3C14A

Complex of gs-alpha with the catalytic domains of mammalian adenylyl cyclase: complex with pyrophosphate and ca
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
189
structure length
189
Chain Sequence
MMFHKIYIQKHDNVSILFADIEGFTSLASQCTAQELVMTLNELFARFDKLAAENHCLRIKILGDCYYCVSGLPEARADHAHCCVEMGMDMIEAISLVREMTGVNVNMRVGIHSGRVHCGVLGLRKWQFDVWSNDVTLANHMEAGGKAGRIHITKATLSYLNGDYEVEPGCGGERNAYLKEHSIETFLIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Lyase/lyase inhibitor
molecule keywords Adenylate cyclase type 5
publication title Structural basis for inhibition of mammalian adenylyl cyclase by calcium.
pubmed doi rcsb
source organism Canis lupus familiaris
total genus 50
structure length 189
sequence length 189
ec nomenclature ec 4.6.1.1: Adenylate cyclase.
pdb deposition date 2008-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00211 Guanylate_cyc Adenylate and Guanylate cyclase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1230 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleotide cyclase 3c14A00
1Y10A 1CS4B 1CJVB 1CJKB 5D0RA 5IV3A 3MAAB 4OYZA 4NI2B 2QV6A 4CLWA 2GVZB 1WC3A 1CJTA 1U0HA 3UVJA 5D0GA 4OYPA 2GVDB 2W01A 1TL7A 3ET6B 4CLKA 4OYWA 4USUA 4CM0A 1FX2A 2WZ1A 1AZSA 3C14A 1CS4A 1CJVA 1CJKA 3C16B 4OYOA 4CLLA 3MAAA 1CULB 4NI2A 4CLSA 1YK9A 5D0EA 2GVZA 4WP8A 4OYMA 3G82B 4P2XA 1WC5A 3MR7A 3ET6A 1YBTA 3R5GA 4USTA 1AB8A 3UVJB 4CLYA 1WC4A 1Y11A 3C16A 4OZ2A 4P2MA 3C15B 1CJUB 4USVA 4OYAA 4WP9A 1WC6A 2GVDA 1FX4A 2BW7A 3G82A 4WPAA 4CLFA 4CLZA 1CJTB 1U0HB 1YBUA 5IV4A 5D15A 1WC0A 4CLTA 4CLPA 5D0HA 1TL7B 4OYXA 4OZ3A 4OYBA 4CM2A 1CULA 4WP3A 1WC1A 4OYIA 4P2FA 4USWA 3C15A 4CLUA 1CJUA 1AZSB 3C14B
chains in the Genus database with same CATH superfamily
3KJVB 2N4CA 3GONA 4R8UA 2B51A 3KNGA 1P6TA 2HKEA 3FCWA 2BW2A 5ETLA 3V4IB 3IO1A 1RCXB 4B3TF 1X4DA 3MPWA 1TFWA 2F9DA 2E1MC 1VFJA 2VQEF 1AXQA 2E1PA 2E5HA 3HVAA 2LVWA 2DNLA 2H54B 2EC2A 2YNGA 4L3KA 5A6WA 3MGJA 4LIRA 3DRPB 2CJYB 1YVFA 1BXNA 3R5JB 4FF3A 1LV5A 5G0RB 1REVA 1U2CA 2R7QA 3MM8A 3QFHA 3PG9A 1S1UB 3E51A 2Y0BB 1EP4B 1XMBA 1VQ7S 4K4VA 2V63A 3OL8A 2MQQA 4ZS6A 5KFSA 2UVUA 4QYZK 4PEOA 2JDJA 5SUHA 3RRGA 3NRBA 1W7WA 1NUEA 1PGZA 2B3TB 1U0HB 5D78A 3E01B 1U1LA 5DRKA 2ATCB 4K4UA 1NEEA 3MPVA 3OR2A 2J6SA 5D3GB 4QW8A 4OYIA 3Q86A 1RAIB 3O2IA 2XB2D 4QZVB 4O4GB 4PWWA 3SV4A 2EFQA 1CJVB 1EKRA 1TAQA 7FDRA 4WE1A 3UD3P 1JWWA 3CXCR 4JV2A 2LQ8A 2XULA 5L1KA 2J0XA 1RT1B 4IRKA 1TL1A 2RS8A 2Y1IA 2UXBF 3B54A 1B7YB 4CRJA 2D3ZA 2FHKA 3FZ2A 2YH1A 1N5VA 5KT2A 1YJRA 1IBMJ 5KFRA 2BRKA 3I5AA 3C66A 4CO1A 4IR9A 1RU2A 1JLEB 3RJMB 1FEEA 4NPOA 2Q66A 4ETZA 3UVJB 4Y2MA 4PXEA 3G8TA 1SUQA 1WHVA 4DV5F 1IQTA 2DGQA 1RSCA 4YEAA 2WB4A 5HJYA 4R25A 1ZM3A 2WVDA 1IUJA 1H38A 1QLNA 2U2FA 3MWBA 4WXWA 4UOFA 4LF7J 3RB0A 2BDPA 1RDRA 2G2OA 2YH0A 4RW4A 4RUBA 3ZTSA 2OGUA 4I6YA 4DEZA 5CD4H 4NZ0A 1S77D 1H7WA 1JLQA 2CNLB 1G6BA 1VC5A 4ZJOA 2MSTA 3HZEA 3CWJA 2PC6A 1WG4A 4X66F 4JYAJ 2GV1A 4NI2A 2OEJA 2P6TA 4KGXB 2C2EA 6FD1A 3KHLA 1ROFA 1LWCB 3I9ZA 5FLXY 4MKVA 2ROGA 5DLFA 4IH6A 1L3SA 1HYSA 5AJ3J 5CYQB 2V9WA 5B0CA 2RUGA 2CFXA 3S6EA 3SEOA 1Q1KA 4M5HA 2G4BA 3GR1A 1S0NA 2NUHA 2CVIA 1C0UA 4CO3A 1Q8BA 2IRYA 3NG8A 1FKOA 1S6QB 4KHPF 5E3RA 2GAHC 1VRTA 2PDAA 5IXUA 1QVFR 4DR1F 2J7UA 1DQAA 4Q7AA 4ZVOB 2R4FA 1EZZB 2HEKA 2GVDB 1HBMA 1JLFA 5KFQA 3JTOA 2FZKB 3GE9A 1GMUA 4DG1A 3UD4P 1SXLA 4ZJQA 4TU8A 2W2OP 3KJQB 5KFBA 2KB2A 3OTBA 5K9FA 1SI9A 4USTA 1RWVB 3BKUA 1ZOTA 2HWIA 2E9RX 2ZFHA 4XDDA 2WVEA 3KXDA 2L08A 1RBOB 4P2MA 4ZA1A 2X7IA 3WIVA 2E5JA 2KJWA 3J7AN 4ED3A 4WF9Q 1X4HA 1OSDA 1P1TA 3P45B 3G96A 2M5YA 2MGZB 2BJ9A 2ZJQQ 4AFFA 3OVBA 3N9UC 3IRWP 2ZEJA 4WZMA 3Q2TC 3JSRA 3DI6B 3N5BA 4TQSA 1V5VA 2M9KA 4TU9A 3HKZD 5KTQA 1N5SA 2H9ZA 4PG5A 5E2QA 3IBCB 3BSAA 2VPZB 2OIHA 2OP5A 1UJ6A 4U8VA 2WONB 1U02A 1F2HA 1MN9A 4ZVHA 1HQEB 3WZ0A 1Y5LB 3GG1A 2DIUA 1RWKB 4YQWA 2C3UA 2DNZA 4KGMA 4P7TA 1KP6A 4DR2F 3LGHA 5IT0A 2HHWA 3CW2C 3B78A 2E5LJ 4IRDA 3EICA 1NKBA 1G1XA 3W65A 3OD2A 4MFBA 2CJAA 2W7PA 4KV8B 4X4SA 2LDYA 4F2RA 2VG5B 2ZM6F 3QGHA 1WEZA 4HT7A 2FHOB 2JLEA 5GAEI 3AQOA 4M5KA 2CJBA 3U1LA 2RKIB 4ED7A 2B9WA 4TY8B 3M4XA 1RJJA 2Y1JA 4QWEA 4ANCA 3IS9B 3M2VB 3DU5A 3VAKA 1KKHA 4B9UA 2MEWA 1CS4B 1HWUA 4IFVB 3HFVA 2UV8A 2PO4A 3VAJA 4UOGA 1PKUA 2HLUA 1W2BR 1R89A 1QM9A 2I9SA 2IA6A 4OI2A 4G3IA 4XK8C 2YWHA 1LWEB 1V5IB 1UWBB 4HACA 2VU5A 5J2PB 4C8ZA 3GJSB 5J2QB 1NM2A 1S1VB 5ADZA 3AD8C 3ETMA 2CJ9A 2NYIA 4IO9Q 3HULA 2OD4A 3V6DB 5BR8F 1HQUB 1VRUB 3FBBA 1X4GA 4FF1A 4ZLPA 1BMQB 2F4VJ 1MROB 1RT6B 2CQIA 3BV8A 4CLFA 2ATLA 2VB6A 3W2WA 3KLGA 3GQCA 4U7UK 3CCMS 1RP5A 5LT5A 1T3NA 3NWRA 2L3MA 5DZ6A 1NXIA 1X7VA 2C2NA 3FFIA 3HSZA 1HWIA 3MUVP 1U1NA 1H7XA 2FDNA 1H6KX 2FLOA 2CWXA 3QSYB 3OFHA 5KFXA 1Z1ZA 2A2DA 4AL7A 1HQ2A 3FSXA 2MZQA 2ZITA 4RNOA 5HI7A 2GGPB 2GC8A 4ELVA 3A1YG 2EFNA 1RUSA 3BBBA 2K3IA 1XNQJ 1R0CB 1MU2A 2MLXA 1QY7A 1RWWB 3MCOA 5EX3A 1AUSL 4G1QA 3TX8A 3NEKA 2KHCA 2FHJD 4ED6A 3I5CA 4F0MA 2FPHX 2VKZG 4L73A 3VGSA 4O3OA 5EUHA 4LF5F 3Q8UA 1OS5A 5KT6A 3TP2A 2VDIA 4F36A 4PQUB 3D54A 1FRJA 1RHQB 2YXLA 2OTJS 4DL6A 4NEZA 1RLDA 2YWWA 5I4MA 5GAEU 5F8JA 1PIEA 1QUPA 4RR5A 4K4SA 1QE1B 5HANA 4PWUA 1KLMA 1NAQA 1ZYQA 2ZH9A 3D6FB 1XR6A 1WD6A 3BGUA 5IC6B 4GKJF 1S1WA 4JV0A 1Y0HA 4LR7A 2ZHAA 1LQ9A 4ZPWR 3CE8A 4OHZA 4ID5B 5AE2A 2JLGA 5DJBA 3SQGB 4DL5A 1LEOA 4CLLA 3MECB 3R7SB 2RU9A 5DM6Q 2AJQA 3KK1A 2PD1A 4HVZA 3AB2B 4PYDA 4IR1A 4DSFA 1DHMA 3PY8A 1T03A 4XIUA 9RUBA 3TNVA 1Q53A 2OSQA 2OELA 4JI0J 4QWAA 4W4MA 1RA7A 4N56A 2GHWA 1X5TA 2ZJRQ 3A3PB 2LU2A 1N33F 2PT0A 2F5GA 5LJ3Y 2KYXA 3PR5B 3B4MA 3UDLA 1J5OB 3ILOA 3D2WA 1EQMA 3BYPA 3D1HA 3H0PA 4X4QA 4KKOA 5GMEA 1LK7A 2AGPA 3GFHA 1N5TA 1WEYA 2GX8A 4J90A 4X64F 1CVJA 4KJIA 3UQSA 5K8MA 4A48A 4CP5A 3MMCB 2W2PP 4KY3A 4DFMA 2AMCB 2DXDA 2J5AA 1AZSA 4NWBA 1D9FA 1RHUB 4RPFA 3TQEA 2LA6A 3FBCA 2DY1A 3MDFA 2GVZA 2FJWA 1I94J 3AD7C 4JV5F 3PVXA 2LEBA 2VONA 2CYYA 4I7FB 1CC7A 2P9CA 1HHTP 2KT5A 1LW2A 3CJKA 2FGOA 3RUBL 2O67A 2PN6A 3CCES 3BQ2A 3H2LA 5B7WA 2COLA 1RLCL 2WTFA 4LVOP 2G0JA 4QJVA 5C42A 1NJIT 1S1XA 2QLWA 5M2UA 3T5JA 2XS5A 3FVYA 2EFVA 5H9FJ 2JFDA 4DS4A 4ZLNA 3EZUA 4DR6J 4WFAQ 4DUYJ 2M2BA 5KFPA 3IBFB 1DTQA 1BE4A 1FJ7A 1WJ9A 2F8MA 2KTQA 2DYAA 2CZ9A 2CQ4A 1S9EA 2RUSA 2X3GA 1K8AT 3KHGA 3POTB 4DPUA 1P9YA 1FDDA 3MR7A 1M5HA 1KOHA 1F9HA 2B4UA 3HHLB 4GRSA 1O6XA 1RT5A 3KJVA 5IT9U 1HD1A 2J76E 4DQRA 1UAWA 1HW9A 2NXNA 1HHQA 2XHCA 1KHVA 1SKRA 1DQ9A 1YJNS 2YNHA 1GXLA 1Q7LB 2P5VA 3NCRA 1XWLA 1Q7YT 3CB4A 5ETKA 3M6XA 3FEYB 2Y3YA 1U6BA 5ETRA 1JKHA 2PA3A 3NKYA 3DGVA 3WX8A 3M8SA 1N6QA 1JLAB 3PYEA 1BGXT 4WKYA 1RAJA 1U8SA 1KQFB 3AODA 1C1CB 4ZLJA 3QIDA 1FKPA 1EP4A 3M8PB 3M1VA 5KFKA 8ATCB 2HYIB 3T1AA 2FVCA 2M8DB 3NP5A 3JSMA 4B3MF 1D8ZA 4OI6A 5D8HB 2IDEA 2PA8D 4DLGA 5HP1A 2PI4A 5KFAA 4RU9A 4Z2XA 3GYNA 3L7OA 2G1HA 3BH7B 3CJQA 4USIA 4PAAA 1T95A 1WACA 4OZJA 2XSJA 2YY3A 3UR3C 4P6QA 1T9XA 2DT9A 2OAUA 4WIIA 2P2CB 3G82A 3MUMP 1RT1A 2FVSA 1RTDB 2DR9A 2V8GA 2POKA 3IM8A 2QIFA 3US5A 2RHQB 3TARA 2KFZA 4PG8A 2NR0A 2UUAJ 4HEA9 3W5ZA 4LF6J 3W9HA 1JNZB 2CIMA 3RYLA 3AXKA 2ZZTA 2VOOA 2VL1A 3IRXA 3UVJA 3QSIA 3HP6A 2ADBA 3NAHA 1BUXA 4TU7A 5C7PA 4MK9A 4TLRA 4CTAA 4NLDA 4UT4A 2ZH7A 4DX8H 2UU9F 1JJ4A 1HBNA 3FCHA 1KS2A 4ZVFA 3H4DA 1RCOB 4KBIA 2G2YA 5EN1A 1VIOA 1T9VA 3L4BC 4JI8J 3MCSA 4LJMA 1MWQA 1WOOA 1N0VC 1S6PB 2QA2A 2C1EB 1F9FA 1FE4A 4X65J 1VK3A 4A8SA 2HIYA 4A8MP 2GIQA 4A8QA 4CH1A 1FJCA 1MG7A 4B3OB 4USJC 2FVPA 1FK9B 3LP0B 3MMJA 4PXCA 4DHVA 4P7VA 3LPYA 2XNRA 2BUNA 5LMUF 4DV4F 3I0SA 3KLHB 1C4CA 3CC4S 1VBXA 2VQFF 4LRFA 5K8OA 3G6ES 3QPIA 1CJTA 5CYQA 4DV7J 2WVBA 2UUWA 4B02A 2QL9B 4GVBB 3QFWA 1DY3A 2VFVA 3ILJA 3W64A 3RG6A 3CUNA 2EG1A 4I56A 5AXKA 1L3VA 3AHPA 4QIGA 1IBCB 2B7BB 2DIVA 4RW9A 1HNZJ 2C22A 2ZD1B 3D6TB 2HQFA 1SVDA 2CPFA 4KTQA 1U2RA 3OXGA 3DRXA 5KAKA 2GVDA 5HK4A 2CNNB 2OUGA 1B3TA 1EETA 3QO9B 4UF4A 1RKIA 5HATA 1HNIA 1FNMA 3CMES 5D15A 2QZ8A 2KXNB 1LK5A 4WFBQ 1QAJA 3KTQA 4OLOA 1C1BA 3W1YC 1FXLA 2P8IA 3GLJA 3SSRA 1KFSA 3IR7B 4K59A 3I32A 2D3O1 5KFUA 1WF1A 3V4MA 3CMAS 1N52B 3F0NA 4H4MB 3FRYA 1A9NB 5HN0A 4A8KA 3D5MA 2EFOA 2OEKA 1FNXH 2HQ3A 3H40A 2V4JB 5AE1A 2EEYA 4CH0S 3T41A 3OTOF 4ID8A 5F8IA 1RTIB 5K8NA 1KVJA 2VH7A 2VOPA 1VMBA 3LGMA 2HZAA 3CCSS 4C0HA 4B3RJ 1LWFA 1L3UA 3JXOA 1K1SA 3QJJA 2CZ4A 5A8WA 4M5IA 2U1AA 3DI6A 3K5PA 1KR4A 3VHQA 3BQ0A 1HR0F 3W61A 4WFZA 3IA0A 3KMQA 3RB4A 1JNRB 2WBMA 3JSYA 3TJAA 2F63A 4OIXA 3H90A 4C98A 5KT3A 1NJZA 2DJWA 1HPZA 4EZ6A 2ZE2A 1K47A 3PRVA 5JVGQ 1S76D 1RISA 3PX0A 4ZVEA 2HS4A 3HF5A 1HL6A 5K14A 2VUGA 2XQCA 4E98A 4KRWA 3G9CA 1YJUA 3MAAB 5L1JA 2RQKA 4KHMA 2GHPA 4MH8A 3H5SA 3WC0A 3UN2A 2QJ3A 5ETVA 4OJ1A 2K1RB 2ZUAA 2DXEA 1J27A 2MKIA 3OL9A 2QMWA 4KV8A 3SCIE 4OX8A 3T9NA 2GZOA 2EC0A 3IBWA 3DMJB 1WI6A 4Z7CA 2AT1B 1PG5B 2QYGA 4OHXA 1YK9A 4JP8A 3CCQS 1B99A 2E29A 4DUZJ 3HO1A 3L3CA 2O3DA 2W9BB 2F3JA 3Q8QB 4URSA 2DNGA 5T14A 3EWGA 5BJRA 5ETNA 1IBLJ 1U2FA 4DV0F 1RB0A 5FLXU 4WP9A 1WC6A 2RVJA 5J2NB 4ZVTB 2AD9A 5BR8J 5IM0A 3UI3A 3TEHB 1UVKA 3KK2B 1TELA 4H54A 3EUNA 4NLYA 4WP3A 1REGX 2OI2A 3IWNC 1HLWA 1UWBA 3DOMB 2ROPA 2DNOA 4LRAA 4DR5F 4DUTA 2V34A 4DSEA 3WIUA 3ZZZA 4WJBA 2QGFB 4IFYB 1N36J 2XY5A 4P9SA 3BO4A 2CPDA 2RRBA 3AOBA 1RA6A 2GO8A 3KNAA 3BKFA 5C25A 3HHDA 3DGPB 3LANA 4KGZB 3IN5A 2B4VA 1CJKA 3ZTRA 3TOQA 2DR8A 2BE2B 3GIJA 4WFNQ 4LBIA 2FZGB 3PIPQ 1S9GA 3R1HA 2PE8A 3ET6A 2LXUA 4BCAA 1HNVB 1UVMA 4HT5A 3OTEA 1B0PA 1YJVA 5C24A 4CT8A 3AD9C 3BR8A 4CNYA 1YRUA 2W4CA 5HROB 2VJVA 3F44A 4YS2A 3C19A 3TW0A 4KT0C 3G4SS 3W9JA 1NB2A 1R8AA 1FO1A 3EGVA 2VG6A 2BR0A 2VG7B 4ZOSA 3O3LA 1OJ4A 4LF5J 4O44A 4CO5A 1J5EF 1KTQA 1OSCA 1T9YA 3MM9B 1QSLA 3V2UC 5J1PA 2GO9A 3EGNA 4I64A 4UZBA 2BA9A 2BJ3A 1BC6A 1MN7A 5BYSA 2RSQA 4OYZA 4HTJA 4ANEA 1U48A 4QCLA 2C3YA 1VQ6S 3N6MA 3ISNC 3EVOA 2BJEA 3NNCA 3K89A 4RLEA 4RX6A 3D3BJ 5I42B 3W8PA 3ZNUA 4FDFA 4DCOB 3J81U 4M94A 4P10A 5GAGI 3MEEA 4P52A 1W26A 2DGVA 1SH3A 3PX4A 2QFJA 5H9EK 2CJXB 2UV8G 1TVRB 3U1NA 3FMBA 3A12A 4DV2F 3V81A 3J7A1 2WK4A 4F7VA 3OVAA 1OPZA 4AXJA 5AXLA 4U95A 3PW7A 1UWAA 2KDOA 4IH7A 4MIWA 3M8RA 2MKSA 4PG7A 2LQJA 4N5SA 2HBQB 2RQMA 4RWWA 5L1IA 1NK8A 4ED8A 3S8SA 1XBWA 2A0FB 4L3NA 3C8YA 1UVJA 2RS2A 3MM5A 2NYHA 4J9VA 1PAEX 2EVZA 1U24A 4BWJA 3KUHA 2HNZA 2V8DA 2HNYA 2WBRA 3MMAB 2VF3A 1D3WA 1EARA 4A8XA 1KONA 2OPRB 3O6QA 4BC9A 1HNXF 1OMSA 1JLCB 4H4KA 4O3SA 3MEGB 4U67Q 2XGPA 2HRTA 1T05A 1HA1A 2HSEB 2J9DE 1M1KT 1M5PC 3HHNB 2OD6A 1FEHA 4JV5J 2MY8A 4C2MA 3BN4A 1PAUB 3HM9A 5KG6A 1O51A 2IYGA 4EK2A 1JMTA 1RBLA 2D9PA 2RIJA 2ZH3A 3ADAC 4F3MA 3NBPA 1GTHA 4KO0A 3CCZA 4O0NA 4IRCA 1QSYA 4ZHRB 2D3UA 1XJWB 2LQBA 3AA9A 1TQLA 4NLGA 2W24A 2YKNA 2P9EA 2XI2A 1N32J 2YKMB 1NSAA 3TJ9A 3CPWR 2H5IB 4V1Ak 2V94A 3B6BA 3GSIA 5CZXA 3W62A 3RAXA 5L9XA 2CXEA 5JVHQ 5DO2A 1BHNA 2XWYA 3I0RA 6AT1B 2KFYA 2MZTA 3M2UB 1NSPA 1FWPA 4AL5A 2GMHA 3AH6A 4IOCQ 5KFVA 1F3FA 1SC4B 1SQFA 5GAGU 2FIUA 1TAUA 2OKQA 5A0YB 4F4YA 2MXYA 5BXIA 3ULHA 2LLZA 4U8YA 4URGA 2DCUB 4Z37A 1JLBB 3DOLB 1RWOB 1CJUB 2CQBA 3IWXA 1IM4A 2DR6A 2QYCA 2GIFA 1B7FA 5K20B 5C5JA 3HDSA 1XR5A 3CEDA 2WW4A 1H2UX 2CG4A 3NS6A 3FCVA 2VV5A 3OHBA 2W7OA 1V3RA 1RAEB 4GC6A 4F2SA 4DI6A 1WG5A 1C0TB 5FDLB 2QV6A 3VZHA 4JI1F 2V68A 2KVQE 3EYZA 1KWMA 2CQDA 3QWPA 1SL2A 4OYWA 3GPAA 2WZ1A 4NCAA 2XZWA 4U7UD 1RTJB 2CRLA 2C2MB 2MDAA 1OY6A 1LW0A 1F5AA 4E0DA 4HI2A 1N5QA 3PXGa 1UEKA 3BZQA 3ENQA 3C6UA 1M1HA 2YPZA 2BQUA 1U8WA 1TKXA 4NLOA 3CDAA 4ECRA 2HMIB 4K4WA 4OJHA 4Q2MA 1E6YA 2H5JB 5B0EA 4JB8B 2R8KA 4FVMA 1SQGA 2V50A 3DYAA 3T5LA 2UVWA 3M30A 1NH8A 3M8YA 2XMJA 5F3TA 1F5CA 5D4PA 3R2DJ 1I1GA 1KBRA 4J9RA 2A2CA 5BYQA 3RR8A 1LNQA 2ZNZA 3T5HA 1L3KA 1S97A 3PKMA 2MSSA 2CUYA 2MY7A 4DL4A 4Y2CA 4DQQA 2D1CA 3BBCA 1Z2ZA 1TV6A 4F4ZA 2YKOA 3ITHA 2XMMA 2IRXA 2RRAA 1Q95G 4K2XA 3ZZOA 4J9PA 4DX5A 1K0TA 2MHEA 3ZC4A 4MT1A 1JJ2R 4J9LA 1FHTA 3CCTA 4ZPCA 1IR1A 2XMUA 1RTDA 1RWUA 4ECTA 4NX9A 4WK3A 2OFGX 1RT4B 3CCWA 2DRAA 2UU9J 1BY9A 3KK3A 1XMQF 4FYXB 1N5YA 3OV7A 2E1CA 1VQNS 3PZPA 3UCGA 3TA1A 2HHTA 1YSJA 3OTDA 4RW8B 4M95A 3X3UA 3MM6A 4J37A 5LM7E 2YQ1A 3MR2A 4OX9F 2V5HG 2CPHA 4LF9F 1RT7A 3EX7B 1JXEA 3R9LA 2W9AA 4WU2A 2HBRB 1D9AA 4EYHB 4ZN1A 4WYLA 5IQQA 4DR4J 4CLPA 1HBUA 3RW6A 4Q8EA 1D0EA 4F4KA 1ZBTA 1CSJA 3GIIA 4ZCLA 3OPKA 4J9KA 4CO4A 4XPEA 2X1GA 3SDEA 2W2NP 5LMUJ 3M8QB 1VGYA 4ECQA 2HHHJ 2KJVA 2HRYA 4ECUA 2HHUA 1JIHA 3HHLC 1RTHA 2R7SA 3PO5A 5HQLA 3QZ8A 3OW2R 1QAYA 4DV1J 4DL7A 2UXCJ 1W25A 2V8VA 2DNKA 1M5OC 3QIPB 2BJDA 4NOHA 2NSCA 1TP7A 3Q8VA 2K3KA 2HVHA 1M1GA 3EPIA 1HNWF 1ITPA 2CPXA 1WOPA 4USVA 3AA8A 3VQSA 4EEYA 4CZCA 2RJZA 1NU4A 2GQQA 2NS1B 1EX8A 3V6JA 5L46A 3LW5C 4OX6A 2F8EX 3LUYA 3IGNA 4CQ1A 1TL7B 1RBAA 2V9KA 2HVIA 3K57A 4I2QB 3G6VA 4NLUA 2BKPA 4IOBA 4NEYA 4DSIA 3HSDA 3KG4A 4DWIA 3E3XA 1CQNA 1TKTA 1H98A 3H5YA 4JI2F 2QSFA 5ETTA 1QJHA 3C46A 1VLOA 2X51A 2XZDB 3BN7A 2HQIA 5KFHA 3CJ4A 3VVTA 1NK9A 2CPIA 2EW9A 4OX7A 2A3JA 1TL5A 2N7YA 3DLEA 2DO0A 1SPBP 4J5OA 1RGVA 1E6VB 1U26A 2WW8A 2Z30B 3H5UA 5AXMA 2UXDF 3AAWB 4K4YA 2M70A 3CGIA 2D9OA 3GFZA 3PHTA 1WEXA 2FGCA 2OFHX 1RQ0A 1NPKA 3PX6A 1DBDA 2DVIA 4B3SF 2BXJA 1SQEA 3CJRA 1B0TA 2BACA 2XY6A 3B8HA 3M6WA 9ATCB 4CLTA 8AT1B 4PG4A 4OZ3A 1FI4A 4LF1A 1U47A 5GMDA 1SKWA 3UCZP 2CDQA 3C15A 2H51B 3AB4B 1S0MA 2VFRA 1JLGB 4QR2A 5GVQA 5CXTA 1VYAA 1RT2A 5HMYA 2UVVA 2NPFA 4EO6A 4C4WA 2CADA 1BQNB 1FKAF 1BQXA 1RHMB 3H7HB 4EZ9A 2ERRA 3OUYB 4YR3A 4WK1A 2BBEA 3CJ0A 2E7VA 4P72A 3M9MB 4JI6F 1U1RA 3R8YA 3H42A 1WHXA 2B5JB 4EBCA 1HI0P 4RO0A 1UW9A 3FEXB 3MMBA 4DBQA 3SFGA 3HHEA 1Q79A 2MJNA 3VGTA 3T1YJ 2BKOA 3J80U 4WXOA 1QSSA 2V2KA 1SJ1A 2HFUA 3JB9k 4GKKF 1N34F 4OJ3A 4NASA 2XMKA 3HJFA 3NS5A 2AU0A 2ZH6A 5DLGA 3HCXA 4DSKA 2YQ0A 1B64A 1P1LA 3OQ2A 1M5KC 1NHVA 3IMQJ 3M2RA 4MTPA 4FF2A 4KIAA 3MHYA 2NSBA 1PBUA 3OT9A 3A8KA 4ER8A 4J9OA 3NNHA 2RD5C 2O5DA 3RAQA 1WSVA 1EIYB 3JYTB 2FC9A 1TK0A 3JTPA 2DNHA 4IDKA 5HBMA 4MMOA 2Q3PA 4JI3J 2ABYA 5KG0A 1GXUA 1WORA 1M90T 1URNA 5T7LA 3TUJC 4D3GA 2JEGA 2KHDA 2DH9A 3KLIA 4F25A 1KOOA 5KFIA 3DC2A 5HO4A 3GMGA 2GFFA 4UTGA 3L95X 4DF4A 3M32A 4YFUA 3DLGB 3OR1A 2XO7A 4N76A 3DNCA 2WHOA 2WOMA 1DQ8A 2R8GA 5F8HA 4P73A 4X4VA 3NCPA 1VHFA 3NOCA 1KC8T 3VCDA 4AE5A 1WSRA 4LFBF 2YPYA 1U6FA 2SXLA 3VR1A 4M5DB 4BLGA 3DRSA 2Q6BA 3PFEA 2RDDA 1R7IA 4NYZA 2HQGA 3JQKA 1T0TV 2YKAA 4AL6A 2G0CA 1SL1A 2CWKA 2VFSA 2P6SA 4QW9A 1FDNA 1HWLA 5AE3A 4PRFA 4PQAA 1RT3A 3L7UA 1S0VA 4WU3A 1WDTA 3CIMA 4KFBB 3QWUA 2D41A 2Z4PA 2B8PA 3NAIA 5DQGA 2W2MP 4YMEA 1RAGB 1Y00A 1L3TA 1DLOB 1B0VA 2GJIA 4FNHA 3UDEA 3KOAA 4GVLA 3WQPA 3Q83A 4ZPVR 2YX4A 2MYFA 4NXNJ 1WHWA 3A3OB 3MEDA 2AZ3A 3IG1A 3D1QA 4IG3B 1VQSA 4CYUB 5GAHI 2HWHA 4NLQA 5A8KA 1L5UA 2RF2A 2BZ2A 1JJHA 4KPYA 4FXDA 2LYVA 1YWXA 3I5BA 2E9ZA 2VA3A 3DDIA 4DL2A 1T8EA 2IC3B 2EFGA 4OZ1A 2KG1A 3U1MA 2NXEA 2AF6A 1NDPA 1NB7A 1DTTB 2KXHA 2D7SA 2PFDA 4DQSA 2R8IA 4JI7J 1IKXA 5CCLA 1TL3A 3CD5A 2DH7A 4H4OB 1FX2A 2D74B 2YBVA 2VICA 2FLPA 1NK0A 2HW3A 4A4JA 3UW1A 3C16B 4RNNA 2OPQB 4B9MA 4X62J 1O8BA 4J9NA 4CO0A 1FRHA 3QT6A 5CYMB 4A46A 5I3PA 1UZHA 2XI3A 3R5DA 3W2VA 1ZAVA 1FRKA 4FPIA 5LL6d 1D9DA 1OY9A 6FDRA 1KFDA 1H2TZ 3P8BB 3KDNA 1R6YA 5DGAA 4LF4J 4E8UA 2ASYA 1JXVA 3ISZA 4EBEA 1FCAA 5CD4A 2PSZA 2RAQA 3CJ8A 1JLCA 1F1BB 4NZ7A 4F4XA 2QLXA 4QIEA 4YY3F 3SCKE 3OFGA 2DNPA 1NRKA 3R5BA 2HFSA 4PPDA 1AFIA 1Q5YA 2V69A 3UR0A 1NPPA 1NH7A 2DRDA 2I5JB 2R7XA 4GMKA 4LFAJ 5E3QA 2BANB 4YR2A 2DO4A 2AJ1A 3OFFA 3IR5B 1N4LA 2XHWA 4FPRA 4LSLA 5KT7A 3QGIA 2QMXA 3M05A 4DPWA 1R31A 4ECZA 1NHKL 3PFOA 3R5CA 4LFCJ 4I2PA 3VAIA 1NZ8A 1WNEA 2UZAA 4FXWA 1RWXB 2HVEA 3DM2B 4A8OA 1VOMA 1TTHB 3LQVA 2DISA 1FJGJ 1XNRF 3KLEB 1VQKS 3A8EA 4OZ0A 4MKAA 4RW6A 1F5BA 2J9CA 3VF0B 4DR3J 3HD1A 1FD2A 2OLWA 3CDEA 3RZAA 1DZ5A 3PM9A 4R8UB 5J1EA 2KKHA 1R0AA 1G7CB 2LP4A 3M2UA 5KFLA 5GAHU 3JTNA 5KG5A 3QYYA 2HK3A 2EKNA 2BEFA 3NNAA 2YNGB 1Q78A 5A0YA 2KT2A 3HSGA 4WKRA 1T94A 3WDOA 4KGVB 1UJ5A 1WC3A 1I6JA 4CDIA 1SCJB 3EGWB 3IFEA 1IKYA 4DF8A 3W3SA 2XYPB 3MD3A 1REVB 2I8EA 2JWNA 4KHRA 3DOLA 4ECVA 2MMYA 2W4PA 1KD1T 4NMLA 3KDOA 2YQ3A 3JQMA 5DQHA 1LWXA 3OL7A 3AFGA 1AW0A 5F41A 2F4FA 1UA1A 2H4YB 2XY7A 2QO3A 1MLAA 5B0BA 3ETOA 3CC7S 4RBUA 2YKQA 2ZC4A 4OLPA 4DS5A 2C2DA 4NCGA 5CCMA 3N79A 3OR2B 2HHVA 2XLJA 4ECWA 2A6MA 4YDDB 3MXHP 2CQPA 5IFMA 3VWSA 2DTJA 4WE1B 2Y8YA 4ZDNA 3L09A 2CQ0A 1X5SA 3CJ3A 1IKVA 5LSRA 4YB1P 5DDQC 3GJRB 1G3OA 2H3EB 2HRUA 1OIAA 1WUUA 1C2PA 1FFGB 4PUOA 4M8LA 3TAPA 1TL1B 4C0OC 2DEIA 5A8RA 5LXRA 3ENAA 4ED0A 2CVEA 2CNOB 1ULRA 4MJKA 2N7CA 4DJBA 3AXMA 2W01A 4C97A 2QA4S 4G1IA 5LMNJ 4EUVA 5F8GA 1IBKJ 5RUBA 2WVFA 3DLKA 2CQGA 5L39A 1SUQB 2MPUA 2QSWA 3OSNA 3QT5A 4AT1B 3NY0A 2KI2A 2FYXA 3DU6A 4P75A 1WELA 5D4NA 5KFEA 1XMOF 4JOUA 2GNKA 1IBMF 2IMWP 4PCQA 4OZ2A 2Q43A 4DQIA 4RW4B 1UA0A 2CQHA 1XK8A 3NGTA 1SKUB 1JLQB 5KFJA 4NA3A 1SV5A 1JXLA 2UUBJ 4FYVB 2OPPB 4IG0A 5E41A 4ZPBA 3TAMA 5IOLA 2VPYB 4RNFA 3CVKA 4ANDA 3G6YA 4DZDA 1GNKA 2FTRA 2ZUGA 4LF7F 3G8SA 3MAQA 2W9CA 1YLXA 4C3KA 4NI2B 3GCXP 1U1KA 2YNIA 5CA5A 1KQSR 4P2SA 3C6TA 1UJ4A 1V3SA 5HLFA 1YKWA 4ENOA 1RWMB 4YUDA 3BBFA 4F0HA 5HAOA 1LXJA 1HYSB 2ASLA 2UP1A 3C14A 4RZRA 5DG7A 4U9RA 3CJTA 3FMWA 4YHHJ 4JYAF 4JI5J 2K8GA 2JSXA 3RGIA 3UWTA 1ZM2A 3GU0A 5CABA 1C0UB 4N8OA 2H4WB 1FKOB 2JX2A 4LT6A 4F3OA 1NK5A 3MF5A 2JLFA 1R8CA 1PJ7A 5CH7B 3B82A 2BOAA 1FERA 1VRTB 4OYAA 1K44A 4I68A 2BM0A 5F8MA 4G1PA 4FN5A 2LU1A 4FNIA 3C3LA 1PO6A 3LP2A 2IPOB 3TA0A 2MQ8A 1JLFB 1QUVA 2FD2A 3J81Y 3GSDA 4KR0B 4DPXA 3LGNA 1IXKA 3CF5Q 1YJTA 2Y1LB 4DG1B 4EWTA 3H25A 5EWFA 3K5LA 4Y2IA 1MWYA 2OPSA 3BO3A 4PR6A 2HAIA 3R27A 3SI8A 3EJMA 1AUDA 3DOKA 2B6AA 1TKZA 4NXMJ 5CZVA 2HFOA 2Z2MA 4DV6J 3T1HJ 2EG2A 1HBOA 5A2QU 3R2CJ 3TA2A 2QG9B 2OO4A 3GV7B 2YWGA 3D66A 4I6WA 3PW5A 3RB6A 2B56A 4HKQA 3L9ZA 2XTJP 5HVHA 3HX9A 3DLLQ 4YB7A 4RL1A 2ZC3A 2ZBRA 3I82A 2ZBCA 3MURP 1DARA 3M8ZA 2DGUA 1FRXA 5LXYA 4KH0B 3I56S 3SIPB 4XO0A 4TXSA 5EHHA 3W60A 3CMQA 5I3UA 2HBYB 4F02A 8RUCA 3PCOB 1S9FA 1X4BA 2PMWA 3CSKA 5GADI 2A18A 1IKWA 1YJWS 1BQMA 4MFBB 2CPJA 2DKOB 4BBYA 1MMNA 1S57A 4RNMA 3SCLE 2ROEA 1DAXA 1N54B 4B9VA 3HFZB 2XCPA 4PPZA 2E44A 4J9MA 4LBHA 4NLWA 2ZVSA 1Y7PA 1X0PA 3AY0A 2IJFA 1U09A 3ENWA 4DXLA 1LXNA 2B7CB 1X31C 3GWCA 4AD6A 1QAIA 1VC0A 2E5LF 3CD6S 2WCXA 1S12A 2Y0SD 2Q79A 3BREA 1S0OA 3NGRA 2N82B 1IQZA 4KGKA 3LTOA 1VISA 2RMLA 4CLUA 2WSEC 3TX0A 4RKUC 2B43A 2GAGC 2FY8A 4PKDB 4CI0B 4LRCA 3P5TL 4HACB 3EVMA 4USHA 3Q24A 4A47A 3ZFVA 3MPDA 2IIHA 3DDNA 3GCWP 1VI7A 4Q44A 3CTRA 3PJ9A 4ICLA 2IVMA 5B0FA 3R5AA 3KYLA 3LWLA 4MIAA 2OHDA 2HWTA 2DGXA 3X1LB 2KL8A 2R3VA 2VPXB 3OSPA 1IWGA 3TUZC 3W2WB 4FBUA 3PKYA 3KLGB 3NS7B 4R0EA 2LCWA 4DR7J 1VQLS 2IJNA 2XCAA 1EQ0A 2PGCA 4NLRA 4KPCA 1NK6A 1NSKL 3FFIB 1S5ZA 4B9TA 4DX7A 2BJ7A 4NCBA 1XERA 3UN5A 2F4VF 4C11B 2MLZA 2PEBA 2RB7A 1SJ3P 4QR0A 1MWZA 3P49B 3NGKA 3DRRA 2R7VA 4OHWA 2HFNA 4O3NA 1MU2B 2NLWA 5B08A 1Y9OA 3KLFA 2YWKA 3QLHA 2R2TA 4B9SA 3EZOA 4G1QB 2ZHBA 4C8KA 4C7QA 3KLVA 4MYUA 5HJXA 1NDLA 1H2VZ 5GADU 4AQYJ 4PWDA 4OYOA 3I96A 2EK6A 4USMA 3GJTB 3CCVS 1XNQF 4RBVA 4KE5A 4FS2A 3IM9A 1R0BG 2GQCA 1RE1B 3ZZPA 5ETPA 5D4OA 1GXTA 3R1LA 1V6HA 2VC0A 3T6JA 2J6TA 1KLMB 1NK7A 4FS1A 2AHOB 5IWAJ 3IR6B 2HQDA 1BWVA 1S1TB 4C6AA 4R5PA 1S1WB 1NDCA 1N8RT 1U4BA 2YX1A 2ZWPA 3MM7A 3LP1A 4M5LA 1YQHA 3EZ5A 4K0KJ 4RW7A 3BSCA 4NLSA 3J7Z5 2HPUA 1FD8A 2N4DA 5J2MA 3QMQA 1U1QA 2E66A 3BSNA 1HFEL 1H73A 2DHHA 4TYBA 2XWXA 3KK1B 1U0SA 3EXCX 1UFWA 1KTVA 3P96A 3K17A 4F3QA 2YNFA 2HNDA 5KFGA 1T9TA 3AOCA 1T03B 2OTLS 3M6VA 4EI2A 4LQ3A 4UUWA 1VLYA 1X9SA 4Q8FA 2YWEA 4LF8J 1ZTTA 4J91A 1QTNB 1CG2A 1IJEB 2IC3A 1AB8A 4RNHA 4DV3J 3HI9A 3FBFA 5D77A 3NGSA 2C3PA 4LSNA 1K1QA 3RAMA 4DMZA 2HFVA 2JRSA 3FRZA 4ECXA 1RI7A 1RABB 1VQ9S 4KKOB 2W7AA 4JI0F 1Q82T 3QRQA 2VBWA 3OL6A 5ETOA 4ZVSB 2X3DA 2RNEA 2XNQA 1AZSB 1FWKA 3HD2A 4B3TJ 1SIWB 2NQPA 1A7GE 3BGRA 4NE9C 2VQEJ 2IY5B 2GVZB 3C2PA 4NA2A 4XTTA 2B8QA 5U47A 1VJWA 4OL8A 3BPSP 3FQLA 3LOUA 3CO9A 4Q43A 4RBTA 1LW2B 1TL4A 5L9NA 3D7SB 3CJKB 1CULB 3WBZA 1U49A 3DHWC 5CYJA 3V4IA 3M8WA 4LRBA 3OBIA 1RAFB 1HI1A 4ED1A 4DCPB 2AYGA 4HR2A 1I94F 2AJ2A 4W98A 1EAYC 2QN6B 3H59A 1S1XB 3DRPA 2XYHB 5KFCA 1U45A 4HH0A 4EO8A 4BC7A 4LMZA 5G0RA 2MZRA 1OQ6A 2BANA 1X4CA 1KNZA 1U6ZA 3BDPA 1S1UA 4EU0A 4CM2A 4NLXA 4LQ9A 1DTQB 5T41A 5CQGA 5F8LA 2C3MA 2IM0A 2GIRA 5DGBA 1S48A 3ZZ0A 1S9EB 3N5FA 1VIXA 1U0HA 3E01A 3HT0A 2HVDA 2IFXA 2UXBJ 4PG6A 4RUHA 3P3DA 3A8IA 5D3GA 1RT5B 4O4GA 1OYEA 3QAEA 4DR6F 1CJVA 3BQ1A 4DUYF 2G13A 1S59A 3G6XA 2PFFB 3GFYA 4M63A 1GTEA 4C8OA 4HDGA 2YNHB 1Q8IA 4DV5J 1Z4UA 2K2PA 2CG8A 2IDLA 2W1BA 3IAS9 5KFYA 2QEXS 1JKHB 3RR7A 3K0JA 2VD3A 3DLBA 5G4DA 3HSJA 3HPOA 3PRBA 1N6QB 3PJWA 3SSSA 1Q8LA 2XMAA 1EB0A 1VBKA 3K8WA 1JLEA 1S72S 1WTBA 2JOQA 5KFOA 4YR0A 1FKPB 3M1VB 2XO6A 2PI5A 4QYRA 4ZKAA 1LOUA 4BHQA 3JSMB 4FZVA 1FE0A 5HMXA 4Y0FA 1RHRB 3BGOP 5HP1B 3DDKA 1ZS6A 4Y00A 4NYPA 4X66J 1R8HA 3J80Y 4K4TA 2BOPA 2XSJB 1UZDA 4UUXA 2XGQA 3P6YC 3FQKA 4CT9A 3MR3A 2QL7B 1FRLA 3S01A 1HARA 3G82B 2VA2A 3TI0A 2C2RA 5ETMA 1YZ6A 1XMOJ 4M5NA 4X2BA 2H65B 1LWCA 3O5TB 2RDIA 1N48A 2R8HA 3H4BA 4O3QA 4KHPJ 3TVYA 3IRXB 1PYOB 1H74A 3T9ZA 2RH3A 2EPIA 5D0HA 4CTAB 4DR1J 2G9OA 4ZMMA 1KQGB 1HBNB 1YRXA 2YX7A 2V6AA 5D0RA 4N41A 2BE7D 2UUAF 2FLLA 3Q8SB 1TK8A 2QMUB 4QPXA 3TZYA 4LF6F 5EDWA 2ZH8A 1S6QA 2NUUG 3NMRA 5HMWA 5A76A 2QLJB 3WHIA 1FRIA 5AXNA 4D3HA 5KG7A 4MIBA 2CZVC 3AJDA 4BDPA 2OPPA 2N3LA 2IM3A 2M8HA 4WCEQ 1B4SA 3Q23A 2R2RA 5JUMA 5DDOC 1S49A 4KAIA 4JI8F 2PEHA 1NDKA 2Y9HA 2FZCB 2C2OB 3FSYA 4DOZA 1FFWB 1X4EA 4ATNA 3TEGA 2QE5A 3I0SB 2AYBA 4X65F 2AWZA 3DKDA 3TWZA 2IBOA 5H9EJ 2B9EA 4CLZA 4X4OA 1CJTB 5HMZA 5JJBA 1U1MA 4ZP6A 2DHSA 2KRRA 4U7CA 1WOSA 2FJVA 1F2GA 3CT9A 2FUG9 3BGFA 2K7JA 4KSEB 3KUEA 3PDNA 4P71A 5HSPA 3U02A 2CDRB 2MGZA 3QAUA 3PR4A 5DDRC 1LKZA 4EMDA 3VAGA 4DV7F 4RW9B 1UVIA 3DRYA 3VAMA 3E2EA 2KO1A 2J6UA 5DS7A 4DR2J 4J7CA 2CPEA 1KQKA 4DQPA 1SJRA 1UEUA 3MCNA 1EETB 2I2YA 1IJFB 1HNIB 1FTCA 5HVGA 2WONA 5L38A 2DXFA 1H0HB 2ZM6J 5E3CA 1C1BB 1HQEA 4UOHA 1NBEB 1OY8A 1BWEA 5F0UA 2XLIA 2O1PA 1AYEA 1HNZF 4WZQA 4QOTA 3TRGA 4ED2A 3TANA 1NKEA 2LQ5A 1VRQC 1JK9B 3OFEA 4DL3A 3Q22A 3ZZYA 1RAHB 4YN3B 4GO5X 5IC4B 2VG5A 3MTKA 3K5MA 3MFIA 1HKAA 3CCJS 2CAJA 1GMWA 3TZWA 1LWFB 4ITSA 2XBPA 2RKIA 3H5XA 1OQ3A 2QA1A 2HHXA 3KUGA 4TY8A 3CJ2A 3NCQA 5A8WB 2BYCA 5E7OB 3IS9A 3M2VA 5JXSA 3G86A 1HD0A 1CS4A 1P9QC 4IFVA 4DN0A 5IS2A 4C8LA 2R8JA 3FBEA 3SV3A 3SBMA 2XMTA 5LSLA 4WFXA 4B08A 1V9OA 1YBTA 3D9BA 4B3RF 3O1LA 1HPZB 3J7YI 2ZE2B 3I87A 1LWEA 3NGDA 3HT3A 2Y8WA 3GILA 2ZJPQ 3QNWB 3BPDA 5J2PA 5K14B 2FJBB 1U1PA 3R7BB 2RRNA 5J2QA 1F3VA 4K4XA 2BV3A 1S1VA 3OHAA 3Q2SC 3VGUA 3DLHA 3NL0A 2B9XA 3OLAA 3BM7A 3GYXB 4O3PA 3V6DA 1WC1A 1HQUA 4V19X 1VRUA 3R6LB 1HIYA 3PEHA 1RACB 3GB0A 3MFHA 1KDNA 1MROA 1RT6A 2GS8A 3UO0A 2QLFB 3JS9A 2IAJB 3PW2A 2AV5A 1UP1A 3QT8A 1YIJS 3UNYA 3W5XA 1H72C 1YI2S 2R9LA 2CPYA 2IJRA 3O44A 5EGYA 4AUKA 4I67A 2E1AA 2FJEB 4MYTA 3KMSA 2ZH5A 4IKAA 4GO7X 1UPPA 4OZLA 2DNNA 4QU6A 4F8RA 5IM0B 4DUZF 3TUPA 2ZBIA 5JMNA 2GGPA 4X84A 1FTRA 1GMVA 3K7RA 4OZ5A 2IM2A 2BX6A 3PEJA 4NA1A 3QJPA 1KRPA 2F1FA 3RRKA 1IBLF 2MQNA 4OHVA 1HMVB 3FK4A 3EVWA 5KFDA 2AEFA 4G6VB 4M5MA 1ZETA 3MOZA 4Z7YA 4HYKA 5C25B 2VDHA 3GTYX 2DBBA 1CJKB 2L9NA 4GKJJ 1YG0A 2AX1A 1GEHA 1G4CA 4B9NA 5E0OA 4PQUA 2MKYA 3KHHA 2NXUA 1S9GB 3ET6B 1N36F 5F9LA 3SSQA 1UVNA 5C24B 3THVA 1QE1A 2UUCF 3EMTA 1X0FA 2F9JA 2ZKTA 4B9LA 1S7IA 1DURA 7AT1B 2J7KA 1HWJA 2VG6B 2G1DA 4C11A 1ZA1B 1N88A 2WAQD 3I31A 1QAXA 2RT3A 4ID5A 4O44B 1U7LA 3N01A 3BJYA 3SQGA 4M1KA 2VBYA 3SFUA 1GQEA 3CIZA 3MECA 3J7YU 3H2UB 4LUBA 4HH1A 1N33J 3AOAA 2BM1A 2CQ3A 2NCKL 4A8YA 2DR5A 3ZZRA 1IR2A 2KG0A 5KT5A 1Q81T 2VBZA 3RB3A 3NMAA 1EKSA 2AW0A 4MAKA 4ZJLA 3JAMU 5HVFA 5IV3A 4X64J 3MEEB 3CDWA 5ETSA 1RYRA 3F41A 4XPCA 5DQIA 2K06A 4PZVA 1SKSA 2ZDOA 3PJXA 3Q89A 1RK8A 2GCFA 2CNKB 5EX0A 3DXSX 1FXDA 1J5OA 1F6TA 1ZM9A 3V81B 2Q6CA 3SQOP 4DX6A 4Y3CA 4MKYA 1S1TA 4M5GA 2E1RA 1ACMB 1AA1B 2PMZD 4QIWD 4DSJA 3BF4A 2JEJA 1NO8A 2AQ4A 3MMCA 4UY85 4WWSA 1S6OA 3O8WA 2ILZA 4HDHA 4HHHA 2JL9A 1KEKA 3FC9A 3GFXA 3MM5B 3BR9A 4P74A 4I7FA 3UFCX 2J8AA 1S79A 4LF2A 1XTZA 1YBUA 3MPUB 3RU0A 1ZTWA 2HNZB 2HNYB 4DU7A 2OMOA 4K5RA 4I0WA 2HZCA 3QGPA 3DXBA 2FQQB 1CQMA 3VALA 3IXQA 1T05B 4CLKA 1RWNB 3SMZA 1YHQS 2HQCA 3D0IE 3P4UB 2KH9A 2J8SA 3FUYA 4I1TA 4F04B 5MLCV 4O3RA 2DGTA 2M52A 2AJFE 2Z2ZA 3FZBA 3NBPB 2LA4A 4J9SA 4LREA 4KO0B 3Q8RB 2JVOA 2RQCA 2XS2A 3OVSA 2HVZA 4C48A 3SXLA 4CNZA 1VQYA 1QDUB 2DNYA 2YKNB 3EDRB 2ASJA 3POTA 2BRLA 3N28A 1X4FA 2ADCA 1MSWD 1VQ5S 2LEAA 5F0WA 3HHLA 1Y3JA 3LWMA 4C8YA 4NLVA 1CULA 1FRMA 2VC1A 4DU8A 4YB6A 5I3QA 3I0RB 5A2QY 2ZKUA 2DCLA 1VCTA 2ZOFA 1S4EA 1YDLA 1N32F 1WTFA 5H1SV 1KHWA 4B3MJ 3DHXA 3GG0A 3MOJB 2AEJA 3WX4A 2W8LA 1TMMA 2HS0A 2FB0A 1JB0C 2AYMA 2KRBA 4Y2AA 4O0IA 1ZH5A 1PC5A 1M5SA 1JLAA 3NWGA 3RBEA 3ZNJ1 2ILYA 5HL7Q 1C1CA 3QRRA 2DPJA 5KFTA 2VIHA 2HFZA 3M8PA 5L1LA 4KYZA 2F7VA 3UN3A 3FGVA 2J0WA 3D67A 1T9UA 1JQGA 5FJ4A 2W8KA 2H5EA 4ZCKA 4ZVQB 2MQPA 1OPIA 3HZGA 3CCUS 3AQPA 3MEKA 2HURA 4K5SA 1VQ4S 2PMHA 2JFKA 5MAOA 4TKTA 3FDSA 5M2PA 5DDPC 3ZZTA 3TO8A 3HVWA 1LW0B 3TZXA 4MK7A 3C6UB 2XMWA 4B17A 4IYQA 4AXIA 1K9MT 1TKXB 3BS9A 2OMLA 2N3OA 3T6BA 4HHUA 3J81j 4ZP9A 2AEMA 4I69A 3D6HB 3VGVA 1E6YB 4CWBA 1K73T 4FBTA 4DZ6A 1HW8A 3DYAB 2JJ4D 4CLSA 3M30B 4N8NA 3HJVA 2MKCA 2YKPA 3TUIC 4UQTA 2KN4A 3L7PA 2CKWA 2BJ8A 4JI4F 1NNDA 5ITHA 3TQ1A 3W8GA 3GR0A 1RZMA 2GMJA 3D6MB 1DFDA 3D0HE 5F3ZA 1TV6B 2HIQA 3VVUA 3ITHB 2Z2YB 3Q0AA 1S6PA 3FEZA 4DV4J 2EK1A 1Q16B 3BEGB 1B70B 1HHSA 4WFYA 2VQFJ 2OEMA 3N6NA 2QT7A 2ALYB 5D6GA 4USWA 3PW0A 4OV1A 1CLFA 2Z8QA 3LH2S 3AJ2A 4OQJA 1UEVA 4B3OA 5IT4A 2KVIA 2DGOA 1UTAA 1VK8A 1FK9A 1NZAA 1RADB 3LP0A 1S10A 3KK3B 1N5YB 1YITS 3PYFA 2R2SA 2G2ZA 3KLHA 3MM6B 4CO2A 1ZAXA 4CH7A 3K8VA 2ZOMA 2YVSA 5C2GA 4O23A 1RT7B 1FNOA 5IQ6A 3RW7A 1WC5A 3R5GA 2B0GA 2AYEA 2YWFA 5DG8A 4IUFA 4V19J 4YOEA 4GVBA 3OJUA 1HBUB 1ZM4A 4ZIWA 2J0SD 4W90B 1IN0A 4J9QA 1R8PA 2BKNA 4RU2A 1G2EA 4WBFA 4ELTA 1I5OB 5AT1B 5GMKa 3SDEB 2HHQA 3CCRS 4J9UE 1RTZA 4F50A 4KH1B 1VC6A 2BVZA 1RTHB 4ZPDA 4OYBA 2ZD1A 4OZNA 2ZOGA 2A1BA 4DR4F 1TUWA 3NOGA 1AROP 3RTVA 2O66A 3QO9A 3OTOJ 1SL0A 2E9TA 2VBXA 1PJ6A 2KZZA 1Q8KA 3M9OB 3BH6B 2HHHF 4IQMA 3ENVA 4H4MA 1N56A 2V8HA 1SC3B 1WF0A 4QIVA 4DV1F 4IOAQ 2UXCF 3IWLA 4UW2A 2V4JA 2KM8B 2DHXA 2QLBB 5HQ8A 1HR0J 1RWPB 4U96A 2ASDA 4R0JA 1RTIA 2MB0B 1AT1B 1Y5IB 3HK2A 2XM3A 3RBXA 2KT3A 3ZZUA 4QIFA 2CQCA 4C0BA 5H9FK 1TKTB 2IVYA 4KQZA 4Q5VA 5IV4A 3DN9A 4TN2A 2MZJA 3EXYA 1A0OB 2WVCA 1VBYA 5KOXA 2PIIA 2NZCA 4DPYA 4NYOA 4LR8A 2AP6A 4ECYA 5J1NA 1VQPS 3MZIA 4RUCA 3B4DA 2V2ZA 1DRZA 1RYSA 3DLEB 4OFZA 2F8HA 3HVTB 2QA4G 2OH2A 4EFAC 2X1BA 1Y4ZB 4QU7A 1W2IA 4EGLA 3J7ZT 4C8NA 1VBZA 2Z2LA 3MAAA 2MQMA 4W92B 3KG0A 1APSA 4Y65A 2BJ1A 2K1RA 3UDVA 3ISND 4DV0J 4Y28C 2MLYA 2ZDPA 2WSFC 1YBAA 3ZTQA 2ZNYA 4ZCMA 4L74A 3DMJA 3FSIA 4UQGA 3C15B 2M4MA 3TR5A 5FD1A 1O0PA 3PIOQ 2FVQA 2ZH2A 1GMWD 2W9BA 4OI0A 1SBRA 1RT2B 7FD1A 4IH5A 4ES3A 4QYZJ 4L72B 1IVZA 4M5JA 1C4AA 4F0KA 4DR5J 1SH0A 4ES1A 4OYXA 4URQU 5LOQA 2P9GA 3CC2S 4ZP7A 1WKJA 5J2NA 5KG1A 2IRUA 4LRDA 3CJ5A 2JEFA 2DD8S 2V67A 1NCLA 3D1OA 2DNMA 2QX0A 3KK2A 2J9DA 2HLTA 2D69A 3HKWA 3MMBB 2I6WA 2ZZMA 2DY9A 3DOMA 4CM0A 2XEXA 1TR0A 1SC6A 3CJSA 2ZHOA 5KG4A 1EJ7L 4C3MA 2C42A 5DM7Q 4YB5A 4IFYA 2GW8A 2UVRA 4Y2KA 1SJQA 2M3DA 5A6PA 2G0IA 2R7TA 3VAHA 1KSPA 1MMDA 2IMOA 3DGPA 2L41A 1UKUA 1KVIA 2JZ5A 3FKBA 3M2RB 1PBAA 2BE2A 2IAJA 1J5EJ 2ZWOA 3T1YF 2E5IA 2BW7A 2F65A 4C3LA 3QRPA 3GIKA 4IQXA 1HNVA 4UZCA 4WTYA 3K59A 1FVSA 4YDXA 5HROA 3LAMA 2MKKA 1AFJA 3ZXWA 1XQIA 1FESA 1SH2A 4IDKB 3MI7X 1Q86T 3CD0A 1ICEB 1TZ0A 3T3FA 4ERDA 4FXVA 5HBMB 1PSDA 1I3OB 1V3ZA 4L75A 1T11A 2O01C 2VG7A 3RRHA 1UMJA 2L48A 5T7LB 1X9MA 4LSZB 2LMIA 2AJ0A 3MM9A 2JC1A 1JX4A 1SC1B 3PYGA 4N47A 5KFFA 3KLIB 1KVKA 1XIQA 1HMVA 1VR6A 4Q0BB 5THWA 1J2VA 4LBPA 1VDHA 3A13A 3M32B 2RHSB 2Z0GA 4ZVUB 3OR1B 1T7PA 2UUCJ 4JI3F 4CCHA 4WIQA 2WOMB 4DV2J 2LFVA 4ED4A 3CD7A 3S7RA 1VHIA 2HK2A 1GFWB 5I42A 1GAOA 1N0UA 3NLCA 3TYTA 2A6OA 1BD6A 2L9WA 4DLEA 3NXZA 4E2FB 4F67A 4ZN3A 4ECSA 3DRSB 1R43A 3ILLA 1CPZA 5KT4A 1R6VA 2I38A 1HWKA 3UNGC 3GIMA 1S7HA 1TVRA 4NRTA 3W7BA 2FC8A 2HS3A 3LO3A 4I6AA 2J0QD 1X4AA 2LXFA 3V5RA 1RT3B 1SIZA 4P2FA 2GJ2A 2VASA 3DLJA 2CJQA 2CQ2A 3VAFA 2BE9B 2EWHA 2IBKA 3S1TA 2W4DA 2Z58B 1PYTA 1HNXJ 1P8GA 4F4AA 4PYAA 1VQ8S 4WYWA 2ACYA 4DPTA 3CDUA 5KFWA 4X4TA 2FLNA 1YRTA 2EI5A 3MEDB 4A8FA 3IG1B 1YGYA 2C28A 3CCLS 3MMAA 5A8KB 3EE3A 5CHCB 2RF2B 2OPRA 3UDCA 2RDJA 2CQ1A 4ZITA 1WKLA 2QL5B 1UL3A 1TUVA 3MEGA 1Q5VA 4PXDA 3QQCD 4QWDA 4NXNF 3UD5A 3N4WA 2AIRB 4JUZA 4FP9A 1IKXB 4QR1A 1TL3B 3G2XA 4XAKA 4QWCA 2E5GA 4S0MA 4TVAB 3MUTP 3VTIA 1RXOB 2VHGA 2QRRA 2V2VA 4F26A 5KFMA 5SZTA 3IAM9 1D8YA 2ZVIA 3KJNB 1Z2LA 2W25A 2RILA 4FYYB 3QJLA 3PYDA 1CBKA 1ZPVA 3PACA 2DB1A 4ZHRA 1X60A 1PYSB 1VS3A 2GA7A 1UCNA 1SJFA 3W2VB 1T3OA 4USUA 2VKRA 1WWHA 1WHYA 2YKMA 3HMJG 4JI7F 4DSLA 3EDQB 5D0EA 2KYZA 2DNQA 1D1UA 1S99A 4X62F 3M7VA 1WI8A 1FWLA 2QFIA 2VFTA 3ZTOA 4LIWA 3HVRA 4HHJA 3PV8A 4OI3A 2ACMA 2DITA 2BMBA 3LPEA 5HQMA 4K4ZA 3FNNA 3U27A 3PRDA 3KJFB 5B0AA 4LF4F 3WC2A 1JLBA 2C2KB 4TQRA 1CJUA 4JI1J 3MM8B 2LQ9A 3LAKA 3EM1A 3DCAA 2H48B 4LSLB 3GJQB 5DG9A 2VODA 1OWXA 3ELHA 1P27B 2B4PA 4I2PB 1NLKL 2IHR1 4EBDA 2JH3A 4L76A 4C9DA 2HAFA 3A4TA 2V4RA 2DR7A 2HHPA 3MCMA 3CO0P 5KG2A 1C0TA 3TAQA 1F0XA 1U25A 2MKHA 3D28A 4LFAF 1YX2A 4RW6B 5FDLA 3G71S 2IYIA 2ZH4A 1Q4RA 1H3DA 1A6LA 2UUTA 1FDBA 1RKJA 1VQOS 4O4RA 5J1EB 3SYZA 3HHLD 3R3TA 1R0AB 1T02A 1ZAWA 3EPGA 4LFCF 2R7RA 3MTJA 3QZ7A 4CLYA 4X4UA 4K2JA 1RTJA 2OSRA 2FJDB 5IZHA 3UE2A 4Y6IA 2DPIA 1FJGF 3GV5B 2HMIA 5KOWA 1BLUA 1WG1A 2BABA 4DR3F 2R7UA 1IKYB 5B0GA 2K7KA 2Z56B 2MQOA 1FA0A 2XG8A 3MR6A 1Y10A 1ZZFA 3P5BP 1FDAA 4BWMA 1D09B 2X1FA 1X9WA 3QT7A 1RHJB 4UOCA 2H1YA 3K5NA 4A8WA 3GIRA 2AJ4A 3KFWX 4NCGB 1XMQJ 3KG1A 2JC0A 3PNIA 2OJ3A 1MW7A 2E7XA 1IKVB 4QBUA 3I4HX 2BQRA 4OX9J 2JEIA 4OMFG 3F56A 4LF9J 2YTCA 5KFNA 4PUOB 2AZ1A 2KZMA 4JI4J 1YJ9S 1RT4A 1PCAA 4H4KC 4HLBA 5A8RB 2D3OR 2NXJA 2GJFA 3IGVA 3PTWA 5EWEA 3MD1A 1LFPA 3M9NB 2GQ2A 4RW8A 1Y5NB 1UVLA 1WKKA 3ZO7A 5E3AA 3DLKB 2NPIA 1WDDA 1O5JA 4DFKA 1CEZA 3T5KA 4RJVA 1EHWA 4ZPTR 4N7TA 4NL5A 2I1RA 1OYDA 1GH8A 4KC5A 5K5MA 3M6UA 3GV8B 2I0XA 3W63A 2C2ZB 3ONQA 5LMNF 1CC8A 1IBKF 4Y34A 3M8QA 2MZSA 3V6HA 4OYMA 4QQBA 5AJ3F 4LVNP 1RAOA 1R3NA 3PHEA 1HNWJ 3R6GB 3CULA 1UFLA 3D3CJ 4K7QA 4TLQA 3UCUP 2E7WA 1SV5B 2WB1D 4IG0B 2NZ4A 2M88A 3AT1B 3TAMB 1HBMB 4OV6A 4OJGA 1XN9A 2M0GB 3BSOA 3OXLA 2W9CB 2ZZNA 3QIPA 2YNIB 4DN9A 2EBGA 3OXFA 1WC0A 3C6TB 4DL0C 5HLFB 3TVZA 3UPFA 3N6LA 2CPZA 2FVRA 2UUBF 4JI2J 3C14B 2ALZA 4OI1A 3I9V9 2Y1RI 1MNEA 2MHNA 5DETA 1XR7A 2R2UA 1TMJA 1XEZA 3QATA 1M0SA 5LJ5Y 2DGWA 1TL7A 2R7OA 1ZZNA 1S6UA 2IA0A 2HBZB 5K8PA 4I2QA 3W9IA 2DHGA 1HI8A 4I4BA 2AX0A 2HGNA 3K5OA 3QBCA 2UXDJ 4P2XA 1YTYA 4ETXA 2EXUA 3K58A 4ZP8A 1S4FA 3LP2B 4ILRA 4YHHF 2M7SA 2NXCA 2EKYA 4JI5F 4B3SJ 5BYRA 3JAMY 1Y11A 3ILIA 3VZIA 2FY1A 1YJ7A 3MR5A 1UPMB 2KFNA 1FX4A 5F9NA 4L6V3 5B0DA 2CA9A 3AJ1A 4NMXA 2WSCC 1E6VA 4X4NA 2OPSB 2LEPA 3D4JA 4DFPA 4ILMA 2J9EA 3HFKA 3ZTPA 5LSOA 3DOKB 2B6AB 3HLUA 1TKZB 3NGUA 1FVQA 3GYGA 1KLNA 2J7WA 4ZVPB 4IO1A 1PC4A 1SJ4P 1HBOB 4FYDA 3MPYA 2AGOA 3I4PA 3GZ7A 4MK8A 3I6PA 3ICLA 1NK4A 4ED5A 1TUGB 2JHEA 2IM1A 1RHKB 4JI6J 1JLGA 2DNRA 4FKXA 4NXMF 1MMLA 2KU7A 4WP8A 4LR9A 4TNOA 4OI4A 3VV2B 4DV6F 1TU0B 1F60B 2ZH1A 3BO2A 2C3OA 3T1HF 4XDCA 1BQNA 2BQ3A 5E33A 2LKZA 3OUYA 4GKKJ 1N34J 1NJXA 2IVFB 4DCJB 1U1OA 2MQLA 2MTLA 4QWBA 2XYGB 2B5JA 3OLBA 4ZCIA 4CIOA 1NJWA 3HVTA 5I3UB 1URRA 3TZZA 4HTIA 3W5YA 4FYWB 4Q2LA 3VQTA 4BS2A 4UY8T 2FJAB 1ZPWX 2VPWB 4JBCA 3TVKA 1NSQA 5CAAA 1IKWB 1FFSB 2HGMA 3BGLA 5KFZA 1BQMB 1PJ5A 1ZA2B 5F8NA 1WF2A 3DFEA 4FVCA 1IWAA 3HXMA 2V8PA 3KHRA 2EBEA 3V6KA 2APOA 5B09A 3LA0A 1UFKA 3G87A 3GP9A 3OTCA 4MKBA 3BYRA 1JJCB 3SZ2A 4K50A 4YP3A 1X5OA 3SCJE 4NLTA 2XZTB 2A10A 3JYTA 1YZ7A 1TK5A 4FKYA 2LECA 3RBDA 5D4LA 4U6PA 1WC4A 4TY9A 4DPOA 4Q45A 1QD1A 2DK2A 2AGQA 1FT8A 4LFBJ 3G8QA 2FHJA 2ZBQA 4ICLB 4ZVGA 3DLGA 3BB5A 4X4PA 2DRBA 2KM8C 2XMVA 5EWGA 3H2VE 2FJXA 1FXRA 1NKCA 5L8RC 1QTMA 4N77A 2XLKA 2JNJA 4KB7A 3EGZA 4M5DA 3D0GE 3IP0A 3A8JA 1TKDA 1XC9A 3JQJA 2HHSA 5E5NA 4HL9A 1KN6A 5IT9Y 1M5VC 2MZ1A 3H20A 4AYBD 2HG4A 3CDBA 3JSBA 1GX5A 3RBZA 3R97A 2HZVA 2NREA 4K8RA 3PW4A 4KFBA 3DRRB 2EFPA 2MJUA 4DR7F 3T19A 1F9EB 2DH8A 1DJ0A 2CJKA 3KLFB 3QLHB 3QGGA 3MAHA 1DLOA 3N0VA 2RE1A 2V0NA 1PILA 1TFYA 1NMEB 4ZIVA 4FF4A 4Q0BA 2XS7A 3U7JA 4NZ6A 2R42A 4EYIB 3F73A 2B4OA 4PWDB 3Q8PB 4IG3A 1VJQA 3CNQP 2DGSA 4CYUA 2VFUA 3FJ2A 3BKTA 2QC3A 4OYPA 4ES2A 2XC9A 4ZK7M 4ALZA 2VZ9A 1R8BA 2JVRA 2KXFA 1NJYA 1I51B 4DFJA 3Q8YA 4NLPA 2X1AA 3TJ8A 5M2RA 4ZPAA 1DTTA 3HHKA 1RAAB 3KWMA 4AQYF 1RU1A 3THTA 1T9WA 5DZ7A 1LFWA 4WTOB 3A3NB 2Z57B 4H4OA 4ZVRB 3LALA 4R5PB 4RWXA 1OO0B 4X4RA 3MM7B 3LP1B 4PXBA 1X8DA 3C16A 1ELOA 2V4QA 1GT8A 2OPQA 1FF2A 2GHVC 4RW7B 4G65A 4WPAA 5CYMA 5J2MB 4ZLLA 2RQ4A 2DHAA 4YY3J 2LDIA 1R27B 5IWAF 2V2QA 3PO4A 1X5PA 2AKWB 2YNFB 1IM6A 2HNDB 4NRUA 3IC1A 2FHMA 3D68A 2VJUA 1Y3KA 5KG3A 4CLWA 4K0KF 5D0GA 1NPRA 1UW4A 3H98A 3R7NB 2L9DA 4C8MA 4ELUA 1GX6A 5FIIA 2W2QP 3W66A 3LF0A 4OHYA 2XSFA 5C42B 5E3PA 3KKFA 4RUAA 4LSNB 4DDFA 1NHUA 1UETA 2I5JA 1XNRJ 5C2CA 3THPA 4TYAA 3BDEA 2GMLA 4GC7A 4LF8F 2HGLA 3I55S 4JV1A 4USKA 2WRMA 1FJEB 2Q1LA 4DV3F 1VQMS 1IR0A 4HI1A 4F4WA 4ILLA 3BGRB 2LXIA 3E8OA 2B9YA 4QPTA 1K0VA 2F40A 1Q0NA 1QVGR 2RU3A 2MKJA 3DM2A 2ZBPA 3H8YA 2QTWA 2R7WA 5ETQA 3OJSA 3KLEA 2DEJA 1GK8A 1SB6A 4PABA 3K2YA
chains in the Genus database with same CATH topology
1Y10A 1CS4B 1CJVB 1CJKB 5D0RA 5IV3A 3MAAB 4OYZA 4NI2B 2QV6A 4CLWA 2GVZB 1WC3A 1CJTA 1U0HA 3UVJA 5D0GA 4OYPA 2GVDB 2W01A 1TL7A 3ET6B 4CLKA 4OYWA 4USUA 4CM0A 1FX2A 2WZ1A 1AZSA 3C14A 1CS4A 1CJVA 1CJKA 3C16B 4OYOA 4CLLA 3MAAA 1CULB 4NI2A 4CLSA 1YK9A 5D0EA 2GVZA 4WP8A 4OYMA 3G82B 4P2XA 1WC5A 3MR7A 3ET6A 1YBTA 3R5GA 4USTA 1AB8A 3UVJB 4CLYA 1WC4A 1Y11A 3C16A 4OZ2A 4P2MA 3C15B 1CJUB 4USVA 4OYAA 4WP9A 1WC6A 2GVDA 1FX4A 2BW7A 3G82A 4WPAA 4CLFA 4CLZA 1CJTB 1U0HB 1YBUA 5IV4A 5D15A 1WC0A 4CLTA 4CLPA 5D0HA 1TL7B 4OYXA 4OZ3A 4OYBA 4CM2A 1CULA 4WP3A 1WC1A 4OYIA 4P2FA 4USWA 3C15A 4CLUA 1CJUA 1AZSB 3C14B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y10 A;  1CS4 B;  1CJV B;  1CJK B;  5D0R A;  5IV3 A;  3MAA B;  4OYZ A;  4NI2 B;  2QV6 A;  4CLW A;  2GVZ B;  1WC3 A;  1CJT A;  1U0H A;  3UVJ A;  5D0G A;  4OYP A;  2GVD B;  2W01 A;  1TL7 A;  3ET6 B;  4CLK A;  4OYW A;  4USU A;  4CM0 A;  1FX2 A;  2WZ1 A;  1AZS A;  3C14 A;  1CS4 A;  1CJV A;  1CJK A;  3C16 B;  4OYO A;  4CLL A;  3MAA A;  1CUL B;  4NI2 A;  4CLS A;  1YK9 A;  5D0E A;  2GVZ A;  4WP8 A;  4OYM A;  3G82 B;  4P2X A;  1WC5 A;  3MR7 A;  3ET6 A;  1YBT A;  3R5G A;  4UST A;  1AB8 A;  3UVJ B;  4CLY A;  1WC4 A;  1Y11 A;  3C16 A;  4OZ2 A;  4P2M A;  3C15 B;  1CJU B;  4USV A;  4OYA A;  4WP9 A;  1WC6 A;  2GVD A;  1FX4 A;  2BW7 A;  3G82 A;  4WPA A;  4CLF A;  4CLZ A;  1CJT B;  1U0H B;  1YBU A;  5IV4 A;  5D15 A;  1WC0 A;  4CLT A;  4CLP A;  5D0H A;  1TL7 B;  4OYX A;  4OZ3 A;  4OYB A;  4CM2 A;  1CUL A;  4WP3 A;  1WC1 A;  4OYI A;  4P2F A;  4USW A;  3C15 A;  4CLU A;  1CJU A;  1AZS B;  3C14 B; 
#chains in the Genus database with same CATH topology
 3KJV B;  2N4C A;  3GON A;  4R8U A;  2B51 A;  3KNG A;  1P6T A;  2HKE A;  3FCW A;  2BW2 A;  5ETL A;  3V4I B;  3IO1 A;  1RCX B;  4B3T F;  1X4D A;  3MPW A;  1TFW A;  2F9D A;  2E1M C;  1VFJ A;  2VQE F;  1AXQ A;  2E1P A;  2E5H A;  3HVA A;  2LVW A;  2DNL A;  2H54 B;  2EC2 A;  2YNG A;  4L3K A;  5A6W A;  3MGJ A;  4LIR A;  3DRP B;  2CJY B;  1YVF A;  1BXN A;  3R5J B;  4FF3 A;  1LV5 A;  5G0R B;  1REV A;  1U2C A;  2R7Q A;  3MM8 A;  3QFH A;  3PG9 A;  1S1U B;  3E51 A;  2Y0B B;  1EP4 B;  1XMB A;  1VQ7 S;  4K4V A;  2V63 A;  3OL8 A;  2MQQ A;  4ZS6 A;  5KFS A;  2UVU A;  4QYZ K;  4PEO A;  2JDJ A;  5SUH A;  3RRG A;  3NRB A;  1W7W A;  1NUE A;  1PGZ A;  2B3T B;  1U0H B;  5D78 A;  3E01 B;  1U1L A;  5DRK A;  2ATC B;  4K4U A;  1NEE A;  3MPV A;  3OR2 A;  2J6S A;  5D3G B;  4QW8 A;  4OYI A;  3Q86 A;  1RAI B;  3O2I A;  2XB2 D;  4QZV B;  4O4G B;  4PWW A;  3SV4 A;  2EFQ A;  1CJV B;  1EKR A;  1TAQ A;  7FDR A;  4WE1 A;  3UD3 P;  1JWW A;  3CXC R;  4JV2 A;  2LQ8 A;  2XUL A;  5L1K A;  2J0X A;  1RT1 B;  4IRK A;  1TL1 A;  2RS8 A;  2Y1I A;  2UXB F;  3B54 A;  1B7Y B;  4CRJ A;  2D3Z A;  2FHK A;  3FZ2 A;  2YH1 A;  1N5V A;  5KT2 A;  1YJR A;  1IBM J;  5KFR A;  2BRK A;  3I5A A;  3C66 A;  4CO1 A;  4IR9 A;  1RU2 A;  1JLE B;  3RJM B;  1FEE A;  4NPO A;  2Q66 A;  4ETZ A;  3UVJ B;  4Y2M A;  4PXE A;  3G8T A;  1SUQ A;  1WHV A;  4DV5 F;  1IQT A;  2DGQ A;  1RSC A;  4YEA A;  2WB4 A;  5HJY A;  4R25 A;  1ZM3 A;  2WVD A;  1IUJ A;  1H38 A;  1QLN A;  2U2F A;  3MWB A;  4WXW A;  4UOF A;  4LF7 J;  3RB0 A;  2BDP A;  1RDR A;  2G2O A;  2YH0 A;  4RW4 A;  4RUB A;  3ZTS A;  2OGU A;  4I6Y A;  4DEZ A;  5CD4 H;  4NZ0 A;  1S77 D;  1H7W A;  1JLQ A;  2CNL B;  1G6B A;  1VC5 A;  4ZJO A;  2MST A;  3HZE A;  3CWJ A;  2PC6 A;  1WG4 A;  4X66 F;  4JYA J;  2GV1 A;  4NI2 A;  2OEJ A;  2P6T A;  4KGX B;  2C2E A;  6FD1 A;  3KHL A;  1ROF A;  1LWC B;  3I9Z A;  5FLX Y;  4MKV A;  2ROG A;  5DLF A;  4IH6 A;  1L3S A;  1HYS A;  5AJ3 J;  5CYQ B;  2V9W A;  5B0C A;  2RUG A;  2CFX A;  3S6E A;  3SEO A;  1Q1K A;  4M5H A;  2G4B A;  3GR1 A;  1S0N A;  2NUH A;  2CVI A;  1C0U A;  4CO3 A;  1Q8B A;  2IRY A;  3NG8 A;  1FKO A;  1S6Q B;  4KHP F;  5E3R A;  2GAH C;  1VRT A;  2PDA A;  5IXU A;  1QVF R;  4DR1 F;  2J7U A;  1DQA A;  4Q7A A;  4ZVO B;  2R4F A;  1EZZ B;  2HEK A;  2GVD B;  1HBM A;  1JLF A;  5KFQ A;  3JTO A;  2FZK B;  3GE9 A;  1GMU A;  4DG1 A;  3UD4 P;  1SXL A;  4ZJQ A;  4TU8 A;  2W2O P;  3KJQ B;  5KFB A;  2KB2 A;  3OTB A;  5K9F A;  1SI9 A;  4UST A;  1RWV B;  3BKU A;  1ZOT A;  2HWI A;  2E9R X;  2ZFH A;  4XDD A;  2WVE A;  3KXD A;  2L08 A;  1RBO B;  4P2M A;  4ZA1 A;  2X7I A;  3WIV A;  2E5J A;  2KJW A;  3J7A N;  4ED3 A;  4WF9 Q;  1X4H A;  1OSD A;  1P1T A;  3P45 B;  3G96 A;  2M5Y A;  2MGZ B;  2BJ9 A;  2ZJQ Q;  4AFF A;  3OVB A;  3N9U C;  3IRW P;  2ZEJ A;  4WZM A;  3Q2T C;  3JSR A;  3DI6 B;  3N5B A;  4TQS A;  1V5V A;  2M9K A;  4TU9 A;  3HKZ D;  5KTQ A;  1N5S A;  2H9Z A;  4PG5 A;  5E2Q A;  3IBC B;  3BSA A;  2VPZ B;  2OIH A;  2OP5 A;  1UJ6 A;  4U8V A;  2WON B;  1U02 A;  1F2H A;  1MN9 A;  4ZVH A;  1HQE B;  3WZ0 A;  1Y5L B;  3GG1 A;  2DIU A;  1RWK B;  4YQW A;  2C3U A;  2DNZ A;  4KGM A;  4P7T A;  1KP6 A;  4DR2 F;  3LGH A;  5IT0 A;  2HHW A;  3CW2 C;  3B78 A;  2E5L J;  4IRD A;  3EIC A;  1NKB A;  1G1X A;  3W65 A;  3OD2 A;  4MFB A;  2CJA A;  2W7P A;  4KV8 B;  4X4S A;  2LDY A;  4F2R A;  2VG5 B;  2ZM6 F;  3QGH A;  1WEZ A;  4HT7 A;  2FHO B;  2JLE A;  5GAE I;  3AQO A;  4M5K A;  2CJB A;  3U1L A;  2RKI B;  4ED7 A;  2B9W A;  4TY8 B;  3M4X A;  1RJJ A;  2Y1J A;  4QWE A;  4ANC A;  3IS9 B;  3M2V B;  3DU5 A;  3VAK A;  1KKH A;  4B9U A;  2MEW A;  1CS4 B;  1HWU A;  4IFV B;  3HFV A;  2UV8 A;  2PO4 A;  3VAJ A;  4UOG A;  1PKU A;  2HLU A;  1W2B R;  1R89 A;  1QM9 A;  2I9S A;  2IA6 A;  4OI2 A;  4G3I A;  4XK8 C;  2YWH A;  1LWE B;  1V5I B;  1UWB B;  4HAC A;  2VU5 A;  5J2P B;  4C8Z A;  3GJS B;  5J2Q B;  1NM2 A;  1S1V B;  5ADZ A;  3AD8 C;  3ETM A;  2CJ9 A;  2NYI A;  4IO9 Q;  3HUL A;  2OD4 A;  3V6D B;  5BR8 F;  1HQU B;  1VRU B;  3FBB A;  1X4G A;  4FF1 A;  4ZLP A;  1BMQ B;  2F4V J;  1MRO B;  1RT6 B;  2CQI A;  3BV8 A;  4CLF A;  2ATL A;  2VB6 A;  3W2W A;  3KLG A;  3GQC A;  4U7U K;  3CCM S;  1RP5 A;  5LT5 A;  1T3N A;  3NWR A;  2L3M A;  5DZ6 A;  1NXI A;  1X7V A;  2C2N A;  3FFI A;  3HSZ A;  1HWI A;  3MUV P;  1U1N A;  1H7X A;  2FDN A;  1H6K X;  2FLO A;  2CWX A;  3QSY B;  3OFH A;  5KFX A;  1Z1Z A;  2A2D A;  4AL7 A;  1HQ2 A;  3FSX A;  2MZQ A;  2ZIT A;  4RNO A;  5HI7 A;  2GGP B;  2GC8 A;  4ELV A;  3A1Y G;  2EFN A;  1RUS A;  3BBB A;  2K3I A;  1XNQ J;  1R0C B;  1MU2 A;  2MLX A;  1QY7 A;  1RWW B;  3MCO A;  5EX3 A;  1AUS L;  4G1Q A;  3TX8 A;  3NEK A;  2KHC A;  2FHJ D;  4ED6 A;  3I5C A;  4F0M A;  2FPH X;  2VKZ G;  4L73 A;  3VGS A;  4O3O A;  5EUH A;  4LF5 F;  3Q8U A;  1OS5 A;  5KT6 A;  3TP2 A;  2VDI A;  4F36 A;  4PQU B;  3D54 A;  1FRJ A;  1RHQ B;  2YXL A;  2OTJ S;  4DL6 A;  4NEZ A;  1RLD A;  2YWW A;  5I4M A;  5GAE U;  5F8J A;  1PIE A;  1QUP A;  4RR5 A;  4K4S A;  1QE1 B;  5HAN A;  4PWU A;  1KLM A;  1NAQ A;  1ZYQ A;  2ZH9 A;  3D6F B;  1XR6 A;  1WD6 A;  3BGU A;  5IC6 B;  4GKJ F;  1S1W A;  4JV0 A;  1Y0H A;  4LR7 A;  2ZHA A;  1LQ9 A;  4ZPW R;  3CE8 A;  4OHZ A;  4ID5 B;  5AE2 A;  2JLG A;  5DJB A;  3SQG B;  4DL5 A;  1LEO A;  4CLL A;  3MEC B;  3R7S B;  2RU9 A;  5DM6 Q;  2AJQ A;  3KK1 A;  2PD1 A;  4HVZ A;  3AB2 B;  4PYD A;  4IR1 A;  4DSF A;  1DHM A;  3PY8 A;  1T03 A;  4XIU A;  9RUB A;  3TNV A;  1Q53 A;  2OSQ A;  2OEL A;  4JI0 J;  4QWA A;  4W4M A;  1RA7 A;  4N56 A;  2GHW A;  1X5T A;  2ZJR Q;  3A3P B;  2LU2 A;  1N33 F;  2PT0 A;  2F5G A;  5LJ3 Y;  2KYX A;  3PR5 B;  3B4M A;  3UDL A;  1J5O B;  3ILO A;  3D2W A;  1EQM A;  3BYP A;  3D1H A;  3H0P A;  4X4Q A;  4KKO A;  5GME A;  1LK7 A;  2AGP A;  3GFH A;  1N5T A;  1WEY A;  2GX8 A;  4J90 A;  4X64 F;  1CVJ A;  4KJI A;  3UQS A;  5K8M A;  4A48 A;  4CP5 A;  3MMC B;  2W2P P;  4KY3 A;  4DFM A;  2AMC B;  2DXD A;  2J5A A;  1AZS A;  4NWB A;  1D9F A;  1RHU B;  4RPF A;  3TQE A;  2LA6 A;  3FBC A;  2DY1 A;  3MDF A;  2GVZ A;  2FJW A;  1I94 J;  3AD7 C;  4JV5 F;  3PVX A;  2LEB A;  2VON A;  2CYY A;  4I7F B;  1CC7 A;  2P9C A;  1HHT P;  2KT5 A;  1LW2 A;  3CJK A;  2FGO A;  3RUB L;  2O67 A;  2PN6 A;  3CCE S;  3BQ2 A;  3H2L A;  5B7W A;  2COL A;  1RLC L;  2WTF A;  4LVO P;  2G0J A;  4QJV A;  5C42 A;  1NJI T;  1S1X A;  2QLW A;  5M2U A;  3T5J A;  2XS5 A;  3FVY A;  2EFV A;  5H9F J;  2JFD A;  4DS4 A;  4ZLN A;  3EZU A;  4DR6 J;  4WFA Q;  4DUY J;  2M2B A;  5KFP A;  3IBF B;  1DTQ A;  1BE4 A;  1FJ7 A;  1WJ9 A;  2F8M A;  2KTQ A;  2DYA A;  2CZ9 A;  2CQ4 A;  1S9E A;  2RUS A;  2X3G A;  1K8A T;  3KHG A;  3POT B;  4DPU A;  1P9Y A;  1FDD A;  3MR7 A;  1M5H A;  1KOH A;  1F9H A;  2B4U A;  3HHL B;  4GRS A;  1O6X A;  1RT5 A;  3KJV A;  5IT9 U;  1HD1 A;  2J76 E;  4DQR A;  1UAW A;  1HW9 A;  2NXN A;  1HHQ A;  2XHC A;  1KHV A;  1SKR A;  1DQ9 A;  1YJN S;  2YNH A;  1GXL A;  1Q7L B;  2P5V A;  3NCR A;  1XWL A;  1Q7Y T;  3CB4 A;  5ETK A;  3M6X A;  3FEY B;  2Y3Y A;  1U6B A;  5ETR A;  1JKH A;  2PA3 A;  3NKY A;  3DGV A;  3WX8 A;  3M8S A;  1N6Q A;  1JLA B;  3PYE A;  1BGX T;  4WKY A;  1RAJ A;  1U8S A;  1KQF B;  3AOD A;  1C1C B;  4ZLJ A;  3QID A;  1FKP A;  1EP4 A;  3M8P B;  3M1V A;  5KFK A;  8ATC B;  2HYI B;  3T1A A;  2FVC A;  2M8D B;  3NP5 A;  3JSM A;  4B3M F;  1D8Z A;  4OI6 A;  5D8H B;  2IDE A;  2PA8 D;  4DLG A;  5HP1 A;  2PI4 A;  5KFA A;  4RU9 A;  4Z2X A;  3GYN A;  3L7O A;  2G1H A;  3BH7 B;  3CJQ A;  4USI A;  4PAA A;  1T95 A;  1WAC A;  4OZJ A;  2XSJ A;  2YY3 A;  3UR3 C;  4P6Q A;  1T9X A;  2DT9 A;  2OAU A;  4WII A;  2P2C B;  3G82 A;  3MUM P;  1RT1 A;  2FVS A;  1RTD B;  2DR9 A;  2V8G A;  2POK A;  3IM8 A;  2QIF A;  3US5 A;  2RHQ B;  3TAR A;  2KFZ A;  4PG8 A;  2NR0 A;  2UUA J;  4HEA 9;  3W5Z A;  4LF6 J;  3W9H A;  1JNZ B;  2CIM A;  3RYL A;  3AXK A;  2ZZT A;  2VOO A;  2VL1 A;  3IRX A;  3UVJ A;  3QSI A;  3HP6 A;  2ADB A;  3NAH A;  1BUX A;  4TU7 A;  5C7P A;  4MK9 A;  4TLR A;  4CTA A;  4NLD A;  4UT4 A;  2ZH7 A;  4DX8 H;  2UU9 F;  1JJ4 A;  1HBN A;  3FCH A;  1KS2 A;  4ZVF A;  3H4D A;  1RCO B;  4KBI A;  2G2Y A;  5EN1 A;  1VIO A;  1T9V A;  3L4B C;  4JI8 J;  3MCS A;  4LJM A;  1MWQ A;  1WOO A;  1N0V C;  1S6P B;  2QA2 A;  2C1E B;  1F9F A;  1FE4 A;  4X65 J;  1VK3 A;  4A8S A;  2HIY A;  4A8M P;  2GIQ A;  4A8Q A;  4CH1 A;  1FJC A;  1MG7 A;  4B3O B;  4USJ C;  2FVP A;  1FK9 B;  3LP0 B;  3MMJ A;  4PXC A;  4DHV A;  4P7V A;  3LPY A;  2XNR A;  2BUN A;  5LMU F;  4DV4 F;  3I0S A;  3KLH B;  1C4C A;  3CC4 S;  1VBX A;  2VQF F;  4LRF A;  5K8O A;  3G6E S;  3QPI A;  1CJT A;  5CYQ A;  4DV7 J;  2WVB A;  2UUW A;  4B02 A;  2QL9 B;  4GVB B;  3QFW A;  1DY3 A;  2VFV A;  3ILJ A;  3W64 A;  3RG6 A;  3CUN A;  2EG1 A;  4I56 A;  5AXK A;  1L3V A;  3AHP A;  4QIG A;  1IBC B;  2B7B B;  2DIV A;  4RW9 A;  1HNZ J;  2C22 A;  2ZD1 B;  3D6T B;  2HQF A;  1SVD A;  2CPF A;  4KTQ A;  1U2R A;  3OXG A;  3DRX A;  5KAK A;  2GVD A;  5HK4 A;  2CNN B;  2OUG A;  1B3T A;  1EET A;  3QO9 B;  4UF4 A;  1RKI A;  5HAT A;  1HNI A;  1FNM A;  3CME S;  5D15 A;  2QZ8 A;  2KXN B;  1LK5 A;  4WFB Q;  1QAJ A;  3KTQ A;  4OLO A;  1C1B A;  3W1Y C;  1FXL A;  2P8I A;  3GLJ A;  3SSR A;  1KFS A;  3IR7 B;  4K59 A;  3I32 A;  2D3O 1;  5KFU A;  1WF1 A;  3V4M A;  3CMA S;  1N52 B;  3F0N A;  4H4M B;  3FRY A;  1A9N B;  5HN0 A;  4A8K A;  3D5M A;  2EFO A;  2OEK A;  1FNX H;  2HQ3 A;  3H40 A;  2V4J B;  5AE1 A;  2EEY A;  4CH0 S;  3T41 A;  3OTO F;  4ID8 A;  5F8I A;  1RTI B;  5K8N A;  1KVJ A;  2VH7 A;  2VOP A;  1VMB A;  3LGM A;  2HZA A;  3CCS S;  4C0H A;  4B3R J;  1LWF A;  1L3U A;  3JXO A;  1K1S A;  3QJJ A;  2CZ4 A;  5A8W A;  4M5I A;  2U1A A;  3DI6 A;  3K5P A;  1KR4 A;  3VHQ A;  3BQ0 A;  1HR0 F;  3W61 A;  4WFZ A;  3IA0 A;  3KMQ A;  3RB4 A;  1JNR B;  2WBM A;  3JSY A;  3TJA A;  2F63 A;  4OIX A;  3H90 A;  4C98 A;  5KT3 A;  1NJZ A;  2DJW A;  1HPZ A;  4EZ6 A;  2ZE2 A;  1K47 A;  3PRV A;  5JVG Q;  1S76 D;  1RIS A;  3PX0 A;  4ZVE A;  2HS4 A;  3HF5 A;  1HL6 A;  5K14 A;  2VUG A;  2XQC A;  4E98 A;  4KRW A;  3G9C A;  1YJU A;  3MAA B;  5L1J A;  2RQK A;  4KHM A;  2GHP A;  4MH8 A;  3H5S A;  3WC0 A;  3UN2 A;  2QJ3 A;  5ETV A;  4OJ1 A;  2K1R B;  2ZUA A;  2DXE A;  1J27 A;  2MKI A;  3OL9 A;  2QMW A;  4KV8 A;  3SCI E;  4OX8 A;  3T9N A;  2GZO A;  2EC0 A;  3IBW A;  3DMJ B;  1WI6 A;  4Z7C A;  2AT1 B;  1PG5 B;  2QYG A;  4OHX A;  1YK9 A;  4JP8 A;  3CCQ S;  1B99 A;  2E29 A;  4DUZ J;  3HO1 A;  3L3C A;  2O3D A;  2W9B B;  2F3J A;  3Q8Q B;  4URS A;  2DNG A;  5T14 A;  3EWG A;  5BJR A;  5ETN A;  1IBL J;  1U2F A;  4DV0 F;  1RB0 A;  5FLX U;  4WP9 A;  1WC6 A;  2RVJ A;  5J2N B;  4ZVT B;  2AD9 A;  5BR8 J;  5IM0 A;  3UI3 A;  3TEH B;  1UVK A;  3KK2 B;  1TEL A;  4H54 A;  3EUN A;  4NLY A;  4WP3 A;  1REG X;  2OI2 A;  3IWN C;  1HLW A;  1UWB A;  3DOM B;  2ROP A;  2DNO A;  4LRA A;  4DR5 F;  4DUT A;  2V34 A;  4DSE A;  3WIU A;  3ZZZ A;  4WJB A;  2QGF B;  4IFY B;  1N36 J;  2XY5 A;  4P9S A;  3BO4 A;  2CPD A;  2RRB A;  3AOB A;  1RA6 A;  2GO8 A;  3KNA A;  3BKF A;  5C25 A;  3HHD A;  3DGP B;  3LAN A;  4KGZ B;  3IN5 A;  2B4V A;  1CJK A;  3ZTR A;  3TOQ A;  2DR8 A;  2BE2 B;  3GIJ A;  4WFN Q;  4LBI A;  2FZG B;  3PIP Q;  1S9G A;  3R1H A;  2PE8 A;  3ET6 A;  2LXU A;  4BCA A;  1HNV B;  1UVM A;  4HT5 A;  3OTE A;  1B0P A;  1YJV A;  5C24 A;  4CT8 A;  3AD9 C;  3BR8 A;  4CNY A;  1YRU A;  2W4C A;  5HRO B;  2VJV A;  3F44 A;  4YS2 A;  3C19 A;  3TW0 A;  4KT0 C;  3G4S S;  3W9J A;  1NB2 A;  1R8A A;  1FO1 A;  3EGV A;  2VG6 A;  2BR0 A;  2VG7 B;  4ZOS A;  3O3L A;  1OJ4 A;  4LF5 J;  4O44 A;  4CO5 A;  1J5E F;  1KTQ A;  1OSC A;  1T9Y A;  3MM9 B;  1QSL A;  3V2U C;  5J1P A;  2GO9 A;  3EGN A;  4I64 A;  4UZB A;  2BA9 A;  2BJ3 A;  1BC6 A;  1MN7 A;  5BYS A;  2RSQ A;  4OYZ A;  4HTJ A;  4ANE A;  1U48 A;  4QCL A;  2C3Y A;  1VQ6 S;  3N6M A;  3ISN C;  3EVO A;  2BJE A;  3NNC A;  3K89 A;  4RLE A;  4RX6 A;  3D3B J;  5I42 B;  3W8P A;  3ZNU A;  4FDF A;  4DCO B;  3J81 U;  4M94 A;  4P10 A;  5GAG I;  3MEE A;  4P52 A;  1W26 A;  2DGV A;  1SH3 A;  3PX4 A;  2QFJ A;  5H9E K;  2CJX B;  2UV8 G;  1TVR B;  3U1N A;  3FMB A;  3A12 A;  4DV2 F;  3V81 A;  3J7A 1;  2WK4 A;  4F7V A;  3OVA A;  1OPZ A;  4AXJ A;  5AXL A;  4U95 A;  3PW7 A;  1UWA A;  2KDO A;  4IH7 A;  4MIW A;  3M8R A;  2MKS A;  4PG7 A;  2LQJ A;  4N5S A;  2HBQ B;  2RQM A;  4RWW A;  5L1I A;  1NK8 A;  4ED8 A;  3S8S A;  1XBW A;  2A0F B;  4L3N A;  3C8Y A;  1UVJ A;  2RS2 A;  3MM5 A;  2NYH A;  4J9V A;  1PAE X;  2EVZ A;  1U24 A;  4BWJ A;  3KUH A;  2HNZ A;  2V8D A;  2HNY A;  2WBR A;  3MMA B;  2VF3 A;  1D3W A;  1EAR A;  4A8X A;  1KON A;  2OPR B;  3O6Q A;  4BC9 A;  1HNX F;  1OMS A;  1JLC B;  4H4K A;  4O3S A;  3MEG B;  4U67 Q;  2XGP A;  2HRT A;  1T05 A;  1HA1 A;  2HSE B;  2J9D E;  1M1K T;  1M5P C;  3HHN B;  2OD6 A;  1FEH A;  4JV5 J;  2MY8 A;  4C2M A;  3BN4 A;  1PAU B;  3HM9 A;  5KG6 A;  1O51 A;  2IYG A;  4EK2 A;  1JMT A;  1RBL A;  2D9P A;  2RIJ A;  2ZH3 A;  3ADA C;  4F3M A;  3NBP A;  1GTH A;  4KO0 A;  3CCZ A;  4O0N A;  4IRC A;  1QSY A;  4ZHR B;  2D3U A;  1XJW B;  2LQB A;  3AA9 A;  1TQL A;  4NLG A;  2W24 A;  2YKN A;  2P9E A;  2XI2 A;  1N32 J;  2YKM B;  1NSA A;  3TJ9 A;  3CPW R;  2H5I B;  4V1A k;  2V94 A;  3B6B A;  3GSI A;  5CZX A;  3W62 A;  3RAX A;  5L9X A;  2CXE A;  5JVH Q;  5DO2 A;  1BHN A;  2XWY A;  3I0R A;  6AT1 B;  2KFY A;  2MZT A;  3M2U B;  1NSP A;  1FWP A;  4AL5 A;  2GMH A;  3AH6 A;  4IOC Q;  5KFV A;  1F3F A;  1SC4 B;  1SQF A;  5GAG U;  2FIU A;  1TAU A;  2OKQ A;  5A0Y B;  4F4Y A;  2MXY A;  5BXI A;  3ULH A;  2LLZ A;  4U8Y A;  4URG A;  2DCU B;  4Z37 A;  1JLB B;  3DOL B;  1RWO B;  1CJU B;  2CQB A;  3IWX A;  1IM4 A;  2DR6 A;  2QYC A;  2GIF A;  1B7F A;  5K20 B;  5C5J A;  3HDS A;  1XR5 A;  3CED A;  2WW4 A;  1H2U X;  2CG4 A;  3NS6 A;  3FCV A;  2VV5 A;  3OHB A;  2W7O A;  1V3R A;  1RAE B;  4GC6 A;  4F2S A;  4DI6 A;  1WG5 A;  1C0T B;  5FDL B;  2QV6 A;  3VZH A;  4JI1 F;  2V68 A;  2KVQ E;  3EYZ A;  1KWM A;  2CQD A;  3QWP A;  1SL2 A;  4OYW A;  3GPA A;  2WZ1 A;  4NCA A;  2XZW A;  4U7U D;  1RTJ B;  2CRL A;  2C2M B;  2MDA A;  1OY6 A;  1LW0 A;  1F5A A;  4E0D A;  4HI2 A;  1N5Q A;  3PXG a;  1UEK A;  3BZQ A;  3ENQ A;  3C6U A;  1M1H A;  2YPZ A;  2BQU A;  1U8W A;  1TKX A;  4NLO A;  3CDA A;  4ECR A;  2HMI B;  4K4W A;  4OJH A;  4Q2M A;  1E6Y A;  2H5J B;  5B0E A;  4JB8 B;  2R8K A;  4FVM A;  1SQG A;  2V50 A;  3DYA A;  3T5L A;  2UVW A;  3M30 A;  1NH8 A;  3M8Y A;  2XMJ A;  5F3T A;  1F5C A;  5D4P A;  3R2D J;  1I1G A;  1KBR A;  4J9R A;  2A2C A;  5BYQ A;  3RR8 A;  1LNQ A;  2ZNZ A;  3T5H A;  1L3K A;  1S97 A;  3PKM A;  2MSS A;  2CUY A;  2MY7 A;  4DL4 A;  4Y2C A;  4DQQ A;  2D1C A;  3BBC A;  1Z2Z A;  1TV6 A;  4F4Z A;  2YKO A;  3ITH A;  2XMM A;  2IRX A;  2RRA A;  1Q95 G;  4K2X A;  3ZZO A;  4J9P A;  4DX5 A;  1K0T A;  2MHE A;  3ZC4 A;  4MT1 A;  1JJ2 R;  4J9L A;  1FHT A;  3CCT A;  4ZPC A;  1IR1 A;  2XMU A;  1RTD A;  1RWU A;  4ECT A;  4NX9 A;  4WK3 A;  2OFG X;  1RT4 B;  3CCW A;  2DRA A;  2UU9 J;  1BY9 A;  3KK3 A;  1XMQ F;  4FYX B;  1N5Y A;  3OV7 A;  2E1C A;  1VQN S;  3PZP A;  3UCG A;  3TA1 A;  2HHT A;  1YSJ A;  3OTD A;  4RW8 B;  4M95 A;  3X3U A;  3MM6 A;  4J37 A;  5LM7 E;  2YQ1 A;  3MR2 A;  4OX9 F;  2V5H G;  2CPH A;  4LF9 F;  1RT7 A;  3EX7 B;  1JXE A;  3R9L A;  2W9A A;  4WU2 A;  2HBR B;  1D9A A;  4EYH B;  4ZN1 A;  4WYL A;  5IQQ A;  4DR4 J;  4CLP A;  1HBU A;  3RW6 A;  4Q8E A;  1D0E A;  4F4K A;  1ZBT A;  1CSJ A;  3GII A;  4ZCL A;  3OPK A;  4J9K A;  4CO4 A;  4XPE A;  2X1G A;  3SDE A;  2W2N P;  5LMU J;  3M8Q B;  1VGY A;  4ECQ A;  2HHH J;  2KJV A;  2HRY A;  4ECU A;  2HHU A;  1JIH A;  3HHL C;  1RTH A;  2R7S A;  3PO5 A;  5HQL A;  3QZ8 A;  3OW2 R;  1QAY A;  4DV1 J;  4DL7 A;  2UXC J;  1W25 A;  2V8V A;  2DNK A;  1M5O C;  3QIP B;  2BJD A;  4NOH A;  2NSC A;  1TP7 A;  3Q8V A;  2K3K A;  2HVH A;  1M1G A;  3EPI A;  1HNW F;  1ITP A;  2CPX A;  1WOP A;  4USV A;  3AA8 A;  3VQS A;  4EEY A;  4CZC A;  2RJZ A;  1NU4 A;  2GQQ A;  2NS1 B;  1EX8 A;  3V6J A;  5L46 A;  3LW5 C;  4OX6 A;  2F8E X;  3LUY A;  3IGN A;  4CQ1 A;  1TL7 B;  1RBA A;  2V9K A;  2HVI A;  3K57 A;  4I2Q B;  3G6V A;  4NLU A;  2BKP A;  4IOB A;  4NEY A;  4DSI A;  3HSD A;  3KG4 A;  4DWI A;  3E3X A;  1CQN A;  1TKT A;  1H98 A;  3H5Y A;  4JI2 F;  2QSF A;  5ETT A;  1QJH A;  3C46 A;  1VLO A;  2X51 A;  2XZD B;  3BN7 A;  2HQI A;  5KFH A;  3CJ4 A;  3VVT A;  1NK9 A;  2CPI A;  2EW9 A;  4OX7 A;  2A3J A;  1TL5 A;  2N7Y A;  3DLE A;  2DO0 A;  1SPB P;  4J5O A;  1RGV A;  1E6V B;  1U26 A;  2WW8 A;  2Z30 B;  3H5U A;  5AXM A;  2UXD F;  3AAW B;  4K4Y A;  2M70 A;  3CGI A;  2D9O A;  3GFZ A;  3PHT A;  1WEX A;  2FGC A;  2OFH X;  1RQ0 A;  1NPK A;  3PX6 A;  1DBD A;  2DVI A;  4B3S F;  2BXJ A;  1SQE A;  3CJR A;  1B0T A;  2BAC A;  2XY6 A;  3B8H A;  3M6W A;  9ATC B;  4CLT A;  8AT1 B;  4PG4 A;  4OZ3 A;  1FI4 A;  4LF1 A;  1U47 A;  5GMD A;  1SKW A;  3UCZ P;  2CDQ A;  3C15 A;  2H51 B;  3AB4 B;  1S0M A;  2VFR A;  1JLG B;  4QR2 A;  5GVQ A;  5CXT A;  1VYA A;  1RT2 A;  5HMY A;  2UVV A;  2NPF A;  4EO6 A;  4C4W A;  2CAD A;  1BQN B;  1FKA F;  1BQX A;  1RHM B;  3H7H B;  4EZ9 A;  2ERR A;  3OUY B;  4YR3 A;  4WK1 A;  2BBE A;  3CJ0 A;  2E7V A;  4P72 A;  3M9M B;  4JI6 F;  1U1R A;  3R8Y A;  3H42 A;  1WHX A;  2B5J B;  4EBC A;  1HI0 P;  4RO0 A;  1UW9 A;  3FEX B;  3MMB A;  4DBQ A;  3SFG A;  3HHE A;  1Q79 A;  2MJN A;  3VGT A;  3T1Y J;  2BKO A;  3J80 U;  4WXO A;  1QSS A;  2V2K A;  1SJ1 A;  2HFU A;  3JB9 k;  4GKK F;  1N34 F;  4OJ3 A;  4NAS A;  2XMK A;  3HJF A;  3NS5 A;  2AU0 A;  2ZH6 A;  5DLG A;  3HCX A;  4DSK A;  2YQ0 A;  1B64 A;  1P1L A;  3OQ2 A;  1M5K C;  1NHV A;  3IMQ J;  3M2R A;  4MTP A;  4FF2 A;  4KIA A;  3MHY A;  2NSB A;  1PBU A;  3OT9 A;  3A8K A;  4ER8 A;  4J9O A;  3NNH A;  2RD5 C;  2O5D A;  3RAQ A;  1WSV A;  1EIY B;  3JYT B;  2FC9 A;  1TK0 A;  3JTP A;  2DNH A;  4IDK A;  5HBM A;  4MMO A;  2Q3P A;  4JI3 J;  2ABY A;  5KG0 A;  1GXU A;  1WOR A;  1M90 T;  1URN A;  5T7L A;  3TUJ C;  4D3G A;  2JEG A;  2KHD A;  2DH9 A;  3KLI A;  4F25 A;  1KOO A;  5KFI A;  3DC2 A;  5HO4 A;  3GMG A;  2GFF A;  4UTG A;  3L95 X;  4DF4 A;  3M32 A;  4YFU A;  3DLG B;  3OR1 A;  2XO7 A;  4N76 A;  3DNC A;  2WHO A;  2WOM A;  1DQ8 A;  2R8G A;  5F8H A;  4P73 A;  4X4V A;  3NCP A;  1VHF A;  3NOC A;  1KC8 T;  3VCD A;  4AE5 A;  1WSR A;  4LFB F;  2YPY A;  1U6F A;  2SXL A;  3VR1 A;  4M5D B;  4BLG A;  3DRS A;  2Q6B A;  3PFE A;  2RDD A;  1R7I A;  4NYZ A;  2HQG A;  3JQK A;  1T0T V;  2YKA A;  4AL6 A;  2G0C A;  1SL1 A;  2CWK A;  2VFS A;  2P6S A;  4QW9 A;  1FDN A;  1HWL A;  5AE3 A;  4PRF A;  4PQA A;  1RT3 A;  3L7U A;  1S0V A;  4WU3 A;  1WDT A;  3CIM A;  4KFB B;  3QWU A;  2D41 A;  2Z4P A;  2B8P A;  3NAI A;  5DQG A;  2W2M P;  4YME A;  1RAG B;  1Y00 A;  1L3T A;  1DLO B;  1B0V A;  2GJI A;  4FNH A;  3UDE A;  3KOA A;  4GVL A;  3WQP A;  3Q83 A;  4ZPV R;  2YX4 A;  2MYF A;  4NXN J;  1WHW A;  3A3O B;  3MED A;  2AZ3 A;  3IG1 A;  3D1Q A;  4IG3 B;  1VQS A;  4CYU B;  5GAH I;  2HWH A;  4NLQ A;  5A8K A;  1L5U A;  2RF2 A;  2BZ2 A;  1JJH A;  4KPY A;  4FXD A;  2LYV A;  1YWX A;  3I5B A;  2E9Z A;  2VA3 A;  3DDI A;  4DL2 A;  1T8E A;  2IC3 B;  2EFG A;  4OZ1 A;  2KG1 A;  3U1M A;  2NXE A;  2AF6 A;  1NDP A;  1NB7 A;  1DTT B;  2KXH A;  2D7S A;  2PFD A;  4DQS A;  2R8I A;  4JI7 J;  1IKX A;  5CCL A;  1TL3 A;  3CD5 A;  2DH7 A;  4H4O B;  1FX2 A;  2D74 B;  2YBV A;  2VIC A;  2FLP A;  1NK0 A;  2HW3 A;  4A4J A;  3UW1 A;  3C16 B;  4RNN A;  2OPQ B;  4B9M A;  4X62 J;  1O8B A;  4J9N A;  4CO0 A;  1FRH A;  3QT6 A;  5CYM B;  4A46 A;  5I3P A;  1UZH A;  2XI3 A;  3R5D A;  3W2V A;  1ZAV A;  1FRK A;  4FPI A;  5LL6 d;  1D9D A;  1OY9 A;  6FDR A;  1KFD A;  1H2T Z;  3P8B B;  3KDN A;  1R6Y A;  5DGA A;  4LF4 J;  4E8U A;  2ASY A;  1JXV A;  3ISZ A;  4EBE A;  1FCA A;  5CD4 A;  2PSZ A;  2RAQ A;  3CJ8 A;  1JLC A;  1F1B B;  4NZ7 A;  4F4X A;  2QLX A;  4QIE A;  4YY3 F;  3SCK E;  3OFG A;  2DNP A;  1NRK A;  3R5B A;  2HFS A;  4PPD A;  1AFI A;  1Q5Y A;  2V69 A;  3UR0 A;  1NPP A;  1NH7 A;  2DRD A;  2I5J B;  2R7X A;  4GMK A;  4LFA J;  5E3Q A;  2BAN B;  4YR2 A;  2DO4 A;  2AJ1 A;  3OFF A;  3IR5 B;  1N4L A;  2XHW A;  4FPR A;  4LSL A;  5KT7 A;  3QGI A;  2QMX A;  3M05 A;  4DPW A;  1R31 A;  4ECZ A;  1NHK L;  3PFO A;  3R5C A;  4LFC J;  4I2P A;  3VAI A;  1NZ8 A;  1WNE A;  2UZA A;  4FXW A;  1RWX B;  2HVE A;  3DM2 B;  4A8O A;  1VOM A;  1TTH B;  3LQV A;  2DIS A;  1FJG J;  1XNR F;  3KLE B;  1VQK S;  3A8E A;  4OZ0 A;  4MKA A;  4RW6 A;  1F5B A;  2J9C A;  3VF0 B;  4DR3 J;  3HD1 A;  1FD2 A;  2OLW A;  3CDE A;  3RZA A;  1DZ5 A;  3PM9 A;  4R8U B;  5J1E A;  2KKH A;  1R0A A;  1G7C B;  2LP4 A;  3M2U A;  5KFL A;  5GAH U;  3JTN A;  5KG5 A;  3QYY A;  2HK3 A;  2EKN A;  2BEF A;  3NNA A;  2YNG B;  1Q78 A;  5A0Y A;  2KT2 A;  3HSG A;  4WKR A;  1T94 A;  3WDO A;  4KGV B;  1UJ5 A;  1WC3 A;  1I6J A;  4CDI A;  1SCJ B;  3EGW B;  3IFE A;  1IKY A;  4DF8 A;  3W3S A;  2XYP B;  3MD3 A;  1REV B;  2I8E A;  2JWN A;  4KHR A;  3DOL A;  4ECV A;  2MMY A;  2W4P A;  1KD1 T;  4NML A;  3KDO A;  2YQ3 A;  3JQM A;  5DQH A;  1LWX A;  3OL7 A;  3AFG A;  1AW0 A;  5F41 A;  2F4F A;  1UA1 A;  2H4Y B;  2XY7 A;  2QO3 A;  1MLA A;  5B0B A;  3ETO A;  3CC7 S;  4RBU A;  2YKQ A;  2ZC4 A;  4OLP A;  4DS5 A;  2C2D A;  4NCG A;  5CCM A;  3N79 A;  3OR2 B;  2HHV A;  2XLJ A;  4ECW A;  2A6M A;  4YDD B;  3MXH P;  2CQP A;  5IFM A;  3VWS A;  2DTJ A;  4WE1 B;  2Y8Y A;  4ZDN A;  3L09 A;  2CQ0 A;  1X5S A;  3CJ3 A;  1IKV A;  5LSR A;  4YB1 P;  5DDQ C;  3GJR B;  1G3O A;  2H3E B;  2HRU A;  1OIA A;  1WUU A;  1C2P A;  1FFG B;  4PUO A;  4M8L A;  3TAP A;  1TL1 B;  4C0O C;  2DEI A;  5A8R A;  5LXR A;  3ENA A;  4ED0 A;  2CVE A;  2CNO B;  1ULR A;  4MJK A;  2N7C A;  4DJB A;  3AXM A;  2W01 A;  4C97 A;  2QA4 S;  4G1I A;  5LMN J;  4EUV A;  5F8G A;  1IBK J;  5RUB A;  2WVF A;  3DLK A;  2CQG A;  5L39 A;  1SUQ B;  2MPU A;  2QSW A;  3OSN A;  3QT5 A;  4AT1 B;  3NY0 A;  2KI2 A;  2FYX A;  3DU6 A;  4P75 A;  1WEL A;  5D4N A;  5KFE A;  1XMO F;  4JOU A;  2GNK A;  1IBM F;  2IMW P;  4PCQ A;  4OZ2 A;  2Q43 A;  4DQI A;  4RW4 B;  1UA0 A;  2CQH A;  1XK8 A;  3NGT A;  1SKU B;  1JLQ B;  5KFJ A;  4NA3 A;  1SV5 A;  1JXL A;  2UUB J;  4FYV B;  2OPP B;  4IG0 A;  5E41 A;  4ZPB A;  3TAM A;  5IOL A;  2VPY B;  4RNF A;  3CVK A;  4AND A;  3G6Y A;  4DZD A;  1GNK A;  2FTR A;  2ZUG A;  4LF7 F;  3G8S A;  3MAQ A;  2W9C A;  1YLX A;  4C3K A;  4NI2 B;  3GCX P;  1U1K A;  2YNI A;  5CA5 A;  1KQS R;  4P2S A;  3C6T A;  1UJ4 A;  1V3S A;  5HLF A;  1YKW A;  4ENO A;  1RWM B;  4YUD A;  3BBF A;  4F0H A;  5HAO A;  1LXJ A;  1HYS B;  2ASL A;  2UP1 A;  3C14 A;  4RZR A;  5DG7 A;  4U9R A;  3CJT A;  3FMW A;  4YHH J;  4JYA F;  4JI5 J;  2K8G A;  2JSX A;  3RGI A;  3UWT A;  1ZM2 A;  3GU0 A;  5CAB A;  1C0U B;  4N8O A;  2H4W B;  1FKO B;  2JX2 A;  4LT6 A;  4F3O A;  1NK5 A;  3MF5 A;  2JLF A;  1R8C A;  1PJ7 A;  5CH7 B;  3B82 A;  2BOA A;  1FER A;  1VRT B;  4OYA A;  1K44 A;  4I68 A;  2BM0 A;  5F8M A;  4G1P A;  4FN5 A;  2LU1 A;  4FNI A;  3C3L A;  1PO6 A;  3LP2 A;  2IPO B;  3TA0 A;  2MQ8 A;  1JLF B;  1QUV A;  2FD2 A;  3J81 Y;  3GSD A;  4KR0 B;  4DPX A;  3LGN A;  1IXK A;  3CF5 Q;  1YJT A;  2Y1L B;  4DG1 B;  4EWT A;  3H25 A;  5EWF A;  3K5L A;  4Y2I A;  1MWY A;  2OPS A;  3BO3 A;  4PR6 A;  2HAI A;  3R27 A;  3SI8 A;  3EJM A;  1AUD A;  3DOK A;  2B6A A;  1TKZ A;  4NXM J;  5CZV A;  2HFO A;  2Z2M A;  4DV6 J;  3T1H J;  2EG2 A;  1HBO A;  5A2Q U;  3R2C J;  3TA2 A;  2QG9 B;  2OO4 A;  3GV7 B;  2YWG A;  3D66 A;  4I6W A;  3PW5 A;  3RB6 A;  2B56 A;  4HKQ A;  3L9Z A;  2XTJ P;  5HVH A;  3HX9 A;  3DLL Q;  4YB7 A;  4RL1 A;  2ZC3 A;  2ZBR A;  3I82 A;  2ZBC A;  3MUR P;  1DAR A;  3M8Z A;  2DGU A;  1FRX A;  5LXY A;  4KH0 B;  3I56 S;  3SIP B;  4XO0 A;  4TXS A;  5EHH A;  3W60 A;  3CMQ A;  5I3U A;  2HBY B;  4F02 A;  8RUC A;  3PCO B;  1S9F A;  1X4B A;  2PMW A;  3CSK A;  5GAD I;  2A18 A;  1IKW A;  1YJW S;  1BQM A;  4MFB B;  2CPJ A;  2DKO B;  4BBY A;  1MMN A;  1S57 A;  4RNM A;  3SCL E;  2ROE A;  1DAX A;  1N54 B;  4B9V A;  3HFZ B;  2XCP A;  4PPZ A;  2E44 A;  4J9M A;  4LBH A;  4NLW A;  2ZVS A;  1Y7P A;  1X0P A;  3AY0 A;  2IJF A;  1U09 A;  3ENW A;  4DXL A;  1LXN A;  2B7C B;  1X31 C;  3GWC A;  4AD6 A;  1QAI A;  1VC0 A;  2E5L F;  3CD6 S;  2WCX A;  1S12 A;  2Y0S D;  2Q79 A;  3BRE A;  1S0O A;  3NGR A;  2N82 B;  1IQZ A;  4KGK A;  3LTO A;  1VIS A;  2RML A;  4CLU A;  2WSE C;  3TX0 A;  4RKU C;  2B43 A;  2GAG C;  2FY8 A;  4PKD B;  4CI0 B;  4LRC A;  3P5T L;  4HAC B;  3EVM A;  4USH A;  3Q24 A;  4A47 A;  3ZFV A;  3MPD A;  2IIH A;  3DDN A;  3GCW P;  1VI7 A;  4Q44 A;  3CTR A;  3PJ9 A;  4ICL A;  2IVM A;  5B0F A;  3R5A A;  3KYL A;  3LWL A;  4MIA A;  2OHD A;  2HWT A;  2DGX A;  3X1L B;  2KL8 A;  2R3V A;  2VPX B;  3OSP A;  1IWG A;  3TUZ C;  3W2W B;  4FBU A;  3PKY A;  3KLG B;  3NS7 B;  4R0E A;  2LCW A;  4DR7 J;  1VQL S;  2IJN A;  2XCA A;  1EQ0 A;  2PGC A;  4NLR A;  4KPC A;  1NK6 A;  1NSK L;  3FFI B;  1S5Z A;  4B9T A;  4DX7 A;  2BJ7 A;  4NCB A;  1XER A;  3UN5 A;  2F4V F;  4C11 B;  2MLZ A;  2PEB A;  2RB7 A;  1SJ3 P;  4QR0 A;  1MWZ A;  3P49 B;  3NGK A;  3DRR A;  2R7V A;  4OHW A;  2HFN A;  4O3N A;  1MU2 B;  2NLW A;  5B08 A;  1Y9O A;  3KLF A;  2YWK A;  3QLH A;  2R2T A;  4B9S A;  3EZO A;  4G1Q B;  2ZHB A;  4C8K A;  4C7Q A;  3KLV A;  4MYU A;  5HJX A;  1NDL A;  1H2V Z;  5GAD U;  4AQY J;  4PWD A;  4OYO A;  3I96 A;  2EK6 A;  4USM A;  3GJT B;  3CCV S;  1XNQ F;  4RBV A;  4KE5 A;  4FS2 A;  3IM9 A;  1R0B G;  2GQC A;  1RE1 B;  3ZZP A;  5ETP A;  5D4O A;  1GXT A;  3R1L A;  1V6H A;  2VC0 A;  3T6J A;  2J6T A;  1KLM B;  1NK7 A;  4FS1 A;  2AHO B;  5IWA J;  3IR6 B;  2HQD A;  1BWV A;  1S1T B;  4C6A A;  4R5P A;  1S1W B;  1NDC A;  1N8R T;  1U4B A;  2YX1 A;  2ZWP A;  3MM7 A;  3LP1 A;  4M5L A;  1YQH A;  3EZ5 A;  4K0K J;  4RW7 A;  3BSC A;  4NLS A;  3J7Z 5;  2HPU A;  1FD8 A;  2N4D A;  5J2M A;  3QMQ A;  1U1Q A;  2E66 A;  3BSN A;  1HFE L;  1H73 A;  2DHH A;  4TYB A;  2XWX A;  3KK1 B;  1U0S A;  3EXC X;  1UFW A;  1KTV A;  3P96 A;  3K17 A;  4F3Q A;  2YNF A;  2HND A;  5KFG A;  1T9T A;  3AOC A;  1T03 B;  2OTL S;  3M6V A;  4EI2 A;  4LQ3 A;  4UUW A;  1VLY A;  1X9S A;  4Q8F A;  2YWE A;  4LF8 J;  1ZTT A;  4J91 A;  1QTN B;  1CG2 A;  1IJE B;  2IC3 A;  1AB8 A;  4RNH A;  4DV3 J;  3HI9 A;  3FBF A;  5D77 A;  3NGS A;  2C3P A;  4LSN A;  1K1Q A;  3RAM A;  4DMZ A;  2HFV A;  2JRS A;  3FRZ A;  4ECX A;  1RI7 A;  1RAB B;  1VQ9 S;  4KKO B;  2W7A A;  4JI0 F;  1Q82 T;  3QRQ A;  2VBW A;  3OL6 A;  5ETO A;  4ZVS B;  2X3D A;  2RNE A;  2XNQ A;  1AZS B;  1FWK A;  3HD2 A;  4B3T J;  1SIW B;  2NQP A;  1A7G E;  3BGR A;  4NE9 C;  2VQE J;  2IY5 B;  2GVZ B;  3C2P A;  4NA2 A;  4XTT A;  2B8Q A;  5U47 A;  1VJW A;  4OL8 A;  3BPS P;  3FQL A;  3LOU A;  3CO9 A;  4Q43 A;  4RBT A;  1LW2 B;  1TL4 A;  5L9N A;  3D7S B;  3CJK B;  1CUL B;  3WBZ A;  1U49 A;  3DHW C;  5CYJ A;  3V4I A;  3M8W A;  4LRB A;  3OBI A;  1RAF B;  1HI1 A;  4ED1 A;  4DCP B;  2AYG A;  4HR2 A;  1I94 F;  2AJ2 A;  4W98 A;  1EAY C;  2QN6 B;  3H59 A;  1S1X B;  3DRP A;  2XYH B;  5KFC A;  1U45 A;  4HH0 A;  4EO8 A;  4BC7 A;  4LMZ A;  5G0R A;  2MZR A;  1OQ6 A;  2BAN A;  1X4C A;  1KNZ A;  1U6Z A;  3BDP A;  1S1U A;  4EU0 A;  4CM2 A;  4NLX A;  4LQ9 A;  1DTQ B;  5T41 A;  5CQG A;  5F8L A;  2C3M A;  2IM0 A;  2GIR A;  5DGB A;  1S48 A;  3ZZ0 A;  1S9E B;  3N5F A;  1VIX A;  1U0H A;  3E01 A;  3HT0 A;  2HVD A;  2IFX A;  2UXB J;  4PG6 A;  4RUH A;  3P3D A;  3A8I A;  5D3G A;  1RT5 B;  4O4G A;  1OYE A;  3QAE A;  4DR6 F;  1CJV A;  3BQ1 A;  4DUY F;  2G13 A;  1S59 A;  3G6X A;  2PFF B;  3GFY A;  4M63 A;  1GTE A;  4C8O A;  4HDG A;  2YNH B;  1Q8I A;  4DV5 J;  1Z4U A;  2K2P A;  2CG8 A;  2IDL A;  2W1B A;  3IAS 9;  5KFY A;  2QEX S;  1JKH B;  3RR7 A;  3K0J A;  2VD3 A;  3DLB A;  5G4D A;  3HSJ A;  3HPO A;  3PRB A;  1N6Q B;  3PJW A;  3SSS A;  1Q8L A;  2XMA A;  1EB0 A;  1VBK A;  3K8W A;  1JLE A;  1S72 S;  1WTB A;  2JOQ A;  5KFO A;  4YR0 A;  1FKP B;  3M1V B;  2XO6 A;  2PI5 A;  4QYR A;  4ZKA A;  1LOU A;  4BHQ A;  3JSM B;  4FZV A;  1FE0 A;  5HMX A;  4Y0F A;  1RHR B;  3BGO P;  5HP1 B;  3DDK A;  1ZS6 A;  4Y00 A;  4NYP A;  4X66 J;  1R8H A;  3J80 Y;  4K4T A;  2BOP A;  2XSJ B;  1UZD A;  4UUX A;  2XGQ A;  3P6Y C;  3FQK A;  4CT9 A;  3MR3 A;  2QL7 B;  1FRL A;  3S01 A;  1HAR A;  3G82 B;  2VA2 A;  3TI0 A;  2C2R A;  5ETM A;  1YZ6 A;  1XMO J;  4M5N A;  4X2B A;  2H65 B;  1LWC A;  3O5T B;  2RDI A;  1N48 A;  2R8H A;  3H4B A;  4O3Q A;  4KHP J;  3TVY A;  3IRX B;  1PYO B;  1H74 A;  3T9Z A;  2RH3 A;  2EPI A;  5D0H A;  4CTA B;  4DR1 J;  2G9O A;  4ZMM A;  1KQG B;  1HBN B;  1YRX A;  2YX7 A;  2V6A A;  5D0R A;  4N41 A;  2BE7 D;  2UUA F;  2FLL A;  3Q8S B;  1TK8 A;  2QMU B;  4QPX A;  3TZY A;  4LF6 F;  5EDW A;  2ZH8 A;  1S6Q A;  2NUU G;  3NMR A;  5HMW A;  5A76 A;  2QLJ B;  3WHI A;  1FRI A;  5AXN A;  4D3H A;  5KG7 A;  4MIB A;  2CZV C;  3AJD A;  4BDP A;  2OPP A;  2N3L A;  2IM3 A;  2M8H A;  4WCE Q;  1B4S A;  3Q23 A;  2R2R A;  5JUM A;  5DDO C;  1S49 A;  4KAI A;  4JI8 F;  2PEH A;  1NDK A;  2Y9H A;  2FZC B;  2C2O B;  3FSY A;  4DOZ A;  1FFW B;  1X4E A;  4ATN A;  3TEG A;  2QE5 A;  3I0S B;  2AYB A;  4X65 F;  2AWZ A;  3DKD A;  3TWZ A;  2IBO A;  5H9E J;  2B9E A;  4CLZ A;  4X4O A;  1CJT B;  5HMZ A;  5JJB A;  1U1M A;  4ZP6 A;  2DHS A;  2KRR A;  4U7C A;  1WOS A;  2FJV A;  1F2G A;  3CT9 A;  2FUG 9;  3BGF A;  2K7J A;  4KSE B;  3KUE A;  3PDN A;  4P71 A;  5HSP A;  3U02 A;  2CDR B;  2MGZ A;  3QAU A;  3PR4 A;  5DDR C;  1LKZ A;  4EMD A;  3VAG A;  4DV7 F;  4RW9 B;  1UVI A;  3DRY A;  3VAM A;  3E2E A;  2KO1 A;  2J6U A;  5DS7 A;  4DR2 J;  4J7C A;  2CPE A;  1KQK A;  4DQP A;  1SJR A;  1UEU A;  3MCN A;  1EET B;  2I2Y A;  1IJF B;  1HNI B;  1FTC A;  5HVG A;  2WON A;  5L38 A;  2DXF A;  1H0H B;  2ZM6 J;  5E3C A;  1C1B B;  1HQE A;  4UOH A;  1NBE B;  1OY8 A;  1BWE A;  5F0U A;  2XLI A;  2O1P A;  1AYE A;  1HNZ F;  4WZQ A;  4QOT A;  3TRG A;  4ED2 A;  3TAN A;  1NKE A;  2LQ5 A;  1VRQ C;  1JK9 B;  3OFE A;  4DL3 A;  3Q22 A;  3ZZY A;  1RAH B;  4YN3 B;  4GO5 X;  5IC4 B;  2VG5 A;  3MTK A;  3K5M A;  3MFI A;  1HKA A;  3CCJ S;  2CAJ A;  1GMW A;  3TZW A;  1LWF B;  4ITS A;  2XBP A;  2RKI A;  3H5X A;  1OQ3 A;  2QA1 A;  2HHX A;  3KUG A;  4TY8 A;  3CJ2 A;  3NCQ A;  5A8W B;  2BYC A;  5E7O B;  3IS9 A;  3M2V A;  5JXS A;  3G86 A;  1HD0 A;  1CS4 A;  1P9Q C;  4IFV A;  4DN0 A;  5IS2 A;  4C8L A;  2R8J A;  3FBE A;  3SV3 A;  3SBM A;  2XMT A;  5LSL A;  4WFX A;  4B08 A;  1V9O A;  1YBT A;  3D9B A;  4B3R F;  3O1L A;  1HPZ B;  3J7Y I;  2ZE2 B;  3I87 A;  1LWE A;  3NGD A;  3HT3 A;  2Y8W A;  3GIL A;  2ZJP Q;  3QNW B;  3BPD A;  5J2P A;  5K14 B;  2FJB B;  1U1P A;  3R7B B;  2RRN A;  5J2Q A;  1F3V A;  4K4X A;  2BV3 A;  1S1V A;  3OHA A;  3Q2S C;  3VGU A;  3DLH A;  3NL0 A;  2B9X A;  3OLA A;  3BM7 A;  3GYX B;  4O3P A;  3V6D A;  1WC1 A;  1HQU A;  4V19 X;  1VRU A;  3R6L B;  1HIY A;  3PEH A;  1RAC B;  3GB0 A;  3MFH A;  1KDN A;  1MRO A;  1RT6 A;  2GS8 A;  3UO0 A;  2QLF B;  3JS9 A;  2IAJ B;  3PW2 A;  2AV5 A;  1UP1 A;  3QT8 A;  1YIJ S;  3UNY A;  3W5X A;  1H72 C;  1YI2 S;  2R9L A;  2CPY A;  2IJR A;  3O44 A;  5EGY A;  4AUK A;  4I67 A;  2E1A A;  2FJE B;  4MYT A;  3KMS A;  2ZH5 A;  4IKA A;  4GO7 X;  1UPP A;  4OZL A;  2DNN A;  4QU6 A;  4F8R A;  5IM0 B;  4DUZ F;  3TUP A;  2ZBI A;  5JMN A;  2GGP A;  4X84 A;  1FTR A;  1GMV A;  3K7R A;  4OZ5 A;  2IM2 A;  2BX6 A;  3PEJ A;  4NA1 A;  3QJP A;  1KRP A;  2F1F A;  3RRK A;  1IBL F;  2MQN A;  4OHV A;  1HMV B;  3FK4 A;  3EVW A;  5KFD A;  2AEF A;  4G6V B;  4M5M A;  1ZET A;  3MOZ A;  4Z7Y A;  4HYK A;  5C25 B;  2VDH A;  3GTY X;  2DBB A;  1CJK B;  2L9N A;  4GKJ J;  1YG0 A;  2AX1 A;  1GEH A;  1G4C A;  4B9N A;  5E0O A;  4PQU A;  2MKY A;  3KHH A;  2NXU A;  1S9G B;  3ET6 B;  1N36 F;  5F9L A;  3SSQ A;  1UVN A;  5C24 B;  3THV A;  1QE1 A;  2UUC F;  3EMT A;  1X0F A;  2F9J A;  2ZKT A;  4B9L A;  1S7I A;  1DUR A;  7AT1 B;  2J7K A;  1HWJ A;  2VG6 B;  2G1D A;  4C11 A;  1ZA1 B;  1N88 A;  2WAQ D;  3I31 A;  1QAX A;  2RT3 A;  4ID5 A;  4O44 B;  1U7L A;  3N01 A;  3BJY A;  3SQG A;  4M1K A;  2VBY A;  3SFU A;  1GQE A;  3CIZ A;  3MEC A;  3J7Y U;  3H2U B;  4LUB A;  4HH1 A;  1N33 J;  3AOA A;  2BM1 A;  2CQ3 A;  2NCK L;  4A8Y A;  2DR5 A;  3ZZR A;  1IR2 A;  2KG0 A;  5KT5 A;  1Q81 T;  2VBZ A;  3RB3 A;  3NMA A;  1EKS A;  2AW0 A;  4MAK A;  4ZJL A;  3JAM U;  5HVF A;  5IV3 A;  4X64 J;  3MEE B;  3CDW A;  5ETS A;  1RYR A;  3F41 A;  4XPC A;  5DQI A;  2K06 A;  4PZV A;  1SKS A;  2ZDO A;  3PJX A;  3Q89 A;  1RK8 A;  2GCF A;  2CNK B;  5EX0 A;  3DXS X;  1FXD A;  1J5O A;  1F6T A;  1ZM9 A;  3V81 B;  2Q6C A;  3SQO P;  4DX6 A;  4Y3C A;  4MKY A;  1S1T A;  4M5G A;  2E1R A;  1ACM B;  1AA1 B;  2PMZ D;  4QIW D;  4DSJ A;  3BF4 A;  2JEJ A;  1NO8 A;  2AQ4 A;  3MMC A;  4UY8 5;  4WWS A;  1S6O A;  3O8W A;  2ILZ A;  4HDH A;  4HHH A;  2JL9 A;  1KEK A;  3FC9 A;  3GFX A;  3MM5 B;  3BR9 A;  4P74 A;  4I7F A;  3UFC X;  2J8A A;  1S79 A;  4LF2 A;  1XTZ A;  1YBU A;  3MPU B;  3RU0 A;  1ZTW A;  2HNZ B;  2HNY B;  4DU7 A;  2OMO A;  4K5R A;  4I0W A;  2HZC A;  3QGP A;  3DXB A;  2FQQ B;  1CQM A;  3VAL A;  3IXQ A;  1T05 B;  4CLK A;  1RWN B;  3SMZ A;  1YHQ S;  2HQC A;  3D0I E;  3P4U B;  2KH9 A;  2J8S A;  3FUY A;  4I1T A;  4F04 B;  5MLC V;  4O3R A;  2DGT A;  2M52 A;  2AJF E;  2Z2Z A;  3FZB A;  3NBP B;  2LA4 A;  4J9S A;  4LRE A;  4KO0 B;  3Q8R B;  2JVO A;  2RQC A;  2XS2 A;  3OVS A;  2HVZ A;  4C48 A;  3SXL A;  4CNZ A;  1VQY A;  1QDU B;  2DNY A;  2YKN B;  3EDR B;  2ASJ A;  3POT A;  2BRL A;  3N28 A;  1X4F A;  2ADC A;  1MSW D;  1VQ5 S;  2LEA A;  5F0W A;  3HHL A;  1Y3J A;  3LWM A;  4C8Y A;  4NLV A;  1CUL A;  1FRM A;  2VC1 A;  4DU8 A;  4YB6 A;  5I3Q A;  3I0R B;  5A2Q Y;  2ZKU A;  2DCL A;  1VCT A;  2ZOF A;  1S4E A;  1YDL A;  1N32 F;  1WTF A;  5H1S V;  1KHW A;  4B3M J;  3DHX A;  3GG0 A;  3MOJ B;  2AEJ A;  3WX4 A;  2W8L A;  1TMM A;  2HS0 A;  2FB0 A;  1JB0 C;  2AYM A;  2KRB A;  4Y2A A;  4O0I A;  1ZH5 A;  1PC5 A;  1M5S A;  1JLA A;  3NWG A;  3RBE A;  3ZNJ 1;  2ILY A;  5HL7 Q;  1C1C A;  3QRR A;  2DPJ A;  5KFT A;  2VIH A;  2HFZ A;  3M8P A;  5L1L A;  4KYZ A;  2F7V A;  3UN3 A;  3FGV A;  2J0W A;  3D67 A;  1T9U A;  1JQG A;  5FJ4 A;  2W8K A;  2H5E A;  4ZCK A;  4ZVQ B;  2MQP A;  1OPI A;  3HZG A;  3CCU S;  3AQP A;  3MEK A;  2HUR A;  4K5S A;  1VQ4 S;  2PMH A;  2JFK A;  5MAO A;  4TKT A;  3FDS A;  5M2P A;  5DDP C;  3ZZT A;  3TO8 A;  3HVW A;  1LW0 B;  3TZX A;  4MK7 A;  3C6U B;  2XMW A;  4B17 A;  4IYQ A;  4AXI A;  1K9M T;  1TKX B;  3BS9 A;  2OML A;  2N3O A;  3T6B A;  4HHU A;  3J81 j;  4ZP9 A;  2AEM A;  4I69 A;  3D6H B;  3VGV A;  1E6Y B;  4CWB A;  1K73 T;  4FBT A;  4DZ6 A;  1HW8 A;  3DYA B;  2JJ4 D;  4CLS A;  3M30 B;  4N8N A;  3HJV A;  2MKC A;  2YKP A;  3TUI C;  4UQT A;  2KN4 A;  3L7P A;  2CKW A;  2BJ8 A;  4JI4 F;  1NND A;  5ITH A;  3TQ1 A;  3W8G A;  3GR0 A;  1RZM A;  2GMJ A;  3D6M B;  1DFD A;  3D0H E;  5F3Z A;  1TV6 B;  2HIQ A;  3VVU A;  3ITH B;  2Z2Y B;  3Q0A A;  1S6P A;  3FEZ A;  4DV4 J;  2EK1 A;  1Q16 B;  3BEG B;  1B70 B;  1HHS A;  4WFY A;  2VQF J;  2OEM A;  3N6N A;  2QT7 A;  2ALY B;  5D6G A;  4USW A;  3PW0 A;  4OV1 A;  1CLF A;  2Z8Q A;  3LH2 S;  3AJ2 A;  4OQJ A;  1UEV A;  4B3O A;  5IT4 A;  2KVI A;  2DGO A;  1UTA A;  1VK8 A;  1FK9 A;  1NZA A;  1RAD B;  3LP0 A;  1S10 A;  3KK3 B;  1N5Y B;  1YIT S;  3PYF A;  2R2S A;  2G2Z A;  3KLH A;  3MM6 B;  4CO2 A;  1ZAX A;  4CH7 A;  3K8V A;  2ZOM A;  2YVS A;  5C2G A;  4O23 A;  1RT7 B;  1FNO A;  5IQ6 A;  3RW7 A;  1WC5 A;  3R5G A;  2B0G A;  2AYE A;  2YWF A;  5DG8 A;  4IUF A;  4V19 J;  4YOE A;  4GVB A;  3OJU A;  1HBU B;  1ZM4 A;  4ZIW A;  2J0S D;  4W90 B;  1IN0 A;  4J9Q A;  1R8P A;  2BKN A;  4RU2 A;  1G2E A;  4WBF A;  4ELT A;  1I5O B;  5AT1 B;  5GMK a;  3SDE B;  2HHQ A;  3CCR S;  4J9U E;  1RTZ A;  4F50 A;  4KH1 B;  1VC6 A;  2BVZ A;  1RTH B;  4ZPD A;  4OYB A;  2ZD1 A;  4OZN A;  2ZOG A;  2A1B A;  4DR4 F;  1TUW A;  3NOG A;  1ARO P;  3RTV A;  2O66 A;  3QO9 A;  3OTO J;  1SL0 A;  2E9T A;  2VBX A;  1PJ6 A;  2KZZ A;  1Q8K A;  3M9O B;  3BH6 B;  2HHH F;  4IQM A;  3ENV A;  4H4M A;  1N56 A;  2V8H A;  1SC3 B;  1WF0 A;  4QIV A;  4DV1 F;  4IOA Q;  2UXC F;  3IWL A;  4UW2 A;  2V4J A;  2KM8 B;  2DHX A;  2QLB B;  5HQ8 A;  1HR0 J;  1RWP B;  4U96 A;  2ASD A;  4R0J A;  1RTI A;  2MB0 B;  1AT1 B;  1Y5I B;  3HK2 A;  2XM3 A;  3RBX A;  2KT3 A;  3ZZU A;  4QIF A;  2CQC A;  4C0B A;  5H9F K;  1TKT B;  2IVY A;  4KQZ A;  4Q5V A;  5IV4 A;  3DN9 A;  4TN2 A;  2MZJ A;  3EXY A;  1A0O B;  2WVC A;  1VBY A;  5KOX A;  2PII A;  2NZC A;  4DPY A;  4NYO A;  4LR8 A;  2AP6 A;  4ECY A;  5J1N A;  1VQP S;  3MZI A;  4RUC A;  3B4D A;  2V2Z A;  1DRZ A;  1RYS A;  3DLE B;  4OFZ A;  2F8H A;  3HVT B;  2QA4 G;  2OH2 A;  4EFA C;  2X1B A;  1Y4Z B;  4QU7 A;  1W2I A;  4EGL A;  3J7Z T;  4C8N A;  1VBZ A;  2Z2L A;  3MAA A;  2MQM A;  4W92 B;  3KG0 A;  1APS A;  4Y65 A;  2BJ1 A;  2K1R A;  3UDV A;  3ISN D;  4DV0 J;  4Y28 C;  2MLY A;  2ZDP A;  2WSF C;  1YBA A;  3ZTQ A;  2ZNY A;  4ZCM A;  4L74 A;  3DMJ A;  3FSI A;  4UQG A;  3C15 B;  2M4M A;  3TR5 A;  5FD1 A;  1O0P A;  3PIO Q;  2FVQ A;  2ZH2 A;  1GMW D;  2W9B A;  4OI0 A;  1SBR A;  1RT2 B;  7FD1 A;  4IH5 A;  4ES3 A;  4QYZ J;  4L72 B;  1IVZ A;  4M5J A;  1C4A A;  4F0K A;  4DR5 J;  1SH0 A;  4ES1 A;  4OYX A;  4URQ U;  5LOQ A;  2P9G A;  3CC2 S;  4ZP7 A;  1WKJ A;  5J2N A;  5KG1 A;  2IRU A;  4LRD A;  3CJ5 A;  2JEF A;  2DD8 S;  2V67 A;  1NCL A;  3D1O A;  2DNM A;  2QX0 A;  3KK2 A;  2J9D A;  2HLT A;  2D69 A;  3HKW A;  3MMB B;  2I6W A;  2ZZM A;  2DY9 A;  3DOM A;  4CM0 A;  2XEX A;  1TR0 A;  1SC6 A;  3CJS A;  2ZHO A;  5KG4 A;  1EJ7 L;  4C3M A;  2C42 A;  5DM7 Q;  4YB5 A;  4IFY A;  2GW8 A;  2UVR A;  4Y2K A;  1SJQ A;  2M3D A;  5A6P A;  2G0I A;  2R7T A;  3VAH A;  1KSP A;  1MMD A;  2IMO A;  3DGP A;  2L41 A;  1UKU A;  1KVI A;  2JZ5 A;  3FKB A;  3M2R B;  1PBA A;  2BE2 A;  2IAJ A;  1J5E J;  2ZWO A;  3T1Y F;  2E5I A;  2BW7 A;  2F65 A;  4C3L A;  3QRP A;  3GIK A;  4IQX A;  1HNV A;  4UZC A;  4WTY A;  3K59 A;  1FVS A;  4YDX A;  5HRO A;  3LAM A;  2MKK A;  1AFJ A;  3ZXW A;  1XQI A;  1FES A;  1SH2 A;  4IDK B;  3MI7 X;  1Q86 T;  3CD0 A;  1ICE B;  1TZ0 A;  3T3F A;  4ERD A;  4FXV A;  5HBM B;  1PSD A;  1I3O B;  1V3Z A;  4L75 A;  1T11 A;  2O01 C;  2VG7 A;  3RRH A;  1UMJ A;  2L48 A;  5T7L B;  1X9M A;  4LSZ B;  2LMI A;  2AJ0 A;  3MM9 A;  2JC1 A;  1JX4 A;  1SC1 B;  3PYG A;  4N47 A;  5KFF A;  3KLI B;  1KVK A;  1XIQ A;  1HMV A;  1VR6 A;  4Q0B B;  5THW A;  1J2V A;  4LBP A;  1VDH A;  3A13 A;  3M32 B;  2RHS B;  2Z0G A;  4ZVU B;  3OR1 B;  1T7P A;  2UUC J;  4JI3 F;  4CCH A;  4WIQ A;  2WOM B;  4DV2 J;  2LFV A;  4ED4 A;  3CD7 A;  3S7R A;  1VHI A;  2HK2 A;  1GFW B;  5I42 A;  1GAO A;  1N0U A;  3NLC A;  3TYT A;  2A6O A;  1BD6 A;  2L9W A;  4DLE A;  3NXZ A;  4E2F B;  4F67 A;  4ZN3 A;  4ECS A;  3DRS B;  1R43 A;  3ILL A;  1CPZ A;  5KT4 A;  1R6V A;  2I38 A;  1HWK A;  3UNG C;  3GIM A;  1S7H A;  1TVR A;  4NRT A;  3W7B A;  2FC8 A;  2HS3 A;  3LO3 A;  4I6A A;  2J0Q D;  1X4A A;  2LXF A;  3V5R A;  1RT3 B;  1SIZ A;  4P2F A;  2GJ2 A;  2VAS A;  3DLJ A;  2CJQ A;  2CQ2 A;  3VAF A;  2BE9 B;  2EWH A;  2IBK A;  3S1T A;  2W4D A;  2Z58 B;  1PYT A;  1HNX J;  1P8G A;  4F4A A;  4PYA A;  1VQ8 S;  4WYW A;  2ACY A;  4DPT A;  3CDU A;  5KFW A;  4X4T A;  2FLN A;  1YRT A;  2EI5 A;  3MED B;  4A8F A;  3IG1 B;  1YGY A;  2C28 A;  3CCL S;  3MMA A;  5A8K B;  3EE3 A;  5CHC B;  2RF2 B;  2OPR A;  3UDC A;  2RDJ A;  2CQ1 A;  4ZIT A;  1WKL A;  2QL5 B;  1UL3 A;  1TUV A;  3MEG A;  1Q5V A;  4PXD A;  3QQC D;  4QWD A;  4NXN F;  3UD5 A;  3N4W A;  2AIR B;  4JUZ A;  4FP9 A;  1IKX B;  4QR1 A;  1TL3 B;  3G2X A;  4XAK A;  4QWC A;  2E5G A;  4S0M A;  4TVA B;  3MUT P;  3VTI A;  1RXO B;  2VHG A;  2QRR A;  2V2V A;  4F26 A;  5KFM A;  5SZT A;  3IAM 9;  1D8Y A;  2ZVI A;  3KJN B;  1Z2L A;  2W25 A;  2RIL A;  4FYY B;  3QJL A;  3PYD A;  1CBK A;  1ZPV A;  3PAC A;  2DB1 A;  4ZHR A;  1X60 A;  1PYS B;  1VS3 A;  2GA7 A;  1UCN A;  1SJF A;  3W2V B;  1T3O A;  4USU A;  2VKR A;  1WWH A;  1WHY A;  2YKM A;  3HMJ G;  4JI7 F;  4DSL A;  3EDQ B;  5D0E A;  2KYZ A;  2DNQ A;  1D1U A;  1S99 A;  4X62 F;  3M7V A;  1WI8 A;  1FWL A;  2QFI A;  2VFT A;  3ZTO A;  4LIW A;  3HVR A;  4HHJ A;  3PV8 A;  4OI3 A;  2ACM A;  2DIT A;  2BMB A;  3LPE A;  5HQM A;  4K4Z A;  3FNN A;  3U27 A;  3PRD A;  3KJF B;  5B0A A;  4LF4 F;  3WC2 A;  1JLB A;  2C2K B;  4TQR A;  1CJU A;  4JI1 J;  3MM8 B;  2LQ9 A;  3LAK A;  3EM1 A;  3DCA A;  2H48 B;  4LSL B;  3GJQ B;  5DG9 A;  2VOD A;  1OWX A;  3ELH A;  1P27 B;  2B4P A;  4I2P B;  1NLK L;  2IHR 1;  4EBD A;  2JH3 A;  4L76 A;  4C9D A;  2HAF A;  3A4T A;  2V4R A;  2DR7 A;  2HHP A;  3MCM A;  3CO0 P;  5KG2 A;  1C0T A;  3TAQ A;  1F0X A;  1U25 A;  2MKH A;  3D28 A;  4LFA F;  1YX2 A;  4RW6 B;  5FDL A;  3G71 S;  2IYI A;  2ZH4 A;  1Q4R A;  1H3D A;  1A6L A;  2UUT A;  1FDB A;  1RKJ A;  1VQO S;  4O4R A;  5J1E B;  3SYZ A;  3HHL D;  3R3T A;  1R0A B;  1T02 A;  1ZAW A;  3EPG A;  4LFC F;  2R7R A;  3MTJ A;  3QZ7 A;  4CLY A;  4X4U A;  4K2J A;  1RTJ A;  2OSR A;  2FJD B;  5IZH A;  3UE2 A;  4Y6I A;  2DPI A;  1FJG F;  3GV5 B;  2HMI A;  5KOW A;  1BLU A;  1WG1 A;  2BAB A;  4DR3 F;  2R7U A;  1IKY B;  5B0G A;  2K7K A;  2Z56 B;  2MQO A;  1FA0 A;  2XG8 A;  3MR6 A;  1Y10 A;  1ZZF A;  3P5B P;  1FDA A;  4BWM A;  1D09 B;  2X1F A;  1X9W A;  3QT7 A;  1RHJ B;  4UOC A;  2H1Y A;  3K5N A;  4A8W A;  3GIR A;  2AJ4 A;  3KFW X;  4NCG B;  1XMQ J;  3KG1 A;  2JC0 A;  3PNI A;  2OJ3 A;  1MW7 A;  2E7X A;  1IKV B;  4QBU A;  3I4H X;  2BQR A;  4OX9 J;  2JEI A;  4OMF G;  3F56 A;  4LF9 J;  2YTC A;  5KFN A;  4PUO B;  2AZ1 A;  2KZM A;  4JI4 J;  1YJ9 S;  1RT4 A;  1PCA A;  4H4K C;  4HLB A;  5A8R B;  2D3O R;  2NXJ A;  2GJF A;  3IGV A;  3PTW A;  5EWE A;  3MD1 A;  1LFP A;  3M9N B;  2GQ2 A;  4RW8 A;  1Y5N B;  1UVL A;  1WKK A;  3ZO7 A;  5E3A A;  3DLK B;  2NPI A;  1WDD A;  1O5J A;  4DFK A;  1CEZ A;  3T5K A;  4RJV A;  1EHW A;  4ZPT R;  4N7T A;  4NL5 A;  2I1R A;  1OYD A;  1GH8 A;  4KC5 A;  5K5M A;  3M6U A;  3GV8 B;  2I0X A;  3W63 A;  2C2Z B;  3ONQ A;  5LMN F;  1CC8 A;  1IBK F;  4Y34 A;  3M8Q A;  2MZS A;  3V6H A;  4OYM A;  4QQB A;  5AJ3 F;  4LVN P;  1RAO A;  1R3N A;  3PHE A;  1HNW J;  3R6G B;  3CUL A;  1UFL A;  3D3C J;  4K7Q A;  4TLQ A;  3UCU P;  2E7W A;  1SV5 B;  2WB1 D;  4IG0 B;  2NZ4 A;  2M88 A;  3AT1 B;  3TAM B;  1HBM B;  4OV6 A;  4OJG A;  1XN9 A;  2M0G B;  3BSO A;  3OXL A;  2W9C B;  2ZZN A;  3QIP A;  2YNI B;  4DN9 A;  2EBG A;  3OXF A;  1WC0 A;  3C6T B;  4DL0 C;  5HLF B;  3TVZ A;  3UPF A;  3N6L A;  2CPZ A;  2FVR A;  2UUB F;  4JI2 J;  3C14 B;  2ALZ A;  4OI1 A;  3I9V 9;  2Y1R I;  1MNE A;  2MHN A;  5DET A;  1XR7 A;  2R2U A;  1TMJ A;  1XEZ A;  3QAT A;  1M0S A;  5LJ5 Y;  2DGW A;  1TL7 A;  2R7O A;  1ZZN A;  1S6U A;  2IA0 A;  2HBZ B;  5K8P A;  4I2Q A;  3W9I A;  2DHG A;  1HI8 A;  4I4B A;  2AX0 A;  2HGN A;  3K5O A;  3QBC A;  2UXD J;  4P2X A;  1YTY A;  4ETX A;  2EXU A;  3K58 A;  4ZP8 A;  1S4F A;  3LP2 B;  4ILR A;  4YHH F;  2M7S A;  2NXC A;  2EKY A;  4JI5 F;  4B3S J;  5BYR A;  3JAM Y;  1Y11 A;  3ILI A;  3VZI A;  2FY1 A;  1YJ7 A;  3MR5 A;  1UPM B;  2KFN A;  1FX4 A;  5F9N A;  4L6V 3;  5B0D A;  2CA9 A;  3AJ1 A;  4NMX A;  2WSC C;  1E6V A;  4X4N A;  2OPS B;  2LEP A;  3D4J A;  4DFP A;  4ILM A;  2J9E A;  3HFK A;  3ZTP A;  5LSO A;  3DOK B;  2B6A B;  3HLU A;  1TKZ B;  3NGU A;  1FVQ A;  3GYG A;  1KLN A;  2J7W A;  4ZVP B;  4IO1 A;  1PC4 A;  1SJ4 P;  1HBO B;  4FYD A;  3MPY A;  2AGO A;  3I4P A;  3GZ7 A;  4MK8 A;  3I6P A;  3ICL A;  1NK4 A;  4ED5 A;  1TUG B;  2JHE A;  2IM1 A;  1RHK B;  4JI6 J;  1JLG A;  2DNR A;  4FKX A;  4NXM F;  1MML A;  2KU7 A;  4WP8 A;  4LR9 A;  4TNO A;  4OI4 A;  3VV2 B;  4DV6 F;  1TU0 B;  1F60 B;  2ZH1 A;  3BO2 A;  2C3O A;  3T1H F;  4XDC A;  1BQN A;  2BQ3 A;  5E33 A;  2LKZ A;  3OUY A;  4GKK J;  1N34 J;  1NJX A;  2IVF B;  4DCJ B;  1U1O A;  2MQL A;  2MTL A;  4QWB A;  2XYG B;  2B5J A;  3OLB A;  4ZCI A;  4CIO A;  1NJW A;  3HVT A;  5I3U B;  1URR A;  3TZZ A;  4HTI A;  3W5Y A;  4FYW B;  4Q2L A;  3VQT A;  4BS2 A;  4UY8 T;  2FJA B;  1ZPW X;  2VPW B;  4JBC A;  3TVK A;  1NSQ A;  5CAA A;  1IKW B;  1FFS B;  2HGM A;  3BGL A;  5KFZ A;  1BQM B;  1PJ5 A;  1ZA2 B;  5F8N A;  1WF2 A;  3DFE A;  4FVC A;  1IWA A;  3HXM A;  2V8P A;  3KHR A;  2EBE A;  3V6K A;  2APO A;  5B09 A;  3LA0 A;  1UFK A;  3G87 A;  3GP9 A;  3OTC A;  4MKB A;  3BYR A;  1JJC B;  3SZ2 A;  4K50 A;  4YP3 A;  1X5O A;  3SCJ E;  4NLT A;  2XZT B;  2A10 A;  3JYT A;  1YZ7 A;  1TK5 A;  4FKY A;  2LEC A;  3RBD A;  5D4L A;  4U6P A;  1WC4 A;  4TY9 A;  4DPO A;  4Q45 A;  1QD1 A;  2DK2 A;  2AGQ A;  1FT8 A;  4LFB J;  3G8Q A;  2FHJ A;  2ZBQ A;  4ICL B;  4ZVG A;  3DLG A;  3BB5 A;  4X4P A;  2DRB A;  2KM8 C;  2XMV A;  5EWG A;  3H2V E;  2FJX A;  1FXR A;  1NKC A;  5L8R C;  1QTM A;  4N77 A;  2XLK A;  2JNJ A;  4KB7 A;  3EGZ A;  4M5D A;  3D0G E;  3IP0 A;  3A8J A;  1TKD A;  1XC9 A;  3JQJ A;  2HHS A;  5E5N A;  4HL9 A;  1KN6 A;  5IT9 Y;  1M5V C;  2MZ1 A;  3H20 A;  4AYB D;  2HG4 A;  3CDB A;  3JSB A;  1GX5 A;  3RBZ A;  3R97 A;  2HZV A;  2NRE A;  4K8R A;  3PW4 A;  4KFB A;  3DRR B;  2EFP A;  2MJU A;  4DR7 F;  3T19 A;  1F9E B;  2DH8 A;  1DJ0 A;  2CJK A;  3KLF B;  3QLH B;  3QGG A;  3MAH A;  1DLO A;  3N0V A;  2RE1 A;  2V0N A;  1PIL A;  1TFY A;  1NME B;  4ZIV A;  4FF4 A;  4Q0B A;  2XS7 A;  3U7J A;  4NZ6 A;  2R42 A;  4EYI B;  3F73 A;  2B4O A;  4PWD B;  3Q8P B;  4IG3 A;  1VJQ A;  3CNQ P;  2DGS A;  4CYU A;  2VFU A;  3FJ2 A;  3BKT A;  2QC3 A;  4OYP A;  4ES2 A;  2XC9 A;  4ZK7 M;  4ALZ A;  2VZ9 A;  1R8B A;  2JVR A;  2KXF A;  1NJY A;  1I51 B;  4DFJ A;  3Q8Y A;  4NLP A;  2X1A A;  3TJ8 A;  5M2R A;  4ZPA A;  1DTT A;  3HHK A;  1RAA B;  3KWM A;  4AQY F;  1RU1 A;  3THT A;  1T9W A;  5DZ7 A;  1LFW A;  4WTO B;  3A3N B;  2Z57 B;  4H4O A;  4ZVR B;  3LAL A;  4R5P B;  4RWX A;  1OO0 B;  4X4R A;  3MM7 B;  3LP1 B;  4PXB A;  1X8D A;  3C16 A;  1ELO A;  2V4Q A;  1GT8 A;  2OPQ A;  1FF2 A;  2GHV C;  4RW7 B;  4G65 A;  4WPA A;  5CYM A;  5J2M B;  4ZLL A;  2RQ4 A;  2DHA A;  4YY3 J;  2LDI A;  1R27 B;  5IWA F;  2V2Q A;  3PO4 A;  1X5P A;  2AKW B;  2YNF B;  1IM6 A;  2HND B;  4NRU A;  3IC1 A;  2FHM A;  3D68 A;  2VJU A;  1Y3K A;  5KG3 A;  4CLW A;  4K0K F;  5D0G A;  1NPR A;  1UW4 A;  3H98 A;  3R7N B;  2L9D A;  4C8M A;  4ELU A;  1GX6 A;  5FII A;  2W2Q P;  3W66 A;  3LF0 A;  4OHY A;  2XSF A;  5C42 B;  5E3P A;  3KKF A;  4RUA A;  4LSN B;  4DDF A;  1NHU A;  1UET A;  2I5J A;  1XNR J;  5C2C A;  3THP A;  4TYA A;  3BDE A;  2GML A;  4GC7 A;  4LF8 F;  2HGL A;  3I55 S;  4JV1 A;  4USK A;  2WRM A;  1FJE B;  2Q1L A;  4DV3 F;  1VQM S;  1IR0 A;  4HI1 A;  4F4W A;  4ILL A;  3BGR B;  2LXI A;  3E8O A;  2B9Y A;  4QPT A;  1K0V A;  2F40 A;  1Q0N A;  1QVG R;  2RU3 A;  2MKJ A;  3DM2 A;  2ZBP A;  3H8Y A;  2QTW A;  2R7W A;  5ETQ A;  3OJS A;  3KLE A;  2DEJ A;  1GK8 A;  1SB6 A;  4PAB A;  3K2Y A; 
#chains in the Genus database with same CATH homology
 1Y10 A;  1CS4 B;  1CJV B;  1CJK B;  5D0R A;  5IV3 A;  3MAA B;  4OYZ A;  4NI2 B;  2QV6 A;  4CLW A;  2GVZ B;  1WC3 A;  1CJT A;  1U0H A;  3UVJ A;  5D0G A;  4OYP A;  2GVD B;  2W01 A;  1TL7 A;  3ET6 B;  4CLK A;  4OYW A;  4USU A;  4CM0 A;  1FX2 A;  2WZ1 A;  1AZS A;  3C14 A;  1CS4 A;  1CJV A;  1CJK A;  3C16 B;  4OYO A;  4CLL A;  3MAA A;  1CUL B;  4NI2 A;  4CLS A;  1YK9 A;  5D0E A;  2GVZ A;  4WP8 A;  4OYM A;  3G82 B;  4P2X A;  1WC5 A;  3MR7 A;  3ET6 A;  1YBT A;  3R5G A;  4UST A;  1AB8 A;  3UVJ B;  4CLY A;  1WC4 A;  1Y11 A;  3C16 A;  4OZ2 A;  4P2M A;  3C15 B;  1CJU B;  4USV A;  4OYA A;  4WP9 A;  1WC6 A;  2GVD A;  1FX4 A;  2BW7 A;  3G82 A;  4WPA A;  4CLF A;  4CLZ A;  1CJT B;  1U0H B;  1YBU A;  5IV4 A;  5D15 A;  1WC0 A;  4CLT A;  4CLP A;  5D0H A;  1TL7 B;  4OYX A;  4OZ3 A;  4OYB A;  4CM2 A;  1CUL A;  4WP3 A;  1WC1 A;  4OYI A;  4P2F A;  4USW A;  3C15 A;  4CLU A;  1CJU A;  1AZS B;  3C14 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...