5LMNF

Structure of bacterial 30s-if1-if3-mrna translation pre-initiation complex (state-1a)
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
101
structure length
101
Chain Sequence
MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFLANA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Large-Scale Movements of IF3 and tRNA during Bacterial Translation Initiation.
pubmed doi rcsb
source organism Thermus thermophilus (strain hb8 / atcc 27634 / dsm 579)
molecule tags Ribosome
total genus 25
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2016-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01250 Ribosomal_S6 Ribosomal protein S6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5lmnF00
4X62F 1F60B 2HHHF 1HNWF 4DV4F 4DV6F 1N33F 4LF6F 2E5LF 4DR2F 4DV2F 1GH8A 4X65F 4B3TF 4B3RF 4GKKF 3ZZPA 4DR5F 4DV7F 2BVZA 4DR6F 2VQFF 1FKAF 1LOUA 2UUAF 4JI0F 5BR8F 4DR7F 2B7CB 1QJHA 4LF9F 2UU9F 4DV3F 2UUCF 4JI2F 1IBKF 2B7BB 1CQNA 1XMOF 4JI1F 3OTOF 1G1XA 4JYAF 4NXMF 2BXJA 1XNQF 4LF7F 4JI3F 1IJFB 4LFAF 2YY3A 1IBMF 4KHPF 4OX9F 4NXNF 5AJ3F 4LFCF 4DUYF 1HNZF 4DR4F 4LF8F 2RJZA 4DR3F 4X64F 4YY3F 2KJWA 1N36F 2UXCF 4DV1F 4DV5F 2F4VF 1I94F 1VMBA 1HR0F 1XMQF 1N32F 4B3SF 4B3MF 1N34F 1B64A 4DUZF 4JV5F 2UXBF 4YHHF 4LF4F 2J5AA 1CQMA 4X66F 4AQYF 1RISA 1J5EF 4JI4F 1G7CB 3R3TA 1FJGF 5LMUF 5IWAF 1XNRF 4K0KF 4DR1F 4DV0F 2KJVA 4JI6F 4GKJF 4JI7F 1IJEB 1HNXF 1IBLF 2UXDF 4JI8F 4JI5F 2VQEF 5LMNF 4LFBF 4LF5F 3T1YF 2ZM6F 3T1HF 2UUBF
chains in the Genus database with same CATH superfamily
2RKIB 2VKRA 2FHMA 2Z30B 3ADAC 3PO4A 1S1TB 2KFNA 1GH8A 3E8OA 4LR9A 4WJBA 1RA6A 3J7Z5 3L3CA 2DNZA 2E5GA 2VZ9A 1FX2A 4LBIA 1DARA 4IR1A 2DNHA 2OI2A 2RRBA 4YB6A 4W90B 2JFDA 4NLQA 1WTFA 1VIOA 1WC1A 1UJ5A 1C1BB 1ELOA 1V5VA 3HHLC 1RAFB 2E44A 1TL7B 4K7QA 2Y0BB 3LGNA 1VQ8S 1KP6A 1N8RT 1Z4UA 2QEXS 3DLKA 2ZNZA 2GQ2A 4PUOB 1HW9A 3CDEA 2WTFA 3V6KA 4EK2A 1XC9A 3TUJC 2JJ4D 1OIAA 4U7UK 3NGDA 4O3QA 1YBAA 1QUPA 1CBKA 2VD3A 1RZMA 2HNDA 4K4SA 5KAKA 4I64A 5HJXA 1XMBA 5J1NA 1RA7A 4ER8A 4UTGA 2NREA 4YR0A 1CS4A 2IBKA 2PN6A 1Y5LB 2LLZA 2WB1D 4ED6A 3NGKA 2ZBIA 1JLGA 1KRPA 4OV6A 3PM9A 3VGVA 4KR0B 2X7IA 1EP4A 5AXKA 1UFWA 4ZK7M 3WC2A 3PY8A 2OPSB 4XAKA 5EX3A 3K57A 1VQLS 1H73A 5L9XA 4HKQA 4B3TJ 4ZPBA 3PKYA 3T6BA 3DLJA 4YB7A 1S5ZA 2AU0A 3W63A 3ZTPA 4PYAA 5DLFA 2GCFA 1JLFA 2Y1RI 1R89A 3SCKE 3TEGA 1MU2B 5HQLA 3MD1A 4HR2A 4LF4F 3Q86A 4C0HA 4AQYF 1S6UA 3BN4A 4H4KC 3N6LA 1JQGA 1I3OB 2ZOFA 2V8GA 1V5IB 2HIQA 2RMLA 3OR1B 2QFJA 2QZ8A 4C8OA 2KFYA 3SV3A 4J9SA 1VQ6S 3WIVA 2XLJA 5A8RB 4KKOA 2DYAA 3FCVA 4U6PA 1QAXA 3G6XA 1HPZA 3DOKA 3O44A 2MKKA 1FCAA 3IR7B 2VB6A 4Y2AA 4TQSA 1I5OB 1RWNB 1HMVB 3BZQA 4P75A 4NMXA 2R7SA 5HP1A 3P96A 2A2DA 4H4OA 1D0EA 1WHYA 3FQLA 3NMAA 3RB0A 5AXLA 5LXRA 3HK2A 1VYAA 1L3SA 3Q8YA 5BYSA 4B3OA 2P6TA 3I9V9 2DNNA 4URSA 2IM3A 2MZ1A 1U25A 5IT4A 4KH1B 3HHEA 4DS5A 3C15A 2P9EA 4ZLJA 1TP7A 1TL4A 4NWBA 1M5VC 2HQ3A 5KFQA 2RDJA 3C46A 2M52A 4ZHRB 3BV8A 3VGUA 3Q8SB 4K4YA 2MQNA 1L3UA 2IMOA 2MY7A 4DR2F 4JV1A 4QIWD 1X9MA 4DPXA 1FJGJ 2A6MA 1MMDA 3J80U 1WG4A 4LSNB 1LWFB 2UUAF 2HFUA 5C2CA 2ALYB 1RHUB 3AHPA 2AX1A 2C3PA 4KBIA 4MMOA 2VASA 2V4RA 1UZHA 2LA6A 5LMNJ 4YUDA 3M8QB 2W4DA 5D3GB 4QBUA 4LF6J 1GMWD 1N5TA 1VQ5S 3KLGB 5CXTA 2CPYA 2WCXA 2KXHA 4PYDA 2CQIA 1HI0P 3IS9A 3PW7A 3B4DA 3TA0A 4KHMA 2DGVA 1QD1A 3N5FA 3UNYA 4C3KA 3HHDA 3KG4A 2B9EA 1K47A 2N3OA 1QAYA 1M5PC 1GK8A 5J1PA 3EXCX 2W9BA 3W2WB 2MQOA 1WELA 3D6TB 3K5OA 4CLLA 1TV6A 3MECB 3CT9A 4OZJA 2MXYA 4KC5A 3PFEA 4LFBJ 2YKAA 4UUWA 3MFHA 2CFXA 3P3DA 3PRBA 3OL6A 3RYLA 1S49A 4N5SA 2LU1A 3A1YG 1S57A 4JI0F 3VZHA 1JLAA 2CZVC 3CJTA 4CLWA 3DOMB 5KT7A 3A4TA 1X9WA 3DNCA 2QLJB 4OMFG 4JV2A 5E3RA 2KDOA 5I3UB 3QFHA 3OL8A 3D67A 1F0XA 4P7VA 3FEZA 3HJVA 1HW8A 3SEOA 1RHRB 5LJ3Y 3KLIB 2ROEA 1R8PA 1B3TA 2W2OP 1BQMA 3PEHA 1R8AA 4BWJA 4B3MF 3ISND 1ZA1B 4C6AA 2YKMB 4J7CA 3JQMA 3MPUB 4ETXA 2V69A 2HS4A 3CJ3A 3AJ1A 4YP3A 1NB7A 1T94A 3PACA 1ZM9A 4OX7A 5KFLA 4RW9B 1S7HA 3S7RA 1N5QA 2KXFA 3TNVA 2DH7A 3VWSA 3WDOA 4FPIA 2E9TA 2JOQA 3SXLA 3AFGA 1HNWF 3CF5Q 2OELA 3VAMA 4WYLA 1FTRA 4CO5A 1AFJA 2JL9A 3EPIA 5IC6B 4DR6F 3DDKA 1KOOA 4OYOA 3EZ5A 1SJFA 4HI1A 1Q95G 5KFXA 3JTOA 3QSYB 4RNOA 4JI2F 3SYZA 1I6JA 1BWVA 5ETTA 1R7IA 4URQU 4QW9A 1BUXA 1EQ0A 1UJ6A 5M2RA 3CCES 3FDSA 4IKAA 1W26A 2F40A 1JLCA 3M9OB 1K0TA 2ZWOA 5C7PA 2MZQA 4DWIA 3CDUA 4OZ2A 3J80Y 2RD5C 2HQCA 2F4VF 2YWGA 3HVTA 2RIJA 5D0EA 1Z2ZA 3AOAA 3T19A 1S59A 2C2MB 2C3UA 2LEBA 4HVZA 3BSCA 2HBQB 1KC8T 4FYYB 4NZ7A 2OGUA 3OTEA 1HQEB 1QE1A 3EPGA 2GZOA 1T05A 4B3SJ 4J5OA 1ZAXA 1KDNA 2DEJA 1F9EB 3ZZRA 2R7QA 5E33A 2C2KB 1XK8A 3BR9A 5LXYA 2V8HA 3ZTQA 3J81j 2BKNA 4NA3A 5KFKA 3G82B 4I7FA 2VDIA 1U1PA 5HMWA 2BVZA 1YVFA 2XZDB 5KFUA 3GZ7A 4IO9Q 3W60A 4Z7YA 1FXLA 2HKEA 2HFSA 7AT1B 4A8XA 1WACA 3FCWA 1LFWA 3C15B 1V3RA 1AZSA 4WKRA 2RE1A 4LF1A 3VGTA 4ED7A 3T41A 5E3AA 2DGSA 4JB8B 2B4PA 5I42A 4ID8A 1NK0A 2F5GA 3QT7A 1AW0A 2VBWA 3C16A 3B4MA 2HWHA 3QSIA 1R8HA 4E98A 4WXWA 2FYXA 2I5JB 3G6VA 4M8LA 5BJRA 2MZTA 3AXMA 5KFGA 4PXDA 2XYHB 3IM9A 2RVJA 1AB8A 2CJXB 3QPIA 2BE9B 3GV8B 2AKWB 1U6FA 2OPRB 3IG1A 1N33F 1UW9A 1SC6A 3PYGA 1SUQA 1FKPA 1TKXB 3MOJB 1IKYB 2UXDJ 1NLKL 1DRZA 1SL2A 1CQNA 3OFHA 4IFYB 2OEJA 4HI2A 3IFEA 1QDUB 4USWA 1AXQA 2FZKB 4MK8A 2WVDA 4UT4A 2F8MA 4DJBA 4DV1F 2HZCA 2N3LA 2HK3A 3KNAA 3LP2A 4TU9A 1HQUB 1S0NA 3MM5A 2QA4S 1HHSA 1RXOB 3HFKA 5H9FK 3LANA 5GAGU 3CD7A 3PIPQ 1Q8LA 1M1HA 3MM6B 1TL5A 4G1QB 2PMZD 5B0EA 2EKNA 2KJVA 3BSOA 3T5HA 3W65A 3TOQA 2QMXA 2EKYA 4RBVA 2VIHA 4BCAA 3DLHA 2CQ2A 3DMJA 1H6KX 4LQ3A 2AYGA 4HACB 1PC4A 3CO0P 2WBMA 4NCAA 4LT6A 2UXBJ 4YHHJ 4ITSA 4MK7A 3T1YF 1NPPA 2MSTA 1BQNA 1RTDA 3MDFA 1YRTA 4I67A 1Y5IB 2HHVA 3IXQA 2IVYA 1WHXA 2OPPA 1Q8BA 3ONQA 4OZ0A 4GMKA 3FBEA 5BYQA 4EU0A 2R2RA 4NXMF 3PRVA 4ILLA 1L5UA 4CT8A 5CYJA 4ECSA 2XTJP 1HBMA 4HH1A 2SXLA 4DU7A 3M8RA 2GIFA 1M5SA 1TELA 1NK9A 1T9YA 4DSKA 3K58A 4X66F 2Y1JA 1U45A 2PE8A 4V19X 3I0RB 5IV4A 1F3VA 4C3LA 4FYWB 1U1KA 1NZAA 5HQMA 1X0FA 4X4NA 4A47A 4ZCLA 3ILOA 3HVTB 3TUZC 3TJAA 2OUGA 1RTHB 2DD8S 2BRLA 3UCUP 4DBQA 4EZ9A 1HKAA 2KT5A 3OR2B 4F36A 1YRUA 4CLUA 4CTAB 3C6TB 2JC0A 3ZZOA 5CQGA 2LDYA 2DR7A 4F0KA 1QE1B 2IRYA 2B43A 4P72A 1XMOF 1SPBP 1F9HA 3BKUA 4DF8A 4QJVA 3Q2TC 2J0SD 2Q66A 3BGRA 4GKKJ 3MEKA 2RQKA 4DHVA 2YVSA 1QVGR 3MR6A 2FJWA 3MM9B 3K5PA 4LF9J 1XR5A 3NCQA 3NKYA 1NJZA 4USVA 2BACA 1ITPA 2QL9B 3ZZTA 4A8KA 2MLXA 3TAMB 4NRUA 4HHUA 2H5JB 3FRYA 4ZOSA 1F5BA 2AJ4A 4DX5A 1FRLA 5B0DA 4BDPA 4HTIA 2GHPA 3IGVA 1HR0J 3CNQP 2ZH7A 3KMQA 4OI1A 3EZUA 4PG7A 1RT1B 4ANDA 3KK3A 4QWBA 1SIWB 3H5SA 2V50A 4ZN1A 1UEVA 2HS0A 1FRXA 3DGVA 4QPTA 2Q1LA 4OZ3A 1WEYA 1AFIA 3D3CJ 3RB4A 1DQ8A 1E6VB 2W7AA 2DH8A 5DDOC 2DJWA 2F9DA 3QGHA 1ICEB 2CQCA 3G6YA 4LBHA 3U02A 2N7CA 3M8WA 5AE1A 4B9MA 3G96A 4DQIA 4TU8A 5E41A 3IWLA 2KT3A 4WP8A 4JI3F 6FDRA 1KSPA 3CMAS 4MJKA 2IY5B 2QGFB 4KT0C 5J2QA 4MIWA 2BX6A 3KDOA 2E66A 4ED8A 1RK8A 2FTRA 1VQ4S 2GJFA 4L75A 4E8UA 3CCQS 1W25A 2CADA 3CD5A 3DXSX 4OJ3A 2MB0B 1RHJB 1E6YB 2HRUA 3F56A 4ZA1A 3OVBA 1N0VC 1LNQA 4BHQA 2VA3A 3J7A1 4CH1A 2FHJA 5L1JA 1SL0A 3HT0A 2E1AA 1GMWA 3MCOA 2ZVIA 2VFTA 4XDDA 2H9ZA 1Q8KA 3KKFA 2C2RA 4DSJA 4DV2F 1TR0A 3KLHB 2A1BA 1DTQB 4ZJLA 2RUSA 4V19J 3EE3A 1X0PA 3PJXA 5EWGA 5HVGA 5ETNA 1S1WB 4ED4A 3L95X 5LSOA 3TX0A 3VAKA 3UVJA 3LWLA 2MKJA 1O0PA 1PYTA 2QSWA 5CZXA 4QWCA 1YZ7A 4WFZA 2XMVA 1CVJA 2W9CA 1RDRA 4DR5J 1HNZF 5DETA 4IO1A 1B0VA 1NDKA 4F4ZA 3CJKB 3THTA 4U8VA 4EBCA 3AB4B 3GYNA 4K8RA 2W2PP 1IKVA 2MHNA 4X4SA 1RTJB 3G6ES 2DRAA 4C8ZA 3H59A 4LQ9A 1WD6A 3JTPA 4RUBA 4PAAA 4O3SA 4DDFA 4J9VA 4L6V3 3IWXA 5F9NA 4UW2A 1NK6A 4C98A 1ZPVA 1VJWA 1X5PA 2KL8A 3H5XA 1ZA2B 3CW2C 1HNVA 1UA0A 4N8NA 2UUWA 2CPIA 3GV7B 3QJLA 2CQ3A 4KJIA 2AJFE 1NJXA 4OHYA 1WORA 3H25A 3FK4A 3NGTA 4DI6A 2CG4A 3JSBA 3DXBA 3TZWA 3BO3A 2CAJA 3H0PA 2R7XA 1U26A 3KWMA 1HNXJ 2LCWA 5L9NA 4I1TA 1U2RA 2CPEA 2HURA 5KG2A 3ZNJ1 3OTCA 3OBIA 2OH2A 4PEOA 4F50A 2QX0A 3TW0A 1EETA 4K50A 3CJ4A 2MJNA 2XS5A 2NUHA 5IT9Y 3EVWA 1TFWA 2Z57B 5KG0A 1P9YA 2KG0A 3BQ0A 1K44A 4OX8A 4ZITA 5L38A 1IKXA 2IRUA 3CJ2A 2CYYA 5ETKA 3W5ZA 3ZZYA 2XYGB 4WU3A 4OFZA 4RUHA 1UVJA 2O67A 2FY8A 3TARA 2OP5A 5FJ4A 3HSGA 1DAXA 1TL1A 4UOFA 2BMBA 3MPWA 2V8VA 1B7FA 5J2PB 5KT2A 2PT0A 2Y1IA 3BYPA 5G4DA 2CVEA 3TAQA 4FXDA 2HHHF 3Q24A 2MQMA 2B4VA 1S9EB 4OHXA 3UQSA 3FNNA 3DRRA 1IXKA 1RAHB 2CPZA 4ID5A 3R97A 4C9DA 2AMCB 5BR8F 3R5AA 1KWMA 5DQHA 2Y9HA 4JI7J 2GIRA 2F9JA 2BABA 4R8UA 5CH7B 4MIAA 2KI2A 4JI1F 3P5BP 3IBFB 2ZITA 3MPVA 1Z1ZA 5I3PA 1SVDA 1T11A 1U2FA 3DRPA 4CM0A 4WFNQ 4QYZJ 4UOCA 2JH3A 4ED1A 4Q0BB 5KG7A 5D4NA 4IFVB 1UWBA 3V81B 3S1TA 3F41A 2VC1A 3UR0A 2XSFA 2RILA 4C11B 2EFNA 2HNZB 2IA6A 1YDLA 1OS5A 1V3ZA 4P10A 1SQGA 2E7WA 5LL6d 3R9LA 3JQJA 1QLNA 1GTEA 5A8KA 1GAOA 5CD4H 2W2MP 3MAHA 1VHFA 3QGPA 2H4WB 1R3NA 3PNIA 1SIZA 2H54B 5F8GA 1DURA 1MN7A 1H7WA 1Y4ZB 3GJRB 2OO4A 1NHKL 1IWGA 2VFSA 3POTB 4JYAF 5IC4B 4W92B 3QRPA 1FK9A 1S1VB 3CEDA 4Q7AA 2BJ1A 3A3OB 3UN3A 1UJ4A 3UDCA 2R8IA 3WX4A 2DGWA 1Y7PA 2C22A 3C14A 5FD1A 3GLJA 5HK4A 2VPZB 5HMYA 4P52A 2R7VA 1JMTA 2Z2MA 4H4MB 3EICA 4XPEA 4F2SA 3FRZA 3GB0A 1TL3B 3GG0A 2MKCA 2B4UA 1FRJA 1CC8A 4GRSA 2QJ3A 1MROA 4M94A 1PBAA 2UUBF 1LWXA 1ZZNA 1VRTA 2YWWA 4KV8A 4DCPB 4X65F 4DL0C 3AJ2A 1BC6A 2CKWA 2ZWPA 5HBMA 2DNQA 2HFNA 3GSDA 3CDBA 1IWAA 1X60A 3MUVP 2W4CA 4J9QA 2VODA 3HO1A 2W4PA 3ENAA 4FVMA 1RT2B 2GO8A 4XTTA 4KHPF 2OIHA 3G8QA 1RT3B 2YNGA 2JVOA 2MHEA 1N6QB 2POKA 3Q8UA 3JSYA 3V5RA 2XS7A 1JJ4A 1F3FA 2HQIA 5K14A 2MGZB 5EUHA 3FBCA 2ZD1A 2ZZMA 4JI4F 5KFYA 5C24B 2GJIA 4ZIWA 3UD4P 1Q79A 1B7YB 5EWFA 2GX8A 4DQPA 5G0RA 5GMKa 1I94J 4XPCA 1REVB 4MK9A 3FKBA 4O0NA 3NCRA 3TVYA 4AL5A 3SFGA 3TVZA 1WC4A 1AYEA 5F8IA 4A8WA 3D5MA 4IH6A 4EEYA 2DGUA 3PVXA 9RUBA 4UUXA 1HWLA 1JLQA 3C6UB 3QAUA 1S9GA 3OVSA 2NXUA 1LW0B 3R2CJ 3BB5A 3CB4A 4O3PA 1Q8IA 1UTAA 5K8NA 1N5YB 4JBCA 5L8RC 1OSDA 3I5AA 4R0JA 1N52B 2K2PA 1T9XA 2H5IB 4NCGA 4R5PB 1XMQJ 3R7BB 4QPXA 2XEXA 2MY8A 2XHWA 3NCPA 3T5KA 3JYTB 4PQUB 1T3OA 2HWTA 4E0DA 1C4AA 2ZBQA 3SCLE 4F04B 2PI5A 3VF0B 4JI6F 2GHVC 2CIMA 1D9DA 4TY8B 2W7PA 2BJ9A 2V8DA 3EJMA 4DFJA 4NLYA 4LFBF 2BE2A 4NI2A 2ZE2A 1XTZA 3KLEA 2BV3A 2LP4A 3GJQB 1FKAF 2EFVA 3NNHA 3TANA 2N4DA 4ECRA 5FIIA 3QRQA 2MEWA 2VHGA 1VQNS 5CYMB 1RWUA 3OSNA 1WOOA 3E01B 4Y3CA 2R7TA 2AEFA 2OTJS 1T9WA 4LFAF 1B70B 3AA8A 1RABB 4ZJQA 4DV7J 2OSRA 2XY7A 3OXGA 4X64F 3R5GA 1BQXA 2ZZTA 4OLPA 2CG8A 2KHDA 2R8GA 1CJVA 2XWXA 1IBKJ 5KFEA 4WIQA 2ZZNA 2WBRA 2XZWA 1V6HA 3GIRA 1SJQA 4FKXA 4I2QA 4NXNJ 1J5EF 1OY8A 4TYAA 1IM6A 2XZTB 2HZVA 1L3KA 2BRKA 5GAHU 2QMWA 3H5YA 1V3SA 3Q8RB 3ULHA 2JEJA 2E1RA 2V4JA 1RAGB 1H98A 3SDEB 5D0HA 1CSJA 2VV5A 4NLUA 1XEZA 2QL7B 5H9EJ 1N4LA 1RE1B 2F1FA 4DFKA 4F4KA 2XS2A 1KNZA 4NZ6A 5MAOA 3MMCB 2DHAA 4LRCA 4KY3A 3MEDA 1CJTB 4LF5J 2I9SA 3PIOQ 4F25A 2VDHA 3CDAA 1CC7A 1OQ3A 1S0OA 1U1LA 2E7VA 1SCJB 4OV1A 2D9OA 3M32A 2BJ3A 1M5HA 2R3VA 3M2VB 2IC3B 3KMSA 5H9EK 5EN1A 3DLBA 4M5DB 1G6BA 4CCHA 2NZ4A 2ZUGA 1PBUA 1TVRA 4USTA 2ZH3A 3I96A 2E1PA 3MTJA 4C48A 4OI3A 3DGPA 4TNOA 1MWZA 3H4BA 4KQZA 4RX6A 4IG3B 4A8QA 2I2YA 2N7YA 4LRBA 2EEYA 3DN9A 4AT1B 4PKDB 3J81U 4RU2A 1U1QA 3MAAA 1VRUA 4Q5VA 1SJ1A 2OMOA 3OQ2A 4JOUA 2ZOGA 1YI2S 4C8NA 1UAWA 1HQ2A 1WDDA 3HHLD 4QWAA 3QO9A 2DXFA 3JTNA 4DV0J 4NLWA 2YWHA 3HKWA 2H3EB 1IUJA 3MOZA 4GO5X 1PO6A 4QR2A 4FZVA 3CJRA 3G71S 4RW6A 4L72B 2XY6A 4USJC 1NKBA 2D41A 2Z58B 1FEEA 2Y8WA 2ZFHA 1NDPA 4B9NA 2B9YA 3QIDA 2KZMA 3GCWP 4I6WA 4DUZF 5T14A 1S1XA 2MJUA 4P2MA 3OTOJ 2NSBA 4LF7J 3IN5A 4HHJA 1REGX 1W2BR 5E3QA 2H5EA 1K1SA 1VDHA 1QM9A 1Y3JA 3MMAA 2XSJA 3LF0A 1N0UA 4WYWA 2J9EA 3ZXWA 4Y34A 4X84A 2WK4A 1DLOA 2XMMA 5GADU 3DI6B 3D1HA 1VS3A 1YG0A 3HCXA 1NH8A 2VQFF 2QLXA 1JLEB 4AUKA 4IRDA 4NZ0A 2F63A 3GSIA 1SJ4P 4J9NA 2RU9A 2ZM6J 3T1HJ 3HHKA 1B4SA 4FNHA 1ACMB 2HHUA 4B9SA 2BE2B 2PFDA 3K5NA 4HLBA 3Q83A 4WF9Q 4K4ZA 2BM1A 1NEEA 2M0GB 1WOPA 2UUCJ 2W8LA 4OYXA 4QWDA 3OHAA 2CPDA 2MLYA 2C2OB 4A8FA 2FVPA 5HAOA 1C1CA 5AJ3J 2M8DB 1RP5A 3TUPA 4PG8A 3SMZA 3VVTA 3IC1A 3JSMA 3D68A 2QC3A 4PWUA 4RWWA 4YB5A 2LVWA 1XBWA 1XERA 4PWDB 3PX6A 3ZZPA 5J2NA 1Q86T 5DDPC 3OUYA 5M2UA 1R0AB 1T03A 2QYGA 2R7OA 4WZQA 4DR7F 3IO1A 4Q2LA 3RJMB 3OD2A 2DNGA 4N7TA 3QJPA 3RRGA 1KQFB 1ZM4A 4C8MA 2X3GA 1KLMA 2K1RA 2J7UA 2VG7A 3TA2A 1S6QA 4DL6A 2D3OR 1N36F 1NK8A 2LQJA 5E2QA 3FEYB 2W24A 5EGYA 4EGLA 1H0HB 2PI4A 2J9DE 2OKQA 4OJHA 3EZOA 2CPHA 2LQ8A 4EWTA 2VG5B 2VL1A 1HBNA 3UWTA 1XN9A 4AXJA 5ITHA 3OTBA 2FGCA 3GPAA 3TVKA 3ZFVA 3MAQA 4KGMA 2KG1A 3IR6B 2ALZA 4TU7A 1C0TB 5EDWA 3M7VA 4HTJA 3BQ2A 5B7WA 2J6TA 3MR5A 2M3DA 1R6YA 5IWAJ 2ILZA 2RHQB 2YPYA 1TMJA 2GVZA 2YKOA 3KHGA 3CJ5A 5JVHQ 2G1HA 5SUHA 1P8GA 3M9NB 1TVRB 1NSAA 2GW8A 2VPXB 4PPDA 3OXFA 2Q6BA 2QSFA 2KYZA 4OJ1A 1CJKB 1TKTB 3R5DA 1ZBTA 3MCMA 2AYMA 5HMZA 2Z0GA 2V5HG 2ZH6A 3FEXB 3D66A 2V4QA 1T95A 1YWXA 2VBXA 3V6DB 1QSYA 3MCSA 2XCPA 1U7LA 3BGOP 3PW5A 4OX9J 1KS2A 1CG2A 2BZ2A 4NEZA 4LFCJ 1VQ7S 2FPHX 1NHVA 4EUVA 4O44B 1IKWB 3CCLS 2AW0A 3LP0A 1HBOB 1PJ5A 2AEJA 1TU0B 1KQKA 3NEKA 3NAIA 1KR4A 2HRTA 3LWMA 1R31A 4OYMA 2RQMA 4J9KA 5KFOA 1RHKB 3AOBA 2XGPA 4V1Ak 3CXCR 2KXNB 4ELVA 3VHQA 1HFEL 4TY9A 4MH8A 4L74A 3MR2A 5K8PA 2WVFA 5FLXU 3D2WA 1VISA 3RRKA 2XI3A 5D78A 2RKIA 1S1TA 4KGZB 1FNXH 2JEIA 3V6HA 1VC6A 3TQ1A 2AD9A 4UY8T 3FVYA 3AA9A 4RWXA 3GR1A 1RWKB 2FGOA 1RBOB 3JS9A 2CPJA 3DM2B 5HLFB 4RL1A 2IJRA 1D3WA 1NO8A 1C1BA 4DX8H 2VONA 3CJ8A 3ZTOA 4LF8J 2PC6A 1UA1A 3T1AA 4USMA 4WTOB 3MEGB 4B9TA 4I68A 2IJFA 1WWHA 5HI7A 2MQQA 4MFBB 4OJGA 2QE5A 4J90A 3BREA 4QW8A 1SV5A 2MPUA 4LMZA 3SIPB 3WC0A 1ULRA 1X4BA 2ZOMA 4IOCQ 1C1CB 5DZ7A 1T02A 2BBEA 1NK4A 2K3IA 3MUMP 2R8JA 4NLOA 4WZMA 1WEZA 3JSMB 2E9ZA 3AODA 1T7PA 2LQBA 2KRBA 4K4TA 3BM7A 4ZDNA 3N4WA 4M5GA 2B3TB 2V0NA 1RT5B 1M1KT 1WSVA 4ZJOA 3VGSA 2IHR1 2F8HA 5J2NB 2U2FA 5CAAA 1N34F 2OPSA 1XR7A 1FWPA 1P1TA 3W61A 4K4UA 1VK8A 5ETRA 4K4XA 4DQSA 1C0UA 1RI7A 5L39A 2MKIA 2BDPA 2FVRA 2K1RB 2GVDB 2VG6B 1VI7A 4YR2A 2VG7B 1HWJA 4ATNA 1RBLA 1MU2A 2KTQA 1RYRA 4JI5F 3GIMA 5CYQB 3BKFA 4M63A 1RAIB 5DG8A 1YQHA 4DV6F 2DHGA 1B0PA 1CJUB 3BEGB 1Q82T 3D6FB 3OR1A 4KSEB 1ZS6A 3U1NA 1T3NA 3MPDA 2MQLA 5DG9A 3QGIA 4LR8A 4P9SA 1GQEA 5A8RA 4P6QA 4AFFA 2FLPA 1RWXB 2YH0A 3HLUA 3SZ2A 2DR6A 2MKHA 1IBCB 4LRAA 2W2QP 1WNEA 4PXCA 2NLWA 4FBUA 3QLHB 1J5OB 3RW7A 1HMVA 4TKTA 1FRIA 4MT1A 3ZO7A 4WKYA 1U8SA 2I6WA 3T3FA 2P9GA 2QLBB 3M30B 1WEXA 4I69A 3OL9A 4NLDA 2AP6A 5LMUF 1VK3A 3H98A 3BDEA 5LSRA 2ATCB 3FUYA 3BDPA 4QU6A 3EVOA 4RU9A 3JAMY 3I82A 2QA2A 4LF4J 1YBTA 4O4GB 4AQYJ 3LTOA 3M9MB 2EI5A 2CJQA 1G4CA 1RQ0A 4DEZA 3LO3A 2V2QA 5KFTA 2H4YB 4NYPA 2OJ3A 3LP1B 5GVQA 2ZDPA 4O3OA 2IM0A 4ZHRA 3NAHA 1HIYA 4P7TA 4F67A 4KPYA 3W8PA 3N28A 5DM7Q 2B56A 1R6VA 4Y00A 3IGNA 1Y5NB 2YBVA 4LSNA 1LWFA 5IS2A 1HWKA 3FZBA 3BGUA 3BH7B 2MQPA 4PWWA 2APOA 1U1NA 1R0BG 3SSSA 4ED2A 1H7XA 1SKRA 3H4DA 3M8QA 4RNMA 2RDDA 2JEFA 5K9FA 2PMHA 5D3GA 3EGWB 1RAEB 5F9LA 3KLGA 4K0KF 2AF6A 5H1SV 2HLTA 4CO1A 4GKJF 4J9PA 4P2XA 1VQKS 5KT6A 2GHWA 2X1FA 2V94A 4JI8F 1AA1B 2FJDB 4ZPWR 2Q43A 4WIIA 2LECA 1X4CA 2E5LF 3SQOP 1EHWA 1P6TA 2OD4A 3NWGA 1WG1A 5KT5A 3W2WA 2XQCA 1HD1A 3VAFA 2JWNA 1U6BA 3FFIB 2PGCA 2CJBA 3MECA 2GC8A 1TTHB 3X3UA 4L3KA 3T6JA 2B4OA 1X5OA 4DR2J 2YX1A 2PD1A 1OO0B 3T9ZA 1SV5B 1Y00A 4DR4F 2C2EA 2ROPA 2UUAJ 3Q89A 3FSIA 3UCGA 5GAGI 3DOMA 1W7WA 4ZPVR 2EK1A 5JMNA 5I3UA 4ZLNA 4RW4B 3R5JB 4TVAB 3I9ZA 2ZH1A 2BANB 5SZTA 3NBPB 3FSXA 3KLIA 4YFUA 1XQIA 2WZ1A 5KOXA 2B8PA 3MMBB 2DY9A 3I4PA 2L9DA 4QIVA 1XJWB 1U0HB 2YKMA 3AQPA 3CIMA 5DQGA 3KLFB 4DSLA 2R7UA 2QG9B 2VPYB 3W7BA 3THVA 3D6MB 2ADCA 1C0UB 2DGQA 3U27A 3QQCD 4RW9A 2XB2D 3OV7A 2HZAA 4DV3J 1OQ6A 2QA4G 3KTQA 4PRFA 2L08A 4DN9A 5JJBA 3HPOA 4ZVSB 4Q44A 2D3ZA 1RCOB 1HL6A 3BGFA 3FGVA 4LIRA 2FJVA 4JI0J 3PHEA 1WOSA 4M5MA 5GMDA 4O23A 2DVIA 2YX7A 3EMTA 3O3LA 1AROP 3DHXA 1O6XA 3PYFA 3SCIE 4UZCA 5D0RA 5DGAA 4IR9A 4DR1F 5F8JA 3DFEA 2YWFA 2AZ1A 2DRBA 2IJNA 4B3MJ 2CRLA 3D3BJ 3MCNA 5THWA 3RU0A 3HX9A 2HRYA 3KYLA 2CNLB 2V9KA 2XNQA 1WF1A 3MURP 2LQ9A 2B9XA 2ZHAA 1HQEA 3HVRA 4LVOP 4F3QA 2QRRA 3ITHB 2R2SA 1FHTA 2M7SA 1VFJA 3K7RA 3OVAA 2UU9F 2HQDA 2R8HA 3GFHA 5ETMA 1HNWJ 2OPQB 2BJ7A 3G82A 2QN6B 4FF3A 4UQTA 4DR6J 4RW7B 4YY3F 4ED0A 4OI2A 2K3KA 5B0CA 1XMQF 2XWYA 2R2TA 1URRA 3I0SB 4JI2J 4CYUB 5MLCV 3QWPA 2KRRA 3DOLB 1RISA 3OPKA 2LQ5A 4EMDA 4KTQA 4MTPA 2KZZA 2NQPA 4CM2A 3UPFA 1PJ7A 4ZVOB 2V34A 4ECZA 2F4VJ 4LIWA 1FXRA 3D0HE 2DNOA 2M2BA 2I0XA 2WSEC 5HJYA 3HKZD 1DQ9A 5KFAA 1BD6A 3RBEA 1KVJA 2M9KA 3HHLB 4NYOA 2I5JA 1S10A 1KBRA 4HH0A 1AT1B 1VBYA 3G87A 1CPZA 3FMBA 3O5TB 3KUHA 1ZETA 3HMJG 2IA0A 2OPRA 3PZPA 5B0FA 4FDFA 4AD6A 1JB0C 2DXDA 2JC1A 1TKXA 3W66A 1S4FA 1IKYA 3GFXA 2RAQA 3UDVA 2FZGB 2ZJRQ 1Q53A 4RW8B 1VQSA 2JNJA 2DT9A 4IFYA 3M2RA 5JVGQ 2HVIA 1YBUA 2EXUA 2Z2YB 5KFSA 2GFFA 2ZC3A 1GMUA 4YEAA 1LK5A 2RH3A 4QIEA 3W9IA 1HQUA 4ECTA 3QYYA 1NSKL 4WCEQ 3JB9k 2UP1A 2XMUA 1NCLA 2Z2LA 3I56S 2WB4A 4N8OA 4B3RF 2HYIB 3MM6A 5CHCB 3N01A 4G1QA 3KG0A 1JJ2R 1N54B 4KE5A 4X4PA 2IMWP 1LWEB 4HACA 2VOOA 2BW2A 1RLDA 4K2XA 2C28A 2H48B 1MMNA 4ZCIA 2CNNB 2YXLA 3I4HX 1YX2A 2V2KA 3ZZZA 2D3UA 1N33J 1NZ8A 4WWSA 1L3VA 2WW8A 1OYEA 4ZN3A 5D4OA 3MTKA 1FNMA 3K8WA 3QT5A 4DXLA 1U8WA 1K1QA 2CZ9A 4FF4A 1OY6A 3TO8A 3W9HA 1IQTA 2HLUA 4FYXB 3PJWA 4OI0A 3M2UA 3GIIA 2PO4A 4LBPA 1JKHB 4ILRA 4C3MA 3RBZA 2CXEA 1Q7YT 2IYIA 4D3GA 1H2TZ 3EGZA 3KG1A 1CLFA 2EWHA 2ADBA 1NH7A 2RS8A 1S72S 2IDEA 4FXVA 4WTYA 1U49A 1T8EA 4CNZA 3I0RA 3N9UC 1K9MT 4G6VB 1U1MA 4IRCA 1RT6B 4LSZB 1S7IA 1QJHA 2P5VA 4LREA 2NXNA 4DLGA 2R2UA 4J9OA 1VGYA 4OIXA 3RUBL 4CLZA 3BO4A 3T1YJ 1LQ9A 1RTHA 2CWKA 1FE0A 5FDLB 2YY3A 3R5CA 1NXIA 3HVWA 2L9WA 4WP9A 2HG4A 3OR2A 3VVUA 5EWEA 3W9JA 4CTAA 3WBZA 2YX4A 3C6TA 3NGRA 1L3TA 2GMHA 3J7YU 1WSRA 3HF5A 4ZPTR 3ILLA 3ENWA 2CJAA 5J1EB 1UVLA 5KFDA 4NXMJ 3BYRA 2R8KA 4NASA 2DHXA 3LALA 3CCSS 3GV5B 3B54A 3HZGA 4DOZA 3MM9A 3KHLA 3UCZP 1WJ9A 2DCUB 4DG1B 2VBYA 1SC4B 3UI3A 3TAMA 1YGYA 2YNFB 4X66J 3PDNA 5KG6A 1VQOS 3DCAA 3UN5A 4DV4F 1R43A 4LJMA 3MEEB 1GEHA 3C8YA 1KHWA 1HA1A 2NXJA 1NSQA 3VALA 1HBUB 2E5JA 3RBXA 1YZ6A 1RT1A 2J76E 4ZP8A 4OL8A 2XY5A 4TLQA 2HWIA 1RT4A 2FJBB 3ZNUA 1RSCA 4M5IA 1E6VA 3W2VB 1OY9A 3NMRA 3G8TA 1VIXA 3AQOA 1VJQA 2UXCF 3CCMS 2KHCA 2LKZA 4ZKAA 4OLOA 3DLGA 1SC1B 2BA9A 2MQ8A 2J0WA 1XMOJ 3R1HA 2EC2A 2JX2A 2XMKA 4TQRA 2ZBPA 2KT2A 1VQYA 3M6WA 2XO7A 3L09A 4Q43A 3NS7B 4ELUA 1BLUA 1YKWA 4KGXB 4CLSA 3T9NA 3GE9A 4FXWA 3BSNA 3RB3A 3KJNB 3BBCA 1B99A 5HANA 2HNYB 2P9CA 4GVBB 3AD9C 2WHOA 3M2RB 1E6YA 3QNWB 4NMLA 5A2QU 1KD1T 1RTZA 4ZVQB 4DSFA 3KXDA 2YNIB 2AJ0A 2J6UA 2K8GA 2DO4A 5LJ5Y 3HD2A 5HL7Q 1NJIT 1DFDA 4ECQA 1NNDA 3KLHA 4IOAQ 1DTQA 2PEHA 2W9AA 3TP2A 2FHOB 3B6BA 4CO4A 2H51B 1Q16B 3WZ0A 1PAEX 1S1WA 4DR3J 3FZ2A 1SL1A 4HDHA 3DHWC 4JI3J 1Q4RA 4GC6A 3DKDA 1IM4A 3GJTB 1Q78A 1X4GA 4ES2A 3EM1A 2GJ2A 3QIPB 1XNRF 1WDTA 3CJKA 1M1GA 3DRSB 4RLEA 3B82A 1YK9A 1RTJA 2BYCA 1LW2B 1FJ7A 1PSDA 2VQEF 5CABA 4X62F 2ZHOA 1U09A 3LGMA 3AOCA 3M2UB 3EX7B 3NGSA 4QCLA 4P2SA 2H65B 1F5AA 4MYUA 3H2VE 1X5SA 3VTIA 3SI8A 4Y2KA 2PA8D 1FWLA 2FZCB 4MKVA 4DV2J 1JWWA 3WIUA 3H2LA 3D7SB 3IRXA 2OMLA 1RGVA 4CH0S 1N32F 4ECUA 2O66A 3QMQA 1F1BB 1Q5YA 5IM0B 4QZVB 1EB0A 3X1LB 2HQGA 2M8HA 1X7VA 1PILA 1HNZJ 3BPDA 3HFZB 1FKOB 4KO0B 2O5DA 5I3QA 4USIA 4BBYA 3G4SS 3M1VB 2RS2A 4G65A 2YWKA 1F60B 1G3OA 1UCNA 3NRBA 2HGNA 3V2UC 4OHVA 2DRDA 4Z2XA 2LXUA 2NSCA 1PG5B 2Q3PA 2HPUA 5J2PA 2H1YA 3LPEA 2IIHA 3RZAA 2K7JA 2OTLS 4KYZA 2VA2A 2XNRA 1DTTB 2L41A 2AX0A 2G2OA 2OSQA 2Y0SD 2RNEA 4YS2A 1XNQF 1S9EA 1HD0A 2HMIB 2YQ3A 3VAHA 3I31A 2X1AA 1CULB 4F3MA 3IA0A 4ELTA 4YMEA 1YJ9S 3IWNC 4IDKB 4CO3A 2AWZA 2XMAA 4DLEA 3NG8A 5C2GA 5KFCA 1RB0A 4FN5A 1RT4B 3Q22A 5KT3A 3BJYA 4UQGA 2DITA 3CPWR 1T9TA 2CDRB 4FP9A 4Q0BA 4IFVA 1PC5A 3V81A 3UNGC 2BE7D 3GP9A 2EW9A 3MZIA 2VFVA 2GNKA 1P27B 3DLGB 4ALZA 2ASJA 2B5JB 4C11A 4OHZA 2HNZA 1ZOTA 3DU6A 2JSXA 3W5YA 2HHSA 4I56A 3KJVA 2XC9A 3Q23A 4FKYA 1FI4A 3SBMA 2V67A 1N5VA 2WONB 2HHHJ 2D69A 2XG8A 3PW4A 2WSCC 4I0WA 4QYRA 4KHRA 5K5MA 4DCOB 2CQDA 3K5MA 3CO9A 1HYSB 2BQ3A 5BR8J 4DV5F 2VOPA 4G1IA 3SSRA 3D0IE 2AGPA 3L7OA 3PXGa 1QVFR 2ZC4A 4PG5A 1UVNA 4F4WA 3POTA 5GAHI 4JI1J 4NLTA 2BQRA 1S1VA 2CPFA 3CCZA 8AT1B 1X4EA 2IYGA 2RF2B 5IFMA 3NL0A 1MNEA 3HI9A 3HHNB 1IBLF 1Y0HA 2G13A 5DG7A 3UD3P 3AT1B 1JLBA 2WVBA 1FVSA 5F0WA 1LWCB 2FC8A 2MYFA 4H4MA 1NK7A 2DGTA 1KTQA 1TL3A 2AYEA 1FFSB 2ERRA 3B78A 4RO0A 2A0FB 3LUYA 2ASDA 1RU1A 3NXZA 1QAIA 2ZH9A 4LSLB 3SQGB 4XIUA 2YTCA 1U48A 5BYRA 3MMJA 1RAJA 1UPPA 1FDBA 2IPOB 2HHPA 3DYAB 2VUGA 1RT2A 2YQ1A 2RU3A 4JYAJ 2ZJPQ 2B8QA 4J9UE 2AT1B 1RT3A 2DCLA 4F3OA 1N6QA 1KQSR 2PEBA 8RUCA 1VCTA 1HNIA 3KK1B 2GS8A 4PXBA 3T5LA 3KOAA 1IJEB 3PHTA 3IRXB 2B6AB 1A9NB 1UP1A 2MGZA 1F9FA 1TKZB 4O3NA 4WE1B 4X4UA 5DGBA 3EUNA 5C24A 4I2PB 5GAEI 2ZBCA 1CEZA 1REVA 5F8MA 2ACMA 3RAQA 2RDIA 2RHSB 4EO8A 3O1LA 2RSQA 3EYZA 2UUBJ 2IDLA 3VR1A 1I1GA 4NL5A 2X3DA 3FMWA 3MUTP 2M88A 4X65J 3AXKA 3BSAA 3TX8A 2WVCA 5KFFA 3C6UA 3IRWP 1FFWB 2IAJB 4BC7A 2V2ZA 4NCBA 1EX8A 1ZYQA 4AYBD 2LFVA 2E9RX 2YQ0A 4OZ1A 1LW0A 3HFVA 4JV5F 2BKPA 4TN2A 2ILYA 4K5RA 1FE4A 4ZVTB 1N5YA 1XR6A 4KHPJ 3PG9A 4DZDA 2FUG9 5F8LA 2G4BA 3GYXB 1RTIB 1SH2A 1S0MA 2HSEB 3NGUA 3OTDA 1SC3B 2O1PA 5GADI 2F7VA 1Q81T 2F4FA 1S79A 2WOMB 2BOPA 3MR3A 1FD2A 5KFRA 1RACB 4IG0B 4R5PA 1KVIA 5AXNA 4DUTA 4A8MP 3JYTA 4PQUA 1S1UA 1NPRA 3I5CA 2GGPA 3MM8B 2GAHC 5J2MB 2J8SA 4OZ5A 4JI4J 2ZBRA 2YH1A 1OMSA 3US5A 3CIZA 3PCOB 3QBCA 2G2ZA 5T7LB 3CJQA 1D8YA 5DO2A 1SI9A 5D15A 3CJSA 3S01A 4TY8A 5A8WB 1RT7B 1WI8A 3ET6A 4WP3A 3DLEB 1MSWD 2NPFA 2HFOA 3MM7B 4GVLA 5DLGA 4HT5A 3R6LB 5A6PA 4WK1A 4M5JA 3HM9A 5D8HB 1IBMJ 4CP5A 1S6PB 9ATCB 3KK2B 1S9FA 2MKYA 3QJJA 3SFUA 3NWRA 1YLXA 5CYMA 2FHJD 3E01A 3KJVB 2EBEA 2J5AA 3M6UA 2W8KA 1Y3KA 1MMLA 4IQMA 4USKA 4X4VA 4PABA 1M90T 4QYZK 2AJQA 2WSFC 1WF2A 4OI4A 3EWGA 2BM0A 3CCVS 4Q8FA 1MN9A 2LA4A 3CCTA 5IT0A 1NJWA 5KG3A 1HI1A 2UVRA 2DHHA 4B3TF 2MMYA 3CGIA 3CC4S 4F0HA 4Y0FA 4W98A 4ANCA 4JI6J 4OYBA 2ROGA 2DISA 3I32A 3SDEA 4DV3F 3DLKB 1TUWA 4C0OC 4O3RA 1Q0NA 1UVKA 3R27A 2ATLA 3R7NB 4TXSA 1JLBB 4YN3B 2FLLA 4F26A 2V6AA 4ZP7A 2LXFA 3MMCA 3AH6A 1IR2A 4OYIA 2HNDB 4FF1A 1WHVA 1RBAA 1CJTA 1QSSA 1GTHA 1B64A 4BWMA 1ZAVA 1VQ9S 1YJWS 1YJUA 4LFAJ 2UV8A 2HAFA 4DX6A 3QZ7A 1ZM2A 1CS4B 4NRTA 1QTNB 2W25A 2J6SA 4X64J 1BWEA 2CZ4A 3DU5A 4QWEA 1JLGB 2I1RA 5D77A 1FESA 2J0XA 3M2VA 2IC3A 3HXMA 3S8SA 4M5DA 1EP4B 4U9RA 4C8KA 2XYPB 4J9MA 1WC6A 2A6OA 5HQ8A 1LKZA 2LXIA 4PCQA 1J5EJ 4WXOA 5B0AA 3TA1A 2FJEB 1J2VA 2CQ0A 1DHMA 1Y11A 3DLLQ 4OI6A 2NCKL 2B51A 2XM3A 4IG3A 2DR9A 1HNIB 4RUAA 1FTCA 1RWMB 1JLFB 4BLGA 1RWWB 5DDRC 4CO0A 2A18A 4IH5A 1VQMS 1IJFB 1FJCA 2DGOA 4Q45A 3ENQA 3GU0A 3VQSA 2D7SA 3ICLA 1FJEB 2MZSA 2HHQA 1NK5A 2VH7A 1F6TA 2W1BA 4YDDB 4JUZA 2CJKA 3O8WA 3WQPA 4KKOB 4N41A 1YRXA 2HK2A 1NRKA 1GT8A 2XLIA 3UW1A 1FF2A 3R3TA 1HPZB 3DOKB 1FJGF 5B0BA 3PYDA 4LVNP 1H38A 2M5YA 3K59A 2OFGX 4B02A 2ACYA 5A76A 1IR0A 5LMNF 1NB2A 4OX6A 2BEFA 5HP1B 1TK5A 5L1KA 3EGNA 4J9LA 4LF6F 1MWYA 4H4OB 4CRJA 7FDRA 4B17A 1M0SA 1M5OC 3NS5A 4F4XA 3IM8A 3THPA 4B3OB 3IP0A 5E5NA 1S12A 2DY1A 3DI6A 2ASYA 5I4MA 2IBOA 2DNKA 1BGXT 1KTVA 1OSCA 1S1UB 4RNFA 2GGPB 4JP8A 4ZMMA 4ANEA 3PYEA 1JLEA 4DUYJ 3BBBA 3W64A 1BXNA 4BS2A 4LRDA 4YR3A 4Y28C 2NYIA 3J7AN 2JZ5A 3ET6B 2FVQA 2W7OA 2JEGA 5IQ6A 4USUA 3PEJA 4WPAA 5E3CA 2COLA 4NEYA 1K73T 3CSKA 1GFWB 5DS7A 2DB1A 2R7WA 4F4AA 2NR0A 2LDIA 4DUZJ 1KKHA 1GX6A 2KM8B 1IVZA 2FLNA 4Y2IA 1NKEA 1SKWA 4NLVA 4ZVPB 1JNRB 2QA1A 4ED5A 2PA3A 4MYTA 1KLNA 4ES3A 3FSYA 3TZXA 4HYKA 1RWPB 2UZAA 1Q1KA 3IS9B 4ZVEA 3EVMA 1H2VZ 3K0JA 4ZPDA 3TUIC 5H9FJ 4PWDA 4FNIA 5HSPA 2VQFJ 4KB7A 1R0AA 1PYSB 4K2JA 2LMIA 4ECWA 1B0TA 4WFBQ 2C2ZB 1EZZB 2KYXA 2E29A 1H3DA 3U1MA 2W9BB 4OYWA 2XHCA 3EGVA 4E2FB 3P8BB 3RAMA 2LU2A 1TV6B 5HVFA 4OZLA 1ZPWX 2D1CA 4DN0A 1I51B 2W2NP 1NPKA 1OPZA 2HHTA 1YHQS 2CNOB 1WTBA 2MZRA 3FC9A 2R9LA 1FA0A 1JLAB 4N56A 4ZPAA 2AGOA 2DPJA 3JQKA 5C42A 5EHHA 2CQ1A 4X4OA 2LYVA 3VAJA 4DPUA 2P6SA 2VG5A 5CCLA 3U1LA 2E7XA 1SH0A 4DS4A 3C3LA 2XMJA 4EFAC 2CDQA 3BBFA 1IN0A 2CQ4A 1BQMB 3GWCA 5D4PA 2XGQA 2QYCA 2QTWA 1EAYC 1C0TA 2YWEA 2ASLA 1SQFA 1OJ4A 2DKOB 3A8KA 5K20B 3E3XA 2ZEJA 2ZNYA 1U4BA 4A4JA 1TUVA 4Y65A 1HARA 2MDAA 5DRKA 5KFPA 4DR7J 3BR8A 3GMGA 5B09A 2G0JA 4B3SF 5RUBA 1BHNA 1CJKA 2OD6A 1TKTA 3FJ2A 2ZHBA 1OWXA 1YJNS 1RHMB 1RUSA 3BKTA 1N36J 1TZ0A 3V6DA 2O01C 3QZ8A 4XK8C 2V8PA 1TK8A 2PSZA 1R27B 5GAEU 4KAIA 1VLOA 1YJ7A 5KFHA 1JLCB 4O44A 1IKWA 3NNAA 5DZ6A 4MIBA 2DIVA 2HBZB 3L7UA 2DNLA 1O8BA 1HBOA 4AXIA 4P2FA 5F8NA 2HVZA 2QIFA 2GQQA 1FDNA 3SV4A 1U6ZA 1Z2LA 2IM1A 2VPWB 1WKLA 2HW3A 2KVQE 2C1EB 2PIIA 2HEKA 2F3JA 2BQUA 2GAGC 2M4MA 1T05B 5KFJA 3F0NA 4CWBA 4CQ1A 3ENVA 4DFMA 2ZKUA 1EARA 4DL2A 2MKSA 4RNNA 3IR5B 4C7QA 2ZH5A 3CD0A 4I7FB 5D0GA 1OPIA 2KVIA 1F2HA 5ETQA 2QL5B 2GA7A 3C66A 2UXDF 1EKSA 2OAUA 4OHWA 2UVVA 3PW0A 2ZUAA 2Z56B 3DM2A 2B9WA 5F3TA 1LXJA 5HLFA 1AZSB 1DQAA 1SKUB 2LEAA 1VOMA 1GNKA 3Q0AA 2L9NA 3BF4A 3A8JA 4NLGA 2VICA 3MEGA 3HSZA 4R0EA 3NP5A 5ETLA 4MKAA 4MFBA 3VZIA 4N77A 5I42B 3HDSA 1UFKA 1LXNA 4DL4A 3RGIA 4NLRA 3TWZA 2GMLA 5IT9U 2J9DA 3C16B 4ZLLA 4DR3F 4EO6A 5KT4A 4U95A 4M95A 4XO0A 4CDIA 3L4BC 1PIEA 3VV2B 2UXBF 2CUYA 4FS1A 4YHHF 4NPOA 3V6JA 2J9CA 4FBTA 2FIUA 3M4XA 4I6YA 2I8EA 3IG1B 4ZP6A 1RT5A 1W2IA 2XULA 4NLSA 4KIAA 3OHBA 1SUQB 1JXLA 2MZJA 1FKPB 4ICLA 1VBXA 1XWLA 2JLFA 5KTQA 2HQFA 3CUNA 4DQQA 5CCMA 4EBEA 3OXLA 2C3MA 1NHUA 3J81Y 3BO2A 2ABYA 3LPYA 2GVDA 2VG6A 3LQVA 2AJ2A 3RW6A 1FD8A 4Q2MA 2GO9A 4B9LA 1RKJA 4UOHA 2UV8G 4X4QA 5CYQA 3LP2B 3MM5B 2DBBA 4BC9A 3D0GE 4DU8A 1CJUA 5C42B 3WX8A 2WVEA 3ETOA 5A6WA 3AAWB 3IBCB 1FRKA 1D9FA 2WRMA 2K06A 1UL3A 1DZ5A 3DMJB 4WFAQ 2JHEA 1CQMA 2Q6CA 5K8OA 2AIRB 1BQNB 4EI2A 1RTDB 1HI8A 1A7GE 2PDAA 1DY3A 4CLKA 4C8LA 3QLHA 3UO0A 1J5OA 2AV5A 3H2UB 3GILA 1S76D 2OPPB 2XMTA 3KJQB 2KO1A 1N34J 5L1IA 3H90A 3M30A 1X4AA 3GCXP 4PG4A 1FWKA 3Q8QB 2C2NA 1TQLA 1HLWA 1HWIA 4GKKF 1HBMB 1D8ZA 2DH9A 5C5JA 4DPYA 2Q79A 3MI7X 4LF9F 1EJ7L 5L1LA 4AL6A 4DFPA 1WC0A 4DX7A 4JI5J 1YTYA 4O4GA 2HHXA 1NDLA 4OYAA 3UR3C 4DV6J 2HVHA 2QO3A 2FY1A 3T5JA 3TZYA 3LP1A 1VMBA 1HR0F 3QWUA 1X4DA 1WHWA 3BQ1A 1C2PA 3HVAA 4NOHA 3DRYA 4YB1P 3HSDA 2HFZA 4N47A 3IMQJ 2V68A 5GMEA 1GXUA 4OYZA 5K8MA 4FYDA 5IV3A 4HL9A 1MW7A 1WKJA 4ZS6A 3ISNC 2CJYB 4W4MA 4QOTA 5BXIA 1S99A 4ES1A 4QIFA 3TQEA 4P74A 1BY9A 4RZRA 1GXLA 1PAUB 3FBBA 3M05A 5LMUJ 2DR5A 3BGRB 1JK9B 2G1DA 3HZEA 4NA1A 3LH2S 3P4UB 1A0OB 3PJ9A 2JLGA 2YKNA 1LFPA 4F7VA 3R2DJ 3GYGA 4NYZA 4U7CA 5CD4A 4IH7A 2E5IA 4GC7A 2DGXA 2XO6A 3ZTSA 4O4RA 2FDNA 2VC0A 3FFIA 2UVUA 2HGLA 3KK3B 3CD6S 5D4LA 3D4JA 2R7RA 7FD1A 5U47A 1SBRA 3LGHA 2EVZA 2DNYA 1XIQA 2G0CA 2QT7A 1VBKA 3R8YA 4DZ6A 2FB0A 3OW2R 5E0OA 4RW4A 3OSPA 4F02A 2BANA 2XMWA 4ECVA 3NBPA 3D1QA 1GMVA 4DR5F 4K0KJ 1FT8A 5J2QB 3AB2B 2N82B 3MMBA 3CWJA 4GKJJ 2KFZA 3W1YC 1U0HA 4JI8J 4P71A 3RB6A 4ICLB 3KLFA 3K5LA 4AE5A 4QR0A 2E5LJ 1NKCA 3W5XA 1U1RA 2EFQA 3HT3A 1WUUA 2ZVSA 1UWAA 3DC2A 2WW4A 3K2YA 2KM8C 2OLWA 3J7ZT 2D74B 4LRFA 1K0VA 4ZLPA 1TKDA 1VRQC 1FFGB 1RCXB 2HS3A 2O3DA 3CCUS 3R7SB 2E5HA 5ETVA 4DR4J 5IQQA 2Y3YA 2CPXA 3AJDA 3QFWA 2K7KA 2DHSA 2YNHA 1HNXF 4KGVB 2NYHA 3P45B 3TJ9A 3UVJB 5LT5A 5HROA 2DXEA 1GX5A 4C4WA 4HDGA 2IVMA 4OZNA 4ED3A 2M70A 4DL7A 2W9CB 2VKZG 2YPZA 1YIJS 3C2PA 1LOUA 1PKUA 2DNRA 4ETZA 2IRXA 3M6VA 3UE2A 4UZBA 1IKVB 1C4CA 5FLXY 2YKPA 3J7YI 1UZDA 1VLYA 1S97A 3RR7A 2IM2A 1UFLA 2VFUA 3PX4A 3A12A 3ITHA 3MD3A 3ILIA 1JX4A 4I6AA 4G1PA 1QUVA 2V9WA 2DEIA 1WC3A 2AHOB 1HNVB 2OPQA 4A8OA 1LV5A 4CI0B 1X4FA 4CLPA 3VCDA 4RW7A 1UVIA 4FYVB 4K59A 4B9VA 1FEHA 1LEOA 5KG5A 2HFVA 1SJ3P 3I0SA 5B0GA 3MWBA 4JI7F 3OLBA 4CYUA 3DOLA 3KUEA 5KFZA 4RNHA 3TR5A 1KEKA 4ZVHA 4U67Q 1FO1A 3O2IA 3UDEA 3CJ0A 2HBRB 1EETB 4DQRA 3RR8A 4DR1J 2GQCA 4DL5A 2WAQD 5AE2A 2ZDOA 1TUGB 4S0MA 5LM7E 5A0YA 3MHYA 1IKXB 3I6PA 2RUGA 5F8HA 3BS9A 4TYBA 2DO0A 4WBFA 1NM2A 1FRHA 1IBMF 2FHKA 3HHLA 1TL1B 1A6LA 1WF0A 1P9QC 5E3PA 4RBUA 3H40A 2NZCA 1Q5VA 3GQCA 1U2CA 2UU9J 2XI2A 1S0VA 2VU5A 4IQXA 4EYIB 1NMEB 1N5SA 3HSJA 4ECXA 5ADZA 4Y2CA 2DIUA 4PZVA 3DRRB 4A8YA 3PR4A 2FVCA 3M6XA 4YY3J 3LAKA 2YKNB 4CIOA 4ID5B 2C42A 5B08A 1H2UX 5HVHA 1ZM3A 4RW8A 1U47A 3ZC4A 5D6GA 4R8UB 2JDJA 5LOQA 1X5TA 3MGJA 4QU7A 1URNA 2L3MA 2FJXA 2X51A 3RTVA 3EXYA 3DRPB 1O51A 4PPZA 3QAEA 4X4RA 1RWVB 4J37A 2VBZA 1UWBB 4OYPA 1ZH5A 3KUGA 1JIHA 2VJVA 1TAQA 3VAIA 3FQKA 3NNCA 4RBTA 4DF4A 3L9ZA 1UEKA 5T41A 4X4TA 2E1CA 1AUSL 5AXMA 1LWEA 1YITS 1FERA 5A8KB 4H4KA 1N88A 1FNOA 3ELHA 4R25A 2RQCA 2DK2A 4A8SA 4ECYA 2N4CA 4ZCKA 3I55S 3D6HB 3MF5A 1YJVA 2OEMA 2UUTA 4IOBA 2F65A 4K4VA 2Y8YA 1D09B 3MR7A 2CWXA 3B8HA 1UEUA 1K8AT 3N79A 3G8SA 3GG1A 1JKHA 1FK9B 3RRHA 3W62A 1APSA 3KHRA 2EK6A 3G9CA 3JSRA 2HIYA 5L46A 1X8DA 2NUUG 5DM6Q 2W01A 4ZVGA 2P2CB 3KHHA 2HAIA 3V4MA 3NLCA 3A13A 3C14B 2QMUB 2YNHB 4NX9A 2DTJA 3ZZUA 4X2BA 2EPIA 5HROB 4B3RJ 3CMES 3CCRS 1NSPA 1EIYB 1RT6A 2P8IA 3R6GB 4MKYA 3R5BA 1EQMA 1SQEA 1I94F 1M5KC 4FF2A 1TMMA 2CQPA 4F8RA 2CA9A 3A3PB 8ATCB 4CLTA 3M8YA 5FDLA 1MROB 2KKHA 1VRTB 4IYQA 4GO7X 3LW5C 2R42A 4KV8B 4CZCA 3HJFA 3TRGA 2HVEA 5HBMB 3D54A 1NUEA 5J1EA 1T9VA 2DPIA 1V9OA 3L7PA 3H7HB 1OYDA 2QV6A 3AD7C 4O0IA 2HHWA 3EDRB 3D28A 3AD8C 1TAUA 4LR7A 4LF2A 2YNGB 2HGMA 2L48A 2ZH4A 2B7CB 4XDCA 4DG1A 5KFNA 2MTLA 3AY0A 2YNFA 4K5SA 2B7BB 1RWOB 3N0VA 3PV8A 3PFOA 4Y2MA 5K14B 4RKUC 3LAMA 1KFSA 3Q2SC 1PGZA 2ZD1B 3MEEA 4FS2A 2QFIA 4DUYF 4LUBA 1RJJA 1HBUA 3D9BA 4CO2A 4PQAA 4YOEA 5G0RB 1H74A 1YSJA 4CNYA 4RJVA 4ZCMA 1UVMA 2HBYB 1UMJA 2RT3A 5A0YB 1RAAB 4HHHA 4URGA 3W2VA 1PJ6A 1VC0A 3CCJS 3UDLA 4IRKA 5KFVA 1FDDA 1JLQB 4L76A 2J8AA 3CDWA 1Q7LB 2JVRA 3UD5A 1S9GB 3GTYX 1S77D 2VFRA 3U7JA 2KH9A 3DDNA 3I87A 2A3JA 1WG5A 1VBZA 3TAPA 2OEKA 1U02A 4DV7F 3R1LA 2G9OA 1YJTA 2BJ8A 5AE3A 2F8EX 2KN4A 3EDQB 1PYOB 4Z7CA 2HNYA 5HATA 1FX4A 4NCGB 3KJFB 1IBKF 3P6YC 1JXEA 1IR1A 4GVBA 2BXJA 4DV4J 4NXNF 2U1AA 1NDCA 1VQPS 2BOAA 4WFYA 2AJ1A 1MWQA 2CVIA 4OQJA 4YQWA 4M5HA 2YNIA 3UFCX 3CC7S 1TFYA 1SB6A 5IXUA 2CJ9A 5IOLA 2Y1LB 4C0BA 1KQGB 4FVCA 3VQTA 3GIJA 4NI2B 2ZE2B 2CNKB 4UOGA 4B08A 3KLEB 4EYHB 4F2RA 1HHTP 2X1GA 2NXCA 1QAJA 1BMQB 1WC5A 3OJSA 2UXCJ 4P73A 4U7UD 5HO4A 3CCWA 1KFDA 3W8GA 3N6MA 4KH0B 1F2GA 2KB2A 4F0MA 4LF5F 3PO5A 1KVKA 4CH7A 2KU7A 3NY0A 4A48A 2J7KA 2I38A 3QIPA 5F3ZA 2AYBA 3DRSA 5DDQC 1R8CA 3GFYA 3OFEA 3RBDA 1LW2A 4QR1A 1RHQB 3K8VA 3H5UA 1CJVB 3H42A 2C2DA 2EG2A 5ETPA 4ZIVA 2XLKA 4EZ6A 4L73A 5KOWA 3V4IA 1U1OA 3FCHA 4I2QB 3QATA 2XBPA 3PRDA 3KNGA 2ZH2A 3ILJA 3NOCA 2OFHX 5KFBA 2GIQA 3OT9A 4ILMA 2V4JB 4DV1J 2QLFB 3MXHP 2EFGA 3H8YA 1X4HA 1F5CA 2JFKA 6FD1A 2RRNA 4M1KA 1PCAA 2MSSA 3BPSP 2G0IA 3LOUA 1D1UA 3BH6B 1NU4A 2RB7A 3CMQA 3RG6A 4DV0F 4C8YA 4U96A 5CZVA 3FBFA 3M8SA 3MEDB 3DDIA 4HT7A 3MPYA 4DPWA 4TLRA 4CLFA 5IM0A 3QT8A 4NLPA 2FD2A 4Q8EA 5KG1A 1FKOA 4KO0A 1XNRJ 4ERDA 1O5JA 1JXVA 2V2VA 3QGGA 4DL3A 5KFWA 3RAXA 3OFGA 3M1VA 3TYTA 3M32B 2C3YA 4ZVRB 4J91A 4K4WA 4QQBA 3BN7A 1J27A 2VQEJ 1T9UA 2FC9A 3OTOF 4KGKA 3CVKA 4X62J 4LF7F 2A2CA 1NJYA 2DR8A 2B0GA 1FXDA 1IQZA 3OLAA 2FVSA 2CQHA 3N6NA 1DJ0A 2KJWA 4ZPCA 3CC2S 2D3O1 5CA5A 4I4BA 3TEHB 3DGPB 1T0TV 2AGQA 5EX0A 4J9RA 1DTTA 4RR5A 2GMJA 1FRMA 2IVFB 1S48A 2AQ4A 2EBGA 2HMIA 2NXEA 3MAAB 1VRUB 1CULA 3HD1A 3M8PA 2FQQB 3QRRA 1H72C 2ZH8A 3QO9B 1R0CB 4IDKA 4KFBA 1N32J 3G86A 3PKMA 3TI0A 4PXEA 3P5TL 4F4YA 4CT9A 2ZM6F 3T1HF 3DRXA 4RW6B 6AT1B 3D1OA 3BGLA 1SH3A 5M2PA 5HN0A 5IZHA 5E7OB 4DMZA 1QSLA 1ZZFA 4FPRA 3K89A 2UUCF 5JUMA 5C25A 3OFFA 4DPOA 1S1XB 3GONA 2B5JA 2CQBA 5KG4A 4CLYA 1R8BA 4A46A 3JXOA 4ZVUB 5AJ3F 2YKQA 2E1MC 2RRAA 1JJCB 1ZTTA 1LK7A 2G2YA 2RJZA 2D9PA 2NS1B 3MMAB 3Q8PB 2XSJB 3GR0A 5HMXA 4AL7A 3I5BA 2J0QD 2BJDA 1AUDA 3E51A 1NAQA 2WONA 1JNZB 2A10A 3NS6A 1DLOB 2LEPA 2BKOA 1XNQJ 1GXTA 1Y10A 2CQGA 2Z2ZA 5ETOA 3A3NB 3A8IA 3IAS9 1HYSA 3JAMU 1N48A 4D3HA 2DNPA 3Q8VA 3M8ZA 2VJUA 3N5BA 3WHIA 3LA0A 4WU2A 2BR0A 1TL7A 2JLEA 4RUCA 3VAGA 2RF2A 5AT1B 1FDAA 2JRSA 3C19A 4PUOA 1G2EA 4IUFA 1MLAA 1UPMB 2FJAB 4USHA 1UETA 1LWCA 1G1XA 1FVQA 5DJBA 1RU2A 4H54A 2EFOA 4L3NA 3ETMA 3E2EA 1HWUA 4B9UA 4N76A 1WI6A 1VR6A 1YJRA 2NPIA 4LSLA 3CE8A 3SQGA 3PX0A 1ZAWA 1U24A 2GV1A 2EG1A 3KFWX 1SJRA 3A8EA 5F0UA 1JJHA 2PMWA 5IWAF 4NA2A 3ZTRA 3V4IB 4C2MA 5ETSA 3MFIA 3OUYB 4DV5J 3DYAA 1T03B 1U0SA 3F44A 2DNMA 2FLOA 3KDNA 2J7WA 3PTWA 3P49B 3KLVA 2AEMA 5F41A 4DCJB 2OHDA 1UKUA 3PW2A 4KRWA 5JXSA 3ZZ0A 1KLMB 3NOGA 2BUNA 1S6OA 2AZ3A 3KK1A 1S6QB 3S6EA 1TK0A 3F73A 3GIKA 4ZVFA 1RLCL 2B6AA 1IBLJ 4Y6IA 3OL7A 4JV0A 5DQIA 2XCAA 4M5KA 2PFFB 1TKZA 4WE1A 2RQ4A 1QY7A 4U8YA 4OX9F 3PR5B 3QT6A 4I2PA 4YDXA 4Z37A 5KFIA 1SKSA 5KFMA 4LFCF 1HBNB 4DSEA 4DPTA 3ISZA 1X9SA 3GJSB 4UF4A 1UW4A 1Y9OA 4RPFA 4NLXA 2Z4PA 1MG7A 4ZP9A 1D9AA 1G7CB 1KHVA 4UY85 5LSLA 2IAJA 2MLZA 4HEA9 4C97A 4EBDA 1N56A 4ENOA 2GVZB 1VC5A 1BE4A 2VF3A 1SXLA 1S4EA 1X31C 1KONA 2BJEA 2QLWA 3HULA 4MAKA 3CULA 2ZKTA 2R4FA 1DBDA 4KPCA 1RTIA 3HP6A 3GFZA 1RADB 1P1LA 1KOHA 4PR6A 3G2XA 2UVWA 2WOMA 2ZJQQ 4PG6A 1HHQA 1ZTWA 4IG0A 2BW7A 5A2QY 3M8PB 3CTRA 3H20A 2HVDA 4MKBA 4M5LA 3MM8A 4KFBB 4QIGA 5J2MA 4DSIA 1RYSA 1KN6A 3O6QA 4WK3A 4G3IA 3W3SA 1ROFA 1QTMA 4LF8F 1RKIA 5T7LA 1NBEB 3OJUA 3TJ8A 4M5NA 5A8WA 1RT7A 3DLEA 3LP0B 3MM7A 1RAOA 4NE9C 3IBWA 2IFXA 5C25B 4WFXA 2C3OA 1WKKA 2EFPA 1S6PA 3UN2A 3KK2A 2V63A 2EC0A 3K17A 1VHIA 3IAM9 3SSQA 1EKRA 3SCJE 4JV5J 3TZZA 2Z8QA 2X1BA
chains in the Genus database with same CATH topology
5CCMA 4A8WA 3D5MA 4EBEA 2RS8A 3OXLA 2RKIB 2VKRA 1S72S 2FHMA 4FXVA 4IH6A 4WTYA 1U49A 2C3MA 3PO4A 4EEYA 1T8EA 2DGUA 1S1TB 4CNZA 2KFNA 1NHUA 3I0RA 3N9UC 3J81Y 1GH8A 3BO2A 3PVXA 2ABYA 3E8OA 3LPYA 4UUXA 1K9MT 2VG6A 1HWLA 3LQVA 4WJBA 1JLQA 1RA6A 4G6VB 3J7Z5 1U1MA 4IRCA 3RW6A 3C6UB 1RT6B 3L3CA 1FD8A 3QAUA 1S9GA 4Q2MA 2DNZA 2GO9A 2E5GA 2VZ9A 4B9LA 1QJHA 2P5VA 3OVSA 1RKJA 2NXUA 4DLGA 2UV8G 2R2UA 4X4QA 4J9OA 1VGYA 1LW0B 4OIXA 1DARA 5CYQA 4IR1A 2DNHA 3BB5A 3CB4A 4O3PA 3BO4A 3LP2B 1Q8IA 1LQ9A 1RTHA 2RRBA 3MM5B 2DBBA 1FE0A 4YB6A 4BC9A 5FDLB 4W90B 2JFDA 3D0GE 5K8NA 2YY3A 4NLQA 1N5YB 4JBCA 1WTFA 5L8RC 3R5CA 3HVWA 1OSDA 5C42B 1VIOA 2L9WA 1UJ5A 1C1BB 2HG4A 3OR2A 1ELOA 3I5AA 5EWEA 3HHLC 4R0JA 4CTAA 3WBZA 3ETOA 5A6WA 2E44A 2YX4A 3C6TA 1N52B 2GMHA 1L3TA 3AAWB 3J7YU 3LGNA 2K2PA 1VQ8S 1FRKA 1D9FA 2WRMA 1N8RT 3HF5A 1Z4UA 1UL3A 2QEXS 1DZ5A 4ZPTR 4NCGA 3DLKA 3DMJB 4R5PB 4WFAQ 2ZNZA 2CJAA 2XEXA 3ENWA 4QPXA 2GQ2A 2MY8A 2JHEA 2XHWA 5J1EB 1UVLA 5KFDA 3NCPA 3T5KA 3JYTB 4PQUB 4PUOB 1HW9A 1CQMA 1T3OA 3CDEA 2Q6CA 2WTFA 3V6KA 5K8OA 1BQNB 2HWTA 1XC9A 1RTDB 3TUJC 1HI8A 2JJ4D 2R8KA 1A7GE 1OIAA 2PDAA 4U7UK 4E0DA 2DHXA 3NGDA 3LALA 4C8LA 4O3QA 1C4AA 3CCSS 3QLHA 3GV5B 1J5OA 2AV5A 3H2UB 3SCLE 3HZGA 1YBAA 3GILA 1QUPA 2PI5A 2VD3A 4DOZA 3MM9A 3VF0B 1S76D 2HNDA 4K4SA 5KAKA 3KHLA 4JI6F 3UCZP 4I64A 2GHVC 2CIMA 2OPPB 2XMTA 1D9DA 1XMBA 2KO1A 4TY8B 2W7PA 5L1IA 2DCUB 2V8DA 5J1NA 1RA7A 4DG1B 2VBYA 4DFJA 3UI3A 4NLYA 4LFBF 3TAMA 1YGYA 2YNFB 2BE2A 3M30A 2ZE2A 3PDNA 1XTZA 5KG6A 1X4AA 2NREA 4PG4A 3DCAA 1VQOS 3KLEA 3Q8QB 4DV4F 1R43A 2BV3A 1TQLA 4LJMA 3MEEB 4YR0A 1HWIA 2IBKA 4GKKF 2PN6A 1Y5LB 1HBMB 2LLZA 2WB1D 3C8YA 4ED6A 1KHWA 1HA1A 1D8ZA 2DH9A 3NGKA 3VALA 2EFVA 5C5JA 1HBUB 2E5JA 2ZBIA 1JLGA 1FKAF 1KRPA 3NNHA 2Q79A 3TANA 3MI7X 2N4DA 3PM9A 4LF9F 4ECRA 5FIIA 1RT1A 5L1LA 4AL6A 4KR0B 4DFPA 1EP4A 2J76E 4ZP8A 1VQNS 4OL8A 5AXKA 5CYMB 1RWUA 1UFWA 4ZK7M 3OSNA 2OPSB 3WC2A 4XAKA 2XY5A 4TLQA 3PY8A 1YTYA 4O4GA 2HWIA 5EX3A 3E01B 4Y3CA 2R7TA 2HHXA 1RT4A 3K57A 2OTJS 2FJBB 4LFAF 3UR3C 3AA8A 1VQLS 2HVHA 5L9XA 2QO3A 4HKQA 1E6VA 4ZPBA 3W2VB 2OSRA 2XY7A 3PKYA 3NMRA 3T6BA 3OXGA 3DLJA 2FY1A 3G8TA 3T5JA 1VIXA 3AQOA 4YB7A 4X64F 2UXCF 2AU0A 3CCMS 2KHCA 2LKZA 3LP1A 5DLFA 1VMBA 1HR0F 1BQXA 3QWUA 4ZKAA 4OLOA 1X4DA 2GCFA 4OLPA 1JLFA 1WHWA 2Y1RI 3DLGA 1R89A 3SCKE 2KHDA 3BQ1A 2R8GA 2BA9A 1C2PA 2XWXA 5KFEA 2J0WA 1MU2B 2ZZNA 3HVAA 4NOHA 3MD1A 3R1HA 2WBRA 3DRYA 2XZWA 4YB1P 4LF4F 2HFZA 1V6HA 1SJQA 2JX2A 4C0HA 4AQYF 1S6UA 3BN4A 4H4KC 3N6LA 4I2QA 4N47A 1J5EF 2XMKA 4TYAA 4TQRA 2ZOFA 2V8GA 2KT2A 1VQYA 3M6WA 2XO7A 2HIQA 3L09A 4Q43A 2RMLA 1L3KA 4ELUA 2BRKA 3OR1B 5GAHU 2QMWA 2QFJA 3H5YA 1V3SA 1BLUA 1GXUA 2QZ8A 5K8MA 4FYDA 3Q8RB 3ULHA 2JEJA 2E1RA 4C8OA 3T9NA 2V4JA 2KFYA 1H98A 3SV3A 3GE9A 4FXWA 4HL9A 3BSNA 3RB3A 3SDEB 4J9SA 1VQ6S 1MW7A 4ZS6A 2XLJA 2HNYB 5A8RB 3ISNC 1CSJA 2VV5A 4QOTA 4KKOA 1S99A 4ES1A 4NLUA 4QIFA 1XEZA 2P9CA 5H9EJ 4U6PA 1N4LA 1QAXA 1BY9A 3G6XA 2WHOA 3M2RB 1HPZA 2F1FA 3DOKA 1GXLA 1E6YA 4RZRA 3O44A 2MKKA 4DFKA 1FCAA 4F4KA 3M05A 2XS2A 1KNZA 4NMLA 4NZ6A 3BGRB 5MAOA 1KD1T 2DR5A 1JK9B 3IR7B 2VB6A 2G1DA 3MMCB 4DSFA 3HZEA 2YNIB 2AJ0A 2DHAA 4Y2AA 4NA1A 4TQSA 2J6UA 2K8GA 2DO4A 3MEDA 1HMVB 3LH2S 5LJ5Y 3BZQA 2JLGA 5HL7Q 1NJIT 2R7SA 1DFDA 5HP1A 2I9SA 3P96A 3PIOQ 4F25A 2A2DA 3CDAA 4ECQA 1CC7A 1NNDA 1OQ3A 4H4OA 1D0EA 3KLHA 2YKNA 1S0OA 1WHYA 4IOAQ 3FQLA 1LFPA 1DTQA 3NMAA 1U1LA 2PEHA 4NYZA 2W9AA 3TP2A 3RB0A 4U7CA 4IH7A 2E5IA 4GC7A 2FHOB 5AXLA 5LXRA 4CO4A 3HK2A 1Q16B 2DGXA 1L3SA 4OV1A 3WZ0A 2D9OA 3M32A 1S1WA 5BYSA 3FZ2A 4O4RA 2FDNA 4B3OA 1M5HA 2P6TA 2VC0A 3FFIA 3I9V9 1SL1A 2UVUA 3M2VB 2IC3B 3KMSA 2HGLA 5EN1A 3DLBA 4M5DB 1G6BA 3KK3B 4HDHA 4CCHA 2NZ4A 2ZUGA 3DHWC 1Q4RA 2DNNA 3CD6S 4GC6A 4URSA 1IM4A 1Q78A 5D4LA 2R7RA 7FD1A 1X4GA 4ES2A 1TVRA 2IM3A 2MZ1A 5U47A 2GJ2A 3QIPB 1SBRA 1U25A 2EVZA 1XNRF 5IT4A 2ZH3A 3I96A 3CJKA 2DNYA 3DRSB 3MTJA 4RLEA 4OI3A 3DGPA 3HHEA 2G0CA 4TNOA 4DS5A 1MWZA 2P9EA 3B82A 2QT7A 3H4BA 1RTJA 2BYCA 4KQZA 4RX6A 1LW2B 1TP7A 4IG3B 4A8QA 1TL4A 4NWBA 2N7YA 1M5VC 2I2YA 1FJ7A 2HQ3A 3DN9A 1PSDA 5KFQA 2RDJA 2VQEF 3C46A 2M52A 4PKDB 4ZHRB 2FB0A 3OW2R 1U1QA 4RU2A 1VRUA 4X62F 4Q5VA 3Q8SB 5E0OA 1SJ1A 4RW4A 2OMOA 2ZHOA 3OQ2A 2ZOGA 2MQNA 4JOUA 4K4YA 1U09A 3OSPA 1YI2S 4F02A 1L3UA 3LGMA 2IMOA 2MY7A 2BANA 2XMWA 3M2UB 1UAWA 4C8NA 4DR2F 4JV1A 4ECVA 3NBPA 4QIWD 1X9MA 3HHLD 3D1QA 3EX7B 4DR5F 1FT8A 4QWAA 1MMDA 5J2QB 3AB2B 3QO9A 2N82B 3JTNA 4QCLA 1WG4A 4LSNB 1LWFB 4P2SA 2UUAF 4NLWA 2YWHA 3CWJA 3HKWA 3MMBA 1IUJA 1F5AA 4MYUA 2KFZA 3MOZA 3H2VE 4GO5X 1X5SA 2AX1A 2C3PA 3AHPA 4KBIA 4MMOA 4QR2A 1PO6A 3VTIA 4FZVA 3SI8A 2VASA 3G71S 2V4RA 2LA6A 4Y2KA 4YUDA 4RW6A 3M8QB 3RB6A 4L72B 2PA8D 4ICLB 3KLFA 3K5LA 4AE5A 2W4DA 4QR0A 2XY6A 5D3GB 4QBUA 4USJC 1NKBA 2D41A 1NKCA 1JWWA 1U1RA 2EFQA 1N5TA 1VQ5S 3H2LA 3HT3A 1FEEA 2ZFHA 3KLGB 2ZVSA 5CXTA 3IRXA 3DC2A 4B9NA 2B9YA 3QIDA 2OMLA 2KZMA 1RGVA 2CPYA 4CH0S 1N32F 2WCXA 3K2YA 4ECUA 2KXHA 2CQIA 2O66A 4I6WA 3IS9A 1HI0P 4DUZF 5T14A 3QMQA 3PW7A 1S1XA 2MJUA 3B4DA 2KM8C 3TA0A 2OLWA 4KHMA 3J7ZT 2NSBA 2D74B 1K0VA 5IM0B 4QZVB 2DGVA 4ZLPA 1TKDA 3IN5A 3N5FA 2O3DA 2HS3A 3CCUS 3X1LB 4HHJA 2M8HA 4C3KA 5E3QA 2H5EA 1X7VA 1PILA 2E5HA 3HHDA 3KG4A 1W2BR 1K1SA 2N3OA 1QM9A 5IQQA 1FKOB 4KO0B 1QAYA 1Y3JA 1M5PC 3MMAA 2O5DA 2XSJA 2CPXA 5I3QA 4USIA 2K7KA 2DHSA 4BBYA 5J1PA 3EXCX 2W9BA 3W2WB 3G4SS 3M1VB 2MQOA 3LF0A 1N0UA 2YNHA 4WYWA 1HNXF 1WELA 3K5OA 2RS2A 2J9EA 1TV6A 4Y34A 4X84A 3MECB 2WK4A 1DLOA 2XMMA 5LT5A 5GADU 3CT9A 5HROA 3DI6B 2YWKA 3D1HA 4OZJA 1F60B 1GX5A 4KC5A 4HDGA 2MXYA 4C4WA 3PFEA 1VS3A 1G3OA 2YKAA 1YG0A 4UUWA 3NRBA 3MFHA 2IVMA 4OZNA 2CFXA 4ED3A 2M70A 3P3DA 4DL7A 3PRBA 2HGNA 3V2UC 2W9CB 2VKZG 4OHVA 3OL6A 4Z2XA 3RYLA 2LXUA 1S49A 2NSCA 1NH8A 1YIJS 4N5SA 2VQFF 3C2PA 2Q3PA 5J2PA 2HPUA 2LU1A 1LOUA 3A1YG 4JI0F 4ETZA 2DNRA 2QLXA 1JLEB 4AUKA 3VZHA 4NZ0A 4IRDA 3RZAA 2K7JA 2IRXA 1JLAA 2CZVC 3M6VA 3UE2A 2OTLS 5KT7A 1SJ4P 2VA2A 2XNRA 1DTTB 2L41A 1IKVB 2AX0A 1C4CA 1X9WA 4J9NA 5FLXY 2OSQA 3DNCA 2RU9A 2Y0SD 2RNEA 2YKPA 4OMFG 4JV2A 3J7YI 1XNQF 1S9EA 3HHKA 1HD0A 5E3RA 1VLYA 2HMIB 4FNHA 2KDOA 5I3UB 1S97A 2HHUA 3OL8A 3RR7A 2YQ3A 3VAHA 2BE2B 4B9SA 3I31A 1F0XA 2IM2A 1UFLA 2VFUA 4P7VA 3PX4A 2X1AA 3FEZA 3K5NA 4HLBA 3ITHA 1HW8A 3MD3A 4F3MA 3SEOA 4WF9Q 3IA0A 5LJ3Y 3KLIB 2ROEA 4ELTA 4YMEA 1R8PA 1JX4A 4I6AA 4K4ZA 1BQMA 2BM1A 1NEEA 3PEHA 4G1PA 1YJ9S 3IWNC 4IDKB 1R8AA 4CO3A 4BWJA 2M0GB 4B3MF 1QUVA 2V9WA 2AWZA 2W8LA 4DLEA 3NG8A 3ISND 4QWDA 3OHAA 2CPDA 5KFCA 1HNVB 2OPQA 2YKMB 4A8FA 4A8OA 1LV5A 2FVPA 4ETXA 1C1CA 4CI0B 4FN5A 1RT4B 3Q22A 1X4FA 3VCDA 4RW7A 2HS4A 1UVIA 3CJ3A 3AJ1A 5KT3A 4K59A 3BJYA 4YP3A 1NB7A 1FEHA 1T94A 2M8DB 4B9VA 1RP5A 4PG8A 4UQGA 2DITA 3SMZA 3PACA 3CPWR 5KG5A 1ZM9A 4OX7A 5KFLA 3IC1A 4FP9A 4Q0BA 3JSMA 4IFVA 3I0SA 1SJ3P 4RW9B 1S7HA 3S7RA 1N5QA 5B0GA 3MWBA 2KXFA 4JI7F 3TNVA 1PC5A 2DH7A 4PWUA 4RWWA 4YB5A 3UNGC 3VWSA 3WDOA 3OLBA 3V81A 2EW9A 3MZIA 2LVWA 2E9TA 2VFVA 2GNKA 1P27B 2JOQA 3DOLA 3SXLA 1XBWA 5KFZA 3DLGB 1HNWF 4ALZA 3CF5Q 1XERA 2ASJA 4RNHA 3VAMA 4WYLA 3TR5A 2B5JB 1KEKA 4ZVHA 1FTRA 4C11A 4U67Q 4PWDB 3PX6A 1FO1A 3O2IA 4CO5A 4OHZA 2HNZA 1AFJA 1ZOTA 3CJ0A 2JL9A 1EETB 3ZZPA 4DQRA 5J2NA 3DU6A 2JSXA 3EPIA 4DR6F 1Q86T 3DDKA 5DDPC 3OUYA 3RR8A 1KOOA 5M2UA 1R0AB 1T03A 2GQCA 2R7OA 4WZQA 3EZ5A 2HHSA 4I56A 3IO1A 4Q2LA 3KJVA 4DL5A 4DR7F 2WAQD 5AE2A 2XC9A 1SJFA 4HI1A 2ZDOA 3Q23A 5A0YA 2DNGA 5KFXA 3MHYA 3JTOA 1IKXB 3QJPA 3RRGA 4RNOA 3I6PA 2RUGA 1KQFB 4JI2F 3SYZA 1ZM4A 5F8HA 1I6JA 1N5VA 3BS9A 4TYBA 2DO0A 1R7IA 4URQU 2WONB 4C8MA 2X3GA 4QW9A 1UJ6A 5M2RA 1KLMA 2K1RA 3CCES 3FDSA 1FRHA 2XG8A 4IKAA 1IBMF 2F40A 3PW4A 2WSCC 4I0WA 4QYRA 1JLCA 4KHRA 3M9OB 2FHKA 1K0TA 5K5MA 2J7UA 3HHLA 2MZQA 4DWIA 2VG7A 3CDUA 3TA2A 1TL1B 2CQDA 1A6LA 3K5MA 1S6QA 3CO9A 1WF0A 3J80Y 2RD5C 1HYSB 4DL6A 2D3OR 1P9QC 5E3PA 4RBUA 2BQ3A 1NK8A 1N36F 3H40A 4DV5F 2F4VF 2YWGA 3HVTA 2VOPA 3GQCA 4G1IA 2LQJA 5E2QA 3FEYB 2W24A 3SSRA 2RIJA 2XI2A 1Z2ZA 3D0IE 5EGYA 1S0VA 2AGPA 4IQXA