2Z0GA

The crystal structure of pii protein
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
112
structure length
95
Chain Sequence
b'MKKIEAIIKPFKLDEVKDALVEIGIGGMTVTEVKGFDFLPKVKIEVVVRDEDVEKVVETIVKTAQTGRVGDGKIFIIPVEDVIRIRTGERGEQAI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrogen regulatory protein P-II
publication title The crystal structure of PII protein
rcsb
source organism Aquifex aeolicus
molecule tags Signaling protein
total genus 20
structure length 95
sequence length 112
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00543 P-II Nitrogen regulatory protein P-II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2z0gA00
3NCRA 2ZOMA 3DFEA 4CNYA 4NYPA 4AFFA 2CZ4A 1J2VA 4RWWA 4Y6IA 4USJC 4WK1A 4OZLA 3TA1A 2PIIA 2E66A 4USIA 2J9CA 1KR4A 1V3RA 2XZWA 1V6HA 3MHYA 3X3UA 3LF0A 4CO1A 2XULA 4R25A 2DCLA 1XK8A 1UL3A 2J9DE 4OZNA 2GX8A 3T9ZA 4C3MA 1Q1KA 4YB7A 2JJ4D 1O51A 2VD3A 2NUHA 3AH6A 3GSDA 3NCQA 4CO4A 4CO0A 4YB6A 3TA2A 4ZK7M 2J9DA 4RX6A 4YB5A 4OZJA 5D4LA 1OSCA 4RLEA 3O5TB 4C3KA 1H3DA 2GNKA 3OPKA 5DRKA 1UMJA 4D3GA 4IYQA 1UFLA 4E98A 1V3SA 1NAQA 1VFJA 4WK3A 4CO5A 4CNZA 2NS1B 3TA0A 2O67A 5D4NA 1NZAA 2J9EA 1V9OA 2V5HG 1NH7A 1GNKA 3M05A 4USHA 1HWUA 4CO3A 3HLUA 1O5JA 1VHFA 2O66A 5D4PA 5D4OA 4C3LA 3BZQA 2EG1A 3AHPA 3N5BA 2XG8A 4RWXA 4NYOA 1UKUA 3AA9A 3NCPA 2EG2A 2XBPA 4D3HA 5L9NA 1QY7A 5DS7A 2ZFHA 4Y65A 3AA8A 1P1LA 3L7PA 2RD5C 4CO2A 2Z0GA 2NUUG 1PILA 2GW8A 1NH8A 3CE8A 3O8WA
chains in the Genus database with same CATH superfamily
4P2MA 2MTLA 2VJVA 2IRXA 4I4BA 2UU9J 2FHMA 4MYTA 4FS1A 2XGQA 7FDRA 1XN9A 2BABA 1LOUA 3T9NA 1A6LA 2V63A 1XK8A 1LWFB 2NPFA 3GB0A 3QT8A 2ZNZA 3KLFB 5A76A 4QU7A 1C1BA 2K1RA 1RTHB 2QE5A 3QZ7A 1NLKL 5D4LA 2F9JA 4N47A 3IA0A 3KLGA 4ECWA 1YJUA 1Y10A 2MY7A 1T8EA 2OSQA 3N9UC 1TKZB 5J1EA 3JAMU 1V9OA 4WZQA 3OXFA 1RU2A 2CNLB 1HBNA 2HHQA 4N41A 3M8PB 3JAMY 1HYSB 3P45B 4RPFA 1FKAF 1K0TA 2CPZA 4B9TA 1E6YA 1I1GA 3CJTA 3HFVA 3FSYA 2QIFA 3L7PA 2KFNA 2IFXA 1M5OC 2CPHA 4WXOA 1QVFR 3Q0AA 1RHUB 4MTPA 2DY1A 3CCLS 4K4UA 3LP1A 2XMUA 1RTJB 3LP0A 2IAJA 1AB8A 4ED8A 1YBUA 1SJFA 4DR4F 3FBFA 3A8JA 2XMVA 2MPUA 3KLVA 3DRPA 3QFHA 3KK3B 3O3LA 1TL5A 4C0OC 2FLNA 2D3ZA 1MU2B 3QNWB 2CQIA 1TV6A 3BKTA 3PEHA 1TKXA 4O0IA 5K8PA 3OLBA 3CDAA 5KFSA 3THTA 3QAUA 1VQ9S 1FJGJ 5HVFA 4NPOA 3HSZA 2HKEA 3WIVA 2QLBB 5C2GA 1NK6A 2V67A 5KFDA 4JI8F 4CLUA 2FY1A 3H8YA 5DO2A 1SH3A 1M5VC 3CJKB 1RDRA 2QYGA 3DKDA 2XBPA 2W9BB 4HI1A 4JB8B 2RDJA 3DRSA 2BJ7A 1PC5A 1RXOB 3GP9A 1PJ5A 1TUGB 4BCAA 3HSDA 3PY8A 2ILYA 3HO1A 1WC5A 4NCGB 3FUYA 5HN0A 3WDOA 1IJFB 2Z2LA 4WK1A 1VQKS 4QQBA 4O3RA 2WOMA 2DR6A 4F3OA 1H98A 3NP5A 4K0KF 5DLGA 2C2DA 4K4SA 3U27A 3KJVB 2RJZA 2F5GA 4PKDB 4CNZA 2D1CA 4M5GA 2HHXA 2QL5B 2O01C 1GT8A 2RRAA 5F41A 2ZH4A 5A6PA 1KVJA 1RTDA 2W1BA 2CVEA 2K8GA 5KTQA 1CVJA 4ZPTR 5A8RA 4WKRA 1PGZA 1RT4B 2FJEB 4X4UA 2HMIB 3DCAA 4LRCA 3FEZA 5A8WA 1NJZA 4EWTA 2BJ1A 4S0MA 3TYTA 1RT3A 1HKAA 1SKUB 2CZVC 2IM1A 4ECXA 1UAWA 3I6PA 2OO4A 3A4TA 2FVRA 4M1KA 3EGWB 2DITA 3PW4A 1N4LA 2JRSA 2ZOFA 4WTOB 3K5LA 2VC0A 2CWXA 2PEHA 3BR8A 3OTOJ 5LMNJ 3MECA 3HX9A 2XI2A 3IWNC 1S0NA 4UOFA 2BBEA 2HGNA 4P9SA 1JIHA 2XS2A 5B0AA 1DZ5A 1NNDA 3HJVA 2RQ4A 4OYZA 3R7BB 1LWFA 2F7VA 5GMDA 3ET6B 1SIWB 2FYXA 3P5TL 4MIWA 2XTJP 3KLFA 3AJ1A 1RTHA 1M5SA 2V8HA 2W9CA 2E1CA 3ZXWA 2BQ3A 1RLDA 4MIAA 1NB7A 3EJMA 1NZ8A 5CZVA 2ZNYA 3ILLA 4LF5J 4L75A 2UUAJ 5ETKA 5EWGA 3TAQA 2QJ3A 2HURA 1TKZA 1KEKA 4OI0A 1X4DA 4O4GB 1UW9A 1TL4A 2GIQA 3M8PA 1HYSA 1VISA 3K5MA 4ZVFA 7FD1A 5EWEA 3V6HA 1IVZA 2MZSA 4DV0J 2JOQA 3OV7A 2OSRA 1X4CA 2FHKA 4EEYA 4DV7F 3UR3C 2BR0A 2IA0A 2RDDA 1RT2B 2UVWA 1RTJA 3FZBA 2R8JA 4MK9A 5AXMA 2DEIA 2UZAA 4P7TA 5KG2A 2AEMA 2ZHAA 5KFXA 1TFWA 3KK3A 2A6MA 4KBIA 1KNZA 3ILJA 1F5BA 1GTHA 1NSKL 4L3KA 1MU2A 3DLJA 3I4PA 2EG1A 1M5PC 2AJQA 3VHQA 5KG7A 1EETB 3C2PA 4H4MB 3KWMA 4ER8A 2DH7A 4JI4J 4TU8A 3P5BP 3F0NA 2FHJA 5LL6d 2MHEA 2XYGB 2MLZA 4CM0A 4LF4J 2CNNB 4NA2A 3CJKA 3MM5B 4OZLA 2I8EA 3D6FB 1WEZA 3OT9A 2W9BA 2FIUA 4L6V3 4O3QA 5IWAJ 4CLKA 3OHAA 3MMBB 4L76A 4W98A 4NCGA 4XTTA 3QYYA 1EP4B 3R3TA 2KO1A 3L7OA 1LWXA 1R6VA 2HBQB 3TUZC 2K2PA 2HRUA 1H72C 4DPOA 2GHPA 2EVZA 5KG1A 3CCQS 1X9SA 2MZQA 3FZ2A 4NZ0A 3TUPA 3QPIA 3KJVA 1PYSB 4CTAB 1WKJA 3MPYA 1HHTP 1QSLA 4QPTA 3Q8QB 1L3VA 1TL7B 1X9MA 2FZGB 2BMBA 4F4WA 1WC1A 4B08A 3R5BA 4JI6J 4DL4A 5B7WA 2DIUA 4LRAA 4F4XA 3UDLA 4ZLNA 4UOGA 4DV4J 3VGUA 2J0SD 2QEXS 1RACB 1RT4A 1DLOB 2HMIA 4PXBA 1KLMB 5F8IA 3R1HA 2ABYA 3UVJB 2CQ1A 2E1RA 2YH0A 2G0JA 3WBZA 4DR3J 2LU1A 5AJ3J 3VAKA 4RNNA 5ETTA 2CAJA 3UE2A 3O2IA 4CLSA 3CDWA 1N5SA 3C6UB 2FZCB 1MMNA 2ZH5A 2RMLA 2XNRA 4TYAA 5RUBA 3D0HE 2F65A 4ED4A 2HQGA 2PA8D 3KUEA 2NS1B 4QIGA 3RW7A 3NGDA 1KHWA 3G96A 2V5HG 3GCWP 4FN5A 2HK3A 3DC2A 5ETNA 2PDAA 5BR8J 4PG5A 5KG4A 2FJXA 4HDHA 4ECQA 2IMWP 1QY7A 1HW8A 1LEOA 3ET6A 2DB1A 1RAOA 4IOBA 2JEJA 1NKBA 2FLLA 4IQXA 4RWWA 2E9TA 4A8XA 3GG1A 2HVDA 3T19A 1AROP 3RR8A 4CLLA 4QW9A 4O4GA 1H0HB 4CLZA 4NXNF 2FJDB 3FKBA 4NL5A 5J1PA 2DHSA 4GC7A 3Q8YA 1BWVA 2DRAA 4A47A 1FHTA 2UUCJ 4YHHJ 2H4WB 2VZ9A 1YJ9S 4YR3A 2DIVA 2KZZA 3BO3A 1PSDA 1F2HA 3M8WA 4DXLA 1RT2A 2C3OA 1T02A 4HT7A 3TZWA 4U7CA 3QLHB 2U2FA 5G0RB 2GVDB 2LQJA 3MZIA 3TRGA 4IRCA 1RAIB 1X31C 4CO2A 2YKOA 4LFAF 2G1DA 4WP8A 1K0VA 2Y9HA 4UT4A 3D3BJ 2BYCA 2X7IA 4DV7J 3DNCA 3OFEA 4B9MA 1EETA 4H4MA 1UWBB 2IC3B 4ID8A 4HH0A 4MJKA 5JVHQ 3G8SA 4J7CA 6FDRA 2QMXA 2WBMA 4DLEA 4M5IA 1HI1A 1SJ4P 2RH3A 4NLUA 3MM5A 3PRBA 1S6QB 2M5YA 2RQCA 2BRKA 2VFRA 3EM1A 4Y00A 3KG1A 1O0PA 4ZP8A 1N32F 5KT2A 3MMBA 5C2CA 3UFCX 1GTEA 1Q8IA 3R9LA 2QFJA 2Z2ZA 2AD9A 4DR5F 1HHQA 1EP4A 1U8SA 1SCJB 3DHWC 2HFNA 3IGVA 4DFPA 2WONA 2DISA 4NEZA 1HBMB 4GRSA 3BSAA 3JTPA 2MJNA 1B4SA 3K7RA 1YQHA 1IBKJ 2MKJA 4DUYJ 5HMZA 4CTAA 1WI6A 3DXBA 2VQFF 3SCIE 3B82A 4A8QA 1YX2A 1NSQA 3KMSA 2P6SA 5B0CA 1TL7A 3GONA 4F4KA 3OL8A 1X0PA 4M5NA 4R25A 5B0BA 2ZJQQ 4AUKA 2JSXA 2AQ4A 1Q78A 2FQQB 8AT1B 1PIEA 1F60B 4EYIB 3D4JA 5M2PA 3TQ1A 1Q7LB 1DLOA 2JLGA 2W24A 1KLMA 3BN7A 3UVJA 4CO5A 1YSJA 5AXNA 3MEDB 1WSVA 3ISZA 4USHA 2MQNA 1NDKA 4MKAA 4YB1P 4RR5A 3C6UA 2GIRA 4JV5F 3SV3A 2LXFA 2W2NP 3ZNJ1 1T03B 1ZTTA 4DUZF 3EICA 5D0HA 2HFUA 3MUMP 1JLBB 2RHSB 5E2QA 4EZ6A 1N36F 4JI1J 2R7SA 3DU5A 2EFPA 3HT3A 3SI8A 4RW8B 3PFEA 2GZOA 1J5EJ 3UR0A 4Y6IA 5K14B 3HT0A 3HMJG 2ROEA 5A6WA 2VASA 1EARA 4CM2A 1T94A 1XBWA 4X66J 2IY5B 2RQKA 4ANEA 1QSYA 4RNFA 4QR1A 1T3NA 2QLWA 4C2MA 2CPIA 4DQQA 4D3GA 4QYZK 3L9ZA 3LGHA 4LBPA 2BEFA 2KHCA 2BJ3A 2KVQE 3J7Z5 2CVIA 1CJUB 3I32A 2HVIA 2RU9A 1KQFB 2BJDA 4ZCKA 1S48A 2M7SA 2GAGC 4PUOB 4KHPJ 3PX6A 3E3XA 1NSPA 3JQJA 3CUNA 3QGGA 1FX2A 1NDCA 4MIBA 4LR9A 4X64F 4ZLLA 1TTHB 3LO3A 1NH8A 3KLHB 5T14A 4DN9A 2LEPA 4GKKJ 4LQ3A 2B51A 3QLHA 4XDDA 5KFEA 1J2VA 5G0RA 2GVDA 2HPUA 3LTOA 4NXNJ 1SUQB 2AV5A 3D7SB 1L3KA 1Y3JA 3CC7S 1U26A 2D9PA 1C1CA 3FEXB 3OQ2A 1DURA 3VGTA 4DV1J 1VJQA 4LMZA 4NZ6A 1IKYB 4ZOSA 3R6GB 2MQPA 3BQ1A 5J2MB 2GO8A 4F04B 3G6VA 3IM9A 4CQ1A 1AUSL 2OMLA 2E7WA 4ZVPB 1UWBA 1IKXB 4YR0A 2IC3A 2KL8A 3BM7A 1H38A 4F0KA 4KKOA 3SMZA 2VH7A 3RB4A 2EKYA 3U02A 3OL9A 4QIFA 2R9LA 1GX5A 3DOMB 1WOOA 1S6QA 2CQPA 3KLIB 3P3DA 1RAJA 2DGUA 2C3YA 1OYDA 1WELA 1SJQA 3MUTP 3QT5A 3GLJA 2FZKB 1NMEB 2RIJA 3RTVA 1FA0A 2CNKB 5K9FA 3CD7A 1WKLA 1CJVB 2MY8A 2DKOB 1ZPVA 1HBMA 5M2RA 1X5OA 2DXFA 3JSRA 4RBVA 2CDRB 2MQOA 3R27A 2VODA 4EU0A 2XHWA 5F3ZA 2QSWA 2WVCA 1F1BB 1HNVB 3TJ9A 4NLDA 2MJUA 3EDRB 4DG1B 4ED5A 2YX4A 4DSLA 3MDFA 3B54A 4OX9F 4ECVA 4OZ2A 4OI1A 4WFYA 4ZVRB 2R7OA 4YDXA 3ICLA 1RT6B 4QIWD 3VGVA 4QU6A 3QT6A 4C0BA 3BN4A 3HVRA 1XNQF 3T5KA 4B3RF 1Y4ZB 3KFWX 3B4MA 3MEDA 5EN1A 4KO0B 2ASLA 1TAQA 1U4BA 1FFGB 1RADB 2VPZB 2J6SA 1T03A 4NLSA 3N6LA 1X5SA 1VOMA 4WE1B 4OYWA 3V6KA 1IQTA 4K59A 1JLBA 1B7FA 1N5QA 3Q86A 1S7HA 5IOLA 2E5JA 1K1QA 4PEOA 2WVEA 4RW8A 3IR6B 2G13A 3MR5A 5K14A 3MM9B 4B9UA 1QTNB 3J80U 2AX0A 4F2SA 4ELVA 4K2JA 1IXKA 3HKWA 1U49A 2ZZTA 2VBWA 4Q2MA 4JV5J 3D67A 3J80Y 2XQCA 4DSIA 2GJ2A 2B9XA 3I96A 2N3OA 5SZTA 2HVZA 3ZO7A 1N36J 2CPXA 3MEKA 4TU9A 3HXMA 3PYDA 1W26A 4CI0B 3ADAC 1R8BA 1CJUA 2QC3A 4ZPWR 1VLYA 5C42B 4CNYA 5DDPC 1T9UA 4PUOA 1EX8A 4QYRA 2MQLA 4USTA 2HZCA 1U6FA 4P71A 3PHEA 4B3MF 2C22A 2HK2A 3JXOA 4MMOA 2Z2YB 1FWPA 3K58A 1YTYA 4I6AA 4J5OA 1Q1KA 2CDQA 3K89A 2I6WA 2DRBA 1ZOTA 2ZH1A 3KLHA 4YN3B 2C3PA 3MAHA 1YZ7A 2JWNA 4DZDA 1FE4A 2VL1A 2UV8A 2QFIA 2J8SA 3TX8A 4F4YA 1SUQA 3TAPA 5DRKA 4URSA 4DPTA 1LKZA 4USWA 1Q5YA 3TQEA 2JLEA 1U0HB 1T95A 1PC4A 1UCNA 2OPPB 1IKYA 2R7UA 1URNA 5J2MA 4JI5J 5F0WA 2DNPA 3HHLB 4TLQA 4KIAA 1UP1A 2GJFA 1IKXA 4E8UA 5DETA 5E7OB 1ZPWX 4ANCA 2N7CA 3QSYB 5BXIA 1EB0A 2YNIB 4NLXA 1H74A 4FXVA 2NXEA 2B4OA 1FTRA 2JEIA 4A8FA 1P9QC 5BYRA 5IC4B 5ETQA 3DOMA 3DM2B 1RYSA 4AD6A 4AFFA 3H90A 4K4TA 3KLIA 1KS2A 1BD6A 4JV0A 1QJHA 1YG0A 4IUFA 4O44B 2CQ4A 7AT1B 2QN6B 3OSNA 2W7PA 4KT0C 3G82B 2UXBJ 4TNOA 4XAKA 5BYQA 5DDQC 4RUAA 2D3UA 1RWUA 4ZMMA 2ACYA 2CJYB 2GQCA 1TL3B 3H40A 2ZH3A 3BF4A 4RX6A 2KXNB 1CJVA 4DL2A 3GG0A 4AT1B 3TVZA 1QE1B 2E9ZA 4RW7B 3E01B 2FHOB 2XY7A 3UDVA 5L38A 4DCJB 1HNVA 2HWHA 1K8AT 3CJ2A 5KFIA 2KYZA 2B43A 4P6QA 4DV6J 4TY8B 1HNXF 3BYPA 4RWXA 2D3O1 4DG1A 2PT0A 2HQCA 4L73A 1RT6A 2BM0A 2Q6CA 4OQJA 4Q0BB 3M9OB 3CVKA 4G1QB 3TO8A 1KR4A 1MROB 3IWLA 4Q8EA 2DR9A 2GX8A 2CJAA 4KO0A 3D3CJ 3PR5B 2HIYA 3HD1A 1BC6A 4F3MA 2JFKA 4WP9A 2YWKA 4Z2XA 2XLIA 2LLZA 2YNGB 4GKJF 3M6UA 1LK7A 4WE1A 3NNCA 4J9PA 2RS2A 2AMCB 5HQ8A 4A8YA 4I67A 5DQIA 4DWIA 4LSLB 2B0GA 1Z2LA 4ED3A 1AYEA 2OH2A 1RAHB 3MM9A 2M2BA 3B4DA 2W4PA 1GMWD 3GIIA 2FLPA 3KUGA 2VFTA 3B78A 3BV8A 3QJLA 4N7TA 1U24A 2IDLA 2ZWOA 3CJ3A 1PG5B 2E7XA 2DRDA 5HANA 3POTB 2MKHA 2ERRA 3PCOB 3RAXA 2MKCA 4KH1B 2HFOA 1A9NB 1T0TV 5FDLB 2CPYA 4IG0B 4CH1A 3PJ9A 3MCMA 5C42A 4ZKAA 4DPXA 3K17A 3EXYA 1N34F 1Q53A 2DNMA 4P74A 1T05B 1FKPB 3UW1A 3M8RA 5IV3A 1SI9A 3CGIA 1HWIA 1IKWB 2ADCA 5BYSA 1TELA 3OTCA 5F8JA 1YDLA 3MMJA 2QX0A 5KAKA 3CDBA 4CO3A 2HS0A 1KLNA 5HK4A 4KGVB 3Q83A 2C2KB 1C0TB 1BE4A 4O3PA 4KRWA 3N5BA 4YFUA 1JMTA 2JHEA 1U0HA 1JKHB 3PX0A 2OPPA 5H9FK 1TK5A 2WCXA 3M2UB 4QR2A 1S79A 1EKRA 3BGFA 3HHLA 3FK4A 4NLYA 3HHLC 1V6HA 3MHYA 3FBCA 3G2XA 1ZH5A 2YNIA 3R5CA 4LSNB 2OEMA 2RKIB 5L1KA 2Z30B 3M7VA 3OFFA 3ZFVA 1OO0B 2GHWA 2V69A 3VR1A 1AZSB 3BB5A 3DM2A 3TA2A 4LF6F 2B56A 4O44A 1UWAA 3G82A 1V3SA 5KFAA 2PGCA 1RCXB 4JI0F 1IM4A 4M63A 1AFJA 1TL3A 1LV5A 3TEHB 1RSCA 1OPZA 5D8HB 2Y8YA 2LEAA 3GE9A 5K8NA 3EVOA 3W65A 2UVUA 1QE1A 3CMQA 3AA8A 4HHJA 4RW7A 3E01A 4ECZA 1RA7A 3G87A 3H98A 2W01A 3GFZA 1SQFA 2H54B 3NS6A 2UXCJ 4TY8A 3T1HF 1NPRA 4QBUA 3PXGa 5KFWA 2I5JB 1T9WA 4BBYA 4DFKA 3EDQB 3SEOA 2P6TA 4AL6A 3W62A 2BACA 4DU7A 2ZM6F 3M8YA 3C8YA 2ZC4A 2CFXA 3I9ZA 3Q22A 3J7ZT 2IVMA 1AXQA 4Q0BA 3R5GA 1HQUB 2YX7A 3ZZ0A 4G1QA 1T9TA 3DRRB 2KG0A 1MROA 4ZITA 2KJVA 2E7VA 4Y2MA 5KG6A 2EPIA 5HMYA 3GFHA 2RSQA 1RGVA 2GMLA 3CJ4A 2L9WA 5EX0A 1JX4A 4KC5A 1N56A 5HI7A 3AOCA 5HBMB 4FKXA 2YNGA 1FCAA 2CA9A 4PCQA 3SDEB 2HVEA 2R2TA 4LSLA 3DLGB 3V6DA 1S4FA 1MWYA 2V9KA 3HM9A 1BXNA 2NSCA 2QMWA 1CG2A 1YITS 2IVYA 3GR1A 3QFWA 4ED1A 3DOKB 2LP4A 1RWXB 2DGWA 1ELOA 3QRPA 2ZD1B 1GMVA 1TUWA 4GKJJ 4H4OB 3GIRA 1CPZA 1EIYB 2BW2A 2VQEF 2MLXA 3UN5A 2OEKA 3CDEA 2YNHB 2FPHX 2J76E 1DBDA 1K44A 4ZJLA 2SXLA 2WB4A 2CPFA 1RTZA 3POTA 5IXUA 5CYMA 3RBEA 2BDPA 4WP3A 1HNZF 1S57A 5FDLA 2C3MA 4QR0A 3NWGA 4PQUB 3MR7A 3TI0A 4RW6B 4QCLA 5D4PA 1T05A 2XLJA 2UUTA 4BWJA 1FKPA 2O5DA 2FTRA 3UCUP 1L3TA 2XG8A 4TVAB 2Q1LA 1DTQB 5G4DA 1IKWA 1FJCA 4CIOA 2Q6BA 3ZZPA 3IRWP 3ELHA 2GJIA 5EUHA 5CA5A 1FK9B 3FJ2A 2LDYA 2VFVA 1C0TA 3TANA 1F3FA 1NKCA 1QAYA 1WF0A 4OZ1A 4YDDB 3E8OA 5KFCA 1JKHA 2H48B 2A6OA 5C7PA 1KDNA 3CJ0A 1OY8A 4OFZA 3M2UA 3MI7X 2XCPA 3H4BA 1RHJB 1F2GA 4CP5A 1P6TA 3THVA 1CBKA 1S6OA 2CQ2A 4XIUA 2ZOGA 1ACMB 4XO0A 2LU2A 1H3DA 3KG0A 1OPIA 1WC6A 3ETMA 4ZPDA 4LSNA 1U6ZA 2AJ0A 2IBOA 1R3NA 2RKIA 2XS7A 2HFZA 1B0TA 3K57A 1IBMF 4RU9A 3FCWA 2OPRB 1AZSA 3RU0A 3W5YA 1NHVA 3GFYA 3W9IA 3V4MA 4QPXA 2YKAA 5CZXA 3WIUA 3IWXA 5LMUF 3Q89A 2XB2D 2E9RX 1XTZA 1R0CB 3GIKA 3JS9A 4F02A 4X4VA 4CYUB 2EXUA 4AXIA 3A12A 1J27A 3WHIA 3SSQA 2C2EA 4UUWA 3NCRA 5D0GA 1MMLA 1LWCB 3BS9A 1W7WA 3DLEB 1PO6A 2CG8A 4B3TJ 2XMWA 1BUXA 1S76D 1YJVA 2X1BA 2DHXA 4HHUA 3W2WB 3I82A 1ZZFA 2G2ZA 1ZETA 1FRJA 1Q79A 2DGTA 1SQEA 4YB7A 2JJ4D 4ILLA 3VALA 2CQ3A 4FYXB 2QSFA 3OR2B 2YX1A 5HVGA 2WSEC 2BANB 4K4WA 4JI3F 1RYRA 2I5JA 4FF2A 3IBFB 4O3SA 4DX8H 1DQ9A 4LF2A 3UI3A 3MMCB 1D8ZA 3AOAA 3HJFA 4FP9A 1FXDA 2VDIA 4ZP9A 1SL1A 4KHMA 3QJPA 3JSYA 2OEJA 1HQUA 4UTGA 5EDWA 3DRRA 1FNXH 3MCOA 1VLOA 1PCAA 4RJVA 1NK0A 4ENOA 1PYTA 1VYAA 1OQ3A 3DYAB 2HZVA 2GC8A 3NKYA 2PN6A 1KQGB 5AE2A 4MT1A 3TX0A 2NR0A 4FDFA 1NK4A 3RR7A 4KV8B 5HBMA 4K4ZA 4GC6A 1O6XA 4OZ5A 2AGPA 1BWEA 3SDEA 4ED0A 2EFGA 2ILZA 4TLRA 3VAIA 3VVTA 2DD8S 2PFFB 3DLGA 3CXCR 2B9WA 2VV5A 2CJQA 3W61A 3DOKA 3NBPB 3G8TA 5L1LA 1TMJA 3MR6A 2FVPA 2Z8QA 2ZD1A 3FCVA 5M2UA 4UQTA 3FEYB 4H4OA 1M1HA 4NLOA 1SVDA 4LVOP 2H9ZA 3D54A 5FLXU 1ZA1B 2YNHA 1FNMA 3LPEA 1KBRA 3KNGA 3CCSS 3EZOA 4C4WA 2HHHJ 5L9NA 4D3HA 5FLXY 2DHGA 1U25A 1ZAVA 2J0QD 4EGLA 3PW5A 1H7XA 4PQUA 4I1TA 5IQQA 3SXLA 4RW6A 2NUUG 1SKSA 2XMTA 3H2UB 5U47A 1O8BA 3GYGA 4FBTA 3SQGB 4DDFA 2MQMA 1BQMB 1WHXA 1DTQA 2YBVA 5B0EA 2VDHA 4HEA9 5E3QA 1NXIA 1FK9A 2DXEA 1UJ4A 1RT1B 1U2CA 1U1RA 3SSSA 4FBUA 1UFWA 2LECA 3KTQA 1WDDA 4Y28C 3WC2A 1FJGF 2KFZA 4ZVSB 4BC7A 2WRMA 3WZ0A 4OHYA 4FNHA 4NZ7A 2F4VJ 1HNWJ 3K5NA 5KT7A 3DLBA 1GNKA 3G86A 4U96A 1RAGB 2RU3A 2F8EX 4BDPA 4G3IA 3TJ8A 4XK8C 4WZMA 2HGLA 3KDNA 3G6XA 1JXVA 2P8IA 2CZ9A 4XDCA 1N8RT 3PR4A 5F8MA 4AL5A 4ILRA 5AXKA 2J6TA 2RQMA 4DL7A 2OPRA 1RBAA 3IS9B 4NYPA 3PKYA 2VB6A 3M6VA 1G7CB 5HP1B 3OVSA 2KN4A 1WDTA 2EC0A 2R7TA 2HZAA 1V5IB 2MSTA 2AKWB 3AB4B 2R8IA 2I38A 4CYUA 1G6BA 2R2SA 1YRTA 1LWCA 3ZTQA 3TUIC 3DLEA 2XLKA 4IQMA 1FT8A 4YB5A 5D78A 1MN7A 4EI2A 4FYVB 3GSIA 3H5SA 4DSJA 2AJ2A 3PIPQ 3WX4A 3W2WA 3C15B 5KFTA 3B8HA 4F3QA 4J9VA 4PZVA 1S1TB 2HIQA 5IT9Y 4OHVA 4J91A 2UXDJ 3OR2A 3BGLA 4NXMJ 1HR0J 5GAGI 1R7IA 2GVZB 2BANA 4RUBA 3U1NA 5GAEI 3NOCA 4KJIA 4HKQA 3VVUA 1LFPA 1HIYA 4MFBB 1QUVA 4NA3A 3MMCA 3A3NB 2C2ZB 2C3UA 3T5JA 4O4RA 1B99A 1ZBTA 2DK2A 3ENQA 1XJWB 1JK9B 1VHIA 3WX8A 4QYZJ 1K47A 4U67Q 4ED7A 3OTOF 3HHEA 1DTTB 4CO1A 3DYAA 2J9DE 2RAQA 5J1NA 3RJMB 1SL2A 1IBCB 1WKKA 1JXEA 2PD1A 4LBHA 2CNOB 2KG1A 1IN0A 2R7XA 4KV8A 3VV2B 5K8OA 2GMJA 3CO0P 1RJJA 1SH2A 4RLEA 2CYYA 1VI7A 3OPKA 4HYKA 5BJRA 3M32B 1KQKA 3RW6A 4BS2A 3MD3A 4OI3A 1A7GE 1NJWA 1HQEB 5GAHI 3ZC4A 1S0OA 2O66A 3RB6A 2DVIA 1LQ9A 3TW0A 1C4CA 4X4OA 4DL0C 5LJ3Y 2FJWA 2BE2B 3NBPA 1Y5IB 1PJ6A 3M8SA 3JB9k 1FVSA 2EC2A 4KTQA 4AXJA 4PAAA 3OTEA 5CXTA 2CJBA 1NHKL 4CT9A 4A8SA 4DV0F 3IBCB 3SCKE 3VAGA 2LXIA 4B17A 4MYUA 4X4NA 1WHVA 5HO4A 2FC9A 1MW7A 3W8GA 5EWFA 2YNFB 5AT1B 1PBAA 2DNHA 4X65J 1C2PA 4C6AA 3BBFA 1VQ8S 1JLQB 5IFMA 1IUJA 1ZM3A 3BPSP 2V6AA 4DBQA 2JFDA 3ZZTA 3SQGA 4X84A 1WG5A 1I6JA 3QRQA 2C2NA 4ILMA 4PQAA 3W2VB 5KFQA 1RT1A 3NS5A 1TMMA 2F3JA 3D5MA 1QDUB 1UEVA 1IBLF 9RUBA 4NLTA 4NRUA 1OY9A 2FUG9 3T6BA 3J81j 3D2WA 4UW2A 4PXDA 3OJSA 4JI4F 3VF0B 5E5NA 2IRUA 2K7KA 4RO0A 1VS3A 3MPVA 1IR2A 1RAFB 3DU6A 3OTBA 4LF4F 3M6XA 3I5BA 2VOOA 3Q8SB 2Y0BB 3IFEA 1WF1A 4NLVA 4GMKA 1I51B 4DR7J 4UOCA 1I5OB 2VPYB 5IWAF 1RT7B 1RWOB 3NG8A 1VBZA 4ZA1A 2GGPB 2QT7A 3QWPA 1AW0A 2PFDA 4IRDA 3TJAA 2IBKA 4WFZA 1S6UA 3IS9A 4OX6A 3CDUA 4I68A 5HP1A 1EQMA 3W64A 4I2QB 1ZYQA 2GNKA 2GA7A 1WC4A 1ZM9A 2PI4A 3Q2TC 3DDKA 3R5JB 4KGMA 1C4AA 1SC1B 2CKWA 1HWJA 1KQSR 1P27B 1BLUA 1GXTA 2LDIA 3FQKA 2YQ0A 2V4JB 5F8HA 4NYOA 2F1FA 2HHPA 1FRMA 4JI6F 5T41A 3C15A 4EUVA 1FNOA 1XR6A 2HAFA 3R2DJ 2K3KA 3FBEA 3JYTB 4DMZA 2M70A 4Y2KA 1VC0A 4DV4F 3BKFA 5KFOA 4MH8A 4Q2LA 3KXDA 2GVZA 3EXCX 1ZAWA 1RHMB 1JJHA 3D6MB 3KLEB 2N7YA 1NEEA 4GO7X 3ZTRA 1WD6A 1MLAA 3K8WA 2CJXB 1B0VA 4PG4A 4PRFA 4DR3F 1VDHA 4MFBA 4ZVGA 5AJ3F 4V19J 3SBMA 4YY3J 2G9OA 2IA6A 2MKYA 2J6UA 1JB0C 1NO8A 3T1YJ 4KAIA 1AUDA 3LAMA 3BO2A 5E0OA 1SKWA 5GMEA 1MNEA 2GV1A 2FVSA 2WBRA 1DTTA 1KFSA 3TA0A 2CQBA 5D4NA 5BR8F 2ZITA 3M05A 4IKAA 1WEXA 3RBZA 4MK7A 3AJ2A 2OPSB 1R89A 3W7BA 2KT5A 1N0VC 3NGRA 2MB0B 4Y3CA 5GAGU 1XEZA 3V81B 3AHPA 3MM7B 5GAEU 3M32A 4K5SA 3ILOA 1AT1B 4P2FA 1R0BG 1SBRA 2HHWA 5F8LA 3BJYA 4Q8FA 2M52A 1HQEA 2M3DA 3OXGA 2VC1A 2GFFA 3CF5Q 1XR7A 4C8MA 1SJ3P 3MTKA 1FX4A 2BE9B 1T9XA 2CZ4A 3DGPB 5HROB 1VCTA 5KG3A 5KFJA 3DRXA 5I4MA 1WUUA 2BE2A 1P8GA 1RK8A 4ZVOB 3D0GE 3CB4A 3ONQA 2V4QA 1N54B 4USVA 1QAJA 3VGSA 4K2XA 3H20A 1PAUB 1B3TA 3DHXA 2IYIA 4RL1A 1YGYA 4IOCQ 2UUCF 2XI3A 4YHHF 2I2YA 3TOQA 1R31A 4ZLPA 4ZIWA 2YNFA 3NNAA 1TKTB 3VQSA 1VQMS 4ZDNA 1SL0A 2ZZNA 1JLQA 3DGVA 2UP1A 4Z7CA 2J9EA 3HVTB 1WNEA 2E29A 1SQGA 4RNOA 2AHOB 2LQ8A 1YJNS 4V19X 2LQ5A 5GAHU 3S6EA 4NA1A 3BSOA 3I9V9 4DV5F 2DGXA 3HP6A 3W2VA 3H42A 3MM6B 1R0AB 3QGHA 1U1MA 2MKKA 2XHCA 1S1UB 4GVBB 1W2IA 4X4PA 2LA6A 1S4EA 1JQGA 4ZPAA 2HS4A 2ZE2B 5A2QU 5F8NA 4YOEA 1F9FA 2QLFB 1U09A 3LOUA 2A18A 4ES1A 4WFBQ 1CULB 1FD2A 3R5AA 3EZUA 4NE9C 2B8PA 1ZA2B 3A1YG 3TARA 2J7UA 1FWLA 3QIDA 3E51A 3X1LB 1FO1A 1F0XA 4DR1J 3K59A 1RT7A 2YTCA 1FFWB 5D3GB 1KD1T 1XMOJ 1FFSB 2GGPA 4TXSA 2E44A 1FJEB 1IBLJ 5HVHA 4DSEA 3H0PA 2R7RA 1B64A 3KMQA 1HHSA 2OTJS 3W5ZA 5KFVA 2AGQA 4DR6J 2R4FA 2EKNA 2UUBJ 2KFYA 1N6QB 1REVB 2PE8A 4KPCA 4I2QA 3HZGA 2WVDA 3ZNUA 4AE5A 1M0SA 2C1EB 1CJKB 5DS7A 1RABB 3V6JA 4B9LA 2ATLA 3MF5A 2JDJA 2Z0GA 2VKRA 1IBKF 3CD0A 1FEEA 4DUYF 1HD1A 5IC6B 1NK7A 5JMNA 3BGRB 1VBXA 2MHNA 3AAWB 4K4XA 1N5YB 1ZM4A 2DNKA 2V4JA 3CC2S 1IR0A 3C16B 3UN3A 4MAKA 1VQPS 1TVRB 3L7UA 3H5XA 2HS3A 3JYTA 3CCJS 3MR3A 2OMOA 4W4MA 3BBCA 2F40A 3HULA 2PC6A 2U1AA 2NUHA 3HHKA 2HW3A 4LT6A 1EZZB 2Z58B 1S1XB 3KLEA 4LUBA 1VQ5S 2O1PA 2YQ1A 3GQCA 3VCDA 3H5YA 2C28A 2AYEA 3S01A 3BDEA 5J2NB 2P9GA 3OLAA 3NOGA 1D9AA 5E3CA 2V9WA 1KFDA 2OFGX 1BQNB 2G2OA 6FD1A 2W2OP 2DGSA 3KNAA 1KVIA 2ALZA 4J9SA 4JI1F 3MURP 4Y0FA 4R8UB 1S12A 5AE1A 3H59A 1Q81T 4LF1A 2V94A 3PYEA 4DQSA 1J5EF 2OPSA 1Y5NB 2BJ9A 4I64A 1KHVA 5FJ4A 3AD7C 3KOAA 2Y3YA 3V81A 3PW2A 3MM7A 4JYAJ 4DCOB 5LSRA 1NPKA 1HPZB 2E66A 3CJ5A 1L3SA 3HSGA 2G0IA 3X3UA 1GX6A 1RA6A 1QTMA 4YUDA 3MCSA 1XWLA 4JI2J 1B7YB 4X66F 2EEYA 3VZIA 1RAEB 3MR2A 2VONA 3AH6A 1Y0HA 3DGPA 3ENVA 5HROA 1KRPA 1I3OB 3KJFB 2KM8C 2QL7B 5CD4H 5D15A 4PXCA 3FQLA 1S7IA 3CCWA 5T7LB 4Q5VA 4F26A 2PMHA 1NPPA 2KKHA 2X51A 5H9FJ 3ZTOA 2HNZB 2W7OA 1VRTB 3THPA 4KHPF 5DG7A 3J81U 4TY9A 2DCUB 2Z4PA 1TAUA 3A8EA 1TKTA 3J81Y 5IQ6A 1WJ9A 3HVTA 4GKKF 1S9GB 3MAAB 1HI8A 4OJ3A 5LM7E 5KT6A 2KI2A 1K1SA 4IR1A 4QWDA 2OD6A 4USJC 2BRLA 5K8MA 2DNOA 2R3VA 1M5KC 4WFXA 1RQ0A 3QGPA 3NAHA 4DV1F 3MM6A 1U1NA 1R0AA 1S1UA 4GVBA 1FXRA 1S97A 2ZE2A 4H4KA 4WXWA 1LWEB 1FVQA 3W63A 1H6KX 1Q0NA 1V3ZA 5DLFA 4FYYB 3U1LA 4DV3J 4H4KC 4NLRA 1CULA 4C98A 2N4CA 2F63A 4ZCMA 3EPGA 1IWGA 3S8SA 2AW0A 3SZ2A 4OHZA 2VBZA 1PYOB 2V8VA 4AQYJ 1LW2B 2Z56B 4DV5J 1UVMA 5D4OA 5D3GA 3FBBA 2GAHC 4ID5B 2OI2A 4O0NA 3ZTSA 2M8DB 1F9EB 2E5IA 3MOZA 2FY8A 3CMES 3DLHA 1N6QA 4ZLJA 1REVA 4DX5A 2EK6A 3FSXA 3Q8PB 3SFGA 3R6LB 5ETLA 4K8RA 4DHVA 1CJKA 1K9MT 3PYGA 3SCJE 4DL6A 4PXEA 2BJEA 2BJ8A 2XMAA 4C8LA 2HQDA 2KJWA 5D0RA 4OMFG 2DNNA 4QJVA 3BGRA 1N5YA 3C16A 3JQKA 4OZ3A 3EGNA 2HLTA 2VF3A 1TVRA 3RRKA 4HTIA 3JSMB 1JLAB 3D6TB 1J5OB 2HG4A 4WFNQ 4FPRA 1BGXT 2O67A 1H2VZ 2JL9A 4UUXA 4N8NA 4IR9A 1S99A 3P49B 2ZH8A 2V68A 3CD5A 1S1XA 4ES3A 3MFIA 1X5PA 4USMA 5KOWA 4XPCA 2RT3A 5J2NA 4G1IA 2XS5A 1CEZA 3M9NB 4MKVA 3TVYA 4IH6A 2XZTB 3ZZUA 4JUZA 4CH7A 3JSBA 5HATA 5ETRA 5KOXA 3R5DA 2B7CB 1GEHA 1BQNA 4F0HA 5CD4A 4DF8A 2IMOA 5H9EK 5IZHA 4R8UA 2XULA 3F44A 3LPYA 4LQ9A 4DFJA 4J9QA 3NMRA 4I0WA 2FGOA 2IYGA 3FRZA 4TQSA 1N48A 1U02A 3OL6A 3DLLQ 2ZEJA 1W25A 4C48A 3CIMA 4ZP7A 3Q8UA 5C24B 1U1OA 2PO4A 3OFGA 3H2VE 1HPZA 5E3RA 2ASJA 3CCMS 3HKZD 1YK9A 2WK4A 3C3LA 2MKSA 2J7WA 3I56S 1RLCL 1VJWA 3BGOP 1S9FA 1VHFA 5D77A 1MWZA 3GR0A 4EMDA 2E1AA 1S10A 1R8HA 3ZZZA 2VIHA 2MQ8A 2Q3PA 5T7LA 2BV3A 3M8ZA 2B4PA 1E6VB 1RT3B 1XMQF 3KK1B 2HNZA 3FVYA 4J9LA 1VRTA 1WC3A 5DM6Q 2JX2A 3DMJB 5E33A 4L74A 4OHXA 1FERA 2B9YA 3MCNA 2V50A 1SIZA 2H51B 2Y1LB 1YRUA 4OYAA 4CZCA 2BOAA 4OYOA 2HQFA 2BKPA 5F3TA 4O23A 1X60A 1VC6A 1S9GA 3EYZA 4DU8A 4I2PB 3MAAA 1KOOA 3QIPB 5DJBA 3CCTA 2JC1A 2F8HA 4IO1A 2D7SA 4OV6A 3ZZOA 2D9OA 1C0UB 2M88A 1MN9A 4J9KA 5L8RC 1ZM2A 4P52A 4DI6A 4DQPA 4TYBA 1GAOA 4OJHA 4JI5F 4OZ0A 4KYZA 4CT8A 2W9CB 1LWEA 3ENAA 1S1VB 3RB0A 2RHQB 5EHHA 3R7NB 5EX3A 4NX9A 2RF2B 3S1TA 2AX1A 1RHKB 5CYQB 1OSDA 3BEGB 2VFSA 1XNRJ 5DGAA 2BVZA 1EAYC 3PV8A 5IM0B 1U0SA 2R7WA 1N33F 2KTQA 2RS8A 1VGYA 2FVQA 4P2XA 2XYHB 1LW2A 2VG5B 3DN9A 2DBBA 5JJBA 1IKVB 5IV4A 1QLNA 2J8AA 4ID5A 2UXBF 4N5SA 2FVCA 2ZH6A 3LF0A 4I6WA 1TR0A 1HBUB 5DQHA 3MM8B 4HLBA 4J9NA 1T11A 5CQGA 3V2UC 2Q79A 2XO7A 3G71S 3IRXB 3JTOA 1JLEB 3TVKA 1WC0A 4FXDA 1VRUB 2G4BA 4Z7YA 2VBXA 4HL9A 3ZZRA 2VKZG 3BPDA 1UTAA 1VQ4S 2J0WA 1VBYA 4DV6F 4A8WA 1D8YA 2YWWA 2OELA 4ZIVA 4HT5A 5KFNA 2IPOB 1LK5A 4LIWA 2FDNA 1GMWA 4CDIA 3JSMA 1JLAA 4YEAA 2IVFB 3MXHP 1J5OA 1RE1B 2L41A 4X4RA 4B9NA 2YWHA 2BW7A 4A8KA 5KT4A 1CC8A 2ZJPQ 4OI6A 4F36A 3RRGA 1TP7A 1CS4B 1WG1A 4IG3B 4X4SA 4OX8A 3MAQA 3ISND 1TKDA 3TUJC 1H7WA 5K5MA 4YQWA 2B6AB 1JJ2R 1YWXA 2BQRA 4FF3A 2M8HA 2KVIA 2LYVA 3AXKA 2WZ1A 1Q8LA 1TQLA 3CJSA 2VD3A 3CPWR 1YBAA 3GSDA 2H4YB 2KRRA 3AQOA 4NWBA 4PG7A 2M4MA 2N82B 2WHOA 5ETPA 3TZXA 4WYLA 4E98A 1FEHA 5F9LA 1DQAA 2KDOA 2AYGA 4K4YA 1B0PA 5KFBA 4CLYA 1O5JA 5C24A 3CTRA 4B3SF 2IJFA 1Y11A 2VPWB 2EBEA 1CC7A 5B0GA 3KHHA 4ECYA 3DLKB 4LF9J 4U8YA 4RZRA 2JZ5A 1EQ0A 2YWFA 3CNQP 3OFHA 2MZTA 2P9CA 1CQMA 5CHCB 1MMDA 2QLXA 1IR1A 3HVWA 1NB2A 1DFDA 4DR2F 3W9JA 2KZMA 4LR8A 1SC6A 1E6VA 3KK1A 4C0HA 3OSPA 4C8KA 5LT5A 3MPDA 2XY6A 3GYNA 2IDEA 3DMJA 1KVKA 4DX7A 2YKMB 2ZBQA 2DO0A 5A8KB 3QGIA 1Q16B 1WHYA 3MD1A 3U7JA 3UO0A 2YQ3A 3QO9B 3LALA 5B09A 1JNRB 2W2PP 1I94J 1WI8A 4F4ZA 3PVXA 3MFHA 5I42B 2VG7B 3NEKA 4Q43A 1CJTB 1UA0A 3GJRB 3CC4S 2DXDA 4I2PA 4Y2IA 3QIPA 4I56A 1S0MA 2WB1D 3UD5A 4M94A 2OD4A 1FTCA 2YPZA 3V4IB 8RUCA 1XMQJ 3A13A 2MZ1A 2IJNA 1C0UA 3D28A 4OLPA 2EG2A 2KYXA 1D0EA 3KHGA 3LQVA 4ZVQB 3LGNA 4UY85 2ZBRA 4X62J 1VK3A 1S1VA 2HHTA 3PW7A 1OJ4A 3PG9A 2JVRA 4FZVA 3IN5A 1T9YA 1Y00A 5I3PA 2RF2A 1UZDA 3SQOP 5CYQA 2F4FA 1X4BA 4ERDA 1NU4A 1RHRB 3HDSA 1IWAA 2DNGA 5IM0A 4P2SA 4EBCA 3ULHA 3VAFA 4OHWA 1YBTA 2NCKL 4EBEA 4HVZA 2JH3A 4EO8A 5DG8A 2VG5A 4OIXA 2Z57B 3EE3A 4LR7A 1IKVA 4EO6A 2Q43A 3GJSB 2W9AA 3AY0A 5CCMA 2X1AA 3ETOA 1HBUA 3MM8A 3UWTA 1GK8A 1NH7A 3IRXA 1JLEA 1KC8T 4CCHA 3B6BA 2CQDA 1UZHA 1VRUA 3SFUA 2V8PA 3NLCA 1KN6A 4FKYA 3K2YA 4DJBA 3KUHA 3IBWA 1N33J 2AEFA 1N5VA 1HMVB 2NYHA 4FVMA 2WSFC 2W2MP 1YJRA 3RZAA 2G2YA 2UXCF 3VAHA 1HLWA 4FS2A 5C5JA 4I7FB 1APSA 3BO4A 3K0JA 3G6YA 4LVNP 3CJRA 1MWQA 2EK1A 4RKUC 2VICA 2E5LF 3MPUB 3G6ES 4J9MA 4DR4J 3I55S 1CS4A 4IG3A 2RVJA 1FDNA 4ECSA 4WF9Q 1AFIA 2HFSA 3T41A 4RW4B 3N0VA 2B6AA 3QSIA 4I69A 3DXSX 2LQBA 1BMQB 1S49A 1R43A 4ZCIA 1Q95G 1SKRA 4ANDA 2WONB 1UJ5A 5DGBA 3BZQA 4J9RA 1VRQC 1TK8A 3OL7A 4JI8J 1FDDA 4LREA 5JVGQ 1HARA 1SB6A 2R42A 4OV1A 3RYLA 4NLWA 4PWWA 4U8VA 1DAXA 2RRBA 5FD1A 1LFWA 1S9EB 3MPWA 1D9FA 1V3RA 5CH7B 1HWKA 3DLKA 4DUTA 3A8KA 2NZ4A 5L1IA 3A8IA 2FJVA 1TL1B 3WC0A 2QO3A 5ETVA 3KDOA 3CCES 2HBZB 3RB3A 4K0KJ 2V8DA 4Q44A 1FDAA 4QOTA 2XMKA 1YHQS 4B02A 2HHSA 3PZPA 1P9YA 1FDBA 4URGA 3PYFA 2AZ3A 2J7KA 3TR5A 2VFUA 2V2VA 4B3SJ 2OHDA 2DEJA 1TK0A 2YKMA 2K7JA 5HL7Q 5A8KA 4C3LA 3PX4A 2VUGA 1M1GA 3QO9A 4C7QA 1PAEX 1FE0A 1GQEA 2CWKA 4PWDB 5KG5A 5I42A 2VG7A 2PEBA 1CJTA 5ETSA 2PI5A 1F5CA 4P7VA 1JNZB 4F25A 4DR2J 5C25B 3N6MA 1EJ7L 1BHNA 3V4IA 2QA2A 1XIQA 3LH2S 4ETZA 5GADI 2J0XA 1ZTWA 2RRNA 3KK2B 3J7AN 3SSRA 5KFUA 2W4CA 3T5HA 1HD0A 4A48A 2M0GB 4NMXA 4DQIA 1T7PA 2ZUAA 3GV5B 2W25A 3EWGA 3W1YC 1KTVA 5LXRA 1QAIA 4YB6A 4RUHA 1UMJA 1KONA 3NS7B 3P96A 1K73T 5AE3A 3BSCA 3DI6B 3UCZP 3FCHA 4UZCA 4USKA 4FPIA 1JLCB 2E1PA 3N79A 5DZ6A 2JC0A 2MQQA 2ZUGA 2B3TB 4LFBF 3TP2A 2AEJA 2VA3A 2RE1A 3GZ7A 4QWEA 3ENWA 3IC1A 1YLXA 4B3TF 3I0SB 4U6PA 5IT0A 3CCVS 2ZDOA 1U8WA 3N5FA 2WVFA 2PIIA 1HMVA 4DZ6A 1C1CB 4N8OA 4FVCA 4WFAQ 2AJ1A 3ITHB 2ZKTA 1X7VA 2JEGA 3I5AA 3RBDA 3NMAA 3OD2A 4ZVEA 3MUVP 2NXJA 2LXUA 3G8QA 4I7FA 4QZVB 3US5A 5J2QB 4KKOB 1W2BR 1YRXA 1SH0A 2Y8WA 4I6YA 1ZS6A 4WIQA 2BQUA 5CYJA 1HWUA 5HQLA 4A8OA 3MMAB 2OJ3A 3HLUA 3UN2A 2LMIA 2NLWA 3L3CA 4RW4A 3M2RB 1G3OA 1N0UA 3Q24A 3MOJB 4V1Ak 3FFIB 1Q8KA 4JV2A 3OXLA 5KFZA 5HJYA 3IGNA 4OI4A 4NMLA 2E5LJ 1L3UA 2I0XA 4M5LA 4HDGA 2AGOA 1Y3KA 2XZWA 2VU5A 5A0YB 1HBOB 1UPMB 3TAMB 2DGOA 4J9UE 1M5HA 4A8MP 3H5UA 4ZK7M 2ZWPA 4ICLB 1S9EA 3A3OB 4C11B 1ITPA 2E1MC 3OJUA 2QGFB 2OPQB 4ZN3A 4G6VB 4ES2A 3IR5B 2ZKUA 4DSFA 4W92B 2XSJB 1TL1A 4JV1A 3LW5C 4RBUA 2WAQD 2V0NA 1R8PA 2K06A 1M90T 4YP3A 2HHHF 1XC9A 2BUNA 2L48A 4KE5A 1T9VA 2DYAA 2VPXB 3HZEA 3QAEA 2BA9A 2QA4S 2HHVA 3NXZA 2G1HA 2FHJD 3AD8C 2MKIA 2DJWA 4OYMA 2APOA 3VWSA 2CJ9A 2G0CA 4FYDA 4U7UK 2R7QA 3CD6S 4JI7F 2XWXA 4PWDA 4O3OA 4X2BA 4P73A 3T6JA 3QMQA 1KKHA 2BM1A 1G1XA 2DR5A 4C3MA 1JXLA 4LF7F 2EW9A 3QATA 4KQZA 5C25A 1G2EA 3UD4P 4IG0A 3GPAA 2ASYA 4U7UD 4Y34A 4GVLA 2F4VF 3KK2A 1HNWF 3E2EA 2EFNA 4HTJA 1NUEA 3PKMA 1H2UX 3HHDA 1U1KA 2XM3A 2RUSA 5KFYA 2ZH9A 5L1JA 5B0FA 3PFOA 3P6YC 2ROGA 3DI6A 2YKNB 3CJ8A 2DT9A 2HQ3A 4PG6A 3KJNB 1FWKA 4CLPA 1RU1A 5E3PA 1JLCA 1OYEA 3JQMA 2CJKA 3R8YA 2VOPA 4P75A 2JLFA 4DS5A 2ZOMA 2ROPA 1FJ7A 5LOQA 3C46A 3PRDA 5GADU 1DY3A 1Y7PA 5MLCV 5B08A 4WU2A 2ZBPA 2RNEA 3I0SA 1T3OA 5DM7Q 5KT5A 2H1YA 2A2CA 2FD2A 1U1PA 1MG7A 1GFWB 3ZTPA 2F8MA 4Z37A 3KYLA 3ITHA 2UXDF 4NXMF 1HR0F 4OX7A 2FJAB 4WCEQ 3QRRA 3M6WA 4K5RA 2R2RA 2QYCA 4LFBJ 1SV5B 4N56A 3FC9A 3LANA 2LEBA 5J2QA 4X4TA 1FF2A 2DNLA 2HWIA 2HWTA 2YKQA 3RG6A 4ZHRB 5KFMA 4L3NA 4PYDA 3MMAA 1XQIA 4A4JA 2WVBA 1Q4RA 4M5DB 2XSFA 3OVBA 4FF4A 3M2RA 4LFAJ 5IS2A 1ULRA 5HJXA 3AOBA 2NREA 2J9CA 3FFIA 2AP6A 2DCLA 3CSKA 2HAIA 1OQ6A 2HLUA 5ETOA 1WF2A 1UVKA 4NEYA 2XMMA 5LSLA 2NZCA 4UZBA 4CRJA 3I0RB 1CQNA 2B8QA 4CO4A 2ZJRQ 3GIMA 2IM0A 4KFBB 1KSPA 1EKSA 2E5GA 3D66A 3G4SS 3O5TB 4RUCA 4DL3A 4M5KA 3GV7B 5A0YA 3CCUS 1UW4A 1HBOA 2JNJA 3BKUA 2OP5A 1R8AA 4MKBA 3HVAA 1YI2S 3HSJA 2KHDA 1RKIA 2NXNA 3TAMA 3AJDA 4USUA 1N32J 1UEKA 4ETXA 3O44A 1D1UA 4UY8T 3OHBA 4Y2AA 1X5TA 4ICLA 2D69A 4C11A 1X4GA 4B9SA 3BREA 4DR5J 4M95A 2EFOA 1Y9OA 2OPQA 1SC4B 2ZBCA 3N4WA 1JJ4A 2IHR1 4DF4A 4KY3A 2N3LA 2F9DA 2XSJA 1NK8A 2BKOA 3P4UB 4TQRA 1NJYA 1X8DA 2XCAA 1DARA 3CCRS 5CABA 2WW4A 2DR8A 2B5JB 5HSPA 5DDRC 3ILIA 3IR7B 3AXMA 4X65F 1NK9A 3G9CA 2QL9B 2XY5A 3GCXP 3M30B 2P9EA 2EFQA 3PRVA 2VQFJ 2LA4A 5KFFA 2UUWA 2PMWA 2L9NA 3VQTA 5IT4A 1RWMB 4K50A 1RUSA 3N01A 4OLOA 2B4UA 2L9DA 1S0VA 1R27B 1X0FA 1UFLA 4DL5A 1XR5A 1Z4UA 2QV6A 4IH7A 5HMWA 2R7VA 1X9WA 2AF6A 4PG8A 2OLWA 4CLFA 1YIJS 1Z1ZA 2RILA 3RBXA 2K3IA 3HCXA 1YJWS 2O3DA 1YVFA 3EMTA 4QWAA 5KFLA 2N4DA 1S72S 3EGVA 3RRHA 4EK2A 2VHGA 2EI5A 1FKOB 3M8QB 1L5UA 2PA3A 5DDOC 4DUZJ 2VG6B 2DPIA 4DR7F 4F67A 3W66A 3UNGC 4JI7J 2OTLS 3HD2A 4CH0S 3BSNA 4ED6A 3LA0A 4LBIA 1XERA 2AYMA 1SC3B 4LF7J 3L09A 2HHUA 4BWMA 2YKNA 4NLPA 4OJGA 1VQNS 1D9DA 1XMBA 1VIOA 3W60A 1TFYA 4DOZA 1Y5LB 2UV8G 1HA1A 2X3DA 4ECTA 3LP2B 3QT7A 3CJQA 2DGQA 2QA1A 1OSCA 2Y1JA 1RI7A 1RWKB 3R7SB 1RCOB 3JTNA 4EZ9A 1S6PB 4OJ1A 1UEUA 1FESA 4W90B 1HI0P 3T1AA 4F0MA 1VFJA 2AYBA 4RNHA 3RGIA 4PPDA 4FNIA 4IH5A 4UOHA 1HWLA 1GXLA 2VJUA 1NBEB 5H9EJ 1VIXA 3OBIA 2DPJA 3H2LA 1FI4A 1Q82T 4K7QA 3NAIA 4ECRA 1PILA 4JBCA 2IM2A 3NWRA 2V2KA 5GVQA 3OUYB 1LXNA 1SV5A 5ITHA 2W2QP 1IQZA 4X64J 5K20B 2MMYA 4YY3F 1RWVB 3CW2C 2C2RA 4IO9Q 4ZHRA 3T1YF 1RHQB 1X4FA 3T9ZA 4DLGA 1RAAB 3HF5A 3FRYA 2YWGA 4M5DA 4OYIA 2PMZD 2QA4G 1UFKA 2P2CB 4IOAQ 4DPYA 4KGKA 1WORA 3CWJA 3A3PB 2CUYA 5JXSA 3QQCD 3LGMA 3DDNA 4EFAC 1S1WB 3MTJA 4Q45A 1NKEA 2NPIA 3BH6B 2HNYB 2Z2MA 2D41A 1NM2A 4F2RA 2HVHA 3I0RA 3D1HA 4KFBA 5I3UB 3TNVA 2OAUA 1TZ0A 1WEYA 4WWSA 4LF8F 1RBOB 2L3MA 1X4HA 4TN2A 2B9EA 2MLYA 2KH9A 2X1FA 2HGMA 3KG4A 2QLJB 2BE7D 2QTWA 5LJ5Y 3MWBA 1YKWA 4ED2A 3BH7B 4ZCLA 4DSKA 1NRKA 4OI2A 1QM9A 1BQXA 2ZVIA 2DY9A 1N88A 4ZVUB 2A0FB 2B7BB 3DRYA 2W8LA 3IG1B 1UVJA 3NCQA 2M9KA 2B5JA 3C14B 2MYFA 3M30A 1V5VA 2BX6A 3EUNA 8ATCB 2H5EA 2D3OR 2I1RA 4J9OA 3GMGA 3DDIA 3W9HA 3KJQB 3J7YI 4C8OA 1RKJA 2P5VA 4NOHA 1WWHA 2DNRA 4C8YA 3IO1A 1CSJA 3BQ0A 1FRXA 4XPEA 3CULA 3M4XA 1HW9A 4OX9J 1S77D 3R1LA 2W4DA 3BR9A 2HBYB 2DGVA 3V6DB 4P72A 5DQGA 1B70B 3C19A 2DNZA 4NI2B 5DZ7A 1XNQJ 4B3RJ 3R2CJ 4LIRA 4DEZA 2YKPA 2BKNA 1JJCB 1U45A 2R8KA 4RW9B 1OY6A 1FKOA 1BQMA 2GMHA 4BC9A 3M8QA 4C8NA 2VG6A 4DR1F 3M2VB 4NASA 2OGUA 1RP5A 3PTWA 3Q8VA 1XMOF 3U1MA 4WKYA 4OYBA 5CYMB 2LCWA 5J2PB 3HK2A 3C6TB 5FIIA 2YWEA 2QRRA 3I5CA 1RB0A 3MEEB 4DR6F 1N5TA 3CT9A 2UUBF 3SIPB 2AT1B 3GIJA 3GYXB 4G65A 4RU2A 4DN0A 3TZYA 2MSSA 1S5ZA 2GIFA 3LP2A 4WTYA 2HBRB 2GHVC 3NY0A 2CQCA 1OS5A 1S6PA 3VAJA 3ZZYA 2GO9A 2XMJA 1Q86T 4ALZA 1JLGB 2POKA 1NJIT 2ZDPA 2WSCC 2MGZB 4DFMA 4KHRA 1DHMA 3O8WA 4KPYA 4N77A 3M1VB 2MXYA 1EHWA 4YMEA 1RBLA 3EGZA 2VA2A 3CO9A 3S7RA 3D6HB 3D68A 4OYXA 4J90A 5HMXA 4NCAA 1F9HA 5THWA 3OW2R 4C9DA 1VQSA 2JVOA 4B3OB 4B3MJ 3OUYA 1RT5B 1WTFA 4PPZA 4TU7A 2OUGA 3MEGB 4AYBD 2PSZA 5ETMA 1OIAA 1U48A 2HQIA 1HNIB 4WK3A 5HAOA 1U2FA 3UDEA 2CIMA 2GS8A 4IFVB 4DV2F 4BLGA 2DHHA 1S1TA 4ELUA 3NRBA 1RISA 3FMWA 3SYZA 2FGCA 1LW0B 2DO4A 2CQHA 5GMKa 3EPIA 5HQMA 4U95A 2ZVSA 1DRZA 4Y65A 1S1WA 3F56A 1H73A 4NYZA 2XNQA 2HSEB 4ZVHA 2NXCA 1OWXA 2HNYA 1D09B 4URQU 2MEWA 4JYAF 1QAXA 4YR2A 2R2UA 1KP6A 1M1KT 5I3UA 2Q66A 4LRBA 4HHHA 2CRLA 4E0DA 1YJTA 4JI2F 2ZC3A 4ELTA 4PABA 2NQPA 5JUMA 2XO6A 3GV8B 3LWMA 3L95X 2V34A 1DJ0A 1WOPA 1U6BA 3QWUA 1VQ7S 3K5PA 4CO0A 3KHRA 1HQ2A 4JOUA 2AJFE 1ZZNA 4NLQA 3BDPA 4DCPB 1D3WA 3Q2SC 2R8HA 1GXUA 4CLWA 3BBBA 4OL8A 3Q8RB 1A0OB 2EWHA 2MZRA 2YPYA 3M9MB 1VQLS 1F5AA 3PDNA 3OR1B 4N76A 2AZ1A 1SPBP 1NZAA 4LFCF 4X4QA 4KGXB 3L4BC 2J5AA 3IG1A 2W7AA 1URRA 4Y2CA 1AA1B 2CPEA 3CIZA 4WU3A 3QZ8A 5KFPA 4H54A 1F6TA 4LF8J 3C14A 1JLFB 5D6GA 2KM8B 2XZDB 3AA9A 3I87A 3MGJA 5F0UA 1GH8A 1HNXJ 5CAAA 2HRYA 3OVAA 1HFEL 1FXLA 2NSBA 4FXWA 3NNHA 2DNQA 1TUVA 3H4DA 1KTQA 1ROFA 5HLFB 5KFGA 3VAMA 3T3FA 1H2TZ 3PW0A 4RBTA 1X4EA 2KT3A 3TA1A 2ZBIA 3PO4A 2R8GA 2Y1IA 4DQRA 3PM9A 3GILA 3D0IE 4K4VA 1O51A 3FMBA 4WJBA 4IDKB 2XEXA 4NI2A 3I4HX 4DS4A 4DV3F 3Q23A 1WOSA 1NDLA 4ECUA 2CG4A 4TKTA 3AT1B 2ACMA 4RW9A 4C3KA 5E3AA 4NLGA 2L08A 4AQYF 5L9XA 2GCFA 2KXHA 2RDIA 3M2VA 4PR6A 3LWLA 2A10A 1RWNB 2HYIB 4EBDA 2FLOA 3J7YU 2BZ2A 3WQPA 3SV4A 2AJ4A 5J2PA 3FSIA 3C6TA 3D1OA 1WHWA 3MEEA 1Q8BA 3AQPA 5A2QY 4ZPCA 2ZHOA 3IM8A 1U47A 3TEGA 4R0JA 3RAQA 3VZHA 4P10A 4DPUA 4C97A 1S59A 2V4RA 4ITSA 4EYHB 1YZ6A 4ZN1A 4MKYA 1JLGA 3KKFA 4F7VA 2IRYA 1QVGR 2MGZA 4M5HA 4PYAA 3EVMA 4M5JA 3UNYA 2DTJA 4HH1A 3TZZA 1NSAA 5KFHA 3M1VA 4QW8A 2ZH7A 1REGX 1FD8A 3FGVA 1OMSA 2GQQA 4MK8A 1N34J 1VQYA 2MZJA 3T5LA 4IYQA 2IM3A 1NHUA 3GU0A 4WPAA 4CLTA 1NAQA 2NYIA 4HACB 1RWWB 2KU7A 3DOLB 4B3OA 2CQ0A 4M5MA 2HNDB 1RT5A 1UETA 3NGTA 4BHQA 4Q7AA 2LFVA 5ADZA 3MEGA 2D74B 1UA1A 1SJRA 1UKUA 4ZP6A 2ZFHA 1VBKA 1HNIA 2AWZA 1PJ7A 1NCLA 4IFVA 3NL0A 3BGUA 2A1BA 3NGKA 4QWCA 2B4VA 4R5PB 3CE8A 4FF1A 1Z2ZA 4C8ZA 1VR6A 1LW0A 4QIEA 4F4AA 4NCBA 1UVLA 1RZMA 1NK5A 5L39A 4FYWB 4KGZB 2RB7A 5I3QA 4NRTA 5AXLA 1TU0B 3PIOQ 2E5HA 3R97A 2H65B 1R6YA 2KRBA 3LUYA 3RUBL 3CCZA 4OZJA 3D1QA 4ZPBA 4DV2J 2YVSA 1WG4A 1MSWD 4YS2A 4ZPVR 1IJEB 4LF6J 3AODA 3N28A 2UVVA 2WTFA 4UQGA 3H25A 2Y1RI 2UVRA 3HI9A 3KHLA 1X4AA 1U1LA 2OIHA 1WTBA 3PEJA 3QBCA 4CWBA 2C2OB 2KXFA 4JI0J 3PJWA 1DQ8A 1NDPA 2ATCB 3OR1A 2RUGA 4DX6A 5F8GA 1Q7YT 3OTDA 3UPFA 2HFVA 3P8BB 3HHLD 3DFEA 2BXJA 2DHAA 4UF4A 2FJBB 5KG0A 1JLFA 1RWPB 1RTIB 3BQ2A 3GWCA 4USIA 3T1HJ 3BYRA 5MAOA 2X3GA 2UU9F 1VMBA 3CEDA 5HLFA 2COLA 2V2ZA 2AIRB 3PO5A 3K8VA 4ZJQA 2ZM6J 3O1LA 4R0EA 4IFYB 4KB7A 4LFCJ 4ATNA 3GTYX 2MDAA 2KT2A 1P1TA 5EGYA 4HR2A 4IDKA 4KR0B 2KB2A 1HL6A 2XYPB 5KFRA 4F50A 3VTIA 3IAS9 4OYPA 1XNRF 2LQ9A 1U7LA 3GFXA 2OFHX 1WACA 3EZ5A 2LKZA 1WSRA 3V5RA 1GMUA 4WIIA 2CPJA 3IP0A 3CMAS 2RD5C 2DH9A 3F73A 2NXUA 2CXEA 4KSEB 3TWZA 4U9RA 1C1BB 4ZJOA 5CCLA 2K1RB 3AFGA 1CLFA 3KLGB 2H5IB 1UVNA 2ZHBA 3ISNC 1YJ7A 5E41A 1KWMA 4LRFA 2QG9B 1FRIA 3IXQA 5J1EB 2QZ8A 1U1QA 2FC8A 3PACA 4ZVTB 1HBNB 5KT3A 3I31A 1PKUA 2VBYA 1SXLA 4B9VA 4LRDA 2VQEJ 1BY9A 5F9NA 1E6YB 2BOPA 4IRKA 4DPWA 2QMUB 2EBGA 2WW8A 3FNNA 1HNZJ 2I9SA 1FRKA 2XC9A 3W3SA 5L46A 2V8GA 4HI2A 3LP1B 3LP0B 6AT1B 2V2QA 5B0DA 2IAJB 3F41A 2IJRA 5LXYA 4HACA 3EX7B 3DOLA 1QUPA 2ZH2A 2HNDA 2YY3A 3C66A 4JP8A 1JWWA 3DRPB 2DR7A 2ASDA 2H5JB 4GO5X 4RNMA 2HEKA 3GJQB 3IAM9 1FRLA 2HRTA 1TV6B 1KOHA 2C42A 1TKXB 1QD1A 3IMQJ 1IM6A 1UL3A 2H3EB 4WYWA 4OZNA 2ADBA 3W5XA 2A2DA 4R5PA 2ZZMA 4G1PA 1ZAXA 3NGSA 2J9DA 2C2MB 2EFVA 3FDSA 3UDCA 3UQSA 1UPPA 2FB0A 1VC5A 3HFZB 3DRSB 4E2FB 2XWYA 3QJJA 4PWUA 4M8LA 1NJXA 3D9BA 1FRHA 3PNIA 1VK8A 2GQ2A 2AU0A 4AL7A 1IBMJ 2JEFA 5IT9U 4LF9F 1UJ6A 4WBFA 4L72B 2WOMB 4ZS6A 1N52B 2IIHA 2DH8A 1P1LA 1Q5VA 3W8PA 5LMUJ 1G4CA 5KFKA 1VQ6S 3AB2B 2W8KA 4QWBA 5LSOA 1LXJA 1R8CA 3GJTB 3EVWA 3J7A1 3HHNB 2Y0SD 2CADA 3N6NA 4LJMA 3HFKA 3RAMA 1F3VA 4KH0B 1QSSA 3HPOA 2CQGA 2X1GA 1RTDB 1I94F 5SUHA 3UD3P 5A8RB 1RTIA 3NGUA 5LMNF 5H1SV 1UVIA 5DG9A 2YH1A 4QIVA 1LNQA 1ICEB 2ALYB 5A8WB 4JI3J 4LSZB 2CPDA 1U2RA 9ATCB 4F8RA 3O6QA 4IFYA 1PBUA 4O3NA 5D0EA 2DNYA 3LAKA 3NCPA 2YXLA 3PJXA 3SCLE 4X62F 1VQOS 4J37A 2A3JA 1SJ1A 3PHTA 4LF5F 2LVWA 2GW8A 2UUAF 3AD9C 4A46A 3H7HB 2OKQA 3MECB 3UCGA 3K5OA 2XGPA
chains in the Genus database with same CATH topology
2JLFA 4DS5A 2ZOMA 2ROPA 3BGRB 1VBXA 1FJ7A 2MHNA 3AAWB 3PRDA 1RT6A 4K4XA 2BM0A 2Q6CA 1ZM4A 4OQJA 1N5YB 2IRXA 4I4BA 2DNKA 4Q0BB 2V4JA 3CC2S 2FHMA 4MYTA 1IR0A 3CVKA 2XGQA 7FDRA 3M9OB 4FS1A 1XN9A 4G1QB 2BABA 4MAKA 1VQPS 1LOUA 3TO8A 1KR4A 1MROB 3IWLA 5GADU 1TVRB 3T9NA 4Q8EA 3H5XA 1A6LA 2HS3A 1Y7PA 5MLCV 1XK8A 2DR9A 2GX8A 3JYTA 3MR3A 3CCJS 2OMOA 1LWFB 4WU2A 5B08A 2NPFA 2CJAA 2RNEA 3GB0A 4KO0A 2F40A 3I0SA 2PC6A 2U1AA 1T3OA 3PR5B 5DM7Q 2ZNZA 5KT5A 2NUHA 3KLFB 4QU7A 1BC6A 4F3MA 1C1BA 3HHKA 2JFKA 2A2CA 2FD2A 1RTHB 2K1RA 2HW3A 2QE5A 3QZ7A 2YWKA 4LT6A 1U1PA 4Z2XA 2XLIA 5D4LA 2LLZA 1S1XB 2F9JA 2YNGB 4GKJF 4N47A 3KLEA 3IA0A 3M6UA 3KLGA 4ECWA 1LK7A 1YJUA 4WE1A 4LUBA 3NNCA 1VQ5S 4J9PA 2RS2A 2O1PA 3GQCA 5HQ8A 2F8MA 2MY7A 3VCDA 4Z37A 3H5YA 1T8EA 3KYLA 2C28A 2AYEA 3S01A 3BDEA 4A8YA 2OSQA 3ITHA 3N9UC 5J2NB 4I67A 2UXDF 1TKZB 5J1EA 4NXMF 5DQIA 1HR0F 2P9GA 4DWIA 4OX7A 3OLAA 1V9OA 4LSLB 4WZQA 3OXFA 2B0GA 1D9AA 2FJAB 5E3CA 4WCEQ 1Z2LA 1HBNA 2V9WA 4ED3A 3M6WA 4K5RA 2R2RA 2HHQA 1KFDA 2QYCA 2OFGX 4N41A 1SV5B 3M8PB 2OH2A 4N56A 3JAMY 1BQNB 6FD1A 1HYSB 2DGSA 3KNAA 1KVIA 2ALZA 3MM9A 2M2BA 3LANA 3B4DA 2LEBA 2W4PA 1FKAF 1K0TA 2CPZA 5J2QA 4X4TA 1E6YA 1FF2A 1I1GA 3GIIA 2FLPA 4J9SA 4B9TA 4JI1F 3MURP 2DNLA 4Y0FA 2HWIA 3FSYA 2HWTA 4R8UB 2YKQA 2VFTA 3B78A 2QIFA 3L7PA 2KFNA 2IFXA 1M5OC 4ZHRB 2CPHA 5AE1A 3QJLA 4WXOA 1QVFR 3Q0AA 3H59A 5KFMA 1U24A 1Q81T 4L3NA 4MTPA 2V94A 4DQSA 1J5EF 3MMAA 2OPSA 3CCLS 1Y5NB 4I64A 1KHVA 4A4JA 4K4UA 1Q4RA 4M5DB 2XSFA 3OVBA 5FJ4A 3CJ3A 4FF4A 3KOAA 3LP1A 2XMUA 1RTJB 3LP0A 3M2RA 3V81A 3PW2A 3MM7A 2E7XA 5IS2A 1ULRA 5LSRA 2IAJA 1HPZB 4ED8A 2E66A 3CJ5A 1L3SA 2NREA 2J9CA 1SJFA 3POTB 2MKHA 4DR4F 2ERRA 3X3UA 1GX6A 1RA6A 3FFIA 2AP6A 1QTMA 4YUDA 3RAXA 2DCLA 1XWLA 3CSKA 3MCSA 2MKCA 2HAIA 1OQ6A 2HLUA 2XMVA 4X66F 1WF2A 2MPUA 3KLVA 1UVKA 2HFOA 1A9NB 2XMMA 5FDLB 2CPYA 4IG0B 4CH1A 5LSLA 3VZIA 3DRPA 3KK3B 3O3LA 5C42A 4ZKAA 3MR2A 2VONA 3AH6A 3EXYA 3I0RB 1CQNA 1TL5A 4C0OC 1Y0HA 4CO4A 3DGPA 3GIMA 3ENVA 2ZJRQ 5HROA 2IM0A 4KFBB 1N34F 1KSPA 2FLNA 1Q53A 2D3ZA 2DNMA 1T05B 1KRPA 2E5GA 1FKPB 1MU2B 3G4SS 3UW1A 2CQIA 1TV6A 3O5TB 3PEHA 4RUCA 2KM8C 3M8RA 1SI9A 4DL3A 5CD4H 3GV7B 1TKXA 3CGIA 4O0IA 1HWIA 1IKWB 5A0YA 4PXCA 5K8PA 3FQLA 3CCUS 2ADCA 3CCWA 1UW4A 1HBOA 5T7LB 5BYSA 4Q5VA 4F26A 2PMHA 3OTCA 2OP5A 1R8AA 4MKBA 3OLBA 3CDAA 3HVAA 5KFSA 3THTA 2KKHA 2X51A 1YI2S 3QAUA 5F8JA 5H9FJ 1VQ9S 2KHDA 2HNZB 1RKIA 3MMJA 3TAMA 2W7OA 1VRTB 5KAKA 3CDBA 4NPOA 4CO3A 2HS0A 3THPA 1KLNA 4ETXA 3O44A 1NK6A 4KHPF 5DG7A 5KFDA 1D1UA 4UY8T 3OHBA 4Y2AA 4JI8F 1C0TB 1X5TA 4ICLA 4O3PA 2FY1A 3H8YA 4TY9A 2DCUB 4C11A 5DO2A 1SH3A 1X4GA 2Z4PA 4B9SA 1M5VC 4KRWA 3CJKB 3BREA 3N5BA 4YFUA 1TAUA 1JMTA 2EFOA 1Y9OA 2OPQA 1RDRA 2JHEA 2ZBCA 3A8EA 4M95A 1TKTA 3N4WA 1JJ4A 2XBPA 2IHR1 2W9BB 4DF4A 4HI1A 2N3LA 2F9DA 3J81Y 2XSJA 2RDJA 3DRSA 1NK8A 1PC5A 5IQ6A 4TQRA 1NJYA 1JKHB 3HVTA 3PX0A 4GKKF 2OPPA 1X8DA 2XCAA 1S9GB 1TK5A 1DARA 3CCRS 2WCXA 4BCAA 3M2UB 4QR2A 1HI8A 1S79A 4OJ3A 3PY8A 2ILYA 2DR8A 3HO1A 4NCGB 5KT6A 2KI2A 1K1SA 3BGFA 4IR1A 3HHLA 5HN0A 4QWDA 2B5JB 2OD6A 3WDOA 1IJFB 5DDRC 2Z2LA 3IR7B 4NLYA 4USJC 4WK1A 4X65F 2BRLA 5K8MA 1NK9A 1VQKS 2DNOA 4QQBA 3HHLC 1M5KC 3G9CA 4WFXA 4O3RA 1RQ0A 2XY5A 3QGPA 3M30B 1V6HA 2WOMA 3NAHA 3MHYA 4DV1F 2P9EA 2EFQA 1ZH5A 3MM6A 2YNIA 3R5CA 1U1NA 4F3OA 4LSNB 1R0AA 2LA4A 1S1UA 1H98A 2RKIB 3NP5A 4K0KF 5DLGA 5KFFA 2C2DA 5L1KA 2UUWA 4K4SA 3OFFA 1FXRA 3ZFVA 1S97A 2ZE2A 1OO0B 2GHWA 3VR1A 4H4KA 3BB5A 3DM2A 4WXWA 1LWEB 2L9NA 1FVQA 3VQTA 1H6KX 5IT4A 1V3ZA 4K50A 3TA2A 5DLFA 4LF6F 3U1LA 3U27A 4H4KC 3KJVB 4NLRA 3N01A 4OLOA 2B4UA 2B56A 2RJZA 2L9DA 4O44A 4C98A 2N4CA 1S0VA 4ZCMA 1R27B 1X0FA 1UFLA 4PKDB 3EPGA 4DL5A 1V3SA 3S8SA 2AW0A 3SZ2A 4CNZA 2D1CA 5KFAA 1XR5A 2PGCA 1Z4UA 2QV6A 2HHXA 4IH7A 4OHZA 5HMWA 2R7VA 2O01C 1GT8A 1X9WA 2AF6A 4JI0F 4PG8A 1IM4A 2OLWA 1YIJS 2VBZA 4M63A 2RRAA 1Z1ZA 2V8VA 1AFJA 2RILA 5F41A 2ZH4A 1TL3A 5A6PA 1LV5A 1KVJA 2K3IA 1LW2B 1RTDA 1YJWS 2CVEA 2K8GA 5KTQA 1CVJA 2O3DA 1YVFA 4ZPTR 4QWAA 5KFLA 1OPZA 5D8HB 1UVMA 2N4DA 5D4OA 5A8RA 5D3GA 4WKRA 1PGZA 1S72S 1RT4B 3RRHA 4ID5B 2LEAA 2EI5A 2FJEB 3GE9A 5K8NA 1FKOB 2UVUA 4X4UA 2M8DB 2HMIB 2E5IA 3DCAA 3MOZA 3M8QB 1QE1A 3AA8A 4HHJA 3FEZA 5A8WA 4RW7A 3E01A 2PA3A 5DDOC 1NJZA 1L5UA 4EWTA 4ECZA 2VG6B 2DPIA 4DR7F 1RA7A 4F67A 3TYTA 3UNGC 3CMES 1RT3A 2OTLS 3DLHA 4CH0S 3H98A 2CZVC 3BSNA 2IM1A 4ED6A 4ECXA 1N6QA 1REVA 3GFZA 1UAWA 3I6PA 2EK6A 2OO4A 3NS6A 3FSXA 3Q8PB 2FVRA 1XERA 4TY8A 3SFGA 2AYMA 3T1HF 4M1KA 3EGWB 3L09A 2HHUA 4BWMA 4QBUA 4DHVA 3PXGa 2DITA 2YKNA 5KFWA 4NLPA 4OJGA 1K9MT 2I5JB 3PW4A 3SCJE 4DL6A 1VQNS 1N4LA 4PXEA 2JRSA 2ZOFA 2BJEA 4BBYA 4C8LA 4DFKA 2KJWA 3K5LA 3SEOA 2P6TA 2VC0A 4AL6A 1D9DA 2PEHA 1XMBA 1VIOA 3BR8A 2BACA 2ZM6F 1TFYA 4DOZA 3C8YA 2ZC4A 4OMFG 1Y5LB 2DNNA 3MECA 2CFXA 2UV8G 3HX9A 1HA1A 2XI2A 3I9ZA 4QJVA 3IWNC 1S0NA 3Q22A 4ECTA 2BBEA 2HGNA 2IVMA 1AXQA 3BGRA 3J7ZT 1N5YA 1JIHA 3LP2B 4Q0BA 2XS2A 2DGQA 2QA1A 1HQUB 1OSCA 2YX7A 5B0AA 2Y1JA 1RI7A 3EGNA 3ZZ0A 4G1QA 2HLTA 3JTNA 3DRRB 4EZ9A 1S6PB 2KG0A 1MROA 1TVRA 1DZ5A 1NNDA 2KJVA 4OJ1A 1UEUA 2RQ4A 3RRKA 1FESA 4HTIA 4Y2MA 4W90B 5KG6A 3JSMB 1HI0P 1JLAB 3T1AA 2EPIA 1J5OB 1VFJA 2HG4A 4FPRA 4WFNQ 2AYBA 1LWFA 2F7VA 4RNHA 1BGXT 5HMYA 3GFHA 2O67A 2RSQA 4PPDA 4FNIA 1RGVA 1H2VZ 2GMLA 1SIWB 3CJ4A 2L9WA 4IH5A 3P5TL 4MIWA 5EX0A 1JX4A 4KC5A 2JL9A 4UUXA 3KLFA 1HWLA 1GXLA 4N8NA 5HI7A 1N56A 4IR9A 3AJ1A 1RTHA 1S99A 1M5SA 2V8HA 2W9CA 3P49B 2ZH8A 3CD5A 5HBMB 5H9EJ 1S1XA 2YNGA 1VIXA 2E1CA 1FCAA 4ES3A 2BQ3A 4MIAA 3MFIA 1X5PA 1NB7A 3OBIA 2DPJA 4PCQA 5CZVA 3H2LA 2ZNYA 5KOWA 3SDEB 4XPCA 2RT3A 5EWGA 5J2NA 3TAQA 4G1IA 2XS5A 1CEZA 4A8KA 1TKZA 1Q82T 2R2TA 1KEKA 3M9NB 3TVYA 4IH6A 3NAIA 3ZZUA 4LSLA 4OI0A 4JUZA 4CH7A 1X4DA 3JSBA 4O4GB 4ECRA 3DLGB 1PILA 4JBCA 2IM2A 3V6DA 2V2KA 5GVQA 5KOXA 1S4FA 1MWYA 2V9KA 3R5DA 1TL4A 2B7CB 3OUYB 3HM9A 2NSCA 1LXNA 1SV5A 2GIQA 3M8PA 5ITHA 1BQNA 1HYSA 2QMWA 1CG2A 1YITS 1IQZA 3K5MA 2MMYA 4DF8A 4ZVFA 2IVYA 2IMOA 7FD1A 5IZHA 4YY3F 5EWEA 3GR1A 3V6HA 4ED1A 3DOKB 2MZSA 2C2RA 2DGWA 4R8UA 4IO9Q 1ELOA 2JOQA 2XULA 3F44A 3LPYA 4LQ9A 4DFJA 3OV7A 2OSRA 4J9QA 1X4CA 2ZD1B 2FHKA 4ZHRA 4I0WA 2FGOA 3NMRA 3T1YF 1X4FA 3T9ZA 2IYGA 3FRZA 4DLGA 4TQSA 1N48A 4EEYA 4DV7F 3UR3C 3HF5A 3OL6A 3FRYA 4H4OB 2BR0A 3DLLQ 1W25A 1CPZA 2IA0A 2BW2A 2YWGA 2VQEF 4M5DA 1RT2B 2PMZD 2QA4G 2UVWA 3CIMA 4IOAQ 4ZP7A 3CDEA 4KGKA 1RTJA 3FZBA 5C24B 2YNHB 1BWEA 1U1OA 2PO4A 2R8JA 2FPHX 3OFGA 4MK9A 3CWJA 2J76E 1DBDA 3H2VE 5AXMA 2SXLA 1HPZA 2WB4A 2CPFA 2UZAA 5E3RA 3POTA 2ASJA 5IXUA 4P7TA 5JXSA 5CYMA 3CCMS 3HKZD 5KG2A 3RBEA 3LGMA 3DDNA 2ZHAA 5KFXA 2BDPA 4EFAC 2WK4A 1TFWA 1S1WB 3MTJA 3C3LA 4Q45A 1HNZF 1NKEA 2MKSA 2J7WA 5FDLA 2C3MA 4QR0A 3I56S 3NWGA 4PQUB 2NPIA 3TI0A 4RW6B 2HNYB 2Z2MA 2D41A 1VJWA 3KK3A 1S9FA 4F2RA 4KBIA 1KNZA 2HVHA 3I0RA 3D1HA 1F5BA 4QCLA 1GTHA 1VHFA 4KFBA 5D77A 1MWZA 3GR0A 5D4PA 5I3UB 2XLJA 1T05A 2UUTA 4BWJA 3TNVA 1FKPA 2O5DA 2E1AA 1MU2A 2OAUA 1R8HA 2FTRA 1S10A 3DLJA 3I4PA 2EG1A 1M5PC 2AJQA 3UCUP 1L3TA 3ZZZA 5KG7A 2XG8A 2Q1LA 1DTQB 1TZ0A 1IKWA 5G4DA 1FJCA 4CIOA 2Q6BA 1EETB 2Q3PA 5T7LA 4H4MB 3C2PA 1WEYA 3ZZPA 3IRWP 4LF8F 2BV3A 2L3MA 3KWMA 2B4PA 1E6VB 1RT3B 1XMQF 2GJIA 3KK1B 2HNZA 1X4HA 3FVYA 4J9LA 4TN2A 2DH7A 1VRTA 5EUHA 4TU8A 5CA5A 1FK9B 5DM6Q 2FHJA 3FJ2A 2MHEA 5LL6d 2JX2A 3DMJB 5E33A 2KH9A 2X1FA 2LDYA 2VFVA 4OHXA 2HGMA 3KG4A 1C0TA 1FERA 3TANA 2B9YA 1SIZA 1NKCA 1QAYA 5LJ5Y 1YRUA 3MWBA 4NA2A 3MM5B 3CJKA 1WF0A 4OZLA 4ED2A 2I8EA 1WEZA 4OZ1A 4YDDB 3E8OA 4ZCLA 2W9BA 2FIUA 4DSKA 1NRKA 4CZCA 5KFCA 4L6V3 4O3QA 4OI2A 1QM9A 1BQXA 5F3TA 1JKHA 1N88A 3OHAA 4O23A 1VC6A 1S9GA 2B7BB 3MMBB 3CJ0A 4OFZA 3EYZA 3DRYA 4I2PB 3M2UA 2W8LA 1KOOA 3QIPB 5DJBA 3IG1B 3MI7X 3CCTA 2XCPA 2JC1A 3H4BA 1UVJA 4NCGA 3NCQA 1F2GA 2F8HA 1P6TA 2M9KA 3THVA 3QYYA 1EP4B 2B5JA 1S6OA 2CQ2A 4XIUA 4IO1A 2MYFA 2ZOGA 2KO1A 3R3TA 4XO0A 2D7SA 2LU2A 1H3DA 3ZZOA 2D9OA 3L7OA 3KG0A 1C0UB 3M30A 2M88A 4J9KA 1OPIA 5L8RC 3EUNA 3TUZC 1ZM2A