2CQ4A

Solution structure of rna binding domain in rna binding motif protein 23
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
114
structure length
114
Chain Sequence
b'GSSGSSGKSPVREPVDNLSPEERDARTVFCMQLAARIRPRDLEDFFSAVGKVRDVRIISDRNSRRSKGIAYVEFCEIQSVPLAIGLTGQRLLGVPIIVQASQAEKNRLSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords RNA binding motif protein 23
publication title solution structure of RNA binding domain in RNA binding motif protein 23
rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 16
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2005-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2cq4A01
2DNYA 5CA5A 3MUMP 2DHGA 2CQGA 2LMIA 2KVIA 1HL6A 2CPEA 2MSTA 3CC2S 1VBZA 4YB1P 2OTJS 1SJFA 1SJ4P 2KT5A 5DDQC 5MLCV 3HHNB 2MQPA 2RU3A 2D9PA 3THTA 2N7CA 3P6YC 1YIJS 2LXUA 2EK1A 1U1NA 1WEYA 1H2UX 2YH0A 2MQOA 2D3OR 1R8PA 2D9OA 2DB1A 2CPHA 2DNNA 1X5PA 3UWTA 1M1KT 2CQIA 2G4BA 2CJKA 1OWXA 1WF0A 1OIAA 1YHQS 1YI2S 1X4CA 1U1MA 3J7YU 2DNKA 1VQ8S 2MGZB 3R1LA 2AD9A 4ZKAA 4CH1A 2FC9A 2X1AA 3BEGB 3SMZA 1U1KA 1WF1A 3UCZP 2MKCA 3S7RA 3VAKA 2MB0B 3R27A 1O0PA 1SJQA 2VOPA 3NS6A 1PO6A 2MKIA 4YOEA 3G4SS 1U1LA 1H2VZ 2DIVA 3Q2SC 1Q82T 4WCEQ 2VODA 4LIRA 2DNLA 2J76E 2MZTA 2DISA 3VAHA 1BY9A 3VAFA 2CQPA 1U1RA 3NS5A 4QU7A 1JMTA 1S79A 2J0SD 5CXTA 4C0OC 1VQMS 2XS7A 1WHXA 3MI7X 3G6ES 4Y00A 3US5A 2OJ3A 3CULA 3SDEA 2F9JA 2PE8A 1WHVA 1Q81T 2DGTA 3JB9k 3BO4A 2E44A 5LSOA 2KU7A 4BS2A 3PIPQ 1CVJA 4W90B 2EK6A 3VAMA 3HI9A 2U2FA 2LEAA 2QFJA 2XSFA 2DGOA 1D9AA 4WFNQ 2K8GA 3S01A 2DGWA 1N8RT 4Y0FA 4LMZA 1N52B 2L9WA 2NLWA 2DGUA 2RS8A 3N9UC 2OIHA 2RT3A 2O3DA 1XN9A 2X1BA 2XB2D 2YWKA 1URNA 2VONA 4ED5A 1WEZA 2RRBA 1X0FA 1M5OC 2FHOB 2QEXS 5DM6Q 1FXLA 5GAEU 1JJHA 2DHXA 2LCWA 2F9DA 2MGZA 2F3JA 2RNEA 3TO8A 1VQLS 2KG1A 3G8TA 4PR6A 4C7QA 2N82B 1R8HA 1WG4A 1VQ6S 1L3KA 3CCQS 1DRZA 2E5GA 2HGNA 3U1LA 5FJ4A 2LA4A 2RQCA 2MQLA 1YJ9S 2KYXA 1YJNS 2G1DA 1YTYA 2CPXA 2KRBA 1PGZA 1SJ3P 2DNQA 1WWHA 2KHCA 1Q86T 1X4BA 3D2WA 2E5JA 2MZRA 2FC8A 4TLQA 4YUDA 2RRAA 1NU4A 2M52A 2M70A 1QVGR 1WHWA 2MY8A 2AYEA 1NJIT 4UQTA 4WIIA 4P6QA 2M7SA 3MUVP 2X1FA 2GHPA 5LJ5Y 2RQ4A 1ZZNA 5IQQA 2OSQA 3RW6A 2XNRA 2CPFA 4V19X 1FO1A 2FY1A 2MXYA 2CQ2A 1WI8A 2GO9A 3ZZZA 2M4MA 2YH1A 3MOJB 2OTLS 1FJEB 2I2YA 1FJCA 1HD0A 2RUGA 1UFWA 4F26A 2DHAA 1OO0B 2BZ2A 5JVGQ 3UCGA 5BJRA 3UE2A 2QA4S 2L41A 3TYTA 3CCJS 2HVZA 5EN1A 1VC5A 1X4EA 3BS9A 1AUDA 2MSSA 2MKSA 5ITHA 1Q7YT 2CPDA 4W92B 3BO2A 4QPTA 2DNPA 4F02A 2UP1A 1U1OA 1YWXA 5GMKa 1F9FA 3K0JA 2E5IA 2DH7A 1H2TZ 1KOOA 1X4HA 5IM0A 3CCMS 3IRWP 2LEBA 2SXLA 1NO8A 2LQ5A 3P49B 1U6FA 2JRSA 2CPZA 4QU6A 1K8AT 2M8HA 1VQ4S 2K3KA 2MJUA 2MPUA 2CQ0A 5GVQA 3LQVA 3V4MA 3CCVS 1KOHA 2DITA 2ZJRQ 2DHSA 3OW2R 1X4DA 5LXYA 4IOAQ 2DH8A 1P1TA 1DHMA 2KXHA 4J5OA 2MKKA 2M0GB 1VBYA 2DO0A 3CCUS 2DH9A 2KRRA 1U1QA 1D8ZA 2LKZA 2M2BA 3CC7S 2KI2A 1P27B 5LJ3Y 3MD1A 3I55S 4TU8A 1HA1A 1X5TA 5HO4A 2AYGA 1FNXH 4CQ1A 1OPIA 2DNGA 1B7FA 4FXVA 1UP1A 3VF0B 2LXIA 1JJ4A 1WF2A 1DZ5A 1X4AA 4Z2XA 2KXNB 1M90T 3CCSS 1N54B 2DNOA 5LSLA 1VQKS 3EGZA 1WTBA 3NMRA 1KQSR 3CMES 2HYIB 1RKJA 2DGVA 3MUTP 1YJWS 2KFYA 1UW4A 2V94A 1ZZFA 2AYMA 4PKDB 1S72S 3LPYA 3VAGA 3NNCA 2DGQA 2DGSA 3MURP 3MD3A 2MJNA 1ZH5A 1G2EA 1FHTA 2DK2A 2MQMA 2MY7A 2PEHA 4WF9Q 2RVJA 3G8SA 2JVRA 3EGNA 1A9NB 1KD1T 2CQBA 2J0QD 2KXFA 2DNHA 4OZ1A 3SDEB 1FJ7A 3J7ZT 2KH9A 2MQQA 2AYBA 3MDFA 3B4DA 4OZ0A 4RU2A 2MKJA 2JVOA 1M5VC 2J8AA 2MQNA 3ULHA 2CQ3A 2MKHA 5GAHU 2MMYA 2CQHA 1VBXA 4UY8T 4M5DB 3VAJA 1VQOS 5DM7Q 5IFMA 3CMAS 5D78A 2HGMA 3B4MA 2LYVA 4CIOA 3CXCR 1WHYA 2CPYA 5DDRC 2ADCA 1UAWA 5LXRA 2MYFA 3VAIA 1SJRA 1DBDA 2CQ4A 2DGXA 1QM9A 2N3LA 2A3JA 3FEXB 2ADBA 5DDPC 2WBRA 2N3OA 2Q79A 1VQ5S 2DIUA 2KN4A 1KC8T 1N88A 3CD6S 3VALA 1VC6A 1WEXA 3DLLQ 3G9CA 1QVFR 5GADU 1VQPS 1VQ9S 2DO4A 4ERDA 2CQ1A 1M5PC 2G0CA 2JX2A 2I38A 4LJMA 3P3DA 3TP2A 3BO3A 3EX7B 3CF5Q 2M88A 4IO9Q 3I56S 2OSRA 5HL7Q 3R1HA 2MZJA 2KG0A 1U1PA 3UD3P 2BOPA 1U6BA 2MZSA 3THPA 1WG5A 2X1GA 1YITS 2MZ1A 2XS2A 1WELA 4QQBA 4IUFA 1X5SA 1H6KX 2MZQA 5JVHQ 3PIOQ 4PRFA 5GAGU 2YTCA 3CCRS 4CH0S 1X5OA 2YKAA 3CCES 3MXHP 2MHNA 3U1MA 4C4WA 3CPWR 1VC0A 2XNQA 3H2UB 1SXLA 1HD1A 2VOOA 3S6EA 3H2VE 4FXWA 2HZCA 2M8DB 2JWNA 3NNHA 3L3CA 4WKRA 3RW7A 2DNRA 2NZ4A 2KM8B 3NNAA 2CPIA 4U67Q 2U1AA 2CQCA 2FPHX 2M9KA 2KM8C 3UD4P 2RS2A 1X4GA 1RK8A 4A8XA 1VQNS 1M5KC 2ZJQQ 1A7GE 2LECA 1W2BR 3Q2TC 5D77A 4EGLA 4WFBQ 3DXBA 1WG1A 3P5TL 4WFAQ 5DDOC 1VQ7S 1WI6A 1K73T 4IOCQ 2LA6A 1U2FA 3CC4S 2EVZA 3FEYB 3UCUP 1X4FA 3S8SA 3CUNA 2B0GA 2E5HA 4TU7A 2HGLA 3G71S 2ZJPQ 5DETA 1K9MT 2CQDA 4F25A 2CPJA 2L08A 3SXLA 2XS5A 3CTRA 2DNZA 5CYJA 1IQTA 2ERRA 3ZZYA 1FT8A 3IWNC 5H1SV 1JJ2R 3G96A 2DNMA 4TU9A 3CCLS 5IM0B
chains in the Genus database with same CATH superfamily
5HJYA 2PI5A 2C1EB 2F65A 3TUPA 2BJEA 3KJQB 2KFZA 1VBZA 2KT3A 2KT5A 3PKMA 2W2MP 3FNNA 2MQPA 2K3IA 1XWLA 2HNDA 4EMDA 2W2NP 1RQ0A 2CJKA 5HROB 3R6GB 2BVZA 3SQGB 2BV3A 2CRLA 1WC0A 3TA2A 5ETTA 2LQBA 4HVZA 2UVVA 4MIBA 2AWZA 2E7WA 1U1LA 3GFZA 2OPQA 1CJKB 2FVCA 3VAFA 3AQPA 4CLTA 4OLOA 1L3TA 2XS7A 3ZC4A 3QWUA 2EFOA 4AL5A 5HMWA 3J7AN 3K8VA 5DG8A 3IO1A 3VGVA 2GAGC 2YKNB 2QYCA 2FVSA 1FWLA 5KT3A 1T8EA 5G4DA 1B70B 5J1EB 4KTQA 5H9EK 2OLWA 2B6AA 4DV0F 4DUTA 4F0HA 3DLEA 1U4BA 4LMZA 1E6YB 5HANA 4G1QA 2RS8A 4DUYF 3PRDA 2OIHA 4KFBB 5D3GA 2XB2D 5F8GA 3OL8A 1WACA 1WC3A 3HD2A 4ZHRA 4GKJJ 4LF5F 3BDEA 1S1VB 1HARA 3D6MB 3BQ1A 3TVZA 4DPTA 3RR7A 4DSIA 4ALZA 2CG8A 1S77D 1YTYA 1IKYB 5KFAA 1H38A 2ZD1B 1X4BA 5KG1A 4U96A 2RRAA 1IWGA 1NJIT 1VISA 3RBXA 4WP9A 4XTTA 2LQJA 2KJVA 2B7CB 1JQGA 1YQHA 3CD7A 4ZVRB 3OFFA 3UPFA 1SL2A 2W25A 2UUTA 3BQ0A 4B3MF 1RHMB 4PPZA 1PJ6A 4F26A 1Y5IB 1Q4RA 3LALA 3KWMA 3CDWA 3DOMB 4JI6F 4QPTA 1U1OA 2RE1A 4FYVB 1RU1A 4QPXA 4F8RA 3NRBA 4P7VA 3D28A 1R8CA 3TQEA 4FYDA 5IZHA 4ECRA 3QRQA 1SC6A 3NWGA 2MPUA 3DOKB 2C2KB 5GVQA 3CCVS 2ZJRQ 1QE1A 2DHSA 4OLPA 4EFAC 3AOAA 3PFEA 3MD1A 3E8OA 2EWHA 1NB7A 1HA1A 1X5TA 5CZVA 4W98A 1R0BG 1B7FA 2DNGA 3HHDA 1UA0A 4RW9B 4LF6J 2E1AA 2DNOA 1OY8A 4FXDA 3NMRA 5K8MA 2QSFA 2AQ4A 3KNGA 5B0FA 1UW4A 2JLFA 4J91A 2XLKA 1AFIA 2DGQA 2WONB 1XMOJ 3MD3A 1QSLA 2FLPA 4UT4A 4X4UA 5KG3A 2OELA 1C1CB 1GQEA 3R5CA 4Y34A 2KTQA 5HQLA 2DNHA 2P2CB 4OJGA 2NYHA 3PW7A 3KK2A 4ETXA 1TKXA 2CQ3A 4NYOA 4DFPA 5IFMA 4FKYA 5DDRC 1PBUA 5F8JA 1QM9A 1HNVA 3BSCA 2C2MB 3AA8A 4USJC 2ATLA 4DUZJ 4QJVA 3QSYB 3UD3P 1BGXT 3PYDA 2VDHA 4EU0A 1C0UA 4FF2A 4IUFA 4PG7A 1RZMA 1XMOF 3N5FA 4C97A 2YKAA 4C4WA 2IVFB 4JI0J 1EJ7L 2BABA 2FLOA 2M9KA 3EDRB 3K57A 1NK5A 3IN5A 2HIYA 3P5TL 4WFAQ 1N0UA 3FCWA 4ED7A 3MAHA 1WI6A 2LA6A 2VQEF 1OY9A 4H4OB 1PSDA 5AE2A 2DR7A 3SZ2A 3OTBA 1QUPA 4IFYA 1LV5A 1K9MT 3WC2A 2AZ3A 2ERRA 4EBCA 2BANB 4KGXB 4KO0B 1RLDA 1XNRF 2DNYA 1RTHA 1F2HA 5CZXA 1R27B 5DJBA 3OL6A 3M8PA 4YB1P 3O8WA 4DV6J 3FQKA 1NM2A 3TUJC 4KSEB 3NBPA 2CFXA 1PYSB 1NK9A 1YIJS 1HNIA 1ICEB 5E3RA 4I2QB 3IFEA 1X9MA 4BWJA 4KGVB 1KR4A 4JI0F 3DGPA 3B54A 1XC9A 1SUQB 3HHLC 1WUUA 2CVIA 3GJRB 1YI2S 3MM7B 3JAMU 2BM1A 1XEZA 2MKCA 4USWA 1SJQA 2Y0BB 2VKZG 3L7UA 5IQ6A 4CLSA 3SFUA 3M05A 1M1GA 3D1QA 5L38A 1K47A 2OPPA 4NA1A 4DLEA 4DX5A 4E2FB 1FX2A 3JSMB 3PHEA 2WVCA 5BYSA 2E7VA 3JB9k 3GZ7A 3VVUA 2GZOA 2ILYA 3LH2S 1JLCA 1REGX 3B78A 4OYOA 1YRUA 2HEKA 3GYNA 3TUIC 5T7LB 2DGWA 4NXNJ 4ES1A 3AD9C 2H51B 3HSDA 1KLMB 4WBFA 1QAIA 4O4GB 2YWEA 2HQ3A 3KLEA 4I0WA 2FJEB 2UV8A 1URNA 2RQMA 2FHOB 1VRQC 4AXIA 3GV8B 4P2SA 1FWPA 1I6JA 2ZE2A 3QWPA 3EICA 3D6TB 3PRBA 2VD3A 1S48A 5D0RA 4ZP7A 3RRHA 4JUZA 4ZVHA 5F0UA 2R9LA 3E51A 2RQCA 1S1TB 7AT1B 2LU1A 3O6QA 1N33J 3QT6A 4YUDA 3UI3A 3IRXA 4DR3J 4UQTA 4PWUA 2X1FA 2NS1B 2J9CA 1IKVA 5CD4H 2CJXB 4KKOB 3MFIA 3WDOA 3NAHA 2YH1A 2R7SA 2GS8A 5KFJA 3A3OB 1GX6A 1MWZA 2VG7B 4JI8F 5KG4A 1DARA 1JLAB 4NXNF 4CT8A 2IM3A 4YMEA 4FZVA 4WFZA 3BO2A 4JI5F 1YWXA 4WE1A 2KVQE 3TEGA 3DRSB 2EKYA 1UW9A 4NX9A 2C2OB 3FBCA 4U8VA 1HQEA 3OXGA 3FFIA 2AJ4A 5FLXY 4WXWA 1KVKA 3MCSA 3C19A 3OW2R 4AE5A 5DGAA 1T11A 3MOZA 4KYZA 1X0PA 8RUCA 2LP4A 3RTVA 3CC7S 2HNDB 2G0IA 2GNKA 4OZ2A 4NRUA 4CLUA 2JEGA 4DV3J 2LXIA 1AW0A 1ZTWA 1AXQA 4FN5A 3CCSS 2ASDA 3H7HB 2FLLA 1ZZFA 1RT5B 3SEOA 2ASLA 1U0HA 4A4JA 2MJNA 4I2PA 4GC6A 1RI7A 1UZDA 2BYCA 5D0EA 3M6WA 4A48A 3H5SA 4X65J 2B6AB 4N76A 4PXEA 3EVWA 3PYFA 3TRGA 4N7TA 1HIYA 3JAMY 2G13A 4ZPCA 2UVUA 3DMJA 4CLWA 2Q79A 1RTZA 2RKIA 4I1TA 4ZHRB 4HHJA 4Y65A 4C8OA 2G0CA 3F56A 5A8KA 2Z58B 5D0GA 1U6BA 3VWSA 1YITS 3L7PA 5JVHQ 4GVLA 1J27A 2UUAF 2UVRA 3UDEA 1VCTA 4NLPA 2HHHF 3LWLA 2PGCA 2KM8B 3NNAA 3PYEA 1IJEB 3GMGA 4BWMA 1VQNS 5F0WA 3MPVA 2OFGX 3CDEA 4X65F 4J9NA 2XMTA 4WFYA 2BA9A 2CXEA 3KLIA 3OXFA 1HQUA 4GVBA 2V67A 5JMNA 2XS5A 2L08A 3CDBA 4CI0B 3K89A 4RW6A 4QR2A 1R3NA 1WC6A 1RHQB 1F60B 3TJAA 4ZPDA 1FRLA 5HQMA 4KIAA 3DFEA 2XM3A 4ZVOB 1APSA 1RLCL 3M8WA 1QE1B 3CB4A 2C2RA 4KHMA 1TUVA 4LRDA 1A6LA 2GIQA 4DV4F 2DNNA 2DRDA 1YX2A 1B3TA 2EFQA 4QWBA 4F0MA 2VFUA 4M5GA 2IMOA 4ECQA 4ZLPA 2VICA 3R27A 2E1CA 2HBYB 5IS2A 4OL8A 4PPDA 4DF4A 3JSYA 2ZOGA 4Y00A 2OJ3A 3TZZA 1HWLA 1TK8A 4FF4A 2IHR1 2O1PA 1I1GA 1S12A 2QC3A 3OL9A 4B02A 4PAAA 4UTGA 3G86A 1NBEB 2FHJD 3KK2B 3GB0A 2QFJA 1TKXB 4PXDA 5L1KA 3RBEA 3I5AA 3PDNA 2UUCF 2X1BA 2QRRA 3HLUA 2R8JA 1F5CA 4J9SA 2GMJA 1HNVB 4URSA 2CWXA 2VFRA 4Q7AA 2CNKB 4NLWA 2A10A 2LQ8A 2G1DA 2HFVA 3D3BJ 3X3UA 2AIRB 4MIWA 3ZTOA 1G3OA 4RLEA 4ZMMA 2NSBA 2VBZA 4LFBF 1FK9A 3ICLA 1ZZNA 1RAAB 3EVOA 2E9RX 2NR0A 1RAEB 2HFSA 4IH6A 3NXZA 4AUKA 3F73A 2YX1A 2QL7B 1WC4A 5I3UA 3BS9A 1AUDA 1C4CA 4IFYB 1P1LA 3N01A 2MHEA 4PXCA 1XERA 2UP1A 4CO2A 3SSQA 1JLBB 4ICLA 2LQ5A 1U6FA 3RAXA 2ZOFA 3OL7A 5IWAJ 3M8PB 2R7UA 2CAJA 3WX4A 3V4MA 1T03A 3NBPB 4FS2A 3DRXA 4P10A 3DLKB 1U09A 2DXFA 2Y9HA 1ZM2A 2J6SA 3ET6B 2G1HA 1JXEA 3GTYX 4DL4A 2KXNB 2XY7A 2NCKL 1HNWJ 3RB0A 3GR0A 1W25A 3RYLA 1Y3KA 4FYWB 1G7CB 3NEKA 2CKWA 1NXIA 2HG4A 3HVTA 3LPYA 1S1WA 5E3QA 2C3UA 5F8IA 4QCLA 3U02A 3BPDA 2AT1B 2OPPB 2HWTA 3IC1A 4MKYA 1HI0P 4ER8A 2CQBA 1LWFA 4CO1A 2H48B 4RU2A 2MKJA 3WQPA 1JLCB 5L1JA 3ULHA 5IWAF 4DR7F 3G82A 3HJFA 1YKWA 2V6AA 4MYUA 3MR7A 1LW2B 3I5CA 1NHVA 4OJHA 2HS0A 4ZVTB 1S9EA 5KFEA 3DRRA 1VQ5S 1YLXA 1NKBA 4CLYA 4NXMJ 2YNIB 3VALA 1WEXA 4CH7A 4KH1B 2DO4A 3GJSB 3RAQA 2P6TA 2F63A 2GIRA 2NXUA 3SQOP 2J9EA 5KOXA 3W65A 4S0MA 2M88A 2CJQA 3QRPA 2MZJA 2KG0A 4DSFA 5DG9A 2MZSA 1Y5NB 1WG5A 5J2PA 3EXCX 3PVXA 4C2MA 3TARA 3IRXB 1VJQA 2HQCA 1IVZA 3CJ8A 1IKVB 3UD4P 3I9ZA 2YKOA 3ENQA 4RJVA 5KT7A 1F2GA 1H7XA 3AJ1A 2CJ9A 3M8RA 4C0BA 3W5YA 3D4JA 1U49A 1SCJB 4J9LA 3PW2A 4NRTA 4USKA 4WE1B 3ZFVA 3QRRA 4P72A 4ED6A 2V4QA 1HQEB 3FFIB 3JTPA 3IGVA 2HSEB 3THTA 4G65A 1ZETA 1WEYA 2V4JA 4QWDA 4P9SA 4BHQA 3GP9A 4BCAA 5KG2A 3L4BC 2DNKA 4FNIA 3AHPA 3Q8QB 3C16B 3SMZA 3TOQA 5ETMA 1WF1A 4UQGA 3S7RA 2E1PA 1RWUA 3PJWA 1EB0A 4C98A 5J2NA 5EGYA 2NPFA 1XTZA 3AQOA 1SPBP 4KPCA 2BW2A 4Y3CA 3DU5A 5CXTA 4DL0C 1U0HB 2CZ4A 4NYZA 2DPIA 4LF8J 2EFNA 4J90A 1U26A 2A2CA 3CJ0A 3UO0A 2R2UA 2KU7A 2HNZA 5H9FJ 1ZM3A 4Q0BA 3MM8B 2VPZB 5K9FA 2QX0A 4H4KC 4J9RA 3PKYA 1VIOA 4OI3A 1KTVA 1ULRA 2DHXA 4EYIB 5ETKA 2PEBA 2Y1RI 3DMJB 2HK3A 4ECTA 2HZVA 2RKIB 1R31A 4AXJA 5IT9U 4C7QA 1UJ4A 2BJ8A 3QIDA 1HR0J 3BBCA 5A8KB 4MKVA 5D0HA 3ZZ0A 3D1OA 2KRBA 3AT1B 1T94A 2D1CA 5DRKA 3T5HA 3FBBA 1NU4A 2M70A 3D7SB 1JKHB 5KFTA 3D66A 5ETLA 4YDDB 4LFCJ 4LF8F 2FJAB 3DXSX 3M6VA 2CPFA 3OVAA 3EGWB 4JYAF 1QTMA 2YPZA 1R8BA 2EFPA 2FY8A 5AE1A 4QIFA 4DV1J 3CIMA 2RUGA 1FRKA 3TYTA 5EDWA 2UXBJ 2ZHBA 3KLIB 4UOGA 1VS3A 4ITSA 5AXMA 1HQUB 4GVBB 1AFJA 4F02A 5GMKa 1Y4ZB 3JTOA 1KOOA 1X4HA 2VPXB 2KJWA 4RW6B 2CUYA 4M5NA 2LEBA 3I6PA 2VJVA 2APOA 4OI2A 1CJTA 1HR0F 1S9GA 1K8AT 3M8QA 4ANEA 1KHWA 2KYZA 3RU0A 2G2ZA 1PYOB 3PJ9A 1Q16B 2XY6A 1G1XA 1VBYA 5AXKA 3QO9A 4DPWA 4ZCIA 2QG9B 3I55S 3V5RA 3K8WA 4HDHA 5KFVA 4CQ1A 2J9DE 1X4AA 3CD5A 3TJ9A 3UDVA 4YR0A 4ZP6A 4DV1F 2GO8A 4LVNP 1LK7A 5F3ZA 4Q5VA 1LNQA 3NNCA 2IA0A 1YJUA 4WF9Q 3RUBL 4C48A 1RAJA 4FVMA 1HKAA 3IR6B 5KFDA 4DXLA 1Z1ZA 4ZPWR 4DG1A 1YZ7A 2H5IB 4MFBB 3BZQA 1B0PA 4I6YA 5K14A 2FHJA 2LYVA 3W5ZA 3HVAA 2AF6A 1UAWA 4NI2A 4K4YA 2WBRA 1PJ7A 5JXSA 1N88A 3OVBA 3OFEA 3DLLQ 3G9CA 2UUWA 2CYYA 4OHZA 1HMVB 1JLQA 4KAIA 3T19A 3TP2A 2A6OA 3PR4A 3QT8A 4DR2J 4IG3A 4MT1A 5E3PA 3UNGC 3ENWA 6FDRA 5I4MA 1HW8A 2ZBCA 1JB0C 2OEKA 4PEOA 2E5LJ 3UR0A 2HW3A 4FBTA 3H2VE 1NPRA 2AEJA 2C2EA 1IM6A 1AA1B 3DHWC 2F40A 2XWYA 3FMBA 5AJ3J 1WKKA 2UUBJ 4QR0A 1W2BR 4BC9A 4K59A 3E3XA 4F3QA 4IOCQ 3ZZRA 2W7AA 4CLZA 1X4FA 4ZDNA 2E5HA 3A8JA 2Q6CA 4OZ5A 5I3UB 1J5OA 2FTRA 1CEZA 1FT8A 5H1SV 1QTNB 4ED2A 3GU0A 4L6V3 1EP4B 4N77A 4ICLB 2RILA 2D3O1 2Y8YA 3A3NB 1X31C 5CA5A 3MUMP 3P96A 2WTFA 2R7XA 3OD2A 2KVIA 1NSAA 1FX4A 4Z37A 2F8MA 1T03B 2HFZA 4OYPA 2LXUA 4E8UA 1Q5YA 3UFCX 2D3OR 3I9V9 1KFDA 4I68A 3BKFA 1NZAA 2OHDA 3I5BA 3UN3A 1TVRB 3GONA 4MKAA 5AJ3F 3MTJA 2F5GA 1TL3A 3G4SS 5IV3A 4Y2CA 2DIVA 3J7Z5 2FYXA 2J76E 4HDGA 4NA2A 1BY9A 1S1XB 2CQPA 2J6UA 3HVTB 1S1WB 2ZITA 1WHXA 4F4KA 1SH0A 3DN9A 3QFWA 3OR1A 5J2QA 2OMOA 1UVKA 2J8SA 2DGTA 3H25A 4WP3A 1WOPA 2Q1LA 1LWFB 1RBOB 4HI1A 1KWMA 1RJJA 1R6YA 4WFNQ 5HMXA 1LFPA 1WKJA 1Q78A 3G82B 4RO0A 1S0OA 1UPMB 2DR9A 2O3DA 2V0NA 3SYZA 2HQFA 1QD1A 3ZTSA 2AJFE 3JQMA 3KOAA 1R0AA 2F3JA 1S9EB 2DT9A 5KFIA 5ETSA 1R8HA 5HP1A 2HGNA 1PKUA 3U1LA 4LF9J 1T9UA 1DFDA 3GIIA 3Q8YA 4AL7A 2ASYA 5L9NA 2HLTA 4OYIA 1YBTA 2XGQA 1NH8A 1V9OA 2FC8A 2B51A 1U02A 2M52A 3FC9A 4B9NA 3KDNA 2W7OA 5U47A 3BJYA 3JTNA 4RNHA 2BJ7A 3EPIA 2CNLB 2CQ2A 2GO9A 3MR3A 4WWSA 4KH0B 3UVJA 4FDFA 1FJCA 4B3RJ 4DQPA 3MZIA 4ZN1A 2WBMA 2CZ9A 1X4EA 3C6UB 1M5HA 2FZCB 4KY3A 4KV8A 2DXEA 3UW1A 2YNHA 4DHVA 1UJ5A 3FGVA 4K7QA 2FUG9 4NLQA 5H9FK 1VRUB 1EKSA 3GSIA 3EGVA 4GRSA 1FF2A 1RTDA 1CS4A 3MWBA 3BGLA 4JP8A 2VPYB 1H7WA 3IP0A 2QA1A 3U27A 4IOAQ 4DX6A 1RAOA 3UQSA 1BQMA 5IC4B 3GSDA 2V4JB 3RB6A 2I8EA 2KI2A 2VDIA 4CLFA 3BH7B 4N56A 4LIWA 4FVCA 4W4MA 2YNFA 3KTQA 3POTA 4DR4F 4HLBA 5IT0A 1N36F 5J2NB 2V94A 2DGSA 1YK9A 2W4DA 3M2VA 3DNCA 2VQFJ 3MGJA 1AROP 3HCXA 3NGDA 4DU8A 4ECZA 5F8LA 2R8KA 2HNZB 2Q3PA 2QMWA 4QYRA 2MQNA 2ZUAA 1VHFA 3LGHA 4HT7A 1YZ6A 3PW5A 1TMMA 4LREA 2HGMA 3K7RA 5LMNJ 2CPYA 2A0FB 5DDPC 2Q66A 4F4XA 3TAQA 1O6XA 4MTPA 4DR1J 1JK9B 3UN5A 2CQ1A 3BKTA 4LJMA 4ENOA 5CCMA 1BC6A 4DPUA 2WZ1A 4B9TA 4A47A 3FRYA 2N4CA 5DZ6A 2MZ1A 3UNYA 4ZITA 2MZQA 4PRFA 3GFHA 5GAGU 1JIHA 1VK3A 2JWNA 2RSQA 3DRYA 1HNZJ 2NZ4A 1BXNA 2FPHX 2OD4A 3MM6A 5SZTA 1HWUA 2W2PP 2CA9A 4A8YA 2YQ3A 5KFOA 3ADAC 3M9MB 4OYAA 4C8MA 3TAPA 2E1RA 3H5YA 3PV8A 5E5NA 5E3AA 3JXOA 1ZA1B 4DN0A 3CCLS 3PJXA 3L09A 4GO5X 2XMMA 4V19J 4DQIA 1CJTB 4OV1A 3M8QB 3KLFA 1BD6A 2POKA 2EI5A 2XZWA 3KJVA 4Y28C 7FD1A 2BDPA 4XIUA 4ES3A 3HZEA 3HHEA 1FFGB 4RW4A 2CPHA 5J2MA 4DN9A 1M1KT 3QO9B 2J7KA 4TN2A 3M8ZA 3AJDA 3MPDA 4DZ6A 1UCNA 1PO6A 3I87A 2HRTA 2ZDPA 3AH6A 1F3VA 5LMUJ 2B5JA 3A12A 2BE7D 5EWEA 4QU7A 2RF2A 3BGFA 3HT0A 2A6MA 1RB0A 3SDEA 5K5MA 2CIMA 1XR5A 3IM8A 1CVJA 5CYQA 3VAMA 4LRBA 4CM2A 2ZKUA 4ILLA 4DG1B 2XULA 4ILRA 3QSIA 4Y0FA 1MWYA 1I3OB 3H5XA 3MMBB 2JH3A 2V63A 1P9QC 2WB4A 4AQYJ 5K14B 2AX0A 2RT3A 4ZJOA 4U9RA 2QEXS 5DM6Q 1ZAXA 4NI2B 4EUVA 1JJHA 4PWDA 1RHRB 3SQGA 3D3CJ 3R5BA 5THWA 1LKZA 4EZ6A 2IAJA 2J9DA 3G8TA 4PR6A 1S97A 3OTEA 1WG4A 1KONA 3NLCA 1DRZA 3T9ZA 2XG8A 3NOGA 5FJ4A 2LA4A 4YHHF 4TVAB 2YX4A 3BBBA 2HQDA 1SJ3P 1P6TA 5LMUF 5KG5A 4IG3B 2AYEA 3F44A 2M7SA 2PMZD 1RT3A 3NGUA 3C46A 4UZCA 2L3MA 4LSZB 5L9XA 1T9WA 4C6AA 4I69A 2ZKTA 1SQGA 1S5ZA 3IMQJ 4URGA 1VQSA 1SQFA 5BJRA 2I0XA 4AQYF 1HYSA 3CCJS 1Q7YT 1RWPB 2HFNA 4B3TF 4WU3A 2F4VF 2VG5A 5IM0A 4KJIA 1SKWA 1NPPA 1WKLA 1CPZA 4HACA 2ACYA 2CPZA 1SL0A 2W9BA 2K3KA 4X84A 1FFWB 4F2SA 1MU2A 2OD6A 1UKUA 3GQCA 4X66J 2B8PA 3GILA 1XMQJ 5KFPA 2V8GA 1B4SA 9ATCB 3LW5C 3H42A 3TVKA 3C6TA 2O5DA 4ECYA 1FI4A 3MPWA 2WB1D 5D4PA 5GAHI 1KTQA 1TL3B 4I7FA 3LUYA 4TY8B 1LFWA 2JHEA 2F8EX 2RAQA 2R8HA 2HBQB 3VAGA 4WK1A 1BMQB 4DQQA 1G2EA 2DK2A 2PEHA 1U6ZA 4ECWA 4B9UA 2ZFHA 5GADI 4LFAF 3LP0B 4URQU 3T1YJ 2LLZA 2K1RB 4U7CA 4ZJLA 5J2QB 3KXDA 3GIJA 4USMA 2AYBA 1EQ0A 4BLGA 4C8NA 3FCHA 2XY5A 2G0JA 3EMTA 3RR8A 1FRJA 3IBWA 3H98A 3CMAS 5F8HA 4CIOA 3IBFB 3PM9A 1DBDA 2N3LA 2KDOA 3HD1A 3GPAA 3HKWA 3CD6S 3ZNJ1 1R0AB 4ERDA 2OO4A 3R2DJ 2B4UA 4DOZA 2RU9A 4DJBA 1RHJB 3CF5Q 1FD2A 2VC1A 4HH1A 2X3GA 2WONA 4GKKJ 4QYZJ 1NDCA 4QQBA 5EUHA 4ZS6A 1V3ZA 1ZOTA 1NJXA 2AJ1A 3QAEA 3A1YG 4MAKA 3W64A 3CMQA 4L73A 5D6GA 4ECVA 2B4VA 2V50A 5IOLA 3T1YF 2RS2A 3VTIA 4EWTA 4UZBA 3IR7B 4Q8FA 2RH3A 1RYRA 3UVJB 1K73T 2ALZA 3AFGA 5M2UA 4H4MA 1F5AA 4JI4F 4YS2A 4OYWA 4DX7A 3SXLA 1KP6A 4KV8B 4L72B 2YNHB 5AE3A 2LDIA 2EEYA 5BR8F 4Q44A 1DAXA 4OQJA 1Y3JA 3CJ2A 1Q5VA 3M2RB 2ZEJA 1TKTB 3I0RA 4ECSA 3QGGA 1ZPWX 1CS4B 2D9PA 2QMUB 1FD8A 1ZS6A 2UVWA 3KUEA 1N5YA 3V2UC 3OSNA 4RUHA 4IFVA 1BLUA 1ZA2B 1BQXA 2MGZB 1VYAA 2R2SA 1WDDA 1RABB 2OAUA 4DSKA 1PC4A 2QZ8A 3OFGA 5KFNA 1R89A 3MM9B 2RMLA 1NEEA 1Q8LA 4QIEA 1L3UA 4ZA1A 4G1PA 1FEHA 2J0SD 5T14A 3MI7X 3US5A 1XK8A 3CULA 3M2VB 4C3KA 1H74A 2ZM6J 1W7WA 1EAYC 2KO1A 4U7UD 3ETMA 3LGMA 3HI9A 3IWXA 1RA6A 1RTJB 3HT3A 1T7PA 1LWEA 3KHHA 3RBZA 4LSLA 3TX8A 1Q7LB 5HATA 3D0HE 1GMWA 5LSRA 2R7QA 2YWKA 2N4DA 3KUHA 2CJBA 2LCWA 2BJDA 4G1IA 2RNEA 1QAJA 4P73A 3IR5B 2QJ3A 2YX7A 4K4WA 3FZBA 1Z2LA 2E5GA 4ZVQB 5C2GA 1Y10A 4RBUA 1RSCA 4DR5J 3OTOJ 1C4AA 2GAHC 3T1HF 1RP5A 2FLNA 1S4EA 3ISNC 4HKQA 4NMXA 3TUZC 3JSMA 1WHWA 2MY8A 3J81U 3QGPA 4TXSA 2R7RA 2GHPA 4O4RA 4JV0A 1TR0A 1GFWB 3R3TA 4OI4A 3MM6B 4N41A 2HS3A 3A8IA 2W01A 4B9SA 1KLMA 2IRXA 4DCJB 1Z2ZA 3KLHA 2DHAA 1RAFB 3I31A 3W8PA 3H2LA 2RRNA 3N4WA 4ED8A 4RNOA 1V3RA 4AT1B 1HBMA 1S49A 3CW2C 2NXNA 3K0JA 3FVYA 2HRUA 2FB0A 4PQAA 5C2CA 4UOCA 4J9UE 3LQVA 4ZPAA 1KOHA 3KLFB 4DQSA 2I1RA 1T0TV 1TU0B 2KXHA 4GO7X 3U1NA 2LVWA 2LFVA 1CC7A 2DH9A 1D8ZA 1V5VA 5J2MB 3DM2A 1FERA 3L7OA 2AYGA 4P7TA 4FXVA 2HVIA 2VG7A 4X4TA 1M90T 4CTAA 5MAOA 1N54B 3W63A 2W7PA 3EGZA 1WTBA 4I56A 1VHIA 2UXCJ 2E1MC 4WYWA 4IH5A 2RIJA 3M9NB 2B5JB 3SV3A 3G8SA 2W2OP 2F7VA 2OI2A 3EGNA 1VBKA 3SDEB 1FJ7A 4DV0J 4NEZA 4NCBA 2NREA 5CYQB 1MMDA 1KLNA 2QT7A 2ZH9A 2B4OA 4LRFA 4N8NA 4DUYJ 3I0SA 4DPOA 3GIRA 4U6PA 3Q83A 3I96A 2LEPA 2ADCA 1VDHA 2GHVC 1HWIA 1NK6A 1OYEA 3HJVA 4LF5J 4PWDB 3V6DA 3W61A 4P75A 3VR1A 4IG0A 1MMLA 4AFFA 2UZAA 1N4LA 2IAJB 2RUSA 2JX2A 3EX7B 3K59A 4JI1F 1S6QA 4IO9Q 1E6VB 2ZWPA 4OFZA 2ZBRA 2AMCB 1RT5A 5HK4A 4J7CA 2XS2A 4CLLA 2UXCF 4I6WA 1MN9A 1PIEA 4LQ9A 4TKTA 2AGPA 3BBFA 3Q8PB 1HD1A 2PA3A 2V8HA 1RT3B 4B3MJ 3SCJE 1GAOA 4MKBA 2QN6B 2F8HA 2AJ2A 2KM8C 4HHHA 1X4GA 3TZYA 3P5BP 3FK4A 4KGKA 3FMWA 3H90A 4ZCLA 1OJ4A 1WJ9A 4DI6A 4F4WA 2Y8WA 3A13A 5KFKA 4O44B 4JI6J 1HYSB 1RWXB 4USIA 4DV2J 1IQTA 1RWWB 5D4OA 2VG5B 2BW7A 3FUYA 5IM0B 2I5JA 2LMIA 4HACB 2IVYA 1HL6A 5E2QA 2MSTA 3J81Y 1ZAWA 3ILLA 2W9BB 1T9TA 2VBWA 5D4LA 1O8BA 3Q89A 3PRVA 1HLWA 1MU2B 1SC1B 1OMSA 2JEIA 5EWFA 4ZVSB 1LWCA 2DXDA 1WF0A 4OI0A 4MK8A 1HHQA 3C6TB 1FCAA 2HHXA 3CCWA 2R42A 3LANA 4ZIVA 3VZIA 3UCZP 3ITHB 1O0PA 3E01B 1XJWB 1BWEA 4WCEQ 4I7FB 5B0BA 1JLFA 4B9MA 2EFVA 2DISA 1J2VA 1ACMB 3M30A 4ECUA 3OTDA 4DV2F 3PW0A 2C42A 5KT4A 2XEXA 1WHVA 3WHIA 3QGIA 5KFZA 1IKXB 4BS2A 2EK6A 3HFKA 4OYZA 2ACMA 2U2FA 2IRUA 4NLSA 1KRPA 1PC5A 2RDIA 1RYSA 3HXMA 2IFXA 4I64A 1XN9A 2BMBA 3Q8UA 2AP6A 1IKWB 4EYHB 2QE5A 4RWWA 3NOCA 2F9DA 3TR5A 4ID5B 2G9OA 4QW9A 3VQTA 3MEGA 1RT4B 3HVRA 4N47A 2M3DA 1VI7A 2G2OA 5GMEA 3RB3A 2I6WA 2C3MA 4BDPA 4CYUA 2C3PA 2VA3A 3FSIA 3D6FB 4WIIA 4A8QA 1YBUA 3SCIE 5IQQA 3ZZUA 3NKYA 4RUAA 3J81j 2D7SA 3VV2B 1D9DA 4V19X 3OR2A 3KK3A 1WI8A 4NLGA 3Q0AA 5E0OA 2FD2A 4QBUA 2VQEJ 1RU2A 3OHAA 5JVGQ 1FE4A 4XDCA 3TQ1A 3M2UA 2QA4S 3C66A 4BC7A 4OX9J 3MPUB 4ZIWA 1VC5A 3DLHA 4Q8EA 3MEDB 4ANCA 4H4MB 5IT4A 1CULA 1XNRJ 4QIGA 1NUEA 2OEMA 3CCMS 4RKUC 4NLDA 1KBRA 2GQ2A 4IRDA 1UVLA 1QJHA 2X51A 5K20B 2MLXA 1DTQA 5B0EA 2JNJA 2MJUA 3I0RB 2PFFB 3R5GA 4LR7A 3CDUA 5HN0A 1RUSA 2KRRA 3DDNA 3M8SA 1N5YB 1UP1A 4IFVB 4DF8A 1FRXA 1O5JA 4RPFA 4P71A 3DYAA 3FEZA 5ETPA 2ASJA 4OX9F 2HHUA 3R7SB 1JLBA 3KDOA 1NDPA 1GX5A 4Q45A 3ETOA 4F4AA 1OY6A 2ZH3A 1VRTA 1HQ2A 2JVOA 1D0EA 1R43A 2HVHA 5D4NA 2MKHA 3IAS9 1LWEB 2XLIA 4LSLB 2HBZB 2Z57B 3DLKA 5D78A 1WHYA 2QL9B 4XPEA 3NCRA 3C15A 3KG4A 4NA3A 2DR5A 2EFGA 1T02A 3ET6A 2A18A 2FVRA 2R7VA 4LF4J 2I38A 3GYXB 1NKCA 3R1HA 3BPSP 4HR2A 2ZH2A 2KKHA 3THPA 5KFRA 3M4XA 3HHKA 4NLRA 2H5JB 4CH0S 4RW7A 4DCOB 3HF5A 2VOOA 2PMWA 2HRYA 3MAQA 2V68A 4DV5F 2DNRA 4U67Q 1LWXA 3D54A 2VFTA 4ELVA 4JI8J 4DEZA 3DXBA 3K5LA 1LW2A 4ZLJA 3PEHA 1U2FA 1T05B 3KLHB 2YNIA 4JI5J 2ZH5A 5C25A 4K4XA 2P9EA 4A8FA 1HBMB 4LF4F 4TU9A 4KHPF 3W8GA 2W8LA 4B3SF 1LW0B 3ILIA 3ZZTA 1VR6A 3KUGA 4O3OA 4IR9A 2DD8S 3X1LB 5KOWA 2DBBA 1OWXA 1J5EJ 3DM2B 1U1MA 3MHYA 4K4SA 4CH1A 3PG9A 4ZCMA 3LAKA 2MB0B 1RWOB 4CTAB 2HAFA 1TKZA 1S59A 9RUBA 4YDXA 1KVIA 1FVQA 3EE3A 3I82A 2KL8A 3JSBA 3NAIA 4K2XA 2OFHX 2ZVSA 2EBGA 3A4TA 4P2MA 2XLJA 2ZH8A 4MK9A 2HHSA 4ILMA 2K8GA 4IH7A 3I0SB 3EM1A 4DL5A 3GWCA 2PSZA 3IAM9 3OBIA 1T9VA 4WTYA 1J5EF 3C16A 3V6DB 2E66A 3CJ4A 4IG0B 1RADB 2FZKB 2MQ8A 3IGNA 1S6QB 1XR7A 1YJ9S 2KYXA 1Q8IA 3LWMA 2CPXA 1RGVA 1KQGB 2VBXA 1WSVA 2UUAJ 2IY5B 1U24A 2HHHJ 1IM4A 3MUVP 2IA6A 4L3NA 2VA2A 4OX6A 2ZHOA 2ZH7A 2OSQA 4OYBA 1YJTA 3MM8A 1C0TB 4HL9A 4O3RA 5EHHA 3MOJB 1SJ1A 1AZSB 7FDRA 4ED3A 2HZAA 3UCGA 2YNGA 4JI3J 3KYLA 3LTOA 1MNEA 4DFMA 4WYLA 4ZJQA 2R2TA 2I5JB 3L95X 4A8KA 3MMCB 1VQ4S 4USTA 3DLGA 1JKHA 2DITA 1RCOB 1H73A 4DV4J 1DHMA 2HVEA 4A8WA 3LP1B 1N48A 4TNOA 3MEKA 2YXLA 1W26A 2JEFA 5HO4A 1LWCB 1FNXH 2Z2ZA 3VCDA 4DFKA 1OPIA 3FBEA 3VF0B 4K0KJ 5BYQA 4K5RA 3HZGA 2J6TA 1JJ4A 2V2ZA 1RT6A 1YBAA 1G4CA 4CCHA 4O3PA 1VQKS 2KHDA 5M2PA 1UPPA 3AA9A 1HPZA 1JLFB 3DLBA 4JI3F 3N0VA 3M30B 1YVFA 3K5PA 4CT9A 3QJJA 1UTAA 2G2YA 1CJVA 1S10A 2Z4PA 2Z2MA 3E2EA 2XI2A 3VHQA 1SKSA 4TY9A 2XMAA 2GMLA 3DDKA 3MR6A 1D9FA 2UUCJ 5KFGA 1VQOS 1RHUB 1K1QA 3ZXWA 2W2QP 5T41A 2N3OA 2JC1A 2DIUA 4Q43A 5LL6d 1VJWA 4K0KF 1SH3A 3MEGB 1M5PC 3BH6B 1SIWB 2B56A 1R7IA 3I56S 1NHUA 3BR9A 2W4CA 1RA7A 2IM2A 2B4PA 2ROPA 4CYUB 4LFBJ 4X4PA 3R7BB 2QL5B 4DL7A 2XZTB 2B7BB 3IG1A 1VC0A 1RHKB 2IM0A 2ZBPA 2ZH1A 3RW7A 2BX6A 4JV5F 3N6NA 4MFBA 3OR2B 1TL4A 3KK3B 3FKBA 4NZ6A 1U25A 1VFJA 3PCOB 5D77A 4EGLA 5ADZA 3PHTA 4RU9A 3AXKA 4M5JA 3AY0A 1I94J 2ZUGA 1UA1A 2YWHA 4K4UA 2HLUA 4TU7A 1DURA 3M2UB 2VPWB 3PNIA 2MTLA 5DETA 4IKAA 4ZPBA 2CQDA 2CNNB 1HMVA 1HI8A 1D09B 1CULB 2WOMB 1Y9OA 3C2PA 5EX0A 1FESA 1SIZA 1A0OB 4QR1A 3O1LA 1H3DA 3GR1A 1DTQB 4JI7J 1HNXJ 3MEEA 2AJ0A 2B8QA 2UXDF 2ZDOA 5KG6A 2YH0A 3OQ2A 2BOAA 4RR5A 1FEEA 1Y0HA 2B3TB 1R6VA 1EKRA 3CVKA 1FNOA 3W3SA 1SBRA 3BKUA 2DEIA 2OEJA 3VAKA 2ZBQA 4OX7A 1FNMA 1I94F 1Q82T 1FKPA 3DYAB 5GMDA 5DG7A 1EP4A 4IQMA 2D41A 2RHSB 2CNOB 4NLXA 3MR2A 3BO4A 3TZWA 5LSOA 3G87A 4DR7J 4W90B 1VRTB 4U7UK 2K7JA 1XBWA 3KKFA 4K50A 4JI7F 1N8RT 1N52B 1HNXF 2W24A 4HTJA 3ZTRA 2HNYB 5KFCA 2XCPA 3WZ0A 1TVRA 4NE9C 4DSLA 2YY3A 2ABYA 3C15B 4Y6IA 2NXCA 1TZ0A 1WD6A 2Z56B 4ED1A 2HIQA 3LAMA 5A8WB 4HEA9 2V34A 2IJRA 2N82B 4MMOA 1FVSA 4ZLNA 4DR6J 2EBEA 1KKHA 4YFUA 4XAKA 1V6HA 2IDLA 3NL0A 2P9GA 1PGZA 1S1XA 4HHUA 4ZVGA 1NK8A 1TFYA 2E5JA 2ZHAA 2BKPA 2WSFC 2BJ3A 2ZNYA 3W2VA 2QLBB 5F41A 1GTHA 4X4VA 3M32A 4RW7B 2D3UA 1IBKF 1UL3A 2OKQA 1JLEA 4NZ0A 3CJ3A 4ZP9A 2MXYA 4DV7F 4YB5A 1VIXA 1BQNA 1JNZB 1ROFA 1X8DA 1XIQA 4L75A 2I2YA 2IM1A 2FVQA 1UFWA 3O44A 2BZ2A 2HHTA 3V81A 5K8OA 4OIXA 4UF4A 4DL2A 4UOHA 3HDSA 4LBHA 5C25B 4KPYA 4R0JA 1U45A 5KFHA 3DRPB 4J9OA 2E5IA 3DHXA 2DH7A 1H0HB 3UN2A 4UY85 1TUGB 2FJVA 1FDNA 4B9LA 4DR6F 2WRMA 1S0MA 2HS4A 4P2XA 3SV4A 2YKQA 4WTOB 2AU0A 2AV5A 1QAXA 3CJ5A 4C8ZA 2PIIA 3ZTQA 5KFXA 5LXYA 4I4BA 4QOTA 4QWAA 1N5SA 5DS7A 2GJ2A 2MKKA 2JJ4D 2V4RA 4N5SA 2DO0A 1GK8A 1U1QA 1TL5A 4F4YA 5LJ3Y 2Z0GA 1K1SA 4DPYA 2Y1JA 4OMFG 1IBMJ 2BBEA 1QSYA 2ZZMA 4MIAA 4OV6A 3AODA 3Q23A 1FXDA 4ZVPB 2COLA 3K5NA 3GG1A 3C6UA 5CH7B 1TKZB 2W9CB 3NMAA 4C3MA 3H5UA 2RDDA 2MY7A 2RVJA 1QUVA 2IPOB 1C2PA 3T9NA 3CT9A 2KXFA 1VRUA 2O67A 2F4FA 1M5VC 2H4YB 2CQHA 3PO4A 1FFSB 3R2CJ 3QAUA 4ZPVR 3OJUA 4KHRA 4P2FA 1RWMB 4L3KA 3VAIA 1NDLA 4IO1A 2W8KA 1M5SA 3ISZA 1QVFR 3FQLA 1CQMA 2QYGA 1Q53A 2GQCA 4E98A 1IBMF 3NG8A 3HFZB 4GKJF 2HFOA 1S4FA 5CD4A 5HAOA 2CJYB 2PC6A 2HURA 1NK7A 3BR8A 1Y11A 3NGKA 2XI3A 1N6QB 4KGMA 2E9ZA 2PMHA 2XMVA 3D5MA 3KJNB 4NOHA 3RB4A 4JYAJ 2V5HG 4M5HA 3D67A 3EUNA 2JFDA 1AYEA 2OPRA 4NLOA 2QV6A 2H9ZA 4PG8A 2NXJA 2H65B 4ZVUB 5KT6A 3G71S 2YNGB 2ZJPQ 2FGOA 5A8RB 4RWXA 1R0CB 3KHLA 3AB4B 2BACA 1HWJA 1EQMA 1MWQA 4LRCA 1PJ5A 5HVHA 4YR2A 3DLGB 2N7CA 4RUCA 2AEMA 5HMYA 1LOUA 2Y3YA 4PXBA 1U1NA 2CG4A 3GLJA 3FRZA 4X4NA 1WSRA 3T3FA 2CQIA 4HYKA 2IBOA 3QBCA 3C3LA 2DY1A 3BN4A 3J7YU 4EZ9A 1RWKB 1TAQA 1VQ8S 5HJXA 4DS4A 3B8HA 2DRBA 4R8UA 4WU2A 4LF6F 1RT6B 1RBAA 5G0RA 5CCLA 1N34J 2MKIA 4YOEA 3T5LA 3CJTA 2BJ1A 3MMAA 2Z2YB 1FDAA 3AJ2A 3VAHA 3PX0A 1HPZB 2NXEA 3NS5A 1JMTA 4C0OC 3DDIA 3T6BA 1NSKL 3T5JA 5FLXU 4FF3A 2KB2A 2J0XA 2GGPB 3AB2B 1CJVB 2QGFB 1RISA 2ZVIA 4Y2MA 2VF3A 4CZCA 2LEAA 4M5DA 4M94A 2UU9J 2MKYA 4ZVFA 3QT5A 3PACA 2L9WA 1S6UA 3DI6A 3AOBA 3I4PA 2NLWA 3W2WA 3V4IB 4YB7A 2CZVC 4KR0B 1M5OC 1NJYA 1GH8A 3K5OA 1TL1A 1U8WA 3QATA 4JB8B 2DR8A 1U2CA 4QZVB 2AEFA 4NASA 2KG1A 2LQ9A 5J1NA 2Y0SD 3A8EA 4DUZF 2C2NA 1ZM4A 1N34F 4F7VA 2DNQA 1SL1A 1WWHA 2Y1LB 3O5TB 2DTJA 2OH2A 4C8YA 2FJXA 4QW8A 1TL7A 2V8DA 2YQ1A 3IG1B 3W9IA 5IV4A 4ZPTR 4YB6A 3PEJA 4NPOA 2QIFA 5DLGA 1S99A 3MM5A 2XMWA 4YEAA 3ILOA 1P8GA 4ED0A 3MMBA 2HWHA 2OTLS 2UU9F 4LSNA 4NMLA 5JUMA 1NJZA 2GA7A 2QFIA 2R2RA 2V2QA 2VUGA 1TV6A 5GAEI 1RAGB 4USHA 2V9WA 3KLGA 1V5IB 4YR3A 3QJPA 5EX3A 1OS5A 1H2TZ 2OP5A 1VOMA 5RUBA 1C1BA 1S1UA 4OHWA 1I5OB 2ROGA 4CLKA 1KS2A 2M8HA 4LF1A 4M5IA 2P6SA 3ENVA 5DQGA 3N28A 3SFGA 2DRAA 4DV6F 4XPCA 1KEKA 3MEEB 1IUJA 4PQUA 3SI8A 1IBLJ 1EIYB 3P8BB 1RT7B 4UUXA 2LKZA 3BSOA 4ATNA 3HHLA 2VH7A 2FDNA 1S9FA 1U7LA 3RZAA 6FD1A 1KQFB 3HSJA 1NJWA 3BREA 3U7JA 3IBCB 1B99A 4TYBA 1NLKL 2DGVA 5IT9Y 2IC3A 3V6JA 2Z8QA 1FKPB 2HHWA 2H54B 2JVRA 1FRHA 1X7VA 4NLUA 2YKMA 4KB7A 1K0TA 3F0NA 4F3OA 3TX0A 3IS9A 4OZJA 2BKOA 2J5AA 3MDFA 3TVYA 3PZPA 1VBXA 1Z4UA 5DM7Q 3GG0A 3B4MA 2P8IA 5GAGI 3G8QA 1OYDA 2NUHA 5D15A 2CQ4A 1IBLF 1PILA 1SQEA 4C3LA 3BGRB 1U48A 4FS1A 2R8IA 1VQ9S 3P4UB 2DKOB 3PO5A 4TY8A 5HL7Q 5I3PA 3SCLE 1UVJA 2WVFA 3F41A 4IR1A 3CIZA 3LP0A 1N33F 3W2VB 3CCES 2K1RA 4F36A 1HBUA 3M32B 5DGBA 4DR3F 5KAKA 4ZOSA 2ZH4A 1S76D 2CPIA 2CQCA 1JLEB 3AD8C 1TQLA 2R4FA 2W1BA 5KFMA 2XYPB 3C8YA 5B08A 2MLZA 1IWAA 1BQNB 2VG6A 2KT2A 4EK2A 1PCAA 3R7NB 2H1YA 3HMJG 2VZ9A 1VGYA 3CCTA 3BN7A 2R7TA 3V81B 1UEUA 2OPQB 2CPJA 1F3FA 4CDIA 3D6HB 2DNZA 3HO1A 4LR8A 4CNZA 1L3VA 3Q8VA 1KHVA 2DNMA 1WC1A 1TELA 4ETZA 3BM7A 1RAHB 2BM0A 3K2YA 5A6WA 2HMIA 3JQKA 4RNNA 1PG5B 1NNDA 3DLEB 1WTFA 3T5KA 1R8PA 2XWXA 5AT1B 4G1QB 3UWTA 2VJUA 5D3GB 1RWVB 2G4BA 1YRTA 2HVDA 3QFHA 3P45B 1YHQS 2W4PA 5DQHA 4DR4J 4ZKAA 5A6PA 2FC9A 2XSJA 1NK0A 4DV3F 2VOPA 4P52A 1N36J 4DSJA 4TLRA 2B9EA 2DEJA 2DNLA 5A76A 2KFNA 4Q2MA 1FTCA 3G6ES 3TA1A 1FTRA 3PY8A 2NQPA 4WJBA 2JEJA 2YPYA 4B08A 4KGZB 5B0GA 3MCOA 1UVMA 3M2RA 6AT1B 1TKTA 3R5JB 1FKOA 4M63A 1GXTA 2DGOA 5LT5A 3S01A 4FBUA 1TFWA 1ZYQA 1TTHB 2IDEA 3MR5A 1R8AA 3VVTA 1FKAF 4RUBA 3EPGA 3RBDA 1X0FA 5GAEU 3EZOA 2MGZA 1F0XA 3QZ7A 3QPIA 4LRAA 1Y7PA 3MM9A 4J9MA 1GMUA 3QNWB 1URRA 2KZZA 4FP9A 3W1YC 3AOCA 3O3LA 4EO6A 5LJ5Y 1UEVA 4A8MP 5IXUA 1HBOA 3GIKA 1BUXA 1IR2A 1FDDA 1L5UA 1RTJA 1Q1KA 3CWJA 5KFLA 1GEHA 5CYMA 1GMWD 1NKEA 4NL5A 2OPRB 2N7YA 2AHOB 1SKUB 5ETVA 4NEYA 3UE2A 2XYHB 1JXVA 4A8OA 1ELOA 2MKSA 5ITHA 1KNZA 5DQIA 4W92B 4O3QA 3QLHA 2DNPA 1EX8A 2FVPA 4R0EA 5KG7A 2SXLA 4LT6A 2XO7A 4X4RA 4D3GA 1F9HA 4UUWA 2GMHA 2XYGB 4HT5A 3ENAA 2MLYA 2CQ0A 3CGIA 4EEYA 4OI1A 2QLJB 4K4TA 5KT5A 3R9LA 1S57A 2VV5A 2R7OA 3WC0A 4FYXB 3M6UA 3BSNA 1DZ5A 1TK5A 2WAQD 4DBQA 4DWIA 4TYAA 4R8UB 1UEKA 5G0RB 2HYIB 1OQ3A 2H3EB 2KFYA 4O3SA 1YSJA 4EO8A 4PYDA 4C0HA 2AYMA 3LOUA 3MMAB 4FPRA 1MMNA 2NUUG 3VGUA 2XMUA 2V8PA 1C0UB 3ISND 2NZCA 1Y5LB 1RT2A 2XGPA 1PAUB 4LR9A 2GC8A 2K7KA 3EZ5A 5B0DA 4OZ0A 4WKYA 1P9YA 1U0SA 1LXJA 3NGSA 4UY8T 4M5DB 1K0VA 4WIQA 3ZTPA 1ZAVA 3DI6B 3CXCR 1REVA 4J9KA 3BYRA 1SB6A 3W2WB 2EXUA 5ETRA 3B6BA 3FEXB 1D8YA 1KC8T 2QSWA 1TL1B 3H59A 1T9YA 4RZRA 4YHHJ 1RWNB 2EG1A 1U1PA 3FSXA 4FPIA 2BOPA 1TK0A 1RTHB 4OI6A 3TWZA 2JOQA 2RD5C 3RG6A 1JNRB 2D74B 3THVA 2VU5A 4DMZA 1TL7B 1HNIB 1CQNA 2KZMA 2HAIA 5BYRA 3CDAA 3MM5B 1RK8A 1M5KC 3DGPB 5ETNA 2ZJQQ 1IXKA 2NYIA 1MG7A 3CNQP 3EXYA 1GNKA 4LSNB 4X2BA 4CO5A 3CUNA 3NGRA 3VZHA 3DCAA 4B3TJ 2HGLA 4C11A 3RRKA 2F4VJ 3CTRA 4LBPA 4J37A 1TV6B 3ZZYA 3M1VA 1E6VA 1JJ2R 4JI2J 2WW8A 3KLGB 2UV8G 4DFJA 1C1BB 2CQGA 5B7WA 1S1UB 2CPEA 2YQ0A 2WSEC 4G6VB 3UR3C 3NS7B 4DS5A 5A0YA 1SJFA 5DDQC 4KC5A 4RNFA 3KLVA 2VIHA 3CD0A 2BJ9A 4YN3B 4PQUB 1X5PA 3Q86A 3KLEB 1WC5A 1FRMA 1N5TA 3HHLB 2XC9A 3ELHA 1X4CA 4AYBD 2Q6BA 4I67A 4OHVA 2ZE2B 1U1KA 2ZBIA 2BEFA 3NCQA 4O44A 2RDJA 1HNWF 2GIFA 3Q2SC 2C28A 2VODA 4LIRA 1CJUA 2IC3B 4R5PA 5F9LA 2QA2A 1YRXA 4LFAJ 2DR6A 4LF2A 1YJRA 5L46A 1S0VA 3W66A 3CEDA 2OMLA 4JI2F 3SSSA 2YKMB 4IDKA 2JC0A 2E44A 2M5YA 4KBIA 3PIPQ 3IS9B 1FXRA 3MECA 1S6OA 3NP5A 4K8RA 2GJFA 1F1BB 4M5LA 1X60A 2VB6A 3EJMA 4DX8H 3TO8A 1DQ8A 3ITHA 4NXMF 2VHGA 2EC2A 3E01A 1VQ6S 1Y00A 3CCQS 3UDLA 3TJ8A 2MQLA 5E33A 4X62J 1SC4B 1NSPA 4USVA 3LP2A 4B3OA 3BV8A 5F8NA 2B9YA 5C7PA 4TLQA 1AUSL 2X3DA 3BDPA 1W2IA 2QLWA 1CBKA 1IKXA 3JSRA 1HBUB 2GJIA 3RW6A 1HWKA 1RACB 2FY1A 4UW2A 3EYZA 1HBNA 2X7IA 3VGTA 4N8OA 1IKWA 3CJKA 1PYTA 3S1TA 4JI4J 2VG6B 3JYTA 4ID5A 1K44A 1KFSA 1YJVA 4H54A 1RT4A 5AXNA 4GC7A 1GXUA 5BR8J 1RTIA 3IRWP 2B9WA 2XZDB 4I2PB 5HVFA 2W9AA 2MDAA 3KNAA 3H40A 1BWVA 3N5BA 3H8YA 4X62F 1F9EB 2L48A 1TUWA 2HMIB 5B0AA 3NWRA 3MAAA 1SI9A 1FDBA 5ETQA 5IC6B 2M2BA 4AD6A 4TU8A 2VFVA 1SKRA 3TANA 3D68A 3R6LB 4NCAA 4OZNA 3W62A 3OV7A 2ZWOA 2B43A 4WK3A 2XSJB 1EHWA 3MF5A 3IM9A 1RKJA 1YJWS 3MEDA 3KJFB 1RKIA 1Q0NA 4KRWA 4CO4A 2XBPA 4DZDA 1Q95G 1N5VA 2V2VA 5HLFA 3W9JA 1KQKA 1DY3A 4P74A 4X4SA 1NDKA 1F6TA 1I51B 1N56A 1FKOB 3LPEA 4H4KA 3DOLA 3R5AA 2MMYA 8ATCB 3H0PA 3HULA 3M8YA 2HQGA 3GYGA 1MROA 1DLOA 1V3SA 2ZZNA 2DGXA 2KN4A 1S6PA 5A2QU 2BKNA 1VQPS 2O66A 3P3DA 2BQ3A 3BQ2A 3T1HJ 1DQ9A 1AT1B 4XO0A 2FHMA 4F2RA 1WELA 2WVEA 4WZMA 1H6KX 2EW9A 3PIOQ 4J9QA 3OFHA 1X5OA 1Q8KA 4QWEA 3CPWR 4HH0A 5C24A 1HBOB 4LFCF 1UFKA 1QAYA 4LUBA 4A8XA 2RQKA 3R5DA 5CYMB 2AX1A 1DTTA 2ZC3A 1S7HA 2LECA 3ONQA 1WG1A 5DDOC 1VQ7S 1GXLA 2R3VA 3HSZA 3CC4S 2EVZA 3FEYB 4ZN3A 3UCUP 1QDUB 2B0GA 1XNQJ 2QMXA 3M6XA 4K5SA 2UXBF 4ZVEA 2AKWB 1U8SA 3QLHB 5FDLA 2WK4A 2IIHA 2BXJA 2DPJA 3TEHB 1UJ6A 3O2IA 2XTJP 1EARA 4YP3A 2CADA 4O3NA 1N32J 5MLCV 3N6LA 4AL6A 2IVMA 3V6KA 4LBIA 3HHNB 3DKDA 4V1Ak 4U8YA 3FBFA 4USUA 2D9OA 2DB1A 3H20A 1B64A 1OIAA 1XMBA 2BRLA 3D9BA 3R1LA 3GCXP 4IYQA 5F9NA 1IR0A 1T05A 5C42A 1NAQA 3KG0A 3NS6A 1FRIA 2FJDB 3IXQA 5ETOA 3JS9A 2MEWA 4IRCA 1KN6A 1XNQF 3QQCD 4OX8A 4ZP8A 2Z30B 2PE8A 1LW0A 1RT2B 3KHRA 1M0SA 1FK9B 2Z2LA 2HHQA 3A8KA 3PFOA 4PUOA 2XSFA 1N32F 2GVZA 4PWWA 2H5EA 2C3YA 1REVB 2VONA 2YBVA 2RRBA 3MCMA 3HFVA 2NSCA 3OPKA 3HSGA 3I32A 4ANDA 4JI1J 1HHTP 4OHYA 1RE1B 3ZZPA 2V9KA 3HPOA 3QT7A 1VLOA 4DR2F 1JLGA 3D2WA 2BR0A 3QJLA 4FF1A 4PCQA 4PABA 5CAAA 4P6QA 4GMKA 3PW4A 3GFXA 4EBDA 1TMJA 2E5LF 5CQGA 3HP6A 2AGOA 3T6JA 3BB5A 1FO1A 1RCXB 3OXLA 2GQQA 3ZZZA 1WNEA 5HI7A 2CDQA 3H4DA 2UUBF 3DLJA 1FJEB 5C5JA 2DCLA 4PG4A 1UWBA 4JV2A 5A2QY 1NSQA 1RXOB 1UMJA 2FQQB 1N0VC 2PI4A 4D3HA 2MSSA 2ROEA 2CPDA 4C11B 3RJMB 2FZGB 4PG6A 1F9FA 3KFWX 3D0GE 3M1VB 1RDRA 2JRSA 3BSAA 2RB7A 1VLYA 5KT2A 5BXIA 3J7A1 5FD1A 2V8VA 3KK1A 4CLPA 5A0YB 4HI2A 4Y2AA 4HTIA 1X4DA 2QO3A 1JX4A 1C0TA 2YWFA 4DQRA 1Q79A 3QZ8A 4JV1A 3OHBA 1BE4A 3DRRB 1AZSA 3OSPA 4ZCKA 1IQZA 2J7UA 4B9VA 5L8RC 3EZUA 3G6YA 2EKNA 3SCKE 3MUTP 1T9XA 2IYGA 2LDYA 3PTWA 4X64J 2FHKA 3NGTA 2GVDA 3MURP 2CJAA 1CJUB 2CWKA 4F04B 5J2PB 4R5PB 3OJSA 2AZ1A 1FWKA 3CO9A 1HI1A 1YGYA 4PYAA 2P5VA 2RHQB 5E3CA 3N6MA 5HSPA 4OZ1A 4K4VA 3MMCA 2MQQA 4IDKB 3C14A 1CC8A 3B82A 4IQXA 1B7YB 1IN0A 3MECB 3Q8SB 1Q8BA 4RBVA 2IRYA 4DDFA 1YG0A 3LP1A 4F67A 1SH2A 1HW9A 1S0NA 1QY7A 2MYFA 2JFKA 3H4BA 3QIPA 1RT1A 3R97A 1DJ0A 3OUYA 3TAMA 4FYYB 3DC2A 3W5XA 4G3IA 2D3ZA 3K5MA 1UFLA 3MCNA 2LXFA 4QYZK 1TAUA 5L1IA 1OSDA 1YJ7A 2HWIA 1X9SA 4LF9F 4O0NA 4X64F 5I42A 1FA0A 1X5SA 3LP2B 4B3OB 1NK4A 2YTCA 4QWCA 3MXHP 2MHNA 3GCWP 1SXLA 2M8DB 5HBMA 3L3CA 4WKRA 8AT1B 1TKDA 3IA0A 4J9PA 3HVWA 5M2RA 1ZTTA 1RBLA 4DL3A 4WFBQ 1JJCB 1HBNB 3FZ2A 3MFHA 4ES2A 2E29A 1B0VA 2J7WA 3CJKB 3S8SA 4B3RF 3K17A 3JYTB 4NCGA 4F25A 2DJWA 3FSYA 5I3QA 3FDSA 4DL6A 2R7WA 3IWNC 4M95A 3G96A 4I6AA 2BQRA 1RTIB 1WDTA 4CP5A 4F4ZA 4B17A 3AD7C 5KFSA 3GV7B 3CC2S 2OTJS 2GCFA 4U95A 4QIVA 4Q0BB 2RU3A 3P6YC 2O01C 2EK1A 4KE5A 3SIPB 4DSEA 2MQOA 3MAAB 1WOSA 3OVSA 1FE0A 3VQSA 3MTKA 4F3MA 2R8GA 3PYGA 1T3NA 2AD9A 5CHCB 2X1AA 3BEGB 2CDRB 2BRKA 1U2RA 4ECXA 1SC3B 1ZM9A 4PG5A 1SV5A 2HQIA 2MZTA 2A2DA 1U1RA 1S79A 5KFFA 2WOMA 5L1LA 3GIMA 3SBMA 3PR5B 2BE2A 1OPZA 5HLFB 2P9CA 4L74A 1Q81T 2ZC4A 2VQFF 2VBYA 4RW8A 2AW0A 4C8KA 1IJFB 4EBEA 5FIIA 2HPUA 3RRGA 2ZH6A 1GTEA 3WBZA 2GW8A 3DOLB 3UD5A 2VASA 2F1FA 2QLFB 4DLGA 1MROB 1DLOB 4ED5A 1WEZA 5LMNF 4J9VA 2IJFA 3DU6A 4CRJA 1VQYA 1NB2A 2D69A 1S6PB 3EDQB 1LQ9A 4A8SA 5KTQA 1BHNA 5JJBA 3T1AA 1JWWA 3TI0A 4DR1F 1RAIB 2HHVA 1IBCB 4CM0A 3G2XA 1MSWD 2FGCA 4O0IA 3V6HA 1CLFA 1S9GB 1OQ6A 2KHCA 1HFEL 2MZRA 5KFBA 5LOQA 4DV5J 2DVIA 2DY9A 2XNRA 5C24B 4OYXA 2VL1A 1HNZF 4C8LA 4WFXA 3LGNA 1PBAA 2M4MA 1DTTB 1H72C 2HNYA 1NHKL 1HD0A 3PX4A 2WVBA 4MK7A 3LO3A 4JBCA 1M1HA 1ZBTA 1D3WA 1EETA 4XDDA 2JZ5A 5A8WA 3HM9A 2OPSA 2OGUA 4JOUA 4KHPJ 3AXMA 4ED4A 5FDLB 4B3SJ 1G6BA 1NO8A 2ZOMA 1VK8A 4YQWA 3P49B 4QU6A 4CO0A 1KSPA 1UVNA 1F5BA 4XK8C 1DQAA 3GFYA 5K8NA 4J5OA 2L9DA 2HBRB 3I4HX 3GJTB 1P27B 5HROA 1QSSA 4OJ1A 1MLAA 2GV1A 2ILZA 2Q43A 3MMJA 3WX8A 5LSLA 4A46A 1JLQB 4OHXA 2K2PA 4MJKA 3CMES 5C42B 1U47A 1CJKA 2XHWA 3Q24A 3KMQA 1S72S 1CSJA 3DRPA 1NMEB 1NH7A 1FHTA 2MQMA 4RL1A 1N5QA 4NLYA 3JQJA 1EZZB 2WW4A 2IJNA 2YKNA 2JL9A 1O51A 2ATCB 2BE9B 4NLTA 3J80U 1HHSA 5J1EA 2KH9A 4M5KA 3B4DA 4PUOB 3CJRA 3EVMA 4TQRA 2C2DA 1E6YA 3NCPA 3OLAA 2BQUA 3CJSA 4KFBA 2GVZB 1TP7A 4WZQA 3BGUA 2XCAA 1SJRA 1OSCA 4X4QA 3RAMA 5KFUA 1FJGJ 3TNVA 1J5OB 1S1VA 4MYTA 4K2JA 1UZHA 2HKEA 2E9TA 2W9CA 2OSRA 2JSXA 1IKYA 2DYAA 1JXLA 4L76A 2ALYB 2ZD1A 4CWBA 2PO4A 4ELTA 2C2ZB 4KT0C 3SSRA 5D8HB 1JLGB 3DGVA 5AXLA 3A3PB 3U1MA 2QLXA 3H2UB 4ELUA 2YWGA 3BYPA 4MH8A 3NNHA 4CNYA 2LU2A 2U1AA 1NCLA 5DLFA 1A7GE 5H9EJ 1LEOA 4O23A 4X4OA 4Z7CA 2V69A 5HVGA 2C3OA 3CJQA 1UWBB 4UOFA 2PD1A 3DOMA 2I9SA 5KG0A 2EG2A 2HHPA 1FJGF 4Y2KA 1ZPVA 2XMJA 2DHHA 2JLEA 2DHGA 3OR1B 2JDJA 1KVJA 4KQZA 3DOKA 1SJ4P 1N6QA 1CG2A 1XQIA 1MN7A 4RBTA 3KK1B 1S7IA 1T3OA 2YVSA 5F8MA 1H2UX 5KFYA 4X66F 2GX8A 2YKPA 2FJWA 2QA4G 2K06A 3PX6A 1XMQF 3BF4A 2NPIA 4RW9A 5L39A 5LM7E 2JLGA 4OZLA 1NRKA 3FJ2A 1B0TA 5HP1B 1H2VZ 1NPKA 5A8RA 4LQ3A 3VGSA 2AGQA 4NZ7A 4YY3J 1VQMS 2GVDB 1XR6A 1C1CA 4OJ3A 1GT8A 2AJQA 2F9JA 4ID8A 1UVIA 2V2KA 4R25A 3AAWB 3C14B 1LXNA 1NZ8A 1D9AA 1LK5A 3GV5B 2C22A 3GE9A 2DGUA 3N9UC 1FXLA 4K4ZA 3QMQA 1MW7A 2Y1IA 3NY0A 3TZXA 2H4WB 3QIPB 1RT1B 2YWWA 1VQLS 3OUYB 5EWGA 1L3KA 3TAMB 1D1UA 1VMBA 1T95A 4WPAA 3ZNUA 4M8LA 3KHGA 3KG1A 1YJNS 1H98A 5B0CA 4RNMA 2HK2A 1Q86T 5DO2A 4GKKF 5I42B 3L9ZA 3CO0P 3J80Y 1RTDB 1QVGR 2GHWA 2GGPA 1SVDA 4YY3F 3IWLA 1KDNA 2WSCC 2RQ4A 2B9XA 3HKZD 4JV5J 2WCXA 2VKRA 1BQMB 4WXOA 4CO3A 4M1KA 5HBMB 4DCPB 3Q22A 1GMVA 2DCUB 2XMKA 3G6XA 2PT0A 3TA0A 2FIUA 4IOBA 5K8PA 3V4IA 2YNFB 3POTB 2VFSA 4H4OA 1OO0B 3R8YA 3D1HA 2L41A 5F3TA 2HVZA 5EN1A 3HK2A 3M9OB 4FNHA 5KFWA 2OUGA 4NCGB 4OYMA 5HQ8A 2BANA 4KO0A 3ILJA 4Y2IA 3LA0A 5HMZA 3QGHA 1X9WA 1UWAA 2XO6A 2WVDA 2FJBB 2PA8D 5E7OB 2PN6A 2UXDJ 3OT9A 4I2QA 2DH8A 1P1TA 4Q2LA 2M0GB 4F0KA 3CCUS 1UETA 4TQSA 3KMSA 3QYYA 5E41A 1SUQA 2BUNA 3MM7A 4IRKA 5J1PA 1WF2A 5KFQA 4Z2XA 3FCVA 1AB8A 2J0WA 4E0DA 3OLBA 3W60A 4NYPA 3LF0A 1KQSR 3PXGa 2GFFA 1SV5B 4PKDB 3N79A 1WORA 3BGOP 2VC0A 3T41A 1ZH5A 2XQCA 3WIUA 2XHCA 4OZ3A 5B09A 1A9NB 1KD1T 2J0QD 2BE2B 2E7XA 2CVEA 3J7ZT 3G6VA 4RW8B 4LVOP 3D0IE 2J8AA 2ZM6F 4PZVA 5T7LA 5GAHU 3HHLD 3VAJA 4O4GA 2RJZA 1L3SA 1RT7A 2A1BA 4DPXA 4ZK7M 1YDLA 5LXRA 4QIWD 2PDAA 2A3JA 2ADBA 4BBYA 1VC6A 4Z7YA 5GADU 2IYIA 5SUHA 4LF7J 3ZO7A 3BO3A 3RGIA 1ITPA 2IBKA 1S1TA 4ZLLA 4FKXA 3EWGA 4C9DA 2X1GA 4DR5F 2HFUA 4F50A 3W7BA 3OTOF 3CCRS 1IBKJ 4NWBA 4NLVA 3KJVB 2XNQA 2ZNZA 2IMWP 3S6EA 4FXWA 2HZCA 3K58A 4M5MA 3WIVA 2EC0A 4RW4B 4DV7J 5DZ7A 4KKOA 1PAEX 3M7VA 5CABA 4DU7A 1IR1A 4WP8A 3Q2TC 2PFDA 2EPIA 1JLAA 3HX9A 2WHOA 3TW0A 3OTCA 3CCZA 1WOOA 3ZZOA 2ZZTA 3BGRA 4RX6A 1EETB 3CE8A 1QLNA 4EI2A 2QTWA 5CYJA 2OPSB 3DRSA 2L9NA 2RF2B 3UDCA 3CSKA 3MPYA 3J7YI 3W9HA 3GJQB 3Q8RB 4LF7F
chains in the Genus database with same CATH topology
5CA5A 1C1BB 3MUMP 2PI5A 2CQGA 3P96A 2BJEA 2WTFA 2W8LA 4B3SF 1LW0B 2KVIA 5B7WA 2R7XA 2KFZA 1S1UB 2CPEA 2WSEC 3ZZTA 4G6VB 3UR3C 1VBZA 4DS5A 5A0YA 1SJFA 2KT3A 4O3OA 2KT5A 4IR9A 4Z37A 5DDQC 3PKMA 4KC5A 2DD8S 2F8MA 4RNFA 3FNNA 2MQPA 1T03B 3X1LB 3KLVA 2HFZA 3CD0A 5KOWA 4ED2A 2LXUA 4E8UA 2K3IA 1XWLA 2DBBA 3UFCX 2D3OR 2HNDA 3I9V9 4PQUB 1KFDA 4I68A 1X5PA 1NZAA 3I5BA 1RQ0A 3KLEB 2CJKA 1OWXA 1FRMA 1N5TA 1TVRB 3HHLB 5HROB 3DM2B 2XC9A 1X4CA 1U1MA 2BVZA 4AYBD 3SQGB 2BV3A 2CRLA 3MHYA 4K4SA 2Q6BA 4MKAA 5AJ3F 4I67A 4CH1A 4OHVA 2ZE2B 3TA2A 4ZCMA 3LAKA 2LQBA 1U1KA 4HVZA 2MB0B 2ZBIA 3MTJA 1TL3A 4CTAB 4MIBA 2AWZA 2UVVA 3NCQA 4O44A 1TKZA 2RDJA 1HNWF 2E7WA 3G4SS 1U1LA 4Y2CA 4YDXA 2DIVA 3GFZA 3Q2SC 2OPQA 2C28A 4LIRA 3J7Z5 2VODA 1KVIA 2FVCA 1FVQA 2J76E 2IC3B 4HDGA 4NA2A 1BY9A 3VAFA 3I82A 4R5PA 1S1XB 5F9LA 2CQPA 2QA2A 2J6UA 3AQPA 3HVTB 4OLOA 1YRXA 1S1WB 1L3TA 3JSBA 2ZITA 1WHXA 2XS7A 3ZC4A 4F4KA 3QWUA 1SH0A 1YJRA 2EFOA 1S0VA 3DN9A 4AL5A 3NAIA 5HMWA 3CEDA 4K2XA 2OFHX 2ZVSA 2OMLA 3K8VA 3IO1A 3OR1A 4JI2F 2OMOA 5DG8A 1UVKA 2EBGA 2QYCA 2DGTA 2YKNB 2YKMB 4IDKA 3SSSA 3H25A 2FVSA 5KT3A 2JC0A 2E44A 2M5YA 4KBIA 1T8EA 2Q1LA 5G4DA 3PIPQ 2XLJA 5J1EB 3IS9B 4KTQA 2OLWA 1LWFB 2ZH8A 1FXRA 3MECA 2B6AA 1S6OA 4MK9A 4DV0F 3NP5A 2HHSA 4HI1A 3DLEA 4ILMA 1RJJA 1R6YA 4WFNQ 5HMXA 1LFPA 2K8GA 1U4BA 1Q78A 4LMZA 1E6YB 4IH7A 3I0SB 4G1QA 2RS8A 4DUYF 1S0OA 3PRDA 2OIHA 2DR9A 2O3DA 4KFBB 5D3GA 2V0NA 2XB2D 3SYZA 4DL5A 3GWCA 2PSZA 2VB6A 3IAM9 2AJFE 5F8GA 3OL8A 3KOAA 4DX8H 1R0AA 2F3JA 1S9EB 1WACA 2DT9A 4ZHRA 3OBIA 4WTYA 1J5EF 3V6DB 5KFIA 2E66A 3TO8A 4LF5F 3CJ4A 1DQ8A 3BDEA 3ITHA 4IG0B 1S1VB 4NXMF 1HARA 3E01A 3BQ1A 1R8HA 1VQ6S 1Y00A 3CCQS 3TVZA 5HP1A 2HGNA 3UDLA 3U1LA 3RR7A 4DSIA 3IGNA 1S6QB 1XR7A 2MQLA 4ALZA 2KYXA 1Q8IA 1YJ9S 5E33A 1S77D 1DFDA 3GIIA 1YTYA 3LWMA 1IKYB 2CPXA 1RGVA 4AL7A 5KFAA 1KQGB 2ASYA 2VBXA 5L9NA 1H38A 2ZD1B 3LP2A 4B3OA 2HLTA 5F8NA 1X4BA 5KG1A 1NH8A 1V9OA 2B9YA 2B51A 2FC8A 2XGQA 4TLQA 2RRAA 2M52A 1U24A 3BDPA 4B9NA 1NJIT 1W2IA 2W7OA 2QLWA 1IM4A 3MUVP 2IA6A 1IKXA 5U47A 3BJYA 3JSRA 3JTNA 4L3NA 4OX6A 2VA2A 2ZHOA 2ZH7A 2LQJA 2KJVA 2OSQA 2B7CB 4RNHA 1HBUB 2GJIA 1YQHA 3CD7A 3RW6A 3OFFA 3UPFA 3EPIA 1SL2A 1YJTA 2W25A 3MM8A 2UUTA 1HWKA 3BQ0A 2FY1A 4B3MF 1C0TB 2CQ2A 2GO9A 4UW2A 4HL9A 3MR3A 3EYZA 4O3RA 4PPZA 5EHHA 1HBNA 1SJ1A 3MOJB 7FDRA 4ED3A 4N8OA 1FJCA 4DQPA 1IKWA 3CJKA 3MZIA 4F26A 2WBMA 3S1TA 3UCGA 2VG6B 3JYTA 1Y5IB 1Q4RA 2YNGA 4ID5A 1X4EA 3LALA 3C6UB 3KWMA 1KFSA 3CDWA 1M5HA 1YJVA 4H54A 3KYLA 4JI6F 1RT4A 4KV8A 4QPTA 5AXNA 3UW1A 2YNHA 1U1OA 4GC7A 2RE1A 1GXUA 1MNEA 4DHVA 4QPXA 4F8RA 1RTIA 3IRWP 1UJ5A 2B9WA 4I2PB 4DFMA 3FGVA 2W9AA 2MDAA 3NRBA 4P7VA 3D28A 1R8CA 4WYLA 3KNAA 3H40A 2R2TA 4FYDA 2FUG9 2I5JB 4NLQA 5IZHA 4ECRA 3L95X 1VRUB 1SC6A 3N5BA 4A8KA 3MMCB 3H8YA 4X62F 1VQ4S 3NWGA 2MPUA 1FF2A 3DLGA 1RTDA 3MWBA 3DOKB 2L48A 5GVQA 3BGLA 1JKHA 3CCVS 2VPYB 2DITA 2ZJRQ 1QE1A 2DHSA 2HMIB 1H7WA 4OLPA 5B0AA 2QA1A 3U27A 4IOAQ 4EFAC 1DHMA 1SI9A 3UQSA 1BQMA 4A8WA 3LP1B 3GSDA 1N48A 1FDBA 2V4JB 4TNOA 3RB6A 3MEKA 2I8EA 3PFEA 2M2BA 2KI2A 3MD1A 3E8OA 4TU8A 2EWHA 1NB7A 1HA1A 1X5TA 5CZVA 5HO4A 2JEFA 1LWCB 2VFVA 1SKRA 3TANA 1FNXH 3VCDA 4DFKA 1OPIA 2DNGA 1B7FA 3VF0B 4N56A 4LIWA 4NCAA 4OZNA 3OV7A 5BYQA 4K5RA 3HZGA 2J6TA 3HHDA 4FVCA 1UA0A 1JJ4A 2B43A 4RW9B 2YNFA 3KTQA 2E1AA 3POTA 4DR4F 4WK3A 1RT6A 1YBAA 2DNOA 2XSJB 4CCHA 4O3PA 1VQKS 3NMRA 4FXDA 2KHDA 5M2PA 4HLBA 3MF5A 5K8MA 1RKJA 2QSFA 1YJWS 3MEDA 5IT0A 1N36F 1RKIA 3AA9A 2AQ4A 5J2NB 3KNGA 5B0FA 1UW4A 2JLFA 2V94A 2XLKA 4KRWA 1HPZA 1AFIA 1JLFB 2DGQA 2WONB 2DGSA 3DLBA 4CO4A 4JI3F 3MD3A 3N0VA 2XBPA 1N5VA 3M30B 1QSLA 1YVFA 2FLPA 2W4DA 3K5PA 4X4UA 3M2VA 4CT9A 5KG3A 3DNCA 1C1CB 1GQEA 3R5CA 5HLFA 3QJJA 4Y34A 1S10A 1KQKA 2Z4PA 3MGJA 2KTQA 2Z2MA 2DNHA 1AROP 3E2EA 4OJGA 3NGDA 2XI2A 4ECZA 4X4SA 5F8LA 3PW7A 3KK2A 2R8KA 4ETXA 2HNZB 2Q3PA 2QMWA 4QYRA 2MQNA 1SKSA 1TKXA 1N56A 1VHFA 1FKOB 2CQ3A 4HT7A 4NYOA 4H4KA 4TY9A 3DOLA 3PW5A 2GMLA 3DDKA 2MMYA 3R5AA 4DFPA 3MR6A 1D9FA 5KFGA 1VQOS 5IFMA 2HGMA 3K7RA 1MROA 1DLOA 1V3SA 2CPYA 5DDRC 2ZZNA 5F8JA 1K1QA 2DGXA 1QM9A 1HNVA 3BSCA 5DDPC 2Q66A 5T41A 2N3OA 2JC1A 4F4XA 2DIUA 2KN4A 4Q43A 3TAQA 1S6PA 5LL6d 1VJWA 4MTPA 1VQPS 3AA8A 1JK9B 4K0KF 2CQ1A 1SH3A 2O66A 3MEGB 1M5PC 4USJC 4LJMA 3P3DA 2ATLA 5CCMA 4QJVA 1SIWB 2BQ3A 2B56A 1BC6A 1R7IA 3I56S 1NHUA 3BR9A 3BQ2A 4B9TA 3UD3P 1DQ9A 1BGXT 4A47A 4XO0A 2W4CA 1RA7A 2FHMA 2IM2A 4F2RA 3FRYA 2N4CA 4EU0A 2MZ1A 1C0UA 1WELA 2B4PA 2ROPA 4FF2A 4IUFA 4PG7A 4X4PA 4WZMA 1H6KX 2MZQA 2EW9A 4PRFA 3PIOQ 4DL7A 3GFHA 4J9QA 1XMOF 3N5FA 4C97A 2B7BB 5GAGU 3OFHA 3IG1A 1X5OA 2YKAA 4C4WA 4QWEA 3CPWR 1VC0A 1JIHA 1VK3A 2IVFB 2JWNA 2RSQA 4HH0A 5C24A 2IM0A 3DRYA 1HBOB 2ZH1A 4LFCF 2BABA 3RW7A 2FLOA 1QAYA 2NZ4A 4LUBA 2FPHX 2M9KA 4JV5F 2OD4A 3N6NA 3K57A 4MFBA 3MM6A