1CJKB

Complex of gs-alpha with the catalytic domains of mammalian adenylyl cyclase: complex with adenosine 5'-(alpha thio)-triphosphate (rp), mg, and mn
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
201
structure length
190
Chain Sequence
LYHQSYDCVCVMFASIPDFKEFYTESDVNKEGLECLRLLNEIIADFDDLLSKPKFSGVEKIKTIGSTYMAATGLSARQYMHIGTMVEFAYALVGKLDAINKHSFNDFKLRVGINHGPVIAGVIGAQKPQYDIWGNTVNVASRMDSTGVLDKIQVTEETSLILQTLGYTCTCRGIINVKGKGDLKTYFVNT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ADENYLATE CYCLASE, TYPE V
publication title Two-metal-Ion catalysis in adenylyl cyclase.
pubmed doi rcsb
source organism Canis lupus familiaris
molecule tags Lyase/lyase/signaling protein
total genus 59
structure length 190
sequence length 201
ec nomenclature ec 4.6.1.1: Adenylate cyclase.
pdb deposition date 1999-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00211 Guanylate_cyc Adenylate and Guanylate cyclase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1230 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleotide cyclase 1cjkB00
3C14A 4OYOA 1CULB 1TL7B 1CJVA 1WC1A 4USVA 4OYMA 4CM0A 4OYZA 1CULA 1TL7A 1WC3A 2GVZB 4WP9A 4OYIA 1FX2A 3C15B 4OZ2A 2WZ1A 2GVZA 1AZSB 3G82B 4CLPA 3C15A 1AZSA 4CLLA 1CJTB 4CLYA 4CLZA 5D0RA 1AB8A 4CLKA 1YK9A 5IV3A 4P2MA 3MR7A 1CJUB 2GVDB 3UVJB 5D15A 1Y11A 3MAAB 4OYPA 1CJUA 2GVDA 5D0HA 1WC4A 4NI2B 3UVJA 3MAAA 4CLSA 1U0HB 2QV6A 3G82A 5D0EA 3C16B 4P2FA 1CJKB 4OZ3A 4OYAA 4USTA 4CLTA 1CJTA 4CLUA 1U0HA 3C14B 3C16A 1CJKA 1WC6A 4CLFA 4P2XA 4OYBA 1WC0A 1YBTA 3ET6B 4CM2A 4WP3A 5IV4A 4CLWA 4OYWA 3ET6A 4OYXA 3R5GA 5D0GA 1FX4A 4NI2A 4USUA 4USWA 1CS4B 1WC5A 2W01A 4WP8A 1CJVB 4WPAA 2BW7A 1Y10A 1YBUA 1CS4A
chains in the Genus database with same CATH superfamily
3Q8VA 3QLHA 4ZHRB 4GO7X 2ZEJA 4NCBA 3UDCA 2CVIA 4RLEA 2B56A 3R5AA 3I31A 5M2UA 2EVZA 1S5ZA 2JX2A 3MCOA 4GMKA 4JI3F 4OX7A 3MI7X 4CQ1A 1EIYB 3BO3A 3D6FB 2VG7B 3SSSA 3I5AA 1H73A 3THTA 1D3WA 3CCZA 4J90A 1ZM9A 2JEGA 4C11B 4RW9A 1DFDA 2W2NP 1W7WA 3ENWA 1HWUA 3KG0A 4NLGA 2B7CB 2ZKTA 4NRTA 2YNFB 2YKPA 5JXSA 3DLKB 1GT8A 1HQEB 3CJRA 3TZXA 5IC4B 2VF3A 4QU7A 1UVJA 4DX6A 4C8YA 2PD1A 3IR7B 4O3NA 4Q2MA 4ED8A 5DM7Q 1IKWA 4EMDA 2MJNA 4DLGA 2B7BB 3US5A 1T94A 4X66J 2FJWA 2IRYA 5LOQA 5H9EK 1VHFA 4DUTA 1U47A 5K8NA 1RHUB 3FSIA 4DL6A 1JLCA 2W9BA 3CJKB 3SCKE 2CNOB 2WBRA 2IVFB 2HK2A 1XERA 2HHQA 4DSLA 4CP5A 4IH5A 1RU1A 3A8KA 2Z8QA 4OZNA 1DARA 4PPZA 3FBCA 3UFCX 3SQGB 5HLFB 1Y11A 2RHQB 2AJ4A 2R7OA 4Y28C 4WK1A 2LA4A 4O3PA 4G1QB 1VQKS 3EXCX 2CQBA 4KQZA 5FJ4A 2MY8A 3S8SA 4I2QA 5KFLA 2FJXA 4K4TA 3BB5A 3K0JA 2P2CB 4PWUA 1S1WB 1GMUA 4ZLPA 3ET6B 3H90A 3ONQA 2N7CA 1YRTA 1EJ7L 2JEIA 5C2CA 4QIFA 4BLGA 5L38A 4ZK7M 5IZHA 1WOOA 2YVSA 3IFEA 1XWLA 1HNZF 2XMMA 1PYSB 1CS4B 3GONA 5J1NA 3T3FA 2VQEJ 2RMLA 3F73A 2N3OA 1MWQA 2IYGA 3POTA 3GPAA 4HDHA 1X0FA 4CM0A 1OY6A 1TL7A 2J9CA 1HYSB 3D3BJ 2CQCA 1ZTWA 4QWEA 2ZE2B 2FLLA 2MKKA 5E41A 4FNIA 2EFVA 5DQHA 2V8VA 3C46A 3TI0A 2LEAA 1S6QB 3OFGA 3I0RB 2GVDB 1UCNA 3VAMA 2O5DA 3WIVA 4X4QA 4LRBA 4N56A 4DR3J 1URRA 1OY8A 3LH2S 2WSCC 4O44B 1WACA 3PFEA 3UR0A 1U45A 2DNLA 5D78A 2EFPA 4M8LA 1RWVB 4DZ6A 3OSPA 3N6MA 4J91A 4P2XA 4LFBF 2R2SA 2CZVC 3G6ES 3RJMB 2E7XA 9ATCB 4A8SA 4B9UA 3H5SA 3CJ0A 1SUQB 2R7WA 4WFBQ 3M30A 3JSBA 1H3DA 3UR3C 3DHXA 1RT3B 3ISND 1HNXF 4KH0B 1T9YA 3NG8A 5KFVA 4KY3A 3D6MB 3R2DJ 3I6PA 2DIVA 3CD6S 2KO1A 1NJWA 2I38A 1NDKA 3VZHA 2VPWB 1L3KA 2LFVA 3DRYA 3MM7B 5K8MA 5DG8A 2F63A 2K1RA 4F04B 2YKMB 1TVRB 2WB4A 2HGMA 1SC3B 9RUBA 3GIJA 1ZS6A 1Z1ZA 4M5IA 1I3OB 1UA0A 1S57A 3BGOP 1VJQA 3EGVA 4CLUA 1U0HA 4XTTA 2HFVA 3J7Z5 2H5IB 1VQYA 2FTRA 1NO8A 3GFHA 3UNYA 4XDCA 5HVGA 3QWPA 4V19X 4P72A 3KJVA 1UJ4A 5HMYA 3WIUA 4HDGA 3G87A 2J0SD 1TAQA 3G96A 2MGZB 1S76D 1C1BB 4ICLB 1NSAA 3R6GB 3TOQA 4IRCA 1X0PA 1UAWA 1FDDA 1QUVA 4X2BA 3DLJA 3EVOA 2D9PA 4X4TA 4QWDA 1S0OA 1OJ4A 4DFJA 1N33F 1RACB 2DO4A 1LW2B 2L08A 2FHJD 2GJ2A 4NA2A 1H2VZ 3MCSA 4MKYA 1TELA 5A6PA 2DH7A 1BXNA 3B78A 4OYPA 3VQSA 5DG7A 4ZVTB 3M1VA 3AFGA 2OUGA 3MPWA 3V4MA 5JMNA 1DTTA 3GYGA 4P73A 3MFHA 4F2SA 4LRDA 2UVRA 3TAPA 2O1PA 4LF7J 2NPFA 1UWAA 1U6BA 1H74A 2JLEA 2XSFA 2XZWA 4HH0A 1IN0A 1FRLA 2HBYB 1DZ5A 4A8QA 4RU2A 4ZKAA 3OR1A 2ATCB 2CJBA 2GVZB 2L9DA 1URNA 4C48A 2VHGA 2ZH8A 1U48A 3W7BA 4M5MA 1M0SA 2EC0A 2W7PA 2Y0BB 4X62J 2BXJA 2BOAA 4JI5F 4NZ6A 5A8KA 2HLTA 4DR6J 2KM8C 2F8HA 1KQGB 3GCWP 1WKJA 4PG7A 3R97A 2ZWOA 3KNAA 1UPMB 2XTJP 1Z2ZA 3PO5A 2QLXA 1FTCA 2ZDPA 4NRUA 4FF2A 1N6QA 3HJFA 1R7IA 3TX8A 3CCLS 3CDAA 4A8YA 5B7WA 2GO8A 1N36F 5D8HB 3SV3A 2HRUA 3PEJA 3MM8A 4DBQA 2OKQA 1CJKA 3TARA 2BV3A 2ZC4A 3IBFB 1G3OA 2RRAA 4QJVA 1VQ6S 4IR9A 4IDKA 1R8HA 1WHWA 3QIPA 1FXLA 4RNMA 2L3MA 4MH8A 4Q7AA 3GYXB 3QRRA 3SBMA 2J6UA 3CXCR 4JP8A 4WK3A 4DV0J 3BEGB 2MQNA 3LP2B 2GFFA 2QFJA 1F0XA 3MEGA 2DGUA 2Z56B 5IS2A 3QO9A 3GIIA 2HMIA 1U26A 3BO2A 4OZ5A 4NLOA 5M2RA 2OIHA 5FD1A 1YQHA 2V63A 4OLOA 4TKTA 4RW6A 2R8KA 2YWWA 3SFGA 3RB6A 5BR8J 3BDPA 3CJTA 1F1BB 4J9OA 4TYAA 1LWFB 1HR0F 5IQQA 2V50A 1SIZA 3UVJB 5ETRA 5GAEI 1SPBP 2OP5A 2Y0SD 4OI0A 1XTZA 4DQQA 4OHWA 1HHSA 3W9HA 2EXUA 3PRBA 4U9RA 1CJTA 3BV8A 2MZJA 1FA0A 4GRSA 2BKPA 1PGZA 4WP3A 4HVZA 2GJFA 3A13A 3O6QA 5ETQA 3HHLA 5IT4A 1X4EA 2HZCA 5HJYA 3I4PA 1P1TA 5H1SV 4RJVA 3QT5A 1NMEB 3T6BA 3CC7S 1K0VA 5HVFA 4JV2A 2GGPB 1BQMB 3O44A 1AROP 4TQSA 2OTJS 1Y3KA 2EK6A 4WKRA 3ENAA 4YR0A 2H9ZA 1WHYA 2WZ1A 1R6YA 2LDYA 2APOA 3KMSA 5LJ5Y 4P10A 1KS2A 3ADAC 2M0GB 1HHQA 1FDNA 3PXGa 2X1FA 4TVAB 3E2EA 4V19J 3ILLA 2ZKUA 3R3TA 1JNZB 4YHHF 3VZIA 1WC4A 5BYQA 1LKZA 2YPZA 3HVTB 4KRWA 2YQ3A 2FIUA 1EP4B 2DNYA 2W2PP 3BYPA 5LMUJ 3FVYA 3IS9A 3N4WA 3UO0A 1GAOA 1QM9A 3OFEA 1RT2A 1X31C 3TAQA 2HFOA 3D0IE 4CDIA 1U49A 2E5LJ 2V4JB 3MM5A 5J2PA 1VOMA 4OJHA 2VFVA 3LPEA 2ZJQQ 2QA4S 3RB0A 2CADA 4LF9F 4JI0F 4J9NA 3BGFA 4EZ9A 3BKUA 3IG1A 4LSNB 3NL0A 4K4ZA 1SKWA 1EETB 2BJDA 4TYBA 1VIXA 1KC8T 2BACA 4J9PA 2I2YA 4JI1F 2E9ZA 2GA7A 3UCZP 2NYIA 1AB8A 1S1XA 3QT8A 3U27A 4UUXA 3G71S 1S1TB 3VTIA 1VQ9S 3C19A 5KG7A 5KFRA 2VFRA 3TNVA 3OHBA 1QTNB 3GV7B 2H51B 2D3OR 2MKJA 2R7TA 3PYEA 4OZ3A 4DN0A 3AOBA 3ZXWA 4Y2KA 4RO0A 5AXKA 3K89A 1F3VA 3PRVA 4CLFA 2ADBA 4YDDB 1DLOA 5KFEA 4YR3A 3OL9A 5L9XA 1U1QA 1NPKA 4Y0FA 1RTJA 1XEZA 2XBPA 3W8GA 1IM4A 2HHUA 3MR5A 5KOXA 3E3XA 1IKVB 2YWHA 3RBEA 4K4SA 2LQJA 2YKQA 4FVMA 2VC1A 2QLJB 4KGZB 2BOPA 4L74A 2C42A 4OYIA 1FF2A 5C7PA 2ERRA 3G86A 2LQ9A 1WWHA 1CQMA 1RLDA 2KVQE 4ZPCA 1VQ8S 1U24A 2H65B 3Q0AA 1MU2A 4IOCQ 1LFPA 4C3KA 4PG5A 1YK9A 2ZHOA 1YJVA 4J9LA 3PR4A 2BRKA 3B4DA 3I32A 3MMCB 1JLEB 1S1VB 2UUAJ 2CYYA 2AHOB 2M4MA 2DD8S 4YR2A 2KRRA 3NWGA 1ZBTA 2HW3A 1TTHB 5HVHA 1FRXA 2XMWA 1FWLA 3W3SA 4F2RA 4S0MA 1IBCB 1U02A 1UETA 1YBTA 3VAJA 2N4DA 4DV5F 3JQKA 3R2CJ 1A9NB 2NR0A 2KDOA 1ZPWX 2YKOA 1DQ9A 4QQBA 2GIQA 2HIYA 5F8MA 1Q4RA 2X3GA 2ZITA 3M8SA 2DY1A 3CD7A 2XNRA 3RBDA 1NJYA 4DHVA 3IXQA 1RT5A 1VDHA 4B3RJ 1VISA 3M8YA 4WTOB 4HEA9 3KLHA 4QIEA 2VC0A 2X1BA 5CABA 5ETPA 2PSZA 2CQ1A 1UP1A 1FTRA 2UUBF 5D0RA 1S10A 3Q89A 3MPUB 4LF6J 2VASA 2CXEA 4ILRA 2PE8A 4D3GA 4P2SA 4OX9F 5F0WA 3KJQB 3HULA 3GE9A 1VQOS 1GMWA 5F41A 1TMMA 1LNQA 2XWYA 2IC3A 4CLSA 1RA7A 4LF4F 1RHKB 2QSWA 1NH8A 4K4VA 4ECYA 4DPWA 1IUJA 4UZCA 3AQPA 4OV1A 3C6UA 2KG1A 3A8EA 4ZVOB 2AX1A 4O0IA 3C8YA 4ZIWA 2KT2A 3LUYA 2ZWPA 3IRXA 4F25A 4DQSA 1U2FA 5BYSA 1FX4A 1XK8A 4F7VA 1GMVA 4LF8F 3GB0A 2BKNA 1ZM3A 4W98A 2J7KA 4WF9Q 2CDQA 1S1UB 3DLHA 1J2VA 1X8DA 5GADI 2PN6A 4D3HA 1RYSA 4K50A 4NOHA 3MCMA 1S9GA 3OVAA 2BANB 2PA8D 2QMWA 5DDRC 4IYQA 2HGLA 2MMYA 2BW2A 1IBKF 4UY85 2LVWA 2B9EA 1TUVA 3PYFA 3N0VA 5F9NA 4GKKF 2B4VA 3UD4P 4DV1F 4P2MA 4DV7J 1ELOA 4AXJA 1F5AA 1FK9A 5ETTA 4I7FA 4G1IA 1D8ZA 3IBCB 1VI7A 1UW9A 2HBQB 3RG6A 2FJAB 2FVRA 1P1LA 1FRKA 3DYAA 5CCLA 1Y5LB 1VLYA 2VOPA 4ED5A 3QJLA 1RT6A 4RUCA 5GMDA 4BS2A 3S6EA 2IJNA 1IBMF 4KKOB 1PO6A 2B6AA 4JV5F 4UTGA 1GH8A 1JKHB 4DUZJ 3VGUA 2VV5A 1NCLA 3R5DA 1BQXA 1YTYA 2G0IA 4DWIA 4PUOB 2Y1JA 4I6AA 2K3IA 2AGPA 1YJWS 3DOMA 2KZMA 2WB1D 4H54A 3B8HA 2NPIA 1AYEA 2DISA 5A8WB 1WKKA 4C4WA 4YN3B 4J9RA 1G4CA 1YKWA 1GXLA 2BE2A 2KYZA 5IV3A 4PAAA 1H72C 4M5HA 2DRDA 3ZZRA 3HZGA 4JV1A 4ZVQB 2KH9A 3PVXA 2FJBB 2P9CA 5F3ZA 3V2UC 2VQFF 2DPIA 4AT1B 2DGXA 3IM8A 3NS5A 2W4PA 1PJ7A 2BJ9A 3LQVA 2JEJA 1WORA 1L3SA 4YEAA 5SZTA 3N6LA 1C1CA 3T1HJ 4K59A 3DDIA 3CDBA 1JQGA 1TL1A 1FERA 2F1FA 3HP6A 2MXYA 2B51A 4PWDB 4I0WA 4C3LA 1Y10A 2R2RA 1WOPA 7AT1B 3DGPB 1UVLA 1UWBB 2E1PA 2VPYB 1UFWA 1NSQA 4Q8EA 2FC8A 2OELA 3DOKA 2AYEA 3GG0A 3PZPA 1QVGR 2J0WA 3FBFA 3M6UA 1WKLA 4OJ3A 5C2GA 2RKIA 4OZ1A 3ZZTA 3IM9A 3BJYA 3TX0A 3PR5B 3S7RA 4AQYJ 4WTYA 2KJVA 1NK4A 1DJ0A 3W5YA 3GILA 1U1OA 1JLBB 1GNKA 3TVZA 4JV0A 4OHXA 2EFNA 1N5QA 2YX1A 5L39A 3DRPA 1OPZA 3W64A 3PO4A 4RBVA 1Y0HA 3LP0A 2FY1A 2RDJA 2AJ1A 4CH0S 4CYUB 1Q8KA 2MSSA 1CVJA 4EO6A 2R42A 3A4TA 1IJEB 3VWSA 2XB2D 4DL3A 2EEYA 1FJEB 1CJVA 3EGWB 5EGYA 4WE1B 1WDTA 3VAIA 1BWEA 1M5OC 3J7YU 1NDPA 5MAOA 3CCUS 2W24A 1VHIA 3Q8YA 5GMKa 1T03B 2W4CA 1CJTB 3C2PA 3SSRA 3U02A 3CT9A 3P49B 3CJSA 4R0EA 3EJMA 4GKJF 1BQNB 4CO1A 1X60A 2A6OA 4NXMF 3BPSP 2JNJA 2RU3A 1S6PB 4PG4A 2JWNA 4QIWD 2UU9F 1NSPA 3W62A 3O5TB 3I56S 1PC5A 3MURP 1HW8A 1YZ7A 3VGVA 2C3MA 4EYHB 4ED3A 3SFUA 4Y6IA 2JJ4D 2AT1B 3MOJB 2KU7A 3A1YG 4XIUA 2XGPA 1XMQJ 2DNPA 2XO6A 3DDNA 1VGYA 1PC4A 3RW6A 3HHLD 4HYKA 1RCXB 4WCEQ 2Z2ZA 4UF4A 2LU2A 3SCLE 3PJXA 4NLTA 4Q45A 3MMBB 3H2LA 5CYMA 4F0MA 1WTBA 3NGRA 2V5HG 2ZVSA 2HNZA 1DTQA 2HVEA 2YKAA 4ZDNA 3SCJE 3T1AA 3Q22A 4A8OA 4ECQA 5H9FJ 2CWKA 2L9WA 5F8IA 4LR7A 3BYRA 1TR0A 2HNDA 2H3EB 3KLGB 4CRJA 5CQGA 4DSJA 5KFPA 5D3GA 3CO9A 3R7NB 3EVMA 5B0EA 3IS9B 3AB4B 1NJZA 4NCGB 3GZ7A 3QYYA 2YNIB 3PTWA 5EWFA 4Q0BA 5AJ3F 2JFDA 3ITHB 3FFIA 3PKYA 2LXUA 3UCUP 2LA6A 5DRKA 1VK3A 1RQ0A 3C6TA 2BDPA 4FS2A 2IMOA 3W2WB 3BR9A 2HPUA 3UN3A 2CQ3A 1VYAA 2DGQA 5D6GA 2WBMA 4RBTA 2CJQA 4A8MP 4LF1A 3GSDA 2EW9A 3JAMY 4DU8A 3PNIA 4I69A 3OFFA 2MKSA 3V4IB 3OTBA 5CA5A 1SV5A 1I94F 3G2XA 1N5YA 4KFBB 3BH7B 2LEPA 3MM6B 1RT1A 4LFCJ 3TZWA 1SL0A 2BQUA 2DNMA 3V81B 4U7UD 2AWZA 4F02A 4HLBA 3BSNA 1T0TV 1JLQA 3CE8A 3D3CJ 2RQ4A 3CD5A 5F0UA 4QR1A 3PG9A 1IM6A 3NXZA 2B4OA 3MAAA 4WFAQ 2Z2LA 2HZVA 3C16B 1C2PA 4UY8T 1TK5A 1XIQA 3BN4A 4RNHA 3FBEA 5DM6Q 4U7CA 1MG7A 5BYRA 4N7TA 4BHQA 3SYZA 2MYFA 2HVDA 3I5BA 1VMBA 1B64A 2WVDA 4LSLA 2BJEA 2DVIA 4IG3B 3MZIA 2W1BA 1EZZB 2WSEC 4N41A 4C9DA 1N48A 3KHRA 1ZM4A 2GNKA 1H6KX 1VCTA 1N32J 3DM2A 4TQRA 1YVFA 2CPYA 4DV4F 2R8JA 4ERDA 4P7TA 1TKXB 3TJAA 3U1MA 4QW8A 4IRKA 4NYPA 4TU7A 4ECSA 3KDNA 1C0TB 4PXCA 4U8VA 3CCVS 3IP0A 2DYAA 1XBWA 3AB2B 2CQIA 4X84A 5HSPA 4PYDA 2VD3A 2IIHA 4OV6A 2UZAA 4PXBA 4CTAB 1CQNA 5I3PA 4U8YA 1XNQJ 3THVA 1S79A 5HROB 1JX4A 4PR6A 1HNIA 3EDQB 1Q53A 3TR5A 4CH7A 1HWJA 4EBCA 3GU0A 5J2NA 5L8RC 3QFWA 2VBXA 3DHWC 3CCSS 2RDIA 4HI2A 1DY3A 1M5KC 2VFTA 2BJ3A 2XSJA 4J9SA 2UXDJ 1C0UA 3MFIA 2RD5C 5ETSA 1TZ0A 4F67A 2IM2A 3IBWA 2PGCA 3AODA 1GMWD 3IRXB 5KG0A 1RTIB 5CZXA 1HBNA 1TKTA 2DCLA 3MEEA 1ITPA 5IT0A 3CJ5A 1H2UX 1TKZA 4J5OA 2XI2A 3QAEA 3NCPA 3V6HA 4OYAA 3MHYA 3HFKA 3EZOA 1RU2A 5IXUA 3DRSA 1RTDB 2B3TB 2E9TA 3G9CA 3M8QB 5H9FK 4NLXA 3QGIA 2AV5A 3CPWR 3GJRB 1RJJA 2EWHA 1WF0A 3JYTB 1S0MA 1FFGB 2JRSA 2FJDB 1I5OB 4URSA 5KT6A 3C14A 2KRBA 3VVTA 1HKAA 4CO4A 5BJRA 1FNMA 1NZAA 1RAJA 4ZHRA 1PYOB 2V8DA 4I7FB 3C15B 4DL0C 3P3DA 4RU9A 4LFAJ 4ZPDA 5LMNF 2AKWB 1VC5A 4TY8B 4DG1B 3W63A 2VG7A 1TL5A 4KV8B 4N8NA 1XJWB 1QVFR 3CJ3A 5KT3A 5L46A 4UT4A 2UUTA 4C11A 1RT6B 4N5SA 1NLKL 3CO0P 4C8LA 1E6YB 3MECB 3T6JA 1ULRA 2YWFA 2GW8A 2VDIA 4FYWB 1BLUA 3IWXA 5HK4A 2E66A 4DDFA 2YNFA 1J5EJ 1JLFB 5LJ3Y 3DLKA 4RZRA 4CO5A 5D4PA 1FNOA 4LJMA 4B3MJ 2DXDA 2KXHA 2WOMB 2YNGB 3CJ8A 2VFUA 1HQEA 1NNDA 3ENQA 3MWBA 3TRGA 1AA1B 4NI2A 4USUA 3Q8RB 2HS4A 3K17A 3CJ4A 2H1YA 3KUGA 2BE9B 3TQ1A 2QLFB 2XS7A 2OH2A 4EGLA 1W25A 3J81j 2D9OA 3AA9A 3EVWA 1SKRA 4ZVFA 4QCLA 4FYVB 1UZDA 3QNWB 2HAFA 2HHHF 2DCUB 3CJKA 1KWMA 1UJ6A 5D77A 4ZLJA 3OL7A 1NKEA 3EUNA 8ATCB 2UVWA 4X65J 1B0TA 4NX9A 1NUEA 2HBRB 1JMTA 4ED7A 4F4AA 2BEFA 3SQGA 1RAOA 5HLFA 3I4HX 1VRUB 1RHJB 3DLEB 3NAHA 4G1QA 1L3TA 3M6WA 4NXNF 4I6YA 1UEVA 4JI2F 2VBWA 1S1WA 3ET6A 4DR1J 5KFNA 3DOKB 3AY0A 5B0FA 3IRWP 4JYAJ 3BM7A 5C25B 1WHXA 1X4FA 2BUNA 1CS4A 1RBLA 3JTNA 3M2RB 2ASDA 2RNEA 2GMJA 4IQXA 3R5BA 1V3SA 3FCVA 1ZYQA 3DLBA 2H5JB 2XHCA 4I2PB 1ZZNA 1HYSA 2F3JA 2IBOA 4DS4A 4WFYA 3ZFVA 4LT6A 3ZC4A 4ECXA 2ZE2A 2Q3PA 4WZQA 2GAHC 3LTOA 2OAUA 1S6QA 2V2VA 3I0RA 2GVDA 5D0HA 3T19A 3MTJA 2XO7A 1RAHB 2AMCB 2V4QA 3K5NA 4O44A 2Y1LB 1U6FA 4QPXA 4M5DB 1D0EA 1S0VA 2XLKA 4C0BA 1IKXB 1S97A 4LBIA 1LW0B 2RRNA 4Z7YA 3FRZA 2DO0A 1EQ0A 3QPIA 4TU8A 2KN4A 3CUNA 1U25A 3EICA 4KH1B 1CULB 4X66F 1NHUA 3AAWB 1SUQA 2HNYB 4G3IA 4USVA 2HK3A 2GQQA 1RT7B 3BPDA 1YBAA 2ZOFA 3KUEA 4Q43A 4IKAA 3KG1A 1RK8A 5A76A 1RT3A 1F2GA 2COLA 4J9KA 5IT9Y 1SJFA 4ZJOA 5E3QA 1ZM2A 2CJXB 1FRJA 3OVBA 1NZ8A 2I6WA 3K5MA 3G8SA 1RUSA 3MM7A 2B8QA 2M9KA 2A2DA 1RT4B 2W9CB 2X3DA 2V34A 2XMAA 2HAIA 3NNCA 2YKMA 2PEBA 3HHKA 1TVRA 2DKOB 2ZJPQ 2ZBRA 1S0NA 1X4AA 1FT8A 5B0GA 4NLUA 1RHQB 4H4KC 5GAEU 3TEHB 3NMAA 5A0YB 2J9EA 2I9SA 1T8EA 4Q8FA 1KVJA 4Y34A 1JK9B 2VIHA 1M90T 1FXDA 4UOCA 5HMZA 3SIPB 4RPFA 2VQEF 2MGZA 5KFOA 1C1BA 4ICLA 4RWWA 4O3OA 4FKXA 5DLGA 2FQQB 1WF2A 5ETNA 5KFFA 5EX3A 5ETVA 5EX0A 2WAQD 2HEKA 3IGVA 1CC8A 1OIAA 4FP9A 3GFYA 4UW2A 5BXIA 4OZLA 1N54B 4ZVGA 4Q0BB 2DR5A 3VAFA 1EQMA 3HVAA 4DSKA 4X4PA 4DCOB 1Y5NB 4ZP6A 4EI2A 4DR7J 3L9ZA 1HWKA 5DZ7A 1LW2A 5HAOA 2XZDB 4NLVA 5JUMA 2HWHA 2DHAA 3TUJC 4DR3F 3G82A 2R7VA 5KG6A 4L3NA 2V8PA 2KI2A 2IRXA 2G1DA 2OO4A 5I3UA 2FVQA 1KLMB 3M8PB 1TUGB 4HHUA 2I8EA 5I42B 1RWUA 2R2TA 1P9YA 1T95A 3PX0A 4LR8A 2F7VA 3CIZA 3HJVA 2UUCJ 2ASYA 2HHWA 4C7QA 3J81Y 3FQKA 1HPZB 2CQHA 3HT3A 1LK5A 2R4FA 1NPRA 1ZH5A 2NXEA 3JAMU 3CMES 3BR8A 3CDWA 1TMJA 2GVZA 2FVCA 2NSCA 4QR0A 1GEHA 3PHTA 5D4LA 5G4DA 2HQ3A 1HQUB 1N8RT 4ED2A 3QJPA 3G6VA 4N77A 2XQCA 2GIRA 3N79A 3DGVA 4USIA 3CCRS 3BKFA 3JTOA 3B6BA 4EU0A 3UI3A 4QR2A 5EWEA 4R5PA 4DFPA 2OD4A 4A8XA 1MN9A 4ZPTR 4LQ3A 5KT2A 2OPQB 4YY3F 1TL3B 2IBKA 2Z2MA 4M5NA 3TWZA 2LXIA 2U2FA 1F5CA 4H4MB 5KT5A 1Q1KA 5IM0B 2DNGA 2UP1A 3MR6A 2ZC3A 4BWMA 3WX4A 5KFTA 1J5OB 4PG8A 4DL4A 3NP5A 1BMQB 3BZQA 1QD1A 4HT5A 4X4OA 3E51A 1NJIT 4KAIA 4KPYA 4DPTA 2V2KA 1RXOB 2F5GA 3AJDA 2VBZA 1Y9OA 1UFKA 1H0HB 2VA2A 1HI1A 1RLCL 3LP2A 2CA9A 3WC0A 2DK2A 1RWWB 2V68A 2FC9A 2OEKA 4M5GA 5HP1B 2CQPA 1REVB 2XLIA 2AJFE 4CLZA 2K06A 2PEHA 2QC3A 3M9MB 2YX7A 2UVVA 2QL9B 3EPIA 4NLSA 5CYJA 1FWPA 1DBDA 1SXLA 3P8BB 1LWFA 2OD6A 2MQMA 2HHPA 3UVJA 4KHPJ 4PPDA 1PIEA 4MKBA 4ED1A 4DU7A 4WBFA 4CT8A 3QWUA 2RQCA 3PW5A 1HMVB 2UUWA 2K7JA 3MCNA 1ZPVA 3LA0A 2AD9A 1PYTA 2IM3A 3VAKA 3R1HA 4Z7CA 2CPFA 2FDNA 4IFVB 2HKEA 2NXCA 1HIYA 2DJWA 2BJ7A 5KFUA 4JOUA 1NHKL 3UPFA 2QMXA 1UEUA 4O23A 4OHVA 1OYEA 4BC9A 1FNXH 2L41A 1FVSA 1FDBA 2DNQA 4OYOA 3A3NB 2J8AA 2KFYA 2GGPA 1ACMB 5CH7B 3NMRA 4C3MA 3HLUA 2QA4G 3TEGA 4XO0A 1HBUB 4X62F 3MPVA 3R5JB 2M88A 3CIMA 3IWLA 5GAHI 4V1Ak 3BBFA 3W61A 4HKQA 4KHRA 1T3NA 4I67A 1RZMA 1ZOTA 2R3VA 1FKPB 1TKDA 1WD6A 2H48B 4H4OB 5LSOA 3JS9A 2AJ0A 2DITA 2V2QA 3C14B 1SJQA 4MKAA 2HG4A 3TVYA 2CFXA 1EP4A 4ELTA 4LBPA 3HVRA 4YDXA 5DDOC 4L76A 3D9BA 4GC6A 1B3TA 5L1IA 2IMWP 3OR2B 1ZAVA 3HDSA 3G4SS 4B9SA 1NKBA 1NM2A 1VQNS 1M5HA 2V4JA 4DV0F 3GP9A 3CB4A 5DDQC 4ZIVA 2ILYA 4OYZA 1VQSA 4CZCA 3KK3B 3W1YC 5DJBA 4JUZA 3DI6A 4C6AA 2FB0A 4LSNA 3A12A 2XCAA 1EETA 4JI4F 1SI9A 2CZ9A 4OHZA 4QU6A 5BR8F 5GADU 2XG8A 3TUIC 1P9QC 3TZYA 3I0SB 2H4WB 1S1TA 4FVCA 3NWRA 3R6LB 2QYGA 3H2UB 4NI2B 4IH6A 1YJRA 3TQEA 1LEOA 3LWLA 3CC2S 2IM1A 5DLFA 1PCAA 2FYXA 3KLEB 3S01A 5E2QA 2EFOA 2QG9B 3KLIB 3QFHA 2ZH4A 4FXWA 3IWNC 1SJRA 3KXDA 1KBRA 2FPHX 2Q6CA 4I64A 5C24A 2D3UA 2V69A 4HACB 4DR2J 1VRQC 3OTOJ 1X4CA 2BJ8A 2W7OA 1Q5VA 3HFZB 1NK6A 4PKDB 3PJWA 2QSFA 2Y1RI 1IKVA 3ICLA 5GAGI 2DY9A 4C0HA 3MUTP 1TV6B 3BQ0A 1R0BG 3ETOA 2DH9A 2GS8A 2K2PA 2C3YA 3PACA 1FX2A 3RBXA 6FD1A 4K8RA 2FY8A 2ZOGA 3W2VB 4FYDA 3PW2A 4DV6J 2JFKA 4RR5A 4AXIA 3AXMA 2IYIA 2ALYB 1S9EB 3RAQA 4TLRA 2D3ZA 1KQSR 2ABYA 1FHTA 1B0PA 3MMCA 1JLEA 1SIWB 2CJ9A 2HRYA 1S1VA 3D1HA 1MROB 5C42B 2DNKA 2QMUB 2RB7A 4DSIA 1FFWB 4F4KA 3AXKA 4ECRA 2YKNB 2ZFHA 5LMUF 4C8MA 3OBIA 3KDOA 1BGXT 1U8WA 4X4SA 4USWA 2E5LF 3DLGB 2AZ3A 1KVKA 3P45B 4NCAA 4RBUA 1XNRJ 8AT1B 4JI8J 2Q79A 3ZTRA 1VBYA 2LXFA 2MQQA 3ILOA 4R0JA 4KYZA 3SMZA 4ID8A 1K44A 5AE2A 1X5PA 4Q44A 2YQ0A 4A8KA 4TLQA 2O66A 1R0CB 4O4GB 2HQFA 3FMWA 4N47A 5CD4H 2HHSA 1M1HA 1U6ZA 3AH6A 2ZD1A 2BM1A 1BY9A 4B3OB 2VPXB 5HI7A 1VJWA 3RB3A 2PO4A 1HQ2A 2L48A 2EKYA 3K58A 1LOUA 1RSCA 3L09A 4L72B 2UV8G 3I96A 4DFKA 5J1EB 2FLOA 4NA1A 2BR0A 1QJHA 4U67Q 4KGKA 4CIOA 3WZ0A 2RVJA 1WC5A 3EYZA 1DRZA 2CNNB 3MR3A 3IMQJ 1RWXB 2XY7A 4W4MA 3UCGA 3UDEA 5J2QB 1FXRA 5F8JA 4I1TA 4F4WA 3NGTA 1S1UA 2J9DE 3JTPA 1S7HA 2XMVA 4F50A 5FLXY 2R7RA 2BANA 4YY3J 2EK1A 4YB7A 5A8RA 4M95A 3R9LA 5IT9U 2D1CA 2RRBA 2XLJA 4WU2A 3MPYA 2HHVA 2KXNB 2DR6A 1SQGA 3DN9A 4Y2AA 1Q0NA 4NLQA 2UUAF 4NLYA 2PMZD 4DXLA 2JVOA 4JI7J 3CW2C 5LSRA 1CEZA 2DHGA 4KSEB 5KFDA 1WEYA 2EFGA 3M8RA 1O51A 2WHOA 4ZPWR 4NLDA 2CPZA 3BBBA 1U1NA 3PEHA 4H4KA 5DDPC 2O01C 1Z4UA 2QO3A 5FIIA 3Q23A 4KKOA 4FYXB 1XN9A 1JKHA 3QZ7A 4HTIA 1WC1A 4I56A 2EBGA 3VGSA 4ANDA 1O6XA 3L7OA 4ZVHA 3SV4A 4B3RF 2MLZA 5A2QY 2RDDA 4U7UK 1EB0A 1SJ3P 2CG8A 1D9AA 4PUOA 3QJJA 3DOLB 5DGBA 1X5OA 3G82B 1JXLA 3L3CA 4ZVPB 5A8WA 4G1PA 1J27A 4LF6F 5I3UB 4HTJA 1VBKA 3FUYA 4ECUA 4DOZA 3UN5A 2VPZB 2VG6B 2HWTA 2HFZA 4LBHA 3W9JA 3RB4A 3H59A 5IWAJ 4KPCA 4NASA 3TAMB 5HATA 4CI0B 2GAGC 4DJBA 4C8OA 5E33A 4LRAA 3V6JA 2RIJA 3AT1B 4G65A 4K4YA 4DCJB 2M5YA 5U47A 4TXSA 2ZDOA 2VODA 3TA2A 1KQFB 3P6YC 1YGYA 3KJNB 5KFWA 4K0KJ 3MAHA 4RUAA 1Q86T 2HBZB 1KQKA 2XC9A 5I4MA 3RRKA 3BGRB 2ZBPA 4PWDA 1T11A 3X1LB 2HRTA 3ZZYA 3KHGA 3DGPA 3MXHP 3EGNA 1UWBA 3E8OA 3J81U 4CCHA 4R5PB 1KFSA 2KVIA 4CO0A 1GX6A 2DGVA 4YP3A 3NS6A 2YQ1A 2HQIA 4EZ6A 4CH1A 1IQZA 1F5BA 4C0OC 4DV7F 2MKIA 4ZP7A 3VQTA 2PT0A 1JLBA 2JLGA 3P96A 4QZVB 2MHEA 2XYHB 1RDRA 4HT7A 2WCXA 3R7BB 2RILA 1BE4A 1RTHA 1MWYA 4MTPA 4WZMA 1MMDA 1REGX 4OYXA 4KJIA 2KTQA 3R5GA 1RYRA 4U6PA 2Q66A 4CYUA 1CG2A 2DR9A 2I1RA 3KJFB 4DUZF 2YWEA 1KEKA 4JI4J 1APSA 1KP6A 2RUGA 1RADB 4RW7B 4OJ1A 4GVLA 1D9FA 4WE1A 2W25A 1N5TA 4YOEA 2IAJB 1YJTA 3FZBA 3QAUA 1IBLJ 1R43A 1WSVA 3PDNA 1W26A 4ECVA 5KG1A 1F60B 2L9NA 5G0RA 4ECWA 4ZCLA 1T03A 3RBZA 4L6V3 3ZTPA 1BQNA 1MMNA 3RZAA 2ROPA 1S6PA 4ZLLA 2U1AA 2JLFA 3NLCA 4AD6A 3FJ2A 5IQ6A 2WW4A 5CYQB 1ZA1B 3OXFA 1U7LA 5C5JA 4UOHA 1Z2LA 2AEJA 4LR9A 2FHJA 1NH7A 2PMWA 4CM2A 3GCXP 5ETMA 1G1XA 3KUHA 2MZSA 3T1HF 3D7SB 5EN1A 2FHKA 2IA0A 2DH8A 4F3OA 2P6SA 1WI8A 3ZZPA 2DHHA 3TP2A 2A10A 3FDSA 4TNOA 2KG0A 3UQSA 1SJ1A 2RU9A 3FGVA 3NBPB 4KTQA 2W2OP 2XI3A 1GTEA 5KFGA 1R0AB 3MMBA 1IR0A 2XMJA 4E8UA 4FS1A 2VKZG 2Z4PA 4ZPVR 4OZ2A 1AZSB 2DNRA 1LK7A 3CCWA 2DGOA 1WEXA 1YSJA 5DETA 1X5TA 1VS3A 3GJTB 2R7UA 1UEKA 3KLGA 1HA1A 4AQYF 2HQGA 2Q6BA 1EX8A 2N3LA 1UMJA 4MFBA 1FESA 1EKRA 2J7WA 3G8TA 5L1LA 1O0PA 5HQ8A 3AOAA 3D0GE 2ZNZA 5D0EA 4NCGA 2YNIA 2BMBA 3PHEA 4DR4F 1HBOA 2RF2B 2G0JA 1XMOJ 4X64J 2CQGA 2MZ1A 4R8UB 4YB1P 3BGLA 3ITHA 4FPIA 2CPDA 1QTMA 3BQ2A 4DX5A 4QIGA 5IV4A 2Z0GA 1G6BA 4X4VA 2QX0A 3K8VA 3W2WA 1OY9A 3DI6B 2MLYA 4WIQA 2MZRA 1PBAA 2MDAA 1LQ9A 4DV3F 3EZUA 1BWVA 1R8AA 2J6SA 2JC1A 5DO2A 4B08A 2E7WA 1RBAA 4WFNQ 2B5JB 3PFOA 5KFKA 4DUYJ 3HF5A 2F40A 4NYOA 3QZ8A 3V4IA 1VIOA 4KFBA 4CLLA 2LKZA 2G2ZA 5B0AA 3MM6A 1EARA 3NRBA 5ETLA 2GJIA 1FD8A 4IG0B 4ANCA 3PX6A 3OTCA 3THPA 3UDLA 2ZM6J 3HSZA 3V81A 4BCAA 5C24B 1JLGB 2CPIA 2CUYA 2C2KB 4JI6J 3DMJA 3GWCA 2VBYA 1U1MA 2RUSA 3C16A 2EPIA 5K14B 3Q2TC 3DXSX 4CO3A 2UXBJ 3WHIA 1XMQF 2CPHA 1NK7A 2OPSA 1X5SA 4F8RA 1MW7A 4UUWA 1Q79A 3KLFB 4A46A 3MMAB 3X3UA 1K73T 1PJ6A 5EHHA 2HVIA 4YFUA 3BO4A 1GTHA 4OI3A 3T9NA 4OI4A 4IG3A 2AW0A 3D54A 4QOTA 4WYLA 4MAKA 4Q2LA 3WQPA 4Y2IA 2CZ4A 1PKUA 3W9IA 2ZH2A 1FJCA 1JWWA 1RISA 2LECA 2NQPA 1LXNA 3GFXA 1T02A 4CLKA 3AD9C 1TKXA 1WTFA 1OO0B 2A1BA 3CGIA 1CSJA 3QGGA 3AA8A 1S6UA 1HI8A 4DPYA 2R7XA 1SC6A 1IVZA 3EM1A 2P5VA 2ZNYA 3R7SB 4AE5A 3Q8QB 1C0TA 1X9MA 1EKSA 3HI9A 3AQOA 2ZZNA 4JB8B 2JEFA 4AL5A 1SB6A 1OMSA 1HLWA 3UDVA 4E2FB 4DS5A 3D67A 2R8IA 3IC1A 1QSYA 1S12A 1NKCA 3M2UB 4CTAA 2J8SA 2DNZA 4O4RA 3FBBA 3KK1B 5HROA 2LCWA 3W65A 3JQJA 4DQRA 4YB5A 2RQKA 2IDLA 5LL6d 2GV1A 1HFEL 3GQCA 5B08A 3PJ9A 4TU9A 2ZD1B 4RW4B 4KHMA 4C98A 2H5EA 4LFCF 3GR0A 2DHXA 2JSXA 3M2VB 3D0HE 1Q8LA 3HSJA 4B17A 2ADCA 1HNWJ 4IOAQ 2YY3A 1H7WA 1CC7A 4ELUA 3D4JA 1P27B 2EKNA 2PIIA 3SEOA 2N82B 2BM0A 2RT3A 1RTIA 4ZCKA 2BVZA 5KFAA 1Q16B 3L7UA 4M94A 3TA1A 4DFMA 2XY5A 4PQUB 3OV7A 1N5VA 4LRCA 3UE2A 1R3NA 1B0VA 3FMBA 1RTDA 2AYBA 4KC5A 3M8QA 2QE5A 1WNEA 4OI6A 2OFHX 2ROGA 3MAQA 4DR5J 5AE1A 2YXLA 1VLOA 1YBUA 2VJVA 3JYTA 3R27A 4RW8B 3K5PA 5A8RB 3ZZ0A 2YPYA 2GX8A 1CLFA 4QWAA 2DGTA 1NK9A 2AU0A 5HQLA 2IVYA 2ZOMA 3K59A 4DN9A 1TK0A 4ZLNA 2QA1A 2K3KA 3CC4S 1N32F 2QZ8A 3BS9A 4IO9Q 3I5CA 1JIHA 3T1YJ 3C15A 2GIFA 2LDIA 3C66A 1D1UA 1RKIA 2M70A 3PW4A 5FLXU 3FKBA 1FO1A 4TY8A 3MEDB 4DG1A 1X4DA 4KV8A 2F8EX 1CJUB 1HW9A 5E3PA 4Y2MA 4EWTA 2CJAA 4ALZA 2MY7A 1OYDA 2N4CA 5KG5A 1E6YA 2B9WA 3MECA 3VHQA 1O8BA 5AT1B 4CNYA 3I9V9 5LSLA 4HL9A 3OXGA 3MUVP 1WSRA 4FBTA 3H4DA 2LU1A 4FXDA 1UVKA 3OPKA 3I82A 4PEOA 1T9XA 1XQIA 4GVBB 1RA6A 1JLFA 3F41A 5T7LB 2ZHAA 2YWGA 2WOMA 2YNGA 3GG1A 3LAMA 1OPIA 1RHMB 4B9LA 4FBUA 4NZ0A 2HURA 1XNQF 3GSIA 4PQAA 1EHWA 3D66A 2OGUA 1SL2A 4A48A 1F9FA 4KB7A 4ZPBA 3IGNA 1T9TA 3QT6A 3LGHA 3EXYA 1N5SA 5HMXA 3H20A 2C3OA 3VGTA 4WFZA 3NGSA 1YIJS 2IHR1 1L3VA 3HKZD 1HWLA 3HX9A 4OIXA 3DCAA 1TP7A 2C2ZB 4CLPA 5A2QU 2ZZMA 1QE1A 2XYGB 2UXDF 2ILZA 1WI6A 3OXLA 4LF5J 4DV2J 3NAIA 3K8WA 1NBEB 4RWXA 2CJYB 3QGHA 3Q8UA 2MKHA 4PXEA 1JLAB 4P75A 5THWA 1VRTB 2WVFA 2FLPA 1RKJA 1VRUA 5T41A 2ATLA 4B3SJ 3DLEA 4J37A 3P4UB 4NLRA 4DMZA 2FUG9 3NS7B 1C4AA 2R8GA 3HVWA 3HFVA 1AUSL 1QUPA 4LSZB 1V5IB 3CDEA 1EAYC 3KK2B 1ICEB 3DRXA 1U09A 2QL5B 5C25A 4RNOA 1U1RA 2NXJA 3M2RA 2MLXA 4BC7A 3V5RA 3QRPA 1HNVA 2FZCB 2ACYA 2DRAA 5DZ6A 3M6XA 5L1JA 3PCOB 4LFAF 1YJ9S 1TUWA 2QEXS 4M63A 4ATNA 4I2PA 2DR8A 1X4HA 4EEYA 4DR4J 2D74B 3KMQA 1SCJB 1ZAWA 3B82A 3J80Y 4NPOA 1RTHB 2VKRA 1U2RA 4HHJA 3SXLA 1F2HA 2VFSA 2MZQA 2MKCA 4ER8A 3VAHA 2DR7A 4F4YA 4NLWA 1NK8A 1MWZA 4N76A 5KFSA 2A0FB 1QLNA 4DV3J 2B0GA 1J5EF 2OPRB 4A8WA 1FJGJ 4HH1A 4B3MF 2ACMA 1RWPB 3LP1B 4M5DA 2VJUA 4BBYA 1M1GA 2C2EA 5K20B 1IKXA 2CQ0A 2YWKA 2HGNA 3HSDA 1LW0A 3UD5A 2IM0A 1VC6A 2HFSA 2B8PA 3GV8B 2CJKA 4ITSA 3DRRB 4TY9A 5G0RB 2CQ2A 2CQ4A 2A3JA 1CULA 2HNYA 4ID5B 4QIVA 3TO8A 2ZH5A 1RT7A 5FDLB 4YQWA 1XR7A 2PI5A 3OQ2A 4QPTA 2CG4A 4KO0B 3PW0A 1LWCB 4IFYB 2EFQA 2ZH3A 3W60A 1HHTP 4LVOP 2HHXA 3P5BP 2M3DA 4X65F 1Q8BA 1GX5A 4EYIB 2C2OB 2BABA 3M32B 1RT4A 2W9CA 3T5LA 3TANA 2HHTA 3FEYB 4ZVRB 4WXWA 5B09A 4URGA 3VVUA 3B54A 4YUDA 2FHOB 4UOGA 3Q8PB 1DAXA 1T05A 5A0YA 4DR1F 2IRUA 2UV8A 2KZZA 5IOLA 3ZZZA 3BF4A 4JYAF 4K5SA 2XULA 4LIWA 1A7GE 2ASLA 2CNKB 2BRLA 1KSPA 5SUHA 1NSKL 4QW9A 1RHRB 4MFBB 1RAIB 2I5JA 4RX6A 3D6HB 2RE1A 3SDEA 3BSOA 3K57A 1HBOB 3I87A 2CPJA 3ETMA 5B0DA 2LYVA 2YH0A 2Z30B 3M05A 3NCQA 4Z37A 2KXFA 3RUBL 3GIMA 1X7VA 2ROEA 5T14A 3DFEA 1FDAA 2VA3A 5GAHU 1BC6A 2PMHA 1WG5A 2YNHB 2QL7B 4AFFA 1HD1A 2E1CA 1DQAA 5KTQA 2WONB 3JB9k 2NYHA 2P6TA 2PI4A 2D7SA 2UXCJ 1TU0B 5F9LA 3QRQA 4N8OA 1KLMA 2FJVA 1K0TA 2ZUGA 3M8PA 1U4BA 4DQIA 5I42A 4ANEA 2H54B 1RWMB 2RAQA 2V9KA 3A3PB 4KT0C 3QT7A 1N0VC 1E6VB 2NXNA 3LANA 1S9FA 1HPZA 3OTEA 2OJ3A 4JI3J 3SZ2A 1YJ7A 3V6KA 1GK8A 4PYAA 4NLPA 3E01B 2MPUA 3DLLQ 3DMJB 2HFNA 3LF0A 2E5JA 2KKHA 1QAYA 3SCIE 2BJ1A 2MTLA 2V8HA 1S49A 2BA9A 1HQUA 1TFYA 3PYGA 3N6NA 4WFXA 3P5TL 1HARA 5JVHQ 3QSYB 2OPSB 5CHCB 3DU6A 1S6OA 1Y00A 2NUUG 4LQ9A 5K8PA 4ZJQA 1OS5A 4W90B 1JJCB 2OPQA 1UPPA 4MT1A 1TL3A 4WWSA 3F0NA 1FWKA 1ZA2B 2KHDA 3OUYB 2A18A 2CKWA 4H4MA 2J0QD 1VFJA 5HBMB 5IM0A 4OHYA 1UFLA 1DURA 1UKUA 5DQIA 1J5OA 7FDRA 3H8YA 4P7VA 2ZBQA 2QA2A 4KE5A 4DL2A 2E5IA 1HBMB 2CQDA 4O3QA 1IR1A 4FYYB 1H38A 4URQU 5KT4A 1SH0A 4Z2XA 5KFYA 1FKOB 1RAAB 5GAGU 4CLYA 5HP1A 2E7VA 3MD3A 2HFUA 1REVA 4DR7F 1KONA 2RSQA 2OPPB 1WG4A 3UD3P 1Q95G 1AFJA 3MM9B 5J2MB 2DPJA 4ELVA 4NA3A 3PKMA 5ETOA 1RCOB 1Y5IB 4MIWA 2EG2A 4DPOA 4ZN3A 3LAKA 2VG5B 2V4RA 3RTVA 1HMVA 1N34F 4ES3A 4ZA1A 3GMGA 3BSCA 1HNZJ 3PM9A 1LWEB 2XS5A 2VDHA 3KYLA 4IFVA 1RBOB 3QLHB 1I1GA 2UUCF 1K47A 2OTLS 1YHQS 1TL4A 4KGXB 3M9NB 4FNHA 4O3SA 4E98A 3CD0A 2V67A 1JB0C 4XPCA 1FEHA 3L95X 1HBUA 4RW9B 2MEWA 1KTVA 1BUXA 2G1HA 4FXVA 4GO5X 1LXJA 1GXTA 3D5MA 5F8LA 5LXYA 1W2BR 2F65A 2B9XA 4XPEA 4WXOA 3BQ1A 1I6JA 2G13A 3JSMA 2X7IA 3LGMA 1V3ZA 1FKPA 4LVNP 4LFBJ 2B4PA 2HIQA 5L9NA 4H4OA 3RAMA 1T9UA 2JDJA 1Q5YA 3BGUA 3A8JA 2XS2A 2OFGX 5E3AA 4ZVEA 1IKWB 1MMLA 3G6XA 1FE4A 3OW2R 4BDPA 1YX2A 1D9DA 2C2NA 4W92B 1MN7A 2XEXA 3OR2A 3EPGA 1ZETA 3ZO7A 2BE7D 3VAGA 4USMA 1Y7PA 4L3KA 1JLCB 3MOZA 2W9BB 1HNXJ 2CNLB 1AUDA 3HHDA 2QFIA 4P6QA 3KK3A 6AT1B 5J1PA 3V6DA 2W4DA 1VR6A 4C8KA 3J7ZT 2BZ2A 1VC0A 1R8PA 3D1OA 4DF8A 5IFMA 1KDNA 5I3QA 2AIRB 2C28A 2VL1A 3JSYA 2W2QP 3I0SA 2AF6A 2IA6A 1R89A 1RTZA 4I2QB 4O0NA 4KHPF 4M1KA 1FKAF 4J9QA 2QYCA 1UVMA 4IQMA 3MEKA 1WF1A 1HWIA 5LM7E 3KLEA 4MK8A 2FD2A 2R8HA 3AJ1A 3KLIA 4KGMA 1YWXA 1PAUB 4ECTA 1OQ3A 2JL9A 4HI1A 2J76E 3CSKA 4PXDA 1QE1B 2BW7A 4HACA 2LQ8A 3POTB 4CO2A 2E9RX 1TL7B 2DB1A 2LMIA 3WBZA 1KRPA 1N0UA 3UWTA 2DNHA 3FRYA 2IVMA 2PFDA 1TV6A 3T9ZA 1N33J 2JH3A 1UW4A 3U1NA 4DL7A 2GHWA 4NE9C 2J6TA 3TUZC 1QDUB 2G2YA 3W2VA 2NLWA 1RAGB 5KT7A 4OL8A 2HS0A 3HK2A 3CULA 2DXEA 3MR7A 5AXNA 4B3TF 1S9EA 2MQLA 4WU3A 2CWXA 3C3LA 1JXVA 2GCFA 3MDFA 4CLTA 2DIUA 2R9LA 1RGVA 2QT7A 1MROA 2IJFA 4WJBA 5C42A 2HQCA 1F9EB 3K5OA 1VQMS 4F3QA 4MJKA 2BBEA 3MMJA 2Y8YA 4IRDA 1SKSA 3W5XA 1HNVB 4U95A 2YKNA 3KNGA 1AXQA 5D4NA 2XWXA 3M30B 3L7PA 2NUHA 4LUBA 2JHEA 2B9YA 3HMJG 3DLGA 2NS1B 1PSDA 3HHEA 4ZVSB 3HT0A 3J7AN 1LV5A 2XMTA 2NZCA 4DZDA 3A8IA 4USKA 2R7SA 3HCXA 4JI5J 2DEIA 3O1LA 2K1RB 1HI0P 2DNOA 3QSIA 5E3RA 2P9GA 1X4BA 2AX0A 4O4GA 2Q1LA 4DPXA 1S4FA 3GV5B 3J80U 1SQEA 1O5JA 1N36J 1U0HB 4P2FA 5ADZA 1DQ8A 4F3MA 3GFZA 3VALA 4KR0B 3KOAA 2JOQA 4USHA 4B3OA 2V6AA 2DBBA 4FF3A 2E29A 2I0XA 1B7FA 1R8CA 1WHVA 1KLNA 3GIKA 4DSEA 2OSRA 3KJVB 2D3O1 1U0SA 3ULHA 3R8YA 3ZZOA 3N5BA 1NPPA 5J1EA 4J9UE 2ZJRQ 5KFBA 2YTCA 2XM3A 4DR2F 3H98A 3OTOF 2HWIA 4ZVUB 3T41A 3CMAS 4UQTA 4AUKA 1S77D 2AJQA 1NU4A 3QGPA 1M1KT 2CIMA 4OYMA 4Y00A 2AQ4A 4K5RA 1WC3A 5J2QA 2XY6A 1VQ5S 3FSYA 2DT9A 4WIIA 2M7SA 2Y8WA 4WKYA 4DV6F 4I68A 2DXFA 4GC7A 4R25A 2XMKA 1OSCA 3AHPA 1HR0J 4EBEA 1T05B 3LPYA 5RUBA 1W2IA 2WSFC 1FRMA 4P9SA 4DL5A 3KTQA 3CJ2A 3M1VB 1U2CA 2MQOA 5KOWA 3NEKA 1DTTB 2IJRA 2WVCA 4USTA 3HPOA 3OHAA 1T9VA 1NDCA 3D68A 2FZGB 5K5MA 2Y1IA 1CPZA 4P71A 2GMLA 2AZ1A 4EO8A 2I5JB 3OFHA 1R27B 4X4NA 3SDEB 3VCDA 3U7JA 1V5VA 2DNNA 1L3UA 2DEJA 5CXTA 3OR1B 4EUVA 4KIAA 2J0XA 1N88A 1XNRF 5HQMA 2C3UA 4ZMMA 3F44A 3PW7A 2F4VF 4JI8F 3D28A 3ZZUA 3KHLA 4NEZA 3KKFA 2CDRB 4OLPA 1NXIA 1MNEA 4WYWA 1MSWD 5A8KB 5KG4A 4DLEA 1YZ6A 3RGIA 3DOLA 4J9VA 3SQOP 1N56A 2KB2A 1D8YA 2YH1A 2POKA 4XAKA 1N6QB 1FRHA 1VQ4S 3BBCA 4MK7A 3FCWA 3PIPQ 2OEJA 2ZVIA 2HZAA 4YHHJ 2LQBA 4K2XA 1R31A 4BWJA 1N34J 2VG6A 3MM8B 1CJKB 1SJ4P 3I9ZA 1QSLA 2MKYA 4ZITA 3TAMA 4OYBA 2A2CA 3H42A 4IDKB 3BSAA 3QIPB 4F4ZA 4RUHA 1RI7A 5F8HA 1YDLA 1H2TZ 1S72S 4K4XA 1TFWA 4B9MA 1WDDA 1B4SA 2BKOA 2MHNA 3K5LA 4DSFA 3D2WA 4K4WA 3CCJS 3ISNC 3OT9A 2KT3A 1R8BA 4LF9J 3MEGB 4E0DA 1HL6A 3QO9B 4JI0J 3BGRA 3Q24A 2HMIB 3ZTSA 4ETXA 2DHSA 3WX8A 3LOUA 1JNRB 3DDKA 3F56A 1CBKA 4RW6B 4RL1A 4JI1J 1GQEA 2EBEA 1OSDA 1LFWA 1UVNA 4OZJA 3U1LA 1X9WA 3VV2B 5B0BA 2C1EB 2XMUA 2VB6A 2W2MP 4OX8A 4JI7F 6FDRA 4J9MA 4PCQA 4PWWA 2CPXA 1UJ5A 1YI2S 2RH3A 3FEXB 3RAXA 3T5KA 1KVIA 2RS2A 4F0KA 2WVEA 1RWNB 3HHLB 3GIRA 1SH2A 4C8ZA 3HKWA 3CDUA 3OJUA 4A4JA 4DEZA 2VUGA 4ES2A 5CD4A 1V6HA 1TQLA 2ALZA 1WOSA 4XDDA 3BN7A 2X1AA 2VONA 3AJ2A 3CCMS 1Q8IA 3NGUA 4RW7A 1U8SA 5IC6B 2EC2A 5D4OA 2ZBCA 2JVRA 1VBZA 2QRRA 2KHCA 2IAJA 1KHWA 3N28A 4L73A 4DI6A 3EWGA 3JQMA 2PC6A 2RJZA 2HSEB 3IAM9 1FRIA 4ED6A 1BD6A 2D69A 1RAEB 1UA1A 5IWAF 1IQTA 2LLZA 4LRFA 4DF4A 3DXBA 5CYQA 2R2UA 3QBCA 4F36A 5M2PA 2F4FA 4DV5J 1RT2B 1ZZFA 2H4YB 3MF5A 3MM5B 5J2PB 3I55S 2E1AA 2LP4A 2QJ3A 4C8NA 5HJXA 1FE0A 1NK5A 2NZ4A 4K0KF 4B9VA 1Q82T 3MR2A 1Q7LB 1SKUB 2UVUA 1FJ7A 2KJWA 3ENVA 2E5HA 3AD8C 3IG1B 1XMBA 3NBPA 5KFHA 2CPEA 2FGOA 1QAXA 1R0AA 1ZTTA 3CNQP 4B3TJ 1P8GA 5AXLA 4MK9A 3JSMB 3MTKA 2HVHA 3WC2A 2UUBJ 1S1XB 2O67A 1AZSA 2HLUA 5LT5A 3IR6B 1WEZA 2FJEB 4HHHA 5JVGQ 4OX9J 1JJ2R 2ZUAA 4ILMA 2P8IA 1F6TA 5DQGA 3OLAA 4OFZA 4MIAA 4LF4J 5LXRA 3M8WA 5KFIA 4A8FA 4LF2A 3NKYA 3FC9A 4CNZA 4A47A 4OJGA 3EDRB 1DLOB 2AYMA 2MQPA 5KFJA 4P52A 1WC0A 2RF2A 3G6YA 3PY8A 3GTYX 1RTJB 4CLWA 4R8UA 4USJC 3H5YA 1T9WA 1XR6A 2QGFB 3Q83A 5D0GA 4DQPA 4LF8J 3V6DB 5EUHA 1F3FA 2DGWA 1NDLA 1BHNA 3W8PA 1V3RA 1I51B 1VK8A 3NY0A 3M6VA 3K2YA 3RR7A 1VQ7S 3Q2SC 1S99A 2B5JA 3FQLA 3LWMA 1DHMA 4FF1A 4OMFG 4HR2A 1MU2B 1U1KA 1IBLF 2HYIB 3OL6A 1IBKJ 3PX4A 2IPOB 5L1KA 4GKKJ 3NCRA 4PZVA 4DV1J 2XNQA 4IR1A 3DC2A 3RRHA 1FD2A 4IG0A 4ZPAA 4MKVA 4MYTA 4QWBA 3GJQB 4B02A 2FZKB 1JLGA 2W7AA 1M5VC 3TJ8A 3NGDA 5E0OA 1A0OB 3BH6B 1VBXA 3ZNJ1 5K9FA 4B9TA 4YS2A 5K14A 5K8OA 2OMOA 1IBMJ 3G8QA 2VH7A 4JV5J 1UL3A 1ROFA 4QYZJ 5HO4A 3KLFA 3NGKA 3MMAA 4WPAA 1M5PC 2KYXA 1RT5B 2NSBA 2E1MC 1G7CB 5E7OB 3DU5A 2HS3A 3KLHB 3IN5A 1T7PA 5KFCA 2GMHA 1IWAA 3VR1A 3CCTA 1RWKB 2DRBA 3HM9A 1XR5A 1GFWB 4KBIA 5AXMA 4ED4A 4AL7A 2KT5A 2J9DA 2VQFJ 2IC3B 4NWBA 5HMWA 1U1PA 1SBRA 2C22A 3RRGA 2V2ZA 3C6UB 1AW0A 5CCMA 4Y65A 3S1TA 4K7QA 4K4UA 2BQRA 1KTQA 1UZHA 1XMOF 2F8MA 4MMOA 4X64F 2J5AA 3W5ZA 4CT9A 3PIOQ 2F4VJ 2CRLA 2WW8A 3R1LA 8RUCA 2OLWA 3DKDA 5DS7A 1SC1B 2XYPB 1IKYA 2KL8A 4DPUA 1H98A 4RNFA 1SC4B 2M8HA 5AE3A 5KG2A 1NK0A 2PA3A 3M2UA 2ASJA 1WELA 4ES1A 2RS8A 3ZNUA 3KK1A 1S9GB 1S4EA 4WP9A 4DUYF 2GHVC 4IOBA 4ZP8A 3CCES 2C3PA 2V0NA 1Y3JA 2FHMA 3IA0A 4RKUC 4RW4A 3H0PA 3H7HB 2GC8A 3NNHA 1FK9B 1WUUA 4OI2A 5CAAA 1JXEA 2E1RA 4X4UA 2E44A 2CVEA 3M4XA 4ENOA 1S48A 3M2VA 3M7VA 4YMEA 2ZM6F 4C97A 2QIFA 1TK8A 4C2MA 4JI6F 4UOFA 3DYAB 2B43A 1PJ5A 3RU0A 1PAEX 2AP6A 2ZBIA 3M8ZA 3CEDA 1Q7YT 5HL7Q 1KKHA 4PQUA 3KLVA 2UXBF 4DCPB 2B6AB 3LALA 3FZ2A 2BQ3A 2EG1A 2ZHBA 1B99A 3ELHA 1NJXA 1PG5B 3UNGC 3DOMB 4RW8A 4J7CA 3RR8A 3EZ5A 1UVIA 1YJNS 2BE2B 2QTWA 3Q8SB 4O3RA 3MGJA 2FGCA 4ZOSA 4GKJJ 3TVKA 4XK8C 2M8DB 4NXMJ 2W8KA 4JBCA 5E3CA 7FD1A 4X4RA 3MEDA 1RP5A 2UU9J 1CJUA 1V9OA 3R5CA 3AD7C 2FVPA 1KOHA 1YITS 2ZH1A 4Y3CA 1C1CB 5GVQA 1KFDA 4FPRA 4LMZA 3OSNA 1AT1B 1HD0A 1TL1B 2C2RA 3PRDA 4ED0A 3IAS9 4GVBA 1KN6A 4AYBD 5T7LA 1LWXA 1U1LA 4P74A 1K1QA 3EE3A 3GLJA 1PBUA 2N7YA 3EMTA 3UW1A 3HSGA 4CWBA 3CMQA 1XC9A 3A3OB 1OQ6A 2HQDA 3HO1A 2QN6B 1R6VA 2DTJA 2RKIB 3TW0A 3TYTA 3JXOA 2K7KA 2QLBB 2AEMA 4DX8H 2B4UA 2LQ5A 1KR4A 1RE1B 4QWCA 2WK4A 1M5SA 2P9EA 3HXMA 3T5JA 4MYUA 3KG4A 2KM8B 3HZEA 5HANA 1S59A 5KFMA 1B70B 4QYZK 1HNWF 2ZZTA 4FZVA 1A6LA 4DX7A 1K1SA 2XZTB 5AJ3J 4OX6A 3DRPB 1JLAA 3QATA 1VRTA 1K8AT 3LP0B 1KHVA 1IWGA 3WDOA 1UTAA 5KFXA 3L4BC 5KFZA 3SI8A 1WJ9A 2NXUA 2XGQA 2MJUA 4G6VB 4DR5F 2O3DA 4WP8A 2Y9HA 1CJVB 2D41A 3ILIA 3NOCA 3KK2A 3O3LA 1NAQA 1YRXA 2MB0B 4K2JA 1Q78A 4UQGA 3N01A 3SSQA 1Q81T 1I94J 2KFZA 2PFFB 1NHVA 5DG9A 3PV8A 1ZAXA 1IJFB 2YX4A 2BX6A 5KFQA 3T1YF 1RABB 4U96A 3VF0B 1NRKA 4I4BA 4M5JA 4M5LA 4OI1A 1KD1T 2F9JA 1MLAA 1Y4ZB 2X51A 3B4MA 2XCPA 2QLWA 1WG1A 2RQMA 3BKTA 2G4BA 1NB7A 4ETZA 2QV6A 1NEEA 2FVSA 5ITHA 3CTRA 1WC6A 4F0HA 2K8GA 2OPRA 2W9AA 3OD2A 3KWMA 1T3OA 1FEEA 3TJ9A 2Z57B 3LP1A 5CZVA 4MIBA 4FDFA 5F8GA 2G0CA 2AGQA 2HVZA 1F9HA 2SXLA 5JJBA 2GQCA 1VQPS 5CYMB 4LIRA 3HHNB 2JC0A 2HNZB 1DTQB 3OLBA 3FK4A 3H25A 2OMLA 3DRRA 1L5UA 3JSRA 2WRMA 4ZJLA 1QAJA 4L75A 1FI4A 4TN2A 3D1QA 4DV4J 3HD2A 4NEYA 2GZOA 3N9UC 4ID5A 1YG0A 2HNDB 2AGOA 5FDLA 2BYCA 5D3GB 4KO0A 4EFAC 4LF5F 1LWCA 4IFYA 4DV2F 2MZTA 1RB0A 3LO3A 3H2VE 3CF5Q 4FN5A 2EI5A 3DNCA 3FFIB 1SVDA 3M32A 3OTDA 3OVSA 2E5GA 4LREA 3C6TB 3RW7A 3H40A 4B3SF 3K7RA 4KGVB 3IO1A 3GYNA 1G2EA 3ILJA 1YLXA 3CCQS 1SH3A 2JZ5A 1OWXA 4Q5VA 3CVKA 1YRUA 1H7XA 1SQFA 4RUBA 2IFXA 3FNNA 1B7YB 3UN2A 3LGNA 1KOOA 3TUPA 5F3TA 2AYGA 1KNZA 3O8WA 3H4BA 5GMEA 3ZTOA 1SV5B 4NL5A 2IDEA 1N5YB 1QSSA 3RYLA 4ZN1A 2ZH9A 2Y3YA 5EWGA 1RT1B 3QQCD 2KFNA 3FSXA 4FKYA 2DGSA 2MQ8A 3H5UA 2OI2A 5E5NA 2V94A 1AFIA 1JLQB 4PABA 3N5FA 2R7QA 4NYZA 5KG3A 5DGAA 2A6MA 3MAAB 5B0CA 1IR2A 2W8LA 2GO9A 5H9EJ 4AL6A 2LEBA 3GR1A 4ZP9A 3J7A1 3BDEA 4F26A 5A6WA 1FJGF 2YNHA 3KHHA 3CWJA 3AOCA 1D09B 2Q43A 3ZTQA 2NCKL 4RNNA 2WONA 3LW5C 4LSLB 2CAJA 3J7YI 2ZH6A 2VICA 4Y2CA 2YBVA 2VOOA 2AJ2A 3QIDA 3FCHA 3OL8A 5KAKA 4M5KA 1N52B 3D6TB 3DM2B 5MLCV 2G9OA 1E6VA 2X1GA 4IO1A 3PYDA 2VU5A 1FCAA 2GQ2A 5LMNJ 3E01A 1P6TA 1IXKA 5EDWA 1PILA 3O2IA 4QYRA 2ZH7A 4NZ7A 1S7IA 3QMQA 4OQJA 1VQLS 3FEZA 4B9NA 3BREA 4OZ0A 5ETKA 4F4XA 3KFWX 2WVBA 2V8GA 3IR5B 2MSTA 2Z58B 1NB2A 1RWOB 5F8NA 3GJSB 4QBUA 4IUFA 4FF4A 3HHLC 3H5XA 3HD1A 3TA0A 2NREA 1N4LA 4I6WA 3OJSA 3MD1A 3OUYA 1HNIB 2FLNA 5HBMA 2GHPA 1YJUA 2OHDA 2AEFA 4PG6A 1QY7A 1GXUA 2F9DA 5J2NB 3Q86A 3M9OB 4UZBA 4LF7F 4ZCIA 2IY5B 2G2OA 1QAIA 2OSQA 2OEMA 1TAUA 1HBMA 3TZZA 2HHHJ 2XSJB 1RAFB 4NMXA 4ECZA 1C0UB 1FVQA 4ZCMA 1SL1A 4ZS6A 1FKOA 1K9MT 1BQMA 4PRFA 3MUMP 3W66A 2XHWA 3ISZA 1X9SA 1HBNB 1TKTB 3MEEB 5D15A 1TKZB 2PDAA 2OPPA 3EX7B 2RHSB 2V9WA 4DR6F 3T5HA 3DRSB 2WTFA 1IKYB 4IH7A 2C2DA 3MM9A 1X4GA 5J2MA 2Z2YB 4NMLA 4NXNJ 2C2MB 3MPDA 4EBDA 4JI2J 1FFSB 1C4CA 4OYWA 2VZ9A 2VG5A 2UXCF 2M2BA 3NNAA 2J7UA 3CJQA 4YB6A 5HN0A 3EGZA 2W01A 3NOGA 3HVTA 4ILLA 1LWEA 1JJHA 2M52A 1JJ4A 4EK2A
chains in the Genus database with same CATH topology
3C14A 4OYOA 1CULB 1TL7B 1CJVA 1WC1A 4USVA 4OYMA 4CM0A 4OYZA 1CULA 1TL7A 1WC3A 2GVZB 4WP9A 4OYIA 1FX2A 3C15B 4OZ2A 2WZ1A 2GVZA 1AZSB 3G82B 4CLPA 3C15A 1AZSA 4CLLA 1CJTB 4CLYA 4CLZA 5D0RA 1AB8A 4CLKA 1YK9A 5IV3A 4P2MA 3MR7A 1CJUB 2GVDB 3UVJB 5D15A 1Y11A 3MAAB 4OYPA 1CJUA 2GVDA 5D0HA 1WC4A 4NI2B 3UVJA 3MAAA 4CLSA 1U0HB 2QV6A 3G82A 5D0EA 3C16B 4P2FA 1CJKB 4OZ3A 4OYAA 4USTA 4CLTA 1CJTA 4CLUA 1U0HA 3C14B 3C16A 1CJKA 1WC6A 4CLFA 4P2XA 4OYBA 1WC0A 1YBTA 3ET6B 4CM2A 4WP3A 5IV4A 4CLWA 4OYWA 3ET6A 4OYXA 3R5GA 5D0GA 1FX4A 4NI2A 4USUA 4USWA 1CS4B 1WC5A 2W01A 4WP8A 1CJVB 4WPAA 2BW7A 1Y10A 1YBUA 1CS4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C14 A;  4OYO A;  1CUL B;  1TL7 B;  1CJV A;  1WC1 A;  4USV A;  4OYM A;  4CM0 A;  4OYZ A;  1CUL A;  1TL7 A;  1WC3 A;  2GVZ B;  4WP9 A;  4OYI A;  1FX2 A;  3C15 B;  4OZ2 A;  2WZ1 A;  2GVZ A;  1AZS B;  3G82 B;  4CLP A;  3C15 A;  1AZS A;  4CLL A;  1CJT B;  4CLY A;  4CLZ A;  5D0R A;  1AB8 A;  4CLK A;  1YK9 A;  5IV3 A;  4P2M A;  3MR7 A;  1CJU B;  2GVD B;  3UVJ B;  5D15 A;  1Y11 A;  3MAA B;  4OYP A;  1CJU A;  2GVD A;  5D0H A;  1WC4 A;  4NI2 B;  3UVJ A;  3MAA A;  4CLS A;  1U0H B;  2QV6 A;  3G82 A;  5D0E A;  3C16 B;  4P2F A;  1CJK B;  4OZ3 A;  4OYA A;  4UST A;  4CLT A;  1CJT A;  4CLU A;  1U0H A;  3C14 B;  3C16 A;  1CJK A;  1WC6 A;  4CLF A;  4P2X A;  4OYB A;  1WC0 A;  1YBT A;  3ET6 B;  4CM2 A;  4WP3 A;  5IV4 A;  4CLW A;  4OYW A;  3ET6 A;  4OYX A;  3R5G A;  5D0G A;  1FX4 A;  4NI2 A;  4USU A;  4USW A;  1CS4 B;  1WC5 A;  2W01 A;  4WP8 A;  1CJV B;  4WPA A;  2BW7 A;  1Y10 A;  1YBU A;  1CS4 A; 
#chains in the Genus database with same CATH topology
 3Q8V A;  3QLH A;  4ZHR B;  4GO7 X;  2ZEJ A;  4NCB A;  3UDC A;  2CVI A;  4RLE A;  2B56 A;  3R5A A;  3I31 A;  5M2U A;  2EVZ A;  1S5Z A;  2JX2 A;  3MCO A;  4GMK A;  4JI3 F;  4OX7 A;  3MI7 X;  4CQ1 A;  1EIY B;  3BO3 A;  3D6F B;  2VG7 B;  3SSS A;  3I5A A;  1H73 A;  3THT A;  1D3W A;  3CCZ A;  4J90 A;  1ZM9 A;  2JEG A;  4C11 B;  4RW9 A;  1DFD A;  2W2N P;  1W7W A;  3ENW A;  1HWU A;  3KG0 A;  4NLG A;  2B7C B;  2ZKT A;  4NRT A;  2YNF B;  2YKP A;  5JXS A;  3DLK B;  1GT8 A;  1HQE B;  3CJR A;  3TZX A;  5IC4 B;  2VF3 A;  4QU7 A;  1UVJ A;  4DX6 A;  4C8Y A;  2PD1 A;  3IR7 B;  4O3N A;  4Q2M A;  4ED8 A;  5DM7 Q;  1IKW A;  4EMD A;  2MJN A;  4DLG A;  2B7B B;  3US5 A;  1T94 A;  4X66 J;  2FJW A;  2IRY A;  5LOQ A;  5H9E K;  1VHF A;  4DUT A;  1U47 A;  5K8N A;  1RHU B;  3FSI A;  4DL6 A;  1JLC A;  2W9B A;  3CJK B;  3SCK E;  2CNO B;  2WBR A;  2IVF B;  2HK2 A;  1XER A;  2HHQ A;  4DSL A;  4CP5 A;  4IH5 A;  1RU1 A;  3A8K A;  2Z8Q A;  4OZN A;  1DAR A;  4PPZ A;  3FBC A;  3UFC X;  3SQG B;  5HLF B;  1Y11 A;  2RHQ B;  2AJ4 A;  2R7O A;  4Y28 C;  4WK1 A;  2LA4 A;  4O3P A;  4G1Q B;  1VQK S;  3EXC X;  2CQB A;  4KQZ A;  5FJ4 A;  2MY8 A;  3S8S A;  4I2Q A;  5KFL A;  2FJX A;  4K4T A;  3BB5 A;  3K0J A;  2P2C B;  4PWU A;  1S1W B;  1GMU A;  4ZLP A;  3ET6 B;  3H90 A;  3ONQ A;  2N7C A;  1YRT A;  1EJ7 L;  2JEI A;  5C2C A;  4QIF A;  4BLG A;  5L38 A;  4ZK7 M;  5IZH A;  1WOO A;  2YVS A;  3IFE A;  1XWL A;  1HNZ F;  2XMM A;  1PYS B;  1CS4 B;  3GON A;  5J1N A;  3T3F A;  2VQE J;  2RML A;  3F73 A;  2N3O A;  1MWQ A;  2IYG A;  3POT A;  3GPA A;  4HDH A;  1X0F A;  4CM0 A;  1OY6 A;  1TL7 A;  2J9C A;  1HYS B;  3D3B J;  2CQC A;  1ZTW A;  4QWE A;  2ZE2 B;  2FLL A;  2MKK A;  5E41 A;  4FNI A;  2EFV A;  5DQH A;  2V8V A;  3C46 A;  3TI0 A;  2LEA A;  1S6Q B;  3OFG A;  3I0R B;  2GVD B;  1UCN A;  3VAM A;  2O5D A;  3WIV A;  4X4Q A;  4LRB A;  4N56 A;  4DR3 J;  1URR A;  1OY8 A;  3LH2 S;  2WSC C;  4O44 B;  1WAC A;  3PFE A;  3UR0 A;  1U45 A;  2DNL A;  5D78 A;  2EFP A;  4M8L A;  1RWV B;  4DZ6 A;  3OSP A;  3N6M A;  4J91 A;  4P2X A;  4LFB F;  2R2S A;  2CZV C;  3G6E S;  3RJM B;  2E7X A;  9ATC B;  4A8S A;  4B9U A;  3H5S A;  3CJ0 A;  1SUQ B;  2R7W A;  4WFB Q;  3M30 A;  3JSB A;  1H3D A;  3UR3 C;  3DHX A;  1RT3 B;  3ISN D;  1HNX F;  4KH0 B;  1T9Y A;  3NG8 A;  5KFV A;  4KY3 A;  3D6M B;  3R2D J;  3I6P A;  2DIV A;  3CD6 S;  2KO1 A;  1NJW A;  2I38 A;  1NDK A;  3VZH A;  2VPW B;  1L3K A;  2LFV A;  3DRY A;  3MM7 B;  5K8M A;  5DG8 A;  2F63 A;  2K1R A;  4F04 B;  2YKM B;  1TVR B;  2WB4 A;  2HGM A;  1SC3 B;  9RUB A;  3GIJ A;  1ZS6 A;  1Z1Z A;  4M5I A;  1I3O B;  1UA0 A;  1S57 A;  3BGO P;  1VJQ A;  3EGV A;  4CLU A;  1U0H A;  4XTT A;  2HFV A;  3J7Z 5;  2H5I B;  1VQY A;  2FTR A;  1NO8 A;  3GFH A;  3UNY A;  4XDC A;  5HVG A;  3QWP A;  4V19 X;  4P72 A;  3KJV A;  1UJ4 A;  5HMY A;  3WIU A;  4HDG A;  3G87 A;  2J0S D;  1TAQ A;  3G96 A;  2MGZ B;  1S76 D;  1C1B B;  4ICL B;  1NSA A;  3R6G B;  3TOQ A;  4IRC A;  1X0P A;  1UAW A;  1FDD A;  1QUV A;  4X2B A;  3DLJ A;  3EVO A;  2D9P A;  4X4T A;  4QWD A;  1S0O A;  1OJ4 A;  4DFJ A;  1N33 F;  1RAC B;  2DO4 A;  1LW2 B;  2L08 A;  2FHJ D;  2GJ2 A;  4NA2 A;  1H2V Z;  3MCS A;  4MKY A;  1TEL A;  5A6P A;  2DH7 A;  1BXN A;  3B78 A;  4OYP A;  3VQS A;  5DG7 A;  4ZVT B;  3M1V A;  3AFG A;  2OUG A;  3MPW A;  3V4M A;  5JMN A;  1DTT A;  3GYG A;  4P73 A;  3MFH A;  4F2S A;  4LRD A;  2UVR A;  3TAP A;  2O1P A;  4LF7 J;  2NPF A;  1UWA A;  1U6B A;  1H74 A;  2JLE A;  2XSF A;  2XZW A;  4HH0 A;  1IN0 A;  1FRL A;  2HBY B;  1DZ5 A;  4A8Q A;  4RU2 A;  4ZKA A;  3OR1 A;  2ATC B;  2CJB A;  2GVZ B;  2L9D A;  1URN A;  4C48 A;  2VHG A;  2ZH8 A;  1U48 A;  3W7B A;  4M5M A;  1M0S A;  2EC0 A;  2W7P A;  2Y0B B;  4X62 J;  2BXJ A;  2BOA A;  4JI5 F;  4NZ6 A;  5A8K A;  2HLT A;  4DR6 J;  2KM8 C;  2F8H A;  1KQG B;  3GCW P;  1WKJ A;  4PG7 A;  3R97 A;  2ZWO A;  3KNA A;  1UPM B;  2XTJ P;  1Z2Z A;  3PO5 A;  2QLX A;  1FTC A;  2ZDP A;  4NRU A;  4FF2 A;  1N6Q A;  3HJF A;  1R7I A;  3TX8 A;  3CCL S;  3CDA A;  4A8Y A;  5B7W A;  2GO8 A;  1N36 F;  5D8H B;  3SV3 A;  2HRU A;  3PEJ A;  3MM8 A;  4DBQ A;  2OKQ A;  1CJK A;  3TAR A;  2BV3 A;  2ZC4 A;  3IBF B;  1G3O A;  2RRA A;  4QJV A;  1VQ6 S;  4IR9 A;  4IDK A;  1R8H A;  1WHW A;  3QIP A;  1FXL A;  4RNM A;  2L3M A;  4MH8 A;  4Q7A A;  3GYX B;  3QRR A;  3SBM A;  2J6U A;  3CXC R;  4JP8 A;  4WK3 A;  4DV0 J;  3BEG B;  2MQN A;  3LP2 B;  2GFF A;  2QFJ A;  1F0X A;  3MEG A;  2DGU A;  2Z56 B;  5IS2 A;  3QO9 A;  3GII A;  2HMI A;  1U26 A;  3BO2 A;  4OZ5 A;  4NLO A;  5M2R A;  2OIH A;  5FD1 A;  1YQH A;  2V63 A;  4OLO A;  4TKT A;  4RW6 A;  2R8K A;  2YWW A;  3SFG A;  3RB6 A;  5BR8 J;  3BDP A;  3CJT A;  1F1B B;  4J9O A;  4TYA A;  1LWF B;  1HR0 F;  5IQQ A;  2V50 A;  1SIZ A;  3UVJ B;  5ETR A;  5GAE I;  1SPB P;  2OP5 A;  2Y0S D;  4OI0 A;  1XTZ A;  4DQQ A;  4OHW A;  1HHS A;  3W9H A;  2EXU A;  3PRB A;  4U9R A;  1CJT A;  3BV8 A;  2MZJ A;  1FA0 A;  4GRS A;  2BKP A;  1PGZ A;  4WP3 A;  4HVZ A;  2GJF A;  3A13 A;  3O6Q A;  5ETQ A;  3HHL A;  5IT4 A;  1X4E A;  2HZC A;  5HJY A;  3I4P A;  1P1T A;  5H1S V;  4RJV A;  3QT5 A;  1NME B;  3T6B A;  3CC7 S;  1K0V A;  5HVF A;  4JV2 A;  2GGP B;  1BQM B;  3O44 A;  1ARO P;  4TQS A;  2OTJ S;  1Y3K A;  2EK6 A;  4WKR A;  3ENA A;  4YR0 A;  2H9Z A;  1WHY A;  2WZ1 A;  1R6Y A;  2LDY A;  2APO A;  3KMS A;  5LJ5 Y;  4P10 A;  1KS2 A;  3ADA C;  2M0G B;  1HHQ A;  1FDN A;  3PXG a;  2X1F A;  4TVA B;  3E2E A;  4V19 J;  3ILL A;  2ZKU A;  3R3T A;  1JNZ B;  4YHH F;  3VZI A;  1WC4 A;  5BYQ A;  1LKZ A;  2YPZ A;  3HVT B;  4KRW A;  2YQ3 A;  2FIU A;  1EP4 B;  2DNY A;  2W2P P;  3BYP A;  5LMU J;  3FVY A;  3IS9 A;  3N4W A;  3UO0 A;  1GAO A;  1QM9 A;  3OFE A;  1RT2 A;  1X31 C;  3TAQ A;  2HFO A;  3D0I E;  4CDI A;  1U49 A;  2E5L J;  2V4J B;  3MM5 A;  5J2P A;  1VOM A;  4OJH A;  2VFV A;  3LPE A;  2ZJQ Q;  2QA4 S;  3RB0 A;  2CAD A;  4LF9 F;  4JI0 F;  4J9N A;  3BGF A;  4EZ9 A;  3BKU A;  3IG1 A;  4LSN B;  3NL0 A;  4K4Z A;  1SKW A;  1EET B;  2BJD A;  4TYB A;  1VIX A;  1KC8 T;  2BAC A;  4J9P A;  2I2Y A;  4JI1 F;  2E9Z A;  2GA7 A;  3UCZ P;  2NYI A;  1AB8 A;  1S1X A;  3QT8 A;  3U27 A;  4UUX A;  3G71 S;  1S1T B;  3VTI A;  1VQ9 S;  3C19 A;  5KG7 A;  5KFR A;  2VFR A;  3TNV A;  3OHB A;  1QTN B;  3GV7 B;  2H51 B;  2D3O R;  2MKJ A;  2R7T A;  3PYE A;  4OZ3 A;  4DN0 A;  3AOB A;  3ZXW A;  4Y2K A;  4RO0 A;  5AXK A;  3K89 A;  1F3V A;  3PRV A;  4CLF A;  2ADB A;  4YDD B;  1DLO A;  5KFE A;  4YR3 A;  3OL9 A;  5L9X A;  1U1Q A;  1NPK A;  4Y0F A;  1RTJ A;  1XEZ A;  2XBP A;  3W8G A;  1IM4 A;  2HHU A;  3MR5 A;  5KOX A;  3E3X A;  1IKV B;  2YWH A;  3RBE A;  4K4S A;  2LQJ A;  2YKQ A;  4FVM A;  2VC1 A;  2QLJ B;  4KGZ B;  2BOP A;  4L74 A;  2C42 A;  4OYI A;  1FF2 A;  5C7P A;  2ERR A;  3G86 A;  2LQ9 A;  1WWH A;  1CQM A;  1RLD A;  2KVQ E;  4ZPC A;  1VQ8 S;  1U24 A;  2H65 B;  3Q0A A;  1MU2 A;  4IOC Q;  1LFP A;  4C3K A;  4PG5 A;  1YK9 A;  2ZHO A;  1YJV A;  4J9L A;  3PR4 A;  2BRK A;  3B4D A;  3I32 A;  3MMC B;  1JLE B;  1S1V B;  2UUA J;  2CYY A;  2AHO B;  2M4M A;  2DD8 S;  4YR2 A;  2KRR A;  3NWG A;  1ZBT A;  2HW3 A;  1TTH B;  5HVH A;  1FRX A;  2XMW A;  1FWL A;  3W3S A;  4F2R A;  4S0M A;  1IBC B;  1U02 A;  1UET A;  1YBT A;  3VAJ A;  2N4D A;  4DV5 F;  3JQK A;  3R2C J;  1A9N B;  2NR0 A;  2KDO A;  1ZPW X;  2YKO A;  1DQ9 A;  4QQB A;  2GIQ A;  2HIY A;  5F8M A;  1Q4R A;  2X3G A;  2ZIT A;  3M8S A;  2DY1 A;  3CD7 A;  2XNR A;  3RBD A;  1NJY A;  4DHV A;  3IXQ A;  1RT5 A;  1VDH A;  4B3R J;  1VIS A;  3M8Y A;  4WTO B;  4HEA 9;  3KLH A;  4QIE A;  2VC0 A;  2X1B A;  5CAB A;  5ETP A;  2PSZ A;  2CQ1 A;  1UP1 A;  1FTR A;  2UUB F;  5D0R A;  1S10 A;  3Q89 A;  3MPU B;  4LF6 J;  2VAS A;  2CXE A;  4ILR A;  2PE8 A;  4D3G A;  4P2S A;  4OX9 F;  5F0W A;  3KJQ B;  3HUL A;  3GE9 A;  1VQO S;  1GMW A;  5F41 A;  1TMM A;  1LNQ A;  2XWY A;  2IC3 A;  4CLS A;  1RA7 A;  4LF4 F;  1RHK B;  2QSW A;  1NH8 A;  4K4V A;  4ECY A;  4DPW A;  1IUJ A;  4UZC A;  3AQP A;  4OV1 A;  3C6U A;  2KG1 A;  3A8E A;  4ZVO B;  2AX1 A;  4O0I A;  3C8Y A;  4ZIW A;  2KT2 A;  3LUY A;  2ZWP A;  3IRX A;  4F25 A;  4DQS A;  1U2F A;  5BYS A;  1FX4 A;  1XK8 A;  4F7V A;  1GMV A;  4LF8 F;  3GB0 A;  2BKN A;  1ZM3 A;  4W98 A;  2J7K A;  4WF9 Q;  2CDQ A;  1S1U B;  3DLH A;  1J2V A;  1X8D A;  5GAD I;  2PN6 A;  4D3H A;  1RYS A;  4K50 A;  4NOH A;  3MCM A;  1S9G A;  3OVA A;  2BAN B;  2PA8 D;  2QMW A;  5DDR C;  4IYQ A;  2HGL A;  2MMY A;  2BW2 A;  1IBK F;  4UY8 5;  2LVW A;  2B9E A;  1TUV A;  3PYF A;  3N0V A;  5F9N A;  4GKK F;  2B4V A;  3UD4 P;  4DV1 F;  4P2M A;  4DV7 J;  1ELO A;  4AXJ A;  1F5A A;  1FK9 A;  5ETT A;  4I7F A;  4G1I A;  1D8Z A;  3IBC B;  1VI7 A;  1UW9 A;  2HBQ B;  3RG6 A;  2FJA B;  2FVR A;  1P1L A;  1FRK A;  3DYA A;  5CCL A;  1Y5L B;  1VLY A;  2VOP A;  4ED5 A;  3QJL A;  1RT6 A;  4RUC A;  5GMD A;  4BS2 A;  3S6E A;  2IJN A;  1IBM F;  4KKO B;  1PO6 A;  2B6A A;  4JV5 F;  4UTG A;  1GH8 A;  1JKH B;  4DUZ J;  3VGU A;  2VV5 A;  1NCL A;  3R5D A;  1BQX A;  1YTY A;  2G0I A;  4DWI A;  4PUO B;  2Y1J A;  4I6A A;  2K3I A;  2AGP A;  1YJW S;  3DOM A;  2KZM A;  2WB1 D;  4H54 A;  3B8H A;  2NPI A;  1AYE A;  2DIS A;  5A8W B;  1WKK A;  4C4W A;  4YN3 B;  4J9R A;  1G4C A;  1YKW A;  1GXL A;  2BE2 A;  2KYZ A;  5IV3 A;  4PAA A;  1H72 C;  4M5H A;  2DRD A;  3ZZR A;  3HZG A;  4JV1 A;  4ZVQ B;  2KH9 A;  3PVX A;  2FJB B;  2P9C A;  5F3Z A;  3V2U C;  2VQF F;  2DPI A;  4AT1 B;  2DGX A;  3IM8 A;  3NS5 A;  2W4P A;  1PJ7 A;  2BJ9 A;  3LQV A;  2JEJ A;  1WOR A;  1L3S A;  4YEA A;  5SZT A;  3N6L A;  1C1C A;  3T1H J;  4K59 A;  3DDI A;  3CDB A;  1JQG A;  1TL1 A;  1FER A;  2F1F A;  3HP6 A;  2MXY A;  2B51 A;  4PWD B;  4I0W A;  4C3L A;  1Y10 A;  2R2R A;  1WOP A;  7AT1 B;  3DGP B;  1UVL A;  1UWB B;  2E1P A;  2VPY B;  1UFW A;  1NSQ A;  4Q8E A;  2FC8 A;  2OEL A;  3DOK A;  2AYE A;  3GG0 A;  3PZP A;  1QVG R;  2J0W A;  3FBF A;  3M6U A;  1WKL A;  4OJ3 A;  5C2G A;  2RKI A;  4OZ1 A;  3ZZT A;  3IM9 A;  3BJY A;  3TX0 A;  3PR5 B;  3S7R A;  4AQY J;  4WTY A;  2KJV A;  1NK4 A;  1DJ0 A;  3W5Y A;  3GIL A;  1U1O A;  1JLB B;  1GNK A;  3TVZ A;  4JV0 A;  4OHX A;  2EFN A;  1N5Q A;  2YX1 A;  5L39 A;  3DRP A;  1OPZ A;  3W64 A;  3PO4 A;  4RBV A;  1Y0H A;  3LP0 A;  2FY1 A;  2RDJ A;  2AJ1 A;  4CH0 S;  4CYU B;  1Q8K A;  2MSS A;  1CVJ A;  4EO6 A;  2R42 A;  3A4T A;  1IJE B;  3VWS A;  2XB2 D;  4DL3 A;  2EEY A;  1FJE B;  1CJV A;  3EGW B;  5EGY A;  4WE1 B;  1WDT A;  3VAI A;  1BWE A;  1M5O C;  3J7Y U;  1NDP A;  5MAO A;  3CCU S;  2W24 A;  1VHI A;  3Q8Y A;  5GMK a;  1T03 B;  2W4C A;  1CJT B;  3C2P A;  3SSR A;  3U02 A;  3CT9 A;  3P49 B;  3CJS A;  4R0E A;  3EJM A;  4GKJ F;  1BQN B;  4CO1 A;  1X60 A;  2A6O A;  4NXM F;  3BPS P;  2JNJ A;  2RU3 A;  1S6P B;  4PG4 A;  2JWN A;  4QIW D;  2UU9 F;  1NSP A;  3W62 A;  3O5T B;  3I56 S;  1PC5 A;  3MUR P;  1HW8 A;  1YZ7 A;  3VGV A;  2C3M A;  4EYH B;  4ED3 A;  3SFU A;  4Y6I A;  2JJ4 D;  2AT1 B;  3MOJ B;  2KU7 A;  3A1Y G;  4XIU A;  2XGP A;  1XMQ J;  2DNP A;  2XO6 A;  3DDN A;  1VGY A;  1PC4 A;  3RW6 A;  3HHL D;  4HYK A;  1RCX B;  4WCE Q;  2Z2Z A;  4UF4 A;  2LU2 A;  3SCL E;  3PJX A;  4NLT A;  4Q45 A;  3MMB B;  3H2L A;  5CYM A;  4F0M A;  1WTB A;  3NGR A;  2V5H G;  2ZVS A;  2HNZ A;  1DTQ A;  2HVE A;  2YKA A;  4ZDN A;  3SCJ E;  3T1A A;  3Q22 A;  4A8O A;  4ECQ A;  5H9F J;  2CWK A;  2L9W A;  5F8I A;  4LR7 A;  3BYR A;  1TR0 A;  2HND A;  2H3E B;  3KLG B;  4CRJ A;  5CQG A;  4DSJ A;  5KFP A;  5D3G A;  3CO9 A;  3R7N B;  3EVM A;  5B0E A;  3IS9 B;  3AB4 B;  1NJZ A;  4NCG B;  3GZ7 A;  3QYY A;  2YNI B;  3PTW A;  5EWF A;  4Q0B A;  5AJ3 F;  2JFD A;  3ITH B;  3FFI A;  3PKY A;  2LXU A;  3UCU P;  2LA6 A;  5DRK A;  1VK3 A;  1RQ0 A;  3C6T A;  2BDP A;  4FS2 A;  2IMO A;  3W2W B;  3BR9 A;  2HPU A;  3UN3 A;  2CQ3 A;  1VYA A;  2DGQ A;  5D6G A;  2WBM A;  4RBT A;  2CJQ A;  4A8M P;  4LF1 A;  3GSD A;  2EW9 A;  3JAM Y;  4DU8 A;  3PNI A;  4I69 A;  3OFF A;  2MKS A;  3V4I B;  3OTB A;  5CA5 A;  1SV5 A;  1I94 F;  3G2X A;  1N5Y A;  4KFB B;  3BH7 B;  2LEP A;  3MM6 B;  1RT1 A;  4LFC J;  3TZW A;  1SL0 A;  2BQU A;  2DNM A;  3V81 B;  4U7U D;  2AWZ A;  4F02 A;  4HLB A;  3BSN A;  1T0T V;  1JLQ A;  3CE8 A;  3D3C J;  2RQ4 A;  3CD5 A;  5F0U A;  4QR1 A;  3PG9 A;  1IM6 A;  3NXZ A;  2B4O A;  3MAA A;  4WFA Q;  2Z2L A;  2HZV A;  3C16 B;  1C2P A;  4UY8 T;  1TK5 A;  1XIQ A;  3BN4 A;  4RNH A;  3FBE A;  5DM6 Q;  4U7C A;  1MG7 A;  5BYR A;  4N7T A;  4BHQ A;  3SYZ A;  2MYF A;  2HVD A;  3I5B A;  1VMB A;  1B64 A;  2WVD A;  4LSL A;  2BJE A;  2DVI A;  4IG3 B;  3MZI A;  2W1B A;  1EZZ B;  2WSE C;  4N41 A;  4C9D A;  1N48 A;  3KHR A;  1ZM4 A;  2GNK A;  1H6K X;  1VCT A;  1N32 J;  3DM2 A;  4TQR A;  1YVF A;  2CPY A;  4DV4 F;  2R8J A;  4ERD A;  4P7T A;  1TKX B;  3TJA A;  3U1M A;  4QW8 A;  4IRK A;  4NYP A;  4TU7 A;  4ECS A;  3KDN A;  1C0T B;  4PXC A;  4U8V A;  3CCV S;  3IP0 A;  2DYA A;  1XBW A;  3AB2 B;  2CQI A;  4X84 A;  5HSP A;  4PYD A;  2VD3 A;  2IIH A;  4OV6 A;  2UZA A;  4PXB A;  4CTA B;  1CQN A;  5I3P A;  4U8Y A;  1XNQ J;  3THV A;  1S79 A;  5HRO B;  1JX4 A;  4PR6 A;  1HNI A;  3EDQ B;  1Q53 A;  3TR5 A;  4CH7 A;  1HWJ A;  4EBC A;  3GU0 A;  5J2N A;  5L8R C;  3QFW A;  2VBX A;  3DHW C;  3CCS S;  2RDI A;  4HI2 A;  1DY3 A;  1M5K C;  2VFT A;  2BJ3 A;  2XSJ A;  4J9S A;  2UXD J;  1C0U A;  3MFI A;  2RD5 C;  5ETS A;  1TZ0 A;  4F67 A;  2IM2 A;  3IBW A;  2PGC A;  3AOD A;  1GMW D;  3IRX B;  5KG0 A;  1RTI B;  5CZX A;  1HBN A;  1TKT A;  2DCL A;  3MEE A;  1ITP A;  5IT0 A;  3CJ5 A;  1H2U X;  1TKZ A;  4J5O A;  2XI2 A;  3QAE A;  3NCP A;  3V6H A;  4OYA A;  3MHY A;  3HFK A;  3EZO A;  1RU2 A;  5IXU A;  3DRS A;  1RTD B;  2B3T B;  2E9T A;  3G9C A;  3M8Q B;  5H9F K;  4NLX A;  3QGI A;  2AV5 A;  3CPW R;  3GJR B;  1RJJ A;  2EWH A;  1WF0 A;  3JYT B;  1S0M A;  1FFG B;  2JRS A;  2FJD B;  1I5O B;  4URS A;  5KT6 A;  3C14 A;  2KRB A;  3VVT A;  1HKA A;  4CO4 A;  5BJR A;  1FNM A;  1NZA A;  1RAJ A;  4ZHR A;  1PYO B;  2V8D A;  4I7F B;  3C15 B;  4DL0 C;  3P3D A;  4RU9 A;  4LFA J;  4ZPD A;  5LMN F;  2AKW B;  1VC5 A;  4TY8 B;  4DG1 B;  3W63 A;  2VG7 A;  1TL5 A;  4KV8 B;  4N8N A;  1XJW B;  1QVF R;  3CJ3 A;  5KT3 A;  5L46 A;  4UT4 A;  2UUT A;  4C11 A;  1RT6 B;  4N5S A;  1NLK L;  3CO0 P;  4C8L A;  1E6Y B;  3MEC B;  3T6J A;  1ULR A;  2YWF A;  2GW8 A;  2VDI A;  4FYW B;  1BLU A;  3IWX A;  5HK4 A;  2E66 A;  4DDF A;  2YNF A;  1J5E J;  1JLF B;  5LJ3 Y;  3DLK A;  4RZR A;  4CO5 A;  5D4P A;  1FNO A;  4LJM A;  4B3M J;  2DXD A;  2KXH A;  2WOM B;  2YNG B;  3CJ8 A;  2VFU A;  1HQE A;  1NND A;  3ENQ A;  3MWB A;  3TRG A;  1AA1 B;  4NI2 A;  4USU A;  3Q8R B;  2HS4 A;  3K17 A;  3CJ4 A;  2H1Y A;  3KUG A;  2BE9 B;  3TQ1 A;  2QLF B;  2XS7 A;  2OH2 A;  4EGL A;  1W25 A;  3J81 j;  2D9O A;  3AA9 A;  3EVW A;  1SKR A;  4ZVF A;  4QCL A;  4FYV B;  1UZD A;  3QNW B;  2HAF A;  2HHH F;  2DCU B;  3CJK A;  1KWM A;  1UJ6 A;  5D77 A;  4ZLJ A;  3OL7 A;  1NKE A;  3EUN A;  8ATC B;  2UVW A;  4X65 J;  1B0T A;  4NX9 A;  1NUE A;  2HBR B;  1JMT A;  4ED7 A;  4F4A A;  2BEF A;  3SQG A;  1RAO A;  5HLF A;  3I4H X;  1VRU B;  1RHJ B;  3DLE B;  3NAH A;  4G1Q A;  1L3T A;  3M6W A;  4NXN F;  4I6Y A;  1UEV A;  4JI2 F;  2VBW A;  1S1W A;  3ET6 A;  4DR1 J;  5KFN A;  3DOK B;  3AY0 A;  5B0F A;  3IRW P;  4JYA J;  3BM7 A;  5C25 B;  1WHX A;  1X4F A;  2BUN A;  1CS4 A;  1RBL A;  3JTN A;  3M2R B;  2ASD A;  2RNE A;  2GMJ A;  4IQX A;  3R5B A;  1V3S A;  3FCV A;  1ZYQ A;  3DLB A;  2H5J B;  2XHC A;  4I2P B;  1ZZN A;  1HYS A;  2F3J A;  2IBO A;  4DS4 A;  4WFY A;  3ZFV A;  4LT6 A;  3ZC4 A;  4ECX A;  2ZE2 A;  2Q3P A;  4WZQ A;  2GAH C;  3LTO A;  2OAU A;  1S6Q A;  2V2V A;  3I0R A;  2GVD A;  5D0H A;  3T19 A;  3MTJ A;  2XO7 A;  1RAH B;  2AMC B;  2V4Q A;  3K5N A;  4O44 A;  2Y1L B;  1U6F A;  4QPX A;  4M5D B;  1D0E A;  1S0V A;  2XLK A;  4C0B A;  1IKX B;  1S97 A;  4LBI A;  1LW0 B;  2RRN A;  4Z7Y A;  3FRZ A;  2DO0 A;  1EQ0 A;  3QPI A;  4TU8 A;  2KN4 A;  3CUN A;  1U25 A;  3EIC A;  4KH1 B;  1CUL B;  4X66 F;  1NHU A;  3AAW B;  1SUQ A;  2HNY B;  4G3I A;  4USV A;  2HK3 A;  2GQQ A;  1RT7 B;  3BPD A;  1YBA A;  2ZOF A;  3KUE A;  4Q43 A;  4IKA A;  3KG1 A;  1RK8 A;  5A76 A;  1RT3 A;  1F2G A;  2COL A;  4J9K A;  5IT9 Y;  1SJF A;  4ZJO A;  5E3Q A;  1ZM2 A;  2CJX B;  1FRJ A;  3OVB A;  1NZ8 A;  2I6W A;  3K5M A;  3G8S A;  1RUS A;  3MM7 A;  2B8Q A;  2M9K A;  2A2D A;  1RT4 B;  2W9C B;  2X3D A;  2V34 A;  2XMA A;  2HAI A;  3NNC A;  2YKM A;  2PEB A;  3HHK A;  1TVR A;  2DKO B;  2ZJP Q;  2ZBR A;  1S0N A;  1X4A A;  1FT8 A;  5B0G A;  4NLU A;  1RHQ B;  4H4K C;  5GAE U;  3TEH B;  3NMA A;  5A0Y B;  2J9E A;  2I9S A;  1T8E A;  4Q8F A;  1KVJ A;  4Y34 A;  1JK9 B;  2VIH A;  1M90 T;  1FXD A;  4UOC A;  5HMZ A;  3SIP B;  4RPF A;  2VQE F;  2MGZ A;  5KFO A;  1C1B A;  4ICL A;  4RWW A;  4O3O A;  4FKX A;  5DLG A;  2FQQ B;  1WF2 A;  5ETN A;  5KFF A;  5EX3 A;  5ETV A;  5EX0 A;  2WAQ D;  2HEK A;  3IGV A;  1CC8 A;  1OIA A;  4FP9 A;  3GFY A;  4UW2 A;  5BXI A;  4OZL A;  1N54 B;  4ZVG A;  4Q0B B;  2DR5 A;  3VAF A;  1EQM A;  3HVA A;  4DSK A;  4X4P A;  4DCO B;  1Y5N B;  4ZP6 A;  4EI2 A;  4DR7 J;  3L9Z A;  1HWK A;  5DZ7 A;  1LW2 A;  5HAO A;  2XZD B;  4NLV A;  5JUM A;  2HWH A;  2DHA A;  3TUJ C;  4DR3 F;  3G82 A;  2R7V A;  5KG6 A;  4L3N A;  2V8P A;  2KI2 A;  2IRX A;  2G1D A;  2OO4 A;  5I3U A;  2FVQ A;  1KLM B;  3M8P B;  1TUG B;  4HHU A;  2I8E A;  5I42 B;  1RWU A;  2R2T A;  1P9Y A;  1T95 A;  3PX0 A;  4LR8 A;  2F7V A;  3CIZ A;  3HJV A;  2UUC J;  2ASY A;  2HHW A;  4C7Q A;  3J81 Y;  3FQK A;  1HPZ B;  2CQH A;  3HT3 A;  1LK5 A;  2R4F A;  1NPR A;  1ZH5 A;  2NXE A;  3JAM U;  3CME S;  3BR8 A;  3CDW A;  1TMJ A;  2GVZ A;  2FVC A;  2NSC A;  4QR0 A;  1GEH A;  3PHT A;  5D4L A;  5G4D A;  2HQ3 A;  1HQU B;  1N8R T;  4ED2 A;  3QJP A;  3G6V A;  4N77 A;  2XQC A;  2GIR A;  3N79 A;  3DGV A;  4USI A;  3CCR S;  3BKF A;  3JTO A;  3B6B A;  4EU0 A;  3UI3 A;  4QR2 A;  5EWE A;  4R5P A;  4DFP A;  2OD4 A;  4A8X A;  1MN9 A;  4ZPT R;  4LQ3 A;  5KT2 A;  2OPQ B;  4YY3 F;  1TL3 B;  2IBK A;  2Z2M A;  4M5N A;  3TWZ A;  2LXI A;  2U2F A;  1F5C A;  4H4M B;  5KT5 A;  1Q1K A;  5IM0 B;  2DNG A;  2UP1 A;  3MR6 A;  2ZC3 A;  4BWM A;  3WX4 A;  5KFT A;  1J5O B;  4PG8 A;  4DL4 A;  3NP5 A;  1BMQ B;  3BZQ A;  1QD1 A;  4HT5 A;  4X4O A;  3E51 A;  1NJI T;  4KAI A;  4KPY A;  4DPT A;  2V2K A;  1RXO B;  2F5G A;  3AJD A;  2VBZ A;  1Y9O A;  1UFK A;  1H0H B;  2VA2 A;  1HI1 A;  1RLC L;  3LP2 A;  2CA9 A;  3WC0 A;  2DK2 A;  1RWW B;  2V68 A;  2FC9 A;  2OEK A;  4M5G A;  5HP1 B;  2CQP A;  1REV B;  2XLI A;  2AJF E;  4CLZ A;  2K06 A;  2PEH A;  2QC3 A;  3M9M B;  2YX7 A;  2UVV A;  2QL9 B;  3EPI A;  4NLS A;  5CYJ A;  1FWP A;  1DBD A;  1SXL A;  3P8B B;  1LWF A;  2OD6 A;  2MQM A;  2HHP A;  3UVJ A;  4KHP J;  4PPD A;  1PIE A;  4MKB A;  4ED1 A;  4DU7 A;  4WBF A;  4CT8 A;  3QWU A;  2RQC A;  3PW5 A;  1HMV B;  2UUW A;  2K7J A;  3MCN A;  1ZPV A;  3LA0 A;  2AD9 A;  1PYT A;  2IM3 A;  3VAK A;  3R1H A;  4Z7C A;  2CPF A;  2FDN A;  4IFV B;  2HKE A;  2NXC A;  1HIY A;  2DJW A;  2BJ7 A;  5KFU A;  4JOU A;  1NHK L;  3UPF A;  2QMX A;  1UEU A;  4O23 A;  4OHV A;  1OYE A;  4BC9 A;  1FNX H;  2L41 A;  1FVS A;  1FDB A;  2DNQ A;  4OYO A;  3A3N B;  2J8A A;  2KFY A;  2GGP A;  1ACM B;  5CH7 B;  3NMR A;  4C3M A;  3HLU A;  2QA4 G;  3TEG A;  4XO0 A;  1HBU B;  4X62 F;  3MPV A;  3R5J B;  2M88 A;  3CIM A;  3IWL A;  5GAH I;  4V1A k;  3BBF A;  3W61 A;  4HKQ A;  4KHR A;  1T3N A;  4I67 A;  1RZM A;  1ZOT A;  2R3V A;  1FKP B;  1TKD A;  1WD6 A;  2H48 B;  4H4O B;  5LSO A;  3JS9 A;  2AJ0 A;  2DIT A;  2V2Q A;  3C14 B;  1SJQ A;  4MKA A;  2HG4 A;  3TVY A;  2CFX A;  1EP4 A;  4ELT A;  4LBP A;  3HVR A;  4YDX A;  5DDO C;  4L76 A;  3D9B A;  4GC6 A;  1B3T A;  5L1I A;  2IMW P;  3OR2 B;  1ZAV A;  3HDS A;  3G4S S;  4B9S A;  1NKB A;  1NM2 A;  1VQN S;  1M5H A;  2V4J A;  4DV0 F;  3GP9 A;  3CB4 A;  5DDQ C;  4ZIV A;  2ILY A;  4OYZ A;  1VQS A;  4CZC A;  3KK3 B;  3W1Y C;  5DJB A;  4JUZ A;  3DI6 A;  4C6A A;  2FB0 A;  4LSN A;  3A12 A;  2XCA A;  1EET A;  4JI4 F;  1SI9 A;  2CZ9 A;  4OHZ A;  4QU6 A;  5BR8 F;  5GAD U;  2XG8 A;  3TUI C;  1P9Q C;  3TZY A;  3I0S B;  2H4W B;  1S1T A;  4FVC A;  3NWR A;  3R6L B;  2QYG A;  3H2U B;  4NI2 B;  4IH6 A;  1YJR A;  3TQE A;  1LEO A;  3LWL A;  3CC2 S;  2IM1 A;  5DLF A;  1PCA A;  2FYX A;  3KLE B;  3S01 A;  5E2Q A;  2EFO A;  2QG9 B;  3KLI B;  3QFH A;  2ZH4 A;  4FXW A;  3IWN C;  1SJR A;  3KXD A;  1KBR A;  2FPH X;  2Q6C A;  4I64 A;  5C24 A;  2D3U A;  2V69 A;  4HAC B;  4DR2 J;  1VRQ C;  3OTO J;  1X4C A;  2BJ8 A;  2W7O A;  1Q5V A;  3HFZ B;  1NK6 A;  4PKD B;  3PJW A;  2QSF A;  2Y1R I;  1IKV A;  3ICL A;  5GAG I;  2DY9 A;  4C0H A;  3MUT P;  1TV6 B;  3BQ0 A;  1R0B G;  3ETO A;  2DH9 A;  2GS8 A;  2K2P A;  2C3Y A;  3PAC A;  1FX2 A;  3RBX A;  6FD1 A;  4K8R A;  2FY8 A;  2ZOG A;  3W2V B;  4FYD A;  3PW2 A;  4DV6 J;  2JFK A;  4RR5 A;  4AXI A;  3AXM A;  2IYI A;  2ALY B;  1S9E B;  3RAQ A;  4TLR A;  2D3Z A;  1KQS R;  2ABY A;  1FHT A;  1B0P A;  3MMC A;  1JLE A;  1SIW B;  2CJ9 A;  2HRY A;  1S1V A;  3D1H A;  1MRO B;  5C42 B;  2DNK A;  2QMU B;  2RB7 A;  4DSI A;  1FFW B;  4F4K A;  3AXK A;  4ECR A;  2YKN B;  2ZFH A;  5LMU F;  4C8M A;  3OBI A;  3KDO A;  1BGX T;  1U8W A;  4X4S A;  4USW A;  2E5L F;  3DLG B;  2AZ3 A;  1KVK A;  3P45 B;  4NCA A;  4RBU A;  1XNR J;  8AT1 B;  4JI8 J;  2Q79 A;  3ZTR A;  1VBY A;  2LXF A;  2MQQ A;  3ILO A;  4R0J A;  4KYZ A;  3SMZ A;  4ID8 A;  1K44 A;  5AE2 A;  1X5P A;  4Q44 A;  2YQ0 A;  4A8K A;  4TLQ A;  2O66 A;  1R0C B;  4O4G B;  2HQF A;  3FMW A;  4N47 A;  5CD4 H;  2HHS A;  1M1H A;  1U6Z A;  3AH6 A;  2ZD1 A;  2BM1 A;  1BY9 A;  4B3O B;  2VPX B;  5HI7 A;  1VJW A;  3RB3 A;  2PO4 A;  1HQ2 A;  2L48 A;  2EKY A;  3K58 A;  1LOU A;  1RSC A;  3L09 A;  4L72 B;  2UV8 G;  3I96 A;  4DFK A;  5J1E B;  2FLO A;  4NA1 A;  2BR0 A;  1QJH A;  4U67 Q;  4KGK A;  4CIO A;  3WZ0 A;  2RVJ A;  1WC5 A;  3EYZ A;  1DRZ A;  2CNN B;  3MR3 A;  3IMQ J;  1RWX B;  2XY7 A;  4W4M A;  3UCG A;  3UDE A;  5J2Q B;  1FXR A;  5F8J A;  4I1T A;  4F4W A;  3NGT A;  1S1U A;  2J9D E;  3JTP A;  1S7H A;  2XMV A;  4F50 A;  5FLX Y;  2R7R A;  2BAN A;  4YY3 J;  2EK1 A;  4YB7 A;  5A8R A;  4M95 A;  3R9L A;  5IT9 U;  2D1C A;  2RRB A;  2XLJ A;  4WU2 A;  3MPY A;  2HHV A;  2KXN B;  2DR6 A;  1SQG A;  3DN9 A;  4Y2A A;  1Q0N A;  4NLQ A;  2UUA F;  4NLY A;  2PMZ D;  4DXL A;  2JVO A;  4JI7 J;  3CW2 C;  5LSR A;  1CEZ A;  2DHG A;  4KSE B;  5KFD A;  1WEY A;  2EFG A;  3M8R A;  1O51 A;  2WHO A;  4ZPW R;  4NLD A;  2CPZ A;  3BBB A;  1U1N A;  3PEH A;  4H4K A;  5DDP C;  2O01 C;  1Z4U A;  2QO3 A;  5FII A;  3Q23 A;  4KKO A;  4FYX B;  1XN9 A;  1JKH A;  3QZ7 A;  4HTI A;  1WC1 A;  4I56 A;  2EBG A;  3VGS A;  4AND A;  1O6X A;  3L7O A;  4ZVH A;  3SV4 A;  4B3R F;  2MLZ A;  5A2Q Y;  2RDD A;  4U7U K;  1EB0 A;  1SJ3 P;  2CG8 A;  1D9A A;  4PUO A;  3QJJ A;  3DOL B;  5DGB A;  1X5O A;  3G82 B;  1JXL A;  3L3C A;  4ZVP B;  5A8W A;  4G1P A;  1J27 A;  4LF6 F;  5I3U B;  4HTJ A;  1VBK A;  3FUY A;  4ECU A;  4DOZ A;  3UN5 A;  2VPZ B;  2VG6 B;  2HWT A;  2HFZ A;  4LBH A;  3W9J A;  3RB4 A;  3H59 A;  5IWA J;  4KPC A;  4NAS A;  3TAM B;  5HAT A;  4CI0 B;  2GAG C;  4DJB A;  4C8O A;  5E33 A;  4LRA A;  3V6J A;  2RIJ A;  3AT1 B;  4G65 A;  4K4Y A;  4DCJ B;  2M5Y A;  5U47 A;  4TXS A;  2ZDO A;  2VOD A;  3TA2 A;  1KQF B;  3P6Y C;  1YGY A;  3KJN B;  5KFW A;  4K0K J;  3MAH A;  4RUA A;  1Q86 T;  2HBZ B;  1KQK A;  2XC9 A;  5I4M A;  3RRK A;  3BGR B;  2ZBP A;  4PWD A;  1T11 A;  3X1L B;  2HRT A;  3ZZY A;  3KHG A;  3DGP A;  3MXH P;  3EGN A;  1UWB A;  3E8O A;  3J81 U;  4CCH A;  4R5P B;  1KFS A;  2KVI A;  4CO0 A;  1GX6 A;  2DGV A;  4YP3 A;  3NS6 A;  2YQ1 A;  2HQI A;  4EZ6 A;  4CH1 A;  1IQZ A;  1F5B A;  4C0O C;  4DV7 F;  2MKI A;  4ZP7 A;  3VQT A;  2PT0 A;  1JLB A;  2JLG A;  3P96 A;  4QZV B;  2MHE A;  2XYH B;  1RDR A;  4HT7 A;  2WCX A;  3R7B B;  2RIL A;  1BE4 A;  1RTH A;  1MWY A;  4MTP A;  4WZM A;  1MMD A;  1REG X;  4OYX A;  4KJI A;  2KTQ A;  3R5G A;  1RYR A;  4U6P A;  2Q66 A;  4CYU A;  1CG2 A;  2DR9 A;  2I1R A;  3KJF B;  4DUZ F;  2YWE A;  1KEK A;  4JI4 J;  1APS A;  1KP6 A;  2RUG A;  1RAD B;  4RW7 B;  4OJ1 A;  4GVL A;  1D9F A;  4WE1 A;  2W25 A;  1N5T A;  4YOE A;  2IAJ B;  1YJT A;  3FZB A;  3QAU A;  1IBL J;  1R43 A;  1WSV A;  3PDN A;  1W26 A;  4ECV A;  5KG1 A;  1F60 B;  2L9N A;  5G0R A;  4ECW A;  4ZCL A;  1T03 A;  3RBZ A;  4L6V 3;  3ZTP A;  1BQN A;  1MMN A;  3RZA A;  2ROP A;  1S6P A;  4ZLL A;  2U1A A;  2JLF A;  3NLC A;  4AD6 A;  3FJ2 A;  5IQ6 A;  2WW4 A;  5CYQ B;  1ZA1 B;  3OXF A;  1U7L A;  5C5J A;  4UOH A;  1Z2L A;  2AEJ A;  4LR9 A;  2FHJ A;  1NH7 A;  2PMW A;  4CM2 A;  3GCX P;  5ETM A;  1G1X A;  3KUH A;  2MZS A;  3T1H F;  3D7S B;  5EN1 A;  2FHK A;  2IA0 A;  2DH8 A;  4F3O A;  2P6S A;  1WI8 A;  3ZZP A;  2DHH A;  3TP2 A;  2A10 A;  3FDS A;  4TNO A;  2KG0 A;  3UQS A;  1SJ1 A;  2RU9 A;  3FGV A;  3NBP B;  4KTQ A;  2W2O P;  2XI3 A;  1GTE A;  5KFG A;  1R0A B;  3MMB A;  1IR0 A;  2XMJ A;  4E8U A;  4FS1 A;  2VKZ G;  2Z4P A;  4ZPV R;  4OZ2 A;  1AZS B;  2DNR A;  1LK7 A;  3CCW A;  2DGO A;  1WEX A;  1YSJ A;  5DET A;  1X5T A;  1VS3 A;  3GJT B;  2R7U A;  1UEK A;  3KLG A;  1HA1 A;  4AQY F;  2HQG A;  2Q6B A;  1EX8 A;  2N3L A;  1UMJ A;  4MFB A;  1FES A;  1EKR A;  2J7W A;  3G8T A;  5L1L A;  1O0P A;  5HQ8 A;  3AOA A;  3D0G E;  2ZNZ A;  5D0E A;  4NCG A;  2YNI A;  2BMB A;  3PHE A;  4DR4 F;  1HBO A;  2RF2 B;  2G0J A;  1XMO J;  4X64 J;  2CQG A;  2MZ1 A;  4R8U B;  4YB1 P;  3BGL A;  3ITH A;  4FPI A;  2CPD A;  1QTM A;  3BQ2 A;  4DX5 A;  4QIG A;  5IV4 A;  2Z0G A;  1G6B A;  4X4V A;  2QX0 A;  3K8V A;  3W2W A;  1OY9 A;  3DI6 B;  2MLY A;  4WIQ A;  2MZR A;  1PBA A;  2MDA A;  1LQ9 A;  4DV3 F;  3EZU A;  1BWV A;  1R8A A;  2J6S A;  2JC1 A;  5DO2 A;  4B08 A;  2E7W A;  1RBA A;  4WFN Q;  2B5J B;  3PFO A;  5KFK A;  4DUY J;  3HF5 A;  2F40 A;  4NYO A;  3QZ8 A;  3V4I A;  1VIO A;  4KFB A;  4CLL A;  2LKZ A;  2G2Z A;  5B0A A;  3MM6 A;  1EAR A;  3NRB A;  5ETL A;  2GJI A;  1FD8 A;  4IG0 B;  4ANC A;  3PX6 A;  3OTC A;  3THP A;  3UDL A;  2ZM6 J;  3HSZ A;  3V81 A;  4BCA A;  5C24 B;  1JLG B;  2CPI A;  2CUY A;  2C2K B;  4JI6 J;  3DMJ A;  3GWC A;  2VBY A;  1U1M A;  2RUS A;  3C16 A;  2EPI A;  5K14 B;  3Q2T C;  3DXS X;  4CO3 A;  2UXB J;  3WHI A;  1XMQ F;  2CPH A;  1NK7 A;  2OPS A;  1X5S A;  4F8R A;  1MW7 A;  4UUW A;  1Q79 A;  3KLF B;  4A46 A;  3MMA B;  3X3U A;  1K73 T;  1PJ6 A;  5EHH A;  2HVI A;  4YFU A;  3BO4 A;  1GTH A;  4OI3 A;  3T9N A;  4OI4 A;  4IG3 A;  2AW0 A;  3D54 A;  4QOT A;  4WYL A;  4MAK A;  4Q2L A;  3WQP A;  4Y2I A;  2CZ4 A;  1PKU A;  3W9I A;  2ZH2 A;  1FJC A;  1JWW A;  1RIS A;  2LEC A;  2NQP A;  1LXN A;  3GFX A;  1T02 A;  4CLK A;  3AD9 C;  1TKX A;  1WTF A;  1OO0 B;  2A1B A;  3CGI A;  1CSJ A;  3QGG A;  3AA8 A;  1S6U A;  1HI8 A;  4DPY A;  2R7X A;  1SC6 A;  1IVZ A;  3EM1 A;  2P5V A;  2ZNY A;  3R7S B;  4AE5 A;  3Q8Q B;  1C0T A;  1X9M A;  1EKS A;  3HI9 A;  3AQO A;  2ZZN A;  4JB8 B;  2JEF A;  4AL5 A;  1SB6 A;  1OMS A;  1HLW A;  3UDV A;  4E2F B;  4DS5 A;  3D67 A;  2R8I A;  3IC1 A;  1QSY A;  1S12 A;  1NKC A;  3M2U B;  4CTA A;  2J8S A;  2DNZ A;  4O4R A;  3FBB A;  3KK1 B;  5HRO A;  2LCW A;  3W65 A;  3JQJ A;  4DQR A;  4YB5 A;  2RQK A;  2IDL A;  5LL6 d;  2GV1 A;  1HFE L;  3GQC A;  5B08 A;  3PJ9 A;  4TU9 A;  2ZD1 B;  4RW4 B;  4KHM A;  4C98 A;  2H5E A;  4LFC F;  3GR0 A;  2DHX A;  2JSX A;  3M2V B;  3D0H E;  1Q8L A;  3HSJ A;  4B17 A;  2ADC A;  1HNW J;  4IOA Q;  2YY3 A;  1H7W A;  1CC7 A;  4ELU A;  3D4J A;  1P27 B;  2EKN A;  2PII A;  3SEO A;  2N82 B;  2BM0 A;  2RT3 A;  1RTI A;  4ZCK A;  2BVZ A;  5KFA A;  1Q16 B;  3L7U A;  4M94 A;  3TA1 A;  4DFM A;  2XY5 A;  4PQU B;  3OV7 A;  1N5V A;  4LRC A;  3UE2 A;  1R3N A;  1B0V A;  3FMB A;  1RTD A;  2AYB A;  4KC5 A;  3M8Q A;  2QE5 A;  1WNE A;  4OI6 A;  2OFH X;  2ROG A;  3MAQ A;  4DR5 J;  5AE1 A;  2YXL A;  1VLO A;  1YBU A;  2VJV A;  3JYT A;  3R27 A;  4RW8 B;  3K5P A;  5A8R B;  3ZZ0 A;  2YPY A;  2GX8 A;  1CLF A;  4QWA A;  2DGT A;  1NK9 A;  2AU0 A;  5HQL A;  2IVY A;  2ZOM A;  3K59 A;  4DN9 A;  1TK0 A;  4ZLN A;  2QA1 A;  2K3K A;  3CC4 S;  1N32 F;  2QZ8 A;  3BS9 A;  4IO9 Q;  3I5C A;  1JIH A;  3T1Y J;  3C15 A;  2GIF A;  2LDI A;  3C66 A;  1D1U A;  1RKI A;  2M70 A;  3PW4 A;  5FLX U;  3FKB A;  1FO1 A;  4TY8 A;  3MED B;  4DG1 A;  1X4D A;  4KV8 A;  2F8E X;  1CJU B;  1HW9 A;  5E3P A;  4Y2M A;  4EWT A;  2CJA A;  4ALZ A;  2MY7 A;  1OYD A;  2N4C A;  5KG5 A;  1E6Y A;  2B9W A;  3MEC A;  3VHQ A;  1O8B A;  5AT1 B;  4CNY A;  3I9V 9;  5LSL A;  4HL9 A;  3OXG A;  3MUV P;  1WSR A;  4FBT A;  3H4D A;  2LU1 A;  4FXD A;  1UVK A;  3OPK A;  3I82 A;  4PEO A;  1T9X A;  1XQI A;  4GVB B;  1RA6 A;  1JLF A;  3F41 A;  5T7L B;  2ZHA A;  2YWG A;  2WOM A;  2YNG A;  3GG1 A;  3LAM A;  1OPI A;  1RHM B;  4B9L A;  4FBU A;  4NZ0 A;  2HUR A;  1XNQ F;  3GSI A;  4PQA A;  1EHW A;  3D66 A;  2OGU A;  1SL2 A;  4A48 A;  1F9F A;  4KB7 A;  4ZPB A;  3IGN A;  1T9T A;  3QT6 A;  3LGH A;  3EXY A;  1N5S A;  5HMX A;  3H20 A;  2C3O A;  3VGT A;  4WFZ A;  3NGS A;  1YIJ S;  2IHR 1;  1L3V A;  3HKZ D;  1HWL A;  3HX9 A;  4OIX A;  3DCA A;  1TP7 A;  2C2Z B;  4CLP A;  5A2Q U;  2ZZM A;  1QE1 A;  2XYG B;  2UXD F;  2ILZ A;  1WI6 A;  3OXL A;  4LF5 J;  4DV2 J;  3NAI A;  3K8W A;  1NBE B;  4RWX A;  2CJY B;  3QGH A;  3Q8U A;  2MKH A;  4PXE A;  1JLA B;  4P75 A;  5THW A;  1VRT B;  2WVF A;  2FLP A;  1RKJ A;  1VRU A;  5T41 A;  2ATL A;  4B3S J;  3DLE A;  4J37 A;  3P4U B;  4NLR A;  4DMZ A;  2FUG 9;  3NS7 B;  1C4A A;  2R8G A;  3HVW A;  3HFV A;  1AUS L;  1QUP A;  4LSZ B;  1V5I B;  3CDE A;  1EAY C;  3KK2 B;  1ICE B;  3DRX A;  1U09 A;  2QL5 B;  5C25 A;  4RNO A;  1U1R A;  2NXJ A;  3M2R A;  2MLX A;  4BC7 A;  3V5R A;  3QRP A;  1HNV A;  2FZC B;  2ACY A;  2DRA A;  5DZ6 A;  3M6X A;  5L1J A;  3PCO B;  4LFA F;  1YJ9 S;  1TUW A;  2QEX S;  4M63 A;  4ATN A;  4I2P A;  2DR8 A;  1X4H A;  4EEY A;  4DR4 J;  2D74 B;  3KMQ A;  1SCJ B;  1ZAW A;  3B82 A;  3J80 Y;  4NPO A;  1RTH B;  2VKR A;  1U2R A;  4HHJ A;  3SXL A;  1F2H A;  2VFS A;  2MZQ A;  2MKC A;  4ER8 A;  3VAH A;  2DR7 A;  4F4Y A;  4NLW A;  1NK8 A;  1MWZ A;  4N76 A;  5KFS A;  2A0F B;  1QLN A;  4DV3 J;  2B0G A;  1J5E F;  2OPR B;  4A8W A;  1FJG J;  4HH1 A;  4B3M F;  2ACM A;  1RWP B;  3LP1 B;  4M5D A;  2VJU A;  4BBY A;  1M1G A;  2C2E A;  5K20 B;  1IKX A;  2CQ0 A;  2YWK A;  2HGN A;  3HSD A;  1LW0 A;  3UD5 A;  2IM0 A;  1VC6 A;  2HFS A;  2B8P A;  3GV8 B;  2CJK A;  4ITS A;  3DRR B;  4TY9 A;  5G0R B;  2CQ2 A;  2CQ4 A;  2A3J A;  1CUL A;  2HNY A;  4ID5 B;  4QIV A;  3TO8 A;  2ZH5 A;  1RT7 A;  5FDL B;  4YQW A;  1XR7 A;  2PI5 A;  3OQ2 A;  4QPT A;  2CG4 A;  4KO0 B;  3PW0 A;  1LWC B;  4IFY B;  2EFQ A;  2ZH3 A;  3W60 A;  1HHT P;  4LVO P;  2HHX A;  3P5B P;  2M3D A;  4X65 F;  1Q8B A;  1GX5 A;  4EYI B;  2C2O B;  2BAB A;  3M32 B;  1RT4 A;  2W9C A;  3T5L A;  3TAN A;  2HHT A;  3FEY B;  4ZVR B;  4WXW A;  5B09 A;  4URG A;  3VVU A;  3B54 A;  4YUD A;  2FHO B;  4UOG A;  3Q8P B;  1DAX A;  1T05 A;  5A0Y A;  4DR1 F;  2IRU A;  2UV8 A;  2KZZ A;  5IOL A;  3ZZZ A;  3BF4 A;  4JYA F;  4K5S A;  2XUL A;  4LIW A;  1A7G E;  2ASL A;  2CNK B;  2BRL A;  1KSP A;  5SUH A;  1NSK L;  4QW9 A;  1RHR B;  4MFB B;  1RAI B;  2I5J A;  4RX6 A;  3D6H B;  2RE1 A;  3SDE A;  3BSO A;  3K57 A;  1HBO B;  3I87 A;  2CPJ A;  3ETM A;  5B0D A;  2LYV A;  2YH0 A;  2Z30 B;  3M05 A;  3NCQ A;  4Z37 A;  2KXF A;  3RUB L;  3GIM A;  1X7V A;  2ROE A;  5T14 A;  3DFE A;  1FDA A;  2VA3 A;  5GAH U;  1BC6 A;  2PMH A;  1WG5 A;  2YNH B;  2QL7 B;  4AFF A;  1HD1 A;  2E1C A;  1DQA A;  5KTQ A;  2WON B;  3JB9 k;  2NYH A;  2P6T A;  2PI4 A;  2D7S A;  2UXC J;  1TU0 B;  5F9L A;  3QRQ A;  4N8O A;  1KLM A;  2FJV A;  1K0T A;  2ZUG A;  3M8P A;  1U4B A;  4DQI A;  5I42 A;  4ANE A;  2H54 B;  1RWM B;  2RAQ A;  2V9K A;  3A3P B;  4KT0 C;  3QT7 A;  1N0V C;  1E6V B;  2NXN A;  3LAN A;  1S9F A;  1HPZ A;  3OTE A;  2OJ3 A;  4JI3 J;  3SZ2 A;  1YJ7 A;  3V6K A;  1GK8 A;  4PYA A;  4NLP A;  3E01 B;  2MPU A;  3DLL Q;  3DMJ B;  2HFN A;  3LF0 A;  2E5J A;  2KKH A;  1QAY A;  3SCI E;  2BJ1 A;  2MTL A;  2V8H A;  1S49 A;  2BA9 A;  1HQU A;  1TFY A;  3PYG A;  3N6N A;  4WFX A;  3P5T L;  1HAR A;  5JVH Q;  3QSY B;  2OPS B;  5CHC B;  3DU6 A;  1S6O A;  1Y00 A;  2NUU G;  4LQ9 A;  5K8P A;  4ZJQ A;  1OS5 A;  4W90 B;  1JJC B;  2OPQ A;  1UPP A;  4MT1 A;  1TL3 A;  4WWS A;  3F0N A;  1FWK A;  1ZA2 B;  2KHD A;  3OUY B;  2A18 A;  2CKW A;  4H4M A;  2J0Q D;  1VFJ A;  5HBM B;  5IM0 A;  4OHY A;  1UFL A;  1DUR A;  1UKU A;  5DQI A;  1J5O A;  7FDR A;  3H8Y A;  4P7V A;  2ZBQ A;  2QA2 A;  4KE5 A;  4DL2 A;  2E5I A;  1HBM B;  2CQD A;  4O3Q A;  1IR1 A;  4FYY B;  1H38 A;  4URQ U;  5KT4 A;  1SH0 A;  4Z2X A;  5KFY A;  1FKO B;  1RAA B;  5GAG U;  4CLY A;  5HP1 A;  2E7V A;  3MD3 A;  2HFU A;  1REV A;  4DR7 F;  1KON A;  2RSQ A;  2OPP B;  1WG4 A;  3UD3 P;  1Q95 G;  1AFJ A;  3MM9 B;  5J2M B;  2DPJ A;  4ELV A;  4NA3 A;  3PKM A;  5ETO A;  1RCO B;  1Y5I B;  4MIW A;  2EG2 A;  4DPO A;  4ZN3 A;  3LAK A;  2VG5 B;  2V4R A;  3RTV A;  1HMV A;  1N34 F;  4ES3 A;  4ZA1 A;  3GMG A;  3BSC A;  1HNZ J;  3PM9 A;  1LWE B;  2XS5 A;  2VDH A;  3KYL A;  4IFV A;  1RBO B;  3QLH B;  1I1G A;  2UUC F;  1K47 A;  2OTL S;  1YHQ S;  1TL4 A;  4KGX B;  3M9N B;  4FNH A;  4O3S A;  4E98 A;  3CD0 A;  2V67 A;  1JB0 C;  4XPC A;  1FEH A;  3L95 X;  1HBU A;  4RW9 B;  2MEW A;  1KTV A;  1BUX A;  2G1H A;  4FXV A;  4GO5 X;  1LXJ A;  1GXT A;  3D5M A;  5F8L A;  5LXY A;  1W2B R;  2F65 A;  2B9X A;  4XPE A;  4WXO A;  3BQ1 A;  1I6J A;  2G13 A;  3JSM A;  2X7I A;  3LGM A;  1V3Z A;  1FKP A;  4LVN P;  4LFB J;  2B4P A;  2HIQ A;  5L9N A;  4H4O A;  3RAM A;  1T9U A;  2JDJ A;  1Q5Y A;  3BGU A;  3A8J A;  2XS2 A;  2OFG X;  5E3A A;  4ZVE A;  1IKW B;  1MML A;  3G6X A;  1FE4 A;  3OW2 R;  4BDP A;  1YX2 A;  1D9D A;  2C2N A;  4W92 B;  1MN7 A;  2XEX A;  3OR2 A;  3EPG A;  1ZET A;  3ZO7 A;  2BE7 D;  3VAG A;  4USM A;  1Y7P A;  4L3K A;  1JLC B;  3MOZ A;  2W9B B;  1HNX J;  2CNL B;  1AUD A;  3HHD A;  2QFI A;  4P6Q A;  3KK3 A;  6AT1 B;  5J1P A;  3V6D A;  2W4D A;  1VR6 A;  4C8K A;  3J7Z T;  2BZ2 A;  1VC0 A;  1R8P A;  3D1O A;  4DF8 A;  5IFM A;  1KDN A;  5I3Q A;  2AIR B;  2C28 A;  2VL1 A;  3JSY A;  2W2Q P;  3I0S A;  2AF6 A;  2IA6 A;  1R89 A;  1RTZ A;  4I2Q B;  4O0N A;  4KHP F;  4M1K A;  1FKA F;  4J9Q A;  2QYC A;  1UVM A;  4IQM A;  3MEK A;  1WF1 A;  1HWI A;  5LM7 E;  3KLE A;  4MK8 A;  2FD2 A;  2R8H A;  3AJ1 A;  3KLI A;  4KGM A;  1YWX A;  1PAU B;  4ECT A;  1OQ3 A;  2JL9 A;  4HI1 A;  2J76 E;  3CSK A;  4PXD A;  1QE1 B;  2BW7 A;  4HAC A;  2LQ8 A;  3POT B;  4CO2 A;  2E9R X;  1TL7 B;  2DB1 A;  2LMI A;  3WBZ A;  1KRP A;  1N0U A;  3UWT A;  2DNH A;  3FRY A;  2IVM A;  2PFD A;  1TV6 A;  3T9Z A;  1N33 J;  2JH3 A;  1UW4 A;  3U1N A;  4DL7 A;  2GHW A;  4NE9 C;  2J6T A;  3TUZ C;  1QDU B;  2G2Y A;  3W2V A;  2NLW A;  1RAG B;  5KT7 A;  4OL8 A;  2HS0 A;  3HK2 A;  3CUL A;  2DXE A;  3MR7 A;  5AXN A;  4B3T F;  1S9E A;  2MQL A;  4WU3 A;  2CWX A;  3C3L A;  1JXV A;  2GCF A;  3MDF A;  4CLT A;  2DIU A;  2R9L A;  1RGV A;  2QT7 A;  1MRO A;  2IJF A;  4WJB A;  5C42 A;  2HQC A;  1F9E B;  3K5O A;  1VQM S;  4F3Q A;  4MJK A;  2BBE A;  3MMJ A;  2Y8Y A;  4IRD A;  1SKS A;  3W5X A;  1HNV B;  4U95 A;  2YKN A;  3KNG A;  1AXQ A;  5D4N A;  2XWX A;  3M30 B;  3L7P A;  2NUH A;  4LUB A;  2JHE A;  2B9Y A;  3HMJ G;  3DLG A;  2NS1 B;  1PSD A;  3HHE A;  4ZVS B;  3HT0 A;  3J7A N;  1LV5 A;  2XMT A;  2NZC A;  4DZD A;  3A8I A;  4USK A;  2R7S A;  3HCX A;  4JI5 J;  2DEI A;  3O1L A;  2K1R B;  1HI0 P;  2DNO A;  3QSI A;  5E3R A;  2P9G A;  1X4B A;  2AX0 A;  4O4G A;  2Q1L A;  4DPX A;  1S4F A;  3GV5 B;  3J80 U;  1SQE A;  1O5J A;  1N36 J;  1U0H B;  4P2F A;  5ADZ A;  1DQ8 A;  4F3M A;  3GFZ A;  3VAL A;  4KR0 B;  3KOA A;  2JOQ A;  4USH A;  4B3O A;  2V6A A;  2DBB A;  4FF3 A;  2E29 A;  2I0X A;  1B7F A;  1R8C A;  1WHV A;  1KLN A;  3GIK A;  4DSE A;  2OSR A;  3KJV B;  2D3O 1;  1U0S A;  3ULH A;  3R8Y A;  3ZZO A;  3N5B A;  1NPP A;  5J1E A;  4J9U E;  2ZJR Q;  5KFB A;  2YTC A;  2XM3 A;  4DR2 F;  3H98 A;  3OTO F;  2HWI A;  4ZVU B;  3T41 A;  3CMA S;  4UQT A;  4AUK A;  1S77 D;  2AJQ A;  1NU4 A;  3QGP A;  1M1K T;  2CIM A;  4OYM A;  4Y00 A;  2AQ4 A;  4K5R A;  1WC3 A;  5J2Q A;  2XY6 A;  1VQ5 S;  3FSY A;  2DT9 A;  4WII A;  2M7S A;  2Y8W A;  4WKY A;  4DV6 F;  4I68 A;  2DXF A;  4GC7 A;  4R25 A;  2XMK A;  1OSC A;  3AHP A;  1HR0 J;  4EBE A;  1T05 B;  3LPY A;  5RUB A;  1W2I A;  2WSF C;  1FRM A;  4P9S A;  4DL5 A;  3KTQ A;  3CJ2 A;  3M1V B;  1U2C A;  2MQO A;  5KOW A;  3NEK A;  1DTT B;  2IJR A;  2WVC A;  4UST A;  3HPO A;  3OHA A;  1T9V A;  1NDC A;  3D68 A;  2FZG B;  5K5M A;  2Y1I A;  1CPZ A;  4P71 A;  2GML A;  2AZ1 A;  4EO8 A;  2I5J B;  3OFH A;  1R27 B;  4X4N A;  3SDE B;  3VCD A;  3U7J A;  1V5V A;  2DNN A;  1L3U A;  2DEJ A;  5CXT A;  3OR1 B;  4EUV A;  4KIA A;  2J0X A;  1N88 A;  1XNR F;  5HQM A;  2C3U A;  4ZMM A;  3F44 A;  3PW7 A;  2F4V F;  4JI8 F;  3D28 A;  3ZZU A;  3KHL A;  4NEZ A;  3KKF A;  2CDR B;  4OLP A;  1NXI A;  1MNE A;  4WYW A;  1MSW D;  5A8K B;  5KG4 A;  4DLE A;  1YZ6 A;  3RGI A;  3DOL A;  4J9V A;  3SQO P;  1N56 A;  2KB2 A;  1D8Y A;  2YH1 A;  2POK A;  4XAK A;  1N6Q B;  1FRH A;  1VQ4 S;  3BBC A;  4MK7 A;  3FCW A;  3PIP Q;  2OEJ A;  2ZVI A;  2HZA A;  4YHH J;  2LQB A;  4K2X A;  1R31 A;  4BWJ A;  1N34 J;  2VG6 A;  3MM8 B;  1CJK B;  1SJ4 P;  3I9Z A;  1QSL A;  2MKY A;  4ZIT A;  3TAM A;  4OYB A;  2A2C A;  3H42 A;  4IDK B;  3BSA A;  3QIP B;  4F4Z A;  4RUH A;  1RI7 A;  5F8H A;  1YDL A;  1H2T Z;  1S72 S;  4K4X A;  1TFW A;  4B9M A;  1WDD A;  1B4S A;  2BKO A;  2MHN A;  3K5L A;  4DSF A;  3D2W A;  4K4W A;  3CCJ S;  3ISN C;  3OT9 A;  2KT3 A;  1R8B A;  4LF9 J;  3MEG B;  4E0D A;  1HL6 A;  3QO9 B;  4JI0 J;  3BGR A;  3Q24 A;  2HMI B;  3ZTS A;  4ETX A;  2DHS A;  3WX8 A;  3LOU A;  1JNR B;  3DDK A;  3F56 A;  1CBK A;  4RW6 B;  4RL1 A;  4JI1 J;  1GQE A;  2EBE A;  1OSD A;  1LFW A;  1UVN A;  4OZJ A;  3U1L A;  1X9W A;  3VV2 B;  5B0B A;  2C1E B;  2XMU A;  2VB6 A;  2W2M P;  4OX8 A;  4JI7 F;  6FDR A;  4J9M A;  4PCQ A;  4PWW A;  2CPX A;  1UJ5 A;  1YI2 S;  2RH3 A;  3FEX B;  3RAX A;  3T5K A;  1KVI A;  2RS2 A;  4F0K A;  2WVE A;  1RWN B;  3HHL B;  3GIR A;  1SH2 A;  4C8Z A;  3HKW A;  3CDU A;  3OJU A;  4A4J A;  4DEZ A;  2VUG A;  4ES2 A;  5CD4 A;  1V6H A;  1TQL A;  2ALZ A;  1WOS A;  4XDD A;  3BN7 A;  2X1A A;  2VON A;  3AJ2 A;  3CCM S;  1Q8I A;  3NGU A;  4RW7 A;  1U8S A;  5IC6 B;  2EC2 A;  5D4O A;  2ZBC A;  2JVR A;  1VBZ A;  2QRR A;  2KHC A;  2IAJ A;  1KHW A;  3N28 A;  4L73 A;  4DI6 A;  3EWG A;  3JQM A;  2PC6 A;  2RJZ A;  2HSE B;  3IAM 9;  1FRI A;  4ED6 A;  1BD6 A;  2D69 A;  1RAE B;  1UA1 A;  5IWA F;  1IQT A;  2LLZ A;  4LRF A;  4DF4 A;  3DXB A;  5CYQ A;  2R2U A;  3QBC A;  4F36 A;  5M2P A;  2F4F A;  4DV5 J;  1RT2 B;  1ZZF A;  2H4Y B;  3MF5 A;  3MM5 B;  5J2P B;  3I55 S;  2E1A A;  2LP4 A;  2QJ3 A;  4C8N A;  5HJX A;  1FE0 A;  1NK5 A;  2NZ4 A;  4K0K F;  4B9V A;  1Q82 T;  3MR2 A;  1Q7L B;  1SKU B;  2UVU A;  1FJ7 A;  2KJW A;  3ENV A;  2E5H A;  3AD8 C;  3IG1 B;  1XMB A;  3NBP A;  5KFH A;  2CPE A;  2FGO A;  1QAX A;  1R0A A;  1ZTT A;  3CNQ P;  4B3T J;  1P8G A;  5AXL A;  4MK9 A;  3JSM B;  3MTK A;  2HVH A;  3WC2 A;  2UUB J;  1S1X B;  2O67 A;  1AZS A;  2HLU A;  5LT5 A;  3IR6 B;  1WEZ A;  2FJE B;  4HHH A;  5JVG Q;  4OX9 J;  1JJ2 R;  2ZUA A;  4ILM A;  2P8I A;  1F6T A;  5DQG A;  3OLA A;  4OFZ A;  4MIA A;  4LF4 J;  5LXR A;  3M8W A;  5KFI A;  4A8F A;  4LF2 A;  3NKY A;  3FC9 A;  4CNZ A;  4A47 A;  4OJG A;  3EDR B;  1DLO B;  2AYM A;  2MQP A;  5KFJ A;  4P52 A;  1WC0 A;  2RF2 A;  3G6Y A;  3PY8 A;  3GTY X;  1RTJ B;  4CLW A;  4R8U A;  4USJ C;  3H5Y A;  1T9W A;  1XR6 A;  2QGF B;  3Q83 A;  5D0G A;  4DQP A;  4LF8 J;  3V6D B;  5EUH A;  1F3F A;  2DGW A;  1NDL A;  1BHN A;  3W8P A;  1V3R A;  1I51 B;  1VK8 A;  3NY0 A;  3M6V A;  3K2Y A;  3RR7 A;  1VQ7 S;  3Q2S C;  1S99 A;  2B5J A;  3FQL A;  3LWM A;  1DHM A;  4FF1 A;  4OMF G;  4HR2 A;  1MU2 B;  1U1K A;  1IBL F;  2HYI B;  3OL6 A;  1IBK J;  3PX4 A;  2IPO B;  5L1K A;  4GKK J;  3NCR A;  4PZV A;  4DV1 J;  2XNQ A;  4IR1 A;  3DC2 A;  3RRH A;  1FD2 A;  4IG0 A;  4ZPA A;  4MKV A;  4MYT A;  4QWB A;  3GJQ B;  4B02 A;  2FZK B;  1JLG A;  2W7A A;  1M5V C;  3TJ8 A;  3NGD A;  5E0O A;  1A0O B;  3BH6 B;  1VBX A;  3ZNJ 1;  5K9F A;  4B9T A;  4YS2 A;  5K14 A;  5K8O A;  2OMO A;  1IBM J;  3G8Q A;  2VH7 A;  4JV5 J;  1UL3 A;  1ROF A;  4QYZ J;  5HO4 A;  3KLF A;  3NGK A;  3MMA A;  4WPA A;  1M5P C;  2KYX A;  1RT5 B;  2NSB A;  2E1M C;  1G7C B;  5E7O B;  3DU5 A;  2HS3 A;  3KLH B;  3IN5 A;  1T7P A;  5KFC A;  2GMH A;  1IWA A;  3VR1 A;  3CCT A;  1RWK B;  2DRB A;  3HM9 A;  1XR5 A;  1GFW B;  4KBI A;  5AXM A;  4ED4 A;  4AL7 A;  2KT5 A;  2J9D A;  2VQF J;  2IC3 B;  4NWB A;  5HMW A;  1U1P A;  1SBR A;  2C22 A;  3RRG A;  2V2Z A;  3C6U B;  1AW0 A;  5CCM A;  4Y65 A;  3S1T A;  4K7Q A;  4K4U A;  2BQR A;  1KTQ A;  1UZH A;  1XMO F;  2F8M A;  4MMO A;  4X64 F;  2J5A A;  3W5Z A;  4CT9 A;  3PIO Q;  2F4V J;  2CRL A;  2WW8 A;  3R1L A;  8RUC A;  2OLW A;  3DKD A;  5DS7 A;  1SC1 B;  2XYP B;  1IKY A;  2KL8 A;  4DPU A;  1H98 A;  4RNF A;  1SC4 B;  2M8H A;  5AE3 A;  5KG2 A;  1NK0 A;  2PA3 A;  3M2U A;  2ASJ A;  1WEL A;  4ES1 A;  2RS8 A;  3ZNU A;  3KK1 A;  1S9G B;  1S4E A;  4WP9 A;  4DUY F;  2GHV C;  4IOB A;  4ZP8 A;  3CCE S;  2C3P A;  2V0N A;  1Y3J A;  2FHM A;  3IA0 A;  4RKU C;  4RW4 A;  3H0P A;  3H7H B;  2GC8 A;  3NNH A;  1FK9 B;  1WUU A;  4OI2 A;  5CAA A;  1JXE A;  2E1R A;  4X4U A;  2E44 A;  2CVE A;  3M4X A;  4ENO A;  1S48 A;  3M2V A;  3M7V A;  4YME A;  2ZM6 F;  4C97 A;  2QIF A;  1TK8 A;  4C2M A;  4JI6 F;  4UOF A;  3DYA B;  2B43 A;  1PJ5 A;  3RU0 A;  1PAE X;  2AP6 A;  2ZBI A;  3M8Z A;  3CED A;  1Q7Y T;  5HL7 Q;  1KKH A;  4PQU A;  3KLV A;  2UXB F;  4DCP B;  2B6A B;  3LAL A;  3FZ2 A;  2BQ3 A;  2EG1 A;  2ZHB A;  1B99 A;  3ELH A;  1NJX A;  1PG5 B;  3UNG C;  3DOM B;  4RW8 A;  4J7C A;  3RR8 A;  3EZ5 A;  1UVI A;  1YJN S;  2BE2 B;  2QTW A;  3Q8S B;  4O3R A;  3MGJ A;  2FGC A;  4ZOS A;  4GKJ J;  3TVK A;  4XK8 C;  2M8D B;  4NXM J;  2W8K A;  4JBC A;  5E3C A;  7FD1 A;  4X4R A;  3MED A;  1RP5 A;  2UU9 J;  1CJU A;  1V9O A;  3R5C A;  3AD7 C;  2FVP A;  1KOH A;  1YIT S;  2ZH1 A;  4Y3C A;  1C1C B;  5GVQ A;  1KFD A;  4FPR A;  4LMZ A;  3OSN A;  1AT1 B;  1HD0 A;  1TL1 B;  2C2R A;  3PRD A;  4ED0 A;  3IAS 9;  4GVB A;  1KN6 A;  4AYB D;  5T7L A;  1LWX A;  1U1L A;  4P74 A;  1K1Q A;  3EE3 A;  3GLJ A;  1PBU A;  2N7Y A;  3EMT A;  3UW1 A;  3HSG A;  4CWB A;  3CMQ A;  1XC9 A;  3A3O B;  1OQ6 A;  2HQD A;  3HO1 A;  2QN6 B;  1R6V A;  2DTJ A;  2RKI B;  3TW0 A;  3TYT A;  3JXO A;  2K7K A;  2QLB B;  2AEM A;  4DX8 H;  2B4U A;  2LQ5 A;  1KR4 A;  1RE1 B;  4QWC A;  2WK4 A;  1M5S A;  2P9E A;  3HXM A;  3T5J A;  4MYU A;  3KG4 A;  2KM8 B;  3HZE A;  5HAN A;  1S59 A;  5KFM A;  1B70 B;  4QYZ K;  1HNW F;  2ZZT A;  4FZV A;  1A6L A;  4DX7 A;  1K1S A;  2XZT B;  5AJ3 J;  4OX6 A;  3DRP B;  1JLA A;  3QAT A;  1VRT A;  1K8A T;  3LP0 B;  1KHV A;  1IWG A;  3WDO A;  1UTA A;  5KFX A;  3L4B C;  5KFZ A;  3SI8 A;  1WJ9 A;  2NXU A;  2XGQ A;  2MJU A;  4G6V B;  4DR5 F;  2O3D A;  4WP8 A;  2Y9H A;  1CJV B;  2D41 A;  3ILI A;  3NOC A;  3KK2 A;  3O3L A;  1NAQ A;  1YRX A;  2MB0 B;  4K2J A;  1Q78 A;  4UQG A;  3N01 A;  3SSQ A;  1Q81 T;  1I94 J;  2KFZ A;  2PFF B;  1NHV A;  5DG9 A;  3PV8 A;  1ZAX A;  1IJF B;  2YX4 A;  2BX6 A;  5KFQ A;  3T1Y F;  1RAB B;  4U96 A;  3VF0 B;  1NRK A;  4I4B A;  4M5J A;  4M5L A;  4OI1 A;  1KD1 T;  2F9J A;  1MLA A;  1Y4Z B;  2X51 A;  3B4M A;  2XCP A;  2QLW A;  1WG1 A;  2RQM A;  3BKT A;  2G4B A;  1NB7 A;  4ETZ A;  2QV6 A;  1NEE A;  2FVS A;  5ITH A;  3CTR A;  1WC6 A;  4F0H A;  2K8G A;  2OPR A;  2W9A A;  3OD2 A;  3KWM A;  1T3O A;  1FEE A;  3TJ9 A;  2Z57 B;  3LP1 A;  5CZV A;  4MIB A;  4FDF A;  5F8G A;  2G0C A;  2AGQ A;  2HVZ A;  1F9H A;  2SXL A;  5JJB A;  2GQC A;  1VQP S;  5CYM B;  4LIR A;  3HHN B;  2JC0 A;  2HNZ B;  1DTQ B;  3OLB A;  3FK4 A;  3H25 A;  2OML A;  3DRR A;  1L5U A;  3JSR A;  2WRM A;  4ZJL A;  1QAJ A;  4L75 A;  1FI4 A;  4TN2 A;  3D1Q A;  4DV4 J;  3HD2 A;  4NEY A;  2GZO A;  3N9U C;  4ID5 A;  1YG0 A;  2HND B;  2AGO A;  5FDL A;  2BYC A;  5D3G B;  4KO0 A;  4EFA C;  4LF5 F;  1LWC A;  4IFY A;  4DV2 F;  2MZT A;  1RB0 A;  3LO3 A;  3H2V E;  3CF5 Q;  4FN5 A;  2EI5 A;  3DNC A;  3FFI B;  1SVD A;  3M32 A;  3OTD A;  3OVS A;  2E5G A;  4LRE A;  3C6T B;  3RW7 A;  3H40 A;  4B3S F;  3K7R A;  4KGV B;  3IO1 A;  3GYN A;  1G2E A;  3ILJ A;  1YLX A;  3CCQ S;  1SH3 A;  2JZ5 A;  1OWX A;  4Q5V A;  3CVK A;  1YRU A;  1H7X A;  1SQF A;  4RUB A;  2IFX A;  3FNN A;  1B7Y B;  3UN2 A;  3LGN A;  1KOO A;  3TUP A;  5F3T A;  2AYG A;  1KNZ A;  3O8W A;  3H4B A;  5GME A;  3ZTO A;  1SV5 B;  4NL5 A;  2IDE A;  1N5Y B;  1QSS A;  3RYL A;  4ZN1 A;  2ZH9 A;  2Y3Y A;  5EWG A;  1RT1 B;  3QQC D;  2KFN A;  3FSX A;  4FKY A;  2DGS A;  2MQ8 A;  3H5U A;  2OI2 A;  5E5N A;  2V94 A;  1AFI A;  1JLQ B;  4PAB A;  3N5F A;  2R7Q A;  4NYZ A;  5KG3 A;  5DGA A;  2A6M A;  3MAA B;  5B0C A;  1IR2 A;  2W8L A;  2GO9 A;  5H9E J;  4AL6 A;  2LEB A;  3GR1 A;  4ZP9 A;  3J7A 1;  3BDE A;  4F26 A;  5A6W A;  1FJG F;  2YNH A;  3KHH A;  3CWJ A;  3AOC A;  1D09 B;  2Q43 A;  3ZTQ A;  2NCK L;  4RNN A;  2WON A;  3LW5 C;  4LSL B;  2CAJ A;  3J7Y I;  2ZH6 A;  2VIC A;  4Y2C A;  2YBV A;  2VOO A;  2AJ2 A;  3QID A;  3FCH A;  3OL8 A;  5KAK A;  4M5K A;  1N52 B;  3D6T B;  3DM2 B;  5MLC V;  2G9O A;  1E6V A;  2X1G A;  4IO1 A;  3PYD A;  2VU5 A;  1FCA A;  2GQ2 A;  5LMN J;  3E01 A;  1P6T A;  1IXK A;  5EDW A;  1PIL A;  3O2I A;  4QYR A;  2ZH7 A;  4NZ7 A;  1S7I A;  3QMQ A;  4OQJ A;  1VQL S;  3FEZ A;  4B9N A;  3BRE A;  4OZ0 A;  5ETK A;  4F4X A;  3KFW X;  2WVB A;  2V8G A;  3IR5 B;  2MST A;  2Z58 B;  1NB2 A;  1RWO B;  5F8N A;  3GJS B;  4QBU A;  4IUF A;  4FF4 A;  3HHL C;  3H5X A;  3HD1 A;  3TA0 A;  2NRE A;  1N4L A;  4I6W A;  3OJS A;  3MD1 A;  3OUY A;  1HNI B;  2FLN A;  5HBM A;  2GHP A;  1YJU A;  2OHD A;  2AEF A;  4PG6 A;  1QY7 A;  1GXU A;  2F9D A;  5J2N B;  3Q86 A;  3M9O B;  4UZB A;  4LF7 F;  4ZCI A;  2IY5 B;  2G2O A;  1QAI A;  2OSQ A;  2OEM A;  1TAU A;  1HBM A;  3TZZ A;  2HHH J;  2XSJ B;  1RAF B;  4NMX A;  4ECZ A;  1C0U B;  1FVQ A;  4ZCM A;  1SL1 A;  4ZS6 A;  1FKO A;  1K9M T;  1BQM A;  4PRF A;  3MUM P;  3W66 A;  2XHW A;  3ISZ A;  1X9S A;  1HBN B;  1TKT B;  3MEE B;  5D15 A;  1TKZ B;  2PDA A;  2OPP A;  3EX7 B;  2RHS B;  2V9W A;  4DR6 F;  3T5H A;  3DRS B;  2WTF A;  1IKY B;  4IH7 A;  2C2D A;  3MM9 A;  1X4G A;  5J2M A;  2Z2Y B;  4NML A;  4NXN J;  2C2M B;  3MPD A;  4EBD A;  4JI2 J;  1FFS B;  1C4C A;  4OYW A;  2VZ9 A;  2VG5 A;  2UXC F;  2M2B A;  3NNA A;  2J7U A;  3CJQ A;  4YB6 A;  5HN0 A;  3EGZ A;  2W01 A;  3NOG A;  3HVT A;  4ILL A;  1LWE A;  1JJH A;  2M52 A;  1JJ4 A;  4EK2 A; 
#chains in the Genus database with same CATH homology
 3C14 A;  4OYO A;  1CUL B;  1TL7 B;  1CJV A;  1WC1 A;  4USV A;  4OYM A;  4CM0 A;  4OYZ A;  1CUL A;  1TL7 A;  1WC3 A;  2GVZ B;  4WP9 A;  4OYI A;  1FX2 A;  3C15 B;  4OZ2 A;  2WZ1 A;  2GVZ A;  1AZS B;  3G82 B;  4CLP A;  3C15 A;  1AZS A;  4CLL A;  1CJT B;  4CLY A;  4CLZ A;  5D0R A;  1AB8 A;  4CLK A;  1YK9 A;  5IV3 A;  4P2M A;  3MR7 A;  1CJU B;  2GVD B;  3UVJ B;  5D15 A;  1Y11 A;  3MAA B;  4OYP A;  1CJU A;  2GVD A;  5D0H A;  1WC4 A;  4NI2 B;  3UVJ A;  3MAA A;  4CLS A;  1U0H B;  2QV6 A;  3G82 A;  5D0E A;  3C16 B;  4P2F A;  1CJK B;  4OZ3 A;  4OYA A;  4UST A;  4CLT A;  1CJT A;  4CLU A;  1U0H A;  3C14 B;  3C16 A;  1CJK A;  1WC6 A;  4CLF A;  4P2X A;  4OYB A;  1WC0 A;  1YBT A;  3ET6 B;  4CM2 A;  4WP3 A;  5IV4 A;  4CLW A;  4OYW A;  3ET6 A;  4OYX A;  3R5G A;  5D0G A;  1FX4 A;  4NI2 A;  4USU A;  4USW A;  1CS4 B;  1WC5 A;  2W01 A;  4WP8 A;  1CJV B;  4WPA A;  2BW7 A;  1Y10 A;  1YBU A;  1CS4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...