4MAKA

Crystal structure of a putative ssrna endonuclease cas2, crispr adaptation protein from e.coli
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
73
structure length
73
Chain Sequence
SMLVVVTENVPPRLRGRLAIWLLEVRAGVYVGDVSAKIREMIWEQIAGLAEEGNVVMAWATNTETGFEFQTFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a putative ssRNA endonuclease Cas2, CRISPR adaptation protein from E.coli
rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords CRISPR-associated endoribonuclease Cas2
total genus 16
structure length 73
sequence length 73
chains with identical sequence B
ec nomenclature ec 3.1.-.-:
pdb deposition date 2013-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09707 Cas_Cas2CT1978 CRISPR-associated protein (Cas_Cas2CT1978)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.240 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4makA00
3LH2S 1T95A 1P9QC 3ZZUA 2NPFA 4ZCIA 4MAKA 3OQ2A 1ELOA 2XEXA 1ZM2A 2EFGA 1KTVA 4QR0A 2E1RA 3B78A 4QR1A 2L9NA 1FNMA 1N0UA 4MYUA 5G4DA 1N0VC 2KDOA 1DARA 4ES1A 3EXCX 2CVEA 3E3XA 3B82A 4ES2A 3B8HA 3ZZTA 2ZITA 4TNOA 2BM1A 2I0XA 4QR2A 3ZZ0A 4M1KA 4MYTA 4FN5A 4ZCLA 1ZM4A 2BV3A 2IVYA 4ES3A 4ZCMA 1ZPWX 1ZM3A 2BM0A 3UI3A 2J7KA 4ZCKA 2I8EA 2WBMA 1VI7A 1U2RA 1ZM9A
chains in the Genus database with same CATH superfamily
2QA4G 4IKAA 1LWEB 1TL4A 2H51B 2YX1A 3DLEA 2FVPA 3U7JA 4DXLA 3OQ2A 1KWMA 2CPHA 3VALA 2Y3YA 1SJQA 4YR2A 4F2SA 2FLPA 1KD1T 3LGMA 3GV7B 2F3JA 2MKCA 1CPZA 2KDOA 5MAOA 3NAIA 2DNGA 2IAJA 4RW6A 4K4XA 3MMCB 4MKVA 3HFZB 2FLOA 2GQQA 2Z2ZA 3JSBA 5IV4A 4RU9A 3G9CA 2AYMA 2G9OA 2P9EA 3V6DB 5H9EK 1SL0A 3DHWC 3J7ZT 2BR0A 4J9KA 2QYCA 2HVIA 3KOAA 2AD9A 5ETOA 1VBYA 1Y5IB 2DRBA 3LUYA 5LSOA 1ZYQA 2ERRA 1VQPS 5EX3A 4DPUA 2HHHF 3RRGA 1ZA2B 4O3RA 2HMIB 3K5OA 1HWLA 2LQ5A 4WWSA 2XY6A 2M2BA 3O1LA 3P45B 3TAQA 2PI4A 1FJCA 1LXNA 3Q2SC 1MN9A 5AJ3J 2XHCA 2N4DA 4QR1A 1SH3A 3BKUA 4UOHA 2HVEA 1YDLA 2H1YA 2JJ4D 3IBFB 3O3LA 3ET6B 4KGMA 3MM7A 2H9ZA 3A3PB 5U47A 4FKXA 3MXHP 2VG5A 1U1RA 2RNEA 1LWFA 1QY7A 1BQMB 2Y0BB 1JLFB 3NOCA 4TYAA 3PR5B 2B3TB 1PO6A 1R3NA 3HHLA 3MEEA 1YHQS 2AQ4A 4A48A 2LP4A 2VA2A 4J9MA 5EN1A 4M63A 1TK0A 4OI3A 4OJHA 4M95A 2Q6BA 3R7NB 3POTB 1RE1B 3KKFA 2E5LF 2H5JB 2CZVC 2KVIA 4OFZA 5EUHA 2W9BA 2R7WA 2DR5A 4KPCA 4C3LA 2V0NA 3FC9A 3DOLA 2UXDJ 4LUBA 5AE1A 3M2VA 3OL9A 2GCFA 4WYLA 5CHCB 1TELA 3GJRB 1F9HA 2K8GA 1HWUA 2PMHA 4LBPA 3R2DJ 1RTDA 3FBFA 3FEZA 2PD1A 2FC8A 4K8RA 4J7CA 4WU2A 1LFWA 1GX6A 1HWKA 1T3OA 3VWSA 2WVCA 2ASLA 2OFGX 4ZVFA 1JNRB 5D6GA 2C2EA 4WP9A 2BBEA 2DIVA 1AUSL 1QUVA 3R8YA 4URGA 3JSRA 4QW8A 4C8YA 4K59A 2HRUA 3I0SB 3IG1B 1UA0A 3GYXB 5D0EA 4ED3A 4B3SF 4IFYB 3ZTOA 3ICLA 1RXOB 4WIQA 4Y65A 1U45A 3OXGA 2EPIA 1Z4UA 3G86A 1X5TA 2DGUA 2EBGA 2XYGB 3RW7A 5LMUF 3CPWR 1TAUA 1UA1A 4QU7A 5CYJA 4TLQA 3CJKA 1N0UA 2ADCA 2V34A 1IN0A 2CQCA 3MM7B 1XR7A 4QOTA 3NGSA 5G4DA 1O51A 1QJHA 1TU0B 3I87A 4QBUA 5I42A 5LSRA 4IH6A 4HDHA 3PIOQ 3H4DA 1QVFR 5KG6A 2FTRA 4EMDA 5EDWA 3A4TA 2CFXA 2KXNB 1YJUA 2B4PA 2XYHB 3SYZA 4GKKJ 1PBAA 3JXOA 3AJDA 3FQKA 4B9UA 2AJ4A 4XAKA 3W8GA 3HD2A 1RYRA 1TZ0A 4AQYF 1HNXJ 1VQYA 3IM8A 3JQKA 3U1NA 4DCPB 2C1EB 1U2FA 2W4PA 4PR6A 3BSNA 2FYXA 1U4BA 3IRWP 3LWLA 2F5GA 4M5DA 3M4XA 4OMFG 2FZCB 1S10A 5ITHA 3PXGa 2Z8QA 3LGHA 1XEZA 4GVLA 4MAKA 4DX6A 1ELOA 3CCJS 1KN6A 2XM3A 3QAUA 1NDKA 4RX6A 5H9FJ 2N7CA 2XLJA 4CIOA 4LF6F 1Z1ZA 1FDAA 2XCPA 1BLUA 1CULA 2NZCA 2OD6A 1U0SA 3VZIA 4CNZA 4NLXA 4PUOA 2CPYA 2J9DE 5L8RC 1NSPA 2JX2A 2A18A 2MLXA 2EVZA 3D6FB 3P5BP 3ZTQA 2OIHA 1ZZFA 1D09B 2BV3A 4C11A 2Q43A 2XG8A 3ADAC 3C8YA 3VZHA 4F3OA 2DH7A 1R6VA 4WF9Q 3C46A 4RNMA 3OJUA 4J5OA 2W9BB 3QGIA 2ZEJA 3ENAA 1RWUA 3NNAA 3VAIA 2F8MA 2GC8A 2ZD1A 5J2PA 1IKWA 2B4UA 2DHGA 3GSIA 5L38A 4QYZK 3BS9A 2GA7A 3GV8B 1E6VB 5DM6Q 5HN0A 3J81Y 2G2ZA 3OTOF 1OMSA 4HH0A 2EKYA 2ZH1A 1HNIB 1UETA 2OELA 3DLKB 4RNFA 3KLGA 5D4OA 1HNXF 5D0HA 5K8OA 1GTHA 1UW4A 1DZ5A 1F9FA 1ZPVA 2HLUA 1JX4A 1S6OA 3MMCA 2HNYB 2I9SA 4WTYA 3T1HJ 3TUZC 4WFXA 4JI1J 3NY0A 4YB5A 4CLYA 2UUAJ 3FBCA 1SL1A 4NMLA 2CG8A 2KYXA 2A3JA 3MAHA 4FVMA 4OYPA 2LXIA 5FIIA 2PA3A 5E3CA 2QLXA 4OX9F 1I5OB 3FVYA 3K57A 1XIQA 3HULA 1BQNA 2J6UA 2R8GA 2HBZB 5FDLA 1J27A 3W1YC 4I0WA 1D0EA 2RKIA 2V6AA 1Q0NA 3QFHA 1Y3JA 3M6XA 4ZVSB 1F3FA 1FE0A 1HMVB 1TKTA 3D2WA 4HI2A 2LQ9A 2QLJB 5THWA 4HDGA 1GXUA 1S99A 2PIIA 2WVDA 3L7UA 5CYQA 2JEJA 3AA8A 1JXEA 4KY3A 4NYZA 3EPIA 4BC9A 4WZQA 1IM4A 1PJ5A 4KGVB 2HYIB 2B0GA 2RB7A 5E3QA 4CO1A 5B0CA 4NLRA 2GGPA 2ZM6F 1UFLA 1XK8A 1RA7A 3MTJA 3OR1A 3A8IA 3R9LA 4DL2A 1VJWA 2IVMA 2OUGA 4EEYA 4RW4A 1H72C 2VUGA 2HQFA 2GQCA 4UQGA 3H5YA 4E8UA 3MURP 4J9OA 1T05B 1NK9A 3PO5A 5HJXA 1IKYA 1FRLA 4JI4J 4PZVA 4CRJA 4CTAA 2A0FB 5HROB 1N5YB 3ELHA 4IH5A 3W2VA 3MECB 3M9NB 3UDCA 3VCDA 3OTBA 4ZP7A 4FBUA 1FRXA 3DOMA 5DDQC 1JJ4A 1YZ6A 2RF2A 4ID5B 3CDAA 1NJYA 2DNPA 2DPJA 2IBKA 2D3OR 1F5BA 2DCUB 1TL3A 2QX0A 4OZ1A 2ABYA 1JLQB 5JVGQ 4KHPJ 1X4CA 1UW9A 2BACA 4O4RA 2CPXA 1S9FA 1U8SA 1D8ZA 4A8XA 4CYUB 2AMCB 5M2RA 1MMDA 3TYTA 3B8HA 1DQ8A 3JYTA 2ADBA 4DV5F 2X51A 3RRHA 1HI8A 3MWBA 2IFXA 3KDNA 3I0RB 4RUHA 1XN9A 4B9LA 1EHWA 1Q16B 3OLBA 4OYZA 4HL9A 4J37A 4OX6A 5ETKA 5IZHA 2BDPA 3NNCA 3N5BA 1ZETA 3BPSP 1X5SA 2OI2A 4BS2A 1FDBA 1VIOA 1KR4A 3TP2A 3N01A 5SUHA 5KFRA 1YVFA 3M1VB 1CJTA 1N5VA 4WXWA 4ZA1A 3MHYA 1Y00A 3OSPA 1U1PA 2IMWP 3H25A 2HFZA 1LKZA 3TAMB 1FF2A 3IBWA 4LREA 4CCHA 3AOAA 3HVAA 2DY9A 2PFDA 1RAAB 1HYSA 3DKDA 2CPIA 2ZWPA 1F5CA 4HI1A 4NYPA 4DR7F 1RTDB 1BWEA 1RT4A 3HVTB 4KFBB 4PAAA 1NSQA 5DQGA 4HR2A 3LP2B 3M9OB 1UMJA 4C8ZA 1FTCA 3PJ9A 8RUCA 3T1YF 5LMNJ 2HWIA 2HQCA 4WIIA 1SKWA 4OZ2A 2MGZB 3CWJA 4WKYA 4NE9C 1UVLA 1RHUB 1WF0A 1BQNB 4FNHA 1T0TV 3EGNA 3M05A 1EAYC 2HZAA 2MJNA 3OFEA 5L1IA 2AYGA 2EK1A 4KB7A 4OL8A 5IWAF 3HFVA 4IG0A 2OP5A 3IRXA 4ZIVA 5J2NB 1XNRJ 3BO2A 1MLAA 1T9TA 3CD5A 3ILOA 5HVFA 5RUBA 4LFCF 3D3BJ 2KRBA 1CJVA 3DMJB 1DTTA 4DFKA 2DNHA 2HQDA 4PG5A 3VGSA 1WEZA 3IA0A 5IOLA 3ZO7A 4RBTA 2YKQA 1A6LA 3MZIA 4F4YA 4QCLA 2IHR1 1JJHA 2GVDA 2WVBA 2YWKA 4OZ3A 1ZZNA 4KJIA 2DT9A 3GU0A 3R5DA 2XO7A 3PYFA 5DZ7A 5D4NA 2FJXA 3OVBA 2AJQA 4X4SA 1I94J 2VPWB 1R8CA 4I2QB 3QO9B 3TUJC 3FSIA 2LEAA 3GJQB 1HBOA 2ZKUA 4ID8A 2XMKA 3EGWB 4X84A 1P8GA 5D4LA 4X4RA 3RBXA 3A3OB 3EZ5A 4L6V3 4FYXB 3KK3B 1RT3A 4J9QA 5G0RB 3L4BC 2VH7A 4ZIWA 3KHLA 4JI2J 1CQMA 3MR2A 1TV6A 3V6KA 1S1VA 3NOGA 4EUVA 1RWOB 1SV5B 4CZCA 4PWWA 4QIVA 3T5LA 3D9BA 4U9RA 2HWHA 4QWEA 1NSKL 4RW6B 1M5PC 2KZMA 3SCIE 2CYYA 4HVZA 1KOHA 3GTYX 3W9HA 4QPTA 4JV1A 1K9MT 4RW8A 2G2OA 4DV2F 3NS6A 5HVGA 3VGTA 1UVMA 1JLBA 2I0XA 2GO9A 4RNHA 3D1OA 2BJ9A 3BN7A 3C14A 4ZCLA 2G1DA 2VF3A 5MLCV 3EXYA 5C2GA 5CH7B 4O3QA 3V4IA 4DR3J 2XBPA 4Q2MA 2ROEA 3HHLD 4AL7A 2IY5B 1P1TA 1QAXA 1WKLA 2I8EA 2W7OA 4Z7CA 5CYMB 1UVKA 3H2UB 4KGKA 3U02A 1Q82T 5KFPA 3HD1A 4O3SA 4R5PB 3OL6A 1H6KX 1HLWA 3GFHA 3C66A 3GV5B 1CS4A 2XCAA 1KTVA 3DMJA 1IWAA 3K7RA 1NU4A 2IVFB 3UQSA 4ZDNA 4UT4A 1OY6A 3QQCD 3FRZA 1CULB 2IIHA 2B6AB 3M2UB 3RB0A 1RACB 4ZITA 1MSWD 2HFVA 3D6HB 2PGCA 2LQ8A 2GVZA 2ZITA 4U95A 4FXWA 5HJYA 4YQWA 2UUBJ 1DAXA 1JIHA 1RLDA 4G1IA 2FZKB 4LQ9A 3PRVA 4UQTA 2Z2MA 4FP9A 5D0RA 3SCLE 3TEHB 3GCWP 2IRUA 2R42A 3OR2A 4YB1P 2R7SA 1QM9A 2W4CA 2R7VA 4JUZA 4RWXA 1NZAA 2L9WA 3FSYA 3I9V9 4C3KA 4XDDA 4F4KA 2N7YA 3A13A 5I3UB 3R2CJ 3MI7X 3D5MA 4KH1B 5K20B 3M6WA 2LXFA 4HACB 1JLEA 1LW2A 3ZNJ1 4XO0A 5LMUJ 2J7WA 4DSFA 1J5EF 2DNYA 3C6TA 4ZPDA 1Q8LA 3OTCA 5LXYA 1KKHA 2AYBA 3I32A 3QWPA 2GFFA 2YNFA 3FEXB 3M2RB 2DHAA 5FLXU 1RAOA 1KEKA 5GAHI 2CQ0A 4I56A 3QZ7A 3E3XA 2GMLA 4N8NA 4ZVHA 3I55S 2X1BA 3CCZA 1HBMB 2BKNA 4OJ1A 2KZZA 1OSDA 2DH8A 1S6UA 5DGAA 1RHKB 4AT1B 2B51A 5IWAJ 2WCXA 3H40A 3M8YA 3K5NA 2W2NP 1X9MA 2WB1D 3Q8YA 1T94A 5HMYA 3POTA 4ZP8A 2MKIA 1HNZF 2QA4S 2J0WA 3ZXWA 3KJVA 2J7KA 2C2NA 5LOQA 5H9EJ 3GFYA 6AT1B 1M1HA 4LF8F 5CAAA 2VFSA 2R8KA 2GIQA 5KG2A 3W61A 1IBKF 3ZZOA 2KYZA 4EZ6A 3MEGB 5IV3A 1PAUB 5EGYA 2OSRA 2IC3B 5KFVA 4IRDA 3C16B 3I4PA 3LWMA 4RBVA 4DEZA 2VG7B 2OPRB 4OX8A 4X4PA 2JLFA 1DRZA 1Q95G 2VKRA 3JTNA 1RHQB 4MIBA 3W8PA 3TZWA 3VVTA 3BQ0A 4KT0C 4EBEA 2J9DA 4B3TF 2CUYA 2W8KA 1RWWB 4O23A 2MZSA 4BWMA 2DYAA 3HSDA 1FNOA 1SIWB 3IWXA 3OLAA 1N48A 2E29A 1ZM4A 1MWYA 2LQJA 4HKQA 3KMSA 2B8PA 4CLKA 2BJEA 5B09A 2XQCA 1IXKA 4XK8C 1LOUA 5KFIA 2RVJA 3MDFA 4V19X 3PTWA 5F8GA 5EWFA 1A0OB 1FX4A 1V5VA 3QGPA 3FCHA 2KTQA 3QAEA 3W9JA 5KOWA 3EGZA 4O44B 3SSQA 4LRDA 1P9QC 4LRAA 5J2QA 1FNXH 4MH8A 3QBCA 1IQTA 2AW0A 2HBQB 3S8SA 1JLAB 4B3TJ 1NAQA 4C8MA 3C6TB 4ANCA 4ELVA 3IM9A 1N36F 1IM6A 1EIYB 3CJ4A 3MMAA 1VRQC 4USTA 4CYUA 4DZDA 4KTQA 3J80U 2QL5B 1R31A 2FJDB 2P9GA 3B82A 3PG9A 2HNZA 1PKUA 1S49A 3PNIA 3H4BA 4QWAA 1N33J 2P5VA 3AB4B 3BQ2A 1L3KA 3FQLA 2W4DA 1RADB 4ZN3A 2Q79A 5HP1A 1MMLA 2P8IA 2ASYA 4X4VA 3DGPB 3E01A 2RS8A 4WP3A 4TQRA 1FX2A 5A2QU 3RR8A 1VI7A 2QSWA 1VLOA 4DCOB 2I2YA 4ERDA 4RW9B 1NHUA 2RRNA 3CCSS 2YKOA 4IO1A 4ECZA 2ROGA 3DLJA 3N6NA 3SBMA 3D1HA 4C0HA 3T41A 3TARA 1DJ0A 3MM9A 3DHXA 1JMTA 2MSTA 3FSXA 2H4YB 2U1AA 3NLCA 3ZZYA 1S1XB 4BCAA 5DDRC 3TI0A 1SJFA 2MZJA 2KT3A 1D8YA 1ZAXA 2E5LJ 3MUMP 1VQ6S 1RWPB 4LR8A 3KLVA 2NYIA 1X5OA 1G1XA 2QSFA 2RHSB 1S1UB 4F4ZA 3QT8A 3U1LA 2NREA 2MHNA 1RHJB 1N5QA 2DGOA 4MKAA 1RT5B 2BJDA 2HZVA 2YPZA 2O67A 3R5AA 2IVYA 2E1AA 3NBPB 1J5OA 5CXTA 4B3OB 5A8WB 2XNQA 4I2QA 2MZQA 4NLDA 4CO3A 5DDPC 1M5KC 4LFBF 5FDLB 1ZAWA 3MOZA 3P96A 2OEKA 2ZH4A 3QT5A 4ILLA 3D4JA 1VQOS 3CMES 4IR1A 1TL7B 1N33F 5F41A 4ZOSA 2VASA 1F1BB 2AJFE 2B5JB 1RCOB 4L73A 4PXCA 4Z37A 4M5HA 4YR3A 4DV7F 4A8MP 3LA0A 3SSRA 3KJFB 4URSA 3BSOA 2E7VA 5K14B 3K89A 2V67A 4DQIA 1KHWA 2RH3A 1WEYA 5J1PA 5IS2A 2ZH6A 4EWTA 3TVZA 4M5NA 3MM5B 1HNVA 3QT6A 3CSKA 3VHQA 4C8KA 1M5VC 4ZVTB 4M1KA 5C2CA 4QWDA 4WU3A 2JLGA 1T02A 2UXBF 3J80Y 1K47A 3IS9B 1YBTA 2VD3A 2BKOA 3DN9A 3FKBA 3I5CA 5ETPA 1B70B 3GZ7A 5E3RA 3CMAS 1UVNA 2OPSB 1R0AA 1RT3B 4PABA 2BEFA 2WZ1A 3Q8UA 3CJ0A 3TUIC 2NXNA 2MQOA 4P7TA 1Q7YT 4KIAA 2ZH9A 4D3GA 2YKPA 2ZE2A 1KQGB 2I1RA 4J90A 3AY0A 1WI8A 1VBZA 1PG5B 2MEWA 3CJKB 1YRXA 5A2QY 4FNIA 4WPAA 1HYSB 5D8HB 1U6FA 4E98A 4W90B 3R97A 4P74A 2HZCA 3IGVA 1IKXA 4DR7J 5M2PA 1N54B 1GMWA 3DU5A 1WNEA 3GSDA 4NRUA 2BZ2A 4USKA 4WBFA 1HNVB 2V2VA 3KYLA 3QJJA 3SZ2A 2M88A 3OL8A 2D9OA 4RLEA 2HWTA 4CLFA 1C0TB 1GTEA 4USVA 1WG1A 3BGUA 5F0UA 3US5A 4F25A 3GIRA 5F8MA 2KM8C 1MWZA 1ULRA 2OSQA 3AT1B 3GWCA 3P4UB 4HT5A 2GX8A 3OBIA 4OHYA 5E3PA 5A0YA 3IR7B 4CO5A 5HMZA 2EW9A 3AAWB 1F3VA 2VZ9A 3H5SA 3CCRS 1RAHB 3CEDA 4OI0A 1ZBTA 1PIEA 2AEJA 2OPRA 3G8TA 2VL1A 2YNFB 3BM7A 3F41A 4YHHJ 2FGOA 2AGPA 4X62J 4IOCQ 4DS4A 5J1EA 1UVIA 5C25B 2RIJA 3J7YI 3QGHA 4U6PA 3CCWA 1QDUB 1WHXA 2VPYB 1NK5A 3C2PA 2OGUA 2XMJA 2QN6B 1HNWF 1U1QA 3F44A 1RABB 2AJ2A 5JMNA 4DL4A 1CG2A 2L08A 4MIWA 4C0OC 1NHKL 3OXFA 3TX8A 4K4SA 2XMTA 3ZTPA 1HHSA 1LK7A 3HHDA 3RB4A 2VICA 4PYDA 4OYMA 5LMNF 1DQ9A 1VFJA 2ILZA 2FJAB 2F4VF 2DO4A 2UUCF 4F36A 1WC6A 2W8LA 2PI5A 3FCVA 2G4BA 3IWNC 3MUTP 2WSFC 4BWJA 2WAQD 2BJ8A 1RWNB 2WBRA 2WHOA 3DYAB 1V6HA 5LM7E 1HPZB 2BJ7A 2VG5B 4JI6F 3UCUP 5KT7A 3V81A 1HNWJ 1S1WB 3DLGA 4H4MB 5FJ4A 1WTFA 5HBMA 3VAHA 1NZ8A 1KHVA 1H98A 1WHVA 2NPIA 4Q44A 3SQOP 3Q0AA 2YH1A 1L3UA 1JLBB 2HKEA 5D4PA 3R5GA 2OO4A 3AQPA 3CCES 1FDNA 2UXCJ 1RP5A 4CH7A 2C3YA 1X9SA 2WK4A 1X4AA 1KLNA 2CQDA 4Y00A 4YP3A 1D3WA 2FHOB 4NLUA 1APSA 4X4UA 2H48B 4KV8B 4F04B 2DHXA 3UVJA 1O5JA 1B0VA 2BE2A 1FRHA 2B9YA 4ZPTR 1YSJA 4AXIA 1FJGJ 3P8BB 2FB0A 4OHZA 4K2JA 3TJAA 5LJ5Y 3PW7A 1QSLA 3QMQA 3C15B 4K4TA 3F56A 4U67Q 1HNIA 2XZTB 3GMGA 1R8PA 1S6PA 3P3DA 3MD3A 1VRTB 2JNJA 3R27A 2CQ2A 5KG5A 2YWHA 4K5RA 3K58A 3GIMA 2NSCA 3IXQA 2QG9B 3OR1B 2FUG9 4OZ5A 5DM7Q 1U0HA 3T9NA 2BANA 4K4ZA 3JB9k 4H4MA 2L48A 3Q86A 2X1AA 1YJNS 1DLOB 1RZMA 3BYPA 4FPRA 4X66J 2BE9B 2R8HA 1DBDA 2FD2A 3HZEA 4J9NA 1IBLF 3PHEA 3WHIA 5GADU 3MCOA 2MY7A 3BH7B 3SFUA 3AOCA 3CMQA 3NCRA 3DXBA 4KAIA 4P75A 2V4RA 2RDIA 4EYHB 4QR2A 2OPQA 4B08A 3BSAA 3BYRA 5KFJA 2ZOFA 1YITS 2JLEA 2IPOB 4DL6A 3C15A 5JUMA 3CCVS 2EFNA 5A8RA 1TAQA 4Y2KA 5K9FA 3OL7A 1O6XA 2LFVA 2XWXA 2LA6A 3TA1A 4PWDB 2XSJA 3V6JA 1MROB 3TA0A 4GO5X 4Y0FA 5DG9A 3AHPA 4CH1A 1RAGB 2LEBA 2D3O1 4IQXA 4H4KA 5K8MA 2MQMA 5A8KA 1NLKL 1FEEA 3BDEA 3N0VA 2YKMA 2B9EA 2C2MB 4QZVB 2MGZA 1XERA 1PSDA 3PACA 1QSYA 4JYAJ 1T9WA 3UR3C 2EWHA 1TUGB 4KO0A 4LR9A 2RAQA 4TXSA 2D41A 1RYSA 1G6BA 4U7CA 4QWCA 2W9CA 1Q4RA 1YRTA 4GO7X 5ETTA 3SDEB 4CLZA 4O0NA 4TQSA 5L1KA 1IR2A 2BQRA 4NCGB 4ECVA 4JI3J 1Q8KA 1IBKJ 1YGYA 1KDNA 5D0GA 3ETMA 5L9XA 3UFCX 2R9LA 4DS5A 4BDPA 1S0VA 3W60A 1VGYA 1RWXB 2HQGA 2GNKA 2DNOA 1YX2A 3B54A 2DGTA 1DTTB 1HW9A 2DGSA 2HAFA 3KFWX 3HP6A 4IRKA 1OIAA 1RB0A 3VGUA 1PILA 2J7UA 4P2MA 3KG1A 4BC7A 2MXYA 3J81U 1EX8A 2RQ4A 2CZ4A 2QL9B 3LAMA 1KFSA 1NHVA 3NMAA 4GKKF 1HBMA 1SUQB 2BMBA 2IYGA 3L3CA 2NZ4A 1LK5A 4WKRA 3LQVA 1YBAA 3I5BA 3OPKA 3QSIA 2ZDPA 4N8OA 4MT1A 4ZN1A 4TLRA 4ANEA 4ECWA 1UZHA 1JLGA 3BGRB 4Y3CA 4J9VA 3CJTA 3M8QB 4XDCA 2CJXB 2CJKA 4K4YA 3DFEA 1CJUB 4YR0A 3PR4A 3HSGA 2E1MC 3N5FA 1Y10A 9RUBA 4WFAQ 2MSSA 3FK4A 4BLGA 3VV2B 1HI1A 5HI7A 3VAGA 2ZE2B 3PX0A 1QE1B 2PMWA 1JLCB 2F7VA 5IT9U 4N47A 3M9MB 1RBOB 2QRRA 4Y2AA 3PJWA 2MY8A 3TW0A 2ZH7A 1SKRA 5SZTA 1RGVA 2HSEB 3R5JB 4KBIA 5T7LA 4F7VA 1W2BR 2W7PA 3DM2B 2HNDA 4B17A 3HK2A 3J7AN 1MROA 4KSEB 2CNNB 3S6EA 5KG4A 3W9IA 4TNOA 5GMEA 5A8KB 4RNOA 3KMQA 4KRWA 2YKMB 1R8BA 4RW4B 2MKKA 4KGZB 2IDLA 3IS9A 1T05A 1KSPA 3KLHA 1JLGB 3BGRA 4OHVA 5DQHA 2PFFB 3H2VE 2OAUA 4Q7AA 7AT1B 4LF7F 2HFSA 1KLMA 3NS7B 1REVB 2V69A 1IVZA 2B43A 5ETNA 4NCGA 4UOFA 2EEYA 1OQ6A 3ZTSA 4CNYA 2V2ZA 3QSYB 4W92B 3QRRA 1TV6B 3AD8C 3H98A 3T1YJ 3F73A 1LFPA 2CQBA 3GP9A 2XLKA 1WOOA 3BPDA 1BWVA 3DI6B 3C6UA 4AUKA 3CUNA 2F40A 5M2UA 5ETSA 2VPXB 4USJC 4JI8F 3N9UC 4QYRA 3SXLA 1U2CA 5AJ3F 1AYEA 2RUSA 2V50A 4NLVA 2A10A 3VAMA 4HLBA 4AL5A 1NXIA 3IMQJ 2KU7A 5A76A 1JQGA 2PA8D 1N5SA 3C14B 2CWKA 3CIZA 2ZH2A 4HHJA 2B8QA 3NBPA 4ZCMA 2V4QA 4DV1F 3PW0A 1J5OB 1DFDA 2HHPA 4AL6A 1WHYA 5IT4A 4AQYJ 2BXJA 2LLZA 2OMLA 1NBEB 2LQBA 2AV5A 2R4FA 5JVHQ 4NMXA 3G4SS 1IR1A 4RNNA 4FXDA 2YBVA 2ZBPA 5LSLA 1VQ9S 4YEAA 2IM0A 4DU8A 1ZS6A 4EK2A 1RTHB 2ZNZA 1GEHA 1C4CA 1WF1A 3MM8A 5EX0A 2B6AA 5AE2A 2F9DA 1FK9A 2BA9A 2GAHC 2QE5A 4ES1A 4LF6J 4JYAF 1RWMB 1XWLA 2V8VA 3W3SA 2HBRB 4OYOA 5EHHA 1SKSA 4JI5J 1P27B 2BANB 4ER8A 1NNDA 1TVRA 2UUTA 1S48A 2HK3A 2K06A 5GVQA 1BUXA 1X0PA 5C24B 3UCZP 5BYSA 1R89A 4ZS6A 1FRIA 1NCLA 3M30A 5DS7A 1TKDA 1RT6A 4C9DA 2PE8A 1S9GB 2XZWA 3AA9A 2EI5A 4HTIA 4LBHA 2HGMA 2M52A 4DJBA 2FVRA 4PQUA 2C2RA 3TAMA 3H8YA 4QYZJ 4DV4J 1SQFA 2J0SD 4DV2J 4J9SA 2IC3A 3VAFA 1RT1B 1K1SA 3ONQA 2KJVA 2CQHA 3A1YG 4I7FB 3VVUA 4HH1A 4NWBA 4RPFA 4CM2A 2RRAA 4DR5F 2PT0A 1HD1A 2EBEA 5KFMA 4DPYA 3KXDA 3W64A 4RR5A 2IAJB 3KUEA 2ASDA 2DRAA 1XR6A 2KL8A 3A12A 1MU2B 3IP0A 2DITA 1TR0A 2J5AA 1U47A 1HWIA 3D3CJ 4R25A 2AX1A 1NPRA 1R43A 2ZNYA 7FDRA 2V8GA 4I6YA 2H65B 3BGFA 3GR1A 2AJ1A 2WOMA 3SEOA 3ZFVA 5KFWA 2CQ3A 3UDLA 2UV8G 4LSNA 5ETVA 4B9NA 3PM9A 3T5HA 2Z2YB 1G7CB 3UD3P 2NPFA 2VFRA 4DX7A 2D69A 2EFPA 3IRXB 3OVSA 3JSMB 1JLAA 3HVWA 4YB7A 2VOPA 2F1FA 1NJIT 1WDTA 3KLFA 2HS0A 2XMMA 2YPYA 4L72B 1K0TA 2XMAA 2LKZA 3ULHA 1IR0A 1HHTP 1HFEL 5AE3A 2XGQA 1WC1A 4DV7J 4DPXA 2D1CA 2VDHA 3NCPA 3CO9A 5L9NA 2UUCJ 3LANA 3OT9A 3UN3A 2BE7D 3S1TA 1KP6A 3BJYA 1RWKB 1OO0B 4LFAJ 3K8WA 4P6QA 5B0FA 1F6TA 3BR8A 1ROFA 2K3IA 3EMTA 4AFFA 5CD4A 2E9RX 2AHOB 3I0SA 3EPGA 1S9GA 1L5UA 1RUSA 4K4VA 2GV1A 4RZRA 2DNKA 3N6LA 1OJ4A 4OI1A 2UXCF 4Q8FA 5AXNA 4EBDA 3ETOA 2C2KB 2MQLA 1BMQB 3D1QA 3OHBA 2APOA 4QQBA 4B3SJ 4FVCA 3UR0A 2ACYA 2FY1A 1REGX 2LU1A 3EXCX 2HAIA 3RAMA 1UJ5A 2E5HA 4UY85 5LL6d 3W5XA 2EC0A 1IUJA 2RJZA 2DR6A 3Q23A 1SUQA 2MHEA 1SQEA 4X4TA 1VQKS 2XNRA 1OPIA 2MDAA 4U7UD 1VIXA 2CPFA 2N3LA 3MM6A 3S7RA 3WIVA 4JI7J 5EWGA 3AXKA 1WOPA 4USHA 3DLLQ 4A8SA 2FHJD 4B9VA 4JI0F 1UEUA 2WBMA 1FKOA 4A8KA 4RW9A 2HFNA 2AJ0A 2B4VA 2LDIA 1LW0A 1X4DA 2JRSA 2MLYA 2NXJA 3DC2A 4A4JA 1H38A 1RLCL 1TL7A 1URRA 1NPPA 2RDJA 5A6WA 2IJRA 3AB2B 3R5CA 1VQLS 2POKA 1UP1A 2V9WA 3I9ZA 4IUFA 4DPTA 5IFMA 3KK1B 2FVQA 4MYUA 1YTYA 2UV8A 1CC7A 2YNHB 4LSLB 4UUXA 3EVOA 3BKFA 4WE1B 2BQUA 2FJVA 1IWGA 1VHIA 2KO1A 3VR1A 4WZMA 3QJLA 4X4OA 4I64A 4H4KC 4LRCA 4DQPA 2VBZA 2HHHJ 4RKUC 3QJPA 3DDKA 4X62F 4JP8A 4S0MA 1OQ3A 1RAEB 3MM6B 2V9KA 2VBYA 3NEKA 4KH0B 4MK7A 1FXRA 4HT7A 2XMVA 2I5JB 1SH2A 1SL2A 4DSKA 2CQ1A 3UVJB 2RRBA 1GT8A 3QT7A 4NLYA 3V2UC 4ALZA 2AEFA 2VBWA 2ZVSA 2XS7A 3CJSA 4IYQA 3BDPA 4ZMMA 2VOOA 1E6VA 1NK7A 3TANA 1HIYA 2V8PA 1WEXA 3K5PA 5IM0B 1RT7B 3MAAB 2IM2A 3PW5A 3DI6A 4KKOA 3NGUA 2O5DA 4O3OA 3SFGA 2BVZA 3UDEA 5KFHA 2XLIA 1N4LA 1K73T 3NMRA 4NLOA 4OHWA 5HBMB 2XGPA 5IXUA 4UY8T 1FJGF 1YBUA 3VQSA 4DR6J 3P6YC 5IT9Y 1B0PA 4X65F 2VHGA 1TP7A 1X7VA 3AFGA 2OKQA 3NRBA 1IJEB 4WYWA 4C11B 3MFHA 2J0QD 2PEHA 4L75A 5A8WA 1WC0A 3BSCA 1HR0F 4FYVB 1REVA 5KT2A 2DIUA 5AXKA 5DLFA 3PZPA 4WK3A 3A8KA 1F2GA 4F50A 3M7VA 2ZZNA 3KG0A 4TY8A 1D9AA 2ACMA 4NLTA 4KE5A 2I5JA 3V6HA 3A8EA 2XC9A 1LW0B 3EM1A 4JI3F 4HEA9 4CP5A 1SV5A 1B64A 2BW7A 3JTOA 1CJVB 3UE2A 2QL7B 1KC8T 4PXDA 1DY3A 3DLKA 5GMDA 4ETXA 5B0DA 3KLGB 2ZJRQ 1T7PA 3P49B 4ED2A 1HR0J 5KT6A 4WE1A 2N3OA 4XPCA 2HS4A 2ZBQA 1OYEA 3RAXA 3PYDA 3M8RA 1HNZJ 2CKWA 3JAMU 2QLFB 1BXNA 1RJJA 3M8SA 3HVRA 3LO3A 1C1BA 5AXLA 2LVWA 4ED5A 1RKIA 3TZYA 3UI3A 2AGQA 1XMQJ 4TU7A 4IG3A 4X66F 2B7CB 5J2QB 2DNNA 3TZXA 4DUYF 3HJFA 5KFYA 2E7WA 4DR6F 4NRTA 5J2MA 1AT1B 2NYHA 3C16A 4DLEA 4N41A 2YNIB 1TMMA 1LNQA 1A9NB 3NGRA 4CM0A 4PG7A 2E66A 2K1RB 3G8SA 2WRMA 1RWVB 1Y4ZB 4ECUA 2E5IA 3LW5C 4YY3F 4DHVA 4DFPA 2VBXA 2C42A 3MPYA 1XJWB 5F9NA 1TFWA 3Q2TC 4DX5A 2C3PA 1RU1A 2MQPA 1KONA 4Q43A 1J5EJ 3FEYB 1UL3A 2F4FA 4DV3F 2ATLA 1IBMF 1H3DA 4JV2A 3PEHA 5HSPA 1RISA 2LECA 5CABA 1Q8IA 4NZ6A 1PAEX 3TX0A 4CDIA 2QA1A 3OW2R 1N32F 2C28A 1NDPA 2H54B 3CC7S 2DNZA 3WX4A 4JI6J 4C7QA 1NPKA 1SC6A 2X3GA 1AROP 2YKNB 3EGVA 2WOMB 3MUVP 5B0AA 1YWXA 2KRRA 3CULA 3K0JA 2YNGA 3MEDA 4WTOB 2FHJA 2ZHOA 1T95A 2OTLS 3M6VA 1TL3B 1FESA 2E7XA 4USMA 1F9EB 3FGVA 4YOEA 4GMKA 3Q83A 1FKPB 1JLCA 1JLEB 1LW2B 2RT3A 1U8WA 3HDSA 4JB8B 2NQPA 3EX7B 3B78A 1JLQA 1TFYA 3RG6A 3DRSB 5ADZA 1EP4A 1Y0HA 1S1XA 4IO9Q 2BQ3A 4F4XA 1PYOB 3FRYA 3Q8VA 2W24A 3UN5A 4FF2A 3B6BA 4ETZA 3WZ0A 1MU2A 5KFOA 4GKJJ 5DLGA 4CO2A 1FVSA 1S1UA 5KFZA 1NJZA 4ENOA 3D28A 3PW4A 5E5NA 5HO4A 2LYVA 2COLA 5GAEI 4AXJA 3BKTA 3DGPA 3E01B 1KQFB 2FVSA 1DTQB 1E6YA 4QIFA 2KN4A 2P6TA 1W7WA 3CD7A 3JQJA 2Y1RI 5CYMA 3R7SB 4KQZA 4NEZA 2JFKA 2KJWA 1WACA 4YDXA 2CQGA 4EO6A 2GHVC 4EI2A 1Q5YA 2J6SA 1S76D 3H0PA 1RTIB 3W7BA 2GJFA 2XI3A 5KG7A 4TU8A 2KKHA 1IBLJ 1GMWD 3SV3A 1WSRA 4WFBQ 4X2BA 2IYIA 3KG4A 1R6YA 1C0UA 4NI2A 2F8HA 4V19J 1FK9B 1VQ7S 1VOMA 3L7PA 3RB6A 2NXUA 2XI2A 5HAOA 3PYGA 1S97A 3MM5A 1RT5A 2XZDB 2Y0SD 3UD5A 4CLWA 2O3DA 5A6PA 3CJ3A 2YY3A 3LP0A 4O4GB 5I3PA 2NSBA 4C8LA 4USWA 1XC9A 4E0DA 3GLJA 4CLSA 5KFEA 2EG2A 1GX5A 1SVDA 2HIQA 4IG0B 1LWEA 3DLEB 2DNMA 3JS9A 4LVOP 4W4MA 2DNQA 2B5JA 5L46A 4XIUA 4O44A 3RW6A 2HLTA 3A3NB 4OI4A 1ACMB 2A6OA 4I4BA 3J7A1 2VA3A 1S1VB 2FZGB 4DR1J 4NLWA 4QR0A 1I94F 5B08A 2KI2A 3B4DA 1WELA 2JWNA 2NLWA 4RUBA 4DPWA 5K8NA 3T5KA 1N0VC 3CCMS 1N36J 2YWFA 1EP4B 1VMBA 2W2PP 3TQEA 3M32B 3L7OA 4PQAA 2OJ3A 4RBUA 3BN4A 3WC2A 4RL1A 3AH6A 2ZHAA 4B3MJ 1ZAVA 4J9RA 2J0XA 4GVBA 4OV1A 4J9LA 3QATA 5DDOC 5T14A 3HHLC 1RKJA 1S57A 3OD2A 5ETRA 4M5JA 5ETQA 3I56S 1YJVA 3EE3A 3HSZA 4DLGA 2AGOA 1KVIA 1JKHB 4DMZA 2RU9A 2IA6A 4DR1F 4ZPWR 1WJ9A 3I4HX 3PDNA 4IFYA 1H2TZ 3THTA 2FY8A 3WDOA 1FKAF 1VS3A 3MEGA 3D6TB 5J2NA 1VQNS 2DGQA 3MAQA 1L3VA 1X5PA 2XS2A 3CNQP 2MKHA 3BZQA 3DCAA 3PKYA 2FLNA 4F26A 3BR9A 3HJVA 2M3DA 2GHPA 2LXUA 5CZVA 3KLFB 2K3KA 4UTGA 1IKXB 4DI6A 2ZH8A 1U6BA 1V5IB 3AD9C 3DM2A 5EWEA 4K4WA 4PYAA 4ED7A 2JHEA 2HRTA 3RZAA 1VQ5S 3WX8A 2VG6B 3UNGC 3PW2A 2WB4A 3ZZ0A 3TQ1A 2OLWA 4C97A 4F0HA 4DUZJ 1MWQA 4FN5A 3O44A 3IBCB 5B7WA 5H1SV 3QO9A 4ZPBA 5HMXA 2EXUA 3DRRB 3CDUA 2HVZA 3H5UA 1X60A 4DR5J 4DG1B 1B7YB 5DJBA 4ID5A 2MZTA 1KNZA 1VQ8S 4DN9A 4LF2A 2OTJS 3RYLA 2DK2A 3CJ5A 3LF0A 1YQHA 3M8ZA 2G0JA 2D74B 4FPIA 2UUBF 3QLHB 4B9MA 1VC5A 2MMYA 2YQ1A 1AB8A 2HQ3A 1ZTTA 3W5ZA 3PJXA 1P6TA 1N5TA 2B7BB 2V4JA 4Z2XA 4HYKA 2JEIA 1YG0A 4ZPAA 4WP8A 2W9AA 1FDDA 3GFZA 3VAKA 1U1NA 4I68A 1JK9B 3GILA 5HQ8A 3DGVA 1XR5A 2EK6A 2GVZB 2XSFA 4DDFA 1RSCA 4MIAA 4I6AA 5KFQA 2M8DB 2NXCA 2YX7A 1FWLA 2ZBCA 3B4MA 5KG3A 3RJMB 2W2QP 5JJBA 1TL5A 1U1LA 3R5BA 1CQNA 4C8NA 4C48A 2JDJA 3TJ9A 3VGVA 2FC9A 3HHEA 4R5PA 1HARA 1VHFA 2F4VJ 3ZZUA 3THPA 1QTNB 2ATCB 2FJBB 3O2IA 1B3TA 4HACA 1SB6A 2MZRA 2Z56B 3CGIA 4I2PA 1D9FA 2E5GA 3CIMA 3I31A 4F0KA 1HQEA 2IM3A 2PSZA 1PYTA 2QT7A 1Q1KA 2CA9A 3EDRB 2ILYA 5E33A 1DARA 5KFTA 4QIWD 2LA4A 5DG8A 4Y6IA 4ECXA 2Y1IA 1FE4A 1QUPA 2DCLA 2DH9A 2IM1A 2MKSA 4EU0A 1R27B 5F3TA 5GADI 4JI1F 3WBZA 4LF5F 3H90A 2DJWA 3HLUA 3QNWB 1C1CB 1GMUA 1HBOB 1HL6A 1NDCA 1UZDA 4X64F 3Q8PB 1UKUA 3AODA 3M30B 2BE2B 4J9PA 1I6JA 3RTVA 4PQUB 3OSNA 2HURA 2XULA 1JXVA 4P52A 1PC5A 2DXEA 2R8IA 2DNRA 3JAMY 1RA6A 2JSXA 5KOXA 5ETLA 3CCLS 2V5HG 3G82A 1SPBP 3TNVA 2I6WA 4FF4A 2DB1A 1RT7A 3MAAA 4LSLA 1F0XA 2YQ3A 2ZM6J 1FTRA 5FLXY 1GQEA 2HHWA 1NJXA 2DO0A 2IJFA 3EICA 4RW8B 1CJKA 2JC1A 2CAJA 3HCXA 5GAEU 4Y2CA 1VK8A 4BHQA 2G13A 2EFOA 2DY1A 4PRFA 4F02A 2RUGA 1RTZA 4ES3A 4DQSA 2CADA 4TYBA 5CZXA 1Q8BA 5KFNA 4N56A 4GC6A 2C22A 1PJ7A 1VRUB 3PFOA 1L3SA 3DU6A 2UXBJ 3FNNA 2J9CA 1U1KA 4NCAA 1MNEA 1U02A 3K17A 2LMIA 1Y7PA 1TKTB 2W2MP 2ZOGA 3M8PB 3PEJA 4G1PA 3HSJA 1VJQA 3NWGA 4I67A 1FRJA 5K8PA 4ED4A 1FA0A 3GG0A 2ZVIA 1HQEB 3I96A 3MMAB 4DV1J 1X4BA 3CD0A 3ILIA 1X31C 2FHKA 5J1EB 1VC6A 2HNZB 2GVDB 3FUYA 3LGNA 3M32A 3OTOJ 2XY5A 1S72S 1TVRB 3ILLA 4IQMA 1S79A 4QIGA 1FRMA 4NASA 4RJVA 3UW1A 2V68A 2VFTA 4DPOA 3MGJA 8AT1B 2QLBB 1S6QB 4DL7A 1N6QA 4K4UA 1M0SA 1TTHB 2FVCA 2PO4A 1TL1B 3CT9A 3PHTA 5GAGU 2RILA 4IDKA 4IFVA 5LJ3Y 2C2DA 5E41A 2CPZA 4HHUA 3PCOB 1C1CA 3V4MA 1X9WA 1HQUA 3BF4A 4ZVOB 2JEFA 3KNAA 2SXLA 3W2WA 3KWMA 3FDSA 3LH2S 3AJ2A 3ISND 2FDNA 4DBQA 4W98A 3IR5B 2JC0A 2YX4A 2ZC4A 4OX7A 4DUYJ 4Q0BB 1WG4A 1DURA 4PUOB 4G1QB 4LF9F 3OUYA 1EKSA 3GYNA 2M5YA 2DPIA 5D15A 1FXDA 2EG1A 5I4MA 1FT8A 4M5GA 1FXLA 4MKYA 4EBCA 4YY3J 1Q86T 1F5AA 1S0OA 1YJTA 3KK2A 3KNGA 4Z7YA 1WORA 3FZBA 4DQQA 1RTJA 3LP1A 4WJBA 1BGXT 5DQIA 4N77A 2OMOA 3K8VA 1RCXB 1S9EB 3J7Z5 3ZZZA 1EQMA 2BM0A 2B4OA 3HHKA 3W2VB 1RT2B 3H2LA 1GNKA 4RO0A 2OHDA 3PIPQ 3OFFA 3HT0A 4LF9J 3OJSA 3RBDA 1CJTB 3FCWA 4M5DB 4C98A 4EO8A 4RUCA 4O0IA 4DV6J 2PDAA 1LQ9A 4NLSA 4OLPA 3TUPA 2EFGA 2KHDA 3D0IE 5H9FK 2AWZA 1FRKA 4QU6A 1NH8A 2N82B 3M2RA 3CJ8A 4WCEQ 1I1GA 3D66A 3PRBA 1X4GA 5AXMA 3E8OA 4MTPA 2QZ8A 3E2EA 2PN6A 4OI6A 4ZJLA 2WTFA 2CRLA 3BB5A 3EDQB 1PGZA 1SC4B 1S6QA 2ZFHA 4GKJF 3EJMA 2HG4A 1OSCA 4KC5A 1SIZA 1H7XA 3DRRA 4ICLB 4IR9A 3CDBA 4F3QA 4ECYA 5L1JA 2ZDOA 2ZC3A 1JNZB 2DHHA 3MCSA 2VONA 1RAFB 4OYIA 3BH6B 4I6WA 4D3HA 1U26A 3CJ2A 3SMZA 2YNGB 3MEDB 1OYDA 2FJWA 2HMIA 2W9CB 5A0YB 2VODA 2J9EA 3ZZPA 4MFBB 2IRYA 2DXFA 3QYYA 1KQKA 5K5MA 4CWBA 3OUYB 1S1TB 5KG0A 2R2TA 3GONA 4PKDB 3T3FA 2RQKA 2V4JB 2YWGA 3M8WA 2WONB 1RHRB 4A47A 1RU2A 4DL0C 3GE9A 5KFFA 2C3UA 2CJ9A 2M4MA 2KFZA 2Z0GA 3V6DA 6FDRA 3BO3A 1SH0A 2DNLA 4C6AA 2W01A 2BJ1A 2D9PA 4GC7A 1AXQA 1U48A 4ZP6A 1JLFA 2QFIA 4DWIA 4C0BA 1RHMB 3MEEB 4OJGA 3G71S 3W66A 1H2VZ 5HP1B 2IBOA 4LR7A 3OXLA 4CO4A 1RT2A 1TQLA 3W2WB 4DCJB 2OPQB 4O3PA 5KAKA 1ZM9A 4K0KJ 1LWXA 1IKWB 2QMWA 2BX6A 4FYWB 4PG6A 4PWUA 4I69A 1YK9A 4RW7B 2BYCA 2VQEJ 1Y5NB 4K50A 1HD0A 1TKZB 2CPJA 3AJ1A 3FFIA 4NL5A 1H0HB 5CYQB 3NXZA 1HQ2A 1SQGA 4PXEA 4OJ3A 4WFZA 3ZC4A 4ZKAA 3CB4A 4KKOB 3FZ2A 1NRKA 4Q2LA 1KRPA 4UF4A 2HPUA 4ILMA 1BQMA 2ROPA 2AU0A 1CEZA 1WOSA 2XMUA 1U7LA 3UN2A 1GK8A 1KOOA 5F8IA 2VJUA 1X0FA 4JV5F 3L95X 4L3NA 4J9UE 2H5EA 5ETMA 1XMOF 1JXLA 2JFDA 4JI8J 3ISNC 1NK0A 2MPUA 3BEGB 4Y2IA 1EARA 1KLMB 2M0GB 3BBFA 5KFKA 1FD8A 1UWAA 4KV8A 4DUZF 4DZ6A 1OS5A 1S7IA 4R0JA 1K1QA 3UD4P 2DKOB 5BYQA 1CS4B 2GIRA 3DRXA 1ZH5A 1WKKA 3P5TL 1YIJS 3CF5Q 5D77A 3HT3A 2O1PA 5F8LA 2Y1LB 4R0EA 5E3AA 4XTTA 3DOKA 4WXOA 2RU3A 2HVDA 4NXNF 4KFBA 3KTQA 3DLGB 4X4NA 3ENVA 2HS3A 2GMJA 3OTEA 4ELTA 1XBWA 2CNOB 2KB2A 2NS1B 1U1OA 5BR8J 4TY9A 1NEEA 1WI6A 1GH8A 3Q89A 4OQJA 4ICLA 4LIWA 2HEKA 4C8OA 4TKTA 4Y34A 2UXDF 5DG7A 2VC1A 3EZUA 3UWTA 2Z30B 3TVKA 1VRUA 1V3RA 5KFAA 3T6JA 1WF2A 1H74A 1EQ0A 1GFWB 3TZZA 3HMJG 3GIKA 1Y5LB 3BBBA 1AFJA 4DV3J 2MLZA 2UU9J 4OZ0A 2CQIA 1O0PA 2YXLA 4L3KA 2VU5A 3T1HF 3LAKA 2HHSA 5DO2A 2C3MA 5T7LB 2K1RA 2CWXA 1RT4B 2OPPA 3HVTA 1BC6A 4B02A 2OEJA 3GG1A 4K5SA 2JEGA 1F2HA 3EUNA 3Q8QB 2VV5A 3C6UB 1QAJA 4MMOA 1PCAA 1FWPA 4MK9A 3EZOA 3MPUB 4YUDA 3OVAA 1FVQA 1P1LA 4DFJA 1Y9OA 4CT8A 3KLIB 1VC0A 3IO1A 5C42A 4KPYA 4U8YA 4YDDB 7FD1A 3F0NA 1EETB 1GXTA 2RS2A 4MK8A 2AZ1A 5C7PA 2KT2A 4BBYA 3GJTB 3ITHB 4LFBJ 1KFDA 1D9DA 2ZBRA 3ILJA 3KJNB 4KO0B 3N79A 2PMZD 3OFHA 3GIIA 3K59A 3M1VA 2YH0A 1FKOB 2XO6A 2Y9HA 1RK8A 2BABA 2MYFA 4Q45A 3DOLB 4ED1A 5GAHU 1TKXB 3I6PA 4OI2A 3T19A 3TJ8A 4Q0BA 3X1LB 1RT1A 3LALA 3MR3A 1UFKA 4X64J 3DRSA 3HX9A 4YB6A 4LRFA 2XSJB 4NA2A 4RWWA 4ZVEA 4DOZA 2DXDA 2CJAA 1C4AA 2FGCA 1DHMA 1NUEA 2CDQA 2CJYB 2V8DA 5L39A 4ES2A 1UWBA 5C25A 2ZH5A 3HO1A 1VCTA 4DR4J 3W62A 3NCQA 4NA1A 2CG4A 4PPZA 5C42B 4NXMJ 5KFLA 5CCMA 1EJ7L 4ECRA 2R7QA 1AW0A 4LF1A 4H4OB 1S0NA 1BD6A 1S9EA 2CNKB 4USUA 1FFGB 3GR0A 3E51A 4PCQA 5E7OB 2F9JA 2PC6A 3NL0A 2XYPB 3H59A 2RKIB 3IWLA 3SDEA 4CH0S 2V8HA 1UFWA 4P9SA 1U6ZA 2CVIA 2GAGC 3QIDA 5B0GA 5IQQA 4N5SA 1OWXA 3CCUS 3THVA 4NLPA 2ZJQQ 4F3MA 1ITPA 3UPFA 3DRPA 2EKNA 3OTDA 4PPDA 1YZ7A 2GZOA 2MKYA 5IC6B 4PWDA 5IM0A 5KT3A 2BRKA 5HL7Q 2OPPB 2GGPB 2QO3A 1SCJB 4OYWA 4U8VA 1T8EA 2W7AA 1N32J 3KHRA 1Z2ZA 3PO4A 2DGVA 3JSYA 3BGLA 4DN0A 2DGXA 4J91A 3I0RA 1OY8A 2JZ5A 3G6ES 1YKWA 2J6TA 4F8RA 2ZZMA 1YJRA 4DV0J 1JJ2R 3QWUA 4B3OA 3MR7A 1IJFB 3RUBL 1ZM3A 1HW8A 4P10A 2NUUG 4A8WA 1RT6B 3TO8A 1K0VA 2DR7A 2YVSA 2JVOA 1BHNA 3KUHA 1IQZA 2MQQA 4LSNB 1T3NA 2HFOA 4IRCA 1HMVA 1TMJA 3SQGA 2BOPA 3NS5A 2HFUA 3BQ1A 5KFCA 4ZVPB 5KTQA 2ALZA 2M70A 4B3MF 4FKYA 4DR4F 4L74A 4USIA 1OY9A 3D68A 1HKAA 2L3MA 2ZOMA 3G82B 4FDFA 5DGBA 1AA1B 3G6YA 2YWWA 2KFNA 5F8NA 1QAIA 2GW8A 2H4WB 2R7RA 3CDEA 1VBXA 1R8AA 4YHHF 2X7IA 3OV7A 1HPZA 4ZVGA 3T9ZA 2WW8A 3DYAA 3EVMA 1UPMB 2ZWOA 4DV0F 4ZK7M 2CNLB 5I3QA 2KVQE 1WSVA 2C2OB 3MMBB 5DRKA 4X65J 2UU9F 2HHXA 3BV8A 4ECQA 2R7XA 4DUTA 3TR5A 1X4FA 3AD7C 4N7TA 2MJUA 4AD6A 4CO0A 1XQIA 4ZLLA 1PC4A 3KLHB 4HHHA 1RAIB 4DL5A 4KYZA 3W63A 3JTPA 3G96A 4DL3A 3PX6A 1ICEB 4NYOA 1WWHA 1VQ4S 1FO1A 2AIRB 1WD6A 1YLXA 2ALYB 2AP6A 4F67A 3TAPA 4L76A 1KTQA 1Q5VA 4B3RJ 1HBUB 2D7SA 4OIXA 5B0EA 2Q6CA 1VK3A 4C2MA 1Z2LA 1GMVA 1TKZA 2GMHA 2RHQB 2ZD1B 5J2PB 2DR8A 4RW7A 4CI0B 3D6MB 3CXCR 2ZUAA 1UVJA 2ZBIA 3FFIB 1Q79A 1R0BG 3RRKA 2R2SA 3Q22A 4DF4A 2RDDA 3IR6B 2E9TA 1U1MA 2MZ1A 2DRDA 3IC1A 3QFWA 3VTIA 4A8OA 4P2XA 4UW2A 3M6UA 1HWJA 1S1WA 3CCQS 1N34F 4JI4F 1N34J 2HVHA 1X8DA 3IFEA 2M8HA 3KUGA 2O66A 3SCKE 1HHQA 1L3TA 2FQQB 1B4SA 2KT5A 3R6GB 1X4EA 3PVXA 2CDRB 3NGKA 2MTLA 2JH3A 5LT5A 3KJVB 1YJ9S 1VBKA 3Q8RB 1NO8A 2IRXA 4C3MA 4OX9J 2J76E 2K7KA 1G4CA 2QYGA 3D67A 1WC4A 3DDNA 4AYBD 1FJEB 1SJRA 4LFAF 4YN3B 4EGLA 2HGNA 2KXFA 4OZJA 4JV0A 2OD4A 2A2DA 3IGNA 4DSLA 5F0WA 4ZHRA 5KT5A 3H7HB 1T11A 4OYBA 1FNMA 2E1PA 4CQ1A 2O01C 1B0TA 3FJ2A 4TVAB 1C0UB 1NMEB 4NI2B 5GMKa 3O8WA 3EWGA 1RTJB 5C5JA 1IBMJ 3MR6A 4PXBA 2XS5A 1CSJA 2BOAA 3L09A 4ATNA 4YFUA 2XHWA 1S59A 2R2RA 3KLIA 4DV4F 3DLHA 1FCAA 4MKBA 4YS2A 1IKYB 2BW2A 4ZVQB 4ZVUB 2AT1B 1C0TA 2VQFJ 4G6VB 1R0AB 5BXIA 3V5RA 1WTBA 4ELUA 2G2YA 4P7VA 3JQMA 4JI7F 5D3GA 3TWZA 5BJRA 4ZCIA 1R0CB 2BKPA 3TOQA 2VIHA 2QA2A 3GB0A 4Y2MA 5E0OA 4JI0J 3CJRA 1CBKA 2A1BA 3DRYA 3IAS9 3VQTA 3JSMA 2D3ZA 4DU7A 2B9WA 3ZZRA 3SSSA 4M5KA 2GJIA 3AXMA 1R8HA 4PG8A 1SXLA 4QWBA 1WHWA 1XNQJ 1PYSB 3DLBA 2AF6A 1Q53A 2EFQA 2XMWA 1S5ZA 4FXVA 4E2FB 1F60B 2A2CA 1V3SA 1NKBA 1QLNA 3MCMA 4IH7A 3R1HA 2WVFA 2MB0B 1SC1B 3BREA 3MPWA 1QVGR 1ZPWX 3TEGA 1BQXA 3LPYA 3J81j 5F3ZA 2QLWA 3MECA 3N6MA 4KGXB 4IG3B 1EZZB 1W26A 1NKCA 2DEJA 1NDLA 3M2VB 3U27A 2YKAA 2RF2B 4F0MA 1VDHA 2YTCA 4WFYA 1AFIA 1M1GA 3D0GE 2VQEF 1J2VA 5DZ6A 2A6MA 3ZTRA 1XNQF 4PG4A 2WSCC 2F63A 5K14A 2WVEA 2R2UA 5L1LA 4DSIA 2BJ3A 2V2QA 3HKZD 4NZ7A 1RBAA 1CJKB 1NM2A 1KQSR 1NB7A 3FBEA 1T03A 3T6BA 1S12A 4FZVA 4GVBB 4MYTA 1VLYA 2C3OA 3FBBA 4LF8J 5GAGI 1LV5A 4B3RF 3V4IB 3MR5A 4UOGA 4NXNJ 9ATCB 4R8UB 4B9TA 3RBEA 2IJNA 4IFVB 2JOQA 2E44A 4JBCA 1FJ7A 4TY8B 1C2PA 1N88A 4DG1A 1FFSB 2MQNA 5FD1A 3DXSX 3DNCA 1CVJA 3HHNB 5AT1B 2XEXA 4G65A 1K8AT 3ENWA 4O3NA 5HQLA 3SV4A 1S6PB 1RBLA 1H7WA 3NNHA 2NUHA 2R7TA 3OHAA 4DR3F 2YWEA 2YQ0A 3X3UA 4P2FA 3CO0P 2BM1A 3PY8A 1K44A 3SI8A 2M7SA 2X1FA 2QGFB 2NR0A 3HHLB 1FEHA 1VR6A 4IDKB 1R7IA 1PBUA 1M5HA 2DGWA 2DTJA 4H54A 4U7UK 4DR2J 4NCBA 3R1LA 2XWYA 3NWRA 2VFVA 3C3LA 1IKVA 1EKRA 3MD1A 4JOUA 2V2KA 4JI2F 3DRPB 2FLLA 1RTIA 2ZUGA 2BUNA 3BO4A 2MQ8A 1CC8A 1FKPA 2R3VA 1UAWA 2E1CA 2XB2D 4OZNA 3DOKB 5CCLA 2DEIA 3G6VA 1S77D 2P2CB 4QW9A 2UUWA 3GYGA 4MJKA 2CZ9A 4ZLPA 2X3DA 1U0HB 1XTZA 2OFHX 4TN2A 3MMJA 4P2SA 1QD1A 2WSEC 4OLOA 5T41A 5KFUA 1T03B 3T1AA 4DSEA 4ZPVR 3QRQA 2RQMA 2AKWB 4OV6A 3R6LB 4FS1A 4LT6A 4URQU 2KH9A 1YRUA 3I82A 3M8QA 3NKYA 4FYYB 1M5OC 4F2RA 2DBBA 4CLPA 1LXJA 4ZJQA 2H3EB 4NEYA 3CCTA 2XY7A 1XMOJ 5F8JA 4NXMF 3PRDA 1SJ4P 4LVNP 3RGIA 3UCGA 2FIUA 2CPEA 2HK2A 4U96A 5D78A 4QPXA 2ZJPQ 2UUAF 1TUVA 2QMXA 2D3UA 3QZ8A 3T5JA 2LDYA 3N28A 3NP5A 4N76A 2BRLA 2K7JA 2B56A 1H73A 3CC4S 2YNHA 3HZGA 3QPIA 1N52B 2LU2A 4F4WA 3G8QA 2VPZB 1U24A 3MTKA 1PJ6A 2ZKTA 4ZPCA 5CD4H 2QEXS 1LEOA 3V81B 4B9SA 4UUWA 3MEKA 1MW7A 4LMZA 4C4WA 4ZJOA 1D1UA 4IOAQ 1ZOTA 3KDOA 4ED0A 5HLFA 6FD1A 1EETA 1XMBA 2I38A 5HMWA 4M94A 2AX0A 5IT0A 4LQ3A 4R8UA 2HQIA 2UVVA 4ED8A 2GJ2A 3GFXA 1N5YA 4NLQA 2DD8S 5HATA 5LXRA 3BGOP 3H42A 1CJUA 4X4QA 4LF7J 1QAYA 5IC4B 3CTRA 3CC2S 3DDIA 4FS2A 3CVKA 4ECTA 5J2MB 4ECSA 2NCKL 4ZP9A 4KR0B 2GHWA 1UJ4A 2L9NA 4OYXA 4FYDA 1XMQF 2RMLA 4RUAA 1NK8A 2WONA 3QRPA 2HHTA 3M2UA 1AZSB 4A46A 5HK4A 3JYTB 4DFMA 3CE8A 3J7YU 2JVRA 1VQSA 3OFGA 1M90T 4LFCJ 2F8EX 4CLTA 3K5LA 3HF5A 2EFVA 2UVUA 1GXLA 2CIMA 1TK8A 2AEMA 5KFGA 1URNA 2QMUB 3ITHA 2IA0A 4CTAB 4XPEA 5HROA 1FHTA 4OYAA 2FJEB 3R3TA 3KHHA 4DSJA 1UTAA 4K7QA 2Y8YA 1JWWA 3NAHA 5DETA 1SJ3P 3DOMB 2YKNA 1I51B 3HM9A 3FMWA 1NKEA 2AZ3A 1RDRA 1SI9A 3Q24A 1IKVB 4NPOA 3GPAA 4YMEA 2Y1JA 4JV5J 4QJVA 3M8PA 1H2UX 3TVYA 3RBZA 4ZHRB 2R7UA 2N4CA 2Q66A 3MM9B 5CQGA 5B0BA 3H20A 2Q3PA 1VRTA 2Q1LA 2QTWA 1YI2S 3CW2C 4UZCA 1WUUA 2V94A 5KG1A 4NA3A 3UDVA 2U2FA 3ET6A 4DR2F 4LSZB 4PEOA 2E5JA 4DX8H 2W25A 5HLFB 1M1KT 1LWFB 3G2XA 3WQPA 4ZLJA 4JI5F 3D0HE 2CJBA 1C1BB 1X4HA 2HGLA 4KHRA 1HBNB 3WC0A 3EYZA 3BBCA 1U09A 5C24A 1JKHA 1LWCB 3K2YA 1ZA1B 2RE1A 1NSAA 3ENQA 4NX9A 5HVHA 2M9KA 2KHCA 1OPZA 1U25A 2VKZG 5F8HA 5I3UA 1NJWA 2HIYA 3HFKA 1TUWA 4A8FA 3O6QA 4ITSA 1G3OA 4ED6A 3SQGB 3KJQB 5BR8F 3PX4A 1QSSA 5KFBA 2ZHBA 2FHMA 2UVWA 3AOBA 1UEVA 2G0IA 3CD6S 3O5TB 2PEBA 4EZ9A 3MM8B 5A8RB 1XNRF 3AQOA 1FWKA 3GCXP 2HHVA 5HQMA 3NG8A 2G1HA 2CVEA 2VDIA 2HNYA 4P71A 3MFIA 3GJSB 3W65A 3LPEA 2CPDA 2IMOA 5J1NA 4TU9A 1SC3B 2G0CA 2HHUA 1N6QB 3RR7A 3C19A 3IAM9 4CT9A 4M5MA 3RB3A 3VAJA 1DQAA 4OHXA 4K0KF 3HXMA 2DISA 2K2PA 3PFEA 2ZH3A 1N8RT 1WC3A 3H5XA 1UJ6A 3IN5A 1JB0C 1LWCA 4LIRA 3MPDA 5G0RA 1MN7A 4ANDA 4KHPF 3KK3A 4G3IA 1I3OB 2RD5C 3UNYA 1QTMA 3SIPB 3CJQA 1KS2A 2J8AA 2GO8A 2H5IB 2XTJP 1QE1A 2DVIA 3SCJE 1CLFA 1Q7LB 2VG7A 2UZAA 1T9VA 3KLEB 3W5YA 3KK1A 4EFAC 3G87A 4A8YA 5IQ6A 1WC5A 1AZSA 1FI4A 3N4WA 3QIPB 1AUDA 3L9ZA 4QIEA 2CJQA 2Z57B 4NLGA 1RI7A 1S7HA 2Z2LA 2QJ3A 1NH7A 5BYRA 2V63A 1S4FA 4LRBA 2QIFA 2RSQA 3MPVA 1YJWS 1YJ7A 4M5IA 4IOBA 1RAJA 3LP0B 4O4GA 2KM8B 2UP1A 3IG1A 2HHQA 1DTQA 1E6YB 4DF8A 1WDDA 3MF5A 3NGTA 1FERA 4CLLA 4ZLNA 3GIJA 1KVJA 1RQ0A 2W1BA 3HKWA 1G2EA 8ATCB 1U2RA 3MCNA 1B7FA 4DV6F 2R8JA 4UOCA 4UZBA 2KG0A 5KT4A 3I5AA 2W2OP 4MFBA 2L41A 4I2PB 4EYIB 1ZM2A 2HRYA 4V1Ak 1S1TA 1B99A 5KFXA 3NGDA 2FPHX 1UPPA 5E2QA 2KXHA 3TRGA 1VISA 1VQMS 1Y3KA 5I42B 2AYEA 2HNDB 1T9YA 3ZZTA 3D54A 4A8QA 1S0MA 2QC3A 2GQ2A 1UWBB 2VG6A 4LJMA 2ZZTA 4Q5VA 2LCWA 1JJCB 3OR2B 1FD2A 4ZVRB 1NK4A 3CDWA 3Q8SB 2X1GA 4DQRA 1UEKA 1W25A 2J8SA 4M5LA 2QFJA 4OZLA 2Z58B 3K5MA 4GRSA 4P72A 1HQUB 1Q78A 1KBRA 3RU0A 5D3GB 4LF5J 4LF4F 2LEPA 2OEMA 1S4EA 4RU2A 1TKXA 2VB6A 3HI9A 3PV8A 2QV6A 2CQPA 4KHMA 4NOHA 2Y8WA 2L9DA 1VYAA 1FFWB 2YNIA 4AE5A 1SKUB 2E1RA 4CLUA 3HPOA 1WG5A 1SJ1A 3LTOA 3KLEA 1T9XA 4M8LA 2OH2A 2VQFF 3LP2A 2E9ZA 1Q81T 3MOJB 1V3ZA 1TK5A 2C2ZB 3PKMA 2KG1A 3KK2B 2R7OA 1U49A 2UVRA 3TA2A 1DLOA 1Y11A 3LP1B 4Y28C 2EC2A 4ILRA 3KHGA 1ZTWA 4H4OA 2GS8A 4LF4J 1SBRA 1WKJA 4K2XA 1P9YA 2OPSA 5F9LA 1HI0P 1M5SA 1N56A 2B9XA 2IDEA 3EVWA 1NB2A 2Z4PA 3ZNUA 4Q8EA 3G6XA 4WK1A 3FMBA 3RAQA 4HTJA 4LBIA 1O8BA 2DHSA 5KFDA 3QLHA 3A8JA 1A7GE 4FBTA 2VJVA 1RTHA 3GQCA 4DV5J 1MG7A 5CA5A 1T9UA 2ASJA 2DR9A 2NXEA 4G1QA 3UO0A 2MKJA 4I7FA 2HW3A 1HA1A 3PYEA 3ISZA 3U1MA 3QIPA 3WIUA 1W2IA 3LOUA 1EB0A 4I1TA 3VF0B 2CXEA 1KVKA 3S01A 1UCNA 5KFSA 4FF3A 1V9OA 1BE4A 2CQ4A 3MMBA 2P6SA 4F4AA 3R7BB 2P9CA 4NZ0A 4P73A 2KFYA 2VC0A 1TL1A 1NK6A 4WFNQ 2GIFA 1GAOA 1MMNA 1HBNA 2F65A 2WW4A 5HANA 5JXSA 2RQCA 4FF1A 4ZCKA 2VFUA 1BY9A 3QGGA 2JL9A 1IBCB 3D7SB 1HBUA 2HBYB
chains in the Genus database with same CATH topology
2QA4G 4IKAA 1LWEB 1TL4A 2YX1A 3DLEA 2FVPA 3U7JA 3OQ2A 2CPHA 3VALA 1SJQA 4YR2A 4F2SA 2FLPA 1KD1T 3LGMA 3GV7B 2F3JA 2MKCA 1CPZA 2KDOA 5MAOA 3NAIA 2DNGA 2IAJA 4RW6A 4K4XA 3MMCB 3G9CA 2FLOA 2GQQA 3JSBA 4RU9A 1HD1A 2AYMA 2G9OA 2P9EA 3V6DB 1SL0A 3DHWC 3J7ZT 2BR0A 4J9KA 2QYCA 2HVIA 3KOAA 2AD9A 1VBYA 1Y5IB 2DRBA 3LUYA 5LSOA 1ZYQA 2ERRA 1VQPS 5EX3A 2HHHF 4O3RA 2HMIB 3K5OA 1HWLA 2LQ5A 2XY6A 2M2BA 3O1LA 3TAQA 2PI4A 1FJCA 1LXNA 3Q2SC 2N4DA 4QR1A 1SH3A 2JJ4D 4E0DA 3O3LA 4KGMA 3MXHP 5U47A 3MM7A 2H9ZA 2VG5A 1U1RA 2RNEA 1LWFA 1QY7A 1BQMB 4TYAA 1JLFB 3PR5B 1PO6A 2B3TB 1R3NA 3HHLA 3MEEA 1YHQS 2AQ4A 4A48A 2VA2A 4J9MA 5EN1A 4M63A 1TK0A 4OI3A 4OJHA 4M95A 2Q6BA 3POTB 3KKFA 2E5LF 2KVIA 2CZVC 4OFZA 5EUHA 2W9BA 2R7WA 2DR5A 4C3LA 2V0NA 3DOLA 4LUBA 5AE1A 3M2VA 3OL9A 2GCFA 4WYLA 5CHCB 2K8GA 1HWUA 2PMHA 1RTDA 3FEZA 2PD1A 2FC8A 4WU2A 1LFWA 1GX6A 1HWKA 1T3OA 3VWSA 2ASLA 2OFGX 4ZVFA 1JNRB 5D6GA 2C2EA 2BBEA 2DIVA 1QUVA 4URGA 3JSRA 4QW8A 4C8YA 4K59A 2HRUA 3I0SB 3IG1B 1UA0A 3GYXB 4ED3A 4B3SF 4IFYB 3ICLA 4Y65A 1U45A 3OXGA 2EPIA 1Z4UA 3G86A 1X5TA 2DGUA 2EBGA 3RW7A 5LMUF 1T7PA 3CPWR 1TAUA 1UA1A 4QU7A 5CYJA 4TLQA 3CJKA 1N0UA 2ADCA 1IN0A 2CQCA 3MM7B 1XR7A 4QOTA 5G4DA 5I42A 1QJHA 1O51A 3I87A 4QBUA 2HW3A 5LSRA 4IH6A 4HDHA 3PIOQ 3H4DA 1QVFR 5KG6A 2FTRA 5EDWA 2KXNB 2CFXA 1YJUA 2B4PA 3SYZA 3FQKA 4B9UA 2AJ4A 4XAKA 1RYRA 1TZ0A 4AQYF 1VQYA 3U1NA 2W4PA 1U2FA 4PR6A 3BSNA 4RU2A 1U4BA 3IRWP 3LWLA 4M5DA 3M4XA 4OMFG 5ITHA 3PXGa 2Z8QA 1XEZA 4MAKA 3CCJS 1KN6A 1ELOA 3QAUA 4RX6A 5H9FJ 2N7CA 2XLJA 4CIOA 4LF6F 1Z1ZA 1FDAA 1BLUA 2OD6A 3VZIA 4CNZA 4NLXA 2CPYA 2J9DE 5L8RC 2JX2A 2OIHA 2A18A 2EVZA 1ZZFA 2BV3A 4C11A 2Q43A 2XG8A 3C8YA 3VZHA 4F3OA 2DH7A 4WF9Q 3C46A 4RNMA 3OJUA 4J5OA 2W9BB 3QGIA 1RWUA 3NNAA 3VAIA 2F8MA 2GC8A 2ZD1A 5J2PA 1IKWA 2B4UA 2DHGA 5L38A 3BS9A 2GA7A 3GV8B 1E6VB 5DM6Q 5HN0A 3J81Y 3OTOF 4HH0A 2EKYA 2ZH1A 1HNIB 1UETA 3DLKB 4RNFA 3KLGA 1HNXF 5D4OA 5K8OA 1GTHA 1UW4A 1DZ5A 1F9FA 1ZPVA 2HLUA 1JX4A 1S6OA 3MMCA 2HNYB 2I9SA 4WTYA 3TUZC 4WFXA 4YB5A 1SL1A 4NMLA 3MAHA 2KYXA 2A3JA 4FVMA 2LXIA 5FIIA 2PA3A 5E3CA 2QLXA 4OX9F 3K57A 3FVYA 2J6UA 2R8GA 1BQNA 5FDLA 1D0EA 4I0WA 2RKIA 1Y3JA 3M6XA 1FE0A 1TKTA 1HMVB 3D2WA 4HI2A 2LQ9A 5THWA 4HDGA 1GXUA 1S99A 2PIIA 5CYQA 2JEJA 3AA8A 1JXEA 4NYZA 3EPIA 4BC9A 1IM4A 2HYIB 2B0GA 2RB7A 5E3QA 4CO1A 5B0CA 4NLRA 2GGPA 2ZM6F 1UFLA 1XK8A 1RA7A 3MTJA 3OR1A 4DL2A 1VJWA 2IVMA 4EEYA 4RW4A 2VUGA 4J9OA 2GQCA 4UQGA 3H5YA 4E8UA 3MURP 1T05B 1NK9A 3PO5A 1IKYA 1FRLA 4CTAA 5HROB 1N5YB 4IH5A 3W2VA 3MECB 3M9NB 3UDCA 3VCDA 3OTBA 4ZP7A 4FBUA 1FRXA 3DOMA 5DDQC 1JJ4A 4ID5B 2RF2A 1NJYA 3CDAA 2IBKA 2DNPA 2DPJA 2D3OR 1F5BA 2DCUB 1TL3A 4OZ1A 2ABYA 1JLQB 5JVGQ 1X4CA 2BACA 4O4RA 2CPXA 1S9FA 1U8SA 1D8ZA 4A8XA 5M2RA 1MMDA 3TYTA 3B8HA 1DQ8A 3JYTA 2ADBA 4DV5F 2X51A 3RRHA 1HI8A 3MWBA 2IFXA 3I0RB 4RUHA 1XN9A 4B9LA 3OLBA 1Q16B 2BDPA 3NNCA 4HL9A 4J37A 4OX6A 5IZHA 3N5BA 1ZETA 1X5SA 4BS2A 1FDBA 1VIOA 1KR4A 3TP2A 3N01A 5SUHA 5KFRA 1YVFA 3M1VB 1N5VA 4WXWA 4ZA1A 3OSPA 3MHYA 1Y00A 1U1PA 2IMWP 3H25A 2HFZA 1LKZA 3TAMB 1FF2A 3IBWA 4CCHA 3HVAA 1HYSA 2CPIA 4HI1A 1F5CA 4NYPA 4DR7F 1RTDB 1BWEA 1RT4A 3HVTB 4KFBB 5DQGA 3M9OB 2DR8A 4C8ZA 3LP2B 1UMJA 1FTCA 3T1YF 2HWIA 4WIIA 1SKWA 2MGZB 3CWJA 4WKYA 1UVLA 4FNHA 1WF0A 1BQNB 3M05A 3EGNA 3OFEA 5L1IA 2MJNA 2AYGA 2EK1A 4KB7A 4OL8A 5IWAF 4IG0A 2OP5A 3IRXA 5J2NB 3BO2A 4LFCF 3CD5A 2KRBA 3DMJB 1DTTA 4DFKA 2DNHA 4PG5A 1WEZA 3IA0A 4RBTA 2YKQA 1A6LA 3MZIA 4F4YA 4QCLA 2IHR1 1JJHA 2YWKA 1ZZNA 4KJIA 2DT9A 3R5DA 2XO7A 2AJQA 5D4NA 3OVBA 4X4SA 2VPWB 1R8CA 4I2QB 3QO9B 3TUJC 3FSIA 2LEAA 4X84A 1HBOA 2ZKUA 4ID8A 2XMKA 3EGWB 5D4LA 1P8GA 4X4RA 3EZ5A 4L6V3 3KK3B 4J9QA 1RT3A 5G0RB 2VH7A 3KHLA 1CQMA 3MR2A 1TV6A 3V6KA 1S1VA 4EUVA 1SV5B 4CZCA 4QIVA 3T5LA 4U9RA 2HWHA 4QWEA 4RW6B 1M5PC 2KZMA 3SCIE 2CYYA 4HVZA 1KOHA 4QPTA 4JV1A 1K9MT 4RW8A 4DV2F 3NS6A 1UVMA 1JLBA 2I0XA 2GO9A 4RNHA 3D1OA 3BN7A 4ZCLA 2G1DA 5MLCV 3EXYA 5CH7B 4O3QA 3V4IA 2XBPA 4Q2MA 2ROEA 3HHLD 4AL7A 1P1TA 1QAXA 2I8EA 2W7OA 5CYMB 1UVKA 3H2UB 4KGKA 3U02A 1Q82T 5KFPA 4O3SA 4R5PB 3OL6A 1H6KX 3GFHA 3C66A 3GV5B 2XCAA 1KTVA 3DMJA 3K7RA 2IVFB 1NU4A 3UQSA 4ZDNA 3FRZA 3RB0A 3M2UB 2B6AB 1MSWD 2PGCA 2ZITA 4YQWA 4FXWA 1DAXA 1JIHA 4G1IA 4LQ9A 3SCLE 4UQTA 2Z2MA 4FP9A 2R7SA 4YB1P 2IRUA 3OR2A 1QM9A 2W4CA 2R7VA 4JUZA 4RWXA 1NZAA 2L9WA 3FSYA 3I9V9 4C3KA 4XDDA 4F4KA 2N7YA 5I3UB 3MI7X 3D5MA 3M6WA 2LXFA 1JLEA 1LW2A 4XO0A 4DSFA 2J7WA 1J5EF 2DNYA 3C6TA 4ZPDA 1Q8LA 3OTCA 5LXYA 2AYBA 3I32A 3QWPA 2GFFA 2YNFA 3FEXB 3M2RB 2DHAA 1KEKA 5GAHI 2CQ0A 4I56A 3QZ7A 3E3XA 2GMLA 4N8NA 4ZVHA 3I55S 2X1BA 3CCZA 1HBMB 4OJ1A 2KZZA 1OSDA 2DH8A 1S6UA 5DGAA 2B51A 2WCXA 3H40A 3K5NA 1X9MA 2WB1D 2MKIA 1T94A 5HMYA 3POTA 4ZP8A 1HNZF 2QA4S 2J0WA 3KJVA 2J7KA 5H9EJ 3GFYA 4LF8F 2R8KA 2VFSA 2GIQA 5KG2A 1IBKF 3ZZOA 2KYZA 4EZ6A 3MEGB 5EGYA 2OSRA 2IC3B 5KFVA 4IRDA 3LWMA 3I4PA 4RBVA 4DEZA 2VG7B 2OPRB 4OX8A 4X4PA 2JLFA 1DRZA 2VKRA 3JTNA 4MIBA 3BQ0A 4KT0C 4EBEA 2J9DA 4B3TF 2W8KA 4O23A 2MZSA 4BWMA 1FNOA 1SIWB 3IWXA 3OLAA 1N48A 2E29A 1ZM4A 1MWYA 2LQJA 4HKQA 3KMSA 5B09A 2BJEA 1IXKA 4XK8C 1LOUA 5KFIA 2RVJA 3MDFA 4V19X 5F8GA 5EWFA 3QGPA 3FCHA 2KTQA 3QAEA 5KOWA 3EGZA 4O44B 3SSQA 5J2QA 1P9QC 1FNXH 4MH8A 1IQTA 2AW0A 3S8SA 1JLAB 1NAQA 4C8MA 3C6TB 4ELVA 1N36F 3CJ4A 3MMAA 4KTQA 1R31A 2FJDB 2P9GA 3B82A 2HNZA 1S49A 3PNIA 3H4BA 4QWAA 2P5VA 3AB4B 3BQ2A 1L3KA 3FQLA 2W4DA 5HP1A 2Q79A 1MMLA 2ASYA 4X4VA 3E01A 2RS8A 4TQRA 3RR8A 1VI7A 2QSWA 4ERDA 2I2YA 4RW9B 1NHUA 2RRNA 3CCSS 2YKOA 4IO1A 4ECZA 2ROGA 3DLJA 3N6NA 1N34F 3D1HA 4C0HA 3TARA 1DJ0A 3MM9A 3DHXA 1JMTA 2MSTA 3FSXA 3NLCA 2U1AA 3ZZYA 1D8YA 1S1XB 4BCAA 5DDRC 3TI0A 1SJFA 2MZJA 2KT3A 1VQ6S 1ZAXA 3MUMP 3KLVA 2NYIA 1X5OA 1G1XA 2QSFA 1S1UB 4F4ZA 3U1LA 2NREA 2MHNA 1N5QA 2DGOA 4MKAA 1RT5B 2BJDA 5CXTA 2O67A 3R5AA 2IVYA 2E1AA 3NBPB 1J5OA 4B3OB 5A8WB 2XNQA 4I2QA 2MZQA 4NLDA 4CO3A 5DDPC 1M5KC 4LFBF 5FDLB 1ZAWA 3MOZA 3P96A 4ILLA 1VQOS 3CMES 4IR1A 1N33F 5F41A 4ZOSA 2VASA 2AJFE 2B5JB 4Z37A 4PXCA 4YR3A 4DV7F 4A8MP 3SSRA 4URSA 3BSOA 5K14B 4DQIA 1KHWA 2RH3A 1WEYA 5J1PA 5IS2A 2ZH6A 4EWTA 3TVZA 3MM5B 1HNVA 4C8KA 3CSKA 1M5VC 4M1KA 4QWDA 4WU3A 2JLGA 1T02A 2UXBF 3J80Y 3IS9B 2VD3A 3I5CA 3DN9A 3CMAS 3GZ7A 5E3RA 1UVNA 2OPSB 1R0AA 1RT3B 3CJ0A 3TUIC 2MQOA 4P7TA 1Q7YT 4KIAA 2ZH9A 4D3GA 2YKPA 2ZE2A 1KQGB 2I1RA 3AY0A 1WI8A 1VBZA 3CJKB 1YRXA 5A2QY 4FNIA 1HYSB 5D8HB 1U6FA 4E98A 4W90B 2HZCA 3IGVA 1IKXA 5M2PA 1N54B 3DU5A 1WNEA 3GSDA 4NRUA 2BZ2A 1HNVB 3KYLA 3QJJA 3SZ2A 2M88A 3OL8A 2D9OA 4RLEA 2HWTA 1C0TB 1GTEA 5F0UA 1WG1A 3BGUA 3US5A 4F25A 5F8MA 2KM8C 1MWZA 1ULRA 2OSQA 3GWCA 4OHYA 4HT5A 2GX8A 3OBIA 5E3PA 5A0YA 3IR7B 4CO5A 5HMZA 2EW9A 3AAWB 2VZ9A 3H5SA 3CCRS 3CEDA 4OI0A 1ZBTA 2OPRA 3G8TA 2VL1A 2YNFB 3BM7A 3F41A 2FGOA 2AGPA 4IOCQ 4DS4A 5J1EA 1UVIA 5C25B 2RIJA 3J7YI 3QGHA 4U6PA 3CCWA 1WHXA 2VPYB 1NK5A 3C2PA 2XMJA 1HNWF 1U1QA 3F44A 4DL4A 1CG2A 2L08A 4MIWA 4C0OC 3TX8A 3OXFA 4K4SA 2XMTA 1HHSA 1LK7A 3HHDA 3RB4A 5LMNF 1DQ9A 1VFJA 2ILZA 2FJAB 2F4VF 2DO4A 2UUCF 2W8LA 2PI5A 2G4BA 3IWNC 3MUTP 2WSFC 4BWJA 2WAQD 2WBRA 2WHOA 3DYAB 2ZJRQ 1V6HA 4JI6F 1HPZB 2VG5B 1VQMS 3UCUP 1KQSR 5KT7A 3V81A 1S1WB 3DLGA 4H4MB 5FJ4A 1WTFA 5HBMA 3VAHA 3Q0AA 1KHVA 1H98A 1WHVA 2NPIA 4Q44A 2YH1A 1L3UA 1JLBB 5D4PA 3CCES 2OO4A 3AQPA 1FDNA 1RP5A 4CH7A 2C3YA 1X9SA 2WK4A 1X4AA 1KLNA 2CQDA 4Y00A 4YP3A 1D3WA 2FHOB 4NLUA 1APSA 4X4UA 4KV8B 2DHXA 4AXIA 1O5JA 1B0VA 2BE2A 1FRHA 2B9YA 4ZPTR 1YSJA 2FB0A 4OHZA 5LJ5Y 1QSLA 3PW7A 3QMQA 4K4TA 3F56A 4U67Q 1HNIA 3GMGA 1R8PA 1S6PA 3P3DA 3MD3A 1VRTB 3R27A 5KG5A 2CQ2A 2YWHA 4K5RA 3K58A 3GIMA 2NSCA 3IXQA 4OZ5A 3OR1B 2FUG9 5DM7Q 4K4ZA 3T9NA 2BANA 3JB9k 4H4MA 2L48A 2X1AA 1YJNS 1DLOB 4FPRA 2R8HA 1DBDA 2FD2A 3HZEA 4J9NA 1IBLF 3PHEA 5GADU 2MY7A 3SFUA 3NCRA 3DXBA 4KAIA 2V4RA 2RDIA 4EYHB 4QR2A 2OPQA 4B08A 3BSAA 5KFJA 2ZOFA 1YITS 2JLEA 4DL6A 5JUMA 3CCVS 2EFNA 5A8RA 1TAQA 4Y2KA 5K9FA 3OL7A 2XWXA 4PWDB 2LA6A 3TA1A 2XSJA 3V6JA 1MROB 3TA0A 4GO5X 4Y0FA 5DG9A 3AHPA 4CH1A 2LEBA 4IQXA 4H4KA 5K8MA 2MQMA 5A8KA 1FEEA 3BDEA 3N0VA 2YKMA 2MGZA 4QZVB 1XERA 1PSDA 3PACA 1QSYA 3UR3C 2EWHA 4KO0A 4TXSA 1RYSA 2D41A 1G6BA 4U7CA 4QWCA 2W9CA 1Q4RA 1YRTA 4GO7X 3SDEB 4TQSA 5L1KA 2BQRA 4NCGB 4ECVA 1YGYA 1S0VA 4DS5A 5L9XA 3UFCX 2R9LA 4BDPA 1VGYA 2GNKA 2DNOA 2Y1JA 2DGTA 1DTTB 1HW9A 2DGSA 3KFWX 3HP6A 4IRKA 1OIAA 4BC7A 1PILA 2J7UA 3KG1A 2MXYA 2RQ4A 1KFSA