3HLUA

Crystal structure of uncharacterized protein conserved in bacteria duf2179 from eubacterium ventriosum
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
73
structure length
73
Chain Sequence
DQQTMVYIVSAKRKIIADRMLQELDLGVTMLQAVGAYKNNETEVIMCVMRKATLVKVRNLLKEVDPDAFMIVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords uncharacterized protein DUF2179
publication title Crystal Structure of Uncharacterized Protein Conserved in Bacteria DUF2179 from Eubacterium ventriosum
rcsb
source organism Eubacterium ventriosum
total genus 13
structure length 73
sequence length 73
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10035 DUF2179 Uncharacterized protein conserved in bacteria (DUF2179)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3hluA00
4USJC 4E98A 1VFJA 4CO1A 3O8WA 4Y65A 3BZQA 1NZAA 2RD5C 2EG2A 4RLEA 3TA2A 3AHPA 1QY7A 1V9OA 1UL3A 4NYPA 4IYQA 5D4LA 1UMJA 4C3MA 4C3LA 3X3UA 4CO4A 3DFEA 4WK1A 3L7PA 4WK3A 3M05A 3NCPA 4RWXA 2Z0GA 4C3KA 3MHYA 4CO2A 4CNYA 4R25A 1PILA 4ZK7M 2PIIA 4Y6IA 3TA1A 1KR4A 2ZOMA 2GW8A 2CZ4A 3NCQA 1UFLA 1Q1KA 2XG8A 3NCRA 2J9CA 2DCLA 5D4OA 2GX8A 1UKUA 1O51A 1V6HA 5L9NA 5D4PA 2O66A 4CO3A 4D3GA 4YB6A 3AA9A 4USHA 5DS7A 4OZJA 2NUHA 2XZWA 4NYOA 2ZFHA 3HLUA 1NH8A 3T9ZA 1NAQA 2XBPA 2EG1A 3AH6A 1NH7A 4CO5A 4CO0A 1H3DA 1J2VA 1V3SA 2E66A 4D3HA 1HWUA 2J9DE 3CE8A 5DRKA 2J9EA 1VHFA 2JJ4D 1P1LA 1OSCA 2XULA 4CNZA 2GNKA 2O67A 3O5TB 1GNKA 4RX6A 3TA0A 4OZNA 4USIA 1XK8A 2V5HG 2J9DA 4AFFA 3OPKA 1O5JA 5D4NA 3N5BA 2NUUG 3LF0A 4OZLA 2VD3A 4YB7A 4RWWA 3AA8A 2NS1B 1V3RA 4YB5A 3GSDA
chains in the Genus database with same CATH superfamily
5L8RC 1X4EA 4ICLB 4P2MA 2QO3A 2MZ1A 1X8DA 3DCAA 1R0CB 1G3OA 2PI5A 5KFIA 3JAMU 2RJZA 3C6UB 2GGPB 3NRBA 3DLHA 2X7IA 1RTIB 4Q45A 4NL5A 4NCBA 1PJ7A 3KLIA 2BJ9A 2L9DA 1TKZA 2DR9A 3QWPA 3ZXWA 1QSLA 4OIXA 1SH0A 1WACA 2NREA 1S5ZA 3W7BA 1ZYQA 2M0GB 4DV0F 3MEGA 2YNGB 1NHKL 1O6XA 1IBKJ 4GVBB 2EKNA 5FLXY 3CDWA 4ILMA 5HATA 1V3SA 2RU3A 4CH7A 3TAMB 4LBHA 2HFNA 1E6VA 5A8RA 4CLYA 1IKWB 1XQIA 5AE1A 2XHWA 3IM9A 2UUBF 3MWBA 1EIYB 3D67A 4EO8A 4J9SA 3MPUB 1RT1B 1Y00A 2QN6B 3PRVA 5D77A 1CULA 1K8AT 3IBFB 4UY8T 2VFRA 2R7RA 4Y65A 2OSQA 1XMOF 3MM5A 1TR0A 2XC9A 2ACYA 2VG7A 2CQGA 1NSPA 3GZ7A 3KUGA 2DB1A 4CLPA 1VQSA 2K1RA 2UXBF 3GWCA 3TA1A 3JSYA 4DV3J 2BV3A 1EX8A 2H5JB 2ZE2B 5CYMA 2CJ9A 2B9EA 2DEIA 1FDBA 1SL2A 2KL8A 3B6BA 3FBCA 3CF5Q 2KJVA 1UJ6A 3LA0A 1RT5A 4PWWA 2VODA 5IQ6A 2MXYA 4DCPB 3EDRB 3RTVA 4QYZJ 5I3UB 1OY6A 4ELUA 4J9LA 2EG1A 1YJRA 4DBQA 7FDRA 3OR2A 3T5JA 2UXCJ 5F0UA 2DNQA 4J9PA 4CWBA 2W2NP 4WFYA 5IT9U 2HYIB 1NJZA 5EX3A 2VPYB 1C2PA 5IQQA 4FZVA 1H74A 4HACA 2IRXA 3H5YA 1HBOA 4DXLA 1RWMB 3G4SS 1Y5LB 3R9LA 2A1BA 1LEOA 3MR7A 3QSYB 1RAGB 2UUTA 4ETZA 1YLXA 3HK2A 1HQEA 2QJ3A 2C2ZB 4CNYA 1RTJB 3CEDA 5LOQA 2XGPA 2UVWA 5BR8J 3RBZA 2E1PA 4IH7A 3SV3A 3J80Y 2KJWA 2E44A 5IC4B 1SJ4P 3M9OB 4C8YA 2KO1A 3ZTPA 4XPCA 2Z2ZA 1F60B 5E3QA 3GCWP 1S48A 2KDOA 3ZTRA 5DS7A 2P2CB 4GMKA 4PWDA 1S10A 3T1YF 4CQ1A 1D8YA 1TP7A 4QR1A 4TXSA 1O0PA 2QIFA 2R7UA 1QE1A 4K0KF 3M8PA 4ZCMA 1Q78A 1XNQF 5HVGA 2H51B 3A1YG 2HQGA 4KHPJ 4FPRA 1R0BG 1JK9B 1PJ6A 1IQZA 3KK3A 1P9QC 1Q16B 4H4KC 4M8LA 4YB7A 3SFGA 4E0DA 3BPSP 2NS1B 1M1GA 5KG4A 3MECB 4ZPBA 4RL1A 1B0VA 1HBMB 2FUG9 4I2PB 1RYRA 2YNHA 5KG6A 1N0VC 3LGMA 4DUZF 3TNVA 5H9EJ 1DLOA 4V1Ak 4OI6A 2WVDA 4KT0C 1ZBTA 4XK8C 4KTQA 2XM3A 4ZPDA 1S1WA 2W4PA 3KKFA 4QIFA 4X64F 1JLFB 1WG5A 1FRIA 1S57A 1RISA 3PYDA 2AKWB 3FBBA 1YG0A 4DR1F 2KYXA 2HFZA 2EXUA 2BE2B 4ED0A 3LP1B 3EGVA 2YKPA 3L4BC 3QPIA 3H5SA 3OTOJ 4LF4J 2HGMA 1C4AA 1VRUA 1HWKA 1ZS6A 4QYZK 2HQFA 2N7YA 4ZPAA 1YRTA 1W26A 4JI1F 3F73A 1G6BA 3CO0P 4A4JA 1XIQA 3MEKA 2GVDA 4LFAJ 1HWIA 4JI8F 4MFBB 1SJFA 2C2EA 1WDTA 2D74B 1B3TA 2OEKA 4IH6A 2DGQA 3CJSA 4YHHF 1TELA 3H5XA 3LPEA 1RWWB 4EUVA 4LQ9A 3GV5B 2WONA 1X31C 4AUKA 2HK2A 1FRLA 4JI6J 1OY9A 1ZA2B 2UXDF 3M1VB 3TZZA 2YNFB 1U49A 2NUHA 1UVIA 1VRTA 2X1AA 2HFUA 3JSBA 1HL6A 2PN6A 1S99A 1PC5A 1BY9A 3TAQA 5D3GB 3VAGA 2ALZA 4MH8A 4CLKA 1AB8A 4PG7A 2FLLA 1W2BR 3CB4A 2HS0A 3R2DJ 2JHEA 3ULHA 1VHFA 4K4VA 3TJAA 2B3TB 2E5LJ 3GYNA 2YX7A 4K4UA 2J6TA 1VOMA 2CZ9A 2FJVA 4J7CA 4C8LA 1T9VA 2NXNA 2GJ2A 5JXSA 2WBRA 5L1IA 1NHUA 3GLJA 3HM9A 1FRMA 4OYAA 1RT7B 3MTKA 3OXLA 1GX6A 2HS3A 5GAEI 4Z7CA 4RNHA 4ALZA 2JC0A 2WHOA 4PG5A 1U8SA 1FKPA 2W2OP 4CIOA 2VA2A 1VIOA 1HR0J 2YNIB 2JC1A 3MM7A 2GAHC 3RB6A 2BW2A 3RB3A 5E7OB 1N36F 3T9NA 1U1OA 4UF4A 1HMVA 4LSLA 4CDIA 4BWJA 1TL7A 2R9LA 4MIBA 1TAQA 4F36A 3ENAA 3EVMA 5C5JA 2J8SA 3IMQJ 1T95A 1TV6A 3CJ3A 4DFPA 1VQ4S 3OPKA 4KC5A 4R8UA 2IC3B 3GSIA 4JV5F 1RJJA 2V94A 3GJQB 2B4OA 4RUBA 3PVXA 4N47A 4RW4A 3DRPB 4HH1A 3EM1A 5IXUA 1YIJS 2MGZA 1LWCB 4FKYA 1DBDA 5J2QA 2FHOB 4Q0BA 1N6QB 1X5TA 2B8PA 1FEHA 3CC4S 3BDPA 3HI9A 2E29A 3KXDA 2WW8A 3AODA 2EKYA 4MIAA 1X4HA 3KUHA 2DYAA 4R0JA 2CWXA 4UT4A 3DLEB 5KFXA 1SIZA 1UKUA 2CRLA 3GFZA 4RPFA 1WD6A 4ED1A 4QIGA 2ZVSA 3C66A 4BHQA 1SIWB 2RRNA 4PXCA 2ABYA 2W4DA 1C1CA 4DV4F 1JJ4A 1IBCB 4ECYA 4A46A 4DJBA 4JI4J 1YK9A 1F5AA 3FNNA 1GNKA 4TNOA 2DGUA 3EXCX 3WIUA 1E6YB 1F3FA 4RBVA 3R8YA 1KKHA 3CDUA 4ES3A 2ASYA 4ZVHA 2OAUA 1KOOA 2BJ7A 4EGLA 4JB8B 4F4XA 4E98A 2J6UA 4CO1A 1SH2A 2MZSA 1OO0B 4HHHA 3DFEA 2D9OA 1GMWD 1LW0A 2KB2A 4LRBA 3VALA 3DMJB 3JXOA 2CQCA 1FX2A 2DNMA 2JWNA 5ETKA 2EBGA 4WFZA 2CPJA 4YUDA 3CO9A 4M5MA 1S1VB 4DFKA 3I5BA 3DRYA 3US5A 5K8MA 2MSTA 1D8ZA 4LR8A 1RI7A 5HROB 1X5SA 2XBPA 4N76A 1BQMB 4U96A 4ECRA 1S79A 4ICLA 4Y2IA 1TUGB 3V81B 2YWFA 5KFPA 4LF9J 3WC2A 2FVCA 3HSGA 4FVMA 4HHUA 3DHWC 2E5GA 3C6UA 2GGPA 4LJMA 2VJUA 1FF2A 4MTPA 2DR6A 1RABB 2K3KA 2MLZA 4ECUA 3MAHA 3MAQA 2VJVA 2DNYA 1CJUB 2NCKL 2CYYA 1RA7A 4DEZA 3KJFB 3K8VA 3AB4B 3RB0A 4B02A 4YR2A 4Y2KA 3TAMA 3M8WA 3UWTA 3LWLA 4M95A 2YH1A 1VJQA 4F67A 2CDRB 3PYEA 1UJ5A 3UD3P 4ZPVR 1RT1A 3UFCX 4NPOA 3CD5A 3ET6B 1XTZA 3KK2B 2DXEA 4J9NA 1HW8A 4LMZA 5FJ4A 2Y1IA 3W9JA 5ETNA 2Z2LA 1FX4A 1PIEA 3G9CA 4X4NA 3EPIA 2FJXA 2HIYA 2QA4G 2LQJA 5HN0A 2PT0A 2CQPA 2KXHA 2H4WB 1RAIB 4RBUA 1VQNS 1C0UB 3VWSA 2ZE2A 2C2DA 1AFIA 3T19A 4IRCA 3NY0A 5GMKa 2KTQA 4LBPA 3R1LA 2LVWA 2EWHA 4DPWA 1PC4A 4CRJA 1FRXA 4KHMA 2YKQA 3CW2C 1V9OA 1M1HA 5I3UA 3H40A 5KFWA 2N3LA 2Y8YA 4DV3F 3QT8A 4ID5B 3W2VB 1SB6A 3H2VE 1GQEA 2MTLA 2HQ3A 2I6WA 4NA3A 3JSMB 3TZYA 2YBVA 2JEIA 5LMNJ 2EFVA 4B9LA 3DOKB 3ETOA 3KLVA 2F40A 2G13A 1U45A 1WTBA 3U02A 1UP1A 1VC6A 5CYJA 1Y5IB 2WRMA 3K8WA 2AJ0A 2M9KA 2OGUA 3UDEA 2ZJPQ 4UY85 1QVGR 2UXCF 1G2EA 1M5KC 1VQYA 4WYWA 2ROGA 2EPIA 1PYSB 3PDNA 1VMBA 3LAKA 4LUBA 3GIJA 2V5HG 3MMCA 2NUUG 4C97A 3VQTA 2JZ5A 3TAPA 3M8SA 2MJNA 3DOLB 5ETVA 3IWLA 3VAMA 3CCES 3BO3A 2ZH6A 3DKDA 4PG4A 2EFQA 1U0SA 3CSKA 5DJBA 3VGTA 4MK8A 2LKZA 5BR8F 4ELTA 2GV1A 2HQCA 1ZZNA 2E9TA 1RHMB 2QLJB 3UO0A 2ADBA 3CXCR 2R2SA 4WCEQ 3OFHA 1VR6A 1EB0A 1NPKA 3HMJG 2DBBA 2NXUA 3MFHA 3TR5A 2H9ZA 4DUTA 2OIHA 1RTZA 5T7LA 1SUQA 1M1KT 2ZKTA 1N32F 3D0IE 3MGJA 4ZLJA 5A8KB 2HGLA 1S72S 3FFIA 2B4VA 3D4JA 1X9SA 4NYZA 3QYYA 4MK7A 4USVA 1N33J 3A8KA 4QCLA 4NZ6A 3CD7A 3B4DA 3QT7A 4GC7A 4IOBA 3MZIA 1JLFA 1IBLJ 4DG1B 5DO2A 3BYPA 1QY7A 3W61A 4QPTA 5J2NB 3BDEA 3LP1A 2XMWA 4IFVA 1V3ZA 1X0PA 2YKNB 5KT4A 2OMOA 4ZK7M 3I5AA 2D1CA 3D6FB 4WFBQ 4PXBA 4DL3A 5K5MA 1HBNB 3MPDA 2VICA 1PJ5A 3R27A 1FJCA 1HI8A 5IV4A 3DYAA 2RF2A 1LFPA 3UCUP 4FNIA 4NX9A 2BKNA 2F8HA 5GADI 4NCGB 3NAIA 1DZ5A 1K0VA 1RE1B 1GMVA 2DO4A 5B0EA 1RCXB 2B0GA 2IVMA 2KHDA 3PX6A 2KI2A 1IUJA 3D1QA 3CCRS 3OTOF 1UTAA 3GJSB 4LF4F 3IN5A 5ETOA 5DRKA 5IM0B 1XMBA 4YR0A 1G7CB 2XULA 4C11B 4WF9Q 2IPOB 3R7NB 3I0SA 1N5QA 3CCQS 1WF2A 4QYRA 3KK1A 4BLGA 4LFAF 1TUVA 5KFEA 1QVFR 3TEHB 2MY7A 4DR4J 1REGX 1SKSA 4CLZA 4NLSA 3I9V9 2AJ1A 4FYXB 1H38A 1FVSA 1RXOB 4NLDA 1LW2A 3FCVA 1AUDA 2QYCA 3DLGB 3D6MB 2E9ZA 3W66A 1RTHB 3R5GA 4UQTA 4CLFA 1WNEA 3M32B 2OFGX 3D7SB 3I4PA 2LFVA 2GS8A 4BWMA 2WVCA 2F65A 2V4JA 3QJJA 3SCKE 2QZ8A 4Q8EA 3OQ2A 1HNVB 2MZRA 3O2IA 3SEOA 2PA3A 2ZH8A 3D54A 2ZNYA 4DPTA 1KQSR 2KZMA 2AJ2A 1XMQF 4ATNA 2LECA 4GC6A 2JJ4D 4U7UD 3HP6A 5FDLB 2M8DB 3ILLA 4Z7YA 3KHLA 1JWWA 1U0HB 3ZC4A 4AYBD 4OX6A 4EBCA 1K1SA 5J2PA 2CQ3A 1T3NA 2J0SD 3LAMA 1TK0A 4NLWA 5LJ5Y 2YNIA 1KFDA 3O8WA 5DGBA 4Q2MA 3MPYA 2R4FA 3JYTB 4IG3A 2HBQB 2GHVC 3U7JA 3H20A 1S1XB 2VQFJ 2BQRA 2A10A 1I1GA 4PQUA 1Y5NB 5KG0A 2FJEB 1SQFA 1HR0F 2DNHA 2C2KB 1P9YA 1U1KA 3UNYA 3KOAA 2HHHJ 4RNFA 2IC3A 2RT3A 2R7VA 5LXYA 1FO1A 4RNMA 3DRPA 1DAXA 1SV5A 2NYIA 3ZZRA 2HKEA 3CE8A 3NS5A 2DIVA 2XSJA 3SSSA 2ASLA 2KN4A 1VQ8S 2KRBA 4KPCA 4C98A 5CAAA 1H6KX 1H7WA 5F8HA 5A6WA 3BGLA 1WOSA 4XTTA 1FWLA 2IY5B 2PA8D 1WI8A 1MWQA 3F41A 2KG0A 3MPVA 3CDEA 2AQ4A 2K3IA 4WTYA 4OI4A 2UV8A 3B54A 4NLPA 5L1LA 2XG8A 3BGFA 4RW6B 4ED7A 4QU6A 1GT8A 1IXKA 2RUSA 3C15B 1RHJB 3TO8A 1N0UA 3G6ES 2FD2A 2J7KA 4NYOA 3N79A 3CIZA 1F2GA 2YWWA 3EXYA 3GU0A 2MSSA 1B64A 2DHSA 4DR2J 2XY6A 4JI4F 2D3UA 4J5OA 1IQTA 3L95X 4QZVB 4N56A 3QGPA 3RZAA 1KVIA 2HBZB 4PYAA 1LQ9A 3TVKA 4EI2A 3A8IA 4GO7X 1SJRA 3LPYA 1T9UA 3NGSA 4KQZA 1SPBP 3DMJA 1SH3A 3QGHA 4F7VA 5IC6B 2W01A 3J81Y 3PHTA 4L75A 3RYLA 1S1VA 3OUYA 2EG2A 1S6PA 2XEXA 1N34J 2CQBA 2WVBA 5HROA 2LA6A 3NWRA 3CDBA 2HHTA 3CVKA 1F1BB 4CH0S 3C6TB 4XPEA 3V81A 5HANA 3R5DA 1VK8A 3NWGA 5CCMA 2HHSA 5D4OA 2UP1A 2YPZA 2IYIA 4KGXB 3LGNA 1YKWA 4X66J 3V4IB 3ZTOA 5B0BA 4I2QA 4I64A 3HHDA 1OSDA 3T9ZA 1CJUA 1X4CA 3EZ5A 3G2XA 4DQQA 2ZH4A 1VQ9S 2W1BA 3Q89A 2GJFA 1KLMB 1YJNS 4OZNA 4ENOA 2BM1A 2CJAA 2ZZTA 2FY8A 4KBIA 3MMJA 2HHPA 1TL1B 1U2CA 4NLTA 4TKTA 4G1PA 2YQ0A 1WSVA 5EDWA 1XERA 2HEKA 1FCAA 1TKTB 3EGNA 4EU0A 3KK2A 1W2IA 3X3UA 4HDGA 1KRPA 1LKZA 1U24A 1OY8A 4WP9A 2GMHA 3QO9B 4ANEA 3PG9A 2COLA 3SXLA 1VDHA 2A6OA 3NCRA 3G8TA 3CCJS 1T03B 2HFSA 1SKRA 1AW0A 4DX7A 4HR2A 5CYQA 4I1TA 2DNKA 2LQBA 5D0RA 1I3OB 2G2ZA 4MYUA 1Q79A 2JFKA 3HX9A 3QZ7A 4OV1A 1BWVA 3MM8A 1CVJA 3M8ZA 1Q8LA 4L3KA 4NLOA 3CCUS 2EFOA 3TA0A 3PXGa 4S0MA 4ID5A 3W2VA 2ASJA 2DEJA 3R5CA 3JSMA 3E01B 3TYTA 3SSQA 1EETB 3DOKA 3W65A 2D3O1 4I7FB 1ZAXA 3RAXA 2Y0SD 2AZ1A 2ZC3A 1WEXA 1NK0A 3ILOA 1KEKA 1CBKA 2XNQA 2PSZA 4F0HA 4RR5A 5LMNF 4F3MA 3WX4A 3S7RA 3ENWA 3KLEA 2CJXB 4CO3A 2I8EA 5CCLA 1Y3JA 4F4KA 1K44A 3DOLA 2YWGA 4ECSA 1KBRA 3DDIA 4ED8A 3OL8A 3SQOP 4OMFG 1Y4ZB 4N8NA 6FDRA 3PEJA 5EUHA 4DUYJ 1GTHA 4J9RA 2YQ1A 1P6TA 3DLKA 1W25A 3W9IA 1VBYA 1KQFB 2DIUA 3UI3A 4ZCLA 3K5MA 2NXJA 5D4NA 2QLXA 1R3NA 2VD3A 5B0CA 2ZZMA 1A9NB 2W2MP 4RKUC 3N5FA 3PR5B 2F63A 3Q8YA 3H25A 2DR7A 2VZ9A 3AFGA 4X4VA 1MROB 4L72B 3RJMB 3A8JA 2MQPA 4J9MA 2DRDA 1HA1A 5THWA 5A8KA 1VGYA 2OKQA 3QRQA 1L3TA 2XLKA 3PM9A 5LSLA 3MTJA 2V8PA 3H98A 3OL7A 1RA6A 1TL5A 1SBRA 5KT3A 1N4LA 1S6UA 1XWLA 3DRRB 4D3GA 1H2UX 5E3AA 3MR2A 1HPZB 2RDIA 3D1HA 4OZ0A 3BPDA 2QRRA 4DN0A 4DV7F 3ITHB 3OTDA 3FBEA 2JVOA 1WG1A 1KVKA 3UD4P 3ICLA 5J2NA 2EC0A 4DFMA 1JXEA 3KUEA 2GNKA 5KFMA 2BQ3A 4QJVA 5DDOC 3GIIA 2RS8A 2IM1A 3MCOA 4USIA 4CH1A 3THTA 1IBLF 1HBNA 2QSWA 1YWXA 2FJBB 1HYSB 3G96A 1RGVA 5HO4A 3WDOA 4AXJA 5CH7B 2VFSA 2B6AB 1YJTA 1M5PC 1ITPA 1NK7A 2CNNB 4M5NA 2C2OB 2K8GA 4MMOA 2GZOA 4NYPA 1LXJA 2FPHX 3OW2R 2E1AA 4ECWA 4NMLA 2ZH5A 4CLSA 4ETXA 1XJWB 5KFRA 3Q86A 4TQRA 3UDLA 5HJYA 1Z2LA 2MZQA 5IM0A 1HHTP 4I4BA 2BJ8A 1LFWA 4BC7A 4OYZA 4C11A 3KHRA 3HFKA 2AT1B 3JB9k 1KNZA 1FJGF 5KFDA 1JJ2R 3CGIA 1Q4RA 1TKZB 2L9WA 4ZJOA 2W7OA 2HWIA 1FE0A 2UUBJ 4N41A 4WU3A 3B78A 4NRTA 3DXSX 1N5YB 3BQ1A 3I6PA 1KD1T 2ZH9A 4WIQA 2EFNA 2DHGA 3ELHA 1SJQA 3D3BJ 3J7YU 2Q3PA 2GJIA 4IO9Q 4Q5VA 2MQMA 1E6VB 2BBEA 2EK6A 4QW9A 1PAEX 3M32A 3W5XA 2I5JB 1FTRA 1UWBA 3DRSA 3K0JA 2HLUA 2C3OA 1CULB 4ES2A 1HNVA 2VFVA 1N48A 1SC4B 3NMAA 3MM5B 4QIWD 3L9ZA 4G6VB 1JKHB 4P10A 4GKJF 2LQ9A 1IKYB 4DL7A 2EC2A 3MCMA 1ZTTA 1UA1A 2OTLS 2F3JA 4BDPA 3EX7B 1ZM9A 3GIMA 5C24A 3EYZA 3FRYA 1EKSA 1U0HA 2IFXA 1RT6A 4DSIA 2ZBQA 4HT5A 4HI1A 4LF7J 4AQYJ 2HHQA 4ID8A 4OI0A 5SZTA 2C2NA 4K5SA 2M2BA 3JS9A 5BXIA 7AT1B 1JLQB 2KVIA 5KG7A 3JYTA 4QWBA 4ES1A 3VCDA 3HSZA 1HKAA 3UVJB 3DXBA 1RWOB 2UUWA 2M8HA 3OR2B 2CPXA 4CLWA 3BQ0A 2CQ4A 2V34A 3FC9A 1GX5A 4O3RA 2XZDB 1JX4A 5AJ3J 2KT5A 3TVYA 1KN6A 3MURP 4LFBJ 2QA2A 2RKIB 4HACB 2P6TA 3ADAC 4C3KA 4CO2A 1HBOB 3CDAA 2VQFF 1QJHA 1FERA 2DITA 3N4WA 2Q6CA 2GFFA 2GC8A 4WP3A 3T1YJ 5C25B 2OP5A 4X4PA 2CPIA 3OJSA 2CXEA 4K0KJ 1U47A 2B9XA 4IOAQ 2XZTB 4F50A 1NDPA 3QAEA 1O8BA 1C0TB 1RBLA 4TQSA 2Z2YB 2J9DE 4TY9A 4OZ5A 3BR9A 1CJKB 4UTGA 3KJNB 3OLBA 2OPPA 1YBTA 4KKOA 4RW7B 1RAOA 4RW6A 4XAKA 3C15A 2KT2A 1YJ9S 1J5OB 1OIAA 2RQKA 3F56A 4ZCKA 3K59A 1XEZA 1DRZA 2VASA 1ACMB 2V68A 3AAWB 2YNHB 3MCNA 5KFBA 2ZNZA 1ULRA 3KG1A 4DZDA 2W9AA 4DR1J 4M5JA 2WZ1A 2AEJA 3V6DB 4I68A 3UDCA 5AE3A 1J27A 3I0RA 4USMA 3HPOA 1S1WB 2UV8G 1S0NA 1HQ2A 4ZMMA 4DQRA 2CPFA 4U8VA 3PKMA 2W9CA 1MU2A 2E7XA 4RW8A 4ECZA 2P9CA 4DR2F 1JLEB 4JI1J 1PBUA 1T9TA 4FXWA 1S1UA 3NEKA 3UR0A 3D0HE 2LCWA 2R8HA 1D9AA 1P1LA 3RGIA 2GO9A 1Q86T 4QBUA 5L38A 4DPYA 1SKUB 3BS9A 3TP2A 1NDKA 4ZLNA 1U4BA 2ZH3A 1N34F 4FYWB 5DDRC 3V4IA 5ADZA 3I96A 4WK1A 1IM4A 2AGQA 5IS2A 1NXIA 1X4DA 4TY8B 3QIDA 4P7TA 2VH7A 1TVRB 3FSXA 3PFOA 4G1QB 1KOHA 4I0WA 5A76A 4G1IA 1KC8T 2CAJA 3MI7X 2NZ4A 3NOCA 4A8YA 1UW9A 1YI2S 2CPZA 3S01A 3I5CA 2DNNA 4TYAA 4UUXA 1VQKS 1KLMA 4X66F 1N54B 4AL7A 5H9FK 1TL1A 2K7JA 2IMWP 2ZOGA 1I6JA 3R5JB 3K5NA 2RQCA 1X5PA 2D3ZA 4IQXA 4A8SA 1TKTA 1Y7PA 1VRTB 1U1RA 2FZKB 8ATCB 5GMDA 4ELVA 3A8EA 2DH8A 1FWPA 4B3MJ 5DLFA 4L76A 3DM2A 1S4FA 3QO9A 3N5BA 1UFKA 3CJQA 4E8UA 1JNZB 3NKYA 5AE2A 2F4VJ 4DL2A 3GSDA 2J0WA 3GG1A 1T03A 4TU8A 2V9KA 3MD3A 2ZDOA 5MLCV 3UDVA 5BYRA 2NSCA 3CCVS 3FEYB 4ZHRA 5KFKA 3FSYA 1S9FA 3LOUA 3N0VA 5K8PA 3O44A 3I55S 1CS4A 4X65F 1NK4A 3PW5A 5JUMA 1GMWA 2FHKA 1B4SA 4YP3A 1TUWA 4NLRA 1FVQA 4YEAA 2YX4A 4DL5A 3UN3A 3CC7S 4FF1A 1H0HB 4KO0A 1X60A 3DHXA 4OJ3A 2ZITA 4C48A 1FKPB 3RRHA 2YH0A 1S97A 3UCGA 3E01A 3HVWA 2BMBA 3HSDA 3WBZA 1EETA 5I3PA 3SSRA 6AT1B 2IA6A 1UWAA 2G4BA 4JV5J 1MMDA 1NBEB 4LSLB 1Z2ZA 1TL7B 3AD8C 3FEZA 3OL6A 3QJPA 5B09A 4UZBA 1VQPS 4K50A 4M94A 4QWEA 2OPQB 4DZ6A 3NMRA 2VV5A 4OYXA 4RW9B 4ECVA 4YB5A 2LMIA 4NXMJ 4R8UB 3ISNC 4DCOB 1QLNA 3NBPB 1M5OC 3KDOA 3NL0A 2VBWA 3HVAA 4ZVFA 4KE5A 1R43A 1LK7A 4JV0A 2VQEJ 4IR1A 5J2QB 2VUGA 2XI2A 4Q0BB 3HDSA 1NM2A 2Z4PA 1RWUA 5LM7E 3N6LA 2J9CA 2V8DA 2GQCA 3OR1B 3DU5A 2XO6A 3GFXA 2B7BB 3VV2B 3RBDA 1U2RA 3H0PA 5KT7A 2GA7A 1FNOA 1HI0P 1S7HA 2GVZB 3H90A 5GAHU 5GMEA 4X84A 5DDPC 4L3NA 2HNYB 2AYMA 3VGSA 2CNOB 4DUYF 4N5SA 3H7HB 3QGGA 3T3FA 1MROA 2Y3YA 1RHUB 2M88A 3TJ8A 4IG0B 2BJDA 4CI0B 1C1CB 3EUNA 4IUFA 2HG4A 1XK8A 4I6WA 2KRRA 4NZ0A 1WC4A 1F9HA 3BM7A 4NA1A 4DN9A 1VQ6S 3GJTB 2MQLA 1T94A 2R2RA 2K06A 3DRRA 2KKHA 4FVCA 4TYBA 1HPZA 3JAMY 2YWKA 3MM6B 3T1HF 1D1UA 4HYKA 3DC2A 2WVEA 1SC1B 3ITHA 1D09B 3BKUA 4MKBA 3M6VA 2P5VA 1B0PA 3MEEB 3QIPA 3UD5A 3EZOA 1IKVB 4WFAQ 5CD4A 4F4ZA 5F9NA 2V8HA 4F0MA 3AA9A 3BB5A 4OHVA 2CNLB 1I94F 1B0TA 2F8MA 5E3CA 1HYSA 3T6JA 4LIWA 2VA3A 1GTEA 1P1TA 2N82B 4J9QA 2ERRA 4J91A 3TUPA 3AJDA 2R7OA 1HD1A 3P4UB 3P5BP 4O3PA 4H54A 4K4SA 1FESA 2PEHA 1FXLA 1ZETA 3B8HA 2NPFA 2PEBA 2AU0A 2UUAJ 4HT7A 2X3DA 3HJFA 2CZVC 5D8HB 4C0HA 2HS4A 1H2VZ 1GMUA 3E8OA 4K59A 3MF5A 2CKWA 2NQPA 3M2UB 2W7PA 4K4TA 1M90T 3LQVA 2VONA 4IRKA 4DR7J 3K7RA 3ETMA 1KQKA 4KH0B 2FJWA 2QC3A 1WC1A 2HHUA 1ZM2A 3W64A 3PJWA 4Q43A 3G86A 2XGQA 1EQ0A 1N5YA 1RWVB 1LWFB 4X4RA 1NO8A 5DG9A 1S12A 3TZXA 3NNAA 2XMTA 5D78A 4Q44A 1K73T 3GIKA 5KFYA 4L74A 2VFUA 2I5JA 4HLBA 2QL7B 4CO0A 1U6FA 1F3VA 2X51A 1NJYA 3HHLB 1MSWD 2DGTA 1HW9A 5L9XA 1FT8A 4CNZA 2O67A 1JKHA 2XMVA 1RAJA 2GQ2A 3A3PB 1IKYA 1UW4A 4FF3A 1F9EB 4YB1P 3CMQA 1VLYA 2MQNA 5HSPA 4YQWA 2HZAA 3P5TL 2J8AA 2BANA 3OVSA 3R2CJ 3HZGA 4NEZA 4JI5J 1RT2A 4YDXA 1VQ7S 3NGUA 4U6PA 1NJXA 3GPAA 1ZAVA 3VGUA 1JLQA 2X3GA 5I3QA 2E1RA 2C3UA 3UVJA 4O3NA 2D9PA 2HWTA 2D3OR 1FXRA 3VQSA 2DGWA 4J9OA 3TUIC 3CJ5A 2UUCJ 2DNZA 3QGIA 4LF7F 4AQYF 2P6SA 3ZFVA 4KB7A 3C16A 1GAOA 5IWAJ 4ED2A 4LREA 3MUMP 1U8WA 3D6TB 4RJVA 4O4RA 1HWUA 2RKIA 1L3VA 1OSCA 4PPDA 5KT2A 5KFVA 2NYHA 1TK8A 1F6TA 2D41A 4FBUA 2C1EB 3VAKA 3BSAA 5C25A 2FJAB 2CJBA 5AJ3F 1NK8A 4KPYA 4FF2A 3F0NA 3MMCB 3LWMA 4LFBF 3DU6A 1YJUA 2ZBCA 4IYQA 2OI2A 5HP1B 2ZWOA 4Q7AA 4HL9A 2HNDB 5EWGA 3JSRA 1RDRA 4IDKB 5K14A 1RYSA 3FZBA 4J9VA 1FKAF 2CFXA 4B3OB 1PO6A 1NMEB 4DOZA 5K8OA 1C0TA 5ETMA 4GKKJ 1N32J 4AL5A 1KTQA 4UW2A 2VDIA 1CJKA 3FK4A 1DURA 1FA0A 3PJXA 2R7SA 4KGVB 4RW7A 2CG8A 4PCQA 1XNRF 4CLTA 5HQ8A 4PAAA 1CJTA 3R5BA 5E41A 1TU0B 5KFHA 2I1RA 5T7LB 1J5OA 1SUQB 3ONQA 1BQXA 1TL3B 2YXLA 4IOCQ 1FHTA 3FFIB 2MKKA 2QA4S 3CCWA 2EVZA 3HF5A 3BN7A 2JEGA 2J5AA 1R8BA 2CJQA 3V6DA 5D15A 4OHZA 2Z58B 3TANA 4QR0A 5A6PA 4WKRA 3THVA 2NXCA 1WG4A 1BWEA 4K8RA 4CP5A 2WB1D 2N4CA 4P6QA 3PW4A 3S1TA 4XDDA 3IRXB 1JLEA 2PC6A 3ZTQA 4IFVB 2VG5B 4F4AA 4M5DA 2PMWA 3F44A 4C9DA 2CPHA 4DR5J 2FLNA 4RU9A 4ZDNA 2FY1A 3DYAB 1ZA1B 2WB4A 3W63A 2RF2B 2MYFA 2G1DA 4MK9A 3P6YC 1NKBA 5M2UA 2QLFB 2RDDA 3WX8A 4HH0A 2ZUGA 4TY8A 2F7VA 1NEEA 1TVRA 4ZP8A 1HHSA 1WEZA 1DTQA 4G1QA 3BGRB 1YTYA 2DO0A 3M8QA 2XCAA 4X4QA 3WIVA 1UVLA 3BH7B 3D5MA 2L48A 4FYVB 3GE9A 2AIRB 3I0SB 2XMJA 5KFLA 2KT3A 1JLGA 3KK1B 2DHHA 4C8KA 2LQ5A 1UCNA 1DQAA 3NP5A 1UL3A 3ZZYA 5CZXA 4EFAC 1QAIA 3T1AA 3V5RA 2KZZA 2ZC4A 4ZS6A 4FP9A 3AOAA 3FKBA 3OD2A 3OFGA 2KFNA 3PKYA 1LW2B 4ZJLA 4NI2B 3R5AA 1QD1A 1XMQJ 1QDUB 4B9TA 3MFIA 5CABA 1JLBB 1SI9A 2IBKA 3P49B 4B3SJ 2V4JB 1R31A 5KFZA 2MKCA 3IGNA 2ROPA 1FTCA 2BRKA 1UVMA 4B3MF 5DG7A 1U26A 2KM8B 2BJ3A 1XC9A 2OEJA 1NSAA 3TX8A 4AFFA 4ZIVA 4I6AA 2JH3A 3CCTA 4NLVA 2F4VF 5KOXA 1FFWB 1HIYA 5ETSA 3SBMA 2C3PA 4JI2J 5J2PB 1R6VA 3V6JA 3CJRA 2YQ3A 3M05A 2VPZB 1L3KA 3NNCA 2V6AA 2GMLA 3C14B 3TARA 1OPZA 2ILZA 1I51B 2OEMA 2XI3A 4IG3B 3DOMB 1F5CA 3TVZA 2I2YA 1IJEB 1LWEB 8AT1B 2R8IA 1RHRB 3U1LA 4PQUB 5KTQA 4OZJA 2OPQA 3VGVA 3P3DA 2AJFE 1HWLA 3K5PA 4RW9A 3G87A 4WXOA 2PDAA 2JEFA 1DQ9A 1F2HA 2F9DA 1ZH5A 1DFDA 2DK2A 2QYGA 2E66A 3NBPA 5SUHA 3OJUA 2POKA 2N4DA 1CQMA 4AXIA 1RUSA 4OX9F 3PYFA 1SV5B 1A7GE 1NK9A 2VIHA 2BKOA 1JQGA 1HBUB 4TU9A 2XSJB 4X4OA 1X9WA 4RWWA 1S76D 2XMUA 5J2MB 2IM3A 3OLAA 4NXMF 3OR1A 4HHJA 1KDNA 3PCOB 4PPZA 1YVFA 2JRSA 3SFUA 1HARA 2UU9F 2GVZA 4P73A 3BREA 1YZ6A 2HNYA 2QE5A 2VQEF 3ZZPA 2QGFB 7FD1A 1VC0A 3R7BB 1Q5VA 3Q8UA 1NJWA 4IG0A 2YPYA 1XR7A 3SV4A 2RSQA 1U1PA 3C2PA 5KFAA 1XR5A 5CXTA 4B9NA 1S1TB 4MYTA 1HHQA 4PYDA 3PTWA 2XZWA 4LRFA 1M5SA 3I32A 1VHIA 1NH8A 5F9LA 3W5ZA 4EMDA 2DD8S 2JLEA 1SL0A 5C2CA 3IR6B 2XLJA 3TI0A 4D3HA 1NB2A 2QSFA 1ZPVA 4A8KA 3MM6A 5DG8A 3QMQA 4PABA 3O1LA 4WYLA 2I38A 2R42A 4MKVA 5B0GA 3MEEA 3M30B 2YVSA 3AJ2A 3PRDA 3AXKA 4RO0A 1RU1A 1IKVA 4CZCA 4AE5A 4KY3A 3RUBL 3ISND 2FVSA 3R1HA 3EMTA 1T05B 5L39A 2OMLA 4FBTA 5G0RB 3CD0A 1S59A 4WWSA 4K7QA 5DETA 3OUYB 1RAAB 1S6PB 5E3RA 2RRAA 5KFCA 3EJMA 5M2RA 1R6YA 4ED6A 2OH2A 2XB2D 2C22A 3CCMS 2RQ4A 2LEAA 1Q7LB 1XBWA 3MMAA 2G9OA 3DN9A 2MB0B 1FFSB 5HMYA 3E2EA 1VBZA 5KOWA 4Q8FA 3M9NB 5DQHA 1YX2A 2F1FA 3M2UA 3U1MA 3W1YC 2PFDA 3HSJA 4KHRA 4I2QB 2UUAF 3OFFA 1X4GA 3BKFA 3KLGA 1GXTA 3TRGA 4DSJA 3GP9A 4B3TJ 2XYGB 4DX5A 1MN7A 1HNWJ 1D9DA 1LWFA 1WHWA 2B7CB 4EEYA 4P2FA 3LTOA 3PNIA 3BBFA 2HK3A 4DR7F 8RUCA 2P9GA 2BM0A 3UPFA 4ILRA 4U67Q 2QG9B 3PIOQ 2H65B 2OFHX 4ZCIA 2E7VA 3Q0AA 1HNIB 5LL6d 3NNHA 4M1KA 2OTJS 3NCQA 3HHLA 5G4DA 2IJFA 5F8MA 3NS7B 2CQ0A 2YTCA 3RW7A 3CJ8A 5EGYA 3TEGA 1RHKB 2V67A 3KG0A 4JI7J 5LT5A 2E5JA 5CYQB 3K89A 3FCHA 4ZPTR 5AXNA 4WFNQ 3C46A 4YR3A 4U95A 1T7PA 1LOUA 4LVNP 3SI8A 1VS3A 2EFPA 5KAKA 3MM8B 2ZEJA 1DHMA 4CTAA 1J5EJ 2MHNA 3OSNA 4ED3A 2FGOA 2WVFA 2M7SA 2ZJQQ 3MUTP 2HNZB 4JI5F 3BZQA 3Q8VA 1B7YB 1HNXF 4WJBA 1NK6A 2H48B 4PKDB 3VF0B 4C0BA 4GVLA 4K4XA 2FDNA 4C7QA 1RP5A 2RHSB 4NZ7A 5JJBA 2IAJB 5D0GA 1NB7A 1QAJA 5KFFA 4WBFA 5DGAA 3IG1B 1VYAA 3ILJA 1IR1A 2PE8A 4CCHA 4OJHA 2UUCF 3VR1A 2H4YB 1G1XA 4DU7A 3KMQA 2Z56B 5A2QY 2PO4A 3M2VA 5IWAF 4DU8A 1KQGB 4FYYB 3KLEB 1U6BA 1NAQA 2IRYA 5D0HA 1Q95G 1DJ0A 4KIAA 3ZZ0A 2EK1A 5KG1A 5HP1A 3QFHA 3CJKA 3GJRB 2HNDA 4IDKA 1WOOA 2VPXB 2LP4A 3ISZA 2LA4A 4URGA 4B3OA 1U6ZA 4UOHA 1FDAA 3V4MA 4F8RA 1JLAB 3Q2SC 3DLKB 1UA0A 2VL1A 4HVZA 4DI6A 2MQOA 2RMLA 5HI7A 1GFWB 2XNRA 2W4CA 4ZKAA 2VOOA 1SCJB 2YWEA 3UQSA 5B0FA 3GR1A 3MEDB 3KJVB 2GIFA 3ZNJ1 4GKKF 5LXRA 1TL3A 2L9NA 3JTOA 2XQCA 3TX0A 3BJYA 2WW4A 3H2UB 3CJ2A 2ZUAA 3QWUA 3MM9A 1YJ7A 2FLPA 1MWYA 4X4TA 1BUXA 2FHJD 4DV7J 2UVRA 4UOGA 3ZZOA 3LP2B 4EBDA 4I56A 5DLGA 3SCIE 2VOPA 4WE1B 4YS2A 1IKXB 2VB6A 3H8YA 1WHYA 3RU0A 3LH2S 1BE4A 1T3OA 2J9EA 3IRXA 4EBEA 3CULA 1RT3A 3JTPA 3GONA 4DX8H 2V8GA 1WC0A 4W92B 4QQBA 3LP0A 4CT8A 1UPPA 2VG5A 4DLEA 1K1QA 2E5IA 5HQMA 3I82A 4RBTA 5EX0A 4A8XA 4P71A 1FNXH 1D3WA 4RNNA 4YMEA 1M5VC 3G6XA 1TTHB 2G0IA 2LDYA 4RUHA 2ZDPA 4O3OA 2BR0A 3AHPA 3IM8A 1P8GA 2BXJA 1GXUA 3CC2S 3THPA 3Q24A 1SKWA 2CPDA 1ICEB 1N5VA 3LANA 1FJGJ 5FIIA 2LDIA 3RR8A 4DV5F 5GVQA 3CMAS 4USKA 2VG6B 4I69A 4DR5F 2DGVA 5AT1B 3BGRA 1YDLA 5I42A 1HFEL 2A18A 4IRDA 3ZZZA 2HAFA 2MJUA 2FIUA 3R7SB 2IBOA 1OYDA 3POTB 4ITSA 4DL4A 3CJ0A 5FLXU 2XS2A 2A0FB 3Q83A 2V2ZA 4R0EA 3PX0A 3P8BB 2VC0A 4OI2A 4ERDA 5M2PA 2O1PA 4PR6A 2MKIA 5E33A 4LF8J 4OQJA 1UVKA 4USJC 5J1PA 4NI2A 4GKJJ 3HD2A 3K57A 1T11A 2IVFB 1MG7A 3T5LA 2F4FA 1A0OB 2WCXA 1JLBA 3QSIA 2AWZA 1UWBB 2BJEA 3DRSB 4DL6A 2K7KA 5B0AA 1OQ3A 4Y3CA 4KFBB 1WTFA 2N7CA 3PRBA 4TU7A 3M8RA 1OPIA 5L9NA 4ZJQA 3FVYA 5D4PA 3QFWA 1A6LA 1RT4A 3PR4A 2IM2A 4FNHA 4OYPA 2CVIA 2FGCA 5I4MA 4X2BA 4ZVOB 5IZHA 4B3SF 5C24B 1FNMA 3H4BA 3FCWA 1RT6B 1FJEB 3NAHA 4H4OB 3VZHA 4MJKA 3Q8PB 1WOPA 4R5PB 2DNRA 5E2QA 2WOMB 3OHAA 4MAKA 1VI7A 2CDQA 3C14A 2IM0A 5ITHA 2DXDA 1L5UA 2JNJA 3DOMA 1Q81T 1FRKA 2CIMA 1LWEA 4DV1F 4JI2F 2BA9A 3GMGA 1NZAA 1WORA 1AZSA 2MKHA 3FBFA 5ETQA 4LF6J 1EZZB 1SVDA 3QLHA 4R25A 1RLCL 4MIWA 2WK4A 3GV8B 4ZVRB 2Y1LB 3M7VA 1AXQA 3PEHA 4CLUA 1MMLA 2IVYA 2C42A 5F3TA 5GAGU 1VK3A 4W98A 2ZBPA 3J80U 2FTRA 2BDPA 1TQLA 3PFEA 4F25A 3NGDA 4ZVQB 2UVVA 4DPOA 1HBUA 1IJFB 2DGXA 1NSQA 4JI3F 1GEHA 5J2MA 1SC6A 5J1EA 1WJ9A 4FXVA 3IR7B 5KFJA 2WAQD 5K9FA 3K58A 3M6UA 5F0WA 2CPYA 2C3YA 1WHVA 3EGWB 4LF1A 4C2MA 4YOEA 2WSCC 1GH8A 1VBKA 1S6QB 5F41A 3LO3A 1FDDA 3ENQA 2MLYA 1YQHA 4QWDA 5HK4A 3DGPA 2HVEA 4QIEA 1V3RA 5C42A 5F8GA 2OPPB 4LBIA 4KKOB 1VFJA 3LALA 3UW1A 1RWXB 5BYSA 1S1TA 2C28A 1P27B 3SMZA 2AZ3A 2RDJA 5IV3A 2R2UA 3KHGA 4ANCA 4PQAA 4OZ2A 4RZRA 1CC8A 5ETRA 1O51A 1QUPA 3D2WA 2O66A 3IWNC 2H1YA 4YY3J 3FGVA 3AOCA 3S8SA 3I0RB 2AEFA 3M30A 3J7YI 1D0EA 3MMBB 3PHEA 5A0YA 4WP8A 4PZVA 2W9CB 1MU2B 1MNEA 4CO5A 4UOFA 1FI4A 1FFGB 2DPJA 4RW8B 5HBMA 5LSOA 5BJRA 1FRJA 1OJ4A 1T05A 3BO2A 5G0RA 1HLWA 3MR3A 2QMUB 1S1UB 1RU2A 4MKYA 4PXDA 4B08A 3RR7A 2XS5A 2OHDA 3HVRA 2E9RX 1NK5A 3IGVA 3M6XA 4NRUA 5F8IA 4JUZA 2FZCB 2CJKA 2QL5B 5KFGA 3CPWR 1HQUB 2VF3A 1ZZFA 2ZD1B 4ZPCA 2JSXA 2OPRB 4DQPA 4KSEB 3ZZUA 1EHWA 1DQ8A 3R3TA 3TQ1A 3G6YA 3QATA 2GX8A 2DGSA 3LUYA 3M6WA 2OD6A 5A8WB 2GCFA 2EI5A 4FKXA 3D1OA 1BC6A 3HLUA 2OELA 2CQ2A 1TZ0A 3OL9A 3BKTA 2MKSA 2ATCB 3U27A 3BGOP 1NH7A 1FRHA 3G82A 2HBRB 1HWJA 2OSRA 4DSFA 1VQLS 5H9EK 3O5TB 4PUOA 4B3TF 5L1KA 1BQNA 4KJIA 1HNIA 3PW2A 1HNWF 4OZLA 2RE1A 2FVRA 2AJ4A 3KYLA 1CC7A 3DM2B 3I56S 2BKPA 4X65J 2QV6A 1L3UA 1KSPA 4OZ1A 3J81j 2PMHA 2ZVIA 4FF4A 5KFNA 3IS9B 2JVRA 3BBCA 2XSFA 4ZHRB 2IHR1 4C8ZA 2R7XA 5IOLA 1X4FA 1CJVB 2BW7A 1CS4B 2HIQA 2RIJA 3QZ8A 3NOGA 2MPUA 3BN4A 2AV5A 4A48A 3DRXA 4USTA 4LSNA 2Z30B 3EVWA 2FB0A 3UN2A 2XO7A 5C7PA 4KGZB 2XLIA 4NLYA 4QWCA 4QPXA 2AYGA 4JI7F 4KO0B 2HNZA 2XCPA 3P45B 4P75A 4O23A 4OV6A 2RVJA 1RBOB 3J7AN 2AYBA 3VVTA 1NNDA 2L3MA 1U1NA 1LK5A 5E5NA 4AL6A 2IAJA 1UETA 1J5EF 3RW6A 4NWBA 3QRPA 2YKMB 4ZVEA 3IG1A 4ZP9A 4K2XA 3A3NB 5L46A 2B56A 3UN5A 1MWZA 4JBCA 1UZHA 3KWMA 4HTJA 2B5JB 2FJDB 4KGMA 1U48A 1NHVA 3AOBA 2M3DA 3HHEA 2ASDA 1R27B 3V6KA 4Y6IA 1B7FA 4C4WA 1VJWA 3GG0A 1FK9B 4DPUA 2H5EA 1UVJA 2LYVA 3ENVA 3X1LB 3E3XA 5CQGA 2HMIB 4C0OC 4DV2J 5JMNA 2HHXA 5KFOA 1JLAA 2V69A 1R8AA 2DR5A 4JI0J 1R0AA 4ZLLA 2JLGA 1U02A 1WKKA 3MEDA 2E1MC 3KJVA 4Y00A 3V6HA 3SDEB 4PWUA 3KJQB 5DQGA 3J7ZT 2V63A 2IRUA 4DV6J 1WSRA 5E0OA 3T1HJ 4DPXA 2IJRA 4PRFA 3V2UC 1PG5B 3SZ2A 1SJ3P 2B4PA 2CWKA 2YKAA 3LP2A 3KTQA 1UMJA 5IFMA 1RTIA 3L7PA 4LVOP 4HDHA 4F2SA 2AEMA 1MW7A 4WE1A 4DX6A 2SXLA 1NUEA 1IKXA 4QWAA 1WEYA 4L73A 3OTBA 2BUNA 1RWPB 1I94J 2AF6A 4ZITA 3W2WB 3CCZA 2BOAA 2BRLA 1YRXA 2YNGA 3RRGA 1WKJA 2B51A 2HURA 4GVBA 4NASA 1VBXA 2V4RA 3GYXB 3CJ4A 3QIPB 1Q8KA 3BBBA 2Y9HA 1ELOA 1IKWA 4XIUA 4O4GB 1ZM4A 2GIRA 2NXEA 2QLBB 4KGKA 2V9WA 2QFJA 3Q22A 1Y3KA 4UZCA 4DQSA 5HVFA 1IBKF 3VHQA 1SXLA 2HBYB 2LEPA 1VIXA 5AXMA 1O5JA 5J1NA 2L41A 4TVAB 1Q0NA 4LSZB 4OJGA 2ZOFA 3QT6A 2VG6A 1X5OA 4ZLPA 4N8OA 2MLXA 2RILA 1H98A 4WZMA 4QU7A 2A6MA 1U1LA 3IR5B 2DJWA 3GQCA 2D69A 3HKZD 3DI6B 3ILIA 5U47A 2J7UA 3JQJA 3JTNA 4OLPA 4ZP6A 2PIIA 2E1CA 3POTA 1Q1KA 5KFTA 2VBZA 4NOHA 3HHLC 2HVHA 1AYEA 2MQQA 1WI6A 1R8CA 5ETPA 2KHCA 2J0QD 3BF4A 4LT6A 3FEXB 3BSCA 4DCJB 4JP8A 3WC0A 2FC9A 2R8GA 3N6MA 4FXDA 2RAQA 2H3EB 1CSJA 2KH9A 2C3MA 2W24A 2ACMA 3RAQA 3I87A 4KFBA 1RSCA 3TWZA 2O3DA 4LF8F 4Y2CA 3EDQB 1QSYA 3GILA 4B9VA 2JEJA 1UEUA 3ZO7A 3BSNA 2ILYA 1RTJA 4M5HA 1TAUA 3RBEA 2AGOA 4WZQA 2NLWA 3MHYA 4EK2A 2BANB 2RB7A 3FQLA 1RT2B 4H4OA 2IIHA 2K2PA 1FD8A 2AGPA 2ZBRA 4R5PA 5GAHI 3IAM9 2FZGB 2GHPA 3N6NA 1YITS 2BOPA 2WOMA 3AQPA 2BE9B 5GAEU 2I9SA 3FMBA 4ER8A 4NLGA 4QW8A 2HHWA 2DGOA 1N5TA 4DLGA 4NMXA 2BABA 1EQMA 4EZ6A 2G2YA 1YBAA 4OI3A 1TFYA 1H72C 1RHQB 4FS2A 4A8FA 2ZZNA 4ILLA 3C16B 3BH6B 1Q8BA 2DHAA 4O0IA 3BO4A 1MLAA 3HD1A 4XDCA 3DLBA 3MECA 1GK8A 1Q5YA 5H1SV 1PKUA 5A2QU 5LSRA 4HI2A 3PO4A 5F8JA 1HBMA 4I2PA 3E51A 4X62J 5H9FJ 2A2CA 3K5LA 3CTRA 4KHPF 4U7UK 3UNGC 4HEA9 4WFXA 5JVHQ 4C8MA 5HLFB 4ED4A 3K2YA 4NA2A 2ZM6J 4LF6F 3WQPA 4BBYA 2FVQA 5T41A 3HZEA 1D9FA 3SIPB 5IT4A 1RWNB 4LF5J 1TL4A 2IDLA 4CYUB 1JNRB 4CT9A 1XNRJ 2B9WA 2G2OA 1N52B 3MOZA 5K14B 1BXNA 2NZCA 2KG1A 2VKZG 3ZNUA 1BHNA 2BE2A 2GHWA 3PJ9A 1S6QA 4LR7A 1K0TA 1JB0C 4AT1B 4JYAJ 1YSJA 4LQ3A 4QR2A 3QBCA 2E5HA 1KP6A 2CQIA 3CT9A 1CJTB 2XS7A 2HZVA 1UZDA 3HFVA 4M5IA 1PAUB 1KLNA 2JDJA 4OHYA 3W8GA 3TOQA 3H59A 2M5YA 1RQ0A 2HAIA 4MFBA 4K4YA 2DXFA 2YX1A 5T14A 4ZN1A 2XMAA 4ANDA 1RWKB 2HVIA 2R7QA 2H54B 2MHEA 3QRRA 2DISA 1NLKL 2EEYA 2JOQA 1MN9A 5LJ3Y 2P9EA 1RACB 3KNAA 1TK5A 2CG4A 4HKQA 3MMBA 1YBUA 3EWGA 1KR4A 2BE7D 2JL9A 1X7VA 3LW5C 2CZ4A 3M1VA 1CQNA 2QEXS 2YNFA 4BS2A 4F0KA 3N28A 3EVOA 3RAMA 1S0MA 2I0XA 4YY3F 2F5GA 4P52A 2HVDA 4OHWA 4P7VA 3O6QA 3SCJE 1K47A 4DMZA 3HFZB 2HSEB 2DH9A 5D3GA 4WXWA 3W5YA 3J7A1 4M5DB 4X4SA 1S4EA 1WC6A 2VBXA 4JI6F 3QQCD 3OBIA 1VRQC 1VQMS 3M2RB 2Z57B 1TKXB 4A8QA 1C1BB 2XMKA 1HQUA 3MAAB 2ZD1A 5HVHA 2BX6A 2OPRA 1RK8A 1H73A 1N5SA 4B3RJ 2HZCA 5DDQC 4KYZA 3H42A 3TQEA 4LFCJ 1UVNA 2G1HA 1YJWS 2X1BA 3C8YA 2AX1A 1DTQB 2R3VA 1NKCA 1RT7A 1AROP 2E5LF 3M8QB 5KFSA 1HNZJ 5A8WA 2RD5C 2DNLA 3SCLE 1H7XA 1JLGB 3EICA 2RU9A 3WZ0A 2DR8A 4KAIA 4FS1A 4GO5X 3KDNA 3PIPQ 2LLZA 3HULA 3AJ1A 2QA1A 2DH7A 4O44B 2B8QA 1U1QA 3HO1A 2KM8C 5EN1A 3NLCA 5KG2A 2NSBA 4DS5A 3KLFB 1PGZA 4FDFA 3D66A 2JX2A 1PCAA 4F3QA 2HRYA 3KLHB 5F3ZA 2RQMA 1IBMJ 3NGTA 4URQU 3RB4A 1RTDB 2RS2A 2IA0A 2HWHA 4J9KA 3IS9A 4BC9A 3KHHA 3MOJB 2W7AA 1UEVA 3DLLQ 1DY3A 1YZ7A 2LQ8A 4P72A 1OYEA 4TN2A 1CJVA 3H4DA 3EGZA 1SL1A 6FD1A 1LXNA 1LWCA 3AY0A 1YGYA 1N6QA 2X1GA 4C3MA 3NGKA 1R8PA 4KV8B 1B70B 1QAYA 3CCSS 4UQGA 4QOTA 4USWA 2KU7A 4DR6J 1S7IA 4WU2A 3DLEA 5DZ6A 2D7SA 3CWJA 3MD1A 1N88A 2G0CA 1WC3A 4M5LA 2DNOA 2F8EX 1T9WA 3K17A 2J76E 1V6HA 5D0EA 2ZH7A 3IC1A 2XYPB 3MDFA 4W90B 2ZKUA 2YKMA 2LU2A 1RKJA 4MKAA 3PZPA 1EARA 1Y9OA 3GFYA 4TLRA 1KTVA 1WKLA 2R8JA 4OX9J 1RKIA 3ZZTA 3QT5A 2CNKB 3W62A 4F4YA 2B5JA 1E6YA 4EZ9A 4J9UE 4IFYB 1VISA 4N7TA 3D9BA 3G8SA 1FDNA 1G4CA 4RX6A 2VC1A 1S9GB 4URSA 1FK9A 3L7UA 3K5OA 3HVTB 2UU9J 1Y0HA 4GRSA 1S0OA 5ETLA 3DNCA 2HMIA 2W9BB 4X4UA 4F4WA 3H5UA 1U09A 4F26A 2MQ8A 2LXUA 4M63A 3M9MB 2HQIA 5FD1A 4JOUA 4OYIA 2ZOMA 3L7OA 5KG3A 2WSFC 3MCSA 4UUWA 2VDHA 4DV2F 4USUA 3T41A 2V4QA 3M8YA 1TMJA 2L08A 3OFEA 3SDEA 2KFYA 2R7WA 2XHCA 4HTIA 3GR0A 2J0XA 2RUGA 3TJ9A 1BQMA 5B08A 3G8QA 4JI0F 3S6EA 2ADCA 3HJVA 4OYBA 2ZH1A 4IQMA 1Q8IA 2BQUA 3OT9A 3ZTSA 1QUVA 1WDDA 5C2GA 4OFZA 3VTIA 1S6OA 1WUUA 1H2TZ 4DV6F 3NGRA 1EAYC 1U1MA 3FUYA 1RLDA 4ZVGA 2HFOA 2M52A 1ZOTA 3AA8A 3W2WA 4LF9F 5AXKA 3GB0A 3CMES 5RUBA 4UOCA 4A47A 2QLWA 1RAFB 3J81U 4RLEA 1NRKA 4ZVSB 3KG4A 2CADA 1OMSA 1OS5A 9RUBA 1S9EB 2HRUA 4O4GA 3L3CA 4OLOA 1QAXA 3I31A 4C6AA 3ET6A 1AT1B 4A8WA 1NDLA 2KFZA 2M4MA 4U9RA 2M70A 4TLQA 3R6GB 1IWGA 2IDEA 2VU5A 3J7Z5 4E2FB 3RRKA 4ZPWR 4G65A 1EJ7L 4Y34A 1CEZA 1DTTB 2DY9A 3OVBA 3MMAB 4U8YA 1C0UA 2FC8A 4LRDA 1IR2A 1S0VA 5CA5A 5GADU 3DI6A 2FLOA 1X0FA 1HI1A 4IO1A 2VBYA 3B82A 2Y1RI 1Z4UA 2HQDA 3KLGB 5HJXA 4U7CA 1X4BA 1IN0A 1TFWA 3CUNA 1FE4A 4OYWA 2B9YA 2W2PP 1JLCB 4K4ZA 5EHHA 2GO8A 4CLLA 4CO4A 4RUAA 4IKAA 2BEFA 1NPPA 2Z0GA 3NS6A 2IJNA 5DZ7A 4Y2AA 1XN9A 2AW0A 1BD6A 3MXHP 5LMUJ 1IVZA 2Q6BA 3FMWA 3RBXA 2W8LA 1T0TV 4KR0B 3IBCB 4NXNJ 3T6BA 1GXLA 3VAJA 2OPSB 5IT9Y 3FRZA 2FYXA 4Y28C 1NU4A 4DHVA 3OV7A 2FHJA 2OJ3A 4JV2A 5K20B 3OTCA 2PMZD 1ZPWX 2B4UA 1LNQA 4OZ3A 5HMWA 3AT1B 3GYGA 3RG6A 4WPAA 4NLUA 4DR3J 2Q1LA 1Z1ZA 2ZBIA 3AQOA 3GCXP 4NCAA 2PI4A 1HNXJ 1ZM3A 3SQGB 2UZAA 3PACA 1F9FA 1LWXA 4QIVA 3DDNA 3CNQP 3H2LA 5L1JA 2AMCB 4CTAB 3BSOA 1X9MA 1U25A 3TA2A 2DT9A 2H5IB 3D0GE 3G71S 2EW9A 1T02A 3PW7A 1RCOB 1T8EA 2XMMA 3JQKA 5F8LA 4Z2XA 5KT5A 2MMYA 3HXMA 3DGVA 4FPIA 1IWAA 4AD6A 3Q8QB 4C8NA 3G6VA 2X1FA 2YY3A 4ZN3A 4Y2MA 2DCLA 4P9SA 3HHLD 4FN5A 3I4HX 3OXGA 4DS4A 1YJVA 2C2RA 5CD4H 1IM6A 3IRWP 2MZJA 1FJ7A 2CQ1A 5KT6A 5HLFA 3M2VB 2JFDA 3IFEA 4K5RA 2OO4A 4F2RA 4ZIWA 1BGXT 1R7IA 3FDSA 4H4MB 4P2SA 3QJLA 3QAUA 4DG1A 4H4KA 4IH5A 4CYUA 3CJKB 1PYOB 4X62F 4C8OA 2W2QP 1NCLA 4B9SA 2ZHBA 3IXQA 1N33F 2OUGA 3BEGB 1REVB 2EBEA 1EP4B 2F9JA 2YKNA 4J37A 2ZM6F 4XO0A 3KNGA 2LEBA 2P8IA 2XYHB 3NG8A 1FKOB 3NCPA 4LF5F 2ATLA 1PILA 1N56A 2KYZA 2VFTA 1JMTA 2Z2MA 3CIMA 2V8VA 1JJHA 2V50A 2AHOB 2GW8A 4B17A 2FVPA 3IWXA 3C19A 4NCGA 1MMNA 2WSEC 3SYZA 2CVEA 4JYAF 3VZIA 3MM9B 2J6SA 4EYHB 4DV0J 1UFWA 4Y0FA 2V2QA 1VC5A 3EZUA 5B7WA 3KLIB 2A3JA 3Q2TC 4K2JA 3VAIA 3IA0A 3VAHA 1RT3B 2V2KA 4DF4A 4P74A 3MEGB 3LP0B 2NPIA 4YDDB 3NXZA 5JVGQ 2Q66A 3GFHA 4G3IA 4WIIA 3PV8A 4DV5J 1XMOJ 3A13A 3DLGA 3IBWA 2Q79A 4A8OA 5A8RB 1UAWA 1RTHA 4DR4F 2ZHAA 1NPRA 2RHQB 3W9HA 5KG5A 1BLUA 4NE9C 3M2RA 2XWYA 4F04B 2UXBJ 2PD1A 1TKXA 4PXEA 1C1BA 3MAAA 4B9UA 1I5OB 4F02A 4YN3B 2CQHA 2XY5A 3UE2A 4DL0C 1URRA 1R89A 2VG7B 4RU2A 3D68A 2ROEA 3TUJC 2R7TA 1S77D 2K1RB 5I42B 2LXIA 3M4XA 3DLJA 1V5IB 1JXLA 1PYTA 1NJIT 5FDLA 5CYMB 1UPMB 2GIQA 2LXFA 2O01C 1F0XA 4PEOA 4B3RF 3D6HB 5KFUA 5EWFA 1W7WA 2Y0BB 1RT5B 4L6V3 4LFCF 1Q7YT 5HMZA 2FHMA 1KHWA 2DVIA 4O44A 1HD0A 1HNZF 3IAS9 1YRUA 9ATCB 3TUZC 4DSEA 3KLFA 1S1XA 4OYMA 4RWXA 4ZVTB 3KLHA 3MR6A 2YKOA 2Y1JA 5HAOA 1RTDA 1F5BA 1M0SA 2HPUA 3VAFA 4PG8A 4M5KA 3GV7B 4IR9A 1HQEB 2W8KA 1RT4B 3KFWX 2WTFA 2OD4A 1IBMF 2BYCA 3W60A 2HHHF 5E3PA 3OXFA 4KV8A 2DRAA 1ZTWA 4YFUA 4DV1J 4N77A 1XNQJ 2XWXA 2MKYA 1PSDA 3WHIA 1SQEA 1JXVA 1KFSA 3HKWA 2AX0A 2XY7A 2CPEA 4K4WA 4PWDB 2KVQE 1OQ6A 2V2VA 2VKRA 1QM9A 2GMJA 2RNEA 3EE3A 2BJ1A 2DRBA 1QE1B 1KS2A 1Q53A 3M8PB 4C3LA 1RADB 2ZHOA 1C4CA 4DR6F 4DUZJ 1CG2A 1AZSB 5B0DA 2QX0A 1VQ5S 3HT3A 1URNA 3KK3B 4LIRA 4JI3J 1FWKA 4IFYA 1RB0A 2CA9A 3QLHB 2AYEA 4NLQA 4X64J 2JLFA 4J90A 2DKOB 2EFGA 1S9GA 2G0JA 2PFFB 3FJ2A 3L09A 3HVTA 2DHXA 3FZ2A 4I6YA 2W25A 1NDCA 2W9BA 4V19X 1WC5A 1DLOB 2GQQA 4LRCA 1H3DA 5CZVA 1Q82T 4CM0A 3PW0A 3FQKA 2O5DA 1FXDA 2OLWA 5J1EB 2DTJA 3FSIA 2HLTA 1WELA 4F3OA 2J9DA 4DWIA 2U2FA 3LF0A 3PO5A 2MY8A 3IO1A 3D28A 2CUYA 4JI8J 4ED5A 3AD9C 3DGPB 3TW0A 1TKDA 3C6TA 3UCZP 5C42B 1NZ8A 2QFIA 1VRUB 3N9UC 1T9YA 4CM2A 2VPWB 2KXNB 4YHHJ 1AUSL 2ZH2A 4ZVPB 4RUCA 1YHQS 2GVDB 4O3SA 2HHVA 4Z37A 3B4MA 2C2MB 4YB6A 2UXDJ 1QTNB 1DARA 1QTMA 1BMQB 2VHGA 2APOA 1Y10A 2MEWA 2HVZA 3AH6A 3A3OB 3HCXA 3AB2B 1J2VA 2WONB 2IMOA 2A2DA 5A0YB 3PYGA 5K8NA 4PG6A 2GAGC 1KWMA 1S9EA 1X4AA 4NEYA 2DCUB 4RNOA 2Y8WA 4O0NA 1M5HA 2U1AA 5HBMB 1LV5A 5IT0A 4Q2LA 4DFJA 4OHXA 2HGNA 4EWTA 3A12A 2ZWPA 4LF2A 2WBMA 1NSKL 2NR0A 3KMSA 3BV8A 2XTJP 2AP6A 3BYRA 1QSSA 1Y11A 1WHXA 4V19J 1UEKA 4DDFA 2CJYB 3HHNB 2HFVA 1DTTA 4ZVUB 3MR5A 3C3LA 4I67A 4ZP7A 1UFLA 1B99A 5DM6Q 2PGCA 2DNPA 1N8RT 4O3QA 3LGHA 1SQGA 3BR8A 2E7WA 5KFQA 3DDKA 1VCTA 1UJ4A 3Q8SB 4USHA 3IP0A 1AA1B 2ZFHA 2V0NA 1CLFA 4OL8A 1N36J 1JLCA 3PY8A 2R2TA 3CJTA 1NKEA 2RRBA 4KRWA 2J7WA 1K9MT 1RAEB 1JJCB 3AD7C 3G82B 2QMXA 5EWEA 2RH3A 3MM7B 3QNWB 3TZWA 4OYOA 3W8PA 2ALYB 1VLOA 3OTEA 3AXMA 4PUOB 4I7FA 1BQNB 2MZTA 1WF0A 3EPGA 4OX7A 3VVUA 1OWXA 3R97A 3MPWA 1HMVB 2OPSA 1RAHB 3R6LB 5AXLA 4WTOB 3UR3C 5D4LA 1U7LA 3O3LA 3U1NA 5DM7Q 5GAGI 3BQ2A 3MUVP 3CD6S 3HT0A 5LMUF 3PX4A 4LRAA 2MKJA 2HRTA 1TV6B 1U2FA 1APSA 5HQLA 3OSPA 3T5HA 1FD2A 4NXNF 1RBAA 4FYDA 1L3SA 5BYQA 4RW4B 3SQGA 1KONA 4KH1B 3I9ZA 4B9MA 1AFJA 4OX8A 2MGZB 4OI1A 1R8HA 1VQOS 4ZA1A 5HL7Q 4LSNB 3Q23A 4A8MP 3GTYX 2N3OA 2Q43A 3T5KA 5F8NA 4DR3F 2MDAA 2AD9A 4LR9A 3JQMA 1EKRA 4MT1A 4DV4J 2LU1A 2QL9B 2BZ2A 1SC3B 1V5VA 1S49A 2QMWA 4EYIB 2AJQA 3OVAA 4ECTA 1FEEA 4OJ1A 1T9XA 4P2XA 1ZAWA 3BGUA 4DQIA 3OHBA 4WK3A 2DPIA 1PBAA 3N01A 5MAOA 1ROFA 4W4MA 4ZOSA 2BACA 4DSKA 3A4TA 1WF1A 1XR6A 4M5GA 3HHKA 4BCAA 2Z8QA 1CPZA 4DSLA 4NLXA 4H4MA 1IR0A 3Q8RB 3D3CJ 1JIHA 2DY1A 2BVZA 2HW3A 4EO6A 4ECXA 5DQIA 3P96A 4ECQA 2IYGA 2DNGA 3GIRA 2R8KA 2QTWA 5CHCB 1RZMA 5ETTA 2B43A 3CCLS 2FQQB 1LW0B 1WWHA 1REVA 1EP4A 4DF8A 2ZJRQ 3W3SA 2UVUA 5D6GA 1FKOA 5HMXA 1R0AB 2KXFA 2QT7A 1KVJA 4JV1A 2B6AA 1TMMA 1SJ1A 4WKYA 2CQDA 1KHVA 2YWHA
chains in the Genus database with same CATH topology
4WFXA 2C3PA 5L8RC 1XERA 5EDWA 1X4EA 1FCAA 5JVHQ 4ICLB 1TKTB 3EGNA 4C8MA 5HLFB 3K2YA 4EU0A 5J2PB 3KK2A 4NA2A 4LF6F 1W2IA 3X3UA 2QO3A 2MZ1A 3V6JA 4BBYA 2FVQA 1X8DA 3DCAA 5T41A 3HZEA 2YQ3A 3M05A 1D9FA 4HDGA 2VPZB 1G3OA 2PI5A 1L3KA 5KFIA 5IT4A 3NNCA 1KRPA 2RJZA 3C6UB 1LKZA 2GGPB 3NRBA 1TL4A 1U24A 2GMLA 3DLHA 3TARA 1OPZA 1RTIB 2GMHA 1JNRB 2ILZA 4Q45A 4CT9A 3QO9B 2XI3A 2B9WA 1N52B 4IG3B 4NL5A 1F5CA 3MOZA 3TVZA 5K14B 2COLA 2KG1A 2VKZG 3SXLA 4NCBA 2I2YA 3KLIA 1IJEB 3NCRA 2BE2A 3G8TA 2GHWA 2L9DA 1LWEB 2R8IA 1S6QA 1TKZA 3U1LA 3CCJS 2DR9A 1K0TA 3QWPA 1T03B 1JB0C 1QSLA 4PQUB 1SKRA 1AW0A 4OIXA 5KTQA 1YSJA 1SH0A 1WACA 4OZJA 2NREA 5CYQA 2OPQA 2DNKA 4I1TA 3P3DA 3W7BA 4LQ3A 2AJFE 1HWLA 1ZYQA 4QR2A 2M0GB 2LQBA 3K5PA 4DV0F 4RW9A 3MEGA 2E5HA 2YNGB 4WXOA 2PDAA 2JEFA 1DQ9A 2F9DA 5FLXY 4MYUA 1ZH5A 1DFDA 1Q79A 2CQIA 2DK2A 2JFKA 3CDWA 4ILMA 3CT9A 3HX9A 3QZ7A 1V3SA 4OV1A 2RU3A 2E66A 2XS7A 3NBPA 4CH7A 5SUHA 3TAMB 3OJUA 2HFNA 2POKA 3MM8A 1CVJA 1E6VA 2N4DA 5A8RA 1KLNA 2JDJA 4OHYA 3TOQA 1Q8LA 1IKWB 1CQMA 4AXIA 4NLOA 4OX9F 3H59A 2M5YA 2EFOA 3TA0A 1RQ0A 2XHWA 2HAIA 5AE1A 3CCUS 1SV5B 2UUBF 3PXGa 1A7GE 3MWBA 4MFBA 1NK9A 4EO8A 4ID5A 4J9SA 4K4YA 1HBUB 4TU9A 2YX1A 1RT1B 2XSJB 3W2VA 5T14A 2ASJA 1Y00A 4X4OA 1X9WA 4RWWA 1S76D 2XMUA 5J2MB 3R5CA 5D77A 1K8AT 2HVIA 2IM3A 3OLAA 4NXMF 2R7QA 4UY8T 2VFRA 3JSMA 3E01B 2R7RA 3TYTA 3OR1A 4HHJA 3SSQA 2MHEA 4Y65A 2OSQA 4PPZA 1XMOF 1EETB 1YVFA 3DOKA 3MM5A 2DISA 1TR0A 2JRSA 2XC9A 2ACYA 4I7FB 1ZAXA 3RAXA 2JOQA 2VG7A 3SFUA 1HARA 5LJ3Y 2P9EA 2UU9F 3KNAA 2Y0SD 2CQGA 2ZC3A 1TK5A 2CG4A 4HKQA 3GZ7A 3MMBA 3BREA 2DB1A 2HNYA 1VQSA 2K1RA 2UXBF 3GWCA 3TA1A 3JSYA 1KR4A 2QE5A 2BV3A 2VQEF 3ZZPA 2ZE2B 1WEXA 2JL9A 7FD1A 1X7VA 3LW5C 1VC0A 1NK0A 2CZ4A 3M1VA 1CQNA 2CJ9A 5CYMA 2QEXS 2YNFA 1KEKA 1FDBA 1SL2A 2XNQA 4BS2A 2PSZA 1NJWA 4IG0A 3CF5Q 2KJVA 1UJ6A 3N28A 1XR7A 3RAMA 4F3MA 2I0XA 2RSQA 5LMNF 3SV4A 1S0MA 1RT5A 4YY3F 2VODA 5IQ6A 3WX4A 1U1PA 2MXYA 3C2PA 4OHWA 4P7VA 5KFAA 3O6QA 3S7RA 1XR5A 3ENWA 3SCJE 3KLEA 5CXTA 4B9NA 4CO3A 4DMZA 2DH9A 5D3GA 1S1TB 4MYTA 3RTVA 2I8EA 5CCLA 1Y3JA 4QYZJ 4F4KA 4WXWA 3J7A1 4M5DB 3DOLA 2XZWA 5I3UB 2YWGA 4X4SA 4ECSA 1M5SA 2VBXA 3I32A 4ED8A 1NH8A 5F9LA 4J9LA 4ELUA 2DD8S 2JLEA 2EG1A 4JI6F 3OL8A 1SL0A 3OBIA 4OMFG 1Y4ZB 3IR6B 4N8NA 1VQMS 3M2RB 1YJRA 6FDRA 2XLJA 3PEJA 5EUHA 4DBQA 7FDRA 3OR2A 1TKXB 4A8QA 3TI0A 1C1BB 4D3HA 2XMKA 3T5JA 2QSFA 1HQUA 1ZPVA 5F0UA 4A8KA 3MM6A 1GTHA 5DG8A 4J9RA 3QMQA 2ZD1A 2DNQA 1P6TA 3DLKA 2OPRA 1W25A 4J9PA 3O1LA 1VBYA 1KQFB 4WFYA 1RK8A 2DIUA 1N5SA 4WYLA 3UI3A 4ZCLA 2I38A 3K5MA 2HZCA 2HYIB 5DDQC 1NJZA 5D4NA 2QLXA 1R3NA 5EX3A 2VD3A 5B0GA 5B0CA 2VPYB 1UVNA 3MEEA 2ZZMA 1C2PA 3M30B 2YVSA 3AJ2A 1YJWS 3PRDA 2X1BA 3C8YA 5IQQA 2AX1A 4FZVA 1DTQB 1NKCA 1IKVA 2IRXA 4CZCA 1RT7A 1AROP 3H5YA 4RKUC 2E5LF 3M8QB 3N5FA 5KFSA 1HBOA 4AE5A 3PR5B 3H25A 3G4SS 2VZ9A 1Y5LB 2DR7A 5A8WA 2RD5C 4X4VA 2A1BA 1MROB 3ISND 4L72B 2FVSA 3R1HA 2DNLA 2MQPA 4J9MA 3SCLE 1H7XA 1JLGB 2UUTA 4ETZA 5L39A 1T05B 2OMLA 4FBTA 3HK2A 1HQEA 2RU9A 5G0RB 3CD0A 4CNYA 1HA1A 5THWA 3WZ0A 5A8KA 2DR8A 1VGYA 1RTJB 3CEDA 5DETA 3OUYB 2XGPA 2OKQA 2UVWA 4KAIA 1S6PB 4IH7A 4FS1A 5E3RA 1L3TA 4GO5X 2RRAA 2XLKA 5KFCA 3SV3A 3PIPQ 2LLZA 5M2RA 1R6YA 3J80Y 2KJWA 2E44A 3PM9A 1SJ4P 3M9OB 3AJ1A 2QA1A 2DH7A 5LSLA 3MTJA 4ED6A 4C8YA 4O44B 2OH2A 2XB2D 2C22A 3H98A 2KO1A 3OL7A 1U1QA 4XPCA 1RA6A 1TL5A 3CCMS 1SBRA 1F60B 5KT3A 3HO1A 1N4LA 5E3QA 2RQ4A 1S6UA 1XWLA 3DRRB 2LEAA 3NLCA 5KG2A 2KM8C 5EN1A 2NSBA 1Q7LB 4D3GA 1XBWA 4DS5A 3MMAA 3KLFB 1S48A 1H2UX 2KDOA 1PGZA 5DS7A 5E3AA 4GMKA 3MR2A 1HPZB 2G9OA 1S10A 3DN9A 4PWDA 2MB0B 2JX2A 3T1YF 5HMYA 4CQ1A 2RDIA 4F3QA 2HRYA 3E2EA 3D1HA 1VBZA 1D8YA 4OZ0A 1TP7A 4QR1A 2QRRA 4TXSA 5KOWA 3M9NB 4Q8FA 1O0PA 2QIFA 2R7UA 5DQHA 3KLHB 4DN0A 2F1FA 3M2UA 1QE1A 3ITHB 5F3ZA 4DV7F 3OTDA 3U1MA 2JVOA 2RQMA 1WG1A 3M8PA 4K0KF 4KHRA 4ZCMA 1Q78A 4URQU 3UD4P 3ICLA 4I2QB 5J2NA 2UUAF 1XNQF 2EC0A 4DFMA 1JXEA 3A1YG 3OFFA 3RB4A 1X4GA 1RTDB 3KLGA 2RS2A 2IA0A 2GNKA 5KFMA 1GXTA 2HWHA 4J9KA 3IS9A 4QJVA 5DDOC 2BQ3A 4BC9A 3GIIA 2RS8A 3KHHA 2W7AA 2IM1A 1UEVA 4USIA 4FPRA 3TRGA 4CH1A 3DLLQ 4DSJA 3THTA 1JK9B 1IQZA 3KK3A 1P9QC 1IBLF 1HBNA 2QSWA 1Q16B 1YWXA 2FJBB 4H4KC 1HYSB 3G96A 4M8LA 1D9DA 1RGVA 1LWFA 4YB7A 1WHWA 3SFGA 5HO4A 4E0DA 2B7CB 2NS1B 4TN2A 5KG4A 4EEYA 3H4DA 3EGZA 3MECB 4ZPBA 3WDOA 1SL1A 6FD1A 1LXNA 1LWCA 5CH7B 2VFSA 2B6AB 1YJTA 4AXJA 1M5PC 1B0VA 3AY0A 1YGYA 1NK7A 1HBMB 2FUG9 4I2PB 3PNIA 1RYRA 2YNHA 1N6QA 2K8GA 2X1GA 4MMOA 5KG6A 4NYPA 1LXJA 4C3MA 1N0VC 2FPHX 3OW2R 4DR7F 2E1AA 3NGKA 1R8PA 2P9GA 4KV8B 3LGMA 4DUZF 1QAYA 3TNVA 4ECWA 5H9EJ 2BM0A 1DLOA 3UPFA 4ILRA 3CCSS 4U67Q 4UQGA 4OI6A 4NMLA 3PIOQ 2ZH5A 4KT0C 4QOTA 2OFHX 1ZBTA 2KU7A 4XK8C 4ETXA 4ZCIA 4KTQA 4WU2A 3DLEA 4ZPDA 3Q0AA 2D7SA 5KFRA 1HNIB 1S1WA 5LL6d 4TQRA 3CWJA 3MD1A 3UDLA 3NNHA 1N88A 4M1KA 1Z2LA 2G0CA 2W4PA 3KKFA 3NCQA 3HHLA 2OTJS 5G4DA 2MZQA 5IM0A 4QIFA 4X64F 1HHTP 1JLFB 1WG5A 1FRIA 2IJFA 4I4BA 1LFWA 4BC7A 4C11A 2DNOA 5F8MA 3KHRA 2F8EX 2CQ0A 2YTCA 3RW7A 3HFKA 1RISA 2J76E 1V6HA 3JB9k 2ZH7A 3IC1A 5EGYA 1YG0A 3MDFA 4DR1F 1KNZA 1FJGF 4W90B 2ZKUA 2YKMA 2KYXA 2LU2A 5KFDA 2HFZA 3CGIA 1RKJA 1JJ2R 2BE2B 4ED0A 4MKAA 3PZPA 3LP1B 1Q4RA 1Y9OA 3GFYA 1TKZB 4TLRA 1KTVA 2L9WA 2R8JA 2W7OA 2HWIA 1FE0A 3KG0A 1RKIA 2YKPA 3ZZTA 5LT5A 3QPIA 4N41A 4WU3A 2E5JA 5CYQB 3B78A 3H5SA 3MOJB 3FCHA 4NRTA 4F4YA 2B5JA 1E6YA 4EZ9A 4ZPTR 3DXSX 4IFYB 5AXNA 4WFNQ 1N5YB 2HGMA 1C4AA 3C46A 4YR3A 3BQ1A 1VRUA 3I6PA 1KD1T 2ZH9A 1T7PA 1LOUA 2EFNA 4LVNP 3SI8A 1VS3A 2DHGA 1HWKA 1SJQA 3J7YU 3G8SA 2Q3PA 1FDNA 4RX6A 2N7YA 2VC1A 2GJIA 2EFPA 4IO9Q 4ZPAA 1S9GB 4URSA 1FK9A 1YRTA 4JI1F 3F73A 1G6BA 3K5OA 5KAKA 4Q5VA 2MQMA 3MM8B 3HVTB 1E6VB 1DHMA 4CTAA 1Y0HA 1S0OA 2BBEA 2EK6A 2MHNA 3OSNA 3DNCA 4A4JA 4QW9A 3MEKA 2HMIA 4ED3A 2FGOA 2W9BB 3M32A 4X4UA 1HWIA 2M7SA 4JI8F 2ZJQQ 4F4WA 3MUTP 3H5UA 4MFBB 2HNZB 2I5JB 1SJFA 1FTRA 1UWBA 2C2EA 4JI5F 2D74B 3BZQA 3DRSA 3K0JA 1HNXF 2HLUA 1U09A 4F26A 4WJBA 2C3OA 1NK6A 4ES2A 2LXUA 4M63A 4PKDB 3M9MB 1HNVA 2HQIA 4IH6A 2VFVA 3VF0B 5FD1A 1N48A 2DGQA 4C0BA 4K4XA 3NMAA 3MM5B 4QIWD 4JOUA 4G6VB 4YHHF 1JKHB 2FDNA 4C7QA 1RP5A 2ZOMA 4NZ7A 4GKJF 5JJBA 2LQ9A 3L7OA 1IKYB 3H5XA 2IAJB 5KG3A 2WSFC 3MCSA 4EUVA 4DL7A 1NB7A 4UUWA 1QAJA 5KFFA 1ZTTA 4LQ9A 3GV5B 5DGAA 2WONA 4DV2F 2V4QA 1UA1A 3IG1B 2OTLS 2F3JA 4BDPA 2L08A 3OFEA 2PE8A 3SDEA 4CCHA 4OJHA 2KFYA 2R7WA 3EX7B 4AUKA 2UUCF 1FRLA 3VR1A 1ZM9A 3GIMA 2UXDF 1G1XA 4HTIA 3M1VB 5C24A 2YNFB 3KMQA 3GR0A 3EYZA 3FRYA 2J0XA 2RUGA 1U49A 1BQMA 2IFXA 5B08A 3G8QA 5A2QY 1RT6A 2PO4A 4DSIA 2NUHA 1UVIA 3M2VA 4JI0F 3S6EA 5IWAF 4HT5A 2ADCA 1VRTA 4HI1A 2X1AA 3JSBA 1KQGB 2HHQA 2ZH1A 1HL6A 4ID8A 4IQMA 2PN6A 3KLEB 1S99A 5SZTA 4OI0A 1PC5A 1NAQA 1U6BA 2IRYA 2M2BA 1BY9A 4K5SA 3TAQA 1Q8IA 5D3GB 3VAGA 2ALZA 4MH8A 2BQUA 1DJ0A 4PG7A 1JLQB 2KVIA 4KIAA 1W2BR 2FLLA 5KG7A 3CB4A 3ZZ0A 2EK1A 5KG1A 2HS0A 5HP1A 3CJKA 2JHEA 1QUVA 4OFZA 4QWBA 3JYTA 4ES1A 3VCDA 3ULHA 3VTIA 2HNDA 1VHFA 4IDKA 4K4VA 3DXBA 1S6OA 2VPXB 2UUWA 3ISZA 2B3TB 1H2TZ 2LA4A 4DV6F 3GYNA 4URGA 2M8HA 4B3OA 3OR2B 2CPXA 3BQ0A 1U6ZA 2YX7A 1U1MA 1FDAA 4K4UA 2J6TA 2CQ4A 1VOMA 3V4MA 2FJVA 4F8RA 1JLAB 3Q2SC 4ZVGA 2HFOA 3DLKB 2M52A 2VL1A 1UA0A 4C8LA 1ZOTA 3AA8A 4HVZA 1GX5A 3W2WA 2MQOA 4O3RA 2RMLA 5HI7A 2XNRA 4LF9F 5AXKA 3GB0A 2W4CA 2GJ2A 4ZKAA 3CMES 2VOOA 4UOCA 5JXSA 1JX4A 4A47A 2QLWA 2WBRA 2YWEA 5L1IA 2KT5A 3UQSA 3TVYA 1KN6A 1NHUA 4RLEA 5B0FA 3MURP 3GR1A 1NRKA 2QA2A 3HM9A 2RKIB 3MEDB 3KJVB 3KG4A 1FRMA 1RT7B 2P6TA 4C3KA 3MTKA 1HBOB 3CDAA 1GX6A 3OXLA 4CO2A 2VQFF 1QJHA 2HS3A 1OS5A 5GAEI 1S9EB 1FERA 2HRUA 4O4GA 3L3CA 4GKKF 5LXRA 4OLOA 1TL3A 1QAXA 2DITA 2L9NA 3JTOA 3I31A 3BJYA 3N4WA 3H2UB 2Q6CA 2GFFA 2GC8A 4RNHA 3CJ2A 4ALZA 2JC0A 2WHOA 4PG5A 1U8SA 5C25B 1FKPA 4A8WA 2OP5A 3QWUA 3MM9A 2KFZA 2FLPA 2M4MA 4U9RA 4X4PA 4CIOA 2VA2A 1MWYA 2CPIA 2M70A 4X4TA 4TLQA 3OJSA 1VIOA 2FHJD 2YNIB 2JC1A 2UVRA 3MM7A 3RB6A 3ZZOA 3LP2B 1U47A 2BW2A 4EBDA 4I56A 3J7Z5