3HLUA

Crystal structure of uncharacterized protein conserved in bacteria duf2179 from eubacterium ventriosum
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
73
structure length
73
Chain Sequence
DQQTMVYIVSAKRKIIADRMLQELDLGVTMLQAVGAYKNNETEVIMCVMRKATLVKVRNLLKEVDPDAFMIVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Uncharacterized Protein Conserved in Bacteria DUF2179 from Eubacterium ventriosum
rcsb
source organism Eubacterium ventriosum
molecule tags Structural genomics, unknown function
molecule keywords uncharacterized protein DUF2179
total genus 13
structure length 73
sequence length 73
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10035 DUF2179 Uncharacterized protein conserved in bacteria (DUF2179)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3hluA00
1NH7A 4WK1A 2XZWA 2ZOMA 1OSCA 2JJ4D 1V9OA 2EG1A 1HWUA 4RWWA 1UKUA 3HLUA 4C3LA 2E66A 2O67A 1NH8A 3CE8A 1QY7A 1NZAA 4USIA 4AFFA 2EG2A 3N5BA 3NCPA 2O66A 2V5HG 3BZQA 3DFEA 5DRKA 4YB5A 3NCQA 2PIIA 2J9EA 3X3UA 1J2VA 1KR4A 4OZNA 5D4OA 4CNYA 3AH6A 4D3GA 2XG8A 1UMJA 3TA0A 5DS7A 1VHFA 4YB6A 2NUUG 5D4NA 3NCRA 3O8WA 4RX6A 4CNZA 2XBPA 4NYPA 2CZ4A 2VD3A 3AHPA 4R25A 2J9CA 4CO5A 4CO0A 2ZFHA 1NAQA 3AA8A 4ZK7M 1Q1KA 4WK3A 4YB7A 2GW8A 2RD5C 4OZJA 4C3MA 3AA9A 3LF0A 3L7PA 3TA2A 2J9DE 3MHYA 1O5JA 1H3DA 4CO4A 3TA1A 1GNKA 1UL3A 1V3RA 4CO1A 1PILA 4CO3A 2J9DA 3T9ZA 4IYQA 1P1LA 1V3SA 4CO2A 1UFLA 1V6HA 4OZLA 4E98A 2Z0GA 5D4LA 4Y6IA 1XK8A 2NUHA 1VFJA 5D4PA 3GSDA 5L9NA 2DCLA 3O5TB 4USHA 4C3KA 4RWXA 2XULA 4Y65A 2NS1B 3OPKA 4NYOA 4D3HA 3M05A 4USJC 1O51A 2GX8A 2GNKA 4RLEA
chains in the Genus database with same CATH superfamily
1LK5A 2VDHA 2GJFA 4WK1A 3KMQA 3DLGA 3TO8A 1OIAA 2CQ2A 5JVGQ 1ZM2A 2W4PA 5HVHA 2J0SD 3QO9B 2XM3A 2LMIA 2UUWA 4DDFA 4K2XA 4YDDB 2ZHAA 4WF9Q 1T3OA 2FHJD 3VZHA 3TARA 1N0VC 3OSNA 3M30B 3U02A 4QYRA 1N34J 1U47A 3P3DA 2J0XA 2BJ7A 1FERA 3EWGA 2M8HA 2MZQA 3N5BA 2WK4A 1KQKA 4G3IA 3T1AA 3PRDA 4CLKA 4AQYF 3PYFA 2CG4A 5L39A 4PRFA 4RNMA 2CVIA 2LA6A 2EWHA 3CDAA 3OV7A 1X31C 3HFVA 4C8LA 1IVZA 2K7KA 2VPXB 5GAHU 1L3UA 1NLKL 2D9PA 3V6JA 5CZVA 2K3IA 3ET6B 4J9SA 4M5GA 1NM2A 5K14B 4AYBD 3B82A 5IT9Y 4IUFA 2J6TA 4OYIA 4KHRA 1GXTA 3MEDB 1UA1A 2HBQB 2HVHA 4ZVFA 4UOGA 3MFHA 2BEFA 1XBWA 2HPUA 4PKDB 1RTIA 2AJ2A 3D7SB 4RBUA 3MTJA 4U8YA 4K50A 2AHOB 1RA6A 2G1HA 3PKMA 4FS1A 1IR1A 3EGVA 1D1UA 3M6UA 1RT6B 1RHRB 1TKZB 2G2YA 2XI2A 2HFUA 1CS4A 3FMWA 3KHLA 5H9EJ 5K8NA 1RB0A 1FCAA 2LEAA 3AJ1A 1HW9A 3ONQA 4Q2MA 3VGSA 4PUOA 1T94A 4R25A 4LFBF 5ADZA 1N36J 2G13A 4YHHF 3R6LB 1WC0A 1MN9A 2DBBA 1C0UB 3CCWA 4H4KA 4LSLB 5F8LA 2OFHX 3W9JA 4G1PA 1WKKA 4KC5A 2JNJA 4YUDA 2N7CA 4QPTA 1GH8A 3I82A 1M5VC 2SXLA 1A7GE 2ZFHA 1FDNA 4ZLLA 1NK5A 1NCLA 5HMXA 4X66F 5KFTA 4RNFA 4FF2A 3CC7S 1AFIA 1SV5A 5BR8F 1NSPA 2KXNB 4CT9A 3R97A 2IYGA 3N6LA 4YB1P 1JLBA 1URNA 1X0PA 3SSQA 1X7VA 3PO4A 3PHEA 5A6WA 3W8PA 2UXBF 1HYSA 1IJEB 2QIFA 1OYEA 4RW8A 1A6LA 1CJVA 4DV0J 1FEEA 4DQSA 1RYSA 1N33F 2FVQA 1AFJA 3MI7X 4LUBA 3H0PA 3MM7A 3MUTP 1F9FA 3M1VA 1YJWS 3TW0A 3HP6A 5A8RA 3IR5B 2UXDJ 3ZNJ1 4HACB 3C46A 2DGVA 1RTJA 1QUPA 2R7OA 1V6HA 1T9WA 3GU0A 4AE5A 1JXLA 4F2SA 3QRPA 1JLGA 2UVWA 4LSNA 2BANA 2CNKB 5KG3A 2UP1A 1U25A 1NEEA 2JSXA 2Y8WA 3KK2A 4G1IA 4ZLJA 4IOCQ 1U6FA 2D74B 3CMQA 3GG1A 3Q83A 4KKOB 1C1CA 2OLWA 3PHTA 5ETQA 4JV0A 3GIIA 5J2MA 4NX9A 2HS3A 4WZQA 1Q79A 1ZS6A 2VF3A 1WDTA 2HLUA 4RR5A 1Y11A 4EMDA 3ZZRA 3MCOA 2YKQA 4NLDA 5CCMA 3AODA 2RH3A 3VV2B 1UVJA 3I0RA 4O23A 5AT1B 4J5OA 1LEOA 3K57A 2RQ4A 3I9ZA 2LP4A 1FRXA 4EUVA 2HRYA 2KN4A 3GLJA 2V4JB 3POTA 3R9LA 1KVKA 1SKWA 1JJ4A 3SQOP 2VA3A 2JX2A 1F1BB 3G6XA 1HWIA 1TVRB 2RNEA 2XQCA 5I3UA 1FJ7A 4P7VA 3PFOA 3TJAA 1Q8KA 2CG8A 3KHHA 1HWUA 2DH7A 3BQ1A 2VBYA 3KKFA 2AKWB 3MAHA 2RRBA 4ZCKA 1E6VA 3VQTA 5CA5A 2A10A 4CLYA 5CAAA 5IM0A 1NH8A 2V0NA 4Y2MA 2K06A 4I56A 4WTOB 2AV5A 1NDKA 1TL5A 2G1DA 4TY8B 1YG0A 4DFMA 3TZWA 1AA1B 2DT9A 3ENWA 2DYAA 5DETA 3DFEA 3OLBA 2MQQA 3FEZA 4K4UA 1G2EA 4ZVTB 2RQKA 2J9EA 3EYZA 1S1WB 3MZIA 5BXIA 1H73A 1RWVB 5M2PA 2FB0A 2UUCJ 4P72A 1VQOS 1S1UA 2E7WA 3MM6A 3M2RA 3DGPA 3KHGA 2CQBA 1UEVA 3TA0A 2I1RA 3T6JA 4LF7J 2YWGA 4ZP6A 4ED6A 2PO4A 1LW0B 2BVZA 3IS9A 3SBMA 4GO5X 2B0GA 1WF2A 5F0WA 2WSCC 4ZN3A 2CQGA 3CIZA 5DG9A 2KG1A 4O3OA 1RHJB 4WFXA 2ZBPA 3MOZA 3W65A 4ECSA 1ITPA 2GQQA 3BBCA 4GO7X 5KFCA 1X60A 3HM9A 1VQ9S 5GAGI 2HWTA 3ZZOA 3O8WA 5K20B 3O3LA 4M1KA 1LW0A 3IS9B 3LAMA 4TQSA 2R8JA 4MAKA 2UUBJ 1RWWB 4RNHA 3DGPB 3M2RB 3Q23A 3MM6B 1S1UB 2KRRA 1NKCA 3W3SA 3IC1A 3P5TL 3T41A 1XMQF 1F9HA 1S1WA 2BJEA 3QFHA 4TXSA 4YEAA 2ZH9A 2UV8A 1VQ4S 4W92B 2RILA 4NLQA 2AP6A 2MKIA 1VJWA 1SL2A 2YKAA 2CKWA 2M5YA 2EFGA 3K7RA 4AL6A 1Q82T 3BO4A 2MKJA 3F0NA 4ZCMA 1GMWD 4TY8A 4UY85 4WK3A 4DV3F 4DV5F 1S77D 3GP9A 1FFSB 1PC5A 1PBUA 1E6VB 2B9XA 3F56A 5IM0B 3KLFB 1DY3A 2H5IB 5KG1A 1LV5A 2D3UA 1WTBA 3N28A 3CJ0A 4J37A 3TA1A 1PCAA 4O3SA 1FKAF 3NAIA 3D1HA 2MQOA 2ACMA 4LBIA 5GAEU 5I3UB 1TVRA 1IN0A 3CWJA 1TK5A 4MJKA 3D5MA 3EVWA 1S0VA 1VQKS 2AYGA 1KD1T 1HNWF 3VHQA 3HKWA 2V4JA 1U8WA 3POTB 4FNHA 3HVRA 4DR5F 4CLWA 3TQ1A 4I68A 4FNIA 4ZIWA 3W64A 1RHQB 3M8YA 3I0RB 4DS4A 4RNNA 5L38A 2V2QA 2IM3A 3GSIA 3OXFA 3VF0B 1U1KA 4JYAJ 2ZWPA 4JI0F 2CPIA 3JTPA 1WHWA 1X4DA 4KH1B 1HI0P 4LREA 4DR4F 3GSDA 1X4BA 2MQ8A 1FDAA 1C1CB 5J2MB 1I3OB 2YY3A 1LFWA 2R4FA 4KKOA 3OHBA 2BRKA 3M4XA 4NLUA 3KK2B 2F9DA 3JQJA 3QPIA 3RRHA 2HYIB 2RS8A 2VIHA 4ZPVR 4WFNQ 5D0HA 1FA0A 5KG6A 4DV4J 2BANB 4LSNB 1TP7A 4DUYJ 1S5ZA 1JLGB 2XMKA 3KUEA 5KFEA 1JJCB 2NS1B 4CLPA 5D15A 1SJ3P 4B9LA 1RTJB 2IM1A 4HACA 2BACA 5B0EA 1HLWA 5A8RB 5DG8A 1WHYA 1MLAA 1RE1B 2HS4A 1HWKA 2H48B 3M1VB 3BQ2A 1NSAA 2QYGA 3MM7B 3IBWA 2V2KA 3JSYA 2KO1A 2BQRA 1TKDA 4ZVRB 1CJVB 1UP1A 4RW8B 1VGYA 3H4BA 2MQLA 2XLKA 2MLYA 1N34F 1HYSB 3SYZA 3OSPA 1T02A 1JB0C 1JLBB 3A1YG 3NNHA 3DRYA 1QSYA 2VFSA 2FLOA 2LQ9A 2PN6A 2U2FA 5ETKA 1SV5B 3UN2A 1X9WA 2MHEA 3QT5A 1SVDA 2QC3A 1GMWA 4X4QA 3O1LA 2DY1A 4J9RA 1XTZA 4WKYA 4OZ0A 3KJFB 1EKSA 2P2CB 2ACYA 4LSLA 1C0UA 1YBAA 1WEXA 2XYGB 5B0AA 3TP2A 4M94A 2ZZTA 4FBUA 3F73A 2DNOA 3A8JA 1L3TA 4PUOB 2MYFA 3VVTA 2XC9A 3FSXA 3GILA 1CS4B 4HT7A 4DCPB 1TKZA 1RT6A 1SC4B 1WUUA 3JAMY 1H2VZ 3CCLS 5AE1A 4NLWA 4URQU 3HT3A 3T1YF 5J1PA 3RTVA 1TK8A 1RTIB 3ADAC 3HI9A 4Y2AA 4C6AA 1W2IA 4JI8F 1RAFB 2FUG9 1K1QA 4PG6A 2JOQA 3MEDA 2XWXA 3UD4P 3U1NA 5GAEI 4ETXA 3KJQB 3UN5A 2R2TA 5I42A 5K14A 2IBKA 1NSQA 2HFOA 3ET6A 2CZ4A 2DNMA 3NGTA 3QGHA 4WP9A 3DNCA 4OZ3A 2CQ1A 4X4NA 2JLFA 3FJ2A 4ZVEA 4EO8A 3QT8A 1FO1A 2K7JA 2XO7A 4M5IA 1K47A 3N6MA 4OJ3A 4YFUA 1PGZA 1U48A 4KE5A 4MH8A 4U9RA 3SCJE 1SBRA 1P9YA 1Y5LB 2C2NA 3LGNA 5SZTA 4BCAA 4CDIA 3HFKA 1UVIA 3TJ9A 1Q1KA 4FZVA 4DL0C 3KLVA 5H9FJ 2RD5C 3M30A 1ZYQA 2J8AA 2OIHA 3RBZA 2D3O1 4DI6A 4F3MA 1L5UA 1WDDA 2ZWOA 1DAXA 3IWNC 2AGPA 3P49B 2A2DA 1TL4A 3QO9A 3UNGC 4A48A 1RHMB 4UUXA 2C3OA 1X4HA 3DLGB 2KB2A 1NJYA 1ZM4A 2FJBB 2V68A 2W24A 3NKYA 2ZBIA 5J2QA 1VBKA 4HHUA 5LXYA 1SH3A 1KTQA 5CQGA 4CO2A 5C25A 1YITS 2IA6A 3DDIA 1KLMB 2VUGA 2GGPB 5EHHA 1CJUA 1GXUA 1ZAXA 1R8HA 4DV6J 2YNIB 2MGZB 3HHLD 5KT3A 1TL7A 1LWCB 1HQEB 2E7XA 2ILZA 3M2UA 4DPUA 4KBIA 3GQCA 2GMLA 1Y9OA 2MKYA 2VBWA 1QUVA 3DGVA 1HWJA 3TZYA 3N01A 1Q8IA 2W1BA 1XIQA 5F41A 3D54A 1M0SA 1Y0HA 4DQRA 1VQ7S 1I94J 2R7TA 2FD2A 5G0RA 4NCAA 3BGFA 1LNQA 1S1VB 1VHIA 1W25A 2IYIA 3MPWA 4EK2A 2GVDA 3EICA 4DX5A 3AOBA 1RABB 1RGVA 3QGGA 2JRSA 2HHTA 4JI2J 4DF4A 2AEMA 3KLGA 3G4SS 4OYBA 2PD1A 3K5NA 3RRGA 5F0UA 3I9V9 5EN1A 1QAYA 2FVCA 1WKJA 3OBIA 4V1Ak 5LXRA 3ZZYA 2AU0A 4LRAA 2W4CA 4QR2A 4B02A 2KJWA 4GC7A 2HHPA 3ITHB 3Q8PB 1M5SA 3ELHA 1RWUA 1NH7A 2HNZB 1IKWB 2YWEA 2RKIB 3U1MA 4LF6F 5E2QA 2JWNA 2P9EA 1WG5A 4RW4B 4IFYB 1E6YB 1LWEA 4M5DA 5HBMA 4DR6J 5LMUJ 1K0VA 2HGMA 3M2VA 4GKJF 2IM2A 2ASYA 2XO6A 5I3PA 3G96A 1H38A 1YWXA 3CE8A 5KFMA 1JLQA 1VMBA 2RT3A 3DXBA 3MCSA 1FXRA 3OW2R 2Y1JA 1RT2B 3TAPA 3R27A 2AEFA 4DS5A 5F8MA 5KFWA 1FWKA 1XQIA 1NHKL 2GHVC 2KYXA 2WVBA 3VCDA 4WJBA 3W61A 3UR0A 1IWGA 2IHR1 2QLJB 1N8RT 5KFNA 2LQ5A 3GB0A 2B7BB 4BLGA 2P9GA 2CAJA 3TVZA 1HNZF 2C3PA 2RHSB 3EE3A 2V8PA 1HNXJ 4QQBA 1XNRJ 5E3CA 2FJXA 4MKYA 4B3TJ 4NI2B 1QSSA 3KDOA 1NDLA 3M8PA 2LDYA 2XI3A 3LP2B 4ED0A 2FHKA 3JSBA 4DXLA 3FBFA 3VAIA 4NXMF 2M0GB 3R7SB 3O6QA 5EDWA 4W90B 1S4FA 2LXFA 3TJ8A 4NLSA 1ZAWA 4IQMA 5A0YB 4YY3F 1RT3A 4Q0BB 1JLFB 2DEJA 4OHVA 4K0KF 3H8YA 4F3QA 1KQSR 2WONB 3Q86A 4OI6A 4U7UK 1LWFA 4QIWD 1RI7A 1ZPWX 4DX8H 1VRUA 5DQHA 2MQNA 2Z4PA 3QWPA 1RBAA 4GVBA 4ZP8A 3K59A 2EBGA 3CJ5A 4QIEA 2LVWA 1NU4A 5CXTA 3Q8QB 4RO0A 1C2PA 1BQMB 2R2UA 2Q66A 4IG3B 5HK4A 1D3WA 1QAXA 1D9FA 2VOOA 4F02A 3Q89A 2BZ2A 1K73T 3N5FA 2I0XA 1C4CA 2HRUA 3ZZUA 1K44A 2YWFA 1JQGA 1JLAB 4DN9A 5A76A 3MMBB 4PWUA 3EUNA 3OR1B 4RBTA 5HN0A 3OXGA 3Q8SB 2W9BB 2FZGB 3GJSB 3RAQA 1ZTTA 1H3DA 2ROEA 4F8RA 1TL3A 3KG0A 1GT8A 1WHVA 1WC3A 2HQDA 3UDEA 6FD1A 3JSMB 3Q2SC 4HTIA 4ELTA 2Z30B 3HSJA 1Q7YT 2E29A 1CLFA 3HFZB 1CULB 4J9OA 1DLOB 3KXDA 3KLEB 4BDPA 2B5JB 2ASDA 2ZH4A 4NXNF 1U2CA 2HEKA 3FNNA 3AD8C 1S49A 1R8BA 1UFLA 5D77A 2GHWA 2A3JA 1AYEA 2PFDA 3R7NB 2CPHA 2X1FA 2ZUGA 5K8PA 2YNFB 4PXDA 1XN9A 4ZVUB 4Z37A 4B3SF 2JEJA 1NPRA 2O01C 4PEOA 5KFDA 4Z7CA 2VQEF 1OQ6A 3ENAA 3DRPA 4K8RA 2H4YB 4KT0C 3PR5B 1YRXA 1IBKF 2H51B 1HNIB 1Y7PA 2HHUA 5FJ4A 3D1OA 4N8NA 4ELVA 1RWMB 1FFWB 1HMVA 2VG7A 3H2UB 2I38A 3NNAA 4FPRA 3NGDA 2MMYA 1JKHB 4UZBA 2CNNB 4QWEA 2XS2A 2QTWA 1U02A 3HHNB 1AUSL 1RDRA 4KJIA 1R8AA 1ZAVA 3OPKA 3MMCB 1NK0A 2KTQA 2DKOB 4QOTA 5KFIA 2GCFA 1MU2B 1H74A 2DNRA 2C42A 3QGPA 4FP9A 4PZVA 4J9MA 4DFPA 2GIFA 2I5JB 5DGAA 2BW7A 4OI3A 4FKYA 3PX4A 1N6QB 2KRBA 3FZBA 5KT7A 4DR6F 1RAJA 2XY6A 3MDFA 2AD9A 3OFHA 4DV7J 3H5XA 2PEHA 5HP1A 4CCHA 2F1FA 1DBDA 3MURP 1YJ7A 4O3NA 3VAHA 3EMTA 2RHQB 1XR6A 2EG1A 3G86A 1HQUB 2VFVA 1F0XA 2H54B 2DR5A 2L08A 1UKUA 2RRAA 1R3NA 1R0AB 3BGRA 2XGQA 1FJGF 4WCEQ 3KWMA 1HD1A 4E2FB 1A0OB 3CO9A 1Y00A 9RUBA 3PX6A 1TAUA 2EG2A 2O3DA 3W7BA 3OFGA 2ZNZA 2DGTA 4O4GA 2V5HG 3D6MB 1KDNA 3KLIB 3IM9A 2AX0A 2HLTA 4YB5A 5CYQA 1H98A 1QSLA 2M88A 1GQEA 3QAUA 4B3TF 4NWBA 3S01A 2A6MA 3HSDA 1YJ9S 4ZDNA 1HHQA 3AH6A 4Y34A 4P2FA 3S1TA 3R5DA 3HHLB 3T5HA 4XK8C 1X4GA 1XMOF 3R2CJ 1U8SA 4TVAB 1YJUA 1YRUA 4HLBA 4BHQA 2IRXA 2CPDA 5CD4H 2F4VF 1M1GA 4PG4A 2Z56B 4UTGA 1SIWB 1TQLA 2AW0A 2HVZA 5GVQA 2MY8A 2VC0A 2V9KA 3I0SA 3IG1B 1RUSA 4IH5A 3W62A 5E41A 1FT8A 1PJ6A 3E01A 5AJ3F 3CXCR 2V8VA 4F67A 4JI0J 4NCGB 3K2YA 4RNOA 1MROB 2J7WA 2W01A 2Y1LB 1OS5A 4FYVB 3PW7A 2E1PA 1HIYA 3W60A 4OV6A 2BW2A 3HZEA 3I31A 2OPPB 5HQ8A 4I67A 2KXHA 2HNYA 1VDHA 1U0HB 2OH2A 4A8SA 3CDEA 2MLXA 2QZ8A 4UZCA 1TELA 4WIIA 4DF8A 4USVA 5J1EA 3H40A 3A8EA 1UVKA 3JSRA 2XS7A 4DZ6A 4MT1A 2FDNA 2IY5B 2FHOB 1UWBA 2I9SA 2MXYA 4L75A 1BUXA 1RT1A 2DEIA 3NOCA 2X51A 2OPSB 5ETVA 3IP0A 4RW7A 5K8OA 1KWMA 2K1RA 5F8GA 2B4VA 2GW8A 4OZJA 4AD6A 4C3MA 1J27A 1F5AA 3R5GA 4NLPA 3PW0A 4JI6J 3TA2A 1RXOB 2WVFA 1QVFR 4PQUA 5KTQA 2MSSA 1CQMA 3CCJS 1HL6A 2ZC3A 3AAWB 4XAKA 2IIHA 3R1HA 1U1RA 3VALA 3UVJA 5KT4A 3M9MB 1PILA 5J1NA 5C24A 4CO3A 3MOJB 4ZLPA 4F7VA 2VBXA 3C16B 3M32A 3MEEB 1FNOA 4Y28C 2MB0B 1UA0A 1XR5A 3A12A 3BEGB 2PI4A 1KNZA 2RUSA 4KO0A 4OYZA 3OT9A 4R8UA 5BYSA 2HZAA 1RT7A 2IRYA 2MY7A 1S6QA 3MM5B 4F4XA 1RWXB 3VWSA 2QSWA 4F4YA 4NLOA 3T1YJ 4IO9Q 5AXKA 5SUHA 4DL6A 1BWVA 4QW9A 2KDOA 3OTOJ 1WACA 1Q86T 4DSKA 1YZ6A 4HKQA 2FVRA 5IV4A 5D4PA 4ZJQA 2YH0A 2MZSA 4WFYA 4QYZJ 1TKTB 2NCKL 2QMXA 4FPIA 3NP5A 4KRWA 2OTLS 3NEKA 3V5RA 3EZUA 4C0BA 1U1NA 1CG2A 3CC4S 4C8ZA 5I4MA 2NXNA 3LANA 4FVCA 1FVQA 3HXMA 3ENVA 2GIRA 5ITHA 4Y65A 1FK9A 4L72B 1TR0A 4K59A 4EGLA 2OUGA 1GTEA 1EARA 2MQMA 1YVFA 3HHDA 4OHXA 4L6V3 3CDUA 1N56A 2DNLA 1HA1A 2B8PA 5DDOC 3IRXA 1KBRA 2DB1A 1TU0B 2HK2A 4KTQA 2NZCA 3T1HJ 3CF5Q 4Z2XA 3EPGA 3BSAA 2OSQA 2E9RX 2MKSA 3FDSA 2IC3B 4ZPDA 3BYPA 4TYBA 4A8KA 2AGQA 2BKPA 3V4MA 4DFJA 2Z2LA 2KHDA 4X65J 3H2LA 3HLUA 2CQPA 1T9VA 3OTCA 4C98A 3QZ8A 2YQ0A 2DGOA 2ZE2A 2A1BA 2XGPA 3FCWA 2AJ4A 2KL8A 1MW7A 3JQMA 2R7WA 1YIJS 3MFIA 2OMLA 3K17A 2QYCA 3KNAA 2Z8QA 4UF4A 3KG4A 3TUPA 4C8MA 2Y3YA 2DNZA 4N77A 3CB4A 1BY9A 4PABA 4K4XA 4LF8J 1ZOTA 5G4DA 3UN3A 3Q22A 2VG5B 2PIIA 3T3FA 1FFGB 3CCQS 3RU0A 2RSQA 1REVB 1JWWA 2CPZA 3CEDA 1RKJA 3SEOA 3SCKE 1H2UX 2YQ3A 4WP3A 1NRKA 4LR9A 2BMBA 4OYAA 2MHNA 1QM9A 3B4MA 4GKJJ 2XB2D 2MSTA 4WE1A 4ZMMA 4UW2A 2JLEA 3FZ2A 2B9YA 3RW7A 1L3VA 2UVRA 2E9ZA 1MSWD 4NYZA 1WORA 1RAOA 1H6KX 2NXUA 4MKAA 4O44A 2DR7A 2DNPA 3NCRA 3LGMA 3AOCA 2CQ0A 1VC5A 3TUIC 2F65A 2QEXS 1WHXA 3T9NA 4ID5A 3KJNB 2ATLA 3FGVA 4IDKA 4UUWA 2GV1A 4NMLA 3SZ2A 2ALZA 3DLKA 3AHPA 2DNQA 3DM2B 1WC6A 4W4MA 3CCRS 1T3NA 4DR7J 3QT7A 1RHKB 3DU6A 4GKKF 2W7PA 1UFWA 1UZDA 3HVTA 1RT5B 1VRTB 3F41A 2MQPA 4EBEA 1RHUB 1F5CA 4I7FA 1UJ5A 3H7HB 3UFCX 3TI0A 2KZZA 2MZJA 3DHWC 3PDNA 1GK8A 3Q8VA 2RU9A 3M8ZA 2ZH2A 3OTDA 4OLPA 1XC9A 1J5EJ 1WJ9A 4TYAA 4DL5A 2QL9B 3BGLA 2DHHA 2ZH8A 1CBKA 1HPZA 4WP8A 5DZ6A 5A8WB 4C8YA 1IKXB 3BREA 2WVEA 3TYTA 2DY9A 1Q8BA 1NK6A 1FESA 3BYRA 1S7HA 1DQAA 5F8IA 4JI7F 3R6GB 5CYMB 2K2PA 4J9PA 4O0IA 3FQLA 3DOMB 4LFAJ 2DGXA 3FFIA 4BWMA 1SC1B 4I2PA 4LQ3A 4WPAA 1WNEA 1EHWA 2FC9A 3FCHA 1DJ0A 2F8HA 4JBCA 4OZ5A 4H4OA 4ZCLA 3MR7A 2IFXA 3RRKA 4DJBA 4E98A 4B3MJ 3K89A 4HDHA 3Q2TC 1LW2A 2Y0SD 5GMKa 2ZH5A 2DXDA 4KFBA 1SI9A 3UPFA 3U7JA 3J7Z5 1JXEA 4XTTA 3OJSA 4DPOA 1LXNA 4DV2F 3SV3A 1Q7LB 1HBOA 1GAOA 2JC1A 1U49A 4B3RF 4I69A 2ZDPA 3G82A 1H0HB 3PW5A 4ZPCA 5J2NB 1I5OB 4DR4J 4TY9A 2G2ZA 1B3TA 2F3JA 1DHMA 2ZKTA 2YX1A 4IOBA 1MWYA 3NGRA 3GV8B 5D3GA 2XULA 5EWFA 2GAHC 4LRFA 2LQ8A 3DLHA 1SL0A 4PG7A 3EPIA 3MTKA 4ZIVA 3E8OA 2Z57B 4JB8B 3UI3A 4MK9A 2AIRB 2WRMA 3HVWA 1FWPA 3MD3A 1VBYA 2HBRB 2W4DA 4I2QA 1SKSA 1JX4A 5ETNA 3RG6A 1OWXA 1X4CA 3NLCA 1YBTA 3PRVA 3QFWA 1S6UA 2HK3A 3HULA 3KYLA 4DLGA 4WU2A 1CSJA 3MF5A 2DRAA 2W9CA 2VU5A 1IM6A 5I3QA 2LQBA 3TEHB 2D7SA 4CH0S 4NASA 4DLEA 1NJIT 1Q53A 3J7ZT 2WSEC 4QWAA 3FBCA 1J5EF 2E44A 2BXJA 3F44A 3WC0A 1DTTA 1N48A 5DRKA 3G71S 2L3MA 1FKOA 4IG0A 4DV0F 4Q5VA 1UPMB 2PC6A 2XY5A 3CCZA 4K5RA 1NK4A 4N76A 4CH7A 2C2MB 4H4MB 4CWBA 1J2VA 2YX4A 1TKXB 5T7LB 1Y3JA 5HQMA 3BH6B 1U4BA 5KFGA 2XG8A 5E3AA 3DRSB 2IDEA 1U1PA 1Y10A 1T7PA 2W2MP 5HAOA 4C0OC 3FSIA 3VAJA 1BC6A 5DO2A 4OI1A 4JI8J 1H7WA 4QBUA 3MAQA 1B99A 1QTMA 4OI0A 4Q45A 3I56S 1BQNA 3JXOA 4LBPA 5ETRA 3BR8A 3MWBA 3QIPA 5IS2A 3MUMP 4P52A 4F25A 4FYWB 5LMNF 2UXCF 2B3TB 2VL1A 1AT1B 3CD0A 3CJ2A 1NSKL 4IFVB 4YQWA 3WC2A 4K4ZA 2YWWA 1M5HA 1WOSA 2DXEA 2G9OA 2I8EA 5CZXA 3KK1A 1NDPA 3DLEA 1RA7A 3D6HB 3HF5A 4I6AA 4KGMA 2PGCA 4NYPA 3W2VB 3J80U 1TL1A 1HHSA 2R2SA 3J7AN 3HO1A 3MCNA 4IKAA 5GAHI 3P8BB 2HFNA 1T03A 1EX8A 2X1GA 1NNDA 4C8KA 4YOEA 4GMKA 4C2MA 2ZH7A 3E2EA 1R6VA 3JYTA 1ZPVA 3ICLA 4MYTA 3THTA 4X64J 2AYMA 2GJIA 3C15A 2VH7A 1T0TV 1WD6A 3OFEA 4URSA 2PMHA 2CADA 1PSDA 3MEGB 5DLGA 3MECA 5FDLA 1G7CB 3LO3A 1NKEA 3DCAA 1FVSA 1WSVA 1HFEL 4USKA 4IRKA 3M7VA 2CNLB 1EQ0A 2CJAA 4N47A 4F4KA 2KHCA 3NL0A 2OD4A 1XMQJ 3NMRA 3C6TA 4ECZA 5DLFA 4LFAF 3PJXA 3TUJC 3QIDA 3WBZA 2VBZA 3B54A 4CLUA 4LR8A 1UEUA 2XMTA 1Q8LA 2E5JA 5IT0A 3DOKA 5JVHQ 1REGX 2ZNYA 4OHWA 1FF2A 1J5OB 4B9UA 5GAGU 3CD6S 2FGOA 1H72C 2C3UA 3H4DA 1S6PA 4OJGA 3VQSA 3K5LA 2NLWA 4DQIA 2FZKB 2FJDB 2C2OB 2C22A 4DL3A 2DR6A 1FEHA 3QLHB 4C7QA 2XS5A 1N32F 2CZ9A 4YN3B 2KT5A 3N6NA 2QL5B 3NY0A 3J7YI 2YH1A 2B9EA 2OEMA 2YWHA 2IAJA 2WSFC 3IMQJ 5KFAA 5LT5A 4KQZA 2ASLA 4ZS6A 1B0VA 1PJ5A 3CUNA 1NXIA 4A8OA 2WOMA 4XPEA 2VC1A 1RADB 3FEYB 3PIOQ 4LIRA 5BYRA 1HNXF 4PWWA 2M9KA 2VA2A 1I51B 1G4CA 2FC8A 2ZITA 2UUBF 3CJTA 3GTYX 2ZJRQ 5KG2A 4KGKA 4V19J 3BGOP 4JYAF 1KOOA 4DG1B 3V6DB 5KFJA 4JI4J 2HHXA 2GX8A 1ULRA 4FXWA 3KDNA 3MM8B 1BE4A 5J2PB 4LFBJ 2IBOA 1FD2A 3EGWB 2FLNA 2VZ9A 3DRRA 1P1TA 2GIQA 2E1CA 2P6SA 3P4UB 5C7PA 2MEWA 1KTVA 3NGKA 2DHXA 4HT5A 1ACMB 2N3LA 4DV4F 1HBUA 1RAGB 4ATNA 4L74A 4O4RA 3LP1B 1N5TA 5BJRA 3RBDA 4ED2A 4AXIA 2GMJA 3NNCA 1X9MA 5D0GA 3TQEA 3ZNUA 2HMIB 1DRZA 2CPJA 4B3OA 5H9FK 3MR2A 1C0TB 3IBFB 4ZVQB 1U1OA 2WHOA 1GEHA 4M95A 3GFXA 3DOLA 1T05A 5HJYA 2BJ9A 2QX0A 3PTWA 2LXUA 2RVJA 2YKNB 2BM1A 4J7CA 4CYUA 2LQJA 3OR2A 4ANCA 2YX7A 1CQNA 4NXMJ 1VI7A 2EFOA 1AZSB 1KS2A 1R27B 2V8HA 4ICLB 5KFLA 1M1KT 4U7UD 4OI2A 1KLNA 1TUVA 2AX1A 3NWRA 1UJ6A 2CDRB 4YB6A 1T9UA 4UQGA 3X1LB 4CTAA 2XHWA 2CWXA 2XSJB 3MM9B 5D4NA 5CCLA 1CPZA 2IMOA 4MKVA 3EVMA 1R8PA 1SL1A 3MD1A 3UDCA 4WFBQ 3NGSA 3MPVA 2PE8A 4OYPA 1VIOA 3OL7A 2EEYA 2XCPA 2OELA 3DDNA 2IJFA 3ZO7A 2KXFA 1JLCB 2C2DA 2I6WA 5M2RA 1BMQB 2FIUA 1NB2A 2ALYB 4K0KJ 2CIMA 1S1TB 2PA3A 2IVFB 1HBMB 4ALZA 4OL8A 1TZ0A 1B7FA 2VPWB 1EP4A 2COLA 3DC2A 4OZ1A 3SQGB 4RU9A 4LSZB 2DNHA 2CQ3A 3BJYA 4A8QA 5ETPA 3KK3B 3G6YA 2YNHB 2HQCA 4Y2IA 5T41A 3H5UA 2QLFB 3PYEA 4QR0A 5IC4B 2B6AA 3SDEB 4CO5A 2DPJA 4NLGA 4CO0A 2VODA 4ZK7M 3NBPA 2R42A 2C28A 2AT1B 2NPIA 1VQPS 1JNRB 4OX7A 1RQ0A 2NXJA 3GJRB 4U96A 1ZBTA 3HJVA 4DSJA 4P6QA 3M6WA 4QCLA 1IKYA 1ICEB 3LAKA 5C2GA 4RZRA 2OMOA 2H5EA 4F3OA 1V3RA 3LP0B 5AXNA 4FXDA 3J81Y 2OAUA 3CW2C 3CTRA 5L1KA 1ZTWA 2QA4G 5E3RA 1QAJA 4IYQA 1D9AA 1PYTA 1VIXA 4USWA 4ZVPB 5F9NA 1U2RA 5B7WA 4AL5A 4X2BA 4MIBA 3DN9A 4OX9J 3BKUA 2VICA 4GVLA 4C9DA 2VG6B 4DX6A 4I64A 5CYJA 4HHHA 4NXNJ 2M2BA 2AYBA 2CPFA 2DVIA 3RBXA 3DMJA 2NPFA 4X4UA 1FRHA 5IQ6A 2J6SA 2CQHA 3FMBA 4PG5A 1WOPA 1RTZA 1XERA 4MFBB 4RW6A 5D4LA 5A8KB 1CEZA 1HARA 3GIKA 2NUHA 3UW1A 1NB7A 1UEKA 4A8MP 3VAMA 3NAHA 4KGXB 4QR1A 3A3PB 2XZTB 4R0JA 1V5VA 3GWCA 1KRPA 1RT4A 3ZTOA 3LALA 2DGQA 2EFVA 1IBKJ 2V2VA 1JLEB 2XMJA 2HRTA 4PWDA 1RKIA 4ECTA 2QA4S 2N7YA 4TKTA 2QJ3A 3CD7A 2HHHJ 3U1LA 1RCXB 1D8ZA 1Z2LA 5KFYA 2FPHX 1XNRF 1VLOA 2YWKA 2IVMA 2F4FA 2LYVA 3OTEA 3TR5A 3ZTPA 4CLFA 4X4PA 3D68A 2GO8A 3Q24A 4OX6A 1YK9A 1YBUA 2M70A 4RLEA 2Q3PA 4KV8B 5KFHA 3DYAB 1S1XB 2NXEA 2ABYA 1KQGB 4HL9A 2PI5A 4ERDA 2BE2B 3ZZPA 2R8HA 1KONA 4C11A 1YSJA 1FRKA 2L48A 2NYHA 2V50A 3CDWA 2FY8A 4N8OA 3UQSA 2HFZA 1MWZA 2F5GA 1S9GA 2RB7A 4RWWA 2VQFJ 4O0NA 1FKPB 3EGZA 2YKOA 4TLRA 8ATCB 1C1BA 2XHCA 4LF4J 2KZMA 1TUWA 5B0BA 5A2QU 2E5GA 2HIQA 2BQUA 4X4VA 3MEKA 3L7OA 1PAEX 3CCES 3HX9A 1FDBA 2O66A 3IN5A 3M8QB 2GAGC 3CGIA 4LJMA 2HVIA 1BLUA 2AYEA 4DR3J 2P5VA 1TFYA 2QFJA 2OFGX 1FRMA 3C6UA 3D3BJ 2XLJA 2V2ZA 2DR8A 1OY6A 2YNGB 3CNQP 2W9AA 3CC2S 4OYOA 3ZFVA 3FBEA 2PA8D 2B8QA 1YHQS 4F50A 2V67A 3W9IA 1QE1A 4O3QA 4Y2KA 2RF2B 4Z7YA 3N0VA 1HQ2A 2JFKA 1XNQJ 3PYGA 5IV3A 3CCUS 2R7RA 5DQGA 1PYSB 5F9LA 1T9YA 3OVAA 2CJQA 1GMUA 2JH3A 2HSEB 4UQTA 2V4QA 4MIAA 3HVAA 5DG7A 1EIYB 3MAAA 2BUNA 4KIAA 2VONA 4RUCA 4QU6A 1S7IA 2C3YA 5FIIA 1S9EA 1EETB 4R5PA 3KUHA 4NPOA 3A8KA 1RTDA 2BE7D 1V5IB 2HNDB 1WSRA 2DTJA 4HHJA 4AQYJ 4LFCF 5C42B 1Y5NB 1IKVA 1N52B 3LQVA 4TLQA 4ZJLA 3W63A 1LOUA 1AROP 1HNVB 2R7XA 5JUMA 4DV1F 1ROFA 4YR0A 4K7QA 4C4WA 1FX2A 4U95A 2E5LF 1NAQA 4WKRA 2HKEA 2QFIA 3A4TA 4H54A 4NLXA 2N3OA 3AFGA 1IBCB 3KJVA 1XMBA 4P75A 1O6XA 3IXQA 5HVFA 2JLGA 2OGUA 2PSZA 3HSZA 1CJTA 1NBEB 3AA9A 5ETMA 2ADBA 1SCJB 4CRJA 2WTFA 4D3GA 4DV5J 2LEBA 1WEZA 3V4IB 2Q43A 4RUHA 2JVRA 3P6YC 2YKMB 1ELOA 2Q1LA 3H90A 5LL6d 2ROGA 2DK2A 2N4CA 4OX9F 3LWMA 4PXCA 3TAMA 1U1LA 2LXIA 4UOHA 3VGVA 3BSNA 3GFYA 2AZ1A 2R9LA 5EX3A 5KT6A 4URGA 2C1EB 1FRIA 3GR0A 2BOPA 4PG8A 4M5NA 5LJ5Y 3CD5A 3R1LA 4X66J 1WWHA 3S6EA 4LF8F 3OUYA 2JHEA 2FZCB 4K5SA 1B70B 3EM1A 4DR2F 3TAQA 3KLHA 3VVUA 2HVEA 1MNEA 3TX8A 3RB6A 2OPRB 2B9WA 2LU1A 1TV6B 2GVZB 2R8IA 3WDOA 2PDAA 2Z2YB 1BD6A 2CZVC 5D8HB 5E0OA 1VFJA 2W2QP 2ZBCA 4RW9A 3OTOF 4B3SJ 5KAKA 2ZD1B 4OYMA 1RTHB 4G65A 4C3KA 4LRBA 3DI6B 5K8MA 2G2OA 3W2WA 4LVNP 4MTPA 5IC6B 4RJVA 4ED1A 1VK8A 1RLCL 1MN7A 1MMLA 2CPYA 3TRGA 1HBNA 2MKKA 2X3DA 5U47A 3KLFA 4KGVB 2UV8G 4ZVGA 3VZIA 4KYZA 2PT0A 2RU3A 3MMAA 5IWAJ 3BQ0A 1XMOJ 2KT2A 2HBYB 2GNKA 4FN5A 4NE9C 1PC4A 3IM8A 1F3VA 3E51A 4AUKA 1JJHA 3BPSP 2ZOMA 3R3TA 2KU7A 2P6TA 4NLTA 3CJKB 4OHZA 1WF0A 2CRLA 2VASA 4WU3A 3GONA 3TVYA 3H20A 2UUCF 1RU1A 3WX4A 2OPQA 4HDGA 1RWKB 1PYOB 3J7YU 3C14B 2ZBQA 9ATCB 2NQPA 1IUJA 5F3TA 1T95A 5KT5A 4XO0A 1EZZB 3KHRA 1IBMF 2NZ4A 2DPIA 2X3GA 2LEPA 3BBBA 2MDAA 4IQXA 1RK8A 1FJGJ 1PBAA 1CJKB 2OEKA 5IWAF 4ZHRB 2AJFE 1DQ9A 2AJ0A 3X3UA 4DN0A 3CT9A 5HMYA 1KR4A 5HROB 4G1QB 4TQRA 3LTOA 2R8GA 3QRQA 2X7IA 1JMTA 1YLXA 1M5PC 4ZKAA 4J9UE 2EPIA 4X84A 4GC6A 4F4WA 2W25A 3H59A 4CP5A 3BDPA 1RSCA 4NRTA 2J7UA 3D6FB 3TX0A 1SUQB 5LMUF 3T5KA 1DTQB 4DBQA 3V81A 2YVSA 5KFBA 4JI6F 2DNGA 2MZTA 5HLFB 4JI3F 4BC9A 3WZ0A 1UZHA 2A0FB 1RZMA 1K8AT 2CPXA 3CJSA 1N5YB 4N7TA 1FE0A 1SQGA 2QMUB 4W98A 3BR9A 1N5YA 4L3KA 2GFFA 2VPZB 3D6TB 1PAUB 2MJNA 3HHLC 5HLFA 4RX6A 5KG4A 2Z2MA 2UU9F 4FBTA 1DTQA 2H5JB 3V81B 1SUQA 4TN2A 5CH7B 3SMZA 4CLLA 1ZA1B 2G0IA 5D6GA 4XPCA 4KY3A 4USMA 5HJXA 4N56A 3WQPA 4G1QA 4JOUA 1WG4A 4NZ6A 5HROA 3DKDA 3G87A 4FF4A 2YXLA 3A3NB 1G1XA 2W7AA 4A47A 5B0GA 4ZHRA 2UUAF 1M5KC 1CJKA 1LK7A 3W5XA 2RE1A 1U45A 3PYDA 2VJUA 1Q5YA 2F9JA 2V8DA 4OZ2A 2FLLA 3QJPA 3AJ2A 3I96A 4DPWA 1H2TZ 2GO9A 1GXLA 4M5JA 2D9OA 4NZ0A 4K2JA 4JP8A 2UXBJ 1IR0A 1VISA 3C14A 2NSBA 2J7KA 5DGBA 2HZVA 3OJUA 1K0TA 2J9DE 2HGLA 2C2ZB 1O5JA 2OPQB 4ZPWR 1S99A 5IFMA 1SJFA 3SXLA 1GNKA 1HHTP 1VQSA 4CO1A 3CJKA 2VHGA 5HVGA 3C8YA 1URRA 1T8EA 4DSIA 3GIRA 5LM7E 2QL7B 5HSPA 2NXCA 2BM0A 1IBMJ 2GMHA 3TEGA 3MMAB 3L95X 3RB3A 3QZ7A 4LF6J 1FX4A 2XNRA 5KG7A 3EVOA 4QYZK 5KT2A 3SCLE 3CCVS 2UU9J 2AWZA 1HBNB 5AE2A 3M6VA 3FEXB 2DRBA 4WXWA 1Z1ZA 3TWZA 4JI3J 4B17A 3W2WB 4EEYA 3DI6A 5L8RC 3A8IA 2AJQA 4LF7F 1RWPB 1RTHA 1YQHA 2E1RA 1VR6A 2ZD1A 2V69A 1HWLA 1U6ZA 3CCTA 4RW9B 3TUZC 3C66A 1Y4ZB 2HAFA 1LFPA 2M7SA 2RRNA 1QAIA 1TV6A 2GVZA 2YBVA 4USHA 4XDCA 2OPRA 1GMVA 3BO3A 3UD3P 1VLYA 1RAIB 3KLHB 2DR9A 2W7OA 7AT1B 1VRQC 2ZH6A 3I55S 3OUYB 3M9OB 1FTCA 4DEZA 2FY1A 1U0SA 3H5YA 2RUGA 4J9VA 2BJ1A 3VAGA 2KVQE 2ADCA 2J8SA 1A9NB 4BC7A 3CMAS 1K9MT 1VQNS 1BWEA 2GS8A 1R89A 3TAMB 5KFZA 1RBOB 1U24A 3AD9C 2YKMA 3M8RA 5HI7A 3UCUP 2QA1A 3V4IA 3K8WA 4E0DA 4YS2A 1CJTB 3MR5A 2E66A 3UDVA 5T14A 1IWAA 3BSCA 3KJVB 2J76E 3GFZA 3QWUA 4RPFA 4AFFA 3K5MA 4RUBA 1NKBA 3OTBA 3RR7A 2G4BA 3M8WA 3BN4A 3L4BC 4LRCA 2HHVA 2WVCA 1HNVA 2QA2A 2RAQA 3BPDA 3NS6A 4JV2A 3FBBA 1U7LA 1IKVB 1BQXA 2B4UA 5C42A 2N82B 4X64F 1NJZA 3TVKA 4JV1A 1XEZA 2D3ZA 5F8JA 2HNDA 3CJ3A 3IR6B 5BR8J 1RTDB 2BA9A 3HPOA 1OQ3A 4KR0B 1YRTA 1TMMA 4MKBA 1EETA 1S9EB 1VHFA 1WEYA 5DS7A 3GFHA 4R5PB 4TU7A 3CMES 4LMZA 2E9TA 3MAAB 4OV1A 1JJ2R 3ZZ0A 5LSOA 4A4JA 1TFWA 2HGNA 4OI4A 4PPZA 1M90T 1OJ4A 1IQTA 2VKZG 2RQCA 4KPYA 1KC8T 2JEIA 3JTNA 3NS7B 4L73A 2IA0A 2QLBB 3HSGA 2VQEJ 3QSYB 4X65F 1OPIA 1B64A 4ZVHA 2RF2A 1PKUA 3R8YA 1QE1B 1RU2A 5KFFA 4JI7J 3LUYA 3PEHA 3GV5B 5IQQA 1BHNA 2YNGA 4BBYA 1N33J 2FTRA 2F40A 1RWNB 2E5HA 4ZP9A 2LFVA 2W2OP 2HFVA 3C6UB 3JB9k 4LF9J 2R7VA 1DZ5A 2KI2A 4DHVA 1KOHA 2DO4A 4Y0FA 4WYLA 2NSCA 1WI6A 1X5SA 3BV8A 3M8QA 4ED4A 2WCXA 4CM0A 4DU7A 2EC0A 3AA8A 2R7QA 2V6AA 5B09A 4DV6F 1XJWB 4I6WA 4OJ1A 2L9DA 1NHUA 4YB7A 1NHVA 4DV1J 1C1BB 3HHEA 1FKPA 1Q5VA 5ETSA 2V94A 1MG7A 1S9GB 2IJNA 1IR2A 4DZDA 3MR6A 3VAFA 1P8GA 1R8CA 4DR3F 3CULA 4C11B 2DHAA 4Y00A 2BE2A 3EXYA 5KOXA 1QDUB 4A8FA 4JI4F 4LR7A 1S1XA 3DYAA 3QNWB 4KV8A 1DARA 2UUTA 2ZOFA 2XEXA 4HEA9 2HVDA 4KHPJ 2HS0A 2Q79A 1QLNA 2OTJS 1VQ6S 2HAIA 3HJFA 4CIOA 3I4HX 4JI2F 4WXOA 4ZCIA 4OZLA 4JI1F 4X4OA 3DDKA 3D1QA 5KFPA 2IRUA 4Q8EA 5KFSA 4LIWA 5GADI 4PWDB 1JLEA 4PQAA 3UE2A 4M5KA 4CLZA 5EWEA 2MZRA 2B51A 3DLBA 4FYDA 1RT4B 1NUEA 3CPWR 1RAAB 1S72S 1B0TA 2DGUA 4B08A 3LW5C 4ED5A 3SIPB 1PIEA 1N32J 4PXBA 4DL4A 4F4ZA 5JMNA 3R5AA 4DQQA 1XNQF 3J80Y 5A8KA 4MFBA 5C2CA 4RW6B 4F0MA 1KHWA 1TMJA 3AJDA 1BXNA 1GX6A 1WC5A 2BRLA 3EJMA 4ZITA 3DMJB 2DH8A 3ZTQA 4OHYA 3OL6A 2Y8YA 1JXVA 4MK7A 1ZETA 1HNZJ 2VG6A 1XWLA 3PFEA 1YTYA 1LWXA 2PMZD 4D3HA 3M8SA 4IRDA 1S0MA 1LKZA 1U1MA 3PJWA 1O51A 1KFDA 4Y6IA 2BKNA 2BQ3A 3TNVA 2AQ4A 1CVJA 1K1SA 2JJ4D 4ZOSA 4O3RA 3P45B 4RBVA 3LP0A 1RCOB 4DR1J 4UOFA 4Q2LA 4J9KA 1IKYB 3GCXP 2QGFB 3W5YA 1YKWA 1UCNA 2WB4A 4A8XA 2HWIA 2YPYA 3QT6A 3SFUA 2W8KA 2J0QD 1QY7A 1F60B 4A8WA 4L3NA 3NBPB 3R5CA 4LRDA 1UTAA 2CDQA 4OIXA 3FQKA 3CCMS 3R2DJ 4B9MA 1WC1A 3BZQA 1B4SA 2CQ4A 2B6AB 4KH0B 2C2RA 2OP5A 4YY3J 3IGVA 3SDEA 2YNHA 4NA3A 2Q6BA 3KK3A 3GE9A 3SQGA 1QTNB 3EXCX 5MAOA 1EP4B 4CI0B 3PKYA 3K58A 2BBEA 4OZNA 1HBMA 4Q8FA 5C5JA 3PJ9A 1S1TA 3KNGA 1TAQA 1ZM9A 3ETMA 4OJHA 1P27B 1Z2ZA 5DZ7A 3W66A 3EX7B 2ZOGA 1OSDA 1N36F 4IR9A 4RKUC 1JLCA 3V2UC 3NXZA 3PM9A 4U6PA 3IR7B 3V6KA 2IM0A 2OD6A 3A13A 4P71A 3PW4A 5H9EK 3AOAA 2ZDOA 3EGNA 4DPTA 1SXLA 3ILLA 2OEJA 1FRJA 4X62F 4FDFA 5HL7Q 2OHDA 2XSJA 3MM9A 3M9NB 4CTAB 2DXFA 5GMEA 2C2EA 1H7XA 2HQFA 2XMWA 3AB4B 4FKXA 1AZSA 4ICLA 4M5MA 4NEZA 4C8NA 5IT4A 3OR2B 4UT4A 4JI1J 4TNOA 2F8MA 4F26A 2VFUA 2YKNA 3PR4A 1YI2S 2JZ5A 1F3FA 1X5PA 3OD2A 1T05B 2J9CA 2BV3A 3DOLB 4P74A 3RB0A 2FVSA 3L09A 4DQPA 4JV5F 4X4RA 1C0TA 4ED8A 3MPDA 4Y2CA 1S10A 2HMIA 4B3OB 3RGIA 1VCTA 2V8GA 3QSIA 4USTA 3VGTA 3DHXA 4NCBA 4YR2A 1L3KA 1BGXT 2Z58B 3LP1A 2XY7A 1HBUB 5E5NA 2MTLA 3ETOA 4KAIA 2MZ1A 4FS2A 3L7PA 3MHYA 4DOZA 7FDRA 1M5OC 3DRRB 4YHHJ 2BJ3A 5AE3A 5IOLA 3ILIA 2HG4A 3IAS9 3MM8A 5J2PA 1TK0A 1V3SA 4AL7A 2A18A 1ZA2B 3V6DA 3UR3C 4DG1A 3FC9A 2R3VA 2CPEA 3PG9A 3I5AA 4ECXA 2ZUAA 4Q44A 2HBZB 1VQLS 2EFNA 4DR1F 3QAEA 1YGYA 2RMLA 3WHIA 2O1PA 3B78A 5B0FA 1D8YA 3DLLQ 3NRBA 2RDDA 3GPAA 2WOMB 4EBDA 5MLCV 1KP6A 1Q78A 3PACA 4MYUA 4OLOA 2NREA 1MMDA 1XK8A 4KPCA 4ZPTR 3D2WA 2MKHA 2IAJB 3ISND 1X8DA 1VS3A 5L9NA 2BABA 4ED3A 1T11A 5KFUA 4I0WA 4ZVSB 2EBEA 2OKQA 4ZJOA 2QLXA 2WZ1A 3GMGA 4E8UA 4WFAQ 2JEGA 3K0JA 3I5BA 3K8VA 3QLHA 3UCZP 4P2SA 4QIVA 4U8VA 5GADU 4ECUA 3OL9A 2HHWA 3CJ8A 4EO6A 3PIPQ 4KB7A 3RR8A 1S6PB 3QGIA 4Q7AA 3ZXWA 3ILOA 2LU2A 2OI2A 1L3SA 4PPDA 4JI5F 1J5OA 3OVBA 3M05A 2FGCA 2ZHBA 1NO8A 3DOKB 4HH1A 3DLJA 3HT0A 3UO0A 1R0BG 1R7IA 3AXKA 3D28A 4M5HA 3G6VA 2VQFF 2DD8S 4UOCA 2X1BA 4DMZA 3C6TB 3G9CA 2KVIA 1B7YB 3GJTB 1V9OA 4P2MA 1SJ4P 1YJRA 5KFOA 1NZ8A 2LDIA 2XWYA 5LJ3Y 2AF6A 3MECB 5FDLB 1RYRA 3MEGA 2H4WB 3AY0A 3O44A 1NZAA 2EI5A 4NLYA 4F4AA 5JJBA 2FJWA 1YJTA 3BF4A 1EAYC 5DM6Q 3O2IA 3CO0P 3C15B 7FD1A 1X5OA 3FKBA 2CFXA 2O5DA 1UW9A 3JYTB 1N4LA 3I6PA 4ZPAA 5EGYA 2DCUB 1FRLA 1SC6A 1NPKA 4C48A 1T03B 3CVKA 3K5OA 1OMSA 4LVOP 3PRBA 4IH7A 4I6YA 3RJMB 3BBFA 2H65B 1ZH5A 3TANA 1SQEA 2NR0A 4S0MA 5D4OA 1TL1B 4CNYA 3H98A 2EKYA 4CQ1A 2XNQA 3W2VA 3DLEB 2HQIA 4CLSA 3KK1B 3ISNC 5ETLA 3G6ES 2I2YA 2BYCA 2KM8C 1HI1A 3BKTA 5AXMA 4IFVA 3B4DA 4WYWA 3NMAA 1WTFA 1KSPA 1N54B 3PVXA 2BJ8A 4ZVOB 2PMWA 3QIPB 5I42B 2DRDA 2VOPA 1BQNB 3I4PA 1EJ7L 5K5MA 3WIVA 3WX8A 4AT1B 5LSLA 1SH0A 3KFWX 4ZA1A 4X4SA 4J90A 3U27A 2XMAA 1OY8A 2D69A 3DRXA 4CNZA 3I32A 2KG0A 3NGUA 5EX0A 5HMWA 3PZPA 2W8LA 3IFEA 4F36A 1FTRA 3DRSA 4OMFG 2UZAA 2VD3A 4DSEA 1IXKA 5T7LA 2DHGA 3UWTA 1TKXA 3J81j 1U6BA 4YDXA 2ILYA 4H4MA 5E7OB 3B6BA 4TU8A 5M2UA 1WOOA 1QD1A 3D9BA 1FKOB 3GYGA 4IG0B 1N5QA 1DTTB 1I1GA 1UWAA 4CM2A 2R2RA 2H9ZA 3ENQA 3HZGA 4U67Q 1FNXH 4ITSA 2DGWA 2YPZA 3CJRA 3TOQA 2UVUA 5A2QY 2GJ2A 2POKA 1NK8A 1GTHA 1IBLF 4C8OA 1N5SA 2W9CB 4X4TA 4CLTA 2HZCA 3CJ4A 2MKCA 6FDRA 2QT7A 1V3ZA 3OL8A 1UETA 4I2QB 4G6VB 4DSFA 3UNYA 2QLWA 1NK7A 3BN7A 4MMOA 2JDJA 1SQFA 4LF1A 4WBFA 5F8HA 3K5PA 5L1IA 3R7BB 2KM8B 3CDBA 3G8TA 3N4WA 3T5LA 1VQ8S 2DNYA 2IPOB 3D0HE 3LPYA 3OFFA 4K4YA 1S57A 2JL9A 2VB6A 5D3GB 2HIYA 1IQZA 4KHPF 5CD4A 1S0OA 3HDSA 2W2PP 3Q8YA 2HWHA 5KFRA 2Z0GA 4CT8A 5J2NA 4HI1A 4FVMA 4ANEA 3EDQB 1SKUB 3G82B 3RYLA 4P9SA 3IBCB 1KHVA 2P9CA 1HBOB 2CQCA 5L1LA 4DWIA 1X4FA 1T9TA 2XYPB 3LH2S 1HR0F 3MCMA 4ILLA 3JTOA 5FLXU 4KFBB 1AB8A 2ZC4A 1W26A 2JFDA 1LW2B 2GC8A 2MLZA 1VJQA 2ATCB 3LOUA 5E3QA 5ETTA 3EZOA 1KQFB 4CZCA 2R7UA 4H4OB 3PW2A 1WG1A 1HD0A 3IO1A 1KN6A 4I2PB 4ES1A 3FFIB 1F6TA 4NYOA 2FHMA 4DCOB 3RAXA 3DOMA 2K3KA 4R0EA 5CYMA 4DV7F 2DNKA 4IRCA 2CWKA 2WB1D 3FK4A 2FLPA 4P10A 2JEFA 2M4MA 1LXJA 4I4BA 4K4TA 5D0RA 5KFQA 3R5JB 2CJXB 4ECYA 1IKXA 4EZ9A 5A8WA 4P2XA 3VAKA 2V4RA 1RLDA 1HPZB 4PXEA 3D4JA 3FRZA 1HR0J 1P9QC 2UUAJ 2L9WA 1PG5B 1D09B 5K9FA 1B0PA 2L9NA 2O67A 3FCVA 5H1SV 2GZOA 2VKRA 4USIA 3RBEA 4PYDA 3PY8A 2V9WA 1Q4RA 3LA0A 3LPEA 2C3MA 3NCPA 2XMMA 4LF4F 5L9XA 5FD1A 4I7FB 6AT1B 1N5VA 3UDLA 1S79A 2Y0BB 1WELA 5LOQA 1RT5A 1VRTA 3BS9A 3HVTB 3ZZTA 3MR3A 3E3XA 5DJBA 4EYHB 1AUDA 3RW6A 4DUZF 1FWLA 1RWOB 1UW4A 2BOAA 2FJEB 2N4DA 3DM2A 3NS5A 3DLKB 3NWGA 4OYXA 4WIQA 1FDDA 1UMJA 1ZZFA 2DHSA 2ZBRA 1U26A 3S8SA 3V6HA 1JK9B 4IDKB 4DCJB 1KFSA 3IRWP 1Q0NA 1I94F 4J9NA 2ERRA 2NUUG 4OX8A 4NRUA 4ID5B 1PO6A 1DQ8A 2XLIA 4J91A 2CNOB 2QMWA 3IWLA 4QPXA 1Z4UA 2BJDA 3KG1A 1YDLA 4LT6A 3FVYA 4O44B 3L7UA 2EK6A 3ZZZA 2YTCA 3RAMA 1LQ9A 5KOWA 4HYKA 1NJWA 4UY8T 2Z2ZA 4OFZA 1YX2A 4WE1B 4F0HA 2XBPA 5L1JA 1S97A 4WZMA 3P96A 2D41A 2HQ3A 5J2QB 2ZVIA 1O8BA 3B8HA 4DL2A 4B9TA 3TZXA 2ZKUA 1CC8A 4JUZA 4M63A 4WTYA 2K8GA 3W9HA 1REVA 2E5IA 2QE5A 3P5BP 1HI8A 1TTHB 5DDRC 2XCAA 4YP3A 2VG5A 1UVMA 1WKLA 2G0JA 3VTIA 3VR1A 4EFAC 2RDJA 1O0PA 4DV3J 3PX0A 2MJUA 2ZJPQ 3VGUA 3BH7B 3L3CA 3H5SA 5AJ3J 2RJZA 5EUHA 1KVJA 2CJKA 2XSFA 2DITA 3BGUA 5HQLA 2ZE2B 2EKNA 2ZEJA 2FVPA 1FHTA 4A46A 2F4VJ 2J5AA 1UL3A 2IC3A 4DV2J 2ZM6F 4QWBA 1YJVA 4Q43A 2IJRA 2VJVA 3UD5A 2J9DA 3T9ZA 4EI2A 3BDEA 4F04B 2KFYA 3IRXB 1VQMS 2CUYA 2IVYA 1P1LA 3IAM9 4BS2A 5CABA 2OO4A 1UVLA 1S59A 2H3EB 5B0DA 5A6PA 1UPPA 2D1CA 5BYQA 3HKZD 4IO1A 4DR7F 5HANA 1FK9B 1PJ7A 2DNNA 2BKOA 1NPPA 2CA9A 2VPYB 3JS9A 5EWGA 1QVGR 2YKPA 3D0IE 3AXMA 3SI8A 3BB5A 4FF1A 1C4AA 4NZ7A 4KSEB 1TKTA 1U2FA 2FYXA 5LSRA 3KUGA 1X5TA 4BWJA 2GA7A 1GFWB 2L41A 1S0NA 1U1QA 4PR6A 2DCLA 3C3LA 3O5TB 5L46A 5KFKA 4DPXA 3TZZA 4RWXA 8AT1B 1FD8A 4XIUA 2D3OR 2BDPA 2OSRA 2EVZA 4ZLNA 1AXQA 3MM5A 2J6UA 1S6QB 3JQKA 1RT7B 3Q8RB 3N79A 4KO0B 4R8UB 4K4WA 1APSA 1UJ4A 3M32B 3C16A 2ZVSA 3MEEA 2ROPA 2LKZA 3QATA 4NA2A 4PAAA 5D78A 4DR5J 5C24B 3NG8A 2JVOA 1OSCA 3UVJB 2VFRA 4NOHA 3SFGA 1NMEB 2M8DB 4PQUB 4FF3A 1JNZB 1HW8A 4XDDA 5HATA 2OJ3A 1RBLA 2K1RB 2U1AA 4RW7B 4ETZA 2AGOA 2OPSA 2IMWP 4QU7A 1RT1B 2PFFB 4QWDA 2APOA 2LCWA 4B9VA 1MMNA 1UWBB 2M52A 4J9LA 1YJNS 3NOGA 2HQGA 1R0CB 5J1EB 4IOAQ 1WF1A 4ECQA 4HI2A 4LF5J 3HK2A 1RACB 3WIUA 3CJQA 3ULHA 3KMSA 1SIZA 1SPBP 4OQJA 5KG5A 1U0HA 2HNYB 2VV5A 3G8QA 1VQ5S 2HHHF 4ELUA 1RAHB 2OPPA 3GCWP 4ES3A 2EK1A 2DGSA 4NMXA 4ECWA 4IR1A 2B4OA 2XZDB 2RDIA 4RL1A 2HURA 3SSRA 3UCGA 1VC0A 4NL5A 1HNWJ 1MROA 1N88A 3M6XA 4LF2A 2CQIA 4NCGA 5E3PA 4ID8A 3HMJG 3E01B 1RJJA 3PNIA 1FXDA 2LECA 1IM4A 3IG1A 3I0SB 2DJWA 4CYUB 2QO3A 1HKAA 3QQCD 3G8SA 4TU9A 3H25A 2ASJA 3EDRB 1VC6A 1OYDA 2EC2A 4QW8A 3OVSA 4J9QA 4PYAA 4GRSA 2GQ2A 4LF5F 4B9SA 3HHLA 2PEBA 3PCOB 4WWSA 2RS2A 3QJLA 5B08A 3GZ7A 1FXLA 4YR3A 1Y5IB 3D66A 1EB0A 4M5LA 2A6OA 3IA0A 1Q81T 2DIUA 2KFNA 1ZM3A 2AMCB 5F8NA 1WI8A 2C2KB 3GG0A 4YMEA 5CYQB 3KLIA 3OXLA 1IBLJ 4N5SA 3C2PA 4O4GB 1S76D 2CJYB 4WFZA 3W8GA 4DPYA 1W2BR 3PV8A 1F2HA 1I6JA 3CCSS 1S12A 2RQMA 3AT1B 3CSKA 5RUBA 4EYIB 4C0HA 1FJCA 3BGRB 1R0AA 2QSFA 2RIJA 1NK9A 2WW4A 3LF0A 4V19X 1SJQA 1HQUA 2V34A 3ZTRA 3AB2B 3QJJA 3RB4A 2HHQA 1M1HA 1S6OA 2R7SA 5HP1B 2XMUA 2AZ3A 4ANDA 2UXCJ 2BE9B 3LWLA 3ZC4A 3A3OB 4EBCA 1S4EA 2CJ9A 1R31A 2CVEA 2MPUA 1N6QA 1Y3KA 1UAWA 1SJ1A 2I5JA 2KYZA 4P73A 4QJVA 4Y3CA 2ZJQQ 1VYAA 1MU2A 4DUTA 4DUYF 4IH6A 2CYYA 3MMCA 3GIMA 5AXLA 4EU0A 1Q16B 3H2VE 2QN6B 3FRYA 3D3CJ 4NEYA 3OLAA 3KOAA 4MK8A 2X1AA 3T5JA 4NLRA 1F9EB 4DX7A 4ED7A 2XYHB 4B3RJ 3T6BA 1JKHA 5F3ZA 3KTQA 1SJRA 5DDQC 2DIVA 1HMVB 2VG7B 3FUYA 1R43A 4NA1A 1HNIA 1R6YA 4K4SA 2ZZMA 5THWA 5DDPC 3DRPB 5DQIA 2WVDA 1Q95G 2W2NP 3Q0AA 1S48A 3IGNA 4GKKJ 2YQ1A 4LBHA 5LMNJ 2F63A 1OY9A 2YNFA 4ILMA 3MUVP 5E33A 4X62J 4ZPBA 1FJEB 2FQQB 3D67A 4MIWA 1SC3B 2DO0A 3FSYA 3BO2A 3CIMA 2AJ1A 1D9DA 2QRRA 4DR2J 4EZ6A 1VK3A 3T19A 3W1YC 3ZTSA 4B3MF 2UVVA 1KVIA 4QZVB 3QBCA 2NYIA 4KGZB 3US5A 2B5JA 1UVNA 4O3PA 4RUAA 3KLEA 1XR7A 2P8IA 1DLOA 2UXDF 1U09A 3HHKA 4ZN1A 1CULA 2XZWA 4HR2A 5B0CA 1FE4A 2EFQA 2F7VA 3JSMA 1EQMA 2DISA 4H4KC 1CC7A 1TL3B 5IZHA 4DFKA 3MXHP 4JV5J 4QIGA 4ECRA 2XMVA 2W9BA 3OR1A 4C3LA 3S7RA 3MMBA 2HW3A 1JLAA 2B56A 2FJVA 2VDIA 1QJHA 4P7TA 2CJBA 4I1TA 2FJAB 3OHAA 2CQDA 4K4VA 3N9UC 2KJVA 3GR1A 2KKHA 3DXSX 3NCQA 4M8LA 4LF9F 2KH9A 3SSSA 2G0CA 4ER8A 1P6TA 1SH2A 2A2CA 1RAEB 4DU8A 4IG3A 3J7A1 1BQMA 1YZ7A 5D0EA 1DFDA 1RP5A 4RU2A 2IDLA 2Q6CA 4HH0A 2ZHOA 2V63A 2HFSA 3IWXA 4GVBB 4LFCJ 1VRUB 1X4AA 2B7CB 1LWFB 4ES2A 1KKHA 3RUBL 2BX6A 2WONA 1NJXA 2WAQD 1AW0A 2B43A 2GQCA 4AXJA 2JC0A 1JLFA 3D0GE 1RT3B 4F0KA 5A0YA 4Q0BA 1WC4A 4KHMA 2J0WA 3RZAA 3H42A 5KFVA 5KG0A 2DH9A 2ZM6J 2AEJA 1N0UA 3BKFA 2EFPA 3GYNA 3JAMU 2ZH1A 1SKRA 3PEJA 5CHCB 2Y1IA 2EW9A 1FI4A 3OQ2A 4A8YA 2LA4A 3AQOA 3LP2A 3M8PB 4DUZJ 2R8KA 4NI2A 2E1MC 1OO0B 2HHSA 3GYXB 1X9SA 3SCIE 3AQPA 1IJFB 2FHJA 4ENOA 3ISZA 2KFZA 2LLZA 4ILRA 3ILJA 1FNMA 5IXUA 3Q8UA 3GIJA 3GV7B 4JI5J 3QMQA 4QWCA 1T9XA 1VQYA 1RT2A 3BM7A 4EWTA 5HO4A 1GX5A 1F2GA 1JLQB 2H1YA 4U7CA 2Y1RI 2E5LJ 3MMJA 1X4EA 2XTJP 1KEKA 4ECVA 3I87A 3M2VB 3R5BA 4M5DB 1LWEB 5KFXA 2CXEA 3DU5A 4CO4A 2F8EX 1E6YA 2WBRA 5HBMB 3SV4A 3THVA 4IFYA 4RW4A 1JIHA 2M3DA 4LQ9A 2RKIA 2Y9HA 1D0EA 1IKWA 8RUCA 4N41A 2HNZA 3GJQB 2GHPA 4ZP7A 2ZZNA 4NLVA 4FXVA 3ITHA 5GMDA 3AD7C 2QG9B 1X0FA 1VBZA 3QRRA 4F2RA 3T1HF 2VFTA 1ZZNA 2EXUA 1VBXA 2E1AA 4DSLA 3LGHA 5ETOA 3C19A 4FYYB 1RISA 3MPUB 4C97A 1UFKA 3KLGB 2WW8A 4L76A 4DL7A 1OPZA 1G3OA 5IT9U 3G2XA 1F5BA 4QIFA 5FLXY 3PXGa 3L9ZA 1DURA 3QYYA 3W5ZA 2GVDB 3J81U 3THPA 3EZ5A 1S1VA 3HD2A 5G0RB 1S9FA 4HVZA 1SB6A 1TUGB 3HCXA 4B9NA 3HD1A 3MPYA 4FYXB 1EKRA 4HTJA 2QV6A 1W7WA 1MWQA 2E7VA 4OYWA 4CH1A 4PCQA 2ZH3A 2BR0A 3M2UB 1HQEA 2B4PA 1LWCA 1TL7B 5JXSA 3BSOA 5DM7Q 2MGZA 3PO5A 2YNIA 1G6BA 1CJUB 2GGPA 4USUA 1KLMA 1VOMA 3I5CA 5C25B 5HMZA 2WBMA 2KT3A 3MGJA 4USJC 1NDCA
chains in the Genus database with same CATH topology
1LK5A 4WK1A 3KMQA 3DLGA 3TO8A 1OIAA 2CQ2A 5JVGQ 1ZM2A 2W4PA 2J0SD 3QO9B 2LMIA 2UUWA 4DDFA 4K2XA 4YDDB 2ZHAA 4WF9Q 1T3OA 2FHJD 3VZHA 3TARA 1N0VC 3OSNA 3M30B 3U02A 4QYRA 1U47A 3P3DA 2J0XA 1FERA 2M8HA 2MZQA 3N5BA 2WK4A 1KQKA 4G3IA 3T1AA 3PRDA 4AQYF 2CG4A 5L39A 4PRFA 4RNMA 2CVIA 2LA6A 2EWHA 3CDAA 3OV7A 4C8LA 2K7KA 2VPXB 5GAHU 1L3UA 2D9PA 3V6JA 5CZVA 2K3IA 4J9SA 4AYBD 5K14B 3B82A 5IT9Y 4IUFA 2J6TA 4KHRA 1GXTA 3MEDB 1UA1A 2HVHA 4ZVFA 3MFHA 1XBWA 2HPUA 4PKDB 1RTIA 4RBUA 3MTJA 4K50A 1RA6A 3PKMA 4FS1A 1D1UA 3M6UA 1RT6B 1TKZB 2XI2A 3FMWA 3KHLA 5H9EJ 5K8NA 1FCAA 2LEAA 3AJ1A 1HW9A 3ONQA 4Q2MA 4PUOA 1T94A 4R25A 4LFBF 5ADZA 2G13A 4YHHF 4H4KA 2DBBA 1C0UB 3CCWA 4LSLB 5F8LA 2OFHX 2N7CA 4G1PA 4KC5A 4YUDA 1GH8A 4QPTA 3I82A 1M5VC 2SXLA 1A7GE 2ZFHA 1FDNA 1NK5A 5HMXA 4X66F 5KFTA 4RNFA 4FF2A 3CC7S 1AFIA 1SV5A 5BR8F 2KXNB 4CT9A 2IYGA 3N6LA 4YB1P 1JLBA 1URNA 1X0PA 3SSQA 1X7VA 3PO4A 3PHEA 5A6WA 2UXBF 1HYSA 1IJEB 2QIFA 4RW8A 1A6LA 1AFJA 4DQSA 1FEEA 1N33F 1RYSA 2FVQA 3MI7X 4LUBA 3MM7A 3MUTP 1F9FA 3M1VA 1YJWS 3TW0A 3HP6A 5A8RA 3IR5B 3C46A 2DGVA 1RTJA 1QUPA 2R7OA 1V6HA 4AE5A 1JXLA 4F2SA 1JLGA 2UVWA 4LSNA 2BANA 5KG3A 2UP1A 1U25A 1NEEA 2JSXA 3KK2A 4G1IA 4IOCQ 1U6FA 2D74B 3GG1A 4KKOB 4JV0A 3PW0A 1C1CA 2OLWA 3GIIA 5J2MA 4NX9A 2HS3A 4WZQA 1Q79A 2HLUA 3ZZRA 2YKQA 4NLDA 5CCMA 2RH3A 1UVJA 3I0RA 4O23A 4J5OA 3K57A 2RQ4A 3I9ZA 1FRXA 4EUVA 2HRYA 2KN4A 2XS2A 2V4JB 3POTA 1SKWA 1JJ4A 2VA3A 2JX2A 3G6XA 1HWIA 1TVRB 2RNEA 5I3UA 1FJ7A 4P7VA 3PFOA 3KHHA 1HWUA 2DH7A 3BQ1A 2VBYA 3KKFA 3MAHA 3VQTA 2RRBA 4ZCKA 1E6VA 5CA5A 3KLFA 2A10A 5IM0A 1NH8A 2V0NA 4Y2MA 4I56A 2AV5A 1TL5A 2G1DA 4TY8B 1YG0A 4DFMA 2DT9A 3ENWA 5DETA 3DFEA 3OLBA 2MQQA 3FEZA 2RQKA 2J9EA 3EYZA 1S1WB 3MZIA 5M2PA 2FB0A 1VQOS 1S1UA 2E7WA 3MM6A 3M2RA 3DGPA 3KHGA 2CQBA 1UEVA 3TA0A 2I1RA 3T6JA 2YWGA 4ZP6A 4ED6A 2PO4A 1LW0B 2BVZA 3IS9A 4GO5X 2B0GA 1WF2A 5F0WA 2WSCC 5DG9A 2CQGA 3CIZA 2KG1A 2ADBA 4O3OA 4WFXA 2FVPA 3MOZA 1QVFR 4ECSA 2GQQA 4GO7X 5KFCA 3HM9A 1VQ9S 5GAGI 2HWTA 3ZZOA 3O8WA 3O3LA 4M1KA 1LW0A 3IS9B 3LAMA 4TQSA 2R8JA 4MAKA 4RNHA 3Q23A 3M2RB 3MM6B 1S1UB 2KRRA 1NKCA 3W3SA 3IC1A 3P5TL 1XMQF 1S1WA 2ZH9A 2BJEA 4YEAA 4TXSA 2UV8A 1VQ4S 4W92B 2RILA 4NLQA 2AP6A 2MKIA 1VJWA 1SL2A 2YKAA 2CKWA 2M5YA 2EFGA 3K7RA 4AL6A 1Q82T 3BO4A 2MKJA 4ZCMA 4TY8A 4UY85 4WK3A 4DV3F 4DV5F 1S77D 1PC5A 2B9XA 5IM0B 1E6VB 3F56A 3KLFB 5KG1A 1LV5A 2D3UA 1WTBA 3N28A 3CJ0A 4J37A 3TA1A 1FKAF 3NAIA 3D1HA 2MQOA 5GAEU 5I3UB 1TVRA 1IN0A 3CWJA 1TK5A 4MJKA 3D5MA 1S0VA 1VQKS 2AYGA 1KD1T 3HKWA 2V4JA 3POTB 4FNHA 3HVRA 4DR5F 3TQ1A 4I68A 4FNIA 3I0RB 4DS4A 5L38A 2IM3A 3OXFA 1U1KA 3VF0B 4JI0F 2CPIA 3JTPA 1WHWA 1X4DA 1HI0P 4DR4F 3GSDA 1X4BA 5J2MB 1FDAA 1C1CB 2YY3A 1LFWA 2R4FA 4KKOA 3OHBA 2BRKA 3M4XA 4NLUA 3KK2B 2F9DA 3RRHA 3QPIA 2HYIB 2RS8A 4ZPVR 4WFNQ 1FA0A 5KG6A 2BANB 4LSNB 1TP7A 2XMKA 1JLGB 5KFEA 4B9LA 2NS1B 1SJ3P 1RTJB 2IM1A 2BACA 5B0EA 5A8RB 5DG8A 1WHYA 2HS4A 1HWKA 3M1VB 3BQ2A 3MM7B 3IBWA 2V2KA 3JSYA 2KO1A 2BQRA 1TKDA 1UP1A 3H4BA 4RW8B 1VGYA 2XLKA 2MQLA 1N34F 1HYSB 3SYZA 3OSPA 1T02A 1JB0C 1JLBB 3A1YG 3NNHA 3DRYA 1QSYA 2VFSA 2FLOA 2LQ9A 2PN6A 2U2FA 1SV5B 1X9WA 2MHEA 4X4QA 3O1LA 4J9RA 1XTZA 4WKYA 4OZ0A 2ACYA 4LSLA 1C0UA 1YBAA 1WEXA 5B0AA 3TP2A 4M94A 4FBUA 3F73A 2DNOA 1L3TA 4PUOB 2MYFA 2XC9A 3GILA 3FSXA 4HT7A 1TKZA 1RT6A 3CCLS 3JAMY 1H2VZ 5AE1A 4NLWA 4URQU 3HT3A 3T1YF 5J1PA 3RTVA 1TK8A 1RTIB 3HI9A 4Y2AA 1W2IA 4JI8F 2FUG9 1K1QA 4PG6A 2JOQA 3MEDA 2XWXA 3UD4P 3U1NA 5GAEI 4ETXA 2R2TA 5K14A 2IBKA 2HFOA 2CZ4A 2DNMA 3QGHA 3DNCA 2CQ1A 2JLFA 3FJ2A 4ZVEA 4EO8A 2XO7A 1FO1A 2K7JA 4OJ3A 3N6MA 4YFUA 1PGZA 1U48A 4KE5A 4MH8A 4U9RA 3SCJE 1SBRA 1Y5LB 5SZTA 3LGNA 4BCAA 3HFKA 1UVIA 1Q1KA 4FZVA 4DL0C 3KLVA 5H9FJ 2RD5C 3M30A 1ZYQA 2J8AA 2OIHA 4F3MA 1L5UA 1DAXA 3IWNC 3P49B 2A2DA 1TL4A 3QO9A 3UNGC 4A48A 4UUXA 1NJYA 2C3OA 1X4HA 3DLGB 2KB2A 1ZM4A 2FJBB 2W24A 3NKYA 2ZBIA 5J2QA 5LXYA 1SH3A 1KTQA 5CQGA 4CO2A 5C25A 1YITS 2IA6A 1KLMB 2VUGA 2GGPB 5EHHA 1GXUA 1ZAXA 1R8HA 2YNIB 2MGZB 3HHLD 5KT3A 1LWCB 1HQEB 2E7XA 2ILZA 3M2UA 4KBIA 3GQCA 2GMLA 1Y9OA 2VBWA 1QUVA 1HWJA 3N01A 1Q8IA 5F41A 2R7TA 3D54A 1M0SA 1Y0HA 4DQRA 1VQ7S 2FD2A 5G0RA 4NCAA 3BGFA 1S1VB 1W25A 2IYIA 3MPWA 1RGVA 3QGGA 2JRSA 2HHTA 4DF4A 3KLGA 3RRGA 3G4SS 3K5NA 2PD1A 5F0UA 3I9V9 5EN1A 1QAYA 2FVCA 3OBIA 2AU0A 5LXRA 3ZZYA 2W4CA 4QR2A 4B02A 2KJWA 4GC7A 2HHPA 3ITHB 3Q8PB 1M5SA 1RWUA 1NH7A 2HNZB 1IKWB 2YWEA 2RKIB 3U1MA 4LF6F 5E2QA 2JWNA 2P9EA 1WG5A 4RW4B 4IFYB 1E6YB 1LWEA 4M5DA 5HBMA 1K0VA 2HGMA 3M2VA 4GKJF 2IM2A 2ASYA 5I3PA 3G96A 1H38A 1YWXA 3CE8A 5KFMA 1JLQA 1VMBA 2RT3A 3DXBA 3MCSA 1FXRA 3OW2R 2Y1JA 1RT2B 3R27A 4DS5A 5F8MA 5KFWA 2KYXA 3VCDA 3UR0A 2GHVC 4WJBA 2IHR1 1N8RT 5KFNA 2LQ5A 3GB0A 2B7BB 2P9GA 3TVZA 1HNZF 2C3PA 4QQBA 5E3CA 2FJXA 4MKYA 1QSSA 3M8PA 2LDYA 2XI3A 3LP2B 4ED0A 2FHKA 3JSBA 4NXMF 3VAIA 2M0GB 3O6QA 5EDWA 4W90B 1S4FA 2LXFA 4NLSA 1ZAWA 4IQMA 5A0YB 4YY3F 1RT3A 4Q0BB 1JLFB 4OHVA 4K0KF 3H8YA 4F3QA 1KQSR 2WONB 4OI6A 4U7UK 1LWFA 4QIWD 1RI7A 1ZPWX 4DX8H 1VRUA 5DQHA 2MQNA 2Z4PA 3QWPA 3K59A 5CXTA 4ZP8A 2EBGA 3CJ5A 4QIEA 2LVWA 1NU4A 3Q8QB 2R2UA 1C2PA 1BQMB 2Q66A 4IG3B 1D3WA 1QAXA 1D9FA 2VOOA 4F02A 2BZ2A 1K73T 3N5FA 2I0XA 1C4CA 2HRUA 3ZZUA 2YWFA 1JLAB 4DN9A 3MMBB 4PWUA 3EUNA 3OR1B 4RBTA 5HN0A 3OXGA 3Q8SB 2W9BB 3RAQA 1ZTTA 1H3DA 2ROEA 4F8RA 1TL3A 3KG0A 1GT8A 1WHVA 4ELTA 6FD1A 3JSMB 3Q2SC 4HTIA 1Q7YT 2E29A 1CLFA 4J9OA 1DLOB 3KLEB 2B5JB 2ASDA 2ZH4A 4NXNF 3FNNA 1S49A 1R8BA 1UFLA 5D77A 2GHWA 2A3JA 2CPHA 2X1FA 2ZUGA 5K8PA 2YNFB 4PXDA 1XN9A 4Z37A 4B3SF 2JEJA 2O01C 5KFDA 2VQEF 1OQ6A 3DRPA 3PR5B 4KT0C 1YRXA 1IBKF 1HNIB 1Y7PA 2HHUA 5FJ4A 3D1OA 4N8NA 4ELVA 2VG7A 1HMVA 3H2UB 3NNAA 2I38A 4FPRA 3NGDA 2MMYA 1JKHB 4QWEA 3HHNB 1RDRA 4KJIA 1R8AA 1ZAVA 3OPKA 3MMCB 1NK0A 2KTQA 5KFIA 4QOTA 2GCFA 1MU2B 2DNRA 2C42A 3QGPA 4FP9A 4J9MA 4DFPA 3RAXA 5DGAA 2I5JB 3PX4A 4OI3A 1N6QB 2KRBA 3FZBA 5KT7A 4DR6F 1RAJA 2XY6A 3MDFA 2AD9A 3OFHA 3H5XA 2PEHA 5HP1A 4CCHA 2F1FA 1DBDA 3MURP 4O3NA 3VAHA 1XR6A 2EG1A 3G86A 1HQUB 2VFVA 1F0XA 2DR5A 2L08A 1UKUA 2RRAA 1R3NA 1R0AB 3BGRA 2XGQA 1FJGF 4WCEQ 3KWMA 1HD1A 3CO9A 1Y00A 3PX6A 1TAUA 2EG2A 2O3DA 3W7BA 3OFGA 2ZNZA 2DGTA 4O4GA 2V5HG 3KLIB 5CYQA 2AX0A 2HLTA 4YB5A 1H98A 1QSLA 2M88A 1GQEA 3QAUA 4B3TF 4NWBA 3S01A 1YJ9S 4ZDNA 3AH6A 4Y34A 3T5HA 3S1TA 3R5DA 3HHLB 4XK8C 1X4GA 1XMOF 1U8SA 1YJUA 1YRUA 4HLBA 4BHQA 2IRXA 2CPDA 5CD4H 2F4VF 4PG4A 5GVQA 2HHVA 1SIWB 1TQLA 2AW0A 2HVZA 2MY8A 2VC0A 2V9KA 3I0SA 3IG1B 4IH5A 5E41A 1FT8A 3E01A 5AJ3F 3CXCR 2V8VA 4F67A 4NCGB 3K2YA 4RNOA 1MROB 2J7WA 1OS5A 3PW7A 2BW2A 3HZEA 3I31A 2OPPB 5HQ8A 4I67A 2KXHA 2HNYA 2OH2A 4A8SA 3CDEA 2QZ8A 4WIIA 4DF8A 5J1EA 3H40A 3A8EA 1UVKA 3JSRA 2XS7A 2FDNA 2FHOB 1UWBA 2I9SA 2MXYA 1RT1A 5K8OA 2UU9F 2X51A 2OPSB 4RW7A 5F8GA 2K1RA 2B4VA 2GW8A 4OZJA 4C3MA 1F5AA 4NLPA 4PQUA 3TA2A 5KTQA 2MSSA 1CQMA 3CCJS 3AAWB 1HL6A 2ZC3A 4XAKA 3R1HA 1U1RA 3VALA 5KT4A 3M9MB 1PILA 5J1NA 5C24A 4CO3A 3MOJB 4ZLPA 2VBXA 3M32A 3MEEB 1FNOA 4Y28C 2MB0B 1UA0A 1XR5A 3BEGB 2PI4A 4KO0A 4R8UA 5BYSA 2IRYA 1RT7A 2MY7A 1S6QA 3MM5B 4F4XA 3VWSA 2QSWA 4F4YA 4NLOA 4IO9Q 5AXKA 5SUHA 4DL6A 4QW9A 2KDOA 1WACA 1Q86T 4DSKA 4HKQA 2FVRA 5D4PA 2YH0A 2MZSA 4WFYA 4QYZJ 1TKTB 2QMXA 3NP5A 4KRWA 2OTLS 3V5RA 3EZUA 4C0BA 1U1NA 1CG2A 3CC4S 4C8ZA 5I4MA 3LANA 4FVCA 1FVQA 3HXMA 3ENVA 2GIRA 5ITHA 4Y65A 1FK9A 4L72B 1TR0A 4K59A 4EGLA 1GTEA 2MQMA 1YVFA 3HHDA 4OHXA 4L6V3 3CDUA 1N56A 2DNLA 1HA1A 5DDOC 3IRXA 2DB1A 3CF5Q 4Z2XA 3EPGA 3BSAA 2OSQA 2E9RX 2MKSA 3FDSA 2IC3B 4ZPDA 4TYBA 4A8KA 3V4MA 4DFJA 2Z2LA 2KHDA 2AGQA 3H2LA 3HLUA 2CQPA 4C98A 3OTCA 3QZ8A 2ZE2A 2DGOA 5L1KA 2A1BA 2AJ4A 2R7WA 1MW7A 1YIJS 3MFIA 2OMLA 2QYCA 3KNAA 2Z8QA 3KG4A 4C8MA 2DNZA 4N77A 3CB4A 1BY9A 4K4XA 1ZOTA 5G4DA 3T3FA 3Q22A 2VG5B 2PIIA 3CCQS 3RU0A 2RSQA 1REVB 1JWWA 2CPZA 3CEDA 1RKJA 3SEOA 3SCKE 1H2UX 2YQ3A 1NRKA 3B4MA 1QM9A 2MHNA 2XB2D 2MSTA 4WE1A 4ZMMA 4UW2A 2JLEA 3FZ2A 2B9YA 3RW7A 1L3VA 2UVRA 2E9ZA 1MSWD 4NYZA 2NXUA 1H6KX 4MKAA