3C14A

Complex of gs-alpha with the catalytic domains of mammalian adenylyl cyclase: complex with pyrophosphate and ca
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
189
structure length
189
Chain Sequence
MMFHKIYIQKHDNVSILFADIEGFTSLASQCTAQELVMTLNELFARFDKLAAENHCLRIKILGDCYYCVSGLPEARADHAHCCVEMGMDMIEAISLVREMTGVNVNMRVGIHSGRVHCGVLGLRKWQFDVWSNDVTLANHMEAGGKAGRIHITKATLSYLNGDYEVEPGCGGERNAYLKEHSIETFLIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for inhibition of mammalian adenylyl cyclase by calcium.
pubmed doi rcsb
source organism Canis lupus familiaris
molecule tags Lyase/lyase inhibitor
molecule keywords Adenylate cyclase type 5
total genus 50
structure length 189
sequence length 189
ec nomenclature ec 4.6.1.1: Adenylate cyclase.
pdb deposition date 2008-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00211 Guanylate_cyc Adenylate and Guanylate cyclase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1230 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleotide cyclase 3c14A00
1CS4A 3ET6B 1YBUA 5D0GA 4CLKA 5D0HA 2GVDB 4CLPA 3C16A 4WP9A 4OYPA 1U0HB 3UVJA 4NI2A 4USTA 4OZ3A 1CJUB 2WZ1A 4OYZA 5D15A 1YK9A 4OYIA 1CS4B 4OYWA 3C15B 4CM2A 1AB8A 4WP3A 1U0HA 1Y10A 1WC1A 1CJVB 3C14B 2GVZA 5IV4A 1WC5A 4CLFA 3MAAB 1CJKA 4OYOA 4CLYA 2W01A 2GVZB 4P2MA 4WPAA 4USWA 1CJTA 1WC6A 1FX2A 1CULB 1CJKB 3G82A 4USUA 3UVJB 4OYXA 4OZ2A 1WC3A 1CJTB 4CLTA 1AZSB 5D0EA 3C15A 4USVA 2BW7A 1CJVA 1TL7B 1YBTA 1Y11A 3R5GA 4OYAA 4P2XA 4P2FA 1WC0A 1CULA 5IV3A 1TL7A 4WP8A 3C14A 4OYBA 1AZSA 5D0RA 4OYMA 4CLLA 4CLWA 3G82B 3MAAA 4CLUA 1FX4A 4CLZA 3ET6A 2GVDA 2QV6A 3C16B 4NI2B 1CJUA 3MR7A 4CLSA 1WC4A 4CM0A
chains in the Genus database with same CATH superfamily
2DR7A 4F3OA 2ALYB 2JC0A 2RDJA 1SV5A 4JOUA 2XC9A 4CYUA 1TL1A 1XN9A 1MROB 4QR0A 3OR1A 1UFLA 4X4OA 3VHQA 1VC6A 2FHKA 5DDOC 5GMDA 5GAHU 3RR7A 1ZTWA 8RUCA 1BE4A 1IKYB 1FRKA 2C2NA 4CLPA 1HWKA 2K1RB 3JAMU 5I3PA 4ES3A 3GV5B 2D3O1 2C42A 4OYPA 2YH1A 1U48A 1U0HB 4KGVB 2XMJA 4DV6F 3PYFA 3EYZA 3K5NA 5D4LA 4YHHF 3V4IB 1X9WA 1JXLA 1UVKA 3DLKB 4NI2A 3NGRA 2IC3A 3M6XA 4HI1A 3OSNA 4ZVQB 3QRPA 3BB5A 3ELHA 1FKOB 2W2NP 3TUPA 2CFXA 4DR1J 3HK2A 1BY9A 1U7LA 2ZC3A 1GK8A 2F8MA 4P71A 2QFIA 3C15B 3T1HJ 3W9JA 5T41A 2BANA 2DR6A 2IC3B 4BDPA 2CPFA 4U7CA 5SZTA 1UZDA 4EBCA 5J2PA 2HBZB 1L3SA 5KTQA 3PZPA 1S0NA 2NXJA 4FF3A 1U0HA 3ADAC 5M2RA 4UZBA 3CO9A 2EKYA 1FHTA 1EB0A 3RAMA 4J9QA 1HW8A 4J9UE 2G13A 1KLMA 4U95A 3I9ZA 2XZDB 1JLAB 1SKSA 1U6BA 3IWXA 1CBKA 2IVMA 4R25A 2P2CB 3G6VA 1RTIB 5IT0A 2UV8A 4OYOA 4ENOA 1U1RA 4OI1A 4A47A 4DEZA 2RF2A 2R8IA 4Q0BB 4LFBJ 3MOZA 1WDDA 2Z30B 3ZNUA 5K20B 4EMDA 4UUWA 4DWIA 4TXSA 5KFWA 1LNQA 3IBWA 4ZVSB 4AQYJ 1CJKB 4NLRA 2MEWA 4N8NA 2DY1A 2E5GA 4JB8B 3UVJB 2FD2A 5F8GA 5KFHA 4DF8A 3PX0A 3D28A 2VFSA 2X3GA 3OXFA 5KG6A 1ZYQA 2UVUA 4X4RA 1NBEB 1VBYA 4X84A 3W5ZA 4QQBA 2YNHA 4UOGA 3V6KA 3FUYA 5F8JA 4G1QA 3QRQA 5E3AA 1QVFR 2GZOA 3H0PA 1N0VC 4E8UA 3Q8UA 4ZVGA 1OYEA 2W2PP 2I2YA 4CNYA 2R7VA 4Z37A 3BGRB 1QTNB 1NNDA 1YWXA 3BKFA 3D5MA 3HLUA 4FYVB 4GVBA 4LVNP 2Y1IA 2H4WB 3D6FB 4UY85 4DUTA 2QEXS 4IH6A 5KG3A 3GP9A 1YRUA 3FMBA 1S0OA 2WONA 3CE8A 4CH1A 2MPUA 4OX9F 4AQYF 3MMBA 4B3MJ 3M6VA 4JI5F 1WSRA 4LF8J 2XMTA 4DV2J 4WF9Q 1D8YA 4NYZA 3D6HB 1I94F 4JV5F 2UUCF 5IM0A 1DQ8A 1PBAA 1MU2B 2WB4A 2RS8A 3N6MA 1HNZJ 3HVTA 4CH0S 4BHQA 3CC7S 2B9XA 4MIWA 2MYFA 1PILA 2CZ9A 3CJ0A 4HL9A 1R8PA 4O3SA 2MKJA 1JLFA 2HNZB 3OJUA 2E1AA 4KTQA 3KFWX 1OJ4A 2HBQB 3GIKA 2G1DA 2ZD1B 4NXNJ 4GVLA 1HARA 3JSBA 3NBPB 3S7RA 4AL7A 1Q82T 5CABA 1FESA 1TV6B 4LF8F 2PN6A 1XJWB 4CCHA 1B0TA 4KSEB 2DTJA 2DGVA 3QGGA 2FLNA 2V50A 5GADU 4ZP9A 4JV2A 2DHSA 3LPEA 1RSCA 4K2JA 3VAMA 3CMQA 4LSLB 4ANCA 4DR7J 1A9NB 1IBKF 1BMQB 2H9ZA 1WG5A 2OJ3A 3T5JA 3M32B 1U1NA 4F4KA 1DFDA 2GVDB 1RT3B 1NPRA 1HBNA 1WWHA 4KKOA 4LT6A 1IBLJ 2KKHA 3HF5A 3M6UA 2RKIB 2RILA 3M8RA 4ETZA 2XMMA 4A8OA 2AJQA 3KOAA 1SQEA 1NJZA 1AXQA 1H3DA 2KFZA 1UMJA 1NMEB 2XO7A 5CZVA 4IH5A 3FGVA 3A8EA 5DG8A 5A8WA 4X65F 4P74A 1O8BA 3MMCA 1HI1A 1SUQB 1HBUA 5KFNA 1T7PA 1JLAA 2J7KA 3C66A 1JB0C 1YIJS 2KZMA 2BKOA 1VJQA 1U2FA 4OZ0A 1NSKL 4LR8A 1HNWF 5HMXA 3J80Y 4LJMA 1KR4A 3GYNA 2XB2D 3AJDA 4V19J 3LP0B 1PJ5A 1H2TZ 4DI6A 4LUBA 4DR1F 1Q81T 4KY3A 3F41A 3BYPA 2RS2A 4FS2A 1U1LA 3KXDA 4XPEA 4KQZA 3H4BA 2ZWOA 4QJVA 4DL6A 2ZZMA 1PAEX 4ID8A 1XR7A 3MM8A 1WC1A 3D0HE 2V8PA 2AU0A 1VQKS 3GYGA 5B0CA 4KV8B 2XYPB 4UUXA 1KFSA 3W2WB 2XGPA 2DNNA 1S5ZA 2OGUA 3NCPA 2QMWA 2CQPA 1U8SA 2Y0SD 4KHMA 2QLFB 1LWEA 3PRBA 2N3LA 2QLBB 4FKXA 3DGPA 1N32F 5THWA 1WI6A 2DH8A 4QU6A 2A0FB 3SQOP 2DHXA 4RW4B 4DQPA 1U8WA 2BUNA 1P9QC 2E1RA 1HL6A 1S12A 4P2MA 4XK8C 4N8OA 4DQSA 4AL5A 4USWA 3K17A 4IFYB 1YDLA 5CHCB 3U1MA 3PX4A 1WC6A 1MSWD 1CULB 3R5AA 1EARA 2QT7A 3DCAA 4WE1B 4YB7A 1AA1B 1BQMA 1FNOA 2GCFA 4I2QB 1Q4RA 1VGYA 1XR5A 2W2MP 3QGIA 2DYAA 1J5OA 2IMWP 2F4VF 4RW6B 4PWDB 2KXFA 7AT1B 5D78A 1EJ7L 3MMJA 4FXWA 3BPDA 2QRRA 2GIRA 5F41A 3ZZPA 3HHLB 5HQ8A 2RF2B 2JVOA 3CCJS 3H25A 4IFVB 5LMNF 3BDPA 1RWNB 2NYIA 4F4XA 4DSIA 4JI4F 2DIVA 1TKZA 3WX4A 1S77D 1LWEB 3H5YA 3NLCA 3O5TB 3Q8VA 5DZ6A 3JAMY 1Q5YA 2J6TA 2UP1A 4PG8A 1RJJA 2D9PA 3SDEB 1TKDA 2BA9A 4X62J 2MZRA 1Q8BA 3R7NB 3T1YF 1E6VA 3FZ2A 2HVIA 2JEFA 1W25A 2OO4A 4AL6A 4I67A 2HNYA 2HFUA 2O5DA 2D9OA 2N4CA 1WKKA 2BMBA 2LMIA 1Q0NA 5L46A 4CLUA 2DO0A 2YY3A 3QRRA 4BBYA 3GPAA 4XTTA 4IG3B 5KFMA 2WVBA 3X1LB 1S97A 5FDLB 2GJ2A 3WC0A 5C25B 3IXQA 3TNVA 3B8HA 2XYGB 4DL4A 2XG8A 2GHPA 4EUVA 1T3NA 2ZEJA 4DR5F 2KO1A 1C1BB 4A46A 1X5SA 1VQOS 1AT1B 2BXJA 3EDQB 3T41A 1HMVB 2M0GB 4RBUA 1N33F 1PG5B 1NPPA 1P27B 2LYVA 2U1AA 3W9HA 3QGPA 3L3CA 5DO2A 2FJXA 1SC6A 3EGWB 1UA1A 1KONA 1VLOA 4M5NA 1RWXB 4IOBA 3M30A 2NPIA 3Q83A 3HT3A 5MAOA 4OJ3A 3I0SA 1RYRA 1RT6A 4TU8A 4IDKB 2IVYA 1SH2A 1QDUB 1XWLA 2MSSA 4NOHA 1BHNA 1T03A 1FF2A 1R8CA 4HACA 4P6QA 2OFGX 2LQJA 3LWMA 1HQEA 1FRHA 2QMXA 2JOQA 5F9NA 1J5EJ 1M1GA 2C2RA 2AZ3A 3OLBA 3SEOA 4IR9A 2NCKL 4DHVA 3IMQJ 3MEDB 4OHWA 5HP1B 4KHRA 2DEIA 1IUJA 2IDLA 1XMQF 3R2DJ 4WZQA 2UU9F 1B0VA 3LP2A 2OP5A 2CPIA 2CKWA 3Q0AA 3SQGB 1B70B 2DH9A 3DRRA 1R6VA 1ZM2A 1UWAA 4DCJB 1YK9A 1T9UA 5ETTA 3UW1A 2KM8C 4YFUA 4ILLA 2LEAA 2MZJA 2ZZNA 3W60A 4A4JA 1RBAA 3MXHP 2YNGA 2FVPA 2GMLA 1JLQA 3KDOA 4DCPB 2YWHA 1U45A 3HSJA 3TEHB 4ATNA 3MPWA 3GQCA 1KLNA 1WF1A 5G0RB 3I56S 1FKAF 3ETOA 2MQNA 3RBDA 3KWMA 3DM2A 3EMTA 2HSEB 2HZCA 3IS9B 2BANB 3LW5C 1RCOB 1CJVB 3CCVS 2WVDA 1RT4B 1BQNB 3C14B 1NDLA 3ILJA 5JVGQ 1LFPA 1WC5A 1CC8A 4UW2A 1BWVA 1F5CA 1FVQA 1U1QA 4PABA 3GYXB 4IYQA 1OPIA 1FDBA 2KT2A 1VBXA 2LXIA 2FHJD 1VQ4S 3UO0A 1XIQA 2K1RA 4DPWA 4K50A 2IRYA 1RT2B 2YNHB 1U0SA 2DNYA 2L48A 3R5BA 3R6LB 1MW7A 1O6XA 2WHOA 4LRBA 1GMUA 1S72S 4B9TA 2DCLA 3OFHA 2CVIA 2LDIA 2UUWA 1HFEL 3TWZA 3KHHA 2AYBA 2FJEB 3LGHA 1P1LA 4IFYA 1F0XA 4LRCA 1XERA 2CNOB 3CCMS 4Y00A 2VFTA 1GH8A 3KG1A 3PM9A 4Q0BA 5EUHA 1TL7B 1Y11A 4XO0A 1RTZA 2ZOGA 1IM6A 2RQCA 3Q2TC 4S0MA 1RWPB 1S4FA 2WRMA 2B7BB 4P2XA 4EI2A 5AJ3J 1J27A 1X4CA 2P5VA 3BPSP 4HACB 3DRXA 1HLWA 1RLCL 4L6V3 1G3OA 1WI8A 4QBUA 1HNIA 1RUSA 1N8RT 1RAGB 3OXLA 2R4FA 3FBFA 3GFZA 4PKDB 3KLGA 3BSCA 1XNRF 1T05B 4Q45A 3AH6A 3KLIB 2V5HG 2MB0B 2ZHBA 4W98A 1LKZA 3E8OA 4ANEA 4ZPDA 1JJ4A 3H2LA 1F9HA 1KWMA 5J1PA 4A8QA 4GKJF 1FX4A 2BJEA 3RAQA 2ZITA 1RTHB 5GMKa 2X1GA 3POTB 2HQCA 4QIWD 3BO3A 1F9EB 1X31C 2KU7A 2R7SA 5H9FJ 5KFOA 1Q8KA 3CF5Q 2AYEA 3AA9A 3OL9A 1PKUA 4TKTA 3PW0A 1NK8A 5A8WB 2EBGA 5C24B 4HEA9 3M2RA 1C2PA 4JUZA 2I5JA 5DDQC 2W1BA 2VFVA 4CT8A 1WUUA 1JNRB 3U1LA 1VOMA 5HVHA 1YJ9S 2YH0A 4C8ZA 1V5VA 1F3FA 4U7UK 2PD1A 2F63A 3VZIA 2BE9B 4JI0J 2A6OA 1A0OB 2B56A 2DNRA 3Q8PB 4CO0A 3W8GA 4RNFA 5B7WA 1RE1B 3NOGA 3QLHB 3MZIA 4WWSA 4ZVHA 1DRZA 2GS8A 2PGCA 4Q8EA 4HVZA 3HP6A 1TL1B 2KVIA 2PA3A 1UVJA 3M2UB 2HW3A 1YJUA 3FFIA 3H5SA 1TV6A 3F73A 2XS5A 3NOCA 4O23A 5BYRA 4HTJA 1Q16B 3QLHA 4CRJA 4DV0J 4FZVA 2HQIA 1LQ9A 1WDTA 3CJ4A 5B0BA 3RTVA 3PJ9A 1S1UA 4TLQA 4KH1B 4NA1A 2QLJB 3CDUA 1RACB 4IO9Q 1RT2A 4OI6A 4ZVFA 3W5YA 1R31A 1N36J 3GZ7A 3IRXA 3HJFA 1X8DA 2HVEA 1X4FA 4I64A 4MT1A 3KK3B 4Q2LA 4N7TA 1AB8A 4QW8A 1YKWA 2IRUA 3RJMB 2VF3A 3G8SA 3KUHA 3DI6A 3MCNA 2VDHA 3VR1A 4CO2A 5DQGA 1RHKB 1M5VC 4X4NA 2V0NA 4MFBB 4O44B 5GAEI 1HNZF 1VK3A 1TZ0A 1FDAA 1Y0HA 3VGSA 4N56A 1FVSA 2BYCA 2GQCA 1FD2A 2GAHC 1FKOA 2MQ8A 1IBKJ 2DBBA 4PG4A 1C1CB 1GT8A 2AW0A 2MKYA 3IGNA 3EVWA 5HLFA 3UR3C 4B08A 1S0VA 1O51A 2K2PA 3D66A 2O66A 3QT6A 2JDJA 1TFYA 3KLIA 1L3VA 1RT5A 1LW0B 1WORA 3OVBA 1H73A 2FJVA 2GQQA 1K73T 5B0AA 2KG1A 2AIRB 1WHYA 1KBRA 4WZMA 3ITHB 4RNHA 1KN6A 1FJGF 4DR4F 1QUVA 1S4EA 1SC3B 4W4MA 1WHVA 3AFGA 2UV8G 4IKAA 2W9BA 4ED4A 4RNOA 3FJ2A 2JLFA 3UDEA 4KJIA 2X3DA 5IFMA 2BE7D 2ASYA 4B3OA 2BW7A 2WW4A 5A6PA 1T9XA 3OR2B 2ZM6J 3BSOA 1KTQA 2X1BA 4G3IA 2DNHA 3EJMA 2E66A 3HT0A 4KGZB 4NLWA 3U27A 1Z4UA 1SJ3P 3K0JA 3DRYA 2QMUB 1FD8A 2CPDA 2MTLA 4ZPTR 1SCJB 2VG6A 4NRTA 3TX8A 5HMYA 2AHOB 3MPVA 2H48B 1UPPA 4JV0A 1KLMB 2A18A 3I0SB 4C8NA 3BQ2A 1R0AB 5EN1A 2VC0A 3KNGA 3LF0A 5C42B 3L4BC 5CA5A 5DQHA 1KS2A 1SL0A 4KHPJ 2UXDJ 2BW2A 2VV5A 3KK1A 3MOJB 1HQUB 1CG2A 2E5IA 4C8KA 3GIMA 3PEJA 3BN7A 4U67Q 4J9MA 1G6BA 3NXZA 3TRGA 4A8SA 2XLKA 1WEZA 4UY8T 3ENQA 3PNIA 2J9CA 4PYDA 4RWWA 4BWMA 4C3LA 4CLZA 2V4RA 3OV7A 4N47A 5KFXA 4FF1A 3SV3A 4LSNA 1GMWA 1UJ6A 5D3GA 3BSAA 4ZJLA 4QWAA 1ZAXA 3DLKA 4NI2B 2G9OA 2JZ5A 2DNGA 1OY8A 2H1YA 4L74A 5D4PA 4ZCKA 1U47A 3MPUB 4CLSA 1K47A 2J0WA 2ASDA 1K0TA 5H9EK 4K0KF 4DQQA 3UDLA 2YNGB 5FJ4A 3ENWA 1O5JA 2P9EA 3MCOA 1Q86T 3H59A 4TNOA 5DLFA 1REVA 1S1TB 4LF2A 4JI6J 4K0KJ 3DRRB 2R2RA 2HS0A 3AHPA 3WZ0A 1EKRA 4RUBA 1NDKA 3W65A 2RD5C 3MM5B 3RGIA 3VGUA 2GIFA 5FD1A 4OHVA 3LPYA 3LP2B 3RBZA 1P9YA 2H3EB 3A8KA 5KT3A 4DV1F 4OJ1A 1K1SA 1H98A 2V4JA 3A3PB 2CJBA 3RBXA 3UDVA 4DJBA 2HRYA 2KT3A 3PFOA 4EO6A 5ADZA 3TUZC 1LW2B 2XQCA 3MCSA 3QJPA 2RAQA 1GX5A 2EWHA 3K59A 1ICEB 3M8ZA 3ENAA 1BQMB 2HZAA 1F6TA 1ZM9A 2CJAA 3P5TL 4IDKA 3CJKA 2R7OA 2ZH2A 3D1HA 2VQEJ 1LW0A 4M5IA 2IM3A 1F2HA 1I1GA 1AYEA 3LAKA 1SH3A 4I0WA 1T94A 3LWLA 4QWDA 4NZ0A 1L3UA 1ZM4A 2XYHB 3CJ8A 2EC2A 3R7SB 4AXIA 2N3OA 3GV8B 1H74A 2OELA 3OTEA 1QAIA 1UFWA 5LSRA 2C1EB 3M1VB 1S6UA 4ZMMA 4LF4F 1LK7A 1LWCB 5EDWA 2LXFA 3WQPA 4FPRA 3R7BB 2PI4A 1AFIA 1S9GA 4WFYA 2ZUAA 3PG9A 1RP5A 5DZ7A 2CNNB 5D77A 1ACMB 7FD1A 4DV7J 1Q1KA 1UFKA 1QAYA 3Q89A 2AD9A 3KJFB 4PXCA 3A3NB 2B4VA 3AJ2A 1Q79A 4I4BA 4USKA 2LP4A 4DZ6A 4DX7A 1X0PA 3K58A 1MMLA 3VTIA 4DL3A 2XS2A 1FK9A 2VOPA 5HK4A 2YBVA 5SUHA 2WVFA 2B43A 2YWFA 3W1YC 1EQMA 2DNPA 1J2VA 2PIIA 4MK7A 4PZVA 1T05A 2ZWPA 1N33J 3NS7B 4NLOA 3OTOJ 4ED2A 1JJ2R 4MKVA 5ETSA 2LA6A 1FJ7A 4X64J 3CJTA 3B78A 1RWOB 2FLOA 2H4YB 3BGOP 3ILIA 3BM7A 2UVWA 5L1JA 1FEHA 1XMOJ 3O8WA 4MIBA 3ZZRA 3MUTP 4C3KA 4F50A 4E0DA 3Q8QB 1FXRA 2HK2A 2MLXA 3K89A 4OFZA 4ZPBA 1I94J 3QWUA 8ATCB 2FY1A 2JFKA 2CJXB 3BS9A 1YBTA 3C19A 1U2RA 3AXMA 3MMAA 5CYMA 4ZPVR 3GONA 5KFLA 4QIEA 4ANDA 2K7JA 4X62F 2E44A 5LSOA 2ZBRA 2B7CB 4Y2AA 2KRBA 3R8YA 4IRDA 3I5BA 2RRNA 3OUYA 2VIHA 3R1HA 2MKSA 2GGPA 2ADCA 2G1HA 5L38A 4BS2A 5D0RA 4K8RA 4OYMA 4CWBA 3DGPB 1B0PA 1TTHB 2H54B 2DB1A 2J9EA 4CNZA 4Y2IA 4DV5J 2Y9HA 4NLGA 1C1BA 2CJ9A 1U25A 2Q3PA 1PAUB 1FKPA 2W25A 3J81Y 1WTFA 5A8RB 4B3TF 1N34F 4NZ7A 3FCWA 1VLYA 3M9OB 1YJWS 1N54B 3E01B 2HFOA 2ADBA 1JXVA 2MQOA 4DR3J 2E7XA 2FHMA 2QYGA 4YB1P 2D41A 3MD1A 4PQAA 3CO0P 1MWQA 2DD8S 2XMKA 3FDSA 1TUGB 4NLPA 1D0EA 4DSFA 1APSA 2NXCA 5IWAJ 3M8YA 3ZZZA 3IRXB 4X4UA 1KQGB 4MH8A 2HQDA 1NCLA 1VJWA 1Y7PA 2EK6A 4ZLNA 1TFWA 2UXCJ 3K5LA 3EWGA 1S1UB 3SCLE 2V8HA 2HIYA 2IJFA 3Q86A 1YG0A 4OV1A 5AT1B 1TKZB 2O67A 3OHBA 3DHXA 2G2YA 1N88A 2Y0BB 2CJYB 3CIMA 3VGVA 3TQ1A 3C16A 5GAGU 2NR0A 4IH7A 3HKZD 1TK0A 1GTEA 2ZE2B 1G4CA 1NJIT 2IFXA 2M8HA 4N41A 2A10A 2ZNZA 2DH7A 4RJVA 1CEZA 2FUG9 2DR9A 1NK6A 2J76E 1HQEB 4E2FB 3P96A 4K4WA 4NPOA 4QR2A 2I38A 1CJUB 2P6TA 2YQ1A 5LXRA 4OIXA 5KT4A 5HROB 3JYTB 3PW2A 4PXBA 3GILA 1GXUA 2CUYA 3NL0A 3MWBA 4YR0A 2D69A 4YDXA 4DU8A 2XZTB 3W3SA 4CDIA 3OL8A 2AJ2A 4F7VA 2R7XA 3CSKA 1NZ8A 2Y8WA 4I6WA 5IT9Y 2BOPA 2L08A 1RAHB 2D74B 3M2RB 4Y34A 4ZVPB 3M8SA 4UQTA 3QATA 2AT1B 3AD9C 1Y3KA 2JRSA 3AOBA 3DHWC 3DU6A 1Y10A 3LGMA 5F9LA 2X1AA 3FMWA 4QPTA 3EUNA 2ATLA 4EYHB 1S79A 4J91A 2FZKB 3LP1B 1VHFA 5J1EB 5KT6A 1YJVA 5KG0A 3GLJA 3KJVB 2UXDF 2CWKA 1XMQJ 1KP6A 5IM0B 3M2VA 4DL0C 5FIIA 4Y28C 5ETPA 1S1VA 4DPUA 1S48A 4KO0A 4DBQA 1DBDA 2OEJA 1W7WA 1HNWJ 1WEXA 3HSZA 3JQKA 3PRVA 2JNJA 3MMBB 2C2DA 3D4JA 4ETXA 3SCIE 1NJYA 2NLWA 4I1TA 3ZZYA 1NO8A 1UVNA 4U7UD 1ZA1B 2EFOA 2J9DE 3TEGA 4DQRA 2PC6A 4P72A 2DXFA 2BDPA 1U1OA 1FX2A 1Y5LB 3S01A 2QA4S 1BGXT 3G82A 4M1KA 5KFRA 4ECXA 3PRDA 4OI0A 2PFFB 2IPOB 1REGX 4CH7A 2R3VA 2V2QA 3H40A 4Y2CA 2W7AA 2C2EA 3BGRA 3N5FA 2GGPB 1CJTB 3GCWP 3KDNA 2AMCB 3ISND 4C0HA 5L9XA 3CEDA 1H0HB 2VOOA 2YKPA 4IG0B 4LF1A 4H4KC 3WDOA 3CCZA 3TZWA 3P4UB 4DF4A 3QJLA 1V3ZA 1UVIA 1RWKB 4LREA 4LBHA 2I1RA 1TL3A 5ETMA 3IAM9 4DFMA 3DLGA 1S57A 3DRPB 3VQSA 5LXYA 1RYSA 2HVDA 2AJ1A 5L9NA 1CULA 2HHHJ 1FJCA 5AE3A 3OR2A 4FYDA 1TL7A 8AT1B 2XSJB 3I31A 2GX8A 2ZC4A 4J9VA 2ZE2A 2HLTA 2ZOFA 5ETRA 3MURP 2PEBA 4JYAJ 1PYTA 2AGOA 3GR1A 3CJRA 4UT4A 1EKSA 1G2EA 5ETVA 3BQ0A 2OI2A 1QSLA 3NGKA 2UXBJ 3G82B 2PMZD 2E5HA 4C9DA 3ITHA 1DTTA 4ICLB 4MK8A 3IRWP 1RBLA 1S9FA 3NGTA 1JNZB 4WTYA 4K5RA 2IM2A 4B9VA 1WG1A 2PSZA 3HSDA 1LK5A 2LEPA 4OJHA 1D9DA 3OLAA 4WXWA 2M7SA 2ZH6A 4I56A 1JLEA 2OLWA 2WOMA 2J7UA 1VR6A 5KG7A 3QT8A 2YKMA 4JI0F 5JXSA 1DJ0A 1OSDA 4KGMA 1EETB 2V8GA 3MEGA 4TY9A 3E01A 3GE9A 4F2SA 3K5OA 1RT4A 2R8HA 2BJ7A 3MCMA 4ICLA 2XCAA 4DSJA 1HYSB 3DXBA 2L9WA 1WSVA 2VPZB 3PVXA 2XMWA 3MUMP 4NYPA 1VCTA 1WJ9A 1WOSA 2QSFA 3D54A 4U96A 3V4IA 1U1KA 2UUBF 2HGNA 4KFBA 1UEKA 3KK3A 5KG2A 3S6EA 4DLEA 4LF7J 1FTCA 2HBYB 4RBVA 1C0TB 2J7WA 4WYLA 1K9MT 5IT9U 1HPZA 2CA9A 2VFRA 1NLKL 5C2CA 1M5KC 3ZTSA 1V5IB 3M32A 2KB2A 5GAGI 3NAIA 4RNMA 1M5HA 1HWIA 1RLDA 4ELTA 3WIUA 3IG1B 2MQMA 3IWNC 1JMTA 1U26A 3PKYA 2DR5A 1MMNA 3TYTA 2UZAA 3RU0A 3WIVA 3VAIA 2ZUGA 5F8MA 1F9FA 4LIWA 2MQQA 1VC0A 3NS5A 2OPRA 3C6UB 3C6TB 5ETNA 3QSYB 4IO1A 5GVQA 1TR0A 1KOHA 1URRA 3ZZTA 2UVVA 4JI3J 3I32A 2YWKA 4M5LA 1SIZA 4NLTA 1UJ4A 5HO4A 4K4TA 1RKIA 2CQBA 2HAIA 4ED1A 2OPPA 3TVKA 2PT0A 4CO4A 4DFJA 2N7CA 4QCLA 3MAHA 3I4PA 2K8GA 3DMJB 2CDQA 2JEJA 4I2PB 5KFSA 4WCEQ 4ECRA 1B64A 3TX0A 4W90B 2PO4A 3EZUA 4C98A 2XI2A 2MZ1A 4CLFA 4M5GA 4IRCA 4LMZA 4LFBF 1M5PC 1RU2A 3IR5B 1NK7A 1KD1T 2ATCB 1VIOA 3OL7A 4C2MA 2UUAJ 4O3RA 2OKQA 4LQ3A 1IVZA 1BQXA 3M8QB 3PJXA 4MIAA 5A8RA 2R9LA 1NKCA 2DGQA 3MM6B 5HQLA 4HKQA 2O3DA 4Y0FA 2CQ1A 2XWYA 3AAWB 1HI8A 2AJFE 3JXOA 2KFYA 5LMUF 2DPIA 4USUA 3NMAA 1JWWA 3IWLA 3W5XA 1U49A 2EFQA 2HQ3A 1BC6A 4QPXA 1PC5A 4R5PA 1JIHA 4JI2F 1RTJB 4KH0B 3SBMA 4DR2J 1P1TA 3Q2SC 1FWLA 2Q43A 3CTRA 4FNIA 4OZJA 3BYRA 4ZDNA 4ED5A 2RHQB 3R1LA 2J0XA 1ZPWX 2DEJA 1FFWB 2IBOA 2YNFA 5EWEA 3CXCR 1EP4A 3HM9A 2AEFA 2EFNA 1VQ9S 2VPXB 4FYXB 4Y65A 4OX9J 5D4NA 4DPTA 2NZCA 3RB4A 4CYUB 4DFKA 2W8LA 1RHMB 4WP8A 2DR8A 1FJEB 1FA0A 5IQ6A 1U4BA 2DNKA 2QL9B 1JQGA 4ZPWR 1J5OB 2E5JA 2QX0A 1FO1A 3HMJG 3T6JA 4CLLA 3ZZ0A 3M7VA 4B9SA 1RTIA 4MYTA 1EQ0A 2BZ2A 4MTPA 2JL9A 3SFUA 3CCRS 2WSCC 1SKUB 3G4SS 4C3MA 1NK9A 2B4OA 3D1QA 3AB2B 1M5SA 5BR8J 3DOKB 1Y00A 4DPOA 1RT5B 2PA8D 3AJ1A 1ZZFA 2M3DA 1PIEA 2AX0A 3GU0A 1YZ6A 5A2QY 3PIPQ 2ZH5A 4DR3F 2AJ4A 1R3NA 3KK2B 1WACA 3VAFA 1MWZA 1RABB 3R27A 4ECZA 2KYXA 2ZZTA 1X4DA 2MZQA 2WK4A 3FZBA 2PMWA 4YS2A 1IBMJ 3DYAB 3J81j 4M94A 2WAQD 1YTYA 2DHGA 5HJXA 1LXJA 1RA6A 2JVRA 2IA0A 1LWCA 1UAWA 2HNDA 3IC1A 4PEOA 3JS9A 2QN6B 3QBCA 1TK8A 4GKJJ 5D4OA 4QOTA 1HBUB 2XM3A 2KFNA 3FBCA 1EETA 2GAGC 1MNEA 2LXUA 4OLPA 3V6DB 3D0IE 1TAQA 1CLFA 5CCMA 3NNAA 4I69A 5HATA 3ZNJ1 4C48A 1KVKA 3RW7A 4RW8A 2LKZA 2DY9A 2ILZA 2Y1LB 1DTQA 1NH8A 3DMJA 3M8PA 1JKHA 4L3KA 4NLQA 5C42A 1GNKA 1HNVB 2CQHA 2DNOA 4OZ5A 3VQTA 4F3QA 3TZYA 2NZ4A 4DV5F 3BKTA 4YMEA 2Q79A 3DRSB 3IP0A 1KHWA 1RAAB 3UVJA 4RU2A 3U1NA 1DZ5A 4JI1F 5KFCA 3OSPA 1WOPA 1IKWA 4DPXA 4B3TJ 3EICA 1RK8A 4HI2A 4F04B 5L8RC 3SYZA 2J9DA 1L5UA 1FFSB 1UEUA 4G1IA 3OTBA 2PFDA 4R8UB 1L3KA 1RTDB 2GIQA 2VH7A 3DLEB 4NCGA 2F40A 3R5JB 3LANA 1IKWB 2UU9J 2X1FA 3UCGA 1HHSA 2W24A 4FPIA 2IVFB 1TKTB 4Y2MA 1YJRA 5L1KA 1HWUA 4XAKA 1RBOB 1UP1A 4F36A 4DX5A 1NZAA 3ZFVA 3H2VE 4OZ1A 3GWCA 2ZFHA 2QG9B 1JLCA 1ZOTA 2CZ4A 3V4MA 4RU9A 4X66F 4Y2KA 5LSLA 2CQ2A 5M2PA 3QIPB 4DR4J 1KVJA 3AD8C 3MTJA 4NX9A 1D9AA 4P75A 4DV6J 3Q23A 1UPMB 5A0YA 1HD1A 1C4CA 1Y5IB 3HHNB 3MAAB 4GKKF 2YTCA 2HGMA 3ZZUA 4AFFA 3OW2R 1NKEA 2G2ZA 4B9MA 3JSYA 4QWBA 3NCQA 4O3OA 2KXHA 3BH6B 3RR8A 2BE2A 2EFPA 1U1PA 4DL2A 1PC4A 2G0CA 3HZGA 4LF9J 2Z2LA 4ZPAA 2XY7A 4N5SA 1U1MA 4LFCF 1VIXA 3I0RA 1JJHA 2XZWA 4FVMA 3HZEA 1MWYA 3QIPA 3KLEB 4I2PA 3DOLB 3IM9A 4CLTA 2W9CB 2RSQA 4GRSA 3K5PA 4I6YA 1NHKL 2MJNA 1D09B 2B3TB 2OSQA 3F0NA 4RLEA 2VA2A 4WBFA 3W7BA 2VBXA 2DGWA 3SDEA 2WONB 4RUHA 3UCZP 3KLHB 1IWAA 1DQAA 3PYGA 4F0HA 4QYZK 1B4SA 1RZMA 5HBMA 3PJWA 2VPWB 2XCPA 3HCXA 3L09A 4PR6A 3IA0A 4Z2XA 3OXGA 5LJ3Y 2C3OA 3UR0A 4BLGA 3CD7A 3CJQA 2W9BB 4GC7A 2X7IA 3N5BA 2JLEA 2B9EA 4L76A 5K8OA 1U24A 2N7YA 2WSEC 1QSSA 4MJKA 5KFTA 3DRSA 3OJSA 3UN2A 5MLCV 3KHLA 3DGVA 4J9PA 1F1BB 2V8DA 3N0VA 3NP5A 2CNKB 3G8TA 1JKHB 1XNQJ 1YJ7A 4USMA 2W7OA 4KPCA 5LM7E 3HVWA 4CTAB 5FLXU 2O01C 1RWVB 1YSJA 2QLWA 5E0OA 4RNNA 2C2OB 6FDRA 3KMSA 2J0QD 2QV6A 2QSWA 4K4ZA 4QIGA 5ETOA 1IKXA 2L41A 1VMBA 3DOMB 4WU2A 2D3ZA 1SJQA 3O44A 2DISA 2W4PA 1CS4A 1ELOA 1RT1B 4YQWA 4ID5A 3SXLA 4O44A 3FEZA 2XGQA 2AWZA 1F5BA 2DRDA 4I6AA 4ZVOB 1FKPB 4DV2F 1JLBA 4YEAA 2AEJA 3VVTA 4EK2A 2JX2A 4ZN3A 3KHGA 4JBCA 4AE5A 4BC7A 2HFVA 4DR6F 3FVYA 4LF7F 2A6MA 1R27B 3QQCD 4DOZA 1U02A 2P8IA 3KK2A 3FSIA 4J9NA 3RRKA 4LBIA 4P73A 2ZH4A 3G2XA 1TMMA 2J6SA 3H90A 3QO9A 5E5NA 4X2BA 4DUZF 3IR7B 3QFWA 3W63A 9RUBA 2VBZA 4RBTA 2YQ0A 3DU5A 4O3QA 2AV5A 5J2QA 2FY8A 4BCAA 3J7YU 5DM7Q 1T9WA 2KXNB 3E2EA 3H98A 2FDNA 4YDDB 1XMBA 2XMUA 3D7SB 2ROPA 4F26A 3D9BA 4RW7B 2M88A 4QIVA 4QR1A 3EXCX 3HXMA 3LOUA 1SJ4P 2DRAA 3PW4A 2HRTA 4KKOB 5U47A 2POKA 1X0FA 2AYMA 2IA6A 2HIQA 3IG1A 4PPZA 2HKEA 3TW0A 4IOAQ 4TVAB 1T3OA 3NS6A 3B54A 3K7RA 1HD0A 3OL6A 2EVZA 5K5MA 3HHEA 2V34A 3M30B 2Y1JA 4ZVEA 4RW8B 5D8HB 2WBRA 3PO5A 2IDEA 1VRTA 2HBRB 2C3YA 2MHNA 4J5OA 4TLRA 4R5PB 1IR0A 5EGYA 3MEKA 4EBEA 2M70A 2WW8A 4HDGA 2VQEF 5KFBA 1AFJA 2KH9A 4CLYA 4B3SJ 5H1SV 4ECVA 1S9GB 3MI7X 2E1CA 2HLUA 2PEHA 3L7OA 4MYUA 3Q8SB 4F4ZA 2RJZA 1V3RA 3DI6B 5ETLA 4DDFA 3DM2B 4DN0A 3J7A1 1S7HA 3KUGA 1FK9B 4UOFA 5HJYA 5I4MA 1UWBA 1SJFA 4PQUA 1HQ2A 3N6LA 3GIJA 1A6LA 3KJVA 3I55S 4ZS6A 2MXYA 4CTAA 2IAJB 2KHCA 2VZ9A 4ZJQA 2K06A 3R5DA 3MR5A 1PGZA 1HNIB 4KB7A 2ERRA 1RCXB 2VDIA 4NA3A 3TAMA 2G4BA 2R42A 1DTTB 3NAHA 4OYAA 2YKAA 4JP8A 1RA7A 1YGYA 2MJUA 4OJGA 2DGSA 1M5OC 1H72C 3G6ES 4Q5VA 5D6GA 4KC5A 4F2RA 2DGUA 1CQMA 2A1BA 4NLYA 4ZOSA 3DLLQ 3BH7B 5HVGA 2DJWA 3DLHA 2OMLA 4H54A 3UWTA 2ZH3A 4A8KA 2HRUA 5F3ZA 1VQSA 3T19A 3PR4A 2ZDPA 2UUAF 2GO8A 4WE1A 5BR8F 5GAHI 2HQGA 3UI3A 2L9NA 3TA0A 4NLUA 1C4AA 2F8HA 4DX6A 3JSMB 2EC0A 9ATCB 2AP6A 1HPZB 2JH3A 3LUYA 2W9CA 1NU4A 1VYAA 2HAFA 2LVWA 2Z4PA 4DX8H 1SKWA 1TAUA 1FRLA 4EZ9A 1UL3A 2CPHA 4EYIB 2ZDOA 1EIYB 2FJBB 4KFBB 3FCHA 3I0RB 1S9EB 4DG1B 1UW4A 4ZP8A 4ECWA 2AZ1A 3GCXP 3EPGA 3T9NA 1VBZA 4RWXA 1AROP 5GADI 3PDNA 2IYGA 3QMQA 2AGQA 3A13A 1BXNA 4LSNB 1NB7A 5AXLA 2DK2A 2FVSA 1CPZA 4Q2MA 4F0MA 4J9RA 2F7VA 5F8NA 1FNXH 1DLOA 2ASLA 3T1HF 5F8IA 1IM4A 2XWXA 5JUMA 4IG3A 2YKMB 2EKNA 3J80U 5HN0A 1HA1A 3BBFA 1UA0A 2RUSA 4E98A 3CB4A 1GMVA 5AXKA 3WHIA 4DV3J 5CCLA 3AQPA 4OX6A 3OQ2A 1N34J 1R7IA 2IYIA 3AT1B 1R43A 4JV1A 2FB0A 1JLBB 3LP1A 5J1EA 3PX6A 1R0AA 2OAUA 1QD1A 3QT5A 5B0EA 1IR1A 5RUBA 3NWRA 1JJCB 5BJRA 4M95A 3MR3A 4NASA 1T9TA 2IRXA 3HDSA 4F4YA 4YR2A 2XI3A 3DLEA 2VASA 4ILRA 2YWEA 5DGBA 2P9CA 2DVIA 3EGVA 5AJ3F 3CVKA 5B09A 5AXNA 4C6AA 2HHXA 3MAQA 1E6YA 1RT3A 3HX9A 2FZGB 1LFWA 3M05A 3QWPA 1YHQS 4F25A 1I51B 3CCUS 2HFNA 1NDPA 3GMGA 1DHMA 4YR3A 2I6WA 3RB0A 1VQ8S 4R0EA 1XNRJ 2RUGA 3P45B 4LSLA 2R2UA 4ERDA 4ELUA 2QLXA 5T14A 3RZAA 1LW2A 1HHQA 1Q7LB 3HKWA 4G6VB 4KR0B 2VQFF 3JB9k 3D68A 3K2YA 4LRFA 2FVRA 4OI3A 4HT5A 1AUSL 1R0CB 2EPIA 2V4JB 3L7UA 4FNHA 5HAOA 1RXOB 4EFAC 1VQNS 3D1OA 4HLBA 1FCAA 2JC1A 2O1PA 4A8WA 1R8BA 4M5KA 3BF4A 2VU5A 2LECA 3FRZA 5A8KB 1XBWA 3T5KA 1ZPVA 1VRQC 2W01A 3TAMB 3F56A 5E2QA 5J2MA 4DL7A 1AUDA 2YXLA 4ES1A 4F4WA 3K5MA 1P6TA 4L72B 2W8KA 1S59A 2F1FA 4B02A 5KT2A 3T3FA 2WBMA 4LIRA 4OYXA 4I7FA 1VK8A 2ILYA 1OYDA 2IHR1 2V2VA 4Z7CA 4WXOA 4C11A 1RHUB 3HFVA 1GFWB 1PBUA 1I3OB 3GTYX 2D3OR 3H5XA 2GMHA 4WFXA 3T6BA 1ZM3A 3C15A 3B4MA 3CCWA 4ZP6A 3ZTOA 5HSPA 5C5JA 3T1AA 5K8NA 3CCSS 2V2ZA 5E3PA 2WVCA 1FRIA 2BQRA 4NXNF 3MFHA 1KFDA 3VAHA 2A2DA 3DOMA 1AW0A 3AA8A 2OFHX 2HVHA 1HWLA 2YPYA 1S6OA 1X5PA 5EHHA 1NK4A 1KQKA 3MPYA 4RUAA 4UTGA 4NEYA 3SV4A 3OFEA 3BGFA 1N52B 2VL1A 3AB4B 3RB6A 4EBDA 5HANA 2BQUA 4RO0A 1Y4ZB 4DZDA 3FEXB 5I3QA 4WIQA 2J0SD 3B82A 2GO9A 4ZHRB 3OFGA 3JSMA 1RAOA 3NRBA 5ETQA 1AZSA 2MKKA 1EP4B 1OWXA 3DFEA 4UQGA 3J7ZT 3Q24A 1B99A 2NUHA 4CT9A 2DXDA 2VG6B 3CCES 2VC1A 3J7YI 2H5EA 4DQIA 2FVCA 3D67A 3ZO7A 5A2QU 3K8VA 1OSCA 1TL4A 2CWXA 2OHDA 1VQ7S 5I42B 3MMAB 4WYWA 4IQMA 2CJKA 2HPUA 3I96A 3W64A 3G6XA 2QFJA 1EHWA 3BN4A 1SJ1A 1Z1ZA 1OY9A 3CDBA 4NCAA 1VHIA 4IOCQ 2ZVSA 4X4TA 3C16B 3VAGA 1CSJA 5KT5A 1C0UB 4HYKA 3MEEB 4K7QA 2VJUA 1S6QB 4X66J 2YX4A 3VZHA 2HHHF 3LH2S 1FRJA 4PPDA 3M6WA 5L1IA 3UN5A 3PYEA 4C8YA 1MG7A 2F3JA 3MM8B 2CPYA 4ZKAA 2LCWA 5J2QB 2BRKA 5D3GB 1LV5A 2UXBF 4RL1A 2ZVIA 4Q7AA 2R2TA 1YI2S 4TN2A 1QAXA 1WF0A 4F0KA 4HT7A 5C2GA 3LA0A 4FBUA 3KNAA 4RW9A 7FDRA 4M5DA 4CLKA 3CC2S 1RHQB 1U2CA 3EDRB 2HNYB 4USIA 3UQSA 3TVYA 1RT7B 3A4TA 2ZJQQ 2V8VA 5D0HA 2DRBA 1GEHA 5KFPA 5IWAF 3CWJA 3FSYA 2CPXA 2V94A 3SI8A 2V63A 4AYBD 4B3SF 1T02A 2RT3A 1SC4B 2GQ2A 4K59A 4NMXA 4QWCA 4JI1J 4JI7F 4K4SA 2QYCA 1N5TA 2VBYA 2HQFA 4OZNA 3KTQA 3KMQA 1NAQA 4NYOA 2XHCA 3DC2A 1RWMB 4Z7YA 5A8KA 2BBEA 3O2IA 2IIHA 5IXUA 3OVAA 1HBMB 3N6NA 2JHEA 1ZAWA 1TQLA 3CULA 2CDRB 2UUCJ 2UVRA 2FJDB 3HO1A 3GR0A 3RRGA 2J8SA 4DMZA 2CQCA 4CM2A 1Q5VA 3E3XA 3GG0A 2ZJPQ 2RVJA 4OI2A 4LRAA 4ITSA 4AD6A 4DUYF 5KFGA 3PIOQ 5CYJA 4DL5A 3R5CA 5DGAA 5K14B 4KHPF 3DN9A 2HHWA 2R7UA 2FJWA 4L3NA 1YZ7A 2VJVA 3NEKA 1OQ3A 2EK1A 2NYHA 2EFVA 4R8UA 3SSQA 1E6YB 1EZZB 3W61A 2KM8B 1HR0J 1SV5B 3TJAA 2Y8YA 3FBBA 2R7WA 3KKFA 1QLNA 2IJNA 3PKMA 3M2UA 4J90A 1NPKA 4DR6J 2DCUB 4P7VA 4CO3A 5HQMA 2BVZA 2VQFJ 3HJVA 1U6FA 3CUNA 5KFVA 2KYZA 4C0OC 2ZBCA 3BQ1A 4ED6A 3I9V9 1NK5A 2KT5A 2YKOA 3FBEA 2WSFC 4DR2F 2KHDA 4QIFA 3OPKA 4ZLLA 5JJBA 1N5YB 1I6JA 3SIPB 3O6QA 2NUUG 4H4OB 4LFCJ 3MHYA 5KFEA 1IQTA 3LO3A 2LQ8A 2C3MA 1V3SA 3OTDA 3MD3A 4TY8A 4I68A 2E5LJ 2L3MA 4G65A 1L3TA 1XMOF 3DLJA 1T95A 1NDCA 2Y3YA 2APOA 4U8VA 1ZETA 1OQ6A 2NXUA 3G9CA 2EFGA 4ID5B 1LEOA 4NWBA 5D0EA 4YP3A 3DDIA 3HHDA 2RU9A 3QT7A 4JI8J 2HHVA 4HHHA 1K8AT 2IM1A 2HWTA 1VQPS 2HS3A 4B9LA 1IKXB 4K4XA 3AOAA 3THTA 1FNMA 4LF6J 4NXMF 5H9EJ 1VQ5S 4A8FA 1F5AA 4OQJA 2EW9A 1WC0A 2MZSA 3LAMA 1Z2LA 4CP5A 4QWEA 3JTOA 4EU0A 1X5TA 5GMEA 3FCVA 3KG4A 2RKIA 2E1MC 3EM1A 3W2VB 1HKAA 3DOKA 5F0WA 2RIJA 5HL7Q 1IBMF 3D6MB 4B3MF 4JI5J 2Q66A 3THPA 2M9KA 2YWWA 3PCOB 1T03B 3FQLA 3D2WA 3CIZA 1Q7YT 4U9RA 1F2GA 4CLWA 3RAXA 3TARA 3L95X 2CQIA 1RT6B 1C0UA 1N5SA 1IJEB 2BJ3A 2XHWA 3HSGA 2Z8QA 4LBPA 4DN9A 5KFJA 5LT5A 5IS2A 1Q8LA 4M8LA 1SH0A 4WFNQ 4XPCA 1CQNA 2XEXA 4FKYA 5CXTA 4LVOP 4ZIWA 3KG0A 1WNEA 5I42A 2HHUA 4PCQA 3ZTRA 1KC8T 1UCNA 1YJTA 4HR2A 2XLIA 2C22A 4HDHA 1WTBA 2GJFA 1WKJA 1KHVA 2B5JA 4EGLA 2PMHA 1RB0A 2YNIA 3BSNA 2B8PA 2CQDA 4YY3J 1S1WA 3EVOA 4CI0B 4LSZB 4H4MB 2VODA 1YITS 4ZLJA 4DV4J 2F4VJ 3RYLA 3TR5A 3VVUA 4W92B 2ACMA 1DY3A 1S99A 3QFHA 1BD6A 2HWHA 4ECUA 2FPHX 1N36F 2E9TA 5B0DA 1DLOB 2N4DA 2FC9A 2V68A 1XNQF 3QJJA 1SI9A 2B0GA 2GC8A 3QZ7A 4GC6A 4B3RJ 1X4EA 3HULA 2OH2A 2HGLA 5FDLA 3DXSX 3NGUA 2KI2A 1WOOA 3R6GB 1IXKA 4RR5A 3ILLA 4LR7A 4C8MA 2F8EX 3GJSB 4QU7A 1UEVA 1IWGA 2DGXA 2GNKA 4PRFA 4EZ6A 4A48A 1RDRA 1SIWB 3MM9B 4OYIA 2VG5B 2Z2YB 1QUPA 1VDHA 3P6YC 4K4VA 3AQOA 4PWDA 2ASJA 3GJQB 4OYWA 4PYAA 1YLXA 2OMOA 3BR9A 3QAUA 4WIIA 1N5YA 5KOXA 4OHYA 5AXMA 4LFAJ 3FNNA 3U02A 3M9NB 2YX1A 3OR1B 3A12A 1HIYA 1Y9OA 3B6BA 4WP3A 1YX2A 2YQ3A 4NA2A 1SXLA 5KFQA 2E7WA 4ES2A 4DV1J 3WBZA 4DUYJ 2RB7A 4ZPCA 3UNGC 4URSA 1IN0A 2ZNYA 2GA7A 2HK3A 5EWGA 4K4YA 4DUZJ 1NUEA 4C0BA 2OIHA 4RZRA 2XBPA 2MKIA 1WELA 3RW6A 1OO0B 4AT1B 3A8JA 3DDNA 3H42A 3MM5A 1HR0F 2MKHA 1KSPA 1OIAA 3K8WA 3NMRA 2CQ4A 2OD4A 2FLLA 4KV8A 2VKRA 1Y5NB 3IBCB 4WK1A 3TVZA 5E7OB 1NHVA 1DTQB 1R89A 3M8PB 4OX8A 4WPAA 5DDRC 3QO9B 4WU3A 4ZN1A 1HNVA 1FERA 1QJHA 1X4GA 3MM9A 1RTJA 5KOWA 3NGSA 2X51A 2YKNB 3HFKA 3R3TA 2Q1LA 5T7LA 2V4QA 2E9RX 4RW4A 1TELA 3LP0A 3NNHA 5J2PB 3VF0B 3VALA 3ILOA 1S6PA 1WC3A 4DU7A 1FWKA 2BE2B 4FS1A 4M5JA 4Y3CA 3TZZA 1GXLA 2JWNA 4C4WA 1X9MA 5EWFA 3WC2A 3DLBA 3IS9A 1D3WA 2HNDB 4DV3F 3A1YG 2HZVA 2ZH9A 5IC4B 1R6YA 2BJ8A 2R7TA 3SSRA 4ZA1A 1XK8A 1S6PB 4A8MP 1FXLA 1FXDA 3IAS9 2DPJA 2F65A 5KFFA 1YRTA 2IJRA 3A3OB 3KUEA 3M2VB 5KG5A 4NLSA 1FJGJ 1P8GA 5LOQA 4DR5J 4KT0C 1JLCB 4LF6F 2F5GA 2FHOB 3K57A 3HVRA 2LEBA 3ZZOA 2MGZA 2V6AA 3PEHA 4OYBA 1LOUA 3KLFB 2BABA 4HH1A 4P10A 4ZVTB 3MM7B 3OT9A 3UFCX 1O0PA 1S9EA 1M1KT 3VWSA 3FFIB 4ZCIA 4X4VA 3MEDA 4HHUA 1QY7A 5HP1A 2RU3A 1N0UA 4D3HA 3RRHA 2KTQA 1H2VZ 2CJQA 2MDAA 2BM1A 3MM7A 2DNZA 2GVDA 1VC5A 2NQPA 4LF5J 1D1UA 1HNXJ 5HROA 4I2QA 1M90T 5K14A 2AYGA 2YNFB 1UW9A 3O1LA 4LQ9A 4FYYB 3QAEA 3A8IA 3AODA 3BDEA 3ET6B 5B08A 5BYSA 3S8SA 3V81A 3JQMA 1U6ZA 2KJWA 2FGCA 1UKUA 1HBMA 5DQIA 2YWGA 2I5JB 1YBUA 3AY0A 1IKVB 2VB6A 3FKBA 1VI7A 3QGHA 4ZLPA 1NK0A 1NSAA 1PO6A 3B4DA 4YY3F 3P49B 2YVSA 3JTNA 2R7QA 1WD6A 3ZTQA 2ZD1A 4BWJA 4ER8A 5C24A 1HYSA 3OFFA 1CC7A 3ISZA 3M8QA 2V9KA 3CJ3A 3W2WA 4DV4F 1K0VA 4U8YA 1PSDA 3MM6A 4ECSA 3UD4P 5L39A 2GJIA 4MKBA 2MQPA 2QC3A 1GX6A 1S1VB 2BKNA 2MLZA 3BGUA 2RH3A 4RKUC 1RAFB 3HVTB 3M8WA 4USTA 3RG6A 3TP2A 4TQSA 1UWBB 4OZ3A 3TANA 5J1NA 4YUDA 2A2CA 1B7YB 2CQ3A 4M63A 2CNLB 4G1QB 3CDAA 2RQKA 3SCJE 2J5AA 3AOCA 4ZJOA 2KRRA 2HHQA 1QE1A 3ULHA 3I82A 2BEFA 1HBOA 4WJBA 5E3CA 1U09A 3CJKB 4QZVB 5FLXY 2XS7A 2EG1A 1JLGA 2W2QP 3MEEA 4NL5A 1FT8A 4MKAA 4M5MA 5J2NB 2KG0A 3BO4A 3T5LA 1TKXA 2IY5B 2Y1RI 1NEEA 1TMJA 3G86A 3GFYA 4O4GA 4OV6A 4UF4A 4UZCA 1SVDA 1X5OA 2W7PA 3TJ9A 4DCOB 5LJ5Y 2BACA 3L9ZA 1TK5A 3OHAA 4OL8A 1HHTP 2VONA 4A8YA 2IBKA 1TUWA 5F0UA 2PI5A 4V1Ak 2AF6A 2RRBA 2XNRA 2J8AA 4WFAQ 2WCXA 3VGTA 5F8LA 2E29A 3BEGB 1N5QA 2OUGA 2KN4A 1Z2ZA 2C3PA 3CJ2A 5CYQB 3IO1A 4Q43A 1FEEA 2M4MA 3DOLA 4O4RA 5A6WA 3AXKA 3CT9A 2DT9A 3GFHA 2CZVC 5KFDA 3VAJA 4R0JA 3NKYA 4H4KA 4PWWA 5CAAA 1SL2A 1T0TV 1TUVA 1TVRB 3JTPA 4DS4A 2MMYA 4OZLA 2XY5A 2QA1A 4WKYA 3KLFA 3TUJC 2BKPA 1MLAA 3I6PA 3N4WA 3HI9A 5F3TA 4USVA 2COLA 2ZKUA 2CG8A 1CJVA 2EEYA 1EAYC 2H5IB 3SZ2A 5H9FK 2DGTA 1DURA 2V2KA 2W2OP 2M5YA 2MY8A 1H6KX 3R5GA 4C11B 2YX7A 1W2BR 3BO2A 4RW9B 3X3UA 1H2UX 5G0RA 4JI7J 1HQUA 3O3LA 2RQ4A 2XSFA 4OHXA 1SL1A 1GQEA 4TY8B 3TA2A 4MMOA 2YNIB 3V6HA 4DS5A 1KQSR 2OSRA 1RGVA 2HG4A 3HD2A 4FVCA 1VRUB 1XQIA 2GFFA 2IMOA 2P9GA 3ONQA 4KGXB 5E3QA 4GO5X 1N56A 3OBIA 4ED0A 3H5UA 2N82B 1ITPA 2HHPA 3FC9A 1KOOA 2SXLA 4FF4A 1S1XA 2F9DA 1DAXA 3CDEA 4DG1A 2NREA 4O3NA 4IFVA 1F60B 1X7VA 4FYWB 2LQBA 3GIRA 1KEKA 5LMUJ 5IOLA 5KFUA 1I5OB 2GHVC 3GSDA 1ZS6A 3BV8A 4RW6A 4PUOA 2EXUA 5DETA 3CPWR 2CQGA 2A3JA 3HFZB 3PACA 4NLDA 4OLOA 1LXNA 1CJUA 4CO1A 2DXEA 3MR7A 2DNQA 3H2UB 4KBIA 4ZP7A 1X4HA 3HPOA 2DHAA 5HMWA 1HWJA 1DQ9A 1RAJA 2BOAA 3HD1A 3MECA 5DDPC 2G2OA 2Z56B 3I5CA 4IG0A 3TOQA 5KG4A 3CJSA 2BQ3A 2B9YA 3ZXWA 3CC4S 3PFEA 2I0XA 2NPFA 1GAOA 1SQFA 2ALZA 4KYZA 4ZCMA 3G87A 2DKOB 3W66A 3H8YA 2RQMA 1C1CA 2C3UA 1RWWB 2ABYA 2F9JA 4D3GA 3KJQB 5HBMB 3G96A 4X4QA 3PY8A 2DGOA 1RTDA 4MAKA 2QL5B 4WP9A 1HBOB 2LLZA 3DDKA 2QL7B 2RNEA 1BQNA 2OPSA 5CQGA 4DFPA 2AGPA 1YBAA 1NJWA 1QVGR 1K1QA 3NG8A 3W62A 5DG9A 1X4BA 2OTJS 5C25A 2VG5A 1SBRA 3US5A 1FRMA 1IJFB 3HHLC 1NSQA 4P9SA 3EX7B 3DNCA 3PW5A 3WX8A 1FFGB 3FSXA 4JI8F 2ACYA 4URQU 2K3KA 1NM2A 2XTJP 2WZ1A 3NCRA 2R8GA 2ZBPA 4OYZA 3T9ZA 3AD7C 3THVA 4LRDA 2L9DA 2OEMA 3TAQA 4J9KA 2VFUA 3U7JA 3W8PA 2CPJA 1URNA 3M1VA 2Z0GA 2HFSA 3SCKE 5A76A 2DITA 4X64F 2EG2A 3SQGA 2M8DB 1SUQA 1PYSB 3PR5B 1RAIB 2GV1A 2D7SA 1S6QA 1X9SA 2B8QA 1OMSA 4CZCA 3G8QA 4ECTA 1IQZA 1FTRA 4KPYA 2CQ0A 1KTVA 4ILMA 3HVAA 1IR2A 4X65J 2ZBIA 1RHRB 3QZ8A 2Q6BA 1M0SA 4WKRA 3R97A 1MN7A 1BLUA 2XSJA 1S1WB 2AKWB 2B4PA 2GVZA 3JYTA 1TP7A 1T9YA 5CYQA 5KT7A 2HYIB 2I9SA 4MK9A 4KE5A 3GV7B 1JK9B 1VISA 4TU9A 4GKKJ 1CJKA 4JI6F 1SB6A 5I3UA 5G4DA 2XY6A 3MDFA 4AUKA 3H4DA 2XMVA 3FK4A 5CYMB 1MMDA 4LF4J 3PV8A 2E1PA 4ZHRA 1C0TA 2QJ3A 4ZCLA 5E41A 1ZTTA 2C28A 4FBTA 2JLGA 4KIAA 3CCQS 4FDFA 1V6HA 4OX7A 4JV5J 2NXNA 2KZZA 3D6TB 1YQHA 5CH7B 1FE4A 2V69A 4OZ2A 4V19X 4JI3F 1RAEB 4F4AA 4K5SA 1GTHA 3MR6A 2YKQA 1QAJA 4ZVRB 1S49A 4YHHJ 4N76A 2D3UA 4Q44A 3I87A 4U6PA 4B9NA 1VS3A 1YRXA 2BRLA 4PQUB 3CD6S 1G7CB 4P2SA 1MN9A 1HI0P 2ZM6F 2V67A 3UD5A 4KRWA 3KYLA 1N48A 3PO4A 4AXJA 5CD4A 4RPFA 4F3MA 4GO7X 4TU7A 5B0FA 2OPPB 4NCBA 3TUIC 1M1HA 3HHLD 4H4OA 3EVMA 3QNWB 2QA2A 4UOHA 1W26A 5KFIA 3UNYA 1PJ6A 4FXVA 2NSCA 5HMZA 2AEMA 2MKCA 4O0NA 3FEYB 3GJRB 4DV7F 3D0GE 2UUTA 2H5JB 2OPQB 1KRPA 4JI2J 2CAJA 4F8RA 1BUXA 4ZVUB 4C8OA 3EGZA 3C46A 4ZITA 2VUGA 1BWEA 3MECB 3V2UC 5M2UA 3ET6A 1HNXF 1IKYA 3J7Z5 4P52A 1HBNB 4ED7A 1HW9A 2QGFB 5AE2A 1JX4A 2R8KA 3ISNC 3FRYA 1TL3B 5AE1A 2QIFA 1SKRA 3CJ5A 1T9VA 2CXEA 1CVJA 2BX6A 3ETMA 4L75A 2ROGA 4EWTA 2RDIA 3IBFB 3QSIA 1KNZA 4ECYA 4C97A 4LR9A 4YB6A 3MR2A 1TKXB 5K8MA 4RUCA 2H65B 1Q78A 2ZH8A 1S7IA 1SQGA 2DHHA 5D0GA 1S10A 2EI5A 4B9UA 3NNCA 4USHA 2JSXA 3ICLA 3R2CJ 3PHEA 3TJ8A 3GG1A 2QZ8A 2XLJA 1RKJA 1VRUA 4DR7F 1S76D 2C2KB 2Z58B 4G1PA 4PG6A 5ETKA 2RDDA 1H38A 1G1XA 2Z2ZA 4KAIA 1NSPA 1RT7A 2CYYA 3HHKA 5HLFB 1MU2A 5KFKA 2BJ1A 2MLYA 2KL8A 3IM8A 4KO0B 1OPZA 2W9AA 1XTZA 1JLQB 1W2IA 2BM0A 3CMAS 4O0IA 3GIIA 4QYRA 2YPZA 4LFAF 5E3RA 1OY6A 2KDOA 2EBEA 1CS4B 1RT1A 2Q6CA 2ROEA 4HH0A 3UD3P 1UETA 3EZ5A 5CZXA 6AT1B 4IRKA 2FZCB 1Y3JA 3MMCB 4P7TA 4B17A 1TU0B 2RHSB 3BR8A 4XDDA 1TVRA 2RRAA 3CDWA 5KFAA 1NJXA 4Q8FA 2NSBA 5BXIA 3BREA 1XEZA 4GVBB 4DSKA 2MQLA 4M5DB 3UN3A 3RBEA 1LWFB 2B6AB 2VG7A 5DG7A 2FIUA 3OTCA 5T7LB 2KVQE 3S1TA 4CQ1A 3N28A 3V81B 2FLPA 4QYZJ 2NS1B 2HHSA 1RWUA 5E33A 3KLGB 4ED3A 5IV4A 4XIUA 1X60A 5K9FA 1XC9A 3DLGB 3DRPA 2JEGA 2MHEA 3QPIA 4LF9F 5DJBA 2JJ4D 4YB5A 3ENVA 5KAKA 2MSTA 3MGJA 2AQ4A 1RI7A 4PXDA 2GVZB 3KHRA 4ECQA 2U2FA 4LF5F 2ZBQA 4PXEA 3CD0A 4GMKA 1KKHA 1D9FA 3MUVP 2FTRA 4RW7A 1CJTA 1WKLA 2HURA 3MPDA 2RE1A 1ZZNA 3OTOF 4ZIVA 1S1XB 1RADB 2I8EA 2HMIB 2HFZA 2ZHAA 2D1CA 1ULRA 2VA3A 3KLHA 4DSEA 4M5HA 5J2NA 1VQ6S 2VHGA 2F4FA 4NEZA 3TAPA 3R9LA 3I5AA 4L73A 2BJ9A 4X4PA 5GAEU 3SFGA 2HEKA 1ZA2B 4O3PA 3TA1A 3OD2A 1NXIA 3MTKA 1FDNA 4J9OA 2CVEA 2RMLA 1TL5A 3LTOA 2R7RA 4C8LA 4PWUA 4TYBA 1QTMA 1EX8A 1LWXA 3OVSA 4NRUA 4J9LA 2ZHOA 5KFYA 2VD3A 4MKYA 1R8HA 4RX6A 2J6UA 3IFEA 3EXYA 3SSSA 4JI4J 3Q8YA 3N01A 3UCUP 2K7KA 3C14A 5J2MB 2E9ZA 1RTHA 1WEYA 2DNLA 5DM6Q 4CIOA 2BR0A 3PW7A 2E5LF 2H51B 4HTIA 2CRLA 4NE9C 3UDCA 3BBBA 4A8XA 5A0YB 3MAAA 2B4UA 3GB0A 3T1YJ 2B9WA 3HHLA 4I7FB 2UUBJ 2ZOMA 1JLEB 1UJ5A 2WOMB 3BJYA 2CIMA 3C2PA 1SJRA 4WFZA 5EX0A 3KK1B 2NXEA 3KLVA 2DIUA 2G0JA 1FRXA 3DKDA 4DLGA 3J7AN 2B5JB 2WB1D 2XULA 3RB3A 1FWPA 1Q8IA 2OD6A 2WVEA 2FGOA 4PG5A 2QE5A 1WG4A 5DRKA 2FHJA 4QW9A 2CPEA 4WFBQ 1MROA 1TKTA 2PDAA 1N6QB 1NH7A 2VICA 5K8PA 2FC8A 4PUOB 2MZTA 2QA4G 2C2MB 1FDDA 2M2BA 4X4SA 4KGKA 3Q8RB 3CMES 4B3OB 4OI4A 2BV3A 2Z57B 3IN5A 5L1LA 3M4XA 1D8ZA 2QO3A 1YJNS 1N6QA 4K4UA 2VBWA 1WHXA 4FXDA 4URGA 1QE1B 4HHJA 4J7CA 3PXGa 4DXLA 3GSIA 5B0GA 1REVB 1S1TA 3G71S 3P8BB 3EGNA 2R2SA 1KDNA 3LQVA 3CGIA 2ZH1A 1UTAA 3C8YA 3W2VA 2GMJA 2XNQA 3GFXA 1RU1A 2WTFA 1SPBP 4K2XA 2XMAA 3M9MB 3V6JA 2W4CA 1LWFA 2B6AA 2VG7B 4CO5A 2GW8A 1QSYA 1GXTA 6FD1A 3C3LA 5IC6B 2DO4A 3TZXA 1HMVA 1ROFA 2KJVA 5EX3A 2C2ZB 1IBCB 4FP9A 5D15A 4YN3B 3LGNA 5IT4A 3UPFA 2XO6A 2ZH7A 2HS4A 2P6SA 3J81U 3CCLS 1V9OA 1YVFA 4UOCA 3IR6B 3F44A 2R8JA 1H7WA 4MFBA 1VFJA 4DSLA 1RISA 3QYYA 3FQKA 5BYQA 4PG7A 3KJNB 3EPIA 5LMNJ 1IKVA 3DYAA 3PHTA 1PYOB 1VRTB 4WTOB 4DV0F 3D3BJ 2IM0A 2LA4A 2PE8A 2BJDA 3BKUA 1NKBA 3L7PA 4B3RF 2YKNA 3E51A 3G6YA 4Y6IA 2HHTA 1R8AA 4N77A 1VQMS 2JFDA 3NGDA 5LL6d 4XDCA 4NZ6A 1FI4A 4J37A 3Q22A 2E7VA 3UE2A 1UZHA 2Z2MA 3VAKA 2FQQB 1Q53A 5IZHA 3PTWA 1IBLF 2ZJRQ 4NMLA 3JQJA 2HMIA 3EZOA 3ZC4A 3VV2B 1NRKA 2MY7A 4NCGB 1NHUA 3NWGA 4ALZA 2CPZA 2LDYA 1VQYA 1T11A 2LFVA 3P3DA 5KG1A 4BC9A 2AJ0A 4NLXA 4ED8A 4FN5A 4O4GB 3TO8A 1S0MA 2LU1A 4C7QA 1RQ0A 3V5RA 1T8EA 2CADA 5I3UB 1NB2A 1KVIA 3NBPA 5C7PA 3TQEA 1ZH5A 1JLGB 2DNMA 1QM9A 2CG4A 4F67A 1UVMA 2MGZB 2FJAB 2QTWA 1ZBTA 4IUFA 4DPYA 1AZSB 3CD5A 1JLFB 2HNZA 4YOEA 5F8HA 1N4LA 3EE3A 1N32J 2G0IA 2LQ9A 3H20A 1VQLS 3IGVA 1WHWA 1F3VA 1DARA 3CW2C 2GHWA 1JXEA 1PJ7A 2OPQA 3BBCA 5HI7A 1ZAVA 3KLEA 4J9SA 2HWIA 3GJTB 3V6DA 4P2FA 2K3IA 3TI0A 1B7FA 3W9IA 3NY0A 4TQRA 3BGLA 3MF5A 4OHZA 5IV3A 1J5EF 1Q95G 2HVZA 1SC1B 2LU2A 2OPSB 2VPYB 5DS7A 3BZQA 3POTA 3I4HX 2W4DA 3CCTA 2IAJA 3MEGB 5JVHQ 4EEYA 4EO8A 4NLVA 5JMNA 4NXMJ 2FVQA 4JYAF 2JEIA 2VKZG 4IR1A 1KQFB 3H7HB 3LALA 2LQ5A 1XR6A 2OEKA 1UVLA 1RHJB 1WF2A 3PYDA 3P5BP 3RUBL 4H4MA 1E6VB 1VBKA 4USJC 1X4AA 4WK3A 3JSRA 1K44A 4PAAA 5DLGA 2OTLS 1FE0A 2AX1A 3QIDA 4OMFG 4ZK7M 3MFIA 3D3CJ 4FF2A 1H7XA 5HVFA 1R0BG 1OS5A 3N79A 2UXCF 4TYAA 2FYXA 5IQQA 3OUYB 3T5HA 5KFZA 2B51A 1N5VA 3N9UC 1A7GE 2OPRB 3C6TA 3C6UA 3CNQP 3ZTPA 5ITHA 2V9WA 4ELVA 3SMZA 4F02A 1PCAA 1WC4A 2M52A 1B3TA 3VCDA 4CM0A 1GMWD 4IQXA 2ZKTA 5CD4H
chains in the Genus database with same CATH topology
1CS4A 3ET6B 1YBUA 5D0GA 4CLKA 5D0HA 2GVDB 4CLPA 3C16A 4WP9A 4OYPA 1U0HB 3UVJA 4NI2A 4USTA 4OZ3A 1CJUB 2WZ1A 4OYZA 5D15A 1YK9A 4OYIA 1CS4B 4OYWA 3C15B 4CM2A 1AB8A 4WP3A 1U0HA 1Y10A 1WC1A 1CJVB 3C14B 2GVZA 5IV4A 1WC5A 4CLFA 3MAAB 1CJKA 4OYOA 4CLYA 2W01A 2GVZB 4P2MA 4WPAA 4USWA 1CJTA 1WC6A 1FX2A 1CULB 1CJKB 3G82A 4USUA 3UVJB 4OYXA 4OZ2A 1WC3A 1CJTB 4CLTA 1AZSB 5D0EA 3C15A 4USVA 2BW7A 1CJVA 1TL7B 1YBTA 1Y11A 3R5GA 4OYAA 4P2XA 4P2FA 1WC0A 1CULA 5IV3A 1TL7A 4WP8A 3C14A 4OYBA 1AZSA 5D0RA 4OYMA 4CLLA 4CLWA 3G82B 3MAAA 4CLUA 1FX4A 4CLZA 3ET6A 2GVDA 2QV6A 3C16B 4NI2B 1CJUA 3MR7A 4CLSA 1WC4A 4CM0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CS4 A;  3ET6 B;  1YBU A;  5D0G A;  4CLK A;  5D0H A;  2GVD B;  4CLP A;  3C16 A;  4WP9 A;  4OYP A;  1U0H B;  3UVJ A;  4NI2 A;  4UST A;  4OZ3 A;  1CJU B;  2WZ1 A;  4OYZ A;  5D15 A;  1YK9 A;  4OYI A;  1CS4 B;  4OYW A;  3C15 B;  4CM2 A;  1AB8 A;  4WP3 A;  1U0H A;  1Y10 A;  1WC1 A;  1CJV B;  3C14 B;  2GVZ A;  5IV4 A;  1WC5 A;  4CLF A;  3MAA B;  1CJK A;  4OYO A;  4CLY A;  2W01 A;  2GVZ B;  4P2M A;  4WPA A;  4USW A;  1CJT A;  1WC6 A;  1FX2 A;  1CUL B;  1CJK B;  3G82 A;  4USU A;  3UVJ B;  4OYX A;  4OZ2 A;  1WC3 A;  1CJT B;  4CLT A;  1AZS B;  5D0E A;  3C15 A;  4USV A;  2BW7 A;  1CJV A;  1TL7 B;  1YBT A;  1Y11 A;  3R5G A;  4OYA A;  4P2X A;  4P2F A;  1WC0 A;  1CUL A;  5IV3 A;  1TL7 A;  4WP8 A;  3C14 A;  4OYB A;  1AZS A;  5D0R A;  4OYM A;  4CLL A;  4CLW A;  3G82 B;  3MAA A;  4CLU A;  1FX4 A;  4CLZ A;  3ET6 A;  2GVD A;  2QV6 A;  3C16 B;  4NI2 B;  1CJU A;  3MR7 A;  4CLS A;  1WC4 A;  4CM0 A; 
#chains in the Genus database with same CATH topology
 2DR7 A;  4F3O A;  2ALY B;  2JC0 A;  2RDJ A;  1SV5 A;  4JOU A;  2XC9 A;  4CYU A;  1TL1 A;  1XN9 A;  1MRO B;  4QR0 A;  3OR1 A;  1UFL A;  4X4O A;  3VHQ A;  1VC6 A;  2FHK A;  5DDO C;  5GMD A;  5GAH U;  3RR7 A;  1ZTW A;  8RUC A;  1BE4 A;  1IKY B;  1FRK A;  2C2N A;  4CLP A;  1HWK A;  2K1R B;  3JAM U;  5I3P A;  4ES3 A;  3GV5 B;  2D3O 1;  2C42 A;  4OYP A;  2YH1 A;  1U48 A;  1U0H B;  4KGV B;  2XMJ A;  4DV6 F;  3PYF A;  3EYZ A;  3K5N A;  5D4L A;  4YHH F;  3V4I B;  1X9W A;  1JXL A;  1UVK A;  3DLK B;  4NI2 A;  3NGR A;  2IC3 A;  3M6X A;  4HI1 A;  3OSN A;  4ZVQ B;  3QRP A;  3BB5 A;  3ELH A;  1FKO B;  2W2N P;  3TUP A;  2CFX A;  4DR1 J;  3HK2 A;  1BY9 A;  1U7L A;  2ZC3 A;  1GK8 A;  2F8M A;  4P71 A;  2QFI A;  3C15 B;  3T1H J;  3W9J A;  5T41 A;  2BAN A;  2DR6 A;  2IC3 B;  4BDP A;  2CPF A;  4U7C A;  5SZT A;  1UZD A;  4EBC A;  5J2P A;  2HBZ B;  1L3S A;  5KTQ A;  3PZP A;  1S0N A;  2NXJ A;  4FF3 A;  1U0H A;  3ADA C;  5M2R A;  4UZB A;  3CO9 A;  2EKY A;  1FHT A;  1EB0 A;  3RAM A;  4J9Q A;  1HW8 A;  4J9U E;  2G13 A;  1KLM A;  4U95 A;  3I9Z A;  2XZD B;  1JLA B;  1SKS A;  1U6B A;  3IWX A;  1CBK A;  2IVM A;  4R25 A;  2P2C B;  3G6V A;  1RTI B;  5IT0 A;  2UV8 A;  4OYO A;  4ENO A;  1U1R A;  4OI1 A;  4A47 A;  4DEZ A;  2RF2 A;  2R8I A;  4Q0B B;  4LFB J;  3MOZ A;  1WDD A;  2Z30 B;  3ZNU A;  5K20 B;  4EMD A;  4UUW A;  4DWI A;  4TXS A;  5KFW A;  1LNQ A;  3IBW A;  4ZVS B;  4AQY J;  1CJK B;  4NLR A;  2MEW A;  4N8N A;  2DY1 A;  2E5G A;  4JB8 B;  3UVJ B;  2FD2 A;  5F8G A;  5KFH A;  4DF8 A;  3PX0 A;  3D28 A;  2VFS A;  2X3G A;  3OXF A;  5KG6 A;  1ZYQ A;  2UVU A;  4X4R A;  1NBE B;  1VBY A;  4X84 A;  3W5Z A;  4QQB A;  2YNH A;  4UOG A;  3V6K A;  3FUY A;  5F8J A;  4G1Q A;  3QRQ A;  5E3A A;  1QVF R;  2GZO A;  3H0P A;  1N0V C;  4E8U A;  3Q8U A;  4ZVG A;  1OYE A;  2W2P P;  2I2Y A;  4CNY A;  2R7V A;  4Z37 A;  3BGR B;  1QTN B;  1NND A;  1YWX A;  3BKF A;  3D5M A;  3HLU A;  4FYV B;  4GVB A;  4LVN P;  2Y1I A;  2H4W B;  3D6F B;  4UY8 5;  4DUT A;  2QEX S;  4IH6 A;  5KG3 A;  3GP9 A;  1YRU A;  3FMB A;  1S0O A;  2WON A;  3CE8 A;  4CH1 A;  2MPU A;  4OX9 F;  4AQY F;  3MMB A;  4B3M J;  3M6V A;  4JI5 F;  1WSR A;  4LF8 J;  2XMT A;  4DV2 J;  4WF9 Q;  1D8Y A;  4NYZ A;  3D6H B;  1I94 F;  4JV5 F;  2UUC F;  5IM0 A;  1DQ8 A;  1PBA A;  1MU2 B;  2WB4 A;  2RS8 A;  3N6M A;  1HNZ J;  3HVT A;  4CH0 S;  4BHQ A;  3CC7 S;  2B9X A;  4MIW A;  2MYF A;  1PIL A;  2CZ9 A;  3CJ0 A;  4HL9 A;  1R8P A;  4O3S A;  2MKJ A;  1JLF A;  2HNZ B;  3OJU A;  2E1A A;  4KTQ A;  3KFW X;  1OJ4 A;  2HBQ B;  3GIK A;  2G1D A;  2ZD1 B;  4NXN J;  4GVL A;  1HAR A;  3JSB A;  3NBP B;  3S7R A;  4AL7 A;  1Q82 T;  5CAB A;  1FES A;  1TV6 B;  4LF8 F;  2PN6 A;  1XJW B;  4CCH A;  1B0T A;  4KSE B;  2DTJ A;  2DGV A;  3QGG A;  2FLN A;  2V50 A;  5GAD U;  4ZP9 A;  4JV2 A;  2DHS A;  3LPE A;  1RSC A;  4K2J A;  3VAM A;  3CMQ A;  4LSL B;  4ANC A;  4DR7 J;  1A9N B;  1IBK F;  1BMQ B;  2H9Z A;  1WG5 A;  2OJ3 A;  3T5J A;  3M32 B;  1U1N A;  4F4K A;  1DFD A;  2GVD B;  1RT3 B;  1NPR A;  1HBN A;  1WWH A;  4KKO A;  4LT6 A;  1IBL J;  2KKH A;  3HF5 A;  3M6U A;  2RKI B;  2RIL A;  3M8R A;  4ETZ A;  2XMM A;  4A8O A;  2AJQ A;  3KOA A;  1SQE A;  1NJZ A;  1AXQ A;  1H3D A;  2KFZ A;  1UMJ A;  1NME B;  2XO7 A;  5CZV A;  4IH5 A;  3FGV A;  3A8E A;  5DG8 A;  5A8W A;  4X65 F;  4P74 A;  1O8B A;  3MMC A;  1HI1 A;  1SUQ B;  1HBU A;  5KFN A;  1T7P A;  1JLA A;  2J7K A;  3C66 A;  1JB0 C;  1YIJ S;  2KZM A;  2BKO A;  1VJQ A;  1U2F A;  4OZ0 A;  1NSK L;  4LR8 A;  1HNW F;  5HMX A;  3J80 Y;  4LJM A;  1KR4 A;  3GYN A;  2XB2 D;  3AJD A;  4V19 J;  3LP0 B;  1PJ5 A;  1H2T Z;  4DI6 A;  4LUB A;  4DR1 F;  1Q81 T;  4KY3 A;  3F41 A;  3BYP A;  2RS2 A;  4FS2 A;  1U1L A;  3KXD A;  4XPE A;  4KQZ A;  3H4B A;  2ZWO A;  4QJV A;  4DL6 A;  2ZZM A;  1PAE X;  4ID8 A;  1XR7 A;  3MM8 A;  1WC1 A;  3D0H E;  2V8P A;  2AU0 A;  1VQK S;  3GYG A;  5B0C A;  4KV8 B;  2XYP B;  4UUX A;  1KFS A;  3W2W B;  2XGP A;  2DNN A;  1S5Z A;  2OGU A;  3NCP A;  2QMW A;  2CQP A;  1U8S A;  2Y0S D;  4KHM A;  2QLF B;  1LWE A;  3PRB A;  2N3L A;  2QLB B;  4FKX A;  3DGP A;  1N32 F;  5THW A;  1WI6 A;  2DH8 A;  4QU6 A;  2A0F B;  3SQO P;  2DHX A;  4RW4 B;  4DQP A;  1U8W A;  2BUN A;  1P9Q C;  2E1R A;  1HL6 A;  1S12 A;  4P2M A;  4XK8 C;  4N8O A;  4DQS A;  4AL5 A;  4USW A;  3K17 A;  4IFY B;  1YDL A;  5CHC B;  3U1M A;  3PX4 A;  1WC6 A;  1MSW D;  1CUL B;  3R5A A;  1EAR A;  2QT7 A;  3DCA A;  4WE1 B;  4YB7 A;  1AA1 B;  1BQM A;  1FNO A;  2GCF A;  4I2Q B;  1Q4R A;  1VGY A;  1XR5 A;  2W2M P;  3QGI A;  2DYA A;  1J5O A;  2IMW P;  2F4V F;  4RW6 B;  4PWD B;  2KXF A;  7AT1 B;  5D78 A;  1EJ7 L;  3MMJ A;  4FXW A;  3BPD A;  2QRR A;  2GIR A;  5F41 A;  3ZZP A;  3HHL B;  5HQ8 A;  2RF2 B;  2JVO A;  3CCJ S;  3H25 A;  4IFV B;  5LMN F;  3BDP A;  1RWN B;  2NYI A;  4F4X A;  4DSI A;  4JI4 F;  2DIV A;  1TKZ A;  3WX4 A;  1S77 D;  1LWE B;  3H5Y A;  3NLC A;  3O5T B;  3Q8V A;  5DZ6 A;  3JAM Y;  1Q5Y A;  2J6T A;  2UP1 A;  4PG8 A;  1RJJ A;  2D9P A;  3SDE B;  1TKD A;  2BA9 A;  4X62 J;  2MZR A;  1Q8B A;  3R7N B;  3T1Y F;  1E6V A;  3FZ2 A;  2HVI A;  2JEF A;  1W25 A;  2OO4 A;  4AL6 A;  4I67 A;  2HNY A;  2HFU A;  2O5D A;  2D9O A;  2N4C A;  1WKK A;  2BMB A;  2LMI A;  1Q0N A;  5L46 A;  4CLU A;  2DO0 A;  2YY3 A;  3QRR A;  4BBY A;  3GPA A;  4XTT A;  4IG3 B;  5KFM A;  2WVB A;  3X1L B;  1S97 A;  5FDL B;  2GJ2 A;  3WC0 A;  5C25 B;  3IXQ A;  3TNV A;  3B8H A;  2XYG B;  4DL4 A;  2XG8 A;  2GHP A;  4EUV A;  1T3N A;  2ZEJ A;  4DR5 F;  2KO1 A;  1C1B B;  4A46 A;  1X5S A;  1VQO S;  1AT1 B;  2BXJ A;  3EDQ B;  3T41 A;  1HMV B;  2M0G B;  4RBU A;  1N33 F;  1PG5 B;  1NPP A;  1P27 B;  2LYV A;  2U1A A;  3W9H A;  3QGP A;  3L3C A;  5DO2 A;  2FJX A;  1SC6 A;  3EGW B;  1UA1 A;  1KON A;  1VLO A;  4M5N A;  1RWX B;  4IOB A;  3M30 A;  2NPI A;  3Q83 A;  3HT3 A;  5MAO A;  4OJ3 A;  3I0S A;  1RYR A;  1RT6 A;  4TU8 A;  4IDK B;  2IVY A;  1SH2 A;  1QDU B;  1XWL A;  2MSS A;  4NOH A;  1BHN A;  1T03 A;  1FF2 A;  1R8C A;  4HAC A;  4P6Q A;  2OFG X;  2LQJ A;  3LWM A;  1HQE A;  1FRH A;  2QMX A;  2JOQ A;  5F9N A;  1J5E J;  1M1G A;  2C2R A;  2AZ3 A;  3OLB A;  3SEO A;  4IR9 A;  2NCK L;  4DHV A;  3IMQ J;  3MED B;  4OHW A;  5HP1 B;  4KHR A;  2DEI A;  1IUJ A;  2IDL A;  1XMQ F;  3R2D J;  4WZQ A;  2UU9 F;  1B0V A;  3LP2 A;  2OP5 A;  2CPI A;  2CKW A;  3Q0A A;  3SQG B;  1B70 B;  2DH9 A;  3DRR A;  1R6V A;  1ZM2 A;  1UWA A;  4DCJ B;  1YK9 A;  1T9U A;  5ETT A;  3UW1 A;  2KM8 C;  4YFU A;  4ILL A;  2LEA A;  2MZJ A;  2ZZN A;  3W60 A;  4A4J A;  1RBA A;  3MXH P;  2YNG A;  2FVP A;  2GML A;  1JLQ A;  3KDO A;  4DCP B;  2YWH A;  1U45 A;  3HSJ A;  3TEH B;  4ATN A;  3MPW A;  3GQC A;  1KLN A;  1WF1 A;  5G0R B;  3I56 S;  1FKA F;  3ETO A;  2MQN A;  3RBD A;  3KWM A;  3DM2 A;  3EMT A;  2HSE B;  2HZC A;  3IS9 B;  2BAN B;  3LW5 C;  1RCO B;  1CJV B;  3CCV S;  2WVD A;  1RT4 B;  1BQN B;  3C14 B;  1NDL A;  3ILJ A;  5JVG Q;  1LFP A;  1WC5 A;  1CC8 A;  4UW2 A;  1BWV A;  1F5C A;  1FVQ A;  1U1Q A;  4PAB A;  3GYX B;  4IYQ A;  1OPI A;  1FDB A;  2KT2 A;  1VBX A;  2LXI A;  2FHJ D;  1VQ4 S;  3UO0 A;  1XIQ A;  2K1R A;  4DPW A;  4K50 A;  2IRY A;  1RT2 B;  2YNH B;  1U0S A;  2DNY A;  2L48 A;  3R5B A;  3R6L B;  1MW7 A;  1O6X A;  2WHO A;  4LRB A;  1GMU A;  1S72 S;  4B9T A;  2DCL A;  3OFH A;  2CVI A;  2LDI A;  2UUW A;  1HFE L;  3TWZ A;  3KHH A;  2AYB A;  2FJE B;  3LGH A;  1P1L A;  4IFY A;  1F0X A;  4LRC A;  1XER A;  2CNO B;  3CCM S;  4Y00 A;  2VFT A;  1GH8 A;  3KG1 A;  3PM9 A;  4Q0B A;  5EUH A;  1TL7 B;  1Y11 A;  4XO0 A;  1RTZ A;  2ZOG A;  1IM6 A;  2RQC A;  3Q2T C;  4S0M A;  1RWP B;  1S4F A;  2WRM A;  2B7B B;  4P2X A;  4EI2 A;  5AJ3 J;  1J27 A;  1X4C A;  2P5V A;  3BPS P;  4HAC B;  3DRX A;  1HLW A;  1RLC L;  4L6V 3;  1G3O A;  1WI8 A;  4QBU A;  1HNI A;  1RUS A;  1N8R T;  1RAG B;  3OXL A;  2R4F A;  3FBF A;  3GFZ A;  4PKD B;  3KLG A;  3BSC A;  1XNR F;  1T05 B;  4Q45 A;  3AH6 A;  3KLI B;  2V5H G;  2MB0 B;  2ZHB A;  4W98 A;  1LKZ A;  3E8O A;  4ANE A;  4ZPD A;  1JJ4 A;  3H2L A;  1F9H A;  1KWM A;  5J1P A;  4A8Q A;  4GKJ F;  1FX4 A;  2BJE A;  3RAQ A;  2ZIT A;  1RTH B;  5GMK a;  2X1G A;  3POT B;  2HQC A;  4QIW D;  3BO3 A;  1F9E B;  1X31 C;  2KU7 A;  2R7S A;  5H9F J;  5KFO A;  1Q8K A;  3CF5 Q;  2AYE A;  3AA9 A;  3OL9 A;  1PKU A;  4TKT A;  3PW0 A;  1NK8 A;  5A8W B;  2EBG A;  5C24 B;  4HEA 9;  3M2R A;  1C2P A;  4JUZ A;  2I5J A;  5DDQ C;  2W1B A;  2VFV A;  4CT8 A;  1WUU A;  1JNR B;  3U1L A;  1VOM A;  5HVH A;  1YJ9 S;  2YH0 A;  4C8Z A;  1V5V A;  1F3F A;  4U7U K;  2PD1 A;  2F63 A;  3VZI A;  2BE9 B;  4JI0 J;  2A6O A;  1A0O B;  2B56 A;  2DNR A;  3Q8P B;  4CO0 A;  3W8G A;  4RNF A;  5B7W A;  1RE1 B;  3NOG A;  3QLH B;  3MZI A;  4WWS A;  4ZVH A;  1DRZ A;  2GS8 A;  2PGC A;  4Q8E A;  4HVZ A;  3HP6 A;  1TL1 B;  2KVI A;  2PA3 A;  1UVJ A;  3M2U B;  2HW3 A;  1YJU A;  3FFI A;  3H5S A;  1TV6 A;  3F73 A;  2XS5 A;  3NOC A;  4O23 A;  5BYR A;  4HTJ A;  1Q16 B;  3QLH A;  4CRJ A;  4DV0 J;  4FZV A;  2HQI A;  1LQ9 A;  1WDT A;  3CJ4 A;  5B0B A;  3RTV A;  3PJ9 A;  1S1U A;  4TLQ A;  4KH1 B;  4NA1 A;  2QLJ B;  3CDU A;  1RAC B;  4IO9 Q;  1RT2 A;  4OI6 A;  4ZVF A;  3W5Y A;  1R31 A;  1N36 J;  3GZ7 A;  3IRX A;  3HJF A;  1X8D A;  2HVE A;  1X4F A;  4I64 A;  4MT1 A;  3KK3 B;  4Q2L A;  4N7T A;  1AB8 A;  4QW8 A;  1YKW A;  2IRU A;  3RJM B;  2VF3 A;  3G8S A;  3KUH A;  3DI6 A;  3MCN A;  2VDH A;  3VR1 A;  4CO2 A;  5DQG A;  1RHK B;  1M5V C;  4X4N A;  2V0N A;  4MFB B;  4O44 B;  5GAE I;  1HNZ F;  1VK3 A;  1TZ0 A;  1FDA A;  1Y0H A;  3VGS A;  4N56 A;  1FVS A;  2BYC A;  2GQC A;  1FD2 A;  2GAH C;  1FKO A;  2MQ8 A;  1IBK J;  2DBB A;  4PG4 A;  1C1C B;  1GT8 A;  2AW0 A;  2MKY A;  3IGN A;  3EVW A;  5HLF A;  3UR3 C;  4B08 A;  1S0V A;  1O51 A;  2K2P A;  3D66 A;  2O66 A;  3QT6 A;  2JDJ A;  1TFY A;  3KLI A;  1L3V A;  1RT5 A;  1LW0 B;  1WOR A;  3OVB A;  1H73 A;  2FJV A;  2GQQ A;  1K73 T;  5B0A A;  2KG1 A;  2AIR B;  1WHY A;  1KBR A;  4WZM A;  3ITH B;  4RNH A;  1KN6 A;  1FJG F;  4DR4 F;  1QUV A;  1S4E A;  1SC3 B;  4W4M A;  1WHV A;  3AFG A;  2UV8 G;  4IKA A;  2W9B A;  4ED4 A;  4RNO A;  3FJ2 A;  2JLF A;  3UDE A;  4KJI A;  2X3D A;  5IFM A;  2BE7 D;  2ASY A;  4B3O A;  2BW7 A;  2WW4 A;  5A6P A;  1T9X A;  3OR2 B;  2ZM6 J;  3BSO A;  1KTQ A;  2X1B A;  4G3I A;  2DNH A;  3EJM A;  2E66 A;  3HT0 A;  4KGZ B;  4NLW A;  3U27 A;  1Z4U A;  1SJ3 P;  3K0J A;  3DRY A;  2QMU B;  1FD8 A;  2CPD A;  2MTL A;  4ZPT R;  1SCJ B;  2VG6 A;  4NRT A;  3TX8 A;  5HMY A;  2AHO B;  3MPV A;  2H48 B;  1UPP A;  4JV0 A;  1KLM B;  2A18 A;  3I0S B;  4C8N A;  3BQ2 A;  1R0A B;  5EN1 A;  2VC0 A;  3KNG A;  3LF0 A;  5C42 B;  3L4B C;  5CA5 A;  5DQH A;  1KS2 A;  1SL0 A;  4KHP J;  2UXD J;  2BW2 A;  2VV5 A;  3KK1 A;  3MOJ B;  1HQU B;  1CG2 A;  2E5I A;  4C8K A;  3GIM A;  3PEJ A;  3BN7 A;  4U67 Q;  4J9M A;  1G6B A;  3NXZ A;  3TRG A;  4A8S A;  2XLK A;  1WEZ A;  4UY8 T;  3ENQ A;  3PNI A;  2J9C A;  4PYD A;  4RWW A;  4BWM A;  4C3L A;  4CLZ A;  2V4R A;  3OV7 A;  4N47 A;  5KFX A;  4FF1 A;  3SV3 A;  4LSN A;  1GMW A;  1UJ6 A;  5D3G A;  3BSA A;  4ZJL A;  4QWA A;  1ZAX A;  3DLK A;  4NI2 B;  2G9O A;  2JZ5 A;  2DNG A;  1OY8 A;  2H1Y A;  4L74 A;  5D4P A;  4ZCK A;  1U47 A;  3MPU B;  4CLS A;  1K47 A;  2J0W A;  2ASD A;  1K0T A;  5H9E K;  4K0K F;  4DQQ A;  3UDL A;  2YNG B;  5FJ4 A;  3ENW A;  1O5J A;  2P9E A;  3MCO A;  1Q86 T;  3H59 A;  4TNO A;  5DLF A;  1REV A;  1S1T B;  4LF2 A;  4JI6 J;  4K0K J;  3DRR B;  2R2R A;  2HS0 A;  3AHP A;  3WZ0 A;  1EKR A;  4RUB A;  1NDK A;  3W65 A;  2RD5 C;  3MM5 B;  3RGI A;  3VGU A;  2GIF A;  5FD1 A;  4OHV A;  3LPY A;  3LP2 B;  3RBZ A;  1P9Y A;  2H3E B;  3A8K A;  5KT3 A;  4DV1 F;  4OJ1 A;  1K1S A;  1H98 A;  2V4J A;  3A3P B;  2CJB A;  3RBX A;  3UDV A;  4DJB A;  2HRY A;  2KT3 A;  3PFO A;  4EO6 A;  5ADZ A;  3TUZ C;  1LW2 B;  2XQC A;  3MCS A;  3QJP A;  2RAQ A;  1GX5 A;  2EWH A;  3K59 A;  1ICE B;  3M8Z A;  3ENA A;  1BQM B;  2HZA A;  1F6T A;  1ZM9 A;  2CJA A;  3P5T L;  4IDK A;  3CJK A;  2R7O A;  2ZH2 A;  3D1H A;  2VQE J;  1LW0 A;  4M5I A;  2IM3 A;  1F2H A;  1I1G A;  1AYE A;  3LAK A;  1SH3 A;  4I0W A;  1T94 A;  3LWL A;  4QWD A;  4NZ0 A;  1L3U A;  1ZM4 A;  2XYH B;  3CJ8 A;  2EC2 A;  3R7S B;  4AXI A;  2N3O A;  3GV8 B;  1H74 A;  2OEL A;  3OTE A;  1QAI A;  1UFW A;  5LSR A;  2C1E B;  3M1V B;  1S6U A;  4ZMM A;  4LF4 F;  1LK7 A;  1LWC B;  5EDW A;  2LXF A;  3WQP A;  4FPR A;  3R7B B;  2PI4 A;  1AFI A;  1S9G A;  4WFY A;  2ZUA A;  3PG9 A;  1RP5 A;  5DZ7 A;  2CNN B;  5D77 A;  1ACM B;  7FD1 A;  4DV7 J;  1Q1K A;  1UFK A;  1QAY A;  3Q89 A;  2AD9 A;  3KJF B;  4PXC A;  3A3N B;  2B4V A;  3AJ2 A;  1Q79 A;  4I4B A;  4USK A;  2LP4 A;  4DZ6 A;  4DX7 A;  1X0P A;  3K58 A;  1MML A;  3VTI A;  4DL3 A;  2XS2 A;  1FK9 A;  2VOP A;  5HK4 A;  2YBV A;  5SUH A;  2WVF A;  2B43 A;  2YWF A;  3W1Y C;  1EQM A;  2DNP A;  1J2V A;  2PII A;  4MK7 A;  4PZV A;  1T05 A;  2ZWP A;  1N33 J;  3NS7 B;  4NLO A;  3OTO J;  4ED2 A;  1JJ2 R;  4MKV A;  5ETS A;  2LA6 A;  1FJ7 A;  4X64 J;  3CJT A;  3B78 A;  1RWO B;  2FLO A;  2H4Y B;  3BGO P;  3ILI A;  3BM7 A;  2UVW A;  5L1J A;  1FEH A;  1XMO J;  3O8W A;  4MIB A;  3ZZR A;  3MUT P;  4C3K A;  4F50 A;  4E0D A;  3Q8Q B;  1FXR A;  2HK2 A;  2MLX A;  3K89 A;  4OFZ A;  4ZPB A;  1I94 J;  3QWU A;  8ATC B;  2FY1 A;  2JFK A;  2CJX B;  3BS9 A;  1YBT A;  3C19 A;  1U2R A;  3AXM A;  3MMA A;  5CYM A;  4ZPV R;  3GON A;  5KFL A;  4QIE A;  4AND A;  2K7J A;  4X62 F;  2E44 A;  5LSO A;  2ZBR A;  2B7C B;  4Y2A A;  2KRB A;  3R8Y A;  4IRD A;  3I5B A;  2RRN A;  3OUY A;  2VIH A;  3R1H A;  2MKS A;  2GGP A;  2ADC A;  2G1H A;  5L38 A;  4BS2 A;  5D0R A;  4K8R A;  4OYM A;  4CWB A;  3DGP B;  1B0P A;  1TTH B;  2H54 B;  2DB1 A;  2J9E A;  4CNZ A;  4Y2I A;  4DV5 J;  2Y9H A;  4NLG A;  1C1B A;  2CJ9 A;  1U25 A;  2Q3P A;  1PAU B;  1FKP A;  2W25 A;  3J81 Y;  1WTF A;  5A8R B;  4B3T F;  1N34 F;  4NZ7 A;  3FCW A;  1VLY A;  3M9O B;  1YJW S;  1N54 B;  3E01 B;  2HFO A;  2ADB A;  1JXV A;  2MQO A;  4DR3 J;  2E7X A;  2FHM A;  2QYG A;  4YB1 P;  2D41 A;  3MD1 A;  4PQA A;  3CO0 P;  1MWQ A;  2DD8 S;  2XMK A;  3FDS A;  1TUG B;  4NLP A;  1D0E A;  4DSF A;  1APS A;  2NXC A;  5IWA J;  3M8Y A;  3ZZZ A;  3IRX B;  4X4U A;  1KQG B;  4MH8 A;  2HQD A;  1NCL A;  1VJW A;  1Y7P A;  2EK6 A;  4ZLN A;  1TFW A;  2UXC J;  3K5L A;  3EWG A;  1S1U B;  3SCL E;  2V8H A;  2HIY A;  2IJF A;  3Q86 A;  1YG0 A;  4OV1 A;  5AT1 B;  1TKZ B;  2O67 A;  3OHB A;  3DHX A;  2G2Y A;  1N88 A;  2Y0B B;  2CJY B;  3CIM A;  3VGV A;  3TQ1 A;  3C16 A;  5GAG U;  2NR0 A;  4IH7 A;  3HKZ D;  1TK0 A;  1GTE A;  2ZE2 B;  1G4C A;  1NJI T;  2IFX A;  2M8H A;  4N41 A;  2A10 A;  2ZNZ A;  2DH7 A;  4RJV A;  1CEZ A;  2FUG 9;  2DR9 A;  1NK6 A;  2J76 E;  1HQE B;  4E2F B;  3P96 A;  4K4W A;  4NPO A;  4QR2 A;  2I38 A;  1CJU B;  2P6T A;  2YQ1 A;  5LXR A;  4OIX A;  5KT4 A;  5HRO B;  3JYT B;  3PW2 A;  4PXB A;  3GIL A;  1GXU A;  2CUY A;  3NL0 A;  3MWB A;  4YR0 A;  2D69 A;  4YDX A;  4DU8 A;  2XZT B;  3W3S A;  4CDI A;  3OL8 A;  2AJ2 A;  4F7V A;  2R7X A;  3CSK A;  1NZ8 A;  2Y8W A;  4I6W A;  5IT9 Y;  2BOP A;  2L08 A;  1RAH B;  2D74 B;  3M2R B;  4Y34 A;  4ZVP B;  3M8S A;  4UQT A;  3QAT A;  2AT1 B;  3AD9 C;  1Y3K A;  2JRS A;  3AOB A;  3DHW C;  3DU6 A;  1Y10 A;  3LGM A;  5F9L A;  2X1A A;  3FMW A;  4QPT A;  3EUN A;  2ATL A;  4EYH B;  1S79 A;  4J91 A;  2FZK B;  3LP1 B;  1VHF A;  5J1E B;  5KT6 A;  1YJV A;  5KG0 A;  3GLJ A;  3KJV B;  2UXD F;  2CWK A;  1XMQ J;  1KP6 A;  5IM0 B;  3M2V A;  4DL0 C;  5FII A;  4Y28 C;  5ETP A;  1S1V A;  4DPU A;  1S48 A;  4KO0 A;  4DBQ A;  1DBD A;  2OEJ A;  1W7W A;  1HNW J;  1WEX A;  3HSZ A;  3JQK A;  3PRV A;  2JNJ A;  3MMB B;  2C2D A;  3D4J A;  4ETX A;  3SCI E;  1NJY A;  2NLW A;  4I1T A;  3ZZY A;  1NO8 A;  1UVN A;  4U7U D;  1ZA1 B;  2EFO A;  2J9D E;  3TEG A;  4DQR A;  2PC6 A;  4P72 A;  2DXF A;  2BDP A;  1U1O A;  1FX2 A;  1Y5L B;  3S01 A;  2QA4 S;  1BGX T;  3G82 A;  4M1K A;  5KFR A;  4ECX A;  3PRD A;  4OI0 A;  2PFF B;  2IPO B;  1REG X;  4CH7 A;  2R3V A;  2V2Q A;  3H40 A;  4Y2C A;  2W7A A;  2C2E A;  3BGR A;  3N5F A;  2GGP B;  1CJT B;  3GCW P;  3KDN A;  2AMC B;  3ISN D;  4C0H A;  5L9X A;  3CED A;  1H0H B;  2VOO A;  2YKP A;  4IG0 B;  4LF1 A;  4H4K C;  3WDO A;  3CCZ A;  3TZW A;  3P4U B;  4DF4 A;  3QJL A;  1V3Z A;  1UVI A;  1RWK B;  4LRE A;  4LBH A;  2I1R A;  1TL3 A;  5ETM A;  3IAM 9;  4DFM A;  3DLG A;  1S57 A;  3DRP B;  3VQS A;  5LXY A;  1RYS A;  2HVD A;  2AJ1 A;  5L9N A;  1CUL A;  2HHH J;  1FJC A;  5AE3 A;  3OR2 A;  4FYD A;  1TL7 A;  8AT1 B;  2XSJ B;  3I31 A;  2GX8 A;  2ZC4 A;  4J9V A;  2ZE2 A;  2HLT A;  2ZOF A;  5ETR A;  3MUR P;  2PEB A;  4JYA J;  1PYT A;  2AGO A;  3GR1 A;  3CJR A;  4UT4 A;  1EKS A;  1G2E A;  5ETV A;  3BQ0 A;  2OI2 A;  1QSL A;  3NGK A;  2UXB J;  3G82 B;  2PMZ D;  2E5H A;  4C9D A;  3ITH A;  1DTT A;  4ICL B;  4MK8 A;  3IRW P;  1RBL A;  1S9F A;  3NGT A;  1JNZ B;  4WTY A;  4K5R A;  2IM2 A;  4B9V A;  1WG1 A;  2PSZ A;  3HSD A;  1LK5 A;  2LEP A;  4OJH A;  1D9D A;  3OLA A;  4WXW A;  2M7S A;  2ZH6 A;  4I56 A;  1JLE A;  2OLW A;  2WOM A;  2J7U A;  1VR6 A;  5KG7 A;  3QT8 A;  2YKM A;  4JI0 F;  5JXS A;  1DJ0 A;  1OSD A;  4KGM A;  1EET B;  2V8G A;  3MEG A;  4TY9 A;  3E01 A;  3GE9 A;  4F2S A;  3K5O A;  1RT4 A;  2R8H A;  2BJ7 A;  3MCM A;  4ICL A;  2XCA A;  4DSJ A;  1HYS B;  3DXB A;  2L9W A;  1WSV A;  2VPZ B;  3PVX A;  2XMW A;  3MUM P;  4NYP A;  1VCT A;  1WJ9 A;  1WOS A;  2QSF A;  3D54 A;  4U96 A;  3V4I A;  1U1K A;  2UUB F;  2HGN A;  4KFB A;  1UEK A;  3KK3 A;  5KG2 A;  3S6E A;  4DLE A;  4LF7 J;  1FTC A;  2HBY B;  4RBV A;  1C0T B;  2J7W A;  4WYL A;  1K9M T;  5IT9 U;  1HPZ A;  2CA9 A;  2VFR A;  1NLK L;  5C2C A;  1M5K C;  3ZTS A;  1V5I B;  3M32 A;  2KB2 A;  5GAG I;  3NAI A;  4RNM A;  1M5H A;  1HWI A;  1RLD A;  4ELT A;  3WIU A;  3IG1 B;  2MQM A;  3IWN C;  1JMT A;  1U26 A;  3PKY A;  2DR5 A;  1MMN A;  3TYT A;  2UZA A;  3RU0 A;  3WIV A;  3VAI A;  2ZUG A;  5F8M A;  1F9F A;  4LIW A;  2MQQ A;  1VC0 A;  3NS5 A;  2OPR A;  3C6U B;  3C6T B;  5ETN A;  3QSY B;  4IO1 A;  5GVQ A;  1TR0 A;  1KOH A;  1URR A;  3ZZT A;  2UVV A;  4JI3 J;  3I32 A;  2YWK A;  4M5L A;  1SIZ A;  4NLT A;  1UJ4 A;  5HO4 A;  4K4T A;  1RKI A;  2CQB A;  2HAI A;  4ED1 A;  2OPP A;  3TVK A;  2PT0 A;  4CO4 A;  4DFJ A;  2N7C A;  4QCL A;  3MAH A;  3I4P A;  2K8G A;  3DMJ B;  2CDQ A;  2JEJ A;  4I2P B;  5KFS A;  4WCE Q;  4ECR A;  1B64 A;  3TX0 A;  4W90 B;  2PO4 A;  3EZU A;  4C98 A;  2XI2 A;  2MZ1 A;  4CLF A;  4M5G A;  4IRC A;  4LMZ A;  4LFB F;  1M5P C;  1RU2 A;  3IR5 B;  1NK7 A;  1KD1 T;  2ATC B;  1VIO A;  3OL7 A;  4C2M A;  2UUA J;  4O3R A;  2OKQ A;  4LQ3 A;  1IVZ A;  1BQX A;  3M8Q B;  3PJX A;  4MIA A;  5A8R A;  2R9L A;  1NKC A;  2DGQ A;  3MM6 B;  5HQL A;  4HKQ A;  2O3D A;  4Y0F A;  2CQ1 A;  2XWY A;  3AAW B;  1HI8 A;  2AJF E;  3JXO A;  2KFY A;  5LMU F;  2DPI A;  4USU A;  3NMA A;  1JWW A;  3IWL A;  3W5X A;  1U49 A;  2EFQ A;  2HQ3 A;  1BC6 A;  4QPX A;  1PC5 A;  4R5P A;  1JIH A;  4JI2 F;  1RTJ B;  4KH0 B;  3SBM A;  4DR2 J;  1P1T A;  3Q2S C;  1FWL A;  2Q43 A;  3CTR A;  4FNI A;  4OZJ A;  3BYR A;  4ZDN A;  4ED5 A;  2RHQ B;  3R1L A;  2J0X A;  1ZPW X;  2DEJ A;  1FFW B;  2IBO A;  2YNF A;  5EWE A;  3CXC R;  1EP4 A;  3HM9 A;  2AEF A;  2EFN A;  1VQ9 S;  2VPX B;  4FYX B;  4Y65 A;  4OX9 J;  5D4N A;  4DPT A;  2NZC A;  3RB4 A;  4CYU B;  4DFK A;  2W8L A;  1RHM B;  4WP8 A;  2DR8 A;  1FJE B;  1FA0 A;  5IQ6 A;  1U4B A;  2DNK A;  2QL9 B;  1JQG A;  4ZPW R;  1J5O B;  2E5J A;  2QX0 A;  1FO1 A;  3HMJ G;  3T6J A;  4CLL A;  3ZZ0 A;  3M7V A;  4B9S A;  1RTI A;  4MYT A;  1EQ0 A;  2BZ2 A;  4MTP A;  2JL9 A;  3SFU A;  3CCR S;  2WSC C;  1SKU B;  3G4S S;  4C3M A;  1NK9 A;  2B4O A;  3D1Q A;  3AB2 B;  1M5S A;  5BR8 J;  3DOK B;  1Y00 A;  4DPO A;  1RT5 B;  2PA8 D;  3AJ1 A;  1ZZF A;  2M3D A;  1PIE A;  2AX0 A;  3GU0 A;  1YZ6 A;  5A2Q Y;  3PIP Q;  2ZH5 A;  4DR3 F;  2AJ4 A;  1R3N A;  3KK2 B;  1WAC A;  3VAF A;  1MWZ A;  1RAB B;  3R27 A;  4ECZ A;  2KYX A;  2ZZT A;  1X4D A;  2MZQ A;  2WK4 A;  3FZB A;  2PMW A;  4YS2 A;  1IBM J;  3DYA B;  3J81 j;  4M94 A;  2WAQ D;  1YTY A;  2DHG A;  5HJX A;  1LXJ A;  1RA6 A;  2JVR A;  2IA0 A;  1LWC A;  1UAW A;  2HND A;  3IC1 A;  4PEO A;  3JS9 A;  2QN6 B;  3QBC A;  1TK8 A;  4GKJ J;  5D4O A;  4QOT A;  1HBU B;  2XM3 A;  2KFN A;  3FBC A;  1EET A;  2GAG C;  1MNE A;  2LXU A;  4OLP A;  3V6D B;  3D0I E;  1TAQ A;  1CLF A;  5CCM A;  3NNA A;  4I69 A;  5HAT A;  3ZNJ 1;  4C48 A;  1KVK A;  3RW7 A;  4RW8 A;  2LKZ A;  2DY9 A;  2ILZ A;  2Y1L B;  1DTQ A;  1NH8 A;  3DMJ A;  3M8P A;  1JKH A;  4L3K A;  4NLQ A;  5C42 A;  1GNK A;  1HNV B;  2CQH A;  2DNO A;  4OZ5 A;  3VQT A;  4F3Q A;  3TZY A;  2NZ4 A;  4DV5 F;  3BKT A;  4YME A;  2Q79 A;  3DRS B;  3IP0 A;  1KHW A;  1RAA B;  3UVJ A;  4RU2 A;  3U1N A;  1DZ5 A;  4JI1 F;  5KFC A;  3OSP A;  1WOP A;  1IKW A;  4DPX A;  4B3T J;  3EIC A;  1RK8 A;  4HI2 A;  4F04 B;  5L8R C;  3SYZ A;  2J9D A;  1L5U A;  1FFS B;  1UEU A;  4G1I A;  3OTB A;  2PFD A;  4R8U B;  1L3K A;  1RTD B;  2GIQ A;  2VH7 A;  3DLE B;  4NCG A;  2F40 A;  3R5J B;  3LAN A;  1IKW B;  2UU9 J;  2X1F A;  3UCG A;  1HHS A;  2W24 A;  4FPI A;  2IVF B;  1TKT B;  4Y2M A;  1YJR A;  5L1K A;  1HWU A;  4XAK A;  1RBO B;  1UP1 A;  4F36 A;  4DX5 A;  1NZA A;  3ZFV A;  3H2V E;  4OZ1 A;  3GWC A;  2ZFH A;  2QG9 B;  1JLC A;  1ZOT A;  2CZ4 A;  3V4M A;  4RU9 A;  4X66 F;  4Y2K A;  5LSL A;  2CQ2 A;  5M2P A;  3QIP B;  4DR4 J;  1KVJ A;  3AD8 C;  3MTJ A;  4NX9 A;  1D9A A;  4P75 A;  4DV6 J;  3Q23 A;  1UPM B;  5A0Y A;  1HD1 A;  1C4C A;  1Y5I B;  3HHN B;  3MAA B;  4GKK F;  2YTC A;  2HGM A;  3ZZU A;  4AFF A;  3OW2 R;  1NKE A;  2G2Z A;  4B9M A;  3JSY A;  4QWB A;  3NCQ A;  4O3O A;  2KXH A;  3BH6 B;  3RR8 A;  2BE2 A;  2EFP A;  1U1P A;  4DL2 A;  1PC4 A;  2G0C A;  3HZG A;  4LF9 J;  2Z2L A;  4ZPA A;  2XY7 A;  4N5S A;  1U1M A;  4LFC F;  1VIX A;  3I0R A;  1JJH A;  2XZW A;  4FVM A;  3HZE A;  1MWY A;  3QIP A;  3KLE B;  4I2P A;  3DOL B;  3IM9 A;  4CLT A;  2W9C B;  2RSQ A;  4GRS A;  3K5P A;  4I6Y A;  1NHK L;  2MJN A;  1D09 B;  2B3T B;  2OSQ A;  3F0N A;  4RLE A;  2VA2 A;  4WBF A;  3W7B A;  2VBX A;  2DGW A;  3SDE A;  2WON B;  4RUH A;  3UCZ P;  3KLH B;  1IWA A;  1DQA A;  3PYG A;  4F0H A;  4QYZ K;  1B4S A;  1RZM A;  5HBM A;  3PJW A;  2VPW B;  2XCP A;  3HCX A;  3L09 A;  4PR6 A;  3IA0 A;  4Z2X A;  3OXG A;  5LJ3 Y;  2C3O A;  3UR0 A;  4BLG A;  3CD7 A;  3CJQ A;  2W9B B;  4GC7 A;  2X7I A;  3N5B A;  2JLE A;  2B9E A;  4L76 A;  5K8O A;  1U24 A;  2N7Y A;  2WSE C;  1QSS A;  4MJK A;  5KFT A;  3DRS A;  3OJS A;  3UN2 A;  5MLC V;  3KHL A;  3DGV A;  4J9P A;  1F1B B;  2V8D A;  3N0V A;  3NP5 A;  2CNK B;  3G8T A;  1JKH B;  1XNQ J;  1YJ7 A;  4USM A;  2W7O A;  4KPC A;  5LM7 E;  3HVW A;  4CTA B;  5FLX U;  2O01 C;  1RWV B;  1YSJ A;  2QLW A;  5E0O A;  4RNN A;  2C2O B;  6FDR A;  3KMS A;  2J0Q D;  2QV6 A;  2QSW A;  4K4Z A;  4QIG A;  5ETO A;  1IKX A;  2L41 A;  1VMB A;  3DOM B;  4WU2 A;  2D3Z A;  1SJQ A;  3O44 A;  2DIS A;  2W4P A;  1CS4 A;  1ELO A;  1RT1 B;  4YQW A;  4ID5 A;  3SXL A;  4O44 A;  3FEZ A;  2XGQ A;  2AWZ A;  1F5B A;  2DRD A;  4I6A A;  4ZVO B;  1FKP B;  4DV2 F;  1JLB A;  4YEA A;  2AEJ A;  3VVT A;  4EK2 A;  2JX2 A;  4ZN3 A;  3KHG A;  4JBC A;  4AE5 A;  4BC7 A;  2HFV A;  4DR6 F;  3FVY A;  4LF7 F;  2A6M A;  1R27 B;  3QQC D;  4DOZ A;  1U02 A;  2P8I A;  3KK2 A;  3FSI A;  4J9N A;  3RRK A;  4LBI A;  4P73 A;  2ZH4 A;  3G2X A;  1TMM A;  2J6S A;  3H90 A;  3QO9 A;  5E5N A;  4X2B A;  4DUZ F;  3IR7 B;  3QFW A;  3W63 A;  9RUB A;  2VBZ A;  4RBT A;  2YQ0 A;  3DU5 A;  4O3Q A;  2AV5 A;  5J2Q A;  2FY8 A;  4BCA A;  3J7Y U;  5DM7 Q;  1T9W A;  2KXN B;  3E2E A;  3H98 A;  2FDN A;  4YDD B;  1XMB A;  2XMU A;  3D7S B;  2ROP A;  4F26 A;  3D9B A;  4RW7 B;  2M88 A;  4QIV A;  4QR1 A;  3EXC X;  3HXM A;  3LOU A;  1SJ4 P;  2DRA A;  3PW4 A;  2HRT A;  4KKO B;  5U47 A;  2POK A;  1X0F A;  2AYM A;  2IA6 A;  2HIQ A;  3IG1 A;  4PPZ A;  2HKE A;  3TW0 A;  4IOA Q;  4TVA B;  1T3O A;  3NS6 A;  3B54 A;  3K7R A;  1HD0 A;  3OL6 A;  2EVZ A;  5K5M A;  3HHE A;  2V34 A;  3M30 B;  2Y1J A;  4ZVE A;  4RW8 B;  5D8H B;  2WBR A;  3PO5 A;  2IDE A;  1VRT A;  2HBR B;  2C3Y A;  2MHN A;  4J5O A;  4TLR A;  4R5P B;  1IR0 A;  5EGY A;  3MEK A;  4EBE A;  2M70 A;  2WW8 A;  4HDG A;  2VQE F;  5KFB A;  1AFJ A;  2KH9 A;  4CLY A;  4B3S J;  5H1S V;  4ECV A;  1S9G B;  3MI7 X;  2E1C A;  2HLU A;  2PEH A;  3L7O A;  4MYU A;  3Q8S B;  4F4Z A;  2RJZ A;  1V3R A;  3DI6 B;  5ETL A;  4DDF A;  3DM2 B;  4DN0 A;  3J7A 1;  1S7H A;  3KUG A;  1FK9 B;  4UOF A;  5HJY A;  5I4M A;  1UWB A;  1SJF A;  4PQU A;  1HQ2 A;  3N6L A;  3GIJ A;  1A6L A;  3KJV A;  3I55 S;  4ZS6 A;  2MXY A;  4CTA A;  2IAJ B;  2KHC A;  2VZ9 A;  4ZJQ A;  2K06 A;  3R5D A;  3MR5 A;  1PGZ A;  1HNI B;  4KB7 A;  2ERR A;  1RCX B;  2VDI A;  4NA3 A;  3TAM A;  2G4B A;  2R42 A;  1DTT B;  3NAH A;  4OYA A;  2YKA A;  4JP8 A;  1RA7 A;  1YGY A;  2MJU A;  4OJG A;  2DGS A;  1M5O C;  1H72 C;  3G6E S;  4Q5V A;  5D6G A;  4KC5 A;  4F2R A;  2DGU A;  1CQM A;  2A1B A;  4NLY A;  4ZOS A;  3DLL Q;  3BH7 B;  5HVG A;  2DJW A;  3DLH A;  2OML A;  4H54 A;  3UWT A;  2ZH3 A;  4A8K A;  2HRU A;  5F3Z A;  1VQS A;  3T19 A;  3PR4 A;  2ZDP A;  2UUA F;  2GO8 A;  4WE1 A;  5BR8 F;  5GAH I;  2HQG A;  3UI3 A;  2L9N A;  3TA0 A;  4NLU A;  1C4A A;  2F8H A;  4DX6 A;  3JSM B;  2EC0 A;  9ATC B;  2AP6 A;  1HPZ B;  2JH3 A;  3LUY A;  2W9C A;  1NU4 A;  1VYA A;  2HAF A;  2LVW A;  2Z4P A;  4DX8 H;  1SKW A;  1TAU A;  1FRL A;  4EZ9 A;  1UL3 A;  2CPH A;  4EYI B;  2ZDO A;  1EIY B;  2FJB B;  4KFB B;  3FCH A;  3I0R B;  1S9E B;  4DG1 B;  1UW4 A;  4ZP8 A;  4ECW A;  2AZ1 A;  3GCX P;  3EPG A;  3T9N A;  1VBZ A;  4RWX A;  1ARO P;  5GAD I;  3PDN A;  2IYG A;  3QMQ A;  2AGQ A;  3A13 A;  1BXN A;  4LSN B;  1NB7 A;  5AXL A;  2DK2 A;  2FVS A;  1CPZ A;  4Q2M A;  4F0M A;  4J9R A;  2F7V A;  5F8N A;  1FNX H;  1DLO A;  2ASL A;  3T1H F;  5F8I A;  1IM4 A;  2XWX A;  5JUM A;  4IG3 A;  2YKM B;  2EKN A;  3J80 U;  5HN0 A;  1HA1 A;  3BBF A;  1UA0 A;  2RUS A;  4E98 A;  3CB4 A;  1GMV A;  5AXK A;  3WHI A;  4DV3 J;  5CCL A;  3AQP A;  4OX6 A;  3OQ2 A;  1N34 J;  1R7I A;  2IYI A;  3AT1 B;  1R43 A;  4JV1 A;  2FB0 A;  1JLB B;  3LP1 A;  5J1E A;  3PX6 A;  1R0A A;  2OAU A;  1QD1 A;  3QT5 A;  5B0E A;  1IR1 A;  5RUB A;  3NWR A;  1JJC B;  5BJR A;  4M95 A;  3MR3 A;  4NAS A;  1T9T A;  2IRX A;  3HDS A;  4F4Y A;  4YR2 A;  2XI3 A;  3DLE A;  2VAS A;  4ILR A;  2YWE A;  5DGB A;  2P9C A;  2DVI A;  3EGV A;  5AJ3 F;  3CVK A;  5B09 A;  5AXN A;  4C6A A;  2HHX A;  3MAQ A;  1E6Y A;  1RT3 A;  3HX9 A;  2FZG B;  1LFW A;  3M05 A;  3QWP A;  1YHQ S;  4F25 A;  1I51 B;  3CCU S;  2HFN A;  1NDP A;  3GMG A;  1DHM A;  4YR3 A;  2I6W A;  3RB0 A;  1VQ8 S;  4R0E A;  1XNR J;  2RUG A;  3P45 B;  4LSL A;  2R2U A;  4ERD A;  4ELU A;  2QLX A;  5T14 A;  3RZA A;  1LW2 A;  1HHQ A;  1Q7L B;  3HKW A;  4G6V B;  4KR0 B;  2VQF F;  3JB9 k;  3D68 A;  3K2Y A;  4LRF A;  2FVR A;  4OI3 A;  4HT5 A;  1AUS L;  1R0C B;  2EPI A;  2V4J B;  3L7U A;  4FNH A;  5HAO A;  1RXO B;  4EFA C;  1VQN S;  3D1O A;  4HLB A;  1FCA A;  2JC1 A;  2O1P A;  4A8W A;  1R8B A;  4M5K A;  3BF4 A;  2VU5 A;  2LEC A;  3FRZ A;  5A8K B;  1XBW A;  3T5K A;  1ZPV A;  1VRQ C;  2W01 A;  3TAM B;  3F56 A;  5E2Q A;  5J2M A;  4DL7 A;  1AUD A;  2YXL A;  4ES1 A;  4F4W A;  3K5M A;  1P6T A;  4L72 B;  2W8K A;  1S59 A;  2F1F A;  4B02 A;  5KT2 A;  3T3F A;  2WBM A;  4LIR A;  4OYX A;  4I7F A;  1VK8 A;  2ILY A;  1OYD A;  2IHR 1;  2V2V A;  4Z7C A;  4WXO A;  4C11 A;  1RHU B;  3HFV A;  1GFW B;  1PBU A;  1I3O B;  3GTY X;  2D3O R;  3H5X A;  2GMH A;  4WFX A;  3T6B A;  1ZM3 A;  3C15 A;  3B4M A;  3CCW A;  4ZP6 A;  3ZTO A;  5HSP A;  5C5J A;  3T1A A;  5K8N A;  3CCS S;  2V2Z A;  5E3P A;  2WVC A;  1FRI A;  2BQR A;  4NXN F;  3MFH A;  1KFD A;  3VAH A;  2A2D A;  3DOM A;  1AW0 A;  3AA8 A;  2OFH X;  2HVH A;  1HWL A;  2YPY A;  1S6O A;  1X5P A;  5EHH A;  1NK4 A;  1KQK A;  3MPY A;  4RUA A;  4UTG A;  4NEY A;  3SV4 A;  3OFE A;  3BGF A;  1N52 B;  2VL1 A;  3AB4 B;  3RB6 A;  4EBD A;  5HAN A;  2BQU A;  4RO0 A;  1Y4Z B;  4DZD A;  3FEX B;  5I3Q A;  4WIQ A;  2J0S D;  3B82 A;  2GO9 A;  4ZHR B;  3OFG A;  3JSM A;  1RAO A;  3NRB A;  5ETQ A;  1AZS A;  2MKK A;  1EP4 B;  1OWX A;  3DFE A;  4UQG A;  3J7Z T;  3Q24 A;  1B99 A;  2NUH A;  4CT9 A;  2DXD A;  2VG6 B;  3CCE S;  2VC1 A;  3J7Y I;  2H5E A;  4DQI A;  2FVC A;  3D67 A;  3ZO7 A;  5A2Q U;  3K8V A;  1OSC A;  1TL4 A;  2CWX A;  2OHD A;  1VQ7 S;  5I42 B;  3MMA B;  4WYW A;  4IQM A;  2CJK A;  2HPU A;  3I96 A;  3W64 A;  3G6X A;  2QFJ A;  1EHW A;  3BN4 A;  1SJ1 A;  1Z1Z A;  1OY9 A;  3CDB A;  4NCA A;  1VHI A;  4IOC Q;  2ZVS A;  4X4T A;  3C16 B;  3VAG A;  1CSJ A;  5KT5 A;  1C0U B;  4HYK A;  3MEE B;  4K7Q A;  2VJU A;  1S6Q B;  4X66 J;  2YX4 A;  3VZH A;  2HHH F;  3LH2 S;  1FRJ A;  4PPD A;  3M6W A;  5L1I A;  3UN5 A;  3PYE A;  4C8Y A;  1MG7 A;  2F3J A;  3MM8 B;  2CPY A;  4ZKA A;  2LCW A;  5J2Q B;  2BRK A;  5D3G B;  1LV5 A;  2UXB F;  4RL1 A;  2ZVI A;  4Q7A A;  2R2T A;  1YI2 S;  4TN2 A;  1QAX A;  1WF0 A;  4F0K A;  4HT7 A;  5C2G A;  3LA0 A;  4FBU A;  3KNA A;  4RW9 A;  7FDR A;  4M5D A;  4CLK A;  3CC2 S;  1RHQ B;  1U2C A;  3EDR B;  2HNY B;  4USI A;  3UQS A;  3TVY A;  1RT7 B;  3A4T A;  2ZJQ Q;  2V8V A;  5D0H A;  2DRB A;  1GEH A;  5KFP A;  5IWA F;  3CWJ A;  3FSY A;  2CPX A;  2V94 A;  3SI8 A;  2V63 A;  4AYB D;  4B3S F;  1T02 A;  2RT3 A;  1SC4 B;  2GQ2 A;  4K59 A;  4NMX A;  4QWC A;  4JI1 J;  4JI7 F;  4K4S A;  2QYC A;  1N5T A;  2VBY A;  2HQF A;  4OZN A;  3KTQ A;  3KMQ A;  1NAQ A;  4NYO A;  2XHC A;  3DC2 A;  1RWM B;  4Z7Y A;  5A8K A;  2BBE A;  3O2I A;  2IIH A;  5IXU A;  3OVA A;  1HBM B;  3N6N A;  2JHE A;  1ZAW A;  1TQL A;  3CUL A;  2CDR B;  2UUC J;  2UVR A;  2FJD B;  3HO1 A;  3GR0 A;  3RRG A;  2J8S A;  4DMZ A;  2CQC A;  4CM2 A;  1Q5V A;  3E3X A;  3GG0 A;  2ZJP Q;  2RVJ A;  4OI2 A;  4LRA A;  4ITS A;  4AD6 A;  4DUY F;  5KFG A;  3PIO Q;  5CYJ A;  4DL5 A;  3R5C A;  5DGA A;  5K14 B;  4KHP F;  3DN9 A;  2HHW A;  2R7U A;  2FJW A;  4L3N A;  1YZ7 A;  2VJV A;  3NEK A;  1OQ3 A;  2EK1 A;  2NYH A;  2EFV A;  4R8U A;  3SSQ A;  1E6Y B;  1EZZ B;  3W61 A;  2KM8 B;  1HR0 J;  1SV5 B;  3TJA A;  2Y8Y A;  3FBB A;  2R7W A;  3KKF A;  1QLN A;  2IJN A;  3PKM A;  3M2U A;  4J90 A;  1NPK A;  4DR6 J;  2DCU B;  4P7V A;  4CO3 A;  5HQM A;  2BVZ A;  2VQF J;  3HJV A;  1U6F A;  3CUN A;  5KFV A;  2KYZ A;  4C0O C;  2ZBC A;  3BQ1 A;  4ED6 A;  3I9V 9;  1NK5 A;  2KT5 A;  2YKO A;  3FBE A;  2WSF C;  4DR2 F;  2KHD A;  4QIF A;  3OPK A;  4ZLL A;  5JJB A;  1N5Y B;  1I6J A;  3SIP B;  3O6Q A;  2NUU G;  4H4O B;  4LFC J;  3MHY A;  5KFE A;  1IQT A;  3LO3 A;  2LQ8 A;  2C3M A;  1V3S A;  3OTD A;  3MD3 A;  4TY8 A;  4I68 A;  2E5L J;  2L3M A;  4G65 A;  1L3T A;  1XMO F;  3DLJ A;  1T95 A;  1NDC A;  2Y3Y A;  2APO A;  4U8V A;  1ZET A;  1OQ6 A;  2NXU A;  3G9C A;  2EFG A;  4ID5 B;  1LEO A;  4NWB A;  5D0E A;  4YP3 A;  3DDI A;  3HHD A;  2RU9 A;  3QT7 A;  4JI8 J;  2HHV A;  4HHH A;  1K8A T;  2IM1 A;  2HWT A;  1VQP S;  2HS3 A;  4B9L A;  1IKX B;  4K4X A;  3AOA A;  3THT A;  1FNM A;  4LF6 J;  4NXM F;  5H9E J;  1VQ5 S;  4A8F A;  1F5A A;  4OQJ A;  2EW9 A;  1WC0 A;  2MZS A;  3LAM A;  1Z2L A;  4CP5 A;  4QWE A;  3JTO A;  4EU0 A;  1X5T A;  5GME A;  3FCV A;  3KG4 A;  2RKI A;  2E1M C;  3EM1 A;  3W2V B;  1HKA A;  3DOK A;  5F0W A;  2RIJ A;  5HL7 Q;  1IBM F;  3D6M B;  4B3M F;  4JI5 J;  2Q66 A;  3THP A;  2M9K A;  2YWW A;  3PCO B;  1T03 B;  3FQL A;  3D2W A;  3CIZ A;  1Q7Y T;  4U9R A;  1F2G A;  4CLW A;  3RAX A;  3TAR A;  3L95 X;  2CQI A;  1RT6 B;  1C0U A;  1N5S A;  1IJE B;  2BJ3 A;  2XHW A;  3HSG A;  2Z8Q A;  4LBP A;  4DN9 A;  5KFJ A;  5LT5 A;  5IS2 A;  1Q8L A;  4M8L A;  1SH0 A;  4WFN Q;  4XPC A;  1CQN A;  2XEX A;  4FKY A;  5CXT A;  4LVO P;  4ZIW A;  3KG0 A;  1WNE A;  5I42 A;  2HHU A;  4PCQ A;  3ZTR A;  1KC8 T;  1UCN A;  1YJT A;  4HR2 A;  2XLI A;  2C22 A;  4HDH A;  1WTB A;  2GJF A;  1WKJ A;  1KHV A;  2B5J A;  4EGL A;  2PMH A;  1RB0 A;  2YNI A;  3BSN A;  2B8P A;  2CQD A;  4YY3 J;  1S1W A;  3EVO A;  4CI0 B;  4LSZ B;  4H4M B;  2VOD A;  1YIT S;  4ZLJ A;  4DV4 J;  2F4V J;  3RYL A;  3TR5 A;  3VVU A;  4W92 B;  2ACM A;  1DY3 A;  1S99 A;  3QFH A;  1BD6 A;  2HWH A;  4ECU A;  2FPH X;  1N36 F;  2E9T A;  5B0D A;  1DLO B;  2N4D A;  2FC9 A;  2V68 A;  1XNQ F;  3QJJ A;  1SI9 A;  2B0G A;  2GC8 A;  3QZ7 A;  4GC6 A;  4B3R J;  1X4E A;  3HUL A;  2OH2 A;  2HGL A;  5FDL A;  3DXS X;  3NGU A;  2KI2 A;  1WOO A;  3R6G B;  1IXK A;  4RR5 A;  3ILL A;  4LR7 A;  4C8M A;  2F8E X;  3GJS B;  4QU7 A;  1UEV A;  1IWG A;  2DGX A;  2GNK A;  4PRF A;  4EZ6 A;  4A48 A;  1RDR A;  1SIW B;  3MM9 B;  4OYI A;  2VG5 B;  2Z2Y B;  1QUP A;  1VDH A;  3P6Y C;  4K4V A;  3AQO A;  4PWD A;  2ASJ A;  3GJQ B;  4OYW A;  4PYA A;  1YLX A;  2OMO A;  3BR9 A;  3QAU A;  4WII A;  1N5Y A;  5KOX A;  4OHY A;  5AXM A;  4LFA J;  3FNN A;  3U02 A;  3M9N B;  2YX1 A;  3OR1 B;  3A12 A;  1HIY A;  1Y9O A;  3B6B A;  4WP3 A;  1YX2 A;  2YQ3 A;  4NA2 A;  1SXL A;  5KFQ A;  2E7W A;  4ES2 A;  4DV1 J;  3WBZ A;  4DUY J;  2RB7 A;  4ZPC A;  3UNG C;  4URS A;  1IN0 A;  2ZNY A;  2GA7 A;  2HK3 A;  5EWG A;  4K4Y A;  4DUZ J;  1NUE A;  4C0B A;  2OIH A;  4RZR A;  2XBP A;  2MKI A;  1WEL A;  3RW6 A;  1OO0 B;  4AT1 B;  3A8J A;  3DDN A;  3H42 A;  3MM5 A;  1HR0 F;  2MKH A;  1KSP A;  1OIA A;  3K8W A;  3NMR A;  2CQ4 A;  2OD4 A;  2FLL A;  4KV8 A;  2VKR A;  1Y5N B;  3IBC B;  4WK1 A;  3TVZ A;  5E7O B;  1NHV A;  1DTQ B;  1R89 A;  3M8P B;  4OX8 A;  4WPA A;  5DDR C;  3QO9 B;  4WU3 A;  4ZN1 A;  1HNV A;  1FER A;  1QJH A;  1X4G A;  3MM9 A;  1RTJ A;  5KOW A;  3NGS A;  2X51 A;  2YKN B;  3HFK A;  3R3T A;  2Q1L A;  5T7L A;  2V4Q A;  2E9R X;  4RW4 A;  1TEL A;  3LP0 A;  3NNH A;  5J2P B;  3VF0 B;  3VAL A;  3ILO A;  1S6P A;  1WC3 A;  4DU7 A;  1FWK A;  2BE2 B;  4FS1 A;  4M5J A;  4Y3C A;  3TZZ A;  1GXL A;  2JWN A;  4C4W A;  1X9M A;  5EWF A;  3WC2 A;  3DLB A;  3IS9 A;  1D3W A;  2HND B;  4DV3 F;  3A1Y G;  2HZV A;  2ZH9 A;  5IC4 B;  1R6Y A;  2BJ8 A;  2R7T A;  3SSR A;  4ZA1 A;  1XK8 A;  1S6P B;  4A8M P;  1FXL A;  1FXD A;  3IAS 9;  2DPJ A;  2F65 A;  5KFF A;  1YRT A;  2IJR A;  3A3O B;  3KUE A;  3M2V B;  5KG5 A;  4NLS A;  1FJG J;  1P8G A;  5LOQ A;  4DR5 J;  4KT0 C;  1JLC B;  4LF6 F;  2F5G A;  2FHO B;  3K57 A;  3HVR A;  2LEB A;  3ZZO A;  2MGZ A;  2V6A A;  3PEH A;  4OYB A;  1LOU A;  3KLF B;  2BAB A;  4HH1 A;  4P10 A;  4ZVT B;  3MM7 B;  3OT9 A;  3UFC X;  1O0P A;  1S9E A;  1M1K T;  3VWS A;  3FFI B;  4ZCI A;  4X4V A;  3MED A;  4HHU A;  1QY7 A;  5HP1 A;  2RU3 A;  1N0U A;  4D3H A;  3RRH A;  2KTQ A;  1H2V Z;  2CJQ A;  2MDA A;  2BM1 A;  3MM7 A;  2DNZ A;  2GVD A;  1VC5 A;  2NQP A;  4LF5 J;  1D1U A;  1HNX J;  5HRO A;  4I2Q A;  1M90 T;  5K14 A;  2AYG A;  2YNF B;  1UW9 A;  3O1L A;  4LQ9 A;  4FYY B;  3QAE A;  3A8I A;  3AOD A;  3BDE A;  3ET6 B;  5B08 A;  5BYS A;  3S8S A;  3V81 A;  3JQM A;  1U6Z A;  2KJW A;  2FGC A;  1UKU A;  1HBM A;  5DQI A;  2YWG A;  2I5J B;  1YBU A;  3AY0 A;  1IKV B;  2VB6 A;  3FKB A;  1VI7 A;  3QGH A;  4ZLP A;  1NK0 A;  1NSA A;  1PO6 A;  3B4D A;  4YY3 F;  3P49 B;  2YVS A;  3JTN A;  2R7Q A;  1WD6 A;  3ZTQ A;  2ZD1 A;  4BWJ A;  4ER8 A;  5C24 A;  1HYS A;  3OFF A;  1CC7 A;  3ISZ A;  3M8Q A;  2V9K A;  3CJ3 A;  3W2W A;  4DV4 F;  1K0V A;  4U8Y A;  1PSD A;  3MM6 A;  4ECS A;  3UD4 P;  5L39 A;  2GJI A;  4MKB A;  2MQP A;  2QC3 A;  1GX6 A;  1S1V B;  2BKN A;  2MLZ A;  3BGU A;  2RH3 A;  4RKU C;  1RAF B;  3HVT B;  3M8W A;  4UST A;  3RG6 A;  3TP2 A;  4TQS A;  1UWB B;  4OZ3 A;  3TAN A;  5J1N A;  4YUD A;  2A2C A;  1B7Y B;  2CQ3 A;  4M63 A;  2CNL B;  4G1Q B;  3CDA A;  2RQK A;  3SCJ E;  2J5A A;  3AOC A;  4ZJO A;  2KRR A;  2HHQ A;  1QE1 A;  3ULH A;  3I82 A;  2BEF A;  1HBO A;  4WJB A;  5E3C A;  1U09 A;  3CJK B;  4QZV B;  5FLX Y;  2XS7 A;  2EG1 A;  1JLG A;  2W2Q P;  3MEE A;  4NL5 A;  1FT8 A;  4MKA A;  4M5M A;  5J2N B;  2KG0 A;  3BO4 A;  3T5L A;  1TKX A;  2IY5 B;  2Y1R I;  1NEE A;  1TMJ A;  3G86 A;  3GFY A;  4O4G A;  4OV6 A;  4UF4 A;  4UZC A;  1SVD A;  1X5O A;  2W7P A;  3TJ9 A;  4DCO B;  5LJ5 Y;  2BAC A;  3L9Z A;  1TK5 A;  3OHA A;  4OL8 A;  1HHT P;  2VON A;  4A8Y A;  2IBK A;  1TUW A;  5F0U A;  2PI5 A;  4V1A k;  2AF6 A;  2RRB A;  2XNR A;  2J8A A;  4WFA Q;  2WCX A;  3VGT A;  5F8L A;  2E29 A;  3BEG B;  1N5Q A;  2OUG A;  2KN4 A;  1Z2Z A;  2C3P A;  3CJ2 A;  5CYQ B;  3IO1 A;  4Q43 A;  1FEE A;  2M4M A;  3DOL A;  4O4R A;  5A6W A;  3AXK A;  3CT9 A;  2DT9 A;  3GFH A;  2CZV C;  5KFD A;  3VAJ A;  4R0J A;  3NKY A;  4H4K A;  4PWW A;  5CAA A;  1SL2 A;  1T0T V;  1TUV A;  1TVR B;  3JTP A;  4DS4 A;  2MMY A;  4OZL A;  2XY5 A;  2QA1 A;  4WKY A;  3KLF A;  3TUJ C;  2BKP A;  1MLA A;  3I6P A;  3N4W A;  3HI9 A;  5F3T A;  4USV A;  2COL A;  2ZKU A;  2CG8 A;  1CJV A;  2EEY A;  1EAY C;  2H5I B;  3SZ2 A;  5H9F K;  2DGT A;  1DUR A;  2V2K A;  2W2O P;  2M5Y A;  2MY8 A;  1H6K X;  3R5G A;  4C11 B;  2YX7 A;  1W2B R;  3BO2 A;  4RW9 B;  3X3U A;  1H2U X;  5G0R A;  4JI7 J;  1HQU A;  3O3L A;  2RQ4 A;  2XSF A;  4OHX A;  1SL1 A;  1GQE A;  4TY8 B;  3TA2 A;  4MMO A;  2YNI B;  3V6H A;  4DS5 A;  1KQS R;  2OSR A;  1RGV A;  2HG4 A;  3HD2 A;  4FVC A;  1VRU B;  1XQI A;  2GFF A;  2IMO A;  2P9G A;  3ONQ A;  4KGX B;  5E3Q A;  4GO5 X;  1N56 A;  3OBI A;  4ED0 A;  3H5U A;  2N82 B;  1ITP A;  2HHP A;  3FC9 A;  1KOO A;  2SXL A;  4FF4 A;  1S1X A;  2F9D A;  1DAX A;  3CDE A;  4DG1 A;  2NRE A;  4O3N A;  4IFV A;  1F60 B;  1X7V A;  4FYW B;  2LQB A;  3GIR A;  1KEK A;  5LMU J;  5IOL A;  5KFU A;  1I5O B;  2GHV C;  3GSD A;  1ZS6 A;  3BV8 A;  4RW6 A;  4PUO A;  2EXU A;  5DET A;  3CPW R;  2CQG A;  2A3J A;  3HFZ B;  3PAC A;  4NLD A;  4OLO A;  1LXN A;  1CJU A;  4CO1 A;  2DXE A;  3MR7 A;  2DNQ A;  3H2U B;  4KBI A;  4ZP7 A;  1X4H A;  3HPO A;  2DHA A;  5HMW A;  1HWJ A;  1DQ9 A;  1RAJ A;  2BOA A;  3HD1 A;  3MEC A;  5DDP C;  2G2O A;  2Z56 B;  3I5C A;  4IG0 A;  3TOQ A;  5KG4 A;  3CJS A;  2BQ3 A;  2B9Y A;  3ZXW A;  3CC4 S;  3PFE A;  2I0X A;  2NPF A;  1GAO A;  1SQF A;  2ALZ A;  4KYZ A;  4ZCM A;  3G87 A;  2DKO B;  3W66 A;  3H8Y A;  2RQM A;  1C1C A;  2C3U A;  1RWW B;  2ABY A;  2F9J A;  4D3G A;  3KJQ B;  5HBM B;  3G96 A;  4X4Q A;  3PY8 A;  2DGO A;  1RTD A;  4MAK A;  2QL5 B;  4WP9 A;  1HBO B;  2LLZ A;  3DDK A;  2QL7 B;  2RNE A;  1BQN A;  2OPS A;  5CQG A;  4DFP A;  2AGP A;  1YBA A;  1NJW A;  1QVG R;  1K1Q A;  3NG8 A;  3W62 A;  5DG9 A;  1X4B A;  2OTJ S;  5C25 A;  2VG5 A;  1SBR A;  3US5 A;  1FRM A;  1IJF B;  3HHL C;  1NSQ A;  4P9S A;  3EX7 B;  3DNC A;  3PW5 A;  3WX8 A;  1FFG B;  3FSX A;  4JI8 F;  2ACY A;  4URQ U;  2K3K A;  1NM2 A;  2XTJ P;  2WZ1 A;  3NCR A;  2R8G A;  2ZBP A;  4OYZ A;  3T9Z A;  3AD7 C;  3THV A;  4LRD A;  2L9D A;  2OEM A;  3TAQ A;  4J9K A;  2VFU A;  3U7J A;  3W8P A;  2CPJ A;  1URN A;  3M1V A;  2Z0G A;  2HFS A;  3SCK E;  5A76 A;  2DIT A;  4X64 F;  2EG2 A;  3SQG A;  2M8D B;  1SUQ A;  1PYS B;  3PR5 B;  1RAI B;  2GV1 A;  2D7S A;  1S6Q A;  1X9S A;  2B8Q A;  1OMS A;  4CZC A;  3G8Q A;  4ECT A;  1IQZ A;  1FTR A;  4KPY A;  2CQ0 A;  1KTV A;  4ILM A;  3HVA A;  1IR2 A;  4X65 J;  2ZBI A;  1RHR B;  3QZ8 A;  2Q6B A;  1M0S A;  4WKR A;  3R97 A;  1MN7 A;  1BLU A;  2XSJ A;  1S1W B;  2AKW B;  2B4P A;  2GVZ A;  3JYT A;  1TP7 A;  1T9Y A;  5CYQ A;  5KT7 A;  2HYI B;  2I9S A;  4MK9 A;  4KE5 A;  3GV7 B;  1JK9 B;  1VIS A;  4TU9 A;  4GKK J;  1CJK A;  4JI6 F;  1SB6 A;  5I3U A;  5G4D A;  2XY6 A;  3MDF A;  4AUK A;  3H4D A;  2XMV A;  3FK4 A;  5CYM B;  1MMD A;  4LF4 J;  3PV8 A;  2E1P A;  4ZHR A;  1C0T A;  2QJ3 A;  4ZCL A;  5E41 A;  1ZTT A;  2C28 A;  4FBT A;  2JLG A;  4KIA A;  3CCQ S;  4FDF A;  1V6H A;  4OX7 A;  4JV5 J;  2NXN A;  2KZZ A;  3D6T B;  1YQH A;  5CH7 B;  1FE4 A;  2V69 A;  4OZ2 A;  4V19 X;  4JI3 F;  1RAE B;  4F4A A;  4K5S A;  1GTH A;  3MR6 A;  2YKQ A;  1QAJ A;  4ZVR B;  1S49 A;  4YHH J;  4N76 A;  2D3U A;  4Q44 A;  3I87 A;  4U6P A;  4B9N A;  1VS3 A;  1YRX A;  2BRL A;  4PQU B;  3CD6 S;  1G7C B;  4P2S A;  1MN9 A;  1HI0 P;  2ZM6 F;  2V67 A;  3UD5 A;  4KRW A;  3KYL A;  1N48 A;  3PO4 A;  4AXJ A;  5CD4 A;  4RPF A;  4F3M A;  4GO7 X;  4TU7 A;  5B0F A;  2OPP B;  4NCB A;  3TUI C;  1M1H A;  3HHL D;  4H4O A;  3EVM A;  3QNW B;  2QA2 A;  4UOH A;  1W26 A;  5KFI A;  3UNY A;  1PJ6 A;  4FXV A;  2NSC A;  5HMZ A;  2AEM A;  2MKC A;  4O0N A;  3FEY B;  3GJR B;  4DV7 F;  3D0G E;  2UUT A;  2H5J B;  2OPQ B;  1KRP A;  4JI2 J;  2CAJ A;  4F8R A;  1BUX A;  4ZVU B;  4C8O A;  3EGZ A;  3C46 A;  4ZIT A;  2VUG A;  1BWE A;  3MEC B;  3V2U C;  5M2U A;  3ET6 A;  1HNX F;  1IKY A;  3J7Z 5;  4P52 A;  1HBN B;  4ED7 A;  1HW9 A;  2QGF B;  5AE2 A;  1JX4 A;  2R8K A;  3ISN C;  3FRY A;  1TL3 B;  5AE1 A;  2QIF A;  1SKR A;  3CJ5 A;  1T9V A;  2CXE A;  1CVJ A;  2BX6 A;  3ETM A;  4L75 A;  2ROG A;  4EWT A;  2RDI A;  3IBF B;  3QSI A;  1KNZ A;  4ECY A;  4C97 A;  4LR9 A;  4YB6 A;  3MR2 A;  1TKX B;  5K8M A;  4RUC A;  2H65 B;  1Q78 A;  2ZH8 A;  1S7I A;  1SQG A;  2DHH A;  5D0G A;  1S10 A;  2EI5 A;  4B9U A;  3NNC A;  4USH A;  2JSX A;  3ICL A;  3R2C J;  3PHE A;  3TJ8 A;  3GG1 A;  2QZ8 A;  2XLJ A;  1RKJ A;  1VRU A;  4DR7 F;  1S76 D;  2C2K B;  2Z58 B;  4G1P A;  4PG6 A;  5ETK A;  2RDD A;  1H38 A;  1G1X A;  2Z2Z A;  4KAI A;  1NSP A;  1RT7 A;  2CYY A;  3HHK A;  5HLF B;  1MU2 A;  5KFK A;  2BJ1 A;  2MLY A;  2KL8 A;  3IM8 A;  4KO0 B;  1OPZ A;  2W9A A;  1XTZ A;  1JLQ B;  1W2I A;  2BM0 A;  3CMA S;  4O0I A;  3GII A;  4QYR A;  2YPZ A;  4LFA F;  5E3R A;  1OY6 A;  2KDO A;  2EBE A;  1CS4 B;  1RT1 A;  2Q6C A;  2ROE A;  4HH0 A;  3UD3 P;  1UET A;  3EZ5 A;  5CZX A;  6AT1 B;  4IRK A;  2FZC B;  1Y3J A;  3MMC B;  4P7T A;  4B17 A;  1TU0 B;  2RHS B;  3BR8 A;  4XDD A;  1TVR A;  2RRA A;  3CDW A;  5KFA A;  1NJX A;  4Q8F A;  2NSB A;  5BXI A;  3BRE A;  1XEZ A;  4GVB B;  4DSK A;  2MQL A;  4M5D B;  3UN3 A;  3RBE A;  1LWF B;  2B6A B;  2VG7 A;  5DG7 A;  2FIU A;  3OTC A;  5T7L B;  2KVQ E;  3S1T A;  4CQ1 A;  3N28 A;  3V81 B;  2FLP A;  4QYZ J;  2NS1 B;  2HHS A;  1RWU A;  5E33 A;  3KLG B;  4ED3 A;  5IV4 A;  4XIU A;  1X60 A;  5K9F A;  1XC9 A;  3DLG B;  3DRP A;  2JEG A;  2MHE A;  3QPI A;  4LF9 F;  5DJB A;  2JJ4 D;  4YB5 A;  3ENV A;  5KAK A;  2MST A;  3MGJ A;  2AQ4 A;  1RI7 A;  4PXD A;  2GVZ B;  3KHR A;  4ECQ A;  2U2F A;  4LF5 F;  2ZBQ A;  4PXE A;  3CD0 A;  4GMK A;  1KKH A;  1D9F A;  3MUV P;  2FTR A;  4RW7 A;  1CJT A;  1WKL A;  2HUR A;  3MPD A;  2RE1 A;  1ZZN A;  3OTO F;  4ZIV A;  1S1X B;  1RAD B;  2I8E A;  2HMI B;  2HFZ A;  2ZHA A;  2D1C A;  1ULR A;  2VA3 A;  3KLH A;  4DSE A;  4M5H A;  5J2N A;  1VQ6 S;  2VHG A;  2F4F A;  4NEZ A;  3TAP A;  3R9L A;  3I5A A;  4L73 A;  2BJ9 A;  4X4P A;  5GAE U;  3SFG A;  2HEK A;  1ZA2 B;  4O3P A;  3TA1 A;  3OD2 A;  1NXI A;  3MTK A;  1FDN A;  4J9O A;  2CVE A;  2RML A;  1TL5 A;  3LTO A;  2R7R A;  4C8L A;  4PWU A;  4TYB A;  1QTM A;  1EX8 A;  1LWX A;  3OVS A;  4NRU A;  4J9L A;  2ZHO A;  5KFY A;  2VD3 A;  4MKY A;  1R8H A;  4RX6 A;  2J6U A;  3IFE A;  3EXY A;  3SSS A;  4JI4 J;  3Q8Y A;  3N01 A;  3UCU P;  2K7K A;  3C14 A;  5J2M B;  2E9Z A;  1RTH A;  1WEY A;  2DNL A;  5DM6 Q;  4CIO A;  2BR0 A;  3PW7 A;  2E5L F;  2H51 B;  4HTI A;  2CRL A;  4NE9 C;  3UDC A;  3BBB A;  4A8X A;  5A0Y B;  3MAA A;  2B4U A;  3GB0 A;  3T1Y J;  2B9W A;  3HHL A;  4I7F B;  2UUB J;  2ZOM A;  1JLE B;  1UJ5 A;  2WOM B;  3BJY A;  2CIM A;  3C2P A;  1SJR A;  4WFZ A;  5EX0 A;  3KK1 B;  2NXE A;  3KLV A;  2DIU A;  2G0J A;  1FRX A;  3DKD A;  4DLG A;  3J7A N;  2B5J B;  2WB1 D;  2XUL A;  3RB3 A;  1FWP A;  1Q8I A;  2OD6 A;  2WVE A;  2FGO A;  4PG5 A;  2QE5 A;  1WG4 A;  5DRK A;  2FHJ A;  4QW9 A;  2CPE A;  4WFB Q;  1MRO A;  1TKT A;  2PDA A;  1N6Q B;  1NH7 A;  2VIC A;  5K8P A;  2FC8 A;  4PUO B;  2MZT A;  2QA4 G;  2C2M B;  1FDD A;  2M2B A;  4X4S A;  4KGK A;  3Q8R B;  3CME S;  4B3O B;  4OI4 A;  2BV3 A;  2Z57 B;  3IN5 A;  5L1L A;  3M4X A;  1D8Z A;  2QO3 A;  1YJN S;  1N6Q A;  4K4U A;  2VBW A;  1WHX A;  4FXD A;  4URG A;  1QE1 B;  4HHJ A;  4J7C A;  3PXG a;  4DXL A;  3GSI A;  5B0G A;  1REV B;  1S1T A;  3G71 S;  3P8B B;  3EGN A;  2R2S A;  1KDN A;  3LQV A;  3CGI A;  2ZH1 A;  1UTA A;  3C8Y A;  3W2V A;  2GMJ A;  2XNQ A;  3GFX A;  1RU1 A;  2WTF A;  1SPB P;  4K2X A;  2XMA A;  3M9M B;  3V6J A;  2W4C A;  1LWF A;  2B6A A;  2VG7 B;  4CO5 A;  2GW8 A;  1QSY A;  1GXT A;  6FD1 A;  3C3L A;  5IC6 B;  2DO4 A;  3TZX A;  1HMV A;  1ROF A;  2KJV A;  5EX3 A;  2C2Z B;  1IBC B;  4FP9 A;  5D15 A;  4YN3 B;  3LGN A;  5IT4 A;  3UPF A;  2XO6 A;  2ZH7 A;  2HS4 A;  2P6S A;  3J81 U;  3CCL S;  1V9O A;  1YVF A;  4UOC A;  3IR6 B;  3F44 A;  2R8J A;  1H7W A;  4MFB A;  1VFJ A;  4DSL A;  1RIS A;  3QYY A;  3FQK A;  5BYQ A;  4PG7 A;  3KJN B;  3EPI A;  5LMN J;  1IKV A;  3DYA A;  3PHT A;  1PYO B;  1VRT B;  4WTO B;  4DV0 F;  3D3B J;  2IM0 A;  2LA4 A;  2PE8 A;  2BJD A;  3BKU A;  1NKB A;  3L7P A;  4B3R F;  2YKN A;  3E51 A;  3G6Y A;  4Y6I A;  2HHT A;  1R8A A;  4N77 A;  1VQM S;  2JFD A;  3NGD A;  5LL6 d;  4XDC A;  4NZ6 A;  1FI4 A;  4J37 A;  3Q22 A;  2E7V A;  3UE2 A;  1UZH A;  2Z2M A;  3VAK A;  2FQQ B;  1Q53 A;  5IZH A;  3PTW A;  1IBL F;  2ZJR Q;  4NML A;  3JQJ A;  2HMI A;  3EZO A;  3ZC4 A;  3VV2 B;  1NRK A;  2MY7 A;  4NCG B;  1NHU A;  3NWG A;  4ALZ A;  2CPZ A;  2LDY A;  1VQY A;  1T11 A;  2LFV A;  3P3D A;  5KG1 A;  4BC9 A;  2AJ0 A;  4NLX A;  4ED8 A;  4FN5 A;  4O4G B;  3TO8 A;  1S0M A;  2LU1 A;  4C7Q A;  1RQ0 A;  3V5R A;  1T8E A;  2CAD A;  5I3U B;  1NB2 A;  1KVI A;  3NBP A;  5C7P A;  3TQE A;  1ZH5 A;  1JLG B;  2DNM A;  1QM9 A;  2CG4 A;  4F67 A;  1UVM A;  2MGZ B;  2FJA B;  2QTW A;  1ZBT A;  4IUF A;  4DPY A;  1AZS B;  3CD5 A;  1JLF B;  2HNZ A;  4YOE A;  5F8H A;  1N4L A;  3EE3 A;  1N32 J;  2G0I A;  2LQ9 A;  3H20 A;  1VQL S;  3IGV A;  1WHW A;  1F3V A;  1DAR A;  3CW2 C;  2GHW A;  1JXE A;  1PJ7 A;  2OPQ A;  3BBC A;  5HI7 A;  1ZAV A;  3KLE A;  4J9S A;  2HWI A;  3GJT B;  3V6D A;  4P2F A;  2K3I A;  3TI0 A;  1B7F A;  3W9I A;  3NY0 A;  4TQR A;  3BGL A;  3MF5 A;  4OHZ A;  5IV3 A;  1J5E F;  1Q95 G;  2HVZ A;  1SC1 B;  2LU2 A;  2OPS B;  2VPY B;  5DS7 A;  3BZQ A;  3POT A;  3I4H X;  2W4D A;  3CCT A;  2IAJ A;  3MEG B;  5JVH Q;  4EEY A;  4EO8 A;  4NLV A;  5JMN A;  4NXM J;  2FVQ A;  4JYA F;  2JEI A;  2VKZ G;  4IR1 A;  1KQF B;  3H7H B;  3LAL A;  2LQ5 A;  1XR6 A;  2OEK A;  1UVL A;  1RHJ B;  1WF2 A;  3PYD A;  3P5B P;  3RUB L;  4H4M A;  1E6V B;  1VBK A;  4USJ C;  1X4A A;  4WK3 A;  3JSR A;  1K44 A;  4PAA A;  5DLG A;  2OTL S;  1FE0 A;  2AX1 A;  3QID A;  4OMF G;  4ZK7 M;  3MFI A;  3D3C J;  4FF2 A;  1H7X A;  5HVF A;  1R0B G;  1OS5 A;  3N79 A;  2UXC F;  4TYA A;  2FYX A;  5IQQ A;  3OUY B;  3T5H A;  5KFZ A;  2B51 A;  1N5V A;  3N9U C;  1A7G E;  2OPR B;  3C6T A;  3C6U A;  3CNQ P;  3ZTP A;  5ITH A;  2V9W A;  4ELV A;  3SMZ A;  4F02 A;  1PCA A;  1WC4 A;  2M52 A;  1B3T A;  3VCD A;  4CM0 A;  1GMW D;  4IQX A;  2ZKT A;  5CD4 H; 
#chains in the Genus database with same CATH homology
 1CS4 A;  3ET6 B;  1YBU A;  5D0G A;  4CLK A;  5D0H A;  2GVD B;  4CLP A;  3C16 A;  4WP9 A;  4OYP A;  1U0H B;  3UVJ A;  4NI2 A;  4UST A;  4OZ3 A;  1CJU B;  2WZ1 A;  4OYZ A;  5D15 A;  1YK9 A;  4OYI A;  1CS4 B;  4OYW A;  3C15 B;  4CM2 A;  1AB8 A;  4WP3 A;  1U0H A;  1Y10 A;  1WC1 A;  1CJV B;  3C14 B;  2GVZ A;  5IV4 A;  1WC5 A;  4CLF A;  3MAA B;  1CJK A;  4OYO A;  4CLY A;  2W01 A;  2GVZ B;  4P2M A;  4WPA A;  4USW A;  1CJT A;  1WC6 A;  1FX2 A;  1CUL B;  1CJK B;  3G82 A;  4USU A;  3UVJ B;  4OYX A;  4OZ2 A;  1WC3 A;  1CJT B;  4CLT A;  1AZS B;  5D0E A;  3C15 A;  4USV A;  2BW7 A;  1CJV A;  1TL7 B;  1YBT A;  1Y11 A;  3R5G A;  4OYA A;  4P2X A;  4P2F A;  1WC0 A;  1CUL A;  5IV3 A;  1TL7 A;  4WP8 A;  3C14 A;  4OYB A;  1AZS A;  5D0R A;  4OYM A;  4CLL A;  4CLW A;  3G82 B;  3MAA A;  4CLU A;  1FX4 A;  4CLZ A;  3ET6 A;  2GVD A;  2QV6 A;  3C16 B;  4NI2 B;  1CJU A;  3MR7 A;  4CLS A;  1WC4 A;  4CM0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...