3C14A

Complex of gs-alpha with the catalytic domains of mammalian adenylyl cyclase: complex with pyrophosphate and ca
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
189
structure length
189
Chain Sequence
MMFHKIYIQKHDNVSILFADIEGFTSLASQCTAQELVMTLNELFARFDKLAAENHCLRIKILGDCYYCVSGLPEARADHAHCCVEMGMDMIEAISLVREMTGVNVNMRVGIHSGRVHCGVLGLRKWQFDVWSNDVTLANHMEAGGKAGRIHITKATLSYLNGDYEVEPGCGGERNAYLKEHSIETFLIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Adenylate cyclase type 5
publication title Structural basis for inhibition of mammalian adenylyl cyclase by calcium.
pubmed doi rcsb
source organism Canis lupus familiaris
molecule tags Lyase/lyase inhibitor
total genus 50
structure length 189
sequence length 189
ec nomenclature ec 4.6.1.1: Adenylate cyclase.
pdb deposition date 2008-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00211 Guanylate_cyc Adenylate and Guanylate cyclase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1230 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleotide cyclase 3c14A00
1AZSB 2QV6A 4USUA 4P2XA 1WC4A 1CJKA 4USVA 1CULA 4CM0A 4CLKA 3MAAB 2W01A 3ET6A 5D0RA 3C14A 1TL7A 1WC6A 3UVJA 4CLWA 4OYAA 4WP9A 1CJVA 1FX2A 1CJTB 4CLUA 1WC0A 3C16A 2GVZB 4OYBA 1YBUA 5D0HA 4OZ2A 4CLPA 4NI2A 1WC5A 4OYZA 4WP3A 4OZ3A 1YK9A 3C15A 4USWA 1CJUA 1CS4B 2GVDA 5IV3A 3G82B 5D15A 4OYOA 1CJVB 1U0HA 5IV4A 4CLYA 1AZSA 4USTA 1CJKB 4CM2A 1FX4A 1CULB 1AB8A 4WPAA 4CLSA 5D0GA 3ET6B 4NI2B 4OYXA 3C14B 3C15B 4P2FA 1TL7B 1WC1A 5D0EA 3UVJB 3R5GA 4CLFA 1Y10A 4OYIA 1CJTA 1U0HB 2WZ1A 4OYWA 2GVZA 1WC3A 3C16B 4OYMA 4CLLA 4CLTA 3MAAA 4P2MA 4CLZA 3MR7A 4OYPA 1CS4A 1Y11A 2BW7A 1CJUB 3G82A 1YBTA 2GVDB 4WP8A
chains in the Genus database with same CATH superfamily
4OZ5A 1BMQB 2PN6A 5CZVA 4P2XA 2EC0A 4CO4A 1FNXH 3FK4A 4JP8A 4J9OA 2BKNA 2HZAA 4ES2A 3PX4A 2C2ZB 3ZZYA 3W2WB 4JI5F 4PCQA 1T95A 1CVJA 3OTEA 2G0CA 3C16A 1YLXA 4NLGA 5KFZA 2GAHC 1RA6A 3KHGA 1VBYA 1WHVA 4IG0A 4RLEA 1RBLA 1SC4B 1FJGJ 1RTJA 2PMWA 1SQGA 4RNOA 2E1PA 3K8VA 3P5TL 2QMWA 2MZTA 5D0EA 2VDHA 4M1KA 1ZA1B 3ZTQA 2DO0A 1NNDA 2DR5A 1RWXB 5M2UA 3M30A 2ZH4A 2MQOA 1W2BR 3ETOA 1B70B 2ZVIA 3TUZC 3P8BB 3L7PA 2HVHA 1NJYA 3G96A 3V81B 2FHJA 1JLAA 5IT4A 3P6YC 1DTTA 4PWDB 4A46A 4B9MA 4ED3A 5GAEU 2OELA 4LFBJ 1N6QA 3HKWA 4RUHA 3HT0A 1YGYA 1OSCA 3D3BJ 1FD2A 4LFAF 3KNAA 4MFBA 4U67Q 2KRRA 1U1PA 2CJQA 4LF1A 2CZ9A 2JDJA 3UCUP 2YWEA 5KFQA 3GYXB 3H0PA 4PWWA 5KT6A 1PIEA 5AE1A 3TR5A 4NXNF 4TNOA 4B17A 3T5HA 4FYYB 1PCAA 4FYWB 3GYNA 4ZVUB 1R8CA 2Y1RI 1L3KA 3RU0A 5EN1A 3KMSA 3RTVA 4F4AA 2DTJA 5HQLA 1RWWB 2FHOB 2QL7B 2XY6A 4JI1J 3G6YA 2O01C 2FVRA 4FVMA 5E7OB 4N8NA 4NMLA 1OYDA 4N5SA 2HVZA 3D54A 1YVFA 1WUUA 1VI7A 1RT4A 3C16B 1HA1A 3K89A 2R8HA 2A2CA 3EGVA 1UFWA 3T1YF 1JNRB 4PG4A 3AT1B 4FKYA 3QJLA 1UEKA 2QLBB 4KQZA 4QYZK 4C0HA 3R3TA 1KRPA 3G71S 3BDPA 2DNNA 5IT9Y 1GH8A 4IG0B 1NZAA 2CYYA 4OX9J 2GCFA 4JI8J 3TJ9A 1RTJB 4ZPWR 1XJWB 4EYIB 3KUHA 4IQXA 2LYVA 1HQEB 3CW2C 3IGVA 4AL7A 2CPXA 1S0NA 1TUWA 3Q83A 1Z4UA 2XI2A 1DURA 3W61A 3PJWA 4DFKA 3M30B 2YWKA 4WWSA 2IFXA 4KR0B 1IJEB 1ZS6A 2NSCA 4K4VA 2QIFA 3ENQA 1S1TA 4YHHF 3AAWB 5HO4A 1DTTB 1U48A 5IWAJ 2HEKA 2MTLA 5B0EA 3G6ES 5F8GA 1N6QB 1FX4A 1HNWJ 3D0GE 4MFBB 4GKKF 3VAMA 2MKJA 4UQGA 2WCXA 4LF7J 2XY7A 5EDWA 1QM9A 3CGIA 3K59A 4OLPA 1GMUA 3HSJA 1XNRF 2HQCA 4ES1A 5KG0A 4A48A 1VQMS 4ZP6A 2B5JB 2WB1D 1A6LA 2Y1LB 2HBRB 2R8GA 2BKOA 3N5BA 4ALZA 1ZBTA 2OD4A 2FLNA 3M8QA 4IR9A 1HI8A 4DN9A 2D9OA 1MN9A 4DQIA 4ZA1A 2IDLA 1I94F 1WC6A 4QCLA 4E98A 5H9FJ 2WVEA 3NWRA 4F0HA 2NXNA 1RT1A 5HVFA 4WK1A 2KDOA 4ZPAA 3W7BA 1NJWA 3AA8A 4OHVA 5J2PA 2XSFA 4O3RA 3SFUA 1U0SA 4IQMA 1S7HA 2B6AB 5DQHA 2FHKA 1HD1A 2NCKL 2YWHA 2DNQA 3PKMA 2CPJA 2Z2MA 1S9GA 1T05A 1CJTA 3GV5B 3JSRA 3J80Y 3QPIA 4MIWA 3DRYA 2DNYA 2E9TA 2V34A 2EXUA 2PGCA 2NLWA 1S1TB 2B51A 4ZCLA 2RU3A 5HAOA 3EGWB 3L9ZA 3FCWA 5D0RA 3M9NB 2R9LA 3NS5A 1UVIA 1BUXA 4CDIA 4EO8A 2H65B 1RAJA 2VFSA 3BH6B 3THVA 2J0WA 2MZSA 3WIVA 1ELOA 2R7UA 3FC9A 4NCAA 1X5SA 1RB0A 4DR6F 3QAUA 2F40A 3T6JA 3DNCA 4ZDNA 1AZSA 1ZM4A 2AJFE 2BXJA 3GB0A 2CQPA 2ZM6J 2AYGA 3EZ5A 3PRDA 4B9SA 5E0OA 2GS8A 4DQQA 1IXKA 4AXJA 4P73A 2OPQA 2ZJPQ 1RT1B 2QSFA 2XWYA 5DO2A 1NK9A 1VQ7S 4ES3A 1UFLA 5ETPA 1EKRA 4HKQA 4WP8A 3VZIA 1XNQF 5K5MA 3OT9A 1YJ9S 3ZFVA 3KTQA 4USUA 4Z7YA 3VGSA 2R7VA 1CC7A 1JJCB 2E7WA 2HBYB 5I3PA 3BREA 1NZ8A 2VPYB 5CAAA 1FFSB 4X64J 4M95A 2K1RB 1S9GB 3JQJA 1S6QA 2ACMA 1CJTB 2VFRA 3AY0A 4KSEB 4V1Ak 4LQ9A 2ZDOA 2KRBA 4RBUA 1SJ3P 1S99A 1S9EA 4XPEA 3I56S 2FVSA 3NGDA 4F8RA 3UN2A 3JXOA 4NLYA 4ZN3A 3DMJB 4U95A 2V94A 8RUCA 5ITHA 4CLSA 1KVJA 2GO9A 2Q6BA 1MMDA 4ECZA 5KFLA 9RUBA 4HHHA 4UTGA 3BQ0A 4ERDA 3OHAA 4URSA 2GZOA 5HMXA 3R5AA 2IM1A 4RW8A 2C2NA 2H4WB 3ZTPA 4FN5A 4I0WA 1OPIA 1TP7A 4BS2A 2AP6A 2MQNA 3GCWP 2CPIA 1AZSB 2YY3A 1CJKA 4N76A 1HWUA 1QDUB 2N4CA 4DL6A 1FVQA 2VC0A 2PT0A 3EUNA 2EG2A 1N8RT 3MPUB 3UO0A 5KFPA 4V19X 2OPQB 2NZ4A 3BSNA 1U6BA 3OL8A 2DK2A 4JYAF 2VONA 1WG5A 2D3ZA 4PQUA 4K5RA 1W7WA 4C8NA 5DG7A 2NXCA 5AE3A 3LGMA 1L3SA 3M32B 4PXDA 1W26A 2CFXA 3D6FB 1S6QB 3MDFA 3FUYA 2E1MC 2M0GB 3ZO7A 3PR5B 1WKJA 1RAIB 3MURP 4X65F 1UEVA 4PG7A 2OKQA 1S9EB 1TKXA 1IJFB 2MQPA 1JMTA 2Z57B 4DCJB 5DDOC 4C6AA 1X4GA 1RWNB 2JWNA 4ILLA 2QYGA 1F5BA 2YBVA 4QW9A 5J2QB 2UXCJ 2Y8WA 1P1LA 2NZCA 4BC9A 3J7YU 5GAHU 2DNZA 2M7SA 1NHVA 1HNXF 3W2VA 1NBEB 4J9RA 3M9OB 1ICEB 3X1LB 2PC6A 3DLHA 3BQ2A 4RW8B 5GADI 3FJ2A 3THTA 2UXBJ 1HWKA 4R8UA 4ZJLA 2D41A 1PAEX 2QSWA 4M5HA 3D7SB 1K8AT 3ZTOA 1CJKB 1E6VA 1NPPA 3GLJA 4U7UD 4F67A 3IG1A 3BO4A 2IDEA 5LM7E 4DV4F 2E5LJ 2DR7A 3LP2A 1U1LA 5HL7Q 2GVZA 4ID8A 4ZPDA 4CTAB 2L9WA 4LRDA 2VA2A 3HZEA 2R7QA 3M8SA 1RU1A 2HHVA 4ELVA 4RW9A 4CLZA 5F3ZA 2DGWA 3N5FA 2GAGC 3HJVA 2LDYA 2BE9B 2YVSA 2KJWA 3FGVA 2LQ5A 2QGFB 1SVDA 4AYBD 2FPHX 1WTBA 4HH0A 2CNNB 2HFUA 2HWIA 4DV2J 4IG3A 1OY9A 1WI6A 2UVUA 1N54B 1SXLA 4RWXA 2VZ9A 3NLCA 1GAOA 3W65A 4EU0A 2DRAA 3SEOA 1VK3A 4KV8A 2VBWA 2VFTA 5IV4A 3QT6A 2FC8A 1WHXA 4RNFA 2E7VA 3CDEA 4OI6A 4R5PA 1F60B 2V2VA 1NK0A 2LU1A 3R2CJ 2P5VA 3CJKA 2BZ2A 4NE9C 3DI6A 1T9TA 1XR6A 2G2OA 3W2VB 3JTNA 1UVKA 5IS2A 2DIVA 2DHHA 2VHGA 2AIRB 1Q8IA 3V6HA 4LF4F 3KXDA 2IA0A 1HMVA 3QRRA 2XCAA 1FJEB 2DHAA 3MMBA 2C2EA 3K5PA 1N4LA 1HARA 2CJYB 5D4OA 4R8UB 3K57A 3R27A 1LW2A 2MEWA 3MAAB 4XDDA 4HEA9 1BQXA 1UEUA 3H5XA 2YKQA 5EGYA 2IRYA 2OLWA 2HVIA 5JXSA 3LP2B 2YWGA 3R6LB 2GVZB 1K47A 2YKPA 4DR2J 3C66A 5DG8A 1XIQA 5T41A 3AOAA 3TVYA 4RW9B 4L3KA 5DLGA 2HIYA 4N7TA 2QLJB 2X1GA 4Y34A 2WB4A 1VHIA 3TZWA 2PD1A 1C1BA 2AGPA 4WZQA 2AMCB 1QSYA 3M2RA 4CM2A 2KT3A 4DX5A 2G13A 3CJ3A 4ZIWA 3R5JB 1RAOA 3BB5A 5KFWA 3FEXB 2QLWA 3NCRA 4B3MF 4IG3B 1OWXA 5IC6B 2C3MA 2P6TA 4ZLPA 3CDUA 3IRXB 5BJRA 1FVSA 2H9ZA 3MMAA 3DOMA 5DRKA 3AD9C 2J9DE 3IA0A 3S8SA 4C11A 2AYBA 2CQDA 4HDGA 4KV8B 1I1GA 4W92B 3AJ2A 2HZCA 1REVB 5KG4A 1PJ7A 1Q0NA 1LK5A 5A0YA 3NAIA 2KG0A 2RS2A 4BWMA 2LXFA 2ROGA 2VG7A 4RNMA 4PUOA 2W9CA 1RUSA 3SI8A 2YX4A 3T9ZA 2ZH3A 2XZTB 2XWXA 2GA7A 1SBRA 4TLRA 3C19A 2CPFA 3C15A 1HFEL 3PJXA 3LQVA 1HMVB 3UE2A 2RQKA 4Q43A 4W98A 3SBMA 3OL7A 4RL1A 4NYPA 4JBCA 1BQMA 2AGOA 4QYRA 5KAKA 3MUVP 3N9UC 1M5OC 1VQNS 2R2UA 4XPCA 3JSMA 4CRJA 1RQ0A 2ZITA 5M2RA 2XMTA 5ETMA 1WC3A 4DPXA 1H7WA 4GC7A 2CQIA 1FT8A 1JKHA 3TA1A 3HVAA 1Y11A 2FGOA 5F8MA 4USIA 5IC4B 4ZJQA 1KBRA 3KJFB 2IJRA 1JLGA 2YQ3A 3MPYA 4R25A 3SCJE 1C1BB 3VGTA 3MEEB 3M2RB 5GMDA 4UW2A 2EKYA 2P6SA 3IO1A 3EX7B 1XTZA 1IKYA 5J2MA 3A4TA 4OJGA 4A8FA 5KT2A 3GIKA 3BO2A 1NK5A 2DGVA 2BDPA 5I42A 2PO4A 3MMAB 1RAEB 3GPAA 1N5QA 4KRWA 4C11B 3NNAA 5JVHQ 2C2RA 3CXCR 1TL4A 1WD6A 3ZNUA 3R8YA 1PJ5A 3OVSA 5A0YB 1HI0P 2AU0A 4TY8A 1QSLA 1LOUA 1QSSA 5JJBA 1KNZA 5KT3A 4EZ6A 1T94A 4CLFA 1LKZA 1VQPS 2VBZA 3HDSA 2W9CB 1BWEA 2Q66A 1QUVA 2XNRA 1SL2A 3SDEA 5SZTA 2XZWA 4NX9A 2VG6B 1UMJA 4PKDB 4OHZA 3DU6A 4LMZA 2ASDA 1JXVA 4OFZA 3PFOA 1RT3A 1N5TA 2DHGA 4LR8A 3QIDA 1S97A 4I6WA 4JI2J 3VAIA 3OXGA 3UD4P 3EM1A 3CMES 3JTOA 3LO3A 3JSMB 4DSJA 2CQ2A 2UUAJ 2R42A 2JFKA 3CIMA 5A8RA 5DDQC 1JKHB 2HK2A 2CJAA 1VC0A 1G4CA 4JI4F 2R7TA 3MM5B 1ULRA 2XYPB 3KHRA 4FF1A 2R3VA 1KN6A 1WHYA 2AJ4A 4DQSA 1WG4A 1RKJA 2LQ8A 2DNMA 4KAIA 4OMFG 2W24A 5CABA 2DBBA 3HXMA 2KH9A 3FMBA 3NS6A 4PZVA 5ETLA 1IKYB 4O3PA 5J2MB 3OL9A 3RJMB 1BXNA 2OEMA 2ZFHA 3E8OA 4HYKA 4JI6F 4LRCA 1DTQA 2NUUG 2BJDA 3R1LA 3IS9A 3PHEA 1KP6A 2RHQB 2GC8A 1QTMA 3G2XA 4O23A 4OV6A 1OSDA 3D6HB 2JC0A 3EXCX 2KYZA 4KO0A 4L3NA 1PBAA 2RVJA 3PYGA 2W7OA 4XO0A 4FF3A 4IOBA 1VQYA 4KYZA 2HFZA 3W66A 1WDDA 2AX0A 2F8MA 5F8IA 1R8HA 3MXHP 5E3PA 4DPTA 2QYCA 3K7RA 3QATA 1UZHA 3E51A 5AXNA 3CJ8A 4KY3A 4C0BA 3QWPA 2MKHA 4L76A 1RT3B 2MZ1A 2MSSA 1IBMF 3CDAA 2CNOB 3FEZA 4LUBA 5HK4A 3L3CA 4RW6A 3GSDA 5L39A 4ZITA 1UZDA 3TAMA 3SV4A 1C1CB 5A8RB 3HCXA 4DS4A 2MKYA 2EBEA 5CCMA 3BDEA 4P7TA 5ETSA 3O6QA 1B3TA 1H73A 3D6MB 2C3UA 1YJ7A 2AYEA 1KLMA 1YI2S 2RE1A 2I9SA 4DV7F 5CYJA 4ECYA 5EWFA 2KI2A 1IBKJ 4ZLJA 4OJ3A 2DH8A 1EB0A 4DUZF 3ITHA 1WSVA 3VCDA 5AXMA 1Q8BA 1S1UA 2NPFA 3AXKA 3HHDA 1YITS 5KFUA 3IS9B 1CJUA 3G8TA 4LFCJ 3BKUA 4B9TA 1Z1ZA 1H2VZ 2ZNYA 2F7VA 4KO0B 4M5KA 1EAYC 2EFOA 1RWKB 4A47A 2EFVA 4M63A 2IIHA 2EVZA 1WF2A 3KFWX 1KD1T 1FKOA 2QFJA 1FE4A 2VL1A 3CPWR 1U4BA 2VB6A 1FO1A 3A1YG 4F0KA 4XTTA 3FFIB 1RDRA 4NLQA 4PYDA 2XC9A 1ZZFA 2N3LA 1UW9A 1LW0A 3GZ7A 1D9AA 1DY3A 2GV1A 3OUYB 2VQEF 5KFXA 2ZKUA 2BUNA 1WI8A 4Q45A 3P3DA 1X4CA 3TAMB 5RUBA 3MFIA 1WEXA 5DJBA 3I96A 1WKKA 2CG8A 3RB3A 2ZVSA 1N34F 4J9VA 1U7LA 1Z2ZA 1RYRA 3PHTA 2YKNA 2Y1IA 4NCBA 1S0VA 4ILMA 1KLMB 5L38A 4B02A 2HFSA 3CCTA 2LMIA 3T1HF 2RQMA 5ETOA 1NKEA 3S1TA 2Y0SD 4YB6A 1GEHA 4HH1A 8ATCB 4RU2A 1QAXA 3UDEA 1M5VC 2RQCA 1VIXA 1VHFA 3M6XA 2OTLS 2DNPA 4UQTA 2X1FA 1CJUB 5HLFA 1R8BA 1F3FA 3ILOA 2RDDA 3FMWA 4H4MA 3HVTA 3BBBA 3LP0A 3NMRA 1YJWS 1Z2LA 2HS4A 1KQFB 2JVOA 3EZUA 1XR7A 5LMUJ 1RLDA 1RWOB 2CQCA 1X31C 1FKPA 1WC0A 4H4OB 1OMSA 3VHQA 2CQ0A 3Q8SB 4KHPF 3RUBL 1SV5A 2XSJA 1M5HA 1FKOB 3U1NA 1R27B 2B9WA 4LVOP 5KFEA 5A8WB 4NXMF 1MU2A 3MPWA 3NRBA 2FZKB 2V4JA 4KGZB 2KXHA 1HW8A 3K58A 4RX6A 3BN4A 1EP4A 2VQFJ 2W2MP 4UT4A 1YJTA 3EVOA 1LW0B 3KJQB 4MIBA 3KJNB 4OHXA 4L75A 1NPKA 4LIRA 3NGKA 3NOCA 4CWBA 3Q2SC 1RSCA 1VYAA 2DNHA 2YNFB 2KM8C 4NPOA 4W90B 4B3SJ 2R7RA 3SQOP 2R4FA 3SXLA 2W9AA 4X4OA 5IM0A 4DL2A 3FSXA 2YKNB 3PKYA 1RWPB 3AQOA 1LWFA 2IM3A 3QT5A 4MMOA 2LECA 3MPVA 2Q3PA 1CG2A 2CG4A 1RHJB 4NLRA 3TUJC 3H5YA 1NK4A 3FQKA 2CPYA 2XHWA 2BQ3A 1U1KA 5HLFB 2LA4A 2LFVA 1NRKA 4H4MB 2CVIA 4CT8A 2MMYA 2GIRA 3HVTB 3LP0B 3SSQA 2OH2A 3M1VA 3BPSP 4MKVA 2ZOMA 2J9DA 4IOCQ 2VPWB 4QWCA 3UD5A 5HSPA 3D66A 1FRJA 2OUGA 2OMLA 2JEIA 1FKPB 3N6LA 5KFMA 4NWBA 4CLTA 2JH3A 2BOAA 1T0TV 1EQMA 4DXLA 1JNZB 4RPFA 2CQGA 4LBPA 1SV5B 4YR3A 3R5BA 4ZIVA 3PJ9A 4UY8T 2XSJB 1MU2B 1RHQB 2F4VJ 5KT5A 2G1DA 3KLGB 2V4JB 4QQBA 4RUCA 2OSQA 1CSJA 2CDRB 4G6VB 3VAHA 1KVKA 4CLUA 2BOPA 4LSZB 2JHEA 4DS5A 2ZNZA 3CO9A 2A2DA 5D0HA 3B54A 5ETVA 4K4WA 1CQNA 5IM0B 2KXNB 4DR5J 2E9RX 3AB2B 2UUBJ 3PEJA 1K1SA 2UZAA 4JI3J 3DKDA 1DLOA 3JAMU 1LWFB 3MEKA 5A6WA 5L8RC 2DXFA 1HBUA 3FBCA 1YSJA 1LNQA 1P27B 1UJ5A 4Y2AA 3D3CJ 2C28A 3NP5A 3RZAA 3IAM9 2ZJQQ 3ENVA 4P2MA 3I82A 3GFZA 4WFBQ 3D1OA 3PM9A 1JK9B 4YB5A 3IGNA 2ZBCA 2ZBRA 4DFMA 5E41A 3Q86A 3GU0A 2RD5C 3M1VB 2XS7A 2YKMA 5D3GA 4BDPA 1T9VA 4ZS6A 2B9YA 2Z56B 1CPZA 4ZMMA 2ZH5A 5AXKA 2ACYA 4DZ6A 2W7PA 4RWWA 4A8WA 1YK9A 1KFSA 2HBZB 2AJ1A 3CC7S 2MSTA 3HZGA 3VAFA 1U8WA 5CQGA 4DV0F 1H72C 4J9QA 2OEKA 5IOLA 1XK8A 2GFFA 1SJFA 2BM1A 2LQ9A 4HI1A 3M2VA 1XEZA 3EMTA 3T19A 3PO4A 2BM0A 1XMQJ 4URQU 4WE1A 1U1MA 3MM8A 3C6TA 3CMAS 4CI0B 3KDNA 3DHXA 1FRHA 4OLOA 5B09A 2XYHB 3TQEA 2Z2YB 3OTOJ 2VOOA 3EICA 1ZH5A 4QIFA 4GVLA 4WFNQ 2V2QA 1UPMB 1VOMA 3DLEB 4A8KA 3PZPA 5K14A 1FDAA 3P4UB 2E9ZA 3ZZPA 2J0XA 3ET6A 5L1LA 2ZZNA 2UXDF 1C4CA 1HBUB 3CC2S 4OYAA 3I5AA 2NYIA 4MK7A 2XCPA 2OMOA 3M6VA 1U02A 4WU2A 2PA3A 3QMQA 4OYZA 2HHSA 1M1KT 4LRAA 3SMZA 1NO8A 2V6AA 1D9FA 3ZZ0A 2QL9B 3O44A 1Q8KA 5SUHA 3HD1A 4M5GA 2VIHA 3A3PB 3I0RA 5C5JA 3GFHA 2QLFB 3W5YA 4F4XA 2YKMB 3O3LA 3KMQA 2GQ2A 1BD6A 2OD6A 3H8YA 4Z37A 4ED8A 1F0XA 6AT1B 4ZPVR 2IRXA 2L48A 5KFKA 1UVJA 1FWLA 1V3RA 2VF3A 2HAFA 1ZAWA 2B8QA 4LIWA 3C6UB 4MYTA 1S57A 3QZ7A 2GQQA 2HHUA 4PXBA 2W2PP 4NA1A 2Z30B 1XR5A 1TR0A 1B0TA 2XMUA 1X60A 1G1XA 5LMNJ 2DGSA 2RAQA 3KHHA 3IBCB 4I2PB 3KLEA 4USJC 1V6HA 4KGKA 3PFEA 1CJVA 2V4QA 1RK8A 4WE1B 2HS0A 3MM8B 3C6TB 1MNEA 3M7VA 8AT1B 2RS8A 1Q86T 3DYAA 3WDOA 2X51A 3HHLD 4IOAQ 1VQ9S 4EK2A 1SPBP 2KL8A 9ATCB 1SKWA 2HZVA 5K14B 3ET6B 4J9NA 1HNZF 4HHUA 4L73A 1CLFA 1UTAA 1YQHA 1VISA 2MQMA 1LFPA 3RGIA 2VFUA 4OYMA 1N48A 1JJHA 1VQLS 3HP6A 2F1FA 4R0JA 3NNCA 3VAKA 3KLVA 3G6VA 5T7LA 5CCLA 4F0MA 1MWQA 4DV6J 2V8GA 4F3OA 3I0RB 2ZWOA 1V3ZA 2O66A 1RT6B 1FWKA 2LXUA 3N6MA 2VG5A 2VJVA 2X1AA 4YN3B 4B9LA 1MWYA 4MKAA 2V8DA 3V5RA 2XQCA 2ERRA 4LR9A 3CD7A 1VDHA 1F1BB 2E1RA 1OQ6A 3FSIA 2LEAA 4ZK7M 3OFFA 4TLQA 3CJ4A 1AUSL 2J6SA 2GNKA 1BQNA 3C8YA 4I1TA 2KZMA 4JI0F 3KLEB 3V4IB 3W5ZA 4WFAQ 2ZHAA 3ILJA 1JB0C 3QNWB 1SIZA 3DYAB 4NCGA 3I6PA 1SI9A 1S4EA 2ROEA 2YX7A 4USVA 1FWPA 4Y2KA 2C2MB 2ZHOA 2ASLA 4TYBA 3KLHA 1FD8A 2EBGA 2EEYA 3I31A 4DR4J 4J9MA 1K9MT 2R2SA 4OZ0A 4CNZA 2ZBPA 2YPZA 4DR7J 2CQ4A 3U7JA 4FS1A 1SH3A 1X0PA 1U2FA 2PFFB 2DVIA 2HFNA 4HT7A 2QN6B 2HW3A 2DY9A 4K5SA 3LH2S 5T7LB 4GO5X 2L3MA 1XN9A 5J2NB 2JX2A 3MMCA 1NK8A 1TKTB 4NLUA 3KUGA 4M5LA 4AFFA 2FUG9 5I4MA 2BRKA 4KGMA 3HMJG 3RB4A 4N41A 2VG5B 4NLPA 3QO9A 3IAS9 1XBWA 1B4SA 2KT5A 2DNGA 2VV5A 5BYSA 2GHPA 1RA7A 2XO7A 3AOCA 1X5OA 1CS4A 1TL1A 3SYZA 1G2EA 5CD4H 3MTKA 5KT4A 3VQTA 2XULA 4LF5F 1UW4A 4CM0A 4U9RA 2DXDA 4ECWA 2KVQE 2ZBIA 4PQAA 3FZ2A 4B3TJ 1BQNB 3NOGA 4QU7A 4DLEA 4YDDB 4DV1J 4CO0A 4EUVA 2F63A 2PE8A 2Y8YA 3NY0A 4RU9A 1YJVA 3GG0A 3G87A 2DRDA 5HI7A 5HVGA 1JLFA 1S1WA 4ZLLA 1ACMB 3TW0A 4NCGB 5GMEA 2AEFA 1JQGA 5MAOA 5IV3A 2RDIA 3RBXA 2MZRA 1GFWB 2ZOFA 5THWA 5JUMA 5IFMA 4LF9J 3CUNA 1N33F 3PW0A 3OJUA 3KLHB 2NQPA 2M3DA 4JI7F 5KFIA 5F9NA 1SJ1A 3CJ2A 4LRFA 2MHEA 5L1IA 3MM6A 2VDIA 1DBDA 2POKA 1RTHA 4LF6F 1S6OA 1RE1B 2FY8A 3JSBA 3SSSA 2D3OR 2LQBA 1FTRA 1VQKS 4X62F 2YNHA 3MMCB 4I69A 1KHWA 3RRKA 2W7AA 4TKTA 1IBLJ 2A6OA 3BGLA 4QU6A 3I9V9 2R7WA 4P10A 3FZBA 3NG8A 4E8UA 4S0MA 5GMKa 1JLQB 4O4RA 2ZD1A 2K7JA 1RBOB 2CAJA 2EFPA 3S6EA 4QBUA 1CS4B 1QVGR 1S0OA 1RP5A 4NLVA 5B0AA 5EWGA 2DT9A 3RR8A 1WF1A 2HAIA 4WFZA 5F8JA 3ENWA 2MGZA 3QT7A 4OYWA 2XMVA 3CB4A 1HNVB 2HWTA 3KLFA 2XG8A 4RW4A 5E3QA 4LSNB 1JLFB 1S1WB 1VBZA 2PFDA 1IM4A 4C8LA 2WRMA 3MAHA 5DZ6A 3F44A 1UKUA 3W5XA 5H9EJ 4N8OA 1VR6A 2HQFA 3BJYA 4YY3J 1P9QC 3EE3A 1XERA 2ZZMA 2KYXA 5KFYA 1NCLA 3TA2A 4OYBA 4DV5F 2R2TA 4PR6A 3MM6B 4BHQA 3HX9A 2CNLB 1RTHB 5GAGI 2AT1B 3WHIA 3KG1A 2M8HA 4DN0A 2AJQA 3RR7A 4J9KA 2Z0GA 4ZHRA 1B0VA 1NLKL 1SC3B 2WBRA 1MW7A 3MD1A 3LP1B 3AFGA 4I68A 2GJ2A 3HF5A 1V9OA 2CQHA 2MKCA 4B9UA 1M1HA 1D9DA 2ZD1B 2ABYA 3AHPA 3TRGA 5FLXY 4MK8A 4O0IA 1X9SA 3C2PA 2EK6A 4IFYA 2W9BA 3D67A 4YDXA 5C7PA 1AFJA 4DV3J 2OHDA 1VJWA 1N0VC 1T03B 4HACA 1XMOF 3LTOA 4GO7X 3BEGB 2DNKA 1HR0J 3HO1A 3DLJA 2MGZB 2WAQD 1Q81T 1W2IA 2CJ9A 4G1PA 1D8ZA 2HLUA 3OXFA 3BKFA 2WW4A 3JQMA 4RW4B 3F73A 1NK7A 2YH1A 4AL6A 1N5YA 4Q0BA 2BJEA 4OZJA 2DNRA 3RB0A 2I1RA 1PBUA 1BE4A 3J80U 2WW8A 3DOKA 4CNYA 5IZHA 1YRXA 4C2MA 2LA6A 1RAGB 1N32J 5J1NA 4DQRA 4PWUA 1WOPA 1WOSA 1S5ZA 4HR2A 4F4ZA 5J1EA 3PDNA 4B3RJ 5CZXA 4ZVFA 3UN3A 2P8IA 4DUYJ 1KONA 2W4DA 4ELUA 3OBIA 5C24A 4UOHA 4C3KA 1U6FA 5E33A 2AZ3A 4TVAB 3PG9A 2CQ3A 3LWMA 4RW7A 1IWAA 4M5DA 2XGPA 3NBPA 2FJXA 4K8RA 3LPYA 2COLA 4AQYJ 1Q8LA 1KEKA 4YQWA 2AF6A 3P5BP 4QOTA 1Q78A 1CULA 4ZHRB 3D28A 2V8HA 3CJSA 1Q7YT 2HFVA 4A8XA 3R7SB 3CCES 1O0PA 4X4UA 4J91A 3QRPA 3R97A 1NM2A 1JLCA 3V4MA 1KTQA 4I4BA 1N36J 4WIIA 2VA3A 3HVWA 2IAJA 2W9BB 2QT7A 2VUGA 4B9VA 4K2XA 1U25A 4DX6A 3A3OB 2OJ3A 4J9LA 4KBIA 3DRSA 1AROP 1U6ZA 2R7OA 2BBEA 2APOA 4WXOA 3T1AA 2PMHA 1F9HA 1TUGB 1FNOA 5KFJA 5FDLA 4PG5A 4JI5J 4U7UK 3HKZD 4A8MP 1VBXA 3TX8A 2UP1A 3RYLA 2OFGX 2D3UA 1N5YB 2D9PA 4Q0BB 4C97A 4ED4A 2ILYA 5E3RA 3CC4S 4KKOA 2EFQA 3PYEA 2P9GA 2OAUA 4TY9A 2HURA 5J1EB 3F41A 3PCOB 5GAEI 1S1VA 1GXLA 1JLAB 1FX2A 2CZVC 3PYFA 4KTQA 5C24B 3LAKA 3CE8A 1HBOA 3QJPA 5ETKA 4CH1A 3TANA 1VQOS 1UA1A 4MAKA 3A13A 4ZVEA 4RW7B 1URNA 1N0UA 1U09A 6FDRA 4M5DB 4GKJF 3N6NA 3DXSX 7AT1B 3NBPB 1NJXA 2ZH6A 3UDVA 3DGPA 2Z2LA 1SJQA 3AB4B 2JFDA 3R7NB 1CULB 1IKWA 2YKOA 3ZZOA 5ETTA 4PEOA 2DEIA 4LFAJ 3MCOA 2CDQA 1VK8A 4DR1F 4EBEA 1NU4A 3R5CA 1H38A 3BBCA 1XQIA 2HGLA 2IAJB 4OYPA 3ILIA 1OJ4A 1PC5A 4U6PA 4NXNJ 2HRUA 4RKUC 1XWLA 5KFCA 1RT4B 2MQQA 3J81j 3AQPA 5D4NA 2RKIA 3IXQA 4DR3F 3VALA 3DRSB 2GQCA 5LXRA 3ULHA 4OI0A 3ZZUA 4DPYA 1RWMB 3ONQA 3MTJA 3J7Z5 1O51A 3FRYA 1FF2A 2J7WA 4OV1A 5FDLB 4UOFA 3EYZA 3PV8A 1SQEA 3PO5A 3W62A 2J9CA 5CA5A 4DL7A 3T1YJ 3CCLS 3IRWP 2BR0A 3W8GA 1VQ5S 2AV5A 4KHRA 3AODA 3J7A1 2F9DA 1I51B 2C2KB 3SV3A 3IM9A 4JV5F 3LWLA 3GTYX 4AXIA 1EQ0A 3T5JA 4F7VA 4NEZA 1S1VB 1VBKA 3I4PA 1YJUA 1NDPA 4B3OA 1RTDA 5KG7A 4MT1A 1HBOB 1X5TA 1ZTTA 2YQ0A 2HMIA 1EARA 3K5OA 7FD1A 4F36A 2IVFB 4X4SA 1VQ4S 4AT1B 1LWEA 3BF4A 1EETA 2GIQA 2J6TA 1REGX 1SC1B 3TUIC 1IN0A 1TVRA 3ZZTA 3PYDA 3J81U 3PVXA 2IJFA 1K0TA 4YHHJ 1IKWB 2JLFA 1WSRA 2AEMA 2AYMA 3VVTA 1HLWA 4GKKJ 4ZP8A 4C98A 3M8QB 4OJHA 4AL5A 4DHVA 1RYSA 2VODA 5HMWA 4RJVA 1MWZA 2C2OB 1PC4A 2FYXA 4Z7CA 2LVWA 3BS9A 2F8EX 1Y0HA 3T5LA 4GVBA 1VQSA 4LF8F 4EMDA 1RWUA 2B0GA 4DZDA 1XNRJ 2H1YA 2VBYA 2CWKA 4K50A 2HGNA 2E5HA 2CADA 1K0VA 3UR0A 4OZ1A 5J2PB 3LOUA 1Y10A 3NWGA 3R7BB 1RAAB 1DARA 1I94J 3R1HA 4DEZA 4G1QA 4C0OC 5BYRA 3KNGA 3FCHA 3CCUS 4OI3A 1T05B 2OEJA 5DS7A 1EX8A 3D0IE 2YX1A 4K0KF 1X4BA 2HHHF 4AE5A 2M70A 4U7CA 3A8JA 1FRIA 2PA8D 5D4LA 2FJAB 2UUCF 4NA3A 3JAMY 5HN0A 4C9DA 2HNZA 3AD8C 2N82B 4NI2A 5A8KA 1IWGA 2HMIB 2WHOA 1H2UX 1NXIA 4EYHB 1LWEB 3TVKA 1U1NA 1EETB 4RBTA 2AD9A 1U0HA 2UU9F 2RJZA 3R9LA 3VAJA 1Q7LB 5EX3A 5BR8F 1VRTA 3R5GA 2OFHX 2XMWA 4K4YA 4UUWA 2R8JA 4KE5A 3WC0A 2OSRA 2I2YA 2NYHA 3NGSA 2FJVA 2FY1A 3C3LA 2HIQA 4X66F 4P6QA 4I67A 2RQ4A 1YKWA 3PW4A 2DGOA 4GVBB 2FB0A 3QSIA 1SQFA 4EGLA 1B7FA 1PSDA 1CC8A 1R6VA 5IQQA 3CDWA 1UVNA 4GRSA 4MKYA 5HBMA 4DR6J 3FCVA 3NEKA 3D68A 4L72B 3GYGA 3QQCD 2RHSB 4I2QA 2HNYA 3DRPA 3TUPA 1TL3A 4ED1A 4ZP9A 4GC6A 3GIRA 3GE9A 1OPZA 1RCOB 2QA2A 2ATLA 3TAQA 1WOOA 1RT7A 3DC2A 4TU8A 1N56A 1FA0A 4G1QB 2G9OA 4RNNA 2Q1LA 2AKWB 4WFYA 4IKAA 1H74A 4QW8A 1TKDA 2KHDA 2NSBA 4FS2A 3BO3A 4Y3CA 3NKYA 3HLUA 1J5EF 4DBQA 1FDDA 1PAUB 2H3EB 1XNQJ 5ADZA 2MQ8A 3PW2A 3H20A 4QWAA 3EGZA 1FXDA 3TYTA 1DJ0A 3GR1A 5AJ3F 3SSRA 1HWIA 2OPSA 1U24A 1R0CB 1NKBA 3M6UA 3MR7A 1YX2A 4YS2A 2HQDA 1T02A 2A1BA 5T14A 1L3VA 3OFEA 4YEAA 4QR0A 1Q79A 4ZOSA 1VRTB 2RIJA 2V9WA 4F3QA 2J6UA 3QSYB 2KM8B 4OI4A 3IFEA 1RHMB 1S72S 1U2CA 2ADBA 2I6WA 4ZCMA 3OXLA 4WCEQ 2KFZA 1U8SA 2HRTA 5HBMB 4MH8A 3CD0A 3EVMA 4B08A 1WHWA 4HVZA 2QL5B 1N52B 4OX6A 4I2QB 2HNYB 2F3JA 3DRPB 2RSQA 1Q16B 1I6JA 4PQUB 2L9NA 1UWBA 2ZJRQ 3OR1A 2E66A 5C42A 2O3DA 1RT7B 2K3KA 1JIHA 1RLCL 3CWJA 1MMLA 2DPIA 2NR0A 2FLLA 4YB1P 1LFWA 1OYEA 1HBMA 3QFHA 1BGXT 2CPHA 1SJRA 4AUKA 4N47A 4JYAJ 2V8PA 1JXEA 2RF2A 4M5NA 4TYAA 1TKXB 3DLKA 1S1XA 1MMNA 4HT5A 1PKUA 1P9YA 4DF8A 1TU0B 4GMKA 1RTZA 4Q2MA 2E44A 2I0XA 6FD1A 3V6DA 4OZ2A 2OPSB 3J7YI 4WP3A 5GAHI 2DNOA 3AA9A 3AJ1A 5KFGA 2HHWA 1AA1B 1HWLA 1WEYA 4CLYA 1KSPA 1HHSA 2EG1A 3VGUA 1M90T 4X65J 1QVFR 3H40A 2H5IB 1LQ9A 4ECRA 2OPPA 4OYXA 4MKBA 2UV8A 4PPDA 4CZCA 2M52A 4A4JA 3D4JA 3SCLE 3DN9A 4ITSA 4EBCA 1R0BG 5AXLA 1F2HA 3OW2R 4ZCKA 1E6VB 1GTEA 1KQGB 4ED6A 2X3GA 1HNXJ 1FJGF 3IG1B 2CRLA 3WC2A 1UETA 3MAQA 2Z4PA 2WOMA 3CJQA 2ZH8A 2AQ4A 1WC4A 4QIWD 1SCJB 1UPPA 3ENAA 2XLJA 3DRRA 2XBPA 3MI7X 3W3SA 5IT0A 5DQIA 1PYOB 1UWBB 2E5GA 3OR1B 1KC8T 2HG4A 4ZPBA 5C42B 3CNQP 3CCRS 1C2PA 3WBZA 4DV4J 4DOZA 4LFBF 4OZ3A 2C22A 1NJZA 2C3OA 3CJ0A 3W9IA 3TOQA 1AT1B 1H0HB 5JMNA 2CPZA 3H4BA 1HBMB 2OGUA 3MHYA 5L46A 2XHCA 1RAHB 2QA4G 1NDLA 1TZ0A 3DRXA 5HATA 1FJCA 2VOPA 1V3SA 5CYMA 3BQ1A 3QGIA 3IWNC 3V81A 2GHVC 3DLKB 1S1XB 4KH1B 4EEYA 5KFVA 4DSKA 3I5BA 3AOBA 1HHQA 3PW7A 2E1CA 3MEGA 4XAKA 4R5PB 4WYWA 1NPRA 4JI1F 2E1AA 1WEZA 4QR1A 1HKAA 2RUGA 3UCZP 3CJKB 3DI6B 4OX8A 4WZMA 2VJUA 3C14A 2CPDA 2OPPB 1X5PA 1APSA 2RRAA 2D7SA 3MMBB 3L7UA 2IY5B 1IKVA 5AE2A 4RUAA 3MCMA 1LW2B 2LEPA 2WVDA 3FRZA 2BJ8A 3DFEA 4X4TA 4OX9F 2LQJA 5CYQA 5LSRA 3TAPA 4JI8F 5H1SV 2MLXA 1S77D 2HK3A 5HP1A 1C0UA 1VC5A 3ZTRA 2WOMB 2KHCA 4PXCA 4LF4J 2JSXA 1Y00A 2WSFC 3Q8PB 3DRRB 4ED2A 1WC1A 2BEFA 5KOWA 1JXLA 4OYIA 2AGQA 2EFNA 1W25A 3O5TB 3MGJA 4UF4A 4PRFA 2HVEA 5IWAF 3QLHA 5A2QU 2DXEA 3HFKA 1F5CA 1HQEA 4DMZA 4ECSA 1HNWF 3N0VA 4NRTA 4QIEA 5LXYA 3GG1A 2BJ3A 2JEJA 2RILA 1T3OA 3L7OA 3H4DA 2NUHA 4I7FA 3DOMB 3D1HA 4LF7F 1M0SA 3GFYA 5CYMB 1B0PA 5FD1A 1NSKL 4DUTA 1FFGB 2BW2A 1FTCA 3EPGA 4E2FB 4LVNP 4B3MJ 3TA0A 2MZQA 4OL8A 2AWZA 3MEGB 4TQRA 1JLEA 3V2UC 2VG7B 2C3PA 4PUOB 1NK6A 3E3XA 4CYUA 3EDRB 4ED7A 1R89A 1YJRA 3KHLA 4Q44A 2ZH9A 1T9WA 3CIZA 5F8NA 3C14B 3C15B 1EZZB 3N01A 1S9FA 1GMWD 3RBDA 2B5JA 4NZ7A 1IKVB 2WZ1A 5C25A 5H9EK 3UQSA 1BQMB 2HS3A 2DCUB 1A9NB 3HFVA 1UAWA 2MDAA 4CP5A 1BHNA 2YPYA 3EVWA 5CYQB 3MFHA 1R3NA 1YZ7A 3HHNB 4QZVB 2MKKA 1Y5NB 3BGRA 5F9LA 3CCQS 2KT2A 5HP1B 1C0UB 3VWSA 2X7IA 4JV2A 2V63A 2W01A 5B0FA 4CH0S 3L95X 3K0JA 2DIUA 5B08A 2KZZA 3FQLA 3CMQA 2VH7A 4IUFA 2D74B 4ZCIA 3Q23A 4DPWA 1JLGB 3O1LA 3GONA 1C0TA 2B6AA 3LGNA 4DI6A 3CCVS 1R6YA 1QJHA 4QWBA 4J90A 3QLHB 1NHUA 2W2OP 3GFXA 2J0SD 5D78A 5A76A 2CNKB 4OYOA 2K2PA 3M6WA 3HHLA 5I42B 2UUTA 3QGGA 2E5IA 1GT8A 4I7FB 2ZOGA 3PIOQ 1TK8A 2O1PA 1R31A 1EKSA 4DSEA 3M8PA 2ADCA 4ZP7A 2JLGA 3MF5A 3TJAA 4TY8B 3UFCX 1SJ4P 1F2GA 3UWTA 3OSPA 2F8HA 2ZM6F 1JLEB 4LF2A 3OTDA 5KFFA 3W63A 3GQCA 5E3CA 4CYUB 3SDEB 1UP1A 3FBBA 1IR2A 2D3O1 5K20B 2LXIA 2W1BA 2L9DA 1YTYA 2F4FA 2A10A 1QLNA 4OJ1A 3HM9A 1KFDA 5CXTA 1R8PA 5C25B 4I6AA 5ETNA 2IMOA 1QD1A 3NMAA 1SL0A 3CCSS 2W4CA 3SIPB 1QTNB 3DU5A 4LBIA 4YR0A 2OIHA 4LSLA 3BGRB 2XI3A 1VS3A 3MR6A 4X64F 2OPRA 2FC9A 2DCLA 2BV3A 3GCXP 4TU9A 4MIAA 3VV2B 4OZNA 1VCTA 4DWIA 3FVYA 2J76E 1F3VA 2KVIA 4CO1A 4P9SA 2YWFA 4DDFA 3BSCA 5KG3A 1C0TB 2M8DB 2Y9HA 1B64A 4F04B 4C8MA 3IWLA 5KFHA 4WU3A 5EWEA 1A7GE 2QX0A 1TELA 2K1RA 3PEHA 1EJ7L 2KU7A 2U1AA 2DISA 1T9YA 4JI4J 3HHLB 3AH6A 2BA9A 3T41A 1DTQB 1T9XA 1AXQA 1J5OA 3LGHA 3P96A 4L74A 5BXIA 2B56A 3PNIA 3MZIA 4PABA 2XMKA 3DMJA 4YR2A 1RJJA 3M8PB 2DHSA 3FNNA 1FRXA 3RBEA 1VQ8S 4CQ1A 4C48A 4HTJA 1SKRA 1G7CB 2AZ1A 4K4TA 1JX4A 4JI6J 1X9WA 1T9UA 5F0UA 5L9NA 3BYPA 2MKIA 4Q7AA 3NCQA 5DDRC 1Q5YA 5DDPC 3A12A 3H98A 1PYSB 3THPA 4C8KA 1SL1A 4O44A 5LJ5Y 2FVQA 3HT3A 1YBAA 4KT0C 2V68A 2BE2A 5KTQA 4RW6B 4LSLB 1ZM9A 2W8KA 4K4XA 2V67A 4IO1A 2OPRB 2Z58B 2GJFA 5D8HB 2MZJA 4J5OA 1P1TA 1O6XA 1IBMJ 2FJWA 1CEZA 3H2UB 3GMGA 1RISA 4N56A 3OQ2A 2BANA 3M32A 4LBHA 3UW1A 2DJWA 3G8QA 1FJ7A 3X3UA 3MR2A 3ITHB 3TX0A 2UXCF 3GR0A 1FNMA 3P45B 1LEOA 3GP9A 3JSYA 1S1UB 2VASA 1Q4RA 2P2CB 4EZ9A 1J5OB 5J1PA 1LV5A 1HBNA 1KVIA 5ETRA 4DV7J 1QAJA 3EPIA 1FXLA 2UXBF 4P52A 4DUZJ 1ZOTA 4LT6A 1VMBA 5J2QA 4W4MA 1D3WA 4WK3A 4KH0B 4Q2LA 2DRBA 4OI1A 2J9EA 2VKZG 3ZZZA 4U8YA 5LL6d 4L6V3 2CPEA 4NLXA 3DLBA 2FZGB 3I55S 2BX6A 2E5LF 1K44A 3M2UA 4CLKA 3KG4A 1FHTA 2DR8A 3QYYA 3N79A 4QIGA 4B9NA 3T5KA 2EKNA 2LU2A 5GADU 3RG6A 4CO2A 4IDKA 1FCAA 5CD4A 1PJ6A 4ILRA 4O44B 3QIPA 5A6PA 2BE2B 4FP9A 4DV2F 4CTAA 1OIAA 1NDKA 5LT5A 3CCZA 2AW0A 4ATNA 4DFPA 2J7KA 2IYGA 2JNJA 1X4DA 1F9EB 2J8AA 3LF0A 1GTHA 1DQAA 2JEGA 3PY8A 4DSFA 2BANB 3K17A 2QFIA 4TU7A 2DITA 2O5DA 2VQEJ 4BWJA 4WF9Q 2FDNA 1T7PA 2CQ1A 5D77A 1NB7A 3SCIE 2B9XA 1S76D 2PEBA 3U1MA 1IQTA 1N34J 1U1QA 4MYUA 3OJSA 3KWMA 1H2TZ 1FEHA 2YQ1A 4ELTA 1VJQA 4YUDA 3OLBA 4NLOA 3EXYA 4U8VA 1HBNB 3W9HA 4YP3A 1U2RA 2UVWA 2N3OA 3T1HJ 1M5KC 4FNIA 4P71A 2ZWPA 3Q8VA 3CD5A 2JVRA 2WVBA 2QTWA 3CCWA 3MUMP 4D3GA 2ZE2A 3M2UB 3F0NA 4C7QA 1RU2A 3V6KA 4DR2F 2M5YA 3UD3P 3J81Y 1ZYQA 2RUSA 1UA0A 5DM6Q 4X4NA 1X7VA 2XY5A 1S12A 2H4YB 4IDKB 3MAAA 1EP4B 4QPXA 1LWXA 3AJDA 4FPRA 3OV7A 2H54B 2G1HA 3QIPB 3GJQB 4KHPJ 2QLXA 1F9FA 4KJIA 2IBOA 2SXLA 2V0NA 3J7AN 4NXMJ 1YHQS 1CQMA 1T3NA 3R5DA 1D0EA 4MJKA 2WTFA 4WIQA 5AT1B 1UVLA 4NZ6A 4ZLNA 3MM7A 5B7WA 4ZJOA 2C42A 3DXBA 1ZZNA 2FD2A 2FLOA 4P72A 3DDNA 4K59A 2YTCA 1YIJS 2KO1A 2XLKA 1RGVA 3IR5B 3Q24A 4ZKAA 2B4VA 2FQQB 2BJ9A 3IRXA 3GSIA 2DKOB 2ROPA 3H90A 3BKTA 4PPZA 4Q8FA 2FIUA 5FJ4A 2KXFA 2LKZA 1VC6A 4V19J 1X4AA 4DPOA 4AD6A 4IYQA 1L3TA 2QMUB 2ZDPA 1REVA 5D6GA 1IVZA 5B0DA 3IN5A 5HVHA 3A8IA 3DGVA 4RNHA 2MLZA 2ZC3A 1M5PC 3DHWC 3Q89A 1SUQA 4H4KA 5C2GA 2V2ZA 4ICLA 2E29A 5CHCB 2ZE2B 3ICLA 3K8WA 4C3MA 5L1JA 4USKA 5DM7Q 1NEEA 2VKRA 4KC5A 3KUEA 1OY6A 4WP9A 4ED0A 2HNDA 2IMWP 2WSCC 2Q43A 1TKZA 2VD3A 3IMQJ 5D15A 1TAUA 1S4FA 2C1EB 2A6MA 3OSNA 4FXDA 4CO3A 4DSLA 4F3MA 1FE0A 1N5VA 2JOQA 1FDBA 2XO6A 1DAXA 4X4VA 3FBEA 1EIYB 1Y5IB 1HL6A 2CZ4A 1Y3KA 1U1OA 3E01A 3LALA 4IH7A 3MM7B 2FHJD 4FYXB 4DF4A 4CLLA 3MEEA 1NH7A 1DLOB 2F9JA 5IXUA 1RT2A 1U47A 3ZC4A 4OHWA 4HLBA 3EWGA 3G82A 3BR8A 4DCPB 5B0BA 2YXLA 4BCAA 1Y5LB 1LXJA 1GX5A 3QBCA 4P75A 2XS2A 4IH6A 2MJUA 1ITPA 2XNQA 2YNGA 3D6TB 2QG9B 3JYTA 2DH9A 5F0WA 3GJRB 3POTA 3A3NB 1NAQA 4ZPTR 1IKXA 5D3GB 1K1QA 2XMMA 1BWVA 1V5IB 4JI2F 3DLLQ 1SUQB 2HQGA 2L41A 4ICLB 3W8PA 4ETXA 3BSOA 1X0FA 3ELHA 1FESA 2VG6A 3BBFA 2UUAF 1KKHA 3UNYA 3R6GB 5HQMA 4NA2A 4F4YA 1AW0A 4M8LA 1VRQC 2BQUA 3OLAA 2RH3A 3UI3A 3VVUA 2C2DA 2XB2D 4N77A 3BV8A 2HNDB 2FZCB 3IC1A 3HHKA 3JQKA 4FBTA 3W9JA 1NSQA 1TKZB 3M2VB 2VICA 4UUXA 1VLOA 3ISZA 4O3SA 1RCXB 2MQLA 3H59A 5FIIA 4DPUA 2QV6A 4PAAA 5CH7B 2MPUA 1RT5A 2V9KA 3LW5C 2VU5A 5LSLA 3US5A 4DV0J 2FJBB 1FK9A 4BBYA 4FYVB 2ZH7A 3MM5A 4FXVA 4O3NA 3MPDA 3HD2A 2NXJA 1I3OB 3E01B 1BC6A 2VPZB 2GMJA 1UFKA 3KK3A 4DL4A 5L1KA 3G4SS 5KOXA 1HQUA 3OTBA 4ANDA 1RT2B 2ZC4A 4F4KA 1S79A 1U45A 2UVVA 3JB9k 2ASYA 3G82B 3VQSA 2LDIA 2IYIA 1HPZA 4ZVOB 2V4RA 3IWXA 2RU9A 3FKBA 1TTHB 4PXEA 2O67A 2GGPA 1VLYA 3DCAA 3HSZA 5KG2A 1J2VA 1GXUA 2QMXA 2YNGB 4ER8A 2UXDJ 1ROFA 2E5JA 3TVZA 2BMBA 4KPCA 3FSYA 2Q6CA 5E3AA 3JYTB 3PW5A 3POTB 1R43A 3ILLA 3U27A 4WJBA 2ILZA 1WF0A 1IKXB 4J9SA 1TQLA 3MR3A 3W1YC 4WTOB 4X4PA 5K8MA 2QA1A 2LEBA 3OVBA 2IPOB 3K5MA 4XDCA 4ZVGA 5KFBA 4IRDA 2HHTA 5B0CA 2HLTA 4KGVB 1URRA 5U47A 1DFDA 1XMBA 2BJ7A 1V5VA 3PTWA 5KFDA 2UVRA 3TO8A 1DRZA 1LK7A 4DJBA 4QWDA 3OTCA 3GIJA 4NL5A 2F65A 1F6TA 4Y65A 2RRBA 1NDCA 1IBKF 1CJVB 4C3LA 2HYIB 1IQZA 1BLUA 1C1CA 3BR9A 1RKIA 1RT5B 2XZDB 1X4HA 1WNEA 1NSAA 5D0GA 1GX6A 3MOZA 5HJYA 3OD2A 1FDNA 1RTIA 1FK9B 1MSWD 3CCMS 1X8DA 3GJSB 5DLFA 3PIPQ 2OI2A 2U2FA 1JLBA 2CKWA 4LFCF 3KK3B 4DL0C 1HQUB 4JV1A 1UJ6A 4J9PA 5F3TA 5HMZA 2K06A 3G9CA 2FHMA 1HPZB 2Y3YA 2N4DA 1NJIT 3M8YA 3I0SA 2BJ1A 3BSAA 3MCSA 2BVZA 2GGPB 2V50A 1OO0B 2HHQA 3BGUA 3I87A 1HNZJ 4FPIA 3TZYA 1NH8A 3HHLC 1N88A 1RWVB 2VC1A 1WG1A 1KOHA 2CVEA 1S49A 4FDFA 4YOEA 1PILA 4OI2A 1RBAA 1PGZA 5FLXU 2DR6A 2GIFA 3QGPA 3H5SA 2BACA 1KWMA 2GX8A 4Y28C 2G0JA 3D5MA 1KLNA 4PG8A 2IBKA 3I5CA 5D4PA 3FFIA 3TNVA 1DZ5A 1UVMA 4M5JA 3UCGA 2E7XA 3E2EA 2ZEJA 2M88A 4K4ZA 5DZ7A 4RZRA 1M1GA 4A8OA 3OUYA 3G86A 1FEEA 3SFGA 3D9BA 1IUJA 1SH2A 3KLIA 2JRSA 1RTIB 1AFIA 1TV6A 2YH0A 1HYSA 2IHR1 2G0IA 4EI2A 4F02A 3GJTB 4J9UE 2DGXA 1JLBB 2VBXA 4YMEA 2GHWA 1X4EA 2B43A 3WX8A 4JI0J 3EDQB 2WVFA 3LA0A 1S6PA 2MHNA 5A2QY 5LMUF 4NRUA 4OQJA 4ZVHA 5K8OA 3CJRA 5KT7A 3I0SB 4NLTA 2PSZA 2BQRA 3CF5Q 4IFVA 4WXWA 2BABA 2D69A 7FDRA 1NSPA 1OS5A 3TEHB 1H6KX 2DD8S 3AXMA 4G65A 1Q1KA 5JVGQ 2V69A 2ZZTA 4Y0FA 3HK2A 3BGOP 4A8YA 4TN2A 5KG5A 2VQFF 4RUBA 1RAFB 1YBTA 4NOHA 4Q8EA 2J8SA 4H4OA 4WBFA 2R8KA 3QO9B 4YFUA 3DLGA 4NLSA 3OL6A 2R8IA 2B4UA 2DHXA 3NGUA 1P8GA 4KHMA 3G6XA 1M5SA 2CUYA 2XGQA 4ZPCA 2GW8A 3L09A 1TL1B 5A8WA 2RDJA 2N7CA 1DHMA 4B3SF 2HWHA 4OHYA 3RAMA 3R2DJ 3D2WA 2YNIA 1GNKA 2MKSA 3QFWA 1TL5A 5IT9U 2IVYA 3NGTA 3Q0AA 3TWZA 4CIOA 5KFAA 2B9EA 1ZAXA 1YJNS 1WORA 1TK0A 1TMJA 3CD6S 4C8OA 4OX7A 4USTA 3KJVA 1Y9OA 2FVCA 3CEDA 1JJ4A 2YNFA 3LAMA 4FVCA 2I38A 4K7QA 4QWEA 3KLIB 4FXWA 2R2RA 4LF5J 2A0FB 1TV6B 4YB7A 4DQPA 3EGNA 2MB0B 1HYSB 4ANCA 4F4WA 4I6YA 3CJTA 3IM8A 3OFGA 5KFRA 1MLAA 2KKHA 3CO0P 1KQSR 1SIWB 2B7BB 5DG9A 4USHA 1S6PB 3I32A 2J0QD 5KFOA 3UN5A 4FKXA 1ZAVA 5F8HA 2C3YA 1VRUA 3BM7A 4QYZJ 5H9FK 4IFVB 5L9XA 1N33J 5G4DA 2YNHB 3NCPA 4NMXA 4WKYA 2F4VF 3A8KA 3EJMA 4JI7J 2NXUA 1Q95G 1KDNA 4FBUA 4C4WA 1FKAF 4X84A 2CWXA 4UOGA 3V6JA 4LF6J 4NASA 3DLGB 2QJ3A 4Y00A 1A0OB 2QEXS 3GV7B 2V2KA 1FRMA 2IM0A 2DGUA 1PG5B 3LPEA 4X62J 3QRQA 3KLGA 4ANEA 1SKSA 4P7VA 1IR0A 1R7IA 2IC3A 3EZOA 2A3JA 2YNIB 3CTRA 4DR5F 1KTVA 2YKAA 2UUBF 3CJ5A 1T11A 2IM2A 4G1IA 2HBQB 1Y3JA 4EBDA 3RRHA 4JI3F 2HGMA 4UZBA 4LJMA 2BRLA 5HJXA 3DM2A 2XTJP 1OQ3A 1GQEA 3CCJS 3H25A 3KJVB 4DSIA 3KLFB 1RHKB 1U49A 1MN7A 2FTRA 1I5OB 4M5MA 1TFYA 1WTFA 5KFNA 4C8ZA 2GMLA 2G2YA 1QE1A 4ETZA 3HSDA 2WONA 1YBUA 2DH7A 2VFVA 3FBFA 3Q8QB 4UY85 4WFXA 4USWA 2GVDA 2F5GA 5GVQA 3ZTSA 1GXTA 4RBVA 4CCHA 4P2SA 4IRKA 3DDKA 5MLCV 3T6BA 1N5SA 1IM6A 4O0NA 4KFBA 2MXYA 3RAQA 1VRUB 1YG0A 1Y4ZB 1HD0A 1R0AA 2PEHA 4KGXB 4Y2CA 1S10A 3FEYB 3NGRA 3KOAA 3U02A 3CDBA 4DV5J 3HSGA 2XMAA 3RW6A 1SKUB 1QAYA 1XMQF 3B82A 3UPFA 1KQKA 1GMVA 3BZQA 4X2BA 3TZZA 1KS2A 2XMJA 1RADB 3T9NA 1TL7A 4WKRA 1KHVA 3UVJA 4IFYB 2B7CB 5C2CA 1H3DA 2BYCA 4LQ3A 3OTOF 3M8RA 3NS7B 3MEDA 2IC3B 2M2BA 4HACB 2AEJA 4PYAA 1TK5A 1CBKA 5EUHA 3QGHA 2NPIA 4MTPA 2QA4S 3DM2B 4BLGA 2EK1A 1YDLA 5HQ8A 2N7YA 3GIMA 2FVPA 4D3HA 3MOJB 3OFHA 4LR7A 4ECUA 1G6BA 3VR1A 1YRUA 1TMMA 2MY7A 3DOKB 1XMOJ 1QE1B 5F8LA 4QIVA 3DLEA 1H98A 2WONB 4ZVRB 2QE5A 4PG6A 1S7IA 3MMJA 4ZVPB 3M4XA 2D1CA 3CT9A 3H42A 2GVDB 3PR4A 4F26A 2VPXB 5KFSA 2UUWA 3HVRA 2CA9A 3TQ1A 3SCKE 1PO6A 3TZXA 3Q8UA 4KFBB 3GV8B 3M8ZA 4QR2A 2PI4A 4EWTA 4J37A 2JEFA 2EC2A 3IBFB 1R0AB 2V5HG 4CO5A 1ZA2B 4C8YA 5HANA 3QT8A 3PXGa 4ECQA 4MK9A 3MWBA 3VZHA 5LMNF 3S7RA 2G2ZA 1JLCB 2MLYA 1HI1A 2ATCB 3RAXA 2CJXB 3HI9A 3BYRA 4WPAA 2DB1A 2RRNA 4X4QA 4LREA 3GWCA 1TL7B 1QAIA 2Z2ZA 3UVJB 3QZ8A 4A8SA 3C6UA 3VAGA 4H4KC 1VGYA 4WYLA 1NKCA 2EFGA 3MEDB 3W60A 3TARA 1HNIA 3M8WA 2KN4A 1Q53A 1GMWA 4O4GA 2QC3A 2FJDB 1E6YA 4I2PA 5I3UA 3SQGA 3KG0A 3S01A 5DQGA 3B4MA 3IP0A 3NNHA 4HL9A 3ADAC 3GIIA 1BY9A 2DGQA 2KFYA 3C46A 4URGA 4IH5A 4ZN1A 1MROA 4K4SA 2RT3A 5DGBA 3H7HB 4ECXA 2DGTA 1FI4A 1U1RA 2PI5A 3QWUA 4CT9A 3RW7A 2GJIA 2K3IA 2W2NP 4KKOB 4J7CA 2K8GA 2DR9A 4DV6F 2ZH2A 3UNGC 1WELA 3RRGA 1MG7A 4XK8C 4F25A 4M94A 4ED5A 2EW9A 1FERA 4ZVSB 4Y6IA 1UWAA 3AD7C 4UZCA 2B3TB 3KK1A 5LSOA 3OPKA 1DQ8A 3DGPB 1HIYA 1AUDA 2AJ2A 4JV0A 2ZKTA 3J7ZT 4M5IA 1TUVA 3W64A 1S59A 1RT6A 1KR4A 4FZVA 1TAQA 1QY7A 4XIUA 1NB2A 1PYTA 2WSEC 1DQ9A 4IO9Q 2JC1A 1SB6A 3NL0A 3M05A 1D09B 4GKJJ 1SC6A 3N28A 2MYFA 4DU7A 3MR5A 2JZ5A 2ALZA 1B7YB 2IVMA 4NLWA 1FFWB 5BYQA 2PIIA 4Y2MA 3H2LA 1U26A 2CQBA 2RKIB 5G0RA 2OO4A 1HNIB 4OIXA 2XLIA 1ZM2A 5KG1A 3MM9A 1EHWA 5LOQA 4O4GB 3HHEA 1E6YB 5I3UB 4DR1J 3V4IA 4FYDA 3SQGB 4DR4F 1L3UA 1YWXA 2ZUGA 3HFZB 3UDCA 3BH7B 1D8YA 4DX8H 5HMYA 1FXRA 1RZMA 3B78A 4P2FA 4DR7F 2ASJA 3L4BC 1MROB 3WQPA 4DR3J 1R8AA 3K2YA 4U96A 4LRBA 3HULA 3GILA 5E5NA 5IQ6A 2ZH1A 1S6UA 1FRLA 2ALYB 1LXNA 1K73T 4B3OB 1RTDB 2A18A 2I5JA 2XYGB 3LUYA 2JL9A 3G8SA 2HHXA 4FNHA 2CJKA 2KB2A 4E0DA 3SZ2A 3KK1B 1O8BA 2V8VA 1C4AA 1HHTP 2CIMA 4JV5J 2NXEA 5J2NA 3F56A 2BE7D 2DY1A 1TVRB 1TKTA 3WZ0A 2KFNA 2GMHA 4HI2A 2KG1A 2J5AA 1RACB 4IR1A 2HPUA 1P6TA 4Q5VA 2PMZD 3B4DA 4B3TF 4TQSA 1RHRB 2RB7A 2KTQA 3TEGA 2L08A 2HHPA 4DV1F 2PDAA 3D1QA 3K5LA 1VQ6S 3N4WA 2ZHBA 1WKLA 2LCWA 2HQ3A 4ZVQB 2OTJS 4K2JA 3TJ8A 1YRTA 2Z8QA 3MECA 1NHKL 3FDSA 5G0RB 4LF9F 2HVDA 2QO3A 2G4BA 3O8WA 3MM9B 2XM3A 4DG1A 2FGCA 2QZ8A 3JTPA 3BGFA 2NS1B 2IRUA 2RMLA 4LF8J 1TFWA 1ZM3A 1NUEA 3M9MB 2P9EA 3ETMA 2EI5A 1Y7PA 2B4PA 4KB7A 2Y0BB 4A8QA 2AHOB 3OHBA 3ISND 3JS9A 3KYLA 4I64A 3TP2A 4F50A 4TXSA 4USMA 2JJ4D 2CJBA 3DOLA 1L5UA 4P74A 1AYEA 4CLPA 5DETA 1WC5A 2HFOA 1HWJA 3BPDA 4NYZA 1IBLF 5M2PA 4NZ0A 1RABB 1UJ4A 2I5JB 4CH7A 1UL3A 5HROA 1AB8A 2WK4A 2HNZB 2H5EA 2HQIA 1RXOB 2B4OA 2X1BA 4NI2B 2BKPA 5A8KB 1S48A 1RHUB 4NLDA 3ZNJ1 4K0KJ 2HHHJ 1U0HB 1Q5VA 2CXEA 4R0EA 3I4HX 3OR2A 2UUCJ 4FF4A 2B8PA 2M9KA 4EFAC 3Q8RB 4DL5A 1X9MA 5E2QA 4G3IA 2XEXA 2IJNA 2W2QP 2QRRA 1HW9A 4DFJA 1LWCA 1ZPWX 1F5AA 3P49B 3HPOA 1JLQA 3BN7A 4DLGA 2HRYA 3CVKA 4Z2XA 3KKFA 2R7SA 2UU9J 2MY8A 5EX0A 4WTYA 4HTIA 2W4PA 5K8NA 4JUZA 2DPJA 4ID5A 3MUTP 4KPYA 5BR8J 3NXZA 4JOUA 5ETQA 3PRBA 2FLPA 3RBZA 3KK2A 1WACA 4EO6A 3H2VE 1GK8A 4O3OA 1JWWA 2AX1A 2W8LA 1H7XA 2K7KA 3MECB 5I3QA 1J27A 3RB6A 1WWHA 1TL3B 3MCNA 2Y1JA 3Q2TC 1VIOA 4DG1B 4DU8A 2HKEA 5KG6A 4DX7A 4X66J 5B0GA 4YY3F 1HNVA 1X4FA 2EPIA 3UR3C 1S0MA 2M4MA 1WJ9A 4X4RA 4LSNA 2WBMA 4KIAA 2UV8G 3IR6B 2IA6A 3VTIA 2Q79A 2JLEA 2YWWA 3DOLB 1OY8A 3I9ZA 4K4UA 2BW7A 4HHJA 3MD3A 5K8PA 3O2IA 2XS5A 3B8HA 3PX0A 2AJ0A 3VF0B 1D1UA 3VGVA 5HROB 3IBWA 1UCNA 4FF2A 2DNLA 3OVAA 1ZETA 5K9FA 1J5EJ 5GAGU 1O5JA 1SH0A 2P9CA 2HSEB 3NAHA 1XC9A 2H51B 1JJ2R 4DV3F 3OR2B 4F2RA 2X3DA 4OZLA 1IR1A 3LP1A 5AJ3J 3PRVA 2W25A 3ZXWA 3ISNC 3HJFA 1HR0F 1LWCB 3QJJA 4BC7A 2R7XA 4HDHA 1KOOA 3W2WA 3U1LA 4JB8B 2DYAA 2MJNA 4UOCA 1B99A 4ID5B 3B6BA 3Q8YA 3DDIA 4IRCA 2I8EA 1T03A 3KK2B 3CULA 1IBCB 2ZBQA 2DO4A 1QUPA 1ZTWA 3PX6A 5DGAA 1RI7A 1N32F 2LP4A 3D0HE 1Q82T 4F2SA 1HQ2A 3CSKA 4DCOB 4B3RF 2LLZA 1YZ6A 5EHHA 3H5UA 4DUYF 3KDOA 2H5JB 1FRKA 4ZVTB 1T8EA 2FJEB 4CLWA 1NMEB 4QPTA 3K5NA 2WVCA 2ZUAA 2DEJA 5F41A 3QAEA 2RNEA 2NREA 4I56A 4ECVA 3UDLA 1VFJA 1G3OA 2H48B 4AQYF 3A8EA 3LANA 4RO0A 4ECTA 2RF2B 4H54A 3IR7B 5KFTA 2KJVA 4PWDA 4QJVA 3WX4A 3WIUA 4Y2IA 2J7UA 3V6DB 4ENOA 1N36F 4RR5A 2OP5A 1WDTA 3PACA 5LJ3Y 4NYOA 3TI0A 4O3QA 3ZZRA 2GO8A 3T3FA 1ZPVA 4DL3A 2EWHA 3Q22A 4NEYA
chains in the Genus database with same CATH topology
1AZSB 2QV6A 4USUA 4P2XA 1WC4A 1CJKA 4USVA 1CULA 4CM0A 4CLKA 3MAAB 2W01A 3ET6A 5D0RA 3C14A 1TL7A 1WC6A 3UVJA 4CLWA 4OYAA 4WP9A 1CJVA 1FX2A 1CJTB 4CLUA 1WC0A 3C16A 2GVZB 4OYBA 1YBUA 5D0HA 4OZ2A 4CLPA 4NI2A 1WC5A 4OYZA 4WP3A 4OZ3A 1YK9A 3C15A 4USWA 1CJUA 1CS4B 2GVDA 5IV3A 3G82B 5D15A 4OYOA 1CJVB 1U0HA 5IV4A 4CLYA 1AZSA 4USTA 1CJKB 4CM2A 1FX4A 1CULB 1AB8A 4WPAA 4CLSA 5D0GA 3ET6B 4NI2B 4OYXA 3C14B 3C15B 4P2FA 1TL7B 1WC1A 5D0EA 3UVJB 3R5GA 4CLFA 1Y10A 4OYIA 1CJTA 1U0HB 2WZ1A 4OYWA 2GVZA 1WC3A 3C16B 4OYMA 4CLLA 4CLTA 3MAAA 4P2MA 4CLZA 3MR7A 4OYPA 1CS4A 1Y11A 2BW7A 1CJUB 3G82A 1YBTA 2GVDB 4WP8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AZS B;  2QV6 A;  4USU A;  4P2X A;  1WC4 A;  1CJK A;  4USV A;  1CUL A;  4CM0 A;  4CLK A;  3MAA B;  2W01 A;  3ET6 A;  5D0R A;  3C14 A;  1TL7 A;  1WC6 A;  3UVJ A;  4CLW A;  4OYA A;  4WP9 A;  1CJV A;  1FX2 A;  1CJT B;  4CLU A;  1WC0 A;  3C16 A;  2GVZ B;  4OYB A;  1YBU A;  5D0H A;  4OZ2 A;  4CLP A;  4NI2 A;  1WC5 A;  4OYZ A;  4WP3 A;  4OZ3 A;  1YK9 A;  3C15 A;  4USW A;  1CJU A;  1CS4 B;  2GVD A;  5IV3 A;  3G82 B;  5D15 A;  4OYO A;  1CJV B;  1U0H A;  5IV4 A;  4CLY A;  1AZS A;  4UST A;  1CJK B;  4CM2 A;  1FX4 A;  1CUL B;  1AB8 A;  4WPA A;  4CLS A;  5D0G A;  3ET6 B;  4NI2 B;  4OYX A;  3C14 B;  3C15 B;  4P2F A;  1TL7 B;  1WC1 A;  5D0E A;  3UVJ B;  3R5G A;  4CLF A;  1Y10 A;  4OYI A;  1CJT A;  1U0H B;  2WZ1 A;  4OYW A;  2GVZ A;  1WC3 A;  3C16 B;  4OYM A;  4CLL A;  4CLT A;  3MAA A;  4P2M A;  4CLZ A;  3MR7 A;  4OYP A;  1CS4 A;  1Y11 A;  2BW7 A;  1CJU B;  3G82 A;  1YBT A;  2GVD B;  4WP8 A; 
#chains in the Genus database with same CATH topology
 4OZ5 A;  1BMQ B;  2PN6 A;  5CZV A;  4P2X A;  2EC0 A;  4CO4 A;  1FNX H;  3FK4 A;  4JP8 A;  4J9O A;  2BKN A;  2HZA A;  4ES2 A;  3PX4 A;  2C2Z B;  3ZZY A;  3W2W B;  4JI5 F;  4PCQ A;  1T95 A;  1CVJ A;  3OTE A;  2G0C A;  3C16 A;  1YLX A;  4NLG A;  5KFZ A;  2GAH C;  1RA6 A;  3KHG A;  1VBY A;  1WHV A;  4IG0 A;  4RLE A;  1RBL A;  1SC4 B;  1FJG J;  1RTJ A;  2PMW A;  1SQG A;  4RNO A;  2E1P A;  3K8V A;  3P5T L;  2QMW A;  2MZT A;  5D0E A;  2VDH A;  4M1K A;  1ZA1 B;  3ZTQ A;  2DO0 A;  1NND A;  2DR5 A;  1RWX B;  5M2U A;  3M30 A;  2ZH4 A;  2MQO A;  1W2B R;  3ETO A;  1B70 B;  2ZVI A;  3TUZ C;  3P8B B;  3L7P A;  2HVH A;  1NJY A;  3G96 A;  3V81 B;  2FHJ A;  1JLA A;  5IT4 A;  3P6Y C;  1DTT A;  4PWD B;  4A46 A;  4B9M A;  4ED3 A;  5GAE U;  2OEL A;  4LFB J;  1N6Q A;  3HKW A;  4RUH A;  3HT0 A;  1YGY A;  1OSC A;  3D3B J;  1FD2 A;  4LFA F;  3KNA A;  4MFB A;  4U67 Q;  2KRR A;  1U1P A;  2CJQ A;  4LF1 A;  2CZ9 A;  2JDJ A;  3UCU P;  2YWE A;  5KFQ A;  3GYX B;  3H0P A;  4PWW A;  5KT6 A;  1PIE A;  5AE1 A;  3TR5 A;  4NXN F;  4TNO A;  4B17 A;  3T5H A;  4FYY B;  1PCA A;  4FYW B;  3GYN A;  4ZVU B;  1R8C A;  2Y1R I;  1L3K A;  3RU0 A;  5EN1 A;  3KMS A;  3RTV A;  4F4A A;  2DTJ A;  5HQL A;  1RWW B;  2FHO B;  2QL7 B;  2XY6 A;  4JI1 J;  3G6Y A;  2O01 C;  2FVR A;  4FVM A;  5E7O B;  4N8N A;  4NML A;  1OYD A;  4N5S A;  2HVZ A;  3D54 A;  1YVF A;  1WUU A;  1VI7 A;  1RT4 A;  3C16 B;  1HA1 A;  3K89 A;  2R8H A;  2A2C A;  3EGV A;  1UFW A;  3T1Y F;  1JNR B;  4PG4 A;  3AT1 B;  4FKY A;  3QJL A;  1UEK A;  2QLB B;  4KQZ A;  4QYZ K;  4C0H A;  3R3T A;  1KRP A;  3G71 S;  3BDP A;  2DNN A;  5IT9 Y;  1GH8 A;  4IG0 B;  1NZA A;  2CYY A;  4OX9 J;  2GCF A;  4JI8 J;  3TJ9 A;  1RTJ B;  4ZPW R;  1XJW B;  4EYI B;  3KUH A;  4IQX A;  2LYV A;  1HQE B;  3CW2 C;  3IGV A;  4AL7 A;  2CPX A;  1S0N A;  1TUW A;  3Q83 A;  1Z4U A;  2XI2 A;  1DUR A;  3W61 A;  3PJW A;  4DFK A;  3M30 B;  2YWK A;  4WWS A;  2IFX A;  4KR0 B;  1IJE B;  1ZS6 A;  2NSC A;  4K4V A;  2QIF A;  3ENQ A;  1S1T A;  4YHH F;  3AAW B;  5HO4 A;  1DTT B;  1U48 A;  5IWA J;  2HEK A;  2MTL A;  5B0E A;  3G6E S;  5F8G A;  1N6Q B;  1FX4 A;  1HNW J;  3D0G E;  4MFB B;  4GKK F;  3VAM A;  2MKJ A;  4UQG A;  2WCX A;  4LF7 J;  2XY7 A;  5EDW A;  1QM9 A;  3CGI A;  3K59 A;  4OLP A;  1GMU A;  3HSJ A;  1XNR F;  2HQC A;  4ES1 A;  5KG0 A;  4A48 A;  1VQM S;  4ZP6 A;  2B5J B;  2WB1 D;  1A6L A;  2Y1L B;  2HBR B;  2R8G A;  2BKO A;  3N5B A;  4ALZ A;  1ZBT A;  2OD4 A;  2FLN A;  3M8Q A;  4IR9 A;  1HI8 A;  4DN9 A;  2D9O A;  1MN9 A;  4DQI A;  4ZA1 A;  2IDL A;  1I94 F;  1WC6 A;  4QCL A;  4E98 A;  5H9F J;  2WVE A;  3NWR A;  4F0H A;  2NXN A;  1RT1 A;  5HVF A;  4WK1 A;  2KDO A;  4ZPA A;  3W7B A;  1NJW A;  3AA8 A;  4OHV A;  5J2P A;  2XSF A;  4O3R A;  3SFU A;  1U0S A;  4IQM A;  1S7H A;  2B6A B;  5DQH A;  2FHK A;  1HD1 A;  2NCK L;  2YWH A;  2DNQ A;  3PKM A;  2CPJ A;  2Z2M A;  1S9G A;  1T05 A;  1CJT A;  3GV5 B;  3JSR A;  3J80 Y;  3QPI A;  4MIW A;  3DRY A;  2DNY A;  2E9T A;  2V34 A;  2EXU A;  2PGC A;  2NLW A;  1S1T B;  2B51 A;  4ZCL A;  2RU3 A;  5HAO A;  3EGW B;  3L9Z A;  3FCW A;  5D0R A;  3M9N B;  2R9L A;  3NS5 A;  1UVI A;  1BUX A;  4CDI A;  4EO8 A;  2H65 B;  1RAJ A;  2VFS A;  3BH6 B;  3THV A;  2J0W A;  2MZS A;  3WIV A;  1ELO A;  2R7U A;  3FC9 A;  4NCA A;  1X5S A;  1RB0 A;  4DR6 F;  3QAU A;  2F40 A;  3T6J A;  3DNC A;  4ZDN A;  1AZS A;  1ZM4 A;  2AJF E;  2BXJ A;  3GB0 A;  2CQP A;  2ZM6 J;  2AYG A;  3EZ5 A;  3PRD A;  4B9S A;  5E0O A;  2GS8 A;  4DQQ A;  1IXK A;  4AXJ A;  4P73 A;  2OPQ A;  2ZJP Q;  1RT1 B;  2QSF A;  2XWY A;  5DO2 A;  1NK9 A;  1VQ7 S;  4ES3 A;  1UFL A;  5ETP A;  1EKR A;  4HKQ A;  4WP8 A;  3VZI A;  1XNQ F;  5K5M A;  3OT9 A;  1YJ9 S;  3ZFV A;  3KTQ A;  4USU A;  4Z7Y A;  3VGS A;  2R7V A;  1CC7 A;  1JJC B;  2E7W A;  2HBY B;  5I3P A;  3BRE A;  1NZ8 A;  2VPY B;  5CAA A;  1FFS B;  4X64 J;  4M95 A;  2K1R B;  1S9G B;  3JQJ A;  1S6Q A;  2ACM A;  1CJT B;  2VFR A;  3AY0 A;  4KSE B;  4V1A k;  4LQ9 A;  2ZDO A;  2KRB A;  4RBU A;  1SJ3 P;  1S99 A;  1S9E A;  4XPE A;  3I56 S;  2FVS A;  3NGD A;  4F8R A;  3UN2 A;  3JXO A;  4NLY A;  4ZN3 A;  3DMJ B;  4U95 A;  2V94 A;  8RUC A;  5ITH A;  4CLS A;  1KVJ A;  2GO9 A;  2Q6B A;  1MMD A;  4ECZ A;  5KFL A;  9RUB A;  4HHH A;  4UTG A;  3BQ0 A;  4ERD A;  3OHA A;  4URS A;  2GZO A;  5HMX A;  3R5A A;  2IM1 A;  4RW8 A;  2C2N A;  2H4W B;  3ZTP A;  4FN5 A;  4I0W A;  1OPI A;  1TP7 A;  4BS2 A;  2AP6 A;  2MQN A;  3GCW P;  2CPI A;  1AZS B;  2YY3 A;  1CJK A;  4N76 A;  1HWU A;  1QDU B;  2N4C A;  4DL6 A;  1FVQ A;  2VC0 A;  2PT0 A;  3EUN A;  2EG2 A;  1N8R T;  3MPU B;  3UO0 A;  5KFP A;  4V19 X;  2OPQ B;  2NZ4 A;  3BSN A;  1U6B A;  3OL8 A;  2DK2 A;  4JYA F;  2VON A;  1WG5 A;  2D3Z A;  4PQU A;  4K5R A;  1W7W A;  4C8N A;  5DG7 A;  2NXC A;  5AE3 A;  3LGM A;  1L3S A;  3M32 B;  4PXD A;  1W26 A;  2CFX A;  3D6F B;  1S6Q B;  3MDF A;  3FUY A;  2E1M C;  2M0G B;  3ZO7 A;  3PR5 B;  1WKJ A;  1RAI B;  3MUR P;  4X65 F;  1UEV A;  4PG7 A;  2OKQ A;  1S9E B;  1TKX A;  1IJF B;  2MQP A;  1JMT A;  2Z57 B;  4DCJ B;  5DDO C;  4C6A A;  1X4G A;  1RWN B;  2JWN A;  4ILL A;  2QYG A;  1F5B A;  2YBV A;  4QW9 A;  5J2Q B;  2UXC J;  2Y8W A;  1P1L A;  2NZC A;  4BC9 A;  3J7Y U;  5GAH U;  2DNZ A;  2M7S A;  1NHV A;  1HNX F;  3W2V A;  1NBE B;  4J9R A;  3M9O B;  1ICE B;  3X1L B;  2PC6 A;  3DLH A;  3BQ2 A;  4RW8 B;  5GAD I;  3FJ2 A;  3THT A;  2UXB J;  1HWK A;  4R8U A;  4ZJL A;  2D41 A;  1PAE X;  2QSW A;  4M5H A;  3D7S B;  1K8A T;  3ZTO A;  1CJK B;  1E6V A;  1NPP A;  3GLJ A;  4U7U D;  4F67 A;  3IG1 A;  3BO4 A;  2IDE A;  5LM7 E;  4DV4 F;  2E5L J;  2DR7 A;  3LP2 A;  1U1L A;  5HL7 Q;  2GVZ A;  4ID8 A;  4ZPD A;  4CTA B;  2L9W A;  4LRD A;  2VA2 A;  3HZE A;  2R7Q A;  3M8S A;  1RU1 A;  2HHV A;  4ELV A;  4RW9 A;  4CLZ A;  5F3Z A;  2DGW A;  3N5F A;  2GAG C;  3HJV A;  2LDY A;  2BE9 B;  2YVS A;  2KJW A;  3FGV A;  2LQ5 A;  2QGF B;  1SVD A;  4AYB D;  2FPH X;  1WTB A;  4HH0 A;  2CNN B;  2HFU A;  2HWI A;  4DV2 J;  4IG3 A;  1OY9 A;  1WI6 A;  2UVU A;  1N54 B;  1SXL A;  4RWX A;  2VZ9 A;  3NLC A;  1GAO A;  3W65 A;  4EU0 A;  2DRA A;  3SEO A;  1VK3 A;  4KV8 A;  2VBW A;  2VFT A;  5IV4 A;  3QT6 A;  2FC8 A;  1WHX A;  4RNF A;  2E7V A;  3CDE A;  4OI6 A;  4R5P A;  1F60 B;  2V2V A;  1NK0 A;  2LU1 A;  3R2C J;  2P5V A;  3CJK A;  2BZ2 A;  4NE9 C;  3DI6 A;  1T9T A;  1XR6 A;  2G2O A;  3W2V B;  3JTN A;  1UVK A;  5IS2 A;  2DIV A;  2DHH A;  2VHG A;  2AIR B;  1Q8I A;  3V6H A;  4LF4 F;  3KXD A;  2IA0 A;  1HMV A;  3QRR A;  2XCA A;  1FJE B;  2DHA A;  3MMB A;  2C2E A;  3K5P A;  1N4L A;  1HAR A;  2CJY B;  5D4O A;  4R8U B;  3K57 A;  3R27 A;  1LW2 A;  2MEW A;  3MAA B;  4XDD A;  4HEA 9;  1BQX A;  1UEU A;  3H5X A;  2YKQ A;  5EGY A;  2IRY A;  2OLW A;  2HVI A;  5JXS A;  3LP2 B;  2YWG A;  3R6L B;  2GVZ B;  1K47 A;  2YKP A;  4DR2 J;  3C66 A;  5DG8 A;  1XIQ A;  5T41 A;  3AOA A;  3TVY A;  4RW9 B;  4L3K A;  5DLG A;  2HIY A;  4N7T A;  2QLJ B;  2X1G A;  4Y34 A;  2WB4 A;  1VHI A;  3TZW A;  2PD1 A;  1C1B A;  2AGP A;  4WZQ A;  2AMC B;  1QSY A;  3M2R A;  4CM2 A;  2KT3 A;  4DX5 A;  2G13 A;  3CJ3 A;  4ZIW A;  3R5J B;  1RAO A;  3BB5 A;  5KFW A;  3FEX B;  2QLW A;  3NCR A;  4B3M F;  4IG3 B;  1OWX A;  5IC6 B;  2C3M A;  2P6T A;  4ZLP A;  3CDU A;  3IRX B;  5BJR A;  1FVS A;  2H9Z A;  3MMA A;  3DOM A;  5DRK A;  3AD9 C;  2J9D E;  3IA0 A;  3S8S A;  4C11 A;  2AYB A;  2CQD A;  4HDG A;  4KV8 B;  1I1G A;  4W92 B;  3AJ2 A;  2HZC A;  1REV B;  5KG4 A;  1PJ7 A;  1Q0N A;  1LK5 A;  5A0Y A;  3NAI A;  2KG0 A;  2RS2 A;  4BWM A;  2LXF A;  2ROG A;  2VG7 A;  4RNM A;  4PUO A;  2W9C A;  1RUS A;  3SI8 A;  2YX4 A;  3T9Z A;  2ZH3 A;  2XZT B;  2XWX A;  2GA7 A;  1SBR A;  4TLR A;  3C19 A;  2CPF A;  3C15 A;  1HFE L;  3PJX A;  3LQV A;  1HMV B;  3UE2 A;  2RQK A;  4Q43 A;  4W98 A;  3SBM A;  3OL7 A;  4RL1 A;  4NYP A;  4JBC A;  1BQM A;  2AGO A;  4QYR A;  5KAK A;  3MUV P;  3N9U C;  1M5O C;  1VQN S;  2R2U A;  4XPC A;  3JSM A;  4CRJ A;  1RQ0 A;  2ZIT A;  5M2R A;  2XMT A;  5ETM A;  1WC3 A;  4DPX A;  1H7W A;  4GC7 A;  2CQI A;  1FT8 A;  1JKH A;  3TA1 A;  3HVA A;  1Y11 A;  2FGO A;  5F8M A;  4USI A;  5IC4 B;  4ZJQ A;  1KBR A;  3KJF B;  2IJR A;  1JLG A;  2YQ3 A;  3MPY A;  4R25 A;  3SCJ E;  1C1B B;  3VGT A;  3MEE B;  3M2R B;  5GMD A;  4UW2 A;  2EKY A;  2P6S A;  3IO1 A;  3EX7 B;  1XTZ A;  1IKY A;  5J2M A;  3A4T A;  4OJG A;  4A8F A;  5KT2 A;  3GIK A;  3BO2 A;  1NK5 A;  2DGV A;  2BDP A;  5I42 A;  2PO4 A;  3MMA B;  1RAE B;  3GPA A;  1N5Q A;  4KRW A;  4C11 B;  3NNA A;  5JVH Q;  2C2R A;  3CXC R;  1TL4 A;  1WD6 A;  3ZNU A;  3R8Y A;  1PJ5 A;  3OVS A;  5A0Y B;  1HI0 P;  2AU0 A;  4TY8 A;  1QSL A;  1LOU A;  1QSS A;  5JJB A;  1KNZ A;  5KT3 A;  4EZ6 A;  1T94 A;  4CLF A;  1LKZ A;  1VQP S;  2VBZ A;  3HDS A;  2W9C B;  1BWE A;  2Q66 A;  1QUV A;  2XNR A;  1SL2 A;  3SDE A;  5SZT A;  2XZW A;  4NX9 A;  2VG6 B;  1UMJ A;  4PKD B;  4OHZ A;  3DU6 A;  4LMZ A;  2ASD A;  1JXV A;  4OFZ A;  3PFO A;  1RT3 A;  1N5T A;  2DHG A;  4LR8 A;  3QID A;  1S97 A;  4I6W A;  4JI2 J;  3VAI A;  3OXG A;  3UD4 P;  3EM1 A;  3CME S;  3JTO A;  3LO3 A;  3JSM B;  4DSJ A;  2CQ2 A;  2UUA J;  2R42 A;  2JFK A;  3CIM A;  5A8R A;  5DDQ C;  1JKH B;  2HK2 A;  2CJA A;  1VC0 A;  1G4C A;  4JI4 F;  2R7T A;  3MM5 B;  1ULR A;  2XYP B;  3KHR A;  4FF1 A;  2R3V A;  1KN6 A;  1WHY A;  2AJ4 A;  4DQS A;  1WG4 A;  1RKJ A;  2LQ8 A;  2DNM A;  4KAI A;  4OMF G;  2W24 A;  5CAB A;  2DBB A;  3HXM A;  2KH9 A;  3FMB A;  3NS6 A;  4PZV A;  5ETL A;  1IKY B;  4O3P A;  5J2M B;  3OL9 A;  3RJM B;  1BXN A;  2OEM A;  2ZFH A;  3E8O A;  4HYK A;  4JI6 F;  4LRC A;  1DTQ A;  2NUU G;  2BJD A;  3R1L A;  3IS9 A;  3PHE A;  1KP6 A;  2RHQ B;  2GC8 A;  1QTM A;  3G2X A;  4O23 A;  4OV6 A;  1OSD A;  3D6H B;  2JC0 A;  3EXC X;  2KYZ A;  4KO0 A;  4L3N A;  1PBA A;  2RVJ A;  3PYG A;  2W7O A;  4XO0 A;  4FF3 A;  4IOB A;  1VQY A;  4KYZ A;  2HFZ A;  3W66 A;  1WDD A;  2AX0 A;  2F8M A;  5F8I A;  1R8H A;  3MXH P;  5E3P A;  4DPT A;  2QYC A;  3K7R A;  3QAT A;  1UZH A;  3E51 A;  5AXN A;  3CJ8 A;  4KY3 A;  4C0B A;  3QWP A;  2MKH A;  4L76 A;  1RT3 B;  2MZ1 A;  2MSS A;  1IBM F;  3CDA A;  2CNO B;  3FEZ A;  4LUB A;  5HK4 A;  3L3C A;  4RW6 A;  3GSD A;  5L39 A;  4ZIT A;  1UZD A;  3TAM A;  3SV4 A;  1C1C B;  5A8R B;  3HCX A;  4DS4 A;  2MKY A;  2EBE A;  5CCM A;  3BDE A;  4P7T A;  5ETS A;  3O6Q A;  1B3T A;  1H73 A;  3D6M B;  2C3U A;  1YJ7 A;  2AYE A;  1KLM A;  1YI2 S;  2RE1 A;  2I9S A;  4DV7 F;  5CYJ A;  4ECY A;  5EWF A;  2KI2 A;  1IBK J;  4ZLJ A;  4OJ3 A;  2DH8 A;  1EB0 A;  4DUZ F;  3ITH A;  1WSV A;  3VCD A;  5AXM A;  1Q8B A;  1S1U A;  2NPF A;  3AXK A;  3HHD A;  1YIT S;  5KFU A;  3IS9 B;  1CJU A;  3G8T A;  4LFC J;  3BKU A;  4B9T A;  1Z1Z A;  1H2V Z;  2ZNY A;  2F7V A;  4KO0 B;  4M5K A;  1EAY C;  2EFO A;  1RWK B;  4A47 A;  2EFV A;  4M63 A;  2IIH A;  2EVZ A;  1WF2 A;  3KFW X;  1KD1 T;  1FKO A;  2QFJ A;  1FE4 A;  2VL1 A;  3CPW R;  1U4B A;  2VB6 A;  1FO1 A;  3A1Y G;  4F0K A;  4XTT A;  3FFI B;  1RDR A;  4NLQ A;  4PYD A;  2XC9 A;  1ZZF A;  2N3L A;  1UW9 A;  1LW0 A;  3GZ7 A;  1D9A A;  1DY3 A;  2GV1 A;  3OUY B;  2VQE F;  5KFX A;  2ZKU A;  2BUN A;  1WI8 A;  4Q45 A;  3P3D A;  1X4C A;  3TAM B;  5RUB A;  3MFI A;  1WEX A;  5DJB A;  3I96 A;  1WKK A;  2CG8 A;  3RB3 A;  2ZVS A;  1N34 F;  4J9V A;  1U7L A;  1Z2Z A;  1RYR A;  3PHT A;  2YKN A;  2Y1I A;  4NCB A;  1S0V A;  4ILM A;  1KLM B;  5L38 A;  4B02 A;  2HFS A;  3CCT A;  2LMI A;  3T1H F;  2RQM A;  5ETO A;  1NKE A;  3S1T A;  2Y0S D;  4YB6 A;  1GEH A;  4HH1 A;  8ATC B;  4RU2 A;  1QAX A;  3UDE A;  1M5V C;  2RQC A;  1VIX A;  1VHF A;  3M6X A;  2OTL S;  2DNP A;  4UQT A;  2X1F A;  1CJU B;  5HLF A;  1R8B A;  1F3F A;  3ILO A;  2RDD A;  3FMW A;  4H4M A;  3HVT A;  3BBB A;  3LP0 A;  3NMR A;  1YJW S;  1Z2L A;  2HS4 A;  1KQF B;  2JVO A;  3EZU A;  1XR7 A;  5LMU J;  1RLD A;  1RWO B;  2CQC A;  1X31 C;  1FKP A;  1WC0 A;  4H4O B;  1OMS A;  3VHQ A;  2CQ0 A;  3Q8S B;  4KHP F;  3RUB L;  1SV5 A;  2XSJ A;  1M5H A;  1FKO B;  3U1N A;  1R27 B;  2B9W A;  4LVO P;  5KFE A;  5A8W B;  4NXM F;  1MU2 A;  3MPW A;  3NRB A;  2FZK B;  2V4J A;  4KGZ B;  2KXH A;  1HW8 A;  3K58 A;  4RX6 A;  3BN4 A;  1EP4 A;  2VQF J;  2W2M P;  4UT4 A;  1YJT A;  3EVO A;  1LW0 B;  3KJQ B;  4MIB A;  3KJN B;  4OHX A;  4L75 A;  1NPK A;  4LIR A;  3NGK A;  3NOC A;  4CWB A;  3Q2S C;  1RSC A;  1VYA A;  2DNH A;  2YNF B;  2KM8 C;  4NPO A;  4W90 B;  4B3S J;  2R7R A;  3SQO P;  2R4F A;  3SXL A;  2W9A A;  4X4O A;  5IM0 A;  4DL2 A;  3FSX A;  2YKN B;  3PKY A;  1RWP B;  3AQO A;  1LWF A;  2IM3 A;  3QT5 A;  4MMO A;  2LEC A;  3MPV A;  2Q3P A;  1CG2 A;  2CG4 A;  1RHJ B;  4NLR A;  3TUJ C;  3H5Y A;  1NK4 A;  3FQK A;  2CPY A;  2XHW A;  2BQ3 A;  1U1K A;  5HLF B;  2LA4 A;  2LFV A;  1NRK A;  4H4M B;  2CVI A;  4CT8 A;  2MMY A;  2GIR A;  3HVT B;  3LP0 B;  3SSQ A;  2OH2 A;  3M1V A;  3BPS P;  4MKV A;  2ZOM A;  2J9D A;  4IOC Q;  2VPW B;  4QWC A;  3UD5 A;  5HSP A;  3D66 A;  1FRJ A;  2OUG A;  2OML A;  2JEI A;  1FKP B;  3N6L A;  5KFM A;  4NWB A;  4CLT A;  2JH3 A;  2BOA A;  1T0T V;  1EQM A;  4DXL A;  1JNZ B;  4RPF A;  2CQG A;  4LBP A;  1SV5 B;  4YR3 A;  3R5B A;  4ZIV A;  3PJ9 A;  4UY8 T;  2XSJ B;  1MU2 B;  1RHQ B;  2F4V J;  5KT5 A;  2G1D A;  3KLG B;  2V4J B;  4QQB A;  4RUC A;  2OSQ A;  1CSJ A;  2CDR B;  4G6V B;  3VAH A;  1KVK A;  4CLU A;  2BOP A;  4LSZ B;  2JHE A;  4DS5 A;  2ZNZ A;  3CO9 A;  2A2D A;  5D0H A;  3B54 A;  5ETV A;  4K4W A;  1CQN A;  5IM0 B;  2KXN B;  4DR5 J;  2E9R X;  3AB2 B;  2UUB J;  3PEJ A;  1K1S A;  2UZA A;  4JI3 J;  3DKD A;  1DLO A;  3JAM U;  1LWF B;  3MEK A;  5A6W A;  5L8R C;  2DXF A;  1HBU A;  3FBC A;  1YSJ A;  1LNQ A;  1P27 B;  1UJ5 A;  4Y2A A;  3D3C J;  2C28 A;  3NP5 A;  3RZA A;  3IAM 9;  2ZJQ Q;  3ENV A;  4P2M A;  3I82 A;  3GFZ A;  4WFB Q;  3D1O A;  3PM9 A;  1JK9 B;  4YB5 A;  3IGN A;  2ZBC A;  2ZBR A;  4DFM A;  5E41 A;  3Q86 A;  3GU0 A;  2RD5 C;  3M1V B;  2XS7 A;  2YKM A;  5D3G A;  4BDP A;  1T9V A;  4ZS6 A;  2B9Y A;  2Z56 B;  1CPZ A;  4ZMM A;  2ZH5 A;  5AXK A;  2ACY A;  4DZ6 A;  2W7P A;  4RWW A;  4A8W A;  1YK9 A;  1KFS A;  2HBZ B;  2AJ1 A;  3CC7 S;  2MST A;  3HZG A;  3VAF A;  1U8W A;  5CQG A;  4DV0 F;  1H72 C;  4J9Q A;  2OEK A;  5IOL A;  1XK8 A;  2GFF A;  1SJF A;  2BM1 A;  2LQ9 A;  4HI1 A;  3M2V A;  1XEZ A;  3EMT A;  3T19 A;  3PO4 A;  2BM0 A;  1XMQ J;  4URQ U;  4WE1 A;  1U1M A;  3MM8 A;  3C6T A;  3CMA S;  4CI0 B;  3KDN A;  3DHX A;  1FRH A;  4OLO A;  5B09 A;  2XYH B;  3TQE A;  2Z2Y B;  3OTO J;  2VOO A;  3EIC A;  1ZH5 A;  4QIF A;  4GVL A;  4WFN Q;  2V2Q A;  1UPM B;  1VOM A;  3DLE B;  4A8K A;  3PZP A;  5K14 A;  1FDA A;  3P4U B;  2E9Z A;  3ZZP A;  2J0X A;  3ET6 A;  5L1L A;  2ZZN A;  2UXD F;  1C4C A;  1HBU B;  3CC2 S;  4OYA A;  3I5A A;  2NYI A;  4MK7 A;  2XCP A;  2OMO A;  3M6V A;  1U02 A;  4WU2 A;  2PA3 A;  3QMQ A;  4OYZ A;  2HHS A;  1M1K T;  4LRA A;  3SMZ A;  1NO8 A;  2V6A A;  1D9F A;  3ZZ0 A;  2QL9 B;  3O44 A;  1Q8K A;  5SUH A;  3HD1 A;  4M5G A;  2VIH A;  3A3P B;  3I0R A;  5C5J A;  3GFH A;  2QLF B;  3W5Y A;  4F4X A;  2YKM B;  3O3L A;  3KMQ A;  2GQ2 A;  1BD6 A;  2OD6 A;  3H8Y A;  4Z37 A;  4ED8 A;  1F0X A;  6AT1 B;  4ZPV R;  2IRX A;  2L48 A;  5KFK A;  1UVJ A;  1FWL A;  1V3R A;  2VF3 A;  2HAF A;  1ZAW A;  2B8Q A;  4LIW A;  3C6U B;  4MYT A;  1S57 A;  3QZ7 A;  2GQQ A;  2HHU A;  4PXB A;  2W2P P;  4NA1 A;  2Z30 B;  1XR5 A;  1TR0 A;  1B0T A;  2XMU A;  1X60 A;  1G1X A;  5LMN J;  2DGS A;  2RAQ A;  3KHH A;  3IBC B;  4I2P B;  3KLE A;  4USJ C;  1V6H A;  4KGK A;  3PFE A;  1CJV A;  2V4Q A;  1RK8 A;  4WE1 B;  2HS0 A;  3MM8 B;  3C6T B;  1MNE A;  3M7V A;  8AT1 B;  2RS8 A;  1Q86 T;  3DYA A;  3WDO A;  2X51 A;  3HHL D;  4IOA Q;  1VQ9 S;  4EK2 A;  1SPB P;  2KL8 A;  9ATC B;  1SKW A;  2HZV A;  5K14 B;  3ET6 B;  4J9N A;  1HNZ F;  4HHU A;  4L73 A;  1CLF A;  1UTA A;  1YQH A;  1VIS A;  2MQM A;  1LFP A;  3RGI A;  2VFU A;  4OYM A;  1N48 A;  1JJH A;  1VQL S;  3HP6 A;  2F1F A;  4R0J A;  3NNC A;  3VAK A;  3KLV A;  3G6V A;  5T7L A;  5CCL A;  4F0M A;  1MWQ A;  4DV6 J;  2V8G A;  4F3O A;  3I0R B;  2ZWO A;  1V3Z A;  2O66 A;  1RT6 B;  1FWK A;  2LXU A;  3N6M A;  2VG5 A;  2VJV A;  2X1A A;  4YN3 B;  4B9L A;  1MWY A;  4MKA A;  2V8D A;  3V5R A;  2XQC A;  2ERR A;  4LR9 A;  3CD7 A;  1VDH A;  1F1B B;  2E1R A;  1OQ6 A;  3FSI A;  2LEA A;  4ZK7 M;  3OFF A;  4TLQ A;  3CJ4 A;  1AUS L;  2J6S A;  2GNK A;  1BQN A;  3C8Y A;  4I1T A;  2KZM A;  4JI0 F;  3KLE B;  3V4I B;  3W5Z A;  4WFA Q;  2ZHA A;  3ILJ A;  1JB0 C;  3QNW B;  1SIZ A;  3DYA B;  4NCG A;  3I6P A;  1SI9 A;  1S4E A;  2ROE A;  2YX7 A;  4USV A;  1FWP A;  4Y2K A;  2C2M B;  2ZHO A;  2ASL A;  4TYB A;  3KLH A;  1FD8 A;  2EBG A;  2EEY A;  3I31 A;  4DR4 J;  4J9M A;  1K9M T;  2R2S A;  4OZ0 A;  4CNZ A;  2ZBP A;  2YPZ A;  4DR7 J;  2CQ4 A;  3U7J A;  4FS1 A;  1SH3 A;  1X0P A;  1U2F A;  2PFF B;  2DVI A;  2HFN A;  4HT7 A;  2QN6 B;  2HW3 A;  2DY9 A;  4K5S A;  3LH2 S;  5T7L B;  4GO5 X;  2L3M A;  1XN9 A;  5J2N B;  2JX2 A;  3MMC A;  1NK8 A;  1TKT B;  4NLU A;  3KUG A;  4M5L A;  4AFF A;  2FUG 9;  5I4M A;  2BRK A;  4KGM A;  3HMJ G;  3RB4 A;  4N41 A;  2VG5 B;  4NLP A;  3QO9 A;  3IAS 9;  1XBW A;  1B4S A;  2KT5 A;  2DNG A;  2VV5 A;  5BYS A;  2GHP A;  1RA7 A;  2XO7 A;  3AOC A;  1X5O A;  1CS4 A;  1TL1 A;  3SYZ A;  1G2E A;  5CD4 H;  3MTK A;  5KT4 A;  3VQT A;  2XUL A;  4LF5 F;  1UW4 A;  4CM0 A;  4U9R A;  2DXD A;  4ECW A;  2KVQ E;  2ZBI A;  4PQA A;  3FZ2 A;  4B3T J;  1BQN B;  3NOG A;  4QU7 A;  4DLE A;  4YDD B;  4DV1 J;  4CO0 A;  4EUV A;  2F63 A;  2PE8 A;  2Y8Y A;  3NY0 A;  4RU9 A;  1YJV A;  3GG0 A;  3G87 A;  2DRD A;  5HI7 A;  5HVG A;  1JLF A;  1S1W A;  4ZLL A;  1ACM B;  3TW0 A;  4NCG B;  5GME A;  2AEF A;  1JQG A;  5MAO A;  5IV3 A;  2RDI A;  3RBX A;  2MZR A;  1GFW B;  2ZOF A;  5THW A;  5JUM A;  5IFM A;  4LF9 J;  3CUN A;  1N33 F;  3PW0 A;  3OJU A;  3KLH B;  2NQP A;  2M3D A;  4JI7 F;  5KFI A;  5F9N A;  1SJ1 A;  3CJ2 A;  4LRF A;  2MHE A;  5L1I A;  3MM6 A;  2VDI A;  1DBD A;  2POK A;  1RTH A;  4LF6 F;  1S6O A;  1RE1 B;  2FY8 A;  3JSB A;  3SSS A;  2D3O R;  2LQB A;  1FTR A;  1VQK S;  4X62 F;  2YNH A;  3MMC B;  4I69 A;  1KHW A;  3RRK A;  2W7A A;  4TKT A;  1IBL J;  2A6O A;  3BGL A;  4QU6 A;  3I9V 9;  2R7W A;  4P10 A;  3FZB A;  3NG8 A;  4E8U A;  4S0M A;  5GMK a;  1JLQ B;  4O4R A;  2ZD1 A;  2K7J A;  1RBO B;  2CAJ A;  2EFP A;  3S6E A;  4QBU A;  1CS4 B;  1QVG R;  1S0O A;  1RP5 A;  4NLV A;  5B0A A;  5EWG A;  2DT9 A;  3RR8 A;  1WF1 A;  2HAI A;  4WFZ A;  5F8J A;  3ENW A;  2MGZ A;  3QT7 A;  4OYW A;  2XMV A;  3CB4 A;  1HNV B;  2HWT A;  3KLF A;  2XG8 A;  4RW4 A;  5E3Q A;  4LSN B;  1JLF B;  1S1W B;  1VBZ A;  2PFD A;  1IM4 A;  4C8L A;  2WRM A;  3MAH A;  5DZ6 A;  3F44 A;  1UKU A;  3W5X A;  5H9E J;  4N8O A;  1VR6 A;  2HQF A;  3BJY A;  4YY3 J;  1P9Q C;  3EE3 A;  1XER A;  2ZZM A;  2KYX A;  5KFY A;  1NCL A;  3TA2 A;  4OYB A;  4DV5 F;  2R2T A;  4PR6 A;  3MM6 B;  4BHQ A;  3HX9 A;  2CNL B;  1RTH B;  5GAG I;  2AT1 B;  3WHI A;  3KG1 A;  2M8H A;  4DN0 A;  2AJQ A;  3RR7 A;  4J9K A;  2Z0G A;  4ZHR A;  1B0V A;  1NLK L;  1SC3 B;  2WBR A;  1MW7 A;  3MD1 A;  3LP1 B;  3AFG A;  4I68 A;  2GJ2 A;  3HF5 A;  1V9O A;  2CQH A;  2MKC A;  4B9U A;  1M1H A;  1D9D A;  2ZD1 B;  2ABY A;  3AHP A;  3TRG A;  5FLX Y;  4MK8 A;  4O0I A;  1X9S A;  3C2P A;  2EK6 A;  4IFY A;  2W9B A;  3D67 A;  4YDX A;  5C7P A;  1AFJ A;  4DV3 J;  2OHD A;  1VJW A;  1N0V C;  1T03 B;  4HAC A;  1XMO F;  3LTO A;  4GO7 X;  3BEG B;  2DNK A;  1HR0 J;  3HO1 A;  3DLJ A;  2MGZ B;  2WAQ D;  1Q81 T;  1W2I A;  2CJ9 A;  4G1P A;  1D8Z A;  2HLU A;  3OXF A;  3BKF A;  2WW4 A;  3JQM A;  4RW4 B;  3F73 A;  1NK7 A;  2YH1 A;  4AL6 A;  1N5Y A;  4Q0B A;  2BJE A;  4OZJ A;  2DNR A;  3RB0 A;  2I1R A;  1PBU A;  1BE4 A;  3J80 U;  2WW8 A;  3DOK A;  4CNY A;  5IZH A;  1YRX A;  4C2M A;  2LA6 A;  1RAG B;  1N32 J;  5J1N A;  4DQR A;  4PWU A;  1WOP A;  1WOS A;  1S5Z A;  4HR2 A;  4F4Z A;  5J1E A;  3PDN A;  4B3R J;  5CZX A;  4ZVF A;  3UN3 A;  2P8I A;  4DUY J;  1KON A;  2W4D A;  4ELU A;  3OBI A;  5C24 A;  4UOH A;  4C3K A;  1U6F A;  5E33 A;  2AZ3 A;  4TVA B;  3PG9 A;  2CQ3 A;  3LWM A;  4RW7 A;  1IWA A;  4M5D A;  2XGP A;  3NBP A;  2FJX A;  4K8R A;  3LPY A;  2COL A;  4AQY J;  1Q8L A;  1KEK A;  4YQW A;  2AF6 A;  3P5B P;  4QOT A;  1Q78 A;  1CUL A;  4ZHR B;  3D28 A;  2V8H A;  3CJS A;  1Q7Y T;  2HFV A;  4A8X A;  3R7S B;  3CCE S;  1O0P A;  4X4U A;  4J91 A;  3QRP A;  3R97 A;  1NM2 A;  1JLC A;  3V4M A;  1KTQ A;  4I4B A;  1N36 J;  4WII A;  2VA3 A;  3HVW A;  2IAJ A;  2W9B B;  2QT7 A;  2VUG A;  4B9V A;  4K2X A;  1U25 A;  4DX6 A;  3A3O B;  2OJ3 A;  4J9L A;  4KBI A;  3DRS A;  1ARO P;  1U6Z A;  2R7O A;  2BBE A;  2APO A;  4WXO A;  3T1A A;  2PMH A;  1F9H A;  1TUG B;  1FNO A;  5KFJ A;  5FDL A;  4PG5 A;  4JI5 J;  4U7U K;  3HKZ D;  4A8M P;  1VBX A;  3TX8 A;  2UP1 A;  3RYL A;  2OFG X;  2D3U A;  1N5Y B;  2D9P A;  4Q0B B;  4C97 A;  4ED4 A;  2ILY A;  5E3R A;  3CC4 S;  4KKO A;  2EFQ A;  3PYE A;  2P9G A;  2OAU A;  4TY9 A;  2HUR A;  5J1E B;  3F41 A;  3PCO B;  5GAE I;  1S1V A;  1GXL A;  1JLA B;  1FX2 A;  2CZV C;  3PYF A;  4KTQ A;  5C24 B;  3LAK A;  3CE8 A;  1HBO A;  3QJP A;  5ETK A;  4CH1 A;  3TAN A;  1VQO S;  1UA1 A;  4MAK A;  3A13 A;  4ZVE A;  4RW7 B;  1URN A;  1N0U A;  1U09 A;  6FDR A;  4M5D B;  4GKJ F;  3N6N A;  3DXS X;  7AT1 B;  3NBP B;  1NJX A;  2ZH6 A;  3UDV A;  3DGP A;  2Z2L A;  1SJQ A;  3AB4 B;  2JFD A;  3R7N B;  1CUL B;  1IKW A;  2YKO A;  3ZZO A;  5ETT A;  4PEO A;  2DEI A;  4LFA J;  3MCO A;  2CDQ A;  1VK8 A;  4DR1 F;  4EBE A;  1NU4 A;  3R5C A;  1H38 A;  3BBC A;  1XQI A;  2HGL A;  2IAJ B;  4OYP A;  3ILI A;  1OJ4 A;  1PC5 A;  4U6P A;  4NXN J;  2HRU A;  4RKU C;  1XWL A;  5KFC A;  1RT4 B;  2MQQ A;  3J81 j;  3AQP A;  5D4N A;  2RKI A;  3IXQ A;  4DR3 F;  3VAL A;  3DRS B;  2GQC A;  5LXR A;  3ULH A;  4OI0 A;  3ZZU A;  4DPY A;  1RWM B;  3ONQ A;  3MTJ A;  3J7Z 5;  1O51 A;  3FRY A;  1FF2 A;  2J7W A;  4OV1 A;  5FDL B;  4UOF A;  3EYZ A;  3PV8 A;  1SQE A;  3PO5 A;  3W62 A;  2J9C A;  5CA5 A;  4DL7 A;  3T1Y J;  3CCL S;  3IRW P;  2BR0 A;  3W8G A;  1VQ5 S;  2AV5 A;  4KHR A;  3AOD A;  3J7A 1;  2F9D A;  1I51 B;  2C2K B;  3SV3 A;  3IM9 A;  4JV5 F;  3LWL A;  3GTY X;  4AXI A;  1EQ0 A;  3T5J A;  4F7V A;  4NEZ A;  1S1V B;  1VBK A;  3I4P A;  1YJU A;  1NDP A;  4B3O A;  1RTD A;  5KG7 A;  4MT1 A;  1HBO B;  1X5T A;  1ZTT A;  2YQ0 A;  2HMI A;  1EAR A;  3K5O A;  7FD1 A;  4F36 A;  2IVF B;  4X4S A;  1VQ4 S;  4AT1 B;  1LWE A;  3BF4 A;  1EET A;  2GIQ A;  2J6T A;  1REG X;  1SC1 B;  3TUI C;  1IN0 A;  1TVR A;  3ZZT A;  3PYD A;  3J81 U;  3PVX A;  2IJF A;  1K0T A;  4YHH J;  1IKW B;  2JLF A;  1WSR A;  2AEM A;  2AYM A;  3VVT A;  1HLW A;  4GKK J;  4ZP8 A;  4C98 A;  3M8Q B;  4OJH A;  4AL5 A;  4DHV A;  1RYS A;  2VOD A;  5HMW A;  4RJV A;  1MWZ A;  2C2O B;  1PC4 A;  2FYX A;  4Z7C A;  2LVW A;  3BS9 A;  2F8E X;  1Y0H A;  3T5L A;  4GVB A;  1VQS A;  4LF8 F;  4EMD A;  1RWU A;  2B0G A;  4DZD A;  1XNR J;  2H1Y A;  2VBY A;  2CWK A;  4K50 A;  2HGN A;  2E5H A;  2CAD A;  1K0V A;  3UR0 A;  4OZ1 A;  5J2P B;  3LOU A;  1Y10 A;  3NWG A;  3R7B B;  1RAA B;  1DAR A;  1I94 J;  3R1H A;  4DEZ A;  4G1Q A;  4C0O C;  5BYR A;  3KNG A;  3FCH A;  3CCU S;  4OI3 A;  1T05 B;  2OEJ A;  5DS7 A;  1EX8 A;  3D0I E;  2YX1 A;  4K0K F;  1X4B A;  2HHH F;  4AE5 A;  2M70 A;  4U7C A;  3A8J A;  1FRI A;  2PA8 D;  5D4L A;  2FJA B;  2UUC F;  4NA3 A;  3JAM Y;  5HN0 A;  4C9D A;  2HNZ A;  3AD8 C;  2N82 B;  4NI2 A;  5A8K A;  1IWG A;  2HMI B;  2WHO A;  1H2U X;  1NXI A;  4EYH B;  1LWE B;  3TVK A;  1U1N A;  1EET B;  4RBT A;  2AD9 A;  1U0H A;  2UU9 F;  2RJZ A;  3R9L A;  3VAJ A;  1Q7L B;  5EX3 A;  5BR8 F;  1VRT A;  3R5G A;  2OFH X;  2XMW A;  4K4Y A;  4UUW A;  2R8J A;  4KE5 A;  3WC0 A;  2OSR A;  2I2Y A;  2NYH A;  3NGS A;  2FJV A;  2FY1 A;  3C3L A;  2HIQ A;  4X66 F;  4P6Q A;  4I67 A;  2RQ4 A;  1YKW A;  3PW4 A;  2DGO A;  4GVB B;  2FB0 A;  3QSI A;  1SQF A;  4EGL A;  1B7F A;  1PSD A;  1CC8 A;  1R6V A;  5IQQ A;  3CDW A;  1UVN A;  4GRS A;  4MKY A;  5HBM A;  4DR6 J;  3FCV A;  3NEK A;  3D68 A;  4L72 B;  3GYG A;  3QQC D;  2RHS B;  4I2Q A;  2HNY A;  3DRP A;  3TUP A;  1TL3 A;  4ED1 A;  4ZP9 A;  4GC6 A;  3GIR A;  3GE9 A;  1OPZ A;  1RCO B;  2QA2 A;  2ATL A;  3TAQ A;  1WOO A;  1RT7 A;  3DC2 A;  4TU8 A;  1N56 A;  1FA0 A;  4G1Q B;  2G9O A;  4RNN A;  2Q1L A;  2AKW B;  4WFY A;  4IKA A;  1H74 A;  4QW8 A;  1TKD A;  2KHD A;  2NSB A;  4FS2 A;  3BO3 A;  4Y3C A;  3NKY A;  3HLU A;  1J5E F;  4DBQ A;  1FDD A;  1PAU B;  2H3E B;  1XNQ J;  5ADZ A;  2MQ8 A;  3PW2 A;  3H20 A;  4QWA A;  3EGZ A;  1FXD A;  3TYT A;  1DJ0 A;  3GR1 A;  5AJ3 F;  3SSR A;  1HWI A;  2OPS A;  1U24 A;  1R0C B;  1NKB A;  3M6U A;  3MR7 A;  1YX2 A;  4YS2 A;  2HQD A;  1T02 A;  2A1B A;  5T14 A;  1L3V A;  3OFE A;  4YEA A;  4QR0 A;  1Q79 A;  4ZOS A;  1VRT B;  2RIJ A;  2V9W A;  4F3Q A;  2J6U A;  3QSY B;  2KM8 B;  4OI4 A;  3IFE A;  1RHM B;  1S72 S;  1U2C A;  2ADB A;  2I6W A;  4ZCM A;  3OXL A;  4WCE Q;  2KFZ A;  1U8S A;  2HRT A;  5HBM B;  4MH8 A;  3CD0 A;  3EVM A;  4B08 A;  1WHW A;  4HVZ A;  2QL5 B;  1N52 B;  4OX6 A;  4I2Q B;  2HNY B;  2F3J A;  3DRP B;  2RSQ A;  1Q16 B;  1I6J A;  4PQU B;  2L9N A;  1UWB A;  2ZJR Q;  3OR1 A;  2E66 A;  5C42 A;  2O3D A;  1RT7 B;  2K3K A;  1JIH A;  1RLC L;  3CWJ A;  1MML A;  2DPI A;  2NR0 A;  2FLL A;  4YB1 P;  1LFW A;  1OYE A;  1HBM A;  3QFH A;  1BGX T;  2CPH A;  1SJR A;  4AUK A;  4N47 A;  4JYA J;  2V8P A;  1JXE A;  2RF2 A;  4M5N A;  4TYA A;  1TKX B;  3DLK A;  1S1X A;  1MMN A;  4HT5 A;  1PKU A;  1P9Y A;  4DF8 A;  1TU0 B;  4GMK A;  1RTZ A;  4Q2M A;  2E44 A;  2I0X A;  6FD1 A;  3V6D A;  4OZ2 A;  2OPS B;  3J7Y I;  4WP3 A;  5GAH I;  2DNO A;  3AA9 A;  3AJ1 A;  5KFG A;  2HHW A;  1AA1 B;  1HWL A;  1WEY A;  4CLY A;  1KSP A;  1HHS A;  2EG1 A;  3VGU A;  1M90 T;  4X65 J;  1QVF R;  3H40 A;  2H5I B;  1LQ9 A;  4ECR A;  2OPP A;  4OYX A;  4MKB A;  2UV8 A;  4PPD A;  4CZC A;  2M52 A;  4A4J A;  3D4J A;  3SCL E;  3DN9 A;  4ITS A;  4EBC A;  1R0B G;  5AXL A;  1F2H A;  3OW2 R;  4ZCK A;  1E6V B;  1GTE A;  1KQG B;  4ED6 A;  2X3G A;  1HNX J;  1FJG F;  3IG1 B;  2CRL A;  3WC2 A;  1UET A;  3MAQ A;  2Z4P A;  2WOM A;  3CJQ A;  2ZH8 A;  2AQ4 A;  1WC4 A;  4QIW D;  1SCJ B;  1UPP A;  3ENA A;  2XLJ A;  3DRR A;  2XBP A;  3MI7 X;  3W3S A;  5IT0 A;  5DQI A;  1PYO B;  1UWB B;  2E5G A;  3OR1 B;  1KC8 T;  2HG4 A;  4ZPB A;  5C42 B;  3CNQ P;  3CCR S;  1C2P A;  3WBZ A;  4DV4 J;  4DOZ A;  4LFB F;  4OZ3 A;  2C22 A;  1NJZ A;  2C3O A;  3CJ0 A;  3W9I A;  3TOQ A;  1AT1 B;  1H0H B;  5JMN A;  2CPZ A;  3H4B A;  1HBM B;  2OGU A;  3MHY A;  5L46 A;  2XHC A;  1RAH B;  2QA4 G;  1NDL A;  1TZ0 A;  3DRX A;  5HAT A;  1FJC A;  2VOP A;  1V3S A;  5CYM A;  3BQ1 A;  3QGI A;  3IWN C;  3V81 A;  2GHV C;  3DLK B;  1S1X B;  4KH1 B;  4EEY A;  5KFV A;  4DSK A;  3I5B A;  3AOB A;  1HHQ A;  3PW7 A;  2E1C A;  3MEG A;  4XAK A;  4R5P B;  4WYW A;  1NPR A;  4JI1 F;  2E1A A;  1WEZ A;  4QR1 A;  1HKA A;  2RUG A;  3UCZ P;  3CJK B;  3DI6 B;  4OX8 A;  4WZM A;  2VJU A;  3C14 A;  2CPD A;  2OPP B;  1X5P A;  1APS A;  2RRA A;  2D7S A;  3MMB B;  3L7U A;  2IY5 B;  1IKV A;  5AE2 A;  4RUA A;  3MCM A;  1LW2 B;  2LEP A;  2WVD A;  3FRZ A;  2BJ8 A;  3DFE A;  4X4T A;  4OX9 F;  2LQJ A;  5CYQ A;  5LSR A;  3TAP A;  4JI8 F;  5H1S V;  2MLX A;  1S77 D;  2HK3 A;  5HP1 A;  1C0U A;  1VC5 A;  3ZTR A;  2WOM B;  2KHC A;  4PXC A;  4LF4 J;  2JSX A;  1Y00 A;  2WSF C;  3Q8P B;  3DRR B;  4ED2 A;  1WC1 A;  2BEF A;  5KOW A;  1JXL A;  4OYI A;  2AGQ A;  2EFN A;  1W25 A;  3O5T B;  3MGJ A;  4UF4 A;  4PRF A;  2HVE A;  5IWA F;  3QLH A;  5A2Q U;  2DXE A;  3HFK A;  1F5C A;  1HQE A;  4DMZ A;  4ECS A;  1HNW F;  3N0V A;  4NRT A;  4QIE A;  5LXY A;  3GG1 A;  2BJ3 A;  2JEJ A;  2RIL A;  1T3O A;  3L7O A;  3H4D A;  2NUH A;  4I7F A;  3DOM B;  3D1H A;  4LF7 F;  1M0S A;  3GFY A;  5CYM B;  1B0P A;  5FD1 A;  1NSK L;  4DUT A;  1FFG B;  2BW2 A;  1FTC A;  3EPG A;  4E2F B;  4LVN P;  4B3M J;  3TA0 A;  2MZQ A;  4OL8 A;  2AWZ A;  3MEG B;  4TQR A;  1JLE A;  3V2U C;  2VG7 B;  2C3P A;  4PUO B;  1NK6 A;  3E3X A;  4CYU A;  3EDR B;  4ED7 A;  1R89 A;  1YJR A;  3KHL A;  4Q44 A;  2ZH9 A;  1T9W A;  3CIZ A;  5F8N A;  3C14 B;  3C15 B;  1EZZ B;  3N01 A;  1S9F A;  1GMW D;  3RBD A;  2B5J A;  4NZ7 A;  1IKV B;  2WZ1 A;  5C25 A;  5H9E K;  3UQS A;  1BQM B;  2HS3 A;  2DCU B;  1A9N B;  3HFV A;  1UAW A;  2MDA A;  4CP5 A;  1BHN A;  2YPY A;  3EVW A;  5CYQ B;  3MFH A;  1R3N A;  1YZ7 A;  3HHN B;  4QZV B;  2MKK A;  1Y5N B;  3BGR A;  5F9L A;  3CCQ S;  2KT2 A;  5HP1 B;  1C0U B;  3VWS A;  2X7I A;  4JV2 A;  2V63 A;  2W01 A;  5B0F A;  4CH0 S;  3L95 X;  3K0J A;  2DIU A;  5B08 A;  2KZZ A;  3FQL A;  3CMQ A;  2VH7 A;  4IUF A;  2D74 B;  4ZCI A;  3Q23 A;  4DPW A;  1JLG B;  3O1L A;  3GON A;  1C0T A;  2B6A A;  3LGN A;  4DI6 A;  3CCV S;  1R6Y A;  1QJH A;  4QWB A;  4J90 A;  3QLH B;  1NHU A;  2W2O P;  3GFX A;  2J0S D;  5D78 A;  5A76 A;  2CNK B;  4OYO A;  2K2P A;  3M6W A;  3HHL A;  5I42 B;  2UUT A;  3QGG A;  2E5I A;  1GT8 A;  4I7F B;  2ZOG A;  3PIO Q;  1TK8 A;  2O1P A;  1R31 A;  1EKS A;  4DSE A;  3M8P A;  2ADC A;  4ZP7 A;  2JLG A;  3MF5 A;  3TJA A;  4TY8 B;  3UFC X;  1SJ4 P;  1F2G A;  3UWT A;  3OSP A;  2F8H A;  2ZM6 F;  1JLE B;  4LF2 A;  3OTD A;  5KFF A;  3W63 A;  3GQC A;  5E3C A;  4CYU B;  3SDE B;  1UP1 A;  3FBB A;  1IR2 A;  2D3O 1;  5K20 B;  2LXI A;  2W1B A;  2L9D A;  1YTY A;  2F4F A;  2A10 A;  1QLN A;  4OJ1 A;  3HM9 A;  1KFD A;  5CXT A;  1R8P A;  5C25 B;  4I6A A;  5ETN A;  2IMO A;  1QD1 A;  3NMA A;  1SL0 A;  3CCS S;  2W4C A;  3SIP B;  1QTN B;  3DU5 A;  4LBI A;  4YR0 A;  2OIH A;  4LSL A;  3BGR B;  2XI3 A;  1VS3 A;  3MR6 A;  4X64 F;  2OPR A;  2FC9 A;  2DCL A;  2BV3 A;  3GCX P;  4TU9 A;  4MIA A;  3VV2 B;  4OZN A;  1VCT A;  4DWI A;  3FVY A;  2J76 E;  1F3V A;  2KVI A;  4CO1 A;  4P9S A;  2YWF A;  4DDF A;  3BSC A;  5KG3 A;  1C0T B;  2M8D B;  2Y9H A;  1B64 A;  4F04 B;  4C8M A;  3IWL A;  5KFH A;  4WU3 A;  5EWE A;  1A7G E;  2QX0 A;  1TEL A;  2K1R A;  3PEH A;  1EJ7 L;  2KU7 A;  2U1A A;  2DIS A;  1T9Y A;  4JI4 J;  3HHL B;  3AH6 A;  2BA9 A;  3T41 A;  1DTQ B;  1T9X A;  1AXQ A;  1J5O A;  3LGH A;  3P96 A;  4L74 A;  5BXI A;  2B56 A;  3PNI A;  3MZI A;  4PAB A;  2XMK A;  3DMJ A;  4YR2 A;  1RJJ A;  3M8P B;  2DHS A;  3FNN A;  1FRX A;  3RBE A;  1VQ8 S;  4CQ1 A;  4C48 A;  4HTJ A;  1SKR A;  1G7C B;  2AZ1 A;  4K4T A;  1JX4 A;  4JI6 J;  1X9W A;  1T9U A;  5F0U A;  5L9N A;  3BYP A;  2MKI A;  4Q7A A;  3NCQ A;  5DDR C;  1Q5Y A;  5DDP C;  3A12 A;  3H98 A;  1PYS B;  3THP A;  4C8K A;  1SL1 A;  4O44 A;  5LJ5 Y;  2FVQ A;  3HT3 A;  1YBA A;  4KT0 C;  2V68 A;  2BE2 A;  5KTQ A;  4RW6 B;  4LSL B;  1ZM9 A;  2W8K A;  4K4X A;  2V67 A;  4IO1 A;  2OPR B;  2Z58 B;  2GJF A;  5D8H B;  2MZJ A;  4J5O A;  1P1T A;  1O6X A;  1IBM J;  2FJW A;  1CEZ A;  3H2U B;  3GMG A;  1RIS A;  4N56 A;  3OQ2 A;  2BAN A;  3M32 A;  4LBH A;  3UW1 A;  2DJW A;  3G8Q A;  1FJ7 A;  3X3U A;  3MR2 A;  3ITH B;  3TX0 A;  2UXC F;  3GR0 A;  1FNM A;  3P45 B;  1LEO A;  3GP9 A;  3JSY A;  1S1U B;  2VAS A;  1Q4R A;  2P2C B;  4EZ9 A;  1J5O B;  5J1P A;  1LV5 A;  1HBN A;  1KVI A;  5ETR A;  4DV7 J;  1QAJ A;  3EPI A;  1FXL A;  2UXB F;  4P52 A;  4DUZ J;  1ZOT A;  4LT6 A;  1VMB A;  5J2Q A;  4W4M A;  1D3W A;  4WK3 A;  4KH0 B;  4Q2L A;  2DRB A;  4OI1 A;  2J9E A;  2VKZ G;  3ZZZ A;  4U8Y A;  5LL6 d;  4L6V 3;  2CPE A;  4NLX A;  3DLB A;  2FZG B;  3I55 S;  2BX6 A;  2E5L F;  1K44 A;  3M2U A;  4CLK A;  3KG4 A;  1FHT A;  2DR8 A;  3QYY A;  3N79 A;  4QIG A;  4B9N A;  3T5K A;  2EKN A;  2LU2 A;  5GAD U;  3RG6 A;  4CO2 A;  4IDK A;  1FCA A;  5CD4 A;  1PJ6 A;  4ILR A;  4O44 B;  3QIP A;  5A6P A;  2BE2 B;  4FP9 A;  4DV2 F;  4CTA A;  1OIA A;  1NDK A;  5LT5 A;  3CCZ A;  2AW0 A;  4ATN A;  4DFP A;  2J7K A;  2IYG A;  2JNJ A;  1X4D A;  1F9E B;  2J8A A;  3LF0 A;  1GTH A;  1DQA A;  2JEG A;  3PY8 A;  4DSF A;  2BAN B;  3K17 A;  2QFI A;  4TU7 A;  2DIT A;  2O5D A;  2VQE J;  4BWJ A;  4WF9 Q;  2FDN A;  1T7P A;  2CQ1 A;  5D77 A;  1NB7 A;  3SCI E;  2B9X A;  1S76 D;  2PEB A;  3U1M A;  1IQT A;  1N34 J;  1U1Q A;  4MYU A;  3OJS A;  3KWM A;  1H2T Z;  1FEH A;  2YQ1 A;  4ELT A;  1VJQ A;  4YUD A;  3OLB A;  4NLO A;  3EXY A;  4U8V A;  1HBN B;  3W9H A;  4YP3 A;  1U2R A;  2UVW A;  2N3O A;  3T1H J;  1M5K C;  4FNI A;  4P71 A;  2ZWP A;  3Q8V A;  3CD5 A;  2JVR A;  2WVB A;  2QTW A;  3CCW A;  3MUM P;  4D3G A;  2ZE2 A;  3M2U B;  3F0N A;  4C7Q A;  1RU2 A;  3V6K A;  4DR2 F;  2M5Y A;  3UD3 P;  3J81 Y;  1ZYQ A;  2RUS A;  1UA0 A;  5DM6 Q;  4X4N A;  1X7V A;  2XY5 A;  1S12 A;  2H4Y B;  4IDK B;  3MAA A;  1EP4 B;  4QPX A;  1LWX A;  3AJD A;  4FPR A;  3OV7 A;  2H54 B;  2G1H A;  3QIP B;  3GJQ B;  4KHP J;  2QLX A;  1F9F A;  4KJI A;  2IBO A;  2SXL A;  2V0N A;  3J7A N;  4NXM J;  1YHQ S;  1CQM A;  1T3N A;  3R5D A;  1D0E A;  4MJK A;  2WTF A;  4WIQ A;  5AT1 B;  1UVL A;  4NZ6 A;  4ZLN A;  3MM7 A;  5B7W A;  4ZJO A;  2C42 A;  3DXB A;  1ZZN A;  2FD2 A;  2FLO A;  4P72 A;  3DDN A;  4K59 A;  2YTC A;  1YIJ S;  2KO1 A;  2XLK A;  1RGV A;  3IR5 B;  3Q24 A;  4ZKA A;  2B4V A;  2FQQ B;  2BJ9 A;  3IRX A;  3GSI A;  2DKO B;  2ROP A;  3H90 A;  3BKT A;  4PPZ A;  4Q8F A;  2FIU A;  5FJ4 A;  2KXF A;  2LKZ A;  1VC6 A;  4V19 J;  1X4A A;  4DPO A;  4AD6 A;  4IYQ A;  1L3T A;  2QMU B;  2ZDP A;  1REV A;  5D6G A;  1IVZ A;  5B0D A;  3IN5 A;  5HVH A;  3A8I A;  3DGV A;  4RNH A;  2MLZ A;  2ZC3 A;  1M5P C;  3DHW C;  3Q89 A;  1SUQ A;  4H4K A;  5C2G A;  2V2Z A;  4ICL A;  2E29 A;  5CHC B;  2ZE2 B;  3ICL A;  3K8W A;  4C3M A;  5L1J A;  4USK A;  5DM7 Q;  1NEE A;  2VKR A;  4KC5 A;  3KUE A;  1OY6 A;  4WP9 A;  4ED0 A;  2HND A;  2IMW P;  2WSC C;  2Q43 A;  1TKZ A;  2VD3 A;  3IMQ J;  5D15 A;  1TAU A;  1S4F A;  2C1E B;  2A6M A;  3OSN A;  4FXD A;  4CO3 A;  4DSL A;  4F3M A;  1FE0 A;  1N5V A;  2JOQ A;  1FDB A;  2XO6 A;  1DAX A;  4X4V A;  3FBE A;  1EIY B;  1Y5I B;  1HL6 A;  2CZ4 A;  1Y3K A;  1U1O A;  3E01 A;  3LAL A;  4IH7 A;  3MM7 B;  2FHJ D;  4FYX B;  4DF4 A;  4CLL A;  3MEE A;  1NH7 A;  1DLO B;  2F9J A;  5IXU A;  1RT2 A;  1U47 A;  3ZC4 A;  4OHW A;  4HLB A;  3EWG A;  3G82 A;  3BR8 A;  4DCP B;  5B0B A;  2YXL A;  4BCA A;  1Y5L B;  1LXJ A;  1GX5 A;  3QBC A;  4P75 A;  2XS2 A;  4IH6 A;  2MJU A;  1ITP A;  2XNQ A;  2YNG A;  3D6T B;  2QG9 B;  3JYT A;  2DH9 A;  5F0W A;  3GJR B;  3POT A;  3A3N B;  1NAQ A;  4ZPT R;  1IKX A;  5D3G B;  1K1Q A;  2XMM A;  1BWV A;  1V5I B;  4JI2 F;  3DLL Q;  1SUQ B;  2HQG A;  2L41 A;  4ICL B;  3W8P A;  4ETX A;  3BSO A;  1X0F A;  3ELH A;  1FES A;  2VG6 A;  3BBF A;  2UUA F;  1KKH A;  3UNY A;  3R6G B;  5HQM A;  4NA2 A;  4F4Y A;  1AW0 A;  4M8L A;  1VRQ C;  2BQU A;  3OLA A;  2RH3 A;  3UI3 A;  3VVU A;  2C2D A;  2XB2 D;  4N77 A;  3BV8 A;  2HND B;  2FZC B;  3IC1 A;  3HHK A;  3JQK A;  4FBT A;  3W9J A;  1NSQ A;  1TKZ B;  3M2V B;  2VIC A;  4UUX A;  1VLO A;  3ISZ A;  4O3S A;  1RCX B;  2MQL A;  3H59 A;  5FII A;  4DPU A;  2QV6 A;  4PAA A;  5CH7 B;  2MPU A;  1RT5 A;  2V9K A;  3LW5 C;  2VU5 A;  5LSL A;  3US5 A;  4DV0 J;  2FJB B;  1FK9 A;  4BBY A;  4FYV B;  2ZH7 A;  3MM5 A;  4FXV A;  4O3N A;  3MPD A;  3HD2 A;  2NXJ A;  1I3O B;  3E01 B;  1BC6 A;  2VPZ B;  2GMJ A;  1UFK A;  3KK3 A;  4DL4 A;  5L1K A;  3G4S S;  5KOX A;  1HQU A;  3OTB A;  4AND A;  1RT2 B;  2ZC4 A;  4F4K A;  1S79 A;  1U45 A;  2UVV A;  3JB9 k;  2ASY A;  3G82 B;  3VQS A;  2LDI A;  2IYI A;  1HPZ A;  4ZVO B;  2V4R A;  3IWX A;  2RU9 A;  3FKB A;  1TTH B;  4PXE A;  2O67 A;  2GGP A;  1VLY A;  3DCA A;  3HSZ A;  5KG2 A;  1J2V A;  1GXU A;  2QMX A;  2YNG B;  4ER8 A;  2UXD J;  1ROF A;  2E5J A;  3TVZ A;  2BMB A;  4KPC A;  3FSY A;  2Q6C A;  5E3A A;  3JYT B;  3PW5 A;  3POT B;  1R43 A;  3ILL A;  3U27 A;  4WJB A;  2ILZ A;  1WF0 A;  1IKX B;  4J9S A;  1TQL A;  3MR3 A;  3W1Y C;  4WTO B;  4X4P A;  5K8M A;  2QA1 A;  2LEB A;  3OVB A;  2IPO B;  3K5M A;  4XDC A;  4ZVG A;  5KFB A;  4IRD A;  2HHT A;  5B0C A;  2HLT A;  4KGV B;  1URR A;  5U47 A;  1DFD A;  1XMB A;  2BJ7 A;  1V5V A;  3PTW A;  5KFD A;  2UVR A;  3TO8 A;  1DRZ A;  1LK7 A;  4DJB A;  4QWD A;  3OTC A;  3GIJ A;  4NL5 A;  2F65 A;  1F6T A;  4Y65 A;  2RRB A;  1NDC A;  1IBK F;  1CJV B;  4C3L A;  2HYI B;  1IQZ A;  1BLU A;  1C1C A;  3BR9 A;  1RKI A;  1RT5 B;  2XZD B;  1X4H A;  1WNE A;  1NSA A;  5D0G A;  1GX6 A;  3MOZ A;  5HJY A;  3OD2 A;  1FDN A;  1RTI A;  1FK9 B;  1MSW D;  3CCM S;  1X8D A;  3GJS B;  5DLF A;  3PIP Q;  2OI2 A;  2U2F A;  1JLB A;  2CKW A;  4LFC F;  3KK3 B;  4DL0 C;  1HQU B;  4JV1 A;  1UJ6 A;  4J9P A;  5F3T A;  5HMZ A;  2K06 A;  3G9C A;  2FHM A;  1HPZ B;  2Y3Y A;  2N4D A;  1NJI T;  3M8Y A;  3I0S A;  2BJ1 A;  3BSA A;  3MCS A;  2BVZ A;  2GGP B;  2V50 A;  1OO0 B;  2HHQ A;  3BGU A;  3I87 A;  1HNZ J;  4FPI A;  3TZY A;  1NH8 A;  3HHL C;  1N88 A;  1RWV B;  2VC1 A;  1WG1 A;  1KOH A;  2CVE A;  1S49 A;  4FDF A;  4YOE A;  1PIL A;  4OI2 A;  1RBA A;  1PGZ A;  5FLX U;  2DR6 A;  2GIF A;  3QGP A;  3H5S A;  2BAC A;  1KWM A;  2GX8 A;  4Y28 C;  2G0J A;  3D5M A;  1KLN A;  4PG8 A;  2IBK A;  3I5C A;  5D4P A;  3FFI A;  3TNV A;  1DZ5 A;  1UVM A;  4M5J A;  3UCG A;  2E7X A;  3E2E A;  2ZEJ A;  2M88 A;  4K4Z A;  5DZ7 A;  4RZR A;  1M1G A;  4A8O A;  3OUY A;  3G86 A;  1FEE A;  3SFG A;  3D9B A;  1IUJ A;  1SH2 A;  3KLI A;  2JRS A;  1RTI B;  1AFI A;  1TV6 A;  2YH0 A;  1HYS A;  2IHR 1;  2G0I A;  4EI2 A;  4F02 A;  3GJT B;  4J9U E;  2DGX A;  1JLB B;  2VBX A;  4YME A;  2GHW A;  1X4E A;  2B43 A;  3WX8 A;  4JI0 J;  3EDQ B;  2WVF A;  3LA0 A;  1S6P A;  2MHN A;  5A2Q Y;  5LMU F;  4NRU A;  4OQJ A;  4ZVH A;  5K8O A;  3CJR A;  5KT7 A;  3I0S B;  4NLT A;  2PSZ A;  2BQR A;  3CF5 Q;  4IFV A;  4WXW A;  2BAB A;  2D69 A;  7FDR A;  1NSP A;  1OS5 A;  3TEH B;  1H6K X;  2DD8 S;  3AXM A;  4G65 A;  1Q1K A;  5JVG Q;  2V69 A;  2ZZT A;  4Y0F A;  3HK2 A;  3BGO P;  4A8Y A;  4TN2 A;  5KG5 A;  2VQF F;  4RUB A;  1RAF B;  1YBT A;  4NOH A;  4Q8E A;  2J8S A;  4H4O A;  4WBF A;  2R8K A;  3QO9 B;  4YFU A;  3DLG A;  4NLS A;  3OL6 A;  2R8I A;  2B4U A;  2DHX A;  3NGU A;  1P8G A;  4KHM A;  3G6X A;  1M5S A;  2CUY A;  2XGQ A;  4ZPC A;  2GW8 A;  3L09 A;  1TL1 B;  5A8W A;  2RDJ A;  2N7C A;  1DHM A;  4B3S F;  2HWH A;  4OHY A;  3RAM A;  3R2D J;  3D2W A;  2YNI A;  1GNK A;  2MKS A;  3QFW A;  1TL5 A;  5IT9 U;  2IVY A;  3NGT A;  3Q0A A;  3TWZ A;  4CIO A;  5KFA A;  2B9E A;  1ZAX A;  1YJN S;  1WOR A;  1TK0 A;  1TMJ A;  3CD6 S;  4C8O A;  4OX7 A;  4UST A;  3KJV A;  1Y9O A;  2FVC A;  3CED A;  1JJ4 A;  2YNF A;  3LAM A;  4FVC A;  2I38 A;  4K7Q A;  4QWE A;  3KLI B;  4FXW A;  2R2R A;  4LF5 J;  2A0F B;  1TV6 B;  4YB7 A;  4DQP A;  3EGN A;  2MB0 B;  1HYS B;  4ANC A;  4F4W A;  4I6Y A;  3CJT A;  3IM8 A;  3OFG A;  5KFR A;  1MLA A;  2KKH A;  3CO0 P;  1KQS R;  1SIW B;  2B7B B;  5DG9 A;  4USH A;  1S6P B;  3I32 A;  2J0Q D;  5KFO A;  3UN5 A;  4FKX A;  1ZAV A;  5F8H A;  2C3Y A;  1VRU A;  3BM7 A;  4QYZ J;  5H9F K;  4IFV B;  5L9X A;  1N33 J;  5G4D A;  2YNH B;  3NCP A;  4NMX A;  4WKY A;  2F4V F;  3A8K A;  3EJM A;  4JI7 J;  2NXU A;  1Q95 G;  1KDN A;  4FBU A;  4C4W A;  1FKA F;  4X84 A;  2CWX A;  4UOG A;  3V6J A;  4LF6 J;  4NAS A;  3DLG B;  2QJ3 A;  4Y00 A;  1A0O B;  2QEX S;  3GV7 B;  2V2K A;  1FRM A;  2IM0 A;  2DGU A;  1PG5 B;  3LPE A;  4X62 J;  3QRQ A;  3KLG A;  4ANE A;  1SKS A;  4P7V A;  1IR0 A;  1R7I A;  2IC3 A;  3EZO A;  2A3J A;  2YNI B;  3CTR A;  4DR5 F;  1KTV A;  2YKA A;  2UUB F;  3CJ5 A;  1T11 A;  2IM2 A;  4G1I A;  2HBQ B;  1Y3J A;  4EBD A;  3RRH A;  4JI3 F;  2HGM A;  4UZB A;  4LJM A;  2BRL A;  5HJX A;  3DM2 A;  2XTJ P;  1OQ3 A;  1GQE A;  3CCJ S;  3H25 A;  3KJV B;  4DSI A;  3KLF B;  1RHK B;  1U49 A;  1MN7 A;  2FTR A;  1I5O B;  4M5M A;  1TFY A;  1WTF A;  5KFN A;  4C8Z A;  2GML A;  2G2Y A;  1QE1 A;  4ETZ A;  3HSD A;  2WON A;  1YBU A;  2DH7 A;  2VFV A;  3FBF A;  3Q8Q B;  4UY8 5;  4WFX A;  4USW A;  2GVD A;  2F5G A;  5GVQ A;  3ZTS A;  1GXT A;  4RBV A;  4CCH A;  4P2S A;  4IRK A;  3DDK A;  5MLC V;  3T6B A;  1N5S A;  1IM6 A;  4O0N A;  4KFB A;  2MXY A;  3RAQ A;  1VRU B;  1YG0 A;  1Y4Z B;  1HD0 A;  1R0A A;  2PEH A;  4KGX B;  4Y2C A;  1S10 A;  3FEY B;  3NGR A;  3KOA A;  3U02 A;  3CDB A;  4DV5 J;  3HSG A;  2XMA A;  3RW6 A;  1SKU B;  1QAY A;  1XMQ F;  3B82 A;  3UPF A;  1KQK A;  1GMV A;  3BZQ A;  4X2B A;  3TZZ A;  1KS2 A;  2XMJ A;  1RAD B;  3T9N A;  1TL7 A;  4WKR A;  1KHV A;  3UVJ A;  4IFY B;  2B7C B;  5C2C A;  1H3D A;  2BYC A;  4LQ3 A;  3OTO F;  3M8R A;  3NS7 B;  3MED A;  2IC3 B;  2M2B A;  4HAC B;  2AEJ A;  4PYA A;  1TK5 A;  1CBK A;  5EUH A;  3QGH A;  2NPI A;  4MTP A;  2QA4 S;  3DM2 B;  4BLG A;  2EK1 A;  1YDL A;  5HQ8 A;  2N7Y A;  3GIM A;  2FVP A;  4D3H A;  3MOJ B;  3OFH A;  4LR7 A;  4ECU A;  1G6B A;  3VR1 A;  1YRU A;  1TMM A;  2MY7 A;  3DOK B;  1XMO J;  1QE1 B;  5F8L A;  4QIV A;  3DLE A;  1H98 A;  2WON B;  4ZVR B;  2QE5 A;  4PG6 A;  1S7I A;  3MMJ A;  4ZVP B;  3M4X A;  2D1C A;  3CT9 A;  3H42 A;  2GVD B;  3PR4 A;  4F26 A;  2VPX B;  5KFS A;  2UUW A;  3HVR A;  2CA9 A;  3TQ1 A;  3SCK E;  1PO6 A;  3TZX A;  3Q8U A;  4KFB B;  3GV8 B;  3M8Z A;  4QR2 A;  2PI4 A;  4EWT A;  4J37 A;  2JEF A;  2EC2 A;  3IBF B;  1R0A B;  2V5H G;  4CO5 A;  1ZA2 B;  4C8Y A;  5HAN A;  3QT8 A;  3PXG a;  4ECQ A;  4MK9 A;  3MWB A;  3VZH A;  5LMN F;  3S7R A;  2G2Z A;  1JLC B;  2MLY A;  1HI1 A;  2ATC B;  3RAX A;  2CJX B;  3HI9 A;  3BYR A;  4WPA A;  2DB1 A;  2RRN A;  4X4Q A;  4LRE A;  3GWC A;  1TL7 B;  1QAI A;  2Z2Z A;  3UVJ B;  3QZ8 A;  4A8S A;  3C6U A;  3VAG A;  4H4K C;  1VGY A;  4WYL A;  1NKC A;  2EFG A;  3MED B;  3W60 A;  3TAR A;  1HNI A;  3M8W A;  2KN4 A;  1Q53 A;  1GMW A;  4O4G A;  2QC3 A;  2FJD B;  1E6Y A;  4I2P A;  5I3U A;  3SQG A;  3KG0 A;  3S01 A;  5DQG A;  3B4M A;  3IP0 A;  3NNH A;  4HL9 A;  3ADA C;  3GII A;  1BY9 A;  2DGQ A;  2KFY A;  3C46 A;  4URG A;  4IH5 A;  4ZN1 A;  1MRO A;  4K4S A;  2RT3 A;  5DGB A;  3H7H B;  4ECX A;  2DGT A;  1FI4 A;  1U1R A;  2PI5 A;  3QWU A;  4CT9 A;  3RW7 A;  2GJI A;  2K3I A;  2W2N P;  4KKO B;  4J7C A;  2K8G A;  2DR9 A;  4DV6 F;  2ZH2 A;  3UNG C;  1WEL A;  3RRG A;  1MG7 A;  4XK8 C;  4F25 A;  4M94 A;  4ED5 A;  2EW9 A;  1FER A;  4ZVS B;  4Y6I A;  1UWA A;  3AD7 C;  4UZC A;  2B3T B;  3KK1 A;  5LSO A;  3OPK A;  1DQ8 A;  3DGP B;  1HIY A;  1AUD A;  2AJ2 A;  4JV0 A;  2ZKT A;  3J7Z T;  4M5I A;  1TUV A;  3W64 A;  1S59 A;  1RT6 A;  1KR4 A;  4FZV A;  1TAQ A;  1QY7 A;  4XIU A;  1NB2 A;  1PYT A;  2WSE C;  1DQ9 A;  4IO9 Q;  2JC1 A;  1SB6 A;  3NL0 A;  3M05 A;  1D09 B;  4GKJ J;  1SC6 A;  3N28 A;  2MYF A;  4DU7 A;  3MR5 A;  2JZ5 A;  2ALZ A;  1B7Y B;  2IVM A;  4NLW A;  1FFW B;  5BYQ A;  2PII A;  4Y2M A;  3H2L A;  1U26 A;  2CQB A;  2RKI B;  5G0R A;  2OO4 A;  1HNI B;  4OIX A;  2XLI A;  1ZM2 A;  5KG1 A;  3MM9 A;  1EHW A;  5LOQ A;  4O4G B;  3HHE A;  1E6Y B;  5I3U B;  4DR1 J;  3V4I A;  4FYD A;  3SQG B;  4DR4 F;  1L3U A;  1YWX A;  2ZUG A;  3HFZ B;  3UDC A;  3BH7 B;  1D8Y A;  4DX8 H;  5HMY A;  1FXR A;  1RZM A;  3B78 A;  4P2F A;  4DR7 F;  2ASJ A;  3L4B C;  1MRO B;  3WQP A;  4DR3 J;  1R8A A;  3K2Y A;  4U96 A;  4LRB A;  3HUL A;  3GIL A;  5E5N A;  5IQ6 A;  2ZH1 A;  1S6U A;  1FRL A;  2ALY B;  1LXN A;  1K73 T;  4B3O B;  1RTD B;  2A18 A;  2I5J A;  2XYG B;  3LUY A;  2JL9 A;  3G8S A;  2HHX A;  4FNH A;  2CJK A;  2KB2 A;  4E0D A;  3SZ2 A;  3KK1 B;  1O8B A;  2V8V A;  1C4A A;  1HHT P;  2CIM A;  4JV5 J;  2NXE A;  5J2N A;  3F56 A;  2BE7 D;  2DY1 A;  1TVR B;  1TKT A;  3WZ0 A;  2KFN A;  2GMH A;  4HI2 A;  2KG1 A;  2J5A A;  1RAC B;  4IR1 A;  2HPU A;  1P6T A;  4Q5V A;  2PMZ D;  3B4D A;  4B3T F;  4TQS A;  1RHR B;  2RB7 A;  2KTQ A;  3TEG A;  2L08 A;  2HHP A;  4DV1 F;  2PDA A;  3D1Q A;  3K5L A;  1VQ6 S;  3N4W A;  2ZHB A;  1WKL A;  2LCW A;  2HQ3 A;  4ZVQ B;  2OTJ S;  4K2J A;  3TJ8 A;  1YRT A;  2Z8Q A;  3MEC A;  1NHK L;  3FDS A;  5G0R B;  4LF9 F;  2HVD A;  2QO3 A;  2G4B A;  3O8W A;  3MM9 B;  2XM3 A;  4DG1 A;  2FGC A;  2QZ8 A;  3JTP A;  3BGF A;  2NS1 B;  2IRU A;  2RML A;  4LF8 J;  1TFW A;  1ZM3 A;  1NUE A;  3M9M B;  2P9E A;  3ETM A;  2EI5 A;  1Y7P A;  2B4P A;  4KB7 A;  2Y0B B;  4A8Q A;  2AHO B;  3OHB A;  3ISN D;  3JS9 A;  3KYL A;  4I64 A;  3TP2 A;  4F50 A;  4TXS A;  4USM A;  2JJ4 D;  2CJB A;  3DOL A;  1L5U A;  4P74 A;  1AYE A;  4CLP A;  5DET A;  1WC5 A;  2HFO A;  1HWJ A;  3BPD A;  4NYZ A;  1IBL F;  5M2P A;  4NZ0 A;  1RAB B;  1UJ4 A;  2I5J B;  4CH7 A;  1UL3 A;  5HRO A;  1AB8 A;  2WK4 A;  2HNZ B;  2H5E A;  2HQI A;  1RXO B;  2B4O A;  2X1B A;  4NI2 B;  2BKP A;  5A8K B;  1S48 A;  1RHU B;  4NLD A;  3ZNJ 1;  4K0K J;  2HHH J;  1U0H B;  1Q5V A;  2CXE A;  4R0E A;  3I4H X;  3OR2 A;  2UUC J;  4FF4 A;  2B8P A;  2M9K A;  4EFA C;  3Q8R B;  4DL5 A;  1X9M A;  5E2Q A;  4G3I A;  2XEX A;  2IJN A;  2W2Q P;  2QRR A;  1HW9 A;  4DFJ A;  1LWC A;  1ZPW X;  1F5A A;  3P49 B;  3HPO A;  1JLQ A;  3BN7 A;  4DLG A;  2HRY A;  3CVK A;  4Z2X A;  3KKF A;  2R7S A;  2UU9 J;  2MY8 A;  5EX0 A;  4WTY A;  4HTI A;  2W4P A;  5K8N A;  4JUZ A;  2DPJ A;  4ID5 A;  3MUT P;  4KPY A;  5BR8 J;  3NXZ A;  4JOU A;  5ETQ A;  3PRB A;  2FLP A;  3RBZ A;  3KK2 A;  1WAC A;  4EO6 A;  3H2V E;  1GK8 A;  4O3O A;  1JWW A;  2AX1 A;  2W8L A;  1H7X A;  2K7K A;  3MEC B;  5I3Q A;  1J27 A;  3RB6 A;  1WWH A;  1TL3 B;  3MCN A;  2Y1J A;  3Q2T C;  1VIO A;  4DG1 B;  4DU8 A;  2HKE A;  5KG6 A;  4DX7 A;  4X66 J;  5B0G A;  4YY3 F;  1HNV A;  1X4F A;  2EPI A;  3UR3 C;  1S0M A;  2M4M A;  1WJ9 A;  4X4R A;  4LSN A;  2WBM A;  4KIA A;  2UV8 G;  3IR6 B;  2IA6 A;  3VTI A;  2Q79 A;  2JLE A;  2YWW A;  3DOL B;  1OY8 A;  3I9Z A;  4K4U A;  2BW7 A;  4HHJ A;  3MD3 A;  5K8P A;  3O2I A;  2XS5 A;  3B8H A;  3PX0 A;  2AJ0 A;  3VF0 B;  1D1U A;  3VGV A;  5HRO B;  3IBW A;  1UCN A;  4FF2 A;  2DNL A;  3OVA A;  1ZET A;  5K9F A;  1J5E J;  5GAG U;  1O5J A;  1SH0 A;  2P9C A;  2HSE B;  3NAH A;  1XC9 A;  2H51 B;  1JJ2 R;  4DV3 F;  3OR2 B;  4F2R A;  2X3D A;  4OZL A;  1IR1 A;  3LP1 A;  5AJ3 J;  3PRV A;  2W25 A;  3ZXW A;  3ISN C;  3HJF A;  1HR0 F;  1LWC B;  3QJJ A;  4BC7 A;  2R7X A;  4HDH A;  1KOO A;  3W2W A;  3U1L A;  4JB8 B;  2DYA A;  2MJN A;  4UOC A;  1B99 A;  4ID5 B;  3B6B A;  3Q8Y A;  3DDI A;  4IRC A;  2I8E A;  1T03 A;  3KK2 B;  3CUL A;  1IBC B;  2ZBQ A;  2DO4 A;  1QUP A;  1ZTW A;  3PX6 A;  5DGA A;  1RI7 A;  1N32 F;  2LP4 A;  3D0H E;  1Q82 T;  4F2S A;  1HQ2 A;  3CSK A;  4DCO B;  4B3R F;  2LLZ A;  1YZ6 A;  5EHH A;  3H5U A;  4DUY F;  3KDO A;  2H5J B;  1FRK A;  4ZVT B;  1T8E A;  2FJE B;  4CLW A;  1NME B;  4QPT A;  3K5N A;  2WVC A;  2ZUA A;  2DEJ A;  5F41 A;  3QAE A;  2RNE A;  2NRE A;  4I56 A;  4ECV A;  3UDL A;  1VFJ A;  1G3O A;  2H48 B;  4AQY F;  3A8E A;  3LAN A;  4RO0 A;  4ECT A;  2RF2 B;  4H54 A;  3IR7 B;  5KFT A;  2KJV A;  4PWD A;  4QJV A;  3WX4 A;  3WIU A;  4Y2I A;  2J7U A;  3V6D B;  4ENO A;  1N36 F;  4RR5 A;  2OP5 A;  1WDT A;  3PAC A;  5LJ3 Y;  4NYO A;  3TI0 A;  4O3Q A;  3ZZR A;  2GO8 A;  3T3F A;  1ZPV A;  4DL3 A;  2EWH A;  3Q22 A;  4NEY A; 
#chains in the Genus database with same CATH homology
 1AZS B;  2QV6 A;  4USU A;  4P2X A;  1WC4 A;  1CJK A;  4USV A;  1CUL A;  4CM0 A;  4CLK A;  3MAA B;  2W01 A;  3ET6 A;  5D0R A;  3C14 A;  1TL7 A;  1WC6 A;  3UVJ A;  4CLW A;  4OYA A;  4WP9 A;  1CJV A;  1FX2 A;  1CJT B;  4CLU A;  1WC0 A;  3C16 A;  2GVZ B;  4OYB A;  1YBU A;  5D0H A;  4OZ2 A;  4CLP A;  4NI2 A;  1WC5 A;  4OYZ A;  4WP3 A;  4OZ3 A;  1YK9 A;  3C15 A;  4USW A;  1CJU A;  1CS4 B;  2GVD A;  5IV3 A;  3G82 B;  5D15 A;  4OYO A;  1CJV B;  1U0H A;  5IV4 A;  4CLY A;  1AZS A;  4UST A;  1CJK B;  4CM2 A;  1FX4 A;  1CUL B;  1AB8 A;  4WPA A;  4CLS A;  5D0G A;  3ET6 B;  4NI2 B;  4OYX A;  3C14 B;  3C15 B;  4P2F A;  1TL7 B;  1WC1 A;  5D0E A;  3UVJ B;  3R5G A;  4CLF A;  1Y10 A;  4OYI A;  1CJT A;  1U0H B;  2WZ1 A;  4OYW A;  2GVZ A;  1WC3 A;  3C16 B;  4OYM A;  4CLL A;  4CLT A;  3MAA A;  4P2M A;  4CLZ A;  3MR7 A;  4OYP A;  1CS4 A;  1Y11 A;  2BW7 A;  1CJU B;  3G82 A;  1YBT A;  2GVD B;  4WP8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...