3HLUA

Crystal structure of uncharacterized protein conserved in bacteria duf2179 from eubacterium ventriosum
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
73
structure length
73
Chain Sequence
DQQTMVYIVSAKRKIIADRMLQELDLGVTMLQAVGAYKNNETEVIMCVMRKATLVKVRNLLKEVDPDAFMIVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords uncharacterized protein DUF2179
publication title Crystal Structure of Uncharacterized Protein Conserved in Bacteria DUF2179 from Eubacterium ventriosum
rcsb
source organism Eubacterium ventriosum
molecule tags Structural genomics, unknown function
total genus 13
structure length 73
sequence length 73
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10035 DUF2179 Uncharacterized protein conserved in bacteria (DUF2179)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3hluA00
5DRKA 4CO1A 2NS1B 1VHFA 3NCPA 4NYOA 4AFFA 2XBPA 4Y65A 2ZFHA 2EG1A 5L9NA 4RWWA 4USHA 2PIIA 4USJC 1J2VA 4C3LA 1GNKA 2XZWA 1V3RA 1Q1KA 2XULA 2O66A 2CZ4A 4CNZA 1VFJA 4WK1A 1NAQA 3AH6A 4CO5A 4D3HA 1O5JA 3L7PA 3OPKA 1NH7A 4CO3A 3MHYA 4D3GA 4OZLA 1V3SA 3HLUA 4CO2A 2O67A 1QY7A 4OZNA 3AA9A 2RD5C 3DFEA 1O51A 2NUHA 3BZQA 1NH8A 3N5BA 1P1LA 2J9DE 5D4PA 1UMJA 4CNYA 4ZK7M 1HWUA 3NCQA 1UL3A 2DCLA 2GNKA 4YB6A 2J9DA 3TA0A 5D4OA 4RX6A 3O8WA 2JJ4D 5D4LA 1PILA 4WK3A 3TA1A 2J9CA 1V9OA 5D4NA 5DS7A 2Z0GA 4Y6IA 1KR4A 3X3UA 1UFLA 3T9ZA 3TA2A 3AA8A 4NYPA 2ZOMA 3M05A 4E98A 2EG2A 3LF0A 4C3MA 3O5TB 4USIA 3CE8A 1H3DA 4IYQA 1XK8A 2V5HG 4RWXA 4CO4A 2VD3A 3GSDA 3NCRA 4C3KA 2NUUG 4YB7A 2XG8A 1OSCA 2J9EA 2GW8A 4OZJA 4YB5A 2GX8A 3AHPA 1UKUA 1V6HA 4CO0A 2E66A 4RLEA 4R25A 1NZAA
chains in the Genus database with same CATH superfamily
1HNIB 1S97A 2BABA 3NCPA 2CAJA 1C1BB 2KT3A 4QJVA 4OYPA 3G6VA 4G1QB 3PV8A 4TXSA 2HNZB 2P9EA 3GV5B 4MMOA 3ENWA 1X0PA 2OPRA 5LM7E 3HHLB 3TJ9A 4L6V3 3CMQA 5FLXY 2CWXA 2FHMA 1P1TA 1BD6A 2YWEA 3DYAB 1RBLA 3CDAA 3PDNA 2DCLA 1RK8A 3CCJS 2HIYA 2O01C 4ZLJA 3POTA 2AYEA 2LFVA 2NXNA 4JYAJ 3Q2TC 3MXHP 1QE1A 4YEAA 5E0OA 2QLFB 1HD1A 1IM4A 1VISA 4F7VA 2K7KA 4HLBA 3MD1A 3E2EA 4ZVEA 4USKA 2GJFA 1P27B 4X4SA 4DQIA 2E1RA 3O3LA 1XMOJ 4CM2A 1BGXT 4KH1B 1IJEB 4TY8B 1EP4B 3PJXA 1IBKF 4F0KA 1N36F 3HVAA 3SSSA 2EI5A 1ZAVA 3FBFA 2AJ4A 3P6YC 4HI1A 3G4SS 5I3UA 2Y0BB 2OPPA 3Q8YA 1FHTA 1F5BA 3G82B 2PGCA 4ED4A 4IR1A 3QZ7A 4QWDA 3B8HA 4LSZB 5A8WA 1ZM4A 3NXZA 1ACMB 2W24A 2DNQA 2ZJPQ 2UVUA 4IG0B 5FD1A 2C3YA 4WWSA 1BQXA 2GNKA 2BJ3A 1JJHA 3M2RB 4BWMA 1WEYA 1H2UX 2VDIA 3ONQA 3HP6A 1FRJA 1X8DA 1AXQA 1FJGF 4F04B 3W65A 2LU2A 1NKBA 3PYDA 4ED7A 4RUAA 1OY9A 5KG6A 2OPQB 2V8PA 2HNDB 3GIMA 4YQWA 3MR6A 1I94J 2RQKA 1RWPB 2MB0B 2UZAA 3I0SB 3PR4A 1W2BR 3LOUA 2XLJA 2O1PA 3C6TB 2B9WA 3GR0A 2CKWA 4N47A 2VJVA 2IC3A 5HVFA 2XCAA 1L3UA 5B0DA 1N5TA 4C3LA 1RAEB 1YRXA 2IM0A 1D9FA 3GTYX 2QMXA 1EKSA 3F44A 4W4MA 4PWWA 2B3TB 2F4FA 2GCFA 4U7CA 3NMAA 3MR2A 3HM9A 1YRTA 2KXNB 2E7WA 3KK2B 3B82A 3H98A 1RTDA 1FERA 2QL9B 1PILA 3CJ4A 3SV4A 4KQZA 1WKLA 6AT1B 4C11B 3SFGA 4KO0A 4I1TA 2DB1A 2RRAA 4JI1F 1GK8A 3KLGA 4U8VA 5JVGQ 5A8RA 2CZVC 5K14A 3CC4S 1Q53A 3DLKA 2B8QA 1D8ZA 2CNOB 2VG5B 2PEBA 2K1RB 1OPZA 4MTPA 1RTJA 3MFHA 2UUTA 3NAIA 1IQTA 1KVKA 3DRRB 4FN5A 2UXBF 3N6NA 4DV1F 4DR3J 1ZPWX 3PW2A 3FEYB 1F60B 1TKTB 3QZ8A 4WBFA 2WAQD 2RS8A 5KFJA 3OXFA 5CH7B 1WI8A 4K0KJ 3U1NA 3TOQA 8AT1B 2BE2A 4Y00A 1HBNA 1TL1A 1DTTB 1TZ0A 4RUHA 5GVQA 4OZ2A 5AT1B 4QWBA 2EK1A 3W9HA 3SMZA 1P1LA 5KFHA 3MR3A 1GMUA 3G71S 4NWBA 1RSCA 2HMIB 1UFKA 3EGZA 4RX6A 3J81Y 2VIHA 1F9HA 2R7RA 3AB4B 2OKQA 3T1HF 2OH2A 4ECRA 4MKVA 4B3TF 3NP5A 4O4GB 5C5JA 3M2UB 2DH7A 3LW5C 5LMNF 5CXTA 1SKRA 1T05A 1YRUA 1ZS6A 4OI6A 4WFAQ 3AHPA 1V6HA 4WE1B 4M5NA 4R25A 1Q16B 3BEGB 1OMSA 1CBKA 3HKZD 1CJVB 2H9ZA 3MUTP 3MCSA 5AE2A 4RBVA 3TVYA 3PX4A 2CA9A 2C2EA 2ZM6J 4WFBQ 3B54A 4CQ1A 1TQLA 3HHDA 1YBAA 4Z7YA 4U7UK 2H48B 3OW2R 4C4WA 1M1HA 4LSLB 2HFZA 2RDIA 3J7YU 2PC6A 4ED2A 2XMWA 3RG6A 1NDLA 2HBZB 3GIJA 4OHZA 3QLHB 3KHRA 1AFJA 2HGNA 4NYPA 3GP9A 2DRDA 5KFEA 4X64J 3BV8A 4NCAA 3MR5A 1HWLA 3C46A 2CQ4A 2XS5A 4TYAA 4B9NA 3K8WA 3L7UA 2MZSA 2W9CB 1RWOB 2FJBB 4ES2A 4DV6J 2BEFA 3CO9A 5IFMA 2O3DA 5B0GA 4NCBA 3FCWA 3K58A 2E1CA 3M8SA 1LWFA 4NLQA 2UXDJ 5J1EA 4U6PA 3K5MA 4FXDA 1YVFA 4P75A 2PFFB 2WSFC 3OHAA 4DR4J 1Q1KA 2KG1A 2V69A 1QAJA 3ENQA 4PPDA 2PT0A 4ES1A 1A6LA 1NKEA 3T5HA 1FRMA 5KFKA 3MAHA 4WZMA 4DV2J 2O67A 2YPZA 5ETSA 4RW8B 5LOQA 3TZXA 1CJTA 4F4YA 2ZBQA 3J81U 1BE4A 4X4VA 5KFRA 3NKYA 2ZJQQ 1RWXB 4TY9A 3PHEA 1R8CA 3MPUB 1B70B 4P71A 4LMZA 4ECSA 4OL8A 2BRLA 2JLFA 2MQOA 4DR1F 2A2CA 2NPIA 3AQOA 4DV5J 5HMWA 1OY8A 2B7CB 2GGPA 4EBEA 4KFBB 4HI2A 4ICLA 1VIOA 4JI3F 4X65J 1DLOB 2FJWA 3KWMA 5F9LA 4HTIA 5LJ5Y 2IHR1 4IRCA 2RRBA 3Q86A 1IM6A 4KB7A 3HVRA 2LVWA 4WTOB 1S0VA 2DR8A 4DSKA 2F7VA 1F5CA 1SH3A 4DSJA 5DZ6A 4YOEA 4QWAA 1FKPB 4PYDA 8ATCB 2N7CA 4HACB 3N0VA 4RW6A 1N6QA 3HD1A 4NXMJ 4OHXA 4R8UB 1CJKA 2Q43A 4K8RA 2V8VA 3QNWB 4DPWA 5HP1B 4WKRA 5ETMA 1XMOF 2RIJA 4WXWA 2G2YA 1DURA 3BGRA 3Q22A 4U7UD 1WDDA 4M5IA 3J7ZT 2J6SA 5I42A 2IM2A 3DXSX 1UVNA 4J9LA 3LP1B 2J76E 1H73A 2EVZA 3JSMB 3MMAB 2E66A 3NY0A 3RU0A 4K2XA 3PG9A 1SC6A 1OIAA 4OJ1A 5AXNA 5DDPC 1NZ8A 1VQ5S 3ILJA 1VQ7S 3V6DA 2ZZMA 4ENOA 3ITHA 1S6PB 2ZOFA 4Z2XA 4X4OA 2G2OA 5KFFA 3ZNUA 3C3LA 5BR8F 3CNQP 1SQEA 2OMLA 2B51A 4LREA 2RHSB 1WEZA 4DPTA 5J2MB 4YR0A 2C22A 3R5DA 1I94F 5B09A 3P45B 1TK5A 1FDAA 1SJ1A 3T19A 4N77A 3PNIA 3CCMS 1JLAA 1XC9A 1N8RT 4DJBA 3FKBA 1RAOA 3U1MA 4IKAA 3PXGa 3MTKA 4DCJB 2G1HA 1S79A 4C3KA 2NUUG 5HROA 2QIFA 5L9XA 7AT1B 3OUYA 4CLKA 1RT3A 4R5PB 4LF8J 1U48A 1X0FA 5AE1A 1TVRA 3ISNC 4EI2A 3HKWA 5F41A 3OFFA 3CJKA 5LT5A 4LFAJ 5D6GA 4CNZA 3D67A 1RQ0A 2VICA 2NXEA 3PO4A 2MQMA 1OY6A 2KRBA 4ZVFA 2VA2A 4NXNF 2KB2A 1BUXA 4K4XA 1F3FA 1RT7A 3TAMA 4DUYJ 1WG4A 4UQGA 2KT2A 3K8VA 2XMTA 3A12A 2JX2A 3MPVA 2FVSA 4KKOB 4OYIA 1JLEA 3R3TA 1ZPVA 2BXJA 1E6VB 1RAIB 2JH3A 2ZNZA 1VQ4S 1CVJA 1IKXB 5DDOC 3FZ2A 4USTA 3CE8A 4GO5X 4PXCA 3VAHA 1YHQS 1VQ8S 4ES3A 3CULA 1CS4A 3QT5A 3BQ0A 3SI8A 4ED0A 4RW4B 2MKHA 4K5SA 3V6JA 1PC4A 4QIWD 3RAQA 4K0KF 4PPZA 1T9VA 5IT4A 1GFWB 3W62A 4R0JA 3KUEA 1S1XA 2GV1A 2QE5A 2LKZA 1FRIA 3M8ZA 1WC5A 2Z8QA 3MM9B 5K8OA 5L1LA 2C2RA 1GT8A 2E5JA 4CLZA 4USMA 1NK8A 3BO4A 3CO0P 5E3RA 3Q83A 3AQPA 4DX6A 2IPOB 4USWA 1XJWB 2ZC4A 1C0UB 4C97A 5ITHA 3GSIA 4ED5A 2N3OA 1S1WB 4AQYJ 4KGKA 1RDRA 4DL4A 1FO1A 1HQUB 4IH6A 5KT2A 4B02A 3JSBA 3CGIA 1QSSA 3HT0A 3I56S 4NZ7A 3C15A 2GQCA 4ZPAA 2WTFA 1NPKA 1YJRA 3PYGA 2PA8D 4DUZJ 4DV0J 2C1EB 4NEYA 3GE9A 4CO3A 2IYGA 5KAKA 4KE5A 3NGUA 3QBCA 2ZM6F 4Y2KA 2XO7A 2VQEJ 3TUPA 1M0SA 1D1UA 4KBIA 1J5EJ 1AUSL 5C24A 2CJBA 5G0RA 1Q8IA 3SIPB 1L3SA 1FWLA 5HLFB 2ASYA 1MN9A 3V81B 1SC3B 2NXCA 1X4AA 3W2VA 2MQ8A 2A0FB 2YKOA 3NLCA 3KMSA 2KFZA 5H9EJ 1XNQJ 5ETQA 1V9OA 5A2QU 5HQ8A 3D6FB 1CEZA 4WP3A 3G6XA 1S6QB 5J1NA 1NJZA 1NK7A 2GIFA 1VOMA 3VAFA 3E01A 1PYOB 2BM0A 4WU2A 4LQ9A 3BKUA 2HFNA 4DV6F 2HVHA 4F2RA 3DYAA 3LWMA 4DV4J 2F3JA 1RYRA 3TRGA 3IFEA 2D3UA 3FCHA 4IUFA 2UXDF 3IMQJ 3QQCD 3FQLA 1S4EA 4DR4F 4L3NA 1YTYA 3MFIA 5ETPA 1C4AA 4X4PA 2V34A 2BJEA 1J2VA 2OEJA 3DDIA 2ZE2A 2Z2LA 2VASA 1VLYA 4JV1A 4IG3B 1S6UA 4N7TA 1X4FA 1FTRA 4EU0A 4DV3J 2BJ7A 1IKYB 4QWEA 3QO9B 4IDKA 2KTQA 3IP0A 3PKYA 4A8YA 3A8JA 3O8WA 4GRSA 4J7CA 1X4GA 1JLQA 2ZJRQ 1SKSA 1PJ5A 2HVIA 2BKPA 3KNAA 3HPOA 2CYYA 2NREA 1ITPA 4DV5F 2QLXA 1FFGB 1R0CB 3PVXA 4CYUB 1ZM9A 2L9DA 2QLBB 2XLKA 2ZHAA 5LSLA 1FK9B 3UO0A 1AT1B 1U6BA 2ZDPA 4TLRA 3BR8A 3QATA 1S9GA 2JRSA 1IWGA 3U1LA 4X65F 1OSCA 3KYLA 3GIKA 4X4UA 5CA5A 3M2RA 4O4RA 1Y11A 4KHRA 3OJUA 2YKNA 2Z57B 1IKVB 2RF2A 3IRWP 2VFRA 2DNNA 2RKIB 2RDDA 2XULA 5KFDA 3HMJG 4PWDA 3DOLB 2PI4A 3JQKA 4M5KA 4YHHJ 4NXMF 2KU7A 4TU7A 2XY6A 1JLBB 2HURA 2IVFB 5GADU 7FDRA 3C6TA 3LPYA 5CQGA 3DDKA 2AEFA 5T7LB 1VGYA 4Y3CA 1LWCB 1HIYA 1S1TB 2RE1A 4OV6A 3LWLA 1FXDA 4RNFA 1U0SA 2WB1D 4Y6IA 1YJ7A 1YJUA 2YNGA 5BJRA 3DC2A 4LF1A 3PFEA 2QFIA 4RW7B 4EZ6A 1C0TA 2DY9A 3DRSB 1SJFA 3HVTB 5IXUA 1XEZA 3O6QA 5GAHU 3RBZA 3M8QB 2GIRA 4PG7A 2V9WA 1VK3A 1GXTA 2WRMA 3CJ2A 2SXLA 1RHKB 1KDNA 3FFIB 3IAM9 1J27A 3EE3A 4EEYA 1PG5B 2DNZA 1OSDA 2RNEA 3BM7A 1PBUA 5IS2A 3ILLA 1A7GE 4RL1A 4DEZA 5BXIA 3D2WA 3SSRA 3D28A 3VAJA 2XMJA 3MCMA 4MFBA 3PW7A 1FX2A 2HHHJ 1M1GA 3DMJB 2BJ1A 1HBOA 3C66A 2CXEA 4ECUA 3NMRA 2IJNA 4Y2IA 4GVBB 5CZVA 1HYSB 2MJNA 4F36A 4DI6A 1TKTA 1UETA 3W61A 1NO8A 2BANA 3HJVA 4B9SA 1UPPA 2H5IB 2DH8A 4JP8A 1KLMB 1NJIT 3CCZA 2YNFA 2CRLA 3M30A 1VBZA 1DTTA 5BYRA 5E5NA 2HQCA 2ASJA 4ZVUB 1H7WA 4YDXA 4LF8F 2WBRA 3UVJB 4BDPA 1H74A 4KIAA 2I5JB 3L95X 4LFAF 4DF8A 4OLOA 1NB7A 3W7BA 1S1UB 2W9BB 1HWKA 3D66A 5FJ4A 3QGIA 1OYDA 1CJUB 4ZIWA 1KFDA 3IWXA 1M1KT 3HI9A 1HNVA 3PJWA 4DUYF 2VH7A 4C8MA 3IM9A 4DSIA 3HZEA 2ACMA 3ZZPA 3SQGA 2DR6A 3N79A 1IVZA 1VC5A 4I2PB 5DG8A 1CJVA 3GCWP 4P2MA 1RHMB 2FLPA 2EFGA 3MECA 1FEHA 1HQ2A 3OR1A 1PYSB 1VQYA 2I1RA 3LP2A 3S01A 4ZN3A 3BF4A 3MI7X 1HA1A 3NCRA 2FHJD 4LSLA 1FFWB 2QTWA 3GJQB 2WVCA 4CZCA 1NBEB 3MM5A 2D9OA 1MLAA 3MAAA 1KTVA 1S99A 3FBEA 3X1LB 1XERA 5KOXA 2AEJA 3ZTRA 1IBLF 4M5HA 1LW2A 4LSNB 4M8LA 3MD3A 3OV7A 2NLWA 2KT5A 2MDAA 2RRNA 3PRVA 1TKZB 4KGXB 4F3QA 2VFSA 3RB3A 2Y3YA 1Y00A 4MKBA 5ETLA 3D68A 4OZ0A 5DLFA 2IAJA 3R5BA 2AGOA 2DNPA 5EX0A 4F02A 1NB2A 1R0BG 5GAGI 3VGSA 1BWVA 1Q95G 4XDDA 2FZKB 2BE7D 3MMCA 4ZVOB 1MSWD 1F3VA 1URNA 2IA6A 3C16B 3TQ1A 4KYZA 1SH2A 5K5MA 2MKIA 4DV0F 5D78A 2HNYA 1QUPA 5CYQA 2AX1A 5HVGA 1AW0A 2QMUB 1BQNB 2CQHA 4LFBJ 3WZ0A 4HTJA 1U02A 4B3OB 5BYSA 2WB4A 1U2CA 4G3IA 1ZH5A 2VQEF 2W4CA 2BMBA 2EPIA 2MZ1A 1JIHA 1J5EF 3ZZZA 3CJRA 1RT5B 2DPJA 5B0CA 4O3QA 3V2UC 1NH7A 2XY7A 4PZVA 1ZZFA 3JB9k 2W2MP 4A8FA 3HLUA 3LALA 1IKWB 1ROFA 5CD4A 1JLGB 2HHUA 3PRBA 1CC7A 4L72B 4OZNA 4J9KA 4KFBA 1XNQF 2ROPA 1G3OA 2XMUA 3MPDA 3I96A 3N5BA 2MZQA 4ZCMA 1VJQA 4Y2MA 2K8GA 2IDEA 2YQ0A 3CD5A 3EVWA 3G96A 1RT6B 3CCRS 1EKRA 1UVJA 1YITS 4OYMA 1ZETA 1K47A 1WHWA 1X9WA 3IRXB 1EB0A 4X66J 2DHHA 2KZZA 2VFVA 4DV4F 2RQMA 2V50A 1DTQA 1LK5A 2WONB 3W2WA 4UZBA 3OL9A 3UQSA 1CG2A 3UNGC 3IWNC 2N7YA 1RJJA 2NZ4A 2HS4A 1FD8A 3O44A 1VRUB 3SCLE 4F4WA 2HLTA 4P2SA 3JAMY 5KT4A 2R2RA 4UZCA 1VQKS 4DXLA 3FRYA 4RLEA 1TL7B 3S6EA 1HI1A 2PIIA 2ZH9A 2GIQA 2D7SA 1RZMA 3AXKA 4DV3F 4KJIA 2IVYA 2BDPA 2W9AA 2QG9B 5SZTA 1NNDA 3JSMA 3TANA 3MWBA 4GKJJ 3H42A 4U9RA 4DWIA 2HBRB 4NLOA 2V68A 2KH9A 4EBDA 4AL7A 1R3NA 3GV7B 2PSZA 3KKFA 1UW9A 5DS7A 1WJ9A 3HFVA 2VODA 4JOUA 1HKAA 3IA0A 4ZJOA 3A4TA 3H5XA 1FKAF 1T94A 3OLAA 3LF0A 3DN9A 1NHKL 2YXLA 2CJ9A 2UVWA 1U8SA 1YBUA 2YWKA 4O3RA 1AB8A 3GJTB 3D6MB 3DGPB 1B3TA 1Z2ZA 2B7BB 4FVCA 5J2MA 5D8HB 4V19J 1XWLA 4NZ6A 3C8YA 4WKYA 2W7PA 3QWUA 3H40A 3CUNA 1NZAA 3GFYA 2E7XA 1BY9A 1C1CA 3SZ2A 1UWBB 4YHHF 3PY8A 2GJIA 1TTHB 1R8BA 2EK6A 3RBXA 3CC7S 1AZSB 3DI6B 3JTPA 3D3CJ 1R7IA 5LXRA 3T5LA 4CRJA 4PKDB 2EFPA 2DBBA 1PSDA 4FVMA 4CNYA 2QA1A 3MOZA 4PCQA 1D09B 2IMOA 5CYJA 1RBOB 4UUWA 4ED6A 1TKXA 3OVAA 1NSKL 2WOMB 2W7AA 1LOUA 2N3LA 3BH7B 2CNNB 2V4JB 5THWA 3SEOA 3J7A1 2Z2ZA 3BJYA 3FSXA 4CO4A 1U25A 4UW2A 4FXVA 3VGUA 3B4DA 3RW6A 2B4PA 3DXBA 9RUBA 1K1QA 2GJ2A 2NZCA 5EWEA 3JSYA 1YK9A 3KDOA 2YWWA 2IFXA 1NK0A 5DETA 3M32B 1WOSA 3DNCA 3VV2B 1FX4A 2IRYA 1E6VA 3TQEA 2JSXA 5L39A 1NDKA 2IIHA 1IKXA 3W66A 2HHHF 5HL7Q 3T1YJ 3CC2S 2DRAA 2LP4A 1N5YA 3UCGA 2DGQA 5AJ3J 4RW9A 3EGWB 2IBKA 2JNJA 2JL9A 1KQGB 4CIOA 1YX2A 5KFYA 4ECYA 1VDHA 1RWUA 2FPHX 5F8IA 3D54A 1W7WA 3PM9A 5RUBA 2CDRB 1XQIA 4K7QA 4UTGA 4G1PA 5HK4A 4Y2CA 3R6LB 2B4UA 2BBEA 5A8KB 2KZMA 1SXLA 2FHJA 1S4FA 2CVIA 3FBBA 3MM6A 3MTJA 1RT4B 4OYXA 4F4XA 4E0DA 3L09A 3N4WA 3T9NA 5GMKa 4C8YA 2LA6A 4ERDA 2D3ZA 1KN6A 3IG1A 4IFYA 3ULHA 2YY3A 1SV5A 3QFWA 2FGOA 3MM7B 5L46A 1KD1T 2CQCA 2I8EA 2M3DA 5J2NB 3FSYA 1M5PC 3W8GA 3KK3A 2Y1JA 5KG1A 3LP0B 2M52A 2YKMB 4AD6A 3CWJA 2R4FA 4DLEA 2IA0A 4I4BA 3CDBA 5A76A 1REVA 3Q8SB 2BOPA 4BC9A 1F9EB 4PEOA 2KM8C 1URRA 1NJXA 4LF6F 5IQ6A 3QWPA 2P2CB 1Q79A 5HQMA 4GKKJ 2M8HA 4FYDA 1TL3A 1V3ZA 1LFWA 1RAAB 1HNXJ 4DR6F 1SPBP 3I4HX 3IR5B 2FZGB 1FXLA 4WCEQ 1D9DA 2P9CA 4JBCA 2QC3A 2IBOA 4M63A 3M05A 2JC1A 2MKCA 3K5OA 2A1BA 4MAKA 2DH9A 2HRUA 1WC1A 2M8DB 3DLGB 1M5KC 3M9NB 4YMEA 2YNHB 1M5VC 1TUGB 2LEPA 1K0TA 2W4PA 3HDSA 1TFWA 5B0AA 4I7FB 5C42A 4LF5F 5B08A 2ZHOA 2R2TA 3A8KA 2B8PA 1UA1A 1WUUA 5C25A 3Q24A 3RR8A 2V8GA 2XI2A 5IZHA 3UE2A 1Q8BA 4ANCA 2U2FA 4HT5A 3MF5A 2DTJA 4IOAQ 1CPZA 6FD1A 3MEGA 2YNIB 2DNRA 2ZZTA 4ZK7M 1CSJA 3P49B 1UJ5A 1S7HA 1Z2LA 1TV6B 4YB6A 3OD2A 5KT5A 1RWNB 2RDJA 3T41A 2BOAA 3MM8B 2F8HA 2DHGA 2E5HA 2CQ1A 2EBEA 2IYIA 4WJBA 2VU5A 3C6UA 2O5DA 4CM0A 4LFBF 2CWKA 2J8SA 5IM0B 1IKYA 4EZ9A 1WG1A 1O8BA 4LF4J 3KJNB 4KV8B 1WTBA 1Q86T 2ZC3A 4RJVA 4IQMA 5AXLA 2R8JA 1OYEA 3OBIA 1QUVA 4PQUB 4URGA 5KTQA 2V9KA 4FZVA 4NLSA 2XTJP 1QAIA 1FDBA 1QLNA 1VS3A 3ADAC 1JLCA 4P10A 3C19A 2C3UA 5CD4H 3PYFA 1UEUA 2CQ2A 1JXVA 3J7YI 4X66F 1QSLA 2HAIA 1NKCA 4PRFA 3GONA 3RUBL 3BKTA 1S57A 1CULB 2NXJA 4I69A 4F0HA 4C48A 3G86A 5KG2A 4PYAA 1UCNA 3GG0A 2DNHA 2XS2A 2QYGA 4ID5B 3OT9A 2KFYA 1UJ6A 1RAFB 4G65A 1GTHA 2PMHA 1LWCA 1G6BA 3ENAA 1FTCA 2DIUA 4JI4J 2OSQA 2GO8A 5GMEA 3DOKB 5DRKA 3R8YA 3FUYA 1IBCB 4DFMA 5M2RA 2XGQA 1FI4A 4H4OB 3DOMA 1H2TZ 1EQ0A 1YI2S 3CD0A 3RYLA 4GKJF 1A0OB 2QA4G 1YLXA 2CPIA 5KG5A 1RAGB 4ZS6A 2FVRA 3QMQA 2VZ9A 1P9YA 2XYPB 4M5DA 2VOPA 1RHRB 4WK3A 2MSSA 2PFDA 2F63A 3HZGA 2YWFA 1UVKA 4CTAA 4O44A 2XNRA 1B7FA 1D0EA 1SL1A 1X9MA 1RTIB 1T9YA 1WORA 3UDVA 1DJ0A 1RWMB 1LNQA 2VPZB 2RB7A 1JKHB 2QRRA 3ZTQA 3IGVA 3R1LA 2Q1LA 4C7QA 2WVBA 2HS0A 1S0OA 4DBQA 1M90T 3P3DA 4P2XA 1HNZJ 3KJQB 3M8RA 1KLMA 5CHCB 4NI2B 5KFCA 2FJVA 2DR7A 2XNQA 4DSLA 1N88A 2AF6A 1PC5A 5CYMB 4R0EA 4ILMA 1RLCL 2MPUA 1Y7PA 2RH3A 2AU0A 2L41A 3CJ5A 1DY3A 2HGMA 4J9UE 2LQ9A 1S10A 3QT8A 2Z2MA 3KNGA 3KJVA 3EDQB 4DLGA 3BN7A 4AXJA 2LXIA 1S49A 1S1UA 1FA0A 3E3XA 4DFPA 1RHUB 2D3OR 3ICLA 2HHTA 3PEHA 3C2PA 3AODA 1NSPA 1T03B 4B9MA 2CJYB 4E98A 3T3FA 3GILA 3CCQS 3H90A 3ZZUA 2C28A 4BWJA 3I0RA 1U1OA 3WC0A 3AXMA 1GMWD 2L9NA 3RJMB 2B4OA 2QLWA 3EM1A 4QR2A 2JVRA 3D3BJ 2H51B 2U1AA 2XZTB 3R5GA 3T1YF 2MGZB 3WDOA 3MMBB 3M1VA 4DS4A 1PBAA 4RPFA 2HIQA 2AYMA 1HFEL 5AJ3F 2OUGA 4DPXA 3N6LA 3GLJA 3I5CA 4IOBA 1V3SA 3VQTA 3H4DA 2CNKB 3V5RA 3P8BB 5F8LA 4X4QA 4TNOA 3TEGA 2CPEA 4NPOA 2B5JA 3NCQA 1UL3A 2OD6A 3R5CA 4HDHA 4DL3A 4H4MB 1RT2B 3IS9A 4LF2A 4DR2J 1N56A 1RISA 3TA1A 1P8GA 4ECTA 4NA3A 3ET6B 2JEFA 4M5JA 1MWQA 3ZXWA 5E3QA 1ZYQA 1D8YA 2ZWPA 2XSJB 1YIJS 4OX9J 1JJCB 2E1AA 2XMMA 5K8MA 4DG1B 2M4MA 2R7TA 3NS5A 1Z4UA 2ACYA 3EGVA 1Q5VA 1R8AA 4IH7A 1VRTA 2XM3A 1JMTA 2W25A 1IR0A 3ISZA 4A8SA 5IC4B 1RUSA 4FBTA 3CJSA 3G87A 2FB0A 1MU2A 3OR2B 3KLFB 3PHTA 1Q0NA 4FXWA 1U1QA 2P6SA 2KM8B 1HPZB 2QA4S 4OZ3A 4C8KA 4X4NA 5E33A 4OI1A 4F8RA 2DHAA 3EZOA 5F0WA 2ALYB 2B6AB 4CP5A 2AKWB 1FNOA 4HHJA 1HNXF 2F40A 2VG7A 2F8MA 2R7WA 4JV5J 2NCKL 5J2PB 2RU9A 3QIDA 3V6HA 4ZP6A 1TUVA 1JXEA 3G6YA 2WW8A 5L8RC 3CJQA 5CCMA 2KHCA 1MWYA 5KG0A 2W2NP 1MMNA 3MZIA 2UUBF 1HMVB 3NWRA 2V5HG 2MTLA 4DCPB 1NCLA 2ATCB 2HG4A 4RO0A 1N33J 5LMUJ 1ULRA 3KLEA 3HXMA 3TARA 4FKXA 3OVBA 4WZQA 3OSPA 5MLCV 1WF1A 5DJBA 4WIQA 1VFJA 1S12A 1O5JA 5ADZA 4GVLA 4WFXA 2AMCB 4DZDA 2CJQA 3POTB 2DGVA 2HSEB 1JB0C 4LF9J 3ZFVA 1QE1B 1HHQA 3FEZA 3AAWB 1U0HA 2LLZA 3J81j 1HBMA 2D74B 1UVLA 1YWXA 2XSFA 2J8AA 2VQFJ 1KQSR 1I1GA 3NNCA 2HS3A 4PXEA 3GB0A 3BO2A 2OJ3A 1NK4A 4LF4F 3TEHB 1OJ4A 4ALZA 2FZCB 5I3UB 1PGZA 2OPPB 5I3QA 3B78A 3P96A 1RA7A 2Z2YB 2HFSA 2AYBA 3G8TA 3FEXB 3A3OB 3UW1A 3PRDA 2WK4A 3ILIA 4LFCJ 3EICA 5A8WB 2GVDA 4J9VA 2EG1A 2I9SA 1M5SA 2V67A 5KFXA 4PG4A 3CT9A 3AD9C 4FF4A 3KUGA 2Y1LB 2QSFA 2JLEA 3MHYA 4ZCLA 4D3GA 3UD4P 3LUYA 3UD3P 3DGPA 3P5TL 1SB6A 1QM9A 3TUZC 3HHNB 1NUEA 2DKOB 1HWIA 2A3JA 4BHQA 3DLLQ 3GFZA 4X62J 1WC0A 3VVUA 3WIUA 2E1PA 2LXUA 3Q8UA 5DQIA 4RNOA 1MNEA 1DFDA 2G2ZA 2FHOB 3JXOA 4L76A 1ZM2A 4LRDA 2YH1A 3OHBA 4CT8A 3UFCX 1UP1A 4FBUA 3FC9A 2DGTA 3CF5Q 2FJXA 1AA1B 1SKWA 3QIPA 2XLIA 2G1DA 4JI4F 2E5LJ 4I2QA 1HNWF 2XMAA 2A6MA 2IC3B 4ELVA 4C8LA 4F26A 2XWXA 9ATCB 1ZZNA 5BYQA 2WOMA 3OL8A 2VKRA 3EGNA 2BW2A 4NX9A 3V4IA 1HR0J 2V4RA 3CCLS 1TKDA 2J7KA 4DN9A 2GA7A 2HW3A 4TU8A 4PQAA 1YJVA 2V4JA 3KK1A 4ZA1A 2CZ4A 1WD6A 1TFYA 3VAIA 4EBCA 2LDYA 4J37A 1MMLA 2ZVIA 3G2XA 1E6YA 2W2QP 1RTDB 2J7WA 2KVIA 3PIOQ 3SDEA 4A46A 1GTEA 3K89A 5DQGA 2APOA 1R8HA 2R8IA 4KO0B 4A8OA 3PKMA 3JYTA 3I31A 4I6AA 3KLGB 2ADBA 4AYBD 3EZUA 1F1BB 4ZHRA 5A8RB 2OPSB 2FJDB 5K14B 3DLKB 2ZOMA 2WCXA 1ZOTA 2RJZA 1GMWA 1WHXA 1RTJB 1B7YB 4X4TA 2VJUA 2ZH2A 2JDJA 3NBPA 1JK9B 2XG8A 2G9OA 1HNZF 3CD6S 2M5YA 3QJJA 2RU3A 2AW0A 1RTHA 3MEEA 2DXDA 1FESA 4NLTA 1X4BA 4UOHA 4Q0BA 1PIEA 4ZKAA 4XTTA 2BE2B 4GO7X 3T6BA 1VHIA 1HBNB 4XIUA 2E29A 4RWWA 5K9FA 1TL1B 1SC1B 4HR2A 3BH6B 4F0MA 4DFJA 1X4HA 3LH2S 2Z30B 1I6JA 2G4BA 2ZZNA 4QOTA 2DT9A 4EO6A 1IR1A 5GADI 2ZEJA 5K8NA 3AA9A 2COLA 2HQIA 2J7UA 1RCXB 4OFZA 2CG4A 2HQGA 2HRTA 2CQIA 1AROP 3RTVA 2EEYA 4HT7A 3R7NB 2FC9A 1DQ8A 5I3PA 2Y8WA 3SYZA 1LWEA 1S9EA 4KHPJ 1K0VA 1FFSB 3AA8A 1T05B 4FPRA 3KMQA 1OO0B 3IXQA 5GAHI 1AYEA 2Q3PA 3TO8A 1KQKA 3RAXA 2VF3A 2EC0A 2AJQA 4ILRA 1SH0A 1I3OB 2C2OB 2VA3A 3UCZP 4QIGA 2PI5A 3CMAS 3VR1A 2OI2A 2W4DA 4JI0J 2C2MB 3T5JA 2ZOGA 4DX5A 4UY85 3H2UB 2Y9HA 1MROA 2HBQB 3NEKA 3SCIE 1UVMA 2XC9A 3BBBA 2VBXA 3VCDA 4B9UA 2LQJA 2WW4A 4EK2A 4ZPWR 2VV5A 1W25A 4OI0A 4I6WA 4N41A 4FS1A 3TZZA 4FS2A 2OTJS 5E3AA 1QD1A 4K4TA 4JI8J 2YX7A 1X4DA 3K57A 4C98A 4OX9F 4EWTA 4K4UA 4OZ5A 2EFVA 2Q6BA 4OYBA 2E9RX 4MIAA 5F3TA 5F8MA 4TU9A 1NMEB 4KPCA 4L74A 2CJAA 5FIIA 1QAYA 2LYVA 1KWMA 2K7JA 2OMOA 1NK5A 5J1EB 4W90B 1G4CA 3C14A 4RUBA 4OHWA 3V6KA 3D1OA 2Y1RI 4JI5F 3UD5A 2X3GA 3G8SA 1NK9A 4C6AA 2CPXA 1HL6A 3L7OA 3KG1A 4V19X 5J2QA 3ZZRA 2DNLA 3U7JA 2PD1A 4UOCA 4JV5F 3DHWC 1CJTB 3TJAA 3CDWA 4HEA9 2AQ4A 3E8OA 4KV8A 1N36J 2ZH5A 4F4ZA 1LEOA 3O2IA 4I6YA 4KHMA 2ZKUA 4U95A 3W9JA 4P73A 3HHLD 2CQ0A 5DLGA 3S1TA 1WSRA 5KFSA 1V5IB 3D1HA 2LA4A 2UUAJ 3Q23A 4RR5A 2ZH3A 1N33F 2GGPB 4J90A 1TR0A 4DQSA 2UUWA 3BDPA 4G6VB 4ICLB 2R7VA 1PKUA 1HBUA 1NK6A 3GPAA 5AXKA 3CW2C 1RB0A 2M2BA 4YUDA 1S9FA 3OL6A 1S0MA 3QRPA 1VIXA 1CULA 1Q8LA 2UU9J 4CO1A 2BUNA 5F8JA 4LBHA 4QPXA 4J9OA 3I4PA 2ZD1B 3K59A 2XHCA 4X84A 1X31C 3JSRA 3R9LA 4JYAF 2FJEB 5D3GA 3W5YA 3VF0B 3Q8VA 5KG3A 4LF9F 1U7LA 3BPSP 4EYIB 2KKHA 4RW6B 1N6QB 1YKWA 3RRGA 4A47A 2RUSA 1FKOA 3FRZA 4Y0FA 5CZXA 4DR7J 3MPYA 4Q44A 3DOKA 2VQFF 4DR5J 4DOZA 2MSTA 3QGPA 3BGLA 1A9NB 3M8PA 3CTRA 2W8KA 2MLXA 3NGDA 3BGRB 2DJWA 4X4RA 3UDEA 4ZLNA 3GQCA 5I42B 5ETTA 4HDGA 1GMVA 1O6XA 4C3MA 2ZHBA 1NPPA 5C2CA 3NWGA 5D77A 5HJXA 4IOCQ 2YWHA 2YTCA 1KBRA 5EHHA 2RS2A 1SIZA 1FJEB 2J0SD 3M2VA 2GX8A 3M6VA 3TR5A 2HPUA 4Q8EA 2PE8A 3ITHB 3M8YA 4NMXA 1GX5A 3AD7C 1U1RA 4JI2J 1LFPA 2DIVA 3JS9A 3CPWR 3NG8A 1H6KX 2F1FA 4PXBA 3OVSA 2ZITA 2XEXA 1SUQA 2L48A 4DUTA 2GHWA 3LAMA 4B3RJ 2ZBRA 2LQ5A 4NE9C 1WC3A 3EPGA 1JLAB 3D0GE 4WYLA 5G4DA 2Q6CA 4OX8A 4ZLPA 3HFZB 2A6OA 3EXCX 1FWKA 4QCLA 1Y10A 2E5LF 3H2LA 3IAS9 3AJ2A 5HROB 4LJMA 2N4DA 1TL5A 2M70A 4A8MP 2Y0SD 4U8YA 1RT3B 1N52B 1DBDA 2JVOA 2PDAA 3IR7B 5KFBA 2WVEA 3FBCA 5A0YB 4K4WA 3QGGA 4RUCA 3D1QA 1TVRB 1X9SA 2QA2A 2HFUA 3CJKB 4ZCIA 2VBWA 4TVAB 4YN3B 3QJPA 1FRXA 4CH1A 1FXRA 3VAKA 1SJ3P 3N6MA 2K3KA 3T1HJ 4QPTA 1MN7A 3VZHA 5ETRA 1YJWS 1T03A 1KP6A 1XNRJ 1MG7A 3EXYA 1RT7B 4ILLA 2V2KA 1U09A 5A2QY 1HQEA 2Z56B 2C2KB 4A8XA 2QSWA 2MLZA 1NH8A 4P74A 2MHNA 2DGWA 1HWUA 2QT7A 1Z1ZA 4OI2A 1MWZA 1JLEB 3KLHB 2MZRA 2H3EB 4Q43A 2LECA 4EYHB 1BQMA 4MT1A 2AGPA 2VDHA 3RRHA 4DR3F 4IFVA 2E7VA 2NPFA 1KRPA 4ZVTB 4K50A 2MJUA 1CS4B 2HFVA 1C2PA 4ZCKA 1FE0A 3A8IA 4Q45A 2VFUA 5HI7A 4QW9A 3PEJA 1IQZA 1SL0A 3M8WA 4M95A 1CLFA 2VC0A 5IWAJ 1S1XB 2EC2A 4JI7J 4OYZA 3DCAA 1U1PA 3NAHA 2FD2A 2DNMA 2FDNA 4V1Ak 3RR7A 1JLFA 4ZITA 3NL0A 4OZ1A 3LPEA 2XWYA 5FDLA 1VQ6S 3R6GB 3E51A 3G8QA 1KVIA 4HYKA 3DM2A 2ZH8A 4NMLA 2FQQB 1LK7A 3A3NB 4CDIA 1IUJA 2DGXA 2I38A 3EMTA 3BYPA 4KHPF 1WSVA 2GHVC 3QYYA 4P7TA 3VQSA 2VHGA 2MQLA 5KFOA 1K73T 5DQHA 3MEKA 3N01A 4NCGA 4A48A 2CG8A 1HWJA 2DO4A 1RT1A 1HPZA 2JFKA 1UFLA 2C3MA 4CLLA 2XMKA 4CLWA 4CLSA 1U49A 1KVJA 4OI4A 1Y5LB 2GS8A 2B0GA 1UEKA 4DF4A 2OGUA 5KFLA 4JI0F 1N4LA 2NYHA 3VAGA 5KG7A 1TK8A 5M2PA 5GMDA 5F8GA 3DRPB 4LF7J 2OFHX 4YS2A 4B17A 2CPZA 4B9VA 3MEDB 4LRAA 5G0RB 2VG6A 1U45A 3HULA 3HK2A 2QYCA 1HMVA 2E1MC 4PG5A 1HNIA 3W2VB 4RNMA 1EJ7L 1C1BA 1UZDA 1VQNS 1FNMA 2HWHA 4DPYA 4X64F 4G1QA 2A18A 3RGIA 4QYRA 4CLPA 2HNZA 4JI8F 1X5OA 4P72A 2AEMA 3HHLA 4CLYA 4OIXA 1S7IA 1ZA2B 3GYXB 4ED1A 4JI3J 3R5JB 4B9TA 3E01B 4ECXA 2J9CA 5D4NA 5SUHA 4J9NA 1U1KA 1BMQB 2ILZA 2YQ3A 2C2NA 5A6WA 2BYCA 4QIVA 5D0HA 1FD2A 3TUJC 2VPXB 4RWXA 3EDRB 2ZVSA 4AXIA 4FDFA 5IV3A 4YB7A 4DV2F 5JJBA 1PYTA 3KOAA 4QIEA 4YY3J 3IBWA 2ZE2B 4H4KA 4O0IA 4TY8A 1EP4A 4Y65A 3ZTOA 4F50A 1H98A 1UEVA 3AJ1A 2AHOB 4F3OA 2PN6A 2N4CA 4J9SA 1OS5A 4CO5A 2UVRA 1TAUA 1OWXA 4ZVQB 3T1AA 3G82A 4IDKB 1Y3JA 1M5OC 3GFHA 1XR7A 1WTFA 3I32A 2Y8YA 2ZUGA 2EFOA 3SSQA 2DEJA 3RB6A 1NLKL 2FLNA 1JLQB 3ZC4A 3PW0A 2IM3A 4Q2MA 3CEDA 4QQBA 1APSA 2UUAF 3A8EA 4IG0A 3EX7B 4LT6A 2AYGA 4CWBA 5HN0A 2I0XA 1RI7A 1S9GB 1VCTA 1Y5NB 4WFZA 1SI9A 3S8SA 1DARA 1AFIA 2X1FA 1WHVA 5BR8J 5KFNA 2QX0A 2CJKA 2YKNB 1JJ2R 2UU9F 2OPQA 2HNDA 3BBCA 3R97A 4RU2A 2DY1A 2RF2B 4EO8A 4KTQA 1FNXH 4UQTA 3I0SA 4PWDB 2YPYA 1X7VA 4L73A 4OJGA 4NYOA 3TUIC 1T9XA 1K8AT 4ETZA 3Q2SC 2BRKA 1JWWA 1YGYA 1VQPS 4M5LA 2F4VJ 2ERRA 4DDFA 4DR7F 4LIRA 1BWEA 3PX0A 1SQGA 4DR5F 4TQSA 2LQBA 3D7SB 3M4XA 1J5OB 4ZPVR 2BQUA 2B9EA 2NUHA 3HO1A 2BZ2A 1R31A 2YNGB 1S48A 5KOWA 4K4SA 1WWHA 5FLXU 3VVTA 2X51A 3UPFA 1C0TB 1G2EA 2ALZA 1W26A 1L3KA 5D0EA 2GQQA 3KK2A 4IO9Q 1XIQA 2MHEA 4NXNJ 3L4BC 1N54B 2HVZA 3US5A 2P5VA 4C11A 2IJFA 3BGUA 3JTOA 3BQ2A 1ZAWA 2OP5A 3MMJA 4M1KA 4JI2F 3J7AN 1UJ4A 1VR6A 3F56A 2VBYA 4K4ZA 2VG5A 2OPSA 5GAEU 2WVFA 2K1RA 4E2FB 4JI6J 4AUKA 4NLYA 2BJDA 3BDEA 4MFBB 4B3SJ 3SQOP 4HH1A 2MZTA 1N5VA 3DRRA 3LQVA 4Q5VA 4B3RF 3GYGA 5J1PA 1HBOB 3QT6A 4ZPBA 5L38A 4MK8A 2C2DA 1EETB 5DM6Q 1HD0A 2W7OA 3D5MA 3NNHA 4MKAA 1P6TA 2BANB 4ZP9A 2F9JA 2E5IA 2OLWA 1VC0A 3MCOA 2YNFB 3M30B 3RB0A 2BJ8A 3OXGA 4OYWA 2HMIA 4AE5A 2WHOA 1S6OA 3NGKA 3B4MA 3RAMA 2K06A 3Q89A 4NLPA 3OJSA 2D41A 3CIMA 2QL7B 1RWVB 5HVHA 1LV5A 5C2GA 3AOBA 4DL7A 4O4GA 1OPIA 2XGPA 3M2UA 4HHHA 1XNRF 2NSCA 4S0MA 2NS1B 4LRFA 3ZZTA 1HNVB 1XN9A 3H7HB 5K20B 4IR9A 3CVKA 4YDDB 1FRLA 1RGVA 3RBEA 4WE1A 2QEXS 4QZVB 3SQGB 2MKYA 4DQRA 3BS9A 4C0OC 3H5SA 3PYEA 1BXNA 4O0NA 2W8LA 3BGOP 3UDLA 3UR3C 5A6PA 3PTWA 1HI0P 3THVA 4N8NA 5DO2A 3GJRB 3MECB 4F25A 3OR1B 2RHQB 3LP2B 2OEMA 2HBYB 5U47A 2CPDA 2KRRA 1T3OA 2WSEC 1Y4ZB 1K9MT 4NLRA 3MM5B 1H3DA 3MAAB 5IWAF 4I67A 4ETXA 4JI7F 3DLJA 3QLHA 1LW0B 3QSYB 4NZ0A 1RHQB 2R2UA 3I9V9 1RP5A 5D0RA 5HAOA 4WF9Q 4NLWA 1LW2B 1YSJA 2W9CA 1EZZB 4XPCA 1VQ9S 2ZBCA 2AGQA 4USJC 3OQ2A 3TJ8A 4AQYF 1FRKA 1DQ9A 5DM7Q 1GQEA 1NAQA 4XAKA 1OQ3A 1S59A 1LXNA 2IAJB 1RYSA 3TW0A 4H54A 4P9SA 1VBYA 4J9RA 1VI7A 3WIVA 4AT1B 1UFWA 1UMJA 2G13A 1RADB 4DUZF 3MMCB 3PZPA 4JV0A 2Z0GA 3BGFA 1S5ZA 4RW8A 1JXLA 3DHXA 2HNYB 4Q7AA 1HARA 4WPAA 3VGVA 5CYQB 3ELHA 3K2YA 2BA9A 1UPMB 2B56A 2FHKA 3VTIA 1CQNA 4LF7F 2HKEA 1WDTA 5IQQA 4MIBA 2J5AA 3K5PA 2GW8A 1G1XA 1WOOA 4EMDA 1VLOA 4HKQA 2BKNA 4NEZA 1YBTA 3CJ3A 5E3PA 4ED3A 5HJYA 1Q7LB 1ZBTA 1SL2A 1KHVA 2EBGA 1T9UA 4DL0C 4BC7A 2PO4A 3EUNA 3OFGA 1DLOA 4ZPCA 3P5BP 4OZLA 2LEBA 4EGLA 1O51A 3BZQA 3ZZYA 2VPYB 3OFEA 1YJ9S 2DHXA 3OFHA 3HT3A 4C0HA 3K7RA 2NSBA 2G0CA 1DTQB 3QT7A 4WTYA 3W2WB 2ZD1A 2D69A 2EW9A 1FKPA 2HHPA 5IC6B 5KFPA 4HACA 2MYFA 4TKTA 3NGSA 3FSIA 3RRKA 1M5HA 2P8IA 4FYYB 3RW7A 4R8UA 1NHVA 1WC6A 3QPIA 4MIWA 4QR1A 3M9MB 1FE4A 1ELOA 4YY3F 3GSDA 5HP1A 1KQFB 4EUVA 2AJ0A 2ROEA 2G0IA 3WHIA 1ICEB 1QY7A 4DV7J 4FYVB 4DX8H 2MQNA 3LP1A 2IDLA 3MMAA 5IOLA 4PWUA 1WNEA 4LUBA 1EIYB 1UA0A 4NASA 4XPEA 2DNOA 2MKSA 1L3VA 4BBYA 3ZTPA 2M9KA 2UUCJ 2KFNA 2AIRB 2MEWA 5T41A 3W5ZA 1S6PA 2RQ4A 1RACB 1H0HB 3FJ2A 5HATA 4WXOA 3GCXP 1QTNB 2IMWP 4NA2A 3QJLA 1KHWA 4LR7A 2DO0A 5HMYA 4Y34A 5E3CA 1XK8A 3M6WA 4AL5A 4K4YA 1RWKB 4PABA 1SVDA 5EX3A 1C1CB 3NOGA 2W01A 2IJRA 1QTMA 2JOQA 1NU4A 4PUOB 2E9TA 1WELA 3CD7A 2JEIA 2F4VF 4DN0A 4O23A 4KR0B 4R5PA 5LJ3Y 3DDNA 1SJQA 4OHVA 3HX9A 3OXLA 4PG6A 3HF5A 5A0YA 3BQ1A 3CJTA 3OSNA 3SV3A 3MCNA 2RT3A 2FUG9 2XYHB 4HH0A 2RSQA 2XZDB 5HMZA 4F3MA 1TKXB 3QSIA 5KFIA 3KLIB 1X5TA 3HD2A 4UY8T 1RA6A 2VC1A 3UI3A 2MQQA 5DGAA 1C4CA 3GG1A 4KC5A 2R2SA 3BPDA 1WKKA 2C3OA 4KKOA 2X1BA 1YJTA 3H5YA 2EKNA 4C8NA 4QYZK 2QN6B 2ATLA 3CDEA 3KLHA 4JI6F 3PCOB 3WX8A 3CB4A 4GC7A 2HQ3A 3Q8RB 4B3SF 2IRXA 2L08A 3LAKA 4ZMMA 1N5YB 1QVGR 2C2ZB 4UOGA 3ISND 5JMNA 3I5AA 4NL5A 3MGJA 1FRHA 4RW4A 3HSZA 4RW9B 1GXLA 2VBZA 3OLBA 4F4AA 3BSOA 4N56A 3W9IA 4FYXB 3IGNA 3W63A 5D0GA 1N48A 3MM9A 2DR5A 4ECVA 2HYIB 2VL1A 5D4OA 3JQJA 2YKQA 2R8HA 1IBLJ 4QW8A 2ROGA 5KFGA 3TP2A 3GJSB 4B08A 1EHWA 5E7OB 1IBMJ 1H72C 3HSJA 3UWTA 3MM6B 5I4MA 4QWCA 3LGMA 2JLGA 1VQSA 2KYZA 2HVEA 2GVZB 3T9ZA 1UW4A 1VK8A 2ZDOA 1C0UA 2KL8A 3KG0A 4IRDA 1YZ7A 1QSYA 3IG1B 4IFYB 3ETOA 4USIA 1S1WA 4NLVA 3H20A 1KFSA 1SV5B 2GO9A 4FF2A 1HQUA 3R7BB 2C42A 2OIHA 2E44A 2HLUA 1HHTP 3KK3B 1IJFB 4OMFG 4DL6A 1TMMA 4FP9A 3OTEA 1Y5IB 3HVWA 2V0NA 2M7SA 1ZTWA 3THPA 2JZ5A 1R0AB 4M5MA 1REVB 2V8HA 3ZZ0A 3TYTA 1HI8A 4USHA 2CUYA 4KY3A 3TAPA 2UV8A 1TK0A 5LSOA 3CIZA 1U1NA 3L7PA 1F9FA 2BACA 1HHSA 2IRUA 1N0VC 1TL3B 4OX6A 1VBXA 2K3IA 3T6JA 3IM8A 1T02A 1XR5A 3OL7A 3DRPA 1IN0A 1RCOB 4ZVPB 3DU5A 5HLFA 3MEDA 4ATNA 1KC8T 3V81A 1T8EA 4XO0A 2QGFB 2VFTA 1N5SA 3KG4A 5B0EA 1DZ5A 1D3WA 2XY5A 1VRQC 2AV5A 1P9QC 2KJVA 4M5GA 4J9PA 3MOJB 3AY0A 3R27A 5C42B 2N82B 1S6QA 4E8UA 2VD3A 4ID8A 1YJNS 2P6TA 1VJWA 1S1VB 5C25B 1EQMA 2A2DA 1D9AA 1TAQA 2V2VA 2FVCA 2V63A 3K0JA 4AFFA 5KFMA 5L9NA 1U4BA 4FF1A 3MEGB 3GV8B 2O66A 2CADA 4DPUA 5EWFA 5HBMB 3DLBA 5LXYA 4PAAA 1JQGA 2HHVA 4FNHA 2BW7A 2FC8A 4ZP7A 1Q82T 3LTOA 2CQPA 3C6UB 3EPIA 1NJWA 1T9WA 4LR8A 4J9QA 4IG3A 2HK3A 1TU0B 2YX1A 4ECWA 3QO9A 4I0WA 1N34J 5DDRC 2JC0A 2OAUA 1YZ6A 4ZVHA 2DD8S 4YR3A 1RHJB 2R9LA 3OTOJ 2HHSA 5IV4A 3CCVS 4CYUA 1T9TA 4DSEA 1FK9A 1DHMA 2ZKTA 3MAQA 4ECQA 1RWWB 4O3SA 3CCWA 2H5EA 4CT9A 6FDRA 2ZFHA 1JLCB 1KSPA 1BC6A 4NYZA 2XMVA 2B9YA 2F65A 4DU7A 3Q0AA 2V6AA 2IM1A 4USVA 1IKVA 3AB2B 2FGCA 2KVQE 4GMKA 2VONA 1VQOS 2KI2A 1F2GA 2RKIA 1WACA 2ILYA 3CJ8A 1MW7A 4OQJA 1SQFA 3MDFA 1B0VA 3L3CA 1LXJA 3DOLA 1KTQA 1R43A 1U1LA 2DHSA 3D0IE 4XK8C 3M6XA 1T11A 1JLBA 3LA0A 5T7LA 2HGLA 1S1TA 2DNGA 3TAQA 1Q7YT 2KDOA 2QO3A 1J5OA 2FY1A 2L3MA 1RE1B 2J6TA 4DV7F 4RW7A 3CSKA 1X4EA 3DOMB 3TNVA 2GMLA 3L9ZA 1QJHA 4CO0A 3DRSA 3HVTA 2OD4A 2MKKA 4PR6A 3ILOA 3M8QA 1VYAA 3NGTA 2LU1A 3PO5A 3NNAA 1VBKA 1S77D 3FFIA 4KRWA 1FVSA 1N32J 2UUCF 4N76A 2KN4A 3W3SA 4HVZA 2DGSA 3BN4A 1RTZA 4M5DB 3CCSS 3RZAA 1SJ4P 4N8OA 4J5OA 1Q78A 4P2FA 3VGTA 2HRYA 4CTAB 4O44B 3TA0A 2UXCJ 3DGVA 2WSCC 3DMJA 1FEEA 2DXEA 4O3PA 4C0BA 4ANEA 4NLXA 2KXHA 1WOPA 3CCES 4MK7A 4GVBA 1QVFR 1HYSA 1YQHA 1EETA 3O5TB 4MJKA 2R7UA 3BSAA 2DXFA 4YB5A 2GZOA 2GQ2A 2BX6A 2RILA 3G6ES 1TUWA 3UVJA 3U02A 3EYZA 3GR1A 4XDCA 2IY5B 2ZUAA 4IRKA 2XBPA 4DQPA 2LQ8A 2NYIA 1O0PA 2I5JA 3WX4A 1FJ7A 3AH6A 5KT3A 2W9BA 3KJVB 3DLEB 2XO6A 4KH0B 2R7OA 1RU1A 1CJUA 1QAXA 4C9DA 2R8GA 1UAWA 5HMXA 1MMDA 2R42A 4JUZA 5EUHA 2X7IA 2CQBA 3UN5A 2J0QD 3IN5A 4EFAC 5F3ZA 1SJRA 3OTBA 4I2PA 4M94A 3I0RB 5AXMA 3VAMA 1TL4A 5CAAA 5D15A 4UT4A 4KGMA 1WI6A 3BSNA 2VKZG 3H5UA 3D9BA 4LF6J 2BKOA 1ZTTA 3UR0A 3T5KA 5KFQA 3R2DJ 3M1VB 4YB1P 1PAUB 3SCJE 1XMQJ 4DR6J 5LL6d 4KSEB 5DZ7A 4B3MJ 3FNNA 2R7XA 4LIWA 5H9FK 5ETKA 3PR5B 1HLWA 2WVDA 3W64A 2B5JB 2JEGA 1FVQA 1LW0A 3IS9B 5F8HA 4CLFA 4ER8A 5MAOA 4LSNA 1R6YA 1UVIA 1CQMA 2BM1A 1IBMF 2BE9B 2KHDA 3EVMA 4LF5J 4ITSA 2MXYA 1TKZA 3GFXA 3Q8QB 3MUVP 2BVZA 4HL9A 3I55S 3H59A 2HK2A 2BV3A 3N28A 3LO3A 1Q4RA 3EJMA 3Q8PB 4YP3A 2FVPA 1NDCA 4RNNA 2B9XA 4KGZB 1VRTB 3VWSA 3FCVA 3M6UA 4J91A 2V2QA 4ZN1A 4U96A 2DPIA 1MU2B 4DQQA 3MURP 3OTCA 2DNYA 3C16A 5KFWA 3KLVA 3H2VE 2ZWOA 4ED8A 2CQ3A 1EAYC 2GFFA 1KONA 3JQMA 4GKKF 4Z37A 3FQKA 1BQNA 1U47A 2NR0A 2AJ1A 4O3OA 4MH8A 2OSRA 4OLPA 3A1YG 4B3OA 1BHNA 3GWCA 5KFTA 3NS7B 4WU3A 2H5JB 2VG7B 4D3HA 5EDWA 1RT5A 2AX0A 4PG8A 4ZVRB 2EWHA 5AE3A 1KKHA 2E9ZA 3ETMA 4G1IA 1PO6A 4TN2A 3UCUP 5F9NA 1U6ZA 3P4UB 1T3NA 1DQAA 1QDUB 1NPRA 2OO4A 2HZCA 2ZNYA 3F73A 2B43A 4ANDA 1OQ6A 1IKWA 1JLGA 3IBCB 2H4YB 4RZRA 3SFUA 3R2CJ 2RUGA 2GHPA 4BCAA 3BB5A 5E41A 1VMBA 2QLJB 2MY8A 3ZTSA 3W8PA 1I5OB 1RT6A 3J80Y 2OPRB 3BREA 4KAIA 4IYQA 3GZ7A 3KLEB 3IRXA 2UP1A 2W1BA 2W2PP 3CMES 1R6VA 1F6TA 2WONA 2DRBA 3GYNA 2DGUA 2FYXA 1X5SA 4MK9A 2DISA 2FIUA 4NA1A 5ETVA 2E5GA 1WEXA 1B0PA 1VRUA 2CJXB 3U27A 2PA3A 2XZWA 1LQ9A 4B9LA 1LWXA 2HHWA 1JX4A 1WF2A 4HHUA 3HHKA 4ECZA 3I9ZA 3R1HA 1TL7A 2UV8G 5KT6A 2XS7A 2HHQA 1U0HB 3SCKE 2EKYA 2XCPA 1HBMB 2BQRA 2BJ9A 4LQ3A 3BYRA 4ELUA 4OJ3A 3TX0A 1N34F 2J6UA 4FPIA 3BSCA 3F41A 3KJFB 8RUCA 1I51B 4A4JA 4K5RA 1IR2A 2QV6A 3EZ5A 4A8KA 4RNHA 3AOCA 1K1SA 3OTOF 5C7PA 4LVNP 3TVZA 1UWAA 1Q81T 3LANA 2POKA 3WBZA 3KUHA 1LKZA 2R7QA 4FYWB 4TQRA 2YH0A 3AOAA 1V5VA 3IC1A 2J9EA 2GVDB 3HHEA 2F5GA 3K5NA 4DFKA 1KLNA 4OJHA 1PJ7A 1WKJA 1YDLA 2CVEA 2DITA 1V3RA 4DL5A 2EXUA 4C2MA 4DS5A 1F5AA 2WZ1A 5DGBA 2B4VA 4BLGA 4LVOP 1UWBA 4I68A 2HFOA 2AD9A 3VZIA 1ZAXA 1CC8A 3DFEA 2CIMA 1AZSA 1KOHA 3DI6A 4PUOA 1K44A 4DZ6A 1Y3KA 4URSA 4W98A 1GXUA 4IH5A 1H38A 3QIPB 2IVMA 3DLHA 3FVYA 4I2QB 4BS2A 3KHHA 1XTZA 3FMBA 1NHUA 2J0XA 1KS2A 5B0FA 5M2UA 4CLTA 3J80U 5EGYA 3QRQA 2X3DA 2KJWA 1EX8A 3W5XA 3V4IB 1F0XA 2VOOA 3KLIA 4DPOA 1R27B 3MUMP 3KK1B 4QBUA 1NSAA 3G9CA 1N32F 4NLGA 2CQDA 1E6YB 3CJ0A 3D6TB 3AT1B 3M32A 3SDEB 4KPYA 3JAMU 3H0PA 1H2VZ 2JFDA 2CDQA 4CO2A 2UXCF 1FDNA 3JYTB 1VC6A 3QGHA 4X2BA 3LGNA 2FJAB 4ZHRB 2VUGA 3J7Z5 2MQPA 2J9DA 4O3NA 3K17A 2DVIA 2EFNA 2MKJA 5D4LA 5KT7A 1NDPA 5EN1A 1H7XA 1FJCA 3DRXA 1XBWA 4I64A 3NS6A 1Q5YA 3NBPB 2J0WA 3O1LA 1RTHB 3GMGA 3MEEB 1W2IA 4RKUC 3TWZA 2HVDA 1JNRB 3AFGA 2I2YA 1BLUA 1N0UA 2HHXA 4Q0BB 3QAEA 1KEKA 5A8KA 3FDSA 4UF4A 1PAEX 2QFJA 5L1KA 3WC2A 4QYZJ 1RT4A 2JEJA 2JHEA 4ZVSB 2LDIA 4OYAA 2AZ3A 4YFUA 2VB6A 3I82A 3M7VA 4F4KA 2GVZA 5H1SV 4P7VA 3NOCA 2F8EX 1B4SA 2GC8A 3ZNJ1 1GNKA 4OYOA 3MM7A 2AJ2A 5J2NA 2K2PA 2FY8A 3WQPA 3AD8C 3LP0A 2LCWA 4C8ZA 2R8KA 4UUXA 7FD1A 2YKMA 1U6FA 1B0TA 2KXFA 2MLYA 2UVVA 2EFQA 2L9WA 4MYTA 1SKUB 2YBVA 4QR0A 2HEKA 1LWEB 1S9EB 2ABYA 4LRCA 4U67Q 2MZJA 3CCTA 1R0AA 5IT0A 1KNZA 1T95A 3N9UC 3W1YC 4PXDA 5KG4A 4MKYA 3DKDA 1T7PA 5F0UA 3PFOA 3TZWA 3TA2A 2FLOA 1G7CB 2RAQA 2YKPA 3HCXA 1RAHB 4ZJLA 3N5FA 2MMYA 2DCUB 1U2RA 3HSDA 1XMQF 4RBTA 1RXOB 4Z7CA 3THTA 1ZA1B 4B3MF 3PX6A 3V4MA 1U2FA 4UOFA 2G0JA 1VQMS 3H4BA 2KO1A 3CCUS 5KFAA 3DLGA 2ZH6A 4YR2A 5GAEI 2YNHA 4DR2F 1MROB 4A8WA 1KOOA 2H1YA 2CPHA 4I7FA 1NJYA 4QU6A 2AJFE 2YKAA 4AL6A 2UUBJ 1RU2A 3KHGA 4WP9A 5HANA 4ZDNA 4LBPA 4DU8A 3KTQA 2QZ8A 2DR9A 2PMZD 1S1VA 4F2SA 2H54B 3ENVA 1R8PA 2ASDA 2DGOA 3HHLC 1SCJB 1U1MA 2YNIA 4NLUA 2PEHA 2Q66A 4QU7A 2OELA 1LWFB 2DNKA 1TV6A 5HSPA 1FT8A 1XR6A 3B6BA 2P9GA 2QMWA 4USUA 2AP6A 2RQCA 1RKIA 5HBMA 3MM8A 3C14B 1WF0A 4URQU 1ZM3A 4J9MA 3BKFA 4LRBA 1VQLS 3CXCR 3IWLA 2AT1B 5KFVA 5KFUA 1U26A 3MPWA 5J2QB 3KDNA 5E2QA 4OHYA 3ZZOA 5IM0A 2NXUA 2QL5B 2CFXA 3UN2A 5CABA 2H65B 2XQCA 4H4KC 1IBKJ 3NRBA 3I87A 2D3O1 1DRZA 2W2OP 2VPWB 4PQUA 3OPKA 1SBRA 3TI0A 1U24A 2I6WA 4P52A 1HW8A 4TLQA 1NXIA 2JWNA 2OHDA 3FMWA 3FGVA 1YG0A 5K8PA 1F2HA 2ZH1A 3EWGA 5LMUF 5EWGA 1GAOA 4ZVGA 2M0GB 2CPJA 3X3UA 1HBUB 5F8NA 1S72S 4Y28C 3I6PA 5JXSA 2V8DA 1REGX 1FJGJ 2HQDA 2OFGX 2ADCA 3QRRA 2HAFA 1N5QA 3D6HB 1FDDA 2GMJA 1HW9A 4P6QA 2RVJA 5ETOA 4OZJA 3PW5A 2H4WB 3RB4A 1NRKA 1S0NA 2A10A 5D3GB 4ID5A 2DEIA 3W60A 1Q8KA 1VHFA 2FLLA 1CJKB 1FWPA 2HZAA 3FK4A 3GU0A 2HWTA 3IBFB 4ZP8A 3H8YA 4WYWA 4WK1A 1FKOB 4KT0C 4CLUA 2CNLB 1HNWJ 4H4OA 2X1GA 2YX4A 4FKYA 3M8PB 2XI3A 2V4QA 4CH7A 3UDCA 2RD5C 3I5BA 4FNIA 5LSRA 1R89A 2XHWA 1L5UA 2R3VA 2ZBPA 3KXDA 3BO3A 2GMHA 3HJFA 1SIWB 4CH0S 1DAXA 5CCLA 3JTNA 1PCAA 3BR9A 4LFCF 3DU6A 1EARA 4Q8FA 2MY7A 3D0HE 5IT9Y 2KG0A 4DL2A 3AJDA 3M2VB 4GC6A 2AWZA 3V6DB 4K2JA 1JJ4A 1NSQA 3GIIA 4MYUA 3R5AA 4JI1J 1IWAA 1RTIA 4Q2LA 2XB2D 1U8WA 3QFHA 3PW4A 3TX8A 1JKHA 3IR6B 1Y0HA 4X62F 1IXKA 1SUQB 3IO1A 3FZBA 1S76D 5B0BA 1Y9OA 2UXBJ 1WG5A 1X4CA 4DV1J 2Z58B 4C8OA 1TP7A 1B64A 2FTRA 4ZJQA 2OTLS 1GEHA 3UNYA 2ZH4A 4NI2A 1B99A 2PMWA 1X5PA 1RAJA 5CYMA 5DG9A 2AZ1A 4RU9A 5DDQC 4K59A 4WP8A 3EVOA 3OUYB 4NOHA 1FCAA 2NQPA 2WBMA 2QJ3A 4ZPDA 4OV1A 3A3PB 2CPFA 4CCHA 1UZHA 5GAGU 4WIIA 3PJ9A 1HR0F 2R7SA 4OI3A 4ELTA 2ASLA 2XYGB 3DLEA 1WHYA 2BR0A 1L3TA 4KGVB 2BQ3A 3D4JA 4B3TJ 2DK2A 4N5SA 4ZPTR 5JUMA 1UKUA 3TAMB 5LMNJ 3HFKA 1GH8A 2V94A 1HQEB 2YVSA 2HZVA 1RABB 5T14A 4A8QA 4LBIA 2CZ9A 2KYXA 2MGZA 3PIPQ 3HSGA 3MMBA 3BBFA 4CI0B 5B7WA 1BQMB 1FF2A 4DMZA 4K4VA 2Q79A 5D4PA 2ZH7A 2CPYA 4QIFA 3RBDA 2D9PA 3H25A 4IFVB 2FVQA 5DG7A 2GAGC 2F9DA 4LR9A 3SBMA 4WFNQ 5HO4A 2Y1IA 1KR4A 2LEAA 4TYBA 4Y2AA 4H4MA 1RT2A 5L1JA 3MR7A 2RMLA 2LMIA 3ZO7A 1TMJA 2ZBIA 3ET6A 3KHLA 5L1IA 5IT9U 2CQGA 1AUDA 4JV2A 1UTAA 4JB8B 5ETNA 1NEEA 4IO1A 2DYAA 2XSJA 3UN3A 2M88A 3K5LA 1PJ6A 3CDUA 4DG1A 4F67A 3TVKA 4IQXA 4NLDA 3KFWX 1SC4B 1JLFB 3R7SB 5FDLB 1TELA 1T0TV 4W92B 3DM2B 3QAUA 5KFZA 5H9FJ 3F0NA 1XMBA 3S7RA 3OR2A 3KLFA 4NRUA 4NRTA 4DX7A 2X1AA 5HQLA 3VHQA 3C15B 4WFYA 2LXFA 1RLDA 4NCGB 2C3PA 2J9DE 1JNZB 3M9OB 1RT1B 4DSFA 4JI5J 4L3KA 5H9EK 2YQ1A 2HQFA 1RKJA 3PACA 2JJ4D 2B6AA 5JVHQ 3OTDA 1GX6A 1X60A 5J2PA 3TZYA 2OEKA 3A13A 4I56A 4DCOB 2GAHC 4ZLLA 2Z4PA 4FF3A 2EG2A 4L75A 3LGHA 3GIRA 1NM2A 5C24B 3DRYA 2HWIA 3VALA 2D1CA 4RBUA 1RBAA 2V2ZA 4ZIVA 2YWGA 3SXLA 2VG6B 1WC4A 4DR1J 4DHVA 3NGRA 4OX7A 4ZOSA
chains in the Genus database with same CATH topology
1TAQA 2X3GA 2VQEF 2W4CA 3G8SA 1HNIB 1S97A 2BABA 2EPIA 3NCPA 2FVCA 1JIHA 2MZ1A 1NK9A 1J5EF 1C1BB 3ZZZA 3K0JA 2CPXA 2KT3A 4QJVA 4AFFA 1RT5B 5KFMA 5L9NA 1HL6A 3G6VA 2DPJA 3L7OA 1U4BA 3KG1A 4G1QB 5J2QA 4V19X 3ZZRA 4FF1A 3PV8A 3MEGB 2DNLA 4TXSA 2HNZB 2P9EA 5B0CA 3GV8B 3GV5B 2O66A 4MMOA 3ENWA 1X0PA 2OPRA 4O3QA 3HHLB 3U7JA 3V2UC 4L6V3 1NH7A 2PD1A 4UOCA 4JV5F 2XY7A 5FLXY 3DHWC 1ZZFA 3JB9k 5EWFA 5HBMB 3DLBA 4A8FA 5LXYA 2FHMA 3HLUA 3LALA 1IKWB 1ROFA 1P1TA 1BD6A 1JLGB 2HHUA 2YWEA 2HHVA 3CDWA 3DYAB 3PRBA 4FNHA 4HEA9 2AQ4A 3E8OA 4KV8A 3CDAA 1CC7A 2FC8A 4L72B 2ZH5A 4OZNA 4J9KA 4KFBA 1XNQF 4ZP7A 2ROPA 1G3OA 2XMUA 1Q82T 4F4ZA 3I96A 3N5BA 3PDNA 2DCLA 2MZQA 1RK8A 3O2IA 4I6YA 4ZCMA 3CCJS 4KHMA 2CQPA 2ZKUA 3C6UB 4Y2MA 2K8GA 2O01C 3EPIA 1NJWA 3HHLD 2CQ0A 4J9QA 3POTA 3G96A 3CD5A 4IG3A 2AYEA 5DLGA 3S1TA 1RT6B 3CCRS 1UVJA 5KFSA 1YITS 1ZETA 3D1HA 3Q2TC 1WHWA 3MXHP 1X9WA 3IRXB 1QE1A 2YX1A 4ECWA 3QO9A 2LA4A 4I0WA 2KZZA 4YEAA 5E0OA 3Q23A 5DDRC 2VFVA 4DV4F 2ZH3A 2RQMA 1N33F 2JC0A 1DTQA 1LK5A 2WONB 2GGPB 3W2WA 3OL9A 1HD1A 3UQSA 1IM4A 1CG2A 2OAUA 1TR0A 4DQSA 3UNGC 2UUWA 2K7KA 4HLBA 3MD1A 3BDPA 4G6VB 4ZVHA 4ZVEA 3E2EA 3IWNC 2N7YA 2DD8S 4ICLB 1P27B 4YR3A 4X4SA 2R7VA 4DQIA 1RJJA 2NZ4A 2E1RA 3O3LA 1HBUA 1NK6A 2HS4A 1FD8A 2R9LA 3O44A 5AXKA 1VRUB 2M2BA 2HHSA 1BGXT 3SCLE 4F4WA 1IJEB 3CCVS 2HLTA 1EP4B 3PJXA 4TY8B 4YUDA 1S9FA 3OL6A 4P2SA 1S0MA 1IBKF 1N36F 3HVAA 3SSSA 2EI5A 1ZAVA 3JAMY 5KT4A 1VIXA 4DSEA 2R2RA 1FK9A 1DHMA 2AJ4A 1VQKS 2ZKTA 3MAQA 4ECQA 3FRYA 4RLEA 3P6YC 4O3SA 3CCWA 2H5EA 4HI1A 3G4SS 1Q8LA 5I3UA 4CO1A 2BUNA 4CT9A 5F8JA 2OPPA 1FHTA 4QPXA 1F5BA 4J9OA 2PGCA 3I4PA 2ZD1B 6FDRA 2ZFHA 3S6EA 3K59A 1JLCB 1KSPA 1BC6A 1HI1A 2PIIA 4NYZA 4X84A 3JSRA 2ZH9A 4JYAF 4IR1A 2XMVA 2GIQA 2D7SA 2B9YA 2FJEB 5D3GA 3QZ7A 4QWDA 3B8HA 3VF0B 3Q0AA 5KG3A 2IM1A 4DV3F 5A8WA 4LF9F 4KJIA 1U7LA 1ZM4A 1IKVA 2W24A 4EYIB 2KKHA 2IVYA 4RW6B 1N6QB 3AB2B 2FGCA 2DNQA 4GMKA 2BDPA 2ZJPQ 1VQOS 2VONA 2KI2A 2UVUA 4IG0B 1F2GA 5FD1A 2RKIA 1WACA 2ILYA 2W9AA 1MW7A 2C3YA 4OQJA 3RRGA 4A47A 5SZTA 1NNDA 1FKOA 3FRZA 3MDFA 3JSMA 4Y0FA 1B0VA 5CZXA 3L3CA 1LXJA 1BQXA 3DOLA 3TANA 1KTQA 3MWBA 3MPYA 2GNKA 4Q44A 3DOKA 2VQFF 4U9RA 4DOZA 2MSTA 1R43A 3BGLA 3QGPA 1JJHA 3M2RB 4BWMA 1U1LA 2DHSA 3D0IE 4DWIA 4XK8C 1A9NB 4NLOA 3M8PA 3CTRA 3M6XA 2KH9A 2W8KA 4EBDA 1WEYA 1H2UX 3NGDA 1JLBA 4AL7A 1R3NA 3GV7B 3ONQA 2PSZA 3KKFA 3BGRB 5DS7A 3HP6A 2VODA 1FRJA 1X8DA 4JOUA 2DJWA 5T7LA 1AXQA 4X4RA 1FJGF 3IA0A 2LU2A 1NKBA 3GQCA 4ED7A 4RUAA 5I42B 2HGLA 1S1TA 5KG6A 2OPQB 3H5XA 2HNDB 4HDGA 2DNGA 1FKAF 1T94A 3GIMA 4YQWA 3OLAA 3MR6A 3LF0A 3TAQA 1Q7YT 4C3MA 2ZHBA 3DN9A 3NWGA 5D77A 2RQKA 2KDOA 2QO3A 4IOCQ 1J5OA 2CJ9A 2YWHA 2MB0B 2UVWA 1U8SA 2YTCA 2YWKA 2UZAA 3I0SB 3PR4A 4O3RA 2FY1A 1W2BR 2L3MA 3LOUA 2J6TA 5EHHA 1Z2ZA 2B7BB 2XLJA 1SIZA 4FVCA 4DV7F 2RS2A 4RW7A 3CSKA 5J2MA 1FJEB 1X4EA 2J0SD 4V19J 5D8HB 2O1PA 3C6TB 3M2VA 2GMLA 2B9WA 1XWLA 2GX8A 3C8YA 3GR0A 3M6VA 2CKWA 4NZ6A 4WKYA 2W7PA 1QJHA 4CO0A 3QWUA 3H40A 3TR5A 3CUNA 3DRSA 4N47A 3HVTA 1NZAA 2OD4A 2MKKA 2HPUA 4Q8EA 3GFYA 4PR6A 2PE8A 2E7XA 3M8QA 1BY9A 3ITHB 1C1CA 2IC3A 1GX5A 3SZ2A 1UWBB 2LU1A 2XCAA 1U1RA 1L3UA 3PO5A 3NNAA 4YHHF 1LFPA 2DIVA 1S77D 5B0DA 1N5TA 3PY8A 3FFIA 4C3LA 4KRWA 1YRXA 3CPWR 2GJIA 1FVSA 2IM0A 1D9FA 2UUCF 4N76A 1R8BA 2EK6A 3NG8A 1H6KX 2KN4A 3W3SA 2F1FA 3CC7S 2QMXA 4PXBA 3DI6B 3F44A 3JTPA 4HVZA 3OVSA 2DGSA 2ZITA 1R7IA 5LXRA 3BN4A 2XEXA 1SUQA 2L48A 3T5LA 2B3TB 2GHWA 4PKDB 4M5DB 3CCSS 3RZAA 2EFPA 3LAMA 2DBBA 1PSDA 2GCFA 1SJ4P 4N8OA 2LQ5A 4U7CA 3NMAA 4J5OA 4FVMA 3MR2A 4CNYA 1Q78A 2QA1A 3HM9A 3EPGA 1YRTA 3MOZA 2HRYA 4CTAB 2KXNB 2E7WA 4O44B 4PCQA 3TA0A 1JLAB 3KK2B 2IMOA 3D0GE 4WYLA 3B82A 5G4DA 2Q6CA 3H98A 5CYJA 1FERA 1RTDA 4OX8A 4UUWA 4ZLPA 1PILA 3CJ4A 2WSCC 4ED6A 3DMJA 1FEEA 3EXCX 3SV4A 4KQZA 1TKXA 3OVAA 4O3PA 2WOMB 4C0BA 4QCLA 2W7AA 1LOUA 4NLXA 4C11B 2E5LF 2KXHA 2N3LA 3SFGA 3H2LA 3IAS9 3CCES 4MK7A 3AJ2A 4KO0A 5HROB 4LJMA 4I1TA 2N4DA 1TL5A 2M70A 1QVFR 1HYSA 2V4JB 4A8MP 1YQHA 2DB1A 2Y0SD 5THWA 3SEOA 2RRAA 4JI1F 3J7A1 3BJYA 3KLGA 1EETA 3O5TB 1RT3B 1N52B 1DBDA 2JVOA 2PDAA 3IR7B 4MJKA 3FSXA 5KFBA 5JVGQ 5A8RA 5A0YB 4CO4A 4K4WA 3QGGA 4RUCA 1U25A 2CZVC 5K14A 3CC4S 1Q53A 3DLKA 4UW2A 2R7UA 1D8ZA 3D1QA 4FXVA 1TVRB 1X9SA 2QA2A 3BSAA 2VG5B 3RW6A 3B4DA 4YB5A 2K1RB 1OPZA 3CJKB 4ZCIA 2VBWA 2B4PA 2GQ2A 4MTPA 3DXBA 1RTJA 3MFHA 1K1QA 2GJ2A 2UUTA 3NAIA 5EWEA 3QJPA 1FRXA 1IQTA 4CH1A 2RILA 1FXRA 3VAKA 3JSYA 3G6ES 1SJ3P 3DRRB 4FN5A 3N6MA 2IFXA 1NK0A 3N6NA 2UXBF 3U02A 2K3KA 5DETA 3EYZA 3GR1A 4XDCA 3M32B 4DV1F 3DNCA 4QPTA 4IRKA 1ZPWX 2XBPA 4DQPA 3PW2A 2NYIA 3VZHA 1O0PA 2IRYA 3FEYB 1E6VA 2JSXA 1F60B 1TKTB 2I5JA 5L39A 1YJWS 1T03A 3QZ8A 3WX4A 1IKXA 1FJ7A 3EXYA 2WAQD 2HHHF 5HL7Q 2RS8A 5KFJA 3AH6A 3OXFA 1RT7B 5CH7B 4ILLA 1WI8A 2V2KA 1U09A 5KT3A 5A2QY 3CC2S 3U1NA 1HQEA 3TOQA 2DRAA 2W9BA 3KJVB 2BE2A 1N5YA 3DLEB 4Y00A 3UCGA 1HBNA 1TL1A 2DGQA 4A8XA 1DTTB 1TZ0A 4RUHA 5GVQA 2QSWA 2R7OA 4QWBA 1QAXA 4RW9A 3EGWB 4C9DA 2IBKA 2EK1A 2R8GA 1UAWA 5HMXA 2JL9A 1NH8A 1KQGB 1P1LA 2MHNA 1MMDA 3SMZA 4JUZA 4CIOA 1HWUA 2DGWA 5EUHA 2QT7A 5KFHA 1Z1ZA 4OI2A 3MR3A 5KFYA 4ECYA 1RWUA 1MWZA 1JLEB 3G71S 4NWBA 2CQBA 3KLHB 2HMIB 2FPHX 2MZRA 4Q43A 2J0QD 3EGZA 4RX6A 2LECA 3J81Y 1BQMA 3IN5A 4EYHB 4EFAC 2R7RA 5F3ZA 1SJRA 5F8IA 3D54A 2AGPA 3AB4B 3OTBA 2OKQA 3PM9A 3RRHA 4G1PA 3T1HF 4DR3F 4I2PA 4M94A 4IFVA 3I0RB 5AXMA 2OH2A 4Y2CA 4ECRA 2NPFA 1KRPA 4K50A 3VAMA 1TL4A 2B4UA 2BBEA 2MJUA 5A8KB 2KZMA 1SXLA 4B3TF 3NP5A 2FHJA 1S4FA 4O4GB 1C2PA 2CVIA 4KGMA 1WI6A 4ZCKA 5C5JA 1FE0A 4Q45A 3BSNA 3M2UB 2VFUA 2VKZG 5HI7A 3MM6A 2DH7A 3H5UA 3LW5C 1RT4B 3MTJA 3PEJA 4QW9A 5LMNF 4F4XA 5CXTA 4E0DA 3L09A 1ZTTA 1SKRA 1IQZA 3N4WA 3UR0A 3P49B 1T05A 1SL0A 3T9NA 5GMKa 4C8YA 3T5KA 1YRUA 2LA6A 5KFQA 4M95A 1CLFA 4ERDA 2D3ZA 3M1VB 4YB1P 1KN6A 4OI6A 4WFAQ 3IG1A 4IFYA 2VC0A 3AHPA 3SCJE 3ULHA 2YY3A 1S1XB 1SV5A 1V6HA 4WE1B 2FGOA 3MM7B 4R25A 1Q16B 4KSEB 5LL6d 1KD1T 3DCAA 3BEGB 3FNNA 2R7XA 3HKZD 2CQCA 2I8EA 2M3DA 5J2NB 3FSYA 1U1PA 1M5PC 3KK3A 2H9ZA 4LIWA 2Y1JA 5KG1A 3NAHA 3LP0B 2FD2A 3PR5B 2DNMA 2M52A 3MUTP 2YKMB 3CWJA 3MCSA 2FDNA 2R4FA 4DLEA 5AE2A 2IA0A 4I4BA 4RBVA 3RR7A 1JLFA 3CDBA 3NL0A 4OZ1A 3TVYA 2B5JB 5FDLA 2XWYA 2JEGA 1FVQA 3PX4A 1REVA 3Q8SB 2C2EA 1LW0A 4WFBQ 2BOPA 1VQ6S 4CQ1A 1TQLA 3E51A 3G8QA 3HHDA 3IS9B 4BC9A 4HYKA 1KVIA 5F8HA 3DM2A 2ZH8A 5MAOA 1YBAA 4LSNA 2KM8C 4NMLA 1R6YA 4U7UK 1LK7A 1UVIA 1URRA 3OW2R 1NJXA 4LF6F 4C4WA 1CQMA 3QWPA 5IQ6A 1IUJA 4LSLB 2BM1A 2HFZA 1Q79A 1IBMF 2DGXA 2KHDA 2RDIA 3J7YU 2I38A 2M8HA 4ITSA 2MXYA 2PC6A 1TKZA 2XMWA 3GFXA 4ED2A 3Q8QB 3MUVP 1TL3A 1V3ZA 2BVZA 4KHPF 4FYDA 4HL9A 3I55S 3H59A 2GHVC 3QYYA 4P7TA 3VQSA 2MQLA 5KFOA 2BV3A 1LFWA 1K73T 3N28A 5DQHA 3MEKA 3N01A 3GIJA 4DR6F 3LO3A 4NCGA 4OHZA 3I4HX 1HWJA 4A48A 1Q4RA 3Q8PB 2DO4A 4YP3A 3IR5B 2FVPA 1RT1A 1HPZA 4RNNA 2B9XA 2JFKA 1UFLA 2C3MA 3QLHB 2XMKA 1FXLA 3KHRA 1AFJA 4WCEQ 1D9DA 2P9CA 4JBCA 2HGNA 2IBOA 4NYPA 1VRTB 3VWSA 4M63A 3M05A 5KFEA 2JC1A 2MKCA 3K5OA 3M6UA 2A1BA 1U49A 4MAKA 3MR5A 1HWLA 4OI4A 3C46A 1Y5LB 4NCAA 1KVJA 2CQ4A 2XS5A 2B0GA 2DH9A 4TYAA 2HRUA 2DPIA 1MU2B 2M8DB 4B9NA 4DQQA 3DLGB 3K8WA 1M5KC 2MZSA 3MURP 2W9CB 3OTCA 3M9NB 4DF4A 4YMEA 2FJBB 4ES2A 2YNHB 5KFLA 2DNYA 4JI0F 1M5VC 2LEPA 1K0TA 1N4LA 2W4PA 3HDSA 5KFWA 3CO9A 5B0AA 3VAGA 5IFMA 1TFWA 3KLVA 3H2VE 4I7FB 5KG7A 1TK8A 2O3DA 5B0GA 5M2PA 5F8GA 4NCBA 4ED8A 2CQ3A 5C42A 3DRPB 2OFHX 2GFFA 1KONA 4B17A 4LF5F 2CPZA 5B08A 4GKKF 4Z37A 3K58A 3FQKA 2E1CA 1BQNA 2ZHOA 3M8SA 1U47A 1LWFA 4NLQA 2NR0A 4B9VA 2R2TA 3MEDB 2AJ1A 4O3OA 1UA1A 4MH8A 5J1EA 4U6PA 2OSRA 5G0RB 5C25A 4OLPA 3K5MA 2VG6A 1YVFA 3A1YG 3Q24A 4B3OA 4FXDA 2PFFB 3GWCA 2WSFC 3OHAA 1U45A 3HK2A 2QYCA 3RR8A 2V8GA 1Q1KA 2XI2A 5IZHA 5KFTA 2KG1A 4WU3A 1QAJA 3ENQA 4PPDA 1HMVA 2E1MC 4PG5A 3UE2A 2VG7B 2PT0A 4ES1A 1A6LA 1HNIA 1Q8BA 4D3HA 3W2VB 4RNMA 1NKEA 3T5HA 1C1BA 2U2FA 1FRMA 5EDWA 5KFKA 3MAHA 1RT5A 1VQNS 2AX0A 4HT5A 3MF5A 4PG8A 4WZMA 1FNMA 2DTJA