2Y8WA

Structure of crispr endoribonuclease cse3 bound to 20 nt rna
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
215
structure length
215
Chain Sequence
GTGAMWLTKLVLNPASRAARRDLANPYEMHRTLSKAVSRALEEGRERLLWRLEPARGLEPPVVLVQTLTEPDWSVLDEGYAQVFPPKPFHPALKPGQRLRFRLRANPAKRLAATGKRVALKTPAEKVAWLERRLEEGGFRLLEGERGPWVQILQDTFLEVRRKKDGEEAGKLLQVQAVLFEGRLEVVDPERALATLRRGVGPGKALGLGLLSVAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CSE3
publication title An RNA-Induced Conformational Change Required for Crispr RNA Cleavage by the Endoribonuclease Cse3.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Hydrolase/rna
total genus 56
structure length 215
sequence length 215
ec nomenclature
pdb deposition date 2011-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08798 CRISPR_assoc CRISPR associated protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1200 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Crispr-associated protein; domain 1 2y8wA01
3.30.70.1210 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Crispr-associated protein; domain 2 2y8wA02
2Y9HA 5CD4A 1WJ9A 5H9FK 2Y8YA 3QRPA 2Y8WA 4U7UD 4DZDA 5H9EK 3QRRA 4QYZK 3QRQA
chains in the Genus database with same CATH superfamily
3HJVA 2QLXA 1L3VA 2ZH5A 3H5SA 2XCAA 4EGLA 1HWLA 2MXYA 5KFQA 1GXUA 3R5CA 1TP7A 3KMSA 2AZ3A 2KTQA 4CZCA 5LSLA 3KLFB 4ED5A 1T9VA 3LGNA 4PWDB 1HI8A 2VBXA 1IKWA 4IYQA 3RB0A 3SCKE 3IXQA 2XZDB 3QPIA 2IVFB 2DGXA 1VQMS 2WW4A 5FD1A 4JI6F 5THWA 1JLAA 4QR2A 3MMJA 4LSZB 3T1HJ 3LP1B 2GVZA 3KLIA 3UE2A 2BKOA 3O8WA 3LGHA 2AZ1A 4LFCF 2VIHA 2YKQA 1PYOB 1YBTA 2G13A 2MGZB 2PEBA 4OJ3A 2KFYA 1CC7A 2XLKA 3PZPA 2NXUA 2BZ2A 2XSFA 2QA2A 1CULB 1UZDA 4DL7A 4UUXA 1N34J 4QCLA 3JTPA 3WBZA 2HNZB 1MWZA 1CEZA 1D0EA 2XZTB 2AP6A 2QYGA 4NRTA 3T19A 5JVGQ 5GAGI 1H6KX 1ZPWX 4PPZA 4DQQA 3G4SS 4I2QB 4WE1A 1QJHA 2R2TA 3QIPB 3US5A 2FVQA 4OZ0A 2R7TA 2DO4A 1YBUA 3UDCA 1TL3B 4LF5J 1HNXJ 5DG7A 2CQPA 4CO3A 1HNIA 1K47A 2KL8A 5DJBA 4H4OA 2RF2A 5KFBA 4DQIA 2FQQB 1U7LA 1F5CA 4WU3A 4QWDA 4KB7A 3HK2A 4FYVB 4RX6A 3LWMA 1IKVA 2HBRB 4N8OA 2UXCJ 2QGFB 2LDIA 2RT3A 4ILMA 2NSBA 5KFWA 4DZ6A 2GJFA 3G82B 2OSQA 1C4AA 1FTCA 3HD1A 4J9SA 2Y1IA 1XC9A 5M2UA 2DR8A 2ZH6A 3D3BJ 3MAAA 5BXIA 1F9HA 2J0WA 2R8HA 3PVXA 1MW7A 2QFIA 4N47A 3RZAA 3NOCA 1ZM9A 3S01A 2F5GA 4YHHJ 2XO7A 4K8RA 5DM7Q 1KHVA 3PHEA 3EICA 3QJJA 4DFPA 5HK4A 4J90A 3X1LB 1K0TA 1EP4B 1EETB 2K7JA 3C14A 1YJRA 2K3IA 3PW0A 1YI2S 4LUBA 2B4OA 1JLEA 4B9MA 1RLCL 1HYSA 2VASA 3WX4A 2IMOA 4I2PA 2YPYA 3TAMA 3KLVA 2CKWA 2H5EA 4EUVA 4B9VA 3E01A 5HLFB 3H7HB 3LOUA 4F26A 3M8ZA 2DT9A 5HSPA 3NMAA 1VQLS 3PG9A 1BHNA 1GMUA 7FDRA 3TO8A 2PIIA 1VI7A 2FGOA 1R8AA 2NCKL 4QWAA 4WFBQ 4ZCKA 4WU2A 3DDIA 1JLCB 2W2PP 4ZP7A 4DR1J 1DQ8A 3QWUA 2YWGA 4KFBA 4N76A 4KHPJ 4O3PA 1YG0A 2GA7A 1VQNS 2B3TB 3SXLA 4OV6A 2DH9A 4ZJLA 4UQGA 2BBEA 4PXCA 4IFYA 4KGZB 1RA7A 3MPVA 2KXFA 1TK0A 1NSAA 1R89A 1T3OA 1HNVA 3BO2A 3K7RA 2JEFA 4IDKB 3AA9A 2AHOB 5B0FA 4GKKJ 4ZP8A 3M30A 4P7VA 1HNWJ 4YDDB 1NK0A 4J9RA 5LMNJ 2LQJA 1FX4A 3DNCA 2V9WA 4W4MA 5EWFA 2CG8A 2MKKA 1PO6A 5ETVA 2YKNA 1RKIA 2DY1A 2UUBF 3AXKA 2HQIA 2MQLA 1B4SA 2VKRA 4NYOA 1R7IA 1OQ3A 2ROEA 1VQ8S 4DCJB 1Q82T 2OPQB 1VJWA 5DLFA 2KJWA 5KOWA 2ACMA 2AJ1A 4DV1F 3HFZB 4NX9A 3B78A 4G6VB 4F8RA 3NG8A 1V3SA 4C8ZA 3PO5A 4FF2A 3D6MB 1EKSA 1RWNB 4U8VA 3UN5A 3RB3A 4DDFA 2G1DA 1SUQB 2E1RA 2HPUA 1HWIA 4OZ1A 2EG2A 1RADB 3CTRA 3O3LA 3D9BA 3ZTQA 1O6XA 3H0PA 2ZFHA 1WF0A 1S76D 2OEMA 3W60A 4ZPVR 1Y7PA 2CPZA 3N4WA 3M8YA 4O3OA 5IZHA 3GP9A 1M5VC 4C8OA 1RWPB 4Q45A 4RW9B 2IBKA 4ELVA 3GFHA 3FFIA 3R5GA 2VODA 3MFHA 3TVKA 4DL5A 2CQDA 2MZTA 2R7OA 2AJ4A 2Y3YA 3UN2A 1JLQB 3MTJA 2EK1A 1JLFB 4G65A 1Y0HA 3PYEA 1GEHA 3OT9A 1OYEA 2YX1A 4NLSA 1TKDA 4C8LA 3P5BP 4LT6A 1AFIA 2ZEJA 2IFXA 3V6DB 1HPZA 1U26A 1FA0A 2DPJA 5D77A 1MSWD 3CCVS 2EK6A 1YIJS 1XR6A 2H9ZA 1TZ0A 4C0BA 3KLFA 2AJFE 4OYZA 4LF8F 1S1XB 4KGKA 2CG4A 2R8KA 3OSNA 2OO4A 2VG6B 1Q8BA 4P2XA 3IO1A 3PW2A 2F7VA 1S79A 2HFNA 4ZCMA 3EYZA 3E51A 4RJVA 3RW7A 2VFSA 3DDKA 4HHJA 3VTIA 1TU0B 3JXOA 3HCXA 5DLGA 3MR3A 3MOZA 1TV6B 3MECB 2WB1D 4RUCA 1IN0A 4H4KA 2MGZA 3NGDA 1FRJA 1PG5B 2WOMB 1X60A 3KHHA 2RAQA 2BANB 4LMZA 4CP5A 2IA6A 1WG5A 4PG8A 2HNZA 1D8ZA 4O3RA 4B3OA 4DMZA 2E1CA 3I9ZA 2WB4A 1WC0A 2IRUA 1XR7A 1MWQA 1NPPA 4JYAJ 4ZDNA 1WHXA 4MKVA 2MEWA 3PEJA 2ZVSA 1N5TA 4QU7A 2QO3A 4ER8A 3W5YA 3CO0P 2G1HA 1MN7A 3T1HF 1P9QC 5CZXA 1S0MA 2XGPA 1TL3A 2KYZA 3OFHA 4GMKA 2FZKB 2W4PA 4CIOA 3W5ZA 1EQMA 3FCVA 1JWWA 3BS9A 1X5SA 4IH5A 1WNEA 2FPHX 3OR1A 1YRXA 2YX7A 4DHVA 1FKPA 1BQXA 1QM9A 2Q3PA 3TA2A 2A18A 4LVOP 1N34F 3G82A 3NNHA 3AJ1A 2EPIA 4JI8J 5KT4A 1U09A 3GWCA 3RBDA 2MDAA 1RT5A 4UF4A 1M5PC 2ZHBA 1PJ7A 4OQJA 1FDDA 2JFDA 3SV4A 3TJ8A 1EJ7L 4UT4A 2OIHA 2XWYA 4QYZJ 1SI9A 2XTJP 3D68A 1S9GB 3IAS9 4OYMA 4DL4A 1HNXF 3BR8A 1PYSB 2V8VA 3NNAA 1HW9A 4F04B 2C2DA 1CJUA 1H2UX 3IS9B 4K59A 2VQEJ 3UPFA 4ZLNA 2NUHA 3F73A 3RB6A 5K8NA 4X84A 4OYXA 4HACB 2UXCF 2VPYB 1SIWB 2LKZA 3BKTA 2HHVA 4CTAB 1RAIB 1HARA 4L6V3 4ANEA 1S9FA 1DTQB 1S9EB 2IPOB 2CQ1A 4QBUA 5K5MA 4Y2CA 2XLJA 3T5JA 4ILLA 1X4GA 3KNGA 1WEXA 4RUHA 4YHHF 1LW2B 3R2DJ 4L3NA 2HZAA 1YJNS 3MCOA 2OKQA 1MROB 2ADBA 3I31A 3M2VB 3KLHB 2J9DE 5KFXA 2C2ZB 2D9PA 3R3TA 1FRKA 1T9YA 2XMTA 2C2NA 5ETNA 3DFEA 4IFVA 2UUCJ 4P74A 2CPJA 1RU1A 2MTLA 4IDKA 1N5YA 4B9LA 5EX0A 1YKWA 2WONB 1WKLA 2L3MA 4M8LA 2O01C 2JNJA 1V9OA 3S1TA 5AXLA 2GZOA 4DUYF 2N4CA 9RUBA 4ZN1A 3NLCA 3P4UB 4O44B 2AQ4A 4WCEQ 1X4BA 3TVZA 2LA6A 1PBUA 2AMCB 3DRSB 5D0EA 3JSYA 3O2IA 2PDAA 3D66A 1WC4A 4DR1F 3BV8A 4CNYA 3CJ0A 5IT4A 3K5PA 2J5AA 2VPZB 1G7CB 1H2VZ 3GJSB 4KHPF 3BKUA 1NJYA 1JB0C 2NXCA 2W2QP 2ZZNA 4ZP9A 4EMDA 1YGYA 1RTHB 1S7IA 3LAKA 2M8HA 5G4DA 2JEGA 3J7ZT 4XDCA 1SUQA 2OP5A 2ZOMA 1WOPA 3KHRA 4GKKF 2DGVA 1X9SA 3PHTA 3JQJA 4WP9A 2W1BA 1NXIA 4TVAB 1HNWF 3EWGA 2KRBA 5B0DA 2HHTA 3AT1B 3ULHA 5LMNF 2E9ZA 3MEKA 3FCWA 1A6LA 3SDEB 2XQCA 2AGOA 5KT2A 4DR2J 2GMHA 4UOCA 2V8GA 1TKZB 4NXMJ 1CJTA 1WJ9A 5F8GA 1GQEA 3O44A 2GJ2A 1AFJA 2C1EB 2DTJA 3T5LA 3B54A 2HBZB 4DPUA 1I94F 4J37A 1F3VA 4HI1A 3T6BA 2V8HA 3FQKA 5IC6B 2N3LA 1B0PA 1X5OA 3CDUA 5EHHA 3IMQJ 1Y3KA 3LUYA 2V8DA 2OELA 1JLQA 2RQ4A 2BABA 1R0BG 1TL1A 4DPWA 2HHXA 5EN1A 3HZGA 4HVZA 4F4YA 4DSEA 4DQSA 4M5IA 2ZNYA 3I0RB 2I5JA 1VBZA 8RUCA 1V5IB 5DETA 1TK8A 2KKHA 3IAM9 2B8QA 4X4RA 4RU9A 5AT1B 5GAEU 1JJCB 2V34A 2DITA 2FTRA 1G6BA 3MEDB 2I38A 2RH3A 3R2CJ 1UW4A 4Q43A 3QGIA 3BGRB 2YH1A 4USTA 1QE1B 3AAWB 1NDCA 4LSLB 2APOA 1S0VA 5A0YB 4OX6A 1Z2LA 3LWLA 4CLLA 3MOJB 3VZIA 1TV6A 3D3CJ 3MECA 3ZTOA 1UWBB 1DBDA 2J9DA 2DXDA 1KFSA 2VA3A 4DR7J 2ZITA 3D2WA 3J7AN 4R25A 3JYTB 4NEYA 1SQGA 3DCAA 2LEBA 1HL6A 4E2FB 1Q86T 1RUSA 4ZS6A 2AEFA 2QIFA 1VK8A 2K1RB 1TUVA 3CJ5A 1RABB 3BQ0A 3HP6A 3DGVA 3QRRA 4DUZJ 2PEHA 2OPSB 2KT3A 1FKOB 5GMKa 3IR7B 1FK9A 1X7VA 2XC9A 3VQTA 3TJ9A 2XULA 3R27A 5D3GA 1TMJA 2R7QA 3J7Z5 1UAWA 1GMWA 3OTOJ 1S1TB 3A3PB 1FJCA 2EKYA 2YQ1A 2C3UA 3H98A 2NPIA 2XY5A 3OPKA 2B9XA 4L3KA 5J2NB 3HJFA 2FJDB 1Z4UA 1X4CA 3LP2A 2DXEA 2D7SA 3AD9C 4OV1A 4FKXA 2BDPA 2H5JB 1FXDA 4HH0A 2V67A 1T3NA 1RT2B 1LWFB 2MQOA 1HBUA 2FHKA 3MFIA 4JYAF 2X7IA 5EX3A 4EYIB 1U6ZA 1KEKA 1ACMB 1SH3A 4NZ0A 1MN9A 1HI1A 2QMXA 3IWNC 2LXUA 1S9GA 2RRNA 5E3RA 4BS2A 2KG1A 1Y3JA 5B09A 4W92B 3NNCA 2O66A 1VK3A 5HL7Q 2AGQA 3U1MA 4M63A 1T95A 3KG0A 4O3NA 1FDAA 3PKYA 4GVLA 5AJ3J 1TVRA 5LM7E 2WSFC 2RJZA 4Q8FA 1Q5YA 1NK8A 1ZH5A 2POKA 3OXLA 1KP6A 3IM9A 2B56A 5D4NA 5DRKA 2J0QD 1RI7A 4ECYA 3DM2B 4JI8F 2KT2A 3ZNJ1 2N3OA 3JTOA 2VHGA 2W25A 1QSSA 2CNOB 3ZZYA 2M5YA 3BGFA 3KKFA 5IT0A 3HHNB 1VC0A 4X62J 1FKAF 4WTYA 4C98A 4ENOA 3CC4S 4RW4B 3M2VA 4N5SA 1KQKA 3KLHA 2VC0A 3OSPA 3U02A 2QV6A 5KFJA 3OQ2A 2BOPA 2DRBA 1SQEA 2VQEF 5GAEI 4WYLA 2OI2A 2PMHA 1NBEB 2BJ8A 2LYVA 4WZMA 1HWJA 1NNDA 4U7UD 3PKMA 2ZM6J 1XR5A 2LQ5A 3BDEA 2WONA 2HBYB 4I68A 4ZPDA 5KFSA 3W65A 2A2DA 2B4VA 1UVLA 5L8RC 2ILYA 2RQCA 2EVZA 3DRSA 2XSJB 3ZTRA 1XNQJ 1DY3A 4IQMA 4KH1B 4OJHA 2CZVC 3MMBA 2QLBB 3K8VA 1X9MA 1P8GA 4DZDA 2DIUA 1RHUB 1APSA 1SCJB 4LBPA 1D9DA 1HD1A 5F3TA 4PEOA 1RZMA 1FTRA 4ETZA 2P6SA 2CJKA 4F0HA 3I32A 2XYPB 3CD5A 3DGPA 4ZP6A 2UUCF 3AD8C 1IM6A 4GVBA 2A2CA 1RP5A 2IAJA 5MAOA 3MF5A 2KFNA 2R4FA 3OFEA 2LDYA 5I3PA 3N9UC 2I9SA 3ZNUA 5F8NA 3SDEA 3TANA 1PAUB 2CFXA 4RW6B 1T11A 4CLUA 1O51A 1H7XA 2B7CB 3DRPB 1ZTTA 2HMIB 3MEEB 4FVCA 3TQEA 3PRVA 3TEGA 2GIRA 1S5ZA 2FY8A 1S97A 3G2XA 3QGPA 1N6QA 3OLAA 3V6HA 1F6TA 4LF9F 2ZD1B 2JHEA 3KG1A 2DGWA 1FXRA 5DQHA 5HMWA 1U02A 1JK9B 4LF1A 4QW8A 3I0RA 3LGMA 3MUTP 3PDNA 2C42A 2VFTA 4ZHRB 2ZBPA 1PJ5A 1I1GA 4Y3CA 2YQ0A 1Q53A 4F4WA 5HBMB 4L75A 1Q8IA 4DR2F 4URGA 4NXMF 4RL1A 2P9EA 1C1BB 2ROPA 6AT1B 1L3KA 3NCPA 3M2UB 2ZUGA 2NREA 3B4MA 3HPOA 3MEDA 5D0GA 3Q83A 3W5XA 4LF7J 1I6JA 2UVRA 1RBLA 2RDIA 2GMJA 3BGRA 4DL0C 3CIZA 3QAUA 5ETMA 2KFZA 4M5JA 3A1YG 1DQAA 1QE1A 1VDHA 4CCHA 3QJLA 3CNQP 4CT9A 4K0KJ 1Q8KA 3IBCB 4UOHA 4YEAA 4NLDA 2A10A 2DNMA 4KAIA 3LALA 3R7SB 3K89A 5CXTA 3B82A 3ZZRA 1UCNA 1ICEB 3D1HA 3Q8QB 4DSIA 2OTLS 2DR5A 3FRZA 3UDEA 1UWBA 2LU2A 2IRXA 3SCLE 1D3WA 3GIRA 1W2BR 3JYTA 5I42B 1GTHA 1VISA 2MKCA 4EU0A 3QLHA 3SSQA 3VAJA 1NHUA 1VYAA 1HKAA 1Y5NB 2LFVA 1RAGB 1IKYB 4BDPA 2R7RA 1Y4ZB 1FHTA 9ATCB 3TARA 3C46A 2K1RA 3Q8VA 3JSBA 4ZK7M 2V63A 3LAMA 3M8PA 3TW0A 1VIOA 3A4TA 4EI2A 1U49A 2Q43A 2ZH4A 5K14B 4TU8A 4CYUB 1DHMA 2D9OA 1UFKA 4LQ9A 4AD6A 3Q23A 4DPOA 3VAFA 4JI7F 1NU4A 1W25A 2B7BB 2FZCB 2E5GA 1AB8A 5DGAA 5IT9U 3IR5B 4J9MA 1VLYA 1FWKA 4DR7F 1UJ4A 2IJFA 1W7WA 4UY8T 2HS4A 2B8PA 2X3DA 2KVIA 4Y00A 2OFGX 2FJWA 1FJEB 1DFDA 2VFUA 4IRKA 3J7A1 2XMVA 5D0HA 5JUMA 5IQQA 2R8IA 1AROP 2YBVA 3WC0A 1B0TA 4DUZF 2W9CB 1X4FA 4Q2MA 4PQUB 1FWLA 3Q8YA 2J9CA 5LXRA 2IM3A 3C6TB 2IDLA 1RHKB 2MB0B 3UDVA 1TUWA 2J0SD 5LJ5Y 1VLOA 2JX2A 3OTOF 2QSWA 5E3PA 1M5OC 5KG4A 3QAEA 3QGHA 4DOZA 1TKTA 1WSRA 1RAJA 1XWLA 1V3RA 4JI2J 2PSZA 4NMLA 3K0JA 1FO1A 1HI0P 3K5OA 3MPDA 2D41A 4GKJJ 3DXBA 2XCPA 3AQOA 5IS2A 2XMWA 3CC7S 2GX8A 5LXYA 3QSIA 1FI4A 2GFFA 4DV4J 4FVMA 3QO9B 2RDDA 3T9ZA 3RBZA 1Y11A 4C6AA 3NS7B 4QR1A 4NLYA 3E3XA 2N7YA 4I69A 4XPEA 2QC3A 1U25A 5AJ3F 1N0UA 2Z30B 4HL9A 2UUWA 1N88A 2XMKA 5DG9A 5F41A 5K8PA 3GILA 4LR9A 1C0TB 2DHHA 5KG7A 2JWNA 4N8NA 1XMBA 4YDXA 1EHWA 3CCUS 2J8AA 3VGSA 3G8TA 1RT6B 2NUUG 3I96A 1S7HA 2F63A 2ZZTA 1YWXA 4QU6A 3UD3P 2B51A 3C15A 5K8MA 1QLNA 1UWAA 1JLGB 4BHQA 2GMLA 4I6AA 2EXUA 2VG5B 4DQPA 4UW2A 4N41A 3CT9A 1UTAA 1QAJA 5E3AA 4UY85 2BEFA 5H9FK 3ISZA 1U0SA 2DHXA 4NLTA 5G0RB 5A8KB 1LOUA 2KXNB 2B4PA 1S4FA 3GIKA 1RTDB 2GQQA 4ECWA 4IH7A 5E41A 1SQFA 1J5OA 1XMQJ 1FRIA 2FY1A 3FSXA 1YZ6A 4DV3F 3MEGA 4DV0J 2J7KA 2EFVA 4RW6A 1S6UA 4X66J 1BC6A 4PG5A 4K4SA 5KFUA 3DRPA 4DU7A 3CJRA 5LSOA 1EKRA 2HMIA 3CD7A 5C42B 5JXSA 3PJ9A 3MEEA 3MM8B 2XS7A 1NSPA 4OHVA 4X4OA 2CQ3A 2HQFA 3HT3A 3PV8A 4N7TA 3PJWA 4DL6A 2GGPB 1DLOB 3D28A 4JI3J 2GIFA 3UR3C 3MR7A 1K0VA 2BW7A 4WFYA 3FMWA 5AE2A 1F2HA 4I0WA 1N32F 4Y2MA 3CUNA 4G3IA 5L9XA 3EZ5A 2M8DB 4DS4A 2E7XA 2Y1LB 2UXBJ 4ZHRA 3GYGA 1Q8LA 1NKBA 3CF5Q 4U7CA 4DJBA 1QUPA 3I5CA 5HBMA 3GV5B 1U1OA 2B4UA 3HT0A 1SL0A 4C8NA 3CJKA 2F4FA 2PA3A 5B08A 3RRGA 1C1BA 4PRFA 2XY7A 3NRBA 3FBBA 3M2UA 2ABYA 2ZNZA 3DDNA 2AIRB 2RNEA 3CCZA 2XG8A 2GW8A 3BBCA 1WWHA 1VR6A 3AD7C 2V6AA 2QX0A 4RR5A 5BYQA 1PIEA 2CQIA 3MPYA 2PD1A 3HSJA 4NPOA 3N01A 2NZ4A 3PACA 3AJ2A 3BEGB 4F36A 5DQIA 4UQTA 5ADZA 4WPAA 2DJWA 1B70B 2WZ1A 3ILIA 4KJIA 1OQ6A 4TQRA 4U6PA 3FNNA 2YNIA 1S6OA 1IQZA 3QIDA 1V6HA 3W2WB 4ZVHA 2DGTA 3GJRB 1LFWA 4NL5A 2B9YA 1IKYA 5EGYA 4QIWD 2C3OA 2IRYA 3W9JA 1WUUA 3V4IB 4LF7F 3VAKA 2YH0A 4V19X 3UCUP 3PRBA 5KFVA 4NZ7A 4Q8EA 2V2VA 4PZVA 3LANA 4ZVQB 4K0KF 2L48A 2W2OP 4I4BA 5K14A 3GIIA 4CYUA 2C3PA 1YBAA 2R7UA 4R0JA 4A8MP 4QIEA 2IY5B 1RT7B 3OL8A 5HMZA 2QA4G 3BGOP 2CPXA 2M9KA 4IOCQ 2HYIB 4PCQA 2I0XA 1VQOS 3J80U 3IRXB 4C3MA 1WI6A 2P2CB 2GV1A 2HIYA 4M5NA 4KPCA 3VWSA 1L3UA 5KFFA 3QNWB 1NO8A 3JSMA 3FVYA 2BJ7A 4D3HA 5CYQB 1BWVA 4B02A 2HHPA 4NA3A 2HS0A 2QTWA 4IO1A 5GMDA 5KFRA 1E6YA 3OTEA 3LPYA 4NASA 2K2PA 3KK2B 4RNFA 2W9CA 2F8MA 1K1SA 4I67A 3GMGA 1O0PA 3TAPA 3CMAS 1WC5A 4ZVGA 3MM7B 2FJVA 2Z8QA 1YHQS 1P6TA 4LRCA 2CA9A 1WF1A 2RILA 3MPWA 3RB4A 1BLUA 1NK9A 3SI8A 2W9BA 2QMUB 3I0SA 3EX7B 4JI0J 5AXNA 2HWTA 4OYBA 4ZVTB 1ZYQA 4IRCA 3CJ8A 3BN7A 3W9HA 2WBRA 1AZSB 4L74A 1X9WA 2VOOA 1FFSB 3BKFA 3MR5A 4AE5A 3S8SA 2GC8A 2I2YA 3NWRA 1GXTA 2LCWA 2WVDA 1L3TA 3W63A 1ZZNA 2OMOA 1E6VB 1U1MA 3L7PA 2Q1LA 4USUA 4RNOA 1PBAA 1K44A 2YQ3A 1UW9A 5HP1A 4OZJA 1UFWA 1UKUA 3CCJS 5EDWA 2HRUA 2RU3A 3UW1A 1C0UA 2CPYA 5EUHA 5I3UA 3HSGA 3QO9A 1LXNA 2YKAA 3GCXP 1JMTA 2AX0A 2M70A 1NHVA 1TKXA 4ECUA 2HHQA 3AODA 1R3NA 4JI2F 4DL2A 3H2LA 2CDQA 1JNZB 4WIQA 5KFZA 1S48A 2FC9A 2YX4A 2R7SA 2W8LA 1C0TA 4FNIA 4ED8A 4PWWA 3VAGA 3HVWA 3DOMA 4Z7YA 2EFQA 4OI0A 5FDLB 4QYRA 4GKJF 1LWCB 2UVWA 1M5KC 1RT6A 4KY3A 4X4NA 4KV8B 5C2CA 3QWPA 3ZZOA 3A13A 5E33A 2ZE2B 3PCOB 4E98A 2W24A 3ILLA 3ZTPA 5DDPC 1C1CB 2R42A 3X3UA 4DV4F 1RK8A 4LF6J 2FJBB 1UVKA 4NI2A 4J9OA 3EZUA 2DNPA 3SQGB 3CC2S 4ECZA 3OVSA 4YP3A 3GB0A 5G0RA 5A8KA 2H4YB 5C25B 1TQLA 2HQCA 4HYKA 4B3RJ 2AYGA 2G2OA 1UP1A 1S10A 3DLGB 3NCRA 3M6UA 4CO2A 1NK5A 3HULA 4X4UA 4RWWA 1ZM4A 2KM8C 3DOLB 2H5IB 5ETLA 1BD6A 4C7QA 5J1EA 1C2PA 2HKEA 4HLBA 5D15A 3EZOA 2IVYA 1U2RA 2NPFA 2E9TA 1UA0A 5T7LB 4XDDA 3FSYA 3GYNA 3MM8A 1RT1B 1LXJA 2M2BA 2PMZD 1CJKB 2K7KA 2DBBA 2FYXA 1V3ZA 3RR7A 2GGPA 2G2ZA 4WXOA 2AEJA 2D69A 3H20A 2W7PA 4Y65A 2JL9A 2AT1B 1ZPVA 1G4CA 3OUYB 1X8DA 3A8KA 1SIZA 2DR7A 1FJGF 2OAUA 4NLQA 3OR2A 2P9CA 1XMQF 4OI2A 1GX6A 2FZGB 2LVWA 1S4EA 5CQGA 4DV0F 5FLXY 4CNZA 3CSKA 4X66F 5B0AA 2QA4S 3MAHA 1B7YB 1X5PA 3SSRA 1VOMA 1LWEA 4F50A 5D0RA 4OFZA 1WC6A 4K2JA 3LQVA 2KHCA 1NB2A 2HVEA 4F4AA 3W8PA 1XIQA 4YR2A 3RBEA 2MY7A 4K4XA 4JI3F 4NLGA 1N4LA 3NEKA 4K4ZA 2DVIA 3F56A 3ET6B 4JI1J 1B64A 3CMQA 1ZM2A 4TYBA 3Q0AA 5H9EJ 2UXBF 3GJQB 3U7JA 2KM8B 3GU0A 2E9RX 2D3UA 4DL3A 1EARA 2HEKA 4RBTA 3VGTA 2KVQE 4ZJOA 3K59A 1UEVA 3FUYA 1RYRA 2VF3A 1VQ6S 4R0EA 1KD1T 1WI8A 1SVDA 2DK2A 3PJXA 5ETPA 3NGTA 1U24A 1MU2B 2MQ8A 3PYFA 2LMIA 2Y0BB 3DHWC 5IM0B 3K2YA 2LU1A 1SJQA 1SPBP 4IQXA 1B0VA 4OJGA 2KHDA 1RT7A 1WORA 2ZVIA 2ALZA 5M2RA 1SKRA 2XYGB 2XS2A 1VGYA 3Q24A 1WHWA 1K9MT 1FRLA 3M05A 2HFVA 3JQKA 1EZZB 4PXEA 2BA9A 4USVA 1U8SA 3G96A 2RHQB 1S77D 5ETQA 2HGLA 4RZRA 4LIWA 5KT6A 4FZVA 4ED0A 5KFOA 1X4AA 5CYQA 4MK7A 4QZVB 1MLAA 3OXGA 3C16B 2QG9B 4PG4A 1OWXA 4X65F 1QAXA 3AOAA 3SCIE 1AT1B 1T8EA 3RRKA 4O23A 4I7FB 4JBCA 3MCMA 3SSSA 1NLKL 5I3QA 4B08A 4Q0BB 1H7WA 2DHSA 4A47A 3MR6A 3KTQA 2HRYA 3V4MA 1NJXA 4Q5VA 1KOHA 4NCGA 3MM7A 5DDOC 4JV0A 1FWPA 1OY6A 4KKOB 4QWBA 1PKUA 1EIYB 3QT7A 2GVDB 4X4SA 2JLGA 2HIQA 4KGVB 5FJ4A 2RRAA 3HKWA 2LXFA 3T6JA 3BYRA 1BMQB 3TEHB 4WIIA 4CH1A 2LLZA 2L9WA 5L1IA 1AZSA 3KHLA 3CMES 3GONA 4RNNA 3ISNC 2ZOGA 1FE0A 2LQ9A 4IG0A 4QIVA 5KFLA 2DCLA 4ITSA 4BBYA 3P96A 2LECA 4KGMA 1E6VA 3CD0A 1MWYA 4MH8A 3QATA 2W7OA 4U8YA 4XPCA 3L7UA 4DCOB 3H4DA 4C4WA 4F0MA 1FEEA 1T9TA 1YJ9S 2EFNA 1HBOA 4AT1B 3AFGA 2XNQA 4RKUC 5MLCV 3VHQA 2VA2A 4CO1A 3NGRA 2AV5A 5HMYA 2B0GA 1SJ3P 4MK8A 2JVOA 2B43A 3THPA 5T41A 4PKDB 4JI0F 3ADAC 2VDHA 2FLLA 3F0NA 4ECSA 4Y6IA 4NE9C 2CAJA 3QQCD 2D3O1 2RU9A 2JH3A 3A3NB 2CQGA 2X51A 4KBIA 5C2GA 1VQSA 3FZBA 2BOAA 3NMRA 1PAEX 2JEIA 2VFVA 1NB7A 1GTEA 1RWOB 2R8JA 3MM5A 5FDLA 1LWCA 4JV1A 4KV8A 1XERA 3OTBA 1TUGB 2C2OB 1YLXA 4JP8A 1Q95G 2DY9A 1S49A 2ZE2A 2PI4A 3Q86A 2VPWB 1MMNA 3CCES 1C1CA 1UVJA 3CDEA 2NR0A 3MCSA 1D9AA 4USWA 3VGVA 2BUNA 1R8CA 3EVMA 1HQEB 2H48B 1VC5A 3PO4A 1RBOB 4MT1A 5ETKA 2W9AA 1RDRA 4LRAA 3IR6B 1PGZA 1FFWB 4LRBA 3DMJA 3OVAA 3V5RA 2CNNB 1FJ7A 3CEDA 4DPYA 2DNRA 5C25A 2E29A 1FT8A 2Y9HA 4O0IA 5BR8J 1RHJB 1S6QA 4FF4A 2YWEA 3N5BA 3M1VB 2JSXA 2CUYA 4ED4A 1P9YA 2E44A 5GAHU 4DUTA 3J81U 3DOLA 1XBWA 1Y00A 2KJVA 2HSEB 4WKRA 2HFOA 2R8GA 3DHXA 4FS2A 1OMSA 4OHWA 4M5LA 4NLPA 2M0GB 2JEJA 3W8GA 1V5VA 5T7LA 1TK5A 4LFBJ 2BJ1A 2VV5A 3ISND 2E7VA 2WVBA 4CI0B 3EM1A 3CWJA 1RA6A 2MJNA 1KLNA 1RT1A 3Q89A 2ROGA 3SZ2A 2WSEC 1CJKA 2AJQA 1FF2A 5K20B 5K9FA 3J81j 1TL4A 1LK5A 1T9UA 1IBCB 1TAQA 2HVDA 5KFKA 2E7WA 4DFKA 4DCPB 5KFHA 1NKEA 3OUYA 1B99A 4B3RF 5HO4A 2V68A 3UWTA 3KLGB 4L73A 3ITHB 4ES2A 2BQUA 1S99A 2HAFA 5ETSA 3NS6A 2Y1JA 1TL5A 3DI6B 1VRUB 2YNFB 4NLOA 3Q8SB 3R1HA 2DEIA 1G1XA 2BQRA 3VVTA 1PILA 4OI1A 4ANCA 1K1QA 3DXSX 2F4VJ 3EMTA 2UXDJ 2CIMA 2ZJRQ 3QFHA 5EWGA 2GHWA 1Q78A 4O4GB 4L72B 4K4YA 4B9SA 5ETTA 3PX0A 4H4MB 4ED3A 1RLDA 5DGBA 3TUPA 3GSDA 2V94A 1GXLA 4NCBA 3ET6A 5DDRC 1ZA2B 2Z4PA 1NK7A 1JLBA 4J9VA 2QL5B 3HVRA 5HN0A 2KZMA 2ZH9A 1UEKA 3QZ8A 4DSJA 2CQ0A 2JC0A 1R0AB 3HHEA 3RGIA 1OIAA 2VJUA 2CPFA 1KSPA 5JMNA 2AEMA 1DTTA 1ZETA 2UUAJ 3N6NA 1RQ0A 1U1NA 1NH7A 1N48A 4ECXA 4GC6A 4B3TJ 1YRUA 2RQMA 4DXLA 4F7VA 4FXVA 4ICLB 3FEYB 1SJFA 2J6UA 1QD1A 5IM0A 3GFYA 2OPPB 4WFXA 2WSCC 3RTVA 3CXCR 5B0CA 2G2YA 4WXWA 2BV3A 2JLFA 5EWEA 4JI1F 1RAAB 7FD1A 4LSNB 4OYWA 1U48A 2AYMA 1YJUA 2R3VA 1FNMA 2ZKTA 5KFAA 4P2SA 1N56A 3SCJE 4J5OA 2FHMA 1HLWA 4LQ3A 2BQ3A 5L9NA 2Z2MA 2IHR1 5KT7A 2CJYB 2AU0A 2MSTA 2KT5A 5A2QU 3FRYA 1BQMB 4FP9A 3M8SA 3H40A 3OHBA 2HWIA 4RW8B 2ZOFA 1U4BA 2YNHB 3CJ3A 4U7UK 2BW2A 4ZPWR 1HNZJ 3I55S 4OX8A 4UZBA 3BJYA 1JJ2R 2A0FB 1S12A 1YQHA 3F44A 1OO0B 4I7FA 1VBXA 3DYAA 1M1HA 3J7YU 2R2SA 2VD3A 1C4CA 1UJ5A 4J9NA 4Q0BA 4ZIWA 3WC2A 2IYGA 4GC7A 1HBNB 3FSIA 4F67A 3N5FA 3MGJA 4W90B 3MM9B 3M8WA 1KR4A 2X1AA 4EBDA 2U2FA 4YUDA 4KKOA 4PWDA 1RTJB 2Z2YB 1S1VB 1RAHB 3IWLA 4FKYA 5GAHI 3M2RB 1HHSA 1HQUB 3AOCA 3MMAB 2MQNA 3I5BA 1KOOA 4S0MA 4QIGA 2XYHB 5CABA 2ZDPA 3VAMA 3PX4A 2HURA 3LP1A 4RUBA 4Z2XA 2XM3A 1SXLA 4MIAA 3DLLQ 2PFDA 3UD4P 2QA1A 2VBZA 4CH0S 2DNHA 2HGNA 2DNGA 2Z2ZA 1RB0A 5DS7A 4LJMA 3FBCA 1Z2ZA 2OEKA 1SC1B 1VJQA 5CD4H 1FE4A 1CULA 1HA1A 1IKWB 2MZ1A 4FYYB 3IGNA 4P52A 3EPIA 2QL7B 1IR0A 8ATCB 4HT7A 5DQGA 1SH0A 4BCAA 1UPPA 1A7GE 3DOKB 3M8QB 4RPFA 2VBWA 5HROB 5IXUA 3LO3A 2BR0A 4I2QA 2GQCA 1SL1A 2JLEA 3H4BA 3QIPA 4UTGA 2CWKA 4BC9A 7AT1B 2DKOB 5CA5A 4DF8A 2NQPA 4A48A 1SKWA 1AW0A 4QJVA 3UCZP 3L9ZA 1YRTA 2WAQD 5C24B 3CJTA 4O4RA 2VH7A 1ZBTA 3EVOA 2HNDB 2ZJQQ 2YWWA 4CM0A 4A8SA 4CLPA 3K17A 1YJTA 3MUMP 5E7OB 4OLPA 1AXQA 3BGUA 4L76A 4M5HA 3GFXA 4HH1A 3JAMU 4HDHA 4C0OC 4DR6J 2DHGA 1GMWD 3M9MB 4NZ6A 1Q0NA 2V2QA 3IFEA 2RRBA 1YZ7A 1KLMB 4AL6A 2IBOA 3B8HA 2DNQA 5A8WB 3CJQA 2YWHA 5KT3A 2PI5A 3M1VA 5D4PA 3VF0B 4LF5F 2DXFA 3BSCA 2MQQA 1EP4A 1EETA 2XMJA 4DR4J 2HK2A 1IKVB 4OI3A 2CQCA 4ZCLA 4YB1P 4DG1B 1FDBA 1TAUA 2I6WA 3FGVA 3G86A 3GR1A 5HLFA 3MAAB 3S7RA 1WC3A 4QWEA 1HFEL 3NKYA 2QLJB 3SMZA 3HHKA 4X4QA 3T1AA 2HLUA 3TA1A 5F8IA 1SC3B 4ZITA 4OYIA 1IXKA 3GCWP 2V9KA 4P71A 2DR6A 1VCTA 1JLCA 2YWFA 1U8WA 1KQSR 1H38A 5BR8F 3VV2B 2D74B 1JLEB 1REVB 4MMOA 3KLGA 3BSOA 2QE5A 3ITHA 3J7YI 4ZVRB 3VCDA 3HVTB 3R5BA 2KZZA 3DI6A 3FEZA 1U6BA 2YNFA 3TAMB 5CH7B 4NA1A 3VALA 4DSKA 3E01B 3CIMA 3KK3B 1NJWA 4YB6A 2HFUA 3KUEA 3TQ1A 4MK9A 1NJZA 4NLXA 2G9OA 2LP4A 2E5IA 1L5UA 2VDIA 4CLYA 2DGUA 4O4GA 3V6KA 4LREA 2CPDA 1RJJA 3HF5A 1MNEA 1GX5A 3D0IE 4H4MA 2R2RA 4EYHB 1YSJA 2F8EX 4KFBB 3PM9A 4JI4J 2LA4A 2HHWA 1BQNB 3AB4B 3QZ7A 2VPXB 2OPQA 2W4DA 4TLQA 4WZQA 3M6XA 3QYYA 1HNVB 1BE4A 1QY7A 2OHDA 5AE3A 1PYTA 2A6MA 1R0AA 3P6YC 1KTQA 2MZSA 3GQCA 3Q2TC 4BC7A 1RHQB 1SJ1A 2R7WA 5IV3A 3CCQS 1IUJA 2F4VF 3LH2S 4ZLJA 2UXDF 3Q22A 1BY9A 1WELA 1UETA 3WQPA 5JVHQ 4P75A 1U1RA 3EGNA 4ICLA 4C8KA 4EZ9A 3SBMA 2E1MC 3H25A 3RAQA 3IC1A 5KG0A 2OPPA 2XI3A 4K4WA 1LV5A 2OJ3A 4IUFA 3D7SB 3AB2B 3W7BA 1G2EA 1F5BA 3AOBA 4F3MA 3UNYA 5KFPA 1REGX 4LSNA 2GO8A 1HBMB 1KVIA 1FESA 3OBIA 2FHJD 4RW9A 1RHMB 1B7FA 4URQU 5DDQC 4QR0A 1BQMA 2YPZA 4FN5A 3H5UA 1JLFA 2UUAF 4RW8A 1CG2A 3CCMS 2EFGA 3DLBA 2AYBA 5HQMA 4Y0FA 4DLEA 2N82B 3NS5A 4B3TF 5J2QB 3SIPB 2KDOA 2EEYA 4KHRA 3V6DA 4P2FA 4LF8J 1CLFA 4YFUA 3TOQA 5CYJA 1LQ9A 4J9KA 4A8QA 4K4VA 1U1QA 5F9NA 2KI2A 2CVEA 4J9LA 1NPRA 1S1XA 4LR7A 2ILZA 1S1VA 2UV8G 1N54B 1YK9A 3CCRS 2VG6A 4P10A 1HWKA 1FVQA 3KFWX 5L38A 3OTCA 4J9UE 1NSKL 3ETMA 5B0GA 3HHLB 1OY8A 2A1BA 2H4WB 2H54B 3VZHA 2BKPA 1HPZB 1Y5IB 1HNZF 3C8YA 2W2NP 2QZ8A 4RWXA 1GH8A 1WDDA 2AF6A 5L39A 2JDJA 3UNGC 2JRSA 1IBMJ 1JXVA 4WK1A 2WOMA 1JNRB 2BANA 3MURP 4LF4J 3QRPA 4A8OA 1RT4B 4M5DB 3HHLD 1QTMA 2XS5A 2ZUAA 1DARA 1NK4A 4OHYA 1I51B 1J5EJ 3MDFA 1AYEA 5LSRA 1DURA 1FNXH 2W4CA 3DOKA 3M8QA 3VQSA 4A8KA 5HROA 3TZYA 3WIUA 3OV7A 2P6TA 4ZKAA 1HWUA 1TR0A 4FF3A 4I56A 3D1OA 3JQMA 4Y28C 4N56A 4EO8A 3QJPA 3H90A 3P45B 2V0NA 5C24A 1SV5B 4WWSA 4C8YA 2HNDA 2JZ5A 3KXDA 5D4OA 2FLNA 2RS8A 2E5LJ 1O5JA 2COLA 4QPTA 2ZC3A 3FQLA 4B3OB 3V6JA 5D6GA 2ASYA 3UN3A 1R31A 1SBRA 3JB9k 2UVVA 4HTJA 3EVWA 1ZTWA 3R9LA 1CSJA 1IJEB 3HLUA 3VAHA 1WEZA 2CRLA 3HXMA 4DV6J 3ZO7A 2MKJA 1OY9A 1H2TZ 3ENWA 4P72A 1S6PB 1KLMA 3H42A 5A8RB 1Q79A 2N7CA 5A8WA 3I56S 3R1LA 2BRKA 1SJRA 4ZVEA 2FVCA 2IM2A 3CW2C 3OR1B 2ACYA 1RWVB 4DG1A 1FKPB 3IS9A 2XMUA 4Y34A 2DD8S 2V4JB 4ZJQA 2BM1A 4HACA 2G0IA 4OX7A 3L3CA 3UCGA 4FYWB 4ELUA 1HR0J 1RT5B 4CTAA 3KOAA 2LQBA 2VUGA 4ATNA 4AYBD 1DTQA 1S9EA 2V5HG 3V2UC 4LRFA 4DR6F 2JFKA 1M1GA 4DR5J 5J2PB 2CDRB 2G0JA 3K8WA 2EFOA 3RR8A 4YR0A 3PFOA 2CXEA 1NZ8A 3SFUA 2O5DA 4MTPA 5LL6d 1LW2A 1T94A 3T1YJ 2ZJPQ 5E3CA 2ASDA 1REVA 2HVIA 1CJUB 1MROA 4DQRA 1CBKA 4C9DA 2V8PA 4X64J 4LR8A 3HVTA 4DR4F 4OHZA 3DKDA 3OL9A 4TLRA 2QLFB 3R97A 4A8YA 3KK3A 2CADA 3LP0B 1Y9OA 1IWGA 2AYEA 4DUYJ 4NEZA 3NGUA 2IYIA 5L1KA 3FZ2A 1D8YA 3ONQA 3BN4A 4DPXA 1YITS 3BZQA 1YTYA 1N33J 2K8GA 4O44A 2BE9B 3R6GB 4OJ1A 2WK4A 4O3SA 1D9FA 2BJDA 1DQ9A 2MMYA 1Q7YT 3KJNB 3MTKA 5B0EA 4B9NA 1BQNA 4MKAA 1D1UA 2A3JA 2RUSA 2NZCA 2GHVC 1UVIA 4ID8A 1JJ4A 1OPIA 2RE1A 4CLWA 2HVZA 1F5AA 3NAIA 4IFVB 2HFZA 3R5DA 1N5YB 2BE2B 3FEXB 1RTHA 1GT8A 3M32B 3TZXA 1RTIB 5KOXA 1XK8A 1H74A 3JTNA 4QWCA 1MMLA 3NCQA 3QSYB 3L09A 5IV4A 4TYAA 4DV7J 3HKZD 3E2EA 2FHJA 5LMUJ 2MKIA 2V2ZA 3MAQA 1X5TA 3ZZ0A 3OVBA 3GFZA 2KXHA 1F0XA 4KQZA 1I94J 2WW8A 3EXYA 2U1AA 1TKZA 5F0UA 4QW9A 3B6BA 1U47A 4JI4F 3GJTB 4H54A 1HBMA 2H65B 1M5SA 1U0HB 2XY6A 3ENVA 4M95A 2WHOA 2IM1A 1FD8A 5CCMA 2V50A 3EDRB 4EFAC 2QSFA 2QN6B 2KRRA 5KFMA 1PJ6A 1LFPA 5J2QA 1NRKA 1T9WA 3L7OA 1J2VA 1FXLA 1CJTB 1M1KT 1VQKS 3BH7B 3PIPQ 4DX6A 1VS3A 3TNVA 4OHXA 4F0KA 5RUBA 5IFMA 2PT0A 3CE8A 2W8KA 2CZ4A 2FIUA 4RNHA 3BPDA 2MJUA 1IKXB 4IR9A 2GQ2A 4V1Ak 2XWXA 2RMLA 3EGVA 1H98A 4WP3A 2DH8A 1TL1B 2C2KB 2ZH1A 2D1CA 4WBFA 2F40A 2M52A 2MHNA 3H5YA 4LSLA 5A0YA 1U1KA 2ZHOA 3HHLA 2I5JB 3ZTSA 3BPSP 3WHIA 5LT5A 4O0NA 4CH7A 4A46A 3UQSA 1S0OA 2YY3A 1U45A 3HZEA 2NXEA 1UZHA 4ECTA 2XMMA 1JJHA 4Q44A 4Q7AA 4FYDA 3GG0A 5KG3A 3VR1A 4WFNQ 2DNZA 1RT4A 3P49B 4M5DA 2O3DA 2L41A 1ZAXA 4X2BA 3KWMA 4OZLA 1F60B 2CPHA 4I6YA 1CQMA 1T03B 1LW0B 3C19A 1XTZA 5J2MB 5HJYA 2VQFJ 3PTWA 4WK3A 1CPZA 1QTNB 2OPSA 1YJVA 1FKOA 4USHA 2MHEA 2JVRA 2V2KA 1RWKB 2OSRA 2UU9J 1VQ9S 4JV2A 5U47A 5F9LA 2MLZA 1SKSA 2XI2A 5KTQA 2ZH7A 4K5RA 2MQMA 3AQPA 4U95A 1SV5A 2AJ2A 3OW2R 1S1TA 3QGGA 1VQ5S 2EFPA 3F41A 1HHTP 1ITPA 1SJ4P 1HIYA 1IBMF 1N5VA 5J2NA 4JI5J 2FVRA 4X4TA 3PY8A 4LF4F 4HEA9 5K8OA 2C3YA 1PC4A 3MCNA 3U1NA 4IO9Q 3CJ2A 3W3SA 1VRQC 5KG1A 1FK9B 4ZVPB 1NH8A 1J5EF 1RT2A 1LWFA 3OJUA 3OXFA 3R8YA 3G6VA 4F4XA 1XMOJ 5D3GB 4JOUA 4MIWA 3OHAA 1S6PA 1TMMA 4AXIA 5A8RA 2HHSA 2QMWA 5KAKA 4NRUA 2RHSB 2OPRB 3RRHA 1AUSL 1JIHA 1K73T 1YJWS 4DN9A 1CVJA 2LEPA 3CCTA 3IN5A 4E8UA 3LP2B 3A12A 2V4JA 2E5LF 4C2MA 1PSDA 3OL6A 5BJRA 3RBXA 3KMQA 5E3QA 2FLPA 2CPIA 2B5JB 1HBUB 2PO4A 2AJ0A 3DM2A 1KRPA 4KYZA 5A6WA 2HW3A 4CQ1A 3M7VA 1FD2A 5ETOA 5J2PA 1DAXA 3QT6A 2IM0A 2OD6A 4DV6F 4RBVA 3CDBA 1IR2A 1LEOA 4WFZA 4KT0C 2EWHA 4ED6A 4DBQA 3HX9A 4OMFG 1KNZA 4K4TA 2FLOA 1TVRB 4RW4A 2IIHA 3DRXA 2HG4A 4CLSA 2DYAA 4GO5X 2ZH2A 2IC3B 4OZ3A 4HDGA 1R6YA 2CJQA 3LP0A 1NMEB 3I82A 3T5KA 1RXOB 1W2IA 4WTOB 4M94A 3M8RA 3BQ1A 1YDLA 5CCLA 2VICA 1HR0F 4DLGA 5H9FJ 4HR2A 1N52B 3ZFVA 5KFDA 3OFFA 4QYZK 1QVFR 1WOSA 4DR5F 2DHAA 1RGVA 2KU7A 1KWMA 4KRWA 3OJSA 1UMJA 3A3OB 2J7WA 3H59A 5IT9Y 2XSJA 1QAYA 4X62F 1FEHA 1RU2A 3T1YF 1H0HB 4K4UA 5T14A 2KH9A 2HHHJ 1QDUB 4TY9A 2KG0A 3P8BB 5HMXA 1NJIT 1WTBA 2CJXB 1F9EB 1S57A 4X64F 2CZ9A 3AY0A 1EQ0A 1RKJA 3MD3A 3FBFA 4OYAA 2BE2A 3M32A 3FKBA 3AA8A 3TX0A 1RTIA 2YKMB 2WRMA 4C8MA 1Q4RA 2YKPA 2QRRA 3I6PA 1EB0A 3DRRB 3TVYA 4JV5J 1YVFA 5IQ6A 2FDNA 2ZM6F 2NXJA 4PR6A 3ZZPA 1KC8T 2VZ9A 1VQYA 3MWBA 3N6LA 3MZIA 3ICLA 1N33F 3MMBB 4PYAA 2QT7A 3ZC4A 4K7QA 2EW9A 1XNQF 1JXEA 4BLGA 4PPDA 1RAOA 1UVMA 4IG3B 4YB5A 1MG7A 4AL7A 1U0HA 4LF9J 3QRQA 3DGPB 1X4EA 5B7WA 4GVBB 4LBHA 2BX6A 3ZZZA 2IAJB 4EZ6A 2WTFA 2ZD1A 5ITHA 1SB6A 1XQIA 3C66A 4DV7F 4DR3J 2AW0A 2UZAA 5LMUF 2EBEA 5KG5A 4JUZA 1XN9A 2ZBIA 1N5SA 2OUGA 2DO0A 1RWMB 4ZCIA 5ETRA 4F02A 2CYYA 3N79A 3TUZC 3DLHA 1WG4A 3TYTA 1LWXA 2UVUA 1IKXA 4GO7X 3SV3A 4ZOSA 2ZHAA 1KKHA 2GAGC 2CJ9A 3UD5A 1HQ2A 5AE1A 2R9LA 4PUOB 3VAIA 2KO1A 1N6QB 5BYSA 4RUAA 5A6PA 1ZS6A 3MPUB 3JS9A 1KVKA 3G6YA 2BJEA 3W61A 4Y2IA 3W62A 1KHWA 3BSAA 4OZ5A 5DZ6A 2BKNA 4UOFA 3K5NA 3K5MA 2NXNA 4CLKA 2J7UA 3UFCX 2ZWPA 5F3ZA 3IRWP 4J9QA 1UPMB 5D8HB 2DGSA 2J76E 5I42A 3OLBA 5E5NA 3GYXB 3H5XA 2HHUA 2GIQA 1NHKL 2RS2A 3WZ0A 3V81B 1VFJA 5HVHA 4CT8A 3MM6B 3HFKA 1T03A 1LW0A 2PC6A 3D0HE 3GV7B 5J2MA 4NLUA 4MFBB 3RYLA 3EDQB 2Z2LA 1FVSA 4C0HA 4JI7J 2Q6BA 3TZWA 5L1LA 4IR1A 4DU8A 1I5OB 4J9PA 1P1LA 4RO0A 3GR0A 2ZH8A 3QLHB 4ELTA 2IMWP 1VBKA 4PWUA 2DNNA 4F3QA 3L95X 2AX1A 2M7SA 3T9NA 2HFSA 3M8PB 3SQOP 1RYSA 5M2PA 1FRXA 1OS5A 4BWJA 2Z0GA 4QOTA 4DX5A 1GMVA 3W9IA 3ENAA 2VQFF 4DF4A 6FDRA 3BO4A 5DZ7A 3KJFB 4KC5A 2FB0A 4PQUA 4RW7B 3VGUA 2UU9F 3FJ2A 3C6TA 1OJ4A 2OPRA 3PXGa 3AXMA 1HD0A 4Y2KA 5L1JA 3UO0A 2HGMA 4CLFA 4YS2A 4KE5A 4F3OA 3A8JA 4G1PA 4KR0B 2M88A 4G1QB 1S0NA 3ILOA 3KK1B 5B0BA 4NXNJ 2J0XA 2NYHA 1KVJA 4C3KA 3PFEA 4HTIA 4NA2A 1WTFA 4JI5F 3RAXA 3PW4A 4C11B 1I3OB 3NGSA 3IBFB 4CLZA 4USKA 2B5JA 2ZH3A 3LW5C 2GCFA 4M5MA 4USIA 5JJBA 2LQ8A 3W64A 3KHGA 1NCLA 4ZN3A 1WDTA 5KFNA 1UL3A 1XMOF 4ETXA 1NDKA 4OL8A 4LIRA 3GLJA 5HI7A 4K2XA 3CDWA 2OGUA 4ZVUB 3DLJA 2XHCA 3PYDA 3W2VB 4QIFA 5CD4A 3BBBA 3TA0A 2YVSA 4YQWA 4F4ZA 5KFTA 1TKTB 1R8HA 1CQNA 1R43A 3I9V9 4ED7A 1URRA 1KONA 3G87A 3D0GE 2IC3A 2KYXA 1WKKA 1CC8A 3NWGA 5KFEA 1RISA 4XK8C 1VC6A 3FMBA 2R7XA 2V69A 4DFMA 4IOBA 2W2MP 3HI9A 5HJXA 1OSDA 4I1TA 2Z57B 3HHDA 4ED1A 1VHFA 1WG1A 3RW6A 2RD5C 5KFGA 3J80Y 2UUTA 4YR3A 5H1SV 4NYPA 3POTB 4A8FA 2B9EA 3PR5B 4J91A 1JLGA 1U1PA 2X1GA 3EJMA 4MYTA 2W01A 3ENQA 1Q5VA 5GMEA 4ES3A 2VG5A 3RJMB 4DEZA 3EGWB 4U67Q 2XHWA 4ECRA 3DLEB 3TZZA 5HQ8A 1BWEA 2YKMA 4NLWA 4A8XA 2R2UA 2H3EB 3DRRA 2XLIA 3HSDA 4EBEA 4DV3J 3HSZA 1RTDA 4LRDA 4UZCA 3LTOA 2V4QA 5LJ3Y 2RQKA 3R5AA 1UA1A 2JC1A 6FD1A 2L9NA 3C15B 1RT3B 2GNKA 1GAOA 2Q79A 1XNRJ 2XNRA 3HFVA 4AQYJ 2GAHC 1ELOA 3FC9A 5HVGA 1NKCA 5F8JA 4IG3A 2HHHF 5C42A 2YKOA 4U96A 4OI6A 3C6UB 1IBLJ 1ZZFA 3FBEA 3OTDA 4KPYA 1RWWB 4ZIVA 4D3GA 3CCSS 2LEAA 4DWIA 1N32J 2BYCA 1DLOA 3RG6A 2VBYA 5J1PA 4NCAA 1J5OB 4PQAA 4CLTA 3QMQA 4ZPTR 4JV5F 2VOPA 2F1FA 2QJ3A 3MEGB 5KG2A 5A76A 1R27B 3BR9A 2C3MA 3ZZTA 2I8EA 1URNA 3D5MA 3ILJA 2YTCA 4YB7A 5KFCA 4EK2A 2BJ3A 4X4PA 1DJ0A 3PW5A 1FRHA 4OZ2A 4OX9J 5F0WA 4PUOA 4URSA 2HZVA 3H8YA 2Y1RI 2PFFB 3RUBL 2CJAA 2MZJA 2DCUB 4QPXA 4NLRA 2UP1A 1FNOA 1NZAA 2ZBQA 1Y10A 2D3OR 2VL1A 1Q7LB 2CNKB 3IWXA 3MUVP 1VRTB 2DR9A 1OSCA 5HQLA 2M3DA 4FXDA 4XTTA 4A8WA 1U1LA 4DR3F 2HWHA 2L08A 4NOHA 4PXBA 3CJKB 1T0TV 1XEZA 1RACB 2NSCA 2OH2A 3W2WA 3H2VE 5E0OA 3NBPB 1GK8A 2ZC4A 3NL0A 5HANA 5HVFA 3ZXWA 2MPUA 4OZNA 2GO9A 3V81A 2HQ3A 5CYMB 1WEYA 1T7PA 3G8SA 2FUG9 4WJBA 5KG6A 1ULRA 1S1WB 1QVGR 3PIOQ 3V4IA 1T02A 3FDSA 3MM6A 4JB8B 2VC1A 2CJBA 3PNIA 4K5SA 2N4DA 3T41A 4MFBA 2HLTA 3TUJC 2ADCA 2Q66A 2MYFA 2QL9B 2YNGB 4LF2A 1JXLA 3QT5A 5IWAJ 1BUXA 2MLXA 4ZPCA 2OEJA 1DRZA 2ASJA 4FNHA 4TKTA 4FF1A 2YNIB 3R7NB 3BO3A 3IBWA 2DISA 1Y5LB 1JKHB 2H51B 3BSNA 2C28A 1UJ6A 2AD9A 4IH6A 4CO0A 3THVA 1R8PA 4C48A 4PG6A 4Y2AA 3IRXA 4GRSA 1D09B 3D4JA 1KQGB 2XMAA 2HBQB 5FIIA 3W66A 1F2GA 2HZCA 4PAAA 4P2MA 3P5TL 2B6AB 1WHVA 4ZVSB 2DH7A 3KK2A 2NLWA 4NLVA 2VB6A 2YWKA 3B4DA 1OPZA 5IC4B 4RW7A 2RKIB 2BVZA 2Z58B 1WOOA 3W1YC 2ATCB 2Y0SD 4NMXA 3SYZA 3CULA 2XGQA 2RB7A 2IJRA 2MKHA 3GE9A 4IRDA 3M9NB 5D4LA 4R5PB 4EEYA 4DX8H 1T05B 4G1QA 3KK1A 4M1KA 1IQTA 3JSMB 3PR4A 1S72S 2X1BA 3SEOA 3K58A 3ETOA 3EUNA 2XZWA 2Q6CA 4C11A 1RHRB 4N77A 2HVHA 3Q8UA 3Q8PB 1UVNA 1E6YB 2KB2A 4FBTA 3N0VA 3CJSA 4DFJA 3EPGA 4PG7A 1PCAA 4TU7A 3CCLS 1RAFB 1Z1ZA 3G9CA 1HHQA 4DV2J 1FFGB 4W98A 1ROFA 5I4MA 4LFAJ 2MY8A 2C2MB 3G6ES 2QFJA 2BM0A 3D67A 1PC5A 1ZAWA 2W9BB 1LNQA 3I0SB 3W2VA 4TU9A 2VU5A 2EC2A 3HVAA 3IG1B 4DSLA 2JOQA 3R6LB 3EXCX 3TJAA 1F3FA 2HQDA 4NXNF 4CDIA 2F9JA 3MMCB 2MQPA 4USJC 4OLOA 1R6VA 5IOLA 3CD6S 3TX8A 3N28A 2M4MA 1WKJA 2R7VA 3MI7X 1CS4B 1HMVB 3U1LA 4KGXB 2IDEA 4B3SJ 2HK3A 4DV5J 5HP1B 2X3GA 4KIAA 4B3MJ 2E1PA 2F9DA 5DO2A 4YOEA 1C0UB 2HNYB 3R7BB 3KDNA 4F2SA 5I3UB 3TAQA 1RBAA 3POTA 1WACA 2WVCA 3KDOA 3KJQB 1TKXB 2UV8A 2DEJA 4EWTA 5GVQA 2XEXA 3ELHA 3TP2A 1EX8A 4B9UA 4AFFA 4FPIA 3IM8A 2VFRA 4KSEB 4LBIA 3SQGA 4B17A 4G1IA 5KFYA 2GJIA 2AKWB 2IJNA 3DLEA 3P3DA 1KN6A 3MD1A 3DOMB 3UVJB 2D3ZA 3DC2A 4E0DA 3KJVB 3JSRA 3NGKA 4OIXA 4I64A 1U2FA 4YY3J 3DLGA 1H3DA 3RAMA 4P6QA 1CJVB 1X31C 2RUGA 4XAKA 4HHUA 2QEXS 4FYXB 2EC0A 2IVMA 3OD2A 1RWXB 3OFGA 3PW7A 1RT3A 3I4HX 1Q16B 1FCAA 1KS2A 5KT5A 3BH6B 4NI2B 1IBKJ 2CVIA 3TR5A 4O3QA 3TRGA 4LF6F 2DIVA 2XBPA 3C6UA 1KDNA 1SC6A 2P9GA 2WVEA 1IR1A 3BB5A 1GFWB 1RSCA 3WIVA 3TUIC 3CGIA 2CQBA 2FGCA 2CQ4A 2ATLA 1FJGJ 2V4RA 1P27B 3QBCA 4B9TA 4Q2LA 4XIUA 1TTHB 3G71S 5J1EB 1NPKA 1NUEA 5F8LA 3BYPA 1KBRA 3O5TB 4EBCA 3A8IA 3EGZA 2FJXA 4ZVOB 1XNRF 2F65A 1N0VC 4IKAA 4AQYF 1T9XA 1UEUA 1TELA 2ZZMA 4ZLLA 4Z7CA 3BQ2A 4OI4A 1IBLF 3GSIA 4KHMA 4LVNP 2WVFA 3BBFA 1S1UB 2FJAB 2J9EA 3MHYA 3CDAA 4P73A 1VRTA 1KTVA 1XJWB 3OR2B 1ZM3A 2G4BA 1H72C 2B9WA 4F2RA 5C5JA 3GV8B 5F8MA 3CO9A 4I6WA 4U9RA 2ZDOA 1OYDA 3CB4A 2PGCA 3QFWA 3NBPA 1LWEB 4EO6A 1A9NB 2DNOA 5F8HA 1ZAVA 5CYMA 4MJKA 2E1AA 2O67A 4OX9F 3PX6A 1VQPS 4J7CA 2MZRA 1S1WA 2E66A 3WDOA 2K06A 3RU0A 2J6SA 4ILRA 1MU2A 4FPRA 2W7AA 2YNGA 1X0PA 3KNAA 4F25A 5SUHA 4M5GA 2MKSA 4R8UB 1IJFB 2CQ2A 3J81Y 2H1YA 5SZTA 2FD2A 3DLKB 4ALZA 1JKHA 4X4VA 2CPEA 4KTQA 2RIJA 1TL7B 1LKZA 3GPAA 3BM7A 1N36J 3UDLA 2ZBRA 1IVZA 3LA0A 4KO0B 2X1FA 1LK7A 2XB2D 3QT8A 3SFGA 3DN9A 4ZVFA 4X65J 1IWAA 4RU2A 3HM9A 4ID5B 1TFWA 1B3TA 3C16A 1WC1A 4TY8B 2B6AA 1SKUB 4CRJA 2VJVA 1VIXA 4FDFA 2RKIA 2OTJS 5IWAF 2J6TA 1X0FA 4NYZA 4AL5A 4OYPA 3M6VA 3HDSA 1VBYA 1WHYA 3IA0A 2HAIA 4R5PA 4V19J 1H73A 2O1PA 1T05A 1VQ4S 1N5QA 2GVDA 4PYDA 3E8OA 4JI6J 1RTZA 5E2QA 3K57A 1VHIA 3BF4A 3IP0A 3KLEB 4ERDA 3I87A 1VQ7S 4P9SA 4CO5A 4LFCJ 2VG7B 3CVKA 2AGPA 4TQSA 2G0CA 2PN6A 4ECVA 4K50A 2WBMA 3NAHA 3BGLA 3AJDA 1R8BA 2MSSA 1FERA 1DZ5A 3M6WA 3O1LA 4NCGB 3BREA 1M90T 3KYLA 3U27A 4AXJA 5HAOA 2BMBA 4UUWA 1SC4B 4TXSA 1AA1B 3HD2A 1NM2A 3IG1A 4HT5A 1WD6A 3PYGA 1SL2A 1JQGA 3I4PA 3D6TB 2KN4A 1NEEA 2DRDA 4RNMA 4ECQA 2OFHX 5GADU 4DSFA 3MMCA 1EAYC 2PA8D 1JLAB 5AXKA 2EKNA 2GS8A 1F9FA 1NDPA 2RSQA 4MYUA 2GVZB 4IG0B 3KLIB 3VVUA 2BJ9A 2CWXA 3G6XA 5L46A 1CS4A 2LXIA 4A4JA 2RDJA 1HMVA 5BYRA 4KH0B 3PEHA 3D54A 4DV2F 4ED2A 2HQGA 1HBOB 1P1TA 3FCHA 4LFAF 3GIJA 2HNYA 4YN3B 5FLXU 2MKYA 1K8AT 3CJ4A 5A2QY 4ZMMA 4TN2A 1MMDA 3TWZA 2ZBCA 1HQEA 4WE1B 1Q1KA 4MKYA 1RAEB 4PXDA 1M0SA 4YMEA 1QSYA 5CZVA 4NWBA 3T5HA 2MLYA 3UVJA 3TI0A 3KJVA 1BXNA 2C2RA 1HNIB 5DG8A 4CM2A 3MM5B 3WX8A 4H4OB 2RF2B 4MKBA 4B3SF 2GHPA 1CJVA 3NOGA 2DNKA 4DV5F 3KUGA 1NDLA 2A6OA 2DNLA 4ZLPA 2C22A 3C2PA 1A0OB 2BACA 3IGVA 4B3MF 4AUKA 1FX2A 3HMJG 1S59A 1RWUA 2ZKUA 2OD4A 3Q8RB 3MR2A 1IM4A 2XO6A 3BDPA 3D1QA 3M4XA 3EE3A 1RE1B 4HKQA 3DMJB 3GZ7A 1TFYA 3DU5A 4UOGA 1W26A 3AHPA 2EG1A 3DU6A 1UFLA 1S6QB 1NSQA 1FRMA 3G8QA 3GTYX 4DN0A 3C14B 2DPIA 3HO1A 4FBUA 8AT1B 1BGXT 4YY3F 4FS1A 2DGQA 1HYSB 2FVSA 2L9DA 1YJ7A 2QYCA 4WP8A 4I2PB 2OLWA 1VRUA 3T3FA 4P7TA 1WF2A 2I1RA 1YX2A 2IA0A 2E5JA 3K5LA 2VONA 1IBKF 2OMLA 4LFBF 4PABA 1NK6A 4OYOA 2DNYA 1Q81T 2FJEB 1M5HA 3AH6A 1S1UA 1X4HA 2F3JA 2WCXA 1O8BA 2UUBJ 2CNLB 5C7PA 4ES1A 2VKZG 3S6EA 2ERRA 5D78A 3CCWA 4MIBA 2QLWA 4DV1J 4ZPAA 5AXMA 5GAGU 2SXLA 2YXLA 3A8EA 2HS3A 4IFYB 2J8SA 3MXHP 3DRYA 4ZPBA 1R0CB 4CO4A 2P8IA 1AUDA 2HRTA 2BE7D 4Z37A 3JAMY 4M5KA 2ZWOA 4CWBA 4DS5A 1F1BB 3M30B 3ZZUA 2F8HA 3HHLC 3NY0A 4XO0A 2P5VA 2EI5A 5KFIA 3GIMA 1J27A 1JX4A 3GG1A 2BRLA 4WYWA 5GADI 2YKNB 4HHHA 2DB1A 1FDNA 1L3SA 1NAQA 5CHCB 1QSLA 1JLBB 2E5HA 4R8UA 4ZA1A 4FXWA 1VMBA 4RBUA 2FHOB 4DI6A 3DLKA 3M9OB 3D6FB 1N8RT 1TL7A 1G3OA 4USMA 5LOQA 2JJ4D 4F4KA 4WF9Q 1DTTB 2DRAA 4KO0A 4ANDA 3THTA 1KFDA 2FC8A 4DPTA 3KUHA 3D6HB 2MZQA 2Z56B 4ID5A 4BWMA 2RVJA 2YNHA 2EBGA 2CQHA 3R5JB 2FVPA 4H4KC 1SH2A 1ZA1B 3NXZA 5CAAA 3CPWR 4TY8A 4IOAQ 1QAIA 3NP5A 4QQBA 1HW8A 4C97A 2ASLA 1X4DA 4WFAQ 1GNKA 3OL7A 5J1NA 2ALYB 3O6QA 5H9EK 3Q2SC 4C3LA 1ZOTA 1HBNA 2PMWA 4MAKA 3UR0A 3MM9A 3PRDA 2BXJA 2PE8A 4DX7A 1U2CA 2NS1B 3L4BC 3C3LA 3H2UB 3LPEA 2Y8WA 1RTJA 3FFIB 5HATA 1N36F 3M2RA 4RLEA 5DM6Q 3LF0A 2AWZA 1HQUA 3MMAA 2Y8YA 1KQFB 2C2EA 4TNOA 3I5AA 3KG4A 3FK4A 4WKYA 1RCXB 4HI2A 1U6FA 1QUVA 3KLEA 3N6MA 2VG7A 1WSVA 2DGOA 2K3KA 3UI3A 3DYAB 2NYIA 1RCOB
chains in the Genus database with same CATH topology
2Y9HA 5CD4A 1WJ9A 5H9FK 2Y8YA 3QRPA 2Y8WA 4U7UD 4DZDA 5H9EK 3QRRA 4QYZK 3QRQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y9H A;  5CD4 A;  1WJ9 A;  5H9F K;  2Y8Y A;  3QRP A;  2Y8W A;  4U7U D;  4DZD A;  5H9E K;  3QRR A;  4QYZ K;  3QRQ A; 
#chains in the Genus database with same CATH topology
 3HJV A;  2QLX A;  1L3V A;  2ZH5 A;  3H5S A;  2XCA A;  4EGL A;  1HWL A;  2MXY A;  5KFQ A;  1GXU A;  3R5C A;  1TP7 A;  3KMS A;  2AZ3 A;  2KTQ A;  4CZC A;  5LSL A;  3KLF B;  4ED5 A;  1T9V A;  3LGN A;  4PWD B;  1HI8 A;  2VBX A;  1IKW A;  4IYQ A;  3RB0 A;  3SCK E;  3IXQ A;  2XZD B;  3QPI A;  2IVF B;  2DGX A;  1VQM S;  2WW4 A;  5FD1 A;  4JI6 F;  5THW A;  1JLA A;  4QR2 A;  3MMJ A;  4LSZ B;  3T1H J;  3LP1 B;  2GVZ A;  3KLI A;  3UE2 A;  2BKO A;  3O8W A;  3LGH A;  2AZ1 A;  4LFC F;  2VIH A;  2YKQ A;  1PYO B;  1YBT A;  2G13 A;  2MGZ B;  2PEB A;  4OJ3 A;  2KFY A;  1CC7 A;  2XLK A;  3PZP A;  2NXU A;  2BZ2 A;  2XSF A;  2QA2 A;  1CUL B;  1UZD A;  4DL7 A;  4UUX A;  1N34 J;  4QCL A;  3JTP A;  3WBZ A;  2HNZ B;  1MWZ A;  1CEZ A;  1D0E A;  2XZT B;  2AP6 A;  2QYG A;  4NRT A;  3T19 A;  5JVG Q;  5GAG I;  1H6K X;  1ZPW X;  4PPZ A;  4DQQ A;  3G4S S;  4I2Q B;  4WE1 A;  1QJH A;  2R2T A;  3QIP B;  3US5 A;  2FVQ A;  4OZ0 A;  2R7T A;  2DO4 A;  1YBU A;  3UDC A;  1TL3 B;  4LF5 J;  1HNX J;  5DG7 A;  2CQP A;  4CO3 A;  1HNI A;  1K47 A;  2KL8 A;  5DJB A;  4H4O A;  2RF2 A;  5KFB A;  4DQI A;  2FQQ B;  1U7L A;  1F5C A;  4WU3 A;  4QWD A;  4KB7 A;  3HK2 A;  4FYV B;  4RX6 A;  3LWM A;  1IKV A;  2HBR B;  4N8O A;  2UXC J;  2QGF B;  2LDI A;  2RT3 A;  4ILM A;  2NSB A;  5KFW A;  4DZ6 A;  2GJF A;  3G82 B;  2OSQ A;  1C4A A;  1FTC A;  3HD1 A;  4J9S A;  2Y1I A;  1XC9 A;  5M2U A;  2DR8 A;  2ZH6 A;  3D3B J;  3MAA A;  5BXI A;  1F9H A;  2J0W A;  2R8H A;  3PVX A;  1MW7 A;  2QFI A;  4N47 A;  3RZA A;  3NOC A;  1ZM9 A;  3S01 A;  2F5G A;  4YHH J;  2XO7 A;  4K8R A;  5DM7 Q;  1KHV A;  3PHE A;  3EIC A;  3QJJ A;  4DFP A;  5HK4 A;  4J90 A;  3X1L B;  1K0T A;  1EP4 B;  1EET B;  2K7J A;  3C14 A;  1YJR A;  2K3I A;  3PW0 A;  1YI2 S;  4LUB A;  2B4O A;  1JLE A;  4B9M A;  1RLC L;  1HYS A;  2VAS A;  3WX4 A;  2IMO A;  4I2P A;  2YPY A;  3TAM A;  3KLV A;  2CKW A;  2H5E A;  4EUV A;  4B9V A;  3E01 A;  5HLF B;  3H7H B;  3LOU A;  4F26 A;  3M8Z A;  2DT9 A;  5HSP A;  3NMA A;  1VQL S;  3PG9 A;  1BHN A;  1GMU A;  7FDR A;  3TO8 A;  2PII A;  1VI7 A;  2FGO A;  1R8A A;  2NCK L;  4QWA A;  4WFB Q;  4ZCK A;  4WU2 A;  3DDI A;  1JLC B;  2W2P P;  4ZP7 A;  4DR1 J;  1DQ8 A;  3QWU A;  2YWG A;  4KFB A;  4N76 A;  4KHP J;  4O3P A;  1YG0 A;  2GA7 A;  1VQN S;  2B3T B;  3SXL A;  4OV6 A;  2DH9 A;  4ZJL A;  4UQG A;  2BBE A;  4PXC A;  4IFY A;  4KGZ B;  1RA7 A;  3MPV A;  2KXF A;  1TK0 A;  1NSA A;  1R89 A;  1T3O A;  1HNV A;  3BO2 A;  3K7R A;  2JEF A;  4IDK B;  3AA9 A;  2AHO B;  5B0F A;  4GKK J;  4ZP8 A;  3M30 A;  4P7V A;  1HNW J;  4YDD B;  1NK0 A;  4J9R A;  5LMN J;  2LQJ A;  1FX4 A;  3DNC A;  2V9W A;  4W4M A;  5EWF A;  2CG8 A;  2MKK A;  1PO6 A;  5ETV A;  2YKN A;  1RKI A;  2DY1 A;  2UUB F;  3AXK A;  2HQI A;  2MQL A;  1B4S A;  2VKR A;  4NYO A;  1R7I A;  1OQ3 A;  2ROE A;  1VQ8 S;  4DCJ B;  1Q82 T;  2OPQ B;  1VJW A;  5DLF A;  2KJW A;  5KOW A;  2ACM A;  2AJ1 A;  4DV1 F;  3HFZ B;  4NX9 A;  3B78 A;  4G6V B;  4F8R A;  3NG8 A;  1V3S A;  4C8Z A;  3PO5 A;  4FF2 A;  3D6M B;  1EKS A;  1RWN B;  4U8V A;  3UN5 A;  3RB3 A;  4DDF A;  2G1D A;  1SUQ B;  2E1R A;  2HPU A;  1HWI A;  4OZ1 A;  2EG2 A;  1RAD B;  3CTR A;  3O3L A;  3D9B A;  3ZTQ A;  1O6X A;  3H0P A;  2ZFH A;  1WF0 A;  1S76 D;  2OEM A;  3W60 A;  4ZPV R;  1Y7P A;  2CPZ A;  3N4W A;  3M8Y A;  4O3O A;  5IZH A;  3GP9 A;  1M5V C;  4C8O A;  1RWP B;  4Q45 A;  4RW9 B;  2IBK A;  4ELV A;  3GFH A;  3FFI A;  3R5G A;  2VOD A;  3MFH A;  3TVK A;  4DL5 A;  2CQD A;  2MZT A;  2R7O A;  2AJ4 A;  2Y3Y A;  3UN2 A;  1JLQ B;  3MTJ A;  2EK1 A;  1JLF B;  4G65 A;  1Y0H A;  3PYE A;  1GEH A;  3OT9 A;  1OYE A;  2YX1 A;  4NLS A;  1TKD A;  4C8L A;  3P5B P;  4LT6 A;  1AFI A;  2ZEJ A;  2IFX A;  3V6D B;  1HPZ A;  1U26 A;  1FA0 A;  2DPJ A;  5D77 A;  1MSW D;  3CCV S;  2EK6 A;  1YIJ S;  1XR6 A;  2H9Z A;  1TZ0 A;  4C0B A;  3KLF A;  2AJF E;  4OYZ A;  4LF8 F;  1S1X B;  4KGK A;  2CG4 A;  2R8K A;  3OSN A;  2OO4 A;  2VG6 B;  1Q8B A;  4P2X A;  3IO1 A;  3PW2 A;  2F7V A;  1S79 A;  2HFN A;  4ZCM A;  3EYZ A;  3E51 A;  4RJV A;  3RW7 A;  2VFS A;  3DDK A;  4HHJ A;  3VTI A;  1TU0 B;  3JXO A;  3HCX A;  5DLG A;  3MR3 A;  3MOZ A;  1TV6 B;  3MEC B;  2WB1 D;  4RUC A;  1IN0 A;  4H4K A;  2MGZ A;  3NGD A;  1FRJ A;  1PG5 B;  2WOM B;  1X60 A;  3KHH A;  2RAQ A;  2BAN B;  4LMZ A;  4CP5 A;  2IA6 A;  1WG5 A;  4PG8 A;  2HNZ A;  1D8Z A;  4O3R A;  4B3O A;  4DMZ A;  2E1C A;  3I9Z A;  2WB4 A;  1WC0 A;  2IRU A;  1XR7 A;  1MWQ A;  1NPP A;  4JYA J;  4ZDN A;  1WHX A;  4MKV A;  2MEW A;  3PEJ A;  2ZVS A;  1N5T A;  4QU7 A;  2QO3 A;  4ER8 A;  3W5Y A;  3CO0 P;  2G1H A;  1MN7 A;  3T1H F;  1P9Q C;  5CZX A;  1S0M A;  2XGP A;  1TL3 A;  2KYZ A;  3OFH A;  4GMK A;  2FZK B;  2W4P A;  4CIO A;  3W5Z A;  1EQM A;  3FCV A;  1JWW A;  3BS9 A;  1X5S A;  4IH5 A;  1WNE A;  2FPH X;  3OR1 A;  1YRX A;  2YX7 A;  4DHV A;  1FKP A;  1BQX A;  1QM9 A;  2Q3P A;  3TA2 A;  2A18 A;  4LVO P;  1N34 F;  3G82 A;  3NNH A;  3AJ1 A;  2EPI A;  4JI8 J;  5KT4 A;  1U09 A;  3GWC A;  3RBD A;  2MDA A;  1RT5 A;  4UF4 A;  1M5P C;  2ZHB A;  1PJ7 A;  4OQJ A;  1FDD A;  2JFD A;  3SV4 A;  3TJ8 A;  1EJ7 L;  4UT4 A;  2OIH A;  2XWY A;  4QYZ J;  1SI9 A;  2XTJ P;  3D68 A;  1S9G B;  3IAS 9;  4OYM A;  4DL4 A;  1HNX F;  3BR8 A;  1PYS B;  2V8V A;  3NNA A;  1HW9 A;  4F04 B;  2C2D A;  1CJU A;  1H2U X;  3IS9 B;  4K59 A;  2VQE J;  3UPF A;  4ZLN A;  2NUH A;  3F73 A;  3RB6 A;  5K8N A;  4X84 A;  4OYX A;  4HAC B;  2UXC F;  2VPY B;  1SIW B;  2LKZ A;  3BKT A;  2HHV A;  4CTA B;  1RAI B;  1HAR A;  4L6V 3;  4ANE A;  1S9F A;  1DTQ B;  1S9E B;  2IPO B;  2CQ1 A;  4QBU A;  5K5M A;  4Y2C A;  2XLJ A;  3T5J A;  4ILL A;  1X4G A;  3KNG A;  1WEX A;  4RUH A;  4YHH F;  1LW2 B;  3R2D J;  4L3N A;  2HZA A;  1YJN S;  3MCO A;  2OKQ A;  1MRO B;  2ADB A;  3I31 A;  3M2V B;  3KLH B;  2J9D E;  5KFX A;  2C2Z B;  2D9P A;  3R3T A;  1FRK A;  1T9Y A;  2XMT A;  2C2N A;  5ETN A;  3DFE A;  4IFV A;  2UUC J;  4P74 A;  2CPJ A;  1RU1 A;  2MTL A;  4IDK A;  1N5Y A;  4B9L A;  5EX0 A;  1YKW A;  2WON B;  1WKL A;  2L3M A;  4M8L A;  2O01 C;  2JNJ A;  1V9O A;  3S1T A;  5AXL A;  2GZO A;  4DUY F;  2N4C A;  9RUB A;  4ZN1 A;  3NLC A;  3P4U B;  4O44 B;  2AQ4 A;  4WCE Q;  1X4B A;  3TVZ A;  2LA6 A;  1PBU A;  2AMC B;  3DRS B;  5D0E A;  3JSY A;  3O2I A;  2PDA A;  3D66 A;  1WC4 A;  4DR1 F;  3BV8 A;  4CNY A;  3CJ0 A;  5IT4 A;  3K5P A;  2J5A A;  2VPZ B;  1G7C B;  1H2V Z;  3GJS B;  4KHP F;  3BKU A;  1NJY A;  1JB0 C;  2NXC A;  2W2Q P;  2ZZN A;  4ZP9 A;  4EMD A;  1YGY A;  1RTH B;  1S7I A;  3LAK A;  2M8H A;  5G4D A;  2JEG A;  3J7Z T;  4XDC A;  1SUQ A;  2OP5 A;  2ZOM A;  1WOP A;  3KHR A;  4GKK F;  2DGV A;  1X9S A;  3PHT A;  3JQJ A;  4WP9 A;  2W1B A;  1NXI A;  4TVA B;  1HNW F;  3EWG A;  2KRB A;  5B0D A;  2HHT A;  3AT1 B;  3ULH A;  5LMN F;  2E9Z A;  3MEK A;  3FCW A;  1A6L A;  3SDE B;  2XQC A;  2AGO A;  5KT2 A;  4DR2 J;  2GMH A;  4UOC A;  2V8G A;  1TKZ B;  4NXM J;  1CJT A;  1WJ9 A;  5F8G A;  1GQE A;  3O44 A;  2GJ2 A;  1AFJ A;  2C1E B;  2DTJ A;  3T5L A;  3B54 A;  2HBZ B;  4DPU A;  1I94 F;  4J37 A;  1F3V A;  4HI1 A;  3T6B A;  2V8H A;  3FQK A;  5IC6 B;  2N3L A;  1B0P A;  1X5O A;  3CDU A;  5EHH A;  3IMQ J;  1Y3K A;  3LUY A;  2V8D A;  2OEL A;  1JLQ A;  2RQ4 A;  2BAB A;  1R0B G;  1TL1 A;  4DPW A;  2HHX A;  5EN1 A;  3HZG A;  4HVZ A;  4F4Y A;  4DSE A;  4DQS A;  4M5I A;  2ZNY A;  3I0R B;  2I5J A;  1VBZ A;  8RUC A;  1V5I B;  5DET A;  1TK8 A;  2KKH A;  3IAM 9;  2B8Q A;  4X4R A;  4RU9 A;  5AT1 B;  5GAE U;  1JJC B;  2V34 A;  2DIT A;  2FTR A;  1G6B A;  3MED B;  2I38 A;  2RH3 A;  3R2C J;  1UW4 A;  4Q43 A;  3QGI A;  3BGR B;  2YH1 A;  4UST A;  1QE1 B;  3AAW B;  1NDC A;  4LSL B;  2APO A;  1S0V A;  5A0Y B;  4OX6 A;  1Z2L A;  3LWL A;  4CLL A;  3MOJ B;  3VZI A;  1TV6 A;  3D3C J;  3MEC A;  3ZTO A;  1UWB B;  1DBD A;  2J9D A;  2DXD A;  1KFS A;  2VA3 A;  4DR7 J;  2ZIT A;  3D2W A;  3J7A N;  4R25 A;  3JYT B;  4NEY A;  1SQG A;  3DCA A;  2LEB A;  1HL6 A;  4E2F B;  1Q86 T;  1RUS A;  4ZS6 A;  2AEF A;  2QIF A;  1VK8 A;  2K1R B;  1TUV A;  3CJ5 A;  1RAB B;  3BQ0 A;  3HP6 A;  3DGV A;  3QRR A;  4DUZ J;  2PEH A;  2OPS B;  2KT3 A;  1FKO B;  5GMK a;  3IR7 B;  1FK9 A;  1X7V A;  2XC9 A;  3VQT A;  3TJ9 A;  2XUL A;  3R27 A;  5D3G A;  1TMJ A;  2R7Q A;  3J7Z 5;  1UAW A;  1GMW A;  3OTO J;  1S1T B;  3A3P B;  1FJC A;  2EKY A;  2YQ1 A;  2C3U A;  3H98 A;  2NPI A;  2XY5 A;  3OPK A;  2B9X A;  4L3K A;  5J2N B;  3HJF A;  2FJD B;  1Z4U A;  1X4C A;  3LP2 A;  2DXE A;  2D7S A;  3AD9 C;  4OV1 A;  4FKX A;  2BDP A;  2H5J B;  1FXD A;  4HH0 A;  2V67 A;  1T3N A;  1RT2 B;  1LWF B;  2MQO A;  1HBU A;  2FHK A;  3MFI A;  4JYA F;  2X7I A;  5EX3 A;  4EYI B;  1U6Z A;  1KEK A;  1ACM B;  1SH3 A;  4NZ0 A;  1MN9 A;  1HI1 A;  2QMX A;  3IWN C;  2LXU A;  1S9G A;  2RRN A;  5E3R A;  4BS2 A;  2KG1 A;  1Y3J A;  5B09 A;  4W92 B;  3NNC A;  2O66 A;  1VK3 A;  5HL7 Q;  2AGQ A;  3U1M A;  4M63 A;  1T95 A;  3KG0 A;  4O3N A;  1FDA A;  3PKY A;  4GVL A;  5AJ3 J;  1TVR A;  5LM7 E;  2WSF C;  2RJZ A;  4Q8F A;  1Q5Y A;  1NK8 A;  1ZH5 A;  2POK A;  3OXL A;  1KP6 A;  3IM9 A;  2B56 A;  5D4N A;  5DRK A;  2J0Q D;  1RI7 A;  4ECY A;  3DM2 B;  4JI8 F;  2KT2 A;  3ZNJ 1;  2N3O A;  3JTO A;  2VHG A;  2W25 A;  1QSS A;  2CNO B;  3ZZY A;  2M5Y A;  3BGF A;  3KKF A;  5IT0 A;  3HHN B;  1VC0 A;  4X62 J;  1FKA F;  4WTY A;  4C98 A;  4ENO A;  3CC4 S;  4RW4 B;  3M2V A;  4N5S A;  1KQK A;  3KLH A;  2VC0 A;  3OSP A;  3U02 A;  2QV6 A;  5KFJ A;  3OQ2 A;  2BOP A;  2DRB A;  1SQE A;  2VQE F;  5GAE I;  4WYL A;  2OI2 A;  2PMH A;  1NBE B;  2BJ8 A;  2LYV A;  4WZM A;  1HWJ A;  1NND A;  4U7U D;  3PKM A;  2ZM6 J;  1XR5 A;  2LQ5 A;  3BDE A;  2WON A;  2HBY B;  4I68 A;  4ZPD A;  5KFS A;  3W65 A;  2A2D A;  2B4V A;  1UVL A;  5L8R C;  2ILY A;  2RQC A;  2EVZ A;  3DRS A;  2XSJ B;  3ZTR A;  1XNQ J;  1DY3 A;  4IQM A;  4KH1 B;  4OJH A;  2CZV C;  3MMB A;  2QLB B;  3K8V A;  1X9M A;  1P8G A;  4DZD A;  2DIU A;  1RHU B;  1APS A;  1SCJ B;  4LBP A;  1D9D A;  1HD1 A;  5F3T A;  4PEO A;  1RZM A;  1FTR A;  4ETZ A;  2P6S A;  2CJK A;  4F0H A;  3I32 A;  2XYP B;  3CD5 A;  3DGP A;  4ZP6 A;  2UUC F;  3AD8 C;  1IM6 A;  4GVB A;  2A2C A;  1RP5 A;  2IAJ A;  5MAO A;  3MF5 A;  2KFN A;  2R4F A;  3OFE A;  2LDY A;  5I3P A;  3N9U C;  2I9S A;  3ZNU A;  5F8N A;  3SDE A;  3TAN A;  1PAU B;  2CFX A;  4RW6 B;  1T11 A;  4CLU A;  1O51 A;  1H7X A;  2B7C B;  3DRP B;  1ZTT A;  2HMI B;  3MEE B;  4FVC A;  3TQE A;  3PRV A;  3TEG A;  2GIR A;  1S5Z A;  2FY8 A;  1S97 A;  3G2X A;  3QGP A;  1N6Q A;  3OLA A;  3V6H A;  1F6T A;  4LF9 F;  2ZD1 B;  2JHE A;  3KG1 A;  2DGW A;  1FXR A;  5DQH A;  5HMW A;  1U02 A;  1JK9 B;  4LF1 A;  4QW8 A;  3I0R A;  3LGM A;  3MUT P;  3PDN A;  2C42 A;  2VFT A;  4ZHR B;  2ZBP A;  1PJ5 A;  1I1G A;  4Y3C A;  2YQ0 A;  1Q53 A;  4F4W A;  5HBM B;  4L75 A;  1Q8I A;  4DR2 F;  4URG A;  4NXM F;  4RL1 A;  2P9E A;  1C1B B;  2ROP A;  6AT1 B;  1L3K A;  3NCP A;  3M2U B;  2ZUG A;  2NRE A;  3B4M A;  3HPO A;  3MED A;  5D0G A;  3Q83 A;  3W5X A;  4LF7 J;  1I6J A;  2UVR A;  1RBL A;  2RDI A;  2GMJ A;  3BGR A;  4DL0 C;  3CIZ A;  3QAU A;  5ETM A;  2KFZ A;  4M5J A;  3A1Y G;  1DQA A;  1QE1 A;  1VDH A;  4CCH A;  3QJL A;  3CNQ P;  4CT9 A;  4K0K J;  1Q8K A;  3IBC B;  4UOH A;  4YEA A;  4NLD A;  2A10 A;  2DNM A;  4KAI A;  3LAL A;  3R7S B;  3K89 A;  5CXT A;  3B82 A;  3ZZR A;  1UCN A;  1ICE B;  3D1H A;  3Q8Q B;  4DSI A;  2OTL S;  2DR5 A;  3FRZ A;  3UDE A;  1UWB A;  2LU2 A;  2IRX A;  3SCL E;  1D3W A;  3GIR A;  1W2B R;  3JYT A;  5I42 B;  1GTH A;  1VIS A;  2MKC A;  4EU0 A;  3QLH A;  3SSQ A;  3VAJ A;  1NHU A;  1VYA A;  1HKA A;  1Y5N B;  2LFV A;  1RAG B;  1IKY B;  4BDP A;  2R7R A;  1Y4Z B;  1FHT A;  9ATC B;  3TAR A;  3C46 A;  2K1R A;  3Q8V A;  3JSB A;  4ZK7 M;  2V63 A;  3LAM A;  3M8P A;  3TW0 A;  1VIO A;  3A4T A;  4EI2 A;  1U49 A;  2Q43 A;  2ZH4 A;  5K14 B;  4TU8 A;  4CYU B;  1DHM A;  2D9O A;  1UFK A;  4LQ9 A;  4AD6 A;  3Q23 A;  4DPO A;  3VAF A;  4JI7 F;  1NU4 A;  1W25 A;  2B7B B;  2FZC B;  2E5G A;  1AB8 A;  5DGA A;  5IT9 U;  3IR5 B;  4J9M A;  1VLY A;  1FWK A;  4DR7 F;  1UJ4 A;  2IJF A;  1W7W A;  4UY8 T;  2HS4 A;  2B8P A;  2X3D A;  2KVI A;  4Y00 A;  2OFG X;  2FJW A;  1FJE B;  1DFD A;  2VFU A;  4IRK A;  3J7A 1;  2XMV A;  5D0H A;  5JUM A;  5IQQ A;  2R8I A;  1ARO P;  2YBV A;  3WC0 A;  1B0T A;  4DUZ F;  2W9C B;  1X4F A;  4Q2M A;  4PQU B;  1FWL A;  3Q8Y A;  2J9C A;  5LXR A;  2IM3 A;  3C6T B;  2IDL A;  1RHK B;  2MB0 B;  3UDV A;  1TUW A;  2J0S D;  5LJ5 Y;  1VLO A;  2JX2 A;  3OTO F;  2QSW A;  5E3P A;  1M5O C;  5KG4 A;  3QAE A;  3QGH A;  4DOZ A;  1TKT A;  1WSR A;  1RAJ A;  1XWL A;  1V3R A;  4JI2 J;  2PSZ A;  4NML A;  3K0J A;  1FO1 A;  1HI0 P;  3K5O A;  3MPD A;  2D41 A;  4GKJ J;  3DXB A;  2XCP A;  3AQO A;  5IS2 A;  2XMW A;  3CC7 S;  2GX8 A;  5LXY A;  3QSI A;  1FI4 A;  2GFF A;  4DV4 J;  4FVM A;  3QO9 B;  2RDD A;  3T9Z A;  3RBZ A;  1Y11 A;  4C6A A;  3NS7 B;  4QR1 A;  4NLY A;  3E3X A;  2N7Y A;  4I69 A;  4XPE A;  2QC3 A;  1U25 A;  5AJ3 F;  1N0U A;  2Z30 B;  4HL9 A;  2UUW A;  1N88 A;  2XMK A;  5DG9 A;  5F41 A;  5K8P A;  3GIL A;  4LR9 A;  1C0T B;  2DHH A;  5KG7 A;  2JWN A;  4N8N A;  1XMB A;  4YDX A;  1EHW A;  3CCU S;  2J8A A;  3VGS A;  3G8T A;  1RT6 B;  2NUU G;  3I96 A;  1S7H A;  2F63 A;  2ZZT A;  1YWX A;  4QU6 A;  3UD3 P;  2B51 A;  3C15 A;  5K8M A;  1QLN A;  1UWA A;  1JLG B;  4BHQ A;  2GML A;  4I6A A;  2EXU A;  2VG5 B;  4DQP A;  4UW2 A;  4N41 A;  3CT9 A;  1UTA A;  1QAJ A;  5E3A A;  4UY8 5;  2BEF A;  5H9F K;  3ISZ A;  1U0S A;  2DHX A;  4NLT A;  5G0R B;  5A8K B;  1LOU A;  2KXN B;  2B4P A;  1S4F A;  3GIK A;  1RTD B;  2GQQ A;  4ECW A;  4IH7 A;  5E41 A;  1SQF A;  1J5O A;  1XMQ J;  1FRI A;  2FY1 A;  3FSX A;  1YZ6 A;  4DV3 F;  3MEG A;  4DV0 J;  2J7K A;  2EFV A;  4RW6 A;  1S6U A;  4X66 J;  1BC6 A;  4PG5 A;  4K4S A;  5KFU A;  3DRP A;  4DU7 A;  3CJR A;  5LSO A;  1EKR A;  2HMI A;  3CD7 A;  5C42 B;  5JXS A;  3PJ9 A;  3MEE A;  3MM8 B;  2XS7 A;  1NSP A;  4OHV A;  4X4O A;  2CQ3 A;  2HQF A;  3HT3 A;  3PV8 A;  4N7T A;  3PJW A;  4DL6 A;  2GGP B;  1DLO B;  3D28 A;  4JI3 J;  2GIF A;  3UR3 C;  3MR7 A;  1K0V A;  2BW7 A;  4WFY A;  3FMW A;  5AE2 A;  1F2H A;  4I0W A;  1N32 F;  4Y2M A;  3CUN A;  4G3I A;  5L9X A;  3EZ5 A;  2M8D B;  4DS4 A;  2E7X A;  2Y1L B;  2UXB J;  4ZHR A;  3GYG A;  1Q8L A;  1NKB A;  3CF5 Q;  4U7C A;  4DJB A;  1QUP A;  3I5C A;  5HBM A;  3GV5 B;  1U1O A;  2B4U A;  3HT0 A;  1SL0 A;  4C8N A;  3CJK A;  2F4F A;  2PA3 A;  5B08 A;  3RRG A;  1C1B A;  4PRF A;  2XY7 A;  3NRB A;  3FBB A;  3M2U A;  2ABY A;  2ZNZ A;  3DDN A;  2AIR B;  2RNE A;  3CCZ A;  2XG8 A;  2GW8 A;  3BBC A;  1WWH A;  1VR6 A;  3AD7 C;  2V6A A;  2QX0 A;  4RR5 A;  5BYQ A;  1PIE A;  2CQI A;  3MPY A;  2PD1 A;  3HSJ A;  4NPO A;  3N01 A;  2NZ4 A;  3PAC A;  3AJ2 A;  3BEG B;  4F36 A;  5DQI A;  4UQT A;  5ADZ A;  4WPA A;  2DJW A;  1B70 B;  2WZ1 A;  3ILI A;  4KJI A;  1OQ6 A;  4TQR A;  4U6P A;  3FNN A;  2YNI A;  1S6O A;  1IQZ A;  3QID A;  1V6H A;  3W2W B;  4ZVH A;  2DGT A;  3GJR B;  1LFW A;  4NL5 A;  2B9Y A;  1IKY A;  5EGY A;  4QIW D;  2C3O A;  2IRY A;  3W9J A;  1WUU A;  3V4I B;  4LF7 F;  3VAK A;  2YH0 A;  4V19 X;  3UCU P;  3PRB A;  5KFV A;  4NZ7 A;  4Q8E A;  2V2V A;  4PZV A;  3LAN A;  4ZVQ B;  4K0K F;  2L48 A;  2W2O P;  4I4B A;  5K14 A;  3GII A;  4CYU A;  2C3P A;  1YBA A;  2R7U A;  4R0J A;  4A8M P;  4QIE A;  2IY5 B;  1RT7 B;  3OL8 A;  5HMZ A;  2QA4 G;  3BGO P;  2CPX A;  2M9K A;  4IOC Q;  2HYI B;  4PCQ A;  2I0X A;  1VQO S;  3J80 U;  3IRX B;  4C3M A;  1WI6 A;  2P2C B;  2GV1 A;  2HIY A;  4M5N A;  4KPC A;  3VWS A;  1L3U A;  5KFF A;  3QNW B;  1NO8 A;  3JSM A;  3FVY A;  2BJ7 A;  4D3H A;  5CYQ B;  1BWV A;  4B02 A;  2HHP A;  4NA3 A;  2HS0 A;  2QTW A;  4IO1 A;  5GMD A;  5KFR A;  1E6Y A;  3OTE A;  3LPY A;  4NAS A;  2K2P A;  3KK2 B;  4RNF A;  2W9C A;  2F8M A;  1K1S A;  4I67 A;  3GMG A;  1O0P A;  3TAP A;  3CMA S;  1WC5 A;  4ZVG A;  3MM7 B;  2FJV A;  2Z8Q A;  1YHQ S;  1P6T A;  4LRC A;  2CA9 A;  1WF1 A;  2RIL A;  3MPW A;  3RB4 A;  1BLU A;  1NK9 A;  3SI8 A;  2W9B A;  2QMU B;  3I0S A;  3EX7 B;  4JI0 J;  5AXN A;  2HWT A;  4OYB A;  4ZVT B;  1ZYQ A;  4IRC A;  3CJ8 A;  3BN7 A;  3W9H A;  2WBR A;  1AZS B;  4L74 A;  1X9W A;  2VOO A;  1FFS B;  3BKF A;  3MR5 A;  4AE5 A;  3S8S A;  2GC8 A;  2I2Y A;  3NWR A;  1GXT A;  2LCW A;  2WVD A;  1L3T A;  3W63 A;  1ZZN A;  2OMO A;  1E6V B;  1U1M A;  3L7P A;  2Q1L A;  4USU A;  4RNO A;  1PBA A;  1K44 A;  2YQ3 A;  1UW9 A;  5HP1 A;  4OZJ A;  1UFW A;  1UKU A;  3CCJ S;  5EDW A;  2HRU A;  2RU3 A;  3UW1 A;  1C0U A;  2CPY A;  5EUH A;  5I3U A;  3HSG A;  3QO9 A;  1LXN A;  2YKA A;  3GCX P;  1JMT A;  2AX0 A;  2M70 A;  1NHV A;  1TKX A;  4ECU A;  2HHQ A;  3AOD A;  1R3N A;  4JI2 F;  4DL2 A;  3H2L A;  2CDQ A;  1JNZ B;  4WIQ A;  5KFZ A;  1S48 A;  2FC9 A;  2YX4 A;  2R7S A;  2W8L A;  1C0T A;  4FNI A;  4ED8 A;  4PWW A;  3VAG A;  3HVW A;  3DOM A;  4Z7Y A;  2EFQ A;  4OI0 A;  5FDL B;  4QYR A;  4GKJ F;  1LWC B;  2UVW A;  1M5K C;  1RT6 A;  4KY3 A;  4X4N A;  4KV8 B;  5C2C A;  3QWP A;  3ZZO A;  3A13 A;  5E33 A;  2ZE2 B;  3PCO B;  4E98 A;  2W24 A;  3ILL A;  3ZTP A;  5DDP C;  1C1C B;  2R42 A;  3X3U A;  4DV4 F;  1RK8 A;  4LF6 J;  2FJB B;  1UVK A;  4NI2 A;  4J9O A;  3EZU A;  2DNP A;  3SQG B;  3CC2 S;  4ECZ A;  3OVS A;  4YP3 A;  3GB0 A;  5G0R A;  5A8K A;  2H4Y B;  5C25 B;  1TQL A;  2HQC A;  4HYK A;  4B3R J;  2AYG A;  2G2O A;  1UP1 A;  1S10 A;  3DLG B;  3NCR A;  3M6U A;  4CO2 A;  1NK5 A;  3HUL A;  4X4U A;  4RWW A;  1ZM4 A;  2KM8 C;  3DOL B;  2H5I B;  5ETL A;  1BD6 A;  4C7Q A;  5J1E A;  1C2P A;  2HKE A;  4HLB A;  5D15 A;  3EZO A;  2IVY A;  1U2R A;  2NPF A;  2E9T A;  1UA0 A;  5T7L B;  4XDD A;  3FSY A;  3GYN A;  3MM8 A;  1RT1 B;  1LXJ A;  2M2B A;  2PMZ D;  1CJK B;  2K7K A;  2DBB A;  2FYX A;  1V3Z A;  3RR7 A;  2GGP A;  2G2Z A;  4WXO A;  2AEJ A;  2D69 A;  3H20 A;  2W7P A;  4Y65 A;  2JL9 A;  2AT1 B;  1ZPV A;  1G4C A;  3OUY B;  1X8D A;  3A8K A;  1SIZ A;  2DR7 A;  1FJG F;  2OAU A;  4NLQ A;  3OR2 A;  2P9C A;  1XMQ F;  4OI2 A;  1GX6 A;  2FZG B;  2LVW A;  1S4E A;  5CQG A;  4DV0 F;  5FLX Y;  4CNZ A;  3CSK A;  4X66 F;  5B0A A;  2QA4 S;  3MAH A;  1B7Y B;  1X5P A;  3SSR A;  1VOM A;  1LWE A;  4F50 A;  5D0R A;  4OFZ A;  1WC6 A;  4K2J A;  3LQV A;  2KHC A;  1NB2 A;  2HVE A;  4F4A A;  3W8P A;  1XIQ A;  4YR2 A;  3RBE A;  2MY7 A;  4K4X A;  4JI3 F;  4NLG A;  1N4L A;  3NEK A;  4K4Z A;  2DVI A;  3F56 A;  3ET6 B;  4JI1 J;  1B64 A;  3CMQ A;  1ZM2 A;  4TYB A;  3Q0A A;  5H9E J;  2UXB F;  3GJQ B;  3U7J A;  2KM8 B;  3GU0 A;  2E9R X;  2D3U A;  4DL3 A;  1EAR A;  2HEK A;  4RBT A;  3VGT A;  2KVQ E;  4ZJO A;  3K59 A;  1UEV A;  3FUY A;  1RYR A;  2VF3 A;  1VQ6 S;  4R0E A;  1KD1 T;  1WI8 A;  1SVD A;  2DK2 A;  3PJX A;  5ETP A;  3NGT A;  1U24 A;  1MU2 B;  2MQ8 A;  3PYF A;  2LMI A;  2Y0B B;  3DHW C;  5IM0 B;  3K2Y A;  2LU1 A;  1SJQ A;  1SPB P;  4IQX A;  1B0V A;  4OJG A;  2KHD A;  1RT7 A;  1WOR A;  2ZVI A;  2ALZ A;  5M2R A;  1SKR A;  2XYG B;  2XS2 A;  1VGY A;  3Q24 A;  1WHW A;  1K9M T;  1FRL A;  3M05 A;  2HFV A;  3JQK A;  1EZZ B;  4PXE A;  2BA9 A;  4USV A;  1U8S A;  3G96 A;  2RHQ B;  1S77 D;  5ETQ A;  2HGL A;  4RZR A;  4LIW A;  5KT6 A;  4FZV A;  4ED0 A;  5KFO A;  1X4A A;  5CYQ A;  4MK7 A;  4QZV B;  1MLA A;  3OXG A;  3C16 B;  2QG9 B;  4PG4 A;  1OWX A;  4X65 F;  1QAX A;  3AOA A;  3SCI E;  1AT1 B;  1T8E A;  3RRK A;  4O23 A;  4I7F B;  4JBC A;  3MCM A;  3SSS A;  1NLK L;  5I3Q A;  4B08 A;  4Q0B B;  1H7W A;  2DHS A;  4A47 A;  3MR6 A;  3KTQ A;  2HRY A;  3V4M A;  1NJX A;  4Q5V A;  1KOH A;  4NCG A;  3MM7 A;  5DDO C;  4JV0 A;  1FWP A;  1OY6 A;  4KKO B;  4QWB A;  1PKU A;  1EIY B;  3QT7 A;  2GVD B;  4X4S A;  2JLG A;  2HIQ A;  4KGV B;  5FJ4 A;  2RRA A;  3HKW A;  2LXF A;  3T6J A;  3BYR A;  1BMQ B;  3TEH B;  4WII A;  4CH1 A;  2LLZ A;  2L9W A;  5L1I A;  1AZS A;  3KHL A;  3CME S;  3GON A;  4RNN A;  3ISN C;  2ZOG A;  1FE0 A;  2LQ9 A;  4IG0 A;  4QIV A;  5KFL A;  2DCL A;  4ITS A;  4BBY A;  3P96 A;  2LEC A;  4KGM A;  1E6V A;  3CD0 A;  1MWY A;  4MH8 A;  3QAT A;  2W7O A;  4U8Y A;  4XPC A;  3L7U A;  4DCO B;  3H4D A;  4C4W A;  4F0M A;  1FEE A;  1T9T A;  1YJ9 S;  2EFN A;  1HBO A;  4AT1 B;  3AFG A;  2XNQ A;  4RKU C;  5MLC V;  3VHQ A;  2VA2 A;  4CO1 A;  3NGR A;  2AV5 A;  5HMY A;  2B0G A;  1SJ3 P;  4MK8 A;  2JVO A;  2B43 A;  3THP A;  5T41 A;  4PKD B;  4JI0 F;  3ADA C;  2VDH A;  2FLL A;  3F0N A;  4ECS A;  4Y6I A;  4NE9 C;  2CAJ A;  3QQC D;  2D3O 1;  2RU9 A;  2JH3 A;  3A3N B;  2CQG A;  2X51 A;  4KBI A;  5C2G A;  1VQS A;  3FZB A;  2BOA A;  3NMR A;  1PAE X;  2JEI A;  2VFV A;  1NB7 A;  1GTE A;  1RWO B;  2R8J A;  3MM5 A;  5FDL A;  1LWC A;  4JV1 A;  4KV8 A;  1XER A;  3OTB A;  1TUG B;  2C2O B;  1YLX A;  4JP8 A;  1Q95 G;  2DY9 A;  1S49 A;  2ZE2 A;  2PI4 A;  3Q86 A;  2VPW B;  1MMN A;  3CCE S;  1C1C A;  1UVJ A;  3CDE A;  2NR0 A;  3MCS A;  1D9A A;  4USW A;  3VGV A;  2BUN A;  1R8C A;  3EVM A;  1HQE B;  2H48 B;  1VC5 A;  3PO4 A;  1RBO B;  4MT1 A;  5ETK A;  2W9A A;  1RDR A;  4LRA A;  3IR6 B;  1PGZ A;  1FFW B;  4LRB A;  3DMJ A;  3OVA A;  3V5R A;  2CNN B;  1FJ7 A;  3CED A;  4DPY A;  2DNR A;  5C25 A;  2E29 A;  1FT8 A;  2Y9H A;  4O0I A;  5BR8 J;  1RHJ B;  1S6Q A;  4FF4 A;  2YWE A;  3N5B A;  3M1V B;  2JSX A;  2CUY A;  4ED4 A;  1P9Y A;  2E44 A;  5GAH U;  4DUT A;  3J81 U;  3DOL A;  1XBW A;  1Y00 A;  2KJV A;  2HSE B;  4WKR A;  2HFO A;  2R8G A;  3DHX A;  4FS2 A;  1OMS A;  4OHW A;  4M5L A;  4NLP A;  2M0G B;  2JEJ A;  3W8G A;  1V5V A;  5T7L A;  1TK5 A;  4LFB J;  2BJ1 A;  2VV5 A;  3ISN D;  2E7V A;  2WVB A;  4CI0 B;  3EM1 A;  3CWJ A;  1RA6 A;  2MJN A;  1KLN A;  1RT1 A;  3Q89 A;  2ROG A;  3SZ2 A;  2WSE C;  1CJK A;  2AJQ A;  1FF2 A;  5K20 B;  5K9F A;  3J81 j;  1TL4 A;  1LK5 A;  1T9U A;  1IBC B;  1TAQ A;  2HVD A;  5KFK A;  2E7W A;  4DFK A;  4DCP B;  5KFH A;  1NKE A;  3OUY A;  1B99 A;  4B3R F;  5HO4 A;  2V68 A;  3UWT A;  3KLG B;  4L73 A;  3ITH B;  4ES2 A;  2BQU A;  1S99 A;  2HAF A;  5ETS A;  3NS6 A;  2Y1J A;  1TL5 A;  3DI6 B;  1VRU B;  2YNF B;  4NLO A;  3Q8S B;  3R1H A;  2DEI A;  1G1X A;  2BQR A;  3VVT A;  1PIL A;  4OI1 A;  4ANC A;  1K1Q A;  3DXS X;  2F4V J;  3EMT A;  2UXD J;  2CIM A;  2ZJR Q;  3QFH A;  5EWG A;  2GHW A;  1Q78 A;  4O4G B;  4L72 B;  4K4Y A;  4B9S A;  5ETT A;  3PX0 A;  4H4M B;  4ED3 A;  1RLD A;  5DGB A;  3TUP A;  3GSD A;  2V94 A;  1GXL A;  4NCB A;  3ET6 A;  5DDR C;  1ZA2 B;  2Z4P A;  1NK7 A;  1JLB A;  4J9V A;  2QL5 B;  3HVR A;  5HN0 A;  2KZM A;  2ZH9 A;  1UEK A;  3QZ8 A;  4DSJ A;  2CQ0 A;  2JC0 A;  1R0A B;  3HHE A;  3RGI A;  1OIA A;  2VJU A;  2CPF A;  1KSP A;  5JMN A;  2AEM A;  1DTT A;  1ZET A;  2UUA J;  3N6N A;  1RQ0 A;  1U1N A;  1NH7 A;  1N48 A;  4ECX A;  4GC6 A;  4B3T J;  1YRU A;  2RQM A;  4DXL A;  4F7V A;  4FXV A;  4ICL B;  3FEY B;  1SJF A;  2J6U A;  1QD1 A;  5IM0 A;  3GFY A;  2OPP B;  4WFX A;  2WSC C;  3RTV A;  3CXC R;  5B0C A;  2G2Y A;  4WXW A;  2BV3 A;  2JLF A;  5EWE A;  4JI1 F;  1RAA B;  7FD1 A;  4LSN B;  4OYW A;  1U48 A;  2AYM A;  1YJU A;  2R3V A;  1FNM A;  2ZKT A;  5KFA A;  4P2S A;  1N56 A;  3SCJ E;  4J5O A;  2FHM A;  1HLW A;  4LQ3 A;  2BQ3 A;  5L9N A;  2Z2M A;  2IHR 1;  5KT7 A;  2CJY B;  2AU0 A;  2MST A;  2KT5 A;  5A2Q U;  3FRY A;  1BQM B;  4FP9 A;  3M8S A;  3H40 A;  3OHB A;  2HWI A;  4RW8 B;  2ZOF A;  1U4B A;  2YNH B;  3CJ3 A;  4U7U K;  2BW2 A;  4ZPW R;  1HNZ J;  3I55 S;  4OX8 A;  4UZB A;  3BJY A;  1JJ2 R;  2A0F B;  1S12 A;  1YQH A;  3F44 A;  1OO0 B;  4I7F A;  1VBX A;  3DYA A;  1M1H A;  3J7Y U;  2R2S A;  2VD3 A;  1C4C A;  1UJ5 A;  4J9N A;  4Q0B A;  4ZIW A;  3WC2 A;  2IYG A;  4GC7 A;  1HBN B;  3FSI A;  4F67 A;  3N5F A;  3MGJ A;  4W90 B;  3MM9 B;  3M8W A;  1KR4 A;  2X1A A;  4EBD A;  2U2F A;  4YUD A;  4KKO A;  4PWD A;  1RTJ B;  2Z2Y B;  1S1V B;  1RAH B;  3IWL A;  4FKY A;  5GAH I;  3M2R B;  1HHS A;  1HQU B;  3AOC A;  3MMA B;  2MQN A;  3I5B A;  1KOO A;  4S0M A;  4QIG A;  2XYH B;  5CAB A;  2ZDP A;  3VAM A;  3PX4 A;  2HUR A;  3LP1 A;  4RUB A;  4Z2X A;  2XM3 A;  1SXL A;  4MIA A;  3DLL Q;  2PFD A;  3UD4 P;  2QA1 A;  2VBZ A;  4CH0 S;  2DNH A;  2HGN A;  2DNG A;  2Z2Z A;  1RB0 A;  5DS7 A;  4LJM A;  3FBC A;  1Z2Z A;  2OEK A;  1SC1 B;  1VJQ A;  5CD4 H;  1FE4 A;  1CUL A;  1HA1 A;  1IKW B;  2MZ1 A;  4FYY B;  3IGN A;  4P52 A;  3EPI A;  2QL7 B;  1IR0 A;  8ATC B;  4HT7 A;  5DQG A;  1SH0 A;  4BCA A;  1UPP A;  1A7G E;  3DOK B;  3M8Q B;  4RPF A;  2VBW A;  5HRO B;  5IXU A;  3LO3 A;  2BR0 A;  4I2Q A;  2GQC A;  1SL1 A;  2JLE A;  3H4B A;  3QIP A;  4UTG A;  2CWK A;  4BC9 A;  7AT1 B;  2DKO B;  5CA5 A;  4DF8 A;  2NQP A;  4A48 A;  1SKW A;  1AW0 A;  4QJV A;  3UCZ P;  3L9Z A;  1YRT A;  2WAQ D;  5C24 B;  3CJT A;  4O4R A;  2VH7 A;  1ZBT A;  3EVO A;  2HND B;  2ZJQ Q;  2YWW A;  4CM0 A;  4A8S A;  4CLP A;  3K17 A;  1YJT A;  3MUM P;  5E7O B;  4OLP A;  1AXQ A;  3BGU A;  4L76 A;  4M5H A;  3GFX A;  4HH1 A;  3JAM U;  4HDH A;  4C0O C;  4DR6 J;  2DHG A;  1GMW D;  3M9M B;  4NZ6 A;  1Q0N A;  2V2Q A;  3IFE A;  2RRB A;  1YZ7 A;  1KLM B;  4AL6 A;  2IBO A;  3B8H A;  2DNQ A;  5A8W B;  3CJQ A;  2YWH A;  5KT3 A;  2PI5 A;  3M1V A;  5D4P A;  3VF0 B;  4LF5 F;  2DXF A;  3BSC A;  2MQQ A;  1EP4 A;  1EET A;  2XMJ A;  4DR4 J;  2HK2 A;  1IKV B;  4OI3 A;  2CQC A;  4ZCL A;  4YB1 P;  4DG1 B;  1FDB A;  1TAU A;  2I6W A;  3FGV A;  3G86 A;  3GR1 A;  5HLF A;  3MAA B;  3S7R A;  1WC3 A;  4QWE A;  1HFE L;  3NKY A;  2QLJ B;  3SMZ A;  3HHK A;  4X4Q A;  3T1A A;  2HLU A;  3TA1 A;  5F8I A;  1SC3 B;  4ZIT A;  4OYI A;  1IXK A;  3GCW P;  2V9K A;  4P71 A;  2DR6 A;  1VCT A;  1JLC A;  2YWF A;  1U8W A;  1KQS R;  1H38 A;  5BR8 F;  3VV2 B;  2D74 B;  1JLE B;  1REV B;  4MMO A;  3KLG A;  3BSO A;  2QE5 A;  3ITH A;  3J7Y I;  4ZVR B;  3VCD A;  3HVT B;  3R5B A;  2KZZ A;  3DI6 A;  3FEZ A;  1U6B A;  2YNF A;  3TAM B;  5CH7 B;  4NA1 A;  3VAL A;  4DSK A;  3E01 B;  3CIM A;  3KK3 B;  1NJW A;  4YB6 A;  2HFU A;  3KUE A;  3TQ1 A;  4MK9 A;  1NJZ A;  4NLX A;  2G9O A;  2LP4 A;  2E5I A;  1L5U A;  2VDI A;  4CLY A;  2DGU A;  4O4G A;  3V6K A;  4LRE A;  2CPD A;  1RJJ A;  3HF5 A;  1MNE A;  1GX5 A;  3D0I E;  4H4M A;  2R2R A;  4EYH B;  1YSJ A;  2F8E X;  4KFB B;  3PM9 A;  4JI4 J;  2LA4 A;  2HHW A;  1BQN B;  3AB4 B;  3QZ7 A;  2VPX B;  2OPQ A;  2W4D A;  4TLQ A;  4WZQ A;  3M6X A;  3QYY A;  1HNV B;  1BE4 A;  1QY7 A;  2OHD A;  5AE3 A;  1PYT A;  2A6M A;  1R0A A;  3P6Y C;  1KTQ A;  2MZS A;  3GQC A;  3Q2T C;  4BC7 A;  1RHQ B;  1SJ1 A;  2R7W A;  5IV3 A;  3CCQ S;  1IUJ A;  2F4V F;  3LH2 S;  4ZLJ A;  2UXD F;  3Q22 A;  1BY9 A;  1WEL A;  1UET A;  3WQP A;  5JVH Q;  4P75 A;  1U1R A;  3EGN A;  4ICL A;  4C8K A;  4EZ9 A;  3SBM A;  2E1M C;  3H25 A;  3RAQ A;  3IC1 A;  5KG0 A;  2OPP A;  2XI3 A;  4K4W A;  1LV5 A;  2OJ3 A;  4IUF A;  3D7S B;  3AB2 B;  3W7B A;  1G2E A;  1F5B A;  3AOB A;  4F3M A;  3UNY A;  5KFP A;  1REG X;  4LSN A;  2GO8 A;  1HBM B;  1KVI A;  1FES A;  3OBI A;  2FHJ D;  4RW9 A;  1RHM B;  1B7F A;  4URQ U;  5DDQ C;  4QR0 A;  1BQM A;  2YPZ A;  4FN5 A;  3H5U A;  1JLF A;  2UUA F;  4RW8 A;  1CG2 A;  3CCM S;  2EFG A;  3DLB A;  2AYB A;  5HQM A;  4Y0F A;  4DLE A;  2N82 B;  3NS5 A;  4B3T F;  5J2Q B;  3SIP B;  2KDO A;  2EEY A;  4KHR A;  3V6D A;  4P2F A;  4LF8 J;  1CLF A;  4YFU A;  3TOQ A;  5CYJ A;  1LQ9 A;  4J9K A;  4A8Q A;  4K4V A;  1U1Q A;  5F9N A;  2KI2 A;  2CVE A;  4J9L A;  1NPR A;  1S1X A;  4LR7 A;  2ILZ A;  1S1V A;  2UV8 G;  1N54 B;  1YK9 A;  3CCR S;  2VG6 A;  4P10 A;  1HWK A;  1FVQ A;  3KFW X;  5L38 A;  3OTC A;  4J9U E;  1NSK L;  3ETM A;  5B0G A;  3HHL B;  1OY8 A;  2A1B A;  2H4W B;  2H54 B;  3VZH A;  2BKP A;  1HPZ B;  1Y5I B;  1HNZ F;  3C8Y A;  2W2N P;  2QZ8 A;  4RWX A;  1GH8 A;  1WDD A;  2AF6 A;  5L39 A;  2JDJ A;  3UNG C;  2JRS A;  1IBM J;  1JXV A;  4WK1 A;  2WOM A;  1JNR B;  2BAN A;  3MUR P;  4LF4 J;  3QRP A;  4A8O A;  1RT4 B;  4M5D B;  3HHL D;  1QTM A;  2XS5 A;  2ZUA A;  1DAR A;  1NK4 A;  4OHY A;  1I51 B;  1J5E J;  3MDF A;  1AYE A;  5LSR A;  1DUR A;  1FNX H;  2W4C A;  3DOK A;  3M8Q A;  3VQS A;  4A8K A;  5HRO A;  3TZY A;  3WIU A;  3OV7 A;  2P6T A;  4ZKA A;  1HWU A;  1TR0 A;  4FF3 A;  4I56 A;  3D1O A;  3JQM A;  4Y28 C;  4N56 A;  4EO8 A;  3QJP A;  3H90 A;  3P45 B;  2V0N A;  5C24 A;  1SV5 B;  4WWS A;  4C8Y A;  2HND A;  2JZ5 A;  3KXD A;  5D4O A;  2FLN A;  2RS8 A;  2E5L J;  1O5J A;  2COL A;  4QPT A;  2ZC3 A;  3FQL A;  4B3O B;  3V6J A;  5D6G A;  2ASY A;  3UN3 A;  1R31 A;  1SBR A;  3JB9 k;  2UVV A;  4HTJ A;  3EVW A;  1ZTW A;  3R9L A;  1CSJ A;  1IJE B;  3HLU A;  3VAH A;  1WEZ A;  2CRL A;  3HXM A;  4DV6 J;  3ZO7 A;  2MKJ A;  1OY9 A;  1H2T Z;  3ENW A;  4P72 A;  1S6P B;  1KLM A;  3H42 A;  5A8R B;  1Q79 A;  2N7C A;  5A8W A;  3I56 S;  3R1L A;  2BRK A;  1SJR A;  4ZVE A;  2FVC A;  2IM2 A;  3CW2 C;  3OR1 B;  2ACY A;  1RWV B;  4DG1 A;  1FKP B;  3IS9 A;  2XMU A;  4Y34 A;  2DD8 S;  2V4J B;  4ZJQ A;  2BM1 A;  4HAC A;  2G0I A;  4OX7 A;  3L3C A;  3UCG A;  4FYW B;  4ELU A;  1HR0 J;  1RT5 B;  4CTA A;  3KOA A;  2LQB A;  2VUG A;  4ATN A;  4AYB D;  1DTQ A;  1S9E A;  2V5H G;  3V2U C;  4LRF A;  4DR6 F;  2JFK A;  1M1G A;  4DR5 J;  5J2P B;  2CDR B;  2G0J A;  3K8W A;  2EFO A;  3RR8 A;  4YR0 A;  3PFO A;  2CXE A;  1NZ8 A;  3SFU A;  2O5D A;  4MTP A;  5LL6 d;  1LW2 A;  1T94 A;  3T1Y J;  2ZJP Q;  5E3C A;  2ASD A;  1REV A;  2HVI A;  1CJU B;  1MRO A;  4DQR A;  1CBK A;  4C9D A;  2V8P A;  4X64 J;  4LR8 A;  3HVT A;  4DR4 F;  4OHZ A;  3DKD A;  3OL9 A;  4TLR A;  2QLF B;  3R97 A;  4A8Y A;  3KK3 A;  2CAD A;  3LP0 B;  1Y9O A;  1IWG A;  2AYE A;  4DUY J;  4NEZ A;  3NGU A;  2IYI A;  5L1K A;  3FZ2 A;  1D8Y A;  3ONQ A;  3BN4 A;  4DPX A;  1YIT S;  3BZQ A;  1YTY A;  1N33 J;  2K8G A;  4O44 A;  2BE9 B;  3R6G B;  4OJ1 A;  2WK4 A;  4O3S A;  1D9F A;  2BJD A;  1DQ9 A;  2MMY A;  1Q7Y T;  3KJN B;  3MTK A;  5B0E A;  4B9N A;  1BQN A;  4MKA A;  1D1U A;  2A3J A;  2RUS A;  2NZC A;  2GHV C;  1UVI A;  4ID8 A;  1JJ4 A;  1OPI A;  2RE1 A;  4CLW A;  2HVZ A;  1F5A A;  3NAI A;  4IFV B;  2HFZ A;  3R5D A;  1N5Y B;  2BE2 B;  3FEX B;  1RTH A;  1GT8 A;  3M32 B;  3TZX A;  1RTI B;  5KOX A;  1XK8 A;  1H74 A;  3JTN A;  4QWC A;  1MML A;  3NCQ A;  3QSY B;  3L09 A;  5IV4 A;  4TYA A;  4DV7 J;  3HKZ D;  3E2E A;  2FHJ A;  5LMU J;  2MKI A;  2V2Z A;  3MAQ A;  1X5T A;  3ZZ0 A;  3OVB A;  3GFZ A;  2KXH A;  1F0X A;  4KQZ A;  1I94 J;  2WW8 A;  3EXY A;  2U1A A;  1TKZ A;  5F0U A;  4QW9 A;  3B6B A;  1U47 A;  4JI4 F;  3GJT B;  4H54 A;  1HBM A;  2H65 B;  1M5S A;  1U0H B;  2XY6 A;  3ENV A;  4M95 A;  2WHO A;  2IM1 A;  1FD8 A;  5CCM A;  2V50 A;  3EDR B;  4EFA C;  2QSF A;  2QN6 B;  2KRR A;  5KFM A;  1PJ6 A;  1LFP A;  5J2Q A;  1NRK A;  1T9W A;  3L7O A;  1J2V A;  1FXL A;  1CJT B;  1M1K T;  1VQK S;  3BH7 B;  3PIP Q;  4DX6 A;  1VS3 A;  3TNV A;  4OHX A;  4F0K A;  5RUB A;  5IFM A;  2PT0 A;  3CE8 A;  2W8K A;  2CZ4 A;  2FIU A;  4RNH A;  3BPD A;  2MJU A;  1IKX B;  4IR9 A;  2GQ2 A;  4V1A k;  2XWX A;  2RML A;  3EGV A;  1H98 A;  4WP3 A;  2DH8 A;  1TL1 B;  2C2K B;  2ZH1 A;  2D1C A;  4WBF A;  2F40 A;  2M52 A;  2MHN A;  3H5Y A;  4LSL A;  5A0Y A;  1U1K A;  2ZHO A;  3HHL A;  2I5J B;  3ZTS A;  3BPS P;  3WHI A;  5LT5 A;  4O0N A;  4CH7 A;  4A46 A;  3UQS A;  1S0O A;  2YY3 A;  1U45 A;  3HZE A;  2NXE A;  1UZH A;  4ECT A;  2XMM A;  1JJH A;  4Q44 A;  4Q7A A;  4FYD A;  3GG0 A;  5KG3 A;  3VR1 A;  4WFN Q;  2DNZ A;  1RT4 A;  3P49 B;  4M5D A;  2O3D A;  2L41 A;  1ZAX A;  4X2B A;  3KWM A;  4OZL A;  1F60 B;  2CPH A;  4I6Y A;  1CQM A;  1T03 B;  1LW0 B;  3C19 A;  1XTZ A;  5J2M B;  5HJY A;  2VQF J;  3PTW A;  4WK3 A;  1CPZ A;  1QTN B;  2OPS A;  1YJV A;  1FKO A;  4USH A;  2MHE A;  2JVR A;  2V2K A;  1RWK B;  2OSR A;  2UU9 J;  1VQ9 S;  4JV2 A;  5U47 A;  5F9L A;  2MLZ A;  1SKS A;  2XI2 A;  5KTQ A;  2ZH7 A;  4K5R A;  2MQM A;  3AQP A;  4U95 A;  1SV5 A;  2AJ2 A;  3OW2 R;  1S1T A;  3QGG A;  1VQ5 S;  2EFP A;  3F41 A;  1HHT P;  1ITP A;  1SJ4 P;  1HIY A;  1IBM F;  1N5V A;  5J2N A;  4JI5 J;  2FVR A;  4X4T A;  3PY8 A;  4LF4 F;  4HEA 9;  5K8O A;  2C3Y A;  1PC4 A;  3MCN A;  3U1N A;  4IO9 Q;  3CJ2 A;  3W3S A;  1VRQ C;  5KG1 A;  1FK9 B;  4ZVP B;  1NH8 A;  1J5E F;  1RT2 A;  1LWF A;  3OJU A;  3OXF A;  3R8Y A;  3G6V A;  4F4X A;  1XMO J;  5D3G B;  4JOU A;  4MIW A;  3OHA A;  1S6P A;  1TMM A;  4AXI A;  5A8R A;  2HHS A;  2QMW A;  5KAK A;  4NRU A;  2RHS B;  2OPR B;  3RRH A;  1AUS L;  1JIH A;  1K73 T;  1YJW S;  4DN9 A;  1CVJ A;  2LEP A;  3CCT A;  3IN5 A;  4E8U A;  3LP2 B;  3A12 A;  2V4J A;  2E5L F;  4C2M A;  1PSD A;  3OL6 A;  5BJR A;  3RBX A;  3KMQ A;  5E3Q A;  2FLP A;  2CPI A;  2B5J B;  1HBU B;  2PO4 A;  2AJ0 A;  3DM2 A;  1KRP A;  4KYZ A;  5A6W A;  2HW3 A;  4CQ1 A;  3M7V A;  1FD2 A;  5ETO A;  5J2P A;  1DAX A;  3QT6 A;  2IM0 A;  2OD6 A;  4DV6 F;  4RBV A;  3CDB A;  1IR2 A;  1LEO A;  4WFZ A;  4KT0 C;  2EWH A;  4ED6 A;  4DBQ A;  3HX9 A;  4OMF G;  1KNZ A;  4K4T A;  2FLO A;  1TVR B;  4RW4 A;  2IIH A;  3DRX A;  2HG4 A;  4CLS A;  2DYA A;  4GO5 X;  2ZH2 A;  2IC3 B;  4OZ3 A;  4HDG A;  1R6Y A;  2CJQ A;  3LP0 A;  1NME B;  3I82 A;  3T5K A;  1RXO B;  1W2I A;  4WTO B;  4M94 A;  3M8R A;  3BQ1 A;  1YDL A;  5CCL A;  2VIC A;  1HR0 F;  4DLG A;  5H9F J;  4HR2 A;  1N52 B;  3ZFV A;  5KFD A;  3OFF A;  4QYZ K;  1QVF R;  1WOS A;  4DR5 F;  2DHA A;  1RGV A;  2KU7 A;  1KWM A;  4KRW A;  3OJS A;  1UMJ A;  3A3O B;  2J7W A;  3H59 A;  5IT9 Y;  2XSJ A;  1QAY A;  4X62 F;  1FEH A;  1RU2 A;  3T1Y F;  1H0H B;  4K4U A;  5T14 A;  2KH9 A;  2HHH J;  1QDU B;  4TY9 A;  2KG0 A;  3P8B B;  5HMX A;  1NJI T;  1WTB A;  2CJX B;  1F9E B;  1S57 A;  4X64 F;  2CZ9 A;  3AY0 A;  1EQ0 A;  1RKJ A;  3MD3 A;  3FBF A;  4OYA A;  2BE2 A;  3M32 A;  3FKB A;  3AA8 A;  3TX0 A;  1RTI A;  2YKM B;  2WRM A;  4C8M A;  1Q4R A;  2YKP A;  2QRR A;  3I6P A;  1EB0 A;  3DRR B;  3TVY A;  4JV5 J;  1YVF A;  5IQ6 A;  2FDN A;  2ZM6 F;  2NXJ A;  4PR6 A;  3ZZP A;  1KC8 T;  2VZ9 A;  1VQY A;  3MWB A;  3N6L A;  3MZI A;  3ICL A;  1N33 F;  3MMB B;  4PYA A;  2QT7 A;  3ZC4 A;  4K7Q A;  2EW9 A;  1XNQ F;  1JXE A;  4BLG A;  4PPD A;  1RAO A;  1UVM A;  4IG3 B;  4YB5 A;  1MG7 A;  4AL7 A;  1U0H A;  4LF9 J;  3QRQ A;  3DGP B;  1X4E A;  5B7W A;  4GVB B;  4LBH A;  2BX6 A;  3ZZZ A;  2IAJ B;  4EZ6 A;  2WTF A;  2ZD1 A;  5ITH A;  1SB6 A;  1XQI A;  3C66 A;  4DV7 F;  4DR3 J;  2AW0 A;  2UZA A;  5LMU F;  2EBE A;  5KG5 A;  4JUZ A;  1XN9 A;  2ZBI A;  1N5S A;  2OUG A;  2DO0 A;  1RWM B;  4ZCI A;  5ETR A;  4F02 A;  2CYY A;  3N79 A;  3TUZ C;  3DLH A;  1WG4 A;  3TYT A;  1LWX A;  2UVU A;  1IKX A;  4GO7 X;  3SV3 A;  4ZOS A;  2ZHA A;  1KKH A;  2GAG C;  2CJ9 A;  3UD5 A;  1HQ2 A;  5AE1 A;  2R9L A;  4PUO B;  3VAI A;  2KO1 A;  1N6Q B;  5BYS A;  4RUA A;  5A6P A;  1ZS6 A;  3MPU B;  3JS9 A;  1KVK A;  3G6Y A;  2BJE A;  3W61 A;  4Y2I A;  3W62 A;  1KHW A;  3BSA A;  4OZ5 A;  5DZ6 A;  2BKN A;  4UOF A;  3K5N A;  3K5M A;  2NXN A;  4CLK A;  2J7U A;  3UFC X;  2ZWP A;  5F3Z A;  3IRW P;  4J9Q A;  1UPM B;  5D8H B;  2DGS A;  2J76 E;  5I42 A;  3OLB A;  5E5N A;  3GYX B;  3H5X A;  2HHU A;  2GIQ A;  1NHK L;  2RS2 A;  3WZ0 A;  3V81 B;  1VFJ A;  5HVH A;  4CT8 A;  3MM6 B;  3HFK A;  1T03 A;  1LW0 A;  2PC6 A;  3D0H E;  3GV7 B;  5J2M A;  4NLU A;  4MFB B;  3RYL A;  3EDQ B;  2Z2L A;  1FVS A;  4C0H A;  4JI7 J;  2Q6B A;  3TZW A;  5L1L A;  4IR1 A;  4DU8 A;  1I5O B;  4J9P A;  1P1L A;  4RO0 A;  3GR0 A;  2ZH8 A;  3QLH B;  4ELT A;  2IMW P;  1VBK A;  4PWU A;  2DNN A;  4F3Q A;  3L95 X;  2AX1 A;  2M7S A;  3T9N A;  2HFS A;  3M8P B;  3SQO P;  1RYS A;  5M2P A;  1FRX A;  1OS5 A;  4BWJ A;  2Z0G A;  4QOT A;  4DX5 A;  1GMV A;  3W9I A;  3ENA A;  2VQF F;  4DF4 A;  6FDR A;  3BO4 A;  5DZ7 A;  3KJF B;  4KC5 A;  2FB0 A;  4PQU A;  4RW7 B;  3VGU A;  2UU9 F;  3FJ2 A;  3C6T A;  1OJ4 A;  2OPR A;  3PXG a;  3AXM A;  1HD0 A;  4Y2K A;  5L1J A;  3UO0 A;  2HGM A;  4CLF A;  4YS2 A;  4KE5 A;  4F3O A;  3A8J A;  4G1P A;  4KR0 B;  2M88 A;  4G1Q B;  1S0N A;  3ILO A;  3KK1 B;  5B0B A;  4NXN J;  2J0X A;  2NYH A;  1KVJ A;  4C3K A;  3PFE A;  4HTI A;  4NA2 A;  1WTF A;  4JI5 F;  3RAX A;  3PW4 A;  4C11 B;  1I3O B;  3NGS A;  3IBF B;  4CLZ A;  4USK A;  2B5J A;  2ZH3 A;  3LW5 C;  2GCF A;  4M5M A;  4USI A;  5JJB A;  2LQ8 A;  3W64 A;  3KHG A;  1NCL A;  4ZN3 A;  1WDT A;  5KFN A;  1UL3 A;  1XMO F;  4ETX A;  1NDK A;  4OL8 A;  4LIR A;  3GLJ A;  5HI7 A;  4K2X A;  3CDW A;  2OGU A;  4ZVU B;  3DLJ A;  2XHC A;  3PYD A;  3W2V B;  4QIF A;  5CD4 A;  3BBB A;  3TA0 A;  2YVS A;  4YQW A;  4F4Z A;  5KFT A;  1TKT B;  1R8H A;  1CQN A;  1R43 A;  3I9V 9;  4ED7 A;  1URR A;  1KON A;  3G87 A;  3D0G E;  2IC3 A;  2KYX A;  1WKK A;  1CC8 A;  3NWG A;  5KFE A;  1RIS A;  4XK8 C;  1VC6 A;  3FMB A;  2R7X A;  2V69 A;  4DFM A;  4IOB A;  2W2M P;  3HI9 A;  5HJX A;  1OSD A;  4I1T A;  2Z57 B;  3HHD A;  4ED1 A;  1VHF A;  1WG1 A;  3RW6 A;  2RD5 C;  5KFG A;  3J80 Y;  2UUT A;  4YR3 A;  5H1S V;  4NYP A;  3POT B;  4A8F A;  2B9E A;  3PR5 B;  4J91 A;  1JLG A;  1U1P A;  2X1G A;  3EJM A;  4MYT A;  2W01 A;  3ENQ A;  1Q5V A;  5GME A;  4ES3 A;  2VG5 A;  3RJM B;  4DEZ A;  3EGW B;  4U67 Q;  2XHW A;  4ECR A;  3DLE B;  3TZZ A;  5HQ8 A;  1BWE A;  2YKM A;  4NLW A;  4A8X A;  2R2U A;  2H3E B;  3DRR A;  2XLI A;  3HSD A;  4EBE A;  4DV3 J;  3HSZ A;  1RTD A;  4LRD A;  4UZC A;  3LTO A;  2V4Q A;  5LJ3 Y;  2RQK A;  3R5A A;  1UA1 A;  2JC1 A;  6FD1 A;  2L9N A;  3C15 B;  1RT3 B;  2GNK A;  1GAO A;  2Q79 A;  1XNR J;  2XNR A;  3HFV A;  4AQY J;  2GAH C;  1ELO A;  3FC9 A;  5HVG A;  1NKC A;  5F8J A;  4IG3 A;  2HHH F;  5C42 A;  2YKO A;  4U96 A;  4OI6 A;  3C6U B;  1IBL J;  1ZZF A;  3FBE A;  3OTD A;  4KPY A;  1RWW B;  4ZIV A;  4D3G A;  3CCS S;  2LEA A;  4DWI A;  1N32 J;  2BYC A;  1DLO A;  3RG6 A;  2VBY A;  5J1P A;  4NCA A;  1J5O B;  4PQA A;  4CLT A;  3QMQ A;  4ZPT R;  4JV5 F;  2VOP A;  2F1F A;  2QJ3 A;  3MEG B;  5KG2 A;  5A76 A;  1R27 B;  3BR9 A;  2C3M A;  3ZZT A;  2I8E A;  1URN A;  3D5M A;  3ILJ A;  2YTC A;  4YB7 A;  5KFC A;  4EK2 A;  2BJ3 A;  4X4P A;  1DJ0 A;  3PW5 A;  1FRH A;  4OZ2 A;  4OX9 J;  5F0W A;  4PUO A;  4URS A;  2HZV A;  3H8Y A;  2Y1R I;  2PFF B;  3RUB L;  2CJA A;  2MZJ A;  2DCU B;  4QPX A;  4NLR A;  2UP1 A;  1FNO A;  1NZA A;  2ZBQ A;  1Y10 A;  2D3O R;  2VL1 A;  1Q7L B;  2CNK B;  3IWX A;  3MUV P;  1VRT B;  2DR9 A;  1OSC A;  5HQL A;  2M3D A;  4FXD A;  4XTT A;  4A8W A;  1U1L A;  4DR3 F;  2HWH A;  2L08 A;  4NOH A;  4PXB A;  3CJK B;  1T0T V;  1XEZ A;  1RAC B;  2NSC A;  2OH2 A;  3W2W A;  3H2V E;  5E0O A;  3NBP B;  1GK8 A;  2ZC4 A;  3NL0 A;  5HAN A;  5HVF A;  3ZXW A;  2MPU A;  4OZN A;  2GO9 A;  3V81 A;  2HQ3 A;  5CYM B;  1WEY A;  1T7P A;  3G8S A;  2FUG 9;  4WJB A;  5KG6 A;  1ULR A;  1S1W B;  1QVG R;  3PIO Q;  3V4I A;  1T02 A;  3FDS A;  3MM6 A;  4JB8 B;  2VC1 A;  2CJB A;  3PNI A;  4K5S A;  2N4D A;  3T41 A;  4MFB A;  2HLT A;  3TUJ C;  2ADC A;  2Q66 A;  2MYF A;  2QL9 B;  2YNG B;  4LF2 A;  1JXL A;  3QT5 A;  5IWA J;  1BUX A;  2MLX A;  4ZPC A;  2OEJ A;  1DRZ A;  2ASJ A;  4FNH A;  4TKT A;  4FF1 A;  2YNI B;  3R7N B;  3BO3 A;  3IBW A;  2DIS A;  1Y5L B;  1JKH B;  2H51 B;  3BSN A;  2C28 A;  1UJ6 A;  2AD9 A;  4IH6 A;  4CO0 A;  3THV A;  1R8P A;  4C48 A;  4PG6 A;  4Y2A A;  3IRX A;  4GRS A;  1D09 B;  3D4J A;  1KQG B;  2XMA A;  2HBQ B;  5FII A;  3W66 A;  1F2G A;  2HZC A;  4PAA A;  4P2M A;  3P5T L;  2B6A B;  1WHV A;  4ZVS B;  2DH7 A;  3KK2 A;  2NLW A;  4NLV A;  2VB6 A;  2YWK A;  3B4D A;  1OPZ A;  5IC4 B;  4RW7 A;  2RKI B;  2BVZ A;  2Z58 B;  1WOO A;  3W1Y C;  2ATC B;  2Y0S D;  4NMX A;  3SYZ A;  3CUL A;  2XGQ A;  2RB7 A;  2IJR A;  2MKH A;  3GE9 A;  4IRD A;  3M9N B;  5D4L A;  4R5P B;  4EEY A;  4DX8 H;  1T05 B;  4G1Q A;  3KK1 A;  4M1K A;  1IQT A;  3JSM B;  3PR4 A;  1S72 S;  2X1B A;  3SEO A;  3K58 A;  3ETO A;  3EUN A;  2XZW A;  2Q6C A;  4C11 A;  1RHR B;  4N77 A;  2HVH A;  3Q8U A;  3Q8P B;  1UVN A;  1E6Y B;  2KB2 A;  4FBT A;  3N0V A;  3CJS A;  4DFJ A;  3EPG A;  4PG7 A;  1PCA A;  4TU7 A;  3CCL S;  1RAF B;  1Z1Z A;  3G9C A;  1HHQ A;  4DV2 J;  1FFG B;  4W98 A;  1ROF A;  5I4M A;  4LFA J;  2MY8 A;  2C2M B;  3G6E S;  2QFJ A;  2BM0 A;  3D67 A;  1PC5 A;  1ZAW A;  2W9B B;  1LNQ A;  3I0S B;  3W2V A;  4TU9 A;  2VU5 A;  2EC2 A;  3HVA A;  3IG1 B;  4DSL A;  2JOQ A;  3R6L B;  3EXC X;  3TJA A;  1F3F A;  2HQD A;  4NXN F;  4CDI A;  2F9J A;  3MMC B;  2MQP A;  4USJ C;  4OLO A;  1R6V A;  5IOL A;  3CD6 S;  3TX8 A;  3N28 A;  2M4M A;  1WKJ A;  2R7V A;  3MI7 X;  1CS4 B;  1HMV B;  3U1L A;  4KGX B;  2IDE A;  4B3S J;  2HK3 A;  4DV5 J;  5HP1 B;  2X3G A;  4KIA A;  4B3M J;  2E1P A;  2F9D A;  5DO2 A;  4YOE A;  1C0U B;  2HNY B;  3R7B B;  3KDN A;  4F2S A;  5I3U B;  3TAQ A;  1RBA A;  3POT A;  1WAC A;  2WVC A;  3KDO A;  3KJQ B;  1TKX B;  2UV8 A;  2DEJ A;  4EWT A;  5GVQ A;  2XEX A;  3ELH A;  3TP2 A;  1EX8 A;  4B9U A;  4AFF A;  4FPI A;  3IM8 A;  2VFR A;  4KSE B;  4LBI A;  3SQG A;  4B17 A;  4G1I A;  5KFY A;  2GJI A;  2AKW B;  2IJN A;  3DLE A;  3P3D A;  1KN6 A;  3MD1 A;  3DOM B;  3UVJ B;  2D3Z A;  3DC2 A;  4E0D A;  3KJV B;  3JSR A;  3NGK A;  4OIX A;  4I64 A;  1U2F A;  4YY3 J;  3DLG A;  1H3D A;  3RAM A;  4P6Q A;  1CJV B;  1X31 C;  2RUG A;  4XAK A;  4HHU A;  2QEX S;  4FYX B;  2EC0 A;  2IVM A;  3OD2 A;  1RWX B;  3OFG A;  3PW7 A;  1RT3 A;  3I4H X;  1Q16 B;  1FCA A;  1KS2 A;  5KT5 A;  3BH6 B;  4NI2 B;  1IBK J;  2CVI A;  3TR5 A;  4O3Q A;  3TRG A;  4LF6 F;  2DIV A;  2XBP A;  3C6U A;  1KDN A;  1SC6 A;  2P9G A;  2WVE A;  1IR1 A;  3BB5 A;  1GFW B;  1RSC A;  3WIV A;  3TUI C;  3CGI A;  2CQB A;  2FGC A;  2CQ4 A;  2ATL A;  1FJG J;  2V4R A;  1P27 B;  3QBC A;  4B9T A;  4Q2L A;  4XIU A;  1TTH B;  3G71 S;  5J1E B;  1NPK A;  1NUE A;  5F8L A;  3BYP A;  1KBR A;  3O5T B;  4EBC A;  3A8I A;  3EGZ A;  2FJX A;  4ZVO B;  1XNR F;  2F65 A;  1N0V C;  4IKA A;  4AQY F;  1T9X A;  1UEU A;  1TEL A;  2ZZM A;  4ZLL A;  4Z7C A;  3BQ2 A;  4OI4 A;  1IBL F;  3GSI A;  4KHM A;  4LVN P;  2WVF A;  3BBF A;  1S1U B;  2FJA B;  2J9E A;  3MHY A;  3CDA A;  4P73 A;  1VRT A;  1KTV A;  1XJW B;  3OR2 B;  1ZM3 A;  2G4B A;  1H72 C;  2B9W A;  4F2R A;  5C5J A;  3GV8 B;  5F8M A;  3CO9 A;  4I6W A;  4U9R A;  2ZDO A;  1OYD A;  3CB4 A;  2PGC A;  3QFW A;  3NBP A;  1LWE B;  4EO6 A;  1A9N B;  2DNO A;  5F8H A;  1ZAV A;  5CYM A;  4MJK A;  2E1A A;  2O67 A;  4OX9 F;  3PX6 A;  1VQP S;  4J7C A;  2MZR A;  1S1W A;  2E66 A;  3WDO A;  2K06 A;  3RU0 A;  2J6S A;  4ILR A;  1MU2 A;  4FPR A;  2W7A A;  2YNG A;  1X0P A;  3KNA A;  4F25 A;  5SUH A;  4M5G A;  2MKS A;  4R8U B;  1IJF B;  2CQ2 A;  3J81 Y;  2H1Y A;  5SZT A;  2FD2 A;  3DLK B;  4ALZ A;  1JKH A;  4X4V A;  2CPE A;  4KTQ A;  2RIJ A;  1TL7 B;  1LKZ A;  3GPA A;  3BM7 A;  1N36 J;  3UDL A;  2ZBR A;  1IVZ A;  3LA0 A;  4KO0 B;  2X1F A;  1LK7 A;  2XB2 D;  3QT8 A;  3SFG A;  3DN9 A;  4ZVF A;  4X65 J;  1IWA A;  4RU2 A;  3HM9 A;  4ID5 B;  1TFW A;  1B3T A;  3C16 A;  1WC1 A;  4TY8 B;  2B6A A;  1SKU B;  4CRJ A;  2VJV A;  1VIX A;  4FDF A;  2RKI A;  2OTJ S;  5IWA F;  2J6T A;  1X0F A;  4NYZ A;  4AL5 A;  4OYP A;  3M6V A;  3HDS A;  1VBY A;  1WHY A;  3IA0 A;  2HAI A;  4R5P A;  4V19 J;  1H73 A;  2O1P A;  1T05 A;  1VQ4 S;  1N5Q A;  2GVD A;  4PYD A;  3E8O A;  4JI6 J;  1RTZ A;  5E2Q A;  3K57 A;  1VHI A;  3BF4 A;  3IP0 A;  3KLE B;  4ERD A;  3I87 A;  1VQ7 S;  4P9S A;  4CO5 A;  4LFC J;  2VG7 B;  3CVK A;  2AGP A;  4TQS A;  2G0C A;  2PN6 A;  4ECV A;  4K50 A;  2WBM A;  3NAH A;  3BGL A;  3AJD A;  1R8B A;  2MSS A;  1FER A;  1DZ5 A;  3M6W A;  3O1L A;  4NCG B;  3BRE A;  1M90 T;  3KYL A;  3U27 A;  4AXJ A;  5HAO A;  2BMB A;  4UUW A;  1SC4 B;  4TXS A;  1AA1 B;  3HD2 A;  1NM2 A;  3IG1 A;  4HT5 A;  1WD6 A;  3PYG A;  1SL2 A;  1JQG A;  3I4P A;  3D6T B;  2KN4 A;  1NEE A;  2DRD A;  4RNM A;  4ECQ A;  2OFH X;  5GAD U;  4DSF A;  3MMC A;  1EAY C;  2PA8 D;  1JLA B;  5AXK A;  2EKN A;  2GS8 A;  1F9F A;  1NDP A;  2RSQ A;  4MYU A;  2GVZ B;  4IG0 B;  3KLI B;  3VVU A;  2BJ9 A;  2CWX A;  3G6X A;  5L46 A;  1CS4 A;  2LXI A;  4A4J A;  2RDJ A;  1HMV A;  5BYR A;  4KH0 B;  3PEH A;  3D54 A;  4DV2 F;  4ED2 A;  2HQG A;  1HBO B;  1P1T A;  3FCH A;  4LFA F;  3GIJ A;  2HNY A;  4YN3 B;  5FLX U;  2MKY A;  1K8A T;  3CJ4 A;  5A2Q Y;  4ZMM A;  4TN2 A;  1MMD A;  3TWZ A;  2ZBC A;  1HQE A;  4WE1 B;  1Q1K A;  4MKY A;  1RAE B;  4PXD A;  1M0S A;  4YME A;  1QSY A;  5CZV A;  4NWB A;  3T5H A;  2MLY A;  3UVJ A;  3TI0 A;  3KJV A;  1BXN A;  2C2R A;  1HNI B;  5DG8 A;  4CM2 A;  3MM5 B;  3WX8 A;  4H4O B;  2RF2 B;  4MKB A;  4B3S F;  2GHP A;  1CJV A;  3NOG A;  2DNK A;  4DV5 F;  3KUG A;  1NDL A;  2A6O A;  2DNL A;  4ZLP A;  2C22 A;  3C2P A;  1A0O B;  2BAC A;  3IGV A;  4B3M F;  4AUK A;  1FX2 A;  3HMJ G;  1S59 A;  1RWU A;  2ZKU A;  2OD4 A;  3Q8R B;  3MR2 A;  1IM4 A;  2XO6 A;  3BDP A;  3D1Q A;  3M4X A;  3EE3 A;  1RE1 B;  4HKQ A;  3DMJ B;  3GZ7 A;  1TFY A;  3DU5 A;  4UOG A;  1W26 A;  3AHP A;  2EG1 A;  3DU6 A;  1UFL A;  1S6Q B;  1NSQ A;  1FRM A;  3G8Q A;  3GTY X;  4DN0 A;  3C14 B;  2DPI A;  3HO1 A;  4FBU A;  8AT1 B;  1BGX T;  4YY3 F;  4FS1 A;  2DGQ A;  1HYS B;  2FVS A;  2L9D A;  1YJ7 A;  2QYC A;  4WP8 A;  4I2P B;  2OLW A;  1VRU A;  3T3F A;  4P7T A;  1WF2 A;  2I1R A;  1YX2 A;  2IA0 A;  2E5J A;  3K5L A;  2VON A;  1IBK F;  2OML A;  4LFB F;  4PAB A;  1NK6 A;  4OYO A;  2DNY A;  1Q81 T;  2FJE B;  1M5H A;  3AH6 A;  1S1U A;  1X4H A;  2F3J A;  2WCX A;  1O8B A;  2UUB J;  2CNL B;  5C7P A;  4ES1 A;  2VKZ G;  3S6E A;  2ERR A;  5D78 A;  3CCW A;  4MIB A;  2QLW A;  4DV1 J;  4ZPA A;  5AXM A;  5GAG U;  2SXL A;  2YXL A;  3A8E A;  2HS3 A;  4IFY B;  2J8S A;  3MXH P;  3DRY A;  4ZPB A;  1R0C B;  4CO4 A;  2P8I A;  1AUD A;  2HRT A;  2BE7 D;  4Z37 A;  3JAM Y;  4M5K A;  2ZWO A;  4CWB A;  4DS5 A;  1F1B B;  3M30 B;  3ZZU A;  2F8H A;  3HHL C;  3NY0 A;  4XO0 A;  2P5V A;  2EI5 A;  5KFI A;  3GIM A;  1J27 A;  1JX4 A;  3GG1 A;  2BRL A;  4WYW A;  5GAD I;  2YKN B;  4HHH A;  2DB1 A;  1FDN A;  1L3S A;  1NAQ A;  5CHC B;  1QSL A;  1JLB B;  2E5H A;  4R8U A;  4ZA1 A;  4FXW A;  1VMB A;  4RBU A;  2FHO B;  4DI6 A;  3DLK A;  3M9O B;  3D6F B;  1N8R T;  1TL7 A;  1G3O A;  4USM A;  5LOQ A;  2JJ4 D;  4F4K A;  4WF9 Q;  1DTT B;  2DRA A;  4KO0 A;  4AND A;  3THT A;  1KFD A;  2FC8 A;  4DPT A;  3KUH A;  3D6H B;  2MZQ A;  2Z56 B;  4ID5 A;  4BWM A;  2RVJ A;  2YNH A;  2EBG A;  2CQH A;  3R5J B;  2FVP A;  4H4K C;  1SH2 A;  1ZA1 B;  3NXZ A;  5CAA A;  3CPW R;  4TY8 A;  4IOA Q;  1QAI A;  3NP5 A;  4QQB A;  1HW8 A;  4C97 A;  2ASL A;  1X4D A;  4WFA Q;  1GNK A;  3OL7 A;  5J1N A;  2ALY B;  3O6Q A;  5H9E K;  3Q2S C;  4C3L A;  1ZOT A;  1HBN A;  2PMW A;  4MAK A;  3UR0 A;  3MM9 A;  3PRD A;  2BXJ A;  2PE8 A;  4DX7 A;  1U2C A;  2NS1 B;  3L4B C;  3C3L A;  3H2U B;  3LPE A;  2Y8W A;  1RTJ A;  3FFI B;  5HAT A;  1N36 F;  3M2R A;  4RLE A;  5DM6 Q;  3LF0 A;  2AWZ A;  1HQU A;  3MMA A;  2Y8Y A;  1KQF B;  2C2E A;  4TNO A;  3I5A A;  3KG4 A;  3FK4 A;  4WKY A;  1RCX B;  4HI2 A;  1U6F A;  1QUV A;  3KLE A;  3N6M A;  2VG7 A;  1WSV A;  2DGO A;  2K3K A;  3UI3 A;  3DYA B;  2NYI A;  1RCO B; 
#chains in the Genus database with same CATH homology
 2Y9H A;  5CD4 A;  1WJ9 A;  5H9F K;  2Y8Y A;  3QRP A;  2Y8W A;  4U7U D;  4DZD A;  5H9E K;  3QRR A;  4QYZ K;  3QRQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...