1CJKB

Complex of gs-alpha with the catalytic domains of mammalian adenylyl cyclase: complex with adenosine 5'-(alpha thio)-triphosphate (rp), mg, and mn
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
201
structure length
190
Chain Sequence
LYHQSYDCVCVMFASIPDFKEFYTESDVNKEGLECLRLLNEIIADFDDLLSKPKFSGVEKIKTIGSTYMAATGLSARQYMHIGTMVEFAYALVGKLDAINKHSFNDFKLRVGINHGPVIAGVIGAQKPQYDIWGNTVNVASRMDSTGVLDKIQVTEETSLILQTLGYTCTCRGIINVKGKGDLKTYFVNT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Two-metal-Ion catalysis in adenylyl cyclase.
pubmed doi rcsb
source organism Canis lupus familiaris
molecule tags Lyase/lyase/signaling protein
molecule keywords ADENYLATE CYCLASE, TYPE V
total genus 59
structure length 190
sequence length 201
ec nomenclature ec 4.6.1.1: Adenylate cyclase.
pdb deposition date 1999-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00211 Guanylate_cyc Adenylate and Guanylate cyclase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1230 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleotide cyclase 1cjkB00
4OYWA 4OYMA 1CJTA 3MAAA 4WPAA 4WP8A 4OZ2A 3MAAB 5IV3A 4CM2A 4WP9A 3C14B 2GVDA 4NI2A 4P2FA 1TL7A 3C15A 5IV4A 3G82B 1U0HA 3ET6A 4OYPA 1YBUA 1CJTB 1WC0A 1WC6A 5D0RA 4CLLA 4P2MA 1CJVA 4CLYA 1CS4B 2GVZB 1CS4A 1FX2A 3MR7A 1WC5A 4OYOA 4CLSA 4USWA 1AB8A 3R5GA 1YK9A 5D15A 1CULA 1WC3A 4CLFA 3UVJA 1FX4A 2GVDB 3C16B 4CLKA 2BW7A 1AZSB 4CLPA 1TL7B 3C15B 4NI2B 4USTA 4CM0A 1YBTA 2QV6A 4USVA 1CJUA 4OYAA 4P2XA 5D0GA 1WC4A 4OYBA 2WZ1A 4OYXA 1Y11A 1AZSA 4OYIA 3C16A 3UVJB 1WC1A 1CJKA 1CULB 2GVZA 4OYZA 2W01A 4OZ3A 4WP3A 5D0HA 4CLWA 1U0HB 3ET6B 1CJKB 3G82A 4CLZA 1CJUB 1CJVB 4CLTA 5D0EA 4CLUA 4USUA 1Y10A 3C14A
chains in the Genus database with same CATH superfamily
4DG1B 1UZDA 2B5JA 3PJWA 1RQ0A 2WBMA 5KG5A 2N3OA 4QYZJ 2ZJRQ 3MECB 4ECYA 2VB6A 3CD5A 3MAAA 2IYIA 4RW4B 4AQYF 1R7IA 3M7VA 5K8NA 3TZZA 1PCAA 1S4EA 5F0WA 1FRLA 2MTLA 4WIIA 4LF9F 3KDOA 3T41A 1S48A 3DM2B 4QJVA 3KLHA 5CXTA 3KXDA 2JNJA 3HVTB 5E2QA 1UWAA 1Q1KA 2V8PA 2QYCA 3RB0A 2E7VA 3FMWA 2GC8A 3VVTA 2KT3A 2EFNA 3M8QB 5HQ8A 1M5KC 2MKSA 5IXUA 3FUYA 1FTCA 5AE1A 4C0HA 1SC3B 1YZ7A 2JEGA 1AA1B 1SXLA 4NLGA 4WFNQ 3QAEA 2ZITA 3DRSA 2AYGA 3KLIA 2AGQA 2V68A 3HD1A 2IIHA 4DR4J 3CE8A 3DRRB 3MMJA 5HMYA 3BR9A 1XMQF 2DNGA 3VQSA 1ELOA 2R3VA 1RB0A 3W65A 1DLOB 1GXUA 2YNFB 4CLYA 2FDNA 2XMMA 2LA6A 4LSZB 4IG3A 2J7WA 1URRA 4PR6A 4UY85 3BPSP 3L09A 4RNFA 1SBRA 3JSYA 3SV4A 3PJXA 3H40A 1UFWA 1FKAF 3IO1A 2WW8A 1B4SA 4FYDA 4FNHA 4EK2A 3LO3A 3P3DA 4UOHA 3O1LA 1PGZA 4ZLJA 2UXCF 4RBVA 4ED5A 1N5YB 3SFGA 3QT8A 1RHRB 2YKNA 3TO8A 1X4AA 1BQXA 3ISZA 2OP5A 4LF5F 5HMZA 1FCAA 2F65A 2X3DA 5JUMA 5KT3A 4PPZA 4DL5A 3M8SA 3FCHA 1BGXT 1QDUB 3PFEA 1GNKA 1DHMA 3MAHA 2DRAA 2DD8S 2DXFA 2I1RA 5GAGI 2MGZB 5F9NA 1RU2A 1S1XA 2MKHA 2Q79A 3IAM9 5IFMA 2CPIA 1X4GA 3N6NA 1X8DA 1Y5IB 4ECQA 2CZ4A 2E5GA 3R6GB 1VQYA 1F2HA 3QLHB 4PWWA 4J9LA 4OLOA 1RWPB 2DPJA 2ZZMA 4ED3A 1GEHA 2BZ2A 2CJBA 3AAWB 2IRXA 4FPIA 2AZ3A 1NM2A 1R8HA 2X7IA 4ANCA 1VQ9S 1UVNA 1WKJA 4ZK7M 2B6AB 3OFFA 4ALZA 1U1QA 3R97A 1K44A 1KTQA 2WVEA 3LP1B 1HWIA 4X66J 4BCAA 1W25A 5B7WA 4RNHA 5HL7Q 2HQFA 4A8QA 1UA1A 4DR6J 4LBHA 2OTJS 1OIAA 1YRXA 2IVMA 3B54A 3D6FB 1E6VB 1OPZA 2VONA 2EK6A 3KNGA 3MM6B 2BE2B 1NHVA 2DEIA 2W25A 4YB5A 2QLWA 4J9MA 4WXOA 3BGRA 1ICEB 3KWMA 4G1QA 3EVMA 3MXHP 2HWHA 1HBUB 3BSAA 1VRTB 2VD3A 1DURA 4ZA1A 4B9TA 5J2NB 1IQTA 1I5OB 2APOA 2UXDJ 2B43A 2MB0B 4OYZA 5BR8J 1MN9A 3GMGA 2OIHA 4PKDB 1FFWB 1FKOB 4LSLA 3KHHA 1ULRA 1IR1A 4WP3A 2KZMA 4KGXB 4DV0J 4LMZA 4U8VA 4F2SA 1N5VA 3R2DJ 2IDEA 4NL5A 5E33A 2FVQA 1Q53A 4O0IA 2JEIA 2XMAA 1N0VC 2CVEA 5KTQA 2C2NA 1SQGA 4CLZA 2VC1A 3DRYA 1FT8A 5K8OA 2ASDA 3LALA 2RDDA 2HWIA 4DR4F 2A18A 3M2RA 4Y3CA 2E9RX 3LGMA 1HWLA 5G4DA 1R8CA 2M5YA 3H59A 2V9KA 1ZS6A 4RW8B 4K0KF 3IA0A 3DXBA 4OYWA 1JLEA 1NEEA 1VJWA 1YKWA 4CT9A 3JYTA 1TFYA 2VFSA 3I4PA 5J2PA 1SJFA 1WWHA 3VQTA 2VBXA 4KO0B 1AUSL 1QY7A 1P27B 5HMWA 2DCUB 4OMFG 1FWPA 1UWBA 2OLWA 2AF6A 1R3NA 4ZP8A 4N8OA 1EHWA 2VHGA 3I31A 1IBCB 4FKXA 4KV8A 2FLPA 4YDDB 4ED4A 2CPEA 1S0MA 3H98A 4C3MA 3GLJA 2L9DA 1HBOB 3HSDA 3ZTSA 5A8RA 5KFNA 3QRPA 2GV1A 3C15A 2GFFA 4DV1J 4PG4A 3PY8A 3J7Z5 4ZVSB 1X4CA 3FFIA 5HJXA 2MZ1A 2JZ5A 3K5MA 1UA0A 3O5TB 3U1MA 3DC2A 1RE1B 1U02A 2CNKB 3GG0A 3JS9A 4IFVB 4F3MA 5HVGA 3PYEA 5KFJA 2UUWA 2RT3A 3ONQA 2BJ3A 2ASJA 3I87A 3P4UB 2QN6B 5FDLB 2VG6B 4MYUA 4O3OA 2CJQA 2N4CA 5T14A 1IBLF 1FDDA 1KR4A 2LEAA 2MKJA 3A3NB 3EICA 3SSRA 4O4GB 2H4YB 4JI1J 3MR7A 4TNOA 1WC5A 4ILLA 1N6QB 2BVZA 4AXJA 1WTBA 4LF8J 1LWFA 1Y00A 3PHTA 5H9EK 4C3LA 4EU0A 3OXFA 4IDKB 3ETMA 3PACA 1WF2A 4K7QA 2NUHA 3S6EA 1DY3A 5K8PA 5JJBA 3WIVA 4B9LA 2VH7A 4E98A 4C6AA 4WYLA 1FKPB 4IH6A 5J1EB 4ZDNA 2QSWA 2MQQA 4I69A 5CD4A 1DLOA 4P75A 2GA7A 3GIMA 3V81B 1CEZA 2YX7A 1EKSA 5KFQA 2FVCA 4FXDA 1RHJB 1AZSB 1PBUA 1S7HA 2MLYA 4B3TF 2HHQA 3MEGB 1FRIA 2HQCA 2XMVA 4ZVRB 4B3MJ 4DSKA 2BANB 2LCWA 2WSCC 5LOQA 2V5HG 5T7LB 1FD8A 1HA1A 2CQ0A 3AODA 4JV0A 3TJ9A 3NGDA 3GV8B 4F50A 5CZXA 2I0XA 2Y0BB 3J7ZT 3CMAS 4DUYF 4ZIVA 2X3GA 2C2EA 4L75A 2OEKA 1TKXA 3POTA 3UO0A 5M2PA 1K8AT 4K2XA 4QWCA 1JLGB 4QIGA 5KG7A 3SFUA 3PR4A 2QA4G 1SUQA 3G4SS 2M8DB 2I8EA 4RW9A 3K5LA 3G86A 3D6HB 1WKKA 3P5BP 4DR3F 3BDEA 2DGUA 1VRUB 3BSCA 4OHWA 2E1MC 1LQ9A 1T3NA 4QYZK 1EETB 4V1Ak 3NNCA 3W9JA 4GMKA 2H5JB 3OR2B 5EX0A 3TZWA 2QLJB 2RHSB 4U8YA 4RLEA 1FRMA 4PG8A 3R1LA 3GYXB 2NXEA 5EWGA 2P9EA 2R8HA 1RBOB 1U45A 2V2VA 1FJ7A 3W5XA 5F8JA 3BF4A 5HVHA 1RTJB 2LXFA 4OX7A 3I55S 5JXSA 2CUYA 4IO9Q 4ENOA 1N54B 2ZKUA 1TP7A 3ZZ0A 3J81j 1NK0A 4IR9A 1UCNA 4TYBA 1HNIA 3MEEB 4JI0J 2X1FA 3K89A 4K5SA 3VF0B 2J0WA 1SJRA 3NP5A 3MUTP 5KFLA 5KG3A 3KG1A 1DARA 3BQ2A 3VAIA 1APSA 3EM1A 2KU7A 4LIWA 4BDPA 3HFKA 1AW0A 2ATCB 2JHEA 2QT7A 3BH6B 4DI6A 2AEJA 4QZVB 3EYZA 3LP2A 4B3OB 4CLTA 3IN5A 3QRQA 1KKHA 1S1UA 4HH0A 3W8PA 4EO8A 4A8MP 4HHJA 4FP9A 2RE1A 2C3OA 3IM8A 1PAEX 2IJFA 5GMEA 3UWTA 5EDWA 3HHKA 1VDHA 4LQ3A 3HK2A 2V2ZA 1JKHA 1N33F 1TAQA 3SV3A 2F1FA 1HQUA 4OZ2A 5JVHQ 4RW4A 1B0VA 5C25B 1T94A 4CM2A 1WELA 3VWSA 2GMHA 3BO2A 5HK4A 3EPIA 4I2PB 5ETKA 3B4MA 4MKVA 3US5A 1EX8A 2E7WA 1J5EJ 1VC5A 3HJFA 2DGTA 4ECWA 4ES2A 2FC8A 4WK3A 4OZ1A 2VFRA 1DAXA 4FXWA 4OYPA 5J2PB 4I6YA 3CW2C 3CJKB 2ZJPQ 1LW0A 1RT2A 2JL9A 2BX6A 2AYMA 4XDCA 5M2RA 4MJKA 3MD3A 5D0RA 3TVYA 2E5JA 2VPZB 3FGVA 4URQU 4YR3A 3MUVP 1QTNB 5IC4B 1QSSA 3ZZOA 4DFJA 1REVB 4MIBA 1IBKJ 2LMIA 3KJQB 5B08A 2ZH3A 3GIIA 1VQOS 2G0IA 4KJIA 3IC1A 2HNZB 2RKIB 1XMOF 2RMLA 3IR5B 2R7SA 1TKTA 1KQSR 1RADB 2RILA 1JLBB 3RBEA 2VPXB 4C8YA 3LQVA 1EARA 4D3GA 3DYAA 3B8HA 4DX7A 2RDJA 3OV7A 3CC2S 3T5LA 4RU2A 4DCPB 2R7UA 2EBEA 3O3LA 3KHRA 2XB2D 2LQBA 3WIUA 2O1PA 3C6TA 3HJVA 2D9OA 5D3GA 2VKZG 1FNOA 1L3TA 3KJFB 4G1PA 2OPSA 4ZPCA 3TA0A 2FJWA 4F2RA 2R7XA 1CULA 1TV6A 2LP4A 7FD1A 4G1IA 1S10A 4PQAA 1SV5A 2XTJP 4WBFA 3UE2A 3G8SA 4K4VA 3V4IB 2E66A 4FPRA 3GYNA 3N01A 2KL8A 4YY3F 5CYQA 3GJSB 2AX1A 3FMBA 2ZM6J 2V0NA 1JXEA 3W2WB 1N8RT 1IKVA 5FIIA 2CDRB 2DGOA 2EG1A 2ZFHA 3HFVA 4M5LA 3TEGA 4CO3A 5CYMA 1Q0NA 2J9DA 3DN9A 1VLYA 3W63A 8RUCA 4K4WA 3JYTB 5A8WA 5L46A 3I56S 5HLFB 4MK9A 5HROB 3PEJA 4KTQA 1RYRA 4O23A 1R8PA 4HR2A 4BWJA 3FC9A 3TOQA 1R6VA 2VG7B 3OXLA 3PYDA 1U1NA 1N56A 1KSPA 2R7VA 1H2VZ 2OH2A 1HFEL 2BKOA 2FHOB 2ROGA 4WFZA 6FD1A 3PW7A 4AL5A 4PG5A 1HNXF 1K1QA 2ZOFA 4I2QB 4URGA 5CCLA 3IAS9 1HR0J 1B70B 5ETPA 1A9NB 3E3XA 1RAGB 3NWGA 3IG1B 2VBYA 3TUZC 1S6QA 4OI6A 3PJ9A 4WU3A 1L5UA 2UUTA 1I94F 2QSFA 2MMYA 1V3RA 2YBVA 5THWA 2VJVA 2GVZA 5K5MA 3U1LA 4P6QA 3T5HA 5C42B 2V34A 3CIMA 2DXDA 3BV8A 2ZVSA 2LLZA 2H54B 1RAFB 4DR5F 1FJCA 4L76A 2D3O1 2ZD1A 4MKYA 3HF5A 2CADA 3QFWA 5DDPC 2OFHX 2GW8A 2I2YA 4ECZA 1RK8A 3V5RA 4QIFA 4F25A 2LQJA 3CSKA 3KK1A 3I32A 3UFCX 1WUUA 1NPRA 2AQ4A 2J0SD 3LP1A 3SDEB 5GAHI 1OWXA 3OFHA 3OTCA 4TY8A 3U02A 3IRWP 2G1DA 2AYBA 2DTJA 4ECRA 2G2YA 4PWDA 5DLFA 4OQJA 3GJRB 3RB4A 2Z2ZA 4Q2LA 1NB2A 3KLIB 4CTAA 1YHQS 3TZXA 5AXMA 3W1YC 4CYUA 2JLFA 5J1PA 2W1BA 2IVYA 3FCVA 2OD6A 4RR5A 1M5VC 1KHWA 1SL2A 2VJUA 1T03A 1URNA 4TU8A 3FRYA 2HVHA 1L3UA 2NXCA 2WOMA 1HI8A 4Y65A 1PSDA 1VC6A 2UVRA 4PWDB 2LQ8A 3CD6S 1WDTA 3W60A 3VZIA 3A8KA 4K2JA 2B9WA 1Y7PA 4TKTA 2B9XA 4L3NA 3NL0A 3KUHA 1WNEA 3KG0A 5L9NA 5CYMB 2AEMA 5ETVA 4ZJQA 2ZBPA 1YJ9S 4MIWA 1IKVB 3PCOB 4C11A 3GV7B 4ZPWR 3MECA 5CHCB 1NPPA 5KFOA 4ELTA 2X1BA 4C2MA 4OV6A 1OQ3A 2GX8A 3GE9A 4QPXA 3MM9B 4WFXA 1CJVA 2RRBA 4FDFA 3NS6A 2QMUB 3H2VE 2CA9A 1YJRA 2CJXB 3JSRA 3P45B 1AUDA 1ROFA 1RA7A 3CDEA 3NCRA 4ID8A 1CS4A 3D4JA 1ZYQA 4DL7A 1FX2A 3CJQA 2HHUA 2YNFA 3C6TB 3NCQA 4M5GA 2RJZA 3RAQA 4HEA9 2W8LA 5CABA 3AQOA 3R5DA 5EX3A 4FYVB 1R0CB 2CRLA 3T6BA 4HDGA 4YMEA 4WXWA 4WTOB 3MFIA 1S9GB 3V6DB 5B0FA 4KR0B 5KAKA 4I2QA 1SJ3P 4CZCA 2GGPA 5F8LA 4U67Q 2UUBF 2ZNYA 4W4MA 2BE7D 5HATA 1FX4A 2GVDB 5FD1A 3HMJG 2VV5A 3EXCX 5AJ3F 3AJDA 1U1LA 5L1KA 1ZTTA 3PVXA 4KFBA 2RSQA 3QYYA 5D8HB 1LXJA 3AD7C 2GS8A 4QYRA 1UMJA 3QGGA 5A8WB 2NQPA 3P49B 3TAMA 1IBLJ 1Y4ZB 3J7YI 1DTTB 3KK3B 4M5MA 2RNEA 3QAUA 1BQNB 4ZLNA 1Q8LA 2YQ1A 2IY5B 3K58A 1D1UA 1D0EA 3I96A 1FFSB 2W9BA 1BQMB 2R7OA 2OPQA 2ZEJA 4Q0BA 4WKRA 4I2PA 1IVZA 2WB1D 4P10A 4J9KA 1VIOA 3QJJA 1F9HA 3THPA 4V19J 4QW9A 3LP0B 1N36F 4NEYA 2HS3A 1BQNA 2VPYB 3GB0A 2H1YA 1PIEA 2BJ7A 2GJIA 5D0GA 1HBMB 4DV5F 2F8EX 4YN3B 5B0EA 2GCFA 4N56A 2XLIA 5A2QY 1BY9A 2CQCA 3O6QA 5C2CA 3UD3P 2W9AA 4LFCF 3MPDA 1KEKA 3OPKA 2XO6A 3BZQA 3MOJB 4ZVGA 1I3OB 1DQ9A 1HNWJ 2EFGA 2HVIA 2H51B 1HARA 4Q5VA 1B7YB 5RUBA 2OMLA 5FLXY 2QTWA 3DGVA 2BJEA 3HSGA 3PW5A 1X31C 4M5DB 2ATLA 1IBKF 1KFSA 2ZDPA 5CQGA 4DPWA 4JI1F 4ILMA 3TAPA 3CD0A 1NBEB 1VQSA 4GVLA 1LWXA 5GAEI 4YR2A 4OX9F 3HHLC 3CMQA 1IM4A 1MMDA 4J91A 3M6WA 3ZFVA 4IG0B 3P96A 1B3TA 4A8FA 5B09A 1RHQB 4QW8A 2IC3A 4KH1B 4PWUA 4JI3F 1KFDA 1NK8A 4LRAA 2KYZA 3O8WA 1GH8A 2R8GA 2MEWA 3CF5Q 4PXDA 2DYAA 4DV5J 4NXNJ 1J27A 1TU0B 3ZTOA 4JV5J 2HS0A 1OYDA 3MMCB 3A3PB 4J9NA 2BE9B 5EN1A 5DETA 4XTTA 2PMWA 2HMIB 2ZHAA 1CBKA 5KT5A 2PI5A 1OMSA 3G9CA 1RLDA 3KLEB 4LFAF 1NK6A 4ICLA 3A1YG 5CYJA 2R2UA 3HDSA 4ED8A 1P9YA 1T9XA 3IBFB 2ZDOA 2XWYA 1Q81T 4N77A 2ASYA 4X4RA 3TVZA 2O3DA 5DDRC 3RAMA 3TJ8A 4ED7A 4X66F 1C0UB 3GP9A 1I6JA 3PG9A 4NEZA 4OJGA 2CJAA 5KFYA 3BREA 5KG6A 2E9ZA 1T11A 2IA6A 5LT5A 1UL3A 5U47A 4IUFA 2Y8WA 1U2CA 3I0SA 5IQ6A 5AJ3J 4F8RA 2XSFA 4IH7A 3W62A 3PW2A 2XEXA 3GFZA 4GVBA 4RL1A 4P2MA 2HZAA 5CAAA 2D1CA 2JWNA 2H9ZA 4AUKA 1RCXB 3DLJA 3TEHB 1D9FA 1S0NA 3M8RA 3PX6A 1N4LA 3M32A 1F9FA 1Q95G 2FLOA 1HI1A 4NX9A 1SKRA 1ZH5A 5KT6A 3LWLA 2DHSA 2Y0SD 5EGYA 1RT6B 3EGZA 2HNYB 2EFVA 4DV0F 3DLLQ 3CVKA 2BRKA 1S6OA 2ZD1B 3BO3A 1JJCB 5KFGA 4RUAA 5H1SV 3P5TL 4ILRA 1M5PC 1KQFB 3MM7B 4OJHA 5KFFA 4C11B 1IKYB 2B4VA 2DO4A 4QQBA 3ZZRA 4PRFA 2U2FA 4DR6F 2XYHB 1H2UX 5KT7A 2HKEA 1P8GA 4CLFA 5L38A 4CLKA 3GYGA 2P5VA 4HL9A 2QL7B 1NJYA 1Q5VA 1JJ4A 1S6PA 4DQIA 3ULHA 4ZP7A 3MOZA 4OX8A 2UV8G 4L72B 3R5CA 1IWGA 4R25A 1T05A 1UVIA 1RWXB 5JMNA 3AHPA 3M8PA 2MKCA 1JLCA 3DU5A 3TX0A 3FK4A 3R7BB 1OYEA 4NLRA 4DL4A 4IOCQ 3C15B 1U47A 4IQMA 3MTJA 4PXEA 3V6KA 1R31A 3MM5B 3DOKB 5I3UA 3HHLB 3DLBA 2HVZA 3E51A 4AL7A 4YHHJ 2CNNB 3PYFA 3KLVA 3HP6A 2X51A 2E5LJ 2QV6A 2HFUA 1SQFA 2LYVA 3KLGB 2CG4A 3KLFB 3KFWX 1YBAA 3PXGa 5LSLA 3OR1A 5E41A 1WOOA 4C8MA 2QC3A 2MJNA 2RAQA 4PQUB 3HLUA 2AJ2A 1Q7LB 1UZHA 4RW8A 1C1BA 2HQGA 5AE2A 1Y11A 5D3GB 3UDLA 3RBZA 4A8KA 5KFIA 3K8WA 1Y5LB 3M30B 2VDIA 4YY3J 2MY7A 2VUGA 4ZPVR 1B7FA 1D9AA 3AQPA 1E6YA 1SV5B 4DF4A 2VFUA 4AE5A 3Q8SB 3HZGA 2DT9A 2W01A 5KFMA 3PTWA 3L3CA 5F0UA 1X9SA 4EMDA 2JFDA 2G4BA 4QU7A 4QCLA 1S1VB 1PYOB 4DV7F 2YWFA 2BOPA 1R0AB 3DLEB 4M94A 1XMBA 4IFVA 2XYPB 3BEGB 4NLDA 2D9PA 4XAKA 1XR5A 3FBEA 2KVIA 4CLWA 1N5SA 3U1NA 1U0HB 4GKJJ 3QSYB 2GHVC 3NBPB 2BABA 4G1QB 1T9VA 3HKWA 1NUEA 2A1BA 4A47A 3JQKA 2FJAB 1RP5A 1YJUA 3IR7B 4YFUA 2RQKA 4MH8A 2C2DA 4UOCA 2HNDA 2K06A 1LKZA 1SB6A 3LOUA 1VK3A 2F9JA 1ZPWX 2RQCA 5AE3A 4PYAA 2ZM6F 3BPDA 4WPAA 5D78A 7FDRA 2WVBA 2EEYA 2W24A 4UW2A 2BYCA 2RUGA 5MLCV 1SIWB 3LWMA 2JLEA 2B6AA 2NZCA 3G8QA 3KLGA 4O4RA 5CYQB 4ES3A 4ED0A 2HNDB 3IP0A 3LA0A 3H2LA 4DDFA 1SH0A 5SZTA 1QTMA 3BBFA 2YNIA 4NI2A 4B9SA 3GSDA 4P2FA 1TL7A 5IV4A 3G82B 1HQUB 3QATA 4LIRA 2Z4PA 3RBXA 5I4MA 4KY3A 3OVAA 1N36J 2FVPA 3JSBA 4ZLLA 3M8PB 1HNVA 2KT5A 4DV3J 1MMNA 1WC6A 2KXHA 1HMVB 3D67A 4DCJB 4PPDA 4UT4A 3F73A 3OSPA 1JX4A 1VQKS 3RR7A 2EXUA 3DYAB 2AD9A 2MZJA 5A8KB 2W7AA 5IWAF 1B99A 3H42A 5CA5A 3H5XA 5A6PA 1FKOA 3NWRA 2PT0A 3N0VA 1RHUB 4J5OA 2IFXA 2DHXA 4A8WA 2G0JA 3ELHA 1N88A 1IKYA 1S59A 4QIWD 1WHWA 5F41A 2Y1LB 5D4NA 2BKNA 4OX6A 3W61A 1PJ5A 4RWWA 2YQ3A 5CCMA 4NCAA 4RW6B 1TUVA 1YTYA 2RHQB 4M5JA 4TLRA 2M9KA 3VAGA 1LW0B 1X5PA 4O3QA 2E29A 2MDAA 3TUPA 1WHXA 5IC6B 4M95A 1X5TA 2F63A 1F9EB 2ZUGA 3DMJA 1BUXA 5T41A 4R8UB 3RW6A 9RUBA 4M5KA 3ZTRA 1UKUA 2YVSA 1R89A 3OR2A 4DBQA 4FF1A 2GHWA 4NZ0A 8AT1B 1QSYA 1PO6A 3CDBA 1QM9A 2CAJA 1C0TB 2XGPA 2KFZA 4UUXA 3MM8A 4OIXA 4LBIA 5DZ7A 4CH0S 4CI0B 3T5KA 3CB4A 5HI7A 3MR6A 4EZ9A 1CVJA 4RW9B 4ECSA 4LRDA 4C9DA 4RWXA 1ZAWA 3BKTA 4G65A 1QD1A 3OUYA 4ZPAA 3WX8A 4JI7J 1KNZA 2AP6A 4ECVA 2ZOGA 1RAAB 4WK1A 2R2RA 1Q8BA 4U7UD 4DL6A 2BKPA 1TK8A 3D6MB 3OUYB 3DNCA 1RU1A 1NK9A 1L3VA 1NDKA 4LF7J 1LFWA 4IRDA 2F5GA 3CJ3A 2YKNB 3B4DA 3WBZA 4H4MB 4DPUA 1O51A 3H8YA 2C42A 3MEGA 4N5SA 1NAQA 4EO6A 4O0NA 5IWAJ 4RNOA 2QMXA 1HWKA 2VBZA 2CPYA 1X5SA 2NREA 1RTJA 4QBUA 2QX0A 3I5BA 3PM9A 3PRVA 1HIYA 3LUYA 2GAGC 3M32B 2AKWB 1UFKA 4NLSA 3BJYA 3TYTA 2LXIA 4GO7X 3ZZYA 2WONB 3CDAA 2CPJA 2K7KA 3MI7X 4D3HA 4EYIB 4X4VA 2V69A 4OI2A 3R5BA 3GCWP 3LAMA 4O44B 1N6QA 2HVDA 3D3CJ 1NSQA 2E1PA 3MCNA 3V6HA 4RW7A 1Z1ZA 2PEHA 3QPIA 1S9FA 5L1LA 4O3RA 2RU3A 2YKPA 1FO1A 5D4OA 3SSQA 1U1MA 1UW4A 4P72A 1VQ7S 5D0EA 3FBBA 4YB6A 2DY1A 5A8KA 3M8QA 4GC7A 3JTOA 1OQ6A 1RTHA 2O67A 1QVFR 4NLWA 1UPPA 5A6WA 4DUZF 1KD1T 1JJ2R 2EKNA 2PA3A 3OQ2A 4QWEA 3KLEA 2YNHA 5T7LA 2DNOA 5FLXU 3BM7A 2VQEF 5IQQA 2MQMA 1SI9A 3MAAB 4DUYJ 2HBQB 3UN2A 2DGVA 4C48A 4Q45A 2Y1IA 3JSMB 3NMAA 4KV8B 2KYXA 4DG1A 3AY0A 2WVFA 3RYLA 3QRRA 1YDLA 2AEFA 5GMDA 2ACMA 2MXYA 1NJXA 5E3QA 4MMOA 4KBIA 3PKMA 2DITA 3G6YA 3G6VA 2IDLA 2BJ9A 4O3PA 4XIUA 4F4WA 3L95X 3LPYA 2VODA 4ZVQB 5E3RA 1GFWB 5CZVA 2R8KA 2DGSA 4H54A 5HP1A 4RZRA 3C46A 1UVLA 4YDXA 5F3TA 1X4HA 3L4BC 4TU9A 2EVZA 5C24A 2M70A 1FRHA 4KGMA 4OV1A 5I42A 4O4GA 2OUGA 3NGUA 4KHPJ 4N47A 4C0BA 4LF9J 5HSPA 3AB4B 5DM6Q 3NNHA 1ZAXA 2DKOB 4ZVUB 2EPIA 4DQSA 1SL1A 4DX5A 3T9NA 4DV7J 1V5IB 1VC0A 4P9SA 1KLMB 2E5LF 1MWYA 1NH8A 1PC4A 1WSVA 2AV5A 2VC0A 3B78A 3UW1A 1W2BR 1Y3JA 1V5VA 1HNVB 4USMA 4DCOB 4XO0A 2MQ8A 1R6YA 3FFIB 3F41A 4DX8H 1S7IA 2ZUAA 5J2NA 1KONA 1U2FA 3UN5A 3KJVB 2QFIA 2J6TA 1FJGJ 1TFWA 2WCXA 2CPFA 4WYWA 4KQZA 1RTZA 2GAHC 4PG6A 3MR3A 3CCUS 1K0TA 3D0HE 1XC9A 1QAXA 1F60B 2BE2A 3W7BA 3GU0A 4H4KC 5F3ZA 4MFBA 2U1AA 2ZE2A 3KMQA 1C1BB 1KDNA 3KK2B 4K8RA 1OS5A 2EC0A 3M1VA 3MPWA 1T3OA 2VDHA 3QMQA 3BSOA 2FLLA 3CCMS 2V63A 2HHTA 1H7XA 2KRRA 3KNAA 2R7TA 4M5NA 2MPUA 3P8BB 1VLOA 4NLQA 2HIYA 3BB5A 4KFBB 2KN4A 2F4FA 2XMWA 3UNYA 3MUMP 4FYWB 4WE1A 1U4BA 2XO7A 2V2QA 4A4JA 1HBNA 4OYAA 1NSAA 3RB6A 2E5HA 1KBRA 1ZM4A 3IRXA 1MG7A 3M9NB 4F3OA 2MKKA 1NJIT 4USIA 2ZH4A 4EBEA 1J5OA 3D9BA 3H2UB 4JOUA 2HGLA 2N3LA 4MTPA 4B17A 5LM7E 4N7TA 4HTIA 2EI5A 1S6PB 4B9UA 4LSLB 4Z2XA 3NRBA 4I1TA 3H4DA 1XNQF 4O3NA 3SDEA 2DNNA 1FVSA 2WSFC 4WU2A 1NH7A 3ETOA 5A0YA 2BMBA 3GR1A 2QMWA 4DUTA 2NXUA 3ILLA 2VFTA 2GJFA 3UR3C 3V81A 1XMOJ 3N28A 4C8OA 5ETOA 5KT2A 3OW2R 1FK9B 3FRZA 3LH2S 3Q8RB 1E6VA 2HFVA 1R8AA 1YZ6A 1YG0A 2ZBCA 3SCIE 3TWZA 5KFCA 3ZZPA 2BQ3A 2XBPA 2UUBJ 4K4UA 3R5AA 3S7RA 4IH5A 1SCJB 3W5ZA 1IKXB 1FRXA 3NAIA 3MTKA 2SXLA 3PW0A 4JI4J 3B82A 5HBMA 4LF4J 2WOMB 3N4WA 3WC2A 4P7VA 2HFOA 3AOBA 5J2MB 3HM9A 1F5CA 5I3QA 2POKA 3CDUA 2HHSA 2OAUA 1RAHB 2XM3A 4JI6J 2FGCA 4NYOA 2BR0A 1J2VA 1XWLA 4CH1A 1JLCB 2FJBB 4LQ9A 3MF5A 5IV3A 1C0UA 3GJTB 4TQSA 2M3DA 2JLGA 4Z7CA 1RJJA 1SKSA 2Y8YA 1V9OA 3KTQA 2FD2A 3CJ2A 1WTFA 4YS2A 2RRAA 2BEFA 2HAIA 2OSRA 4KGVB 1WI8A 2OMOA 1RTDA 4EI2A 3JAMY 2UVUA 4HLBA 4F0HA 1FA0A 1HYSA 4Q0BB 2GIFA 1WORA 4GRSA 1S9EB 2A10A 2IHR1 1VIXA 2RD5C 1WC0A 1WHYA 3SEOA 1JLQB 2JDJA 5HQLA 5KOWA 3UR0A 4ZCMA 3PIPQ 3GIKA 2E1CA 2UUAF 4JV5F 1AYEA 3AB2B 5LMNF 1KN6A 2C28A 4NYZA 5KG2A 2LDIA 2JVOA 3EVOA 5ETLA 3KJVA 3CCJS 1UEKA 2QRRA 4IYQA 2MQPA 1XNQJ 2GVZB 4CO1A 1OO0B 3TW0A 2VG5B 2OSQA 3OTEA 4IFYA 4LRFA 1VFJA 3PZPA 2HGNA 1LXNA 5DG8A 3N5FA 4I0WA 5C5JA 1MSWD 1VBXA 5KFAA 2DRDA 4PZVA 3TRGA 4LT6A 3R5GA 3T1AA 5K14A 3ZC4A 2CQ3A 2PN6A 2RKIA 4F4XA 2NS1B 2LA4A 3RR8A 4JI3J 1FNXH 4FN5A 4PUOB 2W7OA 2HHWA 3UNGC 2MQLA 2OPRA 3UVJA 2MZQA 3SXLA 1S0VA 2IBOA 2BW7A 2J7KA 1P9QC 1RCOB 2VPWB 1WEYA 4HTJA 1RAEB 4HVZA 4ZCKA 1KQGB 5A76A 4Y2IA 1OPIA 2GMLA 3A13A 5BJRA 2CJKA 3UD5A 1VQMS 2BQUA 2F8MA 1HWJA 2NPFA 2KB2A 3GPAA 3CJ8A 2KXNB 4C3KA 3F56A 1QE1A 2HRUA 3T6JA 4B9NA 1BD6A 4UZCA 3RAXA 3RUBL 2N7YA 3PIOQ 1VQNS 3NGSA 3UN3A 4IO1A 4H4OB 3DLGA 1M1KT 5F8IA 2QEXS 3VHQA 1RWNB 1JXVA 3CCES 1P1TA 3C8YA 1LEOA 1CJUA 5C25A 1KP6A 2VFVA 3GZ7A 2MLZA 1ZETA 1QE1B 2B51A 4LVOP 5GMKa 3SMZA 4Q8EA 1JKHB 1DTTA 2IC3B 4FZVA 2RDIA 3HKZD 3KK3A 3T3FA 3RB3A 4OYBA 3DFEA 4B3RF 1U7LA 2AJFE 2QO3A 4NLYA 5G0RA 1SKUB 4Z37A 3R1HA 4KGZB 4DUZJ 2K8GA 2LQ5A 2G1HA 3JB9k 2YPYA 4ZIWA 3EZ5A 4ZHRA 2RB7A 3EGVA 2XSJA 1N33J 4JI8F 4DR1F 3D5MA 2GO8A 1LK7A 1V3SA 4GO5X 4PUOA 1HPZA 2XMUA 4DPTA 2BOAA 5KFPA 1SJQA 2Z8QA 3UCUP 3PNIA 1EQMA 3Q2TC 5DG7A 2MJUA 3D1HA 2J0XA 1EZZB 1WG1A 1FXRA 1KOHA 3C19A 1A6LA 3OTOJ 4OHYA 1LWEA 2DH7A 2K1RA 1G4CA 3DCAA 3A3OB 5DDOC 4X65J 1NZ8A 1JLFA 2HVEA 3D66A 3RRHA 1U6BA 3J81U 2GJ2A 2NPIA 2QJ3A 1G3OA 4EUVA 2YWHA 5ETTA 2COLA 1SH3A 4JYAJ 1RT7B 3C14A 3DOLB 5HO4A 3NAHA 2NYIA 3C2PA 3DKDA 5HJYA 2J9DE 1YQHA 2W9BB 3QT5A 3BO4A 1CJTA 1P1LA 2IJRA 3K5OA 4NLTA 4WF9Q 3CO9A 1X4DA 5IT4A 1LW2B 4IRCA 3DRXA 4WFBQ 1UEVA 5J2QA 2MYFA 1YI2S 1ZA1B 4JI7F 3J7A1 1SQEA 2DJWA 4R5PA 4ED6A 3EVWA 4DL0C 5DJBA 5KFKA 3MEDB 5DG9A 1NKBA 4NLVA 3MCMA 3QJLA 2WTFA 2BJ1A 2MKIA 2GVDA 3QGIA 1QUVA 1G7CB 3BYRA 1M1HA 3D54A 3MD1A 3RRGA 3ET6A 2V4JA 2NCKL 2UVWA 4KHMA 4X65F 2DK2A 1S9GA 3V6DA 1GK8A 2XS5A 5FJ4A 1BXNA 2Q3PA 4ID5B 1GMWD 4LRCA 1BE4A 3CCLS 4O44A 3T1HF 2PI4A 3ENAA 3MAQA 1SC6A 2DIVA 4CLLA 5C7PA 2MHEA 3M2UB 3HT3A 4Y6IA 2ZH8A 1FWKA 1U0SA 2NSCA 2WK4A 4Q8FA 2MSTA 2HWTA 3IS9B 2XZWA 3BN4A 1RXOB 4ZMMA 1T9UA 2DGQA 2DXEA 2VG5A 1R8BA 4DR1J 1CS4B 3HHLD 2V9WA 2HURA 2UZAA 4OHVA 1K0VA 2B8QA 4C8NA 1WJ9A 3OLAA 2I6WA 3VAKA 5M2UA 1UEUA 2MZRA 2Z56B 4TXSA 3MHYA 4JUZA 3EXYA 3SQGA 3I5CA 1FK9A 1HQ2A 1N0UA 3TA2A 3NGRA 4ZVTB 4CLSA 3KDNA 2XCAA 1XNRF 3MURP 1MU2B 3M2VB 2ROEA 2YQ0A 2B7CB 1VRUA 1NHUA 1S9EA 4J9PA 2AGOA 2M7SA 4FXVA 4ZJOA 3E01A 4DR3J 1CPZA 2VBWA 1RBLA 1XERA 1U8SA 2B7BB 4DJBA 2XY5A 2J8SA 5HANA 3Q8UA 3W8GA 4DWIA 2C3YA 1T95A 3NG8A 2CQHA 1IBMF 2IMOA 9ATCB 3OL6A 2ZBIA 1HHQA 1HNWF 4K50A 2DNKA 1FESA 2FHJD 3EPGA 5GAGU 4UF4A 4K4TA 3K5NA 3D7SB 1TL7B 4DR2J 4LF6J 4DMZA 5IS2A 3MM8B 2HHHF 3CJ5A 3HHNB 1H72C 1C0TA 1QAYA 3DU6A 2XMTA 2AW0A 3NGKA 1TL3A 3OTOF 1UWBB 5HROA 5LJ5Y 2A2DA 2E9TA 1NHKL 1MNEA 2XGQA 4DV1F 4NA2A 2MHNA 4DFMA 4KE5A 5K8MA 4RNNA 4OHZA 5L1IA 3AJ2A 4UY8T 2GQCA 3EDRB 4K59A 4LREA 2EWHA 2OI2A 2XI3A 1XN9A 2HQDA 5DS7A 3HVAA 4PCQA 2AMCB 1UFLA 3BGOP 3C16A 3FZBA 2I9SA 4I4BA 4NZ7A 2L41A 3FBFA 3Q0AA 4NLOA 5A0YB 2BM1A 1CULB 1TV6B 3HI9A 3QGHA 4ZCLA 2OPSB 4MAKA 2KG1A 4TY9A 4I67A 1TQLA 2ZWPA 3C6UB 5D77A 1H2TZ 2PD1A 2VASA 1BLUA 3PKYA 1WD6A 1PC5A 1Q4RA 2ZWOA 1XR6A 2M88A 1JJHA 1XJWB 4OI0A 1A7GE 3GFHA 2DGWA 2DNZA 2HNZA 2IM0A 2ZNZA 4PG7A 4CDIA 1FDBA 1HW9A 1NSPA 3FNNA 3G82A 3PDNA 3R7SB 3SSSA 1HNXJ 1CLFA 1BWEA 3ZZUA 4DEZA 4CO2A 3SI8A 2JFKA 2NUUG 2VF3A 5ADZA 2UUAJ 2FJEB 4NPOA 4JI2J 1IBMJ 5LMNJ 1WOPA 1YJVA 4ITSA 3CPWR 1WHVA 3FEYB 2V8VA 4ZN3A 5ITHA 1VQPS 1RT4B 1YVFA 3QNWB 1Y5NB 4HH1A 2AU0A 3E2EA 1GQEA 4KO0A 4NWBA 3IWNC 1RACB 3HZEA 2K3IA 4E2FB 3KK2A 1RT4A 2ZHBA 2KI2A 2FZKB 4OI1A 5L1JA 2C2KB 2B0GA 5HN0A 3PX0A 3CJSA 5KFXA 3DGPA 3HXMA 2B56A 1NJZA 2WHOA 3QLHA 3VGUA 3NBPA 4F67A 2W9CB 3HVWA 5IM0B 1T8EA 1X4BA 1NLKL 1U0HA 4X64J 1ZM3A 3M4XA 1HD1A 2ZBQA 3CO0P 1X4FA 2OJ3A 1EQ0A 1JIHA 1RKIA 4FF3A 4CWBA 3L9ZA 1S5ZA 3CIZA 2JSXA 2QZ8A 2FJDB 2DO0A 1LNQA 5L8RC 4ZN1A 2UV8A 4Q7AA 4TN2A 4CNYA 2IM3A 2UXDF 1E6YB 3D28A 1N5TA 3BGRB 1MU2A 3M2VA 4ES1A 3J80U 4QWDA 3TP2A 2V8DA 5DQGA 2BRLA 2YNGA 3DLKB 3SQGB 1UW9A 1VOMA 2AWZA 1IQZA 3CJRA 4F36A 3T1YJ 1RT2B 1U49A 1XQIA 3M05A 1TL4A 2V50A 1N48A 1T0TV 1WF1A 5GAHU 3Q24A 3CGIA 1RT3B 2WAQD 3AOAA 3HFZB 4M5IA 4MT1A 2QA2A 4J9OA 4DL3A 2GQ2A 1YSJA 3E8OA 4DR7J 2OELA 3ITHB 3MR5A 1FXLA 2CZ9A 3BYPA 4NMLA 2QL5B 3M2UA 4AT1B 1EIYB 4N41A 3UD4P 2ROPA 1PG5B 4GVBB 3JSMA 2AJQA 1SIZA 3R3TA 3TQEA 5MAOA 5LSOA 3BN7A 2AJ4A 4DV2F 1HNZF 1U48A 1S49A 3TUIC 1VQLS 2D41A 4QR1A 3TQ1A 2IMWP 1Q86T 1WOSA 1S1XB 2AYEA 1HLWA 1IJFB 1VBYA 2ZH6A 4ANEA 1TL5A 4OHXA 2DH9A 1VCTA 5IT0A 5F8GA 2ZZNA 4USVA 3AD9C 2HK2A 4B02A 3LPEA 4B3OA 2UXCJ 5KFSA 3D1OA 4JI5F 3VALA 3E01B 3VAMA 4HDHA 2ERRA 4ETXA 2YH0A 4NXNF 2OEJA 3Q2SC 4J9UE 3N6LA 2D3OR 5EUHA 3HT0A 1JNRB 2A3JA 4OYIA 1G6BA 5B0BA 4L74A 1K73T 4PAAA 2LEPA 2R42A 4LVNP 4A48A 4X62F 1CC7A 3Q83A 2VOPA 4DX6A 1FI4A 1RT3A 2O66A 3CCVS 2HYIB 4BWMA 3OSNA 2YKMB 5KG1A 3MMAA 1C4CA 2EW9A 2HEKA 1IKWA 5ETNA 4FVMA 3HO1A 4NCBA 3BQ0A 4RW6A 5JVGQ 4LF8F 2VICA 3D1QA 2Q6BA 3TARA 2NXJA 4H4MA 4ID5A 4F7VA 4LR8A 3L7UA 3M9OB 3F44A 4M5DA 5D0HA 5KFEA 2UXBF 1CJKB 1YJ7A 1LV5A 1SUQB 4RUCA 1FWLA 5HQMA 3UQSA 2QYGA 4WIQA 5IZHA 3VVUA 5KFUA 2M8HA 3UCZP 4ELUA 2Z2YB 1GMUA 4NMXA 2A0FB 4DN0A 5EHHA 3Q23A 2XLKA 4O3SA 1HMVA 3S8SA 1VQ5S 3KLHB 2HK3A 3JTNA 5KG4A 2DGXA 4P52A 3THTA 2W9CA 3ILIA 2V67A 3NCPA 4ETZA 1DRZA 2ILYA 1TKZA 2Y1RI 3MMCA 1OY8A 1LWCA 2ZOMA 3IXQA 4S0MA 3OVBA 3V4MA 2BXJA 2XNRA 2QG9B 1YIJS 2XULA 5ETMA 3J80Y 4FBTA 2D74B 3GTYX 2LEBA 2NZ4A 2HLTA 5AXLA 1EP4B 5KOXA 4JI5J 3G2XA 3ZNUA 3N9UC 3TAMB 3DLHA 4UTGA 4K4YA 1PJ7A 1QSLA 5F9LA 3KJNB 2BW2A 3Q89A 2HHXA 4WJBA 2JH3A 3AFGA 4QU6A 5L9XA 3GONA 1REGX 5C2GA 3JXOA 2AX0A 1BC6A 2OPRB 3CXCR 4K0KJ 1KTVA 1M5SA 2DEJA 5B0CA 2W4DA 2MSSA 4CIOA 2IVFB 1N32J 1YLXA 3D68A 2UUCF 3D0IE 5K14B 5GVQA 4DU7A 3TAQA 5B0AA 5GAEU 2H5IB 1U24A 2N4DA 4RO0A 4EWTA 4X84A 6AT1B 4TVAB 3J7AN 3LGNA 1AB8A 1JLAA 4MKBA 4USWA 4KAIA 3G96A 3VR1A 4JBCA 4K4SA 3LGHA 3QWUA 2M52A 2F40A 4HT7A 4R0EA 1EKRA 5CD4H 1HBUA 3X3UA 1ZZNA 1QAJA 2MZTA 3C16B 5BYQA 4ER8A 3WZ0A 2W2OP 3MM9A 1F3FA 3T1HJ 2KDOA 4AXIA 2ADCA 3BBBA 1S99A 2XWXA 4TQRA 3SCJE 4C97A 2R2TA 2Q6CA 1JLQA 3THVA 2E1AA 2FIUA 3FSXA 3TNVA 2H5EA 2PA8D 2YX4A 4DU8A 4KPYA 2KTQA 2OPPA 3W9HA 2A2CA 1HYSB 2W2MP 4Y28C 2RH3A 1TUGB 1U1RA 3PRBA 1RTDB 3T5JA 1S79A 2DR7A 3AA9A 3GCXP 1LFPA 2W4CA 1NDLA 1NU4A 2KJWA 4RKUC 3KG4A 1RHKB 1F0XA 4N8NA 4WZMA 4USJC 2CPDA 3ENWA 4U9RA 3HHLA 2XC9A 2CG8A 1T7PA 3I4HX 1JK9B 1T9WA 3F0NA 1FERA 1VR6A 3A12A 4B3SF 4GKKF 2ASLA 3G87A 1TKDA 3CMES 2CXEA 1O5JA 3JAMU 4PXCA 4U96A 2FB0A 3DHXA 1NK5A 1M5HA 1UVJA 2FVRA 2WZ1A 1FXDA 2BUNA 2GZOA 3EGNA 5DDQC 2WVCA 1FEHA 1R0AA 2ACYA 3ZTQA 2K3KA 4OJ3A 2CYYA 5E3PA 3QO9A 1FDAA 1ZPVA 4OI3A 2C3PA 2VIHA 1SC1B 1RKJA 3BDPA 2RS2A 1RABB 1GMVA 3U7JA 3HSJA 2UUCJ 1N32F 3V2UC 1L3SA 3DDIA 1N5YA 1NJWA 2ABYA 2W2QP 3V6JA 1S97A 2ZH5A 3H5SA 3QJPA 3MPUB 3W2VA 2FHJA 1DZ5A 3HCXA 3PYGA 2Z2MA 2UP1A 3UI3A 2N7CA 2E5IA 2DNRA 3CJ0A 2CFXA 4ATNA 2ADBA 1TL1B 5BYSA 3VCDA 4F4AA 3VGTA 3OHAA 1VHFA 2EFQA 1VQ4S 4B3RJ 2IRYA 1TL3B 1PAUB 4AD6A 1RZMA 4BC7A 4CRJA 4USUA 2KFYA 4DLGA 3W5YA 4B3TJ 3DRRA 4ZPBA 3IG1A 1F5AA 4CT8A 3M8YA 3SZ2A 3P6YC 1RTIA 4OYMA 2C2ZB 5HAOA 2ZJQQ 2IPOB 2J9CA 3BKUA 4X62J 4J9QA 1KVJA 3WC0A 4X4OA 1RA6A 2KO1A 4CYUB 2LFVA 5LXYA 4DR2F 1KLNA 4LF6F 1HBNB 1RTIB 4DV6F 2EBGA 3FEZA 1CG2A 2VG7A 1VI7A 1N34F 1NDPA 3CCSS 4LFBF 2M0GB 1PJ6A 1IJEB 1IKXA 2GHPA 2FY8A 3EDQB 3H0PA 2L9NA 3LAKA 3PRDA 4WFYA 5ETRA 4ED2A 4KHRA 5J2QB 5HLFA 2RF2A 4K4XA 1LW2A 3KKFA 2P6TA 1V3ZA 3MWBA 4X4QA 1M0SA 5LSRA 3OL8A 3KK1B 3JQJA 4G6VB 4GKJF 2HBYB 1VQ6S 2A6OA 1SJ4P 1FF2A 3CCQS 4MFBB 3I6PA 4LFCJ 3W2VB 4KB7A 3CULA 1RBAA 2EFPA 1PYSB 4LR9A 1T9TA 3W66A 4YUDA 1F3VA 1UPMB 4U7CA 4YR0A 2RQ4A 3MPVA 2CQBA 2IM1A 3QBCA 1HD0A 3H4BA 2XY7A 4MYTA 1I94J 2FLNA 2QE5A 2VL1A 2VA3A 3RGIA 3T9ZA 2K1RB 2KKHA 4QPTA 3I0RA 5B0GA 5KFVA 3KOAA 4ELVA 1RT5B 1FE4A 2R7RA 2CPHA 4OX9J 4XPCA 3EWGA 4X4NA 1XTZA 2HSEB 2AIRB 2Q66A 1JLBA 1U8WA 2HQ3A 1J5OB 4Y0FA 2JEJA 3DRPB 4L6V3 1TK5A 1HPZB 2VA2A 1VJQA 2FVSA 3C66A 1WC3A 2LKZA 1VBZA 2G2OA 4P73A 1OSCA 4ZHRB 3BR8A 4C8LA 4UUWA 4XK8C 2B9EA 4ANDA 2NSBA 4F4YA 1WEZA 1F1BB 2AJ1A 2Y3YA 4LF1A 1UTAA 5KFWA 1HWUA 3MEDA 1MROB 1AT1B 1NDCA 4ZVEA 5KG0A 2CPXA 4U95A 1AXQA 4R5PB 5HP1B 2HW3A 1RDRA 2IRUA 2RVJA 1GAOA 3NS5A 3RG6A 1GT8A 3J81Y 3EUNA 2WSEC 2PMHA 3QFHA 2OPPB 1ZAVA 1QUPA 1YJTA 2K7JA 2P9GA 3OD2A 2V4RA 1NK4A 4RBUA 2YX1A 5IT9Y 2CJYB 3EJMA 4DXLA 1LWCB 5GADI 1RHMB 1FD2A 3ILJA 1YBTA 4P71A 2HPUA 4ZP6A 4DPYA 3K59A 2CDQA 5H9FK 3HHDA 1RUSA 1F5BA 2O5DA 2JVRA 2EK1A 2Z58B 2MQOA 1VQ8S 2XHWA 4ZOSA 5DQIA 1ZM2A 4IG0A 4ERDA 4ZKAA 4JI4F 2NR0A 4AFFA 3UDEA 4FKYA 4CH7A 1RAIB 1X60A 2HFNA 1OY6A 4LF2A 3G71S 1MWQA 3QSIA 1TAUA 3IGVA 2CNLB 2HHPA 4LBPA 3ZO7A 2HMIA 4OZNA 1U26A 1WC1A 2AJ0A 1PBAA 1RLCL 4Q2MA 4RJVA 3TX8A 4Q43A 2GGPB 5DQHA 3B6BA 2H48B 1DQAA 1G1XA 4F04B 2F8HA 2E44A 3BBCA 1YJNS 3FSIA 2I38A 3KMSA 3CDWA 2FGOA 1ZBTA 2P2CB 1X4EA 3QGPA 4ZS6A 3Q22A 3CUNA 5G0RB 1F6TA 1M1GA 2XZTB 3DDNA 1HBMA 2WB4A 3DI6B 2F9DA 4X64F 1VGYA 4LSNA 2A6MA 1DJ0A 3EE3A 3LP0A 4OZJA 2Z57B 1S0OA 2C3MA 3MMBB 1Q16B 2ZZTA 5F8HA 3N6MA 4KYZA 4CLUA 2CQ2A 3LANA 2LU2A 1H38A 2QA1A 2RIJA 1S76D 4Q44A 1RT1A 2FJVA 3CC4S 1O6XA 2CKWA 2VZ9A 4LJMA 1KOOA 2PGCA 3VAHA 1R27B 2L9WA 2L3MA 3S01A 1NSKL 1HHTP 1YRUA 2UU9F 1TTHB 3IR6B 1LK5A 1WEXA 2AHOB 2BBEA 2GO9A 3EZOA 4WP8A 5SUHA 3OTDA 3RJMB 1QJHA 3CJ4A 5BYRA 2DR9A 2IJNA 4IOBA 1TK0A 4DSJA 3BSNA 4GC6A 2PFDA 5B0DA 1ITPA 3A8IA 4PEOA 4DR5J 2BM0A 3GIRA 4WP9A 2G13A 3FBCA 2XMJA 3QIPB 1S1UB 1XK8A 3H5YA 2RQMA 3NXZA 4Y2CA 4WFAQ 3LP2B 4FVCA 1CSJA 1XR7A 5ETSA 4ECUA 1UJ4A 1VRQC 4DSEA 1SKWA 3RU0A 2WBRA 1YBUA 2PMZD 2BANA 3GR0A 4A8OA 4C98A 4A8SA 1TELA 1DTQA 2FHMA 2H4WB 3SCKE 3DHWC 1UAWA 2J0QD 4ZVHA 1ZZFA 1IM6A 3RRKA 4RPFA 4F0MA 3PO5A 4FF4A 5HBMB 4RX6A 2XLJA 4X4SA 1CQNA 1TMJA 3ISNC 3QQCD 4TY8B 2L48A 3I0RB 4X4UA 4R8UA 1W7WA 2PE8A 3M8WA 2AZ1A 2P8IA 2DNPA 2PIIA 3BGFA 3LW5C 4K5RA 1Q8KA 4ZVPB 1HI0P 1B64A 1VYAA 4KH0B 1EJ7L 2NLWA 3GFYA 2JRSA 4OYOA 3ZXWA 5LL6d 1RWOB 3NGTA 2M2BA 1IUJA 4ECXA 1LWFB 3FQLA 2X1AA 1M5OC 2HGMA 4JP8A 1IXKA 3HPOA 3OL7A 5C42A 3SIPB 2GNKA 3QWPA 1GXTA 3KHLA 4P7TA 3VAFA 4FNIA 1R43A 2DHHA 2DR5A 2F4VF 2BJDA 4I56A 4BS2A 2DHAA 4JI2F 1WG5A 1IWAA 2MZSA 3IGNA 3DOMB 3IBWA 2KRBA 3K8VA 3Q8YA 5DGBA 1X9WA 3R27A 3BGLA 4FYXB 3GWCA 2UU9J 2DNHA 3H90A 4DFPA 3IFEA 1HQEA 1TVRB 3R6LB 2I5JB 4AQYJ 3IRXB 1FVQA 4CLPA 2FC9A 2ZC4A 1Z2ZA 5IM0A 4KKOA 5DO2A 2YNIB 4NI2B 1N5QA 3CD7A 4BC9A 2VQEJ 4DV6J 5F8NA 3OJUA 1XBWA 1JQGA 1FHTA 2ZBRA 1N52B 4M8LA 5AT1B 1RAJA 3ITHA 3D0GE 2LU1A 1FKPA 1U1KA 1RAOA 2C3UA 4OZ0A 4NXMF 3K7RA 2RS8A 3IM9A 4EBDA 1K47A 3DMJB 4J90A 2BQRA 2UXBJ 3C3LA 3UDCA 2JX2A 3CCTA 3ICLA 1WC4A 3AXKA 3M1VB 3M6UA 4HI2A 3N5BA 3UCGA 3A8JA 1F2GA 3AH6A 1UJ5A 1T02A 4KT0C 4W90B 2YNGB 1HKAA 3DLKA 4YQWA 1RISA 4I7FA 2VQFJ 4C4WA 2C2MB 3BS9A 1BWVA 5D4LA 3ZZTA 1H98A 4F4KA 3CT9A 3OHBA 2R7QA 3I5AA 3VZHA 1SL0A 1VS3A 3CNQP 4X2BA 8ATCB 4NCGA 3KYLA 3ADAC 1I1GA 2NXNA 2JC0A 3DLEA 2KH9A 4YHHF 2J6SA 2CWXA 1XEZA 5BXIA 2CQIA 5H9FJ 1EB0A 2Q1LA 3DXSX 3SQOP 4WKYA 3CCZA 3L7OA 1VRTA 4QWBA 5A8RB 4L3KA 1RGVA 1YRTA 5C24B 2PDAA 1RWMB 4WE1B 1PILA 2WVDA 1S77D 2JJ4D 1NKEA 2CWKA 4DSLA 1SPBP 4DOZA 3TA1A 2Y1JA 3VGSA 2ZKTA 4BHQA 3R7NB 3OR1B 1EP4A 4CCHA 4ZVOB 1FNMA 1PKUA 2EKYA 1SH2A 1D09B 1JLEB 4P2SA 3W2WA 2XI2A 4DN9A 5EWFA 2ZE2B 2FZGB 2FUG9 3ZTPA 1ZOTA 2QLXA 1M90T 2DRBA 1U25A 2R4FA 2DVIA 1GMWA 2B8PA 2F3JA 2WRMA 3HSZA 5E3AA 3NY0A 3PHEA 4USKA 3MM5A 3I9ZA 4OLPA 3R9LA 4RUHA 3LTOA 2GIQA 3GFXA 4RU9A 2DNLA 1Z4UA 3DDKA 1HQEB 1TVRA 1HR0F 4CO4A 3GSIA 1H74A 5K20B 3D2WA 2LDYA 2CQ1A 2KXFA 2MGZA 2VOOA 1K1SA 1U09A 2DIUA 1H3DA 2PC6A 5KFZA 1C2PA 1RTHB 1WKLA 2QIFA 5LXRA 3SBMA 1H73A 2KM8C 5DGAA 4IRKA 1MN7A 4NCGB 2R7WA 5AXKA 2IAJA 1NO8A 5KFTA 2CVIA 4PXBA 4FBUA 4JI8J 4USHA 1QLNA 1REVA 3RW7A 2IM2A 2DHGA 1C1CB 1JB0C 2C1EB 3K5PA 1T9YA 2CNOB 2G9OA 1HNIB 3MEEA 3MM6A 2D3ZA 3Q8VA 4ZITA 2HS4A 2WONA 1RT6A 4CQ1A 4NXMJ 2YTCA 4NA1A 3CJKA 2YKMA 4E8UA 5LMUF 5D15A 1NNDA 3CEDA 4YB1P 4NA3A 2YWGA 4OI4A 3Q8QB 3KLFA 2J9EA 2BV3A 2HZVA 4V19X 4NYPA 4ECTA 2AT1B 2DR6A 1L3KA 3BH7B 4W98A 1EETA 2CJ9A 2DPIA 1W26A 1JNZB 1TKZB 1XMQJ 1S57A 3FZ2A 3IMQJ 1ACMB 3MFHA 4NRUA 4KKOB 3TR5A 3I0SB 2ZH2A 2DNQA 2C2RA 3BQ1A 2YNHB 1V6HA 1D9DA 2DCLA 4K4ZA 3G6XA 2R2SA 1JWWA 1H0HB 1FFGB 2EC2A 1EAYC 1S1TB 4USTA 2HRYA 4TU7A 1P6TA 2QFJA 2HBZB 3DOMA 1KQKA 1KS2A 5KFBA 3PR5B 4HHUA 1BMQB 3VAJA 4WZQA 3FKBA 4RUBA 2DB1A 4DSIA 4MIAA 4PABA 3WQPA 1IN0A 4A8XA 4DPXA 5HMXA 4I68A 3WDOA 1NK7A 4U7UK 1YITS 1NKCA 3CCWA 1D8ZA 4WCEQ 2F4VJ 4MK7A 2Q43A 2ZH1A 1FJGF 2FTRA 4F3QA 3K2YA 5LJ3Y 1RT1B 1A0OB 1AZSA 3IBCB 4FF2A 4EEYA 2XS2A 4KSEB 4HACB 4DV4J 3FVYA 3AOCA 3MMAB 3OFGA 7AT1B 5J1EA 4DQPA 4N76A 1JLFB 2DNMA 1KWMA 1YWXA 2YY3A 1LWEB 1RWUA 3K57A 3IS9A 4HACA 4OZ3A 1U2RA 4DSFA 1NPKA 4AYBD 6FDRA 1NXIA 2RUSA 4NLUA 3T1YF 1VISA 2HIQA 3H7HB 3T19A 2FJXA 1GTEA 4ED1A 3HULA 2Z30B 4OJ1A 5LMUJ 2ALZA 2M4MA 3DRSB 2GQQA 3OJSA 4DS5A 3ET6B 3PW4A 1O0PA 3TUJC 1SVDA 4F4ZA 2OTLS 2IA0A 2IAJB 2YWWA 1JLGA 2JC1A 3NLCA 3VV2B 5FDLA 3M9MB 3X1LB 3POTB 1TKXB 4LR7A 1Y10A 1JXLA 4WTYA 4IOAQ 3FSYA 4KGKA 1QAIA 2KVQE 2LECA 3UPFA 1S1TA 2MQNA 1TMMA 2JOQA 2B4OA 2J76E 3DM2A 4DV2J 3ISND 3NEKA 2B4UA 3OBIA 4QR2A 2YWKA 2C2OB 3JQMA 4C0OC 2W8KA 1HNZJ 3D6TB 1GX6A 1DFDA 1WF0A 1B0TA 1HBOA 4HYKA 4FS1A 3NS7B 1Y0HA 4YB7A 3IWLA 3C14B 3DOLA 3FJ2A 3NKYA 3TZYA 3CJTA 1Q79A 3ILOA 1KRPA 2OPQB 3A8EA 2YXLA 3AT1B 4NE9C 4DPOA 2R8IA 1FJEB 4M63A 3GV5B 4XPEA 1NMEB 3NMRA 4B3SJ 4LF5J 1Q5YA 3H5UA 4XDDA 2HFZA 4NLPA 2B9YA 4IDKA 4J9VA 3OT9A 4ZP9A 3SCLE 2OO4A 4IR1A 2QA4S 5DRKA 2VQFF 4ZPTR 2XY6A 4IKAA 3QIDA 4I64A 5H9EJ 4Z7YA 1KVKA 5IT9U 2MKYA 1C1CA 4EZ6A 1R0BG 2PFFB 2ZH9A 3MEKA 3IWXA 3OFEA 3QZ8A 2VG6A 5E5NA 4J7CA 4DZDA 2V94A 2YKQA 3MR2A 1UVMA 3VGVA 4JI0F 2JEFA 1ZTWA 1VMBA 4UOFA 3W3SA 3CC7S 2FHKA 2XYGB 1J5EF 2MLXA 3C6UA 1K9MT 4GKKJ 4CNZA 2FPHX 4J9SA 2Z2LA 4E0DA 4CP5A 3MCOA 4C8ZA 3MGJA 2OGUA 1ZA2B 2IYGA 3O44A 4OFZA 2DBBA 4CO0A 4UOGA 3AD8C 2HAFA 3M30A 3QT7A 3DGPB 1S6UA 4I7FB 2B4PA 4R0JA 4ZVFA 3RZAA 2J6UA 2RU9A 3R2CJ 3FCWA 1X7VA 2CZVC 4H4OA 4EBCA 2H65B 4DV4F 3EGWB 5KFHA 1WACA 3ENVA 1HHSA 1OY9A 4PQUA 1TR0A 2EG2A 2OFGX 4TLQA 1VK8A 1NZAA 4IQXA 2FY1A 4NASA 3RBDA 3CWJA 2W7PA 3QZ7A 2J7UA 4Y2AA 5HVFA 5F8MA 2CPZA 4EGLA 3EX7B 1RYSA 1N34J 4NLXA 3AJ1A 2UVVA 4NRTA 4QWAA 4EYHB 4W92B 2KZZA 3OTBA 1AFJA 2DH8A 2E1RA 3M2RB 3ENQA 1XIQA 2QLFB 3GJQB 3M8ZA 4NOHA 1T03B 2NYHA 3MCSA 4L73A 1S12A 2ILZA 3KUEA 2W4PA 4OZ5A 4Y00A 3W9IA 2HRTA 2BA9A 2ZH7A 2KT2A 4M5HA 4CO5A 5IOLA 2FQQB 2KG0A 3H25A 2HG4A 3TANA 1Y9OA 3DRPA 1T05B 1FEEA 3AXMA 1H6KX 4KC5A 4OYXA 4EFAC 4DV3F 2BDPA 1KHVA 4JYAF 1AFIA 1W2IA 4DFKA 2ZVIA 1S1VA 1FDNA 3EZUA 5DZ6A 1DBDA 1RT5A 4LRBA 2R8JA 2CQDA 4IFYB 1OJ4A 3Q86A 2XQCA 1KC8T 4JV2A 1FRKA 3SYZA 1WDDA 1GTHA 4QIVA 2KHDA 2W2NP 4B08A 1I51B 3ZNJ1 2QLBB 2EFOA 4KHPF 3MM7A 1WG4A 5KT4A 1U6ZA 1CQMA 4YEAA 1UP1A 1WI6A 4MK8A 4DS4A 1TUWA 3ZZZA 4M1KA 5AXNA 4KPCA 4QR0A 4PYDA 3I82A 1X9MA 3CCRS 1XNRJ 5I42B 4FYYB 4I6AA 2Y9HA 2DY9A 3H20A 2G0CA 4DLEA 2QL9B 2PO4A 5D6GA 1UVKA 2RF2B 1S72S 1RWWB 2XS7A 2BACA 4QOTA 2Z0GA 2V2KA 3QO9B 3A4TA 2V8HA 1JMTA 3NOCA 1C4AA 5L39A 3O2IA 3L7PA 4MKAA 1IR0A 3BGUA 4B3MF 3PV8A 1RWVB 3DOKA 5I3UB 3HVRA 1DTQB 1UJ6A 4KIAA 4AL6A 2YPZA 2BJ8A 4DQRA 3S1TA 4J37A 2I5JA 1FE0A 4RBTA 4A46A 1Q8IA 1VBKA 3MZIA 3W64A 3NOGA 1U6FA 4CTAB 5BR8F 2HHHJ 3HX9A 5J2MA 1SC4B 1BHNA 2N82B 1H7WA 4WWSA 3G8TA 3K0JA 2LQ9A 2RRNA 3HVTA 4UZBA 2IBKA 4LF7F 1NCLA 2PSZA 4C7QA 3TVKA 4A8YA 1TL1A 2D7SA 1Z2LA 2VU5A 2YKAA 2FZCB 1S4FA 2O01C 3CTRA 3M6XA 1CJTB 3PEHA 1MMLA 4JV1A 3OXGA 5CH7B 2W2PP 1U1OA 2PEBA 2CIMA 2B5JB 3K17A 3WX4A 2ZC3A 1NB7A 1LOUA 4LUBA 2XNQA 5DM7Q 1YGYA 2HNYA 4KRWA 4P74A 1X0PA 3MMBA 4C8KA 3KHGA 3U27A 2HFSA 4LF4F 3KUGA 4BBYA 1S1WB 1NRKA 5E0OA 3R8YA 2V8GA 2QGFB 4LSNB 1VHIA 2OEMA 3FEXB 3DI6A 2MY8A 3MDFA 1QVGR 4IG3B 4BLGA 5EWEA 2KM8B 2V6AA 3PO4A 4NZ6A 1TZ0A 4RNMA 1Q78A 3G6ES 1S6QB 5E7OB 5KFRA 2HLUA 3D3BJ 4ZPDA 2D69A 2XG8A 4DHVA 1Q7YT 4QIEA 3QT6A 1YK9A 3WHIA 4TYAA 2V4JB 4OZLA 2P9CA 1RI7A 4Y2KA 3FQKA 3UDVA 4Y2MA 1OSDA 2VKRA 3GIJA 3BKFA 1AROP 4F02A 4FS2A 1HW8A 3LF0A 3QIPA 4F26A 2OHDA 2H3EB 2KHCA 3N79A 5I3PA 4ZCIA 3J7YU 3HHEA 4ICLB 3AA8A 4X4PA 2ALYB 1O8BA 1RSCA 1U1PA 2D3UA 2KJVA 4JI6F 2C22A 4LFAJ 1HL6A 4Y34A 5D4PA 2F7VA 3GQCA 1D3WA 2OD4A 1MLAA 2L08A 5KFDA 4CM0A 4YOEA 1RT7A 4ZJLA 2LXUA 4HKQA 2ZHOA 2P6SA 2YH1A 4YP3A 2OKQA 1BQMA 1DQ8A 1FTRA 3PFOA 5GADU 4DL2A 3V4IA 1GX5A 2CQ4A 4B9VA 4JB8B 2LVWA 2E7XA 1B0PA 1SJ1A 2DISA 1MWZA 2X1GA 2XMKA 3MPYA 3I9V9 4P2XA 3VTIA 2CQGA 2HQIA 4HHHA 2DR8A 2HHVA 4H4KA 2HZCA 5J1NA 4DR7F 2YWEA 1JLAB 2B3TB 2J8AA 1YX2A 3FDSA 5K9FA 2YKOA 1KLMA 1MROA 4U6PA 1Y3KA 2J5AA 2GMJA 2HBRB 5DLGA 4DQQA 2XHCA 4B9MA 4DF8A 1PYTA 3EMTA 3HD2A 1TKTB 3R5JB 3UVJB 5A2QU 3OLBA 3OL9A 1G2EA 1KVIA 4J9RA 1CJKA 3TJAA 2AGPA 1X0FA 2FYXA 4RW7B 4X4TA 2XSJB 4URSA 1X5OA 3M6VA 4HT5A 3Q8PB 1IR2A 1RWKB 4HI1A 1MW7A 1WSRA 1GXLA 1FRJA 3JTPA 2GIRA 1ZM9A 2K2PA 4LFBJ 3OVSA 2CQPA 4G3IA 3PX4A 5E3CA 4UQTA 3NNAA 1IKWB 4I6WA 4ZLPA 1Q82T 4F0KA 2V4QA 3RTVA 5ETQA 1UETA 1S1WA 2G2ZA 2XCPA 2DNYA 2R9LA 3GG1A 1YJWS 1CJUB 3TI0A 2KFNA 1CJVB 4UQGA 3GILA 1CC8A 2XZDB 4DZ6A 2WW4A 4OL8A 1D8YA 3DLGB
chains in the Genus database with same CATH topology
4OYWA 4OYMA 1CJTA 3MAAA 4WPAA 4WP8A 4OZ2A 3MAAB 5IV3A 4CM2A 4WP9A 3C14B 2GVDA 4NI2A 4P2FA 1TL7A 3C15A 5IV4A 3G82B 1U0HA 3ET6A 4OYPA 1YBUA 1CJTB 1WC0A 1WC6A 5D0RA 4CLLA 4P2MA 1CJVA 4CLYA 1CS4B 2GVZB 1CS4A 1FX2A 3MR7A 1WC5A 4OYOA 4CLSA 4USWA 1AB8A 3R5GA 1YK9A 5D15A 1CULA 1WC3A 4CLFA 3UVJA 1FX4A 2GVDB 3C16B 4CLKA 2BW7A 1AZSB 4CLPA 1TL7B 3C15B 4NI2B 4USTA 4CM0A 1YBTA 2QV6A 4USVA 1CJUA 4OYAA 4P2XA 5D0GA 1WC4A 4OYBA 2WZ1A 4OYXA 1Y11A 1AZSA 4OYIA 3C16A 3UVJB 1WC1A 1CJKA 1CULB 2GVZA 4OYZA 2W01A 4OZ3A 4WP3A 5D0HA 4CLWA 1U0HB 3ET6B 1CJKB 3G82A 4CLZA 1CJUB 1CJVB 4CLTA 5D0EA 4CLUA 4USUA 1Y10A 3C14A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OYW A;  4OYM A;  1CJT A;  3MAA A;  4WPA A;  4WP8 A;  4OZ2 A;  3MAA B;  5IV3 A;  4CM2 A;  4WP9 A;  3C14 B;  2GVD A;  4NI2 A;  4P2F A;  1TL7 A;  3C15 A;  5IV4 A;  3G82 B;  1U0H A;  3ET6 A;  4OYP A;  1YBU A;  1CJT B;  1WC0 A;  1WC6 A;  5D0R A;  4CLL A;  4P2M A;  1CJV A;  4CLY A;  1CS4 B;  2GVZ B;  1CS4 A;  1FX2 A;  3MR7 A;  1WC5 A;  4OYO A;  4CLS A;  4USW A;  1AB8 A;  3R5G A;  1YK9 A;  5D15 A;  1CUL A;  1WC3 A;  4CLF A;  3UVJ A;  1FX4 A;  2GVD B;  3C16 B;  4CLK A;  2BW7 A;  1AZS B;  4CLP A;  1TL7 B;  3C15 B;  4NI2 B;  4UST A;  4CM0 A;  1YBT A;  2QV6 A;  4USV A;  1CJU A;  4OYA A;  4P2X A;  5D0G A;  1WC4 A;  4OYB A;  2WZ1 A;  4OYX A;  1Y11 A;  1AZS A;  4OYI A;  3C16 A;  3UVJ B;  1WC1 A;  1CJK A;  1CUL B;  2GVZ A;  4OYZ A;  2W01 A;  4OZ3 A;  4WP3 A;  5D0H A;  4CLW A;  1U0H B;  3ET6 B;  1CJK B;  3G82 A;  4CLZ A;  1CJU B;  1CJV B;  4CLT A;  5D0E A;  4CLU A;  4USU A;  1Y10 A;  3C14 A; 
#chains in the Genus database with same CATH topology
 4DG1 B;  1UZD A;  2B5J A;  3PJW A;  1RQ0 A;  2WBM A;  5KG5 A;  2N3O A;  4QYZ J;  2ZJR Q;  3MEC B;  4ECY A;  2VB6 A;  3CD5 A;  3MAA A;  2IYI A;  4RW4 B;  4AQY F;  1R7I A;  3M7V A;  5K8N A;  3TZZ A;  1PCA A;  1S4E A;  5F0W A;  1FRL A;  2MTL A;  4WII A;  4LF9 F;  3KDO A;  3T41 A;  1S48 A;  3DM2 B;  4QJV A;  3KLH A;  5CXT A;  3KXD A;  2JNJ A;  3HVT B;  5E2Q A;  1UWA A;  1Q1K A;  2V8P A;  2QYC A;  3RB0 A;  2E7V A;  3FMW A;  2GC8 A;  3VVT A;  2KT3 A;  2EFN A;  3M8Q B;  5HQ8 A;  1M5K C;  2MKS A;  5IXU A;  3FUY A;  1FTC A;  5AE1 A;  4C0H A;  1SC3 B;  1YZ7 A;  2JEG A;  1AA1 B;  1SXL A;  4NLG A;  4WFN Q;  3QAE A;  2ZIT A;  3DRS A;  2AYG A;  3KLI A;  2AGQ A;  2V68 A;  3HD1 A;  2IIH A;  4DR4 J;  3CE8 A;  3DRR B;  3MMJ A;  5HMY A;  3BR9 A;  1XMQ F;  2DNG A;  3VQS A;  1ELO A;  2R3V A;  1RB0 A;  3W65 A;  1DLO B;  1GXU A;  2YNF B;  4CLY A;  2FDN A;  2XMM A;  2LA6 A;  4LSZ B;  4IG3 A;  2J7W A;  1URR A;  4PR6 A;  4UY8 5;  3BPS P;  3L09 A;  4RNF A;  1SBR A;  3JSY A;  3SV4 A;  3PJX A;  3H40 A;  1UFW A;  1FKA F;  3IO1 A;  2WW8 A;  1B4S A;  4FYD A;  4FNH A;  4EK2 A;  3LO3 A;  3P3D A;  4UOH A;  3O1L A;  1PGZ A;  4ZLJ A;  2UXC F;  4RBV A;  4ED5 A;  1N5Y B;  3SFG A;  3QT8 A;  1RHR B;  2YKN A;  3TO8 A;  1X4A A;  1BQX A;  3ISZ A;  2OP5 A;  4LF5 F;  5HMZ A;  1FCA A;  2F65 A;  2X3D A;  5JUM A;  5KT3 A;  4PPZ A;  4DL5 A;  3M8S A;  3FCH A;  1BGX T;  1QDU B;  3PFE A;  1GNK A;  1DHM A;  3MAH A;  2DRA A;  2DD8 S;  2DXF A;  2I1R A;  5GAG I;  2MGZ B;  5F9N A;  1RU2 A;  1S1X A;  2MKH A;  2Q79 A;  3IAM 9;  5IFM A;  2CPI A;  1X4G A;  3N6N A;  1X8D A;  1Y5I B;  4ECQ A;  2CZ4 A;  2E5G A;  3R6G B;  1VQY A;  1F2H A;  3QLH B;  4PWW A;  4J9L A;  4OLO A;  1RWP B;  2DPJ A;  2ZZM A;  4ED3 A;  1GEH A;  2BZ2 A;  2CJB A;  3AAW B;  2IRX A;  4FPI A;  2AZ3 A;  1NM2 A;  1R8H A;  2X7I A;  4ANC A;  1VQ9 S;  1UVN A;  1WKJ A;  4ZK7 M;  2B6A B;  3OFF A;  4ALZ A;  1U1Q A;  3R97 A;  1K44 A;  1KTQ A;  2WVE A;  3LP1 B;  1HWI A;  4X66 J;  4BCA A;  1W25 A;  5B7W A;  4RNH A;  5HL7 Q;  2HQF A;  4A8Q A;  1UA1 A;  4DR6 J;  4LBH A;  2OTJ S;  1OIA A;  1YRX A;  2IVM A;  3B54 A;  3D6F B;  1E6V B;  1OPZ A;  2VON A;  2EK6 A;  3KNG A;  3MM6 B;  2BE2 B;  1NHV A;  2DEI A;  2W25 A;  4YB5 A;  2QLW A;  4J9M A;  4WXO A;  3BGR A;  1ICE B;  3KWM A;  4G1Q A;  3EVM A;  3MXH P;  2HWH A;  1HBU B;  3BSA A;  1VRT B;  2VD3 A;  1DUR A;  4ZA1 A;  4B9T A;  5J2N B;  1IQT A;  1I5O B;  2APO A;  2UXD J;  2B43 A;  2MB0 B;  4OYZ A;  5BR8 J;  1MN9 A;  3GMG A;  2OIH A;  4PKD B;  1FFW B;  1FKO B;  4LSL A;  3KHH A;  1ULR A;  1IR1 A;  4WP3 A;  2KZM A;  4KGX B;  4DV0 J;  4LMZ A;  4U8V A;  4F2S A;  1N5V A;  3R2D J;  2IDE A;  4NL5 A;  5E33 A;  2FVQ A;  1Q53 A;  4O0I A;  2JEI A;  2XMA A;  1N0V C;  2CVE A;  5KTQ A;  2C2N A;  1SQG A;  4CLZ A;  2VC1 A;  3DRY A;  1FT8 A;  5K8O A;  2ASD A;  3LAL A;  2RDD A;  2HWI A;  4DR4 F;  2A18 A;  3M2R A;  4Y3C A;  2E9R X;  3LGM A;  1HWL A;  5G4D A;  1R8C A;  2M5Y A;  3H59 A;  2V9K A;  1ZS6 A;  4RW8 B;  4K0K F;  3IA0 A;  3DXB A;  4OYW A;  1JLE A;  1NEE A;  1VJW A;  1YKW A;  4CT9 A;  3JYT A;  1TFY A;  2VFS A;  3I4P A;  5J2P A;  1SJF A;  1WWH A;  3VQT A;  2VBX A;  4KO0 B;  1AUS L;  1QY7 A;  1P27 B;  5HMW A;  2DCU B;  4OMF G;  1FWP A;  1UWB A;  2OLW A;  2AF6 A;  1R3N A;  4ZP8 A;  4N8O A;  1EHW A;  2VHG A;  3I31 A;  1IBC B;  4FKX A;  4KV8 A;  2FLP A;  4YDD B;  4ED4 A;  2CPE A;  1S0M A;  3H98 A;  4C3M A;  3GLJ A;  2L9D A;  1HBO B;  3HSD A;  3ZTS A;  5A8R A;  5KFN A;  3QRP A;  2GV1 A;  3C15 A;  2GFF A;  4DV1 J;  4PG4 A;  3PY8 A;  3J7Z 5;  4ZVS B;  1X4C A;  3FFI A;  5HJX A;  2MZ1 A;  2JZ5 A;  3K5M A;  1UA0 A;  3O5T B;  3U1M A;  3DC2 A;  1RE1 B;  1U02 A;  2CNK B;  3GG0 A;  3JS9 A;  4IFV B;  4F3M A;  5HVG A;  3PYE A;  5KFJ A;  2UUW A;  2RT3 A;  3ONQ A;  2BJ3 A;  2ASJ A;  3I87 A;  3P4U B;  2QN6 B;  5FDL B;  2VG6 B;  4MYU A;  4O3O A;  2CJQ A;  2N4C A;  5T14 A;  1IBL F;  1FDD A;  1KR4 A;  2LEA A;  2MKJ A;  3A3N B;  3EIC A;  3SSR A;  4O4G B;  2H4Y B;  4JI1 J;  3MR7 A;  4TNO A;  1WC5 A;  4ILL A;  1N6Q B;  2BVZ A;  4AXJ A;  1WTB A;  4LF8 J;  1LWF A;  1Y00 A;  3PHT A;  5H9E K;  4C3L A;  4EU0 A;  3OXF A;  4IDK B;  3ETM A;  3PAC A;  1WF2 A;  4K7Q A;  2NUH A;  3S6E A;  1DY3 A;  5K8P A;  5JJB A;  3WIV A;  4B9L A;  2VH7 A;  4E98 A;  4C6A A;  4WYL A;  1FKP B;  4IH6 A;  5J1E B;  4ZDN A;  2QSW A;  2MQQ A;  4I69 A;  5CD4 A;  1DLO A;  4P75 A;  2GA7 A;  3GIM A;  3V81 B;  1CEZ A;  2YX7 A;  1EKS A;  5KFQ A;  2FVC A;  4FXD A;  1RHJ B;  1AZS B;  1PBU A;  1S7H A;  2MLY A;  4B3T F;  2HHQ A;  3MEG B;  1FRI A;  2HQC A;  2XMV A;  4ZVR B;  4B3M J;  4DSK A;  2BAN B;  2LCW A;  2WSC C;  5LOQ A;  2V5H G;  5T7L B;  1FD8 A;  1HA1 A;  2CQ0 A;  3AOD A;  4JV0 A;  3TJ9 A;  3NGD A;  3GV8 B;  4F50 A;  5CZX A;  2I0X A;  2Y0B B;  3J7Z T;  3CMA S;  4DUY F;  4ZIV A;  2X3G A;  2C2E A;  4L75 A;  2OEK A;  1TKX A;  3POT A;  3UO0 A;  5M2P A;  1K8A T;  4K2X A;  4QWC A;  1JLG B;  4QIG A;  5KG7 A;  3SFU A;  3PR4 A;  2QA4 G;  1SUQ A;  3G4S S;  2M8D B;  2I8E A;  4RW9 A;  3K5L A;  3G86 A;  3D6H B;  1WKK A;  3P5B P;  4DR3 F;  3BDE A;  2DGU A;  1VRU B;  3BSC A;  4OHW A;  2E1M C;  1LQ9 A;  1T3N A;  4QYZ K;  1EET B;  4V1A k;  3NNC A;  3W9J A;  4GMK A;  2H5J B;  3OR2 B;  5EX0 A;  3TZW A;  2QLJ B;  2RHS B;  4U8Y A;  4RLE A;  1FRM A;  4PG8 A;  3R1L A;  3GYX B;  2NXE A;  5EWG A;  2P9E A;  2R8H A;  1RBO B;  1U45 A;  2V2V A;  1FJ7 A;  3W5X A;  5F8J A;  3BF4 A;  5HVH A;  1RTJ B;  2LXF A;  4OX7 A;  3I55 S;  5JXS A;  2CUY A;  4IO9 Q;  4ENO A;  1N54 B;  2ZKU A;  1TP7 A;  3ZZ0 A;  3J81 j;  1NK0 A;  4IR9 A;  1UCN A;  4TYB A;  1HNI A;  3MEE B;  4JI0 J;  2X1F A;  3K89 A;  4K5S A;  3VF0 B;  2J0W A;  1SJR A;  3NP5 A;  3MUT P;  5KFL A;  5KG3 A;  3KG1 A;  1DAR A;  3BQ2 A;  3VAI A;  1APS A;  3EM1 A;  2KU7 A;  4LIW A;  4BDP A;  3HFK A;  1AW0 A;  2ATC B;  2JHE A;  2QT7 A;  3BH6 B;  4DI6 A;  2AEJ A;  4QZV B;  3EYZ A;  3LP2 A;  4B3O B;  4CLT A;  3IN5 A;  3QRQ A;  1KKH A;  1S1U A;  4HH0 A;  3W8P A;  4EO8 A;  4A8M P;  4HHJ A;  4FP9 A;  2RE1 A;  2C3O A;  3IM8 A;  1PAE X;  2IJF A;  5GME A;  3UWT A;  5EDW A;  3HHK A;  1VDH A;  4LQ3 A;  3HK2 A;  2V2Z A;  1JKH A;  1N33 F;  1TAQ A;  3SV3 A;  2F1F A;  1HQU A;  4OZ2 A;  5JVH Q;  4RW4 A;  1B0V A;  5C25 B;  1T94 A;  4CM2 A;  1WEL A;  3VWS A;  2GMH A;  3BO2 A;  5HK4 A;  3EPI A;  4I2P B;  5ETK A;  3B4M A;  4MKV A;  3US5 A;  1EX8 A;  2E7W A;  1J5E J;  1VC5 A;  3HJF A;  2DGT A;  4ECW A;  4ES2 A;  2FC8 A;  4WK3 A;  4OZ1 A;  2VFR A;  1DAX A;  4FXW A;  4OYP A;  5J2P B;  4I6Y A;  3CW2 C;  3CJK B;  2ZJP Q;  1LW0 A;  1RT2 A;  2JL9 A;  2BX6 A;  2AYM A;  4XDC A;  5M2R A;  4MJK A;  3MD3 A;  5D0R A;  3TVY A;  2E5J A;  2VPZ B;  3FGV A;  4URQ U;  4YR3 A;  3MUV P;  1QTN B;  5IC4 B;  1QSS A;  3ZZO A;  4DFJ A;  1REV B;  4MIB A;  1IBK J;  2LMI A;  3KJQ B;  5B08 A;  2ZH3 A;  3GII A;  1VQO S;  2G0I A;  4KJI A;  3IC1 A;  2HNZ B;  2RKI B;  1XMO F;  2RML A;  3IR5 B;  2R7S A;  1TKT A;  1KQS R;  1RAD B;  2RIL A;  1JLB B;  3RBE A;  2VPX B;  4C8Y A;  3LQV A;  1EAR A;  4D3G A;  3DYA A;  3B8H A;  4DX7 A;  2RDJ A;  3OV7 A;  3CC2 S;  3T5L A;  4RU2 A;  4DCP B;  2R7U A;  2EBE A;  3O3L A;  3KHR A;  2XB2 D;  2LQB A;  3WIU A;  2O1P A;  3C6T A;  3HJV A;  2D9O A;  5D3G A;  2VKZ G;  1FNO A;  1L3T A;  3KJF B;  4G1P A;  2OPS A;  4ZPC A;  3TA0 A;  2FJW A;  4F2R A;  2R7X A;  1CUL A;  1TV6 A;  2LP4 A;  7FD1 A;  4G1I A;  1S10 A;  4PQA A;  1SV5 A;  2XTJ P;  4WBF A;  3UE2 A;  3G8S A;  4K4V A;  3V4I B;  2E66 A;  4FPR A;  3GYN A;  3N01 A;  2KL8 A;  4YY3 F;  5CYQ A;  3GJS B;  2AX1 A;  3FMB A;  2ZM6 J;  2V0N A;  1JXE A;  3W2W B;  1N8R T;  1IKV A;  5FII A;  2CDR B;  2DGO A;  2EG1 A;  2ZFH A;  3HFV A;  4M5L A;  3TEG A;  4CO3 A;  5CYM A;  1Q0N A;  2J9D A;  3DN9 A;  1VLY A;  3W63 A;  8RUC A;  4K4W A;  3JYT B;  5A8W A;  5L46 A;  3I56 S;  5HLF B;  4MK9 A;  5HRO B;  3PEJ A;  4KTQ A;  1RYR A;  4O23 A;  1R8P A;  4HR2 A;  4BWJ A;  3FC9 A;  3TOQ A;  1R6V A;  2VG7 B;  3OXL A;  3PYD A;  1U1N A;  1N56 A;  1KSP A;  2R7V A;  1H2V Z;  2OH2 A;  1HFE L;  2BKO A;  2FHO B;  2ROG A;  4WFZ A;  6FD1 A;  3PW7 A;  4AL5 A;  4PG5 A;  1HNX F;  1K1Q A;  2ZOF A;  4I2Q B;  4URG A;  5CCL A;  3IAS 9;  1HR0 J;  1B70 B;  5ETP A;  1A9N B;  3E3X A;  1RAG B;  3NWG A;  3IG1 B;  2VBY A;  3TUZ C;  1S6Q A;  4OI6 A;  3PJ9 A;  4WU3 A;  1L5U A;  2UUT A;  1I94 F;  2QSF A;  2MMY A;  1V3R A;  2YBV A;  5THW A;  2VJV A;  2GVZ A;  5K5M A;  3U1L A;  4P6Q A;  3T5H A;  5C42 B;  2V34 A;  3CIM A;  2DXD A;  3BV8 A;  2ZVS A;  2LLZ A;  2H54 B;  1RAF B;  4DR5 F;  1FJC A;  4L76 A;  2D3O 1;  2ZD1 A;  4MKY A;  3HF5 A;  2CAD A;  3QFW A;  5DDP C;  2OFH X;  2GW8 A;  2I2Y A;  4ECZ A;  1RK8 A;  3V5R A;  4QIF A;  4F25 A;  2LQJ A;  3CSK A;  3KK1 A;  3I32 A;  3UFC X;  1WUU A;  1NPR A;  2AQ4 A;  2J0S D;  3LP1 A;  3SDE B;  5GAH I;  1OWX A;  3OFH A;  3OTC A;  4TY8 A;  3U02 A;  3IRW P;  2G1D A;  2AYB A;  2DTJ A;  4ECR A;  2G2Y A;  4PWD A;  5DLF A;  4OQJ A;  3GJR B;  3RB4 A;  2Z2Z A;  4Q2L A;  1NB2 A;  3KLI B;  4CTA A;  1YHQ S;  3TZX A;  5AXM A;  3W1Y C;  4CYU A;  2JLF A;  5J1P A;  2W1B A;  2IVY A;  3FCV A;  2OD6 A;  4RR5 A;  1M5V C;  1KHW A;  1SL2 A;  2VJU A;  1T03 A;  1URN A;  4TU8 A;  3FRY A;  2HVH A;  1L3U A;  2NXC A;  2WOM A;  1HI8 A;  4Y65 A;  1PSD A;  1VC6 A;  2UVR A;  4PWD B;  2LQ8 A;  3CD6 S;  1WDT A;  3W60 A;  3VZI A;  3A8K A;  4K2J A;  2B9W A;  1Y7P A;  4TKT A;  2B9X A;  4L3N A;  3NL0 A;  3KUH A;  1WNE A;  3KG0 A;  5L9N A;  5CYM B;  2AEM A;  5ETV A;  4ZJQ A;  2ZBP A;  1YJ9 S;  4MIW A;  1IKV B;  3PCO B;  4C11 A;  3GV7 B;  4ZPW R;  3MEC A;  5CHC B;  1NPP A;  5KFO A;  4ELT A;  2X1B A;  4C2M A;  4OV6 A;  1OQ3 A;  2GX8 A;  3GE9 A;  4QPX A;  3MM9 B;  4WFX A;  1CJV A;  2RRB A;  4FDF A;  3NS6 A;  2QMU B;  3H2V E;  2CA9 A;  1YJR A;  2CJX B;  3JSR A;  3P45 B;  1AUD A;  1ROF A;  1RA7 A;  3CDE A;  3NCR A;  4ID8 A;  1CS4 A;  3D4J A;  1ZYQ A;  4DL7 A;  1FX2 A;  3CJQ A;  2HHU A;  2YNF A;  3C6T B;  3NCQ A;  4M5G A;  2RJZ A;  3RAQ A;  4HEA 9;  2W8L A;  5CAB A;  3AQO A;  3R5D A;  5EX3 A;  4FYV B;  1R0C B;  2CRL A;  3T6B A;  4HDG A;  4YME A;  4WXW A;  4WTO B;  3MFI A;  1S9G B;  3V6D B;  5B0F A;  4KR0 B;  5KAK A;  4I2Q A;  1SJ3 P;  4CZC A;  2GGP A;  5F8L A;  4U67 Q;  2UUB F;  2ZNY A;  4W4M A;  2BE7 D;  5HAT A;  1FX4 A;  2GVD B;  5FD1 A;  3HMJ G;  2VV5 A;  3EXC X;  5AJ3 F;  3AJD A;  1U1L A;  5L1K A;  1ZTT A;  3PVX A;  4KFB A;  2RSQ A;  3QYY A;  5D8H B;  1LXJ A;  3AD7 C;  2GS8 A;  4QYR A;  1UMJ A;  3QGG A;  5A8W B;  2NQP A;  3P49 B;  3TAM A;  1IBL J;  1Y4Z B;  3J7Y I;  1DTT B;  3KK3 B;  4M5M A;  2RNE A;  3QAU A;  1BQN B;  4ZLN A;  1Q8L A;  2YQ1 A;  2IY5 B;  3K58 A;  1D1U A;  1D0E A;  3I96 A;  1FFS B;  2W9B A;  1BQM B;  2R7O A;  2OPQ A;  2ZEJ A;  4Q0B A;  4WKR A;  4I2P A;  1IVZ A;  2WB1 D;  4P10 A;  4J9K A;  1VIO A;  3QJJ A;  1F9H A;  3THP A;  4V19 J;  4QW9 A;  3LP0 B;  1N36 F;  4NEY A;  2HS3 A;  1BQN A;  2VPY B;  3GB0 A;  2H1Y A;  1PIE A;  2BJ7 A;  2GJI A;  5D0G A;  1HBM B;  4DV5 F;  2F8E X;  4YN3 B;  5B0E A;  2GCF A;  4N56 A;  2XLI A;  5A2Q Y;  1BY9 A;  2CQC A;  3O6Q A;  5C2C A;  3UD3 P;  2W9A A;  4LFC F;  3MPD A;  1KEK A;  3OPK A;  2XO6 A;  3BZQ A;  3MOJ B;  4ZVG A;  1I3O B;  1DQ9 A;  1HNW J;  2EFG A;  2HVI A;  2H51 B;  1HAR A;  4Q5V A;  1B7Y B;  5RUB A;  2OML A;  5FLX Y;  2QTW A;  3DGV A;  2BJE A;  3HSG A;  3PW5 A;  1X31 C;  4M5D B;  2ATL A;  1IBK F;  1KFS A;  2ZDP A;  5CQG A;  4DPW A;  4JI1 F;  4ILM A;  3TAP A;  3CD0 A;  1NBE B;  1VQS A;  4GVL A;  1LWX A;  5GAE I;  4YR2 A;  4OX9 F;  3HHL C;  3CMQ A;  1IM4 A;  1MMD A;  4J91 A;  3M6W A;  3ZFV A;  4IG0 B;  3P96 A;  1B3T A;  4A8F A;  5B09 A;  1RHQ B;  4QW8 A;  2IC3 A;  4KH1 B;  4PWU A;  4JI3 F;  1KFD A;  1NK8 A;  4LRA A;  2KYZ A;  3O8W A;  1GH8 A;  2R8G A;  2MEW A;  3CF5 Q;  4PXD A;  2DYA A;  4DV5 J;  4NXN J;  1J27 A;  1TU0 B;  3ZTO A;  4JV5 J;  2HS0 A;  1OYD A;  3MMC B;  3A3P B;  4J9N A;  2BE9 B;  5EN1 A;  5DET A;  4XTT A;  2PMW A;  2HMI B;  2ZHA A;  1CBK A;  5KT5 A;  2PI5 A;  1OMS A;  3G9C A;  1RLD A;  3KLE B;  4LFA F;  1NK6 A;  4ICL A;  3A1Y G;  5CYJ A;  2R2U A;  3HDS A;  4ED8 A;  1P9Y A;  1T9X A;  3IBF B;  2ZDO A;  2XWY A;  1Q81 T;  4N77 A;  2ASY A;  4X4R A;  3TVZ A;  2O3D A;  5DDR C;  3RAM A;  3TJ8 A;  4ED7 A;  4X66 F;  1C0U B;  3GP9 A;  1I6J A;  3PG9 A;  4NEZ A;  4OJG A;  2CJA A;  5KFY A;  3BRE A;  5KG6 A;  2E9Z A;  1T11 A;  2IA6 A;  5LT5 A;  1UL3 A;  5U47 A;  4IUF A;  2Y8W A;  1U2C A;  3I0S A;  5IQ6 A;  5AJ3 J;  4F8R A;  2XSF A;  4IH7 A;  3W62 A;  3PW2 A;  2XEX A;  3GFZ A;  4GVB A;  4RL1 A;  4P2M A;  2HZA A;  5CAA A;  2D1C A;  2JWN A;  2H9Z A;  4AUK A;  1RCX B;  3DLJ A;  3TEH B;  1D9F A;  1S0N A;  3M8R A;  3PX6 A;  1N4L A;  3M32 A;  1F9F A;  1Q95 G;  2FLO A;  1HI1 A;  4NX9 A;  1SKR A;  1ZH5 A;  5KT6 A;  3LWL A;  2DHS A;  2Y0S D;  5EGY A;  1RT6 B;  3EGZ A;  2HNY B;  2EFV A;  4DV0 F;  3DLL Q;  3CVK A;  2BRK A;  1S6O A;  2ZD1 B;  3BO3 A;  1JJC B;  5KFG A;  4RUA A;  5H1S V;  3P5T L;  4ILR A;  1M5P C;  1KQF B;  3MM7 B;  4OJH A;  5KFF A;  4C11 B;  1IKY B;  2B4V A;  2DO4 A;  4QQB A;  3ZZR A;  4PRF A;  2U2F A;  4DR6 F;  2XYH B;  1H2U X;  5KT7 A;  2HKE A;  1P8G A;  4CLF A;  5L38 A;  4CLK A;  3GYG A;  2P5V A;  4HL9 A;  2QL7 B;  1NJY A;  1Q5V A;  1JJ4 A;  1S6P A;  4DQI A;  3ULH A;  4ZP7 A;  3MOZ A;  4OX8 A;  2UV8 G;  4L72 B;  3R5C A;  1IWG A;  4R25 A;  1T05 A;  1UVI A;  1RWX B;  5JMN A;  3AHP A;  3M8P A;  2MKC A;  1JLC A;  3DU5 A;  3TX0 A;  3FK4 A;  3R7B B;  1OYE A;  4NLR A;  4DL4 A;  4IOC Q;  3C15 B;  1U47 A;  4IQM A;  3MTJ A;  4PXE A;  3V6K A;  1R31 A;  3MM5 B;  3DOK B;  5I3U A;  3HHL B;  3DLB A;  2HVZ A;  3E51 A;  4AL7 A;  4YHH J;  2CNN B;  3PYF A;  3KLV A;  3HP6 A;  2X51 A;  2E5L J;  2QV6 A;  2HFU A;  1SQF A;  2LYV A;  3KLG B;  2CG4 A;  3KLF B;  3KFW X;  1YBA A;  3PXG a;  5LSL A;  3OR1 A;  5E41 A;  1WOO A;  4C8M A;  2QC3 A;  2MJN A;  2RAQ A;  4PQU B;  3HLU A;  2AJ2 A;  1Q7L B;  1UZH A;  4RW8 A;  1C1B A;  2HQG A;  5AE2 A;  1Y11 A;  5D3G B;  3UDL A;  3RBZ A;  4A8K A;  5KFI A;  3K8W A;  1Y5L B;  3M30 B;  2VDI A;  4YY3 J;  2MY7 A;  2VUG A;  4ZPV R;  1B7F A;  1D9A A;  3AQP A;  1E6Y A;  1SV5 B;  4DF4 A;  2VFU A;  4AE5 A;  3Q8S B;  3HZG A;  2DT9 A;  2W01 A;  5KFM A;  3PTW A;  3L3C A;  5F0U A;  1X9S A;  4EMD A;  2JFD A;  2G4B A;  4QU7 A;  4QCL A;  1S1V B;  1PYO B;  4DV7 F;  2YWF A;  2BOP A;  1R0A B;  3DLE B;  4M94 A;  1XMB A;  4IFV A;  2XYP B;  3BEG B;  4NLD A;  2D9P A;  4XAK A;  1XR5 A;  3FBE A;  2KVI A;  4CLW A;  1N5S A;  3U1N A;  1U0H B;  4GKJ J;  3QSY B;  2GHV C;  3NBP B;  2BAB A;  4G1Q B;  1T9V A;  3HKW A;  1NUE A;  2A1B A;  4A47 A;  3JQK A;  2FJA B;  1RP5 A;  1YJU A;  3IR7 B;  4YFU A;  2RQK A;  4MH8 A;  2C2D A;  4UOC A;  2HND A;  2K06 A;  1LKZ A;  1SB6 A;  3LOU A;  1VK3 A;  2F9J A;  1ZPW X;  2RQC A;  5AE3 A;  4PYA A;  2ZM6 F;  3BPD A;  4WPA A;  5D78 A;  7FDR A;  2WVB A;  2EEY A;  2W24 A;  4UW2 A;  2BYC A;  2RUG A;  5MLC V;  1SIW B;  3LWM A;  2JLE A;  2B6A A;  2NZC A;  3G8Q A;  3KLG A;  4O4R A;  5CYQ B;  4ES3 A;  4ED0 A;  2HND B;  3IP0 A;  3LA0 A;  3H2L A;  4DDF A;  1SH0 A;  5SZT A;  1QTM A;  3BBF A;  2YNI A;  4NI2 A;  4B9S A;  3GSD A;  4P2F A;  1TL7 A;  5IV4 A;  3G82 B;  1HQU B;  3QAT A;  4LIR A;  2Z4P A;  3RBX A;  5I4M A;  4KY3 A;  3OVA A;  1N36 J;  2FVP A;  3JSB A;  4ZLL A;  3M8P B;  1HNV A;  2KT5 A;  4DV3 J;  1MMN A;  1WC6 A;  2KXH A;  1HMV B;  3D67 A;  4DCJ B;  4PPD A;  4UT4 A;  3F73 A;  3OSP A;  1JX4 A;  1VQK S;  3RR7 A;  2EXU A;  3DYA B;  2AD9 A;  2MZJ A;  5A8K B;  2W7A A;  5IWA F;  1B99 A;  3H42 A;  5CA5 A;  3H5X A;  5A6P A;  1FKO A;  3NWR A;  2PT0 A;  3N0V A;  1RHU B;  4J5O A;  2IFX A;  2DHX A;  4A8W A;  2G0J A;  3ELH A;  1N88 A;  1IKY A;  1S59 A;  4QIW D;  1WHW A;  5F41 A;  2Y1L B;  5D4N A;  2BKN A;  4OX6 A;  3W61 A;  1PJ5 A;  4RWW A;  2YQ3 A;  5CCM A;  4NCA A;  4RW6 B;  1TUV A;  1YTY A;  2RHQ B;  4M5J A;  4TLR A;  2M9K A;  3VAG A;  1LW0 B;  1X5P A;  4O3Q A;  2E29 A;  2MDA A;  3TUP A;  1WHX A;  5IC6 B;  4M95 A;  1X5T A;  2F63 A;  1F9E B;  2ZUG A;  3DMJ A;  1BUX A;  5T41 A;  4R8U B;  3RW6 A;  9RUB A;  4M5K A;  3ZTR A;  1UKU A;  2YVS A;  1R89 A;  3OR2 A;  4DBQ A;  4FF1 A;  2GHW A;  4NZ0 A;  8AT1 B;  1QSY A;  1PO6 A;  3CDB A;  1QM9 A;  2CAJ A;  1C0T B;  2XGP A;  2KFZ A;  4UUX A;  3MM8 A;  4OIX A;  4LBI A;  5DZ7 A;  4CH0 S;  4CI0 B;  3T5K A;  3CB4 A;  5HI7 A;  3MR6 A;  4EZ9 A;  1CVJ A;  4RW9 B;  4ECS A;  4LRD A;  4C9D A;  4RWX A;  1ZAW A;  3BKT A;  4G65 A;  1QD1 A;  3OUY A;  4ZPA A;  3WX8 A;  4JI7 J;  1KNZ A;  2AP6 A;  4ECV A;  2ZOG A;  1RAA B;  4WK1 A;  2R2R A;  1Q8B A;  4U7U D;  4DL6 A;  2BKP A;  1TK8 A;  3D6M B;  3OUY B;  3DNC A;  1RU1 A;  1NK9 A;  1L3V A;  1NDK A;  4LF7 J;  1LFW A;  4IRD A;  2F5G A;  3CJ3 A;  2YKN B;  3B4D A;  3WBZ A;  4H4M B;  4DPU A;  1O51 A;  3H8Y A;  2C42 A;  3MEG A;  4N5S A;  1NAQ A;  4EO6 A;  4O0N A;  5IWA J;  4RNO A;  2QMX A;  1HWK A;  2VBZ A;  2CPY A;  1X5S A;  2NRE A;  1RTJ A;  4QBU A;  2QX0 A;  3I5B A;  3PM9 A;  3PRV A;  1HIY A;  3LUY A;  2GAG C;  3M32 B;  2AKW B;  1UFK A;  4NLS A;  3BJY A;  3TYT A;  2LXI A;  4GO7 X;  3ZZY A;  2WON B;  3CDA A;  2CPJ A;  2K7K A;  3MI7 X;  4D3H A;  4EYI B;  4X4V A;  2V69 A;  4OI2 A;  3R5B A;  3GCW P;  3LAM A;  4O44 B;  1N6Q A;  2HVD A;  3D3C J;  1NSQ A;  2E1P A;  3MCN A;  3V6H A;  4RW7 A;  1Z1Z A;  2PEH A;  3QPI A;  1S9F A;  5L1L A;  4O3R A;  2RU3 A;  2YKP A;  1FO1 A;  5D4O A;  3SSQ A;  1U1M A;  1UW4 A;  4P72 A;  1VQ7 S;  5D0E A;  3FBB A;  4YB6 A;  2DY1 A;  5A8K A;  3M8Q A;  4GC7 A;  3JTO A;  1OQ6 A;  1RTH A;  2O67 A;  1QVF R;  4NLW A;  1UPP A;  5A6W A;  4DUZ F;  1KD1 T;  1JJ2 R;  2EKN A;  2PA3 A;  3OQ2 A;  4QWE A;  3KLE A;  2YNH A;  5T7L A;  2DNO A;  5FLX U;  3BM7 A;  2VQE F;  5IQQ A;  2MQM A;  1SI9 A;  3MAA B;  4DUY J;  2HBQ B;  3UN2 A;  2DGV A;  4C48 A;  4Q45 A;  2Y1I A;  3JSM B;  3NMA A;  4KV8 B;  2KYX A;  4DG1 A;  3AY0 A;  2WVF A;  3RYL A;  3QRR A;  1YDL A;  2AEF A;  5GMD A;  2ACM A;  2MXY A;  1NJX A;  5E3Q A;  4MMO A;  4KBI A;  3PKM A;  2DIT A;  3G6Y A;  3G6V A;  2IDL A;  2BJ9 A;  4O3P A;  4XIU A;  4F4W A;  3L95 X;  3LPY A;  2VOD A;  4ZVQ B;  5E3R A;  1GFW B;  5CZV A;  2R8K A;  2DGS A;  4H54 A;  5HP1 A;  4RZR A;  3C46 A;  1UVL A;  4YDX A;  5F3T A;  1X4H A;  3L4B C;  4TU9 A;  2EVZ A;  5C24 A;  2M70 A;  1FRH A;  4KGM A;  4OV1 A;  5I42 A;  4O4G A;  2OUG A;  3NGU A;  4KHP J;  4N47 A;  4C0B A;  4LF9 J;  5HSP A;  3AB4 B;  5DM6 Q;  3NNH A;  1ZAX A;  2DKO B;  4ZVU B;  2EPI A;  4DQS A;  1SL1 A;  4DX5 A;  3T9N A;  4DV7 J;  1V5I B;  1VC0 A;  4P9S A;  1KLM B;  2E5L F;  1MWY A;  1NH8 A;  1PC4 A;  1WSV A;  2AV5 A;  2VC0 A;  3B78 A;  3UW1 A;  1W2B R;  1Y3J A;  1V5V A;  1HNV B;  4USM A;  4DCO B;  4XO0 A;  2MQ8 A;  1R6Y A;  3FFI B;  3F41 A;  4DX8 H;  1S7I A;  2ZUA A;  5J2N A;  1KON A;  1U2F A;  3UN5 A;  3KJV B;  2QFI A;  2J6T A;  1FJG J;  1TFW A;  2WCX A;  2CPF A;  4WYW A;  4KQZ A;  1RTZ A;  2GAH C;  4PG6 A;  3MR3 A;  3CCU S;  1K0T A;  3D0H E;  1XC9 A;  1QAX A;  1F60 B;  2BE2 A;  3W7B A;  3GU0 A;  4H4K C;  5F3Z A;  4MFB A;  2U1A A;  2ZE2 A;  3KMQ A;  1C1B B;  1KDN A;  3KK2 B;  4K8R A;  1OS5 A;  2EC0 A;  3M1V A;  3MPW A;  1T3O A;  2VDH A;  3QMQ A;  3BSO A;  2FLL A;  3CCM S;  2V63 A;  2HHT A;  1H7X A;  2KRR A;  3KNA A;  2R7T A;  4M5N A;  2MPU A;  3P8B B;  1VLO A;  4NLQ A;  2HIY A;  3BB5 A;  4KFB B;  2KN4 A;  2F4F A;  2XMW A;  3UNY A;  3MUM P;  4FYW B;  4WE1 A;  1U4B A;  2XO7 A;  2V2Q A;  4A4J A;  1HBN A;  4OYA A;  1NSA A;  3RB6 A;  2E5H A;  1KBR A;  1ZM4 A;  3IRX A;  1MG7 A;  3M9N B;  4F3O A;  2MKK A;  1NJI T;  4USI A;  2ZH4 A;  4EBE A;  1J5O A;  3D9B A;  3H2U B;  4JOU A;  2HGL A;  2N3L A;  4MTP A;  4B17 A;  5LM7 E;  4N7T A;  4HTI A;  2EI5 A;  1S6P B;  4B9U A;  4LSL B;  4Z2X A;  3NRB A;  4I1T A;  3H4D A;  1XNQ F;  4O3N A;  3SDE A;  2DNN A;  1FVS A;  2WSF C;  4WU2 A;  1NH7 A;  3ETO A;  5A0Y A;  2BMB A;  3GR1 A;  2QMW A;  4DUT A;  2NXU A;  3ILL A;  2VFT A;  2GJF A;  3UR3 C;  3V81 A;  1XMO J;  3N28 A;  4C8O A;  5ETO A;  5KT2 A;  3OW2 R;  1FK9 B;  3FRZ A;  3LH2 S;  3Q8R B;  1E6V A;  2HFV A;  1R8A A;  1YZ6 A;  1YG0 A;  2ZBC A;  3SCI E;  3TWZ A;  5KFC A;  3ZZP A;  2BQ3 A;  2XBP A;  2UUB J;  4K4U A;  3R5A A;  3S7R A;  4IH5 A;  1SCJ B;  3W5Z A;  1IKX B;  1FRX A;  3NAI A;  3MTK A;  2SXL A;  3PW0 A;  4JI4 J;  3B82 A;  5HBM A;  4LF4 J;  2WOM B;  3N4W A;  3WC2 A;  4P7V A;  2HFO A;  3AOB A;  5J2M B;  3HM9 A;  1F5C A;  5I3Q A;  2POK A;  3CDU A;  2HHS A;  2OAU A;  1RAH B;  2XM3 A;  4JI6 J;  2FGC A;  4NYO A;  2BR0 A;  1J2V A;  1XWL A;  4CH1 A;  1JLC B;  2FJB B;  4LQ9 A;  3MF5 A;  5IV3 A;  1C0U A;  3GJT B;  4TQS A;  2M3D A;  2JLG A;  4Z7C A;  1RJJ A;  1SKS A;  2Y8Y A;  1V9O A;  3KTQ A;  2FD2 A;  3CJ2 A;  1WTF A;  4YS2 A;  2RRA A;  2BEF A;  2HAI A;  2OSR A;  4KGV B;  1WI8 A;  2OMO A;  1RTD A;  4EI2 A;  3JAM Y;  2UVU A;  4HLB A;  4F0H A;  1FA0 A;  1HYS A;  4Q0B B;  2GIF A;  1WOR A;  4GRS A;  1S9E B;  2A10 A;  2IHR 1;  1VIX A;  2RD5 C;  1WC0 A;  1WHY A;  3SEO A;  1JLQ B;  2JDJ A;  5HQL A;  5KOW A;  3UR0 A;  4ZCM A;  3PIP Q;  3GIK A;  2E1C A;  2UUA F;  4JV5 F;  1AYE A;  3AB2 B;  5LMN F;  1KN6 A;  2C28 A;  4NYZ A;  5KG2 A;  2LDI A;  2JVO A;  3EVO A;  5ETL A;  3KJV A;  3CCJ S;  1UEK A;  2QRR A;  4IYQ A;  2MQP A;  1XNQ J;  2GVZ B;  4CO1 A;  1OO0 B;  3TW0 A;  2VG5 B;  2OSQ A;  3OTE A;  4IFY A;  4LRF A;  1VFJ A;  3PZP A;  2HGN A;  1LXN A;  5DG8 A;  3N5F A;  4I0W A;  5C5J A;  1MSW D;  1VBX A;  5KFA A;  2DRD A;  4PZV A;  3TRG A;  4LT6 A;  3R5G A;  3T1A A;  5K14 A;  3ZC4 A;  2CQ3 A;  2PN6 A;  2RKI A;  4F4X A;  2NS1 B;  2LA4 A;  3RR8 A;  4JI3 J;  1FNX H;  4FN5 A;  4PUO B;  2W7O A;  2HHW A;  3UNG C;  2MQL A;  2OPR A;  3UVJ A;  2MZQ A;  3SXL A;  1S0V A;  2IBO A;  2BW7 A;  2J7K A;  1P9Q C;  1RCO B;  2VPW B;  1WEY A;  4HTJ A;  1RAE B;  4HVZ A;  4ZCK A;  1KQG B;  5A76 A;  4Y2I A;  1OPI A;  2GML A;  3A13 A;  5BJR A;  2CJK A;  3UD5 A;  1VQM S;  2BQU A;  2F8M A;  1HWJ A;  2NPF A;  2KB2 A;  3GPA A;  3CJ8 A;  2KXN B;  4C3K A;  3F56 A;  1QE1 A;  2HRU A;  3T6J A;  4B9N A;  1BD6 A;  4UZC A;  3RAX A;  3RUB L;  2N7Y A;  3PIO Q;  1VQN S;  3NGS A;  3UN3 A;  4IO1 A;  4H4O B;  3DLG A;  1M1K T;  5F8I A;  2QEX S;  3VHQ A;  1RWN B;  1JXV A;  3CCE S;  1P1T A;  3C8Y A;  1LEO A;  1CJU A;  5C25 A;  1KP6 A;  2VFV A;  3GZ7 A;  2MLZ A;  1ZET A;  1QE1 B;  2B51 A;  4LVO P;  5GMK a;  3SMZ A;  4Q8E A;  1JKH B;  1DTT A;  2IC3 B;  4FZV A;  2RDI A;  3HKZ D;  3KK3 A;  3T3F A;  3RB3 A;  4OYB A;  3DFE A;  4B3R F;  1U7L A;  2AJF E;  2QO3 A;  4NLY A;  5G0R A;  1SKU B;  4Z37 A;  3R1H A;  4KGZ B;  4DUZ J;  2K8G A;  2LQ5 A;  2G1H A;  3JB9 k;  2YPY A;  4ZIW A;  3EZ5 A;  4ZHR A;  2RB7 A;  3EGV A;  2XSJ A;  1N33 J;  4JI8 F;  4DR1 F;  3D5M A;  2GO8 A;  1LK7 A;  1V3S A;  4GO5 X;  4PUO A;  1HPZ A;  2XMU A;  4DPT A;  2BOA A;  5KFP A;  1SJQ A;  2Z8Q A;  3UCU P;  3PNI A;  1EQM A;  3Q2T C;  5DG7 A;  2MJU A;  3D1H A;  2J0X A;  1EZZ B;  1WG1 A;  1FXR A;  1KOH A;  3C19 A;  1A6L A;  3OTO J;  4OHY A;  1LWE A;  2DH7 A;  2K1R A;  1G4C A;  3DCA A;  3A3O B;  5DDO C;  4X65 J;  1NZ8 A;  1JLF A;  2HVE A;  3D66 A;  3RRH A;  1U6B A;  3J81 U;  2GJ2 A;  2NPI A;  2QJ3 A;  1G3O A;  4EUV A;  2YWH A;  5ETT A;  2COL A;  1SH3 A;  4JYA J;  1RT7 B;  3C14 A;  3DOL B;  5HO4 A;  3NAH A;  2NYI A;  3C2P A;  3DKD A;  5HJY A;  2J9D E;  1YQH A;  2W9B B;  3QT5 A;  3BO4 A;  1CJT A;  1P1L A;  2IJR A;  3K5O A;  4NLT A;  4WF9 Q;  3CO9 A;  1X4D A;  5IT4 A;  1LW2 B;  4IRC A;  3DRX A;  4WFB Q;  1UEV A;  5J2Q A;  2MYF A;  1YI2 S;  1ZA1 B;  4JI7 F;  3J7A 1;  1SQE A;  2DJW A;  4R5P A;  4ED6 A;  3EVW A;  4DL0 C;  5DJB A;  5KFK A;  3MED B;  5DG9 A;  1NKB A;  4NLV A;  3MCM A;  3QJL A;  2WTF A;  2BJ1 A;  2MKI A;  2GVD A;  3QGI A;  1QUV A;  1G7C B;  3BYR A;  1M1H A;  3D54 A;  3MD1 A;  3RRG A;  3ET6 A;  2V4J A;  2NCK L;  2UVW A;  4KHM A;  4X65 F;  2DK2 A;  1S9G A;  3V6D A;  1GK8 A;  2XS5 A;  5FJ4 A;  1BXN A;  2Q3P A;  4ID5 B;  1GMW D;  4LRC A;  1BE4 A;  3CCL S;  4O44 A;  3T1H F;  2PI4 A;  3ENA A;  3MAQ A;  1SC6 A;  2DIV A;  4CLL A;  5C7P A;  2MHE A;  3M2U B;  3HT3 A;  4Y6I A;  2ZH8 A;  1FWK A;  1U0S A;  2NSC A;  2WK4 A;  4Q8F A;  2MST A;  2HWT A;  3IS9 B;  2XZW A;  3BN4 A;  1RXO B;  4ZMM A;  1T9U A;  2DGQ A;  2DXE A;  2VG5 A;  1R8B A;  4DR1 J;  1CS4 B;  3HHL D;  2V9W A;  2HUR A;  2UZA A;  4OHV A;  1K0V A;  2B8Q A;  4C8N A;  1WJ9 A;  3OLA A;  2I6W A;  3VAK A;  5M2U A;  1UEU A;  2MZR A;  2Z56 B;  4TXS A;  3MHY A;  4JUZ A;  3EXY A;  3SQG A;  3I5C A;  1FK9 A;  1HQ2 A;  1N0U A;  3TA2 A;  3NGR A;  4ZVT B;  4CLS A;  3KDN A;  2XCA A;  1XNR F;  3MUR P;  1MU2 B;  3M2V B;  2ROE A;  2YQ0 A;  2B7C B;  1VRU A;  1NHU A;  1S9E A;  4J9P A;  2AGO A;  2M7S A;  4FXV A;  4ZJO A;  3E01 A;  4DR3 J;  1CPZ A;  2VBW A;  1RBL A;  1XER A;  1U8S A;  2B7B B;  4DJB A;  2XY5 A;  2J8S A;  5HAN A;  3Q8U A;  3W8G A;  4DWI A;  2C3Y A;  1T95 A;  3NG8 A;  2CQH A;  1IBM F;  2IMO A;  9ATC B;  3OL6 A;  2ZBI A;  1HHQ A;  1HNW F;  4K50 A;  2DNK A;  1FES A;  2FHJ D;  3EPG A;  5GAG U;  4UF4 A;  4K4T A;  3K5N A;  3D7S B;  1TL7 B;  4DR2 J;  4LF6 J;  4DMZ A;  5IS2 A;  3MM8 B;  2HHH F;  3CJ5 A;  3HHN B;  1H72 C;  1C0T A;  1QAY A;  3DU6 A;  2XMT A;  2AW0 A;  3NGK A;  1TL3 A;  3OTO F;  1UWB B;  5HRO A;  5LJ5 Y;  2A2D A;  2E9T A;  1NHK L;  1MNE A;  2XGQ A;  4DV1 F;  4NA2 A;  2MHN A;  4DFM A;  4KE5 A;  5K8M A;  4RNN A;  4OHZ A;  5L1I A;  3AJ2 A;  4UY8 T;  2GQC A;  3EDR B;  4K59 A;  4LRE A;  2EWH A;  2OI2 A;  2XI3 A;  1XN9 A;  2HQD A;  5DS7 A;  3HVA A;  4PCQ A;  2AMC B;  1UFL A;  3BGO P;  3C16 A;  3FZB A;  2I9S A;  4I4B A;  4NZ7 A;  2L41 A;  3FBF A;  3Q0A A;  4NLO A;  5A0Y B;  2BM1 A;  1CUL B;  1TV6 B;  3HI9 A;  3QGH A;  4ZCL A;  2OPS B;  4MAK A;  2KG1 A;  4TY9 A;  4I67 A;  1TQL A;  2ZWP A;  3C6U B;  5D77 A;  1H2T Z;  2PD1 A;  2VAS A;  1BLU A;  3PKY A;  1WD6 A;  1PC5 A;  1Q4R A;  2ZWO A;  1XR6 A;  2M88 A;  1JJH A;  1XJW B;  4OI0 A;  1A7G E;  3GFH A;  2DGW A;  2DNZ A;  2HNZ A;  2IM0 A;  2ZNZ A;  4PG7 A;  4CDI A;  1FDB A;  1HW9 A;  1NSP A;  3FNN A;  3G82 A;  3PDN A;  3R7S B;  3SSS A;  1HNX J;  1CLF A;  1BWE A;  3ZZU A;  4DEZ A;  4CO2 A;  3SI8 A;  2JFK A;  2NUU G;  2VF3 A;  5ADZ A;  2UUA J;  2FJE B;  4NPO A;  4JI2 J;  1IBM J;  5LMN J;  1WOP A;  1YJV A;  4ITS A;  3CPW R;  1WHV A;  3FEY B;  2V8V A;  4ZN3 A;  5ITH A;  1VQP S;  1RT4 B;  1YVF A;  3QNW B;  1Y5N B;  4HH1 A;  2AU0 A;  3E2E A;  1GQE A;  4KO0 A;  4NWB A;  3IWN C;  1RAC B;  3HZE A;  2K3I A;  4E2F B;  3KK2 A;  1RT4 A;  2ZHB A;  2KI2 A;  2FZK B;  4OI1 A;  5L1J A;  2C2K B;  2B0G A;  5HN0 A;  3PX0 A;  3CJS A;  5KFX A;  3DGP A;  3HXM A;  2B56 A;  1NJZ A;  2WHO A;  3QLH A;  3VGU A;  3NBP A;  4F67 A;  2W9C B;  3HVW A;  5IM0 B;  1T8E A;  1X4B A;  1NLK L;  1U0H A;  4X64 J;  1ZM3 A;  3M4X A;  1HD1 A;  2ZBQ A;  3CO0 P;  1X4F A;  2OJ3 A;  1EQ0 A;  1JIH A;  1RKI A;  4FF3 A;  4CWB A;  3L9Z A;  1S5Z A;  3CIZ A;  2JSX A;  2QZ8 A;  2FJD B;  2DO0 A;  1LNQ A;  5L8R C;  4ZN1 A;  2UV8 A;  4Q7A A;  4TN2 A;  4CNY A;  2IM3 A;  2UXD F;  1E6Y B;  3D28 A;  1N5T A;  3BGR B;  1MU2 A;  3M2V A;  4ES1 A;  3J80 U;  4QWD A;  3TP2 A;  2V8D A;  5DQG A;  2BRL A;  2YNG A;  3DLK B;  3SQG B;  1UW9 A;  1VOM A;  2AWZ A;  1IQZ A;  3CJR A;  4F36 A;  3T1Y J;  1RT2 B;  1U49 A;  1XQI A;  3M05 A;  1TL4 A;  2V50 A;  1N48 A;  1T0T V;  1WF1 A;  5GAH U;  3Q24 A;  3CGI A;  1RT3 B;  2WAQ D;  3AOA A;  3HFZ B;  4M5I A;  4MT1 A;  2QA2 A;  4J9O A;  4DL3 A;  2GQ2 A;  1YSJ A;  3E8O A;  4DR7 J;  2OEL A;  3ITH B;  3MR5 A;  1FXL A;  2CZ9 A;  3BYP A;  4NML A;  2QL5 B;  3M2U A;  4AT1 B;  1EIY B;  4N41 A;  3UD4 P;  2ROP A;  1PG5 B;  4GVB B;  3JSM A;  2AJQ A;  1SIZ A;  3R3T A;  3TQE A;  5MAO A;  5LSO A;  3BN7 A;  2AJ4 A;  4DV2 F;  1HNZ F;  1U48 A;  1S49 A;  3TUI C;  1VQL S;  2D41 A;  4QR1 A;  3TQ1 A;  2IMW P;  1Q86 T;  1WOS A;  1S1X B;  2AYE A;  1HLW A;  1IJF B;  1VBY A;  2ZH6 A;  4ANE A;  1TL5 A;  4OHX A;  2DH9 A;  1VCT A;  5IT0 A;  5F8G A;  2ZZN A;  4USV A;  3AD9 C;  2HK2 A;  4B02 A;  3LPE A;  4B3O A;  2UXC J;  5KFS A;  3D1O A;  4JI5 F;  3VAL A;  3E01 B;  3VAM A;  4HDH A;  2ERR A;  4ETX A;  2YH0 A;  4NXN F;  2OEJ A;  3Q2S C;  4J9U E;  3N6L A;  2D3O R;  5EUH A;  3HT0 A;  1JNR B;  2A3J A;  4OYI A;  1G6B A;  5B0B A;  4L74 A;  1K73 T;  4PAA A;  2LEP A;  2R42 A;  4LVN P;  4A48 A;  4X62 F;  1CC7 A;  3Q83 A;  2VOP A;  4DX6 A;  1FI4 A;  1RT3 A;  2O66 A;  3CCV S;  2HYI B;  4BWM A;  3OSN A;  2YKM B;  5KG1 A;  3MMA A;  1C4C A;  2EW9 A;  2HEK A;  1IKW A;  5ETN A;  4FVM A;  3HO1 A;  4NCB A;  3BQ0 A;  4RW6 A;  5JVG Q;  4LF8 F;  2VIC A;  3D1Q A;  2Q6B A;  3TAR A;  2NXJ A;  4H4M A;  4ID5 A;  4F7V A;  4LR8 A;  3L7U A;  3M9O B;  3F44 A;  4M5D A;  5D0H A;  5KFE A;  2UXB F;  1CJK B;  1YJ7 A;  1LV5 A;  1SUQ B;  4RUC A;  1FWL A;  5HQM A;  3UQS A;  2QYG A;  4WIQ A;  5IZH A;  3VVU A;  5KFU A;  2M8H A;  3UCZ P;  4ELU A;  2Z2Y B;  1GMU A;  4NMX A;  2A0F B;  4DN0 A;  5EHH A;  3Q23 A;  2XLK A;  4O3S A;  1HMV A;  3S8S A;  1VQ5 S;  3KLH B;  2HK3 A;  3JTN A;  5KG4 A;  2DGX A;  4P52 A;  3THT A;  2W9C A;  3ILI A;  2V67 A;  3NCP A;  4ETZ A;  1DRZ A;  2ILY A;  1TKZ A;  2Y1R I;  3MMC A;  1OY8 A;  1LWC A;  2ZOM A;  3IXQ A;  4S0M A;  3OVB A;  3V4M A;  2BXJ A;  2XNR A;  2QG9 B;  1YIJ S;  2XUL A;  5ETM A;  3J80 Y;  4FBT A;  2D74 B;  3GTY X;  2LEB A;  2NZ4 A;  2HLT A;  5AXL A;  1EP4 B;  5KOX A;  4JI5 J;  3G2X A;  3ZNU A;  3N9U C;  3TAM B;  3DLH A;  4UTG A;  4K4Y A;  1PJ7 A;  1QSL A;  5F9L A;  3KJN B;  2BW2 A;  3Q89 A;  2HHX A;  4WJB A;  2JH3 A;  3AFG A;  4QU6 A;  5L9X A;  3GON A;  1REG X;  5C2G A;  3JXO A;  2AX0 A;  1BC6 A;  2OPR B;  3CXC R;  4K0K J;  1KTV A;  1M5S A;  2DEJ A;  5B0C A;  2W4D A;  2MSS A;  4CIO A;  2IVF B;  1N32 J;  1YLX A;  3D68 A;  2UUC F;  3D0I E;  5K14 B;  5GVQ A;  4DU7 A;  3TAQ A;  5B0A A;  5GAE U;  2H5I B;  1U24 A;  2N4D A;  4RO0 A;  4EWT A;  4X84 A;  6AT1 B;  4TVA B;  3J7A N;  3LGN A;  1AB8 A;  1JLA A;  4MKB A;  4USW A;  4KAI A;  3G96 A;  3VR1 A;  4JBC A;  4K4S A;  3LGH A;  3QWU A;  2M52 A;  2F40 A;  4HT7 A;  4R0E A;  1EKR A;  5CD4 H;  1HBU A;  3X3U A;  1ZZN A;  1QAJ A;  2MZT A;  3C16 B;  5BYQ A;  4ER8 A;  3WZ0 A;  2W2O P;  3MM9 A;  1F3F A;  3T1H J;  2KDO A;  4AXI A;  2ADC A;  3BBB A;  1S99 A;  2XWX A;  4TQR A;  3SCJ E;  4C97 A;  2R2T A;  2Q6C A;  1JLQ A;  3THV A;  2E1A A;  2FIU A;  3FSX A;  3TNV A;  2H5E A;  2PA8 D;  2YX4 A;  4DU8 A;  4KPY A;  2KTQ A;  2OPP A;  3W9H A;  2A2C A;  1HYS B;  2W2M P;  4Y28 C;  2RH3 A;  1TUG B;  1U1R A;  3PRB A;  1RTD B;  3T5J A;  1S79 A;  2DR7 A;  3AA9 A;  3GCX P;  1LFP A;  2W4C A;  1NDL A;  1NU4 A;  2KJW A;  4RKU C;  3KG4 A;  1RHK B;  1F0X A;  4N8N A;  4WZM A;  4USJ C;  2CPD A;  3ENW A;  4U9R A;  3HHL A;  2XC9 A;  2CG8 A;  1T7P A;  3I4H X;  1JK9 B;  1T9W A;  3F0N A;  1FER A;  1VR6 A;  3A12 A;  4B3S F;  4GKK F;  2ASL A;  3G87 A;  1TKD A;  3CME S;  2CXE A;  1O5J A;  3JAM U;  4PXC A;  4U96 A;  2FB0 A;  3DHX A;  1NK5 A;  1M5H A;  1UVJ A;  2FVR A;  2WZ1 A;  1FXD A;  2BUN A;  2GZO A;  3EGN A;  5DDQ C;  2WVC A;  1FEH A;  1R0A A;  2ACY A;  3ZTQ A;  2K3K A;  4OJ3 A;  2CYY A;  5E3P A;  3QO9 A;  1FDA A;  1ZPV A;  4OI3 A;  2C3P A;  2VIH A;  1SC1 B;  1RKJ A;  3BDP A;  2RS2 A;  1RAB B;  1GMV A;  3U7J A;  3HSJ A;  2UUC J;  1N32 F;  3V2U C;  1L3S A;  3DDI A;  1N5Y A;  1NJW A;  2ABY A;  2W2Q P;  3V6J A;  1S97 A;  2ZH5 A;  3H5S A;  3QJP A;  3MPU B;  3W2V A;  2FHJ A;  1DZ5 A;  3HCX A;  3PYG A;  2Z2M A;  2UP1 A;  3UI3 A;  2N7C A;  2E5I A;  2DNR A;  3CJ0 A;  2CFX A;  4ATN A;  2ADB A;  1TL1 B;  5BYS A;  3VCD A;  4F4A A;  3VGT A;  3OHA A;  1VHF A;  2EFQ A;  1VQ4 S;  4B3R J;  2IRY A;  1TL3 B;  1PAU B;  4AD6 A;  1RZM A;  4BC7 A;  4CRJ A;  4USU A;  2KFY A;  4DLG A;  3W5Y A;  4B3T J;  3DRR A;  4ZPB A;  3IG1 A;  1F5A A;  4CT8 A;  3M8Y A;  3SZ2 A;  3P6Y C;  1RTI A;  4OYM A;  2C2Z B;  5HAO A;  2ZJQ Q;  2IPO B;  2J9C A;  3BKU A;  4X62 J;  4J9Q A;  1KVJ A;  3WC0 A;  4X4O A;  1RA6 A;  2KO1 A;  4CYU B;  2LFV A;  5LXY A;  4DR2 F;  1KLN A;  4LF6 F;  1HBN B;  1RTI B;  4DV6 F;  2EBG A;  3FEZ A;  1CG2 A;  2VG7 A;  1VI7 A;  1N34 F;  1NDP A;  3CCS S;  4LFB F;  2M0G B;  1PJ6 A;  1IJE B;  1IKX A;  2GHP A;  2FY8 A;  3EDQ B;  3H0P A;  2L9N A;  3LAK A;  3PRD A;  4WFY A;  5ETR A;  4ED2 A;  4KHR A;  5J2Q B;  5HLF A;  2RF2 A;  4K4X A;  1LW2 A;  3KKF A;  2P6T A;  1V3Z A;  3MWB A;  4X4Q A;  1M0S A;  5LSR A;  3OL8 A;  3KK1 B;  3JQJ A;  4G6V B;  4GKJ F;  2HBY B;  1VQ6 S;  2A6O A;  1SJ4 P;  1FF2 A;  3CCQ S;  4MFB B;  3I6P A;  4LFC J;  3W2V B;  4KB7 A;  3CUL A;  1RBA A;  2EFP A;  1PYS B;  4LR9 A;  1T9T A;  3W66 A;  4YUD A;  1F3V A;  1UPM B;  4U7C A;  4YR0 A;  2RQ4 A;  3MPV A;  2CQB A;  2IM1 A;  3QBC A;  1HD0 A;  3H4B A;  2XY7 A;  4MYT A;  1I94 J;  2FLN A;  2QE5 A;  2VL1 A;  2VA3 A;  3RGI A;  3T9Z A;  2K1R B;  2KKH A;  4QPT A;  3I0R A;  5B0G A;  5KFV A;  3KOA A;  4ELV A;  1RT5 B;  1FE4 A;  2R7R A;  2CPH A;  4OX9 J;  4XPC A;  3EWG A;  4X4N A;  1XTZ A;  2HSE B;  2AIR B;  2Q66 A;  1JLB A;  1U8W A;  2HQ3 A;  1J5O B;  4Y0F A;  2JEJ A;  3DRP B;  4L6V 3;  1TK5 A;  1HPZ B;  2VA2 A;  1VJQ A;  2FVS A;  3C66 A;  1WC3 A;  2LKZ A;  1VBZ A;  2G2O A;  4P73 A;  1OSC A;  4ZHR B;  3BR8 A;  4C8L A;  4UUW A;  4XK8 C;  2B9E A;  4AND A;  2NSB A;  4F4Y A;  1WEZ A;  1F1B B;  2AJ1 A;  2Y3Y A;  4LF1 A;  1UTA A;  5KFW A;  1HWU A;  3MED A;  1MRO B;  1AT1 B;  1NDC A;  4ZVE A;  5KG0 A;  2CPX A;  4U95 A;  1AXQ A;  4R5P B;  5HP1 B;  2HW3 A;  1RDR A;  2IRU A;  2RVJ A;  1GAO A;  3NS5 A;  3RG6 A;  1GT8 A;  3J81 Y;  3EUN A;  2WSE C;  2PMH A;  3QFH A;  2OPP B;  1ZAV A;  1QUP A;  1YJT A;  2K7J A;  2P9G A;  3OD2 A;  2V4R A;  1NK4 A;  4RBU A;  2YX1 A;  5IT9 Y;  2CJY B;  3EJM A;  4DXL A;  1LWC B;  5GAD I;  1RHM B;  1FD2 A;  3ILJ A;  1YBT A;  4P71 A;  2HPU A;  4ZP6 A;  4DPY A;  3K59 A;  2CDQ A;  5H9F K;  3HHD A;  1RUS A;  1F5B A;  2O5D A;  2JVR A;  2EK1 A;  2Z58 B;  2MQO A;  1VQ8 S;  2XHW A;  4ZOS A;  5DQI A;  1ZM2 A;  4IG0 A;  4ERD A;  4ZKA A;  4JI4 F;  2NR0 A;  4AFF A;  3UDE A;  4FKY A;  4CH7 A;  1RAI B;  1X60 A;  2HFN A;  1OY6 A;  4LF2 A;  3G71 S;  1MWQ A;  3QSI A;  1TAU A;  3IGV A;  2CNL B;  2HHP A;  4LBP A;  3ZO7 A;  2HMI A;  4OZN A;  1U26 A;  1WC1 A;  2AJ0 A;  1PBA A;  1RLC L;  4Q2M A;  4RJV A;  3TX8 A;  4Q43 A;  2GGP B;  5DQH A;  3B6B A;  2H48 B;  1DQA A;  1G1X A;  4F04 B;  2F8H A;  2E44 A;  3BBC A;  1YJN S;  3FSI A;  2I38 A;  3KMS A;  3CDW A;  2FGO A;  1ZBT A;  2P2C B;  1X4E A;  3QGP A;  4ZS6 A;  3Q22 A;  3CUN A;  5G0R B;  1F6T A;  1M1G A;  2XZT B;  3DDN A;  1HBM A;  2WB4 A;  3DI6 B;  2F9D A;  4X64 F;  1VGY A;  4LSN A;  2A6M A;  1DJ0 A;  3EE3 A;  3LP0 A;  4OZJ A;  2Z57 B;  1S0O A;  2C3M A;  3MMB B;  1Q16 B;  2ZZT A;  5F8H A;  3N6M A;  4KYZ A;  4CLU A;  2CQ2 A;  3LAN A;  2LU2 A;  1H38 A;  2QA1 A;  2RIJ A;  1S76 D;  4Q44 A;  1RT1 A;  2FJV A;  3CC4 S;  1O6X A;  2CKW A;  2VZ9 A;  4LJM A;  1KOO A;  2PGC A;  3VAH A;  1R27 B;  2L9W A;  2L3M A;  3S01 A;  1NSK L;  1HHT P;  1YRU A;  2UU9 F;  1TTH B;  3IR6 B;  1LK5 A;  1WEX A;  2AHO B;  2BBE A;  2GO9 A;  3EZO A;  4WP8 A;  5SUH A;  3OTD A;  3RJM B;  1QJH A;  3CJ4 A;  5BYR A;  2DR9 A;  2IJN A;  4IOB A;  1TK0 A;  4DSJ A;  3BSN A;  4GC6 A;  2PFD A;  5B0D A;  1ITP A;  3A8I A;  4PEO A;  4DR5 J;  2BM0 A;  3GIR A;  4WP9 A;  2G13 A;  3FBC A;  2XMJ A;  3QIP B;  1S1U B;  1XK8 A;  3H5Y A;  2RQM A;  3NXZ A;  4Y2C A;  4WFA Q;  3LP2 B;  4FVC A;  1CSJ A;  1XR7 A;  5ETS A;  4ECU A;  1UJ4 A;  1VRQ C;  4DSE A;  1SKW A;  3RU0 A;  2WBR A;  1YBU A;  2PMZ D;  2BAN A;  3GR0 A;  4A8O A;  4C98 A;  4A8S A;  1TEL A;  1DTQ A;  2FHM A;  2H4W B;  3SCK E;  3DHW C;  1UAW A;  2J0Q D;  4ZVH A;  1ZZF A;  1IM6 A;  3RRK A;  4RPF A;  4F0M A;  3PO5 A;  4FF4 A;  5HBM B;  4RX6 A;  2XLJ A;  4X4S A;  1CQN A;  1TMJ A;  3ISN C;  3QQC D;  4TY8 B;  2L48 A;  3I0R B;  4X4U A;  4R8U A;  1W7W A;  2PE8 A;  3M8W A;  2AZ1 A;  2P8I A;  2DNP A;  2PII A;  3BGF A;  3LW5 C;  4K5R A;  1Q8K A;  4ZVP B;  1HI0 P;  1B64 A;  1VYA A;  4KH0 B;  1EJ7 L;  2NLW A;  3GFY A;  2JRS A;  4OYO A;  3ZXW A;  5LL6 d;  1RWO B;  3NGT A;  2M2B A;  1IUJ A;  4ECX A;  1LWF B;  3FQL A;  2X1A A;  1M5O C;  2HGM A;  4JP8 A;  1IXK A;  3HPO A;  3OL7 A;  5C42 A;  3SIP B;  2GNK A;  3QWP A;  1GXT A;  3KHL A;  4P7T A;  3VAF A;  4FNI A;  1R43 A;  2DHH A;  2DR5 A;  2F4V F;  2BJD A;  4I56 A;  4BS2 A;  2DHA A;  4JI2 F;  1WG5 A;  1IWA A;  2MZS A;  3IGN A;  3DOM B;  3IBW A;  2KRB A;  3K8V A;  3Q8Y A;  5DGB A;  1X9W A;  3R27 A;  3BGL A;  4FYX B;  3GWC A;  2UU9 J;  2DNH A;  3H90 A;  4DFP A;  3IFE A;  1HQE A;  1TVR B;  3R6L B;  2I5J B;  4AQY J;  3IRX B;  1FVQ A;  4CLP A;  2FC9 A;  2ZC4 A;  1Z2Z A;  5IM0 A;  4KKO A;  5DO2 A;  2YNI B;  4NI2 B;  1N5Q A;  3CD7 A;  4BC9 A;  2VQE J;  4DV6 J;  5F8N A;  3OJU A;  1XBW A;  1JQG A;  1FHT A;  2ZBR A;  1N52 B;  4M8L A;  5AT1 B;  1RAJ A;  3ITH A;  3D0G E;  2LU1 A;  1FKP A;  1U1K A;  1RAO A;  2C3U A;  4OZ0 A;  4NXM F;  3K7R A;  2RS8 A;  3IM9 A;  4EBD A;  1K47 A;  3DMJ B;  4J90 A;  2BQR A;  2UXB J;  3C3L A;  3UDC A;  2JX2 A;  3CCT A;  3ICL A;  1WC4 A;  3AXK A;  3M1V B;  3M6U A;  4HI2 A;  3N5B A;  3UCG A;  3A8J A;  1F2G A;  3AH6 A;  1UJ5 A;  1T02 A;  4KT0 C;  4W90 B;  2YNG B;  1HKA A;  3DLK A;  4YQW A;  1RIS A;  4I7F A;  2VQF J;  4C4W A;  2C2M B;  3BS9 A;  1BWV A;  5D4L A;  3ZZT A;  1H98 A;  4F4K A;  3CT9 A;  3OHB A;  2R7Q A;  3I5A A;  3VZH A;  1SL0 A;  1VS3 A;  3CNQ P;  4X2B A;  8ATC B;  4NCG A;  3KYL A;  3ADA C;  1I1G A;  2NXN A;  2JC0 A;  3DLE A;  2KH9 A;  4YHH F;  2J6S A;  2CWX A;  1XEZ A;  5BXI A;  2CQI A;  5H9F J;  1EB0 A;  2Q1L A;  3DXS X;  3SQO P;  4WKY A;  3CCZ A;  3L7O A;  1VRT A;  4QWB A;  5A8R B;  4L3K A;  1RGV A;  1YRT A;  5C24 B;  2PDA A;  1RWM B;  4WE1 B;  1PIL A;  2WVD A;  1S77 D;  2JJ4 D;  1NKE A;  2CWK A;  4DSL A;  1SPB P;  4DOZ A;  3TA1 A;  2Y1J A;  3VGS A;  2ZKT A;  4BHQ A;  3R7N B;  3OR1 B;  1EP4 A;  4CCH A;  4ZVO B;  1FNM A;  1PKU A;  2EKY A;  1SH2 A;  1D09 B;  1JLE B;  4P2S A;  3W2W A;  2XI2 A;  4DN9 A;  5EWF A;  2ZE2 B;  2FZG B;  2FUG 9;  3ZTP A;  1ZOT A;  2QLX A;  1M90 T;  2DRB A;  1U25 A;  2R4F A;  2DVI A;  1GMW A;  2B8P A;  2F3J A;  2WRM A;  3HSZ A;  5E3A A;  3NY0 A;  3PHE A;  4USK A;  3MM5 A;  3I9Z A;  4OLP A;  3R9L A;  4RUH A;  3LTO A;  2GIQ A;  3GFX A;  4RU9 A;  2DNL A;  1Z4U A;  3DDK A;  1HQE B;  1TVR A;  1HR0 F;  4CO4 A;  3GSI A;  1H74 A;  5K20 B;  3D2W A;  2LDY A;  2CQ1 A;  2KXF A;  2MGZ A;  2VOO A;  1K1S A;  1U09 A;  2DIU A;  1H3D A;  2PC6 A;  5KFZ A;  1C2P A;  1RTH B;  1WKL A;  2QIF A;  5LXR A;  3SBM A;  1H73 A;  2KM8 C;  5DGA A;  4IRK A;  1MN7 A;  4NCG B;  2R7W A;  5AXK A;  2IAJ A;  1NO8 A;  5KFT A;  2CVI A;  4PXB A;  4FBU A;  4JI8 J;  4USH A;  1QLN A;  1REV A;  3RW7 A;  2IM2 A;  2DHG A;  1C1C B;  1JB0 C;  2C1E B;  3K5P A;  1T9Y A;  2CNO B;  2G9O A;  1HNI B;  3MEE A;  3MM6 A;  2D3Z A;  3Q8V A;  4ZIT A;  2HS4 A;  2WON A;  1RT6 A;  4CQ1 A;  4NXM J;  2YTC A;  4NA1 A;  3CJK A;  2YKM A;  4E8U A;  5LMU F;  5D15 A;  1NND A;  3CED A;  4YB1 P;  4NA3 A;  2YWG A;  4OI4 A;  3Q8Q B;  3KLF A;  2J9E A;  2BV3 A;  2HZV A;  4V19 X;  4NYP A;  4ECT A;  2AT1 B;  2DR6 A;  1L3K A;  3BH7 B;  4W98 A;  1EET A;  2CJ9 A;  2DPI A;  1W26 A;  1JNZ B;  1TKZ B;  1XMQ J;  1S57 A;  3FZ2 A;  3IMQ J;  1ACM B;  3MFH A;  4NRU A;  4KKO B;  3TR5 A;  3I0S B;  2ZH2 A;  2DNQ A;  2C2R A;  3BQ1 A;  2YNH B;  1V6H A;  1D9D A;  2DCL A;  4K4Z A;  3G6X A;  2R2S A;  1JWW A;  1H0H B;  1FFG B;  2EC2 A;  1EAY C;  1S1T B;  4UST A;  2HRY A;  4TU7 A;  1P6T A;  2QFJ A;  2HBZ B;  3DOM A;  1KQK A;  1KS2 A;  5KFB A;  3PR5 B;  4HHU A;  1BMQ B;  3VAJ A;  4WZQ A;  3FKB A;  4RUB A;  2DB1 A;  4DSI A;  4MIA A;  4PAB A;  3WQP A;  1IN0 A;  4A8X A;  4DPX A;  5HMX A;  4I68 A;  3WDO A;  1NK7 A;  4U7U K;  1YIT S;  1NKC A;  3CCW A;  1D8Z A;  4WCE Q;  2F4V J;  4MK7 A;  2Q43 A;  2ZH1 A;  1FJG F;  2FTR A;  4F3Q A;  3K2Y A;  5LJ3 Y;  1RT1 B;  1A0O B;  1AZS A;  3IBC B;  4FF2 A;  4EEY A;  2XS2 A;  4KSE B;  4HAC B;  4DV4 J;  3FVY A;  3AOC A;  3MMA B;  3OFG A;  7AT1 B;  5J1E A;  4DQP A;  4N76 A;  1JLF B;  2DNM A;  1KWM A;  1YWX A;  2YY3 A;  1LWE B;  1RWU A;  3K57 A;  3IS9 A;  4HAC A;  4OZ3 A;  1U2R A;  4DSF A;  1NPK A;  4AYB D;  6FDR A;  1NXI A;  2RUS A;  4NLU A;  3T1Y F;  1VIS A;  2HIQ A;  3H7H B;  3T19 A;  2FJX A;  1GTE A;  4ED1 A;  3HUL A;  2Z30 B;  4OJ1 A;  5LMU J;  2ALZ A;  2M4M A;  3DRS B;  2GQQ A;  3OJS A;  4DS5 A;  3ET6 B;  3PW4 A;  1O0P A;  3TUJ C;  1SVD A;  4F4Z A;  2OTL S;  2IA0 A;  2IAJ B;  2YWW A;  1JLG A;  2JC1 A;  3NLC A;  3VV2 B;  5FDL A;  3M9M B;  3X1L B;  3POT B;  1TKX B;  4LR7 A;  1Y10 A;  1JXL A;  4WTY A;  4IOA Q;  3FSY A;  4KGK A;  1QAI A;  2KVQ E;  2LEC A;  3UPF A;  1S1T A;  2MQN A;  1TMM A;  2JOQ A;  2B4O A;  2J76 E;  3DM2 A;  4DV2 J;  3ISN D;  3NEK A;  2B4U A;  3OBI A;  4QR2 A;  2YWK A;  2C2O B;  3JQM A;  4C0O C;  2W8K A;  1HNZ J;  3D6T B;  1GX6 A;  1DFD A;  1WF0 A;  1B0T A;  1HBO A;  4HYK A;  4FS1 A;  3NS7 B;  1Y0H A;  4YB7 A;  3IWL A;  3C14 B;  3DOL A;  3FJ2 A;  3NKY A;  3TZY A;  3CJT A;  1Q79 A;  3ILO A;  1KRP A;  2OPQ B;  3A8E A;  2YXL A;  3AT1 B;  4NE9 C;  4DPO A;  2R8I A;  1FJE B;  4M63 A;  3GV5 B;  4XPE A;  1NME B;  3NMR A;  4B3S J;  4LF5 J;  1Q5Y A;  3H5U A;  4XDD A;  2HFZ A;  4NLP A;  2B9Y A;  4IDK A;  4J9V A;  3OT9 A;  4ZP9 A;  3SCL E;  2OO4 A;  4IR1 A;  2QA4 S;  5DRK A;  2VQF F;  4ZPT R;  2XY6 A;  4IKA A;  3QID A;  4I64 A;  5H9E J;  4Z7Y A;  1KVK A;  5IT9 U;  2MKY A;  1C1C A;  4EZ6 A;  1R0B G;  2PFF B;  2ZH9 A;  3MEK A;  3IWX A;  3OFE A;  3QZ8 A;  2VG6 A;  5E5N A;  4J7C A;  4DZD A;  2V94 A;  2YKQ A;  3MR2 A;  1UVM A;  3VGV A;  4JI0 F;  2JEF A;  1ZTW A;  1VMB A;  4UOF A;  3W3S A;  3CC7 S;  2FHK A;  2XYG B;  1J5E F;  2MLX A;  3C6U A;  1K9M T;  4GKK J;  4CNZ A;  2FPH X;  4J9S A;  2Z2L A;  4E0D A;  4CP5 A;  3MCO A;  4C8Z A;  3MGJ A;  2OGU A;  1ZA2 B;  2IYG A;  3O44 A;  4OFZ A;  2DBB A;  4CO0 A;  4UOG A;  3AD8 C;  2HAF A;  3M30 A;  3QT7 A;  3DGP B;  1S6U A;  4I7F B;  2B4P A;  4R0J A;  4ZVF A;  3RZA A;  2J6U A;  2RU9 A;  3R2C J;  3FCW A;  1X7V A;  2CZV C;  4H4O A;  4EBC A;  2H65 B;  4DV4 F;  3EGW B;  5KFH A;  1WAC A;  3ENV A;  1HHS A;  1OY9 A;  4PQU A;  1TR0 A;  2EG2 A;  2OFG X;  4TLQ A;  1VK8 A;  1NZA A;  4IQX A;  2FY1 A;  4NAS A;  3RBD A;  3CWJ A;  2W7P A;  3QZ7 A;  2J7U A;  4Y2A A;  5HVF A;  5F8M A;  2CPZ A;  4EGL A;  3EX7 B;  1RYS A;  1N34 J;  4NLX A;  3AJ1 A;  2UVV A;  4NRT A;  4QWA A;  4EYH B;  4W92 B;  2KZZ A;  3OTB A;  1AFJ A;  2DH8 A;  2E1R A;  3M2R B;  3ENQ A;  1XIQ A;  2QLF B;  3GJQ B;  3M8Z A;  4NOH A;  1T03 B;  2NYH A;  3MCS A;  4L73 A;  1S12 A;  2ILZ A;  3KUE A;  2W4P A;  4OZ5 A;  4Y00 A;  3W9I A;  2HRT A;  2BA9 A;  2ZH7 A;  2KT2 A;  4M5H A;  4CO5 A;  5IOL A;  2FQQ B;  2KG0 A;  3H25 A;  2HG4 A;  3TAN A;  1Y9O A;  3DRP A;  1T05 B;  1FEE A;  3AXM A;  1H6K X;  4KC5 A;  4OYX A;  4EFA C;  4DV3 F;  2BDP A;  1KHV A;  4JYA F;  1AFI A;  1W2I A;  4DFK A;  2ZVI A;  1S1V A;  1FDN A;  3EZU A;  5DZ6 A;  1DBD A;  1RT5 A;  4LRB A;  2R8J A;  2CQD A;  4IFY B;  1OJ4 A;  3Q86 A;  2XQC A;  1KC8 T;  4JV2 A;  1FRK A;  3SYZ A;  1WDD A;  1GTH A;  4QIV A;  2KHD A;  2W2N P;  4B08 A;  1I51 B;  3ZNJ 1;  2QLB B;  2EFO A;  4KHP F;  3MM7 A;  1WG4 A;  5KT4 A;  1U6Z A;  1CQM A;  4YEA A;  1UP1 A;  1WI6 A;  4MK8 A;  4DS4 A;  1TUW A;  3ZZZ A;  4M1K A;  5AXN A;  4KPC A;  4QR0 A;  4PYD A;  3I82 A;  1X9M A;  3CCR S;  1XNR J;  5I42 B;  4FYY B;  4I6A A;  2Y9H A;  2DY9 A;  3H20 A;  2G0C A;  4DLE A;  2QL9 B;  2PO4 A;  5D6G A;  1UVK A;  2RF2 B;  1S72 S;  1RWW B;  2XS7 A;  2BAC A;  4QOT A;  2Z0G A;  2V2K A;  3QO9 B;  3A4T A;  2V8H A;  1JMT A;  3NOC A;  1C4A A;  5L39 A;  3O2I A;  3L7P A;  4MKA A;  1IR0 A;  3BGU A;  4B3M F;  3PV8 A;  1RWV B;  3DOK A;  5I3U B;  3HVR A;  1DTQ B;  1UJ6 A;  4KIA A;  4AL6 A;  2YPZ A;  2BJ8 A;  4DQR A;  3S1T A;  4J37 A;  2I5J A;  1FE0 A;  4RBT A;  4A46 A;  1Q8I A;  1VBK A;  3MZI A;  3W64 A;  3NOG A;  1U6F A;  4CTA B;  5BR8 F;  2HHH J;  3HX9 A;  5J2M A;  1SC4 B;  1BHN A;  2N82 B;  1H7W A;  4WWS A;  3G8T A;  3K0J A;  2LQ9 A;  2RRN A;  3HVT A;  4UZB A;  2IBK A;  4LF7 F;  1NCL A;  2PSZ A;  4C7Q A;  3TVK A;  4A8Y A;  1TL1 A;  2D7S A;  1Z2L A;  2VU5 A;  2YKA A;  2FZC B;  1S4F A;  2O01 C;  3CTR A;  3M6X A;  1CJT B;  3PEH A;  1MML A;  4JV1 A;  3OXG A;  5CH7 B;  2W2P P;  1U1O A;  2PEB A;  2CIM A;  2B5J B;  3K17 A;  3WX4 A;  2ZC3 A;  1NB7 A;  1LOU A;  4LUB A;  2XNQ A;  5DM7 Q;  1YGY A;  2HNY A;  4KRW A;  4P74 A;  1X0P A;  3MMB A;  4C8K A;  3KHG A;  3U27 A;  2HFS A;  4LF4 F;  3KUG A;  4BBY A;  1S1W B;  1NRK A;  5E0O A;  3R8Y A;  2V8G A;  2QGF B;  4LSN B;  1VHI A;  2OEM A;  3FEX B;  3DI6 A;  2MY8 A;  3MDF A;  1QVG R;  4IG3 B;  4BLG A;  5EWE A;  2KM8 B;  2V6A A;  3PO4 A;  4NZ6 A;  1TZ0 A;  4RNM A;  1Q78 A;  3G6E S;  1S6Q B;  5E7O B;  5KFR A;  2HLU A;  3D3B J;  4ZPD A;  2D69 A;  2XG8 A;  4DHV A;  1Q7Y T;  4QIE A;  3QT6 A;  1YK9 A;  3WHI A;  4TYA A;  2V4J B;  4OZL A;  2P9C A;  1RI7 A;  4Y2K A;  3FQK A;  3UDV A;  4Y2M A;  1OSD A;  2VKR A;  3GIJ A;  3BKF A;  1ARO P;  4F02 A;  4FS2 A;  1HW8 A;  3LF0 A;  3QIP A;  4F26 A;  2OHD A;  2H3E B;  2KHC A;  3N79 A;  5I3P A;  4ZCI A;  3J7Y U;  3HHE A;  4ICL B;  3AA8 A;  4X4P A;  2ALY B;  1O8B A;  1RSC A;  1U1P A;  2D3U A;  2KJV A;  4JI6 F;  2C22 A;  4LFA J;  1HL6 A;  4Y34 A;  5D4P A;  2F7V A;  3GQC A;  1D3W A;  2OD4 A;  1MLA A;  2L08 A;  5KFD A;  4CM0 A;  4YOE A;  1RT7 A;  4ZJL A;  2LXU A;  4HKQ A;  2ZHO A;  2P6S A;  2YH1 A;  4YP3 A;  2OKQ A;  1BQM A;  1DQ8 A;  1FTR A;  3PFO A;  5GAD U;  4DL2 A;  3V4I A;  1GX5 A;  2CQ4 A;  4B9V A;  4JB8 B;  2LVW A;  2E7X A;  1B0P A;  1SJ1 A;  2DIS A;  1MWZ A;  2X1G A;  2XMK A;  3MPY A;  3I9V 9;  4P2X A;  3VTI A;  2CQG A;  2HQI A;  4HHH A;  2DR8 A;  2HHV A;  4H4K A;  2HZC A;  5J1N A;  4DR7 F;  2YWE A;  1JLA B;  2B3T B;  2J8A A;  1YX2 A;  3FDS A;  5K9F A;  2YKO A;  1KLM A;  1MRO A;  4U6P A;  1Y3K A;  2J5A A;  2GMJ A;  2HBR B;  5DLG A;  4DQQ A;  2XHC A;  4B9M A;  4DF8 A;  1PYT A;  3EMT A;  3HD2 A;  1TKT B;  3R5J B;  3UVJ B;  5A2Q U;  3OLB A;  3OL9 A;  1G2E A;  1KVI A;  4J9R A;  1CJK A;  3TJA A;  2AGP A;  1X0F A;  2FYX A;  4RW7 B;  4X4T A;  2XSJ B;  4URS A;  1X5O A;  3M6V A;  4HT5 A;  3Q8P B;  1IR2 A;  1RWK B;  4HI1 A;  1MW7 A;  1WSR A;  1GXL A;  1FRJ A;  3JTP A;  2GIR A;  1ZM9 A;  2K2P A;  4LFB J;  3OVS A;  2CQP A;  4G3I A;  3PX4 A;  5E3C A;  4UQT A;  3NNA A;  1IKW B;  4I6W A;  4ZLP A;  1Q82 T;  4F0K A;  2V4Q A;  3RTV A;  5ETQ A;  1UET A;  1S1W A;  2G2Z A;  2XCP A;  2DNY A;  2R9L A;  3GG1 A;  1YJW S;  1CJU B;  3TI0 A;  2KFN A;  1CJV B;  4UQG A;  3GIL A;  1CC8 A;  2XZD B;  4DZ6 A;  2WW4 A;  4OL8 A;  1D8Y A;  3DLG B; 
#chains in the Genus database with same CATH homology
 4OYW A;  4OYM A;  1CJT A;  3MAA A;  4WPA A;  4WP8 A;  4OZ2 A;  3MAA B;  5IV3 A;  4CM2 A;  4WP9 A;  3C14 B;  2GVD A;  4NI2 A;  4P2F A;  1TL7 A;  3C15 A;  5IV4 A;  3G82 B;  1U0H A;  3ET6 A;  4OYP A;  1YBU A;  1CJT B;  1WC0 A;  1WC6 A;  5D0R A;  4CLL A;  4P2M A;  1CJV A;  4CLY A;  1CS4 B;  2GVZ B;  1CS4 A;  1FX2 A;  3MR7 A;  1WC5 A;  4OYO A;  4CLS A;  4USW A;  1AB8 A;  3R5G A;  1YK9 A;  5D15 A;  1CUL A;  1WC3 A;  4CLF A;  3UVJ A;  1FX4 A;  2GVD B;  3C16 B;  4CLK A;  2BW7 A;  1AZS B;  4CLP A;  1TL7 B;  3C15 B;  4NI2 B;  4UST A;  4CM0 A;  1YBT A;  2QV6 A;  4USV A;  1CJU A;  4OYA A;  4P2X A;  5D0G A;  1WC4 A;  4OYB A;  2WZ1 A;  4OYX A;  1Y11 A;  1AZS A;  4OYI A;  3C16 A;  3UVJ B;  1WC1 A;  1CJK A;  1CUL B;  2GVZ A;  4OYZ A;  2W01 A;  4OZ3 A;  4WP3 A;  5D0H A;  4CLW A;  1U0H B;  3ET6 B;  1CJK B;  3G82 A;  4CLZ A;  1CJU B;  1CJV B;  4CLT A;  5D0E A;  4CLU A;  4USU A;  1Y10 A;  3C14 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...