4MAKA

Crystal structure of a putative ssrna endonuclease cas2, crispr adaptation protein from e.coli
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
73
structure length
73
Chain Sequence
SMLVVVTENVPPRLRGRLAIWLLEVRAGVYVGDVSAKIREMIWEQIAGLAEEGNVVMAWATNTETGFEFQTFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a putative ssRNA endonuclease Cas2, CRISPR adaptation protein from E.coli
rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords CRISPR-associated endoribonuclease Cas2
total genus 16
structure length 73
sequence length 73
chains with identical sequence B
ec nomenclature ec 3.1.-.-:
pdb deposition date 2013-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09707 Cas_Cas2CT1978 CRISPR-associated protein (Cas_Cas2CT1978)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.240 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4makA00
1ZM3A 1FNMA 1ZM4A 2I0XA 2WBMA 3ZZ0A 2E1RA 1DARA 1ZM2A 2I8EA 2KDOA 4ZCMA 3E3XA 2J7KA 1N0VC 4MYTA 3EXCX 4MYUA 2XEXA 1ZPWX 4ES2A 1P9QC 1KTVA 2BM0A 2BM1A 4ZCLA 2L9NA 3ZZTA 3B78A 2IVYA 4M1KA 1ZM9A 2NPFA 4QR1A 3LH2S 4ZCIA 2CVEA 3UI3A 4QR0A 2EFGA 3B8HA 4TNOA 2ZITA 1T95A 3B82A 4QR2A 2BV3A 5G4DA 4ES1A 4MAKA 3ZZUA 4FN5A 4ES3A 4ZCKA 3OQ2A 1U2RA 1N0UA 1ELOA 1VI7A
chains in the Genus database with same CATH superfamily
4B3RJ 1B7YB 1KR4A 1RWXB 2OPSA 4UZCA 3W2WB 4OYIA 1TK8A 3VAMA 3L4BC 1PYTA 3X3UA 2N7CA 3MM8B 2FUG9 1J5OB 5RUBA 4F4WA 4CM2A 2BJ8A 4DV1F 1U0HA 4U9RA 1U6BA 1S0NA 3PZPA 1IVZA 4RJVA 4CCHA 1V3SA 2KHDA 2HIQA 2BZ2A 3HULA 1BQXA 4RW9A 3KTQA 3D6TB 5A76A 3QMQA 4NOHA 4QR0A 5L8RC 3G71S 1CC8A 3DGPA 4YHHJ 1F2HA 3R5JB 4RZRA 3DYAB 3VALA 1N36F 2HMIA 1RLDA 3THVA 1WF1A 2WB4A 1M5HA 1IKYA 4C3MA 4ZVSB 2M7SA 1FXDA 3C46A 4P2SA 4C97A 1G7CB 2RQMA 2AGOA 3MM5A 4ILMA 3MAAB 1IBLF 2MY8A 3AJDA 1N34F 3LPYA 2AW0A 3N9UC 1UEUA 2R7RA 2FC9A 1ZA1B 1N48A 2H4YB 3NS7B 3CJKB 3W2WA 5E3RA 3KXDA 1DQ9A 4ES2A 2R2TA 2Y3YA 1RDRA 1MMNA 3C66A 3I82A 3T1AA 3MEGA 4P2XA 4OZJA 1ROFA 5JJBA 2KKHA 1T3NA 1DJ0A 1N52B 2E5IA 3DRSA 2LQ8A 4CLZA 2CVEA 3DRRA 3KJVB 2CPJA 3SV4A 1QTNB 1EQMA 2XMUA 5HATA 1RBLA 2KM8C 1N54B 2ASDA 3F56A 3GE9A 2QLWA 2D69A 3LO3A 3CCZA 5AXLA 3BO4A 2HVHA 1LK5A 2R2SA 2XWXA 4Q8FA 3OXGA 4HLBA 2ZH1A 1HQEA 1VBYA 1NKCA 4Y0FA 1JLEB 2YKOA 2ASYA 3ETOA 1C4CA 4CLUA 2YQ1A 4MK8A 4NLSA 3IGVA 3NBPB 3UCZP 2NXJA 1YBUA 1FX2A 1NNDA 3TVYA 4AXIA 2J9EA 5CYJA 2V8DA 1FDBA 2I1RA 1Q82T 4WP9A 3UCGA 3CCES 2DGUA 1RA6A 4DXLA 4KBIA 2CG4A 4I2PB 4M1KA 1C0TA 1RI7A 3T9ZA 1RT1A 1HBOA 4ECTA 5CCLA 3SQOP 3L3CA 1FX4A 3MCMA 2CQHA 2VQEJ 3TI0A 1VBKA 3A8JA 5A8WB 3K59A 4KQZA 3BQ0A 5I4MA 1SJ3P 1KSPA 3T6BA 2XO6A 1NSAA 1GXTA 3QSIA 4WZQA 4A46A 2RVJA 3QIPB 4I0WA 1ZH5A 3OL9A 1JLCB 2RRBA 3QO9B 2NZCA 3W1YC 2PC6A 4ZVGA 2V34A 2OEJA 1Q5VA 4DV0F 1LWCA 1KQKA 1FD2A 4V1Ak 2KXFA 3H4DA 4X64J 1MG7A 1SKUB 1T3OA 2V6AA 3DDIA 4XDCA 2GS8A 2RMLA 3FMBA 2CVIA 3L7UA 3KJNB 1BY9A 2W2OP 4GVLA 1PC4A 4ZOSA 4CM0A 5HL7Q 2MMYA 3FSIA 4ZLJA 2XYPB 2HQIA 1RWMB 2YWWA 1FE0A 3HVTA 3GSDA 3MMAA 2IVFB 3W5ZA 4DJBA 5F3ZA 1WTBA 1SJQA 3M6WA 4FNHA 2CWKA 2FLNA 1IUJA 1QAIA 2RF2A 3W2VB 3PR4A 2R8HA 1QTMA 4KFBA 4ZN3A 3BR9A 2EKYA 5HROA 3DOMA 5CZXA 2Z8QA 3DN9A 2R3VA 1LQ9A 1H2UX 1YRXA 3LP2A 2VASA 4I68A 5AJ3F 4M95A 3C15B 1H73A 2RS8A 4ZCKA 2QG9B 3FBCA 1JLFA 3I5AA 4KSEB 4DPTA 1N56A 1KHWA 2CQ3A 2G0JA 2MB0B 4DR7J 1U1QA 2EBGA 4TKTA 5G0RB 1CJVB 4F0MA 4IQXA 1VR6A 1WKKA 2H5JB 2PDAA 3IS9B 5AT1B 4YUDA 1UVJA 3HSZA 2R8KA 4P73A 4OI0A 3EDRB 3I5BA 2JC1A 1T05A 2YY3A 4IDKA 5DS7A 1RA7A 1NHVA 3C16B 3N01A 3OTEA 3SDEA 5IS2A 1V3RA 2IRXA 4X62J 3CCVS 2ZH2A 3QBCA 2GJIA 4DR6F 4M5KA 1NHKL 3MMBB 3P5TL 4ECYA 1RXOB 2ZNYA 3C3LA 4OX9F 2F4VJ 3SXLA 2C28A 2R7XA 2JX2A 4Q7AA 1FRKA 3T9NA 4NLGA 3GIKA 4U6PA 5H9FK 4DR4F 2XSJA 3TARA 1SV5A 2W9AA 5KT6A 1T9XA 4DV5J 1VQ9S 4ZCMA 1L3TA 2KZZA 4N7TA 5DM6Q 3MAQA 5LMNJ 2E66A 1HNIB 2QN6B 5ETMA 2HSEB 2VQEF 3ZO7A 3IN5A 4Q44A 4OYOA 1T02A 2BXJA 2M4MA 3JSBA 4M5LA 1NSQA 3OTOF 1LV5A 5IXUA 5HI7A 4ECWA 3RB4A 5J1EA 1TVRA 3EPIA 2IMWP 4MT1A 2QL7B 3UDCA 3B8HA 3IA0A 4CNYA 3U02A 4IDKB 2D41A 3SDEB 1KEKA 2HHQA 5D0GA 3T6JA 4Y2IA 2DGWA 4DR5J 3SV3A 1N5YA 1JWWA 1Q7YT 4IH5A 5ETSA 1CQNA 3ZZRA 2LXUA 5A8RA 2P6SA 1EP4A 2Z30B 3IS9A 1VBZA 1OYEA 2EK1A 2LXFA 3IFEA 5HBMA 2KH9A 1TMJA 3HD2A 1TL3A 2QLBB 3D54A 4CO3A 1RBOB 3Q8UA 4MYTA 4TLQA 2MYFA 3CCSS 4B3TJ 1VMBA 1FERA 3GJSB 3OFFA 3MXHP 3BREA 5AXKA 2V9KA 2RRAA 2K1RA 2DRAA 2JFDA 3MR5A 4M63A 2B4VA 3K5OA 4EI2A 2W9CB 4A8QA 2FPHX 1LFWA 2OELA 2UUBF 1QLNA 3UI3A 5H9FJ 1DY3A 1ZA2B 4CLFA 2YNFA 4WBFA 4B9SA 4JI8J 3M2VB 2RILA 5KFEA 2MHEA 2DO4A 4DV5F 2YNGB 2CA9A 3RG6A 3V6HA 2AEMA 2Z56B 5KTQA 4DX8H 3R2DJ 1KOHA 2NXUA 1RAHB 2O3DA 1N4LA 1VCTA 3AT1B 2R7OA 5DG8A 1N33J 1ZM2A 2LQ5A 5B0AA 5AXMA 3BDPA 1O8BA 3OXLA 2QL9B 5M2UA 4YHHF 4ECZA 2DPJA 4AE5A 2AF6A 2DEIA 2G0CA 2IIHA 2MKSA 3VQSA 1SBRA 3G6VA 4A8YA 4OZLA 2F40A 1W25A 5DRKA 4JI5F 1IR1A 4K59A 4DL5A 1MNEA 3MD3A 4CTAB 2XNRA 2PD1A 4K5SA 3JTOA 4LQ9A 5D8HB 1HQUA 2BACA 2FVCA 1YVFA 3DOKA 3OL8A 4IOBA 4EZ6A 2XMKA 1D1UA 4PR6A 4ZHRB 4O0IA 4ID5A 1FRXA 3MM7A 4FN5A 3SCKE 2WB1D 3X1LB 1K0TA 2AX0A 2FHOB 3FMWA 4K7QA 5L39A 5DLGA 4A8FA 3UE2A 3KHLA 1X5PA 4FF3A 1U49A 4IG3A 2VOOA 3MECB 1EJ7L 5LMUF 1C1BB 2OPRB 2ZVIA 4QOTA 1D9DA 4NA2A 4NA3A 1S6PB 1FCAA 2NSCA 3BKUA 4ZPBA 1UJ6A 2ADCA 4ZLPA 3BPDA 4XIUA 5LMNF 4FF1A 3O1LA 3GJQB 4QWAA 2CNNB 1YITS 3M2RA 5KFQA 4N76A 4IO1A 3FJ2A 3PW5A 1T0TV 4O4RA 1MMDA 2HFVA 1RADB 2QA1A 2WHOA 4J5OA 4OHWA 2WW8A 4I6YA 5F0UA 4DZ6A 3W66A 4DV7F 1F60B 4FYDA 2B51A 2HG4A 1ZTTA 3EVOA 1N36J 4U67Q 2XMMA 1VIXA 2CNOB 4W98A 1FDNA 3KLHA 1AUDA 1JNZB 1M1GA 1TELA 1NSPA 1OIAA 2R8JA 1CEZA 3CDAA 3RAMA 3N6NA 3UD5A 3KLGA 3NRBA 4U8YA 2P9CA 4ELVA 3DHWC 2G2ZA 2XMJA 4KGVB 3LWMA 1CJUB 3QAEA 2RB7A 3CCUS 2HIYA 2JLFA 3W8PA 4DFJA 1RT5B 2XY5A 2VC0A 1AZSB 3GG1A 3K8WA 2MZQA 4L75A 5IV4A 1D9AA 3G8TA 2L08A 4R5PB 2ADBA 4HH1A 5I3UA 2UVWA 1B0VA 1QJHA 1ZYQA 2GV1A 1C1BA 4AQYF 3FZBA 5F3TA 4F4KA 2ZOMA 1C1CA 4UT4A 4URQU 2AYBA 2R7VA 4IFYA 4HVZA 2JVOA 4BLGA 1Q8BA 5FD1A 4DQSA 2XC9A 3HCXA 1RAEB 2Y8WA 2ZDPA 4DU8A 1F5AA 1TK5A 4WCEQ 3UN5A 1WD6A 3OW2R 4HR2A 1OY6A 2CQIA 2EWHA 1U1KA 2O5DA 2RRNA 3CD5A 1O5JA 1SL1A 1NUEA 1HW8A 1YX2A 5KG1A 2YX1A 9ATCB 1S49A 5CYQA 1E6VB 1NAQA 3MEDA 1NH7A 3DXSX 3MHYA 2V94A 4PPZA 4C2MA 3MFIA 1JXEA 2ROEA 2GVDB 1Y5NB 2HQ3A 2W7AA 1G6BA 5C2CA 4JI3F 5K9FA 2PSZA 1TKZB 4EU0A 2LEPA 1FEEA 2JC0A 2FHJD 3FUYA 2NPFA 1XMQF 2P6TA 2R7QA 2WK4A 4I4BA 1JLAA 3ZTSA 5E33A 1FI4A 1LXJA 4NASA 2Y1IA 1IBMJ 4GKJJ 2YPYA 4WXWA 2ZH8A 2FQQB 4C0OC 4ALZA 2NUHA 2ZD1B 5DO2A 5T7LB 3KMQA 1I6JA 1LFPA 1GX5A 3MM9A 1GNKA 1VRUB 4XPCA 3P3DA 2RKIA 3BBBA 5F9LA 3BS9A 1QUVA 2A6OA 3NCPA 4W4MA 2QO3A 2ZC4A 4CWBA 4EK2A 1RAJA 4N8NA 2HNZB 1OS5A 2YWGA 5ETNA 3PY8A 1TUWA 4O3PA 1JLGA 1FTCA 3TR5A 1J5EJ 1DRZA 3O5TB 2GJ2A 5E3QA 3U1NA 4GVBA 3OJSA 2NYIA 4P7TA 5HQ8A 2WOMB 1TL1B 3IM9A 2LA4A 2ZNZA 1KFDA 1BXNA 1TU0B 3F44A 3TO8A 2W8KA 1WC6A 4QWBA 1GT8A 1S57A 1M5SA 2VF3A 4C11A 1IJFB 2MQOA 2ZJRQ 3KK2A 5HP1B 3FK4A 1G3OA 1FNOA 1PYSB 3DGVA 1B70B 3CIZA 3KJQB 2H5IB 5DJBA 4QIEA 1T9YA 3D6MB 1RT4A 4DPXA 5KFDA 5H9EK 3HT0A 2KM8B 3TX0A 2ILYA 4DR1J 1RP5A 1HI8A 4G3IA 4P9SA 2HHTA 3J7ZT 2HHPA 2ZBRA 1VQ4S 2EC2A 2G2OA 3QIPA 2MZSA 1NDLA 1HYSB 1NZAA 3D1OA 3PHEA 4RBVA 2QC3A 1RAAB 3WX4A 2FY1A 1W26A 2ZH9A 4JV5F 3VVUA 2VKRA 3BO3A 1UJ4A 3U1LA 3MMCA 1UCNA 4ED2A 4DDFA 3H2UB 4O3QA 3EZOA 3G6ES 1LWXA 1TL4A 2LVWA 1BWEA 2ZH4A 2D3O1 2VPZB 2B4OA 2QJ3A 2K06A 1X31C 2UXCF 1YBAA 1SL2A 2JRSA 3CJ3A 2JLEA 3G6XA 4LF9F 2F1FA 2C2KB 4J91A 2QFIA 3TRGA 1RWOB 2DD8S 3G82B 3NWGA 5G4DA 2BE9B 3KYLA 4DLEA 1N6QB 1FTRA 3FGVA 4KJIA 3EGVA 5BXIA 3US5A 2FVPA 4OV6A 1F2GA 4DV7J 2BDPA 2H9ZA 2A3JA 3IRXA 3DRPA 3IR6B 4DHVA 2W2PP 7FDRA 4TQSA 4LF2A 4TN2A 3RR8A 4ELUA 4BCAA 1CBKA 4J90A 3AH6A 4WU2A 2AYEA 3TAMA 2VOPA 3OHBA 5IOLA 2C2MB 3CDUA 4IG0A 2LECA 3QZ8A 4D3HA 5J2MA 4X65F 3UPFA 4OHXA 4LF4J 3THPA 3UR3C 2GCFA 1U25A 4DQRA 5B0BA 3BSNA 4FNIA 4DF4A 4CLKA 2UUCJ 2NXEA 2YKMA 1KONA 3PACA 4RPFA 4ZVEA 5A8WA 3I9V9 4I6AA 1SJ4P 5M2RA 4P71A 2CJ9A 3P45B 2HBRB 3NGRA 3W9IA 1HBMA 1S4EA 2FHJA 4PXEA 1Q86T 2EG1A 4KHPJ 3RGIA 4ZPCA 2DCUB 4F4ZA 4IFVB 4XO0A 2HZCA 3P5BP 5DQGA 2VFRA 3B4DA 4DUYF 1TL5A 4RW4B 2JEIA 4NCBA 1DLOA 2OD6A 2QSWA 1F5CA 3TVZA 3TYTA 1FFSB 1YBTA 2FZKB 3V4MA 1MN7A 5B08A 4F50A 4RU2A 4F2RA 3D1QA 2YH1A 4JI0J 3T1HJ 1PYOB 1UVKA 3SFUA 1R0BG 1PJ7A 1RHUB 2F65A 2JFKA 3OFEA 4DV3F 4GKKJ 4F3MA 4UQTA 3RRHA 1U1NA 1WSRA 1QY7A 4FXDA 2HQDA 3OD2A 3BSCA 1UW4A 4R8UA 4H4KA 4O3OA 4IOAQ 1Y11A 4DR4J 1XEZA 4I64A 4O0NA 4LF5J 2BRKA 1ZS6A 1SH0A 1WC5A 1E6YB 2B3TB 2FD2A 2HWHA 5JVGQ 4DR7F 2EI5A 1YWXA 1Q5YA 4F2SA 1IBMF 2PFDA 1FFGB 1KVKA 1V6HA 4LF9J 1MSWD 3KK3B 3BQ2A 3PVXA 5KFMA 1I51B 2G1HA 3DKDA 3LANA 1KLMA 4YDXA 2HRUA 5LXYA 2AQ4A 4X66J 5DDRC 1I5OB 1D3WA 1K0VA 4QJVA 4OJGA 1H2VZ 1UKUA 3IO1A 3Q86A 1EP4B 1NHUA 3S6EA 3K58A 1IXKA 1DTTA 1JLEA 4Y65A 1P1LA 2DGOA 3M8SA 2B5JA 2YH0A 1U6ZA 3H42A 5BR8F 4F4XA 3K17A 3TW0A 2ZFHA 1M5PC 2MSSA 3DLJA 3QPIA 2R2RA 3T5LA 3KDOA 3HVRA 1VOMA 5ITHA 4MFBA 3PR5B 1W2IA 2IY5B 4HT5A 3NEKA 4OI6A 4QYZK 1QD1A 4O44A 1VK3A 1HFEL 2OGUA 2J9DA 3S8SA 4YY3J 1OJ4A 2ACYA 2P8IA 2XMWA 4LRDA 4ECXA 2RS2A 1CJUA 2GMLA 2JEFA 5HN0A 5MAOA 3JSMB 2M52A 2CQDA 2QGFB 1BC6A 3H2VE 1EB0A 2VDHA 1HNXF 2Q1LA 2FZCB 1TV6A 2GHPA 5SZTA 3CULA 3A8EA 2DB1A 3IXQA 2R7WA 4X4TA 1SIZA 3LPEA 1XR5A 1UAWA 3CJ5A 3TJ8A 1IKVA 5E3PA 1NJIT 4OL8A 1Y3JA 3AXKA 4NI2B 4MTPA 6FD1A 2BQ3A 1CJKA 2BJ3A 2BW7A 3OR2A 4N77A 1MROB 1YJTA 4AT1B 4OZNA 3Q8RB 4F7VA 3OVAA 1HI0P 1HI1A 1PC5A 2ZBPA 4ZVUB 4PQUA 2JSXA 5DZ6A 4X64F 4DV0J 1VQSA 4UZBA 1UVNA 2CNKB 2UUCF 1SQGA 1RCOB 4I6WA 5J2QA 3TNVA 1EETA 3C2PA 1FXLA 4LF7F 1R31A 5K8OA 2FJVA 3UVJA 5C25B 2J0SD 5D4PA 1YIJS 1F0XA 2OPQA 4HI1A 2V2VA 2LXIA 1RT2B 2DHXA 4O3NA 3KWMA 4D3GA 3MAHA 4G1PA 4NL5A 1X4DA 4ERDA 4RL1A 1WOPA 2OSQA 4YR0A 2XULA 3R27A 3V81A 2MDAA 2QLJB 4CLSA 4Y28C 1KQGB 1YG0A 3BV8A 4ID5B 3R8YA 4PUOB 1XBWA 3MEEB 2J0WA 1JLFB 4CO1A 3OL6A 3WHIA 4TY8B 2L48A 4PPDA 1Q8IA 1NRKA 1SKSA 5KFJA 1ZPVA 4A8WA 1F9EB 2ZBQA 4ZPDA 3HM9A 2DVIA 1FESA 3DRYA 2RF2B 3W2VA 2D7SA 1FVSA 2XZWA 2QFJA 4B9NA 1N32F 5D0RA 2HW3A 3M32B 2FDNA 2ALZA 4P2FA 2VDIA 4YEAA 4MKAA 3G6YA 1GMUA 1DFDA 4TNOA 3WIVA 3T5KA 2PI4A 5BYRA 1C1CB 5KFIA 4B9VA 4FKXA 3UNYA 1SXLA 2GIFA 1VC0A 2COLA 2H4WB 3UWTA 2CQCA 3O6QA 1S4FA 4CYUB 4CH0S 3PJ9A 4P6QA 4ZVHA 5A6PA 5IT4A 3KHRA 2OP5A 3Q83A 2E5HA 2IYIA 5THWA 1R8HA 2GO9A 5HJYA 5IM0A 3WC2A 3R5CA 1NZ8A 4KAIA 2WOMA 5GAGU 2MSTA 1W2BR 1TKDA 1GX6A 3DLEA 3FBEA 4LUBA 4N41A 2V8VA 3FCHA 3DOLA 4C11B 1SH2A 4R0JA 1P9YA 3JAMU 3A4TA 1HQUB 1WHWA 1N8RT 4J9QA 2CPEA 3EDQB 2PO4A 3QGHA 2HQFA 4WIIA 2AYMA 5HSPA 2GNKA 2RIJA 4J9UE 1I94F 3J7A1 4QCLA 4U7CA 3I55S 1PJ5A 2AJ2A 4CLTA 3CCMS 1RT7B 2GHVC 4FS2A 5KOXA 2HS0A 3BGRA 3VQTA 1D8YA 1XNQF 5I3QA 1VK8A 1AXQA 2J5AA 1I94J 3IWNC 2YTCA 1AA1B 4MH8A 3ISNC 3M6VA 5IT0A 2HHSA 1WKLA 2N82B 3F0NA 3LAKA 2VHGA 2ALYB 4DCJB 3MCSA 4DSLA 4C8NA 3E3XA 4RKUC 1HNVB 1Z4UA 3CWJA 4F4YA 3EXCX 2MZTA 2R4FA 1FWLA 2JJ4D 3AOAA 3FBFA 3GYXB 3D7SB 1T9UA 3A1YG 3DGPB 3H98A 4H54A 3GSIA 4QQBA 1UPMB 3IBWA 2BM1A 1E6VA 1J27A 2VV5A 5F0WA 4X4NA 4EFAC 1PBAA 1YJUA 4JI2F 2GVDA 2LEAA 5L1JA 3NGTA 5LMUJ 4OZ0A 3MEGB 2C22A 4L3NA 2HFSA 4NXMF 1Y10A 2CDRB 2XS2A 3BBFA 2QSFA 3HHLB 3EMTA 5KFCA 3ISND 3Q8PB 3C6TB 2PI5A 2Y0BB 4KV8A 4EWTA 3VHQA 1H2TZ 3H0PA 2Z4PA 2ZE2A 3RRKA 4DI6A 2VA3A 4USKA 4RUAA 2YNIA 1TL3B 3A12A 1MW7A 5LM7E 3T3FA 2I2YA 1X60A 4ICLB 3ET6B 1Z1ZA 3Q8YA 2Y0SD 3NNAA 4EO6A 1XNRF 3M8RA 2KRBA 5SUHA 3W5YA 4ED7A 4WE1A 2J76E 2KYZA 3RW7A 1VBXA 2Q3PA 2OPQB 4GC6A 2IBKA 3BKFA 4LVOP 4FDFA 4NRTA 3MCNA 3DLBA 3PO5A 1XMBA 5HK4A 1N88A 5CXTA 1OO0B 2OFHX 1NPPA 3BBCA 3QFHA 5KFHA 2CXEA 2C3UA 2HKEA 1FFWB 1U47A 5FDLA 3UR0A 1U6FA 2V8GA 4J9SA 1KQSR 4K4XA 2V2KA 4PQUB 4B08A 4WXOA 3CNQP 4OQJA 3VZHA 4LBIA 2LKZA 2MKJA 3HSJA 2HHWA 1KVIA 2J7WA 4IR9A 4FS1A 1WUUA 2IPOB 3TZYA 2LEBA 2HZVA 3FFIA 1BWVA 2KT2A 1C4AA 2OMOA 3FRZA 1FK9B 4TY9A 3CCWA 1MMLA 3KLIA 1FRIA 4UY8T 2BYCA 2OAUA 2W2QP 2KG0A 2FJEB 2VONA 2W2MP 3ZXWA 1AUSL 4CO4A 4HKQA 2IRUA 2KFYA 3HVAA 1GQEA 1FRJA 2ZWPA 4YB6A 2UU9F 3E01B 4ENOA 3CB4A 5D6GA 1AB8A 1PCAA 4ECQA 5GAHU 4B3RF 2DIUA 3N79A 3LTOA 2DISA 1A7GE 5HVFA 4AUKA 2V63A 4J7CA 2E9ZA 3KG4A 2ZM6F 4DR5F 2YBVA 4JI0F 2K3IA 4LR9A 5KG7A 3Q22A 3O44A 3TAQA 3NWRA 3MUMP 1RTDB 3FSXA 3ZZUA 5LJ5Y 4TLRA 2IDEA 2OPRA 3AD8C 2DNRA 3SQGB 5KFZA 3CIMA 1YJVA 4IUFA 3ILLA 3G8QA 2DHHA 2W1BA 3THTA 2HGNA 1Z2LA 3DNCA 4ZIWA 1NJYA 3DLLQ 5HLFA 4NXMJ 3GMGA 2AYGA 1JB0C 1H3DA 3MWBA 4GO7X 2VKZG 4R25A 3RB3A 4I2QB 4RU9A 4TY8A 3WBZA 4DSEA 4CLPA 2NPIA 4M5IA 3EVMA 1N34J 5F8JA 1MN9A 4B9UA 1WG5A 4J9VA 4DPWA 1JLQB 3I5CA 2DGQA 2RQ4A 2AD9A 2IJNA 1TP7A 3CCQS 1U09A 4ECUA 3FCWA 3RYLA 5ADZA 2RUSA 1FHTA 4OV1A 2YNFB 4P74A 1NK4A 2QYGA 2XM3A 3TJAA 2ZH7A 1X7VA 1HHSA 2GO8A 5B0FA 4LF8F 4LSNA 1IKXA 2B9EA 4MK7A 1WI8A 4OIXA 5KT3A 3V6DB 4I7FA 1FVQA 5KG4A 4WKYA 3RR7A 1UW9A 2I5JA 3MPYA 2OI2A 3PYGA 5KT2A 3GZ7A 5HLFB 2HBQB 4RO0A 2DGVA 3LAMA 4KKOB 3P6YC 4WFXA 3CT9A 3U27A 1YJNS 4P52A 4HHHA 3VAFA 5T41A 4A48A 3IR7B 1IR0A 4QU6A 1S6QA 4RW8A 4R0EA 2XMTA 3CSKA 4K0KF 4A8KA 4PG6A 4M5DA 2CDQA 2J6UA 3TAMB 1R6VA 3LP0A 1S0MA 4IKAA 4NLYA 1IBCB 4WTYA 3TQEA 1WWHA 4HACB 3DLKB 3HKZD 1VQPS 2NZ4A 2E5JA 3LF0A 4H4KC 4JP8A 1JLQA 2HVDA 1UTAA 2CQ1A 2C3PA 3M8QB 1WC3A 2EK6A 5D77A 4NLXA 1LNQA 3CGIA 3QO9A 4QWEA 4WK3A 3FVYA 1SKWA 3MPUB 2OD4A 3OR1A 2VBZA 2XBPA 3QIDA 4I2QA 3W61A 3T5HA 1K44A 5HJXA 3S1TA 3HSDA 3M8YA 5H9EJ 2R8IA 2UXDJ 2CQ4A 4ZPVR 1VQ7S 5CZVA 3ULHA 4CO2A 2M8DB 2E9RX 1BMQB 1V9OA 4J37A 4MJKA 1CJTA 3AOCA 1J5EF 4W90B 4YQWA 3BR8A 2NCKL 4PG4A 3M1VB 3AFGA 2CRLA 1S12A 4B9TA 4NEZA 3VV2B 1WC0A 3MM6A 1RTHA 3BDEA 5L9XA 2IM3A 4LR7A 2DITA 3PW2A 2QMWA 2M70A 2WBMA 3DCAA 3GIRA 2DH7A 1PO6A 3EICA 4DCOB 3RB6A 2K3KA 3ZZ0A 1RT4B 5C24A 3VAJA 4ED6A 1FA0A 4CO0A 4P2MA 1VRTA 1WDDA 2OPPA 3KUEA 2MQNA 3VZIA 3VAHA 3VAKA 3NAIA 4F25A 2W4DA 2QTWA 5CYMA 3PIOQ 3BN7A 2KYXA 4OLOA 3HO1A 5F8IA 2XYGB 5F8NA 1QVGR 2DHGA 1SL0A 2AV5A 2Y1JA 1SC3B 2NSBA 1K47A 3LOUA 4F0HA 3D68A 5L1IA 1UWBA 3AA8A 2ATLA 4OX9J 5D4OA 2OO4A 3CMES 2XNQA 3D0IE 2F8HA 3TUIC 2XG8A 2ZZNA 1R8CA 2Z0GA 3CDEA 3L7OA 2AZ3A 4DU7A 1G1XA 2N7YA 2F8EX 5CYQB 1YQHA 1LWEB 1H7WA 2ZKUA 4USUA 4U96A 5DGAA 3I9ZA 3W60A 4NLQA 4KGZB 3MR3A 2C2RA 1WF0A 3QFWA 2QE5A 3IGNA 3FEYB 1PJ6A 5EHHA 4UOFA 4M5JA 1KNZA 2HQCA 2V2QA 1AROP 2BABA 5EGYA 2BVZA 2DNGA 2HFNA 2MZJA 1WF2A 3QWPA 2WTFA 4F4AA 2OEMA 2HGMA 1S9GA 2B6AB 4KYZA 1G2EA 2LFVA 1JLCA 5A0YB 2GFFA 4USVA 3EGWB 4YR2A 3IRXB 3BQ1A 1HWUA 3LUYA 3NS6A 1XMOJ 3BH7B 2YXLA 1LWCB 3PV8A 2DKOB 1VQYA 4X4VA 1NM2A 4DR2J 5J2PA 1HWJA 3J81U 3I31A 2RU3A 1AW0A 4X62F 1WOOA 1ZM3A 1UA1A 2IA6A 1YZ6A 1RHJB 4IFVA 1PIEA 2IVMA 4RWWA 1U45A 1OQ3A 2MLYA 3L9ZA 1EARA 1YK9A 2CZ9A 5B09A 1VYAA 2HPUA 2J9DE 1S6UA 4B17A 4KFBB 1S1UB 3B54A 1REVA 2B8PA 4DV6F 2D3ZA 2B7CB 3GFHA 1Q8LA 3ZTQA 1X5SA 3C8YA 3RTVA 1HWLA 1H72C 2BV3A 5D3GA 1RZMA 4CH1A 4ED8A 3Q8SB 5ETOA 3M8QA 3NGDA 3IM8A 1AZSA 1Z2ZA 4PXBA 5KFAA 3AODA 3MTKA 3QGPA 1N0UA 2HBZB 3AXMA 3KK2B 1R27B 2RDIA 1S1XB 2VL1A 2W9BB 4DN9A 2BE7D 5DDPC 1PG5B 3CCTA 2N3OA 4JI6F 2HK2A 1S9FA 3IWXA 3CW2C 4HT7A 4KH0B 2VG6B 3ADAC 1Y3KA 1NDPA 5IWAJ 3QT7A 4KB7A 1I1GA 1VLOA 3ET6A 5AE3A 1KC8T 1WEXA 3BJYA 4WU3A 1TKTB 4JI7J 1YJ9S 4J9NA 2C3OA 5E0OA 2GQ2A 5CABA 1HR0F 4ZDNA 1KQFB 4YR3A 1VJWA 2GQCA 1ZM9A 5KFTA 1LK7A 4CQ1A 6FDRA 2LA6A 1FEHA 2BMBA 3GV5B 2DHSA 4O4GB 2AJ4A 2EFNA 3KDNA 5J2PB 4ZLNA 4KTQA 4C98A 3CD0A 4DSKA 2C1EB 1H74A 4RLEA 5IT9Y 2P9EA 3DHXA 1NH8A 3MAAA 3ZNJ1 4CLWA 4JV1A 3PG9A 1IM4A 1XIQA 2A0FB 3DDKA 1RWKB 5FDLB 4O44B 5HQLA 2RUGA 4K4YA 4HDGA 2I0XA 2GIRA 2HGLA 3MFHA 1L3UA 1HNWJ 4KHRA 2LMIA 2YQ0A 3KUHA 1PSDA 1MU2B 1F3VA 8AT1B 2ZVSA 4ICLA 3OVSA 3HLUA 3DRSB 5KFLA 1U24A 2YVSA 3N0VA 1VQOS 3NNCA 3I96A 2AMCB 4KPYA 5GMEA 4WFBQ 2WSCC 3D66A 1RT3B 2QYCA 5ETLA 4ZVRB 2NQPA 3W9HA 4NI2A 2CG8A 2V0NA 1CJKB 5K5MA 2RDDA 4L72B 2F5GA 2HRTA 2OKQA 1X9SA 3EWGA 1B3TA 1ZAWA 3AHPA 1IQTA 3MMJA 4MKYA 1PBUA 4UW2A 1HBNA 3B6BA 1UPPA 3JTNA 5B0EA 3RAQA 5HBMB 1OPZA 5F41A 1QE1B 3VF0B 4RNMA 4CT9A 2C2DA 3KHHA 3KFWX 3Q23A 2H3EB 4J9RA 3MD1A 5K8PA 4WIQA 1XN9A 3FCVA 2JEJA 5I3PA 2J8AA 4JI2J 1HNVA 3QYYA 2XLIA 1S6OA 3DRXA 2LQBA 3IBCB 3MTJA 5F8GA 1Y4ZB 1DBDA 3R97A 4BHQA 2WVDA 3HHEA 1LOUA 3HHDA 1EETB 3AB4B 4IQMA 1BLUA 1RT5A 3NCRA 5KFBA 2L41A 1CG2A 3RBZA 3BO2A 4ITSA 1N5VA 3ZTPA 1XJWB 2BQUA 3TP2A 3GCWP 2RHSB 2ZBIA 1HA1A 4Z2XA 1RK8A 4X4RA 4IYQA 1NB2A 1M5OC 4OLPA 4Y3CA 1G4CA 3D2WA 2XB2D 1B0TA 1NK8A 4ED3A 1X5OA 3EGNA 4PQAA 4OFZA 2MHNA 3I0SB 4DMZA 3H40A 1GTHA 4DPUA 4J9MA 3PTWA 1H6KX 4C3LA 3ZZYA 2A10A 4C8MA 1HBOB 2M3DA 3H7HB 3HSGA 4TQRA 1B64A 4K4SA 2HS4A 2FHMA 3FBBA 2DGTA 4KO0A 5DDOC 3W64A 2V9WA 1Q4RA 5KFNA 1N5YB 1UFLA 3PEJA 2E5GA 1VC6A 2X1AA 1KBRA 1IKWB 3AQPA 4GKJF 2F4FA 1RAFB 4YP3A 4P7VA 1JIHA 3TEHB 5IM0B 4DL2A 1XMQJ 4E0DA 3KKFA 2VBXA 2CPHA 1KTVA 2EXUA 3MDFA 3QATA 4QIGA 5D0EA 5ETTA 1UEVA 3CF5Q 4JI1F 4JI7F 1XR6A 4FZVA 2D1CA 3Q8QB 3DLGB 1S1WA 4WTOB 2NXCA 7FD1A 3WDOA 1HQ2A 3QLHB 5KFYA 5AE1A 1TKZA 3W3SA 3VVTA 8RUCA 3H5UA 5K8MA 2AJ0A 3SI8A 4K0KJ 3PRDA 1K8AT 2KHCA 4F3QA 2DXDA 1IBKJ 4OMFG 2E1AA 3O2IA 2OIHA 4MK9A 1FJEB 3G87A 4DEZA 3NOCA 1Y7PA 1D09B 5L1KA 4DUZJ 1S10A 2J0QD 1S6QB 2AU0A 3OTBA 1OY8A 3Q24A 1IBKF 3OV7A 4X2BA 3G96A 3HDSA 2KTQA 1NPRA 1S48A 2MJUA 3I0RA 4DQIA 2EG2A 4LSNB 3LWLA 1KOOA 3N4WA 3ITHB 4M5MA 1T9WA 2CQPA 2FVRA 3GCXP 4MIWA 3R5GA 4NZ7A 3CEDA 4XTTA 1TR0A 3LH2S 1PILA 4ZKAA 2KT3A 1C0UB 3HP6A 1VQKS 4LFAF 3J7AN 3UQSA 1X8DA 3UDLA 3H8YA 1QUPA 3P8BB 1UA0A 1NB7A 3NMAA 1RGVA 4ZS6A 5GAEU 2JH3A 3DLGA 4KGXB 3SCLE 1U2RA 5HP1A 4WWSA 3M8ZA 2FGCA 4B02A 4R5PA 2X1BA 5IC6B 2X3GA 1S9EB 4ANCA 4LBHA 4CLYA 4N8OA 4UOHA 3MEDB 1RU1A 2VQFJ 3V6KA 2DNZA 1W7WA 4LT6A 2AGPA 2IAJB 3WQPA 2YWFA 4GVBB 2DXEA 1FWKA 2W9CA 5T14A 1C0TB 4NZ6A 2YPZA 5IV3A 1RT1B 4F02A 2FZGB 1FE4A 3PDNA 3QQCD 1S99A 1RT6A 2Z2YB 4KGMA 4OYMA 1AT1B 4ZN1A 4ZCIA 2ZKTA 2XS7A 4U7UK 1B99A 5DG9A 4XPEA 2DIVA 5E41A 1U4BA 2VH7A 2HURA 1B7FA 2HHUA 2IM2A 3GFZA 2BE2A 3PYEA 2CYYA 3SFGA 4NLOA 1WJ9A 1FRHA 1TVRB 2VD3A 4QPTA 2I6WA 4ZVPB 2BOPA 3CC7S 5FJ4A 2DRBA 2K8GA 4DS5A 3CC4S 3PW0A 4K4ZA 2B5JB 2D3UA 2DY9A 2I8EA 3TA0A 1OYDA 2YWKA 4NX9A 2DO0A 1R0AA 1TL1A 4CH7A 3AJ1A 5J1PA 1ZPWX 2XZDB 1Y5LB 3Q2SC 2CJXB 3TOQA 3SYZA 3HFZB 1UZHA 4HL9A 1HKAA 4JI1J 1URRA 4Z7CA 3JTPA 3T1YJ 4ZLLA 2C2ZB 2R9LA 5F8LA 1FJGJ 5C7PA 4LF4F 3FQKA 4DV4F 1TFYA 1HMVB 1XTZA 1IBLJ 4ZVTB 1CJTB 2KFZA 3OT9A 4DL6A 1DTQA 4RW7A 1UWBB 1EHWA 4LR8A 5U47A 3MMBA 5BJRA 4QW9A 3KNAA 3ICLA 2UUTA 2GMHA 3GFXA 3BGFA 4ZVOB 3OR1B 4NLUA 4H4OB 3D6FB 5GAGI 2PA3A 2XS5A 4X4OA 2YWHA 4ID8A 4Y2MA 5HAOA 5E2QA 2LP4A 3C16A 3VTIA 2VPWB 2LDIA 4OZ2A 2DCLA 4TU8A 3T1HF 3R3TA 4DS4A 1KVJA 5A6WA 2L9NA 2X7IA 2NUUG 2IFXA 4PWWA 1U1LA 1CLFA 4AYBD 4ZHRA 2HLTA 1R0CB 4K4TA 1P27B 3K7RA 3KLGB 2PMHA 3UW1A 2P2CB 3U1MA 4DZDA 4EYIB 1RWNB 2AGQA 1RU2A 1FDAA 3JSYA 2V67A 2XSJB 3W9JA 2M8HA 2GGPB 2KFNA 2ZZTA 3GILA 3DMJA 5D4NA 3BN4A 3R6GB 4C6AA 1TFWA 1RLCL 1HNXJ 4P75A 2ZUGA 1NBEB 1WI6A 1NJXA 1TUVA 4NZ0A 4N5SA 1WDTA 2XI2A 2Z57B 4YY3F 3LGMA 4X65J 4YS2A 2CQBA 3PKMA 1LEOA 2LYVA 2O01C 3FEXB 2DGXA 3TAPA 4B3MF 1S6PA 3V4IA 2IVYA 3BPSP 5C5JA 2EVZA 3MPDA 1LXNA 3GR0A 4NCGB 1UL3A 2F9JA 3DRPB 1NK6A 3PJXA 3ZNUA 4CYUA 4A8SA 1SPBP 3NOGA 5B0GA 4YDDB 4BC7A 2PGCA 3AQOA 4CP5A 2W01A 4ES3A 1NSKL 3BGOP 4LFBJ 2ZOGA 3OSNA 1X0FA 2UUBJ 3AD9C 1RUSA 3DU6A 2CPYA 2X1FA 3CJ2A 1BQMB 3C15A 4NEYA 1UWAA 1H0HB 3LP2B 2XLJA 1XMOF 1JLGB 2IM0A 2YKQA 1YKWA 4KRWA 4QBUA 4RWXA 4PRFA 1JLBB 1HPZA 1FJ7A 1FJGF 1FF2A 1QAYA 2Q6BA 1RBAA 1KN6A 3ETMA 1KWMA 4K5RA 1LKZA 1HYSA 2HFUA 3QNWB 4WK1A 4YMEA 2NLWA 5DQHA 1SVDA 5LOQA 1FWPA 2MXYA 4CT8A 3IR5B 3J7YI 5KFSA 3QSYB 1RHQB 5I3UB 1ZTWA 2UVRA 2YNHA 1M1HA 3KNGA 4JOUA 3ISZA 5C42B 3WX8A 5KFGA 1RKIA 1Q79A 3ZC4A 4RUBA 3V4IB 2LLZA 3NGKA 3PEHA 3BH6B 2WVEA 1RTIB 2DJWA 4HACA 1H98A 3VGUA 1HNZF 2HZAA 3DLHA 5LT5A 2CJBA 2QX0A 3DOKB 4ZPWR 1GXUA 4LREA 4XDDA 1GMVA 2OTJS 3DC2A 1BQNB 2VPYB 3D9BA 3AJ2A 1SC1B 3OTOJ 3BF4A 3HZEA 2KXNB 5LSLA 2ZH5A 2OTLS 4KHPF 3RAXA 2GAHC 1H38A 1ZZFA 3TZZA 5BYSA 2MQLA 5BYQA 2MGZB 4NMLA 4FBUA 3IC1A 3W7BA 2M2BA 2IAJA 4ZCLA 2WZ1A 4HDHA 3LQVA 4PXCA 2ZD1A 1T9TA 3D28A 3H2LA 5T7LA 3ZZPA 1ICEB 2J9CA 5LXRA 4DV6J 1X4AA 3RBXA 4DUTA 4JI4F 1IN0A 3HFKA 3QZ7A 2D3OR 4ZITA 4MKBA 1CS4A 1RTZA 2HNDA 4HYKA 3QAUA 3R5DA 4C8YA 1OY9A 3H25A 1WELA 2HFOA 5KG0A 5DM7Q 4DR6J 3CJQA 2DBBA 4ETZA 2XY7A 3DYAA 3T41A 4LF7J 3QGGA 4BBYA 2OSRA 4Q2LA 4I67A 2BJ1A 1LW2A 2IYGA 1CULB 1Q78A 2VU5A 3UDEA 4MIAA 2CQ2A 1K73T 1FO1A 2ABYA 2O67A 3M4XA 4TYAA 3R7NB 4RW9B 5E5NA 4H4MB 4JUZA 2CIMA 5J2QB 3CJRA 2FHKA 4BDPA 2MKIA 1UMJA 1KRPA 3BYPA 1SH3A 1IR2A 2E5LJ 1U1RA 2ILZA 4PYDA 3TUPA 2RNEA 2XHCA 4DLGA 3RW6A 1CVJA 3TZXA 1LW0B 1TV6B 2N4CA 2V4JB 3FFIB 3UN2A 3PCOB 3MPWA 1VIOA 5CH7B 5C2GA 5AJ3J 2VA2A 5A8RB 2HRYA 3GU0A 3JQMA 1BQNA 4PXDA 3GV7B 2RDJA 4HI2A 2VG7B 1WOSA 1UJ5A 2CWXA 3QLHA 3D1HA 5EX0A 5J1NA 1EKSA 1WC4A 1NK7A 4LF6F 1T03B 2UUWA 4FYXB 2ZHOA 5GVQA 2HFZA 4UF4A 4DFMA 1GXLA 4LFCF 5IZHA 3GR1A 2VG5B 4C8ZA 4PZVA 4NLPA 2BUNA 2C3YA 3UCUP 2VFSA 1S1TB 1ULRA 3SBMA 4OHYA 4OI1A 4ED5A 1Q0NA 4OYPA 3KHGA 3GIMA 4FBTA 5D15A 1L3SA 2QL5B 4DG1A 1JJ2R 5JXSA 4JYAF 3GYNA 1VC5A 2FLOA 8ATCB 1RHKB 1M90T 1QM9A 2A2DA 4QPXA 2W2NP 4URGA 3J7YU 3EM1A 1K1QA 1REVB 1NMEB 4HHJA 2B8QA 4RW4A 1S1UA 2BX6A 5AE2A 5L38A 2KJVA 4NWBA 1SV5B 4NMXA 1TL7A 2XO7A 1N33F 5KFOA 1J2VA 2LQ9A 4RUHA 4OZ3A 4JI4J 3UD4P 1R0AB 3G2XA 4LF5F 1HIYA 5A8KA 3IG1A 3O8WA 2BBEA 2W25A 4C0HA 3MM9B 2HEKA 4LRAA 4YB5A 2IC3A 4CI0B 5IQ6A 3OUYB 1VISA 2E29A 3BZQA 3HT3A 1N5QA 3KK1A 2W7PA 1RKJA 2AP6A 2BJEA 5CA5A 1B4SA 4KR0B 1KD1T 2Y8YA 4IG3B 2V4QA 1SIWB 2WVFA 2R8GA 5C42A 4KY3A 2KU7A 2ACMA 1VQ8S 3ZFVA 2HHXA 3MPVA 1WTFA 3M2UB 3PRVA 3HMJG 3OFHA 2AKWB 2E7WA 1RWPB 3MM7B 2HYIB 2FJDB 1KFSA 4PKDB 5DETA 1R6YA 3S7RA 1T95A 2GQQA 2HBYB 2WSFC 1HLWA 1YZ7A 3I4PA 3CCRS 4USHA 1FXRA 4CDIA 3HX9A 3JXOA 4F36A 2OHDA 3GIJA 1HBMB 2ZH6A 4EBCA 2DH9A 3F41A 2I5JB 4DSFA 1SJRA 2BJ7A 4DF8A 1NK0A 2XGPA 2KO1A 2VUGA 3RUBL 4DBQA 4KC5A 4DCPB 4OHZA 3VR1A 1Y0HA 5IC4B 3CTRA 2HQGA 1RE1B 3C14A 1Q53A 2B56A 1MU2A 1AFIA 2NS1B 3TX8A 1OMSA 1WORA 4PG7A 3PW7A 1O0PA 4FXWA 1RB0A 1D0EA 2IA0A 2HHHF 1KDNA 2EFPA 3KJFB 3K8VA 3PYFA 4OI4A 5K14A 3EX7B 2QEXS 1EAYC 3LALA 4LQ3A 3CJ8A 4QWCA 2Q66A 1CJVA 3TA1A 4LRBA 3VGVA 2VB6A 3IG1B 4KT0C 3MGJA 2A6MA 2VBYA 1ZOTA 3G82A 4JI8F 4EO8A 4ZIVA 3OUYA 3KK1B 1YHQS 1QSSA 5DG7A 3HHNB 2UXBJ 1N6QA 4DR2F 1R89A 3I0RB 2XCPA 1S0VA 2KZMA 4Y34A 2FTRA 2J6TA 4C8KA 2CQ0A 3R5BA 3HHKA 2BKPA 1HD1A 1BQMA 2WCXA 1NKEA 2L3MA 2R42A 3HI9A 4FYYB 2GZOA 1FNXH 3P49B 2LU2A 2FJBB 4OZ5A 3WIUA 3OL7A 4LFCJ 2F7VA 3PKYA 3M9OB 1TQLA 2WSEC 2DXFA 4Y2CA 2BQRA 4KHMA 4B3SJ 2WAQD 3MI7X 2C2EA 3ENVA 4O23A 1YSJA 1TKXB 3H5XA 2R7TA 4ZVFA 3V81B 3WZ0A 2E1CA 2KL8A 2L9DA 3C19A 3W63A 5HQMA 2HHVA 2FGOA 4FPIA 1FKPB 1VQMS 2MZ1A 4NLRA 4E8UA 4F0KA 3CD6S 1KTQA 2CPZA 1XK8A 3NGSA 4UTGA 4K4UA 1BUXA 3J80U 2JLGA 2ATCB 2W8LA 2V8PA 1JLAB 1VRTB 2OPPB 4EGLA 4WFYA 2XCAA 3E51A 2F63A 4ANEA 4Q45A 2PN6A 4I69A 1TK0A 1M5VC 3GP9A 2E5LF 4C7QA 2Q6CA 1EX8A 2RQKA 1FT8A 2AEFA 4RW6B 5CD4H 3NL0A 4ED0A 3PJWA 2VZ9A 2H54B 3EXYA 2E7VA 2Z2LA 3N5FA 3RJMB 2V2ZA 4LVNP 4NYOA 3TWZA 4ZJQA 4AL7A 4O3SA 1VQNS 4MKVA 3RB0A 2C3MA 2GC8A 2UU9J 2HNZA 1X4EA 5DGBA 3CXCR 3A8KA 1EKRA 2UZAA 1UVLA 1SCJB 3LW5C 3KMSA 1SJ1A 2FIUA 3G9CA 1A9NB 1GH8A 1VRUA 4FXVA 4DSJA 2WBRA 2F4VF 3PRBA 1AFJA 1RYRA 3FKBA 5LSOA 1GAOA 4JV0A 3Q89A 5A0YA 3WC0A 5I42A 3PO4A 4JI6J 3RU0A 1IJEB 3TJ9A 2G9OA 2MKCA 5EWGA 4M5GA 4F3OA 5EN1A 2PEBA 2ZUAA 4TU9A 4JYAJ 1UZDA 2MKKA 2AEJA 4LIWA 3DLKA 4U8VA 1WHYA 5L9NA 2KB2A 2F8MA 2QZ8A 2UV8G 4GRSA 3IP0A 4DSIA 2AX1A 3PX6A 2V50A 2BW2A 3N6LA 4K50A 2PMWA 3MM8A 1J5OA 1NDCA 1HBNB 3B78A 2IJFA 3N5BA 4EZ9A 4NYPA 1SQFA 1X9WA 1NDKA 1VRQC 2KVIA 3HHLA 3QT8A 1NEEA 3DM2B 1X4HA 4OX8A 1HWIA 3SEOA 1WG1A 1RISA 2ZE2B 1QDUB 1PKUA 2ZBCA 3FDSA 2EEYA 2DNLA 4Q8EA 1Q1KA 1RABB 3PFOA 2NREA 2OPSB 4DL7A 2DR6A 3A13A 4PCQA 4RW6A 1XR7A 1QSYA 1RAGB 2MKYA 5HMYA 2HAFA 3UFCX 3DU5A 1L3KA 1F9FA 3HD1A 3SSQA 1QSLA 4QIWD 5GADU 1HW9A 2DR5A 1GEHA 1ZAVA 1RAOA 2B9WA 3MR7A 4MFBB 3CPWR 3JYTA 4K4WA 5KFRA 3TUJC 3CJTA 3T5JA 3KLHB 3OBIA 2UVVA 4O3RA 4X66F 3OLAA 2RHQB 2CPDA 4C3KA 3JS9A 5D3GB 1BGXT 3ENQA 3QRPA 1GTEA 3BKTA 3ZZOA 1U8WA 3TA2A 4TVAB 3CVKA 2O1PA 2EFGA 4ED4A 4WFAQ 1SKRA 2CQGA 3R1HA 3FC9A 1RT6B 4JB8B 3ZZZA 3CJSA 3DRRB 3QT5A 3KJVA 1SC4B 2YKNB 2OH2A 2QRRA 2RH3A 2CJKA 1SB6A 4FVMA 2XWYA 1IQZA 2DNNA 1SI9A 1XQIA 2J0XA 5KFPA 3I6PA 4HEA9 1XERA 2K7JA 1DQ8A 2K7KA 2WVCA 3FNNA 1DARA 3H59A 1YJ7A 3I0SA 2XQCA 3NP5A 2RE1A 2E9TA 1U2FA 4RBTA 3ZTRA 1CQMA 3AD7C 3DXBA 4DOZA 1HQEB 4MYUA 1P1TA 1S76D 3VCDA 1WHXA 5FLXU 5DLFA 2WVBA 4HTIA 4IH6A 1FKPA 1RT2A 2C2OB 1ZZNA 2Q79A 5KOWA 4EEYA 1YJRA 4LIRA 3SCJE 4IR1A 3KG0A 3JYTB 3PM9A 3GPAA 1S72S 1VQ5S 4PG5A 2OEKA 1KKHA 3HHLD 3C6UB 2J8SA 1UVIA 2RJZA 4ZP8A 1WSVA 4DX7A 3G4SS 4CTAA 4RX6A 3EYZA 1FKOA 4FYVB 4ZJOA 1DHMA 1JLBA 4OYZA 4N47A 3DDNA 3K0JA 1HL6A 3MF5A 1JMTA 4KIAA 4EYHB 4L74A 4RNFA 2J7KA 1LWFA 1RTJB 4WFNQ 2EW9A 3N6MA 5HVGA 4NYZA 4ILLA 1U2CA 2IDLA 4PYAA 1IKXB 3TZWA 5B0DA 4OYXA 1NCLA 3NLCA 2FC8A 3K5NA 2EFOA 2KI2A 3K5MA 1S1TA 1IKYB 1YRTA 3K5LA 2CFXA 1NKBA 2DR9A 3NG8A 2AZ1A 2QMUB 4DPYA 4Z7YA 3ENWA 4J9KA 4QYZJ 5F8MA 4QU7A 1BHNA 1PAUB 2B43A 1U02A 1T94A 4EBDA 1UETA 1NXIA 2DNQA 3D0HE 3UN3A 4UOCA 4I56A 5MLCV 1YGYA 2DNKA 2OFGX 5C24B 1RCXB 2QIFA 2K2PA 4H4OA 4WYLA 4WFZA 2YNGA 5HO4A 4NPOA 3I87A 3DMJB 2X1GA 1H7XA 2IBOA 2BEFA 3TEGA 3BSOA 3NAHA 3DM2A 1IKVB 3ZTOA 2ZJPQ 1FK9A 1P9QC 2E7XA 3UDVA 2MQPA 4ECSA 2XY6A 4ZP6A 3ILOA 1RACB 2P9GA 1R8AA 1X4CA 3R7SB 2DGSA 1MLAA 2H48B 4K8RA 5B7WA 1OQ6A 3JSMA 2Q43A 4DG1B 3F73A 4DUZF 4DV3J 4C8LA 4UY85 2RD5C 1UVMA 1MWQA 2H1YA 4LSLA 4G1QA 3M2UA 3P4UB 4QR2A 5JVHQ 1JJCB 3ILIA 1S1XA 4B9MA 3GYGA 3M8WA 4IFYB 5GAHI 2W4PA 1APSA 3OJUA 4FF2A 4ZJLA 2FJWA 3QJJA 4GKKF 1KLNA 3MURP 4LF1A 1U26A 1VI7A 3PIPQ 3OHAA 1ZM4A 5GADI 1ACMB 3G8SA 2MQMA 2WW4A 5F9NA 2HVEA 2N3LA 3A3PB 4ANDA 2P5VA 2IJRA 3CD7A 3I4HX 1S1VB 3AA9A 3DI6A 4ELTA 1SC6A 2H65B 2SXLA 3FZ2A 1WC1A 3MECA 5LSRA 2CKWA 1V5IB 2HNYA 1T05B 1ZETA 2ZJQQ 1SJFA 3J81j 1Y5IB 4QYRA 3IMQJ 2VJUA 1CSJA 4OYWA 2FJAB 2DNMA 5ETRA 4EMDA 4O4GA 1HPZB 4EUVA 5JMNA 1HMVA 2JHEA 1FRLA 4B3SF 3M1VA 2HVZA 4U95A 4YFUA 3KLFA 3CC2S 2DPIA 4HHUA 1RTHB 4G6VB 4USJC 4DN0A 5A2QY 2ERRA 3D67A 3EUNA 5CQGA 3KK3A 2APOA 2DNPA 4J9OA 1JJHA 4YN3B 4PWDA 2JZ5A 2YKMB 4OYBA 2CUYA 2E1PA 2MQQA 2AJ1A 3PFEA 5KG5A 4LFAJ 2UXBF 4DL4A 2RAQA 4IRKA 3KLEA 4NA1A 1RTIA 3GWCA 3SCIE 1VQ6S 3HVTB 3MEKA 5A2QU 2HAIA 2E1RA 1T8EA 3M7VA 4OX7A 2G13A 2KVQE 4DL0C 1S9EA 4V19J 4DX6A 1U1OA 5HANA 2VJVA 3NNHA 1S5ZA 1VFJA 4UUWA 1DLOB 4OJHA 1SUQB 5K8NA 2X51A 3GIIA 3TANA 2U1AA 3HF5A 1SQEA 1TAQA 2ROGA 3EZUA 3ZZTA 3GJRB 4RW8B 3K89A 1VHFA 4Q0BB 4EBEA 3JQJA 4F04B 2DT9A 1YJWS 4B3TF 3HJVA 4ZP7A 2PA8D 5CCMA 2QT7A 1TZ0A 2YX4A 2MGZA 4I1TA 4JV5J 4AD6A 3GG0A 2LQJA 5G0RA 3V2UC 2K1RB 1P6TA 1BE4A 2B0GA 3CE8A 4ZK7M 2BRLA 4DL3A 4IRDA 1M1KT 3ENAA 4Y2AA 3GJTB 1U0SA 1EQ0A 2VG6A 4DUYJ 4DV2J 1DZ5A 4RNNA 3AAWB 5IQQA 3JQKA 1U7LA 4FF4A 2HVIA 2R7UA 5EWEA 4WJBA 1YRUA 3MR6A 1DAXA 2POKA 2PE8A 1XC9A 2UVUA 3Q2TC 4YOEA 2I38A 3PNIA 3J7Z5 1FKOB 1NPKA 2DY1A 1YTYA 3LA0A 3OPKA 4NCGA 4ED1A 1U1PA 2G0IA 1RYSA 3EJMA 3QJPA 1FRMA 2CJYB 4DFPA 1X5TA 2JWNA 3OXFA 4DPOA 1JJ4A 4JI5J 3BM7A 1YI2S 2VC1A 1NJWA 4L73A 3TQ1A 4C48A 1WNEA 1B0PA 1S97A 1Q95G 2LU1A 3B4MA 5FLXY 3L7PA 1Q8KA 1ZBTA 2B7BB 3RBDA 1CC7A 1IWGA 4QZVB 2JEGA 3MOJB 1FD8A 1T9VA 2B9XA 3UO0A 3KLEB 2KG1A 4LF8J 4QIFA 4OJ3A 3HJFA 3OQ2A 2ZOFA 2HHHJ 2DNHA 3W62A 1HNIA 1V3ZA 2A18A 2YX7A 3M6XA 3AB2B 4ZP9A 3SSRA 3MM6B 2YKNA 4BS2A 1XNQJ 3TVKA 2YKPA 5CHCB 4PAAA 3JAMY 1JXLA 1N0VC 3CJ0A 3GLJA 7AT1B 3K57A 1U48A 2BANB 3GV8B 4Q0BA 1IWAA 5LL6d 4QIVA 4ATNA 2EPIA 3M30A 4M5HA 2W9BA 4PUOA 2VPXB 2MLZA 1HR0J 2VG5A 1HHTP 1KS2A 1S7IA 1RAIB 1WEYA 2G1DA 2JOQA 4GMKA 3QT6A 4QR1A 1EIYB 2C42A 3VGSA 2QLXA 5F8HA 4UUXA 2ZITA 2VG7A 2ROPA 4M94A 3AOBA 3OTCA 4DFKA 3Q8VA 4BC9A 4AXJA 3CMAS 2PIIA 5J1EB 2EFQA 3K2YA 3PXGa 4KO0B 4DX5A 3JB9k 1Q16B 1QVFR 1DTTB 1GFWB 3NKYA 4TYBA 2GVZA 3CO0P 2QLFB 2D74B 1TL7B 4W92B 1OWXA 3M9MB 5E7OB 3CDBA 2I9SA 4LSZB 5KT5A 3D3CJ 4AFFA 4OI2A 4A47A 1WKJA 3BGUA 1REGX 3FRYA 5D0HA 3J80Y 5D4LA 3QJLA 3RZAA 3KLIB 2H51B 1UP1A 2MY7A 3I56S 5IT9U 4UOGA 2EC0A 3R9LA 2A1BA 1RHRB 2RU9A 4FKYA 2DR7A 2MTLA 3DOMB 2C2NA 1IM6A 4NRUA 4URSA 4ECRA 1HD0A 1RWWB 2ZEJA 4OX6A 2A2CA 1F1BB 3HKWA 3PX0A 4HH0A 1VQLS 1RT3A 5ETVA 2Z2ZA 4R8UB 4K2XA 1WEZA 3BYRA 4DV4J 1CPZA 1CULA 1F3FA 1R3NA 5ETQA 2HS3A 4OJ1A 1N5SA 2WRMA 3UNGC 1Q81T 4X4QA 2MZRA 4CZCA 4DQQA 2AHOB 2LCWA 4CIOA 2CPIA 4CLLA 4G1IA 4A8OA 4U7UD 5I42B 1HHQA 2E44A 4Q2MA 5B0CA 2XMVA 3GQCA 1QE1A 3CMQA 1HARA 1GK8A 3ITHA 2W7OA 5GMDA 4K4VA 3HVWA 2R7SA 2NYHA 3H5SA 3QWUA 4QW8A 2W24A 2N4DA 2IM1A 1TUGB 3GFYA 4QWDA 2Y9HA 3EE3A 3OVBA 2BA9A 3H90A 4KV8B 2RQCA 4H4MA 2BR0A 1GMWD 1VGYA 3PX4A 2GW8A 2QMXA 2QV6A 2GMJA 3A3NB 4TU7A 1VHIA 5EUHA 1S77D 2GVZB 4FP9A 4M5NA 1JQGA 5CAAA 1C2PA 5GMKa 1M5KC 2EFVA 1S79A 4M8LA 5J2NB 4E2FB 3A8IA 4WZMA 2BJDA 5J2MB 3NBPA 1FNMA 1MWYA 3VGTA 2AJQA 5CYMB 3M2RB 3FSYA 1D9FA 4GC7A 4F8RA 2CPFA 2KDOA 2VFUA 3MOZA 3J81Y 1AYEA 1Q7LB 2M88A 4LBPA 3IBFB 4ZVQB 3W5XA 5H1SV 2QA4S 4LRCA 2KN4A 3GTYX 2Y1LB 2XEXA 3M9NB 2CJQA 2EKNA 4IRCA 2BM0A 2NXNA 4LSLB 4A4JA 1HNWF 3M6UA 4MMOA 2JL9A 4RBUA 3FQLA 4AQYJ 1MWZA 2V5HG 4CNZA 3VAIA 2ZHBA 2WONA 3BEGB 2H5EA 2ZDOA 3POTA 1JNRB 2V68A 5FIIA 3B82A 4ES1A 4DQPA 3KLFB 2FB0A 4FVCA 1L3VA 2JVRA 2ZHAA 2BOAA 3SMZA 4DR3F 3LGHA 4S0MA 1E6YA 1WACA 2PT0A 4RNHA 2DYAA 5HROB 2LDYA 2MEWA 3DLEB 2UP1A 3HHLC 1QAXA 1OSCA 1D8ZA 5KFFA 2ASLA 1HBUA 3M8PA 4V19X 2GHWA 4X4PA 3GONA 3MMAB 3H4BA 1N5TA 4G65A 3CCJS 2J6SA 5DQIA 2R2UA 1RHMB 2B6AA 3ELHA 3CUNA 6AT1B 2ASJA 2KJWA 1URNA 3CDWA 3LP1B 4GO5X 1KHVA 2GJFA 2YQ3A 1WHVA 4K2JA 4L6V3 2BE2B 2CPXA 3HPOA 2XYHB 2FLLA 3OLBA 3M2VA 2XGQA 4PG8A 4FPRA 2MQ8A 3MUTP 4Q5VA 2BANA 4WE1B 3H20A 4OYAA 2D9OA 1FJCA 2AIRB 5IFMA 4Y00A 5J2NA 4IO9Q 4ZMMA 1T7PA 1XNRJ 2VBWA 4C8OA 5KFUA 3KLVA 3D5MA 4MAKA 1LW0A 2V4JA 3HZGA 3M32A 4USTA 5L1LA 2MKHA 4WKRA 1NLKL 3C6TA 1NK5A 5AXNA 5LJ3Y 4UQGA 1R8PA 3BGLA 3SIPB 4X84A 2YKAA 4E98A 5K20B 3MCOA 5E3CA 4NXNJ 4ZA1A 4PABA 2CZVC 5KT4A 3BSAA 2DRDA 3E8OA 3K5PA 3SQGA 5KFVA 4CRJA 3MEEA 1JKHB 1Y00A 1DQAA 4A8MP 4ER8A 5K14B 4C4WA 1VJQA 1TTHB 3OSPA 1GMWA 3R6LB 3JSRA 3NY0A 3NXZA 5EWFA 2JNJA 3O3LA 5DDQC 3EGZA 1FDDA 3LP1A 1ZAXA 2HMIB 2HWTA 3D0GE 4KGKA 3U7JA 2V69A 4NLDA 5HMXA 1RWUA 3L95X 4L76A 4ECVA 3UVJB 1VLYA 4A8XA 4OHVA 5KG2A 2B9YA 2F3JA 2VIHA 2RT3A 4WP8A 2AT1B 4ZPTR 2FJXA 1IKWA 3PHTA 1U8SA 5KAKA 1U0HB 2UXCJ 1DURA 1RTJA 3RRGA 3HK2A 4PWDB 3BGRB 3L09A 3OTDA 3CCLS 9RUBA 2CZ4A 2J7UA 2FVQA 2NR0A 2MLXA 1RJJA 1LWEA 4F67A 3N28A 4C9DA 2HWIA 1OPIA 2DTJA 2DNYA 2X3DA 2RKIB 2L9WA 2PEHA 3NGUA 1A6LA 3SSSA 3V5RA 3W65A 1KP6A 4LFBF 2HNYB 2VODA 3TUZC 3Q0AA 3DOLB 4RR5A 1X4FA 1NO8A 2IHR1 4B3OB 2DK2A 2O66A 5IWAF 4XAKA 2FLPA 1YLXA 4JV2A 3D4JA 1K9MT 1V5VA 4Y2KA 4LMZA 4L3KA 3QRRA 2UV8A 1RQ0A 4AL5A 2PFFB 3R1LA 1I3OB 1TKXA 5EX3A 1UFWA 2IC3B 4JBCA 4N56A 1ELOA 2HLUA 3D6HB 2XZTB 4HTJA 4DV2F 1N32J 2HK3A 2FYXA 4NE9C 1JKHA 4ZPAA 1TMMA 3EZ5A 4TXSA 3DFEA 2BJ9A 2AWZA 3LP0B 2IMOA 2ZM6J 1NK9A 2Y1RI 2YNIB 4WPAA 1XWLA 3HFVA 5EDWA 1X4GA 2D9PA 2XTJP 2XSFA 4RNOA 2FVSA 2IRYA 3ONQA 3RBEA 2ZZMA 4LRFA 4KE5A 2JDJA 4BWJA 1EZZB 3R7BB 1JXVA 5ETKA 2AJFE 4I7FB 1PAEX 1R7IA 2DNOA 2M9KA 5HVHA 4J9PA 4NLTA 2OJ3A 2XLKA 4B3MJ 1L5UA 1F5BA 4P72A 1A0OB 3AY0A 2XMAA 2VQFF 1UFKA 3KG1A 4IG0B 1LW2B 2DR8A 2G2YA 3C6UA 3CJ4A 3R5AA 4USIA 1U1MA 1Y9OA 5ETPA 3T1YF 1NU4A 1C0UA 4NLVA 1R43A 3VWSA 2FY8A 2GAGC 3T19A 5L46A 4DR3J 2UXDF 1X4BA 3PYDA 1O6XA 3C14B 4Q43A 1F6TA 4M5DB 3KUGA 4ILRA 4WYWA 1OSDA 1T11A 4DV1J 1R8BA 2KXHA 1HBUB 3M8PB 3PW4A 4NCAA 2BKOA 4NXNF 1P8GA 2EBEA 3G86A 2B4UA 3LGNA 2RSQA 4NLWA 4WP3A 1CS4B 2HNDB 5HMWA 1TAUA 3UD3P 1RT7A 4LF6J 4JI3J 1LWFB 4DR1F 1FKAF 3QRQA 4X4UA 1MROA 4XK8C 2OMLA 3IWLA 2GGPA 2M0GB 5KFKA 5KT7A 3IRWP 2PMZD 4CO5A 1S0OA 4KKOA 1QAJA 1TKTA 2QA2A 5KFWA 4OI3A 4X4SA 3QGIA 3MUVP 2V4RA 2QA4G 2UUAJ 1BD6A 1RWVB 2XI3A 5DZ7A 4MIBA 1JK9B 4F26A 1HWKA 2CAJA 1S59A 3V6DA 3R2CJ 4YB7A 5D78A 5KG3A 1UEKA 2GIQA 1X0PA 2UUAF 3I32A 1F9HA 2W4CA 1SUQA 4PEOA 4DWIA 3KOAA 1S9GB 1S1WB 5M2PA 2VFVA 1JX4A 1WG4A 3ILJA 3OFGA 4KPCA 3D3BJ 2ZH3A 5C25A 3A3OB 2B4PA 1YDLA 2ZWOA 5BR8J 2CJAA 3IAS9 3M30B 1DTQB 4RW7B 4J9LA 3V6JA 3E01A 1RTDA 4KH1B 4WF9Q 3GB0A 1K1SA 4FYWB 3SZ2A 4USMA 3P96A 2Z2MA 1KLMB 4I2PA 4OZ1A 2Z58B 3NS5A 2WONB 4IH7A 3S01A 3POTB 2F9DA 3CO9A 3NCQA 4Z37A 2E1MC 4USWA 2OLWA 3HXMA 4P10A 5KFXA 2CNLB 4C0BA 1NJZA 4ETXA 3MMCB 2OUGA 2G4BA 4B9LA 2V8HA 2M5YA 2U2FA 2DH8A 2VICA 2DHAA 2ZC3A 3FEZA 2MPUA 2KRRA 2GA7A 5GAEI 1PGZA 4BWMA 3MM5B 4PWUA 1S7HA 4RUCA 1S1VA 2KT5A 4YB1P 3MR2A 1RSCA 4AL6A 3EPGA 2MJNA 5JUMA 2YNHB 5HMZA 3DI6B 3W8GA 5E3AA 2CADA 5KG6A 4G1QB 3MZIA 4LJMA 1M0SA 5CD4A 3EVWA 2VFTA 3M05A 2GX8A 3VAGA 1T03A 3BB5A 1HNZJ 1O51A 5A8KB 3IAM9 4IOCQ 4B3OA 1VDHA 3E2EA 1VS3A 1ITPA 2DEJA 2YWEA 3H5YA 2XHWA 2BKNA 1X9MA 3NMRA 3OR2B 4Y6IA 3CJKA
chains in the Genus database with same CATH topology
1KR4A 2OPSA 3W2WB 1TK8A 3VAMA 2N7CA 3X3UA 3MM8B 2FUG9 1J5OB 4F4WA 1U6BA 4DV1F 4U9RA 1S0NA 3PZPA 4CCHA 1V3SA 2KHDA 2HIQA 2BZ2A 1BQXA 4RW9A 3KTQA 3G71S 3QMQA 4NOHA 4QR0A 5L8RC 1CC8A 3DGPA 4RZRA 3DYAB 3VALA 1N36F 2HMIA 3THVA 1WF1A 2WB4A 1M5HA 1IKYA 4C3MA 2M7SA 1FXDA 3C46A 4P2SA 4C97A 1G7CB 2RQMA 2AGOA 3MM5A 4ILMA 1IBLF 2MY8A 3LPYA 2AW0A 3N9UC 1UEUA 2R7RA 2FC9A 1N48A 3CJKB 3W2WA 5E3RA 2R2TA 1DQ9A 4ES2A 3C66A 1RDRA 1MMNA 3I82A 3T1AA 3MEGA 4OZJA 1ROFA 5JJBA 2KKHA 1T3NA 1DJ0A 1N52B 2E5IA 3DRSA 2CVEA 3DRRA 3KJVB 2CPJA 3SV4A 2XMUA 2KM8C 2ASDA 1N54B 3F56A 3GE9A 2QLWA 3LO3A 3CCZA 5AXLA 3BO4A 2HVHA 1LK5A 2R2SA 2XWXA 4Q8FA 3OXGA 4HLBA 2ZH1A 1HQEA 1VBYA 1NKCA 4Y0FA 1JLEB 2YKOA 2ASYA 3ETOA 1C4CA 4MK8A 4NLSA 3IGVA 3NBPB 3UCZP 4AXIA 1NNDA 3TVYA 5CYJA 2J9EA 2V8DA 1FDBA 2I1RA 1Q82T 3UCGA 3CCES 2DGUA 1RA6A 4KBIA 2CG4A 4I2PB 4M1KA 1C0TA 1RI7A 3T9ZA 1RT1A 1HBOA 3TI0A 5CCLA 3L3CA 2CQHA 3K59A 5A8WB 3BQ0A 4KQZA 5I4MA 1SJ3P 1KSPA 3T6BA 1GXTA 4WZQA 4A46A 2RVJA 3QIPB 4I0WA 1ZH5A 3OL9A 1JLCB 2RRBA 3QO9B 2PC6A 4ZVGA 4DV0F 1LWCA 1KQKA 1FD2A 2KXFA 3H4DA 1T3OA 4XDCA 2RMLA 3FMBA 2CVIA 1KC8T 1BY9A 5HL7Q 1PC4A 4ZOSA 3G6XA 4J9LA 2MMYA 3FSIA 3HVTA 2HQIA 1FE0A 2IVFB 3GSDA 3MMAA 4DJBA 1WTBA 5F3ZA 1SJQA 3M6WA 4FNHA 2FLNA 1IUJA 1QAIA 2RF2A 3W2VB 3PR4A 2R8HA 1QTMA 4KFBA 3BR9A 2EKYA 5HROA 3DOMA 5CZXA 2Z8QA 3DN9A 1QLNA 1LQ9A 1H2UX 1YRXA 3LP2A 2VASA 4I68A 5AJ3F 4M95A 2RS8A 4ZCKA 4KSEB 1JLFA 3I5AA 1N56A 1KHWA 2CQ3A 2MB0B 1U1QA 2EBGA 4TKTA 5G0RB 4IQXA 2PDAA 3IS9B 4YUDA 1UVJA 2R8KA 4OI0A 1T05A 3I5BA 2JC1A 2YY3A 4IDKA 5DS7A 1RA7A 1NHVA 3N01A 3OTEA 3SDEA 5IS2A 4N76A 1V3RA 2IRXA 3CCVS 2ZH2A 4DR6F 2GJIA 3MMBB 3P5TL 4ECYA 2ZNYA 3C3LA 4OX9F 3SXLA 2C28A 2R7XA 2JX2A 4Q7AA 1FRKA 3T9NA 4NLGA 3GIKA 4U6PA 4DR4F 2XSJA 3TARA 1SV5A 2W9AA 5KT6A 1VQ9S 4ZCMA 1L3TA 2KZZA 5DM6Q 3MAQA 2E66A 1HNIB 2VQEF 3IN5A 4Q44A 1T02A 2BXJA 2M4MA 3JSBA 3OTOF 1LV5A 5IXUA 5HI7A 4ECWA 3RB4A 5J1EA 1TVRA 3EPIA 2IMWP 3UDCA 3B8HA 3IA0A 4CNYA 3U02A 4IDKB 2D41A 3SDEB 1KEKA 2HHQA 3T6JA 4Y2IA 2DGWA 3SV3A 1N5YA 1JWWA 1Q7YT 4IH5A 1CQNA 3ZZRA 2LXUA 5A8RA 2P6SA 1EP4A 3IS9A 1VBZA 2EK1A 2LXFA 3IFEA 5HBMA 2KH9A 1TL3A 3D54A 4CO3A 4TLQA 4MYTA 2MYFA 3CCSS 1VMBA 1FERA 3OFFA 3MXHP 3BREA 5AXKA 2V9KA 2RRAA 2K1RA 2DRAA 2JFDA 3MR5A 4M63A 2B4VA 3K5OA 4A8QA 2W9CB 2FPHX 1LFWA 2UUBF 3UI3A 5H9FJ 2YNFA 4B9SA 3M2VB 2RILA 5KFEA 2MHEA 2DO4A 4DV5F 2YNGB 3V6HA 5KTQA 4DX8H 1KOHA 2NXUA 2O3DA 1N4LA 2R7OA 5DG8A 1ZM2A 2LQ5A 5B0AA 5AXMA 3BDPA 1O8BA 3OXLA 5M2UA 4YHHF 4ECZA 2DPJA 4AE5A 2AF6A 2G0CA 2MKSA 3VQSA 1SBRA 3G6VA 4A8YA 4OZLA 2F40A 1W25A 5DRKA 4JI5F 4K59A 4DL5A 1MNEA 3MD3A 4CTAB 2XNRA 2PD1A 4K5SA 3JTOA 4LQ9A 5D8HB 1HQUA 2BACA 2FVCA 1YVFA 3DOKA 3OL8A 4IOBA 4EZ6A 2XMKA 1D1UA 4PR6A 4ZHRB 4O0IA 4ID5A 1FRXA 3MM7A 4FN5A 3SCKE 2WB1D 3X1LB 1K0TA 2AX0A 2FHOB 3FMWA 5L39A 5DLGA 4A8FA 3UE2A 3KHLA 1X5PA 4FF3A 1U49A 4IG3A 2VOOA 3MECB 5LMUF 1C1BB 2OPRB 4QOTA 1D9DA 4NA2A 4NA3A 1S6PB 1FCAA 2NSCA 4ZPBA 1UJ6A 2ADCA 4ZLPA 4XIUA 5LMNF 4FF1A 3O1LA 4QWAA 1YITS 3M2RA 5KFQA 4IO1A 3FJ2A 3PW5A 4O4RA 1MMDA 2WHOA 2QA1A 4J5OA 4OHWA 2WW8A 4I6YA 5F0UA 4DV7F 1F60B 4FYDA 2B51A 2HG4A 1ZTTA 4U67Q 2XMMA 1VIXA 1AUDA 3KLHA 1FDNA 1JNZB 1OIAA 2R8JA 1CEZA 3CDAA 3RAMA 3N6NA 3KLGA 3NRBA 4ELVA 2P9CA 3DHWC 3LWMA 2XMJA 3QAEA 2RB7A 3CCUS 4DFJA 2JLFA 2XY5A 1RT5B 2VC0A 3GG1A 3K8WA 2MZQA 3G8TA 2ADBA 1D9AA 2L08A 4R5PB 4HH1A 5I3UA 2UVWA 1B0VA 1QJHA 1ZYQA 2GV1A 1C1BA 4AQYF 3FZBA 5F3TA 4F4KA 2ZOMA 1C1CA 4URQU 2AYBA 2R7VA 4IFYA 4HVZA 2JVOA 1Q8BA 5FD1A 4DQSA 2XC9A 2ZDPA 1F5AA 1TK5A 4WCEQ 1WD6A 3OW2R 1U1KA 2CQIA 2EWHA 2O5DA 2RRNA 3CD5A 1O5JA 1SL1A 1HW8A 5KG1A 2YX1A 1S49A 5CYQA 1E6VB 1NAQA 3MEDA 1NH7A 3DXSX 3MHYA 2V94A 4PPZA 4C2MA 3MFIA 1JXEA 2ROEA 1Y5NB 2W7AA 2HQ3A 1G6BA 4JI3F 5K9FA 2PSZA 1TKZB 4EU0A 2LEPA 1FEEA 2JC0A 2FHJD 2NPFA 1XMQF 2P6TA 2R7QA 2WK4A 4I4BA 1JLAA 5E33A 1LXJA 2Y1IA 4WXWA 2ZH8A 4C0OC 4ALZA 2NUHA 2ZD1B 5DO2A 5T7LB 3KMQA 1I6JA 1LFPA 1GX5A 3MM9A 1GNKA 1VRUB 4XPCA 3P3DA 2RKIA 5F9LA 3BS9A 1QUVA 3NCPA 2QO3A 2ZC4A 1RAJA 4N8NA 2HNZB 1OS5A 2YWGA 3PY8A 4O3PA 1JLGA 1FTCA 3TR5A 3O5TB 2GJ2A 5E3QA 3U1NA 3OJSA 2NYIA 4P7TA 5HQ8A 2WOMB 1TL1B 2LA4A 2ZNZA 1KFDA 3TO8A 3F44A 2W8KA 4QWBA 1GT8A 4C11A 1M5SA 2ZJRQ 2MQOA 1IJFB 3KK2A 5HP1B 1G3OA 1FNOA 3CIZA 5DJBA 4QIEA 1RT4A 5KFDA 2KM8B 2ILYA 1RP5A 1HI8A 4G3IA 2HHTA 3J7ZT 2HHPA 1VQ4S 3QIPA 2MZSA 1HYSB 1NZAA 3D1OA 3PHEA 4RBVA 2FY1A 3WX4A 4JV5F 2HHXA 2ZH9A 2VKRA 3BO3A 1UJ4A 3U1LA 3MMCA 4ED2A 4DDFA 3H2UB 4O3QA 3G6ES 1TL4A 1BWEA 2LVWA 2ZH4A 2VPZB 2B4OA 2UXCF 1YBAA 1SL2A 3CJ3A 2JRSA 2JLEA 4LF9F 2F1FA 3TRGA 3NWGA 2DD8S 5G4DA 3KYLA 4DLEA 1N6QB 1FTRA 3FGVA 4KJIA 2FVPA 1F2GA 3US5A 2BDPA 2H9ZA 2A3JA 3IRXA 3DRPA 3IR6B 4DHVA 7FDRA 4TQSA 4ELUA 4TN2A 3RR8A 4BCAA 4WU2A 3AH6A 2AYEA 3TAMA 2VOPA 3OHBA 2LECA 3CDUA 4IG0A 3QZ8A 4D3HA 5J2MA 4X65F 3UPFA 4OHXA 3THPA 3UR3C 2GCFA 1U25A 4DQRA 5B0BA 3BSNA 4FNIA 4DF4A 2YKMA 1KONA 3PACA 4ZVEA 5A8WA 3I9V9 4I6AA 1SJ4P 5M2RA 2CJ9A 1HBMA 2FHJA 4PXEA 1Q86T 2EG1A 4ZPCA 2DCUB 4F4ZA 4IFVB 4XO0A 2HZCA 5DQGA 2VFRA 3B4DA 4DUYF 1TL5A 4RW4B 2JEIA 4NCBA 1DLOA 2OD6A 2QSWA 1F5CA 3TVZA 3TYTA 3V4MA 4F50A 5B08A 4RU2A 4F2RA 3D1QA 2YH1A 1UVKA 3SFUA 2JFKA 3OFEA 4DV3F 4F3MA 4UQTA 3RRHA 1U1NA 1QY7A 4FXDA 4R8UA 3BSCA 1UW4A 4H4KA 4O3OA 4IOAQ 1XEZA 4I64A 2BRKA 1SH0A 1E6YB 2B3TB 2FD2A 2HWHA 5JVGQ 4DR7F 2EI5A 1YWXA 4F2SA 1IBMF 1V6HA 1MSWD 3KK3B 3BQ2A 3PVXA 5KFMA 3LANA 1KLMA 4YDXA 2HRUA 5LXYA 2AQ4A 5DDRC 1D3WA 1K0VA 4QJVA 4OJGA 1H2VZ 1UKUA 3IO1A 3K58A 1EP4B 1NHUA 3S6EA 1IXKA 1DTTA 1JLEA 4Y65A 1P1LA 2DGOA 3M8SA 2YH0A 2B5JA 1U6ZA 5BR8F 4F4XA 3TW0A 2ZFHA 1M5PC 2MSSA 3DLJA 3QPIA 2R2RA 3T5LA 3HVRA 1VOMA 5ITHA 4MFBA 3PR5B 1W2IA 4HT5A 4OI6A 4O44A 1VK3A 1HFEL 2J9DA 3S8SA 2RS2A 2ACYA 2XMWA 4ECXA 2GMLA 2JEFA 5HN0A 5MAOA 3JSMB 2M52A 2CQDA 1BC6A 3H2VE 1HNXF 2Q1LA 1TV6A 2GHPA 5SZTA 3CULA 3A8EA 2DB1A 3IXQA 2R7WA 4X4TA 1SIZA 1XR5A 1UAWA 3CJ5A 1IKVA 5E3PA 1NJIT 4OL8A 1Y3JA 6FD1A 2BQ3A 4MTPA 4N77A 3Q8RB 3OR2A 3OVAA 1MROB 1YJTA 1HI0P 4OZNA 1HI1A 1PC5A 4PQUA 2JSXA 4X64F 1VQSA 1UVNA 2UUCF 4I6WA 5J2QA 1FXLA 3C2PA 3TNVA 1EETA 4LF7F 1R31A 5K8OA 2FJVA 5C25B 2J0SD 5D4PA 1YIJS 1F0XA 2OPQA 4HI1A 2LXIA 1RT2B 2DHXA 4O3NA 3KWMA 4D3GA 3MAHA 4G1PA 4NL5A 1X4DA 4ERDA 2OSQA 2XULA 3R27A 3V81A 2MDAA 4Y28C 1KQGB 1YG0A 4ID5B 4PUOB 1XBWA 3MEEB 2J0WA 1JLFB 4CO1A 3OL6A 4TY8B 2L48A 4PPDA 1Q8IA 1NRKA 1SKSA 5KFJA 1ZPVA 4A8WA 4ZPDA 3HM9A 2DVIA 1FESA 3DRYA 2RF2B 3W2VA 2D7SA 1FVSA 2XZWA 2QFJA 4B9NA 1N32F 2HW3A 3M32B 2FDNA 2ALZA 4YEAA 4MKAA 3G6YA 1DFDA 4TNOA 3T5KA 5BYRA 1C1CB 5KFIA 4B9VA 1SXLA 1VC0A 2COLA 3UWTA 2CQCA 3O6QA 1S4FA 4CH0S 5A6PA 4P6QA 4ZVHA 5IT4A 3KHRA 2OP5A 2E5HA 2IYIA 5THWA 1R8HA 2GO9A 3WC2A 5IM0A 3R5CA 4KAIA 2WOMA 5GAGU 2MSTA 1W2BR 1TKDA 1GX6A 3DLEA 4LUBA 4N41A 2V8VA 3FCHA 3DOLA 4C11B 1SH2A 4R0JA 1HQUB 1WHWA 1N8RT 4J9QA 2CPEA 2PO4A 3QGHA 4WIIA 2AYMA 2GNKA 2RIJA 1I94F 3J7A1 4QCLA 4U7CA 3I55S 3CCMS 1RT7B 2GHVC 4FS2A 5KOXA 2HS0A 3BGRA 3VQTA 1D8YA 1XNQF 5I3QA 1VK8A 1AXQA 2J5AA 3IWNC 2YTCA 4MH8A 3ISNC 3M6VA 5IT0A 2HHSA 2N82B 3LAKA 4DSLA 3MCSA 4C8NA 3E3XA 4RKUC 1HNVB 1Z4UA 3CWJA 4F4YA 3EXCX 2MZTA 2R4FA 3MFHA 2JJ4D 2AGPA 3GYXB 3H98A 4H54A 1N34F 3A1YG 1DRZA 4DV6F 4QQBA 3IBWA 2BM1A 1E6VA 5F0WA 2VV5A 4X4NA 4EFAC 1YJUA 4JI2F 5L1JA 2LEAA 4OZ0A 3MEGB 2C22A 4L3NA 2XS2A 4NXMF 2QSFA 3HHLB 5KFCA 3ISND 3Q8PB 3C6TB 2PI5A 4KV8A 4EWTA 1H2TZ 3RRKA 2Z4PA 2ZE2A 2VA3A 4RUAA 2YNIA 1TL3B 1MW7A 3T3FA 2I2YA 4ICLB 1Z1ZA 2Y0SD 3NNAA 4EO6A 1XNRF 3M8RA 2KRBA 5SUHA 4ED7A 4WE1A 2J76E 2KYZA 3RW7A 1VBXA 2Q3PA 2OPQB 4GC6A 2IBKA 4LVOP 4NRTA 3DLBA 3PO5A 1XMBA 1N88A 5CXTA 1OO0B 2OFHX 5KFHA 2C3UA 1U47A 1KQSR 5FDLA 3UR0A 1U6FA 2V8GA 4J9SA 4PQUB 4K4XA 2V2KA 4B08A 4WXOA 4OQJA 3VZHA 2LKZA 2MKJA 2HHWA 1KVIA 2J7WA 4IR9A 4FS1A 2LEBA 3FFIA 2KT2A 1C4AA 2OMOA 3FRZA 1FK9B 4TY9A 3CCWA 1MMLA 3KLIA 1FRIA 4UY8T 2BYCA 2OAUA 2VONA 2KG0A 2FJEB 4CO4A 4HKQA 2IRUA 2KFYA 3HVAA 1GQEA 1FRJA 4YB6A 2UU9F 3E01B 5D6GA 3CB4A 4ECQA 5GAHU 4B3RF 2DIUA 3N79A 2DISA 1A7GE 4AUKA 2E9ZA 3KG4A 2ZM6F 4DR5F 4JI0F 2K3IA 5KG7A 3Q22A 3O44A 3TAQA 3MUMP 1RTDB 3FSXA 3ZZUA 5LJ5Y 4TLRA 2OPRA 2DNRA 3SQGB 5KFZA 3CIMA 1YJVA 4IUFA 3G8QA 3THTA 2HGNA 1Z2LA 3DNCA 1NJYA 3DLLQ 5HLFA 3GMGA 2AYGA 1JB0C 1H3DA 3MWBA 4GO7X 2VKZG 4R25A 3RB3A 4I2QB 4RU9A 4TY8A 3WBZA 4DSEA 2NPIA 5F8JA 4B9UA 1WG5A 1JLQB 3I5CA 2DGQA 2RQ4A 2AD9A