1YIJS

Crystal structure of telithromycin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
81
structure length
81
Chain Sequence
SWDVIKHPHVTEKAMNDMDFQNKLQFAVDDRASKGEVADAVEEQYDVTVEQVNTQNTMDGEKKAVVRLSEDDDAQEVASRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S Ribosomal RNA
publication title Structures of MLSBK antibiotics bound to mutated large ribosomal subunits provide a structural explanation for resistance.
pubmed doi rcsb
molecule tags Ribosome
total genus 20
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2005-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF00276 Ribosomal_L23 Ribosomal protein L23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1yijS00
2CPJA 1VC6A 1VC0A 3H2UB 2DB1A 5DM7Q 1RK8A 2X1GA 2MQOA 5DDRC 1KOHA 4Y00A 3CCLS 5DETA 1OWXA 2MZ1A 2GO9A 1WWHA 1X4HA 2ADCA 5DDOC 1ZH5A 1D8ZA 4LMZA 2DNHA 2AYGA 2BOPA 1CVJA 3PIOQ 1U1OA 2CPFA 2ADBA 4TLQA 5BJRA 5GVQA 3H2VE 2MQNA 1X5TA 1NJIT 4C0OC 1YIJS 3MURP 2N3LA 1WG1A 2SXLA 2M8DB 2LQ5A 3TYTA 3RW6A 3UWTA 2J76E 3D2WA 2OJ3A 2LKZA 2DNZA 2MMYA 1P1TA 2KVIA 1QM9A 2X1AA 2CJKA 3BS9A 1U6FA 1VQ4S 2Q79A 3R1LA 4YOEA 3CC2S 3ZZZA 2MSTA 1WF1A 1QVFR 1YJWS 1WELA 1OPIA 3B4DA 3R1HA 1JJ4A 4QQBA 3TP2A 2KT5A 4IOCQ 1M5PC 1KC8T 1YHQS 2MZJA 2MKHA 4W92B 1WHYA 3HI9A 4V19X 2DNYA 2LYVA 5H1SV 2XS7A 2MY7A 3PIPQ 2L41A 3J7YU 1F9FA 3ULHA 1R8PA 5CA5A 2VONA 4F26A 1FO1A 1WF2A 2OSRA 1WI6A 1NO8A 1JJHA 2CQIA 2CQ0A 2DO4A 3MUTP 3S8SA 3BO2A 1WF0A 1WTBA 2DGSA 2VODA 5LJ3Y 3J7ZT 2MQLA 3I55S 3NS6A 3UD4P 1U1RA 1U1KA 2EVZA 1K73T 2MKCA 5GADU 1KQSR 1AUDA 3G8TA 2E5HA 1SJFA 3P5TL 2MXYA 5DDPC 1X5SA 1HD0A 5LXRA 2VOOA 1D9AA 2KHCA 2A3JA 3CTRA 2RQCA 2DGTA 1HL6A 2RRBA 4P6QA 2JVOA 2CPXA 3THTA 3CCRS 4ED5A 4CIOA 2CQCA 1WEXA 2MKIA 2N7CA 4WFNQ 3MUMP 4LIRA 1R8HA 1DRZA 2MPUA 5DM6Q 3NNAA 2MQMA 4YB1P 2U1AA 3UCUP 2KFYA 3CCES 3UCZP 2EK6A 3SXLA 2G1DA 1H2TZ 2MYFA 3VAMA 2CQ2A 4F25A 3LQVA 3MD1A 1X5PA 1X0FA 3B4MA 2J0SD 3G9CA 1OIAA 2MB0B 2DGVA 2XB2D 5GAGU 2CPEA 3U1LA 1N8RT 3LPYA 2PE8A 3EX7B 3VAHA 2AD9A 3CCQS 2QFJA 1PO6A 3CD6S 2FC8A 2NLWA 1K8AT 2I2YA 2DNGA 2CQDA 3G4SS 3DXBA 3VAIA 3MDFA 3S7RA 2F9JA 4RU2A 5IM0B 3G71S 1VQMS 2DNNA 2K3KA 4M5DB 1K9MT 4IO9Q 2CPHA 2E5GA 1U1MA 2M70A 2CPIA 2DNRA 2D3OR 1WEZA 2D9PA 3NNHA 1WI8A 2LA6A 4IOAQ 4OZ0A 2CQBA 4W90B 2FC9A 1WEYA 2UP1A 4TU8A 2YTCA 4WKRA 1DHMA 5LXYA 2FHOB 2YH0A 1VBYA 5IM0A 1SXLA 4WFBQ 3G6ES 1B7FA 1UW4A 1KD1T 2DITA 3Q2TC 1X4BA 1HD1A 3MOJB 2L08A 2HVZA 1L3KA 1VQ6S 4C4WA 1YI2S 2E5IA 1YJ9S 1Q81T 3FEXB 1W2BR 2CQ3A 1VBZA 1M90T 1FHTA 1VQ5S 1U2FA 2X1FA 1YJNS 5JVGQ 3EGZA 1S79A 1N54B 4C7QA 3CC4S 3THPA 2F3JA 2HZCA 5HO4A 2CPDA 3CCVS 1Q7YT 4IUFA 5FJ4A 3MI7X 3CULA 2XS2A 2LEBA 2DGQA 1WHVA 1FNXH 3Q2SC 3IWNC 5GMKa 2DGWA 3CC7S 2DH8A 3G96A 2MKSA 2GHPA 1DZ5A 2RU3A 1FJEB 2MJUA 1X4DA 2KM8B 2XSFA 3IRWP 4QPTA 2DHGA 2N82B 1X4FA 3CPWR 2DISA 1H6KX 4U67Q 2G0CA 2V94A 5ITHA 2ERRA 2RNEA 1WG4A 3P49B 1FT8A 2KU7A 4UY8T 2CQHA 2MKJA 2E5JA 2G4BA 4CH0S 2RS8A 2JRSA 2XNRA 2DH9A 5LSLA 3MUVP 5HL7Q 2QEXS 2L9WA 2DHAA 2DNQA 1UAWA 2MQQA 1OO0B 1SJQA 1O0PA 3DLLQ 2X1BA 3MD3A 2LCWA 5GAHU 1X4GA 2LEAA 2M2BA 4Z2XA 3HHNB 3I56S 5EN1A 2B0GA 2LXIA 2KN4A 2HGMA 2XS5A 1S72S 1H2UX 1VQNS 2JVRA 5IQQA 2DGUA 2KYXA 1A9NB 3VAFA 2XNQA 4PRFA 2ZJRQ 2F9DA 4LJMA 2DNOA 4FXWA 2MZTA 2HGLA 2MJNA 4WF9Q 1YITS 1XN9A 2J8AA 1VQ9S 1U1NA 4J5OA 3ZZYA 2LA4A 2PEHA 3P3DA 3RW7A 1PGZA 5D78A 1Q82T 3MXHP 2RRAA 1U6BA 4WFAQ 3CMAS 4OZ1A 2JX2A 2M7SA 5D77A 3CCSS 2OIHA 3CF5Q 1KOOA 2DHSA 2CQ1A 2MGZB 3TO8A 3EGNA 1X4EA 1ZZFA 2KXNB 1P27B 1N88A 2DNPA 2KG1A 4PR6A 3L3CA 1VQ8S 2M88A 5LJ5Y 2DK2A 2M0GB 2KI2A 2NZ4A 4BS2A 4Y0FA 2CPYA 1U1PA 2CQGA 2RQ4A 2RVJA 4UQTA 4TU7A 2DGOA 2FPHX 1Q86T 3SDEB 3VAJA 1ZZNA 3CCMS 3BEGB 2KXHA 2MSSA 2MGZA 3BO3A 2KXFA 2M8HA 2N3OA 1N52B 1UFWA 1H2VZ 2OSQA 2KH9A 1QVGR 2KRRA 2YWKA 2LECA 2MQPA 2AYEA 1U1QA 2LMIA 3NMRA 2DIVA 2MHNA 3P6YC 3VAKA 3BO4A 1YTYA 1M5VC 1U1LA 3V4MA 2VOPA 3SDEA 5CXTA 2JWNA 3S6EA 1IQTA 1WHWA 2M9KA 2DNMA 3OW2R 3K0JA 2DH7A 4A8XA 4CH1A 2RT3A 3NNCA 3VAGA 1M5OC 3FEYB 5CYJA 1YWXA 1VBXA 2KG0A 1VQOS 3UD3P 2M52A 3CMES 2AYMA 3NS5A 1BY9A 2I38A 4QU6A 2OTJS 3VALA 1WG5A 2CPZA 4FXVA 4TU9A 1VQKS 2BZ2A 1X4AA 1NU4A 2MY8A 1FXLA 2CQ4A 3UCGA 3G8SA 5LSOA 2DO0A 1M5KC 2YKAA 2O3DA 2MZSA 1RKJA 2EK1A 2DIUA 4F02A 1VQPS 3SMZA 3U1MA 1VC5A 1URNA 4ZKAA 1SJRA 4PKDB 1M1KT 1X5OA 2WBRA 1WHXA 3CXCR 2KRBA 2DNLA 4EGLA 2MZRA 2MKKA 2K8GA 3N9UC 1A7GE 2CQPA 2E44A 3CCUS 2D9OA 1JJ2R 2DNKA 5JVHQ 3S01A 2KM8C 2M4MA 2HYIB 1DBDA 2RS2A 4QU7A 2YH1A 2DHXA 3CCJS 5MLCV 2FY1A 4CQ1A 2ZJQQ 2QA4S 1FJ7A 5IFMA 1SJ3P 2J0QD 3R27A 3JB9k 2AYBA 4WCEQ 1UP1A 2U2FA 3UE2A 4ERDA 4WIIA 3US5A 1JMTA 1HA1A 2RUGA 2HGNA 2MZQA 1X4CA 3VF0B 3CUNA 5GAEU 1SJ4P 2LXUA 2OTLS 2ZJPQ 1G2EA 1FJCA 1VQLS 5DDQC 1VQ7S 4YUDA 2DGXA
chains in the Genus database with same CATH superfamily
5DM7Q 3HULA 2RDDA 5J1EB 1B3TA 1OWXA 2NR0A 4DR3F 3O5TB 1CC8A 1RZMA 4WYWA 4F4WA 2W4DA 3M8PA 1YIJS 2SXLA 2M8DB 3HK2A 1B0VA 2OHDA 5CQGA 2DY9A 2PMHA 1VYAA 2J76E 2XY5A 1RHMB 2ZVSA 5ETPA 4P10A 2E1MC 3KKFA 1K0TA 4X4VA 3WX4A 3JXOA 3O3LA 1TQLA 4HDHA 2WAQD 1OY6A 4K4SA 1TK0A 4RUBA 1SV5A 4DI6A 1T03B 2FHKA 4DSIA 3GFHA 3MM7B 1D09B 4YB5A 2UXDF 4FVMA 2B9WA 2GHVC 4X4SA 4LSNB 1RA6A 2OEJA 1S1VB 3NS6A 1HNIB 5DQHA 2MDAA 4NCGA 3BQ0A 1XNQJ 1AUDA 2E5HA 3ILOA 3RGIA 2BM1A 2H65B 4OYAA 3THTA 4DS4A 4HTIA 1WACA 5KFGA 2Z0GA 1VR6A 2WVBA 3KUGA 3KLIB 2VUGA 5FIIA 2AJ0A 5GMDA 3BBBA 2DGVA 4PXDA 5KG3A 1PC5A 2WONB 2FLNA 3LWMA 2MQ8A 4P74A 1YX2A 2UXBF 2Z2ZA 1JXLA 4XPEA 1N33J 4OI3A 4PQAA 3N6MA 2D3OR 4DPUA 3IP0A 4FPIA 3H2LA 1HMVA 1V3RA 2B7CB 2LXFA 4TY9A 2YWHA 4FDFA 2AZ1A 4C0HA 2XZWA 3OSPA 4Q44A 2J0WA 2PEBA 1M90T 2YY3A 2P9GA 3SCKE 4ZJLA 3KDNA 4ZPAA 1YBTA 3MCMA 3MI7X 3IWNC 2GX8A 4JI5F 4U96A 2PMWA 2GQQA 5DLGA 3IN5A 1BMQB 3PO4A 2YNHA 2HPUA 3M6VA 1LOUA 4U6PA 4U7UK 4M5LA 3DDKA 4DLEA 5HL7Q 1CEZA 4N8OA 1YBAA 4R0EA 4LFAF 1NLKL 2ZNYA 3NY0A 5EGYA 2V4QA 4R8UA 2B0GA 2XS5A 2KYXA 4MFBB 1R6YA 2HQDA 4IH5A 3Q8PB 2ZJRQ 4LJMA 2EKYA 4UOCA 4FXWA 2FLLA 1K0VA 4KHPF 4NA2A 2BUNA 3QT7A 1ZAXA 1RXOB 5J2PA 1XERA 1N32F 2E1AA 2XYHB 2CQ1A 3ISND 3MAHA 3IR7B 4F04B 4N8NA 1DTQA 2RU9A 2IA0A 5D15A 1FRIA 3DHXA 2GMHA 3OVBA 2B4OA 4USMA 4PCQA 4PQUA 1NUEA 1H98A 3DOMA 2OSQA 3WDOA 1IBKF 2ACYA 4DR5J 3CO0P 5B08A 1C4CA 3VAKA 4J9PA 1PILA 3AXKA 3QLHA 1ZM4A 3ELHA 4DEZA 2KG0A 3TA2A 1LW0B 3QRPA 1HPZB 4FXVA 1SUQA 2C2ZB 2XEXA 4X4QA 2FVSA 4LSLB 2YKAA 1WC0A 4DX5A 1JIHA 4TVAB 3KJQB 1SJRA 3K89A 1WD6A 3MGJA 2KO1A 4EU0A 3RBXA 1OJ4A 5D4NA 1A7GE 3M8QB 2HS4A 3JSBA 1CBKA 4ZPDA 4KYZA 3Q8VA 3CJRA 3ZTSA 4OYXA 3MM8A 1C0UA 5CCLA 4Y2IA 3G2XA 1FWLA 2BJEA 2W9CA 3CWJA 1GTEA 1RISA 4YY3F 1J5EJ 3CUNA 1EX8A 1SJ4P 2OFHX 2LXUA 4LF5F 1G2EA 1JNRB 2ZWPA 3DDIA 4Y3CA 1QAYA 3HKWA 3KJNB 4QPXA 2AYGA 2FJVA 1U2CA 2VG6A 4ECRA 2P8IA 3KG0A 4PWUA 4F0KA 2XY7A 5KFPA 3AJ2A 4LRBA 4JI0F 4ENOA 3KLHA 3BS9A 1TVRA 4CTAB 1YJWS 2RE1A 4IOCQ 4HKQA 3TUPA 1JLQB 2A2CA 2B5JA 1HNZJ 2VASA 2MY7A 2QLWA 3LANA 3FGVA 3Q89A 4KKOA 4ZS6A 4NRTA 5FLXY 3ULHA 4KIAA 1NO8A 2NSCA 1Q5YA 4C8LA 4RUHA 1KWMA 4HHJA 3PM9A 5K14A 2ALYB 3UQSA 2A3JA 3CTRA 4P6QA 4I67A 2HFVA 4IYQA 4P7TA 3C19A 2HBZB 1QTNB 2HFNA 3OHBA 3HO1A 1X0FA 1UW9A 2HHSA 2RKIB 3BSOA 1NDCA 1OIAA 3A12A 3G9CA 2CPEA 4NXNJ 2JEGA 2YXLA 4DSFA 4DV4F 1JLFA 3VR1A 4ZJQA 1IM6A 2GJIA 1BQXA 4JI1J 2C2MB 3RU0A 2Q6BA 1YQHA 1CS4B 1FKPA 2UVUA 3DLKB 4I64A 1U02A 3CCTA 4R5PB 1SVDA 4CLKA 3RRGA 2EPIA 3T6JA 2NXNA 5LXYA 3W2VA 1S6QB 3RYLA 3RJMB 3F73A 3B78A 3O2IA 1GX5A 3RB0A 4GO5X 3MOJB 1UA0A 4IH7A 4W4MA 4Q2MA 1Y5NB 3DYAA 3OFHA 3DM2A 4DUYJ 3PYFA 5EHHA 4F4ZA 4QBUA 3W9JA 4JB8B 3PNIA 1AFJA 5KT7A 2PFFB 2IMOA 3F41A 1S12A 4JV0A 4KHRA 5J1NA 4NLYA 3IRWP 1QAIA 1HWKA 5IT9Y 2JHEA 2VDHA 3EVWA 3GJRB 2MKJA 3IBWA 3CIMA 2XHCA 1PJ7A 3ISZA 1TZ0A 2F8EX 5DRKA 3V6DA 1OO0B 3FMWA 3IC1A 3HHLB 3N6NA 3D6FB 1RT5B 4LRDA 2QFIA 2M2BA 4CLWA 4JI4F 4OZLA 1QE1A 3K17A 3A8JA 4MK9A 2J8SA 2JVRA 2VQFJ 3VAFA 2F9DA 5CH7B 4UT4A 1X8DA 1VRUA 2HNZB 4K2XA 3H4BA 1VQ9S 3EZ5A 4L6V3 1XR6A 4JV5F 3IBFB 2AV5A 1Q4RA 2KJVA 3GV5B 5L9NA 4PR6A 2B8QA 2R8HA 4L3NA 1N5TA 4MYTA 2Y9HA 2KI2A 4DFKA 1RAAB 4KHMA 3TUZC 3P5BP 5J2NB 5LMNF 2LFVA 1B4SA 4B9TA 4RNMA 4N41A 1JLAA 3NGKA 5ETKA 3PXGa 2KRRA 2PSZA 2GVZB 1UWBB 2BW7A 2VPZB 1YJUA 2WSCC 4AYBD 3HDSA 2DHHA 5DZ7A 1HARA 3ZZPA 2VBWA 2NXEA 2KTQA 4XIUA 3GSDA 3ETMA 1VIOA 4A8SA 3MHYA 1TKZB 5H9FJ 1YZ7A 1UWAA 1BUXA 3NRBA 5HK4A 3HVRA 4CYUA 4ZJOA 2Z56B 1TL3A 1FXLA 3UCGA 2AZ3A 2C1EB 3E51A 4URSA 1ZTWA 1UVIA 2XLKA 2HHUA 1MMNA 2OO4A 2FVPA 1CJVB 2WBRA 3QNWB 3HPOA 3C16A 2DPIA 1UFKA 2DNLA 4ECXA 2BVZA 4Q7AA 1T9TA 4AQYF 2CQPA 4JI7J 2K1RA 4O23A 2V2ZA 2KM8C 1DBDA 2QA2A 1UVNA 5E0OA 4ID5A 4A8FA 1NK8A 3US5A 4B3RF 2XWYA 4GVBA 2VFVA 2WCXA 2UUCJ 4GKJJ 2QLXA 1QUPA 2CPJA 3CVKA 8AT1B 3QIPA 3LF0A 4P9SA 4DL3A 4JI6F 3JYTA 5DZ6A 4L3KA 3OVAA 2F8HA 2WVCA 1W25A 4KY3A 4C0OC 2W25A 2V63A 1T9VA 1W2IA 3PW0A 2HS3A 3A3OB 1KRPA 2BJ1A 4YB6A 1DARA 4X65F 3BDEA 3GMGA 2YPYA 2XYGB 4W92B 2ZH4A 2GA7A 2OPRB 2BV3A 4UF4A 2P6SA 2OPSA 4DR6J 5F8GA 4RLEA 4FBUA 2DT9A 2VODA 1AB8A 2ZE2B 4ZPTR 4WZQA 3PKYA 3ENAA 5LM7E 1Y5IB 1X5SA 3UN3A 5LXRA 1Q5VA 5KFFA 3KDOA 5HI7A 2XHWA 2RRBA 1MNEA 1TKDA 1ZM3A 1HBOA 4HHHA 1DRZA 3IAM9 3ET6A 5DM6Q 3V81A 3UCUP 5KFTA 4K4TA 5ETSA 1EQMA 1MWQA 1F60B 4HYKA 1S49A 2MYFA 3R5AA 1RCXB 4OV1A 4CT9A 1TUGB 2ZOFA 1YJRA 2FZCB 4WU2A 3KOAA 4ZVRB 2HWHA 3U1LA 4LQ3A 3KMQA 2IPOB 4UUWA 3LPYA 2R2TA 4DV3J 4ECWA 4HR2A 4KPCA 3NXZA 3I9V9 3QFHA 2IYIA 4LT6A 2YBVA 3T9NA 3BKUA 5E41A 1TKXA 3GSIA 4ANEA 3IS9B 5G0RB 5HQ8A 5A8WA 3PYEA 3WIUA 2EI5A 4ILRA 3MEDB 1U0HB 2QIFA 2GIQA 1YRUA 5D0EA 1S0MA 4C3KA 3DLJA 2FJWA 3TVZA 4A8MP 4W90B 1JQGA 2CJYB 1TV6B 5SUHA 1D1UA 3H5YA 5B0BA 2JSXA 3H7HB 1G3OA 8ATCB 4ZP8A 2RJZA 4AXJA 1FFGB 4KGZB 1RT3A 5JVGQ 3W8GA 1W7WA 3LP2B 1NSAA 5KT5A 2OPPB 5GMKa 1NCLA 5CZVA 1EJ7L 3FNNA 5ETNA 1X4DA 4URQU 2Q3PA 2HVDA 3QO9A 1JNZB 3OLBA 2R4FA 3IBCB 3UVJB 2G4BA 2I5JA 2XNRA 2IA6A 1DLOA 2QEXS 2BQUA 3PX4A 1CJTA 4TQRA 3MD3A 2LCWA 4LF2A 4V1Ak 3BGOP 4DR7J 2CDRB 1MLAA 1R89A 4ED2A 1SH2A 1S1XB 1NH7A 3POTB 3A13A 3HFKA 2HW3A 4HH0A 3QZ8A 4G6VB 3KLGB 3T9ZA 2HHQA 3TANA 1S76D 1Q0NA 1BHNA 3RW7A 4NLVA 5H9EJ 2RRAA 2NYHA 2ZHAA 2ILYA 2BXJA 5HJXA 3OR2B 1CSJA 1NH8A 4RW6A 5B0CA 6AT1B 3GJTB 4S0MA 1JXVA 2LDYA 4RJVA 4QWCA 4NEYA 2M0GB 3LO3A 4BS2A 1CQNA 2CNKB 5DQGA 1N6QB 2DGOA 2DR6A 2RF2B 1ULRA 2Y1JA 4LFCJ 3MMJA 2N3OA 1DURA 4F36A 2V8DA 2AYEA 4CH7A 1S1UA 1MROA 2Y8YA 5D4PA 2GJFA 4OI6A 1HNWJ 3P6YC 1RT2A 4NYPA 3CCZA 3A3NB 1U26A 4L74A 3OW2R 4LRAA 3QRQA 2XSJA 4A8XA 4ELVA 2AYMA 3BH7B 3VALA 4PABA 2IM2A 1S6PB 2E7VA 2IVFB 1S59A 2UUBF 1RCOB 1RWKB 3M6UA 3PDNA 1LFWA 3ETOA 1VS3A 1V3ZA 1VC5A 1WUUA 1URNA 3FSYA 3HSJA 4DU7A 1WHXA 4DBQA 1RT7A 2CJXB 2VZ9A 2MKKA 4G3IA 2A0FB 5D3GB 1WDTA 4PWDB 2M4MA 5F8HA 5B0FA 5D8HB 2DHXA 5MLCV 1RHKB 2AEJA 4QW8A 4PWWA 3R27A 3LUYA 2NPFA 1UP1A 1A6LA 2VC0A 5LMUF 5K8NA 5I42B 2W2QP 2N4DA 2F1FA 2ZJPQ 3HFVA 4P71A 3AOCA 2Y3YA 5ETRA 4NA3A 1VC0A 4FF1A 5I3PA 1N5QA 5IOLA 1S9EB 3V6HA 1O6XA 1OYDA 3IR6B 2V8VA 2BOPA 4I7FA 1IBCB 4LR9A 1RT4A 2PO4A 1UJ4A 4Q43A 3VVUA 1FTRA 2FJXA 1RU2A 4A8YA 3SSSA 5IC4B 3SIPB 3DLEA 1NJYA 1WELA 3C14B 1KC8T 4ZP6A 4RNNA 5L39A 5C42B 1PIEA 3IR5B 3PW2A 2JZ5A 2OI2A 2FVRA 3MUTP 2BQRA 1MMDA 4XPCA 4ZVEA 2OAUA 4BHQA 2RQKA 3BSAA 4DU8A 2IRYA 1S1WA 5I4MA 1HD0A 1HIYA 3DOKA 2IAJA 4DV2F 3IXQA 2R7TA 5KFAA 3B6BA 4KV8B 3PFEA 2X51A 3QSYB 2LQ8A 3MPUB 4TY8A 5KFKA 2PA3A 1LWFA 1V5IB 1FDAA 1LWCA 4MKVA 3ISNC 1MWZA 3VGUA 4LFBJ 4C0BA 1R0AA 2KDOA 1TL7A 1HNXJ 3PW4A 3OPKA 3QAUA 2BRLA 5G4DA 3GCWP 3VAIA 3N0VA 1RHJB 4WIQA 4MH8A 2DNNA 3BPDA 2BA9A 3C15B 2M70A 1WEZA 1DFDA 1FFWB 5CYMB 3U7JA 1HBMB 4QWBA 2OFGX 4DL7A 1XMQJ 3M1VB 4O44A 1K47A 1UW4A 2GGPB 2VA3A 1EP4B 1L3KA 3ILIA 1H72C 2EW9A 1K1SA 1RU1A 2Z4PA 3GR1A 3C2PA 5KTQA 1GFWB 5L1LA 2WVFA 2EKNA 5IWAF 4CM2A 2XLIA 2HQCA 5IT4A 4IUFA 2XG8A 4ZP7A 4IG0A 3CC7S 4B3SF 1MU2B 2KM8B 1FF2A 4CDIA 3CPWR 3I0RA 5ITHA 1UVKA 1FT8A 2QG9B 3QJJA 1ZA1B 1GXTA 2F5GA 3R5BA 2R7SA 2X1BA 1TL1B 1DQ9A 4I6AA 4YB7A 4WWSA 5AXKA 1S10A 4DV1J 2AHOB 2AGPA 3R5DA 5K5MA 3JTNA 1Q8BA 4DQIA 3RB6A 4K59A 4DV0J 2BE2B 5LT5A 5KFHA 4OJ1A 4TN2A 4A46A 4LBPA 3MXHP 3TO8A 2XY6A 4B3MJ 5KOXA 1U4BA 4B3OB 5J2QA 1IBMF 1FRLA 2OPQA 2KXHA 4WZMA 1SIZA 1YKWA 1U1QA 3F44A 3NP5A 5L1JA 1VIXA 4WFYA 1RLDA 2BANB 4QR1A 3K0JA 1VMBA 2CG4A 5CYJA 1YWXA 1SJ1A 3NGTA 4B08A 2F4FA 1HR0J 2CJAA 4Y65A 5FLXU 3WC0A 5J1PA 4MK7A 2XCPA 2W2PP 3LTOA 1KR4A 2C3PA 5CAAA 3SQGB 2ZOMA 3KXDA 3SMZA 4RW4A 3BF4A 1PAUB 2VH7A 2WOMB 1SC4B 1IWAA 2YWEA 2H4WB 3PRVA 3MPYA 2NXJA 3IA0A 2E44A 2B9XA 4QIGA 3N6LA 4OYZA 1UVJA 4ZCIA 4PEOA 2FY1A 4LQ9A 1SKSA 5THWA 3OTOF 1F3VA 1R7IA 2IHR1 5K20B 2BABA 4C98A 4KC5A 1HA1A 2DCLA 4NYOA 2CADA 3VF0B 2QO3A 5L38A 4UOHA 2DGXA 1XEZA 1RTDA 2CPFA 4NLDA 2KFZA 4BWJA 2AJFE 3I96A 1RWPB 1QTMA 5HANA 2KVIA 1VRTA 5FDLB 2FJDB 1BC6A 1H7XA 4LF6J 1T0TV 5GADI 1N5SA 2MSTA 1WF1A 3AQPA 2HHVA 4QQBA 4UQGA 1N34J 1H38A 1D9FA 2V6AA 2LYVA 3QGPA 3PIPQ 3DRPB 4RBTA 4F26A 3P45B 4H4KA 4TLRA 3HD2A 2AU0A 2EXUA 2FHJD 2DO4A 3JTOA 2GMLA 2CNLB 5C24B 3LP1B 1NSKL 4ILLA 3NBPB 3D28A 2WSFC 1NRKA 2UUAJ 2R2UA 1Y5LB 3W8PA 2HQFA 2VOOA 5IT9U 4X64J 4K2JA 4IQXA 1HBUA 2ZKTA 4DL0C 4LSLA 1F5AA 2XO6A 2QMWA 4RWXA 4ELTA 2DXFA 2CXEA 2W9BA 1F5BA 2PA8D 2U1AA 1ACMB 4K4VA 1GT8A 4F25A 1RTIA 1EKSA 1LWEB 2D74B 1PC4A 3M8QA 2R8GA 3BYPA 3MMAB 2ALZA 5HROA 2Y8WA 2JDJA 4PG6A 2QFJA 1T05A 1HBNB 3SZ2A 4YR2A 3MDFA 3GZ7A 3JSRA 4RU2A 4K4UA 1J5EF 5EX0A 1SC3B 3BQ1A 4FVCA 1J27A 1E6YA 4PPDA 1HWIA 3AY0A 1VHFA 2ROEA 3R7SB 2Y1RI 5M2RA 2LA6A 1U25A 3EPIA 4ED1A 3EXYA 4NI2A 4ED8A 3LW5C 3V2UC 4ZHRA 1VQ6S 1TUWA 3E8OA 3LGMA 5HMXA 1C0TB 2UVVA 1NK9A 1KVIA 1IKXB 2HMIB 4Z7CA 2K3IA 2VA2A 5A0YA 4HHUA 1ZM9A 1OPZA 2Q1LA 3E01A 3OTDA 1HI0P 1JWWA 2VC1A 1JLBA 4F4XA 2XSFA 1MN7A 4OI2A 4U67Q 3BSNA 1RTHB 2E5JA 1S0NA 1T3OA 4CH0S 1IR0A 1JLEA 3TOQA 4C2MA 4NPOA 4HI2A 1X4GA 4ZVHA 2YKNB 3D0HE 2Z30B 4DOZA 4LF8J 3GG1A 4OJHA 2VBZA 6FD1A 2CJ9A 4UOFA 1UCNA 3T1HF 2ASJA 3LALA 3DKDA 4F2SA 2R8JA 4NXNF 4ZIWA 3BH6B 2AEMA 3KK2B 4DL4A 3NL0A 1B0TA 5AE3A 3GJSB 3O6QA 1FVSA 4C11A 2EFGA 3BYRA 4WE1A 1RTJB 3JTPA 2WW8A 4A8OA 1BQMB 1J2VA 4E98A 2D3ZA 2VG5B 2VU5A 1CS4A 3OUYA 3NGRA 4R5PA 1Q7LB 5A8KB 2QRRA 2BJ7A 5HLFB 1M5HA 4ZVQB 2WHOA 2QE5A 3S6EA 3GLJA 3QATA 4DUZJ 4I69A 5K9FA 4ZN3A 4URGA 2FGCA 4DF8A 1PJ6A 4JI2J 2RH3A 4AL7A 2MEWA 4QCLA 1VI7A 2O3DA 5KFLA 1BQNB 1TMJA 2V2VA 1REVB 2JFKA 2G2YA 2KRBA 4UY85 5KFRA 3E3XA 4LVNP 3N9UC 2HHTA 4ZVGA 2XMUA 3GCXP 1OS5A 3IWLA 2YKMB 2WVEA 3TVYA 3KK1A 2YH1A 1SKUB 5HQLA 1IKWA 1RT5A 1N48A 1FRJA 3MM9B 2ZJQQ 1QY7A 1FJ7A 3UR0A 1SJ3P 2J0QD 3JB9k 4GVLA 4RPFA 4DL2A 2YVSA 2YNGA 1V3SA 2X1GA 2MQOA 3AODA 3G6YA 2HNZA 1N36F 4O3RA 1YVFA 5LOQA 2EG1A 1GK8A 2BOAA 4EWTA 3EVMA 4WJBA 5AE2A 5KFSA 5BJRA 3NOGA 2NZCA 2AX0A 1WORA 3TYTA 4K7QA 4OYOA 3D3BJ 4MK8A 4F4KA 1TK8A 1QM9A 2ZWOA 3BN4A 3R1LA 3J80Y 1VJQA 3R7BB 3M2RA 1SL2A 2XMKA 2C2EA 3R1HA 1M5PC 1O8BA 4DV7F 4DV5J 3AD7C 2DNYA 2GVZA 5I3UA 1UWBA 5EWFA 2MLZA 2VPWB 3W66A 2W4CA 3TZYA 2H5JB 3JSYA 3C6TA 2BEFA 3D7SB 4DV6J 4TKTA 1X60A 2V4JB 1AZSA 4CLSA 3VQSA 4N47A 5JMNA 4YMEA 4NLUA 2G13A 4AUKA 3MZIA 5ETOA 1S1TA 3TRGA 2FDNA 3NNAA 4RW9B 3UCZP 1QAJA 2CRLA 2GFFA 5D4LA 2FIUA 4ICLB 3ITHA 3K59A 1G4CA 1KFSA 2MB0B 3GR0A 3AH6A 4O0IA 3M2VB 5I3QA 5D0GA 4DN0A 2AD9A 4PUOA 3CCQS 3NCQA 1R0CB 2QTWA 2ZEJA 2APOA 4DUTA 4KT0C 3DXBA 3L7UA 3TJ9A 1YJ7A 1XMOJ 4NOHA 2UUCF 2HHXA 4M5DB 1K9MT 5AXLA 3QWUA 2A1BA 2E5GA 1D9DA 4IOAQ 3ENWA 1JLGB 3BN7A 3FK4A 4OI4A 1WEYA 2YTCA 4WKRA 1FRMA 4Y2MA 3O44A 2GW8A 1WKKA 3KK3A 4NZ0A 2J7UA 3HVTB 1C2PA 5IXUA 2E66A 2VKZG 3OJUA 2ZBQA 1O51A 1VBZA 2E9RX 1U2FA 2NUHA 3EICA 1DTTA 1QJHA 3UN2A 3O8WA 2KFNA 4CRJA 3CCVS 3AFGA 2RDIA 3Q2SC 2AGOA 2DGWA 1FDBA 2IC3A 4OX8A 1DZ5A 1X9MA 4P2XA 3FBEA 2ERRA 2YNIB 1WG4A 3MFIA 4DR6F 2FVQA 2XGQA 1NDPA 4IDKB 1N56A 3J7Z5 2J0XA 1NSPA 1SJQA 5C2GA 1VQYA 2I9SA 1HNVA 3D1QA 5GMEA 2JLEA 1I6JA 1XR7A 4A8KA 4PG4A 4DR2J 4X62F 3OXFA 4Q0BB 3BKFA 4FZVA 2J9EA 4ITSA 3CJ0A 1AT1B 1LXJA 4ZVTB 1ZAWA 2VG7A 1NAQA 3CE8A 3K7RA 2MJNA 4N56A 3V6KA 1FXRA 2J8AA 3W61A 3KLVA 1R8AA 4NLWA 4Y34A 1FD2A 1NHKL 1IBLJ 2F4VJ 4I0WA 4DV3F 5A8RB 2R7QA 5CD4A 5JJBA 2M88A 1U8SA 4X66J 1LEOA 2B51A 3CW2C 2W01A 3KG4A 3NOCA 4OJGA 3GYNA 2IY5B 3KNAA 3GB0A 5E3CA 2V69A 2KH9A 1RAEB 3GONA 4ZMMA 1BGXT 4NLRA 4WXWA 4FPRA 2O5DA 4USHA 1E6VB 3GIKA 4B9LA 3DLGB 4ZIVA 2MTLA 3I0SB 1G6BA 1IQTA 2ASLA 2DNMA 4Q8EA 1LXNA 1VQOS 1KN6A 1K1QA 4FBTA 5BYQA 5M2PA 3GQCA 1R0BG 1YBUA 2VB6A 4CO4A 4RUCA 1EETB 4RBUA 2R7OA 2CQ4A 3KHGA 5HP1B 2EK1A 3BDPA 2Q6CA 1X5OA 1X9WA 4C8YA 5L8RC 1C1BA 3HLUA 3V4IB 3HCXA 1UZDA 2CJQA 3MM6A 5JVHQ 2GMJA 5J2MB 2HK3A 2HKEA 3SSRA 4PYDA 3TZXA 3GU0A 3SYZA 1RWOB 5KG5A 2OP5A 4C8OA 2DB1A 2B4PA 3KLGA 3G82A 1S0OA 2AQ4A 1WWHA 2NSBA 1CJUA 1URRA 4LMZA 2DNHA 3AB4B 3V5RA 1S6OA 5GVQA 3TUJC 2F7VA 1NJIT 2JC1A 4DL6A 3NG8A 2HZVA 1CJKA 3VHQA 1AUSL 4RO0A 1N6QA 2CJKA 2ZM6F 3CC2S 1RAHB 2UXDJ 2Y0BB 1RQ0A 4YR0A 2GIFA 4NCGB 2XI2A 1Y00A 1F9FA 1VLOA 3SSQA 5CA5A 2Z57B 2CIMA 1HHSA 1FO1A 4IG3B 1WTFA 3LPEA 3VGTA 3I5BA 2VL1A 2D3UA 2J6SA 3KG1A 3I55S 4DR1F 2EVZA 4CCHA 4JV2A 4M5MA 3EE3A 4I6WA 3RRKA 2MXYA 3HM9A 5AT1B 3KLFA 5AXNA 2EG2A 4DCOB 3HHDA 2KHCA 2V8HA 1HL6A 1XBWA 1S6PA 2QMXA 3CCRS 4N77A 4WFNQ 1SKWA 1GH8A 3UN5A 3FBFA 1D8YA 1XNRF 2GCFA 2VIHA 5L1IA 3FFIB 2G0IA 4USUA 2G9OA 1F6TA 1M1GA 4K5SA 4FNIA 3K8VA 1P1LA 4ELUA 3AB2B 2UXBJ 5GAGU 1JKHA 3OHAA 2RMLA 2HFSA 1Y9OA 4ALZA 1HMVB 2ZH2A 3C66A 4OX9F 1SB6A 2OUGA 3RBEA 1PAEX 1XQIA 1JLCA 1KLMA 4X4PA 2FC9A 1NK6A 1DHMA 2GQ2A 3H20A 5IM0A 1SXLA 2ZKUA 2NXUA 1CPZA 1Q81T 4JI5J 1FHTA 2VFSA 3DXSX 2M3DA 4ZK7M 3VGVA 3VZIA 2YNHB 4HL9A 2V8GA 3D54A 2P9EA 1SKRA 5HVGA 1YZ6A 2AEFA 3GFXA 3C14A 4BDPA 3MPDA 4H54A 1FJEB 4H4OB 2CVEA 2B7BB 1TFWA 3RR7A 1KDNA 3MR6A 3PRBA 4FS1A 4LFAJ 4R8UB 4HH1A 4I2PA 4UY8T 2AJ2A 4Y2AA 3C6UA 1R8BA 4HVZA 2YQ0A 2DNQA 3S1TA 4ES3A 1C1CA 1I94F 1PYSB 2LU2A 2AKWB 3PEJA 2C22A 4KHPJ 2D69A 3UI3A 1S72S 2BACA 4KV8A 3IWXA 4DR4J 1N32J 3M32B 1F9HA 3ZO7A 1RT1B 4NCAA 3GJQB 1DTQB 2VF3A 4JI8J 4LFBF 1IKVA 2DEIA 3CD0A 4ED7A 4PQUB 1U47A 4ZDNA 4F67A 3DOMB 2XTJP 1IBKJ 3FMBA 1U1PA 3NWGA 3QGIA 3JQJA 5CZXA 4OX7A 3CCMS 2HSEB 2XYPB 1FNOA 3RRHA 2HVIA 3GP9A 5F3TA 1RWWB 1S0VA 1I3OB 1SUQB 4QIWD 2GGPA 3DCAA 2VJUA 3QWPA 1EARA 2XMAA 3R8YA 3FEYB 4CWBA 3LP0A 4CLTA 1WOPA 2CPZA 3ZZ0A 2HQGA 2XLJA 4P2MA 3G8SA 2DO0A 3QT6A 2JEIA 3PFOA 2IBOA 1VQPS 3MM8B 1NXIA 4TXSA 5K8PA 4EGLA 3DGPA 3UO0A 1RUSA 1RWNB 4MIWA 4KH1B 4M5IA 4USJC 2CNNB 1NHUA 1IR2A 2HHHJ 4DV1F 1TL1A 3I87A 3R6GB 7FD1A 4NA1A 4G1IA 1OYEA 2CFXA 4HLBA 4EK2A 2QA1A 3CJ8A 1X4CA 2VG6B 4DPYA 4DV0F 4EZ6A 2ZD1A 1VQ7S 3HHEA 2EFVA 2R2RA 5C25A 3HP6A 2HWTA 2JNJA 2HIYA 4DN9A 4DG1A 3OFGA 3C46A 1KSPA 4JI0J 1U1OA 4B3MF 4NLQA 1RTZA 2V4RA 2ZZMA 2XC9A 5B0GA 1F0XA 1S5ZA 2B5JB 2VPYB 1UETA 4I2QA 4KKOB 3TUIC 2QX0A 2OKQA 2RB7A 3B4DA 4OZ2A 1YHQS 3SI8A 5K14B 1WHYA 3HI9A 3QPIA 3IG1A 5ETVA 3AD9C 3M9OB 1SC1B 1S99A 4QIEA 4QIVA 1VHIA 1APSA 3A3PB 1MN9A 4KSEB 3KJVA 5LJ3Y 3J7ZT 3E2EA 3GTYX 3UD4P 1HR0F 1U1KA 2IM3A 1K73T 2V68A 1SJFA 5KFOA 3P5TL 3DU6A 1F2HA 5DDPC 4ZPVR 3TX0A 3KYLA 1Y3KA 2ZBRA 3NGDA 3EUNA 2N7CA 3MEEA 2A10A 4QYZJ 4IR1A 3SQGA 1JLFB 1KP6A 3OV7A 3SXLA 2O1PA 2ZFHA 3LQVA 3ZTPA 1JK9B 1XWLA 3QT5A 2GV1A 3NAIA 4EBCA 4C9DA 4KO0B 3FBBA 3SEOA 4GKKJ 3OFFA 1FKPB 2L48A 1Y4ZB 5E2QA 3TWZA 3M4XA 3AXMA 4DX6A 3HD1A 1UEUA 3EM1A 2WRMA 4M63A 3W2VB 4OMFG 1IN0A 3GIMA 3G71S 2PFDA 3H8YA 2RHQB 1TMMA 4CI0B 1S9GA 3DYAB 5F8MA 4N5SA 3DM2B 2XWXA 5E3RA 4QR2A 1GMVA 1AW0A 2PI4A 5C5JA 3G6ES 2HG4A 2POKA 1NB7A 2DITA 2UXCF 2XMWA 3D0IE 3OFEA 3DRSB 4RX6A 4QOTA 4CO3A 1B0PA 2EFNA 4WU3A 1EHWA 2AW0A 1Q7YT 5FJ4A 3CULA 5D0HA 4HACB 3V6DB 2C3MA 3PRDA 3NMAA 2ZVIA 5F3ZA 1KNZA 2ZH6A 1Z2LA 1QE1B 2KT3A 2OD4A 4LF4F 4JI4J 2DH9A 4NWBA 1W26A 5LSLA 2N4CA 1GEHA 1VRUB 1S57A 3DLLQ 2IM1A 3NBPA 4P2SA 3NLCA 4X64F 5GAEI 3HHNB 3VQTA 2LQ9A 3HKZD 1FEHA 2IBKA 1NK4A 4ES1A 2ROGA 4DF4A 2B56A 3FUYA 4JV5J 1A9NB 1T9XA 5M2UA 2AX1A 2DNOA 2MKYA 2HGLA 4WF9Q 2E29A 2V9KA 2DJWA 1SH0A 4QR0A 3T5HA 3M05A 4FF2A 2PC6A 4CLZA 4ZVOB 4M5GA 1MMLA 1X4EA 4K4ZA 2JEJA 2VJVA 8RUCA 3D4JA 3PX0A 4OZ5A 1LK5A 1HBNA 4ED3A 2XQCA 2W8LA 1FJGJ 2WW4A 4QIFA 2FPHX 2FJAB 4AT1B 1ZZNA 2X7IA 2MGZA 2AT1B 2KXFA 1H2VZ 3K57A 5KG7A 3CJTA 1PKUA 3D6TB 5DG7A 1BXNA 3NCPA 4C8MA 3RBDA 3OL7A 4CYUB 2EBEA 3MOZA 2XMMA 2ILZA 1ZS6A 3J80U 1TL3B 3MAAA 3ZTQA 5MAOA 4UW2A 3ICLA 3IRXA 3ZZUA 4RWWA 5EDWA 1CQMA 1RT6B 2PDAA 3J7AN 3C16B 3I82A 1K44A 2GO8A 4OX6A 3SCLE 4OZNA 4L75A 2I6WA 5DJBA 2KZMA 5DGBA 2ZH1A 3T1YF 1TKTA 4ID5B 2X3GA 4GVBB 1SL1A 4C3MA 5F8LA 1IVZA 4TNOA 4B3RJ 4NMLA 3ZZRA 4BWMA 2RS2A 4NLXA 1IKYA 1L3TA 1BWEA 3QIPB 2GAHC 3FSXA 3BBCA 4HTJA 3JYTB 4WCEQ 4LF8F 4ERDA 4WIIA 4JI6J 2ACMA 3WZ0A 5GAEU 3EDQB 4J9OA 2Y0SD 1VQLS 1CG2A 1Q78A 4C48A 1FX2A 4USWA 5DETA 4QW9A 4P2FA 4L76A 1D8ZA 4MIBA 1CVJA 4Y2KA 4J9KA 4FYWB 3ONQA 1RYRA 1H73A 2VQEF 2CDQA 5F0WA 2D41A 4RKUC 1RWMB 2X1AA 1KHVA 4J9SA 3Q8UA 5HSPA 2HNYB 3CMQA 5KFYA 2DKOB 3ZZZA 1QVFR 2FJEB 5B0DA 4YFUA 4ZPWR 2Z8QA 3ZNUA 3FDSA 2A6MA 2MKHA 3WX8A 1FDDA 4JI3J 2HHWA 5F9LA 1R8PA 2C3OA 4DZ6A 2D3O1 4MJKA 1WI6A 4KB7A 3BZQA 4O4GA 1HBOB 2DGSA 3D67A 4EO6A 3ET6B 1XMBA 2C2RA 2W4PA 2RQCA 4NZ7A 2GJ2A 1HW8A 2QL5B 2O01C 4U8VA 2WBMA 4ES2A 4K5RA 1ROFA 1Y0HA 1P9YA 3I5AA 5BYSA 4RW8A 1X5PA 3CIZA 5A8WB 2J0SD 2VDIA 1N8RT 4J37A 3Q8QB 3VZHA 4QWAA 5KT6A 3VCDA 3VAHA 3IGNA 1KTQA 1YSJA 2I2YA 3MM9A 3G4SS 4F50A 2H3EB 2RAQA 3OVSA 2JL9A 3TARA 2HVEA 3GILA 3PYGA 4O3OA 3UNGC 3FVYA 3HT0A 2AWZA 2DR7A 1VGYA 3CNQP 3UFCX 3NCRA 2B9YA 3DRRA 4LBHA 3SV4A 2FHOB 1VBYA 5ETMA 1EB0A 3U1NA 2BYCA 4A4JA 2QC3A 1FE0A 1Z1ZA 5RUBA 1N54B 4C7QA 2F3JA 4DWIA 5HO4A 4NCBA 4XAKA 2I5JB 1T9YA 5GAHI 1NEEA 1FK9A 1DLOB 4DV5F 3BGRB 2JH3A 3AT1B 1CJTB 2GHPA 3FCVA 2H54B 2EFOA 1FTCA 2G0CA 4H4KC 2VPXB 4FKXA 4BC9A 4DJBA 1HYSA 3H98A 1R27B 4ZPBA 2IJRA 1RSCA 2JRSA 3OTCA 3W5ZA 2LEAA 3PEHA 4LR8A 4GRSA 2LXIA 5T41A 4J9VA 4WXOA 5LSRA 3FEZA 5F8JA 1U49A 3TJ8A 4RW9A 4Q2LA 3H5XA 4J5OA 3M2UA 3PV8A 5BR8F 1WDDA 1XJWB 3PO5A 2KKHA 3W65A 2IJNA 5E33A 3P3DA 1GAOA 4ZCKA 1U6BA 3CMAS 5D77A 3VV2B 3BM7A 2D1CA 3OL9A 2H5EA 4XDDA 3LWLA 5DG8A 1XMOF 1S1UB 4TYBA 2OGUA 1UEVA 4TU7A 4KGKA 2BJ3A 4ETXA 2XSJB 2EC0A 4R0JA 4CNYA 3BR9A 1U09A 2W7PA 3BB5A 2BM0A 1JLGA 3R5JB 3RR8A 3BO4A 1YTYA 1FE4A 4NMXA 3JSMA 2HNDB 4OQJA 3PX6A 1P8GA 2UUBJ 4E2FB 3Q8SB 2G0JA 2ZHOA 4JBCA 3WC2A 4EI2A 2UVWA 5A76A 5KG0A 5KOWA 3KLEB 3O1LA 2JLFA 5L46A 1FKAF 4ECVA 3DOLA 4DXLA 2Y1IA 1S77D 1AA1B 4LVOP 3THVA 2DCUB 3RUBL 4M5KA 1AROP 3CO9A 2F40A 2FZKB 2QT7A 2YPZA 3PCOB 3QMQA 1J5OA 2HQIA 3M30A 4D3HA 4B3TJ 2AMCB 2L3MA 1FERA 3HF5A 3R9LA 1LW2A 5EWGA 3DI6A 2AYBA 2R9LA 2BKOA 5HMZA 3UE2A 2ZC4A 3W5XA 4I7FB 1Y10A 1H7WA 3CJ4A 3LOUA 1WKJA 2OTLS 1RT4B 1FJCA 2EWHA 5DDQC 4C3LA 3Q8YA 3I4HX 2H5IB 1ZPVA 2B8PA 2GO9A 4ZPCA 4ED4A 3VWSA 4LF1A 2XI3A 3TJAA 3DLEB 5A8RA 3G87A 4LRFA 1X5TA 4X66F 3MURP 1PYOB 2ZNZA 2OH2A 4DSJA 3W63A 2BJ9A 1FXDA 1JJCB 3DDNA 2Q79A 3CDWA 4YOEA 2NS1B 4LF7F 3L4BC 1OPIA 1JJ4A 2ZUGA 4IFVA 2AJ1A 3W2WA 1L3VA 1RGVA 1S1WB 4ZLJA 1OSCA 2PMZD 2L41A 3DOKB 2YQ3A 2VONA 2IAJB 2PT0A 1JJHA 2QN6B 1QD1A 2CQ0A 4RUAA 4DV2J 3TAPA 4M5JA 4TY8B 1JB0C 2HFZA 4HI1A 3GV8B 2V2QA 1CULB 3IMQJ 4NZ6A 1LWCB 3H0PA 1UVMA 4C8ZA 4YEAA 3T1AA 3CJKA 1EETA 2JVOA 4ED5A 4M5NA 3MMCA 4LIRA 1R8HA 3R7NB 5T7LA 2O67A 3J81Y 2COLA 2JFDA 2EK6A 4X4UA 3BREA 3HVAA 3B4MA 1O5JA 3FCHA 4PPZA 2G2ZA 3GPAA 1SL0A 3S7RA 2LLZA 5HQMA 4O44B 1S6UA 3TAMB 1XC9A 4YP3A 3N28A 2R42A 2KVQE 1WC5A 3HJVA 2DNRA 5KG2A 1S7HA 3KHHA 5KFCA 3MMBA 2E1PA 3QFWA 5CYQA 2YH0A 4WFBQ 1B7FA 5IWAJ 4J9QA 1MWYA 3UD5A 3W9HA 1TR0A 4A48A 4IG0B 3EZUA 5B09A 5IV3A 3OD2A 2X3DA 2HVZA 3OT9A 2Z2MA 3SQOP 1KQKA 4RW7A 2PGCA 4B3SJ 2DR8A 3I0RB 4FS2A 2J6UA 1HQUA 5AJ3J 4YUDA 2MJUA 1FKOB 4ECSA 2H51B 2NREA 3P49B 3HX9A 3MR5A 5DLFA 2R7UA 4IG3A 1NNDA 1F3FA 1SQFA 3MUVP 2EBGA 1Y3JA 1O0PA 5EUHA 1IJEB 2ZDOA 4Z2XA 1HQEA 4M5HA 5EN1A 7AT1B 3PACA 2UUTA 1KHWA 2DGUA 4NRUA 4PRFA 2XM3A 3RB4A 1VJWA 2QGFB 2AJQA 1FVQA 5DS7A 3FFIA 2PEHA 1UZHA 3UDEA 1Q82T 5J2QB 2P9CA 4WFAQ 1N5YA 4F8RA 2M7SA 2OIHA 2OPQB 1IBMJ 4PXBA 2HLUA 1P27B 3L3CA 1VQ8S 1T7PA 5CABA 1RHRB 4Y0FA 1TELA 4NXMF 3J7YI 2WB4A 3BO3A 5HJYA 2KT2A 1KONA 4C6AA 2IVYA 3M9MB 2FB0A 2B43A 3T5JA 2DEJA 3M8YA 2OEMA 1U1LA 4XO0A 3SDEA 4P72A 2DH7A 3K5PA 4ZVSB 1RB0A 4N7TA 4RW4B 1DJ0A 3RAXA 1UJ6A 1B64A 2UV8A 4EYIB 4XK8C 3BSCA 3LH2S 4WPAA 2DRAA 4F02A 4OJ3A 1P9QC 4H4OA 3N5BA 4B9VA 4O3SA 2R7RA 4LF9J 3OTOJ 5IZHA 1FNMA 4AL5A 2CAJA 3JS9A 2W24A 3RB3A 3I31A 4F3MA 3CD5A 3H5UA 4ZCMA 2DVIA 4WK3A 1RTDB 2J9DE 3CB4A 5F41A 2IM0A 2U2FA 3ZZTA 4DR4F 2MZQA 2OEKA 4PG8A 4DLGA 1KLNA 1X9SA 3ADAC 3M32A 3EDRB 1TTHB 3CDUA 4JI8F 1RT1A 3MAQA 2ROPA 1S7IA 3CCLS 5L1KA 3EZOA 2XCAA 1SI9A 1VRTB 3DMJB 2HRUA 3PIOQ 2FYXA 4A8QA 4MKYA 1FFSB 4YR3A 5L9XA 4DPOA 4K0KJ 3UWTA 5J1EA 1UVLA 2CUYA 3NAHA 4JYAJ 3GIIA 1GTHA 4M94A 1VQ4S 2AP6A 2E7XA 1WC4A 4EYHB 1U24A 3CJ3A 2R8IA 5KFUA 1SIWB 3R5GA 3J7YU 1OQ6A 1HBUB 1NSQA 3FC9A 1YLXA 4FP9A 1RDRA 2W9BB 1WC3A 3G8TA 2PIIA 1T03A 3QAEA 3RTVA 1RBOB 2YX1A 3HT3A 1RTIB 3MM7A 2CZ9A 4D3GA 1I51B 4LSNA 1XNQF 1S1VA 3TEGA 1ZBTA 1HNIA 5HROB 3D0GE 2KFYA 1T05B 3MD1A 4F7VA 1RAIB 3CGIA 2XZDB 3ZFVA 2LVWA 4YHHJ 1VLYA 2YX4A 2HHHF 2E5LJ 1E6YB 1TUVA 2L9NA 3OSNA 1N5VA 3A1YG 1K8AT 3KLIA 2KHDA 4AFFA 4H4MB 5DG9A 2BQ3A 4NI2B 2FHMA 3PJWA 4GC7A 1U0SA 4B9NA 4LREA 4ZHRB 3NWRA 2IIHA 3MR2A 1U1MA 1V5VA 2FTRA 3BV8A 3H40A 4OHVA 3NNHA 2WONA 1S9FA 1NKBA 1WSVA 2UP1A 1N33F 1ZM2A 2ZZNA 5KT3A 3GIJA 4DSKA 1KD1T 4CP5A 5A0YB 2L08A 3SV3A 4CLPA 4AD6A 3E01B 1KFDA 4RNOA 1W2BR 1JLBB 3M6XA 2GIRA 4K8RA 2FY8A 1S79A 4OI0A 2XS2A 1JLEB 1ZYQA 4IOBA 1Y7PA 1H6KX 1ZA2B 4U7UD 1Z2ZA 2ATLA 2JLGA 2ZBPA 4KTQA 5H9FK 1R8CA 5BXIA 3QGGA 1QSLA 1IM4A 3PKMA 3T1HJ 2IDEA 2HGMA 4NLTA 1Q8LA 2CZ4A 3Q8RB 2IYGA 3L09A 3RG6A 3TEHB 2J6TA 5ETTA 2MZTA 2DXEA 3EGVA 1YITS 4OHWA 3AOBA 4C11B 2HFUA 2J9DA 4KJIA 1P6TA 4WE1B 2JX2A 4MFBA 4GKKF 1KOOA 2DHSA 4KO0A 2KL8A 5CHCB 1EIYB 1ZZFA 2KXNB 4ECQA 1N88A 3OUYB 4EUVA 3OXGA 1DY3A 3ZC4A 2NZ4A 1HKAA 3UDCA 4AXIA 4OFZA 2RQ4A 5AE1A 3PR5B 3SCJE 2J5AA 4B17A 3BEGB 2BW2A 2M8HA 3OTBA 1QVGR 4MTPA 2LECA 2HURA 2LMIA 2DIVA 3NKYA 1HI1A 4FYYB 4WFZA 2VOPA 4ZVFA 1HI8A 1WHWA 3IO1A 3DC2A 3HZEA 4DR5F 3NNCA 1VFJA 3DRSA 2RRNA 3MEGB 2DYAA 3W7BA 1EKRA 3UD3P 2R2SA 3N5FA 1V9OA 3GV7B 2I38A 1Y11A 4HT5A 2OTJS 5KFZA 4X2BA 3OL6A 4ECUA 1KQFB 1X4AA 2YQ1A 4HACA 4UZCA 1NJZA 1GNKA 2ZH7A 4FYVB 3KK1B 3U1MA 1N4LA 2WK4A 1IKWB 4OHZA 4J9RA 1LW0A 1HPZA 4PXCA 4F4AA 1VBKA 4NE9C 3RAMA 3PG9A 1XR5A 1PYTA 2HQ3A 2YNGB 5FD1A 1Q79A 5A2QY 3TAQA 2DRBA 3G6VA 1N36J 2NQPA 3TA0A 4ID8A 2V9WA 2QL9B 1NDKA 1JXEA 1RBLA 4UOGA 2NPIA 3H2UB 4Y00A 2ABYA 2C2NA 4EBDA 1SC6A 5DDOC 3PHTA 2ADBA 4YQWA 3M2RB 2GZOA 3FQKA 3TVKA 4I68A 4FF4A 2HHPA 3KUHA 1WG1A 4IFYB 2LQ5A 1AXQA 1FJGF 5I3UB 4DV7J 1UJ5A 4OHYA 2OJ3A 4PZVA 1UMJA 3C6TB 2YWGA 3T5KA 3M9NB 1AZSB 2FLPA 1WKLA 2BBEA 2OMLA 1GXUA 2RUSA 2DY1A 1NJXA 1WF2A 2GVDB 2C2OB 1S1TB 2B6AB 3QSIA 4CTAA 2W8KA 4FYDA 1HNZF 1R6VA 5GADU 3QRRA 3GG0A 1JLQA 1VK3A 2ZH3A 1RT6A 4Z7YA 3ITHB 3K5LA 3D68A 4CT8A 1WEXA 5ADZA 2G2OA 1B7YB 1HLWA 2RSQA 2YNFB 1BLUA 4PUOB 2BJ8A 1TK5A 4DFMA 3K5NA 2CQ2A 1RWXB 5HBMB 3F0NA 4EO8A 2P2CB 3H4DA 2OLWA 2HBYB 2V50A 3CD6S 2MHEA 2LEPA 1NK7A 2F9JA 1VQMS 4PG7A 2RKIA 3KK3B 1RBAA 4IO9Q 2CPHA 2GNKA 1B70B 2D9PA 4BBYA 5K8MA 4WP9A 1DTTB 4JI1F 4CO1A 1GMUA 5H9EK 3PVXA 1KKHA 1ZTTA 4JUZA 3PTWA 2DPJA 2IC3B 4C4WA 1GX6A 3FEXB 3DLKA 3GFYA 3MTKA 2ZH5A 3FRYA 4NEZA 2BRKA 1S6QA 3CC4S 4J90A 4X4NA 4CLFA 2LEBA 2HNYA 4DQSA 2FQQB 4DUYF 4O4RA 1HFEL 2VFRA 3QGHA 2DH8A 4JI3F 4IR9A 4MT1A 1T95A 4MMOA 3L7OA 2ZBCA 5HAOA 4U95A 2KJWA 3TZZA 1X4FA 2ZH8A 1HNVB 4OYWA 1BD6A 3TQ1A 2CQHA 2GQCA 2RS8A 4P7VA 4X62J 3NGSA 4PAAA 1UAWA 1WJ9A 2VG7B 2DBBA 2IDLA 4ETZA 1OMSA 4DZDA 5HN0A 3NS7B 2A18A 5IQQA 1I5OB 3HHLA 5AXMA 3TW0A 1TAUA 3MECB 1YG0A 1XN9A 4NLPA 4DMZA 2LA4A 2NXCA 2VQFF 3FQLA 1HWJA 2C2KB 2E7WA 3EVOA 3CCSS 5ETQA 4DQRA 5F9NA 1ZAVA 5DGAA 5KFBA 4B9MA 2FHJA 4OYIA 3J7A1 4EZ9A 2HIQA 3JAMU 4HT7A 2ZOGA 4RU9A 1WC6A 3D1HA 3WHIA 4M1KA 2XMJA 2DR9A 3SFGA 2W2NP 1Q8IA 5J2NA 1C4AA 5CXTA 2JWNA 4UUXA 4ZN1A 2R7XA 3OL8A 5E7OB 1M5OC 3PW7A 3W60A 2IRUA 4DX8H 4N76A 1BY9A 4DQQA 4FNHA 4CLYA 4KGVB 4TU9A 1C1BB 2BZ2A 4C8NA 2Q43A 1ZOTA 1JX4A 4QJVA 3MM6B 2I0XA 4OLPA 2J9CA 3BGRA 2MZSA 2DIUA 1TKZA 3I4PA 3DLHA 4OZ3A 3KTQA 3CXCR 1R3NA 4DSEA 7FDRA 2DNKA 3RAQA 1NZ8A 1H3DA 1MW7A 1RABB 1H0HB 3K5MA 2XMTA 1KTVA 3VTIA 5A6PA 3J81U 4PYAA 1UA1A 1CJVA 1R31A 1VK8A 4G1QB 3TZWA 2VD3A 3G82B 4J9LA 4JI7F 1CJUB 4OI1A 1JMTA 3MEKA 3FRZA 4WP3A 4KFBB 4XDCA 2JEFA 5KT4A 4K50A 3I32A 1CJKB 1TL4A 2H1YA 2ZHBA 2H48B 5K8OA 2ADCA 3ZXWA 3HSDA 1G7CB 4GKJF 1BE4A 1F1BB 2FJBB 4IRDA 3DU5A 2ZM6J 1RACB 2XZTB 3D2WA 3PW5A 3FZBA 1QUVA 1RAOA 1VISA 2FUG9 5E5NA 3TP2A 2BKNA 3LAKA 2MLYA 5H1SV 1NPRA 3KLFB 4DR1J 3OJSA 2Z58B 5KFMA 1Q1KA 3Q86A 3BR8A 4MIAA 1TAQA 3S8SA 3BO2A 1WTBA 3G86A 2HNDA 1KQSR 4Y28C 2VFUA 2OPRA 2UV8G 3KLEA 3BQ2A 1XNRJ 2ZZTA 3IGVA 2CPXA 3AOAA 2ZE2A 1UKUA 1EAYC 3MUMP 4DSLA 1M5SA 5EWEA 3D6HB 1EZZB 3MF5A 4V19J 1JKHB 1SH3A 2KZZA 2MQMA 3L7PA 2RIJA 3IFEA 1L3SA 2LDIA 4ANCA 3MCNA 3M8WA 3GE9A 2ZITA 1PCAA 4B3TF 3IM9A 5KG6A 3AD8C 2BX6A 2W2OP 2XB2D 3KHLA 1RE1B 4OX9J 3UPFA 3EX7B 1JLCB 3DRXA 1RHQB 1KLMB 4EBEA 3CCWA 4NL5A 5KAKA 4ZVPB 5IM0B 3U02A 3KJFB 1RKIA 1FI4A 2BR0A 1OSDA 1SCJB 2UU9J 1WI8A 3M6WA 4DFPA 2XO7A 2QL7B 4F0HA 4TU8A 4X4TA 1RHUB 3CD7A 3IS9A 5G0RA 2OMOA 4ATNA 3Q2TC 1X4BA 1VCTA 3MEDA 1U0HA 1YI2S 3OR1B 1UL3A 2FD2A 2FLOA 2VHGA 2Y1LB 2X1FA 9RUBA 2V34A 1TV6A 4I2PB 2VKRA 3THPA 3TX8A 3MPWA 4LUBA 2R7WA 1UTAA 3MR3A 3C6UB 2DGQA 4QWDA 1UEKA 2RILA 1Z4UA 3G96A 2MKSA 4M95A 3P8BB 2RU3A 3PJXA 2VICA 1C1CB 2N82B 3H25A 4U8YA 5F8IA 4MAKA 2RD5C 2V94A 5A6WA 1I94J 3LP2A 4BC7A 2OPPA 5B7WA 2OD6A 1RWUA 4UZBA 2MQQA 1X31C 1F5CA 4NASA 1CULA 3B82A 3EWGA 1RAGB 2CJBA 3QJPA 3UVJA 3MM5B 1IKVB 1GQEA 1H2UX 3FCWA 3GYXB 1RAFB 4ECYA 1N0VC 3QYYA 4O3QA 4DR7F 2LU1A 4GC6A 3P4UB 1DAXA 3ZZYA 3VGSA 3ZTRA 2A6OA 1MG7A 3TQEA 1SQGA 2Z2LA 3CJQA 4DR3J 1A0OB 4ZVUB 4FN5A 1ZPWX 3M8PB 1RADB 4WBFA 1S1XA 3POTA 4K4YA 2C28A 5LJ5Y 3N79A 2W9AA 4Q45A 4DX7A 4U7CA 1QLNA 4ZLNA 2CQGA 4DQPA 3R3TA 2HEKA 1Q86T 1WNEA 1XTZA 2B4VA 3TAMA 3OR2A 2QA4G 2K7JA 4DCPB 1N52B 4IKAA 4LRCA 4CO2A 2FZGB 4DS5A 2MQPA 3P96A 1SV5B 3LP0B 4NLGA 4B9UA 1FWKA 1WOOA 4K4XA 4LFCF 2RF2A 1U7LA 4FYXB 2RT3A 2HRYA 1FD8A 1HNWF 1QAXA 3DNCA 4USVA 2W1BA 2GS8A 5KFIA 3DGPB 1FDNA 2HBQB 5AJ3F 3X3UA 2VFTA 1HHQA 3H59A 2WVDA 1RKJA 1SPBP 1NZAA 1NBEB 1FKOA 2B4UA 1LK7A 2GHWA 4E0DA 2E1CA 3C3LA 2ZD1B 1AYEA 3BPSP 3A8KA 1L3UA 5C25B 3HXMA 3F56A 1DQAA 3L95X 1IWGA 4DPXA 1VOMA 4DG1B 2F8MA 3KHRA 2KYZA 1KVKA 1S48A 1T9WA 5D3GA 3G8QA 2IMWP 3ILLA 4CM0A 1WSRA 1CC7A 4PWDA 4C8KA 2QLBB 2A2DA 3EJMA 3H5SA 3R97A 3RZAA 3A4TA 3ZZOA 1RK8A 5DDRC 5KT2A 4I2QB 2F63A 4KE5A 4DHVA 5I42A 4BCAA 4CNZA 3Q24A 2N3LA 4O0NA 3IG1B 2J7WA 5JUMA 1TL5A 1S9EA 1PG5B 4Q5VA 3T19A 3FKBA 1FRKA 1SBRA 3KJVB 3L9ZA 3PY8A 4F0MA 2HWIA 3CJ2A 2V2KA 1FWPA 3BKTA 4B9SA 3QQCD 2OSRA 4EFAC 2BJDA 4QZVB 1TU0B 3A8IA 1REGX 3MEEB 1T94A 3KFWX 1S4FA 2RQMA 2MKCA 5C42A 1IJFB 2V8PA 1ITPA 2ZDPA 4NX9A 3W5YA 1D9AA 2DGTA 1U6ZA 3R2CJ 2R8KA 2AGQA 2MKIA 2MPUA 1LFPA 4X84A 1YJTA 3EXCX 4LF9F 5J2PB 4EEYA 1RP5A 5T14A 4ED0A 3WIVA 3M7VA 2QLFB 3EMTA 1S9GB 2NYIA 2AJ4A 4OZJA 2DNGA 4JOUA 3T3FA 3MR7A 3FSIA 4RBVA 4RL1A 1HNXF 1NPPA 2DD8S 3GFZA 4GO7X 5LL6d 3W3SA 2HVHA 2UXCJ 2DRDA 5E3QA 2CQBA 2QJ3A 5F8NA 3HHLD 1QSYA 4MYUA 2AF6A 3DMJA 3I6PA 2HAFA 4J9UE 3QLHB 1HD1A 3C15A 3R5CA 1SQEA 3EYZA 3DFEA 4K0KF 4P75A 1YJ9S 4JYAF 5CYMA 1XMQF 3LGHA 1YJNS 1HBMA 3JQKA 3UDVA 1UPPA 2MLXA 3M1VA 2HZCA 2CPDA 2IFXA 1RAJA 1EP4A 5B0AA 4OHXA 3GIRA 2HK2A 4LF4J 4OLOA 4Q8FA 3MWBA 4O3NA 2DHGA 2XMVA 4OL8A 4DDFA 4X4RA 2KU7A 3OBIA 3W1YC 3EGWB 2QZ8A 1MU2A 5E3AA 1HW9A 5JXSA 1C0UB 3UW1A 3I56S 4CO5A 3C8YA 3TI0A 3CJ5A 3D3CJ 1GXLA 2IRXA 3AA8A 2W9CB 2KN4A 2XNQA 1PJ5A 4YY3J 2XULA 4DCJB 4LF5J 1IUJA 1R43A 1U1NA 5A2QU 3AA9A 2AIRB 4ZITA 4IQMA 4YHHF 2E5LF 1PGZA 5D78A 5KFEA 3FZ2A 1NJWA 3CF5Q 4HDGA 2MGZB 5ETLA 4OV6A 1F2GA 2QYCA 2BE2A 2OELA 3HSGA 3KLHB 4H4MA 2V5HG 4UQTA 2BDPA 1TVRB 2JC0A 3MAAB 4KH0B 3BGUA 3BGLA 2UVRA 3IRXB 3N01A 1UFWA 1WC1A 3TNVA 2YWKA 3G6XA 1U8WA 4B3OA 2HRTA 2LP4A 4MKAA 2BE9B 1YRXA 4JP8A 1M5VC 5C7PA 3H42A 1RYSA 2ASYA 3Q83A 5IT0A 2WB1D 3HJFA 3D5MA 1S4EA 5C2CA 1YDLA 3HZGA 1RI7A 3HHKA 2M52A 3CMES 1TKTB 3IM8A 4LR7A 3T1YJ 1NU4A 2MY8A 2BANA 2IJFA 1M5KC 1IKYB 4PG5A 2QSWA 2V67A 2DXDA 2ZBIA 2BKPA 3CCUS 2D9OA 3SFUA 1X0PA 1NHVA 4EMDA 1M0SA 3MPVA 3I9ZA 3KMSA 4QU7A 2WOMA 3MTJA 4DV4J 2CNOB 5KFJA 5KG4A 4I56A 2RUGA 2HGNA 3WQPA 1FA0A 4RZRA 3HMJG 3T5LA 4JV1A 1KOHA 2XGPA 1B99A 1UPMB 2MZ1A 2W7AA 1X4HA 2EFPA 1ZH5A 3JQMA 2VQEJ 2LQJA 4QWEA 4A8WA 3H2VE 1GMWA 3AAWB 3ENQA 4J7CA 6FDRA 4TYAA 2LKZA 2DNZA 5KFVA 1P1TA 3ILJA 1U6FA 2CWXA 3QIDA 3OQ2A 4O4GB 4CLUA 1HHTP 2CZVC 2MZJA 2L9DA 2QLJB 2XS7A 1AFIA 4LF6F 4HEA9 5FDLA 3CDAA 1N34F 1Q16B 1WF0A 4UTGA 1XK8A 5HVFA 3MEGA 1NB2A 3DRPA 1RJJA 1QSSA 1CLFA 4ZLLA 2VBXA 1U2RA 4RW8B 4IRKA 2QSFA 1L5UA 1G1XA 4CIOA 5C24A 2UUAF 4ZCLA 3QT8A 3LP1A 4YB1P 3CCES 2R7VA 3K2YA 1H2TZ 3VAMA 2ZUAA 2H4YB 3AHPA 4MKBA 4WP8A 4RNFA 3NGUA 2N7YA 2WSEC 3T6BA 2YKPA 3FJ2A 2M5YA 4Z37A 1Q53A 3DRRB 1LWEA 3MFHA 1V6HA 4P73A 1M1HA 3CJSA 1JLAB 5LMNJ 3RBZA 4F3OA 1YJVA 3CDBA 3MMAA 1OY8A 2RHSB 2C3YA 1LNQA 4KBIA 3DGVA 2RDJA 3KNGA 1ICEB 1FK9B 2NUUG 2E5IA 1RLCL 3PHEA 2CQ3A 4IFYA 4DPWA 4Y2CA 4LBIA 4TQSA 1ELOA 3EGZA 2HS0A 1HYSB 2ASDA 1IQZA 4USTA 2C2DA 4FXDA 1OQ3A 3OLAA 1FNXH 4J9MA 1QDUB 1C0TA 2YX7A 1IKXA 2NCKL 4K4WA 2DISA 2HMIA 4USKA 5KFQA 3W62A 4ED6A 2GVDA 1NPKA 2HLTA 2B6AA 2ZC3A 2B9EA 2K1RB 3LAMA 2L9WA 4AQYJ 1X7VA 2H9ZA 2QV6A 3M2UB 4U9RA 1RTHA 2HBRB 5BR8J 1VRQC 1TFYA 4YDDB 4C97A 2YNFA 3KUEA 4XTTA 3EPGA 3U27A 5DQIA 4PXEA 2YKNA 3H90A 3B8HA 3R6LB 5HBMA 4LIWA 3DLBA 3WBZA 4I4BA 2HZAA 2C42A 4ZA1A 3EGNA 5U47A 1FRHA 2DNPA 3QZ7A 3AQOA 3AJDA 4USIA 5HMYA 3NEKA 5HMWA 4OIXA 3MCSA 3HFZB 4DPTA 1T9UA 1Q8KA 3VAJA 3JSMB 3BJYA 2UUWA 2YKQA 4X65J 5DO2A 1LWXA 3KK2A 4F4YA 3PR4A 4F2RA 1U45A 3NMRA 2MHNA 2Q66A 2F65A 2HFOA 2OPSB 2LQBA 1YGYA 1RTJA 4Y6IA 4KQZA 3DOLB 2M9KA 2J7KA 1BQMA 2VG5A 4CH1A 3FBCA 1Q95G 4NYZA 3NS5A 5KG1A 3KWMA 5A8KA 4QU6A 3V6JA 1J5OB 4WTOB 5HLFA 5IC6B 3M30B 4DUZF 3GWCA 5LSOA 2CYYA 1LQ9A 2JJ4D 4QYRA 3V81B 4ZOSA 4PKDB 2EC2A 4JI2F 3GYGA 1XIQA 4NLOA 1LW2B 3DI6B 1VQSA 4CO0A 2MZRA 2ATCB 4OYBA 3D66A 1JJ2R 4ER8A 2YKOA 1VDHA 3AJ1A 4B02A 1BQNA 2E9TA 2VV5A 3CCJS 5HATA 2W2MP 1REVA 2QA4S 2FVCA 2UZAA 5IFMA 1KQGB 3I5CA 4L73A 1TKXB 3ENVA 3K8WA 3OXLA 2YKMA 1YRTA 4IRCA 1D0EA 4WFXA 1VC6A 3UNYA 3MECA 4KGMA 3ZTOA 4YDXA 2C3UA 3CT9A 1BWVA 4TLQA 1NK5A 2MQNA 4WTYA 4LF7J 4IFVB 4L72B 4KRWA 3W2WB 3RW6A 1NMEB 1RT3B 2EFQA 2MMYA 3X1LB 4KGXB 4ZLPA 5BYRA 2PD1A 1T11A 2KT5A 3B54A 4V19X 5E3PA 3QO9B 4LSZB 4YN3B 3CJKB 5KFXA 2CQIA 5SZTA 4FKYA 2MQLA 3MMCB 3SBMA 1U1RA 2GAGC 4A47A 4ZP9A 5T7LB 2PI5A 2D7SA 4G65A 5GAGI 4BLGA 4DV6F 5B0EA 2CG8A 1LKZA 3D9BA 4ECZA 2WTFA 1PBUA 1HQ2A 2V4JA 2CQCA 4DL5A 1NDLA 2K7KA 3M8RA 2KB2A 4WKYA 4AE5A 2G1DA 3PZPA 1N0UA 1DQ8A 3N4WA 5KFDA 1ZETA 1UFLA 2CVIA 3Q22A 4IH6A 4RW6B 3D6MB 2PE8A 3K58A 3SCIE 1PO6A 2FC8A 2NLWA 3MMBB 3TA1A 2CQDA 3J81j 4G1QA 5CYQB 3QJLA 4ICLA 3LA0A 2K3KA 3M2VA 2E9ZA 3BGFA 4KFBA 1S97A 2QMUB 1HWLA 2CPIA 4I1TA 1WOSA 4RW7B 4OZ0A 1MROB 3Q0AA 3HVWA 1RT2B 1T3NA 5D4OA 2HAIA 4M5DA 1RWVB 2IVMA 1HQUB 1NK0A 2P5VA 4CZCA 1VQ5S 3CSKA 3K5OA 3DRYA 2YWWA 4GMKA 3OTEA 2K2PA 5HVHA 1WHVA 3HVTA 1IXKA 4RNHA 3D1OA 1KS2A 2W7OA 4J91A 4RR5A 4QPTA 1HQEB 2V0NA 2RNEA 4KPYA 1RT7B 3LGNA 2GC8A 2BE7D 1T02A 4CLLA 5F0UA 1I1GA 2DHAA 3TR5A 4F3QA 3CEDA 2CKWA 2Z2YB 4E8UA 5GAHU 2BMBA 5D0RA 2YNIA 2ZH9A 1VQNS 4KAIA 4IDKA 3HSZA 1N5YB 2DR5A 1FEEA 5LMUJ 3UR3C 2WZ1A 2QYGA 3ZNJ1 4FF3A 1NM2A 2EEYA 1FCAA 4ECTA 1T8EA 4DR2F 2K06A 3UDLA 2I1RA 3DHWC 1TP7A 4G1PA 1KBRA 4Q0BA 1NKEA 3R2DJ 4P52A 4OZ1A 1EQ0A 2I8EA 2E1RA 4ILMA 5CCMA 4NXMJ 1D3WA 2KG1A 3M8SA 2DK2A 4I6YA 2CPYA 1IBLF 2F4VF 2CA9A 2RVJA 1YK9A 3JAMY 2PN6A 4NLSA 3DN9A 3SDEB 3PYDA 2UU9F 2MSSA 5IV4A 1FRXA 1FX4A 5IQ6A 4KR0B 5EX3A 9ATCB 1PSDA 3V4MA 2CWKA 3M8ZA 4J9NA 2VBYA 4W98A 4OYMA 1MSWD 3OR1A 3VAGA 1F9EB 1VBXA 1H74A 3CDEA 5D6GA 3VVTA 1OY9A 1GMWD 3IAS9 4R25A 2FGOA 1WG5A 1E6VA 1VQKS 3A8EA 3DLGA 1HWUA 4OYPA 3I0SA 1LV5A 2G1HA 4O3PA 4WYLA 1RA7A 1LWFB 2YWFA 4ZKAA 5CD4H 1M1KT 3W64A 3QBCA 1KVJA 2K8GA 1PBAA 4DFJA 5IS2A 4AL6A 1R0AB 1IR1A 5HP1A 3T41A 1KEKA 1TL7B 3S01A 2B3TB 2HYIB 2R3VA 1U48A 3MCOA 4CQ1A 4X4OA 2JOQA 5KFWA 3Q23A 2P6TA 3V4IA 3MM5A 2DTJA 3PJ9A 1FESA 2XBPA 4QYZK 3W9IA 2O66A 1NKCA 3HHLC 4YS2A 4WK1A 5KFNA 4ANDA 4M8LA 5J2MA 4IO1A 3BBFA
chains in the Genus database with same CATH topology
1Q78A 5DM7Q 1XEZA 1TL4A 5J1EB 2ZHBA 5DETA 4QW9A 1OWXA 1RTDA 2NR0A 4DR3F 3O5TB 5K8OA 1CC8A 2ADCA 1D8ZA 4MIBA 1G7CB 1CVJA 2CPFA 4NLDA 4GKJF 4Y2KA 2FJBB 2KFZA 4WYWA 4F4WA 4BWJA 2W4DA 2AJFE 3DU5A 4IRDA 3M8PA 3I96A 4J9KA 1YIJS 2SXLA 2M8DB 3HK2A 1B0VA 1QTMA 5CQGA 3ONQA 2PMHA 2J76E 1RYRA 2XY5A 2ZVSA 4DR7F 2VQEF 2CDQA 3D2WA 3PW5A 3FZBA 2E1MC 3KKFA 5F0WA 2D41A 1K0TA 2KVIA 4RKUC 1VRTA 5FDLB 2X1AA 2FJDB 1KHVA 4X4VA 1BC6A 1H7XA 4J9SA 1QUVA 5GADI 3WX4A 2HNYB 3O3LA 1TQLA 1N5SA 5KFYA 3ZZZA 2MSTA 1WF1A 4HDHA 2FUG9 3AQPA 1QVFR 2FJEB 5B0DA 2WAQD 2HHVA 4YFUA 5E5NA 4QQBA 3TP2A 4ZPWR 2Z8QA 4UQGA 1H38A 1D9FA 4K4SA 3FDSA 2MKHA 3LAKA 1TK0A 1FDDA 2LYVA 5H1SV 1SV5A 2HHWA 3QGPA 3PIPQ 3KLFB 1T03B 3DRPB 5F9LA 3OJSA 4RBTA 2FHKA 1R8PA 2C3OA 4MJKA 4F26A 4DSIA 5KFMA 4H4KA 4TLRA 3GFHA 3MM7B 1WI6A 4YB5A 2AU0A 1Q1KA 4FVMA 2B9WA 3BR8A 2UXDF 4MIAA 2FHJD 2GHVC 2DO4A 4KB7A 1TAQA 3BZQA 2GMLA 3JTOA 4O4GA 3S8SA 1HBOB 3BO2A 5C24B 4X4SA 2DGSA 3G86A 1WTBA 4LSNB 1RA6A 2HNDA 1S1VB 3LP1B 3NS6A 4EO6A 1HNIB 5DQHA 2MDAA 4NCGA 3NBPB 3D28A 3BQ0A 4ILLA 2WSFC 1NRKA 1KQSR 1AUDA 2E5HA 2R2UA 1Y5LB 1XMBA 2C2RA 4Y28C 2VFUA 2OPRA 2W4PA 2UV8G 2VOOA 3KLEA 3BQ2A 2BM1A 4IQXA 2RQCA 4NZ7A 2GJ2A 1HW8A 1HBUA 2ZKTA 3IGVA 2CPXA 3THTA 2O01C 4DL0C 4DS4A 4HTIA 2WBMA 4LSLA 1F5AA 1WACA 1UKUA 2ZE2A 5KFGA 3MUMP 4ES2A 2QMWA 4RWXA 1M5SA 4ELTA 4DSLA 5EWEA 2W9BA 2Z0GA 3MF5A 4V19J 1F5BA 1JKHB 1SH3A 2KZZA 2MQMA 4K5RA 3L7PA 2RIJA 2PA8D 2U1AA 3IFEA 1ROFA 1L3SA 2LDIA 3KLIB 1Y0HA 2VUGA 5FIIA 2AJ0A 4K4VA 1GT8A 3GE9A 4F25A 3I5AA 1RTIA 2ZITA 5BYSA 4RW8A 1LWEB 1X5PA 4B3TF 2D74B 5KG6A 3CIZA 1PC4A 3M8QA 5A8WB 2J0SD 2R8GA 2DGVA 2XB2D 1N8RT 4J37A 3KHLA 3Q8QB 3VZHA 3MMAB 3UPFA 4QWAA 5KT6A 3EX7B 3VCDA 3VAHA 4PXDA 2ALZA 3IGNA 5HROA 1JLCB 3DRXA 2JDJA 4PG6A 2QFJA 1KTQA 1KLMB 1YSJA 1PC5A 2WONB 5KG3A 1T05A 2FLNA 3LWMA 1HBNB 2I2YA 3SZ2A 3MM9A 3G4SS 4F50A 4EBEA 4YR2A 3CCWA 3MDFA 4NL5A 5KAKA 3GZ7A 2UXBF 3OVSA 3JSRA 4RU2A 4K4UA 5IM0B 1JXLA 1J5EF 5EX0A 2JL9A 3BQ1A 3U02A 4XPEA 4OI3A 4FVCA 3TARA 1E6YA 4PPDA 1RKIA 4O3OA 3GILA 3UNGC 1HWIA 4PQAA 3AY0A 2BR0A 1OSDA 3N6MA 2D3OR 1VHFA 2ROEA 3FVYA 2Y1RI 5M2RA 1WI8A 2LA6A 3H2LA 3M6WA 1U25A 4DFPA 2XO7A 1HMVA 1V3RA 3EPIA 2AWZA 2DR7A 1VGYA 4ED1A 4TU8A 3UFCX 3EXYA 3NCRA 2B7CB 2LXFA 2B9YA 3DRRA 4TY9A 4X4TA 3SV4A 2YWHA 2FHOB 4ED8A 3CD7A 1VBYA 3IS9A 3LW5C 5G0RA 2OMOA 4ATNA 3Q2TC 1X4BA 3V2UC 4ZHRA 1VQ6S 3U1NA 3MEDA 4C0HA 2XZWA 2BYCA 1YI2S 4A4JA 3E8OA 3LGMA 3OR1B 3OSPA 4Q44A 5HMXA 1UL3A 1C0TB 2J0WA 2UVVA 2FD2A 1NK9A 1M90T 2YY3A 1KVIA 2FLOA 2P9GA 1IKXB 2X1FA 3SCKE 2HMIB 1FE0A 1Z1ZA 4ZPAA 1N54B 4C7QA 1TV6A 4I2PB 2VKRA 3THPA 2F3JA 2K3IA 3MPWA 4LUBA 3TX8A 5HO4A 2R7WA 2VA2A 4DWIA 3MR3A 4NCBA 4XAKA 2I5JB 3MI7X 3C6UB 5GAHI 5A0YA 2DGQA 4QWDA 1ZM9A 3IWNC 2GX8A 4JI5F 2RILA 1NEEA 1FK9A 1DLOB 1Z4UA 1OPZA 4DV5F 3BGRB 2JH3A 2GQQA 3G96A 2MKSA 2Q1LA 2GHPA 3E01A 3OTDA 5DLGA 2RU3A 1HI0P 4M95A 1JWWA 2VC1A 1JLBA 3IN5A 4F4XA 2EFOA 2XSFA 3PJXA 1C1CB 2N82B 3H25A 4OI2A 5F8IA 4U67Q 3PO4A 1FTCA 2G0CA 2RD5C 2V94A 4MAKA 5A6WA 4H4KC 2YNHA 2VPXB 3BSNA 4BC9A 2HPUA 4DJBA 1HYSA 1RTHB 1R27B 3H98A 2E5JA 3LP2A 1LOUA 3M6VA 1T3OA 4ZPBA 4BC7A 4U7UK 4CH0S 4U6PA 1S0NA 1IR0A 2OPPA 5B7WA 2JRSA 2OD6A 1JLEA 3DDKA 1RWUA 4DLEA 5HL7Q 1CEZA 4N8OA 2MQQA 1F5CA 1YBAA 4R0EA 3TOQA 3OTCA 4NPOA 4C2MA 4LFAF 3B82A 4HI2A 2ZNYA 1X4GA 2LEAA 4ZVHA 5EGYA 3PEHA 2CJBA 2V4QA 2YKNB 4R8UA 3D0HE 2B0GA 3QJPA 2LXIA 1IKVB 3MM5B 1GQEA 5T41A 5LSRA 4WXOA 2XS5A 3FEZA 1H2UX 5F8JA 4DOZA 2KYXA 4MFBB 1R6YA 3GYXB 3GG1A 4IH5A 3Q8PB 2ZJRQ 4LJMA 2EKYA 4OJHA 4UOCA 4ECYA 4FXWA 2VBZA 1N0VC 2FLLA 1U49A 1K0VA 4RW9A 4KHPF 4Q2LA 3QYYA 6FD1A 4NA2A 2BUNA 2CJ9A 3H5XA 4O3QA 2LU1A 4J5OA 4GC6A 3T1HF 3M2UA 3PV8A 2ASJA 3LALA 1DAXA 3ZZYA 5BR8F 1ZAXA 3PO5A 4F2SA 2KKHA 2IJNA 5J2PA 5E33A 3P3DA 1GAOA 2Z2LA 2R8JA 4NXNF 1XERA 4ZCKA 1U6BA 3CMAS 1N32F 5D77A 3BM7A 2E1AA 4FN5A 1ZPWX 2CQ1A 2D1CA 3M8PB 3OL9A 3ISND 2H5EA 1S1XA 3MAHA 4XDDA 3IR7B 3POTA 4K4YA 3KK2B 4DL4A 2C28A 3LWLA 5LJ5Y 3N79A 4N8NA 5DG8A 3NL0A 1B0TA 5AE3A 2W9AA 1XMOF 1S1UB 4TYBA 4Q45A 1DTQA 2RU9A 3O6QA 4U7CA 1FVSA 1QLNA 4C11A 2CQGA 4DQPA 1UEVA 2EFGA 3R3TA 2IA0A 4TU7A 4KGKA 1FRIA 1Q86T 4WE1A 1WNEA 1XTZA 2B4VA 3DHXA 3TAMA 1RTJB 3JTPA 2GMHA 4ETXA 3OVBA 2B4OA 2WW8A 4A8OA 4PCQA 1BQMB 3OR2A 2QA4G 1J2VA 2K7JA 4PQUA 2XSJB 1H98A 2D3ZA 2VG5B 4R0JA 4CNYA 1N52B 4IKAA 3BR9A 4E98A 2EC0A 3DOMA 4CO2A 3OUYA 1U09A 2OSQA 3WDOA 2W7PA 1IBKF 2ACYA 4DS5A 2MQPA 3P96A 3BB5A 4R5PA 1SV5B 2BM0A 1JLGA 1Q7LB 5B08A 1C4CA 3LP0B 4NLGA 5A8KB 4B9UA 2QRRA 3VAKA 3RR8A 4J9PA 3BO4A 1PILA 1YTYA 1FE4A 4K4XA 4LFCF 5HLFB 1M5HA 2RF2A 3QLHA 2WHOA 1ZM4A 3JSMA 1U7LA 2QE5A 3S6EA 2HNDB 4DEZA 4OQJA 3PX6A 1P8GA 2RT3A 2HRYA 1FD8A 3Q8SB 1HNWF 2ZHOA 2KG0A 3TA2A