4MAKA

Crystal structure of a putative ssrna endonuclease cas2, crispr adaptation protein from e.coli
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
73
structure length
73
Chain Sequence
b'SMLVVVTENVPPRLRGRLAIWLLEVRAGVYVGDVSAKIREMIWEQIAGLAEEGNVVMAWATNTETGFEFQTFG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CRISPR-associated endoribonuclease Cas2
publication title Crystal structure of a putative ssRNA endonuclease Cas2, CRISPR adaptation protein from E.coli
rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 16
structure length 73
sequence length 73
chains with identical sequence B
ec nomenclature ec 3.1.-.-:
pdb deposition date 2013-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09707 Cas_Cas2CT1978 CRISPR-associated protein (Cas_Cas2CT1978)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.240 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4makA00
2J7KA 1ZM9A 2BM0A 1ZM4A 1ZPWX 4ZCKA 4QR0A 4MYUA 1P9QC 1VI7A 1N0UA 4MAKA 5G4DA 2NPFA 1ZM2A 2I0XA 3B78A 4FN5A 1U2RA 4ES2A 2BM1A 3LH2S 4QR1A 4ES1A 1FNMA 2L9NA 1ELOA 2XEXA 3ZZTA 2ZITA 2EFGA 3OQ2A 4TNOA 3EXCX 1KTVA 2BV3A 4ZCLA 4MYTA 1N0VC 3B82A 3B8HA 2I8EA 3ZZ0A 2E1RA 4ZCMA 4M1KA 4ZCIA 3ZZUA 3E3XA 2CVEA 4QR2A 1ZM3A 2KDOA 4ES3A 2IVYA 2WBMA 1DARA 1T95A 3UI3A
chains in the Genus database with same CATH superfamily
2HLUA 3R5GA 4X66J 2Y0BB 4YFUA 4JI3F 2QA4G 5LSOA 3CULA 1F3FA 1RT2B 5F0UA 2AYGA 1TELA 3W8GA 2F1FA 4Q8EA 3CC2S 3DHXA 4OHZA 4OZNA 1XK8A 2FC9A 4M5HA 1JNZB 1SH2A 1TL1B 3P6YC 4EGLA 4NXNF 4DFJA 1N0VC 3NS5A 1SJQA 3M9MB 5KFZA 1RT7A 4DLGA 1FCAA 3DOKA 4OI4A 4CWBA 1PAEX 5DO2A 2RVJA 1FDNA 2CJXB 2H4YB 2ZOGA 3IXQA 1FHTA 4I0WA 4MKAA 4ZVRB 2OI2A 3LOUA 5KFHA 3M1VB 4F3QA 4USJC 2ABYA 1R8BA 2QL5B 3HT3A 2XG8A 1FJGJ 3BB5A 2W2QP 3PKMA 4F4KA 2ZBIA 4HEA9 3MR6A 1QSYA 4DX5A 2FJXA 3T19A 3QQCD 4ZLJA 1KP6A 4QPXA 4XDCA 1GT8A 1F2HA 4F4ZA 1GEHA 4G1IA 4C9DA 4OLPA 3ZTQA 1Q4RA 4QIVA 3FCHA 3B6BA 2WZ1A 1U45A 1IBLF 2MKCA 1P9QC 2VBWA 4JBCA 4YEAA 4K2XA 3CDAA 2HS3A 1RA7A 4U67Q 4QU6A 3SFUA 5C2CA 3CF5Q 5A8WA 5CABA 2N4CA 7AT1B 3OFEA 3NS7B 1S49A 1IKVB 4HL9A 4DSIA 4K7QA 3CIMA 1N32J 1GMUA 1KHVA 3D4JA 2CQ3A 1YGYA 4WIIA 4DU7A 1VRTA 5FD1A 3RJMB 2RD5C 4KY3A 4K50A 4OYPA 2H4WB 3CXCR 1HNIA 2DNGA 4QBUA 4USKA 2FLPA 3SI8A 4CO1A 3TZXA 5J2MB 2H5IB 2HMIB 4USMA 2BRLA 1B64A 3U1NA 4OYWA 3NCPA 3D0HE 1HWJA 2V2ZA 2NZ4A 3DRPA 2XWYA 1K0TA 2EFVA 3T1YF 4LF2A 3UCUP 1S10A 3HX9A 2QX0A 1JLFB 1VHFA 1VQSA 3MM8A 4YQWA 4FKYA 1ZPVA 1UPMB 2D7SA 2QG9B 4ICLA 1E6YB 4KGKA 4PZVA 4JI1F 3C2PA 4DUZJ 2DNKA 2PO4A 5E41A 2I5JA 1OQ3A 4DSFA 1S0OA 2OSRA 4Y2CA 1YSJA 2R7UA 4YB6A 2GQQA 4KPCA 4WF9Q 3FRYA 2IC3A 2KXNB 4I56A 3V6HA 4RW9B 1EKSA 3WZ0A 3G6VA 1TKTB 1SIZA 4IOBA 4ETZA 3V6JA 1SKRA 1RP5A 1JXLA 2K3IA 1TL3B 5E3PA 2DGQA 2HGLA 1ZH5A 2XY6A 5C2GA 2HHVA 4DR5F 3HFKA 3PEHA 2DXEA 4UOCA 1YKWA 2VA2A 4DV2J 1S57A 2VG6A 2H51B 2ZH1A 2POKA 1EP4A 2FJEB 1RA6A 2FUG9 1CJUB 3BGOP 4M63A 2VPYB 1J5EJ 3W5ZA 2XNQA 1FDBA 1X0PA 3BSAA 4R8UB 1QUVA 4C11B 4NA1A 2RS2A 2QLWA 4RNNA 2EBEA 4ZP6A 1Y3JA 1Z4UA 1IR0A 3HHEA 3A3NB 3ZZTA 4UY85 5FDLB 1DFDA 4K4TA 3G8SA 5A8KA 2KKHA 3M8WA 1HQUB 1FJ7A 3MM6A 3PNIA 3EVMA 2ROPA 3BDEA 2WRMA 3UR3C 4ZVOB 3AQOA 1NK9A 4X66F 4TU7A 2E1CA 1VQ8S 2GIQA 1DQAA 2Y1LB 3TR5A 5D0GA 3HP6A 2DGXA 3CMAS 1VC5A 5KAKA 3H2UB 2OPSB 5BYSA 3G86A 3W3SA 2K7KA 1X4GA 1YHQS 2IJRA 2LDYA 4YR3A 3DMJB 2W4DA 3TQEA 3NNAA 4P73A 4IH7A 4K4ZA 3QRRA 4E8UA 3MZIA 4QIGA 2BKPA 1HBOA 2EFNA 1BE4A 2GJIA 4RWWA 4CNZA 1P1LA 3TA0A 2DITA 3LAMA 3RAQA 1NPPA 4CO2A 1QM9A 1R0AA 3OW2R 2UU9F 1MW7A 3KLIB 4ZN3A 2RU3A 4XPEA 4PUOB 5HLFB 3MEGB 3UN3A 3G6YA 4PWUA 1S0MA 1R3NA 2E5IA 1V6HA 5IC4B 2HNZA 4Y65A 2RSQA 5ETQA 1B7YB 2MKIA 3RYLA 2VPWB 1TP7A 2ACMA 4J9PA 4DU8A 3E2EA 1EQMA 4OMFG 4KSEB 1JLBA 3ADAC 2AJFE 3U27A 3SDEA 2KFNA 4B9VA 4A4JA 1FRXA 4J5OA 1CQNA 1HMVA 2LEAA 1PYOB 4YY3J 3MR7A 2DR8A 2ZZTA 3GFHA 3CSKA 2EWHA 3KLEA 2ERRA 1FRIA 1EETA 1ZOTA 3CDBA 2W01A 1Y5NB 4NL5A 3BZQA 5KFDA 3ILJA 3EVWA 3VGSA 3LP1A 3PTWA 3KHGA 4ZVSB 3BF4A 3EZUA 2OTLS 2NXCA 5HROA 2PIIA 4FVCA 1RHUB 5DDOC 1OIAA 2NPFA 1AFJA 1SH0A 2F63A 1K47A 2YWHA 4HH0A 2WOMA 1XMOJ 2JEJA 4DDFA 2IMOA 5GAEI 3KLGA 4MH8A 5CYMA 3T5JA 2BUNA 4WFAQ 1HKAA 1WG1A 1R8PA 3DI6A 5DDQC 1X31C 4U8VA 2A2CA 1CJVA 4URSA 1Y10A 4PXBA 2DPJA 3MMJA 3QWUA 1KBRA 1X4EA 3RB6A 1RISA 3H20A 3LO3A 1VIXA 5HATA 1NH8A 2E9ZA 1VC6A 4IO9Q 2EFQA 2PSZA 3VAFA 3C6UB 4DCOB 2XULA 3JSBA 4DR1J 5DLFA 4J9UE 5F0WA 4HDHA 3CJKA 1X5OA 3MMAB 2Q43A 1RCOB 4AYBD 1DRZA 3J7YU 3CJ5A 2NYHA 4DUZF 1WKLA 4P9SA 1FWPA 2RDIA 3RR7A 3NS6A 1NKBA 3D68A 2QRRA 1B70B 1M5VC 3QO9B 2V9WA 2W7PA 2EBGA 2HLTA 4RKUC 2PE8A 1KKHA 4HACA 1UCNA 3NMRA 1D09B 2R2TA 4L3NA 5RUBA 2ZOFA 3SV3A 1Q8BA 1I51B 2AJ0A 2RQMA 4R0JA 3X1LB 4WZQA 1FESA 1WG4A 2VFVA 3N6LA 4U7UK 5LSRA 1D9FA 1LWFB 4F2SA 1S77D 1S0NA 2HAFA 1IM6A 4KBIA 2LQJA 2CPYA 2J9DA 1RQ0A 5B7WA 2PFDA 5C24B 3Q86A 5J2PA 4GVBA 2XSJB 3J81U 3HFVA 2Z30B 3HCXA 4Z7YA 3KDNA 2HHPA 4DV2F 3M2UA 4OFZA 3N0VA 2XO7A 3PX6A 2XS5A 4B3OB 1N56A 1MROA 2DYAA 2YNIA 2F8MA 3EVOA 3ETMA 4UY8T 4DEZA 4PQUA 4DX7A 4RW7B 4XO0A 4H54A 5A8RB 2VBYA 2OO4A 2FVQA 4NLWA 3A8EA 3H5UA 3HVTB 1WEZA 5EX3A 3Q0AA 1S9GB 2VQEJ 4K4YA 1DY3A 4O4RA 2AT1B 2H48B 3GE9A 2JLFA 4P72A 4F4YA 2G9OA 3KJNB 2GC8A 3D66A 2DGWA 1TZ0A 4A8OA 4RLEA 3DLGB 3BN4A 3NGDA 4ZVQB 3R8YA 1TQLA 4ED2A 4EI2A 2JL9A 4LREA 2KT5A 2W7OA 4DV0J 1UFWA 4GRSA 3TVYA 3QFWA 3FJ2A 4ES2A 3M2VB 2IRXA 4A8FA 4LIWA 1HI0P 3CCLS 1U6FA 5CHCB 2YX7A 2MKHA 2CDQA 4PXCA 4RNMA 3CUNA 4B3SJ 2HBRB 3TNVA 2DNOA 1SCJB 1LW2B 2I9SA 4ED8A 2FJBB 5C25B 1R89A 3FVYA 1FFWB 3UD5A 3LA0A 3MECA 2YNGA 3FBFA 3H8YA 1L3SA 3DHWC 4TY8A 5LT5A 3MPUB 4N7TA 3RBZA 2CZ9A 3UDEA 5IWAF 3D67A 4DL7A 2XBPA 1G7CB 2GQCA 3BPSP 1WOOA 2QV6A 1TV6A 1Q53A 4N41A 4NLQA 1WHXA 3NNCA 2MQNA 3KLHB 3FSXA 1UP1A 5F9LA 4CO4A 4YY3F 4K5SA 1BLUA 2WBRA 4I64A 3ENAA 1F5CA 3LPEA 2M52A 4KKOB 3QAEA 2R8JA 2N82B 4I67A 3MAAB 3C8YA 4ZJQA 2K06A 3HSZA 1XR5A 2JLGA 1NK0A 2HWTA 2FZKB 2JEFA 3C14B 1BGXT 1RAAB 4B3TF 4A8SA 5CXTA 4AXIA 4E2FB 4JUZA 2J5AA 2P6TA 5E7OB 2DR7A 2K1RA 1EB0A 2HHQA 1LWEB 5K9FA 2FYXA 3QGHA 3A1YG 1KN6A 1KONA 1NKCA 4DSKA 1UEUA 2E5JA 4L73A 1S1XB 2CQPA 3AA9A 3ZZPA 1NK5A 3C6TA 1ZTWA 3M8QB 1LXJA 2ZNZA 5B0BA 3AOBA 1A0OB 5A0YA 5DGBA 4Y00A 4OJGA 4HI2A 2YXLA 3EX7B 3KDOA 3HSDA 4HKQA 4I7FA 1YWXA 5KFUA 1S9FA 2DNYA 1YTYA 5KFOA 2HYIB 2OLWA 1IBKJ 1N5SA 1BQNA 3MMBA 2HBQB 4H4MB 4DQPA 2ZBPA 3R3TA 4DR1F 2CQDA 1E6VA 2BOPA 1OS5A 2OELA 1O8BA 2FJVA 3VF0B 1PGZA 3PYDA 2XMWA 1RJJA 3SIPB 3HULA 5ETOA 2ILZA 1FF2A 5BXIA 3RB0A 3BEGB 1YK9A 1SB6A 5DQGA 4WBFA 2E9RX 3AB4B 4KR0B 4ILLA 4K4SA 1VI7A 2CG8A 3O3LA 1NNDA 2OHDA 3MD3A 4OYIA 1YRUA 5ETTA 4UT4A 3EDQB 4ZN1A 3QT8A 5IM0B 2MSSA 1S79A 4DG1B 2OTJS 3DFEA 4OYMA 3ZXWA 4USUA 1GTEA 4V1Ak 4F26A 2C2KB 2RF2A 3M30B 2HAIA 5HSPA 1FX2A 4ZMMA 1S4EA 3M32B 1CVJA 4CQ1A 4PQAA 3MEKA 2HIQA 2HZCA 4J9VA 1RHJB 1TAUA 1WHWA 1UFLA 2DXFA 3BKFA 4NYZA 4GC7A 5J2NB 1JLGB 3WBZA 2GVZB 1LW0A 3ITHA 1DBDA 4F0KA 1TTHB 2AD9A 3TAQA 2X3DA 4OZ3A 1C4AA 3HHNB 4R5PA 1QUPA 3GIRA 3MEDA 1NHVA 4NZ7A 2VU5A 2VZ9A 2VQEF 4K59A 2XLIA 4F3MA 2A6OA 1XNQJ 3H7HB 3BR9A 5HN0A 4HR2A 1IKYB 3HSGA 4LFBJ 2X7IA 3CO9A 4LSLA 4D3HA 1KRPA 1PIEA 1HNXF 4Q2MA 1HBNA 2V68A 4Q45A 4ZA1A 1BY9A 3Q8UA 2DH7A 2QTWA 3IGNA 4CT8A 2V6AA 3M1VA 3LP0B 3TVZA 4GC6A 4A8MP 2KU7A 5KG1A 3PM9A 4UZCA 4O0IA 3AXMA 1YJRA 1VHIA 1KFSA 1VDHA 2ZJRQ 2W7AA 3E01B 4LF4J 4BC7A 3R6LB 2G4BA 4JV5J 3LUYA 5SZTA 3EDRB 3PX4A 2QC3A 1S7IA 3RRKA 3RTVA 1SUQA 1VQ9S 4JI2J 2WW4A 1IQTA 3QZ7A 4J9SA 5T41A 2GHPA 3W2VB 4WKRA 2NXNA 4QWCA 4FYDA 1S9EB 1KQFB 1KNZA 2HQDA 2IRUA 2VC1A 3L7PA 5LJ5Y 1YX2A 1S72S 3LP2B 4EO6A 1SJ3P 3GJRB 2C2EA 1I6JA 1URNA 3D5MA 1HLWA 3IN5A 4UZBA 2LU1A 3CCUS 3PYEA 2ZBRA 1SL2A 2WSCC 3GJQB 3SXLA 2ZH5A 1IBCB 4C8YA 4TLQA 3QLHB 5LOQA 3MUVP 4NLRA 5KG0A 3G87A 3J7Z5 4LF8J 5DG7A 1VFJA 4MK8A 5J2MA 3OXFA 1DLOB 2HZVA 2CPDA 2PMWA 5AE2A 3KHHA 2J7WA 4XIUA 1REVA 1FKOB 3O1LA 4FKXA 4OV6A 2P9GA 3M2RB 3CC7S 2W9CB 1NJYA 4WPAA 3CCES 2LP4A 4IR9A 3TA2A 3T1HJ 3ZFVA 1JLFA 4CH7A 3L09A 3FGVA 7FD1A 3FMWA 1E6YA 1G4CA 2DT9A 5JVHQ 1OJ4A 5FLXU 2G2ZA 5T7LA 2VOOA 2QA1A 2D9OA 4CI0B 5AE1A 1VRQC 3THTA 2GMLA 4JV0A 4J9RA 3IGVA 2R7OA 3OT9A 2ASDA 2ATCB 1XC9A 3R5CA 4Q0BA 4RW9A 3CW2C 1U4BA 3PXGa 4CO5A 3MCSA 1TKTA 1Z1ZA 6FDRA 1NZAA 3P96A 4A8YA 1VQOS 1HD1A 1U48A 2BE7D 3U1LA 1IBMJ 3M6XA 3BQ1A 3FMBA 1WSRA 2PA8D 1TL3A 3OPKA 4OZ2A 1J5OB 1VQMS 3J7AN 3W9HA 3N9UC 2L9WA 2MQMA 3FKBA 3O8WA 4UTGA 5KT3A 4EBCA 2HWHA 3VAKA 4C4WA 4ES3A 1YJUA 4ANEA 5J1EB 3RAMA 5D3GA 4FNIA 2HBZB 4ZPBA 4C0OC 3J80Y 1X9SA 2WVDA 1HARA 4ZDNA 1CJUA 1JLQA 3KUHA 4R8UA 2RNEA 2AWZA 4C11A 2MZ1A 2EKYA 3I5AA 2C3UA 2JOQA 2AJ4A 1PC4A 3Q23A 3MM5B 2E44A 5J1PA 2D1CA 5BYRA 2EI5A 5IT9Y 2XS7A 4F8RA 4BCAA 4JI5J 1RAHB 2Z0GA 4K5RA 4DR3J 4B9NA 1HQUA 2CZVC 2UP1A 3T9NA 3I82A 3CC4S 2HK2A 2H5JB 4RUAA 3D3CJ 3QYYA 1FTCA 4KTQA 2HQIA 4AE5A 3JB9k 2OPSA 4J37A 2B51A 2DIUA 4F4XA 3D2WA 1UVLA 2NLWA 1IN0A 3DMJA 1ROFA 3JAMU 3JTPA 4I1TA 5GVQA 5I3UA 1DZ5A 1AUSL 1R43A 4BWJA 1R0CB 4DS4A 4QZVB 3PW0A 2HHSA 3HJFA 2RRBA 3TRGA 1Y5IB 1NMEB 4I6AA 4LFBF 1A9NB 3QNWB 5KT2A 4KGXB 4HTIA 3OUYA 1M1HA 3GYXB 3TZWA 1V3SA 1NDPA 2ZITA 3DNCA 1Y0HA 5MLCV 4CT9A 4J9QA 3KYLA 1QAJA 3FBEA 3TAPA 1OSDA 1Y9OA 1B3TA 3I5BA 3TAMB 2RIJA 1WF0A 3BH7B 1Q95G 1FFGB 2DNMA 4KC5A 3LGMA 5HAOA 1M1KT 4JV1A 3KK2A 3M6UA 2NSCA 4WE1B 4ED5A 2HKEA 3F0NA 9RUBA 1SC1B 2E7VA 2QA4S 4P2MA 5JJBA 2C2MB 2ZH9A 1HW8A 4WJBA 1KQKA 3EGNA 2YNFB 4TKTA 2XWXA 4QW9A 3AJ1A 2YBVA 2Y8WA 1FJCA 3TO8A 4J9MA 4KAIA 2FZCB 1F9HA 4KH0B 3S01A 3OL8A 3DGPA 3HDSA 4O3RA 4DR4J 4O4GB 4CLYA 4KFBB 1T3OA 3J7ZT 4PG5A 1CSJA 2QYGA 3CTRA 1BWVA 3RZAA 2EG1A 1U6BA 3K17A 2EW9A 2IBOA 3H90A 1NSQA 4DLEA 5D4LA 1EKRA 3OTBA 4LF7J 2KDOA 3PVXA 3CJ2A 1EX8A 4OHWA 1YLXA 1RTIB 4LQ3A 2CWXA 4PG7A 4JP8A 3EGWB 3NOCA 3C6UA 1OY9A 3T1HF 2M70A 2C42A 5A8WB 3M05A 1NCLA 3ZZUA 3MMAA 2VA3A 2OP5A 4DFMA 1GXTA 5DRKA 2IM3A 3MTKA 1S48A 2OPPA 4YOEA 1VLOA 2R2RA 3QMQA 4TY9A 4J7CA 3BDPA 3GQCA 2DRBA 2Q6BA 2V69A 1VRTB 3CJRA 3I87A 4QYRA 2DH8A 2GS8A 4C3LA 1B0TA 5EGYA 2LLZA 3WDOA 4LRFA 1RADB 2M8HA 1L3TA 1GXUA 4GO5X 1XBWA 2CPXA 3QIPA 1DARA 1NK7A 3PACA 1LWFA 3QIDA 2HGNA 2I38A 4OX6A 1RE1B 3UPFA 2ASJA 1IBMF 2IVMA 4F25A 1F3VA 2P8IA 1SC4B 1C1CA 2BE2A 3W5XA 3DRPB 5A6PA 2ASYA 2XB2D 3BPDA 3IWNC 1FXRA 4IRCA 3MM8B 2J0XA 1RU1A 3DU5A 4ICLB 1WC0A 2Z57B 1IXKA 1X5PA 1RBLA 1JLCA 1NB2A 4WIQA 5KFJA 2LQ5A 4B3OA 2EVZA 2PA3A 4TQRA 3H5YA 4OHXA 3HVWA 2IPOB 4P2XA 4RW7A 1O5JA 3PV8A 4C8KA 5A8RA 1RTJB 3MCMA 1NAQA 3HVTA 4WZMA 3I0RB 1SJRA 2QEXS 3ZTOA 3W65A 2AIRB 1MMDA 3Q8RB 2B9YA 3ZTPA 2W8KA 2W2PP 5AXKA 3ENQA 3PRBA 3WQPA 2VKZG 3DKDA 3GTYX 1GX6A 3LF0A 4U96A 5CYJA 3VAGA 1EP4B 4JI0J 2DR6A 2KYXA 3UNGC 2OGUA 4N76A 2RU9A 2VG5B 1FNOA 3IO1A 3E3XA 4ZITA 4USVA 3ZZOA 3JS9A 2VV5A 4F67A 1U26A 3HHDA 2UVWA 3I4HX 3D9BA 4KJIA 4ZCMA 3GV7B 1AA1B 1RWXB 2E5LF 5A8KB 4OX8A 1VRUB 4LIRA 1RKIA 5BYQA 3JSYA 2GMHA 2IM2A 3FZ2A 4NLUA 2LDIA 4L74A 4NLOA 4AD6A 4TVAB 2NCKL 2ZKTA 3KJVB 4WU2A 3CJ3A 5CZXA 1T3NA 3K5PA 3QWPA 2CXEA 3ELHA 2ZH3A 4B3MJ 4H4OB 2WW8A 3UE2A 1VK8A 2RMLA 3RRHA 1P8GA 1QSSA 4ED1A 2Z4PA 3HZEA 2HGMA 3U1MA 1KEKA 1WEXA 1OSCA 1W26A 2VUGA 3NBPB 2MQ8A 4ANDA 2LYVA 4KKOA 4NX9A 3TVKA 1TKZA 5ETSA 5GMEA 3A12A 2VJVA 5F8HA 1AXQA 4NLSA 2F40A 4ED0A 2DB1A 3I9V9 2B4VA 2QL9B 2P5VA 3IA0A 4LBPA 4JI4J 3IM9A 2C3PA 4DX6A 1NSAA 2RRNA 1YIJS 3LWLA 4W4MA 1TVRB 3LGNA 3J81j 1LWEA 2VQFJ 3CJ8A 3DXBA 2XS2A 1EZZB 3BBFA 2KL8A 2CUYA 2FJWA 1I1GA 1M5HA 2XMMA 3QAUA 1UPPA 4B08A 2GCFA 3JYTA 2C2RA 1U02A 2YWFA 4NLYA 3CDEA 3SDEB 5D4PA 4J9LA 3EICA 1LKZA 2Z2MA 4S0MA 3DDIA 5IV4A 3DLEB 1WC5A 3N79A 3PEJA 1AB8A 1FERA 1SV5B 4G6VB 4F4WA 2R8KA 5FJ4A 2G0CA 3VCDA 1X9MA 1C2PA 2OMLA 2AYEA 2J9CA 2CQ4A 2DGSA 1EETB 1SL0A 4NOHA 1NJIT 2FZGB 1Y7PA 3CMQA 2ZH7A 4ES1A 2HRTA 5SUHA 2J0WA 4WFBQ 1HA1A 2AEFA 4Q2LA 4KO0A 2PDAA 1T8EA 2YPZA 3UI3A 4CLZA 3OHBA 5CAAA 3QPIA 4MYUA 2QO3A 1C0UB 1SIWB 4X65J 1NJXA 2BQ3A 3OVSA 1WJ9A 2R7QA 5CYMB 2J0QD 5HO4A 1NSPA 4LQ9A 1Z2LA 4FYYB 1R8CA 2XSFA 1CC8A 4MKYA 1SC6A 2I0XA 1IWGA 2QLJB 2M7SA 3DI6B 2FHJD 5IM0A 1Q7YT 2D3UA 1S59A 1GAOA 4X64J 2VFRA 3FZBA 4FF1A 4RBTA 1YVFA 4A8WA 5L46A 2BV3A 1QVFR 4ELUA 1TAQA 3ETOA 3FEYB 1ZTTA 4PXDA 2LECA 3CJKB 4DN0A 3J81Y 5J2NA 1Y3KA 2H3EB 1QE1A 3BBCA 4CM2A 3CJ0A 1N5VA 5LL6d 4RNOA 3UQSA 2MZJA 3LANA 2CPHA 4NA2A 2GO8A 4ALZA 4R0EA 4JI8F 1CS4A 1ZM4A 4X84A 3IP0A 4UF4A 4LVNP 4ZS6A 3THVA 1JLEA 1BD6A 3UNYA 3N28A 3IBFB 3K2YA 1AYEA 5B0EA 2C2OB 3CCZA 4DXLA 4N5SA 3CDWA 4LBHA 1HWIA 2O67A 2VL1A 1KHWA 3EE3A 2DGUA 1U2RA 3SCIE 1HD0A 2VOPA 2HHHJ 4JOUA 1RACB 1JKHB 5KFSA 4YS2A 1Y11A 4EU0A 5J2PB 2HFNA 4TXSA 2QN6B 2NYIA 4C3KA 1N48A 4U7CA 2VH7A 3EGVA 4E0DA 3ILOA 3W63A 3BREA 4EYIB 2BACA 3L95X 1ZA2B 3QJLA 2MKSA 3ILIA 1M5OC 3PHEA 4OX9F 2YNIB 4DR2F 4DV7J 4OI0A 2QMXA 2G1DA 1RSCA 4ZP9A 2ZH2A 5B09A 1RK8A 2K7JA 2B4OA 3W2VA 3H4DA 4KQZA 2PN6A 3B8HA 3SEOA 5HQLA 4LBIA 2XYGB 1R27B 5IT4A 1M1GA 1U1MA 2AMCB 4FDFA 1RYRA 2JC0A 1ZZFA 5CZVA 2MHEA 4OV1A 3CJSA 3G71S 3HHLA 5HP1A 2UVRA 1KQSR 4F50A 2KYZA 2FPHX 4F0HA 1RZMA 4WKYA 4Y28C 1LK7A 2QGFB 5K8PA 1H2VZ 2B3TB 1RWNB 2YVSA 4ZVEA 2UUCF 4JYAJ 1ZM9A 2V4RA 4PYDA 2BDPA 3HLUA 1YBAA 2CJ9A 3ZO7A 5HJYA 3OTCA 3KUEA 1WACA 2EKNA 3OJUA 2NPIA 2HHTA 2W9CA 4WCEQ 3KMQA 2XHCA 3WC0A 5KFTA 5D6GA 1N0UA 1MWYA 1A6LA 1H98A 1U8SA 4NI2A 2OPRA 5F8GA 3L9ZA 2MJNA 2FHKA 4DV3F 1RWPB 1WF2A 2XHWA 2L3MA 2X51A 3IR7B 3GV8B 5D4OA 2HK3A 2LQBA 4FPIA 4O3PA 4MJKA 2BX6A 2XO6A 2P6SA 3R5DA 2KXHA 4CLKA 1OWXA 4LF6J 4X4OA 2HWIA 4I2PB 1OO0B 5EWEA 3Q83A 1S4FA 2LVWA 3O6QA 5ADZA 3WC2A 1X0FA 3BBBA 2UV8A 2F9JA 3HZGA 1H6KX 4P6QA 2IDLA 1RHQB 2YWWA 4PCQA 1J5OA 4FF2A 3R2CJ 4B3RJ 4HH1A 1F9EB 2M5YA 4Y34A 4RJVA 1I94F 1R7IA 5BR8J 3OL6A 2ZDPA 2AGOA 2KJWA 1XR6A 3I0SB 3MI7X 4ZIVA 3CWJA 5GADI 1MN7A 3DRSB 4PG4A 5KFBA 2V2QA 3TEHB 3HJVA 2GNKA 3KTQA 4P2SA 3OFFA 5KTQA 2HHXA 1FEEA 4CO0A 2HHUA 1PJ5A 3MM5A 4DQIA 3TARA 3OTOJ 1UVKA 1BXNA 4F7VA 4QWBA 2X1FA 3OQ2A 4DI6A 3DM2B 1YZ6A 2D74B 4IOCQ 3I56S 1BQNB 1FE4A 1FE0A 2A0FB 2FVRA 4ELTA 3P3DA 1RXOB 2HIYA 2LA4A 3SBMA 4Y2MA 1E6VB 2N7CA 2WVCA 2ZJQQ 5I3QA 2DGOA 2OH2A 2BM0A 1HHSA 3DU6A 2GQ2A 4LFAF 3MOJB 2VFTA 5L1LA 1N34J 2O66A 2UXBF 3D0GE 5F9NA 4CH1A 2VDIA 3CT9A 1VBKA 3BO2A 1XNRF 1H7XA 4LVOP 3MPVA 2BA9A 4YDXA 2RHQB 1X4AA 5DG9A 5KFCA 4I6YA 4K4VA 3OXGA 2G0IA 5IXUA 5KG7A 3EZ5A 4Q8FA 4LT6A 4NMLA 1GMWD 2R42A 4ZPAA 1H2UX 4KT0C 5IZHA 1TMJA 4RUBA 1XQIA 3P8BB 2LEPA 2HG4A 2KHCA 2J6SA 2GVDA 2RF2B 5F8LA 1JMTA 4WWSA 3KHRA 5DZ6A 1T95A 1IJEB 4L75A 2NXUA 5KT5A 4B9TA 1LFPA 3PFOA 2M3DA 4F3OA 1QSLA 4CYUB 3TAMA 1Q78A 3QJJA 1LW0B 3ITHB 2Z2LA 3FK4A 4WTOB 1N36J 2WVEA 1GK8A 4DPTA 3G9CA 3ILLA 3G8QA 4LSNB 4DF8A 3AH6A 4WE1A 4DV7F 1F0XA 4R5PB 3U7JA 1N5YB 4ECTA 3D6HB 3NWRA 1TR0A 4DSLA 3MAQA 3MEDB 1UA1A 4IG3A 3SV4A 1SKWA 2F8EX 9ATCB 1P9YA 1QAXA 1GNKA 1U0SA 2YNFA 4L6V3 5KFGA 1S6PA 1OPZA 4ZCKA 1QVGR 4DHVA 4NLDA 4LSLB 1HBNB 3L7OA 2OEJA 1S1UB 3I6PA 2B43A 3QT6A 4OZ0A 4K4UA 1FRHA 3IAM9 1D8YA 3F73A 1G1XA 4TU9A 1U24A 3TZYA 1WI6A 1RT3B 4QR0A 2A18A 2NQPA 3TYTA 5L9XA 1VMBA 1HHQA 2YKAA 4WP3A 2YKMA 4TN2A 1X4DA 4O4GA 4KFBA 1YJTA 2ZZMA 3A3PB 4FBUA 3AFGA 3DRRA 4RWXA 4HLBA 3FQKA 4OYAA 4ZVHA 3FEZA 4FP9A 3NEKA 2M4MA 4FYWB 1SUQB 1RTIA 4M5JA 4RW4B 2UUBJ 1S6QB 3BYPA 4NLGA 2RUSA 4AT1B 3JQJA 4OZJA 4KPYA 3CJQA 4HT5A 4XDDA 2BZ2A 3DLLQ 4LF9F 3DRXA 1T9YA 2HSEB 5D0RA 4YDDB 1GMVA 2N7YA 1JLAB 1X8DA 1HHTP 4X4QA 2DHSA 3BQ2A 5DLGA 3FFIB 2XMAA 1WUUA 4USWA 2IBKA 3GFZA 2R7SA 1UEKA 2A1BA 2DRDA 5H1SV 1DTTB 5ETPA 4USIA 3GCXP 1M5PC 3GR0A 1SQFA 4EBEA 3D54A 4DV4J 4ZLPA 1REVB 3OR2B 2Z58B 2C3YA 4B3RF 4IH5A 2XMVA 1TUWA 2MY8A 4BC9A 4C8OA 1PSDA 5J2QB 3TZZA 5BR8F 3T6JA 2ZHBA 2VB6A 3MEEB 5AXNA 4YR2A 4NXMF 1Q5YA 1KVIA 1WELA 4RPFA 1U47A 4AQYJ 1ITPA 5T7LB 4DUYJ 1Q1KA 4U9RA 4Y2AA 4MMOA 4M5KA 3KNAA 2C2NA 2JWNA 1RTJA 4QWEA 3OTOF 4GKKJ 3I0RA 4KHPF 4K4XA 3SCLE 4Q0BB 4DPWA 2H9ZA 2DEIA 5AJ3J 3OFHA 2Y1JA 2V4JA 5ETRA 4J9KA 3BO4A 1RCXB 4DV1J 2F5GA 5DDRC 2JDJA 3K8VA 2KM8C 3OVBA 4KGMA 4JI7F 3GMGA 3MD1A 1TL4A 4ZJLA 4CLPA 3FEXB 3T6BA 3R5AA 5FIIA 2BKNA 4QYZK 1PC5A 1U1NA 1REGX 2Q3PA 3W9IA 3TX0A 1AROP 3PW4A 5EN1A 4G1QA 5D3GB 1AUDA 1CEZA 1YITS 2OKQA 5CCMA 1UA0A 4ECQA 3FCVA 1GX5A 3V6DA 2VG5A 1JLQB 2DHXA 3JAMY 1MWZA 3CNQP 2VHGA 4RBUA 1JXEA 1HWKA 4K0KJ 3R5JB 1HQEA 2IMWP 2ACYA 1X5SA 2EK1A 4P7TA 2MGZB 2IIHA 1DHMA 3BQ0A 4QIEA 2BQRA 2M2BA 1WHYA 7FDRA 1HR0F 1VRUA 1N6QB 3MUMP 4FPRA 4PG6A 1RLCL 1RT4B 1F60B 1RAGB 2HNDB 3PKYA 4MK9A 3KJVA 4IUFA 1H3DA 4UW2A 4PYAA 4H4OA 3OLAA 3OL7A 4DV5J 2DNLA 2YKNB 3GYNA 1UW4A 3RU0A 3HMJG 1JJHA 2CQ0A 2WB4A 1H7WA 5T14A 2BABA 2HQ3A 1LOUA 1FI4A 2FDNA 4URGA 3VGVA 4LRAA 5I3UB 3NBPA 3H2LA 4DR7J 3IS9A 4A8QA 2QJ3A 3WIUA 3NNHA 3Q2TC 1IKWB 1WI8A 1X4FA 2C28A 3ICLA 5IFMA 4YN3B 2B0GA 3OUYB 1TVRA 1VQ7S 2DNNA 2QFJA 2RJZA 3NY0A 4PKDB 1FJGF 3FBCA 5C42B 2E5HA 3DN9A 2GIFA 1MNEA 2GO9A 5JXSA 2ATLA 1NH7A 4IFYB 4PPZA 4DCPB 3DLEA 3F56A 2DY1A 2IAJB 3FUYA 3KK2B 1FA0A 1H74A 2Q6CA 5ETMA 1N54B 4NRTA 1SV5A 5HBMB 3QT5A 1FRJA 4U8YA 4NCAA 1RT1A 3UWTA 4PXEA 4Z7CA 2AU0A 1C4CA 3GONA 4DL0C 1FO1A 2E5GA 1VQLS 2CQCA 4CLLA 1RTDA 4LFCJ 1FJEB 3QFHA 1UWBB 5DQIA 2V8VA 2ADCA 3QGGA 1N32F 2LMIA 3CJTA 1JK9B 3FSYA 4TU8A 4IH6A 2SXLA 2RE1A 1C0UA 3W9JA 2VASA 4LF5J 1X5TA 2HS0A 3BYRA 2DBBA 1QY7A 3GIKA 3DGPB 5HMWA 2UUTA 5KOXA 4H4KA 3CCJS 2IY5B 3TA1A 5GADU 5DJBA 4JI6J 4C2MA 2NZCA 4ZLNA 2FB0A 2KH9A 4EZ9A 2RUGA 2CJBA 1OMSA 3NAHA 1FDAA 1KFDA 4P74A 3OV7A 1VQPS 1WKKA 2WB1D 2HNYB 1SJFA 4C98A 4MAKA 3WIVA 3P49B 2J7UA 1VS3A 2P9CA 3RBEA 3NWGA 3HD1A 1RHMB 2ZOMA 1HIYA 2CQIA 4C48A 5LJ3Y 4YHHJ 1NUEA 3A4TA 1WWHA 4EBDA 4AQYF 2OPPB 4DUYF 4N77A 3OTDA 3CD6S 1Q0NA 4AL5A 1T03A 3W62A 4C0HA 2KRBA 5LMUJ 4DUTA 4C0BA 4V19X 1FD8A 1SKUB 3T9ZA 3ULHA 3TQ1A 2XLKA 4GKKF 3RB4A 2AEJA 2XCPA 3PRDA 3CVKA 1NJWA 4JI3J 3IWXA 4L76A 3QIPB 1B99A 5KFYA 3RG6A 5KFPA 3HVAA 3MURP 2FLOA 3K5LA 1WF1A 3HFZB 4FF4A 3G96A 2C22A 3I5CA 3MHYA 2MQPA 1KOOA 2YWGA 1C1CB 2BE2B 3BM7A 1HNWJ 4NXNJ 1JKHA 2E29A 4AL6A 1HBUA 4A8XA 1Q8LA 1PILA 1K73T 4ECXA 5IQ6A 3A13A 3R6GB 4EFAC 4FNHA 5KFXA 2X1BA 5H9FK 3NXZA 1JLCB 2NREA 1T9VA 2CAJA 3BGRA 3VAHA 2ZWOA 1J5EF 1Q79A 4MIBA 1NEEA 3M8RA 2JVOA 2AX1A 3P4UB 2R9LA 3PW5A 3K5NA 1TKDA 1W2BR 4OYBA 2V2VA 4RNFA 4OLOA 1NPKA 2LKZA 3MCOA 2GHWA 3Q24A 1TL5A 1VGYA 5KFAA 3KG0A 2B8QA 2FY1A 4FXWA 3NGTA 2PT0A 1LWCB 1P1TA 2GAGC 2LQ9A 2QZ8A 1QTMA 5EX0A 3H59A 2W2MP 3IWLA 2B5JA 2CPZA 3RRGA 2ZH4A 2WTFA 2R7WA 4HDGA 4DV5F 1IBLJ 3BN7A 4PAAA 4DN9A 4NPOA 2Y1IA 2YQ0A 1URRA 3QRQA 1V5VA 1RAOA 1KQGB 2QMUB 2XLJA 4KH1B 1LNQA 5HVGA 4EEYA 2XGQA 5HMZA 3HKZD 2PMZD 3V81B 2XY5A 3D6MB 3IFEA 3VAIA 4DR7F 4V19J 4YB5A 2RDDA 4QOTA 3MM7A 1QAIA 4HHJA 3H98A 4QYZJ 2W4PA 3N6NA 3GR1A 2FGOA 2ZH8A 4ITSA 1FNMA 1RLDA 5CCLA 2B4PA 2DNPA 3M8PB 2HZAA 5F8IA 3H2VE 1D0EA 4CLSA 1VISA 3RAXA 4CIOA 1WOSA 1IR2A 1YDLA 2C2ZB 1R0BG 4RW8B 4ZPDA 2H1YA 1X7VA 4YUDA 2BRKA 2G2YA 2I6WA 4URQU 4CRJA 5HVHA 1N88A 1DQ8A 2J8AA 3R1LA 4JV2A 2GAHC 4ZCLA 2DNRA 2VODA 2ZUGA 4WK1A 4I2PA 3HK2A 2Y3YA 1BC6A 1CJKA 2WAQD 3PYFA 4JI1J 2E7XA 1TKZB 4NLXA 4GO7X 1Y4ZB 5A2QU 2XI3A 3E8OA 2BJDA 4PEOA 3QJPA 4LFCF 3R7SB 1T9UA 5D0EA 1FK9A 4R25A 3GU0A 2DXDA 2D3ZA 2N4DA 2IRYA 1UW9A 2VG7B 2BE9B 3I0SA 5M2PA 1LFWA 1XMOF 3DRSA 2ZDOA 2WK4A 1YBTA 3JYTB 3AQPA 1VBZA 3PDNA 4JI6F 4MYTA 3K5OA 2RS8A 2HS4A 3IRWP 5IOLA 1QLNA 4DR5J 2FD2A 2J6TA 4G3IA 2G1HA 4USHA 5G4DA 2HHWA 2M9KA 1SKSA 2FGCA 1T05A 3DM2A 3G82A 2K3KA 4IG0A 3ET6A 5ETNA 5I4MA 1X4BA 2YKOA 1NPRA 1FXDA 2FLLA 4FBTA 2BMBA 4IYQA 4UOFA 3K7RA 3CD5A 2R3VA 4YHHF 2NUUG 3B82A 1UMJA 5B0CA 3BKUA 4DJBA 4KO0B 3JTOA 3PJ9A 4WTYA 2J7KA 1FRLA 4MKVA 3V4IA 2E66A 1U8WA 1IQZA 1XERA 4ER8A 5LMUF 4OL8A 2QSWA 1KC8T 3DYAA 2ZJPQ 2XZDB 3HVRA 2HQCA 5L1KA 1K9MT 2N3OA 2ZHAA 2Q79A 3UVJB 3OXLA 4WP8A 2KI2A 3GSIA 1SVDA 1KDNA 2KT2A 2F3JA 4ECZA 2ZH6A 5IV3A 5LXYA 1JIHA 1B7FA 3NCQA 4C3MA 2XQCA 3E51A 4B9LA 3OR1A 4J9NA 5DZ7A 1IJFB 2GW8A 5CYQA 1HNWF 1ELOA 3C19A 4N47A 2QE5A 2L41A 1XEZA 2KTQA 4AL7A 1ZYQA 1R6YA 2ZD1A 3DCAA 4DFPA 1A7GE 1Q8KA 3PHTA 3R7NB 4ZVPB 2MQLA 1UFKA 2R2UA 1OY6A 4CYUA 2D3OR 1TK5A 1QE1B 4DWIA 5IC6B 2UU9J 3KUGA 1D9AA 4LSNA 4RR5A 1HI8A 3MM9B 1N5YA 1CS4B 3CB4A 3UD4P 1MSWD 2ZNYA 3KK3B 3AXKA 3W2WA 2J8SA 3T5KA 1JLEB 2LXUA 5AXMA 5J1NA 2E1PA 3M8SA 2W9BB 2RT3A 4RBVA 2R7RA 8ATCB 4DV6J 1S1UA 4YB7A 1ICEB 4F2RA 5KT4A 3W60A 1OYDA 1XMBA 5KFVA 1MMLA 3M9OB 2YNHB 1UL3A 1RT3A 4ZHRB 1NZ8A 2V4QA 3KJQB 4DV0F 2FVPA 1RAIB 1J27A 4C8MA 1UTAA 2DRAA 1JJ2R 4ZPCA 3W61A 3RB3A 3BR8A 1NM2A 3NGSA 1SJ4P 2DH9A 1WORA 3KWMA 1NSKL 3NGKA 2Z56B 3I55S 4RZRA 4B3SF 5L39A 2B56A 5H9FJ 4RW4A 1PYTA 5E0OA 4WFZA 1S6QA 5KFLA 1WD6A 1XN9A 1YBUA 2QLFB 1UJ4A 1U7LA 4ZKAA 2XYHB 1TUGB 2XZTB 2F9DA 3SSSA 1VYAA 4P2FA 3H5SA 3RGIA 1P27B 4NYOA 2RDJA 2JEGA 2YKQA 4M5LA 1JLAA 1YG0A 3UN2A 3N01A 2LEBA 3VALA 1N5TA 4NCGB 3FFIA 3HHLB 1BHNA 2J9EA 5HP1B 3T41A 1R31A 1VJWA 1SQGA 5CQGA 3SCJE 4EMDA 1DTTA 1C0TB 3JQKA 1RTZA 2OFGX 2JLEA 4RU2A 3PYGA 2IA6A 3FBBA 2F8HA 1U1KA 1Q86T 1SC3B 3OR2A 1FFSB 2KN4A 4O3OA 3CCRS 4TLRA 4C8NA 4X4VA 2HRUA 4W90B 2CRLA 5J2QA 3ZZYA 1WSVA 4DL2A 3MEEA 3LPYA 1HBMA 4CO3A 4AUKA 4NI2B 5JUMA 1FRKA 2OPRB 3GJTB 4Y0FA 1JQGA 3PY8A 5F3ZA 2MYFA 2Z2YB 4PWWA 4DR6J 1PKUA 1XIQA 3I4PA 2B7CB 2YTCA 2DHAA 2MZSA 5H9EJ 3CPWR 1I5OB 2HURA 4ECSA 1RTHA 2MLXA 2XMUA 5IQQA 2AYBA 3TJAA 3FNNA 2BBEA 5L9NA 1IBKF 4TYBA 3DRYA 1DAXA 1PJ6A 4EWTA 2OD6A 2IM1A 1BQMA 5HANA 2AP6A 2E9TA 2CWKA 4RNHA 4C6AA 2VBXA 3EJMA 3CCMS 4OJHA 2ZZNA 4DQSA 3Q8VA 5HQMA 1CG2A 2VIHA 3PRVA 4CLWA 3I96A 1VJQA 2CJKA 4FVMA 1YJ9S 3HPOA 3D28A 1LXNA 4P75A 5K5MA 5HMXA 1VR6A 3OLBA 2RB7A 2DJWA 2MGZA 1KLMB 3DOLA 2FHMA 2VJUA 2XYPB 3FC9A 1QTNB 1RYSA 3J7A1 2PI5A 4KRWA 4QIFA 3C66A 3L7UA 1N6QA 1MU2B 4LR7A 4P52A 3K0JA 1RT4A 1PG5B 1HQ2A 2HNDA 2G13A 3TUZC 4WYLA 2APOA 3IG1B 4TNOA 2K8GA 3Q8QB 3EUNA 2Z8QA 3ISND 1APSA 5I42A 8AT1B 2YKNA 2LFVA 3OD2A 4CM0A 4KHMA 5KG4A 4M5DB 4EUVA 1KSPA 2JRSA 1F6TA 3C16A 4DMZA 1Z2ZA 2OEKA 4P71A 2R7VA 1OQ6A 3CMES 3BO3A 2YQ1A 4K8RA 2XM3A 4N8NA 2BANB 3D6TB 5IWAJ 5G0RA 3M4XA 1XNQF 2DGTA 3HI9A 4PPDA 2P2CB 2ZC4A 3DGVA 1IKWA 3T3FA 3PIOQ 1HPZB 5L1IA 1FTRA 3KK1A 4MFBB 5K8MA 4KHRA 4DV6F 4ID5B 3PG9A 2NUHA 2WONB 3DDNA 5M2UA 4DSJA 1L5UA 3ZZRA 2UZAA 2NS1B 3R1HA 2V34A 2ZC3A 2BJ9A 2GVDB 4DL4A 2OPQB 1M0SA 2BJ3A 2M88A 3IRXB 2IJFA 1Q82T 3F41A 2G2OA 5C42A 4MT1A 5F8MA 2HVIA 2MQOA 5DGAA 2GMJA 1NBEB 4KGVB 4WXWA 3L4BC 4LF4F 4Q43A 4IFYA 3K89A 3IR6B 2YY3A 4B3TJ 4JV5F 2IAJA 2R7XA 4OI6A 3FCWA 4HYKA 1T94A 5HBMA 1RBAA 1H73A 4QR1A 2EFGA 1KVJA 4IG3B 4ZVFA 4JI2F 2HPUA 1FXLA 3V4MA 4USTA 1M5SA 4IOAQ 1X60A 2J0SD 2RQ4A 3H4BA 4CCHA 4DL3A 1ZA1B 4IR1A 1CC7A 1S6PB 2V8HA 4QWDA 5K8NA 2XI2A 2JEIA 2KO1A 3CCQS 3GIJA 1UWBA 4NRUA 2FVSA 1W2IA 3OSPA 1JWWA 1F5BA 2FQQB 3KHLA 1QDUB 2AQ4A 2ZFHA 1IKXB 1ZAWA 5E33A 3R97A 2YKMB 1JNRB 3CCVS 3X3UA 4DPOA 1NDCA 4BLGA 1HWUA 3CGIA 2VC0A 4X62J 5CA5A 4ED4A 2EFPA 1C1BB 3DRRB 4MIAA 3UO0A 2AZ1A 4LF8F 2DHGA 1VQYA 4IFVB 3OFGA 2HNYA 2CPEA 2IVFB 4F02A 4OQJA 2UXDJ 4CTAB 3DXSX 1IWAA 5BJRA 4ZVUB 4WFNQ 4O3SA 2FHOB 1EHWA 4RW6B 2PI4A 3VQSA 4ZK7M 5HI7A 4TQSA 3H25A 2MJUA 4DR6F 3IM8A 3OSNA 4ZLLA 2MDAA 2COLA 5KOWA 2KZMA 3K58A 2JSXA 2FJDB 1NU4A 3CE8A 3HHLC 1L3VA 2BKOA 2QFIA 4XAKA 4U7UD 1LV5A 4DZ6A 4OYOA 1QD1A 1KVKA 5U47A 2AV5A 2CNKB 1MWQA 4FF3A 1DURA 2FVCA 1FT8A 1ULRA 2GHVC 2ZWPA 5CD4A 2DISA 3MAHA 5K8OA 2MLYA 3JSRA 1XTZA 4Q5VA 5ETVA 1FVSA 3MGJA 3AJDA 2AJ2A 1S1TB 2YH1A 3WHIA 3GILA 1U0HB 2VFSA 5C5JA 1U1RA 4IQXA 2MTLA 3K8WA 4NEZA 1HNXJ 2MZTA 1BQXA 4I2QA 4TYAA 3B4DA 1CQMA 2QL7B 3N5FA 4MK7A 3G8TA 1UETA 3QGPA 2R4FA 1UWAA 3EXCX 2OEMA 4OYXA 2BYCA 3IBWA 4JI5F 2RKIB 2IA0A 4PWDA 3T1AA 1D8ZA 4DR3F 2QSFA 4FYXB 5HVFA 4FXDA 2V4JB 1LWCA 5DM6Q 1SXLA 2DHHA 4QW8A 5AT1B 2U2FA 2AJQA 3CCTA 4NZ0A 1UZHA 3H42A 1UVJA 2DCUB 1R8AA 4J9OA 1S97A 2B9EA 2LXFA 1TK8A 4RUCA 2ROGA 4DQRA 3AJ2A 2CPJA 1FNXH 4G1QB 2G0JA 1SJ1A 3V81A 2ZM6J 2IFXA 1JXVA 4LUBA 1K1SA 3V6DB 2UVUA 4CLTA 3PX0A 3EXYA 5GMDA 3LAKA 3MR3A 1F5AA 1HQEB 1CJTA 4IDKB 2DR9A 1N33J 2JNJA 1U2CA 3PIPQ 3M8PA 4ID8A 1O0PA 5KFQA 4LJMA 4RX6A 3GV5B 3HM9A 1RT5B 3PO4A 4ENOA 3Q8YA 3CJ4A 4RW8A 1PYSB 2GGPB 2MLZA 2D3O1 4ANCA 1NJZA 2Y0SD 3HSJA 2ZE2B 3C15B 2GFFA 1NDKA 4P10A 3OL9A 1S7HA 3BSNA 3CD7A 3AD8C 1HYSA 5E3RA 1U1QA 2MXYA 4UQGA 2BW7A 4F04B 1WTBA 1VC0A 1FEHA 5B0DA 3TOQA 3QSYB 1HFEL 4OZ5A 4O3NA 3IS9B 3LW5C 4C8ZA 2Y9HA 2WSEC 1UZDA 2HQGA 4KV8A 1NK6A 3SYZA 2W2NP 3SQGA 5AXLA 2VFUA 5HJXA 1G2EA 4YR0A 3KLFB 2QT7A 4FN5A 3P5TL 4KIAA 2JH3A 3DLKB 3G4SS 2VG7A 1SQEA 2XCAA 4ILMA 2JFKA 2V8GA 4ED3A 2EEYA 2AYMA 1U1PA 2HQFA 1RAEB 4JB8B 1S76D 4NYPA 3KG4A 3UW1A 3PFEA 4RL1A 4DR4F 1PCAA 3O44A 1RT6B 2IYIA 4X62F 2V0NA 1OY8A 4I68A 5B0FA 3ZNUA 2CG4A 3KMSA 3NG8A 4OI1A 3D0IE 4LF7F 2B6AB 4WU3A 1K44A 3ZNJ1 1HNVA 4DBQA 3G2XA 1FX4A 4I6WA 3GFYA 3V6KA 2QMWA 2UXDF 1RT1B 4N8OA 3W7BA 4QWAA 1RU2A 5B0AA 3H0PA 1U2FA 2HFOA 4ATNA 3HF5A 1GQEA 2WSFC 1WC4A 1T11A 4O0NA 1WC3A 1FKPA 1RTDB 3OBIA 3FSIA 4ILRA 1ZBTA 4QJVA 2D41A 2R8HA 3DOMA 5E2QA 3D1QA 2ZKUA 3BGUA 4LRBA 3IAS9 3K5MA 3WX8A 1Q7LB 5GAHI 4O23A 4HHHA 2IM0A 1SL1A 3UVJA 1WHVA 3R9LA 1S1VB 3POTB 3D1OA 2HFVA 3EYZA 1RT2A 3DLBA 1RWKB 3LALA 2LU2A 2IYGA 2OMOA 5B0GA 3AY0A 3U02A 4OHYA 3R7BB 2ZUAA 1TL1A 3QZ8A 3RBXA 2U1AA 2CA9A 2BW2A 3SFGA 4EZ6A 2A3JA 2DCLA 5ETKA 4OZLA 1NXIA 4U95A 2OSQA 1HNZJ 3W5YA 1AZSB 3EPIA 5LXRA 2L9NA 2HBYB 3M6VA 4M5IA 4EO8A 1LK5A 1RI7A 5JVGQ 3D3BJ 1T03B 4OI2A 4LSZB 3MM9A 1WOPA 5CD4H 1TL7B 3K57A 3MFIA 3KK3A 1NHUA 2R2SA 4O3QA 1JX4A 2QLBB 2W9BA 3MMCB 3Q22A 2DKOB 4DZDA 3I31A 5M2RA 5DG8A 4A46A 1JJCB 5KFIA 5KFWA 3MUTP 1VQ4S 1DTQB 4YB1P 1N8RT 2XTJP 3SZ2A 2PEBA 1VIOA 1EAYC 5A76A 1NLKL 3VZHA 1SH3A 1G6BA 2A10A 4OYZA 2AF6A 1NDLA 2DNQA 2YNHA 2DK2A 1TKXB 2HVZA 2CZ4A 4CH0S 4ZHRA 2DO0A 3PJWA 1F1BB 2Q66A 3LTOA 3H5XA 2H54B 3PO5A 1HBUB 3P5BP 3P45B 3MR5A 4DPXA 1X4CA 4YMEA 2ZM6F 2BEFA 3Q2SC 3UD3P 4JI0F 4GMKA 3MOZA 3BGRB 1IKVA 2NR0A 3VHQA 1YJNS 2E1AA 1V5IB 5LMNJ 3GWCA 2MB0B 1ZAXA 3IBCB 3R5BA 3VGTA 2BJ1A 5K14B 3I9ZA 4DPUA 2EC0A 3T5LA 3F44A 1N33F 2ZEJA 3ONQA 3VTIA 3BSCA 4DSEA 3JSMB 2V9KA 2DNHA 3QATA 2GX8A 2KVIA 5GAEU 2XMTA 1I3OB 2DD8S 3CD0A 2O01C 2HMIA 3M9NB 3S7RA 5JMNA 4Q44A 2VONA 1GFWB 2B5JB 2DVIA 4NCGA 3GIMA 3GFXA 1HL6A 3GG0A 3HHLD 4B3MF 2XMJA 3H40A 3AAWB 4DL5A 2CQ1A 2EXUA 4IQMA 6FD1A 2HVDA 3VAMA 2JHEA 2UXCJ 2F65A 1C0TA 2JJ4D 1LEOA 4KGZB 3SCKE 3D7SB 3MTJA 5EUHA 3MM7B 4DFKA 1WKJA 2DO4A 1ZAVA 4OI3A 3K59A 5KG2A 5KFRA 1Q5VA 2JX2A 1ZM2A 2KB2A 4JI4F 4NCBA 1S1WB 1HI1A 4ECUA 4UQTA 5A2QY 4DCJB 1IM4A 2DNZA 1RABB 1AW0A 1P6TA 2VQFF 3VAJA 2JVRA 2X1AA 4NLTA 2W24A 3LGHA 2V63A 1BUXA 1CLFA 4B9MA 1BMQB 6AT1B 4NEYA 2DTJA 4UOHA 4FS2A 3ZZ0A 1RKJA 3PW2A 3VZIA 1PBAA 5KT7A 3RW6A 4QCLA 1WEYA 3A3OB 1L3UA 4I69A 3ISZA 3GZ7A 2R8IA 5B08A 2AW0A 3AD9C 2C1EB 2O3DA 2CADA 3ZTRA 4XPCA 4MIWA 3ENWA 4LRCA 2E1MC 4IRKA 1WTFA 1CJKB 2RRAA 4HTJA 1EIYB 1FRMA 1T9TA 2HFZA 1S12A 2A6MA 4B9SA 3S1TA 3CEDA 4N56A 5E3CA 4KE5A 5C7PA 2CQHA 1MMNA 1FK9B 5FDLA 1G3OA 1T9WA 4YP3A 1VBYA 2I2YA 4X65F 3NGRA 5CH7B 1XJWB 1KD1T 2IVYA 1TUVA 5E5NA 4QPTA 4HT7A 4BBYA 3MFHA 2YQ3A 4AFFA 4EK2A 4B02A 3TANA 2XGPA 3TW0A 1SBRA 1FVQA 1WC1A 4NA3A 2YPYA 2FTRA 1CULB 1KLMA 3C3LA 2NXEA 3S8SA 5KG6A 1UKUA 1K8AT 2RILA 2HVHA 4X64F 4RUHA 4XTTA 1T05B 3G82B 1B0VA 2E1RA 4IG0B 1MU2A 3ET6B 4ZVTB 4LMZA 1RWUA 2UUAJ 2BVZA 2YWEA 2JC1A 3GG1A 3CO0P 3IG1A 1HNZF 2I8EA 2MMYA 1X9WA 2M0GB 2YX1A 4X4SA 1EARA 1VK3A 3DDKA 5DM7Q 4M5DA 4B17A 3KLIA 4WYWA 4ERDA 3V4IB 2E5LJ 4PUOA 4ZVGA 3GB0A 5HLFA 1B4SA 3MEGA 3SSQA 2JZ5A 2ZVSA 3DYAB 5EDWA 2MEWA 3IC1A 1H38A 3TWZA 2X3GA 3IR5B 2BANA 4O44B 4AXJA 3FQLA 2V94A 2GIRA 1RWMB 1HWLA 1HPZA 1TK0A 3ENVA 4H4KC 2W25A 4MFBA 3MDFA 4ID5A 1T9XA 1TMMA 2WONA 3QRPA 2AKWB 1Y5LB 2BJ7A 2BR0A 3M6WA 3OR1B 2HHHF 3A8KA 3TEGA 2KFYA 5EHHA 5CYQB 1KOHA 2CJAA 1MN9A 2OPQA 4DL6A 1U49A 3IRXA 2ZD1B 2F4FA 3G6XA 1RT7B 4KB7A 4PRFA 3DOKB 1NO8A 4ZPTR 3PR4A 4BHQA 2ZHOA 3S6EA 3L3CA 5LMNF 2DR5A 1V9OA 2Z2ZA 4RO0A 1XMQJ 1SPBP 4A48A 2XMKA 4BS2A 2MKYA 2KG1A 3LH2S 2KT3A 3W2WB 3RW7A 2IDEA 1YRTA 3TX8A 1RB0A 1ZS6A 3LWMA 1H72C 2PD1A 2ALZA 2W4CA 2MY7A 1YJWS 3BS9A 3UFCX 3KKFA 2OAUA 2O1PA 3N6MA 2UVVA 2V2KA 3MR2A 2ZBCA 4ZOSA 2KG0A 1OYEA 3RUBL 3VVUA 3O2IA 3N4WA 2O5DA 4MKBA 4B9UA 3JQMA 5IS2A 1IKXA 1N5QA 3SSRA 3KJFB 3QSIA 2ZBQA 4HI1A 4CZCA 3GYGA 2M8DB 2ZVIA 1R6VA 2UXCF 4NLPA 2MQQA 2HRYA 2CJYB 1C1BA 3HHKA 4UUWA 2QLXA 3NMAA 5DDPC 4IFVA 4ZIWA 4JYAF 1VQKS 3GLJA 2MSTA 5D0HA 1SI9A 1MLAA 3QO9A 1UEVA 2CVIA 2CIMA 2BJ8A 2PC6A 3R27A 5A6WA 4CTAA 3UDVA 2AZ3A 4ECRA 3OJSA 4PABA 2MZRA 2H5EA 4K2JA 1W25A 1HNIB 1PO6A 3PJXA 2CVEA 2C3MA 4ELVA 4RW6A 1YQHA 5GAGI 2EK6A 2OIHA 4LR9A 2LQ8A 4HHUA 3C46A 3GP9A 3VR1A 4X4PA 3TI0A 4HVZA 5FLXY 5C24A 4IRDA 4CLFA 1Q16B 1NB7A 2V67A 5I3PA 3AA8A 4OZ1A 1VCTA 3R2DJ 2XSJA 3TUJC 4NLVA 4LF6F 4NZ6A 1V3RA 4M5MA 2PGCA 5ETLA 1EJ7L 4OJ1A 5GAHU 1WC6A 1KLNA 2AEMA 2MHNA 3VV2B 2I5JB 4NWBA 1GXLA 3EMTA 4W98A 1S6UA 2CFXA 1RUSA 4P7VA 4JI8J 4LR8A 1RAFB 3VVTA 1S9GA 2IC3B 1S1TA 2OFHX 3NRBA 2GZOA 1HBMB 1U0HA 1GTHA 3A8JA 4BWMA 2GJ2A 5KFEA 2V5HG 4NASA 3GIIA 2F4VJ 1VQNS 2OD4A 4C7QA 2CQGA 1BWEA 2RQCA 2V8DA 3NLCA 2KRRA 3DLGA 3GCWP 4OJ3A 5THWA 3UDCA 4OHVA 4X4TA 2WCXA 2H65B 4IKAA 3O5TB 3V5RA 3NOGA 1RTHB 4WXOA 1IR1A 1NRKA 1XR7A 5D15A 2RKIA 1RBOB 2D9PA 2VG6B 1GH8A 2CPIA 3M2VA 3HXMA 1M90T 2HFUA 3US5A 2UUAF 5ITHA 4ZP8A 3EPGA 1BQMB 4Z2XA 3QGIA 4OX9J 4DR2J 3EWGA 1DJ0A 4M5NA 1U25A 1V3ZA 5D8HB 3KLVA 1CBKA 3CCSS 1HW9A 4F0MA 1LW2A 3RBDA 3AOCA 4ZCIA 4L72B 3OVAA 1N34F 5C25A 4J90A 2KXFA 2I1RA 3BSOA 3Q8PB 2C3OA 3HD2A 2CNNB 1S0VA 3PZPA 3MM6B 4K4WA 4QU7A 2LA6A 3NL0A 4WK3A 3GSDA 1YRXA 2CJQA 4IDKA 2WVBA 2UV8G 3QT7A 2E7WA 2FC8A 3V2UC 1D9DA 4M5GA 3DOLB 2XEXA 2XY7A 4G65A 2HFSA 3KLHA 2CQ2A 1RT5A 3KFWX 2VF3A 1VBXA 2GGPA 3ZZZA 2R8GA 2UUCJ 1HBOB 4FYVB 1JJ4A 5HL7Q 4Q7AA 3JXOA 3MAAA 2VICA 2ZE2A 3C15A 3SQOP 5I42B 1R8HA 3CCWA 1PAUB 1NKEA 5DS7A 4I4BA 3C14A 2KFZA 1N36F 2CPFA 1R0AB 1U1LA 2BM1A 2DEJA 2FLNA 3NCRA 1XMQF 5D4NA 2LCWA 3C16B 2C2DA 4M1KA 1ZETA 4Y3CA 1F9FA 2ALYB 1AT1B 3EM1A 1S1XA 4A8KA 2HNZB 5G0RB 2ASLA 4Y2KA 1NK4A 2A2DA 2FJAB 3M8QA 3I32A 1JLBB 4DV3J 4CDIA 2YH0A 3KLFA 3KK1B 3W66A 3AD7C 2YX4A 4PR6A 1S5ZA 2W2OP 2YKPA 3HKWA 4J91A 3DLKA 3TUIC 3CDUA 4DOZA 1HMVB 2MKJA 1W7WA 3SMZA 1PBUA 2XNRA 3KLEB 4H4MA 1RT6A 4OX7A 1O51A 4WP9A 1Y00A 4XK8C 2B9WA 2R7TA 2V8PA 1FWLA 2Y1RI 4QIWD 3LP1B 3DC2A 2EC2A 4M94A 3KG1A 1K0VA 3RR8A 2DY9A 3UR0A 1I94J 2B6AA 5HROB 2LXIA 4ECVA 1OPIA 8RUCA 3AOAA 3B78A 1VQ5S 4WFYA 2J6UA 3MPYA 2WOMB 2MKKA 3KLGB 3B54A 2UUBF 2OJ3A 1RWWB 4F4AA 2W1BA 3NKYA 2UUWA 2B4UA 4FXVA 2Y8YA 1WDDA 4ZPVR 1X4HA 2BXJA 2FHJA 3NP5A 4DG1A 1Q81T 1CJVB 1TFWA 5E3QA 2YWKA 4GVLA 1DQ9A 3TJ8A 2CYYA 2EG2A 1T0TV 4FZVA 3M30A 5IT0A 3W1YC 3AODA 1VOMA 1LQ9A 3M32A 4GKJJ 3Q8SB 3GPAA 2N3LA 1S1VA 3POTA 5LSLA 1RGVA 2BQUA 2VDHA 1H0HB 5KFNA 1JLGA 3IMQJ 1QAYA 2GVZA 5KT6A 2VPZB 4CNYA 1S6OA 1F2GA 4OIXA 4LFAJ 4DV4F 3HO1A 3MCNA 2UXBJ 3AB2B 3AT1B 3DLHA 4HACB 4UOGA 2L9DA 1XNRJ 1KTVA 2K2PA 4D3GA 4ECYA 5F41A 2WHOA 4M8LA 1IKYA 1AZSA 2BOAA 1YZ7A 5KG3A 1H2TZ 5L38A 1RHKB 3DLJA 2F4VF 1KTQA 3NAIA 2EFOA 2EPIA 2L48A 1RWOB 1K1QA 1LWXA 1NK8A 4A47A 1TL7A 2AJ1A 3EZOA 3LP0A 1UVNA 1RWVB 2QYCA 4DX8H 4GVBB 4C8LA 1UVIA 4CLUA 3A8IA 2DPIA 3MMCA 4Y6IA 5DETA 5KFMA 2FIUA 3BKTA 4E98A 4IO1A 4LF1A 1O6XA 5AJ3F 1ZM3A 3M7VA 2L08A 1DTQA 3M2UB 2HEKA 1IVZA 1T7PA 3VWSA 3E01A 4EYHB 4DV1F 3HT0A 2RHSB 1JB0C 2CQBA 1N52B 1MROB 4RU9A 3BGFA 4PQUB 1TKXA 3ZTSA 3M8YA 2BJEA 1PJ7A 2IJNA 2QA2A 3UCGA 3NGUA 4ZP7A 2PEHA 5L8RC 5F3TA 1S9EA 4I2QB 3FDSA 1YJVA 1KR4A 2J76E 5KFFA 3LP2A 2P9EA 2DGVA 1YJ7A 4DPYA 4K0KF 3PW7A 2CNOB 5K14A 2AHOB 1RHRB 1TU0B 4CP5A 4L3KA 2NSBA 4QR2A 1MG7A 2RQKA 3JSMA 4ED6A 2W9AA 5HK4A 1WNEA 4PWDB 3KXDA 5D78A 3T5HA 3G6ES 3QLHA 1S99A 4UUXA 1U6ZA 2WBMA 2ROEA 3MPDA 1DLOA 1ZPWX 1FKOA 3EGZA 4Y2IA 4X4UA 5HQ8A 3M2RA 3W64A 4BDPA 1WG5A 3QBCA 4DS5A 1UVMA 1WDTA 3ZC4A 2RH3A 2X1GA 1FDDA 2KZZA 3BV8A 3UDLA 4W92B 3MECB 4MTPA 2YNGB 3BGLA 4LF9J 1KWMA 5L1JA 4TY8B 2VD3A 3BH6B 4DQQA 2WVFA 2QIFA 1Q8IA 2JFDA 4ED7A 3MF5A 1CJTB 2J9DE 1FWKA 1ZZNA 3VGUA 4DF4A 1S1WA 5EWGA 2B8PA 1TV6B 3TUPA 2GA7A 4M95A 5H9EK 3WX4A 3THPA 2V50A 3N5BA 2DIVA 3W8PA 2GJFA 2KHDA 1UJ5A 2NXJA 1U09A 5LM7E 2KM8B 4X4RA 3FRZA 3D1HA 1KS2A 2XC9A 5F8NA 5GAGU 1L3KA 1CPZA 1B0PA 1NHKL 1EQ0A 3VQTA 1TFYA 3KNGA 2CDRB 2F7VA 3JTNA 1XWLA 3AHPA 3T1YJ 1HYSB 2B7BB 5EWFA 1RAJA 3ISNC 4ECWA 1FD2A 2K1RB 1U1OA 3Q89A 3PR5B 5J1EA 3MPWA 4NXMJ 3MWBA 2AGQA 5D77A 1D3WA 5F8JA 1T02A 3C6TB 5HMYA 2AGPA 4KV8B 3LQVA 3SQGB 1J2VA 2AX0A 1ACMB 5A0YB 5MAOA 2B9XA 4LRDA 4F36A 2D69A 4QQBA 4NE9C 4KHPJ 4I7FB 5K20B 3M8ZA 4LF5F 2ADBA 5GMKa 2KVQE 4NMXA 2PFFB 3CIZA 5DQHA 4WFXA 4ETXA 3MMBB 5AE3A 2VKRA 4GKJF 1IUJA 3D6FB 3UCZP 2FY8A 3J7YI 3UN5A 1D1UA 4JI7J 3BJYA 2HVEA 4FS1A 1CULA 2GV1A 1VLYA 4Z37A 1UAWA 2IHR1 2ILYA 3OTEA 3J80U 1N4LA 1FKAF 1HNVB 1VQ6S 2Q1LA 2VPXB 3B4MA 2MZQA 3TP2A 1QJHA 4C97A 4U6PA 1RDRA 4G1PA 3PCOB 2W8LA 3GJSB 2VBZA 1AFIA 2RAQA 2XZWA 5KFKA 4ZJOA 5IT9U 1UJ6A 4X4NA 1FKPB 2PMHA 1YI2S 2CNLB 5KG5A 4X2BA 1GMWA 2HW3A 2CKWA 2MPUA 3KOAA 2KJVA 1M5KC 3DOMB 5E3AA 1HR0J 4KYZA 3MXHP 4ZPWR 2OUGA 4O44A 3TJ9A 3OHAA 4PG8A
chains in the Genus database with same CATH topology
4KC5A 3LGMA 3UWTA 1M1KT 2HLUA 4PXEA 4JV1A 2D41A 3M6UA 3KK2A 2NSCA 2AU0A 1C4CA 4WE1B 4ED5A 2R8HA 3DOMA 5E2QA 3D1QA 4DL0C 4YFUA 1FO1A 4JI3F 2QA4G 5LSOA 2E5GA 1VQLS 2ZKUA 3CULA 2QA4S 1RT2B 2CQCA 3BGUA 5JJBA 2ZH9A 1RTDA 5F0UA 2AYGA 1HW8A 1FJEB 3IAS9 1UWBB 2F1FA 4Q8EA 5DQIA 3K5MA 2V8VA 3CC2S 1Q7LB 2ADCA 4WJBA 3QGGA 1KQKA 1N32F 2LMIA 5GAHI 3EGNA 1JK9B 3FSYA 4O23A 4TU8A 2YNFB 2IM0A 1SL1A 4IH6A 3DHXA 2SXLA 4TKTA 1WHVA 4OZNA 4OHZA 2RE1A 1XK8A 1C0UA 2FC9A 1S1VB 3POTB 2VASA 2XWXA 1X5TA 2HS0A 1JNZB 1SH2A 3D1OA 4QW9A 3AJ1A 1TL1B 3P6YC 4EGLA 2DBBA 4NXNF 1QY7A 3GIKA 3EYZA 1RT2A 5HMWA 3DLBA 4DFJA 2UUTA 1N0VC 5KOXA 3LALA 2LU2A 3NS5A 1SJQA 4H4KA 3M9MB 3CCJS 2IYGA 5KFZA 1FJCA 3TO8A 2OMOA 5B0GA 4J9MA 1RT7A 3AY0A 4KAIA 3TA1A 5GADU 5DJBA 4DLGA 3U02A 1FCAA 4OHYA 3DOKA 4C2MA 4OI4A 1TL1A 3QZ8A 5DO2A 3S01A 3OL8A 2RVJA 1FDNA 2FB0A 3DGPA 3HDSA 2KH9A 4EZ9A 4O3RA 2RUGA 2CJBA 2U1AA 3NAHA 2ZOGA 2BW2A 1FDAA 1KFDA 3SFGA 4O4GB 4EZ6A 4KFBB 3IXQA 2A3JA 4I0WA 1FHTA 1T3OA 4MKAA 2DCLA 3OV7A 1VQPS 3J7ZT 4PG5A 1CSJA 3CTRA 4OZLA 3LOUA 2OSQA 3RZAA 2EG1A 2WB1D 2HNYB 3EPIA 5KFHA 1SJFA 1U6BA 4C98A 3M1VB 4MAKA 2EW9A 4F3QA 2IBOA 4USJC 3P49B 2J7UA 1VS3A 2P9CA 3RBEA 3NWGA 2ABYA 1R8BA 5LXRA 2L9NA 3M6VA 3HT3A 4EO8A 4DLEA 5D4LA 2XG8A 1LK5A 1RI7A 2ZOMA 5JVGQ 3BB5A 3OTBA 1T03B 4OI2A 3PKMA 4F4KA 2ZBIA 4HEA9 3MR6A 2KDOA 1QSYA 2CQIA 3MM9A 5LJ3Y 2FJXA 3T19A 5CD4H 3PVXA 3K57A 4QPXA 4XDCA 3MFIA 3CJ2A 1GT8A 1WWHA 3KK3A 1NHUA 4EBDA 4F4ZA 4AQYF 4OHWA 2OPPB 2R2SA 4O3QA 4DUYF 1JX4A 4N77A 4G1IA 3OTDA 3CD6S 4C9DA 1RTIB 4LQ3A 4OLPA 4PG7A 2W9BA 3EGWB 3MMCB 3C6UA 3T1HF 4AL5A 3Q22A 1T03A 4C0HA 1Q4RA 2M70A 2KRBA 4QIVA 2C42A 3I31A 3FCHA 5M2RA 5A8WB 5DG8A 4A46A 3M05A 3ZZUA 3MMAA 5KFIA 4C0BA 5KFWA 3MUTP 2OP5A 2VA3A 1U45A 1DTQB 4YB1P 1IBLF 1N8RT 1VQ4S 4V19X 3SZ2A 4DFMA 2MKCA 1P9QC 1VIOA 1GXTA 5DRKA 2IM3A 3MTKA 1FD8A 1S48A 2OPPA 2VBWA 4JBCA 2R2RA 3T9ZA 3ULHA 4YEAA 4YOEA 3TQ1A 3VZHA 2XLKA 3QMQA 4K2XA 3CDAA 4TY9A 4GKKF 2HS3A 1SH3A 1G6BA 3RB4A 1RA7A 4U67Q 3BDPA 3GQCA 2XCPA 4QU6A 2A10A 3SFUA 2DRBA 2AF6A 2DNQA 3CF5Q 2YNHA 2Q6BA 5A8WA 2DK2A 1TKXB 1VRTB 2N4CA 2HVZA 3PRDA 2CZ4A 3CVKA 4CH0S 1NJWA 3I87A 4ZHRA 3IWXA 2DO0A 3QIPB 3PJWA 2Q66A 3OFEA 4QYRA 5KFYA 1S49A 3H5XA 2DH8A 3PO5A 1HBUB 1IKVB 5KFPA 4HL9A 4C3LA 3HVAA 3MURP 2FLOA 3K5LA 1B0TA 1WF1A 4DSIA 3CIMA 4FF4A 5EGYA 2LLZA 3WDOA 1KHVA 3MR5A 3G96A 2C22A 3I5CA 2CQ3A 2M8HA 1YGYA 1L3TA 3MHYA 2MQPA 1GXUA 4WIIA 4GO5X 1KOOA 2YWGA 1VRTA 1XBWA 5FD1A 1X4CA 2CPXA 1C1CB 2BE2B 3BM7A 3Q2SC 4YMEA 2ZM6F 3UD3P 2RD5C 3QIPA 4GMKA 1DARA 4JI0F 1JKHA 1NK7A 2E29A 3MOZA 3PACA 1LWFA 3BGRB 1HBUA 4AL6A 1IKVA 4K50A 3QIDA 2HGNA 2I38A 4A8XA 4OX6A 2NR0A 1YJNS 2E1AA 3UPFA 1Q8LA 1PILA 3GWCA 1K73T 2MB0B 2ASJA 1IBMF 4ECXA 5IQ6A 4EFAC 2IVMA 1ZAXA 4F25A 3CXCR 1HNIA 2DNGA 4FNHA 3R5BA 5KFXA 2X1BA 4QBUA 5K14B 3I9ZA 2EC0A 1C1CA 2BE2A 3T5LA 2FLPA 3DRPB 1JLCB 3F44A 1N33F 3SI8A 5A6PA 2NREA 2ASYA 5J2MB 2HMIB 3ONQA 3VTIA 3BGRA 3VAHA 2XB2D 3BSCA 4DSEA 1J5EF 1Q79A 4MIBA 3JSMB 2V9KA 1NEEA 2DNHA 3IWNC 3M8RA 1FXRA 2JVOA 2BRLA 2GX8A 4IRCA 2KVIA 2AX1A 1B64A 2R9LA 3MM8B 3U1NA 3PW5A 2J0XA 3K5NA 5GAEU 3DU5A 1TKDA 2XMTA 4ICLB 1W2BR 3NCPA 2DD8S 3D0HE 1IXKA 4RNFA 1X5PA 1HWJA 4OLOA 2NZ4A 3CD0A 3DRPA 1JLCA 2LKZA 2XWYA 1K0TA 2GHWA 2EFVA 3Q24A 3T1YF 1TL5A 2O01C 1VGYA 5KFAA 2HMIA 5KFJA 3M9NB 3S7RA 3KG0A 3UCUP 1S10A 2LQ5A 3HX9A 4Q44A 2FY1A 2VONA 4B3OA 2EVZA 2PA3A 2B5JB 2DVIA 4FXWA 4NCGA 1JLFB 1VHFA 1VQSA 3MM8A 4TQRA 3GIMA 3GFXA 4YQWA 3H5YA 4OHXA 1HL6A 1ZPVA 3GG0A 2D7SA 3HHLD 4ICLA 4B3MF 2XMJA 3HVWA 4RW7A 2PT0A 3H40A 1O5JA 1E6YB 1LWCB 4KGKA 3PV8A 4C8KA 3AAWB 5A8RA 1RTJB 4DL5A 1P1TA 1NAQA 4JI1F 3HVTA 2CQ1A 3C2PA 2LQ9A 4IQMA 2DNKA 4WZMA 6FD1A 2PO4A 2QZ8A 3I0RB 5E41A 1QTMA 5EX0A 2I5JA 3H59A 1OQ3A 4DSFA 3IWLA 3VAMA 1S0OA 2B5JA 1SJRA 2CPZA 2JHEA 2QEXS 1C0TA 2JJ4D 3RRGA 2ZH4A 2WTFA 2OSRA 2R7WA 4Y2CA 1YSJA 4HDGA 4DV5F 2R7UA 4YB6A 3BN7A 3SCKE 2GQQA 4DN9A 3MTJA 4NPOA 5EUHA 3MM7B 4DFKA 2DO4A 4WF9Q 1ZAVA 2Y1IA 3FRYA 1URRA 4OI3A 3K59A 1KQGB 2XLJA 2IC3A 5KG2A 2KXNB 4I56A 3V6HA 5KFRA 1MMDA 3Q8RB 4RW9B 2B9YA 4EEYA 2XGQA 3WZ0A 3G6VA 2JX2A 2W8KA 1ZM2A 5HMZA 3HKZD 2KB2A 2PMZD 3V81B 1TKTB 5AXKA 2XY5A 3ENQA 3IFEA 3VAIA 4JI4F 3PRBA 4NCBA 1SIZA 4DR7F 1S1WB 1HI1A 4ECUA 4V19J 4UQTA 4YB5A 5A2QY 1IM4A 4QOTA 3MM7A 2VKZG 2DNZA 1QAIA 4IOBA 1AW0A 4ETZA 4HHJA 1P6TA 3V6JA 1SKRA 1RP5A 3H98A 1JXLA 4QYZJ 2W4PA 2K3IA 1TL3B 5E3PA 2VQFF 3VAJA 1GX6A 2DGQA 2JVRA 3LF0A 3N6NA 4NLTA 2X1AA 3GR1A 2FGOA 5CYJA 2W24A 2ZH8A 2HGLA 1ZH5A 2XY6A 3VAGA 4ITSA 1CLFA 4B9MA 1EP4B 2HHVA 1FNMA 5CCLA 4DR5F 2DTJA 2KYXA 3UNGC 4FS2A 4N76A 2B4PA 2DNPA 3ZZ0A 2RU9A 2VG5B 1FNOA 3IO1A 3HFKA 3M8PB 1RKJA 3PW2A 3VZIA 3PEHA 3E3XA 4UOCA 5KT7A 3RW6A 5F8IA 2VA2A 3H2VE 1D0EA 2VG6A 3ZZOA 2ZH1A 4QCLA 1WEYA 2VV5A 3RAXA 4CIOA 1L3UA 4I69A 2POKA 1EP4A 2FJEB 3ISZA 4RW8B 3GZ7A 4F67A 1U26A 2R8IA 3HHDA 1RA6A 4ZPDA 2FUG9 5B08A 2AW0A 3I4HX 2UVWA 4M63A 2VPYB 4KJIA 1X7VA 4YUDA 4ZCMA 3GV7B 2BRKA 2O3DA 2E5LF 2XNQA 1FDBA 1X0PA 3BSAA 4URQU 4R8UB 1QUVA 5A8KB 4XPCA 4C11B 4MIWA 1VRUB 3ENWA 4LIRA 4NA1A 4OX8A 1N88A 1RKIA 1DQ8A 2QLWA 3JSYA 2J8AA 2E1MC 5BYQA 4RNNA 2RS2A 3R1LA 2GMHA 4JV2A 2EBEA 2IM2A 3FZ2A 4NLUA 4IRKA 2LDIA 1WTFA 4ZP6A 4NLOA 1Y3JA 2RRAA 1Z4UA 4HTJA 1IR0A 3HHEA 3ZZTA 1FRMA 4UY85 5FDLB 4ZCLA 2ZKTA 2DNRA 2VODA 3KJVB 4WU2A 2HFZA 3CJ3A 1DFDA 4K4TA 5CZXA 4B9SA 3G8SA 3S1TA 2ZUGA 5A8KA 1T3NA 4WK1A 3CEDA 3K5PA 4I2PA 3QWPA 2ZH3A 4N56A 3HK2A 4H4OB 2WW8A 2KKHA 5E3CA 4KE5A 3UE2A 2CQHA 1HQUB 1MMNA 1BC6A 1FJ7A 3MM6A 3PNIA 1VK8A 2WAQD 2RMLA 1FK9B 3RRHA 2ROPA 2E7XA 3BDEA 1P8GA 1TKZB 2WRMA 4NLXA 1QSSA 4ED1A 5FDLA 1G3OA 3UR3C 2Z4PA 3AQOA 3HZEA 4GO7X 1NK9A 2HGMA 4X66F 1Y4ZB 4YP3A 1VBYA 2I2YA 2XI3A 4X65F 3E8OA 4TU7A 5CH7B 2BJDA 3U1MA 1KEKA 1WEXA 1OSCA 2E1CA 1KD1T 2IVYA 1VQ8S 2GIQA 1TUVA 5E5NA 4QPTA 4PG8A 2VUGA 1DQAA 4HT7A 3TR5A 3NBPB 3QJPA 4BBYA 3HP6A 3MFHA 2YQ3A 2DGXA 3CMAS 4LFCF 1VC5A 2LYVA 4KKOA 4AFFA 5KAKA 4NX9A 3H2UB 1FK9A 4R25A 3TVKA 2OPSB 4B02A 1TKZA 3G86A 5BYSA 3W3SA 3TANA 2K7KA 2D3ZA 1X4GA 2N4DA 2XGPA 5F8HA 1AXQA 2IRYA 3TW0A 4NLSA 2VG7B 1YHQS 2F40A 1SBRA 3I0SA 1FVQA 4ED0A 2LDYA 4YR3A 2DB1A 4NA3A 5M2PA 3DMJB 3I9V9 2W4DA 2B4VA 1LFWA 2FTRA 2P5VA 3NNAA 3IA0A 1XMOF 1KLMA 4IH7A 3C3LA 4K4ZA 3DRSA 2C3PA 4E8UA 3MZIA 2ZDOA 4QIGA 3S8SA 1HBOA 2WK4A 2RRNA 5KG6A 2EFNA 3JYTB 1UKUA 1YIJS 3LWLA 1TVRB 1K8AT 3AQPA 2GJIA 2RILA 1VBZA 3LGNA 3PDNA 4RWWA 4JI6F 2HVHA 4X64F 1LWEA 4MYTA 4RUHA 1T05B 3K5OA 1B0VA 2E1RA 4IG0B 4CNZA 2RS8A 1P1LA 1MU2A 3DXBA 4LMZA 2XS2A 3TA0A 2HS4A 3IRWP 2DITA 2FJWA 1QLNA 3LAMA 1I1GA 3RAQA 2FD2A 1M5HA 1RWUA 2J6TA 4G3IA 2XMMA 2BVZA 4CO2A 4USHA 1QM9A 2JC1A 2YWEA 3GG1A 1MW7A 3KLIB 5G4DA 3OW2R 3QAUA 1R0AA 4B08A 2UU9F 2RU3A 2GCFA 3JYTA 2HHWA 4XPEA 4PUOB 3IG1A 2C2RA 5HLFB 2M9KA 1SKSA 2FGCA 1HNZF 2YWFA 3MEGB 1T05A 3DM2A 2K3KA 4IG0A 4NLYA 2I8EA 3CDEA 3SDEB 3G6YA 2MMYA 5D4PA 4J9LA 1LKZA 1X9WA 2M0GB 2YX1A 2Z2MA 4PWUA 5I4MA 4X4SA 1S0MA 1R3NA 1X4BA 2E5IA 2YKOA 1V6HA 1VK3A 3DDKA 1FXDA 5DM7Q 2FLLA 3DLEB 4M5DA 2HNZA 4B17A 4FBTA 3KLIA 4WYWA 4IYQA 4Y65A 2RSQA 3K7RA 2MKIA 4ERDA 3V4IB 3N79A 3PEJA 3RYLA 1FERA 2VPWB 1TP7A 4J9PA 4PUOA 4ZVGA 3E2EA 3CD5A 3GB0A 5HLFA 4OMFG 1SV5B 4YHHF 4KSEB 1JLBA 3MEGA 4G6VB 3SSQA 4F4WA 2NUUG 2R8KA 2AJFE 5FJ4A 3B82A 3SDEA 3U27A 2JZ5A 2KFNA 2G0CA 3VCDA 1UMJA 1X9MA 2ZVSA 1C2PA 3DYAB 5B0CA 5EDWA 2OMLA 4DJBA 4KO0B 2AYEA 2J9CA 4B9VA 3IC1A 3JTOA 2CQ4A 4WTYA 1H38A 2X3GA 2DGSA 2J7KA 1EETB 2BANA 3IR5B 4O44B 1FRLA 4A4JA 4AXJA 1SL0A 3FQLA 1FRXA 4J5OA 4NOHA 3V4IA 2V94A 1CQNA 1NJIT 2E66A 2GIRA 1Y7PA 1IQZA 2ZH7A 1HMVA 2LEAA 1XERA 1HWLA 1HPZA 1TK0A 4ES1A 5LMUF 3ENVA 4H4KC 4OL8A 2QSWA 2W25A 5SUHA 1KC8T 2DR8A 4MFBA 3DYAA 2ZJPQ 3GFHA 3MDFA 3CSKA 4ID5A 2J0WA 4WFBQ 1HA1A 4Q2LA 4KO0A 3HVRA 2WONA 2PDAA 2EWHA 3KLEA 5L1KA 2ERRA 1Y5LB 1T8EA 1FRIA 1EETA 1ZOTA 3UI3A 2N3OA 1K9MT 2ZHAA 3OHBA 3CDBA 2Q79A 2BR0A 1Y5NB 3QPIA 4MYUA 4NL5A 2QO3A 1C0UB 3BZQA 3M6WA 3OXLA 1SIWB 3OR1B 5KFDA 2HHHF 1NJXA 2KI2A 2KFYA 5EHHA 2BQ3A 5CYQB 1KOHA 2CJAA 3OVSA 2KT2A 2OPQA 3LP1A 4DL6A 2R7QA 2F3JA 5CYMB 2J0QD 4ECZA 3KHGA 5HO4A 1U49A 4LQ9A 1Z2LA 3BF4A 2ZH6A 3IRXA 2ZD1B 5LXYA 3EZUA 1JIHA 2OTLS 1B7FA 1R8CA 3G6XA 5HROA 2XSFA 3NCQA 2PIIA 1CC8A 1RT7B 4C3MA 4FVCA 4KB7A 4PRFA 4MKYA 3E51A 5DDOC 1OIAA 4B9LA 3DOKB 3OR1A 4J9NA 1NO8A 1SC6A 4ZPTR 2I0XA 2NPFA 3PR4A 1AFJA 1SH0A 4HH0A 1IJFB 2GW8A