1CJKB

Complex of gs-alpha with the catalytic domains of mammalian adenylyl cyclase: complex with adenosine 5'-(alpha thio)-triphosphate (rp), mg, and mn
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
201
structure length
190
Chain Sequence
LYHQSYDCVCVMFASIPDFKEFYTESDVNKEGLECLRLLNEIIADFDDLLSKPKFSGVEKIKTIGSTYMAATGLSARQYMHIGTMVEFAYALVGKLDAINKHSFNDFKLRVGINHGPVIAGVIGAQKPQYDIWGNTVNVASRMDSTGVLDKIQVTEETSLILQTLGYTCTCRGIINVKGKGDLKTYFVNT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ADENYLATE CYCLASE, TYPE V
publication title Two-metal-Ion catalysis in adenylyl cyclase.
pubmed doi rcsb
source organism Canis lupus familiaris
molecule tags Lyase/lyase/signaling protein
total genus 59
structure length 190
sequence length 201
ec nomenclature ec 4.6.1.1: Adenylate cyclase.
pdb deposition date 1999-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00211 Guanylate_cyc Adenylate and Guanylate cyclase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1230 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleotide cyclase 1cjkB00
4WPAA 4OZ3A 4OYXA 1WC3A 1WC0A 4OYIA 3UVJA 1FX4A 4OYOA 5D0EA 1AZSA 1CULB 1YK9A 3C16A 1WC1A 1CS4A 1TL7A 4OYPA 5D0GA 2GVDB 1WC4A 4CLSA 4OYWA 3C14B 4CLYA 5IV3A 1CJTB 5D0HA 4CM0A 4USTA 3MAAA 3R5GA 3MR7A 4P2XA 2GVZA 1CJKB 3C15B 4OYAA 1AB8A 4USVA 1WC6A 1U0HB 4CLPA 3G82B 1CJUA 1CJVB 4P2MA 3ET6B 4NI2B 2QV6A 1FX2A 3MAAB 4WP8A 4WP9A 3UVJB 4CLKA 1CULA 1AZSB 3C16B 4CLZA 1YBTA 1CS4B 2BW7A 1TL7B 2GVDA 3C14A 1CJTA 4OYZA 4CLFA 5IV4A 4P2FA 4CLUA 1YBUA 4OYMA 2W01A 5D0RA 1Y10A 4OYBA 1Y11A 4WP3A 2WZ1A 5D15A 1CJKA 4CM2A 3C15A 2GVZB 4CLTA 4CLWA 4OZ2A 1U0HA 3G82A 4USWA 1CJVA 3ET6A 1WC5A 4USUA 1CJUB 4CLLA 4NI2A
chains in the Genus database with same CATH superfamily
1XMBA 4EWTA 4ID5A 3FRYA 3PV8A 3KLVA 3C19A 2V67A 4B3OA 1FDAA 4UW2A 2YNIB 1ITPA 5KFFA 4K5SA 3HHLB 1S57A 4ED2A 3MUVP 2UV8G 2GQQA 3T9ZA 3I5BA 3CJ3A 2VG7B 3G8SA 4ZVFA 1R8CA 3PVXA 2W9BA 5HMYA 1RCOB 5L39A 4RW9A 2L9DA 1VDHA 2DPJA 2IDLA 3D0IE 3M8SA 2JOQA 3HX9A 4NX9A 2RE1A 2C2EA 3UCZP 5HATA 1AZSB 3DI6A 1PJ7A 3K8VA 1HPZA 2AX0A 1MSWD 5JVHQ 2OPSA 1NK5A 3FBEA 3Q8UA 2B43A 3KK2A 1Q53A 1OQ3A 2R7OA 3R2CJ 3GSDA 2IVMA 2FZCB 1XNQJ 5BXIA 3BEGB 1SL0A 3TUZC 2EFGA 2MJUA 1WJ9A 2JSXA 5EWEA 4IO1A 3HXMA 1GTEA 4UOCA 3C16A 1Y00A 2QEXS 2ZH8A 4HACB 5E5NA 2KXHA 2VFTA 4JV2A 5DLGA 3KLFB 4C48A 5M2UA 3R7BB 3CMES 2FJXA 2ASJA 1T8EA 3A8EA 2J5AA 1PC5A 1WTBA 3FFIB 1NK0A 1NK9A 4OV6A 3UWTA 4XAKA 1EHWA 1NHUA 1TL5A 1EP4B 3QGPA 2NLWA 1U4BA 2EI5A 3MEDA 4U8YA 2HNZA 1LWFA 2DGSA 3I32A 2RRAA 4WKRA 3ILJA 1LNQA 2UUAJ 3FUYA 5HQMA 4EBCA 5D0RA 1OY9A 2UXCJ 5CYMA 5A8RB 1LW2B 1HHQA 1L3SA 4OX8A 4B9NA 1EIYB 1NDKA 1Q16B 1Y3KA 3DMJB 1Q1KA 2EFQA 4DQRA 2GIQA 1M90T 1PYTA 1TVRB 3FBBA 4AE5A 1C1CA 4U6PA 3T5KA 1YJWS 1WC4A 5CZXA 3OR2A 1MMNA 1X4HA 4A8XA 1YJVA 2CQCA 2BW2A 2CJYB 3I5AA 3MAAA 1RBAA 4PG5A 1FK9A 3SSRA 3G6YA 4CO2A 3MEEB 3NAHA 3ZFVA 4USVA 4ZVSB 1FVSA 5HBMA 1U0SA 3JYTB 4OZ0A 4K4SA 1NSAA 5LT5A 4DPTA 1X8DA 1HWUA 1RTJB 3W65A 2CPYA 1VQ7S 4WZMA 2H5JB 3AOAA 4RNFA 3BYRA 5DLFA 3MEKA 1U1NA 3R97A 1GNKA 2C2OB 4Q0BA 1S9EA 3MDFA 3MCNA 1VBXA 4I1TA 1E6VA 4ETZA 3BQ2A 4JI6F 3CTRA 8RUCA 2B5JA 5IQQA 2RQKA 4EGLA 2OTLS 3OFGA 4OZ2A 3TEGA 3CCMS 2V34A 1V9OA 1IBLF 5E7OB 4R0EA 2R8IA 3K89A 2UUTA 5E3RA 2J6UA 1SKRA 2KT5A 3M2VB 3QAEA 4YP3A 2RVJA 3LAKA 4LBHA 3WC2A 1HR0F 1R6VA 3CVKA 3GZ7A 3EZUA 2UU9J 2DNHA 1NK6A 2DXFA 1FDNA 3LTOA 1BXNA 1VRQC 3NNAA 4WU2A 2E5JA 1CJVB 1U8WA 4N8OA 3MECB 5B0FA 5HMZA 2HFOA 2OGUA 3PHEA 3MHYA 3BPDA 2MQ8A 3CDAA 1FKPB 5E2QA 1F0XA 1T95A 5KT2A 5J2PA 2M5YA 4FBUA 4M63A 5L1IA 3R5DA 2OPQA 1UMJA 2MZ1A 1QUPA 1VQNS 1VRTB 4C11A 3MM9B 3DLHA 3LF0A 2MY7A 4DDFA 1RT1B 2C2ZB 4NEZA 3FZBA 5KFPA 3CB4A 1S4FA 1ZA2B 1K1SA 1NRKA 4I7FA 2RNEA 1QJHA 1M5KC 2OFGX 3TUJC 4UY8T 5H9EK 3PHTA 4EO6A 1S4EA 3KJQB 2M7SA 3HFKA 4LF9F 3LGNA 4LSLA 4M5MA 2HQIA 2OHDA 3BV8A 1ZM3A 3MURP 2BZ2A 2FZKB 1RWUA 3EPIA 5A2QU 3OT9A 2E1AA 3HSDA 3RB4A 4DN9A 4PEOA 3KMSA 1I1GA 1M0SA 2GGPB 4Q8EA 4USHA 5BR8F 1RT2A 2DT9A 4B9MA 4YB6A 4USIA 1M1HA 3QWUA 3WX8A 1TKZB 4N77A 1E6YA 4QU6A 4ZPTR 2VPZB 4DV7F 3NKYA 1TAQA 4LF5F 4JI0F 3NGRA 2VOOA 1UEVA 3MPVA 4ILMA 3D1QA 2PMZD 3QJJA 4FXDA 5ETKA 4DUYJ 3FZ2A 4K59A 1RCXB 4LRDA 3MR6A 2I38A 1PKUA 1UJ6A 1SC1B 1C0TA 4UZBA 2FY8A 3NMAA 4X64J 2QIFA 4ILRA 4OHXA 1QLNA 4A8WA 4LF6J 1C1BA 2QMUB 4KR0B 2OFHX 2ILZA 3SCJE 2K1RB 3EM1A 4WE1A 3LP0B 2Y1IA 5DDRC 1RU2A 1SB6A 3QMQA 1NDLA 1WORA 3BJYA 5KOXA 1RAGB 2E5HA 5E0OA 4WTYA 4BWJA 3WIVA 3CCJS 4HH1A 1KN6A 1VC0A 1JKHB 3W60A 3T19A 2XNQA 1LWCA 4LRBA 5FDLA 1TQLA 1Y3JA 2BE2A 4N5SA 4KSEB 4ZVGA 1FFWB 1KONA 4F8RA 2RDIA 4FPRA 1PCAA 2DHAA 4KHPJ 5IV3A 1N56A 1UFKA 4OX9J 3POTA 4Z2XA 4EBEA 4HT5A 2H48B 2MZQA 4URQU 1CC7A 4P7TA 3R3TA 5DM7Q 4NZ6A 1GXTA 5L9NA 2KO1A 2XZTB 2JC0A 3GIJA 4F36A 5F8MA 1IUJA 4NA2A 2CNKB 1VCTA 4KV8A 4PUOA 4WP9A 4JI7F 3HHKA 1LW2A 3TP2A 3G6ES 1H98A 1SPBP 3QFHA 2F8EX 3M2RA 2XGPA 4ZJOA 4DLEA 2HNDB 4QQBA 3D7SB 1XK8A 2ATCB 1YTYA 1VQMS 2W24A 3SBMA 2ZM6F 4M5HA 1YI2S 1IWAA 3RGIA 2ILYA 2HPUA 3L9ZA 1X7VA 3TEHB 5DZ7A 2LYVA 2YKQA 2FJBB 2Q1LA 4DUZJ 3SCKE 4DV6F 2GO8A 3JSMA 4A8YA 2V63A 3KJNB 2IMWP 2W7AA 4A48A 4CM0A 1HWJA 5K8OA 3IAM9 3BKUA 3O6QA 2CQDA 1IKXB 3MMCB 2YNGB 1IR1A 3IA0A 2IAJA 1TKTB 4DQSA 2KZMA 4YOEA 4RPFA 3W5YA 2RU3A 1CJUA 3D4JA 4GKJF 1MMDA 2O67A 2GHPA 5KFWA 2A3JA 2V2QA 7FD1A 1UW9A 1N36F 2HFZA 3JTOA 2XYHB 1I5OB 5T7LB 1OPZA 3QO9B 3OJSA 2W01A 1Y5NB 2UUCF 5I42B 3DRSB 3M6UA 2EWHA 2D3UA 3J7A1 4DS5A 2JVRA 4YDDB 2PO4A 2FVCA 4O3OA 3GG1A 4ED3A 5EWGA 2CJAA 4G65A 2V4QA 2V6AA 3ZZZA 3LP2B 4Y2MA 3M8PB 3Q24A 2MQMA 4C98A 3CJ2A 1WC1A 1FT8A 2XULA 1JQGA 3GCWP 4DWIA 4CLYA 1R3NA 1RXOB 3GMGA 3MECA 4JI1F 4J9KA 4KGKA 4WFXA 4F4ZA 4W90B 3RBXA 3CO0P 4FF1A 1LXJA 1N48A 3ZZYA 3K58A 1N6QB 1DAXA 2AJ0A 3WX4A 2DH9A 3VZHA 2GAHC 4D3HA 3UI3A 4PRFA 3MM9A 2I5JA 1FRHA 3A13A 1HARA 2P6SA 5L38A 2BQRA 2I8EA 1CG2A 2YX7A 3EDRB 1T03B 4KPYA 2HBRB 3N6NA 5IT9Y 3TZWA 2QC3A 3DCAA 1KBRA 2ZZTA 4NLTA 3JSRA 1RKJA 4LFAJ 5BYQA 1U1PA 3QLHB 3DRPA 4ZDNA 4KTQA 3HHLD 1NH8A 2J9DA 4M8LA 2V69A 1NZ8A 4ZITA 2X1BA 1XC9A 2EK1A 2B7BB 4MKYA 1S1XB 4FS1A 4CO0A 5HMXA 1NU4A 3T1HF 4MKVA 2KI2A 5A0YB 1CEZA 1S1VB 3MM8B 4IDKA 2RKIB 4X84A 5EGYA 1SCJB 4MYUA 2Z0GA 3M2UA 3QWPA 2OPRB 2IRXA 1HWKA 1EQ0A 3FVYA 3KK3B 4IOCQ 1YDLA 1NDCA 4ZS6A 2C28A 4CM2A 5IZHA 4ECWA 3FKBA 2LCWA 3EVOA 4BC7A 3EICA 1UKUA 2AWZA 3CT9A 2MGZB 2QJ3A 1HD1A 3O5TB 1KQSR 3ZC4A 3RB0A 5KTQA 3MEGB 3J7AN 3US5A 2GA7A 1TU0B 1MROA 4NLDA 1TK8A 4W92B 2NCKL 5DO2A 5IWAF 2QLWA 3DOMA 1N5YB 3HJVA 3W2VB 1Z2LA 5F0UA 4C8OA 1XEZA 1B3TA 3EGWB 2AIRB 2UUWA 3HF5A 2W2MP 2AYMA 2QV6A 4QIGA 4NLPA 4CNZA 4WJBA 2UVWA 5LMUJ 4RUBA 2VFVA 4MH8A 5L1KA 2V2KA 1N33F 3MAHA 1CS4B 3S6EA 5A8WB 2DISA 2W4DA 2LFVA 3I4HX 1WEXA 1TFYA 2Y9HA 1D9AA 3AOCA 4CLFA 3KLHB 1ZH5A 2R2TA 3CIMA 2C22A 5IOLA 5HANA 2HYIB 3D0GE 4TQRA 3WC0A 1LOUA 1TUGB 5JVGQ 3JTNA 2VFSA 2YTCA 2OEJA 1G4CA 3HO1A 1G1XA 3K5LA 1HBUB 2OEKA 1RBLA 3DLGA 4RJVA 2VFRA 5HROA 2AMCB 1S59A 3PYFA 2MSSA 4OYAA 5LSLA 2BM1A 3ENQA 1SC6A 4XTTA 5DG7A 4WCEQ 1I51B 3DDKA 2ZKUA 2RQMA 4IG0A 3LP1A 1PBAA 2ZBCA 3CDUA 1OYEA 1IBMF 1B99A 2KXNB 2XS2A 2IC3B 1EETA 2GCFA 2KM8C 2O66A 3PX0A 4LQ9A 4ZVQB 5C25B 3TOQA 3SCIE 4UQGA 2BRKA 5CA5A 1U1MA 2HLUA 1IVZA 2F9DA 3TA0A 4J9SA 2R7RA 5ETLA 4JB8B 2DH8A 2DGXA 3HZGA 3CMQA 4B9SA 2OMOA 2M8DB 2YQ3A 2VC1A 3B82A 1L3KA 2DB1A 3D2WA 3MCMA 3C66A 3S7RA 2E9RX 4ZPVR 1FJGJ 4H4KA 1IBKJ 1HWLA 2BOAA 1JMTA 4BHQA 2PFFB 2CQIA 1Q0NA 5MLCV 2JEJA 2BOPA 1TV6B 4K0KF 1SQGA 2W4CA 4A8KA 4UUWA 3GFZA 1DFDA 2WTFA 3QSYB 3J7YU 1FA0A 3EYZA 4C3LA 2EBGA 1S5ZA 3UE2A 4DR2F 2UZAA 3CJKA 3Q2TC 2QE5A 3UN5A 4PXBA 3HD2A 4RZRA 3T6JA 3ZTRA 5IV4A 1UA1A 1U02A 3A3NB 4QU7A 3N79A 1S9GB 1QVGR 2F9JA 2QYCA 2V2VA 4WZQA 1NSKL 1DARA 1EKRA 2LQJA 3CMAS 4KO0A 3K5OA 2DH7A 3MR2A 3B78A 4IQMA 1QUVA 3UFCX 2Z56B 4DR7F 3IRXB 3Q86A 2FTRA 4A8OA 2BV3A 3JQJA 3V81B 1JLQA 3H2UB 4DL3A 1RLCL 2NSCA 3QQCD 2XMTA 4DCJB 4B3RJ 4ZJQA 4DR3F 3VR1A 5KG7A 2E5LJ 4Q44A 4OI4A 4S0MA 3RRKA 2PEBA 1T11A 4DI6A 2GV1A 4HLBA 1RAEB 2V4JA 1DHMA 2CZ4A 4J9UE 1YX2A 4ED4A 3CXCR 3PIPQ 3RB3A 5GAGI 1UWBB 2G2YA 2R7VA 1I6JA 1CJTA 3UR3C 3B4DA 3CE8A 1S1UA 4C9DA 5J1EB 1TL1A 5L8RC 4DSJA 4PG8A 2V94A 3J81Y 3DLKB 2WOMB 1X4DA 5F8NA 2Z2ZA 3P8BB 3D5MA 3CO9A 2QLJB 1IBCB 1UVIA 4F67A 5D0EA 4NYZA 3H25A 1RWNB 4LVOP 3MPWA 1PAEX 4O0NA 2HQFA 5D0HA 3X3UA 4X65F 4YEAA 4I64A 3MI7X 2CVEA 2PA3A 4IUFA 4P73A 3DOLB 2XHCA 3E51A 2D41A 3R1LA 2MZTA 2EEYA 1F9EB 4DV3J 4IO9Q 2HK3A 4KT0C 3ENVA 4C97A 3C46A 2MQQA 2JHEA 5GAEU 2NYIA 2QFIA 2YKAA 2XSJA 3KK3A 1SIWB 4WWSA 4ETXA 3SDEA 2XLKA 3K8WA 3EZ5A 4ZPDA 3KDNA 2D3O1 3ISNC 2NUHA 2AT1B 1I94J 1FNOA 4KIAA 4DG1A 1XERA 4I6WA 4PG4A 2KJVA 4J9QA 1RUSA 3PG9A 3I0SB 1AXQA 2C3UA 2Z2MA 1RHKB 1T9WA 3RBZA 4F3OA 4IRKA 4R25A 2CIMA 2N4CA 4IFVA 4QWEA 3BPSP 3WDOA 1PSDA 1N5YA 4FN5A 3UVJA 1N5TA 1FE0A 4P75A 3KXDA 3I6PA 2UP1A 4ED1A 2IM2A 1RP5A 3VGVA 1CBKA 2YH1A 1YIJS 1WG4A 3BR8A 4ZCMA 4X4SA 2EG1A 3ZZ0A 2GIRA 2R7XA 4GO7X 2W9AA 2DCLA 3L7PA 3GP9A 1VHIA 3CPWR 4HI2A 5IFMA 1JXLA 4B3TF 2B8QA 2IJRA 3VGSA 4DF8A 3UD4P 2JJ4D 4H4OB 3C8YA 4OL8A 3PW2A 2LECA 3IP0A 3IXQA 4UF4A 1X5TA 1U47A 2UXDJ 4OZNA 3MUMP 3H0PA 2V50A 1EARA 2LQBA 5KG3A 3NWRA 2VF3A 1N5SA 1U0HA 1DQAA 1S10A 4DOZA 1BY9A 3KUHA 3VCDA 3DN9A 4P74A 4WPAA 2E7WA 4HT7A 3OR1A 1MWQA 2UUCJ 4XK8C 4ZPAA 4OHZA 1WELA 2UVUA 5KOWA 1NJXA 1NJWA 5D3GA 3TO8A 5C24A 2HQ3A 4K4YA 1RWOB 2OAUA 4I6YA 2GVZA 2FHKA 5HP1B 3BSNA 1R0AB 2X1AA 3BSOA 4B9VA 2FHJA 1ZM4A 3M8QB 1MN9A 3GONA 3C2PA 5L1LA 4WP8A 3NMRA 1X9SA 3MF5A 2W2QP 2UVRA 3DOKA 5KFLA 4TYAA 4ZVHA 2DGTA 2RS2A 2DNOA 2VA2A 4RBVA 1Q8IA 1RJJA 1RA7A 1NLKL 4OFZA 2YKMA 4J37A 4PXDA 1VLOA 3ZO7A 4U96A 3CCSS 3OV7A 3JB9k 1VS3A 4WBFA 1YWXA 3TNVA 4P10A 4RU2A 1N32J 1W7WA 3PEHA 1REVA 4ZK7M 3NXZA 1XR7A 3A8KA 2GMJA 2VJVA 4O4GB 2WW8A 2LA4A 4LBIA 4ERDA 1TAUA 3J7ZT 4Y3CA 1VQOS 1RT5B 2MHNA 3AAWB 4E0DA 2O5DA 2GQCA 1NKCA 4CP5A 1ZTTA 2ACMA 3DM2A 2BJ1A 3QNWB 2DNMA 2RUGA 2LEBA 1GEHA 5LMNF 4DXLA 5ETSA 3D9BA 3CNQP 5FIIA 2K7JA 3TW0A 3ILOA 1U1KA 2HNYB 2KM8B 1RA6A 2M52A 1R8BA 1S48A 4DV4F 1QD1A 3UNYA 1YITS 3L7OA 4N8NA 4NOHA 4CLUA 1NM2A 4LRFA 1EQMA 3M6WA 3MFIA 4JV5F 5CHCB 2PFDA 4MYTA 2NSBA 3V81A 3QFWA 1GX6A 1J5OA 3NBPA 2NXUA 2YKOA 3P49B 3PXGa 1AFIA 3M30A 2B7CB 1R8HA 1MU2A 2IFXA 2MKIA 1QAIA 3K17A 1LEOA 2G0CA 1HI8A 3GV5B 3DDIA 1S6QB 2GHWA 3RRGA 1NSQA 4RW4A 3NLCA 5KT6A 5KFVA 3M32A 3TX8A 2A1BA 1HNXF 1YGYA 1KTQA 1RT4B 1U24A 2UXBF 2VPYB 4M5DA 3I31A 3VHQA 3GILA 4A8SA 3NCRA 2DGWA 4B3MJ 3G9CA 4A46A 1U7LA 2ADCA 4I69A 3H98A 4OJ3A 3ZTSA 2CQPA 3TARA 4DV5F 2X3GA 2ZH3A 2EW9A 1KFDA 1UTAA 1M5PC 2GIFA 4DLGA 5KFKA 5KT4A 4CTAB 3TX0A 3QGGA 3OSNA 2B6AB 3M9OB 2HRUA 2ZDPA 3V6DA 3QIPB 4FF4A 3BGRB 4B3SF 4TY8A 3H42A 4X66J 3BDPA 1Q79A 2OD6A 4M5NA 4MMOA 2NQPA 5IT9U 1V5IB 1HBOA 5LJ3Y 4K4TA 1W2IA 2YWWA 4OIXA 4OI1A 3GIRA 4DFKA 1X4BA 2XZDB 3PCOB 5F8IA 2BE9B 2PT0A 2ZBPA 2ZWOA 5DDPC 4JI2J 4F2RA 4ZN3A 1SH2A 3LWLA 1VRUA 3C6TB 4OMFG 3CCZA 1IKYB 2G0IA 2MQOA 3N5BA 3TVKA 3G71S 5AXLA 2HHHF 2XMMA 2J0XA 3QT6A 4FVCA 3Q8YA 1R8AA 1G7CB 2YNHA 1LXNA 5IXUA 3J80Y 4JI3J 3IBCB 2AP6A 1RT7B 5DQHA 2F8HA 4WFBQ 2D9PA 1WTFA 4O3QA 4ZPBA 3FRZA 2C3MA 1QDUB 3DLBA 4ZLNA 4UOHA 2I9SA 3O1LA 3RZAA 4DHVA 1S0NA 2MY8A 2JEFA 1Q86T 1RT6B 2DNPA 2LKZA 4ZCIA 2R2SA 2AYBA 4PXEA 2W7PA 3N5FA 1K44A 4Q5VA 3JSYA 4MKAA 4NL5A 1VFJA 2J8SA 1MN7A 1S7HA 2YQ0A 4OHVA 3OUYB 2J9CA 3S8SA 3R7SB 2BACA 1AB8A 4C3KA 3DRRB 5J2MA 4K8RA 3G82B 2BQUA 1VLYA 3BO4A 1HBNA 4MIBA 1SL1A 1SKWA 1KEKA 2JH3A 3AD8C 4LFCJ 3HSZA 3W66A 1H2UX 3MR3A 2KXFA 3W3SA 4DL4A 1ZPVA 4TXSA 2H9ZA 2A6OA 2G2OA 2OELA 2RIJA 1YJRA 4ENOA 1XJWB 1YZ7A 4WYWA 1C2PA 1H6KX 4Y34A 3N6LA 3MPDA 4Q45A 1DY3A 5T41A 3M1VA 2Y0BB 3MM7B 4YY3J 3DDNA 3T5HA 4DR4J 1YHQS 3G4SS 2OKQA 2YWKA 2RF2B 2NR0A 4ZHRA 5ADZA 1WNEA 2YKNA 1R27B 4B02A 2ASDA 2G13A 1R0BG 4AT1B 3PZPA 2OPPA 3WBZA 3K0JA 3R6LB 5AJ3J 4MK8A 1WOOA 3OSPA 4A8FA 2HIQA 1FD2A 2W9CA 1DTQA 3GJQB 2GJFA 2DBBA 2ZITA 2W1BA 4NWBA 2XMUA 2FLNA 2PE8A 2HHWA 4DFJA 2RB7A 3O2IA 1HWIA 2HHQA 1NB2A 2JC1A 1B0VA 2OUGA 5IM0B 2O1PA 1VJQA 3T5LA 2MTLA 3OHAA 4KB7A 3OFEA 2YNFB 4LMZA 3WHIA 2YPYA 3CC2S 4CLTA 3EGZA 3JAMY 4C7QA 2HWTA 3M6XA 3Q22A 1DTTA 2YY3A 1TMJA 5DM6Q 1NNDA 2Q6CA 5J2QB 2MZRA 4M94A 3IBWA 4FPIA 1NBEB 1Q8BA 3EXCX 4LUBA 1UZDA 4ZVRB 2UUBF 4AFFA 2ZH5A 1SI9A 1AT1B 4DR5J 4DV2J 3HFVA 3NS7B 5DG9A 1X5SA 2HQCA 3KLGB 1U1QA 4RUAA 2B4VA 4DR6F 1JX4A 5DETA 1WHXA 1VQ8S 5DQIA 1JJ2R 2H1YA 5KG1A 3IS9B 4M5KA 1NHVA 2CA9A 1FJEB 3HHDA 2QSFA 1NXIA 3I4PA 1JLCA 3VTIA 3RBEA 3I0RA 1X60A 1KP6A 2QO3A 3G2XA 4DX5A 4RWXA 3K5MA 4DPYA 1JLFB 2L9WA 3ZTOA 3E2EA 2XTJP 1O5JA 4HVZA 4Y65A 3KLIB 4P9SA 1HNZJ 1FWLA 2DEIA 1KHWA 4DX8H 4L6V3 1BQMA 4Y00A 3PKMA 1FTRA 2BXJA 3PKYA 1KDNA 2B0GA 3NOGA 1EX8A 1YRXA 4NCGB 3BH6B 3A4TA 1LKZA 1U6ZA 2QT7A 1WD6A 3W9IA 3KWMA 4DV0J 1WI8A 3HK2A 3MR7A 3W5XA 4V19J 2DKOB 3LGHA 1D3WA 1IKWB 2AJFE 3D6FB 3SMZA 1S77D 2CPHA 2CUYA 2V2ZA 5DS7A 1N34F 4AL5A 4LQ3A 3I9ZA 5KFQA 2OJ3A 2HAFA 3MM5B 4P2SA 4ZVPB 4V1Ak 4IH6A 1DLOB 1S1WA 2FY1A 4GKKF 3OTOJ 3RJMB 3O44A 3GV8B 2QA2A 1H2VZ 1K47A 1S97A 3SZ2A 1FHTA 1OIAA 1H7WA 1YJNS 4IG3B 1HBMB 4RNNA 2RUSA 1NHKL 5GAGU 1J5EF 1NK7A 2AJ1A 1W26A 1RTIB 4K7QA 3J81U 5KFEA 3CDEA 1JJHA 4KFBB 4DL0C 4UOFA 4PG6A 4NLRA 2XI3A 2QX0A 1LW0A 5D4LA 3G6XA 3TZZA 3FJ2A 3Q23A 2DGOA 1R31A 1MLAA 7FDRA 3H20A 4YFUA 2I6WA 3UQSA 3SFGA 2OTJS 1VBYA 3VAKA 4AQYJ 3HPOA 2FGCA 2JEGA 1F9HA 1UP1A 3CF5Q 4Y2KA 4C8NA 3H40A 4CLZA 5CCLA 1T9UA 1UAWA 1WEYA 2C2MB 1LWEA 1FRXA 1N54B 2ZVIA 2XMVA 5HLFB 1BQXA 1BGXT 4G1QB 3MD1A 3CW2C 4U7CA 3W9HA 4H4MA 4J5OA 1ROFA 3U1MA 4RW7A 4DR1F 1X9MA 3HHNB 4J90A 4NI2A 2XMAA 4QR2A 3HFZB 3UN2A 5EDWA 1U1RA 3OUYA 4EO8A 3PRBA 3EGNA 3FSXA 1UFWA 2ZE2A 3UD5A 2HHTA 3DRRA 4B9LA 3AFGA 3MM6A 3I55S 5LXRA 3BKTA 2FLOA 3AD7C 3IFEA 1RT3B 4ZPWR 1FTCA 2B9WA 1SJRA 4F0HA 3TJAA 5EX0A 2DIVA 1JLBB 2KVQE 4URGA 2ZD1A 2FD2A 2CWKA 4P2XA 2EKNA 3QGHA 1D8YA 1U49A 2AEFA 2Y1LB 1T05B 1TL3B 4YB1P 4O44B 2HFSA 4KKOA 3BO2A 1X0FA 5CYJA 2E9ZA 1RZMA 4CYUB 1ZBTA 3FQLA 2J6SA 1BD6A 3H90A 3QRRA 4QWDA 2P5VA 3HVTB 2ZBIA 4YHHJ 2KFZA 5C42A 2DNLA 2XSFA 1RABB 2B4PA 2R42A 2BJ7A 3JQMA 2R4FA 2CNNB 1Y9OA 2RRBA 4BCAA 1WHWA 3SQGA 1QE1A 5KG2A 2NXEA 1XNRF 4R5PB 4C2MA 4NLOA 1SQFA 1YJTA 1S0OA 2XMKA 1ZZFA 2GVDB 5KFGA 2IM1A 1ZTWA 2RU9A 2VU5A 5EWFA 3DLEB 3AB4B 5J2NA 2ZH6A 1WDTA 3NEKA 4LF7J 5M2RA 4I2PA 3S01A 2QA4G 2B4UA 2NPFA 4JI8F 1CQMA 2B9XA 5IM0A 2DHGA 5A76A 5B0GA 3DRXA 4LJMA 3T9NA 2X7IA 4GVBB 1SJFA 2HS3A 4DQPA 4UT4A 1WHVA 1IN0A 1VYAA 4ES2A 1BQNA 2BABA 3FBFA 2XQCA 4RLEA 1HLWA 2HFNA 2W4PA 3EE3A 3Q89A 1VIOA 5THWA 2R7WA 3HHEA 4YS2A 2HVHA 1NEEA 4PQUB 1P9QC 3TZYA 2B3TB 5I4MA 1AUSL 3M8RA 1M5HA 2CADA 4NXNJ 4EYIB 5FJ4A 1JXVA 2DRBA 5ETTA 4NEYA 4IKAA 1IJFB 3C3LA 2F4VJ 2XEXA 3CJ5A 1QAYA 3ITHA 2MKJA 1P6TA 4U67Q 1UL3A 3DNCA 5K14A 2HG4A 2FZGB 3A3OB 5D6GA 1HQEB 3KHRA 4KQZA 4NRTA 1KOHA 3D1HA 4YN3B 1G2EA 4P72A 4QW8A 3K2YA 2XY7A 2J7WA 3W2WA 2HW3A 2CNOB 3BBFA 2XLIA 4JI4F 2BKPA 2R9LA 4LR8A 2MQPA 3T1YF 3AB2B 4JOUA 3F56A 4OQJA 1KRPA 2ZC4A 1P9YA 2W7OA 4HH0A 4U9RA 2KYXA 2DR8A 1HNWJ 2FUG9 2IA0A 5DDOC 3C6UA 3KMQA 2HZAA 1G3OA 2E44A 3W1YC 3AXKA 3P5BP 4U8VA 4F4KA 2VG5B 2E1MC 4TKTA 4GMKA 4ECVA 2VG6A 1CJKA 4NLWA 5L9XA 2HWIA 4DV1J 1HNVA 3JTPA 3HVWA 4IFYB 3A3PB 2FLPA 1VGYA 1C0UB 1VQLS 2DHSA 2D1CA 1XMOF 3SIPB 4EFAC 3Q0AA 2NZCA 1FO1A 4TYBA 4Y2IA 2ADBA 3W8GA 3KDOA 4FBTA 4OLPA 2JVOA 2V8VA 3OHBA 2XZWA 4TQSA 2CPFA 4RW6A 2RHQB 4WYLA 3E01B 4OJGA 1ZS6A 2DR6A 3OXLA 2KVIA 2VH7A 1TP7A 4JYAF 2ZNZA 3L7UA 3GIKA 5U47A 5FLXY 3V4IA 4LR7A 4R8UA 4NXMF 2Z30B 2VBWA 4LRAA 4OYZA 4LFBJ 3CGIA 1F1BB 2LXIA 3A8IA 4N47A 3DGPA 4KH0B 4RNHA 3J7YI 3HI9A 2VPWB 4LREA 3LO3A 1EZZB 3GQCA 1U1LA 3VZIA 4P7VA 3H2VE 4PWDB 3AJ1A 3BGOP 2GW8A 5IT4A 5CABA 1YK9A 1TKXB 5D0GA 5T14A 3QYYA 2D3OR 3C14B 3DYAB 1FEHA 4ED8A 1KLMB 4MKBA 2XYGB 4F0KA 3HCXA 1S6PA 4QR0A 1HNIA 2FGOA 3IRWP 3HT3A 3PW0A 3C15B 1T9TA 2KH9A 1T9VA 4X62J 2AGOA 1RWKB 2IRYA 3CD7A 2H65B 4X2BA 4UQTA 3T41A 1JK9B 5F8LA 3BBCA 2NXJA 1HYSA 5D8HB 1CULA 3GYXB 2PIIA 1SL2A 3R5JB 4PQAA 1TL7B 2VZ9A 3ISND 4ALZA 5HVFA 1WSVA 1IJEB 3PW7A 3RAXA 1HA1A 5KT7A 4CIOA 5KFYA 4ITSA 4OHYA 3MMBA 4ER8A 2RQCA 4AL7A 3HULA 5HL7Q 1OWXA 2I2YA 5HK4A 4CLWA 1S7IA 4FXWA 4IYQA 2DY1A 4EI2A 3FEXB 1XNQF 4DFPA 2VA3A 1NPRA 5HQ8A 3J80U 3W9JA 2QFJA 1JLAB 2HGMA 2G9OA 4Z7YA 1O0PA 4MTPA 1KTVA 2MHEA 3GLJA 4IR9A 5EHHA 2EFPA 3EVWA 2YH0A 3I96A 2NREA 2CKWA 4OZ1A 5LL6d 4RL1A 1K73T 1FRLA 3R5GA 4Y2AA 1GMVA 3HM9A 2IYIA 3TJ9A 3P4UB 2F65A 2QL7B 3ET6B 5G0RB 3HMJG 4FYWB 2VBYA 3A12A 1RTDB 2MKSA 3CIZA 3KJFB 2IJFA 2HRYA 2CQ4A 1HQUA 3PR5B 1Q8LA 5I3UA 3H4DA 1SV5B 3KK1B 1NJZA 4QWBA 2F4FA 4DEZA 4F4WA 2DPIA 3GJSB 2UUAF 4Z37A 4R5PA 8ATCB 1VBZA 5GAEI 2UXCF 3IG1B 4ZVEA 1SUQA 4FYDA 3I56S 2HS0A 3KLEA 2B4OA 2KU7A 1W2BR 4F2SA 4R0JA 1FXDA 3OLAA 1JLEA 2BANA 3BQ1A 1NK8A 2AJ4A 4JI5J 5JMNA 3VQTA 2VL1A 1P1LA 3ILLA 1KC8T 5ETRA 2JDJA 1PC4A 4Q7AA 1Y7PA 2RDDA 3BM7A 2CYYA 3SCLE 3U1LA 3CC4S 4NZ0A 1LK5A 2DRDA 4ZOSA 3MWBA 5A8KB 1QTNB 1XMQJ 5KFHA 4FYYB 5K9FA 2PMHA 2DGUA 1UFLA 2AU0A 4LF8J 1FXRA 2XO7A 3QZ7A 4DBQA 1N8RT 1T3NA 2IM0A 1SQEA 5BYSA 2YNIA 3UCUP 2JL9A 3HHLA 1X4EA 1C4CA 3RAMA 2RJZA 2VG7A 3NWGA 3T6BA 3MMAB 2VONA 1RHUB 3PFEA 2LEAA 5ETMA 1YSJA 1HMVB 4LF4J 3G96A 4RBTA 1ULRA 1FKOB 2B8PA 2F40A 6FD1A 4RW8B 3CCWA 4F4AA 5E3CA 4KJIA 1GFWB 5GADU 2VOPA 3KUGA 2R2RA 3P3DA 2YXLA 4LSZB 1AZSA 3OL8A 4ZP6A 2CDQA 2W25A 3GJRB 1MG7A 3JAMU 5K8NA 3QRPA 4GC7A 2AZ3A 2M4MA 3CCRS 3PW5A 2XWXA 1J27A 1V3SA 2UU9F 3D6HB 2VHGA 3DC2A 4CI0B 4V19X 3HVAA 2AYGA 3W5ZA 4F7VA 2RH3A 5HAOA 4OI0A 1J2VA 1GTHA 3T5JA 4RNMA 4L76A 1O8BA 2L3MA 4EMDA 2VQFJ 1FX2A 4EYHB 2Y8WA 5ETQA 4ID5B 4DPWA 2ZZMA 1WACA 4NE9C 4B3OB 3JSBA 4Q43A 4F25A 4XDDA 1ZA1B 2DJWA 4K4ZA 4HACA 1L3TA 3KLFA 2YQ1A 1NAQA 2W9BB 1S76D 4F4YA 4RU9A 3FFIA 1S1TB 4RW9B 2DNNA 1ZPWX 1HFEL 2APOA 1LFWA 1VQYA 2CPIA 1NJIT 5A6PA 2HFUA 5KFZA 5ETOA 3UDVA 1EP4A 1HQ2A 1PYSB 2WAQD 2VQEJ 1PO6A 4ECYA 2A2DA 3DI6B 4ZCLA 2J9DE 2M88A 9ATCB 3E01A 1HPZB 2OPSB 2IPOB 3KNGA 1UPMB 2AHOB 3KK2B 3GYNA 2W2NP 2FC8A 5LOQA 5A8RA 3K57A 1FD8A 3BREA 4ELVA 1T3OA 1JLGB 1RTHB 4EK2A 5L46A 2XWYA 3DMJA 4YR0A 2W2OP 2H5EA 3GCXP 1AFJA 1I3OB 1KQKA 1RAIB 3NGDA 3U7JA 3NS6A 1NCLA 1VR6A 2H4WB 4NYOA 2FHOB 5KG6A 4DX7A 5B08A 1TVRA 2MQLA 2XMJA 1L3VA 3FMBA 3C16B 2DR9A 5ITHA 5KFRA 2CAJA 5ETVA 1FRKA 4O3PA 1Y0HA 4K2JA 3SI8A 4P2FA 3KNAA 4WIIA 4K5RA 5D4OA 2EG2A 3MEEA 4FKXA 2M2BA 4ZIVA 2M3DA 4XDCA 2ZZNA 3D6MB 1BC6A 3QJLA 4ZVTB 3CSKA 3JYTA 2C42A 3PY8A 4G6VB 3D0HE 4ANDA 1AA1B 4KYZA 4QW9A 1GAOA 3D3BJ 3FCWA 2N3OA 1RTJA 4DUYF 2BVZA 4ECTA 1Q78A 2GQ2A 5AT1B 4MJKA 5J1NA 3PM9A 1Y5IB 2GMLA 1D0EA 1VISA 3MEDB 4AYBD 1NB7A 2HNZB 3LWMA 1LWFB 1KQFB 2WVEA 3M6VA 1GMWA 1TUVA 5SZTA 4X64F 5CYMB 2XS7A 3LPEA 3PX4A 1KNZA 2C2DA 3KG1A 4LF6F 5DG8A 3HKWA 2Q3PA 4QIFA 2DNYA 2HQDA 2PC6A 4X4QA 1N4LA 3PJXA 2EXUA 3GFYA 2BYCA 3LAMA 2HURA 2RILA 1JJCB 3M2VA 3R7NB 2WB4A 1C1CB 5EN1A 1U09A 5A6WA 2ALZA 3HKZD 2FPHX 3OR2B 1PIEA 3DFEA 2CG8A 2J9EA 4WP3A 1FK9B 2B51A 1A6LA 3FBCA 1YRUA 4BBYA 1CJVA 2QLFB 2BMBA 2WONB 4M1KA 3NAIA 4QPTA 3ISZA 1BLUA 1U6BA 2GAGC 2BA9A 2ZH2A 4Q0BB 1A0OB 1FKPA 4KHPF 1S9EB 2E1PA 1RAAB 2WVCA 1WF1A 2HIYA 4L3NA 4OX9F 2X1FA 1E6VB 2MEWA 3NOCA 3PYGA 1DBDA 1VRTA 3L95X 2B5JB 5KT3A 2E7XA 1FESA 2CJQA 4F04B 3X1LB 1RT1A 2DXEA 1FDDA 1UETA 1CC8A 1KFSA 2MB0B 1Z4UA 2CQ1A 2BRLA 1FRJA 1YBTA 4EZ9A 4TNOA 4EZ6A 3J81j 4O4RA 5JUMA 2DCUB 4WFAQ 3KKFA 2VDHA 4W4MA 5ETNA 5KFIA 2HVEA 3CD0A 3GG0A 2LEPA 3TR5A 2ATLA 4USWA 2J7KA 3MOJB 4USUA 4TU8A 5K20B 4ECSA 1XBWA 4O3NA 4N7TA 2GGPA 4DUZF 3DHWC 4C0OC 3H7HB 4ANCA 4PYAA 1ZOTA 3M8WA 3FEZA 1VJWA 1YRTA 3E3XA 4U7UK 1KVJA 4KH1B 5J2PB 2FLLA 1RACB 2W2PP 1TKZA 4PABA 3HLUA 5K8PA 3AY0A 2YWFA 2OPQB 3BN7A 2R7QA 2V8HA 1DRZA 5HVGA 1D09B 4C11B 5GVQA 4G1IA 1R6YA 4Y28C 1B0TA 1BWVA 5RUBA 4LBPA 1WKJA 4PCQA 3MMAA 1WOSA 3AQPA 5CXTA 3ELHA 2MSTA 2Z8QA 2WVFA 1BUXA 1YVFA 1MW7A 4RW8A 3D3CJ 4L73A 4LSLB 4KAIA 2AD9A 5GMDA 2JEIA 1RWVB 4I56A 2HKEA 1RAFB 3OBIA 2AGQA 2A6MA 2MQNA 2K1RA 2KHDA 3LP0A 4CT9A 2GO9A 1RT2B 3G8TA 3OQ2A 1RWPB 2MKYA 2V0NA 2CNLB 3B4MA 2LDIA 3ETMA 2AKWB 3FMWA 1YQHA 3ZXWA 3OPKA 1E6YB 1EJ7L 1JKHA 3IM9A 3AJ2A 3AOBA 3ADAC 5ETPA 1OO0B 4NLSA 2VKZG 3IAS9 2VPXB 2F7VA 5CD4A 1UVKA 1S1TA 2MDAA 2HS4A 1F3VA 3EMTA 3OW2R 1Q7YT 1S9FA 4D3GA 2L08A 4PPDA 1BE4A 1C0TB 2AX1A 4QYRA 4JI6J 2WSEC 1UVLA 2C3PA 1B7FA 1WOPA 3PYEA 1IBLJ 3B6BA 3UN3A 1C1BB 1T02A 2GFFA 3NGTA 4G3IA 4LFAF 4WE1B 2WRMA 4A4JA 1JLGA 1RTHA 3GJTB 3N28A 4ATNA 3VVUA 5F41A 4NLXA 1URNA 1DQ8A 3CCLS 4E2FB 2HNDA 4CCHA 1HR0J 2OIHA 3F0NA 4FZVA 3GWCA 5DGAA 1QAJA 5K8MA 1RWXB 2QA4S 4FKYA 3LH2S 1LWCB 4MT1A 5FDLB 5GAHU 2QGFB 1RYRA 3CULA 4DJBA 2BE2B 3FC9A 3GIIA 2DD8S 4DQQA 4LSNB 2ZUGA 2OO4A 2V8DA 4OLOA 2CZVC 2ZBQA 3D6TB 3NNHA 4HHHA 1KVKA 2IDEA 3NG8A 3POTB 2Z4PA 1URRA 1IKXA 3MMCA 1F6TA 2YNGA 4H4KC 2BJEA 4CO4A 3QZ8A 2RAQA 2VUGA 1TKTA 4NMXA 1YKWA 4J9LA 5FLXU 2YPZA 4UUXA 4N56A 3D1OA 2LU2A 4UY85 2IBOA 1R7IA 4KV8B 4PUOB 2V8PA 1Q5YA 2KRBA 2ZNYA 5J1PA 1MNEA 5HO4A 5T7LA 3B54A 3M2RB 3QO9A 3AJDA 2HVIA 3M05A 2O3DA 2ROGA 4LF9J 1VBKA 3LOUA 5KFJA 3M7VA 5I42A 1R89A 2DK2A 3DRSA 3BGLA 5C2CA 2OH2A 2HBYB 3GR0A 2IY5B 3QT8A 3QT7A 4QWCA 9RUBA 1VK8A 2PA8D 1JNZB 1ZAWA 3AA8A 3K7RA 4KY3A 3LP2A 1QSLA 1L3UA 2HBZB 5LMUF 2V9KA 3M8PA 5BR8J 3FQKA 2BJ3A 3JSMB 5F9LA 3ZZPA 1FERA 2WONA 5GMKa 2R8KA 4DV7J 4ZLPA 4QWAA 4LF5J 1FJCA 4JI0J 5CCMA 2ZC3A 1S6UA 2IAJB 2IMOA 3FNNA 3R5CA 2XY5A 1FNMA 2DVIA 1CJUB 1N6QA 2EFOA 3PO5A 2ZJPQ 4UTGA 1Q8KA 3O8WA 4F02A 4MAKA 3A1YG 2JRSA 1ICEB 5B09A 2H5IB 4W98A 5AXNA 1H74A 3QBCA 3OL7A 2XO6A 2Z2YB 2HVZA 2VASA 4QR1A 4N41A 1T03A 4DPUA 3CJRA 1A9NB 3QPIA 4MFBB 5HSPA 1VQPS 3P96A 2DHXA 3PJWA 1T7PA 2ROPA 3AXMA 1FRIA 3M4XA 3VALA 3GYGA 3KFWX 3SEOA 3ENWA 1NPPA 1TFWA 1S49A 3QLHA 1WSRA 3DXBA 1IR2A 3UDCA 2DGQA 3PX6A 4CQ1A 3MCOA 4BS2A 2JFDA 3SFUA 4CO1A 2VBXA 1S1XA 2V9WA 3UO0A 4AD6A 3W8PA 2DO4A 3N4WA 4N76A 2CQGA 5A0YA 1S1VA 3MM8A 4NZ7A 2RKIA 1RLDA 4A8QA 5LJ5Y 2CFXA 5C2GA 2FIUA 3BGUA 2OPRA 2I5JB 2PSZA 4DL5A 2V8GA 4K4UA 1FJGF 1U45A 1IBKF 2BX6A 3ZZRA 1GXLA 2CJBA 3Q8PB 3AQOA 1SJ4P 3R6GB 2MGZA 3PR4A 4QJVA 4NRUA 4FXVA 3KOAA 4JI7J 2CJKA 3MEGA 1DJ0A 3CDBA 4DSKA 2C2KB 3H5UA 3DRPB 2ZHAA 4X4PA 1XIQA 4ZLJA 2VDIA 1QTMA 2WBRA 3M8ZA 4NLYA 4FVMA 3HSGA 4RR5A 4WU3A 3IBFB 2ZM6J 1FEEA 2KTQA 1U2FA 3W2VA 2R8JA 2A10A 2C2NA 1UPPA 2AEJA 3DU6A 1RHQB 1TK5A 4ZCKA 1SH0A 3VGTA 4IH7A 4CLLA 1RAHB 4C8ZA 5LXYA 4BC9A 4I0WA 4M5GA 1TMMA 5G4DA 1K0TA 1FFGB 2KKHA 6AT1B 5DRKA 4DV6J 2IM3A 2EFVA 4IDKB 3QT5A 2BE7D 1CS4A 2DHHA 3HP6A 3M2UB 3MXHP 5BJRA 2GMHA 5A8WA 1CQNA 3KLHA 4K4XA 4USTA 4TN2A 3F44A 4B3RF 2MXYA 2KJWA 2E5LF 4URSA 3CD6S 1H73A 3EUNA 2HMIB 4U7UD 3Q2SC 3WQPA 4GKJJ 4K2XA 4ZP8A 2D3ZA 3ZTQA 3NGUA 3H5XA 1WWHA 2XCAA 1N36J 3CDWA 4PYDA 3H5SA 3K5PA 1MROB 2E5GA 3SV4A 1KS2A 1HBUA 1XQIA 4USMA 4ANEA 3TRGA 3DOMB 5KG0A 1P27B 2J0WA 4C6AA 4ECQA 4DPOA 4F0MA 4ICLB 3MPYA 1Q95G 3EDQB 2CJXB 4F26A 1GK8A 1GT8A 4UZCA 2AEMA 5F9NA 3OFFA 2WBMA 2IC3A 4KHMA 4ES1A 1LK7A 5C25A 3AT1B 4JI1J 1XWLA 2GZOA 1QSYA 2ZH7A 4KGZB 5KG5A 4LSNA 5I3QA 3IO1A 5B0AA 1FKAF 4KC5A 4EUVA 3NY0A 5H9EJ 1BWEA 2FYXA 4DV3F 3D28A 1OPIA 4Y2CA 4EU0A 3TA1A 4I2QB 2BM0A 1IM4A 3CCTA 2QTWA 2IBKA 2C2RA 4RNOA 2GHVC 1OYDA 2UV8A 1I94F 1NKBA 5IC4B 3CCES 3KYLA 1MWYA 4QCLA 1WDDA 1R43A 3DLGB 3TAMB 4RBUA 4I6AA 2ZBRA 3VAGA 1HIYA 2VODA 3VF0B 5HROB 1EB0A 1TV6A 2ZWPA 3RW6A 2PGCA 1FI4A 2JZ5A 1DURA 4U95A 3EJMA 2D74B 2NZ4A 3I5CA 2K3IA 2PEHA 2Q79A 4IG0B 5KFNA 3VAMA 3LP1B 2N3LA 4DZ6A 4ZIWA 1QVFR 1SBRA 1M5VC 3UDLA 1EETB 1KHVA 2E29A 4CH7A 4QZVB 4P52A 1RHMB 3TVYA 3BKFA 3RG6A 1S9GA 5F3ZA 4ED7A 1HI1A 3QJPA 5DJBA 2MKKA 4EEYA 4P6QA 2Y3YA 3VV2B 4ID8A 3HDSA 3VQSA 4P2MA 3T1HJ 2OP5A 4KBIA 2FHMA 3VAHA 1X4AA 1EAYC 1NO8A 4F50A 7AT1B 3DXSX 2V4RA 4PPZA 4RWWA 3IRXA 3VVTA 3MAQA 2J0QD 4XIUA 3T3FA 2HBQB 2PMWA 4OJ1A 4IR1A 2OLWA 2UXDF 3RU0A 4HHUA 2DTJA 3MOZA 3GU0A 2X3DA 3HD1A 4MK9A 2JWNA 4HDHA 4ZVUB 2XB2D 2WVBA 2JX2A 4J91A 4DS4A 4C0HA 3OTCA 3ZTPA 3DGVA 2ZFHA 4NYPA 4HYKA 1B70B 2CRLA 4ILLA 2CZ9A 1HHSA 1N52B 3CJKB 2ZHBA 1UWBA 4MFBA 1TTHB 2LDYA 5IWAJ 5J1EA 3IM8A 3DLKA 1O51A 4M95A 2WOMA 4IRDA 3Q8VA 1B64A 5E33A 1PJ5A 3R8YA 2VJUA 3CD5A 3RR7A 5CD4H 4KO0B 3TAQA 2WHOA 3A8JA 3P45B 5AXKA 1N33J 3IWXA 1RQ0A 1QY7A 3D54A 1JLQB 1LQ9A 2Y1JA 2C3YA 2FQQB 2AQ4A 1ACMB 3NCQA 3DOLA 4OI2A 3L4BC 3AD9C 2PN6A 1N32F 2ZHOA 1NKEA 2UVVA 1ZETA 4Q8FA 4OV1A 2V4JB 4OYIA 1RGVA 1U2RA 2BDPA 4K4WA 1FJ7A 5KAKA 1N88A 2VC0A 1KWMA 3M8YA 2RSQA 1CJTB 1SJ1A 1S1UB 3V5RA 3OD2A 2DNKA 1NDPA 1MMLA 1TL1B 2WB1D 2KFYA 1N0VC 3MGJA 3I0SA 2HVDA 1GMUA 4B17A 3EX7B 2N7YA 3FSYA 2D7SA 3QGIA 1N5QA 2VFUA 4PZVA 1OJ4A 5KFCA 1RHJB 4DU8A 3FGVA 3OXFA 3U02A 4WKYA 1IBMJ 3DLJA 2FJVA 3FK4A 5D77A 3KG0A 3BSCA 1NH7A 4X4OA 2XGQA 3MCSA 4WK3A 4UOGA 2KZZA 2I0XA 3CJ8A 2M8HA 1ZAVA 2V68A 1UJ5A 1Q4RA 2CG4A 2FJDB 2XSJB 3IMQJ 4OHWA 4H4OA 4ZN1A 3SDEB 4O23A 1B4SA 3RAQA 1OS5A 2JLFA 1TL4A 2H4YB 1AW0A 4ECXA 2K06A 2HMIA 5B0DA 1QM9A 3L09A 1H2TZ 1VC6A 5F0WA 1VQSA 2P9GA 5CYQB 4ED5A 4DG1B 2F3JA 4CRJA 1UWAA 1G6BA 3BH7B 3FCHA 1UEUA 4K0KJ 1QAXA 4ZMMA 1YJ7A 3HZEA 2CQBA 1D8ZA 2CVIA 2LVWA 2QRRA 4ES3A 2ABYA 1RAJA 2BQ3A 4IFVB 2WCXA 2CQ3A 2DEJA 2QLBB 2RT3A 3G6VA 4DR2J 2YVSA 3UVJB 4CH1A 3MMJA 4AXJA 3O3LA 5DQGA 2BW7A 3IR7B 4B3MF 4ICLA 4QYZK 2LLZA 2YX4A 4B08A 4KPCA 3K5NA 1NJYA 2CPXA 3GFXA 2CQHA 4USKA 5IS2A 4JV1A 5HP1A 1R0AA 1VQ6S 1F60B 5AXMA 5KG4A 3M8QA 3GV7B 1A7GE 4RX6A 3DKDA 1WC0A 1TUWA 4XPEA 3OVBA 2ASYA 4DR7J 2HRTA 3BSAA 2L41A 4X66F 3DRYA 2DXDA 4KGVB 4J9NA 2ZH9A 2QLXA 2N7CA 2J6TA 5IC6B 4I2QA 4YB7A 2KG1A 1KLNA 1RWMB 2Q43A 4DR3J 4NASA 2FVPA 2CPJA 3PDNA 4ZKAA 4WXWA 1ZZNA 1U0HB 2QZ8A 2QA1A 5GADI 4JI2F 2AW0A 3ULHA 5JJBA 2DNGA 4O4GA 3SQOP 3OR1B 3TAMA 1YZ6A 3TUIC 2D9OA 3FDSA 3LW5C 5D4NA 3OL6A 5D3GB 3NNCA 2U1AA 5C24B 1RT5A 1YG0A 2SXLA 4O3SA 3UDEA 3PNIA 4JI3F 3D68A 1PYOB 2YBVA 1AYEA 2HAIA 4IOAQ 2GVZB 1OQ6A 4LIRA 2N4DA 5LM7E 2R2UA 2DIUA 1FCAA 3HSJA 2OSRA 3I87A 1VQ4S 2RHSB 2HZVA 3N6MA 5KFTA 3N01A 1GMWD 1FDBA 3DOKB 2HNYA 2R8GA 4X65J 3KHLA 4GRSA 2Z58B 2YKMB 3W61A 4JBCA 3QIDA 1K9MT 1HI0P 4DFMA 4AL6A 4ZA1A 3TA2A 3UD3P 3VAJA 4EBDA 1Q81T 1REVB 2ZOMA 2O01C 4LFCF 1T0TV 5CAAA 5GMEA 4QYZJ 1FWKA 2HHXA 3THPA 3V6HA 2CPZA 2PDAA 1S6QA 2AJ2A 2CQ0A 3AHPA 4HTIA 2GC8A 4F3MA 1REGX 2KRRA 1UCNA 3DM2B 4I4BA 2XM3A 1RT4A 4DL6A 4WF9Q 5BYRA 1X4GA 3MFHA 4YY3F 2ALYB 1WC3A 4DR4F 3PW4A 2A2CA 2ZVSA 4J9RA 2EKYA 1U25A 4LRCA 2POKA 4Q2LA 3BS9A 4ELTA 4KHRA 1VHFA 3KJVB 3F41A 2GJ2A 4YR3A 3CUNA 1JWWA 2XG8A 2KN4A 3ENAA 2K7KA 5AJ3F 1O6XA 3EGVA 4CNYA 4CTAA 3CJ4A 4ELUA 2B6AA 1U1OA 3Q8QB 4C0BA 1J5OB 3QIPA 4B3TJ 2QG9B 3NBPB 3LALA 5LSRA 3BGRA 4YUDA 2QSWA 4Q2MA 1V3RA 4PKDB 1YLXA 4QIEA 1M5SA 3M30B 2VD3A 4KGMA 2DR7A 1K8AT 1Y4ZB 2M70A 3QATA 1MU2B 4CWBA 1UW4A 3LQVA 2WK4A 4DMZA 3TJ8A 3V6KA 4RW4B 4GC6A 2L9NA 1WC5A 3M32B 1W25A 3C6TA 4WK1A 1CPZA 2BJ9A 1IWGA 1IKYA 4K50A 4M5DB 4QIWD 4QBUA 5CZVA 3RRHA 1YJ9S 4OYPA 1SIZA 3P5TL 4CLSA 4TY9A 2OI2A 2BEFA 5AE3A 2IHR1 5HI7A 1RT7A 4DR5F 5MAOA 4DV2F 1VQKS 1M5OC 2KB2A 2MMYA 2LP4A 2J8AA 2XNRA 4L72B 3G8QA 4A47A 1LWXA 2Y1RI 3V6DB 1H7XA 3OTDA 4TY8B 1RKIA 5KFAA 2XI2A 3Q83A 1RT6A 1HKAA 1JXEA 1VOMA 2RS8A 2OMLA 1Q5VA 3NGKA 3KUEA 2HWHA 4OX7A 1S12A 5KFUA 4WXOA 1HBOB 3PTWA 1R0CB 3HJFA 2GNKA 1HNZF 1KR4A 4NLQA 4OZLA 3UNGC 1RAOA 3G82A 3CEDA 2COLA 2EVZA 1VRUB 3MD3A 3OTBA 2PI4A 3TUPA 3J7Z5 4JUZA 5CYQA 4LF2A 2HZCA 2XC9A 3NRBA 3JXOA 2MKHA 4YB5A 4HR2A 1F3FA 4NA1A 1Z2ZA 4BDPA 3L3CA 2YNHB 2ERRA 1F2HA 3Q8RB 4DV0F 1CVJA 2BKNA 2FJEB 3GSIA 3GE9A 3BGFA 4YMEA 1SXLA 4DCOB 4PWUA 1U48A 3GPAA 1TR0A 2ZOFA 3MM7A 3OFHA 2FJWA 5LMNJ 1U8SA 4FDFA 2XMWA 1RB0A 1SC3B 1PGZA 2CQ2A 5KFOA 4XO0A 3OVAA 2RF2A 2XCPA 2EFNA 1RI7A 1AROP 3IR5B 3IC1A 4DV4J 2OD4A 3CJ0A 2E5IA 3I9V9 4MK7A 3OTOF 4NA3A 1BHNA 1FE4A 4JV5J 2E1CA 4OZ5A 3CJQA 1XTZA 2LXUA 2F5GA 5J2MB 2H51B 1F9FA 1HBNB 1PG5B 2NS1B 1Z1ZA 2DNRA 2BJ8A 1LV5A 1K0VA 2EC2A 2WVDA 2D69A 1T9XA 1VQ5S 4O3RA 3QAUA 3CCQS 3OJUA 1IKVB 2ASLA 1WG5A 4NPOA 2IA6A 2AGPA 4RUCA 3TQ1A 4RUHA 1IR0A 1GQEA 2YNFA 1WHYA 4MIWA 1X4CA 5B0EA 5KFXA 1ZYQA 1S72S 2FDNA 3M1VB 1HNXJ 3MTJA 1OMSA 2UXBJ 4DUTA 3CJSA 1UVNA 4AQYF 3W62A 4L74A 2KYZA 2JLGA 3PRDA 5J2QA 5LSOA 1MWZA 3IGVA 2HK2A 4ZP7A 2PD1A 3LANA 4ZHRB 2ZH1A 4M5JA 2Q66A 2ZJRQ 4E8UA 1JJ4A 2YKNB 4J9OA 3TWZA 2XY6A 5HQLA 1GXUA 1EKSA 4DV5J 5I3PA 2OPPB 3KLGA 1F5CA 2MPUA 3LA0A 2W9CB 1DTQB 2IYGA 3R27A 2FB0A 4B3SJ 1F2GA 3IS9A 3KHGA 1X4FA 4F3QA 1TKDA 1JB0C 4P71A 5B7WA 2K2PA 2QL5B 1UZHA 5D4PA 3IR6B 5C5JA 4OYWA 1JLFA 4FYXB 3T1AA 5F8HA 1RU1A 4HI1A 3KLIA 2HHUA 4DU7A 3THVA 5E3QA 2RRNA 3EVMA 2IVYA 3R1HA 2YWEA 2P8IA 1S0MA 2V5HG 4QPXA 5DGBA 4ECZA 4PR6A 1DTTB 2CPDA 3R9LA 5KFSA 2HHHJ 4NCGA 2IIHA 3EXYA 3TAPA 3BB5A 5C7PA 2FC9A 5KFDA 3D67A 1RBOB 4YHHF 4OYMA 5HJXA 5GAHI 4FP9A 2MZSA 4ZP9A 2E66A 2B9YA 4DSIA 2R7UA 1IKWA 3H59A 3RYLA 4Z7CA 5KFBA 3JS9A 4A8MP 3PRVA 3TI0A 3BF4A 1HD0A 2Z57B 2DO0A 3MM5A 1FWPA 3KJVA 1GX5A 3KG4A 1H72C 3V4MA 1DLOA 4TU7A 2OSQA 4KRWA 1JLCB 3I0RB 2Y8YA 1K1QA 2P6TA 3BO3A 2CPEA 4YR2A 1FRMA 4NLUA 4IG3A 1HBMA 2NUUG 5CQGA 3H8YA 1KKHA 4LF7F 5EUHA 4OX6A 4BLGA 3ETOA 2RMLA 2FJAB 4AUKA 4H54A 1BQMB 3DU5A 2AZ1A 2JNJA 4FNIA 1RTIA 1SKUB 4HL9A 4ZVOB 4E98A 4KFBA 3WZ0A 3CJTA 2X51A 2F1FA 3W64A 1SJ3P 1Q7LB 1X9WA 5B0CA 1VK3A 1SH3A 3CC7S 2HEKA 1FXLA 1SVDA 2LU1A 2E9TA 3OXGA 4NXNF 2KT3A 3UCGA 3PEJA 1WF0A 2XYPB 4OYXA 4DSFA 3BR9A 2F4VF 4PXCA 4DX6A 3V6JA 1KOOA 3UR0A 3H2LA 3ICLA 4OYOA 1S1WB 2BKOA 2DY9A 2LQ5A 2EK6A 5HLFA 4G1QA 5E3AA 2P9CA 2HFVA 2DR5A 1PILA 1H0HB 4HEA9 1OY6A 3LUYA 3NP5A 4CLPA 1KD1T 1X5PA 5KT5A 4CT8A 4I68A 4LVNP 3RR8A 1WEZA 2LA6A 4C3MA 4NCBA 1DZ5A 2I1RA 8AT1B 3DLLQ 1IM6A 1HL6A 1U6FA 3BYPA 4BWMA 2BUNA 4ZJLA 2U2FA 4CDIA 1HNWF 1RT3A 2MLXA 2Q6BA 3NL0A 1XR5A 2W8LA 3BDEA 4CO5A 1LW0B 4X4VA 1JLBA 4OYBA 4X4TA 3GIMA 2VICA 1RHRB 4I67A 1VIXA 2ZH4A 1T05A 2ZOGA 1N5VA 2KDOA 1ZM9A 1TL3A 1XR6A 4M5LA 4HKQA 1S99A 4OI3A 4O44A 4LT6A 4DV1F 3U1NA 5HMWA 3P6YC 3ZZUA 4IRCA 1TZ0A 1N0UA 2HHVA 2HQGA 2GS8A 1WI6A 1B0PA 4CYUA 4TU9A 3GR1A 3AA9A 4IH5A 3MUTP 1LWEB 5SUHA 3HVTA 1YBAA 2UUBJ 2J0SD 2KHCA 4ECRA 1KVIA 3PYDA 2XHWA 3KHHA 4H4MB 2F8MA 2FVQA 1NK4A 1NSPA 5H9FK 2YX1A 4DR6J 1B7YB 4RW7B 1FVQA 2NPIA 4WFZA 1D9DA 2ROEA 3R5BA 4CZCA 1H3DA 4NI2B 4ZLLA 2MYFA 1M1GA 5F8GA 4ED6A 1SC4B 3GFHA 2NXNA 2NXCA 4CLKA 2ZE2B 2GVDA 3MM6B 1JNRB 3TZXA 4DL7A 1L5UA 2HGLA 4CH0S 2PI5A 4LFBF 3QSIA 3DLEA 2WW4A 1S79A 3TVZA 2RDJA 2ZD1B 4YQWA 1GH8A 2DYAA 5FD1A 1IKVA 3SSSA 4AXIA 1S0VA 3FCVA 4KKOB 2AYEA 2MLYA 2W8KA 2JFKA 2FHJD 2AF6A 1IXKA 1NPKA 2IRUA 3B8HA 2E7VA 4GVBA 2G4BA 4C8MA 2G2ZA 4USJC 3U27A 1OSCA 5A2QY 3UW1A 4C4WA 1CSJA 3HHLC 1P1TA 2B56A 2EC0A 2F63A 2GX8A 5C42B 2N82B 3CWJA 1CLFA 1VQ9S 4PQUA 3F73A 2KFNA 2MKCA 1UA0A 4X4NA 2ACYA 4HTJA 4GO5X 4HHJA 4X62F 1LFPA 2Z2LA 3WIUA 1N34J 5E41A 1C4AA 1H38A 3SQGB 1QE1B 3S1TA 4YDXA 2QMXA 2DRAA 3M9MB 3NS5A 3GTYX 2XS5A 2X1GA 5K5MA 2Y0SD 1HQEA 4DSLA 1F5BA 4DZDA 3PO4A 2J7UA 4GKKJ 3VAIA 2OEMA 3KTQA 1IQZA 2JLEA 2ZEJA 1D9FA 1Y11A 3GB0A 5J2NB 2YKPA 3IWNC 2VV5A 3FEYB 4I2PB 4J9PA 4J7CA 2VKRA 1NZAA 4OZJA 1V3ZA 2EPIA 1J5EJ 2H3EB 1RE1B 2R7TA 5IQ6A 4G1PA 2BBEA 4XPCA 3SV3A 4PAAA 4NLVA 2ZDOA 3ZZTA 2XLJA 3THTA 4NLGA 1F5AA 2G1HA 1BQNB 4FF2A 4KE5A 4DN0A 2WSFC 2HHPA 3RUBL 2L48A 1WKLA 4FYVB 2VG5A 4TVAB 3RW7A 5H9FJ 3HT0A 3MZIA 3R5AA 4CO3A 5H1SV 4QIVA 4C8LA 4RKUC 4X4UA 3QRQA 4IFYA 3DHXA 2MLZA 2A0FB 2QYGA 3EZOA 3Q8SB 1WG1A 3ZZOA 4NCAA 3ITHB 4C8KA 2ZJQQ 1C0UA 1FNXH 5M2PA 5K14B 3VGUA 1RISA 5D78A 1DQ9A 2EBEA 1ELOA 1Y5LB 3NGSA 3SYZA 1YBUA 4IOBA 5DZ6A 2CDRB 5E3PA 3NCPA 2DNZA 5DDQC 3W2WB 3R2DJ 1APSA 2E1RA 4DR1J 3RB6A 4NMLA 4HDGA 2R7SA 4F4XA 1X5OA 3E8OA 1S6OA 2VBZA 2KG0A 1T9YA 1FF2A 2RQ4A 4J9MA 1UVMA 1ZAXA 1FX4A 4JI5F 1V5VA 3IWLA 2IJNA 3FSIA 3VAFA 3C6UB 4FS2A 4KGXB 2NYHA 3AODA 2YWGA 2ZUAA 1YJUA 1RSCA 4ED0A 2HLTA 2VG6B 1XMQF 1CJKB 3BQ0A 3MR5A 1OSDA 3ONQA 3I82A 2FVRA 1HNVB 4LF8F 3N9UC 4PWDA 1PAUB 1D1UA 3ZNJ1 3EPGA 2R8HA 1ZM2A 1TKXA 2MJNA 5HVHA 1PBUA 2VB6A 4B9TA 3C14A 3DYAA 1SJQA 4ECUA 1KLMA 4B9UA 1TELA 4IQXA 5CH7B 1Y10A 3CCVS 4DQIA 1JIHA 3TANA 2WZ1A 3C15A 2DNQA 4RW6B 2GJIA 2YWHA 3K59A 4TLRA 4LF4F 1RWWB 3SSQA 1XNRJ 3PACA 4WIQA 4GVLA 1PJ6A 2J76E 1HW8A 1U26A 1RK8A 1Q82T 1TL7A 1HHTP 3V4IB 4R8UB 2M9KA 3JQKA 4TLQA 5AE1A 5IT0A 3BZQA 2DGVA 3BBBA 2P9EA 4LIWA 1OY8A 1RADB 3DGPB 1HW9A 2K8GA 3UPFA 4FNHA 4Y6IA 4DL2A 4JI8J 2VIHA 3IGNA 2IVFB 1KSPA 5L1JA 3G87A 2VQFF 1KQGB 3MAAB 1NMEB 4ZPCA 3BN4A 2LQ9A 4OJHA 4QOTA 1WUUA 1JLAA 5HJYA 3H4BA 1UJ4A 3H5YA 4L75A 3EWGA 4O0IA 5HBMB 2RD5C 5EX3A 4L3KA 2AV5A 4X4RA 1R8PA 1S6PB 2A18A 1HNIB 2HGNA 2DITA 1WKKA 1T94A 2KL8A 3SXLA 4Y0FA 3ET6A 5G0RA 5F3TA 2WSCC 1RTDA 2CWXA 3M9NB 3RTVA 3PJ9A 1HYSB 3MPUB 3ZNUA 1CULB 2VQEF 3D66A 1RTZA 1IQTA 1SV5A 3KK1A 1BMQB 3RBDA 2C3OA 2MZJA 2HSEB 2FVSA 1P8GA 3OTEA 3MMBB 5F8JA 1RYSA 3IG1A 4WTOB 3CCUS 1XN9A 4JI4J 2R3VA 4MIAA 3G86A 3T1YJ 4M5IA 1QSSA 3MTKA 2C1EB 2CJ9A 3V2UC 3PFOA 4WFYA 3OVSA 3OLBA 4PG7A 4LR9A 2QL9B 4DCPB 3VWSA 1M1KT 1AUDA 2B9EA 3N0VA 4K4VA 3IN5A 2AJQA 2G1DA 2LQ8A 4PWWA 5A8KA 2M0GB 5D15A 3PIOQ 3LGMA 4DF4A 3ILIA 5KFMA 2LXFA 5AE2A 1VMBA 4C8YA 2XBPA 4OZ3A 3TYTA 3W63A 4FF3A 2BR0A 2K3KA 1VI7A 4JV0A 4RO0A 1UEKA 1XMOJ 1HQUB 5JXSA 5I3UB 4J9VA 6FDRA 1UVJA 2G0JA 4WFNQ 1X0PA 1V6HA 3OL9A 4I7FB 4DPXA 4DSEA 1HMVA 2QN6B 3HVRA 1WC6A 1SUQB 1FKOA 2CXEA 3KLEB 2QMWA 1VC5A 3LPYA 4JYAJ 2H54B 1JLEB 2BANB 1RDRA 2BJDA 1TK0A 4OI6A 4LF1A 2LMIA 4NXMJ 2HHSA 2KT2A 1NUEA 1WF2A 5B0BA 1FFSB 1X31C 2P2CB 1SKSA 1U2CA 4JP8A 2ZKTA 3AH6A 5HN0A 3TQEA 3W7BA
chains in the Genus database with same CATH topology
4WPAA 4OZ3A 4OYXA 1WC3A 1WC0A 4OYIA 3UVJA 1FX4A 4OYOA 5D0EA 1AZSA 1CULB 1YK9A 3C16A 1WC1A 1CS4A 1TL7A 4OYPA 5D0GA 2GVDB 1WC4A 4CLSA 4OYWA 3C14B 4CLYA 5IV3A 1CJTB 5D0HA 4CM0A 4USTA 3MAAA 3R5GA 3MR7A 4P2XA 2GVZA 1CJKB 3C15B 4OYAA 1AB8A 4USVA 1WC6A 1U0HB 4CLPA 3G82B 1CJUA 1CJVB 4P2MA 3ET6B 4NI2B 2QV6A 1FX2A 3MAAB 4WP8A 4WP9A 3UVJB 4CLKA 1CULA 1AZSB 3C16B 4CLZA 1YBTA 1CS4B 2BW7A 1TL7B 2GVDA 3C14A 1CJTA 4OYZA 4CLFA 5IV4A 4P2FA 4CLUA 1YBUA 4OYMA 2W01A 5D0RA 1Y10A 4OYBA 1Y11A 4WP3A 2WZ1A 5D15A 1CJKA 4CM2A 3C15A 2GVZB 4CLTA 4CLWA 4OZ2A 1U0HA 3G82A 4USWA 1CJVA 3ET6A 1WC5A 4USUA 1CJUB 4CLLA 4NI2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WPA A;  4OZ3 A;  4OYX A;  1WC3 A;  1WC0 A;  4OYI A;  3UVJ A;  1FX4 A;  4OYO A;  5D0E A;  1AZS A;  1CUL B;  1YK9 A;  3C16 A;  1WC1 A;  1CS4 A;  1TL7 A;  4OYP A;  5D0G A;  2GVD B;  1WC4 A;  4CLS A;  4OYW A;  3C14 B;  4CLY A;  5IV3 A;  1CJT B;  5D0H A;  4CM0 A;  4UST A;  3MAA A;  3R5G A;  3MR7 A;  4P2X A;  2GVZ A;  1CJK B;  3C15 B;  4OYA A;  1AB8 A;  4USV A;  1WC6 A;  1U0H B;  4CLP A;  3G82 B;  1CJU A;  1CJV B;  4P2M A;  3ET6 B;  4NI2 B;  2QV6 A;  1FX2 A;  3MAA B;  4WP8 A;  4WP9 A;  3UVJ B;  4CLK A;  1CUL A;  1AZS B;  3C16 B;  4CLZ A;  1YBT A;  1CS4 B;  2BW7 A;  1TL7 B;  2GVD A;  3C14 A;  1CJT A;  4OYZ A;  4CLF A;  5IV4 A;  4P2F A;  4CLU A;  1YBU A;  4OYM A;  2W01 A;  5D0R A;  1Y10 A;  4OYB A;  1Y11 A;  4WP3 A;  2WZ1 A;  5D15 A;  1CJK A;  4CM2 A;  3C15 A;  2GVZ B;  4CLT A;  4CLW A;  4OZ2 A;  1U0H A;  3G82 A;  4USW A;  1CJV A;  3ET6 A;  1WC5 A;  4USU A;  1CJU B;  4CLL A;  4NI2 A; 
#chains in the Genus database with same CATH topology
 1XMB A;  4EWT A;  4ID5 A;  3FRY A;  3PV8 A;  3KLV A;  3C19 A;  2V67 A;  4B3O A;  1FDA A;  4UW2 A;  2YNI B;  1ITP A;  5KFF A;  4K5S A;  3HHL B;  1S57 A;  4ED2 A;  3MUV P;  2UV8 G;  2GQQ A;  3T9Z A;  3I5B A;  3CJ3 A;  2VG7 B;  3G8S A;  4ZVF A;  1R8C A;  3PVX A;  2W9B A;  5HMY A;  1RCO B;  5L39 A;  4RW9 A;  2L9D A;  1VDH A;  2DPJ A;  2IDL A;  3D0I E;  3M8S A;  2JOQ A;  3HX9 A;  4NX9 A;  2RE1 A;  2C2E A;  3UCZ P;  5HAT A;  1AZS B;  3DI6 A;  1PJ7 A;  3K8V A;  1HPZ A;  2AX0 A;  1MSW D;  5JVH Q;  2OPS A;  1NK5 A;  3FBE A;  3Q8U A;  2B43 A;  3KK2 A;  1Q53 A;  1OQ3 A;  2R7O A;  3R2C J;  3GSD A;  2IVM A;  2FZC B;  1XNQ J;  5BXI A;  3BEG B;  1SL0 A;  3TUZ C;  2EFG A;  2MJU A;  1WJ9 A;  2JSX A;  5EWE A;  4IO1 A;  3HXM A;  1GTE A;  4UOC A;  3C16 A;  1Y00 A;  2QEX S;  2ZH8 A;  4HAC B;  5E5N A;  2KXH A;  2VFT A;  4JV2 A;  5DLG A;  3KLF B;  4C48 A;  5M2U A;  3R7B B;  3CME S;  2FJX A;  2ASJ A;  1T8E A;  3A8E A;  2J5A A;  1PC5 A;  1WTB A;  3FFI B;  1NK0 A;  1NK9 A;  4OV6 A;  3UWT A;  4XAK A;  1EHW A;  1NHU A;  1TL5 A;  1EP4 B;  3QGP A;  2NLW A;  1U4B A;  2EI5 A;  3MED A;  4U8Y A;  2HNZ A;  1LWF A;  2DGS A;  3I32 A;  2RRA A;  4WKR A;  3ILJ A;  1LNQ A;  2UUA J;  3FUY A;  5HQM A;  4EBC A;  5D0R A;  1OY9 A;  2UXC J;  5CYM A;  5A8R B;  1LW2 B;  1HHQ A;  1L3S A;  4OX8 A;  4B9N A;  1EIY B;  1NDK A;  1Q16 B;  1Y3K A;  3DMJ B;  1Q1K A;  2EFQ A;  4DQR A;  2GIQ A;  1M90 T;  1PYT A;  1TVR B;  3FBB A;  4AE5 A;  1C1C A;  4U6P A;  3T5K A;  1YJW S;  1WC4 A;  5CZX A;  3OR2 A;  1MMN A;  1X4H A;  4A8X A;  1YJV A;  2CQC A;  2BW2 A;  2CJY B;  3I5A A;  3MAA A;  1RBA A;  4PG5 A;  1FK9 A;  3SSR A;  3G6Y A;  4CO2 A;  3MEE B;  3NAH A;  3ZFV A;  4USV A;  4ZVS B;  1FVS A;  5HBM A;  1U0S A;  3JYT B;  4OZ0 A;  4K4S A;  1NSA A;  5LT5 A;  4DPT A;  1X8D A;  1HWU A;  1RTJ B;  3W65 A;  2CPY A;  1VQ7 S;  4WZM A;  2H5J B;  3AOA A;  4RNF A;  3BYR A;  5DLF A;  3MEK A;  1U1N A;  3R97 A;  1GNK A;  2C2O B;  4Q0B A;  1S9E A;  3MDF A;  3MCN A;  1VBX A;  4I1T A;  1E6V A;  4ETZ A;  3BQ2 A;  4JI6 F;  3CTR A;  8RUC A;  2B5J A;  5IQQ A;  2RQK A;  4EGL A;  2OTL S;  3OFG A;  4OZ2 A;  3TEG A;  3CCM S;  2V34 A;  1V9O A;  1IBL F;  5E7O B;  4R0E A;  2R8I A;  3K89 A;  2UUT A;  5E3R A;  2J6U A;  1SKR A;  2KT5 A;  3M2V B;  3QAE A;  4YP3 A;  2RVJ A;  3LAK A;  4LBH A;  3WC2 A;  1HR0 F;  1R6V A;  3CVK A;  3GZ7 A;  3EZU A;  2UU9 J;  2DNH A;  1NK6 A;  2DXF A;  1FDN A;  3LTO A;  1BXN A;  1VRQ C;  3NNA A;  4WU2 A;  2E5J A;  1CJV B;  1U8W A;  4N8O A;  3MEC B;  5B0F A;  5HMZ A;  2HFO A;  2OGU A;  3PHE A;  3MHY A;  3BPD A;  2MQ8 A;  3CDA A;  1FKP B;  5E2Q A;  1F0X A;  1T95 A;  5KT2 A;  5J2P A;  2M5Y A;  4FBU A;  4M63 A;  5L1I A;  3R5D A;  2OPQ A;  1UMJ A;  2MZ1 A;  1QUP A;  1VQN S;  1VRT B;  4C11 A;  3MM9 B;  3DLH A;  3LF0 A;  2MY7 A;  4DDF A;  1RT1 B;  2C2Z B;  4NEZ A;  3FZB A;  5KFP A;  3CB4 A;  1S4F A;  1ZA2 B;  1K1S A;  1NRK A;  4I7F A;  2RNE A;  1QJH A;  1M5K C;  2OFG X;  3TUJ C;  4UY8 T;  5H9E K;  3PHT A;  4EO6 A;  1S4E A;  3KJQ B;  2M7S A;  3HFK A;  4LF9 F;  3LGN A;  4LSL A;  4M5M A;  2HQI A;  2OHD A;  3BV8 A;  1ZM3 A;  3MUR P;  2BZ2 A;  2FZK B;  1RWU A;  3EPI A;  5A2Q U;  3OT9 A;  2E1A A;  3HSD A;  3RB4 A;  4DN9 A;  4PEO A;  3KMS A;  1I1G A;  1M0S A;  2GGP B;  4Q8E A;  4USH A;  5BR8 F;  1RT2 A;  2DT9 A;  4B9M A;  4YB6 A;  4USI A;  1M1H A;  3QWU A;  3WX8 A;  1TKZ B;  4N77 A;  1E6Y A;  4QU6 A;  4ZPT R;  2VPZ B;  4DV7 F;  3NKY A;  1TAQ A;  4LF5 F;  4JI0 F;  3NGR A;  2VOO A;  1UEV A;  3MPV A;  4ILM A;  3D1Q A;  2PMZ D;  3QJJ A;  4FXD A;  5ETK A;  4DUY J;  3FZ2 A;  4K59 A;  1RCX B;  4LRD A;  3MR6 A;  2I38 A;  1PKU A;  1UJ6 A;  1SC1 B;  1C0T A;  4UZB A;  2FY8 A;  3NMA A;  4X64 J;  2QIF A;  4ILR A;  4OHX A;  1QLN A;  4A8W A;  4LF6 J;  1C1B A;  2QMU B;  4KR0 B;  2OFH X;  2ILZ A;  3SCJ E;  2K1R B;  3EM1 A;  4WE1 A;  3LP0 B;  2Y1I A;  5DDR C;  1RU2 A;  1SB6 A;  3QMQ A;  1NDL A;  1WOR A;  3BJY A;  5KOX A;  1RAG B;  2E5H A;  5E0O A;  4WTY A;  4BWJ A;  3WIV A;  3CCJ S;  4HH1 A;  1KN6 A;  1VC0 A;  1JKH B;  3W60 A;  3T19 A;  2XNQ A;  1LWC A;  4LRB A;  5FDL A;  1TQL A;  1Y3J A;  2BE2 A;  4N5S A;  4KSE B;  4ZVG A;  1FFW B;  1KON A;  4F8R A;  2RDI A;  4FPR A;  1PCA A;  2DHA A;  4KHP J;  5IV3 A;  1N56 A;  1UFK A;  4OX9 J;  3POT A;  4Z2X A;  4EBE A;  4HT5 A;  2H48 B;  2MZQ A;  4URQ U;  1CC7 A;  4P7T A;  3R3T A;  5DM7 Q;  4NZ6 A;  1GXT A;  5L9N A;  2KO1 A;  2XZT B;  2JC0 A;  3GIJ A;  4F36 A;  5F8M A;  1IUJ A;  4NA2 A;  2CNK B;  1VCT A;  4KV8 A;  4PUO A;  4WP9 A;  4JI7 F;  3HHK A;  1LW2 A;  3TP2 A;  3G6E S;  1H98 A;  1SPB P;  3QFH A;  2F8E X;  3M2R A;  2XGP A;  4ZJO A;  4DLE A;  2HND B;  4QQB A;  3D7S B;  1XK8 A;  2ATC B;  1YTY A;  1VQM S;  2W24 A;  3SBM A;  2ZM6 F;  4M5H A;  1YI2 S;  1IWA A;  3RGI A;  2ILY A;  2HPU A;  3L9Z A;  1X7V A;  3TEH B;  5DZ7 A;  2LYV A;  2YKQ A;  2FJB B;  2Q1L A;  4DUZ J;  3SCK E;  4DV6 F;  2GO8 A;  3JSM A;  4A8Y A;  2V63 A;  3KJN B;  2IMW P;  2W7A A;  4A48 A;  4CM0 A;  1HWJ A;  5K8O A;  3IAM 9;  3BKU A;  3O6Q A;  2CQD A;  1IKX B;  3MMC B;  2YNG B;  1IR1 A;  3IA0 A;  2IAJ A;  1TKT B;  4DQS A;  2KZM A;  4YOE A;  4RPF A;  3W5Y A;  2RU3 A;  1CJU A;  3D4J A;  4GKJ F;  1MMD A;  2O67 A;  2GHP A;  5KFW A;  2A3J A;  2V2Q A;  7FD1 A;  1UW9 A;  1N36 F;  2HFZ A;  3JTO A;  2XYH B;  1I5O B;  5T7L B;  1OPZ A;  3QO9 B;  3OJS A;  2W01 A;  1Y5N B;  2UUC F;  5I42 B;  3DRS B;  3M6U A;  2EWH A;  2D3U A;  3J7A 1;  4DS5 A;  2JVR A;  4YDD B;  2PO4 A;  2FVC A;  4O3O A;  3GG1 A;  4ED3 A;  5EWG A;  2CJA A;  4G65 A;  2V4Q A;  2V6A A;  3ZZZ A;  3LP2 B;  4Y2M A;  3M8P B;  3Q24 A;  2MQM A;  4C98 A;  3CJ2 A;  1WC1 A;  1FT8 A;  2XUL A;  1JQG A;  3GCW P;  4DWI A;  4CLY A;  1R3N A;  1RXO B;  3GMG A;  3MEC A;  4JI1 F;  4J9K A;  4KGK A;  4WFX A;  4F4Z A;  4W90 B;  3RBX A;  3CO0 P;  4FF1 A;  1LXJ A;  1N48 A;  3ZZY A;  3K58 A;  1N6Q B;  1DAX A;  2AJ0 A;  3WX4 A;  2DH9 A;  3VZH A;  2GAH C;  4D3H A;  3UI3 A;  4PRF A;  3MM9 A;  2I5J A;  1FRH A;  3A13 A;  1HAR A;  2P6S A;  5L38 A;  2BQR A;  2I8E A;  1CG2 A;  2YX7 A;  3EDR B;  1T03 B;  4KPY A;  2HBR B;  3N6N A;  5IT9 Y;  3TZW A;  2QC3 A;  3DCA A;  1KBR A;  2ZZT A;  4NLT A;  3JSR A;  1RKJ A;  4LFA J;  5BYQ A;  1U1P A;  3QLH B;  3DRP A;  4ZDN A;  4KTQ A;  3HHL D;  1NH8 A;  2J9D A;  4M8L A;  2V69 A;  1NZ8 A;  4ZIT A;  2X1B A;  1XC9 A;  2EK1 A;  2B7B B;  4MKY A;  1S1X B;  4FS1 A;  4CO0 A;  5HMX A;  1NU4 A;  3T1H F;  4MKV A;  2KI2 A;  5A0Y B;  1CEZ A;  1S1V B;  3MM8 B;  4IDK A;  2RKI B;  4X84 A;  5EGY A;  1SCJ B;  4MYU A;  2Z0G A;  3M2U A;  3QWP A;  2OPR B;  2IRX A;  1HWK A;  1EQ0 A;  3FVY A;  3KK3 B;  4IOC Q;  1YDL A;  1NDC A;  4ZS6 A;  2C28 A;  4CM2 A;  5IZH A;  4ECW A;  3FKB A;  2LCW A;  3EVO A;  4BC7 A;  3EIC A;  1UKU A;  2AWZ A;  3CT9 A;  2MGZ B;  2QJ3 A;  1HD1 A;  3O5T B;  1KQS R;  3ZC4 A;  3RB0 A;  5KTQ A;  3MEG B;  3J7A N;  3US5 A;  2GA7 A;  1TU0 B;  1MRO A;  4NLD A;  1TK8 A;  4W92 B;  2NCK L;  5DO2 A;  5IWA F;  2QLW A;  3DOM A;  1N5Y B;  3HJV A;  3W2V B;  1Z2L A;  5F0U A;  4C8O A;  1XEZ A;  1B3T A;  3EGW B;  2AIR B;  2UUW A;  3HF5 A;  2W2M P;  2AYM A;  2QV6 A;  4QIG A;  4NLP A;  4CNZ A;  4WJB A;  2UVW A;  5LMU J;  4RUB A;  2VFV A;  4MH8 A;  5L1K A;  2V2K A;  1N33 F;  3MAH A;  1CS4 B;  3S6E A;  5A8W B;  2DIS A;  2W4D A;  2LFV A;  3I4H X;  1WEX A;  1TFY A;  2Y9H A;  1D9A A;  3AOC A;  4CLF A;  3KLH B;  1ZH5 A;  2R2T A;  3CIM A;  2C22 A;  5IOL A;  5HAN A;  2HYI B;  3D0G E;  4TQR A;  3WC0 A;  1LOU A;  1TUG B;  5JVG Q;  3JTN A;  2VFS A;  2YTC A;  2OEJ A;  1G4C A;  3HO1 A;  1G1X A;  3K5L A;  1HBU B;  2OEK A;  1RBL A;  3DLG A;  4RJV A;  2VFR A;  5HRO A;  2AMC B;  1S59 A;  3PYF A;  2MSS A;  4OYA A;  5LSL A;  2BM1 A;  3ENQ A;  1SC6 A;  4XTT A;  5DG7 A;  4WCE Q;  1I51 B;  3DDK A;  2ZKU A;  2RQM A;  4IG0 A;  3LP1 A;  1PBA A;  2ZBC A;  3CDU A;  1OYE A;  1IBM F;  1B99 A;  2KXN B;  2XS2 A;  2IC3 B;  1EET A;  2GCF A;  2KM8 C;  2O66 A;  3PX0 A;  4LQ9 A;  4ZVQ B;  5C25 B;  3TOQ A;  3SCI E;  4UQG A;  2BRK A;  5CA5 A;  1U1M A;  2HLU A;  1IVZ A;  2F9D A;  3TA0 A;  4J9S A;  2R7R A;  5ETL A;  4JB8 B;  2DH8 A;  2DGX A;  3HZG A;  3CMQ A;  4B9S A;  2OMO A;  2M8D B;  2YQ3 A;  2VC1 A;  3B82 A;  1L3K A;  2DB1 A;  3D2W A;  3MCM A;  3C66 A;  3S7R A;  2E9R X;  4ZPV R;  1FJG J;  4H4K A;  1IBK J;  1HWL A;  2BOA A;  1JMT A;  4BHQ A;  2PFF B;  2CQI A;  1Q0N A;  5MLC V;  2JEJ A;  2BOP A;  1TV6 B;  4K0K F;  1SQG A;  2W4C A;  4A8K A;  4UUW A;  3GFZ A;  1DFD A;  2WTF A;  3QSY B;  3J7Y U;  1FA0 A;  3EYZ A;  4C3L A;  2EBG A;  1S5Z A;  3UE2 A;  4DR2 F;  2UZA A;  3CJK A;  3Q2T C;  2QE5 A;  3UN5 A;  4PXB A;  3HD2 A;  4RZR A;  3T6J A;  3ZTR A;  5IV4 A;  1UA1 A;  1U02 A;  3A3N B;  4QU7 A;  3N79 A;  1S9G B;  1QVG R;  2F9J A;  2QYC A;  2V2V A;  4WZQ A;  1NSK L;  1DAR A;  1EKR A;  2LQJ A;  3CMA S;  4KO0 A;  3K5O A;  2DH7 A;  3MR2 A;  3B78 A;  4IQM A;  1QUV A;  3UFC X;  2Z56 B;  4DR7 F;  3IRX B;  3Q86 A;  2FTR A;  4A8O A;  2BV3 A;  3JQJ A;  3V81 B;  1JLQ A;  3H2U B;  4DL3 A;  1RLC L;  2NSC A;  3QQC D;  2XMT A;  4DCJ B;  4B3R J;  4ZJQ A;  4DR3 F;  3VR1 A;  5KG7 A;  2E5L J;  4Q44 A;  4OI4 A;  4S0M A;  3RRK A;  2PEB A;  1T11 A;  4DI6 A;  2GV1 A;  4HLB A;  1RAE B;  2V4J A;  1DHM A;  2CZ4 A;  4J9U E;  1YX2 A;  4ED4 A;  3CXC R;  3PIP Q;  3RB3 A;  5GAG I;  1UWB B;  2G2Y A;  2R7V A;  1I6J A;  1CJT A;  3UR3 C;  3B4D A;  3CE8 A;  1S1U A;  4C9D A;  5J1E B;  1TL1 A;  5L8R C;  4DSJ A;  4PG8 A;  2V94 A;  3J81 Y;  3DLK B;  2WOM B;  1X4D A;  5F8N A;  2Z2Z A;  3P8B B;  3D5M A;  3CO9 A;  2QLJ B;  1IBC B;  1UVI A;  4F67 A;  5D0E A;  4NYZ A;  3H25 A;  1RWN B;  4LVO P;  3MPW A;  1PAE X;  4O0N A;  2HQF A;  5D0H A;  3X3U A;  4X65 F;  4YEA A;  4I64 A;  3MI7 X;  2CVE A;  2PA3 A;  4IUF A;  4P73 A;  3DOL B;  2XHC A;  3E51 A;  2D41 A;  3R1L A;  2MZT A;  2EEY A;  1F9E B;  4DV3 J;  4IO9 Q;  2HK3 A;  4KT0 C;  3ENV A;  4C97 A;  3C46 A;  2MQQ A;  2JHE A;  5GAE U;  2NYI A;  2QFI A;  2YKA A;  2XSJ A;  3KK3 A;  1SIW B;  4WWS A;  4ETX A;  3SDE A;  2XLK A;  3K8W A;  3EZ5 A;  4ZPD A;  3KDN A;  2D3O 1;  3ISN C;  2NUH A;  2AT1 B;  1I94 J;  1FNO A;  4KIA A;  4DG1 A;  1XER A;  4I6W A;  4PG4 A;  2KJV A;  4J9Q A;  1RUS A;  3PG9 A;  3I0S B;  1AXQ A;  2C3U A;  2Z2M A;  1RHK B;  1T9W A;  3RBZ A;  4F3O A;  4IRK A;  4R25 A;  2CIM A;  2N4C A;  4IFV A;  4QWE A;  3BPS P;  3WDO A;  1PSD A;  1N5Y A;  4FN5 A;  3UVJ A;  1N5T A;  1FE0 A;  4P75 A;  3KXD A;  3I6P A;  2UP1 A;  4ED1 A;  2IM2 A;  1RP5 A;  3VGV A;  1CBK A;  2YH1 A;  1YIJ S;  1WG4 A;  3BR8 A;  4ZCM A;  4X4S A;  2EG1 A;  3ZZ0 A;  2GIR A;  2R7X A;  4GO7 X;  2W9A A;  2DCL A;  3L7P A;  3GP9 A;  1VHI A;  3CPW R;  4HI2 A;  5IFM A;  1JXL A;  4B3T F;  2B8Q A;  2IJR A;  3VGS A;  4DF8 A;  3UD4 P;  2JJ4 D;  4H4O B;  3C8Y A;  4OL8 A;  3PW2 A;  2LEC A;  3IP0 A;  3IXQ A;  4UF4 A;  1X5T A;  1U47 A;  2UXD J;  4OZN A;  3MUM P;  3H0P A;  2V50 A;  1EAR A;  2LQB A;  5KG3 A;  3NWR A;  2VF3 A;  1N5S A;  1U0H A;  1DQA A;  1S10 A;  4DOZ A;  1BY9 A;  3KUH A;  3VCD A;  3DN9 A;  4P74 A;  4WPA A;  2E7W A;  4HT7 A;  3OR1 A;  1MWQ A;  2UUC J;  4XK8 C;  4ZPA A;  4OHZ A;  1WEL A;  2UVU A;  5KOW A;  1NJX A;  1NJW A;  5D3G A;  3TO8 A;  5C24 A;  2HQ3 A;  4K4Y A;  1RWO B;  2OAU A;  4I6Y A;  2GVZ A;  2FHK A;  5HP1 B;  3BSN A;  1R0A B;  2X1A A;  3BSO A;  4B9V A;  2FHJ A;  1ZM4 A;  3M8Q B;  1MN9 A;  3GON A;  3C2P A;  5L1L A;  4WP8 A;  3NMR A;  1X9S A;  3MF5 A;  2W2Q P;  2UVR A;  3DOK A;  5KFL A;  4TYA A;  4ZVH A;  2DGT A;  2RS2 A;  2DNO A;  2VA2 A;  4RBV A;  1Q8I A;  1RJJ A;  1RA7 A;  1NLK L;  4OFZ A;  2YKM A;  4J37 A;  4PXD A;  1VLO A;  3ZO7 A;  4U96 A;  3CCS S;  3OV7 A;  3JB9 k;  1VS3 A;  4WBF A;  1YWX A;  3TNV A;  4P10 A;  4RU2 A;  1N32 J;  1W7W A;  3PEH A;  1REV A;  4ZK7 M;  3NXZ A;  1XR7 A;  3A8K A;  2GMJ A;  2VJV A;  4O4G B;  2WW8 A;  2LA4 A;  4LBI A;  4ERD A;  1TAU A;  3J7Z T;  4Y3C A;  1VQO S;  1RT5 B;  2MHN A;  3AAW B;  4E0D A;  2O5D A;  2GQC A;  1NKC A;  4CP5 A;  1ZTT A;  2ACM A;  3DM2 A;  2BJ1 A;  3QNW B;  2DNM A;  2RUG A;  2LEB A;  1GEH A;  5LMN F;  4DXL A;  5ETS A;  3D9B A;  3CNQ P;  5FII A;  2K7J A;  3TW0 A;  3ILO A;  1U1K A;  2HNY B;  2KM8 B;  1RA6 A;  2M52 A;  1R8B A;  1S48 A;  4DV4 F;  1QD1 A;  3UNY A;  1YIT S;  3L7O A;  4N8N A;  4NOH A;  4CLU A;  1NM2 A;  4LRF A;  1EQM A;  3M6W A;  3MFI A;  4JV5 F;  5CHC B;  2PFD A;  4MYT A;  2NSB A;  3V81 A;  3QFW A;  1GX6 A;  1J5O A;  3NBP A;  2NXU A;  2YKO A;  3P49 B;  3PXG a;  1AFI A;  3M30 A;  2B7C B;  1R8H A;  1MU2 A;  2IFX A;  2MKI A;  1QAI A;  3K17 A;  1LEO A;  2G0C A;  1HI8 A;  3GV5 B;  3DDI A;  1S6Q B;  2GHW A;  3RRG A;  1NSQ A;  4RW4 A;  3NLC A;  5KT6 A;  5KFV A;  3M32 A;  3TX8 A;  2A1B A;  1HNX F;  1YGY A;  1KTQ A;  1RT4 B;  1U24 A;  2UXB F;  2VPY B;  4M5D A;  3I31 A;  3VHQ A;  3GIL A;  4A8S A;  3NCR A;  2DGW A;  4B3M J;  3G9C A;  4A46 A;  1U7L A;  2ADC A;  4I69 A;  3H98 A;  4OJ3 A;  3ZTS A;  2CQP A;  3TAR A;  4DV5 F;  2X3G A;  2ZH3 A;  2EW9 A;  1KFD A;  1UTA A;  1M5P C;  2GIF A;  4DLG A;  5KFK A;  5KT4 A;  4CTA B;  3TX0 A;  3QGG A;  3OSN A;  2B6A B;  3M9O B;  2HRU A;  2ZDP A;  3V6D A;  3QIP B;  4FF4 A;  3BGR B;  4B3S F;  4TY8 A;  3H42 A;  4X66 J;  3BDP A;  1Q79 A;  2OD6 A;  4M5N A;  4MMO A;  2NQP A;  5IT9 U;  1V5I B;  1HBO A;  5LJ3 Y;  4K4T A;  1W2I A;  2YWW A;  4OIX A;  4OI1 A;  3GIR A;  4DFK A;  1X4B A;  2XZD B;  3PCO B;  5F8I A;  2BE9 B;  2PT0 A;  2ZBP A;  2ZWO A;  5DDP C;  4JI2 J;  4F2R A;  4ZN3 A;  1SH2 A;  3LWL A;  1VRU A;  3C6T B;  4OMF G;  3CCZ A;  1IKY B;  2G0I A;  2MQO A;  3N5B A;  3TVK A;  3G71 S;  5AXL A;  2HHH F;  2XMM A;  2J0X A;  3QT6 A;  4FVC A;  3Q8Y A;  1R8A A;  1G7C B;  2YNH A;  1LXN A;  5IXU A;  3J80 Y;  4JI3 J;  3IBC B;  2AP6 A;  1RT7 B;  5DQH A;  2F8H A;  4WFB Q;  2D9P A;  1WTF A;  4O3Q A;  4ZPB A;  3FRZ A;  2C3M A;  1QDU B;  3DLB A;  4ZLN A;  4UOH A;  2I9S A;  3O1L A;  3RZA A;  4DHV A;  1S0N A;  2MY8 A;  2JEF A;  1Q86 T;  1RT6 B;  2DNP A;  2LKZ A;  4ZCI A;  2R2S A;  2AYB A;  4PXE A;  2W7P A;  3N5F A;  1K44 A;  4Q5V A;  3JSY A;  4MKA A;  4NL5 A;  1VFJ A;  2J8S A;  1MN7 A;  1S7H A;  2YQ0 A;  4OHV A;  3OUY B;  2J9C A;  3S8S A;  3R7S B;  2BAC A;  1AB8 A;  4C3K A;  3DRR B;  5J2M A;  4K8R A;  3G82 B;  2BQU A;  1VLY A;  3BO4 A;  1HBN A;  4MIB A;  1SL1 A;  1SKW A;  1KEK A;  2JH3 A;  3AD8 C;  4LFC J;  3HSZ A;  3W66 A;  1H2U X;  3MR3 A;  2KXF A;  3W3S A;  4DL4 A;  1ZPV A;  4TXS A;  2H9Z A;  2A6O A;  2G2O A;  2OEL A;  2RIJ A;  1YJR A;  4ENO A;  1XJW B;  1YZ7 A;  4WYW A;  1C2P A;  1H6K X;  4Y34 A;  3N6L A;  3MPD A;  4Q45 A;  1DY3 A;  5T41 A;  3M1V A;  2Y0B B;  3MM7 B;  4YY3 J;  3DDN A;  3T5H A;  4DR4 J;  1YHQ S;  3G4S S;  2OKQ A;  2YWK A;  2RF2 B;  2NR0 A;  4ZHR A;  5ADZ A;  1WNE A;  2YKN A;  1R27 B;  4B02 A;  2ASD A;  2G13 A;  1R0B G;  4AT1 B;  3PZP A;  2OPP A;  3WBZ A;  3K0J A;  3R6L B;  5AJ3 J;  4MK8 A;  1WOO A;  3OSP A;  4A8F A;  2HIQ A;  1FD2 A;  2W9C A;  1DTQ A;  3GJQ B;  2GJF A;  2DBB A;  2ZIT A;  2W1B A;  4NWB A;  2XMU A;  2FLN A;  2PE8 A;  2HHW A;  4DFJ A;  2RB7 A;  3O2I A;  1HWI A;  2HHQ A;  1NB2 A;  2JC1 A;  1B0V A;  2OUG A;  5IM0 B;  2O1P A;  1VJQ A;  3T5L A;  2MTL A;  3OHA A;  4KB7 A;  3OFE A;  2YNF B;  4LMZ A;  3WHI A;  2YPY A;  3CC2 S;  4CLT A;  3EGZ A;  3JAM Y;  4C7Q A;  2HWT A;  3M6X A;  3Q22 A;  1DTT A;  2YY3 A;  1TMJ A;  5DM6 Q;  1NND A;  2Q6C A;  5J2Q B;  2MZR A;  4M94 A;  3IBW A;  4FPI A;  1NBE B;  1Q8B A;  3EXC X;  4LUB A;  1UZD A;  4ZVR B;  2UUB F;  4AFF A;  2ZH5 A;  1SI9 A;  1AT1 B;  4DR5 J;  4DV2 J;  3HFV A;  3NS7 B;  5DG9 A;  1X5S A;  2HQC A;  3KLG B;  1U1Q A;  4RUA A;  2B4V A;  4DR6 F;  1JX4 A;  5DET A;  1WHX A;  1VQ8 S;  5DQI A;  1JJ2 R;  2H1Y A;  5KG1 A;  3IS9 B;  4M5K A;  1NHV A;  2CA9 A;  1FJE B;  3HHD A;  2QSF A;  1NXI A;  3I4P A;  1JLC A;  3VTI A;  3RBE A;  3I0R A;  1X60 A;  1KP6 A;  2QO3 A;  3G2X A;  4DX5 A;  4RWX A;  3K5M A;  4DPY A;  1JLF B;  2L9W A;  3ZTO A;  3E2E A;  2XTJ P;  1O5J A;  4HVZ A;  4Y65 A;  3KLI B;  4P9S A;  1HNZ J;  1FWL A;  2DEI A;  1KHW A;  4DX8 H;  4L6V 3;  1BQM A;  4Y00 A;  3PKM A;  1FTR A;  2BXJ A;  3PKY A;  1KDN A;  2B0G A;  3NOG A;  1EX8 A;  1YRX A;  4NCG B;  3BH6 B;  3A4T A;  1LKZ A;  1U6Z A;  2QT7 A;  1WD6 A;  3W9I A;  3KWM A;  4DV0 J;  1WI8 A;  3HK2 A;  3MR7 A;  3W5X A;  4V19 J;  2DKO B;  3LGH A;  1D3W A;  1IKW B;  2AJF E;  3D6F B;  3SMZ A;  1S77 D;  2CPH A;  2CUY A;  2V2Z A;  5DS7 A;  1N34 F;  4AL5 A;  4LQ3 A;  3I9Z A;  5KFQ A;  2OJ3 A;  2HAF A;  3MM5 B;  4P2S A;  4ZVP B;  4V1A k;  4IH6 A;  1DLO B;  1S1W A;  2FY1 A;  4GKK F;  3OTO J;  3RJM B;  3O44 A;  3GV8 B;  2QA2 A;  1H2V Z;  1K47 A;  1S97 A;  3SZ2 A;  1FHT A;  1OIA A;  1H7W A;  1YJN S;  4IG3 B;  1HBM B;  4RNN A;  2RUS A;  1NHK L;  5GAG U;  1J5E F;  1NK7 A;  2AJ1 A;  1W26 A;  1RTI B;  4K7Q A;  3J81 U;  5KFE A;  3CDE A;  1JJH A;  4KFB B;  4DL0 C;  4UOF A;  4PG6 A;  4NLR A;  2XI3 A;  2QX0 A;  1LW0 A;  5D4L A;  3G6X A;  3TZZ A;  3FJ2 A;  3Q23 A;  2DGO A;  1R31 A;  1MLA A;  7FDR A;  3H20 A;  4YFU A;  2I6W A;  3UQS A;  3SFG A;  2OTJ S;  1VBY A;  3VAK A;  4AQY J;  3HPO A;  2FGC A;  2JEG A;  1F9H A;  1UP1 A;  3CF5 Q;  4Y2K A;  4C8N A;  3H40 A;  4CLZ A;  5CCL A;  1T9U A;  1UAW A;  1WEY A;  2C2M B;  1LWE A;  1FRX A;  1N54 B;  2ZVI A;  2XMV A;  5HLF B;  1BQX A;  1BGX T;  4G1Q B;  3MD1 A;  3CW2 C;  4U7C A;  3W9H A;  4H4M A;  4J5O A;  1ROF A;  3U1M A;  4RW7 A;  4DR1 F;  1X9M A;  3HHN B;  4J90 A;  4NI2 A;  2XMA A;  4QR2 A;  3HFZ B;  3UN2 A;  5EDW A;  1U1R A;  3OUY A;  4EO8 A;  3PRB A;  3EGN A;  3FSX A;  1UFW A;  2ZE2 A;  3UD5 A;  2HHT A;  3DRR A;  4B9L A;  3AFG A;  3MM6 A;  3I55 S;  5LXR A;  3BKT A;  2FLO A;  3AD7 C;  3IFE A;  1RT3 B;  4ZPW R;  1FTC A;  2B9W A;  1SJR A;  4F0H A;  3TJA A;  5EX0 A;  2DIV A;  1JLB B;  2KVQ E;  4URG A;  2ZD1 A;  2FD2 A;  2CWK A;  4P2X A;  2EKN A;  3QGH A;  1D8Y A;  1U49 A;  2AEF A;  2Y1L B;  1T05 B;  1TL3 B;  4YB1 P;  4O44 B;  2HFS A;  4KKO A;  3BO2 A;  1X0F A;  5CYJ A;  2E9Z A;  1RZM A;  4CYU B;  1ZBT A;  3FQL A;  2J6S A;  1BD6 A;  3H90 A;  3QRR A;  4QWD A;  2P5V A;  3HVT B;  2ZBI A;  4YHH J;  2KFZ A;  5C42 A;  2DNL A;  2XSF A;  1RAB B;  2B4P A;  2R42 A;  2BJ7 A;  3JQM A;  2R4F A;  2CNN B;  1Y9O A;  2RRB A;  4BCA A;  1WHW A;  3SQG A;  1QE1 A;  5KG2 A;  2NXE A;  1XNR F;  4R5P B;  4C2M A;  4NLO A;  1SQF A;  1YJT A;  1S0O A;  2XMK A;  1ZZF A;  2GVD B;  5KFG A;  2IM1 A;  1ZTW A;  2RU9 A;  2VU5 A;  5EWF A;  3DLE B;  3AB4 B;  5J2N A;  2ZH6 A;  1WDT A;  3NEK A;  4LF7 J;  5M2R A;  4I2P A;  3S01 A;  2QA4 G;  2B4U A;  2NPF A;  4JI8 F;  1CQM A;  2B9X A;  5IM0 A;  2DHG A;  5A76 A;  5B0G A;  3DRX A;  4LJM A;  3T9N A;  2X7I A;  4GVB B;  1SJF A;  2HS3 A;  4DQP A;  4UT4 A;  1WHV A;  1IN0 A;  1VYA A;  4ES2 A;  1BQN A;  2BAB A;  3FBF A;  2XQC A;  4RLE A;  1HLW A;  2HFN A;  2W4P A;  3EE3 A;  3Q89 A;  1VIO A;  5THW A;  2R7W A;  3HHE A;  4YS2 A;  2HVH A;  1NEE A;  4PQU B;  1P9Q C;  3TZY A;  2B3T B;  5I4M A;  1AUS L;  3M8R A;  1M5H A;  2CAD A;  4NXN J;  4EYI B;  5FJ4 A;  1JXV A;  2DRB A;  5ETT A;  4NEY A;  4IKA A;  1IJF B;  3C3L A;  2F4V J;  2XEX A;  3CJ5 A;  1QAY A;  3ITH A;  2MKJ A;  1P6T A;  4U67 Q;  1UL3 A;  3DNC A;  5K14 A;  2HG4 A;  2FZG B;  3A3O B;  5D6G A;  1HQE B;  3KHR A;  4KQZ A;  4NRT A;  1KOH A;  3D1H A;  4YN3 B;  1G2E A;  4P72 A;  4QW8 A;  3K2Y A;  2XY7 A;  2J7W A;  3W2W A;  2HW3 A;  2CNO B;  3BBF A;  2XLI A;  4JI4 F;  2BKP A;  2R9L A;  4LR8 A;  2MQP A;  3T1Y F;  3AB2 B;  4JOU A;  3F56 A;  4OQJ A;  1KRP A;  2ZC4 A;  1P9Y A;  2W7O A;  4HH0 A;  4U9R A;  2KYX A;  2DR8 A;  1HNW J;  2FUG 9;  2IA0 A;  5DDO C;  3C6U A;  3KMQ A;  2HZA A;  1G3O A;  2E44 A;  3W1Y C;  3AXK A;  3P5B P;  4U8V A;  4F4K A;  2VG5 B;  2E1M C;  4TKT A;  4GMK A;  4ECV A;  2VG6 A;  1CJK A;  4NLW A;  5L9X A;  2HWI A;  4DV1 J;  1HNV A;  3JTP A;  3HVW A;  4IFY B;  3A3P B;  2FLP A;  1VGY A;  1C0U B;  1VQL S;  2DHS A;  2D1C A;  1XMO F;  3SIP B;  4EFA C;  3Q0A A;  2NZC A;  1FO1 A;  4TYB A;  4Y2I A;  2ADB A;  3W8G A;  3KDO A;  4FBT A;  4OLP A;  2JVO A;  2V8V A;  3OHB A;  2XZW A;  4TQS A;  2CPF A;  4RW6 A;  2RHQ B;  4WYL A;  3E01 B;  4OJG A;  1ZS6 A;  2DR6 A;  3OXL A;  2KVI A;  2VH7 A;  1TP7 A;  4JYA F;  2ZNZ A;  3L7U A;  3GIK A;  5U47 A;  5FLX Y;  3V4I A;  4LR7 A;  4R8U A;  4NXM F;  2Z30 B;  2VBW A;  4LRA A;  4OYZ A;  4LFB J;  3CGI A;  1F1B B;  2LXI A;  3A8I A;  4N47 A;  3DGP A;  4KH0 B;  4RNH A;  3J7Y I;  3HI9 A;  2VPW B;  4LRE A;  3LO3 A;  1EZZ B;  3GQC A;  1U1L A;  3VZI A;  4P7V A;  3H2V E;  4PWD B;  3AJ1 A;  3BGO P;  2GW8 A;  5IT4 A;  5CAB A;  1YK9 A;  1TKX B;  5D0G A;  5T14 A;  3QYY A;  2D3O R;  3C14 B;  3DYA B;  1FEH A;  4ED8 A;  1KLM B;  4MKB A;  2XYG B;  4F0K A;  3HCX A;  1S6P A;  4QR0 A;  1HNI A;  2FGO A;  3IRW P;  3HT3 A;  3PW0 A;  3C15 B;  1T9T A;  2KH9 A;  1T9V A;  4X62 J;  2AGO A;  1RWK B;  2IRY A;  3CD7 A;  2H65 B;  4X2B A;  4UQT A;  3T41 A;  1JK9 B;  5F8L A;  3BBC A;  2NXJ A;  1HYS A;  5D8H B;  1CUL A;  3GYX B;  2PII A;  1SL2 A;  3R5J B;  4PQA A;  1TL7 B;  2VZ9 A;  3ISN D;  4ALZ A;  5HVF A;  1WSV A;  1IJE B;  3PW7 A;  3RAX A;  1HA1 A;  5KT7 A;  4CIO A;  5KFY A;  4ITS A;  4OHY A;  3MMB A;  4ER8 A;  2RQC A;  4AL7 A;  3HUL A;  5HL7 Q;  1OWX A;  2I2Y A;  5HK4 A;  4CLW A;  1S7I A;  4FXW A;  4IYQ A;  2DY1 A;  4EI2 A;  3FEX B;  1XNQ F;  4DFP A;  2VA3 A;  1NPR A;  5HQ8 A;  3J80 U;  3W9J A;  2QFJ A;  1JLA B;  2HGM A;  2G9O A;  4Z7Y A;  1O0P A;  4MTP A;  1KTV A;  2MHE A;  3GLJ A;  4IR9 A;  5EHH A;  2EFP A;  3EVW A;  2YH0 A;  3I96 A;  2NRE A;  2CKW A;  4OZ1 A;  5LL6 d;  4RL1 A;  1K73 T;  1FRL A;  3R5G A;  4Y2A A;  1GMV A;  3HM9 A;  2IYI A;  3TJ9 A;  3P4U B;  2F65 A;  2QL7 B;  3ET6 B;  5G0R B;  3HMJ G;  4FYW B;  2VBY A;  3A12 A;  1RTD B;  2MKS A;  3CIZ A;  3KJF B;  2IJF A;  2HRY A;  2CQ4 A;  1HQU A;  3PR5 B;  1Q8L A;  5I3U A;  3H4D A;  1SV5 B;  3KK1 B;  1NJZ A;  4QWB A;  2F4F A;  4DEZ A;  4F4W A;  2DPI A;  3GJS B;  2UUA F;  4Z37 A;  4R5P A;  8ATC B;  1VBZ A;  5GAE I;  2UXC F;  3IG1 B;  4ZVE A;  1SUQ A;  4FYD A;  3I56 S;  2HS0 A;  3KLE A;  2B4O A;  2KU7 A;  1W2B R;  4F2S A;  4R0J A;  1FXD A;  3OLA A;  1JLE A;  2BAN A;  3BQ1 A;  1NK8 A;  2AJ4 A;  4JI5 J;  5JMN A;  3VQT A;  2VL1 A;  1P1L A;  3ILL A;  1KC8 T;  5ETR A;  2JDJ A;  1PC4 A;  4Q7A A;  1Y7P A;  2RDD A;  3BM7 A;  2CYY A;  3SCL E;  3U1L A;  3CC4 S;  4NZ0 A;  1LK5 A;  2DRD A;  4ZOS A;  3MWB A;  5A8K B;  1QTN B;  1XMQ J;  5KFH A;  4FYY B;  5K9F A;  2PMH A;  2DGU A;  1UFL A;  2AU0 A;  4LF8 J;  1FXR A;  2XO7 A;  3QZ7 A;  4DBQ A;  1N8R T;  1T3N A;  2IM0 A;  1SQE A;  5BYS A;  2YNI A;  3UCU P;  2JL9 A;  3HHL A;  1X4E A;  1C4C A;  3RAM A;  2RJZ A;  2VG7 A;  3NWG A;  3T6B A;  3MMA B;  2VON A;  1RHU B;  3PFE A;  2LEA A;  5ETM A;  1YSJ A;  1HMV B;  4LF4 J;  3G96 A;  4RBT A;  1ULR A;  1FKO B;  2B8P A;  2F40 A;  6FD1 A;  4RW8 B;  3CCW A;  4F4A A;  5E3C A;  4KJI A;  1GFW B;  5GAD U;  2VOP A;  3KUG A;  2R2R A;  3P3D A;  2YXL A;  4LSZ B;  1AZS A;  3OL8 A;  4ZP6 A;  2CDQ A;  2W25 A;  3GJR B;  1MG7 A;  3JAM U;  5K8N A;  3QRP A;  4GC7 A;  2AZ3 A;  2M4M A;  3CCR S;  3PW5 A;  2XWX A;  1J27 A;  1V3S A;  2UU9 F;  3D6H B;  2VHG A;  3DC2 A;  4CI0 B;  4V19 X;  3HVA A;  2AYG A;  3W5Z A;  4F7V A;  2RH3 A;  5HAO A;  4OI0 A;  1J2V A;  1GTH A;  3T5J A;  4RNM A;  4L76 A;  1O8B A;  2L3M A;  4EMD A;  2VQF J;  1FX2 A;  4EYH B;  2Y8W A;  5ETQ A;  4ID5 B;  4DPW A;  2ZZM A;  1WAC A;  4NE9 C;  4B3O B;  3JSB A;  4Q43 A;  4F25 A;  4XDD A;  1ZA1 B;  2DJW A;  4K4Z A;  4HAC A;  1L3T A;  3KLF A;  2YQ1 A;  1NAQ A;  2W9B B;  1S76 D;  4F4Y A;  4RU9 A;  3FFI A;  1S1T B;  4RW9 B;  2DNN A;  1ZPW X;  1HFE L;  2APO A;  1LFW A;  1VQY A;  2CPI A;  1NJI T;  5A6P A;  2HFU A;  5KFZ A;  5ETO A;  3UDV A;  1EP4 A;  1HQ2 A;  1PYS B;  2WAQ D;  2VQE J;  1PO6 A;  4ECY A;  2A2D A;  3DI6 B;  4ZCL A;  2J9D E;  2M88 A;  9ATC B;  3E01 A;  1HPZ B;  2OPS B;  2IPO B;  3KNG A;  1UPM B;  2AHO B;  3KK2 B;  3GYN A;  2W2N P;  2FC8 A;  5LOQ A;  5A8R A;  3K57 A;  1FD8 A;  3BRE A;  4ELV A;  1T3O A;  1JLG B;  1RTH B;  4EK2 A;  5L46 A;  2XWY A;  3DMJ A;  4YR0 A;  2W2O P;  2H5E A;  3GCX P;  1AFJ A;  1I3O B;  1KQK A;  1RAI B;  3NGD A;  3U7J A;  3NS6 A;  1NCL A;  1VR6 A;  2H4W B;  4NYO A;  2FHO B;  5KG6 A;  4DX7 A;  5B08 A;  1TVR A;  2MQL A;  2XMJ A;  1L3V A;  3FMB A;  3C16 B;  2DR9 A;  5ITH A;  5KFR A;  2CAJ A;  5ETV A;  1FRK A;  4O3P A;  1Y0H A;  4K2J A;  3SI8 A;  4P2F A;  3KNA A;  4WII A;  4K5R A;  5D4O A;  2EG2 A;  3MEE A;  4FKX A;  2M2B A;  4ZIV A;  2M3D A;  4XDC A;  2ZZN A;  3D6M B;  1BC6 A;  3QJL A;  4ZVT B;  3CSK A;  3JYT A;  2C42 A;  3PY8 A;  4G6V B;  3D0H E;  4AND A;  1AA1 B;  4KYZ A;  4QW9 A;  1GAO A;  3D3B J;  3FCW A;  2N3O A;  1RTJ A;  4DUY F;  2BVZ A;  4ECT A;  1Q78 A;  2GQ2 A;  5AT1 B;  4MJK A;  5J1N A;  3PM9 A;  1Y5I B;  2GML A;  1D0E A;  1VIS A;  3MED B;  4AYB D;  1NB7 A;  2HNZ B;  3LWM A;  1LWF B;  1KQF B;  2WVE A;  3M6V A;  1GMW A;  1TUV A;  5SZT A;  4X64 F;  5CYM B;  2XS7 A;  3LPE A;  3PX4 A;  1KNZ A;  2C2D A;  3KG1 A;  4LF6 F;  5DG8 A;  3HKW A;  2Q3P A;  4QIF A;  2DNY A;  2HQD A;  2PC6 A;  4X4Q A;  1N4L A;  3PJX A;  2EXU A;  3GFY A;  2BYC A;  3LAM A;  2HUR A;  2RIL A;  1JJC B;  3M2V A;  3R7N B;  2WB4 A;  1C1C B;  5EN1 A;  1U09 A;  5A6W A;  2ALZ A;  3HKZ D;  2FPH X;  3OR2 B;  1PIE A;  3DFE A;  2CG8 A;  2J9E A;  4WP3 A;  1FK9 B;  2B51 A;  1A6L A;  3FBC A;  1YRU A;  4BBY A;  1CJV A;  2QLF B;  2BMB A;  2WON B;  4M1K A;  3NAI A;  4QPT A;  3ISZ A;  1BLU A;  1U6B A;  2GAG C;  2BA9 A;  2ZH2 A;  4Q0B B;  1A0O B;  1FKP A;  4KHP F;  1S9E B;  2E1P A;  1RAA B;  2WVC A;  1WF1 A;  2HIY A;  4L3N A;  4OX9 F;  2X1F A;  1E6V B;  2MEW A;  3NOC A;  3PYG A;  1DBD A;  1VRT A;  3L95 X;  2B5J B;  5KT3 A;  2E7X A;  1FES A;  2CJQ A;  4F04 B;  3X1L B;  1RT1 A;  2DXE A;  1FDD A;  1UET A;  1CC8 A;  1KFS A;  2MB0 B;  1Z4U A;  2CQ1 A;  2BRL A;  1FRJ A;  1YBT A;  4EZ9 A;  4TNO A;  4EZ6 A;  3J81 j;  4O4R A;  5JUM A;  2DCU B;  4WFA Q;  3KKF A;  2VDH A;  4W4M A;  5ETN A;  5KFI A;  2HVE A;  3CD0 A;  3GG0 A;  2LEP A;  3TR5 A;  2ATL A;  4USW A;  2J7K A;  3MOJ B;  4USU A;  4TU8 A;  5K20 B;  4ECS A;  1XBW A;  4O3N A;  4N7T A;  2GGP A;  4DUZ F;  3DHW C;  4C0O C;  3H7H B;  4ANC A;  4PYA A;  1ZOT A;  3M8W A;  3FEZ A;  1VJW A;  1YRT A;  3E3X A;  4U7U K;  1KVJ A;  4KH1 B;  5J2P B;  2FLL A;  1RAC B;  2W2P P;  1TKZ A;  4PAB A;  3HLU A;  5K8P A;  3AY0 A;  2YWF A;  2OPQ B;  3BN7 A;  2R7Q A;  2V8H A;  1DRZ A;  5HVG A;  1D09 B;  4C11 B;  5GVQ A;  4G1I A;  1R6Y A;  4Y28 C;  1B0T A;  1BWV A;  5RUB A;  4LBP A;  1WKJ A;  4PCQ A;  3MMA A;  1WOS A;  3AQP A;  5CXT A;  3ELH A;  2MST A;  2Z8Q A;  2WVF A;  1BUX A;  1YVF A;  1MW7 A;  4RW8 A;  3D3C J;  4L73 A;  4LSL B;  4KAI A;  2AD9 A;  5GMD A;  2JEI A;  1RWV B;  4I56 A;  2HKE A;  1RAF B;  3OBI A;  2AGQ A;  2A6M A;  2MQN A;  2K1R A;  2KHD A;  3LP0 A;  4CT9 A;  2GO9 A;  1RT2 B;  3G8T A;  3OQ2 A;  1RWP B;  2MKY A;  2V0N A;  2CNL B;  3B4M A;  2LDI A;  3ETM A;  2AKW B;  3FMW A;  1YQH A;  3ZXW A;  3OPK A;  1E6Y B;  1EJ7 L;  1JKH A;  3IM9 A;  3AJ2 A;  3AOB A;  3ADA C;  5ETP A;  1OO0 B;  4NLS A;  2VKZ G;  3IAS 9;  2VPX B;  2F7V A;  5CD4 A;  1UVK A;  1S1T A;  2MDA A;  2HS4 A;  1F3V A;  3EMT A;  3OW2 R;  1Q7Y T;  1S9F A;  4D3G A;  2L08 A;  4PPD A;  1BE4 A;  1C0T B;  2AX1 A;  4QYR A;  4JI6 J;  2WSE C;  1UVL A;  2C3P A;  1B7F A;  1WOP A;  3PYE A;  1IBL J;  3B6B A;  3UN3 A;  1C1B B;  1T02 A;  2GFF A;  3NGT A;  4G3I A;  4LFA F;  4WE1 B;  2WRM A;  4A4J A;  1JLG A;  1RTH A;  3GJT B;  3N28 A;  4ATN A;  3VVU A;  5F41 A;  4NLX A;  1URN A;  1DQ8 A;  3CCL S;  4E2F B;  2HND A;  4CCH A;  1HR0 J;  2OIH A;  3F0N A;  4FZV A;  3GWC A;  5DGA A;  1QAJ A;  5K8M A;  1RWX B;  2QA4 S;  4FKY A;  3LH2 S;  1LWC B;  4MT1 A;  5FDL B;  5GAH U;  2QGF B;  1RYR A;  3CUL A;  4DJB A;  2BE2 B;  3FC9 A;  3GII A;  2DD8 S;  4DQQ A;  4LSN B;  2ZUG A;  2OO4 A;  2V8D A;  4OLO A;  2CZV C;  2ZBQ A;  3D6T B;  3NNH A;  4HHH A;  1KVK A;  2IDE A;  3NG8 A;  3POT B;  2Z4P A;  1URR A;  1IKX A;  3MMC A;  1F6T A;  2YNG A;  4H4K C;  2BJE A;  4CO4 A;  3QZ8 A;  2RAQ A;  2VUG A;  1TKT A;  4NMX A;  1YKW A;  4J9L A;  5FLX U;  2YPZ A;  4UUX A;  4N56 A;  3D1O A;  2LU2 A;  4UY8 5;  2IBO A;  1R7I A;  4KV8 B;  4PUO B;  2V8P A;  1Q5Y A;  2KRB A;  2ZNY A;  5J1P A;  1MNE A;  5HO4 A;  5T7L A;  3B54 A;  3M2R B;  3QO9 A;  3AJD A;  2HVI A;  3M05 A;  2O3D A;  2ROG A;  4LF9 J;  1VBK A;  3LOU A;  5KFJ A;  3M7V A;  5I42 A;  1R89 A;  2DK2 A;  3DRS A;  3BGL A;  5C2C A;  2OH2 A;  2HBY B;  3GR0 A;  2IY5 B;  3QT8 A;  3QT7 A;  4QWC A;  9RUB A;  1VK8 A;  2PA8 D;  1JNZ B;  1ZAW A;  3AA8 A;  3K7R A;  4KY3 A;  3LP2 A;  1QSL A;  1L3U A;  2HBZ B;  5LMU F;  2V9K A;  3M8P A;  5BR8 J;  3FQK A;  2BJ3 A;  3JSM B;  5F9L A;  3ZZP A;  1FER A;  2WON A;  5GMK a;  2R8K A;  4DV7 J;  4ZLP A;  4QWA A;  4LF5 J;  1FJC A;  4JI0 J;  5CCM A;  2ZC3 A;  1S6U A;  2IAJ B;  2IMO A;  3FNN A;  3R5C A;  2XY5 A;  1FNM A;  2DVI A;  1CJU B;  1N6Q A;  2EFO A;  3PO5 A;  2ZJP Q;  4UTG A;  1Q8K A;  3O8W A;  4F02 A;  4MAK A;  3A1Y G;  2JRS A;  1ICE B;  5B09 A;  2H5I B;  4W98 A;  5AXN A;  1H74 A;  3QBC A;  3OL7 A;  2XO6 A;  2Z2Y B;  2HVZ A;  2VAS A;  4QR1 A;  4N41 A;  1T03 A;  4DPU A;  3CJR A;  1A9N B;  3QPI A;  4MFB B;  5HSP A;  1VQP S;  3P96 A;  2DHX A;  3PJW A;  1T7P A;  2ROP A;  3AXM A;  1FRI A;  3M4X A;  3VAL A;  3GYG A;  3KFW X;  3SEO A;  3ENW A;  1NPP A;  1TFW A;  1S49 A;  3QLH A;  1WSR A;  3DXB A;  1IR2 A;  3UDC A;  2DGQ A;  3PX6 A;  4CQ1 A;  3MCO A;  4BS2 A;  2JFD A;  3SFU A;  4CO1 A;  2VBX A;  1S1X A;  2V9W A;  3UO0 A;  4AD6 A;  3W8P A;  2DO4 A;  3N4W A;  4N76 A;  2CQG A;  5A0Y A;  1S1V A;  3MM8 A;  4NZ7 A;  2RKI A;  1RLD A;  4A8Q A;  5LJ5 Y;  2CFX A;  5C2G A;  2FIU A;  3BGU A;  2OPR A;  2I5J B;  2PSZ A;  4DL5 A;  2V8G A;  4K4U A;  1FJG F;  1U45 A;  1IBK F;  2BX6 A;  3ZZR A;  1GXL A;  2CJB A;  3Q8P B;  3AQO A;  1SJ4 P;  3R6G B;  2MGZ A;  3PR4 A;  4QJV A;  4NRU A;  4FXV A;  3KOA A;  4JI7 J;  2CJK A;  3MEG A;  1DJ0 A;  3CDB A;  4DSK A;  2C2K B;  3H5U A;  3DRP B;  2ZHA A;  4X4P A;  1XIQ A;  4ZLJ A;  2VDI A;  1QTM A;  2WBR A;  3M8Z A;  4NLY A;  4FVM A;  3HSG A;  4RR5 A;  4WU3 A;  3IBF B;  2ZM6 J;  1FEE A;  2KTQ A;  1U2F A;  3W2V A;  2R8J A;  2A10 A;  2C2N A;  1UPP A;  2AEJ A;  3DU6 A;  1RHQ B;  1TK5 A;  4ZCK A;  1SH0 A;  3VGT A;  4IH7 A;  4CLL A;  1RAH B;  4C8Z A;  5LXY A;  4BC9 A;  4I0W A;  4M5G A;  1TMM A;  5G4D A;  1K0T A;  1FFG B;  2KKH A;  6AT1 B;  5DRK A;  4DV6 J;  2IM3 A;  2EFV A;  4IDK B;  3QT5 A;  2BE7 D;  1CS4 A;  2DHH A;  3HP6 A;  3M2U B;  3MXH P;  5BJR A;  2GMH A;  5A8W A;  1CQN A;  3KLH A;  4K4X A;  4UST A;  4TN2 A;  3F44 A;  4B3R F;  2MXY A;  2KJW A;  2E5L F;  4URS A;  3CD6 S;  1H73 A;  3EUN A;  2HMI B;  4U7U D;  3Q2S C;  3WQP A;  4GKJ J;  4K2X A;  4ZP8 A;  2D3Z A;  3ZTQ A;  3NGU A;  3H5X A;  1WWH A;  2XCA A;  1N36 J;  3CDW A;  4PYD A;  3H5S A;  3K5P A;  1MRO B;  2E5G A;  3SV4 A;  1KS2 A;  1HBU A;  1XQI A;  4USM A;  4ANE A;  3TRG A;  3DOM B;  5KG0 A;  1P27 B;  2J0W A;  4C6A A;  4ECQ A;  4DPO A;  4F0M A;  4ICL B;  3MPY A;  1Q95 G;  3EDQ B;  2CJX B;  4F26 A;  1GK8 A;  1GT8 A;  4UZC A;  2AEM A;  5F9N A;  3OFF A;  2WBM A;  2IC3 A;  4KHM A;  4ES1 A;  1LK7 A;  5C25 A;  3AT1 B;  4JI1 J;  1XWL A;  2GZO A;  1QSY A;  2ZH7 A;  4KGZ B;  5KG5 A;  4LSN A;  5I3Q A;  3IO1 A;  5B0A A;  1FKA F;  4KC5 A;  4EUV A;  3NY0 A;  5H9E J;  1BWE A;  2FYX A;  4DV3 F;  3D28 A;  1OPI A;  4Y2C A;  4EU0 A;  3TA1 A;  4I2Q B;  2BM0 A;  1IM4 A;  3CCT A;  2QTW A;  2IBK A;  2C2R A;  4RNO A;  2GHV C;  1OYD A;  2UV8 A;  1I94 F;  1NKB A;  5IC4 B;  3CCE S;  3KYL A;  1MWY A;  4QCL A;  1WDD A;  1R43 A;  3DLG B;  3TAM B;  4RBU A;  4I6A A;  2ZBR A;  3VAG A;  1HIY A;  2VOD A;  3VF0 B;  5HRO B;  1EB0 A;  1TV6 A;  2ZWP A;  3RW6 A;  2PGC A;  1FI4 A;  2JZ5 A;  1DUR A;  4U95 A;  3EJM A;  2D74 B;  2NZ4 A;  3I5C A;  2K3I A;  2PEH A;  2Q79 A;  4IG0 B;  5KFN A;  3VAM A;  3LP1 B;  2N3L A;  4DZ6 A;  4ZIW A;  1QVF R;  1SBR A;  1M5V C;  3UDL A;  1EET B;  1KHV A;  2E29 A;  4CH7 A;  4QZV B;  4P52 A;  1RHM B;  3TVY A;  3BKF A;  3RG6 A;  1S9G A;  5F3Z A;  4ED7 A;  1HI1 A;  3QJP A;  5DJB A;  2MKK A;  4EEY A;  4P6Q A;  2Y3Y A;  3VV2 B;  4ID8 A;  3HDS A;  3VQS A;  4P2M A;  3T1H J;  2OP5 A;  4KBI A;  2FHM A;  3VAH A;  1X4A A;  1EAY C;  1NO8 A;  4F50 A;  7AT1 B;  3DXS X;  2V4R A;  4PPZ A;  4RWW A;  3IRX A;  3VVT A;  3MAQ A;  2J0Q D;  4XIU A;  3T3F A;  2HBQ B;  2PMW A;  4OJ1 A;  4IR1 A;  2OLW A;  2UXD F;  3RU0 A;  4HHU A;  2DTJ A;  3MOZ A;  3GU0 A;  2X3D A;  3HD1 A;  4MK9 A;  2JWN A;  4HDH A;  4ZVU B;  2XB2 D;  2WVB A;  2JX2 A;  4J91 A;  4DS4 A;  4C0H A;  3OTC A;  3ZTP A;  3DGV A;  2ZFH A;  4NYP A;  4HYK A;  1B70 B;  2CRL A;  4ILL A;  2CZ9 A;  1HHS A;  1N52 B;  3CJK B;  2ZHB A;  1UWB A;  4MFB A;  1TTH B;  2LDY A;  5IWA J;  5J1E A;  3IM8 A;  3DLK A;  1O51 A;  4M95 A;  2WOM A;  4IRD A;  3Q8V A;  1B64 A;  5E33 A;  1PJ5 A;  3R8Y A;  2VJU A;  3CD5 A;  3RR7 A;  5CD4 H;  4KO0 B;  3TAQ A;  2WHO A;  3A8J A;  3P45 B;  5AXK A;  1N33 J;  3IWX A;  1RQ0 A;  1QY7 A;  3D54 A;  1JLQ B;  1LQ9 A;  2Y1J A;  2C3Y A;  2FQQ B;  2AQ4 A;  1ACM B;  3NCQ A;  3DOL A;  4OI2 A;  3L4B C;  3AD9 C;  2PN6 A;  1N32 F;  2ZHO A;  1NKE A;  2UVV A;  1ZET A;  4Q8F A;  4OV1 A;  2V4J B;  4OYI A;  1RGV A;  1U2R A;  2BDP A;  4K4W A;  1FJ7 A;  5KAK A;  1N88 A;  2VC0 A;  1KWM A;  3M8Y A;  2RSQ A;  1CJT B;  1SJ1 A;  1S1U B;  3V5R A;  3OD2 A;  2DNK A;  1NDP A;  1MML A;  1TL1 B;  2WB1 D;  2KFY A;  1N0V C;  3MGJ A;  3I0S A;  2HVD A;  1GMU A;  4B17 A;  3EX7 B;  2N7Y A;  3FSY A;  2D7S A;  3QGI A;  1N5Q A;  2VFU A;  4PZV A;  1OJ4 A;  5KFC A;  1RHJ B;  4DU8 A;  3FGV A;  3OXF A;  3U02 A;  4WKY A;  1IBM J;  3DLJ A;  2FJV A;  3FK4 A;  5D77 A;  3KG0 A;  3BSC A;  1NH7 A;  4X4O A;  2XGQ A;  3MCS A;  4WK3 A;  4UOG A;  2KZZ A;  2I0X A;  3CJ8 A;  2M8H A;  1ZAV A;  2V68 A;  1UJ5 A;  1Q4R A;  2CG4 A;  2FJD B;  2XSJ B;  3IMQ J;  4OHW A;  4H4O A;  4ZN1 A;  3SDE B;  4O23 A;  1B4S A;  3RAQ A;  1OS5 A;  2JLF A;  1TL4 A;  2H4Y B;  1AW0 A;  4ECX A;  2K06 A;  2HMI A;  5B0D A;  1QM9 A;  3L09 A;  1H2T Z;  1VC6 A;  5F0W A;  1VQS A;  2P9G A;  5CYQ B;  4ED5 A;  4DG1 B;  2F3J A;  4CRJ A;  1UWA A;  1G6B A;  3BH7 B;  3FCH A;  1UEU A;  4K0K J;  1QAX A;  4ZMM A;  1YJ7 A;  3HZE A;  2CQB A;  1D8Z A;  2CVI A;  2LVW A;  2QRR A;  4ES3 A;  2ABY A;  1RAJ A;  2BQ3 A;  4IFV B;  2WCX A;  2CQ3 A;  2DEJ A;  2QLB B;  2RT3 A;  3G6V A;  4DR2 J;  2YVS A;  3UVJ B;  4CH1 A;  3MMJ A;  4AXJ A;  3O3L A;  5DQG A;  2BW7 A;  3IR7 B;  4B3M F;  4ICL A;  4QYZ K;  2LLZ A;  2YX4 A;  4B08 A;  4KPC A;  3K5N A;  1NJY A;  2CPX A;  3GFX A;  2CQH A;  4USK A;  5IS2 A;  4JV1 A;  5HP1 A;  1R0A A;  1VQ6 S;  1F60 B;  5AXM A;  5KG4 A;  3M8Q A;  3GV7 B;  1A7G E;  4RX6 A;  3DKD A;  1WC0 A;  1TUW A;  4XPE A;  3OVB A;  2ASY A;  4DR7 J;  2HRT A;  3BSA A;  2L41 A;  4X66 F;  3DRY A;  2DXD A;  4KGV B;  4J9N A;  2ZH9 A;  2QLX A;  2N7C A;  2J6T A;  5IC6 B;  4I2Q A;  4YB7 A;  2KG1 A;  1KLN A;  1RWM B;  2Q43 A;  4DR3 J;  4NAS A;  2FVP A;  2CPJ A;  3PDN A;  4ZKA A;  4WXW A;  1ZZN A;  1U0H B;  2QZ8 A;  2QA1 A;  5GAD I;  4JI2 F;  2AW0 A;  3ULH A;  5JJB A;  2DNG A;  4O4G A;  3SQO P;  3OR1 B;  3TAM A;  1YZ6 A;  3TUI C;  2D9O A;  3FDS A;  3LW5 C;  5D4N A;  3OL6 A;  5D3G B;  3NNC A;  2U1A A;  5C24 B;  1RT5 A;  1YG0 A;  2SXL A;  4O3S A;  3UDE A;  3PNI A;  4JI3 F;  3D68 A;  1PYO B;  2YBV A;  1AYE A;  2HAI A;  4IOA Q;  2GVZ B;  1OQ6 A;  4LIR A;  2N4D A;  5LM7 E;  2R2U A;  2DIU A;  1FCA A;  3HSJ A;  2OSR A;  3I87 A;  1VQ4 S;  2RHS B;  2HZV A;  3N6M A;  5KFT A;  3N01 A;  1GMW D;  1FDB A;  3DOK B;  2HNY A;  2R8G A;  4X65 J;  3KHL A;  4GRS A;  2Z58 B;  2YKM B;  3W61 A;  4JBC A;  3QID A;  1K9M T;  1HI0 P;  4DFM A;  4AL6 A;  4ZA1 A;  3TA2 A;  3UD3 P;  3VAJ A;  4EBD A;  1Q81 T;  1REV B;  2ZOM A;  2O01 C;  4LFC F;  1T0T V;  5CAA A;  5GME A;  4QYZ J;  1FWK A;  2HHX A;  3THP A;  3V6H A;  2CPZ A;  2PDA A;  1S6Q A;  2AJ2 A;  2CQ0 A;  3AHP A;  4HTI A;  2GC8 A;  4F3M A;  1REG X;  2KRR A;  1UCN A;  3DM2 B;  4I4B A;  2XM3 A;  1RT4 A;  4DL6 A;  4WF9 Q;  5BYR A;  1X4G A;  3MFH A;  4YY3 F;  2ALY B;  1WC3 A;  4DR4 F;  3PW4 A;  2A2C A;  2ZVS A;  4J9R A;  2EKY A;  1U25 A;  4LRC A;  2POK A;  4Q2L A;  3BS9 A;  4ELT A;  4KHR A;  1VHF A;  3KJV B;  3F41 A;  2GJ2 A;  4YR3 A;  3CUN A;  1JWW A;  2XG8 A;  2KN4 A;  3ENA A;  2K7K A;  5AJ3 F;  1O6X A;  3EGV A;  4CNY A;  4CTA A;  3CJ4 A;  4ELU A;  2B6A A;  1U1O A;  3Q8Q B;  4C0B A;  1J5O B;  3QIP A;  4B3T J;  2QG9 B;  3NBP B;  3LAL A;  5LSR A;  3BGR A;  4YUD A;  2QSW A;  4Q2M A;  1V3R A;  4PKD B;  1YLX A;  4QIE A;  1M5S A;  3M30 B;  2VD3 A;  4KGM A;  2DR7 A;  1K8A T;  1Y4Z B;  2M70 A;  3QAT A;  1MU2 B;  4CWB A;  1UW4 A;  3LQV A;  2WK4 A;  4DMZ A;  3TJ8 A;  3V6K A;  4RW4 B;  4GC6 A;  2L9N A;  1WC5 A;  3M32 B;  1W25 A;  3C6T A;  4WK1 A;  1CPZ A;  2BJ9 A;  1IWG A;  1IKY A;  4K50 A;  4M5D B;  4QIW D;  4QBU A;  5CZV A;  3RRH A;  1YJ9 S;  4OYP A;  1SIZ A;  3P5T L;  4CLS A;  4TY9 A;  2OI2 A;  2BEF A;  5AE3 A;  2IHR 1;  5HI7 A;  1RT7 A;  4DR5 F;  5MAO A;  4DV2 F;  1VQK S;  1M5O C;  2KB2 A;  2MMY A;  2LP4 A;  2J8A A;  2XNR A;  4L72 B;  3G8Q A;  4A47 A;  1LWX A;  2Y1R I;  3V6D B;  1H7X A;  3OTD A;  4TY8 B;  1RKI A;  5KFA A;  2XI2 A;  3Q83 A;  1RT6 A;  1HKA A;  1JXE A;  1VOM A;  2RS8 A;  2OML A;  1Q5V A;  3NGK A;  3KUE A;  2HWH A;  4OX7 A;  1S12 A;  5KFU A;  4WXO A;  1HBO B;  3PTW A;  1R0C B;  3HJF A;  2GNK A;  1HNZ F;  1KR4 A;  4NLQ A;  4OZL A;  3UNG C;  1RAO A;  3G82 A;  3CED A;  2COL A;  2EVZ A;  1VRU B;  3MD3 A;  3OTB A;  2PI4 A;  3TUP A;  3J7Z 5;  4JUZ A;  5CYQ A;  4LF2 A;  2HZC A;  2XC9 A;  3NRB A;  3JXO A;  2MKH A;  4YB5 A;  4HR2 A;  1F3F A;  4NA1 A;  1Z2Z A;  4BDP A;  3L3C A;  2YNH B;  2ERR A;  1F2H A;  3Q8R B;  4DV0 F;  1CVJ A;  2BKN A;  2FJE B;  3GSI A;  3GE9 A;  3BGF A;  4YME A;  1SXL A;  4DCO B;  4PWU A;  1U48 A;  3GPA A;  1TR0 A;  2ZOF A;  3MM7 A;  3OFH A;  2FJW A;  5LMN J;  1U8S A;  4FDF A;  2XMW A;  1RB0 A;  1SC3 B;  1PGZ A;  2CQ2 A;  5KFO A;  4XO0 A;  3OVA A;  2RF2 A;  2XCP A;  2EFN A;  1RI7 A;  1ARO P;  3IR5 B;  3IC1 A;  4DV4 J;  2OD4 A;  3CJ0 A;  2E5I A;  3I9V 9;  4MK7 A;  3OTO F;  4NA3 A;  1BHN A;  1FE4 A;  4JV5 J;  2E1C A;  4OZ5 A;  3CJQ A;  1XTZ A;  2LXU A;  2F5G A;  5J2M B;  2H51 B;  1F9F A;  1HBN B;  1PG5 B;  2NS1 B;  1Z1Z A;  2DNR A;  2BJ8 A;  1LV5 A;  1K0V A;  2EC2 A;  2WVD A;  2D69 A;  1T9X A;  1VQ5 S;  4O3R A;  3QAU A;  3CCQ S;  3OJU A;  1IKV B;  2ASL A;  1WG5 A;  4NPO A;  2IA6 A;  2AGP A;  4RUC A;  3TQ1 A;  4RUH A;  1IR0 A;  1GQE A;  2YNF A;  1WHY A;  4MIW A;  1X4C A;  5B0E A;  5KFX A;  1ZYQ A;  1S72 S;  2FDN A;  3M1V B;  1HNX J;  3MTJ A;  1OMS A;  2UXB J;  4DUT A;  3CJS A;  1UVN A;  4AQY F;  3W62 A;  4L74 A;  2KYZ A;  2JLG A;  3PRD A;  5J2Q A;  5LSO A;  1MWZ A;  3IGV A;  2HK2 A;  4ZP7 A;  2PD1 A;  3LAN A;  4ZHR B;  2ZH1 A;  4M5J A;  2Q66 A;  2ZJR Q;  4E8U A;  1JJ4 A;  2YKN B;  4J9O A;  3TWZ A;  2XY6 A;  5HQL A;  1GXU A;  1EKS A;  4DV5 J;  5I3P A;  2OPP B;  3KLG A;  1F5C A;  2MPU A;  3LA0 A;  2W9C B;  1DTQ B;  2IYG A;  3R27 A;  2FB0 A;  4B3S J;  1F2G A;  3IS9 A;  3KHG A;  1X4F A;  4F3Q A;  1TKD A;  1JB0 C;  4P71 A;  5B7W A;  2K2P A;  2QL5 B;  1UZH A;  5D4P A;  3IR6 B;  5C5J A;  4OYW A;  1JLF A;  4FYX B;  3T1A A;  5F8H A;  1RU1 A;  4HI1 A;  3KLI A;  2HHU A;  4DU7 A;  3THV A;  5E3Q A;  2RRN A;  3EVM A;  2IVY A;  3R1H A;  2YWE A;  2P8I A;  1S0M A;  2V5H G;  4QPX A;  5DGB A;  4ECZ A;  4PR6 A;  1DTT B;  2CPD A;  3R9L A;  5KFS A;  2HHH J;  4NCG A;  2IIH A;  3EXY A;  3TAP A;  3BB5 A;  5C7P A;  2FC9 A;  5KFD A;  3D67 A;  1RBO B;  4YHH F;  4OYM A;  5HJX A;  5GAH I;  4FP9 A;  2MZS A;  4ZP9 A;  2E66 A;  2B9Y A;  4DSI A;  2R7U A;  1IKW A;  3H59 A;  3RYL A;  4Z7C A;  5KFB A;  3JS9 A;  4A8M P;  3PRV A;  3TI0 A;  3BF4 A;  1HD0 A;  2Z57 B;  2DO0 A;  3MM5 A;  1FWP A;  3KJV A;  1GX5 A;  3KG4 A;  1H72 C;  3V4M A;  1DLO A;  4TU7 A;  2OSQ A;  4KRW A;  1JLC B;  3I0R B;  2Y8Y A;  1K1Q A;  2P6T A;  3BO3 A;  2CPE A;  4YR2 A;  1FRM A;  4NLU A;  4IG3 A;  1HBM A;  2NUU G;  5CQG A;  3H8Y A;  1KKH A;  4LF7 F;  5EUH A;  4OX6 A;  4BLG A;  3ETO A;  2RML A;  2FJA B;  4AUK A;  4H54 A;  1BQM B;  3DU5 A;  2AZ1 A;  2JNJ A;  4FNI A;  1RTI A;  1SKU B;  4HL9 A;  4ZVO B;  4E98 A;  4KFB A;  3WZ0 A;  3CJT A;  2X51 A;  2F1F A;  3W64 A;  1SJ3 P;  1Q7L B;  1X9W A;  5B0C A;  1VK3 A;  1SH3 A;  3CC7 S;  2HEK A;  1FXL A;  1SVD A;  2LU1 A;  2E9T A;  3OXG A;  4NXN F;  2KT3 A;  3UCG A;  3PEJ A;  1WF0 A;  2XYP B;  4OYX A;  4DSF A;  3BR9 A;  2F4V F;  4PXC A;  4DX6 A;  3V6J A;  1KOO A;  3UR0 A;  3H2L A;  3ICL A;  4OYO A;  1S1W B;  2BKO A;  2DY9 A;  2LQ5 A;  2EK6 A;  5HLF A;  4G1Q A;  5E3A A;  2P9C A;  2HFV A;  2DR5 A;  1PIL A;  1H0H B;  4HEA 9;  1OY6 A;  3LUY A;  3NP5 A;  4CLP A;  1KD1 T;  1X5P A;  5KT5 A;  4CT8 A;  4I68 A;  4LVN P;  3RR8 A;  1WEZ A;  2LA6 A;  4C3M A;  4NCB A;  1DZ5 A;  2I1R A;  8AT1 B;  3DLL Q;  1IM6 A;  1HL6 A;  1U6F A;  3BYP A;  4BWM A;  2BUN A;  4ZJL A;  2U2F A;  4CDI A;  1HNW F;  1RT3 A;  2MLX A;  2Q6B A;  3NL0 A;  1XR5 A;  2W8L A;  3BDE A;  4CO5 A;  1LW0 B;  4X4V A;  1JLB A;  4OYB A;  4X4T A;  3GIM A;  2VIC A;  1RHR B;  4I67 A;  1VIX A;  2ZH4 A;  1T05 A;  2ZOG A;  1N5V A;  2KDO A;  1ZM9 A;  1TL3 A;  1XR6 A;  4M5L A;  4HKQ A;  1S99 A;  4OI3 A;  4O44 A;  4LT6 A;  4DV1 F;  3U1N A;  5HMW A;  3P6Y C;  3ZZU A;  4IRC A;  1TZ0 A;  1N0U A;  2HHV A;  2HQG A;  2GS8 A;  1WI6 A;  1B0P A;  4CYU A;  4TU9 A;  3GR1 A;  3AA9 A;  4IH5 A;  3MUT P;  1LWE B;  5SUH A;  3HVT A;  1YBA A;  2UUB J;  2J0S D;  2KHC A;  4ECR A;  1KVI A;  3PYD A;  2XHW A;  3KHH A;  4H4M B;  2F8M A;  2FVQ A;  1NK4 A;  1NSP A;  5H9F K;  2YX1 A;  4DR6 J;  1B7Y B;  4RW7 B;  1FVQ A;  2NPI A;  4WFZ A;  1D9D A;  2ROE A;  3R5B A;  4CZC A;  1H3D A;  4NI2 B;  4ZLL A;  2MYF A;  1M1G A;  5F8G A;  4ED6 A;  1SC4 B;  3GFH A;  2NXN A;  2NXC A;  4CLK A;  2ZE2 B;  2GVD A;  3MM6 B;  1JNR B;  3TZX A;  4DL7 A;  1L5U A;  2HGL A;  4CH0 S;  2PI5 A;  4LFB F;  3QSI A;  3DLE A;  2WW4 A;  1S79 A;  3TVZ A;  2RDJ A;  2ZD1 B;  4YQW A;  1GH8 A;  2DYA A;  5FD1 A;  1IKV A;  3SSS A;  4AXI A;  1S0V A;  3FCV A;  4KKO B;  2AYE A;  2MLY A;  2W8K A;  2JFK A;  2FHJ D;  2AF6 A;  1IXK A;  1NPK A;  2IRU A;  3B8H A;  2E7V A;  4GVB A;  2G4B A;  4C8M A;  2G2Z A;  4USJ C;  3U27 A;  1OSC A;  5A2Q Y;  3UW1 A;  4C4W A;  1CSJ A;  3HHL C;  1P1T A;  2B56 A;  2EC0 A;  2F63 A;  2GX8 A;  5C42 B;  2N82 B;  3CWJ A;  1CLF A;  1VQ9 S;  4PQU A;  3F73 A;  2KFN A;  2MKC A;  1UA0 A;  4X4N A;  2ACY A;  4HTJ A;  4GO5 X;  4HHJ A;  4X62 F;  1LFP A;  2Z2L A;  3WIU A;  1N34 J;  5E41 A;  1C4A A;  1H38 A;  3SQG B;  1QE1 B;  3S1T A;  4YDX A;  2QMX A;  2DRA A;  3M9M B;  3NS5 A;  3GTY X;  2XS5 A;  2X1G A;  5K5M A;  2Y0S D;  1HQE A;  4DSL A;  1F5B A;  4DZD A;  3PO4 A;  2J7U A;  4GKK J;  3VAI A;  2OEM A;  3KTQ A;  1IQZ A;  2JLE A;  2ZEJ A;  1D9F A;  1Y11 A;  3GB0 A;  5J2N B;  2YKP A;  3IWN C;  2VV5 A;  3FEY B;  4I2P B;  4J9P A;  4J7C A;  2VKR A;  1NZA A;  4OZJ A;  1V3Z A;  2EPI A;  1J5E J;  2H3E B;  1RE1 B;  2R7T A;  5IQ6 A;  4G1P A;  2BBE A;  4XPC A;  3SV3 A;  4PAA A;  4NLV A;  2ZDO A;  3ZZT A;  2XLJ A;  3THT A;  4NLG A;  1F5A A;  2G1H A;  1BQN B;  4FF2 A;  4KE5 A;  4DN0 A;  2WSF C;  2HHP A;  3RUB L;  2L48 A;  1WKL A;  4FYV B;  2VG5 A;  4TVA B;  3RW7 A;  5H9F J;  3HT0 A;  3MZI A;  3R5A A;  4CO3 A;  5H1S V;  4QIV A;  4C8L A;  4RKU C;  4X4U A;  3QRQ A;  4IFY A;  3DHX A;  2MLZ A;  2A0F B;  2QYG A;  3EZO A;  3Q8S B;  1WG1 A;  3ZZO A;  4NCA A;  3ITH B;  4C8K A;  2ZJQ Q;  1C0U A;  1FNX H;  5M2P A;  5K14 B;  3VGU A;  1RIS A;  5D78 A;  1DQ9 A;  2EBE A;  1ELO A;  1Y5L B;  3NGS A;  3SYZ A;  1YBU A;  4IOB A;  5DZ6 A;  2CDR B;  5E3P A;  3NCP A;  2DNZ A;  5DDQ C;  3W2W B;  3R2D J;  1APS A;  2E1R A;  4DR1 J;  3RB6 A;  4NML A;  4HDG A;  2R7S A;  4F4X A;  1X5O A;  3E8O A;  1S6O A;  2VBZ A;  2KG0 A;  1T9Y A;  1FF2 A;  2RQ4 A;  4J9M A;  1UVM A;  1ZAX A;  1FX4 A;  4JI5 F;  1V5V A;  3IWL A;  2IJN A;  3FSI A;  3VAF A;  3C6U B;  4FS2 A;  4KGX B;  2NYH A;  3AOD A;  2YWG A;  2ZUA A;  1YJU A;  1RSC A;  4ED0 A;  2HLT A;  2VG6 B;  1XMQ F;  1CJK B;  3BQ0 A;  3MR5 A;  1OSD A;  3ONQ A;  3I82 A;  2FVR A;  1HNV B;  4LF8 F;  3N9U C;  4PWD A;  1PAU B;  1D1U A;  3ZNJ 1;  3EPG A;  2R8H A;  1ZM2 A;  1TKX A;  2MJN A;  5HVH A;  1PBU A;  2VB6 A;  4B9T A;  3C14 A;  3DYA A;  1SJQ A;  4ECU A;  1KLM A;  4B9U A;  1TEL A;  4IQX A;  5CH7 B;  1Y10 A;  3CCV S;  4DQI A;  1JIH A;  3TAN A;  2WZ1 A;  3C15 A;  2DNQ A;  4RW6 B;  2GJI A;  2YWH A;  3K59 A;  4TLR A;  4LF4 F;  1RWW B;  3SSQ A;  1XNR J;  3PAC A;  4WIQ A;  4GVL A;  1PJ6 A;  2J76 E;  1HW8 A;  1U26 A;  1RK8 A;  1Q82 T;  1TL7 A;  1HHT P;  3V4I B;  4R8U B;  2M9K A;  3JQK A;  4TLQ A;  5AE1 A;  5IT0 A;  3BZQ A;  2DGV A;  3BBB A;  2P9E A;  4LIW A;  1OY8 A;  1RAD B;  3DGP B;  1HW9 A;  2K8G A;  3UPF A;  4FNH A;  4Y6I A;  4DL2 A;  4JI8 J;  2VIH A;  3IGN A;  2IVF B;  1KSP A;  5L1J A;  3G87 A;  2VQF F;  1KQG B;  3MAA B;  1NME B;  4ZPC A;  3BN4 A;  2LQ9 A;  4OJH A;  4QOT A;  1WUU A;  1JLA A;  5HJY A;  3H4B A;  1UJ4 A;  3H5Y A;  4L75 A;  3EWG A;  4O0I A;  5HBM B;  2RD5 C;  5EX3 A;  4L3K A;  2AV5 A;  4X4R A;  1R8P A;  1S6P B;  2A18 A;  1HNI B;  2HGN A;  2DIT A;  1WKK A;  1T94 A;  2KL8 A;  3SXL A;  4Y0F A;  3ET6 A;  5G0R A;  5F3T A;  2WSC C;  1RTD A;  2CWX A;  3M9N B;  3RTV A;  3PJ9 A;  1HYS B;  3MPU B;  3ZNU A;  1CUL B;  2VQE F;  3D66 A;  1RTZ A;  1IQT A;  1SV5 A;  3KK1 A;  1BMQ B;  3RBD A;  2C3O A;  2MZJ A;  2HSE B;  2FVS A;  1P8G A;  3OTE A;  3MMB B;  5F8J A;  1RYS A;  3IG1 A;  4WTO B;  3CCU S;  1XN9 A;  4JI4 J;  2R3V A;  4MIA A;  3G86 A;  3T1Y J;  4M5I A;  1QSS A;  3MTK A;  2C1E B;  2CJ9 A;  3V2U C;  3PFO A;  4WFY A;  3OVS A;  3OLB A;  4PG7 A;  4LR9 A;  2QL9 B;  4DCP B;  3VWS A;  1M1K T;  1AUD A;  2B9E A;  3N0V A;  4K4V A;  3IN5 A;  2AJQ A;  2G1D A;  2LQ8 A;  4PWW A;  5A8K A;  2M0G B;  5D15 A;  3PIO Q;  3LGM A;  4DF4 A;  3ILI A;  5KFM A;  2LXF A;  5AE2 A;  1VMB A;  4C8Y A;  2XBP A;  4OZ3 A;  3TYT A;  3W63 A;  4FF3 A;  2BR0 A;  2K3K A;  1VI7 A;  4JV0 A;  4RO0 A;  1UEK A;  1XMO J;  1HQU B;  5JXS A;  5I3U B;  4J9V A;  6FDR A;  1UVJ A;  2G0J A;  4WFN Q;  1X0P A;  1V6H A;  3OL9 A;  4I7F B;  4DPX A;  4DSE A;  1HMV A;  2QN6 B;  3HVR A;  1WC6 A;  1SUQ B;  1FKO A;  2CXE A;  3KLE B;  2QMW A;  1VC5 A;  3LPY A;  4JYA J;  2H54 B;  1JLE B;  2BAN B;  1RDR A;  2BJD A;  1TK0 A;  4OI6 A;  4LF1 A;  2LMI A;  4NXM J;  2HHS A;  2KT2 A;  1NUE A;  1WF2 A;  5B0B A;  1FFS B;  1X31 C;  2P2C B;  1SKS A;  1U2C A;  4JP8 A;  2ZKT A;  3AH6 A;  5HN0 A;  3TQE A;  3W7B A; 
#chains in the Genus database with same CATH homology
 4WPA A;  4OZ3 A;  4OYX A;  1WC3 A;  1WC0 A;  4OYI A;  3UVJ A;  1FX4 A;  4OYO A;  5D0E A;  1AZS A;  1CUL B;  1YK9 A;  3C16 A;  1WC1 A;  1CS4 A;  1TL7 A;  4OYP A;  5D0G A;  2GVD B;  1WC4 A;  4CLS A;  4OYW A;  3C14 B;  4CLY A;  5IV3 A;  1CJT B;  5D0H A;  4CM0 A;  4UST A;  3MAA A;  3R5G A;  3MR7 A;  4P2X A;  2GVZ A;  1CJK B;  3C15 B;  4OYA A;  1AB8 A;  4USV A;  1WC6 A;  1U0H B;  4CLP A;  3G82 B;  1CJU A;  1CJV B;  4P2M A;  3ET6 B;  4NI2 B;  2QV6 A;  1FX2 A;  3MAA B;  4WP8 A;  4WP9 A;  3UVJ B;  4CLK A;  1CUL A;  1AZS B;  3C16 B;  4CLZ A;  1YBT A;  1CS4 B;  2BW7 A;  1TL7 B;  2GVD A;  3C14 A;  1CJT A;  4OYZ A;  4CLF A;  5IV4 A;  4P2F A;  4CLU A;  1YBU A;  4OYM A;  2W01 A;  5D0R A;  1Y10 A;  4OYB A;  1Y11 A;  4WP3 A;  2WZ1 A;  5D15 A;  1CJK A;  4CM2 A;  3C15 A;  2GVZ B;  4CLT A;  4CLW A;  4OZ2 A;  1U0H A;  3G82 A;  4USW A;  1CJV A;  3ET6 A;  1WC5 A;  4USU A;  1CJU B;  4CLL A;  4NI2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...