2CQ4A

Solution structure of rna binding domain in rna binding motif protein 23
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
114
structure length
114
Chain Sequence
GSSGSSGKSPVREPVDNLSPEERDARTVFCMQLAARIRPRDLEDFFSAVGKVRDVRIISDRNSRRSKGIAYVEFCEIQSVPLAIGLTGQRLLGVPIIVQASQAEKNRLSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Rna binding protein
molecule keywords RNA binding motif protein 23
publication title solution structure of RNA binding domain in RNA binding motif protein 23
rcsb
source organism Homo sapiens
total genus 16
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2005-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2cq4A01
3G96A 2GO9A 1DHMA 4Z2XA 2QEXS 3Q2SC 3H2VE 3EGZA 2VODA 2LEAA 5IFMA 2K3KA 3CTRA 1X4FA 2ZJQQ 1H6KX 2RU3A 1ZZFA 2CPDA 5DDPC 1VQ4S 1U1PA 2FC8A 2G1DA 2CQDA 1FNXH 2I2YA 1M90T 1M5VC 1FJ7A 4TU9A 1YI2S 1Q81T 2VOOA 2KFYA 1B7FA 1L3KA 2CQCA 2K8GA 2JWNA 4U67Q 1A7GE 2M8HA 2X1GA 3UD3P 3MD3A 2V94A 1U1OA 2AYMA 1S79A 1U1MA 2DNQA 2KHCA 1VC0A 2MY8A 2DH8A 1SXLA 1WF0A 1RKJA 2RQ4A 5DM7Q 4V19X 1WG5A 3V4MA 3P6YC 2LCWA 1YWXA 2DHAA 2G0CA 4CQ1A 2DGTA 1WI8A 1UFWA 2JRSA 2CQ3A 2DK2A 1UP1A 1U1LA 2L08A 2J0QD 1VQMS 1HL6A 2SXLA 3CCSS 4C7QA 2JVRA 1Q7YT 2MXYA 2J76E 3U1LA 3CCLS 2D9OA 2N7CA 3PIPQ 1SJFA 3FEXB 5JVGQ 2XB2D 2RNEA 1FT8A 1X4BA 1X4DA 4WF9Q 2QFJA 4M5DB 5DDQC 1VQKS 3G6ES 3RW6A 2D9PA 4YUDA 2CQHA 2DNNA 1VQNS 2AYGA 1OWXA 2XS2A 3UCUP 1WEXA 2DB1A 4FXVA 3I55S 4W90B 4WKRA 1JJ4A 2MSTA 4F25A 2U2FA 4WFBQ 5DETA 1SJ3P 3CCUS 5DM6Q 3BO3A 2HZCA 1KQSR 2HYIB 2DGOA 1U1RA 1OO0B 1SJQA 1WG4A 2MZTA 1NJIT 2OJ3A 1X0FA 1HD1A 2LEBA 1NU4A 3VAKA 1AUDA 2HGMA 3FEYB 2F9JA 2KXFA 2MKCA 2LMIA 3UCGA 2CQIA 2KU7A 5IM0A 5IQQA 2MMYA 1UAWA 2DHGA 3BEGB 4TU8A 4F26A 2DNMA 2E5GA 2J8AA 1DZ5A 2DITA 1BY9A 2MQMA 3J7YU 3DXBA 2M9KA 1WF2A 2M8DB 3TO8A 2M7SA 4OZ1A 5LJ5Y 2MKSA 3MDFA 3SMZA 2KI2A 3CXCR 1X4EA 5GMKa 3I56S 3VAGA 2CJKA 4IO9Q 2KG1A 2KXNB 2XNQA 3U1MA 2MKIA 1JJ2R 2MJUA 3CCRS 1FXLA 2KRBA 3R1HA 1P1TA 5D77A 2CQ0A 5CXTA 2OIHA 1KD1T 2RUGA 2L41A 5IM0B 2DH7A 4CH1A 1WHYA 2CQ2A 5JVHQ 2MKJA 3BO4A 1X5OA 1YJ9S 2BOPA 2G4BA 5CYJA 2CPJA 1N54B 2XS5A 1VC6A 2DNHA 3THTA 2MGZA 3Q2TC 2DNLA 2AD9A 4PRFA 2CPYA 2M4MA 3EX7B 1WTBA 3L3CA 1FHTA 2D3OR 1PGZA 3VAFA 3CF5Q 1YITS 2O3DA 3TYTA 2CQPA 2LQ5A 1U2FA 3HI9A 1S72S 3LQVA 1CVJA 1HA1A 2MHNA 2RS2A 4ED5A 4TU7A 1D9AA 3J7ZT 5GADU 3BO2A 3UE2A 2DO4A 2F3JA 1X5TA 2XS7A 2CPIA 2U1AA 3N9UC 1ZZNA 1ZH5A 1UW4A 2M70A 3MI7X 1VQ8S 2KH9A 2UP1A 4WFNQ 2MY7A 2DNKA 1M1KT 2F9DA 1X5PA 2DNGA 1X4GA 2CPFA 4LIRA 3UD4P 2KM8C 1K73T 2FC9A 2MGZB 4ERDA 1KOHA 2RVJA 1M5PC 2LA4A 3CPWR 1SJRA 1U6FA 1VQLS 2RQCA 3MOJB 3CC7S 3P49B 4FXWA 2XSFA 4UQTA 2YWKA 2XNRA 1VBXA 1WEYA 2BZ2A 4C0OC 1DRZA 5H1SV 3G4SS 3ZZZA 1W2BR 1OPIA 3CD6S 3NNCA 2MQQA 2KVIA 3SXLA 5GAHU 3R1LA 3NNHA 2DGXA 2DNOA 3CCVS 4RU2A 2DHSA 2OTJS 2KM8B 3LPYA 2LXUA 5CA5A 3MUTP 1U1QA 3ULHA 2VONA 2DISA 2I38A 1U1KA 4QU6A 3SDEA 2JX2A 1U1NA 5LSOA 2MQOA 3CMAS 2MZQA 2MZRA 2RRAA 3S7RA 2EVZA 2KYXA 2KXHA 2NLWA 2AYBA 4UY8T 1H2VZ 2DGVA 2OTLS 3CCJS 4LJMA 1R8PA 3UWTA 2HGNA 1WHWA 4CIOA 3NNAA 5ITHA 1M5KC 2M52A 4WCEQ 1D8ZA 1WF1A 4QPTA 1M5OC 3VAMA 3S6EA 3MD1A 2OSRA 1DBDA 1H2TZ 2DNYA 2CQGA 4OZ0A 2A3JA 2DO0A 2M88A 2MPUA 4P6QA 1WHVA 5HO4A 2DH9A 3MUMP 2ZJPQ 1Q86T 3HHNB 2M2BA 4IOAQ 4WFAQ 2MQNA 2L9WA 3SDEB 3D2WA 5MLCV 1X4AA 1QVFR 1R8HA 5GAGU 2GHPA 2DGWA 2X1AA 4BS2A 4W92B 3UCZP 2MZSA 2N3LA 3P5TL 4QQBA 1SJ4P 2DGUA 3MUVP 3BS9A 1F9FA 2DHXA 1P27B 2LYVA 5GAEU 3CC2S 1VQPS 5EN1A 1YTYA 2N82B 1KC8T 1WHXA 3S01A 1X5SA 2DIVA 1N52B 2MKHA 2X1FA 2ZJRQ 1K8AT 2MKKA 2Q79A 2E5JA 4ZKAA 2ADBA 5FJ4A 5DDRC 2ERRA 2VOPA 3MURP 3VALA 5GVQA 2FHOB 4CH0S 2CPZA 2MZJA 2LECA 2PEHA 2CPXA 3ZZYA 1NO8A 4Y00A 3TP2A 3EGNA 2CQ1A 3G8TA 2QA4S 3VAIA 2MSSA 2EK1A 2MJNA 1YIJS 3R27A 1HD0A 3G71S 3THPA 3PIOQ 5HL7Q 2B0GA 2KN4A 3G8SA 3MXHP 2KG0A 2HVZA 1X4CA 2WBRA 1WELA 5LXRA 2ADCA 2MB0B 2DNZA 4QU7A 1JJHA 3P3DA 1A9NB 2MZ1A 1JMTA 3CCMS 1VC5A 2EK6A 2FY1A 3CC4S 3G9CA 3K0JA 2N3OA 2RS8A 5LJ3Y 5D78A 3RW7A 2LKZA 2LA6A 2OSQA 3B4DA 1U6BA 1OIAA 2CQ4A 3S8SA 1N88A 1QVGR 4EGLA 2YTCA 1FO1A 2RT3A 3JB9k 2NZ4A 2CQBA 3H2UB 1Q82T 3CUNA 5LXYA 4A8XA 3DLLQ 4TLQA 2DIUA 2DGQA 2YKAA 4IUFA 2HGLA 1URNA 2E5IA 3IWNC 2LXIA 5DDOC 1X4HA 4PR6A 5BJRA 1YJWS 4F02A 1VQOS 1IQTA 3CULA 1VBZA 1WWHA 1VQ9S 1N8RT 2PE8A 3VAHA 3IRWP 2CPEA 3NMRA 2KT5A 3NS6A 3NS5A 1O0PA 1VBYA 2X1BA 1VQ6S 3OW2R 3CMES 3US5A 3VAJA 1WI6A 1FJCA 1K9MT 4Y0FA 1VQ7S 4WIIA 1YHQS 2JVOA 2MQLA 2YH1A 4LMZA 2J0SD 2DNPA 5LSLA 1H2UX 4PKDB 2M0GB 3CCES 4J5OA 1WEZA 2E44A 4YB1P 2KRRA 1YJNS 1KOOA 2DNRA 3VF0B 1PO6A 1XN9A 2MQPA 2FPHX 1G2EA 1RK8A 2DGSA 3CCQS 4C4WA 4YOEA 2CPHA 1VQ5S 2MYFA 2E5HA 3B4MA 1QM9A 2YH0A 2AYEA 4IOCQ 2RRBA 1FJEB 1WG1A
chains in the Genus database with same CATH superfamily
4NZ0A 1T9TA 1LW0B 1VQ4S 3MGJA 1FNXH 2QGFB 2ZH9A 3OFFA 4B3OA 2V94A 1BUXA 2UU9J 5GAGI 2FGOA 4O3OA 3BSAA 1VR6A 5C24B 2A6MA 2XHWA 3LALA 2VPYB 3P6YC 2CRLA 3BBFA 2H5JB 4X66F 4O3RA 2DHHA 1RB0A 1GMVA 4CLUA 2HHTA 4NASA 3U1LA 1S0OA 1U24A 3JSBA 2D9OA 2E5LJ 2P6TA 5D0RA 1CJTB 5ETQA 1P9QC 1FT8A 2XC9A 3SSSA 2C2RA 3I32A 3M32B 3G6VA 2Y1LB 5KFSA 4DR2J 2J7UA 3ZFVA 4DV0F 3DFEA 4I6YA 4FXVA 3KLFB 5KFFA 2DXFA 4ECXA 2OJ3A 5KFIA 2J6TA 3T9NA 3FEYB 2MKCA 1O8BA 3VZHA 3FRYA 2A6OA 9RUBA 4YQWA 3E8OA 1ZTWA 2EWHA 1KLMA 2HPUA 4YHHF 4DHVA 1RTDA 3SYZA 4DV1J 1DZ5A 1S76D 2QLBB 1UJ5A 3M30B 1HKAA 4PWWA 3TZYA 3PR4A 1RT2A 1TUGB 3CD0A 2OELA 3FMWA 4QWDA 5K8OA 1VK3A 5CXTA 5E5NA 2DH7A 4NXNJ 4YB6A 4HR2A 2W01A 1CPZA 2BW2A 3ZZPA 5KT3A 1HQUA 4HT5A 3C46A 3AB4B 1PGZA 1N5TA 3GWCA 3HZEA 4U7UK 4KT0C 2K3IA 3OLAA 3BO2A 3E51A 2P5VA 3PY8A 2OLWA 4TN2A 2F9DA 1SV5B 3KLGB 4ES3A 3UD4P 4LIRA 1HHQA 3HSJA 1WOPA 4JOUA 1LKZA 1LWCB 2CA9A 4OYMA 5E3QA 4I64A 3DNCA 3KKFA 3BSOA 1BC6A 3GSIA 2KVIA 3R1LA 2W2NP 1YZ7A 1OMSA 2UUCF 2BE2A 4QR0A 3TANA 3QLHB 1OY8A 1OSCA 4USMA 3QZ8A 4DV7F 2MZQA 2MZRA 1HNXF 4RLEA 1SC3B 3X1LB 3CCJS 4ILLA 4UOCA 2AJ1A 1WHWA 3NNAA 3AJ2A 1OQ3A 3P96A 1IKYA 1NZAA 1QDUB 2OSRA 4KV8A 2VQEF 2R42A 4DR6F 2JC1A 5ETMA 1JLCB 3D2WA 3DOKB 3D0GE 2EFOA 3DLGA 3SZ2A 1XR7A 2BJ1A 4A8OA 4ID5B 2D74B 1RE1B 4I2PA 4KBIA 1C1BA 2IYIA 3K58A 2RDIA 3BSNA 2QL7B 3Q83A 1N6QB 5F0WA 4DR4J 4NLRA 5HL7Q 1S4EA 2B0GA 1NSQA 2KG0A 5CD4A 3QAUA 1JJHA 3P3DA 1A9NB 1CJUB 3MM9A 2QFIA 5J2NB 4GO7X 3GPAA 4RL1A 1YQHA 3HLUA 5HROB 4V1Ak 3DLLQ 3KDNA 2AWZA 1P6TA 2ZZTA 2PA3A 1URNA 2MQ8A 4C9DA 1X4HA 4WFYA 4TLRA 4DQIA 4ANDA 5GMDA 1V3SA 2HNZA 2FD2A 3CMES 3PZPA 2OEJA 4PQUB 2FJAB 1U09A 1IJFB 4BLGA 4Y65A 5EX3A 4YB1P 3T3FA 3ENAA 3VF0B 3K7RA 2L3MA 2OO4A 4Y34A 4E0DA 1G2EA 1T9XA 3H5SA 4N47A 3NAIA 3H2LA 3HHKA 1GT8A 2IJNA 3GSDA 1S6QA 2WSFC 1JIHA 5DLGA 3CCTA 1X9WA 1NKEA 1TELA 4FF2A 1U1PA 3HZGA 3UW1A 1Q81T 1ZYQA 1A7GE 1GFWB 2Z56B 1UWBA 2HWTA 1YRXA 3TZXA 4GKKJ 4M5DA 3VVUA 1AW0A 3PW5A 1RISA 3DU5A 2HIYA 3W8PA 1U1LA 4N8NA 3UVJB 5AXLA 2JVRA 4O3SA 4PUOA 4O3NA 1LFPA 4Q7AA 4JYAF 3GV8B 2VUGA 2UXCJ 5DDQC 3RW6A 2VBZA 4CM2A 1I6JA 2NS1B 2AYGA 3AFGA 3ISND 4UTGA 4NZ7A 5F3TA 1GAOA 4KO0B 2G9OA 2CG8A 1N5YA 4F4ZA 4RPFA 2CYYA 1RHQB 4JI2F 3OFEA 3K2YA 3J7YU 2M8DB 1VRTB 2X7IA 1ZPWX 3SMZA 5L1JA 1Y3JA 3UN3A 1AYEA 2IYGA 2IVFB 5D4OA 2CAJA 1TK8A 4CH1A 1VJWA 3MMJA 1TL3B 2ZH7A 3U1NA 4ED3A 1XNRF 2OPQA 3SSRA 2VBXA 4GVLA 3A12A 3FDSA 3M2RB 3FBFA 3MPWA 3M8QB 3D67A 3LQVA 1HA1A 5GADU 1LXNA 2V2VA 4RUAA 1VQ8S 2UP1A 1N36J 2BRKA 1PYOB 3M2VA 2KM8C 2Y0BB 5I42B 5C5JA 8ATCB 2E7XA 4K0KJ 2XO7A 2DD8S 2Z2ZA 4L73A 5B0AA 3I5CA 2P8IA 3QIPA 3R2DJ 4TY8B 3KOAA 2C2NA 1FKPA 2BJ7A 1OPZA 5DRKA 2ZHAA 4X4NA 1U48A 1HHTP 1KS2A 2G2OA 2RRAA 1QAYA 2QYGA 1RBAA 2OTLS 1KNZA 2W4CA 3BB5A 2G2ZA 1SKSA 1JXEA 4QPTA 2Z2YB 3LA0A 3UPFA 1VRUA 2IAJA 2M88A 2MPUA 5HO4A 3KXDA 2VKZG 2B51A 3DGPA 1Q16B 3VZIA 4NMXA 4ZPCA 5E3RA 3D3BJ 4LSNA 1FX4A 3R6GB 4PZVA 2PFFB 3NY0A 4F4YA 3OTOF 2ADBA 2ZDOA 2DXDA 3D6HB 2WVBA 3FFIA 3D6TB 3G86A 3J7A1 3P4UB 1QLNA 2V63A 3B8HA 4YR2A 2YBVA 2MSSA 3FCWA 3NG8A 5DQGA 3AJDA 2FJBB 1KQGB 2UUBF 4LIWA 1FRXA 4DL3A 1HYSA 3PW7A 3WHIA 1KLNA 2HVZA 3DOMA 2HVHA 2R8GA 4KFBA 1JMTA 2OI2A 1N34J 4NLUA 4NYPA 4C8ZA 4FKYA 2C22A 5L8RC 2VFSA 2JC0A 4J9VA 4LF7F 2UUWA 1N88A 3QGPA 2YTCA 5KFBA 1K44A 4J9KA 4RZRA 1H73A 5FDLA 1VIOA 1H0HB 1IQTA 2ZHBA 3DYAB 3UDEA 3KJVA 5LMUF 3ZZOA 4F36A 2XYGB 3NS6A 5KFLA 1AFJA 5HQMA 1LXJA 5B0EA 3CD7A 4ZLLA 4GVBA 2J8SA 2XO6A 3O5TB 3C15A 4LMZA 3CCES 3KG1A 2WK4A 4MYUA 3GLJA 1UL3A 4NA1A 1UVIA 2MQPA 4Z37A 1MU2B 1S1WB 1CG2A 2CPHA 1VQ5S 2Y3YA 4KSEB 2ZFHA 4DG1B 2LEAA 4QIWD 4WYWA 2JLGA 3C16B 1DY3A 1C0TA 4TU9A 1B0TA 4ICLB 3HFVA 2LDIA 2HZAA 2ZM6J 1F1BB 4IQXA 4DR1J 1U8WA 4FYXB 2ZWPA 1XC9A 2EFNA 3N28A 2PT0A 4OI4A 4D3GA 2R7UA 3BR9A 1HL6A 3M6VA 4NLOA 2J76E 4DCOB 1MNEA 3ETMA 5EHHA 1S1XA 2NUUG 1RT4B 5JVGQ 2H9ZA 2RNEA 4K59A 1ZAVA 2UZAA 4ZPBA 5K14A 1Z1ZA 4AQYF 8RUCA 2ZC3A 1DTQA 1HW8A 4O3QA 1XMQJ 3TEGA 3ISZA 4DXLA 1CULA 4ES2A 1JLFA 3A8KA 2HYIB 2NXJA 1KRPA 2BQUA 2CQIA 2VF3A 3R5CA 2BJEA 1RAJA 1PAUB 3DMJA 2D3O1 1P1LA 1S5ZA 3CJTA 4FYYB 4ZDNA 2DNMA 3HVTA 4DPYA 1RBOB 3M8ZA 5KG7A 2V9WA 1GX5A 2YKPA 2UVVA 3TAPA 4JI7F 5IT4A 1YJUA 3PW4A 4KPCA 2GO8A 1RT5B 1YX2A 3VAGA 1X60A 2RILA 4RW4B 3D0IE 4OYOA 5GMEA 4RNMA 3QGHA 3NBPB 4P71A 5MAOA 1DFDA 1RT7A 5CHCB 2ILYA 4PG5A 3F41A 3KLEA 4LBIA 2VQFF 1KHVA 1YITS 4DZDA 5HQLA 3BGUA 4PG4A 2ASDA 1HW9A 3DRSA 4YB5A 4P2MA 4R8UB 1GNKA 4DR5F 3EZOA 4LF5J 2CPIA 1ZH5A 2F5GA 5CCLA 3CGIA 4WXOA 2CPFA 2FUG9 2HHPA 2FC9A 1NHKL 2ZH6A 3V81A 1REVB 2PO4A 3Q8YA 2XNRA 3PX0A 4JI1F 1RHJB 3X3UA 4OHVA 5D4PA 4Q2LA 2E29A 2HHVA 4YY3F 1MWZA 3S7RA 1NNDA 2WOMA 1VHFA 4TVAB 2ZBPA 2HNDA 1H2VZ 3UWTA 2RKIB 4AUKA 1NPRA 2BOAA 1KVJA 1T3NA 2UUAF 3LW5C 2Q1LA 4IFVB 5HSPA 2JEJA 4O4GA 4OZ0A 2ZJPQ 1U4BA 3DOLA 3IN5A 3RBXA 2LFVA 2AJQA 2VG5A 4DJBA 3T1HJ 2QA4G 2HWHA 2LYVA 3CC2S 2CWKA 4B9NA 1HWLA 5A0YA 4NMLA 3LP1B 4ZS6A 4LF9F 2QL9B 2E5JA 1Q1KA 5D0HA 4B08A 2HNYB 2BANB 3J81Y 2KT3A 3RRKA 2Y0SD 2VG6A 2RUSA 2BEFA 1YIJS 4NCBA 2IM1A 1LV5A 1LW2A 4CLSA 4HDHA 3MXHP 3V6JA 2WBRA 3JS9A 5LXRA 4EBCA 2EK6A 4J9MA 4USJC 1RQ0A 1HBNA 4KHMA 5LJ3Y 3QMQA 4FXDA 1L5UA 1XNQJ 3W65A 1NDKA 3LO3A 1G1XA 2FB0A 1TKXA 2HFZA 3KLHB 1HQEA 3DHXA 2VU5A 1FX2A 2V8PA 5IT9Y 5KG3A 1VQ9S 2FHJD 1PYSB 5D4NA 2CPEA 3NS5A 2VFUA 1EX8A 1RI7A 3PG9A 3I87A 1VQ6S 4RW8B 2VJVA 1GTHA 4NLXA 1KKHA 4PWDB 3ZNUA 2PD1A 3DRRA 4B9VA 2FLLA 2OPRB 4HH0A 4DN0A 1UFKA 3ILLA 3I5AA 4V19J 4IG0A 2V8HA 4AXJA 1FDBA 2XQCA 1FEEA 3GIIA 2GIRA 4I2QA 1HNIB 1BXNA 1N0VC 1WG1A 3JSRA 5E41A 5A8WB 3W61A 1TL7A 3KJNB 2ZJQQ 2RU3A 1NDLA 2WSCC 3FKBA 4PXEA 3MMCA 1S9GA 4ZVEA 2ABYA 2KFYA 2CQCA 2Q66A 1HBMA 1KVKA 3IG1B 4Q8FA 4PXCA 2FIUA 1VC0A 2PEBA 2K1RB 3N0VA 2BQ3A 3MM8B 2G0IA 4FPIA 4DV5F 2XZTB 3OL6A 2JRSA 2CQ3A 4CTAA 3IR7B 1SB6A 4NA3A 4GMKA 1VQMS 3CCSS 3OHAA 2GQ2A 4URSA 3UN5A 5HBMA 3TWZA 3PIPQ 2E9RX 1SJFA 4MT1A 2HHHF 5FLXU 4OMFG 1DTTB 5C7PA 2A18A 4TXSA 2XS2A 4KYZA 1JJ4A 1CS4A 2DXEA 2HHWA 4S0MA 1RAFB 2VH7A 1QAIA 4ETXA 1VFJA 4MFBA 1U1RA 1I51B 2IC3A 3NKYA 2WSEC 3C6UB 3BGRA 3QJJA 5L9NA 2H5EA 4QBUA 5M2PA 4QPXA 3QFHA 3V5RA 1RTZA 4OLPA 4WPAA 2PI4A 4A48A 2H3EB 2O01C 2WONA 1Q53A 4OZ1A 5I3UB 2KI2A 3CXCR 4CLLA 2JEGA 4LR7A 1JJ2R 2GVZA 4DUZF 2YQ1A 3ZZTA 2CQ0A 1YDLA 3WQPA 2PGCA 4LFBJ 2Z2MA 5JVHQ 2UUTA 1YJ9S 4MH8A 3DLEB 4ZOSA 3OUYB 2DNHA 1BQMB 3MEEB 4UQGA 1R0AA 1CQMA 3EX7B 1Y9OA 3OSPA 2LVWA 2B9WA 2GMHA 3MCSA 4ZHRA 3MTKA 2IY5B 2V4RA 4KPYA 2WVDA 5CCMA 1TL4A 2XEXA 4B3MJ 1U0SA 3MI7X 5BYQA 3H5XA 4U95A 4ECQA 2A2DA 1FCAA 4IFYA 4L76A 1KOHA 1M5PC 2KFNA 1AXQA 5J2MA 4LF1A 3MEGB 3TX8A 2HIQA 4F7VA 4FBUA 4X4QA 1DRZA 1RWPB 1WTFA 5AJ3F 1T8EA 1IKXB 2XSJB 3H90A 3KG0A 5HVGA 3FNNA 2E1MC 1LK7A 2C42A 4LF6F 2DISA 4CO3A 1C4CA 5IQ6A 1VIXA 4F4KA 4QR1A 1TL1A 3LOUA 3VV2B 3AH6A 1HARA 3D9BA 6AT1B 4MMOA 4XAKA 4YB7A 1FFGB 5F0UA 1WKKA 3HSZA 4CLYA 2ASYA 4WCEQ 1N32J 4Q45A 1NK8A 5F9NA 2F65A 2KT2A 4BBYA 3PDNA 3I0SA 1H2TZ 4WK1A 4P73A 4URGA 3AT1B 3R7SB 3HDSA 1T9YA 1X4AA 2DGWA 3LP0A 2RIJA 2OH2A 4IDKA 1TVRA 4W4MA 5H9EK 1IUJA 5C42B 4OYZA 1FKOA 2J7KA 2B9XA 5DDRC 5J2QA 3MURP 4R5PB 1TKZB 5GVQA 3F44A 1U49A 4X66J 1QUPA 1L3TA 1WC3A 1D3WA 2C3YA 2QA4S 2MJNA 4ECVA 2D3UA 1HBUA 3IMQJ 4DX5A 4WP9A 3RR8A 3MPVA 3QGIA 1RT6B 3ILIA 4HVZA 4WU3A 3PIOQ 3H20A 2NQPA 4DV0J 4LF8F 3RW7A 2HFSA 2LKZA 3MF5A 2VPZB 1U6BA 1F6TA 3S8SA 1FXRA 2LQ9A 2Z57B 1Q82T 1RA6A 3M8PA 3RB4A 4YHHJ 3W66A 4P7VA 3CB4A 4B9SA 1O0PA 5D3GB 1R8BA 4PYAA 1T94A 5F41A 1KVIA 1SKUB 2POKA 4FNIA 3W5ZA 1T05B 3M1VB 3OHBA 2WRMA 4O4RA 2IIHA 4OZ2A 2GGPB 3E01B 1HPZA 1YG0A 4EFAC 2R7WA 5E0OA 1ZTTA 1PO6A 1WC0A 4LQ9A 3HHLC 2UXDF 4RUBA 1K0TA 3OXLA 2KTQA 2HFUA 2MEWA 2D3ZA 3FQKA 2B4VA 2XMVA 2W9BB 4C98A 1U47A 4X2BA 5DDPC 1C0UB 1FJ7A 1RAAB 3PO4A 4ILMA 1S1UA 4DQRA 2M8HA 4USKA 3PHEA 1ACMB 3NAHA 4U6PA 1KP6A 1ZM9A 4KH1B 3RZAA 1WG5A 3BF4A 4CQ1A 4ECSA 3PW0A 2J0QD 4JV5F 2UUCJ 2R3VA 5KFWA 3EXYA 1YVFA 3CCLS 1SC4B 1D09B 3FEZA 2HBRB 2VG7B 2XB2D 1OQ6A 4DV7J 3CJKB 1HNXJ 3TVZA 1QSLA 4MYTA 2ZDPA 2NSBA 2X3GA 1EHWA 4K4VA 4J9PA 3I55S 3MM6B 3W2WB 3GJQB 5KT2A 1KQSR 4ZMMA 1UW9A 1NJIT 1VYAA 1W2IA 2IRYA 4DX6A 4ANEA 2VQEJ 1Q5VA 3G6XA 1EIYB 1LW0A 4DR6J 5JJBA 3J7Z5 2HQCA 2MMYA 3EM1A 2GV1A 2H54B 2DCUB 1UPPA 2J8AA 4ENOA 1NK9A 3BYPA 2H4WB 5A2QY 4WFXA 2MKSA 4M5JA 2Z0GA 4DCJB 3MEKA 5B0FA 3V6DA 3KLIB 2KG1A 2FVCA 2CJBA 2VFTA 5EWGA 4QYRA 4LSLB 3PEHA 4UZCA 1GMWA 4OYWA 3M9NB 1N54B 2XS5A 1J2VA 3Q2TC 1NJWA 3BV8A 4F3QA 1RJJA 4JV1A 2VZ9A 2V4JB 1FHTA 2D3OR 3I6PA 3HK2A 1RUSA 5L9XA 3UNYA 2ZZNA 2ZE2B 4ZCKA 3ENVA 1LWFA 4DF4A 2W24A 3J7ZT 3M8RA 1ZZNA 4LF4F 3T5JA 2HQDA 2FTRA 3CWJA 4HH1A 3PVXA 4PPZA 3Q23A 4XTTA 1J5OB 3CPWR 3CNQP 2RQCA 5J1NA 2ZUGA 4UQTA 4G1IA 3ZZZA 4NI2A 3KUGA 3NMAA 4OX8A 2YNHA 3CD6S 4OV1A 3RR7A 4DSLA 1RAGB 2IA0A 4RNFA 1SQGA 2GVDB 2ZWOA 3IS9B 3AD8C 4G1QB 3MPUB 1RYRA 2JNJA 1U1NA 3EUNA 2NREA 4EWTA 3PEJA 4OQJA 4CO1A 1SIZA 2NLWA 1FXDA 4OZ5A 2HLUA 3MZIA 2FVQA 4ZLNA 4DSKA 1RHMB 1D1UA 2W2PP 4LRFA 1IVZA 3VAMA 3S6EA 5HLFB 3PR5B 1S12A 2CVIA 3R7NB 5U47A 4DV3F 2DO0A 2DPIA 2WVEA 1NSAA 2L9WA 1JK9B 4BS2A 4E2FB 1HI0P 5F9LA 1SV5A 3ICLA 1YTYA 1TFWA 1NK0A 2Z58B 2OEKA 3HVRA 3WDOA 1UZHA 2GJ2A 1YGYA 4LR9A 4X84A 3VQTA 5F8HA 5LSRA 4IH5A 4CH0S 2Z8QA 4A8YA 4Y00A 3IM9A 3TP2A 3DI6B 4DSIA 4OJ3A 1R7IA 3EGNA 4Y2AA 2CQ1A 1S0MA 3VAIA 4ZJOA 3QLHA 4WXWA 1JKHB 3M05A 4O3PA 2BM1A 3OT9A 4Q8EA 4JYAJ 3M6UA 1CBKA 4QWBA 1SL0A 3QRPA 3IAS9 2C2KB 5AXKA 3HO1A 3K0JA 3GP9A 1OJ4A 1NKBA 2ZOFA 2MHEA 4HKQA 1Q8IA 1UTAA 2DGQA 4JI2J 1FDDA 2LXIA 2R2UA 3CULA 4KGZB 1VBZA 3BH7B 1TU0B 1N48A 2HSEB 3WX4A 2JJ4D 5L46A 3FBCA 1M1HA 5C25B 3GFZA 3VAJA 1VJQA 1TP7A 5G0RA 4G6VB 5T7LA 4QWAA 4CO0A 2HFVA 1OYEA 4I6AA 3NRBA 2BE7D 3HHLA 2QT7A 5ETPA 4ETZA 3VTIA 4B9LA 2E44A 3IGVA 2DR6A 1T03B 1RHKB 4IRKA 1IWAA 4OLOA 1U7LA 4H4OB 1NPPA 2DT9A 2QIFA 1XNRJ 3PYDA 2AYEA 2RRBA 4CYUB 1FJEB 3H2VE 2VODA 5IT0A 4OJ1A 2K3KA 1CJUA 5B0CA 3BQ1A 2FY8A 5A76A 3QSIA 3GV5B 1M90T 2LLZA 1IR1A 3M8SA 2B7CB 3EVMA 2ATCB 3PHTA 2HURA 5J1EA 1S9EA 2W9CA 2R7TA 1UFLA 3OQ2A 4JI5F 1WC1A 3AOAA 2Z4PA 2DGTA 5DZ6A 1WI8A 2PIIA 1FI4A 2C3PA 1PJ7A 3FQLA 4FS2A 5KFUA 1VMBA 2N7CA 2HBZB 5D0GA 3H59A 5F8GA 2GJFA 3K57A 2ZNZA 5KFPA 3IBCB 3RBEA 3CCWA 1XTZA 1DJ0A 2C2EA 1KSPA 5DETA 2C3OA 2ROEA 1SI9A 4IRDA 4IRCA 4O0NA 2J6SA 1X0FA 3IGNA 2V2QA 2LMIA 1NK6A 3K8WA 2I8EA 3B54A 4M5GA 1HWIA 2GIQA 3A3OB 4LFCF 3J81j 4DOZA 5FD1A 3G6YA 3GV7B 4EI2A 2VKRA 2DITA 2V2ZA 3DXBA 1GK8A 2ZEJA 1XMOF 1DQ8A 4URQU 3OTOJ 2CJKA 3PTWA 3MPYA 3TUZC 4QIEA 5AXMA 7AT1B 2RH3A 4NLYA 2DBBA 2C2DA 2LXFA 4M5KA 3W62A 2RD5C 3IR5B 3UR3C 1PIEA 4LFAF 1KLMB 3D1HA 1RTDB 1SUQA 3W60A 1VC6A 7FD1A 5IZHA 1FESA 1UEUA 2AD9A 2L9NA 2CZ9A 3L3CA 2UUBJ 3VAFA 2Q6CA 1RT2B 3HI9A 3VGVA 1KHWA 3GZ7A 3D1OA 5AE2A 4ALZA 5B0BA 1VQSA 4LF7J 4H4KC 4F04B 3JYTA 1M1KT 3AD9C 4B3TF 1N33F 2XTJP 1TKTA 3TUJC 5HP1B 3EYZA 2RVJA 1S4FA 2V0NA 3FZBA 3TOQA 5E7OB 3CC7S 4OX7A 2HWIA 4MTPA 5LMUJ 4ZIVA 3MM7A 4ZVPB 2NUHA 3I4PA 2MQQA 2B6AA 3PM9A 4OI6A 1J5EF 1TMJA 1NM2A 2EBEA 3LPYA 3C66A 5K8PA 1U1KA 4WE1A 4NLTA 2KYXA 4J9RA 1R8PA 2DRBA 2EG1A 1PJ5A 2E9ZA 4AT1B 1BWEA 1U45A 2O5DA 3BDEA 2XULA 2EFPA 2WB4A 2V5HG 4DN9A 4X4UA 4K4XA 2BE2B 2CQGA 2WAQD 4ECRA 2GCFA 4LRDA 4U96A 4ANCA 4C3LA 5A2QU 4USIA 2MTLA 4W92B 1GEHA 1L3VA 1SJ4P 1UVLA 5HI7A 3MR3A 2DIVA 2ZJRQ 3P8BB 3CJ3A 1IKYB 4DL6A 1XK8A 4AFFA 4PABA 3K8VA 2H65B 2DY1A 4DEZA 2XMAA 4KV8B 1PC5A 3AODA 3BKFA 1ZAXA 1NJXA 2I5JA 2F63A 3TJ8A 2AEMA 3DLGB 5KFCA 3JTOA 2BQRA 1YJRA 4A4JA 4PWUA 2RHQB 1KFDA 3IXQA 4AQYJ 4CZCA 2VASA 4I2PB 4X4OA 4W98A 1MMLA 3C8YA 2JSXA 4CNYA 3JSYA 1C1BB 2N4DA 2CQ4A 2YQ0A 3FSIA 4CT9A 2CJQA 3CUNA 3RRHA 1VI7A 4IH7A 2IM0A 2CG4A 2HGLA 2NCKL 4OI3A 2GJIA 2NSCA 2AEJA 5B0GA 5H9FJ 1N8RT 1I3OB 3GJSB 1RWUA 2F4FA 4JI7J 2RDDA 3MM9B 4G1PA 4WIIA 3HX9A 4DV2F 2DNPA 3ET6B 2DY9A 2G2YA 4OX9F 3OD2A 1TZ0A 2GNKA 4OYIA 2ZUAA 2IM3A 4O23A 2QSWA 4FYWB 4ZJLA 2HNZB 1YJVA 4IOCQ 2H5IB 1FVQA 4QOTA 2WCXA 3I31A 2VQFJ 1S57A 2GO9A 1B0VA 3KUEA 3J7AN 4X64F 1DURA 4RBTA 1JLGA 1H6KX 1HLWA 4CNZA 3IA0A 3CCZA 4DR5J 2BV3A 1WSVA 2KDOA 3HULA 2ZOMA 2NPIA 2KHCA 2QZ8A 2MY8A 4FNHA 3OR1A 3JQJA 2XCPA 1S6QB 4JI1J 3IBWA 3PYFA 4FYVB 2FLPA 4RBUA 2DK2A 1UP1A 5IV4A 1ZA2B 2QC3A 3MECB 1FRIA 3T9ZA 4P7TA 2V8VA 3PFOA 1W25A 4I7FA 4C7QA 1ELOA 1LWEA 4RUHA 3VGTA 4YY3J 1UWBB 1VRQC 1Q79A 4WF9Q 4M5DB 3I0RB 2IM2A 2W9AA 1XERA 4WP8A 2DNNA 3FCVA 1H7XA 4W90B 4AL7A 4KC5A 1Q8LA 4ELVA 1U0HA 2UUAJ 1MMDA 1SJQA 4G65A 2OFHX 4JB8B 3UCGA 1S48A 2KL8A 4PUOB 4RW9A 2RSQA 1ZS6A 2E5GA 4LREA 4L6V3 2MQMA 2M7SA 4DLEA 2OGUA 3MDFA 2XLKA 3B6BA 1ZPVA 3JSMA 2HMIA 3CJQA 3W1YC 3R6LB 5ETSA 2RUGA 1N5YB 1S97A 4J37A 2O66A 1XR5A 1PBUA 2YWWA 3OVBA 3K59A 1EARA 3UI3A 3KK1A 4QW9A 2Y1IA 5DGBA 3IM8A 4OI1A 2CKWA 3CF5Q 4EU0A 4H4KA 5KFVA 3K5MA 3AOCA 5ETNA 4CH7A 2DR9A 4LBPA 2QA2A 3UE2A 5KFNA 2J0WA 3A8EA 4CDIA 2MY7A 3KYLA 1KBRA 2YVSA 1BQXA 4ZVFA 3WBZA 4C8YA 4XK8C 4ED7A 1TKDA 3QJPA 1SJRA 2OPQB 1PYTA 5J1PA 2OPSB 2DYAA 3Q24A 3PKYA 1U25A 1IKVA 5H1SV 1OPIA 2XMJA 5ETOA 2WHOA 5GAHU 5H9EJ 2F4VF 2MLZA 4KGVB 1U1QA 2VONA 2Q6BA 1SH3A 3P5BP 2AKWB 3ZTPA 3SDEA 3LANA 4RW7A 3M2VB 2EVZA 1KTVA 5CYMA 4ZITA 3OTCA 2QL5B 3QIPB 4DUYF 2VL1A 5DLFA 4ZPTR 4KH0B 2GHVC 2Z30B 2XHCA 1CSJA 1FKPB 2M2BA 4TYAA 3DLHA 3MAQA 3TJAA 5IXUA 2PC6A 2CUYA 3P5TL 4QQBA 3ZTRA 3T5HA 1IBLF 4YDDB 2EBGA 3PX4A 4EBEA 5K5MA 2MKKA 1MW7A 1V3ZA 4AD6A 4C48A 2CPZA 4DV5J 5E3PA 1VRUB 2EC2A 5KT5A 2IAJB 1NO8A 1ZOTA 2ZC4A 4K5RA 1RWNB 2B43A 4HACA 5LOQA 5G4DA 2GAGC 4Z7CA 1JJCB 1TL5A 4LSNB 2V50A 3JTNA 4WKYA 1WC4A 1QSSA 2HHHJ 1RU2A 2BBEA 4HYKA 4Q44A 2DNZA 2KHDA 3ZNJ1 1EKSA 4KKOA 4L75A 1BQNA 3FFIB 2YY3A 4EBDA 3DM2A 1F2HA 1VLYA 5F8JA 8AT1B 4IO1A 1QVGR 2CJ9A 4YDXA 4IFVA 1FWLA 3H5UA 4AYBD 5HJYA 4HEA9 2Q3PA 3POTA 4GO5X 1WOOA 3H98A 2PMZD 2PN6A 3VAHA 4EYHB 1HYSB 1SL2A 3DOMB 4ED0A 5LL6d 4KFBB 2B5JA 2WVFA 2EKNA 3A13A 1T95A 1YJTA 4A47A 1YHQS 3MMAA 4DUZJ 4N77A 1FFWB 2M0GB 1RGVA 1YJNS 5AE1A 4PPDA 4NZ6A 1XN9A 5FDLB 2YKNA 1FERA 3DLKA 1RK8A 3KJVB 3HSDA 1R6VA 2EFVA 2OP5A 5CD4H 4M1KA 2DRAA 4KY3A 4Z2XA 3NP5A 4ZVOB 4ED1A 1Y00A 4GVBB 4NPOA 3C15B 1S0NA 4EZ9A 2P9EA 2XI3A 2XMUA 3EDQB 1YI2S 4DL0C 4TQSA 2QMUB 3R3TA 3AOBA 4K50A 4DPUA 2NXNA 1U1OA 1S79A 3HHLD 4ID8A 2F8HA 2Y8WA 1JQGA 2B8PA 1BGXT 3IWXA 3DDNA 1S1VB 2BKOA 3ITHA 2OMOA 1RT3A 2M5YA 3TA1A 4F67A 1SC6A 1WUUA 1Q7YT 4X62F 4A8FA 2YWGA 3MTJA 2OPRA 1WACA 6FDRA 2ZKUA 3FEXB 4JI6F 1EKRA 4FF3A 4ES1A 4MKYA 2NXUA 3QATA 4K0KF 3H8YA 3C3LA 2ZKTA 3GJTB 2UXBF 1OS5A 1UEVA 4UF4A 4XPEA 3HD1A 3BQ0A 3CE8A 2HGMA 3QT6A 5A6PA 2YWFA 3UN2A 1JLBA 3K5PA 4ZP7A 1TTHB 2WW4A 4M5IA 5IQQA 1S1XB 3QT8A 3Q86A 5K14B 1TV6A 3Q22A 1DARA 1DTQB 2C2ZB 5KT4A 3RAXA 1CULB 5DZ7A 1JLFB 4FF1A 2ZBIA 2W7PA 5D77A 1K1SA 2OIHA 1YRTA 5DO2A 2KJVA 4RW6B 1FRMA 3DMJB 1X5OA 3O44A 3HVTB 3GR1A 4USVA 2QLJB 1RWOB 2MGZA 3ELHA 1HNZF 3JAMY 2E1PA 2EXUA 5DQHA 4GRSA 2HHXA 4JI0F 3GONA 4DSFA 4A8SA 4LF8J 2RS2A 2ATLA 1HMVA 2FHJA 3OR2B 2DO4A 2V6AA 1S6PA 2XS7A 4BC9A 3PCOB 1RWVB 5CYQB 1RT7B 3C6UA 5EGYA 4J90A 5IC4B 1S10A 4ELTA 2JZ5A 2F8EX 3KLEB 3BREA 1Y0HA 1R43A 2RDJA 3G4SS 1T9UA 4H4MA 5I3UA 1SQEA 2LQJA 3DRSB 2DGXA 1QUVA 2Y1RI 2KM8B 2CADA 2LXUA 2YNGB 4QW8A 2BRLA 3M8YA 1HBOA 5J2PA 5KG5A 5F3ZA 2VC0A 2GW8A 3V81B 3TR5A 4DZ6A 1M1GA 3DLEA 2DGVA 3AA9A 2UXDJ 1CC8A 3OUYA 4PQAA 3T1AA 1WF1A 2HAFA 3MD1A 1HWKA 3CJ5A 2ALZA 2A3JA 2DH9A 3MR7A 4OJHA 1W7WA 2KZZA 2D69A 4OZ3A 1N4LA 4C8MA 2KYZA 3G82B 2WOMB 1F9FA 2HNDB 3Q0AA 4PG7A 5GAEU 3OBIA 3OTEA 1N52B 2MKHA 4N5SA 2X1FA 4MIBA 4P72A 2NR0A 1HR0F 2EFQA 3D6MB 1RCOB 4ZN3A 2Y9HA 3WIUA 2FZGB 4X4SA 3TX0A 4ECYA 7FDRA 1OY9A 4NCGA 4O4GB 2V2KA 5EUHA 4JV5J 3DOLB 3LWLA 3KUHA 2VG5B 2DEJA 1FRJA 4F8RA 1CJVA 5A0YB 3SIPB 2ADCA 2YKOA 5A8KA 4WWSA 1SKRA 2Y1JA 1DLOA 3BN7A 2XY7A 2DVIA 2JH3A 4LBHA 1NK5A 2R8KA 2VG6B 1R8CA 3M7VA 1R89A 3NOGA 4J9UE 2WW8A 5LXYA 1Y4ZB 2ZBRA 2HFOA 4A8MP 2DIUA 1LW2B 2YPYA 4F02A 3IRWP 2AZ1A 2NZCA 3C14A 2MDAA 2QTWA 1HBNB 4FP9A 1NMEB 4DQQA 4FVCA 4DS5A 2JVOA 2YH1A 2UV8A 1HQEB 2AGOA 2RRNA 1IBKF 1KR4A 3CJRA 2EPIA 3CW2C 4PG6A 3BM7A 1GH8A 3KMQA 2H1YA 2FJWA 4LT6A 4M5NA 2FJXA 1E6VB 1RKIA 3EGZA 1GQEA 3TAQA 3DRRB 1GXUA 1RTIA 1YSJA 2CPDA 2CQDA 1M5VC 3W7BA 4LF4J 3MCMA 2KZMA 2D41A 3MD3A 5D0EA 1S59A 4CM0A 3OPKA 4C3MA 3TNVA 4JP8A 4V19X 3V4MA 2LCWA 2G13A 3Q8UA 5KFEA 2E1AA 1TL7B 5I4MA 3VGSA 4E8UA 4Q0BA 2C3MA 3MMCB 1S9GB 1QTMA 3E01A 1EP4A 3TEHB 1HBMB 1SQFA 5C2GA 4RU9A 3EVOA 2OD4A 4PAAA 2GQQA 4ZCIA 4F25A 4WFBQ 1B0PA 1Z2ZA 2HZCA 4CTAB 2XZWA 5A8RA 3LGNA 4I0WA 1HNVA 5IM0A 5HBMB 2ZBQA 3ZZRA 4EK2A 1B3TA 2H48B 3BBCA 3MM5B 4NLSA 1JNZB 4H54A 4USTA 1BY9A 3O1LA 1WF2A 2A2CA 1MROA 4QCLA 4Q43A 4CRJA 5KFAA 1B7YB 1CS4B 3SFUA 2KO1A 3TI0A 4IO9Q 2GS8A 1O51A 4KR0B 1UETA 1S49A 4MFBB 3CCRS 4ZJQA 2IRXA 2ZH5A 3BGRB 2E9TA 1UWAA 4ZVUB 4PXDA 2BOPA 2QLFB 5L1LA 1NKCA 1KN6A 4O44B 4NLVA 4ZN1A 2HFNA 3THTA 4QR2A 4AE5A 3T1HF 4P10A 2WONB 2CPYA 3QBCA 3G2XA 3OLBA 1R0CB 2HS4A 4LRAA 4RNOA 1QE1B 3QT5A 3T1YF 3T5KA 4XDDA 2GVZB 2J9EA 2BA9A 4ED5A 3M6WA 4K2JA 2BJ8A 3QIDA 2AGPA 4WFNQ 1MN9A 2VIHA 1RXOB 4PEOA 2GMLA 4DFKA 4DF8A 1R0AB 3P49B 3GG0A 5FLXY 4J9LA 3ZC4A 1K1QA 1MLAA 4LUBA 3T6JA 4ZHRB 2BJ9A 2HRUA 2QRRA 2ZNYA 3KLIA 1D9DA 1QAJA 1K0VA 2A10A 1RYSA 3QJLA 3NOCA 3OVSA 2JX2A 4LSLA 3EDRB 4F4AA 4ZP6A 3LPEA 5J2MB 4OV6A 3RTVA 3FSXA 1TFYA 2V4JA 4CO2A 2IDEA 2YX4A 1RU1A 2XI2A 3BJYA 1HI8A 1X31C 3KHLA 2YWEA 4QYZJ 4IOAQ 5K9FA 5C2CA 2OUGA 1YBAA 1QVFR 5GAGU 2FZCB 4MK7A 2ZBCA 3D7SB 3MPDA 1TL1B 3CDAA 2DHXA 5EN1A 3MR5A 1WHXA 2WZ1A 3J7YI 4I1TA 5FJ4A 2AEFA 2ERRA 1N0UA 3FSYA 4KHPF 1EAYC 3NGUA 3I0SB 4KJIA 1XIQA 2RHSB 3TARA 1GXLA 3V4IA 1QJHA 1B70B 1NRKA 1XMBA 3G8TA 3K5NA 3OXFA 4DPXA 3JAMU 4G1QA 2BYCA 3LP0B 5K20B 1M5HA 4IDKB 1TVRB 4L74A 4DR7F 3RUBL 4NA2A 3DDIA 1SPBP 4NRUA 3I4HX 1FKOB 4YR3A 5J2QB 2FY1A 2IMOA 1UA0A 3KWMA 3HHDA 1R27B 1F5CA 1H74A 3V6HA 4LFCJ 1PAEX 1JXVA 2QJ3A 1Q0NA 3Q8SB 4ED2A 2XWYA 2AMCB 2BMBA 2X1BA 1KONA 1XMOJ 1Y5NB 5JXSA 4C11A 1FJCA 4Y0FA 1P9YA 4U7CA 2FYXA 5AT1B 1S1TA 3W2VB 2VDHA 1RP5A 4P74A 5LSLA 4L3KA 4PKDB 4J5OA 1D8YA 4LFAJ 3CO0P 3M8PB 1F5BA 1L3UA 4C8LA 4Y2CA 2FZKB 2OD6A 1RZMA 5HN0A 3O3LA 2YNFA 2B56A 2ZD1A 5ETLA 1G4CA 4RX6A 5K8NA 3C6TB 1ZAWA 3U7JA 4UOGA 3TJ9A 2R2RA 3DGVA 3F0NA 1HPZB 5E2QA 2VFRA 2LDYA 1B7FA 4NLGA 4B3TJ 1N33J 1R8AA 3SSQA 2QN6B 1S0VA 6FD1A 1V9OA 2B9EA 2DNQA 2DHAA 2BKPA 1IKWA 1QY7A 5HMXA 1F9HA 2ZZMA 3RB3A 1J5EJ 1HIYA 2QLWA 4DX7A 5KT6A 1S7IA 4B3MF 3KHHA 2QE5A 4CLZA 4Y2KA 1S1UB 3BKUA 5KFGA 2CFXA 2QFJA 1EJ7L 4WYLA 4WU2A 1OWXA 4ELUA 2IRUA 4WKRA 2ROGA 3ETOA 3O6QA 1HQ2A 3WX8A 4BC7A 1F3FA 1PC4A 5IWAF 4PG8A 2KXFA 1S99A 3PJ9A 1KEKA 1XWLA 2GZOA 2K06A 1AZSA 4C8KA 2M9KA 3SQGB 1FDNA 1RTJA 2QMXA 3H42A 5KFDA 3SCIE 3SV3A 1AROP 4X4VA 2GIFA 2IBOA 4F0HA 1NSKL 5HAOA 1P1TA 4WFZA 2J5AA 4ZCMA 1JLEA 5CYJA 2ZH1A 4BDPA 2D7SA 1Q95G 1TAUA 3V2UC 2R7VA 1X9SA 4B17A 2J9DE 2F8MA 4LF2A 1EQ0A 5B09A 2ACMA 3V6DB 2CQPA 3UO0A 3LWMA 3HSGA 4YEAA 1CVJA 3AJ1A 4C2MA 4TU7A 5BYRA 2K7KA 2OHDA 3N9UC 3PO5A 3AQOA 2NXEA 2ASJA 1X5PA 1X4GA 4ZLPA 4ERDA 4QZVB 3QO9A 2Y8YA 1UPMB 3RB0A 4NYOA 4C0BA 1AT1B 2P6SA 2AW0A 4LVNP 2FDNA 3O2IA 3DDKA 3EVWA 4Y2MA 1LWFB 5F8IA 1NHVA 1C1CA 3KK3B 2JL9A 2OTJS 5D4LA 4DV2J 5CZXA 3R9LA 4LVOP 2AT1B 1S7HA 4OX9J 4RKUC 2KXHA 2AYBA 2X51A 3UNGC 3NGRA 4X4TA 1DQ9A 2HGNA 1FJGF 2L9DA 4NI2B 1JLAB 3Q89A 2YNHB 5DS7A 1LNQA 1HWJA 4K8RA 3GCWP 4X64J 1T7PA 2V9KA 3D1QA 3CDWA 3W5YA 3R5BA 4C97A 2DRDA 1UEKA 3KLVA 2MZSA 2KVQE 1UJ4A 3I5BA 5HP1A 1KDNA 1KC8T 2DR8A 3QT7A 1X5SA 1G7CB 5KFQA 2DKOB 1NZ8A 4DL5A 5KFOA 3LP2A 3UDCA 2UVRA 4B3SF 5AE3A 3W63A 3ZZYA 2VC1A 2CZVC 4FVMA 4QWEA 2YNIA 1FK9A 5CAAA 3SEOA 1RWWB 1I5OB 3ADAC 3FK4A 1Q5YA 4RUCA 2KN4A 3G8SA 4Y28C 5CQGA 2R7OA 4C0HA 3LGMA 2N3OA 1RTHA 3B4DA 2JFDA 5D8HB 2AHOB 4YFUA 2QA1A 4C8OA 3K17A 4B3RF 2RAQA 4TLQA 3EGWB 4NLPA 3GFHA 4DL7A 5DDOC 1YJWS 5ADZA 2R2TA 4YR0A 4I56A 5LT5A 3NXZA 2GMJA 4CO4A 3TAMA 3OW2R 3EJMA 1NH7A 4LRBA 3OL7A 3H4BA 3I9V9 2J9CA 3MFIA 1WEZA 3BBBA 2FPHX 4L3NA 4WP3A 1CEZA 4DQSA 3CCQS 4TQRA 3BPDA 2DCLA 5HJXA 1TUVA 3MMBA 3B78A 4FZVA 5G0RB 2JEFA 5T7LB 4FPRA 3CTRA 4KGMA 3QGGA 3HHLB 1MWYA 1WORA 1ZZFA 3PV8A 1Y3KA 2FC8A 4CWBA 3DKDA 2I2YA 2J0XA 3A8JA 3KJQB 3HVWA 1L3KA 4A8WA 2X1GA 2OAUA 2AYMA 3M6XA 2XZDB 3PYGA 1RT1A 4OHZA 5DM7Q 2G0CA 1SC1B 1C2PA 2AGQA 1ZA1B 1A6LA 2OFGX 3NLCA 3PKMA 2L08A 2F4VJ 2BR0A 1UJ6A 4RR5A 3ET6A 2D1CA 2PDAA 1X4BA 1X4DA 3KHRA 1F0XA 5J1EB 1S9EB 2W9CB 2D9PA 1Y7PA 4YUDA 3GB0A 3KK2A 1WEXA 2DB1A 3MEDA 1SJ3P 4P52A 4HI1A 2MZTA 4DUYJ 4JUZA 1Z4UA 2F9JA 4HI2A 4ECWA 2W1BA 3VVTA 5HQ8A 3PRBA 4DU7A 3BGFA 2RF2A 2APOA 3AB2B 1AB8A 1IBLJ 2OPPA 3D4JA 4HT7A 2CDRB 1REGX 1CJKA 1VCTA 1KD1T 3MECA 3DRYA 2HEKA 2MKJA 4OX6A 4ZPVR 4TKTA 4C6AA 3QAEA 4PRFA 4FF4A 4USHA 2HS3A 3QZ7A 2B3TB 1RCXB 4OHWA 4UY85 3I0RA 2LQ5A 3OTBA 4OYXA 3HXMA 3QWUA 2BE9B 1TQLA 4DL2A 5ETVA 3AD7C 3G8QA 2HRYA 3PNIA 3QQCD 1U26A 2ZITA 1SUQB 1UKUA 2RMLA 3GYNA 3D6FB 3MOJB 3TUPA 3RYLA 3WIVA 3OVAA 4YS2A 2BZ2A 4CLPA 4KGXB 3QPIA 3CCVS 2IMWP 2AJ0A 3U02A 3ZXWA 5CA5A 2IJRA 1UVKA 3ULHA 3JYTB 1FDAA 1TMMA 2G1HA 1NHUA 1TKTB 3BPSP 2ZHOA 1TK5A 3IRXA 3N4WA 4UY8T 1VDHA 2OKQA 4K4TA 2VA3A 2PSZA 3MM7B 4UZBA 2M52A 1PBAA 4ZLJA 4J9QA 1IWGA 4OL8A 2B6AB 3M2UB 1JLQA 1C4AA 4TYBA 2IBKA 4ZCLA 2ZH2A 3MFHA 4WE1B 2YKMB 3MR2A 3DRPA 2X1AA 2HVIA 2DGUA 4R0EA 4AXIA 1P27B 4DX8H 2XLJA 3MAAB 2K2PA 4JV2A 5KFHA 1F2GA 2OPSA 1H3DA 2MZJA 1NXIA 4OYPA 2PEHA 2VBYA 3W64A 1IBMF 3DLBA 4MJKA 3V6KA 2HHQA 2E1CA 4DL4A 4NE9C 4FBTA 4ZIWA 4X62J 2XBPA 3N79A 3G71S 1XQIA 4JI6J 3KHGA 2P9CA 3FUYA 2B4OA 5HANA 4Y2IA 5HK4A 4IG3A 1SKWA 2XM3A 2B4UA 3D3CJ 5CABA 2UXBJ 2RU9A 4MK8A 1NJYA 3FJ2A 3O8WA 3KDOA 2I5JB 3PRDA 3M8WA 4DMZA 4J9SA 3L7OA 5ETRA 2VV5A 1EETA 3IFEA 4WZMA 4MK9A 1K47A 3PXGa 3MCOA 3TVKA 2L48A 3R5JB 3GFYA 2JFKA 3NMRA 4YP3A 1VBYA 1BMQB 3HFKA 1NPKA 4CLWA 2J0SD 4XDCA 4DPWA 1DAXA 1RWMB 2KRRA 2XWXA 1KOOA 4UUWA 3UQSA 3HVAA 4L72B 4WIQA 3DRXA 5C24A 1HNZJ 3R5DA 3G96A 3BDPA 2QEXS 3Q2SC 4BCAA 4M95A 4JI0J 1QD1A 2BXJA 2IFXA 2HQGA 3W8GA 2R8IA 2VDIA 3JQMA 5KAKA 4ED6A 3ONQA 4U67Q 1FFSB 1CJTA 3W9JA 3M32A 2YX7A 2DH8A 2WBMA 1RKJA 4NRTA 3OTDA 3KLFA 2NXCA 4X65F 1YJ7A 4JI8F 1JLGB 3U27A 1FRKA 2W4PA 4ECUA 1FTRA 4N41A 2IHR1 4U7UD 3AXKA 4J9OA 2LEPA 1Q8BA 2HRTA 1F5AA 4F4WA 1HNWF 1HI1A 3ZTOA 3OR1B 3IWLA 3M30A 3S1TA 2FJVA 2JEIA 3BO3A 1SCJB 4J9NA 1AFIA 4BWMA 1AUDA 4I7FB 4NXMF 1LWEB 1UAWA 3HJFA 3K5LA 2CIMA 4PCQA 3HMJG 3TO8A 5IV3A 2W2OP 2GX8A 4GKJF 1XBWA 1URRA 1HR0J 2XNQA 1U0HB 1WKLA 2M3DA 3SQOP 2BVZA 4Y6IA 3R1HA 1S1VA 2VFVA 2A0FB 2QO3A 4RW9B 2G4BA 2RQMA 4NL5A 2CPJA 5KT7A 3KLGA 5RUBA 4OI2A 5B08A 1LWCA 4KGKA 3ZZ0A 2W2MP 3N01A 1LEOA 2YWHA 3JQKA 3JSMB 4JI3F 1U2FA 2HMIB 3GR0A 3R97A 2VPXB 4USWA 3AHPA 3SV4A 4B9TA 4WBFA 1WJ9A 2KH9A 1RHUB 5KOWA 2P2CB 3PJXA 2E66A 1UZDA 1RA7A 4A8QA 1NUEA 3KK1B 5BR8F 1FA0A 2UVUA 4FXWA 3I82A 1VBXA 3KNGA 4C0OC 3WC0A 3BZQA 4GC6A 2I0XA 2LU1A 3NNHA 2BACA 1NBEB 3MUTP 1IQZA 2J7WA 2W8KA 4P2XA 4QU6A 1JLCA 3DOKA 3PJWA 4RW6A 4M5MA 2MQOA 2LQBA 1IBKJ 3T41A 4HDGA 5KOXA 4ID5A 4DPOA 1RBLA 4ZPDA 4CIOA 2CWXA 1IKVB 3LH2S 4ZPAA 1RABB 2XYPB 1X7VA 2DNYA 2BUNA 2XMWA 3GE9A 2I9SA 1FNOA 3SDEB 3OR2A 5MLCV 3NGTA 1R8HA 4RW7B 1VGYA 1UMJA 3OJUA 5CYQA 4OHXA 5CYMB 1N6QA 4C3KA 1KFSA 4ZKAA 1FKAF 4RNHA 5KFJA 5J2NA 4MAKA 2EEYA 4DR3F 2ZH3A 2CPXA 3A3PB 1FE0A 3TRGA 5HROA 1L3SA 1NSPA 2YNGA 1X8DA 3B82A 2GQCA 1PJ6A 2MLXA 4CI0B 4K4YA 1E6YB 4WJBA 1WC6A 4NYZA 4MIAA 1M0SA 2YKQA 2MZ1A 1CQNA 1SJ1A 3VCDA 3KMSA 4PQUA 2Z2LA 4OZNA 2E1RA 4WK3A 4Q2MA 3ENQA 2NPFA 3QRQA 4EGLA 1FO1A 2FHKA 4B3OB 3H2UB 4JI4F 1ZM2A 4HACB 2HS0A 3H40A 2F7VA 2J9DA 3IWNC 3PW2A 5BJRA 1EQMA 1PKUA 1WWHA 4DV4F 1AUSL 3G82A 5KG0A 1LQ9A 4UT4A 2R2SA 4KKOB 1BQNB 2JDJA 4QIVA 3PYEA 2WTFA 3DM2B 3BN4A 3L7PA 3KFWX 3CJ8A 3GJRB 3HKZD 2YX1A 1UA1A 2AJ4A 4HHJA 3POTB 2B8QA 2IPOB 9ATCB 4NLQA 2OMLA 3IC1A 4OI0A 4U9RA 2HKEA 5CZVA 2FQQB 4DFMA 2B5JB 4K7QA 3MAHA 1SBRA 3T1YJ 2DEIA 3OL9A 3MMAB 2YXLA 1N5VA 3M4XA 3R5AA 3UVJA 1I94F 3QRRA 4PYDA 2QMWA 2AX0A 4A46A 3GU0A 2IVYA 2YKNB 4QIGA 3DLKB 4I6WA 2COLA 1U1MA 4HHUA 1T11A 4OHYA 5E3CA 5ETKA 4FN5A 3HFZB 1QTNB 2RQ4A 4EO8A 1UFWA 2C2MB 1WKJA 4LRCA 4DFPA 4FDFA 2CJXB 4DV6F 4F0MA 2SXLA 4KRWA 4KO0A 4AL5A 1T02A 3R2CJ 4MIWA 2HG4A 3RAQA 1HQUB 2CDQA 3L9ZA 5HVHA 1RSCA 3G6ES 4OIXA 2IDLA 5LMNF 1VRTA 2CQHA 1VQNS 1ZM3A 3TVYA 1N5QA 3N5BA 3ITHB 3CCUS 1A0OB 1T9VA 5KTQA 1RT3B 2DGOA 1WG4A 4IR1A 3VAKA 1E6VA 4N7TA 1EZZB 4HTJA 4P2FA 1RWXB 3BEGB 5B0DA 2H51B 4F26A 3HPOA 5DG7A 2BDPA 5JUMA 1TL3A 3C19A 1O5JA 3RBDA 3OFHA 3AY0A 3PRVA 5LJ5Y 4K4SA 3M2RA 3I56S 3ENWA 4UOHA 3BGLA 3M8QA 2KXNB 2MKIA 1UVNA 4KHPJ 1O6XA 2L41A 1JLBB 1TAQA 1NEEA 1ROFA 2XG8A 4C8NA 1WHYA 3FVYA 3RJMB 2ILZA 5H9FK 4IKAA 4GC7A 1TV6B 5I42A 3N6LA 2RJZA 4N8OA 3FC9A 4OYBA 4DR7J 1IM6A 3TYTA 4XPCA 2QV6A 2FLOA 4QIFA 1ZETA 1VK8A 4TY8A 4ZP9A 2V8GA 2LP4A 1PILA 3NL0A 1LK5A 3VHQA 2U1AA 3RAMA 1GTEA 3CDUA 2UU9F 3KNAA 3A4TA 1S6UA 2DNGA 3T19A 4ZVHA 1K73T 2MGZB 2EI5A 2BX6A 3W9IA 1VISA 3FCHA 3MM5A 3PACA 1WEYA 1W2BR 2FHMA 4CT8A 3N6NA 2AZ3A 4ATNA 1HMVB 1S6PB 4X4RA 2HW3A 2I38A 2E5LF 4JV0A 2V67A 5KFXA 3CMAS 2J6UA 4DR2F 2RB7A 4O44A 2XMMA 4X4PA 1FVSA 5ITHA 3CJ4A 4LR8A 5IC6B 4H4MB 3SCJE 4ZA1A 3ZTQA 1QE1A 2VPWB 2PI5A 2V68A 4WFAQ 3DN9A 5KG6A 1HBOB 5J2PB 2GHPA 1FD2A 3UCZP 4DV1F 1NJZA 2V34A 3NCQA 2R7XA 1QSYA 2DJWA 4EEYA 1VQPS 1H72C 3IP0A 4MKAA 3Q8QB 1K8AT 4RO0A 1RACB 1VHIA 1FE4A 3GTYX 1T0TV 5EX0A 2VHGA 2AQ4A 1R0BG 2AV5A 5KG1A 4NXNF 3GQCA 3CIZA 4LSZB 2HQFA 2KJWA 1FTCA 3DYAA 4EYIB 5KFZA 4U8VA 1R6YA 3CCMS 1VC5A 2C2OB 3H7HB 3IO1A 1FWKA 3NEKA 5D78A 4NCGB 4RNNA 5SUHA 5IWAJ 2CQBA 3LAMA 4A8XA 4DCPB 2B7BB 4D3HA 3L95X 5L1IA 2N4CA 1CJVB 2YQ3A 3D68A 4DFJA 4NWBA 1MU2A 1S1WA 1T9WA 2R4FA 3EWGA 5D15A 1YLXA 5A8KB 3US5A 1DLOB 4DG1A 3SFGA 2CJYB 4KB7A 5D6GA 3EZ5A 4BHQA 1F60B 3C16A 1RADB 1Z2LA 1BD6A 2EG2A 4ICLA 3QWPA 2ACYA 2W25A 1BHNA 3OXGA 3GIKA 3DHWC 3HT0A 5ETTA 1IM4A 3C14B 4LF9J 4MKVA 2MLYA 1TK0A 4RJVA 1ICEB 4ZVSB 3RU0A 2G1DA 2HK2A 3NWGA 4A8KA 5DG9A 1V5VA 3D0HE 2VOOA 2ROPA 2JWNA 1R31A 1PCAA 2QYCA 1U6ZA 5F8MA 1RT4A 5THWA 1MMNA 3PX6A 3QFWA 1WF0A 3KTQA 3Q8VA 1F3VA 2BW7A 5E3AA 3MR6A 1RTIB 2RQKA 3NCRA 1GXTA 2KB2A 5DJBA 3LTOA 3W2VA 5F8NA 2HHUA 1Y11A 2B9YA 4I68A 4DR4F 3E3XA 3R7BB 1VQKS 1RHRB 5EWFA 3IR6B 3UCUP 2MSTA 1RT5A 2U2FA 4Y3CA 1FJGJ 1NH8A 4RW4A 1APSA 5A6WA 4Q0BB 3C6TA 2KU7A 4IQMA 2JHEA 3HF5A 2DHGA 4NEZA 2QSFA 1NK7A 3NBPA 5L38A 1EP4B 1MN7A 4UUXA 3CMQA 1VLOA 2V4QA 2JLEA 3FBEA 4YMEA 3EMTA 2ZH8A 5CH7B 1X4EA 2VA2A 4Z7YA 3U1MA 4DS4A 2MJUA 1J27A 3T6BA 2KRBA 4B3SJ 2FLNA 5A8RB 3QNWB 4R8UA 1HNVB 5IM0B 3VQSA 4XIUA 2XMTA 2WB1D 5M2UA 3BO4A 3FBBA 5I3PA 3QYYA 2EW9A 1P8GA 1FRHA 2W2QP 3HCXA 3L7UA 2DNLA 2VJUA 2M4MA 1MROB 1NCLA 1REVA 2JOQA 1WTBA 4F2SA 4E98A 4DPTA 5AXNA 2N7YA 1XJWB 4N76A 3A3NB 2DTJA 3EICA 3J81U 2BJDA 1NDCA 2MHNA 3H25A 3DGPB 2HZVA 5DG8A 2F3JA 3BYRA 3SCLE 1UW4A 2M70A 5DGAA 2GC8A 4M8LA 1Q78A 4B3RJ 5L39A 2F40A 1GX6A 1IXKA 4WTYA 3I9ZA 1S77D 4GKKF 1FWPA 1VQLS 4M5LA 2KKHA 2RKIA 3LF0A 1GMUA 3SQGA 4EO6A 4PXBA 3NNCA 2QG9B 2AP6A 1B64A 4FS1A 4K4UA 1EB0A 1YBUA 3UDLA 2ZVSA 4I4BA 5IT9U 3RBZA 2UXCF 3HJVA 2NYHA 5K8MA 3FRZA 4Q5VA 3LP1A 3SCKE 4K5SA 1V5IB 4CLFA 2E7VA 3ZZUA 2HNYA 2K7JA 1SVDA 4OFZA 3MCNA 4YN3B 2BANA 4KTQA 1VOMA 2G0JA 4RBVA 4FKXA 4TY9A 4QJVA 2OEMA 5KFKA 2CNOB 2N3LA 1OY6A 2O67A 3MUVP 3GIJA 1Q4RA 1MWQA 1FF2A 3S01A 4B02A 3GCXP 2Q79A 4F0KA 4NLWA 4ED4A 1Q8KA 4DQPA 1G6BA 3HKWA 4DI6A 5B7WA 5JMNA 1YK9A 3KK3A 3W5XA 3M9OB 3KLHA 3EPIA 2NYIA 1HD0A 4HL9A 3K5OA 3R8YA 3KJFB 1JWWA 4RW8A 1S6OA 4OJGA 4ZVQB 5AJ3J 3CC4S 2BKNA 4PWDA 3Q8PB 1H7WA 1C0TB 1JLAA 3V4IB 2LA6A 4F3MA 4LF6J 1OIAA 3CIMA 1N36F 5HMWA 3THVA 4J91A 3R5GA 4B9MA 2X3DA 4QWCA 2PMHA 3DU6A 5IOLA 2PE8A 2FVSA 2HBYB 3UFCX 1HNIA 4ZVGA 1WI6A 2R7QA 5A8WA 1PG5B 5GAHI 1IR2A 4KQZA 2DNRA 2DGSA 3CO9A 3IG1A 2CZ4A 4P2SA 5HMYA 2K1RA 2YH0A 2PFDA 4CLKA 4C11B 3G87A 1DHMA 3MM8A 1S1TB 1ULRA 4ZVRB 3BSCA 2AJFE 3JXOA 4F2RA 3GYGA 1RAHB 1D0EA 2W7AA 3CT9A 1WD6A 5F8LA 1KQKA 2AIRB 3GIMA 3OJSA 4EUVA 1TUWA 2DPJA 1DTTA 1H98A 1U02A 2YNFB 3CSKA 3ISNC 3WC2A 2ZD1B 2V69A 4DBQA 4IH6A 3TQ1A 1FNMA 3WZ0A 3CD5A 3L4BC 3J80Y 1NB7A 2KFZA 4K2XA 4N56A 2MXYA 1IBCB 3D5MA 3F56A 1N34F 1B99A 1IN0A 4IR9A 1IKWB 1DQAA 4ECZA 4K4WA 2JLFA 3NWRA 2DR5A 1VBKA 4RWWA 2CNNB 3MHYA 1WNEA 1BQMA 2HBQB 2I1RA 3MEEA 2C28A 3OFGA 4AL6A 2ZOGA 4KIAA 3EZUA 5M2RA 5GMKa 3ILJA 1NK4A 3CJSA 1FXLA 1B4SA 2W8LA 1F9EB 4NX9A 3BKTA 1N56A 1IBMJ 2CQ2A 1XR6A 2AX1A 1AZSB 2HVEA 3AA8A 5DQIA 3M9MB 4J7CA 3P45B 3TZZA 1RTJB 1I1GA 1NAQA 3HD2A 4B9UA 2V8DA 3MEGA 2O3DA 4IYQA 3LGHA 4XO0A 3QSYB 1IKXA 2XSJA 1D9AA 2HLTA 1X5TA 1ZBTA 4M94A 1JLEB 3CJ0A 4M5HA 5T41A 1RAOA 1HHSA 2DR7A 2ZM6F 4HLBA 2GAHC 4WZQA 1H38A 2LA4A 4DR1F 2CNKB 3UDVA 2XSFA 3LUYA 2YWKA 4OZJA 1LOUA 3BQ2A 2ALYB 1IJEB 1RWKB 4M63A 2DNOA 4RU2A 4F50A 2DHSA 1CLFA 3EE3A 3W9HA 3F73A 5T14A 1X0PA 1QAXA 2R7RA 2GA7A 4NEYA 3N5FA 5E33A 1RLDA 3QO9B 4OYAA 3DLJA 3EGVA 4UW2A 1XMQF 2ZVIA 3CDBA 4LJMA 4K4ZA 5C42A 5KFMA 1D8ZA 2XLIA 3HP6A 3TA0A 1C1CB 3BH6B 4R5PA 1TKZA 4FYDA 1TKXB 2HAIA 1WHVA 1Q86T 3HHNB 2CVEA 4OZLA 2IJFA 1LWXA 5KFYA 3ILOA 3D66A 4DWIA 1RT6A 2N82B 1V6HA 1D9FA 3HHEA 4DDFA 1S9FA 2VOPA 1Q7LB 4MKBA 4X65J 4LQ3A 4JI8J 5HMZA 4IG0B 2FVPA 1VQYA 2A1BA 1WC5A 4U8YA 3GMGA 1R3NA 4I2QB 2FJEB 4ED8A 1HNWJ 1U8SA 2XGQA 5D3GA 1WELA 3LP2B 4QU7A 1VS3A 3TUIC 3CDEA 1WDDA 1T05A 2BM0A 2P9GA 3M1VA 3M2UA 4LF5F 1V3RA 1BE4A 2R8HA 2YNIB 2NZ4A 1Y5IB 2RT3A 1FK9B 2GGPA 2IA6A 4NXMJ 2O1PA 2VD3A 2YKAA 3L09A 2GFFA 2E5IA 1ZM4A 2FGCA 2BABA 4PR6A 2YKMA 1XEZA 1RAIB 3SI8A 4DLGA 2CNLB 3RG6A 3MAAA 4GKJJ 1MG7A 3DCAA 2FVRA 1VQ7S 1RTHB 2W9BA 3NGDA 1Y5LB 4DV3J 2MQLA 2ASLA 1N5SA 1KWMA 1C0UA 3EXCX 2QX0A 3KG4A 2W7OA 4ER8A 3K89A 4F3OA 2HVDA 2E5HA 3B4MA 3TAMB 3H4DA 5KG4A 4DSJA 2IC3B 3TZWA 5IFMA 4JI3J 5HATA 2PA8D 1X4FA 1NB2A 3I96A 1T3OA 2HK3A 4O0IA 3RRGA 1IR0A 4EMDA 2K8GA 3H5YA 4ZPWR 1FRLA 3UD3P 3T5LA 3W3SA 2VG7A 3CJKA 3NS7B 5BR8J 2PMWA 2B4PA 5IS2A 1SXLA 5GAEI 3MMBB 1YWXA 4R25A 4RWXA 1WSRA 3MM6A 3BGOP 3W2WA 3RGIA 1BLUA 4QYZK 3D54A 4I67A 1LFWA 3OV7A 1BWVA 3GG1A 1W26A 4ILRA 1PSDA 4JBCA 1Y10A 3CVKA 1RT1B 4BWJA 4ZVTB 2VBWA 4ZP8A 2GHWA 4IOBA 2XCAA 4F4XA 5DM6Q 1YKWA 2HQ3A 1XNQF 1OO0B 2QLXA 1HD1A 2LEBA 1NU4A 1RDRA 3VGUA 2C1EB 5EWEA 4IFYB 1YBTA 1UVMA 2EKYA 3IBFB 4TU8A 1HFEL 3FZ2A 3OSNA 2EFGA 3NGKA 3KK2B 1CC7A 3MEDB 5FIIA 2ZE2A 4ITSA 4DR3J 4NOHA 2XY6A 1KTQA 1X9MA 2UV8G 2RF2B 4USUA 2H4YB 3A1YG 2FJDB 2OPPB 1J5OA 2E7WA 1WOSA 1NLKL 4EZ6A 4CP5A 4JI5J 5BYSA 2Q43A 3GIRA 1CJKB 1S72S 3VR1A 1ITPA 1SIWB 2AJ2A 2ZH4A 1FD8A 3UR0A 2GVDA 3IS9A 1NDPA 2I6WA 5KFRA 2DNKA 4JI4J 3CJ2A 4KHRA 5BXIA 1SL1A 4KAIA 1HWUA 3C2PA 1U6FA 4R0JA 2XMKA 4DV4J 3PFEA 3NCPA 3J80U 2YPZA 3SXLA 1WDTA 5HLFA 1UCNA 2LQ8A 2R8JA 3TW0A 5GADI 3HT3A 2VB6A 1HBUB 4DUTA 5I3QA 3SBMA 2W4DA 4CCHA 2C3UA 4KE5A 3AAWB 2F1FA 1SH0A 3A8IA 3LAKA 5LSOA 3H0PA 4HHHA 3DXSX 2VICA 3D28A 4NCAA 3MOZA 1JX4A 1YRUA 2XY5A 1M5KC 1OSDA 2CXEA 2XYHB 3GYXB 4CLTA 1M5OC 2AF6A 3CEDA 5SZTA 1U2RA 1DBDA 4P6QA 3MUMP 3DI6A 2MQNA 5HVFA 4HTIA 1I94J 5L1KA 2AU0A 4TNOA 3IRXB 1JKHA 3IAM9 3BS9A 1AA1B 2WVCA 3TQEA 2R9LA 1YZ6A 2UVWA 4I69A 1JLQB 1TR0A 3AQPA 3VALA 2FHOB 2BJ3A 2LECA 3ZO7A 4LFBF 4P75A 1UVJA 3OL8A 4ECTA 3DC2A 5KFTA 5EDWA 4DV6J 4UOFA 3FGVA 2EK1A 3DRPB 3R27A 3RB6A 2EC0A 1RLCL 1SH2A 3THPA 3GFXA 3GILA 1FEHA 2HQIA 1X4CA 5LMNJ 1KQFB 1GMWD 2MB0B 1U2CA 5C25A 4ZK7M 3G9CA 2RS8A 3Q8RB 1JB0C 2OSQA 3FMBA 4DU8A 3E2EA 3JB9k 2CJAA 1MSWD 4IUFA 4CO5A 2IVMA 1T03A 2LU2A 1VQOS 1RAEB 2MKYA 4H4OA 3N6MA 3TA2A 4IG3B 3EPGA 2KT5A 2RE1A 2R7SA 3NGSA 4DSEA 3JTPA 4CYUA 1JNRB 3UD5A 1K9MT 3AXMA 3BR8A 2HHSA 5LM7E 1H2UX 3HM9A 1M5SA 3ZTSA 1EETB 3MWBA 4G3IA 1G3OA 4WTOB 4NLDA 4C4WA 3VWSA 4YOEA 1JXLA 5KG2A 2MYFA 1QM9A 4P9SA 1N32F 2XGPA 1E6YA 1OYDA
chains in the Genus database with same CATH topology
4NZ0A 1SBRA 2D3ZA 2FJXA 1E6VB 3FQKA 2B4VA 1RKIA 2XMVA 2W9BB 3EGZA 1GQEA 3TAQA 3DRRB 4C98A 1GXUA 1LW0B 1RTIA 1U47A 3OL9A 3MMAB 1YSJA 4X2BA 1N5VA 3M4XA 2CPDA 5DDPC 1VQ4S 3MGJA 1C0UB 2CQDA 3R5AA 1FNXH 1I94F 1M5VC 2ZH9A 1FJ7A 2QMWA 3PO4A 2AX0A 3OFFA 3W7BA 4A46A 4NXNF 4ILMA 2KZMA 2IVYA 2YKNB 1S1UA 4QIGA 2M8HA 2D41A 4DQRA 3DLKB 3MD3A 2V94A 4B3OA 3PHEA 4I6WA 2COLA 1U1MA 5GAGI 2FGOA 4OHYA 3NAHA 4O3OA 3BSAA 5E3CA 5C24B 4FN5A 3OPKA 4U6PA 2XHWA 3LALA 4C3MA 3TNVA 1ZM9A 2RQ4A 2VPYB 3RZAA 1WG5A 3V4MA 4V19X 2LCWA 2CRLA 3BF4A 2G13A 3P6YC 4CQ1A 4EO8A 5KFEA 2E1AA 1UFWA 4X66F 5I4MA 4O3RA 4ECSA 3PW0A 4DFPA 4DV6F 2J0QD 4JV5F 2HHTA 4E8UA 4Q0BA 2SXLA 5KFWA 4KRWA 4KO0A 2C3MA 3EXYA 1S9GB 3MMCB 4AL5A 1T02A 1YVFA 3U1LA 3CCLS 1S0OA 1U24A 4MIWA 2HG4A 3JSBA 2D9OA 3RAQA 2P6TA 1HQUB 2CDQA 1QTMA 3E01A 1EP4A 3FEZA 2VG7B 2XB2D 1HBMB 1P9QC 1FT8A 1OQ6A 2XC9A 3CJKB 3SSSA 4RU9A 2C2RA 3I32A 3M32B 3G6VA 3TVZA 5KFSA 3G6ES 1QSLA 4MYTA 2OD4A 2ZDPA 4OIXA 2NSBA 1VRTA 2CQHA 2X3GA 5LMNF 1VQNS 2J7UA 3ZFVA 4DV0F 2GQQA 1ZM3A 3DFEA 4I6YA 4J9PA 3I55S 3TVYA 4FXVA 4K4VA 4ZCIA 3MM6B 1N5QA 3KLFB 4F25A 3W2WB 4WFBQ 5KFFA 3N5BA 3ITHB 1B0PA 3CCUS 1Z2ZA 5KT2A 2HZCA 4CTAB 5KTQA 1KQSR 4ZMMA 4ECXA 1RT3B 2DGOA 2OJ3A 1WG4A 1NJIT 4IR1A 5KFIA 3VAKA 2XZWA 2J6TA 1E6VA 3T9NA 1W2IA 2IRYA 3FEYB 2MKCA 5A8RA 1O8BA 3VZHA 3FRYA 3LGNA 4I0WA 3G6XA 1HNVA 1LW0A 5IM0A 4HTJA 5HBMB 5JJBA 4YQWA 3E8OA 1ZTWA 3ZZRA 3J7Z5 2MMYA 2EWHA 1KLMA 2GV1A 3BEGB 2HPUA 5B0DA 3HPOA 4F26A 4YHHF 4DHVA 5DG7A 2BDPA 1RTDA 2DCUB 3MM5B 4NLSA 5JUMA 1TL3A 1JNZB 1O5JA 4H54A 2J8AA 3SYZA 1DZ5A 3RBDA 1NK9A 3OFHA 1BY9A 3O1LA 1WF2A 2A2CA 1S76D 5A2QY 1MROA 3AY0A 4QCLA 4WFXA 4Q43A 5LJ5Y 2MKSA 1UJ5A 5KFAA 4K4SA 3M30B 2Z0GA 3M2RA 3SFUA 2KO1A 3MEKA 5B0FA 3I56S 3V6DA 3ENWA 3KLIB 3BGLA 3PR4A 4KR0B 1O51A 3M8QA 2KXNB 2KG1A 4IO9Q 1RT2A 2MKIA 1UETA 1S49A 2FVCA 3CD0A 4MFBB 3CCRS 1UVNA 3FMWA 2CJBA 4QWDA 5K8OA 2VFTA 5EWGA 1VK3A 5CXTA 2IRXA 4QYRA 2ZH5A 3BGRB 2L41A 1JLBB 1TAQA 1NEEA 2DH7A 4LSLB 5E5NA 1ROFA 2E9TA 2XG8A 4C8NA 1WHYA 3PEHA 4PXDA 2BOPA 4YB6A 5L1LA 3FVYA 1NKCA 2ILZA 3M9NB 1KN6A 1N54B 4IKAA 4O44B 2XS5A 4NLVA 1CPZA 4GC7A 1TV6B 2HFNA 2BW2A 1J2VA 3ZZPA 3THTA 5I42A 1NJWA 4QR2A 5KT3A 4AE5A 3T1HF 3Q2TC 1HQUA 3N6LA 4F3QA 4HT5A 2WONB 2CPYA 3C46A 1RJJA 2RJZA 4N8OA 4JV1A 2VZ9A 3AB4B 2V4JB 1FHTA 2D3OR 1PGZA 3OLBA 2HS4A 3I6PA 4RNOA 1QE1B 1N5TA 5L9XA 3HK2A 3TYTA 2ZZNA 3T1YF 3T5KA 3GWCA 2ZE2B 4XPCA 2QV6A 3HZEA 2FLOA 4QIFA 3ENVA 4ZCKA 1ZETA 4XDDA 1LWFA 4U7UK 4DF4A 2W24A 1VK8A 2J9EA 4KT0C 2BA9A 4TY8A 2V8GA 4ZP9A 2K3IA 4ED5A 3J7ZT 3OLAA 3BO2A 1PILA 3NL0A 3M6WA 3E51A 1LK5A 3M8RA 3QIDA 2U1AA 3RAMA 1ZZNA 1GTEA 2AGPA 2P5VA 3CDUA 4LF4F 3T5JA 3PY8A 4WFNQ 2OLWA 2FTRA 4TN2A 3CWJA 2F9DA 2UU9F 1SV5B 3KNAA 4HH1A 3KLGB 3PVXA 2GMLA 1S6UA 4DFKA 2DNGA 4DF8A 4PPZA 4ES3A 3UD4P 4LIRA 3T19A 4ZVHA 3Q23A 1R0AB 1K73T 2MGZB 2EI5A 4JOUA 1J5OB 1LKZA 3FCHA 3CPWR 1LWCB 3MM5A 2RQCA 3PACA 5J1NA 3P49B 3GG0A 2ZUGA 4UQTA 5E3QA 1WEYA 5FLXY 4I64A 4J9LA 3ZC4A 1K1QA 4G1IA 4LUBA 3DNCA 3T6JA 3ZZZA 4ZHRB 3KKFA 1W2BR 2FHMA 3NMAA 2HRUA 4OX8A 3BSOA 2YNHA 3CD6S 1BC6A 4CT8A 2QRRA 2KVIA 3R1LA 3N6NA 4OV1A 4ATNA 3RR7A 2ZNYA 4DSLA 1HMVB 2IA0A 3KLIA 2UUCF 1D9DA 2BE2A 4RNFA 4QR0A 1S6PB 3TANA 3IS9B 4G1QB 1QAJA 3QLHB 4X4RA 2A10A 1RYSA 3QJLA 2HW3A 1OSCA 1K0VA 2I38A 2E5LF 4JV0A 1RYRA 3QZ8A 3OVSA 5KFXA 2JX2A 1U1NA 3EUNA 2NREA 4EWTA 3PEJA 4LSLA 3CMAS 4OQJA 2MZQA 4DV7F 2MZRA 4CO1A 1HNXF 1SIZA 2NLWA 4ZP6A 2J6UA 4RLEA 3X1LB 1FXDA 4DR2F 3CCJS 4OZ5A 4ILLA 2HLUA 3MZIA 2FVQA 2RB7A 4O44A 2AJ1A 4UOCA 4DSKA 5J2MB 2XMMA 4X4PA 1FVSA 1WHWA 3RTVA 5ITHA 1D1UA 3NNAA 3CJ4A 3AJ2A 1OQ3A 3FSXA 1TFYA 3P96A 4H4MB 3SCJE 1IKYA 1NZAA 2V4JA 4CO2A 2YX4A 3VAMA 3S6EA 5HLFB 4ZA1A 2XI2A 3PR5B 2CVIA 2OSRA 1QE1A 3BJYA 2VPWB 4KV8A 2PI5A 1HI8A 2VQEF 5U47A 4DV3F 2DO0A 4DR6F 3KHLA 2YWEA 4QYZJ 2DPIA 4WFAQ 4IOAQ 5K9FA 3DN9A 2JC1A 5KG6A 2L9WA 1JLCB 1YBAA 1HBOB 5J2PB 3D2WA 1JK9B 3DOKB 1QVFR 5GAGU 2GHPA 1FD2A 3D0GE 4BS2A 2EFOA 3DLGA 3UCZP 4MK7A 1HI0P 2ZBCA 4DV1F 3SZ2A 1NJZA 1TL1B 3CDAA 1XR7A 2DHXA 3NCQA 2R7XA 5F9LA 1QSYA 2DJWA 4A8OA 4EEYA 1SV5A 4ID5B 1VQPS 5EN1A 3ICLA 1YTYA 3MR5A 4MKAA 1TFWA 1WHXA 1NK0A 3Q8QB 3J7YI 4I1TA 1K8AT 2D74B 5FJ4A 3HVRA 3WDOA 2ERRA 4I2PA 2GJ2A 1YGYA 1FE4A 4X84A 3VQTA 5F8HA 5LSRA 1N0UA 3FSYA 4KHPF 4KBIA 4IH5A 4CH0S 3I0SB 4KJIA 5EX0A 3TARA 1GXLA 1C1BA 3V4IA 2Z8QA 4A8YA 2AQ4A 1QJHA 4Y00A 2AV5A 5KG1A 3DI6B 3TP2A 4DSIA 4OJ3A 1NRKA 1R7IA 3EGNA 1XMBA 4Y2AA 2IYIA 2CQ1A 3G8TA 3GQCA 3K5NA 1S0MA 3OXFA 3CIZA 3VAIA 3K58A 2RDIA 4G1QA 3BSNA 2BYCA 3LP0B 3QLHA 4WXWA 1JKHB 1M5HA 3M05A 4O3PA 2BM1A 2KJWA 4IDKB 1TVRB 1N6QB 4DR7F 1FTCA 5F0WA 4NA2A 4Q8EA 4NLRA 3DYAA 4NRUA 3I4HX 3M6UA 5HL7Q 2B0GA 1FKOB 4YR3A 2KG0A 4QWBA 4EYIB 3QAUA 5KFZA 5J2QB 1JJHA 3P3DA 1A9NB 1R6YA 3CCMS 1SL0A 3MM9A 1VC5A 5J2NB