3C14A

Complex of gs-alpha with the catalytic domains of mammalian adenylyl cyclase: complex with pyrophosphate and ca
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
189
structure length
189
Chain Sequence
MMFHKIYIQKHDNVSILFADIEGFTSLASQCTAQELVMTLNELFARFDKLAAENHCLRIKILGDCYYCVSGLPEARADHAHCCVEMGMDMIEAISLVREMTGVNVNMRVGIHSGRVHCGVLGLRKWQFDVWSNDVTLANHMEAGGKAGRIHITKATLSYLNGDYEVEPGCGGERNAYLKEHSIETFLIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Adenylate cyclase type 5
publication title Structural basis for inhibition of mammalian adenylyl cyclase by calcium.
pubmed doi rcsb
source organism Canis lupus familiaris
molecule tags Lyase/lyase inhibitor
total genus 50
structure length 189
sequence length 189
ec nomenclature ec 4.6.1.1: Adenylate cyclase.
pdb deposition date 2008-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00211 Guanylate_cyc Adenylate and Guanylate cyclase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1230 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleotide cyclase 3c14A00
1WC5A 4NI2B 2GVDA 1CJUB 4CLZA 1CJVA 4CLWA 4OYPA 1AZSB 1YK9A 1WC1A 5D0HA 4CLFA 1WC3A 1U0HB 4P2XA 4OYMA 3ET6B 4OYZA 1CJTB 1WC4A 3C16A 5IV4A 1WC0A 1WC6A 4CLPA 3UVJB 4CLSA 4OYAA 4NI2A 4USVA 1CJUA 3MR7A 4OYIA 1YBTA 4CLTA 4OYBA 3G82B 3C14B 4OYOA 1AZSA 4OYWA 5D0EA 1AB8A 1U0HA 4OZ2A 3ET6A 4WP8A 4P2MA 1CJTA 5IV3A 1FX2A 1CS4B 4OYXA 4WP9A 3UVJA 4CLUA 2WZ1A 4P2FA 2BW7A 1TL7B 4USWA 5D0GA 3MAAB 2GVZB 3G82A 5D15A 3C14A 4WPAA 1CULB 1FX4A 2QV6A 2GVDB 1CJVB 4WP3A 4CM2A 1CS4A 1Y11A 4CLYA 1Y10A 2W01A 5D0RA 1TL7A 4USTA 4CM0A 4CLLA 3C16B 3MAAA 4USUA 3C15B 4CLKA 3R5GA 2GVZA 3C15A 1CULA 1CJKB 1YBUA 4OZ3A 1CJKA
chains in the Genus database with same CATH superfamily
4U7CA 4OYPA 1G1XA 3TX8A 4F7VA 3UPFA 4RUBA 1TUGB 2YH1A 3IBFB 3R97A 3ISND 2ILYA 5LMNJ 3V4IB 2R9LA 3S6EA 3UVJB 3TA1A 2HQIA 3KLIA 2DEJA 3NOCA 2MGZB 1KEKA 4DR7J 1A6LA 3G4SS 1AT1B 2ZWOA 2CPDA 2LLZA 3EVOA 2CNOB 3A3OB 3LP1B 3ZTOA 5K8MA 4NLTA 1E6YB 3DU6A 3BS9A 3R9LA 2CQ2A 2ROGA 2BW2A 3KYLA 4AQYJ 5ETRA 1UFWA 1KTVA 2V9WA 3D68A 2WVBA 3CEDA 4C8KA 2Y0SD 1N36F 1FJCA 3GYXB 4BWMA 1NDCA 3U02A 4DV0J 2VQFJ 2BEFA 4ECWA 3RB4A 2OKQA 2GHPA 4UOGA 1RYRA 2D3ZA 2ZVIA 4JOUA 2P2CB 3J81j 3AOBA 3CDBA 2RMLA 5DGBA 3RGIA 3FUYA 1U0HB 1ELOA 1PC5A 1LWEB 4KGKA 3LP2B 3W9JA 2W2NP 4ID5B 1SPBP 4ZVGA 3W2WA 1KRPA 4DV2J 1SKUB 3PTWA 1VQKS 2YY3A 4DL7A 4F2RA 2AJ2A 4Q8FA 3WX4A 3ADAC 1S9EA 3F56A 2CFXA 2CQHA 2R7WA 3ZZRA 2CZ9A 2E44A 3M1VB 1UEUA 2YNFA 5KFDA 5HROB 2IRYA 3IG1B 1Y3KA 2KT5A 2EFGA 5L9XA 5KFHA 2CQ0A 3PNIA 3IO1A 4B3MJ 3UN3A 2P9CA 1H6KX 2D1CA 3OBIA 2QA4G 4LRBA 2ZZMA 2R8GA 2VPXB 3MECA 2ZUAA 4FN5A 2H9ZA 3TAMA 4M1KA 2HGNA 1B64A 4ZKAA 1DQ9A 1OQ3A 1RZMA 1DQ8A 2FJVA 4ZPAA 3JAMU 1Q8IA 4B3SF 1SUQA 3KJVB 4WIIA 5ETMA 3HI9A 1RWPB 5T7LA 4FBUA 1TKTB 3P5BP 3HK2A 4Q45A 2IDEA 1QVGR 1RT3A 2K7KA 4DV7J 1HFEL 2QLXA 1MG7A 3I5AA 2FUG9 2CQDA 4W98A 4ZIWA 4NLOA 1OY6A 5F3ZA 4GVBA 3AOCA 1VQNS 3IRXB 1UW4A 2M52A 4DCJB 3OUYA 4KQZA 2W4PA 4EFAC 4OX7A 3QO9B 3NP5A 5F8HA 4MK9A 1CEZA 3K58A 2YTCA 4F4YA 3JS9A 2E1RA 4A8SA 3CT9A 4PXDA 1LK7A 3OSPA 2HNZA 4QOTA 1O0PA 3KK1A 3D6FB 3FSYA 2OPQA 3ZZTA 3AAWB 1GTHA 1FD8A 2AMCB 4KAIA 4F3OA 4AL6A 3FBEA 4H4MA 4RW4B 4IOCQ 3H20A 1XERA 3L7PA 1AYEA 5DG8A 2MZJA 3M9MB 3NKYA 2KT2A 2Q66A 2KJWA 5F8IA 1VR6A 2B9YA 4KFBB 2HRTA 3T6BA 2XTJP 2J8AA 4YDXA 1HHTP 3FK4A 3H25A 1D3WA 2L48A 1WTBA 2E5LF 2COLA 2QSWA 1X7VA 4OZLA 4YR0A 4OV6A 1IBMJ 3ZXWA 1LW0A 1SH2A 1JLCA 3MI7X 3TQEA 4ZPCA 2VFTA 1I6JA 2I1RA 3G8SA 4Y2CA 2MZSA 3PRDA 3SEOA 5KG6A 2N7CA 1N56A 3I87A 4EZ6A 3M2VA 2B8PA 1BE4A 1VRUA 1FEHA 2ZH5A 1UFKA 2KFYA 4LSNA 1C4AA 2FIUA 4L3NA 5HAOA 1DTQA 5L1LA 1RBLA 3PJWA 4PYAA 2AW0A 4QU6A 3N6NA 4LF9F 3OL6A 1NJYA 2G1DA 2W2MP 2PN6A 3DGVA 1S1XB 2PDAA 5A8RB 2HW3A 4YY3F 3FSXA 1F3FA 4UOCA 2W24A 4R5PA 5HSPA 1B0PA 2XYHB 3TUZC 2CDQA 5LJ5Y 4FYVB 3C6UB 4JI5J 4PPZA 1LKZA 3UN5A 3RB6A 2PE8A 3SQGA 4V19X 3UDCA 2B4UA 4ES1A 1SXLA 1VOMA 4IQXA 3R1HA 1YJ9S 4C3KA 1JLFB 3SXLA 4JYAJ 3G6VA 4DEZA 5HBMA 5EGYA 2M70A 1FRKA 2Q79A 3CCZA 3GSDA 3H5SA 4A8WA 2W8LA 3LP0B 4J91A 4LRFA 5A0YB 2HSEB 4LBIA 4JI0F 3D1HA 3T1HF 2I5JB 3QZ8A 4U96A 3K8WA 3N6MA 2XMMA 4LMZA 1N6QB 4EUVA 3DOMB 1X8DA 3QYYA 3AA8A 2YX7A 1FFSB 2E9ZA 3EPIA 3K0JA 4ZN3A 2HQ3A 1S57A 1RHQB 1BC6A 4LFAF 4WXOA 4P7VA 2KL8A 4HT7A 3PR5B 2YQ1A 3Q89A 3A8KA 5KFEA 1RACB 1ROFA 3FC9A 3BGRA 3ZZZA 3M8SA 3B54A 2VIHA 2PSZA 1FEEA 1CG2A 4ZLPA 3RR7A 3VVUA 3IM8A 3KHLA 2HFOA 4WIQA 4LF6J 3SSRA 1RWKB 1VQ6S 4WZMA 3CIMA 4GMKA 2IM1A 1GEHA 4EBEA 4WP3A 4F50A 1SV5A 3OL9A 1PAUB 3B78A 3CMAS 2BABA 2FLLA 2JOQA 4IH5A 5A76A 2NXJA 4IRDA 3IS9B 4Z7CA 3P45B 4F3QA 2AJ4A 5CA5A 3QJJA 1N33F 5EWEA 3BPDA 3L3CA 1SKRA 5B08A 5J2MB 2W7AA 3IC1A 3O6QA 1RBOB 2ADBA 1EQ0A 3AH6A 3H98A 3PG9A 2HHTA 2XCAA 2C1EB 4K4VA 1FWLA 4FDFA 1QAYA 4F67A 1BQMA 1BQNB 4IG3A 2B7BB 3J7Z5 1U0SA 4EZ9A 2DH7A 3CW2C 4ELTA 1Y9OA 2ASJA 1Q78A 3CD5A 1AW0A 1T0TV 3IAS9 4P2FA 1SJ3P 1UVMA 1F5AA 5CYMA 1O6XA 1OYEA 4MK8A 1WI6A 1TK8A 1NJIT 1UTAA 4M5MA 3HFVA 3PRVA 3UO0A 4IFYA 1TL3A 3H5UA 3R5DA 3DDNA 4EBCA 4USIA 2C28A 2KG0A 3ZZ0A 4IOBA 4B3TF 3MFHA 3EWGA 2FVPA 2V0NA 5EWFA 2V34A 1YBUA 4NL5A 4ZJLA 2LU2A 2IHR1 2A2DA 2OPSB 5H1SV 3T5KA 3HJFA 1M5SA 4PRFA 1RA6A 5IOLA 1RWVB 2GMLA 4V1Ak 2CWKA 1KHVA 1RI7A 4U7UK 4X4NA 3H40A 2UVWA 3PO5A 4PEOA 3IR6B 2M5YA 3QATA 4NLQA 4URGA 2HZAA 2XSJA 4HL9A 4CO0A 3QRPA 3DLKB 2HG4A 4PPDA 3GV7B 1N0VC 2GMHA 4TU8A 4LRCA 4WU3A 3UD4P 3C6TA 5CXTA 5L46A 4USMA 2YKPA 2XG8A 1YJTA 2YWEA 3K57A 2H48B 2UUTA 4O4GB 1S9GB 1EP4B 4WK1A 3QT8A 1NBEB 2NXUA 4NE9C 4TU7A 3ZZUA 3MR5A 5J2PA 4ECYA 3A8JA 2RF2A 3BREA 3MMBB 1FXRA 5KTQA 2ZH1A 3NOGA 5I3UA 2CQCA 3FCHA 2IA0A 4NPOA 5DS7A 4C11A 1U2FA 3DOLB 4Y6IA 4PKDB 1HBOA 1VDHA 1SBRA 5G4DA 2UUAJ 2WBRA 3TA0A 4DG1A 2MKIA 1FRLA 3D3BJ 4DR6J 2HHPA 3BBBA 4K4UA 1ZPWX 4ZS6A 3TAPA 3MM7B 2K1RA 2F8HA 1RTHA 3LO3A 3PJ9A 5HJXA 2KG1A 2AEJA 1T95A 2IRUA 3NMAA 1IQZA 4EYIB 2BRKA 5IC6B 4DL0C 3HFKA 3ISZA 2XYPB 4G3IA 1Q81T 3JTNA 4ERDA 3MEDB 2ZM6J 3DCAA 2EC2A 5E5NA 4N47A 2ZJRQ 3OLAA 3PFOA 2C2DA 2APOA 3ETOA 2XY5A 3FBFA 1TL7A 4YB6A 4C3MA 5A2QY 2DY1A 2ZHAA 4K4XA 2IVFB 4JI1F 1IM4A 1VRQC 2P9EA 4RPFA 4LT6A 5GAGI 4QWDA 2GIQA 4IG0B 4AXJA 3HLUA 4OZ5A 1U47A 4WFXA 2B56A 4H4KC 4RWXA 1YBTA 1RLCL 1PJ6A 1IR2A 2C3UA 3GFHA 2DHSA 3AQPA 3MUTP 3NG8A 1Z1ZA 1Z2ZA 2DGXA 5LMNF 1GAOA 4XDDA 3W9HA 3A13A 1JLGB 4DCPB 2B6AB 1VC6A 1RT5B 3IAM9 1H72C 5KFVA 1AXQA 2B4OA 4CNZA 3WBZA 4DR7F 3PW4A 3DC2A 2J0XA 1OY8A 1HR0J 4C8ZA 2FGCA 3ZTQA 2BJ7A 3C46A 3CD7A 1S97A 5LXYA 4AQYF 4C0BA 4W92B 5SZTA 1MN7A 5KFJA 4G1QB 4ZLJA 3K2YA 4IDKB 2CAJA 4AT1B 5C42A 3JSBA 2HS4A 2HMIB 4DV0F 2VQFF 4ZVSB 1T05B 3HFZB 2EKYA 1S77D 1XWLA 2KVQE 4C3LA 1P9QC 1HNXF 4JI2J 5B0FA 3VZHA 3NNHA 2RU3A 4OYIA 4RW7B 2G2YA 3WC2A 3EE3A 5J1PA 3VTIA 1YGYA 3WIUA 3J7A1 1X4HA 3AJDA 2ZBIA 2JEIA 5C24A 1T03B 4MMOA 4DV2F 2DXDA 4C8NA 3GR1A 4PAAA 3M8YA 1S7HA 1WEYA 3HULA 2R42A 1MWQA 2IM2A 4KY3A 3F44A 2ZH3A 2GVDB 4ZPTR 4ZVEA 2CDRB 1S0OA 2ERRA 1S6QA 2AT1B 2EFVA 1UVLA 2UV8A 1NSPA 1HQUB 2M8HA 4ZVPB 2C2EA 2R8IA 1SVDA 5KFZA 1IKVA 1X4CA 3WHIA 1N5YA 3CJKA 1VC0A 3NNCA 3MTKA 5H9EK 2QSFA 5E0OA 4GVLA 4B3MF 1TUWA 2Y1JA 4EBDA 1S7IA 5DJBA 3KDNA 1T3OA 1UW9A 4M8LA 4CDIA 1CBKA 3EGVA 3A12A 3IWXA 1FNXH 2IJNA 3BGUA 4Y28C 1ZYQA 1P27B 2XHCA 3ZZOA 3G86A 4X4TA 2DYAA 2YKMB 1VBKA 2BYCA 4JI6F 3LWLA 5BYSA 4DUZJ 2ZKTA 4DLEA 1WDDA 3A3NB 4P73A 4DR5J 1R31A 2BQRA 1HBMA 3J7AN 1WEZA 1LW2B 2DIVA 1HPZB 2QA2A 3EXYA 1HW8A 3KXDA 4DR4J 1UEKA 1UWBB 2DGSA 9ATCB 3N01A 3TUPA 1F6TA 5B0GA 1VIXA 2BJ8A 2FY8A 4RZRA 2KFNA 3PYEA 4GRSA 1VQMS 1N48A 1MWZA 4DV7F 2YQ0A 2HZVA 1R0BG 1PYTA 4RUAA 2N4CA 4K8RA 2HVDA 3UCUP 1WHWA 2W4DA 3CVKA 3BF4A 2MKCA 3FEYB 2WONB 4KH0B 2F8EX 5K8PA 3O5TB 1X5TA 3IRWP 3CPWR 3CC7S 2NYIA 1ACMB 4QIGA 1URNA 4A8KA 2OMLA 1CJTB 4CI0B 2JEFA 2DCLA 3C16A 4ED6A 1HWLA 2GJ2A 3CXCR 1J5EF 4OI6A 1ZOTA 1VC5A 4TY8B 2B9XA 5ETPA 5EN1A 3CJ5A 2YWFA 3MCMA 3EYZA 3NCRA 5KT7A 4X4UA 4HKQA 1N5VA 4QQBA 4A8YA 3W65A 3AODA 5KFAA 3ET6A 3AY0A 1B99A 2XO6A 1QDUB 4LBPA 3UN2A 3MMCB 4QYZK 2ZEJA 3VGTA 2BQUA 1I3OB 1PBAA 1X4GA 4M5IA 4M94A 1XIQA 3H42A 2LEBA 1R6YA 2VG7A 5FLXY 3DM2A 4KKOA 4DI6A 2EK6A 3Q86A 2LEPA 1UVKA 2XMUA 5C25A 3BDPA 2Y8YA 4NLVA 1C0UB 4DXLA 3FQLA 3T5HA 3MPUB 3BEGB 4IYQA 1P1TA 1XEZA 4F0MA 4RO0A 1ULRA 3OPKA 1NZ8A 3VVTA 3TR5A 1U1MA 3TUIC 4A8XA 3M30A 4OYMA 1WUUA 1WEXA 2LEAA 2QLBB 4E8UA 1V3SA 5HO4A 3W66A 5H9EJ 3GTYX 2J7WA 2HHWA 1YRUA 1TUVA 4CIOA 2E1CA 4RWWA 3UCZP 2F8MA 1JLQA 5J1EA 3VGVA 5BR8F 2BJ1A 1TVRB 5F8JA 1H2UX 2RD5C 3O3LA 3KDOA 3OJUA 2HVHA 3M9NB 4K4TA 3KK2A 5HMXA 3ENVA 1F0XA 2HIQA 2Q6BA 2DCUB 4QU7A 5GAGU 2LMIA 3UD3P 3EGNA 2GCFA 1KQKA 4UZBA 2B5JB 2XLIA 1RAOA 4JI7J 2EI5A 5RUBA 2IAJB 2V6AA 5LL6d 2VZ9A 3ITHA 5H9FK 3TZZA 3MR2A 4JYAF 1O5JA 3MMAB 4J9PA 2FLNA 5ETLA 3IXQA 4RU2A 2O5DA 1C1BB 3HXMA 3GG0A 4B9SA 1OO0B 2XMAA 1T94A 4BHQA 2VL1A 1RT1A 4J9RA 4DFKA 3CB4A 2ZZTA 4WE1B 2ZH4A 2E1MC 2ZNYA 3BSOA 1NO8A 3E3XA 4ED3A 1RA7A 5HL7Q 4WWSA 4OLPA 2HRUA 2HHUA 1TP7A 3RW6A 3G6YA 2LXUA 3VWSA 5J2NA 4U9RA 2V8HA 2YNIB 1PILA 1M5VC 2W9BA 1JXEA 4M5JA 1S6UA 3DI6B 3HX9A 4XDCA 1WTFA 2FY1A 3KJNB 4QYZJ 3UQSA 2PA3A 1WF1A 3P96A 5DLGA 4X66J 3QO9A 1ZA1B 2YKQA 1H7XA 4CM0A 1XR5A 5DDOC 2C2MB 4LF6F 1F1BB 2CG8A 2WSFC 2BX6A 5F8LA 3V6DA 3KLIB 3M32A 2Y1IA 2V63A 1MMLA 1U1RA 3GJQB 2IIHA 1SI9A 2KI2A 4LF4J 2B0GA 3RR8A 2JEGA 4RNNA 1FE0A 3PDNA 1YJWS 5KG3A 3WC0A 1VS3A 3DRSB 2OPPA 2WVEA 2PA8D 1VJQA 2MJUA 4OJ3A 2MQNA 5KOWA 2R7VA 1X9WA 3PKMA 1F2GA 2ZH6A 3OTOF 1MROA 2F7VA 2CPJA 4P6QA 4YR3A 2IRXA 5KFOA 5KT3A 1TK0A 4QR1A 2D3OR 4B17A 3HDSA 3JSRA 1IWAA 3CJRA 4FPRA 3W2WB 2JX2A 1TZ0A 4I68A 2R7UA 5HMWA 1NDPA 1S9EB 3H2LA 5IWAJ 5I42A 3KWMA 2BJ9A 5H9FJ 2YNFB 1GXUA 2R3VA 4CLPA 3FFIA 2V8VA 1X9SA 2HNDA 2AV5A 4C8MA 3N0VA 4WJBA 1NDKA 2RUSA 4NCGB 3NS5A 2DIUA 3C3LA 4YFUA 3M8QA 1BD6A 3HM9A 4JI8F 1FTCA 3S7RA 3W60A 2RVJA 1RADB 2J76E 3UDLA 3FCVA 2NXEA 1EX8A 1DQAA 4ZP7A 5KFXA 2IMWP 2PI5A 4F04B 3POTA 1Q86T 1KNZA 2MZTA 4BS2A 4FF2A 4O3QA 2NXCA 5E3QA 1DZ5A 3MECB 4DR2J 3KLGA 5LMUJ 4WFAQ 1S9FA 5KG0A 2B9WA 2ZC4A 3TAMB 4LFBF 3HD2A 4J9VA 2ZUGA 4PABA 3W7BA 1FFWB 1YJUA 4O4RA 2R2SA 1OY9A 2HNYB 2AGPA 3W9IA 3RB3A 2HHQA 1SUQB 2LQ5A 3N5FA 4TQRA 5T7LB 3LP0A 1APSA 5A0YA 1WORA 3B82A 3K5OA 1Q5VA 5EX0A 1RT3B 3V2UC 1NK6A 2I5JA 1WOSA 3MR3A 2CWXA 3JYTA 4QYRA 2BDPA 2Y8WA 2AJ1A 1FWKA 5HN0A 4DBQA 4U95A 2UVUA 1YZ7A 4ZVOB 3JSYA 5DM7Q 4GVBB 4OHZA 2ZDPA 4P7TA 2JRSA 2KKHA 2UUAF 1XMQF 3OUYB 4I4BA 2DKOB 5D4LA 3M8RA 3BKUA 1VRTA 4OZ0A 4K2JA 5F0WA 2MLXA 3Q8SB 3CWJA 4CYUA 1S10A 2GFFA 2IPOB 1KFSA 2VG6A 5D4NA 3VAKA 2HNZB 3IFEA 2E9RX 1A9NB 2RAQA 3CDWA 3VAIA 1K9MT 3KK1B 2OPQB 3PX6A 3DRRB 2CJ9A 4H4MB 1P6TA 3BO4A 2FZGB 1RABB 3IS9A 3HHLD 2ZM6F 2KYXA 2FJAB 2CRLA 2RKIA 1ZBTA 1LFWA 2GQCA 1KQSR 1RHRB 1VLOA 1KR4A 4O3OA 1RU2A 4OYZA 2RQ4A 2ZH7A 2FHMA 3AT1B 2GHWA 3I0RA 4PWUA 4NXMJ 5IV4A 4KC5A 1LW0B 1JLCB 1KBRA 3BB5A 2FJDB 1BQNA 1VQYA 3T3FA 4Q0BA 5FLXU 5ITHA 2WCXA 5ETKA 2F9JA 2SXLA 4C9DA 3ILLA 3DDIA 3M2VB 4OV1A 1ZTWA 1VRUB 2XI3A 4LSNB 4ANCA 2ROEA 3KOAA 4ZHRA 3QGGA 1DTQB 4QW8A 3TARA 2E1PA 5FDLA 1WNEA 2RU9A 3TEHB 1HHSA 3BH6B 4IRKA 4PQAA 2P5VA 3FBCA 4K4WA 1YDLA 1IVZA 2DNPA 2MSTA 3MF5A 1JQGA 3BSAA 4R5PB 3HT0A 3BDEA 2E9TA 4MFBA 1RAJA 4J9SA 3V6HA 4KV8A 3GIIA 2AIRB 4DU7A 4FYXB 5KFSA 4ECRA 3UNGC 1X60A 3HJVA 4M5HA 3SQGB 2OTLS 2B8QA 4ZPVR 4A8OA 3AD8C 4OYBA 2D7SA 4ED7A 2OFHX 2ZHBA 1AZSA 4QWEA 4I56A 2A6MA 4OX8A 4ATNA 1R27B 1RT6A 5HBMB 5AE3A 1Y5LB 3SCJE 4R0JA 4JI2F 3PXGa 2DNGA 1TELA 3EDQB 3FRYA 4X4RA 5GVQA 4U8VA 3MM5B 3ZFVA 2QLFB 3OR2A 1EP4A 5I3PA 4NLPA 3TVYA 4DSFA 3H5YA 2MY8A 1TKZA 1SJ1A 2RHSB 5HVGA 1VFJA 3N6LA 1X0FA 4TYBA 2C42A 1YJNS 3SMZA 3PIPQ 2CQPA 1XNQJ 3TA2A 3FCWA 1EIYB 2IVYA 2GS8A 3OR1A 2VV5A 2HQGA 1VBZA 4F02A 2R7QA 2HRYA 4J9OA 1RKJA 1Q5YA 3RAQA 3BGRB 4ED4A 1RAGB 2KZZA 4K0KF 1S79A 1R8AA 2CQBA 4LF5J 4HDGA 3TEGA 1F2HA 3LF0A 2DISA 1I94J 2R7RA 1JLEA 2DR7A 1T9YA 4O3SA 5B0CA 2RQKA 4K50A 2C2ZB 2VPYB 4NEZA 4B02A 1ZZNA 1SV5B 1X4EA 2ZBPA 3QRRA 3J81Y 3GIKA 4CO5A 5DZ6A 2GIFA 4C4WA 5CD4H 4K5SA 4KBIA 3V6JA 1RTJA 2BV3A 4HTJA 3AHPA 1FX4A 3VV2B 4DSKA 5LT5A 4HHUA 3DFEA 1N88A 5DDRC 3QAEA 3NBPA 3T5LA 2AWZA 2M8DB 2E5LJ 4TNOA 4L73A 4USTA 4RKUC 4NZ7A 2BA9A 1VJWA 4AL5A 3VALA 9RUBA 1BQMB 4IG3B 2D9PA 4RUHA 4M5GA 7FD1A 3EUNA 1WD6A 5K14A 3CULA 3OFHA 1PCAA 3PVXA 4WU2A 1B4SA 4RW8A 2IJRA 1IM6A 2HLTA 2HVZA 3OVBA 3NWGA 2Z8QA 5KAKA 2G9OA 1FK9A 1NRKA 1CJUA 3MR7A 2KVIA 1O8BA 3GJRB 2Z2YB 5CYMB 4OYWA 4WKRA 2WSEC 5BXIA 4ES2A 1LOUA 3W63A 1DBDA 4IFYB 1TL3B 3IR7B 1IWGA 1JLGA 1VQ4S 2HAIA 3CUNA 2BW7A 1URRA 4RUCA 3NS6A 4MIWA 1YSJA 3Q8RB 2AF6A 3SSSA 1YQHA 1CC7A 4PXCA 1M1HA 1FRXA 1UMJA 2DJWA 3RRGA 1NEEA 2HWTA 2FDNA 5J2QB 1FFGB 1I51B 3OVAA 2N3OA 1MW7A 2ZD1B 1GMWD 2XSJB 1DJ0A 1RU1A 2CNKB 1FXLA 1RKIA 3NNAA 3DLGA 2YWGA 1NCLA 2OEJA 2LVWA 2QFIA 3C6TB 6AT1B 3DLHA 3US5A 4J9UE 2OH2A 1Y5IB 1FE4A 4X84A 3QT7A 5M2UA 2F1FA 3K5LA 3RBEA 4ZJQA 2E5HA 1K0VA 4FYYB 4CO4A 3FMBA 5T41A 1SIZA 4LSZB 2DO0A 4X65F 2XMVA 4WK3A 5J2PB 3TX0A 5DLFA 2FB0A 3EZUA 2RF2B 7FDRA 1XC9A 4YHHJ 4DN0A 5I3UB 3DYAA 3MURP 2OSQA 2NZCA 2OD4A 4C11B 3QT6A 1HBOB 3SCIE 1RWXB 2DK2A 4LFAJ 3FQKA 4CTAA 4DUYF 3IGVA 3O44A 1AROP 2FLOA 3CCUS 2L9NA 4DG1B 3GLJA 4M5DB 2PI4A 2N4DA 2B4PA 4PQUA 3HHLA 1S99A 1S6OA 3NS7B 1FDDA 2HKEA 1NJWA 2XB2D 1FNMA 4I67A 1FNOA 4FXDA 5KFLA 2VICA 3JXOA 2VA3A 5K8OA 5JUMA 2QGFB 5GAHI 1G4CA 2HQFA 2YKMA 1F60B 4ECUA 2DEIA 4CLTA 2IA6A 1D09B 4J5OA 1RCXB 3JQKA 2FZKB 3J80Y 3FVYA 5KOXA 2GJIA 2GZOA 1W2BR 2MQOA 1U2RA 4OJHA 1HPZA 4OI2A 2W7OA 1HIYA 2EW9A 1TL7B 2DNYA 5EWGA 3PW5A 2J8SA 3GV5B 1NAQA 2XS2A 3CCMS 3DLLQ 4Q2MA 2Z30B 5CZVA 3NXZA 2G13A 1AUSL 3G8QA 3P49B 2V67A 1X5OA 1UETA 2RRBA 1YBAA 2BACA 2GO8A 2E1AA 1RWWB 2IY5B 2GGPA 4QIFA 5HVFA 1W7WA 4CLZA 1S1VA 3CGIA 4X66F 4XAKA 1RJJA 1JNZB 1P1LA 1OSDA 3GU0A 1JWWA 1Y0HA 2VASA 2LDYA 4K7QA 2X1GA 3MWBA 1NKBA 4OX9F 3ZZPA 2BUNA 2J6TA 4WFNQ 4PWDA 5AE1A 4B3TJ 4NA1A 2AGOA 4MTPA 1U1QA 1RT2A 4ZN1A 1YRXA 5IQQA 3ICLA 5CYQA 4UTGA 5GMEA 2HHSA 2X51A 4DHVA 4LF4F 2GAHC 5KG1A 3LAMA 2WAQD 2DVIA 2FD2A 1MN9A 3WQPA 4NLWA 2HHXA 4TKTA 5C42B 4LJMA 1WACA 3ILJA 2MSSA 5EHHA 4OJGA 1L5UA 2DNRA 3DXBA 4J9QA 2DNZA 1HARA 1PO6A 2HFNA 3N79A 5SUHA 5EDWA 3CCRS 3ILIA 3G87A 3KG1A 4X62F 1WC3A 4I6WA 1R43A 3VAGA 5C24B 4K59A 3JB9k 1SJRA 3L95X 4HYKA 4C2MA 4UUXA 4IO1A 2AP6A 4RR5A 5K5MA 2F9DA 1FJEB 4USKA 1H7WA 2NPFA 1QTNB 2AGQA 2UUCJ 5IWAF 2DHXA 3R5AA 3TP2A 4Q2LA 2Z4PA 3CO0P 1S6QB 5F8NA 4JV2A 4ILRA 4YS2A 4LIRA 5D77A 2MLYA 1IR1A 1M1GA 5DQHA 1IKVB 3KUGA 4ILMA 2HYIB 1N5YB 3LW5C 2RHQB 3CJKB 2DR6A 4KH1B 1NSAA 3QIPA 1PYOB 2CJYB 3BGOP 3RJMB 2MKSA 2F4FA 2GVZA 5E41A 2HBZB 3MCSA 2HURA 2L08A 1NKCA 5LMUF 4YQWA 3NCPA 1B0TA 3MMAA 2C3YA 1UAWA 3M6VA 3J81U 1HBMB 5ETOA 2QN6B 4QIEA 4F0HA 4C8LA 3KLEB 1JKHB 4O44A 2BMBA 1VI7A 3CCTA 4ZIVA 3NY0A 1RHMB 1RE1B 4DV4J 4JI1J 4Y0FA 3TJAA 3AXMA 1JJ2R 1QAJA 3KG4A 1VCTA 5KFTA 2G2OA 3KHRA 1ZM3A 2VKZG 4N7TA 4X64J 3DRXA 3KKFA 3A1YG 4DS4A 4HH0A 5LSRA 3DI6A 3S01A 2C22A 2DO4A 2UVVA 4NLYA 3TOQA 2BJEA 2PMHA 2P9GA 3QFWA 2M7SA 3C16B 1U6ZA 3RTVA 2G4BA 1N8RT 2IC3A 1DFDA 1Y5NB 3DXSX 1YI2S 4G1PA 1F5BA 3W64A 4FPIA 3SYZA 1WKJA 1LFPA 2V8PA 4ECTA 4P2XA 1RISA 3ET6B 1GMWA 2BVZA 2MPUA 1FRIA 1W25A 3I4PA 3T9ZA 4F0KA 1YWXA 2EPIA 3VQSA 4CO2A 1SB6A 4ED2A 2VG7B 4KYZA 3DM2B 4KKOB 2MMYA 4NXMF 1RGVA 4CWBA 4B9NA 1TKXA 3DRSA 3OV7A 3H2VE 3N4WA 5C25B 1Q53A 2X1FA 3OQ2A 5E2QA 2RILA 4Q43A 3R2CJ 4J37A 3J7ZT 1HNXJ 2KXNB 2QC3A 2OUGA 4YB7A 1YJRA 3QIDA 5KFCA 3M30B 2KRRA 4C48A 1W26A 5GAHU 2R7SA 4USUA 2R7TA 2ZVSA 2XY6A 3I56S 2ZHOA 2Y9HA 2J5AA 1JLQB 3PX4A 2FVCA 3TJ9A 5J1EB 4ED0A 2QG9B 1GXTA 2DGTA 4YUDA 4DCOB 1VQLS 3KJFB 1WC6A 4RNFA 5F41A 3D54A 3KK2B 3JSMA 1U24A 3OHAA 2EFNA 2LXFA 4ZVFA 3RUBL 4NCGA 2JZ5A 2GIRA 1ITPA 3QLHA 1GX6A 1FO1A 1T9UA 2AJQA 3HF5A 3OXFA 2CJAA 1UVIA 2RS8A 3OSNA 2BBEA 5KFMA 4KGXB 1NDLA 1RQ0A 4GO7X 2VONA 3ITHB 3DLEA 1KDNA 3E01A 4I69A 4WFYA 3TQ1A 4JI6J 4ZLNA 1IKWB 1X5SA 1H74A 4IOAQ 5HJYA 2HK2A 2FTRA 2HNYA 1RT1B 2VJVA 4I6YA 1YITS 3PKYA 1AFJA 3PM9A 3RBXA 2AD9A 2I2YA 2WTFA 1G2EA 2KHDA 3KLFB 2RNEA 2RB7A 4F4XA 1S49A 2JDJA 3TWZA 1XNQF 5D6GA 3PJXA 5J2NB 2RDDA 2ZKUA 5ETTA 4CLSA 2HVIA 1BMQB 2QMXA 1N0UA 4DQIA 2WVDA 3BYPA 1JK9B 2W9BB 2LP4A 3R5JB 4BDPA 2RJZA 4UF4A 3I5BA 3KMSA 1S0VA 4NX9A 3D9BA 2RDIA 1Q0NA 2W2QP 4EK2A 4HACA 5CZXA 2R2RA 2D41A 1H73A 4U6PA 3THPA 4LF5F 1U25A 2BANA 3CJ8A 4DL2A 3DKDA 4OZJA 1I94F 1HA1A 2LYVA 2WB1D 4LR9A 2VG5A 2Z58B 4L3KA 1G6BA 2OTJS 1IJFB 2DRDA 3V6DB 2HGMA 5CQGA 2ACYA 1T11A 3M32B 1J5EJ 2DBBA 4ICLA 4XTTA 3U1LA 4CM2A 3PV8A 4ZJOA 4TVAB 3DRRA 3I4HX 1S12A 1RAHB 3GR0A 4CZCA 3MD1A 1NB7A 1UVNA 4NWBA 3HCXA 4ZVHA 2MZRA 4DFMA 2GQQA 2JEJA 4B9LA 2VFRA 5D0HA 2QZ8A 2EEYA 2HEKA 1PKUA 5AXNA 3P4UB 2OPPB 1NPKA 3TI0A 5C2CA 2J9DE 4OQJA 3VGUA 2V9KA 3FZ2A 3BJYA 2ZJQQ 1MROB 1NXIA 2EFOA 3PO4A 4WKYA 3D4JA 3R1LA 4Z2XA 1J2VA 4Y2IA 4X4VA 1DLOA 2H5IB 4UW2A 3H5XA 2XYGB 1KHWA 2WZ1A 1S1UA 2MJNA 1TQLA 3DDKA 1G3OA 5IQ6A 2R8KA 1RWMB 3MOJB 1H3DA 2VDIA 4KHPJ 2ZBRA 2XEXA 4DPTA 1WKLA 3A3PB 1H38A 2BKPA 2GV1A 2EFPA 4OL8A 3U7JA 4M5LA 5I42B 4WZQA 5BR8J 3KMQA 3S1TA 1XQIA 4NEYA 3FFIB 5GAEI 3A8IA 2HNDB 3PYDA 1N34J 4ELUA 1FESA 5ETVA 2X7IA 4EO8A 4DSLA 3HHKA 4DV3J 3M8QB 1RUSA 3CCVS 1FKAF 1T9VA 1UJ4A 3POTB 4DX7A 4LR7A 2WW4A 3KLGB 1QTMA 4B3RJ 2QMUB 3G6XA 3CSKA 3Q2TC 3NAHA 5KFIA 2OAUA 1T9TA 4X4QA 5HVHA 3HSDA 5G0RA 1FJ7A 2AYMA 3W5XA 2VFSA 3MM5A 5KG4A 3MPDA 2VH7A 5HQMA 2YKOA 2RS2A 2ZBQA 3IMQJ 3JYTB 4YHHF 3SV3A 4ZK7M 4Q44A 4EU0A 4CQ1A 5DG9A 4ETZA 2GMJA 3M8ZA 3CD6S 1X9MA 4IFVB 7AT1B 1O51A 2DPIA 2CVIA 1SQGA 1VRTB 3TUJC 1N54B 3DNCA 4DV6F 1HYSA 2MTLA 3FKBA 4AE5A 3GSIA 4CO1A 3MPWA 1OQ6A 4CYUB 2A3JA 4NRTA 4FS1A 3UNYA 4DR3J 1OWXA 5LM7E 1IBLJ 3RAXA 2VG6B 1BHNA 5JMNA 2M3DA 4MAKA 5LJ3Y 2IFXA 5HP1A 1HLWA 2Z2MA 5KFBA 3OL8A 4ZVQB 3OXGA 4A46A 1TFYA 3PX0A 4YB5A 4P2SA 1IXKA 4PYDA 4PCQA 2XMJA 2RKIB 5L8RC 2HBYB 5MLCV 1YKWA 2BE7D 2Y3YA 5GMDA 3NMRA 2BM1A 1KC8T 1NLKL 2HFVA 3DN9A 3I0RB 4WXWA 4DFPA 3D1OA 4KO0A 4NA3A 3GB0A 4LRDA 1HD0A 1RDRA 1Y3JA 1J5OA 3QGHA 4J90A 4Q0BB 3J7YI 2FC9A 5KFGA 1EZZB 5I3QA 2XMKA 4UUWA 3VZIA 4F3MA 3PW0A 3ZNUA 2Q3PA 1WOOA 3OTOJ 4F4AA 1GT8A 1BLUA 1NSQA 3ZO7A 3BO3A 1R0AA 1TAUA 2J0WA 2D74B 4OHYA 2DHGA 1SL2A 2Z2ZA 3IP0A 4DV1J 2DR5A 4ZHRB 2UUWA 1QE1B 4TY9A 3KUEA 1KWMA 5DG7A 5FDLB 1AB8A 4P2MA 2H65B 2QL7B 3SIPB 4QW9A 1HNIA 1YJVA 4U67Q 1VQ5S 3MMJA 1U8SA 1LWXA 1S0NA 4A4JA 1VBYA 4JB8B 4QWBA 3GONA 2LCWA 4ANDA 5L1KA 5D4OA 4UZCA 4QWCA 4MFBB 4KV8B 3G96A 2K3IA 2AYBA 3QFHA 2OLWA 1YRTA 5AXMA 2KM8C 1DARA 4JI8J 2UXCJ 2CZVC 1FDNA 4DPOA 1LEOA 5J2QA 1JLAA 1VHFA 2HQCA 2X3GA 4N8NA 2I9SA 4F26A 1AZSB 2OEKA 4HHJA 1YHQS 2ZD1A 1VGYA 3HKZD 1Q1KA 3CCJS 3ENQA 1E6VB 2CQIA 3D0IE 5BYRA 1RT6B 4LFBJ 2CPIA 1JJCB 4LVNP 2A18A 1DTTA 1FRMA 3HHLC 2CJXB 2XC9A 3OR2B 4FBTA 3Q23A 4C8OA 2IDLA 1RB0A 1TKZB 2NS1B 1RT4A 2U2FA 4QPTA 4HI2A 5KG7A 4ITSA 2UUCF 3Q83A 3CJSA 4BC9A 3U1NA 4I1TA 3ZZYA 4G65A 1HW9A 2E5GA 2PGCA 1G7CB 4O3NA 5D3GA 3OR1B 3QT5A 3C66A 1FHTA 3BR9A 1XMQJ 2ATCB 2BOAA 3NLCA 4RLEA 1XMOJ 2HZCA 4M5DA 2MKKA 4Y2AA 1WHVA 3TNVA 3KLVA 4XPEA 5JVHQ 2NZ4A 1JLEB 3NGRA 3N28A 3HVWA 3O1LA 5F9LA 5AE2A 2AYGA 1ZS6A 1KOOA 1XN9A 5CD4A 2PC6A 2Z56B 4CRJA 4PG5A 3VCDA 4FVCA 2H5JB 2VFUA 3T5JA 2DR9A 4USVA 1QY7A 1CQMA 1SCJB 1RTJB 1RK8A 4KSEB 2CZ4A 4UQGA 1K1SA 4X2BA 2XZDB 1AFIA 2ZH2A 4RNMA 3NBPB 1U26A 2YKAA 2I8EA 5GAEU 3DLBA 1NU4A 2JNJA 4IH7A 2DD8S 4DV4F 2XBPA 2QYCA 1OS5A 5GADI 3TZWA 2POKA 2OPRA 3K5MA 1M5PC 1UPPA 3CNQP 4DJBA 2JC0A 2CPFA 5K14B 3GJTB 2ROPA 1R0CB 3HZEA 5E3CA 4X64F 3NL0A 4QPXA 3GE9A 4CLLA 3QJLA 3TZYA 4RW8B 3RZAA 1LXJA 3K89A 4KRWA 5HLFA 3SQOP 1FK9B 2RSQA 2EKNA 1CJUB 3HSJA 1RWOB 3GFZA 2F5GA 2H51B 3DRPA 4L74A 1LWFA 2KU7A 1NJXA 2HVEA 2EG1A 2PFDA 5CHCB 1T7PA 3SV4A 4F2SA 2CJBA 5E7OB 2J9EA 2XM3A 5K20B 1FRHA 2UVRA 3I9V9 2XHWA 3AXKA 3ULHA 1XNRJ 1B70B 4ETXA 3I55S 2BKOA 2OEMA 4CT8A 3EGWB 4HHHA 5L39A 2P8IA 2V4JB 5E3RA 4LQ9A 2MDAA 2VD3A 2XO7A 4PR6A 3DLGB 4KGVB 1WG5A 1GQEA 2MQQA 3FDSA 3R6LB 3RRHA 1X5PA 4KHMA 2PMWA 1CJVA 2YX1A 3H7HB 1MU2A 3KFWX 1SJ4P 1SH0A 4DL3A 8AT1B 1WC0A 3M8PA 1EKSA 1GFWB 2RIJA 1HI0P 3QJPA 3TVZA 2XMWA 1LWCA 3DMJA 3CCQS 2DR8A 2KM8B 1Q4RA 3DYAB 1KS2A 5C5JA 3GYNA 2R7OA 2XZWA 2VPWB 2QE5A 2LU1A 5B0AA 1T02A 4CTAB 1S1TA 2LQ8A 5AJ3J 2KO1A 4DSIA 2DNMA 2JVOA 1T3NA 3NAIA 2NSCA 4DN9A 4K0KJ 3J7YU 4XPCA 4PQUB 1HNVA 3HHLB 2VA2A 5THWA 2C3OA 3T1AA 3MUVP 3HVTA 1D9DA 3K8VA 2HQDA 4JBCA 1LQ9A 1A0OB 4WTOB 1J27A 1CJKB 3MR6A 5HI7A 5L9NA 3W3SA 5LXRA 2VFVA 3E2EA 2AU0A 3GYGA 3LANA 2DHAA 2OMOA 5CABA 3V81A 5I4MA 3MEEA 3M2UA 3HVAA 5CYJA 4MYTA 1HMVA 5AT1B 2XNRA 4I2PA 3KLEA 2C2KB 1JKHA 2M2BA 5KT6A 1ZM2A 1ZM4A 3MPYA 5D0EA 1CLFA 1ZAWA 3GILA 4N76A 1TL5A 4O3PA 4LIWA 5U47A 2JFKA 1NJZA 1JLBB 2EC0A 2CQGA 1JMTA 2VBYA 5IFMA 1XR6A 2OIHA 4DZDA 2F40A 2VU5A 2GGPB 1U7LA 4O23A 4USHA 2OP5A 3O8WA 1T9WA 4KIAA 1S1VB 4N8OA 2IM3A 3QGPA 1UCNA 3IWNC 3A4TA 4ZCMA 4GKKF 2KYZA 3SI8A 1FKPA 2KN4A 3EX7B 4J9MA 3CTRA 2W1BA 2VB6A 5KFUA 2W4CA 1FVSA 1HNZF 1D1UA 2K06A 4PWDB 3GPAA 1YK9A 2MLZA 3LAKA 3P5TL 2YNHB 3KLHB 1FERA 1RT2B 2CKWA 3L4BC 1QAIA 4PXBA 1VHIA 5CYQB 2DNLA 3VAMA 4WF9Q 1YVFA 4ZOSA 4JV1A 3W2VA 2JFDA 2O66A 4EWTA 2KB2A 2NSBA 3D67A 1NPPA 2HWHA 3PHEA 2CUYA 1EARA 4C0HA 1AUDA 2Y0BB 4FP9A 2VQEJ 3RYLA 1V9OA 2ZITA 2G0IA 3PEJA 4ED1A 4NCAA 1V5VA 1YLXA 3PRBA 3R5BA 1X0PA 3PHTA 5F9NA 2DT9A 5F0UA 3MAHA 3V4MA 1B3TA 2MB0B 1Y11A 3T9NA 3LA0A 5E33A 1CVJA 2P6SA 1K0TA 1TV6B 1HBNA 2QMWA 4X4OA 3MPVA 4X65J 4ALZA 3DOKB 4KHPF 5ETNA 2QO3A 1NK9A 3IGNA 2FHJD 4K4YA 1X4AA 4UY85 2OO4A 1OPIA 3GFYA 1U4BA 4IUFA 2KH9A 2C3MA 3FNNA 3UD5A 2J7UA 4DUYJ 1N34F 2MHNA 5KT2A 4CP5A 2IMOA 1WDTA 2XLKA 3FMWA 5GADU 3C19A 4DV3F 5B0BA 2HWIA 4IR1A 1UJ5A 2ILZA 4NCBA 3QIPB 5CCMA 1FJGJ 3GIMA 2XS5A 4RW6A 2GVZB 5KFPA 3SCLE 4EO6A 4C97A 4B3RF 1GH8A 3FGVA 3FBBA 3R7BB 1JIHA 5A6WA 2V68A 3PY8A 1IKWA 2JVRA 1Q7LB 2YNGA 3MAAA 3E51A 1N5QA 2F3JA 2OELA 3SSQA 1WC5A 1YIJS 4O44B 2L41A 1WI8A 4ZMMA 3IBWA 2YXLA 3Q8UA 4IQMA 4ZLLA 1VQSA 3KLFA 3QPIA 4NMXA 3ZTPA 2XLJA 3M05A 3CIZA 2V4QA 3TAQA 1FDBA 5A2QU 4HVZA 4PG7A 3A8EA 1U1NA 1V3RA 4W90B 1Q8BA 2V94A 3KUHA 1XTZA 3GZ7A 3O2IA 1QUVA 2JWNA 2IVMA 2BE2A 3CJ4A 3I6PA 3SCKE 2HBRB 3TW0A 4DR3F 1FTRA 1RAFB 2R7XA 4ECXA 1IBLF 1NK5A 3MCNA 2IC3B 4WPAA 4IO9Q 4KTQA 3MEGA 3GCWP 4DF8A 1NH7A 3GJSB 2JL9A 4OX9J 4DQSA 1A7GE 4PUOA 3TO8A 4M95A 2JLEA 1IN0A 4X4PA 3M8WA 1UZDA 3R27A 3BN4A 4CH0S 3M6XA 4N5SA 4TQSA 3CDUA 3KG0A 3UR0A 3HHEA 4YB1P 1TKXB 3QAUA 3LOUA 4OZ1A 2HHHF 4WYLA 1L3KA 2XWYA 3WDOA 4O0NA 4FYWB 2DGVA 1F9FA 2E66A 2CJKA 4QR2A 1VK8A 3L9ZA 2FPHX 1KOHA 4B9UA 1VISA 4MYUA 4PWWA 3UW1A 3JTOA 1S4FA 2BM0A 4X62J 1NK8A 3FEZA 1QD1A 1C1CA 4DV1F 2AHOB 2NREA 3W5ZA 4DU8A 2W9AA 2WVCA 2R8JA 2FHOB 3OVSA 2YKNA 3ILOA 2OJ3A 1HBUA 4JI4F 1TR0A 4DLGA 4LUBA 4PG8A 4LREA 2AJFE 4ECVA 2W01A 1FT8A 3H59A 1WG1A 1UEVA 5MAOA 3QWUA 4OI0A 1JXVA 3R6GB 1IJEB 2BOPA 4ER8A 3KHHA 3JSMB 4JI3F 4DPXA 1HNWF 4DUTA 5DGAA 1KN6A 4BLGA 2L9WA 3C8YA 4CO3A 3QLHB 4DZ6A 1RTZA 3HD1A 2I6WA 1YG0A 2UXCF 4KHRA 1RWNB 4NASA 4OYAA 5DDPC 3BN7A 1R89A 1N32J 4I64A 4RW9A 1GMVA 1IKXB 1KONA 2H4YB 3DLEB 1HI8A 2FJBB 3E01B 3TANA 3CC4S 2DNQA 4OHWA 3BKTA 4R8UA 3BBCA 5KFRA 3CCWA 3EDRB 3OTBA 4OLOA 4JV5F 2FJWA 3F41A 2F65A 1DY3A 5EX3A 2UP1A 2QX0A 4LF8J 2G1HA 2OI2A 4AD6A 1SJFA 2ZOGA 4OZNA 3HKWA 5FD1A 4ZPWR 2KDOA 3L7UA 1FD2A 1P8GA 3CDEA 4DQQA 3OTCA 2DB1A 2QYGA 4IFVA 2R4FA 3UDEA 2DGQA 3KHGA 1UVJA 3QQCD 4HACB 4DSEA 1SC3B 1XMOF 3DHWC 4D3HA 4NXNF 2BANB 3OT9A 5KT4A 2G2ZA 2XULA 4HH1A 2VG5B 3PW2A 3D6TB 2PEHA 2RQCA 5B09A 2HIYA 2AYEA 4ICLB 3D7SB 1MNEA 2F63A 2VC1A 4AL7A 3OW2R 1FCAA 2PMZD 4EI2A 3C14A 1NK4A 1H2VZ 5FJ4A 4QJVA 4Y2MA 1WG4A 2DY9A 5KFNA 1REVA 2CPYA 4NYPA 3K7RA 4B3OA 1Y10A 2A1BA 2QRRA 3UE2A 1EHWA 5BJRA 2ALYB 2K7JA 3W62A 2C3PA 1D0EA 2ZWPA 4YR2A 1ZZFA 3BSNA 3THVA 2H5EA 4I2QA 1R8BA 2V2KA 1S6PA 5F3TA 2FHJA 4Z7YA 6FDRA 4L75A 4OFZA 1JJ4A 2UUBJ 1U49A 1DLOB 3H2UB 3X3UA 1U2CA 4CNYA 1FKOA 2CVEA 1SL1A 2FLPA 1TAQA 4FXVA 4IRCA 1S1UB 2N3LA 2HLUA 2WOMA 1S76D 4LBHA 1ZAVA 1RTDA 1QE1A 4RL1A 8RUCA 2PIIA 2J9DA 4FKXA 5IZHA 1XK8A 3RU0A 1C0TA 2XZTB 3DHXA 4LFCF 3N9UC 3KTQA 3ZTRA 2VJUA 1LXNA 3CJQA 1WKKA 1Q16B 1KLMA 2UXDJ 2UZAA 3ONQA 1L3SA 1RT7A 2XNQA 2CPXA 1XNRF 4EEYA 4IKAA 4AFFA 2ZE2A 4EGLA 3AJ2A 5DO2A 4NZ6A 4TU9A 3OD2A 1ICEB 1Q8KA 3I82A 3PCOB 1VIOA 4DX5A 2H1YA 4CH7A 2YBVA 3QSYB 3QGIA 1Q95G 1E6VA 3I0SA 4I7FA 1WHYA 3F73A 1EETA 2ALZA 2HHVA 2RE1A 4NI2A 5G0RB 3D3CJ 4Q7AA 2R2UA 1FI4A 4FYDA 4NLSA 4B9VA 2F4VF 3ENAA 5A8WB 5KFFA 4LSLA 1TKDA 4DPYA 1B7FA 1M0SA 1EJ7L 1TL1A 1KQFB 3HSZA 3RBDA 1PG5B 2V5HG 2IBKA 1M5KC 4P9SA 3HHDA 3G82A 5L1JA 2LDIA 2DH8A 2M88A 1I1GA 4ECSA 4JV0A 1CS4A 2AKWB 2V2VA 3UR3C 5AJ3F 1PJ5A 3K5PA 5IM0A 4CLKA 1HYSB 2QL5B 2QFJA 1NHUA 4G6VB 1R6VA 1CULA 2YVSA 5EUHA 2RH3A 2GNKA 5AXKA 2PD1A 2Z0GA 5HP1B 1RHJB 2W9CA 4N41A 1BUXA 3SDEA 1HQEB 1RHKB 1MMNA 3P6YC 3HHNB 4QWAA 4KPYA 4L72B 2D9OA 4H54A 2LQ9A 2EBGA 2KZMA 2DGUA 4V19J 1QSYA 4WP8A 1IKYA 2MZ1A 3CC2S 1PJ7A 1RAEB 1ZTTA 4A48A 4C8YA 4YEAA 1NB2A 1JNRB 3VR1A 4USWA 5LOQA 1R8CA 4KO0B 4A8MP 2P6TA 3G2XA 4DPUA 3T1YJ 4Y34A 1RAIB 1J5OB 1LK5A 3NGDA 1RLDA 3HPOA 1TFWA 4NZ0A 5D4PA 3GIJA 5A8KA 2FJXA 5IXUA 2IM0A 2KFZA 4KE5A 4FF1A 3OXLA 2E29A 3OHBA 1R0AB 1R3NA 2NR0A 3BQ2A 1VQ7S 2AZ1A 1ZPVA 2ZNZA 3BPSP 4NLXA 1X4BA 1N5TA 2ADCA 4LF1A 5M2RA 3QSIA 3MTJA 1R7IA 3M2RA 2W25A 2W2OP 3AFGA 1HNIB 1F9HA 3SFUA 4GC6A 4A8QA 1D8ZA 2O01C 5KFKA 3VGSA 3GP9A 3JTPA 3L7OA 4H4OA 2AZ3A 3AQOA 1Y7PA 4G1IA 5KG5A 4I0WA 2WHOA 2B3TB 3K17A 4GKJJ 4FKYA 4HLBA 2XWXA 2MXYA 3I31A 4UOHA 2C2NA 4HR2A 5ETSA 4MKYA 3MM6A 2QV6A 3LTOA 5HANA 1SC1B 1JLAB 1V6HA 2V4JA 2KRBA 2UU9J 2VQEF 2Z2LA 1VLYA 2BJDA 2MZQA 3MM9B 3N5BA 5HMZA 1DTTB 1Q7YT 5L1IA 4ZVRB 1UP1A 4NYOA 1F5CA 2UXBJ 3PW7A 3FZBA 4RJVA 1UFLA 1UWAA 1RT4B 1T8EA 1BWVA 2RT3A 4OI1A 3MM8A 4X4SA 2ABYA 4DQPA 1BQXA 2YPZA 4WTYA 1RAAB 4BBYA 4LF7J 1R8PA 4OYOA 1JX4A 3NGTA 3ELHA 1SKSA 2H4WB 2JC1A 4ENOA 2GQ2A 5IV3A 5D3GB 2BZ2A 1H98A 3V4IA 3IM9A 4FZVA 3W61A 4BC7A 3UVJA 3HT3A 1GMUA 4FNIA 5KFWA 3MUMP 2MGZA 2VHGA 4ZCLA 1GXLA 5J1NA 4DV6J 2R2TA 1QJHA 3D6MB 3L09A 2VC0A 1FXDA 3WZ0A 3CJ0A 3EVWA 3LP1A 1U6BA 2CYYA 1E6YA 3IA0A 4J9NA 4UOFA 1FJGF 5HQLA 4MKAA 3H0PA 1S1WB 1XMBA 3C15B 3H90A 3QWPA 3NGKA 4HT5A 3PYFA 3ZTSA 4WYWA 4W4MA 1CJKA 3M7VA 1U1KA 2B9EA 2NQPA 2WVFA 1IBMF 1GNKA 3TVKA 3S8SA 4E2FB 1IBKJ 3H8YA 2FVQA 2G0CA 2GA7A 3KK3B 2R8HA 1MWYA 2ASYA 4J9KA 4DR1J 1NK7A 4P75A 3RAMA 4TLRA 2HGLA 4K5RA 4QBUA 3OFGA 4DX8H 1U0HA 2VBWA 1I5OB 1LWEA 2PT0A 3LP2A 1T9XA 2OPRB 5F8MA 4ID5A 4NA2A 3UI3A 1JLBA 4K4ZA 5KFYA 1SKWA 1TTHB 5HLFB 1K1QA 2DGOA 3Q8YA 2QJ3A 2DRBA 3EICA 2WBMA 4NLRA 3M1VA 3GMGA 2A10A 5HROA 4URQU 1OIAA 2DXEA 1NKEA 3EZOA 1S5ZA 3SFGA 3IG1A 3DGPB 2J0SD 1EQMA 3DRPB 4TN2A 4K4SA 1LWFB 2D69A 1R8HA 3GG1A 4M5NA 4QCLA 1KFDA 5K8NA 4P71A 3Q8PB 2YPYA 4JI5F 3BBFA 4CLWA 2LA6A 1NK0A 2YWHA 2YNHA 3KLHA 1PBUA 4YN3B 2B4VA 3CF5Q 4DL5A 5KT5A 1U48A 3UDVA 1RWUA 2DXFA 1M1KT 2NYHA 1S72S 1DURA 3G6ES 2JSXA 3UWTA 2ZBCA 3IR5B 4MKVA 1NH8A 1B0VA 3UFCX 3BGLA 3KJVA 1REGX 2K2PA 1TKTA 4FVMA 1GK8A 3GQCA 4F8RA 1HWUA 2E7VA 1VBXA 5ETQA 1RHUB 1SL0A 3DLJA 1CJVB 1HWKA 2B43A 1K44A 1RCOB 3WX8A 2WSCC 1MU2B 1K73T 2DNHA 4MH8A 1L3UA 1RTIB 3MHYA 2ZOMA 4ES3A 1TV6A 4DV5J 3M8PB 3GWCA 2V8GA 3IRXA 1C4CA 4O3RA 1LWCB 3DMJB 1IUJA 3DOKA 1VQOS 3FSIA 1M90T 2H54B 1FWPA 4CT9A 1OJ4A 2W8KA 2I38A 1KKHA 2Z57B 4ED8A 1WC4A 4P10A 3ZNJ1 3QNWB 4MK7A 1HD1A 1S1TB 4DQRA 1WF0A 1NM2A 2DH9A 1TU0B 2QA4S 2J9CA 4DFJA 4KJIA 5C2GA 1HNVB 4RW4A 1TL4A 4ZITA 3HVTB 3OTDA 4DF4A 4HDHA 3CMQA 1KVJA 4KFBA 5GMKa 4PG6A 2RDJA 2AEFA 1N32F 4TXSA 2YX4A 2ZZNA 5BYQA 2MQMA 1NHVA 3QRQA 2X1BA 1PIEA 2AX0A 2C2RA 1V3ZA 4KB7A 1RBAA 3V81B 3MEEB 4ZVUB 2C2OB 4L76A 3PZPA 3M2UB 4IH6A 4K2XA 2A2CA 3HVRA 4O0IA 1HMVB 1L3TA 1FDAA 4I2PB 4LF8F 4OI4A 4Y3CA 3RG6A 5IC4B 1WWHA 1UL3A 4Z37A 2RUGA 2CPEA 1QM9A 3OTEA 5DQGA 3MCOA 2DNNA 3PACA 1JJHA 1TMMA 2LKZA 3BGFA 1VMBA 1RSCA 1VK3A 5B7WA 3CJ3A 4BWJA 1PC4A 1S1XA 4RNHA 5A8RA 4LRAA 4OYXA 3LH2S 1U1PA 4N56A 3M9OB 3DU5A 1ZH5A 1ZM9A 3B4DA 1FKPB 2E5IA 1NSKL 4QIVA 5D15A 3OFFA 3W1YC 3C6UA 1F9EB 4MIAA 1NUEA 3Q2SC 1VQ8S 2RQMA 3ISNC 3D0HE 4C0OC 3TRGA 3ETMA 3HZGA 4CLYA 2PFFB 3VQTA 5AXLA 1WSRA 1U6FA 1WELA 2EVZA 3D5MA 1NNDA 4OZ3A 3W2VB 4N77A 3M6WA 2ZH9A 2YQ3A 4OX6A 2EK1A 1JLFA 4B9MA 2QEXS 2CADA 5ADZA 4GC7A 4WCEQ 1HL6A 3WIVA 3EZ5A 5DM6Q 2RRAA 3HO1A 2CNNB 1MSWD 4IR9A 3EJMA 4NLGA 2HS0A 2V4RA 5LSOA 2ZDOA 5D8HB 3ENWA 2UUBF 4RU9A 3NEKA 3IN5A 1WOPA 1VQPS 5M2PA 5T14A 1N6QA 3T41A 3DOMA 3R7NB 4CLUA 5KFQA 2XGQA 1HBNB 3D2WA 2CXEA 2PO4A 1PGZA 4ZCKA 3SBMA 5DRKA 4ZPDA 4JUZA 4DR6F 3SZ2A 4KGMA 2AEMA 5FIIA 1WJ9A 2DNKA 3FRZA 1NHKL 2M0GB 2UXDF 4C7QA 2J6UA 2DGWA 3OL7A 1D9FA 2E5JA 3EMTA 3CJ2A 4GO5X 4CLFA 1LV5A 1KVKA 1HWIA 2DITA 2H3EB 3CCES 4LVOP 2Y1RI 3E8OA 1OSCA 1Y00A 2OHDA 3I32A 3R8YA 4DPWA 2ZC3A 1KSPA 3LPYA 3DRYA 4RW6B 5J2MA 1IKXA 1SJQA 2Q6CA 2XGPA 2VPZB 4OHVA 2VODA 2FZCB 4WFBQ 4MJKA 1N36J 4FXWA 1FVQA 2FQQB 1DHMA 4OJ1A 3LGHA 2MYFA 2GO9A 1Q82T 4XO0A 2O67A 5JXSA 2HS3A 2YNGB 4FF3A 3MAAB 2EFQA 4AXIA 3MXHP 2LXIA 2CQ3A 3ZC4A 4OI3A 5HK4A 5C7PA 2ZOFA 3AA9A 3Q24A 2QIFA 5K9FA 1V5IB 2Q43A 4DOZA 3J80U 1EB0A 5LSLA 2BR0A 2B7CB 2K8GA 1HKAA 4P52A 4FS2A 5IT4A 4DX6A 4U8YA 1OMSA 1U1LA 2L9DA 1TMJA 2MY7A 2XCPA 2BRLA 2K3KA 1DRZA 4C98A 2BE2B 4Y2KA 4NLUA 3BZQA 3MOZA 3Q0AA 1P9YA 4P74A 2ASDA 2AQ4A 2GHVC 1HR0F 1ZA2B 4D3GA 3D66A 4GKKJ 3EPGA 2OPSA 1D8YA 4KGZB 3MEGB 4DL4A 4LR8A 2E7WA 2L3MA 3P3DA 4QIWD 2Y1LB 1KTQA 4YOEA 1QVFR 4OMFG 1CC8A 2O3DA 2MEWA 1HNZJ 1XR7A 3MZIA 3CD0A 4PUOB 6FD1A 2FC8A 4LF2A 1FF2A 3V5RA 3R7SB 1QUPA 5D0GA 4M63A 4PXEA 2YWWA 2KXFA 1QSLA 1SH3A 3NGUA 1N4LA 1S4EA 3DLKA 1BGXT 3BQ0A 4ZPBA 2XY7A 1GX5A 2GW8A 2NPIA 1KVIA 3F0NA 4AUKA 2BXJA 2ASLA 1L3VA 1HQ2A 1S48A 4B3SJ 2KT3A 4O4GA 1XJWB 2N82B 1S9GA 2VOOA 1UZHA 3T1YF 2MKYA 2J7KA 4F4KA 3Q8VA 3I96A 4RNOA 3LWMA 3EGZA 4ZP6A 2NCKL 3MMBA 4NMLA 1IR0A 2WK4A 4NRUA 2FGOA 3CDAA 4YP3A 2O1PA 4ECQA 1M5HA 3DOLA 4ID8A 1C1CB 5IT9Y 1BXNA 4XK8C 3LQVA 2MQ8A 4OZ2A 2YKNB 1HBUB 3W5YA 2AX1A 2QTWA 1CPZA 3MM7A 2QLJB 2XSFA 1GTEA 3CMES 2D3O1 4HEA9 2JHEA 3LALA 2HAFA 3AD9C 2JH3A 3NCQA 4S0MA 1SC6A 4GKJF 4PG4A 4BCAA 4DUZF 4RX6A 4DR5F 1S59A 3GCXP 1CQNA 4NOHA 3MEDA 4F4ZA 2V2ZA 1U45A 1EKRA 1WF2A 4PZVA 2XQCA 4DR4F 3CE8A 1XBWA 4RW9B 3VF0B 2IJFA 2UU9F 3D28A 4E98A 2RRNA 4TLQA 4MKBA 3KNAA 4R8UB 2NUHA 2CPHA 2HK3A 1Q79A 2XS7A 4Y00A 4C6AA 1X4DA 2OD6A 1IBCB 2CIMA 3B6BA 4U7UD 2DRAA 3Q8QB 4KR0B 4B9TA 2UXBF 4IG0A 4F4WA 1SQFA 3QMQA 4MT1A 3NGSA 3BKFA 5A8WA 3X1LB 1SIWB 4HTIA 2CG4A 2EG2A 4HI1A 2VBZA 1U1OA 2V2QA 2CA9A 4LF7F 2M4MA 3M4XA 2IBOA 1KQGB 3HSGA 3D6HB 1CSJA 2IYIA 4RBVA 4QR0A 4URSA 4M5KA 4RBTA 4LF9J 3M6UA 3C2PA 2PEBA 2V69A 5KG2A 2B6AA 3T6JA 1RT5A 5JVGQ 3RBZA 4YY3J 1RXOB 1UJ6A 4DL6A 5HATA 2LFVA 3LPEA 3TZXA 4DDFA 2XI2A 5E3PA 2DNOA 2HBQB 4USJC 1LNQA 3TYTA 4G1QA 1HQEA 2IYGA 4IDKA 1RP5A 2XMTA 2BE9B 3FJ2A 2B51A 3BM7A 3QZ7A 2HMIA 2MKJA 3C14B 1IBKF 1F3VA 1T05A 2D3UA 3EVMA 2GX8A 1BY9A 2M9KA 3BH7B 1REVB 1X31C 2LECA 3GV8B 4B3OB 4DR1F 1QSSA 1YTYA 3UCGA 1D9AA 1VYAA 4RW7A 3U27A 4R0EA 4DSJA 4ZDNA 2HFSA 3KNGA 5DQIA 2HHHJ 3K5NA 2NLWA 2VBXA 4JI0J 1AA1B 3AB2B 3PIOQ 4UQTA 4Q8EA 4I2QB 3I5CA 5HQ8A 3T1HJ 1T03A 1S6PB 2YH0A 1UA0A 2JLFA 3PR4A 1NMEB 2VUGA 3CO9A 4DS5A 2FJEB 4ED5A 2LA4A 1FKOB 1Y4ZB 3R5CA 3VAHA 1W2IA 4E0DA 1H2TZ 1S0MA 2BQ3A 2GVDA 2DTJA 3GIRA 2WOMB 2HFZA 5DETA 4UT4A 1RTDB 1TK5A 1ZETA 1HQUA 2U1AA 1C0TB 2ZH8A 2CPZA 4L6V3 1YX2A 4JI4J 2X3DA 1PSDA 2K1RB 1RTHB 1KLMB 4ZP9A 1OPZA 4JI7F 2YWKA 2ZJPQ 3GFXA 2FVSA 4JI3J 3G8TA 1HNWJ 1RT7B 2W7PA 4NYZA 1DAXA 5IT0A 2LQBA 3JAMY 2ZE2B 2A0FB 3H4DA 3CJTA 4QZVB 4F25A 2CQ1A 2JLGA 1KLNA 2UV8G 4KPCA 1N33J 2G0JA 4ZA1A 4P72A 2MHEA 1VQ9S 1B7YB 4FNHA 2EXUA 1LW2A 2A6OA 2VDHA 4ZCIA 1N52B 3OFEA 4Y65A 2GC8A 3OLBA 1UWBA 3EXCX 3I0SB 4I7FB 4YMEA 5IS2A 1EETB 3MD3A 4ZP8A 2V50A 3RB0A 3LGMA 3MM9A 4A8FA 4NI2B 3FEXB 2AJ0A 1M5OC 1KD1T 3B4MA 2EBEA 3QBCA 3PYGA 3AOAA 4JV5J 4LSLB 2CJQA 5D78A 2VF3A 2WONA 1UPMB 3KJQB 4DV5F 4YDDB 1TL1B 2DHHA 3I9ZA 4RBUA 4DMZA 3CCLS 4WFZA 1KP6A 1NPRA 1N5SA 2QA1A 1NZAA 1QAXA 2W2PP 2OFGX 3G82B 2QL9B 4WBFA 5F8GA 3B8HA 2OSRA 2VKRA 2QT7A 1K47A 4XIUA 3EM1A 1CJTA 2VOPA 5CAAA 2ACMA 4UY8T 1FX2A 1CS4B 3H4BA 2KHCA 3D1QA 4MIBA 3G71S 3BQ1A 2MQLA 4OHXA 4TY8A 5IM0B 1CULB 4R25A 4NXNJ 1YZ6A 3U1MA 1JXLA 3IWLA 3VAJA 1FRJA 1C2PA 4EMDA 3MMCA 3AJ1A 5A6PA 2EWHA 4ILLA 2QLWA 2V8DA 1H0HB 1WSVA 2BKNA 2ZFHA 3Q22A 2W9CB 3BSCA 3SDEB 3R5GA 2CNLB 1S1WA 3C15A 5B0DA 4J9LA 1PAEX 4H4KA 2X1AA 2HFUA 4B08A 3IBCB 1BWEA 3MEKA 1YJ7A 2GJFA 3MDFA 3G9CA 5B0EA 1ZAXA 5DZ7A 4JP8A 1Q8LA 2CQ4A 3PFEA 1IKYB 3P8BB 1C0UA 3RRKA 2DPJA 3KK3A 3MAQA 2WB4A 4I6AA 2KTQA 1Z4UA 2FVRA 2NUUG 5CCLA 3MFIA 1MLAA 2WRMA 2N7YA 5CH7B 1SC4B 1OYDA 3BYRA 3VAFA 3K59A 3AD7C 5A8KB 1HI1A 3AB4B 3TJ8A 3NWRA 4WP9A 4NLDA 4J7CA 3T19A 3JQMA 4FF4A 2KJVA 4DWIA 1HHQA 2J0QD 2LQJA 4LQ3A 3MGJA 1TVRA 1X4FA 1U09A 5DDQC 4CH1A 1U02A 4OIXA 4ECZA 5D0RA 3HMJG 1Z2LA 3M2RB 3DGPA 3R2DJ 2JJ4D 2OGUA 3CCSS 3D0GE 5IT9U 3OJSA 4LFCJ 4A47A 2MKHA 4AYBD 3VHQA 5JJBA 3JQJA 4H4OB 4Q5VA 2GAGC 3BV8A 3BO2A 1WC1A 4ANEA 2B5JA 3LGNA 3HP6A 1EAYC 3LUYA 5E3AA 1RYSA 2IAJA 1FA0A 4F36A 1HWJA 4DR2F 3W8GA 1U8WA 2WW8A 2KXHA 3THTA 3V6KA 3MM6B 3W8PA 1C1BA 2FYXA 3NRBA 2E7XA 1IQTA 1SQEA 1JB0C 3RW7A 4WE1A 2J6SA 2MQPA 4ELVA 4KT0C 5L38A 1QLNA 3PEHA 3BR8A 2HPUA 2NXNA 2ATLA 4ZVTB 2I0XA 2BJ3A 8ATCB 1PYSB 1MMDA 2Q1LA 4CCHA 5HMYA 4TYAA 2F4VJ 2YNIA 1K8AT 3R3TA 1RTIA 1UA1A 2FHKA 1UKUA 4EYHB 3MM8B 1WHXA
chains in the Genus database with same CATH topology
1WC5A 4NI2B 2GVDA 1CJUB 4CLZA 1CJVA 4CLWA 4OYPA 1AZSB 1YK9A 1WC1A 5D0HA 4CLFA 1WC3A 1U0HB 4P2XA 4OYMA 3ET6B 4OYZA 1CJTB 1WC4A 3C16A 5IV4A 1WC0A 1WC6A 4CLPA 3UVJB 4CLSA 4OYAA 4NI2A 4USVA 1CJUA 3MR7A 4OYIA 1YBTA 4CLTA 4OYBA 3G82B 3C14B 4OYOA 1AZSA 4OYWA 5D0EA 1AB8A 1U0HA 4OZ2A 3ET6A 4WP8A 4P2MA 1CJTA 5IV3A 1FX2A 1CS4B 4OYXA 4WP9A 3UVJA 4CLUA 2WZ1A 4P2FA 2BW7A 1TL7B 4USWA 5D0GA 3MAAB 2GVZB 3G82A 5D15A 3C14A 4WPAA 1CULB 1FX4A 2QV6A 2GVDB 1CJVB 4WP3A 4CM2A 1CS4A 1Y11A 4CLYA 1Y10A 2W01A 5D0RA 1TL7A 4USTA 4CM0A 4CLLA 3C16B 3MAAA 4USUA 3C15B 4CLKA 3R5GA 2GVZA 3C15A 1CULA 1CJKB 1YBUA 4OZ3A 1CJKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WC5 A;  4NI2 B;  2GVD A;  1CJU B;  4CLZ A;  1CJV A;  4CLW A;  4OYP A;  1AZS B;  1YK9 A;  1WC1 A;  5D0H A;  4CLF A;  1WC3 A;  1U0H B;  4P2X A;  4OYM A;  3ET6 B;  4OYZ A;  1CJT B;  1WC4 A;  3C16 A;  5IV4 A;  1WC0 A;  1WC6 A;  4CLP A;  3UVJ B;  4CLS A;  4OYA A;  4NI2 A;  4USV A;  1CJU A;  3MR7 A;  4OYI A;  1YBT A;  4CLT A;  4OYB A;  3G82 B;  3C14 B;  4OYO A;  1AZS A;  4OYW A;  5D0E A;  1AB8 A;  1U0H A;  4OZ2 A;  3ET6 A;  4WP8 A;  4P2M A;  1CJT A;  5IV3 A;  1FX2 A;  1CS4 B;  4OYX A;  4WP9 A;  3UVJ A;  4CLU A;  2WZ1 A;  4P2F A;  2BW7 A;  1TL7 B;  4USW A;  5D0G A;  3MAA B;  2GVZ B;  3G82 A;  5D15 A;  3C14 A;  4WPA A;  1CUL B;  1FX4 A;  2QV6 A;  2GVD B;  1CJV B;  4WP3 A;  4CM2 A;  1CS4 A;  1Y11 A;  4CLY A;  1Y10 A;  2W01 A;  5D0R A;  1TL7 A;  4UST A;  4CM0 A;  4CLL A;  3C16 B;  3MAA A;  4USU A;  3C15 B;  4CLK A;  3R5G A;  2GVZ A;  3C15 A;  1CUL A;  1CJK B;  1YBU A;  4OZ3 A;  1CJK A; 
#chains in the Genus database with same CATH topology
 4U7C A;  4OYP A;  1G1X A;  3TX8 A;  4F7V A;  3UPF A;  4RUB A;  1TUG B;  2YH1 A;  3IBF B;  3R97 A;  3ISN D;  2ILY A;  5LMN J;  3V4I B;  2R9L A;  3S6E A;  3UVJ B;  3TA1 A;  2HQI A;  3KLI A;  2DEJ A;  3NOC A;  2MGZ B;  1KEK A;  4DR7 J;  1A6L A;  3G4S S;  1AT1 B;  2ZWO A;  2CPD A;  2LLZ A;  3EVO A;  2CNO B;  3A3O B;  3LP1 B;  3ZTO A;  5K8M A;  4NLT A;  1E6Y B;  3DU6 A;  3BS9 A;  3R9L A;  2CQ2 A;  2ROG A;  2BW2 A;  3KYL A;  4AQY J;  5ETR A;  1UFW A;  1KTV A;  2V9W A;  3D68 A;  2WVB A;  3CED A;  4C8K A;  2Y0S D;  1N36 F;  1FJC A;  3GYX B;  4BWM A;  1NDC A;  3U02 A;  4DV0 J;  2VQF J;  2BEF A;  4ECW A;  3RB4 A;  2OKQ A;  2GHP A;  4UOG A;  1RYR A;  2D3Z A;  2ZVI A;  4JOU A;  2P2C B;  3J81 j;  3AOB A;  3CDB A;  2RML A;  5DGB A;  3RGI A;  3FUY A;  1U0H B;  1ELO A;  1PC5 A;  1LWE B;  4KGK A;  3LP2 B;  3W9J A;  2W2N P;  4ID5 B;  1SPB P;  4ZVG A;  3W2W A;  1KRP A;  4DV2 J;  1SKU B;  3PTW A;  1VQK S;  2YY3 A;  4DL7 A;  4F2R A;  2AJ2 A;  4Q8F A;  3WX4 A;  3ADA C;  1S9E A;  3F56 A;  2CFX A;  2CQH A;  2R7W A;  3ZZR A;  2CZ9 A;  2E44 A;  3M1V B;  1UEU A;  2YNF A;  5KFD A;  5HRO B;  2IRY A;  3IG1 B;  1Y3K A;  2KT5 A;  2EFG A;  5L9X A;  5KFH A;  2CQ0 A;  3PNI A;  3IO1 A;  4B3M J;  3UN3 A;  2P9C A;  1H6K X;  2D1C A;  3OBI A;  2QA4 G;  4LRB A;  2ZZM A;  2R8G A;  2VPX B;  3MEC A;  2ZUA A;  4FN5 A;  2H9Z A;  3TAM A;  4M1K A;  2HGN A;  1B64 A;  4ZKA A;  1DQ9 A;  1OQ3 A;  1RZM A;  1DQ8 A;  2FJV A;  4ZPA A;  3JAM U;  1Q8I A;  4B3S F;  1SUQ A;  3KJV B;  4WII A;  5ETM A;  3HI9 A;  1RWP B;  5T7L A;  4FBU A;  1TKT B;  3P5B P;  3HK2 A;  4Q45 A;  2IDE A;  1QVG R;  1RT3 A;  2K7K A;  4DV7 J;  1HFE L;  2QLX A;  1MG7 A;  3I5A A;  2FUG 9;  2CQD A;  4W98 A;  4ZIW A;  4NLO A;  1OY6 A;  5F3Z A;  4GVB A;  3AOC A;  1VQN S;  3IRX B;  1UW4 A;  2M52 A;  4DCJ B;  3OUY A;  4KQZ A;  2W4P A;  4EFA C;  4OX7 A;  3QO9 B;  3NP5 A;  5F8H A;  4MK9 A;  1CEZ A;  3K58 A;  2YTC A;  4F4Y A;  3JS9 A;  2E1R A;  4A8S A;  3CT9 A;  4PXD A;  1LK7 A;  3OSP A;  2HNZ A;  4QOT A;  1O0P A;  3KK1 A;  3D6F B;  3FSY A;  2OPQ A;  3ZZT A;  3AAW B;  1GTH A;  1FD8 A;  2AMC B;  4KAI A;  4F3O A;  4AL6 A;  3FBE A;  4H4M A;  4RW4 B;  4IOC Q;  3H20 A;  1XER A;  3L7P A;  1AYE A;  5DG8 A;  2MZJ A;  3M9M B;  3NKY A;  2KT2 A;  2Q66 A;  2KJW A;  5F8I A;  1VR6 A;  2B9Y A;  4KFB B;  2HRT A;  3T6B A;  2XTJ P;  2J8A A;  4YDX A;  1HHT P;  3FK4 A;  3H25 A;  1D3W A;  2L48 A;  1WTB A;  2E5L F;  2COL A;  2QSW A;  1X7V A;  4OZL A;  4YR0 A;  4OV6 A;  1IBM J;  3ZXW A;  1LW0 A;  1SH2 A;  1JLC A;  3MI7 X;  3TQE A;  4ZPC A;  2VFT A;  1I6J A;  2I1R A;  3G8S A;  4Y2C A;  2MZS A;  3PRD A;  3SEO A;  5KG6 A;  2N7C A;  1N56 A;  3I87 A;  4EZ6 A;  3M2V A;  2B8P A;  1BE4 A;  1VRU A;  1FEH A;  2ZH5 A;  1UFK A;  2KFY A;  4LSN A;  1C4A A;  2FIU A;  4L3N A;  5HAO A;  1DTQ A;  5L1L A;  1RBL A;  3PJW A;  4PYA A;  2AW0 A;  4QU6 A;  3N6N A;  4LF9 F;  3OL6 A;  1NJY A;  2G1D A;  2W2M P;  2PN6 A;  3DGV A;  1S1X B;  2PDA A;  5A8R B;  2HW3 A;  4YY3 F;  3FSX A;  1F3F A;  4UOC A;  2W24 A;  4R5P A;  5HSP A;  1B0P A;  2XYH B;  3TUZ C;  2CDQ A;  5LJ5 Y;  4FYV B;  3C6U B;  4JI5 J;  4PPZ A;  1LKZ A;  3UN5 A;  3RB6 A;  2PE8 A;  3SQG A;  4V19 X;  3UDC A;  2B4U A;  4ES1 A;  1SXL A;  1VOM A;  4IQX A;  3R1H A;  1YJ9 S;  4C3K A;  1JLF B;  3SXL A;  4JYA J;  3G6V A;  4DEZ A;  5HBM A;  5EGY A;  2M70 A;  1FRK A;  2Q79 A;  3CCZ A;  3GSD A;  3H5S A;  4A8W A;  2W8L A;  3LP0 B;  4J91 A;  4LRF A;  5A0Y B;  2HSE B;  4LBI A;  4JI0 F;  3D1H A;  3T1H F;  2I5J B;  3QZ8 A;  4U96 A;  3K8W A;  3N6M A;  2XMM A;  4LMZ A;  1N6Q B;  4EUV A;  3DOM B;  1X8D A;  3QYY A;  3AA8 A;  2YX7 A;  1FFS B;  2E9Z A;  3EPI A;  3K0J A;  4ZN3 A;  2HQ3 A;  1S57 A;  1RHQ B;  1BC6 A;  4LFA F;  4WXO A;  4P7V A;  2KL8 A;  4HT7 A;  3PR5 B;  2YQ1 A;  3Q89 A;  3A8K A;  5KFE A;  1RAC B;  1ROF A;  3FC9 A;  3BGR A;  3ZZZ A;  3M8S A;  3B54 A;  2VIH A;  2PSZ A;  1FEE A;  1CG2 A;  4ZLP A;  3RR7 A;  3VVU A;  3IM8 A;  3KHL A;  2HFO A;  4WIQ A;  4LF6 J;  3SSR A;  1RWK B;  1VQ6 S;  4WZM A;  3CIM A;  4GMK A;  2IM1 A;  1GEH A;  4EBE A;  4WP3 A;  4F50 A;  1SV5 A;  3OL9 A;  1PAU B;  3B78 A;  3CMA S;  2BAB A;  2FLL A;  2JOQ A;  4IH5 A;  5A76 A;  2NXJ A;  4IRD A;  3IS9 B;  4Z7C A;  3P45 B;  4F3Q A;  2AJ4 A;  5CA5 A;  3QJJ A;  1N33 F;  5EWE A;  3BPD A;  3L3C A;  1SKR A;  5B08 A;  5J2M B;  2W7A A;  3IC1 A;  3O6Q A;  1RBO B;  2ADB A;  1EQ0 A;  3AH6 A;  3H98 A;  3PG9 A;  2HHT A;  2XCA A;  2C1E B;  4K4V A;  1FWL A;  4FDF A;  1QAY A;  4F67 A;  1BQM A;  1BQN B;  4IG3 A;  2B7B B;  3J7Z 5;  1U0S A;  4EZ9 A;  2DH7 A;  3CW2 C;  4ELT A;  1Y9O A;  2ASJ A;  1Q78 A;  3CD5 A;  1AW0 A;  1T0T V;  3IAS 9;  4P2F A;  1SJ3 P;  1UVM A;  1F5A A;  5CYM A;  1O6X A;  1OYE A;  4MK8 A;  1WI6 A;  1TK8 A;  1NJI T;  1UTA A;  4M5M A;  3HFV A;  3PRV A;  3UO0 A;  4IFY A;  1TL3 A;  3H5U A;  3R5D A;  3DDN A;  4EBC A;  4USI A;  2C28 A;  2KG0 A;  3ZZ0 A;  4IOB A;  4B3T F;  3MFH A;  3EWG A;  2FVP A;  2V0N A;  5EWF A;  2V34 A;  1YBU A;  4NL5 A;  4ZJL A;  2LU2 A;  2IHR 1;  2A2D A;  2OPS B;  5H1S V;  3T5K A;  3HJF A;  1M5S A;  4PRF A;  1RA6 A;  5IOL A;  1RWV B;  2GML A;  4V1A k;  2CWK A;  1KHV A;  1RI7 A;  4U7U K;  4X4N A;  3H40 A;  2UVW A;  3PO5 A;  4PEO A;  3IR6 B;  2M5Y A;  3QAT A;  4NLQ A;  4URG A;  2HZA A;  2XSJ A;  4HL9 A;  4CO0 A;  3QRP A;  3DLK B;  2HG4 A;  4PPD A;  3GV7 B;  1N0V C;  2GMH A;  4TU8 A;  4LRC A;  4WU3 A;  3UD4 P;  3C6T A;  5CXT A;  5L46 A;  4USM A;  2YKP A;  2XG8 A;  1YJT A;  2YWE A;  3K57 A;  2H48 B;  2UUT A;  4O4G B;  1S9G B;  1EP4 B;  4WK1 A;  3QT8 A;  1NBE B;  2NXU A;  4NE9 C;  4TU7 A;  3ZZU A;  3MR5 A;  5J2P A;  4ECY A;  3A8J A;  2RF2 A;  3BRE A;  3MMB B;  1FXR A;  5KTQ A;  2ZH1 A;  3NOG A;  5I3U A;  2CQC A;  3FCH A;  2IA0 A;  4NPO A;  5DS7 A;  4C11 A;  1U2F A;  3DOL B;  4Y6I A;  4PKD B;  1HBO A;  1VDH A;  1SBR A;  5G4D A;  2UUA J;  2WBR A;  3TA0 A;  4DG1 A;  2MKI A;  1FRL A;  3D3B J;  4DR6 J;  2HHP A;  3BBB A;  4K4U A;  1ZPW X;  4ZS6 A;  3TAP A;  3MM7 B;  2K1R A;  2F8H A;  1RTH A;  3LO3 A;  3PJ9 A;  5HJX A;  2KG1 A;  2AEJ A;  1T95 A;  2IRU A;  3NMA A;  1IQZ A;  4EYI B;  2BRK A;  5IC6 B;  4DL0 C;  3HFK A;  3ISZ A;  2XYP B;  4G3I A;  1Q81 T;  3JTN A;  4ERD A;  3MED B;  2ZM6 J;  3DCA A;  2EC2 A;  5E5N A;  4N47 A;  2ZJR Q;  3OLA A;  3PFO A;  2C2D A;  2APO A;  3ETO A;  2XY5 A;  3FBF A;  1TL7 A;  4YB6 A;  4C3M A;  5A2Q Y;  2DY1 A;  2ZHA A;  4K4X A;  2IVF B;  4JI1 F;  1IM4 A;  1VRQ C;  2P9E A;  4RPF A;  4LT6 A;  5GAG I;  4QWD A;  2GIQ A;  4IG0 B;  4AXJ A;  3HLU A;  4OZ5 A;  1U47 A;  4WFX A;  2B56 A;  4H4K C;  4RWX A;  1YBT A;  1RLC L;  1PJ6 A;  1IR2 A;  2C3U A;  3GFH A;  2DHS A;  3AQP A;  3MUT P;  3NG8 A;  1Z1Z A;  1Z2Z A;  2DGX A;  5LMN F;  1GAO A;  4XDD A;  3W9H A;  3A13 A;  1JLG B;  4DCP B;  2B6A B;  1VC6 A;  1RT5 B;  3IAM 9;  1H72 C;  5KFV A;  1AXQ A;  2B4O A;  4CNZ A;  3WBZ A;  4DR7 F;  3PW4 A;  3DC2 A;  2J0X A;  1OY8 A;  1HR0 J;  4C8Z A;  2FGC A;  3ZTQ A;  2BJ7 A;  3C46 A;  3CD7 A;  1S97 A;  5LXY A;  4AQY F;  4C0B A;  4W92 B;  5SZT A;  1MN7 A;  5KFJ A;  4G1Q B;  4ZLJ A;  3K2Y A;  4IDK B;  2CAJ A;  4AT1 B;  5C42 A;  3JSB A;  2HS4 A;  2HMI B;  4DV0 F;  2VQF F;  4ZVS B;  1T05 B;  3HFZ B;  2EKY A;  1S77 D;  1XWL A;  2KVQ E;  4C3L A;  1P9Q C;  1HNX F;  4JI2 J;  5B0F A;  3VZH A;  3NNH A;  2RU3 A;  4OYI A;  4RW7 B;  2G2Y A;  3WC2 A;  3EE3 A;  5J1P A;  3VTI A;  1YGY A;  3WIU A;  3J7A 1;  1X4H A;  3AJD A;  2ZBI A;  2JEI A;  5C24 A;  1T03 B;  4MMO A;  4DV2 F;  2DXD A;  4C8N A;  3GR1 A;  4PAA A;  3M8Y A;  1S7H A;  1WEY A;  3HUL A;  2R42 A;  1MWQ A;  2IM2 A;  4KY3 A;  3F44 A;  2ZH3 A;  2GVD B;  4ZPT R;  4ZVE A;  2CDR B;  1S0O A;  2ERR A;  1S6Q A;  2AT1 B;  2EFV A;  1UVL A;  2UV8 A;  1NSP A;  1HQU B;  2M8H A;  4ZVP B;  2C2E A;  2R8I A;  1SVD A;  5KFZ A;  1IKV A;  1X4C A;  3WHI A;  1N5Y A;  3CJK A;  1VC0 A;  3NNC A;  3MTK A;  5H9E K;  2QSF A;  5E0O A;  4GVL A;  4B3M F;  1TUW A;  2Y1J A;  4EBD A;  1S7I A;  5DJB A;  3KDN A;  1T3O A;  1UW9 A;  4M8L A;  4CDI A;  1CBK A;  3EGV A;  3A12 A;  3IWX A;  1FNX H;  2IJN A;  3BGU A;  4Y28 C;  1ZYQ A;  1P27 B;  2XHC A;  3ZZO A;  3G86 A;  4X4T A;  2DYA A;  2YKM B;  1VBK A;  2BYC A;  4JI6 F;  3LWL A;  5BYS A;  4DUZ J;  2ZKT A;  4DLE A;  1WDD A;  3A3N B;  4P73 A;  4DR5 J;  1R31 A;  2BQR A;  1HBM A;  3J7A N;  1WEZ A;  1LW2 B;  2DIV A;  1HPZ B;  2QA2 A;  3EXY A;  1HW8 A;  3KXD A;  4DR4 J;  1UEK A;  1UWB B;  2DGS A;  9ATC B;  3N01 A;  3TUP A;  1F6T A;  5B0G A;  1VIX A;  2BJ8 A;  2FY8 A;  4RZR A;  2KFN A;  3PYE A;  4GRS A;  1VQM S;  1N48 A;  1MWZ A;  4DV7 F;  2YQ0 A;  2HZV A;  1R0B G;  1PYT A;  4RUA A;  2N4C A;  4K8R A;  2HVD A;  3UCU P;  1WHW A;  2W4D A;  3CVK A;  3BF4 A;  2MKC A;  3FEY B;  2WON B;  4KH0 B;  2F8E X;  5K8P A;  3O5T B;  1X5T A;  3IRW P;  3CPW R;  3CC7 S;  2NYI A;  1ACM B;  4QIG A;  1URN A;  4A8K A;  2OML A;  1CJT B;  4CI0 B;  2JEF A;  2DCL A;  3C16 A;  4ED6 A;  1HWL A;  2GJ2 A;  3CXC R;  1J5E F;  4OI6 A;  1ZOT A;  1VC5 A;  4TY8 B;  2B9X A;  5ETP A;  5EN1 A;  3CJ5 A;  2YWF A;  3MCM A;  3EYZ A;  3NCR A;  5KT7 A;  4X4U A;  4HKQ A;  1N5V A;  4QQB A;  4A8Y A;  3W65 A;  3AOD A;  5KFA A;  3ET6 A;  3AY0 A;  1B99 A;  2XO6 A;  1QDU B;  4LBP A;  3UN2 A;  3MMC B;  4QYZ K;  2ZEJ A;  3VGT A;  2BQU A;  1I3O B;  1PBA A;  1X4G A;  4M5I A;  4M94 A;  1XIQ A;  3H42 A;  2LEB A;  1R6Y A;  2VG7 A;  5FLX Y;  3DM2 A;  4KKO A;  4DI6 A;  2EK6 A;  3Q86 A;  2LEP A;  1UVK A;  2XMU A;  5C25 A;  3BDP A;  2Y8Y A;  4NLV A;  1C0U B;  4DXL A;  3FQL A;  3T5H A;  3MPU B;  3BEG B;  4IYQ A;  1P1T A;  1XEZ A;  4F0M A;  4RO0 A;  1ULR A;  3OPK A;  1NZ8 A;  3VVT A;  3TR5 A;  1U1M A;  3TUI C;  4A8X A;  3M30 A;  4OYM A;  1WUU A;  1WEX A;  2LEA A;  2QLB B;  4E8U A;  1V3S A;  5HO4 A;  3W66 A;  5H9E J;  3GTY X;  2J7W A;  2HHW A;  1YRU A;  1TUV A;  4CIO A;  2E1C A;  4RWW A;  3UCZ P;  2F8M A;  1JLQ A;  5J1E A;  3VGV A;  5BR8 F;  2BJ1 A;  1TVR B;  5F8J A;  1H2U X;  2RD5 C;  3O3L A;  3KDO A;  3OJU A;  2HVH A;  3M9N B;  4K4T A;  3KK2 A;  5HMX A;  3ENV A;  1F0X A;  2HIQ A;  2Q6B A;  2DCU B;  4QU7 A;  5GAG U;  2LMI A;  3UD3 P;  3EGN A;  2GCF A;  1KQK A;  4UZB A;  2B5J B;  2XLI A;  1RAO A;  4JI7 J;  2EI5 A;  5RUB A;  2IAJ B;  2V6A A;  5LL6 d;  2VZ9 A;  3ITH A;  5H9F K;  3TZZ A;  3MR2 A;  4JYA F;  1O5J A;  3MMA B;  4J9P A;  2FLN A;  5ETL A;  3IXQ A;  4RU2 A;  2O5D A;  1C1B B;  3HXM A;  3GG0 A;  4B9S A;  1OO0 B;  2XMA A;  1T94 A;  4BHQ A;  2VL1 A;  1RT1 A;  4J9R A;  4DFK A;  3CB4 A;  2ZZT A;  4WE1 B;  2ZH4 A;  2E1M C;  2ZNY A;  3BSO A;  1NO8 A;  3E3X A;  4ED3 A;  1RA7 A;  5HL7 Q;  4WWS A;  4OLP A;  2HRU A;  2HHU A;  1TP7 A;  3RW6 A;  3G6Y A;  2LXU A;  3VWS A;  5J2N A;  4U9R A;  2V8H A;  2YNI B;  1PIL A;  1M5V C;  2W9B A;  1JXE A;  4M5J A;  1S6U A;  3DI6 B;  3HX9 A;  4XDC A;  1WTF A;  2FY1 A;  3KJN B;  4QYZ J;  3UQS A;  2PA3 A;  1WF1 A;  3P96 A;  5DLG A;  4X66 J;  3QO9 A;  1ZA1 B;  2YKQ A;  1H7X A;  4CM0 A;  1XR5 A;  5DDO C;  2C2M B;  4LF6 F;  1F1B B;  2CG8 A;  2WSF C;  2BX6 A;  5F8L A;  3V6D A;  3KLI B;  3M32 A;  2Y1I A;  2V63 A;  1MML A;  1U1R A;  3GJQ B;  2IIH A;  1SI9 A;  2KI2 A;  4LF4 J;  2B0G A;  3RR8 A;  2JEG A;  4RNN A;  1FE0 A;  3PDN A;  1YJW S;  5KG3 A;  3WC0 A;  1VS3 A;  3DRS B;  2OPP A;  2WVE A;  2PA8 D;  1VJQ A;  2MJU A;  4OJ3 A;  2MQN A;  5KOW A;  2R7V A;  1X9W A;  3PKM A;  1F2G A;  2ZH6 A;  3OTO F;  1MRO A;  2F7V A;  2CPJ A;  4P6Q A;  4YR3 A;  2IRX A;  5KFO A;  5KT3 A;  1TK0 A;  4QR1 A;  2D3O R;  4B17 A;  3HDS A;  3JSR A;  1IWA A;  3CJR A;  4FPR A;  3W2W B;  2JX2 A;  1TZ0 A;  4I68 A;  2R7U A;  5HMW A;  1NDP A;  1S9E B;  3H2L A;  5IWA J;  5I42 A;  3KWM A;  2BJ9 A;  5H9F J;  2YNF B;  1GXU A;  2R3V A;  4CLP A;  3FFI A;  2V8V A;  1X9S A;  2HND A;  2AV5 A;  4C8M A;  3N0V A;  4WJB A;  1NDK A;  2RUS A;  4NCG B;  3NS5 A;  2DIU A;  3C3L A;  4YFU A;  3M8Q A;  1BD6 A;  3HM9 A;  4JI8 F;  1FTC A;  3S7R A;  3W60 A;  2RVJ A;  1RAD B;  2J76 E;  3UDL A;  3FCV A;  2NXE A;  1EX8 A;  1DQA A;  4ZP7 A;  5KFX A;  2IMW P;  2PI5 A;  4F04 B;  3POT A;  1Q86 T;  1KNZ A;  2MZT A;  4BS2 A;  4FF2 A;  4O3Q A;  2NXC A;  5E3Q A;  1DZ5 A;  3MEC B;  4DR2 J;  3KLG A;  5LMU J;  4WFA Q;  1S9F A;  5KG0 A;  2B9W A;  2ZC4 A;  3TAM B;  4LFB F;  3HD2 A;  4J9V A;  2ZUG A;  4PAB A;  3W7B A;  1FFW B;  1YJU A;  4O4R A;  2R2S A;  1OY9 A;  2HNY B;  2AGP A;  3W9I A;  3RB3 A;  2HHQ A;  1SUQ B;  2LQ5 A;  3N5F A;  4TQR A;  5T7L B;  3LP0 A;  1APS A;  5A0Y A;  1WOR A;  3B82 A;  3K5O A;  1Q5V A;  5EX0 A;  1RT3 B;  3V2U C;  1NK6 A;  2I5J A;  1WOS A;  3MR3 A;  2CWX A;  3JYT A;  4QYR A;  2BDP A;  2Y8W A;  2AJ1 A;  1FWK A;  5HN0 A;  4DBQ A;  4U95 A;  2UVU A;  1YZ7 A;  4ZVO B;  3JSY A;  5DM7 Q;  4GVB B;  4OHZ A;  2ZDP A;  4P7T A;  2JRS A;  2KKH A;  2UUA F;  1XMQ F;  3OUY B;  4I4B A;  2DKO B;  5D4L A;  3M8R A;  3BKU A;  1VRT A;  4OZ0 A;  4K2J A;  5F0W A;  2MLX A;  3Q8S B;  3CWJ A;  4CYU A;  1S10 A;  2GFF A;  2IPO B;  1KFS A;  2VG6 A;  5D4N A;  3VAK A;  2HNZ B;  3IFE A;  2E9R X;  1A9N B;  2RAQ A;  3CDW A;  3VAI A;  1K9M T;  3KK1 B;  2OPQ B;  3PX6 A;  3DRR B;  2CJ9 A;  4H4M B;  1P6T A;  3BO4 A;  2FZG B;  1RAB B;  3IS9 A;  3HHL D;  2ZM6 F;  2KYX A;  2FJA B;  2CRL A;  2RKI A;  1ZBT A;  1LFW A;  2GQC A;  1KQS R;  1RHR B;  1VLO A;  1KR4 A;  4O3O A;  1RU2 A;  4OYZ A;  2RQ4 A;  2ZH7 A;  2FHM A;  3AT1 B;  2GHW A;  3I0R A;  4PWU A;  4NXM J;  5IV4 A;  4KC5 A;  1LW0 B;  1JLC B;  1KBR A;  3BB5 A;  2FJD B;  1BQN A;  1VQY A;  3T3F A;  4Q0B A;  5FLX U;  5ITH A;  2WCX A;  5ETK A;  2F9J A;  2SXL A;  4C9D A;  3ILL A;  3DDI A;  3M2V B;  4OV1 A;  1ZTW A;  1VRU B;  2XI3 A;  4LSN B;  4ANC A;  2ROE A;  3KOA A;  4ZHR A;  3QGG A;  1DTQ B;  4QW8 A;  3TAR A;  2E1P A;  5FDL A;  1WNE A;  2RU9 A;  3TEH B;  1HHS A;  3BH6 B;  4IRK A;  4PQA A;  2P5V A;  3FBC A;  4K4W A;  1YDL A;  1IVZ A;  2DNP A;  2MST A;  3MF5 A;  1JQG A;  3BSA A;  4R5P B;  3HT0 A;  3BDE A;  2E9T A;  4MFB A;  1RAJ A;  4J9S A;  3V6H A;  4KV8 A;  3GII A;  2AIR B;  4DU7 A;  4FYX B;  5KFS A;  4ECR A;  3UNG C;  1X60 A;  3HJV A;  4M5H A;  3SQG B;  2OTL S;  2B8Q A;  4ZPV R;  4A8O A;  3AD8 C;  4OYB A;  2D7S A;  4ED7 A;  2OFH X;  2ZHB A;  1AZS A;  4QWE A;  4I56 A;  2A6M A;  4OX8 A;  4ATN A;  1R27 B;  1RT6 A;  5HBM B;  5AE3 A;  1Y5L B;  3SCJ E;  4R0J A;  4JI2 F;  3PXG a;  2DNG A;  1TEL A;  3EDQ B;  3FRY A;  4X4R A;  5GVQ A;  4U8V A;  3MM5 B;  3ZFV A;  2QLF B;  3OR2 A;  1EP4 A;  5I3P A;  4NLP A;  3TVY A;  4DSF A;  3H5Y A;  2MY8 A;  1TKZ A;  1SJ1 A;  2RHS B;  5HVG A;  1VFJ A;  3N6L A;  1X0F A;  4TYB A;  2C42 A;  1YJN S;  3SMZ A;  3PIP Q;  2CQP A;  1XNQ J;  3TA2 A;  3FCW A;  1EIY B;  2IVY A;  2GS8 A;  3OR1 A;  2VV5 A;  2HQG A;  1VBZ A;  4F02 A;  2R7Q A;  2HRY A;  4J9O A;  1RKJ A;  1Q5Y A;  3RAQ A;  3BGR B;  4ED4 A;  1RAG B;  2KZZ A;  4K0K F;  1S79 A;  1R8A A;  2CQB A;  4LF5 J;  4HDG A;  3TEG A;  1F2H A;  3LF0 A;  2DIS A;  1I94 J;  2R7R A;  1JLE A;  2DR7 A;  1T9Y A;  4O3S A;  5B0C A;  2RQK A;  4K50 A;  2C2Z B;  2VPY B;  4NEZ A;  4B02 A;  1ZZN A;  1SV5 B;  1X4E A;  2ZBP A;  3QRR A;  3J81 Y;  3GIK A;  4CO5 A;  5DZ6 A;  2GIF A;  4C4W A;  5CD4 H;  4K5S A;  4KBI A;  3V6J A;  1RTJ A;  2BV3 A;  4HTJ A;  3AHP A;  1FX4 A;  3VV2 B;  4DSK A;  5LT5 A;  4HHU A;  3DFE A;  1N88 A;  5DDR C;  3QAE A;  3NBP A;  3T5L A;  2AWZ A;  2M8D B;  2E5L J;  4TNO A;  4L73 A;  4UST A;  4RKU C;  4NZ7 A;  2BA9 A;  1VJW A;  4AL5 A;  3VAL A;  9RUB A;  1BQM B;  4IG3 B;  2D9P A;  4RUH A;  4M5G A;  7FD1 A;  3EUN A;  1WD6 A;  5K14 A;  3CUL A;  3OFH A;  1PCA A;  3PVX A;  4WU2 A;  1B4S A;  4RW8 A;  2IJR A;  1IM6 A;  2HLT A;  2HVZ A;  3OVB A;  3NWG A;  2Z8Q A;  5KAK A;  2G9O A;  1FK9 A;  1NRK A;  1CJU A;  3MR7 A;  2KVI A;  1O8B A;  3GJR B;  2Z2Y B;  5CYM B;  4OYW A;  4WKR A;  2WSE C;  5BXI A;  4ES2 A;  1LOU A;  3W63 A;  1DBD A;  4IFY B;  1TL3 B;  3IR7 B;  1IWG A;  1JLG A;  1VQ4 S;  2HAI A;  3CUN A;  2BW7 A;  1URR A;  4RUC A;  3NS6 A;  4MIW A;  1YSJ A;  3Q8R B;  2AF6 A;  3SSS A;  1YQH A;  1CC7 A;  4PXC A;  1M1H A;  1FRX A;  1UMJ A;  2DJW A;  3RRG A;  1NEE A;  2HWT A;  2FDN A;  5J2Q B;  1FFG B;  1I51 B;  3OVA A;  2N3O A;  1MW7 A;  2ZD1 B;  1GMW D;  2XSJ B;  1DJ0 A;  1RU1 A;  2CNK B;  1FXL A;  1RKI A;  3NNA A;  3DLG A;  2YWG A;  1NCL A;  2OEJ A;  2LVW A;  2QFI A;  3C6T B;  6AT1 B;  3DLH A;  3US5 A;  4J9U E;  2OH2 A;  1Y5I B;  1FE4 A;  4X84 A;  3QT7 A;  5M2U A;  2F1F A;  3K5L A;  3RBE A;  4ZJQ A;  2E5H A;  1K0V A;  4FYY B;  4CO4 A;  3FMB A;  5T41 A;  1SIZ A;  4LSZ B;  2DO0 A;  4X65 F;  2XMV A;  4WK3 A;  5J2P B;  3TX0 A;  5DLF A;  2FB0 A;  3EZU A;  2RF2 B;  7FDR A;  1XC9 A;  4YHH J;  4DN0 A;  5I3U B;  3DYA A;  3MUR P;  2OSQ A;  2NZC A;  2OD4 A;  4C11 B;  3QT6 A;  1HBO B;  3SCI E;  1RWX B;  2DK2 A;  4LFA J;  3FQK A;  4CTA A;  4DUY F;  3IGV A;  3O44 A;  1ARO P;  2FLO A;  3CCU S;  2L9N A;  4DG1 B;  3GLJ A;  4M5D B;  2PI4 A;  2N4D A;  2B4P A;  4PQU A;  3HHL A;  1S99 A;  1S6O A;  3NS7 B;  1FDD A;  2HKE A;  1NJW A;  2XB2 D;  1FNM A;  4I67 A;  1FNO A;  4FXD A;  5KFL A;  2VIC A;  3JXO A;  2VA3 A;  5K8O A;  5JUM A;  2QGF B;  5GAH I;  1G4C A;  2HQF A;  2YKM A;  1F60 B;  4ECU A;  2DEI A;  4CLT A;  2IA6 A;  1D09 B;  4J5O A;  1RCX B;  3JQK A;  2FZK B;  3J80 Y;  3FVY A;  5KOX A;  2GJI A;  2GZO A;  1W2B R;  2MQO A;  1U2R A;  4OJH A;  1HPZ A;  4OI2 A;  2W7O A;  1HIY A;  2EW9 A;  1TL7 B;  2DNY A;  5EWG A;  3PW5 A;  2J8S A;  3GV5 B;  1NAQ A;  2XS2 A;  3CCM S;  3DLL Q;  4Q2M A;  2Z30 B;  5CZV A;  3NXZ A;  2G13 A;  1AUS L;  3G8Q A;  3P49 B;  2V67 A;  1X5O A;  1UET A;  2RRB A;  1YBA A;  2BAC A;  2GO8 A;  2E1A A;  1RWW B;  2IY5 B;  2GGP A;  4QIF A;  5HVF A;  1W7W A;  4CLZ A;  1S1V A;  3CGI A;  4X66 F;  4XAK A;  1RJJ A;  1JNZ B;  1P1L A;  1OSD A;  3GU0 A;  1JWW A;  1Y0H A;  2VAS A;  2LDY A;  4K7Q A;  2X1G A;  3MWB A;  1NKB A;  4OX9 F;  3ZZP A;  2BUN A;  2J6T A;  4WFN Q;  4PWD A;  5AE1 A;  4B3T J;  4NA1 A;  2AGO A;  4MTP A;  1U1Q A;  1RT2 A;  4ZN1 A;  1YRX A;  5IQQ A;  3ICL A;  5CYQ A;  4UTG A;  5GME A;  2HHS A;  2X51 A;  4DHV A;  4LF4 F;  2GAH C;  5KG1 A;  3LAM A;  2WAQ D;  2DVI A;  2FD2 A;  1MN9 A;  3WQP A;  4NLW A;  2HHX A;  4TKT A;  5C42 B;  4LJM A;  1WAC A;  3ILJ A;  2MSS A;  5EHH A;  4OJG A;  1L5U A;  2DNR A;  3DXB A;  4J9Q A;  2DNZ A;  1HAR A;  1PO6 A;  2HFN A;  3N79 A;  5SUH A;  5EDW A;  3CCR S;  3ILI A;  3G87 A;  3KG1 A;  4X62 F;  1WC3 A;  4I6W A;  1R43 A;  3VAG A;  5C24 B;  4K59 A;  3JB9 k;  1SJR A;  3L95 X;  4HYK A;  4C2M A;  4UUX A;  4IO1 A;  2AP6 A;  4RR5 A;  5K5M A;  2F9D A;  1FJE B;  4USK A;  1H7W A;  2NPF A;  1QTN B;  2AGQ A;  2UUC J;  5IWA F;  2DHX A;  3R5A A;  3TP2 A;  4Q2L A;  2Z4P A;  3CO0 P;  1S6Q B;  5F8N A;  4JV2 A;  4ILR A;  4YS2 A;  4LIR A;  5D77 A;  2MLY A;  1IR1 A;  1M1G A;  5DQH A;  1IKV B;  3KUG A;  4ILM A;  2HYI B;  1N5Y B;  3LW5 C;  2RHQ B;  3CJK B;  2DR6 A;  4KH1 B;  1NSA A;  3QIP A;  1PYO B;  2CJY B;  3BGO P;  3RJM B;  2MKS A;  2F4F A;  2GVZ A;  5E41 A;  2HBZ B;  3MCS A;  2HUR A;  2L08 A;  1NKC A;  5LMU F;  4YQW A;  3NCP A;  1B0T A;  3MMA A;  2C3Y A;  1UAW A;  3M6V A;  3J81 U;  1HBM B;  5ETO A;  2QN6 B;  4QIE A;  4F0H A;  4C8L A;  3KLE B;  1JKH B;  4O44 A;  2BMB A;  1VI7 A;  3CCT A;  4ZIV A;  3NY0 A;  1RHM B;  1RE1 B;  4DV4 J;  4JI1 J;  4Y0F A;  3TJA A;  3AXM A;  1JJ2 R;  1QAJ A;  3KG4 A;  1VCT A;  5KFT A;  2G2O A;  3KHR A;  1ZM3 A;  2VKZ G;  4N7T A;  4X64 J;  3DRX A;  3KKF A;  3A1Y G;  4DS4 A;  4HH0 A;  5LSR A;  3DI6 A;  3S01 A;  2C22 A;  2DO4 A;  2UVV A;  4NLY A;  3TOQ A;  2BJE A;  2PMH A;  2P9G A;  3QFW A;  2M7S A;  3C16 B;  1U6Z A;  3RTV A;  2G4B A;  1N8R T;  2IC3 A;  1DFD A;  1Y5N B;  3DXS X;  1YI2 S;  4G1P A;  1F5B A;  3W64 A;  4FPI A;  3SYZ A;  1WKJ A;  1LFP A;  2V8P A;  4ECT A;  4P2X A;  1RIS A;  3ET6 B;  1GMW A;  2BVZ A;  2MPU A;  1FRI A;  1W25 A;  3I4P A;  3T9Z A;  4F0K A;  1YWX A;  2EPI A;  3VQS A;  4CO2 A;  1SB6 A;  4ED2 A;  2VG7 B;  4KYZ A;  3DM2 B;  4KKO B;  2MMY A;  4NXM F;  1RGV A;  4CWB A;  4B9N A;  1TKX A;  3DRS A;  3OV7 A;  3H2V E;  3N4W A;  5C25 B;  1Q53 A;  2X1F A;  3OQ2 A;  5E2Q A;  2RIL A;  4Q43 A;  3R2C J;  4J37 A;  3J7Z T;  1HNX J;  2KXN B;  2QC3 A;  2OUG A;  4YB7 A;  1YJR A;  3QID A;  5KFC A;  3M30 B;  2KRR A;  4C48 A;  1W26 A;  5GAH U;  2R7S A;  4USU A;  2R7T A;  2ZVS A;  2XY6 A;  3I56 S;  2ZHO A;  2Y9H A;  2J5A A;  1JLQ B;  3PX4 A;  2FVC A;  3TJ9 A;  5J1E B;  4ED0 A;  2QG9 B;  1GXT A;  2DGT A;  4YUD A;  4DCO B;  1VQL S;  3KJF B;  1WC6 A;  4RNF A;  5F41 A;  3D54 A;  3KK2 B;  3JSM A;  1U24 A;  3OHA A;  2EFN A;  2LXF A;  4ZVF A;  3RUB L;  4NCG A;  2JZ5 A;  2GIR A;  1ITP A;  3QLH A;  1GX6 A;  1FO1 A;  1T9U A;  2AJQ A;  3HF5 A;  3OXF A;  2CJA A;  1UVI A;  2RS8 A;  3OSN A;  2BBE A;  5KFM A;  4KGX B;  1NDL A;  1RQ0 A;  4GO7 X;  2VON A;  3ITH B;  3DLE A;  1KDN A;  3E01 A;  4I69 A;  4WFY A;  3TQ1 A;  4JI6 J;  4ZLN A;  1IKW B;  1X5S A;  1H74 A;  4IOA Q;  5HJY A;  2HK2 A;  2FTR A;  2HNY A;  1RT1 B;  2VJV A;  4I6Y A;  1YIT S;  3PKY A;  1AFJ A;  3PM9 A;  3RBX A;  2AD9 A;  2I2Y A;  2WTF A;  1G2E A;  2KHD A;  3KLF B;  2RNE A;  2RB7 A;  4F4X A;  1S49 A;  2JDJ A;  3TWZ A;  1XNQ F;  5D6G A;  3PJX A;  5J2N B;  2RDD A;  2ZKU A;  5ETT A;  4CLS A;  2HVI A;  1BMQ B;  2QMX A;  1N0U A;  4DQI A;  2WVD A;  3BYP A;  1JK9 B;  2W9B B;  2LP4 A;  3R5J B;  4BDP A;  2RJZ A;  4UF4 A;  3I5B A;  3KMS A;  1S0V A;  4NX9 A;  3D9B A;  2RDI A;  1Q0N A;  2W2Q P;  4EK2 A;  4HAC A;  5CZX A;  2R2R A;  2D41 A;  1H73 A;  4U6P A;  3THP A;  4LF5 F;  1U25 A;  2BAN A;  3CJ8 A;  4DL2 A;  3DKD A;  4OZJ A;  1I94 F;  1HA1 A;  2LYV A;  2WB1 D;  4LR9 A;  2VG5 A;  2Z58 B;  4L3K A;  1G6B A;  2OTJ S;  1IJF B;  2DRD A;  3V6D B;  2HGM A;  5CQG A;  2ACY A;  1T11 A;  3M32 B;  1J5E J;  2DBB A;  4ICL A;  4XTT A;  3U1L A;  4CM2 A;  3PV8 A;  4ZJO A;  4TVA B;  3DRR A;  3I4H X;  1S12 A;  1RAH B;  3GR0 A;  4CZC A;  3MD1 A;  1NB7 A;  1UVN A;  4NWB A;  3HCX A;  4ZVH A;  2MZR A;  4DFM A;  2GQQ A;  2JEJ A;  4B9L A;  2VFR A;  5D0H A;  2QZ8 A;  2EEY A;  2HEK A;  1PKU A;  5AXN A;  3P4U B;  2OPP B;  1NPK A;  3TI0 A;  5C2C A;  2J9D E;  4OQJ A;  3VGU A;  2V9K A;  3FZ2 A;  3BJY A;  2ZJQ Q;  1MRO B;  1NXI A;  2EFO A;  3PO4 A;  4WKY A;  3D4J A;  3R1L A;  4Z2X A;  1J2V A;  4Y2I A;  4X4V A;  1DLO A;  2H5I B;  4UW2 A;  3H5X A;  2XYG B;  1KHW A;  2WZ1 A;  1S1U A;  2MJN A;  1TQL A;  3DDK A;  1G3O A;  5IQ6 A;  2R8K A;  1RWM B;  3MOJ B;  1H3D A;  2VDI A;  4KHP J;  2ZBR A;  2XEX A;  4DPT A;  1WKL A;  3A3P B;  1H38 A;  2BKP A;  2GV1 A;  2EFP A;  4OL8 A;  3U7J A;  4M5L A;  5I42 B;  4WZQ A;  5BR8 J;  3KMQ A;  3S1T A;  1XQI A;  4NEY A;  3FFI B;  5GAE I;  3A8I A;  2HND B;  3PYD A;  1N34 J;  4ELU A;  1FES A;  5ETV A;  2X7I A;  4EO8 A;  4DSL A;  3HHK A;  4DV3 J;  3M8Q B;  1RUS A;  3CCV S;  1FKA F;  1T9V A;  1UJ4 A;  3POT B;  4DX7 A;  4LR7 A;  2WW4 A;  3KLG B;  1QTM A;  4B3R J;  2QMU B;  3G6X A;  3CSK A;  3Q2T C;  3NAH A;  5KFI A;  2OAU A;  1T9T A;  4X4Q A;  5HVH A;  3HSD A;  5G0R A;  1FJ7 A;  2AYM A;  3W5X A;  2VFS A;  3MM5 A;  5KG4 A;  3MPD A;  2VH7 A;  5HQM A;  2YKO A;  2RS2 A;  2ZBQ A;  3IMQ J;  3JYT B;  4YHH F;  3SV3 A;  4ZK7 M;  4Q44 A;  4EU0 A;  4CQ1 A;  5DG9 A;  4ETZ A;  2GMJ A;  3M8Z A;  3CD6 S;  1X9M A;  4IFV B;  7AT1 B;  1O51 A;  2DPI A;  2CVI A;  1SQG A;  1VRT B;  3TUJ C;  1N54 B;  3DNC A;  4DV6 F;  1HYS A;  2MTL A;  3FKB A;  4AE5 A;  3GSI A;  4CO1 A;  3MPW A;  1OQ6 A;  4CYU B;  2A3J A;  4NRT A;  4FS1 A;  3UNY A;  4DR3 J;  1OWX A;  5LM7 E;  1IBL J;  3RAX A;  2VG6 B;  1BHN A;  5JMN A;  2M3D A;  4MAK A;  5LJ3 Y;  2IFX A;  5HP1 A;  1HLW A;  2Z2M A;  5KFB A;  3OL8 A;  4ZVQ B;  3OXG A;  4A46 A;  1TFY A;  3PX0 A;  4YB5 A;  4P2S A;  1IXK A;  4PYD A;  4PCQ A;  2XMJ A;  2RKI B;  5L8R C;  2HBY B;  5MLC V;  1YKW A;  2BE7 D;  2Y3Y A;  5GMD A;  3NMR A;  2BM1 A;  1KC8 T;  1NLK L;  2HFV A;  3DN9 A;  3I0R B;  4WXW A;  4DFP A;  3D1O A;  4KO0 A;  4NA3 A;  3GB0 A;  4LRD A;  1HD0 A;  1RDR A;  1Y3J A;  1J5O A;  3QGH A;  4J90 A;  4Q0B B;  3J7Y I;  2FC9 A;  5KFG A;  1EZZ B;  5I3Q A;  2XMK A;  4UUW A;  3VZI A;  4F3M A;  3PW0 A;  3ZNU A;  2Q3P A;  1WOO A;  3OTO J;  4F4A A;  1GT8 A;  1BLU A;  1NSQ A;  3ZO7 A;  3BO3 A;  1R0A A;  1TAU A;  2J0W A;  2D74 B;  4OHY A;  2DHG A;  1SL2 A;  2Z2Z A;  3IP0 A;  4DV1 J;  2DR5 A;  4ZHR B;  2UUW A;  1QE1 B;  4TY9 A;  3KUE A;  1KWM A;  5DG7 A;  5FDL B;  1AB8 A;  4P2M A;  2H65 B;  2QL7 B;  3SIP B;  4QW9 A;  1HNI A;  1YJV A;  4U67 Q;  1VQ5 S;  3MMJ A;  1U8S A;  1LWX A;  1S0N A;  4A4J A;  1VBY A;  4JB8 B;  4QWB A;  3GON A;  2LCW A;  4AND A;  5L1K A;  5D4O A;  4UZC A;  4QWC A;  4MFB B;  4KV8 B;  3G96 A;  2K3I A;  2AYB A;  3QFH A;  2OLW A;  1YRT A;  5AXM A;  2KM8 C;  1DAR A;  4JI8 J;  2UXC J;  2CZV C;  1FDN A;  4DPO A;  1LEO A;  5J2Q A;  1JLA A;  1VHF A;  2HQC A;  2X3G A;  4N8N A;  2I9S A;  4F26 A;  1AZS B;  2OEK A;  4HHJ A;  1YHQ S;  2ZD1 A;  1VGY A;  3HKZ D;  1Q1K A;  3CCJ S;  3ENQ A;  1E6V B;  2CQI A;  3D0I E;  5BYR A;  1RT6 B;  4LFB J;  2CPI A;  1JJC B;  4LVN P;  2A18 A;  1DTT A;  1FRM A;  3HHL C;  2CJX B;  2XC9 A;  3OR2 B;  4FBT A;  3Q23 A;  4C8O A;  2IDL A;  1RB0 A;  1TKZ B;  2NS1 B;  1RT4 A;  2U2F A;  4QPT A;  4HI2 A;  5KG7 A;  4ITS A;  2UUC F;  3Q83 A;  3CJS A;  4BC9 A;  3U1N A;  4I1T A;  3ZZY A;  4G65 A;  1HW9 A;  2E5G A;  2PGC A;  1G7C B;  4O3N A;  5D3G A;  3OR1 B;  3QT5 A;  3C66 A;  1FHT A;  3BR9 A;  1XMQ J;  2ATC B;  2BOA A;  3NLC A;  4RLE A;  1XMO J;  2HZC A;  4M5D A;  2MKK A;  4Y2A A;  1WHV A;  3TNV A;  3KLV A;  4XPE A;  5JVH Q;  2NZ4 A;  1JLE B;  3NGR A;  3N28 A;  3HVW A;  3O1L A;  5F9L A;  5AE2 A;  2AYG A;  1ZS6 A;  1KOO A;  1XN9 A;  5CD4 A;  2PC6 A;  2Z56 B;  4CRJ A;  4PG5 A;  3VCD A;  4FVC A;  2H5J B;  2VFU A;  3T5J A;  2DR9 A;  4USV A;  1QY7 A;  1CQM A;  1SCJ B;  1RTJ B;  1RK8 A;  4KSE B;  2CZ4 A;  4UQG A;  1K1S A;  4X2B A;  2XZD B;  1AFI A;  2ZH2 A;  4RNM A;  3NBP B;  1U26 A;  2YKA A;  2I8E A;  5GAE U;  3DLB A;  1NU4 A;  2JNJ A;  4IH7 A;  2DD8 S;  4DV4 F;  2XBP A;  2QYC A;  1OS5 A;  5GAD I;  3TZW A;  2POK A;  2OPR A;  3K5M A;  1M5P C;  1UPP A;  3CNQ P;  4DJB A;  2JC0 A;  2CPF A;  5K14 B;  3GJT B;  2ROP A;  1R0C B;  3HZE A;  5E3C A;  4X64 F;  3NL0 A;  4QPX A;  3GE9 A;  4CLL A;  3QJL A;  3TZY A;  4RW8 B;  3RZA A;  1LXJ A;  3K89 A;  4KRW A;  5HLF A;  3SQO P;  1FK9 B;  2RSQ A;  2EKN A;  1CJU B;  3HSJ A;  1RWO B;  3GFZ A;  2F5G A;  2H51 B;  3DRP A;  4L74 A;  1LWF A;  2KU7 A;  1NJX A;  2HVE A;  2EG1 A;  2PFD A;  5CHC B;  1T7P A;  3SV4 A;  4F2S A;  2CJB A;  5E7O B;  2J9E A;  2XM3 A;  5K20 B;  1FRH A;  2UVR A;  3I9V 9;  2XHW A;  3AXK A;  3ULH A;  1XNR J;  1B70 B;  4ETX A;  3I55 S;  2BKO A;  2OEM A;  4CT8 A;  3EGW B;  4HHH A;  5L39 A;  2P8I A;  2V4J B;  5E3R A;  4LQ9 A;  2MDA A;  2VD3 A;  2XO7 A;  4PR6 A;  3DLG B;  4KGV B;  1WG5 A;  1GQE A;  2MQQ A;  3FDS A;  3R6L B;  3RRH A;  1X5P A;  4KHM A;  2PMW A;  1CJV A;  2YX1 A;  3H7H B;  1MU2 A;  3KFW X;  1SJ4 P;  1SH0 A;  4DL3 A;  8AT1 B;  1WC0 A;  3M8P A;  1EKS A;  1GFW B;  2RIJ A;  1HI0 P;  3QJP A;  3TVZ A;  2XMW A;  1LWC A;  3DMJ A;  3CCQ S;  2DR8 A;  2KM8 B;  1Q4R A;  3DYA B;  1KS2 A;  5C5J A;  3GYN A;  2R7O A;  2XZW A;  2VPW B;  2QE5 A;  2LU1 A;  5B0A A;  1T02 A;  4CTA B;  1S1T A;  2LQ8 A;  5AJ3 J;  2KO1 A;  4DSI A;  2DNM A;  2JVO A;  1T3N A;  3NAI A;  2NSC A;  4DN9 A;  4K0K J;  3J7Y U;  4XPC A;  4PQU B;  1HNV A;  3HHL B;  2VA2 A;  5THW A;  2C3O A;  3T1A A;  3MUV P;  3HVT A;  1D9D A;  3K8V A;  2HQD A;  4JBC A;  1LQ9 A;  1A0O B;  4WTO B;  1J27 A;  1CJK B;  3MR6 A;  5HI7 A;  5L9N A;  3W3S A;  5LXR A;  2VFV A;  3E2E A;  2AU0 A;  3GYG A;  3LAN A;  2DHA A;  2OMO A;  5CAB A;  3V81 A;  5I4M A;  3MEE A;  3M2U A;  3HVA A;  5CYJ A;  4MYT A;  1HMV A;  5AT1 B;  2XNR A;  4I2P A;  3KLE A;  2C2K B;  1JKH A;  2M2B A;  5KT6 A;  1ZM2 A;  1ZM4 A;  3MPY A;  5D0E A;  1CLF A;  1ZAW A;  3GIL A;  4N76 A;  1TL5 A;  4O3P A;  4LIW A;  5U47 A;  2JFK A;  1NJZ A;  1JLB B;  2EC0 A;  2CQG A;  1JMT A;  2VBY A;  5IFM A;  1XR6 A;  2OIH A;  4DZD A;  2F40 A;  2VU5 A;  2GGP B;  1U7L A;  4O23 A;  4USH A;  2OP5 A;  3O8W A;  1T9W A;  4KIA A;  1S1V B;  4N8O A;  2IM3 A;  3QGP A;  1UCN A;  3IWN C;  3A4T A;  4ZCM A;  4GKK F;  2KYZ A;  3SI8 A;  1FKP A;  2KN4 A;  3EX7 B;  4J9M A;  3CTR A;  2W1B A;  2VB6 A;  5KFU A;  2W4C A;  1FVS A;  1HNZ F;  1D1U A;  2K06 A;  4PWD B;  3GPA A;  1YK9 A;  2MLZ A;  3LAK A;  3P5T L;  2YNH B;  3KLH B;  1FER A;  1RT2 B;  2CKW A;  3L4B C;  1QAI A;  4PXB A;  1VHI A;  5CYQ B;  2DNL A;  3VAM A;  4WF9 Q;  1YVF A;  4ZOS A;  4JV1 A;  3W2V A;  2JFD A;  2O66 A;  4EWT A;  2KB2 A;  2NSB A;  3D67 A;  1NPP A;  2HWH A;  3PHE A;  2CUY A;  1EAR A;  4C0H A;  1AUD A;  2Y0B B;  4FP9 A;  2VQE J;  3RYL A;  1V9O A;  2ZIT A;  2G0I A;  3PEJ A;  4ED1 A;  4NCA A;  1V5V A;  1YLX A;  3PRB A;  3R5B A;  1X0P A;  3PHT A;  5F9N A;  2DT9 A;  5F0U A;  3MAH A;  3V4M A;  1B3T A;  2MB0 B;  1Y11 A;  3T9N A;  3LA0 A;  5E33 A;  1CVJ A;  2P6S A;  1K0T A;  1TV6 B;  1HBN A;  2QMW A;  4X4O A;  3MPV A;  4X65 J;  4ALZ A;  3DOK B;  4KHP F;  5ETN A;  2QO3 A;  1NK9 A;  3IGN A;  2FHJ D;  4K4Y A;  1X4A A;  4UY8 5;  2OO4 A;  1OPI A;  3GFY A;  1U4B A;  4IUF A;  2KH9 A;  2C3M A;  3FNN A;  3UD5 A;  2J7U A;  4DUY J;  1N34 F;  2MHN A;  5KT2 A;  4CP5 A;  2IMO A;  1WDT A;  2XLK A;  3FMW A;  5GAD U;  3C19 A;  4DV3 F;  5B0B A;  2HWI A;  4IR1 A;  1UJ5 A;  2ILZ A;  4NCB A;  3QIP B;  5CCM A;  1FJG J;  3GIM A;  2XS5 A;  4RW6 A;  2GVZ B;  5KFP A;  3SCL E;  4EO6 A;  4C97 A;  4B3R F;  1GH8 A;  3FGV A;  3FBB A;  3R7B B;  1JIH A;  5A6W A;  2V68 A;  3PY8 A;  1IKW A;  2JVR A;  1Q7L B;  2YNG A;  3MAA A;  3E51 A;  1N5Q A;  2F3J A;  2OEL A;  3SSQ A;  1WC5 A;  1YIJ S;  4O44 B;  2L41 A;  1WI8 A;  4ZMM A;  3IBW A;  2YXL A;  3Q8U A;  4IQM A;  4ZLL A;  1VQS A;  3KLF A;  3QPI A;  4NMX A;  3ZTP A;  2XLJ A;  3M05 A;  3CIZ A;  2V4Q A;  3TAQ A;  1FDB A;  5A2Q U;  4HVZ A;  4PG7 A;  3A8E A;  1U1N A;  1V3R A;  4W90 B;  1Q8B A;  2V94 A;  3KUH A;  1XTZ A;  3GZ7 A;  3O2I A;  1QUV A;  2JWN A;  2IVM A;  2BE2 A;  3CJ4 A;  3I6P A;  3SCK E;  2HBR B;  3TW0 A;  4DR3 F;  1FTR A;  1RAF B;  2R7X A;  4ECX A;  1IBL F;  1NK5 A;  3MCN A;  2IC3 B;  4WPA A;  4IO9 Q;  4KTQ A;  3MEG A;  3GCW P;  4DF8 A;  1NH7 A;  3GJS B;  2JL9 A;  4OX9 J;  4DQS A;  1A7G E;  4PUO A;  3TO8 A;  4M95 A;  2JLE A;  1IN0 A;  4X4P A;  3M8W A;  1UZD A;  3R27 A;  3BN4 A;  4CH0 S;  3M6X A;  4N5S A;  4TQS A;  3CDU A;  3KG0 A;  3UR0 A;  3HHE A;  4YB1 P;  1TKX B;  3QAU A;  3LOU A;  4OZ1 A;  2HHH F;  4WYL A;  1L3K A;  2XWY A;  3WDO A;  4O0N A;  4FYW B;  2DGV A;  1F9F A;  2E66 A;  2CJK A;  4QR2 A;  1VK8 A;  3L9Z A;  2FPH X;  1KOH A;  4B9U A;  1VIS A;  4MYU A;  4PWW A;  3UW1 A;  3JTO A;  1S4F A;  2BM0 A;  4X62 J;  1NK8 A;  3FEZ A;  1QD1 A;  1C1C A;  4DV1 F;  2AHO B;  2NRE A;  3W5Z A;  4DU8 A;  2W9A A;  2WVC A;  2R8J A;  2FHO B;  3OVS A;  2YKN A;  3ILO A;  2OJ3 A;  1HBU A;  4JI4 F;  1TR0 A;  4DLG A;  4LUB A;  4PG8 A;  4LRE A;  2AJF E;  4ECV A;  2W01 A;  1FT8 A;  3H59 A;  1WG1 A;  1UEV A;  5MAO A;  3QWU A;  4OI0 A;  1JXV A;  3R6G B;  1IJE B;  2BOP A;  4ER8 A;  3KHH A;  3JSM B;  4JI3 F;  4DPX A;  1HNW F;  4DUT A;  5DGA A;  1KN6 A;  4BLG A;  2L9W A;  3C8Y A;  4CO3 A;  3QLH B;  4DZ6 A;  1RTZ A;  3HD1 A;  2I6W A;  1YG0 A;  2UXC F;  4KHR A;  1RWN B;  4NAS A;  4OYA A;  5DDP C;  3BN7 A;  1R89 A;  1N32 J;  4I64 A;  4RW9 A;  1GMV A;  1IKX B;  1KON A;  2H4Y B;  3DLE B;  1HI8 A;  2FJB B;  3E01 B;  3TAN A;  3CC4 S;  2DNQ A;  4OHW A;  3BKT A;  4R8U A;  3BBC A;  5KFR A;  3CCW A;  3EDR B;  3OTB A;  4OLO A;  4JV5 F;  2FJW A;  3F41 A;  2F65 A;  1DY3 A;  5EX3 A;  2UP1 A;  2QX0 A;  4LF8 J;  2G1H A;  2OI2 A;  4AD6 A;  1SJF A;  2ZOG A;  4OZN A;  3HKW A;  5FD1 A;  4ZPW R;  2KDO A;  3L7U A;  1FD2 A;  1P8G A;  3CDE A;  4DQQ A;  3OTC A;  2DB1 A;  2QYG A;  4IFV A;  2R4F A;  3UDE A;  2DGQ A;  3KHG A;  1UVJ A;  3QQC D;  4HAC B;  4DSE A;  1SC3 B;  1XMO F;  3DHW C;  4D3H A;  4NXN F;  2BAN B;  3OT9 A;  5KT4 A;  2G2Z A;  2XUL A;  4HH1 A;  2VG5 B;  3PW2 A;  3D6T B;  2PEH A;  2RQC A;  5B09 A;  2HIY A;  2AYE A;  4ICL B;  3D7S B;  1MNE A;  2F63 A;  2VC1 A;  4AL7 A;  3OW2 R;  1FCA A;  2PMZ D;  4EI2 A;  3C14 A;  1NK4 A;  1H2V Z;  5FJ4 A;  4QJV A;  4Y2M A;  1WG4 A;  2DY9 A;  5KFN A;  1REV A;  2CPY A;  4NYP A;  3K7R A;  4B3O A;  1Y10 A;  2A1B A;  2QRR A;  3UE2 A;  1EHW A;  5BJR A;  2ALY B;  2K7J A;  3W62 A;  2C3P A;  1D0E A;  2ZWP A;  4YR2 A;  1ZZF A;  3BSN A;  3THV A;  2H5E A;  4I2Q A;  1R8B A;  2V2K A;  1S6P A;  5F3T A;  2FHJ A;  4Z7Y A;  6FDR A;  4L75 A;  4OFZ A;  1JJ4 A;  2UUB J;  1U49 A;  1DLO B;  3H2U B;  3X3U A;  1U2C A;  4CNY A;  1FKO A;  2CVE A;  1SL1 A;  2FLP A;  1TAQ A;  4FXV A;  4IRC A;  1S1U B;  2N3L A;  2HLU A;  2WOM A;  1S76 D;  4LBH A;  1ZAV A;  1RTD A;  1QE1 A;  4RL1 A;  8RUC A;  2PII A;  2J9D A;  4FKX A;  5IZH A;  1XK8 A;  3RU0 A;  1C0T A;  2XZT B;  3DHX A;  4LFC F;  3N9U C;  3KTQ A;  3ZTR A;  2VJU A;  1LXN A;  3CJQ A;  1WKK A;  1Q16 B;  1KLM A;  2UXD J;  2UZA A;  3ONQ A;  1L3S A;  1RT7 A;  2XNQ A;  2CPX A;  1XNR F;  4EEY A;  4IKA A;  4AFF A;  2ZE2 A;  4EGL A;  3AJ2 A;  5DO2 A;  4NZ6 A;  4TU9 A;  3OD2 A;  1ICE B;  1Q8K A;  3I82 A;  3PCO B;  1VIO A;  4DX5 A;  2H1Y A;  4CH7 A;  2YBV A;  3QSY B;  3QGI A;  1Q95 G;  1E6V A;  3I0S A;  4I7F A;  1WHY A;  3F73 A;  1EET A;  2ALZ A;  2HHV A;  2RE1 A;  4NI2 A;  5G0R B;  3D3C J;  4Q7A A;  2R2U A;  1FI4 A;  4FYD A;  4NLS A;  4B9V A;  2F4V F;  3ENA A;  5A8W B;  5KFF A;  4LSL A;  1TKD A;  4DPY A;  1B7F A;  1M0S A;  1EJ7 L;  1TL1 A;  1KQF B;  3HSZ A;  3RBD A;  1PG5 B;  2V5H G;  2IBK A;  1M5K C;  4P9S A;  3HHD A;  3G82 A;  5L1J A;  2LDI A;  2DH8 A;  2M88 A;  1I1G A;  4ECS A;  4JV0 A;  1CS4 A;  2AKW B;  2V2V A;  3UR3 C;  5AJ3 F;  1PJ5 A;  3K5P A;  5IM0 A;  4CLK A;  1HYS B;  2QL5 B;  2QFJ A;  1NHU A;  4G6V B;  1R6V A;  1CUL A;  2YVS A;  5EUH A;  2RH3 A;  2GNK A;  5AXK A;  2PD1 A;  2Z0G A;  5HP1 B;  1RHJ B;  2W9C A;  4N41 A;  1BUX A;  3SDE A;  1HQE B;  1RHK B;  1MMN A;  3P6Y C;  3HHN B;  4QWA A;  4KPY A;  4L72 B;  2D9O A;  4H54 A;  2LQ9 A;  2EBG A;  2KZM A;  2DGU A;  4V19 J;  1QSY A;  4WP8 A;  1IKY A;  2MZ1 A;  3CC2 S;  1PJ7 A;  1RAE B;  1ZTT A;  4A48 A;  4C8Y A;  4YEA A;  1NB2 A;  1JNR B;  3VR1 A;  4USW A;  5LOQ A;  1R8C A;  4KO0 B;  4A8M P;  2P6T A;  3G2X A;  4DPU A;  3T1Y J;  4Y34 A;  1RAI B;  1J5O B;  1LK5 A;  3NGD A;  1RLD A;  3HPO A;  1TFW A;  4NZ0 A;  5D4P A;  3GIJ A;  5A8K A;  2FJX A;  5IXU A;  2IM0 A;  2KFZ A;  4KE5 A;  4FF1 A;  3OXL A;  2E29 A;  3OHB A;  1R0A B;  1R3N A;  2NR0 A;  3BQ2 A;  1VQ7 S;  2AZ1 A;  1ZPV A;  2ZNZ A;  3BPS P;  4NLX A;  1X4B A;  1N5T A;  2ADC A;  4LF1 A;  5M2R A;  3QSI A;  3MTJ A;  1R7I A;  3M2R A;  2W25 A;  2W2O P;  3AFG A;  1HNI B;  1F9H A;  3SFU A;  4GC6 A;  4A8Q A;  1D8Z A;  2O01 C;  5KFK A;  3VGS A;  3GP9 A;  3JTP A;  3L7O A;  4H4O A;  2AZ3 A;  3AQO A;  1Y7P A;  4G1I A;  5KG5 A;  4I0W A;  2WHO A;  2B3T B;  3K17 A;  4GKJ J;  4FKY A;  4HLB A;  2XWX A;  2MXY A;  3I31 A;  4UOH A;  2C2N A;  4HR2 A;  5ETS A;  4MKY A;  3MM6 A;  2QV6 A;  3LTO A;  5HAN A;  1SC1 B;  1JLA B;  1V6H A;  2V4J A;  2KRB A;  2UU9 J;  2VQE F;  2Z2L A;  1VLY A;  2BJD A;  2MZQ A;  3MM9 B;  3N5B A;  5HMZ A;  1DTT B;  1Q7Y T;  5L1I A;  4ZVR B;  1UP1 A;  4NYO A;  1F5C A;  2UXB J;  3PW7 A;  3FZB A;  4RJV A;  1UFL A;  1UWA A;  1RT4 B;  1T8E A;  1BWV A;  2RT3 A;  4OI1 A;  3MM8 A;  4X4S A;  2ABY A;  4DQP A;  1BQX A;  2YPZ A;  4WTY A;  1RAA B;  4BBY A;  4LF7 J;  1R8P A;  4OYO A;  1JX4 A;  3NGT A;  3ELH A;  1SKS A;  2H4W B;  2JC1 A;  4ENO A;  2GQ2 A;  5IV3 A;  5D3G B;  2BZ2 A;  1H98 A;  3V4I A;  3IM9 A;  4FZV A;  3W61 A;  4BC7 A;  3UVJ A;  3HT3 A;  1GMU A;  4FNI A;  5KFW A;  3MUM P;  2MGZ A;  2VHG A;  4ZCL A;  1GXL A;  5J1N A;  4DV6 J;  2R2T A;  1QJH A;  3D6M B;  3L09 A;  2VC0 A;  1FXD A;  3WZ0 A;  3CJ0 A;  3EVW A;  3LP1 A;  1U6B A;  2CYY A;  1E6Y A;  3IA0 A;  4J9N A;  4UOF A;  1FJG F;  5HQL A;  4MKA A;  3H0P A;  1S1W B;  1XMB A;  3C15 B;  3H90 A;  3QWP A;  3NGK A;  4HT5 A;  3PYF A;  3ZTS A;  4WYW A;  4W4M A;  1CJK A;  3M7V A;  1U1K A;  2B9E A;  2NQP A;  2WVF A;  1IBM F;  1GNK A;  3TVK A;  3S8S A;  4E2F B;  1IBK J;  3H8Y A;  2FVQ A;  2G0C A;  2GA7 A;  3KK3 B;  2R8H A;  1MWY A;  2ASY A;  4J9K A;  4DR1 J;  1NK7 A;  4P75 A;  3RAM A;  4TLR A;  2HGL A;  4K5R A;  4QBU A;  3OFG A;  4DX8 H;  1U0H A;  2VBW A;  1I5O B;  1LWE A;  2PT0 A;  3LP2 A;  1T9X A;  2OPR B;  5F8M A;  4ID5 A;  4NA2 A;  3UI3 A;  1JLB A;  4K4Z A;  5KFY A;  1SKW A;  1TTH B;  5HLF B;  1K1Q A;  2DGO A;  3Q8Y A;  2QJ3 A;  2DRB A;  3EIC A;  2WBM A;  4NLR A;  3M1V A;  3GMG A;  2A10 A;  5HRO A;  4URQ U;  1OIA A;  2DXE A;  1NKE A;  3EZO A;  1S5Z A;  3SFG A;  3IG1 A;  3DGP B;  2J0S D;  1EQM A;  3DRP B;  4TN2 A;  4K4S A;  1LWF B;  2D69 A;  1R8H A;  3GG1 A;  4M5N A;  4QCL A;  1KFD A;  5K8N A;  4P71 A;  3Q8P B;  2YPY A;  4JI5 F;  3BBF A;  4CLW A;  2LA6 A;  1NK0 A;  2YWH A;  2YNH A;  3KLH A;  1PBU A;  4YN3 B;  2B4V A;  3CF5 Q;  4DL5 A;  5KT5 A;  1U48 A;  3UDV A;  1RWU A;  2DXF A;  1M1K T;  2NYH A;  1S72 S;  1DUR A;  3G6E S;  2JSX A;  3UWT A;  2ZBC A;  3IR5 B;  4MKV A;  1NH8 A;  1B0V A;  3UFC X;  3BGL A;  3KJV A;  1REG X;  2K2P A;  1TKT A;  4FVM A;  1GK8 A;  3GQC A;  4F8R A;  1HWU A;  2E7V A;  1VBX A;  5ETQ A;  1RHU B;  1SL0 A;  3DLJ A;  1CJV B;  1HWK A;  2B43 A;  1K44 A;  1RCO B;  3WX8 A;  2WSC C;  1MU2 B;  1K73 T;  2DNH A;  4MH8 A;  1L3U A;  1RTI B;  3MHY A;  2ZOM A;  4ES3 A;  1TV6 A;  4DV5 J;  3M8P B;  3GWC A;  2V8G A;  3IRX A;  1C4C A;  4O3R A;  1LWC B;  3DMJ B;  1IUJ A;  3DOK A;  1VQO S;  3FSI A;  1M90 T;  2H54 B;  1FWP A;  4CT9 A;  1OJ4 A;  2W8K A;  2I38 A;  1KKH A;  2Z57 B;  4ED8 A;  1WC4 A;  4P10 A;  3ZNJ 1;  3QNW B;  4MK7 A;  1HD1 A;  1S1T B;  4DQR A;  1WF0 A;  1NM2 A;  2DH9 A;  1TU0 B;  2QA4 S;  2J9C A;  4DFJ A;  4KJI A;  5C2G A;  1HNV B;  4RW4 A;  1TL4 A;  4ZIT A;  3HVT B;  3OTD A;  4DF4 A;  4HDH A;  3CMQ A;  1KVJ A;  4KFB A;  5GMK a;  4PG6 A;  2RDJ A;  2AEF A;  1N32 F;  4TXS A;  2YX4 A;  2ZZN A;  5BYQ A;  2MQM A;  1NHV A;  3QRQ A;  2X1B A;  1PIE A;  2AX0 A;  2C2R A;  1V3Z A;  4KB7 A;  1RBA A;  3V81 B;  3MEE B;  4ZVU B;  2C2O B;  4L76 A;  3PZP A;  3M2U B;  4IH6 A;  4K2X A;  2A2C A;  3HVR A;  4O0I A;  1HMV B;  1L3T A;  1FDA A;  4I2P B;  4LF8 F;  4OI4 A;  4Y3C A;  3RG6 A;  5IC4 B;  1WWH A;  1UL3 A;  4Z37 A;  2RUG A;  2CPE A;  1QM9 A;  3OTE A;  5DQG A;  3MCO A;  2DNN A;  3PAC A;  1JJH A;  1TMM A;  2LKZ A;  3BGF A;  1VMB A;  1RSC A;  1VK3 A;  5B7W A;  3CJ3 A;  4BWJ A;  1PC4 A;  1S1X A;  4RNH A;  5A8R A;  4LRA A;  4OYX A;  3LH2 S;  1U1P A;  4N56 A;  3M9O B;  3DU5 A;  1ZH5 A;  1ZM9 A;  3B4D A;  1FKP B;  2E5I A;  1NSK L;  4QIV A;  5D15 A;  3OFF A;  3W1Y C;  3C6U A;  1F9E B;  4MIA A;  1NUE A;  3Q2S C;  1VQ8 S;  2RQM A;  3ISN C;  3D0H E;  4C0O C;  3TRG A;  3ETM A;  3HZG A;  4CLY A;  2PFF B;  3VQT A;  5AXL A;  1WSR A;  1U6F A;  1WEL A;  2EVZ A;  3D5M A;  1NND A;  4OZ3 A;  3W2V B;  4N77 A;  3M6W A;  2ZH9 A;  2YQ3 A;  4OX6 A;  2EK1 A;  1JLF A;  4B9M A;  2QEX S;  2CAD A;  5ADZ A;  4GC7 A;  4WCE Q;  1HL6 A;  3WIV A;  3EZ5 A;  5DM6 Q;  2RRA A;  3HO1 A;  2CNN B;  1MSW D;  4IR9 A;  3EJM A;  4NLG A;  2HS0 A;  2V4R A;  5LSO A;  2ZDO A;  5D8H B;  3ENW A;  2UUB F;  4RU9 A;  3NEK A;  3IN5 A;  1WOP A;  1VQP S;  5M2P A;  5T14 A;  1N6Q A;  3T41 A;  3DOM A;  3R7N B;  4CLU A;  5KFQ A;  2XGQ A;  1HBN B;  3D2W A;  2CXE A;  2PO4 A;  1PGZ A;  4ZCK A;  3SBM A;  5DRK A;  4ZPD A;  4JUZ A;  4DR6 F;  3SZ2 A;  4KGM A;  2AEM A;  5FII A;  1WJ9 A;  2DNK A;  3FRZ A;  1NHK L;  2M0G B;  2UXD F;  4C7Q A;  2J6U A;  2DGW A;  3OL7 A;  1D9F A;  2E5J A;  3EMT A;  3CJ2 A;  4GO5 X;  4CLF A;  1LV5 A;  1KVK A;  1HWI A;  2DIT A;  2H3E B;  3CCE S;  4LVO P;  2Y1R I;  3E8O A;  1OSC A;  1Y00 A;  2OHD A;  3I32 A;  3R8Y A;  4DPW A;  2ZC3 A;  1KSP A;  3LPY A;  3DRY A;  4RW6 B;  5J2M A;  1IKX A;  1SJQ A;  2Q6C A;  2XGP A;  2VPZ B;  4OHV A;  2VOD A;  2FZC B;  4WFB Q;  4MJK A;  1N36 J;  4FXW A;  1FVQ A;  2FQQ B;  1DHM A;  4OJ1 A;  3LGH A;  2MYF A;  2GO9 A;  1Q82 T;  4XO0 A;  2O67 A;  5JXS A;  2HS3 A;  2YNG B;  4FF3 A;  3MAA B;  2EFQ A;  4AXI A;  3MXH P;  2LXI A;  2CQ3 A;  3ZC4 A;  4OI3 A;  5HK4 A;  5C7P A;  2ZOF A;  3AA9 A;  3Q24 A;  2QIF A;  5K9F A;  1V5I B;  2Q43 A;  4DOZ A;  3J80 U;  1EB0 A;  5LSL A;  2BR0 A;  2B7C B;  2K8G A;  1HKA A;  4P52 A;  4FS2 A;  5IT4 A;  4DX6 A;  4U8Y A;  1OMS A;  1U1L A;  2L9D A;  1TMJ A;  2MY7 A;  2XCP A;  2BRL A;  2K3K A;  1DRZ A;  4C98 A;  2BE2 B;  4Y2K A;  4NLU A;  3BZQ A;  3MOZ A;  3Q0A A;  1P9Y A;  4P74 A;  2ASD A;  2AQ4 A;  2GHV C;  1HR0 F;  1ZA2 B;  4D3G A;  3D66 A;  4GKK J;  3EPG A;  2OPS A;  1D8Y A;  4KGZ B;  3MEG B;  4DL4 A;  4LR8 A;  2E7W A;  2L3M A;  3P3D A;  4QIW D;  2Y1L B;  1KTQ A;  4YOE A;  1QVF R;  4OMF G;  1CC8 A;  2O3D A;  2MEW A;  1HNZ J;  1XR7 A;  3MZI A;  3CD0 A;  4PUO B;  6FD1 A;  2FC8 A;  4LF2 A;  1FF2 A;  3V5R A;  3R7S B;  1QUP A;  5D0G A;  4M63 A;  4PXE A;  2YWW A;  2KXF A;  1QSL A;  1SH3 A;  3NGU A;  1N4L A;  1S4E A;  3DLK A;  1BGX T;  3BQ0 A;  4ZPB A;  2XY7 A;  1GX5 A;  2GW8 A;  2NPI A;  1KVI A;  3F0N A;  4AUK A;  2BXJ A;  2ASL A;  1L3V A;  1HQ2 A;  1S48 A;  4B3S J;  2KT3 A;  4O4G A;  1XJW B;  2N82 B;  1S9G A;  2VOO A;  1UZH A;  3T1Y F;  2MKY A;  2J7K A;  4F4K A;  3Q8V A;  3I96 A;  4RNO A;  3LWM A;  3EGZ A;  4ZP6 A;  2NCK L;  3MMB A;  4NML A;  1IR0 A;  2WK4 A;  4NRU A;  2FGO A;  3CDA A;  4YP3 A;  2O1P A;  4ECQ A;  1M5H A;  3DOL A;  4ID8 A;  1C1C B;  5IT9 Y;  1BXN A;  4XK8 C;  3LQV A;  2MQ8 A;  4OZ2 A;  2YKN B;  1HBU B;  3W5Y A;  2AX1 A;  2QTW A;  1CPZ A;  3MM7 A;  2QLJ B;  2XSF A;  1GTE A;  3CME S;  2D3O 1;  4HEA 9;  2JHE A;  3LAL A;  2HAF A;  3AD9 C;  2JH3 A;  3NCQ A;  4S0M A;  1SC6 A;  4GKJ F;  4PG4 A;  4BCA A;  4DUZ F;  4RX6 A;  4DR5 F;  1S59 A;  3GCX P;  1CQN A;  4NOH A;  3MED A;  4F4Z A;  2V2Z A;  1U45 A;  1EKR A;  1WF2 A;  4PZV A;  2XQC A;  4DR4 F;  3CE8 A;  1XBW A;  4RW9 B;  3VF0 B;  2IJF A;  2UU9 F;  3D28 A;  4E98 A;  2RRN A;  4TLQ A;  4MKB A;  3KNA A;  4R8U B;  2NUH A;  2CPH A;  2HK3 A;  1Q79 A;  2XS7 A;  4Y00 A;  4C6A A;  1X4D A;  2OD6 A;  1IBC B;  2CIM A;  3B6B A;  4U7U D;  2DRA A;  3Q8Q B;  4KR0 B;  4B9T A;  2UXB F;  4IG0 A;  4F4W A;  1SQF A;  3QMQ A;  4MT1 A;  3NGS A;  3BKF A;  5A8W A;  3X1L B;  1SIW B;  4HTI A;  2CG4 A;  2EG2 A;  4HI1 A;  2VBZ A;  1U1O A;  2V2Q A;  2CA9 A;  4LF7 F;  2M4M A;  3M4X A;  2IBO A;  1KQG B;  3HSG A;  3D6H B;  1CSJ A;  2IYI A;  4RBV A;  4QR0 A;  4URS A;  4M5K A;  4RBT A;  4LF9 J;  3M6U A;  3C2P A;  2PEB A;  2V69 A;  5KG2 A;  2B6A A;  3T6J A;  1RT5 A;  5JVG Q;  3RBZ A;  4YY3 J;  1RXO B;  1UJ6 A;  4DL6 A;  5HAT A;  2LFV A;  3LPE A;  3TZX A;  4DDF A;  2XI2 A;  5E3P A;  2DNO A;  2HBQ B;  4USJ C;  1LNQ A;  3TYT A;  4G1Q A;  1HQE A;  2IYG A;  4IDK A;  1RP5 A;  2XMT A;  2BE9 B;  3FJ2 A;  2B51 A;  3BM7 A;  3QZ7 A;  2HMI A;  2MKJ A;  3C14 B;  1IBK F;  1F3V A;  1T05 A;  2D3U A;  3EVM A;  2GX8 A;  1BY9 A;  2M9K A;  3BH7 B;  1REV B;  1X31 C;  2LEC A;  3GV8 B;  4B3O B;  4DR1 F;  1QSS A;  1YTY A;  3UCG A;  1D9A A;  1VYA A;  4RW7 A;  3U27 A;  4R0E A;  4DSJ A;  4ZDN A;  2HFS A;  3KNG A;  5DQI A;  2HHH J;  3K5N A;  2NLW A;  2VBX A;  4JI0 J;  1AA1 B;  3AB2 B;  3PIO Q;  4UQT A;  4Q8E A;  4I2Q B;  3I5C A;  5HQ8 A;  3T1H J;  1T03 A;  1S6P B;  2YH0 A;  1UA0 A;  2JLF A;  3PR4 A;  1NME B;  2VUG A;  3CO9 A;  4DS5 A;  2FJE B;  4ED5 A;  2LA4 A;  1FKO B;  1Y4Z B;  3R5C A;  3VAH A;  1W2I A;  4E0D A;  1H2T Z;  1S0M A;  2BQ3 A;  2GVD A;  2DTJ A;  3GIR A;  2WOM B;  2HFZ A;  5DET A;  4UT4 A;  1RTD B;  1TK5 A;  1ZET A;  1HQU A;  2U1A A;  1C0T B;  2ZH8 A;  2CPZ A;  4L6V 3;  1YX2 A;  4JI4 J;  2X3D A;  1PSD A;  2K1R B;  1RTH B;  1KLM B;  4ZP9 A;  1OPZ A;  4JI7 F;  2YWK A;  2ZJP Q;  3GFX A;  2FVS A;  4JI3 J;  3G8T A;  1HNW J;  1RT7 B;  2W7P A;  4NYZ A;  1DAX A;  5IT0 A;  2LQB A;  3JAM Y;  2ZE2 B;  2A0F B;  3H4D A;  3CJT A;  4QZV B;  4F25 A;  2CQ1 A;  2JLG A;  1KLN A;  2UV8 G;  4KPC A;  1N33 J;  2G0J A;  4ZA1 A;  4P72 A;  2MHE A;  1VQ9 S;  1B7Y B;  4FNH A;  2EXU A;  1LW2 A;  2A6O A;  2VDH A;  4ZCI A;  1N52 B;  3OFE A;  4Y65 A;  2GC8 A;  3OLB A;  1UWB A;  3EXC X;  3I0S B;  4I7F B;  4YME A;  5IS2 A;  1EET B;  3MD3 A;  4ZP8 A;  2V50 A;  3RB0 A;  3LGM A;  3MM9 A;  4A8F A;  4NI2 B;  3FEX B;  2AJ0 A;  1M5O C;  1KD1 T;  3B4M A;  2EBE A;  3QBC A;  3PYG A;  3AOA A;  4JV5 J;  4LSL B;  2CJQ A;  5D78 A;  2VF3 A;  2WON A;  1UPM B;  3KJQ B;  4DV5 F;  4YDD B;  1TL1 B;  2DHH A;  3I9Z A;  4RBU A;  4DMZ A;  3CCL S;  4WFZ A;  1KP6 A;  1NPR A;  1N5S A;  2QA1 A;  1NZA A;  1QAX A;  2W2P P;  2OFG X;  3G82 B;  2QL9 B;  4WBF A;  5F8G A;  3B8H A;  2OSR A;  2VKR A;  2QT7 A;  1K47 A;  4XIU A;  3EM1 A;  1CJT A;  2VOP A;  5CAA A;  2ACM A;  4UY8 T;  1FX2 A;  1CS4 B;  3H4B A;  2KHC A;  3D1Q A;  4MIB A;  3G71 S;  3BQ1 A;  2MQL A;  4OHX A;  4TY8 A;  5IM0 B;  1CUL B;  4R25 A;  4NXN J;  1YZ6 A;  3U1M A;  1JXL A;  3IWL A;  3VAJ A;  1FRJ A;  1C2P A;  4EMD A;  3MMC A;  3AJ1 A;  5A6P A;  2EWH A;  4ILL A;  2QLW A;  2V8D A;  1H0H B;  1WSV A;  2BKN A;  2ZFH A;  3Q22 A;  2W9C B;  3BSC A;  3SDE B;  3R5G A;  2CNL B;  1S1W A;  3C15 A;  5B0D A;  4J9L A;  1PAE X;  4H4K A;  2X1A A;  2HFU A;  4B08 A;  3IBC B;  1BWE A;  3MEK A;  1YJ7 A;  2GJF A;  3MDF A;  3G9C A;  5B0E A;  1ZAX A;  5DZ7 A;  4JP8 A;  1Q8L A;  2CQ4 A;  3PFE A;  1IKY B;  3P8B B;  1C0U A;  3RRK A;  2DPJ A;  3KK3 A;  3MAQ A;  2WB4 A;  4I6A A;  2KTQ A;  1Z4U A;  2FVR A;  2NUU G;  5CCL A;  3MFI A;  1MLA A;  2WRM A;  2N7Y A;  5CH7 B;  1SC4 B;  1OYD A;  3BYR A;  3VAF A;  3K59 A;  3AD7 C;  5A8K B;  1HI1 A;  3AB4 B;  3TJ8 A;  3NWR A;  4WP9 A;  4NLD A;  4J7C A;  3T19 A;  3JQM A;  4FF4 A;  2KJV A;  4DWI A;  1HHQ A;  2J0Q D;  2LQJ A;  4LQ3 A;  3MGJ A;  1TVR A;  1X4F A;  1U09 A;  5DDQ C;  4CH1 A;  1U02 A;  4OIX A;  4ECZ A;  5D0R A;  3HMJ G;  1Z2L A;  3M2R B;  3DGP A;  3R2D J;  2JJ4 D;  2OGU A;  3CCS S;  3D0G E;  5IT9 U;  3OJS A;  4LFC J;  4A47 A;  2MKH A;  4AYB D;  3VHQ A;  5JJB A;  3JQJ A;  4H4O B;  4Q5V A;  2GAG C;  3BV8 A;  3BO2 A;  1WC1 A;  4ANE A;  2B5J A;  3LGN A;  3HP6 A;  1EAY C;  3LUY A;  5E3A A;  1RYS A;  2IAJ A;  1FA0 A;  4F36 A;  1HWJ A;  4DR2 F;  3W8G A;  1U8W A;  2WW8 A;  2KXH A;  3THT A;  3V6K A;  3MM6 B;  3W8P A;  1C1B A;  2FYX A;  3NRB A;  2E7X A;  1IQT A;  1SQE A;  1JB0 C;  3RW7 A;  4WE1 A;  2J6S A;  2MQP A;  4ELV A;  4KT0 C;  5L38 A;  1QLN A;  3PEH A;  3BR8 A;  2HPU A;  2NXN A;  2ATL A;  4ZVT B;  2I0X A;  2BJ3 A;  8ATC B;  1PYS B;  1MMD A;  2Q1L A;  4CCH A;  5HMY A;  4TYA A;  2F4V J;  2YNI A;  1K8A T;  3R3T A;  1RTI A;  1UA1 A;  2FHK A;  1UKU A;  4EYH B;  3MM8 B;  1WHX A; 
#chains in the Genus database with same CATH homology
 1WC5 A;  4NI2 B;  2GVD A;  1CJU B;  4CLZ A;  1CJV A;  4CLW A;  4OYP A;  1AZS B;  1YK9 A;  1WC1 A;  5D0H A;  4CLF A;  1WC3 A;  1U0H B;  4P2X A;  4OYM A;  3ET6 B;  4OYZ A;  1CJT B;  1WC4 A;  3C16 A;  5IV4 A;  1WC0 A;  1WC6 A;  4CLP A;  3UVJ B;  4CLS A;  4OYA A;  4NI2 A;  4USV A;  1CJU A;  3MR7 A;  4OYI A;  1YBT A;  4CLT A;  4OYB A;  3G82 B;  3C14 B;  4OYO A;  1AZS A;  4OYW A;  5D0E A;  1AB8 A;  1U0H A;  4OZ2 A;  3ET6 A;  4WP8 A;  4P2M A;  1CJT A;  5IV3 A;  1FX2 A;  1CS4 B;  4OYX A;  4WP9 A;  3UVJ A;  4CLU A;  2WZ1 A;  4P2F A;  2BW7 A;  1TL7 B;  4USW A;  5D0G A;  3MAA B;  2GVZ B;  3G82 A;  5D15 A;  3C14 A;  4WPA A;  1CUL B;  1FX4 A;  2QV6 A;  2GVD B;  1CJV B;  4WP3 A;  4CM2 A;  1CS4 A;  1Y11 A;  4CLY A;  1Y10 A;  2W01 A;  5D0R A;  1TL7 A;  4UST A;  4CM0 A;  4CLL A;  3C16 B;  3MAA A;  4USU A;  3C15 B;  4CLK A;  3R5G A;  2GVZ A;  3C15 A;  1CUL A;  1CJK B;  1YBU A;  4OZ3 A;  1CJK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...