5LMNF

Structure of bacterial 30s-if1-if3-mrna translation pre-initiation complex (state-1a)
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
101
structure length
101
Chain Sequence
MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFLANA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
publication title Large-Scale Movements of IF3 and tRNA during Bacterial Translation Initiation.
pubmed doi rcsb
source organism Thermus thermophilus (strain hb8 / atcc 27634 / dsm 579)
total genus 25
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2016-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01250 Ribosomal_S6 Ribosomal protein S6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5lmnF00
1HNXF 4X65F 1F60B 4JI5F 2J5AA 2HHHF 2KJVA 4DV0F 1XMOF 1I94F 4LF6F 4JI3F 4JI0F 4X62F 4B3TF 3OTOF 1G7CB 5LMNF 4JI4F 2F4VF 1CQMA 1VMBA 4JV5F 4DV3F 3T1YF 4K0KF 2UXCF 1FKAF 1N34F 1RISA 1HR0F 4DV4F 2BVZA 1LOUA 2VQEF 4LFAF 4LFCF 4GKKF 2YY3A 4DUYF 1IBLF 4LF5F 2UUBF 5LMUF 4B3SF 2KJWA 5BR8F 4DR3F 2E5LF 1HNZF 4JI2F 1XNRF 1N32F 4DR1F 1G1XA 4YY3F 2UUAF 2UXDF 1IJEB 4GKJF 4DV1F 4KHPF 4JI6F 2UUCF 2B7BB 4AQYF 4NXNF 3R3TA 1FJGF 4X64F 4DR6F 1XMQF 1B64A 1N33F 2RJZA 1N36F 2VQFF 4B3RF 4LF4F 4JI7F 1QJHA 5AJ3F 4LF7F 1IBKF 1J5EF 1GH8A 2B7CB 4DR4F 2ZM6F 4NXMF 1CQNA 1IJFB 1HNWF 4DR5F 2BXJA 4DV7F 4DR2F 4DV5F 4JYAF 4X66F 4JI1F 4LF8F 5IWAF 4DUZF 1IBMF 2UU9F 4B3MF 4OX9F 3T1HF 2UXBF 1XNQF 4DV2F 4DR7F 3ZZPA 4LFBF 4JI8F 4LF9F 4DV6F 4YHHF
chains in the Genus database with same CATH superfamily
2VIHA 5F8MA 1E6VA 4JI5F 4Y2IA 1W26A 1HHSA 5J1EA 5KG4A 1C0UA 3UCGA 4L76A 1VIXA 3GCWP 2W4DA 1SC6A 1O0PA 2XEXA 3CCLS 4LFCF 4YB6A 2DPJA 3T6JA 4TQRA 2DH7A 4CLFA 2DCUB 5T41A 1ELOA 1HD0A 1I94J 1VK8A 3R5JB 1FXLA 5D4PA 1OIAA 3HK2A 5B08A 5DQHA 4B3TJ 1VQLS 1W25A 2OD4A 4DX5A 1NK9A 2MQ8A 2IYGA 3VVTA 2B0GA 5K20B 4LSLA 3VHQA 1L3SA 4CIOA 3P3DA 1X4GA 2ASLA 4N7TA 1UKUA 3OTCA 3UWTA 2QL9B 4XTTA 4CO2A 1SL1A 3IA0A 1WHXA 1LWCA 2E9RX 2HURA 2OPRB 3NCQA 4ES3A 3J81U 1FX4A 1QSYA 3DLJA 2DH8A 3MMCB 4PXCA 5F41A 4E0DA 2J6SA 4F3QA 3QSYB 4BWJA 1F5CA 3CDBA 3B54A 3JAMY 1VC6A 5J1PA 4RBVA 3DDIA 1XQIA 4ZJOA 4WFAQ 1Q79A 1KP6A 2IAJA 1K1SA 2YBVA 5HP1B 5J2NA 4ZN1A 4IRCA 2OPPB 4KGXB 4FBUA 4PG6A 3ICLA 2J6TA 3KKFA 1X4FA 2HPUA 1MN7A 4B9MA 3WX8A 2AP6A 3UNGC 2UUAF 3PYDA 2RUGA 2NXJA 3Q2SC 1E6YA 2RILA 4RW6B 1VBZA 2PE8A 5IT9U 4HHHA 1YJ7A 3QATA 2RRBA 4FF1A 3R5DA 3CDWA 4DR1J 4LF7F 2HFSA 3O5TB 5ETTA 2Q3PA 3DRYA 1TK8A 2XMKA 2ZM6F 4CDIA 2GQQA 5I3QA 5IM0A 3RRGA 1C1BB 4ERDA 1QD1A 3D2WA 4I6AA 2Y1IA 4JB8B 3R7BB 3KLGA 3EE3A 4M5KA 1AROP 2OPSB 3EXYA 2IMWP 4ZP6A 1L3UA 4JI3F 2VKRA 1IBMJ 3BPSP 4LFBJ 1YJWS 4JI8J 5KFRA 1H73A 2C2NA 2RIJA 1HL6A 1RGVA 2IVYA 4WTYA 1KEKA 5KFCA 3QO9A 1QSSA 2YPYA 3DLKB 3IRXA 2BW7A 5ETPA 2HNYB 3RR7A 2ASJA 5E5NA 5KG2A 4URGA 4OI3A 3OL7A 2UV8G 1XNRJ 3NS6A 2BJ3A 3CB4A 2HAIA 4C11A 1RWOB 5KG6A 3MOZA 2D1CA 4G6VB 2CQBA 1RT6A 3KJQB 4YQWA 3GIMA 1Y5LB 3K58A 1KVIA 4MAKA 2G2YA 3LQVA 3FQLA 1QUPA 2QFIA 3KLIA 2R7UA 1QVGR 3KMQA 2LA4A 3TZZA 2Y0BB 2D9OA 3HVAA 5KFGA 4ZJLA 4DL7A 2JDJA 2I38A 4PAAA 2IM0A 2VQEF 3N5BA 2P6TA 5EWGA 2Q1LA 3PHTA 3Q24A 4HDHA 1PBUA 5A8RB 1NDCA 4K2XA 5LXRA 2ZVSA 2WSFC 4EEYA 3C3LA 3RW7A 4PUOA 1CULB 1RWVB 2V94A 4M5HA 2HNDA 4NZ6A 3EJMA 3K57A 5CD4H 5KFOA 4LFAJ 2B6AA 3SXLA 2ILZA 5F8NA 3ZZ0A 1KLMA 4IDKB 3MM7A 2VL1A 4RU9A 3QLHA 4C8LA 3W5ZA 1OY6A 1SH2A 1HI8A 4LR8A 1QE1B 2JC0A 3ZZZA 3CJ2A 4DV1J 2P2CB 3CJKA 1NHVA 4DV7F 3OFFA 2XY7A 2B9EA 4WP3A 1IKWA 4C97A 1APSA 3CJRA 2Q66A 2W9CB 4WZMA 3DM2B 2OI2A 2LQBA 3WHIA 2W9BB 1FESA 1WC5A 3CT9A 2W8KA 3HHLD 1PG5B 1TL7A 5IZHA 3MZIA 1S1VA 4A8OA 1JLEB 1M5VC 5LJ3Y 4JI0F 1JLBA 2K3KA 1LXNA 1DARA 4HT5A 4K0KF 2ZE2B 1WKLA 1T9XA 1TL1B 4ZP8A 1NK0A 5AE1A 2PI4A 5KFMA 1YKWA 3CDAA 2MB0B 2ZUGA 1S57A 3TA0A 2V8DA 3NWGA 3FC9A 2GO9A 5CZXA 1S76D 3BZQA 2MXYA 2UUCF 3CC7S 1S59A 2VJUA 4ZPTR 5D4NA 3ENQA 2IRUA 2PMHA 2XHCA 2Y9HA 3MCMA 3QGGA 1X4DA 1U2CA 1TVRB 2IA0A 2DITA 5E33A 2GZOA 1RWMB 4HT7A 1M5SA 3VCDA 4AQYJ 1U25A 3ENWA 1NPPA 3M6VA 2A18A 2VD3A 3M30B 2RQCA 1VRUB 1G4CA 4M8LA 4QOTA 2W4PA 4CT8A 2VBYA 1IBKJ 4UOHA 4J9QA 3AXKA 1LNQA 3CEDA 4DV6F 1NKCA 1LW0B 3H5SA 3WBZA 2EFOA 4NI2B 1RTHA 3Q8UA 4S0MA 3O44A 3A8IA 4FYVB 3C6UB 3KJFB 4QYZK 4ZCIA 4WK1A 4TYAA 4GC6A 4FXWA 2E1CA 1N4LA 2A6OA 1T95A 4CLSA 1VISA 2EC2A 5C25A 1XMOJ 4CTAA 4RUCA 4NWBA 2EBEA 3X3UA 3G6VA 3W1YC 3T5KA 2A10A 3H42A 1G1XA 1YIJS 4C98A 3LH2S 1W7WA 1P1TA 1UFWA 1H7WA 4DV4J 2OD6A 5K8OA 3J80U 1UEKA 5E7OB 1HQEB 2XNRA 2BE7D 3KHGA 3BO2A 1QDUB 2VFUA 2CJQA 3NLCA 3LWLA 2B4UA 1V3ZA 2BXJA 1FHTA 2OGUA 3DXSX 4UY8T 2BJDA 1IWAA 2DJWA 1DHMA 1UCNA 3T1AA 1S1WA 3V6HA 1D9DA 5A0YA 1S79A 1T03B 1L3KA 1W2IA 5B0DA 4KH1B 4LSNB 3QGIA 3FZBA 5ITHA 4R8UB 3MR3A 2UU9J 2EFQA 3IR6B 3CIZA 4O44A 1Q5VA 4DG1A 4KHRA 1RHMB 5J2QB 4KGVB 1U1KA 1C1CB 3IR5B 2CUYA 4LMZA 5DRKA 4OYXA 2VG7A 4F0MA 4QW9A 1UFKA 4EGLA 3L7UA 5D4LA 1D8YA 1GNKA 2VF3A 2ZC4A 1RAJA 4NPOA 1TELA 4NL5A 1EB0A 3NGUA 1LQ9A 3W61A 5HBMB 5CYQA 3ONQA 2LQ9A 1TL3B 2DNNA 1U1LA 2EFVA 1OSCA 2CFXA 1Y11A 1HBMA 5KFNA 3B82A 2CZ9A 4PG4A 3CCMS 3UDCA 1J5EF 1WJ9A 4OV6A 2WBMA 4OLPA 2HNZA 1X4EA 2QO3A 1S12A 2VKZG 3OR2B 3QWPA 2MKJA 3MM5A 1OS5A 1HBUA 3KK1A 3UDEA 2IA6A 1DAXA 1HI1A 2P6SA 1RTDA 5E3QA 4Y65A 4U7CA 2JSXA 2AGQA 2ZHOA 1MW7A 1VYAA 1OSDA 2VPWB 1LK7A 3WQPA 4ZVQB 2J6UA 5CXTA 4O0IA 3W5XA 2V9KA 3NCPA 3ISNC 2EKYA 3DLGB 2OFGX 2M5YA 4IKAA 1WKKA 1DZ5A 1VDHA 4GO7X 1LKZA 3D5MA 3HHLB 2KI2A 5B0CA 2VONA 3ZZTA 2QLXA 1Y00A 4B9VA 3BKTA 3OHAA 2CPDA 3MURP 4EYIB 4G1QB 2FD2A 3JTNA 2F1FA 1UVIA 4KJIA 4I64A 4MK9A 4RZRA 3TAPA 4IFYB 4ICLA 5IV4A 2KYZA 4LRDA 3ADAC 4U8VA 3AXMA 1B70B 3IWNC 2PC6A 1UFLA 4F36A 3M9MB 4PWDA 2J0XA 3TRGA 3NCRA 3QRPA 3I9ZA 4R5PA 3OTBA 3T41A 3M8PB 3MR6A 1BHNA 3OL6A 5EWEA 1CJKB 7FD1A 3UD3P 3FSYA 2H51B 1C2PA 5G4DA 5KOXA 2VC0A 1I3OB 2LA6A 4OZ1A 2M70A 3JYTA 4ZLPA 2UV8A 1UA1A 1VLYA 3G71S 4J9MA 2HFZA 1Z1ZA 3VGTA 3THVA 4WF9Q 1FKAF 1N6QA 3PJXA 4BWMA 4FF3A 4DSLA 5CQGA 2LQJA 2R42A 4B3OA 1VJWA 2WSCC 2R3VA 1PIEA 2MPUA 2ZNZA 2P9CA 2CPFA 2BYCA 1ULRA 3V81B 2IRYA 4ZLJA 1BUXA 3RRHA 4M63A 4H4MB 3C6TA 3F44A 1HMVA 1WF0A 2MKCA 2JEJA 2X1BA 2XWYA 3IFEA 2HVIA 2VZ9A 2XCAA 1N8RT 2FLOA 5IQ6A 2B7CB 3A8KA 3NOCA 1H72C 1N88A 2WCXA 4LF8F 3IGNA 4E98A 2I2YA 4F50A 2XQCA 5CH7B 4ECZA 2HGLA 2ZH8A 4RW9A 5A6WA 3EVWA 4PQUA 3FBEA 2KZMA 3GSIA 1IKXA 4CLKA 4Z7YA 2GS8A 3TVKA 1U0HA 4LVNP 4QYZJ 4K4VA 3TUZC 1P6TA 1OJ4A 3GE9A 3H2LA 2IDLA 1RAAB 1X0FA 5JVHQ 4PPDA 2PT0A 3MD1A 1KFDA 4HVZA 2B56A 4Y2CA 5HVHA 2LXUA 1U1QA 2AJQA 1DJ0A 1PC4A 3SDEB 9ATCB 2DO0A 2YNHB 2CVIA 3M8ZA 4QWDA 2G1DA 2RAQA 4MMOA 1I1GA 1RDRA 5B7WA 1YGYA 4YFUA 2YX7A 3HM9A 1MG7A 3I5CA 1SB6A 2IVMA 4ZOSA 1JJ2R 2H4YB 3AFGA 1GMUA 1YVFA 4CP5A 2QG9B 5F9NA 5KFWA 2V50A 4B9TA 1RAIB 4KHPJ 1REGX 2X3GA 3MECA 2RS2A 1N48A 3D7SB 3ELHA 4FXVA 2Z57B 3G6YA 2A0FB 3DRSB 4ED8A 3O2IA 3OLAA 1WOOA 3FMWA 3WZ0A 4QU6A 4CLPA 2QMUB 4HH0A 5C2GA 3RGIA 3W2WB 4QPXA 2Z2LA 5KG3A 1TKDA 4IG3A 3MPYA 4TYBA 2BQRA 5A8KB 2AIRB 3KOAA 4UZBA 4ED2A 1VQMS 2JH3A 2OJ3A 2K1RB 1K47A 4FVCA 2MDAA 4ZN3A 3OD2A 2BOPA 2MHNA 2GVDA 4YB7A 2HBYB 5HAOA 1GQEA 2DY9A 1MMNA 3LPEA 4J7CA 4P9SA 1AFJA 4DEZA 4OI1A 4Y6IA 2XNQA 3D3CJ 4LF5J 3NBPA 1T3OA 1S9EB 3MEGB 3GFHA 1Q82T 2FQQB 2V68A 3HPOA 4GVBA 2ZVIA 4U7UD 1CC8A 4NMLA 3M7VA 4DZDA 4AD6A 2MZJA 2F8HA 1S6QB 4IFVB 5HLFB 3CD5A 1WC6A 4OYOA 4ZP9A 4B3RJ 4HKQA 2IC3B 2MY7A 2FC8A 3M8YA 2AKWB 2E66A 1XWLA 3J7AN 3PKMA 3DFEA 4YP3A 1K73T 4EWTA 4N8NA 1FERA 2HRTA 2V9WA 1SVDA 4ECYA 1ZBTA 3B8HA 5KOWA 1FJEB 5L1KA 4LQ9A 4ZVGA 1KSPA 3IS9B 1S4EA 1JLCA 3VQTA 3RRKA 3IAS9 1RJJA 4IH6A 4K4TA 2RHQB 4EBCA 1SJ3P 1RT4A 3MR2A 4A8XA 2B51A 3JTOA 4YY3F 3RTVA 2WBRA 4KIAA 3H5XA 3MPVA 5F8LA 3VV2B 5HATA 2V6AA 3M2RA 2FHKA 5IFMA 3PO5A 2DEIA 5EGYA 2XG8A 2XB2D 3NEKA 2XLIA 1KONA 1NPKA 1Y0HA 1R0AA 4OYBA 2ACMA 5EX0A 2OPRA 4ZP7A 1RHUB 4Y2KA 3MMCA 4DUZF 2PSZA 2POKA 2Y3YA 5MAOA 4DSKA 4CH7A 3FQKA 1IKYB 1I51B 3EZUA 5HQ8A 1DURA 2NUUG 3HF5A 2KDOA 2VFRA 5L39A 4ID8A 2IBKA 4KFBB 4BDPA 1R6VA 4DV0F 1QVFR 2F7VA 1FX2A 2ZBIA 3WX4A 1U45A 4B3MJ 5HP1A 2HZVA 1NB2A 3R5BA 3AT1B 4WCEQ 2V4JA 4DPOA 1TKXB 2QC3A 2PIIA 1DQ9A 1WI8A 2FHJA 4LF6J 1K9MT 3DNCA 3HHNB 4QIGA 4FF4A 2DGXA 5K9FA 3S01A 2MKKA 3WC2A 4GKKJ 2GAHC 3P96A 3JQJA 1S4FA 2QA4S 1JMTA 4ES1A 1XMQF 4URQU 2RRNA 3QSIA 5JVGQ 2OTLS 1C1BA 3PCOB 3RYLA 2BACA 2DNKA 1X7VA 2CA9A 1IR2A 3D66A 1D9FA 5HN0A 1ZTWA 2OPSA 1NXIA 3ETOA 2GC8A 1UVJA 1RYSA 4F0KA 2D3O1 4EFAC 4NXMJ 3R5GA 5LT5A 2FY1A 1NKBA 3NNAA 1H7XA 1SCJB 1SJRA 4NYOA 1OY9A 3ETMA 1N54B 1YJNS 4TU7A 1HNIA 1WG4A 2F3JA 2FPHX 1M1GA 1HPZB 3BBFA 4RU2A 4B08A 2RQ4A 2UUWA 2WB4A 3ZTRA 3DLKA 3AB4B 2QSFA 3EX7B 2HNYA 5LMNJ 1VQOS 2CG4A 3PRBA 1V5IB 2BE2B 3V6JA 4C9DA 2XULA 4EO6A 2DGVA 2HMIB 1MSWD 3Q23A 2HHPA 2JJ4D 3KDNA 5GMEA 2AGOA 5E3CA 5D78A 1IVZA 3BO3A 2QMXA 3MEEB 2VQFJ 4MJKA 3BS9A 4LJMA 2BOAA 2AEMA 3PYFA 2FGCA 1F6TA 3DHXA 1F60B 4TXSA 1EIYB 2HHHF 2IY5B 2XYGB 4J9KA 1TR0A 3FBBA 4DX6A 4W92B 2D3ZA 2FVRA 2M4MA 5A8RA 1Q8LA 1ZZFA 3DCAA 3E2EA 3M2UB 3L9ZA 2JHEA 4PRFA 1WTFA 4A8SA 1DQ8A 1DBDA 4L3NA 2Q6CA 3GFYA 3HVWA 4IDKA 2AU0A 2R9LA 1U2FA 3P5BP 3HKZD 4CNYA 2YXLA 1QE1A 2UUBJ 2WVEA 1HFEL 1YBTA 3ENAA 5CABA 4FF2A 4HTJA 4QU7A 3H2UB 5KFEA 2QEXS 2DGTA 1KHWA 2E1PA 3SCJE 4FYDA 1VR6A 3QIPB 1X5PA 3NS5A 3LP2B 2A2DA 2BEFA 3H4BA 3ILOA 4NCGB 2HHXA 3SFGA 2W9CA 1FD8A 3DM2A 2JEIA 2HK3A 5EDWA 1K0TA 2W9BA 4Z7CA 4FPRA 5DM7Q 3UPFA 4U6PA 3HI9A 3VVUA 1JWWA 1S1TB 1JLQA 4DR4J 3A8JA 4PXEA 3RB3A 4MFBB 4USHA 1MNEA 4G1IA 3L7OA 2EC0A 2IDEA 3I9V9 2KT3A 3M6WA 2M52A 1EETB 1R43A 2B9XA 2APOA 1D8ZA 4Q7AA 2WVFA 1B0VA 2B8QA 1V6HA 2UVUA 4IOCQ 2AGPA 3CCWA 1YBAA 4X64F 2QLFB 2E5LJ 4WU3A 1N0VC 2EI5A 4M5LA 3LAKA 4JI6J 2XS7A 4KPYA 2GJFA 3GQCA 2N3LA 4KGMA 3M30A 5ETLA 3PX0A 4I6YA 5AXKA 2UVWA 4ZVSB 1RTZA 3NP5A 1AB8A 1AUSL 3IP0A 4TN2A 1LW0A 2BRKA 3JSBA 2CNOB 4NI2A 2AWZA 4DN9A 1SJFA 4ECUA 3C6UA 3PIPQ 4MK7A 1F0XA 3OTOF 1RAHB 3K5NA 4KB7A 1ZA2B 1BGXT 1ZETA 1S0MA 4EI2A 2H1YA 1RBAA 4LR7A 3S7RA 2OH2A 3SQGB 5DG7A 2YWHA 3FNNA 1TUVA 4Z2XA 1FDAA 3VAHA 4F4KA 1HQEA 1WC4A 1FCAA 1KQKA 2Q79A 2RH3A 3D0GE 1JJHA 3R5CA 3I82A 3I0RB 2RJZA 3J81Y 1NO8A 5EUHA 2L9DA 2HLTA 5ETKA 5I4MA 4L6V3 4BC9A 1PC5A 4DV5F 4JYAF 3GYNA 3BKFA 4DQSA 1T03A 1XR5A 4PCQA 1KNZA 5GAEU 1ZAWA 1YTYA 2HIQA 2V8PA 3BGRB 2GA7A 2H5IB 1H0HB 4LSNA 1T9TA 4R8UA 3CUNA 5GVQA 1PJ5A 3ZZOA 4IO1A 3R2DJ 4NCBA 5J2QA 2FJBB 2KZZA 2OMOA 1BWVA 1JIHA 2WVBA 1C1CA 1S10A 4URSA 3PO4A 2J7UA 2BR0A 4WBFA 5IT9Y 4RWWA 2BKNA 3OXLA 2DXDA 4USTA 2K2PA 3R27A 2GCFA 5SZTA 3D1QA 5HBMA 2P9GA 1VQNS 4ZVEA 2MQPA 3TAQA 1AFIA 1TL3A 2L08A 1F9HA 1S7HA 4K7QA 1YRXA 2IPOB 4CWBA 1N5VA 1N36F 4F2SA 1JKHB 3F73A 4I69A 4ZMMA 1DFDA 4ZIVA 1A7GE 2BKPA 2I6WA 3M32B 3U1MA 2NLWA 2EVZA 4TKTA 5F0WA 5KFPA 1VQ7S 3MFHA 2G13A 4LF4J 4JI7J 3BGUA 3NOGA 3H25A 2GW8A 1RT2B 2PGCA 1EKRA 1PSDA 4B02A 1S9FA 3C14B 3AJDA 2CQ1A 4CO0A 1DTQB 4O4GA 2QL7B 3H20A 5B0FA 5E3AA 4A47A 3QAEA 2AD9A 1TKZB 2UUTA 1HNXJ 1UWAA 5AXNA 1JLGB 4UT4A 4C0BA 4RO0A 2YQ3A 2W8LA 2D69A 2ADBA 2XO7A 4G1QA 4XPEA 3CCVS 2I1RA 2BW2A 3QWUA 2YQ0A 1RE1B 4HYKA 1RTJA 2N3OA 4IFYA 1R89A 2XMVA 2DNZA 5I42A 2C2DA 2JZ5A 4K2JA 4JI2J 1NLKL 2HQGA 2W24A 2V0NA 3A4TA 3LUYA 4USJC 3M8PA 5DDOC 3SCIE 2CWXA 2QYGA 3POTB 1NDLA 3W5YA 4H4OB 1VRTB 2HYIB 5LSLA 3M9OB 3CULA 3BN4A 4E2FB 3QRRA 4DPTA 3H40A 1UTAA 4JI1J 3FFIB 2V4RA 3QT6A 1UZDA 1FXDA 4J9NA 1KVKA 2UXCF 1WC3A 3QBCA 2CZVC 5LXYA 3Q0AA 3MGJA 1L5UA 1TK0A 2FC9A 4OZLA 3V81A 4Q5VA 4IO9Q 2YH1A 4KSEB 4RW4A 2G1HA 2CQ2A 4H4MA 3HVRA 2LYVA 3QFHA 3I31A 4P6QA 5D3GB 3SCKE 2WHOA 2X1AA 1GX5A 3TVYA 1F9FA 1K0VA 2GV1A 1H6KX 2YKMB 3GFZA 1S99A 3Q8QB 1FE0A 3HP6A 5KFJA 1VBXA 3PW4A 3OFEA 4J37A 2C1EB 3HSJA 2CXEA 4TVAB 4NXNJ 4N56A 1F3VA 2N7YA 2Z30B 5E0OA 2GX8A 4DWIA 4XPCA 2CQ4A 5GMKa 2QA1A 1TKTB 1K44A 3US5A 1NU4A 3CO9A 4MK8A 3CD0A 1SIWB 2DNPA 1XR6A 4Q8FA 2WVCA 3NWRA 2BV3A 1TUWA 4Y2MA 4OZ5A 1RHQB 1Q95G 3OPKA 1EQ0A 3P49B 2R7RA 1VC0A 3ZZUA 1HR0F 3R5AA 3SDEA 1RXOB 2YNHA 4DSIA 4I56A 3HD2A 5BJRA 4WKRA 1R8BA 2XM3A 4KAIA 2GIRA 3I5BA 2DEJA 4WP9A 1R8HA 1KN6A 1BMQB 1S0VA 5THWA 1A9NB 2E5GA 4QPTA 4DDFA 1A0OB 4GKJJ 2Z56B 3UW1A 3D6FB 3HJVA 3HFKA 3HSGA 1Q8BA 2JVOA 1GFWB 3T3FA 4FP9A 3DRSA 1FJGJ 2DXFA 5HROB 3D1HA 4KBIA 2Z4PA 1ZAVA 2IJFA 1FA0A 5F3TA 3R7SB 3CNQP 3THTA 1YDLA 4ZVFA 2MKHA 1Q7LB 1UW4A 1F3FA 2C3MA 4J90A 5A76A 3MAHA 5A8KA 3NNHA 4PABA 2VICA 3AOBA 3TARA 2DIVA 2K1RA 1GK8A 2VDHA 5I3PA 4C8ZA 4OHYA 5FDLB 4JV5F 4NASA 4K59A 1N34F 2DR8A 3GSDA 2R8IA 3FUYA 1LW2B 5GADI 2O3DA 2FLPA 2N7CA 4F3OA 1HWKA 4UW2A 3DGVA 2H4WB 3WIUA 4IQMA 3KLHB 1S9EA 1IBLJ 3MEGA 2CQIA 3W8PA 4WFBQ 4ILLA 5HMWA 1B64A 2OIHA 8AT1B 3VAFA 1KQSR 2EW9A 4PG8A 3R6LB 1LEOA 1CJTA 1S6QA 1GMWA 2UZAA 1I6JA 3OQ2A 3IBCB 2KXHA 5DGAA 2V2VA 3HZGA 3EGWB 3N5FA 3VGUA 2MMYA 1AZSB 3OXFA 2JEFA 1ZA1B 5J2PB 2U1AA 4ED5A 3FSIA 3UD5A 1I94F 5IWAJ 3IAM9 1S9GA 4B3TF 2DR9A 4ZVTB 2AEJA 3LWMA 4KH0B 2HZCA 4LR9A 1RCOB 1WORA 3IS9A 1QTNB 3KUEA 4TY8A 3RR8A 4WTOB 1REVB 2BM0A 1I5OB 3NKYA 1KFSA 2DGQA 3QZ8A 1SL0A 1RWWB 4OHXA 2JFDA 2VC1A 4OYPA 1N5TA 2CRLA 3FVYA 3JAMU 5GAHI 3E01A 3QYYA 3MOJB 3IRWP 2PMZD 2FB0A 2FZKB 2R7VA 4FDFA 2MQLA 1FT8A 5ETNA 3D28A 1F9EB 1AXQA 1NK8A 3AA9A 4J9VA 2LQ8A 2DKOB 1N33J 1FE4A 3U7JA 4UZCA 2YWKA 5DS7A 5ETVA 4ENOA 2CQPA 3TI0A 3C16A 2YNFA 2KH9A 3D6TB 1BD6A 4DX7A 2QFJA 4NEZA 3SI8A 4ZJQA 2ZH1A 1HBOA 3DLEB 3SSQA 3MM6B 5JJBA 1TKXA 4USKA 5BYSA 1WHWA 4LF9J 4WZQA 3DOMB 3V6KA 4FS2A 3FEXB 4ZLNA 2XY6A 4DR1F 2LDYA 2ZH4A 1SPBP 4OI6A 3PR4A 5CCMA 3HVTB 4NLGA 2V67A 1HNZJ 4XIUA 3FRYA 1YQHA 1JNZB 1PKUA 3K2YA 2IYIA 3IM9A 3QMQA 2NYIA 2Z2YB 3HULA 1IBMF 1FDBA 1IR0A 3EMTA 3TYTA 3W3SA 5K14B 4RR5A 1YRTA 4LFBF 4JI8F 2JOQA 2M7SA 2NXUA 2DGSA 1IUJA 2E1AA 2GVZB 2Y1JA 4OZ0A 4OYAA 4RNMA 1HPZA 4CLZA 3QT8A 4MT1A 3KNGA 2HW3A 3DYAA 4EMDA 4Y00A 2H5JB 3I55S 3KUGA 2AT1B 4A8YA 3IN5A 1N5YA 3D1OA 2XZWA 2BE2A 1XNRF 3MDFA 4PG5A 3BM7A 1D3WA 4I4BA 2U2FA 4WWSA 1TL5A 2HMIA 1HWUA 3MUMP 4ECVA 1WHVA 1RACB 2HVDA 3IXQA 1XC9A 2J0QD 4P74A 4ID5B 2PEBA 1X8DA 5AT1B 1O5JA 1RHJB 2LP4A 1NDKA 3ZFVA 5IV3A 2ZDPA 4PXDA 1X9WA 4DSJA 4DR6J 4OHZA 2G2OA 4Y3CA 1FFWB 1FTCA 5A8WA 3HT0A 4WP8A 3PRDA 3AD8C 3AQPA 3HMJG 1S6OA 4BS2A 3CJ0A 1HYSB 3OT9A 4EUVA 4EO8A 1R6YA 5IOLA 5L1JA 3SV3A 2E5JA 2HSEB 3M2UA 4LFAF 3ZTQA 4B17A 2NXEA 4NEYA 4O3NA 1WDTA 3EDQB 1JLFB 4DPWA 2QE5A 2KRRA 4HI1A 2B4VA 1VGYA 2XSFA 3TAMA 4P2XA 5HL7Q 2BJ7A 5H1SV 4K4ZA 2ZZNA 3QQCD 4DV1F 1RBLA 3OFGA 4OYWA 4V19X 4MKYA 2WONB 3QGPA 2W1BA 3JSYA 2VG6A 3M8WA 1ZOTA 3W9JA 3DRRB 4A48A 3QIPA 3MPUB 1F2GA 3LP0B 3O8WA 3LP2A 2YNGB 4O3OA 2JRSA 1UVLA 1XR7A 3UR3C 1Q4RA 2ZZTA 4DL4A 5C24B 4DUTA 1TFWA 1MN9A 3IWLA 1S1TA 4CO1A 3H5UA 4KO0B 5L1LA 4MFBA 3TUIC 2ZJRQ 3EUNA 1FNXH 4DR2J 3OV7A 2DRBA 3GIIA 4ZPDA 2UXBJ 2F8MA 1M0SA 2FLLA 1S77D 3OBIA 2HQ3A 2MHEA 1WC1A 2HHVA 1RYRA 3UN3A 1B3TA 3SSSA 3H7HB 3H0PA 3T1YJ 4FNIA 1C0UB 2PA8D 2VFTA 4DUYJ 4AQYF 2KKHA 3R3TA 3AOAA 3ISZA 2MZTA 2YWGA 1RKJA 2FJEB 1NMEB 5E3PA 2QX0A 5HJYA 1IBKF 5D0EA 5DLFA 3N6MA 3S1TA 1KS2A 1M5HA 2QTWA 2AV5A 4DF8A 2HHQA 3H90A 2QGFB 4FYXB 3JS9A 5E41A 2EG2A 2GMJA 3VWSA 3KNAA 2M8HA 3DU5A 5HMYA 4LIWA 1HNWJ 2F9DA 4NOHA 1GMVA 4P2FA 1TUGB 1XMOF 1LWFB 2ZJQQ 2RS8A 4IH5A 3T5HA 3T5JA 2CVEA 2HIYA 4IR1A 4DV4F 2O1PA 3EWGA 3ZTPA 3KLVA 1PO6A 1UWBB 5IC6B 5HSPA 2V8GA 4DQQA 2A3JA 3K8WA 3DHWC 4NLYA 1RAFB 1TV6A 5J1NA 1YHQS 2VB6A 3LO3A 3C15B 1QY7A 2IIHA 1JXLA 4XDDA 3I0RA 1G6BA 2IAJB 2RD5C 1BQMB 4NLRA 3EGZA 3BBBA 3F56A 5J2NB 4DF4A 2RDJA 1LFWA 1YI2S 4YN3B 2DNOA 2ALZA 1BC6A 1VHFA 3BYPA 3DXBA 1S7IA 4CM2A 2RDIA 4AXJA 3PW5A 2PMWA 2ZBRA 1EKSA 4MKBA 4A8WA 1S5ZA 2UU9F 5H9FJ 3N01A 2ZFHA 3DOKB 3HHKA 3MMAA 1OPIA 1SUQB 4QW8A 3T9ZA 3M8QA 2RF2A 2HQDA 3I56S 1RTIB 2KVIA 2W01A 2KHCA 2FJAB 2DVIA 3GR1A 4V19J 3GIKA 2J7WA 3N6NA 5LJ5Y 4N5SA 2VOPA 4L74A 1H2VZ 3KLGB 1KOHA 1OYDA 2ROGA 4HI2A 2M8DB 4M94A 3BKUA 3GYGA 2I5JB 1T8EA 2WZ1A 2DHXA 2LU1A 4RJVA 5GAGU 4DV3J 4HHJA 3U1NA 5KT7A 4DFKA 3S8SA 3J7YU 3V4MA 3J7Z5 3BREA 3PW2A 2RVJA 3GFXA 3SFUA 2FJWA 1N32J 5J2MB 1AUDA 2R7WA 3FEYB 3QO9B 2YPZA 3IRXB 1UJ4A 2QL5B 2GJ2A 1RT2A 2GNKA 2RKIB 2A1BA 2P9EA 3MWBA 2MLYA 1F2HA 1A6LA 3C14A 4C8NA 3GIRA 3BH6B 2KB2A 2XZDB 4KQZA 1DTQA 4FS1A 1URNA 1WKJA 2CJXB 4XK8C 3DRPB 3UI3A 2YKOA 5C7PA 2ADCA 4RPFA 4C11B 4DV2J 4JV2A 1TKZA 2VUGA 3CO0P 1JLGA 4DL6A 1RT6B 3I5AA 3BPDA 2HHWA 4LF1A 1V5VA 5DG8A 3A3NB 5HMZA 4TY9A 1NCLA 1YZ7A 2GHPA 1X9SA 1HARA 2H9ZA 2MLZA 1HKAA 4P75A 3PFOA 3DGPB 4IRKA 2KU7A 2F4VJ 1VQYA 4RBTA 1WOSA 3ILJA 1R31A 1AT1B 2MZRA 2ZH3A 3TQ1A 4YUDA 2ZZMA 1SQEA 2QA4G 3TX8A 2NR0A 1RWUA 1X9MA 2W9AA 3KUHA 2BX6A 2Z2MA 3BSNA 3R2CJ 4PWWA 1QAXA 1OPZA 2CPZA 4DI6A 3CWJA 4HACB 5F8JA 2HNDB 2CAJA 3ITHA 3PJWA 3POTA 3N9UC 3DLLQ 4H4OA 4C3LA 1KLMB 3OL8A 1SC1B 3BH7B 2L41A 3SIPB 1U02A 1T05A 7AT1B 4CI0B 5HO4A 4NZ7A 5FLXY 5CA5A 1IKWB 5IQQA 1Q8KA 2F9JA 1R0BG 2DNQA 1X60A 4ZPCA 5D3GA 3CF5Q 2B4PA 2O67A 3VR1A 1NZAA 1Y3JA 4U96A 1JLBB 2R8KA 1P9YA 2YKMA 4BBYA 1HLWA 2R7XA 2KM8B 5LMUJ 1Q8IA 5BR8J 2LDIA 2BM1A 1M90T 2HS4A 1QAJA 3EVMA 3U02A 1S6UA 1BE4A 2KYXA 2DHGA 3PXGa 3T6BA 3DOLB 4A8MP 1TKTA 4ER8A 3R8YA 1T7PA 5DDRC 1C0TB 2R2TA 2GQ2A 1FRXA 1VIOA 2E29A 3L3CA 2BE9B 2DT9A 2YKNB 2CJKA 2XBPA 4ED1A 2OUGA 4X66J 4NA1A 1U1OA 1NM2A 3WIVA 3H5YA 5F9LA 2XMAA 1PYOB 4O3RA 1TZ0A 2AMCB 4A8KA 4AYBD 3LP1B 4BLGA 1RK8A 1U6ZA 4K8RA 5G0RB 2DNLA 3VQSA 2RU9A 4EK2A 2DISA 2VHGA 1ZS6A 3HO1A 2PN6A 4JI4J 1FEHA 4YMEA 4KHPF 5KFQA 3D4JA 2JVRA 5DZ7A 1G3OA 1RA7A 4DZ6A 4YOEA 3BR9A 1T9WA 2E7XA 4HTIA 2ATCB 3SV4A 4C8KA 1FFGB 2DHSA 3EXCX 5HQMA 1RWNB 2WRMA 4DJBA 3H4DA 2YWEA 4ES2A 5HROA 2QRRA 1Q16B 4YS2A 3D0HE 3VZIA 1FFSB 2HBZB 2W7OA 3QAUA 1GAOA 1AW0A 4RW8A 5KG5A 5L38A 1SJ1A 1N5QA 5FDLA 3CCUS 2MY8A 2LCWA 4WFYA 5T7LB 4NA2A 1UEUA 3CCTA 3OHBA 1Z2ZA 2NPFA 1RHKB 4DL5A 3QZ7A 4WKYA 2CADA 4RUBA 5A0YB 3PW0A 3RZAA 4LF5F 1HWJA 4G1PA 4X4VA 2VPXB 2YWWA 1FF2A 2IRXA 1NEEA 5LOQA 4RUHA 3VTIA 3KLHA 3KJVB 2MSSA 3EGVA 1OQ3A 4A8QA 3ISND 1ZAXA 1HW9A 3S6EA 4I2QB 4U9RA 1RHRB 3I4PA 3OL9A 1FKPA 4B3RF 5C2CA 1YRUA 4RUAA 4UF4A 2ZBQA 1M5OC 2F4FA 5B0AA 3MM9A 4F4AA 1HWIA 2DCLA 2HFVA 5A2QY 3W64A 4L75A 2LECA 1AZSA 3A8EA 5DG9A 5K5MA 2KFNA 5J2PA 4X84A 1QLNA 2L9WA 2HGNA 4F67A 3DI6B 1HBMB 4DR5J 3LANA 3BDPA 5IT4A 2R7QA 1RT1B 1YJRA 3AAWB 1D9AA 4OYMA 1HBUB 1UL3A 3PEJA 2J9DE 3KK1B 1VI7A 3GJSB 3NRBA 1REVA 2LEPA 3C46A 5D0HA 1WEYA 1U4BA 2QZ8A 2XMJA 2PDAA 2RB7A 1FDDA 5KFDA 4ZK7M 2MKSA 2CNLB 3AQOA 5ETQA 2PA3A 3DKDA 1V3SA 1XIQA 3BSAA 3NGRA 4IOBA 2RHSB 1MROA 4C6AA 2NQPA 2KG0A 1UEVA 1R7IA 5AE2A 3KK3A 2AZ3A 4F04B 2JWNA 1FNOA 1Q81T 2FZCB 4I1TA 1PILA 2NZ4A 1OMSA 2E7WA 4B3MF 5DDQC 3EICA 1CS4A 2K7KA 3GYXB 3MEDB 1DTTB 2OEKA 4ICLB 3BQ2A 1YWXA 5ETOA 4MH8A 4Q0BB 8ATCB 3W2VB 4X4NA 3DLEA 4K50A 4QIFA 4LF6F 5KFZA 3BBCA 2HAFA 1RAEB 3T1HJ 4PWDB 4KKOA 7FDRA 1JXVA 3QNWB 4C8YA 4GKKF 4NLTA 3RUBL 3OW2R 1S6PA 1R27B 3UO0A 2B9YA 4J9LA 4ECTA 2YX1A 1VBKA 2ZUAA 3VZHA 1NPRA 2Z58B 3O1LA 4C7QA 4ZA1A 4B3OB 4WE1B 3BGOP 3NNCA 3TUJC 1DLOA 4QIVA 2F5GA 2FHMA 4NXMF 1U8SA 4G3IA 3UNYA 3QJJA 4RX6A 5DO2A 3LA0A 3MUTP 4J9RA 2JEGA 5K14A 2KRBA 1AA1B 5KFXA 5KAKA 3BQ1A 1U1NA 3N6LA 3AH6A 2LEBA 4K4XA 1MLAA 4JOUA 2GVZA 1VCTA 5CHCB 2KJVA 3V6DB 3RBZA 2LFVA 1YZ6A 2VBWA 2AX0A 5LMNF 3G82B 3ZXWA 3UCUP 4ED7A 4BC7A 2M2BA 2FHJD 4PQUB 4PXBA 5FD1A 3ZTOA 4EYHB 4X62J 3RW6A 2CNNB 4UY85 4GRSA 2HRYA 3B4DA 4C2MA 5ETRA 4CNZA 3JQKA 1SXLA 1XERA 1RWKB 4DR3J 3WDOA 1OWXA 2VQFF 2OTJS 4DS4A 1VQSA 3CJ4A 3MMBA 3MMJA 3H59A 2UXDJ 3CE8A 3MAAB 3ZNUA 1PJ6A 2H65B 2JX2A 1NUEA 3R7NB 2AYBA 4OZNA 2X51A 2RSQA 2D3OR 1HNVB 2IJRA 3AOCA 2Y1RI 1BY9A 1HIYA 2VDIA 1HYSA 1NSPA 2DPIA 2QN6B 4F4YA 3MECB 3HSDA 3A3PB 4OX9J 2E5HA 3G96A 5DGBA 4DR7J 2VV5A 2J8AA 2BABA 3AJ1A 3W9IA 1RISA 3J7ZT 1JLFA 3RBEA 4YHHJ 3NXZA 1KC8T 2DNRA 3KK2B 2UUBF 2ZD1A 4P52A 3FEZA 2WONA 2ASDA 2O5DA 2HQIA 4PYDA 5ETMA 1AYEA 4I67A 3HSZA 3DRRA 4NRTA 3R6GB 3LP0A 1RI7A 2YNGA 2MLXA 3CW2C 2QSWA 1SJQA 3SYZA 1RA6A 4DQIA 1B0TA 2CJBA 5D0RA 4DR4F 1RU1A 1IJFB 5C24A 2NUHA 4R25A 1JLAB 2VFVA 4IUFA 1VQKS 2GO8A 4LBHA 3NBPB 3PNIA 3BSOA 3GG0A 4BHQA 2L9NA 4LUBA 3KHRA 1JB0C 4ELUA 3CD7A 2HBQB 2LXIA 3J7YI 4ITSA 2AYEA 1WEXA 3MXHP 3ZO7A 1TMMA 2VG5B 1HHTP 3G8SA 4JUZA 3JSRA 4J9UE 2BDPA 2V4QA 3GB0A 2EK6A 2K7JA 1UETA 2HWHA 5B0EA 1YSJA 2BVZA 4M5JA 4OX6A 1FEEA 4AXIA 3W62A 2KJWA 4TNOA 2E5LF 4A8FA 2CYYA 3CIMA 1NH8A 4M5NA 4ZPAA 1XMBA 2XYPB 4JI6F 1F5AA 5RUBA 4OZ2A 2NPIA 5CCLA 3TEHB 4DMZA 1CJVB 1NHUA 4WXWA 1CLFA 4K4WA 4EBDA 1ZZNA 2D3UA 1JLCB 3OFHA 4U7UK 1NB7A 2D7SA 3EPIA 5KFYA 1TP7A 1RT4B 2ZNYA 4B9UA 3MAQA 2Z2ZA 3M2RB 4O3QA 4E8UA 3MPDA 2BA9A 4EZ6A 1SIZA 4M5MA 3TX0A 4KV8B 3ULHA 1LWFA 2DD8S 3PJ9A 3Q8YA 1R0AB 4WJBA 4OI0A 2MQOA 2MZ1A 1UAWA 2CQ0A 1G7CB 3GV7B 3PRVA 1P27B 3AODA 3GV5B 1UWBA 5HJXA 1RU2A 2AHOB 2QA2A 2HLUA 1UZHA 2C3YA 3BR8A 4M1KA 3FGVA 3C15A 4NLPA 5H9EK 1IJEB 2QLJB 1BQMA 4WU2A 2ZH2A 3IGVA 2PEHA 4NYZA 3VF0B 2V4JB 2VH7A 3G9CA 2NYHA 3JXOA 3DN9A 3K7RA 5M2UA 3JQMA 4F4ZA 2DR7A 4TLRA 1VLOA 2G0IA 4LQ3A 2MJNA 3DOKA 2FJDB 4W98A 3OR1B 3HKWA 1SUQA 4USMA 1NK4A 4AL6A 3DMJB 1C4CA 4OJ1A 2OPPA 4DLGA 5AJ3J 2MEWA 1RTIA 3D6MB 3NMRA 2J5AA 4RBUA 3CXCR 4K4UA 3K5PA 2YKAA 5DDPC 4H4KC 4ZHRB 2KM8C 2RT3A 3PDNA 1XNQJ 4NA3A 4RW6A 5SUHA 1X4AA 1UPMB 5JUMA 4P10A 5KT6A 4ZVOB 3M9NB 3GPAA 4FN5A 3IBWA 2AF6A 4HHUA 1NJZA 2I5JA 2RDDA 2CQHA 5BYQA 4X4SA 4ZS6A 2GHWA 2WVDA 3K17A 4PPZA 1ZH5A 1HNIB 2XC9A 3GR0A 4P73A 2HS3A 5J2MA 1SC3B 4ECRA 1Q7YT 1VQPS 4LF4F 4JI7F 1T94A 3W7BA 5D77A 4UOFA 2RKIA 1N0UA 3TUPA 1JNRB 3N28A 1V3RA 2BQUA 2OAUA 2PO4A 4YB5A 3MEKA 1KQFB 2K8GA 1HNXF 3DRPA 1RAOA 3DDNA 4DFJA 3CPWR 3BGFA 3KHLA 2BJ8A 3W63A 2XGQA 4DN0A 4PR6A 1BQXA 3PIOQ 1GXUA 3PACA 3TZXA 1TQLA 2FVQA 3OXGA 2BMBA 5CYJA 1Y7PA 3ZC4A 3R9LA 4ZCMA 3DGPA 6FD1A 1B7YB 5B09A 3A13A 4JI2F 4PWUA 2DHAA 4D3HA 4LVOP 2CPXA 3QJLA 1H2TZ 4DL2A 1MWQA 5L46A 2FJXA 2WSEC 3KG0A 2C3UA 4IH7A 4CZCA 4NX9A 4Y0FA 5CZVA 3G8TA 2R7TA 3JSMB 4ZVUB 1VQ5S 4HACA 1IQTA 4NE9C 1YX2A 3LGHA 5FJ4A 4OJGA 4WIQA 4JI1F 3MPWA 4OI4A 2VBZA 2J0SD 3NGDA 3EZ5A 2XS2A 4J5OA 3NS7B 2CPEA 3NGTA 4AL7A 1DQAA 2HQCA 1CULA 2OHDA 3CCES 1RT7B 4LREA 1RT5B 1H3DA 2XMTA 5EWFA 1RQ0A 3TR5A 4WFNQ 1B99A 3ET6B 3R1LA 3GMGA 4X65J 2AYGA 1JLQB 1FK9B 3KHHA 2YVSA 3G2XA 1RBOB 2OP5A 2FVSA 4HR2A 4L3KA 2J9CA 5CAAA 1SL2A 2IM3A 4H4KA 3KFWX 4ED0A 3G86A 2IBOA 4NXNF 2ZWOA 1YJVA 1RCXB 4CO4A 1WACA 4B3SJ 3Q8VA 2J7KA 3ZZYA 1FRHA 4ZPVR 1RP5A 2V8HA 1JLEA 3DOLA 2YX4A 1KRPA 2OO4A 1U6FA 5KFFA 3G6XA 1HQUB 4ZPWR 4U67Q 1VQ4S 3KLFB 1C0TA 4TU8A 2ZE2A 2XWXA 1PAUB 1TL1A 3HXMA 4Q44A 2CQ3A 2UP1A 2YKNA 2VJVA 4ZDNA 2MGZB 3G8QA 1QM9A 1NSAA 1WSRA 3LALA 2NS1B 3M05A 2HFOA 4QWAA 1XEZA 5HQLA 4OZJA 3PTWA 3CDUA 4NYPA 2GJIA 3LP1A 4ZKAA 1U0SA 2I8EA 2XTJP 5HI7A 5G0RA 5H9EJ 3K59A 4JI5J 2MKYA 2H54B 1H38A 5L8RC 4LF2A 1TVRA 3Q83A 5F0UA 1IN0A 3PY8A 5HVGA 4GKJF 4P72A 4LFCJ 3PEHA 1WNEA 1TU0B 5L9XA 3AA8A 1GEHA 3UVJB 1FJGF 1VRUA 5KT4A 1VC5A 2XYHB 3O6QA 3CC2S 3HHLC 2O01C 3H98A 5FIIA 3IM8A 3A12A 4KT0C 3MCSA 2ALYB 1Y5IB 4WFZA 4FBTA 4GO5X 4L73A 1PYTA 4C8OA 4X4TA 3SQOP 2EWHA 2XZTB 3OVAA 3BV8A 2M0GB 3DLHA 5DM6Q 2AW0A 2Y8WA 2Y1LB 3UDVA 5T7LA 2VA3A 1FRLA 2XGPA 2ZBPA 2YKQA 3ZTSA 5D4OA 2ZOGA 1UVKA 1G2EA 3C66A 1X4CA 4X4PA 1KOOA 4CQ1A 1IBLF 4A46A 3KJVA 4EBEA 2ROPA 3CMAS 3Q8PB 3VAGA 1WI6A 3PW7A 3MR7A 4GMKA 3R97A 4I2QA 4HH1A 3IG1B 1PYSB 1N5SA 3FRZA 2DBBA 2VPYB 4DHVA 2W25A 2R8GA 1QUVA 2XY5A 2UUAJ 4NLUA 1U7LA 1NSKL 3D54A 5BXIA 2N4DA 1Y4ZB 1X0PA 2PI5A 2BKOA 3Q86A 2B3TB 4USUA 3CCQS 1H98A 3K89A 2M9KA 3TQEA 5IWAF 5KFSA 2GGPB 3DI6A 1VK3A 1YK9A 4QIEA 4LF7J 2WAQD 1ZM4A 5KT5A 2GIFA 2ZM6J 3M6XA 1BXNA 2V34A 1RT1A 4RNFA 4USIA 3BGLA 2XLJA 2EFNA 2CQDA 2IJNA 3W9HA 1JXEA 1J5OB 1QAYA 1KKHA 1RWPB 2AX1A 1R3NA 4LT6A 1VFJA 3GU0A 1FJCA 1Y9OA 3UN2A 1W2BR 3OJSA 4JI3J 2DGWA 1RLCL 4ELVA 2D41A 2J0WA 5C42B 3QFWA 2DR6A 3OR2A 4KC5A 4O4GB 4IG0B 2W7PA 2F65A 2FJVA 4OJHA 2G4BA 3VAKA 5CYMB 1N33F 4AE5A 1HA1A 1TL4A 4R0JA 3M8SA 1WWHA 2C2MB 1Q1KA 4DCPB 1GMWD 3MF5A 4CYUB 3OSNA 1U47A 3KG4A 2ATLA 3Q2TC 2DR5A 3T19A 1MU2B 2R7SA 4ZVHA 2DH9A 3DLGA 3PYEA 1RTJB 3C8YA 2QYCA 3GWCA 3VAJA 3V4IB 3HLUA 3E51A 3MEDA 1DTTA 3TJ9A 5I42B 4LF9F 2FZGB 4Q0BA 3W2VA 3HHLA 1EQMA 2OFHX 1YITS 1IKVB 1F1BB 4O4RA 2UVRA 2KVQE 4ECSA 4X4RA 3VGVA 2V5HG 4YB1P 3TEGA 5F8GA 1MWYA 1HNZF 2C2EA 3L7PA 1H74A 2DYAA 4FKYA 1SKWA 1M5PC 4X4OA 4J9OA 3NAHA 2VQEJ 3L4BC 1FTRA 1OO0B 4WE1A 4Y2AA 4EU0A 3J7A1 3P45B 1XTZA 3MTJA 3F0NA 2UVVA 1CJKA 2VA2A 2IVFB 1CJUB 1EJ7L 3DDKA 1UVNA 4B9LA 2HS0A 2C3PA 4OX8A 3I0SB 3V5RA 4J9PA 2JFKA 4RW4B 1TAQA 4MYUA 3HT3A 2X1GA 1UP1A 1BQNB 2B4OA 4QQBA 3FK4A 3GCXP 2QV6A 3M4XA 1NRKA 4DFPA 4KTQA 4OJ3A 2KG1A 4LBIA 3CJ5A 3G4SS 1WSVA 5GMDA 3V6DA 1KR4A 3TJ8A 1ZM9A 4DV7J 3K5OA 3GZ7A 1WF1A 1FO1A 3D3BJ 2E7VA 3PVXA 3G82A 2NREA 1YJUA 3MCOA 4I7FB 5CD4A 4N41A 3SBMA 3I96A 1VQ8S 2HFNA 1OQ6A 5KFHA 4JI0J 2HZAA 2X1FA 4OHWA 3IR7B 4JV0A 2AEFA 3IC1A 3SEOA 2OPQB 5IT0A 4K0KJ 3HDSA 4ZITA 3OVBA 2C22A 2CIMA 4YR0A 2XO6A 4DR6F 5EX3A 3A3OB 3N79A 1X5TA 3MAAA 2WTFA 1ZTTA 2XHWA 2JLGA 3BJYA 2UUCJ 1KDNA 2L3MA 1GT8A 3OTEA 4ED6A 2QT7A 1HNVA 1JQGA 3GTYX 2AJFE 4USWA 2E1MC 2ZH7A 1WHYA 1S49A 4LSZB 5JMNA 3V2UC 4RNOA 3FBCA 4OX7A 2HGMA 4KGKA 3KLEB 4I2PB 3DU6A 2KN4A 4DSFA 4ANCA 4DV6J 1CSJA 3KK2A 3RU0A 2W7AA 4OLOA 2KO1A 4O3SA 4PEOA 2HWIA 1PBAA 3GP9A 1XBWA 2LU2A 3R1HA 1RAGB 4Y28C 3EDRB 3HHEA 2Z8QA 3U1LA 4ECWA 1D09B 1C4AA 3JB9k 4N76A 3UFCX 1RT3B 1XJWB 3D0IE 3NL0A 2B9WA 3EZOA 2ZC3A 3QT5A 1MMLA 3PR5B 2NCKL 1JLAA 2ACYA 3W2WA 2ABYA 3T9NA 4DR2F 4QZVB 2CPYA 1NK6A 4F2RA 4YDXA 4DXLA 2V2QA 2KXFA 3OTDA 2UXBF 4XDCA 3GJTB 3HFZB 1Q53A 3EM1A 2XSJB 1UMJA 2K06A 2FVPA 4ED3A 3J80Y 2VG5A 1UPPA 4CLWA 4X4QA 5EHHA 5T14A 1CJTB 4DL3A 1S48A 2H3EB 2G9OA 3CCZA 1CPZA 1IM6A 3FKBA 1IM4A 2EG1A 3T1YF 1EARA 1FRMA 1WG1A 1LOUA 2V63A 4AUKA 4DUYF 1LWEB 4NLQA 1K8AT 4JBCA 3EPGA 3RBDA 4F7VA 3CSKA 3FCWA 2GAGC 2H5EA 1U1MA 1IR1A 2MZQA 1QAIA 2ZITA 4PG7A 2HG4A 2ZOFA 1CJVA 4IFVA 4QYRA 1S9GB 5HLFA 2MZSA 3CMQA 1MWZA 4KRWA 1BLUA 4IRDA 4LIRA 4FKXA 2IC3A 3PKYA 3RB4A 3DLBA 2CPHA 2IM1A 4TY8B 3AY0A 1XK8A 2GHVC 1S97A 1SV5B 1R0CB 4XAKA 2DGOA 1HNWF 4DPXA 4P7VA 4ELTA 3TVZA 2CDQA 2A2CA 3WC0A 4RWXA 4KV8A 3E01B 2H48B 2ZH6A 1J5EJ 2ZH5A 2B5JB 2XMUA 4WIIA 1TK5A 3TP2A 3DRXA 2RU3A 1RKIA 1L3TA 3LTOA 4I68A 3IMQJ 2BANB 1O6XA 3N0VA 1OY8A 4CO3A 1YJTA 1JJCB 3DC2A 5K8NA 4QWBA 1FKOB 1DRZA 4A4JA 3RJMB 2CNKB 3FCVA 3I6PA 1EP4B 1LK5A 1Q0NA 2KT5A 3C16B 2ZKUA 3CMES 2RMLA 2YNFB 4UQTA 5B0BA 1T11A 4UTGA 2AJ0A 4DFMA 1UA0A 4C8MA 1SQGA 2DNHA 3OUYB 2F8EX 1HBOB 2G0CA 1RABB 4FNHA 1S1UB 1IKYA 4K5RA 3GG1A 1S0OA 4DCJB 4KFBA 4QR0A 2IM2A 3LOUA 4IR9A 3PFEA 3M2VB 1PGZA 4W4MA 3OR1A 3DMJA 2EBGA 5EN1A 2XS5A 4ZLLA 2DIUA 1EHWA 4J91A 4RW7B 3A1YG 5D15A 4HL9A 2V2KA 1T9YA 4Q2LA 4ZHRA 4F02A 1NAQA 5D6GA 3B6BA 3P4UB 2ZH9A 4ZVRB 4NMXA 4ECXA 3M1VB 5GADU 3J81j 4FPIA 3LPYA 2N4CA 5KG0A 4DV3F 2P5VA 2QIFA 2VPZB 3OVSA 3QGHA 2YNIB 3B4MA 1N32F 5M2PA 2CKWA 4FYWB 3SZ2A 1NJXA 5LSOA 5I3UB 4U8YA 4DBQA 5C5JA 3DYAB 3BN7A 3CJTA 1S1XB 1NKEA 3TZYA 1V9OA 1FD2A 4DPUA 5B0GA 3BO4A 4OYZA 4MYTA 2C42A 1N5YB 1NJIT 1EX8A 1SQFA 3AJ2A 5AXMA 1Y5NB 1Y10A 5HVFA 1DY3A 5F3ZA 3D6HB 2GQCA 4DLEA 4IYQA 2CQCA 3I87A 4DV2F 2RQMA 3E8OA 3TZWA 1SJ4P 1RLDA 1P9QC 1X4HA 2HHUA 3PM9A 4LF8J 1VQ9S 2HVHA 5K8MA 2F4VF 4L72B 1NJYA 4FZVA 2VBXA 2MKIA 5A8WB 4CCHA 4JV1A 1HWLA 2DO4A 5KFLA 3MM8B 5ETSA 5GAHU 4RNHA 3CCJS 1B4SA 1EAYC 2Q6BA 3THPA 5DQIA 2HK2A 3MEEA 4P2SA 1U49A 3JSMA 4YR2A 1P1LA 4Z37A 1HBNB 5FLXU 3D68A 2E9TA 3TAMB 3ENVA 1KLNA 1RSCA 4LBPA 1U48A 4DOZA 4QBUA 2EPIA 1FI4A 1YJ9S 3QT7A 2CWKA 1TFYA 4UQGA 3PHEA 3TW0A 5K8PA 2VG6B 1RADB 3ZZRA 4M5DB 1RT7A 4RLEA 3SMZA 3MCNA 4CT9A 4NLWA 1RT5A 1WD6A 3LGNA 1VRQC 5GAEI 3ET6A 4CLLA 4R0EA 2HHSA 4ILMA 2JNJA 4M5IA 2ZWPA 1B7FA 3CDEA 1FK9A 5DZ6A 2JC1A 5LMUF 4PYAA 5BR8F 1S72S 3NG8A 4NCGA 3K5LA 1CVJA 2M88A 2YKPA 5HK4A 1CG2A 2JL9A 4USVA 3Q89A 2KFZA 2D9PA 3FZ2A 1YLXA 3MUVP 1KVJA 2HKEA 4PZVA 3P6YC 1WDDA 3TNVA 1HQUA 1LWXA 3KLFA 3BYRA 1GTEA 4X66F 1R8CA 1FVQA 2WOMB 1EETA 4YDDB 1QTMA 2FY8A 2DRAA 3MD3A 2MGZA 2Y0SD 3CC4S 3RAQA 4CH0S 4WPAA 5D8HB 9RUBA 4IOAQ 2FHOB 5BYRA 3I4HX 2AYMA 1KD1T 4WYLA 1FRIA 4WYWA 5KT3A 4W90B 2R2RA 1E6VB 4P2MA 2R8JA 4JI4F 5J1EB 1ROFA 3TA1A 1CEZA 1KTVA 5KFAA 2BJ1A 2YH0A 3HX9A 1KBRA 1N52B 2IMOA 3ILLA 1ZM2A 2COLA 4CO5A 3UVJA 1HI0P 2EFPA 4Q2MA 1RB0A 1NK7A 3CJQA 1HW8A 1GXTA 2RNEA 4ANEA 4LSLB 1RZMA 2K3IA 2GMHA 2ZKTA 1IBCB 4YY3J 3HFVA 1VHIA 1TV6B 4V1Ak 3C19A 2DGUA 4H54A 1O8BA 4ECQA 2AJ1A 2ZHAA 3P5TL 1LWCB 3BQ0A 3TJAA 2MTLA 2C2KB 1SH0A 2HFUA 3SQGA 2B43A 2X3DA 3NGKA 1YG0A 4DUZJ 1WC0A 3SCLE 2HWTA 4Q43A 2LKZA 1ICEB 4CLUA 3D67A 2DNGA 3MMAB 2LLZA 3UCZP 2ZEJA 4DV0J 2DNYA 3ZNJ1 5A2QU 3M8QB 2RF2B 3CJ3A 3G87A 2NSCA 5KFIA 3IG1A 2VODA 2G2ZA 4OL8A 5IXUA 3QPIA 3CJ8A 1NNDA 1J2VA 4GC7A 2AJ4A 1U6BA 1E6YB 3TOQA 1ACMB 3BGRA 3FMBA 3OSPA 3KTQA 4OFZA 4NLDA 2RQKA 5AE3A 2OLWA 3GV8B 4WFXA 4DR5F 5HANA 2KT2A 3E3XA 1GX6A 2GGPA 4UUWA 3FCHA 1XMQJ 2BBEA 5IM0B 2QMWA 3FDSA 4MIWA 3I32A 5KG1A 1KWMA 2CJ9A 2OEMA 1KHVA 1J27A 2EFGA 4HLBA 2KFYA 2R8HA 3TA2A 1J5OA 2MYFA 3RG6A 2W2OP 2LVWA 3GJRB 2W4CA 4QJVA 2ILYA 2W2MP 2WB1D 2ASYA 1JKHA 4ZVPB 2FUG9 5DLGA 2FVCA 2QLWA 3IO1A 2R7OA 4ZPBA 5C42A 3M32A 4KPCA 1PCAA 4IG0A 4KY3A 3W8GA 1PJ7A 5MLCV 4O3PA 5KTQA 4QCLA 5CYMA 1Z2LA 4PKDB 4UOGA 2AZ1A 3KMSA 4K5SA 5LM7E 3UR0A 4CYUA 1MU2A 2DRDA 3RAMA 1RWXB 1WOPA 3BF4A 2CQGA 4X2BA 3FBFA 3V4IA 3GIJA 3PX4A 3CVKA 1JJ4A 4QIWD 3T1HF 4NZ0A 4DQPA 1Q78A 3RBXA 2YTCA 3NY0A 4MIBA 3KLIB 1IKVA 2DB1A 3B78A 2IFXA 4ATNA 3ITHB 1X5OA 1GXLA 2A6MA 5E3RA 1T02A 4OV1A 4ANDA 4C48A 4CRJA 4X4UA 3CCSS 2HHHJ 4KGZB 4N8OA 4AFFA 2FIUA 4LRCA 4DQRA 4DS5A 2PFDA 4TLQA 1U1RA 1T05B 2NXNA 1BWEA 4U95A 2HHTA 2HVZA 4PUOB 4CLTA 3TANA 4J9SA 1CJUA 2Y8YA 1NH7A 2B6AB 2VOOA 3OJUA 1M5KC 4GVLA 5LL6d 2X7IA 2NXCA 3I0SA 3MM7B 1VRTA 3QLHB 4ZCKA 3W66A 2DY1A 1QJHA 4LRBA 2CG8A 4F25A 1VQ6S 3QJPA 1BQNA 3FFIA 2KTQA 1M1HA 3BB5A 4LRFA 4OHVA 1CBKA 4AL5A 3CJKB 4OIXA 1SKSA 3GONA 3ILIA 2KXNB 2FGOA 4QWEA 4XO0A 3CCRS 4M5GA 3JTPA 4NLSA 4DU8A 1FRJA 3TWZA 1WELA 2LQ5A 1TL7B 4X62F 1LV5A 1S1VB 1HD1A 4I7FA 3KJNB 4P7TA 4FXDA 2BZ2A 2V8VA 1QSLA 2ZDOA 4PQAA 3LAMA 2ERRA 1S0NA 4DR3F 2OPQA 2LEAA 3BEGB 1SKUB 2ZOMA 3PYGA 1F5BA 4N77A 2QLBB 3FJ2A 2UXDF 2O66A 2ZBCA 1XN9A 1Y3KA 4KHMA 2OEJA 5IC4B 5KFUA 3C2PA 4D3GA 1IQZA 5KFBA 3LF0A 1RUSA 2CJYB 2VFSA 1IWGA 4KE5A 2GMLA 3CTRA 1FDNA 5L1IA 4I6WA 2PD1A 4Q8EA 4X64J 4RNNA 2GFFA 2P8IA 1EZZB 4CLYA 2E1RA 1N56A 2J8SA 4OX9F 4DR7F 4NLXA 3OLBA 3UQSA 3AHPA 4QWCA 3SSRA 4YHHF 4HDGA 1WUUA 4K4SA 3KLEA 4I2PA 1UW9A 1RTHB 4TQSA 2WW8A 1VMBA 4OI2A 5KG7A 2G0JA 3MTKA 3EVOA 1ZM3A 1SKRA 2WK4A 2HBRB 2OELA 4FYYB 2CDRB 2MQMA 4RW8B 4YEAA 5DQGA 3HCXA 2WW4A 5C25B 2CPJA 4CTAB 3OTOJ 3U27A 3KWMA 2DTJA 3KDOA 1RT3A 2MJUA 4MIAA 8RUCA 2OKQA 4QR1A 3QRQA 4M95A 1NBEB 2W2PP 2BQ3A 1NK5A 4NCAA 3GLJA 5IS2A 1SI9A 4Q45A 1U24A 4NLOA 2D74B 4O0NA 3KYLA 2EK1A 2HVEA 2ZJPQ 3K0JA 3BDEA 2XSJA 2FLNA 1FNMA 4ETZA 4I0WA 1FKPB 1LW2A 2NZCA 1S1WB 3LW5C 2MQQA 2DHHA 2XCPA 4RL1A 3QIDA 4DV5J 1URRA 4JYAJ 1OYEA 3MM9B 1WG5A 4TU9A 5KFTA 3VGSA 3CD6S 1CQMA 3MFIA 1Q5YA 1LWEA 4O44B 5AXLA 4DG1B 4LRAA 2MSTA 2RE1A 1VOMA 2VU5A 4F26A 1K1QA 2XMMA 2VG7B 3W65A 4B9NA 1ZPWX 1FWKA 3Q22A 3BSCA 5DJBA 1SV5A 5CYQB 3UDLA 1B0PA 3HJFA 2EXUA 3IWXA 4NRUA 4ED4A 2Q43A 1TAUA 2HNZB 5F8IA 1N36J 4MTPA 2B5JA 3MM5B 2EEYA 3UN5A 1YBUA 2N82B 1R8AA 2QJ3A 3MR5A 1MROB 5D0GA 1RTDB 2BANA 4DCOB 3KK3B 3KG1A 2C2OB 5U47A 5L9NA 1FKOA 1M1KT 4DPYA 4ETXA 1KTQA 1X5SA 1FWLA 2DNMA 5KFKA 1X31C 1EP4A 4ALZA 3AB2B 1CS4B 2VASA 2DXEA 4CH1A 1LFPA 3NMAA 3OUYA 4DSEA 3L09A 1S1UA 4KKOB 4OZ3A 3NAIA 2IHR1 2B7BB 4G65A 3TO8A 2BJEA 3M8RA 3D9BA 1S6PB 1VJQA 5AJ3F 2L48A 3M2VA 2B8PA 1GH8A 1UJ6A 1CQNA 5A6PA 3VAMA 2KHDA 1FWPA 3H8YA 4OYIA 3MM6A 3PG9A 1U2RA 3EGNA 4RW7A 1SH3A 3MHYA 4FVMA 3PV8A 2E5IA 1XNQF 4CM0A 5F8HA 3DOMA 4UUXA 2YQ1A 4R5PB 3M6UA 1DLOB 1T9VA 4DX8H 1VS3A 4C4WA 3M1VA 2JLFA 2M3DA 2CPIA 2OSQA 2C3OA 4RKUC 4C0HA 1U26A 3IBFB 2CJAA 3JYTB 5JXSA 2NSBA 1HQ2A 2SXLA 1FXRA 3AD7C 3UE2A 3FSXA 3Q8RB 1Q86T 1VBYA 3MI7X 2J9EA 3HVTA 2YNIA 1N6QB 4ILRA 5H9FK 4OMFG 4WK3A 1FJ7A 4MKVA 1WF2A 5I3UA 1FRKA 2XI3A 4DL0C 2UXCJ 1PAEX 2FYXA 1S1XA 2EKNA 2HQFA 4C0OC 4ZCLA 2R4FA 2R2UA 1IXKA 1NJWA 4KYZA 1U09A 4DU7A 3C6TB 3W60A 1HMVB 2DK2A 4C3MA 1D0EA 3K5MA 4F0HA 4N47A 3UD4P 2XI2A 1D1UA 2YWFA 5DETA 2RRAA 2AJ2A 1NZ8A 2XMWA 1LXJA 4JP8A 1NSQA 2ZHBA 2I9SA 4F4XA 4NLVA 5E2QA 2HEKA 3N4WA 4RW9B 3MMBB 1IKXB 1U0HB 1U1PA 2BUNA 2JLEA 1ITPA 2PFFB 2BJ9A 4AT1B 2HRUA 4K4YA 3RB6A 6FDRA 2OSRA 2YY3A 3X1LB 2MQNA 2R2SA 3HD1A 4ID5A 3MM8A 2F40A 2LXFA 1ZYQA 1UJ5A 2XLKA 3AD9C 3G6ES 1HR0J 1Z4UA 2I0XA 2BRLA 2C2RA 3PZPA 5KFVA 6AT1B 1GTHA 1NDPA 1HBNA 3VAIA 4WXOA 3HHDA 1T0TV 1T3NA 3T5LA 4MKAA 4KR0B 2ZD1B 4B9SA 1TMJA 3K8VA 4UOCA 4P71A 4IQXA 1U8WA 4EZ9A 4QR2A 2KL8A 2FDNA 1ZPVA 2J9DA 3GILA 4C3KA 2AQ4A 3PX6A 2V2ZA 1R8PA 4M5DA 3P8BB 3ZZPA 1FVSA 1O51A 4X65F 2FTRA 1WTBA 3F41A 3HZEA 2J76E 3LGMA 5ADZA 2E9ZA 3H2VE 3NGSA 1JX4A 1H2UX 5LSRA 3RAXA 1TTHB 1KQGB 4IG3B 2V69A 4YR3A 2ROEA 2W2QP 3Q8SB 5KT2A 4Y34A 1WEZA 4F8RA 4ZIWA 4B3SF 2C2ZB 1L3VA 3O3LA 1JK9B 5M2RA 3KXDA 4F3MA 4JV5J 5HMXA 2GVDB 1N34J 3GJQB 4F4WA 2GIQA 3RB0A 1NHKL 1SC4B 4KO0A 2Z0GA 2OMLA 2W2NP 1CC7A 5GAGI 3CGIA 3VALA 4OQJA 3EYZA 1UVMA 1P8GA 1X4BA 1SBRA 1T9UA 2CZ4A 2F63A 4GVBB 2WOMA 4HEA9 3CJSA 2C28A 2E44A 2RUSA 4O23A 4BCAA 1MMDA 3L95X 2LMIA 1HHQA
chains in the Genus database with same CATH topology
4ED3A 3J80Y 2VG5A 2AWZA 4DN9A 4X4QA 1SJFA 5L38A 5EHHA 5F8MA 1E6VA 4JI5F 4Y2IA 3C6UA 4ECUA 1SJ1A 1N5QA 5T14A 4DL3A 3PIPQ 1S48A 5FDLA 2G9OA 3CCUS 1HHSA 3CCZA 2MY8A 5J1EA 5KG4A 1CPZA 4MK7A 1F0XA 1C0UA 2LCWA 4WFYA 3UCGA 1IM4A 3OTOF 5T7LB 1VIXA 3K5NA 2EG1A 1UEUA 3CCTA 4NA2A 4KB7A 2W4DA 3OHBA 1SC6A 1Z2ZA 3T1YF 1BGXT 1O0PA 2NPFA 2XEXA 1ZETA 3CCLS 1FRMA 1WG1A 4DL5A 4LFCF 1LOUA 4AUKA 3QZ7A 4WKYA 4YB6A 1S0MA 2DPJA 3T6JA 5A0YB 4TQRA 2DH7A 4DUYF 3PW0A 2DCUB 5T41A 1LWEB 3RZAA 4LF5F 4NLQA 1ELOA 1HWJA 4JBCA 4G1PA 1K8AT 3EPGA 3RBDA 4X4VA 2VPXB 1HD0A 3CSKA 1VK8A 3S7RA 1FF2A 1FXLA 5D4PA 1OIAA 2OH2A 3HK2A 5B08A 2H5EA 2IRXA 1NEEA 3SQGB 5DQHA 1U1MA 4RUHA 1VQLS 3VTIA 3KLHA 2MZQA 3KJVB 2YWHA 5DG7A 2MSSA 1QAIA 3FNNA 2ZITA 1W25A 1TUVA 2OD4A 4Z2XA 4NCBA 4PG7A 2HG4A 2ZOFA 1OQ3A 4IFVA 1FDAA 3VAHA 4A8QA 4QYRA 1S9GB 5HLFA 3ISND 2MZSA 1NK9A 1MWZA 1ZAXA 2IYGA 4F4KA 4KRWA 1HQEA 1BLUA 4IRDA 2B0GA 1HW9A 4LIRA 1FCAA 2IC3A 1KQKA 2Q79A 3S6EA 2RH3A 3D0GE 4I2QB 3PKYA 3RB4A 1JJHA 4U9RA 4LSLA 3I4PA 3R5CA 3DLBA 3I82A 3I0RB 2RJZA 1FKPA 3J81Y 4CIOA 1L3SA 2CPHA 3OL9A 4B3RF 1NO8A 2IM1A 3P3DA 1X4GA 1YRUA 4TY8B 4RUAA 3AY0A 1XK8A 5EUHA 2ASLA 2GHVC 1UKUA 1S97A 3OTCA 3UWTA 1SV5B 1M5OC 2L9DA 4CO2A 2HLTA 5B0AA 3MM9A 4XAKA 2DGOA 5I4MA 1HNWF 1SL1A 4L6V3 4BC9A 3IA0A 1HWIA 1PC5A 4DV5F 1WHXA 4JYAF 2DCLA 4P7VA 1LWCA 3GYNA 2E9RX 4ELTA 5A2QY 3TVZA 2CDQA 2OPRB 2LECA 3NCQA 2A2CA 4ES3A 4DQSA 3A8EA 3WC0A 1T03A 1XR5A 4RWXA 5DG9A 4PCQA 5K5MA 4KV8A 3E01B 5GAEU 1QSYA 1ZAWA 1KNZA 2KFNA 3DLJA 5J2PA 2DH8A 3MMCB 4PXCA 5F41A 4X84A 2HIQA 2ZH6A 2ZH5A 2B5JB 4E0DA 1QLNA 2L9WA 2HGNA 2J6SA 4F67A 3DI6B 3BGRB 2GA7A 2XMUA 1H0HB 4LSNA 4WIIA 4F3QA 1TK5A 1HBMB 3TP2A 4BWJA 1F5CA 3CDBA 3DRXA 4R8UA 2RU3A 3CUNA 3JAMY 1VC6A 1RKIA 3LANA 5J1PA 3BDPA 5IT4A 1L3TA 5GVQA 2R7QA 4I68A 4RBVA 1RT1B 2BANB 1YJRA 3AAWB 3N0VA 1D9AA 3ZZOA 1HBUB 4IO1A 4CO3A 1YJTA 1UL3A 3PEJA 4WFAQ 1Q79A 5J2QA 2J9DE 3DC2A 5K8NA 3KK1B 2FJBB 1FKOB 1VI7A 2IAJA 4QWBA 1K1SA 3NRBA 1DRZA 4A4JA 2KZZA 2OMOA 1JIHA 5HP1B 1C1CA 5J2NA 1REVA 1S10A 4URSA 4IRCA 2OPPB 2LEPA 3PO4A 3C46A 3I6PA 4FBUA 1WEYA 1EP4B 2J7UA 2BR0A 4PG6A 1LK5A 3ICLA 5IT9Y 2J6TA 4RWWA 2KT5A 2ZKUA 3OXLA 3KKFA 3CMES 2RMLA 1X4FA 2YNFB 4UQTA 2HPUA 5B0BA 1U4BA 2QZ8A 2XMJA 4B9MA 2K2PA 2PDAA 1HD1A 3R27A 2RB7A 2AJ0A 4DFMA 2AP6A 2GCFA 3UNGC 5SZTA 1FDDA 3D1QA 1UA0A 4C8MA 2UUAF 5HBMA 2RUGA 4ZK7M 5KFDA 2DNHA 2P9GA 3OUYB 1VQNS 4ZVEA 2F8EX 1HBOB 2MKSA 3Q2SC 3AQOA 2MQPA 1E6YA 3TAQA 2RILA 1TL3A 2G0CA 1AFIA 2L08A 4RW6B 1VBZA 2PA3A 1S7HA 4FNHA 1S1UB 1YRXA 1V3SA 2PE8A 1N5VA 1IKYA 3BSAA 1N36F 4IOBA 4F2SA 1JKHB 2RRBA 3F73A 4I69A 4ZMMA 4FF1A 3R5DA 1MROA 4K5RA 1DFDA 3GG1A 3CDWA 4LF7F 1S0OA 1A7GE 2KG0A 3O5TB 2NQPA 1UEVA 1R7IA 2Q3PA 4KFBA 4QR0A 5AE2A 2IM2A 3LOUA 3DRYA 3M32B 3U1MA 3KK3A 1TK8A 4IR9A 2XMKA 2ZM6F 3PFEA 2NLWA 2GQQA 5I3QA 2EVZA 3M2VB 1PGZA 2JWNA 4TKTA 1FNOA 5F0WA 5IM0A 1Q81T 3RRGA 3OR1A 1C1BB 4ERDA 5KFPA 3DMJA 2EBGA 5EN1A 4I1TA 3D2WA 1PILA 1VQ7S 3MFHA 2NZ4A 2XS5A 4I6AA 2E7WA 2G13A 2DIUA 5DDQC 2Y1IA 4B3MF 3BGUA 3KLGA 3H25A 2GW8A 1RT2B 4RW7B 2K7KA 2PGCA 1AROP 3A1YG 2OPSB 4HL9A 3GYXB 3EXYA 3MEDB 1DTTB 2IMWP 1PSDA 2V2KA 4B02A 4ICLB 4ZP6A 4Q2LA 1S9FA 1L3UA 4ZHRA 4F02A 3BQ2A 1YWXA 1NAQA 2CQ1A 4MH8A 5D6GA 4Q0BB 2ZH9A 3W2VB 4X4NA 3DLEA 4CO0A 4K50A 4QIFA 4LF6F 5KFZA 4JI3F 2VKRA 4ECXA 1DTQB 4O4GA 3M1VB 5GADU 3H20A 5B0FA 3LPYA 4PWDB 4KKOA 7FDRA 2N4CA 5KG0A 4DV3F 2P5VA 5E3AA 1YJWS 4A47A 3QAEA 5KFRA 2AD9A 4C8YA 1TKZB 2RIJA 2UUTA 4GKKF 1HL6A 4NLTA 5AXNA 1JLGB 1RGVA 3OW2R 2QIFA 4C0BA 2IVYA 4WTYA 2VPZB 2YQ3A 1S6PA 2W8LA 1KEKA 1R27B 3OVSA 5KFCA 2ADBA 3QGHA 2B9YA 2YNIB 2XO7A 4J9LA 3QO9A 3B4MA 1QSSA 1N32F 4ECTA 2YX1A 4G1QA 5M2PA 3DLKB 3IRXA 2CKWA 4XPEA 3CCVS 3VZHA 2I1RA 3SZ2A 2BW2A 3QWUA 1NJXA 2HNYB 3RR7A 5LSOA 4HYKA 5I3UB 2ASJA 5E5NA 1RTJA 5KG2A 4DBQA 5C5JA 3O1LA 2N3OA 4C7QA 3DYAB 3BN7A 4URGA 1S1XB 4ZA1A 1NKEA 4IFYA 1R89A 4OI3A 2XMVA 4B3OB 1V9OA 4WE1B 3NNCA 1FD2A 2DNZA 3OL7A 2UV8G 2JZ5A 3TUJC 1DLOA 5I42A 2C2DA 4QIVA 5B0GA 3BO4A 2W24A 3NS6A 2FHMA 4MYTA 2C42A 1N5YB 1NJIT 2V0NA 3AJ2A 5AXMA 1Y5NB 4NXMF 1U8SA 3LUYA 4G3IA 3CB4A 2HAIA 5F3ZA 4USJC 3M8PA 4C11A 3QJJA 4RX6A 5DO2A 5KG6A 5DDOC 2GQCA 3MUTP 4J9RA 5K14A 2JEGA 4DLEA 2KRBA 4IYQA 3MOZA 2D1CA 4G6VB 3SCIE 5KFXA 2CQBA 5KAKA 1RT6A 4YQWA 3BQ1A 1U1NA 3POTB 2CQCA 3N6LA 3AH6A 2LEBA 3GIMA 3I87A 4H4OB 4DV2F 1Y5LB 2RQMA 3E8OA 3K58A 1KVIA 4MAKA 4K4XA 1SJ4P 1VRTB 4JOUA 3LQVA 3FQLA 2HYIB 1QUPA 3KLIA 5LSLA 2R7UA 1P9QC 1QVGR 3M9OB 3CULA 3BN4A 1X4HA 2HHUA 5CHCB 3PM9A 3KMQA 3H40A 2KJVA 2LA4A 3FFIB 2V4RA 3V6DB 1VQ9S 2HVHA 1FXDA 2VBWA 4J9NA 2AX0A 2D9OA 5K8MA 5LMNF 2F4VF 3HVAA 4L72B 5KFGA 4DL7A 2JDJA 2I38A 1NJYA 2UXCF 2CZVC 2IM0A 3UCUP 4FZVA 4ED7A 4BC7A 2VQEF 2M2BA 2VBXA 3N5BA 2P6TA 2FHJD 5LXYA 3Q0AA 5EWGA 3MGJA 2MKIA 2Q1LA 1L5UA 3Q24A 4PQUB 5A8WB 4PXBA 4HDHA 5FD1A 1TK0A 4CCHA 5A8RB 2FC9A 4EYHB 4JV1A 1HWLA 4OZLA 3V81A 2DO4A 4Q5VA 4IO9Q 2YH1A 5KFLA 4K2XA 5LXRA 2ZVSA 2WSFC 3MM8B 4KSEB 4RW4A 4EEYA 3RW6A 5GAHU 3C3LA 4RNHA 3RW7A 4PUOA 2CQ2A 4H4MA 3HVRA 2LYVA 2V94A 4UY85 2HNDA 3I31A 4NZ6A 2HRYA 4P6QA 3K57A 5CD4H 3CCJS 3SCKE 5D3GB 5KFOA 3B4DA 4C2MA 2B6AA 3SXLA 4CNZA 2WHOA 2ILZA 3THPA 2Q6BA 2X1AA 3ZZ0A 5DQIA 1SXLA 5F8NA 3MEEA 1GX5A 1KLMA 1XERA 4IDKB 3TVYA 3MM7A 4P2SA 1F9FA 2VL1A 4RU9A 1U49A 3QLHA 1K0VA 2GV1A 4C8LA 1H6KX 3JSMA 2YKMB 3GFZA 1S99A 1OWXA 1SH2A 1HI8A 3WDOA 4YR2A 3Q8QB 2VQFF 4DS4A 2OTJS 1FE0A 1P1LA 1QE1B 1VQSA 2JC0A 4Z37A 5KFJA 3HP6A 3ZZZA 1HBNB 3CJ4A 3MMBA 1VBXA 3MMJA 3CJ2A 3H59A 3PW4A 3OFEA 2E9TA 4J37A 3TAMB 3ENVA 1KLNA 3CE8A 3CJKA 1NHVA 1U48A 4DOZA 4DV7F 3OFFA 2JX2A 4QBUA 4N56A 2EPIA 2N7YA 2XY7A 2AYBA 4OZNA 2X51A 5E0OA 1YJ9S 2GX8A 1IKWA 4C97A 4DWIA 1APSA 2RSQA 1TFYA 4XPCA 2CQ4A 4UQGA 5GMKa 2QA1A 2D3OR 2W9CB 1HNVB 1TKTB 3PHEA 2Q66A 4WZMA 3DM2B 3TW0A 5K8PA 2VG6B 2LQBA 3US5A 1NU4A 3ZZRA 2W9BB 1FESA 3CT9A 2Y1RI 4M5DB 2W8KA 3CO9A 1BY9A 3CD0A 4MK8A 3HHLD 1SIWB 2DNPA 1XR6A 4Q8FA 1HYSA 1RT7A 2DPIA 4RLEA 3SMZA 4F4YA 5IZHA 3MZIA 4CT9A 1S1VA 1RT5A 4NLWA 4A8OA 1JLEB 3MECB 1WD6A 3LGNA 1M5VC 5LJ3Y 2BV3A 5GAEI 4Y2MA 4JI0F 4OZ5A 1JLBA 2K3KA 2E5HA 1LXNA 3OPKA 4R0EA 5DGBA 3G96A 1DARA 4HT5A 2HHSA 2VV5A 4ILMA 3P49B 4K0KF 2J8AA 2BABA 2ZE2B 2R7RA 3AJ1A 1B7FA 1VC0A 3ZZUA 1RISA 1TL1B 3R5AA 4ZP8A 1JLFA 3J7ZT 3SDEA 5AE1A 3RBEA 3CDEA 1NK0A 1FK9A 1KC8T 2PI4A 2YNHA 2DNRA 5KFMA 2JC1A 3CDAA 3KK2B 2MB0B 2UUBF 5LMUF 5BR8F 4DSIA 2ZD1A 2ZUGA 3TA0A 4I56A 1S72S 3NG8A 2V8DA 5BJRA 4WKRA 3NWGA 1R8BA 3FEZA 4KAIA 2GO9A 5CZXA 1S76D 3BZQA 2GIRA 3I5BA 2WONA 2ASDA 4NCGA 3K5LA 2MXYA 2UUCF 2O5DA 1CVJA 1R8HA 2HQIA 1KN6A 1S0VA 3CC7S 2M88A 4ZPTR 5D4NA 4I67A 3ENQA 5THWA 3DRRA 2YKPA 1A9NB 4NRTA 1CG2A 2E5GA 4QPTA 3LP0A 1RI7A 2IRUA 2JL9A 2PMHA 2YNGA 4DDFA 2KFZA 2D9PA 2QSWA 1SJQA 3FZ2A 3SYZA 3MUVP 3QGGA 1X4DA 1RA6A 1TVRB 2IA0A 1KVJA 4DQIA 3P6YC 2DITA 1B0TA 3TNVA 1HQUA 3UW1A 2CJBA 4DR4F 5E33A 3HFKA 3KLFA 1IJFB 5C24A 1Q8BA 4HT7A 2JVOA 1M5SA 2NUHA 3T3FA 3VCDA 1U25A 4FP9A 1GTEA 3DRSA 4R25A 4X66F 1JLAB 3ENWA 1R8CA 2VFVA 5HROB 1FVQA 3D1HA 4KBIA 2Z4PA 1ZAVA 2A18A 1EETA 2VD3A 2WOMB 3M6VA 2IJFA 1FA0A 4YDDB 1QTMA 2DRAA 3M30B 3MD3A 5F3TA 2MGZA 4IUFA 2RQCA 1VQKS 1VRUB 2Y0SD 3CC4S 2GO8A 3THTA 4CH0S 4ZVFA 3RAQA 3NBPB 4M8LA 4QOTA 2W4PA 2MKHA 3PNIA 2VBYA 4CT8A 3BSOA 5D8HB 3GG0A 4J9QA 4BHQA 4IOAQ 2L9NA 4LUBA 3CEDA 2FHOB 3KHRA 4DV6F 1JB0C 4ELUA 1NKCA 1Q7LB 3CD7A 1LW0B 2LXIA 5BYRA 3H5SA 3WBZA 1UW4A 3J7YI 3I4HX 2EFOA 4ITSA 2AYEA 1WEXA 3MXHP 2AYMA 2C3MA 1KD1T 4WYLA 1RTHA 1FRIA 3MAHA 4WYWA 5A8KA 5KT3A 3NNHA 2VG5B 1HHTP 3O44A 3G8SA 4W90B 4JUZA 2R2RA 1E6VB 3JSRA 3C6UB 3TARA 2R8JA 2DIVA 2K1RA 4C8ZA 5I3PA 4OHYA 5FDLB 4ZCIA 4JI4F 4WK1A 5J1EB 4JV5F 4TYAA 4GC6A 4FXWA 1ROFA 2E1CA 3TA1A 2BDPA 2V4QA 4K59A 3GB0A 1N4LA 2EK6A 2K7JA 1N34F 1UETA 2HWHA 5B0EA 1CEZA 1YSJA 2BVZA 2DR8A 1T95A 4OX6A 3GSDA 1FEEA 2R8IA 1KTVA 4AXIA 1LW2B 5KFAA 5GADI 5C25A 2O3DA 2YH0A 2FLPA 3HX9A 4CTAA 1N52B 2KJWA 4TNOA 2IMOA 4RUCA 4NWBA 2N7CA 1ZM2A 2EBEA 2E5LF 3X3UA 3G6VA 4F3OA 4A8FA