3SQOP

Pcsk9 j16 fab complex
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
92
structure length
92
Chain Sequence
TATFHRCAKDPWRLPGTYVVVLKEETHLSQSERTARRLQAQAARRGYLTKILHVFHGLLPGFLVKMSGDLLELALKLPHVDYIEEDSSVFAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/immune system
molecule keywords Proprotein convertase subtilisin/kexin type 9
publication title Proprotein convertase substilisin/kexin type 9 antagonism reduces low-density lipoprotein cholesterol in statin-treated hypercholesterolemic nonhuman primates.
pubmed doi rcsb
source organism Homo sapiens
total genus 22
structure length 92
sequence length 92
ec nomenclature ec 3.4.21.-:
pdb deposition date 2011-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF05922 Inhibitor_I9 Peptidase inhibitor I9
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.80 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Peptidase S8 propeptide/proteinase inhibitor I9 3sqoP01
3P5BP 3CO0P 3T41A 4JP8A 2QTWA 2Z30B 3A3NB 3WIVA 3BPSP 1R6VA 4OV6A 2Z57B 2W2QP 3GCXP 3BGOP 2W2MP 2XTJP 2Z58B 1SPBP 1ITPA 3SQOP 2ZWPA 2W2NP 3A3PB 3A3OB 3QFHA 3H42A 3GCWP 4NMXA 4YN3B 2Z56B 3AFGA 3WIUA 2E1PA 1SCJB 1V5IB 2W2PP 3VHQA 3CNQP 4K8RA 2PMWA 2ZWOA 2Z2YB 3WHIA 4NE9C 3VV2B 2W2OP 2Z2ZA
chains in the Genus database with same CATH superfamily
2DNQA 3TRGA 2I8EA 4K5RA 1JLQA 1J2VA 4IH6A 3D3BJ 1WEZA 4N8OA 3MPUB 2DNRA 4ERDA 2GGPB 3MFIA 1FWKA 2JC0A 1IKYB 2I5JA 2K1RB 3TVKA 2AYEA 5E7OB 2CWXA 3HP6A 4PQUB 3N6NA 4TU7A 1FT8A 2E1RA 1CJUA 1JXEA 2EG2A 2OPPB 3I96A 4LFBJ 4ZVRB 2UXCF 4OX9F 1Z4UA 4OI1A 4LR7A 3D5MA 4PRFA 2MB0B 3FZBA 1EB0A 2DGUA 4UUWA 4KBIA 4F0KA 2R4FA 4I68A 5KFQA 2XHWA 1OS5A 3RAMA 3BYPA 3TOQA 2VG5A 3CEDA 5AXMA 1H2UX 3GMGA 4DV7F 1S48A 1D8YA 1W25A 2QL7B 4JI7J 2BABA 3DM2A 4O3QA 3DDNA 2AF6A 3SMZA 2VPYB 1XWLA 1SJ4P 3ZNJ1 2YQ3A 4USHA 4IG3A 3GSDA 5LJ5Y 4EBEA 2NZCA 2R7TA 3GTYX 1L3KA 1RADB 4F7VA 2RU9A 5THWA 2NXJA 1K0TA 1X4GA 4N8NA 1R8BA 2ZEJA 3DLLQ 2DCUB 1LW2B 4ZP7A 4BLGA 1JLCB 2OSQA 3Q89A 3NCRA 4PG4A 3DMJA 4K59A 3M2UB 2H5IB 2FDNA 4TKTA 3CDEA 3SV4A 3GYGA 5M2UA 4A8YA 1RT3A 2JJ4D 1FFWB 3Q8RB 3JAMY 4JI8F 4XDCA 2LA6A 3HMJG 1AXQA 2XYHB 3BQ2A 4ZPTR 2R8HA 4MJKA 2R42A 4CT9A 4P7VA 1TMMA 1NPKA 1KP6A 4JV5F 1JLQB 2AV5A 3CW2C 1Q8KA 3V6JA 2ROEA 2HWHA 2EKNA 2QLWA 4JI5F 4TY8A 1VQ6S 2DEJA 1UPMB 2FTRA 1PBUA 2XLIA 1LWEA 2UZAA 2I5JB 5KFMA 4FKXA 4AXJA 3WIUA 4Z7CA 2JC1A 3ZTQA 2AD9A 5I42A 3QPIA 5KAKA 5A8WA 3OV7A 1AZSA 2MXYA 2FLLA 2V4JA 4E2FB 2HW3A 2BKOA 1K73T 3SSQA 1M5SA 2ZE2A 2VG5B 2HNYA 4WXOA 3DN9A 4ANEA 4PXCA 3LW5C 3RJMB 2HHHF 1K1SA 3DM2B 3FSYA 2HFOA 3LP0A 1XMOF 4YY3J 4IG3B 3WIVA 4U8VA 2MJNA 4CI0B 1SJ3P 3O6QA 3A8IA 4FF3A 3CIZA 1NSQA 3GIJA 3U1LA 4IR1A 5GMDA 3X3UA 4L76A 1F2GA 4WE1B 3DMJB 4PG6A 4X4NA 3GLJA 1RU1A 4X66F 2ZZNA 2V67A 2YVSA 2HS4A 3R7NB 4USWA 5KFPA 2QN6B 2D74B 1RT3B 3R2CJ 1UWBB 1Q81T 3QGHA 4U9RA 2NXCA 5AXNA 4J91A 3GG0A 1KQFB 4LSZB 2XSFA 1HNVA 3DDIA 2C2MB 1R7IA 1DJ0A 3PVXA 2DRAA 3AA8A 2C3OA 5ETPA 4GKJJ 3AB2B 1U24A 1SKUB 1FVSA 1EP4B 1IBCB 2E7WA 3PW4A 2RHQB 4JB8B 2Y3YA 4TY8B 4Y2MA 2FPHX 3H25A 1OMSA 1N5YA 4DS5A 4HDGA 5D15A 2MKCA 2WHOA 4YP3A 4Y2IA 1RTHA 1NDCA 2DIVA 2ZOFA 4F4XA 2IBOA 3EVMA 2ILZA 2KYZA 4DSJA 3NGKA 5I4MA 4KY3A 2QZ8A 2OPQB 4ZVOB 2DGOA 3W2VA 2V4JB 5HROA 1LQ9A 2D9PA 4RJVA 5IT9U 4URSA 4QIEA 2G0JA 2IRYA 2K8GA 2QLXA 3T3FA 5HK4A 4A8OA 2ZE2B 2HNYB 2PIIA 3UDCA 3C6UA 2C2ZB 2GHVC 4I64A 5KT2A 4M63A 2C2EA 2AZ1A 3QRRA 2D1CA 4G1IA 3LP0B 1UAWA 3CO9A 5IFMA 1KFDA 4C6AA 1YZ7A 4NASA 3W64A 3HM9A 3WHIA 3IA0A 2CJXB 5C5JA 1WHXA 4FS2A 4DPXA 3P8BB 4F25A 3OPKA 2UVWA 1X4FA 2IJNA 5DQIA 2AGQA 4QZVB 3EE3A 2AMCB 2HFVA 4JI1F 2NCKL 4XTTA 2ZD1A 2VUGA 2NREA 3HXMA 4P2SA 2DHAA 4TVAB 1MWYA 4DN9A 1HPZA 4HDHA 1BQMA 1VQ5S 3TYTA 2Q6BA 3BB5A 1WKKA 3N28A 3MCNA 4BDPA 5A2QY 4OHVA 4GC7A 3QT6A 1C1CA 4ED1A 4O0NA 2F9DA 4UF4A 4RNMA 3KMQA 2HEKA 1WOSA 1X4AA 5ETLA 5KFHA 3CC4S 5IM0B 3G71S 3TZZA 1PIEA 2B6AA 1X60A 1LEOA 2VBZA 3L4BC 3O8WA 4C4WA 2GMLA 1YRXA 1GX5A 4JV0A 4Q5VA 1N5YB 3CGIA 4MKYA 3SZ2A 1RTHB 3W65A 3CB4A 2HBRB 2RQMA 1IJEB 4TYBA 4DUYF 2M2BA 3FQLA 5KFYA 3RYLA 3W2VB 1RWXB 5HROB 2WVFA 2C2DA 2LFVA 2BE9B 2Z2LA 3I5BA 1U1KA 1GT8A 3NS6A 5K14B 1S1XA 2V2QA 5LMNJ 1RAHB 2LXFA 3C6UB 1YITS 4KB7A 1HA1A 3A4TA 4G65A 3IWNC 4LF9J 3GWCA 3LQVA 3V2UC 3O44A 1HQEA 2EW9A 4QR2A 5EWGA 4TU8A 3FNNA 1TL5A 3RB4A 2BE7D 2LQ8A 3P49B 2RRBA 2DJWA 4EEYA 5HO4A 3BR9A 4DX6A 4U7CA 2CQPA 1BGXT 3D7SB 1S0OA 5I3QA 1GFWB 2ZD1B 3PR4A 4DWIA 4NL5A 5A2QU 1M90T 1HPZB 1AA1B 3C14A 1BQMB 4DZ6A 2DNZA 3HVWA 3PYFA 1JB0C 1RGVA 2OHDA 4F4AA 2PI5A 2BJ1A 2JFKA 1N48A 4BWMA 2BKNA 1PYOB 1SJQA 2PT0A 3MUMP 2FVSA 1CPZA 1PC5A 1WUUA 5CQGA 2M8HA 3IBWA 1PJ6A 1T11A 2E5IA 3D2WA 2CPHA 4AL7A 1DRZA 3N4WA 5ETOA 3R5DA 3IGNA 2B6AB 4DX8H 4R5PA 3AOBA 4L3KA 1HWKA 2W2PP 3HKZD 3OR1B 3CC2S 5HN0A 1XQIA 3HHLA 3BN4A 3PW0A 1X7VA 3I4HX 3TO8A 1URNA 4RW6A 4P75A 3T1AA 2QA4G 4PG8A 3PRVA 4RPFA 1GTEA 4FPIA 1KVIA 3AXMA 1VOMA 2R7OA 3MFHA 2AIRB 2B7CB 3T1YJ 4M1KA 1KTVA 1XK8A 1S1XB 1WC3A 1NK9A 4JI7F 3MI7X 4R0JA 4B3OA 2R7WA 1JK9B 4CRJA 3H90A 1BC6A 4EYHB 2E5HA 3D0HE 4DL4A 3BM7A 3ZZTA 2DH8A 4B3SJ 1GXLA 1NEEA 2YWWA 3LGNA 2DIUA 5E3RA 4I2QA 2CPFA 1UP1A 3NGRA 5KT6A 2CDRB 1HI8A 1SH2A 1IQTA 1N52B 4C8MA 1UJ5A 3IXQA 2OELA 2OTLS 3M9NB 2V6AA 4LJMA 4YN3B 2YNFA 4PPDA 4ETXA 4X4RA 2E9ZA 1JJHA 2KJVA 4ZPAA 2ZH3A 1WACA 5J2PA 2VKRA 1SC3B 1YBTA 2AYGA 1NZ8A 3RU0A 3THPA 2VG6A 4ER8A 3W5XA 3VAKA 5CABA 3ET6A 4YEAA 3LO3A 3CJ8A 2ZFHA 1E6YA 3B4MA 4OYPA 4QBUA 3BN7A 2NPIA 2OD4A 1YWXA 3M8QA 3AJDA 2EEYA 4G6VB 3JXOA 3MEGA 5HL7Q 3U27A 2RQCA 2J7KA 3NS5A 4R5PB 5CCLA 4OHZA 4A8SA 3I82A 3CDUA 3HHLB 1J5OA 2XY6A 2BEFA 2OTJS 4RW6B 1AYEA 3MPYA 3M8WA 2G2OA 3L7UA 3K5OA 1R89A 5KFXA 3LPYA 3KYLA 1BWVA 2KI2A 4WFYA 4QWBA 1HNIB 3IR5B 3HD2A 2BM0A 3EDRB 1G4CA 2DNKA 3MOJB 4B3OB 2YH0A 3TWZA 4I56A 2H1YA 3N9UC 4DBQA 3VAGA 4DV5J 4CP5A 4DU7A 4MH8A 2Q66A 4AD6A 5IV4A 4I2QB 4IH5A 4AUKA 2HHQA 1NKEA 1IQZA 4CH1A 1GEHA 4FYDA 2RUSA 3CMES 1NBEB 2G2ZA 3GPAA 4MAKA 1NNDA 4PYDA 3SQGA 2FJDB 4F2SA 2R7QA 1U1LA 4CO4A 2ATLA 5EDWA 5J2PB 4OJHA 3HT3A 2CQ2A 2AJ2A 1U1MA 3KDNA 2MQPA 2RUGA 3HHKA 3CCJS 5BR8F 2XM3A 4K5SA 1X31C 3IRXB 1TAUA 1VJWA 3BREA 1E6YB 2MZ1A 4KHPJ 2RILA 2PMZD 1XERA 3JSRA 3M8QB 5IOLA 4GKJF 3W2WA 4TLRA 3QRPA 3KKFA 4P7TA 1NSKL 4C8NA 4FF2A 1RT4A 3C3LA 1HWJA 2EFQA 3M2RA 4OZLA 2B9WA 3EGWB 2ZDOA 3SSRA 4JV1A 1J5OB 4DCJB 2PD1A 2Q43A 3H2UB 3U1NA 3CC7S 2VBXA 3MAAB 2R7RA 3F44A 4GRSA 1DFDA 4CO5A 1WOOA 3PXGa 2UP1A 2XSJA 1JJ2R 1U2RA 1UA0A 2MZSA 1REVA 3J7Z5 2BOAA 2B7BB 4LFAJ 3FCWA 4IFVA 3H5SA 1DHMA 4I1TA 2MZRA 2KZMA 3MM5A 5F8GA 3V4IA 2MQMA 1X9WA 2CNKB 2UUCF 2R2SA 1RHMB 2ZKTA 2X7IA 5D4NA 2AJQA 4FKYA 2XMTA 2K06A 4LVOP 3TUIC 4ZPCA 3I4PA 4ZPBA 3F41A 1M5HA 2FC8A 3D0IE 9RUBA 1TUGB 2IIHA 1HNXJ 4URQU 3SQGB 1NJXA 3MCSA 3H0PA 3H20A 3PW7A 4DU8A 3RGIA 2D41A 3VQTA 2HHPA 4IO9Q 2IDEA 1NHUA 2RU3A 1NB7A 5EX3A 1NK7A 3MWBA 4MIAA 2RF2A 2DVIA 3QAUA 3R5GA 2HQGA 1Y4ZB 4FDFA 1U47A 1RYSA 3GCXP 2UU9F 4OJ1A 3I6PA 3P96A 3W2WB 2DISA 2RQKA 2E5LJ 5A76A 1FDDA 3AXKA 3TUZC 2OI2A 2E9TA 4CLFA 1T9TA 3M2RB 1RHQB 4DV2J 2WONA 4G3IA 1T9VA 2KHCA 4DQQA 2ILYA 2EPIA 3M32A 1UVLA 1XNRF 5KFJA 3FEXB 1HNZJ 3AA9A 2PFFB 1LV5A 4BC7A 5JVGQ 4HEA9 2XSJB 3W66A 3BV8A 2R2RA 2XS7A 1REVB 3OBIA 1UVIA 3IBCB 4WTYA 4WWSA 3R7BB 5LMNF 4YR3A 2QRRA 2MKJA 4ZPWR 1LXNA 2EFOA 1RT2B 2HBQB 1RZMA 4F0MA 4OYMA 1WDTA 3MM5B 2ZUAA 3V4IB 2CWKA 3NP5A 2W01A 1ACMB 1O6XA 2KM8B 1GXTA 3H8YA 1P6TA 4CCHA 3TX0A 4Y2AA 1KBRA 5CYMB 4WU2A 1X4BA 2PMWA 3S1TA 3M7VA 4HTJA 1U49A 3NNAA 1GMWD 2MQLA 3HCXA 4KJIA 5FJ4A 3H2LA 3PJWA 1UL3A 3MEDA 4AL5A 5KG6A 2B4UA 4ZCMA 1WNEA 2B4OA 2FUG9 5B09A 2QMWA 3JTPA 1NK8A 4Q0BA 4MFBA 1FDBA 1C2PA 3IR7B 4P6QA 1YI2S 2FZGB 1FD2A 3VGTA 1R8CA 5KT3A 3IM9A 4LRAA 1Y11A 3CCTA 3HVAA 3PYGA 3AD7C 4CNYA 4YDXA 4QU7A 3HT0A 3KUHA 3M32B 3GIKA 3BQ0A 3PR5B 2J0QD 2BANA 1M1HA 3PTWA 2KM8C 4OZ0A 4NE9C 4CLSA 3ENWA 3BH6B 3GFXA 1SJFA 2QL5B 2AJ0A 1H2TZ 4A8KA 2KRBA 5A8RA 4F36A 4TYAA 3T1YF 1ITPA 4R0EA 1CJVA 4KRWA 5ETMA 5DRKA 2V8VA 5G0RB 1QLNA 4B02A 4KGMA 4AQYF 2H5EA 3I32A 3FKBA 4U96A 2AYBA 4ED2A 1KQKA 2ERRA 3QT8A 1U45A 4UY8T 3IC1A 4MIWA 1UJ4A 4FP9A 2MKKA 3J7YU 2VBYA 3RTVA 2HKEA 3FGVA 2QLFB 4B3RF 3AOAA 4ID5B 1XJWB 4F02A 3JSMA 3BO4A 3MM8A 4LBPA 3TVYA 5DGAA 1K44A 4RR5A 2XGPA 4OX7A 1HARA 2IM1A 4PG7A 1RWOB 2GAGC 3G82A 2XS5A 3WQPA 4NLOA 1EAYC 3MUVP 1IN0A 1SH0A 3K7RA 2W2NP 4L3NA 3GIIA 1RHKB 2NQPA 2FZCB 4NZ6A 2IAJA 1X4CA 1N88A 1S6QA 3BPDA 1ZM3A 5A6PA 5L9NA 1YTYA 1WOPA 4Q0BB 4YB6A 2J0WA 5J2MA 3CULA 2CYYA 2KG1A 4UW2A 2CNOB 1SH3A 4DV1J 2VC1A 2LXUA 3QAEA 4Q8EA 3H59A 3KJVA 3M8RA 2ASLA 1OO0B 1SIWB 2XI2A 3EXYA 1BMQB 3DRXA 4NLXA 4WJBA 4GO5X 2PN6A 5HJYA 3CIMA 4NRUA 4UTGA 2B9EA 4CLUA 4ECRA 2QIFA 4W90B 3G8QA 3PYEA 5A8RB 1X4HA 3Q23A 4D3HA 5KOXA 1SIZA 2B5JA 2GC8A 4IR9A 1CJVB 3DOMB 1Q8IA 4OIXA 2G0IA 3CJ5A 4NX9A 3H42A 2D9OA 4P73A 2R7UA 4DPUA 1SC6A 1IXKA 4DV5F 4CLLA 4MIBA 4RU2A 1U2FA 3QIPB 3IGVA 4ZHRB 2ZZTA 2M0GB 1EZZB 5HP1A 4K4ZA 2LEPA 3MMBB 1KWMA 1Q53A 5FLXY 3JSMB 3VV2B 2VQFJ 1LKZA 2FVRA 1ZAXA 4ZIWA 4K4WA 2SXLA 2BM1A 2EK1A 3FCHA 3WC0A 3BSOA 1V3RA 3TAMB 1RAAB 3HULA 1FD8A 1WF2A 5KFVA 1WG5A 1S77D 4RU9A 5SUHA 4U6PA 1ZTTA 5F8LA 2IAJB 1FNXH 1S6QB 3OXLA 1AW0A 2QC3A 4KHPF 1KNZA 5D6GA 5DDPC 2RJZA 5J2MB 1FJCA 1WSRA 4RL1A 3PJ9A 3BGOP 5J1EA 3PKMA 2MZTA 2N3LA 4KGVB 5EHHA 1X9MA 1HYSA 2K7JA 1VQ4S 5I3UA 3BDEA 2CJQA 3KJVB 4RO0A 4DI6A 4J9RA 4IRDA 2GS8A 1U8WA 2PSZA 2BQUA 3NY0A 4CIOA 2BKPA 4PCQA 3VTIA 3F0NA 5SZTA 4DR5J 2OEKA 4XPEA 3DLEA 4JYAF 4DPTA 4PZVA 2EC2A 5D4LA 4X4PA 2B5JB 2ALYB 3PRBA 5IXUA 2NYIA 4LFAF 2M3DA 4FBUA 1NRKA 1V5IB 1RCXB 4L74A 3DGVA 3GFZA 2ZM6J 2W7OA 4UOHA 4ANCA 4E8UA 5ITHA 2MTLA 1N34J 1RT6B 2YKOA 5B0GA 4QIGA 1RKIA 4B9TA 5HP1B 2MLYA 2L08A 1K1QA 4NLYA 3OSPA 4NOHA 2Q6CA 4IH7A 1HHSA 2Q1LA 5JMNA 2DHHA 4ZVFA 1C1BA 4CLWA 1EETA 5D0HA 1PO6A 4EUVA 1O5JA 2OPRA 2HK2A 2D7SA 4YUDA 1ZA1B 1VRTB 3D1QA 4HTIA 1D1UA 3GFHA 5FD1A 3IWXA 3RBXA 2XBPA 3SCIE 4X4VA 1HD1A 4NI2A 4KO0B 2XB2D 3GJSB 3ILIA 1B4SA 3UD5A 4B3MJ 1HHTP 1U6BA 3QJPA 5GAEU 5J1EB 1HYSB 2MLXA 3H5UA 1R6VA 1IM6A 4DV2F 2XEXA 2Z58B 1LFPA 1NB2A 5AJ3J 3THTA 2AT1B 4C7QA 2X1FA 4IQMA 1J5EJ 4KSEB 3QGIA 1RLDA 2OSRA 3G86A 3DLEB 4WBFA 2QO3A 4H4MA 5E3QA 1NJZA 3OJUA 5DM6Q 4F4ZA 4DS4A 1Q95G 2QG9B 1YVFA 3KLEA 3QZ7A 3IG1B 4ELVA 2Y8WA 1WWHA 4QCLA 1NLKL 3U1MA 1QAYA 2KRRA 4KGZB 2UUAJ 1I94J 3LGMA 5BXIA 3F73A 4ILRA 5H9FJ 3G4SS 1VLYA 2C3MA 1B70B 3G87A 1HWUA 3M30A 2HZAA 1EJ7L 4AT1B 4JBCA 5HI7A 3VHQA 1VBKA 3FBEA 2CJBA 4RKUC 1NDLA 3I0SB 4TU9A 1C1BB 3E8OA 1EETB 3LP1A 3J81U 3EZUA 4K4TA 2XHCA 1RBOB 2OPRB 5KG3A 4OFZA 3ITHA 2VFSA 4OHYA 4X62F 1T03B 1NJWA 1H2VZ 1NK4A 2LMIA 3ENAA 1HIYA 1UZHA 1NKCA 2HIQA 2FD2A 3B8HA 3Q8SB 2O67A 2R7VA 1H6KX 1YJ7A 2E9RX 3R6GB 2H54B 4KH1B 5IV3A 2DR8A 3AQOA 2CQ4A 1Q1KA 4KE5A 1FX4A 1JJ4A 1DQ8A 2FIUA 5DG7A 1F60B 1FFGB 3Q8YA 3NMAA 4DQRA 4QWCA 4QWAA 3RB0A 2KTQA 3ILOA 5A0YB 3IRWP 2IRXA 3RBEA 3ADAC 4H4MB 4P52A 2E1AA 2Q79A 2W4CA 4C9DA 3DYAA 4DR1J 1VHIA 3KLEB 1UW4A 3OSNA 1PYTA 4MT1A 5BYRA 3UDLA 1FJ7A 2ADBA 5FDLA 1FKPB 3VAFA 2GX8A 3KUEA 3DCAA 2OLWA 2RH3A 1RSCA 1FK9A 2HK3A 1VLOA 2IVFB 1S1WA 2V5HG 2ZH5A 5DG9A 4DV0J 1HMVA 3GV7B 3G9CA 3RW7A 1SQGA 3EYZA 2MQOA 2EFPA 2F5GA 1VQ9S 1RXOB 3LP1B 1S9FA 5DETA 1IBKJ 3HFZB 3ITHB 5J2QA 3Q86A 2EI5A 5H9EK 2YKPA 5F41A 3JSYA 1U8SA 1TL3B 3PM9A 2BOPA 5IQQA 3VGSA 4B9MA 2DY1A 4FZVA 4NXMF 3QSYB 4DV1F 1VQYA 1N8RT 2XLJA 2D3OR 5K9FA 5KG5A 1CLFA 4P9SA 4OHXA 2A2CA 2JSXA 1JNRB 5IT4A 4WZQA 4OZJA 2MZQA 5KFNA 5CD4A 2E7XA 3BKUA 5F8IA 2CPZA 1HI1A 3M6UA 2HFNA 4YHHJ 4KGXB 2W9BA 2V63A 5CYJA 3OR2A 5AXLA 4ECQA 4M5DA 1UA1A 4WYLA 5KG4A 2HBYB 1IKXA 1Y00A 4ZP9A 2MPUA 1GH8A 3DYAB 4ES1A 4JI8J 2VJVA 2L48A 3SCJE 1WC6A 1PAUB 3HI9A 5KT5A 4NXNJ 1XR6A 2MEWA 1FF2A 4K4YA 2XMUA 5IQ6A 3W62A 4A8WA 1S0MA 2Q3PA 4USMA 5LXRA 4KV8A 4JI5J 1S1WB 2CQGA 1HMVB 2H5JB 4XDDA 1SC4B 4DV4F 3JQJA 2VQFF 5L1JA 2GMHA 2BX6A 2J9EA 3TEHB 5D0GA 3EPIA 1G6BA 2XQCA 4J9VA 2GO8A 4ZS6A 4LF7F 1RTJA 5J2QB 2GZOA 4JP8A 2Y8YA 3H40A 3BPSP 5L1LA 3KHHA 4ZP8A 3Q83A 3BBBA 3EXCX 2HHHJ 1MMLA 3G6VA 2I38A 3RZAA 1NU4A 5DJBA 2LQJA 5CAAA 2ASJA 4K8RA 4Q43A 2FY1A 1R3NA 4EYIB 3L7PA 2YWKA 1XMOJ 1TKZA 1U1RA 1L3UA 1CULA 2PE8A 1ICEB 3ZC4A 1UTAA 4LT6A 3T5LA 3DOLA 3TZYA 4CH7A 4DSFA 4C0OC 3ZTRA 4N77A 4QPTA 2G1DA 4C0HA 3DRYA 1VQMS 4K4SA 3R27A 2R8JA 1W2IA 4DR5F 1SV5B 4WK3A 4K2XA 1NPRA 4M5DB 1K47A 4QIFA 2C22A 3IP0A 4Q2MA 1Q0NA 4QYZJ 3FEYB 2HFSA 5M2RA 4BWJA 1IKXB 2P9EA 2RSQA 1RACB 5JUMA 4DCOB 4K2JA 1ZOTA 1IJFB 2R8KA 5JVHQ 1HWLA 1TL1A 3CJ3A 4DL3A 4RUHA 3N0VA 2QEXS 5L1IA 2KU7A 3H5XA 2LEBA 2BJ8A 3AB4B 1V6HA 1HBNA 1N34F 4DHVA 2QFIA 3CPWR 2DNOA 4X2BA 1X5SA 4KV8B 2WVEA 1CJTB 2DR6A 1VRUA 5JXSA 1QM9A 4S0MA 2CXEA 5DZ7A 4OI3A 3L09A 4ILMA 4CLTA 3FMWA 4WU3A 2BE2B 1N5VA 2A0FB 1WC0A 4U67Q 1BQXA 2HIYA 2PC6A 2DR5A 1H3DA 4EI2A 1FJEB 1RTJB 2WVDA 3EZOA 5F0WA 5LJ3Y 3T19A 2QX0A 3AJ1A 4B9SA 5CCMA 3GB0A 2HAIA 5C24A 3QSIA 1K8AT 3UD3P 2IM0A 1JXVA 3MR6A 1WC1A 4HLBA 2CQBA 4WFNQ 1H7XA 4J37A 2M70A 3U02A 4B9UA 2RMLA 4OYAA 2O3DA 1CULB 2E7VA 1TELA 4PAAA 4C3KA 4KT0C 4KYZA 1PBAA 1KONA 3PCOB 4DR7J 3PG9A 3DOKA 3DOLB 5EUHA 2QFJA 3FEZA 2LQ9A 1LWXA 2ZBIA 1YRUA 1Y0HA 4WK1A 1IVZA 4LF6F 3VVUA 2Z2MA 4M5LA 3Q2SC 1J5EF 1UPPA 3GFYA 2FJWA 2DT9A 5KT7A 4FXDA 2HGLA 4DMZA 4UZBA 4MTPA 3TQEA 1FNMA 1S7HA 1NH8A 1BXNA 1UWAA 3P3DA 1MNEA 3V6HA 3JYTB 4USVA 1TL1B 4C8KA 1F1BB 5H9FK 3KLFA 2R7SA 3BSNA 4DL0C 5FIIA 3W8PA 2FB0A 2D3ZA 2UUAF 2XC9A 2BRKA 1XBWA 2EG1A 1RDRA 1B0TA 2XMJA 2HHWA 1IKYA 3L95X 1VRUB 2K1RA 3X1LB 2VOPA 1G1XA 2B3TB 2ZNZA 4PABA 5ETVA 5B0EA 3C2PA 2I1RA 1LFWA 1XNQJ 5ETTA 2V2VA 2W4DA 4DV6F 4CTAA 2OPPA 2CZ4A 2MY8A 2DNGA 1N32F 2PI4A 4ED6A 3LH2S 4ZLPA 5LXYA 3PEJA 2HMIB 1FFSB 3M6WA 1TL4A 5J1PA 4LQ3A 3UCUP 3IFEA 5CYQA 1NSAA 2IA0A 4B17A 4QWEA 1T9XA 1WELA 1RWNB 3UWTA 2PFDA 1N0UA 2C2RA 1DQAA 1L3TA 3IAM9 4PKDB 2XZTB 3G6XA 3DOKB 4KR0B 1ULRA 3TR5A 4NCAA 4QJVA 2ZC4A 2WW4A 2CPXA 1IUJA 4J7CA 4ATNA 3CWJA 5F8MA 3GONA 3DXBA 3J7YI 3EZ5A 2NUUG 1XTZA 1Q5VA 3M2UA 2DXFA 3IBFB 3BQ1A 5B7WA 2HNDA 5KFAA 3RB6A 5AT1B 5D0EA 2FYXA 1TP7A 4WP3A 3K58A 1Y7PA 1OSDA 4HT5A 2UV8A 4CZCA 1GK8A 4FNHA 2YX1A 5E41A 3DNCA 5LSOA 2H4WB 2DGSA 2DKOB 1ZM9A 4NMXA 3MAHA 2B4VA 1VBYA 1NDKA 4LR9A 3LF0A 3FBFA 4LF5J 3D3CJ 1JLFB 1MMNA 3NRBA 4FF1A 4Y3CA 2CVIA 2KH9A 1VISA 2CJYB 1KS2A 2BJ7A 4DV0F 4DUZF 4USKA 2J6TA 3D68A 3GV5B 2VASA 3EDQB 4J9QA 2IBKA 5K5MA 1GMWA 4DF4A 1WG4A 4CTAB 1I5OB 1D3WA 4ZVGA 3J81j 2VFVA 2UVVA 4CLZA 4LRDA 4HH0A 4UOCA 5E3CA 5GAHU 3TQ1A 1IBKF 4OQJA 4HHUA 2HLUA 3JTOA 2J7WA 4LIRA 3T6BA 1UEUA 1GX6A 3FK4A 2HWIA 1KFSA 5CYQB 1JWWA 3TA1A 2VZ9A 4J9SA 1QVFR 4NLPA 3EMTA 2H9ZA 1AUSL 4YB7A 2ZHAA 1TZ0A 1Z2ZA 4YFUA 1WKJA 1LW0B 4NA2A 5KFBA 3PY8A 2GJFA 2WVBA 4BS2A 1LK5A 2KXNB 2APOA 3MF5A 4HVZA 1TVRA 4ZVSB 4OI4A 3MURP 3F56A 5ETRA 4YR0A 1FDAA 1J27A 4WE1A 3MEKA 1S5ZA 3MM7A 1TUVA 2HNDB 4YHHF 2Y1LB 2POKA 4FF4A 4OYWA 2VG7A 2FVPA 2W2QP 1IKVB 4OI6A 3OTEA 4CH0S 4QIVA 2HNZA 2FVCA 4WFXA 3B4DA 1WHVA 1UWBA 3PX4A 4R8UA 2HYIB 3HFKA 2M9KA 4WF9Q 2ZOMA 4J9LA 3JTNA 2H65B 3ZZPA 3PDNA 4NXNF 3BKFA 1U6ZA 3MOZA 5ETSA 1P1LA 3RRHA 3ZZUA 2IJRA 4F26A 2IY5B 1EP4A 5HQMA 4M5GA 2CNNB 3WDOA 3P6YC 1VQLS 3K0JA 1T3OA 3BZQA 3PRDA 3MGJA 2HPUA 5LT5A 3VF0B 2Y1RI 5HQLA 2XY7A 4IQXA 4PR6A 2XGQA 2R2TA 1ZA2B 2I9SA 1NM2A 2OPQA 2NR0A 4L73A 5F3ZA 2DITA 3R5JB 4U7UK 1F3VA 3ZO7A 3M9MB 4DLEA 3TUJC 3MCOA 5A8KA 3HSZA 3PX6A 1UETA 2QMXA 1TFWA 4RBVA 4HI2A 4MK8A 1JLAA 2Z30B 2GIRA 2LECA 4K7QA 3QIDA 4KQZA 1OPIA 4LBHA 2ASYA 4FXWA 2BQRA 1AFJA 1AROP 1IBMF 3O5TB 3K57A 1TV6A 5GMEA 2O5DA 1QVGR 2X51A 1WC5A 3MR5A 1Q8BA 2DRDA 2RIJA 1JMTA 1S1VA 3G6YA 7FDRA 4DFJA 2IVMA 1TVRB 4RW7B 2CIMA 2BW7A 2BV3A 5F3TA 4WP9A 4QYZK 4IDKA 4DL7A 4I69A 3MM7B 4EZ9A 2YH1A 3MR7A 2MKSA 3JAMU 4JI6F 1IKWA 3BGRA 3VCDA 3SFUA 1CJKB 2NYHA 3PW5A 2J76E 2VG7B 2KDOA 1FKAF 2IC3A 3CD0A 1T0TV 2QA4S 1NDPA 2CKWA 2HNZB 3BDPA 2JVOA 2HVHA 2B43A 4P71A 1BLUA 2EFGA 4R8UB 5BR8J 1UVKA 2EKYA 3GJTB 2ACYA 5KG1A 4WIQA 3Q8UA 2WOMB 4LSLA 2QA2A 2HFUA 1YG0A 5IM0A 4MK7A 2K2PA 2DGVA 4ILLA 3HX9A 2WCXA 1SJRA 3W7BA 2COLA 1WHYA 2JDJA 4QPXA 1S10A 4WTOB 1VQ8S 4MK9A 1NK6A 1JLBA 3HF5A 5GAEI 3D66A 2IYIA 2V94A 3CCVS 4F3OA 2JX2A 8AT1B 1AB8A 2VU5A 5L1KA 2YNHA 1GAOA 2ZBQA 1PG5B 3EM1A 1FERA 2GQ2A 4J5OA 1T7PA 1HQUA 5ADZA 2QT7A 1PILA 2F8MA 5A8KB 2W1BA 2OO4A 1OWXA 3I56S 1JLAB 1DLOB 4LMZA 1YJNS 3IN5A 5K14A 2RHSB 3BKTA 5LSLA 2M5YA 5BYSA 1KOHA 2WRMA 3NWGA 1YBUA 2UUCJ 4FYXB 1R6YA 2HWTA 3BR8A 3C15A 1TV6B 3HHEA 3FFIA 1RAIB 2CQIA 1MWZA 2BJ9A 4DR7F 3LUYA 2Y1IA 2QV6A 3VVTA 1S1VB 2ZWPA 2LLZA 2M8DB 4ZK7M 2AJFE 4IDKB 1IKWB 2XY5A 1NUEA 3BGRB 1REGX 4IG0A 3OL7A 2CPDA 3B54A 2B51A 1LOUA 2IC3B 1S6UA 3CCUS 3FMBA 5IZHA 4DSEA 3SYZA 3UFCX 3AJ2A 3I55S 3RR7A 1SQFA 2ZBRA 5U47A 3R97A 1U7LA 2UU9J 2DNHA 4LSLB 4A8MP 4M8LA 3L3CA 2UUWA 4NLQA 1S57A 5KT4A 1VK3A 2B0GA 1C0TB 2DNLA 2L9WA 1NK0A 2QTWA 2DPIA 2YWEA 1JLBB 3OR1A 3T5KA 2HZVA 5RUBA 1XNQF 1XNRJ 3M2VB 2YNHB 4ZCIA 5MAOA 1B7YB 3EWGA 1HQUB 2ZJPQ 3GJQB 2HRUA 4DFKA 4ZJLA 3MZIA 2DHGA 3BF4A 4F4YA 5EWFA 2G9OA 3B6BA 1RHJB 5K20B 1F5CA 2VPWB 3IMQJ 3W8GA 1VQ7S 2OFGX 3BBFA 4GC6A 2HHTA 5C7PA 2PDAA 2G13A 1FRMA 4HKQA 3C15B 3M4XA 6AT1B 4O23A 3FFIB 4DSIA 2BJDA 4ZKAA 1QSLA 4KTQA 2CQ1A 1X8DA 1M5KC 1SVDA 4IRCA 4PWWA 3V6KA 3RBDA 2W9AA 2RRAA 4J9UE 4ZCKA 4DPWA 1PJ7A 3CT9A 3S6EA 4WKRA 4IG0B 1WF0A 2LU2A 1Y5IB 3SCLE 3KWMA 1Q5YA 2AZ3A 1P9QC 3PIOQ 2K7KA 1KQSR 4TY9A 4EMDA 3CD5A 5C42A 2XYGB 1RT1B 2MKHA 1YZ6A 2R3VA 3CCMS 3NL0A 3MM6B 1Q86T 2CPJA 1HBOB 1DBDA 1S4FA 4NYZA 3CMAS 2LU1A 2XWXA 4OYOA 3CCRS 1JLGA 1FXDA 3I87A 7FD1A 4LF5F 3A13A 4HL9A 2W8KA 3AH6A 2R9LA 1VI7A 4P2XA 1NO8A 4QR1A 2RS8A 2ZOGA 5EN1A 1WKLA 2M7SA 3BYRA 2P6SA 1S76D 2KXFA 4TN2A 1EQ0A 1VBZA 3C19A 3M6VA 5AE2A 3FDSA 1OSCA 4C8LA 2E44A 1TKXA 2PEBA 4ZVTB 1YJ9S 2LP4A 2B9XA 1TR0A 2AW0A 4J9KA 2I0XA 3TVZA 1ZETA 3IM8A 3DI6A 2AX1A 1HNIA 1JQGA 1YJRA 1S99A 2L9DA 2JL9A 3D4JA 3DLKA 1FXRA 4Q44A 4OJ3A 3PHTA 1FTRA 1VCTA 3OTOJ 2ZC3A 4TNOA 4XO0A 1D9AA 2YQ1A 4YB5A 4AQYJ 4A47A 4F67A 2VOOA 1N6QA 3KG1A 4UQGA 2HQ3A 2HS0A 4J9PA 3TEGA 2JVRA 1RAEB 3OTBA 1C0UA 1VFJA 3ISNC 4B3RJ 4LR8A 3DLJA 1U02A 1UFKA 2CZVC 2ABYA 1NJIT 1MU2A 3OHAA 1U25A 4DL5A 4B08A 3QT7A 4RW4B 1OPZA 1FRHA 2JWNA 5C42B 2YNGA 4NCBA 4OZ5A 3TP2A 3EGVA 3M1VA 2IDLA 3IRXA 2J8SA 2ZH2A 3RG6A 1SKWA 3CCQS 4PXEA 1U6FA 1JLGB 1R0BG 3ISZA 3MM9A 4A48A 3I9ZA 2UXBJ 5IC4B 4OJGA 1FRXA 1TU0B 2AQ4A 4CWBA 3Q24A 3NBPB 4LSNB 3A3NB 5ETNA 1QUVA 1BUXA 1SKSA 2DO4A 2N82B 2LXIA 1QDUB 2RE1A 2ZVIA 3OD2A 4TLQA 4M5KA 4OV1A 2CPEA 3TZWA 1VGYA 1TKXB 3MAAA 4I2PB 2FC9A 4C3LA 1JIHA 1DZ5A 4WFBQ 3KLIA 1MLAA 2YKMA 5D0RA 3LTOA 3DI6B 1IR1A 1KVKA 3GR0A 3DLKB 5A6WA 2AX0A 3C16B 2XYPB 1XMQJ 3O1LA 3KK3B 1X5TA 3CJQA 1VQKS 3QGPA 2FZKB 1VQOS 1EQMA 2KT5A 4FYVB 3CJRA 3TA2A 4B9VA 4CLKA 1A6LA 2E1PA 4DV3F 2NSCA 4KFBB 1N6QB 3NEKA 5LSRA 4DQSA 2IYGA 5D8HB 1FKOA 2VFTA 1UFWA 1U0SA 1C0UB 2A1BA 4O3NA 1U1NA 3FRYA 1FHTA 2CQ0A 4V19X 3PACA 1TL7A 1G7CB 2KJWA 1SUQA 1MU2B 3CVKA 1WI6A 2VFRA 1MWQA 2YNGB 2NSBA 3OW2R 3M1VB 2KG0A 1S1UA 2ZJQQ 3HHLC 1HKAA 1SXLA 4NRTA 2OKQA 2AJ4A 2VJUA 3QRQA 2HQCA 3MM9B 5AE1A 4YOEA 2B9YA 3QQCD 3SXLA 5LOQA 4WPAA 4CM2A 2HURA 3RRGA 1HW9A 4XAKA 3IR6B 3KJQB 5F0UA 2BBEA 1F9EB 4P10A 2UVRA 4WKYA 3GR1A 4O3SA 2J0XA 1HBUB 3KLIB 3SI8A 1RB0A 2YKMB 4DR4J 4JYAJ 5B0CA 3KJNB 3M8YA 2XCAA 2F4FA 3RUBL 3W9JA 3PZPA 2J8AA 4B9NA 2CRLA 2EFVA 1RT2A 2CQCA 2GVZA 1N0VC 1Y10A 1NHVA 2BA9A 5L46A 2DBBA 1IM4A 2LCWA 1KTQA 3VAHA 4DR3J 1KR4A 4EZ6A 1FKOB 1L5UA 5HMZA 3K5PA 2U1AA 1GXUA 4D3GA 4YS2A 2ZH9A 5CYMA 3FJ2A 5D4OA 3EX7B 2MQNA 2NUHA 3OTCA 2M88A 4NWBA 5KFIA 4DG1A 2HVEA 4I6YA 5L38A 5F8JA 4RUCA 5HVFA 4EGLA 1TL7B 4A46A 3UDVA 3OT9A 1PAEX 2DXDA 2VH7A 4A4JA 2DB1A 1SUQB 5F9LA 3OVBA 3RB3A 3T9ZA 3EPGA 4ID8A 1HHQA 4NZ7A 4EBDA 2V8PA 4NLUA 3TW0A 2QL9B 2DGQA 2GJ2A 2DGTA 2W24A 3M8ZA 2GHWA 1RA6A 1S1UB 3LWLA 3LPEA 2ZUGA 3EJMA 3E2EA 2LYVA 3EUNA 2OEMA 3W60A 5KFFA 2A2DA 2CJAA 3ZZOA 2FHOB 3NNHA 1N36J 4IYQA 3LP2A 2UXDJ 1MN7A 1RWWB 4LF2A 1SL0A 2XULA 4IKAA 2VIHA 1T95A 1F9FA 2KVQE 4QR0A 1N5QA 4O0IA 2W7PA 3NS7B 4NLWA 4EWTA 4C98A 2ZNYA 1QTMA 2C1EB 2XI3A 2XS2A 3G6ES 1NCLA 1Q82T 4O44A 2YKQA 3OQ2A 4ZP6A 5KFGA 3M8PA 3J7AN 1KRPA 3CJ4A 3ILLA 3K2YA 2E29A 4ZVPB 4ZN1A 3OJSA 1S1TA 1KKHA 1ZAVA 2QLBB 5DS7A 3HVTA 3RAXA 2YWFA 4AL6A 4LFCF 4X84A 4V1Ak 5G0RA 2GVZB 2N4DA 2DH7A 2V68A 3UN5A 5ETKA 1O0PA 3JQKA 4R25A 2F40A 2Z56B 1RWPB 3MD3A 5EX0A 1A9NB 4F8RA 3W9IA 2BYCA 4E0DA 2J9CA 5B0BA 3GIRA 3D67A 2XMMA 1PYSB 5KFRA 4I6WA 3N79A 1OQ3A 4QW9A 3HLUA 2LQBA 5HSPA 4F0HA 1O51A 4ID5A 4USJC 4DG1B 5LL6d 1IR2A 2RRNA 5KFUA 1CJUB 4KPYA 1RWUA 1VQPS 1XEZA 3DLBA 1VK8A 1L3SA 2AU0A 1FE0A 4CO0A 1WTFA 4NZ0A 1Y3KA 2CUYA 4ECVA 1C4CA 4K50A 2JLEA 4LF4F 1N54B 2CZ9A 1X0FA 4QQBA 4F2RA 1H98A 2KYXA 4O4GA 5GAHI 4TQRA 4X62J 5IT9Y 3Q0AA 3OLBA 1OQ6A 1APSA 3FUYA 2W25A 5KFDA 1T9UA 3HPOA 1N56A 3EGNA 2KL8A 1RLCL 1S6PA 5GMKa 3HK2A 3OL6A 3A8KA 1RAJA 2VB6A 4KKOA 4Y2CA 3T5JA 3LP2B 4EO8A 3H4BA 2V9KA 2Z2ZA 1EIYB 1DAXA 1ZTWA 2BJ3A 4P74A 5IWAJ 2HQIA 1X4DA 3US5A 2GCFA 4O44B 3IWLA 1TK8A 5LMUJ 1N33F 3M8PB 2VBWA 3N6MA 2KT3A 2MZJA 1VR6A 4I6AA 2VDIA 4RWXA 4O3OA 5KOWA 4LBIA 3MHYA 1S1TB 4DR2J 1F2HA 1PCAA 5KFSA 3ELHA 3CUNA 3HVTB 2B8QA 1BD6A 4N76A 3B78A 3ZTPA 3BO3A 3DOMA 4USIA 1E6VA 1CVJA 4HHJA 3OTOF 2ZBCA 1TK5A 3E3XA 4RW8A 1HR0F 3NGDA 1UEKA 1S97A 2DO0A 2GQCA 1URRA 3TAQA 1RA7A 3R5AA 3QIPA 4LRBA 4ZHRA 3OTDA 2M4MA 4OHWA 2CDQA 1LWEB 1LWCA 2LA4A 2V4QA 3MMBA 4OZ1A 1JJCB 3AAWB 3PX0A 3LAKA 5I42B 2EK6A 1XN9A 2OH2A 1MSWD 1VDHA 3L9ZA 5A8WB 1VC6A 5B0DA 3VAMA 2F9JA 1AZSB 4EK2A 3LGHA 3LALA 3PV8A 3FZ2A 3TAMA 2RNEA 4URGA 3C46A 4DUTA 5HMYA 1VYAA 4Q7AA 3KOAA 3CDBA 2VV5A 3W1YC 2LVWA 4O4GB 4KHMA 1RHRB 3D0GE 3MMAA 1U0HA 3V4MA 1TUWA 3AHPA 5CXTA 3KTQA 2EC0A 2MQQA 2DRBA 1S6PB 1FNOA 2HLTA 2UXBF 4NXMJ 4Q45A 4DN0A 2BZ2A 1WC4A 2GJIA 3OFFA 4KKOB 3TJAA 1R8PA 3MECA 3AOCA 3MMJA 4HT7A 3RRKA 2L9NA 2MMYA 3OL8A 4ECUA 4OI0A 4PG5A 2FJXA 2EFNA 1Q7YT 1RBLA 3TZXA 5C2GA 1A7GE 2FHJD 3T1HJ 3OXGA 3CJ0A 3MD1A 3I5AA 3DU6A 1S72S 3C66A 3MR2A 2HQFA 1Q79A 1CC8A 2WSEC 4ZN3A 2J9DE 3NWRA 1FE4A 4G1PA 1JLEA 9ATCB 1XMQF 5HVGA 2NS1B 2ALZA 1E6VB 2VHGA 4UY85 8ATCB 3V6DA 4DR6J 1HNVB 3FSIA 4RW8B 3CMQA 3K8WA 3ZFVA 3TNVA 2FLPA 1ZM4A 1ZPWX 2C2KB 1RT6A 3MXHP 2IMWP 1WD6A 2PO4A 4U95A 1UEVA 1LWCB 4CYUA 4DV4J 1CSJA 5E3AA 1JX4A 3J80Y 2G4BA 3EICA 1QAJA 4UT4A 4C3MA 1JXLA 2DNPA 1MROA 5KG2A 3ENVA 2VKZG 5T7LA 5C2CA 4LF7J 3KG4A 4NEZA 2B4PA 1VRTA 4BBYA 1WEYA 2ROGA 2YNIA 3MMAB 4N41A 2EBEA 1U0HB 1YJVA 1OYDA 4KO0A 4Z37A 2YKNA 2OMOA 1TAQA 2KO1A 1JKHA 2YTCA 3ZXWA 1AT1B 1X9SA 3NMRA 1BE4A 2E5GA 4PUOA 5J2NA 3D6FB 1P9YA 1RTZA 1D8ZA 1NAQA 1NKBA 3KG0A 3MECB 3MPDA 3EGZA 3GCWP 4JI2J 3LOUA 5T14A 2DHSA 7AT1B 3OFEA 2IRUA 1KSPA 1QTNB 4PEOA 4I0WA 2LKZA 1P1TA 4K0KJ 4YDDB 5GADI 4DL2A 1R8HA 5AXKA 2JEGA 2BRLA 4DR4F 4RLEA 3G8TA 1U26A 1JLEB 1H38A 1O8BA 2W2MP 3N6LA 2GVDA 1ZYQA 2DHXA 1OY9A 3I31A 3RW6A 2YX4A 1C1CB 1CS4A 3IG1A 4XIUA 3OLAA 3V6DB 3E51A 3QZ8A 3MPWA 3VQSA 4NEYA 4ZVQB 4DR3F 5DDRC 3MTJA 1XR7A 5FLXU 4C97A 2AWZA 2XLKA 5KFWA 4UOGA 3J80U 3DRSA 3KNAA 4OX8A 4Q8FA 4CYUB 1SQEA 1KN6A 3Q2TC 5D77A 2ADCA 4ZMMA 2JEFA 3PO4A 3SSSA 3KJFB 1FRIA 1D9FA 4LFBF 3QMQA 2I6WA 2R8IA 1LXJA 1VC0A 3I0SA 4AE5A 1MROB 4Y00A 4DCPB 3GSIA 5T7LB 2VDHA 4OMFG 2HVDA 3W9HA 3Q22A 4DQIA 4RNHA 3NCPA 4DEZA 3AD8C 3UN3A 2YNIB 2WBRA 3ETMA 1T03A 3P45B 4ECTA 1Y5NB 2JHEA 4ITSA 2AEFA 2AEJA 5HMWA 4ETZA 1KEKA 3B82A 4RNOA 3AQPA 2YKNB 1Q8LA 2WSCC 1JKHB 1UZDA 4LF8J 2W4PA 1QSYA 3KXDA 4PUOB 5J2NB 2YPYA 1R27B 2U2FA 1N36F 1HQEB 5E33A 2UXDF 1V3SA 5KFEA 1UFLA 3PIPQ 1TQLA 4NLTA 3HZGA 1SPBP 2VFUA 4X4TA 3T5HA 3LAMA 1VBXA 2H4YB 3UNYA 1YK9A 3MR3A 2JRSA 2C2NA 1S4EA 2KFYA 4LF6J 3QJLA 4ZVHA 5DDQC 2JH3A 5A0YA 3C14B 4EO6A 5KFCA 3UNGC 1S7IA 1SJ1A 1T9YA 2GVDB 4LF1A 2VA3A 3VR1A 5DM7Q 3DRPA 3H7HB 1H74A 1CS4B 2KB2A 4DLGA 2HZCA 1FKPA 4KHRA 4OZNA 2HHSA 2R7XA 3OVAA 1FX2A 2V69A 3T6JA 2UV8G 4C8YA 3BGLA 2DCLA 1H72C 2GV1A 3DFEA 2OPSA 3DRSB 4TQSA 4PXBA 2XMAA 3UO0A 2VONA 2QSFA 2CG8A 4H4OA 3VZHA 5K8NA 1PGZA 2F7VA 2YX7A 5MLCV 4ZIVA 1RKJA 4U7UD 2N7YA 2EVZA 3Q8VA 1FEHA 5GAGU 4DV6J 3HDSA 3GV8B 3OVSA 4FBTA 3N01A 1YGYA 1U09A 1HNWJ 1N32J 2YBVA 2XNRA 1ZBTA 3DHWC 1YIJS 2P5VA 2F4VJ 4MKVA 2JEIA 3TANA 1B99A 1MG7A 1TMJA 2QLJB 1I6JA 1TL3A 4NPOA 3J7ZT 2WAQD 1GMVA 3K59A 1GTHA 5DLGA 4YY3F 3UPFA 1TFYA 2WB4A 1WJ9A 2BVZA 1DQ9A 1VRQC 1W2BR 2KFNA 2BQ3A 3AT1B 3R6LB 1HW8A 4KIAA 2YQ0A 4P72A 2CVEA 4YB1P 3P4UB 1YKWA 1R0CB 4ELUA 1DARA 2YNFB 5IWAF 5EWEA 3FQKA 5HAOA 1KOOA 3NGSA 3R2DJ 5LMUF 2P9GA 5E0OA 2ZBPA 1CG2A 1PSDA 4J9MA 2YXLA 8RUCA 4DR2F 1NK5A 2C3UA 1KHWA 2VG6B 3ZNUA 2O66A 2NLWA 1S12A 4RX6A 3DRPB 2DEIA 3ET6B 2QGFB 1TK0A 1Q78A 3EVOA 1RAFB 2GIQA 2L3MA 2WVCA 3IAS9 4X65J 1PC4A 5F9NA 4WIIA 2KXHA 3W5YA 1F5BA 1ZS6A 1BY9A 3MEGB 1N4LA 5DG8A 1FEEA 3HFVA 2ZHBA 2OPSB 1ZZFA 3MMCA 2DPJA 1QJHA 2FJVA 1WTBA 1H7WA 4IRKA 3VZIA 3W61A 4DUZJ 1F5AA 2DNMA 4H4OB 4X4SA 4OZ2A 4WYWA 2X3GA 4C48A 3U7JA 3R5CA 5HQ8A 3SV3A 2IA6A 1I3OB 4WFAQ 4HH1A 2HG4A 1L3VA 2JLFA 5D3GA 2MLZA 3HHDA 1R8AA 2C2OB 1BWEA 1QY7A 4EU0A 4HHHA 3G96A 3LWMA 2ZH4A 2P8IA 4F4KA 4K4UA 2HHXA 3UCZP 4ECYA 5L39A 4DX7A 5DQGA 3O3LA 4IOBA 1M5VC 3DC2A 4OZ3A 2B8PA 4H4KA 1YLXA 2MDAA 3ULHA 1XMBA 2LQ5A 2CJKA 3ENQA 4WP8A 4YQWA 1RBAA 1VIOA 3QFWA 2DGWA 1VJQA 3KMSA 2Z2YB 4O3RA 3T1HF 2D3UA 4M5IA 5B08A 4F04B 1SV5A 1YX2A 3G2XA 4ED0A 1CBKA 1RTIA 5K8PA 2V2ZA 2MKYA 4ZA1A 3DGPA 2RDJA 1P8GA 3KHGA 2XG8A 2RT3A 5HBMA 3NAHA 5M2PA 4PQAA 3R1HA 4DR6F 2NXEA 4MKAA 4ELTA 3GG1A 1VHFA 3WZ0A 2XO6A 3QO9A 4ED8A 1T8EA 3VGUA 3UR0A 3HSDA 2GHPA 1RT4B 3MMCB 2HVIA 4WCEQ 2ZVSA 1CJTA 3A1YG 4GKKJ 2V8DA 2CNLB 3D28A 1HD0A 1OYEA 5B0AA 4A8XA 4JUZA 2N3OA 1SL1A 2X1AA 3UN2A 4BC9A 1U1PA 2BE2A 3NCQA 1VS3A 2FLNA 1X0PA 5HVHA 1UW9A 3DU5A 1KQGB 3WX8A 4IUFA 5D3GB 1NJYA 1R31A 2KFZA 4DSKA 4V19J 5AE3A 2GNKA 3JSBA 2ZITA 4IFVB 4QIWD 1NPPA 3JB9k 1TKDA 4ANDA 3S8SA 4JI0J 3CSKA 2EBGA 5IS2A 4M5MA 5HMXA 1IBMJ 3QWPA 4LF9F 1RU2A 1FVQA 1UVMA 2QJ3A 4XK8C 2W7AA 1FI4A 2C3YA 3TJ9A 4A8QA 4JI2F 1XIQA 3CJTA 1DTQA 1C4AA 3QT5A 1KVJA 1YBAA 1VC5A 2WB1D 4NA3A 2UUTA 4ED4A 3PNIA 2PA8D 2GAHC 4RUAA 4K0KF 3A8EA 2OMLA 4JI6J 1D9DA 3S01A 2FY8A 3PEHA 2P6TA 4PPZA 2DXEA 1RTIB 2QE5A 3HKWA 2GQQA 3KLGA 1QD1A 2YWHA 2RF2B 5DO2A 3DGPB 1M0SA 3GIMA 2Z8QA 4N7TA 3OL9A 4Y28C 3JYTA 2XWYA 4A8FA 3N5FA 4MYUA 4I7FA 5HBMB 4ZVUB 5EGYA 3QWUA 4BCAA 1RHUB 4JI4J 3VALA 1R0AA 1RWMB 3QO9B 4EFAC 3CD7A 3SEOA 5D78A 2RS2A 3AFGA 3TX8A 5DZ6A 1KLNA 1KD1T 2WONB 1IBLJ 4NYPA 3M6XA 3UR3C 4F3MA 4CLPA 1Q4RA 4USUA 2MY7A 2RQ4A 3EVWA 3CJKA 1RABB 4PYAA 4M95A 2RDIA 4ES3A 1N5TA 3A8JA 2HMIA 3CCES 4H4KC 1I51B 1ZPVA 2VA2A 4DSLA 3A3PB 1M5OC 2ASDA 2HAFA 2ATCB 2VPZB 5L9XA 1FCAA 1T94A 3KNGA 1VMBA 3E01A 1MW7A 2F8HA 4RWWA 2BMBA 1RWVB 1QSSA 4DX5A 2D69A 4LF8F 4B3SF 1KDNA 4CT8A 3CCSS 4F50A 2KHDA 2G0CA 4PWDA 3NNCA 4H54A 1OJ4A 4J9OA 4P2MA 1DTQB 2GIFA 2ZH7A 1UJ6A 2AKWB 4NLDA 4QOTA 4ED3A 2YY3A 1FESA 3H98A 2GO9A 3VWSA 3OXFA 3HZEA 4N5SA 4FVMA 3JQMA 4OLOA 1SBRA 1NXIA 2O1PA 2V0NA 4DPYA 3MEDB 5E5NA 1IWGA 3D1HA 3NOGA 2E5JA 3KLGB 3MUTP 1YSJA 4UQTA 5CD4H 1IWAA 3WX4A 2RAQA 2P2CB 2KVIA 3UW1A 4FPRA 2X1BA 3NOCA 4I7FB 4X64J 4MFBB 4UUXA 2G1HA 1JLFA 4J90A 1R0AB 3NAIA 3NLCA 5C25A 5H9EJ 1FJGJ 3AY0A 2Y9HA 3TI0A 2KZZA 3RR8A 5DLFA 2DD8S 2XMWA 3ZZ0A 1ZZNA 4I4BA 1FXLA 2BANB 1HNWF 2QA1A 3CJKB 3KDOA 3ZTOA 2DR7A 3LANA 2F4VF 4DF8A 2CADA 1R43A 2NZ4A 1TKTA 1T3NA 2XCPA 3E01B 4ZLJA 2OGUA 3QFHA 1RJJA 5KFLA 4Y65A 2DYAA 3QATA 3THVA 3CNQP 5CZXA 1ZAWA 2J6UA 3T41A 4HACA 2V2KA 4RNNA 1EARA 3G8SA 4B3TJ 1HI0P 4LRCA 2FVQA 4PWDB 1LW0A 3UVJA 3MTKA 3QLHA 2V50A 4HR2A 3MM8B 2RB7A 2AGOA 2B56A 4GMKA 3I9V9 2HFZA 3PYDA 1GMUA 3UE2A 2HVZA 3L7OA 4F4WA 3PW2A 2LDYA 3G82B 1OY6A 5K8MA 1IKVA 1U1QA 3BH7B 2DGXA 3GYNA 2F65A 3K17A 3HSJA 3W3SA 1XC9A 2J0SD 3AODA 5K8OA 3BJYA 5KFOA 2AYMA 4X4UA 4ZCLA 5CHCB 3WBZA 4X65F 4G1QA 3D1OA 3QGGA 3MEEA 3HVRA 2Y0SD 5C25B 2DNNA 4K4XA 4N47A 2RKIA 4RW9A 1G2EA 3J7A1 2OJ3A 2XZDB 3OUYA 5BYQA 1S9EA 1GNKA 4L75A 2OD6A 3BGUA 1EX8A 4OYIA 2IM3A 4FYWB 3KUGA 2G2YA 4K4VA 4E98A 2HRTA 1F9HA 4FXVA 1SCJB 5G4DA 4KAIA 1T02A 1RCOB 1TKTB 3POTA 3ISND 4ZVEA 2QMUB 5F8NA 2K3KA 1HFEL 1ROFA 1UCNA 3ZZYA 1M1GA 4CM0A 1WF1A 2WSFC 3BBCA 3V81A 3TARA 1Q7LB 4HACB 3GP9A 3DLHA 2PEHA 4MKBA 3R5BA 2J6SA 2JFDA 3UVJB 3HSGA 2VPXB 3K89A 4X4OA 3QLHB 4RW7A 5DDOC 4M5HA 4OLPA 2N4CA 1HNXF 3V5RA 2DTJA 3UD4P 3UI3A 1CJKA 1A0OB 2J5AA 3C6TA 3QNWB 2RD5C 1FWLA 3D54A 5KFZA 4P2FA 4LRFA 4AFFA 3J81Y 2JOQA 4WZMA 2ZKUA 4CQ1A 3S7RA 4OYZA 4G1QB 4DOZA 2UUBJ 1Y9OA 2WOMA 1ZH5A 3MEEB 3RAQA 3RBZA 3JS9A 4KH0B 2HS3A 2E5LF 3ETOA 1YJWS 1VIXA 1U1OA 2J7UA 2HHVA 2ACMA 2H51B 2RKIB 4RW9B 4JI3J 3OUYB 2PMHA 5CH7B 4GKKF 5I3UB 1S9EB 2DK2A 5E3PA 1NHKL 4ZJQA 1EKRA 2A6MA 4LQ9A 2LEAA 3A3OB 1S9GA 3M9OB 3OHBA 1YJUA 3PFEA 3HJFA 4ZLLA 1HNZF 1DTTA 3DLGA 4QWDA 3OFGA 4RUBA 3R9LA 3QYYA 3ILJA 4F3QA 4C8OA 2V8GA 2IM2A 2GW8A 1CQNA 2HQDA 2IPOB 1S0VA 3POTB 1DLOA 1ELOA 4Q2LA 2EWHA 4O3PA 5IC6B 3CD6S 4JI0F 4NLRA 4YR2A 4CLYA 1LWFA 2DNYA 1SC1B 4DV3J 1I1GA 2MSSA 4RZRA 3M8SA 4LIWA 5CZVA 2ZWOA 3V81B 1RT5A 2FJBB 2VQEJ 1QAXA 5JJBA 1OIAA 2VODA 2JNJA 2DY9A 2ZH6A 3P5TL 1AUDA 4ZJOA 3VGVA 5CA5A 2IVYA 3AD9C 3HD1A 1F3FA 3CO0P 1FO1A 4JV2A 3HHLD 2FHJA 2V8HA 1FTCA 2KN4A 4M5NA 4FS1A 1KC8T 2A6OA 3GU0A 2FJEB 2JLGA 4I67A 1N5SA 4BHQA 4LREA 4YMEA 3FCVA 3C6TB 4PXDA 5ETQA 1RISA 5H1SV 2F3JA 2O01C 1X4EA 1SB6A 3KLVA 4NI2B 1VQNS 2HGNA 4M94A 4JI4F 3O2IA 3TA0A 2NXNA 2H48B 2CG4A 4ENOA 2HBZB 1C0TA 2MHEA 1EHWA 5KFKA 3ICLA 1ZM2A 3TJ8A 3PO5A 3PKYA 2QSWA 4NLGA 3C8YA 1RQ0A 1IBLF 2L41A 3KK1A 3BEGB 1T05A 1S9GB 3D6TB 3A12A 4MYTA 2A10A 2IMOA 1DTTB 4ED7A 3DLGB 3M2VA 2XNQA 3CE8A 4RBTA 1UMJA 1WEXA 1RAOA 3CCWA 1FRLA 4OV6A 4WXWA 1YRTA 2OUGA 5IT0A 1YQHA 1FWPA 4DFPA 1Q16B 1RTDA 1RP5A 3GJRB 3SBMA 3BO2A 2A18A 3P5BP 4Z2XA 1LWFB 5LM7E 2ZJRQ 2BJEA 3HJVA 2MGZA 3R1LA 5HJXA 2XTJP 2ZZMA 1WI8A 1RT5B 5B0FA 2J9DA 2FGCA 3MPVA 3R8YA 6FDRA 1DY3A 2XMVA 3CCLS 4GVBA 1M5PC 3KLHA 1HL6A 3M30B 4IFYA 1D09B 2XMKA 2WTFA 4N56A 3IS9A 5GADU 2E1MC 1G3OA 4ED5A 4ECWA 2UXCJ 4OX9J 3KHRA 4MMOA 1M1KT 2I2YA 1V9OA 2F63A 4QW8A 4NLSA 2MHNA 5GAGI 1WORA 4AYBD 3CTRA 1RI7A 1RT1A 2QYCA 4DV7J 3KK2A 3MM6A 5DQHA 1S6OA 1RK8A 1HBOA 2YPZA 2FHKA 3PFOA 1IR0A 4X64F 3H2VE 1H0HB 4C11A 4LVNP 2XO7A 3DXSX 4ECXA 2XZWA 1S59A 2MQ8A 3TAPA 1FJGF 2VL1A 3IO1A 2NXUA 2PA3A 2QYGA 1UVJA 1Y3JA 1B0VA 2KT2A 1LNQA 3KK1B 3SQOP 1WG1A 1T05B 2BR0A 2MSTA 3I5CA 1NMEB 2ZH1A 4NLVA 4Y34A 3ZZRA 1HLWA 3DKDA 2CPIA 1B0PA 4W92B 1RUSA 3CCZA 3FSXA 5L8RC 4UOFA 3UQSA 4JOUA 4C8ZA 2JZ5A 1F6TA 3BS9A 4ES2A 1W7WA 2GA7A 2ZH8A 4HI1A 3UCGA 2VC0A 1RTDB 3MCMA 1P27B 4LFCJ 3GE9A 4ZLNA 5FDLB 2X1GA 1EKSA 3DHXA 4DDFA 2CQ3A 1TTHB 2MGZB 5KG7A 4JV5J 1U2CA 2OEJA 3N5BA 4USTA 1FK9B 4B3TF 2RVJA 4GVBB 1KHVA 2X3DA 3KLHB 2BUNA 2FLOA 4IFYB 4DQPA 5KG0A 2AEMA 3IS9B 1X5PA 2IJFA 1Z2LA 2WW8A 4DPOA 2FHMA 2A3JA 4LF4J 4CO3A 4Y2KA 4FN5A 4RW4A 1FA0A 4IO1A 4ECSA 2BDPA 5T41A 4AXIA 1S49A 1K0VA 2WK4A 2YKAA 3VAIA 2HRYA 1SI9A 1WHWA 3KK2B 2AGPA 3HO1A 3GILA 3PJXA 2BW2A 4C11B 1U4BA 2HHUA 1BHNA 2E1CA 2JEJA 1CQMA 1QE1A 3K8VA 1MMDA 4OYXA 3NBPA 4LSNA 2PGCA 3MAQA 2CAJA 2P9CA 1VQSA 4Z7YA 1B7FA 4DL6A 2FJAB 3FRZA 3OFHA 3ZTSA 1V5VA 1BQNA 4ZITA 1FRJA 3DDKA 1W26A 4I2PA 3FBCA 4X66J 1NZAA 2W9BB 1N33J 4U8YA 1Z1ZA 1D0EA 3OR2B 2W9CA 2C42A 3LA0A 4NCGA 2CPYA 4RNFA 3SFGA 3K5NA 2FQQB 3NXZA 3CDAA 2CQHA 1NSPA 1RT7A 3NGTA 1QAIA 4OL8A 2IFXA 1AFIA 3C16A 4QU6A 4C0BA 3KK3A 4IOAQ 4Y6IA 2CFXA 6FD1A 2ZM6F 2H3EB 4FNIA 2VF3A 2Y1JA 4OYBA 1HR0J 2HSEB 2OP5A 4KFBA 4ZDNA 3GQCA 1Y5LB 4NMLA 3VAJA 1S79A 2OIHA 4CO1A 3H4DA 4UZCA 1DURA 4O4RA 4KGKA 1B3TA 2AJ1A 3W5ZA 3D9BA 1QUPA 5GVQA 4RBUA 2ROPA 4DXLA 1OY8A 3UDEA 4X4QA 5HLFA 2F1FA 1LK7A 2GMJA 3NG8A 4QYRA 4ZPVR 3BSCA 5E2QA 1HBMA 1K9MT 2Z0GA 2M52A 2E66A 5D4PA 1HQ2A 3D6HB 3CXCR 3DRRA 3Q8PB 1WSVA 3ONQA 2BXJA 2ZHOA 2Z57B 2UUBF 2VD3A 1XR5A 3I0RA 2FGOA 4GO7X 4CDIA 3GYXB 1TKZB 4C2MA 3T9NA 4B3MF 3ZZZA 1QE1B 4NA1A 1PJ5A 2GFFA 4JI3F 4PWUA 3H5YA 2WZ1A 2BACA 2YWGA 1B64A 1T9WA 3SCKE 1RE1B 3R3TA 2OFHX 2ZDPA 3CJSA 4GVLA 5AJ3F 2VICA 2AP6A 2LDIA 5HANA 1BQNB 4ICLA 1HBUA 3QBCA 3D6MB 4JI1J 2C28A 1SL2A 4ECZA 2CQDA 2W9CB 2NPFA 3TUPA 4CO2A 2C3PA 2MJUA 4NCGB 2MYFA 2D3O1 3SDEA 4M5JA 1RYRA 1RT7B 2RDDA 4DFMA 4B9LA 2HGMA 3HHNB 1FRKA 3BSAA 5HATA 2K3IA 1KLMA 3NKYA 4CNZA 1UVNA 1YJTA 1X5OA 1I94F 3FC9A 1HBNB 2VQEF 4L72B 4OX6A 1CEZA 4ZPDA 2OAUA 2GGPA 5J1NA 4L6V3 4OI2A 4LUBA 1U48A 4PQUA 4J9NA 2DR9A 4IOCQ 2R8GA 1CC7A 1H73A 3M05A 4DUYJ 3KHLA 3GZ7A 5DGBA 3WC2A 1SKRA 1MN9A 3PHEA 3Q8QB 2Y0BB 5HLFB 2AHOB 4ZOSA 5KFTA 4TXSA 2W2OP 4WFZA 1S0NA 1HBMB 2IHR1 3BGFA 5C24B 4HYKA 1PKUA 3FBBA 3DRRB 2UVUA 4DZDA 2EXUA 3I0RB 5KTQA 4Y0FA 1F0XA 3FVYA 4KPCA 2MKIA 1RAGB 1YDLA 4KC5A 2V4RA 5BJRA 1RWKB 3R7SB 1GQEA 2N7CA 4DJBA 1UKUA 3SIPB 4W4MA 2F8EX 2W8LA 2KKHA 3CJ2A 1LW2A 3QJJA 2V9WA 1JLCA 1NH7A 2V34A 4FYYB 4ICLB 3KFWX 5I3PA 2Z4PA 3CDWA 4W98A 1V3ZA 4FVCA 3K5MA 5F8HA 3CF5Q 4XPCA 4NYOA 2CJ9A 3MDFA 1YHQS 3K5LA 2WBMA 2DH9A 1JNZB 3SDEB 2CA9A 2R2UA 3NGUA 4ALZA 4DR1F 4EBCA 3W63A 1WDDA 1HWIA 3KLFB 1KLMB 1FDNA
chains in the Genus database with same CATH topology
3P5BP 3CO0P 3T41A 4JP8A 2QTWA 2Z30B 3A3NB 3WIVA 3BPSP 1R6VA 4OV6A 2Z57B 2W2QP 3GCXP 3BGOP 2W2MP 2XTJP 2Z58B 1SPBP 1ITPA 3SQOP 2ZWPA 2W2NP 3A3PB 3A3OB 3QFHA 3H42A 3GCWP 4NMXA 4YN3B 2Z56B 3AFGA 3WIUA 2E1PA 1SCJB 1V5IB 2W2PP 3VHQA 3CNQP 4K8RA 2PMWA 2ZWOA 2Z2YB 3WHIA 4NE9C 3VV2B 2W2OP 2Z2ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P5B P;  3CO0 P;  3T41 A;  4JP8 A;  2QTW A;  2Z30 B;  3A3N B;  3WIV A;  3BPS P;  1R6V A;  4OV6 A;  2Z57 B;  2W2Q P;  3GCX P;  3BGO P;  2W2M P;  2XTJ P;  2Z58 B;  1SPB P;  1ITP A;  3SQO P;  2ZWP A;  2W2N P;  3A3P B;  3A3O B;  3QFH A;  3H42 A;  3GCW P;  4NMX A;  4YN3 B;  2Z56 B;  3AFG A;  3WIU A;  2E1P A;  1SCJ B;  1V5I B;  2W2P P;  3VHQ A;  3CNQ P;  4K8R A;  2PMW A;  2ZWO A;  2Z2Y B;  3WHI A;  4NE9 C;  3VV2 B;  2W2O P;  2Z2Z A; 
#chains in the Genus database with same CATH topology
 2DNQ A;  3TRG A;  2I8E A;  4K5R A;  1JLQ A;  1J2V A;  4IH6 A;  3D3B J;  1WEZ A;  4N8O A;  3MPU B;  2DNR A;  4ERD A;  2GGP B;  3MFI A;  1FWK A;  2JC0 A;  1IKY B;  2I5J A;  2K1R B;  3TVK A;  2AYE A;  5E7O B;  2CWX A;  3HP6 A;  4PQU B;  3N6N A;  4TU7 A;  1FT8 A;  2E1R A;  1CJU A;  1JXE A;  2EG2 A;  2OPP B;  3I96 A;  4LFB J;  4ZVR B;  2UXC F;  4OX9 F;  1Z4U A;  4OI1 A;  4LR7 A;  3D5M A;  4PRF A;  2MB0 B;  3FZB A;  1EB0 A;  2DGU A;  4UUW A;  4KBI A;  4F0K A;  2R4F A;  4I68 A;  5KFQ A;  2XHW A;  1OS5 A;  3RAM A;  3BYP A;  3TOQ A;  2VG5 A;  3CED A;  5AXM A;  1H2U X;  3GMG A;  4DV7 F;  1S48 A;  1D8Y A;  1W25 A;  2QL7 B;  4JI7 J;  2BAB A;  3DM2 A;  4O3Q A;  3DDN A;  2AF6 A;  3SMZ A;  2VPY B;  1XWL A;  1SJ4 P;  3ZNJ 1;  2YQ3 A;  4USH A;  4IG3 A;  3GSD A;  5LJ5 Y;  4EBE A;  2NZC A;  2R7T A;  3GTY X;  1L3K A;  1RAD B;  4F7V A;  2RU9 A;  5THW A;  2NXJ A;  1K0T A;  1X4G A;  4N8N A;  1R8B A;  2ZEJ A;  3DLL Q;  2DCU B;  1LW2 B;  4ZP7 A;  4BLG A;  1JLC B;  2OSQ A;  3Q89 A;  3NCR A;  4PG4 A;  3DMJ A;  4K59 A;  3M2U B;  2H5I B;  2FDN A;  4TKT A;  3CDE A;  3SV4 A;  3GYG A;  5M2U A;  4A8Y A;  1RT3 A;  2JJ4 D;  1FFW B;  3Q8R B;  3JAM Y;  4JI8 F;  4XDC A;  2LA6 A;  3HMJ G;  1AXQ A;  2XYH B;  3BQ2 A;  4ZPT R;  2R8H A;  4MJK A;  2R42 A;  4CT9 A;  4P7V A;  1TMM A;  1NPK A;  1KP6 A;  4JV5 F;  1JLQ B;  2AV5 A;  3CW2 C;  1Q8K A;  3V6J A;  2ROE A;  2HWH A;  2EKN A;  2QLW A;  4JI5 F;  4TY8 A;  1VQ6 S;  2DEJ A;  1UPM B;  2FTR A;  1PBU A;  2XLI A;  1LWE A;  2UZA A;  2I5J B;  5KFM A;  4FKX A;  4AXJ A;  3WIU A;  4Z7C A;  2JC1 A;  3ZTQ A;  2AD9 A;  5I42 A;  3QPI A;  5KAK A;  5A8W A;  3OV7 A;  1AZS A;  2MXY A;  2FLL A;  2V4J A;  4E2F B;  2HW3 A;  2BKO A;  1K73 T;  3SSQ A;  1M5S A;  2ZE2 A;  2VG5 B;  2HNY A;  4WXO A;  3DN9 A;  4ANE A;  4PXC A;  3LW5 C;  3RJM B;  2HHH F;  1K1S A;  3DM2 B;  3FSY A;  2HFO A;  3LP0 A;  1XMO F;  4YY3 J;  4IG3 B;  3WIV A;  4U8V A;  2MJN A;  4CI0 B;  1SJ3 P;  3O6Q A;  3A8I A;  4FF3 A;  3CIZ A;  1NSQ A;  3GIJ A;  3U1L A;  4IR1 A;  5GMD A;  3X3U A;  4L76 A;  1F2G A;  4WE1 B;  3DMJ B;  4PG6 A;  4X4N A;  3GLJ A;  1RU1 A;  4X66 F;  2ZZN A;  2V67 A;  2YVS A;  2HS4 A;  3R7N B;  4USW A;  5KFP A;  2QN6 B;  2D74 B;  1RT3 B;  3R2C J;  1UWB B;  1Q81 T;  3QGH A;  4U9R A;  2NXC A;  5AXN A;  4J91 A;  3GG0 A;  1KQF B;  4LSZ B;  2XSF A;  1HNV A;  3DDI A;  2C2M B;  1R7I A;  1DJ0 A;  3PVX A;  2DRA A;  3AA8 A;  2C3O A;  5ETP A;  4GKJ J;  3AB2 B;  1U24 A;  1SKU B;  1FVS A;  1EP4 B;  1IBC B;  2E7W A;  3PW4 A;  2RHQ B;  4JB8 B;  2Y3Y A;  4TY8 B;  4Y2M A;  2FPH X;  3H25 A;  1OMS A;  1N5Y A;  4DS5 A;  4HDG A;  5D15 A;  2MKC A;  2WHO A;  4YP3 A;  4Y2I A;  1RTH A;  1NDC A;  2DIV A;  2ZOF A;  4F4X A;  2IBO A;  3EVM A;  2ILZ A;  2KYZ A;  4DSJ A;  3NGK A;  5I4M A;  4KY3 A;  2QZ8 A;  2OPQ B;  4ZVO B;  2DGO A;  3W2V A;  2V4J B;  5HRO A;  1LQ9 A;  2D9P A;  4RJV A;  5IT9 U;  4URS A;  4QIE A;  2G0J A;  2IRY A;  2K8G A;  2QLX A;  3T3F A;  5HK4 A;  4A8O A;  2ZE2 B;  2HNY B;  2PII A;  3UDC A;  3C6U A;  2C2Z B;  2GHV C;  4I64 A;  5KT2 A;  4M63 A;  2C2E A;  2AZ1 A;  3QRR A;  2D1C A;  4G1I A;  3LP0 B;  1UAW A;  3CO9 A;  5IFM A;  1KFD A;  4C6A A;  1YZ7 A;  4NAS A;  3W64 A;  3HM9 A;  3WHI A;  3IA0 A;  2CJX B;  5C5J A;  1WHX A;  4FS2 A;  4DPX A;  3P8B B;  4F25 A;  3OPK A;  2UVW A;  1X4F A;  2IJN A;  5DQI A;  2AGQ A;  4QZV B;  3EE3 A;  2AMC B;  2HFV A;  4JI1 F;  2NCK L;  4XTT A;  2ZD1 A;  2VUG A;  2NRE A;  3HXM A;  4P2S A;  2DHA A;  4TVA B;  1MWY A;  4DN9 A;  1HPZ A;  4HDH A;  1BQM A;  1VQ5 S;  3TYT A;  2Q6B A;  3BB5 A;  1WKK A;  3N28 A;  3MCN A;  4BDP A;  5A2Q Y;  4OHV A;  4GC7 A;  3QT6 A;  1C1C A;  4ED1 A;  4O0N A;  2F9D A;  4UF4 A;  4RNM A;  3KMQ A;  2HEK A;  1WOS A;  1X4A A;  5ETL A;  5KFH A;  3CC4 S;  5IM0 B;  3G71 S;  3TZZ A;  1PIE A;  2B6A A;  1X60 A;  1LEO A;  2VBZ A;  3L4B C;  3O8W A;  4C4W A;  2GML A;  1YRX A;  1GX5 A;  4JV0 A;  4Q5V A;  1N5Y B;  3CGI A;  4MKY A;  3SZ2 A;  1RTH B;  3W65 A;  3CB4 A;  2HBR B;  2RQM A;  1IJE B;  4TYB A;  4DUY F;  2M2B A;  3FQL A;  5KFY A;  3RYL A;  3W2V B;  1RWX B;  5HRO B;  2WVF A;  2C2D A;  2LFV A;  2BE9 B;  2Z2L A;  3I5B A;  1U1K A;  1GT8 A;  3NS6 A;  5K14 B;  1S1X A;  2V2Q A;  5LMN J;  1RAH B;  2LXF A;  3C6U B;  1YIT S;  4KB7 A;  1HA1 A;  3A4T A;  4G65 A;  3IWN C;  4LF9 J;  3GWC A;  3LQV A;  3V2U C;  3O44 A;  1HQE A;  2EW9 A;  4QR2 A;  5EWG A;  4TU8 A;  3FNN A;  1TL5 A;  3RB4 A;  2BE7 D;  2LQ8 A;  3P49 B;  2RRB A;  2DJW A;  4EEY A;  5HO4 A;  3BR9 A;  4DX6 A;  4U7C A;  2CQP A;  1BGX T;  3D7S B;  1S0O A;  5I3Q A;  1GFW B;  2ZD1 B;  3PR4 A;  4DWI A;  4NL5 A;  5A2Q U;  1M90 T;  1HPZ B;  1AA1 B;  3C14 A;  1BQM B;  4DZ6 A;  2DNZ A;  3HVW A;  3PYF A;  1JB0 C;  1RGV A;  2OHD A;  4F4A A;  2PI5 A;  2BJ1 A;  2JFK A;  1N48 A;  4BWM A;  2BKN A;  1PYO B;  1SJQ A;  2PT0 A;  3MUM P;  2FVS A;  1CPZ A;  1PC5 A;  1WUU A;  5CQG A;  2M8H A;  3IBW A;  1PJ6 A;  1T11 A;  2E5I A;  3D2W A;  2CPH A;  4AL7 A;  1DRZ A;  3N4W A;  5ETO A;  3R5D A;  3IGN A;  2B6A B;  4DX8 H;  4R5P A;  3AOB A;  4L3K A;  1HWK A;  2W2P P;  3HKZ D;  3OR1 B;  3CC2 S;  5HN0 A;  1XQI A;  3HHL A;  3BN4 A;  3PW0 A;  1X7V A;  3I4H X;  3TO8 A;  1URN A;  4RW6 A;  4P75 A;  3T1A A;  2QA4 G;  4PG8 A;  3PRV A;  4RPF A;  1GTE A;  4FPI A;  1KVI A;  3AXM A;  1VOM A;  2R7O A;  3MFH A;  2AIR B;  2B7C B;  3T1Y J;  4M1K A;  1KTV A;  1XK8 A;  1S1X B;  1WC3 A;  1NK9 A;  4JI7 F;  3MI7 X;  4R0J A;  4B3O A;  2R7W A;  1JK9 B;  4CRJ A;  3H90 A;  1BC6 A;  4EYH B;  2E5H A;  3D0H E;  4DL4 A;  3BM7 A;  3ZZT A;  2DH8 A;  4B3S J;  1GXL A;  1NEE A;  2YWW A;  3LGN A;  2DIU A;  5E3R A;  4I2Q A;  2CPF A;  1UP1 A;  3NGR A;  5KT6 A;  2CDR B;  1HI8 A;  1SH2 A;  1IQT A;  1N52 B;  4C8M A;  1UJ5 A;  3IXQ A;  2OEL A;  2OTL S;  3M9N B;  2V6A A;  4LJM A;  4YN3 B;  2YNF A;  4PPD A;  4ETX A;  4X4R A;  2E9Z A;  1JJH A;  2KJV A;  4ZPA A;  2ZH3 A;  1WAC A;  5J2P A;  2VKR A;  1SC3 B;  1YBT A;  2AYG A;  1NZ8 A;  3RU0 A;  3THP A;  2VG6 A;  4ER8 A;  3W5X A;  3VAK A;  5CAB A;  3ET6 A;  4YEA A;  3LO3 A;  3CJ8 A;  2ZFH A;  1E6Y A;  3B4M A;  4OYP A;  4QBU A;  3BN7 A;  2NPI A;  2OD4 A;  1YWX A;  3M8Q A;  3AJD A;  2EEY A;  4G6V B;  3JXO A;  3MEG A;  5HL7 Q;  3U27 A;  2RQC A;  2J7K A;  3NS5 A;  4R5P B;  5CCL A;  4OHZ A;  4A8S A;  3I82 A;  3CDU A;  3HHL B;  1J5O A;  2XY6 A;  2BEF A;  2OTJ S;  4RW6 B;  1AYE A;  3MPY A;  3M8W A;  2G2O A;  3L7U A;  3K5O A;  1R89 A;  5KFX A;  3LPY A;  3KYL A;  1BWV A;  2KI2 A;  4WFY A;  4QWB A;  1HNI B;  3IR5 B;  3HD2 A;  2BM0 A;  3EDR B;  1G4C A;  2DNK A;  3MOJ B;  4B3O B;  2YH0 A;  3TWZ A;  4I56 A;  2H1Y A;  3N9U C;  4DBQ A;  3VAG A;  4DV5 J;  4CP5 A;  4DU7 A;  4MH8 A;  2Q66 A;  4AD6 A;  5IV4 A;  4I2Q B;  4IH5 A;  4AUK A;  2HHQ A;  1NKE A;  1IQZ A;  4CH1 A;  1GEH A;  4FYD A;  2RUS A;  3CME S;  1NBE B;  2G2Z A;  3GPA A;  4MAK A;  1NND A;  4PYD A;  3SQG A;  2FJD B;  4F2S A;  2R7Q A;  1U1L A;  4CO4 A;  2ATL A;  5EDW A;  5J2P B;  4OJH A;  3HT3 A;  2CQ2 A;  2AJ2 A;  1U1M A;  3KDN A;  2MQP A;  2RUG A;  3HHK A;  3CCJ S;  5BR8 F;  2XM3 A;  4K5S A;  1X31 C;  3IRX B;  1TAU A;  1VJW A;  3BRE A;  1E6Y B;  2MZ1 A;  4KHP J;  2RIL A;  2PMZ D;  1XER A;  3JSR A;  3M8Q B;  5IOL A;  4GKJ F;  3W2W A;  4TLR A;  3QRP A;  3KKF A;  4P7T A;  1NSK L;  4C8N A;  4FF2 A;  1RT4 A;  3C3L A;  1HWJ A;  2EFQ A;  3M2R A;  4OZL A;  2B9W A;  3EGW B;  2ZDO A;  3SSR A;  4JV1 A;  1J5O B;  4DCJ B;  2PD1 A;  2Q43 A;  3H2U B;  3U1N A;  3CC7 S;  2VBX A;  3MAA B;  2R7R A;  3F44 A;  4GRS A;  1DFD A;  4CO5 A;  1WOO A;  3PXG a;  2UP1 A;  2XSJ A;  1JJ2 R;  1U2R A;  1UA0 A;  2MZS A;  1REV A;  3J7Z 5;  2BOA A;  2B7B B;  4LFA J;  3FCW A;  4IFV A;  3H5S A;  1DHM A;  4I1T A;  2MZR A;  2KZM A;  3MM5 A;  5F8G A;  3V4I A;  2MQM A;  1X9W A;  2CNK B;  2UUC F;  2R2S A;  1RHM B;  2ZKT A;  2X7I A;  5D4N A;  2AJQ A;  4FKY A;  2XMT A;  2K06 A;  4LVO P;  3TUI C;  4ZPC A;  3I4P A;  4ZPB A;  3F41 A;  1M5H A;  2FC8 A;  3D0I E;  9RUB A;  1TUG B;  2IIH A;  1HNX J;  4URQ U;  3SQG B;  1NJX A;  3MCS A;  3H0P A;  3H20 A;  3PW7 A;  4DU8 A;  3RGI A;  2D41 A;  3VQT A;  2HHP A;  4IO9 Q;  2IDE A;  1NHU A;  2RU3 A;  1NB7 A;  5EX3 A;  1NK7 A;  3MWB A;  4MIA A;  2RF2 A;  2DVI A;  3QAU A;  3R5G A;  2HQG A;  1Y4Z B;  4FDF A;  1U47 A;  1RYS A;  3GCX P;  2UU9 F;  4OJ1 A;  3I6P A;  3P96 A;  3W2W B;  2DIS A;  2RQK A;  2E5L J;  5A76 A;  1FDD A;  3AXK A;  3TUZ C;  2OI2 A;  2E9T A;  4CLF A;  1T9T A;  3M2R B;  1RHQ B;  4DV2 J;  2WON A;  4G3I A;  1T9V A;  2KHC A;  4DQQ A;  2ILY A;  2EPI A;  3M32 A;  1UVL A;  1XNR F;  5KFJ A;  3FEX B;  1HNZ J;  3AA9 A;  2PFF B;  1LV5 A;  4BC7 A;  5JVG Q;  4HEA 9;  2XSJ B;  3W66 A;  3BV8 A;  2R2R A;  2XS7 A;  1REV B;  3OBI A;  1UVI A;  3IBC B;  4WTY A;  4WWS A;  3R7B B;  5LMN F;  4YR3 A;  2QRR A;  2MKJ A;  4ZPW R;  1LXN A;  2EFO A;  1RT2 B;  2HBQ B;  1RZM A;  4F0M A;  4OYM A;  1WDT A;  3MM5 B;  2ZUA A;  3V4I B;  2CWK A;  3NP5 A;  2W01 A;  1ACM B;  1O6X A;  2KM8 B;  1GXT A;  3H8Y A;  1P6T A;  4CCH A;  3TX0 A;  4Y2A A;  1KBR A;  5CYM B;  4WU2 A;  1X4B A;  2PMW A;  3S1T A;  3M7V A;  4HTJ A;  1U49 A;  3NNA A;  1GMW D;  2MQL A;  3HCX A;  4KJI A;  5FJ4 A;  3H2L A;  3PJW A;  1UL3 A;  3MED A;  4AL5 A;  5KG6 A;  2B4U A;  4ZCM A;  1WNE A;  2B4O A;  2FUG 9;  5B09 A;  2QMW A;  3JTP A;  1NK8 A;  4Q0B A;  4MFB A;  1FDB A;  1C2P A;  3IR7 B;  4P6Q A;  1YI2 S;  2FZG B;  1FD2 A;  3VGT A;  1R8C A;  5KT3 A;  3IM9 A;  4LRA A;  1Y11 A;  3CCT A;  3HVA A;  3PYG A;  3AD7 C;  4CNY A;  4YDX A;  4QU7 A;  3HT0 A;  3KUH A;  3M32 B;  3GIK A;  3BQ0 A;  3PR5 B;  2J0Q D;  2BAN A;  1M1H A;  3PTW A;  2KM8 C;  4OZ0 A;  4NE9 C;  4CLS A;  3ENW A;  3BH6 B;  3GFX A;  1SJF A;  2QL5 B;  2AJ0 A;  1H2T Z;  4A8K A;  2KRB A;  5A8R A;  4F36 A;  4TYA A;  3T1Y F;  1ITP A;  4R0E A;  1CJV A;  4KRW A;  5ETM A;  5DRK A;  2V8V A;  5G0R B;  1QLN A;  4B02 A;  4KGM A;  4AQY F;  2H5E A;  3I32 A;  3FKB A;  4U96 A;  2AYB A;  4ED2 A;  1KQK A;  2ERR A;  3QT8 A;  1U45 A;  4UY8 T;  3IC1 A;  4MIW A;  1UJ4 A;  4FP9 A;  2MKK A;  3J7Y U;  2VBY A;  3RTV A;  2HKE A;  3FGV A;  2QLF B;  4B3R F;  3AOA A;  4ID5 B;  1XJW B;  4F02 A;  3JSM A;  3BO4 A;  3MM8 A;  4LBP A;  3TVY A;  5DGA A;  1K44 A;  4RR5 A;  2XGP A;  4OX7 A;  1HAR A;  2IM1 A;  4PG7 A;  1RWO B;  2GAG C;  3G82 A;  2XS5 A;  3WQP A;  4NLO A;  1EAY C;  3MUV P;  1IN0 A;  1SH0 A;  3K7R A;  2W2N P;  4L3N A;  3GII A;  1RHK B;  2NQP A;  2FZC B;  4NZ6 A;  2IAJ A;  1X4C A;  1N88 A;  1S6Q A;  3BPD A;  1ZM3 A;  5A6P A;  5L9N A;  1YTY A;  1WOP A;  4Q0B B;  4YB6 A;  2J0W A;  5J2M A;  3CUL A;  2CYY A;  2KG1 A;  4UW2 A;  2CNO B;  1SH3 A;  4DV1 J;  2VC1 A;  2LXU A;  3QAE A;  4Q8E A;  3H59 A;  3KJV A;  3M8R A;  2ASL A;  1OO0 B;  1SIW B;  2XI2 A;  3EXY A;  1BMQ B;  3DRX A;  4NLX A;  4WJB A;  4GO5 X;  2PN6 A;  5HJY A;  3CIM A;  4NRU A;  4UTG A;  2B9E A;  4CLU A;  4ECR A;  2QIF A;  4W90 B;  3G8Q A;  3PYE A;  5A8R B;  1X4H A;  3Q23 A;  4D3H A;  5KOX A;  1SIZ A;  2B5J A;  2GC8 A;  4IR9 A;  1CJV B;  3DOM B;  1Q8I A;  4OIX A;  2G0I A;  3CJ5 A;  4NX9 A;  3H42 A;  2D9O A;  4P73 A;  2R7U A;  4DPU A;  1SC6 A;  1IXK A;  4DV5 F;  4CLL A;  4MIB A;  4RU2 A;  1U2F A;  3QIP B;  3IGV A;  4ZHR B;  2ZZT A;  2M0G B;  1EZZ B;  5HP1 A;  4K4Z A;  2LEP A;  3MMB B;  1KWM A;  1Q53 A;  5FLX Y;  3JSM B;  3VV2 B;  2VQF J;  1LKZ A;  2FVR A;  1ZAX A;  4ZIW A;  4K4W A;  2SXL A;  2BM1 A;  2EK1 A;  3FCH A;  3WC0 A;  3BSO A;  1V3R A;  3TAM B;  1RAA B;  3HUL A;  1FD8 A;  1WF2 A;  5KFV A;  1WG5 A;  1S77 D;  4RU9 A;  5SUH A;  4U6P A;  1ZTT A;  5F8L A;  2IAJ B;  1FNX H;  1S6Q B;  3OXL A;  1AW0 A;  2QC3 A;  4KHP F;  1KNZ A;  5D6G A;  5DDP C;  2RJZ A;  5J2M B;  1FJC A;  1WSR A;  4RL1 A;  3PJ9 A;  3BGO P;  5J1E A;  3PKM A;  2MZT A;  2N3L A;  4KGV B;  5EHH A;  1X9M A;  1HYS A;  2K7J A;  1VQ4 S;  5I3U A;  3BDE A;  2CJQ A;  3KJV B;  4RO0 A;  4DI6 A;  4J9R A;  4IRD A;  2GS8 A;  1U8W A;  2PSZ A;  2BQU A;  3NY0 A;  4CIO A;  2BKP A;  4PCQ A;  3VTI A;  3F0N A;  5SZT A;  4DR5 J;  2OEK A;  4XPE A;  3DLE A;  4JYA F;  4DPT A;  4PZV A;  2EC2 A;  5D4L A;  4X4P A;  2B5J B;  2ALY B;  3PRB A;  5IXU A;  2NYI A;  4LFA F;  2M3D A;  4FBU A;  1NRK A;  1V5I B;  1RCX B;  4L74 A;  3DGV A;  3GFZ A;  2ZM6 J;  2W7O A;  4UOH A;  4ANC A;  4E8U A;  5ITH A;  2MTL A;  1N34 J;  1RT6 B;  2YKO A;  5B0G A;  4QIG A;  1RKI A;  4B9T A;  5HP1 B;  2MLY A;  2L08 A;  1K1Q A;  4NLY A;  3OSP A;  4NOH A;  2Q6C A;  4IH7 A;  1HHS A;  2Q1L A;  5JMN A;  2DHH A;  4ZVF A;  1C1B A;  4CLW A;  1EET A;  5D0H A;  1PO6 A;  4EUV A;  1O5J A;  2OPR A;  2HK2 A;  2D7S A;  4YUD A;  1ZA1 B;  1VRT B;  3D1Q A;  4HTI A;  1D1U A;  3GFH A;  5FD1 A;  3IWX A;  3RBX A;  2XBP A;  3SCI E;  4X4V A;  1HD1 A;  4NI2 A;  4KO0 B;  2XB2 D;  3GJS B;  3ILI A;  1B4S A;  3UD5 A;  4B3M J;  1HHT P;  1U6B A;  3QJP A;  5GAE U;  5J1E B;  1HYS B;  2MLX A;  3H5U A;  1R6V A;  1IM6 A;  4DV2 F;  2XEX A;  2Z58 B;  1LFP A;  1NB2 A;  5AJ3 J;  3THT A;  2AT1 B;  4C7Q A;  2X1F A;  4IQM A;  1J5E J;  4KSE B;  3QGI A;  1RLD A;  2OSR A;  3G86 A;  3DLE B;  4WBF A;  2QO3 A;  4H4M A;  5E3Q A;  1NJZ A;  3OJU A;  5DM6 Q;  4F4Z A;  4DS4 A;  1Q95 G;  2QG9 B;  1YVF A;  3KLE A;  3QZ7 A;  3IG1 B;  4ELV A;  2Y8W A;  1WWH A;  4QCL A;  1NLK L;  3U1M A;  1QAY A;  2KRR A;  4KGZ B;  2UUA J;  1I94 J;  3LGM A;  5BXI A;  3F73 A;  4ILR A;  5H9F J;  3G4S S;  1VLY A;  2C3M A;  1B70 B;  3G87 A;  1HWU A;  3M30 A;  2HZA A;  1EJ7 L;  4AT1 B;  4JBC A;  5HI7 A;  3VHQ A;  1VBK A;  3FBE A;  2CJB A;  4RKU C;  1NDL A;  3I0S B;  4TU9 A;  1C1B B;  3E8O A;  1EET B;  3LP1 A;  3J81 U;  3EZU A;  4K4T A;  2XHC A;  1RBO B;  2OPR B;  5KG3 A;  4OFZ A;  3ITH A;  2VFS A;  4OHY A;  4X62 F;  1T03 B;  1NJW A;  1H2V Z;  1NK4 A;  2LMI A;  3ENA A;  1HIY A;  1UZH A;  1NKC A;  2HIQ A;  2FD2 A;  3B8H A;  3Q8S B;  2O67 A;  2R7V A;  1H6K X;  1YJ7 A;  2E9R X;  3R6G B;  2H54 B;  4KH1 B;  5IV3 A;  2DR8 A;  3AQO A;  2CQ4 A;  1Q1K A;  4KE5 A;  1FX4 A;  1JJ4 A;  1DQ8 A;  2FIU A;  5DG7 A;  1F60 B;  1FFG B;  3Q8Y A;  3NMA A;  4DQR A;  4QWC A;  4QWA A;  3RB0 A;  2KTQ A;  3ILO A;  5A0Y B;  3IRW P;  2IRX A;  3RBE A;  3ADA C;  4H4M B;  4P52 A;  2E1A A;  2Q79 A;  2W4C A;  4C9D A;  3DYA A;  4DR1 J;  1VHI A;  3KLE B;  1UW4 A;  3OSN A;  1PYT A;  4MT1 A;  5BYR A;  3UDL A;  1FJ7 A;  2ADB A;  5FDL A;  1FKP B;  3VAF A;  2GX8 A;  3KUE A;  3DCA A;  2OLW A;  2RH3 A;  1RSC A;  1FK9 A;  2HK3 A;  1VLO A;  2IVF B;  1S1W A;  2V5H G;  2ZH5 A;  5DG9 A;  4DV0 J;  1HMV A;  3GV7 B;  3G9C A;  3RW7 A;  1SQG A;  3EYZ A;  2MQO A;  2EFP A;  2F5G A;  1VQ9 S;  1RXO B;  3LP1 B;  1S9F A;  5DET A;  1IBK J;  3HFZ B;  3ITH B;  5J2Q A;  3Q86 A;  2EI5 A;  5H9E K;  2YKP A;  5F41 A;  3JSY A;  1U8S A;  1TL3 B;  3PM9 A;  2BOP A;  5IQQ A;  3VGS A;  4B9M A;  2DY1 A;  4FZV A;  4NXM F;  3QSY B;  4DV1 F;  1VQY A;  1N8R T;  2XLJ A;  2D3O R;  5K9F A;  5KG5 A;  1CLF A;  4P9S A;  4OHX A;  2A2C A;  2JSX A;  1JNR B;  5IT4 A;  4WZQ A;  4OZJ A;  2MZQ A;  5KFN A;  5CD4 A;  2E7X A;  3BKU A;  5F8I A;  2CPZ A;  1HI1 A;  3M6U A;  2HFN A;  4YHH J;  4KGX B;  2W9B A;  2V63 A;  5CYJ A;  3OR2 A;  5AXL A;  4ECQ A;  4M5D A;  1UA1 A;  4WYL A;  5KG4 A;  2HBY B;  1IKX A;  1Y00 A;  4ZP9 A;  2MPU A;  1GH8 A;  3DYA B;  4ES1 A;  4JI8 J;  2VJV A;  2L48 A;  3SCJ E;  1WC6 A;  1PAU B;  3HI9 A;  5KT5 A;  4NXN J;  1XR6 A;  2MEW A;  1FF2 A;  4K4Y A;  2XMU A;  5IQ6 A;  3W62 A;  4A8W A;  1S0M A;  2Q3P A;  4USM A;  5LXR A;  4KV8 A;  4JI5 J;  1S1W B;  2CQG A;  1HMV B;  2H5J B;  4XDD A;  1SC4 B;  4DV4 F;  3JQJ A;  2VQF F;  5L1J A;  2GMH A;  2BX6 A;  2J9E A;  3TEH B;  5D0G A;  3EPI A;  1G6B A;  2XQC A;  4J9V A;  2GO8 A;  4ZS6 A;  4LF7 F;  1RTJ A;  5J2Q B;  2GZO A;  4JP8 A;  2Y8Y A;  3H40 A;  3BPS P;  5L1L A;  3KHH A;  4ZP8 A;  3Q83 A;  3BBB A;  3EXC X;  2HHH J;  1MML A;  3G6V A;  2I38 A;  3RZA A;  1NU4 A;  5DJB A;  2LQJ A;  5CAA A;  2ASJ A;  4K8R A;  4Q43 A;  2FY1 A;  1R3N A;  4EYI B;  3L7P A;  2YWK A;  1XMO J;  1TKZ A;  1U1R A;  1L3U A;  1CUL A;  2PE8 A;  1ICE B;  3ZC4 A;  1UTA A;  4LT6 A;  3T5L A;  3DOL A;  3TZY A;  4CH7 A;  4DSF A;  4C0O C;  3ZTR A;  4N77 A;  4QPT A;  2G1D A;  4C0H A;  3DRY A;  1VQM S;  4K4S A;  3R27 A;  2R8J A;  1W2I A;  4DR5 F;  1SV5 B;  4WK3 A;  4K2X A;  1NPR A;  4M5D B;  1K47 A;  4QIF A;  2C22 A;  3IP0 A;  4Q2M A;  1Q0N A;  4QYZ J;  3FEY B;  2HFS A;  5M2R A;  4BWJ A;  1IKX B;  2P9E A;  2RSQ A;  1RAC B;  5JUM A;  4DCO B;  4K2J A;  1ZOT A;  1IJF B;  2R8K A;  5JVH Q;  1HWL A;  1TL1 A;  3CJ3 A;  4DL3 A;  4RUH A;  3N0V A;  2QEX S;  5L1I A;  2KU7 A;  3H5X A;  2LEB A;  2BJ8 A;  3AB4 B;  1V6H A;  1HBN A;  1N34 F;  4DHV A;  2QFI A;  3CPW R;  2DNO A;  4X2B A;  1X5S A;  4KV8 B;  2WVE A;  1CJT B;  2DR6 A;  1VRU A;  5JXS A;  1QM9 A;  4S0M A;  2CXE A;  5DZ7 A;  4OI3 A;  3L09 A;  4ILM A;  4CLT A;  3FMW A;  4WU3 A;  2BE2 B;  1N5V A;  2A0F B;  1WC0 A;  4U67 Q;  1BQX A;  2HIY A;  2PC6 A;  2DR5 A;  1H3D A;  4EI2 A;  1FJE B;  1RTJ B;  2WVD A;  3EZO A;  5F0W A;  5LJ3 Y;  3T19 A;  2QX0 A;  3AJ1 A;  4B9S A;  5CCM A;  3GB0 A;  2HAI A;  5C24 A;  3QSI A;  1K8A T;  3UD3 P;  2IM0 A;  1JXV A;  3MR6 A;  1WC1 A;  4HLB A;  2CQB A;  4WFN Q;  1H7X A;  4J37 A;  2M70 A;  3U02 A;  4B9U A;  2RML A;  4OYA A;  2O3D A;  1CUL B;  2E7V A;  1TEL A;  4PAA A;  4C3K A;  4KT0 C;  4KYZ A;  1PBA A;  1KON A;  3PCO B;  4DR7 J;  3PG9 A;  3DOK A;  3DOL B;  5EUH A;  2QFJ A;  3FEZ A;  2LQ9 A;  1LWX A;  2ZBI A;  1YRU A;  1Y0H A;  4WK1 A;  1IVZ A;  4LF6 F;  3VVU A;  2Z2M A;  4M5L A;  3Q2S C;  1J5E F;  1UPP A;  3GFY A;  2FJW A;  2DT9 A;  5KT7 A;  4FXD A;  2HGL A;  4DMZ A;  4UZB A;  4MTP A;  3TQE A;  1FNM A;  1S7H A;  1NH8 A;  1BXN A;  1UWA A;  3P3D A;  1MNE A;  3V6H A;  3JYT B;  4USV A;  1TL1 B;  4C8K A;  1F1B B;  5H9F K;  3KLF A;  2R7S A;  3BSN A;  4DL0 C;  5FII A;  3W8P A;  2FB0 A;  2D3Z A;  2UUA F;  2XC9 A;  2BRK A;  1XBW A;  2EG1 A;  1RDR A;  1B0T A;  2XMJ A;  2HHW A;  1IKY A;  3L95 X;  1VRU B;  2K1R A;  3X1L B;  2VOP A;  1G1X A;  2B3T B;  2ZNZ A;  4PAB A;  5ETV A;  5B0E A;  3C2P A;  2I1R A;  1LFW A;  1XNQ J;  5ETT A;  2V2V A;  2W4D A;  4DV6 F;  4CTA A;  2OPP A;  2CZ4 A;  2MY8 A;  2DNG A;  1N32 F;  2PI4 A;  4ED6 A;  3LH2 S;  4ZLP A;  5LXY A;  3PEJ A;  2HMI B;  1FFS B;  3M6W A;  1TL4 A;  5J1P A;  4LQ3 A;  3UCU P;  3IFE A;  5CYQ A;  1NSA A;  2IA0 A;  4B17 A;  4QWE A;  1T9X A;  1WEL A;  1RWN B;  3UWT A;  2PFD A;  1N0U A;  2C2R A;  1DQA A;  1L3T A;  3IAM 9;  4PKD B;  2XZT B;  3G6X A;  3DOK B;  4KR0 B;  1ULR A;  3TR5 A;  4NCA A;  4QJV A;  2ZC4 A;  2WW4 A;  2CPX A;  1IUJ A;  4J7C A;  4ATN A;  3CWJ A;  5F8M A;  3GON A;  3DXB A;  3J7Y I;  3EZ5 A;  2NUU G;  1XTZ A;  1Q5V A;  3M2U A;  2DXF A;  3IBF B;  3BQ1 A;  5B7W A;  2HND A;  5KFA A;  3RB6 A;  5AT1 B;  5D0E A;  2FYX A;  1TP7 A;  4WP3 A;  3K58 A;  1Y7P A;  1OSD A;  4HT5 A;  2UV8 A;  4CZC A;  1GK8 A;  4FNH A;  2YX1 A;  5E41 A;  3DNC A;  5LSO A;  2H4W B;  2DGS A;  2DKO B;  1ZM9 A;  4NMX A;  3MAH A;  2B4V A;  1VBY A;  1NDK A;  4LR9 A;  3LF0 A;  3FBF A;  4LF5 J;  3D3C J;  1JLF B;  1MMN A;  3NRB A;  4FF1 A;  4Y3C A;  2CVI A;  2KH9 A;  1VIS A;  2CJY B;  1KS2 A;  2BJ7 A;  4DV0 F;  4DUZ F;  4USK A;  2J6T A;  3D68 A;  3GV5 B;  2VAS A;  3EDQ B;  4J9Q A;  2IBK A;  5K5M A;  1GMW A;  4DF4 A;  1WG4 A;  4CTA B;  1I5O B;  1D3W A;  4ZVG A;  3J81 j;  2VFV A;  2UVV A;  4CLZ A;  4LRD A;  4HH0 A;  4UOC A;  5E3C A;  5GAH U;  3TQ1 A;  1IBK F;  4OQJ A;  4HHU A;  2HLU A;  3JTO A;  2J7W A;  4LIR A;  3T6B A;  1UEU A;  1GX6 A;  3FK4 A;  2HWI A;  1KFS A;  5CYQ B;  1JWW A;  3TA1 A;  2VZ9 A;  4J9S A;  1QVF R;  4NLP A;  3EMT A;  2H9Z A;  1AUS L;  4YB7 A;  2ZHA A;  1TZ0 A;  1Z2Z A;  4YFU A;  1WKJ A;  1LW0 B;  4NA2 A;  5KFB A;  3PY8 A;  2GJF A;  2WVB A;  4BS2 A;  1LK5 A;  2KXN B;  2APO A;  3MF5 A;  4HVZ A;  1TVR A;  4ZVS B;  4OI4 A;  3MUR P;  3F56 A;  5ETR A;  4YR0 A;  1FDA A;  1J27 A;  4WE1 A;  3MEK A;  1S5Z A;  3MM7 A;  1TUV A;  2HND B;  4YHH F;  2Y1L B;  2POK A;  4FF4 A;  4OYW A;  2VG7 A;  2FVP A;  2W2Q P;  1IKV B;  4OI6 A;  3OTE A;  4CH0 S;  4QIV A;  2HNZ A;  2FVC A;  4WFX A;  3B4D A;  1WHV A;  1UWB A;  3PX4 A;  4R8U A;  2HYI B;  3HFK A;  2M9K A;  4WF9 Q;  2ZOM A;  4J9L A;  3JTN A;  2H65 B;  3ZZP A;  3PDN A;  4NXN F;  3BKF A;  1U6Z A;  3MOZ A;  5ETS A;  1P1L A;  3RRH A;  3ZZU A;  2IJR A;  4F26 A;  2IY5 B;  1EP4 A;  5HQM A;  4M5G A;  2CNN B;  3WDO A;  3P6Y C;  1VQL S;  3K0J A;  1T3O A;  3BZQ A;  3PRD A;  3MGJ A;  2HPU A;  5LT5 A;  3VF0 B;  2Y1R I;  5HQL A;  2XY7 A;  4IQX A;  4PR6 A;  2XGQ A;  2R2T A;  1ZA2 B;  2I9S A;  1NM2 A;  2OPQ A;  2NR0 A;  4L73 A;  5F3Z A;  2DIT A;  3R5J B;  4U7U K;  1F3V A;  3ZO7 A;  3M9M B;  4DLE A;  3TUJ C;  3MCO A;  5A8K A;  3HSZ A;  3PX6 A;  1UET A;  2QMX A;  1TFW A;  4RBV A;  4HI2 A;  4MK8 A;  1JLA A;  2Z30 B;  2GIR A;  2LEC A;  4K7Q A;  3QID A;  4KQZ A;  1OPI A;  4LBH A;  2ASY A;  4FXW A;  2BQR A;  1AFJ A;  1ARO P;  1IBM F;  3O5T B;  3K57 A;  1TV6 A;  5GME A;  2O5D A;  1QVG R;  2X51 A;  1WC5 A;  3MR5 A;  1Q8B A;  2DRD A;  2RIJ A;  1JMT A;  1S1V A;  3G6Y A;  7FDR A;  4DFJ A;  2IVM A;  1TVR B;  4RW7 B;  2CIM A;  2BW7 A;  2BV3 A;  5F3T A;  4WP9 A;  4QYZ K;  4IDK A;  4DL7 A;  4I69 A;  3MM7 B;  4EZ9 A;  2YH1 A;  3MR7 A;  2MKS A;  3JAM U;  4JI6 F;  1IKW A;  3BGR A;  3VCD A;  3SFU A;  1CJK B;  2NYH A;  3PW5 A;  2J76 E;  2VG7 B;  2KDO A;  1FKA F;  2IC3 A;  3CD0 A;  1T0T V;  2QA4 S;  1NDP A;  2CKW A;  2HNZ B;  3BDP A;  2JVO A;  2HVH A;  2B43 A;  4P71 A;  1BLU A;  2EFG A;  4R8U B;  5BR8 J;  1UVK A;  2EKY A;  3GJT B;  2ACY A;  5KG1 A;  4WIQ A;  3Q8U A;  2WOM B;  4LSL A;  2QA2 A;  2HFU A;  1YG0 A;  5IM0 A;  4MK7 A;  2K2P A;  2DGV A;  4ILL A;  3HX9 A;  2WCX A;  1SJR A;  3W7B A;  2COL A;  1WHY A;  2JDJ A;  4QPX A;  1S10 A;  4WTO B;  1VQ8 S;  4MK9 A;  1NK6 A;  1JLB A;  3HF5 A;  5GAE I;  3D66 A;  2IYI A;  2V94 A;  3CCV S;  4F3O A;  2JX2 A;  8AT1 B;  1AB8 A;  2VU5 A;  5L1K A;  2YNH A;  1GAO A;  2ZBQ A;  1PG5 B;  3EM1 A;  1FER A;  2GQ2 A;  4J5O A;  1T7P A;  1HQU A;  5ADZ A;  2QT7 A;  1PIL A;  2F8M A;  5A8K B;  2W1B A;  2OO4 A;  1OWX A;  3I56 S;  1JLA B;  1DLO B;  4LMZ A;  1YJN S;  3IN5 A;  5K14 A;  2RHS B;  3BKT A;  5LSL A;  2M5Y A;  5BYS A;  1KOH A;  2WRM A;  3NWG A;  1YBU A;  2UUC J;  4FYX B;  1R6Y A;  2HWT A;  3BR8 A;  3C15 A;  1TV6 B;  3HHE A;  3FFI A;  1RAI B;  2CQI A;  1MWZ A;  2BJ9 A;  4DR7 F;  3LUY A;  2Y1I A;  2QV6 A;  3VVT A;  1S1V B;  2ZWP A;  2LLZ A;  2M8D B;  4ZK7 M;  2AJF E;  4IDK B;  1IKW B;  2XY5 A;  1NUE A;  3BGR B;  1REG X;  4IG0 A;  3OL7 A;  2CPD A;  3B54 A;  2B51 A;  1LOU A;  2IC3 B;  1S6U A;  3CCU S;  3FMB A;  5IZH A;  4DSE A;  3SYZ A;  3UFC X;  3AJ2 A;  3I55 S;  3RR7 A;  1SQF A;  2ZBR A;  5U47 A;  3R97 A;  1U7L A;  2UU9 J;  2DNH A;  4LSL B;  4A8M P;  4M8L A;  3L3C A;  2UUW A;  4NLQ A;  1S57 A;  5KT4 A;  1VK3 A;  2B0G A;  1C0T B;  2DNL A;  2L9W A;  1NK0 A;  2QTW A;  2DPI A;  2YWE A;  1JLB B;  3OR1 A;  3T5K A;  2HZV A;  5RUB A;  1XNQ F;  1XNR J;  3M2V B;  2YNH B;  4ZCI A;  5MAO A;  1B7Y B;  3EWG A;  1HQU B;  2ZJP Q;  3GJQ B;  2HRU A;  4DFK A;  4ZJL A;  3MZI A;  2DHG A;  3BF4 A;  4F4Y A;  5EWF A;  2G9O A;  3B6B A;  1RHJ B;  5K20 B;  1F5C A;  2VPW B;  3IMQ J;  3W8G A;  1VQ7 S;  2OFG X;  3BBF A;  4GC6 A;  2HHT A;  5C7P A;  2PDA A;  2G13 A;  1FRM A;  4HKQ A;  3C15 B;  3M4X A;  6AT1 B;  4O23 A;  3FFI B;  4DSI A;  2BJD A;  4ZKA A;  1QSL A;  4KTQ A;  2CQ1 A;  1X8D A;  1M5K C;  1SVD A;  4IRC A;  4PWW A;  3V6K A;  3RBD A;  2W9A A;  2RRA A;  4J9U E;  4ZCK A;  4DPW A;  1PJ7 A;  3CT9 A;  3S6E A;  4WKR A;  4IG0 B;  1WF0 A;  2LU2 A;  1Y5I B;  3SCL E;  3KWM A;  1Q5Y A;  2AZ3 A;  1P9Q C;  3PIO Q;  2K7K A;  1KQS R;  4TY9 A;  4EMD A;  3CD5 A;  5C42 A;  2XYG B;  1RT1 B;  2MKH A;  1YZ6 A;  2R3V A;  3CCM S;  3NL0 A;  3MM6 B;  1Q86 T;  2CPJ A;  1HBO B;  1DBD A;  1S4F A;  4NYZ A;  3CMA S;  2LU1 A;  2XWX A;  4OYO A;  3CCR S;  1JLG A;  1FXD A;  3I87 A;  7FD1 A;  4LF5 F;  3A13 A;  4HL9 A;  2W8K A;  3AH6 A;  2R9L A;  1VI7 A;  4P2X A;  1NO8 A;  4QR1 A;  2RS8 A;  2ZOG A;  5EN1 A;  1WKL A;  2M7S A;  3BYR A;  2P6S A;  1S76 D;  2KXF A;  4TN2 A;  1EQ0 A;  1VBZ A;  3C19 A;  3M6V A;  5AE2 A;  3FDS A;  1OSC A;  4C8L A;  2E44 A;  1TKX A;  2PEB A;  4ZVT B;  1YJ9 S;  2LP4 A;  2B9X A;  1TR0 A;  2AW0 A;  4J9K A;  2I0X A;  3TVZ A;  1ZET A;  3IM8 A;  3DI6 A;  2AX1 A;  1HNI A;  1JQG A;  1YJR A;  1S99 A;  2L9D A;  2JL9 A;  3D4J A;  3DLK A;  1FXR A;  4Q44 A;  4OJ3 A;  3PHT A;  1FTR A;  1VCT A;  3OTO J;  2ZC3 A;  4TNO A;  4XO0 A;  1D9A A;  2YQ1 A;  4YB5 A;  4AQY J;  4A47 A;  4F67 A;  2VOO A;  1N6Q A;  3KG1 A;  4UQG A;  2HQ3 A;  2HS0 A;  4J9P A;  3TEG A;  2JVR A;  1RAE B;  3OTB A;  1C0U A;  1VFJ A;  3ISN C;  4B3R J;  4LR8 A;  3DLJ A;  1U02 A;  1UFK A;  2CZV C;  2ABY A;  1NJI T;  1MU2 A;  3OHA A;  1U25 A;  4DL5 A;  4B08 A;  3QT7 A;  4RW4 B;  1OPZ A;  1FRH A;  2JWN A;  5C42 B;  2YNG A;  4NCB A;  4OZ5 A;  3TP2 A;  3EGV A;  3M1V A;  2IDL A;  3IRX A;  2J8S A;  2ZH2 A;  3RG6 A;  1SKW A;  3CCQ S;  4PXE A;  1U6F A;  1JLG B;  1R0B G;  3ISZ A;  3MM9 A;  4A48 A;  3I9Z A;  2UXB J;  5IC4 B;  4OJG A;  1FRX A;  1TU0 B;  2AQ4 A;  4CWB A;  3Q24 A;  3NBP B;  4LSN B;  3A3N B;  5ETN A;  1QUV A;  1BUX A;  1SKS A;  2DO4 A;  2N82 B;  2LXI A;  1QDU B;  2RE1 A;  2ZVI A;  3OD2 A;  4TLQ A;  4M5K A;  4OV1 A;  2CPE A;  3TZW A;  1VGY A;  1TKX B;  3MAA A;  4I2P B;  2FC9 A;  4C3L A;  1JIH A;  1DZ5 A;  4WFB Q;  3KLI A;  1MLA A;  2YKM A;  5D0R A;  3LTO A;  3DI6 B;  1IR1 A;  1KVK A;  3GR0 A;  3DLK B;  5A6W A;  2AX0 A;  3C16 B;  2XYP B;  1XMQ J;  3O1L A;  3KK3 B;  1X5T A;  3CJQ A;  1VQK S;  3QGP A;  2FZK B;  1VQO S;  1EQM A;  2KT5 A;  4FYV B;  3CJR A;  3TA2 A;  4B9V A;  4CLK A;  1A6L A;  2E1P A;  4DV3 F;  2NSC A;  4KFB B;  1N6Q B;  3NEK A;  5LSR A;  4DQS A;  2IYG A;  5D8H B;  1FKO A;  2VFT A;  1UFW A;  1U0S A;  1C0U B;  2A1B A;  4O3N A;  1U1N A;  3FRY A;  1FHT A;  2CQ0 A;  4V19 X;  3PAC A;  1TL7 A;  1G7C B;  2KJW A;  1SUQ A;  1MU2 B;  3CVK A;  1WI6 A;  2VFR A;  1MWQ A;  2YNG B;  2NSB A;  3OW2 R;  3M1V B;  2KG0 A;  1S1U A;  2ZJQ Q;  3HHL C;  1HKA A;  1SXL A;  4NRT A;  2OKQ A;  2AJ4 A;  2VJU A;  3QRQ A;  2HQC A;  3MM9 B;  5AE1 A;  4YOE A;  2B9Y A;  3QQC D;  3SXL A;  5LOQ A;  4WPA A;  4CM2 A;  2HUR A;  3RRG A;  1HW9 A;  4XAK A;  3IR6 B;  3KJQ B;  5F0U A;  2BBE A;  1F9E B;  4P10 A;  2UVR A;  4WKY A;  3GR1 A;  4O3S A;  2J0X A;  1HBU B;  3KLI B;  3SI8 A;  1RB0 A;  2YKM B;  4DR4 J;  4JYA J;  5B0C A;  3KJN B;  3M8Y A;  2XCA A;  2F4F A;  3RUB L;  3W9J A;  3PZP A;  2J8A A;  4B9N A;  2CRL A;  2EFV A;  1RT2 A;  2CQC A;  2GVZ A;  1N0V C;  1Y10 A;  1NHV A;  2BA9 A;  5L46 A;  2DBB A;  1IM4 A;  2LCW A;  1KTQ A;  3VAH A;  4DR3 J;  1KR4 A;  4EZ6 A;  1FKO B;  1L5U A;  5HMZ A;  3K5P A;  2U1A A;  1GXU A;  4D3G A;  4YS2 A;  2ZH9 A;  5CYM A;  3FJ2 A;  5D4O A;  3EX7 B;  2MQN A;  2NUH A;  3OTC A;  2M88 A;  4NWB A;  5KFI A;  4DG1 A;  2HVE A;  4I6Y A;  5L38 A;  5F8J A;  4RUC A;  5HVF A;  4EGL A;  1TL7 B;  4A46 A;  3UDV A;  3OT9 A;  1PAE X;  2DXD A;  2VH7 A;  4A4J A;  2DB1 A;  1SUQ B;  5F9L A;  3OVB A;  3RB3 A;  3T9Z A;  3EPG A;  4ID8 A;  1HHQ A;  4NZ7 A;  4EBD A;  2V8P A;  4NLU A;  3TW0 A;  2QL9 B;  2DGQ A;  2GJ2 A;  2DGT A;  2W24 A;  3M8Z A;  2GHW A;  1RA6 A;  1S1U B;  3LWL A;  3LPE A;  2ZUG A;  3EJM A;  3E2E A;  2LYV A;  3EUN A;  2OEM A;  3W60 A;  5KFF A;  2A2D A;  2CJA A;  3ZZO A;  2FHO B;  3NNH A;  1N36 J;  4IYQ A;  3LP2 A;  2UXD J;  1MN7 A;  1RWW B;  4LF2 A;  1SL0 A;  2XUL A;  4IKA A;  2VIH A;  1T95 A;  1F9F A;  2KVQ E;  4QR0 A;  1N5Q A;  4O0I A;  2W7P A;  3NS7 B;  4NLW A;  4EWT A;  4C98 A;  2ZNY A;  1QTM A;  2C1E B;  2XI3 A;  2XS2 A;  3G6E S;  1NCL A;  1Q82 T;  4O44 A;  2YKQ A;  3OQ2 A;  4ZP6 A;  5KFG A;  3M8P A;  3J7A N;  1KRP A;  3CJ4 A;  3ILL A;  3K2Y A;  2E29 A;  4ZVP B;  4ZN1 A;  3OJS A;  1S1T A;  1KKH A;  1ZAV A;  2QLB B;  5DS7 A;  3HVT A;  3RAX A;  2YWF A;  4AL6 A;  4LFC F;  4X84 A;  4V1A k;  5G0R A;  2GVZ B;  2N4D A;  2DH7 A;  2V68 A;  3UN5 A;  5ETK A;  1O0P A;  3JQK A;  4R25 A;  2F40 A;  2Z56 B;  1RWP B;  3MD3 A;  5EX0 A;  1A9N B;  4F8R A;  3W9I A;  2BYC A;  4E0D A;  2J9C A;  5B0B A;  3GIR A;  3D67 A;  2XMM A;  1PYS B;  5KFR A;  4I6W A;  3N79 A;  1OQ3 A;  4QW9 A;  3HLU A;  2LQB A;  5HSP A;  4F0H A;  1O51 A;  4ID5 A;  4USJ C;  4DG1 B;  5LL6 d;  1IR2 A;  2RRN A;  5KFU A;  1CJU B;  4KPY A;  1RWU A;  1VQP S;  1XEZ A;  3DLB A;  1VK8 A;  1L3S A;  2AU0 A;  1FE0 A;  4CO0 A;  1WTF A;  4NZ0 A;  1Y3K A;  2CUY A;  4ECV A;  1C4C A;  4K50 A;  2JLE A;  4LF4 F;  1N54 B;  2CZ9 A;  1X0F A;  4QQB A;  4F2R A;  1H98 A;  2KYX A;  4O4G A;  5GAH I;  4TQR A;  4X62 J;  5IT9 Y;  3Q0A A;  3OLB A;  1OQ6 A;  1APS A;  3FUY A;  2W25 A;  5KFD A;  1T9U A;  3HPO A;  1N56 A;  3EGN A;  2KL8 A;  1RLC L;  1S6P A;  5GMK a;  3HK2 A;  3OL6 A;  3A8K A;  1RAJ A;  2VB6 A;  4KKO A;  4Y2C A;  3T5J A;  3LP2 B;  4EO8 A;  3H4B A;  2V9K A;  2Z2Z A;  1EIY B;  1DAX A;  1ZTW A;  2BJ3 A;  4P74 A;  5IWA J;  2HQI A;  1X4D A;  3US5 A;  2GCF A;  4O44 B;  3IWL A;  1TK8 A;  5LMU J;  1N33 F;  3M8P B;  2VBW A;  3N6M A;  2KT3 A;  2MZJ A;  1VR6 A;  4I6A A;  2VDI A;  4RWX A;  4O3O A;  5KOW A;  4LBI A;  3MHY A;  1S1T B;  4DR2 J;  1F2H A;  1PCA A;  5KFS A;  3ELH A;  3CUN A;  3HVT B;  2B8Q A;  1BD6 A;  4N76 A;  3B78 A;  3ZTP A;  3BO3 A;  3DOM A;  4USI A;  1E6V A;  1CVJ A;  4HHJ A;  3OTO F;  2ZBC A;  1TK5 A;  3E3X A;  4RW8 A;  1HR0 F;  3NGD A;  1UEK A;  1S97 A;  2DO0 A;  2GQC A;  1URR A;  3TAQ A;  1RA7 A;  3R5A A;  3QIP A;  4LRB A;  4ZHR A;  3OTD A;  2M4M A;  4OHW A;  2CDQ A;  1LWE B;  1LWC A;  2LA4 A;  2V4Q A;  3MMB A;  4OZ1 A;  1JJC B;  3AAW B;  3PX0 A;  3LAK A;  5I42 B;  2EK6 A;  1XN9 A;  2OH2 A;  1MSW D;  1VDH A;  3L9Z A;  5A8W B;  1VC6 A;  5B0D A;  3VAM A;  2F9J A;  1AZS B;  4EK2 A;  3LGH A;  3LAL A;  3PV8 A;  3FZ2 A;  3TAM A;  2RNE A;  4URG A;  3C46 A;  4DUT A;  5HMY A;  1VYA A;  4Q7A A;  3KOA A;  3CDB A;  2VV5 A;  3W1Y C;  2LVW A;  4O4G B;  4KHM A;  1RHR B;  3D0G E;  3MMA A;  1U0H A;  3V4M A;  1TUW A;  3AHP A;  5CXT A;  3KTQ A;  2EC0 A;  2MQQ A;  2DRB A;  1S6P B;  1FNO A;  2HLT A;  2UXB F;  4NXM J;  4Q45 A;  4DN0 A;  2BZ2 A;  1WC4 A;  2GJI A;  3OFF A;  4KKO B;  3TJA A;  1R8P A;  3MEC A;  3AOC A;  3MMJ A;  4HT7 A;  3RRK A;  2L9N A;  2MMY A;  3OL8 A;  4ECU A;  4OI0 A;  4PG5 A;  2FJX A;  2EFN A;  1Q7Y T;  1RBL A;  3TZX A;  5C2G A;  1A7G E;  2FHJ D;  3T1H J;  3OXG A;  3CJ0 A;  3MD1 A;  3I5A A;  3DU6 A;  1S72 S;  3C66 A;  3MR2 A;  2HQF A;  1Q79 A;  1CC8 A;  2WSE C;  4ZN3 A;  2J9D E;  3NWR A;  1FE4 A;  4G1P A;  1JLE A;  9ATC B;  1XMQ F;  5HVG A;  2NS1 B;  2ALZ A;  1E6V B;  2VHG A;  4UY8 5;  8ATC B;  3V6D A;  4DR6 J;  1HNV B;  3FSI A;  4RW8 B;  3CMQ A;  3K8W A;  3ZFV A;  3TNV A;  2FLP A;  1ZM4 A;  1ZPW X;  2C2K B;  1RT6 A;  3MXH P;  2IMW P;  1WD6 A;  2PO4 A;  4U95 A;  1UEV A;  1LWC B;  4CYU A;  4DV4 J;  1CSJ A;  5E3A A;  1JX4 A;  3J80 Y;  2G4B A;  3EIC A;  1QAJ A;  4UT4 A;  4C3M A;  1JXL A;  2DNP A;  1MRO A;  5KG2 A;  3ENV A;  2VKZ G;  5T7L A;  5C2C A;  4LF7 J;  3KG4 A;  4NEZ A;  2B4P A;  1VRT A;  4BBY A;  1WEY A;  2ROG A;  2YNI A;  3MMA B;  4N41 A;  2EBE A;  1U0H B;  1YJV A;  1OYD A;  4KO0 A;  4Z37 A;  2YKN A;  2OMO A;  1TAQ A;  2KO1 A;  1JKH A;  2YTC A;  3ZXW A;  1AT1 B;  1X9S A;  3NMR A;  1BE4 A;  2E5G A;  4PUO A;  5J2N A;  3D6F B;  1P9Y A;  1RTZ A;  1D8Z A;  1NAQ A;  1NKB A;  3KG0 A;  3MEC B;  3MPD A;  3EGZ A;  3GCW P;  4JI2 J;  3LOU A;  5T14 A;  2DHS A;  7AT1 B;  3OFE A;  2IRU A;  1KSP A;  1QTN B;  4PEO A;  4I0W A;  2LKZ A;  1P1T A;  4K0K J;  4YDD B;  5GAD I;  4DL2 A;  1R8H A;  5AXK A;  2JEG A;  2BRL A;  4DR4 F;  4RLE A;  3G8T A;  1U26 A;  1JLE B;  1H38 A;  1O8B A;  2W2M P;  3N6L A;  2GVD A;  1ZYQ A;  2DHX A;  1OY9 A;  3I31 A;  3RW6 A;  2YX4 A;  1C1C B;  1CS4 A;  3IG1 A;  4XIU A;  3OLA A;  3V6D B;  3E51 A;  3QZ8 A;  3MPW A;  3VQS A;  4NEY A;  4ZVQ B;  4DR3 F;  5DDR C;  3MTJ A;  1XR7 A;  5FLX U;  4C97 A;  2AWZ A;  2XLK A;  5KFW A;  4UOG A;  3J80 U;  3DRS A;  3KNA A;  4OX8 A;  4Q8F A;  4CYU B;  1SQE A;  1KN6 A;  3Q2T C;  5D77 A;  2ADC A;  4ZMM A;  2JEF A;  3PO4 A;  3SSS A;  3KJF B;  1FRI A;  1D9F A;  4LFB F;  3QMQ A;  2I6W A;  2R8I A;  1LXJ A;  1VC0 A;  3I0S A;  4AE5 A;  1MRO B;  4Y00 A;  4DCP B;  3GSI A;  5T7L B;  2VDH A;  4OMF G;  2HVD A;  3W9H A;  3Q22 A;  4DQI A;  4RNH A;  3NCP A;  4DEZ A;  3AD8 C;  3UN3 A;  2YNI B;  2WBR A;  3ETM A;  1T03 A;  3P45 B;  4ECT A;  1Y5N B;  2JHE A;  4ITS A;  2AEF A;  2AEJ A;  5HMW A;  4ETZ A;  1KEK A;  3B82 A;  4RNO A;  3AQP A;  2YKN B;  1Q8L A;  2WSC C;  1JKH B;  1UZD A;  4LF8 J;  2W4P A;  1QSY A;  3KXD A;  4PUO B;  5J2N B;  2YPY A;  1R27 B;  2U2F A;  1N36 F;  1HQE B;  5E33 A;  2UXD F;  1V3S A;  5KFE A;  1UFL A;  3PIP Q;  1TQL A;  4NLT A;  3HZG A;  1SPB P;  2VFU A;  4X4T A;  3T5H A;  3LAM A;  1VBX A;  2H4Y B;  3UNY A;  1YK9 A;  3MR3 A;  2JRS A;  2C2N A;  1S4E A;  2KFY A;  4LF6 J;  3QJL A;  4ZVH A;  5DDQ C;  2JH3 A;  5A0Y A;  3C14 B;  4EO6 A;  5KFC A;  3UNG C;  1S7I A;  1SJ1 A;  1T9Y A;  2GVD B;  4LF1 A;  2VA3 A;  3VR1 A;  5DM7 Q;  3DRP A;  3H7H B;  1H74 A;  1CS4 B;  2KB2 A;  4DLG A;  2HZC A;  1FKP A;  4KHR A;  4OZN A;  2HHS A;  2R7X A;  3OVA A;  1FX2 A;  2V69 A;  3T6J A;  2UV8 G;  4C8Y A;  3BGL A;  2DCL A;  1H72 C;  2GV1 A;  3DFE A;  2OPS A;  3DRS B;  4TQS A;  4PXB A;  2XMA A;  3UO0 A;  2VON A;  2QSF A;  2CG8 A;  4H4O A;  3VZH A;  5K8N A;  1PGZ A;  2F7V A;  2YX7 A;  5MLC V;  4ZIV A;  1RKJ A;  4U7U D;  2N7Y A;  2EVZ A;  3Q8V A;  1FEH A;  5GAG U;  4DV6 J;  3HDS A;  3GV8 B;  3OVS A;  4FBT A;  3N01 A;  1YGY A;  1U09 A;  1HNW J;  1N32 J;  2YBV A;  2XNR A;  1ZBT A;  3DHW C;  1YIJ S;  2P5V A;  2F4V J;  4MKV A;  2JEI A;  3TAN A;  1B99 A;  1MG7 A;  1TMJ A;  2QLJ B;  1I6J A;  1TL3 A;  4NPO A;  3J7Z T;  2WAQ D;  1GMV A;  3K59 A;  1GTH A;  5DLG A;  4YY3 F;  3UPF A;  1TFY A;  2WB4 A;  1WJ9 A;  2BVZ A;  1DQ9 A;  1VRQ C;  1W2B R;  2KFN A;  2BQ3 A;  3AT1 B;  3R6L B;  1HW8 A;  4KIA A;  2YQ0 A;  4P72 A;  2CVE A;  4YB1 P;  3P4U B;  1YKW A;  1R0C B;  4ELU A;  1DAR A;  2YNF B;  5IWA F;  5EWE A;  3FQK A;  5HAO A;  1KOO A;  3NGS A;  3R2D J;  5LMU F;  2P9G A;  5E0O A;  2ZBP A;  1CG2 A;  1PSD A;  4J9M A;  2YXL A;  8RUC A;  4DR2 F;  1NK5 A;  2C3U A;  1KHW A;  2VG6 B;  3ZNU A;  2O66 A;  2NLW A;  1S12 A;  4RX6 A;  3DRP B;  2DEI A;  3ET6 B;  2QGF B;  1TK0 A;  1Q78 A;  3EVO A;  1RAF B;  2GIQ A;  2L3M A;  2WVC A;  3IAS 9;  4X65 J;  1PC4 A;  5F9N A;  4WII A;  2KXH A;  3W5Y A;  1F5B A;  1ZS6 A;  1BY9 A;  3MEG B;  1N4L A;  5DG8 A;  1FEE A;  3HFV A;  2ZHB A;  2OPS B;  1ZZF A;  3MMC A;  2DPJ A;  1QJH A;  2FJV A;  1WTB A;  1H7W A;  4IRK A;  3VZI A;  3W61 A;  4DUZ J;  1F5A A;  2DNM A;  4H4O B;  4X4S A;  4OZ2 A;  4WYW A;  2X3G A;  4C48 A;  3U7J A;  3R5C A;  5HQ8 A;  3SV3 A;  2IA6 A;  1I3O B;  4WFA Q;  4HH1 A;  2HG4 A;  1L3V A;  2JLF A;  5D3G A;  2MLZ A;  3HHD A;  1R8A A;  2C2O B;  1BWE A;  1QY7 A;  4EU0 A;  4HHH A;  3G96 A;  3LWM A;  2ZH4 A;  2P8I A;  4F4K A;  4K4U A;  2HHX A;  3UCZ P;  4ECY A;  5L39 A;  4DX7 A;  5DQG A;  3O3L A;  4IOB A;  1M5V C;  3DC2 A;  4OZ3 A;  2B8P A;  4H4K A;  1YLX A;  2MDA A;  3ULH A;  1XMB A;  2LQ5 A;  2CJK A;  3ENQ A;  4WP8 A;  4YQW A;  1RBA A;  1VIO A;  3QFW A;  2DGW A;  1VJQ A;  3KMS A;  2Z2Y B;  4O3R A;  3T1H F;  2D3U A;  4M5I A;  5B08 A;  4F04 B;  1SV5 A;  1YX2 A;  3G2X A;  4ED0 A;  1CBK A;  1RTI A;  5K8P A;  2V2Z A;  2MKY A;  4ZA1 A;  3DGP A;  2RDJ A;  1P8G A;  3KHG A;  2XG8 A;  2RT3 A;  5HBM A;  3NAH A;  5M2P A;  4PQA A;  3R1H A;  4DR6 F;  2NXE A;  4MKA A;  4ELT A;  3GG1 A;  1VHF A;  3WZ0 A;  2XO6 A;  3QO9 A;  4ED8 A;  1T8E A;  3VGU A;  3UR0 A;  3HSD A;  2GHP A;  1RT4 B;  3MMC B;  2HVI A;  4WCE Q;  2ZVS A;  1CJT A;  3A1Y G;  4GKK J;  2V8D A;  2CNL B;  3D28 A;  1HD0 A;  1OYE A;  5B0A A;  4A8X A;  4JUZ A;  2N3O A;  1SL1 A;  2X1A A;  3UN2 A;  4BC9 A;  1U1P A;  2BE2 A;  3NCQ A;  1VS3 A;  2FLN A;  1X0P A;  5HVH A;  1UW9 A;  3DU5 A;  1KQG B;  3WX8 A;  4IUF A;  5D3G B;  1NJY A;  1R31 A;  2KFZ A;  4DSK A;  4V19 J;  5AE3 A;  2GNK A;  3JSB A;  2ZIT A;  4IFV B;  4QIW D;  1NPP A;  3JB9 k;  1TKD A;  4AND A;  3S8S A;  4JI0 J;  3CSK A;  2EBG A;  5IS2 A;  4M5M A;  5HMX A;  1IBM J;  3QWP A;  4LF9 F;  1RU2 A;  1FVQ A;  1UVM A;  2QJ3 A;  4XK8 C;  2W7A A;  1FI4 A;  2C3Y A;  3TJ9 A;  4A8Q A;  4JI2 F;  1XIQ A;  3CJT A;  1DTQ A;  1C4A A;  3QT5 A;  1KVJ A;  1YBA A;  1VC5 A;  2WB1 D;  4NA3 A;  2UUT A;  4ED4 A;  3PNI A;  2PA8 D;  2GAH C;  4RUA A;  4K0K F;  3A8E A;  2OML A;  4JI6 J;  1D9D A;  3S01 A;  2FY8 A;  3PEH A;  2P6T A;  4PPZ A;  2DXE A;  1RTI B;  2QE5 A;  3HKW A;  2GQQ A;  3KLG A;  1QD1 A;  2YWH A;  2RF2 B;  5DO2 A;  3DGP B;  1M0S A;  3GIM A;  2Z8Q A;  4N7T A;  3OL9 A;  4Y28 C;  3JYT A;  2XWY A;  4A8F A;  3N5F A;  4MYU A;  4I7F A;  5HBM B;  4ZVU B;  5EGY A;  3QWU A;  4BCA A;  1RHU B;  4JI4 J;  3VAL A;  1R0A A;  1RWM B;  3QO9 B;  4EFA C;  3CD7 A;  3SEO A;  5D78 A;  2RS2 A;  3AFG A;  3TX8 A;  5DZ6 A;  1KLN A;  1KD1 T;  2WON B;  1IBL J;  4NYP A;  3M6X A;  3UR3 C;  4F3M A;  4CLP A;  1Q4R A;  4USU A;  2MY7 A;  2RQ4 A;  3EVW A;  3CJK A;  1RAB B;  4PYA A;  4M95 A;  2RDI A;  4ES3 A;  1N5T A;  3A8J A;  2HMI A;  3CCE S;  4H4K C;  1I51 B;  1ZPV A;  2VA2 A;  4DSL A;  3A3P B;  1M5O C;  2ASD A;  2HAF A;  2ATC B;  2VPZ B;  5L9X A;  1FCA A;  1T94 A;  3KNG A;  1VMB A;  3E01 A;  1MW7 A;  2F8H A;  4RWW A;  2BMB A;  1RWV B;  1QSS A;  4DX5 A;  2D69 A;  4LF8 F;  4B3S F;  1KDN A;  4CT8 A;  3CCS S;  4F50 A;  2KHD A;  2G0C A;  4PWD A;  3NNC A;  4H54 A;  1OJ4 A;  4J9O A;  4P2M A;  1DTQ B;  2GIF A;  2ZH7 A;  1UJ6 A;  2AKW B;  4NLD A;  4QOT A;  4ED3 A;  2YY3 A;  1FES A;  3H98 A;  2GO9 A;  3VWS A;  3OXF A;  3HZE A;  4N5S A;  4FVM A;  3JQM A;  4OLO A;  1SBR A;  1NXI A;  2O1P A;  2V0N A;  4DPY A;  3MED B;  5E5N A;  1IWG A;  3D1H A;  3NOG A;  2E5J A;  3KLG B;  3MUT P;  1YSJ A;  4UQT A;  5CD4 H;  1IWA A;  3WX4 A;  2RAQ A;  2P2C B;  2KVI A;  3UW1 A;  4FPR A;  2X1B A;  3NOC A;  4I7F B;  4X64 J;  4MFB B;  4UUX A;  2G1H A;  1JLF A;  4J90 A;  1R0A B;  3NAI A;  3NLC A;  5C25 A;  5H9E J;  1FJG J;  3AY0 A;  2Y9H A;  3TI0 A;  2KZZ A;  3RR8 A;  5DLF A;  2DD8 S;  2XMW A;  3ZZ0 A;  1ZZN A;  4I4B A;  1FXL A;  2BAN B;  1HNW F;  2QA1 A;  3CJK B;  3KDO A;  3ZTO A;  2DR7 A;  3LAN A;  2F4V F;  4DF8 A;  2CAD A;  1R43 A;  2NZ4 A;  1TKT A;  1T3N A;  2XCP A;  3E01 B;  4ZLJ A;  2OGU A;  3QFH A;  1RJJ A;  5KFL A;  4Y65 A;  2DYA A;  3QAT A;  3THV A;  3CNQ P;  5CZX A;  1ZAW A;  2J6U A;  3T41 A;  4HAC A;  2V2K A;  4RNN A;  1EAR A;  3G8S A;  4B3T J;  1HI0 P;  4LRC A;  2FVQ A;  4PWD B;  1LW0 A;  3UVJ A;  3MTK A;  3QLH A;  2V50 A;  4HR2 A;  3MM8 B;  2RB7 A;  2AGO A;  2B56 A;  4GMK A;  3I9V 9;  2HFZ A;  3PYD A;  1GMU A;  3UE2 A;  2HVZ A;  3L7O A;  4F4W A;  3PW2 A;  2LDY A;  3G82 B;  1OY6 A;  5K8M A;  1IKV A;  1U1Q A;  3BH7 B;  2DGX A;  3GYN A;  2F65 A;  3K17 A;  3HSJ A;  3W3S A;  1XC9 A;  2J0S D;  3AOD A;  5K8O A;  3BJY A;  5KFO A;  2AYM A;  4X4U A;  4ZCL A;  5CHC B;  3WBZ A;  4X65 F;  4G1Q A;  3D1O A;  3QGG A;  3MEE A;  3HVR A;  2Y0S D;  5C25 B;  2DNN A;  4K4X A;  4N47 A;  2RKI A;  4RW9 A;  1G2E A;  3J7A 1;  2OJ3 A;  2XZD B;  3OUY A;  5BYQ A;  1S9E A;  1GNK A;  4L75 A;  2OD6 A;  3BGU A;  1EX8 A;  4OYI A;  2IM3 A;  4FYW B;  3KUG A;  2G2Y A;  4K4V A;  4E98 A;  2HRT A;  1F9H A;  4FXV A;  1SCJ B;  5G4D A;  4KAI A;  1T02 A;  1RCO B;  1TKT B;  3POT A;  3ISN D;  4ZVE A;  2QMU B;  5F8N A;  2K3K A;  1HFE L;  1ROF A;  1UCN A;  3ZZY A;  1M1G A;  4CM0 A;  1WF1 A;  2WSF C;  3BBC A;  3V81 A;  3TAR A;  1Q7L B;  4HAC B;  3GP9 A;  3DLH A;  2PEH A;  4MKB A;  3R5B A;  2J6S A;  2JFD A;  3UVJ B;  3HSG A;  2VPX B;  3K89 A;  4X4O A;  3QLH B;  4RW7 A;  5DDO C;  4M5H A;  4OLP A;  2N4C A;  1HNX F;  3V5R A;  2DTJ A;  3UD4 P;  3UI3 A;  1CJK A;  1A0O B;  2J5A A;  3C6T A;  3QNW B;  2RD5 C;  1FWL A;  3D54 A;  5KFZ A;  4P2F A;  4LRF A;  4AFF A;  3J81 Y;  2JOQ A;  4WZM A;  2ZKU A;  4CQ1 A;  3S7R A;  4OYZ A;  4G1Q B;  4DOZ A;  2UUB J;  1Y9O A;  2WOM A;  1ZH5 A;  3MEE B;  3RAQ A;  3RBZ A;  3JS9 A;  4KH0 B;  2HS3 A;  2E5L F;  3ETO A;  1YJW S;  1VIX A;  1U1O A;  2J7U A;  2HHV A;  2ACM A;  2H51 B;  2RKI B;  4RW9 B;  4JI3 J;  3OUY B;  2PMH A;  5CH7 B;  4GKK F;  5I3U B;  1S9E B;  2DK2 A;  5E3P A;  1NHK L;  4ZJQ A;  1EKR A;  2A6M A;  4LQ9 A;  2LEA A;  3A3O B;  1S9G A;  3M9O B;  3OHB A;  1YJU A;  3PFE A;  3HJF A;  4ZLL A;  1HNZ F;  1DTT A;  3DLG A;  4QWD A;  3OFG A;  4RUB A;  3R9L A;  3QYY A;  3ILJ A;  4F3Q A;  4C8O A;  2V8G A;  2IM2 A;  2GW8 A;  1CQN A;  2HQD A;  2IPO B;  1S0V A;  3POT B;  1DLO A;  1ELO A;  4Q2L A;  2EWH A;  4O3P A;  5IC6 B;  3CD6 S;  4JI0 F;  4NLR A;  4YR2 A;  4CLY A;  1LWF A;  2DNY A;  1SC1 B;  4DV3 J;  1I1G A;  2MSS A;  4RZR A;  3M8S A;  4LIW A;  5CZV A;  2ZWO A;  3V81 B;  1RT5 A;  2FJB B;  2VQE J;  1QAX A;  5JJB A;  1OIA A;  2VOD A;  2JNJ A;  2DY9 A;  2ZH6 A;  3P5T L;  1AUD A;  4ZJO A;  3VGV A;  5CA5 A;  2IVY A;  3AD9 C;  3HD1 A;  1F3F A;  3CO0 P;  1FO1 A;  4JV2 A;  3HHL D;  2FHJ A;  2V8H A;  1FTC A;  2KN4 A;  4M5N A;  4FS1 A;  1KC8 T;  2A6O A;  3GU0 A;  2FJE B;  2JLG A;  4I67 A;  1N5S A;  4BHQ A;  4LRE A;  4YME A;  3FCV A;  3C6T B;  4PXD A;  5ETQ A;  1RIS A;  5H1S V;  2F3J A;  2O01 C;  1X4E A;  1SB6 A;  3KLV A;  4NI2 B;  1VQN S;  2HGN A;  4M94 A;  4JI4 F;  3O2I A;  3TA0 A;  2NXN A;  2H48 B;  2CG4 A;  4ENO A;  2HBZ B;  1C0T A;  2MHE A;  1EHW A;  5KFK A;  3ICL A;  1ZM2 A;  3TJ8 A;  3PO5 A;  3PKY A;  2QSW A;  4NLG A;  3C8Y A;  1RQ0 A;  1IBL F;  2L41 A;  3KK1 A;  3BEG B;  1T05 A;  1S9G B;  3D6T B;  3A12 A;  4MYT A;  2A10 A;  2IMO A;  1DTT B;  4ED7 A;  3DLG B;  3M2V A;  2XNQ A;  3CE8 A;  4RBT A;  1UMJ A;  1WEX A;  1RAO A;  3CCW A;  1FRL A;  4OV6 A;  4WXW A;  1YRT A;  2OUG A;  5IT0 A;  1YQH A;  1FWP A;  4DFP A;  1Q16 B;  1RTD A;  1RP5 A;  3GJR B;  3SBM A;  3BO2 A;  2A18 A;  3P5B P;  4Z2X A;  1LWF B;  5LM7 E;  2ZJR Q;  2BJE A;  3HJV A;  2MGZ A;  3R1L A;  5HJX A;  2XTJ P;  2ZZM A;  1WI8 A;  1RT5 B;  5B0F A;  2J9D A;  2FGC A;  3MPV A;  3R8Y A;  6FDR A;  1DY3 A;  2XMV A;  3CCL S;  4GVB A;  1M5P C;  3KLH A;  1HL6 A;  3M30 B;  4IFY A;  1D09 B;  2XMK A;  2WTF A;  4N56 A;  3IS9 A;  5GAD U;  2E1M C;  1G3O A;  4ED5 A;  4ECW A;  2UXC J;  4OX9 J;  3KHR A;  4MMO A;  1M1K T;  2I2Y A;  1V9O A;  2F63 A;  4QW8 A;  4NLS A;  2MHN A;  5GAG I;  1WOR A;  4AYB D;  3CTR A;  1RI7 A;  1RT1 A;  2QYC A;  4DV7 J;  3KK2 A;  3MM6 A;  5DQH A;  1S6O A;  1RK8 A;  1HBO A;  2YPZ A;  2FHK A;  3PFO A;  1IR0 A;  4X64 F;  3H2V E;  1H0H B;  4C11 A;  4LVN P;  2XO7 A;  3DXS X;  4ECX A;  2XZW A;  1S59 A;  2MQ8 A;  3TAP A;  1FJG F;  2VL1 A;  3IO1 A;  2NXU A;  2PA3 A;  2QYG A;  1UVJ A;  1Y3J A;  1B0V A;  2KT2 A;  1LNQ A;  3KK1 B;  3SQO P;  1WG1 A;  1T05 B;  2BR0 A;  2MST A;  3I5C A;  1NME B;  2ZH1 A;  4NLV A;  4Y34 A;  3ZZR A;  1HLW A;  3DKD A;  2CPI A;  1B0P A;  4W92 B;  1RUS A;  3CCZ A;  3FSX A;  5L8R C;  4UOF A;  3UQS A;  4JOU A;  4C8Z A;  2JZ5 A;  1F6T A;  3BS9 A;  4ES2 A;  1W7W A;  2GA7 A;  2ZH8 A;  4HI1 A;  3UCG A;  2VC0 A;  1RTD B;  3MCM A;  1P27 B;  4LFC J;  3GE9 A;  4ZLN A;  5FDL B;  2X1G A;  1EKS A;  3DHX A;  4DDF A;  2CQ3 A;  1TTH B;  2MGZ B;  5KG7 A;  4JV5 J;  1U2C A;  2OEJ A;  3N5B A;  4UST A;  1FK9 B;  4B3T F;  2RVJ A;  4GVB B;  1KHV A;  2X3D A;  3KLH B;  2BUN A;  2FLO A;  4IFY B;  4DQP A;  5KG0 A;  2AEM A;  3IS9 B;  1X5P A;  2IJF A;  1Z2L A;  2WW8 A;  4DPO A;  2FHM A;  2A3J A;  4LF4 J;  4CO3 A;  4Y2K A;  4FN5 A;  4RW4 A;  1FA0 A;  4IO1 A;  4ECS A;  2BDP A;  5T41 A;  4AXI A;  1S49 A;  1K0V A;  2WK4 A;  2YKA A;  3VAI A;  2HRY A;  1SI9 A;  1WHW A;  3KK2 B;  2AGP A;  3HO1 A;  3GIL A;  3PJX A;  2BW2 A;  4C11 B;  1U4B A;  2HHU A;  1BHN A;  2E1C A;  2JEJ A;  1CQM A;  1QE1 A;  3K8V A;  1MMD A;  4OYX A;  3NBP A;  4LSN A;  2PGC A;  3MAQ A;  2CAJ A;  2P9C A;  1VQS A;  4Z7Y A;  1B7F A;  4DL6 A;  2FJA B;  3FRZ A;  3OFH A;  3ZTS A;  1V5V A;  1BQN A;  4ZIT A;  1FRJ A;  3DDK A;  1W26 A;  4I2P A;  3FBC A;  4X66 J;  1NZA A;  2W9B B;  1N33 J;  4U8Y A;  1Z1Z A;  1D0E A;  3OR2 B;  2W9C A;  2C42 A;  3LA0 A;  4NCG A;  2CPY A;  4RNF A;  3SFG A;  3K5N A;  2FQQ B;  3NXZ A;  3CDA A;  2CQH A;  1NSP A;  1RT7 A;  3NGT A;  1QAI A;  4OL8 A;  2IFX A;  1AFI A;  3C16 A;  4QU6 A;  4C0B A;  3KK3 A;  4IOA Q;  4Y6I A;  2CFX A;  6FD1 A;  2ZM6 F;  2H3E B;  4FNI A;  2VF3 A;  2Y1J A;  4OYB A;  1HR0 J;  2HSE B;  2OP5 A;  4KFB A;  4ZDN A;  3GQC A;  1Y5L B;  4NML A;  3VAJ A;  1S79 A;  2OIH A;  4CO1 A;  3H4D A;  4UZC A;  1DUR A;  4O4R A;  4KGK A;  1B3T A;  2AJ1 A;  3W5Z A;  3D9B A;  1QUP A;  5GVQ A;  4RBU A;  2ROP A;  4DXL A;  1OY8 A;  3UDE A;  4X4Q A;  5HLF A;  2F1F A;  1LK7 A;  2GMJ A;  3NG8 A;  4QYR A;  4ZPV R;  3BSC A;  5E2Q A;  1HBM A;  1K9M T;  2Z0G A;  2M52 A;  2E66 A;  5D4P A;  1HQ2 A;  3D6H B;  3CXC R;  3DRR A;  3Q8P B;  1WSV A;  3ONQ A;  2BXJ A;  2ZHO A;  2Z57 B;  2UUB F;  2VD3 A;  1XR5 A;  3I0R A;  2FGO A;  4GO7 X;  4CDI A;  3GYX B;  1TKZ B;  4C2M A;  3T9N A;  4B3M F;  3ZZZ A;  1QE1 B;  4NA1 A;  1PJ5 A;  2GFF A;  4JI3 F;  4PWU A;  3H5Y A;  2WZ1 A;  2BAC A;  2YWG A;  1B64 A;  1T9W A;  3SCK E;  1RE1 B;  3R3T A;  2OFH X;  2ZDP A;  3CJS A;  4GVL A;  5AJ3 F;  2VIC A;  2AP6 A;  2LDI A;  5HAN A;  1BQN B;  4ICL A;  1HBU A;  3QBC A;  3D6M B;  4JI1 J;  2C28 A;  1SL2 A;  4ECZ A;  2CQD A;  2W9C B;  2NPF A;  3TUP A;  4CO2 A;  2C3P A;  2MJU A;  4NCG B;  2MYF A;  2D3O 1;  3SDE A;  4M5J A;  1RYR A;  1RT7 B;  2RDD A;  4DFM A;  4B9L A;  2HGM A;  3HHN B;  1FRK A;  3BSA A;  5HAT A;  2K3I A;  1KLM A;  3NKY A;  4CNZ A;  1UVN A;  1YJT A;  1X5O A;  1I94 F;  3FC9 A;  1HBN B;  2VQE F;  4L72 B;  4OX6 A;  1CEZ A;  4ZPD A;  2OAU A;  2GGP A;  5J1N A;  4L6V 3;  4OI2 A;  4LUB A;  1U48 A;  4PQU A;  4J9N A;  2DR9 A;  4IOC Q;  2R8G A;  1CC7 A;  1H73 A;  3M05 A;  4DUY J;  3KHL A;  3GZ7 A;  5DGB A;  3WC2 A;  1SKR A;  1MN9 A;  3PHE A;  3Q8Q B;  2Y0B B;  5HLF B;  2AHO B;  4ZOS A;  5KFT A;  4TXS A;  2W2O P;  4WFZ A;  1S0N A;  1HBM B;  2IHR 1;  3BGF A;  5C24 B;  4HYK A;  1PKU A;  3FBB A;  3DRR B;  2UVU A;  4DZD A;  2EXU A;  3I0R B;  5KTQ A;  4Y0F A;  1F0X A;  3FVY A;  4KPC A;  2MKI A;  1RAG B;  1YDL A;  4KC5 A;  2V4R A;  5BJR A;  1RWK B;  3R7S B;  1GQE A;  2N7C A;  4DJB A;  1UKU A;  3SIP B;  4W4M A;  2F8E X;  2W8L A;  2KKH A;  3CJ2 A;  1LW2 A;  3QJJ A;  2V9W A;  1JLC A;  1NH7 A;  2V34 A;  4FYY B;  4ICL B;  3KFW X;  5I3P A;  2Z4P A;  3CDW A;  4W98 A;  1V3Z A;  4FVC A;  3K5M A;  5F8H A;  3CF5 Q;  4XPC A;  4NYO A;  2CJ9 A;  3MDF A;  1YHQ S;  3K5L A;  2WBM A;  2DH9 A;  1JNZ B;  3SDE B;  2CA9 A;  2R2U A;  3NGU A;  4ALZ A;  4DR1 F;  4EBC A;  3W63 A;  1WDD A;  1HWI A;  3KLF B;  1KLM B;  1FDN A; 
#chains in the Genus database with same CATH homology
 3P5B P;  3CO0 P;  3T41 A;  4JP8 A;  2QTW A;  2Z30 B;  3A3N B;  3WIV A;  3BPS P;  1R6V A;  4OV6 A;  2Z57 B;  2W2Q P;  3GCX P;  3BGO P;  2W2M P;  2XTJ P;  2Z58 B;  1SPB P;  1ITP A;  3SQO P;  2ZWP A;  2W2N P;  3A3P B;  3A3O B;  3QFH A;  3H42 A;  3GCW P;  4NMX A;  4YN3 B;  2Z56 B;  3AFG A;  3WIU A;  2E1P A;  1SCJ B;  1V5I B;  2W2P P;  3VHQ A;  3CNQ P;  4K8R A;  2PMW A;  2ZWO A;  2Z2Y B;  3WHI A;  4NE9 C;  3VV2 B;  2W2O P;  2Z2Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...