4MAKA

Crystal structure of a putative ssrna endonuclease cas2, crispr adaptation protein from e.coli
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
73
structure length
73
Chain Sequence
SMLVVVTENVPPRLRGRLAIWLLEVRAGVYVGDVSAKIREMIWEQIAGLAEEGNVVMAWATNTETGFEFQTFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CRISPR-associated endoribonuclease Cas2
publication title Crystal structure of a putative ssRNA endonuclease Cas2, CRISPR adaptation protein from E.coli
rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 16
structure length 73
sequence length 73
chains with identical sequence B
ec nomenclature ec 3.1.-.-:
pdb deposition date 2013-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09707 Cas_Cas2CT1978 CRISPR-associated protein (Cas_Cas2CT1978)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.240 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4makA00
3B78A 2WBMA 1DARA 3OQ2A 2XEXA 3ZZTA 2BV3A 3B82A 1ZM2A 3ZZ0A 4QR2A 4ZCLA 4QR0A 4ES3A 2E1RA 4MYUA 2KDOA 4FN5A 4ES1A 2BM0A 4QR1A 1N0UA 2NPFA 1ZPWX 2ZITA 2CVEA 3LH2S 1U2RA 2IVYA 2J7KA 4ES2A 1ZM9A 1T95A 3E3XA 4ZCMA 5G4DA 3EXCX 3UI3A 2BM1A 4ZCIA 1ELOA 4MYTA 1KTVA 1N0VC 2I0XA 2L9NA 4M1KA 4ZCKA 2EFGA 4TNOA 1P9QC 3ZZUA 1FNMA 3B8HA 1VI7A 2I8EA 4MAKA 1ZM3A 1ZM4A
chains in the Genus database with same CATH superfamily
3M8RA 1LFWA 1L3UA 4DFJA 1KKHA 4TY8B 2GS8A 2WCXA 4CH0S 3NS7B 1U8WA 4Y28C 3P8BB 2M8DB 2WVDA 5I4MA 2ZJRQ 3SV4A 1ZBTA 1G4CA 1OYDA 1Y11A 3MM6B 2HHTA 1S49A 1DJ0A 3P6YC 1HMVB 3QYYA 2XLKA 3QZ8A 1FK9A 4RW9A 1BMQB 2FVSA 2WBMA 2RS2A 3GQCA 2HQ3A 2ZUAA 3MM8A 1X4HA 1FXDA 4K4XA 2RUGA 1TK5A 3HI9A 4USWA 2X1FA 3PM9A 1WSVA 1XEZA 4B9SA 3C15B 3G96A 5F8HA 4CLYA 3TJ8A 4DL4A 1UEVA 1CEZA 3V2UC 1ZS6A 1DZ5A 2Z56B 4PPZA 2E1AA 1FJ7A 4LFBF 2BANA 3OPKA 3JTOA 3M7VA 1E6YB 2E5GA 4IDKB 5C42B 4AL6A 4MIAA 3T9NA 3TX0A 2HHHJ 1OJ4A 3IO1A 4O4RA 3U02A 2HFOA 1CS4B 3TUJC 3BGRA 2R7UA 4KKOA 4ECWA 4KC5A 4ZPAA 4WE1B 4LQ3A 1CJUB 2LMIA 2AV5A 2M3DA 2QTWA 2CZVC 3ZZZA 2XZWA 3I9V9 4I2QA 3PXGa 3UD3P 3HM9A 2Y3YA 4I7FA 3X3UA 2A1BA 4O3PA 3I4PA 3RYLA 1VJQA 2XS7A 2GA7A 4OX8A 3MM5A 3KK3A 4DL0C 1BHNA 2YKQA 4WFXA 4OYXA 2J7KA 2ZE2B 4RL1A 2OP5A 8ATCB 4PQUB 1SI9A 1LV5A 3DRXA 4JI4F 3BB5A 1FKPA 4OZJA 1X0PA 3OL8A 4LIWA 4DDFA 2XS2A 3CW2C 4NLOA 1KRPA 2R2RA 2G2ZA 2WRMA 4Y65A 3HDSA 4PG4A 2DHSA 1WF2A 5KFOA 4ECXA 3D0GE 4Q5VA 1XWLA 5KT7A 1NH7A 3V81A 4PXEA 5I3QA 2PI4A 3THVA 2OGUA 1HI8A 4ERDA 3D9BA 4QIEA 2PEHA 4RKUC 3RAXA 2CRLA 1Q8KA 2HZVA 4CTAB 5IQQA 3JB9k 3JTNA 4DPUA 1MU2B 2CA9A 2V8GA 1Y5NB 1N33F 3SIPB 2IDEA 2VONA 3R9LA 2E29A 2M9KA 1RT2A 4JBCA 2XMJA 2ROGA 3BSAA 3V6DA 3DFEA 3OL7A 2B5JB 5A2QU 1XNRF 4MIBA 1REGX 4OYMA 3CCMS 3Q8QB 3R2CJ 4FS2A 2B3TB 5A8RA 1M0SA 3PJ9A 4UOGA 4JI8F 2YWEA 3MD3A 4ZCLA 3I87A 2DNOA 3VCDA 3W66A 2X51A 3BQ1A 4XAKA 3UDVA 2OFHX 5AXNA 1JJCB 4KE5A 2QLBB 1XBWA 3AB4B 3I32A 2NZCA 1DY3A 3Q22A 4J9SA 3TZYA 9RUBA 1N5QA 1VLOA 4UY85 1RTZA 1T3OA 2VB6A 3ET6B 3MDFA 3VAGA 5JMNA 3P96A 1UPPA 4MK9A 4PQAA 1T03A 5DRKA 4ZVEA 4WZQA 2FJAB 3GIMA 3UN3A 2LVWA 1APSA 2DNLA 4OJ1A 2DNPA 1CJVA 1KDNA 4ZPDA 4K4TA 1OO0B 1XNQF 1M1GA 4HI2A 1VRUB 2CQDA 3K7RA 2V69A 1RT4A 1T0TV 4DV5F 4DL5A 2XEXA 2XI2A 3DRSA 2AW0A 2Z8QA 2ATCB 4EZ6A 4DR3J 1MROA 4NXMF 4OZ0A 1R0BG 3A3OB 3CCRS 5DM6Q 4NCAA 1RTIB 1VQSA 4LR9A 4P6QA 3GR1A 3ILLA 3UN5A 2HFNA 2VG7A 2KDOA 4X65J 2HHXA 3R5DA 1XERA 2K7JA 1UJ6A 4CCHA 3N28A 1REVA 1IKVB 2HPUA 3RB0A 3Q8PB 4CYUB 3TRGA 1UFKA 2D41A 1B99A 5K5MA 1YBAA 2V50A 2UUWA 1RT5B 1YLXA 2NXJA 3UWTA 5KFFA 1SL1A 3PIOQ 5KG6A 5E5NA 2Q6CA 1T02A 4HLBA 3U1NA 1AFIA 5KTQA 1KQSR 1EX8A 2ZEJA 2W8KA 3SQGA 3CCUS 2D69A 2VF3A 1FHTA 2WONB 5KG3A 3MM7A 1NJIT 4RW6A 2LFVA 1YJTA 3M8YA 3J7YU 4DV1J 3W64A 4AQYJ 2G9OA 2AF6A 4NZ7A 1HL6A 4Z7YA 2RQCA 2FD2A 4K0KJ 1SUQB 1Q8LA 2YKPA 8RUCA 1E6VB 1FRKA 2ZHOA 2ZOFA 5MAOA 1YG0A 4GRSA 5IQ6A 4UQTA 2CWXA 2CPXA 4A8YA 2VOPA 2G0CA 2FLOA 2HGNA 4C8MA 2DHGA 3QAUA 4RR5A 1SCJB 1IKYB 2KM8C 2GMJA 1T7PA 5D78A 2G1HA 1X5OA 2ROEA 4C11B 2VHGA 3I0RB 2HHQA 4CRJA 3DLEB 2IHR1 2WTFA 2B8QA 1DTQA 1ELOA 3G2XA 4QU6A 3M8PA 1CVJA 1OSCA 4V19X 2QO3A 3OTOJ 5ETTA 1DAXA 4ZA1A 5IM0A 3M2UA 2DKOB 5KT4A 4B3OA 4WTOB 4TU7A 2M8HA 2D9OA 4NRTA 3GJRB 2VUGA 2VH7A 4USUA 4C8KA 2OLWA 5B0EA 2MTLA 2RRAA 1T9XA 2VQFJ 1O0PA 1Q7LB 1SQGA 4L75A 4RWXA 5CYMA 3C14B 1TL7A 1Y7PA 4C48A 4IO9Q 4Q43A 3KJFB 1QUPA 2U2FA 1HNVA 1RT7A 4DX5A 1ZA2B 3BBBA 5BR8J 3ZC4A 2BE9B 4QWBA 4C0BA 3M30A 4DUZJ 2ZBPA 3QRQA 2X3DA 2ZH6A 2LKZA 5DG8A 1SH3A 2BKPA 2VG5B 2MKKA 1S48A 2ZZTA 4P75A 1GAOA 3UE2A 2IY5B 1T05A 2JDJA 2I1RA 4DV6F 1TL1B 3O5TB 1NDPA 5FJ4A 1B4SA 2ZD1A 4IUFA 1XN9A 2HBRB 1V9OA 1VJWA 4IO1A 2XZDB 1RT6B 5LMUJ 2Y8YA 5FLXY 1C1BB 3BGFA 3D68A 3TZZA 4PYDA 1U48A 2X1BA 2W9BA 2F4FA 3CCVS 2CPJA 3OXGA 2C28A 3AY0A 3TJAA 1AXQA 2EVZA 2YVSA 4TLRA 2ZM6J 1F3FA 3MAHA 2RKIA 1KHVA 4OI1A 3PG9A 1RXOB 1U26A 4KSEB 2B7CB 4V1Ak 4Q8FA 1HBOB 2E1RA 4WFZA 5HMYA 4GC6A 2BXJA 1N0UA 2HS0A 2J9EA 5C24A 1JXLA 4NPOA 5A8WA 3RGIA 2EKYA 1FVSA 4JI2F 2VJVA 3EICA 4CH1A 3OVBA 1UWBB 1L3SA 1N32J 3L7PA 1LFPA 3KG1A 1DBDA 2AKWB 4C8LA 3E01B 4F3MA 3QJPA 1Q4RA 4ZJOA 3BPDA 3HVAA 3LPEA 2FQQB 4ZIWA 1AUSL 3TYTA 1Y4ZB 4N7TA 3N6MA 3EYZA 4RUBA 1D8YA 1RTDB 1EETB 3BPSP 3KFWX 3GSIA 1YJRA 3MPVA 4DS4A 2Q6BA 4X2BA 2WB1D 2MLZA 2L9DA 4FZVA 4ECRA 2YNHB 3MURP 3R5AA 3PKMA 4FBUA 3FK4A 4HI1A 1WC5A 4ZPVR 3OVSA 5E0OA 3PRVA 1FNMA 5K14A 1KWMA 4QYZK 5GADI 4K50A 3NLCA 4UY8T 4DV4F 1F60B 3ENAA 2DNYA 1HQUA 1TKXA 1RT1B 1TU0B 3EPIA 1H7WA 3QLHB 4AT1B 2E44A 3T41A 3DXSX 2HAIA 3AAWB 4IRCA 5HQLA 2JRSA 4DQRA 4MAKA 2IM2A 1LWEA 2OPSA 4PG8A 2AEMA 3AFGA 3DN9A 3RW6A 4JI6F 3BYRA 2BUNA 4P9SA 2C2DA 4HTJA 4KHPJ 1ZM9A 3JTPA 1H7XA 4Y2CA 4GKKJ 2ZVIA 4NLVA 2UUBF 4C0OC 2L08A 1RWKB 4DR4F 2CFXA 4DFKA 4RWWA 3TUZC 3BGUA 4OJHA 4LF2A 3CMES 5E33A 4JI5F 2C22A 2XB2D 5KFAA 4EEYA 4JI7J 1RWOB 2Z58B 1MN9A 4OLOA 1PILA 3KG4A 2NUHA 4MKYA 4F7VA 2MKCA 2VQEJ 1RYRA 1ZZFA 4CDIA 1UWAA 1YJWS 2BMBA 1S1XB 4DSLA 1WHXA 3R7BB 4A8FA 3HCXA 5HROB 1XMQF 4F0HA 2VG6B 1S1TB 3CE8A 3V6KA 2KL8A 4D3HA 2EKNA 1YX2A 2GQQA 5KFTA 4OHVA 1B7FA 5KG7A 2KHCA 1VQNS 3B4DA 1N6QA 5DDPC 2W9CB 3MPDA 3W9HA 3T6JA 1YIJS 4CZCA 1VR6A 4LF7F 3LUYA 5L46A 1IR1A 1WNEA 1RHRB 5K20B 3T5KA 2CJXB 3LP2A 1Q79A 2OUGA 1VBZA 2W7PA 4LUBA 1AW0A 3KLGB 4MFBA 3FZBA 4K5RA 2A6MA 4IG0A 4NLSA 1RZMA 3I55S 4LFCF 2ZH1A 2E5LF 3CIMA 4CP5A 3MAAB 3Q8YA 3NCQA 4F3QA 1BWVA 1UZHA 1HNIA 2N4CA 3MMAA 2OPRA 3DU6A 2F8EX 1JJHA 4OX9J 2OD6A 1NK9A 3W9JA 2GJ2A 2M2BA 3FDSA 4QPXA 2DITA 4FNIA 5FLXU 3CCLS 3KJVB 2HNYA 4O3OA 2MJNA 3W2WA 3EZ5A 4ANDA 2LP4A 2HHWA 3HMJG 1QSSA 1T8EA 3UW1A 2G1DA 4FKYA 2W4CA 4HDHA 2OPQA 1IR2A 4Q7AA 3KLIA 3CD0A 5EGYA 1XR5A 1TV6B 4RU2A 5IWAJ 2V4QA 1TVRB 1DTTA 5HVFA 4PRFA 4PG5A 5ETKA 2UXBF 2NREA 1BY9A 4M5DB 1RHJB 1JLBB 4DJBA 4U8YA 4RW8A 3MUMP 3BS9A 5LXYA 1NHVA 3NGUA 2F4VJ 2K06A 5KFBA 4MJKA 2UXCF 1R8BA 4PWWA 2XTJP 2R2UA 4X4NA 4N8OA 2CQBA 3IXQA 3OLAA 2A10A 1GXTA 3QWPA 3WC0A 2FC8A 2L3MA 2KHDA 3SQOP 1PC4A 4LSLA 4P52A 3AOCA 3M32A 4DS5A 3IC1A 5CABA 4ZIVA 3QSYB 3Q86A 2HWTA 4URQU 1Q82T 2Q1LA 1V5IB 3QAEA 4KPCA 1HBUA 2M7SA 4RUCA 3U7JA 2YKNA 4NI2B 3OL6A 3UR0A 3I9ZA 1OIAA 5LSRA 4DQIA 3G86A 4ECUA 2FDNA 3DMJA 2WBRA 5KFMA 3ENVA 2CVEA 1MSWD 3CO0P 4NLQA 3GIKA 1UFLA 1C0UA 3TAPA 1T9VA 2EXUA 1R8CA 5EN1A 2GHPA 3DRRA 4KBIA 4DL7A 4C97A 4ED3A 1GMUA 4JI3J 1C1CB 2XNQA 1FE4A 1NB2A 2YX4A 4F4WA 5G4DA 3HKWA 3R3TA 3RW7A 3V4IB 4QZVB 2V8VA 4QCLA 1KOOA 2HBQB 2IMWP 3MEEB 3BGOP 1DURA 3BH6B 3GYXB 2YPYA 1XQIA 3ILIA 3HZGA 4G1QA 5CCMA 2CPZA 3AXMA 1FVQA 4BWJA 2XQCA 2I8EA 3C8YA 4OHYA 2GIFA 5HVGA 3KHGA 4P72A 3DXBA 4BDPA 3CGIA 2POKA 1SJQA 4IOCQ 2CQ2A 2AX1A 3LAMA 1M5OC 2N3LA 2W2NP 4NASA 4IFYA 2C2ZB 2YNFB 3CTRA 2BOPA 4YB7A 4KTQA 4CLSA 3CCES 4LF6J 3G9CA 5MLCV 4USTA 4CLKA 5D3GA 5M2PA 4DV0F 4Y34A 3LTOA 4DL3A 2DR9A 1YJVA 2GFFA 2RHSB 2HK2A 3PACA 2MB0B 2GMLA 3FFIA 1I94J 5HLFA 1UCNA 4EFAC 4F2RA 1AZSA 1D3WA 4WXWA 2XMWA 2JEGA 2EK6A 4JV0A 5LMNJ 1DARA 2XO6A 1WI6A 2F9JA 1KQFB 1S0VA 4LF9J 3C3LA 1SKSA 5KFJA 1R8HA 2R9LA 1LXJA 2VV5A 4ED4A 1RAJA 1HNXJ 2GMHA 3ISNC 1I1GA 3KLEA 1YVFA 2DGQA 2BOAA 3OTDA 3VVTA 1VFJA 4PXDA 5HBMB 3MEDB 4B9MA 2HNDA 2VODA 5A6WA 2ZC3A 4X64J 3HO1A 1QD1A 1IBKJ 1LK7A 4IG3A 5L1KA 4S0MA 2QA4G 3W9IA 3DLBA 4ZN3A 3M2RB 4FF1A 2YWFA 4RBTA 3W2VA 4DV7J 3DGPA 1FEHA 2A2DA 1F3VA 3IR6B 4BWMA 2MZQA 1FX2A 5F3ZA 2V9WA 3J81Y 3DOKB 1KQGB 4DSKA 2ZFHA 1NSAA 2HZAA 2QX0A 3OFEA 2B6AA 1Z4UA 2GVZA 3HVTA 3TVZA 3EVWA 4WFBQ 1ZZNA 1HWKA 2MQLA 5L1JA 4GC7A 3VAHA 4N76A 4WYWA 3OW2R 4M8LA 1VLYA 4DL2A 2OTLS 1WWHA 2QJ3A 1L3TA 4WP8A 3HHLB 1KEKA 3CF5Q 1U2FA 2E66A 4PWDB 1K1QA 1TK8A 1WC1A 2IM1A 4DR2J 1NK6A 5HO4A 2MKIA 2QZ8A 2R8JA 4MKBA 5D4NA 2BE2B 3TUIC 1H2TZ 2FLNA 2YNIB 1HPZB 1U49A 2LXIA 3GYNA 3BKUA 4M5LA 1N5SA 2V4JA 3KMSA 5H9FK 1IM6A 2OKQA 1Q8BA 2HHHF 3UCGA 3Q8UA 3IS9A 2MZJA 2VJUA 3RBXA 1U25A 2QYCA 2QIFA 3DOMA 5GMEA 3I56S 4TN2A 3JSMA 2AZ3A 4ID8A 1VIXA 2MLXA 1PAEX 3RBDA 2RDIA 1UAWA 1SC3B 1PIEA 4H4KC 3PX6A 2AJQA 2R7TA 2PA3A 2KO1A 3PFEA 3QQCD 1T11A 3H98A 4WK1A 3GILA 4P2MA 4C0HA 4QWAA 3BZQA 4W90B 2ZH8A 4MIWA 3POTB 2RHQB 1UEKA 3NGTA 1HR0F 4L72B 3LO3A 3IA0A 1WKJA 4ZDNA 2AYMA 2ZWPA 2FJEB 5EDWA 4YR0A 3BDPA 2ZWOA 4ECVA 4U7CA 5CYJA 1AB8A 1FRHA 3EWGA 4F4XA 2OHDA 3MMBA 5F8GA 2NYHA 5HK4A 5I42A 3O2IA 1C0TB 1IVZA 3BH7B 3EVOA 5KT3A 4QWCA 3K58A 5ETRA 2NPFA 5IC6B 4GVBA 4FDFA 4OX6A 2F8HA 4WZMA 1LW0A 4PUOB 2CQGA 2JEFA 3ILOA 2OTJS 4ZLNA 5EX3A 3W1YC 2EG2A 2MKSA 2D74B 3MMCB 1RAHB 1TKZB 1LWXA 2X7IA 3H59A 4RX6A 3VQSA 4DFPA 4M1KA 4DN9A 5F0WA 2JVOA 3ELHA 1BQMB 3HULA 3LPYA 2UV8A 4ZN1A 5CQGA 3ZZPA 4WFAQ 2KJWA 3OT9A 1X60A 1EKRA 4CLFA 4OIXA 3DI6B 4KRWA 1JJ4A 3TO8A 4X4SA 4A8WA 4CO2A 1ZAWA 3FMWA 4U8VA 4X66J 3PCOB 3PYFA 1M1HA 4E98A 4Z2XA 3SXLA 3HFKA 3MCSA 2MLYA 1Q78A 5KG2A 2R7RA 1RU1A 4DG1B 3EPGA 2J0WA 4EWTA 3WIUA 2IC3B 5F8NA 2XGPA 4PXBA 1IJFB 2CDRB 2FGOA 1RSCA 1HMVA 5HN0A 2ACMA 2JL9A 4DU7A 4L3NA 1UKUA 4DXLA 1IBLJ 2RJZA 1C2PA 4HACA 3AB2B 4WBFA 3HF5A 5HP1A 2KXHA 2PFFB 4DZ6A 3VAFA 3C15A 4KGVB 3RRHA 2U1AA 5D8HB 1RDRA 3AOAA 3G8QA 3J81U 5BYQA 4RW4B 5F9LA 2IJFA 4QWEA 1E6YA 4DR3F 4NLYA 4DX6A 4KGKA 3NMAA 1WEYA 1B7YB 2W4DA 4FXWA 3QT8A 4M63A 2NCKL 1CS4A 1NB7A 1IKXB 1HHTP 4ZKAA 3DLGB 1BQNA 1KOHA 4WE1A 4X65F 1TK0A 5DZ7A 5KFHA 4A8XA 3DDKA 4X62F 2V8DA 2DEIA 3JSYA 1X7VA 2GJIA 1WKKA 2KFZA 1CJTB 1F0XA 3NS5A 3WX4A 1VRQC 2W2OP 3W65A 1U24A 5CD4H 4ID5B 3NP5A 4F0KA 2VU5A 2FHJA 3RBEA 2YTCA 5SZTA 3DCAA 1TUWA 2CJAA 1IUJA 3IAS9 4C3KA 3NY0A 4NYZA 2QSWA 2VFRA 2RQ4A 1VI7A 2PE8A 3EE3A 2ZE2A 4HHUA 4J90A 2C42A 5D77A 2MXYA 3KKFA 2BJ1A 1ZA1B 4DV1F 2VKZG 2BRKA 4QJVA 4PQUA 3DRPB 2L48A 3M6UA 2B4PA 1RUSA 1RB0A 3KDOA 4ZCMA 3SV3A 4K0KF 1YWXA 2Z30B 5JVGQ 5B0CA 3GIIA 4LVNP 2YWKA 4DI6A 3KYLA 3JAMU 1X4DA 2M4MA 4LSNB 4Y3CA 5DDOC 2FJWA 3FKBA 2HBYB 3HT3A 3TA2A 2C3MA 2MKJA 5J2QB 3H2LA 4FP9A 2F8MA 5DLFA 2J6UA 1Q86T 3DM2B 2MZTA 4YFUA 1N5YA 1VHFA 2I9SA 2YKMB 1NEEA 3DGVA 1NNDA 2DEJA 3NOCA 2NXEA 1N4LA 3K89A 3LWLA 3J7AN 3FRYA 2HQDA 1NBEB 5AXLA 1KD1T 4DR5J 2A3JA 3PJXA 3TWZA 4ZS6A 3OTOF 1WELA 2NSBA 3I5BA 4ZHRA 3CVKA 4JB8B 4A8QA 5HSPA 1ZPVA 4EBEA 2QLJB 3DC2A 5ETPA 1S9EB 5JJBA 3H2UB 2YNGA 1X9SA 5L9NA 5I3PA 2C1EB 4IFVA 1T9WA 2VQFF 3HSZA 2FVRA 1J5OB 3ZTRA 3NGSA 4B9UA 3D4JA 1T94A 5G0RA 4V19J 5JXSA 3GJQB 3EDQB 3SBMA 3L09A 2J7UA 1N36J 5IXUA 4O0IA 2NZ4A 3BV8A 3BJYA 5BR8F 5HL7Q 4MMOA 1TKTB 1TQLA 1NKEA 4ECSA 2X1GA 5FDLA 2E9ZA 3ET6A 2R2SA 1XIQA 3GR0A 1T9UA 5ETQA 1F2GA 3R5BA 1TP7A 1RA6A 2KRRA 4YMEA 3D6TB 3D6FB 4U7UK 1JJ2R 1RWPB 4OYWA 4EMDA 2DNKA 4G1IA 5LMUF 4DR6J 3FBCA 2OJ3A 3FC9A 1FK9B 4J9MA 1JX4A 2EWHA 4LJMA 4RW9B 1PJ7A 3HHLC 4ED1A 5J1EA 3OXFA 4DQPA 4EU0A 1ZM3A 3C16A 3MM8B 3BKFA 5HI7A 2FIUA 1CULB 3PTWA 3UO0A 2DGTA 1KN6A 3QO9A 5GAHU 1RWVB 3M2VB 2ZM6F 5J2NB 2LEBA 4LRAA 2M70A 2ROPA 4RNMA 3RBZA 1RAFB 4A8KA 3MTJA 7AT1B 4J9NA 1IKVA 2KJVA 4CYUA 3OUYA 3K5OA 4P7TA 2P8IA 2AEFA 4P7VA 3ETMA 3NAIA 3MEGB 2JNJA 1RT5A 7FDRA 2DNNA 1UP1A 1RYSA 4IOAQ 4ZPBA 2EI5A 5U47A 4N77A 4DPWA 4ZVOB 2QMWA 4KV8A 3LAKA 2D3UA 2BKNA 5L39A 3E3XA 1RQ0A 1RP5A 1RWXB 2J6TA 2WONA 1S77D 2NPIA 2W25A 2L41A 4HKQA 3QFHA 4KKOB 4A47A 4O23A 3TZWA 1MMLA 2GGPB 1CC7A 3FJ2A 3GSDA 4M5KA 4U6PA 1WDTA 4I67A 5KFNA 2LU2A 4DSEA 2J0QD 2WSFC 3RAQA 4I7FB 1WOSA 2IAJA 1WTBA 5E2QA 1CSJA 2V4RA 2XHWA 1K1SA 2CNKB 2QG9B 1U2RA 3EXYA 3CT9A 4H4MA 2VPYB 4UT4A 3M4XA 1IKYA 4FPIA 5EWFA 1I51B 3PY8A 5T41A 3ITHA 4LF8J 4ZP7A 2FJXA 1GMVA 4UOHA 4TLQA 1M90T 3I0RA 5GAEI 1AA1B 4C6AA 3FBEA 5ETSA 1X5SA 1FKPB 1FTRA 1Q95G 1ZAXA 1X4CA 4Q2LA 3OBIA 3MR5A 4PEOA 3A8EA 3RB3A 1GH8A 2B7BB 3DOLA 3CCQS 2QL7B 4N56A 1RKJA 4ZCKA 3I0SA 2HQGA 4MH8A 1RK8A 2BABA 4OZLA 4J9QA 5HJYA 3NL0A 4KHPF 1C4AA 3K5NA 1JLAA 4K59A 1FTCA 5FIIA 4GKKF 2C3OA 2QE5A 4E2FB 2W8LA 3H4DA 4P74A 5KFKA 2DISA 4NMLA 2J9DE 1KFSA 3IRXA 1NKCA 4CO1A 4X4UA 2BZ2A 3OL9A 4K4SA 4F0MA 3JQMA 4P71A 3QJJA 3RR8A 1SBRA 4JI7F 2EC2A 3C14A 4LFAJ 1RKIA 4F4AA 3AD9C 2JVRA 4L3KA 1UVJA 2VQEF 3N4WA 2FYXA 3JS9A 4KFBB 1QE1A 2GVDB 2MGZB 3V6DB 2WW4A 4F26A 5M2RA 4DSFA 2V63A 3P3DA 3N01A 2FVCA 2B4UA 4A4JA 1RAOA 3SMZA 4ECQA 5A8RB 1TL1A 2CPHA 1I6JA 1A7GE 4DN0A 4U9RA 2MY8A 3C19A 1N48A 2H51B 1X9WA 4UTGA 2AJ0A 3HHNB 3PDNA 3SSSA 1C1BA 4YY3J 4TYAA 3KHLA 1SPBP 2AZ1A 2OSRA 2K2PA 3NG8A 5HQ8A 2JX2A 2KVIA 1GQEA 1Q1KA 2DO4A 3IG1B 1F5BA 4JYAJ 4YN3B 2HIYA 3W62A 2HW3A 4LQ9A 4CIOA 1NH8A 5A8KA 1WI8A 2CADA 5F3TA 1FJGJ 3QMQA 5B0AA 1UZDA 3T9ZA 4MK7A 1NAQA 3RB4A 1VHIA 3TUPA 4OX9F 4OYIA 1VQOS 2FGCA 2HRYA 4KQZA 1NXIA 4LFBJ 3ETOA 1JLGB 3IM8A 2ZC4A 2RRBA 1VBYA 2XMKA 4HT7A 4N47A 5E41A 2MY7A 3PR5B 2UVWA 2AU0A 1FRJA 2FLPA 3CCZA 2GO8A 1FXRA 4XK8C 4CLZA 4PG7A 5HMWA 1RTDA 1EETA 1N54B 4ZLPA 2WOMB 2MZ1A 1REVB 1WJ9A 1DHMA 1WOOA 2WHOA 2ASLA 2Y1JA 2IVYA 5IWAF 4ED2A 2E1CA 1DLOB 2YNHA 3BEGB 2OH2A 3CCJS 4RZRA 1PJ5A 4U7UD 3C6TB 4J5OA 4B08A 3VF0B 1H73A 1HD0A 1D9DA 1LEOA 3CJKB 2F1FA 1VYAA 1AT1B 4XTTA 2QN6B 1HBNB 3NAHA 3SQGB 3R1HA 4U67Q 3UFCX 4RW6B 4KGXB 3PW7A 2CPDA 3ZZOA 2KXFA 2BQ3A 2LQ9A 5CCLA 1HNWJ 1RT1A 4JI4J 3SCJE 5ETOA 3TAMB 4CH7A 3QLHA 4Q0BB 2X3GA 1X9MA 1WTFA 4CT9A 1J5EJ 5BYRA 4J9OA 3D66A 1S1WA 4I6WA 8AT1B 2DNRA 3KLHA 1KQKA 5E3PA 5LM7E 1WC0A 1HIYA 3CJSA 1SJ4P 1H2VZ 4KIAA 2WVEA 3IBWA 2LQBA 1Q81T 2CZ4A 3LP0B 4DMZA 5LSOA 1VQMS 4OZ5A 3VAIA 4F2SA 2DXEA 3W60A 2HFZA 2BACA 1HKAA 1V6HA 4DX8H 2DYAA 4OQJA 1WEXA 1U6BA 1AFJA 3T5LA 4CO5A 4X4TA 5HJXA 4Y2MA 2PA8D 2YH0A 3FVYA 2MHEA 2DY1A 1B0PA 3ZTOA 1FFWB 3FEXB 4C2MA 1S76D 1PO6A 4QU7A 3E8OA 3M2UB 4WIIA 1S1XA 1V3SA 4P2FA 3OFHA 4JI3F 1RACB 2ZOGA 2LEPA 4C7QA 3SYZA 3X1LB 2JLFA 4Z7CA 3RU0A 2VG6A 2PFDA 1SV5B 1S1TA 1RTJB 1WD6A 1HWUA 3DLJA 1QVGR 1UTAA 3H5YA 5KFIA 5GADU 1U7LA 1QAXA 5LL6d 1S1UB 2JEJA 2E1PA 4ER8A 1TL7B 1B0VA 2W2MP 2IVFB 3CEDA 1HBMB 3EVMA 1RT7B 4LSZB 4Z37A 4YDXA 1KVIA 4O44A 2VC1A 4NXNJ 1JB0C 1O5JA 1JNRB 5K8NA 1WHYA 3MPYA 3DNCA 1RAEB 3NBPB 4FYVB 3KLGA 1M5VC 2QC3A 2CPYA 3MFIA 1QTNB 4OHZA 1R89A 4RJVA 2BVZA 3MAAA 4FYYB 4TYBA 3MECA 1WG5A 2ZD1B 3PNIA 5GVQA 1I94F 2DRDA 1VQ7S 4MTPA 5LSLA 1VOMA 1NSQA 5B09A 3CJRA 3MD1A 1FDNA 1UETA 3R27A 4CLUA 3M6WA 1U1PA 1M5SA 5LMNF 3JYTB 4AFFA 3KJVA 2W9BB 4TKTA 2HG4A 1QM9A 4LF9F 4C8ZA 1ZM2A 1U0HB 4USIA 3LGNA 3P49B 1HNXF 2XYGB 2GHWA 4EYIB 4OJ3A 4P73A 1PGZA 1WC4A 4K2XA 4QYRA 2MZSA 3VGUA 3J80Y 4U95A 1PKUA 5C24B 3K59A 4ECTA 5A8WB 1R6YA 3VZHA 1CC8A 2QLFB 2DB1A 4UW2A 1TVRA 1IBKF 5BXIA 4NCGA 2GV1A 3NCRA 4PAAA 1FDDA 4JI1J 3I82A 1YRXA 3GFZA 1YHQS 2KVQE 4ES1A 3Q8SB 2IBKA 5J1PA 4ZVTB 4J9RA 1TMMA 3EXCX 3FCHA 4ZJLA 5D15A 2DNQA 4ATNA 1K44A 1H0HB 2DVIA 1N5TA 1JLFB 1S7HA 5A0YB 2JFDA 3NNCA 1KLMB 3CD6S 3NNHA 5DQGA 1RLCL 4KGMA 1S72S 4P10A 2WVFA 1T9YA 1FFSB 3MPWA 1Q8IA 2ADBA 1RT3B 2AJ2A 2ZNZA 2GIQA 2YWWA 4QIFA 3KNAA 4C3LA 5CHCB 1M5PC 3N6NA 4M5GA 4NI2A 4L6V3 3A4TA 4MKAA 3DHWC 2XS5A 4JV5J 3VGTA 3ISND 4LREA 3TQEA 4N8NA 5E3QA 1F9FA 2CG4A 3KG0A 1F1BB 4M5MA 4WYLA 2UZAA 3QSIA 2HKEA 1M5KC 4WKRA 2OPSB 5H9EK 2V68A 1C1CA 3B8HA 2XC9A 3KHHA 3V4IA 4B3TJ 1U0SA 3CDAA 4QR2A 3MEEA 2KYZA 3VAJA 3VAKA 3M8QA 4OHWA 6FDRA 4ANEA 4QBUA 2XCAA 1LW2A 5BYSA 2L9NA 3TARA 3R5GA 3BBCA 2WVCA 1HI1A 4PWUA 3E2EA 2GW8A 1KBRA 3UPFA 4I69A 3F41A 2BE7D 1VDHA 2H9ZA 3Q2SC 1S10A 3BR9A 1VQ4S 1FEEA 3PFOA 3IRWP 1LWFB 4B9LA 2HFUA 2VC0A 3UR3C 3SCLE 2ZJQQ 2KXNB 4F4KA 2YNFA 3C2PA 5M2UA 1HWIA 4MK8A 4F04B 1FCAA 5ETLA 4PABA 3HHEA 5T14A 2OFGX 5D4PA 4D3GA 2HMIB 1U45A 3B6BA 5KFUA 2PGCA 3EUNA 3N79A 4FS1A 3TEHB 5D0HA 5KT5A 3QT6A 5I3UB 2O5DA 3FNNA 4USMA 3SI8A 5D4OA 1YJNS 4RBVA 2G4BA 1K8AT 3R97A 1FE0A 1SJ1A 3D3CJ 3L4BC 4ZVQB 1W2IA 2LLZA 5C25A 1PSDA 2NR0A 4MFBB 2DR5A 1RU2A 4IG0B 3BKTA 1NLKL 2DO0A 3AD8C 1NCLA 3MEDA 3FBBA 2OAUA 4NYOA 3QATA 5F8LA 1IJEB 1URRA 3MMAB 4ZVSB 1S0OA 1D0EA 3B4MA 3F56A 4X66F 4ECZA 4B3MJ 4RO0A 3KK2A 3KHRA 3D2WA 4EO8A 3M2RA 4HVZA 4H54A 1V3RA 3EJMA 5KFEA 1IWAA 4AE5A 2VICA 2HNYB 1VISA 2H48B 4YQWA 4JP8A 2HWHA 3WBZA 1D1UA 3R2DJ 3DOKA 3W2WB 1VQKS 2R8KA 1A6LA 1MWYA 1YITS 4FKXA 3H7HB 5T7LB 4CT8A 1P27B 3KLIB 3CJTA 3PVXA 4M5HA 1EARA 3J80U 1ZPWX 5L1LA 3EGNA 3ZXWA 4NRUA 2DGVA 4L74A 3Q83A 3CD5A 4RW8B 2HBZB 3JQJA 4QYZJ 4PWDA 3BREA 2W2QP 2J5AA 3JQKA 1GFWB 5CZXA 3PV8A 3FEYB 2IA6A 3PYEA 1NUEA 3LWMA 3T6BA 3GP9A 1VRTB 4X4PA 2JH3A 4KT0C 3KLFA 4QOTA 5CYQB 2RILA 1HPZA 2CJBA 2KB2A 2CPEA 4F4ZA 5LXRA 4NMXA 5GMKa 1KTVA 1ROFA 2B4OA 3QBCA 2W2PP 4R25A 2J76E 3B54A 1HQEB 3MI7X 1WF1A 1N34J 4LBPA 2E5JA 4JI6J 5EUHA 3SCKE 3OR2A 2Y0BB 1UEUA 5EWGA 1HBUB 2VBWA 1MWZA 1TL3A 4HTIA 4OYBA 2ZH5A 3UD4P 4C3MA 3Q8VA 4USKA 4EI2A 3IP0A 3EX7B 3PRDA 3PEHA 4RNFA 4JI5J 2V8HA 4CWBA 2BBEA 1XR7A 3KMQA 2GNKA 4DHVA 5KAKA 2CQ4A 1NJXA 1C0UB 3CC4S 3K8WA 4Y6IA 2LQ8A 3DRRB 2DR7A 2EFPA 1FXLA 3M05A 2VBZA 4ALZA 5DJBA 1F6TA 4ANCA 4ZPCA 2CXEA 3K57A 4KHRA 3GG0A 1YDLA 4A48A 1Z2LA 1XMQJ 3TVKA 1FJEB 1C0TA 2GZOA 2KN4A 5KFLA 1DQ9A 2BX6A 1XJWB 4J9UE 4WTYA 1TFWA 1S6OA 4G1QB 3UVJA 5FD1A 2VL1A 2YQ0A 3HX9A 2CUYA 4UUWA 3G71S 3MMCA 1SC4B 1TKZA 2X1AA 5AE3A 2IA0A 4ZVRB 1MNEA 3P5TL 5LJ3Y 3ZTPA 4A8SA 4XO0A 5E3CA 4IFYB 4HL9A 2KFNA 3NS6A 3ENWA 3VHQA 4NLWA 3B82A 2EFNA 4BHQA 3BBFA 3NWRA 3DI6A 3VGSA 3HD1A 1BQXA 4DBQA 1R8AA 1QAYA 2JLGA 1TMJA 5HLFB 1P9YA 2ASYA 3IWNC 2N7CA 2DXFA 2CG8A 3OJUA 1S6QA 4HEA9 1MW7A 3L9ZA 2QA4S 3AQOA 3G8SA 2CQ1A 3GU0A 1Y5IB 1NKBA 4PKDB 2BRLA 2KT2A 2IC3A 1YZ7A 2J0XA 4DF4A 1RADB 1IQTA 2IJNA 5AE2A 4RNHA 3UQSA 2IPOB 1VK8A 1JLQA 1S97A 4OYPA 4R5PB 1FKOB 2DXDA 1KLNA 3G6YA 2OPPB 4HHHA 3HHKA 2N82B 3BQ0A 4JUZA 1HHQA 2HNDB 3LA0A 4OMFG 1UW4A 3K0JA 2VIHA 1AROP 4AL7A 4F50A 3RG6A 2YKOA 4J9LA 1F5AA 1GMWA 3Q24A 5B08A 3W2VB 5J2MB 1DFDA 1RAIB 3T1HJ 4OX7A 5AT1B 4QR1A 3MMJA 1RCXB 1UVIA 2K3KA 2DD8S 4C8OA 4YB1P 3QIPB 3FRZA 3ILJA 1FERA 1X31C 2CJ9A 2MYFA 2COLA 3UDLA 2H65B 4O3NA 3BYPA 2XI3A 4RW4A 4OZ1A 4FXDA 4NE9C 3PHTA 1UJ5A 2DR8A 2B6AB 3MCNA 1K73T 2HLUA 1FF2A 1SKUB 2HVHA 2HZCA 2XMTA 3KUGA 1EJ7L 2OEJA 5KFCA 3PKYA 1NPKA 3KK1B 3BO3A 1KVJA 2V2ZA 2KYXA 4ES3A 2B0GA 3P4UB 3GFYA 1X0FA 3G87A 1H72C 1IBCB 2XMMA 3PYDA 2AX0A 2CJYB 3AOBA 1S5ZA 3W5ZA 1RWUA 4WU3A 2EC0A 3HSGA 2CYYA 3U1MA 5C7PA 2IRYA 2FHKA 1CJTA 1BLUA 2Q3PA 1FRXA 1R27B 2BYCA 4ILLA 4QIGA 4ID5A 2FZCB 3I96A 2XSFA 2MQ8A 2W1BA 2BJ9A 1O8BA 5K9FA 4IKAA 3IS9B 1JKHB 1RJJA 2O1PA 4YDDB 5KFXA 4GKJJ 1NK5A 2AGPA 3DOMB 2AGOA 3DRPA 5GAGI 3VAMA 2GIRA 2LA4A 2ZHAA 3N9UC 4J9PA 3NXZA 4KYZA 2FLLA 1M1KT 3HSJA 1CJKB 6FD1A 2R2TA 4Q8EA 3H40A 5DETA 2UU9J 3AQPA 2E7WA 3EMTA 3A1YG 3BN4A 3D0HE 2UUAF 3L3CA 3AODA 2B9YA 5HMXA 2Y1RI 3TOQA 2RQMA 2VDHA 3P5BP 3TANA 3J7A1 2MQMA 5J2QA 4KO0A 2P9EA 3HHLD 3H8YA 2RF2B 3FCVA 2QMXA 4KJIA 1VBXA 2YKMA 3AA9A 2QFJA 2PT0A 2RB7A 3JSRA 1RWMB 2NXNA 3RUBL 1OQ3A 1SB6A 1TKDA 4ICLA 3J81j 3KUEA 4OLPA 3HJVA 3CC2S 1UVKA 3VTIA 1OSDA 1JLEB 2QLWA 5C2CA 1IN0A 1LW0B 2DK2A 1U2CA 5D6GA 3MWBA 6AT1B 3OD2A 4LF5J 5A2QY 4EK2A 2EFGA 5F0UA 5DG7A 4B3RJ 2CJKA 2XNRA 1G2EA 2W01A 1X4FA 1VMBA 3P45B 1IR0A 4N41A 4I2PB 4DR7J 2ZBCA 4CO4A 3KXDA 4DCJB 4ED6A 3D6MB 1XMBA 5IT4A 1TKTA 4WFYA 2IMOA 2NSCA 1SC1B 3OSPA 2ZJPQ 1SIWB 3HSDA 4FPRA 3G8TA 4DWIA 1PCAA 1ITPA 2V9KA 2DIVA 1K0TA 3HXMA 5THWA 4LVOP 1FWLA 3Q89A 5J2PA 3GJTB 2ZVSA 4YHHJ 3TX8A 3W5XA 5DLGA 2KT3A 3O3LA 2I5JB 1NDKA 4YY3F 3MOJB 3S8SA 2MZRA 1KNZA 1YJ7A 1RBLA 4CO0A 2Z57B 4B9VA 2ZKUA 4JYAF 2AYGA 1OY6A 2DPIA 3JXOA 1CULA 1PYOB 2N7YA 4HACB 2ZH4A 5HP1B 2KKHA 3M2VA 2HGMA 5J2NA 1N5VA 1OPIA 4KB7A 2ZZNA 4ZVPB 2H54B 1ZYQA 1WACA 3FSXA 1QDUB 2ASDA 3W8PA 4TXSA 2Z4PA 1NPPA 2E9RX 4F4YA 1YI2S 1FJGF 1HNZF 2WSEC 4XDDA 2HFSA 2R3VA 1A0OB 3I5AA 3MEGA 1NM2A 3I5CA 1D9AA 3SZ2A 1Q16B 2W24A 1HYSA 3BO4A 1NK0A 3CJ3A 4NLUA 4TVAB 1NJYA 4ZJQA 3UNGC 1G1XA 5H9FJ 1H2UX 3IR7B 2VFTA 1Y3JA 2ZNYA 4LMZA 4BC9A 4I1TA 2BW2A 2E5HA 1YRTA 2R7SA 1QAIA 1BQNB 5KG0A 3W63A 3ZNJ1 3CUNA 2GGPA 3DDIA 1H6KX 3UDEA 5F8IA 4XPCA 4ZVGA 2QYGA 3N5BA 1S6PB 1DRZA 1FO1A 1KFDA 1SJRA 3Q23A 1U1RA 2GQCA 2VASA 2MJUA 1S4FA 2AEJA 1HWLA 5KG4A 2YKAA 1EAYC 1HQ2A 3TW0A 1NHUA 1HR0J 1WHWA 1GMWD 2AD9A 4WF9Q 3DYAA 2K1RB 4B9TA 1W26A 1EB0A 4W98A 3GLJA 3AT1B 3A8IA 1RBOB 4CM2A 1R43A 1HNWF 3QGPA 4ZMMA 3WQPA 1PBUA 3A13A 1RWNB 1S59A 1R0AB 3PX0A 3C6UB 5HATA 4R8UA 1UVLA 1J5EF 4DUYJ 2DGXA 4O3QA 2IVMA 3FZ2A 4I6YA 2HVIA 4ITSA 3QGHA 2H1YA 2DGOA 4O4GA 3RJMB 2BJ8A 1S9GB 4OI3A 2RT3A 2MKHA 1WUUA 4OZ2A 4WP3A 4ZVFA 4J9KA 1DQ8A 1GTHA 3VQTA 1TL4A 3HJFA 1N5YB 4G1PA 2HFVA 2XWYA 2RRNA 3CXCR 4X84A 2VKRA 2PIIA 2XSJA 3LALA 3I6PA 2VD3A 2VA2A 4DSJA 2GHVC 3QJLA 2FPHX 2DCUB 5GAHI 1FRIA 2F63A 2V94A 4ZHRB 3GFHA 4KFBA 2GVDA 1FX4A 2R7QA 4IQMA 1RBAA 1HHSA 2MGZA 2J8SA 2FVPA 2YNGB 4QW9A 2PI5A 4IFVB 5AXMA 1S7IA 3GFXA 1ACMB 2RDJA 4NA1A 4R0JA 2HIQA 2RUSA 1VQ9S 1B64A 1FRMA 3OHAA 2LXFA 1V3ZA 3O44A 5G0RB 4ZPTR 3DLLQ 2HLTA 4BS2A 3QRPA 4B17A 5GAEU 5AE1A 4NXNF 4URGA 1MLAA 2MSTA 5FDLB 3MR2A 4DR1J 2Q79A 3IG1A 1KVKA 1RABB 1QUVA 5KT2A 2RS8A 3PHEA 5CA5A 3LH2S 1IKWA 1YSJA 2EFVA 2NQPA 2UXDJ 4RW7B 4CO3A 4I68A 2HHSA 1T9TA 2VOOA 2CQCA 4DOZA 1Z2ZA 2VPZB 4LIRA 2MPUA 3R5CA 1UA1A 3H0PA 2LECA 3PIPQ 4LBIA 4PR6A 3BSOA 3EZOA 3D1QA 1CG2A 3TEGA 3VALA 4KH0B 4RPFA 1JLGA 4NLRA 3G6VA 4MYUA 3DLKB 1K0VA 5J1EB 3QT5A 5K8PA 4G3IA 4OI0A 1L3VA 3C16B 5E7OB 4HH0A 5ETNA 2JHEA 4W92B 5E3AA 3QO9B 2D3OR 1PAUB 4Q44A 5IFMA 4B02A 1S0MA 1NDLA 3LGMA 2CNOB 4X62J 2JJ4D 2WOMA 4ZCIA 3ULHA 1S99A 2QA2A 1YBUA 4M5NA 1SQFA 3OUYB 1VK3A 1DLOA 5DDQC 3ICLA 2IJRA 4W4MA 3E51A 2GO9A 4JI1F 3C6TA 1NJWA 2DIUA 2JLEA 4OJGA 3CJKA 3FSYA 4KV8B 3D28A 1HBNA 2RH3A 2CQHA 2EFOA 2QL9B 2XYPB 1TAUA 2IFXA 3FBFA 2EBEA 3OTBA 4HH1A 1P1LA 2XZTB 1P6TA 2O66A 5DQHA 2KRBA 2G0JA 1NSPA 1XK8A 5D4LA 3TAMA 1Y00A 1EQ0A 4CLTA 4OI6A 3R5JB 2B4VA 4DLEA 4Q0BA 4C98A 1DQAA 2IAJB 1WC3A 3MF5A 2LDIA 3MAQA 2E7VA 4H4MB 5DGBA 2W7OA 3VGVA 2UUTA 1MMDA 2C2RA 2R7WA 3HT0A 3LP0A 2A18A 1H38A 3ITHB 4E0DA 3N0VA 3B78A 1NDCA 2BW7A 4DLGA 1U02A 1NHKL 3GG1A 4JV5F 2PMWA 2YX7A 2QV6A 3LP1A 3CULA 1IBMJ 2Y8WA 1M5HA 4A46A 4O0NA 3DOLB 5JVHQ 4PXCA 1L5UA 2IM0A 3OLBA 1WOPA 1VC0A 5B0BA 2XYHB 1B70B 2PMHA 2G2OA 3I0SB 2G0IA 3T3FA 1XMOJ 3MCOA 2BM1A 4B3TF 2B8PA 3G4SS 2R8HA 1SV5A 1S1VA 1JLAB 1RTJA 3ZZTA 2RD5C 3L7OA 1VQPS 1LWCA 4LR7A 5IT0A 2JSXA 3IRXB 2DGWA 1RTHB 3UDCA 2FJBB 1S1UA 2EG1A 1S6UA 3HP6A 5KFZA 2FVQA 1KSPA 2P6TA 3V4MA 5HMZA 4DX7A 2WZ1A 4ZOSA 1HBMA 4IQXA 2NS1B 3OFGA 2P5VA 4ZP9A 3CNQP 3IGVA 4TY8A 2KI2A 1NK7A 4K8RA 4LT6A 1ZTTA 4KHMA 4TY9A 1QE1B 4ZP8A 3D5MA 2XCPA 4QIWD 3NBPA 2QL5B 2PEBA 3MM6A 4PPDA 2MMYA 3BDEA 3MR7A 4JI0J 2G2YA 2OI2A 3M1VB 4ZP6A 2RU3A 5ETMA 2NUUG 3US5A 2V2QA 5LJ5Y 1CPZA 2ZH9A 3CJQA 1P1TA 1SC6A 3PW2A 4FXVA 3OV7A 2CJQA 2YPZA 1K47A 3PJWA 2HNZB 3JYTA 4WIQA 4CLWA 1JXEA 2VFUA 2UV8G 5KFPA 4EYHB 2HHPA 1U0HA 2DH7A 4LRFA 2ILYA 2VZ9A 2BR0A 3T5HA 2DH8A 3G6ES 3O8WA 2ZZMA 5A8KB 4LBHA 2M5YA 3BQ2A 2YH1A 4ED5A 3QRRA 3OSNA 1CQMA 2AJ1A 2H5IB 1QSLA 4IDKA 5C42A 4B3MF 1OMSA 5KFDA 5A76A 2LA6A 2DNHA 4AXIA 4DFMA 2HS4A 1JLCB 2B43A 3IGNA 1CJUA 1LK5A 5IC4B 4OFZA 3CSKA 4M5IA 4P2SA 3OR1B 1JLFA 2LEAA 2O01C 2WAQD 5A0YA 2VA3A 1KLMA 4Q45A 3S6EA 4B3SJ 2UVRA 1TZ0A 4ELVA 4QWDA 1LQ9A 2RNEA 4BBYA 1Y10A 2E9TA 3CMAS 3ZZRA 2M0GB 1WDDA 4H4OB 3SFUA 3QGIA 1OS5A 2UVVA 1RT3A 2DNMA 2G13A 3D54A 3OHBA 1RCOB 3FQKA 2DJWA 1PYTA 2GX8A 4AQYF 1SH2A 4HYKA 1ZETA 2FC9A 1NZAA 5J1NA 4HDGA 1G6BA 1JNZB 2PDAA 2IYGA 4DL6A 2R7VA 1VIOA 4KAIA 5LT5A 4DV3J 4UQGA 2XWXA 1Q0NA 2AMCB 5D0EA 2RDDA 1EP4B 2ADCA 1L3KA 4USJC 1MN7A 2DRBA 1S1WB 3KLHB 3A12A 1ULRA 3R1LA 1GX5A 3S7RA 1SQEA 3QGGA 2LXUA 1OWXA 3A8KA 1N34F 1GK8A 1KHWA 4ED7A 2OD4A 1VCTA 1Q5YA 3HVRA 3BSNA 1NSKL 3F0NA 4CTAA 4Y0FA 4DPTA 2VFVA 4YR3A 5EX0A 1MU2A 3LF0A 1QJHA 2QA1A 3G82B 3KWMA 2R8GA 2LQJA 2D7SA 3D7SB 4NYPA 4IYQA 2K8GA 3SDEB 4I64A 3MM9B 2JZ5A 3AJ1A 1S79A 4UZCA 3AJ2A 5KFWA 3GIJA 4PYAA 3TAQA 2DNGA 2PMZD 3MR3A 3IFEA 4LRDA 1X4BA 5CH7B 2B5JA 1LWFA 1VS3A 3OJSA 1QAJA 4UUXA 3HFZB 3BM7A 2V2KA 3TI0A 1HFEL 2ACYA 4WCEQ 4QW8A 3RAMA 4WXOA 3LQVA 5DQIA 2HVZA 1LNQA 2HEKA 3PX4A 2DHXA 2V34A 2C3UA 2VBXA 2DHHA 3LANA 2HMIA 2DGSA 5KG5A 2P9GA 4DUZF 2XULA 3ENQA 2I38A 3KJNB 5I3UA 2FY8A 3TQ1A 1U6ZA 1YJ9S 3TP2A 4O44B 3AJDA 3JSBA 1ZAVA 3Q0AA 2ZH2A 5LOQA 4K4WA 2CKWA 2JC1A 1Z1ZA 3CB4A 5F8MA 2YQ3A 4WJBA 2XO7A 4YOEA 1VRUA 4WU2A 3T1YJ 4QQBA 2PC6A 3UNYA 2BA9A 3BSCA 4ECYA 4K7QA 2ALZA 3M9MB 5L9XA 3MECB 4X4VA 4HHJA 5HVHA 1CLFA 2FZGB 3R6GB 3UD5A 1RTIA 5HAOA 2AJFE 2QRRA 3CCSS 3GONA 2F3JA 2YWGA 5AXKA 4TQSA 3C46A 2MSSA 3W5YA 1JMTA 2I6WA 4B9NA 1FRLA 2WSCC 3FCWA 3C66A 3M8ZA 1YGYA 2YBVA 3MCMA 5T7LA 4YB5A 1FA0A 4X4RA 2YY3A 1N32F 2BANB 1VQ5S 1PG5B 5KT6A 3F44A 3GPAA 3ZO7A 3HHDA 4DPYA 2AJ4A 4NCGB 1D8ZA 3T1AA 1PYSB 3QT7A 3T1HF 3CD7A 3BGRB 5AJ3J 3O1LA 2CVIA 1U1QA 2J9CA 1KTQA 2RU9A 3MUVP 2BM0A 3GB0A 3TA0A 1VRTA 3EGVA 1SUQA 4LF4J 3IBCB 4I2QB 1E6VA 3VZIA 5CYQA 3TNVA 1HARA 2KZZA 2XHCA 1RAGB 1KC8T 3IM9A 4DV2J 3BR8A 3MM5B 3KK3B 2BJ7A 2XY7A 2A6OA 4RBUA 4L73A 1HQEA 2HHVA 2OEMA 4FF2A 1BUXA 4NEYA 4DF8A 4C11A 1U1LA 2HWIA 2H4YB 4CM0A 3AHPA 1SJFA 1RHUB 3DLEA 1URNA 2CAJA 2XLJA 2EK1A 1WSRA 4OYAA 3PW4A 3NEKA 3N6LA 4NLPA 3GIRA 3L95X 3V81B 1FESA 3A3NB 1UVMA 4XDCA 4JOUA 3BF4A 1YBTA 4GKJF 3K17A 2UUCJ 1UPMB 3M9OB 3CC7S 2Z0GA 1O6XA 3QZ7A 1T3NA 1QVFR 1OY8A 5H1SV 3M8QB 1U1MA 2UU9F 5B7WA 1Y9OA 2F40A 4ZPWR 1GT8A 1LW2B 3MHYA 2CZ9A 4IH7A 5RUBA 2C2KB 3QWUA 5IZHA 2CQIA 1X4EA 3MTKA 3ZFVA 1J27A 1FDAA 1RT2B 2M88A 3ONQA 1UVNA 2HURA 4IOBA 2C2EA 2V2VA 4ES2A 3CJ5A 2BQUA 2VG5A 4C8NA 4ED8A 3NRBA 2B9XA 4G65A 5L38A 1HW8A 1YJUA 1GX6A 1FWPA 1KP6A 1UW9A 2C2OB 3RRGA 2HRUA 2OSQA 1WG4A 3R6LB 3DLHA 1WG1A 2EW9A 3CJ4A 1RT6A 4FBTA 3W3SA 5KOXA 3GCWP 3ZZ0A 2HGLA 2Y0SD 4LF5F 2PN6A 2JEIA 4HT5A 4B3RF 2NXUA 3J7YI 3AD7C 4NEZA 2D3ZA 4J7CA 1T03B 2DBBA 3IWXA 2FB0A 2H5EA 4DR7F 3D3BJ 2H5JB 1CJVB 2MHNA 1A9NB 2WW8A 2V0NA 1HBOA 3OVAA 4FVMA 1TAQA 5C25B 3HLUA 4BC7A 1U09A 1U1KA 1WKLA 1X8DA 1RHQB 4USHA 4A8OA 1R6VA 4R5PA 4OYZA 1TFYA 3RZAA 1FKOA 2GQ2A 2RSQA 1UWBA 2OPPA 1RT4B 3H42A 2ZH3A 4EO6A 3QPIA 5B0DA 3DRSB 2BDPA 1MROB 3E01A 1CQNA 3KK2B 1F9HA 4YEAA 1TUGB 1NRKA 3PW0A 5J2MA 2MQQA 1U4BA 2JWNA 2QLXA 3CIZA 2VG7B 3FGVA 4YHHF 4BLGA 1FFGB 3PEJA 5ADZA 4TNOA 1P9QC 2E1MC 3QIPA 1NMEB 5F9NA 4K4YA 3J7Z5 2BKOA 1H3DA 4TQRA 1TL5A 3UCZP 1UMJA 1N88A 4ETXA 4WP9A 2CQ0A 4OZ3A 1RAAB 1RGVA 4WK3A 4CI0B 3VR1A 2EBGA 3KK1A 2F4VF 2ZITA 2H3EB 1IXKA 3MM7B 1FWKA 1N52B 4WFNQ 2RIJA 2ZBQA 1IM4A 2IM3A 2DNZA 4ZVUB 3CDWA 4K4VA 4YUDA 5DM7Q 1B0TA 1F9EB 3KLFB 4EBCA 3WC2A 3DU5A 2E5IA 4UOCA 1QLNA 1OQ6A 4KR0B 1N56A 1JKHA 1SVDA 4MKVA 1H74A 3NGKA 3MUTP 4J91A 5H9EJ 2XMUA 2KTQA 2N4DA 4KY3A 5DS7A 1J2VA 3OR2B 1R8PA 3JAMY 2C2NA 1CJKA 1TL3B 4LRBA 2O67A 3PZPA 2DHAA 2WVBA 1GXLA 4H4KA 4DUTA 2OO4A 5JUMA 2R4FA 1YZ6A 1FI4A 4IR1A 1DTQB 1WEZA 1N33J 1R7IA 3M8PB 5DO2A 4I6AA 1TTHB 3CCTA 2QSFA 3MGJA 5IM0B 4B3OB 5KFRA 5IV3A 2HK3A 3OQ2A 4USVA 2NYIA 2J9DA 3ADAC 5HROA 2RF2A 4NX9A 4DU8A 4YB6A 3NCPA 2ABYA 3TVYA 1XNRJ 4L76A 3KOAA 2OIHA 4GMKA 3R7SB 4CQ1A 1S57A 5K8MA 4RNOA 4F02A 1RHMB 1U1OA 3FMBA 4ETZA 4DUYF 3OXLA 5KFVA 4JI8J 5CYMB 2W9CA 2AYBA 2J6SA 3D6HB 1GNKA 1JLEA 2Q43A 3UVJB 2DR6A 1HNVB 3HPOA 2FY1A 4GO5X 3MEKA 3ZZYA 4C8YA 1UA0A 3M30B 3KJQB 5SUHA 3CPWR 2QGFB 3RTVA 4FNHA 1YK9A 1NZ8A 4F67A 4LF6F 2FTRA 1IQZA 3O6QA 2R8IA 4I2PA 2BV3A 2AT1B 2Y9HA 1T05B 2PD1A 1D9FA 1XNQJ 3H5SA 4OI4A 2E7XA 4NA3A 3CCWA 5GAGU 2HHUA 5E3RA 2AGQA 3WIVA 2DGUA 1HLWA 3IAM9 2GC8A 1JWWA 2JC0A 2FZKB 4DV5J 4OL8A 3VWSA 3SCIE 4NXMJ 3TZXA 1HI0P 2LU1A 2FJDB 2HSEB 2RMLA 4U96A 3SEOA 1S6QB 1N8RT 1F5CA 2RKIB 2KH9A 2LQ5A 4I56A 2W9AA 2H4WB 1GEHA 3MZIA 2I5JA 1HD1A 2N3OA 4RLEA 3K2YA 1TV6A 4CLPA 4X64F 4DSIA 3CJ0A 3GV5B 2B51A 1JLQB 4NL5A 4WPAA 2PSZA 1MG7A 2ZHBA 2XY5A 3KUHA 2XM3A 4M5DA 1MWQA 1NPRA 4DR1F 1NK4A 1JLBA 3NNAA 7FD1A 1FJCA 4ED0A 4DV7F 4LR8A 1NJZA 3THTA 1SH0A 4F36A 4YP3A 2UXDF 3EZUA 4TU9A 2FJVA 2QT7A 4N5SA 2F5GA 4A8MP 1KR4A 5ETVA 2A0FB 3I31A 3PW5A 5F41A 4FYWB 4X4QA 4JV1A 1EIYB 3V5RA 2AIRB 1LKZA 2Z2LA 5HQMA 1FNXH 2ILZA 2Z2ZA 1F2HA 2IIHA 2ZOMA 2APOA 1ZM4A 2GCFA 2CNNB 3AH6A 5KG1A 4ZK7M 1FDBA 1S0NA 3S01A 2Z2YB 5K14B 2C3YA 1X4GA 2F7VA 2GJFA 4DR2F 3OTCA 1CBKA 3UCUP 1YQHA 3NKYA 1HQUB 4Q2MA 2KG1A 3IN5A 1TKXB 1JIHA 1S6PA 3BN7A 2MEWA 2OMOA 3A3PB 4ZVHA 1SIZA 2D3O1 5KFQA 2RQKA 4M94A 4AL5A 2V8PA 3KTQA 1XR6A 3H20A 3DRYA 1LWEB 1R0CB 2MKYA 2K1RA 1HWJA 5HANA 2SXLA 3CDBA 3GCXP 2BJEA 2W4PA 4RU9A 5C5JA 5CAAA 2BQRA 4GVLA 3GE9A 2CPIA 2FHMA 2DT9A 2FUG9 1R0AA 3C6UA 1TR0A 2O3DA 4E8UA 1P8GA 4RUAA 1MMNA 2Y1IA 2CQ3A 1BD6A 4BCAA 1T95A 3J7ZT 4IR9A 4M95A 3M6VA 1UJ4A 3ZZUA 1SKWA 3EM1A 1SL2A 1YRUA 4OV6A 4F8RA 2NXCA 3VV2B 1S9GA 4KO0B 4NZ0A 1O51A 2RE1A 2YX1A 1VBKA 3CWJA 1BXNA 1W2BR 1D09B 3QFWA 3VVUA 2ZBRA 3WHIA 2KG0A 2JFKA 4FN5A 4OYOA 1IBMF 4DV6J 4NLDA 3HVWA 4ICLB 3CO9A 3GV7B 1N6QB 1I5OB 4YS2A 4URSA 4J37A 2LCWA 1XMOF 3U27A 4CNYA 4EZ9A 1HA1A 3LOUA 3SSQA 2UP1A 1VQLS 4ELUA 2HS3A 3W8GA 4MYTA 2P2CB 3LP2B 4PG6A 4NA2A 4NLXA 1VC5A 5KFYA 3WZ0A 3GJSB 5CD4A 2HQIA 3EGWB 1AYEA 1FT8A 1OY9A 2HVEA 2MQOA 4XPEA 4ZLLA 5HBMA 3NMRA 3PO4A 1BGXT 4ILRA 1VC6A 1HNIB 2XY6A 4NOHA 4JI2J 2DY9A 2OPRB 4F3OA 1QY7A 2RVJA 3W7BA 4Y2IA 2OEKA 3UI3A 1S12A 1SJ3P 5D0GA 3LGHA 4KGZB 4RW7A 5ITHA 4DCOB 4QIVA 2YXLA 4C9DA 5J2PB 3M6XA 4JI0F 2J0SD 3HK2A 1VQ6S 4F25A 2NLWA 4IRKA 2KU7A 3CDEA 2EPIA 2OPQB 5C2GA 2UVUA 3GZ7A 2ZBIA 3PYGA 1IBLF 2J8AA 4I0WA 2MDAA 3Q2TC 1DTTB 3DLKA 3LW5C 2JOQA 3HHLA 3S1TA 3ISZA 3IBFB 3A8JA 1BWEA 2P6SA 4XIUA 5IOLA 1WHVA 2P9CA 2Q66A 1X4AA 3MOZA 4DV4J 2KT5A 3BGLA 2IBOA 1VQYA 3ZNUA 2GAGC 2ZKTA 2CQPA 2B56A 1ICEB 2BE2A 2YNIA 3NGDA 2VPWB 4EGLA 1PBAA 4JV2A 4DQSA 4KPYA 2C2MB 2RAQA 5DG9A 1HYSB 4LSLB 4AD6A 1RHKB 2VBYA 4K4ZA 3M32B 2K3IA 4OHXA 2Z2MA 2VPXB 3NGRA 2R42A 1XC9A 2HYIB 1BE4A 2IRUA 3NOGA 5EHHA 1S9FA 2FHOB 2YKNB 4ZITA 3PR4A 3F73A 1ZOTA 4B3SF 2W7AA 2ERRA 2UUBJ 2VDIA 4EBDA 4DR4J 3TJ9A 1KS2A 3DMJB 3UN2A 2HRTA 1WC6A 2V67A 3CJ8A 3GTYX 3POTA 1W7WA 3PO5A 2ZDPA 2F9DA 3DDNA 3QIDA 2UUAJ 3K8VA 3FEZA 4Y2AA 1WF0A 2AYEA 2CNLB 3V6JA 1B3TA 4CNZA 4AUKA 3H4BA 3D67A 1EQMA 3DYAB 4IRDA 1EKSA 4K5SA 3M8SA 2IYIA 4FYXB 4PZVA 3IMQJ 3K5MA 3D0IE 4DV3F 2PO4A 3FUYA 2R7OA 4UF4A 1ZH5A 3BO2A 4R8UB 2D1CA 2MQPA 2D9PA 1Y5LB 4PUOA 1HW9A 4NLTA 4IH6A 1WORA 2XG8A 4EUVA 3SSRA 2BEFA 2BJDA 2XBPA 5EWEA 1K9MT 3ZTSA 4LF7J 3T19A 4O4GB 1RISA 3DHXA 1RA7A 2QFIA 2A2CA 1LXNA 3KDNA 2BJ3A 2DCLA 1BQMA 4IH5A 4OI2A 4NZ6A 2V6AA 5IT9Y 1TELA 2ALYB 1NO8A 3QNWB 2KFYA 4FYDA 5D3GB 1TUVA 1RTHA 4DR5F 1JXVA 2ZUGA 4LFCJ 2E5LJ 2YQ1A 1JQGA 3M8WA 4OV1A 3GV8B 2XSJB 2YWHA 1ZTWA 3FFIB 3V6HA 2I0XA 3FQLA 2FHJD 4P2XA 3IR5B 1AZSB 1U47A 4DPOA 2HQFA 5L8RC 2IDLA 1FKAF 2KZMA 5BJRA 3L7UA 5CZVA 4LRCA 5IV4A 3H25A 4UOFA 1UFWA 1OPZA 1U8SA 3IWLA 4DG1A 2WK4A 1RWWB 3MR6A 5GMDA 2DRAA 4ENOA 4QPTA 1EZZB 3CDUA 1SXLA 3KNGA 3M1VA 1N36F 3KLEB 1RLDA 3MFHA 2CPFA 4AYBD 3AA8A 1W25A 4NCBA 3HZEA 1YTYA 2B9EA 3W61A 5A6PA 3MPUB 1OYEA 1RE1B 4WWSA 4DQQA 2UXBJ 3H2VE 4IG3B 2HNZA 4Y2KA 3M9NB 1SL0A 1PC5A 3EDRB 1H98A 3DGPB 1Q53A 1LOUA 5K8OA 2R7XA 2DH9A 1IKWB 3CJ2A 4NLGA 2VFSA 3T1YF 2UXCJ 3KLVA 4LF1A 3AXKA 4DR6F 2CWKA 1FNOA 1HNZJ 1Q7YT 3Q8RB 5DGAA 2HVDA 1NU4A 3T5JA 2DPJA 1GTEA 9ATCB 2EFQA 2GVZB 4QR0A 5B0GA 3HVTB 3RR7A 4KH1B 2XMVA 3HD2A 2I2YA 1FD2A 4ZLJA 3HFVA 4M5JA 4HR2A 2AP6A 1Q5VA 2OMLA 1IKXA 3OTEA 3DLGA 1JLCA 1R3NA 2C3PA 1KONA 4FF4A 3TA1A 3NWGA 3SFGA 1G3OA 5D0RA 3OR1A 4FF3A 4C4WA 2LYVA 2CIMA 5F8JA 1VQ8S 2QEXS 3HKZD 4YR2A 3H5UA 1V5VA 3R7NB 1C4CA 3ZTQA 2DTJA 2EEYA 2V5HG 2V4JB 4H4OA 4DPXA 2Y1LB 3GWCA 3N5FA 3RRKA 1UL3A 2QMUB 3EGZA 2ASJA 1I3OB 2WB4A 2LDYA 2MQNA 5DZ6A 3R8YA 1AUDA 1X5TA 5AJ3F 2B9WA 1U6FA 3JSMB 5KOWA 1U1NA 2ZH7A 4LF4F 2GAHC 3D1OA 2HAFA 3U1LA 1EHWA 3G6XA 4DZDA 4LSNA 5KFGA 2F65A 3FSIA 1EP4A 4AXJA 4DV2F 4ILMA 3DKDA 1YKWA 2M52A 1QSYA 1X5PA 2IRXA 4ELTA 4LF8F 4UZBA 4TU8A 3DM2A 4I4BA 1JK9B 4FVCA 4O3RA 3I4HX 1Y0HA 3MMBB 4RUHA 4NWBA 3TR5A 4G6VB 1SKRA 5I42B 2KM8B 4WKYA 4PCQA 4RNNA 5KFSA 3G82A 3OFFA 5L1IA 3WX8A 1Y3KA 3D1HA 2ZDOA 4DV0J 4X4OA 1QTMA 3SDEA 4GVBB 3WDOA 3K5PA 3MM9A 4DCPB 3LP1B 2AWZA 2XMAA 4MT1A 3H90A 2AQ4A 4Y00A 5IS2A 2J7WA 1S9EA 3RB6A 5CXTA 4K2JA 1R31A 3K5LA 2UUCF 2CDQA 1S4EA 2AHOB 3MXHP 2OELA 3PRBA 3THPA 1XTZA 1J5OA 1S1VB 2XLIA 1N0VC 1GXUA 1G7CB 5B0FA 1RI7A 3H5XA 4R0EA 4LFAF 1LWCB 2HQCA 1FD8A 5IT9U 1NK8A 2L9WA 4GO7X 2ATLA 4OZNA 4J9VA 1BC6A 4DEZA 3GMGA 1IWGA 4O3SA 2K7KA 4CLLA 3CMQA 1PJ6A 3GYGA 5DDRC 1VGYA 4K4UA 2XGQA
chains in the Genus database with same CATH topology
3M8RA 1LFWA 5KT3A 1JMTA 4QWCA 3K58A 4R25A 1L3UA 4B9NA 1FRLA 4DFJA 2WSCC 4TY8B 2J76E 3C66A 1HQEB 1YGYA 2WCXA 2NPFA 3MI7X 4CH0S 5T7LA 1WF1A 4YB5A 1FA0A 4Y28C 4X4RA 4OX6A 2F8HA 1KLNA 2YY3A 1N32F 2BANB 4WZMA 2E5JA 2M8DB 5EUHA 3SCKE 1VQ5S 3OR2A 5I4MA 2ZJRQ 3SV4A 1LW0A 4PUOB 2CQGA 2JEFA 2OTJS 1ZBTA 5KT6A 1UEUA 5EWGA 1HBUB 2VBWA 5EX3A 2EG2A 3F44A 2MKSA 2D74B 1MWZA 3MM6B 1TL3A 2HHTA 3HHDA 1S49A 2AJ4A 3MMCB 4NCGB 4HTIA 1D8ZA 2ZH5A 3T1AA 1TKZB 1DJ0A 3P6YC 1HMVB 3H59A 4RX6A 3T1HF 4C3MA 3VQSA 3QYYA 3UD4P 3QZ8A 2XLKA 1FK9A 3EX7B 4DFPA 3CD7A 3PRDA 3BGRB 4M1KA 3PEHA 4DN9A 5F0WA 4RNFA 3O1LA 2CVIA 4RW9A 2JVOA 1BQMB 1U1QA 2V8HA 2FVSA 2WBMA 2J9CA 1KTQA 2RS2A 2BBEA 2RU9A 3LPYA 2UV8A 1XR7A 3MUVP 3KMQA 3GQCA 2BM0A 3GB0A 2GNKA 5CQGA 3TA0A 2HQ3A 3MM8A 1VRTA 3ZZPA 1X4HA 4DHVA 5KAKA 4WFAQ 2CQ4A 1NJXA 1C0UB 1FXDA 1SUQA 3CC4S 3K8WA 4K4XA 2RUGA 2KJWA 4I2QB 4Y6IA 1E6VA 3DRRB 1TK5A 3HI9A 2DR7A 2EFPA 1FXLA 3VZIA 3M05A 2VBZA 5CYQA 2X1FA 3TNVA 1HARA 3PM9A 4OIXA 3DI6B 4KRWA 4ALZA 2KZZA 1XEZA 4B9SA 5DJBA 1JJ4A 3TO8A 3G96A 4ZPCA 5F8HA 3K57A 4KHRA 3GG0A 4DL4A 4X4SA 4A48A 1Z2LA 1UEVA 4A8WA 1KC8T 3TVKA 1FJEB 1C0TA 3V2UC 1CEZA 4CO2A 3BR8A 1ZAWA 3MM5B 3FMWA 1DZ5A 3KK3B 2KN4A 5KFLA 2XY7A 1DQ9A 4RBUA 4PPZA 1HQEA 2E1AA 2HHVA 1FJ7A 4E98A 4Z2XA 4FF2A 3SXLA 4WTYA 1TFWA 3HFKA 4LFBF 1S6OA 3MCSA 4G1QB 2BANA 3OPKA 3JTOA 1Q78A 5KG2A 2R7RA 5FD1A 2VL1A 4DF8A 1E6YB 3HX9A 2E5GA 4DG1B 4C11A 1U1LA 4IDKB 5C42B 3EPGA 2HWIA 2J0WA 4AL6A 4UUWA 3AHPA 3G71S 1SJFA 4EWTA 3MMCA 2IC3B 4MIAA 5F8NA 2XGPA 3DLEA 1TKZA 4PXBA 3T9NA 2X1AA 1IJFB 2FGOA 5AE3A 1HMVA 3IO1A 4O4RA 3U02A 1URNA 2HFOA 2IA0A 2XLJA 2EK1A 1MNEA 3PW4A 3P5TL 3TUJC 3N6LA 3BGRA 2R7UA 5HN0A 5LJ3Y 4KKOA 4ECWA 4A8SA 4KC5A 4XO0A 4ZPAA 4NLPA 4WE1B 2JL9A 5E3CA 4IFYB 4LQ3A 4L3NA 3L95X 4HL9A 2LMIA 1UKUA 3V81B 2M3DA 1FESA 2AV5A 1UVMA 2KFNA 2RJZA 2CZVC 4XDCA 3ZZZA 3NS6A 1C2PA 3ENWA 4JOUA 2XZWA 3BF4A 3I9V9 4I2QA 4NLWA 3PXGa 3AB2B 3UD3P 3B82A 2EFNA 3HF5A 5HP1A 3HM9A 4GKJF 4BHQA 2KXHA 4I7FA 3X3UA 3DI6A 2A1BA 2PFFB 4O3PA 1BQXA 3VAFA 3M9OB 3I4PA 3RYLA 4DBQA 3CC7S 2Z0GA 3RRHA 2U1AA 3QZ7A 5D8HB 1T3NA 1QVFR 2XS7A 1R8AA 1QAYA 2JLGA 2GA7A 4OX8A 3MM5A 5HLFB 5H1SV 3KK3A 3M8QB 2ASYA 3IWNC 4DL0C 2N7CA 1U1MA 2YKQA 2UU9F 5B7WA 4WFXA 1Y9OA 1RDRA 3OJUA 3G8QA 2F40A 4ZPWR 1GT8A 1LW2B 1S6QA 4HEA9 3MHYA 1MW7A 5BYQA 2QA4S 3AQOA 4RW4B 5F9LA 2J7KA 2IJFA 4IH7A 4QWEA 2ZE2B 3G8SA 2OP5A 2CQ1A 3QWUA 1E6YA 5IZHA 2CQIA 1X4EA 3MTKA 1Y5IB 1SI9A 1LV5A 3DRXA 3ZFVA 4DR3F 1NKBA 4PQUB 4NLYA 4JI4F 1FDAA 4KGKA 3NMAA 4PKDB 3BB5A 2BRLA 1RT2B 2KT2A 2M88A 1FKPA 2IC3A 4OZJA 1WEYA 1X0PA 3OL8A 2J0XA 2W4DA 3ONQA 4LIWA 4DDFA 4DF4A 2XS2A 1UVNA 1IQTA 4FXWA 1KRPA 4NLOA 2IJNA 4IOBA 4M63A 5AE2A 2R2RA 2C2EA 4RNHA 3UQSA 1NB7A 4ES2A 2WRMA 1VK8A 3CJ5A 2BQUA 2VG5A 1IKXB 1JLQA 4C8NA 4Y65A 4ED8A 3HDSA 1S97A 3NRBA 2B9XA 4R5PB 1FKOB 1HHTP 5L38A 4ZKAA 4PG4A 3DLGB 2DHSA 1BQNA 1WF2A 1KOHA 5KFOA 3G6YA 1HW8A 1YJUA 2OPPB 4WE1A 4X65F 4ECXA 3D0GE 3HHKA 2N82B 4Q5VA 1TK0A 5KFHA 4A8XA 3BQ0A 4JUZA 1GX6A 2HNDB 1XWLA 5KT7A 3DDKA 4X62F 1NH7A 3V81A 4OMFG 1UW4A 3K0JA 2V8DA 3RRGA 2HRUA 4PXEA 2OSQA 1WG4A 3JSYA 1AROP 1X7VA 2GJIA 5I3QA 4AL7A 2PI4A 3THVA 4F50A 3DLHA 1WG1A 2YKOA 4J9LA 1F5AA 1HI8A 4ERDA 2KFZA 1F0XA 3Q24A 2EW9A 3CJ4A 3NS5A 4QIEA 2PEHA 3WX4A 1RT6A 5B08A 4RKUC 3W2VB 5J2MB 1DFDA 1U24A 4FBTA 5CD4H 3RAXA 3W3SA 4ID5B 5KOXA 3NP5A 4OX7A 2FHJA 3ZZ0A 3RBEA 2CRLA 2HGLA 2Y0SD 4LF5F 4QR1A 3MMJA 2YTCA 2PN6A 1UVIA 4CTAB 5IQQA 2JEIA 2K3KA 4HT5A 5SZTA 3JB9k 3DCAA 2DD8S 3JTNA 4C8OA 2CJAA 4YB1P 2NXUA 4B3RF 3QIPB 1MU2B 3FRZA 3J7YI 1FERA 1IUJA 3IAS9 4C3KA 2V8GA 2CJ9A 2MYFA 2COLA 3UDLA 2D3ZA 4O3NA 4NYZA 2QSWA 2VFRA 2RQ4A 1Y5NB 2XI3A 1VI7A 2PE8A 1N33F 4RW4A 2ZE2A 1T03B 2DBBA 2C42A 4OZ1A 5D77A 4FXDA 3IWXA 2MXYA 2FB0A 3KKFA 2VONA 1UJ5A 2DR8A 2B6AB 2H5EA 4DV1F 4DR7F 1K73T 2HLUA 2VKZG 1FF2A 2BRKA 4QJVA 4PQUA 3DRPB 2L48A 3M6UA 2E29A 2HVHA 2MHNA 2HZCA 2M9KA 2B4PA 1RT2A 4JBCA 1A9NB 2XMJA 2XMTA 2WW8A 2V0NA 1HBOA 2ROGA 4FVMA 3OVAA 1TAQA 4ZCMA 3SV3A 4K0KF 1YWXA 5C25B 3BSAA 3V6DA 3DFEA 3HLUA 5JVGQ 4BC7A 1U09A 5KFCA 3PKYA 5B0CA 3KK1B 1U1KA 3GIIA 3BO3A 4LVNP 1KVJA 2KYXA 2YWKA 1X8DA 4ES3A 3OL7A 2B0GA 3KYLA 4A8OA 4USHA 1X4DA 2B5JB 4R5PA 2M4MA 1TFYA 3RZAA 1FKOA 4LSNB 2GQ2A 4Y3CA 1XNRF 2RSQA 1UWBA 2OPPA 4MIBA 1RT4B 3GFYA 3CCMS 2ZH3A 3Q8QB 1X0FA 5DDOC 4EO6A 2FJWA 2XMMA 4FS2A 3QPIA 2AX0A 5B0DA 2B3TB 5A8RA 3DRSB 1RWUA 3HT3A 2BDPA 1MROB 3E01A 4WU3A 3TA2A 2EC0A 1CQNA 2CYYA 1M0SA 2C3MA 3U1MA 2MKJA 4JI8F 2IRYA 2FHKA 2YWEA 3KK2B 5J2QB 3MD3A 1BLUA 2Q3PA 4ZCLA 3H2LA 1FRXA 4FP9A 2F8MA 4YEAA 3I87A 5DLFA 1R27B 2J6UA 2DNOA 3VCDA 1NRKA 2BYCA 2X51A 3BQ1A 5J2MA 2MQQA 4XAKA 3PW0A 4ILLA 1U4BA 2OFHX 2JWNA 5AXNA 1Q86T 4KE5A 4QIGA 2QLXA 3DM2B 4ID5A 1XBWA 3CIZA 3I96A 2VG7B 3AB4B 3I32A 3FGVA 4YHHF 3Q22A 3PEJA 5ADZA 2MZTA 2XSFA 4J9SA 4YFUA 1N5YA 1VHFA 2I9SA 4TNOA 1P9QC 1NEEA 2YKMB 1NNDA 2E1MC 1N5QA 4UY85 1T3OA 2VB6A 3QIPA 3MDFA 1O8BA 3VAGA 5K9FA 4IKAA 3P96A 1N4LA 3LWLA 3IS9B 1JKHB 5F9NA 3FRYA 4K4YA 1RJJA 3J7Z5 4MK9A 2O1PA 4PQAA 4YDDB 1T03A 5KFXA 5DRKA 5AXLA 1H3DA 4ZVEA 2A3JA 3PJXA 1KD1T 4TQRA 4WZQA 2FJAB 4ZS6A 3GIMA 1TL5A 2LVWA 1NK5A 3UCZP 2AGPA 2AGOA 1APSA 1UMJA 2DNLA 4OJ1A 1WELA 3OTOF 2DNPA 3DRPA 1N88A 5GAGI 2NSBA 3VAMA 4ETXA 3I5BA 2GIRA 4ZHRA 3CVKA 4ZPDA 2LA4A 2CQ0A 4A8QA 4K4TA 2ZHAA 1RGVA 3N9UC 1OO0B 1XNQF 1ZPVA 4J9PA 4EBEA 4WK3A 3DC2A 4CI0B 2FLLA 4HI2A 1S9EB 5JJBA 1M1KT 1VRUB 3VR1A 2EBGA 3KK1A 2F4VF 6FD1A 3H2UB 2YNGA 1X9SA 2R2TA 2CQDA 2ZITA 5L9NA 5I3PA 3H40A 4Q8EA 3K7RA 5DETA 3AQPA 2E7WA 4IFVA 3A1YG 3BN4A 1RT4A 4DV5F 2VQFF 1IXKA 3D0HE 3MM7B 2FVRA 3L3CA 2UUAF 2B9YA 5HMXA 4DL5A 2Y1RI 1N52B 3TOQA 2RIJA 2XEXA 4WFNQ 1IM4A 2RQMA 1J5OB 2XI2A 3DRSA 2AW0A 2Z8QA 4EZ6A 1MROA 4NXMF 2IM3A 2DNZA 4OZ0A 3TANA 3J7A1 3CCRS 5DM6Q 4NCAA 4B9UA 1T94A 5G0RA 3CDWA 2MQMA 4V19J 5J2QA 4KO0A 1RTIB 2P9EA 5JXSA 4K4VA 1VQSA 4P6QA 4YUDA 5DM7Q 3HHLD 1B0TA 3H8YA 3GR1A 2RF2B 3L09A 2J7UA 2QMXA 4KJIA 5IXUA 3KLFB 4EBCA 4O0IA 3WC2A 3DU5A 2E5IA 2HFNA 2NZ4A 2VG7A 1VBXA 3BJYA 5BR8F 5HL7Q 4MMOA 4UOCA 1TKTB 2KDOA 2YKMA 1TQLA 3AA9A 4ECSA 1NKEA 1QLNA 2X1GA 5FDLA 2QFJA 2E9ZA 2PT0A 2R2SA 2HHXA 2RB7A 3R5DA 1XERA 3JSRA 2K7JA 1OQ6A 3GR0A 4KR0B 1UJ6A 4CCHA 3N28A 1N56A 1REVA 1IKVB 1OQ3A 1JKHA 1SB6A 2HPUA 1TKDA 3RB0A 3Q8PB 3NGKA 4ICLA 3MUTP 3TRGA 1F2GA 3R5BA 2D41A 5H9EJ 4OLPA 2XMUA 3CC2S 1TP7A 5K5MA 1RA6A 1YBAA 2KRRA 2N4DA 2KTQA 2UUWA 1RT5B 1UVKA 5DS7A 3VTIA 1J2VA 1JLEB 1OSDA 4YMEA 2QLWA 3OR2B 1IN0A 1R8PA 1LW0B 2DK2A 3UWTA 3JAMY 5D6GA 3MWBA 4U7UK 5KFFA 1SL1A 3PIOQ 5KG6A 1JJ2R 5E5NA 2Q6CA 1T02A 4HLBA 3U1NA 1AFIA 1TL3B 5A2QY 5KTQA 2EFGA 5F0UA 5DG7A 1KQSR 2O67A 3PZPA 2DHAA 1GXLA 4H4KA 2W8KA 2CJKA 2OO4A 5JUMA 2DNKA 2XNRA 2R4FA 4G1IA 5LMUF 3SQGA 2OJ3A 1G2EA 4IR1A 3CCUS 1FHTA 1DTQB 1X4FA 1WEZA 2WONB 5KG3A 1FK9B 1VMBA 1R7IA 3MM7A 1NJIT 4J9MA 1JX4A 4RW6A 3M8PB 5DO2A 2EWHA 4LJMA 1YJTA 4I6AA 1IR0A 4RW9B 3CCTA 3HHLC 3J7YU 4I2PB 4N41A 2QSFA 3MGJA 4ED1A 5J1EA 3OXFA 4DQPA 2ZBCA 5IM0B 2G9OA 2AF6A 4B3OB 5KFRA 4NZ7A 4EU0A 1HL6A 1ZM3A 4CO4A 3MM8B 2RQCA 3OQ2A 2FD2A 5HI7A 1SUQB 1Q8LA 2NYIA 2FIUA 2J9DA 5HROA 2YKPA 2RF2A 2DGTA 1KN6A 4NX9A 1E6VB 3QO9A 4ED6A 1FRKA 2ZHOA 5GAHU 1XMBA 3M2VB 2ZM6F 2ZOFA 5J2NB 4YB6A 5MAOA 1YG0A 2LEBA 3NCPA 5IQ6A 5IT4A 4UQTA 2ABYA 3TVYA 1TKTA 4WFYA 2M70A 2IMOA 2CPXA 2NSCA 4A8YA 2ROPA 4RNMA 3KOAA 2OIHA 2VOPA 4GMKA 2G0CA 3OSPA 4A8KA 3MTJA 2FLOA 2ZJPQ 4CQ1A 4RNOA 5K8MA 4J9NA 4F02A 1U1OA 1IKVA 1SIWB 4FPRA 3G8TA 4DWIA 2KJVA 2HGNA 3FMBA 4C8MA 4ETZA 3OXLA 2V9KA 4DUYF 5KFVA 2DHGA 2DIVA 3QAUA 3OUYA 3K5OA 1K0TA 4P7TA 1IKYB 5CYMB 2KM8C 2W9CA 4P7VA 2AYBA 3HXMA 3NAIA 3MEGB 5THWA 2J6SA 4LVOP 2GMJA 1T7PA 5D78A 1RT5A 1X5OA 7FDRA 1GNKA 1JLEA 2DNNA 2Q43A 5J2PA 1UP1A 1HNVB 3HPOA 1RYSA 2ZVSA 2FY1A 4GO5X 3MEKA 3TX8A 2ROEA 4C11B 3I0RB 3ZZYA 4IOAQ 4ZPBA 4C8YA 2HHQA 1UA0A 3M30B 2EI5A 5U47A 5DLGA 2KT3A 4N77A 5SUHA 3CPWR 3O3LA 2QMWA 3DLEB 2IHR1 3RTVA 4KV8A 3LAKA 2D3UA 4FNHA 5L39A 2I5JB 2WTFA 3E3XA 1RQ0A 1RP5A 3T5JA 2J6TA 1DTQA 1ELOA 4F67A 2WONA 4LF6F 1S77D 2NPIA 2W25A 4QU6A 4YY3F 3MOJB 2FTRA 1IQZA 3S8SA 3M8PA 2L41A 2MZRA 4HKQA 1CVJA 1KNZA 4KKOB 4A47A 3O6QA 1OSCA 4V19X 4O23A 4CO0A 2R8IA 4B9VA 4I2PA 2QO3A 1MMLA 2BV3A 1DAXA 4ZA1A 5IM0A 3M2UA 5KT4A 4B3OA 2ZKUA 2GGPB 1CC7A 1T05B 2PD1A 3FJ2A 4TU7A 2AYGA 3GSDA 1D9FA 4JYAF 2M8HA 3H5SA 2D9OA 4U6PA 4NRTA 4OI4A 2DPIA 2N7YA