1YIJS

Crystal structure of telithromycin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
81
structure length
81
Chain Sequence
SWDVIKHPHVTEKAMNDMDFQNKLQFAVDDRASKGEVADAVEEQYDVTVEQVNTQNTMDGEKKAVVRLSEDDDAQEVASRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S Ribosomal RNA
publication title Structures of MLSBK antibiotics bound to mutated large ribosomal subunits provide a structural explanation for resistance.
pubmed doi rcsb
total genus 20
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2005-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF00276 Ribosomal_L23 Ribosomal protein L23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1yijS00
3P49B 1WTBA 2X1FA 2M7SA 1X4CA 1IQTA 1X4EA 2G1DA 1U1NA 2HZCA 2DHXA 3NMRA 1A7GE 2XNRA 3RW7A 3MUTP 1UW4A 2RRAA 2MGZA 1KD1T 4F26A 1PO6A 1WI8A 2DGSA 2XSFA 2VODA 2MB0B 1UP1A 3THPA 2F9DA 5LXRA 2MKSA 2CQGA 4PRFA 2YTCA 1QVGR 2EK6A 2OTJS 1NU4A 1N54B 3SXLA 1U6BA 2MKCA 2EVZA 1WWHA 1X5PA 2L41A 1VQ5S 1O0PA 3MURP 2MYFA 2X1BA 4Z2XA 2KI2A 3TYTA 1U2FA 3VAKA 2LQ5A 2ZJPQ 1FJ7A 5DDQC 2XB2D 2O3DA 2M2BA 2DHSA 2CPZA 2FY1A 2CPJA 1OPIA 2AYBA 3UD4P 4WIIA 2DGOA 3BO4A 2M8HA 2I38A 4QU6A 1Q81T 1VBXA 3TO8A 2RS8A 3LPYA 3G6ES 2CQPA 2PEHA 3CPWR 2QA4S 2CJKA 3CUNA 3VAIA 3CC7S 1X4DA 2JRSA 1YIJS 2FPHX 1QM9A 1WEZA 3H2VE 3NNCA 2MQLA 3Q2SC 2LXUA 1VQ4S 2PE8A 2MHNA 2JVOA 2OSRA 1WF2A 2YH0A 1VC0A 2DK2A 1N88A 1X4FA 2LEBA 2JVRA 1Q82T 3TP2A 1X5SA 2MKKA 2M52A 1KOHA 1WHWA 5LXYA 4WF9Q 4C4WA 1KC8T 2RS2A 1U1PA 4Y0FA 3NNHA 2FC8A 2LCWA 1B7FA 2M0GB 2RQ4A 4ERDA 1RKJA 4QPTA 4UQTA 2LYVA 1WG4A 2MZRA 2CQ1A 5LJ5Y 2WBRA 2DNYA 1WI6A 2MSSA 2KRRA 4F25A 2MZ1A 3CCUS 2D9PA 1SXLA 1OWXA 1WG5A 1JJ4A 3JB9k 4ZKAA 2HGLA 1DBDA 2DITA 1K8AT 2MY8A 2MKIA 2CPEA 3MD1A 1U6FA 1YTYA 5ITHA 1BY9A 1S79A 2MMYA 3R27A 3CF5Q 3CXCR 4PR6A 4ED5A 3VAJA 1URNA 1FJCA 3P5TL 4IOCQ 2MQPA 2BZ2A 2DGVA 2AYMA 3MXHP 3V4MA 2YH1A 5GVQA 4EGLA 1U1MA 2MQNA 2KYXA 2KVIA 3VF0B 1KQSR 3CCRS 2F9JA 2YWKA 2KHCA 2AD9A 2AYEA 5MLCV 2CQ2A 2N82B 3UCZP 1WHYA 2DGTA 3MUVP 3P6YC 2XS2A 2JWNA 3BO3A 1NJIT 2LEAA 2DNPA 2VONA 3UE2A 1VC5A 2CQDA 3BS9A 2ADCA 2DGUA 1N52B 4TU8A 2RUGA 2N7CA 2MXYA 3FEXB 3U1LA 3US5A 2KM8C 3N9UC 5IM0B 4FXWA 1X5TA 2KFYA 1P27B 1SJFA 3CCSS 1DZ5A 2DIUA 5DETA 1P1TA 3H2UB 1DRZA 3CD6S 2N3OA 1WG1A 2M70A 2CQ0A 3BEGB 2RNEA 3D2WA 5DDRC 5CA5A 3R1HA 5FJ4A 1FHTA 1Q86T 1H6KX 1VQOS 2MZTA 2LA6A 1ZZFA 1R8PA 3SDEA 3CMES 1F9FA 2HYIB 4W92B 2XNQA 2KG0A 1AUDA 2UP1A 5GADU 2DNRA 1JJHA 3CULA 4QU7A 3J7YU 2VOOA 1X5OA 1U1RA 5CYJA 5JVHQ 1VQNS 2DGXA 2A3JA 2JX2A 4YOEA 4F02A 2CQHA 2DNMA 2U1AA 1H2UX 1SJQA 2KG1A 2E5HA 2HGMA 2MJNA 2MY7A 4CH0S 2AYGA 2GHPA 2J8AA 2L08A 2DNLA 2KXHA 3VAFA 1KOOA 2KT5A 2KXNB 3UWTA 3CCQS 2E44A 1D9AA 2V94A 2LECA 1VQ7S 3S8SA 3G71S 3NS5A 2DH7A 1K9MT 1ZH5A 3G8TA 2XS5A 1WEYA 2M4MA 1ZZNA 1FNXH 1VC6A 3Q2TC 2KH9A 2CPYA 3NNAA 2CQIA 2DNHA 3J7ZT 2OJ3A 4Y00A 2HGNA 1RK8A 3CMAS 1NO8A 2CQBA 3VAHA 3EGZA 2K3KA 4WFBQ 1XN9A 4TU9A 1YJ9S 2KN4A 1WELA 4LMZA 2RVJA 1VQ6S 2YKAA 4WFNQ 1VBZA 2X1GA 1QVFR 3CCLS 2DNQA 3S7RA 3L3CA 4RU2A 3HHNB 2MKHA 1D8ZA 3CCMS 2E5IA 2KXFA 1WEXA 3OW2R 1A9NB 3MD3A 2MGZB 3G96A 1S72S 2DNOA 2DO0A 5HO4A 3G8SA 3LQVA 3B4MA 1JJ2R 2E5JA 4TU7A 1FXLA 3MDFA 4J5OA 2Q79A 2RRBA 1HD0A 3ZZYA 3RW6A 2LMIA 2MJUA 5DM6Q 2CQCA 4OZ0A 3R1LA 2MSTA 1Q7YT 3THTA 2BOPA 2E5GA 2J76E 2OSQA 2QFJA 1VQ9S 2NZ4A 1FT8A 5HL7Q 4CQ1A 3ZZZA 2MZQA 3CTRA 5GAGU 4LJMA 2G0CA 2F3JA 4FXVA 4IUFA 4IO9Q 5H1SV 1JMTA 1VQPS 3NS6A 3P3DA 3DLLQ 1X4AA 1M5PC 4W90B 3MI7X 5GAHU 4P6QA 1G2EA 2CPXA 5IFMA 1VQLS 2VOPA 1YJNS 1X0FA 1U1QA 1CVJA 1YJWS 1PGZA 2LKZA 1WHXA 3MOJB 3B4DA 2X1AA 3I55S 4BS2A 2ZJQQ 2CQ4A 3EGNA 2GO9A 1YITS 2DHGA 1U1LA 5DDPC 2CPFA 2J0QD 1SJ3P 2QEXS 3FEYB 2RU3A 1SJ4P 3DXBA 1X4BA 2MZSA 2DB1A 2I2YA 1UFWA 3IRWP 2MZJA 3CCVS 1K73T 1HL6A 2EK1A 2DNNA 3SMZA 3U1MA 1DHMA 2RT3A 3MUMP 5CXTA 2FHOB 4U67Q 2OTLS 3PIPQ 1VQKS 2ADBA 2ERRA 2U2FA 1M5OC 4OZ1A 3I56S 3CCES 2FC9A 1FO1A 1OO0B 3UCGA 5LSOA 1VQ8S 4IOAQ 2LXIA 1M1KT 3G4SS 2G4BA 5DDOC 2KU7A 5IQQA 4A8XA 1M90T 5JVGQ 1YWXA 2DGQA 4C0OC 4PKDB 2MQMA 1H2VZ 2D3OR 1HA1A 4WCEQ 2L9WA 2DO4A 2DNZA 4YB1P 1SJRA 2DNGA 3CCJS 3PIOQ 1WF1A 5IM0A 1R8HA 1HD1A 5LJ3Y 1YHQS 2HVZA 4YUDA 5DM7Q 1M5KC 2DNKA 2M88A 2M8DB 2CPDA 1U1OA 4V19X 4M5DB 2K8GA 1H2TZ 2MQOA 2MQQA 2SXLA 2MPUA 1YI2S 1WHVA 4QQBA 4WFAQ 2B0GA 3ULHA 3EX7B 3S01A 3S6EA 1X4HA 2DIVA 3HI9A 1N8RT 1U1KA 4TLQA 2XS7A 2DH9A 2CQ3A 2CPIA 5D77A 2DISA 5LSLA 1WF0A 3VAMA 3VAGA 4LIRA 2DGWA 3UCUP 4CIOA 3G9CA 4UY8T 2DHAA 2M9KA 1W2BR 5GAEU 4WKRA 1VQMS 2J0SD 2CPHA 1X4GA 1M5VC 1L3KA 5D78A 1FJEB 5BJRA 4C7QA 1UAWA 5GMKa 2D9OA 3K0JA 1OIAA 2NLWA 5EN1A 3VALA 2KRBA 2MKJA 2KM8B 2RQCA 3BO2A 2OIHA 3CC2S 2LA4A 1VBYA 2ZJRQ 3IWNC 3SDEB 2DH8A 3UD3P 4CH1A 3CC4S 2N3LA
chains in the Genus database with same CATH superfamily
3P49B 1NK4A 4K0KF 4LF6J 1TL3B 4J90A 1JLQA 1MG7A 1A7GE 2F65A 3ENQA 4FNHA 2W01A 1RAFB 2MGZA 2ZH6A 1PAUB 3D6HB 1NDCA 2HBYB 1C1BB 3DC2A 3K5LA 2HQFA 4EBDA 1HMVA 5D0RA 4OL8A 2E66A 3ZTSA 5A0YB 4ZA1A 1RI7A 4B02A 4A8FA 1OPIA 1FE0A 5DLFA 3UPFA 4XTTA 3SCJE 4QU6A 1KVJA 1JLBA 4ECSA 1XNQF 1UL3A 2W1BA 4ANDA 4IRDA 3A13A 4OHYA 3AA9A 3I32A 1R0AB 4KTQA 1URRA 3M2VB 4AT1B 1LW2A 2CNKB 4R8UB 4A8QA 2XZWA 3FK4A 3DRXA 2ZITA 5J2MA 3WDOA 2HFNA 4AXJA 3Q8PB 4LRFA 4DV4J 1SJ1A 4F04B 4OI6A 4R5PA 2LEPA 4I2QA 3MR7A 3GIKA 3PW4A 1WG5A 4RR5A 2IJRA 1DTQB 5KFMA 5IT9Y 1SC1B 5I3PA 1IBMF 4NCAA 1HHSA 3BBCA 2AIRB 1H0HB 5KFBA 2EWHA 2F1FA 2PA8D 1MU2B 1IXKA 1IR2A 3PW7A 3GQCA 2HPUA 1GTEA 2XLIA 4DF4A 1FI4A 4OJHA 1JKHA 2F9JA 5C42B 2V4JB 1WHYA 4ICLB 3UE2A 3NP5A 1JJCB 3CWJA 4MIAA 2OEJA 2NZCA 1PKUA 1DQ8A 2KHDA 1TP7A 2C42A 2HLUA 5FJ4A 2ILZA 4JI5J 1S7HA 1N36J 4KQZA 2VV5A 3BYRA 2HZVA 1Q7LB 5JMNA 4NYOA 4ED4A 1OSDA 3O44A 2J7UA 2JSXA 4ZPWR 2GGPB 2E7WA 2HGMA 4DSIA 4NXNJ 5JXSA 3GIMA 4UTGA 2A0FB 6FD1A 4DCJB 1F1BB 2YWWA 4OI0A 3O6QA 1V5VA 3SV4A 4KPYA 5C24A 4Y00A 1TL1A 4ZPAA 3CJSA 1HW9A 1XN9A 4WZQA 3TEGA 3EDRB 2VPWB 3RUBL 2RB7A 1RT3B 4RLEA 3R5JB 2W24A 1HI8A 2FB0A 1TUWA 1E6YB 3CNQP 3UO0A 2XZTB 2NXNA 2QFJA 4FF4A 1HNIB 3D1OA 1Q79A 1RBOB 2ZH7A 4RJVA 3DGPB 4DV2J 3ILLA 2H5EA 3TVZA 4M1KA 2VH7A 3HT3A 1F3VA 2K1RB 3EWGA 2PI5A 1U1LA 4K50A 4ZPCA 4WFZA 1X9MA 1FKPA 3D0HE 3DGVA 3DLEB 2JEGA 2F4VJ 2BANB 2XYPB 3C14B 1RTIB 2UXBF 2RJZA 1S4FA 1U8WA 3NWRA 4HT5A 5L1KA 3QO9A 1PC5A 1RTJB 1VR6A 1RE1B 4AL6A 2QG9B 4A8XA 1PYOB 1RHMB 4OZNA 2CAJA 4WCEQ 2ZBPA 3PIOQ 1T3OA 4GO7X 2FQQB 4NCGB 1RHUB 4DPOA 4GVLA 4YUDA 3GPAA 3CJ4A 4CCHA 4ZPDA 3H20A 5B09A 4N41A 3UDLA 4EBEA 4C8LA 2CWKA 3FCWA 3VHQA 2OP5A 2B0GA 1NNDA 3CD0A 1SIZA 2CPIA 4TQSA 5D4LA 4QYRA 1F9HA 2Z8QA 3FFIB 2DHAA 2CJYB 3MFHA 1QSSA 2GW8A 1UAWA 2ROEA 1T03B 9RUBA 4RUBA 1K1SA 1Q95G 3MM8A 2QSFA 4OYOA 1FF2A 4P2XA 2CRLA 4KO0B 1NHKL 2NYHA 3I96A 1VRQC 2WVEA 3MUTP 4RU9A 2PN6A 2QL5B 4K4YA 2K3IA 4X64F 4FS2A 1L3VA 4DR2J 4DL3A 1EP4A 3A8JA 2XY7A 5IQ6A 2H51B 5A2QY 2QLFB 2W2NP 3CJ0A 1FJ7A 2M2BA 3BKFA 4IRCA 2HWHA 4MYTA 1Y00A 4WP3A 3T9NA 1JWWA 1I3OB 4F2SA 5CZXA 3JQKA 5LT5A 3MZIA 4AL7A 4YR2A 1BHNA 5AT1B 1X4FA 4FKXA 3PYGA 3CSKA 5KFGA 1EAYC 2H3EB 4C11B 1X0PA 5F8LA 3P8BB 1U1PA 1C1CB 3WX8A 4CP5A 4DPTA 2DNYA 1BGXT 2D9PA 4DV0J 3ETMA 4JI2J 2ATCB 1UEVA 2HNYA 1IVZA 3NGTA 2LU1A 1FA0A 1S1WA 3GJSB 3I0SB 2JNJA 4WYLA 4F7VA 1RAIB 2HFVA 3BQ1A 3VZIA 2RF2A 3J81j 3AAWB 3G86A 5FLXY 3KK1B 3M2UB 3CCRS 4O3QA 2HG4A 3PW0A 2P9GA 3MF5A 2BE7D 4DG1A 3VGSA 3FEXB 4J9QA 2JLEA 2KM8C 1RT4B 3N9UC 1DZ5A 1Z2ZA 5B0DA 2JLFA 2UUTA 1S9GB 1LQ9A 3W8GA 1FD2A 1HARA 3D3BJ 3M9NB 3DN9A 3POTA 2UP1A 3NLCA 4RO0A 2ZUAA 1DQAA 5KFFA 4C98A 1NKCA 3GJTB 1NJXA 2A3JA 3FNNA 5BR8F 3NCPA 1N5YB 2HHQA 2U1AA 4DOZA 1KEKA 2OD4A 4CH0S 2GHPA 3VAFA 4J9MA 4IH5A 5AXNA 5A8WA 2JL9A 1RYSA 5A6PA 1Q53A 3NNAA 3GYGA 4HDHA 4RZRA 5KFLA 3H5UA 4YB5A 4UOFA 1MROA 4PUOB 3T3FA 1LW0A 1WELA 4NEYA 3T1YF 4XK8C 2V0NA 2DNQA 3MAAA 3S7RA 4U9RA 4PWWA 1WEXA 4OZ5A 4X4OA 1TAUA 1Q8LA 1JJ2R 3SQGB 3V6KA 2CFXA 3CCTA 4NLVA 2I0XA 2LMIA 2DR5A 1HQEA 4P52A 3ZZRA 2VA3A 2LVWA 2V6AA 1MWYA 5ETSA 1VJQA 3QQCD 3HX9A 3ITHB 2IMOA 2HURA 5IFMA 2QE5A 1X0FA 2VG7B 3T1AA 3F41A 1RA6A 5A76A 1OSCA 1OQ6A 3B78A 4RX6A 2AT1B 4ZK7M 2UUCF 4A8OA 3IAM9 2RT3A 4LF5F 2DR6A 2X3GA 4U67Q 3GIRA 2CVIA 4OZ1A 2B51A 4LR7A 3QT7A 4O4GA 1L3UA 2C3UA 3M8YA 2GV1A 4Y6IA 5KFAA 5DDOC 3JSMB 2PMZD 2G2ZA 5EX0A 1EX8A 4J9UE 4ZMMA 5LJ3Y 2FVPA 4EK2A 3D7SB 2QLWA 1UVJA 2MQOA 1WNEA 1CQMA 3GJQB 1IBLJ 2Q66A 4JYAJ 3S6EA 4EEYA 1JLQB 2WHOA 1ZA1B 3VAGA 5IT9U 4LIRA 3JTNA 3L09A 4QJVA 4DI6A 4JI8F 2H5JB 4C3LA 4X65J 3CMQA 5IT4A 2JZ5A 5I42A 3IR6B 2QLBB 2UUWA 4C7QA 5GMKa 4K2XA 2XULA 2PGCA 5EDWA 4B3RJ 3MHYA 4RW9A 4M95A 2HKEA 2NUUG 1SH0A 3QJJA 1D9DA 3QT8A 3OUYB 1XC9A 4RW6B 3RBEA 1YBAA 1JLBB 2OPSA 3IS9A 2WVBA 4HHJA 1KD1T 3FGVA 4QBUA 1S76D 2WZ1A 3THPA 3WZ0A 2F9DA 2H54B 5LOQA 4CM0A 4FPIA 1E6VA 1S1UB 3CD5A 2IAJA 2MTLA 3PJXA 4M5LA 5J2MB 3DRPB 2BXJA 3UN2A 1XR7A 2W9AA 2X1BA 4Z2XA 1XERA 4K8RA 2ZH3A 3QATA 4GKJF 4PXCA 1G3OA 1VFJA 3CCZA 4Q0BB 4P2MA 4TYBA 4H4KA 1TAQA 3CPWR 4CT8A 3OV7A 3CC7S 3TX8A 1GMUA 4K59A 1QM9A 2AJ0A 1FDBA 3C6TA 1VQ4S 5ETRA 1WF2A 1VC0A 3HO1A 5FDLB 3HXMA 3CJ2A 2VASA 3KJVB 4F3QA 4OHXA 1SL2A 2ZWOA 1B7FA 3KLEA 2W4PA 5HQLA 1VRUB 3OFGA 2RD5C 3TWZA 3CJKA 4DLEA 2C2DA 2HGLA 4QIFA 2NXCA 2CPEA 3W8PA 5M2UA 3CXCR 2NR0A 4M5HA 3VGUA 3J7A1 4Q43A 3PO5A 4Y65A 2OKQA 3GILA 1PCAA 2AJ4A 4GC6A 2KHCA 5D0HA 1FK9B 4HKQA 2AX0A 1NJIT 4ZN3A 4KGVB 3M8PA 5F0UA 4XO0A 1IM6A 5ETOA 1RBAA 1CJUB 2YXLA 3R9LA 1SV5A 3IRXA 4DV7F 1OY6A 4UUXA 2VU5A 4YMEA 1Z2LA 2N3OA 5CA5A 3OT9A 1TL1B 1Q86T 3KLIA 4PWDA 2QJ3A 1RAGB 2HYIB 4ECTA 2KG0A 3GG0A 2W9BA 2W2QP 4H4KC 3N01A 3DRYA 2GQQA 2JX2A 3TVKA 2CQHA 3TI0A 5GADI 2E5HA 1O8BA 5CHCB 2MJNA 1XBWA 4RKUC 4J7CA 3L95X 2C2NA 2DH7A 2Z57B 3BM7A 3RBZA 2DNHA 2G9OA 1OS5A 2DVIA 1B7YB 3KG4A 2WVCA 2RVJA 4DV1F 2F4FA 3HHNB 4JI0F 1QSLA 4IR9A 2AF6A 1FTCA 1SQGA 4OYBA 3DLGA 4C0HA 2VDHA 4TY8B 2F63A 1FJGJ 2IRYA 3RW6A 4C0BA 1D8YA 2IJFA 3IA0A 5EWGA 2NZ4A 3G8QA 4FYVB 3ZZZA 5GAGU 4ZVSB 4Y34A 4PABA 1Z1ZA 1TKTA 1HNVA 1X4AA 3BGUA 2GZOA 4C8NA 1HNZF 4LF7F 4FYWB 4OHZA 1SL1A 2LP4A 2X1AA 2EG2A 1FWPA 2JEIA 4NCBA 4X4TA 1Q5VA 5A2QU 2Z4PA 5J2NB 3C6UA 1X4BA 3HFVA 2HQGA 3OFHA 2XMMA 4RW7A 2KJWA 3DOKA 4ER8A 3DLBA 2FVQA 6AT1B 1X8DA 2OTLS 1ZM3A 1V9OA 5L38A 2XBPA 2IIHA 2LFVA 2W25A 5HVGA 3BZQA 4ID8A 1M90T 3PTWA 1YWXA 4LF8F 4J9KA 4LF2A 4R0EA 4YB1P 2DNGA 1CC8A 4M5NA 1M0SA 5KFPA 1RT1B 4WP9A 5LMUJ 3ZFVA 5K9FA 1KQKA 2W2PP 4A8MP 4CT9A 2C3PA 3A8IA 4JI1J 3HFZB 3EX7B 3S01A 1U49A 2XS7A 1LXJA 5A8KA 3H7HB 3R3TA 3H40A 1F6TA 4QPXA 3UCUP 1CULA 1V5IB 2AQ4A 3IWLA 1HLWA 5K8OA 5E33A 3PV8A 6FDRA 4DR4F 2EFGA 3K89A 5FLXU 2YKMB 3K0JA 1EP4B 4HDGA 2KM8B 2OELA 2RDDA 2M5YA 1IM4A 2DH8A 2B9WA 1WTBA 3C16A 5B0CA 2QN6B 2DY1A 2MDAA 4OX9J 1FRXA 4F26A 2FD2A 4Y3CA 3DXSX 4PRFA 2PD1A 4DL5A 1HI0P 4EFAC 5F0WA 2YQ3A 3DRRA 3DHXA 1VQ5S 2AP6A 1O0PA 1ZOTA 1FNMA 1WORA 4HTIA 3MMJA 2ZH8A 4ZOSA 5AJ3F 4DLGA 1REVB 2FY1A 4YHHF 1N0VC 4NLOA 2VJVA 4B9NA 2KKHA 4ZS6A 1S1WB 1X4DA 1IKVB 2DEIA 4OIXA 1BQMB 2YNFA 2RF2B 2WB4A 1U8SA 2OSRA 4YY3J 4NPOA 3TA0A 3W9HA 3MM6A 2RHQB 4ED6A 2P2CB 2HNZB 5KFXA 1X7VA 2ZBCA 4Y0FA 3K5NA 3QRPA 2ASDA 5EX3A 3OTDA 5LJ5Y 4J9NA 2A6MA 4X4RA 3T41A 4MIBA 1Y0HA 2ZOMA 2J9EA 2OUGA 2RDIA 1K8AT 1HBMA 4F2RA 1I94J 2BQUA 1S79A 4U7UD 1OJ4A 3IG1B 1URNA 4JI5F 2DR7A 1DURA 1O6XA 1GT8A 3A3NB 1N36F 1AB8A 1IKXA 2QGFB 2WK4A 5KFYA 4ZVPB 4DX8H 2DGTA 5J1EA 5B7WA 1JB0C 3BS9A 2YY3A 4NXNF 5KFCA 2UVRA 5L1IA 3US5A 2DR8A 1WOSA 1X5TA 3D4JA 5KFRA 4QW8A 1P1TA 2KT3A 3CD6S 2M70A 2CQ0A 4DWIA 3MEGA 2BE9B 1T95A 1MROB 3NBPA 2LA6A 4W92B 4K5SA 2EFVA 1BUXA 4Q2LA 1VOMA 2HVHA 2BKPA 3M1VA 1TKDA 3DFEA 2DNMA 2B4PA 2O66A 3W2WA 3FZBA 1FDAA 1HQEB 1TV6A 4MT1A 2XMJA 2HK3A 3UWTA 3CCQS 3NS5A 1K9MT 5IC4B 1NSPA 3R7BB 2V2VA 2NQPA 1NXIA 4LBHA 1N33F 3EGZA 3KG0A 2AZ1A 2KN4A 2B5JA 3RR8A 5KT2A 4L3NA 3GYXB 2X1GA 1HW8A 3A12A 3L3CA 3SSQA 2E5IA 1KFDA 4PG7A 4O23A 3BREA 3OHBA 2HBRB 3NG8A 5DM6Q 2MJUA 3KJFB 2XLJA 2OSQA 2BACA 3H59A 4O4GB 3HM9A 2R9LA 4B9SA 3VWSA 4G3IA 3WC0A 5GAHU 2WOMA 3CDWA 3ISND 4CYUB 4AFFA 1F5BA 3M6UA 3L7UA 4DR7F 1YJRA 1PJ7A 2VPYB 3LP0A 2ALYB 3DXBA 1RB0A 1W7WA 2NREA 2I6WA 2MZJA 1HL6A 3ZZTA 3N28A 1NAQA 3DDKA 4TN2A 4A48A 4DR1J 2I8EA 3MUMP 2VQEJ 3MM5A 2A2DA 1Y5LB 3CO0P 1XMQJ 2AGQA 1M5OC 2HS4A 1FO1A 3KOAA 1P9YA 1NJYA 2HSEB 3Q8SB 4PCQA 4DV3J 4U8VA 3MEEA 3Q8VA 5I42B 2ZDOA 2DXDA 1HA1A 2GS8A 3PKMA 2ZE2B 3K59A 1HD1A 2AJ2A 4RW9B 3HT0A 1H2TZ 3HSZA 1QE1A 1WHVA 3DLHA 2IPOB 2CG8A 2V4RA 4ETZA 1G1XA 5ETLA 1AUSL 1NKEA 5LSLA 1LK7A 2OPSB 2DBBA 3IS9B 5K5MA 1ELOA 5EUHA 4FVMA 4Q8EA 1FWLA 4HH1A 3BJYA 1ITPA 1GH8A 1L5UA 5E3RA 4FYYB 1W2BR 2R7QA 4QOTA 2RE1A 2HQ3A 4FF1A 2YQ1A 4MYUA 5D78A 2JFKA 2R7WA 1N32F 3ZZUA 2Q43A 3WX4A 2VBWA 2KFZA 1UEKA 3O5TB 3CC2S 3GR0A 1T3NA 3SQOP 3KLGB 4DHVA 1Y5IB 5L46A 2HRYA 3IP0A 2CA9A 2ZD1A 1ZTWA 2AU0A 1TELA 1F3FA 1YZ7A 3Q8QB 1PO6A 3EYZA 2DGSA 3W63A 5K8NA 1S59A 3C6TB 4OYZA 1KONA 2EK6A 2WVFA 5F8MA 1V3RA 3M8ZA 4RUHA 5RUBA 3MM7A 1RACB 3R5AA 2GMLA 3TAMB 1TL7A 5IT0A 2CNLB 4QR2A 3GE9A 3HSGA 2J6SA 2I38A 3G6ES 1S4EA 2Y1IA 4E2FB 3ILIA 4I68A 1S1VB 3I5BA 2MLXA 3GCXP 1Y4ZB 5F8IA 4C9DA 4HL9A 2EBGA 4LFCF 4CNZA 4LF9F 1Q82T 1X5SA 1NRKA 2MKKA 1KOHA 2NSBA 1UA0A 2DXEA 2IRXA 3M8PB 3HJVA 3GSIA 4ZVUB 4PG5A 2GMHA 2CJBA 5M2PA 3FRZA 3CCUS 3QWPA 1I5OB 2ZHOA 3IRXB 2RUSA 1DBDA 3JSBA 2CADA 4N5SA 1YTYA 1KQGB 2MMYA 3KLIB 4M5DA 3J7AN 2ZNYA 1B64A 4V19J 5HBMB 3HZEA 3MOZA 1N6QA 3P5TL 1TKZA 4CTAB 3KFWX 3MM9A 2XWYA 5HP1B 2MQPA 2W9BB 4WKYA 2YH1A 5GVQA 4H4OB 3E01B 2YWKA 2ZH4A 1S1TA 3L7PA 2BKOA 4USIA 4LIWA 1FDNA 1VI7A 3QSIA 4OJGA 4DU7A 4DSJA 1IJFB 2N7CA 5CH7B 3BSNA 2XGQA 2DEJA 3KXDA 4ITSA 3TA2A 3EZ5A 3MR3A 5IM0B 1ZM2A 1ICEB 2CIMA 3SCLE 3Q8YA 3QGPA 1CJVB 1R8PA 3JSYA 3QFHA 2QT7A 4F8RA 4ZCKA 1WOPA 3J81U 3KK3B 3ZZ0A 2G1HA 2HHSA 1YG0A 4EYIB 5KG6A 5E5NA 1UCNA 3OL9A 1VHIA 2OPQB 3R7NB 2J8AA 2FLLA 4F4WA 2CWXA 1H7XA 3QGGA 1HWJA 5HLFA 3CD7A 1Y3JA 4OI3A 4MFBB 1HWKA 3BGLA 1RADB 2KH9A 1TKTB 3AQOA 1UZDA 2CZ9A 4CO5A 1VBZA 3OTOF 2IA6A 1WSVA 2GVDB 4OX6A 3OW2R 4BCAA 1S9EB 3HVAA 2DNOA 2H48B 3C6UB 2E5JA 4RW7B 2IDLA 1YRXA 1KTQA 2HQIA 3P5BP 4AE5A 2FJWA 3T19A 1U7LA 1M1GA 4WIQA 1JLCA 3K58A 3AT1B 2OI2A 2G0CA 2NXEA 1PBUA 3P3DA 1TUVA 1U1QA 1CVJA 2HW3A 2DYAA 5C2CA 2Y9HA 5HMWA 1I51B 5G4DA 1TL5A 2HAFA 3CDAA 2MZSA 4M94A 4B3SF 2NCKL 3CDUA 4NA2A 2MLZA 1JXVA 1SI9A 3SMZA 4ZLNA 2HHHJ 2ABYA 3PX4A 4JYAF 2VPXB 5KT7A 5A8KB 2ADBA 2ZUGA 1RTHB 1HNXF 2QLXA 3DHWC 3CCES 1VQ8S 5G0RA 5J2PA 4JI3F 1CULB 3G4SS 3HHLC 4P2FA 5L8RC 4PPDA 4C0OC 2IBKA 2LQJA 3QGIA 2L9WA 3IN5A 4ZIVA 4MMOA 5F9LA 2E1RA 1C0TA 4B3RF 2NUHA 5KFEA 4KV8B 5K8MA 1JQGA 3ULHA 8AT1B 4JI7F 4GMKA 2DH9A 2DISA 5E2QA 1WF0A 2HNDA 2LLZA 3SFUA 4ZHRA 4DL2A 2R8HA 2NYIA 2XMUA 4KAIA 3OFEA 2B43A 1X4GA 4C8OA 4JI4F 1RWOB 2FVRA 1HBOA 1V6HA 3UDVA 4CLLA 2RQCA 3GFHA 3L9ZA 2VF3A 3VGTA 1HWUA 1VBYA 3FBEA 1FKOA 1L3SA 1N34F 4MKAA 2JOQA 3M6VA 4LFAJ 2QL9B 3LOUA 4ZVRB 2UV8G 2GHVC 4KHRA 2DHXA 3DI6A 2BX6A 1UW4A 2YX7A 4ELVA 2D3ZA 3HVWA 2MB0B 4DU8A 1BXNA 1G6BA 2VDIA 4WTYA 2BW7A 1RWMB 1JLGA 2MKCA 3PR5B 4ECUA 2CNOB 2G0JA 2BUNA 1UMJA 4P72A 1HYSA 3M32A 4I6YA 5DG7A 2YPZA 4QWCA 4N8NA 3IWXA 1NPPA 2XHWA 2CPZA 2HS0A 3M30A 4CRJA 2O5DA 2B4OA 3BQ0A 2IVFB 1UA1A 4RNMA 4ES1A 2YWHA 2HLTA 5IC6B 3WQPA 5KG2A 1X9SA 2VBXA 1EETA 4K4XA 4FS1A 1IKXB 3RAQA 3OL7A 3GFYA 4NI2B 1UFKA 2IRUA 4MK9A 3D6MB 2HHXA 3PFOA 3ILJA 5J1EB 4IDKA 1ZPWX 2UXDJ 4D3GA 1SXLA 1OWXA 1OYDA 4BHQA 5U47A 4USHA 1VS3A 1MN9A 1HQUB 2H4YB 3NBPB 2HVEA 3OL8A 1DTTB 1F2HA 1DJ0A 3UD5A 3HKWA 1N48A 2BYCA 5DGBA 3MR5A 3GB0A 4BWJA 3M1VB 3P6YC 1AFIA 3RG6A 2QSWA 1YGYA 1N52B 1GX5A 1SL0A 3RRGA 2MXYA 2FUG9 2F5GA 3R2DJ 4MKYA 3GMGA 5DETA 3MMBA 1PSDA 1J27A 2RNEA 5D4OA 2BJ3A 2IC3A 3IBFB 2HVDA 3EGVA 1PBAA 1QAIA 1U1RA 2VG6A 4DMZA 2OPPB 4OYXA 3FRYA 1DLOA 3MMCA 5IS2A 1IJEB 3DU5A 1EARA 2DNLA 1REGX 2HBZB 3KMQA 3MPWA 4C8ZA 3BKTA 2E44A 2V94A 3R5GA 1AA1B 1M5HA 3UNYA 5KG5A 4MKVA 3BSCA 2WOMB 4I4BA 4CLZA 2VKZG 2VICA 4PYAA 3R8YA 4B9MA 2OO4A 1D8ZA 4LR9A 1GXLA 4X62J 1S6UA 3LP0B 3EVOA 5M2RA 2I9SA 3G8SA 2H5IB 2LDYA 1FRMA 4Q8FA 2ZBQA 2RRBA 3UVJB 2FJVA 4DUYF 3KLFA 3AJDA 3MM5B 4XDCA 3NGKA 1VQ9S 4QIVA 4X66F 2BV3A 2C2EA 2XO6A 3RTVA 4FXVA 4IUFA 1RLDA 2VFVA 1HBNB 1H74A 2Z2LA 3MEEB 1SQFA 4DR3F 1NPKA 1HI1A 5DG9A 3JQMA 1RYRA 4BS2A 1VRTA 5A6WA 2UUBF 3H5YA 1JK9B 1B3TA 2ZHAA 3RZAA 2ZM6F 4IG3B 3SYZA 2WSFC 2VD3A 2ERRA 4D3HA 2JJ4D 1R43A 2YX1A 3C46A 4DCPB 2LXIA 1FX2A 4IYQA 5IWAF 3V81A 1H2VZ 3CCJS 2IM1A 1RWXB 4H4MA 5KFWA 1UZHA 1PIEA 3FSXA 4OYIA 1MMNA 5K14A 2XYGB 2CDQA 4GVBA 4DQPA 5DQHA 4DDFA 3LGNA 4ZVGA 1U1KA 3V5RA 4DPXA 1RT7B 3LWMA 2R7RA 5CYMB 2DGWA 2QFIA 4KC5A 3H8YA 3NCRA 4DL7A 1QSYA 2VFTA 1VK8A 3EUNA 4KBIA 2QA1A 4CLFA 7FD1A 2CVEA 5D3GB 4F67A 2V9KA 2DT9A 4P7VA 4B3TJ 2EKYA 1PYSB 3ZTQA 1TL7B 4OZJA 4O44A 4F3MA 1VQLS 3QPIA 5IZHA 2XSJA 3GV8B 4O0IA 1KHVA 4B3MF 1RHJB 4QWAA 2XNRA 4C6AA 5I3QA 3LANA 1H73A 1EKSA 2LQBA 5LXRA 4YDXA 1FDDA 2FGCA 2JC1A 4OV6A 4DSFA 2EVZA 3DOLB 3MMAA 4WE1B 4QR0A 2YWGA 1U2RA 2A1BA 1NDPA 2JEJA 4F3OA 5DZ7A 1CJKA 3FCHA 2XYHB 4WJBA 1S1XA 4URQU 3V2UC 5AE1A 4NRTA 4DV6J 1S5ZA 5A8RA 2IBOA 2AYBA 2DGOA 3BO4A 3P45B 3Q0AA 2E1CA 3HCXA 4WU2A 5J2QA 2ACYA 2GX8A 1JLFB 1I6JA 3U1NA 2EKNA 2W2MP 4JBCA 2DD8S 1LEOA 1TKZB 4FVCA 3C15A 4C97A 3SV3A 3GIJA 3OR1A 5LXYA 4C4WA 2POKA 2RS2A 4DX5A 4M63A 1NJZA 1IR1A 4UQTA 1SQEA 5KG7A 2KO1A 3MD1A 4USMA 2JC0A 4N47A 2M3DA 1T05A 1FJCA 4LUBA 1T9XA 4PAAA 2E7XA 3PJ9A 1IKWA 5MLCV 1V3ZA 1AW0A 2VC1A 3IXQA 3SIPB 4ZLPA 4HHUA 5DZ6A 3TZYA 3RBDA 4TU8A 1R27B 2UV8A 3HHLB 4URSA 4BLGA 2V8GA 4DZ6A 4DUZJ 4FXWA 2KFYA 3IBWA 3CCSS 2DIUA 1FTRA 2IM0A 3ENVA 1MN7A 2YBVA 2QV6A 1DRZA 1WG1A 4I64A 5DDRC 2B6AB 1U09A 4HI2A 3G6VA 1LWCA 3PKYA 3N6MA 4K0KJ 5GADU 4LF4F 3C66A 4ZLJA 2LXFA 3GLJA 2B4VA 4YOEA 4H54A 2J6TA 2MY7A 2VL1A 4KR0B 3HVTB 2JFDA 4Z7CA 1CBKA 3PO4A 4FN5A 2F7VA 2XS5A 1ZZNA 1FNXH 1SKWA 4IOBA 4Q45A 1Y7PA 4J91A 1XK8A 3MPUB 4TU9A 1YJ9S 4ED3A 1VQ6S 2RAQA 1UKUA 2PSZA 1FFSB 1XNQJ 3VQTA 2IM3A 3G96A 2EFPA 2KZZA 1XNRJ 3AQPA 2CXEA 3V6HA 4IO1A 2XMKA 4EWTA 4C8YA 1QAJA 5HL7Q 4CQ1A 3T5HA 4P71A 4TVAB 5B0BA 1V3SA 1YRTA 5G0RB 5J2PB 2VOPA 1TK8A 3Q89A 1ZPVA 3MPVA 1PAEX 2AJ1A 4MH8A 5T14A 1IBMJ 2VC0A 1XEZA 3QAEA 2OPRA 4KY3A 2HFOA 4CO2A 4OMFG 5C7PA 2FLPA 2GQ2A 2B3TB 4UW2A 3IRWP 3F56A 1R31A 3U1MA 1A6LA 1U48A 4DBQA 4HVZA 2HNDB 2U2FA 3UN3A 4ZP6A 2HIYA 1WJ9A 5BYQA 2VKRA 1KQFB 3AH6A 4Q7AA 1JNZB 5HSPA 1HIYA 1NHVA 2DO4A 3TZXA 3QMQA 4L73A 4MK7A 1U2CA 1RWNB 2M88A 2M8DB 1VGYA 3PVXA 4I6AA 1J5EF 4YR3A 1RAJA 3W62A 3PHEA 4QWEA 1NK5A 5D77A 4UUWA 2YNGB 3DI6B 1NJWA 1XMBA 1DFDA 2EW9A 3TW0A 2BJ7A 4WWSA 5E3CA 4WKRA 4BC7A 3D54A 4IFYA 2BABA 1FJEB 3W2VA 1Y3KA 5KFVA 1GNKA 2MKJA 5GAEI 1Q78A 4EBCA 3T5KA 1TKXB 1LWFA 5L1JA 1AROP 3SDEB 1HBUA 4JI6F 3MEDB 3QLHA 3MCSA 1FRLA 2WB1D 1M5SA 3M30B 3M8QA 1VMBA 3KHHA 3KTQA 3R5DA 4JP8A 2RRAA 1TTHB 3HHEA 4A8WA 1WI8A 4XDDA 1EETB 1RT5B 3P96A 4U96A 1WC3A 5D6GA 3LPEA 4KKOB 1N54B 1NLKL 1X5PA 3TAPA 3TYTA 1HKAA 2DRBA 1S48A 1NSKL 1AFJA 2B56A 3M7VA 3JYTA 3JTOA 4KFBA 1RWPB 5B0FA 1Q1KA 2VB6A 3PJWA 2F40A 2L3MA 1Q81T 4KHPF 3KDNA 3M6WA 1T11A 4DCOB 4OZLA 4C2MA 4B3OA 2WSCC 2JVOA 2UXBJ 1N88A 4B9VA 1Y11A 2M52A 3GV5B 2ZBRA 1ZAXA 3RB4A 2KTQA 1JLAA 4I6WA 4DSLA 1PYTA 3R7SB 4X4UA 4RW4B 3ET6B 5ETKA 2UU9F 4IG0A 2E1AA 1GK8A 2K2PA 3G82A 4LQ9A 4ED5A 3HULA 2H1YA 3TX0A 2J9CA 4IOCQ 3N6NA 1G4CA 2DGVA 4ILRA 3NY0A 1YLXA 1RA7A 3VF0B 2LU2A 2CQ2A 2J7WA 2RILA 3I9ZA 2QMXA 3KLHA 2KDOA 2DGUA 1MMLA 3DRSB 4N76A 3TZWA 4XPEA 4OI2A 2Z2ZA 4EZ6A 2WCXA 2EEYA 2ZC4A 2MZTA 4M8LA 4DQRA 3L4BC 1JX4A 4Y2AA 4KT0C 4FZVA 1TL3A 4DR6F 1VQNS 1X60A 1CJTB 2AGOA 4F02A 3UNGC 2RU9A 4ZVTB 3I82A 1FD8A 2Q3PA 4X64J 2KXHA 1KOOA 3QGHA 1OMSA 2XI3A 1C1BA 3THVA 3ADAC 4M5GA 3PYFA 5K20B 2ASLA 2DCLA 4B08A 3R2CJ 4ELUA 3CMAS 2CQBA 3J80Y 5A0YA 4C3MA 2PO4A 4B9UA 4FYDA 2KXFA 3QJLA 3K5OA 1TVRB 4LRDA 1BLUA 2PI4A 4ES3A 2FHJA 4ED7A 3R1LA 1R0AA 4ECRA 3THTA 3M2VA 3W9JA 4R8UA 3AD9C 1J5OB 4GKKJ 4XAKA 1S9FA 5KT6A 2EC2A 2F3JA 3Q23A 3MECB 4Y28C 4IO9Q 3DLLQ 3ISZA 5IV4A 5F8NA 2CPXA 4USWA 1SUQB 3V81B 5JJBA 2D7SA 1C0UB 3MOJB 1NSAA 3B4DA 2YKPA 3I9V9 1DTQA 4DSEA 3EGNA 1KR4A 4H4MB 4OYWA 4F0HA 3BSOA 3ZC4A 4AXIA 1SJ4P 2FZCB 2GNKA 1T7PA 2V2KA 5K14B 1UFWA 4UOHA 3CCVS 4UT4A 1MU2A 3PX6A 3C3LA 2IA0A 3TJAA 1R6VA 5C42A 1OO0B 2V4JA 5LSOA 4WPAA 1ROFA 1LOUA 3W66A 5IQQA 3NRBA 5JVGQ 4OI1A 1PG5B 2L9NA 3PZPA 2D3OR 3HSDA 1K0VA 3HKZD 4UOCA 1W26A 4USUA 4OZ3A 2VHGA 2XM3A 3TUZC 1RWVB 4QQBA 1YVFA 4RNFA 2DIVA 3D0IE 1C4AA 5BR8J 1RTDB 2GGPA 2V68A 4ED2A 4J9PA 2QMUB 4ZIWA 2FYXA 2XY5A 2HHPA 2NLWA 4OFZA 3VALA 4GRSA 1U45A 3RRKA 3NMAA 5L9XA 1JXLA 3LP2A 1NCLA 3D9BA 3P4UB 2FGOA 2ZKTA 3JSRA 2ZJRQ 2QZ8A 3T1YJ 4ECXA 2M7SA 1X4EA 2YNIB 4RW8B 3L7OA 1IKYB 2AW0A 2R42A 5HMYA 5D4PA 2W8LA 1RU2A 1RT3A 2R7SA 2XTJP 2KL8A 1E6YA 3C15B 1NU4A 3SBMA 1AYEA 1FRIA 3D28A 1HNIA 3DGPA 5DDQC 2B9XA 4CM2A 2Y8WA 1MW7A 3QBCA 3LGHA 2OEKA 2AWZA 1UTAA 3KNGA 3IFEA 5KFIA 4G6VB 1HPZB 2RS8A 2HK2A 4MJKA 2V63A 1VIXA 4WK3A 2ZWPA 2K1RA 1RAEB 3VAIA 1P8GA 3FSYA 2MQ8A 3E8OA 2UUCJ 4LF5J 5I4MA 2BANA 4FPRA 2DK2A 1RTIA 3CGIA 2GC8A 1RKIA 2QO3A 3G2XA 2JVRA 1NH7A 1XJWB 1WHWA 5ETVA 1KC8T 1RTJA 4DFKA 2H65B 2FC8A 5GMDA 1SPBP 4U6PA 2OFGX 2BJDA 4EMDA 2LYVA 3PW2A 3IAS9 1QY7A 4F25A 2IJNA 1FEEA 3OTBA 2CNNB 1QTNB 4ZKAA 2UXCJ 1RAHB 2R2TA 2DITA 4TNOA 2YKNB 4NCGA 4NA3A 2P6TA 1SVDA 3MAHA 4X84A 3KK2A 2R2SA 4PR6A 5HROA 4IQXA 2P9EA 3LP1A 2Q1LA 2CJ9A 1LWCB 2WONA 5J1PA 2BZ2A 4F4YA 4TKTA 2F8MA 2DPIA 1KQSR 2OGUA 2J5AA 2DNPA 4JI8J 4OLOA 3LF0A 1VC5A 5J1NA 3V6JA 4U95A 3T9ZA 3FFIA 3KUGA 1XTZA 2IYGA 2VFSA 3GTYX 7FDRA 2CDRB 4ED8A 3FMBA 2RHSB 4KPCA 4CLKA 1T03A 5F8JA 1FHTA 3WIUA 2D41A 3V4IA 4PXEA 4O3SA 4NZ0A 1AUDA 3A8KA 2DNRA 1JJHA 1S97A 3CULA 3KWMA 3HPOA 2VIHA 3MGJA 4LFBF 2Y0SD 3IM8A 4QW9A 1OY8A 1HHQA 3GP9A 4X62F 4IFVB 5KFJA 1D0EA 2KG1A 3RB0A 1SH3A 3J7YI 3IC1A 4JV5F 3JAMY 1DQ9A 1QUVA 1ZAVA 4UQGA 1WEYA 1FWKA 2GA7A 2VA2A 5LMNF 4GKJJ 1NZ8A 1KVIA 3VAHA 3MCMA 3BPDA 4LMZA 4PG8A 3J7Z5 1YBTA 3CCLS 1T9VA 1NK9A 2MGZB 1S0MA 2V5HG 5I3UA 3R5CA 1KKHA 4ETXA 4OYPA 2Q79A 4Z7YA 1D09B 2APOA 3PEJA 4KGXB 2E5GA 4NRUA 1HMVB 2ROPA 1RDRA 2IVYA 2OD6A 4XPCA 1OQ3A 4ILMA 1QLNA 4NLWA 1PGZA 2LKZA 2CG4A 4Q2MA 4DV5F 3AOBA 2B8QA 2J0QD 2R8KA 4NLGA 1QUPA 2Y1JA 3I0SA 3R6GB 3KYLA 2DNNA 5KG0A 1LW2B 3NKYA 3KK1A 3T1HF 3EVMA 1HR0F 3FBBA 3PIPQ 1VQKS 5KT3A 3I56S 5B08A 1B0TA 2XCPA 2V69A 2PFDA 4NWBA 2E9RX 2UUAJ 8RUCA 3OD2A 2DRAA 4R5PB 1YX2A 4I2QB 4KRWA 1C4CA 2MQMA 3W2VB 2G2OA 3D66A 3HVRA 1R8HA 1U0HA 2W7OA 2PA3A 1S9GA 5AE3A 2GAGC 1LV5A 4NEZA 3TR5A 2AZ3A 1RT6A 1U1OA 4B3TF 3CDBA 2G0IA 1X31C 1N5VA 1HBUB 3FJ2A 1RAOA 3QLHB 1ZAWA 4YB6A 4WTOB 2KJVA 3C2PA 4X2BA 3HI9A 1JKHB 1N8RT 3I5CA 5KFQA 1YKWA 4TLQA 4DR5F 5LSRA 1NPRA 1YJVA 3PYEA 2CJAA 1YSJA 1GQEA 3ICLA 2Z2YB 1XQIA 2C28A 1UPPA 1UJ5A 2BW2A 2HQDA 3EZOA 4DX7A 4DL0C 3K17A 2FJDB 4CLSA 3TZZA 1Q0NA 3W1YC 3W3SA 3OVBA 3BR9A 3BO2A 2QTWA 2E9ZA 1XMOF 1XR5A 4GO5X 1VLOA 3IWNC 5DJBA 5C2GA 4PUOA 2EXUA 3HDSA 4KFBB 1U24A 2Z30B 2G1DA 4DV1J 1U1NA 2IMWP 3BN4A 4JI0J 2E5LF 1S7IA 1NBEB 3RW7A 4DL4A 4A47A 2BJ8A 2W4DA 4O3NA 3SQGA 4OYAA 2MKSA 5FD1A 4B3OB 2YTCA 2OTJS 4O4RA 3SXLA 3LWLA 1RHRB 2QC3A 2CZ4A 3LAKA 2HQCA 1U4BA 1NSQA 3FC9A 5C24B 2KI2A 3BDPA 2JDJA 1HNZJ 1Y10A 4LF7J 2R7VA 1VBKA 4PPZA 2FJEB 4IG0B 3G82B 2IDEA 1LWEA 2WW8A 2I5JA 2E9TA 4PQAA 3LH2S 2J8SA 2LEBA 1WACA 3N5FA 3QAUA 3Q24A 4TYAA 3G87A 2BQRA 2IM2A 4JUZA 3BGOP 3KLHB 3IO1A 3FKBA 4E98A 2Z56B 4NMLA 4LF8J 3JSMA 5B0EA 2MZ1A 1EIYB 4LBIA 3FQKA 1JJ4A 2MKIA 1FRKA 4DUZF 3QT6A 4P73A 2O01C 1SIWB 3R27A 1FKPB 2VBZA 1RCOB 3CF5Q 1H38A 1KRPA 3OR2A 1DY3A 5E3AA 4RBVA 2V50A 2XMWA 4J37A 3I4HX 3M9OB 3QO9B 2PMHA 4DR4J 2VQFF 4CLYA 4M5JA 4PXBA 3QIPA 3Q83A 2XC9A 3CJ8A 3M2RA 4OV1A 4ZP7A 3PNIA 1WTFA 3BEGB 1CLFA 3EJMA 2V8VA 3R1HA 1MWZA 1S6PA 1H6KX 3LAMA 1VQOS 2FIUA 3CMES 1IBCB 3LA0A 4QYZJ 5D8HB 4AQYJ 3OUYA 4ELTA 4UOGA 4RW6A 2BJEA 4ZCLA 5CYJA 4WFYA 5JVHQ 4OQJA 1SJQA 3BYPA 4NXMJ 3TOQA 3WC2A 1XNRF 4I2PA 2GQCA 3VQSA 3QZ8A 4CZCA 2GCFA 2F8EX 1S1UA 1ZH5A 2VG5A 3ZZPA 3X1LB 3DRPA 1UPMB 5AJ3J 2CQIA 3J7ZT 1WC5A 3MM8B 3M8SA 3K57A 2D74B 4YHHJ 3FCVA 4PWUA 3O2IA 4I67A 4Q0BA 4LF6F 5SUHA 5HN0A 4RU2A 3DDNA 3B4MA 4L74A 1HD0A 3RGIA 3KUHA 1U02A 2ZEJA 2ZFHA 2DHHA 1FT8A 5FDLA 3CDEA 4K4VA 4LJMA 1S0NA 5AXKA 3KJVA 4DPUA 4KGZB 2IFXA 1BWEA 2NPFA 1VRUA 2DXFA 3M05A 1BC6A 4WBFA 1UVLA 2P8IA 3DLJA 2CPFA 1SJ3P 2QEXS 2BJ9A 5EGYA 3KKFA 1MLAA 3UDCA 1NB2A 3N79A 4IH6A 4A8KA 2V8DA 1FK9A 1N0UA 4DQIA 9ATCB 4DV4F 4Q44A 4AD6A 4ECZA 1IR0A 2DGQA 1CJUA 3DOMA 4A8YA 5KAKA 5GMEA 2HNYB 2DNZA 1NK7A 3BH7B 4EO8A 3PCOB 2C3MA 5ETPA 3LP2B 2OH2A 2DNKA 4ENOA 3TRGA 4V19X 2QLJB 4AYBD 2CJXB 4DFMA 1BQNA 1F5CA 4USVA 5F41A 4U7CA 1NUEA 4NYZA 1TZ0A 1B0PA 1SC4B 3ZNJ1 2ZDPA 4KH1B 1HNWJ 4JV1A 1SH2A 2FVCA 4DG1B 3NOGA 4WP8A 3AY0A 3BDEA 3UR3C 1OIAA 4WXWA 5F8GA 1CS4A 1GEHA 2BJ1A 5CD4A 2C3OA 4NOHA 3CJ3A 1N33J 3UW1A 3UD3P 4S0MA 3POTB 2E29A 1B0VA 3CJ5A 2HZCA 4LVOP 1NK6A 3NGDA 1S77D 2XG8A 2R8GA 1ZYQA 1UP1A 1RU1A 2C3YA 4ED0A 2CQGA 3GR1A 1SKRA 4TY8A 2VUGA 4KYZA 3TNVA 4L75A 5A8WB 5THWA 3TARA 4OJ1A 3ELHA 1S99A 3K7RA 4P10A 3I5AA 3Q22A 1LXNA 1WKLA 1NM2A 2PEBA 4WYWA 1LW0B 1QD1A 3EXYA 2CPJA 1ZS6A 1WKJA 3JQJA 3UD4P 3MAAB 3JAMU 4DR7J 1CC7A 4WU3A 7AT1B 3F73A 2CQPA 2PEHA 2XCAA 3X3UA 2E1PA 2JRSA 3KK2B 5J2NA 5HROB 3LP1B 8ATCB 3W9IA 1VYAA 2WONB 1KFSA 3D67A 1YDLA 3UR0A 5DG8A 2FJAB 2V2QA 3BH6B 2P9CA 1T02A 3SSSA 1YK9A 3RR7A 2V8PA 4F0MA 4DV2F 3S1TA 3C19A 1CEZA 3BV8A 4K4TA 4YN3B 4HYKA 5CABA 2WTFA 1RT1A 2HFZA 3GSDA 1ULRA 3V4IB 1NH8A 2GJFA 2QRRA 2F4VF 4EUVA 1FFGB 1H72C 3CIMA 3NAIA 2Y0BB 5E3QA 2JWNA 1UJ6A 4HHHA 2ASJA 4L3KA 2ADCA 1O5JA 3KNAA 1C2PA 2ZZMA 1N32J 4PG6A 4FDFA 3TQ1A 1P27B 2YKMA 2K7KA 1S10A 2HFSA 3H2UB 1IBKJ 2WVDA 4HH0A 1QDUB 1ZZFA 1MMDA 2AEMA 2HS3A 4QU7A 1FNOA 3OPKA 4K4UA 5H9EJ 3AFGA 5I3UB 2DGXA 2G2YA 3SFGA 2ZZTA 1VK3A 1H2UX 3PY8A 1Q4RA 1FXRA 2L08A 3A4TA 2JH3A 5HQMA 2Z58B 2KT5A 3MFIA 4QCLA 1TFWA 4GKKF 1NDKA 2Z0GA 4XIUA 4L6V3 3AA8A 2K3KA 2E1MC 2E7VA 1YJ7A 1REVA 2C2KB 1XWLA 2XWXA 4ECWA 4A8SA 1S72S 2Z2MA 3LQVA 1IKVA 4TU7A 4J5OA 2AX1A 3DKDA 1BQMA 4LFCJ 1VQSA 5CZVA 3HP6A 1Q7YT 1E6VB 2GFFA 2IAJB 3MCNA 4LF9J 2OHDA 4DR2F 2ZC3A 3GFXA 3CTRA 3LO3A 1K1QA 2HNZA 3U02A 1LFWA 4Y2MA 3MI7X 1T94A 1TK0A 4PG4A 1G2EA 1KHWA 3Q8UA 2C2RA 3V6DA 2FLNA 4OHVA 1U0HB 2RRNA 1S49A 5C25A 4FF3A 1RT6B 2R7OA 3NOCA 3H4BA 1K73T 1BQXA 3IG1A 4ZP9A 2FVSA 4X4SA 1FERA 4QIWD 3KLEB 1GMWD 3QRQA 4TLRA 3CJKB 3JS9A 4DV0F 4JI2F 3H2LA 1SJRA 3UI3A 1WF1A 2QYGA 3OBIA 4NZ7A 5B0GA 2HHUA 1YHQS 3T5JA 4K4SA 2K8GA 4ZVFA 3GV7B 2HIQA 3FVYA 4KGMA 4NZ6A 1PJ6A 4C48A 3DU6A 4GC7A 2W7AA 4I69A 4F4AA 4C8KA 4CIOA 3ZTOA 4O3PA 3TA1A 1SCJB 2HHTA 3TEHB 5GAEU 1SV5B 1L3KA 3GFZA 5BJRA 3EDQB 3MPYA 3MR6A 4OJ3A 1WKKA 2GO8A 2YKOA 3RAXA 2BMBA 4PWDB 2N4CA 1D1UA 1HWLA 3OTOJ 1ZTTA 4LRBA 1FRHA 3MEKA 2AV5A 1BMQB 1LWEB 2VODA 2I5JB 2EFOA 2R4FA 2BOAA 1EQMA 1D3WA 3HMJG 3TUIC 4N7TA 4LQ3A 2MYFA 2YX4A 1U2FA 4PXDA 1B4SA 2XB2D 2O3DA 2DHSA 3KDOA 3DMJA 4CYUA 5K8PA 3VZHA 5EWFA 2WBMA 3O3LA 2UXCF 3TANA 2CJKA 3DLGB 4L72B 2C2ZB 2OFHX 4B3SJ 4MIWA 3OR2B 4WFXA 4CI0B 1EQ0A 2EG1A 2EFQA 1HNXJ 2XZDB 2ZOFA 4P2SA 1S0OA 3TVYA 1HNVB 1PILA 4P75A 4JI3J 3PXGa 1RHQB 2I1RA 2L48A 4ERDA 1RKJA 3H5SA 4QPTA 2P6SA 1WI6A 1H7WA 1GAOA 2KRRA 2VFUA 4KE5A 3PYDA 3NWGA 3LTOA 3OJUA 3QIPB 3OL6A 3M2RB 4QYZK 5CD4H 2ZE2A 5ITHA 3SSRA 1KSPA 3A1YG 1S6PB 3DOKB 3FZ2A 4JB8B 3ZTPA 3ZZOA 3AB4B 4JI7J 4FKYA 5HJXA 2JLGA 2HHWA 4ZITA 5E41A 3BPSP 2XS2A 2BM1A 4I2PB 5AXMA 4JI4J 3ZXWA 1RBLA 3H5XA 2DCUB 2V4QA 5FIIA 4NLYA 2VG5B 3CO9A 1UVKA 1RXOB 3D2WA 1N34J 3KLGA 2CUYA 2OMOA 5IOLA 3MAQA 4RNNA 2XNQA 1IBLF 4O3RA 4RWXA 2VOOA 4ZDNA 3M4XA 3U27A 3M8WA 4ZJQA 4K4WA 4DF8A 1R7IA 5KFDA 4X65F 3AOCA 2NXUA 1WC0A 1D9AA 1VQ7S 4N8OA 2M4MA 1RGVA 2QIFA 1PC4A 2ZH5A 2CPYA 3TAMA 3AXMA 1HWIA 3C16B 2XGPA 2XO7A 1GTHA 4ILLA 3CCMS 1KLNA 1TL4A 1ZM4A 3HSJA 1A9NB 1OPZA 3TQEA 5HO4A 2F8HA 1SB6A 3CJTA 3LGMA 1S1VA 1KWMA 3RAMA 4DX6A 2JHEA 1F60B 2O1PA 2J76E 4ECVA 1LFPA 3DRRB 4OHWA 1R0CB 3QSYB 2MZQA 3D68A 1RAAB 4KSEB 4MK8A 1UWAA 3T6BA 3AXKA 3QIDA 4P6QA 2UUAF 3DOMB 4N77A 5DO2A 2ZJQQ 3PRDA 3DLKA 3EPIA 1Y9OA 1G7CB 1SKUB 3W5ZA 2A10A 4MAKA 1EZZB 2DB1A 1WSRA 2YNFB 1BQNB 1HHTP 4C8MA 5HBMA 3W60A 4CTAA 3MM6B 2ZHBA 5HP1A 4H4OA 3DNCA 3E01A 3OXGA 4LSLA 3JTPA 3OLAA 1T8EA 2W9CA 4X4VA 4BWMA 4Y2KA 3EMTA 4OZ2A 4RPFA 2IVMA 2HRTA 4M5MA 3ZO7A 1S0VA 1X9WA 3OXFA 4PYDA 3R97A 4MTPA 3GYNA 1HBMB 1RUSA 5IM0A 2WW4A 1CS4B 2HVZA 3BN7A 4EI2A 4B9LA 2D3O1 2MPUA 2ZVSA 2FJXA 1CJVA 3UDEA 1IWGA 4V1Ak 3WHIA 1X4HA 4HI1A 2CQ3A 3DYAA 3HHLD 3FMWA 4RWWA 3KK3A 2RH3A 1SKSA 3G9CA 3CJQA 4FBTA 2PIIA 2J0SD 2OPQA 4PQUA 3K8VA 1ZBTA 3MR2A 1QTMA 5EN1A 2C1EB 2AEFA 5CCMA 2OMLA 5D0EA 3EGWB 4MFBA 3MEGB 1M1HA 3I0RA 5KG3A 3LALA 3D6FB 3CC4S 3SCKE 4DN0A 5KFHA 4NLPA 2GVDA 5DLGA 1S9EA 3EPGA 1RLCL 4YEAA 1TR0A 2GJIA 3W2WB 1GX6A 1QJHA 2R8IA 4DUYJ 1TV6B 1QVGR 4BDPA 2J0WA 1JNRB 4X66J 4LF1A 4LSNA 4UZBA 3VAKA 2ZJPQ 4DR3J 2YNHA 3TUPA 3J81Y 2B5JB 1NDLA 5LL6d 4ECYA 1K0TA 1N56A 3CUNA 2UUBJ 2DPJA 2IHR1 2LQ9A 4ZVOB 2ZM6J 2R7UA 1FJGF 2LXUA 4KJIA 2RQKA 5KFZA 3TP2A 1RTHA 1PJ5A 1UJ4A 4X4PA 3OTEA 3CW2C 1LNQA 1OYEA 1I1GA 5DRKA 2AKWB 1IN0A 2MZRA 5IWAJ 2MSSA 4F4ZA 3UN5A 3PM9A 5HQ8A 3IGVA 2KFNA 4NASA 3CEDA 2DKOB 5IV3A 4USKA 1LK5A 1BY9A 5H9EK 1BD6A 3BGRA 4KV8A 2KB2A 1WC4A 2AMCB 3IR5B 3V4MA 4EGLA 1U1MA 4AQYF 2MQNA 1EJ7L 4ANEA 3PX0A 2ZKUA 3W7BA 1O51A 4RL1A 2VONA 2V9WA 4NL5A 3PHTA 1WDDA 3B54A 4J9VA 4NXMF 1RCXB 3T5LA 4G1QA 2WRMA 3FDSA 2HVIA 4JOUA 2AEJA 1R8AA 4WZMA 4DQQA 5LMUF 2XLKA 2IY5B 2L9DA 3OVAA 1QE1B 1VISA 1FFWB 2NSCA 3SEOA 3PDNA 4JI1F 2J6UA 1H3DA 4B3MJ 3J7YU 2EBEA 4QIEA 1P9QC 4TY9A 5D4NA 5DS7A 3KJQB 2YWEA 4CO4A 1A0OB 3K5PA 4K2JA 4M5IA 5BXIA 4Z37A 1KS2A 3TJ8A 1TQLA 1AT1B 1KLMA 3VTIA 2LECA 2YQ0A 3GU0A 1CSJA 2PT0A 2BDPA 2KZMA 1VCTA 2BVZA 4YQWA 1TMJA 3N0VA 2HGNA 1RK8A 1NO8A 4ZN1A 2GIQA 3BGFA 2YKAA 2ZD1B 3V6DB 1QVFR 2BRLA 2MKHA 2Y1LB 3MD3A 4OX9F 3ISNC 5C25B 1S6QA 1Y5NB 3BF4A 4ZCMA 1TMMA 3M9MB 4OX8A 4JV2A 2CQCA 4OZ0A 2NPIA 2XI2A 2BOPA 1RT2A 3AODA 4ZLLA 2N4DA 1KP6A 2ASYA 3MM7B 2A2CA 4NI2A 1FVSA 4ZJLA 3AD7C 2OEMA 4YB7A 5ADZA 1UWBA 1Q8BA 1YJWS 2BE2A 2UVVA 2X3DA 3PFEA 2CQ4A 4USTA 2P5VA 2DHGA 5DDPC 1GMWA 3FEYB 2RU3A 2HHVA 2AJFE 1HQUA 3KG1A 3Q86A 1DTTA 1IWAA 2ZNZA 3EXCX 1QAXA 4YY3F 2ACMA 4NLQA 4DXLA 1NHUA 1HNWF 4FBUA 1YQHA 3SCIE 2H4WB 1M1KT 2G4BA 3QYYA 2KU7A 3OHAA 4U8YA 3FQLA 1NK0A 4OLPA 2YPYA 4ID5A 2PFFB 4JV0A 3LUYA 5DM7Q 1I94F 1AZSA 4M5DB 1FEHA 3FEZA 1N6QB 2ZVIA 2BA9A 3MM9B 1T0TV 3IMQJ 1F5AA 2B8PA 4KH0B 3NGSA 4LF4J 4NA1A 5JUMA 3MWBA 1S1TB 3VAMA 3KJNB 2FHKA 2OPPA 2C22A 2KVQE 1P1LA 3BB5A 2RKIA 1VJWA 3IM9A 2CPHA 1M5VC 1HFEL 3AHPA 2PC6A 1KVKA 4Y2IA 2R7XA 4UY85 1GFWB 1XIQA 4DEZA 2LA4A 3HD1A 2C2OB 5CYQA 1K44A 4CH1A 4I1TA 2NXJA 3BBBA 3DMJB 3IBCB 1X4CA 1UW9A 1WDTA 1N5TA 1UFLA 2HFUA 4G1PA 1ZM9A 5DQIA 1XR6A 1KBRA 4LT6A 2KT2A 2D3UA 1FESA 3UVJA 3B8HA 4RNOA 5HLFB 2QMWA 3NGRA 1JIHA 3DM2A 2R8JA 3MURP 2BKNA 1S57A 3PRVA 4CWBA 1HBNA 4DJBA 3OVSA 3EE3A 1AXQA 4O3OA 4R25A 4WIIA 2M8HA 1RJJA 3TO8A 4HTJA 2QA4S 4P74A 1CQNA 2XHCA 2FPHX 2Q6BA 1WEZA 2MQLA 4CNYA 3MTJA 3Q2SC 3M6XA 4CO1A 2COLA 2YH0A 1RABB 1JLCB 4IG3A 1T9WA 4URGA 3GWCA 1R3NA 4RBUA 4NLSA 3UQSA 5KOXA 3NNHA 2HRUA 3C8YA 2RQ4A 1WG4A 1MNEA 4NLXA 1ZA2B 1Q8IA 2KYZA 2AGPA 3UFCX 4LR8A 5KFTA 3E3XA 4ZVHA 3PW5A 2MY8A 3OQ2A 3E2EA 3H42A 3WIVA 3AD8C 1IBKF 3EZUA 1J5EJ 4QZVB 3PG9A 3HJFA 2GVZA 4PZVA 4DR1F 2AYMA 2VQEF 2KYXA 2KVIA 2HMIA 3FUYA 2AD9A 2AYEA 3EICA 1XMQF 1RT7A 3H90A 5EWEA 4TQRA 3FBFA 3UCZP 1ZETA 3BO3A 5CYMA 3R6LB 2N7YA 5F3TA 1EHWA 4DV3F 3TAQA 5HMXA 3SI8A 4ZPBA 2HBQB 1SJFA 3QJPA 5BYSA 5D3GA 1C0TB 3ENAA 1N4LA 4JI6J 3HFKA 3OLBA 3T6JA 2YKQA 4C3KA 2FHMA 4ZHRB 2RMLA 4NLDA 2DR9A 3TUJC 4YR0A 4QWBA 3JXOA 3KUEA 3H25A 1K47A 1T9TA 2AYGA 4OYMA 1HBOB 4I7FA 2X51A 1UEUA 3G71S 2QA2A 5SZTA 3DOLA 4WE1A 4F50A 1VC6A 1FKOB 3A3PB 2NS1B 2BEFA 5H9FJ 4DS4A 1TFYA 2WAQD 2XEXA 1RTZA 1R0BG 3QZ7A 3DLKB 2RSQA 4KHPJ 1IQZA 4NX9A 2G13A 2GJ2A 4UZCA 3W65A 3VVUA 2EPIA 3QWUA 3GG1A 1JLFA 1N5QA 3KHRA 3CVKA 1YRUA 4BBYA 2MSTA 1LKZA 2V8HA 1JLGB 3I4PA 2VFRA 1KN6A 1JLEA 1RWUA 3OSPA 4WK1A 4LSLB 4IH7A 2W9CB 1FXDA 3CIZA 4F4KA 1VQPS 1JMTA 4W90B 1HYSB 3M32B 4RUAA 4YS2A 1YJNS 1FRJA 4UF4A 5HATA 2Q6CA 2O67A 1R8BA 2D69A 2GO9A 3GONA 2UU9J 1RP5A 2ZBIA 3M8RA 3A8EA 2BR0A 2MKYA 1DARA 4ATNA 4WXOA 4K4ZA 1DHMA 4CO3A 2W8KA 3CJRA 3DYAB 1R6YA 1U26A 2J9DE 2FC9A 4QR1A 4CLWA 4HACA 3D1HA 3A3OB 4KIAA 4IDKB 1NB7A 1H98A 3D1QA 5T7LA 4KHMA 4PQUB 2CZVC 3HHLA 1SC3B 2QL7B 4ZVQB 4KB7A 3BQ2A 3D5MA 4OX7A 1NKBA 2ZH1A 5KFOA 3I0RB 2Y1RI 2B6AA 3G6YA 4WFAQ 1J2VA 4DR6J 1RSCA 4NE9C 1FVQA 4FP9A 5E0OA 5B0AA 3WBZA 3W5YA 4UY8T 2M9KA 2CKWA 2K7JA 3LW5C 3I31A 2W4CA 3HLUA 2D9OA 1YJTA 3HVTA 3MMBB 4F4XA 4LSNB 4DL6A 5ETQA 2IC3B 1T9UA 1MSWD 4LREA 4IRKA 4DZDA 2YNHB 4YDDB 3AJ2A 4NYPA 2PMWA 5ETTA 4EU0A 2UVWA 2VG6B 3W5XA 2WSEC 1DLOB 3ETOA 2BM0A 3MMCB 4N56A 4RNHA 2VPZB 2XQCA 3KHLA 2CYYA 5HI7A 2GAHC 3RB6A 1U6BA 3AOAA 4MKBA 4ECQA 4J9RA 3MCOA 5E7OB 5MAOA 3DCAA 3TJ9A 1VQYA 3HZGA 1VBXA 1U25A 3VV2B 4R0JA 4IR1A 3RYLA 1NMEB 5CCLA 5IXUA 5EHHA 3BBFA 2GMJA 3NL0A 3D3CJ 3BGRB 4FF2A 4CLUA 1EKRA 1BE4A 3KLFB 2MHNA 4DN9A 3BR8A 4ZVEA 1U6ZA 5CAAA 1WUUA 4L76A 2GIRA 1WD6A 4WF9Q 5AXLA 1GMVA 4HEA9 2WBRA 2Y3YA 2DY9A 4G1QB 1VRTB 4LSZB 3JB9k 4BC9A 1TK5A 2R7TA 5L1LA 3BSAA 1GXTA 4G1IA 1N5SA 5AE2A 3G6XA 2GHWA 3OJSA 3GZ7A 3PACA 5DQGA 3ENWA 2HHHF 4DQSA 1WOOA 4LVNP 2YNGA 2N82B 1T9YA 2D1CA 1UVIA 1R8CA 2LEAA 2LQ8A 4EYHB 3FSIA 2CQDA 2YVSA 2RUGA 5KOWA 3U1LA 3GCWP 3MPDA 1KLMB 2RQMA 4P7TA 1TU0B 2J7KA 5KG1A 1CPZA 3RB3A 4CH7A 3D6TB 4CLTA 1SBRA 1F2GA 4P9SA 3VR1A 4X4NA 2EC0A 1TKXA 3PRBA 1FKAF 3SDEA 4GVBB 1F9FA 3MEDA 4B9TA 4E8UA 2HWIA 1CG2A 1X5OA 2RDJA 1S6QB 1KTVA 4ICLA 1NEEA 3QNWB 1RISA 2BQ3A 3HF5A 1RT5A 2KXNB 1RT2B 4DPWA 4KKOA 2DTJA 3G8TA 3RBXA 2X7IA 4O44B 3D0GE 1UWBB 2FY8A 4WFBQ 2XSJB 2BE2B 2IYIA 4LFAF 4WFNQ 4Y2CA 3RRHA 3F44A 4HR2A 3CT9A 4KGKA 3OSNA 2DO0A 2C2MB 3MDFA 3ZZYA 2J9DA 1YZ6A 2Y8YA 1KDNA 3I87A 2YWFA 4RUCA 2DRDA 3MMAB 3O8WA 2VJUA 2B9YA 3N6LA 4DFPA 1CJKB 5H1SV 5BYRA 1M5PC 1S1XB 2ZZNA 4NLRA 1F9EB 5A8RB 5GAGI 1WHXA 5KTQA 3K2YA 4RW4A 2VBYA 5F3ZA 1YITS 3ET6A 1Q8KA 4ID5B 5HAOA 5J2QB 3OFFA 1L3TA 1AZSB 3CCWA 2OLWA 2EK1A 1KNZA 4NMXA 2UZAA 3CB4A 3OTCA 1D9FA 1YJUA 3OR1B 4ANCA 1JXEA 3UCGA 5F8HA 1UVMA 4ZP8A 2RKIB 4J9LA 1NK8A 4LRCA 4RBTA 2UXDF 5T41A 1QAYA 5HVHA 4YFUA 4J9SA 3DRSA 1RHKB 3ZTRA 2FZKB 2A6OA 1T05B 4LBPA 1S6OA 3R5BA 5CYQB 4NLUA 2FJBB 2FZGB 2MEWA 3DLEA 4DPYA 3VVTA 1B99A 3C14A 1RWWB 4LFBJ 1IKWB 2UVUA 3HD2A 1CJTA 4E0DA 4U7UK 5DGAA 3W61A 2BBEA 2B7BB 2R3VA 3NGUA 4JV5J 3B82A 3U7JA 1VDHA 3HHKA 4ZJOA 3DM2B 2K06A 2OIHA 5LMNJ 1HQ2A 1R89A 3SZ2A 2RIJA 3DDIA 5L9NA 2B4UA 2OAUA 3QT5A 2N3LA 1FX4A 3H0PA 2X1FA 1WC6A 1IQTA 2FHJD 2H9ZA 1Z4UA 1GXUA 2GIFA 3NMRA 5HK4A 3HK2A 4F0KA 1TVRA 5KT4A 2XSFA 2MHEA 1ACMB 1OY9A 4K5RA 4DUTA 2JEFA 1RZMA 2HZAA 1WWHA 2ZOGA 2L41A 1J5OA 3H4DA 3EM1A 4YP3A 1APSA 3MTKA 3MECA 2LQ5A 4ZPTR 1W2IA 2ZH2A 4ALZA 1SUQA 3F0NA 5KFUA 3K8WA 4DV5J 2ROGA 1C0UA 2HEKA 1RQ0A 3KLVA 3RJMB 4KO0A 3LPYA 1F0XA 1YIJS 3H2VE 3ONQA 3NNCA 4DSKA 2GVZB 2PE8A 2QX0A 3T1HJ 2CJQA 4DS5A 1HR0J 4K7QA 1UVNA 2BRKA 2HMIB 4HLBA 2V2ZA 4O0NA 5ETMA 2B7CB 2LCWA 2M0GB 4QWDA 2CQ1A 3GJRB 1BWVA 5KFSA 2OPRB 4CDIA 1U6FA 5HVFA 1W25A 4ED1A 1RWKB 3BKUA 3VAJA 5L39A 5KFKA 2ATLA 2QA4G 3MXHP 4DR5J 1FCAA 3VGVA 2ZH9A 3KMSA 2FTRA 2ALZA 3MUVP 1U0SA 4C11A 2V67A 3GIIA 3N4WA 1C1CA 1LWXA 1RTDA 1TUGB 1SC6A 4CLPA 1NZAA 1YBUA 4I7FB 5D15A 5H9FK 2B9EA 4J9OA 2XMTA 1XMOJ 2AJQA 2XY6A 2ILYA 1VIOA 4FNIA 4CO0A 4EZ9A 4ZPVR 4W98A 3K5MA 2YNIA 4RW8A 2E5LJ 3M2UA 1MWQA 2XMVA 1IKYA 4W4MA 3O1LA 3NS7B 3FBCA 1EB0A 5CQGA 3NCQA 4F36A 1FE4A 4IFYB 3NEKA 4DV7J 1JLEB 4LRAA 1RT4A 3S8SA 3IGNA 3QRRA 1IUJA 4AL5A 3Q2TC 1LWFB 2OJ3A 4USJC 5ETNA 4G65A 4X4QA 3ZNUA 3NAHA 3H98A 3M8QB 5C5JA 4ES2A 1S12A 5E3PA 1HPZA 2V34A 4B17A 4FXDA 4M5KA 3B6BA 1N5YA 1FXLA 4FYXB 3Q8RB 4DFJA 1B70B 4I56A 2PDAA 4TXSA 2VZ9A 4EO6A 2DJWA 3NXZA 4IQMA 3KHGA 3NS6A 4HACB 4NLTA 2R2UA 1Q16B 3JYTB 3RU0A 4A4JA 5T7LB 4DV6F 3EVWA 2AHOB 1UETA 3I55S 1VHFA 1U47A 2XMAA 5GAHI 5HANA 4PEOA 2LDIA 2YKNA 2I2YA 4Q5VA 2QYCA 5CXTA 2FHOB 2A18A 3PR4A 5LM7E 2W7PA 4I0WA 4IOAQ 5KFNA 3ITHA 1JLAB 2W2OP 4AUKA 2VQFJ 3IR7B 1P6TA 2VG7A 4PKDB 5F9NA 4QIGA 3E51A 2HAIA 2MLYA 2FDNA 3QFWA 1M5KC 3HHDA 5HJYA 1VLYA 4HT7A 4A46A 2CPDA 5KG4A 1DAXA 2EI5A 3OXLA 2MQQA 2SXLA 1YI2S 2HWTA 1WC1A 3J80U 4OI4A 2J0XA 3AJ1A 3PEHA 3W64A 4IFVA 1VQMS 3VCDA 3AB2B 2FLOA 3CE8A 5HMZA 2EFNA 3I6PA 5KT5A 2R2RA 4IKAA 2KRBA 5D0GA 3ILOA 1Q5YA 3N5BA 4ZCIA
chains in the Genus database with same CATH topology
4DHVA 1Y5IB 3P49B 2QZ8A 4ECXA 2M7SA 1X4EA 2YNIB 2HRYA 1NK4A 4DN0A 4RW8B 4K0KF 2ZD1A 1TL3B 1ZTWA 3L7OA 2AU0A 1JLQA 5KFHA 4NLPA 1IKYB 1A7GE 2AW0A 3ENQA 5DLGA 4FNHA 5HMYA 5D4PA 2ZH6A 2MGZA 2W8LA 1PO6A 1S9EA 3Q8QB 3EPGA 3EYZA 4YEAA 2DGSA 1TR0A 2GJIA 3W2WB 1GX6A 1RT3A 5K8NA 1QJHA 3C6TB 2R8IA 2R7SA 1TV6B 5KFBA 1QVGR 4BDPA 1E6YA 1KONA 2J0WA 2EK6A 5F8MA 1V3RA 1JNRB 1C1BB 1NU4A 3DC2A 4RUHA 3K5LA 1FRIA 4EBDA 3D28A 1HNIA 3MM7A 1HMVA 3R5AA 4LSNA 2GMLA 3TAMB 4OL8A 3VAKA 2E66A 2ZJPQ 3DGPA 5A0YB 5DDQC 5IT0A 2B9XA 4ZA1A 2YNHA 3J81Y 4QR2A 2B5JB 1RI7A 4B02A 3GE9A 1MW7A 4A8FA 5LL6d 2AWZA 1OPIA 1FE0A 5DLFA 3KNGA 3IFEA 3UPFA 2J6SA 5KFIA 2I38A 4G6VB 3SCJE 4QU6A 1HPZB 1KVJA 4ECYA 2RS8A 1JLBA 3G6ES 4MJKA 4ECSA 2Y1IA 1XNQF 1K0TA 1VIXA 4WK3A 1N56A 2K1RA 4I68A 3CUNA 3VAIA 1UL3A 4IRDA 1P8GA 3FSYA 1S1VB 3I5BA 3E8OA 2DPJA 2IHR1 2LQ9A 1Y4ZB 5F8IA 4OHYA 3AA9A 3I32A 2R7UA 1FJGF 2LXUA 1R0AB 4KJIA 4KTQA 4HL9A 4C9DA 1URRA 2RQKA 3M2VB 5KFZA 5I4MA 2EBGA 2BANA 1LW2A 4FPRA 4LFCF 4V19J 4R8UB 2DK2A 1RTIA 3CGIA 4CNZA 4A8QA 2GC8A 1RKIA 4LF9F 2XZWA 2QO3A 2JVRA 1Q82T 3DRXA 3TP2A 1X5SA 1NRKA 1NH7A 2MKKA 2ZITA 1KOHA 1RTHA 1WHWA 2NSBA 5J2MA 1UJ4A 4X4PA 3WDOA 1KC8T 3OTEA 2HFNA 4AXJA 1UA0A 2IRXA 1RTJA 4DFKA 3Q8PB 3M8PB 1I1GA 2FC8A 1SJ1A 5DRKA 1IN0A 4OI6A 4U6PA 2OFGX 2BJDA 4PG5A 2GMHA 2CJBA 2LYVA 2MZRA 4R5PA 2LEPA 3PW2A 3IAS9 5M2PA 2MSSA 4I2QA 1QY7A 3FRZA 4F25A 2IJNA 3QWPA 3CCUS 4F4ZA 3GIKA 3PW4A 1FEEA 3OTBA 1WG5A 3PM9A 5HQ8A 1DTQB 2ZHOA 3IGVA 4ZKAA 5KFMA 3IRXB 5IT9Y 2R2TA 1DBDA 2KFNA 2DITA 3JSBA 5I3PA 4TNOA 3CEDA 4N5SA 1IBMF 4NCAA 2YKNB 4NCGA 1HHSA 1YTYA 1LK5A 1KQGB 1BY9A 4NA3A 2MMYA 2P6TA 3MAHA 4X84A 3KK2A 2R2SA 3KLIB 1BD6A 4PR6A 1H0HB 5HROA 3BGRA 4KV8A 4IQXA 4M5DA 2KB2A 2P9EA 3LP1A 2Q1LA 2ZNYA 2CJ9A 2EWHA 2F1FA 2PA8D 1LWCB 3HZEA 1MU2B 3MOZA 5HBMB 1N6QA 1IXKA 3P5TL 1TKZA 4CTAB 3KFWX 2WONA 2XWYA 3MM9A 3IR5B 2BZ2A 1GTEA 2HPUA 4WKYA 5J1PA 2MQPA 2XLIA 2W9BB 3V4MA 4F4YA 4DF4A 4TKTA 2F8MA 5GVQA 4EGLA 4H4OB 2YH1A 4OJHA 2DPIA 1U1MA 4AQYF 1JKHA 2MQNA 1KQSR 2F9JA 2YWKA 3E01B 2ZH4A 1S1TA 3L7PA 5C42B 4USIA 3PX0A 2ZKUA 2V4JB 1WHYA 3W7BA 1O51A 4LIWA 1FDNA 4ICLB 2J5AA 2DNPA 2VONA 3UE2A 2V9WA 4OLOA 3LF0A 1VI7A 3NP5A 4NL5A 5J1NA 1VC5A 3V6JA 4OJGA 3T9ZA 4DSJA 3FFIA 1IJFB 3CWJA 4MIAA 4NXMF 2N7CA 5CH7B 3BSNA 2XGQA 4ITSA 3T5LA 3TA2A 3EZ5A 1XTZA 2IYGA 2VFSA 4G1QA 7FDRA 2WRMA 3FDSA 3MR3A 4ED8A 3FMBA 5IM0B 1ZM2A 1DQ8A 2HVIA 4JOUA 2CIMA 3SCLE 1R8AA 1T03A 3QGPA 2KHDA 5F8JA 1TP7A 4WZMA 2C42A 2HLUA 4DQQA 5LMUF 2XLKA 5FJ4A 2ILZA 1FHTA 2L9DA 3OVAA 2D41A 1QE1B 3V4IA 2NSCA 4PXEA 1R8PA 3JSYA 4O3SA 3SEOA 3PDNA 4NZ0A 2QT7A 4F8RA 4JI1F 4ZCKA 2J6UA 1AUDA 1H3DA 1S7HA 2DNRA 4KQZA 1JJHA 1S97A 3CULA 2VV5A 3KWMA 3HPOA 1Q7LB 3J7YU 2EBEA 3MGJA 4QIEA 4LFBF 1P9QC 4NYOA 2Y0SD 4TY9A 5D4NA 3KK3B 4QW9A 1OSDA 3O44A 5DS7A 3ZZ0A 2YWEA 2J7UA 4CO4A 2JSXA 2HHSA 4X62F 4IFVB 1YG0A 3K5PA 4ZPWR 4EYIB 5KG6A 2GGPB 2E7WA 5E5NA 5KFJA 1D0EA 3OL9A 4Z37A 1KS2A 2KG1A 2HGMA 3RB0A 1SH3A 2OPQB 4DSIA 3J7YI 3IC1A 5JXSA 4JV5F 2J8AA 2FLLA 3GIMA 4F4WA 1TQLA 1H7XA 3JAMY 3QGGA 1DQ9A 1KLMA 1QUVA 3VTIA 1HWJA 1ZAVA 5HLFA 3CD7A 2LECA 6FD1A 1Y3JA 4OI3A 4UQGA 1WEYA 4MFBB 1CSJA 1HWKA 2PT0A 3BGLA 2GA7A 2BDPA 4OI0A 3O6QA 2BVZA 3SV4A 2VA2A 5LMNF 2KZMA 4KPYA 2KH9A 4YQWA 1TKTB 3N0VA 5C24A 4Y00A 2HGNA 1RK8A 1KVIA 1NO8A 1TL1A 4ZPAA 3VAHA 3AQOA 1HW9A 1XN9A 4WZQA 2GIQA 3BGFA 4CO5A 4LMZA 2YKAA 2ZD1B 1VBZA 3V6DB 4PG8A 3OTOF 2IA6A 3J7Z5 1QVFR 3CCLS 2BRLA 1NK9A 2MKHA 4OX6A 3OW2R 3MD3A 4BCAA 2MGZB 4OX9F 1S9EB 3ISNC 1S0MA 2V5HG 3HVAA 5C25B 5I3UA 1S6QA 1Y5NB 2VPWB 2DNOA 3BF4A 4ZCMA 3C6UB 3R5CA 2RB7A 4ETXA 1RT3B 2E5JA 3M9MB 4RW7B 1YRXA 1KTQA 2Q79A 4RLEA 2HQIA 2APOA 4OX8A 2W24A 1HI8A 2FB0A 3PEJA 4JV2A 1E6YB 4AE5A 2CQCA 4OZ0A 2NPIA 2FJWA 3T19A 2XI2A 2BOPA 1U7LA 1RT2A 2E5GA 4NRUA 2QFJA 4FF4A 2N4DA 1JLCA 3K58A 1HNIB 3D1OA 2ASYA 3MM7B 1HMVB 2ROPA 1RDRA 2A2CA 1Q79A 2G0CA 2IVYA 1FVSA 2ZH7A 2OD6A 4XPCA 3P3DA 1OQ3A 1TUVA 4YB7A 4ILMA 5ADZA 1UWBA 1Q8BA 4NLWA 1QLNA 1U1QA 1CVJA 1YJWS 1PGZA 2LKZA 2CG4A 2H5EA 2HW3A 4Q2MA 2BE2A 4DV5F 2UVVA 3PFEA 3TVZA 4M1KA 2CQ4A 5HMWA 2VH7A 3HT3A 2P5VA 2K1RB 5G4DA 2PI5A 2DHGA 1U1LA 1TL5A 5DDPC 2J0QD 3CDAA 2R8KA 4K50A 3FEYB 4ZPCA 4NLGA 2RU3A 1QUPA 4WFZA 2MZSA 2Y1JA 2HHVA 3I0SA 2AJFE 4M94A 1X9MA 1FKPA 3D0HE 4B3SF 3CDUA 4NA2A 1HQUA 3KG1A 3KYLA 2DNNA 5KG0A 1SI9A 3DLEB 3SMZA 1DTTA 2JEGA 2BANB 1LW2B 3NKYA 2ABYA 3PX4A 1RTIB 2ZNZA 3EXCX 1QAXA 3KK1A 2RJZA 3T1HF 4YY3F 4JYAF 2UXBF 1S4FA 2VPXB 1HR0F 5KT7A 3PIPQ 1VQKS 5A8KB 5KT3A 2ADBA 2ZUGA 4HT5A 1RTHB 1HNXF 2QLXA 3DHWC 4NLQA 5L1KA 3QO9A 3I56S 5B08A 3CCES 1B0TA 2XCPA 1NHUA 1PC5A 1RTJB 1HNWF 4FBUA 1YQHA 4NWBA 1VQ8S 5G0RA 5J2PA 2E9RX 4JI3F 3SCIE 1M1KT 3G4SS 4AL6A 4R5PB 2DRAA 2G4BA