4MAKA

Crystal structure of a putative ssrna endonuclease cas2, crispr adaptation protein from e.coli
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
73
structure length
73
Chain Sequence
SMLVVVTENVPPRLRGRLAIWLLEVRAGVYVGDVSAKIREMIWEQIAGLAEEGNVVMAWATNTETGFEFQTFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords CRISPR-associated endoribonuclease Cas2
publication title Crystal structure of a putative ssRNA endonuclease Cas2, CRISPR adaptation protein from E.coli
rcsb
source organism Escherichia coli
total genus 16
structure length 73
sequence length 73
chains with identical sequence B
ec nomenclature ec 3.1.-.-:
pdb deposition date 2013-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09707 Cas_Cas2CT1978 CRISPR-associated protein (Cas_Cas2CT1978)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.240 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4makA00
2EFGA 5G4DA 4ES3A 4ZCLA 4MYTA 3ZZTA 2CVEA 3UI3A 2IVYA 2L9NA 3EXCX 3B8HA 4QR2A 2NPFA 4ES2A 1FNMA 4MAKA 1VI7A 1ZM2A 1ZM4A 1N0VC 4ZCKA 2I8EA 2E1RA 3E3XA 1DARA 4ES1A 4FN5A 1ZM3A 4ZCIA 2BM1A 2BV3A 2I0XA 4TNOA 1T95A 2KDOA 1ELOA 3ZZUA 1ZPWX 3B82A 1N0UA 3OQ2A 3LH2S 3ZZ0A 4ZCMA 3B78A 1U2RA 4QR0A 2WBMA 1P9QC 1ZM9A 2ZITA 1KTVA 2BM0A 4MYUA 4QR1A 2J7KA 4M1KA 2XEXA
chains in the Genus database with same CATH superfamily
2HIQA 1F6TA 2IDLA 3VQTA 4LSLA 3I0SA 1CJKA 1JXEA 3HZGA 3O6QA 2Z4PA 2SXLA 1WG1A 2GQ2A 5FLXY 5BYSA 2GIRA 1UFLA 5B0GA 4UY8T 1HNIA 2YKNA 2IY5B 4PYAA 1KHVA 1XEZA 1ZM2A 3M8PB 1S1XA 5GAEI 4LF2A 3NEKA 3MOJB 1H7XA 4N41A 2G0CA 1HQEB 1DURA 2BQUA 3BKTA 3ISZA 2YX4A 3I82A 1WEZA 1WDTA 4RJVA 4BBYA 1ICEB 4DG1B 1I6JA 1AXQA 2HNZA 3HO1A 4R25A 4CH1A 4KYZA 5IV4A 2HRYA 4QW9A 2Q66A 4WZMA 1U0SA 5AE3A 3Q0AA 4PABA 3PJ9A 1XMOJ 4DQQA 2XCAA 4FNIA 2UUBJ 1M1GA 2LQBA 4F3QA 2NXUA 3UPFA 4DR6F 1NRKA 4DR5J 3EICA 3GJQB 1OPIA 3ET6B 3AT1B 9RUBA 3O44A 5CCLA 2FLNA 1L5UA 3KLFA 4NLWA 5KFQA 4DU8A 3NGKA 3DLLQ 4K4VA 1HBNA 2HG4A 3MCNA 1TFWA 2ATCB 2CJYB 2HQFA 2MKYA 2AIRB 1DFDA 4E0DA 2ZOGA 3KJNB 2POKA 4URQU 4ED8A 2P6SA 4OLPA 2XGQA 1FJ7A 1IVZA 2CZ4A 2ZEJA 1S76D 2ZH4A 2R2UA 3W2WA 2RRNA 2V4JB 4I4BA 6AT1B 1P6TA 3UD5A 3BR8A 2YNFB 2XMJA 2IRXA 4B9NA 2HURA 1NPPA 3NNAA 2VIHA 1KLMA 3N6MA 2J0WA 3WX8A 2JEIA 1SJ1A 4RNFA 2OIHA 4MFBB 3MEEA 2CAJA 3M6WA 1WG4A 1VBXA 4DX7A 1YI2S 1L3TA 3WIVA 3ELHA 2A3JA 2CJBA 3WQPA 3QMQA 2LA6A 5DQHA 3NLCA 4WYWA 3H4DA 3HCXA 3RBXA 4ZHRA 4N7TA 3QJPA 4O3PA 4YS2A 3NNCA 4DPXA 4LFCF 1XQIA 4CO5A 4JI5F 1S5ZA 1SC1B 3PRDA 5F9LA 4WZQA 3QT5A 1HYSA 4B3MJ 3QZ8A 5HL7Q 1S6PA 3DI6B 1VBZA 2VC1A 2J7UA 1B64A 3LPYA 2JRSA 4WP3A 3D1HA 4G1QA 3I9ZA 4WCEQ 1RWUA 3U1NA 3SQGA 4A8OA 1CLFA 2J0XA 4K0KF 2IA0A 4Y28C 5DJBA 4A8YA 1IBMF 1HNXF 1OJ4A 4J9KA 2KFNA 3H25A 1W7WA 3JTOA 3DRPA 3QSIA 2ZH1A 3H98A 1GXUA 1Q16B 3A4TA 2K7KA 1RT1B 4PWWA 4P2MA 4AL6A 2GHVC 1DZ5A 4TN2A 5FIIA 4OX6A 3DLJA 1JMTA 1J27A 2CPFA 3SCJE 3TX8A 3D2WA 5CQGA 5J2QA 2XO6A 3DLEA 1FX4A 3KK3A 3KK2B 4X4QA 4USHA 5KFAA 4DFPA 1Y5LB 5IFMA 4QWAA 1UWBA 4IOBA 1EJ7L 2DXDA 5F41A 5HJYA 4GKJF 3KK1A 3VAHA 1OQ3A 1G2EA 3BDPA 3GV5B 2P9EA 4DV2F 2D3OR 2H5EA 1YRUA 2MDAA 3T5JA 4DSEA 3DC2A 5ETLA 5E3CA 4JI2J 4KO0A 3RG6A 2DITA 3EXYA 4NLPA 3UD3P 4Y65A 3NL0A 4OI3A 1TAQA 4EBEA 3M8RA 5FDLB 2QRRA 3C15B 5DETA 3AA9A 3W9JA 1RT3B 2OFHX 2FHOB 2F1FA 4LRAA 2R9LA 4DL4A 4URSA 3VGUA 2DVIA 2VZ9A 3NNHA 2C2RA 4QWBA 3J7A1 2GQCA 4LR8A 3R2DJ 2G2ZA 1HQ2A 1S1VA 4NXMJ 1PC5A 3I4HX 3AD8C 3KG4A 3ONQA 2VPWB 1BXNA 3RR7A 4JV5F 2GVZA 3BDEA 4U67Q 1U1OA 1YBTA 3GFHA 4A8WA 3Q8YA 2EC2A 2ZE2A 4PQUB 1Z1ZA 1N5SA 1CVJA 1K1QA 2AP6A 1HNXJ 1ZM3A 5HMWA 3D1QA 1IKVA 4IFVB 4B3TF 2HQCA 1TU0B 1AT1B 1C1CB 1U02A 2MYFA 2D7SA 1TKZA 3DRRA 4EO6A 2BKOA 3TAQA 4YR0A 2DR7A 1HFEL 4IG3A 3MR2A 3POTB 3UDCA 3VF0B 2HHVA 2B43A 4WFZA 4P2SA 2OSRA 2O67A 2E1PA 2RHSB 4CLSA 2WBRA 1UJ5A 1N8RT 5LL6d 2G2YA 2ZM6J 2KG1A 2AU0A 2DNHA 4GKJJ 4WXOA 1VRUB 2DO4A 1HI0P 4HTIA 4NCBA 2B8PA 2JFDA 3CEDA 1GEHA 4DV2J 2E5HA 4ZP8A 1RTHA 3G82B 3PEHA 1R6VA 4EYHB 3MUTP 4KFBA 2C2DA 2OTLS 3TUJC 4I0WA 1YZ6A 4OYIA 4M1KA 4NA2A 2ZZMA 1FCAA 5B0BA 1NZAA 2XZWA 2PGCA 3PYEA 4NLDA 1HL6A 1RK8A 2XULA 1NK6A 4DR2F 4NXNJ 2Y8WA 4E2FB 2E5JA 2OPRB 1FDNA 3RRKA 2LECA 1JQGA 1S12A 4DFKA 2D9PA 2LU2A 2ZC4A 4CO4A 3MDFA 2VICA 4X2BA 3HP6A 3C6TB 2HQGA 3Q24A 3T5HA 2HRUA 3CW2C 3WHIA 3DM2B 5EWFA 2NSCA 4RZRA 4TU7A 2VG6B 1PG5B 4CLTA 4JV5J 2HNDB 2KB2A 2ZNYA 3QLHB 4DL6A 2YNHA 1KR4A 5GVQA 3B54A 4CLPA 1Y4ZB 5DGAA 4UY85 4X64F 1V3RA 5GADI 5IC4B 1SKRA 4B3TJ 2UZAA 4A8FA 1N4LA 2JLEA 2DR5A 3KHHA 3BGRB 5B0CA 3I31A 4LF5F 3DLGB 1JNZB 5KFNA 3DYAB 1MWQA 4CDIA 1G3OA 1XMBA 4X4TA 4LIRA 1RWVB 3HHLD 5JVGQ 2YQ3A 4CT8A 2HRTA 1WTBA 2MZSA 1O8BA 2BUNA 1FHTA 3OW2R 3X1LB 2HHUA 3BGOP 1KDNA 4FPRA 2DGUA 3MR5A 4DPTA 3EYZA 2ATLA 2HVEA 5KFCA 4ZVUB 2VQFF 1YJVA 1KQSR 4FF4A 3MEGB 5KG3A 1C2PA 2Y3YA 1IKYB 2FB0A 1DAXA 4ZVRB 3EDQB 4LBPA 3EX7B 2RKIB 5A8RA 3D6TB 4TQRA 1X4DA 2B9YA 2YWHA 3UD4P 1TMJA 2XG8A 4DR2J 3C3LA 2KT2A 2A6OA 2VBXA 5HMZA 3O1LA 3GIIA 1FDBA 3HFVA 2FY1A 2XBPA 1R8PA 1BQNA 3L09A 1TKTA 2J6TA 1EKRA 2MMYA 2UV8G 3KXDA 4FYXB 5A6WA 5IXUA 3I87A 1JJCB 3CCMS 3LTOA 3IR6B 1D9FA 2GW8A 1R8AA 2X51A 1AB8A 1MMLA 4J9PA 5KTQA 5L1LA 3CJRA 4O44B 5KFSA 2DD8S 2W2OP 2EG1A 2AZ1A 1ZETA 3BO2A 4X64J 5EDWA 1N34J 1S6UA 1HNZJ 1DTQB 1Q5VA 2HS0A 3P3DA 2HS4A 4NLGA 4B3OB 3NGSA 1CULB 2DGSA 2VPXB 4ATNA 4DFJA 5HVGA 3S01A 4L74A 4HR2A 4LF5J 2F4FA 4PG8A 3HHEA 1PAUB 3LGHA 1FK9A 2O1PA 3VV2B 3GCXP 1RLCL 2GGPB 4P7TA 2R7OA 3ILIA 4M5LA 1XC9A 1CJVB 3BH7B 4JB8B 2PMHA 2RU3A 3K89A 1LFWA 2NPIA 4IRDA 4JI6F 1FRJA 2VDIA 3CCSS 4OYXA 1JNRB 3R1HA 4ZLNA 4I6YA 3L7UA 2FGCA 5LXRA 3BYPA 3W66A 2B0GA 2YNGA 1TUVA 5SZTA 1K44A 1V5VA 4C7QA 2J6UA 1VIXA 2VBWA 2DNPA 1KWMA 4DR1J 2J6SA 2HFVA 5RUBA 4NCGA 3PO4A 4QR0A 3PRVA 2LQJA 5IWAJ 3EZOA 2NSBA 2EVZA 1LW2A 2OPSA 2BANA 4KGVB 4O3QA 3N5BA 2B56A 4OZ1A 1U0HB 3M4XA 3T41A 2WBMA 3IBFB 1JLAA 4KBIA 3GG1A 2RB7A 2D69A 3UO0A 2DJWA 5THWA 2CNLB 5IM0A 2HVZA 4ZA1A 3FBCA 5H9EK 3RRGA 4M5DB 2GAHC 2VG7A 2KN4A 1IR0A 4DV5J 2EFQA 3BYRA 4X84A 2CVEA 3J80U 3KJVB 3MPDA 4OZ5A 4FXDA 1NXIA 1Q8KA 3R3TA 2C42A 3PYFA 1B7YB 1VMBA 4ZLPA 4Y2MA 3M32A 2GX8A 4DLGA 2IJFA 5IC6B 2RIJA 1NK8A 2BW2A 4FKXA 3JB9k 1VRQC 4DMZA 2VL1A 3LQVA 4UUXA 1N32F 2M70A 4BWJA 5K8OA 2D1CA 4M5MA 3N6LA 5CAAA 1RKIA 2KXNB 4NX9A 5J2NB 1RI7A 3UNYA 4LFAJ 3J7YU 4OZ3A 1UPPA 4GVLA 1CJUA 4JI6J 4QOTA 4KRWA 4OJHA 3CF5Q 1NSQA 2RQKA 3SFUA 4B3SF 3JQJA 1ZA2B 4Y0FA 2EK1A 2HVDA 3FCWA 1UW4A 3IWLA 4PKDB 2HWHA 4A8KA 2Q1LA 4KAIA 2IJNA 2CG8A 4OMFG 1Q53A 3IS9B 5C24A 3ETOA 2X1FA 2G0JA 3P96A 1VQLS 2FC9A 4RWWA 5DZ7A 3BGFA 2OEJA 4K4UA 3IR7B 4ANEA 5F8JA 3D28A 5MAOA 2W2QP 3O2IA 2XHWA 5KT7A 4M5KA 2ALYB 3TO8A 2FPHX 1IBKJ 1P9YA 1UVJA 2R2SA 4BC9A 2BA9A 2IRUA 2DHSA 4O3SA 2E9TA 1KFSA 3DFEA 3AD9C 3DMJB 1VQ5S 3FRZA 1T05A 2UVWA 2ZH3A 5BYRA 2Q3PA 1LW0A 2V69A 4HEA9 4YY3J 3PYGA 1ACMB 4WTOB 5DDPC 2R4FA 2XC9A 2HQIA 4F4YA 3R9LA 3T3FA 1DHMA 1N5YB 3Q8PB 2HSEB 5I3UB 4KTQA 3I5AA 1TL3A 3SSSA 2HMIA 5J1EA 5HP1B 3SV4A 2O01C 3DLKB 3M30B 3B6BA 4B08A 1RTIB 1YJUA 5E0OA 1S4EA 4MIWA 1N32J 2MY7A 3H5XA 1MWZA 1D1UA 2JX2A 2DRBA 3IFEA 4WYLA 3IN5A 4IG0B 4TY8A 3MUMP 1X4HA 1SQGA 5F8GA 2FLLA 2PN6A 4OJGA 2CQ2A 4Q43A 4K4ZA 3I5CA 3AA8A 1Y3JA 3IM8A 3NKYA 3OFFA 2V4RA 3EGZA 3VZHA 5DLFA 4F67A 1F2GA 1VISA 2I5JB 1B99A 2YWWA 5KFOA 3AY0A 1N0UA 2BR0A 2KM8B 2BRKA 4FBTA 2GS8A 2DNNA 4Q2MA 3MURP 1FI4A 2W1BA 5KFRA 2Z58B 3MAAB 2EI5A 4OI6A 2F4VF 4U96A 1R27B 5KT3A 4IO1A 1QDUB 4ZPAA 1BWVA 2RVJA 1UVNA 4QYZK 1CJTA 4KHRA 2YPZA 4WFYA 3MUVP 2DNGA 4MMOA 5HLFB 2FVQA 1ELOA 1KN6A 3EZ5A 2E7VA 2ZOMA 3ENQA 5D0HA 3EGWB 4GVBA 3SCKE 4ZITA 3W61A 5KG4A 2GVDA 2X1GA 5L1JA 3HPOA 3CCUS 5B7WA 2E1CA 1RABB 4FS1A 3RBEA 3I0RA 3RAXA 3ZC4A 2GCFA 1HI8A 1FNXH 5KG0A 3CCQS 2E5IA 4USJC 3W1YC 2B9XA 3QT8A 1HNVA 2BM1A 1RXOB 2PA8D 4UOFA 2AF6A 1LXNA 4NEYA 3S7RA 4ALZA 5SUHA 2WZ1A 2CPDA 2P9CA 4C9DA 2CWXA 4IOAQ 1YX2A 5IT9Y 4HH0A 2AKWB 1Q8BA 3SSRA 1JLEB 2RS8A 1NUEA 5KFHA 2JH3A 2XNRA 3ILOA 2IMOA 1F3FA 3K58A 3T1HF 3GJTB 3BN7A 5DQIA 4HLBA 3FSYA 4F7VA 4QIFA 1N56A 3NGUA 1NSKL 2EK6A 1RWWB 4DR3F 1PKUA 4WBFA 3A1YG 2IBOA 3D6MB 5AJ3F 1QTNB 1SL0A 2F4VJ 1OQ6A 2W4DA 1VC5A 3D0HE 6FD1A 1A9NB 2RUSA 1XWLA 5J1PA 2FD2A 1RP5A 4I68A 1FWKA 2DK2A 1PC4A 4F4ZA 3M2VA 2HBZB 4XDDA 2HNYB 5KFGA 2N4DA 4LF6F 4OLOA 1NK4A 3U27A 2V9WA 1VQMS 3NOCA 4JI8F 2IM2A 3RB4A 4C0BA 3QGIA 4RBVA 5CA5A 2HHHJ 1Q95G 1IKXB 2KTQA 3MPUB 3HDSA 1T9UA 4DN0A 1S9EA 2ASDA 4ZIWA 3PACA 1HBMA 3ENWA 3GJRB 1U25A 2YWEA 4YFUA 2WOMA 2LEAA 3R7NB 2H65B 4I69A 4ECXA 3H2LA 1IKWB 5GMKa 2J9DE 3KLEB 5AT1B 3PVXA 2KYZA 2LDIA 1HHTP 4CRJA 3VALA 1Q1KA 1S0MA 5KFWA 3GTYX 5D3GB 4Y2AA 2G0IA 1YVFA 4ID5B 4AD6A 2EFGA 1FWLA 1N33J 1FFGB 4RL1A 2QFIA 3BKFA 2B4PA 5HMYA 4U7UD 2KHCA 3MPVA 2QMXA 1C4CA 2QJ3A 2UXBJ 4HVZA 2V9KA 4KPCA 3H7HB 4QQBA 4ZK7M 2KXHA 4QPXA 1LNQA 3HVTB 1SL1A 3KLHB 2R7UA 5AJ3J 3KKFA 3QT7A 3AOCA 1D09B 5D4OA 1R6YA 4DQRA 1YSJA 2DO0A 1U1KA 3CCTA 3NWRA 4I2PB 4ANCA 1YG0A 4OFZA 3OXFA 3JTPA 5D0RA 2BABA 2DH9A 3MM8A 1X9WA 2EC0A 1VK8A 1V9OA 4QU6A 3GG0A 3TW0A 1DQ9A 4JI3J 2OO4A 1FWPA 3R7SB 1Y10A 3QPIA 4USMA 1PBAA 5K5MA 2XMMA 1H98A 3MEDA 4JI8J 2DHGA 4A48A 1TL1B 1OWXA 4JI0F 3THVA 3TZWA 2UXCF 3ZTRA 4M95A 1H74A 1H3DA 3NS6A 2XMKA 2AJ1A 1J5EF 3FEYB 2ZNZA 3MOZA 1KC8T 3E01A 5LJ3Y 1GMVA 3CVKA 2RH3A 1NJWA 2KHDA 2IAJA 4NEZA 3QJJA 1L3SA 4UOGA 5CXTA 1E6YB 3I32A 4Y2CA 4J7CA 2KG0A 3CD5A 3P5TL 3QSYB 1TUWA 3R5BA 3NCRA 3GIRA 4FYWB 4NMLA 4CNYA 3HULA 5GAGI 2XWXA 1R89A 3I6PA 4GO5X 2F9JA 3A3PB 3AH6A 2H1YA 1X31C 3UFCX 2AQ4A 1IBLJ 3MCOA 2GJIA 5D4LA 3FKBA 2HEKA 1D3WA 4LQ3A 4C8YA 2XNQA 3TQEA 3S8SA 2ROPA 4A8SA 3RB3A 2FUG9 3HFKA 1RAOA 2VOPA 3JTNA 5K20B 4WU2A 1HPZB 1RQ0A 2JHEA 3H0PA 2QE5A 1RWMB 1IM6A 2B6AA 1S1WB 5ETMA 1S1UB 2CJ9A 2F8EX 3PXGa 4Q5VA 3J81Y 4HT7A 2V50A 2YNIA 1RZMA 3D3BJ 3V81A 1TKDA 3GCWP 3LOUA 2ZD1B 1JLQB 2MKSA 3DOMA 4FP9A 3VVUA 1I94F 1T9YA 4BHQA 3FFIB 2YKPA 5FLXU 4XIUA 2QSFA 3D9BA 3MM7B 1Q8IA 1WF1A 3C66A 3EGVA 2UXCJ 4AT1B 4DPYA 4RW4A 2KFZA 5KOWA 4PPDA 1T3OA 2DHXA 2M4MA 2VFVA 2DCLA 2DYAA 1KEKA 3Q8RB 3ZFVA 4LREA 4RW9B 5EUHA 2RSQA 4N47A 4ECSA 3G96A 3CCRS 4OJ1A 4DUZF 1UL3A 1F2HA 2E9ZA 3PO5A 1FXDA 2BXJA 4FPIA 2OP5A 2LVWA 1H73A 2UUCF 4YN3B 1CC8A 3MMJA 3WX4A 4V1Ak 3OVAA 4P72A 2KO1A 5CYQA 4IFYA 4X4OA 3C16A 2WRMA 2ERRA 5EN1A 1B3TA 2BX6A 1FNOA 2MKCA 2C3UA 4ZIVA 3LUYA 5T41A 4M5GA 1T9TA 2MJUA 3W5YA 3H42A 2KRBA 1VDHA 2NS1B 3QBCA 1CC7A 1YJRA 3HJFA 5GMDA 2EEYA 1K0VA 4Y2IA 2FHJD 3FEXB 3G87A 2CNKB 2F8HA 4WFAQ 4K4TA 2X3GA 1FJGF 4NI2B 3KHRA 1JJ4A 5L9XA 4DS4A 3QIPB 1NK0A 4IH7A 3FGVA 2B5JB 2VB6A 2W9AA 4ZPVR 4JP8A 2YWGA 1ROFA 4OX7A 4IO9Q 5HQMA 1X5TA 2EWHA 2JLFA 1KVKA 2QLWA 3CJ4A 5F8HA 2RT3A 4UTGA 3HSZA 3QO9A 1HNWF 2AYMA 5KFEA 3RGIA 1T9VA 1MW7A 4CQ1A 2RDIA 5LMNJ 1I94J 2WSEC 4CLFA 5J2MB 4QYRA 3EUNA 5DGBA 1RT3A 4DV3F 4K5RA 1GQEA 3OTEA 3EVOA 2P5VA 4Q0BB 4HDHA 1MROB 2XYHB 3VWSA 1H7WA 3VAIA 2Q43A 3ENAA 4PPZA 3VHQA 4I2QB 3A3OB 3H40A 1YBUA 1HWLA 7FD1A 1WOOA 2C2NA 2BJ1A 2KFYA 4FYDA 2IFXA 3KLGB 1DY3A 3SV3A 4DUZJ 2H51B 3RZAA 2PEHA 2R7VA 1TELA 2R7QA 4PQUA 2VUGA 1JKHB 2QA1A 2PD1A 1MMNA 4UQGA 3PX6A 5LSLA 1TKXB 3HVWA 1XERA 2FJWA 2YKMB 2WONA 1K0TA 3PY8A 3OSPA 4HI2A 5F0UA 2AX1A 4X4RA 1R0AA 1ZAVA 3MTJA 4USWA 2E5LF 4HACB 1T95A 5B0AA 2DH8A 4L76A 4KV8A 1JJ2R 2MZQA 4CLZA 4NASA 2GJFA 2CQCA 1XR5A 4W90B 2ABYA 2Y0BB 5DG9A 3TZYA 3DXBA 4CT9A 4F4WA 1K73T 4JV1A 1EP4A 1C0TA 2V5HG 2AD9A 3OJUA 2MLYA 3J7YI 5D78A 4ZN1A 1T11A 1X9SA 3W5XA 1BQMA 2QX0A 1LWCA 2CADA 4X4SA 1F9FA 3OTDA 2EKNA 3RUBL 1VGYA 3MZIA 4A8QA 1HNWJ 1HMVA 4GMKA 3P5BP 1NMEB 1IN0A 3MFIA 4YUDA 4FKYA 4M8LA 5IQQA 2LMIA 2PEBA 1W2IA 4WE1B 1JLFA 1O6XA 5M2RA 5A76A 4R5PA 2X7IA 1KS2A 5CH7B 3DLHA 1UFWA 4PEOA 5T7LA 5L1IA 1OSDA 2O5DA 4RNOA 4RLEA 5F8LA 3OBIA 2H5JB 3CJKA 1JJHA 1R0CB 2OEMA 4OX9J 3KDOA 4X62J 5EWGA 5CD4H 1EETA 1GTEA 3FMBA 4ES3A 1FESA 2NR0A 2XSJA 3CULA 3X3UA 2E1MC 1SBRA 4ILRA 4LR7A 2CNNB 2HFZA 1ZH5A 1PIEA 3G6ES 3QQCD 3ZZ0A 3KYLA 2W9CB 1NK9A 3JSMB 2V8HA 2DNOA 2M2BA 4LBIA 3NXZA 2HWTA 3CNQP 3CJQA 1S97A 1VQKS 4TYAA 3GONA 2XO7A 4JI4J 5C42A 2OGUA 2OUGA 4MK7A 2C2MB 3H59A 1TMMA 2E5LJ 4RBTA 1KQGB 2C2KB 3DLGA 1TP7A 2F40A 2MPUA 4DL3A 1SI9A 2QYGA 1Q8LA 1REVB 3QNWB 4KGXB 2VJUA 3VAJA 2M5YA 3QRQA 3MM6A 4A8MP 1VRTB 4N76A 4ZVQB 1QE1B 2WSCC 2DNZA 4P2XA 3OHAA 4RUHA 4DCJB 2LU1A 2DPJA 4OQJA 3RB6A 5CYMB 2R3VA 2R7SA 1URRA 4CI0B 3UVJB 2CQGA 1F60B 4EI2A 2JEFA 3WDOA 4EUVA 1TAUA 2HBYB 4YP3A 3M2UB 2KL8A 2JNJA 1RHRB 1ZYQA 4J90A 5E2QA 2J9CA 4PWUA 2V8VA 4CTAB 3HZEA 5JVHQ 1HD0A 1F9EB 1KQFB 3ZZUA 3NS7B 2VV5A 2YWFA 1OIAA 1WHYA 5KFUA 1V5IB 4TVAB 4EZ9A 4LSLB 1DRZA 2UXDF 3I0SB 1CJKB 1JX4A 2MZJA 3NP5A 9ATCB 4NOHA 1HWUA 1RT5A 1NK5A 3VAFA 3PV8A 3MHYA 4C98A 2D41A 4LSZB 1HNIB 2IYGA 2YKNB 1RTDA 5DZ6A 1S1XB 2B8QA 4YEAA 2P9GA 4ZVPB 4QBUA 2HVHA 4G3IA 1IXKA 1VJQA 5E5NA 5L9NA 4USIA 1SKUB 1VQ8S 2AEMA 2XQCA 3T9NA 3NGTA 4URGA 1PBUA 1PO6A 3W60A 3OJSA 3BPDA 5GADU 4K5SA 3M9MB 1RWOB 3M9OB 4MKYA 3AB4B 1RAHB 1RT4A 2LCWA 3RAQA 3CCWA 2W8LA 2VDHA 4J9MA 2FY8A 3PFEA 2L9WA 4NYZA 2HVIA 1T94A 1NB7A 2ZITA 3T9ZA 2OFGX 2J7WA 3CCZA 4X66J 1HD1A 2ZBQA 4ZVTB 1U45A 4PRFA 1FJCA 1X4BA 4MK8A 2A2DA 4LF8F 5HAOA 3OTOF 2VA2A 3W7BA 3OTCA 5ETQA 4F8RA 3LW5C 4C4WA 1Y0HA 4L73A 3KLFB 1S9GA 5KFPA 1HBNB 2V2QA 4YDDB 2XY7A 2NREA 4ZPTR 2GMLA 3C14A 5A0YA 2L9NA 4WF9Q 4QU7A 4LFBJ 1VQ6S 4K59A 2CKWA 2AJQA 3QWUA 2VPYB 1ITPA 5DDQC 4DU7A 2WCXA 2ROEA 2ZWOA 5C7PA 2QA2A 3VZIA 2HS3A 3SI8A 1JXLA 3DRSA 1KD1T 1ZAXA 1F3VA 2MZTA 4EBCA 1UZHA 2I0XA 3TANA 3MEKA 3W2WB 4CIOA 2RJZA 3DGPA 4EEYA 5D77A 5AE2A 1SJ4P 3MR6A 2MB0B 2LEPA 3F56A 1RAFB 2FHKA 2YKOA 2ZUAA 3JS9A 4LMZA 3EPIA 2AJ0A 3W8PA 1KLMB 4B3RJ 2EFVA 2M52A 4ZKAA 2OPPA 3MEEB 2OH2A 1UMJA 2Z2LA 2AWZA 4Y34A 1VC0A 2M8HA 2I1RA 1DTTA 3I4PA 1N5QA 2OTJS 1NU4A 4NLOA 2VQEJ 3RTVA 2EFNA 1IQZA 1SQFA 1YJWS 3W5ZA 3TJAA 4ZHRB 1LQ9A 3FDSA 2GZOA 5E3RA 3C6UA 1WKKA 3MMAA 2PMWA 2WVCA 2Y1RI 1S0VA 1U1PA 1B4SA 1PYOB 1HYSB 3VQSA 2VFUA 1S6PB 1H6KX 4LF8J 2MQQA 3O5TB 4ECUA 2W4CA 1Q0NA 3OTOJ 4ES1A 1S0OA 3SBMA 4G1QB 2G4BA 2C22A 3SQGB 2RS2A 4LR9A 3OLAA 4HH1A 2JZ5A 4KR0B 3IRWP 3MMBA 5ETOA 3S6EA 4E8UA 4F4KA 4IOCQ 4UOHA 3N5FA 4J91A 3DOKB 1KQKA 2B4VA 1L3UA 5F9NA 2L9DA 2DGVA 2FJBB 2RHQB 1UVMA 4C11A 3FNNA 2K7JA 2HZCA 2V34A 1U2CA 3W3SA 2MQPA 5L8RC 2KI2A 3TNVA 1FRKA 2RUGA 1RYRA 5J2QB 3W9HA 3CTRA 3DLEB 5ETSA 3KK3B 2MKIA 1YJNS 5DM6Q 3DKDA 1U48A 4ECVA 2CUYA 4USVA 2VONA 3HK2A 4H4MA 3HHLC 1DQ8A 3G4SS 1UWBB 3ITHA 3TP2A 3KK1B 2E1RA 4MIBA 2J76E 2JEJA 2F5GA 3PKYA 4U7UK 3SZ2A 3QAUA 4KO0B 4L3KA 3TX0A 1FA0A 4O0IA 3TARA 4HHHA 2MGZA 1S49A 3D5MA 3I96A 2Z0GA 4NLSA 4HHJA 4DL7A 2XY6A 1VC6A 4K4SA 4TLQA 2MXYA 3UCUP 4I7FA 1QAXA 1U4BA 1Z2ZA 5F8IA 5KG6A 1GH8A 1N48A 2IJRA 3NGDA 3VTIA 3ZTQA 1Z4UA 2HGMA 4I56A 1QSYA 2WSFC 3HKWA 3WC2A 2ZVIA 3TJ9A 2M0GB 1UEUA 1LWFA 1S1VB 1NO8A 2B4OA 1EKSA 4K8RA 3N4WA 2GVZB 3CJ0A 2ZE2B 2D3ZA 3NRBA 4KGMA 4QWEA 3J7ZT 2YY3A 1RBLA 3KLIA 4ZP9A 3OL6A 4JOUA 4CLWA 3RRHA 4QPTA 1RTJA 4EK2A 3ZNJ1 3GIJA 1JLBA 3TA0A 2DEJA 2DR6A 4D3HA 2IM1A 1TKZB 3DRRB 1VI7A 3V5RA 2DHAA 4IG3B 1XNQF 1TFYA 1FXLA 1XTZA 3KUGA 3F44A 4WP9A 3LP0A 3TUIC 4EO8A 2IC3A 1S6QA 2Y1LB 2AEFA 1YIJS 2IPOB 2ZH6A 4LF9F 4QWDA 3MD1A 1RTHB 2MLZA 3EDRB 1NLKL 1S1TA 4KFBB 1LWEA 3AXMA 2ZOFA 4C3KA 1WNEA 1N6QA 5F8NA 3W64A 3WIUA 2JWNA 1NJXA 3NCPA 3W65A 1X4FA 3AODA 2AEJA 1R0BG 3FQLA 3CDEA 4OI4A 1WOSA 1PCAA 2IYIA 4LF7F 1UW9A 1YJ9S 2NUHA 2R42A 2AGOA 2VFTA 1CS4A 4ZS6A 2R7TA 3V6HA 5D6GA 2I2YA 1YRTA 4ELTA 1NPRA 1WEXA 5K9FA 8ATCB 1JLCA 4XTTA 5GAHU 4LF4F 3QRPA 1LK5A 5BYQA 1VHIA 2VKZG 4PXEA 3DXSX 2HKEA 3TWZA 1N36F 2CDRB 3FBEA 1RU1A 3AQOA 3IXQA 4KH1B 1FFWB 1VYAA 1S7IA 3R97A 2GHWA 1FKOA 5EX3A 4ZDNA 2GO9A 2CPIA 2ILYA 3FZ2A 3IG1A 2YNHB 3MECA 1DLOA 4FNHA 3OUYA 1X5SA 2YQ0A 2ZDPA 2QLFB 3M8QA 4DV7F 2BE7D 5G4DA 3CCVS 2E66A 4ED3A 4DX8H 1YITS 2AYEA 4DR4F 2IM3A 2V8GA 2M9KA 3JSYA 3TRGA 5KFKA 4EGLA 2BJDA 1Q78A 1KTQA 2XI2A 4NLQA 1XNQJ 3AXKA 1T03A 2ASYA 4C8NA 5D8HB 4NLXA 4DV0F 3ZXWA 3T5KA 2LQ5A 3I56S 1U8SA 3H2UB 5H9EJ 2CPEA 2YXLA 2CA9A 1VQPS 3PG9A 3H5YA 2G13A 4DR6J 4EWTA 3MAHA 4DWIA 4RW8A 3CJ2A 4Q44A 4F50A 1S9FA 2OELA 2YH1A 2VG5A 4HKQA 5HSPA 2BJ3A 3BM7A 2BBEA 3OHBA 3ENVA 3HHLA 2N4CA 5CZXA 1FD8A 2ZHOA 5A8RB 2QTWA 2W9BA 4B9UA 2FVSA 3HF5A 5KT5A 5ETKA 4GRSA 1WSRA 3DN9A 4N77A 3BQ1A 4LF7J 3QRRA 3R6GB 1E6VA 4IKAA 1SC3B 4JBCA 4ZVSB 4Q7AA 3MAQA 1BC6A 1GK8A 4F0MA 4J37A 2RE1A 4KHPF 5HQLA 3KWMA 2Z2MA 1BY9A 1BQNB 3OT9A 2Q6CA 4LF4J 1TKTB 1Y9OA 5CZVA 3ZTSA 1N36J 3L95X 2PFFB 1F5AA 4OZJA 3M1VA 1IWGA 5J2PA 1JK9B 3JXOA 4I1TA 4RNNA 1SCJB 4EU0A 2B3TB 1FKAF 5IZHA 4DZ6A 5B0FA 3R5AA 4B17A 2Z57B 4LT6A 3W2VA 3RR8A 2RAQA 4ZLLA 4OZ0A 4DSFA 4DR4J 3G6VA 1KVIA 4IQXA 4RPFA 4OHZA 5IT9U 1XMQF 3QT6A 2AYBA 1I3OB 1CQMA 4WFXA 4FS2A 3G8SA 5I4MA 1FK9B 3PM9A 1GFWB 4IDKA 4LFCJ 4JI5J 3MM9A 1X60A 3UDVA 5LOQA 3N0VA 2DB1A 2C2EA 2O66A 4OHWA 4C8OA 4YB7A 5ETRA 3NCQA 2K1RA 1NDPA 1BD6A 2W2PP 4USTA 4CO3A 4R8UA 2FTRA 2R8JA 2RNEA 3PR5B 2ZHBA 4WWSA 2CWKA 5G0RA 4OYZA 2CXEA 1HW9A 1GMWD 1OY9A 4ECWA 4LQ9A 2ZH7A 4K0KJ 3E2EA 3HHNB 2YNGB 1RT6A 2OPQA 1M0SA 2CDQA 3OD2A 2RMLA 2HK2A 1IBMJ 4OL8A 7AT1B 4O4RA 3A13A 4C6AA 4DS5A 4NCGB 3LPEA 2WVDA 5A8WB 1VBYA 2J8SA 2F3JA 3LP2A 2HFSA 1S4FA 4USKA 3GIKA 1LW2B 2MHEA 2OPSB 1QD1A 5A2QY 1PJ7A 2BANB 4OYBA 4Z7CA 2H4YB 1IBCB 3LWMA 4J9SA 1HBUB 3PR4A 2IVFB 1FEHA 2E1AA 4C3LA 3WC0A 1JLAB 5L38A 2J7KA 2E9RX 2IRYA 3FZBA 2N3OA 3PFOA 5LSOA 1LFPA 2FJAB 4EFAC 3OFHA 3Q83A 5D15A 5IM0B 1HWIA 3KDNA 2VG7B 1R3NA 4AXIA 2JEGA 2N7YA 4DL2A 3ZZOA 4QYZJ 2WHOA 1CPZA 2QV6A 1I5OB 3GYGA 2ILZA 1N0VC 3R5GA 4OHXA 5A8KA 2NLWA 3GR0A 1RWKB 4BWMA 3M32B 2DNMA 5LMUF 2AYGA 1TVRA 3K8WA 3MF5A 4LBHA 2CPHA 2CPJA 4GKKF 1YJ7A 1VLOA 2DH7A 2XLIA 4ZCIA 2BJEA 4NLUA 4IYQA 2L41A 5ETTA 2HHPA 4O4GA 1B0PA 1RT2A 3H8YA 5IV3A 4BLGA 3TAPA 2V8DA 1CJUB 2RRBA 2QL9B 4KE5A 3MGJA 4CM0A 4HYKA 3NOGA 2LEBA 1SJRA 2YBVA 1U47A 2MZ1A 3QIDA 2Y1JA 4WK1A 3DOLA 4PXBA 1HARA 3TVKA 3PX0A 1VBKA 3TEGA 5C24B 3BSAA 4UQTA 5ITHA 1J5OA 1EIYB 3CXCR 3DNCA 5GAGU 1U09A 1H0HB 1PJ6A 2ZDOA 2QZ8A 3PRBA 3ADAC 2HAFA 2IM0A 3AOBA 2PMZD 1VQSA 4DUYF 4QWCA 4ID8A 1WF0A 2WTFA 4IH6A 5IOLA 4E98A 3C8YA 1WELA 2UVRA 2DPIA 3SCIE 5E33A 1TL5A 4WFNQ 4ES2A 3J7Z5 4ECQA 5I3QA 2LP4A 3UE2A 2E44A 2V94A 1FO1A 1T05B 5KT2A 3G6XA 3V4IA 3HJVA 2IDEA 1LW0B 1RT7A 3EVWA 1YRXA 2VBYA 5H9FK 4JI1F 1YTYA 4RW6A 4LSNA 4DI6A 5I3PA 2F65A 2VC0A 1D8ZA 4IRCA 3ZZYA 2BEFA 1U1NA 1TL3B 4OZLA 2HMIB 5J1EB 1U49A 3DLBA 5HVHA 1TL7A 1Q82T 3KJQB 3UR0A 2MHNA 3GWCA 1JLGA 4GKKJ 1VQ9S 1Q81T 4M5NA 2FZGB 4A8XA 4KQZA 5AXKA 1N54B 3HX9A 4RUCA 5CD4A 2W4PA 5E3QA 4KGKA 5K8NA 4TY8B 4F36A 4F4AA 4FF3A 2XYPB 3QATA 2D9OA 3CCJS 2OD6A 2LYVA 2BRLA 3BSNA 1TV6A 4PG6A 3J81U 3SDEA 2HGNA 1S7HA 5K8PA 4DEZA 1P1LA 1JXVA 1H38A 2MTLA 1X5OA 1HWKA 1RISA 4OI1A 4XDCA 4DV6F 2DCUB 4AFFA 1X0PA 3E8OA 2LKZA 1EZZB 1U8WA 1S72S 2R7XA 1MSWD 2NQPA 2FJXA 2KVQE 2V6AA 2CNOB 1G7CB 2ZHAA 1RBOB 4TNOA 2UP1A 2WVBA 4XAKA 2PO4A 3TQ1A 3K5LA 1CJTB 3MWBA 2OKQA 3VAMA 1DJ0A 3CB4A 4ZP7A 1LWXA 2QLBB 1SKWA 2UUTA 3K5NA 2VKRA 3EPGA 3PZPA 3UDEA 1REGX 2GIQA 4C0OC 4UW2A 4GVBB 4USUA 1SUQA 2CPYA 5HBMA 1F9HA 2AHOB 3K2YA 1SV5A 2GVDB 1NK7A 1IR2A 1X9MA 4YHHF 3CIMA 4FXVA 3TR5A 3US5A 2DR8A 1VQYA 3FC9A 5HK4A 2WVFA 3I0RB 2PI5A 1H2TZ 3ZZPA 2VQFJ 2LA4A 2BJ9A 1U24A 3C2PA 5ETVA 2ZH8A 4AL7A 2J9EA 2G1HA 3T1YF 3AJDA 2KRRA 2X1AA 3SEOA 1OSCA 5JJBA 4F2RA 1HHQA 4N5SA 2COLA 1L3VA 3GR1A 2AMCB 2UUAF 2GJ2A 2RD5C 4FBUA 3IO1A 4U8VA 3MMCA 2ZWPA 1WOPA 2QL5B 1RE1B 1YZ7A 4C48A 1G4CA 4TYBA 5EWEA 1RAAB 3R5CA 3R27A 4IQMA 2LQ9A 3NBPA 2EPIA 4ZPCA 5HMXA 1FE0A 4UOCA 2VODA 4M63A 2ADCA 1Q7LB 4DV6J 5LT5A 2BQRA 3LP1A 1M5VC 2N3LA 4FF2A 4OYWA 1APSA 3FSIA 3T6JA 2H54B 2FVCA 4N8OA 2OSQA 3CJ3A 3CUNA 1Y3KA 2I8EA 4J9RA 3L3CA 3M2VB 3DU5A 3QFWA 1XMOF 2XGPA 3LAMA 2EBEA 3OV7A 1Q4RA 2W2MP 3IGVA 4ZLJA 4DR5F 3OLBA 1FDAA 2R7WA 4DCPB 4QIVA 1NJYA 1SVDA 4YHHJ 1MN7A 1S9EB 2AV5A 1R43A 2KT5A 3M2RA 3GE9A 3R8YA 2QMUB 2KJVA 4J9UE 3EGNA 2XCPA 3ZZZA 1FTRA 2WOMB 4ED6A 2XS7A 2GV1A 2AT1B 2HLTA 5AXNA 1NAQA 1Y5IB 1MNEA 2EBGA 2GNKA 3T1YJ 2AZ3A 1I1GA 3O3LA 4BDPA 3EM1A 3CMES 3B4DA 4PG4A 5HQ8A 1UKUA 2DISA 1D9AA 5E3PA 3UI3A 3ULHA 5DO2A 2UUAJ 4DLEA 3TAMA 5L46A 1ZZNA 3WZ0A 3UR3C 1RU2A 3LWLA 2EFOA 1S6OA 4PWDA 1D0EA 2V2KA 4ECTA 5HROA 2HHSA 2MSSA 3I5BA 5F8MA 3TVZA 4TU8A 1H72C 3BN4A 1YLXA 3MM5A 3V2UC 2VJVA 3D3CJ 4WPAA 4A46A 3SCLE 3HSGA 4U7CA 5KFTA 1EAYC 5F0WA 3MM8B 3JYTA 4CCHA 5ETPA 4LUBA 2FIUA 3M6XA 1WC0A 1WC6A 3FSXA 5DRKA 2G9OA 5C25A 1BGXT 1NHKL 1VQ4S 4UZBA 2W8KA 2FGOA 1PYSB 3MEDB 4B3MF 2ASJA 2W7AA 1EX8A 1KTVA 5B09A 3KMSA 3A12A 4MTPA 4J5OA 4I6WA 4F25A 4MK9A 2KZMA 5K14A 2BE2A 4J9NA 4ICLA 1TZ0A 4CO2A 3AAWB 5GAHI 3NMRA 4WJBA 4QIWD 2OEKA 3E01B 1C0UA 2HBQB 4NRTA 4OX8A 1FKPB 2IAJB 3DRXA 4OHVA 1KFDA 2MQNA 3GFXA 1QVFR 3B4MA 4M94A 4B3SJ 3IGNA 3FRYA 4RBUA 4I64A 2KT3A 3R5DA 2YQ1A 3K7RA 4V19X 3KUEA 4DX5A 2H48B 3CJ8A 4WIQA 1UJ6A 4ITSA 4ETZA 1M5SA 1KVJA 3OR1A 4ZCMA 4H4OA 1OYDA 4CYUA 3V6DA 2MKKA 2QIFA 3GV8B 1AYEA 1MU2A 4F26A 1RAEB 2KKHA 1RWNB 4DSLA 2YPYA 4HDGA 3I55S 3H90A 2I38A 4YQWA 2PI4A 2OJ3A 2A18A 3LO3A 4X4VA 2NCKL 1C1BA 3UCGA 1HQUA 3MTKA 2HHWA 2B4UA 3TA1A 2VU5A 2V4QA 1SIZA 2B6AB 2WB1D 3EVMA 3KG0A 4LIWA 3NWGA 3NMAA 2MQLA 2UVVA 4JI2F 2YNIB 4F3OA 2FDNA 3V81B 2PFDA 5JUMA 1GX5A 4JUZA 4F3MA 1A6LA 3U7JA 3DOMB 2LDYA 2E7WA 3BS9A 3LGMA 3JSRA 2FZKB 4B9MA 4OIXA 3SFGA 4PUOA 1TK8A 2ZH5A 3IC1A 1U26A 1NDKA 1W25A 4CWBA 4KY3A 2DEIA 4RW4B 4P10A 3CSKA 4WXWA 3G71S 2AGQA 2CVIA 4NXMF 4ZMMA 3G8QA 1GX6A 5KOXA 3VCDA 4RW7A 1CEZA 2VA3A 4IUFA 2C3YA 3BBBA 3ZNUA 4ZPBA 5KFXA 3DOKA 2HYIB 3SMZA 1UVKA 4OJ3A 5CYQB 4IFYB 3C16B 5D4PA 5EHHA 2GHPA 2HQ3A 4ED5A 3LGNA 1RWPB 3FQKA 4L75A 2FYXA 4OYMA 4X4NA 1IUJA 3OVBA 1P8GA 3KFWX 4BS2A 4B9SA 1BQXA 4GC7A 1ZOTA 1HBOA 2C2ZB 3CO0P 3IRXA 2ZVSA 5J1NA 1ZPWX 3F0NA 1OYEA 2D3UA 2DGOA 2XMWA 3Q8QB 1HIYA 3D0GE 2K2PA 2BQ3A 1FRLA 2M88A 4ZVOB 3HHDA 2ZM6F 3V6KA 2XLKA 2Z2YB 3OQ2A 3M8YA 2C3OA 1AZSA 2XLJA 1WACA 3Q23A 1UEVA 4RKUC 2HAIA 1QTMA 1AFJA 1RJJA 4MAKA 3SQOP 3ZTOA 2RF2A 4AYBD 3QO9B 2A0FB 5DLGA 2FHJA 1FX2A 3CCES 3OR2A 1SQEA 3OFEA 2P2CB 3GFYA 1WC3A 4TQSA 3M8SA 4IRKA 2ACYA 4YB1P 2QLXA 1LOUA 5C2CA 4NXNF 5LJ5Y 3RW6A 2CG4A 3LALA 5L1KA 2ZBPA 4ZPWR 1O51A 2RQCA 1LK7A 1WORA 3G86A 3BSOA 1B0VA 1CG2A 4H54A 1VR6A 4X4UA 3DHWC 4DCOB 2VPZB 3D1OA 3T1HJ 3M8PA 2CJKA 2QC3A 1CQNA 3TZXA 4JV0A 3FUYA 4K4XA 4A4JA 2OMLA 1HQEA 1FVSA 2NXEA 4ED1A 4DR3J 3SYZA 4DQSA 3H5UA 3K5PA 1RUSA 2I9SA 1V3SA 4DG1A 1ZM9A 2WONB 3EJMA 4TU9A 2BM0A 4Y00A 3T19A 3IWNC 1R0AB 1NB2A 4XK8C 5T14A 1WF2A 1WD6A 4KV8B 2BACA 4WTYA 4DBQA 3JSBA 3UDLA 5C5JA 1A7GE 2FLOA 4EMDA 3AJ1A 2L3MA 3UN5A 4LF6J 4N56A 3K59A 4PCQA 3Q8SB 1EP4B 4NLYA 1C0TB 3A3NB 2CQIA 6FDRA 1Q7YT 4KHMA 3ET6A 5KFDA 2M8DB 3RW7A 3BR9A 1BQMB 3BGUA 5DDOC 5CHCB 2BZ2A 1LWCB 5D4NA 1K47A 2N7CA 1W26A 4YB6A 1QAYA 1ZBTA 3R5JB 2XEXA 1EQMA 1HMVB 1FERA 3CC7S 2A2CA 4P2FA 3JQKA 2OD4A 4RR5A 1JLFB 4R5PB 1FXRA 2KXFA 1R8BA 2NXCA 3DHXA 3BJYA 4ELVA 5FJ4A 2W7OA 1U1MA 4MYTA 4NLRA 5T7LB 1T0TV 3M05A 1FJEB 7FDRA 1YQHA 2WAQD 5LM7E 4C97A 3CJKB 3HD2A 3GYXB 2QL7B 1EETB 1KP6A 2BMBA 2V4JA 3CMAS 2LXIA 3P8BB 1D8YA 4P9SA 2WVEA 2XSJB 2YNFA 2FHMA 2XZTB 2AW0A 1NKEA 1HKAA 5JXSA 3UW1A 3ILLA 2J9DA 2P6TA 5B0DA 3ILJA 2R8IA 4YMEA 3H4BA 2XWYA 3ISNC 1IQTA 4RWXA 1XN9A 4C8KA 1W2BR 1ZZFA 4CH7A 4CNZA 1FRXA 3Q2TC 1N34F 4MFBA 1B70B 1HNZF 3EMTA 2W7PA 4FN5A 1NSPA 2DNRA 5C42B 1RSCA 4LF1A 2K8GA 1BUXA 1HWJA 5I42B 3IWXA 3IAM9 4RU9A 3CWJA 1KOHA 4NE9C 4DDFA 2GA7A 3GFZA 2QA4G 5KFLA 3VGSA 4ANDA 2DHHA 4I6AA 2A10A 5A6PA 3MM6B 3H2VE 4O23A 2OAUA 2K3IA 1R31A 2GFFA 5M2PA 3U02A 3MXHP 1MMDA 3DI6A 4JI0J 2E29A 1SH0A 2HZVA 3VGVA 1J5EJ 3IBWA 2V8PA 5AE1A 1Y11A 2R8HA 2EXUA 4F0KA 1RADB 1M1KT 4DF4A 5KFIA 2QO3A 3KLVA 1HR0F 4DR1F 3FEZA 3T5LA 5MLCV 2QFJA 2BKNA 3VAGA 5IWAF 4U95A 1J2VA 4C0HA 1NSAA 3CD6S 2LLZA 2J0SD 3IM9A 1RT1A 4KT0C 1FEEA 2HZAA 3PHTA 4DL5A 1S57A 1RT5B 1QAIA 1I51B 1RHKB 3G9CA 5C2GA 3N6NA 3KK2A 1AFIA 3IP0A 1RTDB 3BB5A 1RDRA 2FJDB 3CJSA 4XPCA 4DV5F 5H1SV 3M6UA 2RDDA 4F2SA 3W9IA 1DQAA 3ZZTA 4MKVA 4FZVA 1QUVA 3CC4S 2Y9HA 3GILA 3VAKA 8RUCA 4QR1A 4NZ6A 4ED0A 5FDLA 3C15A 3MD3A 1F5BA 1RT4B 3B8HA 4DN9A 3OL7A 2KDOA 4OV6A 3IMQJ 3OPKA 4LFAF 3M7VA 4ZCLA 3DRYA 2PE8A 2NUUG 2IMWP 3IAS9 1PAEX 2QA4S 3NS5A 4DPWA 1B7FA 4KKOB 2DIVA 2UUWA 1HI1A 2UUCJ 1YJTA 4UT4A 3JAMY 3D7SB 5JMNA 1UAWA 5HO4A 3FJ2A 1XR7A 1HR0J 3UCZP 2WW4A 1YBAA 1S9GB 3OXLA 1BHNA 2U1AA 1OO0B 4P52A 1P1TA 5A8WA 4IFVA 2K3KA 3C14B 4ECZA 5A0YB 3CDUA 3PDNA 2O3DA 1Q5YA 1C1CA 1S59A 2BJ7A 2HLUA 2W25A 4Q2LA 1HBUA 1IBKF 2HQDA 1RA7A 2HGLA 3POTA 2Q79A 3DRSB 3D54A 4ILMA 2XMUA 3BKUA 4R0EA 2MLXA 2XTJP 3OXGA 1RB0A 2CRLA 1RHJB 3DGPB 2MZRA 3EE3A 3M6VA 1F1BB 1KLNA 1VRUA 3F73A 1FJGJ 2IHR1 4DSJA 4YY3F 4MKBA 4CLUA 2UVUA 3MCSA 4G65A 1UVIA 1WSVA 3G82A 3FBBA 5KFMA 5B0EA 1QJHA 5F3ZA 2CQ3A 2AJ2A 1PJ5A 3HI9A 3MPWA 2OPPB 1NZ8A 3AJ2A 3HSDA 2NZ4A 3NAHA 1M5KC 1DTTB 4LRBA 4LVOP 1SH2A 3GYNA 4DV3J 4B9TA 4O3RA 2OPRA 2ZBRA 2YX1A 1M5OC 1FRMA 3CGIA 3D4JA 3WBZA 4RU2A 5HI7A 3C6UB 3GQCA 4CLKA 4F4XA 3MMAB 3C6TA 1VCTA 3Q2SC 1EHWA 2Z8QA 3DM2A 3T6BA 1PYTA 4ECRA 2DT9A 2VG6A 1VHFA 4WP8A 2YH0A 5HN0A 2HNDA 3GP9A 4RNHA 4AL5A 3QLHA 2D74B 2HHTA 4U8YA 2HFUA 4DHVA 1L3KA 1OY6A 3GU0A 3MMBB 4J9QA 4R0JA 4NCAA 3RU0A 3BH6B 1NHVA 3BGRA 3CD7A 3THPA 3BV8A 1U1QA 5DG7A 4C11B 2UU9F 1FE4A 3R1LA 2IIHA 3DYAA 5E41A 2JVOA 4FXWA 3K5MA 2QN6B 5HATA 1S0NA 2GO8A 3M8ZA 4LRCA 1WEYA 3P45B 1YDLA 5KFYA 3IR5B 3FCVA 2VF3A 5LSRA 3MR7A 3KOAA 3RAMA 2F7VA 4H4MB 2KZZA 1DBDA 5L39A 3ITHB 4DV4F 2DBBA 3HD1A 3QGPA 4XPEA 3ZZRA 1FRIA 4NLTA 3MEGA 1IKYA 3BGLA 4CM2A 1OMSA 4FYVB 4Y3CA 1UJ4A 1UCNA 2RKIA 1K8AT 2BJ8A 1TR0A 1AW0A 2DGXA 3RBDA 2MGZB 2J5AA 3N01A 5CCMA 2DGWA 3KTQA 3K17A 1YKWA 5A2QU 2B9EA 2W2NP 4BCAA 1WC1A 2CZVC 4I7FB 4UF4A 5KG2A 3PW4A 4QIGA 1SL2A 4K50A 4NZ0A 1SC4B 3CIZA 3KNGA 2Y1IA 3K5OA 4DXLA 2JJ4D 2DNKA 4CLLA 2XS5A 1AUSL 1VIOA 1TTHB 4G1PA 2WW8A 4ENOA 1WWHA 1PGZA 1LWFB 4TXSA 4Z7YA 4O44A 2A1BA 4C3MA 1SB6A 2DGQA 3ZO7A 2FVPA 1X5PA 1YHQS 1DTQA 1X4CA 2I6WA 4B3OA 4KJIA 1U1RA 1H2VZ 1CULA 1RBAA 1LXJA 3DDIA 3KLIB 1WI6A 2UU9J 4M5IA 5DS7A 2HNZB 1RTJB 1PILA 2UV8A 1X0FA 2KU7A 2HFNA 2PC6A 1JLBB 4HI1A 2QGFB 2GGPA 4JYAF 4A47A 5KFVA 2HHHF 2CJXB 2DKOB 2JOQA 1ZM4A 1CJVA 1UP1A 3QGGA 2KM8C 2C3PA 1XK8A 2XMVA 4P71A 4DOZA 3RB0A 3BBFA 3CO9A 3LP0B 3NY0A 2IC3B 2DTJA 4DV4J 1S6QB 2V68A 1FTCA 2PDAA 1X4GA 1T3NA 2NZCA 2C3MA 4ECYA 2PIIA 4PG7A 1K9MT 5KG1A 1NJIT 4PXCA 4YR3A 2ZJQQ 4Q8EA 1JIHA 2CQBA 4NA1A 5K8MA 3OTBA 4ZN3A 3D6HB 1S1TB 2CQ0A 1FFSB 3PW0A 1LWEB 3OL9A 4ZPDA 2BOPA 1O0PA 2K06A 3AOAA 2D3O1 4ZJQA 1U7LA 2BE9B 1UPMB 2QMWA 4ZJLA 1SJQA 2H5IB 3K8VA 1N6QB 5EGYA 2CYYA 4ELUA 1N33F 1RHUB 3W8GA 2G1DA 1UFKA 3G8TA 3TEHB 4W92B 1T8EA 2B7CB 2X3DA 2DNQA 2UXDJ 4AXJA 1X7VA 2UXBF 5KAKA 2MQMA 4K2JA 1CS4B 4CO1A 1U0HA 5DDRC 2R7RA 1JLCB 4NYPA 3AFGA 3ISND 1FNMA 2Q6BA 2EW9A 2R2TA 3MR3A 3NGRA 2B7BB 1QVGR 4GO7X 4M5DA 3QYYA 3CJ5A 4PR6A 1NCLA 1JB0C 1FKOB 4EZ6A 2XYGB 4AUKA 3IG1B 3KJVA 2Z30B 2ZBCA 3MECB 2NYIA 1DLOB 1RGVA 2YX7A 2MQ8A 3OUYB 5BJRA 3M8QB 4JI3F 1R7IA 4Q8FA 4QW8A 4C8LA 1T02A 4IR9A 4B02A 4J9VA 5B08A 4PZVA 2BOAA 4ETXA 1DARA 2VOOA 2ZZTA 2YKAA 3W62A 4JYAJ 2CFXA 5BXIA 2OHDA 4HTJA 1S10A 1T03B 5J2NA 1VLYA 4MT1A 2EG2A 3TZZA 2L08A 2QEXS 3THTA 1B0TA 2CQ4A 2X1BA 4NRUA 1LEOA 3GV7B 4ZOSA 4B9VA 3FBFA 1X4EA 3GJSB 1MWYA 4RW8B 1NJZA 4ZVEA 4WKYA 1GXLA 4OYOA 2HK3A 5AXMA 1K1SA 1R8CA 5M2UA 1EQ0A 2VG5B 1WI8A 3ZTPA 3IS9A 3HHLB 4M5JA 2HIYA 1N5VA 3EZUA 2CPZA 2W9BB 2JVRA 1WG5A 1RAIB 2ZKUA 2WK4A 4FDFA 1E6VB 1RA6A 5KT4A 1N5TA 3Q8UA 2IA6A 1IBLF 3DRPB 5KFZA 5U47A 3UWTA 4NL5A 3V6JA 2ADBA 2CQPA 4RUAA 2VFSA 4ED7A 2LXFA 1Q86T 3GPAA 1FDDA 1ZTWA 3DMJA 3M1VB 5J2PB 3M8WA 1VFJA 3ICLA 1RKJA 2NPFA 2KJWA 3N79A 3P6YC 4RUBA 1SKSA 3D66A 2GIFA 4CZCA 4TY9A 1SJ3P 1Y7PA 4DSKA 2ZJPQ 4IR1A 1N5YA 2JSXA 1S79A 3W2VB 5I3UA 5KG5A 3W63A 4UZCA 5HP1A 3BO3A 3DLKA 1HA1A 3F41A 2ACMA 3FMWA 3M30A 4Z37A 4G1IA 3MFHA 1RTIA 4G6VB 1EARA 2B51A 4J9LA 1XJWB 4WU3A 1IJEB 2V63A 4Y6IA 3PW5A 2RRAA 3HSJA 2C28A 1VS3A 4WFBQ 1FF2A 4JV2A 3SXLA 4IDKB 4IG0A 1QSLA 1TUGB 3MM9B 3MCMA 3AD7C 2DY1A 3E51A 3OFGA 2C2OB 1FKPA 5E3AA 4DF8A 2K1RB 1MN9A 1GTHA 3CD0A 4MKAA 5H9FJ 2RQ4A 2I5JA 3PW2A 4R8UB 3PIOQ 3HLUA 1OS5A 2Z56B 3PKMA 2ZH2A 3CT9A 5G0RB 2HBRB 3MAAA 2JFKA 4FF1A 2CJAA 3IA0A 3FCHA 1S77D 2JL9A 3L7OA 2H9ZA 1RT6B 3KHLA 2OPQB 3CMQA 2J0QD 4M5HA 3JQMA 1SIWB 2GC8A 1JWWA 3P4UB 3HT0A 2Y0SD 1IWAA 4KH0B 1VOMA 1CBKA 3BQ2A 1R8HA 1T9WA 1IKVB 1U1LA 1YK9A 3C19A 5HLFA 1NDCA 1MLAA 1SPBP 4CP5A 4YR2A 3LP2B 1VQOS 2ZKTA 4HHUA 3BQ0A 3NAIA 1GMWA 4K4YA 4OYAA 3PNIA 3TYTA 2OI2A 3QJLA 2CQHA 5ETNA 3BBCA 2F9DA 1RLDA 5GAEU 4NPOA 3HT3A 1IR1A 2FQQB 1P9QC 2MKJA 2Y8YA 2EFPA 2E5GA 3HKZD 4C8MA 1RYSA 4BC7A 1RTZA 5LMNF 1U2FA 1QUPA 1WKJA 1A0OB 2HHQA 2NXNA 4PAAA 3L4BC 4CO0A 2HHXA 5A8KB 1N52B 1NH7A 3HXMA 2CQDA 4YDXA 1ZTTA 1TVRB 4Q45A 4AQYF 1JLEA 4MH8A 3CDAA 8AT1B 2PA3A 2A6MA 2W01A 1QAJA 4O4GB 3J81j 4F04B 1RT2B 1V3ZA 3K0JA 4TKTA 3BZQA 3B82A 5IS2A 3VR1A 3Q22A 3IBCB 3CJTA 3DOLB 5DQGA 2M7SA 4C8ZA 4H4KC 4Z2XA 4OYPA 1CSJA 3KUHA 3HFZB 1M90T 1J5OB 4C2MA 1F0XA 1BE4A 2HNYA 4FYYB 4XO0A 1AUDA 3D67A 1U6FA 1S48A 1GXTA 2V2VA 1WKLA 3AHPA 2BYCA 2VASA 3A8KA 1U2RA 1IKXA 1GNKA 2DXFA 3TUZC 2ZFHA 4ILLA 2LFVA 3VVTA 4NZ7A 1FVQA 4P7VA 3AB2B 3UN3A 3KMQA 5CYJA 5AXLA 4W98A 4MJKA 2H3EB 3V4IB 1RHMB 2ZZNA 3U1MA 2DNLA 1KSPA 1RT7B 4LF9J 3ETMA 2HWIA 4QR2A 4RW6B 1IKWA 4LSNB 1UEKA 3NG8A 4YB5A 2KH9A 3KLEA 3BEGB 3J80Y 1T9XA 3B78A 4DFMA 3QWPA 4RX6A 5D3GA 3U1LA 1UWAA 4ID5A 1XIQA 2VBZA 1D9DA 1LV5A 1TL7B 4OX9F 4AQYJ 2KYXA 4X62F 1JLGB 1KBRA 1IJFB 2QG9B 4L72B 5E7OB 3OL8A 1KKHA 1URNA 3LANA 1QM9A 5CABA 5F3TA 3FVYA 1WUUA 3EWGA 2FZCB 3BPSP 3TI0A 3LA0A 3CC2S 5IT0A 2LQ8A 2JC1A 2DXEA 3HVTA 3KLHA 1RACB 2XS2A 2APOA 3S1TA 4QIEA 1TV6B 4DV1F 3I9V9 4JI4F 3SDEB 2XHCA 1AA1B 1XBWA 1FD2A 3KG1A 4I2PA 2FC8A 3RBZA 1TK0A 5KT6A 1UETA 1H2UX 3EXCX 4DV7J 1ZS6A 3GLJA 1KRPA 4PXDA 4WKRA 4DR7F 2C1EB 2IVMA 4EYIB 4DPUA 3HVRA 3PJXA 4P6QA 1NNDA 1TL1A 1V6HA 4O3OA 5BR8F 4JI7F 3SIPB 4LRFA 2MEWA 3QFHA 4K4WA 1SUQB 5HBMB 4DV0J 2QLJB 2ROGA 1SV5B 2U2FA 1T7PA 2QYCA 3G2XA 4U6PA 4QZVB 1E6YA 2QSWA 2FJVA 2R8KA 4MYUA 3A8EA 4KIAA 3GSIA 3L7PA 3HHKA 1NKCA 3PHEA 3DCAA 4I67A 2ZH9A 4HL9A 2ZJRQ 4PG5A 1VJWA 4ED4A 4OV1A 3R7BB 3GMGA 1SJFA 1EB0A 4D3GA 1X8DA 2R2RA 2MQOA 5IT4A 2HW3A 4YOEA 1U6ZA 4ERDA 1ZPVA 5IQ6A 4QCLA 4NWBA 4KHPJ 4DL0C 3QGHA 4DSIA 3MMCB 1VQNS 1HPZA 1WC5A 4DV1J 2BW7A 2W24A 1S1WA 3P49B 3NBPB 1S1UA 4ED2A 4U9RA 4O0NA 2CJQA 2XI3A 5I42A 3PX4A 3OSNA 1MG7A 3BSCA 1BWEA 1X4AA 3QZ7A 1IM4A 3LP1B 1N88A 2ZD1A 1JLQA 2NXJA 3MPYA 3K57A 1WHXA 1WHWA 3H20A 2V2ZA 3LAKA 1QSSA 2FJEB 1NM2A 2RDJA 3FFIA 2JDJA 4DR7J 1NHUA 2E7XA 2VD3A 1XMQJ 3MM7A 4AE5A 2ASLA 3BREA 4UUWA 4H4KA 4X66F 5BR8J 4NA3A 4JI7J 2AGPA 3DU6A 3PTWA 4RW9A 1U6BA 1HHSA 2AJFE 2XY5A 2XMAA 3RYLA 4KB7A 3A8JA 1QY7A 1GAOA 3M2RB 4DQPA 1QLNA 1ZAWA 3RJMB 2BDPA 2FVRA 1Y5NB 3Q8VA 4ZVHA 1RWXB 4LFBF 4V19J 4CLYA 3CDWA 2DIUA 3O8WA 4LRDA 1KOOA 3FK4A 2DY9A 1KHWA 3PW7A 5KFFA 3R6LB 2XB2D 1RCXB 4K2XA 5KFBA 2RQMA 1SH3A 3CPWR 3TAMB 2JLGA 5EX0A 4P74A 4NI2A 3L9ZA 3QIPA 1NH8A 1O5JA 4PWDB 4PQAA 3G6YA 4OZ2A 3HMJG 2B5JA 5HROB 1NDLA 4B3RF 5LXYA 3TUPA 2YVSA 1S99A 4LJMA 3E3XA 3MM5B 3VGTA 4WIIA 1WJ9A 1UTAA 1SC6A 1TK5A 3TA2A 1TQLA 1NKBA 4OZNA 5J2MA 4WK3A 2VQEF 1UZDA 3JYTB 3MI7X 4Q0BA 4K7QA 1MROA 3D0IE 5LMUJ 5C25B 2F8MA 2BKPA 1M5HA 5KG7A 3PIPQ 4RNMA 4X65F 2J8AA 2ZC3A 3C46A 4I2QA 3LF0A 2GMJA 4HT5A 3Q86A 3GB0A 4DX6A 1F5CA 3KLGA 2QT7A 5K14B 5D0GA 2BE2B 4KKOA 4ICLB 1AROP 3UQSA 3UN2A 1OY8A 1NPKA 3CCLS 1JKHA 2BV3A 3CDBA 1G6BA 1C0UB 3A8IA 2MJNA 1XR6A 1VQ7S 2HFOA 1TKXA 1RAGB 3HM9A 2PT0A 4ZVGA 2B9WA 2YKMA 3DDKA 2G2OA 1XNRF 1KNZA 4DPOA 2F63A 4DJBA 2DNYA 3DDNA 4N8NA 2V67A 2EKYA 4ER8A 4HACA 2JC0A 1G1XA 3AQPA 1Q79A 3T1AA 4J9OA 1Y00A 3H5SA 2GAGC 4OHYA 1OPZA 2OLWA 4B9LA 1P27B 1UA1A 3KHGA 3OR1B 4H4OB 2DGTA 4CYUB 1UA0A 3V6DB 2N82B 4OI0A 2HPUA 1MU2B 4PYDA 4DUYJ 2VH7A 4KSEB 1ULRA 1TL4A 4KGZB 4W4MA 1UVLA 3V4MA 2DR9A 4ZJOA 2XSFA 1C1BB 1HQUB 3N9UC 3HVAA 2FLPA 2ZBIA 1WC4A 2L48A 2MKHA 3N28A 2BVZA 2VFRA 1LKZA 2H4WB 4ZVFA 1KONA 3BO4A 3CE8A 4F0HA 2YTCA 2M3DA 4NYOA 4JI1J 1C4AA 4WE1A 3BF4A 4NLVA 3KJFB 2V0NA 1YWXA 3GSDA 1HNVB 4ZCKA 2XZDB 4ZP6A 4LVNP 1WDDA 1HW8A 4IH5A 2MY8A 2AJ4A 4X65J 5DG8A 3PYDA 1RHQB 2KVIA 2CQ1A 4PUOB 3R2CJ 2OMOA 2YWKA 2R8GA 4CH0S 3PEJA 3J7AN 1Z2LA 1BLUA 4P73A 1RCOB 2CPXA 3D68A 4L6V3 4O3NA 2W9CA 5HJXA 4S0MA 5GMEA 2PSZA 3UNGC 3JSMA 2WB4A 4MIAA 5HVFA 4RW7B 4KC5A 2YKQA 3TVYA 4QJVA 4OI2A 2Z2ZA 3TJ8A 1XNRJ 2AX0A 2ZUGA 2RU9A 4GC6A 3KNAA 3PJWA 2IBKA 1FT8A 5FD1A 5D0EA 4DZDA 4DQIA 4F02A 4Y2KA 1GMUA 1M1HA 3DGVA 3OVSA 1BMQB 4X4PA 2VHGA 1REVA 4FVMA 3QAEA 3GZ7A 4TLRA 1VRTA 4P75A 2CIMA 1HBOB 1FRHA 2XM3A 3IRXB 5HANA 2DRAA 1QE1A 4NMXA 2DRDA 1RAJA 3D6FB 2NYHA 3TOQA 2MSTA 4RO0A 2UUBF 3PCOB 3Q89A 5CYMA 2RILA 1GT8A 1HLWA 2XMTA 1M5PC 3UVJA 2P8IA 5ADZA 4L3NA 1WTFA 2GQQA 1NEEA 1AZSB 3LH2S 2CZ9A 3M9NB 1NBEB 5KFJA 3JAMU 1SXLA 3M2UA 2ALZA 3GIMA 1YGYA 1HBMB 2GMHA 1PSDA 2IVYA 4DUTA 1WHVA 2RF2B 4CTAA 3SSQA 3OR2B 4KPYA 2LXUA 5DM7Q 1VK3A 1ZA1B 4FVCA 4EBDA
chains in the Genus database with same CATH topology
4DHVA 1L3KA 2HIQA 2IRYA 1OWXA 4JI0F 3FZBA 3THVA 3MMBB 3VQTA 4J9QA 4LSLA 2UXCF 4R0JA 4NCAA 3RU0A 3PFOA 2N3OA 3I0SA 3HZGA 1JXEA 5LSOA 4M95A 1H3DA 1LFPA 3O6QA 2FJAB 3NS6A 4EFAC 2Z4PA 2SXLA 1WG1A 3OFHA 5IM0B 2XMKA 1HWIA 2GQ2A 2AJ1A 1J5EF 5FLXY 3FEYB 5BYSA 1NHVA 2VG7B 2ZNZA 3MOZA 1KC8T 1R3NA 4AXIA 3E01A 5LJ3Y 2JEGA 2GIRA 3BGRA 3CD7A 1UFLA 2N7YA 4DL2A 3THPA 1U1QA 3CVKA 5B0GA 5DG7A 4UY8T 1HNIA 2RH3A 3ZZOA 4C11B 1NJWA 4QYZJ 2UU9F 1FE4A 2YKNA 3R1LA 2KHDA 2IAJA 2WHOA 3QJJA 2QV6A 3DYAA 1L3SA 5E41A 1CPZA 1KHVA 2JVOA 4FXWA 1XEZA 1ZM2A 1N0VC 2ILZA 3M8PB 5CXTA 4OHXA 5A8KA 2NLWA 3GR0A 3K5MA 4BWMA 1S1XA 1S0NA 1E6YB 5GAEI 3I32A 2GO8A 2DNMA 3M32B 5LMUF 2AYGA 4Y2CA 1WEYA 3CD5A 3P5TL 2KG0A 1TVRA 3R5BA 3K8WA 3MF5A 3NCRA 5KFYA 3MOJB 1H7XA 2CPHA 3IR5B 4N41A 2CPJA 5LSRA 4GKKF 2G0CA 1HQEB 1DURA 2BQUA 3KOAA 4NMLA 4CNYA 5GAGI 3ISZA 2XWXA 2YX4A 3I82A 1WEZA 3RAMA 2F7VA 2DH7A 2XLIA 1R89A 3I6PA 4ZCIA 2BJEA 4H4MB 4BBYA 2KZZA 1DBDA 4GO5X 4NLUA 5L39A 4IYQA 4DG1B 3ITHB 4DV4F 1I6JA 1AXQA 2L41A 2DBBA 2F9JA 3QGPA 2HNZA 2HHPA 4O4GA 3ZZRA 4XPEA 1FRIA 4NLTA 3MEGA 3HO1A 4R25A 1B0PA 1RT2A 4CH1A 1IKYA 3BGLA 3H8YA 3AH6A 3TAPA 2V8DA 3UFCX 2HRYA 4QW9A 2AQ4A 4Y3CA 2RRBA 1UJ4A 2GJIA 4KE5A 5D4LA 2RKIA 3MGJA 1K8AT 4HYKA 2Q66A 4WZMA 5L38A 2LEBA 1D3WA 4LQ3A 1TR0A 4C8YA 1SJRA 2XNQA 5AE3A 3Q0AA 3S8SA 2ROPA 1AW0A 4A8SA 3RB3A 1U47A 2MZ1A 3QIDA 2FUG9 3HFKA 2VOPA 4DQQA 2DGXA 3JTNA 2XCAA 2Y1JA 3RBDA 4WU2A 1HPZB 2MGZB 4WK1A 2J5AA 1RQ0A 2JHEA 4FNIA 2QE5A 3N01A 3DOLA 4PXBA 5CCMA 1HARA 2DGWA 3KTQA 2B6AA 2LQBA 1S1WB 4F3QA 2NXUA 1S1UB 3TVKA 3UPFA 3PX0A 2CJ9A 2F8EX 3PXGa 4DR6F 1NRKA 5C24B 4Q5VA 3J81Y 4BCAA 1OPIA 4HT7A 2CZVC 3BSAA 4UQTA 4I7FB 5ITHA 5KG2A 1J5OA 2YNIA 3PW4A 4QIGA 1SL2A 4K50A 4NZ0A 3V81A 3CXCR 1TKDA 3DNCA 5GAGU 1U09A 1H0HB 3LOUA 3CIZA 2ZDOA 3KNGA 3O44A 2QZ8A 3PRBA 5CCLA 2Y1IA 2ZD1B 1JLQB 3K5OA 2FLNA 1L5UA 2JJ4D 2IM0A 2DNKA 2PMZD 2MKSA 3DOMA 4FP9A 3KLFA 1I94F 2XS5A 1VQSA 4NLWA 1VIOA 5KFQA 4G1PA 2WW8A 3NGKA 4DUYF 1WWHA 3DLLQ 4QWCA 4K4VA 4ID8A 4BHQA 1WF0A 1PGZA 2WTFA 4IH6A 1HBNA 3FFIB 2HG4A 2YKPA 1LWFB 4TXSA 4E98A 3C8YA 4XIUA 1WELA 2QSFA 2DPIA 2UVRA 1TFWA 3SCIE 5E33A 4O44A 1TL5A 2A1BA 4WFNQ 4ES2A 4C3MA 3MM7B 1DFDA 1Q8IA 1SB6A 3J7Z5 2DGQA 4ECQA 4E0DA 1WF1A 3C66A 2FVPA 5I3QA 1X5PA 1YHQS 4RW4A 2KFZA 3UE2A 5KOWA 1DTQA 1X4CA 2E44A 1T3OA 2DHXA 2M4MA 2VFVA 2POKA 2V94A 2ZOGA 1FO1A 4PPDA 1T05B 2DCLA 4URQU 1KEKA 5KT2A 3Q8RB 4ED8A 3G6XA 2P6SA 3V4IA 4B3OA 3ZFVA 4KJIA 1U1RA 1H2VZ 4RW9B 4OLPA 1LW0B 5EUHA 1RT7A 1LXJA 2RSQA 4N47A 2XGQA 1YRXA 4ECSA 2VBYA 3G96A 3KLIB 4JI1F 1FJ7A 1WI6A 1YTYA 3CCRS 4OJ1A 4DUZF 2CZ4A 4RW6A 1UL3A 4LSNA 5I3PA 2E9ZA 3PO5A 2VC0A 1D8ZA 1FXDA 2ZH4A 4IRCA 2BXJA 1S76D 2R2UA 3W2WA 2RRNA 5DS7A 2HNZB 1RTJB 2V4JB 2OP5A 3ZZYA 2LVWA 4I4BA 1PILA 2UV8A 1P6TA 1X0FA 2UUCF 2KU7A 3BR8A 2HFNA 2PC6A 1U1NA 1JLBB 1CC8A 1TL3B 2YNFB 3MMJA 2XMJA 3WX4A 4OZLA 2HMIB 3OVAA 5J1EB 2IRXA 4HI1A 1U49A 2GGPA 2KO1A 4JYAF 4A47A 5CYQA 5KFVA 2HHHF 3DLBA 4IFYA 4B9NA 4X4OA 2WRMA 1Q82T 2JOQA 1ZM4A 1UP1A 3UR0A 2ERRA 2MHNA 3GWCA 3NNAA 1JLGA 3QGGA 1VQ9S 2KM8C 2C3PA 5EN1A 1FNOA 2MKCA 1XK8A 2C3UA 1KLMA 2XMVA 4DOZA 1Q81T 3N6MA 3RB0A 2J0WA 3LUYA 5T41A 4A8XA 2JEIA 2MJUA 4KQZA 3CO9A 5AXKA 1SJ1A 4RNFA 2KRBA 3LP0B 4MFBB 2OIHA 1N54B 3HX9A 4RUCA 2IC3B 3MEEA 2DTJA 2W4PA 3M6WA 1S6QB 1FTCA 1WG4A 2NS1B 2PDAA 1VBXA 1X4GA 1T3NA 5E3QA 2C3MA 4KGKA 4ECYA 5K8NA 2PIIA 4TY8B 4PG7A 1YI2S 1CC7A 1K9MT 5KG1A 1YJRA 1NJIT 3HJFA 1L3TA 4PXCA 4YR3A 2ZJQQ 4Q8EA 4FF3A 1JIHA 2CQBA 2D9OA 2A3JA 3CCJS 2CJBA 2OD6A 2LYVA 4NA1A 3QMQA 5K8MA 1K0VA 2LA6A 2BRLA 3OTBA 4Y2IA 5DQHA 2FHJD 3BSNA 3NLCA 1S1TB 2CQ0A 1TV6A 3FEXB 4WYWA 3H4DA 3PW0A 1LWEB 3OL9A 4ZPDA 4PG6A 4ZHRA 2BOPA 2F8HA 1O0PA 4O3PA 3SDEA 4WFAQ 3QJPA 3NNCA 4K4TA 2HGNA 2X3GA 1S7HA 1FJGF 5K8PA 1U7LA 3KHRA 4DEZA 1JJ4A 4LFCF 2QMWA 1P1LA 4CO5A 1H38A 1SJQA 5L9XA 4DS4A 1X5OA 3QIPB 3K8VA 4JI5F 1N6QB 1HWKA 1NK0A 5EGYA 1RISA 4OI1A 4IH7A 2CYYA 3FGVA 4ELUA 2B5JB 2VB6A 3PRDA 4XDCA 1N33F 2W9AA 4DV6F 2DCUB 4AFFA 5F9LA 1X0PA 3E8OA 4ZPVR 4WZQA 2LKZA 2YWGA 1HYSA 2G1DA 3G8TA 1S72S 1ROFA 4OX7A 3QZ8A 4IO9Q 5HL7Q 2R7XA 4W92B 1MSWD 1S6PA 1T8EA 2NQPA 1X5TA 2B7CB 2EWHA 2JLFA 3DI6B 2FJXA 1VBZA 2DNQA 2QLWA 3CJ4A 1G7CB 2ZHAA 5F8HA 2RT3A 2VC1A 1X7VA 4TNOA 4AXJA 2UXBF 2UP1A 2J7UA 4XAKA 2MQMA 5KAKA 3LPYA 2JRSA 1B64A 3D1HA 3QO9A 2PO4A 3I9ZA 4G1QA 4WCEQ 1HNWF 1RWUA 2AYMA 3U1NA 4CO1A 5KFEA 3TQ1A 3K5LA 3SQGA 4A8OA 5DDRC 2R7RA 1MW7A 3MWBA 4CQ1A 2OKQA 3VAMA 2RDIA 1JLCB 1DJ0A 2WSEC 1CLFA 5J2MB 3CB4A 4NYPA 4QYRA 4ZP7A 2J0XA 3EUNA 5DGBA 4K0KF 1SKWA 2IA0A 1RT3A 3ISND 4Y28C 1FNMA 2UUTA 3K5NA 2Q6BA 4K5RA 1GQEA 2EW9A 4DV3F 5DJBA 2VKRA 2R2TA 3MR3A 3OTEA 3EPGA 4GKJF 2B7BB 2P5VA 3PZPA 1QVGR 4Q0BB 4GO7X 4HDHA 2GIQA 1MROB 4C0OC 4UW2A 3VWSA 1SUQA 2CPYA 3QYYA 4M5DA 5HBMA 4A8YA 3K2YA 3CJ5A 4PR6A 1SV5A 1JB0C 1FKOB 1H7WA 1IBMF 4EZ6A 1HNXF 4AUKA 3VAIA 1NK7A 2Q43A 4J9KA 2KFNA 1X9MA 4PPZA 3IG1B 4YHHF 4I2QB 3KJVA 3H25A 3CIMA 2ZBCA 3JTOA 3DRPA 4FXVA 3TR5A 3US5A 2ZH1A 3H98A 2NYIA 3MECB 2DR8A 1DLOB 1RGVA 1GXUA 1VQYA 3H40A 1Q16B 2YX7A 3OUYB 1HWLA 5BJRA 3I0RB 3M8QB 2K7KA 1RT1B 7FD1A 2KFYA 4AL6A 4FYDA 4JI3F 2GHVC 1DZ5A 1R7IA 2IFXA 4TN2A 5FIIA 4OX6A 4QW8A 3KLGB 2PI5A 1T02A 3SV3A 4C8LA 1H2TZ 3ZZPA 4B02A 4IR9A 3DLJA 1JMTA 5B08A 3RZAA 2CPFA 2PEHA 3SCJE 2R7VA 3TX8A 3D2WA 5CQGA 2R7QA 2LA4A 5J2QA 4PQUA 3DLEA 2VUGA 1U24A 1JKHB 4ETXA 3C2PA 2QA1A 3KK3A 2ZH8A 2PD1A 1DARA 2VOOA 1MMNA 3KK2B 4AL7A 2YKAA 4X4QA 4UQGA 3PX6A 5LSLA 2CFXA 1TKXB 2J9EA 4USHA 5KFAA 3HVWA 4DFPA 1Y5LB 1XERA 5IFMA 3T1YF 4QWAA 2FJWA 2YKMB 1UWBA 2WONA 1K0TA 3PY8A 4IOBA 4HTJA 3OSPA 1S10A 1T03B 2KRRA 2X1AA 5J2NA 5F41A 4HI2A 1VLYA 2AX1A 5F0UA 4X4RA 3SEOA 3KK1A 3VAHA 1OSCA 1ZAVA 1OQ3A 5JJBA 1R0AA 2EG2A 1G2EA 3BDPA 2L08A 4F2RA 3MTJA 4N5SA 2COLA 3THTA 1L3VA 2QEXS 1B0TA 2E5LF 2CQ4A 2X1BA 3GV5B 1T95A 5B0AA 4NRUA 2DH8A 4DV2F 3GV7B 3GR1A 2D3OR 2H5EA 4KV8A 4ZOSA 4B9VA 1X4EA 2UUAF 1JJ2R 2MZQA 1YRUA 2GJ2A 2RD5C 2MDAA 3T5JA 1MWYA 4DSEA 3DC2A 2CQCA 4FBUA 1XR5A 4RW8B 1NJZA 4W90B 5E3CA 4ZVEA 4WKYA 1GXLA 2ABYA 4KO0A 3IO1A 5DG9A 2DITA 3EXYA 3MMCA 5AXMA 1K1SA 1R8CA 4NLPA 3UD3P 5M2UA 3DXBA 4Y65A 4CT9A 3NL0A 4F4WA 4TYBA 2VG5B 4OI3A 1K73T 1TAQA 4EBEA 5EWEA 4JV1A 3R5CA 3R27A 1WI8A 4IQMA 2LQ9A 3NBPA 1EP4A 2EPIA 3M8RA 4ZPCA 5FDLB 1C0TA 5HMXA 3IS9A 2V5HG 1FE0A 2QRRA 3HHLB 2AD9A 3OJUA 4UOCA 5DETA 2VODA 3AA9A 4M63A 2ADCA 1N5VA 1RT3B 2OFHX 3EZUA 5D78A 3J7YI 2FHOB 2CPZA 1Q7LB 2F1FA 2W9BB 1X9SA 1BQMA 1WG5A 2JVRA 5LT5A 2BQRA 3LP1A 2R9LA 4DL4A 1M5VC 4URSA 2ZKUA 2WK4A 2DVIA 1LWCA 2N3LA 4FF2A 4X4SA 1F9FA 2VZ9A 3OTDA 1E6VB 1RA6A 5KT4A 1N5TA 3NNHA 2C2RA 1VGYA 4QWBA 2IA6A 3J7A1 3MZIA 1IBLF 2GQCA 1APSA 3FSIA 3T6JA 4A8QA 1HMVA 4GMKA 3DRPB 2FVCA 5KFZA 4N8OA 5U47A 1S1VA 2OSQA 3CJ3A 3UWTA 4NL5A 3CUNA 3V6JA 1IN0A 3MFIA 1PC5A 4YUDA 3I4HX 1Y3KA 2I8EA 4M8LA 5IQQA 3L3CA 4J9RA 2ADBA 3KG4A 3ONQA 2VPWB 3RR7A 3M2VB 2CQPA 3DU5A 4RUAA 4JV5F 2VFSA 2LMIA 1W2IA 1XMOF 3BDEA 4U67Q 1U1OA 4WE1B 2XGPA 1JLFA 3LAMA 5M2RA 4R5PA 2EBEA 4ED7A 1KS2A 2LXFA 3GFHA 5CH7B 4A8WA 1Q86T 1FDDA 3OV7A 1Q4RA 1ZTWA 3DLHA 3DMJA 2ZE2A 4PQUB 1UFWA 3M1VB 5J2PB 1Z1ZA 1VFJA 3IGVA 3ICLA 1RKJA 2NPFA 5T7LA 4DR5F 5L1IA 2KJWA 3OLBA 1N5SA 1OSDA 1K1QA 2O5DA 3N79A 2AP6A 4RLEA 4RNOA 1CVJA 3P6YC 5F8LA 1SKSA 1FDAA 3OBIA 2R7WA 1ZM3A 5HMWA 4CZCA 4QIVA 3D1QA 3CJKA 1JJHA 4TY9A 1NJYA 1IKVA 4IFVB 5EWGA 5CD4H 1S9EB 2AV5A 4B3TF 1SJ3P 1Y7PA 1EETA 4DSKA 2ZJPQ 1GTEA 1R43A 4IR1A 1N5YA 2JSXA 1S79A 3FMBA 4ES3A 1FESA 3W2VB 5I3UA 5KG5A 2NR0A 2XSJA 2KT5A 3M2RA 1C1CB 3GE9A 3CULA 2MYFA 2KJVA 3X3UA 2D7SA 2E1MC 5HP1A 1SBRA 1TKZA 3EGNA 3BO3A 4ILRA 3DRRA 2XCPA 3DLKA 3ZZZA 4EO6A 1FTRA 1HA1A 2HFZA 3F41A 3TAQA 3FMWA 1ZH5A 3G6ES 3M30A 4YR0A 4Z37A 4G1IA 2DR7A 1HFEL 4IG3A 2WOMB 3ZZ0A 4ED6A 3MFHA 3KYLA 1RTIA 3MR2A 2GV1A 2W9CB 2XS7A 4G6VB 1NK9A 2HLTA 3POTB 3UDCA 3VF0B 2B51A 3JSMB 2HHVA 5AXNA 1NAQA 4J9LA 2B43A 2V8HA 1Y5IB 4WFZA 1MNEA 2DNOA 4P2SA 2OSRA 2EBGA 4WU3A 1IJEB 2M2BA 4Y6IA 3PW5A 2O67A 2GNKA 2HWTA 2RRAA 1S97A 1VQKS 2WBRA 1UJ5A 2C28A 1VS3A 4WFBQ 1N8RT 1I1GA 4TYAA 3O3LA 2XO7A 4BDPA 5LL6d 5C42A 1FF2A 2KG1A 2AU0A 2DNHA 4JV2A 3SXLA 3CMES 4WXOA 1VRUB 4IDKB 4MK7A 2DO4A 3B4DA 4IG0A 4PG4A 1HI0P 4HTIA 4NCBA 1QSLA 3H59A 5HQ8A 3MM9B 4RBTA 2JFDA 3CEDA 3E51A 3OFGA 1KQGB 1UKUA 2E5HA 4ZP8A 2DISA 1D9AA 5E3PA 1RTHA 1FKPA 3PEHA 3DLGA 5E3AA 3UI3A 3ULHA 2K1RB 5DO2A