2Y8WA

Structure of crispr endoribonuclease cse3 bound to 20 nt rna
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
215
structure length
215
Chain Sequence
GTGAMWLTKLVLNPASRAARRDLANPYEMHRTLSKAVSRALEEGRERLLWRLEPARGLEPPVVLVQTLTEPDWSVLDEGYAQVFPPKPFHPALKPGQRLRFRLRANPAKRLAATGKRVALKTPAEKVAWLERRLEEGGFRLLEGERGPWVQILQDTFLEVRRKKDGEEAGKLLQVQAVLFEGRLEVVDPERALATLRRGVGPGKALGLGLLSVAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/rna
molecule keywords CSE3
publication title An RNA-Induced Conformational Change Required for Crispr RNA Cleavage by the Endoribonuclease Cse3.
pubmed doi rcsb
source organism Thermus thermophilus
total genus 56
structure length 215
sequence length 215
ec nomenclature
pdb deposition date 2011-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08798 CRISPR_assoc CRISPR associated protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1200 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Crispr-associated protein; domain 1 2y8wA01
3.30.70.1210 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Crispr-associated protein; domain 2 2y8wA02
4U7UD 3QRPA 5H9EK 2Y9HA 4QYZK 3QRQA 5H9FK 5CD4A 2Y8YA 3QRRA 2Y8WA 1WJ9A 4DZDA
chains in the Genus database with same CATH superfamily
1CBKA 5C2GA 4ELVA 4YEAA 1V5VA 1S9FA 4LF4F 3FFIA 2QMWA 1Q16B 2H9ZA 1DFDA 3DRSB 1E6VB 4ANEA 5ETKA 3MMJA 1RBOB 3LWLA 3ISNC 1J5EF 1SJ3P 5J1EB 4U6PA 2RF2B 4DX5A 3JQKA 3P5TL 2DEJA 1TU0B 2AGQA 5H1SV 3ISZA 1BMQB 1CC8A 2QL9B 1KS2A 2HQ3A 4C8ZA 4KR0B 5DDPC 1LK5A 2QRRA 2FC8A 3NLCA 1TL4A 1JLAA 2C2MB 1U24A 1D3WA 3RRGA 1I94F 4BWJA 2F65A 4Y3CA 3ILLA 1RTHB 1F5AA 2PGCA 4UT4A 3MPVA 2XS7A 5BR8F 1NEEA 4X4QA 3JSBA 4R8UB 1B7YB 5C2CA 1SC1B 3H90A 2DXFA 4TN2A 1HNIB 1B99A 2OJ3A 3V4IA 4DSKA 3UDEA 2RDJA 1GXLA 3GIRA 1X9WA 1Q0NA 2XG8A 1ZOTA 4MTPA 4P9SA 4IDKB 4B3SF 3CCUS 5KFDA 4DL4A 2VH7A 3WZ0A 2GAGC 4Q0BB 4F4KA 3E8OA 1MNEA 4NRTA 2YNHB 4YDXA 1TL1A 5HMYA 4CDIA 3RYLA 3FEYB 1A7GE 3I96A 2VG5A 2VPWB 2XSJA 1N5YB 1PAEX 1WF0A 1T9WA 4DU7A 1HNZJ 2J7KA 2E1CA 1NDPA 4I6WA 5L1LA 2ACMA 3MEGB 3C14B 1S0NA 1RT2B 4KC5A 1WEZA 3M05A 3U27A 4LR7A 2XLIA 3P49B 3PX0A 2QSWA 2OH2A 3SCLE 4WKYA 4ZPAA 4ELTA 4OI3A 4ITSA 5M2UA 3PNIA 3FSIA 3IM9A 4QIEA 4YR2A 1KDNA 3W9HA 1X4DA 1ZAVA 1X4BA 2I2YA 5D4NA 3D6HB 1LW2B 2AX0A 1G6BA 3CB4A 3DDIA 1P8GA 1AZSA 3EGZA 1Y4ZB 5C42A 2IAJA 2EWHA 1KONA 3R5CA 2BQRA 2RRNA 3KDOA 2ZOFA 1T05A 2I8EA 2F4VF 1DZ5A 3JTPA 4N77A 3MAAA 4N7TA 1U1QA 4K4TA 2QG9B 5HMWA 2V9WA 2B3TB 2ZJPQ 3NGKA 1XMQF 2V4QA 4M5DB 4ZN3A 3SZ2A 3PDNA 5JUMA 4G1QB 3JQMA 3KG1A 1CVJA 3NCRA 1EQMA 4JV0A 2XQCA 3AQOA 2N3LA 5IS2A 4A8YA 1Q95G 2P6TA 3W2VA 4OX9F 1A0OB 3CSKA 1YK9A 1EIYB 3BR9A 3G4SS 2H5JB 4MK9A 2DXEA 2BKOA 5KFVA 5J2PA 2CNLB 1FKOB 1Y11A 2B4UA 2NZCA 2HFUA 1F5CA 3P45B 3TA1A 4FPIA 1UVIA 4NYPA 3M8ZA 1SL2A 4F50A 1PAUB 2DIVA 2XNRA 1W7WA 2W7OA 2XYHB 5B0AA 1QDUB 1BD6A 1SJRA 1VJWA 5C25B 4V1Ak 5LSRA 1RJJA 3H2VE 4DPYA 3RW6A 3M8QB 1TTHB 1UJ6A 3LO3A 5AXNA 1X31C 4TLRA 2B6AA 5HLFB 1E6YB 3IS9B 5EWGA 4NA2A 5CAAA 2XM3A 2HNZA 1FNMA 4DR1J 4WCEQ 2J9DA 3UD4P 1HNVA 4WFXA 5DM7Q 2ASJA 4WE1A 2PC6A 2R7WA 3FGVA 4IOAQ 4W90B 2ZOGA 3RAQA 4GVBB 1S1WA 2J6UA 1CJTA 1KKHA 3IGNA 3ZZZA 1JJ4A 2ILYA 2D9OA 5LJ5Y 4CYUA 3HSJA 2DYAA 4CNYA 1YBUA 2ALYB 2Y8YA 1V9OA 3KFWX 2BABA 3DYAA 3PYDA 4MKYA 3MR6A 4L3NA 5DZ6A 2YXLA 4ZCKA 2R7OA 1VC0A 2YKNA 3W61A 5AJ3F 4J7CA 1FO1A 5F8IA 5M2PA 1PC4A 1M1KT 2DHHA 2MGZA 4Y65A 2GMLA 3BSOA 4NCGA 3M32B 4ECZA 3BGRA 3HHLA 3BQ2A 4JI6J 4IR9A 5CD4H 4JI3F 2BJ3A 3HDSA 1KLMA 4ILRA 2HVDA 3V6HA 2CA9A 2AJQA 1IBCB 3ZZRA 4CI0B 5DETA 1ZA2B 4NXMJ 3B6BA 2ZJRQ 1UFLA 2GIRA 3AH6A 1WF2A 2RMLA 2DK2A 1JJ2R 3EUNA 2OD4A 5H9EK 2W9AA 1Q8IA 1SJ4P 2HHXA 1V3RA 3GQCA 4RW7A 4YB6A 1DTQB 3FQLA 4K0KJ 3ICLA 3WX8A 5B08A 4TKTA 4C8NA 3R7BB 4KFBA 2WSCC 1Q8BA 4K4YA 3DOLB 1U1KA 2R2SA 2ZE2B 1DY3A 4MKAA 2CQCA 4XK8C 1WHXA 1UKUA 2UXDF 4PZVA 4UTGA 3W8PA 3PKMA 2WRMA 2CG4A 1RTJB 2XEXA 4DV6J 1RTIA 2CPDA 2Z2ZA 4RW6A 5CCLA 1YJ7A 2CPZA 4LFBJ 3TZXA 3R2CJ 2VPYB 3CJKA 3TWZA 4FDFA 2VFUA 3W3SA 3HKWA 4OYMA 2Y1LB 1TMJA 1TL3B 1HWUA 1D8YA 3K5PA 2MKIA 3TANA 1EP4B 3AXKA 1O5JA 3GYXB 2N4DA 3G82B 2QLJB 3I4HX 4NI2A 4O23A 4I68A 3VQTA 1QSLA 5AXKA 2KT5A 2XMMA 3JTOA 1WNEA 5ETQA 4NLGA 3WIVA 4A8XA 2YNGB 2XNQA 1FJ7A 1H3DA 3J7ZT 2D3OR 5KAKA 1FWLA 1RB0A 2DGUA 1BQXA 1S9GA 1JLQB 3EGNA 3DHWC 4DUYF 3OSNA 4HHJA 2F63A 4C48A 4ZHRA 5J2MB 4DR4J 2OEKA 4X62F 2V9KA 3PIPQ 2D3O1 2VFTA 4DPUA 5CYQB 5G0RB 4M5IA 1R8HA 4CLUA 4ES2A 2K1RB 3KLGB 4U8YA 1BQNA 4GC7A 1R0CB 4DV7J 4MK8A 2B0GA 1X4FA 2FVQA 4X4TA 2H54B 3BKTA 3G71S 4DPOA 3BQ1A 2DY9A 5LMUF 3QQCD 2YH0A 2CVEA 4GVLA 3MM6B 1UWBB 3CJ8A 1XJWB 5HATA 4OV6A 5LSLA 3Q22A 2JZ5A 2VD3A 4IRKA 2CVIA 2BJ7A 3H40A 5B0CA 1IBMJ 3ILOA 3ZNJ1 1UEUA 3EXCX 4K4SA 2B9YA 1Q78A 4FXDA 2DXDA 5DZ7A 4ETZA 4DR6J 3BGLA 5KFEA 2E5LJ 1S1UA 3BDPA 4JI7F 4C11B 4LFAF 3BYPA 3CDAA 2KTQA 5AE2A 3UDVA 5KT4A 2G2OA 2KDOA 5KFHA 3TUIC 4RR5A 3VAGA 1HQUB 2V94A 1BQMB 4Q2MA 2B51A 2JVRA 5DGAA 3DLLQ 3W1YC 4C0BA 2YNFA 2BXJA 5A6WA 2MPUA 2VC0A 3OLBA 4EO6A 3CMQA 1YJUA 2WVDA 2OPQB 5KFZA 1T9VA 5F8HA 3QIDA 1WSRA 2ZOMA 1RWXB 4CLLA 5IWAJ 3W5XA 3MPYA 2N7YA 1H74A 2XZWA 5ADZA 2FLPA 1NKEA 5F8GA 3CJRA 2LYVA 1S1VB 3MTKA 3TQEA 1XR7A 2PO4A 1S0MA 2FHJD 2MLYA 3CVKA 2HFVA 2VV5A 4AXJA 1TL7A 1RWNB 4C8LA 1SH3A 2J7WA 4JI2J 3MOZA 4WZMA 4DU8A 3CJQA 1KQKA 4X4NA 2WVCA 3NS7B 2QX0A 3AA9A 2MQPA 2QL7B 4NLQA 2N3OA 2PT0A 1R6YA 1NPPA 2FLOA 4XPCA 5D0GA 1CJUB 5ETPA 4DPTA 4IRCA 1DQ8A 4X64F 2FY1A 2ZEJA 3H5SA 3VAHA 5IV3A 2EI5A 3F0NA 3EICA 4KPYA 4HACB 3TEGA 1R89A 4ZVPB 2VZ9A 2QJ3A 2LA4A 4CRJA 1TZ0A 4N56A 4LF4J 2RUSA 1HA1A 3PHTA 2YWWA 4K2XA 4O44B 4EEYA 5F9NA 1H72C 2AJFE 2LP4A 2DGWA 1J5EJ 3I0SA 3QGPA 1H7XA 4LQ9A 3MXHP 1AROP 3VAFA 1R3NA 1DTTB 2W4CA 2C2ZB 3CCVS 1LEOA 3V2UC 1WF1A 2JEJA 1UVKA 2KM8C 2BJ1A 2MHEA 1D1UA 3NMRA 3T5KA 1I94J 1FTCA 3DLEB 1CQNA 5IT0A 2HWIA 4P2MA 1TFYA 4KHPF 1P6TA 2MSSA 2CQ0A 2GJFA 1RHQB 3D3BJ 1NJXA 5L38A 5BR8J 5ETOA 3ZTRA 2E1MC 3RAXA 2FUG9 2ZD1A 1RT1B 2IA6A 4KO0A 2IJFA 2C2RA 2UVRA 2HHQA 5ETTA 4OHVA 4DFJA 4A8MP 2FYXA 2X1AA 5EWEA 2IC3B 3OFHA 1YJNS 3EVMA 1P1LA 5HROB 3RR8A 3BR8A 3MCOA 2R8IA 4TY8B 1C0TB 2CQHA 3VWSA 2HGLA 3KLHB 3HVRA 2L9NA 2ZDPA 2QE5A 3W5ZA 3SV3A 3HKZD 4GKKF 2E7VA 4B3SJ 1F1BB 1NJYA 2P9GA 1Y9OA 4ECYA 4I69A 1QY7A 3NAIA 1N33F 1S99A 3LQVA 4IG3B 1WI8A 2HZAA 4QCLA 1FESA 3M6UA 2UZAA 3J81j 3EGVA 3SXLA 2AJ1A 4YQWA 1K9MT 3AFGA 1RTZA 2FHKA 2Z2YB 3KTQA 2DRDA 1KSPA 3DXSX 2MQNA 1X9MA 4QYZJ 1ELOA 4NCAA 2BOPA 1FJEB 4P73A 5JXSA 3OJSA 1HBMA 2WB4A 1F3FA 3V6DA 5F3ZA 1BWEA 4PQUB 3HM9A 1GXTA 3NP5A 4YR3A 1YG0A 4NLUA 2MSTA 3K7RA 2N4CA 2K3IA 2IRXA 3IWLA 3TNVA 5KFKA 3VZIA 3IXQA 1R6VA 1SQGA 2NSCA 2MQOA 1KD1T 1X4EA 3OJUA 4ID5B 1CSJA 3OUYB 3GONA 4USTA 3DLHA 4J9KA 5I3QA 1RLCL 4DI6A 2PA8D 5DQHA 1TKTB 5HVFA 2ASLA 3HHEA 2DRAA 4DF4A 1J27A 4G3IA 4DL2A 5EUHA 2F9DA 2ZH6A 4NWBA 2F4VJ 1SXLA 3THTA 2OTJS 5KFSA 4F4AA 3PJXA 2JFDA 3HZEA 4WWSA 3N4WA 4J9LA 3PO5A 4F3QA 3I0RA 1XMQJ 1RDRA 1NAQA 3ZZYA 1WC1A 3DM2B 3GFXA 3MMBA 1JNRB 1QUVA 1OWXA 1VR6A 4G65A 1UETA 5CABA 4ZJQA 2A6OA 3MCSA 4Y2AA 2YBVA 5I42A 1KTVA 4OX9J 4RNOA 4P2SA 2ZWOA 1L3TA 1RKIA 1VC5A 1WG1A 5D3GA 1JX4A 2LXIA 4EU0A 3K5LA 4X66F 2EK6A 2VODA 3ITHA 3ELHA 4Q44A 2LQ5A 2HBRB 5KFTA 1T3NA 4LVNP 1QM9A 2UVVA 5AE1A 2P5VA 1VRQC 1DQ9A 2HSEB 3LALA 5DDOC 1U1NA 3D1HA 3C66A 5B0EA 4ED5A 2E29A 2ROGA 2ZKUA 5FD1A 1QTMA 3PIOQ 2VQEF 1SH0A 2DRBA 2ZUAA 3I32A 4WFZA 1RK8A 1S9EB 2CJAA 3W2WA 5A6PA 2XS5A 4DSIA 5GADU 2HPUA 5K14A 5DQGA 3HHLC 2EG2A 4OI6A 3KLIB 1G7CB 1TKZA 4P71A 4PXCA 1CJVA 3MEDB 5FDLB 3MM8A 5CH7B 3B54A 2W9CA 3CJ2A 2AW0A 4RW8B 1VGYA 4FVMA 3BGUA 3BB5A 2JLEA 5HJYA 2F4FA 4WK1A 4PUOA 4DL6A 1OPZA 3MMCA 2AJ4A 3FSYA 1S0VA 1FJCA 3K2YA 4F26A 2DGOA 1HHSA 4M5NA 4LF7F 3EZOA 4UOGA 4MKBA 4USIA 4EZ6A 4PXBA 5THWA 4LSZB 4RBTA 1SJFA 1NMEB 4JOUA 2XLJA 5LM7E 2FHJA 2IYGA 3M8PB 5AJ3J 1UPMB 2MXYA 3TJAA 1RT5B 4DL5A 1F9FA 1ZETA 2KZZA 2RJZA 4ZVFA 2ZM6F 4O3PA 1DJ0A 1QSSA 3QGIA 1M5KC 3SSQA 5HMXA 3OT9A 1ICEB 3CEDA 2OLWA 1N48A 3CJ0A 1YBAA 3PW0A 1FWKA 4JI3J 1CQMA 2C3MA 4W4MA 1VBXA 3LP0B 2ZBRA 3CC2S 1Q53A 1HPZB 3E51A 3TX0A 3HHDA 3ILJA 4QWEA 2RS8A 3OR1A 4C8KA 1RWOB 3MDFA 1M5HA 2DNMA 5E5NA 2G4BA 1YVFA 4Z7YA 2QLXA 3QFWA 4I7FB 1MN9A 1IXKA 1WWHA 2LLZA 4CLZA 2J0WA 1EAYC 2M7SA 4DR5F 3KUEA 2AQ4A 5HJXA 5L1KA 3V5RA 3HPOA 3UVJB 2XC9A 1WUUA 2CDRB 3PO4A 1JXLA 4JV5F 3SMZA 4WFYA 4CTAA 3N5FA 1EETA 1JKHA 2UXDJ 1IWAA 2W2OP 1I3OB 1VIXA 2LFVA 6AT1B 4U7CA 2V34A 2ZNYA 1HQEA 4JI1F 1VMBA 5GAGU 1MU2B 4ZCIA 1N5QA 4ZCMA 4N41A 4KTQA 3KNGA 1LWXA 3KJQB 3O1LA 1LOUA 3V6KA 2IFXA 1QTNB 1G1XA 1S6OA 2IBOA 2M0GB 3SQGB 2Y8WA 1U1MA 1U0SA 1M0SA 1T94A 1L3UA 3NBPA 2BW2A 2CAJA 2HNDB 2CUYA 5KFIA 3M6XA 3U1LA 2HIQA 3SCIE 3O6QA 4C0HA 4J9OA 1HYSA 2WCXA 1SH2A 4NX9A 4ZLJA 3Q8YA 3L7PA 1IUJA 1WG4A 3CJ4A 2QIFA 1HBUA 2R7SA 3BBFA 5IV4A 4KV8B 4DUYJ 4K4XA 5T41A 4PXDA 2F7VA 2Z4PA 4DDFA 4X62J 4WTOB 4DG1A 4X4RA 2HFSA 1WC0A 3HHKA 4DR2F 2KG1A 2IMWP 1HWIA 3DDKA 3EMTA 3Q0AA 3O5TB 3O44A 4IG0B 4O3RA 2AJ0A 4RUBA 5EWFA 2LEAA 5A8KA 3OVSA 4C6AA 1ITPA 2R8JA 1HBOA 4I56A 2G0JA 1DAXA 1MLAA 2BX6A 4HR2A 5IFMA 2VFVA 5LMUJ 1F9EB 3CCMS 1HW8A 3DLKB 3NNAA 1RSCA 5D78A 4PCQA 3C15A 1FKAF 3HVWA 3KHRA 1C1CB 4F67A 2CPHA 2UUTA 5GADI 2K7KA 2V50A 1L5UA 1IQTA 1R31A 2P6SA 2MKCA 1N0VC 4J5OA 2ZBPA 4LR9A 1Z2LA 1UAWA 4JI7J 1TMMA 4LFAJ 3QPIA 3TAQA 1PGZA 1SL0A 1NB7A 4QPTA 1S4FA 1IKVB 2DCUB 1IQZA 2HRUA 4AD6A 2RH3A 7FDRA 2D69A 1S6UA 2IVYA 3OTDA 2RQMA 4DXLA 4F04B 3M1VA 5DDQC 3Q8SB 3BKFA 5C24A 2HGNA 4Y00A 3SCKE 1V6HA 4E8UA 1Y10A 4YDDB 3NS6A 3CCSS 5H9EJ 1MN7A 2GVZA 4EBEA 1TVRA 4I0WA 2BZ2A 5GMKa 3FMBA 4M94A 5E3RA 4F0MA 4CO2A 2OHDA 5F8NA 4EFAC 3POTA 2Z58B 3QT8A 2MQLA 2JVOA 1UJ4A 4F0KA 2NXNA 3X1LB 3H8YA 1FD8A 2F5GA 2IMOA 3T19A 3Q2TC 3ET6A 1WHVA 1VBKA 1DLOB 5DO2A 4N8OA 3CWJA 2V4JB 3D3CJ 3RB4A 2HW3A 3SFGA 4ERDA 2ZH8A 4B9NA 4M5KA 1Y3JA 4DS4A 2M8HA 3HO1A 3TAMA 2R2UA 4XO0A 1CS4B 4X64J 4KE5A 1YRUA 1KQGB 2QL5B 3THVA 2W8LA 4EGLA 4NLVA 3RW7A 4IRDA 4YY3F 2HZVA 4M5JA 2NR0A 1XMBA 3OV7A 4ES3A 2QLWA 3H25A 4X65F 4Q45A 5CXTA 5KFWA 2KHDA 3J7YU 4GRSA 2V8VA 5LMNF 3MR2A 4RW4B 4I6YA 4M5GA 5HMZA 2O3DA 2JWNA 3KLEB 3DGPB 1SKUB 4R8UA 5KT6A 5GAGI 5LXYA 3N28A 3IP0A 2M9KA 3CMAS 4MFBA 2IDLA 1NJZA 1P9YA 1MSWD 2CJBA 1TUVA 1UFKA 3MCNA 2G0IA 1NO8A 3VQSA 4KHPJ 3KNAA 3IAS9 1KQSR 3DMJB 3KJFB 2AMCB 1LWEB 1ZTWA 1NK9A 5IZHA 1TL5A 3SQOP 4H4OB 4F8RA 3AJDA 1FXRA 3IR5B 4ALZA 9ATCB 2ZVSA 4L6V3 4NLWA 2BV3A 2B8QA 2CJYB 3UR3C 2D1CA 4KGXB 4K4WA 1VYAA 3M2VB 4OX8A 2ZZMA 4WFNQ 3MEGA 3C14A 3NNHA 2H51B 2HRTA 4MIAA 5DJBA 4GKKJ 5F8LA 2NPFA 1W2IA 2HQFA 1HBNB 4U96A 3HMJG 4DZDA 1N33J 3JAMY 2C2OB 2YQ3A 3VV2B 2CDQA 3UFCX 3MPUB 4A4JA 3TJ9A 2G9OA 2WW4A 2E9RX 4DHVA 3L7OA 4JBCA 4FS2A 2LMIA 2OPPB 4C8MA 5U47A 3MF5A 1QD1A 1ZZFA 2AZ1A 3M2RB 3UDCA 5L1IA 4ZITA 3EDQB 5LOQA 2HRYA 3MUMP 1AW0A 3K17A 4NZ0A 4OHWA 1X5OA 5A8WB 2W2PP 4FN5A 1U7LA 3O2IA 3MEEB 3IRXA 1S7HA 2DHSA 2EFNA 1A9NB 4I2PB 4DSLA 2WSFC 5J2QB 1RXOB 5E3QA 2GHVC 2FIUA 3BS9A 5F3TA 5J1PA 2Q6BA 4JI0F 1SV5B 4G1QA 4O0NA 1T9TA 3PYFA 3MM9A 2WONA 2MZSA 3I6PA 4OFZA 2BMBA 3PVXA 4ECSA 4ZIVA 4WP9A 4M95A 3QRPA 3H59A 4HDHA 4BCAA 2GGPA 4OHYA 1R0AA 3L3CA 1Q7LB 1GQEA 2OEMA 4FBUA 1S97A 4Z7CA 1GFWB 3TZWA 2CPFA 4W92B 3CIZA 4Q43A 1GK8A 1HMVB 5HBMA 4XTTA 2Q1LA 2L9DA 3IFEA 1EJ7L 3DI6A 3HVAA 2ZNZA 3T5HA 2AHOB 3MR7A 1IKXA 8AT1B 2Z57B 4DSFA 1VQSA 3Q23A 3THPA 1RWUA 3N01A 4DR7F 1SKSA 3JQJA 3NKYA 1UVLA 2GFFA 4IFVA 2PFFB 5HP1B 5C25A 1RZMA 4DUTA 1N6QA 2BOAA 4AQYF 4X66J 2DNRA 3MFIA 3M8QA 3EXYA 1M1GA 1HQ2A 4TQRA 1VQLS 4LF6F 4DOZA 1E6YA 5BYSA 2DIUA 3V4IB 3BZQA 3V81B 4R25A 4NLOA 3S6EA 2UUBF 1RQ0A 2DD8S 3EX7B 2XMJA 4A46A 3RU0A 3PW2A 3ENAA 1R43A 4C98A 1ZPVA 2AKWB 2VQEJ 4GVBA 1YJWS 2YPYA 1WC6A 1TL1B 3HD2A 5CHCB 3QSYB 2JOQA 1R7IA 1N5TA 2O5DA 4YN3B 2XMWA 2VG5B 2XSJB 2BE9B 2CJXB 1REGX 4ZCLA 3OHBA 3KXDA 3GILA 3CJTA 3KK3A 2KM8B 3D6MB 4ED7A 3DU6A 2GVDA 5EGYA 4B08A 3D2WA 2RAQA 3N79A 1B7FA 4B9TA 4RNMA 1RAGB 3J7YI 2NCKL 1B70B 2ZHOA 2MY8A 4XPEA 4LF7J 5HN0A 5KFBA 2NXCA 3M30A 4J9NA 3WIUA 1U1PA 5D6GA 3EGWB 1T03A 3FMWA 4K8RA 4CLPA 4P74A 2K2PA 2HVZA 3OL8A 1MW7A 1RAAB 1AZSB 3DLJA 3TP2A 5C42B 2ZM6J 1Z4UA 2BBEA 3NXZA 4X4UA 2IIHA 1B3TA 4MIWA 5A2QU 2DHGA 2ROEA 4DMZA 3MAAB 1PYSB 5HSPA 2DR6A 3W5YA 2GZOA 3LP1A 1RHKB 2U1AA 1XC9A 2Z2MA 3GSIA 2L48A 4NZ7A 3WC0A 4FS1A 2NXJA 5T7LA 2JLFA 4TU9A 2M2BA 3M8SA 4OZ5A 2OFHX 2F9JA 1RU2A 2MYFA 4RBUA 4LF9F 4DQQA 1HIYA 4DN9A 1U2RA 4TNOA 1WELA 2HFNA 2WSEC 4F36A 2YKOA 4DR5J 4M5HA 5J2PB 4DF8A 3MMAB 3W60A 4YB7A 1R8PA 4UQGA 4K0KF 2FTRA 1EKRA 5DLGA 1TL3A 5KT2A 2AU0A 5T14A 1VQOS 2OELA 4JV5J 4UQTA 5BJRA 2YH1A 4OLPA 1AFIA 3AHPA 2E7XA 3UCGA 2IBKA 2OPRB 2AGPA 3CPWR 2M70A 4JI1J 2EXUA 3RB0A 4MH8A 4HT7A 2GIFA 3NCPA 2YNGA 2NUUG 3DHXA 4HVZA 1QVFR 4I4BA 1Y5IB 2J76E 2B6AB 3GYNA 1SC4B 5L1JA 1QE1B 2M8DB 2HNZB 2BDPA 4KKOB 3K89A 3W65A 1HNVB 3S01A 1O51A 3EYZA 3BBBA 3QRRA 4L3KA 2ATLA 1S1WB 2AEJA 4ECUA 5D4PA 3T6JA 1DHMA 2FZGB 1JB0C 2QV6A 4LIWA 4OJ3A 4DR3F 1WDTA 2B43A 5KFNA 2IM2A 2OFGX 1ZM3A 3DYAB 4A48A 3A8JA 2BW7A 3GJTB 2MQ8A 4NRUA 2R7TA 2YKNB 3HSZA 3IM8A 3ZTSA 3AT1B 4DR2J 5KG7A 4ED6A 2C2KB 2HVEA 3GTYX 1WG5A 3QMQA 2B9XA 3VHQA 2QT7A 1D0EA 2OKQA 5K20B 4NCGB 2HFOA 3BGRB 2ZBQA 3HHLB 4AL6A 2VOPA 1HFEL 3ETOA 2XI3A 1KLMB 3GG0A 2VUGA 4ZLPA 1FEEA 1SBRA 4WYWA 2XY7A 3ISND 1H7WA 1NDCA 4RO0A 5IT4A 3EJMA 1TFWA 2OP5A 1C2PA 4KH1B 1VQ4S 1X5SA 4JV2A 1Z2ZA 4QZVB 1BQMA 3G8QA 2YQ0A 4Y2CA 1LW0B 4RW7B 4O4GA 1K0TA 5SUHA 3I31A 3OL9A 2P9CA 4LF8F 3TUZC 1U8WA 4KFBB 1JLCA 1IM4A 4H54A 3U1MA 3E2EA 1U6BA 2EW9A 2C2NA 2Z0GA 4QYZK 1TKDA 1RGVA 2AJ2A 2KYZA 2O01C 4NL5A 2KHCA 3ZXWA 3ADAC 2DHAA 2BA9A 4ED8A 2APOA 2E44A 5CYJA 3LGMA 2UVWA 1TR0A 4U95A 1RTIB 5KT7A 4RW6B 5D8HB 2GQ2A 2C2EA 4PKDB 2M3DA 2FJVA 5KG1A 2LVWA 4DCJB 3ULHA 1Y00A 3TW0A 3GU0A 5GAEU 3GLJA 5E3CA 4OLOA 3BV8A 2HS0A 3PM9A 2D3ZA 2YNIB 4NLXA 3T3FA 3TUPA 5EHHA 1KOOA 1PJ7A 5F41A 4NI2B 3LPYA 4CP5A 1S6QB 3VAIA 3VVTA 2VA2A 4K50A 2B9EA 3DLGB 2V69A 3GJQB 4LF5F 2ZH1A 2QYCA 2BKPA 2R7XA 2CPJA 1VLYA 4HACA 3HVTA 3G86A 4DV0F 1H2UX 4ECXA 1PILA 2Y3YA 3M9NB 4P52A 3CD5A 3ENQA 4EZ9A 3T1AA 4OYAA 4E0DA 4O44A 1Y3KA 3RZAA 4K59A 4ID8A 1FVSA 4ZHRB 4DQPA 1DTTA 1NHUA 2VQFF 2WHOA 3FZ2A 4QIVA 4ED0A 4DV3F 3FC9A 2JC1A 1GX6A 5I4MA 2VASA 3D5MA 4EBCA 5FLXU 3UE2A 1NU4A 3DRRA 1H98A 2POKA 1S1TA 2VOOA 1LKZA 4YY3J 1NBEB 4B9LA 5HQLA 2A1BA 1HI0P 1BXNA 1BQNB 1ZYQA 4X65J 2QMXA 2H48B 3SSSA 3OLAA 4OHZA 2U2FA 5LMNJ 2WOMA 1VK3A 2VFSA 3HLUA 1RWMB 2R7VA 2NLWA 4C4WA 3FK4A 4ECTA 2DNGA 5D15A 2VDIA 2RD5C 3BO4A 1U26A 2EPIA 2E1PA 1H2TZ 1OIAA 4UY85 3R5AA 2AWZA 4ZVRB 3KLHA 1RWVB 3OPKA 4NLTA 4PWWA 1Y5LB 4HH0A 2OD6A 1G4CA 2OUGA 4QIWD 1OYEA 3GFHA 2YWHA 4RX6A 4N8NA 1R8CA 1S1UB 3U1NA 4CH0S 4GO7X 2W2QP 3UR0A 5L9NA 2VJVA 4JP8A 2GO8A 2H4YB 4ZK7M 2QFIA 4J9QA 1XMOF 4Y6IA 5B7WA 2JH3A 2QGFB 3PW4A 2CZVC 1IN0A 1RYSA 3ENWA 3LW5C 1OY6A 4LBPA 1ZS6A 1FRHA 3CJ5A 2YNFB 2J5AA 5HAOA 1LV5A 3JSYA 4ZIWA 3P8BB 3CCRS 2W01A 2LU2A 2BANA 1OMSA 4W98A 1H2VZ 3N0VA 1NM2A 4M1KA 3MM5B 3Q83A 3V6JA 3OFGA 5KT5A 1TKXB 2IJNA 2OPSA 3BYRA 2HHSA 3G2XA 3SV4A 2X3DA 4C3LA 1KEKA 3QRQA 1VBZA 1WOPA 2W4PA 3QZ8A 3LOUA 1LNQA 2MZTA 1UA0A 3IMQJ 2ALZA 2E5HA 3CMES 1NSKL 1D09B 5HANA 1G2EA 1TKTA 3G87A 1RKJA 2FJWA 1TL7B 3VALA 3ILIA 2CQDA 1JIHA 3VAMA 1UW9A 4Y28C 1IJEB 4KY3A 1IR1A 3GR1A 1U6FA 2DTJA 4KGVB 4NLSA 1PCAA 1RT7B 3PCOB 2FY8A 4LSNA 1FF2A 4JI0J 2WBRA 3W9JA 1FX4A 3K5OA 2GJIA 5GVQA 1Q7YT 4UOFA 2DNOA 1IKYB 1K0VA 3VF0B 2E5GA 4FF2A 2CQ2A 1SC3B 2HIYA 1KBRA 3I0SB 1HWJA 4ZPDA 4CIOA 2JL9A 1OPIA 1YZ6A 5LXRA 2VIHA 4DPXA 4X84A 5L46A 4U7UK 2HBZB 4FBTA 4LRCA 4AXIA 2PD1A 2MY7A 2IDEA 3AODA 5GAEI 4DR7J 4HL9A 4HYKA 3U02A 1VRTB 2HG4A 3Q8PB 2NQPA 4OZ1A 1DRZA 1YTYA 2DEIA 4AQYJ 2ASDA 4LF2A 1IKWA 3PRDA 4Z37A 2ZD1B 4RW9A 2XWYA 1AXQA 4C0OC 4H4MA 4G6VB 3OQ2A 4LF6J 3MAQA 3UCZP 5SZTA 1REVA 5KG0A 1L3VA 3PW5A 1S0OA 2RKIA 5FDLA 3DOMA 1K8AT 4B3TF 4O3OA 2UUBJ 3OTBA 2QZ8A 3S1TA 4F2RA 1GEHA 3I9ZA 3MECA 1OQ3A 4B9MA 2GC8A 2CNKB 3K58A 4B3OA 4OYZA 3LTOA 3NS5A 1PJ5A 2GA7A 2DISA 3TZYA 5E0OA 3R27A 4PG4A 1FE0A 3DCAA 1N56A 5F0WA 1UFWA 4ECWA 1FD2A 3RGIA 1C0UA 4I6AA 3PJWA 2V0NA 5IOLA 5K8OA 1HBMB 4A8OA 3S7RA 4N76A 4WFAQ 2MJNA 5EX3A 1KHWA 3V6DB 4XDDA 3HT3A 2RU9A 2I0XA 3I9V9 4IUFA 1PC5A 3GZ7A 4ZLNA 1LQ9A 3G8TA 3LGHA 1Q8LA 4O3NA 2COLA 2DNYA 1NSPA 1RT3A 5IT9Y 1HPZA 3UN5A 1RCOB 2KFYA 2DY1A 4J9MA 3E01B 2V8GA 1WEXA 3K57A 2ZZNA 1RBLA 4KB7A 1C1BB 4BC7A 3KUGA 2CFXA 3G8SA 4EYIB 4B9VA 4RUCA 1C4CA 3GYGA 2BJ8A 1KRPA 4A8WA 5KOXA 3W66A 2KT3A 3JSMB 2EFGA 1FDDA 3R9LA 2DNNA 3EPGA 3PG9A 3UVJA 3NCQA 3AOBA 3I0RB 5KFGA 5IM0B 1HW9A 3C16B 4IH7A 2UP1A 3MMBB 3D0IE 1FFWB 2DO4A 5JVHQ 2DPIA 3KK2A 1S5ZA 2VG7A 2QFJA 1ZM9A 3GMGA 2RUGA 3KMSA 1CEZA 3RBEA 1X5PA 3CT9A 1MROA 1ZBTA 4MYTA 1U4BA 2H4WB 5JJBA 4LF9J 3TRGA 4ENOA 5I42B 2IVMA 2CQBA 2D3UA 1DQAA 1AYEA 4A8QA 2Q6CA 2OO4A 5C5JA 4ZMMA 1Q5YA 2KFNA 1YQHA 2E66A 4DQSA 1CC7A 2FHOB 2HBQB 1Q86T 2P8IA 4ATNA 1MWQA 2WZ1A 4IQMA 3MAHA 4OJHA 5KFPA 5A8RA 2ZC4A 2HNDA 4WP8A 1CPZA 3K8VA 4YB5A 2BACA 1FRIA 3FBEA 3MHYA 3IBWA 4L75A 4ZJOA 1F60B 2MKKA 1HI1A 4CT8A 5EX0A 5BYRA 3HT0A 3B4MA 5K14B 2FGCA 2RSQA 2FHMA 4OI1A 2XMAA 2P2CB 1CJVB 3EWGA 4DFPA 3MM8B 4DX7A 4F4YA 3NOCA 2HS3A 3ZZ0A 2W4DA 2G2ZA 1I5OB 4QIFA 3ZTOA 4PUOB 1WHYA 3MMCB 1PG5B 4GO5X 2I6WA 2AP6A 5KG4A 2CNNB 1SPBP 4B17A 1IBLF 4L74A 4DR3J 3PXGa 3NEKA 1U47A 4LRDA 2F1FA 4P2FA 3IO1A 1PKUA 2OMLA 1FRMA 1VHIA 4NLDA 3T1HF 1X9SA 3UNYA 1PO6A 1NK0A 3R7NB 5DDRC 4P10A 1JLBA 1LWFA 1VRUB 1JLEA 5MLCV 4TYAA 3KWMA 1JLFA 3EVOA 1Q82T 3NL0A 5IC4B 4A8SA 3M9OB 4F3OA 4N47A 4RUAA 2X3GA 2FLNA 3TA0A 1RHMB 4CH7A 3T1YF 2HGMA 3C6TA 2UUAF 2RHSB 4MMOA 2B5JA 2WK4A 1WOOA 3A3NB 1FI4A 4USHA 2HKEA 2WVBA 1AFJA 2DGQA 2ZBCA 2XULA 2IHR1 1N88A 2HHWA 3OR1B 4HH1A 8RUCA 4D3HA 3UD5A 1RTDA 2ZKTA 3GV5B 3AQPA 2YTCA 1P27B 2KI2A 1UP1A 2NXUA 3M2UA 1KLNA 3GR0A 3QWUA 7AT1B 2LEPA 4UOCA 1K1SA 4IQXA 1YHQS 4J90A 4PEOA 4LF8J 2ADBA 3CD6S 1FXLA 4RWXA 4P6QA 3KK1B 1U0HB 5HQ8A 3H20A 4FNIA 2JEIA 3GCWP 3MEKA 1S10A 4OI0A 1EETB 1JKHB 4ED1A 1RA6A 5I3PA 3H5UA 1D9FA 4M63A 1HQEB 4P72A 1BE4A 2J9EA 4Y2KA 3O8WA 5FIIA 3TOQA 1TV6A 4KBIA 1XBWA 3I87A 3AJ2A 2YQ1A 2ZH5A 1DLOA 3OFEA 1TUGB 1I6JA 2XI2A 3MR5A 5CZXA 2HHTA 1H73A 2HYIB 2R2RA 5CYMB 2DHXA 5GAHU 2GCFA 5I3UA 1TK0A 1X4CA 4WYLA 3RUBL 1T0TV 3NBPB 3QGGA 3TUJC 3BPSP 4LF5J 2HVHA 1SC6A 2IPOB 4QWBA 1CULA 2EFOA 3AB4B 3HSDA 3JYTA 1FKPB 3GJRB 1RYRA 4DV0J 1HBUB 4CO0A 2HQDA 1FCAA 1FFSB 2KRBA 2ZH9A 5CD4A 4RU2A 2EKYA 4ZPWR 4RW4A 5K5MA 4WU2A 1ZAXA 4BBYA 1UEKA 4LREA 2VQFJ 1FK9A 2VL1A 3HI9A 4DV3J 3TARA 2DPJA 1FXDA 4WIIA 3SEOA 2GJ2A 4HTIA 4DCOB 4CLKA 2MKSA 3M6WA 4ZVSB 4Q2LA 3SIPB 2H65B 5KG6A 4YUDA 2OMOA 3H7HB 4IOCQ 4ECQA 4CWBA 3QJPA 1NH7A 3CTRA 2HQIA 3BGFA 5KTQA 2J9DE 1ZH5A 1A6LA 1RCXB 2FDNA 3J7A1 2IRYA 5A8KB 1VCTA 1HD0A 2UVUA 3ZZTA 3DMJA 2QLFB 4LVOP 3PRVA 4DPWA 4IYQA 1Q79A 2VFRA 3ZZUA 2KB2A 3UD3P 2QA4G 3TI0A 3F44A 1ZPWX 3ZTQA 2B9WA 4O3SA 4TYBA 4XIUA 4UUXA 2CJQA 3BDEA 1QSYA 1VQ9S 1MMNA 3C15B 2OIHA 3DFEA 2FVPA 4XAKA 2BE2A 2R9LA 4DSEA 3CUNA 4FVCA 3R7SB 4BC9A 3VR1A 4LT6A 2M88A 2XY5A 3A3PB 4OJ1A 2KJVA 3WHIA 4NEZA 1WEYA 1VOMA 3KOAA 3HF5A 2QMUB 2NXEA 2G13A 2MZ1A 4ZKAA 3QBCA 2K8GA 1KFSA 1XMOJ 1Z1ZA 3RG6A 1YDLA 2JC0A 3QLHA 2HK2A 3ZNUA 1S77D 4HHUA 1IBKF 4U9RA 3IBCB 2Y1JA 2OPPA 5KG2A 2BJEA 5F0UA 5KFRA 3LUYA 2CQ3A 3SFUA 1UL3A 4J9PA 2XYPB 2VICA 4OV1A 1RHUB 1RAHB 2XYGB 2DNQA 1TVRB 1FRLA 3R1LA 2LQ8A 1OJ4A 1TK5A 4G1PA 3JTNA 2QA1A 3T9NA 4FKYA 3Q8UA 2KN4A 4P7TA 1T3OA 3AJ1A 4X4PA 3ET6B 4O3QA 3TQ1A 3MCMA 1GNKA 1VK8A 4B9UA 1YJTA 2R42A 2CPEA 3UN3A 4USMA 4FF4A 2FVSA 2PDAA 1UJ5A 3NWGA 1WC3A 3HZGA 2R8KA 3TAMB 2G1DA 4NE9C 2KT2A 1BUXA 1FRJA 2D41A 1HMVA 2VPXB 1VI7A 2L08A 4X2BA 1S6PA 3TR5A 2E9TA 1FNXH 3OXGA 2HEKA 1JK9B 3QO9B 3QT6A 3QIPA 1J5OB 3HCXA 3BM7A 2V6AA 2FPHX 2XCAA 3ZO7A 4Q8EA 5DG8A 3BN7A 3FRYA 1VLOA 5HP1A 4MAKA 2P9EA 3P6YC 1RBAA 1N34F 3RBZA 1RAFB 4ZJLA 5F9LA 5L39A 3WQPA 4EWTA 2EC2A 4R0JA 3MPDA 4AYBD 3RB6A 3E3XA 3OHAA 2HWTA 2CRLA 2YKMA 4UZBA 4C8YA 1RWWB 4YP3A 4ZVHA 3V81A 2V8DA 4ZVEA 1HNWF 3PACA 4MFBB 3N6MA 4OZ0A 3CNQP 4G1IA 3W63A 4AL7A 3PHEA 2GW8A 2UU9F 5AT1B 3BH6B 1S7IA 3CO0P 1VQMS 4FNHA 2NYIA 4OL8A 3FRZA 5GAHI 2VKRA 4OYXA 1S72S 2DNZA 4MIBA 4J9UE 2NUHA 1V3ZA 3NRBA 1NSQA 1XQIA 2LQBA 4EYHB 1KOHA 3FQKA 4I2QB 2N82B 2BKNA 3G6XA 4B3TJ 1NJIT 2EC0A 2RS2A 3QFHA 2O67A 3HFVA 1XK8A 1AUDA 1F2GA 1GTEA 2F40A 1GH8A 3G6VA 1CJKA 1DURA 1RT4B 3OL7A 2DH7A 5CA5A 1XNQF 1XIQA 4ELUA 3KJVA 1NK5A 5G4DA 2W2NP 2LQ9A 1RT6B 2YWEA 3VCDA 2C42A 3FCVA 1UCNA 3QAEA 3GFZA 4ZPTR 1QVGR 1M5SA 2BR0A 2XO7A 4USUA 2IRUA 2LXUA 4F7VA 1ZM2A 3GV7B 2H5EA 4CO4A 5DQIA 4DX8H 3ZTPA 3OD2A 3C2PA 4CQ1A 3C3LA 2YWGA 1QAJA 1Y0HA 1KVIA 2EFVA 1MMLA 2B4PA 4CNZA 2ZWPA 4J9RA 2NREA 1RU1A 2ZZTA 3DKDA 3IRXB 1KWMA 3AD9C 1N5SA 1YJVA 2RHQB 2AD9A 3C6UA 5KFLA 1RAEB 3PZPA 4MYUA 5HQMA 3R8YA 2ZH7A 1GMWD 2A6MA 3DOKB 2Y1RI 3MM9B 2WONB 4A8FA 3MM7A 5IQ6A 4E98A 1T7PA 3FVYA 1D8ZA 2QN6B 1U6ZA 4NEYA 1WJ9A 3QAUA 2NS1B 3CDUA 2QA2A 1VIOA 2GGPB 3MD3A 1R0AB 3GSDA 3M7VA 4CLYA 4OZ2A 3RBXA 3MMAA 4A47A 3Q24A 1MMDA 3QGHA 3H0PA 3KLFB 2HMIA 4PXEA 5HBMB 2JSXA 3KHHA 4S0MA 1HL6A 2Y0SD 3SYZA 3DI6B 1IKXB 2GMJA 2DCLA 4QW9A 1BLUA 1HD1A 2OPRA 1SIWB 1OY8A 4LRBA 2VDHA 1BHNA 4P7VA 3EZ5A 2M4MA 1MWZA 4RNFA 4IFVB 1ZTTA 4EMDA 1N6QB 2PI4A 1YX2A 2UXBF 2E7WA 5KFAA 1RE1B 1UEVA 1N32F 5LL6d 1WKKA 2EKNA 1QE1A 4ED2A 4BWMA 4QOTA 3P4UB 5B09A 2ZDOA 1F3VA 4KKOA 4K5SA 3JSRA 3SDEA 1X0FA 2HWHA 4FXVA 2ERRA 3RR7A 1XR6A 1EZZB 4ZPVR 3TJ8A 3FJ2A 2B8PA 2JLGA 2MQMA 3D1QA 4LSLB 1KVKA 3BN4A 3Q8RB 2RDIA 4C3KA 2Q43A 4ECVA 1F0XA 1VQ8S 4NYOA 1NPKA 2PSZA 3HXMA 4URGA 2B7CB 3QT5A 4QR1A 2VBXA 4QWDA 2W9BA 4FF1A 2RNEA 3DNCA 2MZJA 3KK3B 1JLGA 2R4FA 2HZCA 2XHWA 3G9CA 4CT9A 2GVDB 1BGXT 1VQ5S 5LSOA 3C46A 4RPFA 3VGSA 3KLVA 1S79A 1U1LA 2HNYA 4ICLB 3L09A 2A0FB 3BH7B 2C2DA 4OZLA 1QJHA 2V2VA 3ZC4A 1TUWA 1IBLJ 4F25A 4FP9A 3CXCR 3M30B 1W25A 2OSRA 4LR8A 1N8RT 1KFDA 2DR5A 3J80Y 4GMKA 4RLEA 3T1HJ 1T03B 2CQGA 2KYXA 1M5VC 3QZ7A 4LUBA 2XS2A 3T41A 2XY6A 4WFBQ 2ATCB 2D7SA 3IG1A 4YHHF 1L3KA 3D6FB 4PG6A 5KFYA 4PWDA 1FA0A 2VKZG 3QSIA 1LW0A 3B8HA 1IVZA 2UUWA 4CM2A 3FZBA 1ACMB 1U2CA 3T1YJ 2BYCA 2UUAJ 2IY5B 2L9WA 4ZDNA 2VB6A 1S4EA 1GX5A 2XTJP 3LP1B 2LCWA 4FYXB 2AYBA 3OR2B 1B0PA 1FRKA 2IM0A 2FC9A 1PIEA 5D0RA 1FX2A 4CCHA 1X0PA 1LWCA 5T7LB 6FDRA 2VF3A 1WKLA 2FZCB 2VPZB 3Q86A 2IM3A 2CPYA 5KG3A 4HEA9 1OO0B 4R5PA 1KP6A 1ZM4A 2FD2A 3FEZA 5KFXA 4L76A 4IFYA 1V5IB 3P96A 2YNIA 2BE7D 5EN1A 2RE1A 3LP2A 1S6QA 1Q4RA 3MZIA 2W8KA 3DLGA 2YPZA 3KDNA 5BYQA 2ILZA 3DRPA 2MZQA 2Y0BB 2PEBA 2CYYA 3QYYA 1VBYA 1UW4A 2HHPA 4PYAA 2MEWA 2DB1A 2XSFA 1N5VA 3NGSA 2LQJA 2FGOA 2HK3A 4JYAF 4OIXA 4FF3A 3M9MB 4ILMA 4K4UA 1JMTA 4I67A 1FJGF 2J7UA 5J2NA 4QIGA 4MK7A 1HNXF 1T8EA 1SUQB 3US5A 4M5MA 1K47A 2CQIA 2E9ZA 4YOEA 3MGJA 3J81Y 1WOSA 2ACYA 3TO8A 4TLQA 3PEJA 1K1QA 4KPCA 1HLWA 4OJGA 2RU3A 5A0YB 1YRTA 2DNKA 3U7JA 1OSCA 1QAXA 4OYWA 1S59A 2A10A 1RADB 3WDOA 5HO4A 2MKJA 4Q5VA 2ADCA 4B02A 3GP9A 1B4SA 4OI2A 2PIIA 1FERA 1Q5VA 5E2QA 3DRSA 1E6VA 5E41A 4BHQA 3KYLA 4C3MA 2EBGA 4DL0C 5D77A 5A76A 1T9UA 2KL8A 5HL7Q 2UXCF 5J1EA 5IT9U 2RF2A 2OSQA 3GIIA 2E1RA 2H3EB 2J8SA 1NUEA 1BC6A 4RNHA 4AE5A 5H9FJ 2AIRB 3AXMA 2LECA 4ETXA 3NNCA 3AAWB 4RUHA 2HAFA 5CQGA 4B3RF 5GMEA 3VGUA 1NXIA 1FTRA 3H2UB 5F8MA 4DBQA 1UMJA 1EARA 4O4RA 2V4RA 4C7QA 4RBVA 2BUNA 3OXLA 1OY9A 1RTHA 3PYEA 2Z56B 1GMWA 1EB0A 4RNNA 3MUTP 1YIJS 5KFOA 5KOWA 4AT1B 4OI4A 1DARA 4JI8F 3IWXA 5K8NA 3LPEA 1HNIA 4RL1A 1F9HA 3FBFA 4O4GB 4C97A 2GHPA 4JUZA 1YLXA 2G0CA 4LBIA 2QEXS 2FVRA 2IJRA 4NLPA 2CIMA 3MM5A 6FD1A 4KJIA 1JLCB 4PG5A 4IDKA 1TKXA 2RQ4A 1AT1B 1NK6A 2OAUA 1WACA 4Q0BA 3W64A 1NK4A 1S76D 2NPIA 3MPWA 2OGUA 2YNHA 4EUVA 1YITS 2J6TA 1B0VA 4UUWA 3D0GE 3EDRB 2IM1A 1IBKJ 4ZVTB 4Y2MA 4LJMA 1N5YA 3TVYA 1TQLA 2RT3A 2CADA 3PR4A 4RKUC 1RHRB 4PRFA 3DGVA 2EBEA 1VQYA 3CCZA 4NCBA 2SXLA 4DFMA 2M5YA 1RT2A 4PG8A 1F5BA 3FSXA 2KO1A 4CO5A 9RUBA 5KFCA 2HURA 3R6LB 1RUSA 5KFUA 4TQSA 2I5JB 3S8SA 2I9SA 2B4VA 3GIKA 4OYBA 2H1YA 3K59A 3UPFA 4EK2A 3CO9A 1EKSA 2XGPA 1RT7A 3TVZA 3D28A 3UO0A 2GX8A 2F8MA 3JB9k 4CLWA 1LW2A 3TAPA 1WC4A 2VG6B 2E5IA 2LDIA 3HVTB 2C3YA 3R2DJ 2W7AA 5A2QY 1RABB 1LXNA 1X8DA 1IKYA 3K5NA 5GMDA 1S1XB 1DBDA 4HKQA 3R5JB 4YB1P 2C22A 4I64A 3HP6A 1KNZA 1KHVA 5HK4A 3IRWP 2MLZA 3FCWA 3OFFA 3A12A 2XMUA 2BQUA 3PRBA 4OQJA 4M5DA 3DRRB 5AE3A 1FNOA 2JHEA 1S1TB 4LMZA 4X4OA 3FUYA 4NMXA 3R6GB 3BO3A 3I5AA 1GT8A 5D4OA 3B82A 3DXBA 5AXMA 3FFIB 1VRTA 1PYTA 1D9AA 3KG0A 2WOMB 2A18A 1N34J 3EM1A 1FDNA 4ZPBA 4HI2A 4AFFA 5JMNA 4PPDA 1FKOA 4M5LA 4DV4F 2CZ4A 3L7UA 1HNWJ 3A8KA 3LF0A 4MJKA 4KSEB 2DGXA 1BY9A 3WC2A 2UU9J 4PQAA 2IVFB 4RWWA 4YS2A 1JLAB 2HAIA 3B78A 2DVIA 2MKHA 2KU7A 3IBFB 1T02A 2JEFA 4X4SA 3ZZOA 4JI4F 1BWVA 3NMAA 3M8RA 5K9FA 2AT1B 2OEJA 2YWFA 2X1BA 1M5PC 5IQQA 3I4PA 4Q8FA 5HLFA 2ZVIA 3IS9A 3F73A 4A8KA 2J0QD 2YX7A 1K73T 1SJ1A 1XR5A 4FYYB 1HR0F 4WZQA 1U48A 2DNLA 2W2MP 5IC6B 2BANB 3OVAA 1KN6A 2XWXA 2JX2A 1XNQJ 2XCPA 2CQ4A 4K4VA 2WVFA 2MTLA 2OPSB 1VHFA 2VBWA 3FBBA 4PAAA 2YY3A 1VISA 2V8HA 1YKWA 4PYDA 2ZC3A 1GMVA 1GMUA 4KT0C 3E01A 4O0IA 1N36F 1NDKA 1XN9A 2KVQE 4U67Q 4QBUA 1GTHA 1C1BA 1RWKB 4UY8T 4H4KA 2C1EB 1SI9A 3JSMA 4AL5A 3M32A 4F2SA 3D6TB 3N9UC 2ROPA 5CCMA 2WAQD 2QC3A 4ER8A 5IM0A 4LSNB 3FKBA 3C16A 3KMQA 5HVHA 5CZVA 3J7Z5 3MOJB 4UOHA 4DJBA 2RDDA 2DO0A 4URQU 3QJJA 2IAJB 1WC5A 2AYMA 1G3OA 5F8JA 5B0GA 5KFMA 1UVMA 1M90T 3JS9A 4CO1A 3GV8B 4B3MF 4J37A 1T05B 3NY0A 1DTQA 3SSRA 3ZFVA 1SKRA 2DGVA 1AB8A 4DV1F 1R8AA 3M6VA 3DOLA 1HWLA 2ZE2A 2KG0A 3R5GA 1AA1B 3IGVA 1VQKS 2FJXA 1ULRA 4P2XA 2G2YA 1NHVA 2AX1A 4HI1A 2XBPA 1VDHA 4GKJF 2VA3A 3PV8A 3CDWA 1I51B 5DRKA 1RTJA 2UXBJ 3W2VB 1S12A 2D74B 5EDWA 1IKWB 2A3JA 2Q79A 4CLTA 1N32J 4L72B 5ETRA 4CZCA 4RW9B 1I1GA 4H4MB 5DS7A 2W24A 4HLBA 4DSJA 3QATA 1REVB 4NA3A 3NGDA 2R7UA 2PA3A 2RKIB 3GG1A 3QT7A 3D68A 3DOMB 4JI5F 2ZJQQ 1EP4A 4ES1A 3G82A 3Q2SC 2RVJA 1UPPA 2BVZA 3BSNA 3G96A 2EVZA 3MECB 4ZP8A 1VS3A 4PPZA 2ZH2A 4B3OB 2GHWA 2CWXA 3KKFA 4KRWA 2KRRA 4KHRA 2IA0A 2X7IA 4QU7A 2ASYA 2DGTA 1NSAA 4OZ3A 1JLQA 2MMYA 2DJWA 1S48A 3T5JA 1RLDA 3T9ZA 3CC7S 1XEZA 2MB0B 1C0UB 4E2FB 4USWA 3KJNB 3HK2A 3QJLA 5J2MA 2KXHA 3NWRA 5E3PA 5FLXY 2D9PA 1VRUA 4FXWA 4K4ZA 4WE1B 2I1RA 2Q66A 2W7PA 5CYQA 5G0RA 3H98A 2BM0A 1CJTB 3OW2R 2ZBIA 1PJ6A 3I5BA 4J9SA 1FHTA 2K1RA 3KLGA 2KKHA 4ZP6A 1RISA 2B4OA 1GAOA 3FNNA 4CYUB 1FT8A 1UZDA 3NOGA 4UW2A 3MUVP 5E7OB 1RT3B 1T95A 3AD7C 2MJUA 1XERA 4X4VA 4ILLA 1UWAA 3CULA 2BM1A 3F56A 3UN2A 4YHHJ 4BDPA 3MM6A 1UWBA 1NCLA 2YVSA 2QYGA 2Z8QA 4NA1A 3PX6A 1U1RA 3UNGC 2MGZB 1YRXA 3HHNB 3R5DA 2V5HG 3H2LA 4TXSA 1IJFB 2DNHA 5E3AA 4OZJA 1H0HB 2EK1A 1LFWA 2EG1A 3BPDA 3KK1A 3HULA 4C11A 1U0HA 2DH8A 3UCUP 3KUHA 4QWAA 1YZ7A 3BF4A 3KK2B 2VG7B 5KT3A 1WI6A 5J1NA 3KHLA 1MROB 2LDYA 1HQUA 1O6XA 2V2QA 2NSBA 2A2CA 2I38A 2R3VA 4QR2A 2CPIA 4F0HA 1WTBA 3VZHA 4C9DA 3SCJE 3BSCA 2AYEA 3AA8A 2OPQA 4ZVUB 5K8MA 5CYMA 2G1HA 1VQPS 4DV2F 4DL3A 1RP5A 3D67A 1ROFA 1K44A 5A8RB 3BO2A 4IR1A 3PR5B 4N5SA 3NGTA 3DN9A 4LF1A 1S1VA 1SB6A 3CF5Q 5D4LA 1UA1A 1OS5A 1FKPA 5B0BA 4IKAA 1N4LA 2MLXA 4JYAJ 3FCHA 3IAM9 5ETLA 3CJKB 2EEYA 1CG2A 1FJGJ 2AZ3A 3PYGA 3TX8A 5C7PA 5KG5A 1KQFB 3RJMB 2ZHBA 2GNKA 2AEFA 4QJVA 1JJCB 1HNXJ 1VQNS 3RAMA 1XWLA 1N52B 4KAIA 4P75A 2BJDA 4LFCF 1WDDA 2RIJA 3CE8A 3DC2A 3LAKA 3ENVA 2QTWA 3BGOP 3BQ0A 2WVEA 1CJUA 4Y0FA 2EFPA 4USJC 4R0EA 1U09A 3A3OB 1N0UA 2FLLA 4NXNF 1X60A 1HI8A 4Q7AA 2CJKA 4ZS6A 1LK7A 4GC6A 4LIRA 1WD6A 3NAHA 3D7SB 1S9GB 2LU1A 2DITA 1PBUA 1XTZA 4NASA 2AF6A 2XHCA 3CD7A 2FJDB 1X7VA 2BRLA 3T5LA 3BKUA 1NZAA 4QU6A 4DUZF 2UXCJ 3L4BC 3OTOF 1JLBB 2GO9A 1LWFB 4ZP9A 1JLEB 1ZZNA 1RWPB 1X4AA 4DFKA 1JLFB 2C3UA 2JJ4D 3ZZPA 1M5OC 2PEHA 1CLFA 2Q3PA 2VONA 1FDAA 1QUPA 4U7UD 1PYOB 4NLYA 2YX1A 3CC4S 1ZA1B 4FPRA 4B3RJ 3OBIA 2HHHF 3LH2S 2OTLS 3CJ3A 3C6TB 1VQ7S 4PR6A 1XNRF 4PG7A 2XMTA 3DLEA 2B5JB 4F4WA 2V68A 4V19X 2HHVA 5DLFA 3C8YA 3B4DA 1FFGB 3HSGA 4D3GA 3HJFA 1NPRA 1RT1A 3UI3A 4NOHA 2QSFA 3D9BA 1RTDB 2UUCF 2J6SA 1R27B 2IC3A 4JI8J 4U8VA 5HROA 1NH8A 2VC1A 3WX4A 1UZHA 3RB3A 3PFEA 2YX4A 4TY8A 1C0TA 4DV5F 1X4HA 5ETNA 1D9DA 1YBTA 1ZAWA 3VAJA 2CQ1A 3M2UB 3AD8C 1KVJA 3N5BA 5M2RA 3R3TA 4WIQA 1L3SA 4OYIA 1KC8T 4DN0A 3UW1A 3CJSA 3OTCA 1Y7PA 3EE3A 3L95X 3CCJS 3AOCA 3MR3A 4LBHA 1RAJA 4IG3A 3GE9A 4QQBA 2NYHA 3DRYA 3CCQS 3PFOA 3TEHB 4DQRA 2VJUA 3K8WA 4TU7A 3IN5A 2ZITA 4UZCA 1TV6B 4YMEA 1NRKA 2RRAA 1TAUA 4MT1A 4ED4A 4IH6A 3M4XA 3NGRA 4QYRA 1NLKL 4ZP7A 2CPXA 4WP3A 2PI5A 1NB2A 4PQUA 1TELA 5I3UB 2W25A 1TK8A 4DL7A 2OI2A 2MHNA 2J8AA 4NYZA 2VHGA 4HDGA 2KH9A 1VC6A 1JQGA 3DRXA 3OTEA 1RAIB 1RA7A 4FYDA 4HTJA 2AEMA 1CULB 1W26A 4ID5A 4DCPB 3C19A 3A8IA 2MQQA 4HT5A 3OUYA 2VBYA 3JYTB 3HX9A 3IWNC 1SQFA 2JNJA 3QO9A 1J5OA 1EHWA 3GPAA 1Q1KA 3W9IA 4OX7A 5ETVA 3LAMA 2FJAB 2AV5A 3PTWA 5L8RC 3BSAA 3V4MA 4LQ3A 1SQEA 4KGZB 1IM6A 5ITHA 1FK9B 4IO1A 2CG8A 4F02A 3M8WA 3J80U 1P1TA 2LA6A 2Z30B 2X1FA 4XDCA 3W62A 1X4GA 2XZTB 4V19J 3MURP 4DZ6A 3H42A 3Q89A 1M1HA 3DM2A 5E33A 2W1BA 2FJBB 2GS8A 3HJVA 2C28A 3PKYA 1Y5NB 2FJEB 4F4ZA 2XMVA 3GWCA 3OL6A 3BEGB 1U8SA 1WHWA 4BLGA 2Z2LA 1PSDA 4WBFA 4F4XA 8ATCB 4QW8A 1GXUA 4USVA 3N6LA 4ANDA 2HLTA 3AB2B 1NKBA 5LT5A 2GAHC 4DV4J 4I2QA 3VGVA 3D0HE 3MD1A 2WW8A 2KFZA 2BE2B 1URRA 2R2TA 2B56A 3RRKA 4L73A 4ZLLA 3Q8VA 1RT4A 2RB7A 4JV1A 3R5BA 4ZA1A 5IXUA 3P5BP 4H4KC 2F8HA 2V2ZA 4B9SA 4JI4J 2KXNB 1EX8A 2VU5A 2J0SD 1QLNA 1S9EA 1RT6A 2HS4A 4KO0B 3EPIA 3PY8A 1YSJA 2GQQA 3QLHB 4J9VA 4YFUA 3KLIA 1Q8KA 2UV8A 5DM6Q 4PWUA 4Z2XA 5FJ4A 1R0BG 5KFFA 3MEDA 3WBZA 2DR8A 1LXJA 2HQGA 3VVUA 5B0DA 3GIJA 2XMKA 5ETMA 1HR0J 1HNZF 1VQ6S 4RW8A 3BBCA 5RUBA 4PABA 3CW2C 3DU5A 3VTIA 1W2BR 2KZMA 1Q81T 2H5IB 3HD1A 2L3MA 1HWKA 1C4AA 3IR6B 3OSPA 3J81U 3X3UA 1N36J 2F3JA 2L41A 3DOKA 3M8PA 4WTYA 4WJBA 2YKPA 4QR0A 1T9XA 2CNOB 1RT5A 3VGTA 2GV1A 3TYTA 4M8LA 3DLBA 4Y34A 4OZNA 5B0FA 1P9QC 4MKVA 2Y9HA 3MTJA 1SIZA 3GCXP 3CD0A 1J2VA 3KLFA 2HQCA 4HHHA 3LP0A 4RZRA 1S6PB 2O1PA 4WU3A 2K3KA 1NK7A 3IR7B 3PEHA 3QIPB 3A1YG 2ZUGA 1IWGA 1EQ0A 4LRAA 5DG7A 3DDNA 1NKCA 1WTFA 1RACB 2DR9A 4B3MJ 2ABYA 4I7FA 1YI2S 3D54A 1H6KX 3RTVA 2X1GA 4DV1J 2WTFA 1FWPA 2MKYA 2YKMB 2BQ3A 2XLKA 4DWIA 4IOBA 3FBCA 4FYWB 2PMWA 1VJQA 2GQCA 1MG7A 4KYZA 2K7JA 3SBMA 3H5XA 3P3DA 4GKJJ 1NHKL 2J0XA 4QWCA 4TU8A 3D1OA 5KFJA 2PFDA 1MU2A 2XZDB 2LEBA 3H4DA 4LSLA 3I82A 1HHTP 2MZRA 1NDLA 1V3SA 5D3GB 2RRBA 4URSA 4DLGA 3ITHB 5K8PA 2E1AA 4LRFA 3KHGA 3CGIA 3PJ9A 3K0JA 4TY9A 2R7RA 2JDJA 3QNWB 3SQGA 4JI5J 4CO3A 1UVJA 3N6NA 2R8HA 3CCTA 1R8BA 2RILA 4DR1F 4F3MA 3GIMA 4CLFA 1H38A 3I56S 4ICLA 1CJKB 5LJ3Y 2CQPA 3O3LA 4CM0A 3RBDA 1N54B 5HI7A 1B64A 3L9ZA 1RAOA 4WXOA 4OX6A 3KJVB 4ZN1A 3W2WB 4EO8A 2DR7A 2HVIA 3CIMA 4KV8A 2PMHA 1YJRA 2AYGA 2IYIA 2KJWA 1TKZB 5H9FK 3JAMU 2XO6A 3QWPA 2W9CB 3ETMA 1IR2A 2PE8A 4YR0A 5KFQA 4WF9Q 2QO3A 2Y1IA 3I55S 3CDEA 3PX4A 2CKWA 3R1HA 4IG0A 3LWMA 2CWKA 2FB0A 1FRXA 4JI6F 4NLRA 2V2KA 3C6UB 1MWYA 1LFPA 3OR2A 4DX6A 4FZVA 1SCJB 2WBMA 3DLKA 2YKQA 3MM7B 4NXMF 3G6YA 3OVBA 3TVKA 3EVWA 2BJ9A 2DNPA 5ETSA 3AY0A 3D4JA 4KHMA 1B0TA 1C1CA 2O66A 2XGQA 2FVCA 3AOAA 2YWKA 3GJSB 1YGYA 1O8BA 4RJVA 2M52A 3MFHA 4JB8B 2LXFA 2HMIB 4ZVGA 2JEGA 1OSDA 2LKZA 4J91A 1U45A 1F6TA 1IKVA 5DG9A 2HLUA 4WK3A 2FZKB 1WKJA 3NGUA 3LANA 2V67A 1KR4A 1WORA 4DS5A 2HHUA 2UV8G 1O0PA 3A13A 3BJYA 4ZVQB 4DV6F 4EBDA 3CDBA 2F8EX 2ZH3A 3UQSA 2GIQA 2ZH4A 4LFBF 4OHXA 3BREA 1NNDA 1U02A 2J9CA 3TZZA 4I1TA 4DV2J 2V63A 3LGNA 1HKAA 3T6BA 4K5RA 4ANCA 1SUQA 2K06A 4Y2IA 4CTAB 3SDEB 1APSA 3A4TA 2B7BB 4FKXA 2VBZA 4KGKA 2A2DA 1JWWA 3IA0A 4USKA 3W7BA 4K2JA 5A0YA 5DGBA 2WB1D 1FDBA 3GB0A 1SVDA 4NPOA 1U2FA 4ZVOB 2V4JA 2W9BB 1OYDA 4K7QA 2R7QA 2FQQB 1HARA 2ZFHA 1JLGB 3CCWA 4LFCJ 1RI7A 2PMZD 1S57A 3HFZB 4ECRA 1SKWA 4DR4F 2CZ9A 2HNYB 1CS4A 2RQKA 4NMLA 4CLSA 4KQZA 1HYSB 4KGMA 1AUSL 1NZ8A 3CCES 4NXNJ 2KVIA 4KIAA 1QAIA 1JNZB 5BXIA 1YWXA 1U25A 2V8PA 1JJHA 2GMHA 2R8GA 3W8GA 1HHQA 4DV7F 1NK8A 4WKRA 1U1OA 2MDAA 4C8OA 4ZPCA 1URNA 3FEXB 4DUZJ 1UTAA 1TP7A 5L9XA 3KLEA 3OTOJ 3DGPA 4IH5A 1VFJA 4DG1B 3RRHA 1F2HA 3IG1B 1WSVA 1TAQA 1RHJB 4PWDB 3D66A 3HFKA 4ED3A 2HHHJ 1T11A 4DLEA 1IBMF 4BS2A 1XNRJ 2HFZA 4OMFG 3Q8QB 2CJ9A 2EFQA 1YJ9S 3UWTA 1HBOB 4DR6F 3JXOA 1LWEA 3J7AN 2BRKA 3UDLA 2E5LF 2DT9A 7FD1A 4AUKA 4QPXA 3R97A 4H4OA 2C3PA 2PN6A 1FE4A 2UUCJ 5HVGA 1LWCB 1FEHA 2ZHAA 4ZOSA 4IO9Q 4DV5J 2AGOA 4UF4A 3F41A 5D0EA 3PW7A 3M2VA 3G6ES 1IR0A 1KTQA 4R5PB 5AXLA 4OYOA 4CH1A 3SI8A 3M8YA 4RU9A 3H4BA 2NZ4A 1UVNA 2HBYB 1HBNA 5JVGQ 4IFYB 3ONQA 2BEFA 1U49A 2KXFA 3NG8A 2I5JA 4EI2A 5D0HA 5IWAF 1QAYA 2DH9A 2QLBB 1JXEA 2YKAA 3MWBA 3IC1A 2DBBA 2JRSA 3EZUA 3LP2B 3I5CA 3MI7X 3DRPB 3M1VB 2DKOB 1S49A 4NZ6A 2X51A 3LA0A 5C24B 4WXWA 2VG6A 3M2RA 1JXVA 2RQCA 2QA4S 1SJQA 3FDSA 1PBAA 3K5MA 4KH0B 1S1XA 5J2NB 4WPAA 4JI2F 4FYVB 2GVZB 5A8WA 4DQIA 2N7CA 2E5JA 4OYPA 2DGSA 3MEEA 3GFYA 3A8EA 1SL1A 3POTB 2CXEA 3TA2A 2JFKA 1T9YA 3HHLD 4I2PA 3CCLS 5J2QA 3H5YA 3KG4A 1X5TA 2C3OA 3OXFA 4C2MA 1FVQA 2XB2D 1SV5A 1OQ6A 5MAOA 4DEZA 1NJWA 3VAKA 4TVAB
chains in the Genus database with same CATH topology
4U7UD 3QRPA 5H9EK 2Y9HA 4QYZK 3QRQA 5H9FK 5CD4A 2Y8YA 3QRRA 2Y8WA 1WJ9A 4DZDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U7U D;  3QRP A;  5H9E K;  2Y9H A;  4QYZ K;  3QRQ A;  5H9F K;  5CD4 A;  2Y8Y A;  3QRR A;  2Y8W A;  1WJ9 A;  4DZD A; 
#chains in the Genus database with same CATH topology
 1CBK A;  5C2G A;  4ELV A;  4YEA A;  1V5V A;  1S9F A;  4LF4 F;  3FFI A;  2QMW A;  1Q16 B;  2H9Z A;  1DFD A;  3DRS B;  1E6V B;  4ANE A;  5ETK A;  3MMJ A;  1RBO B;  3LWL A;  3ISN C;  1J5E F;  1SJ3 P;  5J1E B;  4U6P A;  2RF2 B;  4DX5 A;  3JQK A;  3P5T L;  2DEJ A;  1TU0 B;  2AGQ A;  5H1S V;  3ISZ A;  1BMQ B;  1CC8 A;  2QL9 B;  1KS2 A;  2HQ3 A;  4C8Z A;  4KR0 B;  5DDP C;  1LK5 A;  2QRR A;  2FC8 A;  3NLC A;  1TL4 A;  1JLA A;  2C2M B;  1U24 A;  1D3W A;  3RRG A;  1I94 F;  4BWJ A;  2F65 A;  4Y3C A;  3ILL A;  1RTH B;  1F5A A;  2PGC A;  4UT4 A;  3MPV A;  2XS7 A;  5BR8 F;  1NEE A;  4X4Q A;  3JSB A;  4R8U B;  1B7Y B;  5C2C A;  1SC1 B;  3H90 A;  2DXF A;  4TN2 A;  1HNI B;  1B99 A;  2OJ3 A;  3V4I A;  4DSK A;  3UDE A;  2RDJ A;  1GXL A;  3GIR A;  1X9W A;  1Q0N A;  2XG8 A;  1ZOT A;  4MTP A;  4P9S A;  4IDK B;  4B3S F;  3CCU S;  5KFD A;  4DL4 A;  2VH7 A;  3WZ0 A;  2GAG C;  4Q0B B;  4F4K A;  3E8O A;  1MNE A;  4NRT A;  2YNH B;  4YDX A;  1TL1 A;  5HMY A;  4CDI A;  3RYL A;  3FEY B;  1A7G E;  3I96 A;  2VG5 A;  2VPW B;  2XSJ A;  1N5Y B;  1PAE X;  1WF0 A;  1T9W A;  4DU7 A;  1HNZ J;  2J7K A;  2E1C A;  1NDP A;  4I6W A;  5L1L A;  2ACM A;  3MEG B;  3C14 B;  1S0N A;  1RT2 B;  4KC5 A;  1WEZ A;  3M05 A;  3U27 A;  4LR7 A;  2XLI A;  3P49 B;  3PX0 A;  2QSW A;  2OH2 A;  3SCL E;  4WKY A;  4ZPA A;  4ELT A;  4OI3 A;  4ITS A;  5M2U A;  3PNI A;  3FSI A;  3IM9 A;  4QIE A;  4YR2 A;  1KDN A;  3W9H A;  1X4D A;  1ZAV A;  1X4B A;  2I2Y A;  5D4N A;  3D6H B;  1LW2 B;  2AX0 A;  1G6B A;  3CB4 A;  3DDI A;  1P8G A;  1AZS A;  3EGZ A;  1Y4Z B;  5C42 A;  2IAJ A;  2EWH A;  1KON A;  3R5C A;  2BQR A;  2RRN A;  3KDO A;  2ZOF A;  1T05 A;  2I8E A;  2F4V F;  1DZ5 A;  3JTP A;  4N77 A;  3MAA A;  4N7T A;  1U1Q A;  4K4T A;  2QG9 B;  5HMW A;  2V9W A;  2B3T B;  2ZJP Q;  3NGK A;  1XMQ F;  2V4Q A;  4M5D B;  4ZN3 A;  3SZ2 A;  3PDN A;  5JUM A;  4G1Q B;  3JQM A;  3KG1 A;  1CVJ A;  3NCR A;  1EQM A;  4JV0 A;  2XQC A;  3AQO A;  2N3L A;  5IS2 A;  4A8Y A;  1Q95 G;  2P6T A;  3W2V A;  4OX9 F;  1A0O B;  3CSK A;  1YK9 A;  1EIY B;  3BR9 A;  3G4S S;  2H5J B;  4MK9 A;  2DXE A;  2BKO A;  5KFV A;  5J2P A;  2CNL B;  1FKO B;  1Y11 A;  2B4U A;  2NZC A;  2HFU A;  1F5C A;  3P45 B;  3TA1 A;  4FPI A;  1UVI A;  4NYP A;  3M8Z A;  1SL2 A;  4F50 A;  1PAU B;  2DIV A;  2XNR A;  1W7W A;  2W7O A;  2XYH B;  5B0A A;  1QDU B;  1BD6 A;  1SJR A;  1VJW A;  5C25 B;  4V1A k;  5LSR A;  1RJJ A;  3H2V E;  4DPY A;  3RW6 A;  3M8Q B;  1TTH B;  1UJ6 A;  3LO3 A;  5AXN A;  1X31 C;  4TLR A;  2B6A A;  5HLF B;  1E6Y B;  3IS9 B;  5EWG A;  4NA2 A;  5CAA A;  2XM3 A;  2HNZ A;  1FNM A;  4DR1 J;  4WCE Q;  2J9D A;  3UD4 P;  1HNV A;  4WFX A;  5DM7 Q;  2ASJ A;  4WE1 A;  2PC6 A;  2R7W A;  3FGV A;  4IOA Q;  4W90 B;  2ZOG A;  3RAQ A;  4GVB B;  1S1W A;  2J6U A;  1CJT A;  1KKH A;  3IGN A;  3ZZZ A;  1JJ4 A;  2ILY A;  2D9O A;  5LJ5 Y;  4CYU A;  3HSJ A;  2DYA A;  4CNY A;  1YBU A;  2ALY B;  2Y8Y A;  1V9O A;  3KFW X;  2BAB A;  3DYA A;  3PYD A;  4MKY A;  3MR6 A;  4L3N A;  5DZ6 A;  2YXL A;  4ZCK A;  2R7O A;  1VC0 A;  2YKN A;  3W61 A;  5AJ3 F;  4J7C A;  1FO1 A;  5F8I A;  5M2P A;  1PC4 A;  1M1K T;  2DHH A;  2MGZ A;  4Y65 A;  2GML A;  3BSO A;  4NCG A;  3M32 B;  4ECZ A;  3BGR A;  3HHL A;  3BQ2 A;  4JI6 J;  4IR9 A;  5CD4 H;  4JI3 F;  2BJ3 A;  3HDS A;  1KLM A;  4ILR A;  2HVD A;  3V6H A;  2CA9 A;  2AJQ A;  1IBC B;  3ZZR A;  4CI0 B;  5DET A;  1ZA2 B;  4NXM J;  3B6B A;  2ZJR Q;  1UFL A;  2GIR A;  3AH6 A;  1WF2 A;  2RML A;  2DK2 A;  1JJ2 R;  3EUN A;  2OD4 A;  5H9E K;  2W9A A;  1Q8I A;  1SJ4 P;  2HHX A;  1V3R A;  3GQC A;  4RW7 A;  4YB6 A;  1DTQ B;  3FQL A;  4K0K J;  3ICL A;  3WX8 A;  5B08 A;  4TKT A;  4C8N A;  3R7B B;  4KFB A;  2WSC C;  1Q8B A;  4K4Y A;  3DOL B;  1U1K A;  2R2S A;  2ZE2 B;  1DY3 A;  4MKA A;  2CQC A;  4XK8 C;  1WHX A;  1UKU A;  2UXD F;  4PZV A;  4UTG A;  3W8P A;  3PKM A;  2WRM A;  2CG4 A;  1RTJ B;  2XEX A;  4DV6 J;  1RTI A;  2CPD A;  2Z2Z A;  4RW6 A;  5CCL A;  1YJ7 A;  2CPZ A;  4LFB J;  3TZX A;  3R2C J;  2VPY B;  3CJK A;  3TWZ A;  4FDF A;  2VFU A;  3W3S A;  3HKW A;  4OYM A;  2Y1L B;  1TMJ A;  1TL3 B;  1HWU A;  1D8Y A;  3K5P A;  2MKI A;  3TAN A;  1EP4 B;  3AXK A;  1O5J A;  3GYX B;  2N4D A;  3G82 B;  2QLJ B;  3I4H X;  4NI2 A;  4O23 A;  4I68 A;  3VQT A;  1QSL A;  5AXK A;  2KT5 A;  2XMM A;  3JTO A;  1WNE A;  5ETQ A;  4NLG A;  3WIV A;  4A8X A;  2YNG B;  2XNQ A;  1FJ7 A;  1H3D A;  3J7Z T;  2D3O R;  5KAK A;  1FWL A;  1RB0 A;  2DGU A;  1BQX A;  1S9G A;  1JLQ B;  3EGN A;  3DHW C;  4DUY F;  3OSN A;  4HHJ A;  2F63 A;  4C48 A;  4ZHR A;  5J2M B;  4DR4 J;  2OEK A;  4X62 F;  2V9K A;  3PIP Q;  2D3O 1;  2VFT A;  4DPU A;  5CYQ B;  5G0R B;  4M5I A;  1R8H A;  4CLU A;  4ES2 A;  2K1R B;  3KLG B;  4U8Y A;  1BQN A;  4GC7 A;  1R0C B;  4DV7 J;  4MK8 A;  2B0G A;  1X4F A;  2FVQ A;  4X4T A;  2H54 B;  3BKT A;  3G71 S;  4DPO A;  3BQ1 A;  2DY9 A;  5LMU F;  3QQC D;  2YH0 A;  2CVE A;  4GVL A;  3MM6 B;  1UWB B;  3CJ8 A;  1XJW B;  5HAT A;  4OV6 A;  5LSL A;  3Q22 A;  2JZ5 A;  2VD3 A;  4IRK A;  2CVI A;  2BJ7 A;  3H40 A;  5B0C A;  1IBM J;  3ILO A;  3ZNJ 1;  1UEU A;  3EXC X;  4K4S A;  2B9Y A;  1Q78 A;  4FXD A;  2DXD A;  5DZ7 A;  4ETZ A;  4DR6 J;  3BGL A;  5KFE A;  2E5L J;  1S1U A;  3BDP A;  4JI7 F;  4C11 B;  4LFA F;  3BYP A;  3CDA A;  2KTQ A;  5AE2 A;  3UDV A;  5KT4 A;  2G2O A;  2KDO A;  5KFH A;  3TUI C;  4RR5 A;  3VAG A;  1HQU B;  2V94 A;  1BQM B;  4Q2M A;  2B51 A;  2JVR A;  5DGA A;  3DLL Q;  3W1Y C;  4C0B A;  2YNF A;  2BXJ A;  5A6W A;  2MPU A;  2VC0 A;  3OLB A;  4EO6 A;  3CMQ A;  1YJU A;  2WVD A;  2OPQ B;  5KFZ A;  1T9V A;  5F8H A;  3QID A;  1WSR A;  2ZOM A;  1RWX B;  4CLL A;  5IWA J;  3W5X A;  3MPY A;  2N7Y A;  1H74 A;  2XZW A;  5ADZ A;  2FLP A;  1NKE A;  5F8G A;  3CJR A;  2LYV A;  1S1V B;  3MTK A;  3TQE A;  1XR7 A;  2PO4 A;  1S0M A;  2FHJ D;  2MLY A;  3CVK A;  2HFV A;  2VV5 A;  4AXJ A;  1TL7 A;  1RWN B;  4C8L A;  1SH3 A;  2J7W A;  4JI2 J;  3MOZ A;  4WZM A;  4DU8 A;  3CJQ A;  1KQK A;  4X4N A;  2WVC A;  3NS7 B;  2QX0 A;  3AA9 A;  2MQP A;  2QL7 B;  4NLQ A;  2N3O A;  2PT0 A;  1R6Y A;  1NPP A;  2FLO A;  4XPC A;  5D0G A;  1CJU B;  5ETP A;  4DPT A;  4IRC A;  1DQ8 A;  4X64 F;  2FY1 A;  2ZEJ A;  3H5S A;  3VAH A;  5IV3 A;  2EI5 A;  3F0N A;  3EIC A;  4KPY A;  4HAC B;  3TEG A;  1R89 A;  4ZVP B;  2VZ9 A;  2QJ3 A;  2LA4 A;  4CRJ A;  1TZ0 A;  4N56 A;  4LF4 J;  2RUS A;  1HA1 A;  3PHT A;  2YWW A;  4K2X A;  4O44 B;  4EEY A;  5F9N A;  1H72 C;  2AJF E;  2LP4 A;  2DGW A;  1J5E J;  3I0S A;  3QGP A;  1H7X A;  4LQ9 A;  3MXH P;  1ARO P;  3VAF A;  1R3N A;  1DTT B;  2W4C A;  2C2Z B;  3CCV S;  1LEO A;  3V2U C;  1WF1 A;  2JEJ A;  1UVK A;  2KM8 C;  2BJ1 A;  2MHE A;  1D1U A;  3NMR A;  3T5K A;  1I94 J;  1FTC A;  3DLE B;  1CQN A;  5IT0 A;  2HWI A;  4P2M A;  1TFY A;  4KHP F;  1P6T A;  2MSS A;  2CQ0 A;  2GJF A;  1RHQ B;  3D3B J;  1NJX A;  5L38 A;  5BR8 J;  5ETO A;  3ZTR A;  2E1M C;  3RAX A;  2FUG 9;  2ZD1 A;  1RT1 B;  2IA6 A;  4KO0 A;  2IJF A;  2C2R A;  2UVR A;  2HHQ A;  5ETT A;  4OHV A;  4DFJ A;  4A8M P;  2FYX A;  2X1A A;  5EWE A;  2IC3 B;  3OFH A;  1YJN S;  3EVM A;  1P1L A;  5HRO B;  3RR8 A;  3BR8 A;  3MCO A;  2R8I A;  4TY8 B;  1C0T B;  2CQH A;  3VWS A;  2HGL A;  3KLH B;  3HVR A;  2L9N A;  2ZDP A;  2QE5 A;  3W5Z A;  3SV3 A;  3HKZ D;  4GKK F;  2E7V A;  4B3S J;  1F1B B;  1NJY A;  2P9G A;  1Y9O A;  4ECY A;  4I69 A;  1QY7 A;  3NAI A;  1N33 F;  1S99 A;  3LQV A;  4IG3 B;  1WI8 A;  2HZA A;  4QCL A;  1FES A;  3M6U A;  2UZA A;  3J81 j;  3EGV A;  3SXL A;  2AJ1 A;  4YQW A;  1K9M T;  3AFG A;  1RTZ A;  2FHK A;  2Z2Y B;  3KTQ A;  2DRD A;  1KSP A;  3DXS X;  2MQN A;  1X9M A;  4QYZ J;  1ELO A;  4NCA A;  2BOP A;  1FJE B;  4P73 A;  5JXS A;  3OJS A;  1HBM A;  2WB4 A;  1F3F A;  3V6D A;  5F3Z A;  1BWE A;  4PQU B;  3HM9 A;  1GXT A;  3NP5 A;  4YR3 A;  1YG0 A;  4NLU A;  2MST A;  3K7R A;  2N4C A;  2K3I A;  2IRX A;  3IWL A;  3TNV A;  5KFK A;  3VZI A;  3IXQ A;  1R6V A;  1SQG A;  2NSC A;  2MQO A;  1KD1 T;  1X4E A;  3OJU A;  4ID5 B;  1CSJ A;  3OUY B;  3GON A;  4UST A;  3DLH A;  4J9K A;  5I3Q A;  1RLC L;  4DI6 A;  2PA8 D;  5DQH A;  1TKT B;  5HVF A;  2ASL A;  3HHE A;  2DRA A;  4DF4 A;  1J27 A;  4G3I A;  4DL2 A;  5EUH A;  2F9D A;  2ZH6 A;  4NWB A;  2F4V J;  1SXL A;  3THT A;  2OTJ S;  5KFS A;  4F4A A;  3PJX A;  2JFD A;  3HZE A;  4WWS A;  3N4W A;  4J9L A;  3PO5 A;  4F3Q A;  3I0R A;  1XMQ J;  1RDR A;  1NAQ A;  3ZZY A;  1WC1 A;  3DM2 B;  3GFX A;  3MMB A;  1JNR B;  1QUV A;  1OWX A;  1VR6 A;  4G65 A;  1UET A;  5CAB A;  4ZJQ A;  2A6O A;  3MCS A;  4Y2A A;  2YBV A;  5I42 A;  1KTV A;  4OX9 J;  4RNO A;  4P2S A;  2ZWO A;  1L3T A;  1RKI A;  1VC5 A;  1WG1 A;  5D3G A;  1JX4 A;  2LXI A;  4EU0 A;  3K5L A;  4X66 F;  2EK6 A;  2VOD A;  3ITH A;  3ELH A;  4Q44 A;  2LQ5 A;  2HBR B;  5KFT A;  1T3N A;  4LVN P;  1QM9 A;  2UVV A;  5AE1 A;  2P5V A;  1VRQ C;  1DQ9 A;  2HSE B;  3LAL A;  5DDO C;  1U1N A;  3D1H A;  3C66 A;  5B0E A;  4ED5 A;  2E29 A;  2ROG A;  2ZKU A;  5FD1 A;  1QTM A;  3PIO Q;  2VQE F;  1SH0 A;  2DRB A;  2ZUA A;  3I32 A;  4WFZ A;  1RK8 A;  1S9E B;  2CJA A;  3W2W A;  5A6P A;  2XS5 A;  4DSI A;  5GAD U;  2HPU A;  5K14 A;  5DQG A;  3HHL C;  2EG2 A;  4OI6 A;  3KLI B;  1G7C B;  1TKZ A;  4P71 A;  4PXC A;  1CJV A;  3MED B;  5FDL B;  3MM8 A;  5CH7 B;  3B54 A;  2W9C A;  3CJ2 A;  2AW0 A;  4RW8 B;  1VGY A;  4FVM A;  3BGU A;  3BB5 A;  2JLE A;  5HJY A;  2F4F A;  4WK1 A;  4PUO A;  4DL6 A;  1OPZ A;  3MMC A;  2AJ4 A;  3FSY A;  1S0V A;  1FJC A;  3K2Y A;  4F26 A;  2DGO A;  1HHS A;  4M5N A;  4LF7 F;  3EZO A;  4UOG A;  4MKB A;  4USI A;  4EZ6 A;  4PXB A;  5THW A;  4LSZ B;  4RBT A;  1SJF A;  1NME B;  4JOU A;  2XLJ A;  5LM7 E;  2FHJ A;  2IYG A;  3M8P B;  5AJ3 J;  1UPM B;  2MXY A;  3TJA A;  1RT5 B;  4DL5 A;  1F9F A;  1ZET A;  2KZZ A;  2RJZ A;  4ZVF A;  2ZM6 F;  4O3P A;  1DJ0 A;  1QSS A;  3QGI A;  1M5K C;  3SSQ A;  5HMX A;  3OT9 A;  1ICE B;  3CED A;  2OLW A;  1N48 A;  3CJ0 A;  1YBA A;  3PW0 A;  1FWK A;  4JI3 J;  1CQM A;  2C3M A;  4W4M A;  1VBX A;  3LP0 B;  2ZBR A;  3CC2 S;  1Q53 A;  1HPZ B;  3E51 A;  3TX0 A;  3HHD A;  3ILJ A;  4QWE A;  2RS8 A;  3OR1 A;  4C8K A;  1RWO B;  3MDF A;  1M5H A;  2DNM A;  5E5N A;  2G4B A;  1YVF A;  4Z7Y A;  2QLX A;  3QFW A;  4I7F B;  1MN9 A;  1IXK A;  1WWH A;  2LLZ A;  4CLZ A;  2J0W A;  1EAY C;  2M7S A;  4DR5 F;  3KUE A;  2AQ4 A;  5HJX A;  5L1K A;  3V5R A;  3HPO A;  3UVJ B;  2XC9 A;  1WUU A;  2CDR B;  3PO4 A;  1JXL A;  4JV5 F;  3SMZ A;  4WFY A;  4CTA A;  3N5F A;  1EET A;  1JKH A;  2UXD J;  1IWA A;  2W2O P;  1I3O B;  1VIX A;  2LFV A;  6AT1 B;  4U7C A;  2V34 A;  2ZNY A;  1HQE A;  4JI1 F;  1VMB A;  5GAG U;  1MU2 B;  4ZCI A;  1N5Q A;  4ZCM A;  4N41 A;  4KTQ A;  3KNG A;  1LWX A;  3KJQ B;  3O1L A;  1LOU A;  3V6K A;  2IFX A;  1QTN B;  1G1X A;  1S6O A;  2IBO A;  2M0G B;  3SQG B;  2Y8W A;  1U1M A;  1U0S A;  1M0S A;  1T94 A;  1L3U A;  3NBP A;  2BW2 A;  2CAJ A;  2HND B;  2CUY A;  5KFI A;  3M6X A;  3U1L A;  2HIQ A;  3SCI E;  3O6Q A;  4C0H A;  4J9O A;  1HYS A;  2WCX A;  1SH2 A;  4NX9 A;  4ZLJ A;  3Q8Y A;  3L7P A;  1IUJ A;  1WG4 A;  3CJ4 A;  2QIF A;  1HBU A;  2R7S A;  3BBF A;  5IV4 A;  4KV8 B;  4DUY J;  4K4X A;  5T41 A;  4PXD A;  2F7V A;  2Z4P A;  4DDF A;  4X62 J;  4WTO B;  4DG1 A;  4X4R A;  2HFS A;  1WC0 A;  3HHK A;  4DR2 F;  2KG1 A;  2IMW P;  1HWI A;  3DDK A;  3EMT A;  3Q0A A;  3O5T B;  3O44 A;  4IG0 B;  4O3R A;  2AJ0 A;  4RUB A;  5EWF A;  2LEA A;  5A8K A;  3OVS A;  4C6A A;  1ITP A;  2R8J A;  1HBO A;  4I56 A;  2G0J A;  1DAX A;  1MLA A;  2BX6 A;  4HR2 A;  5IFM A;  2VFV A;  5LMU J;  1F9E B;  3CCM S;  1HW8 A;  3DLK B;  3NNA A;  1RSC A;  5D78 A;  4PCQ A;  3C15 A;  1FKA F;  3HVW A;  3KHR A;  1C1C B;  4F67 A;  2CPH A;  2UUT A;  5GAD I;  2K7K A;  2V50 A;  1L5U A;  1IQT A;  1R31 A;  2P6S A;  2MKC A;  1N0V C;  4J5O A;  2ZBP A;  4LR9 A;  1Z2L A;  1UAW A;  4JI7 J;  1TMM A;  4LFA J;  3QPI A;  3TAQ A;  1PGZ A;  1SL0 A;  1NB7 A;  4QPT A;  1S4F A;  1IKV B;  2DCU B;  1IQZ A;  2HRU A;  4AD6 A;  2RH3 A;  7FDR A;  2D69 A;  1S6U A;  2IVY A;  3OTD A;  2RQM A;  4DXL A;  4F04 B;  3M1V A;  5DDQ C;  3Q8S B;  3BKF A;  5C24 A;  2HGN A;  4Y00 A;  3SCK E;  1V6H A;  4E8U A;  1Y10 A;  4YDD B;  3NS6 A;  3CCS S;  5H9E J;  1MN7 A;  2GVZ A;  4EBE A;  1TVR A;  4I0W A;  2BZ2 A;  5GMK a;  3FMB A;  4M94 A;  5E3R A;  4F0M A;  4CO2 A;  2OHD A;  5F8N A;  4EFA C;  3POT A;  2Z58 B;  3QT8 A;  2MQL A;  2JVO A;  1UJ4 A;  4F0K A;  2NXN A;  3X1L B;  3H8Y A;  1FD8 A;  2F5G A;  2IMO A;  3T19 A;  3Q2T C;  3ET6 A;  1WHV A;  1VBK A;  1DLO B;  5DO2 A;  4N8O A;  3CWJ A;  2V4J B;  3D3C J;  3RB4 A;  2HW3 A;  3SFG A;  4ERD A;  2ZH8 A;  4B9N A;  4M5K A;  1Y3J A;  4DS4 A;  2M8H A;  3HO1 A;  3TAM A;  2R2U A;  4XO0 A;  1CS4 B;  4X64 J;  4KE5 A;  1YRU A;  1KQG B;  2QL5 B;  3THV A;  2W8L A;  4EGL A;  4NLV A;  3RW7 A;  4IRD A;  4YY3 F;  2HZV A;  4M5J A;  2NR0 A;  1XMB A;  3OV7 A;  4ES3 A;  2QLW A;  3H25 A;  4X65 F;  4Q45 A;  5CXT A;  5KFW A;  2KHD A;  3J7Y U;  4GRS A;  2V8V A;  5LMN F;  3MR2 A;  4RW4 B;  4I6Y A;  4M5G A;  5HMZ A;  2O3D A;  2JWN A;  3KLE B;  3DGP B;  1SKU B;  4R8U A;  5KT6 A;  5GAG I;  5LXY A;  3N28 A;  3IP0 A;  2M9K A;  3CMA S;  4MFB A;  2IDL A;  1NJZ A;  1P9Y A;  1MSW D;  2CJB A;  1TUV A;  1UFK A;  3MCN A;  2G0I A;  1NO8 A;  3VQS A;  4KHP J;  3KNA A;  3IAS 9;  1KQS R;  3DMJ B;  3KJF B;  2AMC B;  1LWE B;  1ZTW A;  1NK9 A;  5IZH A;  1TL5 A;  3SQO P;  4H4O B;  4F8R A;  3AJD A;  1FXR A;  3IR5 B;  4ALZ A;  9ATC B;  2ZVS A;  4L6V 3;  4NLW A;  2BV3 A;  2B8Q A;  2CJY B;  3UR3 C;  2D1C A;  4KGX B;  4K4W A;  1VYA A;  3M2V B;  4OX8 A;  2ZZM A;  4WFN Q;  3MEG A;  3C14 A;  3NNH A;  2H51 B;  2HRT A;  4MIA A;  5DJB A;  4GKK J;  5F8L A;  2NPF A;  1W2I A;  2HQF A;  1HBN B;  4U96 A;  3HMJ G;  4DZD A;  1N33 J;  3JAM Y;  2C2O B;  2YQ3 A;  3VV2 B;  2CDQ A;  3UFC X;  3MPU B;  4A4J A;  3TJ9 A;  2G9O A;  2WW4 A;  2E9R X;  4DHV A;  3L7O A;  4JBC A;  4FS2 A;  2LMI A;  2OPP B;  4C8M A;  5U47 A;  3MF5 A;  1QD1 A;  1ZZF A;  2AZ1 A;  3M2R B;  3UDC A;  5L1I A;  4ZIT A;  3EDQ B;  5LOQ A;  2HRY A;  3MUM P;  1AW0 A;  3K17 A;  4NZ0 A;  4OHW A;  1X5O A;  5A8W B;  2W2P P;  4FN5 A;  1U7L A;  3O2I A;  3MEE B;  3IRX A;  1S7H A;  2DHS A;  2EFN A;  1A9N B;  4I2P B;  4DSL A;  2WSF C;  5J2Q B;  1RXO B;  5E3Q A;  2GHV C;  2FIU A;  3BS9 A;  5F3T A;  5J1P A;  2Q6B A;  4JI0 F;  1SV5 B;  4G1Q A;  4O0N A;  1T9T A;  3PYF A;  3MM9 A;  2WON A;  2MZS A;  3I6P A;  4OFZ A;  2BMB A;  3PVX A;  4ECS A;  4ZIV A;  4WP9 A;  4M95 A;  3QRP A;  3H59 A;  4HDH A;  4BCA A;  2GGP A;  4OHY A;  1R0A A;  3L3C A;  1Q7L B;  1GQE A;  2OEM A;  4FBU A;  1S97 A;  4Z7C A;  1GFW B;  3TZW A;  2CPF A;  4W92 B;  3CIZ A;  4Q43 A;  1GK8 A;  1HMV B;  5HBM A;  4XTT A;  2Q1L A;  2L9D A;  3IFE A;  1EJ7 L;  3DI6 A;  3HVA A;  2ZNZ A;  3T5H A;  2AHO B;  3MR7 A;  1IKX A;  8AT1 B;  2Z57 B;  4DSF A;  1VQS A;  3Q23 A;  3THP A;  1RWU A;  3N01 A;  4DR7 F;  1SKS A;  3JQJ A;  3NKY A;  1UVL A;  2GFF A;  4IFV A;  2PFF B;  5HP1 B;  5C25 A;  1RZM A;  4DUT A;  1N6Q A;  2BOA A;  4AQY F;  4X66 J;  2DNR A;  3MFI A;  3M8Q A;  3EXY A;  1M1G A;  1HQ2 A;  4TQR A;  1VQL S;  4LF6 F;  4DOZ A;  1E6Y A;  5BYS A;  2DIU A;  3V4I B;  3BZQ A;  3V81 B;  4R25 A;  4NLO A;  3S6E A;  2UUB F;  1RQ0 A;  2DD8 S;  3EX7 B;  2XMJ A;  4A46 A;  3RU0 A;  3PW2 A;  3ENA A;  1R43 A;  4C98 A;  1ZPV A;  2AKW B;  2VQE J;  4GVB A;  1YJW S;  2YPY A;  1WC6 A;  1TL1 B;  3HD2 A;  5CHC B;  3QSY B;  2JOQ A;  1R7I A;  1N5T A;  2O5D A;  4YN3 B;  2XMW A;  2VG5 B;  2XSJ B;  2BE9 B;  2CJX B;  1REG X;  4ZCL A;  3OHB A;  3KXD A;  3GIL A;  3CJT A;  3KK3 A;  2KM8 B;  3D6M B;  4ED7 A;  3DU6 A;  2GVD A;  5EGY A;  4B08 A;  3D2W A;  2RAQ A;  3N79 A;  1B7F A;  4B9T A;  4RNM A;  1RAG B;  3J7Y I;  2NCK L;  1B70 B;  2ZHO A;  2MY8 A;  4XPE A;  4LF7 J;  5HN0 A;  5KFB A;  2NXC A;  3M30 A;  4J9N A;  3WIU A;  1U1P A;  5D6G A;  3EGW B;  1T03 A;  3FMW A;  4K8R A;  4CLP A;  4P74 A;  2K2P A;  2HVZ A;  3OL8 A;  1MW7 A;  1RAA B;  1AZS B;  3DLJ A;  3TP2 A;  5C42 B;  2ZM6 J;  1Z4U A;  2BBE A;  3NXZ A;  4X4U A;  2IIH A;  1B3T A;  4MIW A;  5A2Q U;  2DHG A;  2ROE A;  4DMZ A;  3MAA B;  1PYS B;  5HSP A;  2DR6 A;  3W5Y A;  2GZO A;  3LP1 A;  1RHK B;  2U1A A;  1XC9 A;  2Z2M A;  3GSI A;  2L48 A;  4NZ7 A;  3WC0 A;  4FS1 A;  2NXJ A;  5T7L A;  2JLF A;  4TU9 A;  2M2B A;  3M8S A;  4OZ5 A;  2OFH X;  2F9J A;  1RU2 A;  2MYF A;  4RBU A;  4LF9 F;  4DQQ A;  1HIY A;  4DN9 A;  1U2R A;  4TNO A;  1WEL A;  2HFN A;  2WSE C;  4F36 A;  2YKO A;  4DR5 J;  4M5H A;  5J2P B;  4DF8 A;  3MMA B;  3W60 A;  4YB7 A;  1R8P A;  4UQG A;  4K0K F;  2FTR A;  1EKR A;  5DLG A;  1TL3 A;  5KT2 A;  2AU0 A;  5T14 A;  1VQO S;  2OEL A;  4JV5 J;  4UQT A;  5BJR A;  2YH1 A;  4OLP A;  1AFI A;  3AHP A;  2E7X A;  3UCG A;  2IBK A;  2OPR B;  2AGP A;  3CPW R;  2M70 A;  4JI1 J;  2EXU A;  3RB0 A;  4MH8 A;  4HT7 A;  2GIF A;  3NCP A;  2YNG A;  2NUU G;  3DHX A;  4HVZ A;  1QVF R;  4I4B A;  1Y5I B;  2J76 E;  2B6A B;  3GYN A;  1SC4 B;  5L1J A;  1QE1 B;  2M8D B;  2HNZ B;  2BDP A;  4KKO B;  3K89 A;  3W65 A;  1HNV B;  3S01 A;  1O51 A;  3EYZ A;  3BBB A;  3QRR A;  4L3K A;  2ATL A;  1S1W B;  2AEJ A;  4ECU A;  5D4P A;  3T6J A;  1DHM A;  2FZG B;  1JB0 C;  2QV6 A;  4LIW A;  4OJ3 A;  4DR3 F;  1WDT A;  2B43 A;  5KFN A;  2IM2 A;  2OFG X;  1ZM3 A;  3DYA B;  4A48 A;  3A8J A;  2BW7 A;  3GJT B;  2MQ8 A;  4NRU A;  2R7T A;  2YKN B;  3HSZ A;  3IM8 A;  3ZTS A;  3AT1 B;  4DR2 J;  5KG7 A;  4ED6 A;  2C2K B;  2HVE A;  3GTY X;  1WG5 A;  3QMQ A;  2B9X A;  3VHQ A;  2QT7 A;  1D0E A;  2OKQ A;  5K20 B;  4NCG B;  2HFO A;  3BGR B;  2ZBQ A;  3HHL B;  4AL6 A;  2VOP A;  1HFE L;  3ETO A;  2XI3 A;  1KLM B;  3GG0 A;  2VUG A;  4ZLP A;  1FEE A;  1SBR A;  4WYW A;  2XY7 A;  3ISN D;  1H7W A;  1NDC A;  4RO0 A;  5IT4 A;  3EJM A;  1TFW A;  2OP5 A;  1C2P A;  4KH1 B;  1VQ4 S;  1X5S A;  4JV2 A;  1Z2Z A;  4QZV B;  1BQM A;  3G8Q A;  2YQ0 A;  4Y2C A;  1LW0 B;  4RW7 B;  4O4G A;  1K0T A;  5SUH A;  3I31 A;  3OL9 A;  2P9C A;  4LF8 F;  3TUZ C;  1U8W A;  4KFB B;  1JLC A;  1IM4 A;  4H54 A;  3U1M A;  3E2E A;  1U6B A;  2EW9 A;  2C2N A;  2Z0G A;  4QYZ K;  1TKD A;  1RGV A;  2AJ2 A;  2KYZ A;  2O01 C;  4NL5 A;  2KHC A;  3ZXW A;  3ADA C;  2DHA A;  2BA9 A;  4ED8 A;  2APO A;  2E44 A;  5CYJ A;  3LGM A;  2UVW A;  1TR0 A;  4U95 A;  1RTI B;  5KT7 A;  4RW6 B;  5D8H B;  2GQ2 A;  2C2E A;  4PKD B;  2M3D A;  2FJV A;  5KG1 A;  2LVW A;  4DCJ B;  3ULH A;  1Y00 A;  3TW0 A;  3GU0 A;  5GAE U;  3GLJ A;  5E3C A;  4OLO A;  3BV8 A;  2HS0 A;  3PM9 A;  2D3Z A;  2YNI B;  4NLX A;  3T3F A;  3TUP A;  5EHH A;  1KOO A;  1PJ7 A;  5F41 A;  4NI2 B;  3LPY A;  4CP5 A;  1S6Q B;  3VAI A;  3VVT A;  2VA2 A;  4K50 A;  2B9E A;  3DLG B;  2V69 A;  3GJQ B;  4LF5 F;  2ZH1 A;  2QYC A;  2BKP A;  2R7X A;  2CPJ A;  1VLY A;  4HAC A;  3HVT A;  3G86 A;  4DV0 F;  1H2U X;  4ECX A;  1PIL A;  2Y3Y A;  3M9N B;  4P52 A;  3CD5 A;  3ENQ A;  4EZ9 A;  3T1A A;  4OYA A;  4E0D A;  4O44 A;  1Y3K A;  3RZA A;  4K59 A;  4ID8 A;  1FVS A;  4ZHR B;  4DQP A;  1DTT A;  1NHU A;  2VQF F;  2WHO A;  3FZ2 A;  4QIV A;  4ED0 A;  4DV3 F;  3FC9 A;  2JC1 A;  1GX6 A;  5I4M A;  2VAS A;  3D5M A;  4EBC A;  5FLX U;  3UE2 A;  1NU4 A;  3DRR A;  1H98 A;  2POK A;  1S1T A;  2VOO A;  1LKZ A;  4YY3 J;  1NBE B;  4B9L A;  5HQL A;  2A1B A;  1HI0 P;  1BXN A;  1BQN B;  1ZYQ A;  4X65 J;  2QMX A;  2H48 B;  3SSS A;  3OLA A;  4OHZ A;  2U2F A;  5LMN J;  2WOM A;  1VK3 A;  2VFS A;  3HLU A;  1RWM B;  2R7V A;  2NLW A;  4C4W A;  3FK4 A;  4ECT A;  2DNG A;  5D15 A;  2VDI A;  2RD5 C;  3BO4 A;  1U26 A;  2EPI A;  2E1P A;  1H2T Z;  1OIA A;  4UY8 5;  3R5A A;  2AWZ A;  4ZVR B;  3KLH A;  1RWV B;  3OPK A;  4NLT A;  4PWW A;  1Y5L B;  4HH0 A;  2OD6 A;  1G4C A;  2OUG A;  4QIW D;  1OYE A;  3GFH A;  2YWH A;  4RX6 A;  4N8N A;  1R8C A;  1S1U B;  3U1N A;  4CH0 S;  4GO7 X;  2W2Q P;  3UR0 A;  5L9N A;  2VJV A;  4JP8 A;  2GO8 A;  2H4Y B;  4ZK7 M;  2QFI A;  4J9Q A;  1XMO F;  4Y6I A;  5B7W A;  2JH3 A;  2QGF B;  3PW4 A;  2CZV C;  1IN0 A;  1RYS A;  3ENW A;  3LW5 C;  1OY6 A;  4LBP A;  1ZS6 A;  1FRH A;  3CJ5 A;  2YNF B;  2J5A A;  5HAO A;  1LV5 A;  3JSY A;  4ZIW A;  3P8B B;  3CCR S;  2W01 A;  2LU2 A;  2BAN A;  1OMS A;  4W98 A;  1H2V Z;  3N0V A;  1NM2 A;  4M1K A;  3MM5 B;  3Q83 A;  3V6J A;  3OFG A;  5KT5 A;  1TKX B;  2IJN A;  2OPS A;  3BYR A;  2HHS A;  3G2X A;  3SV4 A;  2X3D A;  4C3L A;  1KEK A;  3QRQ A;  1VBZ A;  1WOP A;  2W4P A;  3QZ8 A;  3LOU A;  1LNQ A;  2MZT A;  1UA0 A;  3IMQ J;  2ALZ A;  2E5H A;  3CME S;  1NSK L;  1D09 B;  5HAN A;  1G2E A;  1TKT A;  3G87 A;  1RKJ A;  2FJW A;  1TL7 B;  3VAL A;  3ILI A;  2CQD A;  1JIH A;  3VAM A;  1UW9 A;  4Y28 C;  1IJE B;  4KY3 A;  1IR1 A;  3GR1 A;  1U6F A;  2DTJ A;  4KGV B;  4NLS A;  1PCA A;  1RT7 B;  3PCO B;  2FY8 A;  4LSN A;  1FF2 A;  4JI0 J;  2WBR A;  3W9J A;  1FX4 A;  3K5O A;  2GJI A;  5GVQ A;  1Q7Y T;  4UOF A;  2DNO A;  1IKY B;  1K0V A;  3VF0 B;  2E5G A;  4FF2 A;  2CQ2 A;  1SC3 B;  2HIY A;  1KBR A;  3I0S B;  1HWJ A;  4ZPD A;  4CIO A;  2JL9 A;  1OPI A;  1YZ6 A;  5LXR A;  2VIH A;  4DPX A;  4X84 A;  5L46 A;  4U7U K;  2HBZ B;  4FBT A;  4LRC A;  4AXI A;  2PD1 A;  2MY7 A;  2IDE A;  3AOD A;  5GAE I;  4DR7 J;  4HL9 A;  4HYK A;  3U02 A;  1VRT B;  2HG4 A;  3Q8P B;  2NQP A;  4OZ1 A;  1DRZ A;  1YTY A;  2DEI A;  4AQY J;  2ASD A;  4LF2 A;  1IKW A;  3PRD A;  4Z37 A;  2ZD1 B;  4RW9 A;  2XWY A;  1AXQ A;  4C0O C;  4H4M A;  4G6V B;  3OQ2 A;  4LF6 J;  3MAQ A;  3UCZ P;  5SZT A;  1REV A;  5KG0 A;  1L3V A;  3PW5 A;  1S0O A;  2RKI A;  5FDL A;  3DOM A;  1K8A T;  4B3T F;  4O3O A;  2UUB J;  3OTB A;  2QZ8 A;  3S1T A;  4F2R A;  1GEH A;  3I9Z A;  3MEC A;  1OQ3 A;  4B9M A;  2GC8 A;  2CNK B;  3K58 A;  4B3O A;  4OYZ A;  3LTO A;  3NS5 A;  1PJ5 A;  2GA7 A;  2DIS A;  3TZY A;  5E0O A;  3R27 A;  4PG4 A;  1FE0 A;  3DCA A;  1N56 A;  5F0W A;  1UFW A;  4ECW A;  1FD2 A;  3RGI A;  1C0U A;  4I6A A;  3PJW A;  2V0N A;  5IOL A;  5K8O A;  1HBM B;  4A8O A;  3S7R A;  4N76 A;  4WFA Q;  2MJN A;  5EX3 A;  1KHW A;  3V6D B;  4XDD A;  3HT3 A;  2RU9 A;  2I0X A;  3I9V 9;  4IUF A;  1PC5 A;  3GZ7 A;  4ZLN A;  1LQ9 A;  3G8T A;  3LGH A;  1Q8L A;  4O3N A;  2COL A;  2DNY A;  1NSP A;  1RT3 A;  5IT9 Y;  1HPZ A;  3UN5 A;  1RCO B;  2KFY A;  2DY1 A;  4J9M A;  3E01 B;  2V8G A;  1WEX A;  3K57 A;  2ZZN A;  1RBL A;  4KB7 A;  1C1B B;  4BC7 A;  3KUG A;  2CFX A;  3G8S A;  4EYI B;  4B9V A;  4RUC A;  1C4C A;  3GYG A;  2BJ8 A;  1KRP A;  4A8W A;  5KOX A;  3W66 A;  2KT3 A;  3JSM B;  2EFG A;  1FDD A;  3R9L A;  2DNN A;  3EPG A;  3PG9 A;  3UVJ A;  3NCQ A;  3AOB A;  3I0R B;  5KFG A;  5IM0 B;  1HW9 A;  3C16 B;  4IH7 A;  2UP1 A;  3MMB B;  3D0I E;  1FFW B;  2DO4 A;  5JVH Q;  2DPI A;  3KK2 A;  1S5Z A;  2VG7 A;  2QFJ A;  1ZM9 A;  3GMG A;  2RUG A;  3KMS A;  1CEZ A;  3RBE A;  1X5P A;  3CT9 A;  1MRO A;  1ZBT A;  4MYT A;  1U4B A;  2H4W B;  5JJB A;  4LF9 J;  3TRG A;  4ENO A;  5I42 B;  2IVM A;  2CQB A;  2D3U A;  1DQA A;  1AYE A;  4A8Q A;  2Q6C A;  2OO4 A;  5C5J A;  4ZMM A;  1Q5Y A;  2KFN A;  1YQH A;  2E66 A;  4DQS A;  1CC7 A;  2FHO B;  2HBQ B;  1Q86 T;  2P8I A;  4ATN A;  1MWQ A;  2WZ1 A;  4IQM A;  3MAH A;  4OJH A;  5KFP A;  5A8R A;  2ZC4 A;  2HND A;  4WP8 A;  1CPZ A;  3K8V A;  4YB5 A;  2BAC A;  1FRI A;  3FBE A;  3MHY A;  3IBW A;  4L75 A;  4ZJO A;  1F60 B;  2MKK A;  1HI1 A;  4CT8 A;  5EX0 A;  5BYR A;  3HT0 A;  3B4M A;  5K14 B;  2FGC A;  2RSQ A;  2FHM A;  4OI1 A;  2XMA A;  2P2C B;  1CJV B;  3EWG A;  4DFP A;  3MM8 B;  4DX7 A;  4F4Y A;  3NOC A;  2HS3 A;  3ZZ0 A;  2W4D A;  2G2Z A;  1I5O B;  4QIF A;  3ZTO A;  4PUO B;  1WHY A;  3MMC B;  1PG5 B;  4GO5 X;  2I6W A;  2AP6 A;  5KG4 A;  2CNN B;  1SPB P;  4B17 A;  1IBL F;  4L74 A;  4DR3 J;  3PXG a;  3NEK A;  1U47 A;  4LRD A;  2F1F A;  4P2F A;  3IO1 A;  1PKU A;  2OML A;  1FRM A;  1VHI A;  4NLD A;  3T1H F;  1X9S A;  3UNY A;  1PO6 A;  1NK0 A;  3R7N B;  5DDR C;  4P10 A;  1JLB A;  1LWF A;  1VRU B;  1JLE A;  5MLC V;  4TYA A;  3KWM A;  1JLF A;  3EVO A;  1Q82 T;  3NL0 A;  5IC4 B;  4A8S A;  3M9O B;  4F3O A;  4N47 A;  4RUA A;  2X3G A;  2FLN A;  3TA0 A;  1RHM B;  4CH7 A;  3T1Y F;  2HGM A;  3C6T A;  2UUA F;  2RHS B;  4MMO A;  2B5J A;  2WK4 A;  1WOO A;  3A3N B;  1FI4 A;  4USH A;  2HKE A;  2WVB A;  1AFJ A;  2DGQ A;  2ZBC A;  2XUL A;  2IHR 1;  1N88 A;  2HHW A;  3OR1 B;  4HH1 A;  8RUC A;  4D3H A;  3UD5 A;  1RTD A;  2ZKT A;  3GV5 B;  3AQP A;  2YTC A;  1P27 B;  2KI2 A;  1UP1 A;  2NXU A;  3M2U A;  1KLN A;  3GR0 A;  3QWU A;  7AT1 B;  2LEP A;  4UOC A;  1K1S A;  4IQX A;  1YHQ S;  4J90 A;  4PEO A;  4LF8 J;  2ADB A;  3CD6 S;  1FXL A;  4RWX A;  4P6Q A;  3KK1 B;  1U0H B;  5HQ8 A;  3H20 A;  4FNI A;  2JEI A;  3GCW P;  3MEK A;  1S10 A;  4OI0 A;  1EET B;  1JKH B;  4ED1 A;  1RA6 A;  5I3P A;  3H5U A;  1D9F A;  4M63 A;  1HQE B;  4P72 A;  1BE4 A;  2J9E A;  4Y2K A;  3O8W A;  5FII A;  3TOQ A;  1TV6 A;  4KBI A;  1XBW A;  3I87 A;  3AJ2 A;  2YQ1 A;  2ZH5 A;  1DLO A;  3OFE A;  1TUG B;  1I6J A;  2XI2 A;  3MR5 A;  5CZX A;  2HHT A;  1H73 A;  2HYI B;  2R2R A;  5CYM B;  2DHX A;  5GAH U;  2GCF A;  5I3U A;  1TK0 A;  1X4C A;  4WYL A;  3RUB L;  1T0T V;  3NBP B;  3QGG A;  3TUJ C;  3BPS P;  4LF5 J;  2HVH A;  1SC6 A;  2IPO B;  4QWB A;  1CUL A;  2EFO A;  3AB4 B;  3HSD A;  3JYT A;  1FKP B;  3GJR B;  1RYR A;  4DV0 J;  1HBU B;  4CO0 A;  2HQD A;  1FCA A;  1FFS B;  2KRB A;  2ZH9 A;  5CD4 A;  4RU2 A;  2EKY A;  4ZPW R;  4RW4 A;  5K5M A;  4WU2 A;  1ZAX A;  4BBY A;  1UEK A;  4LRE A;  2VQF J;  1FK9 A;  2VL1 A;  3HI9 A;  4DV3 J;  3TAR A;  2DPJ A;  1FXD A;  4WII A;  3SEO A;  2GJ2 A;  4HTI A;  4DCO B;  4CLK A;  2MKS A;  3M6W A;  4ZVS B;  4Q2L A;  3SIP B;  2H65 B;  5KG6 A;  4YUD A;  2OMO A;  3H7H B;  4IOC Q;  4ECQ A;  4CWB A;  3QJP A;  1NH7 A;  3CTR A;  2HQI A;  3BGF A;  5KTQ A;  2J9D E;  1ZH5 A;  1A6L A;  1RCX B;  2FDN A;  3J7A 1;  2IRY A;  5A8K B;  1VCT A;  1HD0 A;  2UVU A;  3ZZT A;  3DMJ A;  2QLF B;  4LVO P;  3PRV A;  4DPW A;  4IYQ A;  1Q79 A;  2VFR A;  3ZZU A;  2KB2 A;  3UD3 P;  2QA4 G;  3TI0 A;  3F44 A;  1ZPW X;  3ZTQ A;  2B9W A;  4O3S A;  4TYB A;  4XIU A;  4UUX A;  2CJQ A;  3BDE A;  1QSY A;  1VQ9 S;  1MMN A;  3C15 B;  2OIH A;  3DFE A;  2FVP A;  4XAK A;  2BE2 A;  2R9L A;  4DSE A;  3CUN A;  4FVC A;  3R7S B;  4BC9 A;  3VR1 A;  4LT6 A;  2M88 A;  2XY5 A;  3A3P B;  4OJ1 A;  2KJV A;  3WHI A;  4NEZ A;  1WEY A;  1VOM A;  3KOA A;  3HF5 A;  2QMU B;  2NXE A;  2G13 A;  2MZ1 A;  4ZKA A;  3QBC A;  2K8G A;  1KFS A;  1XMO J;  1Z1Z A;  3RG6 A;  1YDL A;  2JC0 A;  3QLH A;  2HK2 A;  3ZNU A;  1S77 D;  4HHU A;  1IBK F;  4U9R A;  3IBC B;  2Y1J A;  2OPP A;  5KG2 A;  2BJE A;  5F0U A;  5KFR A;  3LUY A;  2CQ3 A;  3SFU A;  1UL3 A;  4J9P A;  2XYP B;  2VIC A;  4OV1 A;  1RHU B;  1RAH B;  2XYG B;  2DNQ A;  1TVR B;  1FRL A;  3R1L A;  2LQ8 A;  1OJ4 A;  1TK5 A;  4G1P A;  3JTN A;  2QA1 A;  3T9N A;  4FKY A;  3Q8U A;  2KN4 A;  4P7T A;  1T3O A;  3AJ1 A;  4X4P A;  3ET6 B;  4O3Q A;  3TQ1 A;  3MCM A;  1GNK A;  1VK8 A;  4B9U A;  1YJT A;  2R42 A;  2CPE A;  3UN3 A;  4USM A;  4FF4 A;  2FVS A;  2PDA A;  1UJ5 A;  3NWG A;  1WC3 A;  3HZG A;  2R8K A;  3TAM B;  2G1D A;  4NE9 C;  2KT2 A;  1BUX A;  1FRJ A;  2D41 A;  1HMV A;  2VPX B;  1VI7 A;  2L08 A;  4X2B A;  1S6P A;  3TR5 A;  2E9T A;  1FNX H;  3OXG A;  2HEK A;  1JK9 B;  3QO9 B;  3QT6 A;  3QIP A;  1J5O B;  3HCX A;  3BM7 A;  2V6A A;  2FPH X;  2XCA A;  3ZO7 A;  4Q8E A;  5DG8 A;  3BN7 A;  3FRY A;  1VLO A;  5HP1 A;  4MAK A;  2P9E A;  3P6Y C;  1RBA A;  1N34 F;  3RBZ A;  1RAF B;  4ZJL A;  5F9L A;  5L39 A;  3WQP A;  4EWT A;  2EC2 A;  4R0J A;  3MPD A;  4AYB D;  3RB6 A;  3E3X A;  3OHA A;  2HWT A;  2CRL A;  2YKM A;  4UZB A;  4C8Y A;  1RWW B;  4YP3 A;  4ZVH A;  3V81 A;  2V8D A;  4ZVE A;  1HNW F;  3PAC A;  4MFB B;  3N6M A;  4OZ0 A;  3CNQ P;  4G1I A;  3W63 A;  4AL7 A;  3PHE A;  2GW8 A;  2UU9 F;  5AT1 B;  3BH6 B;  1S7I A;  3CO0 P;  1VQM S;  4FNH A;  2NYI A;  4OL8 A;  3FRZ A;  5GAH I;  2VKR A;  4OYX A;  1S72 S;  2DNZ A;  4MIB A;  4J9U E;  2NUH A;  1V3Z A;  3NRB A;  1NSQ A;  1XQI A;  2LQB A;  4EYH B;  1KOH A;  3FQK A;  4I2Q B;  2N82 B;  2BKN A;  3G6X A;  4B3T J;  1NJI T;  2EC0 A;  2RS2 A;  3QFH A;  2O67 A;  3HFV A;  1XK8 A;  1AUD A;  1F2G A;  1GTE A;  2F40 A;  1GH8 A;  3G6V A;  1CJK A;  1DUR A;  1RT4 B;  3OL7 A;  2DH7 A;  5CA5 A;  1XNQ F;  1XIQ A;  4ELU A;  3KJV A;  1NK5 A;  5G4D A;  2W2N P;  2LQ9 A;  1RT6 B;  2YWE A;  3VCD A;  2C42 A;  3FCV A;  1UCN A;  3QAE A;  3GFZ A;  4ZPT R;  1QVG R;  1M5S A;  2BR0 A;  2XO7 A;  4USU A;  2IRU A;  2LXU A;  4F7V A;  1ZM2 A;  3GV7 B;  2H5E A;  4CO4 A;  5DQI A;  4DX8 H;  3ZTP A;  3OD2 A;  3C2P A;  4CQ1 A;  3C3L A;  2YWG A;  1QAJ A;  1Y0H A;  1KVI A;  2EFV A;  1MML A;  2B4P A;  4CNZ A;  2ZWP A;  4J9R A;  2NRE A;  1RU1 A;  2ZZT A;  3DKD A;  3IRX B;  1KWM A;  3AD9 C;  1N5S A;  1YJV A;  2RHQ B;  2AD9 A;  3C6U A;  5KFL A;  1RAE B;  3PZP A;  4MYU A;  5HQM A;  3R8Y A;  2ZH7 A;  1GMW D;  2A6M A;  3DOK B;  2Y1R I;  3MM9 B;  2WON B;  4A8F A;  3MM7 A;  5IQ6 A;  4E98 A;  1T7P A;  3FVY A;  1D8Z A;  2QN6 B;  1U6Z A;  4NEY A;  1WJ9 A;  3QAU A;  2NS1 B;  3CDU A;  2QA2 A;  1VIO A;  2GGP B;  3MD3 A;  1R0A B;  3GSD A;  3M7V A;  4CLY A;  4OZ2 A;  3RBX A;  3MMA A;  4A47 A;  3Q24 A;  1MMD A;  3QGH A;  3H0P A;  3KLF B;  2HMI A;  4PXE A;  5HBM B;  2JSX A;  3KHH A;  4S0M A;  1HL6 A;  2Y0S D;  3SYZ A;  3DI6 B;  1IKX B;  2GMJ A;  2DCL A;  4QW9 A;  1BLU A;  1HD1 A;  2OPR A;  1SIW B;  1OY8 A;  4LRB A;  2VDH A;  1BHN A;  4P7V A;  3EZ5 A;  2M4M A;  1MWZ A;  4RNF A;  4IFV B;  1ZTT A;  4EMD A;  1N6Q B;  2PI4 A;  1YX2 A;  2UXB F;  2E7W A;  5KFA A;  1RE1 B;  1UEV A;  1N32 F;  5LL6 d;  1WKK A;  2EKN A;  1QE1 A;  4ED2 A;  4BWM A;  4QOT A;  3P4U B;  5B09 A;  2ZDO A;  1F3V A;  4KKO A;  4K5S A;  3JSR A;  3SDE A;  1X0F A;  2HWH A;  4FXV A;  2ERR A;  3RR7 A;  1XR6 A;  1EZZ B;  4ZPV R;  3TJ8 A;  3FJ2 A;  2B8P A;  2JLG A;  2MQM A;  3D1Q A;  4LSL B;  1KVK A;  3BN4 A;  3Q8R B;  2RDI A;  4C3K A;  2Q43 A;  4ECV A;  1F0X A;  1VQ8 S;  4NYO A;  1NPK A;  2PSZ A;  3HXM A;  4URG A;  2B7C B;  3QT5 A;  4QR1 A;  2VBX A;  4QWD A;  2W9B A;  4FF1 A;  2RNE A;  3DNC A;  2MZJ A;  3KK3 B;  1JLG A;  2R4F A;  2HZC A;  2XHW A;  3G9C A;  4CT9 A;  2GVD B;  1BGX T;  1VQ5 S;  5LSO A;  3C46 A;  4RPF A;  3VGS A;  3KLV A;  1S79 A;  1U1L A;  2HNY A;  4ICL B;  3L09 A;  2A0F B;  3BH7 B;  2C2D A;  4OZL A;  1QJH A;  2V2V A;  3ZC4 A;  1TUW A;  1IBL J;  4F25 A;  4FP9 A;  3CXC R;  3M30 B;  1W25 A;  2OSR A;  4LR8 A;  1N8R T;  1KFD A;  2DR5 A;  3J80 Y;  4GMK A;  4RLE A;  3T1H J;  1T03 B;  2CQG A;  2KYX A;  1M5V C;  3QZ7 A;  4LUB A;  2XS2 A;  3T41 A;  2XY6 A;  4WFB Q;  2ATC B;  2D7S A;  3IG1 A;  4YHH F;  1L3K A;  3D6F B;  4PG6 A;  5KFY A;  4PWD A;  1FA0 A;  2VKZ G;  3QSI A;  1LW0 A;  3B8H A;  1IVZ A;  2UUW A;  4CM2 A;  3FZB A;  1ACM B;  1U2C A;  3T1Y J;  2BYC A;  2UUA J;  2IY5 B;  2L9W A;  4ZDN A;  2VB6 A;  1S4E A;  1GX5 A;  2XTJ P;  3LP1 B;  2LCW A;  4FYX B;  2AYB A;  3OR2 B;  1B0P A;  1FRK A;  2IM0 A;  2FC9 A;  1PIE A;  5D0R A;  1FX2 A;  4CCH A;  1X0P A;  1LWC A;  5T7L B;  6FDR A;  2VF3 A;  1WKL A;  2FZC B;  2VPZ B;  3Q86 A;  2IM3 A;  2CPY A;  5KG3 A;  4HEA 9;  1OO0 B;  4R5P A;  1KP6 A;  1ZM4 A;  2FD2 A;  3FEZ A;  5KFX A;  4L76 A;  4IFY A;  1V5I B;  3P96 A;  2YNI A;  2BE7 D;  5EN1 A;  2RE1 A;  3LP2 A;  1S6Q A;  1Q4R A;  3MZI A;  2W8K A;  3DLG A;  2YPZ A;  3KDN A;  5BYQ A;  2ILZ A;  3DRP A;  2MZQ A;  2Y0B B;  2PEB A;  2CYY A;  3QYY A;  1VBY A;  1UW4 A;  2HHP A;  4PYA A;  2MEW A;  2DB1 A;  2XSF A;  1N5V A;  3NGS A;  2LQJ A;  2FGO A;  2HK3 A;  4JYA F;  4OIX A;  4FF3 A;  3M9M B;  4ILM A;  4K4U A;  1JMT A;  4I67 A;  1FJG F;  2J7U A;  5J2N A;  4QIG A;  4MK7 A;  1HNX F;  1T8E A;  1SUQ B;  3US5 A;  4M5M A;  1K47 A;  2CQI A;  2E9Z A;  4YOE A;  3MGJ A;  3J81 Y;  1WOS A;  2ACY A;  3TO8 A;  4TLQ A;  3PEJ A;  1K1Q A;  4KPC A;  1HLW A;  4OJG A;  2RU3 A;  5A0Y B;  1YRT A;  2DNK A;  3U7J A;  1OSC A;  1QAX A;  4OYW A;  1S59 A;  2A10 A;  1RAD B;  3WDO A;  5HO4 A;  2MKJ A;  4Q5V A;  2ADC A;  4B02 A;  3GP9 A;  1B4S A;  4OI2 A;  2PII A;  1FER A;  1Q5V A;  5E2Q A;  3DRS A;  1E6V A;  5E41 A;  4BHQ A;  3KYL A;  4C3M A;  2EBG A;  4DL0 C;  5D77 A;  5A76 A;  1T9U A;  2KL8 A;  5HL7 Q;  2UXC F;  5J1E A;  5IT9 U;  2RF2 A;  2OSQ A;  3GII A;  2E1R A;  2H3E B;  2J8S A;  1NUE A;  1BC6 A;  4RNH A;  4AE5 A;  5H9F J;  2AIR B;  3AXM A;  2LEC A;  4ETX A;  3NNC A;  3AAW B;  4RUH A;  2HAF A;  5CQG A;  4B3R F;  5GME A;  3VGU A;  1NXI A;  1FTR A;  3H2U B;  5F8M A;  4DBQ A;  1UMJ A;  1EAR A;  4O4R A;  2V4R A;  4C7Q A;  4RBV A;  2BUN A;  3OXL A;  1OY9 A;  1RTH A;  3PYE A;  2Z56 B;  1GMW A;  1EB0 A;  4RNN A;  3MUT P;  1YIJ S;  5KFO A;  5KOW A;  4AT1 B;  4OI4 A;  1DAR A;  4JI8 F;  3IWX A;  5K8N A;  3LPE A;  1HNI A;  4RL1 A;  1F9H A;  3FBF A;  4O4G B;  4C97 A;  2GHP A;  4JUZ A;  1YLX A;  2G0C A;  4LBI A;  2QEX S;  2FVR A;  2IJR A;  4NLP A;  2CIM A;  3MM5 A;  6FD1 A;  4KJI A;  1JLC B;  4PG5 A;  4IDK A;  1TKX A;  2RQ4 A;  1AT1 B;  1NK6 A;  2OAU A;  1WAC A;  4Q0B A;  3W64 A;  1NK4 A;  1S76 D;  2NPI A;  3MPW A;  2OGU A;  2YNH A;  4EUV A;  1YIT S;  2J6T A;  1B0V A;  4UUW A;  3D0G E;  3EDR B;  2IM1 A;  1IBK J;  4ZVT B;  4Y2M A;  4LJM A;  1N5Y A;  3TVY A;  1TQL A;  2RT3 A;  2CAD A;  3PR4 A;  4RKU C;  1RHR B;  4PRF A;  3DGV A;  2EBE A;  1VQY A;  3CCZ A;  4NCB A;  2SXL A;  4DFM A;  2M5Y A;  1RT2 A;  4PG8 A;  1F5B A;  3FSX A;  2KO1 A;  4CO5 A;  9RUB A;  5KFC A;  2HUR A;  3R6L B;  1RUS A;  5KFU A;  4TQS A;  2I5J B;  3S8S A;  2I9S A;  2B4V A;  3GIK A;  4OYB A;  2H1Y A;  3K59 A;  3UPF A;  4EK2 A;  3CO9 A;  1EKS A;  2XGP A;  1RT7 A;  3TVZ A;  3D28 A;  3UO0 A;  2GX8 A;  2F8M A;  3JB9 k;  4CLW A;  1LW2 A;  3TAP A;  1WC4 A;  2VG6 B;  2E5I A;  2LDI A;  3HVT B;  2C3Y A;  3R2D J;  2W7A A;  5A2Q Y;  1RAB B;  1LXN A;  1X8D A;  1IKY A;  3K5N A;  5GMD A;  1S1X B;  1DBD A;  4HKQ A;  3R5J B;  4YB1 P;  2C22 A;  4I64 A;  3HP6 A;  1KNZ A;  1KHV A;  5HK4 A;  3IRW P;  2MLZ A;  3FCW A;  3OFF A;  3A12 A;  2XMU A;  2BQU A;  3PRB A;  4OQJ A;  4M5D A;  3DRR B;  5AE3 A;  1FNO A;  2JHE A;  1S1T B;  4LMZ A;  4X4O A;  3FUY A;  4NMX A;  3R6G B;  3BO3 A;  3I5A A;  1GT8 A;  5D4O A;  3B82 A;  3DXB A;  5AXM A;  3FFI B;  1VRT A;  1PYT A;  1D9A A;  3KG0 A;  2WOM B;  2A18 A;  1N34 J;  3EM1 A;  1FDN A;  4ZPB A;  4HI2 A;  4AFF A;  5JMN A;  4PPD A;  1FKO A;  4M5L A;  4DV4 F;  2CZ4 A;  3L7U A;  1HNW J;  3A8K A;  3LF0 A;  4MJK A;  4KSE B;  2DGX A;  1BY9 A;  3WC2 A;  2UU9 J;  4PQA A;  2IVF B;  4RWW A;  4YS2 A;  1JLA B;  2HAI A;  3B78 A;  2DVI A;  2MKH A;  2KU7 A;  3IBF B;  1T02 A;  2JEF A;  4X4S A;  3ZZO A;  4JI4 F;  1BWV A;  3NMA A;  3M8R A;  5K9F A;  2AT1 B;  2OEJ A;  2YWF A;  2X1B A;  1M5P C;  5IQQ A;  3I4P A;  4Q8F A;  5HLF A;  2ZVI A;  3IS9 A;  3F73 A;  4A8K A;  2J0Q D;  2YX7 A;  1K73 T;  1SJ1 A;  1XR5 A;  4FYY B;  1HR0 F;  4WZQ A;  1U48 A;  2DNL A;  2W2M P;  5IC6 B;  2BAN B;  3OVA A;  1KN6 A;  2XWX A;  2JX2 A;  1XNQ J;  2XCP A;  2CQ4 A;  4K4V A;  2WVF A;  2MTL A;  2OPS B;  1VHF A;  2VBW A;  3FBB A;  4PAA A;  2YY3 A;  1VIS A;  2V8H A;  1YKW A;  4PYD A;  2ZC3 A;  1GMV A;  1GMU A;  4KT0 C;  3E01 A;  4O0I A;  1N36 F;  1NDK A;  1XN9 A;  2KVQ E;  4U67 Q;  4QBU A;  1GTH A;  1C1B A;  1RWK B;  4UY8 T;  4H4K A;  2C1E B;  1SI9 A;  3JSM A;  4AL5 A;  3M32 A;  4F2S A;  3D6T B;  3N9U C;  2ROP A;  5CCM A;  2WAQ D;  2QC3 A;  4ER8 A;  5IM0 A;  4LSN B;  3FKB A;  3C16 A;  3KMQ A;  5HVH A;  5CZV A;  3J7Z 5;  3MOJ B;  4UOH A;  4DJB A;  2RDD A;  2DO0 A;  4URQ U;  3QJJ A;  2IAJ B;  1WC5 A;  2AYM A;  1G3O A;  5F8J A;  5B0G A;  5KFM A;  1UVM A;  1M90 T;  3JS9 A;  4CO1 A;  3GV8 B;  4B3M F;  4J37 A;  1T05 B;  3NY0 A;  1DTQ A;  3SSR A;  3ZFV A;  1SKR A;  2DGV A;  1AB8 A;  4DV1 F;  1R8A A;  3M6V A;  3DOL A;  1HWL A;  2ZE2 A;  2KG0 A;  3R5G A;  1AA1 B;  3IGV A;  1VQK S;  2FJX A;  1ULR A;  4P2X A;  2G2Y A;  1NHV A;  2AX1 A;  4HI1 A;  2XBP A;  1VDH A;  4GKJ F;  2VA3 A;  3PV8 A;  3CDW A;  1I51 B;  5DRK A;  1RTJ A;  2UXB J;  3W2V B;  1S12 A;  2D74 B;  5EDW A;  1IKW B;  2A3J A;  2Q79 A;  4CLT A;  1N32 J;  4L72 B;  5ETR A;  4CZC A;  4RW9 B;  1I1G A;  4H4M B;  5DS7 A;  2W24 A;  4HLB A;  4DSJ A;  3QAT A;  1REV B;  4NA3 A;  3NGD A;  2R7U A;  2PA3 A;  2RKI B;  3GG1 A;  3QT7 A;  3D68 A;  3DOM B;  4JI5 F;  2ZJQ Q;  1EP4 A;  4ES1 A;  3G82 A;  3Q2S C;  2RVJ A;  1UPP A;  2BVZ A;  3BSN A;  3G96 A;  2EVZ A;  3MEC B;  4ZP8 A;  1VS3 A;  4PPZ A;  2ZH2 A;  4B3O B;  2GHW A;  2CWX A;  3KKF A;  4KRW A;  2KRR A;  4KHR A;  2IA0 A;  2X7I A;  4QU7 A;  2ASY A;  2DGT A;  1NSA A;  4OZ3 A;  1JLQ A;  2MMY A;  2DJW A;  1S48 A;  3T5J A;  1RLD A;  3T9Z A;  3CC7 S;  1XEZ A;  2MB0 B;  1C0U B;  4E2F B;  4USW A;  3KJN B;  3HK2 A;  3QJL A;  5J2M A;  2KXH A;  3NWR A;  5E3P A;  5FLX Y;  2D9P A;  1VRU A;  4FXW A;  4K4Z A;  4WE1 B;  2I1R A;  2Q66 A;  2W7P A;  5CYQ A;  5G0R A;  3H98 A;  2BM0 A;  1CJT B;  3OW2 R;  2ZBI A;  1PJ6 A;  3I5B A;  4J9S A;  1FHT A;  2K1R A;  3KLG A;  2KKH A;  4ZP6 A;  1RIS A;  2B4O A;  1GAO A;  3FNN A;  4CYU B;  1FT8 A;  1UZD A;  3NOG A;  4UW2 A;  3MUV P;  5E7O B;  1RT3 B;  1T95 A;  3AD7 C;  2MJU A;  1XER A;  4X4V A;  4ILL A;  1UWA A;  3CUL A;  2BM1 A;  3F56 A;  3UN2 A;  4YHH J;  4BDP A;  3MM6 A;  1UWB A;  1NCL A;  2YVS A;  2QYG A;  2Z8Q A;  4NA1 A;  3PX6 A;  1U1R A;  3UNG C;  2MGZ B;  1YRX A;  3HHN B;  3R5D A;  2V5H G;  3H2L A;  4TXS A;  1IJF B;  2DNH A;  5E3A A;  4OZJ A;  1H0H B;  2EK1 A;  1LFW A;  2EG1 A;  3BPD A;  3KK1 A;  3HUL A;  4C11 A;  1U0H A;  2DH8 A;  3UCU P;  3KUH A;  4QWA A;  1YZ7 A;  3BF4 A;  3KK2 B;  2VG7 B;  5KT3 A;  1WI6 A;  5J1N A;  3KHL A;  1MRO B;  2LDY A;  1HQU A;  1O6X A;  2V2Q A;  2NSB A;  2A2C A;  2I38 A;  2R3V A;  4QR2 A;  2CPI A;  4F0H A;  1WTB A;  3VZH A;  4C9D A;  3SCJ E;  3BSC A;  2AYE A;  3AA8 A;  2OPQ A;  4ZVU B;  5K8M A;  5CYM A;  2G1H A;  1VQP S;  4DV2 F;  4DL3 A;  1RP5 A;  3D67 A;  1ROF A;  1K44 A;  5A8R B;  3BO2 A;  4IR1 A;  3PR5 B;  4N5S A;  3NGT A;  3DN9 A;  4LF1 A;  1S1V A;  1SB6 A;  3CF5 Q;  5D4L A;  1UA1 A;  1OS5 A;  1FKP A;  5B0B A;  4IKA A;  1N4L A;  2MLX A;  4JYA J;  3FCH A;  3IAM 9;  5ETL A;  3CJK B;  2EEY A;  1CG2 A;  1FJG J;  2AZ3 A;  3PYG A;  3TX8 A;  5C7P A;  5KG5 A;  1KQF B;  3RJM B;  2ZHB A;  2GNK A;  2AEF A;  4QJV A;  1JJC B;  1HNX J;  1VQN S;  3RAM A;  1XWL A;  1N52 B;  4KAI A;  4P75 A;  2BJD A;  4LFC F;  1WDD A;  2RIJ A;  3CE8 A;  3DC2 A;  3LAK A;  3ENV A;  2QTW A;  3BGO P;  3BQ0 A;  2WVE A;  1CJU A;  4Y0F A;  2EFP A;  4USJ C;  4R0E A;  1U09 A;  3A3O B;  1N0U A;  2FLL A;  4NXN F;  1X60 A;  1HI8 A;  4Q7A A;  2CJK A;  4ZS6 A;  1LK7 A;  4GC6 A;  4LIR A;  1WD6 A;  3NAH A;  3D7S B;  1S9G B;  2LU1 A;  2DIT A;  1PBU A;  1XTZ A;  4NAS A;  2AF6 A;  2XHC A;  3CD7 A;  2FJD B;  1X7V A;  2BRL A;  3T5L A;  3BKU A;  1NZA A;  4QU6 A;  4DUZ F;  2UXC J;  3L4B C;  3OTO F;  1JLB B;  2GO9 A;  1LWF B;  4ZP9 A;  1JLE B;  1ZZN A;  1RWP B;  1X4A A;  4DFK A;  1JLF B;  2C3U A;  2JJ4 D;  3ZZP A;  1M5O C;  2PEH A;  1CLF A;  2Q3P A;  2VON A;  1FDA A;  1QUP A;  4U7U D;  1PYO B;  4NLY A;  2YX1 A;  3CC4 S;  1ZA1 B;  4FPR A;  4B3R J;  3OBI A;  2HHH F;  3LH2 S;  2OTL S;  3CJ3 A;  3C6T B;  1VQ7 S;  4PR6 A;  1XNR F;  4PG7 A;  2XMT A;  3DLE A;  2B5J B;  4F4W A;  2V68 A;  4V19 X;  2HHV A;  5DLF A;  3C8Y A;  3B4D A;  1FFG B;  3HSG A;  4D3G A;  3HJF A;  1NPR A;  1RT1 A;  3UI3 A;  4NOH A;  2QSF A;  3D9B A;  1RTD B;  2UUC F;  2J6S A;  1R27 B;  2IC3 A;  4JI8 J;  4U8V A;  5HRO A;  1NH8 A;  2VC1 A;  3WX4 A;  1UZH A;  3RB3 A;  3PFE A;  2YX4 A;  4TY8 A;  1C0T A;  4DV5 F;  1X4H A;  5ETN A;  1D9D A;  1YBT A;  1ZAW A;  3VAJ A;  2CQ1 A;  3M2U B;  3AD8 C;  1KVJ A;  3N5B A;  5M2R A;  3R3T A;  4WIQ A;  1L3S A;  4OYI A;  1KC8 T;  4DN0 A;  3UW1 A;  3CJS A;  3OTC A;  1Y7P A;  3EE3 A;  3L95 X;  3CCJ S;  3AOC A;  3MR3 A;  4LBH A;  1RAJ A;  4IG3 A;  3GE9 A;  4QQB A;  2NYH A;  3DRY A;  3CCQ S;  3PFO A;  3TEH B;  4DQR A;  2VJU A;  3K8W A;  4TU7 A;  3IN5 A;  2ZIT A;  4UZC A;  1TV6 B;  4YME A;  1NRK A;  2RRA A;  1TAU A;  4MT1 A;  4ED4 A;  4IH6 A;  3M4X A;  3NGR A;  4QYR A;  1NLK L;  4ZP7 A;  2CPX A;  4WP3 A;  2PI5 A;  1NB2 A;  4PQU A;  1TEL A;  5I3U B;  2W25 A;  1TK8 A;  4DL7 A;  2OI2 A;  2MHN A;  2J8A A;  4NYZ A;  2VHG A;  4HDG A;  2KH9 A;  1VC6 A;  1JQG A;  3DRX A;  3OTE A;  1RAI B;  1RA7 A;  4FYD A;  4HTJ A;  2AEM A;  1CUL B;  1W26 A;  4ID5 A;  4DCP B;  3C19 A;  3A8I A;  2MQQ A;  4HT5 A;  3OUY A;  2VBY A;  3JYT B;  3HX9 A;  3IWN C;  1SQF A;  2JNJ A;  3QO9 A;  1J5O A;  1EHW A;  3GPA A;  1Q1K A;  3W9I A;  4OX7 A;  5ETV A;  3LAM A;  2FJA B;  2AV5 A;  3PTW A;  5L8R C;  3BSA A;  3V4M A;  4LQ3 A;  1SQE A;  4KGZ B;  1IM6 A;  5ITH A;  1FK9 B;  4IO1 A;  2CG8 A;  4F02 A;  3M8W A;  3J80 U;  1P1T A;  2LA6 A;  2Z30 B;  2X1F A;  4XDC A;  3W62 A;  1X4G A;  2XZT B;  4V19 J;  3MUR P;  4DZ6 A;  3H42 A;  3Q89 A;  1M1H A;  3DM2 A;  5E33 A;  2W1B A;  2FJB B;  2GS8 A;  3HJV A;  2C28 A;  3PKY A;  1Y5N B;  2FJE B;  4F4Z A;  2XMV A;  3GWC A;  3OL6 A;  3BEG B;  1U8S A;  1WHW A;  4BLG A;  2Z2L A;  1PSD A;  4WBF A;  4F4X A;  8ATC B;  4QW8 A;  1GXU A;  4USV A;  3N6L A;  4AND A;  2HLT A;  3AB2 B;  1NKB A;  5LT5 A;  2GAH C;  4DV4 J;  4I2Q A;  3VGV A;  3D0H E;  3MD1 A;  2WW8 A;  2KFZ A;  2BE2 B;  1URR A;  2R2T A;  2B56 A;  3RRK A;  4L73 A;  4ZLL A;  3Q8V A;  1RT4 A;  2RB7 A;  4JV1 A;  3R5B A;  4ZA1 A;  5IXU A;  3P5B P;  4H4K C;  2F8H A;  2V2Z A;  4B9S A;  4JI4 J;  2KXN B;  1EX8 A;  2VU5 A;  2J0S D;  1QLN A;  1S9E A;  1RT6 A;  2HS4 A;  4KO0 B;  3EPI A;  3PY8 A;  1YSJ A;  2GQQ A;  3QLH B;  4J9V A;  4YFU A;  3KLI A;  1Q8K A;  2UV8 A;  5DM6 Q;  4PWU A;  4Z2X A;  5FJ4 A;  1R0B G;  5KFF A;  3MED A;  3WBZ A;  2DR8 A;  1LXJ A;  2HQG A;  3VVU A;  5B0D A;  3GIJ A;  2XMK A;  5ETM A;  1HR0 J;  1HNZ F;  1VQ6 S;  4RW8 A;  3BBC A;  5RUB A;  4PAB A;  3CW2 C;  3DU5 A;  3VTI A;  1W2B R;  2KZM A;  1Q81 T;  2H5I B;  3HD1 A;  2L3M A;  1HWK A;  1C4A A;  3IR6 B;  3OSP A;  3J81 U;  3X3U A;  1N36 J;  2F3J A;  2L41 A;  3DOK A;  3M8P A;  4WTY A;  4WJB A;  2YKP A;  4QR0 A;  1T9X A;  2CNO B;  1RT5 A;  3VGT A;  2GV1 A;  3TYT A;  4M8L A;  3DLB A;  4Y34 A;  4OZN A;  5B0F A;  1P9Q C;  4MKV A;  2Y9H A;  3MTJ A;  1SIZ A;  3GCX P;  3CD0 A;  1J2V A;  3KLF A;  2HQC A;  4HHH A;  3LP0 A;  4RZR A;  1S6P B;  2O1P A;  4WU3 A;  2K3K A;  1NK7 A;  3IR7 B;  3PEH A;  3QIP B;  3A1Y G;  2ZUG A;  1IWG A;  1EQ0 A;  4LRA A;  5DG7 A;  3DDN A;  1NKC A;  1WTF A;  1RAC B;  2DR9 A;  4B3M J;  2ABY A;  4I7F A;  1YI2 S;  3D54 A;  1H6K X;  3RTV A;  2X1G A;  4DV1 J;  2WTF A;  1FWP A;  2MKY A;  2YKM B;  2BQ3 A;  2XLK A;  4DWI A;  4IOB A;  3FBC A;  4FYW B;  2PMW A;  1VJQ A;  2GQC A;  1MG7 A;  4KYZ A;  2K7J A;  3SBM A;  3H5X A;  3P3D A;  4GKJ J;  1NHK L;  2J0X A;  4QWC A;  4TU8 A;  3D1O A;  5KFJ A;  2PFD A;  1MU2 A;  2XZD B;  2LEB A;  3H4D A;  4LSL A;  3I82 A;  1HHT P;  2MZR A;  1NDL A;  1V3S A;  5D3G B;  2RRB A;  4URS A;  4DLG A;  3ITH B;  5K8P A;  2E1A A;  4LRF A;  3KHG A;  3CGI A;  3PJ9 A;  3K0J A;  4TY9 A;  2R7R A;  2JDJ A;  3QNW B;  3SQG A;  4JI5 J;  4CO3 A;  1UVJ A;  3N6N A;  2R8H A;  3CCT A;  1R8B A;  2RIL A;  4DR1 F;  4F3M A;  3GIM A;  4CLF A;  1H38 A;  3I56 S;  4ICL A;  1CJK B;  5LJ3 Y;  2CQP A;  3O3L A;  4CM0 A;  3RBD A;  1N54 B;  5HI7 A;  1B64 A;  3L9Z A;  1RAO A;  4WXO A;  4OX6 A;  3KJV B;  4ZN1 A;  3W2W B;  4EO8 A;  2DR7 A;  2HVI A;  3CIM A;  4KV8 A;  2PMH A;  1YJR A;  2AYG A;  2IYI A;  2KJW A;  1TKZ B;  5H9F K;  3JAM U;  2XO6 A;  3QWP A;  2W9C B;  3ETM A;  1IR2 A;  2PE8 A;  4YR0 A;  5KFQ A;  4WF9 Q;  2QO3 A;  2Y1I A;  3I55 S;  3CDE A;  3PX4 A;  2CKW A;  3R1H A;  4IG0 A;  3LWM A;  2CWK A;  2FB0 A;  1FRX A;  4JI6 F;  4NLR A;  2V2K A;  3C6U B;  1MWY A;  1LFP A;  3OR2 A;  4DX6 A;  4FZV A;  1SCJ B;  2WBM A;  3DLK A;  2YKQ A;  3MM7 B;  4NXM F;  3G6Y A;  3OVB A;  3TVK A;  3EVW A;  2BJ9 A;  2DNP A;  5ETS A;  3AY0 A;  3D4J A;  4KHM A;  1B0T A;  1C1C A;  2O66 A;  2XGQ A;  2FVC A;  3AOA A;  2YWK A;  3GJS B;  1YGY A;  1O8B A;  4RJV A;  2M52 A;  3MFH A;  4JB8 B;  2LXF A;  2HMI B;  4ZVG A;  2JEG A;  1OSD A;  2LKZ A;  4J91 A;  1U45 A;  1F6T A;  1IKV A;  5DG9 A;  2HLU A;  4WK3 A;  2FZK B;  1WKJ A;  3NGU A;  3LAN A;  2V67 A;  1KR4 A;  1WOR A;  4DS5 A;  2HHU A;  2UV8 G;  1O0P A;  3A13 A;  3BJY A;  4ZVQ B;  4DV6 F;  4EBD A;  3CDB A;  2F8E X;  2ZH3 A;  3UQS A;  2GIQ A;  2ZH4 A;  4LFB F;  4OHX A;  3BRE A;  1NND A;  1U02 A;  2J9C A;  3TZZ A;  4I1T A;  4DV2 J;  2V63 A;  3LGN A;  1HKA A;  3T6B A;  4K5R A;  4ANC A;  1SUQ A;  2K06 A;  4Y2I A;  4CTA B;  3SDE B;  1APS A;  3A4T A;  2B7B B;  4FKX A;  2VBZ A;  4KGK A;  2A2D A;  1JWW A;  3IA0 A;  4USK A;  3W7B A;  4K2J A;  5A0Y A;  5DGB A;  2WB1 D;  1FDB A;  3GB0 A;  1SVD A;  4NPO A;  1U2F A;  4ZVO B;  2V4J A;  2W9B B;  1OYD A;  4K7Q A;  2R7Q A;  2FQQ B;  1HAR A;  2ZFH A;  1JLG B;  3CCW A;  4LFC J;  1RI7 A;  2PMZ D;  1S57 A;  3HFZ B;  4ECR A;  1SKW A;  4DR4 F;  2CZ9 A;  2HNY B;  1CS4 A;  2RQK A;  4NML A;  4CLS A;  4KQZ A;  1HYS B;  4KGM A;  1AUS L;  1NZ8 A;  3CCE S;  4NXN J;  2KVI A;  4KIA A;  1QAI A;  1JNZ B;  5BXI A;  1YWX A;  1U25 A;  2V8P A;  1JJH A;  2GMH A;  2R8G A;  3W8G A;  1HHQ A;  4DV7 F;  1NK8 A;  4WKR A;  1U1O A;  2MDA A;  4C8O A;  4ZPC A;  1URN A;  3FEX B;  4DUZ J;  1UTA A;  1TP7 A;  5L9X A;  3KLE A;  3OTO J;  3DGP A;  4IH5 A;  1VFJ A;  4DG1 B;  3RRH A;  1F2H A;  3IG1 B;  1WSV A;  1TAQ A;  1RHJ B;  4PWD B;  3D66 A;  3HFK A;  4ED3 A;  2HHH J;  1T11 A;  4DLE A;  1IBM F;  4BS2 A;  1XNR J;  2HFZ A;  4OMF G;  3Q8Q B;  2CJ9 A;  2EFQ A;  1YJ9 S;  3UWT A;  1HBO B;  4DR6 F;  3JXO A;  1LWE A;  3J7A N;  2BRK A;  3UDL A;  2E5L F;  2DT9 A;  7FD1 A;  4AUK A;  4QPX A;  3R97 A;  4H4O A;  2C3P A;  2PN6 A;  1FE4 A;  2UUC J;  5HVG A;  1LWC B;  1FEH A;  2ZHA A;  4ZOS A;  4IO9 Q;  4DV5 J;  2AGO A;  4UF4 A;  3F41 A;  5D0E A;  3PW7 A;  3M2V A;  3G6E S;  1IR0 A;  1KTQ A;  4R5P B;  5AXL A;  4OYO A;  4CH1 A;  3SI8 A;  3M8Y A;  4RU9 A;  3H4B A;  2NZ4 A;  1UVN A;  2HBY B;  1HBN A;  5JVG Q;  4IFY B;  3ONQ A;  2BEF A;  1U49 A;  2KXF A;  3NG8 A;  2I5J A;  4EI2 A;  5D0H A;  5IWA F;  1QAY A;  2DH9 A;  2QLB B;  1JXE A;  2YKA A;  3MWB A;  3IC1 A;  2DBB A;  2JRS A;  3EZU A;  3LP2 B;  3I5C A;  3MI7 X;  3DRP B;  3M1V B;  2DKO B;  1S49 A;  4NZ6 A;  2X51 A;  3LA0 A;  5C24 B;  4WXW A;  2VG6 A;  3M2R A;  1JXV A;  2RQC A;  2QA4 S;  1SJQ A;  3FDS A;  1PBA A;  3K5M A;  4KH0 B;  1S1X A;  5J2N B;  4WPA A;  4JI2 F;  4FYV B;  2GVZ B;  5A8W A;  4DQI A;  2N7C A;  2E5J A;  4OYP A;  2DGS A;  3MEE A;  3GFY A;  3A8E A;  1SL1 A;  3POT B;  2CXE A;  3TA2 A;  2JFK A;  1T9Y A;  3HHL D;  4I2P A;  3CCL S;  5J2Q A;  3H5Y A;  3KG4 A;  1X5T A;  2C3O A;  3OXF A;  4C2M A;  1FVQ A;  2XB2 D;  1SV5 A;  1OQ6 A;  5MAO A;  4DEZ A;  1NJW A;  3VAK A;  4TVA B; 
#chains in the Genus database with same CATH homology
 4U7U D;  3QRP A;  5H9E K;  2Y9H A;  4QYZ K;  3QRQ A;  5H9F K;  5CD4 A;  2Y8Y A;  3QRR A;  2Y8W A;  1WJ9 A;  4DZD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...