2Z0GA

The crystal structure of pii protein
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
112
structure length
95
Chain Sequence
MKKIEAIIKPFKLDEVKDALVEIGIGGMTVTEVKGFDFLPKVKIEVVVRDEDVEKVVETIVKTAQTGRVGDGKIFIIPVEDVIRIRTGERGEQAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Nitrogen regulatory protein P-II
publication title The crystal structure of PII protein
rcsb
source organism Aquifex aeolicus
total genus 20
structure length 95
sequence length 112
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00543 P-II Nitrogen regulatory protein P-II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2z0gA00
4IYQA 2J9DA 3TA2A 2DCLA 1NAQA 3NCQA 4NYOA 4OZLA 5DRKA 4CO2A 1P1LA 1KR4A 2ZOMA 2NUUG 4YB5A 2V5HG 1QY7A 3MHYA 4YB7A 5D4LA 3AA9A 3M05A 2EG2A 3TA0A 3AH6A 4ZK7M 1UKUA 1UL3A 3CE8A 4AFFA 3BZQA 3OPKA 1O5JA 3HLUA 2O67A 4USJC 4USIA 4CO5A 4C3MA 5D4NA 1PILA 4CO3A 1UFLA 5D4PA 2Z0GA 4RWWA 3AA8A 1NH7A 2XBPA 3AHPA 1V3SA 2EG1A 2O66A 1HWUA 5L9NA 4OZJA 4WK1A 4CO0A 2J9CA 3T9ZA 1VHFA 2PIIA 1V9OA 2RD5C 4YB6A 4D3GA 1NZAA 2VD3A 2GNKA 4RLEA 2CZ4A 5DS7A 2NUHA 4C3LA 3GSDA 1J2VA 3DFEA 4NYPA 2J9DE 2XULA 4CO1A 4CO4A 4Y6IA 4WK3A 1GNKA 4CNZA 1XK8A 2XZWA 1H3DA 2XG8A 1NH8A 1OSCA 1VFJA 3L7PA 4OZNA 5D4OA 3N5BA 1V6HA 4CNYA 3O5TB 4E98A 4RX6A 4Y65A 2GX8A 3O8WA 4R25A 2E66A 3LF0A 3TA1A 3X3UA 4RWXA 4D3HA 2JJ4D 2NS1B 2ZFHA 4USHA 1O51A 4C3KA 2GW8A 1V3RA 3NCPA 1Q1KA 3NCRA 2J9EA 1UMJA
chains in the Genus database with same CATH superfamily
3UCZP 2MSTA 4XDDA 3MTKA 1RWNB 3VAHA 3OL7A 1TMMA 4JUZA 4LSNA 2GVZA 3NG8A 1UETA 2DNNA 1G4CA 1S6OA 3KUHA 5EUHA 3ILIA 3W63A 3KHHA 2FIUA 1FK9B 2CQCA 4ED0A 4CQ1A 2W25A 5IT9U 1JJHA 1NH7A 1H2TZ 3CC7S 1YRXA 1R89A 1SC3B 4K4ZA 1LOUA 5L9NA 3OD2A 1T9VA 3ISND 2IC3B 3BGLA 4EGLA 1H2VZ 3ITHB 3QO9B 1FKOB 2DNMA 1VRTA 3VQTA 2FJAB 1C1BA 2RH3A 1J2VA 5CZXA 3Q8VA 4WBFA 2DR8A 2BEFA 2Z8QA 2L9WA 2HQIA 2V4QA 4DR6F 5L1JA 1VFJA 4G1QB 2HQCA 2LYVA 2N4DA 4X65F 3N0VA 1IM6A 4HKQA 4FYDA 2EVZA 1KQSR 4ZVRB 3VVUA 1RE1B 4PXEA 4Y00A 4P74A 2VA3A 3G82A 3WDOA 3A1YG 2K1RB 2ZOMA 4YB5A 1HL6A 4DV4F 4IDKB 2BM1A 3JSMA 2JZ5A 1DARA 3SSRA 5KFYA 4KPCA 3MEDB 1YJRA 4NEZA 2V6AA 3R7BB 4IFYB 3HDSA 1N6QA 1ZAWA 2WVEA 2RQCA 4HYKA 2E9ZA 1HWIA 2WOMA 1Y4ZB 3HHLA 1RU2A 5C24A 2AJ2A 3QQCD 3AA8A 3PW0A 2C2RA 2GO9A 2EG1A 1N52B 5IV3A 2J9CA 4Y3CA 4QYZK 2DXFA 5ETVA 4ZPBA 1TQLA 3EJMA 2C2DA 2GIRA 4NCAA 2XYGB 3CB4A 4MTPA 4IQMA 5F8LA 3GWCA 2CVIA 4DUZF 3SFGA 3MAQA 3TYTA 2IM1A 1Q95G 3KJNB 3DM2A 3W2WA 4RWXA 4LFAF 2IYIA 1U2FA 3IP0A 4NLVA 4CT9A 4WYWA 1SQFA 4DV2F 5GAGU 1RAGB 1HYSA 2GHPA 4LBHA 1HBUB 1F5CA 3R7NB 1CJKA 3CXCR 5KFXA 1HBMA 2W24A 1S1WB 2QZ8A 2ZKUA 4B3OA 1FRXA 4O4GA 4RNFA 4DQSA 3PCOB 3FFIB 4KB7A 4KFBA 3CD5A 1TKTB 2F8EX 4NYPA 4E0DA 1HIYA 2HHWA 2OLWA 3BF4A 3G8SA 2ZKTA 5C42A 4WF9Q 2V8VA 5F8JA 3A3NB 1UVNA 3AODA 1ZM3A 2RRAA 3D1OA 3UN5A 2AZ3A 3M8ZA 3FKBA 4HT5A 3TUIC 3D0GE 2VASA 5CZVA 3HI9A 5LOQA 4CLTA 2B4OA 3Q89A 2ZC4A 1HFEL 1T05A 1HQEB 2XM3A 3UWTA 1UA1A 2HBQB 3FCHA 3I9V9 1RT5A 1MROB 1V5VA 3BB5A 3MWBA 4JI3F 5LXRA 1CQMA 3UFCX 2CJQA 3H90A 4LBIA 4FP9A 1U24A 1S1VA 1S6PB 3D6TB 4B17A 1Q7LB 2UUBJ 1IBMF 4I4BA 2LP4A 3D4JA 1RT1A 2DNGA 3SCKE 1TU0B 4CT8A 5I4MA 1ZYQA 2GO8A 1KHWA 4ZJLA 3HSZA 4TU8A 1T94A 3PW7A 2WSEC 3CJKB 4DG1A 4TLQA 3EGNA 1CLFA 5A8WA 1RCOB 3C16B 4DOZA 4LREA 4JI1F 4EEYA 4LBPA 1AFIA 4LF6F 2UXCF 1IKWB 2OEKA 1UA0A 3RW6A 3M2RB 1RTJA 3BKFA 4MIAA 5D78A 2QMWA 5AE2A 1YKWA 4OYOA 2QFJA 2J6UA 3PYGA 4F4AA 1P27B 3MM9A 1O0PA 1BWVA 2CYYA 3AY0A 2JEJA 2F1FA 1VBKA 5DDRC 1DBDA 3GCXP 4NLOA 5IFMA 3JS9A 2DPIA 4LFCF 4MKAA 2L9DA 5AJ3J 3TOQA 3G9CA 3K0JA 1VBZA 3GU0A 3MZIA 3M8WA 3DYAB 3FBBA 1B64A 2HMIB 2GHVC 2ZH4A 4GKJF 2CZ9A 2KG1A 1VHFA 2FVSA 1OWXA 4MMOA 3SDEB 4EWTA 2Y1IA 3U7JA 2HNDB 3J81U 3NAHA 4NLGA 5BYQA 3NBPB 4J9QA 2D3ZA 4USUA 3ZTQA 5GADU 2N82B 1YLXA 2HBRB 4DXLA 3A3OB 3QT5A 4K4VA 1CPZA 3DLKB 3V4IA 1FE4A 4ZP9A 2OPQA 1RWXB 2DGVA 2OSQA 3DRPB 1L3VA 3TJ9A 2QE5A 3SQGB 4DSFA 1FJEB 1TL3B 4OYAA 2KB2A 3KK2A 6FDRA 4W90B 1XNQF 1E6VB 1XR7A 3BYPA 2M3DA 1M5PC 2D3OR 3MM6A 3IAM9 2RQKA 3J80U 4JOUA 3D3CJ 5A8KB 1O5JA 2VA2A 3UD4P 4ZCLA 1RTHB 2YQ3A 1OPZA 5D0RA 2AYGA 2OGUA 4LRCA 3EZUA 3WX8A 2BRKA 5IS2A 4B3SF 4RU2A 3MM5B 5KOWA 5KFQA 3LP1A 3LALA 3MPYA 3R5BA 2RQMA 1XERA 1JJ2R 3POTA 4UOGA 4LF8F 2DH9A 5HQMA 2KHDA 3OUYB 1FX4A 1DTTA 4ZPAA 2KZMA 2VG7A 2A6OA 3GG1A 4EI2A 1RHKB 4NL5A 4USTA 3QBCA 1FHTA 3MR7A 3G86A 2MLZA 2DO4A 3LP0A 4NRTA 1D8ZA 4YUDA 3HVWA 1W2BR 2DRAA 3TAQA 3TX0A 3NOGA 1N5QA 4HTIA 3FZBA 4ECXA 2CPDA 2H9ZA 1JLFA 3DLGA 2XZTB 1WEXA 1NK5A 4B3MJ 1CJVA 4A47A 1SKWA 3R6GB 5H9FJ 4MH8A 4F4KA 2MQQA 3GYGA 1FFSB 3TAPA 1IBKF 3V6KA 3KLHB 2XS7A 3VZHA 4Z7CA 4KY3A 3U1LA 4B9UA 2J0WA 2MZRA 2CFXA 2R8JA 2V63A 2MQPA 1YWXA 3MUVP 2VBXA 3I4PA 3MTJA 4K4XA 1HQUA 4ID8A 1NSKL 2XG8A 1NH8A 1IBLJ 3NEKA 1K47A 1PJ7A 4DHVA 2OO4A 2RHSB 4Q44A 2KVIA 1F2HA 1HMVA 2JRSA 4A8FA 3TQ1A 3I31A 4U67Q 2DR5A 3J7Z5 1SKRA 3VF0B 2DKOB 3JTNA 4P73A 5F3ZA 1SQEA 1N54B 4LSLB 4J37A 2AJ0A 2F7VA 1P1TA 2MQMA 3QWPA 2MDAA 3AD8C 3EPGA 4ZITA 4ETXA 3G4SS 3FEXB 4CO5A 2E29A 1RTDB 2DRBA 2AX1A 4QIGA 2VONA 1RQ0A 2XBPA 2V69A 3IRWP 1CS4A 2A0FB 2BBEA 3C8YA 3EVMA 5B08A 4ED8A 1S1XB 1SVDA 1ZM4A 4CYUA 5KT6A 2HWHA 4NE9C 1LWFA 3FRZA 2WSCC 3GR1A 2ROEA 2LXFA 3IAS9 5DG8A 5F8GA 1N32F 2XZWA 2MGZB 2L08A 2OPRB 2GQQA 3ILOA 4R0JA 3NS6A 5AXLA 5F8HA 4R25A 4F25A 2FVCA 2CPJA 2VICA 5HROA 2PEHA 1VJQA 4DFMA 1J5OA 4U7UD 4EZ9A 4KPYA 2NZ4A 2DR9A 2PDAA 1CSJA 2FJDB 2E44A 1YG0A 2AEJA 4NLQA 4FF2A 3IG1B 2LDYA 4LF4J 4USJC 2VODA 4UOHA 2VJUA 3U02A 1UWBB 4KT0C 2H51B 3THPA 4DDFA 5F8IA 2LMIA 4CH7A 2VHGA 3CC4S 5J1EB 1X4CA 4PG6A 2YBVA 3K5NA 2ZEJA 4ZVTB 3CJRA 1T9WA 3PRVA 3DOMB 2BKOA 2XMJA 4J9MA 2GC8A 5I3UB 1K1QA 5KG4A 2XNRA 4K0KJ 2OTLS 4NZ6A 3FGVA 1T02A 2RUSA 4NLPA 3JSRA 2F9JA 4CLSA 3UCUP 2WBRA 4ERDA 2ZHOA 5CCLA 2LQBA 3UNYA 3RAMA 5B0CA 2AJ4A 1YTYA 2EBGA 4WXOA 1T11A 2BQUA 2E5LF 4BLGA 3D9BA 1VQLS 2EFPA 2K7JA 4K5RA 1UW9A 2QLXA 2QMXA 2VG6B 1N33J 4B3RJ 1HARA 2HVHA 2EI5A 5SZTA 2IRYA 4CLYA 1U2CA 4PQUA 4WE1B 1R27B 4Q2MA 2VFVA 2BANA 1QE1B 2HS3A 4KV8B 3MMCA 5IT9Y 2B6AB 1HI0P 3OSPA 2H5EA 4WIIA 1XBWA 1VCTA 4V19X 3VAJA 4DR5F 4C8YA 4H4OB 1HHSA 2DHHA 1U1RA 2EKNA 3LGNA 5KT2A 3MMAA 4K2JA 1Y9OA 4CLFA 1XR5A 4UOFA 1F9EB 3CDEA 2CWXA 1YRTA 4U95A 4F7VA 2ASLA 3TP2A 3C6UA 4ED4A 2KZZA 3TUZC 4DR3J 5IQQA 2JJ4D 2G4BA 1RWVB 2RMLA 1BQMB 1JLCB 5A8RA 1TELA 3Q23A 2OI2A 4OZLA 3Q24A 1P1LA 1SL2A 1NSQA 3NGRA 3A8EA 3TNVA 4LSNB 4DQPA 2MB0B 1FXLA 5CCMA 3GG0A 1ZZNA 1U1QA 3QAUA 1KKHA 3U1NA 4CO3A 3OR2A 4DLEA 4CP5A 4ATNA 1SH3A 2CG4A 1PYSB 4IR9A 3UDCA 4DCOB 1E6YA 2NYHA 4YN3B 1RT6A 3CJ2A 2AHOB 4FF1A 1QUVA 1UFWA 1VRTB 1Y7PA 3ISNC 5DDQC 1LWCA 1C1BB 4GC7A 2FJEB 1VQ4S 2GMHA 5L46A 2ZZNA 2G2ZA 4OJHA 2CPIA 1UPPA 5B0FA 3W3SA 1OYDA 2DNKA 3BKUA 1Y5NB 4M8LA 1K44A 4I68A 2HRYA 2DR6A 2DEIA 4DX6A 4KKOB 2GAGC 2K7KA 1KVKA 1QSYA 1FTCA 2ERRA 3D3BJ 3E8OA 2DBBA 3MD1A 4K8RA 3UD3P 2MKYA 1XQIA 4C11A 2YWKA 3K58A 5L8RC 3KG4A 5E7OB 4B9SA 2MTLA 3JSMB 3AA9A 1WSRA 3NAIA 1SC1B 3ZZYA 5LSOA 2P9GA 5C25A 2RQ4A 4RNOA 1RACB 3ZXWA 4X84A 2EFGA 3HHEA 2K3IA 3SV3A 1N6QB 1H38A 2JDJA 5I3PA 2ZZMA 2WOMB 2XMUA 4ETZA 3HHLB 5C24B 2J0QD 1TK5A 2J8AA 2ZVIA 3NY0A 1JLAA 4ECTA 2C2NA 4FZVA 3DHWC 2ZWOA 1H7WA 4TN2A 3H2UB 2W2NP 4P2XA 4OJGA 1M90T 2GFFA 4R5PB 4LF9J 1HQ2A 2B4UA 1J27A 3RW7A 1R0AA 1N5VA 3B8HA 2KFYA 2D3O1 4NXNJ 3J7YU 1X0FA 1AT1B 1V6HA 3WIUA 3DM2B 3W2WB 4DPTA 3PFOA 2R42A 4BWMA 1HA1A 1FEEA 3S01A 3PEHA 5DO2A 1C0UB 1V3RA 5KFWA 3DKDA 1UMJA 3M8YA 4LF4F 1NAQA 4PR6A 1Y3KA 4YY3F 3CNQP 5KFBA 2C22A 2V2KA 3NGUA 2W4PA 3HVAA 3G6VA 1HYSB 1FDBA 4NCGB 4HR2A 5E3QA 3CE8A 4FPIA 1VLYA 3QRRA 4LR7A 2GHWA 1CJKB 3G6YA 1KONA 1HBMB 2W7OA 1Q78A 1IKVA 2QO3A 4YS2A 4IH6A 2PA8D 2QJ3A 1KEKA 2OH2A 2B9YA 3CDAA 3PX6A 3PACA 4B3OB 4O4RA 3BBFA 4O4GB 1X4BA 1IBCB 2DNQA 3P96A 5H9EJ 5FLXY 4GVBA 1WSVA 2RRBA 3H4BA 3J81j 1U6ZA 4KFBB 2AYMA 3M8RA 4IUFA 1S79A 2K3KA 3PW5A 2DGWA 3MDFA 3CCRS 2ATLA 5C42B 4JV1A 1KQKA 2B8QA 4M5IA 2WCXA 5CYMB 1KLMA 2GX8A 4NMXA 2V4RA 4ICLB 1HNIA 3BH7B 5HVHA 2YNFA 5HQ8A 4B3RF 2V9KA 5H9FK 3HSDA 4P71A 3A4TA 5HSPA 1WACA 5B7WA 1HBOA 4P7VA 1TTHB 1T05B 4H4KC 1VIOA 4NASA 3PEJA 1QSLA 3HZGA 5E33A 4B9LA 4LSZB 3UE2A 1RT5B 2CQDA 4WFXA 2F3JA 3BZQA 3OPKA 1S1VB 5HATA 5KG7A 2GGPA 2R4FA 3M32A 1GQEA 2G1HA 1QUPA 2XI3A 2W8LA 3OL6A 1TL1A 2MYFA 1Q4RA 1RT1B 5BR8J 2Z56B 3DLEA 5EWEA 4NLSA 4WFNQ 3KLEA 1TUWA 2NXCA 2V8PA 3MEKA 2BRLA 2FJBB 4BC7A 4DG1B 1UEKA 4ECQA 1WC1A 1X0PA 5A8WB 2YX1A 1X9SA 3DFEA 3NP5A 3BR9A 2QLJB 4DR3F 2M5YA 4BHQA 4IOCQ 2R2RA 2B5JA 2PI4A 4I2PA 1MN7A 4S0MA 1RTJB 1XMBA 4GKKJ 1RHRB 1VQ6S 1TK0A 2DHAA 4USHA 4ZN1A 4K4UA 2Y8YA 3NS7B 4PKDB 4BBYA 1IQZA 3UNGC 3DNCA 3CCQS 1S48A 2QT7A 1CVJA 2J9DA 2YQ1A 1DZ5A 1MMLA 2CG8A 4XPEA 5CH7B 1X31C 3WZ0A 1IJFB 1N34F 2DD8S 3L95X 3LGMA 2JEFA 4NLXA 2DGOA 3UW1A 2HLTA 4DSLA 1Y3JA 1SXLA 3J80Y 3KDOA 4USIA 2NR0A 3MGJA 1VDHA 5CYQB 2H1YA 4GRSA 1HHTP 2VFUA 2R7RA 3G71S 3V5RA 4BS2A 1KQFB 3UQSA 2RKIA 2E5HA 2AYEA 2J0XA 2HFVA 3DI6A 2AF6A 3C6TA 4RJVA 5DLGA 1AB8A 4L72B 3ADAC 3Q8YA 2BKNA 3V4IB 2C3UA 2P6SA 2OPQB 3QIPA 2RHQB 3SV4A 1CQNA 1FXDA 2G13A 1YDLA 1ZOTA 1UJ6A 3KFWX 3EXYA 2LA6A 2IPOB 2YWWA 4DN0A 2XY6A 4XPCA 3KK2B 2FLOA 3MR3A 5JVGQ 2O1PA 2NXJA 2OFGX 3L4BC 3MM6B 5HMWA 4L73A 4H54A 2CNOB 4DSIA 2C3MA 2KG0A 1GEHA 5D3GA 3K59A 5F8NA 4N5SA 3NMAA 3F73A 3G2XA 1X60A 2V4JB 4IO1A 3ZZUA 2QLBB 1PBUA 2VDHA 4TU9A 4IOBA 2YNHA 4NRUA 3LP1B 2QA1A 3QZ7A 3SBMA 2Q3PA 5CAAA 1L3KA 4FDFA 2F9DA 2Y8WA 3LOUA 3POTB 3SEOA 1TVRA 5KFHA 5HK4A 4IR1A 3HSJA 1DTTB 2QMUB 2VG7B 3H5UA 1QJHA 3W65A 3DOLA 3MAAA 2FDNA 5F8MA 4DR2F 2DRDA 1HWLA 2IAJA 1D8YA 3LP0B 2NCKL 4WPAA 1URRA 8ATCB 1FO1A 5GAGI 4DF8A 1JLQA 1PBAA 4QQBA 4M94A 2XHCA 2VBZA 1KC8T 1T9UA 2LQ5A 3HHKA 5CABA 2CPEA 1JLFB 3RR7A 4M63A 3DLGB 3PYEA 2CJ9A 2KFZA 2HHPA 3OJSA 1CJVB 2M8DB 4P52A 3R5GA 5JJBA 1Y10A 1HWJA 1VK3A 4Q45A 2UVWA 3OW2R 1N5SA 4WWSA 4RUAA 3KG0A 1BGXT 2MLXA 4ED6A 4JYAF 2DNRA 2E5IA 4OIXA 1HQUB 5KG2A 2CQ2A 3I32A 2QLWA 2HHUA 1KRPA 3BREA 2BJ7A 1EQMA 3OHAA 2OKQA 2CDQA 3L7PA 2BXJA 1IWGA 4QR2A 1HMVB 5C7PA 3KG1A 4KAIA 3RYLA 1EETA 2B4VA 3IN5A 2DO0A 1TL5A 2A18A 3CCUS 1WG5A 4M95A 1CJUB 4QZVB 2VUGA 5KG1A 2DIVA 4OHXA 1RTZA 1C0TA 3SCJE 4DN9A 3FMBA 4DPWA 3DLBA 4M5MA 5AE3A 1U1KA 2AYBA 2R8IA 3BO3A 2W9CA 2D74B 1NCLA 1RHMB 3PKYA 1LFWA 3CJ0A 1XMOF 3AJ1A 3UDLA 3M8QA 1H7XA 1VOMA 1UPMB 1CS4B 1NKBA 2CUYA 2E1CA 4I64A 2Z58B 4DR7F 3VTIA 2AGQA 4CYUB 5B0GA 3CTRA 2RD5C 3TVKA 4YR3A 1R7IA 3EVWA 4NXMJ 5LL6d 5BYRA 3TEGA 4ZIWA 3AJ2A 4ZCMA 2W7PA 4ANCA 2RT3A 1VBXA 3EGZA 1FVSA 3R1HA 3GFHA 3M8SA 4NLDA 3HMJG 4QIVA 4W4MA 4A8XA 2FZGB 3IXQA 1HBNB 3DDIA 1ZZFA 4P9SA 5HROB 4D3HA 4L3KA 3CJ5A 2WB4A 1JK9B 4X64J 1J5OB 3HD1A 4FXDA 3TRGA 2UUAJ 2MZSA 4F0KA 1BQXA 2YNIA 3HVTA 1HNWJ 5K20B 1C1CA 1WNEA 3QYYA 2AX0A 5G4DA 1RLDA 1WOOA 5B0BA 4ZPWR 3N6LA 4NZ7A 4TNOA 2QEXS 4I7FA 1SCJB 3H20A 5F9NA 2V2QA 5K8OA 4NWBA 4KO0A 2OSRA 3CJSA 4QPXA 4C0BA 1NB2A 2DNPA 3Q22A 4O44B 3JAMY 2Z2YB 1DRZA 3TVYA 2OPSB 5GAHU 3L7UA 2J9EA 2WTFA 1VBYA 1QY7A 1H73A 3KKFA 4YB7A 3H25A 1UVMA 1FT8A 4OV1A 3KDNA 3W9IA 1ACMB 4AUKA 5H9EK 1UVLA 2KXNB 2FC9A 4PQUB 2Q6BA 2C3OA 5ETRA 4AE5A 2DGSA 3HXMA 4OHYA 1G2EA 1VQ8S 3HSGA 1RISA 3MMCB 2H5JB 1NHUA 1RAJA 1IQTA 1D1UA 3I82A 4I56A 3HHNB 2YWEA 1FDNA 4PG5A 2NPIA 1TFWA 2HK2A 3K8VA 1ULRA 4JI7F 4P2SA 2PIIA 2B51A 3HFVA 4CLPA 4OMFG 3GE9A 4QCLA 2CVEA 4KHMA 2DPJA 3MMAB 1I6JA 4USWA 2CJKA 4OX9J 4K7QA 5JUMA 3C6UB 2H4WB 4K2XA 1OY6A 1N0VC 3BQ2A 1FDAA 2YVSA 8AT1B 2U2FA 1M0SA 2GQ2A 2KHCA 3U1MA 3E3XA 4YEAA 4ES1A 3MCOA 2PD1A 2PO4A 4ZVSB 4UY85 3KJQB 2MEWA 3OR2B 5D4NA 3M6XA 4E8UA 4ZA1A 2JLFA 2FY8A 3GTYX 3DLHA 2RILA 1VQ5S 1E6YB 2Q79A 4WZQA 2VBWA 1RT6B 3TEHB 1NDCA 2R7TA 2LU2A 1FWKA 4MKYA 3NWGA 4DR4J 4EO8A 4LFBJ 2QL9B 9RUBA 2MKKA 2VBYA 1LWCB 3E2EA 1NBEB 1N48A 2F4FA 4P7TA 2B0GA 1X8DA 1KD1T 2FZCB 4KHPJ 1IJEB 2JSXA 3K5PA 2VOPA 3EXCX 2W8KA 3ULHA 2QA2A 2UUCJ 3G6ES 4QWCA 2YQ0A 4C11B 1KLNA 2EEYA 3JTOA 2Z2ZA 2ATCB 1FNXH 4QPTA 3OLBA 2RDDA 2FVPA 5CA5A 1D9FA 3I0SA 1PAUB 4DUYF 2C1EB 5GMDA 3MR2A 2IM0A 4NOHA 4F50A 1WC3A 4NXMF 3AHPA 1JLAB 3WHIA 3ETMA 4OX8A 2RE1A 4PUOB 1REGX 1QAIA 3CJ3A 4JI5F 3GCWP 4J90A 3GIMA 3R5JB 4C48A 1SJ4P 1VQ9S 3EUNA 1YJ7A 3ZZRA 2CQ3A 2QL5B 3DOKA 4QW9A 3NNHA 1R0AB 3GSDA 2LEPA 3FSXA 3CSKA 3AFGA 1AZSA 3W62A 5IZHA 1GK8A 4OQJA 4DSEA 4L75A 2D1CA 4DEZA 2KT5A 2OJ3A 4KSEB 2QSWA 2HGNA 4ZPCA 4OYXA 2A2DA 2FJVA 4MIBA 3RBZA 1Q8LA 2KO1A 1UEVA 2DJWA 5J2PA 3VGSA 4EFAC 1FFGB 4ZHRB 3CJ8A 2K8GA 4MIWA 1HNWF 4IYQA 1RJJA 1Z4UA 3TUJC 4UUWA 4HDGA 2ACYA 1U2RA 4R8UA 1AUDA 3ICLA 2OUGA 3I0RA 3AH6A 4CH1A 3D28A 3CCZA 1U49A 4DV3F 1IKVB 5HL7Q 1U47A 4YMEA 4QW8A 3PR5B 1FVQA 1BY9A 3MEGB 2XMTA 2C3PA 2NYIA 3KXDA 4CRJA 2ZDOA 3T6BA 4CH0S 3T9ZA 1LXJA 2ZD1A 4HHJA 1WWHA 2VD3A 3IWXA 3KJVB 4MYTA 4PWUA 2DH8A 3SIPB 2KH9A 3AXKA 5HJYA 4TU7A 2UVVA 2R2TA 2Y0BB 1VIXA 2JLEA 4QWBA 5HN0A 4E98A 2O01C 1HNIB 2UP1A 1DLOA 2KDOA 2ZFHA 1CBKA 3I9ZA 5LMUJ 2VQEF 1XEZA 5DG7A 4RBUA 3NCPA 2LFVA 3NCRA 4ECYA 3SI8A 2FHOB 1HBOB 4XIUA 2UZAA 3GIIA 1NK9A 2M88A 1VQOS 2CDRB 2HFUA 4ZP7A 4RUCA 1FRLA 3BS9A 2J7KA 5AXNA 3I4HX 2GGPB 5KG0A 4Y2MA 3M32B 3BSAA 2DHXA 4DX5A 3FDSA 2B3TB 5A0YA 1GTEA 3UDEA 1TL1B 1RKIA 1S0NA 3DLEB 1WI6A 1WF1A 2IJRA 5HP1A 3W7BA 4USKA 2LLZA 5ETLA 3RB0A 5I42A 3KLEB 3FQKA 2G9OA 1REVA 2AW0A 1WF2A 2BQ3A 2XULA 2LXUA 4C8ZA 2B5JB 1VMBA 2VH7A 3BDPA 1ZAXA 1BD6A 4OYWA 4QU6A 1RSCA 5KFRA 3C15A 3OTBA 3CCES 2ILYA 3KLFB 3LW5C 4DL4A 1M1HA 4LIRA 4DZ6A 4C0HA 2V5HG 2HKEA 4ALZA 3AQPA 2BJ1A 2ZJPQ 1WTBA 5D0GA 1B3TA 4KGXB 1RADB 4W98A 4QR1A 2QC3A 3DXSX 2LQJA 4UW2A 3B82A 2KJWA 3CCSS 4LFBF 4K4TA 1QLNA 2V68A 2HHQA 5GMKa 4X62F 1B7FA 5K14B 2B9WA 2XWYA 2RKIB 3H7HB 5L1LA 4O3NA 4B3TJ 3DI6B 3C6TB 2L41A 5U47A 4OHWA 4YR0A 3NMRA 2CQ0A 1ICEB 1A0OB 1RA6A 4NI2A 4FKYA 1FE0A 2I6WA 2KYZA 1KFDA 1YBTA 4UQGA 5CD4H 1FNMA 1FJ7A 1NM2A 3QIPB 5KFMA 4ELTA 2DGUA 3W8GA 5AXKA 2JEGA 5T7LB 1S7IA 1RK8A 3JSBA 4ZVGA 5FIIA 1Y11A 1FD8A 3NKYA 3JXOA 1ZTWA 2HVZA 1NB7A 3EX7B 1UJ5A 1NJZA 4MYUA 4HT7A 2B56A 2UXBJ 5B0EA 4JI6J 3QT8A 3WC0A 4HTJA 4WJBA 5D3GB 4PXBA 4Q8EA 2I5JA 2Q1LA 3CT9A 4I2QB 1S59A 1KVIA 2XO7A 4QWDA 1SPBP 1HW8A 2QLFB 1WORA 3TJ8A 1X5SA 3ZZOA 2YNHB 1NNDA 3UD5A 3M9MB 3HHLC 4CO0A 2J7WA 4O3RA 3ZNJ1 5DZ7A 3G8QA 2I8EA 3T1HJ 1TVRB 3L9ZA 3EWGA 4B9VA 2DHSA 4X2BA 3MAAB 4YP3A 4ED3A 2YY3A 1Q0NA 2KM8B 4CIOA 2UU9F 4P10A 3CO9A 4QYRA 1AROP 3GMGA 4DFJA 4HEA9 3HJFA 4OLOA 4HI2A 4HI1A 1OPIA 3M7VA 2RU9A 1H74A 3M05A 2APOA 4JI4J 1YQHA 3C14A 1UKUA 2HFNA 3GV7B 2PI5A 5L9XA 2BE7D 3N5FA 3TZXA 1NJYA 4ED1A 5FD1A 5E41A 3ZFVA 1YRUA 2J6SA 1XNRF 2E1AA 1X4AA 4HDHA 4IG3A 2OTJS 3QGGA 4W92B 3QSIA 1PC5A 1RHQB 4WZMA 2NSCA 4DR1J 5ETMA 1UTAA 2V2ZA 1FESA 3EZ5A 5ADZA 2CQPA 4UQTA 3IO1A 2E9RX 2CQ4A 3VAIA 4AXJA 1DTQA 4OX7A 1UVJA 2WVFA 2G1DA 3P3DA 4OZNA 1F6TA 4DV5J 1FXRA 1RAEB 1N36J 4QR0A 5F0WA 3O5TB 4ECWA 2ASJA 1GAOA 2XWXA 4CLLA 4ER8A 1EETB 3OXGA 4LF7F 1WHXA 3TAMA 5HVGA 4CZCA 4DPUA 2CQIA 1F9FA 4J9VA 3CF5Q 3MCMA 1B0TA 2GMJA 2FZKB 3FK4A 4C8KA 2Y1LB 1NK8A 1SQGA 4URQU 1HR0J 2HPUA 1S72S 2CPXA 1G1XA 1S99A 2XC9A 2EK1A 2IVMA 1C0TB 5D4LA 1I51B 3H2LA 3BDEA 1IUJA 2W9CB 1YJNS 1W2IA 4TVAB 4RL1A 3C3LA 1NKCA 4U96A 5KT3A 1F5AA 4J9NA 4IG0A 5KG5A 3OXLA 1VGYA 2GA7A 2ZUAA 4MKVA 2HQGA 4JI2J 1S0VA 3RRGA 4KGKA 3FMWA 2J0SD 2ZM6J 2HS0A 3PJXA 2FGOA 5D0EA 7AT1B 2K2PA 1U48A 4X4NA 1FK9A 4DQIA 4ZMMA 1UCNA 1RCXB 2D7SA 4C3LA 3S6EA 2XEXA 1JNZB 6FD1A 3I5CA 1HW9A 3A13A 1NK0A 1OQ3A 2WRMA 5KFGA 1D9DA 1ZAVA 1SJFA 1DQ8A 1TL7A 1P9QC 3KYLA 2ROPA 3CW2C 1FKOA 2MHNA 1LK7A 2I1RA 3AJDA 4K4SA 2XZDB 2M7SA 2WONB 3GLJA 3MMBA 1JXVA 2EFOA 1VI7A 2ZE2A 1HNVA 3KJFB 2YWFA 5A6WA 1ZA1B 3MEEA 3FBFA 2YNIB 4DV0J 2FY1A 3CCLS 5IWAJ 2G0CA 2RRNA 1C1CB 3UCGA 3LTOA 5IC4B 4WCEQ 2HFZA 1KS2A 3GB0A 3HO1A 4IDKA 2CQHA 3BBCA 1RT2A 2Z30B 2DT9A 1JLBA 2MZJA 2KTQA 2BW7A 1X4GA 1FKPA 2MKJA 4I7FB 3FNNA 3PRBA 4JP8A 1VQNS 3MPDA 2CZ4A 4FYWB 3NGKA 1SJRA 4RBVA 2QIFA 4KO0B 3ONQA 2DY9A 2CIMA 3T5HA 2J9DE 3K5OA 4ILRA 1VC0A 4LR9A 3GJQB 4F4XA 3Q2SC 5HJXA 1BXNA 3TW0A 3N79A 3TA1A 4K5SA 4Y2CA 1YJWS 1AYEA 1O51A 2C42A 3LA0A 4DL2A 2RF2B 2GS8A 1HNXJ 3TA2A 4F67A 4NLYA 3V6DA 3VAMA 4FYXB 3GP9A 5HBMA 3ET6B 5K8MA 4YHHJ 2F8HA 1R8HA 1NDLA 5J1PA 2CJXB 4EU0A 2CQGA 3BSCA 1JJCB 5IXUA 3WQPA 3RAQA 3ENWA 4DV1J 4I6WA 3RRKA 2ADBA 3V81B 1KNZA 2DTJA 2HNZA 3IM8A 4FPRA 1KSPA 5CD4A 1RKJA 3EDQB 3ILJA 2C2ZB 1RP5A 3CDUA 2Z4PA 2UXDF 1WKLA 1QTNB 4DWIA 4ZJOA 1RT3A 2W7AA 2HLUA 1U1MA 4GO7X 2WVDA 4LJMA 1M5OC 2ZDPA 4QIEA 3T1YF 3Q86A 4N8NA 3SCIE 3KHLA 3CCVS 4F4YA 1RA7A 5ETPA 3R97A 4F0HA 3FFIA 3D68A 3MM8A 1SH2A 4UY8T 4A8QA 2KRBA 1TKTA 3VV2B 2NS1B 4G65A 1F60B 1LFPA 5KFUA 5EX3A 2PEBA 4OL8A 5K9FA 3N6MA 2DXDA 4CLKA 3B6BA 2HWIA 2WW8A 4P72A 2XI2A 3PW4A 2YTCA 5M2UA 2F4VJ 5FLXU 2ZH3A 5GMEA 2DY1A 4Q8FA 1TFYA 4DFPA 1MN9A 3CULA 1WI8A 2AJFE 3N4WA 4A46A 4ZVEA 2AD9A 2VKRA 5IQ6A 4KH1B 3HM9A 1F1BB 3R1LA 4KYZA 4TYAA 2Z2LA 4ILLA 1IWAA 3I6PA 1NPRA 2BM0A 2LQ8A 1T9XA 2FB0A 2EBEA 1IXKA 3DN9A 2B7BB 4DV7J 1GNKA 3NOCA 3BN7A 1GXUA 2XGQA 2JL9A 3KLIA 1AA1B 1LNQA 3C16A 1UP1A 3W9JA 1T3OA 1S4FA 1FWPA 1FERA 3D1QA 4ZP8A 3FUYA 3T9NA 4OYZA 3QFWA 1YGYA 4RUBA 2EG2A 1X9WA 3TA0A 1NPKA 1FTRA 1W7WA 2E5JA 4ZVPB 5KTQA 3I0SB 4JV2A 2GJIA 2X3GA 2DH7A 1RBAA 3I56S 1Z2ZA 5M2RA 3ZTPA 1CG2A 4TQSA 1T0TV 3TUPA 3K5MA 4MK7A 1B0PA 4ZLNA 1C4CA 3B54A 5ETSA 2HBZB 4IO9Q 2GCFA 3M8PA 5ETQA 4FYYB 2D9PA 1CEZA 1PYTA 4BWJA 4JV0A 4K4WA 3GJSB 3DOKB 1K1SA 4R0EA 1K0VA 1OYEA 3NXZA 2CKWA 2MZ1A 1S97A 4G1PA 4Y6IA 5KG6A 4ELUA 1S6QB 1AZSB 4OYMA 4DU8A 3LUYA 1SV5B 3SDEA 1NSPA 4OI2A 4ANDA 4DBQA 1VC5A 5KFKA 4Y34A 2KRRA 2AT1B 4C6AA 4URGA 3THVA 5IWAF 3NCQA 2HQ3A 3P5TL 1HNZJ 2KJVA 4PRFA 4R8UB 3DRPA 3Q8QB 2AP6A 4ES3A 4AYBD 5F9LA 3I0RB 3LANA 4UZBA 2ZVSA 1NZ8A 1NDPA 3DLJA 4QJVA 4UTGA 1I94J 4RBTA 4ZDNA 4DV6J 1U6BA 1Q86T 2JOQA 2QRRA 3NLCA 1DY3A 2Z0GA 1E6VA 2DNHA 5KT5A 1ZBTA 1SC4B 2F65A 1F2GA 2DYAA 3LAKA 3ENAA 4J9KA 1R8PA 3T5KA 2ZD1B 4ZLLA 3S7RA 2FLNA 2RDJA 4RLEA 2MJNA 3V6HA 4Y28C 4AQYJ 1KQGB 1APSA 3KWMA 1U0SA 3PY8A 1OY8A 3DDKA 1FRHA 1N5YA 2QYGA 5DLFA 3ISZA 7FDRA 1NLKL 5GAHI 4KGMA 3N5BA 2GIQA 2ASDA 4JV5J 1GX6A 2R3VA 1DLOB 3IR6B 4CLUA 1QAJA 4DCPB 2R2SA 3OTCA 2ALYB 2A10A 1SIWB 4KQZA 2PMZD 5L39A 5J2MB 1J5EJ 4FNIA 3W5ZA 2OEMA 4CTAA 3OTOJ 1ZH5A 1QD1A 3R3TA 1Q16B 4PEOA 4A8KA 6AT1B 2YKMA 4DL5A 1ZTTA 1QVGR 4FF4A 3VALA 1VS3A 5A0YB 5CYJA 3FEYB 2CPYA 2C28A 4IQXA 5HP1B 3FBEA 4JI8J 2UV8G 5DGBA 5I42B 2HRTA 2ZHBA 2V8HA 1EZZB 4X4QA 3HKZD 2CZVC 3OFGA 3PHTA 4L76A 1PAEX 3AOAA 5DM6Q 3QAEA 2DNLA 1DHMA 3TJAA 3JB9k 3KMSA 3FJ2A 2XY5A 2JLGA 2FJWA 4C8OA 2UUBF 4KRWA 4OYBA 4CDIA 5HO4A 3Q8SB 3R5AA 2RDIA 2M9KA 3O6QA 3ILLA 1JMTA 3FVYA 4PWDA 4DSKA 4WIQA 4CO2A 2I0XA 4EZ6A 3UVJA 2B8PA 1FJCA 2V2VA 1T95A 2FHJD 3RB3A 1HHQA 4DR6J 2N7CA 1IR0A 1YX2A 1Q81T 1WDDA 4X65J 5LT5A 1U45A 2YWHA 4DL0C 2IMOA 2QYCA 3CDBA 3D0IE 2IMWP 3DRSB 4RW7A 1IKYA 1Q8BA 1GMWA 1XN9A 4ECUA 5C2GA 3BGRA 2HSEB 1BQNB 4ZPDA 2XSFA 3G87A 1ZPVA 1S12A 1S1XA 2ZH6A 1VHIA 5A2QY 3MOJB 3NRBA 5AJ3F 2Q66A 1JNRB 3M4XA 2NSBA 1WD6A 1C2PA 3J7A1 4XTTA 4FBTA 1TKXA 5T14A 4ED5A 1FKAF 3LH2S 3N01A 2HGLA 1WG1A 4P6QA 3ZTSA 2MGZA 5DGAA 1JXEA 3H4DA 4E2FB 3D6FB 1RWWB 3OFHA 5EHHA 3BV8A 2XLIA 1V5IB 3TZYA 1WELA 4DF4A 3D0HE 3EGWB 4NX9A 5KFPA 1FRJA 2OPPA 2XO6A 4M5DA 2MQOA 2I5JB 4RUHA 1FDDA 3UN3A 1UVKA 2BACA 4NZ0A 2YH1A 5DJBA 3R27A 5HMZA 1RBOB 5G0RA 1SB6A 2QGFB 1YI2S 2R7WA 1ZETA 4ZS6A 2BVZA 1U8SA 1KFSA 2KXFA 4DV2J 3HJVA 4PG7A 1B99A 1F0XA 3SXLA 3MECA 2WBMA 3GONA 1U0HA 3UO0A 1RXOB 4A8MP 2ASYA 3C46A 4DX7A 3IRXA 1RWOB 1X4EA 3VGTA 3K7RA 3PVXA 3UR3C 5J1EA 1RTIB 4QWEA 4F4ZA 1A7GE 2L9NA 5HVFA 3CIZA 1TUVA 2XLJA 3MMJA 1WEYA 3KK1A 3RB6A 1L3SA 2BKPA 5D6GA 1PYOB 5A6PA 3KHRA 5DRKA 3MM7B 5CHCB 3A8IA 4CI0B 2H48B 3C14B 4EUVA 2OFHX 1S9FA 1RU1A 2D41A 1WC4A 1RYRA 4U7UK 3BGOP 1UEUA 2AJQA 4IG3B 5E5NA 2CPZA 1JKHA 4N7TA 4WE1A 3JAMU 3TQEA 1MLAA 4L74A 4LRAA 2HW3A 3R5CA 4KJIA 3D6HB 3D6MB 1NSAA 2JFKA 3K8WA 1IKXA 1RT7A 3GJRB 4JI3J 3O44A 4C8LA 1DTQB 1H3DA 1HKAA 4B3MF 4PG8A 2JC1A 4TY8A 5EGYA 1IBMJ 4TY9A 2ILZA 2Q43A 1RAFB 3TAMB 5IT4A 1N8RT 2GVZB 3W66A 4QWAA 2YX7A 3W9HA 4M5KA 3QJJA 1R3NA 2ZHAA 2IFXA 4Z37A 2FYXA 2VB6A 2BA9A 3GYNA 1F3FA 1R8BA 4OZ1A 1RABB 4CLWA 2HQDA 3T3FA 3HHDA 4JI1J 3NNAA 4QIFA 1IVZA 2LEBA 1RYSA 1F9HA 4LF6J 2UXCJ 1SC6A 3FSYA 1IBLF 5D8HB 1X5OA 1VQYA 4TQRA 1KBRA 1W25A 1LW0A 3D67A 1PG5B 2BE2A 4J9PA 2O3DA 4UT4A 2A6MA 2G0JA 2UVRA 1WHWA 4HACA 4AD6A 1FRKA 1P8GA 4AXIA 1VRQC 2HFOA 1MWQA 1WEZA 3HVRA 3A8KA 3JQJA 1TAQA 4LFCJ 5DM7Q 2HVEA 5DETA 3EYZA 1BE4A 3G82B 2ABYA 1TL7B 4OX6A 5I3QA 2VFSA 4NYZA 3NGSA 4PXDA 1O8BA 3LF0A 3BN4A 1JXLA 3FC9A 3CD6S 2HZAA 4YQWA 4GKJJ 4C0OC 1EARA 1GMUA 3MMBB 1VQSA 2ZE2B 1HNVB 3H8YA 1S1TA 1EP4A 5E3RA 1GMWD 3MR5A 1P6TA 4OI1A 3MEEB 4KKOA 4ITSA 3H40A 2YNGA 1LW2A 3PIOQ 1R8CA 4F3MA 4ZLJA 1LXNA 5B0DA 1DJ0A 2NXUA 4LIWA 1FEHA 2A3JA 4RWWA 2JVOA 3DCAA 4MT1A 1RT2B 4F02A 1JLBB 1FKPB 4LRFA 3OL9A 3ETOA 1XNQJ 1K9MT 4Q7AA 2GNKA 1LWEA 3OJUA 3T5LA 1FX2A 2COLA 2VDIA 2XNQA 4PYDA 2FLLA 1T9TA 3LP2A 3J7AN 4CO4A 4GC6A 1QAYA 2GIFA 3FZ2A 5KFSA 3LAMA 1NJIT 2CAJA 2QSFA 4R5PA 2HHXA 2W2QP 5RUBA 1UFKA 3BYRA 2OD6A 4B3SJ 2W4DA 1TKZA 4P2MA 4DLGA 1DURA 3P8BB 3W5XA 1VLOA 1UJ4A 2XLKA 2JH3A 2MSSA 3BKTA 3IC1A 2GAHC 1YJTA 3V6DB 2KKHA 3AD9C 5HBMB 3HULA 1YJUA 4LF8J 4M5HA 4P2FA 3CGIA 2ZH5A 4ZCKA 3DC2A 3KOAA 2CRLA 4DS4A 4N77A 2JFDA 4K0KF 1NU4A 2UUTA 1C0UA 4L6V3 1C4AA 3OFFA 2MKCA 2DGTA 4IKAA 3T5JA 2HIQA 2HNZB 1HI8A 2O66A 2RUGA 4NCGA 2XCAA 3P4UB 4A8OA 4HH0A 3RB4A 3KNAA 1RT3B 1S77D 2F5GA 2HZCA 2X51A 5KG3A 4YDXA 5LJ3Y 4HH1A 1LWXA 1N33F 1QVFR 3IMQJ 1GX5A 1DFDA 4ZOSA 3GILA 3LWMA 1F3VA 5AXMA 2VPXB 5GAEU 3NS5A 4FXVA 3GPAA 4KR0B 2B7CB 3DMJA 3F44A 3MM8B 5GVQA 1IBKJ 2VFTA 4O23A 4CCHA 2R7XA 5DG9A 1Y5IB 1TL4A 2X1AA 3AD7C 3BPSP 2KM8C 3KTQA 5CYMA 4RNMA 3D7SB 2X3DA 3PV8A 1FRMA 4ICLA 3CVKA 2R7QA 3N6NA 3DRRA 2LXIA 2QV6A 4ID5A 2CA9A 2M70A 1JLEA 1GTHA 3OTEA 2P2CB 1SH0A 2P6TA 3DU5A 5B09A 1O6XA 2DK2A 1GFWB 3PYFA 1Q53A 1UZDA 1XWLA 3DRXA 5KAKA 3DHXA 1B0VA 1LK5A 2HVDA 2KYXA 2IY5B 2RAQA 1M5SA 1YITS 3MM9B 4C98A 3VZIA 3BQ0A 1U8WA 3CDWA 3H0PA 3KLIB 4KIAA 2W2PP 2XMVA 3V2UC 3R8YA 4AT1B 1PO6A 1S0OA 1R6YA 3MCSA 4V19J 3B78A 2KT2A 1X7VA 3US5A 2Z2MA 3P45B 4C97A 3MPWA 3SCLE 4EMDA 2OD4A 3PFEA 3HF5A 4OZ0A 2VG5A 1N32J 1TMJA 2R8GA 3T1AA 4ZVHA 3MUMP 3THTA 4OI6A 2XHWA 4ED2A 4TKTA 1QTMA 1M5HA 4EBCA 2ROGA 2IVFB 2VPWB 3F56A 2VJVA 3M8PB 4OZJA 2KVQE 3BPDA 4DMZA 4ZPVR 3SSQA 4Y2KA 3BSOA 5CYQA 3DLLQ 3CC2S 3CCTA 5F3TA 3G8TA 4L3NA 3CUNA 4WK3A 3A12A 4ANEA 1Q8IA 4N47A 1OO0B 2HGMA 2EK6A 4HHHA 1EQ0A 1ZS6A 1N0UA 2MMYA 2VF3A 1FD2A 4FVMA 2YKOA 1B4SA 1B70B 3MAHA 3S1TA 1FWLA 3RZAA 2W9BA 5LSLA 2VU5A 3RU0A 2Y3YA 5EWFA 2AGPA 5T41A 3RUBL 4V1Ak 3HHLD 4X4VA 4IRCA 2FLPA 4LF9F 3BEGB 3OHBA 2I2YA 2MZTA 2H65B 3HFZB 3BO2A 4NXNF 2RB7A 4C8MA 3IBWA 2DNZA 3H5YA 3CJ4A 5K8NA 3LWLA 1T9YA 4RNHA 3LGHA 4ECVA 2MQ8A 3FSIA 3SMZA 2E5LJ 4RO0A 2ZNZA 5DQIA 4PABA 1WF0A 4MFBA 1KP6A 3IM9A 3U27A 4EYHB 3R9LA 2ALZA 1G3OA 1U1PA 4U8YA 2RS2A 2V4JA 1W26A 1BLUA 2SXLA 1D3WA 2VZ9A 5AE1A 3P5BP 3SZ2A 4X66J 1H72C 1TKDA 3HFKA 1N5YB 4NLTA 4I67A 5L1IA 2LVWA 2RSQA 1U7LA 2M0GB 5EN1A 1XR6A 3CIMA 2ZBPA 4K59A 1OMSA 2XYPB 2P9EA 1A6LA 1NUEA 1QSSA 2XS5A 3CPWR 5IV4A 4CTAB 4ZVUB 4DR5J 1YHQS 3ZZ0A 1RWUA 4OFZA 3R2DJ 1VQ7S 1PSDA 4RW9A 2HURA 2D9OA 2EWHA 4C9DA 2YKMB 1X4HA 2L3MA 3GJTB 1EB0A 3CCWA 1YIJS 1URNA 2XY7A 4MKBA 1TV6A 5JXSA 2PE8A 4IH7A 3TZWA 1JWWA 4PPDA 2QL7B 4WK1A 2AGOA 3GSIA 5K5MA 3VVTA 2IBOA 3ZZPA 1AUSL 4HLBA 3K5LA 2HFSA 2NUHA 1T8EA 2PA3A 2JHEA 3RBDA 2YPYA 3PNIA 5ITHA 2LCWA 2M52A 4WTYA 5HMXA 2AMCB 3HP6A 5J1NA 3QFHA 2ADCA 3DDNA 1H98A 3EE3A 3X1LB 2HZVA 1MU2A 3EM1A 5FDLA 4DL3A 5BR8F 3H5XA 4C3KA 3W64A 4PWDB 2XSJA 3TARA 2NUUG 4M5GA 2QTWA 3UVJB 1M5VC 4USVA 1RDRA 1U1LA 2Y0SD 4WKYA 4M5JA 3IA0A 1LWFB 1CJUA 3EICA 2XTJP 4DFKA 4FNHA 3IR7B 5EDWA 1PILA 4TXSA 2DEJA 4J91A 2CPHA 4GKKF 4I6YA 1HD0A 5ETTA 4RW7B 1IKYB 3OFEA 5LSRA 1PGZA 1V9OA 2KN4A 4O0IA 3MF5A 3QT7A 4NEYA 2YX4A 1ZPWX 3BGRB 2KL8A 2AIRB 1X4FA 2MZQA 1S6UA 2X1BA 5LXYA 1L3UA 2OAUA 1OSCA 1OQ6A 2KU7A 4O3PA 5KFJA 1RGVA 2JNJA 1FFWB 2HAFA 1WHVA 3OL8A 2HQFA 2PGCA 4ES2A 1TKXB 3W2VA 1CJTA 5E0OA 2ZZTA 2Z57B 1Q1KA 3BM7A 4Q2LA 4KHRA 9ATCB 2DCLA 1YK9A 1RAHB 4I69A 5HQLA 1N88A 3OSNA 1HBNA 2DITA 2OPPB 4M5DB 2ZH7A 2CNNB 2WVBA 1GMVA 5HAOA 4DQRA 4C3MA 5KOXA 1OSDA 2QX0A 5G0RB 2HVIA 4NA2A 2BE9B 5BXIA 1NXIA 5CXTA 1SUQA 4N76A 4YY3J 3LPYA 2IDLA 5FJ4A 1YJVA 3QLHA 1EKSA 1VK8A 3MECB 4F3OA 1U0HB 3M30A 4PWWA 1KOOA 3IRXB 5L1KA 2F63A 3TWZA 1MWZA 1JQGA 4YDDB 1KTVA 2XMMA 1U02A 1WDTA 2JVRA 4U7CA 2IIHA 4K50A 2LDIA 3KK1B 4H4MA 5IT0A 4LRBA 2BANB 2ZNYA 4DX8H 4XO0A 4DQQA 3BO4A 4O44A 4OZ2A 5KFZA 2OPSA 2X7IA 3O2IA 2E9TA 1L3TA 4U6PA 4OHZA 1ELOA 1G6BA 1DQAA 3OR1A 4J9OA 5KFCA 1JKHB 3PJWA 2V34A 1KTQA 3TR5A 4X66F 1MSWD 2GV1A 3GYXB 2YKNA 2ZITA 2JC0A 2X1GA 3QRPA 2OHDA 4UF4A 1IKXB 1RT7B 4NLUA 4CO1A 5A8RB 1LQ9A 4CNZA 1T03A 1MG7A 5J2QA 3KLVA 4TY8B 3OVBA 3HX9A 4UZCA 3TI0A 4LR8A 5K8PA 1TUGB 4ZP6A 1WG4A 3M6WA 3Q8RB 1XMQJ 3M2UA 1NK4A 1ZA2B 4J9UE 2HHHJ 1M1GA 4O3OA 1FI4A 2BX6A 3Q8PB 3QZ8A 1RT4A 1RWKB 1X9MA 1PCAA 2PFFB 1YJ9S 3NGDA 1WKKA 2BOPA 2B43A 4ENOA 2ZH8A 2N3OA 1Z2LA 1Q82T 3OVAA 1LW0B 5D4PA 1S7HA 3MD3A 2BE2B 4WU3A 1KVJA 3BQ1A 1BWEA 1I5OB 1X5PA 3IS9A 4HACB 2YXLA 1TP7A 5LMNJ 2EXUA 5C2CA 4WXWA 2MHEA 2F8MA 1N34J 2HNYA 4URSA 2OMLA 2ZH9A 3VAGA 2DISA 1MMDA 2GVDA 3CJQA 3PJ9A 1WHYA 2XYHB 3QWUA 2CADA 1T7PA 5KFEA 2DXEA 5KFVA 5KFAA 3O8WA 4YR2A 2VPZB 5C25B 3GR0A 2CNLB 1FRIA 5THWA 5KFOA 2MPUA 2HHVA 1S1TB 4OLPA 1EP4B 1S9GA 4BDPA 4RW4A 4C2MA 3QGHA 3MHYA 3OBIA 2YNGB 1LW2B 3CD0A 4JI0J 4UOCA 2WVCA 3M9NB 1HD1A 1RI7A 2NLWA 3BSNA 3Q8UA 1KWMA 1NEEA 1UFLA 1WOSA 4PQAA 2MLYA 4KGZB 4IFVA 1T3NA 3K89A 1K0TA 3EMTA 4X64F 1BUXA 4G6VB 2VC0A 1Q7YT 1LWEB 4EBDA 4I1TA 1X5TA 3PXGa 2UUAF 3LP2B 4PUOA 2R9LA 4OI3A 1I1GA 1P9YA 4CM0A 5J2NA 3ZTRA 3L3CA 2IRUA 4CM2A 2DVIA 1RWPB 3PTWA 2XB2D 3KUEA 1R31A 3M2VA 1TKZB 4ZCIA 2BJ9A 2D69A 1G7CB 3VWSA 2Y9HA 4DCJB 2MY7A 1U25A 2ZWPA 2U1AA 1U1OA 2IYGA 3DGPA 3G6XA 5JMNA 3IBCB 2PMWA 1RB0A 4ZVFA 1KOHA 3UDVA 4GVBB 4OI4A 1UWAA 4ZHRA 4DR2J 4WFBQ 3VR1A 3GV8B 4RW8A 1NHKL 1CULA 1MW7A 4GO5X 1K8AT 3TVZA 1S1UA 1UZHA 2LECA 1UAWA 5KFLA 1VQPS 3W60A 4X4PA 1RUSA 1JLGA 2B9EA 4I6AA 1KLMB 3GIJA 2V94A 5M2PA 2YNFB 3C66A 3P49B 3MEGA 2YWGA 2GJ2A 5KFDA 2POKA 2CJAA 3RJMB 3H42A 1R8AA 1RAIB 2CJYB 3DMJB 2C3YA 2OMOA 2FVQA 4NCBA 3KJVA 2MXYA 4KC5A 2NZCA 3VGVA 2R2UA 3QMQA 4JYAJ 5HLFA 2M4MA 3MPUB 3CCJS 2AZ1A 3KK3A 3GQCA 3JYTA 4WKRA 3Q2TC 2AWZA 2RVJA 5E3PA 3PO4A 3QNWB 3OV7A 3DRRB 1SJ3P 3CJTA 4ID5B 3PYDA 2QN6B 3E51A 4OX9F 1XC9A 3RBXA 3MUTP 3PZPA 3B4DA 1JLEB 3EZOA 2W9AA 2H5IB 4B02A 1OS5A 2DNOA 4I2PB 1NRKA 2RS8A 2ZUGA 2DCUB 2LQ9A 1KHVA 2RIJA 3GZ7A 1NPPA 2XMWA 4GVLA 4X4RA 1XMQF 2R7VA 1RZMA 3H98A 1XMOJ 1SKUB 2HHHF 4HL9A 3KLGA 3J81Y 4O3SA 1F5BA 4DR7J 3S8SA 2G2OA 1VRUA 2HBYB 1D09B 2AEMA 2XCPA 3I55S 5KFNA 4DI6A 3HPOA 4DR4F 3UI3A 3EVOA 3T6JA 2ZBIA 4B08A 2M2BA 5D77A 2VG5B 2ZBRA 4USMA 4NPOA 4MAKA 3PX0A 3KLFA 2MKSA 1YZ6A 4KHPF 5LMNF 3FBCA 4AL5A 4DJBA 3AB2B 3MXHP 4MJKA 1RWMB 1HWUA 2P9CA 3VQSA 3R5DA 1KN6A 2NQPA 2UUCF 3ZNUA 1RAOA 2FGCA 4IH5A 2UVUA 3RG6A 3M1VA 5MLCV 2VV5A 1B7YB 1GH8A 1WTFA 3O3LA 1XJWB 4M5LA 4X4OA 4Q0BA 8RUCA 5IM0A 4OJ1A 4J9RA 3HCXA 5K14A 3BR8A 3FCVA 3V4MA 4J9LA 5HANA 3I96A 1EJ7L 2VFRA 2BW2A 2W9BB 2OIHA 3E01A 2GMLA 1PKUA 4JI0F 1ROFA 3QPIA 2QFIA 5DDOC 1RAAB 3QJPA 4MK8A 1Q5YA 2E5GA 1JJ4A 1PIEA 2HEKA 1JB0C 2A1BA 3LO3A 5T7LA 4F36A 2F40A 2XMKA 2FQQB 2RU3A 4Q43A 4MK9A 4WFZA 4F2SA 1PJ6A 4Z7YA 3I87A 1TK8A 4LF2A 1CC7A 4MFBB 1H0HB 5A2QU 3KMQA 3DOLB 2WW4A 1NK6A 3NL0A 1GT8A 4ZJQA 5KT4A 4I2QA 2IAJB 4WU2A 1Z1ZA 1YVFA 5F0UA 1JLQB 1SI9A 4Y2IA 1S0MA 2EFQA 4J5OA 2B9XA 4RW6A 2M8HA 2FC8A 4LRDA 2E1MC 1S9EA 2C2OB 4EK2A 4EBEA 2I9SA 2R7OA 4H4KA 2BOAA 4LUBA 4JI7J 3IGVA 1K73T 2EPIA 4ECSA 4QU7A 4G1IA 3JQMA 1HI1A 5KFTA 3D2WA 4RW9B 4DS5A 3CMAS 2HK3A 5L38A 2MJUA 4HHUA 2IM2A 3RAXA 4CLZA 3I5AA 3RTVA 4ZIVA 3L7OA 3IR5B 1TV6B 1HWKA 1V3SA 4ZPTR 1D9AA 3W5YA 5LMUF 5C5JA 3OLAA 4NLRA 3HT0A 2O5DA 2ZOGA 1FCAA 5GAEI 1R0CB 3VAKA 4DL7A 1PC4A 1Q5VA 4ZLPA 3ZO7A 2ZC3A 4GMKA 1HPZA 2BUNA 3J7ZT 5MAOA 4CNYA 4BC9A 1IR1A 3PKMA 4G3IA 5IOLA 1Q8KA 1MU2B 1YBUA 5FDLB 5A76A 4ELVA 3F41A 5KFFA 4FYVB 3OXFA 4FS1A 1QDUB 2XSJB 2LEAA 4NA3A 4KTQA 3M8QB 1N4LA 3AQOA 1SL0A 5DQHA 4X4TA 2DR7A 3ZZTA 4ZK7M 2B4PA 3DGVA 3HLUA 4RNNA 4B9MA 3PIPQ 4N41A 3EGVA 2ZBQA 7FD1A 3CMES 4TYBA 3PW2A 1SBRA 2VPYB 1WC0A 2BQRA 2HAIA 2JWNA 4U9RA 2HS4A 2IC3A 4LVNP 3ITHA 3QO9A 1GXLA 3IBFB 5B0AA 3PR4A 1N56A 4KH0B 4FS2A 1NJXA 1BC6A 4X4UA 5D0HA 2HIYA 4DUYJ 4I0WA 3WIVA 1AFJA 3SYZA 4OHVA 2IHR1 4G1QA 2DGQA 4J7CA 1LEOA 2W01A 1IR2A 4JI5J 4UUXA 3HVTB 3W2VB 3MOZA 1CJTB 3ZTOA 2CJBA 1WUUA 1VC6A 4DSJA 1BMQB 3RGIA 4NYOA 2EFNA 4ECZA 4ILMA 2K1RA 4B3TF 4KGVB 3LQVA 1TZ0A 1KDNA 5E3CA 1WOPA 1S4EA 4OYIA 3MEDA 4WP8A 2KI2A 2WONA 4IFYA 2C2EA 1FA0A 3PDNA 2WAQD 3CEDA 2P8IA 1VJWA 3PHEA 3D54A 1MMNA 1Y5LB 1SUQB 1NMEB 2E1PA 3QLHB 1SJ1A 2VKZG 4A8YA 3RRHA 5DS7A 1LV5A 3AOBA 1FNOA 3M30B 2KT3A 2L48A 4LF1A 1CC8A 4WP9A 2UXBF 4JI6F 2NXEA 4RU9A 3QGIA 4K4YA 3KHGA 4DV3J 5GADI 3IFEA 3OTDA 2WK4A 5LJ5Y 1ZM2A 3C19A 4RKUC 1RHUB 2MY8A 2W1BA 2BABA 4H4MB 4IRKA 2J8SA 2E7XA 2QG9B 1EIYB 3QJLA 3T41A 3V6JA 4XK8C 2H54B 2I38A 1WJ9A 1N5TA 2HHTA 3T1HF 2X1FA 2FD2A 4JBCA 4QIWD 2C2MB 5E2QA 1UL3A 5HMYA 2DNYA 5HI7A 1HBUA 2IA0A 1V3ZA 1H6KX 3LPEA 1UVIA 3N9UC 3GIKA 2OEJA 2RF2A 4BCAA 1SIZA 3MI7X 2BYCA 1S1WA 1IM4A 2DGXA 3AAWB 2LU1A 4NLWA 3OR1B 3ET6A 4X4SA 2VQEJ 1QM9A 2FVRA 2PC6A 2HWTA 2YKPA 4DPYA 2YKNB 1L5UA 1LKZA 4D3GA 4F4WA 1NZAA 3V81A 3PO5A 2CQ1A 2FHKA 5KT7A 2FUG9 1HLWA 4A48A 1FJGJ 4FKXA 1QAXA 5ETKA 1T03B 4JI4F 5J2QB 2J6TA 2IM3A 4LT6A 3H5SA 5ETNA 2NXNA 3MCNA 4F26A 2GQCA 3BH6B 1VR6A 4DU7A 4OZ5A 3BBBA 3K2YA 3M2UB 5DQGA 2CQBA 3MR6A 2Y1JA 4DR1F 3JSYA 1AW0A 4OZ3A 1HQEA 1RT4B 2AKWB 3GFZA 3FCWA 5EWGA 2XGPA 4AFFA 2MKHA 1MROA 1Y00A 2R7SA 3DXBA 3IGNA 2IRXA 1S6PA 4FBUA 4DV5F 1WC6A 1N36F 2YH0A 3AT1B 2VQFJ 4C8NA 1IN0A 2FHJA 4F2RA 3CO0P 4ED7A 4RR5A 3RBEA 3ENVA 4PCQA 2HYIB 3IS9B 2WSFC 5H1SV 2AJ1A 4EYIB 2MQNA 4LF5J 3SQOP 4ZVQB 3CD7A 1HR0F 3CJKA 2XMAA 2HNYB 4IOAQ 3GFYA 3UN2A 4B9NA 4ZKAA 2Q6CA 2OELA 3IWLA 3P6YC 2GVDB 4LQ3A 4CWBA 2GZOA 3QT6A 1IKWA 3DRYA 2KFNA 2ZH2A 4P75A 3M2RA 3BGUA 3O1LA 3X3UA 3C2PA 3IWNC 2N4CA 4JI2F 3T19A 1UW4A 4X62J 3KNGA 3OQ2A 2K06A 3FEZA 1S9GB 1NDKA 4RW4B 2ZM6F 2WZ1A 1KR4A 1GXTA 3GV5B 2MKIA 1S76D 3M9OB 2BJ3A 2V50A 2AQ4A 4J9SA 2ZOFA 2EFVA 5IC6B 2ACMA 4Y0FA 2IDEA 2WB1D 2LKZA 2IVYA 4PG4A 3UR0A 3ENQA 4IFVB 3Q83A 1S10A 1U1NA 3DYAA 4KBIA 4OI0A 1EAYC 3NGTA 2HMIA 2FJXA 5SUHA 2BMBA 1PJ5A 3M6VA 3HZEA 3VCDA 4ZN3A 2BV3A 5EX0A 3NNCA 2G2YA 2BJ8A 5BYSA 2HNDA 3HT3A 3PX4A 4NA1A 3ELHA 4WP3A 1XTZA 3WC2A 3NBPA 4PXCA 3FQLA 5J2PB 3CWJA 4DV0F 5J2NB 2XS2A 3DLKA 2OP5A 4OYPA 5KFIA 1NKEA 1SL1A 3M2VB 3SQGA 2E66A 4QYZJ 1U26A 3A8JA 1M5KC 1TL3A 2R8KA 3QSYB 1JX4A 3JQKA 1S6QA 4HVZA 3B4MA 4F3QA 3DGPB 1SV5A 2W4CA 1R43A 2JEIA 2WHOA 4F04B 4XAKA 2PSZA 3W61A 3BJYA 1MNEA 5A8KA 3HK2A 4RW8B 1RTHA 1CULB 5BJRA 1DQ9A 3PM9A 1S1UB 2UU9J 2AEFA 4DZDA 2MQLA 3R6LB 1JLGB 3MM5A 2E1RA 3HD2A 2NPFA 3R2CJ 4LVOP 1HNXF 1XIQA 4KE5A 4RPFA 4FVCA 3BGFA 4M5NA 2QA4S 4YHHF 2FHMA 1S5ZA 2ZBCA 3OUYA 4RZRA 2V67A 2VOOA 2CNKB 4WFAQ 1OIAA 1NJWA 1XNRJ 1S57A 4DV1F 2ZJRQ 2NREA 2EC0A 3AB4B 5HLFB 3OVSA 4AL6A 2DHGA 2IBKA 1BHNA 4B9TA 4F0MA 3KK3B 4EO6A 1VYAA 3JYTB 2HHSA 3VGUA 3AXMA 1WKJA 4LQ9A 3ZC4A 5F41A 5J2MA 1ITPA 3NWRA 1REVB 3ZZZA 4LF7J 2YKAA 4O3QA 4WYLA 2R8HA 4XDCA 3DU6A 2ZH1A 1FJGF 3TO8A 3KLHA 3TX8A 2PFDA 3WBZA 1AXQA 2BZ2A 2EC2A 3F0NA 4YOEA 3G96A 3C15B 3D5MA 3L09A 1VQMS 2E7VA 2F4VF 3MPVA 1TAUA 3PG9A 3VHQA 5D4OA 4A4JA 1U4BA 4RX6A 3GIRA 3KLGB 3D66A 2DIUA 1Q79A 1VRUB 4C7QA 4ZVOB 2RNEA 4YFUA 1Y0HA 4LSLA 3HKWA 2E7WA 4F8RA 1EX8A 4M1KA 1R0BG 2VQFF 3GFXA 2XQCA 4PPZA 4Q5VA 2GJFA 1MWYA 2BJDA 1YZ7A 2AU0A 1TR0A 4DV7F 2C2KB 4DV4J 4OJ3A 1S49A 1X4DA 4LF5F 1DAXA 1VISA 1RTDA 4NI2B 2CXEA 4LMZA 2VL1A 2BDPA 3QIDA 3QATA 2W2MP 4WTOB 1NO8A 4YB6A 3QRQA 4YB1P 4N56A 3M1VB 2BR0A 4AL7A 2J7UA 3WX4A 2H3EB 4FF3A 3M6UA 3DRSA 2BJEA 4Q0BB 2W2OP 1XK8A 5IM0B 2H4YB 1RBLA 1YBAA 3SSSA 1SKSA 1FF2A 2OPRA 2CWKA 3W8PA 1NHVA 1H2UX 4U8VA 2KXHA 4DUTA 2HRUA 2FPHX 1BQNA 2JX2A 1YSJA 3E01B 2V0NA 1ZM9A 4DUZJ 3MURP 2GW8A 4DPXA 2V9WA 5JVHQ 2IJNA 4LFAJ 3VAFA 4DPOA 5D15A 2P5VA 3CMQA 4A8WA 5DZ6A 3QGPA 3MFHA 3IG1A 4IRDA 4WFYA 3UPFA 1RLCL 3TANA 3D1HA 2AV5A 2G0IA 2J5AA 2IJFA 5ETOA 1UWBA 1R6VA 3H2VE 4DL6A 4Z2XA 2J76E 2D3UA 4QOTA 4OV6A 4PZVA 5DDPC 1M1KT 4PYAA 3DOMA 2QA4G 1HNZF 2YPZA 1OJ4A 1U6FA 5I3UA 5LM7E 1JIHA 2YKQA 5AT1B 3CCMS 1NK7A 4RW6B 1I3OB 3KUGA 1I94F 4A8SA 2EKYA 3J7YI 1S9EB 1D0EA 1VQKS 4DV6F 3R7SB 4Y65A 3MFIA 4ECRA 4O0NA 3JTPA 3H59A 3W1YC 2CPFA 3RR8A 2UXDJ 1RHJB 2UV8A 1RTIA 4N8OA 1EKRA 3I5BA 2VG6A 3T1YJ 1WC5A 4AQYF 3EDRB 2O67A 4QBUA 2A2CA 2HG4A 1QE1A 4KV8A 4JV5F 3MM7A 2R7UA 1A9NB 2FTRA 5E3AA 2B6AA 2VC1A 2PN6A 3SFUA 4C4WA 3K57A 2UUWA 2V8DA 3N28A 1OY9A 1J5EF 2Y1RI 1EHWA 2ZJQQ 2EW9A 3OTOF 4NMLA 2PT0A 4H4OA 2RJZA 2N7YA 3A3PB 2DB1A 3EPIA 1U09A 1HPZB 2VIHA 3AOCA 2LA4A 4Y2AA 5CQGA 2PMHA 2V8GA 3OT9A 3PRDA 4FXWA 2N3LA 2IA6A 3K17A 4FN5A 1SJQA 4TLRA 4JB8B 1BQMA 3TZZA 1JLCA 4PAAA 3FRYA 4JI8F 3Q0AA 4IG0B
chains in the Genus database with same CATH topology
2VBZA 4RW4A 1KC8T 3NCQA 2HQ3A 3P5TL 3UCZP 2MSTA 2KJVA 4PRFA 2LQ5A 4C2MA 3HHKA 3QGHA 3MHYA 2CPEA 4XDDA 1JLFB 4R8UB 3RR7A 3DRPA 3MTKA 3DLGB 4M63A 3Q8QB 2AP6A 4ES3A 3OL7A 4AYBD 5F9LA 3VAHA 4JUZA 3OBIA 2YNGB 3I0RB 3LANA 2CJ9A 1LW2B 2ZVSA 4LSNA 3CD0A 3NG8A 4UOCA 2HHPA 2KFZA 3OJSA 3DLJA 1UETA 2DNNA 4QJVA 2M8DB 1S6OA 5EUHA 5JJBA 3M9NB 4RBTA 4ZDNA 3KHHA 1HWJA 1RI7A 1HD1A 1VK3A 2FIUA 2NLWA 3BSNA 1U6BA 1FK9B 4Q45A 1Q86T 2UVWA 2CQCA 2JOQA 4ED0A 1NEEA 3OW2R 1UFLA 4PQAA 4CQ1A 2W25A 2QRRA 3NLCA 2Z0GA 1JJHA 4IFVA 1NH7A 1N5SA 1H2TZ 1T3NA 3CC7S 1E6VA 2DNHA 5KT5A 1ZBTA 1YRXA 1R89A 1F2GA 3LAKA 4K4ZA 4J9KA 1LOUA 1R8PA 5L9NA 1K0TA 3ISND 4RUAA 3KG0A 1BGXT 3T5KA 4ED6A 4X64F 2ZD1B 2IC3B 4G6VB 2VC0A 3BGLA 4EGLA 4JYAF 1H2VZ 2DNRA 3ITHB 2E5IA 1Q7YT 3QO9B 4OIXA 1LWEB 4EBDA 1FKOB 4I1TA 2DNMA 3S7RA 2RDJA 2FLNA 1HQUB 1VRTA 4RLEA 3VQTA 1X5TA 5KG2A 2CQ2A 3PXGa 2MJNA 2FJAB 3I32A 3V6HA 2UUAF 2QLWA 4Y28C 1C1BA 2RH3A 1J2VA 5CZXA 1KQGB 1APSA 3KWMA 3PY8A 2HHUA 3LP2B 1KRPA 2R9LA 4PUOA 3BREA 4OI3A 2DR8A 3DDKA 2Z8QA 3OHAA 1I1GA 2L9WA 1FRHA 1N5YA 2OKQA 2HQIA 2V4QA 2CDQA 4DR6F 5DLFA 5L1JA 3ISZA 1VFJA 3L7PA 4G1QB 5J2NA 2BXJA 7FDRA 4QR2A 5GAHI 4KGMA 3L3CA 3N5BA 1HMVB 2LYVA 2IRUA 2DVIA 2N4DA 2GIQA 4X65F 3KG1A 2ASDA 2XB2D 4KAIA 1GX6A 3RYLA 1EETA 1R31A 1DLOB 2B4VA 3IR6B 3M2VA 3N0VA 3IN5A 1TKZB 4ZCIA 2DO0A 1TL5A 2A18A 3CCUS 1QAJA 1WG5A 1G7CB 3VWSA 2R2SA 3OTCA 4HKQA 4FYDA 2EVZA 1KQSR 4M95A 2A10A 1SIWB 4KQZA 2PMZD 5L39A 5J2MB 4PXEA 4Y00A 4FNIA 2MY7A 1U25A 4QZVB 2VUGA 2VA3A 3WDOA 3A1YG 2U1AA 4CTAA 2K1RB 2IYGA 2ZOMA 3DGPA 1HL6A 4YB5A 1U1OA 4DV4F 1ZH5A 4IDKB 5KG1A 2BM1A 2DIVA 4OHXA 3R3TA 1C0TA 3SCJE 3JSMA 4DN9A 3FMBA 3G6XA 3DLBA 2JZ5A 1DARA 5AE3A 1Q16B 1U1KA 2AYBA 3SSRA 5KFYA 4ZVFA 4A8KA 3MEDB 1KOHA 1YJRA 2R8IA 3BO3A 4IFYB 3HDSA 2W9CA 2D74B 1N6QA 1ZAWA 4OI4A 2RQCA 2YKMA 4HYKA 1HWIA 2WOMA 4ZHRA 2E9ZA 1Y4ZB 4DL5A 4WFBQ 3PKYA 1ZTTA 1QVGR 3VR1A 3GV8B 4RW8A 1LFWA 3HHLA 4FF4A 3CJ0A 3VALA 1VS3A 1XMOF 5C24A 5A0YB 5CYJA 1MW7A 3AJ1A 3AA8A 4GO5X 3UDLA 3PW0A 3M8QA 1K8AT 3TVZA 1H7XA 1S1UA 3FEYB 2LECA 1VOMA 1UAWA 2C2RA 2GO9A 2CPYA 1NKBA 2EG1A 5KFLA 1VQPS 2E1CA 2C28A 4IQXA 5HP1B 4X4PA 1JLGA 4I64A 1N52B 4DR7F 2UV8G 5DGBA 5I42B 4I6AA 3VTIA 2AGQA 2J9CA 4Y3CA 2ZHBA 5B0GA 3CTRA 2RD5C 2V8HA 1KLMB 3TVKA 4YR3A 4X4QA 3GIJA 1R7IA 2V94A 5LL6d 5BYRA 3HKZD 2CZVC 3OFGA 4ZPBA 5M2PA 2YNFB 1TQLA 2C2DA 3AJ2A 2GIRA 3C66A 5DM6Q 3P49B 4NCAA 3MEGA 4ZCMA 3QAEA 2W7PA 2YWGA 2DNLA 2GJ2A 3CB4A 4MTPA 2RT3A 5KFDA 2POKA 4IQMA 2CJAA 1VBXA 5F8LA 1DHMA 3EGZA 1FVSA 3GWCA 3GFHA 3R1HA 3JB9k 3M8SA 2CVIA 4NLDA 4QIVA 3HMJG 4DUZF 1R8AA 3SFGA 3MAQA 3DMJB 3KMSA 3FJ2A 2IM1A 3TYTA 2C3YA 4A8XA 2XY5A 2JLGA 2FJWA 3DM2A 4C8OA 2OMOA 2UUBF 3W2WA 3IXQA 2FVQA 1HBNB 4NCBA 3KJVA 4KRWA 2MXYA 1ZZFA 4KC5A 4RWXA 4LFAF 5HROB 5HO4A 4D3HA 3Q8SB 3R5AA 3CJ5A 2RDIA 2IYIA 1U2FA 2M9KA 3O6QA 2R2UA 2WB4A 4NLVA 1JK9B 3QMQA 1J5OB 1JMTA 3FVYA 4CT9A 4WYWA 5HLFA 4PWDA 4FXDA 3TRGA 4DSKA 4CO2A 2M4MA 3CCJS 4DV2F 2I0XA 2MZSA 4EZ6A 3KK3A 3GQCA 1BQXA 5GAGU 3JYTA 1HYSA 4WKRA 3Q2TC 2GHPA 2AWZA 1FJCA 2YNIA 2RVJA 3HVTA 5E3PA 1T95A 2FHJD 3RB3A 1HBUB 3PO4A 2N7CA 3OV7A 1IR0A 3DRRB 1SJ3P 1F5CA 1Q81T 4ID5B 1C1CA 3CXCR 5KFXA 1HBMA 3E51A 4OX9F 3QYYA 1XC9A 2W24A 1WNEA 2AX0A 1S1WB 5LT5A 5G4DA 3MUTP 3PZPA 3B4DA 1JLEB 1U45A 2QZ8A 2YWHA 2W9AA 2ZKUA 4DL0C 5B0BA 2IMOA 4B02A 4B3OA 2QYCA 4ZPWR 3CDBA 3D0IE 1FRXA 2IMWP 3DRSB 4O4GA 4RNFA 3N6LA 4RW7A 4NZ7A 1IKYA 1OS5A 4TNOA 2DNOA 2QEXS 4I7FA 4I2PB 4DQSA 1NRKA 2RS8A 2ZUGA 2DCUB 3FFIB 3H20A 1Q8BA 4KB7A 5F9NA 4ECUA 1XN9A 4KFBA 3CD5A 3BGRA 1TKTB 1BQNB 2LQ9A 5K8OA 1KHVA 2RIJA 4NWBA 4KO0A 3GZ7A 4ZPDA 2F8EX 2OSRA 4NYPA 2XMWA 4E0DA 2XSFA 2HHWA 1ZPVA 1S1XA 2ZH6A 4QPXA 2OLWA 4X4RA 4C0BA 1XMQF 2R7VA 3BF4A 3G8SA 2ZKTA 5C42A 3H98A 5A2QY 4WF9Q 2V8VA 3MOJB 5F8JA 3NRBA 2DNPA 3Q22A 4O44B 5AJ3F 3JAMY 2HHHF 1UVNA 2Q66A 1JNRB 3M4XA 2NSBA 4HL9A 1WD6A 1ZM3A 1C2PA 3KLGA 3J81Y 2RRAA 4O3SA 3D1OA 3J7A1 1DRZA 1F5BA 3TVYA 4FBTA 2OPSB 4HT5A 1TKXA 3TUIC 3S8SA 5T14A 4ED5A 3D0GE 1VRUA 1FKAF 2VASA 5CZVA 3HI9A 3LH2S 5GAHU 3N01A 2HGLA 2XCPA 2J9EA 1WG1A 2B4OA 3I55S 4P6QA 2MGZA 5KFNA 2WTFA 5DGAA 1JXEA 2ZC4A 3HPOA 3H4DA 1VBYA 1HFEL 3OFHA 1QY7A 3UI3A 1T05A 4DR4F 1HQEB 3KKFA 4YB7A 5EHHA 3T6JA 2ZBIA 3H25A 3UWTA 1UVMA 1FT8A 4OV1A 4B08A 1UA1A 2XLIA 2M2BA 5D77A 2VG5B 4AUKA 3FCHA 3I9V9 1WELA 1UVLA 2KXNB 2FC9A 4PQUB 4DF4A 3D0HE 1RT5A 3EGWB 1MROB 2Q6BA 2C3OA 4NPOA 3BB5A 3MWBA 4NX9A 4AE5A 4JI3F 5LXRA 2DGSA 5KFPA 1FRJA 1CQMA 2OPPA 4MAKA 4M5DA 2MQOA 3UFCX 3HXMA 3PX0A 2CJQA 2I5JB 4RUHA 4FP9A 1U24A 1S1VA 1S6PB 2MKSA 4B17A 3KLFA 4OHYA 1Q7LB 1FDDA 4KHPF 1UVKA 1G2EA 2BACA 5LMNF 1VQ8S 1IBMF 4AL5A 4DJBA 4NZ0A 2YH1A 5DJBA 1RISA 3AB2B 3MMCB 4I4BA 3MXHP 3R27A 5HMZA 1NHUA 1RAJA 1IQTA 4MJKA 5G0RA 1D1UA 3I82A 4I56A 3HHNB 1SB6A 1RT1A 1HWUA 2DNGA 2YWEA 1FDNA 3SCKE 1YI2S 2P9CA 3VQSA 4PG5A 4CT8A 2NPIA 2R7WA 1TFWA 3R5DA 5I4MA 2NQPA 1KN6A 3K8VA 1ULRA 4JI7F 1ZETA 4P2SA 2UUCF 1ZYQA 2PIIA 2B51A 4ZS6A 2BVZA 1U8SA 2GO8A 1KFSA 1KHWA 2KXFA 2FGCA 4TU8A 1T94A 3PW7A 2WSEC 4PG7A 3CJKB 4DG1A 4TLQA 3EGNA 4OMFG 3GE9A 1F0XA 1CLFA 4IH5A 3SXLA 3MECA 2UVUA 4QCLA 2CVEA 3M1VA 2WBMA 5A8WA 5MLCV 4KHMA 2VV5A 4DOZA 1GH8A 2DPJA 4A8MP 1WTFA 2ASYA 3MMAB 3O3LA 3C46A 3IRXA 1X4EA 4JI1F 4X4OA 3K7RA 3PVXA 4EEYA 1I6JA 4Q0BA 3UR3C 5IM0A 4OJ1A 5J1EA 1AFIA 1RTIB 2CJKA 4J9RA 5K14A 4QWEA 3BR8A 4LF6F 2UXCF 1IKWB 4F4ZA 1A7GE 1UA0A 2L9NA 3V4MA 3CIZA 5JUMA 4J9LA 3RW6A 3I96A 1RTJA 3M2RB 3C6UB 1TUVA 2VFRA 2BW2A 4MIAA 4K2XA 2QMWA 5D78A 2XLJA 5AE2A 3MMJA 2W9BB 1WEYA 2OIHA 1N0VC 3KK1A 2QFJA 3RB6A 3BQ2A 2J6UA 1L3SA 1FDAA 2YVSA 3E01A 2GMLA 4JI0F 1ROFA 3QPIA 5DDOC 1P27B 5D6GA 5A6PA 3QJPA 3MM9A 2U2FA 1O0PA 4MK8A 3KHRA 1M0SA 5DRKA 2GQ2A 2CYYA 3AY0A 2KHCA 2JEJA 2F1FA 3MM7B 2E5GA 3E3XA 3U1MA 1JJ4A 5CHCB 4YEAA 5DDRC 1JB0C 2A1BA 1DBDA 4ES1A 3LO3A 5T7LA 2F40A 2PD1A 4NLOA 2XMKA 4CI0B 2PO4A 4EUVA 5IFMA 2OFHX 1S9FA 2D41A 2DPIA 4UY85 1RYRA 4LFCF 4MKAA 4U7UK 2L9DA 3TOQA 2RU3A 3OR2B 3G9CA 5D4NA 4Q43A 4MK9A 3M6XA 4E8UA 4WFZA 4F2SA 3K0JA 1VBZA 3MZIA 3I87A 1UEUA 2AJQA 4ZA1A 1TK8A 3DYAB 2JLFA 1B64A 3DLHA 2RILA 4IG3B 5E5NA 2HMIB 1VQ5S 1E6YB 2CPZA 2GHVC 2ZH4A 1CC7A 1JKHA 2Q79A 4MFBB 1H0HB 4WZQA 2VBWA 1RT6B 4GKJF 2KG1A 3KMQA 3DOLB 1VHFA 4WE1A 1NK6A 2FVSA 3NL0A 1OWXA 4MMOA 3SDEB 4EWTA 2R7TA 2LU2A 4MKYA 1GT8A 3NWGA 2HNDB 3U7JA 2Y1IA 4EO8A 5KT4A 2MKKA 3NAHA 4I2QA 2VBYA 4NLGA 1LWCB 3R5CA 3E2EA 2HW3A 2IAJB 4KJIA 4WU2A 5BYQA 3NBPB 1N48A 4J9QA 2D3ZA 2JFKA 3K8WA 1IKXA 1Z1ZA 1YVFA 4P7TA 5GADU 1RT7A 2B0GA 5F0UA 1X8DA 2N82B 3O44A 4C8LA 1DTQB 1JLQB 1KD1T 4K4VA 1SI9A 1H3DA 4Y2IA 1S0MA 1CPZA 2EFQA 3DLKB 3V4IA 4PG8A 4J5OA 2JC1A 1FE4A 2B9XA 4RW6A 4TY8A 2M8HA 5EGYA 2FC8A 4TY9A 4ZP9A 2ILZA 2E1MC 2DGVA 1S9EA 2OPQA 2Q43A 1IJEB 2OSQA 3DRPB 4EBEA 2JSXA 1L3VA 2I9SA 2QE5A 3SQGB 3TAMB 2R7OA 5IT4A 1N8RT 3K5PA 2VOPA 4DSFA 4QWAA 2YX7A 3EXCX 2W8KA 4H4KA 3ULHA 1FJEB 4LUBA 2QA2A 1TL3B 3IGVA 1K73T 2KB2A 3G6ES 3QJJA 2EPIA 4QWCA 1R3NA 2ZHAA 2IFXA 4ECSA 4QU7A 4Z37A 4G1IA 4C11B 3KK2A 1HI1A 2VB6A 3JTOA 5KFTA 2BA9A 6FDRA 1KLNA 3GYNA 4W90B 1XNQF 1R8BA 1E6VB 1XR7A 4OZ1A 3D2WA 1FNXH 3T3FA 4RW9B 4DS5A 3CMAS 2M3DA 4QPTA 1M5PC 5L38A 2MJUA 3OLBA 2D3OR 3HHDA 3MM6A 2FVPA 3IAM9 3NNAA 4QIFA 2RQKA 2IM2A 5CA5A 2LEBA 4JOUA 1RYSA 3RAXA 1D9FA 1SC6A 3I0SA 5A8KB 1O5JA 4DUYF 2VA2A 3FSYA 3UD4P 1IBLF 3I5AA 4ZCLA 1RTHB 1X5OA 5D8HB 1VQYA 4TQRA 3RTVA 2YQ3A 3MR2A 3L7OA 3IR5B 1W25A 1TV6B 1HWKA 2IM0A 1LW0A 1OPZA 2AYGA 4NOHA 4F50A 4NXMF 2BE2A 3AHPA 1JLAB 4OX8A 2RE1A 4PUOB 3EZUA 1V3SA 4J9PA 4ZPTR 2O3DA 1QAIA 2BRKA 3CJ3A 5IS2A 4B3SF 4JI5F 4RU2A 3MM5B 5KOWA 5KFQA 1D9AA 3GIMA 5LMUF 2UVRA 1WHWA 5C5JA 1SJ4P 3OLAA 1VQ9S 3LP1A 3LALA 3MPYA 4NLRA 3EUNA 3ZZRA 2CQ3A 2O5DA 2ZOGA 3R5BA 1FCAA 2RQMA 1FRKA 3DOKA 1XERA 5GAEI 1JJ2R 1P8GA 4AXIA 4QW9A 3VAKA 3NNHA 4DL7A 1PC4A 1R0AB 3GSDA 2HFOA 1WEZA 2LEPA 3POTA 4ZLPA 3HVRA 4LF8F 2DH9A 2ZC3A 2KHDA 3FSXA 1TAQA 4GMKA 1HPZA 3OUYB 3CSKA 1DTTA 5DM7Q 4ZPAA 2KZMA 5DETA