1CJKB

Complex of gs-alpha with the catalytic domains of mammalian adenylyl cyclase: complex with adenosine 5'-(alpha thio)-triphosphate (rp), mg, and mn
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
201
structure length
190
Chain Sequence
LYHQSYDCVCVMFASIPDFKEFYTESDVNKEGLECLRLLNEIIADFDDLLSKPKFSGVEKIKTIGSTYMAATGLSARQYMHIGTMVEFAYALVGKLDAINKHSFNDFKLRVGINHGPVIAGVIGAQKPQYDIWGNTVNVASRMDSTGVLDKIQVTEETSLILQTLGYTCTCRGIINVKGKGDLKTYFVNT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Lyase/lyase/signaling protein
molecule keywords ADENYLATE CYCLASE, TYPE V
publication title Two-metal-Ion catalysis in adenylyl cyclase.
pubmed doi rcsb
source organism Canis lupus familiaris
total genus 59
structure length 190
sequence length 201
ec nomenclature ec 4.6.1.1: Adenylate cyclase.
pdb deposition date 1999-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00211 Guanylate_cyc Adenylate and Guanylate cyclase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1230 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleotide cyclase 1cjkB00
1CULA 5IV4A 4CLKA 1FX4A 3G82A 2QV6A 1YBTA 3R5GA 4CLUA 3ET6B 2W01A 1AB8A 3C15A 1AZSB 4CLPA 4CLLA 4OYBA 3MR7A 1FX2A 2BW7A 1U0HA 4CLSA 2GVDB 1CJKB 4OYAA 4NI2A 4CLWA 4P2FA 1CJUA 4WP8A 1TL7B 4CLYA 1CS4A 3C14A 1CJTB 4WP3A 2GVZB 4USUA 4OYXA 5D0HA 4OYZA 3ET6A 3MAAA 1YK9A 1AZSA 4OYMA 5D15A 4P2XA 1WC0A 3C16B 4WPAA 2GVDA 1CJKA 4USVA 3UVJB 1CJVB 1CULB 1TL7A 3C14B 3G82B 1YBUA 1CJTA 1WC6A 4OYOA 2WZ1A 4OYWA 3C15B 2GVZA 4OZ3A 4OYPA 1Y10A 4USTA 5IV3A 4OZ2A 4CLZA 1WC1A 3MAAB 1WC4A 1U0HB 5D0RA 1Y11A 4CM2A 4OYIA 4CLTA 4CLFA 5D0EA 4NI2B 4P2MA 1WC3A 5D0GA 1CJUB 1WC5A 3C16A 1CS4B 4USWA 4CM0A 3UVJA 4WP9A 1CJVA
chains in the Genus database with same CATH superfamily
1CULA 1X9SA 3U1MA 1SKRA 5E3PA 1NU4A 3TRGA 1B70B 1V9OA 5L38A 5AXLA 4DV4J 3GU0A 3KUHA 1SL0A 1DTQB 1VC6A 1FJCA 1FRMA 4NLPA 2KO1A 2PEHA 4M95A 2EXUA 2C2NA 5A8WA 2NXUA 3M05A 3C6UB 1JK9B 2Z2MA 2POKA 3GYNA 4TYAA 3Q89A 4ECWA 1UTAA 2W24A 4WP3A 4X64J 2ZKUA 3JSMA 1SQFA 4NYZA 3ILOA 5F8JA 4X4RA 1Z2LA 3K5PA 3JS9A 1ZTWA 4M1KA 1TELA 1DTTA 1N54B 2NCKL 2CZ4A 1VQ4S 4I56A 2GAHC 5B7WA 4F4KA 1VQPS 1X4GA 4LT6A 1G7CB 4OHWA 1J5EF 3AJDA 4F7VA 3DRSA 2ZWOA 1X5PA 3PNIA 2HWTA 4N47A 2RH3A 2YXLA 2RHQB 1K73T 4C11A 2G1HA 4DL6A 2RILA 3I0SB 6FD1A 2DHAA 5KTQA 2OGUA 4J37A 2IA0A 4ILRA 4DR2F 1HNWF 4QR1A 5KG7A 3I5BA 1M5KC 2IM1A 4G1IA 4O3RA 4KPYA 4LF5J 3CJRA 3CD0A 2XMTA 5IT9Y 3RRKA 3KG1A 2CADA 1S77D 3HHLC 5CZXA 3KYLA 4ECZA 1U7LA 3MM5A 1R8CA 3KXDA 4HTIA 4O44B 1HI0P 3GR0A 1LW2B 4WXOA 4OX9F 1FE0A 1ZM2A 3PKYA 3SDEB 3P4UB 2RB7A 3N9UC 3FCVA 3W5YA 3G6XA 4ZN3A 1VFJA 4P75A 5IWAF 2FLLA 2VFTA 1JX4A 4G1QB 4OX7A 3CCSS 1GXUA 4PQUA 4WFXA 3BR9A 3CDAA 2LMIA 3PY8A 5EN1A 2I0XA 1S1TB 4M8LA 5HROB 2CDQA 4C3KA 3HULA 4MKYA 4MYTA 2JC1A 3FEYB 1KOHA 1N32F 3MCNA 4CLPA 3AD7C 2KXNB 1QD1A 4ZK7M 3RJMB 3UD5A 2XMAA 2DVIA 2BVZA 2PT0A 3R5DA 1BUXA 1KKHA 3DLGB 2V2QA 1CS4A 1PBAA 5LMNF 3NKYA 4BDPA 5I42A 1HI8A 4NXNF 1IKVA 3EXYA 5AE3A 4J9VA 2MHEA 4B3RF 5IS2A 4EEYA 1RWUA 2DNKA 1S1UB 4K2JA 3RAXA 5LL6d 1GX6A 3CJSA 1S4EA 3I87A 1NCLA 4C8NA 2MZSA 2Q3PA 3NAIA 4JI0J 1IKYA 4DV4F 2Z30B 2IHR1 4RW7B 3CXCR 1QUVA 3OXFA 4P7VA 3TA1A 2IJNA 3OPKA 2MJUA 4KGKA 5F0UA 5H9EJ 4ZVQB 3DDIA 2W2MP 3F73A 4CH7A 1D0EA 4CM2A 3DLKB 4X64F 1FKOA 5ETMA 3Q8QB 1CJUB 1RYSA 1YJUA 1C0UB 2W9BB 1GXLA 4DFJA 3TJAA 1FEHA 2HQFA 4F4ZA 1UEVA 4L76A 2R2SA 3FBEA 1FE4A 3CE8A 4FXDA 1H2UX 2HZAA 3K59A 2R7TA 2EFOA 2KYZA 2Z56B 2FIUA 3EDRB 3RR8A 1S1WB 2FJVA 2DR5A 1FT8A 1IR0A 1F2HA 3OSPA 3OTCA 2FTRA 2IY5B 3OD2A 1EAYC 5B0AA 5T14A 4HT5A 2WSEC 2ZHBA 1X60A 4U95A 2J0XA 4TY9A 4DSLA 3R7BB 5LM7E 3VAJA 3HSZA 4P2SA 5I3UA 2QMUB 2I8EA 5FLXU 3MOJB 4ATNA 4LF5F 4WFBQ 4EGLA 3EDQB 1UPPA 4B3OB 3J7A1 4CP5A 4DX5A 3PTWA 3K5LA 2HIYA 2W4DA 2DNHA 2C42A 4KIAA 5D4NA 2BJ8A 2HHQA 4QW9A 4O3SA 2AZ3A 4U8YA 3RYLA 3KJFB 2FJAB 3DDNA 2JVRA 4PEOA 4QU7A 2NUUG 5F41A 4CTAA 4DL4A 4DR4J 1NDPA 2BJ7A 4G3IA 3W8GA 2Y0SD 4NCBA 2HVIA 1LQ9A 4PG5A 1V6HA 3BQ1A 2Y9HA 3TANA 4DL3A 2CVIA 3DXSX 4U7UK 1VHIA 3R2CJ 4MIWA 3D54A 2RQCA 5LT5A 5F9NA 4K4VA 1F0XA 1DQAA 4PRFA 5E3CA 3CJ4A 4DQQA 2ADBA 4NASA 3QPIA 1CJKA 2IYGA 2LQ5A 3LP2A 4USVA 1KP6A 2BQ3A 2ZJRQ 2A1BA 3GSDA 4QR0A 2XYGB 1OSDA 2ABYA 3ZTPA 5HN0A 4CLZA 4Y2AA 5A8KB 3BM7A 2BJEA 4RKUC 2XMVA 2CVEA 3QATA 5KFSA 5DRKA 3C16A 1JJCB 4ANEA 3A3PB 1LW2A 3V6DB 2VJVA 1T9WA 4UOGA 3ZZTA 1UWBB 3ENWA 4JI0F 1HA1A 2YWGA 5JMNA 2UUCJ 2OD4A 3HSDA 3SDEA 2HBYB 1WF0A 3V81B 5DLFA 2YPZA 3IS9A 2YH1A 2KZMA 5DQHA 4G1QA 1JLFB 1AROP 4O3PA 2JZ5A 2ZH8A 3E3XA 3N79A 2E1AA 1X0PA 2ZH4A 2FHKA 3ISND 1D9FA 3RAMA 5ETNA 1LV5A 3K2YA 2RDIA 3CIZA 1NJZA 2HBZB 5ETTA 5IQ6A 2E7WA 5BYQA 4NA1A 2J6SA 2FVCA 3J81j 2GC8A 2D3ZA 2V4JB 3CO0P 1TV6A 2QSFA 2AF6A 4CLFA 3DLGA 1EZZB 4F04B 3ZTQA 1FRLA 1Q8KA 1J5OB 3T5KA 2AJ0A 3BGUA 4C6AA 1KLMB 4ZP7A 4Z7CA 4X84A 1P6TA 5I3PA 1FD8A 3M6VA 2AKWB 3QIDA 4RNHA 4URQU 4QPTA 1JWWA 3KJQB 4P2FA 3M1VA 1ROFA 2EFNA 2PEBA 4HR2A 3ZFVA 3ET6A 1HFEL 3MPYA 5LJ5Y 3J81Y 1XC9A 4KRWA 4ZMMA 2E5IA 3DLKA 2MMYA 3CDWA 1QAXA 1C0UA 1BQMB 2LDYA 4DR4F 2R7OA 2UUAJ 2KT5A 1FFSB 1WTFA 4RUHA 3W5ZA 2ZC3A 4ZVTB 1D1UA 2Q1LA 2CNOB 4YB1P 1ELOA 2CDRB 4F0MA 4R8UB 2WRMA 2RD5C 1NJIT 4G65A 4EYIB 4G1PA 2DR8A 1CJVA 1WELA 2R9LA 4X4TA 1NPRA 1GTEA 1C4CA 2O01C 4QOTA 1HW9A 2DJWA 1SJQA 3R5CA 4H4KC 1R8BA 3CMQA 4ALZA 5ETVA 4DR3F 3GIJA 2KXHA 4KGZB 3ZTRA 4EO6A 4CLSA 4DJBA 4YY3J 1MNEA 3DI6A 2FVRA 3BB5A 1TFWA 1CEZA 4DUYJ 2Z57B 3P5TL 2CWKA 2GVZB 1MROA 1RTJA 1FF2A 4OHYA 2LCWA 1S6PB 2VG7A 5L1JA 3CDEA 3PEJA 3UN2A 1DBDA 1OQ6A 1TUVA 4KYZA 1JJ4A 1S0MA 3CB4A 2KHDA 3ZNJ1 2H65B 1S97A 2UUCF 4DSEA 2QO3A 2XZTB 3MM6B 4OHZA 2Q6BA 3CW2C 3PJWA 5D0RA 4OHXA 2G4BA 3GILA 3MEKA 2UVUA 3TA0A 2HFZA 4QJVA 3W9JA 1J2VA 1TU0B 4LUBA 3MHYA 2JL9A 5J2QA 1F3VA 4C2MA 1TKXB 2FHJA 1RT4B 3MECA 3LOUA 2XNQA 3DHWC 2R7VA 4MMOA 3DRRB 5F3TA 5KG5A 3ZZYA 4NX9A 4OLOA 5LMUJ 1FO1A 2AJ1A 1HYSB 2AQ4A 4ZLNA 4KH0B 3HHLB 2PI5A 1A9NB 3QAEA 4FPRA 2XHCA 4OV1A 1KS2A 1HBMB 4IQMA 2HS3A 4XK8C 3PIOQ 2B9YA 5BYRA 3FCHA 7FDRA 3SBMA 4GO7X 2UVRA 1UVJA 1IM4A 5G4DA 1R3NA 2N3LA 3N28A 2QLJB 5KFRA 3J7AN 2P9CA 1UWBA 1TMMA 3BS9A 2HHTA 3CMAS 1NSKL 1ZAVA 1HWUA 3CVKA 2V8GA 2OEMA 2VA2A 4K59A 3PDNA 4Z7YA 5M2PA 1F9EB 3RUBL 3W60A 3AA8A 2G0CA 5CAAA 2BM1A 2WONA 4ICLB 3QBCA 2OLWA 2WVEA 4KGVB 2MSSA 5C7PA 2UUAF 3MEGA 1WSRA 4GC7A 3IGVA 5GVQA 4OYAA 4ED6A 2DNRA 4F26A 1VOMA 3NOCA 2MZRA 2BBEA 1T7PA 2VH7A 1RWNB 2PI4A 4BHQA 1HNZJ 5IOLA 4WIIA 1TAUA 2DXDA 3KTQA 4OL8A 2B6AA 3K8VA 4UTGA 5CD4H 4CO5A 1J5OA 1ICEB 3GIMA 1X9MA 2OFGX 4LRAA 1KEKA 1X4DA 1FRHA 3D9BA 2EEYA 4USHA 2GJFA 4JYAJ 1VRQC 3EE3A 4YY3F 1B4SA 4DUYF 2F63A 3DOLA 3QIPB 4QIVA 1N6QB 4IOBA 3P49B 2YKPA 1RWMB 1NK0A 3BKFA 1AT1B 4NRTA 1GX5A 2BANB 1S6QA 3DGPB 1UEKA 3NGSA 3EYZA 2F9JA 3UDVA 2F7VA 4PG8A 2DH9A 3QRPA 2XC9A 1LWCB 4PWWA 1R31A 4Z2XA 3Q8RB 2HFOA 3H2UB 1S1XA 2XMKA 5C24B 1FTCA 2RRAA 1IQZA 5KFLA 2LP4A 1IBLJ 2L9WA 3VCDA 1L3UA 4R8UA 2I9SA 3OR2A 3S6EA 3H20A 5KFFA 1RAEB 3BSOA 2UUTA 4IR1A 3UQSA 1K0VA 4O3QA 3H2VE 1VQ6S 3M32B 1D8YA 3W3SA 2ASYA 1TK0A 4JV2A 2GHVC 4P7TA 1OY6A 4LSLB 1UP1A 2KYXA 1U02A 1WSVA 2VV5A 1WC4A 5J2MB 1RHJB 5LMUF 2B4OA 3QO9B 3DC2A 1T05A 4WFNQ 4G6VB 4B9LA 3LGNA 2UUBJ 1HNIA 4ZP6A 3F41A 3C6TB 2MQPA 3T3FA 1S6PA 5I4MA 2CQ1A 1LFPA 3R5JB 3GSIA 2R7QA 2VB6A 4BCAA 1TL1A 2DH7A 1IKWA 2AMCB 4B17A 1KSPA 1SIWB 1U26A 1CJTB 1HHQA 2GW8A 3MM6A 1HIYA 4ZN1A 5KFBA 5CYMB 3V6KA 5KT5A 4WYLA 4ER8A 3QWUA 2H4WB 1P1TA 2NSCA 2YWFA 2IRXA 2MQLA 4N8NA 2A10A 4WFYA 3UVJB 2CQ0A 3DU6A 1TKZB 2DKOB 2WOMA 3OBIA 1T9VA 2BXJA 3THVA 3LP0B 1RT4A 2OELA 3LAKA 2A2CA 3LGMA 1KONA 2RT3A 3Q24A 2EKYA 1X4EA 2ZE2B 3DRRA 2B7BB 2OKQA 3WX8A 4JV1A 1HNZF 4ZIWA 3BO4A 1TUWA 4OX8A 3IG1A 3BN7A 1PO6A 2J9DA 1FA0A 2LXIA 1H3DA 3QWPA 3RBXA 2XWXA 2XBPA 3HSJA 4JYAF 4ECYA 1X9WA 2QZ8A 2I2YA 3KHRA 1X4FA 4C8MA 1F5BA 2VL1A 3M9OB 2XHWA 1JLBB 4QWBA 4DU7A 4RNFA 2HQIA 2EI5A 3FQKA 1Q78A 2IIHA 1RB0A 3OFGA 3TARA 1M5SA 1EKSA 2D74B 3NCRA 2YKOA 3H90A 4CDIA 2B51A 2J9DE 3I4HX 1BQNA 2DHHA 2AYEA 2W7PA 4WU2A 3RAQA 2QYCA 1NNDA 3TWZA 3CJKA 3CJ2A 3GJSB 5KFAA 2WSCC 5LSOA 4JP8A 4NA3A 1HBOB 3AQPA 1WC3A 4LFCJ 1QE1B 2R7SA 3S8SA 5IT9U 2XEXA 2ACMA 1PYTA 1IBLF 1EQ0A 4CIOA 3JTPA 2M7SA 5HLFB 1S7IA 1SL2A 3CCJS 4L73A 1FXRA 2RHSB 3UN5A 2MSTA 3I55S 3PVXA 3MF5A 2W2OP 1HW8A 3K57A 3A3NB 1YHQS 5EGYA 2B5JB 2KRRA 1JXEA 2JFKA 2OPQB 5HK4A 3PO4A 2L9DA 2CA9A 1URRA 1IWAA 5KFXA 4LBPA 3VV2B 4EU0A 2XM3A 4B9SA 3LALA 4IDKA 1KTVA 2UUBF 1FI4A 2UUWA 3C66A 1RT1B 2B7CB 1N6QA 2V94A 4JI1J 4OZNA 4J9OA 2WSFC 1X8DA 3LPEA 2H51B 4F0KA 4AYBD 3BV8A 2B9WA 2BOAA 2W2NP 2HLTA 1PJ7A 4MIAA 2IAJA 1Y0HA 5C24A 4DOZA 2FPHX 2CYYA 2MQOA 2K7KA 3GYGA 3C46A 1T9XA 1XNQJ 1L3KA 3T5JA 4NLYA 5K14B 4K50A 3DU5A 1B99A 4B02A 1RWXB 1N5YA 3TZZA 1SJ3P 1N5QA 4WP8A 4FP9A 1Y5IB 1HARA 3D1HA 1O51A 2DNMA 4DR1J 2BJ1A 3L95X 3E8OA 4OYZA 3ZZRA 1K0TA 4KFBB 1MSWD 5KG6A 1Y5NB 1RTHB 1N0VC 4YUDA 1VLOA 5CA5A 1WC0A 4UY8T 1QSSA 5A6WA 1WF2A 2ZH1A 1QVGR 3IP0A 5C25A 2HZVA 2X1BA 4OI1A 2JEGA 2XZDB 5KT3A 2CQDA 3M2UA 5KFIA 2HWIA 5HMZA 5KG1A 5KFPA 4BWJA 3IO1A 3FBFA 2CPHA 2F65A 1N48A 4A48A 3G82A 2CPDA 1KBRA 2AD9A 1U2CA 2V5HG 1F9HA 1FK9B 3IGNA 4I7FB 2RF2A 2QIFA 2YPYA 2DTJA 3O5TB 3KLVA 1RJJA 2F5GA 1TKZA 3NOGA 4FVMA 2XO6A 2HGMA 4B9NA 1UMJA 4FS1A 2ZD1B 4C7QA 4LFCF 1XMOJ 4Y2MA 1MW7A 2ZE2A 3H0PA 2OTLS 2ZZMA 3I5CA 3BYRA 4OI6A 4KJIA 5DQIA 3H2LA 1JJHA 3QAUA 1L5UA 3PACA 3J80Y 4XPCA 2XQCA 2AHOB 1SH0A 2VG5B 3TUJC 4ZJOA 3Q22A 3N6LA 3PIPQ 5L39A 2NYIA 3Q8UA 4OI3A 2LEAA 3D66A 4K5SA 1ZTTA 4U96A 2DNPA 4ZHRB 3KLIB 2CJXB 4X66J 4CM0A 3HJFA 1Y3JA 5E2QA 2ZDOA 1WKJA 2H48B 3VHQA 4DX8H 1FKAF 2QV6A 2W4PA 2VKRA 4YS2A 1JLBA 4DCOB 4JI4J 1RKJA 1N56A 4JI1F 2BW7A 3SCLE 3RRHA 3GFXA 2KG0A 4FXVA 1C1BB 3BGFA 3UR0A 5J1NA 1SBRA 4AL7A 4OI4A 1PYOB 3LW5C 2ZJQQ 3I56S 4C8ZA 5KOWA 4Q2MA 3JSYA 1JLCB 4FN5A 3P6YC 2IVMA 4CO0A 4H54A 1JNZB 1YJ9S 1QE1A 3ZZPA 1XNQF 2KHCA 3E51A 3M30B 3CCZA 2MKYA 4E98A 2MY7A 4WK3A 2LLZA 5B0GA 4A4JA 1B3TA 2HYIB 4K4XA 3I5AA 2P6TA 1T11A 4OFZA 3E01B 2YBVA 3D7SB 4NLRA 1RWKB 3MMCB 4DR1F 4NLGA 3UR3C 2M88A 1S79A 1N36J 2LEPA 1WHWA 4ZVGA 3TX0A 4DV7J 2W01A 2FY8A 1JLAB 3MEDA 4TLRA 1B64A 2FY1A 5G0RB 3V2UC 3T19A 3W2WA 1HBUB 3O2IA 3HO1A 3E2EA 4I2PB 3J7Z5 3UNGC 3FVYA 4A8SA 1TL4A 4FXWA 3B4DA 4LBIA 3CC2S 1I94J 2MDAA 3UCZP 2NXEA 5KFGA 1DURA 1L3TA 2K7JA 4KKOA 1R89A 2HFNA 5IXUA 5K14A 1U2RA 2AGPA 3VZHA 5JVHQ 2R42A 2Z2YB 4IH6A 3WC2A 3A8JA 4H4KA 2J6TA 4LF9J 2FLNA 1EKRA 3W64A 2H5IB 2HNZA 5HMWA 2LKZA 4USWA 1XMOF 2RAQA 4O3NA 2XMJA 3M8YA 1S1VB 2XLJA 1V5VA 4ED1A 4WF9Q 5LSLA 3GTYX 1EX8A 3TA2A 2ZH5A 1LNQA 3NBPA 4ILLA 3J81U 3CPWR 4P52A 1PC5A 2KFYA 1X0FA 2MZQA 3BBFA 4ED3A 1HBNA 3AOCA 2PFFB 2VA3A 1U1PA 4ZLPA 3IWNC 3PYEA 2IC3A 3LANA 1RA7A 2HFUA 3T5LA 4X66F 4M5MA 2BKPA 3ADAC 2X51A 1REVB 1RCOB 2Z8QA 4C0BA 5HI7A 2HSEB 2GVDA 2CAJA 4JI4F 2R8HA 2CFXA 4CH1A 4QCLA 4DL0C 1WC6A 2C28A 4NWBA 2A6MA 4IQXA 2YY3A 3CC4S 1FK9A 3RB0A 5F8HA 1WC1A 4OJ1A 3EUNA 2VHGA 4EZ9A 3GYXB 2K1RB 4DEZA 3C3LA 4IG0B 4DS4A 1Q8LA 1DRZA 5A0YA 3TQEA 2MKHA 3U27A 2Z2LA 1U6ZA 1DLOB 2K3KA 1OPIA 3MPDA 5LJ3Y 4WFAQ 4QYZJ 2ROEA 2J7KA 3S1TA 2G0JA 5HVFA 3KK3A 2CJYB 3MUMP 2AEMA 2RKIA 3M8SA 4ZIVA 3DLBA 3NGRA 4F4WA 4PCQA 4RW9A 1V5IB 3BGRA 3PV8A 2W7AA 3T1HJ 3DRYA 3I6PA 5F9LA 2DGSA 1M1HA 1T03B 3CJ8A 2E9TA 4YR3A 1T0TV 4ZVFA 2IM2A 1FJGJ 1Y5LB 5KFUA 1IXKA 4LR9A 3RRGA 2M8HA 3BEGB 3ONQA 4LSNB 1WHYA 3OLAA 1WTBA 2HK2A 2BRKA 1N36F 3EVMA 3HLUA 4ECQA 1QLNA 1O5JA 4WPAA 4ANCA 4ZHRA 2ZITA 4YR0A 4DV7F 1PCAA 2CQIA 3TR5A 3K7RA 1FVSA 2I1RA 1JQGA 3CEDA 1FJ7A 4CNYA 4LQ3A 1WD6A 5DLGA 1AYEA 4F67A 3H7HB 2G2ZA 1TUGB 3OL6A 1F9FA 3K58A 2W25A 3R1LA 4QR2A 2E7VA 4O4RA 2R2UA 2CQGA 5F0WA 5AXMA 3VQSA 3NGKA 4DV2J 3BF4A 5KFQA 1NH8A 4ZVEA 1I94F 1HKAA 2NXJA 4NYPA 3CCMS 1JLCA 1DARA 3I9V9 1FX2A 1I3OB 3G8TA 3M30A 3SCJE 1X5TA 7AT1B 1NDKA 3KHLA 3T6BA 1VQYA 1QAIA 5CCMA 4ID5B 3VGTA 1WEXA 3Q8SB 3NWRA 1N5TA 4LF9F 4YEAA 3NXZA 1M5VC 4DS5A 4UZCA 2MTLA 5KFVA 2DCUB 2OMOA 1C0TA 2HVEA 2JEJA 4EWTA 2G2YA 3NWGA 4NLDA 2NR0A 3ULHA 1SKWA 3OVBA 4MJKA 1PILA 4AL5A 3UDCA 3T1YJ 1IUJA 2K2PA 1TL7A 4PWDB 4ID8A 1MMNA 4DPXA 3CT9A 2MGZA 4I64A 4Y34A 4KT0C 2D3UA 1JLAA 4JI6J 4GKJF 3PJXA 4P10A 5G0RA 3TUZC 2RJZA 1FWLA 1KHVA 3KLEA 2ROGA 4ECXA 4YR2A 1PGZA 2H54B 2HNYB 3GCWP 4RW4B 1S10A 3TZYA 3RBZA 3OTOJ 3AJ2A 1FHTA 4UOHA 2WVDA 5FIIA 3DDKA 5IT4A 1SUQB 2YWHA 1CSJA 4UQTA 2XG8A 3OHBA 2XS5A 3KLHA 4CLYA 1M5HA 3RW6A 1MN9A 4Y00A 4RNNA 2PSZA 2YH0A 3EVWA 2O3DA 3GJRB 4A8OA 2N4CA 5KFKA 4ZPDA 5A76A 2E5JA 1KDNA 1JKHA 2B4UA 4DPOA 1RT2B 1KVIA 1ZPWX 2XTJP 1RT3B 3AAWB 3T1HF 3IM8A 3J7YU 1HD1A 1H7WA 3TUPA 4EK2A 5AXNA 2V9KA 4ERDA 2LXUA 1LWEB 2Q66A 4OYIA 1LW0A 2DNNA 1FJGF 2D9PA 1RTIA 4IRDA 3AT1B 2VFUA 4DL5A 5FDLB 1V3ZA 2AX1A 1UW4A 4ED5A 4LF2A 2F4VJ 1Q5VA 1XR5A 3ZC4A 2XLIA 3GV8B 5ITHA 3GB0A 1FRIA 2GGPB 2A2DA 3CTRA 5LSRA 1N8RT 1OQ3A 1VMBA 1H0HB 2K3IA 4DZ6A 3THTA 1UEUA 1YG0A 3AQOA 4LRDA 2YQ3A 4DV6J 2RDDA 2GMHA 2MLXA 4K4UA 4J9LA 1IBKJ 1URNA 2W9CA 2ZKTA 2YNFB 2B9XA 2K1RA 3LWLA 2D9OA 3BPSP 5DG8A 1LXJA 2XY7A 5KG3A 4UUXA 2QA4S 2R8GA 4DG1B 4AQYJ 4R5PB 2YTCA 1HR0J 2E9ZA 3LUYA 1S59A 2XZWA 3DRPB 2V2KA 4K2XA 1RI7A 3IBFB 4KH1B 3PW7A 2FHOB 2OHDA 2BOPA 5CQGA 4XDDA 2VICA 3D3BJ 3OJUA 4IO1A 3R1HA 4YB5A 1W25A 3ENAA 5E3RA 4BC7A 2E1CA 5C5JA 3G6YA 4DR6J 3T1YF 2R7XA 1ZH5A 3CWJA 2A3JA 5HBMA 3MPVA 4O0NA 3MXHP 1GAOA 3KG0A 3R7NB 3JQKA 3POTA 4N8OA 4JI6F 3O44A 1NK7A 4WZMA 1RT6B 1S7HA 2B8PA 4PYAA 3W65A 3OL9A 3ZNUA 3K8WA 3WQPA 4QPXA 3RW7A 4J9NA 1TMJA 5U47A 4DUTA 2EG1A 2DGVA 3OTOF 4DU8A 2HHUA 5K8NA 1WDDA 2DR6A 3DOKA 1V3RA 3G86A 4USTA 2QLBB 1RBOB 5K5MA 1TL3B 1RCXB 2OMLA 1D8ZA 2DK2A 5CD4A 3KDOA 2DGUA 5BJRA 1R0CB 3QRQA 1CQNA 4H4MB 2Y1JA 4HI2A 2JLGA 1S4FA 3W8PA 1APSA 4I6YA 3G96A 3B8HA 1UFWA 2PFDA 5CCLA 1EIYB 2YNIA 4AD6A 1IQTA 2DY1A 1O6XA 4AL6A 4CYUB 1B7YB 3FSYA 4LF4J 1YDLA 2RIJA 3F44A 2OPSA 4J5OA 2YQ1A 2DGWA 3MM7B 1RDRA 2V4QA 2H5JB 2ZHOA 4WJBA 2LU1A 3OL8A 1PBUA 2F4VF 2CJBA 2EBEA 3PRVA 3MZIA 5C42A 2X3DA 2XY5A 3FBCA 3NAHA 2CZ9A 5EHHA 1NEEA 2IJFA 1HPZB 4PPZA 1BD6A 4DV3J 1FJEB 3NGTA 4DV6F 1JXVA 4DL7A 2E1RA 4ED0A 1JLGB 4FZVA 5H9FJ 1UETA 2DRDA 4L72B 1IBKF 1T95A 3AJ1A 1IBMJ 3DLHA 3PFEA 4IUFA 1KOOA 2WB1D 1RAIB 1RHQB 3MM9A 4I67A 3ISNC 3FSIA 1WORA 2OTJS 2HLUA 2RUSA 4AQYF 1HR0F 3FFIA 2HWHA 5DZ7A 3Q8PB 3MTJA 4X4NA 3JYTB 5RUBA 3J7ZT 1U1NA 4MTPA 2CUYA 2DNZA 4LF8J 1FXLA 2DNQA 3OTEA 3SFGA 4QBUA 1U1KA 1WI8A 2EW9A 4K4WA 1RT7B 1NHKL 1AZSA 1CPZA 1ZM3A 2RU3A 4Y6IA 4PUOB 1NHUA 4DPWA 1U1RA 1VBZA 1FWPA 3KK2B 3GV5B 1NZAA 5ETQA 1GMWD 4DR6F 1LEOA 1VC0A 3HSGA 2XYPB 1X4HA 4Q43A 1S6UA 4NLTA 3TAMB 3MMBB 4JI2J 4FF2A 1YKWA 3EGWB 2V4RA 2RRNA 3AB4B 1U4BA 1AFIA 1R0BG 2OPPB 4OZJA 5H9EK 4DMZA 5B0BA 1TVRA 2VONA 3D6FB 5DDQC 4I1TA 1P9QC 5A8RA 3D6HB 3O8WA 1S48A 4Y2IA 2YNFA 2KVIA 3PYGA 2W8LA 2RE1A 1X5OA 1CLFA 1KR4A 1B0PA 2DHXA 2RS2A 1HNVB 2NXNA 4CO2A 1VQ8S 3NEKA 4ZCKA 1WUUA 2DBBA 2M8DB 2BJDA 3EM1A 2QMXA 4YFUA 5T41A 4ED7A 2KH9A 3KLFB 2BE2B 2Q79A 2XB2D 2AJ4A 2BX6A 3MMJA 4OYMA 5DG7A 2IDLA 4U67Q 3EZ5A 5IC6B 3ITHB 3RB3A 3R8YA 1NH7A 3BZQA 3FMBA 3RB6A 2DB1A 3G8QA 4FF4A 4K4SA 4DFPA 4MK8A 4ILMA 2VUGA 2YNHA 2ASLA 3LH2S 2CWXA 2E66A 1D9AA 4LF4F 2OD6A 1CBKA 4ZP9A 4GRSA 3MM8A 2JX2A 4WU3A 4AXIA 3CCTA 1T9UA 3VQTA 1NRKA 4ECRA 2DHSA 5AJ3J 3A12A 4NL5A 5DO2A 3FRZA 1NLKL 3NNAA 5J2NA 5DGBA 1XMBA 1DAXA 1VRTA 3G87A 4Q2LA 2HMIB 2CPJA 3WIVA 1U0HA 4EUVA 3KJNB 2EK6A 1VRUA 4RW8A 3TZXA 4DV3F 1CC8A 4PQAA 2YKNB 3GLJA 3SQOP 1HQEA 3J80U 3GJTB 1M5OC 5IC4B 3X1LB 1TL3A 1NB7A 4HKQA 2ILYA 1YQHA 2MQQA 1IBMF 2E1PA 3SEOA 3MD3A 3ENQA 1BE4A 1RSCA 1EB0A 3BDEA 5J2PB 2AEJA 4N77A 2PO4A 4DL2A 2JC0A 2V63A 5K8MA 5C2CA 1X7VA 2DIVA 4Y0FA 3VGUA 3W5XA 3NL0A 5HAOA 4LF8F 2FJXA 3QRRA 1H72C 4M5DA 2NSBA 3G6VA 2EFVA 1T8EA 4I2QB 2RRBA 2IDEA 3KNGA 3D28A 2ZH6A 4X4PA 1SKUB 5CYQA 1RTDB 5L1IA 2Y1RI 4ECVA 4DCPB 4KR0B 1EQMA 3QLHA 2QE5A 3LA0A 1XEZA 4DUZJ 4JI2F 2MKCA 2IM3A 3PX6A 1R0AA 2PA8D 1EETB 4UOCA 1M90T 2XNRA 4IFYB 1FFGB 2G13A 2FJWA 2BDPA 3IRXB 1SB6A 2COLA 2LQJA 4ZPBA 3DLEB 3HD2A 4J9UE 1EP4A 3VAIA 2ATCB 5KFNA 2HFSA 4NLUA 4OZ2A 1HI1A 2NXCA 1E6VA 4CO1A 2MZTA 3HFVA 4FNHA 1TKTA 3H8YA 3IBCB 4L75A 4UT4A 3FDSA 4WBFA 3GFHA 3IN5A 2YVSA 1MMDA 1SQEA 1YBTA 1UVMA 1VQKS 5HQ8A 1U09A 3G9CA 1RT7A 4Y2KA 3IMQJ 5FJ4A 2DT9A 2ZBRA 4Q44A 3V4IB 1LWFA 4PUOA 2DRAA 1U2FA 4NCGB 2VFVA 2FDNA 2CQHA 4FYVB 3W2VA 1U1OA 4FF1A 3IM9A 3VVUA 4TQRA 2KVQE 4D3GA 2CIMA 1RT5A 2I5JB 3LGHA 1NXIA 3HVAA 4ECSA 5AJ3F 1SJ1A 1VISA 1OY8A 2OPPA 1RWOB 1HMVB 5HSPA 1TP7A 1VQOS 4PYDA 3FGVA 2V8VA 3VAMA 2C2OB 3AH6A 2GIFA 4B3SJ 3DM2B 4MFBA 4CLTA 1U47A 4QQBA 2DD8S 3SYZA 3MEEB 1GNKA 2YKMB 3FKBA 4EBDA 3DYAA 4S0MA 1JLEA 4TY8B 2E7XA 2VU5A 4OMFG 4HHUA 2CQ2A 3C15A 2UZAA 1G3OA 1UVNA 3M8QA 2DNLA 1YJNS 4ZOSA 1WI6A 4EI2A 4DI6A 1EJ7L 4QW8A 3FCWA 2O5DA 4WZQA 2UV8G 1S9GA 2VODA 2QL5B 2AX0A 1ZETA 3IWXA 1HHSA 2B56A 3SCIE 2E9RX 2V2VA 3NS5A 4DV0J 1VYAA 3ZTOA 2AW0A 2VG6B 4ZJQA 3KNAA 3HI9A 5L46A 1UFKA 1DTQA 5D3GB 3FJ2A 3C6UA 3R9LA 5DQGA 3FNNA 4DPUA 2MZ1A 1HQUB 4DUZF 4JI7J 3WDOA 4ZCIA 5B0EA 4IOCQ 4TKTA 3T9ZA 2ZH7A 1KQSR 3H59A 2YKNA 1X4AA 1WG4A 4F25A 5T7LB 2R7UA 2E5GA 4RPFA 3R5GA 4LFAJ 3M9MB 4PG7A 4J9SA 3SQGB 3IFEA 2CJKA 5E5NA 3QJJA 3GIRA 3I0SA 2FVSA 2JEIA 5E3AA 1U24A 2Z58B 3W9HA 3MAHA 4L3NA 2RVJA 5ETRA 2P5VA 4IG3B 4PG6A 3LQVA 4CQ1A 3HVTB 4OLPA 2ZVSA 1KWMA 5HANA 1F6TA 4JI5J 3R97A 5M2UA 2C3YA 3M8PB 1H6KX 2J9EA 4GO5X 3OR1B 3HMJG 4O44A 2ALZA 1NPKA 1YRUA 1S57A 2RQ4A 2Y1LB 2MY8A 3C19A 2DR7A 2LDIA 1SJFA 5D0EA 2NQPA 2QFIA 1OYDA 1YTYA 3KWMA 4R0JA 3D1QA 2C2RA 1NDLA 3M2RB 4ELVA 1TQLA 4L74A 3GWCA 4M5GA 4XIUA 2DH8A 3WC0A 5F3ZA 5L9NA 3FEXB 4ZDNA 1ZAWA 4KPCA 4DDFA 2B4VA 4DX6A 4USKA 3PCOB 1P1LA 2JHEA 3D0IE 3NS7B 5EX0A 1NJYA 3N5FA 1E6YB 4FS2A 1S1TA 4C8OA 3MR5A 5HROA 4B3SF 3IXQA 1Q16B 4P71A 4HVZA 4O0IA 3L4BC 4K4TA 1IN0A 2QFJA 2KJVA 3BSCA 2YNGB 3TP2A 3AODA 2J0WA 2MEWA 4DQRA 2V6AA 1UVIA 3HKWA 2B8QA 3JQMA 2IVFB 1NSQA 4HHHA 3J7YI 2H4YB 4HDHA 4J9RA 1ULRA 4OQJA 3WIUA 1U45A 2EC0A 2HAIA 2OIHA 1TAQA 1S1UA 4R0EA 5HP1B 3NMAA 4ZVRB 3KJVB 2MLZA 1A6LA 3A8IA 2YX4A 4NI2B 1ZBTA 4DV0F 2QGFB 5HO4A 4WP9A 3SSRA 1RK8A 4RW7A 2PMHA 4CWBA 5GADI 1OS5A 1M5PC 1T3OA 2OJ3A 2YX7A 3I9ZA 3G6ES 1U6BA 1JIHA 1TK8A 1Y3KA 1CJUA 1RE1B 4WYWA 3GZ7A 1Q8IA 4JI7F 2IM0A 2VDIA 2RNEA 2W9BA 2F3JA 1RHRB 4RW6B 3CD7A 1B7FA 2QL9B 1OMSA 2NLWA 2VBYA 3H4BA 3CJQA 2V9WA 1T9YA 4LFAF 1S1WA 2CQCA 5J1EB 2M2BA 2JOQA 1CULB 4C3LA 1FD2A 2ZBQA 2PE8A 1PKUA 3DRXA 2HNDB 2UXBJ 5B0CA 2AV5A 4LRBA 4J9MA 5GAEU 3K17A 2OO4A 5AE1A 5F8IA 3LO3A 2PD1A 5A8WB 1F60B 1D09B 2JDJA 4WTYA 5HVGA 4B3OA 3JSMB 2HHXA 3PFOA 4JI5F 1IWGA 4TYBA 1KD1T 2LU2A 4CO4A 4CLLA 1DTTB 2ADCA 5DJBA 2ZNYA 4C0HA 3FMWA 1BMQB 3DRSB 3PM9A 1HQUA 2BMBA 4LJMA 3CDBA 2BABA 2DIUA 3H5UA 2XGQA 4NLSA 5CXTA 4ZPVR 4C11B 2W1BA 2QA4G 3M8RA 3TVYA 5KT2A 2FZGB 2GQ2A 5EUHA 3A4TA 1RHKB 2KFZA 3DLJA 3W63A 1UZHA 2OP5A 5T7LA 1UPMB 5D6GA 3PW2A 5KFTA 2JWNA 2DNYA 3ZZ0A 1PYSB 1VDHA 2D1CA 9RUBA 3NRBA 2P2CB 4LIWA 2FYXA 2N3OA 3RGIA 3V6JA 2XYHB 4EO8A 1KLNA 3MM5B 2ROPA 2JEFA 2W8KA 2VOPA 4NA2A 1WKKA 4ES2A 1N0UA 3P3DA 1UCNA 3DFEA 3SFUA 2GMJA 1QVFR 1QY7A 5A8KA 2GNKA 4FPIA 1TR0A 1U8SA 4TXSA 4K4YA 4HT7A 2JLFA 1UJ6A 2JFDA 4ETZA 3V6DA 4UOFA 4MT1A 3CULA 2XMMA 3R5AA 2ZHAA 4PQUB 4M5KA 4H4OB 3VGSA 1XTZA 1TL5A 4C9DA 1X5SA 3TZWA 1MU2B 5GAHU 1I6JA 1BQXA 1Q95G 3V81A 2XULA 1ZZNA 3K5NA 2I6WA 1JXLA 4DPTA 4FBUA 3FZBA 5HVHA 1SQGA 4C8KA 1JLFA 3VAGA 4PWUA 2DO0A 3A8KA 2E29A 4WIQA 3N5BA 3QGGA 3HD1A 1VQNS 1FCAA 2DNOA 2MQMA 1E6YA 3BH6B 1CS4B 2KDOA 4DLGA 5KFYA 2BV3A 5I42B 3JAMY 2W7OA 1IKVB 3VTIA 2N4DA 1RHUB 3FSXA 5HMYA 2HQ3A 4JB8B 1XBWA 4K8RA 2RS8A 1OY9A 1XR6A 3ICLA 2V4JA 1SC3B 4RBTA 2BZ2A 2AT1B 1H2TZ 4NCAA 4LF7J 1IKYB 2UXBF 2FLOA 4WK1A 5GAGU 3O1LA 2N7YA 4U7UD 1LKZA 4F2SA 1KHWA 5AE2A 1KLMA 2G0IA 3ENVA 5HP1A 1XMQJ 5BXIA 1FKOB 5CABA 1R43A 3MUVP 1RU2A 1OYEA 2R3VA 4AFFA 2KKHA 2HFVA 4Y2CA 2CNKB 4HTJA 2MB0B 1RAHB 3G8SA 4BS2A 4KQZA 4Q7AA 1UW9A 4KV8B 4K5RA 5EDWA 2IBOA 3HPOA 1BQMA 2VQFJ 4ED8A 3QFWA 1VQMS 3UPFA 2YX1A 3LF0A 1RABB 2K06A 1Q4RA 5DS7A 4KC5A 2HAFA 4NXNJ 3JQJA 1U0SA 1N4LA 1SH2A 5I3UB 1Y00A 4O23A 1OO0B 1K1SA 5THWA 3B54A 4YOEA 2ERRA 3EZUA 2F4FA 2JLEA 2HNDA 3O3LA 2HKEA 2MKKA 5D4PA 4Q8EA 2K8GA 4NE9C 4FYXB 2XLKA 2R4FA 4USJC 4CI0B 2C3UA 2P8IA 2ALYB 2V8PA 1WG5A 1YRXA 1IJFB 1K1QA 2OAUA 3FUYA 4HHJA 3PX4A 5ETKA 5DM7Q 3PYFA 4C8YA 1FFWB 2GVZA 2AEFA 4OZ3A 4CTAB 2QA1A 2VASA 2HRTA 3EICA 2V8DA 4YDDB 2GHWA 4UF4A 2J5AA 1WEZA 3QJPA 5F8LA 2IVYA 5H1SV 2EC2A 2WBMA 4N7TA 3G4SS 3M6XA 2GV1A 3OTBA 3T1AA 4RZRA 1LOUA 1HL6A 3L7PA 4XO0A 2FB0A 4RLEA 2YWWA 2XCPA 5K9FA 1FRJA 1WOPA 1CJKB 3LP2B 4UZBA 4ED4A 1BWEA 1MN7A 8ATCB 4ENOA 4NPOA 1Q7YT 2WW8A 1TKXA 4M5LA 2DISA 3RR7A 5D15A 3X3UA 1PJ5A 3C16B 4TU9A 3DKDA 4W90B 4ZPWR 4A46A 2DCLA 4E0DA 3K0JA 2HIQA 1H7XA 2O1PA 4K0KJ 2R8IA 2ASJA 1HYSA 4KBIA 1YGYA 4LF7F 1Y10A 3HHLA 2FJBB 1HBMA 4RJVA 2AJQA 2EKNA 1R7IA 2PIIA 2V50A 3MTKA 1ZPVA 3IS9B 1O8BA 3R6GB 1XMQF 3D0GE 2NS1B 3KMSA 3BREA 3U7JA 4H4OA 1U8WA 2FVQA 4DHVA 4RR5A 2GQCA 3RG6A 2IJRA 1MU2A 4DWIA 4NLVA 3CJ3A 2ZOGA 2GQQA 1AUDA 3I96A 3T5HA 2AJ2A 4URGA 2VPXB 1RP5A 3HF5A 3GE9A 1N5VA 3UDLA 4OIXA 3QYYA 2VQFF 2AU0A 4ICLA 4YB7A 5ETSA 1TV6B 3BR8A 1G1XA 1PG5B 2MQNA 3MGJA 5M2RA 2CJAA 3CNQP 3AFGA 1SC6A 1KN6A 1N52B 1RWPB 1ZM4A 2FC8A 3PRBA 3MOZA 1ZYQA 1GMVA 4XDCA 4V1Ak 1N5SA 1NB2A 2IBKA 2F1FA 4ZPCA 1RWVB 8RUCA 2AGQA 3M1VB 2CQ4A 1PAEX 3BO2A 2OUGA 1FVQA 3BKUA 2CG8A 2WBRA 5KFWA 2LQ9A 3ET6B 3D67A 2HGNA 4LREA 4B9UA 2ZBPA 1SC4B 1F2GA 1FDDA 2V69A 2D69A 1O0PA 4FDFA 1FWKA 2D3OR 2B9EA 3ETOA 1F3FA 3QIPA 2VDHA 2FQQB 3QJLA 2AYGA 1MLAA 1L3SA 2WTFA 1IVZA 5L1LA 3LTOA 4KV8A 2BANA 3R3TA 3DGPA 1NJXA 3SSQA 3UWTA 2C2DA 3BPDA 1P8GA 1VQSA 3KFWX 5IZHA 1LWCA 1CJVB 4KB7A 4DZDA 1NZ8A 3PW4A 3ZXWA 4A8KA 4WXWA 3FC9A 4NZ6A 3VGVA 4Q8FA 2MXYA 3MPUB 1S6OA 2N82B 4OZLA 2ZC4A 2VPYB 3I0RB 1A7GE 1FXDA 3S01A 4RUCA 3BH7B 3TYTA 1UA1A 3DI6B 3HVWA 5C2GA 4EFAC 4LSZB 1VGYA 3CSKA 2CKWA 3M32A 1MROB 2XMUA 2J8SA 4E2FB 1RTJB 1R8AA 2GMLA 2LA6A 2OEKA 3N4WA 5F8GA 4F0HA 2VG7B 4OYBA 4LSLA 1YJVA 4QYRA 1CG2A 3WX4A 2Y8WA 2HRUA 5CYJA 5J2MA 3CMES 2R8KA 3IAM9 3QO9A 4K0KF 3HHKA 5GMDA 4D3HA 2JH3A 4KGMA 4OHVA 2OEJA 1NK6A 5HQLA 2J7UA 4F8RA 3L9ZA 5K8OA 4A8MP 1NDCA 3C6TA 4EMDA 4OJGA 2ZZNA 2RU9A 1VJQA 4V19J 3OSNA 3PHEA 4IRKA 1TFYA 5LOQA 5J2QB 2HQDA 1F5CA 1CJTA 2FHJD 2VQEJ 3MECB 4OYPA 5CYMA 1XERA 2LEBA 3PR4A 1LFWA 4ZVSB 3VWSA 1YLXA 3K5MA 4DR3J 4ECUA 3BBCA 1PC4A 4WKYA 1K8AT 3UVJA 2KTQA 4ES3A 2J0QD 1WOOA 1XQIA 5KFMA 1RKIA 1M0SA 1VQ7S 5EWEA 2CPEA 3BDPA 2BQUA 3Q86A 3LP0A 4ZCMA 4EZ6A 3TO8A 3AOBA 2ZOFA 3FRYA 3HT0A 2KG1A 4B3MJ 1HWKA 4J9QA 4QYZK 3PKMA 3KLGB 3MFHA 2M4MA 3NY0A 2CXEA 1WHVA 2WAQD 2GS8A 3CCWA 4FNIA 4RBVA 4KHPJ 4ZKAA 1NK4A 5KFDA 2NREA 2A18A 5F8NA 4LF1A 1YI2S 3IRWP 3MURP 3DCAA 2VJUA 3EGVA 1Q5YA 2RMLA 2V68A 3EPIA 3C2PA 4USIA 3IAS9 1XR7A 3C14B 3OTDA 2WONB 2C3OA 2X1FA 1DQ9A 2IPOB 3I82A 4FYWB 2OFHX 3RU0A 2HK3A 3MEGB 4X65J 2WHOA 1ZS6A 4NLQA 5D0GA 4DQIA 3VF0B 1UVLA 5DZ6A 2GFFA 5IV4A 2FJEB 3NP5A 5JXSA 1GEHA 4GKKJ 4M5JA 3FBBA 1ZA1B 1GFWB 2W9AA 1RU1A 3BQ2A 4I0WA 1TK5A 2B6AB 2VF3A 2VPZB 1BY9A 1HBOA 4B08A 4TNOA 4OI0A 1AA1B 2GJ2A 4QZVB 2CQPA 2CJ9A 4OV6A 2IMWP 5HLFA 4MIBA 3AY0A 5KT7A 2N7CA 3DOLB 4KHMA 1GMUA 1KTQA 2EFPA 5HL7Q 1NBEB 5SUHA 2B5JA 2OPQA 2WVFA 2QT7A 3W1YC 3IWLA 2VZ9A 1S6QB 2X1AA 3L3CA 4Q0BB 2I38A 4WWSA 4CT9A 2PMWA 1Z2ZA 3V5RA 3N6MA 1SL1A 5SZTA 3PW5A 2RSQA 4IYQA 1VC5A 1RT1A 5D4LA 1S1XB 3W62A 5B08A 4UY85 3BKTA 4X4SA 3G71S 4TQSA 3L09A 2VBXA 1AB8A 1Q82T 3IA0A 4DQPA 3OR2B 5KG4A 4P73A 4EBEA 3WHIA 2IA6A 3H5YA 2VQEF 1IR1A 4TU8A 2GCFA 4CNZA 3GIIA 2VD3A 2VC0A 2GO8A 7FD1A 3KHHA 3CO9A 1G4CA 1YZ7A 5BR8J 3IR7B 4JOUA 3I0RA 3L7UA 1T05B 3NNCA 4I6AA 1JJ2R 2VKZG 3M2VB 1HNIB 2OPRB 3HK2A 1S49A 1Q53A 3D68A 4FVCA 2KT3A 4HH0A 4B3MF 5E7OB 2NYHA 5GAEI 2QJ3A 2MKJA 3DGVA 2GA7A 3CF5Q 5KG0A 2GAGC 4YMEA 2HVZA 1QTMA 4KFBA 2L3MA 1TL1B 1IKWB 3ZTSA 4KHPF 4K4ZA 3QNWB 2HHVA 1RTHA 2WVCA 3NCQA 1VQ5S 3GIKA 5KOXA 4UQGA 3VAHA 4OZ1A 4DFKA 3UCUP 4WKRA 4HDGA 3VVTA 3CCES 4QWEA 4HACB 2DEJA 3KUEA 2ILZA 4M5NA 3SCKE 1RAJA 1VIOA 2DXFA 2DY9A 2MLYA 3UE2A 2R7RA 3MMAB 2B43A 2H3EB 3GMGA 2WOMB 6AT1B 2ZVIA 4X65F 4NEYA 2JNJA 2ZM6J 4AXJA 4F36A 1JNRB 2QMWA 5AXKA 1XNRJ 2ZZTA 2F8MA 5MLCV 4I7FA 4GKKF 3HHLD 3IG1B 3SV4A 2HHHJ 2BYCA 4Z37A 1W7WA 1LK7A 2ZD1A 4IH5A 3N0VA 2BJ3A 2D3O1 3KLGA 3I31A 1SCJB 4ZLJA 2J8AA 2DYAA 2V67A 2QC3A 1NHVA 8AT1B 3D2WA 1GQEA 2J7WA 4IOAQ 1FKPB 1I1GA 1NM2A 2KM8C 1T3NA 4ECTA 1S0OA 2VG5A 3IR5B 2E5HA 4U8VA 2VC1A 3HDSA 3MFIA 4J7CA 5HJXA 3Q0AA 3SV3A 4HI1A 2C2ZB 5GMKa 3GFYA 1R8PA 3HKZD 1BQNB 1WOSA 3C14A 3KLIA 3MCOA 4RNOA 4X4UA 2XMWA 3CJKB 3CGIA 2ZEJA 2FVPA 2MPUA 4ZJLA 5GAHI 3DLLQ 1VS3A 4F02A 1XN9A 4M5HA 4RX6A 1SV5B 2C3MA 1H74A 1C1BA 3BJYA 4NEZA 4FBTA 1X31C 4A8FA 4KHRA 1NSPA 2BQRA 4BWMA 2RQKA 4LVOP 4OX6A 1EHWA 4DCJB 3IBWA 5B0FA 4ZPTR 1YJRA 2ZWPA 5BR8F 2EWHA 2ASDA 3NCPA 4A47A 2RQMA 3M6WA 3BBBA 2AYBA 2DPIA 1QSLA 4IDKB 2WCXA 2DPJA 4R25A 3MR7A 1GTHA 1KQKA 5GAGI 3E01A 2CPXA 1MMLA 2AP6A 5IQQA 1DZ5A 2HVHA 3MMCA 1BWVA 3F0NA 4ZVOB 3QGHA 5JVGQ 5DGAA 2DGQA 5DDOC 4JBCA 2Z0GA 4Q0BA 4USMA 1OIAA 4LRFA 2UV8A 2C2EA 3NS6A 4C3MA 4M5IA 3RBDA 2P9EA 4GVLA 5EX3A 2IAJB 1IBCB 3D0HE 3P96A 2XI2A 2R2TA 3H25A 1HBUA 2QN6B 4CT8A 1VQLS 2XS2A 3JAMU 4I2PA 1B0TA 2Y0BB 2VFRA 3MAAB 4OJHA 1RAFB 4LQ9A 3EWGA 1N5YB 1N88A 2ZM6F 2EPIA 3THPA 2VBZA 2BA9A 4LF6J 4Q5VA 1XNRF 4V19X 3V6HA 2GO9A 4JV5J 3UD3P 3KOAA 2EVZA 5L1KA 4LMZA 1Q1KA 3MPWA 4NLOA 3TAQA 5H9FK 2HHHF 1K9MT 1RADB 3M2VA 2OPRA 5A2QY 5C25B 2VOOA 1I51B 2ZUGA 1VJWA 2DRBA 3BQ0A 4BBYA 4RU2A 2EFQA 1R6VA 1FNOA 1S1VA 4QWCA 1UKUA 3M2UB 2Q43A 2X1GA 2HQCA 2V2ZA 4P72A 4ZA1A 2UU9J 4AE5A 1RA6A 2PGCA 3OFHA 4DF8A 2YWEA 1TKDA 4EYHB 1U25A 3G82B 4HACA 4BLGA 1UJ4A 1GH8A 3AOAA 4PAAA 4URSA 2UVWA 2RF2B 2QSWA 2BACA 4C0OC 5GADU 1OPZA 1REVA 3MMAA 4GMKA 1M1KT 2NZCA 5B09A 2XO7A 2GIRA 2APOA 5DDRC 3W66A 2CG4A 4QWAA 2Y1IA 3K5OA 4IRCA 3PX0A 3A3OB 2DGTA 2M0GB 3VALA 1RHMB 3TJ8A 4F2RA 4DV2F 4PR6A 4IG0A 4DN9A 1HD0A 5KFEA 4Q45A 2XGPA 3K89A 1DLOA 4DSJA 4ZPAA 4OYXA 2P6SA 2KJWA 5KAKA 1U1MA 1I5OB 2Q6CA 1RLDA 3WZ0A 5DDPC 1VHFA 4PZVA 1Q81T 4PG4A 4DFMA 5HMXA 3JXOA 3HFZB 1FKPA 1T03A 1R6YA 3NMRA 4YHHJ 3MCSA 2L48A 4QIGA 2CJQA 5IV3A 4LR7A 1P9YA 3HHDA 4LSNA 2O67A 3CIMA 3OLBA 4KAIA 3GPAA 2GZOA 1BGXT 3EZOA 4NLWA 3FZ2A 1GXTA 2JJ4D 5HQMA 1EARA 1FESA 4I68A 5LXRA 5KFOA 1HNXJ 3AA9A 3QT6A 4CZCA 1YRTA 4F4XA 1T02A 1YJTA 4B9MA 1C1CB 4NXMJ 1KQFB 1SV5A 4QWDA 3LAMA 3CCLS 2DR9A 4O3OA 1UAWA 2EG2A 1L3VA 2FGOA 1WDTA 2Y3YA 1K44A 4ITSA 1WNEA 4TU7A 4RWWA 3OVAA 3JSRA 3MUTP 2CPFA 4L6V3 4DBQA 2QX0A 3QZ7A 4F4AA 4LF6F 3TUIC 3OFEA 5E33A 1MWQA 1IR2A 3CDUA 4WFZA 1GK8A 4JV5F 2RDJA 4LR8A 2L9NA 4CH0S 1DQ8A 1SXLA 3SI8A 4DPYA 4X4OA 3D3CJ 1LXNA 4OYWA 4ID5A 3KMQA 3UN3A 3DN9A 1FNXH 1TZ0A 5EWGA 1BLUA 3MEDB 3OHAA 1FDNA 5KT4A 3D6MB 1PIEA 2BM0A 1REGX 3HXMA 5LXYA 3W2WB 1NK9A 2UU9F 2BUNA 4PWDA 5K8PA 3G2XA 4NOHA 2J76E 1UWAA 2YWKA 2Y8YA 3P5BP 2HEKA 4NRUA 2BJ9A 1RACB 2C2MB 2EFGA 1KNZA 2W2QP 2HPUA 2A0FB 4KTQA 1SKSA 1U1LA 5IFMA 1S0VA 4KKOB 3QSYB 4XPEA 4I4BA 3HVRA 2PN6A 1UA0A 2C1EB 3DXBA 2HNYA 4DSFA 4RW4A 4U6PA 1N34J 3MAAA 5ETPA 4JV0A 1UZDA 5IM0B 4DR7J 4OZ0A 3CD6S 3AXKA 4P2XA 1SUQA 2PMZD 2HNZB 2FHMA 1Q8BA 2DEIA 1RTZA 1MWYA 1DFDA 3SSSA 3OT9A 1U1QA 2HRYA 4IFVB 1YBUA 4IO9Q 1VI7A 4ZVUB 3TQ1A 1H2VZ 4MH8A 2HS4A 3ISZA 2PDAA 3TNVA 3WBZA 2CNLB 3NBPB 1C4AA 3R5BA 1BC6A 1RISA 1G6BA 3CCUS 2ZNZA 4P2MA 3OXLA 1HBNB 2ZBIA 1S9EB 2OSQA 1X4BA 3FK4A 3ZO7A 4AT1B 4DN0A 3GR1A 4IKAA 1WEYA 2IC3B 5AT1B 1RT2A 2M9KA 1VBYA 4RBUA 1RT3A 1T9TA 1F1BB 3PYDA 3MR3A 4C8LA 4Y3CA 3MAQA 1NSAA 1LWEA 3TOQA 4YHHF 2GVDB 4PXCA 2FZCB 3RBEA 3SXLA 1HHTP 4PXEA 4FKXA 2HVDA 2IRYA 2MHNA 5FDLA 1D9DA 4ELTA 4ZCLA 1D3WA 1V3SA 3TJ9A 2L41A 1XIQA 4X62J 2G9OA 3H40A 1S12A 2GGPA 5A0YB 1HLWA 1HNXF 2E5LJ 3GP9A 2HS0A 3CCQS 1NJWA 1U49A 2FGCA 1R8HA 4OYOA 4JI3J 4NXMF 2DO4A 3HJVA 3DNCA 4DLEA 2BW2A 3KK3B 3TW0A 1YWXA 2KRBA 4RUAA 2RKIB 2VFSA 3DMJB 2ACYA 4RW9B 1YVFA 3BGRB 3CJ5A 1SI9A 4P9SA 3C8YA 2H1YA 3DHXA 1WF1A 4W4MA 4DG1A 3TVZA 1ITPA 4R5PA 2XS7A 4CLKA 1W2BR 1WJ9A 3DRPA 1S5ZA 3TI0A 2IFXA 1JLQB 2J9CA 2KM8B 2QLWA 4U7CA 3ZZUA 3A13A 4EBCA 2HHSA 4WE1B 2B0GA 1H73A 3OUYB 4ES1A 2LA4A 1FRKA 4PXDA 3HM9A 3CJ0A 1JB0C 1YK9A 1W26A 1YZ6A 5MAOA 4NZ0A 1YSJA 2VBWA 2F8HA 2HBRB 1U6FA 2XSJB 2KT2A 3UO0A 3MD1A 1RT6A 3B82A 4RNMA 1RQ0A 1C1CA 3PZPA 1S0NA 4DV5J 3T9NA 4LFBJ 1WC5A 2QG9B 2QRRA 1MG7A 5D8HB 1W2IA 5DETA 3GG1A 1N34F 3QT7A 3Q2SC 3EMTA 4DR7F 3UI3A 6FDRA 1HQ2A 2AZ1A 3D1OA 3CUNA 3M7VA 3B78A 2FZKB 3P45B 1Z4UA 1C0TB 2ZDPA 3AD8C 4A8YA 2D41A 2D7SA 2VIHA 3H5XA 3A8EA 3GG0A 5IT0A 1TL7B 3GJQB 3DOMB 2QA2A 3Q2TC 2MGZB 1TTHB 4WTOB 4HYKA 1BHNA 2CPZA 4H4MA 3ZZZA 2GX8A 2YQ0A 4ZS6A 3TVKA 2EBGA 3SZ2A 2LYVA 3GONA 2FUG9 5I3QA 1A0OB 4MKBA 3NG8A 1M1GA 1LWXA 3HX9A 3KLEB 4RU9A 4ED2A 4JUZA 4CYUA 4NLXA 3I32A 3M6UA 1RGVA 4YN3B 2HW3A 4YQWA 4RO0A 1KFSA 4M94A 2MJNA 1BXNA 2W4CA 1KVKA 2LQ8A 1DHMA 4CCHA 3MM7A 1Q0NA 4QIWD 2HG4A 4OJ3A 2B3TB 3ILLA 1XK8A 1ZOTA 2AYMA 3KLHB 4F4YA 1SJRA 2GIQA 3T41A 3T6JA 3QQCD 4X62F 3H98A 3UW1A 1QJHA 1RLCL 1AFJA 2HQGA 3U1LA 5EWFA 3D4JA 1HPZA 2E5LF 5IM0A 1QM9A 1VBKA 4A8QA 3OJSA 1IJEB 3CCVS 3RB4A 4JI3F 2IMOA 2LFVA 2HHPA 1JKHB 4IFVA 2CPYA 4LBHA 1JLGA 2WB4A 4HEA9 5GMEA 3GQCA 3LPYA 2UVVA 1QTNB 4FYYB 2OSRA 3R2DJ 1VK3A 1FRXA 5B0DA 5D4OA 1LW0B 3MR2A 2ZFHA 2JRSA 1RTIB 1JMTA 2GHPA 1UL3A 3JYTA 4GKJJ 4F3OA 1S9EA 4JI8J 1SC1B 1NO8A 5A6PA 2L08A 2CRLA 2CNNB 2QLXA 3KHGA 2J0SD 5CZVA 1CQMA 4KO0B 5FLXY 2UXCJ 3KDNA 2WW4A 1R27B 1IM6A 2JSXA 3KK2A 1KC8T 1RAOA 3VZIA 1GMWA 3VAKA 3O6QA 3QGPA 4M63A 4J9PA 2DITA 2F8EX 3R6LB 3GFZA 1FNMA 3TAMA 2W9CB 1RWWB 3NNHA 3NGUA 3MMBA 3ETMA 2DXEA 5ETLA 3UFCX 5D77A 4N76A 2NUHA 1K47A 1Q7LB 2KL8A 2P9GA 2XI3A 4QU6A 1NUEA 1OSCA 3KK1B 2UP1A 3CD5A 3CJTA 3ILIA 3UCGA 1MWZA 3RZAA 3TAPA 5J1PA 3OL7A 4KE5A 3Q8VA 4DV5F 1IKXB 1C2PA 5DG9A 4LFBF 5JUMA 4ETXA 3Q83A 3DMJA 4MKVA 2EK1A 2Z4PA 1PJ6A 1HNVA 1S9FA 3U1NA 4MAKA 4PKDB 2DGXA 5DM6Q 1AXQA 1N33J 4PPDA 3EVOA 1JLQA 3KLFA 2BE2A 1Y11A 1Y4ZB 3SIPB 2C22A 3PO5A 5HBMB 4DSIA 3ITHA 3AXMA 1RYRA 4FF3A 3POTB 4O4GB 2U1AA 1RUSA 3D6TB 4X4QA 1AUSL 4WE1A 4ZITA 3OUYA 1RBAA 3LP1B 3LWMA 4B9VA 2BKOA 3BGLA 1F5AA 2CQ3A 4N41A 2OH2A 1VR6A 1HWLA 1VK8A 2YKQA 1SIZA 3US5A 1UJ5A 3TX8A 1NKBA 3PHTA 4E8UA 4J90A 3MWBA 5JJBA 2R8JA 2CQBA 2XSJA 3NGDA 3DOKB 4RUBA 2X3GA 3HT3A 3EGZA 4DF4A 3BGOP 2M3DA 1VCTA 1KQGB 2HMIA 1S76D 4YDXA 2NPIA 5KFJA 2IRUA 4QIEA 4L3KA 2A6OA 3UNYA 1WWHA 3HFKA 2WZ1A 3M8WA 4I6WA 3U02A 2M52A 4LRCA 4GVBB 2PC6A 2CZVC 4ANDA 2YNIB 2KZZA 1YIJS 4F3MA 3GCXP 2RUGA 3DOMA 1SVDA 2CPIA 2OPSB 1FDBA 1FTRA 2QEXS 3AHPA 3HHNB 2MQ8A 2V8HA 5J2PA 1OWXA 1NKCA 4CLUA 4JI8F 4KY3A 5KFCA 3W7BA 1S72S 2V0NA 1T94A 4WCEQ 3MCMA 5C42B 3H42A 4TVAB 2MKIA 2UXCF 4N56A 3PRDA 4I2QA 4W98A 4DQSA 4HL9A 3ZZOA 4F3QA 4NMLA 2KI2A 3EXCX 2O66A 1RTDA 4U9RA 3H4DA 4J9KA 1FEEA 1HWIA 1SPBP 3F56A 3SMZA 1DY3A 2BE7D 2FC9A 1J27A 4DV1J 1GT8A 3JTOA 5BYSA 4LVNP 3MM9B 4FKYA 2MZJA 1EETA 3FFIB 2LQBA 4QIFA 3BSNA 1UVKA 1QDUB 4CRJA 1WG1A 4IFYA 3QT5A 3QGIA 1YBAA 3IRXA 1CC7A 3CCRS 2WVBA 1Y7PA 3DLEA 2DHGA 5L9XA 2BEFA 2JVOA 1S99A 1NAQA 4CO3A 3TEHB 4DX7A 3OVSA 1AZSB 1QSYA 1YITS 3RTVA 4MK7A 2QTWA 4XTTA 1Z1ZA 1N33F 3BN4A 4CLWA 2C2KB 4IR9A 2E44A 3JSBA 3N6NA 3S7RA 2AIRB 3QFHA 3AB2B 4KO0A 3PXGa 4P74A 2BR0A 2ZJPQ 3QMQA 3V4IA 2HZCA 4NCGA 1QAJA 1X4CA 4J91A 3EJMA 1TVRB 2QLFB 2ATLA 5A8RB 1VIXA 1RBLA 1PAUB 1VLYA 1QAYA 3W61A 2U2FA 1G2EA 3KK1A 4X4VA 2I5JA 2HBQB 3M4XA 1PSDA 1Y9OA 2KN4A 2NZ4A 1IKXA 4NZ7A 1HMVA 5HJYA 4IH7A 5A2QU 1DJ0A 3HHEA 4ELUA 1B0VA 1FX4A 4B3TJ 1RAAB 3I4PA 5KG2A 1KRPA 2G2OA 2ZBCA 3JTNA 2X7IA 1NKEA 4BC9A 3V4MA 3A1YG 4OI2A 2BKNA 3FQLA 3DM2A 1VBXA 3PEHA 2B4PA 3BYPA 3MEEA 2VPWB 4HH1A 1ZAXA 2YKMA 2YNHB 3ELHA 2F40A 4TY8A 3TEGA 2LXFA 1P27B 2DNGA 2UXDJ 2SXLA 4C48A 3MM8B 2AWZA 2MYFA 1Q86T 4UW2A 4DR5J 3PW0A 1NK8A 4O4GA 4DXLA 1H98A 4ZVPB 3QZ8A 2BRLA 1Q79A 4X2BA 3LP1A 1ZZFA 1YJ7A 3UD4P 3PR5B 2AJFE 3OXGA 5J2NB 3R27A 2AGOA 1VRTB 1YX2A 3EGNA 3M9NB 2VG6A 2GJIA 3VAFA 3EPGA 1U0HB 3N01A 1WHXA 4A8XA 2QYGA 1VRUB 4RW8B 9ATCB 4Y28C 3HZEA 4C97A 1FDAA 2XY6A 2NPFA 5E3QA 4NMXA 5D3GA 3GV7B 2C3PA 1HQEB 4AUKA 4MK9A 3KUGA 4ZP8A 2E1MC 2HHWA 3MI7X 4DV1F 2XWYA 2H9ZA 5KFHA 2FD2A 1RAGB 5KT6A 5KFZA 3W9IA 2KXFA 4USUA 4I69A 2R2RA 5D0HA 4GVBA 3IC1A 3SQGA 4PABA 4M5DB 1ACMB 3Q23A 3QT8A 2KB2A 3HCXA 3BO3A 5CYQB 5E0OA 4YP3A 4IG3A 4ZVHA 2HGLA 4K7QA 4FYDA 3HVTA 3Q8YA 1ZA2B 3BSAA 3NLCA 3QLHB 3ILJA 2ZUAA 2KU7A 4UUWA 3M8PA 1NPPA 3B4MA 3UDEA 5E41A 4A8WA 4GC6A 1KFDA 1U48A 2OI2A 5ETOA 2FLPA 3OR1A 1R0AB 3MDFA 2IYIA 2ZH2A 3OV7A 2LECA 1SJ4P 2M5YA 1J5EJ 1LK5A 5D78A 4RL1A 1WKLA 3HP6A 4KSEB 1EP4B 3AD9C 1FERA 4C98A 2G1DA 2H5EA 3M2RA 3HZGA 5ADZA 3M8ZA 4W92B 1H38A 5L8RC 3OFFA 5FD1A 1WACA 2PA3A 3KG4A 1E6VB 4MKAA 4DR2J 1HNWJ 1CVJA 4TLQA 1SH3A 2ZH9A 2WK4A 3FEZA 4ZLLA 2DGOA 4B3TF 2ZOMA 1TKTB 3CC7S 4HLBA 3L7OA 3OQ2A 3OW2R 1ZM9A 4DSKA 2V34A 2MKSA 3P8BB 4F50A 2XSFA 1RXOB 5CHCB 3VR1A 1LWFB 3IR6B 1XWLA 3JB9k 4PXBA 2YNGA 2QL7B 4OX9J 2UXDF 1RZMA 3W2VB 3PG9A 2LVWA 5F8MA 4B9TA 3QSIA 3MR6A 3D5MA 4DR5F 4NYOA 1RT5B 1HWJA 4TN2A 1XJWB 5IWAJ 1AW0A 3PJ9A 2HURA 3KJVA 4N5SA 4KGXB 4P6QA 4C4WA 4NI2A 5K20B 2KFNA 4Y65A 4MYUA 3KKFA 1NMEB 2BE9B 1QUPA 3H5SA 4YB6A 4MFBB 1YJWS 2W2PP 2YKAA 5HATA 1UFLA 1N32J 3EX7B 5CH7B 2M70A 2ZH3A 1KVJA 1OJ4A 3DYAB 1JLEB 1VQ9S 2Z2ZA 2J6UA 4XAKA 4LIRA 3C15B 4RW6A 3B6BA 2XCAA 3M8QB 5LMNJ 4RWXA 2FJDB 2F9DA 3R7SB 1S9GB 2R7WA 4B3RJ 5J1EA 4OZ5A 1NK5A
chains in the Genus database with same CATH topology
1CULA 5IV4A 4CLKA 1FX4A 3G82A 2QV6A 1YBTA 3R5GA 4CLUA 3ET6B 2W01A 1AB8A 3C15A 1AZSB 4CLPA 4CLLA 4OYBA 3MR7A 1FX2A 2BW7A 1U0HA 4CLSA 2GVDB 1CJKB 4OYAA 4NI2A 4CLWA 4P2FA 1CJUA 4WP8A 1TL7B 4CLYA 1CS4A 3C14A 1CJTB 4WP3A 2GVZB 4USUA 4OYXA 5D0HA 4OYZA 3ET6A 3MAAA 1YK9A 1AZSA 4OYMA 5D15A 4P2XA 1WC0A 3C16B 4WPAA 2GVDA 1CJKA 4USVA 3UVJB 1CJVB 1CULB 1TL7A 3C14B 3G82B 1YBUA 1CJTA 1WC6A 4OYOA 2WZ1A 4OYWA 3C15B 2GVZA 4OZ3A 4OYPA 1Y10A 4USTA 5IV3A 4OZ2A 4CLZA 1WC1A 3MAAB 1WC4A 1U0HB 5D0RA 1Y11A 4CM2A 4OYIA 4CLTA 4CLFA 5D0EA 4NI2B 4P2MA 1WC3A 5D0GA 1CJUB 1WC5A 3C16A 1CS4B 4USWA 4CM0A 3UVJA 4WP9A 1CJVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CUL A;  5IV4 A;  4CLK A;  1FX4 A;  3G82 A;  2QV6 A;  1YBT A;  3R5G A;  4CLU A;  3ET6 B;  2W01 A;  1AB8 A;  3C15 A;  1AZS B;  4CLP A;  4CLL A;  4OYB A;  3MR7 A;  1FX2 A;  2BW7 A;  1U0H A;  4CLS A;  2GVD B;  1CJK B;  4OYA A;  4NI2 A;  4CLW A;  4P2F A;  1CJU A;  4WP8 A;  1TL7 B;  4CLY A;  1CS4 A;  3C14 A;  1CJT B;  4WP3 A;  2GVZ B;  4USU A;  4OYX A;  5D0H A;  4OYZ A;  3ET6 A;  3MAA A;  1YK9 A;  1AZS A;  4OYM A;  5D15 A;  4P2X A;  1WC0 A;  3C16 B;  4WPA A;  2GVD A;  1CJK A;  4USV A;  3UVJ B;  1CJV B;  1CUL B;  1TL7 A;  3C14 B;  3G82 B;  1YBU A;  1CJT A;  1WC6 A;  4OYO A;  2WZ1 A;  4OYW A;  3C15 B;  2GVZ A;  4OZ3 A;  4OYP A;  1Y10 A;  4UST A;  5IV3 A;  4OZ2 A;  4CLZ A;  1WC1 A;  3MAA B;  1WC4 A;  1U0H B;  5D0R A;  1Y11 A;  4CM2 A;  4OYI A;  4CLT A;  4CLF A;  5D0E A;  4NI2 B;  4P2M A;  1WC3 A;  5D0G A;  1CJU B;  1WC5 A;  3C16 A;  1CS4 B;  4USW A;  4CM0 A;  3UVJ A;  4WP9 A;  1CJV A; 
#chains in the Genus database with same CATH topology
 1CUL A;  1X9S A;  3U1M A;  1SKR A;  5E3P A;  1NU4 A;  3TRG A;  1B70 B;  1V9O A;  5L38 A;  5AXL A;  4DV4 J;  3GU0 A;  3KUH A;  1SL0 A;  1DTQ B;  1VC6 A;  1FJC A;  1FRM A;  4NLP A;  2KO1 A;  2PEH A;  4M95 A;  2EXU A;  2C2N A;  5A8W A;  2NXU A;  3M05 A;  3C6U B;  1JK9 B;  2Z2M A;  2POK A;  3GYN A;  4TYA A;  3Q89 A;  4ECW A;  1UTA A;  2W24 A;  4WP3 A;  4X64 J;  2ZKU A;  3JSM A;  1SQF A;  4NYZ A;  3ILO A;  5F8J A;  4X4R A;  1Z2L A;  3K5P A;  3JS9 A;  1ZTW A;  4M1K A;  1TEL A;  1DTT A;  1N54 B;  2NCK L;  2CZ4 A;  1VQ4 S;  4I56 A;  2GAH C;  5B7W A;  4F4K A;  1VQP S;  1X4G A;  4LT6 A;  1G7C B;  4OHW A;  1J5E F;  3AJD A;  4F7V A;  3DRS A;  2ZWO A;  1X5P A;  3PNI A;  2HWT A;  4N47 A;  2RH3 A;  2YXL A;  2RHQ B;  1K73 T;  4C11 A;  2G1H A;  4DL6 A;  2RIL A;  3I0S B;  6FD1 A;  2DHA A;  5KTQ A;  2OGU A;  4J37 A;  2IA0 A;  4ILR A;  4DR2 F;  1HNW F;  4QR1 A;  5KG7 A;  3I5B A;  1M5K C;  2IM1 A;  4G1I A;  4O3R A;  4KPY A;  4LF5 J;  3CJR A;  3CD0 A;  2XMT A;  5IT9 Y;  3RRK A;  3KG1 A;  2CAD A;  1S77 D;  3HHL C;  5CZX A;  3KYL A;  4ECZ A;  1U7L A;  3MM5 A;  1R8C A;  3KXD A;  4HTI A;  4O44 B;  1HI0 P;  3GR0 A;  1LW2 B;  4WXO A;  4OX9 F;  1FE0 A;  1ZM2 A;  3PKY A;  3SDE B;  3P4U B;  2RB7 A;  3N9U C;  3FCV A;  3W5Y A;  3G6X A;  4ZN3 A;  1VFJ A;  4P75 A;  5IWA F;  2FLL A;  2VFT A;  1JX4 A;  4G1Q B;  4OX7 A;  3CCS S;  1GXU A;  4PQU A;  4WFX A;  3BR9 A;  3CDA A;  2LMI A;  3PY8 A;  5EN1 A;  2I0X A;  1S1T B;  4M8L A;  5HRO B;  2CDQ A;  4C3K A;  3HUL A;  4MKY A;  4MYT A;  2JC1 A;  3FEY B;  1KOH A;  1N32 F;  3MCN A;  4CLP A;  3AD7 C;  2KXN B;  1QD1 A;  4ZK7 M;  3RJM B;  3UD5 A;  2XMA A;  2DVI A;  2BVZ A;  2PT0 A;  3R5D A;  1BUX A;  1KKH A;  3DLG B;  2V2Q A;  1CS4 A;  1PBA A;  5LMN F;  3NKY A;  4BDP A;  5I42 A;  1HI8 A;  4NXN F;  1IKV A;  3EXY A;  5AE3 A;  4J9V A;  2MHE A;  4B3R F;  5IS2 A;  4EEY A;  1RWU A;  2DNK A;  1S1U B;  4K2J A;  3RAX A;  5LL6 d;  1GX6 A;  3CJS A;  1S4E A;  3I87 A;  1NCL A;  4C8N A;  2MZS A;  2Q3P A;  3NAI A;  4JI0 J;  1IKY A;  4DV4 F;  2Z30 B;  2IHR 1;  4RW7 B;  3CXC R;  1QUV A;  3OXF A;  4P7V A;  3TA1 A;  2IJN A;  3OPK A;  2MJU A;  4KGK A;  5F0U A;  5H9E J;  4ZVQ B;  3DDI A;  2W2M P;  3F73 A;  4CH7 A;  1D0E A;  4CM2 A;  3DLK B;  4X64 F;  1FKO A;  5ETM A;  3Q8Q B;  1CJU B;  1RYS A;  1YJU A;  1C0U B;  2W9B B;  1GXL A;  4DFJ A;  3TJA A;  1FEH A;  2HQF A;  4F4Z A;  1UEV A;  4L76 A;  2R2S A;  3FBE A;  1FE4 A;  3CE8 A;  4FXD A;  1H2U X;  2HZA A;  3K59 A;  2R7T A;  2EFO A;  2KYZ A;  2Z56 B;  2FIU A;  3EDR B;  3RR8 A;  1S1W B;  2FJV A;  2DR5 A;  1FT8 A;  1IR0 A;  1F2H A;  3OSP A;  3OTC A;  2FTR A;  2IY5 B;  3OD2 A;  1EAY C;  5B0A A;  5T14 A;  4HT5 A;  2WSE C;  2ZHB A;  1X60 A;  4U95 A;  2J0X A;  4TY9 A;  4DSL A;  3R7B B;  5LM7 E;  3VAJ A;  3HSZ A;  4P2S A;  5I3U A;  2QMU B;  2I8E A;  5FLX U;  3MOJ B;  4ATN A;  4LF5 F;  4WFB Q;  4EGL A;  3EDQ B;  1UPP A;  4B3O B;  3J7A 1;  4CP5 A;  4DX5 A;  3PTW A;  3K5L A;  2HIY A;  2W4D A;  2DNH A;  2C42 A;  4KIA A;  5D4N A;  2BJ8 A;  2HHQ A;  4QW9 A;  4O3S A;  2AZ3 A;  4U8Y A;  3RYL A;  3KJF B;  2FJA B;  3DDN A;  2JVR A;  4PEO A;  4QU7 A;  2NUU G;  5F41 A;  4CTA A;  4DL4 A;  4DR4 J;  1NDP A;  2BJ7 A;  4G3I A;  3W8G A;  2Y0S D;  4NCB A;  2HVI A;  1LQ9 A;  4PG5 A;  1V6H A;  3BQ1 A;  2Y9H A;  3TAN A;  4DL3 A;  2CVI A;  3DXS X;  4U7U K;  1VHI A;  3R2C J;  4MIW A;  3D54 A;  2RQC A;  5LT5 A;  5F9N A;  4K4V A;  1F0X A;  1DQA A;  4PRF A;  5E3C A;  3CJ4 A;  4DQQ A;  2ADB A;  4NAS A;  3QPI A;  1CJK A;  2IYG A;  2LQ5 A;  3LP2 A;  4USV A;  1KP6 A;  2BQ3 A;  2ZJR Q;  2A1B A;  3GSD A;  4QR0 A;  2XYG B;  1OSD A;  2ABY A;  3ZTP A;  5HN0 A;  4CLZ A;  4Y2A A;  5A8K B;  3BM7 A;  2BJE A;  4RKU C;  2XMV A;  2CVE A;  3QAT A;  5KFS A;  5DRK A;  3C16 A;  1JJC B;  4ANE A;  3A3P B;  1LW2 A;  3V6D B;  2VJV A;  1T9W A;  4UOG A;  3ZZT A;  1UWB B;  3ENW A;  4JI0 F;  1HA1 A;  2YWG A;  5JMN A;  2UUC J;  2OD4 A;  3HSD A;  3SDE A;  2HBY B;  1WF0 A;  3V81 B;  5DLF A;  2YPZ A;  3IS9 A;  2YH1 A;  2KZM A;  5DQH A;  4G1Q A;  1JLF B;  1ARO P;  4O3P A;  2JZ5 A;  2ZH8 A;  3E3X A;  3N79 A;  2E1A A;  1X0P A;  2ZH4 A;  2FHK A;  3ISN D;  1D9F A;  3RAM A;  5ETN A;  1LV5 A;  3K2Y A;  2RDI A;  3CIZ A;  1NJZ A;  2HBZ B;  5ETT A;  5IQ6 A;  2E7W A;  5BYQ A;  4NA1 A;  2J6S A;  2FVC A;  3J81 j;  2GC8 A;  2D3Z A;  2V4J B;  3CO0 P;  1TV6 A;  2QSF A;  2AF6 A;  4CLF A;  3DLG A;  1EZZ B;  4F04 B;  3ZTQ A;  1FRL A;  1Q8K A;  1J5O B;  3T5K A;  2AJ0 A;  3BGU A;  4C6A A;  1KLM B;  4ZP7 A;  4Z7C A;  4X84 A;  1P6T A;  5I3P A;  1FD8 A;  3M6V A;  2AKW B;  3QID A;  4RNH A;  4URQ U;  4QPT A;  1JWW A;  3KJQ B;  4P2F A;  3M1V A;  1ROF A;  2EFN A;  2PEB A;  4HR2 A;  3ZFV A;  3ET6 A;  1HFE L;  3MPY A;  5LJ5 Y;  3J81 Y;  1XC9 A;  4KRW A;  4ZMM A;  2E5I A;  3DLK A;  2MMY A;  3CDW A;  1QAX A;  1C0U A;  1BQM B;  2LDY A;  4DR4 F;  2R7O A;  2UUA J;  2KT5 A;  1FFS B;  1WTF A;  4RUH A;  3W5Z A;  2ZC3 A;  4ZVT B;  1D1U A;  2Q1L A;  2CNO B;  4YB1 P;  1ELO A;  2CDR B;  4F0M A;  4R8U B;  2WRM A;  2RD5 C;  1NJI T;  4G65 A;  4EYI B;  4G1P A;  2DR8 A;  1CJV A;  1WEL A;  2R9L A;  4X4T A;  1NPR A;  1GTE A;  1C4C A;  2O01 C;  4QOT A;  1HW9 A;  2DJW A;  1SJQ A;  3R5C A;  4H4K C;  1R8B A;  3CMQ A;  4ALZ A;  5ETV A;  4DR3 F;  3GIJ A;  2KXH A;  4KGZ B;  3ZTR A;  4EO6 A;  4CLS A;  4DJB A;  4YY3 J;  1MNE A;  3DI6 A;  2FVR A;  3BB5 A;  1TFW A;  1CEZ A;  4DUY J;  2Z57 B;  3P5T L;  2CWK A;  2GVZ B;  1MRO A;  1RTJ A;  1FF2 A;  4OHY A;  2LCW A;  1S6P B;  2VG7 A;  5L1J A;  3CDE A;  3PEJ A;  3UN2 A;  1DBD A;  1OQ6 A;  1TUV A;  4KYZ A;  1JJ4 A;  1S0M A;  3CB4 A;  2KHD A;  3ZNJ 1;  2H65 B;  1S97 A;  2UUC F;  4DSE A;  2QO3 A;  2XZT B;  3MM6 B;  4OHZ A;  2Q6B A;  3CW2 C;  3PJW A;  5D0R A;  4OHX A;  2G4B A;  3GIL A;  3MEK A;  2UVU A;  3TA0 A;  2HFZ A;  4QJV A;  3W9J A;  1J2V A;  1TU0 B;  4LUB A;  3MHY A;  2JL9 A;  5J2Q A;  1F3V A;  4C2M A;  1TKX B;  2FHJ A;  1RT4 B;  3MEC A;  3LOU A;  2XNQ A;  3DHW C;  2R7V A;  4MMO A;  3DRR B;  5F3T A;  5KG5 A;  3ZZY A;  4NX9 A;  4OLO A;  5LMU J;  1FO1 A;  2AJ1 A;  1HYS B;  2AQ4 A;  4ZLN A;  4KH0 B;  3HHL B;  2PI5 A;  1A9N B;  3QAE A;  4FPR A;  2XHC A;  4OV1 A;  1KS2 A;  1HBM B;  4IQM A;  2HS3 A;  4XK8 C;  3PIO Q;  2B9Y A;  5BYR A;  3FCH A;  7FDR A;  3SBM A;  4GO7 X;  2UVR A;  1UVJ A;  1IM4 A;  5G4D A;  1R3N A;  2N3L A;  3N28 A;  2QLJ B;  5KFR A;  3J7A N;  2P9C A;  1UWB A;  1TMM A;  3BS9 A;  2HHT A;  3CMA S;  1NSK L;  1ZAV A;  1HWU A;  3CVK A;  2V8G A;  2OEM A;  2VA2 A;  4K59 A;  3PDN A;  4Z7Y A;  5M2P A;  1F9E B;  3RUB L;  3W60 A;  3AA8 A;  2G0C A;  5CAA A;  2BM1 A;  2WON A;  4ICL B;  3QBC A;  2OLW A;  2WVE A;  4KGV B;  2MSS A;  5C7P A;  2UUA F;  3MEG A;  1WSR A;  4GC7 A;  3IGV A;  5GVQ A;  4OYA A;  4ED6 A;  2DNR A;  4F26 A;  1VOM A;  3NOC A;  2MZR A;  2BBE A;  1T7P A;  2VH7 A;  1RWN B;  2PI4 A;  4BHQ A;  1HNZ J;  5IOL A;  4WII A;  1TAU A;  2DXD A;  3KTQ A;  4OL8 A;  2B6A A;  3K8V A;  4UTG A;  5CD4 H;  4CO5 A;  1J5O A;  1ICE B;  3GIM A;  1X9M A;  2OFG X;  4LRA A;  1KEK A;  1X4D A;  1FRH A;  3D9B A;  2EEY A;  4USH A;  2GJF A;  4JYA J;  1VRQ C;  3EE3 A;  4YY3 F;  1B4S A;  4DUY F;  2F63 A;  3DOL A;  3QIP B;  4QIV A;  1N6Q B;  4IOB A;  3P49 B;  2YKP A;  1RWM B;  1NK0 A;  3BKF A;  1AT1 B;  4NRT A;  1GX5 A;  2BAN B;  1S6Q A;  3DGP B;  1UEK A;  3NGS A;  3EYZ A;  2F9J A;  3UDV A;  2F7V A;  4PG8 A;  2DH9 A;  3QRP A;  2XC9 A;  1LWC B;  4PWW A;  1R31 A;  4Z2X A;  3Q8R B;  2HFO A;  3H2U B;  1S1X A;  2XMK A;  5C24 B;  1FTC A;  2RRA A;  1IQZ A;  5KFL A;  2LP4 A;  1IBL J;  2L9W A;  3VCD A;  1L3U A;  4R8U A;  2I9S A;  3OR2 A;  3S6E A;  3H20 A;  5KFF A;  1RAE B;  3BSO A;  2UUT A;  4IR1 A;  3UQS A;  1K0V A;  4O3Q A;  3H2V E;  1VQ6 S;  3M32 B;  1D8Y A;  3W3S A;  2ASY A;  1TK0 A;  4JV2 A;  2GHV C;  4P7T A;  1OY6 A;  4LSL B;  1UP1 A;  2KYX A;  1U02 A;  1WSV A;  2VV5 A;  1WC4 A;  5J2M B;  1RHJ B;  5LMU F;  2B4O A;  3QO9 B;  3DC2 A;  1T05 A;  4WFN Q;  4G6V B;  4B9L A;  3LGN A;  2UUB J;  1HNI A;  4ZP6 A;  3F41 A;  3C6T B;  2MQP A;  3T3F A;  1S6P A;  5I4M A;  2CQ1 A;  1LFP A;  3R5J B;  3GSI A;  2R7Q A;  2VB6 A;  4BCA A;  1TL1 A;  2DH7 A;  1IKW A;  2AMC B;  4B17 A;  1KSP A;  1SIW B;  1U26 A;  1CJT B;  1HHQ A;  2GW8 A;  3MM6 A;  1HIY A;  4ZN1 A;  5KFB A;  5CYM B;  3V6K A;  5KT5 A;  4WYL A;  4ER8 A;  3QWU A;  2H4W B;  1P1T A;  2NSC A;  2YWF A;  2IRX A;  2MQL A;  4N8N A;  2A10 A;  4WFY A;  3UVJ B;  2CQ0 A;  3DU6 A;  1TKZ B;  2DKO B;  2WOM A;  3OBI A;  1T9V A;  2BXJ A;  3THV A;  3LP0 B;  1RT4 A;  2OEL A;  3LAK A;  2A2C A;  3LGM A;  1KON A;  2RT3 A;  3Q24 A;  2EKY A;  1X4E A;  2ZE2 B;  3DRR A;  2B7B B;  2OKQ A;  3WX8 A;  4JV1 A;  1HNZ F;  4ZIW A;  3BO4 A;  1TUW A;  4OX8 A;  3IG1 A;  3BN7 A;  1PO6 A;  2J9D A;  1FA0 A;  2LXI A;  1H3D A;  3QWP A;  3RBX A;  2XWX A;  2XBP A;  3HSJ A;  4JYA F;  4ECY A;  1X9W A;  2QZ8 A;  2I2Y A;  3KHR A;  1X4F A;  4C8M A;  1F5B A;  2VL1 A;  3M9O B;  2XHW A;  1JLB B;  4QWB A;  4DU7 A;  4RNF A;  2HQI A;  2EI5 A;  3FQK A;  1Q78 A;  2IIH A;  1RB0 A;  3OFG A;  3TAR A;  1M5S A;  1EKS A;  2D74 B;  3NCR A;  2YKO A;  3H90 A;  4CDI A;  2B51 A;  2J9D E;  3I4H X;  1BQN A;  2DHH A;  2AYE A;  2W7P A;  4WU2 A;  3RAQ A;  2QYC A;  1NND A;  3TWZ A;  3CJK A;  3CJ2 A;  3GJS B;  5KFA A;  2WSC C;  5LSO A;  4JP8 A;  4NA3 A;  1HBO B;  3AQP A;  1WC3 A;  4LFC J;  1QE1 B;  2R7S A;  3S8S A;  5IT9 U;  2XEX A;  2ACM A;  1PYT A;  1IBL F;  1EQ0 A;  4CIO A;  3JTP A;  2M7S A;  5HLF B;  1S7I A;  1SL2 A;  3CCJ S;  4L73 A;  1FXR A;  2RHS B;  3UN5 A;  2MST A;  3I55 S;  3PVX A;  3MF5 A;  2W2O P;  1HW8 A;  3K57 A;  3A3N B;  1YHQ S;  5EGY A;  2B5J B;  2KRR A;  1JXE A;  2JFK A;  2OPQ B;  5HK4 A;  3PO4 A;  2L9D A;  2CA9 A;  1URR A;  1IWA A;  5KFX A;  4LBP A;  3VV2 B;  4EU0 A;  2XM3 A;  4B9S A;  3LAL A;  4IDK A;  1KTV A;  2UUB F;  1FI4 A;  2UUW A;  3C66 A;  1RT1 B;  2B7C B;  1N6Q A;  2V94 A;  4JI1 J;  4OZN A;  4J9O A;  2WSF C;  1X8D A;  3LPE A;  2H51 B;  4F0K A;  4AYB D;  3BV8 A;  2B9W A;  2BOA A;  2W2N P;  2HLT A;  1PJ7 A;  4MIA A;  2IAJ A;  1Y0H A;  5C24 A;  4DOZ A;  2FPH X;  2CYY A;  2MQO A;  2K7K A;  3GYG A;  3C46 A;  1T9X A;  1XNQ J;  1L3K A;  3T5J A;  4NLY A;  5K14 B;  4K50 A;  3DU5 A;  1B99 A;  4B02 A;  1RWX B;  1N5Y A;  3TZZ A;  1SJ3 P;  1N5Q A;  4WP8 A;  4FP9 A;  1Y5I B;  1HAR A;  3D1H A;  1O51 A;  2DNM A;  4DR1 J;  2BJ1 A;  3L95 X;  3E8O A;  4OYZ A;  3ZZR A;  1K0T A;  4KFB B;  1MSW D;  5KG6 A;  1Y5N B;  1RTH B;  1N0V C;  4YUD A;  1VLO A;  5CA5 A;  1WC0 A;  4UY8 T;  1QSS A;  5A6W A;  1WF2 A;  2ZH1 A;  1QVG R;  3IP0 A;  5C25 A;  2HZV A;  2X1B A;  4OI1 A;  2JEG A;  2XZD B;  5KT3 A;  2CQD A;  3M2U A;  5KFI A;  2HWI A;  5HMZ A;  5KG1 A;  5KFP A;  4BWJ A;  3IO1 A;  3FBF A;  2CPH A;  2F65 A;  1N48 A;  4A48 A;  3G82 A;  2CPD A;  1KBR A;  2AD9 A;  1U2C A;  2V5H G;  1F9H A;  1FK9 B;  3IGN A;  4I7F B;  2RF2 A;  2QIF A;  2YPY A;  2DTJ A;  3O5T B;  3KLV A;  1RJJ A;  2F5G A;  1TKZ A;  3NOG A;  4FVM A;  2XO6 A;  2HGM A;  4B9N A;  1UMJ A;  4FS1 A;  2ZD1 B;  4C7Q A;  4LFC F;  1XMO J;  4Y2M A;  1MW7 A;  2ZE2 A;  3H0P A;  2OTL S;  2ZZM A;  3I5C A;  3BYR A;  4OI6 A;  4KJI A;  5DQI A;  3H2L A;  1JJH A;  3QAU A;  1L5U A;  3PAC A;  3J80 Y;  4XPC A;  2XQC A;  2AHO B;  1SH0 A;  2VG5 B;  3TUJ C;  4ZJO A;  3Q22 A;  3N6L A;  3PIP Q;  5L39 A;  2NYI A;  3Q8U A;  4OI3 A;  2LEA A;  3D66 A;  4K5S A;  1ZTT A;  4U96 A;  2DNP A;  4ZHR B;  3KLI B;  2CJX B;  4X66 J;  4CM0 A;  3HJF A;  1Y3J A;  5E2Q A;  2ZDO A;  1WKJ A;  2H48 B;  3VHQ A;  4DX8 H;  1FKA F;  2QV6 A;  2W4P A;  2VKR A;  4YS2 A;  1JLB A;  4DCO B;  4JI4 J;  1RKJ A;  1N56 A;  4JI1 F;  2BW7 A;  3SCL E;  3RRH A;  3GFX A;  2KG0 A;  4FXV A;  1C1B B;  3BGF A;  3UR0 A;  5J1N A;  1SBR A;  4AL7 A;  4OI4 A;  1PYO B;  3LW5 C;  2ZJQ Q;  3I56 S;  4C8Z A;  5KOW A;  4Q2M A;  3JSY A;  1JLC B;  4FN5 A;  3P6Y C;  2IVM A;  4CO0 A;  4H54 A;  1JNZ B;  1YJ9 S;  1QE1 A;  3ZZP A;  1XNQ F;  2KHC A;  3E51 A;  3M30 B;  3CCZ A;  2MKY A;  4E98 A;  2MY7 A;  4WK3 A;  2LLZ A;  5B0G A;  4A4J A;  1B3T A;  2HYI B;  4K4X A;  3I5A A;  2P6T A;  1T11 A;  4OFZ A;  3E01 B;  2YBV A;  3D7S B;  4NLR A;  1RWK B;  3MMC B;  4DR1 F;  4NLG A;  3UR3 C;  2M88 A;  1S79 A;  1N36 J;  2LEP A;  1WHW A;  4ZVG A;  3TX0 A;  4DV7 J;  2W01 A;  2FY8 A;  1JLA B;  3MED A;  4TLR A;  1B64 A;  2FY1 A;  5G0R B;  3V2U C;  3T19 A;  3W2W A;  1HBU B;  3O2I A;  3HO1 A;  3E2E A;  4I2P B;  3J7Z 5;  3UNG C;  3FVY A;  4A8S A;  1TL4 A;  4FXW A;  3B4D A;  4LBI A;  3CC2 S;  1I94 J;  2MDA A;  3UCZ P;  2NXE A;  5KFG A;  1DUR A;  1L3T A;  2K7J A;  4KKO A;  1R89 A;  2HFN A;  5IXU A;  5K14 A;  1U2R A;  2AGP A;  3VZH A;  5JVH Q;  2R42 A;  2Z2Y B;  4IH6 A;  3WC2 A;  3A8J A;  4H4K A;  2J6T A;  4LF9 J;  2FLN A;  1EKR A;  3W64 A;  2H5I B;  2HNZ A;  5HMW A;  2LKZ A;  4USW A;  1XMO F;  2RAQ A;  4O3N A;  2XMJ A;  3M8Y A;  1S1V B;  2XLJ A;  1V5V A;  4ED1 A;  4WF9 Q;  5LSL A;  3GTY X;  1EX8 A;  3TA2 A;  2ZH5 A;  1LNQ A;  3NBP A;  4ILL A;  3J81 U;  3CPW R;  4P52 A;  1PC5 A;  2KFY A;  1X0F A;  2MZQ A;  3BBF A;  4ED3 A;  1HBN A;  3AOC A;  2PFF B;  2VA3 A;  1U1P A;  4ZLP A;  3IWN C;  3PYE A;  2IC3 A;  3LAN A;  1RA7 A;  2HFU A;  3T5L A;  4X66 F;  4M5M A;  2BKP A;  3ADA C;  2X51 A;  1REV B;  1RCO B;  2Z8Q A;  4C0B A;  5HI7 A;  2HSE B;  2GVD A;  2CAJ A;  4JI4 F;  2R8H A;  2CFX A;  4CH1 A;  4QCL A;  4DL0 C;  1WC6 A;  2C28 A;  4NWB A;  2A6M A;  4IQX A;  2YY3 A;  3CC4 S;  1FK9 A;  3RB0 A;  5F8H A;  1WC1 A;  4OJ1 A;  3EUN A;  2VHG A;  4EZ9 A;  3GYX B;  2K1R B;  4DEZ A;  3C3L A;  4IG0 B;  4DS4 A;  1Q8L A;  1DRZ A;  5A0Y A;  3TQE A;  2MKH A;  3U27 A;  2Z2L A;  1U6Z A;  1DLO B;  2K3K A;  1OPI A;  3MPD A;  5LJ3 Y;  4WFA Q;  4QYZ J;  2ROE A;  2J7K A;  3S1T A;  2G0J A;  5HVF A;  3KK3 A;  2CJY B;  3MUM P;  2AEM A;  2RKI A;  3M8S A;  4ZIV A;  3DLB A;  3NGR A;  4F4W A;  4PCQ A;  4RW9 A;  1V5I B;  3BGR A;  3PV8 A;  2W7A A;  3T1H J;  3DRY A;  3I6P A;  5F9L A;  2DGS A;  1M1H A;  1T03 B;  3CJ8 A;  2E9T A;  4YR3 A;  1T0T V;  4ZVF A;  2IM2 A;  1FJG J;  1Y5L B;  5KFU A;  1IXK A;  4LR9 A;  3RRG A;  2M8H A;  3BEG B;  3ONQ A;  4LSN B;  1WHY A;  3OLA A;  1WTB A;  2HK2 A;  2BRK A;  1N36 F;  3EVM A;  3HLU A;  4ECQ A;  1QLN A;  1O5J A;  4WPA A;  4ANC A;  4ZHR A;  2ZIT A;  4YR0 A;  4DV7 F;  1PCA A;  2CQI A;  3TR5 A;  3K7R A;  1FVS A;  2I1R A;  1JQG A;  3CED A;  1FJ7 A;  4CNY A;  4LQ3 A;  1WD6 A;  5DLG A;  1AYE A;  4F67 A;  3H7H B;  2G2Z A;  1TUG B;  3OL6 A;  1F9F A;  3K58 A;  2W25 A;  3R1L A;  4QR2 A;  2E7V A;  4O4R A;  2R2U A;  2CQG A;  5F0W A;  5AXM A;  3VQS A;  3NGK A;  4DV2 J;  3BF4 A;  5KFQ A;  1NH8 A;  4ZVE A;  1I94 F;  1HKA A;  2NXJ A;  4NYP A;  3CCM S;  1JLC A;  1DAR A;  3I9V 9;  1FX2 A;  1I3O B;  3G8T A;  3M30 A;  3SCJ E;  1X5T A;  7AT1 B;  1NDK A;  3KHL A;  3T6B A;  1VQY A;  1QAI A;  5CCM A;  4ID5 B;  3VGT A;  1WEX A;  3Q8S B;  3NWR A;  1N5T A;  4LF9 F;  4YEA A;  3NXZ A;  1M5V C;  4DS5 A;  4UZC A;  2MTL A;  5KFV A;  2DCU B;  2OMO A;  1C0T A;  2HVE A;  2JEJ A;  4EWT A;  2G2Y A;  3NWG A;  4NLD A;  2NR0 A;  3ULH A;  1SKW A;  3OVB A;  4MJK A;  1PIL A;  4AL5 A;  3UDC A;  3T1Y J;  1IUJ A;  2K2P A;  1TL7 A;  4PWD B;  4ID8 A;  1MMN A;  4DPX A;  3CT9 A;  2MGZ A;  4I64 A;  4Y34 A;  4KT0 C;  2D3U A;  1JLA A;  4JI6 J;  4GKJ F;  3PJX A;  4P10 A;  5G0R A;  3TUZ C;  2RJZ A;  1FWL A;  1KHV A;  3KLE A;  2ROG A;  4ECX A;  4YR2 A;  1PGZ A;  2H54 B;  2HNY B;  3GCW P;  4RW4 B;  1S10 A;  3TZY A;  3RBZ A;  3OTO J;  3AJ2 A;  1FHT A;  4UOH A;  2WVD A;  5FII A;  3DDK A;  5IT4 A;  1SUQ B;  2YWH A;  1CSJ A;  4UQT A;  2XG8 A;  3OHB A;  2XS5 A;  3KLH A;  4CLY A;  1M5H A;  3RW6 A;  1MN9 A;  4Y00 A;  4RNN A;  2PSZ A;  2YH0 A;  3EVW A;  2O3D A;  3GJR B;  4A8O A;  2N4C A;  5KFK A;  4ZPD A;  5A76 A;  2E5J A;  1KDN A;  1JKH A;  2B4U A;  4DPO A;  1RT2 B;  1KVI A;  1ZPW X;  2XTJ P;  1RT3 B;  3AAW B;  3T1H F;  3IM8 A;  3J7Y U;  1HD1 A;  1H7W A;  3TUP A;  4EK2 A;  5AXN A;  2V9K A;  4ERD A;  2LXU A;  1LWE B;  2Q66 A;  4OYI A;  1LW0 A;  2DNN A;  1FJG F;  2D9P A;  1RTI A;  4IRD A;  3AT1 B;  2VFU A;  4DL5 A;  5FDL B;  1V3Z A;  2AX1 A;  1UW4 A;  4ED5 A;  4LF2 A;  2F4V J;  1Q5V A;  1XR5 A;  3ZC4 A;  2XLI A;  3GV8 B;  5ITH A;  3GB0 A;  1FRI A;  2GGP B;  2A2D A;  3CTR A;  5LSR A;  1N8R T;  1OQ3 A;  1VMB A;  1H0H B;  2K3I A;  4DZ6 A;  3THT A;  1UEU A;  1YG0 A;  3AQO A;  4LRD A;  2YQ3 A;  4DV6 J;  2RDD A;  2GMH A;  2MLX A;  4K4U A;  4J9L A;  1IBK J;  1URN A;  2W9C A;  2ZKT A;  2YNF B;  2B9X A;  2K1R A;  3LWL A;  2D9O A;  3BPS P;  5DG8 A;  1LXJ A;  2XY7 A;  5KG3 A;  4UUX A;  2QA4 S;  2R8G A;  4DG1 B;  4AQY J;  4R5P B;  2YTC A;  1HR0 J;  2E9Z A;  3LUY A;  1S59 A;  2XZW A;  3DRP B;  2V2K A;  4K2X A;  1RI7 A;  3IBF B;  4KH1 B;  3PW7 A;  2FHO B;  2OHD A;  2BOP A;  5CQG A;  4XDD A;  2VIC A;  3D3B J;  3OJU A;  4IO1 A;  3R1H A;  4YB5 A;  1W25 A;  3ENA A;  5E3R A;  4BC7 A;  2E1C A;  5C5J A;  3G6Y A;  4DR6 J;  3T1Y F;  2R7X A;  1ZH5 A;  3CWJ A;  2A3J A;  5HBM A;  3MPV A;  4O0N A;  3MXH P;  1GAO A;  3KG0 A;  3R7N B;  3JQK A;  3POT A;  4N8O A;  4JI6 F;  3O44 A;  1NK7 A;  4WZM A;  1RT6 B;  1S7H A;  2B8P A;  4PYA A;  3W65 A;  3OL9 A;  3ZNU A;  3K8W A;  3WQP A;  4QPX A;  3RW7 A;  4J9N A;  1TMJ A;  5U47 A;  4DUT A;  2EG1 A;  2DGV A;  3OTO F;  4DU8 A;  2HHU A;  5K8N A;  1WDD A;  2DR6 A;  3DOK A;  1V3R A;  3G86 A;  4UST A;  2QLB B;  1RBO B;  5K5M A;  1TL3 B;  1RCX B;  2OML A;  1D8Z A;  2DK2 A;  5CD4 A;  3KDO A;  2DGU A;  5BJR A;  1R0C B;  3QRQ A;  1CQN A;  4H4M B;  2Y1J A;  4HI2 A;  2JLG A;  1S4F A;  3W8P A;  1APS A;  4I6Y A;  3G96 A;  3B8H A;  1UFW A;  2PFD A;  5CCL A;  1EIY B;  2YNI A;  4AD6 A;  1IQT A;  2DY1 A;  1O6X A;  4AL6 A;  4CYU B;  1B7Y B;  3FSY A;  4LF4 J;  1YDL A;  2RIJ A;  3F44 A;  2OPS A;  4J5O A;  2YQ1 A;  2DGW A;  3MM7 B;  1RDR A;  2V4Q A;  2H5J B;  2ZHO A;  4WJB A;  2LU1 A;  3OL8 A;  1PBU A;  2F4V F;  2CJB A;  2EBE A;  3PRV A;  3MZI A;  5C42 A;  2X3D A;  2XY5 A;  3FBC A;  3NAH A;  2CZ9 A;  5EHH A;  1NEE A;  2IJF A;  1HPZ B;  4PPZ A;  1BD6 A;  4DV3 J;  1FJE B;  3NGT A;  4DV6 F;  1JXV A;  4DL7 A;  2E1R A;  4ED0 A;  1JLG B;  4FZV A;  5H9F J;  1UET A;  2DRD A;  4L72 B;  1IBK F;  1T95 A;  3AJ1 A;  1IBM J;  3DLH A;  3PFE A;  4IUF A;  1KOO A;  2WB1 D;  1RAI B;  1RHQ B;  3MM9 A;  4I67 A;  3ISN C;  3FSI A;  1WOR A;  2OTJ S;  2HLU A;  2RUS A;  4AQY F;  1HR0 F;  3FFI A;  2HWH A;  5DZ7 A;  3Q8P B;  3MTJ A;  4X4N A;  3JYT B;  5RUB A;  3J7Z T;  1U1N A;  4MTP A;  2CUY A;  2DNZ A;  4LF8 J;  1FXL A;  2DNQ A;  3OTE A;  3SFG A;  4QBU A;  1U1K A;  1WI8 A;  2EW9 A;  4K4W A;  1RT7 B;  1NHK L;  1AZS A;  1CPZ A;  1ZM3 A;  2RU3 A;  4Y6I A;  4PUO B;  1NHU A;  4DPW A;  1U1R A;  1VBZ A;  1FWP A;  3KK2 B;  3GV5 B;  1NZA A;  5ETQ A;  1GMW D;  4DR6 F;  1LEO A;  1VC0 A;  3HSG A;  2XYP B;  1X4H A;  4Q43 A;  1S6U A;  4NLT A;  3TAM B;  3MMB B;  4JI2 J;  4FF2 A;  1YKW A;  3EGW B;  2V4R A;  2RRN A;  3AB4 B;  1U4B A;  1AFI A;  1R0B G;  2OPP B;  4OZJ A;  5H9E K;  4DMZ A;  5B0B A;  1TVR A;  2VON A;  3D6F B;  5DDQ C;  4I1T A;  1P9Q C;  5A8R A;  3D6H B;  3O8W A;  1S48 A;  4Y2I A;  2YNF A;  2KVI A;  3PYG A;  2W8L A;  2RE1 A;  1X5O A;  1CLF A;  1KR4 A;  1B0P A;  2DHX A;  2RS2 A;  1HNV B;  2NXN A;  4CO2 A;  1VQ8 S;  3NEK A;  4ZCK A;  1WUU A;  2DBB A;  2M8D B;  2BJD A;  3EM1 A;  2QMX A;  4YFU A;  5T41 A;  4ED7 A;  2KH9 A;  3KLF B;  2BE2 B;  2Q79 A;  2XB2 D;  2AJ4 A;  2BX6 A;  3MMJ A;  4OYM A;  5DG7 A;  2IDL A;  4U67 Q;  3EZ5 A;  5IC6 B;  3ITH B;  3RB3 A;  3R8Y A;  1NH7 A;  3BZQ A;  3FMB A;  3RB6 A;  2DB1 A;  3G8Q A;  4FF4 A;  4K4S A;  4DFP A;  4MK8 A;  4ILM A;  2VUG A;  2YNH A;  2ASL A;  3LH2 S;  2CWX A;  2E66 A;  1D9A A;  4LF4 F;  2OD6 A;  1CBK A;  4ZP9 A;  4GRS A;  3MM8 A;  2JX2 A;  4WU3 A;  4AXI A;  3CCT A;  1T9U A;  3VQT A;  1NRK A;  4ECR A;  2DHS A;  5AJ3 J;  3A12 A;  4NL5 A;  5DO2 A;  3FRZ A;  1NLK L;  3NNA A;  5J2N A;  5DGB A;  1XMB A;  1DAX A;  1VRT A;  3G87 A;  4Q2L A;  2HMI B;  2CPJ A;  3WIV A;  1U0H A;  4EUV A;  3KJN B;  2EK6 A;  1VRU A;  4RW8 A;  3TZX A;  4DV3 F;  1CC8 A;  4PQA A;  2YKN B;  3GLJ A;  3SQO P;  1HQE A;  3J80 U;  3GJT B;  1M5O C;  5IC4 B;  3X1L B;  1TL3 A;  1NB7 A;  4HKQ A;  2ILY A;  1YQH A;  2MQQ A;  1IBM F;  2E1P A;  3SEO A;  3MD3 A;  3ENQ A;  1BE4 A;  1RSC A;  1EB0 A;  3BDE A;  5J2P B;  2AEJ A;  4N77 A;  2PO4 A;  4DL2 A;  2JC0 A;  2V63 A;  5K8M A;  5C2C A;  1X7V A;  2DIV A;  4Y0F A;  3VGU A;  3W5X A;  3NL0 A;  5HAO A;  4LF8 F;  2FJX A;  3QRR A;  1H72 C;  4M5D A;  2NSB A;  3G6V A;  2EFV A;  1T8E A;  4I2Q B;  2RRB A;  2IDE A;  3KNG A;  3D28 A;  2ZH6 A;  4X4P A;  1SKU B;  5CYQ A;  1RTD B;  5L1I A;  2Y1R I;  4ECV A;  4DCP B;  4KR0 B;  1EQM A;  3QLH A;  2QE5 A;  3LA0 A;  1XEZ A;  4DUZ J;  4JI2 F;  2MKC A;  2IM3 A;  3PX6 A;  1R0A A;  2PA8 D;  1EET B;  4UOC A;  1M90 T;  2XNR A;  4IFY B;  1FFG B;  2G13 A;  2FJW A;  2BDP A;  3IRX B;  1SB6 A;  2COL A;  2LQJ A;  4ZPB A;  3DLE B;  3HD2 A;  4J9U E;  1EP4 A;  3VAI A;  2ATC B;  5KFN A;  2HFS A;  4NLU A;  4OZ2 A;  1HI1 A;  2NXC A;  1E6V A;  4CO1 A;  2MZT A;  3HFV A;  4FNH A;  1TKT A;  3H8Y A;  3IBC B;  4L75 A;  4UT4 A;  3FDS A;  4WBF A;  3GFH A;  3IN5 A;  2YVS A;  1MMD A;  1SQE A;  1YBT A;  1UVM A;  1VQK S;  5HQ8 A;  1U09 A;  3G9C A;  1RT7 A;  4Y2K A;  3IMQ J;  5FJ4 A;  2DT9 A;  2ZBR A;  4Q44 A;  3V4I B;  1LWF A;  4PUO A;  2DRA A;  1U2F A;  4NCG B;  2VFV A;  2FDN A;  2CQH A;  4FYV B;  3W2V A;  1U1O A;  4FF1 A;  3IM9 A;  3VVU A;  4TQR A;  2KVQ E;  4D3G A;  2CIM A;  1RT5 A;  2I5J B;  3LGH A;  1NXI A;  3HVA A;  4ECS A;  5AJ3 F;  1SJ1 A;  1VIS A;  1OY8 A;  2OPP A;  1RWO B;  1HMV B;  5HSP A;  1TP7 A;  1VQO S;  4PYD A;  3FGV A;  2V8V A;  3VAM A;  2C2O B;  3AH6 A;  2GIF A;  4B3S J;  3DM2 B;  4MFB A;  4CLT A;  1U47 A;  4QQB A;  2DD8 S;  3SYZ A;  3MEE B;  1GNK A;  2YKM B;  3FKB A;  4EBD A;  3DYA A;  4S0M A;  1JLE A;  4TY8 B;  2E7X A;  2VU5 A;  4OMF G;  4HHU A;  2CQ2 A;  3C15 A;  2UZA A;  1G3O A;  1UVN A;  3M8Q A;  2DNL A;  1YJN S;  4ZOS A;  1WI6 A;  4EI2 A;  4DI6 A;  1EJ7 L;  4QW8 A;  3FCW A;  2O5D A;  4WZQ A;  2UV8 G;  1S9G A;  2VOD A;  2QL5 B;  2AX0 A;  1ZET A;  3IWX A;  1HHS A;  2B56 A;  3SCI E;  2E9R X;  2V2V A;  3NS5 A;  4DV0 J;  1VYA A;  3ZTO A;  2AW0 A;  2VG6 B;  4ZJQ A;  3KNA A;  3HI9 A;  5L46 A;  1UFK A;  1DTQ A;  5D3G B;  3FJ2 A;  3C6U A;  3R9L A;  5DQG A;  3FNN A;  4DPU A;  2MZ1 A;  1HQU B;  4DUZ F;  4JI7 J;  3WDO A;  4ZCI A;  5B0E A;  4IOC Q;  4TKT A;  3T9Z A;  2ZH7 A;  1KQS R;  3H59 A;  2YKN A;  1X4A A;  1WG4 A;  4F25 A;  5T7L B;  2R7U A;  2E5G A;  4RPF A;  3R5G A;  4LFA J;  3M9M B;  4PG7 A;  4J9S A;  3SQG B;  3IFE A;  2CJK A;  5E5N A;  3QJJ A;  3GIR A;  3I0S A;  2FVS A;  2JEI A;  5E3A A;  1U24 A;  2Z58 B;  3W9H A;  3MAH A;  4L3N A;  2RVJ A;  5ETR A;  2P5V A;  4IG3 B;  4PG6 A;  3LQV A;  4CQ1 A;  3HVT B;  4OLP A;  2ZVS A;  1KWM A;  5HAN A;  1F6T A;  4JI5 J;  3R97 A;  5M2U A;  2C3Y A;  3M8P B;  1H6K X;  2J9E A;  4GO5 X;  3OR1 B;  3HMJ G;  4O44 A;  2ALZ A;  1NPK A;  1YRU A;  1S57 A;  2RQ4 A;  2Y1L B;  2MY8 A;  3C19 A;  2DR7 A;  2LDI A;  1SJF A;  5D0E A;  2NQP A;  2QFI A;  1OYD A;  1YTY A;  3KWM A;  4R0J A;  3D1Q A;  2C2R A;  1NDL A;  3M2R B;  4ELV A;  1TQL A;  4L74 A;  3GWC A;  4M5G A;  4XIU A;  2DH8 A;  3WC0 A;  5F3Z A;  5L9N A;  3FEX B;  4ZDN A;  1ZAW A;  4KPC A;  4DDF A;  2B4V A;  4DX6 A;  4USK A;  3PCO B;  1P1L A;  2JHE A;  3D0I E;  3NS7 B;  5EX0 A;  1NJY A;  3N5F A;  1E6Y B;  4FS2 A;  1S1T A;  4C8O A;  3MR5 A;  5HRO A;  4B3S F;  3IXQ A;  1Q16 B;  4P71 A;  4HVZ A;  4O0I A;  3L4B C;  4K4T A;  1IN0 A;  2QFJ A;  2KJV A;  3BSC A;  2YNG B;  3TP2 A;  3AOD A;  2J0W A;  2MEW A;  4DQR A;  2V6A A;  1UVI A;  3HKW A;  2B8Q A;  3JQM A;  2IVF B;  1NSQ A;  4HHH A;  3J7Y I;  2H4Y B;  4HDH A;  4J9R A;  1ULR A;  4OQJ A;  3WIU A;  1U45 A;  2EC0 A;  2HAI A;  2OIH A;  1TAQ A;  1S1U A;  4R0E A;  5HP1 B;  3NMA A;  4ZVR B;  3KJV B;  2MLZ A;  1A6L A;  3A8I A;  2YX4 A;  4NI2 B;  1ZBT A;  4DV0 F;  2QGF B;  5HO4 A;  4WP9 A;  3SSR A;  1RK8 A;  4RW7 A;  2PMH A;  4CWB A;  5GAD I;  1OS5 A;  1M5P C;  1T3O A;  2OJ3 A;  2YX7 A;  3I9Z A;  3G6E S;  1U6B A;  1JIH A;  1TK8 A;  1Y3K A;  1CJU A;  1RE1 B;  4WYW A;  3GZ7 A;  1Q8I A;  4JI7 F;  2IM0 A;  2VDI A;  2RNE A;  2W9B A;  2F3J A;  1RHR B;  4RW6 B;  3CD7 A;  1B7F A;  2QL9 B;  1OMS A;  2NLW A;  2VBY A;  3H4B A;  3CJQ A;  2V9W A;  1T9Y A;  4LFA F;  1S1W A;  2CQC A;  5J1E B;  2M2B A;  2JOQ A;  1CUL B;  4C3L A;  1FD2 A;  2ZBQ A;  2PE8 A;  1PKU A;  3DRX A;  2HND B;  2UXB J;  5B0C A;  2AV5 A;  4LRB A;  4J9M A;  5GAE U;  3K17 A;  2OO4 A;  5AE1 A;  5F8I A;  3LO3 A;  2PD1 A;  5A8W B;  1F60 B;  1D09 B;  2JDJ A;  4WTY A;  5HVG A;  4B3O A;  3JSM B;  2HHX A;  3PFO A;  4JI5 F;  1IWG A;  4TYB A;  1KD1 T;  2LU2 A;  4CO4 A;  4CLL A;  1DTT B;  2ADC A;  5DJB A;  2ZNY A;  4C0H A;  3FMW A;  1BMQ B;  3DRS B;  3PM9 A;  1HQU A;  2BMB A;  4LJM A;  3CDB A;  2BAB A;  2DIU A;  3H5U A;  2XGQ A;  4NLS A;  5CXT A;  4ZPV R;  4C11 B;  2W1B A;  2QA4 G;  3M8R A;  3TVY A;  5KT2 A;  2FZG B;  2GQ2 A;  5EUH A;  3A4T A;  1RHK B;  2KFZ A;  3DLJ A;  3W63 A;  1UZH A;  2OP5 A;  5T7L A;  1UPM B;  5D6G A;  3PW2 A;  5KFT A;  2JWN A;  2DNY A;  3ZZ0 A;  1PYS B;  1VDH A;  2D1C A;  9RUB A;  3NRB A;  2P2C B;  4LIW A;  2FYX A;  2N3O A;  3RGI A;  3V6J A;  2XYH B;  4EO8 A;  1KLN A;  3MM5 B;  2ROP A;  2JEF A;  2W8K A;  2VOP A;  4NA2 A;  1WKK A;  4ES2 A;  1N0U A;  3P3D A;  1UCN A;  3DFE A;  3SFU A;  2GMJ A;  1QVF R;  1QY7 A;  5A8K A;  2GNK A;  4FPI A;  1TR0 A;  1U8S A;  4TXS A;  4K4Y A;  4HT7 A;  2JLF A;  1UJ6 A;  2JFD A;  4ETZ A;  3V6D A;  4UOF A;  4MT1 A;  3CUL A;  2XMM A;  3R5A A;  2ZHA A;  4PQU B;  4M5K A;  4H4O B;  3VGS A;  1XTZ A;  1TL5 A;  4C9D A;  1X5S A;  3TZW A;  1MU2 B;  5GAH U;  1I6J A;  1BQX A;  1Q95 G;  3V81 A;  2XUL A;  1ZZN A;  3K5N A;  2I6W A;  1JXL A;  4DPT A;  4FBU A;  3FZB A;  5HVH A;  1SQG A;  4C8K A;  1JLF A;  3VAG A;  4PWU A;  2DO0 A;  3A8K A;  2E29 A;  4WIQ A;  3N5B A;  3QGG A;  3HD1 A;  1VQN S;  1FCA A;  2DNO A;  2MQM A;  1E6Y A;  3BH6 B;  1CS4 B;  2KDO A;  4DLG A;  5KFY A;  2BV3 A;  5I42 B;  3JAM Y;  2W7O A;  1IKV B;  3VTI A;  2N4D A;  1RHU B;  3FSX A;  5HMY A;  2HQ3 A;  4JB8 B;  1XBW A;  4K8R A;  2RS8 A;  1OY9 A;  1XR6 A;  3ICL A;  2V4J A;  1SC3 B;  4RBT A;  2BZ2 A;  2AT1 B;  1H2T Z;  4NCA A;  4LF7 J;  1IKY B;  2UXB F;  2FLO A;  4WK1 A;  5GAG U;  3O1L A;  2N7Y A;  4U7U D;  1LKZ A;  4F2S A;  1KHW A;  5AE2 A;  1KLM A;  2G0I A;  3ENV A;  5HP1 A;  1XMQ J;  5BXI A;  1FKO B;  5CAB A;  1R43 A;  3MUV P;  1RU2 A;  1OYE A;  2R3V A;  4AFF A;  2KKH A;  2HFV A;  4Y2C A;  2CNK B;  4HTJ A;  2MB0 B;  1RAH B;  3G8S A;  4BS2 A;  4KQZ A;  4Q7A A;  1UW9 A;  4KV8 B;  4K5R A;  5EDW A;  2IBO A;  3HPO A;  1BQM A;  2VQF J;  4ED8 A;  3QFW A;  1VQM S;  3UPF A;  2YX1 A;  3LF0 A;  1RAB B;  2K06 A;  1Q4R A;  5DS7 A;  4KC5 A;  2HAF A;  4NXN J;  3JQJ A;  1U0S A;  1N4L A;  1SH2 A;  5I3U B;  1Y00 A;  4O23 A;  1OO0 B;  1K1S A;  5THW A;  3B54 A;  4YOE A;  2ERR A;  3EZU A;  2F4F A;  2JLE A;  2HND A;  3O3L A;  2HKE A;  2MKK A;  5D4P A;  4Q8E A;  2K8G A;  4NE9 C;  4FYX B;  2XLK A;  2R4F A;  4USJ C;  4CI0 B;  2C3U A;  2P8I A;  2ALY B;  2V8P A;  1WG5 A;  1YRX A;  1IJF B;  1K1Q A;  2OAU A;  3FUY A;  4HHJ A;  3PX4 A;  5ETK A;  5DM7 Q;  3PYF A;  4C8Y A;  1FFW B;  2GVZ A;  2AEF A;  4OZ3 A;  4CTA B;  2QA1 A;  2VAS A;  2HRT A;  3EIC A;  2V8D A;  4YDD B;  2GHW A;  4UF4 A;  2J5A A;  1WEZ A;  3QJP A;  5F8L A;  2IVY A;  5H1S V;  2EC2 A;  2WBM A;  4N7T A;  3G4S S;  3M6X A;  2GV1 A;  3OTB A;  3T1A A;  4RZR A;  1LOU A;  1HL6 A;  3L7P A;  4XO0 A;  2FB0 A;  4RLE A;  2YWW A;  2XCP A;  5K9F A;  1FRJ A;  1WOP A;  1CJK B;  3LP2 B;  4UZB A;  4ED4 A;  1BWE A;  1MN7 A;  8ATC B;  4ENO A;  4NPO A;  1Q7Y T;  2WW8 A;  1TKX A;  4M5L A;  2DIS A;  3RR7 A;  5D15 A;  3X3U A;  1PJ5 A;  3C16 B;  4TU9 A;  3DKD A;  4W90 B;  4ZPW R;  4A46 A;  2DCL A;  4E0D A;  3K0J A;  2HIQ A;  1H7X A;  2O1P A;  4K0K J;  2R8I A;  2ASJ A;  1HYS A;  4KBI A;  1YGY A;  4LF7 F;  1Y10 A;  3HHL A;  2FJB B;  1HBM A;  4RJV A;  2AJQ A;  2EKN A;  1R7I A;  2PII A;  2V50 A;  3MTK A;  1ZPV A;  3IS9 B;  1O8B A;  3R6G B;  1XMQ F;  3D0G E;  2NS1 B;  3KMS A;  3BRE A;  3U7J A;  4H4O A;  1U8W A;  2FVQ A;  4DHV A;  4RR5 A;  2GQC A;  3RG6 A;  2IJR A;  1MU2 A;  4DWI A;  4NLV A;  3CJ3 A;  2ZOG A;  2GQQ A;  1AUD A;  3I96 A;  3T5H A;  2AJ2 A;  4URG A;  2VPX B;  1RP5 A;  3HF5 A;  3GE9 A;  1N5V A;  3UDL A;  4OIX A;  3QYY A;  2VQF F;  2AU0 A;  4ICL A;  4YB7 A;  5ETS A;  1TV6 B;  3BR8 A;  1G1X A;  1PG5 B;  2MQN A;  3MGJ A;  5M2R A;  2CJA A;  3CNQ P;  3AFG A;  1SC6 A;  1KN6 A;  1N52 B;  1RWP B;  1ZM4 A;  2FC8 A;  3PRB A;  3MOZ A;  1ZYQ A;  1GMV A;  4XDC A;  4V1A k;  1N5S A;  1NB2 A;  2IBK A;  2F1F A;  4ZPC A;  1RWV B;  8RUC A;  2AGQ A;  3M1V B;  2CQ4 A;  1PAE X;  3BO2 A;  2OUG A;  1FVQ A;  3BKU A;  2CG8 A;  2WBR A;  5KFW A;  2LQ9 A;  3ET6 B;  3D67 A;  2HGN A;  4LRE A;  4B9U A;  2ZBP A;  1SC4 B;  1F2G A;  1FDD A;  2V69 A;  2D69 A;  1O0P A;  4FDF A;  1FWK A;  2D3O R;  2B9E A;  3ETO A;  1F3F A;  3QIP A;  2VDH A;  2FQQ B;  3QJL A;  2AYG A;  1MLA A;  1L3S A;  2WTF A;  1IVZ A;  5L1L A;  3LTO A;  4KV8 A;  2BAN A;  3R3T A;  3DGP A;  1NJX A;  3SSQ A;  3UWT A;  2C2D A;  3BPD A;  1P8G A;  1VQS A;  3KFW X;  5IZH A;  1LWC A;  1CJV B;  4KB7 A;  4DZD A;  1NZ8 A;  3PW4 A;  3ZXW A;  4A8K A;  4WXW A;  3FC9 A;  4NZ6 A;  3VGV A;  4Q8F A;  2MXY A;  3MPU B;  1S6O A;  2N82 B;  4OZL A;  2ZC4 A;  2VPY B;  3I0R B;  1A7G E;  1FXD A;  3S01 A;  4RUC A;  3BH7 B;  3TYT A;  1UA1 A;  3DI6 B;  3HVW A;  5C2G A;  4EFA C;  4LSZ B;  1VGY A;  3CSK A;  2CKW A;  3M32 A;  1MRO B;  2XMU A;  2J8S A;  4E2F B;  1RTJ B;  1R8A A;  2GML A;  2LA6 A;  2OEK A;  3N4W A;  5F8G A;  4F0H A;  2VG7 B;  4OYB A;  4LSL A;  1YJV A;  4QYR A;  1CG2 A;  3WX4 A;  2Y8W A;  2HRU A;  5CYJ A;  5J2M A;  3CME S;  2R8K A;  3IAM 9;  3QO9 A;  4K0K F;  3HHK A;  5GMD A;  4D3H A;  2JH3 A;  4KGM A;  4OHV A;  2OEJ A;  1NK6 A;  5HQL A;  2J7U A;  4F8R A;  3L9Z A;  5K8O A;  4A8M P;  1NDC A;  3C6T A;  4EMD A;  4OJG A;  2ZZN A;  2RU9 A;  1VJQ A;  4V19 J;  3OSN A;  3PHE A;  4IRK A;  1TFY A;  5LOQ A;  5J2Q B;  2HQD A;  1F5C A;  1CJT A;  2FHJ D;  2VQE J;  3MEC B;  4OYP A;  5CYM A;  1XER A;  2LEB A;  3PR4 A;  1LFW A;  4ZVS B;  3VWS A;  1YLX A;  3K5M A;  4DR3 J;  4ECU A;  3BBC A;  1PC4 A;  4WKY A;  1K8A T;  3UVJ A;  2KTQ A;  4ES3 A;  2J0Q D;  1WOO A;  1XQI A;  5KFM A;  1RKI A;  1M0S A;  1VQ7 S;  5EWE A;  2CPE A;  3BDP A;  2BQU A;  3Q86 A;  3LP0 A;  4ZCM A;  4EZ6 A;  3TO8 A;  3AOB A;  2ZOF A;  3FRY A;  3HT0 A;  2KG1 A;  4B3M J;  1HWK A;  4J9Q A;  4QYZ K;  3PKM A;  3KLG B;  3MFH A;  2M4M A;  3NY0 A;  2CXE A;  1WHV A;  2WAQ D;  2GS8 A;  3CCW A;  4FNI A;  4RBV A;  4KHP J;  4ZKA A;  1NK4 A;  5KFD A;  2NRE A;  2A18 A;  5F8N A;  4LF1 A;  1YI2 S;  3IRW P;  3MUR P;  3DCA A;  2VJU A;  3EGV A;  1Q5Y A;  2RML A;  2V68 A;  3EPI A;  3C2P A;  4USI A;  3IAS 9;  1XR7 A;  3C14 B;  3OTD A;  2WON B;  2C3O A;  2X1F A;  1DQ9 A;  2IPO B;  3I82 A;  4FYW B;  2OFH X;  3RU0 A;  2HK3 A;  3MEG B;  4X65 J;  2WHO A;  1ZS6 A;  4NLQ A;  5D0G A;  4DQI A;  3VF0 B;  1UVL A;  5DZ6 A;  2GFF A;  5IV4 A;  2FJE B;  3NP5 A;  5JXS A;  1GEH A;  4GKK J;  4M5J A;  3FBB A;  1ZA1 B;  1GFW B;  2W9A A;  1RU1 A;  3BQ2 A;  4I0W A;  1TK5 A;  2B6A B;  2VF3 A;  2VPZ B;  1BY9 A;  1HBO A;  4B08 A;  4TNO A;  4OI0 A;  1AA1 B;  2GJ2 A;  4QZV B;  2CQP A;  2CJ9 A;  4OV6 A;  2IMW P;  5HLF A;  4MIB A;  3AY0 A;  5KT7 A;  2N7C A;  3DOL B;  4KHM A;  1GMU A;  1KTQ A;  2EFP A;  5HL7 Q;  1NBE B;  5SUH A;  2B5J A;  2OPQ A;  2WVF A;  2QT7 A;  3W1Y C;  3IWL A;  2VZ9 A;  1S6Q B;  2X1A A;  3L3C A;  4Q0B B;  2I38 A;  4WWS A;  4CT9 A;  2PMW A;  1Z2Z A;  3V5R A;  3N6M A;  1SL1 A;  5SZT A;  3PW5 A;  2RSQ A;  4IYQ A;  1VC5 A;  1RT1 A;  5D4L A;  1S1X B;  3W62 A;  5B08 A;  4UY8 5;  3BKT A;  4X4S A;  3G71 S;  4TQS A;  3L09 A;  2VBX A;  1AB8 A;  1Q82 T;  3IA0 A;  4DQP A;  3OR2 B;  5KG4 A;  4P73 A;  4EBE A;  3WHI A;  2IA6 A;  3H5Y A;  2VQE F;  1IR1 A;  4TU8 A;  2GCF A;  4CNZ A;  3GII A;  2VD3 A;  2VC0 A;  2GO8 A;  7FD1 A;  3KHH A;  3CO9 A;  1G4C A;  1YZ7 A;  5BR8 J;  3IR7 B;  4JOU A;  3I0R A;  3L7U A;  1T05 B;  3NNC A;  4I6A A;  1JJ2 R;  2VKZ G;  3M2V B;  1HNI B;  2OPR B;  3HK2 A;  1S49 A;  1Q53 A;  3D68 A;  4FVC A;  2KT3 A;  4HH0 A;  4B3M F;  5E7O B;  2NYH A;  5GAE I;  2QJ3 A;  2MKJ A;  3DGV A;  2GA7 A;  3CF5 Q;  5KG0 A;  2GAG C;  4YME A;  2HVZ A;  1QTM A;  4KFB A;  2L3M A;  1TL1 B;  1IKW B;  3ZTS A;  4KHP F;  4K4Z A;  3QNW B;  2HHV A;  1RTH A;  2WVC A;  3NCQ A;  1VQ5 S;  3GIK A;  5KOX A;  4UQG A;  3VAH A;  4OZ1 A;  4DFK A;  3UCU P;  4WKR A;  4HDG A;  3VVT A;  3CCE S;  4QWE A;  4HAC B;  2DEJ A;  3KUE A;  2ILZ A;  4M5N A;  3SCK E;  1RAJ A;  1VIO A;  2DXF A;  2DY9 A;  2MLY A;  3UE2 A;  2R7R A;  3MMA B;  2B43 A;  2H3E B;  3GMG A;  2WOM B;  6AT1 B;  2ZVI A;  4X65 F;  4NEY A;  2JNJ A;  2ZM6 J;  4AXJ A;  4F36 A;  1JNR B;  2QMW A;  5AXK A;  1XNR J;  2ZZT A;  2F8M A;  5MLC V;  4I7F A;  4GKK F;  3HHL D;  3IG1 B;  3SV4 A;  2HHH J;  2BYC A;  4Z37 A;  1W7W A;  1LK7 A;  2ZD1 A;  4IH5 A;  3N0V A;  2BJ3 A;  2D3O 1;  3KLG A;  3I31 A;  1SCJ B;  4ZLJ A;  2J8A A;  2DYA A;  2V67 A;  2QC3 A;  1NHV A;  8AT1 B;  3D2W A;  1GQE A;  2J7W A;  4IOA Q;  1FKP B;  1I1G A;  1NM2 A;  2KM8 C;  1T3N A;  4ECT A;  1S0O A;  2VG5 A;  3IR5 B;  2E5H A;  4U8V A;  2VC1 A;  3HDS A;  3MFI A;  4J7C A;  5HJX A;  3Q0A A;  3SV3 A;  4HI1 A;  2C2Z B;  5GMK a;  3GFY A;  1R8P A;  3HKZ D;  1BQN B;  1WOS A;  3C14 A;  3KLI A;  3MCO A;  4RNO A;  4X4U A;  2XMW A;  3CJK B;  3CGI A;  2ZEJ A;  2FVP A;  2MPU A;  4ZJL A;  5GAH I;  3DLL Q;  1VS3 A;  4F02 A;  1XN9 A;  4M5H A;  4RX6 A;  1SV5 B;  2C3M A;  1H74 A;  1C1B A;  3BJY A;  4NEZ A;  4FBT A;  1X31 C;  4A8F A;  4KHR A;  1NSP A;  2BQR A;  4BWM A;  2RQK A;  4LVO P;  4OX6 A;  1EHW A;  4DCJ B;  3IBW A;  5B0F A;  4ZPT R;  1YJR A;  2ZWP A;  5BR8 F;  2EWH A;  2ASD A;  3NCP A;  4A47 A;  2RQM A;  3M6W A;  3BBB A;  2AYB A;  2DPI A;  1QSL A;  4IDK B;  2WCX A;  2DPJ A;  4R25 A;  3MR7 A;  1GTH A;  1KQK A;  5GAG I;  3E01 A;  2CPX A;  1MML A;  2AP6 A;  5IQQ A;  1DZ5 A;  2HVH A;  3MMC A;  1BWV A;  3F0N A;  4ZVO B;  3QGH A;  5JVG Q;  5DGA A;  2DGQ A;  5DDO C;  4JBC A;  2Z0G A;  4Q0B A;  4USM A;  1OIA A;  4LRF A;  2UV8 A;  2C2E A;  3NS6 A;  4C3M A;  4M5I A;  3RBD A;  2P9E A;  4GVL A;  5EX3 A;  2IAJ B;  1IBC B;  3D0H E;  3P96 A;  2XI2 A;  2R2T A;  3H25 A;  1HBU A;  2QN6 B;  4CT8 A;  1VQL S;  2XS2 A;  3JAM U;  4I2P A;  1B0T A;  2Y0B B;  2VFR A;  3MAA B;  4OJH A;  1RAF B;  4LQ9 A;  3EWG A;  1N5Y B;  1N88 A;  2ZM6 F;  2EPI A;  3THP A;  2VBZ A;  2BA9 A;  4LF6 J;  4Q5V A;  1XNR F;  4V19 X;  3V6H A;  2GO9 A;  4JV5 J;  3UD3 P;  3KOA A;  2EVZ A;  5L1K A;  4LMZ A;  1Q1K A;  3MPW A;  4NLO A;  3TAQ A;  5H9F K;  2HHH F;  1K9M T;  1RAD B;  3M2V A;  2OPR A;  5A2Q Y;  5C25 B;  2VOO A;  1I51 B;  2ZUG A;  1VJW A;  2DRB A;  3BQ0 A;  4BBY A;  4RU2 A;  2EFQ A;  1R6V A;  1FNO A;  1S1V A;  4QWC A;  1UKU A;  3M2U B;  2Q43 A;  2X1G A;  2HQC A;  2V2Z A;  4P72 A;  4ZA1 A;  2UU9 J;  4AE5 A;  1RA6 A;  2PGC A;  3OFH A;  4DF8 A;  2YWE A;  1TKD A;  4EYH B;  1U25 A;  3G82 B;  4HAC A;  4BLG A;  1UJ4 A;  1GH8 A;  3AOA A;  4PAA A;  4URS A;  2UVW A;  2RF2 B;  2QSW A;  2BAC A;  4C0O C;  5GAD U;  1OPZ A;  1REV A;  3MMA A;  4GMK A;  1M1K T;  2NZC A;  5B09 A;  2XO7 A;  2GIR A;  2APO A;  5DDR C;  3W66 A;  2CG4 A;  4QWA A;  2Y1I A;  3K5O A;  4IRC A;  3PX0 A;  3A3O B;  2DGT A;  2M0G B;  3VAL A;  1RHM B;  3TJ8 A;  4F2R A;  4DV2 F;  4PR6 A;  4IG0 A;  4DN9 A;  1HD0 A;  5KFE A;  4Q45 A;  2XGP A;  3K89 A;  1DLO A;  4DSJ A;  4ZPA A;  4OYX A;  2P6S A;  2KJW A;  5KAK A;  1U1M A;  1I5O B;  2Q6C A;  1RLD A;  3WZ0 A;  5DDP C;  1VHF A;  4PZV A;  1Q81 T;  4PG4 A;  4DFM A;  5HMX A;  3JXO A;  3HFZ B;  1FKP A;  1T03 A;  1R6Y A;  3NMR A;  4YHH J;  3MCS A;  2L48 A;  4QIG A;  2CJQ A;  5IV3 A;  4LR7 A;  1P9Y A;  3HHD A;  4LSN A;  2O67 A;  3CIM A;  3OLB A;  4KAI A;  3GPA A;  2GZO A;  1BGX T;  3EZO A;  4NLW A;  3FZ2 A;  1GXT A;  2JJ4 D;  5HQM A;  1EAR A;  1FES A;  4I68 A;  5LXR A;  5KFO A;  1HNX J;  3AA9 A;  3QT6 A;  4CZC A;  1YRT A;  4F4X A;  1T02 A;  1YJT A;  4B9M A;  1C1C B;  4NXM J;  1KQF B;  1SV5 A;  4QWD A;  3LAM A;  3CCL S;  2DR9 A;  4O3O A;  1UAW A;  2EG2 A;  1L3V A;  2FGO A;  1WDT A;  2Y3Y A;  1K44 A;  4ITS A;  1WNE A;  4TU7 A;  4RWW A;  3OVA A;  3JSR A;  3MUT P;  2CPF A;  4L6V 3;  4DBQ A;  2QX0 A;  3QZ7 A;  4F4A A;  4LF6 F;  3TUI C;  3OFE A;  5E33 A;  1MWQ A;  1IR2 A;  3CDU A;  4WFZ A;  1GK8 A;  4JV5 F;  2RDJ A;  4LR8 A;  2L9N A;  4CH0 S;  1DQ8 A;  1SXL A;  3SI8 A;  4DPY A;  4X4O A;  3D3C J;  1LXN A;  4OYW A;  4ID5 A;  3KMQ A;  3UN3 A;  3DN9 A;  1FNX H;  1TZ0 A;  5EWG A;  1BLU A;  3MED B;  3OHA A;  1FDN A;  5KT4 A;  3D6M B;  1PIE A;  2BM0 A;  1REG X;  3HXM A;  5LXY A;  3W2W B;  1NK9 A;  2UU9 F;  2BUN A;  4PWD A;  5K8P A;  3G2X A;  4NOH A;  2J76 E;  1UWA A;  2YWK A;  2Y8Y A;  3P5B P;  2HEK A;  4NRU A;  2BJ9 A;  1RAC B;  2C2M B;  2EFG A;  1KNZ A;  2W2Q P;  2HPU A;  2A0F B;  4KTQ A;  1SKS A;  1U1L A;  5IFM A;  1S0V A;  4KKO B;  3QSY B;  4XPE A;  4I4B A;  3HVR A;  2PN6 A;  1UA0 A;  2C1E B;  3DXB A;  2HNY A;  4DSF A;  4RW4 A;  4U6P A;  1N34 J;  3MAA A;  5ETP A;  4JV0 A;  1UZD A;  5IM0 B;  4DR7 J;  4OZ0 A;  3CD6 S;  3AXK A;  4P2X A;  1SUQ A;  2PMZ D;  2HNZ B;  2FHM A;  1Q8B A;  2DEI A;  1RTZ A;  1MWY A;  1DFD A;  3SSS A;  3OT9 A;  1U1Q A;  2HRY A;  4IFV B;  1YBU A;  4IO9 Q;  1VI7 A;  4ZVU B;  3TQ1 A;  1H2V Z;  4MH8 A;  2HS4 A;  3ISZ A;  2PDA A;  3TNV A;  3WBZ A;  2CNL B;  3NBP B;  1C4A A;  3R5B A;  1BC6 A;  1RIS A;  1G6B A;  3CCU S;  2ZNZ A;  4P2M A;  3OXL A;  1HBN B;  2ZBI A;  1S9E B;  2OSQ A;  1X4B A;  3FK4 A;  3ZO7 A;  4AT1 B;  4DN0 A;  3GR1 A;  4IKA A;  1WEY A;  2IC3 B;  5AT1 B;  1RT2 A;  2M9K A;  1VBY A;  4RBU A;  1RT3 A;  1T9T A;  1F1B B;  3PYD A;  3MR3 A;  4C8L A;  4Y3C A;  3MAQ A;  1NSA A;  1LWE A;  3TOQ A;  4YHH F;  2GVD B;  4PXC A;  2FZC B;  3RBE A;  3SXL A;  1HHT P;  4PXE A;  4FKX A;  2HVD A;  2IRY A;  2MHN A;  5FDL A;  1D9D A;  4ELT A;  4ZCL A;  1D3W A;  1V3S A;  3TJ9 A;  2L41 A;  1XIQ A;  4X62 J;  2G9O A;  3H40 A;  1S12 A;  2GGP A;  5A0Y B;  1HLW A;  1HNX F;  2E5L J;  3GP9 A;  2HS0 A;  3CCQ S;  1NJW A;  1U49 A;  2FGC A;  1R8H A;  4OYO A;  4JI3 J;  4NXM F;  2DO4 A;  3HJV A;  3DNC A;  4DLE A;  2BW2 A;  3KK3 B;  3TW0 A;  1YWX A;  2KRB A;  4RUA A;  2RKI B;  2VFS A;  3DMJ B;  2ACY A;  4RW9 B;  1YVF A;  3BGR B;  3CJ5 A;  1SI9 A;  4P9S A;  3C8Y A;  2H1Y A;  3DHX A;  1WF1 A;  4W4M A;  4DG1 A;  3TVZ A;  1ITP A;  4R5P A;  2XS7 A;  4CLK A;  1W2B R;  1WJ9 A;  3DRP A;  1S5Z A;  3TI0 A;  2IFX A;  1JLQ B;  2J9C A;  2KM8 B;  2QLW A;  4U7C A;  3ZZU A;  3A13 A;  4EBC A;  2HHS A;  4WE1 B;  2B0G A;  1H73 A;  3OUY B;  4ES1 A;  2LA4 A;  1FRK A;  4PXD A;  3HM9 A;  3CJ0 A;  1JB0 C;  1YK9 A;  1W26 A;  1YZ6 A;  5MAO A;  4NZ0 A;  1YSJ A;  2VBW A;  2F8H A;  2HBR B;  1U6F A;  2XSJ B;  2KT2 A;  3UO0 A;  3MD1 A;  1RT6 A;  3B82 A;  4RNM A;  1RQ0 A;  1C1C A;  3PZP A;  1S0N A;  4DV5 J;  3T9N A;  4LFB J;  1WC5 A;  2QG9 B;  2QRR A;  1MG7 A;  5D8H B;  1W2I A;  5DET A;  3GG1 A;  1N34 F;  3QT7 A;  3Q2S C;  3EMT A;  4DR7 F;  3UI3 A;  6FDR A;  1HQ2 A;  2AZ1 A;  3D1O A;  3CUN A;  3M7V A;  3B78 A;  2FZK B;  3P45 B;  1Z4U A;  1C0T B;  2ZDP A;  3AD8 C;  4A8Y A;  2D41 A;  2D7S A;  2VIH A;  3H5X A;  3A8E A;  3GG0 A;  5IT0 A;  1TL7 B;  3GJQ B;  3DOM B;  2QA2 A;  3Q2T C;  2MGZ B;  1TTH B;  4WTO B;  4HYK A;  1BHN A;  2CPZ A;  4H4M A;  3ZZZ A;  2GX8 A;  2YQ0 A;  4ZS6 A;  3TVK A;  2EBG A;  3SZ2 A;  2LYV A;  3GON A;  2FUG 9;  5I3Q A;  1A0O B;  4MKB A;  3NG8 A;  1M1G A;  1LWX A;  3HX9 A;  3KLE B;  4RU9 A;  4ED2 A;  4JUZ A;  4CYU A;  4NLX A;  3I32 A;  3M6U A;  1RGV A;  4YN3 B;  2HW3 A;  4YQW A;  4RO0 A;  1KFS A;  4M94 A;  2MJN A;  1BXN A;  2W4C A;  1KVK A;  2LQ8 A;  1DHM A;  4CCH A;  3MM7 A;  1Q0N A;  4QIW D;  2HG4 A;  4OJ3 A;  2B3T B;  3ILL A;  1XK8 A;  1ZOT A;  2AYM A;  3KLH B;  4F4Y A;  1SJR A;  2GIQ A;  3T41 A;  3T6J A;  3QQC D;  4X62 F;  3H98 A;  3UW1 A;  1QJH A;  1RLC L;  1AFJ A;  2HQG A;  3U1L A;  5EWF A;  3D4J A;  1HPZ A;  2E5L F;  5IM0 A;  1QM9 A;  1VBK A;  4A8Q A;  3OJS A;  1IJE B;  3CCV S;  3RB4 A;  4JI3 F;  2IMO A;  2LFV A;  2HHP A;  1JKH B;  4IFV A;  2CPY A;  4LBH A;  1JLG A;  2WB4 A;  4HEA 9;  5GME A;  3GQC A;  3LPY A;  2UVV A;  1QTN B;  4FYY B;  2OSR A;  3R2D J;  1VK3 A;  1FRX A;  5B0D A;  5D4O A;  1LW0 B;  3MR2 A;  2ZFH A;  2JRS A;  1RTI B;  1JMT A;  2GHP A;  1UL3 A;  3JYT A;  4GKJ J;  4F3O A;  1S9E A;  4JI8 J;  1SC1 B;  1NO8 A;  5A6P A;  2L08 A;  2CRL A;  2CNN B;  2QLX A;  3KHG A;  2J0S D;  5CZV A;  1CQM A;  4KO0 B;  5FLX Y;  2UXC J;  3KDN A;  2WW4 A;  1R27 B;  1IM6 A;  2JSX A;  3KK2 A;  1KC8 T;  1RAO A;  3VZI A;  1GMW A;  3VAK A;  3O6Q A;  3QGP A;  4M63 A;  4J9P A;  2DIT A;  2F8E X;  3R6L B;  3GFZ A;  1FNM A;  3TAM A;  2W9C B;  1RWW B;  3NNH A;  3NGU A;  3MMB A;  3ETM A;  2DXE A;  5ETL A;  3UFC X;  5D77 A;  4N76 A;  2NUH A;  1K47 A;  1Q7L B;  2KL8 A;  2P9G A;  2XI3 A;  4QU6 A;  1NUE A;  1OSC A;  3KK1 B;  2UP1 A;  3CD5 A;  3CJT A;  3ILI A;  3UCG A;  1MWZ A;  3RZA A;  3TAP A;  5J1P A;  3OL7 A;  4KE5 A;  3Q8V A;  4DV5 F;  1IKX B;  1C2P A;  5DG9 A;  4LFB F;  5JUM A;  4ETX A;  3Q83 A;  3DMJ A;  4MKV A;  2EK1 A;  2Z4P A;  1PJ6 A;  1HNV A;  1S9F A;  3U1N A;  4MAK A;  4PKD B;  2DGX A;  5DM6 Q;  1AXQ A;  1N33 J;  4PPD A;  3EVO A;  1JLQ A;  3KLF A;  2BE2 A;  1Y11 A;  1Y4Z B;  3SIP B;  2C22 A;  3PO5 A;  5HBM B;  4DSI A;  3ITH A;  3AXM A;  1RYR A;  4FF3 A;  3POT B;  4O4G B;  2U1A A;  1RUS A;  3D6T B;  4X4Q A;  1AUS L;  4WE1 A;  4ZIT A;  3OUY A;  1RBA A;  3LP1 B;  3LWM A;  4B9V A;  2BKO A;  3BGL A;  1F5A A;  2CQ3 A;  4N41 A;  2OH2 A;  1VR6 A;  1HWL A;  1VK8 A;  2YKQ A;  1SIZ A;  3US5 A;  1UJ5 A;  3TX8 A;  1NKB A;  3PHT A;  4E8U A;  4J90 A;  3MWB A;  5JJB A;  2R8J A;  2CQB A;  2XSJ A;  3NGD A;  3DOK B;  4RUB A;  2X3G A;  3HT3 A;  3EGZ A;  4DF4 A;  3BGO P;  2M3D A;  1VCT A;  1KQG B;  2HMI A;  1S76 D;  4YDX A;  2NPI A;  5KFJ A;  2IRU A;  4QIE A;  4L3K A;  2A6O A;  3UNY A;  1WWH A;  3HFK A;  2WZ1 A;  3M8W A;  4I6W A;  3U02 A;  2M52 A;  4LRC A;  4GVB B;  2PC6 A;  2CZV C;  4AND A;  2YNI B;  2KZZ A;  1YIJ S;  4F3M A;  3GCX P;  2RUG A;  3DOM A;  1SVD A;  2CPI A;  2OPS B;  1FDB A;  1FTR A;  2QEX S;  3AHP A;  3HHN B;  2MQ8 A;  2V8H A;  5J2P A;  1OWX A;  1NKC A;  4CLU A;  4JI8 F;  4KY3 A;  5KFC A;  3W7B A;  1S72 S;  2V0N A;  1T94 A;  4WCE Q;  3MCM A;  5C42 B;  3H42 A;  4TVA B;  2MKI A;  2UXC F;  4N56 A;  3PRD A;  4I2Q A;  4W98 A;  4DQS A;  4HL9 A;  3ZZO A;  4F3Q A;  4NML A;  2KI2 A;  3EXC X;  2O66 A;  1RTD A;  4U9R A;  3H4D A;  4J9K A;  1FEE A;  1HWI A;  1SPB P;  3F56 A;  3SMZ A;  1DY3 A;  2BE7 D;  2FC9 A;  1J27 A;  4DV1 J;  1GT8 A;  3JTO A;  5BYS A;  4LVN P;  3MM9 B;  4FKY A;  2MZJ A;  1EET A;  3FFI B;  2LQB A;  4QIF A;  3BSN A;  1UVK A;  1QDU B;  4CRJ A;  1WG1 A;  4IFY A;  3QT5 A;  3QGI A;  1YBA A;  3IRX A;  1CC7 A;  3CCR S;  2WVB A;  1Y7P A;  3DLE A;  2DHG A;  5L9X A;  2BEF A;  2JVO A;  1S99 A;  1NAQ A;  4CO3 A;  3TEH B;  4DX7 A;  3OVS A;  1AZS B;  1QSY A;  1YIT S;  3RTV A;  4MK7 A;  2QTW A;  4XTT A;  1Z1Z A;  1N33 F;  3BN4 A;  4CLW A;  2C2K B;  4IR9 A;  2E44 A;  3JSB A;  3N6N A;  3S7R A;  2AIR B;  3QFH A;  3AB2 B;  4KO0 A;  3PXG a;  4P74 A;  2BR0 A;  2ZJP Q;  3QMQ A;  3V4I A;  2HZC A;  4NCG A;  1QAJ A;  1X4C A;  4J91 A;  3EJM A;  1TVR B;  2QLF B;  2ATL A;  5A8R B;  1VIX A;  1RBL A;  1PAU B;  1VLY A;  1QAY A;  3W61 A;  2U2F A;  1G2E A;  3KK1 A;  4X4V A;  2I5J A;  2HBQ B;  3M4X A;  1PSD A;  1Y9O A;  2KN4 A;  2NZ4 A;  1IKX A;  4NZ7 A;  1HMV A;  5HJY A;  4IH7 A;  5A2Q U;  1DJ0 A;  3HHE A;  4ELU A;  1B0V A;  1FX4 A;  4B3T J;  1RAA B;  3I4P A;  5KG2 A;  1KRP A;  2G2O A;  2ZBC A;  3JTN A;  2X7I A;  1NKE A;  4BC9 A;  3V4M A;  3A1Y G;  4OI2 A;  2BKN A;  3FQL A;  3DM2 A;  1VBX A;  3PEH A;  2B4P A;  3BYP A;  3MEE A;  2VPW B;  4HH1 A;  1ZAX A;  2YKM A;  2YNH B;  3ELH A;  2F40 A;  4TY8 A;  3TEG A;  2LXF A;  1P27 B;  2DNG A;  2UXD J;  2SXL A;  4C48 A;  3MM8 B;  2AWZ A;  2MYF A;  1Q86 T;  4UW2 A;  4DR5 J;  3PW0 A;  1NK8 A;  4O4G A;  4DXL A;  1H98 A;  4ZVP B;  3QZ8 A;  2BRL A;  1Q79 A;  4X2B A;  3LP1 A;  1ZZF A;  1YJ7 A;  3UD4 P;  3PR5 B;  2AJF E;  3OXG A;  5J2N B;  3R27 A;  2AGO A;  1VRT B;  1YX2 A;  3EGN A;  3M9N B;  2VG6 A;  2GJI A;  3VAF A;  3EPG A;  1U0H B;  3N01 A;  1WHX A;  4A8X A;  2QYG A;  1VRU B;  4RW8 B;  9ATC B;  4Y28 C;  3HZE A;  4C97 A;  1FDA A;  2XY6 A;  2NPF A;  5E3Q A;  4NMX A;  5D3G A;  3GV7 B;  2C3P A;  1HQE B;  4AUK A;  4MK9 A;  3KUG A;  4ZP8 A;  2E1M C;  2HHW A;  3MI7 X;  4DV1 F;  2XWY A;  2H9Z A;  5KFH A;  2FD2 A;  1RAG B;  5KT6 A;  5KFZ A;  3W9I A;  2KXF A;  4USU A;  4I69 A;  2R2R A;  5D0H A;  4GVB A;  3IC1 A;  3SQG A;  4PAB A;  4M5D B;  1ACM B;  3Q23 A;  3QT8 A;  2KB2 A;  3HCX A;  3BO3 A;  5CYQ B;  5E0O A;  4YP3 A;  4IG3 A;  4ZVH A;  2HGL A;  4K7Q A;  4FYD A;  3HVT A;  3Q8Y A;  1ZA2 B;  3BSA A;  3NLC A;  3QLH B;  3ILJ A;  2ZUA A;  2KU7 A;  4UUW A;  3M8P A;  1NPP A;  3B4M A;  3UDE A;  5E41 A;  4A8W A;  4GC6 A;  1KFD A;  1U48 A;  2OI2 A;  5ETO A;  2FLP A;  3OR1 A;  1R0A B;  3MDF A;  2IYI A;  2ZH2 A;  3OV7 A;  2LEC A;  1SJ4 P;  2M5Y A;  1J5E J;  1LK5 A;  5D78 A;  4RL1 A;  1WKL A;  3HP6 A;  4KSE B;  1EP4 B;  3AD9 C;  1FER A;  4C98 A;  2G1D A;  2H5E A;  3M2R A;  3HZG A;  5ADZ A;  3M8Z A;  4W92 B;  1H38 A;  5L8R C;  3OFF A;  5FD1 A;  1WAC A;  2PA3 A;  3KG4 A;  1E6V B;  4MKA A;  4DR2 J;  1HNW J;  1CVJ A;  4TLQ A;  1SH3 A;  2ZH9 A;  2WK4 A;  3FEZ A;  4ZLL A;  2DGO A;  4B3T F;  2ZOM A;  1TKT B;  3CC7 S;  4HLB A;  3L7O A;  3OQ2 A;  3OW2 R;  1ZM9 A;  4DSK A;  2V34 A;  2MKS A;  3P8B B;  4F50 A;  2XSF A;  1RXO B;  5CHC B;  3VR1 A;  1LWF B;  3IR6 B;  1XWL A;  3JB9 k;  4PXB A;  2YNG A;  2QL7 B;  4OX9 J;  2UXD F;  1RZM A;  3W2V B;  3PG9 A;  2LVW A;  5F8M A;  4B9T A;  3QSI A;  3MR6 A;  3D5M A;  4DR5 F;  4NYO A;  1RT5 B;  1HWJ A;  4TN2 A;  1XJW B;  5IWA J;  1AW0 A;  3PJ9 A;  2HUR A;  3KJV A;  4N5S A;  4KGX B;  4P6Q A;  4C4W A;  4NI2 A;  5K20 B;  2KFN A;  4Y65 A;  4MYU A;  3KKF A;  1NME B;  2BE9 B;  1QUP A;  3H5S A;  4YB6 A;  4MFB B;  1YJW S;  2W2P P;  2YKA A;  5HAT A;  1UFL A;  1N32 J;  3EX7 B;  5CH7 B;  2M70 A;  2ZH3 A;  1KVJ A;  1OJ4 A;  3DYA B;  1JLE B;  1VQ9 S;  2Z2Z A;  2J6U A;  4XAK A;  4LIR A;  3C15 B;  4RW6 A;  3B6B A;  2XCA A;  3M8Q B;  5LMN J;  4RWX A;  2FJD B;  2F9D A;  3R7S B;  1S9G B;  2R7W A;  4B3R J;  5J1E A;  4OZ5 A;  1NK5 A; 
#chains in the Genus database with same CATH homology
 1CUL A;  5IV4 A;  4CLK A;  1FX4 A;  3G82 A;  2QV6 A;  1YBT A;  3R5G A;  4CLU A;  3ET6 B;  2W01 A;  1AB8 A;  3C15 A;  1AZS B;  4CLP A;  4CLL A;  4OYB A;  3MR7 A;  1FX2 A;  2BW7 A;  1U0H A;  4CLS A;  2GVD B;  1CJK B;  4OYA A;  4NI2 A;  4CLW A;  4P2F A;  1CJU A;  4WP8 A;  1TL7 B;  4CLY A;  1CS4 A;  3C14 A;  1CJT B;  4WP3 A;  2GVZ B;  4USU A;  4OYX A;  5D0H A;  4OYZ A;  3ET6 A;  3MAA A;  1YK9 A;  1AZS A;  4OYM A;  5D15 A;  4P2X A;  1WC0 A;  3C16 B;  4WPA A;  2GVD A;  1CJK A;  4USV A;  3UVJ B;  1CJV B;  1CUL B;  1TL7 A;  3C14 B;  3G82 B;  1YBU A;  1CJT A;  1WC6 A;  4OYO A;  2WZ1 A;  4OYW A;  3C15 B;  2GVZ A;  4OZ3 A;  4OYP A;  1Y10 A;  4UST A;  5IV3 A;  4OZ2 A;  4CLZ A;  1WC1 A;  3MAA B;  1WC4 A;  1U0H B;  5D0R A;  1Y11 A;  4CM2 A;  4OYI A;  4CLT A;  4CLF A;  5D0E A;  4NI2 B;  4P2M A;  1WC3 A;  5D0G A;  1CJU B;  1WC5 A;  3C16 A;  1CS4 B;  4USW A;  4CM0 A;  3UVJ A;  4WP9 A;  1CJV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...