2Y8WA

Structure of crispr endoribonuclease cse3 bound to 20 nt rna
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
215
structure length
215
Chain Sequence
GTGAMWLTKLVLNPASRAARRDLANPYEMHRTLSKAVSRALEEGRERLLWRLEPARGLEPPVVLVQTLTEPDWSVLDEGYAQVFPPKPFHPALKPGQRLRFRLRANPAKRLAATGKRVALKTPAEKVAWLERRLEEGGFRLLEGERGPWVQILQDTFLEVRRKKDGEEAGKLLQVQAVLFEGRLEVVDPERALATLRRGVGPGKALGLGLLSVAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CSE3
publication title An RNA-Induced Conformational Change Required for Crispr RNA Cleavage by the Endoribonuclease Cse3.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Hydrolase/rna
total genus 56
structure length 215
sequence length 215
ec nomenclature
pdb deposition date 2011-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08798 CRISPR_assoc CRISPR associated protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1200 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Crispr-associated protein; domain 1 2y8wA01
3.30.70.1210 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Crispr-associated protein; domain 2 2y8wA02
5H9FK 1WJ9A 3QRQA 3QRPA 3QRRA 5CD4A 2Y8WA 2Y9HA 2Y8YA 4DZDA 4QYZK 4U7UD 5H9EK
chains in the Genus database with same CATH superfamily
5SZTA 2WHOA 1NDCA 1UJ4A 3KMQA 2EC0A 4GVBB 3ZZ0A 3TNVA 1JLQA 2E9RX 4DR6F 3GIIA 4KC5A 4EGLA 3PYGA 3GZ7A 4KKOA 2HHQA 3VAJA 4P6QA 2BACA 1NSPA 2R4FA 3VVUA 2IHR1 3CNQP 2XYPB 1JXVA 2J0QD 2OSQA 1NKEA 4DOZA 2BE7D 3A3NB 3FFIB 2CNLB 1G6BA 3JXOA 3GMGA 2OAUA 2HQIA 2R42A 4LSNB 2ZOGA 3ISNC 2XM3A 4F2SA 1VQ9S 1HNZJ 2HKEA 2YTCA 3HT0A 2EEYA 4RU2A 1VQ4S 2LKZA 2QLXA 4KIAA 4F02A 4IH6A 4MAKA 5J2PB 4CO5A 2QRRA 4DSKA 4KHPJ 2HQ3A 3MR5A 1R8AA 4LIRA 2RQ4A 2R2TA 3HPOA 4Y3CA 3Q2SC 4FF3A 3UD3P 3D0IE 2ZWPA 4WE1B 2ASDA 5AXLA 1X7VA 1WG4A 4HHJA 1TTHB 3GFYA 1WACA 2HIYA 5B0GA 2G9OA 3LGNA 5M2RA 2A18A 4F0MA 2CPJA 2KO1A 1HNXF 2CVEA 1NUEA 3EPGA 2KVIA 5KFDA 1D9DA 2YQ0A 2EC2A 3NS6A 3PDNA 3B4MA 1CC7A 5JUMA 3WIVA 2R7SA 4J7CA 4QW9A 2KFNA 1NU4A 1NJXA 3AXKA 4CO2A 5CA5A 1BC6A 4LSLA 2NS1B 2V2VA 2DGSA 1YKWA 4DR7J 5BYSA 2Z0GA 5KG7A 4CT8A 3CD5A 1LXJA 3R9LA 3P3DA 1DY3A 2VODA 4DZ6A 2UXCF 3GFHA 4USVA 1HIYA 1C0UA 4YR3A 3RB0A 4K4ZA 3W64A 2JWNA 4URSA 4P2MA 3US5A 3ZTQA 4Q5VA 2KL8A 1S1UB 1RAAB 5DRKA 1U09A 3HX9A 4ZLLA 3R2DJ 2W9CB 2K2PA 3M2RB 2D3UA 4X4RA 5CYJA 3Q8SB 1SC4B 1RTHB 4Y2IA 4HI2A 4QIVA 1FRLA 2G0JA 3NNAA 1RTDA 3G82A 1FE0A 2XI3A 3T5HA 1ACMB 3ZNUA 1HR0J 4EMDA 4CRJA 5HAOA 5GAHU 4HR2A 1P9YA 3I82A 2PMWA 3MFHA 3BO2A 4HL9A 2AIRB 1YZ7A 1NK9A 2C3MA 3ETMA 5F3TA 1UEVA 1S6QB 3BSAA 2PEBA 2W7AA 3FQKA 4BWJA 2AX0A 1NPKA 1S9GB 1S10A 1KS2A 4OYAA 5F8MA 2GV1A 3QIPA 3ILOA 2CDQA 1N6QA 1XJWB 1T02A 2FY1A 5E3QA 3ZZOA 1Y3KA 5BJRA 1S1TA 4W98A 1WSVA 2GHWA 4OI6A 3PR4A 2LU1A 2NREA 2OPRA 5B0BA 3T6BA 2W2OP 4RW6A 2FHJA 5KG3A 4RU9A 2XMKA 3H40A 1T95A 1FVQA 2ATLA 1TL1B 1SV5A 3FEZA 2MB0B 4KV8A 3K7RA 4AXJA 3SZ2A 1ZS6A 4GO5X 3GIRA 1VDHA 3OL8A 3V6DA 5EX0A 2CQIA 2FUG9 3M6UA 4UUWA 4PQAA 2VG5A 3LGHA 3H59A 4ZMMA 3PXGa 2AEMA 2ZH8A 4B3OB 1N33J 4BS2A 3R27A 4O3SA 2WBMA 1TL7A 3HMJG 5LJ3Y 4G1QA 3HHLA 2HBYB 4A4JA 2R7XA 3QAEA 3A8JA 1WWHA 3SQGB 5HLFB 2BVZA 1HNVA 2GNKA 3AA8A 2J9DA 4GVBA 3CCQS 5FD1A 1RYSA 3MAHA 4N77A 2ZJPQ 3TANA 3LUYA 2R2RA 2QLBB 5EDWA 3IR7B 4GKKJ 1DZ5A 5E3PA 4XDCA 4U96A 3OTDA 3VF0B 3K5NA 2BW7A 4RKUC 3NY0A 1FF2A 5D0EA 4RUHA 1HQEB 3HVTB 2Y0SD 3OTOJ 3CJQA 4ZVFA 1SJFA 3FFIA 4JBCA 1KC8T 3C2PA 2DNOA 2FLNA 2BJ7A 4N8OA 2L9NA 2VV5A 1XNRF 4LSNA 1KQFB 1NJYA 1RQ0A 3P96A 1AXQA 2QLWA 4R8UA 4ZVTB 4IYQA 2HHPA 2W2MP 2LP4A 3SCIE 3GJSB 4YP3A 3HFKA 2MQPA 4X4QA 1YHQS 3PEHA 3UN2A 3H25A 4HDGA 4ECQA 1BY9A 2FZKB 3HLUA 2OD6A 5EGYA 3CJRA 3S7RA 3GONA 2AX1A 4FF1A 5CCLA 4WE1A 1N5YB 4Y2AA 1OYDA 4OFZA 1F5CA 1BLUA 4AQYF 1RHMB 3NMAA 3TQ1A 1SBRA 5F0UA 4RNHA 5A76A 1BUXA 4M95A 1GEHA 2EBEA 1WG1A 4MKVA 4Z7CA 3AA9A 4RPFA 4U9RA 2AJ0A 4LFBF 3TRGA 5MAOA 5KT6A 1ZTWA 1YDLA 2KG1A 3RAQA 3G2XA 4N76A 4N41A 1EARA 2F40A 2O67A 3CTRA 4DCOB 2SXLA 1B3TA 4DV7F 2FLPA 4QW8A 1S5ZA 4B9UA 3IWXA 4IH5A 3RUBL 1B64A 1IKVB 2KJWA 2LXUA 5I3UB 2DY1A 3CB4A 7AT1B 1SPBP 4LRFA 4OZ3A 3M8YA 1SQEA 4U67Q 5THWA 3BBBA 5HMZA 5HMXA 3B54A 1S1UA 3TUJC 2W9CA 2OPPB 3M2RA 4RNMA 2CQGA 4O3QA 3NRBA 1GXUA 1RTHA 3NLCA 3D68A 2ZEJA 2AT1B 2C3OA 1CEZA 5ETMA 1NB7A 2DGVA 2BBEA 2A10A 1X4BA 3OVBA 1OY8A 4K4VA 4P2FA 2AZ3A 4CM0A 2X3GA 1X4CA 3OV7A 1YRXA 2W4CA 2J5AA 3J81j 1O6XA 3BYPA 4F04B 1S9GA 3D0HE 4DQSA 1MMDA 5GAEI 4CLFA 2DPIA 3GJTB 3CDEA 4KJIA 3TVYA 4WCEQ 3GCWP 2HHHF 1WI6A 4DV7J 5DM6Q 1JK9B 3MM5B 3BR8A 5HO4A 2OI2A 3CJKB 4PUOB 2GMJA 3DLEB 1BQMB 1MWQA 4ZIVA 2UUBF 4F3QA 3S01A 3BGFA 3QQCD 3QAUA 3CT9A 3F0NA 3M32B 4U7UK 1FI4A 2ADCA 4RO0A 1TL1A 1YSJA 4PWWA 3R6GB 2MQLA 1PCAA 3OT9A 4I6YA 3QZ7A 2L08A 2YWKA 4FBTA 1NHVA 4C0HA 1D09B 5BYQA 2CAJA 1BD6A 1HBUB 1PKUA 1NPPA 3FC9A 5J2QB 1FXLA 5H9EK 1FE4A 2VBWA 4M5HA 2G1HA 2ZHOA 5B0CA 3PCOB 4B3OA 2RQKA 5ETPA 4JV2A 3TI0A 3DDNA 3RBEA 5CH7B 1VGYA 3SQGA 5HLFA 4C48A 2KTQA 2ERRA 5KFPA 3R5CA 3QGPA 3JQJA 2HQCA 2M52A 4PG4A 4OJ1A 3DLHA 4DMZA 4C3LA 2RS8A 4C3MA 2J0WA 4KGZB 4WWSA 3MUVP 2MKJA 4DPUA 3VTIA 2HBRB 2A1BA 2IJFA 3U27A 1GXTA 4O44B 1HQEA 5FLXY 3HVTA 4UT4A 4TQSA 8ATCB 2V4JB 5H1SV 4CQ1A 4W4MA 2K1RB 2QO3A 3I5BA 3MPDA 1U26A 3FZBA 4IRKA 4FVCA 1PAUB 4AL6A 2RMLA 4FP9A 5H9FJ 2MXYA 2FHJD 1H72C 5DETA 1XQIA 5ETLA 4USWA 1BXNA 3KK3B 4ECZA 1HBNB 2YKQA 5DJBA 1F9FA 3U1MA 4IFYA 2PI4A 4XK8C 1FT8A 3ENAA 1ZM9A 2XG8A 1O51A 1TL5A 1B7YB 3WQPA 2JLEA 1V3RA 1K1SA 1WORA 2C2MB 4DV4J 2PGCA 1T3OA 2HNZB 9RUBA 3K57A 2XCPA 1N48A 1ZH5A 2VUGA 4ZJQA 3TJ8A 4H54A 3G71S 4KY3A 4YR2A 3IA0A 4NEZA 2R3VA 3ZNJ1 2H4WB 2IA6A 3EXYA 2W7OA 2KI2A 4MMOA 2X7IA 3CJ5A 4B9MA 4QCLA 4JI2F 2OD4A 2ZDPA 2VU5A 3CO0P 5E5NA 1UVNA 4ECVA 4LF8J 3RYLA 2LXFA 3M8RA 1Q7YT 2JEFA 1IKVA 5AT1B 3UO0A 1AYEA 5I3UA 3T19A 3AQPA 2MQMA 3AB2B 2QV6A 2V50A 4WBFA 1Q8LA 4IG3B 3MR3A 2FC9A 4G6VB 4ZCKA 2IVFB 1IBKJ 2OPPA 4UOCA 2YNHA 1I94J 4OYWA 3ZTRA 3DRPB 2PO4A 4JV1A 3QRQA 2XS5A 1NAQA 4RUAA 2VA3A 4OV6A 3A3OB 4PPDA 2DIVA 5KFSA 1YVFA 1N34J 2DCUB 2AEFA 3JTNA 2MZJA 2POKA 2WSCC 5D4OA 3W7BA 5B08A 1Q86T 3EDQB 2C2ZB 4X62J 2W24A 4TY8A 2WSFC 1IKWB 4WKYA 2RRNA 5F41A 3R3TA 1X9SA 4OHVA 2HZVA 3QLHB 4OJHA 4A8SA 2EW9A 1AROP 3O8WA 3JSYA 1T9WA 2B8QA 3Q22A 2LXIA 4MYUA 3MM5A 3Q2TC 2PN6A 4PUOA 3CJKA 3IRWP 3TEHB 3DLEA 4UZCA 1BQMA 5GAHI 1DRZA 4CLZA 3NGUA 8AT1B 1S7IA 5LMNF 1G7CB 1Q79A 5EUHA 1CJVB 3S1TA 3M32A 2WVBA 1YG0A 3G6YA 3IR6B 4EU0A 1FWPA 3T5KA 3BS9A 2MZ1A 1RT2B 2C42A 2GQCA 2Y1LB 3KJQB 4DR4J 1D8ZA 3IBCB 4XPCA 2OIHA 2UUAJ 1RSCA 1X60A 3BBFA 9ATCB 3HP6A 3LANA 4OYIA 4DUYF 5HP1B 1DBDA 2UUCF 3CWJA 4K0KF 2FJDB 3M9MB 2HGLA 3BN4A 1HBUA 5J2QA 2W8KA 2YWEA 1XBWA 4LF4J 4EYIB 1KR4A 2ASYA 3CCUS 2VBZA 2VFVA 4C8ZA 5C7PA 3NNCA 1RLDA 1U24A 4Q0BB 1LFPA 1Z1ZA 4M5JA 3CMES 2RU9A 4JV0A 1FNMA 1YJNS 4DPTA 2OP5A 1JB0C 2HNDB 4IDKB 3J81U 1NSKL 4QR1A 2NSCA 3EYZA 3FQLA 4ZP8A 2Q3PA 2VQEJ 1T9VA 1RT5B 3E51A 4YDDB 3KOAA 5DZ6A 2ZC3A 2W25A 3PRBA 4ED0A 4JI1F 1S79A 4IO9Q 2WOMB 3KLGB 3HSDA 3D4JA 4O44A 5CXTA 1HI8A 2KFYA 2V4JA 3MM9B 2HLUA 1OY9A 4LRBA 2MEWA 4I67A 4QJVA 3C3LA 3WDOA 4X66F 1B0PA 4IR9A 2K1RA 3T9NA 1SUQB 2BKPA 1T9UA 1SQFA 2CG8A 1HA1A 1XMOF 4X65F 1LWEA 4ZP9A 2P9EA 3MCSA 3EVWA 1P27B 1B4SA 3GQCA 1OQ6A 2FYXA 1R43A 3KK3A 1HBNA 4USHA 4USTA 3QO9B 2LECA 1RUSA 4JV5J 3SV3A 1MN9A 4FN5A 1X5PA 4KHRA 2UVRA 4LR9A 4MT1A 4OLOA 2UV8A 2DNPA 3H4DA 3GE9A 1SJ4P 5GVQA 4LFCF 1F5AA 1QDUB 2RKIB 4I64A 1JJ2R 2OELA 4K2JA 3I9V9 3KHGA 2DXEA 4ES1A 3MR6A 4KAIA 2NXCA 3I6PA 4A8MP 4CH0S 2J7UA 3N28A 3V6HA 5C2GA 1S9EA 5HK4A 1RAFB 4YR0A 2B9YA 4NXMF 1N54B 1CBKA 2J0XA 1YLXA 4JI8J 2CRLA 4AFFA 2CPDA 3TA0A 2OTLS 4Y2MA 4RW4A 1WEXA 3ILIA 2BX6A 5ETNA 4KGVB 3VAMA 3GTYX 5IM0B 2W4PA 2KZZA 2A6MA 4X84A 4DDFA 3W5ZA 4EWTA 4WP9A 3WIUA 4EEYA 4IG3A 1TUWA 4OQJA 2PEHA 1TZ0A 1RAJA 4DBQA 3HVRA 3DRPA 3QJPA 4DWIA 4DN0A 1NK4A 1HL6A 4JYAJ 4DG1B 2D3O1 2ZH5A 3HVWA 2VJVA 2AJ4A 3CJSA 2ZKUA 1REVB 1EB0A 5DDPC 3T1HJ 3R7NB 1RA7A 3OHBA 1VRTA 5CYQB 1X4GA 3L4BC 5KFWA 4NLRA 4KSEB 1SKSA 4DI6A 2HHWA 1IKWA 1BWEA 2FVQA 3QLHA 2XGQA 4J9KA 2GA7A 4M5MA 2QX0A 3FSIA 3MPVA 1KHVA 2XZWA 2XNQA 3EPIA 4NXNJ 2NPFA 2GQQA 2DHSA 1VJQA 2NLWA 2W2NP 3NOCA 5BR8F 2HW3A 4B9TA 2AJQA 3THPA 3VZIA 4KGKA 1CJVA 1DJ0A 3PY8A 1R0AB 2YQ3A 3PEJA 1FRJA 3UNGC 4KQZA 4MYTA 4NLVA 5HJYA 1FKAF 1Q53A 3DDIA 2UXBF 4QWCA 4LIWA 4F0KA 3F41A 6AT1B 5HP1A 4J9OA 2EI5A 2KJVA 2DEIA 3TZWA 5KFIA 4G3IA 3UR3C 4DS4A 3UD5A 4BCAA 2YQ1A 3SBMA 4UUXA 1NRKA 1JLAA 2L9WA 4B9NA 3IG1B 1ZA2B 4MIAA 2FHKA 2LQBA 2GJ2A 1X0FA 2J6SA 2DNLA 3KK2B 1N8RT 4LBHA 5I42A 4RUCA 1VMBA 2HNDA 4IDKA 2AZ1A 2CZVC 4K5RA 5F8JA 3R5AA 2H1YA 3DFEA 3C14B 2MKHA 3BQ2A 1RT5A 2CUYA 3O5TB 4FNHA 4I0WA 5A8RB 2UXDF 4GKJF 3QBCA 4YY3J 4HHUA 3OR1B 4P52A 2W4DA 2ZWOA 1M5KC 4OIXA 2O1PA 3BF4A 1U1QA 4KFBB 5EN1A 2QYCA 2H51B 1UMJA 2YWWA 2E5LF 1YWXA 2HQFA 3KLGA 4DL2A 5M2PA 5IQ6A 3GG0A 4IKAA 1M1GA 1FX4A 2WVDA 1NCLA 3BGRB 4EYHB 1TUGB 3GWCA 3MM9A 5M2UA 4X4VA 4LBPA 4J9QA 4OZJA 2VONA 4NI2B 1SUQA 2GO8A 5HQLA 1X9MA 4PPZA 4KYZA 3CGIA 3W2WA 4ZKAA 1M5VC 3ISZA 1LKZA 1ZOTA 2HRYA 5HROB 3WC2A 1WEYA 3QO9A 5A8KB 2YXLA 3W5YA 4AD6A 2CJ9A 3X3UA 1LWFA 4DR3F 1RWOB 3AY0A 1R31A 5MLCV 2PD1A 3TAQA 3MUTP 3I5AA 1L3UA 4FVMA 3MAQA 3PX6A 3THTA 2RKIA 3M2UA 3MGJA 4WFNQ 1IM6A 1HFEL 3QSIA 3N0VA 2HFOA 1C4AA 4WKRA 1OIAA 2JOQA 4I56A 1VQ8S 1HD1A 1TK8A 4XDDA 2V34A 4P71A 3UPFA 2V63A 1Q1KA 5B0EA 4IFVB 4RBVA 1Q95G 4O3RA 2ZITA 3D6MB 2GC8A 2V8HA 3GFZA 1GTHA 3E01B 3DM2B 2WRMA 2NYIA 3IFEA 1QUVA 3PJXA 2J76E 1YJVA 3CXCR 2QFIA 3CMQA 2XS7A 1QLNA 4DR5J 1UPMB 2UU9J 2YVSA 3LO3A 3FSXA 5DG7A 2OH2A 2H5IB 5G0RB 5DDQC 4X4OA 4F0HA 3GLJA 2LQ9A 3HT3A 4FKXA 2CJKA 1NZ8A 2GMHA 3H20A 5B0AA 3MD1A 2YPZA 3CJ8A 2DD8S 2RU3A 2MKSA 1RABB 4DQIA 2OEKA 4DG1A 4NASA 5L1IA 1FRIA 3L09A 3JB9k 1S1WB 1REVA 2EK1A 4ED8A 1FTRA 3MECB 2E7WA 4TU7A 5CYQA 2EFNA 1X5SA 3DRXA 3D9BA 4ZVHA 2I5JB 2YNIB 2QLJB 1FJGF 1WOSA 1FKPB 4TLRA 2CPYA 1S9FA 2WVCA 5D6GA 2PIIA 2XMVA 1SL2A 3KG4A 3O2IA 1HYSB 4ELUA 3CD0A 1QSSA 1O5JA 4OYMA 1TU0B 4FYWB 2D3OR 2FGOA 4GC6A 3U1NA 1KKHA 3RB3A 1GTEA 1OWXA 2AJ2A 2JX2A 1TUVA 4X4NA 1RISA 1PC5A 5KFMA 1YITS 2FTRA 3ZO7A 5LL6d 1HI1A 3K5OA 1S0VA 3JYTA 1VI7A 5KT4A 3ISND 5ETOA 3O3LA 4NLWA 3D6HB 1MN7A 2J9EA 1K9MT 3O44A 3IG1A 4E98A 3H2UB 1PJ5A 4H4MB 4FBUA 4ZIWA 1R0BG 4JI6F 3H98A 3KK2A 2I1RA 5T41A 2I2YA 5C25A 4F26A 2HIQA 2XMMA 2CWKA 2BJ1A 1CLFA 4TY9A 3QT6A 2IIHA 3MCNA 2FJAB 3PYDA 3DGPB 1SJ3P 2X3DA 2KVQE 3D2WA 3MOJB 4OI4A 2LEAA 4KBIA 1VQ7S 1KQKA 1GNKA 3C14A 1UKUA 1WOOA 1WC5A 1ZZFA 5RUBA 2H54B 1V5IB 3CEDA 5A8RA 3QYYA 3OR1A 1H38A 2BQRA 4WK1A 1IN0A 4KFBA 4EBEA 1TQLA 4ICLA 4LR7A 5BXIA 3ZTPA 5F8HA 3FRZA 3DOMB 1HHSA 1KQSR 2UUTA 2JNJA 4F7VA 3BGRA 3J81Y 2CPZA 4TYAA 3L7PA 4BDPA 2UUWA 4Z7YA 3DKDA 2JFDA 2D41A 2B7BB 3UE2A 2DR9A 1KWMA 3M1VB 1VLOA 2D7SA 2B51A 2ZZTA 3W3SA 3JQKA 3AHPA 2HWHA 3HJVA 5HMYA 4PG5A 1RBAA 1RTJB 1U1MA 5HROA 2B56A 3FJ2A 4A8YA 1TL3B 2NXEA 3W9JA 3WBZA 5FIIA 5A8KA 1RWWB 1RB0A 5DQGA 3LQVA 1K1QA 2G2ZA 2M2BA 4ZP7A 1FERA 2RF2A 5KFEA 1S12A 1XMQF 3DRSB 2OSRA 1KD1T 2Z2ZA 2XO7A 4LJMA 3N01A 3PYFA 3R97A 2ACMA 3FBCA 2Y3YA 3MMCB 2V8GA 3D7SB 3TA1A 3Q8YA 4I69A 1IWAA 4P9SA 1RK8A 4EFAC 3DMJB 2XYGB 2HS3A 2HGNA 3M9OB 4ED1A 3VAIA 4QWAA 4IFVA 2E7VA 4B3RF 1S72S 1J5EF 2AYEA 4WU3A 3G8TA 2BW2A 3A12A 3E01A 3DM2A 1H2TZ 1F3FA 2BANB 2RRAA 4I6AA 4KO0B 4ZVEA 1JJCB 2KXFA 2YY3A 4L76A 1T0TV 4DUZF 3Q89A 1WTBA 4WPAA 2IMOA 2LQ5A 3BSCA 4RNNA 4XTTA 1NB2A 1KVIA 4EO8A 3DLLQ 3OFGA 3WX8A 4XPEA 2AJFE 5G0RA 2W2PP 3W60A 4HKQA 2VG6B 1TK5A 1DTTB 1YK9A 2CJQA 1ELOA 4JI3J 2Q6CA 3LW5C 4JI0F 4FNIA 5LSRA 1TMMA 2EKYA 1VQ5S 4CLYA 1N5QA 5KAKA 1S48A 3DDKA 2V9WA 3AJ1A 1FEEA 1V9OA 2DB1A 2P5VA 3EGWB 1S1WA 4IOBA 3FK4A 3D28A 3MECA 3AT1B 4XIUA 6FD1A 4LF9F 2EFGA 1F6TA 2YNIA 3T3FA 1H6KX 3RJMB 2ZH7A 1FKPA 4USUA 6FDRA 3KWMA 1TAUA 3KJVB 4HTIA 3BGOP 4G1PA 1HNIB 5J1EB 2R8GA 1HYSA 4F2RA 4PYDA 3VGUA 4U6PA 1MWYA 5LXYA 4C8YA 3UFCX 2ZH2A 4ZITA 4LQ3A 3BJYA 3BSNA 3R5DA 1LK7A 2DNMA 1FKOB 2EPIA 3KJFB 2H4YB 4NOHA 2JC1A 3ZZRA 1CQNA 4OZNA 2M88A 2NZCA 2BABA 1UEKA 5AE2A 2P8IA 2HS4A 1UL3A 2MQOA 5ETVA 4LF2A 1QUPA 2VDIA 2M9KA 4H4MA 4B9LA 4OX9J 1Y10A 4R5PB 5L1JA 3OVSA 2HYIB 1VBKA 4OL8A 3TP2A 5F9NA 2HNYB 1ZZNA 3TX0A 2A2CA 3DGPA 2VQFF 4N8NA 1VC5A 4HH0A 3VALA 3I32A 3T41A 1H7WA 2ROEA 3V6KA 1XNQF 4TXSA 4DEZA 1F3VA 2A3JA 4AL5A 1U2FA 4DZDA 4B17A 1UA1A 2GJFA 4RWWA 2DR7A 4A8QA 4J37A 2Z2MA 2HEKA 2VZ9A 1WHWA 4YEAA 4B3TJ 3HSGA 2DCLA 2ABYA 4L75A 4QPXA 5F8NA 1HMVA 3DOMA 1X4FA 3PW0A 2ZFHA 5D0HA 5AXMA 4B3MJ 4DL7A 2JEJA 4JB8B 2CJAA 4Y65A 1A9NB 4PRFA 1A0OB 1WC1A 3MCMA 3CDBA 3M1VA 2DY9A 1HW9A 3PYEA 3Q86A 1KOHA 2E1CA 2MKIA 2IBKA 1RTJA 2LEPA 3OSPA 3OL7A 3POTA 1TL3A 2XC9A 3T5JA 3PW2A 1FDBA 3F73A 1KFDA 2LEBA 3QMQA 2K3KA 3CVKA 3DRSA 1WI8A 2BUNA 3GIMA 3OR2B 2IY5B 4DL4A 2Q43A 2CQ1A 5KFVA 3MPYA 4ECYA 3IS9B 1K8AT 4FS2A 5E3RA 5DLGA 3J7YI 2V0NA 3MMCA 3D3CJ 5EHHA 1TELA 4JI7J 2VH7A 1UWAA 3M6XA 4P10A 4KKOB 3DMJA 5DGBA 3Q83A 3G87A 1FWLA 4AYBD 5CZXA 3QZ8A 2GJIA 4MFBB 3K8VA 1AB8A 5AE3A 4DU7A 3JS9A 3BQ0A 4NLYA 4HHHA 3QWUA 3OTEA 3R7SB 4KO0A 3C46A 5J2NB 5AJ3J 1U1RA 2DT9A 1Y9OA 2CPXA 4RW8B 3OJUA 3FBBA 1LOUA 1ZYQA 1O8BA 3JQMA 1WKKA 3MEKA 4M5LA 3GV7B 4A8KA 4J9UE 5HQ8A 4J91A 5ETRA 3BH7B 2E5HA 2X1FA 1KRPA 4C8LA 3QNWB 4JI5F 1Q4RA 3TJ9A 4CLWA 2VG6A 4KT0C 2HHTA 1DTTA 4CLPA 1CJUB 5LM7E 3DOLB 3FMBA 3NS7B 3NWRA 1DURA 3PX4A 4DR1J 5F8GA 4ZJOA 3M8SA 4OZLA 3UD4P 4X2BA 1UVIA 3H5SA 4OHZA 1S59A 3VCDA 1SC1B 2FY8A 1HARA 1Q78A 1Y0HA 3GIJA 1VIXA 1PGZA 2Z2LA 3JTPA 1RWVB 1HBOB 3PZPA 1RCOB 3MM6B 3OBIA 3PNIA 3KHRA 3UQSA 3R1LA 1URNA 3MM8B 1WF2A 3I87A 4QZVB 4LSLB 4DV1F 3W1YC 3KJVA 3LP0A 2J9CA 2BJDA 1VK8A 3N6MA 1HNIA 5J1EA 2RNEA 2WB1D 2YPYA 2EWHA 4HT5A 1LWXA 2ZUGA 3NGDA 4DV3J 2FVPA 1FKOA 1LW0B 1KP6A 2WK4A 5GAEU 1AZSA 3CJTA 2M0GB 2OPQB 4NLUA 2HMIB 4C97A 4AUKA 1FNOA 4PXBA 3I96A 4FYXB 2XBPA 1AUDA 4B9VA 5CYMB 2F65A 2OUGA 3OW2R 4PXEA 4O4GB 1UFLA 2GO9A 2I9SA 5LSOA 4DV5F 3GJQB 2RDDA 1W2BR 1JIHA 1H73A 1LK5A 5ETKA 1SC6A 8RUCA 2L48A 1U02A 4X4PA 1YRTA 3HXMA 1RAGB 2Y1IA 4CH7A 2YX7A 3C66A 3DYAB 1N0UA 2JL9A 4R5PA 2GCFA 3IAM9 1UFWA 4DCJB 2QA1A 1RHRB 5AE1A 2HNYA 1QJHA 5KFHA 1KNZA 3M30B 3OFFA 4URQU 2FPHX 2MKCA 4WFBQ 4OI3A 2OGUA 5LSLA 4ED5A 2NUHA 3FUYA 1N52B 2LDYA 1WC0A 3T1YF 3SSQA 4AT1B 1G4CA 2ZM6F 4B02A 4XAKA 1MNEA 1FRXA 2LQJA 2BKOA 3GILA 1URRA 5K8NA 2HK3A 3MR2A 2XLKA 3KLFA 2V69A 1NXIA 3AFGA 4ERDA 4ZOSA 4OLPA 4MJKA 4YB1P 1IBMJ 3F56A 2JHEA 3MOZA 1VQYA 1UVLA 4YHHJ 3N5BA 1PO6A 1HWUA 4LFAJ 3AH6A 1U4BA 4OYXA 3VR1A 3V6JA 5HJXA 1TAQA 3MR7A 2BOPA 2GAGC 4IH7A 3GU0A 3MFIA 1SQGA 3PHEA 4ZPVR 1TL7B 1UWBB 2CQDA 3RAMA 3O6QA 3MMJA 3C15B 1HWKA 2W01A 4M63A 3W8PA 4ZVPB 4DL6A 2YKOA 2G2OA 4YMEA 2DR8A 3D6TB 3TYTA 3KYLA 3C19A 1HWJA 1S77D 3KNAA 1IKYB 2B43A 1N32J 3OR2A 1NHKL 1VK3A 3G6VA 2OFGX 3HJFA 3IS9A 5IC6B 4DV2J 2ZE2B 4ZLNA 3KDOA 1RT1B 1JNRB 4L74A 2GIQA 3H2LA 1FRHA 2E44A 4Y34A 3R1HA 1UETA 3LP2B 3SDEB 3LP1B 4DV0F 2NR0A 4MFBA 1WF0A 3PKMA 2GIRA 1PYSB 4DLGA 2YNFA 4PG6A 2F3JA 2QYGA 3KG1A 1D3WA 1Q5VA 4A48A 4FXDA 2CQ4A 3VAGA 1R27B 3I0SB 3CCES 4CYUB 4RR5A 2IBOA 4KR0B 2FC8A 4LF7F 1RCXB 3EVMA 5J2NA 4R8UB 3UN3A 1RU2A 4RW8A 2DRBA 4C7QA 3FDSA 4D3HA 1FXDA 5IWAJ 4F4ZA 3MZIA 5GADI 3GR0A 3DI6B 2DNGA 1T03B 5K14B 3V4IB 2FJVA 4R0JA 1B70B 1CJUA 2HQDA 1HNWF 2MPUA 3DOLA 5E33A 1KTQA 1DARA 1LW2B 1R8HA 2XSFA 2HVEA 2WBRA 4FYYB 1U45A 3LAMA 1CQMA 2NCKL 3MD3A 4HH1A 2DH8A 1G2EA 3HK2A 4DR6J 3MCOA 1TKDA 2IJRA 3C6TA 1HBOA 1VLYA 2ILYA 3M9NB 3MM6A 3UCGA 2DGOA 3NAHA 2DNNA 1BGXT 5KG2A 3IRXB 3MM8A 3GV5B 5IZHA 2QSWA 5C2CA 2AYMA 1QAJA 4M1KA 2Z2YB 2HHUA 2IM3A 3PFOA 1R89A 3JSMB 3EICA 2AV5A 4IRDA 4DHVA 4BBYA 1UTAA 2R2UA 1QAYA 3VHQA 3W65A 5KFYA 4RL1A 4F67A 2VOOA 2VPZB 1T9YA 4ZLJA 1RT3B 1T9XA 4ILRA 1LW0A 3MXHP 1NLKL 2HS0A 2HG4A 2X1GA 2OPQA 3JTOA 2DRDA 2HMIA 2ZBRA 1SXLA 3OFEA 2M3DA 4U7UD 1FJ7A 3P5BP 3SFGA 3KLVA 5CYMA 3SV4A 1V3ZA 4O4GA 1RWUA 2N7YA 3RG6A 4W90B 4ID8A 2HHVA 4TVAB 4Z2XA 2L9DA 3W62A 2I8EA 2CADA 3OJSA 2HFVA 3K59A 1X5OA 3EMTA 1OYEA 5KFRA 4HEA9 2KXNB 3DYAA 2OHDA 4ILMA 1BMQB 2IMWP 1QTNB 2RB7A 3RRGA 1HNXJ 1RZMA 4DL5A 5H9EJ 2C22A 1UPPA 4CCHA 2VFUA 4FF4A 2CQCA 4WP8A 3FBEA 1ULRA 1YIJS 3K89A 3UDCA 1S76D 1RT7B 2ROGA 3M30A 3MEGB 2E1AA 1GMWA 1YQHA 4EK2A 5HVHA 3ZTSA 4MKAA 4GO7X 2ZBIA 3BV8A 4DQPA 2E5JA 4CNYA 2UXCJ 1FK9B 2FB0A 1K0VA 1U1LA 1IBLF 4L3NA 4DX5A 3IC1A 3KLIB 1T7PA 2N7CA 4YOEA 3PRVA 2Z57B 2O01C 1HQUB 3EJMA 1APSA 3M7VA 2KHCA 2K8GA 4FKYA 1J5OB 2DGXA 3CCWA 2EKNA 3TQEA 1R8PA 4Q43A 3TW0A 3KLHA 3WHIA 4ETXA 2KXHA 2DH7A 3UVJB 4U7CA 4JUZA 2FDNA 1HLWA 1RYRA 1UWBA 1SKUB 4OX7A 1DLOB 1SJQA 2UVUA 3C15A 4HYKA 1VQNS 1HHQA 5KG1A 5ETQA 1OPIA 1IKYA 4DV6F 4DCPB 5DDRC 2E1RA 3HKWA 1YBAA 4LSZB 4O3OA 2R7TA 1Z4UA 1HHTP 4LRAA 2HQGA 4RX6A 3KNGA 4K4SA 2ZE2A 2QMXA 1RT1A 3MDFA 2JFKA 1OS5A 4DSEA 4HDHA 4NLDA 5D78A 3FBFA 3HO1A 2YX1A 4F4AA 3ZZYA 2AJ1A 2H3EB 3ITHB 1ZBTA 1S57A 3LP2A 2WAQD 2M8DB 4RNFA 3EZOA 3SDEA 1YGYA 3LP1A 4PZVA 4F8RA 1QE1B 2KDOA 5EWFA 5L1LA 3SEOA 3R6LB 5DM7Q 5AXKA 2WW4A 2DNRA 3I0SA 4CYUA 3BREA 1SCJB 2E29A 1VQSA 3CCTA 5CAAA 1U0SA 3K2YA 5K8MA 4C8KA 3J7Z5 2VL1A 3BSOA 2AGOA 3DI6A 1IXKA 1B0VA 1KBRA 1FDNA 1T03A 1Q81T 4P74A 3GIKA 5K14A 2R8KA 1ZM2A 4IFYB 4PYAA 4Q7AA 1ROFA 2WZ1A 3V4IA 1KQGB 3BGUA 1RTIB 2EBGA 1NH7A 2B4UA 4YFUA 1LW2A 2CQBA 3NBPB 5K8PA 5IS2A 3EXCX 3BPSP 3M8QB 1S0MA 5D3GA 1FFWB 3RZAA 1HPZB 2GVDA 4MTPA 1TV6B 2I6WA 1S6PA 1VR6A 3ZC4A 1H2VZ 3GR1A 2Z30B 3DU5A 1HBMB 2CZ4A 2M4MA 1N56A 1U47A 1P8GA 4I2QB 1GX5A 5GMDA 3IRXA 2YX4A 2XQCA 5A6PA 1X5TA 1SJRA 4ID5B 1FCAA 4DFJA 2R8JA 1S6UA 2XWYA 1ZPWX 3JSMA 1B7FA 2GX8A 1XNRJ 4JI4F 1VHFA 3WC0A 2RHSB 4TQRA 4BC7A 4DL3A 3MAAB 2HURA 3NKYA 1RT3A 4KB7A 4TNOA 2D74B 3QT5A 1RP5A 1A6LA 1F2HA 1WC6A 4K4WA 2ADBA 2LFVA 2YNHB 1NKBA 2FVRA 3VAKA 2D1CA 3EZ5A 2ZUAA 3GG1A 2JJ4D 2V6AA 4AQYJ 2EXUA 3KUEA 2DNYA 2ZH3A 1H74A 1GMVA 2XWXA 4ED3A 4USJC 5DQHA 1IR0A 2ASJA 1YJRA 3THVA 1KLMB 1RAEB 1WKLA 4LF5F 4TY8B 3BKTA 4KGMA 1NZAA 4LFBJ 2RVJA 1HQ2A 2AD9A 2CA9A 3UWTA 3NCPA 4ZPTR 3H5YA 1XEZA 1RT7A 5E41A 4MKYA 3MEGA 2FJEB 1X9WA 1ZPVA 4ZPBA 1GX6A 4KHMA 2C2KB 3H90A 5KFLA 1F2GA 3P5TL 2DGUA 1SL1A 4IQXA 1Q8IA 5A6WA 3RGIA 2F4VF 1JJHA 1M1HA 3P4UB 1V6HA 3ZZUA 3HCXA 2MDAA 4L72B 4KE5A 1U1PA 3TUIC 2NXJA 3WX4A 4CP5A 2B4VA 2GVZA 5CHCB 3HI9A 1VHIA 1FK9A 1RGVA 1H0HB 3NMRA 3CD7A 3KLIA 2B5JB 3ZZZA 2YH0A 3MURP 1HQUA 2NSBA 3B8HA 1NK7A 2F7VA 4ZK7M 1J5OA 4EZ6A 3ULHA 2D69A 4WZQA 2ZOFA 1R6YA 4P73A 3BKUA 3K8WA 3RW6A 4AL7A 1NJZA 2CVIA 3R7BB 2F9JA 2EVZA 1N36F 2KN4A 3UVJA 3HSJA 2CJXB 3I56S 5KOXA 3H7HB 5DZ7A 4Q2LA 4L6V3 1IQZA 1H3DA 3M4XA 5L8RC 4NA3A 3SI8A 1DLOA 4DF8A 2V4QA 2MZTA 2BQUA 1UJ6A 3SXLA 3CIMA 3LTOA 2XLJA 1RBOB 4ZVRB 4WFYA 2FGCA 2NPIA 2ROPA 3G6XA 3QJJA 3C16B 3MTKA 2M70A 1EX8A 2HHHJ 4NLQA 2GMLA 2DIUA 3M8WA 5DQIA 1X8DA 1RWPB 2XMWA 4ZPWR 1U2CA 2MY7A 1N5TA 3HHEA 4DR2F 3ITHA 1FA0A 2UUBJ 3VWSA 1VOMA 3A4TA 2FHOB 1QE1A 1ICEB 2HBQB 2MGZB 4YB5A 2FZGB 1EZZB 1KN6A 3GSDA 3QRRA 1NDKA 3NGSA 3JSRA 5B0DA 3ETOA 1SIZA 1LWEB 4NLSA 3D54A 1IUJA 1VBZA 4F3OA 5IT9U 2MQQA 5KFKA 4X4UA 1NDPA 2E1MC 2PDAA 4UOFA 4USIA 2W8LA 2ZDOA 2YH1A 3W61A 2HFNA 3HFZB 5D15A 1RTIA 4C2MA 4NLPA 4V1Ak 3J80U 2KFZA 3NBPA 3M8QA 3I0RB 4X64F 2VC0A 4QWBA 3QGGA 5LMUF 4IOCQ 3FMWA 1HPZA 3P49B 2AGQA 1TV6A 2R7RA 1PILA 5JVGQ 1JLGB 2BRLA 3V5RA 1TKXB 4C3KA 4LRDA 1HBMA 1M5SA 4TN2A 3HHLD 1S9EB 4U8VA 4V19X 2CQPA 4DX8H 5J2MB 4I2QA 1NSQA 1WELA 2DR6A 4ID5A 2V68A 1VS3A 2ZH4A 3IBWA 1OO0B 2LYVA 3AXMA 2HFUA 4RW4B 3IO1A 3QT8A 2R7OA 3WZ0A 4J9VA 3OFHA 4HLBA 4E8UA 3DOKB 1NBEB 2JC0A 3MAAA 4C0BA 2LQ8A 2ZH1A 3PJWA 2RS2A 2F8MA 5KFQA 1MMLA 3SMZA 1YJ7A 3EZUA 3KLEB 1NPRA 2P6SA 1R8BA 3SIPB 3X1LB 1JQGA 2VOPA 1TFYA 3HVAA 1WDDA 1D1UA 5E3AA 1JJ4A 2KZMA 1F9EB 1MU2B 4LT6A 2QZ8A 1FESA 4WXWA 2XMJA 4WZMA 1RWXB 4J9MA 2C3UA 3QFHA 3SYZA 4PCQA 1VRTB 1KLMA 2F9DA 2ZKTA 1LQ9A 1VQKS 2OFHX 4CZCA 3T6JA 1JNZB 5A0YA 4F4WA 2P6TA 1T9TA 2K3IA 3OQ2A 4JI2J 1HNZF 3PW5A 3PW7A 3ONQA 3CULA 4KHPF 2MKYA 1IJFB 1VYAA 2XULA 3IN5A 3DGVA 3AOAA 2L3MA 3FEXB 4CWBA 2CQHA 1LEOA 3AD9C 3DCAA 3VVTA 1GFWB 4CI0B 1R0CB 1AFJA 1U49A 2ZH9A 1YX2A 4N47A 2I38A 3A3PB 3G6ES 1Q0NA 2DGTA 3CPWR 2B5JA 4PQUB 3IBFB 1JKHB 3TEGA 2HHSA 4A8XA 3GPAA 3KUHA 3RRKA 4PABA 2KB2A 2YBVA 3PM9A 1D9AA 2LU2A 3H2VE 3PFEA 4FS1A 2VD3A 1JLAB 2G1DA 1M5OC 2J9DE 4S0MA 1NK5A 1S99A 4FF2A 3FCVA 1KVJA 3BO3A 3OL6A 2JEGA 4FXVA 1IR2A 2VFTA 5I42B 1AT1B 3I31A 1UFKA 2PA3A 4CIOA 2ASLA 2BJ9A 3HF5A 4DR7F 4UF4A 4J9RA 3C16A 2R9LA 2J7KA 2DNQA 2GS8A 5E0OA 1VCTA 4BLGA 4URGA 5DG9A 1FEHA 3HDSA 2KT5A 1SIWB 1X0PA 5LMNJ 4DSJA 2U1AA 4ER8A 2XI2A 1K73T 2XZTB 3RBXA 3FCHA 5U47A 2N4DA 4ZCMA 5KFTA 2MGZA 4W92B 2R2SA 1XR5A 4E2FB 1HR0F 5KFGA 4GMKA 2MQNA 2WONB 1GK8A 4DUYJ 2UUCJ 1RT4B 1BQNB 3W9HA 2GGPA 1FDDA 4K0KJ 2CPHA 3Q8QB 4ECXA 3J7AN 3NL0A 2ACYA 2J6UA 1IJEB 3W2WB 1HWIA 1T05B 4LVOP 1U6BA 4DSFA 2RQMA 1OY6A 4ZVOB 1SC3B 4N56A 5SUHA 2CNOB 1EAYC 1ZA1B 2COLA 3TR5A 4ITSA 4KPYA 1CC8A 4DF4A 1LWFB 1WHYA 2KKHA 4FPIA 3G8SA 3NCRA 5EWEA 5HVFA 3DXBA 3I0RA 2R7UA 3PHTA 3M2UB 4F50A 1GH8A 2UVWA 1WOPA 5AXNA 1DQ8A 2XGPA 4RZRA 1JLGA 1TKXA 3PVXA 1G1XA 2LVWA 3AAWB 1I3OB 4JI1J 2FQQB 1VIOA 3NAIA 5J2MA 3BB5A 4ECWA 2HBZB 3D0GE 4NWBA 1RT6B 1Y3JA 2Q6BA 1N5VA 2EG2A 3B82A 3GYNA 3H0PA 3MPWA 5KT2A 2M7SA 1CJKB 1UEUA 4X66J 1N33F 2D3ZA 3DOKA 5GAGU 3ICLA 3LPEA 1XMOJ 4X65J 4ZPCA 3MM7B 2VBYA 4C98A 2QFJA 5T7LA 5C42A 1Y7PA 2GW8A 1GT8A 5L9NA 3KLEA 2XHCA 5DO2A 3MWBA 4WP3A 4U95A 4C9DA 3FRYA 5IT4A 3SCJE 1IWGA 2V2ZA 4A8FA 4J9LA 1SL0A 4Y28C 2YWHA 4WK3A 2MZQA 1SH0A 2E66A 3V81A 3UI3A 4LFCJ 1MU2A 2JEIA 4GKKF 4HTJA 4RW9B 1KTVA 2FZCB 3R5JB 1SH3A 4NZ6A 2JDJA 3CCLS 2HFSA 3I55S 4MK7A 3RU0A 2R8HA 3OTOF 2Q66A 2XZDB 1OQ3A 1RA6A 4K5SA 4ZHRB 1U1KA 2DYAA 3NP5A 4NXMJ 4H4OB 3RB6A 1D9FA 3MEDB 1YJWS 5IC4B 3NGKA 3Q0AA 1PIEA 3PJ9A 3D5MA 2IRUA 5C24A 2HWIA 1VISA 4G65A 4KRWA 3EGVA 2P2CB 5J1PA 1L3KA 3N9UC 1FFSB 3MMAA 1KVKA 1UVMA 2GHVC 5KG4A 3KXDA 4PQUA 4EO6A 3LGMA 1JKHA 5D77A 4Q45A 4DPXA 2XMAA 3PV8A 1IM4A 3IM9A 2JVRA 1X4EA 3JYTB 2QG9B 1NK8A 2RT3A 4PG8A 3PX0A 4OX6A 5K8OA 5IT0A 4LR8A 1X4HA 1JLCB 2HAFA 1XMBA 3TVZA 4OYBA 4O3PA 1W2IA 2BM1A 1S4EA 4ZDNA 4CLUA 5C25B 3CSKA 2HRTA 1NSAA 2DITA 4RBUA 1FVSA 5KFBA 4UZBA 2IRXA 1T8EA 4I6WA 4EUVA 4CLLA 4ZVSB 4RLEA 2QA4S 2RH3A 1FRKA 1CG2A 3CJ0A 2P9GA 4DX7A 2ATCB 4ED6A 2O5DA 4OI1A 2CIMA 2F63A 5J2PA 2W9AA 5B09A 2XS2A 5BR8J 5D0RA 4ICLB 3BPDA 2JRSA 5LT5A 1FO1A 4K2XA 5A2QU 4OZ5A 3FSYA 2BA9A 3MEEB 1KONA 2V8PA 3G4SS 4OHXA 2ZBCA 2C2RA 1CSJA 2UXBJ 3N5FA 2WONA 3J7YU 4IOAQ 2CPEA 1RT4A 1BQNA 4Q2MA 4DX6A 1PBAA 1AW0A 3HZGA 5KG0A 3AJ2A 3UNYA 4TU8A 4DU8A 1NKCA 1T05A 2BJ8A 3VAFA 2B9WA 2EK6A 3A8IA 2D9OA 3QJLA 3CC4S 2RF2B 1W25A 2Y8WA 1ZETA 1RWNB 4ANCA 5IFMA 4USMA 1XTZA 2QTWA 1UAWA 4EI2A 2PI5A 1TFWA 3BO4A 1ZAVA 2XSJB 4C8OA 2Q79A 4NYOA 1P1LA 2Z8QA 1F60B 4OJ3A 4ZA1A 2UXDJ 4GKJJ 5IT9Y 3M2VB 3O1LA 1LXNA 3CC2S 2C28A 3ILJA 1XK8A 3J7A1 5HN0A 4PEOA 1SB6A 3FZ2A 2E5LJ 1A7GE 2C3YA 1VQOS 1FDAA 1RT6A 4NA2A 1OJ4A 4M5GA 3EGZA 3VQSA 3J80Y 2BMBA 1Y00A 1FXRA 4OZ2A 3NXZA 1CJKA 3BYRA 7FDRA 4MIBA 2NXNA 4NPOA 4ALZA 3LAKA 4OZ1A 1Q7LB 3FGVA 3DRYA 3MM7A 3PIOQ 1S6QA 2UP1A 2PMHA 3CJ3A 3KHHA 4ETZA 3KDNA 4UQTA 1Z2LA 2ZH6A 1RHQB 4N5SA 3M6VA 1JLFB 4DR3J 3L7OA 1NK0A 1KDNA 5DS7A 1MROB 4UQGA 2H9ZA 1E6VB 1C0TB 1LNQA 1NM2A 4RW9A 1WKJA 3A8KA 2FHMA 4ELTA 4DPWA 3KMSA 3DLGB 2ZHBA 3H5XA 2DGWA 4C4WA 1FTCA 3GP9A 4ZHRA 1XERA 1GXLA 5HMWA 2B0GA 5D0GA 4H4OA 3M05A 3N6LA 3MEDA 4YDXA 3K5LA 2VKZG 4N7TA 3E2EA 4DQQA 4WIQA 3S8SA 5ETSA 1JXEA 1C4CA 4K50A 4LF6F 3BBCA 2Z58B 4TYBA 2AWZA 1BWVA 2C2OB 2DBBA 1Y5LB 2QJ3A 3QWPA 1S97A 1MMNA 2DNKA 1WC4A 3GJRB 1YBTA 2IDEA 4JOUA 5F9LA 3Q8RB 3BN7A 1RWKB 1JLBB 4WF9Q 4DV4F 3QIDA 5EX3A 1UZHA 1IQTA 2M5YA 4I4BA 4CLTA 3CCZA 4ZPDA 3CJ2A 5F3ZA 2KH9A 2HFZA 2RHQB 3S6EA 3VZHA 4QIFA 2ZJQQ 1JLCA 4WXOA 1SJ1A 1AA1B 3V2UC 4Q44A 1VQPS 2CZ9A 2XLIA 5KTQA 4QYRA 2LA6A 2V8VA 3KFWX 5T14A 1NNDA 3H4BA 1QAXA 2HPUA 4LF8F 1FJGJ 2IM1A 3G8QA 2G2YA 7FD1A 5KFXA 1U0HB 3NWGA 2AHOB 2KM8C 3R5GA 5C5JA 1B0TA 3U1LA 4CT9A 2HVIA 3UN5A 2CDRB 2AF6A 2RDJA 1KHWA 3B4DA 4NRUA 2RD5C 3DLJA 3W5XA 5D8HB 1FJEB 5HQMA 1XC9A 4LF6J 1S1XB 1IBKF 4AXIA 3TZYA 2QC3A 1HMVB 4WU2A 1I94F 1LV5A 2JSXA 3D6FB 4RJVA 5IOLA 3MEEA 2IDLA 2RUGA 4AE5A 5GMEA 2B4PA 1N5YA 1KFSA 2QN6B 2QGFB 1N5SA 3DC2A 1U1OA 2MQ8A 1N34F 2DXDA 3FNNA 2VFRA 1LFWA 1RWMB 3ELHA 2VICA 2E1PA 4OYZA 1P1TA 1TMJA 1C2PA 2IPOB 2C3PA 2V94A 4X62F 2XCAA 4NZ7A 4ZVQB 2H65B 3POTB 2DHAA 4I68A 3EX7B 1WUUA 4BWMA 4P75A 1I5OB 3KK1B 4JI6J 1NK6A 3E3XA 4I2PB 2ZBPA 1X31C 3NGRA 3CD6S 1H2UX 1U2RA 3BH6B 2GHPA 4RW7B 1REGX 2YNGB 5KG6A 4X4TA 3OSNA 2XSJA 4K59A 1Q8BA 2LMIA 5GADU 3GCXP 2E7XA 4ZS6A 2HVHA 2OO4A 3M2VA 2AP6A 1DAXA 4FPRA 4DR4F 2UUAF 1KOOA 2H5JB 2QEXS 2AYBA 3BDPA 4OZ0A 1BHNA 4ANEA 3CCJS 4LF4F 3ZFVA 2CQ2A 4IR1A 3HM9A 3TA2A 1FX2A 3CCSS 3RRHA 4LRCA 2EFQA 4NEYA 4MK9A 1M90T 1TL4A 5KOWA 2ZNZA 3RTVA 4DS5A 2RRBA 2FJXA 4DXLA 2VQEF 4DQRA 1XMQJ 1JLFA 4ZCLA 4P7TA 3UDVA 1MROA 1E6VA 2KYZA 1C0TA 1I1GA 3NG8A 1R7IA 3N4WA 2QSFA 5GAGI 4QU7A 1UP1A 1K0TA 3PW4A 2DJWA 2VF3A 2MKKA 3DLGA 3Q8PB 4ENOA 1Z2ZA 3DRRB 3E8OA 4WYWA 3IWLA 3LP0B 4V19J 4B3RJ 1J5EJ 5JMNA 3G96A 3OXLA 5K5MA 2VDHA 3FCWA 2CPIA 2KG0A 2B8PA 4USKA 2WVEA 4DUZJ 1Q82T 2B3TB 5KFOA 4QYZJ 4JV5F 1AZSB 2MHEA 3IXQA 2FVCA 2IYGA 4UOGA 2HZAA 2DXFA 2RQCA 3DHXA 4NCAA 4QIWD 1WHXA 2NUUG 2F5GA 1JLBA 3TWZA 1L3SA 1WNEA 3RAXA 1FD8A 4JI0J 1UZDA 5KFUA 3OVAA 1T11A 2ZVIA 4C8NA 2QA2A 2V8DA 1VRQC 2HSEB 5HL7Q 5FDLB 3OTCA 2BJEA 3K5PA 3P8BB 3OL9A 4F4YA 3C8YA 4P2XA 2RUSA 3LPYA 4OYOA 1EKRA 1XR7A 2WTFA 4LF9J 4IRCA 4JI8F 2DKOB 2Q1LA 1XR6A 4OMFG 4WTYA 2YKAA 1U0HA 3LWMA 3HHNB 4DPYA 1J27A 3TX8A 1SVDA 2MSSA 1S0NA 4MIWA 2DEJA 4NMLA 2GZOA 4KPCA 2VFSA 5DDOC 4ECUA 1TVRB 1S1XA 2KT3A 1YJTA 2A2DA 3KLFB 4PKDB 3QRPA 3MHYA 1K47A 1NJIT 4JYAF 2XMUA 4FZVA 1JMTA 5F0WA 5K9FA 4YQWA 3TUPA 4GVLA 4ANDA 2HNZA 2B6AB 1U25A 2PE8A 4NCGB 2BEFA 2AKWB 3AQOA 3T1HF 2Z56B 2PFDA 3CCRS 1CVJA 5HSPA 4K4XA 4PWDB 3G86A 2BE9B 3ZXWA 2JZ5A 3TUZC 2MYFA 3QT7A 3BM7A 4Z37A 1F1BB 5A2QY 3GYXB 3KK1A 4ZPAA 4M94A 5H9FK 4I2PA 2CQ0A 4NXNF 3IR5B 4RW7A 2YNGA 1P6TA 3W2VB 2VQFJ 1S4FA 4DJBA 2BYCA 4H4KC 3CDWA 1XNQJ 3MF5A 3SSRA 1S0OA 3HHKA 5CD4H 4ILLA 1LWCB 1HI0P 2O66A 2YNFB 4CLKA 1CULB 4IO1A 5A8WB 1O0PA 3QFWA 4LF1A 3W66A 3CDAA 4CDIA 2JLGA 2GFFA 1B99A 4J9SA 1M0SA 1DFDA 2KRRA 2XYHB 3PO5A 3HSZA 3ZZTA 2AU0A 1NH8A 2J8SA 3EWGA 2YKMB 3Q23A 3FEYB 2ZOMA 1FRMA 2JH3A 4Y2CA 2KYXA 3EE3A 1UA0A 2B7CB 2PT0A 1U1NA 4B08A 1CJTB 2X1BA 3R5BA 5CZVA 2DHGA 5HVGA 1R6VA 4YY3F 2CNNB 3BEGB 4M5KA 2G0CA 4YS2A 2QLFB 2V2QA 3ENVA 2G13A 3FVYA 5DG8A 2AW0A 3C6TB 1T3NA 1NO8A 4QU6A 4YB6A 3LF0A 3GYGA 3LA0A 3H42A 1RT2A 4F4KA 1YJUA 5L9XA 3MUMP 3DLKB 2ZC4A 3DRRA 3DN9A 2V9KA 2AQ4A 2AEJA 5I3PA 2RDIA 3A1YG 4C8MA 4TU9A 3I5CA 2YWFA 1UW9A 5HBMB 4NLXA 4R0EA 4DFPA 2B9XA 5JVHQ 4M5DB 1L3VA 4KH1B 4ZVUB 1NHUA 2F1FA 1RJJA 4Q0BA 2OTJS 4NYPA 5B7WA 1X4DA 1S7HA 5E2QA 1RHKB 3U7JA 4EZ9A 4DN9A 4JI5J 2FLOA 1WTFA 2Y9HA 2DH9A 1N88A 1YRUA 3CE8A 4UOHA 1M5HA 3P45B 2CFXA 1R3NA 3NCQA 4FXWA 3UR0A 5KT7A 4JP8A 1EQ0A 2D9PA 2HK2A 5FDLA 4UTGA 1DQAA 1TKZB 2A0FB 4Y6IA 1SKRA 2Y8YA 2UV8G 1ZTTA 3QPIA 4O3NA 1UVJA 5EWGA 1JWWA 4NZ0A 1UVKA 4DLEA 2ZZMA 2WOMA 2J8AA 4LQ9A 4NRTA 2HHXA 4CM2A 3U02A 2DGQA 4X4SA 1QVFR 5CQGA 1SH2A 1VRUB 3VAHA 2CPFA 4DV1J 5KT3A 4K4UA 4HVZA 4DR5F 3I4PA 4L3KA 2UU9F 2BXJA 2V5HG 1H7XA 1MLAA 1RHJB 3CO9A 4HT7A 4KH0B 3KUGA 4ZN1A 3VGVA 2NZ4A 1TVRA 4K7QA 3JAMU 1WC3A 3QGIA 1CS4B 2G0IA 3CF5Q 2CYYA 2DRAA 4WJBA 3H5UA 2J6TA 2W7PA 3SSSA 2YKPA 5J1NA 5DGAA 5HI7A 2XO6A 4OV1A 1EKSA 2FJBB 4DV5J 3KLHB 2B6AA 4QR2A 4NCGA 2ILZA 2RILA 2ALYB 2R8IA 3GV8B 1QD1A 3MI7X 5IQQA 4PWDA 2W2QP 1ZAXA 4MK8A 5JJBA 3TAMB 3HKZD 1NJWA 2BM0A 2FLLA 4G1IA 1FJCA 5CD4A 4C6AA 1C1BB 1S1VB 3AODA 3W2VA 1Q8KA 5ADZA 2CKWA 3ET6B 4RWXA 1VC0A 2MHNA 2KM8B 5IM0A 2HVDA 3KG0A 3I4HX 1U48A 3GB0A 1FWKA 3T1YJ 3IAS9 2ZM6J 2VASA 3IP0A 2MLZA 4QBUA 1X4AA 1LWCA 2QMWA 1OSCA 5JXSA 3OD2A 4WFAQ 3AB4B 2PFFB 1CULA 1VC6A 4ECRA 5A8WA 3AJDA 4DPOA 4O0IA 1OSDA 4FYDA 2BZ2A 1L5UA 3TZXA 4ECTA 5KFFA 2Y1JA 1EETB 4F25A 2HZCA 2HRUA 2EG1A 2N3OA 2BE2B 2WSEC 1QY7A 2DISA 3ILLA 4UW2A 3K0JA 2XB2D 5D4PA 4YB7A 2E5GA 2MTLA 2YKMA 1VFJA 2R7WA 1U7LA 3DXSX 2XY6A 3PIPQ 3EM1A 2J0SD 4L73A 1D0EA 4OI0A 2RJZA 1XIQA 5D3GB 1CJTA 2EFPA 3TOQA 3A8EA 2GVDB 1GMUA 3NGTA 1S6PB 2CNKB 2GAHC 5KFAA 4A8WA 4K4TA 2MJNA 2A6OA 1R0AA 4J9PA 3Q8UA 1W26A 3LWLA 1TP7A 3BQ1A 1Q16B 1ZAWA 1DTQB 2UZAA 4DV0J 3DLKA 3KHLA 2RIJA 2XTJP 3C6UB 1NMEB 4R25A 5LOQA 5HBMA 4I7FB 2PA8D 1PJ6A 3UCZP 4Q8EA 3BDEA 4LF7J 5G4DA 4M5DA 2GIFA 2V4RA 2ZBQA 3HHLC 2QL7B 2V2KA 1TR0A 3IMQJ 1KLNA 2CJBA 2Y1RI 3UW1A 2CQ3A 2RSQA 2DO0A 1IBCB 4P7VA 5L38A 1G3OA 4IQMA 4A46A 4M5NA 1HNWJ 2MY8A 2IC3B 1QSYA 2AYGA 4ATNA 3AOBA 2JVOA 2EFOA 3W9IA 2ZJRQ 1VQMS 3OLBA 2O3DA 4WTOB 3CMAS 1TKZA 1UCNA 1JLEB 3EGNA 1IVZA 1QVGR 2KRBA 2FD2A 1DQ9A 2IVYA 2NXUA 4U8YA 1YZ6A 1JX4A 2IAJB 1RXOB 3VGTA 2C2DA 1UJ5A 4PG7A 3QGHA 1RAOA 1VRUA 4QPTA 2FVSA 2DHXA 4YN3B 3PTWA 4NLTA 2H5EA 2DTJA 4RUBA 2KHDA 4EBCA 1EIYB 3I9ZA 4NI2A 4WFXA 3A13A 1BQXA 3RW7A 2DVIA 3HD1A 4QWEA 2OMLA 3D1HA 1RKJA 2GVZB 5FJ4A 1U6ZA 1WEZA 4JI3F 1HWLA 1CS4A 1AUSL 2MLXA 3B78A 4BHQA 2ALZA 2DPJA 2MZSA 2N82B 5L46A 5ITHA 1YTYA 3D66A 2PSZA 3BKFA 3N79A 3OHAA 1FFGB 2XMTA 1TKTB 3Q8VA 2CWXA 4BC9A 2QE5A 2XY7A 2OJ3A 1Y5NB 5D4NA 3AD7C 2VPWB 2YKNB 3ZTOA 2F8EX 3HFVA 3TAMA 5L39A 1N4LA 3LALA 2OPSB 3PR5B 3IM8A 4HACB 3QATA 4P2SA 2MMYA 1WSRA 3AOCA 1L3TA 3BGLA 1V5VA 1C1CB 1C1BA 1S1VA 4LMZA 1OPZA 3P6YC 3IWNC 3TAPA 1RACB 3DHWC 4UY85 5D4LA 2B9EA 3K17A 4CNZA 3ET6A 2N3LA 3KKFA 4QWDA 4E0DA 3CC7S 4LREA 4OX8A 4A47A 2M8HA 2U2FA 1NEEA 4I1TA 2QA4G 3UDLA 4NYZA 3N6NA 3M8ZA 3UDEA 4M8LA 2AMCB 2HLTA 2VG7B 3H8YA 1WG5A 4ZVGA 4K8RA 1P9QC 1Y5IB 1IBLJ 2PMZD 2HGMA 4LUBA 4ED7A 4QOTA 3D1OA 1WDTA 4GRSA 3IGVA 4Y2KA 1EETA 1RLCL 1MG7A 3RBDA 4NLGA 2E9TA 1QM9A 3KTQA 2BV3A 4F36A 3R2CJ 1QAIA 2WB4A 2BE2A 2FJWA 4OX9F 1GAOA 1U8SA 1PJ7A 2BKNA 2QMUB 2JLFA 3SFUA 1WF1A 1H98A 2VKRA 2DHHA 4C0OC 1IR1A 1VQ6S 4MKBA 1GQEA 2I5JA 3CW2C 1NDLA 2WVFA 1MW7A 3NOGA 2QL5B 1FNXH 4J5OA 2B4OA 2K06A 3TO8A 4DV6J 1PYTA 1ZM4A 2V67A 4CLSA 4MH8A 5KT5A 2RE1A 2LCWA 4B3TF 1S49A 3MMBB 4OJGA 5LXRA 4C11B 3CDUA 3VV2B 2IYIA 3UCUP 4NCBA 1RADB 4B3MF 5IXUA 3RB4A 1U6FA 2ZVSA 1PAEX 5F8IA 1DTQA 4O0NA 2VPYB 4P72A 3ENWA 3C6UA 1RBLA 2BOAA 4I7FA 3OUYB 2DK2A 4RBTA 4TLQA 1E6YB 1W7WA 3W8GA 3L9ZA 4A8OA 1SI9A 4ZN3A 3T1AA 2IFXA 5HANA 2VPXB 1RAIB 1T94A 2OEJA 2IRYA 2XEXA 5HATA 4YUDA 4QR0A 2DR5A 1FD2A 1Q5YA 2MJUA 2VB6A 3BZQA 4NMXA 4OYPA 2W1BA 5L1KA 2OMOA 4CTAB 2HWTA 5E7OB 3OLAA 2IC3A 2FIUA 5KFNA 3PACA 4HI1A 4PAAA 2C1EB 4JI7F 3GFXA 3L7UA 1WHVA 1XWLA 2WCXA 3PG9A 3SCLE 1JLEA 4ZLPA 3PKYA 4IG0B 5GMKa 2VC1A 2C2NA 4WFZA 1IKXB 2IAJA 1EHWA 1HKAA 2F4FA 2IA0A 2WW8A 5A0YB 2I0XA 5IV4A 2XHWA 2J7WA 2MZRA 3GSIA 2VJUA 3VQTA 1UW4A 2XY5A 2HVZA 3EVOA 1PYOB 5AJ3F 4IUFA 1S6OA 2ZD1B 1I51B 1EP4B 4UY8T 3L3CA 3CJ4A 4Q8FA 1KEKA 3FKBA 2K7JA 3CUNA 3RR7A 4DUTA 4WIIA 4JI4J 1V3SA 2W9BB 4FYVB 2IJNA 4TKTA 2H48B 4M5IA 1QSLA 4ELVA 4NA1A 1MWZA 2KU7A 3QSYB 4NX9A 1RTZA 1HW8A 2VBXA 3OPKA 3M8PB 5KG5A 2G4BA 2BR0A 1MSWD 3TVKA 4DR1F 3L95X 2DNHA 2IM0A 1TKTA 4OHYA 1FHTA 5BYRA 2Y0BB 1JLQB 1RE1B 2OLWA 3J7ZT 1DHMA 3W63A 5CCMA 1CPZA 1WJ9A 3TZZA 2YKNA 1YJ9S 4FDFA 4KTQA 2R7VA 2OPSA 4HACA 3TARA 5DLFA 2X1AA 4CO1A 4LF5J 3JAMY 2NQPA 2MSTA 3KJNB 1Y4ZB 3EUNA 4OI2A 3MTJA 1KSPA 1C1CA 4XO0A 1VBYA 1QTMA 1ZM3A 4NE9C 2ZHAA 1SKWA 1RI7A 2NYHA 2BANA 3CIZA 3D3BJ 2X51A 2E5IA 3EDRB 2CXEA 4PXDA 4CO4A 4B9SA 4DV3F 3HZEA 2R7QA 5B0FA 1PG5B 4LBIA 1U8WA 3VGSA 3NEKA 1M5PC 3CCMS 4DSLA 4GC7A 1M1KT 2F4VJ 2IVMA 3D67A 2ZZNA 1I6JA 3K58A 2VG7A 1YBUA 3F44A 4D3GA 5K20B 2EFVA 3T5LA 5KFZA 3MPUB 4PXCA 1GMWD 2APOA 5I3QA 3RBZA 3V4MA 3ADAC 1RAHB 4ES2A 5KFCA 2GGPB 4DL0C 2DO4A 2IM2A 4O23A 2AGPA 3HULA 3R8YA 3T9ZA 4OHWA 3OXFA 4ZJLA 2RAQA 4NL5A 1N36J 2VA2A 2N4CA 4LVNP 2P9CA 5IV3A 1YI2S 2K7KA 3K5MA 2YWGA 3LOUA 4DSIA 3DU6A 4QIGA 1D8YA 3HD2A 4K4YA 1RDRA 3TJAA 3B6BA 2MLYA 4CO0A 1C0UB 5LJ5Y 3HHDA 2UVVA 3MMBA 1ITPA 4ED2A 5I4MA 4C11A 1TK0A 4H4KA 1VBXA 1PC4A 4DR2J 1RKIA 3G9CA 1RU1A 1F5BA 3AD8C 2L41A 2F8HA 1IBMF 3OTBA 4B3SF 4YHHF 3DNCA 2VHGA 1OMSA 3CCVS 4LFAF 3LH2S 4J9NA 1RTDB 3G82B 2CG4A 4CH1A 1N0VC 3PRDA 5ETTA 3OUYA 3ZZPA 3IGNA 3RR8A 2PC6A 3DLBA 4QQBA 4F4XA 1E6YA 1EJ7L 2XNRA 2KT2A 5T7LB 5C42B 4Y00A 1JXLA 2HAIA 1BE4A 5E3CA 3SCKE 4J90A 3Q24A 1N32F 1XN9A 3QIPB 2C2EA 1N6QB 4PWUA 1EQMA 3OXGA 4CTAA 4DV2F 2LLZA 2BQ3A 3M6WA 4QYZK 1PSDA 4CO3A 4DFMA 2BRKA 3V81B 1RHUB 1S1TB 5F8LA 4X64J 2BDPA 3SQOP 2BJ3A 2CJYB 4KGXB 5LMUJ 2OPRB 2GQ2A 4QIEA 1HD0A 4RW6B 2LA4A 4Y0FA 4IG0A 1K44A 2QL9B 5CABA 1SV5B 1IKXA 3D1QA 2ZNYA 1VQLS 4KV8B 1VJWA 4RNOA 4WYLA 4ES3A 2QIFA 3NS5A 4ED4A 2OKQA 4PR6A 4B3SJ 2VIHA 3V6DB 1AFIA 3BR9A 2E9ZA 2ZD1A 1EP4A 4ECSA 5IWAF 4O4RA 2VG5B 4ZP6A 5C24B 1WD6A 5KFJA 4DFKA 1Y11A 1J2VA 2W9BA 2QT7A 4F3MA 4EBDA 2Z4PA 3JSBA 3ENQA 1PBUA 3NNHA 4NLOA 4G1QB 3MMAB 3HHLB 5FLXU 1F0XA 1F9HA 3M8PA 4ZCIA 2LDIA 1R8CA 2DNZA 2OEMA 3PO4A 1HNVB
chains in the Genus database with same CATH topology
5H9FK 1WJ9A 3QRQA 3QRPA 3QRRA 5CD4A 2Y8WA 2Y9HA 2Y8YA 4DZDA 4QYZK 4U7UD 5H9EK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5H9F K;  1WJ9 A;  3QRQ A;  3QRP A;  3QRR A;  5CD4 A;  2Y8W A;  2Y9H A;  2Y8Y A;  4DZD A;  4QYZ K;  4U7U D;  5H9E K; 
#chains in the Genus database with same CATH topology
 5SZT A;  2WHO A;  1NDC A;  1UJ4 A;  3KMQ A;  2EC0 A;  4GVB B;  3ZZ0 A;  3TNV A;  1JLQ A;  2E9R X;  4DR6 F;  3GII A;  4KC5 A;  4EGL A;  3PYG A;  3GZ7 A;  4KKO A;  2HHQ A;  3VAJ A;  4P6Q A;  2BAC A;  1NSP A;  2R4F A;  3VVU A;  2IHR 1;  3CNQ P;  2XYP B;  1JXV A;  2J0Q D;  2OSQ A;  1NKE A;  4DOZ A;  2BE7 D;  3A3N B;  3FFI B;  2CNL B;  1G6B A;  3JXO A;  3GMG A;  2OAU A;  2HQI A;  2R42 A;  4LSN B;  2ZOG A;  3ISN C;  2XM3 A;  4F2S A;  1VQ9 S;  1HNZ J;  2HKE A;  2YTC A;  3HT0 A;  2EEY A;  4RU2 A;  1VQ4 S;  2LKZ A;  2QLX A;  4KIA A;  4F02 A;  4IH6 A;  4MAK A;  5J2P B;  4CO5 A;  2QRR A;  4DSK A;  4KHP J;  2HQ3 A;  3MR5 A;  1R8A A;  4LIR A;  2RQ4 A;  2R2T A;  3HPO A;  4Y3C A;  3Q2S C;  4FF3 A;  3UD3 P;  3D0I E;  2ZWP A;  4WE1 B;  2ASD A;  5AXL A;  1X7V A;  1WG4 A;  4HHJ A;  1TTH B;  3GFY A;  1WAC A;  2HIY A;  5B0G A;  2G9O A;  3LGN A;  5M2R A;  2A18 A;  4F0M A;  2CPJ A;  2KO1 A;  1HNX F;  2CVE A;  1NUE A;  3EPG A;  2KVI A;  5KFD A;  1D9D A;  2YQ0 A;  2EC2 A;  3NS6 A;  3PDN A;  3B4M A;  1CC7 A;  5JUM A;  3WIV A;  2R7S A;  4J7C A;  4QW9 A;  2KFN A;  1NU4 A;  1NJX A;  3AXK A;  4CO2 A;  5CA5 A;  1BC6 A;  4LSL A;  2NS1 B;  2V2V A;  2DGS A;  1YKW A;  4DR7 J;  5BYS A;  2Z0G A;  5KG7 A;  4CT8 A;  3CD5 A;  1LXJ A;  3R9L A;  3P3D A;  1DY3 A;  2VOD A;  4DZ6 A;  2UXC F;  3GFH A;  4USV A;  1HIY A;  1C0U A;  4YR3 A;  3RB0 A;  4K4Z A;  3W64 A;  2JWN A;  4URS A;  4P2M A;  3US5 A;  3ZTQ A;  4Q5V A;  2KL8 A;  1S1U B;  1RAA B;  5DRK A;  1U09 A;  3HX9 A;  4ZLL A;  3R2D J;  2W9C B;  2K2P A;  3M2R B;  2D3U A;  4X4R A;  5CYJ A;  3Q8S B;  1SC4 B;  1RTH B;  4Y2I A;  4HI2 A;  4QIV A;  1FRL A;  2G0J A;  3NNA A;  1RTD A;  3G82 A;  1FE0 A;  2XI3 A;  3T5H A;  1ACM B;  3ZNU A;  1HR0 J;  4EMD A;  4CRJ A;  5HAO A;  5GAH U;  4HR2 A;  1P9Y A;  3I82 A;  2PMW A;  3MFH A;  3BO2 A;  4HL9 A;  2AIR B;  1YZ7 A;  1NK9 A;  2C3M A;  3ETM A;  5F3T A;  1UEV A;  1S6Q B;  3BSA A;  2PEB A;  2W7A A;  3FQK A;  4BWJ A;  2AX0 A;  1NPK A;  1S9G B;  1S10 A;  1KS2 A;  4OYA A;  5F8M A;  2GV1 A;  3QIP A;  3ILO A;  2CDQ A;  1N6Q A;  1XJW B;  1T02 A;  2FY1 A;  5E3Q A;  3ZZO A;  1Y3K A;  5BJR A;  1S1T A;  4W98 A;  1WSV A;  2GHW A;  4OI6 A;  3PR4 A;  2LU1 A;  2NRE A;  2OPR A;  5B0B A;  3T6B A;  2W2O P;  4RW6 A;  2FHJ A;  5KG3 A;  4RU9 A;  2XMK A;  3H40 A;  1T95 A;  1FVQ A;  2ATL A;  1TL1 B;  1SV5 A;  3FEZ A;  2MB0 B;  4KV8 A;  3K7R A;  4AXJ A;  3SZ2 A;  1ZS6 A;  4GO5 X;  3GIR A;  1VDH A;  3OL8 A;  3V6D A;  5EX0 A;  2CQI A;  2FUG 9;  3M6U A;  4UUW A;  4PQA A;  2VG5 A;  3LGH A;  3H59 A;  4ZMM A;  3PXG a;  2AEM A;  2ZH8 A;  4B3O B;  1N33 J;  4BS2 A;  3R27 A;  4O3S A;  2WBM A;  1TL7 A;  3HMJ G;  5LJ3 Y;  4G1Q A;  3HHL A;  2HBY B;  4A4J A;  2R7X A;  3QAE A;  3A8J A;  1WWH A;  3SQG B;  5HLF B;  2BVZ A;  1HNV A;  2GNK A;  3AA8 A;  2J9D A;  4GVB A;  3CCQ S;  5FD1 A;  1RYS A;  3MAH A;  4N77 A;  2ZJP Q;  3TAN A;  3LUY A;  2R2R A;  2QLB B;  5EDW A;  3IR7 B;  4GKK J;  1DZ5 A;  5E3P A;  4XDC A;  4U96 A;  3OTD A;  3VF0 B;  3K5N A;  2BW7 A;  4RKU C;  3NY0 A;  1FF2 A;  5D0E A;  4RUH A;  1HQE B;  3HVT B;  2Y0S D;  3OTO J;  3CJQ A;  4ZVF A;  1SJF A;  3FFI A;  4JBC A;  1KC8 T;  3C2P A;  2DNO A;  2FLN A;  2BJ7 A;  4N8O A;  2L9N A;  2VV5 A;  1XNR F;  4LSN A;  1KQF B;  1NJY A;  1RQ0 A;  3P96 A;  1AXQ A;  2QLW A;  4R8U A;  4ZVT B;  4IYQ A;  2HHP A;  2W2M P;  2LP4 A;  3SCI E;  3GJS B;  4YP3 A;  3HFK A;  2MQP A;  4X4Q A;  1YHQ S;  3PEH A;  3UN2 A;  3H25 A;  4HDG A;  4ECQ A;  1BY9 A;  2FZK B;  3HLU A;  2OD6 A;  5EGY A;  3CJR A;  3S7R A;  3GON A;  2AX1 A;  4FF1 A;  5CCL A;  4WE1 A;  1N5Y B;  4Y2A A;  1OYD A;  4OFZ A;  1F5C A;  1BLU A;  4AQY F;  1RHM B;  3NMA A;  3TQ1 A;  1SBR A;  5F0U A;  4RNH A;  5A76 A;  1BUX A;  4M95 A;  1GEH A;  2EBE A;  1WG1 A;  4MKV A;  4Z7C A;  3AA9 A;  4RPF A;  4U9R A;  2AJ0 A;  4LFB F;  3TRG A;  5MAO A;  5KT6 A;  1ZTW A;  1YDL A;  2KG1 A;  3RAQ A;  3G2X A;  4N76 A;  4N41 A;  1EAR A;  2F40 A;  2O67 A;  3CTR A;  4DCO B;  2SXL A;  1B3T A;  4DV7 F;  2FLP A;  4QW8 A;  1S5Z A;  4B9U A;  3IWX A;  4IH5 A;  3RUB L;  1B64 A;  1IKV B;  2KJW A;  2LXU A;  5I3U B;  2DY1 A;  3CB4 A;  7AT1 B;  1SPB P;  4LRF A;  4OZ3 A;  3M8Y A;  1SQE A;  4U67 Q;  5THW A;  3BBB A;  5HMZ A;  5HMX A;  3B54 A;  1S1U A;  3TUJ C;  2W9C A;  2OPP B;  3M2R A;  4RNM A;  2CQG A;  4O3Q A;  3NRB A;  1GXU A;  1RTH A;  3NLC A;  3D68 A;  2ZEJ A;  2AT1 B;  2C3O A;  1CEZ A;  5ETM A;  1NB7 A;  2DGV A;  2BBE A;  2A10 A;  1X4B A;  3OVB A;  1OY8 A;  4K4V A;  4P2F A;  2AZ3 A;  4CM0 A;  2X3G A;  1X4C A;  3OV7 A;  1YRX A;  2W4C A;  2J5A A;  3J81 j;  1O6X A;  3BYP A;  4F04 B;  1S9G A;  3D0H E;  4DQS A;  1MMD A;  5GAE I;  4CLF A;  2DPI A;  3GJT B;  3CDE A;  4KJI A;  3TVY A;  4WCE Q;  3GCW P;  2HHH F;  1WI6 A;  4DV7 J;  5DM6 Q;  1JK9 B;  3MM5 B;  3BR8 A;  5HO4 A;  2OI2 A;  3CJK B;  4PUO B;  2GMJ A;  3DLE B;  1BQM B;  1MWQ A;  4ZIV A;  2UUB F;  4F3Q A;  3S01 A;  3BGF A;  3QQC D;  3QAU A;  3CT9 A;  3F0N A;  3M32 B;  4U7U K;  1FI4 A;  2ADC A;  4RO0 A;  1TL1 A;  1YSJ A;  4PWW A;  3R6G B;  2MQL A;  1PCA A;  3OT9 A;  4I6Y A;  3QZ7 A;  2L08 A;  2YWK A;  4FBT A;  1NHV A;  4C0H A;  1D09 B;  5BYQ A;  2CAJ A;  1BD6 A;  1HBU B;  1PKU A;  1NPP A;  3FC9 A;  5J2Q B;  1FXL A;  5H9E K;  1FE4 A;  2VBW A;  4M5H A;  2G1H A;  2ZHO A;  5B0C A;  3PCO B;  4B3O A;  2RQK A;  5ETP A;  4JV2 A;  3TI0 A;  3DDN A;  3RBE A;  5CH7 B;  1VGY A;  3SQG A;  5HLF A;  4C48 A;  2KTQ A;  2ERR A;  5KFP A;  3R5C A;  3QGP A;  3JQJ A;  2HQC A;  2M52 A;  4PG4 A;  4OJ1 A;  3DLH A;  4DMZ A;  4C3L A;  2RS8 A;  4C3M A;  2J0W A;  4KGZ B;  4WWS A;  3MUV P;  2MKJ A;  4DPU A;  3VTI A;  2HBR B;  2A1B A;  2IJF A;  3U27 A;  1GXT A;  4O44 B;  1HQE A;  5FLX Y;  3HVT A;  4UT4 A;  4TQS A;  8ATC B;  2V4J B;  5H1S V;  4CQ1 A;  4W4M A;  2K1R B;  2QO3 A;  3I5B A;  3MPD A;  1U26 A;  3FZB A;  4IRK A;  4FVC A;  1PAU B;  4AL6 A;  2RML A;  4FP9 A;  5H9F J;  2MXY A;  2FHJ D;  1H72 C;  5DET A;  1XQI A;  5ETL A;  4USW A;  1BXN A;  3KK3 B;  4ECZ A;  1HBN B;  2YKQ A;  5DJB A;  1F9F A;  3U1M A;  4IFY A;  2PI4 A;  4XK8 C;  1FT8 A;  3ENA A;  1ZM9 A;  2XG8 A;  1O51 A;  1TL5 A;  1B7Y B;  3WQP A;  2JLE A;  1V3R A;  1K1S A;  1WOR A;  2C2M B;  4DV4 J;  2PGC A;  1T3O A;  2HNZ B;  9RUB A;  3K57 A;  2XCP A;  1N48 A;  1ZH5 A;  2VUG A;  4ZJQ A;  3TJ8 A;  4H54 A;  3G71 S;  4KY3 A;  4YR2 A;  3IA0 A;  4NEZ A;  2R3V A;  3ZNJ 1;  2H4W B;  2IA6 A;  3EXY A;  2W7O A;  2KI2 A;  4MMO A;  2X7I A;  3CJ5 A;  4B9M A;  4QCL A;  4JI2 F;  2OD4 A;  2ZDP A;  2VU5 A;  3CO0 P;  5E5N A;  1UVN A;  4ECV A;  4LF8 J;  3RYL A;  2LXF A;  3M8R A;  1Q7Y T;  2JEF A;  1IKV A;  5AT1 B;  3UO0 A;  1AYE A;  5I3U A;  3T19 A;  3AQP A;  2MQM A;  3AB2 B;  2QV6 A;  2V50 A;  4WBF A;  1Q8L A;  4IG3 B;  3MR3 A;  2FC9 A;  4G6V B;  4ZCK A;  2IVF B;  1IBK J;  2OPP A;  4UOC A;  2YNH A;  1I94 J;  4OYW A;  3ZTR A;  3DRP B;  2PO4 A;  4JV1 A;  3QRQ A;  2XS5 A;  1NAQ A;  4RUA A;  2VA3 A;  4OV6 A;  3A3O B;  4PPD A;  2DIV A;  5KFS A;  1YVF A;  1N34 J;  2DCU B;  2AEF A;  3JTN A;  2MZJ A;  2POK A;  2WSC C;  5D4O A;  3W7B A;  5B08 A;  1Q86 T;  3EDQ B;  2C2Z B;  4X62 J;  2W24 A;  4TY8 A;  2WSF C;  1IKW B;  4WKY A;  2RRN A;  5F41 A;  3R3T A;  1X9S A;  4OHV A;  2HZV A;  3QLH B;  4OJH A;  4A8S A;  2EW9 A;  1ARO P;  3O8W A;  3JSY A;  1T9W A;  2B8Q A;  3Q22 A;  2LXI A;  4MYU A;  3MM5 A;  3Q2T C;  2PN6 A;  4PUO A;  3CJK A;  3IRW P;  3TEH B;  3DLE A;  4UZC A;  1BQM A;  5GAH I;  1DRZ A;  4CLZ A;  3NGU A;  8AT1 B;  1S7I A;  5LMN F;  1G7C B;  1Q79 A;  5EUH A;  1CJV B;  3S1T A;  3M32 A;  2WVB A;  1YG0 A;  3G6Y A;  3IR6 B;  4EU0 A;  1FWP A;  3T5K A;  3BS9 A;  2MZ1 A;  1RT2 B;  2C42 A;  2GQC A;  2Y1L B;  3KJQ B;  4DR4 J;  1D8Z A;  3IBC B;  4XPC A;  2OIH A;  2UUA J;  1RSC A;  1X60 A;  3BBF A;  9ATC B;  3HP6 A;  3LAN A;  4OYI A;  4DUY F;  5HP1 B;  1DBD A;  2UUC F;  3CWJ A;  4K0K F;  2FJD B;  3M9M B;  2HGL A;  3BN4 A;  1HBU A;  5J2Q A;  2W8K A;  2YWE A;  1XBW A;  4LF4 J;  4EYI B;  1KR4 A;  2ASY A;  3CCU S;  2VBZ A;  2VFV A;  4C8Z A;  5C7P A;  3NNC A;  1RLD A;  1U24 A;  4Q0B B;  1LFP A;  1Z1Z A;  4M5J A;  3CME S;  2RU9 A;  4JV0 A;  1FNM A;  1YJN S;  4DPT A;  2OP5 A;  1JB0 C;  2HND B;  4IDK B;  3J81 U;  1NSK L;  4QR1 A;  2NSC A;  3EYZ A;  3FQL A;  4ZP8 A;  2Q3P A;  2VQE J;  1T9V A;  1RT5 B;  3E51 A;  4YDD B;  3KOA A;  5DZ6 A;  2ZC3 A;  2W25 A;  3PRB A;  4ED0 A;  4JI1 F;  1S79 A;  4IO9 Q;  2WOM B;  3KLG B;  3HSD A;  3D4J A;  4O44 A;  5CXT A;  1HI8 A;  2KFY A;  2V4J A;  3MM9 B;  2HLU A;  1OY9 A;  4LRB A;  2MEW A;  4I67 A;  4QJV A;  3C3L A;  3WDO A;  4X66 F;  1B0P A;  4IR9 A;  2K1R A;  3T9N A;  1SUQ B;  2BKP A;  1T9U A;  1SQF A;  2CG8 A;  1HA1 A;  1XMO F;  4X65 F;  1LWE A;  4ZP9 A;  2P9E A;  3MCS A;  3EVW A;  1P27 B;  1B4S A;  3GQC A;  1OQ6 A;  2FYX A;  1R43 A;  3KK3 A;  1HBN A;  4USH A;  4UST A;  3QO9 B;  2LEC A;  1RUS A;  4JV5 J;  3SV3 A;  1MN9 A;  4FN5 A;  1X5P A;  4KHR A;  2UVR A;  4LR9 A;  4MT1 A;  4OLO A;  2UV8 A;  2DNP A;  3H4D A;  3GE9 A;  1SJ4 P;  5GVQ A;  4LFC F;  1F5A A;  1QDU B;  2RKI B;  4I64 A;  1JJ2 R;  2OEL A;  4K2J A;  3I9V 9;  3KHG A;  2DXE A;  4ES1 A;  3MR6 A;  4KAI A;  2NXC A;  3I6P A;  4A8M P;  4CH0 S;  2J7U A;  3N28 A;  3V6H A;  5C2G A;  1S9E A;  5HK4 A;  1RAF B;  4YR0 A;  2B9Y A;  4NXM F;  1N54 B;  1CBK A;  2J0X A;  1YLX A;  4JI8 J;  2CRL A;  4AFF A;  2CPD A;  3TA0 A;  2OTL S;  4Y2M A;  4RW4 A;  1WEX A;  3ILI A;  2BX6 A;  5ETN A;  4KGV B;  3VAM A;  3GTY X;  5IM0 B;  2W4P A;  2KZZ A;  2A6M A;  4X84 A;  4DDF A;  3W5Z A;  4EWT A;  4WP9 A;  3WIU A;  4EEY A;  4IG3 A;  1TUW A;  4OQJ A;  2PEH A;  1TZ0 A;  1RAJ A;  4DBQ A;  3HVR A;  3DRP A;  3QJP A;  4DWI A;  4DN0 A;  1NK4 A;  1HL6 A;  4JYA J;  4DG1 B;  2D3O 1;  2ZH5 A;  3HVW A;  2VJV A;  2AJ4 A;  3CJS A;  2ZKU A;  1REV B;  1EB0 A;  5DDP C;  3T1H J;  3R7N B;  1RA7 A;  3OHB A;  1VRT A;  5CYQ B;  1X4G A;  3L4B C;  5KFW A;  4NLR A;  4KSE B;  1SKS A;  4DI6 A;  2HHW A;  1IKW A;  1BWE A;  2FVQ A;  3QLH A;  2XGQ A;  4J9K A;  2GA7 A;  4M5M A;  2QX0 A;  3FSI A;  3MPV A;  1KHV A;  2XZW A;  2XNQ A;  3EPI A;  4NXN J;  2NPF A;  2GQQ A;  2DHS A;  1VJQ A;  2NLW A;  2W2N P;  3NOC A;  5BR8 F;  2HW3 A;  4B9T A;  2AJQ A;  3THP A;  3VZI A;  4KGK A;  1CJV A;  1DJ0 A;  3PY8 A;  1R0A B;  2YQ3 A;  3PEJ A;  1FRJ A;  3UNG C;  4KQZ A;  4MYT A;  4NLV A;  5HJY A;  1FKA F;  1Q53 A;  3DDI A;  2UXB F;  4QWC A;  4LIW A;  4F0K A;  3F41 A;  6AT1 B;  5HP1 A;  4J9O A;  2EI5 A;  2KJV A;  2DEI A;  3TZW A;  5KFI A;  4G3I A;  3UR3 C;  4DS4 A;  3UD5 A;  4BCA A;  2YQ1 A;  3SBM A;  4UUX A;  1NRK A;  1JLA A;  2L9W A;  4B9N A;  3IG1 B;  1ZA2 B;  4MIA A;  2FHK A;  2LQB A;  2GJ2 A;  1X0F A;  2J6S A;  2DNL A;  3KK2 B;  1N8R T;  4LBH A;  5I42 A;  4RUC A;  1VMB A;  2HND A;  4IDK A;  2AZ1 A;  2CZV C;  4K5R A;  5F8J A;  3R5A A;  2H1Y A;  3DFE A;  3C14 B;  2MKH A;  3BQ2 A;  1RT5 A;  2CUY A;  3O5T B;  4FNH A;  4I0W A;  5A8R B;  2UXD F;  4GKJ F;  3QBC A;  4YY3 J;  4HHU A;  3OR1 B;  4P52 A;  2W4D A;  2ZWO A;  1M5K C;  4OIX A;  2O1P A;  3BF4 A;  1U1Q A;  4KFB B;  5EN1 A;  2QYC A;  2H51 B;  1UMJ A;  2YWW A;  2E5L F;  1YWX A;  2HQF A;  3KLG A;  4DL2 A;  5M2P A;  5IQ6 A;  3GG0 A;  4IKA A;  1M1G A;  1FX4 A;  2WVD A;  1NCL A;  3BGR B;  4EYH B;  1TUG B;  3GWC A;  3MM9 A;  5M2U A;  4X4V A;  4LBP A;  4J9Q A;  4OZJ A;  2VON A;  4NI2 B;  1SUQ A;  2GO8 A;  5HQL A;  1X9M A;  4PPZ A;  4KYZ A;  3CGI A;  3W2W A;  4ZKA A;  1M5V C;  3ISZ A;  1LKZ A;  1ZOT A;  2HRY A;  5HRO B;  3WC2 A;  1WEY A;  3QO9 A;  5A8K B;  2YXL A;  3W5Y A;  4AD6 A;  2CJ9 A;  3X3U A;  1LWF A;  4DR3 F;  1RWO B;  3AY0 A;  1R31 A;  5MLC V;  2PD1 A;  3TAQ A;  3MUT P;  3I5A A;  1L3U A;  4FVM A;  3MAQ A;  3PX6 A;  3THT A;  2RKI A;  3M2U A;  3MGJ A;  4WFN Q;  1IM6 A;  1HFE L;  3QSI A;  3N0V A;  2HFO A;  1C4A A;  4WKR A;  1OIA A;  2JOQ A;  4I56 A;  1VQ8 S;  1HD1 A;  1TK8 A;  4XDD A;  2V34 A;  4P71 A;  3UPF A;  2V63 A;  1Q1K A;  5B0E A;  4IFV B;  4RBV A;  1Q95 G;  4O3R A;  2ZIT A;  3D6M B;  2GC8 A;  2V8H A;  3GFZ A;  1GTH A;  3E01 B;  3DM2 B;  2WRM A;  2NYI A;  3IFE A;  1QUV A;  3PJX A;  2J76 E;  1YJV A;  3CXC R;  2QFI A;  3CMQ A;  2XS7 A;  1QLN A;  4DR5 J;  1UPM B;  2UU9 J;  2YVS A;  3LO3 A;  3FSX A;  5DG7 A;  2OH2 A;  2H5I B;  5G0R B;  5DDQ C;  4X4O A;  4F0H A;  3GLJ A;  2LQ9 A;  3HT3 A;  4FKX A;  2CJK A;  1NZ8 A;  2GMH A;  3H20 A;  5B0A A;  3MD1 A;  2YPZ A;  3CJ8 A;  2DD8 S;  2RU3 A;  2MKS A;  1RAB B;  4DQI A;  2OEK A;  4DG1 A;  4NAS A;  5L1I A;  1FRI A;  3L09 A;  3JB9 k;  1S1W B;  1REV A;  2EK1 A;  4ED8 A;  1FTR A;  3MEC B;  2E7W A;  4TU7 A;  5CYQ A;  2EFN A;  1X5S A;  3DRX A;  3D9B A;  4ZVH A;  2I5J B;  2YNI B;  2QLJ B;  1FJG F;  1WOS A;  1FKP B;  4TLR A;  2CPY A;  1S9F A;  2WVC A;  5D6G A;  2PII A;  2XMV A;  1SL2 A;  3KG4 A;  3O2I A;  1HYS B;  4ELU A;  3CD0 A;  1QSS A;  1O5J A;  4OYM A;  1TU0 B;  4FYW B;  2D3O R;  2FGO A;  4GC6 A;  3U1N A;  1KKH A;  3RB3 A;  1GTE A;  1OWX A;  2AJ2 A;  2JX2 A;  1TUV A;  4X4N A;  1RIS A;  1PC5 A;  5KFM A;  1YIT S;  2FTR A;  3ZO7 A;  5LL6 d;  1HI1 A;  3K5O A;  1S0V A;  3JYT A;  1VI7 A;  5KT4 A;  3ISN D;  5ETO A;  3O3L A;  4NLW A;  3D6H B;  1MN7 A;  2J9E A;  1K9M T;  3O44 A;  3IG1 A;  4E98 A;  3H2U B;  1PJ5 A;  4H4M B;  4FBU A;  4ZIW A;  1R0B G;  4JI6 F;  3H98 A;  3KK2 A;  2I1R A;  5T41 A;  2I2Y A;  5C25 A;  4F26 A;  2HIQ A;  2XMM A;  2CWK A;  2BJ1 A;  1CLF A;  4TY9 A;  3QT6 A;  2IIH A;  3MCN A;  2FJA B;  3PYD A;  3DGP B;  1SJ3 P;  2X3D A;  2KVQ E;  3D2W A;  3MOJ B;  4OI4 A;  2LEA A;  4KBI A;  1VQ7 S;  1KQK A;  1GNK A;  3C14 A;  1UKU A;  1WOO A;  1WC5 A;  1ZZF A;  5RUB A;  2H54 B;  1V5I B;  3CED A;  5A8R A;  3QYY A;  3OR1 A;  1H38 A;  2BQR A;  4WK1 A;  1IN0 A;  4KFB A;  4EBE A;  1TQL A;  4ICL A;  4LR7 A;  5BXI A;  3ZTP A;  5F8H A;  3FRZ A;  3DOM B;  1HHS A;  1KQS R;  2UUT A;  2JNJ A;  4F7V A;  3BGR A;  3J81 Y;  2CPZ A;  4TYA A;  3L7P A;  4BDP A;  2UUW A;  4Z7Y A;  3DKD A;  2JFD A;  2D41 A;  2B7B B;  3UE2 A;  2DR9 A;  1KWM A;  3M1V B;  1VLO A;  2D7S A;  2B51 A;  2ZZT A;  3W3S A;  3JQK A;  3AHP A;  2HWH A;  3HJV A;  5HMY A;  4PG5 A;  1RBA A;  1RTJ B;  1U1M A;  5HRO A;  2B56 A;  3FJ2 A;  4A8Y A;  1TL3 B;  2NXE A;  3W9J A;  3WBZ A;  5FII A;  5A8K A;  1RWW B;  1RB0 A;  5DQG A;  3LQV A;  1K1Q A;  2G2Z A;  2M2B A;  4ZP7 A;  1FER A;  2RF2 A;  5KFE A;  1S12 A;  1XMQ F;  3DRS B;  2OSR A;  1KD1 T;  2Z2Z A;  2XO7 A;  4LJM A;  3N01 A;  3PYF A;  3R97 A;  2ACM A;  3FBC A;  2Y3Y A;  3MMC B;  2V8G A;  3D7S B;  3TA1 A;  3Q8Y A;  4I69 A;  1IWA A;  4P9S A;  1RK8 A;  4EFA C;  3DMJ B;  2XYG B;  2HS3 A;  2HGN A;  3M9O B;  4ED1 A;  3VAI A;  4QWA A;  4IFV A;  2E7V A;  4B3R F;  1S72 S;  1J5E F;  2AYE A;  4WU3 A;  3G8T A;  2BW2 A;  3A12 A;  3E01 A;  3DM2 A;  1H2T Z;  1F3F A;  2BAN B;  2RRA A;  4I6A A;  4KO0 B;  4ZVE A;  1JJC B;  2KXF A;  2YY3 A;  4L76 A;  1T0T V;  4DUZ F;  3Q89 A;  1WTB A;  4WPA A;  2IMO A;  2LQ5 A;  3BSC A;  4RNN A;  4XTT A;  1NB2 A;  1KVI A;  4EO8 A;  3DLL Q;  3OFG A;  3WX8 A;  4XPE A;  2AJF E;  5G0R A;  2W2P P;  3W60 A;  4HKQ A;  2VG6 B;  1TK5 A;  1DTT B;  1YK9 A;  2CJQ A;  1ELO A;  4JI3 J;  2Q6C A;  3LW5 C;  4JI0 F;  4FNI A;  5LSR A;  1TMM A;  2EKY A;  1VQ5 S;  4CLY A;  1N5Q A;  5KAK A;  1S48 A;  3DDK A;  2V9W A;  3AJ1 A;  1FEE A;  1V9O A;  2DB1 A;  2P5V A;  3EGW B;  1S1W A;  4IOB A;  3FK4 A;  3D28 A;  3MEC A;  3AT1 B;  4XIU A;  6FD1 A;  4LF9 F;  2EFG A;  1F6T A;  2YNI A;  3T3F A;  1H6K X;  3RJM B;  2ZH7 A;  1FKP A;  4USU A;  6FDR A;  3KWM A;  1TAU A;  3KJV B;  4HTI A;  3BGO P;  4G1P A;  1HNI B;  5J1E B;  2R8G A;  1HYS A;  4F2R A;  4PYD A;  3VGU A;  4U6P A;  1MWY A;  5LXY A;  4C8Y A;  3UFC X;  2ZH2 A;  4ZIT A;  4LQ3 A;  3BJY A;  3BSN A;  3R5D A;  1LK7 A;  2DNM A;  1FKO B;  2EPI A;  3KJF B;  2H4Y B;  4NOH A;  2JC1 A;  3ZZR A;  1CQN A;  4OZN A;  2M88 A;  2NZC A;  2BAB A;  1UEK A;  5AE2 A;  2P8I A;  2HS4 A;  1UL3 A;  2MQO A;  5ETV A;  4LF2 A;  1QUP A;  2VDI A;  2M9K A;  4H4M A;  4B9L A;  4OX9 J;  1Y10 A;  4R5P B;  5L1J A;  3OVS A;  2HYI B;  1VBK A;  4OL8 A;  3TP2 A;  5F9N A;  2HNY B;  1ZZN A;  3TX0 A;  2A2C A;  3DGP A;  2VQF F;  4N8N A;  1VC5 A;  4HH0 A;  3VAL A;  3I32 A;  3T41 A;  1H7W A;  2ROE A;  3V6K A;  1XNQ F;  4TXS A;  4DEZ A;  1F3V A;  2A3J A;  4AL5 A;  1U2F A;  4DZD A;  4B17 A;  1UA1 A;  2GJF A;  4RWW A;  2DR7 A;  4A8Q A;  4J37 A;  2Z2M A;  2HEK A;  2VZ9 A;  1WHW A;  4YEA A;  4B3T J;  3HSG A;  2DCL A;  2ABY A;  4L75 A;  4QPX A;  5F8N A;  1HMV A;  3DOM A;  1X4F A;  3PW0 A;  2ZFH A;  5D0H A;  5AXM A;  4B3M J;  4DL7 A;  2JEJ A;  4JB8 B;  2CJA A;  4Y65 A;  1A9N B;  4PRF A;  1A0O B;  1WC1 A;  3MCM A;  3CDB A;  3M1V A;  2DY9 A;  1HW9 A;  3PYE A;  3Q86 A;  1KOH A;  2E1C A;  2MKI A;  2IBK A;  1RTJ A;  2LEP A;  3OSP A;  3OL7 A;  3POT A;  1TL3 A;  2XC9 A;  3T5J A;  3PW2 A;  1FDB A;  3F73 A;  1KFD A;  2LEB A;  3QMQ A;  2K3K A;  3CVK A;  3DRS A;  1WI8 A;  2BUN A;  3GIM A;  3OR2 B;  2IY5 B;  4DL4 A;  2Q43 A;  2CQ1 A;  5KFV A;  3MPY A;  4ECY A;  3IS9 B;  1K8A T;  4FS2 A;  5E3R A;  5DLG A;  3J7Y I;  2V0N A;  3MMC A;  3D3C J;  5EHH A;  1TEL A;  4JI7 J;  2VH7 A;  1UWA A;  3M6X A;  4P10 A;  4KKO B;  3DMJ A;  5DGB A;  3Q83 A;  3G87 A;  1FWL A;  4AYB D;  5CZX A;  3QZ8 A;  2GJI A;  4MFB B;  3K8V A;  1AB8 A;  5AE3 A;  4DU7 A;  3JS9 A;  3BQ0 A;  4NLY A;  4HHH A;  3QWU A;  3OTE A;  3R7S B;  4KO0 A;  3C46 A;  5J2N B;  5AJ3 J;  1U1R A;  2DT9 A;  1Y9O A;  2CPX A;  4RW8 B;  3OJU A;  3FBB A;  1LOU A;  1ZYQ A;  1O8B A;  3JQM A;  1WKK A;  3MEK A;  4M5L A;  3GV7 B;  4A8K A;  4J9U E;  5HQ8 A;  4J91 A;  5ETR A;  3BH7 B;  2E5H A;  2X1F A;  1KRP A;  4C8L A;  3QNW B;  4JI5 F;  1Q4R A;  3TJ9 A;  4CLW A;  2VG6 A;  4KT0 C;  2HHT A;  1DTT A;  4CLP A;  1CJU B;  5LM7 E;  3DOL B;  3FMB A;  3NS7 B;  3NWR A;  1DUR A;  3PX4 A;  4DR1 J;  5F8G A;  4ZJO A;  3M8S A;  4OZL A;  3UD4 P;  4X2B A;  1UVI A;  3H5S A;  4OHZ A;  1S59 A;  3VCD A;  1SC1 B;  2FY8 A;  1HAR A;  1Q78 A;  1Y0H A;  3GIJ A;  1VIX A;  1PGZ A;  2Z2L A;  3JTP A;  1RWV B;  1HBO B;  3PZP A;  1RCO B;  3MM6 B;  3OBI A;  3PNI A;  3KHR A;  3UQS A;  3R1L A;  1URN A;  3MM8 B;  1WF2 A;  3I87 A;  4QZV B;  4LSL B;  4DV1 F;  3W1Y C;  3KJV A;  3LP0 A;  2J9C A;  2BJD A;  1VK8 A;  3N6M A;  1HNI A;  5J1E A;  2RNE A;  2WB1 D;  2YPY A;  2EWH A;  4HT5 A;  1LWX A;  2ZUG A;  3NGD A;  4DV3 J;  2FVP A;  1FKO A;  1LW0 B;  1KP6 A;  2WK4 A;  5GAE U;  1AZS A;  3CJT A;  2M0G B;  2OPQ B;  4NLU A;  2HMI B;  4C97 A;  4AUK A;  1FNO A;  4PXB A;  3I96 A;  4FYX B;  2XBP A;  1AUD A;  4B9V A;  5CYM B;  2F65 A;  2OUG A;  3OW2 R;  4PXE A;  4O4G B;  1UFL A;  2GO9 A;  2I9S A;  5LSO A;  4DV5 F;  3GJQ B;  2RDD A;  1W2B R;  1JIH A;  1H73 A;  1LK5 A;  5ETK A;  1SC6 A;  8RUC A;  2L48 A;  1U02 A;  4X4P A;  1YRT A;  3HXM A;  1RAG B;  2Y1I A;  4CH7 A;  2YX7 A;  3C66 A;  3DYA B;  1N0U A;  2JL9 A;  4R5P A;  2GCF A;  3IAM 9;  1UFW A;  4DCJ B;  2QA1 A;  1RHR B;  5AE1 A;  2HNY A;  1QJH A;  5KFH A;  1KNZ A;  3M30 B;  3OFF A;  4URQ U;  2FPH X;  2MKC A;  4WFB Q;  4OI3 A;  2OGU A;  5LSL A;  4ED5 A;  2NUH A;  3FUY A;  1N52 B;  2LDY A;  1WC0 A;  3T1Y F;  3SSQ A;  4AT1 B;  1G4C A;  2ZM6 F;  4B02 A;  4XAK A;  1MNE A;  1FRX A;  2LQJ A;  2BKO A;  3GIL A;  1URR A;  5K8N A;  2HK3 A;  3MR2 A;  2XLK A;  3KLF A;  2V69 A;  1NXI A;  3AFG A;  4ERD A;  4ZOS A;  4OLP A;  4MJK A;  4YB1 P;  1IBM J;  3F56 A;  2JHE A;  3MOZ A;  1VQY A;  1UVL A;  4YHH J;  3N5B A;  1PO6 A;  1HWU A;  4LFA J;  3AH6 A;  1U4B A;  4OYX A;  3VR1 A;  3V6J A;  5HJX A;  1TAQ A;  3MR7 A;  2BOP A;  2GAG C;  4IH7 A;  3GU0 A;  3MFI A;  1SQG A;  3PHE A;  4ZPV R;  1TL7 B;  1UWB B;  2CQD A;  3RAM A;  3O6Q A;  3MMJ A;  3C15 B;  1HWK A;  2W01 A;  4M63 A;  3W8P A;  4ZVP B;  4DL6 A;  2YKO A;  2G2O A;  4YME A;  2DR8 A;  3D6T B;  3TYT A;  3KYL A;  3C19 A;  1HWJ A;  1S77 D;  3KNA A;  1IKY B;  2B43 A;  1N32 J;  3OR2 A;  1NHK L;  1VK3 A;  3G6V A;  2OFG X;  3HJF A;  3IS9 A;  5IC6 B;  4DV2 J;  2ZE2 B;  4ZLN A;  3KDO A;  1RT1 B;  1JNR B;  4L74 A;  2GIQ A;  3H2L A;  1FRH A;  2E44 A;  4Y34 A;  3R1H A;  1UET A;  3LP2 B;  3SDE B;  3LP1 B;  4DV0 F;  2NR0 A;  4MFB A;  1WF0 A;  3PKM A;  2GIR A;  1PYS B;  4DLG A;  2YNF A;  4PG6 A;  2F3J A;  2QYG A;  3KG1 A;  1D3W A;  1Q5V A;  4A48 A;  4FXD A;  2CQ4 A;  3VAG A;  1R27 B;  3I0S B;  3CCE S;  4CYU B;  4RR5 A;  2IBO A;  4KR0 B;  2FC8 A;  4LF7 F;  1RCX B;  3EVM A;  5J2N A;  4R8U B;  3UN3 A;  1RU2 A;  4RW8 A;  2DRB A;  4C7Q A;  3FDS A;  4D3H A;  1FXD A;  5IWA J;  4F4Z A;  3MZI A;  5GAD I;  3GR0 A;  3DI6 B;  2DNG A;  1T03 B;  5K14 B;  3V4I B;  2FJV A;  4R0J A;  1B70 B;  1CJU A;  2HQD A;  1HNW F;  2MPU A;  3DOL A;  5E33 A;  1KTQ A;  1DAR A;  1LW2 B;  1R8H A;  2XSF A;  2HVE A;  2WBR A;  4FYY B;  1U45 A;  3LAM A;  1CQM A;  2NCK L;  3MD3 A;  4HH1 A;  2DH8 A;  1G2E A;  3HK2 A;  4DR6 J;  3MCO A;  1TKD A;  2IJR A;  3C6T A;  1HBO A;  1VLY A;  2ILY A;  3M9N B;  3MM6 A;  3UCG A;  2DGO A;  3NAH A;  2DNN A;  1BGX T;  5KG2 A;  3IRX B;  3MM8 A;  3GV5 B;  5IZH A;  2QSW A;  5C2C A;  2AYM A;  1QAJ A;  4M1K A;  2Z2Y B;  2HHU A;  2IM3 A;  3PFO A;  1R89 A;  3JSM B;  3EIC A;  2AV5 A;  4IRD A;  4DHV A;  4BBY A;  1UTA A;  2R2U A;  1QAY A;  3VHQ A;  3W65 A;  5KFY A;  4RL1 A;  4F67 A;  2VOO A;  2VPZ B;  1T9Y A;  4ZLJ A;  1RT3 B;  1T9X A;  4ILR A;  1LW0 A;  3MXH P;  1NLK L;  2HS0 A;  2HG4 A;  2X1G A;  2OPQ A;  3JTO A;  2DRD A;  2HMI A;  2ZBR A;  1SXL A;  3OFE A;  2M3D A;  4U7U D;  1FJ7 A;  3P5B P;  3SFG A;  3KLV A;  5CYM A;  3SV4 A;  1V3Z A;  4O4G A;  1RWU A;  2N7Y A;  3RG6 A;  4W90 B;  4ID8 A;  2HHV A;  4TVA B;  4Z2X A;  2L9D A;  3W62 A;  2I8E A;  2CAD A;  3OJS A;  2HFV A;  3K59 A;  1X5O A;  3EMT A;  1OYE A;  5KFR A;  4HEA 9;  2KXN B;  3DYA A;  2OHD A;  4ILM A;  1BMQ B;  2IMW P;  1QTN B;  2RB7 A;  3RRG A;  1HNX J;  1RZM A;  4DL5 A;  5H9E J;  2C22 A;  1UPP A;  4CCH A;  2VFU A;  4FF4 A;  2CQC A;  4WP8 A;  3FBE A;  1ULR A;  1YIJ S;  3K89 A;  3UDC A;  1S76 D;  1RT7 B;  2ROG A;  3M30 A;  3MEG B;  2E1A A;  1GMW A;  1YQH A;  4EK2 A;  5HVH A;  3ZTS A;  4MKA A;  4GO7 X;  2ZBI A;  3BV8 A;  4DQP A;  2E5J A;  4CNY A;  2UXC J;  1FK9 B;  2FB0 A;  1K0V A;  1U1L A;  1IBL F;  4L3N A;  4DX5 A;  3IC1 A;  3KLI B;  1T7P A;  2N7C A;  4YOE A;  3PRV A;  2Z57 B;  2O01 C;  1HQU B;  3EJM A;  1APS A;  3M7V A;  2KHC A;  2K8G A;  4FKY A;  1J5O B;  2DGX A;  3CCW A;  2EKN A;  3TQE A;  1R8P A;  4Q43 A;  3TW0 A;  3KLH A;  3WHI A;  4ETX A;  2KXH A;  2DH7 A;  3UVJ B;  4U7C A;  4JUZ A;  2FDN A;  1HLW A;  1RYR A;  1UWB A;  1SKU B;  4OX7 A;  1DLO B;  1SJQ A;  2UVU A;  3C15 A;  4HYK A;  1VQN S;  1HHQ A;  5KG1 A;  5ETQ A;  1OPI A;  1IKY A;  4DV6 F;  4DCP B;  5DDR C;  2E1R A;  3HKW A;  1YBA A;  4LSZ B;  4O3O A;  2R7T A;  1Z4U A;  1HHT P;  4LRA A;  2HQG A;  4RX6 A;  3KNG A;  4K4S A;  2ZE2 A;  2QMX A;  1RT1 A;  3MDF A;  2JFK A;  1OS5 A;  4DSE A;  4HDH A;  4NLD A;  5D78 A;  3FBF A;  3HO1 A;  2YX1 A;  4F4A A;  3ZZY A;  2AJ1 A;  2H3E B;  3ITH B;  1ZBT A;  1S57 A;  3LP2 A;  2WAQ D;  2M8D B;  4RNF A;  3EZO A;  3SDE A;  1YGY A;  3LP1 A;  4PZV A;  4F8R A;  1QE1 B;  2KDO A;  5EWF A;  5L1L A;  3SEO A;  3R6L B;  5DM7 Q;  5AXK A;  2WW4 A;  2DNR A;  3I0S A;  4CYU A;  3BRE A;  1SCJ B;  2E29 A;  1VQS A;  3CCT A;  5CAA A;  1U0S A;  3K2Y A;  5K8M A;  4C8K A;  3J7Z 5;  2VL1 A;  3BSO A;  2AGO A;  3DI6 A;  1IXK A;  1B0V A;  1KBR A;  1FDN A;  1T03 A;  1Q81 T;  4P74 A;  3GIK A;  5K14 A;  2R8K A;  1ZM2 A;  4IFY B;  4PYA A;  4Q7A A;  1ROF A;  2WZ1 A;  3V4I A;  1KQG B;  3BGU A;  1RTI B;  2EBG A;  1NH7 A;  2B4U A;  4YFU A;  1LW2 A;  2CQB A;  3NBP B;  5K8P A;  5IS2 A;  3EXC X;  3BPS P;  3M8Q B;  1S0M A;  5D3G A;  1FFW B;  3RZA A;  1HPZ B;  2GVD A;  4MTP A;  1TV6 B;  2I6W A;  1S6P A;  1VR6 A;  3ZC4 A;  1H2V Z;  3GR1 A;  2Z30 B;  3DU5 A;  1HBM B;  2CZ4 A;  2M4M A;  1N56 A;  1U47 A;  1P8G A;  4I2Q B;  1GX5 A;  5GMD A;  3IRX A;  2YX4 A;  2XQC A;  5A6P A;  1X5T A;  1SJR A;  4ID5 B;  1FCA A;  4DFJ A;  2R8J A;  1S6U A;  2XWY A;  1ZPW X;  3JSM A;  1B7F A;  2GX8 A;  1XNR J;  4JI4 F;  1VHF A;  3WC0 A;  2RHS B;  4TQR A;  4BC7 A;  4DL3 A;  3MAA B;  2HUR A;  3NKY A;  1RT3 A;  4KB7 A;  4TNO A;  2D74 B;  3QT5 A;  1RP5 A;  1A6L A;  1F2H A;  1WC6 A;  4K4W A;  2ADB A;  2LFV A;  2YNH B;  1NKB A;  2FVR A;  3VAK A;  2D1C A;  3EZ5 A;  2ZUA A;  3GG1 A;  2JJ4 D;  2V6A A;  4AQY J;  2EXU A;  3KUE A;  2DNY A;  2ZH3 A;  1H74 A;  1GMV A;  2XWX A;  4ED3 A;  4USJ C;  5DQH A;  1IR0 A;  2ASJ A;  1YJR A;  3THV A;  1KLM B;  1RAE B;  1WKL A;  4LF5 F;  4TY8 B;  3BKT A;  4KGM A;  1NZA A;  4LFB J;  2RVJ A;  1HQ2 A;  2AD9 A;  2CA9 A;  3UWT A;  3NCP A;  4ZPT R;  3H5Y A;  1XEZ A;  1RT7 A;  5E41 A;  4MKY A;  3MEG A;  2FJE B;  1X9W A;  1ZPV A;  4ZPB A;  1GX6 A;  4KHM A;  2C2K B;  3H90 A;  5KFL A;  1F2G A;  3P5T L;  2DGU A;  1SL1 A;  4IQX A;  1Q8I A;  5A6W A;  3RGI A;  2F4V F;  1JJH A;  1M1H A;  3P4U B;  1V6H A;  3ZZU A;  3HCX A;  2MDA A;  4L72 B;  4KE5 A;  1U1P A;  3TUI C;  2NXJ A;  3WX4 A;  4CP5 A;  2B4V A;  2GVZ A;  5CHC B;  3HI9 A;  1VHI A;  1FK9 A;  1RGV A;  1H0H B;  3NMR A;  3CD7 A;  3KLI A;  2B5J B;  3ZZZ A;  2YH0 A;  3MUR P;  1HQU A;  2NSB A;  3B8H A;  1NK7 A;  2F7V A;  4ZK7 M;  1J5O A;  4EZ6 A;  3ULH A;  2D69 A;  4WZQ A;  2ZOF A;  1R6Y A;  4P73 A;  3BKU A;  3K8W A;  3RW6 A;  4AL7 A;  1NJZ A;  2CVI A;  3R7B B;  2F9J A;  2EVZ A;  1N36 F;  2KN4 A;  3UVJ A;  3HSJ A;  2CJX B;  3I56 S;  5KOX A;  3H7H B;  5DZ7 A;  4Q2L A;  4L6V 3;  1IQZ A;  1H3D A;  3M4X A;  5L8R C;  4NA3 A;  3SI8 A;  1DLO A;  4DF8 A;  2V4Q A;  2MZT A;  2BQU A;  1UJ6 A;  3SXL A;  3CIM A;  3LTO A;  2XLJ A;  1RBO B;  4ZVR B;  4WFY A;  2FGC A;  2NPI A;  2ROP A;  3G6X A;  3QJJ A;  3C16 B;  3MTK A;  2M70 A;  1EX8 A;  2HHH J;  4NLQ A;  2GML A;  2DIU A;  3M8W A;  5DQI A;  1X8D A;  1RWP B;  2XMW A;  4ZPW R;  1U2C A;  2MY7 A;  1N5T A;  3HHE A;  4DR2 F;  3ITH A;  1FA0 A;  2UUB J;  3VWS A;  1VOM A;  3A4T A;  2FHO B;  1QE1 A;  1ICE B;  2HBQ B;  2MGZ B;  4YB5 A;  2FZG B;  1EZZ B;  1KN6 A;  3GSD A;  3QRR A;  1NDK A;  3NGS A;  3JSR A;  5B0D A;  3ETO A;  1SIZ A;  1LWE B;  4NLS A;  3D54 A;  1IUJ A;  1VBZ A;  4F3O A;  5IT9 U;  2MQQ A;  5KFK A;  4X4U A;  1NDP A;  2E1M C;  2PDA A;  4UOF A;  4USI A;  2W8L A;  2ZDO A;  2YH1 A;  3W61 A;  2HFN A;  3HFZ B;  5D15 A;  1RTI A;  4C2M A;  4NLP A;  4V1A k;  3J80 U;  2KFZ A;  3NBP A;  3M8Q A;  3I0R B;  4X64 F;  2VC0 A;  4QWB A;  3QGG A;  5LMU F;  4IOC Q;  3FMW A;  1HPZ A;  3P49 B;  2AGQ A;  1TV6 A;  2R7R A;  1PIL A;  5JVG Q;  1JLG B;  2BRL A;  3V5R A;  1TKX B;  4C3K A;  4LRD A;  1HBM A;  1M5S A;  4TN2 A;  3HHL D;  1S9E B;  4U8V A;  4V19 X;  2CQP A;  4DX8 H;  5J2M B;  4I2Q A;  1NSQ A;  1WEL A;  2DR6 A;  4ID5 A;  2V68 A;  1VS3 A;  2ZH4 A;  3IBW A;  1OO0 B;  2LYV A;  3AXM A;  2HFU A;  4RW4 B;  3IO1 A;  3QT8 A;  2R7O A;  3WZ0 A;  4J9V A;  3OFH A;  4HLB A;  4E8U A;  3DOK B;  1NBE B;  2JC0 A;  3MAA A;  4C0B A;  2LQ8 A;  2ZH1 A;  3PJW A;  2RS2 A;  2F8M A;  5KFQ A;  1MML A;  3SMZ A;  1YJ7 A;  3EZU A;  3KLE B;  1NPR A;  2P6S A;  1R8B A;  3SIP B;  3X1L B;  1JQG A;  2VOP A;  1TFY A;  3HVA A;  1WDD A;  1D1U A;  5E3A A;  1JJ4 A;  2KZM A;  1F9E B;  1MU2 B;  4LT6 A;  2QZ8 A;  1FES A;  4WXW A;  2XMJ A;  4WZM A;  1RWX B;  4J9M A;  2C3U A;  3QFH A;  3SYZ A;  4PCQ A;  1VRT B;  1KLM A;  2F9D A;  2ZKT A;  1LQ9 A;  1VQK S;  2OFH X;  4CZC A;  3T6J A;  1JNZ B;  5A0Y A;  4F4W A;  2P6T A;  1T9T A;  2K3I A;  3OQ2 A;  4JI2 J;  1HNZ F;  3PW5 A;  3PW7 A;  3ONQ A;  3CUL A;  4KHP F;  2MKY A;  1IJF B;  1VYA A;  2XUL A;  3IN5 A;  3DGV A;  3AOA A;  2L3M A;  3FEX B;  4CWB A;  2CQH A;  1LEO A;  3AD9 C;  3DCA A;  3VVT A;  1GFW B;  4CI0 B;  1R0C B;  1AFJ A;  1U49 A;  2ZH9 A;  1YX2 A;  4N47 A;  2I38 A;  3A3P B;  3G6E S;  1Q0N A;  2DGT A;  3CPW R;  2B5J A;  4PQU B;  3IBF B;  1JKH B;  3TEG A;  2HHS A;  4A8X A;  3GPA A;  3KUH A;  3RRK A;  4PAB A;  2KB2 A;  2YBV A;  3PM9 A;  1D9A A;  2LU2 A;  3H2V E;  3PFE A;  4FS1 A;  2VD3 A;  1JLA B;  2G1D A;  1M5O C;  2J9D E;  4S0M A;  1NK5 A;  1S99 A;  4FF2 A;  3FCV A;  1KVJ A;  3BO3 A;  3OL6 A;  2JEG A;  4FXV A;  1IR2 A;  2VFT A;  5I42 B;  1AT1 B;  3I31 A;  1UFK A;  2PA3 A;  4CIO A;  2ASL A;  2BJ9 A;  3HF5 A;  4DR7 F;  4UF4 A;  4J9R A;  3C16 A;  2R9L A;  2J7K A;  2DNQ A;  2GS8 A;  5E0O A;  1VCT A;  4BLG A;  4URG A;  5DG9 A;  1FEH A;  3HDS A;  2KT5 A;  1SIW B;  1X0P A;  5LMN J;  4DSJ A;  2U1A A;  4ER8 A;  2XI2 A;  1K73 T;  2XZT B;  3RBX A;  3FCH A;  5U47 A;  2N4D A;  4ZCM A;  5KFT A;  2MGZ A;  4W92 B;  2R2S A;  1XR5 A;  4E2F B;  1HR0 F;  5KFG A;  4GMK A;  2MQN A;  2WON B;  1GK8 A;  4DUY J;  2UUC J;  1RT4 B;  1BQN B;  3W9H A;  2GGP A;  1FDD A;  4K0K J;  2CPH A;  3Q8Q B;  4ECX A;  3J7A N;  3NL0 A;  2ACY A;  2J6U A;  1IJE B;  3W2W B;  1HWI A;  1T05 B;  4LVO P;  1U6B A;  4DSF A;  2RQM A;  1OY6 A;  4ZVO B;  1SC3 B;  4N56 A;  5SUH A;  2CNO B;  1EAY C;  1ZA1 B;  2COL A;  3TR5 A;  4ITS A;  4KPY A;  1CC8 A;  4DF4 A;  1LWF B;  1WHY A;  2KKH A;  4FPI A;  3G8S A;  3NCR A;  5EWE A;  5HVF A;  3DXB A;  3I0R A;  2R7U A;  3PHT A;  3M2U B;  4F50 A;  1GH8 A;  2UVW A;  1WOP A;  5AXN A;  1DQ8 A;  2XGP A;  4RZR A;  1JLG A;  1TKX A;  3PVX A;  1G1X A;  2LVW A;  3AAW B;  1I3O B;  4JI1 J;  2FQQ B;  1VIO A;  3NAI A;  5J2M A;  3BB5 A;  4ECW A;  2HBZ B;  3D0G E;  4NWB A;  1RT6 B;  1Y3J A;  2Q6B A;  1N5V A;  2EG2 A;  3B82 A;  3GYN A;  3H0P A;  3MPW A;  5KT2 A;  2M7S A;  1CJK B;  1UEU A;  4X66 J;  1N33 F;  2D3Z A;  3DOK A;  5GAG U;  3ICL A;  3LPE A;  1XMO J;  4X65 J;  4ZPC A;  3MM7 B;  2VBY A;  4C98 A;  2QFJ A;  5T7L A;  5C42 A;  1Y7P A;  2GW8 A;  1GT8 A;  5L9N A;  3KLE A;  2XHC A;  5DO2 A;  3MWB A;  4WP3 A;  4U95 A;  4C9D A;  3FRY A;  5IT4 A;  3SCJ E;  1IWG A;  2V2Z A;  4A8F A;  4J9L A;  1SL0 A;  4Y28 C;  2YWH A;  4WK3 A;  2MZQ A;  1SH0 A;  2E66 A;  3V81 A;  3UI3 A;  4LFC J;  1MU2 A;  2JEI A;  4GKK F;  4HTJ A;  4RW9 B;  1KTV A;  2FZC B;  3R5J B;  1SH3 A;  4NZ6 A;  2JDJ A;  3CCL S;  2HFS A;  3I55 S;  4MK7 A;  3RU0 A;  2R8H A;  3OTO F;  2Q66 A;  2XZD B;  1OQ3 A;  1RA6 A;  4K5S A;  4ZHR B;  1U1K A;  2DYA A;  3NP5 A;  4NXM J;  4H4O B;  3RB6 A;  1D9F A;  3MED B;  1YJW S;  5IC4 B;  3NGK A;  3Q0A A;  1PIE A;  3PJ9 A;  3D5M A;  2IRU A;  5C24 A;  2HWI A;  1VIS A;  4G65 A;  4KRW A;  3EGV A;  2P2C B;  5J1P A;  1L3K A;  3N9U C;  1FFS B;  3MMA A;  1KVK A;  1UVM A;  2GHV C;  5KG4 A;  3KXD A;  4PQU A;  4EO6 A;  3LGM A;  1JKH A;  5D77 A;  4Q45 A;  4DPX A;  2XMA A;  3PV8 A;  1IM4 A;  3IM9 A;  2JVR A;  1X4E A;  3JYT B;  2QG9 B;  1NK8 A;  2RT3 A;  4PG8 A;  3PX0 A;  4OX6 A;  5K8O A;  5IT0 A;  4LR8 A;  1X4H A;  1JLC B;  2HAF A;  1XMB A;  3TVZ A;  4OYB A;  4O3P A;  1W2I A;  2BM1 A;  1S4E A;  4ZDN A;  4CLU A;  5C25 B;  3CSK A;  2HRT A;  1NSA A;  2DIT A;  4RBU A;  1FVS A;  5KFB A;  4UZB A;  2IRX A;  1T8E A;  4I6W A;  4EUV A;  4CLL A;  4ZVS B;  4RLE A;  2QA4 S;  2RH3 A;  1FRK A;  1CG2 A;  3CJ0 A;  2P9G A;  4DX7 A;  2ATC B;  4ED6 A;  2O5D A;  4OI1 A;  2CIM A;  2F63 A;  5J2P A;  2W9A A;  5B09 A;  2XS2 A;  5BR8 J;  5D0R A;  4ICL B;  3BPD A;  2JRS A;  5LT5 A;  1FO1 A;  4K2X A;  5A2Q U;  4OZ5 A;  3FSY A;  2BA9 A;  3MEE B;  1KON A;  2V8P A;  3G4S S;  4OHX A;  2ZBC A;  2C2R A;  1CSJ A;  2UXB J;  3N5F A;  2WON A;  3J7Y U;  4IOA Q;  2CPE A;  1RT4 A;  1BQN A;  4Q2M A;  4DX6 A;  1PBA A;  1AW0 A;  3HZG A;  5KG0 A;  3AJ2 A;  3UNY A;  4TU8 A;  4DU8 A;  1NKC A;  1T05 A;  2BJ8 A;  3VAF A;  2B9W A;  2EK6 A;  3A8I A;  2D9O A;  3QJL A;  3CC4 S;  2RF2 B;  1W25 A;  2Y8W A;  1ZET A;  1RWN B;  4ANC A;  5IFM A;  4USM A;  1XTZ A;  2QTW A;  1UAW A;  4EI2 A;  2PI5 A;  1TFW A;  3BO4 A;  1ZAV A;  2XSJ B;  4C8O A;  2Q79 A;  4NYO A;  1P1L A;  2Z8Q A;  1F60 B;  4OJ3 A;  4ZA1 A;  2UXD J;  4GKJ J;  5IT9 Y;  3M2V B;  3O1L A;  1LXN A;  3CC2 S;  2C28 A;  3ILJ A;  1XK8 A;  3J7A 1;  5HN0 A;  4PEO A;  1SB6 A;  3FZ2 A;  2E5L J;  1A7G E;  2C3Y A;  1VQO S;  1FDA A;  1RT6 A;  4NA2 A;  1OJ4 A;  4M5G A;  3EGZ A;  3VQS A;  3J80 Y;  2BMB A;  1Y00 A;  1FXR A;  4OZ2 A;  3NXZ A;  1CJK A;  3BYR A;  7FDR A;  4MIB A;  2NXN A;  4NPO A;  4ALZ A;  3LAK A;  4OZ1 A;  1Q7L B;  3FGV A;  3DRY A;  3MM7 A;  3PIO Q;  1S6Q A;  2UP1 A;  2PMH A;  3CJ3 A;  3KHH A;  4ETZ A;  3KDN A;  4UQT A;  1Z2L A;  2ZH6 A;  1RHQ B;  4N5S A;  3M6V A;  1JLF B;  4DR3 J;  3L7O A;  1NK0 A;  1KDN A;  5DS7 A;  1MRO B;  4UQG A;  2H9Z A;  1E6V B;  1C0T B;  1LNQ A;  1NM2 A;  4RW9 A;  1WKJ A;  3A8K A;  2FHM A;  4ELT A;  4DPW A;  3KMS A;  3DLG B;  2ZHB A;  3H5X A;  2DGW A;  4C4W A;  1FTC A;  3GP9 A;  4ZHR A;  1XER A;  1GXL A;  5HMW A;  2B0G A;  5D0G A;  4H4O A;  3M05 A;  3N6L A;  3MED A;  4YDX A;  3K5L A;  2VKZ G;  4N7T A;  3E2E A;  4DQQ A;  4WIQ A;  3S8S A;  5ETS A;  1JXE A;  1C4C A;  4K50 A;  4LF6 F;  3BBC A;  2Z58 B;  4TYB A;  2AWZ A;  1BWV A;  2C2O B;  2DBB A;  1Y5L B;  2QJ3 A;  3QWP A;  1S97 A;  1MMN A;  2DNK A;  1WC4 A;  3GJR B;  1YBT A;  2IDE A;  4JOU A;  5F9L A;  3Q8R B;  3BN7 A;  1RWK B;  1JLB B;  4WF9 Q;  4DV4 F;  3QID A;  5EX3 A;  1UZH A;  1IQT A;  2M5Y A;  4I4B A;  4CLT A;  3CCZ A;  4ZPD A;  3CJ2 A;  5F3Z A;  2KH9 A;  2HFZ A;  2RHQ B;  3S6E A;  3VZH A;  4QIF A;  2ZJQ Q;  1JLC A;  4WXO A;  1SJ1 A;  1AA1 B;  3V2U C;  4Q44 A;  1VQP S;  2CZ9 A;  2XLI A;  5KTQ A;  4QYR A;  2LA6 A;  2V8V A;  3KFW X;  5T14 A;  1NND A;  3H4B A;  1QAX A;  2HPU A;  4LF8 F;  1FJG J;  2IM1 A;  3G8Q A;  2G2Y A;  7FD1 A;  5KFX A;  1U0H B;  3NWG A;  2AHO B;  2KM8 C;  3R5G A;  5C5J A;  1B0T A;  3U1L A;  4CT9 A;  2HVI A;  3UN5 A;  2CDR B;  2AF6 A;  2RDJ A;  1KHW A;  3B4D A;  4NRU A;  2RD5 C;  3DLJ A;  3W5X A;  5D8H B;  1FJE B;  5HQM A;  1XC9 A;  4LF6 J;  1S1X B;  1IBK F;  4AXI A;  3TZY A;  2QC3 A;  1HMV B;  4WU2 A;  1I94 F;  1LV5 A;  2JSX A;  3D6F B;  4RJV A;  5IOL A;  3MEE A;  2IDL A;  2RUG A;  4AE5 A;  5GME A;  2B4P A;  1N5Y A;  1KFS A;  2QN6 B;  2QGF B;  1N5S A;  3DC2 A;  1U1O A;  2MQ8 A;  1N34 F;  2DXD A;  3FNN A;  2VFR A;  1LFW A;  1RWM B;  3ELH A;  2VIC A;  2E1P A;  4OYZ A;  1P1T A;  1TMJ A;  1C2P A;  2IPO B;  2C3P A;  2V94 A;  4X62 F;  2XCA A;  4NZ7 A;  4ZVQ B;  2H65 B;  3POT B;  2DHA A;  4I68 A;  3EX7 B;  1WUU A;  4BWM A;  4P75 A;  1I5O B;  3KK1 B;  4JI6 J;  1NK6 A;  3E3X A;  4I2P B;  2ZBP A;  1X31 C;  3NGR A;  3CD6 S;  1H2U X;  1U2R A;  3BH6 B;  2GHP A;  4RW7 B;  1REG X;  2YNG B;  5KG6 A;  4X4T A;  3OSN A;  2XSJ A;  4K59 A;  1Q8B A;  2LMI A;  5GAD U;  3GCX P;  2E7X A;  4ZS6 A;  2HVH A;  2OO4 A;  3M2V A;  2AP6 A;  1DAX A;  4FPR A;  4DR4 F;  2UUA F;  1KOO A;  2H5J B;  2QEX S;  2AYB A;  3BDP A;  4OZ0 A;  1BHN A;  4ANE A;  3CCJ S;  4LF4 F;  3ZFV A;  2CQ2 A;  4IR1 A;  3HM9 A;  3TA2 A;  1FX2 A;  3CCS S;  3RRH A;  4LRC A;  2EFQ A;  4NEY A;  4MK9 A;  1M90 T;  1TL4 A;  5KOW A;  2ZNZ A;  3RTV A;  4DS5 A;  2RRB A;  2FJX A;  4DXL A;  2VQE F;  4DQR A;  1XMQ J;  1JLF A;  4ZCL A;  4P7T A;  3UDV A;  1MRO A;  1E6V A;  2KYZ A;  1C0T A;  1I1G A;  3NG8 A;  1R7I A;  3N4W A;  2QSF A;  5GAG I;  4QU7 A;  1UP1 A;  1K0T A;  3PW4 A;  2DJW A;  2VF3 A;  2MKK A;  3DLG A;  3Q8P B;  4ENO A;  1Z2Z A;  3DRR B;  3E8O A;  4WYW A;  3IWL A;  3LP0 B;  4V19 J;  4B3R J;  1J5E J;  5JMN A;  3G96 A;  3OXL A;  5K5M A;  2VDH A;  3FCW A;  2CPI A;  2KG0 A;  2B8P A;  4USK A;  2WVE A;  4DUZ J;  1Q82 T;  2B3T B;  5KFO A;  4QYZ J;  4JV5 F;  1AZS B;  2MHE A;  3IXQ A;  2FVC A;  2IYG A;  4UOG A;  2HZA A;  2DXF A;  2RQC A;  3DHX A;  4NCA A;  4QIW D;  1WHX A;  2NUU G;  2F5G A;  1JLB A;  3TWZ A;  1L3S A;  1WNE A;  3RAX A;  1FD8 A;  4JI0 J;  1UZD A;  5KFU A;  3OVA A;  1T11 A;  2ZVI A;  4C8N A;  2QA2 A;  2V8D A;  1VRQ C;  2HSE B;  5HL7 Q;  5FDL B;  3OTC A;  2BJE A;  3K5P A;  3P8B B;  3OL9 A;  4F4Y A;  3C8Y A;  4P2X A;  2RUS A;  3LPY A;  4OYO A;  1EKR A;  1XR7 A;  2WTF A;  4LF9 J;  4IRC A;  4JI8 F;  2DKO B;  2Q1L A;  1XR6 A;  4OMF G;  4WTY A;  2YKA A;  1U0H A;  3LWM A;  3HHN B;  4DPY A;  1J27 A;  3TX8 A;  1SVD A;  2MSS A;  1S0N A;  4MIW A;  2DEJ A;  4NML A;  2GZO A;  4KPC A;  2VFS A;  5DDO C;  4ECU A;  1TVR B;  1S1X A;  2KT3 A;  1YJT A;  2A2D A;  3KLF B;  4PKD B;  3QRP A;  3MHY A;  1K47 A;  1NJI T;  4JYA F;  2XMU A;  4FZV A;  1JMT A;  5F0W A;  5K9F A;  4YQW A;  3TUP A;  4GVL A;  4AND A;  2HNZ A;  2B6A B;  1U25 A;  2PE8 A;  4NCG B;  2BEF A;  2AKW B;  3AQO A;  3T1H F;  2Z56 B;  2PFD A;  3CCR S;  1CVJ A;  5HSP A;  4K4X A;  4PWD B;  3G86 A;  2BE9 B;  3ZXW A;  2JZ5 A;  3TUZ C;  2MYF A;  3QT7 A;  3BM7 A;  4Z37 A;  1F1B B;  5A2Q Y;  3GYX B;  3KK1 A;  4ZPA A;  4M94 A;  5H9F K;  4I2P A;  2CQ0 A;  4NXN F;  3IR5 B;  4RW7 A;  2YNG A;  1P6T A;  3W2V B;  2VQF J;  1S4F A;  4DJB A;  2BYC A;  4H4K C;  3CDW A;  1XNQ J;  3MF5 A;  3SSR A;  1S0O A;  3HHK A;  5CD4 H;  4ILL A;  1LWC B;  1HI0 P;  2O66 A;  2YNF B;  4CLK A;  1CUL B;  4IO1 A;  5A8W B;  1O0P A;  3QFW A;  4LF1 A;  3W66 A;  3CDA A;  4CDI A;  2JLG A;  2GFF A;  1B99 A;  4J9S A;  1M0S A;  1DFD A;  2KRR A;  2XYH B;  3PO5 A;  3HSZ A;  3ZZT A;  2AU0 A;  1NH8 A;  2J8S A;  3EWG A;  2YKM B;  3Q23 A;  3FEY B;  2ZOM A;  1FRM A;  2JH3 A;  4Y2C A;  2KYX A;  3EE3 A;  1UA0 A;  2B7C B;  2PT0 A;  1U1N A;  4B08 A;  1CJT B;  2X1B A;  3R5B A;  5CZV A;  2DHG A;  5HVG A;  1R6V A;  4YY3 F;  2CNN B;  3BEG B;  4M5K A;  2G0C A;  4YS2 A;  2QLF B;  2V2Q A;  3ENV A;  2G13 A;  3FVY A;  5DG8 A;  2AW0 A;  3C6T B;  1T3N A;  1NO8 A;  4QU6 A;  4YB6 A;  3LF0 A;  3GYG A;  3LA0 A;  3H42 A;  1RT2 A;  4F4K A;  1YJU A;  5L9X A;  3MUM P;  3DLK B;  2ZC4 A;  3DRR A;  3DN9 A;  2V9K A;  2AQ4 A;  2AEJ A;  5I3P A;  2RDI A;  3A1Y G;  4C8M A;  4TU9 A;  3I5C A;  2YWF A;  1UW9 A;  5HBM B;  4NLX A;  4R0E A;  4DFP A;  2B9X A;  5JVH Q;  4M5D B;  1L3V A;  4KH1 B;  4ZVU B;  1NHU A;  2F1F A;  1RJJ A;  4Q0B A;  2OTJ S;  4NYP A;  5B7W A;  1X4D A;  1S7H A;  5E2Q A;  1RHK B;  3U7J A;  4EZ9 A;  4DN9 A;  4JI5 J;  2FLO A;  1WTF A;  2Y9H A;  2DH9 A;  1N88 A;  1YRU A;  3CE8 A;  4UOH A;  1M5H A;  3P45 B;  2CFX A;  1R3N A;  3NCQ A;  4FXW A;  3UR0 A;  5KT7 A;  4JP8 A;  1EQ0 A;  2D9P A;  2HK2 A;  5FDL A;  4UTG A;  1DQA A;  1TKZ B;  2A0F B;  4Y6I A;  1SKR A;  2Y8Y A;  2UV8 G;  1ZTT A;  3QPI A;  4O3N A;  1UVJ A;  5EWG A;  1JWW A;  4NZ0 A;  1UVK A;  4DLE A;  2ZZM A;  2WOM A;  2J8A A;  4LQ9 A;  4NRT A;  2HHX A;  4CM2 A;  3U02 A;  2DGQ A;  4X4S A;  1QVF R;  5CQG A;  1SH2 A;  1VRU B;  3VAH A;  2CPF A;  4DV1 J;  5KT3 A;  4K4U A;  4HVZ A;  4DR5 F;  3I4P A;  4L3K A;  2UU9 F;  2BXJ A;  2V5H G;  1H7X A;  1MLA A;  1RHJ B;  3CO9 A;  4HT7 A;  4KH0 B;  3KUG A;  4ZN1 A;  3VGV A;  2NZ4 A;  1TVR A;  4K7Q A;  3JAM U;  1WC3 A;  3QGI A;  1CS4 B;  2G0I A;  3CF5 Q;  2CYY A;  2DRA A;  4WJB A;  3H5U A;  2J6T A;  2W7P A;  3SSS A;  2YKP A;  5J1N A;  5DGA A;  5HI7 A;  2XO6 A;  4OV1 A;  1EKS A;  2FJB B;  4DV5 J;  3KLH B;  2B6A A;  4QR2 A;  4NCG A;  2ILZ A;  2RIL A;  2ALY B;  2R8I A;  3GV8 B;  1QD1 A;  3MI7 X;  5IQQ A;  4PWD A;  2W2Q P;  1ZAX A;  4MK8 A;  5JJB A;  3TAM B;  3HKZ D;  1NJW A;  2BM0 A;  2FLL A;  4G1I A;  1FJC A;  5CD4 A;  4C6A A;  1C1B B;  1S1V B;  3AOD A;  3W2V A;  1Q8K A;  5ADZ A;  2CKW A;  3ET6 B;  4RWX A;  1VC0 A;  2MHN A;  2KM8 B;  5IM0 A;  2HVD A;  3KG0 A;  3I4H X;  1U48 A;  3GB0 A;  1FWK A;  3T1Y J;  3IAS 9;  2ZM6 J;  2VAS A;  3IP0 A;  2MLZ A;  4QBU A;  1X4A A;  1LWC A;  2QMW A;  1OSC A;  5JXS A;  3OD2 A;  4WFA Q;  3AB4 B;  2PFF B;  1CUL A;  1VC6 A;  4ECR A;  5A8W A;  3AJD A;  4DPO A;  4O0I A;  1OSD A;  4FYD A;  2BZ2 A;  1L5U A;  3TZX A;  4ECT A;  5KFF A;  2Y1J A;  1EET B;  4F25 A;  2HZC A;  2HRU A;  2EG1 A;  2N3O A;  2BE2 B;  2WSE C;  1QY7 A;  2DIS A;  3ILL A;  4UW2 A;  3K0J A;  2XB2 D;  5D4P A;  4YB7 A;  2E5G A;  2MTL A;  2YKM A;  1VFJ A;  2R7W A;  1U7L A;  3DXS X;  2XY6 A;  3PIP Q;  3EM1 A;  2J0S D;  4L73 A;  1D0E A;  4OI0 A;  2RJZ A;  1XIQ A;  5D3G B;  1CJT A;  2EFP A;  3TOQ A;  3A8E A;  2GVD B;  1GMU A;  3NGT A;  1S6P B;  2CNK B;  2GAH C;  5KFA A;  4A8W A;  4K4T A;  2MJN A;  2A6O A;  1R0A A;  4J9P A;  3Q8U A;  1W26 A;  3LWL A;  1TP7 A;  3BQ1 A;  1Q16 B;  1ZAW A;  1DTQ B;  2UZA A;  4DV0 J;  3DLK A;  3KHL A;  2RIJ A;  2XTJ P;  3C6U B;  1NME B;  4R25 A;  5LOQ A;  5HBM A;  4I7F B;  2PA8 D;  1PJ6 A;  3UCZ P;  4Q8E A;  3BDE A;  4LF7 J;  5G4D A;  4M5D A;  2GIF A;  2V4R A;  2ZBQ A;  3HHL C;  2QL7 B;  2V2K A;  1TR0 A;  3IMQ J;  1KLN A;  2CJB A;  2Y1R I;  3UW1 A;  2CQ3 A;  2RSQ A;  2DO0 A;  1IBC B;  4P7V A;  5L38 A;  1G3O A;  4IQM A;  4A46 A;  4M5N A;  1HNW J;  2MY8 A;  2IC3 B;  1QSY A;  2AYG A;  4ATN A;  3AOB A;  2JVO A;  2EFO A;  3W9I A;  2ZJR Q;  1VQM S;  3OLB A;  2O3D A;  4WTO B;  3CMA S;  1TKZ A;  1UCN A;  1JLE B;  3EGN A;  1IVZ A;  1QVG R;  2KRB A;  2FD2 A;  1DQ9 A;  2IVY A;  2NXU A;  4U8Y A;  1YZ6 A;  1JX4 A;  2IAJ B;  1RXO B;  3VGT A;  2C2D A;  1UJ5 A;  4PG7 A;  3QGH A;  1RAO A;  1VRU A;  4QPT A;  2FVS A;  2DHX A;  4YN3 B;  3PTW A;  4NLT A;  2H5E A;  2DTJ A;  4RUB A;  2KHD A;  4EBC A;  1EIY B;  3I9Z A;  4NI2 A;  4WFX A;  3A13 A;  1BQX A;  3RW7 A;  2DVI A;  3HD1 A;  4QWE A;  2OML A;  3D1H A;  1RKJ A;  2GVZ B;  5FJ4 A;  1U6Z A;  1WEZ A;  4JI3 F;  1HWL A;  1CS4 A;  1AUS L;  2MLX A;  3B78 A;  4BHQ A;  2ALZ A;  2DPJ A;  2MZS A;  2N82 B;  5L46 A;  5ITH A;  1YTY A;  3D66 A;  2PSZ A;  3BKF A;  3N79 A;  3OHA A;  1FFG B;  2XMT A;  1TKT B;  3Q8V A;  2CWX A;  4BC9 A;  2QE5 A;  2XY7 A;  2OJ3 A;  1Y5N B;  5D4N A;  3AD7 C;  2VPW B;  2YKN B;  3ZTO A;  2F8E X;  3HFV A;  3TAM A;  5L39 A;  1N4L A;  3LAL A;  2OPS B;  3PR5 B;  3IM8 A;  4HAC B;  3QAT A;  4P2S A;  2MMY A;  1WSR A;  3AOC A;  1L3T A;  3BGL A;  1V5V A;  1C1C B;  1C1B A;  1S1V A;  4LMZ A;  1OPZ A;  3P6Y C;  3IWN C;  3TAP A;  1RAC B;  3DHW C;  4UY8 5;  5D4L A;  2B9E A;  3K17 A;  4CNZ A;  3ET6 A;  2N3L A;  3KKF A;  4QWD A;  4E0D A;  3CC7 S;  4LRE A;  4OX8 A;  4A47 A;  2M8H A;  2U2F A;  1NEE A;  4I1T A;  2QA4 G;  3UDL A;  4NYZ A;  3N6N A;  3M8Z A;  3UDE A;  4M8L A;  2AMC B;  2HLT A;  2VG7 B;  3H8Y A;  1WG5 A;  4ZVG A;  4K8R A;  1P9Q C;  1Y5I B;  1IBL J;  2PMZ D;  2HGM A;  4LUB A;  4ED7 A;  4QOT A;  3D1O A;  1WDT A;  4GRS A;  3IGV A;  4Y2K A;  1EET A;  1RLC L;  1MG7 A;  3RBD A;  4NLG A;  2E9T A;  1QM9 A;  3KTQ A;  2BV3 A;  4F36 A;  3R2C J;  1QAI A;  2WB4 A;  2BE2 A;  2FJW A;  4OX9 F;  1GAO A;  1U8S A;  1PJ7 A;  2BKN A;  2QMU B;  2JLF A;  3SFU A;  1WF1 A;  1H98 A;  2VKR A;  2DHH A;  4C0O C;  1IR1 A;  1VQ6 S;  4MKB A;  1GQE A;  2I5J A;  3CW2 C;  1NDL A;  2WVF A;  1MW7 A;  3NOG A;  2QL5 B;  1FNX H;  4J5O A;  2B4O A;  2K06 A;  3TO8 A;  4DV6 J;  1PYT A;  1ZM4 A;  2V67 A;  4CLS A;  4MH8 A;  5KT5 A;  2RE1 A;  2LCW A;  4B3T F;  1S49 A;  3MMB B;  4OJG A;  5LXR A;  4C11 B;  3CDU A;  3VV2 B;  2IYI A;  3UCU P;  4NCB A;  1RAD B;  4B3M F;  5IXU A;  3RB4 A;  1U6F A;  2ZVS A;  1PAE X;  5F8I A;  1DTQ A;  4O0N A;  2VPY B;  4P72 A;  3ENW A;  3C6U A;  1RBL A;  2BOA A;  4I7F A;  3OUY B;  2DK2 A;  4RBT A;  4TLQ A;  1E6Y B;  1W7W A;  3W8G A;  3L9Z A;  4A8O A;  1SI9 A;  4ZN3 A;  3T1A A;  2IFX A;  5HAN A;  2VPX B;  1RAI B;  1T94 A;  2OEJ A;  2IRY A;  2XEX A;  5HAT A;  4YUD A;  4QR0 A;  2DR5 A;  1FD2 A;  1Q5Y A;  2MJU A;  2VB6 A;  3BZQ A;  4NMX A;  4OYP A;  2W1B A;  5L1K A;  2OMO A;  4CTA B;  2HWT A;  5E7O B;  3OLA A;  2IC3 A;  2FIU A;  5KFN A;  3PAC A;  4HI1 A;  4PAA A;  2C1E B;  4JI7 F;  3GFX A;  3L7U A;  1WHV A;  1XWL A;  2WCX A;  3PG9 A;  3SCL E;  1JLE A;  4ZLP A;  3PKY A;  4IG0 B;  5GMK a;  2VC1 A;  2C2N A;  4WFZ A;  1IKX B;  2IAJ A;  1EHW A;  1HKA A;  2F4F A;  2IA0 A;  2WW8 A;  5A0Y B;  2I0X A;  5IV4 A;  2XHW A;  2J7W A;  2MZR A;  3GSI A;  2VJU A;  3VQT A;  1UW4 A;  2XY5 A;  2HVZ A;  3EVO A;  1PYO B;  5AJ3 F;  4IUF A;  1S6O A;  2ZD1 B;  1I51 B;  1EP4 B;  4UY8 T;  3L3C A;  3CJ4 A;  4Q8F A;  1KEK A;  3FKB A;  2K7J A;  3CUN A;  3RR7 A;  4DUT A;  4WII A;  4JI4 J;  1V3S A;  2W9B B;  4FYV B;  2IJN A;  4TKT A;  2H48 B;  4M5I A;  1QSL A;  4ELV A;  4NA1 A;  1MWZ A;  2KU7 A;  3QSY B;  4NX9 A;  1RTZ A;  1HW8 A;  2VBX A;  3OPK A;  3M8P B;  5KG5 A;  2G4B A;  2BR0 A;  1MSW D;  3TVK A;  4DR1 F;  3L95 X;  2DNH A;  2IM0 A;  1TKT A;  4OHY A;  1FHT A;  5BYR A;  2Y0B B;  1JLQ B;  1RE1 B;  2OLW A;  3J7Z T;  1DHM A;  3W63 A;  5CCM A;  1CPZ A;  1WJ9 A;  3TZZ A;  2YKN A;  1YJ9 S;  4FDF A;  4KTQ A;  2R7V A;  2OPS A;  4HAC A;  3TAR A;  5DLF A;  2X1A A;  4CO1 A;  4LF5 J;  3JAM Y;  2NQP A;  2MST A;  3KJN B;  1Y4Z B;  3EUN A;  4OI2 A;  3MTJ A;  1KSP A;  1C1C A;  4XO0 A;  1VBY A;  1QTM A;  1ZM3 A;  4NE9 C;  2ZHA A;  1SKW A;  1RI7 A;  2NYH A;  2BAN A;  3CIZ A;  3D3B J;  2X51 A;  2E5I A;  3EDR B;  2CXE A;  4PXD A;  4CO4 A;  4B9S A;  4DV3 F;  3HZE A;  2R7Q A;  5B0F A;  1PG5 B;  4LBI A;  1U8W A;  3VGS A;  3NEK A;  1M5P C;  3CCM S;  4DSL A;  4GC7 A;  1M1K T;  2F4V J;  2IVM A;  3D67 A;  2ZZN A;  1I6J A;  3K58 A;  2VG7 A;  1YBU A;  3F44 A;  4D3G A;  5K20 B;  2EFV A;  3T5L A;  5KFZ A;  3MPU B;  4PXC A;  1GMW D;  2APO A;  5I3Q A;  3RBZ A;  3V4M A;  3ADA C;  1RAH B;  4ES2 A;  5KFC A;  2GGP B;  4DL0 C;  2DO4 A;  2IM2 A;  4O23 A;  2AGP A;  3HUL A;  3R8Y A;  3T9Z A;  4OHW A;  3OXF A;  4ZJL A;  2RAQ A;  4NL5 A;  1N36 J;  2VA2 A;  2N4C A;  4LVN P;  2P9C A;  5IV3 A;  1YI2 S;  2K7K A;  3K5M A;  2YWG A;  3LOU A;  4DSI A;  3DU6 A;  4QIG A;  1D8Y A;  3HD2 A;  4K4Y A;  1RDR A;  3TJA A;  3B6B A;  2MLY A;  4CO0 A;  1C0U B;  5LJ5 Y;  3HHD A;  2UVV A;  3MMB A;  1ITP A;  4ED2 A;  5I4M A;  4C11 A;  1TK0 A;  4H4K A;  1VBX A;  1PC4 A;  4DR2 J;  1RKI A;  3G9C A;  1RU1 A;  1F5B A;  3AD8 C;  2L41 A;  2F8H A;  1IBM F;  3OTB A;  4B3S F;  4YHH F;  3DNC A;  2VHG A;  1OMS A;  3CCV S;  4LFA F;  3LH2 S;  4J9N A;  1RTD B;  3G82 B;  2CG4 A;  4CH1 A;  1N0V C;  3PRD A;  5ETT A;  3OUY A;  3ZZP A;  3IGN A;  3RR8 A;  2PC6 A;  3DLB A;  4QQB A;  4F4X A;  1E6Y A;  1EJ7 L;  2XNR A;  2KT2 A;  5T7L B;  5C42 B;  4Y00 A;  1JXL A;  2HAI A;  1BE4 A;  5E3C A;  3SCK E;  4J90 A;  3Q24 A;  1N32 F;  1XN9 A;  3QIP B;  2C2E A;  1N6Q B;  4PWU A;  1EQM A;  3OXG A;  4CTA A;  4DV2 F;  2LLZ A;  2BQ3 A;  3M6W A;  4QYZ K;  1PSD A;  4CO3 A;  4DFM A;  2BRK A;  3V81 B;  1RHU B;  1S1T B;  5F8L A;  4X64 J;  2BDP A;  3SQO P;  2BJ3 A;  2CJY B;  4KGX B;  5LMU J;  2OPR B;  2GQ2 A;  4QIE A;  1HD0 A;  4RW6 B;  2LA4 A;  4Y0F A;  4IG0 A;  1K44 A;  2QL9 B;  5CAB A;  1SV5 B;  1IKX A;  3D1Q A;  2ZNY A;  1VQL S;  4KV8 B;  1VJW A;  4RNO A;  4WYL A;  4ES3 A;  2QIF A;  3NS5 A;  4ED4 A;  2OKQ A;  4PR6 A;  4B3S J;  2VIH A;  3V6D B;  1AFI A;  3BR9 A;  2E9Z A;  2ZD1 A;  1EP4 A;  4ECS A;  5IWA F;  4O4R A;  2VG5 B;  4ZP6 A;  5C24 B;  1WD6 A;  5KFJ A;  4DFK A;  1Y11 A;  1J2V A;  2W9B A;  2QT7 A;  4F3M A;  4EBD A;  2Z4P A;  3JSB A;  3ENQ A;  1PBU A;  3NNH A;  4NLO A;  4G1Q B;  3MMA B;  3HHL B;  5FLX U;  1F0X A;  1F9H A;  3M8P A;  4ZCI A;  2LDI A;  1R8C A;  2DNZ A;  2OEM A;  3PO4 A;  1HNV B; 
#chains in the Genus database with same CATH homology
 5H9F K;  1WJ9 A;  3QRQ A;  3QRP A;  3QRR A;  5CD4 A;  2Y8W A;  2Y9H A;  2Y8Y A;  4DZD A;  4QYZ K;  4U7U D;  5H9E K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...