3SQOP

Pcsk9 j16 fab complex
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
92
structure length
92
Chain Sequence
TATFHRCAKDPWRLPGTYVVVLKEETHLSQSERTARRLQAQAARRGYLTKILHVFHGLLPGFLVKMSGDLLELALKLPHVDYIEEDSSVFAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proprotein convertase subtilisin/kexin type 9
publication title Proprotein convertase substilisin/kexin type 9 antagonism reduces low-density lipoprotein cholesterol in statin-treated hypercholesterolemic nonhuman primates.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/immune system
total genus 22
structure length 92
sequence length 92
ec nomenclature ec 3.4.21.-:
pdb deposition date 2011-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF05922 Inhibitor_I9 Peptidase inhibitor I9
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.80 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Peptidase S8 propeptide/proteinase inhibitor I9 3sqoP01
2W2QP 3GCWP 3WIUA 3GCXP 4NE9C 1R6VA 3BPSP 3P5BP 2Z2YB 2Z57B 3A3PB 3A3NB 3A3OB 2W2NP 2E1PA 2Z56B 1SCJB 2Z30B 3T41A 2ZWPA 4JP8A 2PMWA 3CO0P 3WIVA 2QTWA 2XTJP 4NMXA 1ITPA 3H42A 3QFHA 3CNQP 2Z2ZA 4OV6A 3BGOP 1SPBP 2W2PP 2W2MP 4K8RA 3SQOP 4YN3B 2Z58B 3VV2B 1V5IB 3WHIA 3VHQA 3AFGA 2W2OP 2ZWOA
chains in the Genus database with same CATH superfamily
1YJTA 4EMDA 3PV8A 1RXOB 2CPFA 2A1BA 2MKHA 2DO4A 5LSLA 3NEKA 4UQTA 1LFPA 2R8JA 1DTTA 3GTYX 4X62F 2ZM6F 3M6XA 4K2XA 2YTCA 1X7VA 3CCMS 1QY7A 2KHCA 1VBYA 1Y3KA 2HKEA 1BC6A 3M8YA 2ZH9A 1UAWA 1WOSA 5GVQA 4DL0C 2PA8D 1CJVA 3AJ2A 2XMAA 1HBMA 4LF9F 1BLUA 4RW9B 5CD4H 5CYMB 2OAUA 1U8SA 1HHSA 3N0VA 1R7IA 3A13A 4DV1J 1CULB 2B7CB 3D6TB 3R5GA 1U7LA 2QYGA 4O44A 4PUOA 4OYPA 1DLOA 2F4VF 2E5JA 5CCMA 2IRYA 1IR2A 1XC9A 1Z2ZA 4ZA1A 5HQ8A 2GHVC 2G0JA 5C2GA 2J9CA 2J7WA 3T6BA 4IFVB 3Q23A 1RWVB 1YBTA 2ZZNA 3GFYA 4D3HA 4LBIA 2OPSB 3CJ0A 4I67A 1BXNA 1AZSB 4NLGA 4WBFA 2CFXA 3DC2A 2K2PA 5KFFA 4WIQA 1U25A 2NQPA 3A12A 3GWCA 3K17A 3BN7A 4DJBA 2QIFA 2X7IA 2VASA 3MR3A 1ROFA 1WJ9A 2JHEA 5LOQA 3MM6A 1P9QC 4R0JA 4F50A 3QGHA 5HP1A 4CYUB 5HROB 3TQ1A 1RTHA 1C1CB 1QM9A 1PYTA 4Q0BB 3CJSA 4X4OA 1ZS6A 3HK2A 4IH6A 2NXEA 3DFEA 1I5OB 2V4RA 3KOAA 1DZ5A 3CMES 4U8YA 1VOMA 1H98A 2AYBA 2BJ7A 1UVJA 2PN6A 2EK1A 4G1QA 1OO0B 5EWGA 3HM9A 2BQRA 2V2KA 4KHMA 3A8IA 5LMUF 1XQIA 2IFXA 3CCUS 5IS2A 1VQ7S 1IBMJ 2F9DA 3IAM9 1VI7A 1KWMA 2B6AB 2FC8A 1RISA 5GADI 4C8ZA 1D8ZA 2N4CA 4OV1A 3M9MB 3TX8A 1I94F 1RB0A 5L1KA 4DPYA 3V6DA 3CDBA 3TVYA 2BANA 3IR6B 4ES2A 1VQKS 3PEJA 1E6YA 4Y2CA 3M2VB 2NXCA 4ZP9A 3UDCA 4AUKA 4I69A 1UJ5A 4IRKA 4DSLA 4RUCA 5HBMB 2CQBA 2BJ1A 4GVBA 2CNLB 4Q8EA 4UW2A 2J6UA 1JXVA 3BO2A 1DLOB 1NK5A 1D8YA 2RDDA 1MSWD 5FDLB 4HI1A 3PVXA 4KHPJ 3MF5A 2VDIA 4DWIA 3CSKA 2DB1A 2DNKA 2W7AA 4X4PA 3W9IA 4PAAA 3SDEA 3LGMA 1MMNA 3FEZA 1RWKB 2H54B 1R89A 4WXOA 4IG3B 5J1EB 3GP9A 3PKMA 2XSJA 3DHWC 2Y1LB 1E6VA 1APSA 1S6UA 3PTWA 1YKWA 4UOGA 1Y11A 1LEOA 5ETLA 3RU0A 1BGXT 1HNZF 1FRXA 4J9QA 2HHHJ 3NGRA 3BSCA 1YVFA 2QTWA 4H4OB 2HS3A 3JYTA 1VLOA 1NDKA 4M63A 3H2UB 4Y2AA 4IQXA 1CPZA 3R2DJ 3TZZA 4NL5A 3W3SA 5MAOA 3RZAA 4OX9J 2I6WA 2CJ9A 3EVOA 3Q89A 4CLZA 1TK0A 3QWPA 4DL7A 4RW6B 4UZCA 1OPZA 5KG4A 2HBZB 3G96A 3WC2A 5IM0A 1SQGA 3PYDA 1X4BA 3OUYB 1X5TA 3EJMA 4FYWB 1C0UA 1JLAA 3I31A 2OIHA 3I0RA 2QX0A 4BDPA 3AD8C 1H7WA 4LREA 3PW4A 1R27B 3P5BP 2H5IB 2K3KA 3D7SB 4NZ7A 4LF8F 1D9AA 1UKUA 3MI7X 4KYZA 3QNWB 2IA6A 2ZZTA 1SQEA 3MEEA 4FN5A 4DR6F 1V5VA 3BREA 3K0JA 3FK4A 2E1RA 2HFZA 3TAMA 3W60A 5HLFB 2AJ2A 4ZKAA 3CT9A 4CLPA 3BQ2A 3M30B 1IBKF 5IV3A 3P49B 2IVMA 1H72C 3SFGA 2M88A 5DDPC 4M5KA 2OEJA 5E3AA 4YN3B 4DR7F 1FDNA 3LP2B 3N01A 3W5XA 3GJTB 2DGQA 2VC0A 1PJ5A 1WNEA 2LU1A 1K73T 4KPYA 1T3OA 4IO9Q 4DG1B 1EJ7L 4CO2A 2HGNA 3MPWA 2ZKUA 4AFFA 4P72A 1S7HA 1ZM3A 5KFHA 3ZZRA 4WFXA 1RT4A 4LF6F 2EG2A 2KO1A 4FYYB 2RS2A 1LXJA 1PGZA 2Q66A 1K8AT 1WC5A 2KFNA 3QMQA 1RTJB 3OR2B 1GMWA 3ETMA 1HL6A 2QL7B 5C42A 2FZCB 1W26A 3D54A 2WSFC 2L41A 4LRAA 5CHCB 3GONA 5DJBA 1FFWB 2P9GA 7FD1A 4P52A 2J7KA 2V50A 4IUFA 1VQMS 4UUXA 4QCLA 4NA2A 3JXOA 3R27A 1YRUA 2FHOB 2FHJA 5HQMA 3A8EA 3H25A 5C25B 1CVJA 4DS5A 1S77D 1F2HA 4DEZA 4CLLA 3UWTA 5ETTA 3WBZA 2AIRB 3BKTA 3MAAA 4EZ9A 2CPEA 4Q8FA 4KO0A 3CDEA 1O6XA 1HNWJ 3BKUA 3THPA 1S6PA 4DSFA 2CQ3A 3OD2A 3AB4B 2V4JB 2GHPA 2DPIA 1RU2A 4PQAA 3MR6A 1GMVA 2HHTA 4OLPA 1RAJA 1FJGF 2CADA 4F4KA 2FHMA 4JI3F 3BGRA 2XM3A 3ISND 4ECWA 4PYAA 4IH7A 4CH1A 2DISA 4F0HA 2B56A 1YJNS 2ZC4A 2Q79A 2DHXA 3CIZA 1EZZB 1NHUA 1HBOB 1SH0A 4JI5J 1YI2S 2ZH8A 2PSZA 3QWUA 1TKXA 2A10A 4ED0A 4FNHA 1T3NA 5KG0A 3NWGA 3BQ1A 3EXYA 2PFFB 3LWLA 1FRLA 1PAEX 2DNNA 3Q24A 1S57A 3SXLA 1HQEA 1IKYA 4R8UA 4DN0A 2A2DA 2IRUA 3KJVA 4ED5A 4USWA 3R2CJ 2F40A 3OVBA 1S1UA 4IH5A 2HAIA 1RT4B 2GJFA 2EFNA 6FD1A 1WDTA 4TU9A 4HYKA 1UW9A 3H20A 2D3ZA 2DEJA 3C46A 4BC9A 4DV5F 2VQFF 3ZTPA 1Y3JA 4B9SA 1SC6A 3IG1A 2UU9J 3BB5A 4J91A 4FS2A 1C1BA 3N9UC 4LF4F 4ZDNA 2Z2YB 2XZWA 3CC2S 5CCLA 1KTVA 2JC1A 4ZVFA 2C3YA 2GQ2A 1VBKA 4NCGB 3QIPA 1NUEA 4ALZA 4EGLA 1FRHA 2ALZA 4RWWA 4HLBA 2L3MA 4LFCJ 4X4SA 2G2OA 5KFDA 4WK3A 3KLFB 3HFVA 1IBLF 4RR5A 4K4ZA 2IIHA 3KYLA 1X5PA 2DVIA 3MAAB 4GRSA 1SJRA 4KO0B 2A3JA 5HAOA 3TZWA 3EWGA 1IVZA 4QR1A 3L9ZA 1NKEA 2HMIB 2DNQA 2YKQA 4C3LA 3FMWA 1GTHA 1JLQA 4KKOA 4BLGA 3NY0A 1SXLA 1F3FA 3ZNJ1 4YR2A 2FJAB 1T03A 3I0SB 1KDNA 2LU2A 2Y1RI 1GXLA 2WVFA 2CPJA 1NMEB 2GFFA 5IC4B 1Y0HA 1Q79A 1FVQA 2C3UA 2HWTA 3I55S 1DHMA 5LSOA 3TOQA 4J9RA 2CJKA 2MQOA 4Z37A 3GILA 4DL3A 1F0XA 1XEZA 2A0FB 1QTMA 3SSSA 2B43A 4CT9A 5CYQB 3CJRA 5IV4A 2QA4G 1U4BA 1KLMA 3ILJA 3DMJA 2LECA 3OTDA 1V6HA 2Y0BB 1VC5A 1F60B 3LOUA 2F7VA 2PD1A 2VL1A 3FBCA 2B0GA 1TTHB 2DHGA 1H2TZ 1HQEB 1YG0A 2BKOA 5HVGA 3O1LA 3KJNB 1NU4A 4X4UA 5ITHA 4QPXA 2V8HA 4ZCIA 2YVSA 1ACMB 3KJVB 1F5CA 2IM1A 3EDQB 3TUJC 1DTQB 1S0VA 3UQSA 2H48B 2IC3B 3QFHA 4L75A 5J2QB 3CCQS 2V5HG 5HJXA 3IG1B 1IKVA 4A4JA 1D0EA 1EKSA 3M8QB 3AD7C 3B6BA 4EO6A 2HVEA 2OUGA 4ID8A 2R7VA 4ECXA 3HT0A 4V19X 2RQKA 4ELVA 3NWRA 2QO3A 3OJUA 4MFBB 1A0OB 2LQJA 4RJVA 2G0CA 4AL7A 3DGVA 1VJQA 2Z2LA 3CJTA 1EQMA 1TKDA 5C2CA 5K8MA 3CCWA 1YZ7A 2HURA 1YX2A 4ZN1A 2NYHA 1QAXA 3H7HB 2OJ3A 3OL6A 3GV7B 5KT6A 3M8PA 1M1GA 2XMUA 3C15A 1JLQB 4X66J 4KKOB 3ADAC 2FY8A 2CQ1A 4ZIWA 3T9NA 2Z57B 4QQBA 2W9AA 1J5OB 2YWHA 4XPCA 3SQGA 4U67Q 2LEBA 1JLCA 2KDOA 4O3OA 2LP4A 4DZDA 3D1HA 2FLNA 2E44A 4B9MA 2CNNB 1GQEA 4DR5F 2QSFA 2IMWP 1RT5B 1JNZB 1UL3A 2YWGA 4M5LA 2XEXA 4DV6J 3RAQA 5F8LA 4F2SA 1TFYA 4NLXA 3KFWX 4PXCA 3ISNC 2QFIA 3TWZA 3DMJB 2GVZA 2JEFA 4ZVEA 4R0EA 2CZ4A 3THTA 3GJSB 3OHAA 2FGOA 3QSIA 2GMJA 2RJZA 1RT7B 3F73A 1SBRA 1AUSL 3BH6B 1Q95G 2ATCB 2L48A 2ADCA 2O01C 2W9BA 3I96A 3ICLA 1RCOB 4K4TA 4AT1B 2EC0A 2ILZA 4DV3J 3R5AA 1YJVA 3MMBA 2JFKA 5LXRA 3SCKE 3W62A 2BV3A 5E3RA 2F4FA 3GYNA 2CUYA 2W4DA 3W66A 3DLGB 4RL1A 4NLTA 3JSMB 4U7CA 1G1XA 3ZZYA 1S4EA 1ZM9A 2ZD1A 3NS7B 1UPMB 4XPEA 1N5YB 3QYYA 5GMDA 3CUNA 4NI2A 5AJ3F 1Q0NA 2MQLA 4I0WA 4DV1F 5G0RA 2HW3A 1NNDA 1U1NA 3CCVS 3DLKB 1R8CA 2DNRA 4FF3A 2QGFB 2A6MA 2RUSA 4G3IA 1Q78A 2QEXS 1XN9A 3BSAA 4ZHRA 2IVFB 3ZTSA 1JLFB 1SL2A 4ECTA 1U2FA 3KDNA 3GSIA 2JVOA 3IWXA 1S9EB 4F0KA 1HW8A 1R31A 3LPEA 2ZJRQ 1FRJA 4IRCA 2B9WA 1TZ0A 1HWUA 2FIUA 4K0KJ 1KS2A 1T9UA 1AW0A 4OMFG 2GMHA 2RS8A 4OX7A 2DGUA 1YSJA 4IG0A 1NDLA 2CWXA 2M8HA 3EGVA 1RT6B 3BKFA 1TVRA 4I7FB 2OPPB 2AWZA 2HLTA 1IKXB 5A8WA 3R5BA 2LXIA 1QAYA 3W1YC 5L9NA 8AT1B 3KUHA 1X4CA 2BABA 2IAJB 1GAOA 2IHR1 3D66A 2HZCA 2FJVA 5I3UA 2RH3A 2R2RA 3UN3A 4DPWA 5CH7B 5J2NA 3NP5A 3GYGA 1FCAA 3TAQA 2HAFA 2GVZB 4K4SA 4YY3J 3CJ4A 4CTAB 4RW8A 4KR0B 4YB1P 1LQ9A 4O3QA 1RT2A 3MURP 1LWEA 2V2ZA 3M7VA 1VISA 1SC4B 1O0PA 2BW7A 2JVRA 4ELUA 1NK6A 4NXMF 5ETVA 3RAMA 5D6GA 4L72B 4ECYA 4DR2J 2E5LF 2YNFA 2MSSA 2CRLA 3KHLA 2B51A 5IT9Y 5KG7A 3GJRB 1VCTA 1S6QA 1M5SA 4K8RA 2AMCB 4TVAB 2CWKA 1KFDA 4ER8A 2KXHA 1FDBA 3MFIA 3LANA 4KGVB 5EDWA 3M2UB 3JTNA 1HQUB 1QSYA 4R5PA 3VWSA 2J0QD 3QRRA 2OPQB 4P2SA 3MFHA 1HBNB 4YB7A 5FIIA 1VGYA 2N3LA 4LRCA 3QGPA 1SV5B 2ASLA 2V6AA 1RAAB 2W2OP 3KG1A 1VJWA 3CCSS 1VQ5S 2CAJA 5T14A 5G0RB 2M5YA 3GR1A 4P6QA 1X8DA 2H51B 2GIQA 1U8WA 4CO3A 1RTDB 3S8SA 4NE9C 1HBUA 3RJMB 5BYQA 3MPUB 4FBTA 3QJLA 2WK4A 3KG4A 5L46A 2RDJA 1AT1B 4KHPF 2XULA 5ETMA 3ENQA 3M9NB 3UFCX 4ED6A 1XR7A 1SH2A 3B8HA 1X31C 1F3VA 2W8KA 3V81B 4NEZA 1RA7A 2HQDA 2GHWA 2AV5A 4ANDA 2LQ5A 3V6HA 2M4MA 1ZH5A 3JS9A 9ATCB 3OL8A 5A8WB 4PG5A 1TUGB 5B0AA 2HHWA 3N28A 5DG7A 3TRGA 3KUEA 2AJ0A 1S7IA 4F4YA 1VQ9S 1MWZA 4DI6A 1S1VA 3SYZA 3EE3A 4RW4A 4QWAA 3SZ2A 1WSVA 1SL1A 1J5EF 3EPIA 2RAQA 2ERRA 1Q8LA 2X3DA 2BEFA 4ZP8A 4A8FA 1N52B 1N8RT 1NAQA 4CO1A 4OX9F 2FYXA 2FQQB 3S01A 2QRRA 2P8IA 4KRWA 1S9GA 5AXNA 1LFWA 4DCPB 4PG6A 2DHSA 2VZ9A 2HFUA 3IWLA 1TL3A 3T9ZA 2YKMA 3QBCA 3W8PA 3UI3A 3C6UA 2QZ8A 3BPSP 3JSRA 2K1RA 2RT3A 2R7XA 1GK8A 3NKYA 4C11A 9RUBA 4Y28C 1SQFA 1X4AA 2IYIA 4KY3A 2P9CA 4E2FB 4DCOB 2HQGA 2GJ2A 1MLAA 1T05B 3T5LA 2CQPA 2MSTA 4GO7X 4MMOA 2VQEF 2OELA 2HVHA 2HFNA 3BO4A 3W64A 4NMXA 2EBEA 2CXEA 2ZBRA 1S1XA 4L73A 2WONB 3FKBA 4OFZA 4H54A 4DSKA 1JLGA 2ASDA 3DI6B 1JKHA 3EGNA 2MY8A 3W61A 3TUIC 1KP6A 4ZPDA 2RRNA 1KHVA 4PWUA 5I42B 4PCQA 4W4MA 1NJXA 5BYRA 2W9CA 5K14A 4B3TJ 5KT4A 5EHHA 3T5HA 3NS6A 2JLGA 1F2GA 4KQZA 1HYSB 2GMLA 3RAXA 2CKWA 1JJ2R 5G4DA 4AE5A 3MOJB 3A3NB 2V8VA 4FKXA 1A7GE 3W2WB 3PRDA 3N6NA 3HMJG 1HWIA 4NZ6A 2R2TA 3KNAA 3UVJA 4LF9J 2IBKA 5B7WA 2XO7A 3QT5A 1M0SA 1VC6A 1N33J 3IRXA 3C19A 2BOAA 2MPUA 5HMZA 3OTEA 2BKPA 3Q8SB 2HVZA 4Q43A 3F0NA 1EKRA 2WSEC 2UV8G 4WFAQ 4DV7F 1MN9A 3I9V9 4FBUA 2F4VJ 1DY3A 2HNDA 2D9OA 4LVNP 5RUBA 2V2QA 3BV8A 3QQCD 2JL9A 3AODA 4HACB 1VQNS 5KFZA 2UVRA 2EFPA 4I1TA 1HNWF 4EYIB 2M52A 1B0PA 1M90T 4OI6A 1D09B 2CVIA 3BF4A 2E7VA 1HFEL 2ASJA 4ZPCA 1OJ4A 1TL3B 1JLBA 2LKZA 5A8KA 4OZLA 1ZAVA 1OY6A 3B78A 4RO0A 2XGQA 4OZ5A 5HSPA 1UVMA 1FEHA 3RBEA 4I56A 2NXNA 3W65A 1HHQA 1Z1ZA 4OQJA 1ZTWA 1QSSA 4Y65A 3LQVA 4PG8A 3Q86A 4RLEA 2F8EX 1I51B 4NA1A 3W9JA 4B9UA 3TVKA 3JB9k 4JI5F 2IYGA 2HIYA 3DLEB 4WKRA 2JNJA 2B4OA 2FLLA 1RBOB 4URGA 4JOUA 4IOBA 4M5GA 5MLCV 4C7QA 1CC8A 4UY85 1RK8A 1UP1A 3J7YU 1PILA 1GX5A 3QFWA 1LNQA 4YDDB 1URRA 2G2ZA 3DU5A 4MK7A 1R0CB 1WG1A 1QUVA 3RW6A 1Z2LA 3UN5A 1KKHA 1RKIA 4M94A 2UU9F 3TYTA 3AJ1A 1I94J 4OJGA 2BVZA 2D3UA 4DS4A 4C97A 3I5BA 2YWFA 3MXHP 4Q45A 4LF7J 4I64A 3DRYA 4GKKJ 1SJ4P 4C6AA 2IVYA 2C2DA 2DH7A 3LAKA 4ED1A 1QSLA 4I6YA 1Q8IA 3O2IA 3IRXB 3W9HA 4G1PA 1NB7A 2GVDB 2Y8YA 5HVFA 2B4VA 3ZZ0A 3TA2A 3IR5B 2QA4S 1RT1B 4LFCF 3HI9A 3IGVA 1VRUA 4I4BA 4CT8A 3GMGA 3Q8YA 4QJVA 3M32A 1RWNB 3D0IE 1TL1A 2UVUA 2VONA 3FZ2A 5D3GB 5F8JA 2E5HA 3MEKA 2B8QA 1UVKA 2XMKA 2DNHA 4FXWA 2UUCF 1NZAA 3WDOA 1VRTA 3RB4A 2XO6A 1FNOA 2KB2A 2DR7A 2AF6A 2IBOA 3BJYA 3L7OA 2YWKA 1RADB 2VU5A 3VAIA 2KVIA 1JWWA 4USJC 3V4MA 3BDPA 3IGNA 3EDRB 2VICA 2KYZA 2LXUA 3PYEA 3KHRA 1RT3B 1PG5B 1WKLA 4URQU 3GIKA 3KLEA 3SFUA 4YHHJ 2C3OA 2OMLA 1IR0A 3W63A 3IS9B 3I9ZA 4LFBF 4ED2A 1WF0A 2ZH4A 3PR4A 1H73A 3EXCX 1WUUA 1CG2A 4O0IA 2R2UA 3MMAB 3MR5A 3MEDB 3U7JA 3FEYB 1B7FA 4JI4F 2E1PA 3PEHA 4B3OA 2OSRA 3U1NA 4N56A 2IMOA 2HG4A 1SKRA 2H9ZA 4CIOA 2Z4PA 3HHLD 1IJFB 3TZYA 2DGXA 1X9MA 2AX0A 3L7UA 4HEA9 5BR8J 4RWXA 5DLGA 3M2RB 2FVSA 4LF8J 3EM1A 1T7PA 5F3TA 5B09A 4JBCA 5J2MA 4NWBA 3ZZPA 1WG4A 4ANEA 4ECRA 2Y1JA 1B70B 2Z8QA 2G2YA 2H1YA 3PW7A 4QU6A 1N6QB 1GMUA 2ZUGA 1IBKJ 1FWPA 2VPYB 5K8NA 2W2MP 2V9KA 5IQQA 1BQNB 3CMQA 1L3UA 3WIUA 4DR7J 3AOAA 4CLTA 2V9WA 1LW0B 1Q7LB 4DV4F 4IQMA 2XMMA 4IDKA 5AXMA 2C3PA 4B3RJ 1B7YB 2RRAA 4L74A 1S1TA 3DYAA 1IR1A 2AGQA 3RW7A 1GFWB 3G6ES 3T6JA 2QE5A 1FVSA 2DT9A 1CJKB 1K47A 2POKA 3CCLS 3PHEA 3RUBL 2DYAA 4NMLA 4Y2IA 5DG8A 3CDAA 3FFIA 2DNYA 2B3TB 4X66F 1VLYA 1ZZNA 2RIJA 3KLGB 3CO9A 5KFQA 5AE1A 2N7YA 3AXKA 1XNQJ 3IAS9 4Y00A 1RYRA 5K8OA 4IR1A 1EQ0A 3DDKA 4RU9A 3HF5A 4CRJA 4B17A 2I5JA 5B0GA 2R8GA 4B3MJ 1XMQJ 4UY8T 4E0DA 2VD3A 3R8YA 3IBCB 1SUQA 3FZBA 3R5CA 3DRSB 2DR9A 4DHVA 3X1LB 1D9DA 2YH0A 2BJEA 4OI1A 4DV6F 5KFTA 1KQFB 2LEPA 2ZKTA 2KTQA 2OMOA 3DM2A 2MKCA 2I2YA 3K5MA 4QIWD 4HDHA 1HW9A 3VAKA 3HPOA 3J81Y 2OH2A 2B4UA 3UDEA 1KQKA 5E3QA 2Z30B 1LWFB 4WE1B 2WW4A 4CO0A 4K5RA 4JI7F 2KZZA 3C16A 1OIAA 4YS2A 3KK2B 2R9LA 1I3OB 4E8UA 3CJ3A 2OD4A 1JIHA 1F9EB 3KK1A 3MM9A 1T9TA 4C3MA 2GAHC 3TJ8A 3CDWA 2AYMA 3PY8A 4DL2A 4DV3F 4DX8H 2IDLA 2ROPA 2PGCA 1J2VA 2V0NA 2OD6A 4ETZA 4ZJOA 4M5JA 4HL9A 1FESA 4CO5A 2WVCA 1MU2A 1TMJA 2MLYA 2YQ3A 2R4FA 5E33A 4CM0A 3TQEA 2NXUA 1JLEA 4I2QA 4JP8A 2GGPB 2MKKA 2A2CA 4QBUA 1IXKA 5IT9U 3CJKA 2JDJA 2GA7A 1EARA 2J76E 3PW5A 2MHEA 1RGVA 2J5AA 2LYVA 4A8MP 2J9DE 4NX9A 2OI2A 3IBWA 4BCAA 4F3QA 1R43A 2MKYA 3V2UC 3PCOB 1SIZA 3DRPA 4KGKA 3NGKA 4PG4A 5JVHQ 4KB7A 4N41A 4ILMA 3MECB 2NSBA 4K0KF 3U1MA 4WYLA 2Q3PA 4DV5J 1UWBA 2BM1A 2P6SA 2FJBB 1IWGA 5HI7A 4LSNB 2AD9A 3M1VA 3QAUA 2VG6A 4LF4J 3H90A 3RB3A 1HMVB 4PPZA 2DNLA 3PYGA 3VZIA 3D1QA 3BBFA 3D3BJ 2P2CB 4U7UK 4WTYA 1OSCA 1ZTTA 1LW2B 4DV2J 2ZVIA 4O23A 2ZH1A 1PAUB 2NUUG 2AKWB 3DOMA 5LL6d 3DOKB 3OR1B 4WYWA 1S12A 3UD5A 4OV6A 3TX0A 2OEKA 1TL7A 4QIFA 3CJQA 1IBLJ 1MROA 3FBEA 4DX6A 2FGCA 4EI2A 2L9NA 1HNVB 5CA5A 5DM7Q 1M5KC 1RWMB 3G82A 2ZWPA 3UE2A 3LGHA 4F8RA 3OLBA 3I87A 4X64J 2BKNA 2CPXA 3MM8B 2DIVA 2WOMA 4YY3F 1RWWB 1X9WA 2KHDA 4ZPAA 1IJEB 2B5JB 2HRUA 5IC6B 1FKOA 1R0AA 4HI2A 1B0VA 2QG9B 2B7BB 3C16B 4P2XA 4A8YA 4USVA 2B4PA 4ZS6A 3PRBA 5A8RA 3MM9B 5DGAA 5HO4A 3QGGA 4TQSA 2ZBIA 3W7BA 4O3NA 2AGOA 4JI8F 3J7AN 1RWPB 3CJ5A 2YNHB 1NK8A 5A0YA 2PE8A 5H9FJ 1FK9A 1HPZA 1Y5LB 3HHLC 4DFJA 1FTCA 2KXNB 1U24A 3DU6A 1Q8BA 5JXSA 2CJAA 2IPOB 4LBHA 2KN4A 1M5HA 1PC4A 1U1QA 3Q8UA 4DUTA 2GAGC 1T9VA 2PI5A 2FPHX 3OTBA 1NRKA 1OYEA 4LSLA 4EZ6A 3UDLA 3AJDA 2IRXA 3BN4A 1WI8A 4IOAQ 1KHWA 1TR0A 1XMOJ 1N32F 4NRUA 3K2YA 1TKZB 4HHHA 1RTIB 2KM8B 2HQIA 1Y9OA 4NXNF 4LRBA 2P9EA 1FE0A 2ACYA 4F4AA 4NCAA 3GFHA 2GS8A 1X4EA 1UVNA 3KLHA 2EFQA 2NUHA 3MEGA 2LEAA 5C5JA 2SXLA 2QV6A 4WWSA 2VPWB 3UNYA 2Z56B 4ZJQA 3H5SA 2NZCA 3NCQA 3J7Z5 3TA0A 2BW2A 3T1YJ 1CEZA 3HHKA 1MW7A 2QLJB 3CF5Q 1N56A 3AQOA 4M5MA 1VDHA 2WZ1A 2RQ4A 2IM3A 5IQ6A 3K5OA 3UW1A 3OFGA 3AA9A 3U1LA 1HNXJ 5J2PB 3I56S 2ZE2A 5A2QY 4DX7A 4LRFA 1CS4B 2JZ5A 2RKIB 4O0NA 4MKYA 1Q81T 3IFEA 2D3O1 4MIWA 2C1EB 3G82B 3T5KA 4H4KA 4KFBB 3EGZA 3TUZC 4ZLJA 1UWAA 2AYEA 1UA0A 1NJWA 4XTTA 1WC0A 2YX1A 2DGTA 4ECVA 3CDUA 5D0GA 4HKQA 1X4GA 4J90A 1BE4A 1OS5A 4C8MA 4X4TA 2G1DA 1C0TA 5KG6A 3OSPA 3G2XA 4ITSA 3SCIE 3VGUA 4OYWA 1V9OA 5K20B 1SPBP 3WHIA 3MWBA 1ZAXA 3PFOA 2VFTA 1SB6A 3NNHA 5LXYA 3CTRA 1N48A 2QL5B 2E66A 4KV8A 4ILLA 1P27B 2HS4A 1KONA 4G1IA 1HNIA 4I68A 3BH7B 4EEYA 2KM8C 2LLZA 2XNQA 1KN6A 2GQQA 2F63A 4J5OA 4L3KA 4H4MB 1TKTA 3CCZA 1REVA 2VBZA 1NZ8A 2XGPA 3H2VE 3TVZA 3CCRS 4B3TF 2RU3A 3G8TA 4J9PA 3ET6B 4J9VA 3J7YI 4TN2A 1YRXA 4FF2A 5DRKA 3LTOA 1HQ2A 2NLWA 2OLWA 4WK1A 5KFEA 3D9BA 1W2IA 3QZ8A 4O4GB 2J9DA 3PO4A 4LR8A 3VGSA 3MEGB 1FHTA 2J6TA 1D9FA 4K59A 1OY8A 2KH9A 3IXQA 2OTJS 2C28A 3NNCA 3TR5A 2M3DA 4RNHA 1IWAA 5ETNA 2E1CA 1TFWA 1S1WA 3OTOF 1EETB 2W8LA 4A8QA 1KOHA 4FF4A 3IMQJ 1VC0A 1T94A 1N33F 3TO8A 3QLHA 2K06A 1S59A 5AJ3J 4EBCA 1VQPS 4C8NA 4DU7A 2FJEB 3ZZUA 3L95X 5T7LA 2MYFA 3AD9C 3IM9A 1M5VC 1QLNA 3NOCA 1AFJA 2ZH7A 1MG7A 1GEHA 2DO0A 2ZH5A 5ETKA 2Y8WA 4MKVA 1XMBA 3FSIA 4EU0A 2OPRB 1FXLA 4UOFA 5C24B 4C9DA 2APOA 2L9DA 3ISZA 1K1SA 4XDDA 4UQGA 1JXLA 1NBEB 3OVSA 1S72S 4WKYA 2CPYA 1RAOA 2GZOA 3DXBA 1C0TB 4CLKA 4GKJJ 3DDIA 2VFVA 1CBKA 2M2BA 1J27A 2R8IA 2HIQA 1JJ4A 2QMUB 2BXJA 2M7SA 5FLXY 3HJFA 3IRWP 1XNRF 4MKAA 2W4CA 3NBPA 3OBIA 1VIOA 1LWCA 1NH8A 4UUWA 4OZ1A 3RB6A 2HYIB 4KV8B 1D1UA 3N5FA 1K0TA 5AXKA 3G4SS 2NXJA 3ENWA 4WF9Q 3WIVA 4WPAA 2EKYA 3J80Y 3J7ZT 1TKTB 4FKYA 4NXMJ 4NLPA 1DURA 2KT5A 4EUVA 2FC9A 2E5LJ 4WFNQ 2H65B 2XMJA 1T9YA 2MY7A 3MCOA 1N36J 4ENOA 3PJ9A 3K8VA 1XK8A 4AD6A 4YEAA 4ZMMA 4KHRA 4KJIA 1DTTB 4OLOA 3MR2A 2NPFA 2DCUB 3LP1A 2MZTA 4RBUA 2DRBA 4LF7F 1O51A 3EMTA 1EP4A 1Q86T 4GKKF 4QU7A 1CJVB 2VH7A 2FTRA 1HBMB 2GJIA 1GT8A 2JEIA 2XZTB 3N4WA 3QO9A 5CAAA 3SIPB 1U45A 4F36A 1RDRA 1P9YA 3QATA 3NXZA 5CZVA 1X4DA 4YMEA 2ZDPA 2QLWA 4O44B 4PUOB 2VDHA 1VBXA 4P2FA 4ZJLA 4F0MA 1XR5A 1VIXA 1WKJA 1U1PA 1FFSB 1VS3A 2MZSA 2HQFA 4RPFA 2XZDB 3M9OB 2RDIA 4KC5A 4EK2A 3QJPA 1UETA 1SL0A 1JQGA 4X84A 2WVBA 2MZJA 1DJ0A 4YQWA 1QE1A 1H7XA 1NHVA 2LXFA 2GIFA 3GFXA 4PPDA 4V1Ak 2XLIA 1T9WA 2J9EA 1BQMA 3CO0P 4UOCA 1NPPA 3MHYA 5F9LA 1UJ4A 3C66A 4I6AA 3VHQA 4P74A 4ZLNA 4MH8A 1QTNB 2DXDA 3A3OB 1HI1A 8ATCB 2BX6A 2GV1A 4TU8A 2HHUA 2EKNA 3MM6B 1J5EJ 4Q7AA 4CZCA 3D6HB 4YHHF 2GO8A 1NPKA 4ED3A 5HP1B 2ASYA 1RTHB 4C8KA 4NOHA 4JI0F 2F8HA 1L3KA 3QT7A 2PO4A 1N34J 2MJNA 2AW0A 1RBLA 4AYBD 4IYQA 1U1MA 2AZ1A 4DR1F 2FDNA 3GCXP 1C2PA 4G1QB 4Q44A 2XMVA 2W2NP 1FNXH 4FZVA 2MQNA 4F67A 1VBZA 3VAHA 1WDDA 2HNYA 2AX1A 5BR8F 3ILIA 3BM7A 5DM6Q 2Y1IA 5HQLA 2BA9A 2WW8A 3DRRA 3J81U 2OP5A 2VQEJ 1WKKA 1ITPA 3FMBA 3V6DB 4RX6A 3HZGA 1LK5A 2BANB 1U1RA 4XAKA 4KGMA 1V3ZA 3CJ2A 3AA8A 3M8WA 5BJRA 1E6YB 2GO9A 3Q8VA 3NS5A 2OSQA 1GMWD 1U0HA 2EK6A 2VOPA 3QO9B 3PACA 5LMNJ 2UV8A 1TV6A 4ZLPA 3BSNA 5ETOA 4LUBA 2XS2A 2PMHA 3W5YA 1FTRA 4GVBB 5ETQA 4ANCA 1JMTA 3K57A 4PRFA 2JRSA 1W2BR 4BC7A 4B3RF 3JQJA 1BMQB 1IKWA 2JFDA 4J37A 1P8GA 1NK0A 2GX8A 1JXEA 2FHJD 2KG1A 1NKCA 2MKIA 3K8WA 4K4UA 3GV8B 2HVDA 1WEZA 2DRAA 3VCDA 2JH3A 2IA0A 2EVZA 3P8BB 1CSJA 1FERA 1S48A 5B0DA 3ZFVA 2XI3A 4NA3A 3HLUA 3HZEA 1OQ6A 3SDEB 2W7PA 3RYLA 3AB2B 3M8RA 3G6XA 2A6OA 2PC6A 4LQ3A 2BE2A 5M2UA 3DKDA 4WU2A 1XNQF 3RRGA 2FUG9 2XSJB 5D78A 5DS7A 1E6VB 2FJWA 2WVEA 5B0CA 3MMCA 2H5EA 2HQ3A 4F4WA 5E41A 3OV7A 4WFBQ 3H40A 1FJCA 3JTPA 4B3MF 3Q0AA 1XMQF 4MT1A 4OYIA 4J9SA 4DV7J 3ITHA 1PJ7A 4OZ0A 1DQ8A 3BYPA 3JYTB 3T1HF 2E9RX 1FKPA 1VK8A 1YLXA 4A8KA 1SKUB 1CJTA 2CZ9A 3VAGA 4RBVA 4RW7A 2DNZA 2EWHA 3UDVA 3H59A 5DDRC 1N54B 1NJZA 5D0EA 3IP0A 3GIIA 3JAMY 2CPDA 1PBAA 2KJWA 5IM0B 3POTA 3AHPA 4LT6A 4ZCKA 3R97A 3ZZZA 3R5DA 4DR3J 1C0UB 3FJ2A 1JLAB 4M1KA 2ZBCA 1CQMA 2MGZA 3I0RB 4DZ6A 4ED7A 3VAFA 2KT3A 2G4BA 1GXTA 4OJHA 1FRIA 1F5BA 3MEEB 1OMSA 1CJUA 3TAMB 2XMWA 2HNZA 3Q2SC 1NSQA 4NLVA 1RAIB 2RQMA 3AOBA 3QSYB 3DXSX 1U0HB 1FA0A 1S4FA 2DH8A 2Y9HA 4CCHA 4BWMA 3TARA 2OHDA 5DQHA 1YDLA 3LP0A 4K4YA 1RHJB 3RBZA 5EX3A 4W90B 2HFVA 1TP7A 2CJQA 2ZEJA 4J9MA 4P10A 2VJVA 3DOLA 4ECZA 5D8HB 1TMMA 1TUVA 5KTQA 4HT7A 4MIBA 3IM8A 4I6WA 2V67A 2MEWA 3NAIA 1N5TA 4RNFA 2RUGA 5C42B 1RI7A 4FP9A 4RKUC 2YNGA 4TY9A 4ECQA 4DDFA 2XY5A 2X51A 1Y00A 3G87A 1U48A 1HI0P 3EVMA 4DV2F 4WFZA 4LF2A 3KJFB 2VG7A 4J7CA 5KFIA 1NCLA 6FDRA 3JSBA 4OHZA 4F3OA 1LOUA 1NPRA 3FVYA 4K4WA 1QAIA 4DOZA 4M5DA 3GU0A 4QYRA 3L7PA 1YRTA 1UCNA 4DBQA 4DPTA 1ZAWA 1VQ6S 3FDSA 1ELOA 3JQMA 4X64F 2W01A 1S6PB 2V2VA 4NLWA 4XK8C 2YQ1A 1KVJA 5H9EJ 1SJQA 2C2NA 4FYXB 4EYHB 3SBMA 1R6YA 5A2QU 3MM5A 2UUCJ 3CE8A 5KG1A 3NGDA 3BR9A 3V6JA 1WORA 1QJHA 4I2PA 3KK3A 5F8HA 3DDNA 3VAMA 2VPZB 1G6BA 1AB8A 4YR0A 4JV5F 3BGRB 4TLQA 5B0BA 4MK8A 1DQ9A 2LQ9A 4Y2KA 2B9YA 4CLYA 3HP6A 1QVFR 3DRXA 3O3LA 1CJUB 3WZ0A 4MAKA 4DLEA 4FVCA 4GO5X 1TKXB 5CQGA 2F3JA 1WACA 4LFBJ 4EFAC 2BYCA 2AQ4A 1RE1B 3CULA 1WHVA 2XHWA 3UR0A 2DXEA 2OFHX 2YPYA 1I6JA 2I0XA 1IKYB 1HD1A 4R8UB 2AJFE 3NNAA 3MUVP 4JI4J 3KKFA 4K4VA 1T8EA 3HVAA 2MQ8A 1XMOF 4RW9A 5CYMA 3GG1A 1G2EA 2VF3A 4B3SJ 3DOLB 1OSDA 1S1UB 1CULA 4RNMA 2HBQB 3VALA 1R3NA 1Q5YA 1EIYB 1WHXA 4F7VA 1C1BB 2CVEA 2DJWA 5DDOC 4KSEB 2R7QA 3D3CJ 1N88A 1VQ4S 1F9HA 2EXUA 3T1YF 5D0HA 4DL4A 2CNKB 1Y7PA 2ZOFA 4P9SA 2Q6CA 2GQCA 5AE2A 2C22A 3X3UA 2QT7A 3QIPB 5KFOA 4J9UE 1XTZA 4X4NA 4IFVA 1PKUA 5HMYA 4TY8A 2VG7B 2AZ3A 4OYAA 3VR1A 4DV4J 1HNXF 3HX9A 1B0TA 1AZSA 3T19A 3R3TA 1HIYA 3I4PA 3TW0A 3H5XA 2CPIA 1Q7YT 3BEGB 1S49A 2DBBA 2KKHA 1VFJA 3VQTA 2V34A 2E9ZA 1RQ0A 4DF4A 4B9NA 4LF5F 1R0BG 5A6PA 5KFUA 4M8LA 3HT3A 2YWWA 4Y2MA 5KFJA 2XQCA 1T03B 1FWLA 2RVJA 3FNNA 3QRQA 4CYUA 5HROA 2C2RA 3G6VA 1C1CA 1T02A 4MKBA 4FS1A 4Q0BA 3FSXA 2HK3A 1WELA 1X4FA 4TQRA 3CC4S 1Q53A 5KFGA 3A8KA 4QZVB 3I6PA 3UCZP 2V69A 2N7CA 3CIMA 4LBPA 1WHYA 1MMLA 6AT1B 3FGVA 4DX5A 3SSRA 2RMLA 1EHWA 2HGMA 2D41A 2MXYA 2R7OA 4ES3A 2W25A 2ZFHA 3MMJA 1KLMB 4EWTA 3HVWA 3KJQB 2B6AA 1BD6A 1NXIA 3D4JA 1RACB 1R8BA 2E1MC 4KE5A 2BMBA 2HHXA 5FLXU 1UTAA 2F65A 1TQLA 1VQLS 4A8OA 4CWBA 3K58A 1WTBA 2ZITA 4JI7J 3M2VA 4CH0S 4NEYA 2R7WA 2ZDOA 2FB0A 5F8NA 5F41A 1IM6A 2VG5A 3CB4A 5D4LA 3M4XA 4Z2XA 2K3IA 1NK4A 5HBMA 1HI8A 2ZHBA 5CXTA 2DNOA 1IKVB 3J80U 3T1AA 2LA6A 2E7WA 1GH8A 2ZJQQ 4WP9A 2XHCA 5FDLA 3N5BA 1VQSA 1YBUA 1H74A 3TEHB 3J81j 3LUYA 4ZVHA 4TY8B 5KG5A 4X4VA 4FXVA 1HD0A 3B4DA 4OJ3A 1F6TA 5E7OB 4ES1A 2F1FA 2X1AA 3G71S 2CA9A 5LJ5Y 4IG3A 5J1EA 3VF0B 1Y5NB 1RU1A 1WWHA 3OFEA 4UT4A 3MCNA 2ZHAA 2LDIA 3TI0A 2PMWA 4N8OA 3EGWB 5DQGA 4ZPTR 3PIPQ 2KU7A 3PNIA 3M8PB 5I4MA 2FVQA 1X9SA 1B3TA 4U96A 1NEEA 2R42A 5M2PA 3C15B 2YBVA 4OYXA 5KFSA 2L08A 1UA1A 4H4OA 1OPIA 4F25A 3J7A1 4HTJA 4OZNA 5GAHI 2AJ4A 5IWAF 3HFKA 3SQGB 2OFGX 2R7TA 3BO3A 1SJ1A 4NZ0A 4DSJA 5A76A 4JI2J 2AEMA 1JLCB 4GKJF 3A4TA 4A46A 4IFYA 2LFVA 3GJQB 5IT0A 3W5ZA 4RW6A 3MAQA 4AXJA 4DL6A 1TAUA 3OFHA 4ZCMA 3HO1A 3NGSA 2VA3A 3MCMA 3OUYA 5HMXA 3NCRA 2QC3A 3DGPA 1TUWA 4NLQA 2BRLA 1Q16B 4OZ2A 1NH7A 4QWEA 1JB0C 3OW2R 1HARA 1R8AA 3JQKA 4P75A 1RWXB 3RG6A 3AXMA 4OYOA 4ZPWR 3PW0A 3VGTA 4KPCA 2KZMA 2GNKA 3I5CA 1RYSA 3L4BC 4UTGA 1RWOB 1U09A 5HLFA 1L3SA 4M5NA 1IQTA 1FWKA 3AT1B 2W9BB 3QJJA 3M30A 5KFXA 4ETXA 3S6EA 1N36F 4NYZA 2KFYA 1XWLA 5KAKA 4Y0FA 2VG5B 4B9VA 1KQGB 4WIIA 3LP2A 3RRKA 3OFFA 4WU3A 4JI8J 1FRKA 2NS1B 1FD8A 1R6VA 3GLJA 3MMBB 1FT8A 1UJ6A 4JV2A 3I5AA 2V68A 2DD8S 1ZETA 2B9XA 2V8PA 4DG1A 5U47A 3KNGA 2X1FA 1SJ3P 3ZXWA 3SI8A 2ZD1B 4ZPVR 3UCGA 1UFWA 4DU8A 3V4IA 4NI2B 1FKAF 2X3GA 2JC0A 1RTJA 3OR2A 1WOPA 4BWJA 3KDOA 1GX6A 1KRPA 2D74B 1NM2A 4X4QA 3MR7A 4ZHRB 1N32J 4GC7A 1KEKA 2YH1A 3NLCA 3BYRA 3PO5A 4NXNJ 3FQKA 2DGVA 2UUAJ 3HCXA 2VODA 4WJBA 3FUYA 4P71A 2M70A 2DKOB 3GZ7A 5C25A 2P5VA 4IG0B 3DNCA 1H6KX 1TVRB 5L39A 1QUPA 4CM2A 5SUHA 1M1HA 5GAGU 4ZCLA 2C42A 4OI2A 3KXDA 3D0HE 4O3PA 3MPDA 1X0PA 4IFYB 3OJSA 2NZ4A 4CLFA 3ZTQA 2JSXA 2V4JA 1KBRA 2C2OB 4ZVPB 3GSDA 3E8OA 3MM7A 5KT2A 5ETSA 2GIRA 1XERA 3FCWA 3P3DA 4D3GA 3LH2S 7FDRA 4L76A 5I3UB 2YPZA 5H1SV 4JV0A 2DGOA 3DGPB 5J2NB 2WVDA 4DQSA 2UXCF 1Q82T 3Q8PB 4URSA 3D1OA 3PDNA 2Y0SD 3F44A 2I8EA 1N34F 1U0SA 4RW8B 3NRBA 2M9KA 1RT2B 4HVZA 2IJNA 1S10A 1LWEB 2K7KA 3K89A 5HMWA 4N5SA 1HBOA 5KFKA 4C0HA 2EW9A 1UVLA 3VZHA 5D4OA 3H98A 2C2MB 1U6ZA 3ENVA 5T41A 2YNFB 5IFMA 4MIAA 4ZVGA 4GMKA 4QPTA 2FVPA 1FNMA 1MMDA 4ZVQB 2VJUA 4MYTA 5KFYA 1S6QB 3U02A 2JX2A 1TL5A 4OZ3A 5AT1B 2HWIA 3K5NA 3W2VA 3TA1A 3JAMU 4TYAA 4R5PB 3GB0A 2O5DA 4CLWA 1OWXA 1MN7A 2YX7A 2KJVA 5LMNF 2H5JB 4AL6A 3LF0A 2ZNYA 3V4IB 4DQRA 4NPOA 3CXCR 3W8GA 3KLIA 4HHUA 2WRMA 1C4CA 2BE7D 1NDPA 4PKDB 1HBUB 4NCGA 1AA1B 3NCPA 2DR8A 2UUBJ 3HKZD 3BZQA 5I3PA 4ILRA 5D4PA 2XB2D 3RTVA 2AHOB 2XWYA 2O3DA 3PX0A 2B9EA 2ZOGA 2DHHA 1YJRA 3KLFA 2N82B 4LJMA 1TK8A 4QIVA 3ZTRA 3PZPA 1S0MA 3OTOJ 1G7CB 2FD2A 4FPIA 1PCAA 1DQAA 1RJJA 5KFCA 1UZDA 4CNYA 2R7SA 1SI9A 2HMIA 2CJBA 3SV4A 3R7SB 2UVWA 3HKWA 3CCES 2IJRA 2KT2A 4QYZK 3MM7B 3I0SA 1S1VB 7AT1B 4RW4B 2XS5A 4ZOSA 2UUTA 4JI6J 3PHTA 3I32A 3ONQA 5D4NA 4LFAJ 2CIMA 3PW2A 4KH1B 4QOTA 3K7RA 2W24A 2IM2A 4JB8B 4HTIA 5LM7E 3TANA 1S9GB 4X65J 2R2SA 2MZQA 1PIEA 2FLOA 2FHKA 4J9LA 1L5UA 5CYQA 2YKMB 3C6UB 3RB0A 2CQCA 2DY9A 2K1RB 4DR3F 3C2PA 4C11B 4C3KA 4QR2A 2NR0A 1A6LA 1R8HA 3K5LA 1RWUA 1H0HB 4OX8A 2CQIA 4KGXB 1FI4A 1NSKL 4HHJA 2W2QP 2OO4A 3GE9A 1XNRJ 1VQYA 3I82A 2HFSA 4CO4A 3GPAA 3W2VB 3G8SA 2RILA 3ULHA 1F9FA 3ZC4A 3WQPA 3F41A 1S1XB 4N8NA 5KG2A 2ROGA 4OZJA 3MDFA 2KRBA 1DTQA 4YB5A 4OL8A 4PABA 1JLGB 4LIRA 4C0BA 1JKHB 1GNKA 3BGLA 2IC3A 2JLEA 5J2QA 2HHQA 1O5JA 3M8QA 4WZQA 3KLIB 2J6SA 1RHMB 3KWMA 1WTFA 1NSAA 3H2LA 1S76D 3P45B 1U6FA 2W9CB 4LSZB 5K14B 1P1TA 4K50A 2BRKA 5E2QA 2LMIA 3OL9A 2PEBA 3NOGA 3O6QA 1YITS 2W2PP 4FPRA 1N0VC 5C7PA 2CG4A 4LQ9A 4MFBA 3U27A 3LGNA 4F04B 3HSDA 4C98A 3DLBA 5F0UA 5B0EA 1RHQB 4ICLA 2BJDA 2GCFA 2EI5A 1JJHA 5EWEA 4ED4A 3E01A 4YDXA 2CQDA 4WXWA 1Q1KA 4ECUA 1FXRA 2KRRA 2OKQA 3EZ5A 2AEJA 3CD0A 3UVJB 2WSCC 2BBEA 4DQPA 1M5PC 4DR4F 3FRZA 4EBDA 2LA4A 1REGX 1XR6A 4JUZA 3L09A 5CZXA 2RSQA 2VFRA 3VV2B 1TU0B 2CZVC 2O67A 2WHOA 1XBWA 2UXDF 2H4WB 2A18A 2E1AA 2D9PA 1J5OA 2DNMA 3HSGA 5M2RA 2XTJP 3MD1A 3Q22A 5A6WA 2HNDB 2I38A 3QPIA 5H9FK 3DN9A 2QA1A 3ZZTA 2ADBA 5EUHA 1ZYQA 3LA0A 2MKJA 4IRDA 1YHQS 3DCAA 4G65A 1TELA 4CP5A 2W4PA 2COLA 2IJFA 1U1OA 1RA6A 1A9NB 1RT5A 3CC7S 1S0OA 1JLBB 5A8KB 4X2BA 2VKZG 2YY3A 2ILYA 2UP1A 3R1LA 2V8DA 5KFNA 5HL7Q 2MTLA 5DZ6A 4RNOA 2V94A 4PZVA 4P7VA 4WP8A 5K8PA 2EPIA 1RAFB 1RT7A 1WG5A 4PWWA 3H42A 1VR6A 2DY1A 5JUMA 2G1HA 1HR0J 2XSFA 2CJXB 1LKZA 4OI3A 2O66A 3PX4A 3OHBA 2R7UA 2DGSA 4A8SA 3S7RA 4JI0J 1XJWB 1ZZFA 2HSEB 1VYAA 2UZAA 2FJXA 3BDEA 3TJAA 1IQZA 3HXMA 2ZOMA 1S97A 3P4UB 4CLSA 2PMZD 5THWA 4C4WA 4IO1A 4DR1J 3JSMA 3DLGA 2KG0A 4YP3A 4G6VB 1K0VA 2HGLA 2CQGA 4NLRA 3C6TA 4B3SF 1N5YA 1VRQC 4U8VA 3WX8A 5FJ4A 3EVWA 3ZNUA 2BM0A 3DLKA 4KT0C 1IN0A 4ICLB 3BGOP 2RQCA 4AQYF 4Q5VA 1N5SA 1JLFA 4ZVTB 3E01B 2NCKL 2HZAA 1S9EA 4WP3A 4ZVOB 4XDCA 4USTA 3MOZA 1KNZA 4UZBA 2AJ1A 2YKPA 1S9FA 1YGYA 2WBMA 1EB0A 3Q8QB 4JI1F 1RT6A 2E29A 2V4QA 2I9SA 4I7FA 2OPPA 1VRUB 4K7QA 1VQOS 1IKXA 2WB4A 3M32B 3MPYA 4QR0A 5DO2A 2R7RA 1TL1B 4LRDA 4KIAA 2HZVA 2XMTA 2CDRB 4ID5A 2CYYA 5L1JA 3H8YA 4IKAA 2IAJA 4O3SA 3MUMP 2JWNA 3R6LB 3OL7A 4C0OC 1DARA 1EAYC 4PEOA 1VRTB 1L3TA 2ZC3A 2V63A 1Q5VA 3UN2A 2VFSA 3AOCA 5DLFA 2ZH6A 4OYMA 2HS0A 4CTAA 3BGFA 1B4SA 2Q1LA 2D1CA 1FJ7A 3O44A 4J9KA 2RD5C 4M5HA 2XI2A 3KLEB 1YK9A 1RHKB 4RUHA 3T1HJ 1FDDA 1RCXB 4NRTA 2O1PA 4J9OA 2AJQA 3DLHA 2FY1A 2EC2A 4F3MA 3MAHA 3IBFB 3Q8RB 3M2UA 1BWVA 1FF2A 1HQUA 4R25A 1U26A 5E5NA 4OI0A 4RUBA 4DPXA 2KVQE 2OPQA 1AYEA 2DCLA 4B3OB 1HBNA 1H2VZ 3BQ0A 1UZHA 1SV5A 5DETA 3SQOP 4ZLLA 1X60A 1UFKA 1M1KT 3GIRA 2ZWOA 3M8ZA 3PJXA 3C6TB 1TK5A 3CD5A 4J9NA 2PEHA 2DNPA 1NK9A 2ALYB 1NK7A 3IN5A 2VOOA 3EYZA 1CQNA 2FVCA 3CD7A 5CD4A 5IT4A 5HVHA 1JX4A 3DHXA 5I3QA 4U6PA 5J2MB 4USUA 1RTDA 4LF1A 2UXBJ 2DEIA 4NASA 1M5OC 5EWFA 2DGWA 2YKNA 1CC7A 1OY9A 4UF4A 3RBXA 2ZZMA 2RRBA 2XY6A 1Y5IB 3V81A 4M95A 3E3XA 2J8AA 1L3VA 4IDKB 2DR6A 1N5VA 1S1TB 3DYAB 1UPPA 3EPGA 2PA3A 2AP6A 2BOPA 1RBAA 3GQCA 5F8GA 3L3CA 5AXLA 4M5IA 1WEXA 4FF1A 4ID5B 4B9LA 1SKWA 5DDQC 3FFIB 3KMQA 4F4ZA 2X1GA 3PIOQ 3TEGA 2HFOA 1AUDA 3MZIA 3SMZA 1SC3B 2Y3YA 2IY5B 4JI2F 2FJDB 3FCVA 2NREA 1B64A 3R9LA 4USHA 3V5RA 2ROEA 5GAGI 3NMAA 2YKOA 2I5JB 4Z7CA 5HANA 2UVVA 1ZPWX 2PFDA 1SUQB 5J1NA 2HK2A 1IM4A 1OQ3A 3HULA 3QIDA 2MZ1A 5GAEU 1RUSA 1IBMF 5L1LA 2EG1A 1T05A 3DM2B 1HLWA 3WX4A 3HHEA 4YB6A 3LAMA 3M6WA 3HHNB 4DUZJ 2EEYA 4K2JA 4TYBA 1U2CA 2W1BA 2JLFA 2WONA 2Z58B 2DHAA 1ULRA 2VFUA 4ELTA 5KFPA 1U2RA 3DI6A 3PRVA 2VUGA 3KK1B 4JV5J 2XLKA 1QVGR 2VKRA 4DV0J 5JMNA 4USIA 4C48A 4KAIA 4USMA 5I42A 4O3RA 2OGUA 2QJ3A 1MWYA 2FVRA 5KOXA 2LQ8A 4YR3A 1MU2B 3EUNA 3A1YG 4KTQA 1WSRA 3CEDA 5JVGQ 4CQ1A 2WCXA 3ZO7A 1JLEB 4I2QB 1U1LA 1HYSA 2QA2A 2CQ4A 4NLYA 2YKNB 3CJKB 4ECSA 1CLFA 3PM9A 2AU0A 3Q2TC 4JYAJ 2MMYA 2JJ4D 2X1BA 5BYSA 1KC8T 4PR6A 3Q83A 1Q8KA 3W2WA 5KOWA 4F02A 2VHGA 3M6VA 4CI0B 2FZGB 5EGYA 1V3SA 1ZOTA 3A8JA 3CWJA 3DRPB 1PBUA 3M8SA 1HHTP 3HVTA 2UUAF 1S6OA 4EO8A 1UEKA 5D77A 2PI4A 2JOQA 2MLXA 1P1LA 2MQQA 1UWBB 1URNA 1DBDA 1YZ6A 2CJYB 3DLJA 4NLUA 2HHHF 3M1VB 2VG6B 5F9NA 4PXDA 3FBFA 4PWDA 1RP5A 1QAJA 3SCLE 2KI2A 4HACA 3GYXB 1RLDA 4ZP6A 1Z4UA 3CPWR 2HRYA 3V6KA 2LVWA 3NGUA 5FD1A 3DOMB 3UCUP 1WI6A 1RLCL 4QWCA 2J0WA 5KT7A 1TL7B 4BS2A 4E98A 2EFOA 1MROB 1K9MT 2D7SA 4QWBA 1H38A 4DUYJ 4DPOA 3GR0A 3G6YA 2XYPB 5DG9A 1Y4ZB 2KL8A 3FSYA 5KFWA 2MKSA 3H4BA 4OYBA 2QMXA 1LXNA 1RZMA 1VMBA 2WOMB 1JNRB 2ZNZA 3BGUA 1SH3A 1S99A 2CPHA 2QYCA 4LF5J 4FXDA 1FKOB 3DLEA 2BQ3A 3G8QA 3ILLA 1R0AB 5E0OA 3PG9A 5KT3A 4L6V3 4TNOA 4XO0A 3HJVA 5L1IA 5J1PA 2M8DB 4ATNA 5A8RB 2WTFA 2E9TA 4N7TA 1WOOA 5KFAA 2F8MA 2CQHA 3FRYA 2GW8A 5IXUA 1DRZA 5A0YB 2E5GA 1FK9B 1HPZB 3D6MB 2HVIA 3ENAA 1UW4A 4TXSA 1KLNA 3TP2A 3BBCA 2BZ2A 2DXFA 4AXIA 3ILOA 5DQIA 2XBPA 1RAGB 2M0GB 2AT1B 4DFKA 3BBBA 1WC1A 4X62J 2DIUA 2ZM6J 4LIWA 4LSLB 4NYOA 4CNZA 2G13A 4OI4A 3RBDA 3VAJA 2LCWA 3BPDA 1RAEB 3GCWP 4NLOA 3NAHA 2MDAA 3LPYA 2QN6B 2VIHA 4QIEA 2UUBF 1X5OA 1NHKL 2GVDA 4A47A 3HVTB 3PKYA 3VGVA 2HPUA 4Y3CA 1X4HA 3R5JB 2HEKA 1RT1A 2QLXA 3KLHB 1ZM2A 1ZBTA 2UUWA 1NB2A 3VQSA 3GV5B 1KD1T 4DXLA 4PG7A 4PWDB 3NL0A 4OX6A 4DFPA 2XLJA 1H2UX 1SVDA 5D3GA 2IDEA 3RGIA 3OT9A 3WC0A 2XYHB 3E51A 4DPUA 1PYSB 3QT8A 1WF2A 3OTCA 4P73A 2ZE2B 4TLRA 3P5TL 2BACA 3QAEA 2MQMA 4JI6F 1KVKA 4LR9A 4P2MA 4LFAF 4FDFA 2J8SA 3CCTA 5F8IA 2DTJA 1GXUA 3KUGA 1NKBA 2CQ0A 4ED8A 2XWXA 4YUDA 1FFGB 3ETOA 3H5UA 4DQIA 1RT3A 3LW5C 4X65F 3T5JA 4ZVUB 5DGBA 1DAXA 5EX0A 5L38A 4LVOP 4ZP7A 1W7WA 2U1AA 1SIWB 3AAWB 3QRPA 5IWAJ 3MGJA 2R8HA 3O8WA 3IS9A 4JV1A 4DF8A 1B99A 2DR5A 3R7NB 2E7XA 3MMAA 2YXLA 3MEDA 2J0SD 3CCJS 1MWQA 2BQUA 3HD2A 3EICA 2VBYA 3ZZOA 4PQUA 1RHRB 3RR7A 3B82A 5LMUJ 5CABA 2EFVA 2Z2ZA 2Z0GA 3BSOA 1YWXA 1HNIB 3PJWA 4OHXA 5E3CA 3M2RA 1PSDA 1UMJA 3OSNA 1F5AA 2KFZA 3TAPA 4QWDA 2C3MA 2G9OA 2AEFA 1REVB 3CGIA 3CNQP 2HHVA 5JJBA 5EN1A 1WC3A 1UEVA 4OHWA 1FXDA 1N6QA 4KGZB 5BXIA 4ZPBA 4B02A 3MPVA 4B9TA 2BR0A 2DRDA 1BQNA 2PT0A 2GC8A 4NCBA 1LW0A 2CG8A 1LK7A 4WFYA 4Y6IA 4DFMA 3D0GE 2VA2A 5H9EK 2QL9B 3TZXA 1X5SA 4WCEQ 1RKJA 3FEXB 1CJKA 1PC5A 1N4LA 4RNNA 3N6LA 4O4RA 1S1WB 3AQPA 2VC1A 4WZMA 4ZVSB 3NMRA 3OLAA 2BJ8A 3QLHB 3D28A 2XC9A 2LDYA 1T95A 1PYOB 3AY0A 5HATA 5B08A 2N3OA 4A8WA 3KLGA 1S5ZA 4H4KC 3SEOA 1ZA2B 2IM0A 5T7LB 3FBBA 3SCJE 4B08A 2NPIA 2RB7A 4OHVA 1BQXA 3BS9A 3K59A 1IUJA 3H0PA 1D3WA 3GFZA 5GAHU 1K44A 3O5TB 4U95A 1HNZJ 1ZA1B 3R7BB 4LR7A 3DRSA 2FLPA 5F3ZA 5KFRA 3P96A 2CNOB 1AROP 2XS7A 3KHGA 5D15A 1OYDA 5L9XA 5HK4A 3FQLA 2G0IA 3HFZB 3IWNC 2R3VA 2YQ0A 1LWFA 1FX4A 4WE1A 3NBPB 3VVTA 4PQUB 1PO6A 5L8RC 4QW9A 1HR0F 4YOEA 1LWCB 3KK2A 5GADU 5LSRA 4U9RA 5AE3A 2ZVSA 4BBYA 2HHSA 2ABYA 1X0FA 3K5PA 2UXCJ 3HDSA 2DITA 2K7JA 1ZPVA 1U02A 2CQ2A 4TU7A 1YTYA 1YJ9S 4Z7YA 2D3OR 4DR6J 5LJ3Y 2ZH2A 2AYGA 2GGPA 5ETPA 2RHSB 4OYZA 3S1TA 4A48A 1JK9B 4A8XA 4QIGA 1VQ8S 3B4MA 3UNGC 4OJ1A 3C8YA 1FD2A 1V3RA 4X4RA 1ZM4A 3HHLA 3QT6A 4C8LA 2RU9A 2DH9A 3JTOA 2V8GA 3C14A 2DK2A 4OIXA 4IR9A 4K4XA 4LMZA 2ATLA 3P6YC 5IOLA 4HH0A 1FDAA 1SC1B 3LP1B 4RU2A 1XIQA 1HWJA 1NSPA 1NJIT 2FZKB 3I4HX 3LWMA 1EP4B 2YNIA 2XG8A 4N77A 1NDCA 3MECA 1KSPA 1FRMA 5GMEA 3NGTA 1U1KA 2Z2MA 4LF6J 3QGIA 1BY9A 4ERDA 1K1QA 2BJ9A 4FNIA 3CMAS 4W92B 2XY7A 4LSNA 4U7UD 2L9WA 1H3DA 4CLUA 1G3OA 5KFVA 3IO1A 4C2MA 1NLKL 2H4YB 4L3NA 1EX8A 4AL5A 3OQ2A 5B0FA 2LQBA 1HMVA 4N47A 2R8KA 1VHIA 1PJ6A 3VVUA 5ETRA 3HVRA 1KVIA 4TKTA 2RE1A 2NSCA 2MJUA 1U47A 1LW2A 1YIJS 2Q43A 1GTEA 2ACMA 4GVLA 3FC9A 5KFBA 3PYFA 2MB0B 3DOKA 3OR1A 4Q2LA 4DMZA 1Y10A 3T3FA 3UO0A 2EBGA 2JEGA 1QE1B 1DFDA 1HNVA 3HSJA 4MTPA 2JEJA 4V19J 4HT5A 3UD4P 1FJEB 1G4CA 2HBRB 1BQMB 2QFJA 1S0NA 3MM8A 3EZOA 2C2KB 2QSWA 4USKA 4F2RA 2MZRA 2QLBB 4PXEA 3OXGA 4BHQA 5DZ7A 2B5JA 5ADZA 4P7TA 3SSQA 2HLUA 3GIJA 2WBRA 2F9JA 5KT5A 1O8BA 1BWEA 2PIIA 2XCAA 3PR5B 3N6MA 1HWLA 1FJGJ 5K5MA 4JI3J 1S79A 5KFLA 2RF2A 2EFGA 4QYZJ 5KG3A 5GAEI 3F56A 2YKAA 2K8GA 2YNHA 3CVKA 4DLGA 3N79A 1TAQA 4PXBA 1RHUB 5F8MA 1R8PA 4F26A 1RTZA 1UEUA 2AGPA 1N5QA 1QD1A 4PYDA 3KLVA 2HNYB 3AFGA 1VHFA 2U2FA 5SZTA 3HHLB 1HWKA 1TL4A 3DRRB 3C14B 2E5IA 2YX4A 2UXBF 3KMSA 3MUTP 1TKZA 3ELHA 1RTIA 4FYDA 3OVAA 2J7UA 2YNIB 2VBXA 3UD3P 4OHYA 5E3PA 1SCJB 2HHPA 3TUPA 4RBTA 1NJYA 4Q2MA 3GIMA 1TV6B 3ZTOA 2H3EB 2BE9B 2VQFJ 4MYUA 2C2ZB 4UOHA 4MK9A 3PX6A 3IA0A 1T0TV 1IKWB 3US5A 3UR3C 1YJWS 3H4DA 2QLFB 3M6UA 1U6BA 4QW8A 1RSCA 4DN9A 2HRTA 2DPJA 1KR4A 3SV3A 4DSEA 1WC4A 5IZHA 5J2PA 1N0UA 2VB6A 1KTQA 1JJCB 4C8OA 1CS4A 3RRHA 2RKIA 3KTQA 4HH1A 5D0RA 2B8PA 5LT5A 5KFMA 3C3LA 3TJ9A 2BE2B 4KFBA 4DR4J 3HHDA 4NYPA 4W98A 3MMCB 1WF1A 1YQHA 2XNRA 3D67A 2MHNA 2UXDJ 1RABB 1HA1A 3R1HA 1NO8A 2YWEA 3G86A 2ZJPQ 3ITHB 3OXLA 3GG0A 1SKSA 1VK3A 4XIUA 2PDAA 4DR2F 3LO3A 2NYIA 1FKPB 2WAQD 1QDUB 4DCJB 1AFIA 4HDGA 1CJTB 4DSIA 4RW7B 2RF2B 4CH7A 1FEEA 4DUZF 1KOOA 4F4XA 8RUCA 3POTB 2RHQB 1T11A 3DLLQ 2VPXB 4ZITA 2Q6BA 4HR2A 2VBWA 2C2EA 1U49A 3KHHA 2MGZB 1ICEB 2D69A 3G9CA 4DL5A 4DV0F 3NG8A 3B54A 3T41A 1SJFA 2QMWA 3KG0A 4H4MA 1WC6A 1MNEA 1LWXA 2F5GA 5K9FA 1BHNA 4Y34A 2MLZA 3HD1A 2BUNA 2J0XA 2RNEA 3ET6A 2ZHOA 2HNZB 3D6FB 2VV5A 4RUAA 2ZH3A 2WB1D 1WEYA 4O4GA 1T9XA 1LV5A 1YJUA 4JYAF 2HQCA 4MJKA 3IC1A 1WD6A 3LP0B 2HBYB 3AH6A 3PXGa 4RZRA 1UFLA 1C4AA 3JSYA 2ZBQA 1YJ7A 1KFSA 1EETA 3TNVA 1F1BB 3THVA 3CD6S 4YFUA 4KBIA 1BUXA 2HWHA 2ZBPA 4IOCQ 3FCHA 4NLSA 2P6TA 2CPZA 1Q4RA 3EX7B 1FE4A 1FX2A 3CJ8A 2MQPA 3BR8A 4AQYJ 4WTOB 3OXFA 3E2EA 2BDPA 2YNGB 1WHWA 1RAHB 5GMKa 4DQQA 3MTKA 4EBEA 1UVIA 2ZUAA 4KH0B 3CW2C 2KYXA 3R6GB 1W25A 3M05A 4ZVRB 1IBCB 1FO1A 2N4DA 4FYVB 4ZK7M 2OTLS 2OPRA 4JI1J 5C24A 4FVMA 4S0MA 2OPSA 1KQSR 3MD3A 4ZN3A 1P6TA 4M5DB 2XYGB 1V5IB 3PFEA 4DUYF 3LALA 2CDQA 4ZIVA 1HKAA 3RR8A 4CDIA 3UPFA 5HJYA 2I1RA 4DR5J 4N76A 3A3PB 4GC6A 5HN0A 3D5MA 2W7OA 3MM5B 2DNGA 4K5SA 1I1GA 3OPKA 2KXFA 4I2PB 3KK3B 3MTJA 4C8YA 3MCSA 2XCPA 3EZUA 1YBAA 5CYJA 3HSZA 3D68A 4NLDA 3QZ7A 3D2WA 1AXQA 3H5YA 5F0WA 2BJ3A 3VTIA 3IR7B 2OEMA
chains in the Genus database with same CATH topology
2W2QP 3GCWP 3WIUA 3GCXP 4NE9C 1R6VA 3BPSP 3P5BP 2Z2YB 2Z57B 3A3PB 3A3NB 3A3OB 2W2NP 2E1PA 2Z56B 1SCJB 2Z30B 3T41A 2ZWPA 4JP8A 2PMWA 3CO0P 3WIVA 2QTWA 2XTJP 4NMXA 1ITPA 3H42A 3QFHA 3CNQP 2Z2ZA 4OV6A 3BGOP 1SPBP 2W2PP 2W2MP 4K8RA 3SQOP 4YN3B 2Z58B 3VV2B 1V5IB 3WHIA 3VHQA 3AFGA 2W2OP 2ZWOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W2Q P;  3GCW P;  3WIU A;  3GCX P;  4NE9 C;  1R6V A;  3BPS P;  3P5B P;  2Z2Y B;  2Z57 B;  3A3P B;  3A3N B;  3A3O B;  2W2N P;  2E1P A;  2Z56 B;  1SCJ B;  2Z30 B;  3T41 A;  2ZWP A;  4JP8 A;  2PMW A;  3CO0 P;  3WIV A;  2QTW A;  2XTJ P;  4NMX A;  1ITP A;  3H42 A;  3QFH A;  3CNQ P;  2Z2Z A;  4OV6 A;  3BGO P;  1SPB P;  2W2P P;  2W2M P;  4K8R A;  3SQO P;  4YN3 B;  2Z58 B;  3VV2 B;  1V5I B;  3WHI A;  3VHQ A;  3AFG A;  2W2O P;  2ZWO A; 
#chains in the Genus database with same CATH topology
 1YJT A;  4EMD A;  3PV8 A;  1RXO B;  2CPF A;  2A1B A;  2MKH A;  2DO4 A;  5LSL A;  3NEK A;  4UQT A;  1LFP A;  2R8J A;  1DTT A;  3GTY X;  4X62 F;  2ZM6 F;  3M6X A;  4K2X A;  2YTC A;  1X7V A;  3CCM S;  1QY7 A;  2KHC A;  1VBY A;  1Y3K A;  2HKE A;  1BC6 A;  3M8Y A;  2ZH9 A;  1UAW A;  1WOS A;  5GVQ A;  4DL0 C;  2PA8 D;  1CJV A;  3AJ2 A;  2XMA A;  1HBM A;  4LF9 F;  1BLU A;  4RW9 B;  5CD4 H;  5CYM B;  2OAU A;  1U8S A;  1HHS A;  3N0V A;  1R7I A;  3A13 A;  4DV1 J;  1CUL B;  2B7C B;  3D6T B;  3R5G A;  1U7L A;  2QYG A;  4O44 A;  4PUO A;  4OYP A;  1DLO A;  2F4V F;  2E5J A;  5CCM A;  2IRY A;  1IR2 A;  1XC9 A;  1Z2Z A;  4ZA1 A;  5HQ8 A;  2GHV C;  2G0J A;  5C2G A;  2J9C A;  2J7W A;  3T6B A;  4IFV B;  3Q23 A;  1RWV B;  1YBT A;  2ZZN A;  3GFY A;  4D3H A;  4LBI A;  2OPS B;  3CJ0 A;  4I67 A;  1BXN A;  1AZS B;  4NLG A;  4WBF A;  2CFX A;  3DC2 A;  2K2P A;  5KFF A;  4WIQ A;  1U25 A;  2NQP A;  3A12 A;  3GWC A;  3K17 A;  3BN7 A;  4DJB A;  2QIF A;  2X7I A;  2VAS A;  3MR3 A;  1ROF A;  1WJ9 A;  2JHE A;  5LOQ A;  3MM6 A;  1P9Q C;  4R0J A;  4F50 A;  3QGH A;  5HP1 A;  4CYU B;  5HRO B;  3TQ1 A;  1RTH A;  1C1C B;  1QM9 A;  1PYT A;  4Q0B B;  3CJS A;  4X4O A;  1ZS6 A;  3HK2 A;  4IH6 A;  2NXE A;  3DFE A;  1I5O B;  2V4R A;  3KOA A;  1DZ5 A;  3CME S;  4U8Y A;  1VOM A;  1H98 A;  2AYB A;  2BJ7 A;  1UVJ A;  2PN6 A;  2EK1 A;  4G1Q A;  1OO0 B;  5EWG A;  3HM9 A;  2BQR A;  2V2K A;  4KHM A;  3A8I A;  5LMU F;  1XQI A;  2IFX A;  3CCU S;  5IS2 A;  1VQ7 S;  1IBM J;  2F9D A;  3IAM 9;  1VI7 A;  1KWM A;  2B6A B;  2FC8 A;  1RIS A;  5GAD I;  4C8Z A;  1D8Z A;  2N4C A;  4OV1 A;  3M9M B;  3TX8 A;  1I94 F;  1RB0 A;  5L1K A;  4DPY A;  3V6D A;  3CDB A;  3TVY A;  2BAN A;  3IR6 B;  4ES2 A;  1VQK S;  3PEJ A;  1E6Y A;  4Y2C A;  3M2V B;  2NXC A;  4ZP9 A;  3UDC A;  4AUK A;  4I69 A;  1UJ5 A;  4IRK A;  4DSL A;  4RUC A;  5HBM B;  2CQB A;  2BJ1 A;  4GVB A;  2CNL B;  4Q8E A;  4UW2 A;  2J6U A;  1JXV A;  3BO2 A;  1DLO B;  1NK5 A;  1D8Y A;  2RDD A;  1MSW D;  5FDL B;  4HI1 A;  3PVX A;  4KHP J;  3MF5 A;  2VDI A;  4DWI A;  3CSK A;  2DB1 A;  2DNK A;  2W7A A;  4X4P A;  3W9I A;  4PAA A;  3SDE A;  3LGM A;  1MMN A;  3FEZ A;  1RWK B;  2H54 B;  1R89 A;  4WXO A;  4IG3 B;  5J1E B;  3GP9 A;  3PKM A;  2XSJ A;  3DHW C;  2Y1L B;  1E6V A;  1APS A;  1S6U A;  3PTW A;  1YKW A;  4UOG A;  1Y11 A;  1LEO A;  5ETL A;  3RU0 A;  1BGX T;  1HNZ F;  1FRX A;  4J9Q A;  2HHH J;  3NGR A;  3BSC A;  1YVF A;  2QTW A;  4H4O B;  2HS3 A;  3JYT A;  1VLO A;  1NDK A;  4M63 A;  3H2U B;  4Y2A A;  4IQX A;  1CPZ A;  3R2D J;  3TZZ A;  4NL5 A;  3W3S A;  5MAO A;  3RZA A;  4OX9 J;  2I6W A;  2CJ9 A;  3EVO A;  3Q89 A;  4CLZ A;  1TK0 A;  3QWP A;  4DL7 A;  4RW6 B;  4UZC A;  1OPZ A;  5KG4 A;  2HBZ B;  3G96 A;  3WC2 A;  5IM0 A;  1SQG A;  3PYD A;  1X4B A;  3OUY B;  1X5T A;  3EJM A;  4FYW B;  1C0U A;  1JLA A;  3I31 A;  2OIH A;  3I0R A;  2QX0 A;  4BDP A;  3AD8 C;  1H7W A;  4LRE A;  3PW4 A;  1R27 B;  3P5B P;  2H5I B;  2K3K A;  3D7S B;  4NZ7 A;  4LF8 F;  1D9A A;  1UKU A;  3MI7 X;  4KYZ A;  3QNW B;  2IA6 A;  2ZZT A;  1SQE A;  3MEE A;  4FN5 A;  4DR6 F;  1V5V A;  3BRE A;  3K0J A;  3FK4 A;  2E1R A;  2HFZ A;  3TAM A;  3W60 A;  5HLF B;  2AJ2 A;  4ZKA A;  3CT9 A;  4CLP A;  3BQ2 A;  3M30 B;  1IBK F;  5IV3 A;  3P49 B;  2IVM A;  1H72 C;  3SFG A;  2M88 A;  5DDP C;  4M5K A;  2OEJ A;  5E3A A;  4YN3 B;  4DR7 F;  1FDN A;  3LP2 B;  3N01 A;  3W5X A;  3GJT B;  2DGQ A;  2VC0 A;  1PJ5 A;  1WNE A;  2LU1 A;  1K73 T;  4KPY A;  1T3O A;  4IO9 Q;  4DG1 B;  1EJ7 L;  4CO2 A;  2HGN A;  3MPW A;  2ZKU A;  4AFF A;  4P72 A;  1S7H A;  1ZM3 A;  5KFH A;  3ZZR A;  4WFX A;  1RT4 A;  4LF6 F;  2EG2 A;  2KO1 A;  4FYY B;  2RS2 A;  1LXJ A;  1PGZ A;  2Q66 A;  1K8A T;  1WC5 A;  2KFN A;  3QMQ A;  1RTJ B;  3OR2 B;  1GMW A;  3ETM A;  1HL6 A;  2QL7 B;  5C42 A;  2FZC B;  1W26 A;  3D54 A;  2WSF C;  2L41 A;  4LRA A;  5CHC B;  3GON A;  5DJB A;  1FFW B;  2P9G A;  7FD1 A;  4P52 A;  2J7K A;  2V50 A;  4IUF A;  1VQM S;  4UUX A;  4QCL A;  4NA2 A;  3JXO A;  3R27 A;  1YRU A;  2FHO B;  2FHJ A;  5HQM A;  3A8E A;  3H25 A;  5C25 B;  1CVJ A;  4DS5 A;  1S77 D;  1F2H A;  4DEZ A;  4CLL A;  3UWT A;  5ETT A;  3WBZ A;  2AIR B;  3BKT A;  3MAA A;  4EZ9 A;  2CPE A;  4Q8F A;  4KO0 A;  3CDE A;  1O6X A;  1HNW J;  3BKU A;  3THP A;  1S6P A;  4DSF A;  2CQ3 A;  3OD2 A;  3AB4 B;  2V4J B;  2GHP A;  2DPI A;  1RU2 A;  4PQA A;  3MR6 A;  1GMV A;  2HHT A;  4OLP A;  1RAJ A;  1FJG F;  2CAD A;  4F4K A;  2FHM A;  4JI3 F;  3BGR A;  2XM3 A;  3ISN D;  4ECW A;  4PYA A;  4IH7 A;  4CH1 A;  2DIS A;  4F0H A;  2B56 A;  1YJN S;  2ZC4 A;  2Q79 A;  2DHX A;  3CIZ A;  1EZZ B;  1NHU A;  1HBO B;  1SH0 A;  4JI5 J;  1YI2 S;  2ZH8 A;  2PSZ A;  3QWU A;  1TKX A;  2A10 A;  4ED0 A;  4FNH A;  1T3N A;  5KG0 A;  3NWG A;  3BQ1 A;  3EXY A;  2PFF B;  3LWL A;  1FRL A;  1PAE X;  2DNN A;  3Q24 A;  1S57 A;  3SXL A;  1HQE A;  1IKY A;  4R8U A;  4DN0 A;  2A2D A;  2IRU A;  3KJV A;  4ED5 A;  4USW A;  3R2C J;  2F40 A;  3OVB A;  1S1U A;  4IH5 A;  2HAI A;  1RT4 B;  2GJF A;  2EFN A;  6FD1 A;  1WDT A;  4TU9 A;  4HYK A;  1UW9 A;  3H20 A;  2D3Z A;  2DEJ A;  3C46 A;  4BC9 A;  4DV5 F;  2VQF F;  3ZTP A;  1Y3J A;  4B9S A;  1SC6 A;  3IG1 A;  2UU9 J;  3BB5 A;  4J91 A;  4FS2 A;  1C1B A;  3N9U C;  4LF4 F;  4ZDN A;  2Z2Y B;  2XZW A;  3CC2 S;  5CCL A;  1KTV A;  2JC1 A;  4ZVF A;  2C3Y A;  2GQ2 A;  1VBK A;  4NCG B;  3QIP A;  1NUE A;  4ALZ A;  4EGL A;  1FRH A;  2ALZ A;  4RWW A;  4HLB A;  2L3M A;  4LFC J;  4X4S A;  2G2O A;  5KFD A;  4WK3 A;  3KLF B;  3HFV A;  1IBL F;  4RR5 A;  4K4Z A;  2IIH A;  3KYL A;  1X5P A;  2DVI A;  3MAA B;  4GRS A;  1SJR A;  4KO0 B;  2A3J A;  5HAO A;  3TZW A;  3EWG A;  1IVZ A;  4QR1 A;  3L9Z A;  1NKE A;  2HMI B;  2DNQ A;  2YKQ A;  4C3L A;  3FMW A;  1GTH A;  1JLQ A;  4KKO A;  4BLG A;  3NY0 A;  1SXL A;  1F3F A;  3ZNJ 1;  4YR2 A;  2FJA B;  1T03 A;  3I0S B;  1KDN A;  2LU2 A;  2Y1R I;  1GXL A;  2WVF A;  2CPJ A;  1NME B;  2GFF A;  5IC4 B;  1Y0H A;  1Q79 A;  1FVQ A;  2C3U A;  2HWT A;  3I55 S;  1DHM A;  5LSO A;  3TOQ A;  4J9R A;  2CJK A;  2MQO A;  4Z37 A;  3GIL A;  4DL3 A;  1F0X A;  1XEZ A;  2A0F B;  1QTM A;  3SSS A;  2B43 A;  4CT9 A;  5CYQ B;  3CJR A;  5IV4 A;  2QA4 G;  1U4B A;  1KLM A;  3ILJ A;  3DMJ A;  2LEC A;  3OTD A;  1V6H A;  2Y0B B;  1VC5 A;  1F60 B;  3LOU A;  2F7V A;  2PD1 A;  2VL1 A;  3FBC A;  2B0G A;  1TTH B;  2DHG A;  1H2T Z;  1HQE B;  1YG0 A;  2BKO A;  5HVG A;  3O1L A;  3KJN B;  1NU4 A;  4X4U A;  5ITH A;  4QPX A;  2V8H A;  4ZCI A;  2YVS A;  1ACM B;  3KJV B;  1F5C A;  2IM1 A;  3EDQ B;  3TUJ C;  1DTQ B;  1S0V A;  3UQS A;  2H48 B;  2IC3 B;  3QFH A;  4L75 A;  5J2Q B;  3CCQ S;  2V5H G;  5HJX A;  3IG1 B;  1IKV A;  4A4J A;  1D0E A;  1EKS A;  3M8Q B;  3AD7 C;  3B6B A;  4EO6 A;  2HVE A;  2OUG A;  4ID8 A;  2R7V A;  4ECX A;  3HT0 A;  4V19 X;  2RQK A;  4ELV A;  3NWR A;  2QO3 A;  3OJU A;  4MFB B;  1A0O B;  2LQJ A;  4RJV A;  2G0C A;  4AL7 A;  3DGV A;  1VJQ A;  2Z2L A;  3CJT A;  1EQM A;  1TKD A;  5C2C A;  5K8M A;  3CCW A;  1YZ7 A;  2HUR A;  1YX2 A;  4ZN1 A;  2NYH A;  1QAX A;  3H7H B;  2OJ3 A;  3OL6 A;  3GV7 B;  5KT6 A;  3M8P A;  1M1G A;  2XMU A;  3C15 A;  1JLQ B;  4X66 J;  4KKO B;  3ADA C;  2FY8 A;  2CQ1 A;  4ZIW A;  3T9N A;  2Z57 B;  4QQB A;  2W9A A;  1J5O B;  2YWH A;  4XPC A;  3SQG A;  4U67 Q;  2LEB A;  1JLC A;  2KDO A;  4O3O A;  2LP4 A;  4DZD A;  3D1H A;  2FLN A;  2E44 A;  4B9M A;  2CNN B;  1GQE A;  4DR5 F;  2QSF A;  2IMW P;  1RT5 B;  1JNZ B;  1UL3 A;  2YWG A;  4M5L A;  2XEX A;  4DV6 J;  3RAQ A;  5F8L A;  4F2S A;  1TFY A;  4NLX A;  3KFW X;  4PXC A;  3ISN C;  2QFI A;  3TWZ A;  3DMJ B;  2GVZ A;  2JEF A;  4ZVE A;  4R0E A;  2CZ4 A;  3THT A;  3GJS B;  3OHA A;  2FGO A;  3QSI A;  2GMJ A;  2RJZ A;  1RT7 B;  3F73 A;  1SBR A;  1AUS L;  3BH6 B;  1Q95 G;  2ATC B;  2L48 A;  2ADC A;  2O01 C;  2W9B A;  3I96 A;  3ICL A;  1RCO B;  4K4T A;  4AT1 B;  2EC0 A;  2ILZ A;  4DV3 J;  3R5A A;  1YJV A;  3MMB A;  2JFK A;  5LXR A;  3SCK E;  3W62 A;  2BV3 A;  5E3R A;  2F4F A;  3GYN A;  2CUY A;  2W4D A;  3W66 A;  3DLG B;  4RL1 A;  4NLT A;  3JSM B;  4U7C A;  1G1X A;  3ZZY A;  1S4E A;  1ZM9 A;  2ZD1 A;  3NS7 B;  1UPM B;  4XPE A;  1N5Y B;  3QYY A;  5GMD A;  3CUN A;  4NI2 A;  5AJ3 F;  1Q0N A;  2MQL A;  4I0W A;  4DV1 F;  5G0R A;  2HW3 A;  1NND A;  1U1N A;  3CCV S;  3DLK B;  1R8C A;  2DNR A;  4FF3 A;  2QGF B;  2A6M A;  2RUS A;  4G3I A;  1Q78 A;  2QEX S;  1XN9 A;  3BSA A;  4ZHR A;  2IVF B;  3ZTS A;  1JLF B;  1SL2 A;  4ECT A;  1U2F A;  3KDN A;  3GSI A;  2JVO A;  3IWX A;  1S9E B;  4F0K A;  1HW8 A;  1R31 A;  3LPE A;  2ZJR Q;  1FRJ A;  4IRC A;  2B9W A;  1TZ0 A;  1HWU A;  2FIU A;  4K0K J;  1KS2 A;  1T9U A;  1AW0 A;  4OMF G;  2GMH A;  2RS8 A;  4OX7 A;  2DGU A;  1YSJ A;  4IG0 A;  1NDL A;  2CWX A;  2M8H A;  3EGV A;  1RT6 B;  3BKF A;  1TVR A;  4I7F B;  2OPP B;  2AWZ A;  2HLT A;  1IKX B;  5A8W A;  3R5B A;  2LXI A;  1QAY A;  3W1Y C;  5L9N A;  8AT1 B;  3KUH A;  1X4C A;  2BAB A;  2IAJ B;  1GAO A;  2IHR 1;  3D66 A;  2HZC A;  2FJV A;  5I3U A;  2RH3 A;  2R2R A;  3UN3 A;  4DPW A;  5CH7 B;  5J2N A;  3NP5 A;  3GYG A;  1FCA A;  3TAQ A;  2HAF A;  2GVZ B;  4K4S A;  4YY3 J;  3CJ4 A;  4CTA B;  4RW8 A;  4KR0 B;  4YB1 P;  1LQ9 A;  4O3Q A;  1RT2 A;  3MUR P;  1LWE A;  2V2Z A;  3M7V A;  1VIS A;  1SC4 B;  1O0P A;  2BW7 A;  2JVR A;  4ELU A;  1NK6 A;  4NXM F;  5ETV A;  3RAM A;  5D6G A;  4L72 B;  4ECY A;  4DR2 J;  2E5L F;  2YNF A;  2MSS A;  2CRL A;  3KHL A;  2B51 A;  5IT9 Y;  5KG7 A;  3GJR B;  1VCT A;  1S6Q A;  1M5S A;  4K8R A;  2AMC B;  4TVA B;  2CWK A;  1KFD A;  4ER8 A;  2KXH A;  1FDB A;  3MFI A;  3LAN A;  4KGV B;  5EDW A;  3M2U B;  3JTN A;  1HQU B;  1QSY A;  4R5P A;  3VWS A;  2J0Q D;  3QRR A;  2OPQ B;  4P2S A;  3MFH A;  1HBN B;  4YB7 A;  5FII A;  1VGY A;  2N3L A;  4LRC A;  3QGP A;  1SV5 B;  2ASL A;  2V6A A;  1RAA B;  2W2O P;  3KG1 A;  1VJW A;  3CCS S;  1VQ5 S;  2CAJ A;  5T14 A;  5G0R B;  2M5Y A;  3GR1 A;  4P6Q A;  1X8D A;  2H51 B;  2GIQ A;  1U8W A;  4CO3 A;  1RTD B;  3S8S A;  4NE9 C;  1HBU A;  3RJM B;  5BYQ A;  3MPU B;  4FBT A;  3QJL A;  2WK4 A;  3KG4 A;  5L46 A;  2RDJ A;  1AT1 B;  4KHP F;  2XUL A;  5ETM A;  3ENQ A;  3M9N B;  3UFC X;  4ED6 A;  1XR7 A;  1SH2 A;  3B8H A;  1X31 C;  1F3V A;  2W8K A;  3V81 B;  4NEZ A;  1RA7 A;  2HQD A;  2GHW A;  2AV5 A;  4AND A;  2LQ5 A;  3V6H A;  2M4M A;  1ZH5 A;  3JS9 A;  9ATC B;  3OL8 A;  5A8W B;  4PG5 A;  1TUG B;  5B0A A;  2HHW A;  3N28 A;  5DG7 A;  3TRG A;  3KUE A;  2AJ0 A;  1S7I A;  4F4Y A;  1VQ9 S;  1MWZ A;  4DI6 A;  1S1V A;  3SYZ A;  3EE3 A;  4RW4 A;  4QWA A;  3SZ2 A;  1WSV A;  1SL1 A;  1J5E F;  3EPI A;  2RAQ A;  2ERR A;  1Q8L A;  2X3D A;  2BEF A;  4ZP8 A;  4A8F A;  1N52 B;  1N8R T;  1NAQ A;  4CO1 A;  4OX9 F;  2FYX A;  2FQQ B;  3S01 A;  2QRR A;  2P8I A;  4KRW A;  1S9G A;  5AXN A;  1LFW A;  4DCP B;  4PG6 A;  2DHS A;  2VZ9 A;  2HFU A;  3IWL A;  1TL3 A;  3T9Z A;  2YKM A;  3QBC A;  3W8P A;  3UI3 A;  3C6U A;  2QZ8 A;  3BPS P;  3JSR A;  2K1R A;  2RT3 A;  2R7X A;  1GK8 A;  3NKY A;  4C11 A;  9RUB A;  4Y28 C;  1SQF A;  1X4A A;  2IYI A;  4KY3 A;  2P9C A;  4E2F B;  4DCO B;  2HQG A;  2GJ2 A;  1MLA A;  1T05 B;  3T5L A;  2CQP A;  2MST A;  4GO7 X;  4MMO A;  2VQE F;  2OEL A;  2HVH A;  2HFN A;  3BO4 A;  3W64 A;  4NMX A;  2EBE A;  2CXE A;  2ZBR A;  1S1X A;  4L73 A;  2WON B;  3FKB A;  4OFZ A;  4H54 A;  4DSK A;  1JLG A;  2ASD A;  3DI6 B;  1JKH A;  3EGN A;  2MY8 A;  3W61 A;  3TUI C;  1KP6 A;  4ZPD A;  2RRN A;  1KHV A;  4PWU A;  5I42 B;  4PCQ A;  4W4M A;  1NJX A;  5BYR A;  2W9C A;  5K14 A;  4B3T J;  5KT4 A;  5EHH A;  3T5H A;  3NS6 A;  2JLG A;  1F2G A;  4KQZ A;  1HYS B;  2GML A;  3RAX A;  2CKW A;  1JJ2 R;  5G4D A;  4AE5 A;  3MOJ B;  3A3N B;  2V8V A;  4FKX A;  1A7G E;  3W2W B;  3PRD A;  3N6N A;  3HMJ G;  1HWI A;  4NZ6 A;  2R2T A;  3KNA A;  3UVJ A;  4LF9 J;  2IBK A;  5B7W A;  2XO7 A;  3QT5 A;  1M0S A;  1VC6 A;  1N33 J;  3IRX A;  3C19 A;  2BOA A;  2MPU A;  5HMZ A;  3OTE A;  2BKP A;  3Q8S B;  2HVZ A;  4Q43 A;  3F0N A;  1EKR A;  2WSE C;  2UV8 G;  4WFA Q;  4DV7 F;  1MN9 A;  3I9V 9;  4FBU A;  2F4V J;  1DY3 A;  2HND A;  2D9O A;  4LVN P;  5RUB A;  2V2Q A;  3BV8 A;  3QQC D;  2JL9 A;  3AOD A;  4HAC B;  1VQN S;  5KFZ A;  2UVR A;  2EFP A;  4I1T A;  1HNW F;  4EYI B;  2M52 A;  1B0P A;  1M90 T;  4OI6 A;  1D09 B;  2CVI A;  3BF4 A;  2E7V A;  1HFE L;  2ASJ A;  4ZPC A;  1OJ4 A;  1TL3 B;  1JLB A;  2LKZ A;  5A8K A;  4OZL A;  1ZAV A;  1OY6 A;  3B78 A;  4RO0 A;  2XGQ A;  4OZ5 A;  5HSP A;  1UVM A;  1FEH A;  3RBE A;  4I56 A;  2NXN A;  3W65 A;  1HHQ A;  1Z1Z A;  4OQJ A;  1ZTW A;  1QSS A;  4Y65 A;  3LQV A;  4PG8 A;  3Q86 A;  4RLE A;  2F8E X;  1I51 B;  4NA1 A;  3W9J A;  4B9U A;  3TVK A;  3JB9 k;  4JI5 F;  2IYG A;  2HIY A;  3DLE B;  4WKR A;  2JNJ A;  2B4O A;  2FLL A;  1RBO B;  4URG A;  4JOU A;  4IOB A;  4M5G A;  5MLC V;  4C7Q A;  1CC8 A;  4UY8 5;  1RK8 A;  1UP1 A;  3J7Y U;  1PIL A;  1GX5 A;  3QFW A;  1LNQ A;  4YDD B;  1URR A;  2G2Z A;  3DU5 A;  4MK7 A;  1R0C B;  1WG1 A;  1QUV A;  3RW6 A;  1Z2L A;  3UN5 A;  1KKH A;  1RKI A;  4M94 A;  2UU9 F;  3TYT A;  3AJ1 A;  1I94 J;  4OJG A;  2BVZ A;  2D3U A;  4DS4 A;  4C97 A;  3I5B A;  2YWF A;  3MXH P;  4Q45 A;  4LF7 J;  4I64 A;  3DRY A;  4GKK J;  1SJ4 P;  4C6A A;  2IVY A;  2C2D A;  2DH7 A;  3LAK A;  4ED1 A;  1QSL A;  4I6Y A;  1Q8I A;  3O2I A;  3IRX B;  3W9H A;  4G1P A;  1NB7 A;  2GVD B;  2Y8Y A;  5HVF A;  2B4V A;  3ZZ0 A;  3TA2 A;  3IR5 B;  2QA4 S;  1RT1 B;  4LFC F;  3HI9 A;  3IGV A;  1VRU A;  4I4B A;  4CT8 A;  3GMG A;  3Q8Y A;  4QJV A;  3M32 A;  1RWN B;  3D0I E;  1TL1 A;  2UVU A;  2VON A;  3FZ2 A;  5D3G B;  5F8J A;  2E5H A;  3MEK A;  2B8Q A;  1UVK A;  2XMK A;  2DNH A;  4FXW A;  2UUC F;  1NZA A;  3WDO A;  1VRT A;  3RB4 A;  2XO6 A;  1FNO A;  2KB2 A;  2DR7 A;  2AF6 A;  2IBO A;  3BJY A;  3L7O A;  2YWK A;  1RAD B;  2VU5 A;  3VAI A;  2KVI A;  1JWW A;  4USJ C;  3V4M A;  3BDP A;  3IGN A;  3EDR B;  2VIC A;  2KYZ A;  2LXU A;  3PYE A;  3KHR A;  1RT3 B;  1PG5 B;  1WKL A;  4URQ U;  3GIK A;  3KLE A;  3SFU A;  4YHH J;  2C3O A;  2OML A;  1IR0 A;  3W63 A;  3IS9 B;  3I9Z A;  4LFB F;  4ED2 A;  1WF0 A;  2ZH4 A;  3PR4 A;  1H73 A;  3EXC X;  1WUU A;  1CG2 A;  4O0I A;  2R2U A;  3MMA B;  3MR5 A;  3MED B;  3U7J A;  3FEY B;  1B7F A;  4JI4 F;  2E1P A;  3PEH A;  4B3O A;  2OSR A;  3U1N A;  4N56 A;  2IMO A;  2HG4 A;  1SKR A;  2H9Z A;  4CIO A;  2Z4P A;  3HHL D;  1IJF B;  3TZY A;  2DGX A;  1X9M A;  2AX0 A;  3L7U A;  4HEA 9;  5BR8 J;  4RWX A;  5DLG A;  3M2R B;  2FVS A;  4LF8 J;  3EM1 A;  1T7P A;  5F3T A;  5B09 A;  4JBC A;  5J2M A;  4NWB A;  3ZZP A;  1WG4 A;  4ANE A;  4ECR A;  2Y1J A;  1B70 B;  2Z8Q A;  2G2Y A;  2H1Y A;  3PW7 A;  4QU6 A;  1N6Q B;  1GMU A;  2ZUG A;  1IBK J;  1FWP A;  2VPY B;  5K8N A;  2W2M P;  2V9K A;  5IQQ A;  1BQN B;  3CMQ A;  1L3U A;  3WIU A;  4DR7 J;  3AOA A;  4CLT A;  2V9W A;  1LW0 B;  1Q7L B;  4DV4 F;  4IQM A;  2XMM A;  4IDK A;  5AXM A;  2C3P A;  4B3R J;  1B7Y B;  2RRA A;  4L74 A;  1S1T A;  3DYA A;  1IR1 A;  2AGQ A;  3RW7 A;  1GFW B;  3G6E S;  3T6J A;  2QE5 A;  1FVS A;  2DT9 A;  1CJK B;  1K47 A;  2POK A;  3CCL S;  3PHE A;  3RUB L;  2DYA A;  4NML A;  4Y2I A;  5DG8 A;  3CDA A;  3FFI A;  2DNY A;  2B3T B;  4X66 F;  1VLY A;  1ZZN A;  2RIJ A;  3KLG B;  3CO9 A;  5KFQ A;  5AE1 A;  2N7Y A;  3AXK A;  1XNQ J;  3IAS 9;  4Y00 A;  1RYR A;  5K8O A;  4IR1 A;  1EQ0 A;  3DDK A;  4RU9 A;  3HF5 A;  4CRJ A;  4B17 A;  2I5J A;  5B0G A;  2R8G A;  4B3M J;  1XMQ J;  4UY8 T;  4E0D A;  2VD3 A;  3R8Y A;  3IBC B;  1SUQ A;  3FZB A;  3R5C A;  3DRS B;  2DR9 A;  4DHV A;  3X1L B;  1D9D A;  2YH0 A;  2BJE A;  4OI1 A;  4DV6 F;  5KFT A;  1KQF B;  2LEP A;  2ZKT A;  2KTQ A;  2OMO A;  3DM2 A;  2MKC A;  2I2Y A;  3K5M A;  4QIW D;  4HDH A;  1HW9 A;  3VAK A;  3HPO A;  3J81 Y;  2OH2 A;  2B4U A;  3UDE A;  1KQK A;  5E3Q A;  2Z30 B;  1LWF B;  4WE1 B;  2WW4 A;  4CO0 A;  4K5R A;  4JI7 F;  2KZZ A;  3C16 A;  1OIA A;  4YS2 A;  3KK2 B;  2R9L A;  1I3O B;  4E8U A;  3CJ3 A;  2OD4 A;  1JIH A;  1F9E B;  3KK1 A;  3MM9 A;  1T9T A;  4C3M A;  2GAH C;  3TJ8 A;  3CDW A;  2AYM A;  3PY8 A;  4DL2 A;  4DV3 F;  4DX8 H;  2IDL A;  2ROP A;  2PGC A;  1J2V A;  2V0N A;  2OD6 A;  4ETZ A;  4ZJO A;  4M5J A;  4HL9 A;  1FES A;  4CO5 A;  2WVC A;  1MU2 A;  1TMJ A;  2MLY A;  2YQ3 A;  2R4F A;  5E33 A;  4CM0 A;  3TQE A;  2NXU A;  1JLE A;  4I2Q A;  4JP8 A;  2GGP B;  2MKK A;  2A2C A;  4QBU A;  1IXK A;  5IT9 U;  3CJK A;  2JDJ A;  2GA7 A;  1EAR A;  2J76 E;  3PW5 A;  2MHE A;  1RGV A;  2J5A A;  2LYV A;  4A8M P;  2J9D E;  4NX9 A;  2OI2 A;  3IBW A;  4BCA A;  4F3Q A;  1R43 A;  2MKY A;  3V2U C;  3PCO B;  1SIZ A;  3DRP A;  4KGK A;  3NGK A;  4PG4 A;  5JVH Q;  4KB7 A;  4N41 A;  4ILM A;  3MEC B;  2NSB A;  4K0K F;  3U1M A;  4WYL A;  2Q3P A;  4DV5 J;  1UWB A;  2BM1 A;  2P6S A;  2FJB B;  1IWG A;  5HI7 A;  4LSN B;  2AD9 A;  3M1V A;  3QAU A;  2VG6 A;  4LF4 J;  3H90 A;  3RB3 A;  1HMV B;  4PPZ A;  2DNL A;  3PYG A;  3VZI A;  3D1Q A;  3BBF A;  3D3B J;  2P2C B;  4U7U K;  4WTY A;  1OSC A;  1ZTT A;  1LW2 B;  4DV2 J;  2ZVI A;  4O23 A;  2ZH1 A;  1PAU B;  2NUU G;  2AKW B;  3DOM A;  5LL6 d;  3DOK B;  3OR1 B;  4WYW A;  1S12 A;  3UD5 A;  4OV6 A;  3TX0 A;  2OEK A;  1TL7 A;  4QIF A;  3CJQ A;  1IBL J;  1MRO A;  3FBE A;  4DX6 A;  2FGC A;  4EI2 A;  2L9N A;  1HNV B;  5CA5 A;  5DM7 Q;  1M5K C;  1RWM B;  3G82 A;  2ZWP A;  3UE2 A;  3LGH A;  4F8R A;  3OLB A;  3I87 A;  4X64 J;  2BKN A;  2CPX A;  3MM8 B;  2DIV A;  2WOM A;  4YY3 F;  1RWW B;  1X9W A;  2KHD A;  4ZPA A;  1IJE B;  2B5J B;  2HRU A;  5IC6 B;  1FKO A;  1R0A A;  4HI2 A;  1B0V A;  2QG9 B;  2B7B B;  3C16 B;  4P2X A;  4A8Y A;  4USV A;  2B4P A;  4ZS6 A;  3PRB A;  5A8R A;  3MM9 B;  5DGA A;  5HO4 A;  3QGG A;  4TQS A;  2ZBI A;  3W7B A;  4O3N A;  2AGO A;  4JI8 F;  3J7A N;  1RWP B;  3CJ5 A;  2YNH B;  1NK8 A;  5A0Y A;  2PE8 A;  5H9F J;  1FK9 A;  1HPZ A;  1Y5L B;  3HHL C;  4DFJ A;  1FTC A;  2KXN B;  1U24 A;  3DU6 A;  1Q8B A;  5JXS A;  2CJA A;  2IPO B;  4LBH A;  2KN4 A;  1M5H A;  1PC4 A;  1U1Q A;  3Q8U A;  4DUT A;  2GAG C;  1T9V A;  2PI5 A;  2FPH X;  3OTB A;  1NRK A;  1OYE A;  4LSL A;  4EZ6 A;  3UDL A;  3AJD A;  2IRX A;  3BN4 A;  1WI8 A;  4IOA Q;  1KHW A;  1TR0 A;  1XMO J;  1N32 F;  4NRU A;  3K2Y A;  1TKZ B;  4HHH A;  1RTI B;  2KM8 B;  2HQI A;  1Y9O A;  4NXN F;  4LRB A;  2P9E A;  1FE0 A;  2ACY A;  4F4A A;  4NCA A;  3GFH A;  2GS8 A;  1X4E A;  1UVN A;  3KLH A;  2EFQ A;  2NUH A;  3MEG A;  2LEA A;  5C5J A;  2SXL A;  2QV6 A;  4WWS A;  2VPW B;  3UNY A;  2Z56 B;  4ZJQ A;  3H5S A;  2NZC A;  3NCQ A;  3J7Z 5;  3TA0 A;  2BW2 A;  3T1Y J;  1CEZ A;  3HHK A;  1MW7 A;  2QLJ B;  3CF5 Q;  1N56 A;  3AQO A;  4M5M A;  1VDH A;  2WZ1 A;  2RQ4 A;  2IM3 A;  5IQ6 A;  3K5O A;  3UW1 A;  3OFG A;  3AA9 A;  3U1L A;  1HNX J;  5J2P B;  3I56 S;  2ZE2 A;  5A2Q Y;  4DX7 A;  4LRF A;  1CS4 B;  2JZ5 A;  2RKI B;  4O0N A;  4MKY A;  1Q81 T;  3IFE A;  2D3O 1;  4MIW A;  2C1E B;  3G82 B;  3T5K A;  4H4K A;  4KFB B;  3EGZ A;  3TUZ C;  4ZLJ A;  1UWA A;  2AYE A;  1UA0 A;  1NJW A;  4XTT A;  1WC0 A;  2YX1 A;  2DGT A;  4ECV A;  3CDU A;  5D0G A;  4HKQ A;  1X4G A;  4J90 A;  1BE4 A;  1OS5 A;  4C8M A;  4X4T A;  2G1D A;  1C0T A;  5KG6 A;  3OSP A;  3G2X A;  4ITS A;  3SCI E;  3VGU A;  4OYW A;  1V9O A;  5K20 B;  1SPB P;  3WHI A;  3MWB A;  1ZAX A;  3PFO A;  2VFT A;  1SB6 A;  3NNH A;  5LXY A;  3CTR A;  1N48 A;  2QL5 B;  2E66 A;  4KV8 A;  4ILL A;  1P27 B;  2HS4 A;  1KON A;  4G1I A;  1HNI A;  4I68 A;  3BH7 B;  4EEY A;  2KM8 C;  2LLZ A;  2XNQ A;  1KN6 A;  2GQQ A;  2F63 A;  4J5O A;  4L3K A;  4H4M B;  1TKT A;  3CCZ A;  1REV A;  2VBZ A;  1NZ8 A;  2XGP A;  3H2V E;  3TVZ A;  3CCR S;  4B3T F;  2RU3 A;  3G8T A;  4J9P A;  3ET6 B;  4J9V A;  3J7Y I;  4TN2 A;  1YRX A;  4FF2 A;  5DRK A;  3LTO A;  1HQ2 A;  2NLW A;  2OLW A;  4WK1 A;  5KFE A;  3D9B A;  1W2I A;  3QZ8 A;  4O4G B;  2J9D A;  3PO4 A;  4LR8 A;  3VGS A;  3MEG B;  1FHT A;  2J6T A;  1D9F A;  4K59 A;  1OY8 A;  2KH9 A;  3IXQ A;  2OTJ S;  2C28 A;  3NNC A;  3TR5 A;  2M3D A;  4RNH A;  1IWA A;  5ETN A;  2E1C A;  1TFW A;  1S1W A;  3OTO F;  1EET B;  2W8L A;  4A8Q A;  1KOH A;  4FF4 A;  3IMQ J;  1VC0 A;  1T94 A;  1N33 F;  3TO8 A;  3QLH A;  2K06 A;  1S59 A;  5AJ3 J;  4EBC A;  1VQP S;  4C8N A;  4DU7 A;  2FJE B;  3ZZU A;  3L95 X;  5T7L A;  2MYF A;  3AD9 C;  3IM9 A;  1M5V C;  1QLN A;  3NOC A;  1AFJ A;  2ZH7 A;  1MG7 A;  1GEH A;  2DO0 A;  2ZH5 A;  5ETK A;  2Y8W A;  4MKV A;  1XMB A;  3FSI A;  4EU0 A;  2OPR B;  1FXL A;  4UOF A;  5C24 B;  4C9D A;  2APO A;  2L9D A;  3ISZ A;  1K1S A;  4XDD A;  4UQG A;  1JXL A;  1NBE B;  3OVS A;  1S72 S;  4WKY A;  2CPY A;  1RAO A;  2GZO A;  3DXB A;  1C0T B;  4CLK A;  4GKJ J;  3DDI A;  2VFV A;  1CBK A;  2M2B A;  1J27 A;  2R8I A;  2HIQ A;  1JJ4 A;  2QMU B;  2BXJ A;  2M7S A;  5FLX Y;  3HJF A;  3IRW P;  1XNR F;  4MKA A;  2W4C A;  3NBP A;  3OBI A;  1VIO A;  1LWC A;  1NH8 A;  4UUW A;  4OZ1 A;  3RB6 A;  2HYI B;  4KV8 B;  1D1U A;  3N5F A;  1K0T A;  5AXK A;  3G4S S;  2NXJ A;  3ENW A;  4WF9 Q;  3WIV A;  4WPA A;  2EKY A;  3J80 Y;  3J7Z T;  1TKT B;  4FKY A;  4NXM J;  4NLP A;  1DUR A;  2KT5 A;  4EUV A;  2FC9 A;  2E5L J;  4WFN Q;  2H65 B;  2XMJ A;  1T9Y A;  2MY7 A;  3MCO A;  1N36 J;  4ENO A;  3PJ9 A;  3K8V A;  1XK8 A;  4AD6 A;  4YEA A;  4ZMM A;  4KHR A;  4KJI A;  1DTT B;  4OLO A;  3MR2 A;  2NPF A;  2DCU B;  3LP1 A;  2MZT A;  4RBU A;  2DRB A;  4LF7 F;  1O51 A;  3EMT A;  1EP4 A;  1Q86 T;  4GKK F;  4QU7 A;  1CJV B;  2VH7 A;  2FTR A;  1HBM B;  2GJI A;  1GT8 A;  2JEI A;  2XZT B;  3N4W A;  3QO9 A;  5CAA A;  3SIP B;  1U45 A;  4F36 A;  1RDR A;  1P9Y A;  3QAT A;  3NXZ A;  5CZV A;  1X4D A;  4YME A;  2ZDP A;  2QLW A;  4O44 B;  4PUO B;  2VDH A;  1VBX A;  4P2F A;  4ZJL A;  4F0M A;  1XR5 A;  1VIX A;  1WKJ A;  1U1P A;  1FFS B;  1VS3 A;  2MZS A;  2HQF A;  4RPF A;  2XZD B;  3M9O B;  2RDI A;  4KC5 A;  4EK2 A;  3QJP A;  1UET A;  1SL0 A;  1JQG A;  4X84 A;  2WVB A;  2MZJ A;  1DJ0 A;  4YQW A;  1QE1 A;  1H7X A;  1NHV A;  2LXF A;  2GIF A;  3GFX A;  4PPD A;  4V1A k;  2XLI A;  1T9W A;  2J9E A;  1BQM A;  3CO0 P;  4UOC A;  1NPP A;  3MHY A;  5F9L A;  1UJ4 A;  3C66 A;  4I6A A;  3VHQ A;  4P74 A;  4ZLN A;  4MH8 A;  1QTN B;  2DXD A;  3A3O B;  1HI1 A;  8ATC B;  2BX6 A;  2GV1 A;  4TU8 A;  2HHU A;  2EKN A;  3MM6 B;  1J5E J;  4Q7A A;  4CZC A;  3D6H B;  4YHH F;  2GO8 A;  1NPK A;  4ED3 A;  5HP1 B;  2ASY A;  1RTH B;  4C8K A;  4NOH A;  4JI0 F;  2F8H A;  1L3K A;  3QT7 A;  2PO4 A;  1N34 J;  2MJN A;  2AW0 A;  1RBL A;  4AYB D;  4IYQ A;  1U1M A;  2AZ1 A;  4DR1 F;  2FDN A;  3GCX P;  1C2P A;  4G1Q B;  4Q44 A;  2XMV A;  2W2N P;  1FNX H;  4FZV A;  2MQN A;  4F67 A;  1VBZ A;  3VAH A;  1WDD A;  2HNY A;  2AX1 A;  5BR8 F;  3ILI A;  3BM7 A;  5DM6 Q;  2Y1I A;  5HQL A;  2BA9 A;  2WW8 A;  3DRR A;  3J81 U;  2OP5 A;  2VQE J;  1WKK A;  1ITP A;  3FMB A;  3V6D B;  4RX6 A;  3HZG A;  1LK5 A;  2BAN B;  1U1R A;  4XAK A;  4KGM A;  1V3Z A;  3CJ2 A;  3AA8 A;  3M8W A;  5BJR A;  1E6Y B;  2GO9 A;  3Q8V A;  3NS5 A;  2OSQ A;  1GMW D;  1U0H A;  2EK6 A;  2VOP A;  3QO9 B;  3PAC A;  5LMN J;  2UV8 A;  1TV6 A;  4ZLP A;  3BSN A;  5ETO A;  4LUB A;  2XS2 A;  2PMH A;  3W5Y A;  1FTR A;  4GVB B;  5ETQ A;  4ANC A;  1JMT A;  3K57 A;  4PRF A;  2JRS A;  1W2B R;  4BC7 A;  4B3R F;  3JQJ A;  1BMQ B;  1IKW A;  2JFD A;  4J37 A;  1P8G A;  1NK0 A;  2GX8 A;  1JXE A;  2FHJ D;  2KG1 A;  1NKC A;  2MKI A;  3K8W A;  4K4U A;  3GV8 B;  2HVD A;  1WEZ A;  2DRA A;  3VCD A;  2JH3 A;  2IA0 A;  2EVZ A;  3P8B B;  1CSJ A;  1FER A;  1S48 A;  5B0D A;  3ZFV A;  2XI3 A;  4NA3 A;  3HLU A;  3HZE A;  1OQ6 A;  3SDE B;  2W7P A;  3RYL A;  3AB2 B;  3M8R A;  3G6X A;  2A6O A;  2PC6 A;  4LQ3 A;  2BE2 A;  5M2U A;  3DKD A;  4WU2 A;  1XNQ F;  3RRG A;  2FUG 9;  2XSJ B;  5D78 A;  5DS7 A;  1E6V B;  2FJW A;  2WVE A;  5B0C A;  3MMC A;  2H5E A;  2HQ3 A;  4F4W A;  5E41 A;  3OV7 A;  4WFB Q;  3H40 A;  1FJC A;  3JTP A;  4B3M F;  3Q0A A;  1XMQ F;  4MT1 A;  4OYI A;  4J9S A;  4DV7 J;  3ITH A;  1PJ7 A;  4OZ0 A;  1DQ8 A;  3BYP A;  3JYT B;  3T1H F;  2E9R X;  1FKP A;  1VK8 A;  1YLX A;  4A8K A;  1SKU B;  1CJT A;  2CZ9 A;  3VAG A;  4RBV A;  4RW7 A;  2DNZ A;  2EWH A;  3UDV A;  3H59 A;  5DDR C;  1N54 B;  1NJZ A;  5D0E A;  3IP0 A;  3GII A;  3JAM Y;  2CPD A;  1PBA A;  2KJW A;  5IM0 B;  3POT A;  3AHP A;  4LT6 A;  4ZCK A;  3R97 A;  3ZZZ A;  3R5D A;  4DR3 J;  1C0U B;  3FJ2 A;  1JLA B;  4M1K A;  2ZBC A;  1CQM A;  2MGZ A;  3I0R B;  4DZ6 A;  4ED7 A;  3VAF A;  2KT3 A;  2G4B A;  1GXT A;  4OJH A;  1FRI A;  1F5B A;  3MEE B;  1OMS A;  1CJU A;  3TAM B;  2XMW A;  2HNZ A;  3Q2S C;  1NSQ A;  4NLV A;  1RAI B;  2RQM A;  3AOB A;  3QSY B;  3DXS X;  1U0H B;  1FA0 A;  1S4F A;  2DH8 A;  2Y9H A;  4CCH A;  4BWM A;  3TAR A;  2OHD A;  5DQH A;  1YDL A;  3LP0 A;  4K4Y A;  1RHJ B;  3RBZ A;  5EX3 A;  4W90 B;  2HFV A;  1TP7 A;  2CJQ A;  2ZEJ A;  4J9M A;  4P10 A;  2VJV A;  3DOL A;  4ECZ A;  5D8H B;  1TMM A;  1TUV A;  5KTQ A;  4HT7 A;  4MIB A;  3IM8 A;  4I6W A;  2V67 A;  2MEW A;  3NAI A;  1N5T A;  4RNF A;  2RUG A;  5C42 B;  1RI7 A;  4FP9 A;  4RKU C;  2YNG A;  4TY9 A;  4ECQ A;  4DDF A;  2XY5 A;  2X51 A;  1Y00 A;  3G87 A;  1U48 A;  1HI0 P;  3EVM A;  4DV2 F;  4WFZ A;  4LF2 A;  3KJF B;  2VG7 A;  4J7C A;  5KFI A;  1NCL A;  6FDR A;  3JSB A;  4OHZ A;  4F3O A;  1LOU A;  1NPR A;  3FVY A;  4K4W A;  1QAI A;  4DOZ A;  4M5D A;  3GU0 A;  4QYR A;  3L7P A;  1YRT A;  1UCN A;  4DBQ A;  4DPT A;  1ZAW A;  1VQ6 S;  3FDS A;  1ELO A;  3JQM A;  4X64 F;  2W01 A;  1S6P B;  2V2V A;  4NLW A;  4XK8 C;  2YQ1 A;  1KVJ A;  5H9E J;  1SJQ A;  2C2N A;  4FYX B;  4EYH B;  3SBM A;  1R6Y A;  5A2Q U;  3MM5 A;  2UUC J;  3CE8 A;  5KG1 A;  3NGD A;  3BR9 A;  3V6J A;  1WOR A;  1QJH A;  4I2P A;  3KK3 A;  5F8H A;  3DDN A;  3VAM A;  2VPZ B;  1G6B A;  1AB8 A;  4YR0 A;  4JV5 F;  3BGR B;  4TLQ A;  5B0B A;  4MK8 A;  1DQ9 A;  2LQ9 A;  4Y2K A;  2B9Y A;  4CLY A;  3HP6 A;  1QVF R;  3DRX A;  3O3L A;  1CJU B;  3WZ0 A;  4MAK A;  4DLE A;  4FVC A;  4GO5 X;  1TKX B;  5CQG A;  2F3J A;  1WAC A;  4LFB J;  4EFA C;  2BYC A;  2AQ4 A;  1RE1 B;  3CUL A;  1WHV A;  2XHW A;  3UR0 A;  2DXE A;  2OFH X;  2YPY A;  1I6J A;  2I0X A;  1IKY B;  1HD1 A;  4R8U B;  2AJF E;  3NNA A;  3MUV P;  4JI4 J;  3KKF A;  4K4V A;  1T8E A;  3HVA A;  2MQ8 A;  1XMO F;  4RW9 A;  5CYM A;  3GG1 A;  1G2E A;  2VF3 A;  4B3S J;  3DOL B;  1OSD A;  1S1U B;  1CUL A;  4RNM A;  2HBQ B;  3VAL A;  1R3N A;  1Q5Y A;  1EIY B;  1WHX A;  4F7V A;  1C1B B;  2CVE A;  2DJW A;  5DDO C;  4KSE B;  2R7Q A;  3D3C J;  1N88 A;  1VQ4 S;  1F9H A;  2EXU A;  3T1Y F;  5D0H A;  4DL4 A;  2CNK B;  1Y7P A;  2ZOF A;  4P9S A;  2Q6C A;  2GQC A;  5AE2 A;  2C22 A;  3X3U A;  2QT7 A;  3QIP B;  5KFO A;  4J9U E;  1XTZ A;  4X4N A;  4IFV A;  1PKU A;  5HMY A;  4TY8 A;  2VG7 B;  2AZ3 A;  4OYA A;  3VR1 A;  4DV4 J;  1HNX F;  3HX9 A;  1B0T A;  1AZS A;  3T19 A;  3R3T A;  1HIY A;  3I4P A;  3TW0 A;  3H5X A;  2CPI A;  1Q7Y T;  3BEG B;  1S49 A;  2DBB A;  2KKH A;  1VFJ A;  3VQT A;  2V34 A;  2E9Z A;  1RQ0 A;  4DF4 A;  4B9N A;  4LF5 F;  1R0B G;  5A6P A;  5KFU A;  4M8L A;  3HT3 A;  2YWW A;  4Y2M A;  5KFJ A;  2XQC A;  1T03 B;  1FWL A;  2RVJ A;  3FNN A;  3QRQ A;  4CYU A;  5HRO A;  2C2R A;  3G6V A;  1C1C A;  1T02 A;  4MKB A;  4FS1 A;  4Q0B A;  3FSX A;  2HK3 A;  1WEL A;  1X4F A;  4TQR A;  3CC4 S;  1Q53 A;  5KFG A;  3A8K A;  4QZV B;  3I6P A;  3UCZ P;  2V69 A;  2N7C A;  3CIM A;  4LBP A;  1WHY A;  1MML A;  6AT1 B;  3FGV A;  4DX5 A;  3SSR A;  2RML A;  1EHW A;  2HGM A;  2D41 A;  2MXY A;  2R7O A;  4ES3 A;  2W25 A;  2ZFH A;  3MMJ A;  1KLM B;  4EWT A;  3HVW A;  3KJQ B;  2B6A A;  1BD6 A;  1NXI A;  3D4J A;  1RAC B;  1R8B A;  2E1M C;  4KE5 A;  2BMB A;  2HHX A;  5FLX U;  1UTA A;  2F65 A;  1TQL A;  1VQL S;  4A8O A;  4CWB A;  3K58 A;  1WTB A;  2ZIT A;  4JI7 J;  3M2V A;  4CH0 S;  4NEY A;  2R7W A;  2ZDO A;  2FB0 A;  5F8N A;  5F41 A;  1IM6 A;  2VG5 A;  3CB4 A;  5D4L A;  3M4X A;  4Z2X A;  2K3I A;  1NK4 A;  5HBM A;  1HI8 A;  2ZHB A;  5CXT A;  2DNO A;  1IKV B;  3J80 U;  3T1A A;  2LA6 A;  2E7W A;  1GH8 A;  2ZJQ Q;  4WP9 A;  2XHC A;  5FDL A;  3N5B A;  1VQS A;  1YBU A;  1H74 A;  3TEH B;  3J81 j;  3LUY A;  4ZVH A;  4TY8 B;  5KG5 A;  4X4V A;  4FXV A;  1HD0 A;  3B4D A;  4OJ3 A;  1F6T A;  5E7O B;  4ES1 A;  2F1F A;  2X1A A;  3G71 S;  2CA9 A;  5LJ5 Y;  4IG3 A;  5J1E A;  3VF0 B;  1Y5N B;  1RU1 A;  1WWH A;  3OFE A;  4UT4 A;  3MCN A;  2ZHA A;  2LDI A;  3TI0 A;  2PMW A;  4N8O A;  3EGW B;  5DQG A;  4ZPT R;  3PIP Q;  2KU7 A;  3PNI A;  3M8P B;  5I4M A;  2FVQ A;  1X9S A;  1B3T A;  4U96 A;  1NEE A;  2R42 A;  5M2P A;  3C15 B;  2YBV A;  4OYX A;  5KFS A;  2L08 A;  1UA1 A;  4H4O A;  1OPI A;  4F25 A;  3J7A 1;  4HTJ A;  4OZN A;  5GAH I;  2AJ4 A;  5IWA F;  3HFK A;  3SQG B;  2OFG X;  2R7T A;  3BO3 A;  1SJ1 A;  4NZ0 A;  4DSJ A;  5A76 A;  4JI2 J;  2AEM A;  1JLC B;  4GKJ F;  3A4T A;  4A46 A;  4IFY A;  2LFV A;  3GJQ B;  5IT0 A;  3W5Z A;  4RW6 A;  3MAQ A;  4AXJ A;  4DL6 A;  1TAU A;  3OFH A;  4ZCM A;  3HO1 A;  3NGS A;  2VA3 A;  3MCM A;  3OUY A;  5HMX A;  3NCR A;  2QC3 A;  3DGP A;  1TUW A;  4NLQ A;  2BRL A;  1Q16 B;  4OZ2 A;  1NH7 A;  4QWE A;  1JB0 C;  3OW2 R;  1HAR A;  1R8A A;  3JQK A;  4P75 A;  1RWX B;  3RG6 A;  3AXM A;  4OYO A;  4ZPW R;  3PW0 A;  3VGT A;  4KPC A;  2KZM A;  2GNK A;  3I5C A;  1RYS A;  3L4B C;  4UTG A;  1RWO B;  1U09 A;  5HLF A;  1L3S A;  4M5N A;  1IQT A;  1FWK A;  3AT1 B;  2W9B B;  3QJJ A;  3M30 A;  5KFX A;  4ETX A;  3S6E A;  1N36 F;  4NYZ A;  2KFY A;  1XWL A;  5KAK A;  4Y0F A;  2VG5 B;  4B9V A;  1KQG B;  4WII A;  3LP2 A;  3RRK A;  3OFF A;  4WU3 A;  4JI8 J;  1FRK A;  2NS1 B;  1FD8 A;  1R6V A;  3GLJ A;  3MMB B;  1FT8 A;  1UJ6 A;  4JV2 A;  3I5A A;  2V68 A;  2DD8 S;  1ZET A;  2B9X A;  2V8P A;  4DG1 A;  5U47 A;  3KNG A;  2X1F A;  1SJ3 P;  3ZXW A;  3SI8 A;  2ZD1 B;  4ZPV R;  3UCG A;  1UFW A;  4DU8 A;  3V4I A;  4NI2 B;  1FKA F;  2X3G A;  2JC0 A;  1RTJ A;  3OR2 A;  1WOP A;  4BWJ A;  3KDO A;  1GX6 A;  1KRP A;  2D74 B;  1NM2 A;  4X4Q A;  3MR7 A;  4ZHR B;  1N32 J;  4GC7 A;  1KEK A;  2YH1 A;  3NLC A;  3BYR A;  3PO5 A;  4NXN J;  3FQK A;  2DGV A;  2UUA J;  3HCX A;  2VOD A;  4WJB A;  3FUY A;  4P71 A;  2M70 A;  2DKO B;  3GZ7 A;  5C25 A;  2P5V A;  4IG0 B;  3DNC A;  1H6K X;  1TVR B;  5L39 A;  1QUP A;  4CM2 A;  5SUH A;  1M1H A;  5GAG U;  4ZCL A;  2C42 A;  4OI2 A;  3KXD A;  3D0H E;  4O3P A;  3MPD A;  1X0P A;  4IFY B;  3OJS A;  2NZ4 A;  4CLF A;  3ZTQ A;  2JSX A;  2V4J A;  1KBR A;  2C2O B;  4ZVP B;  3GSD A;  3E8O A;  3MM7 A;  5KT2 A;  5ETS A;  2GIR A;  1XER A;  3FCW A;  3P3D A;  4D3G A;  3LH2 S;  7FDR A;  4L76 A;  5I3U B;  2YPZ A;  5H1S V;  4JV0 A;  2DGO A;  3DGP B;  5J2N B;  2WVD A;  4DQS A;  2UXC F;  1Q82 T;  3Q8P B;  4URS A;  3D1O A;  3PDN A;  2Y0S D;  3F44 A;  2I8E A;  1N34 F;  1U0S A;  4RW8 B;  3NRB A;  2M9K A;  1RT2 B;  4HVZ A;  2IJN A;  1S10 A;  1LWE B;  2K7K A;  3K89 A;  5HMW A;  4N5S A;  1HBO A;  5KFK A;  4C0H A;  2EW9 A;  1UVL A;  3VZH A;  5D4O A;  3H98 A;  2C2M B;  1U6Z A;  3ENV A;  5T41 A;  2YNF B;  5IFM A;  4MIA A;  4ZVG A;  4GMK A;  4QPT A;  2FVP A;  1FNM A;  1MMD A;  4ZVQ B;  2VJU A;  4MYT A;  5KFY A;  1S6Q B;  3U02 A;  2JX2 A;  1TL5 A;  4OZ3 A;  5AT1 B;  2HWI A;  3K5N A;  3W2V A;  3TA1 A;  3JAM U;  4TYA A;  4R5P B;  3GB0 A;  2O5D A;  4CLW A;  1OWX A;  1MN7 A;  2YX7 A;  2KJV A;  5LMN F;  2H5J B;  4AL6 A;  3LF0 A;  2ZNY A;  3V4I B;  4DQR A;  4NPO A;  3CXC R;  3W8G A;  3KLI A;  4HHU A;  2WRM A;  1C4C A;  2BE7 D;  1NDP A;  4PKD B;  1HBU B;  4NCG A;  1AA1 B;  3NCP A;  2DR8 A;  2UUB J;  3HKZ D;  3BZQ A;  5I3P A;  4ILR A;  5D4P A;  2XB2 D;  3RTV A;  2AHO B;  2XWY A;  2O3D A;  3PX0 A;  2B9E A;  2ZOG A;  2DHH A;  1YJR A;  3KLF A;  2N82 B;  4LJM A;  1TK8 A;  4QIV A;  3ZTR A;  3PZP A;  1S0M A;  3OTO J;  1G7C B;  2FD2 A;  4FPI A;  1PCA A;  1DQA A;  1RJJ A;  5KFC A;  1UZD A;  4CNY A;  2R7S A;  1SI9 A;  2HMI A;  2CJB A;  3SV4 A;  3R7S B;  2UVW A;  3HKW A;  3CCE S;  2IJR A;  2KT2 A;  4QYZ K;  3MM7 B;  3I0S A;  1S1V B;  7AT1 B;  4RW4 B;  2XS5 A;  4ZOS A;  2UUT A;  4JI6 J;  3PHT A;  3I32 A;  3ONQ A;  5D4N A;  4LFA J;  2CIM A;  3PW2 A;  4KH1 B;  4QOT A;  3K7R A;  2W24 A;  2IM2 A;  4JB8 B;  4HTI A;  5LM7 E;  3TAN A;  1S9G B;  4X65 J;  2R2S A;  2MZQ A;  1PIE A;  2FLO A;  2FHK A;  4J9L A;  1L5U A;  5CYQ A;  2YKM B;  3C6U B;  3RB0 A;  2CQC A;  2DY9 A;  2K1R B;  4DR3 F;  3C2P A;  4C11 B;  4C3K A;  4QR2 A;  2NR0 A;  1A6L A;  1R8H A;  3K5L A;  1RWU A;  1H0H B;  4OX8 A;  2CQI A;  4KGX B;  1FI4 A;  1NSK L;  4HHJ A;  2W2Q P;  2OO4 A;  3GE9 A;  1XNR J;  1VQY A;  3I82 A;  2HFS A;  4CO4 A;  3GPA A;  3W2V B;  3G8S A;  2RIL A;  3ULH A;  1F9F A;  3ZC4 A;  3WQP A;  3F41 A;  1S1X B;  4N8N A;  5KG2 A;  2ROG A;  4OZJ A;  3MDF A;  2KRB A;  1DTQ A;  4YB5 A;  4OL8 A;  4PAB A;  1JLG B;  4LIR A;  4C0B A;  1JKH B;  1GNK A;  3BGL A;  2IC3 A;  2JLE A;  5J2Q A;  2HHQ A;  1O5J A;  3M8Q A;  4WZQ A;  3KLI B;  2J6S A;  1RHM B;  3KWM A;  1WTF A;  1NSA A;  3H2L A;  1S76 D;  3P45 B;  1U6F A;  2W9C B;  4LSZ B;  5K14 B;  1P1T A;  4K50 A;  2BRK A;  5E2Q A;  2LMI A;  3OL9 A;  2PEB A;  3NOG A;  3O6Q A;  1YIT S;  2W2P P;  4FPR A;  1N0V C;  5C7P A;  2CG4 A;  4LQ9 A;  4MFB A;  3U27 A;  3LGN A;  4F04 B;  3HSD A;  4C98 A;  3DLB A;  5F0U A;  5B0E A;  1RHQ B;  4ICL A;  2BJD A;  2GCF A;  2EI5 A;  1JJH A;  5EWE A;  4ED4 A;  3E01 A;  4YDX A;  2CQD A;  4WXW A;  1Q1K A;  4ECU A;  1FXR A;  2KRR A;  2OKQ A;  3EZ5 A;  2AEJ A;  3CD0 A;  3UVJ B;  2WSC C;  2BBE A;  4DQP A;  1M5P C;  4DR4 F;  3FRZ A;  4EBD A;  2LA4 A;  1REG X;  1XR6 A;  4JUZ A;  3L09 A;  5CZX A;  2RSQ A;  2VFR A;  3VV2 B;  1TU0 B;  2CZV C;  2O67 A;  2WHO A;  1XBW A;  2UXD F;  2H4W B;  2A18 A;  2E1A A;  2D9P A;  1J5O A;  2DNM A;  3HSG A;  5M2R A;  2XTJ P;  3MD1 A;  3Q22 A;  5A6W A;  2HND B;  2I38 A;  3QPI A;  5H9F K;  3DN9 A;  2QA1 A;  3ZZT A;  2ADB A;  5EUH A;  1ZYQ A;  3LA0 A;  2MKJ A;  4IRD A;  1YHQ S;  3DCA A;  4G65 A;  1TEL A;  4CP5 A;  2W4P A;  2COL A;  2IJF A;  1U1O A;  1RA6 A;  1A9N B;  1RT5 A;  3CC7 S;  1S0O A;  1JLB B;  5A8K B;  4X2B A;  2VKZ G;  2YY3 A;  2ILY A;  2UP1 A;  3R1L A;  2V8D A;  5KFN A;  5HL7 Q;  2MTL A;  5DZ6 A;  4RNO A;  2V94 A;  4PZV A;  4P7V A;  4WP8 A;  5K8P A;  2EPI A;  1RAF B;  1RT7 A;  1WG5 A;  4PWW A;  3H42 A;  1VR6 A;  2DY1 A;  5JUM A;  2G1H A;  1HR0 J;  2XSF A;  2CJX B;  1LKZ A;  4OI3 A;  2O66 A;  3PX4 A;  3OHB A;  2R7U A;  2DGS A;  4A8S A;  3S7R A;  4JI0 J;  1XJW B;  1ZZF A;  2HSE B;  1VYA A;  2UZA A;  2FJX A;  3BDE A;  3TJA A;  1IQZ A;  3HXM A;  2ZOM A;  1S97 A;  3P4U B;  4CLS A;  2PMZ D;  5THW A;  4C4W A;  4IO1 A;  4DR1 J;  3JSM A;  3DLG A;  2KG0 A;  4YP3 A;  4G6V B;  1K0V A;  2HGL A;  2CQG A;  4NLR A;  3C6T A;  4B3S F;  1N5Y A;  1VRQ C;  4U8V A;  3WX8 A;  5FJ4 A;  3EVW A;  3ZNU A;  2BM0 A;  3DLK A;  4KT0 C;  1IN0 A;  4ICL B;  3BGO P;  2RQC A;  4AQY F;  4Q5V A;  1N5S A;  1JLF A;  4ZVT B;  3E01 B;  2NCK L;  2HZA A;  1S9E A;  4WP3 A;  4ZVO B;  4XDC A;  4UST A;  3MOZ A;  1KNZ A;  4UZB A;  2AJ1 A;  2YKP A;  1S9F A;  1YGY A;  2WBM A;  1EB0 A;  3Q8Q B;  4JI1 F;  1RT6 A;  2E29 A;  2V4Q A;  2I9S A;  4I7F A;  2OPP A;  1VRU B;  4K7Q A;  1VQO S;  1IKX A;  2WB4 A;  3M32 B;  3MPY A;  4QR0 A;  5DO2 A;  2R7R A;  1TL1 B;  4LRD A;  4KIA A;  2HZV A;  2XMT A;  2CDR B;  4ID5 A;  2CYY A;  5L1J A;  3H8Y A;  4IKA A;  2IAJ A;  4O3S A;  3MUM P;  2JWN A;  3R6L B;  3OL7 A;  4C0O C;  1DAR A;  1EAY C;  4PEO A;  1VRT B;  1L3T A;  2ZC3 A;  2V63 A;  1Q5V A;  3UN2 A;  2VFS A;  3AOC A;  5DLF A;  2ZH6 A;  4OYM A;  2HS0 A;  4CTA A;  3BGF A;  1B4S A;  2Q1L A;  2D1C A;  1FJ7 A;  3O44 A;  4J9K A;  2RD5 C;  4M5H A;  2XI2 A;  3KLE B;  1YK9 A;  1RHK B;  4RUH A;  3T1H J;  1FDD A;  1RCX B;  4NRT A;  2O1P A;  4J9O A;  2AJQ A;  3DLH A;  2FY1 A;  2EC2 A;  4F3M A;  3MAH A;  3IBF B;  3Q8R B;  3M2U A;  1BWV A;  1FF2 A;  1HQU A;  4R25 A;  1U26 A;  5E5N A;  4OI0 A;  4RUB A;  4DPX A;  2KVQ E;  2OPQ A;  1AYE A;  2DCL A;  4B3O B;  1HBN A;  1H2V Z;  3BQ0 A;  1UZH A;  1SV5 A;  5DET A;  3SQO P;  4ZLL A;  1X60 A;  1UFK A;  1M1K T;  3GIR A;  2ZWO A;  3M8Z A;  3PJX A;  3C6T B;  1TK5 A;  3CD5 A;  4J9N A;  2PEH A;  2DNP A;  1NK9 A;  2ALY B;  1NK7 A;  3IN5 A;  2VOO A;  3EYZ A;  1CQN A;  2FVC A;  3CD7 A;  5CD4 A;  5IT4 A;  5HVH A;  1JX4 A;  3DHX A;  5I3Q A;  4U6P A;  5J2M B;  4USU A;  1RTD A;  4LF1 A;  2UXB J;  2DEI A;  4NAS A;  1M5O C;  5EWF A;  2DGW A;  2YKN A;  1CC7 A;  1OY9 A;  4UF4 A;  3RBX A;  2ZZM A;  2RRB A;  2XY6 A;  1Y5I B;  3V81 A;  4M95 A;  3E3X A;  2J8A A;  1L3V A;  4IDK B;  2DR6 A;  1N5V A;  1S1T B;  3DYA B;  1UPP A;  3EPG A;  2PA3 A;  2AP6 A;  2BOP A;  1RBA A;  3GQC A;  5F8G A;  3L3C A;  5AXL A;  4M5I A;  1WEX A;  4FF1 A;  4ID5 B;  4B9L A;  1SKW A;  5DDQ C;  3FFI B;  3KMQ A;  4F4Z A;  2X1G A;  3PIO Q;  3TEG A;  2HFO A;  1AUD A;  3MZI A;  3SMZ A;  1SC3 B;  2Y3Y A;  2IY5 B;  4JI2 F;  2FJD B;  3FCV A;  2NRE A;  1B64 A;  3R9L A;  4USH A;  3V5R A;  2ROE A;  5GAG I;  3NMA A;  2YKO A;  2I5J B;  4Z7C A;  5HAN A;  2UVV A;  1ZPW X;  2PFD A;  1SUQ B;  5J1N A;  2HK2 A;  1IM4 A;  1OQ3 A;  3HUL A;  3QID A;  2MZ1 A;  5GAE U;  1RUS A;  1IBM F;  5L1L A;  2EG1 A;  1T05 A;  3DM2 B;  1HLW A;  3WX4 A;  3HHE A;  4YB6 A;  3LAM A;  3M6W A;  3HHN B;  4DUZ J;  2EEY A;  4K2J A;  4TYB A;  1U2C A;  2W1B A;  2JLF A;  2WON A;  2Z58 B;  2DHA A;  1ULR A;  2VFU A;  4ELT A;  5KFP A;  1U2R A;  3DI6 A;  3PRV A;  2VUG A;  3KK1 B;  4JV5 J;  2XLK A;  1QVG R;  2VKR A;  4DV0 J;  5JMN A;  4USI A;  4C48 A;  4KAI A;  4USM A;  5I42 A;  4O3R A;  2OGU A;  2QJ3 A;  1MWY A;  2FVR A;  5KOX A;  2LQ8 A;  4YR3 A;  1MU2 B;  3EUN A;  3A1Y G;  4KTQ A;  1WSR A;  3CED A;  5JVG Q;  4CQ1 A;  2WCX A;  3ZO7 A;  1JLE B;  4I2Q B;  1U1L A;  1HYS A;  2QA2 A;  2CQ4 A;  4NLY A;  2YKN B;  3CJK B;  4ECS A;  1CLF A;  3PM9 A;  2AU0 A;  3Q2T C;  4JYA J;  2MMY A;  2JJ4 D;  2X1B A;  5BYS A;  1KC8 T;  4PR6 A;  3Q83 A;  1Q8K A;  3W2W A;  5KOW A;  4F02 A;  2VHG A;  3M6V A;  4CI0 B;  2FZG B;  5EGY A;  1V3S A;  1ZOT A;  3A8J A;  3CWJ A;  3DRP B;  1PBU A;  3M8S A;  1HHT P;  3HVT A;  2UUA F;  1S6O A;  4EO8 A;  1UEK A;  5D77 A;  2PI4 A;  2JOQ A;  2MLX A;  1P1L A;  2MQQ A;  1UWB B;  1URN A;  1DBD A;  1YZ6 A;  2CJY B;  3DLJ A;  4NLU A;  2HHH F;  3M1V B;  2VG6 B;  5F9N A;  4PXD A;  3FBF A;  4PWD A;  1RP5 A;  1QAJ A;  3SCL E;  2KI2 A;  4HAC A;  3GYX B;  1RLD A;  4ZP6 A;  1Z4U A;  3CPW R;  2HRY A;  3V6K A;  2LVW A;  3NGU A;  5FD1 A;  3DOM B;  3UCU P;  1WI6 A;  1RLC L;  4QWC A;  2J0W A;  5KT7 A;  1TL7 B;  4BS2 A;  4E98 A;  2EFO A;  1MRO B;  1K9M T;  2D7S A;  4QWB A;  1H38 A;  4DUY J;  4DPO A;  3GR0 A;  3G6Y A;  2XYP B;  5DG9 A;  1Y4Z B;  2KL8 A;  3FSY A;  5KFW A;  2MKS A;  3H4B A;  4OYB A;  2QMX A;  1LXN A;  1RZM A;  1VMB A;  2WOM B;  1JNR B;  2ZNZ A;  3BGU A;  1SH3 A;  1S99 A;  2CPH A;  2QYC A;  4LF5 J;  4FXD A;  1FKO B;  3DLE A;  2BQ3 A;  3G8Q A;  3ILL A;  1R0A B;  5E0O A;  3PG9 A;  5KT3 A;  4L6V 3;  4TNO A;  4XO0 A;  3HJV A;  5L1I A;  5J1P A;  2M8D B;  4ATN A;  5A8R B;  2WTF A;  2E9T A;  4N7T A;  1WOO A;  5KFA A;  2F8M A;  2CQH A;  3FRY A;  2GW8 A;  5IXU A;  1DRZ A;  5A0Y B;  2E5G A;  1FK9 B;  1HPZ B;  3D6M B;  2HVI A;  3ENA A;  1UW4 A;  4TXS A;  1KLN A;  3TP2 A;  3BBC A;  2BZ2 A;  2DXF A;  4AXI A;  3ILO A;  5DQI A;  2XBP A;  1RAG B;  2M0G B;  2AT1 B;  4DFK A;  3BBB A;  1WC1 A;  4X62 J;  2DIU A;  2ZM6 J;  4LIW A;  4LSL B;  4NYO A;  4CNZ A;  2G13 A;  4OI4 A;  3RBD A;  3VAJ A;  2LCW A;  3BPD A;  1RAE B;  3GCW P;  4NLO A;  3NAH A;  2MDA A;  3LPY A;  2QN6 B;  2VIH A;  4QIE A;  2UUB F;  1X5O A;  1NHK L;  2GVD A;  4A47 A;  3HVT B;  3PKY A;  3VGV A;  2HPU A;  4Y3C A;  1X4H A;  3R5J B;  2HEK A;  1RT1 A;  2QLX A;  3KLH B;  1ZM2 A;  1ZBT A;  2UUW A;  1NB2 A;  3VQS A;  3GV5 B;  1KD1 T;  4DXL A;  4PG7 A;  4PWD B;  3NL0 A;  4OX6 A;  4DFP A;  2XLJ A;  1H2U X;  1SVD A;  5D3G A;  2IDE A;  3RGI A;  3OT9 A;  3WC0 A;  2XYH B;  3E51 A;  4DPU A;  1PYS B;  3QT8 A;  1WF2 A;  3OTC A;  4P73 A;  2ZE2 B;  4TLR A;  3P5T L;  2BAC A;  3QAE A;  2MQM A;  4JI6 F;  1KVK A;  4LR9 A;  4P2M A;  4LFA F;  4FDF A;  2J8S A;  3CCT A;  5F8I A;  2DTJ A;  1GXU A;  3KUG A;  1NKB A;  2CQ0 A;  4ED8 A;  2XWX A;  4YUD A;  1FFG B;  3ETO A;  3H5U A;  4DQI A;  1RT3 A;  3LW5 C;  4X65 F;  3T5J A;  4ZVU B;  5DGB A;  1DAX A;  5EX0 A;  5L38 A;  4LVO P;  4ZP7 A;  1W7W A;  2U1A A;  1SIW B;  3AAW B;  3QRP A;  5IWA J;  3MGJ A;  2R8H A;  3O8W A;  3IS9 A;  4JV1 A;  4DF8 A;  1B99 A;  2DR5 A;  3R7N B;  2E7X A;  3MMA A;  2YXL A;  3MED A;  2J0S D;  3CCJ S;  1MWQ A;  2BQU A;  3HD2 A;  3EIC A;  2VBY A;  3ZZO A;  4PQU A;  1RHR B;  3RR7 A;  3B82 A;  5LMU J;  5CAB A;  2EFV A;  2Z2Z A;  2Z0G A;  3BSO A;  1YWX A;  1HNI B;  3PJW A;  4OHX A;  5E3C A;  3M2R A;  1PSD A;  1UMJ A;  3OSN A;  1F5A A;  2KFZ A;  3TAP A;  4QWD A;  2C3M A;  2G9O A;  2AEF A;  1REV B;  3CGI A;  3CNQ P;  2HHV A;  5JJB A;  5EN1 A;  1WC3 A;  1UEV A;  4OHW A;  1FXD A;  1N6Q A;  4KGZ B;  5BXI A;  4ZPB A;  4B02 A;  3MPV A;  4B9T A;  2BR0 A;  2DRD A;  1BQN A;  2PT0 A;  2GC8 A;  4NCB A;  1LW0 A;  2CG8 A;  1LK7 A;  4WFY A;  4Y6I A;  4DFM A;  3D0G E;  2VA2 A;  5H9E K;  2QL9 B;  3TZX A;  1X5S A;  4WCE Q;  1RKJ A;  3FEX B;  1CJK A;  1PC5 A;  1N4L A;  4RNN A;  3N6L A;  4O4R A;  1S1W B;  3AQP A;  2VC1 A;  4WZM A;  4ZVS B;  3NMR A;  3OLA A;  2BJ8 A;  3QLH B;  3D28 A;  2XC9 A;  2LDY A;  1T95 A;  1PYO B;  3AY0 A;  5HAT A;  5B08 A;  2N3O A;  4A8W A;  3KLG A;  1S5Z A;  4H4K C;  3SEO A;  1ZA2 B;  2IM0 A;  5T7L B;  3FBB A;  3SCJ E;  4B08 A;  2NPI A;  2RB7 A;  4OHV A;  1BQX A;  3BS9 A;  3K59 A;  1IUJ A;  3H0P A;  1D3W A;  3GFZ A;  5GAH U;  1K44 A;  3O5T B;  4U95 A;  1HNZ J;  1ZA1 B;  3R7B B;  4LR7 A;  3DRS A;  2FLP A;  5F3Z A;  5KFR A;  3P96 A;  2CNO B;  1ARO P;  2XS7 A;  3KHG A;  5D15 A;  1OYD A;  5L9X A;  5HK4 A;  3FQL A;  2G0I A;  3HFZ B;  3IWN C;  2R3V A;  2YQ0 A;  1LWF A;  1FX4 A;  4WE1 A;  3NBP B;  3VVT A;  4PQU B;  1PO6 A;  5L8R C;  4QW9 A;  1HR0 F;  4YOE A;  1LWC B;  3KK2 A;  5GAD U;  5LSR A;  4U9R A;  5AE3 A;  2ZVS A;  4BBY A;  2HHS A;  2ABY A;  1X0F A;  3K5P A;  2UXC J;  3HDS A;  2DIT A;  2K7J A;  1ZPV A;  1U02 A;  2CQ2 A;  4TU7 A;  1YTY A;  1YJ9 S;  4Z7Y A;  2D3O R;  4DR6 J;  5LJ3 Y;  2ZH2 A;  2AYG A;  2GGP A;  5ETP A;  2RHS B;  4OYZ A;  3S1T A;  4A48 A;  1JK9 B;  4A8X A;  4QIG A;  1VQ8 S;  3B4M A;  3UNG C;  4OJ1 A;  3C8Y A;  1FD2 A;  1V3R A;  4X4R A;  1ZM4 A;  3HHL A;  3QT6 A;  4C8L A;  2RU9 A;  2DH9 A;  3JTO A;  2V8G A;  3C14 A;  2DK2 A;  4OIX A;  4IR9 A;  4K4X A;  4LMZ A;  2ATL A;  3P6Y C;  5IOL A;  4HH0 A;  1FDA A;  1SC1 B;  3LP1 B;  4RU2 A;  1XIQ A;  1HWJ A;  1NSP A;  1NJI T;  2FZK B;  3I4H X;  3LWM A;  1EP4 B;  2YNI A;  2XG8 A;  4N77 A;  1NDC A;  3MEC A;  1KSP A;  1FRM A;  5GME A;  3NGT A;  1U1K A;  2Z2M A;  4LF6 J;  3QGI A;  1BY9 A;  4ERD A;  1K1Q A;  2BJ9 A;  4FNI A;  3CMA S;  4W92 B;  2XY7 A;  4LSN A;  4U7U D;  2L9W A;  1H3D A;  4CLU A;  1G3O A;  5KFV A;  3IO1 A;  4C2M A;  1NLK L;  2H4Y B;  4L3N A;  1EX8 A;  4AL5 A;  3OQ2 A;  5B0F A;  2LQB A;  1HMV A;  4N47 A;  2R8K A;  1VHI A;  1PJ6 A;  3VVU A;  5ETR A;  3HVR A;  1KVI A;  4TKT A;  2RE1 A;  2NSC A;  2MJU A;  1U47 A;  1LW2 A;  1YIJ S;  2Q43 A;  1GTE A;  2ACM A;  4GVL A;  3FC9 A;  5KFB A;  3PYF A;  2MB0 B;  3DOK A;  3OR1 A;  4Q2L A;  4DMZ A;  1Y10 A;  3T3F A;  3UO0 A;  2EBG A;  2JEG A;  1QE1 B;  1DFD A;  1HNV A;  3HSJ A;  4MTP A;  2JEJ A;  4V19 J;  4HT5 A;  3UD4 P;  1FJE B;  1G4C A;  2HBR B;  1BQM B;  2QFJ A;  1S0N A;  3MM8 A;  3EZO A;  2C2K B;  2QSW A;  4USK A;  4F2R A;  2MZR A;  2QLB B;  4PXE A;  3OXG A;  4BHQ A;  5DZ7 A;  2B5J A;  5ADZ A;  4P7T A;  3SSQ A;  2HLU A;  3GIJ A;  2WBR A;  2F9J A;  5KT5 A;  1O8B A;  1BWE A;  2PII A;  2XCA A;  3PR5 B;  3N6M A;  1HWL A;  1FJG J;  5K5M A;  4JI3 J;  1S79 A;  5KFL A;  2RF2 A;  2EFG A;  4QYZ J;  5KG3 A;  5GAE I;  3F56 A;  2YKA A;  2K8G A;  2YNH A;  3CVK A;  4DLG A;  3N79 A;  1TAQ A;  4PXB A;  1RHU B;  5F8M A;  1R8P A;  4F26 A;  1RTZ A;  1UEU A;  2AGP A;  1N5Q A;  1QD1 A;  4PYD A;  3KLV A;  2HNY B;  3AFG A;  1VHF A;  2U2F A;  5SZT A;  3HHL B;  1HWK A;  1TL4 A;  3DRR B;  3C14 B;  2E5I A;  2YX4 A;  2UXB F;  3KMS A;  3MUT P;  1TKZ A;  3ELH A;  1RTI A;  4FYD A;  3OVA A;  2J7U A;  2YNI B;  2VBX A;  3UD3 P;  4OHY A;  5E3P A;  1SCJ B;  2HHP A;  3TUP A;  4RBT A;  1NJY A;  4Q2M A;  3GIM A;  1TV6 B;  3ZTO A;  2H3E B;  2BE9 B;  2VQF J;  4MYU A;  2C2Z B;  4UOH A;  4MK9 A;  3PX6 A;  3IA0 A;  1T0T V;  1IKW B;  3US5 A;  3UR3 C;  1YJW S;  3H4D A;  2QLF B;  3M6U A;  1U6B A;  4QW8 A;  1RSC A;  4DN9 A;  2HRT A;  2DPJ A;  1KR4 A;  3SV3 A;  4DSE A;  1WC4 A;  5IZH A;  5J2P A;  1N0U A;  2VB6 A;  1KTQ A;  1JJC B;  4C8O A;  1CS4 A;  3RRH A;  2RKI A;  3KTQ A;  4HH1 A;  5D0R A;  2B8P A;  5LT5 A;  5KFM A;  3C3L A;  3TJ9 A;  2BE2 B;  4KFB A;  4DR4 J;  3HHD A;  4NYP A;  4W98 A;  3MMC B;  1WF1 A;  1YQH A;  2XNR A;  3D67 A;  2MHN A;  2UXD J;  1RAB B;  1HA1 A;  3R1H A;  1NO8 A;  2YWE A;  3G86 A;  2ZJP Q;  3ITH B;  3OXL A;  3GG0 A;  1SKS A;  1VK3 A;  4XIU A;  2PDA A;  4DR2 F;  3LO3 A;  2NYI A;  1FKP B;  2WAQ D;  1QDU B;  4DCJ B;  1AFI A;  4HDG A;  1CJT B;  4DSI A;  4RW7 B;  2RF2 B;  4CH7 A;  1FEE A;  4DUZ F;  1KOO A;  4F4X A;  8RUC A;  3POT B;  2RHQ B;  1T11 A;  3DLL Q;  2VPX B;  4ZIT A;  2Q6B A;  4HR2 A;  2VBW A;  2C2E A;  1U49 A;  3KHH A;  2MGZ B;  1ICE B;  2D69 A;  3G9C A;  4DL5 A;  4DV0 F;  3NG8 A;  3B54 A;  3T41 A;  1SJF A;  2QMW A;  3KG0 A;  4H4M A;  1WC6 A;  1MNE A;  1LWX A;  2F5G A;  5K9F A;  1BHN A;  4Y34 A;  2MLZ A;  3HD1 A;  2BUN A;  2J0X A;  2RNE A;  3ET6 A;  2ZHO A;  2HNZ B;  3D6F B;  2VV5 A;  4RUA A;  2ZH3 A;  2WB1 D;  1WEY A;  4O4G A;  1T9X A;  1LV5 A;  1YJU A;  4JYA F;  2HQC A;  4MJK A;  3IC1 A;  1WD6 A;  3LP0 B;  2HBY B;  3AH6 A;  3PXG a;  4RZR A;  1UFL A;  1C4A A;  3JSY A;  2ZBQ A;  1YJ7 A;  1KFS A;  1EET A;  3TNV A;  1F1B B;  3THV A;  3CD6 S;  4YFU A;  4KBI A;  1BUX A;  2HWH A;  2ZBP A;  4IOC Q;  3FCH A;  4NLS A;  2P6T A;  2CPZ A;  1Q4R A;  3EX7 B;  1FE4 A;  1FX2 A;  3CJ8 A;  2MQP A;  3BR8 A;  4AQY J;  4WTO B;  3OXF A;  3E2E A;  2BDP A;  2YNG B;  1WHW A;  1RAH B;  5GMK a;  4DQQ A;  3MTK A;  4EBE A;  1UVI A;  2ZUA A;  4KH0 B;  3CW2 C;  2KYX A;  3R6G B;  1W25 A;  3M05 A;  4ZVR B;  1IBC B;  1FO1 A;  2N4D A;  4FYV B;  4ZK7 M;  2OTL S;  2OPR A;  4JI1 J;  5C24 A;  4FVM A;  4S0M A;  2OPS A;  1KQS R;  3MD3 A;  4ZN3 A;  1P6T A;  4M5D B;  2XYG B;  1V5I B;  3PFE A;  4DUY F;  3LAL A;  2CDQ A;  4ZIV A;  1HKA A;  3RR8 A;  4CDI A;  3UPF A;  5HJY A;  2I1R A;  4DR5 J;  4N76 A;  3A3P B;  4GC6 A;  5HN0 A;  3D5M A;  2W7O A;  3MM5 B;  2DNG A;  4K5S A;  1I1G A;  3OPK A;  2KXF A;  4I2P B;  3KK3 B;  3MTJ A;  4C8Y A;  3MCS A;  2XCP A;  3EZU A;  1YBA A;  5CYJ A;  3HSZ A;  3D68 A;  4NLD A;  3QZ7 A;  3D2W A;  1AXQ A;  3H5Y A;  5F0W A;  2BJ3 A;  3VTI A;  3IR7 B;  2OEM A; 
#chains in the Genus database with same CATH homology
 2W2Q P;  3GCW P;  3WIU A;  3GCX P;  4NE9 C;  1R6V A;  3BPS P;  3P5B P;  2Z2Y B;  2Z57 B;  3A3P B;  3A3N B;  3A3O B;  2W2N P;  2E1P A;  2Z56 B;  1SCJ B;  2Z30 B;  3T41 A;  2ZWP A;  4JP8 A;  2PMW A;  3CO0 P;  3WIV A;  2QTW A;  2XTJ P;  4NMX A;  1ITP A;  3H42 A;  3QFH A;  3CNQ P;  2Z2Z A;  4OV6 A;  3BGO P;  1SPB P;  2W2P P;  2W2M P;  4K8R A;  3SQO P;  4YN3 B;  2Z58 B;  3VV2 B;  1V5I B;  3WHI A;  3VHQ A;  3AFG A;  2W2O P;  2ZWO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...