2KHDA

Solution nmr structure of vc_a0919 from vibrio cholerae. northeast structural genomics consortium target vcr52
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
108
structure length
108
Chain Sequence
MSNQTCVENEVCEACGCAGEIGFIIREGDDVAEVSLFGSDKAHLEGKLAEYISLAKQVYANVEYEVAPVADNATELHARFKFEVSAEKLIFELKTRALARLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein VC_A0919
publication title Solution NMR structure of VC_A0919 from Vibrio cholerae. Northeast Structural Genomics Consortium Target VcR52.
rcsb
source organism Vibrio cholerae o1 biovar el tor str. n16961
total genus 19
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2009-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04175 DUF406 Protein of unknown function (DUF406)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.860 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2khdA00
1IN0A 2K3IA 2JZ5A 2KHDA 5B7WA
chains in the Genus database with same CATH superfamily
1TKDA 1RWKB 4L3NA 4DV0F 1Y5LB 1F0XA 1PBAA 4G1QA 4Y2AA 2AMCB 4OYAA 4Q8EA 4K50A 1IBLJ 3K58A 4OI6A 5DG8A 4X4VA 1JQGA 4OX6A 3UNYA 1LXNA 3ENWA 4LFCJ 3PFOA 3KDNA 3AT1B 1UTAA 3VGTA 5A2QU 3MMBA 3MM9A 3CPWR 2DGUA 1EQMA 4ED7A 3I55S 3VQSA 3ZXWA 1EAYC 3RJMB 1GXTA 3GJQB 3QRPA 4I2QA 5HMXA 2IJNA 1C0UA 1GEHA 4AYBD 2W8KA 4O3NA 1YK9A 3OFHA 5KFTA 4ZIWA 5L1KA 2E1PA 4ECXA 4O0IA 5HROA 4DZDA 1FRIA 2EVZA 3AJDA 1H2UX 3I4PA 4ZVPB 2GVZB 1TL4A 4YP3A 2DXDA 4Y65A 2GMJA 3HMJG 2E5LJ 5GADU 2HMIA 4ES1A 3IM8A 1QUVA 4X65J 3ZTPA 3M9MB 5H9FJ 2HIQA 4J9SA 4QWBA 3KLHB 5THWA 2UUAJ 4B9UA 3LPYA 1S48A 3DRRB 4F02A 4DSLA 2VBYA 2R7OA 3CMAS 1X4GA 2PEHA 2OTJS 3V4IB 2FC8A 4WK1A 3R7SB 3EUNA 4U67Q 3A13A 3QAEA 4CO3A 4KH0B 1NH7A 2DRAA 4J9QA 1HNWJ 2UXCJ 4HH1A 5FD1A 4ZKAA 3G6XA 3GV5B 5EUHA 3ZNJ1 3MWBA 1HWUA 4PWUA 2L08A 5IT0A 1TL1B 5DG7A 4M5JA 4ANEA 3JS9A 1DY3A 1FA0A 1JLQB 1FXLA 3K8WA 1O0PA 1RKJA 2HK3A 3SZ2A 3E2EA 5E33A 2IYIA 1FKOA 1IKYB 1U26A 1DARA 4KFBB 4F3QA 3D6FB 4DUZJ 1N32J 3D54A 1X5PA 1VQ6S 4CO4A 4OFZA 1S1VB 4CYUB 1NSQA 3HFVA 2R8KA 3G86A 2UUBF 2V63A 1M5HA 5IQQA 3NNCA 4Y00A 3GR1A 4D3HA 1C0TB 3GP9A 3DHWC 3MEEB 4OV6A 2IFXA 4F2RA 4KRWA 5SUHA 1NJWA 2H65B 1UVKA 2N82B 3EGWB 3CJSA 2DR6A 1E6YA 1A6LA 3I5AA 4WK3A 4EYHB 4OI3A 2UP1A 4DV4J 3D0IE 4Q0BB 5IQ6A 2GX8A 2FLOA 4D3GA 4DX8H 4DR6F 2ADBA 4WZMA 5DZ6A 3D0GE 4EO8A 2MQNA 2KB2A 2ZVSA 3US5A 2U1AA 4A48A 2C2NA 4ECVA 5HVHA 1FRKA 2GHVC 2B9EA 3OJSA 3GG0A 5E2QA 1KWMA 4MK7A 1H72C 3BSNA 3UR0A 2VG5B 3OTOF 1VOMA 1YRUA 2ZH5A 1R8AA 4L3KA 3CC4S 4WP9A 4PG8A 2J6SA 3CO0P 2Y3YA 1TFWA 2D9PA 4EZ6A 3IBCB 4KHPJ 1GXLA 2V50A 1ZPWX 3ITHB 2GS8A 5IM0A 4C11A 3R2DJ 2G2ZA 1TL7B 4HVZA 1P9QC 5CAAA 1XMBA 1ROFA 2IJFA 4JI2J 2VBWA 2YTCA 1K0VA 2DHAA 1RU2A 1DQ8A 3QYYA 1G6BA 2K7JA 4IYQA 2PMHA 3D6TB 2IVMA 4QIWD 2QSWA 2XYPB 2DNHA 5LMUF 1VJWA 1SPBP 5D0RA 1GMVA 3IR7B 4B17A 4CWBA 4G1PA 2AX1A 2BRKA 2V34A 3HM9A 2WAQD 1R0AA 3IS9B 5KT5A 2YNIA 1VRTA 3ONQA 4WIQA 2C2KB 5H1SV 3L9ZA 5G4DA 4N5SA 3LP2B 3GG1A 4IH7A 2D7SA 3FSYA 3Q22A 2LEPA 5LJ5Y 1NHKL 4CDIA 1CC8A 3CCQS 4R5PA 1T95A 3J7YU 5KT6A 4I67A 5EWFA 3M8ZA 2V4JB 2QLWA 4AXIA 4QIFA 3E01B 1BD6A 4DV2J 2NXCA 1IR1A 3MEGB 2C42A 3WQPA 4RNNA 1EKRA 3EE3A 3V4MA 4RWWA 2OMOA 3HZGA 2M8HA 2C2MB 1S6OA 2L9DA 2OMLA 5FLXY 3RAMA 2XY7A 3NCQA 5AJ3F 3JQJA 3UCZP 4OL8A 4L76A 1S4EA 2DNKA 1S1UA 1N6QB 2J7KA 5D4OA 3SQGB 4GC7A 1XMQF 2CNKB 4C3MA 4FYDA 4ELVA 3QSYB 1W7WA 4PPDA 1WF0A 3BDPA 1HNVB 2OPRA 1Y00A 4OHVA 2CZVC 4ZMMA 4PQUB 4LBPA 3VAJA 2CPJA 5LMNJ 2DISA 2LP4A 4ID5B 2GMLA 3U02A 1U1QA 1RT3A 3ILJA 5RUBA 2K3IA 4PXDA 1PC5A 3TUJC 4X64J 2UXDF 2DXEA 1NDCA 1U1LA 1ZAVA 4WFNQ 1S0MA 3NGDA 3R8YA 5E3PA 2JDJA 4MIBA 3HHLA 1RKIA 3D1OA 2Q43A 1FJGF 4IO1A 3KOAA 2DNNA 3M2RA 2HEKA 4B3TJ 4IRCA 4LF4J 3B8HA 1JLCB 2MZRA 3B4MA 1W2BR 2HS0A 5KAKA 3JSRA 2EFVA 3I4HX 4A8FA 2BW7A 5ETNA 1VQYA 1WKJA 3OFFA 1PJ5A 3QSIA 4W90B 1KOOA 2HFNA 4EO6A 2ZH1A 3OBIA 3QIDA 3TX8A 5AE2A 3T1AA 2HAIA 4H4OB 3KKFA 3LGMA 3NBPB 3ENAA 3MEKA 5KFEA 4AL6A 4NXMJ 2MSTA 2NS1B 2IHR1 1JLBB 3UCGA 2RRNA 1RAHB 5K8PA 2DNYA 1RAGB 4KV8B 1WDTA 2PI4A 1S1XB 2FZKB 2CJYB 3FFIA 5DDRC 5ETTA 5SZTA 3J7AN 2CG8A 1WOOA 1MW7A 5F3TA 4ZJQA 2JEJA 1HI0P 3A3NB 3BJYA 3KWMA 2EKNA 4R0JA 3KHGA 1JLAA 2DYAA 1WACA 3TA1A 1Y9OA 1L3UA 2VU5A 3JTPA 2E1MC 4DUYF 4KO0A 3M8QB 2DNZA 3OTDA 2GO9A 1TZ0A 4O3SA 1HBMB 3QT6A 1LV5A 2CZ9A 4F7VA 4RW8B 4HT7A 1HIYA 1XIQA 4C6AA 1PYTA 1VBKA 4KGKA 4U95A 4LFAF 2FGOA 3W2VB 3MPUB 5D4PA 2VQEF 4O4GB 4UUWA 1HL6A 1WTFA 3M32B 4OZ5A 3WIVA 4HHUA 2HVZA 2FGCA 1GH8A 4QW9A 2KM8B 3BQ1A 2ZKTA 2H3EB 2EFOA 2MYFA 1BE4A 4IG3A 3FCHA 2RNEA 1NJIT 3FBEA 3JSMB 2FVRA 3DU6A 2MZ1A 1HMVA 2E9RX 1TR0A 4RW6B 3MUTP 2YPYA 1HYSA 2ZM6F 2Z4PA 5D0GA 1WSRA 1U2CA 3MXHP 1PKUA 3W5YA 1HHQA 1DQAA 3LP0B 4FNIA 3FVYA 3RBDA 4PG5A 1I94J 3H2UB 4QR0A 2KDOA 1RTZA 1S9EB 1FKPA 1T9WA 3WHIA 4NA1A 2ZZTA 1NPRA 4URGA 2QGFB 4TN2A 2E5GA 3GTYX 3HFZB 2GGPA 2LDYA 1RA7A 3BPSP 3IA0A 1NSAA 4OZJA 3GJSB 3R5DA 4YQWA 3J7Z5 3Q8SB 3QBCA 2CUYA 2RQMA 2M2BA 1NPPA 1MN7A 3EX7B 3GSDA 4H4KC 1IR2A 3DGPA 5BYSA 1TMJA 5H9FK 2HHVA 2KJWA 2HW3A 1GTHA 4MIAA 4LSZB 2V8PA 2KVIA 4C9DA 3Q83A 5A76A 1HI1A 3CCWA 1HNZJ 2JEFA 3TA2A 4B9LA 5LSOA 2OSRA 2EI5A 4RW7A 4IG0A 2F9DA 3A3PB 2AYGA 2BANB 3J81j 4RW4B 4I56A 3CCZA 4X4QA 2WVDA 2J6TA 3M8WA 2ZZMA 3J7A1 5LT5A 4OYMA 2C1EB 3UN5A 4OHWA 1MG7A 2WVFA 2XMMA 1EQ0A 1EP4B 3HP6A 2F1FA 2VHGA 3CJ8A 4NA3A 4CCHA 3TAMA 3TUPA 4WCEQ 4N41A 5IT9Y 2OUGA 1RA6A 2MZSA 4ZOSA 1ULRA 3F44A 2WW8A 2XMTA 1ZA2B 4LR7A 1S9GB 4A8KA 4P73A 2DGVA 1WG5A 4C8NA 2BOAA 3EDQB 1J5OB 3JQKA 1F2GA 2ZHOA 4NLYA 2G2YA 2NSCA 5B0DA 2DNRA 2PGCA 1IKVA 4JYAJ 1VBXA 1NK7A 2CJBA 2OPSB 4DFMA 2YQ3A 4HEA9 4R8UA 3KXDA 2XMKA 5C42B 3CCTA 3CCMS 1UZHA 4Q44A 3T6BA 5D3GB 2J7WA 2ZC3A 1FERA 4WFBQ 3G71S 3IM9A 3TZYA 1RT5A 2WSEC 2KT2A 4MKYA 2QA4S 5CHCB 3MM5A 4ZHRB 2JHEA 3N5BA 3N6MA 2BJ8A 4V19J 1QJHA 3GILA 1RT4A 1UZDA 2NPFA 3JAMY 1S6PB 1S99A 2RSQA 2YX7A 3CD0A 1WF1A 3GCXP 4ZVEA 2WVBA 2HVHA 2KXHA 2VV5A 2RHSB 5JMNA 2VKRA 4ZLLA 4UW2A 1RP5A 1CG2A 2C2DA 3QATA 4W4MA 4ATNA 3BF4A 4QBUA 3C19A 1YRXA 4ELTA 1TL3A 4LUBA 4NEYA 2MQMA 4EMDA 2MJUA 1FRJA 1IBKJ 1UMJA 1V9OA 4WFXA 3BH6B 5D78A 3VR1A 3D6MB 4P52A 4QJVA 1G4CA 3LO3A 4OI4A 4FYYB 2YKQA 2VICA 1TL5A 1F9EB 2LCWA 3JSBA 2CG4A 3IR6B 3T1YF 2HFZA 2VPXB 4C0BA 2P6SA 4FNHA 3KLVA 5HAOA 4E0DA 2KFNA 5DDQC 4ZJLA 2RVJA 5KG2A 4RJVA 4RNHA 1TQLA 4G1QB 3J80Y 3D1QA 1X4FA 3I9ZA 3OTCA 1UJ4A 3EGZA 1S6UA 1LWFA 1SCJB 4KB7A 1HWLA 2IBOA 2BXJA 4ZCIA 4WYWA 4AT1B 3OUYB 1OYDA 5A8WB 2CADA 4DL3A 4DV3J 1WC1A 2CRLA 3OLAA 3MMBB 3ZFVA 3N6LA 3MM9B 5ETLA 2HNYB 4W98A 4WE1A 3WZ0A 1EX8A 1M5OC 1HD0A 1RJJA 5LXYA 1SQEA 2BW2A 1OY9A 2LXIA 4I2QB 5CZVA 1S6QB 4CT8A 2B8PA 5E3AA 4I4BA 1A9NB 2FJEB 2QLFB 1WNEA 1LK5A 5HQLA 3ETOA 5HROB 3HD1A 2GA7A 2YKAA 1V5IB 3MPDA 5KFJA 5M2PA 3R27A 4NPOA 1QTNB 1X9WA 1C2PA 4NLWA 2OPPA 3MF5A 3T5HA 2EG2A 2IA0A 2HMIB 1CULA 2OI2A 2DKOB 4NCBA 2P6TA 1WEZA 2CIMA 4RWXA 4ZPWR 2C2ZB 2QMXA 4LMZA 3AHPA 1FCAA 4USJC 3TVKA 3V5RA 2XNQA 4YR3A 3CSKA 1HQ2A 2F3JA 3J81Y 4F0MA 4IUFA 4C0HA 2LKZA 1IBCB 1KVJA 1UPMB 1XNQF 2AJ4A 3QAUA 2VA3A 1LNQA 2NXJA 3HO1A 3M9OB 1MMNA 1G1XA 5GAEI 3OVBA 1E6VA 2V9KA 3UNGC 5JVHQ 1RT7A 4BWJA 4ZVFA 4RBVA 3T5KA 1XQIA 4IOBA 4NLGA 4JV2A 3QPIA 2A2DA 4O3OA 3AD7C 3DLBA 3R5BA 1FK9A 2F8EX 5KG1A 5KFKA 5HN0A 1MSWD 3A4TA 4DR5F 3ET6A 2DO0A 2D9OA 1KDNA 5DLGA 1GTEA 4TQRA 3AB2B 2DTJA 3C66A 4OJ3A 2Q1LA 1FKOB 2B9YA 5A0YA 2OLWA 2V2KA 2W9AA 2B4VA 2WB1D 4B9NA 1DBDA 3HJVA 4JI7J 2ZEJA 4BCAA 3EDRB 3TZXA 3THVA 1Q86T 1UEKA 3EWGA 4YMEA 4DMZA 3ELHA 4FXDA 4AQYJ 4CI0B 2KXNB 1KVIA 3MDFA 1OQ3A 3IAS9 1IM6A 2CPFA 3KLGA 3GCWP 5HL7Q 4IO9Q 3X3UA 4DR3F 3TANA 4NYOA 2J9DE 1NJYA 3D2WA 5DM7Q 4MKBA 4DV7J 4U7UD 3H98A 3OD2A 4A8OA 3PYGA 4YDXA 2W7OA 5J2PA 4K0KJ 2BE9B 2QEXS 2GMHA 5KFQA 2DIUA 2Z2YB 2RRAA 3TRGA 1FVSA 2NLWA 3B78A 1YJNS 2HHWA 1YBAA 1Q78A 4LRDA 2F4VF 4C3LA 2E7XA 2L9NA 5J2QA 3AOBA 3CB4A 3W63A 1BQMA 1FDNA 3SCKE 3I0RA 5CYQA 4X4RA 3FGVA 4DR1J 2LEBA 3MTKA 3NS6A 2R2TA 1NZAA 3UN3A 3PIPQ 2VD3A 2CQ0A 3KG4A 2ROEA 4AL5A 1ZYQA 4U96A 1JK9B 1NRKA 4HI2A 3RRKA 5CCLA 1N4LA 2R2SA 3CDEA 2RU9A 4NASA 5IM0B 1WSVA 2VF3A 2HBYB 1RWWB 1IJEB 4KPYA 2LDIA 2V5HG 5KFCA 1DHMA 3KK1A 3BKTA 3VVUA 2RQCA 2ZOFA 4OYWA 2QYGA 2C3OA 2VL1A 3M1VA 5KFBA 2XY5A 2IAJA 1HQEA 1SH3A 4LSLB 5GAGI 4EYIB 4UY8T 4HDHA 4J9KA 2BE2A 5J1NA 2ERRA 5LL6d 5L9NA 4XO0A 2W01A 4P72A 4MK9A 2ASJA 3GFYA 3LALA 1A7GE 1VGYA 1R0AB 4C8YA 2FZCB 1DLOB 3C16A 5GADI 2ZOGA 4RUBA 2YNIB 4WIIA 4TU9A 1VRTB 2YKNB 3NL0A 1Z2LA 5JXSA 3LPEA 1RSCA 3A8JA 3RB4A 4F4KA 3IR5B 3CMES 1ZAWA 3O8WA 1VI7A 3D4JA 4YR2A 4EBEA 4R5PB 2W24A 1FRMA 3W8GA 4BLGA 4KIAA 1D0EA 4P9SA 4X4OA 1CLFA 3TYTA 4USKA 3AXMA 1WG4A 2R7QA 1Y3KA 1QSLA 1F1BB 3BO3A 4B3MJ 2QTWA 1CQMA 1LXJA 1S10A 4WKRA 1NJZA 3WIUA 2BACA 1GAOA 4AD6A 4ILLA 1S1UB 4RU2A 4JI3F 3MM8A 2HSEB 1CJTA 2M5YA 1QLNA 1NB7A 4CNYA 2FIUA 1U2RA 1FE0A 4I1TA 1PAEX 1KLMA 2OPRB 2C22A 1UEVA 1YGYA 2F8MA 1C4CA 2X1FA 2D41A 3KJVB 4F50A 1PJ6A 2FLLA 3QGIA 4DL7A 2QE5A 3UVJB 1RT3B 4K4YA 3PJXA 2LQBA 2XMJA 2R7UA 2HKEA 2CVEA 4RW9A 4ZVOB 5A8RB 5KG3A 4PWDA 4K4XA 2PDAA 4ELUA 3IG1A 1M1GA 4TY8A 4LJMA 4WKYA 2GCFA 1YITS 2BZ2A 3DOLA 3HHLB 2VG6A 4KR0B 3M2RB 1SQFA 4NYPA 3EZ5A 1KQKA 1BGXT 2OEMA 4DWIA 3PRVA 2YNFA 3QT5A 4N56A 1R7IA 4DFKA 2LA4A 5BYRA 1BQXA 4BHQA 2QMUB 2QA1A 5C24A 1FHTA 4I7FA 3I87A 3W5XA 3QFWA 2CPHA 2Z2LA 1SC1B 2W2PP 2R8GA 1JLFA 3D1HA 1UJ6A 4CH0S 2ATLA 1SB6A 3GE9A 5C2GA 1UEUA 2IC3A 1GX5A 4J37A 2AX0A 2IYGA 3Q24A 1XR5A 2JVOA 2R8JA 4Q7AA 3O3LA 5HLFB 3OR1A 4ECQA 1FRLA 3TP2A 2CWXA 1LFWA 4DUTA 1FNOA 3OV7A 2FJWA 4AFFA 5D0HA 4G65A 2MKYA 2KFYA 1N33J 3AJ1A 5KFSA 2AJ2A 3HHEA 3RGIA 3JTOA 3FFIB 3FEYB 4Z7YA 3HSJA 3CDUA 1Y5NB 2CPDA 4FF4A 1LW2A 1RT2B 3TQEA 2EG1A 1SI9A 3HPOA 1JLAB 1TKTA 1MMLA 1ZOTA 2IIHA 3U7JA 3ICLA 4KO0B 3E51A 3MMCA 1T05A 5E3RA 1WHWA 2ZITA 2GQCA 4DV6F 1TVRA 1XEZA 2IJRA 4M5DA 3PM9A 2J76E 1ITPA 1RGVA 3I5CA 2NREA 2FJXA 1WF2A 4QR2A 2DH9A 4NLXA 4A8SA 1T9VA 1UETA 4I0WA 2XMWA 2HZAA 1IQTA 2ZD1A 5K9FA 2NXEA 4Q43A 1VDHA 4KAIA 5LJ3Y 4OV1A 1XJWB 4LF1A 1WOSA 3DM2A 5KFFA 3HULA 4IG3B 3DKDA 5I42A 3CJ2A 4ZDNA 4ED5A 1OY8A 1HMVB 1NK0A 3MGJA 4JI8F 4DS4A 3CULA 1VQLS 1HYSB 2PC6A 2X3GA 3IBWA 1VLYA 4PAAA 5I3UA 1X4AA 1IWAA 3K59A 4ZPTR 2O1PA 1RT6A 2Y8WA 1ZH5A 3FRZA 3AQPA 3LP1A 2BOPA 3MI7X 1CSJA 2H51B 4ILRA 2BX6A 1U0HA 1U1OA 3CCJS 4YB7A 2VA2A 3MEDA 2CA9A 1U8WA 4P71A 1H73A 1FKPB 4NYZA 4FF2A 4DXLA 1Z4UA 3AODA 3LAKA 3U1MA 3MD3A 2XS7A 2GGPB 3NLCA 2ZBCA 3CD5A 2IMOA 3VAKA 1OYEA 3R3TA 3OW2R 1Q79A 2MLZA 2OH2A 1R0BG 2B8QA 3NNAA 1TAUA 5IV3A 3DGPB 5M2RA 4ZJOA 3Q8VA 4WZQA 3M4XA 4A46A 3OXFA 2VDHA 1DAXA 4F4ZA 2B7CB 3H4BA 4DFPA 1X7VA 4WJBA 3L95X 2FHJA 1MWZA 5HBMA 4KKOB 3DC2A 1L3KA 4IG0B 3MCNA 3R1LA 4Q45A 2RU3A 4IRKA 5DQIA 2UU9F 2ZE2A 4KPCA 4ICLA 2VB6A 2PFDA 3G9CA 1RTDA 2MZTA 3DLJA 3IP0A 4JI5J 1WHYA 3EVOA 3CDBA 5BJRA 2ZFHA 3TAMB 2I38A 2B6AA 3FKBA 5DS7A 4OHXA 1LFPA 3VZHA 3V6DA 3PRBA 1RWMB 1F60B 1HNXJ 2GJIA 3KG0A 2AGPA 3ZNUA 1NMEB 3PRDA 2GVDB 1ICEB 4FYVB 4CT9A 1NPKA 3M8PA 4M1KA 4B3OA 5FLXU 4U7UK 1RWPB 1FWLA 1NM2A 3HSZA 2MGZA 3VWSA 1AA1B 3PYDA 5B0EA 4R8UB 2KKHA 1RAEB 3DLLQ 1W2IA 1X9MA 2HGMA 1N34F 1LQ9A 3GIIA 3ZZ0A 1ZM3A 3MR7A 5D77A 1RT5B 1X5TA 2VJUA 3RBZA 2E29A 3MM5B 2ZH7A 1IBMJ 1VHIA 4USVA 3CO9A 1O51A 3HHLD 1RT4B 5F8NA 2CQ2A 2XC9A 1UPPA 2HLTA 1FNMA 4GKJF 1S7HA 2RKIA 2MKCA 2ZNZA 1SC6A 2ZJPQ 1CVJA 4LFBF 1R8CA 4CLFA 4B9TA 2C2RA 2KRRA 3T1HF 3AB4B 4I2PA 4A8MP 1TL3B 3DRYA 4OZ2A 3P3DA 3H25A 2DGSA 3OL8A 2B5JB 2DITA 3PX0A 5IFMA 1KS2A 4YUDA 3TJ8A 1SJ4P 4CLYA 2HK2A 3D67A 2XLKA 2HHTA 2DNOA 4UQTA 4J9PA 1J5EJ 5C25A 3PG9A 3D0HE 2RH3A 4HT5A 2N4CA 2VBXA 5GVQA 3EMTA 4DR7J 1HKAA 4DPWA 1SIZA 4YB1P 1HWIA 3VGUA 1LWFB 2ILYA 3TWZA 2JEIA 2BM1A 4GO7X 2CDQA 1N5SA 4DQRA 1I51B 4OX9J 3MR2A 4K4VA 1HWJA 2B9XA 3UPFA 4QWEA 2UUCJ 2NXUA 2G1HA 4WE1B 3PHTA 2BEFA 4I6AA 4Q8FA 1WELA 3PO4A 4NLOA 4F25A 1LW0A 1QDUB 1WORA 3R7BB 1Z1ZA 1REGX 1J27A 2XI3A 2JFDA 2AD9A 4M94A 3N0VA 4TVAB 2XGQA 1NH8A 2IM1A 1NLKL 2CQPA 2NYIA 4YB6A 4ZS6A 5K14A 4AUKA 4C97A 2OPPB 1QSYA 5KFZA 1CQNA 3RW7A 3G6YA 4OYXA 3P45B 1CULB 4ZVSB 3UQSA 3DU5A 2AHOB 1F2HA 1P9YA 2XCAA 1IJFB 1OO0B 3VZIA 4ZK7M 3QWUA 2IRUA 3E8OA 1TK5A 2E1AA 2ZHBA 3MZIA 1QSSA 1M90T 2EBEA 4DF4A 4ZP7A 3C15A 2EFPA 3UFCX 3KTQA 5A6WA 3B4DA 2FPHX 4YHHF 1JXVA 2Q6BA 4M5NA 3SDEA 1HW9A 2D3ZA 2UUTA 3AJ2A 3ZZPA 4OLOA 1E6VB 5BR8F 1RT7B 1REVA 2QC3A 4BS2A 2IA6A 3H59A 4X4UA 1AROP 1T9UA 3VAIA 3O6QA 1NK6A 2DB1A 3JSYA 3R97A 2KO1A 4ED1A 2AZ1A 3POTB 4IFYA 5KOWA 3ET6B 2AEJA 1NSKL 3HVTA 4H4KA 5E5NA 2L3MA 3KDOA 2X51A 2YWEA 3DOKA 4FKYA 5A0YB 1NHUA 4LF5J 4O0NA 4BC7A 3DOMA 2VBZA 3GFZA 3CCES 2IM3A 3TQ1A 1MNEA 3GFXA 1RI7A 5CH7B 4ED3A 4JP8A 4KQZA 3EJMA 4QWAA 4P10A 3BBFA 1R3NA 3LH2S 2QJ3A 2HHHF 1U8SA 5LSRA 2RAQA 1D1UA 1N36J 2KZZA 2DHGA 5KFMA 3GQCA 1PIEA 4TYBA 2NQPA 1QVGR 1MMDA 1T3OA 3OSNA 2DR9A 3KLGB 3DYAA 4J5OA 1IVZA 1NK4A 4I64A 5C7PA 4UT4A 4DL5A 2YWWA 1BC6A 5ETVA 4I69A 5IT9U 5HSPA 3L7UA 2BDPA 5J2PB 2YNGA 1Q1KA 2MPUA 2RIJA 4TKTA 2DR7A 1SIWB 2ZHAA 4PUOB 5E7OB 2AJ1A 4C98A 4K2JA 4XPCA 5DRKA 4N8NA 5J2QB 1WC3A 4NLUA 2KVQE 1WOPA 2LFVA 5B0AA 1BQMB 2BUNA 1JNZB 3I0RB 5CYQB 4EZ9A 2RRBA 5ETQA 5D0EA 2C3UA 1RCXB 4HI1A 2I2YA 4X62J 5A6PA 4ECYA 1JWWA 4RUHA 1YZ7A 3KJQB 1EKSA 1RAJA 2YWHA 5KFNA 1VC0A 2OTLS 4N7TA 4WTYA 4HTJA 3GSIA 1KHVA 5H9EJ 1DTTA 3CJKA 1SKWA 1NU4A 2FJBB 2DCUB 1OY6A 2VG7A 3C6UA 3I56S 2DT9A 1I5OB 4PQAA 2YBVA 1ZETA 1X5OA 8RUCA 2JL9A 5KFHA 2XZDB 3PNIA 2O66A 3KK1B 4PWWA 4JI1J 2EFGA 2CQCA 3GMGA 2M88A 3BYRA 4ZVTB 2IAJB 3JAMU 1HQEB 4FN5A 1U1PA 2VC0A 4LF6J 3K7RA 4F4YA 4JI6J 3TA0A 2BE2B 1QTMA 4E8UA 2UUWA 2MY8A 4YFUA 2ROGA 2IPOB 1LWEB 4FP9A 3UDEA 2J9EA 1Q81T 3NAIA 1T7PA 1RTJA 1GXUA 3C16B 1FEEA 3IWNC 1S1WA 3S8SA 1U7LA 3H20A 4ZCLA 4MAKA 5G0RA 1FFSB 2BJ7A 4DQQA 3D5MA 1Q8KA 1RU1A 2CJQA 2W25A 3CTRA 4MYTA 1VQ9S 2BJ9A 2HWHA 4IRDA 4PR6A 5F9LA 2VPWB 4LF8F 5IWAF 3KK3A 1FTCA 2R8HA 2W8LA 1U6BA 4CM0A 4DX7A 4RNOA 5J2MA 2L48A 1AFJA 2WW4A 3DLKA 3J80U 1N5YB 1KC8T 3TAPA 1OQ6A 2BKOA 2AEMA 4JI4F 4UUXA 2DHHA 1Z2ZA 2V0NA 3JB9k 4F4XA 1DFDA 2V94A 2Y1LB 1SQGA 4KGMA 4DQPA 2CFXA 4FVMA 2P5VA 4OHZA 1TUGB 2CNNB 4KSEB 4F36A 4RKUC 3HXMA 1RWOB 1JNRB 3MM8B 4A47A 2MXYA 2W9CA 1CJTB 3B82A 3KLFA 3ZTOA 4P7VA 3LWLA 2QT7A 2VQFF 2W1BA 2HQCA 4OI1A 3BM7A 6FDRA 2R7XA 3IWLA 2CXEA 4K59A 3ISND 1O8BA 3QNWB 4J9NA 1F5CA 2ZBQA 3D3CJ 1SL0A 2AZ3A 2V6AA 1KLNA 2HYIB 1VJQA 4C8MA 4YY3F 1I1GA 1UCNA 4KTQA 3V2UC 2NCKL 1RWUA 2OFGX 2E1RA 5KG4A 4JI0J 2BYCA 3HDSA 2F7VA 4RW9B 2V67A 1NEEA 2FB0A 2UV8G 4PWDB 3IG1B 5KFRA 4YS2A 4TY8B 1UW4A 4M5IA 1HBOB 3BBBA 1YIJS 4DPUA 3DOLB 1Q53A 2GQQA 2VG6B 2X3DA 3CJ5A 1MN9A 2CZ4A 5F8LA 1TUWA 2FTRA 3VGSA 3J81U 4P74A 4DF8A 3MMAA 1K73T 3Q23A 4QOTA 4CO1A 2L9WA 5C24B 3EPIA 3D9BA 3MR3A 4OZ3A 2E5IA 1OPZA 3PX4A 2AYEA 2P9CA 3MAHA 4L72B 3C46A 1RAOA 4MKAA 1JLFB 4J9LA 4KYZA 3WC0A 4X66J 1K44A 2DD8S 9RUBA 1OJ4A 1VFJA 1CPZA 3Q8YA 1FDAA 2HS3A 1AFIA 2GVZA 1ZBTA 3OR1B 4FDFA 1SL2A 2IMWP 3TARA 2BQ3A 4NMLA 1HR0J 2DNMA 3MM7A 2P9GA 3CGIA 2FUG9 1RHQB 2NYHA 2XWXA 4K5SA 3I9V9 1DJ0A 2MKSA 3RRGA 2F40A 4P6QA 2CVIA 3KNGA 1DRZA 3DRRA 4FXVA 2HNDA 2FY8A 3W61A 1WC0A 3BN7A 1EHWA 5KFXA 5KFUA 3B54A 4CLTA 1MWYA 3UR3C 4USHA 1T05B 1S5ZA 1TVRB 4LF9J 3BKFA 3W1YC 4M5DB 4JV5F 3W60A 5KFGA 5D8HB 3FZBA 2MMYA 2CPZA 1SL1A 3BGOP 1SXLA 3AFGA 1TFYA 1S9FA 2YWGA 5GMEA 4F4AA 2ZD1B 1JLQA 1URNA 1UWBA 1S76D 3UDVA 1YTYA 5HJYA 3DDNA 1R6YA 1SUQA 3DM2B 1KR4A 2KHDA 2XWYA 5I42B 1VQSA 4WXWA 2GHWA 3G87A 1HHTP 4QPTA 3PJWA 4B3RF 1JLGA 3VAHA 4TLRA 5KFOA 2V4QA 2QRRA 2EC2A 4GVBB 5I3UB 5HMZA 1IWGA 3BN4A 3QJLA 4CYUA 2DHSA 1RT6B 4Y3CA 1HBUA 2N4DA 3LP1B 3IMQJ 4F26A 4JUZA 2Z56B 2I1RA 3DNCA 1HA1A 4MYUA 1V6HA 1Q0NA 3MEDB 4F3OA 1C4AA 5KFIA 3VF0B 7FDRA 1L3TA 2GV1A 1F6TA 2JJ4D 2PN6A 4NMXA 1ZTWA 4MK8A 2J6UA 1D9DA 2QL5B 1T0TV 1T9TA 3KFWX 3DI6A 1S57A 2YNHA 1HLWA 3RB0A 4O4RA 4KH1B 1TELA 3DDKA 3U1LA 2ZUAA 2VONA 2QX0A 3CWJA 1X4EA 3UI3A 3EGVA 1O5JA 3ZTSA 1X5SA 2QA2A 2H48B 1XNRJ 2W9BA 2ZWPA 3FDSA 4DV1F 5HBMB 3OQ2A 3M9NB 1D9AA 1KONA 5CYMA 5KFWA 4P2XA 2UXBJ 3QLHA 3KLEA 5ITHA 1U1MA 1TKZA 2ZE2B 4ICLB 4Y34A 4QWCA 4ZCKA 2ZOMA 3FZ2A 1K1QA 3DHXA 5B08A 4K8RA 4F67A 2E9TA 2QLXA 3RU0A 5FJ4A 3T5LA 2EEYA 1UL3A 5EWEA 2PEBA 2HIYA 3CCVS 4ILMA 1R27B 1SJFA 3V6DB 1U09A 3QJPA 1RAAB 1SJ1A 2G1DA 2XHCA 2KRBA 1U49A 1FF2A 5F8JA 3A8IA 4DV5J 4IFVA 2C28A 3M8PB 1PAUB 2ZC4A 4B3OB 4B02A 1QAIA 4X4PA 3T6JA 1OSCA 2MQQA 4DR4J 3W9JA 3BDEA 1XR7A 3OSPA 4DHVA 3QT7A 2BQRA 4X2BA 4NLVA 4DEZA 1IBLF 3IS9A 1XBWA 2XMUA 4B3SJ 3EXYA 3A3OB 3G96A 4P7TA 3VTIA 4LF7J 2AGQA 3I96A 4LFCF 4OYBA 1RISA 4FYWB 2V4RA 3KHRA 4O3RA 2W4DA 5MLCV 1VQ5S 3WC2A 4DR2J 2DY9A 4UZCA 2ZDPA 2RKIB 1YQHA 3N6NA 1UAWA 4ZP8A 2MQLA 4ID8A 1X4BA 5HP1B 1H7WA 4MIWA 2KG1A 4I2PB 3DLGA 5DDOC 1GNKA 2VFTA 2V69A 3BPDA 4K4SA 2G0CA 1M5KC 2M70A 4WU3A 1Y0HA 4GKKJ 1YHQS 2HHSA 3LANA 2CAJA 1YVFA 1UVNA 2E5LF 3VALA 5GMDA 3PX6A 3V6JA 1S97A 2KH9A 1VQ7S 2LU1A 4G3IA 2ZNYA 4X65F 2BE7D 3NRBA 3UDLA 3C14A 5C25B 2DH8A 2AYMA 3HSGA 4IOCQ 4ID5A 4DSFA 5JJBA 3H8YA 2UUAF 3G6ES 5H9EK 2KHCA 5I3QA 1T8EA 4DFJA 3QGPA 2KZMA 2DRDA 3NCRA 2DRBA 1YX2A 4QYZK 3CEDA 3THPA 4NZ6A 2ZJQQ 1YBUA 3BREA 2DNGA 4UTGA 2GJFA 1GFWB 4EEYA 2BMBA 4PPZA 3NS7B 5K8NA 2W2NP 1KBRA 2KTQA 1H74A 2JLGA 5J1EA 2XS5A 2JOQA 1HNWF 4M5MA 2UXCF 1K8AT 1B64A 2AYBA 2GFFA 4WU2A 3HKWA 1SH0A 2YWKA 3CC7S 2ZH3A 5B0FA 1FFGB 2YPZA 1VHFA 3H5YA 3HK2A 1LEOA 2RQ4A 1F5BA 1X60A 4NXNJ 4M5LA 4R0EA 4M5HA 4NZ0A 5K14B 3Q8UA 4LRFA 5D4LA 1JX4A 4PG4A 1XMOJ 2N3LA 3CC2S 2L41A 3LAMA 2MTLA 7AT1B 3GB0A 2VFRA 3CJQA 4NRUA 4DUZF 5KFLA 2C2OB 1FTRA 3EYZA 3JQMA 1JLBA 5GAHI 1HNIA 5CZXA 2Z8QA 3S1TA 3I5BA 2I5JA 5KG6A 2HQIA 3C15B 3MR5A 1WC5A 1VC5A 3Q0AA 1S0NA 2DK2A 4DV0J 3SDEB 2XNRA 2RUGA 4GO5X 1GMWA 4DV4F 3OPKA 1REVB 4KHRA 1ELOA 3TVYA 4K5RA 1UP1A 1JMTA 4PKDB 4TQSA 4O44A 3RUBL 1FE4A 1TAQA 3UD5A 1X4HA 4O4GA 4IFYB 2BJ3A 5L1JA 2XULA 3HVTB 1SBRA 3CNQP 1H3DA 2BBEA 3DOKB 3NS5A 2WVCA 3IO1A 1VQMS 1F9FA 4X4TA 4CLZA 5U47A 2OP5A 5M2UA 1JJHA 4IOAQ 3GIRA 2FHJD 2XYHB 2FQQB 3FRYA 1Q16B 1V3SA 2HLUA 4CLUA 4KHPF 4ZP6A 2HBRB 2GC8A 2NXNA 2RILA 4P2SA 4HL9A 3MD1A 2R42A 3SBMA 4NWBA 1V3RA 3GYNA 1N52B 4JI2F 2ZDOA 3A1YG 3C6TA 4FF3A 1DTQB 1RT1A 4FXWA 3DYAB 2J0SD 2J8AA 4B08A 3UCUP 4IH6A 1SH2A 3CT9A 3TJAA 1FVQA 1B99A 4TU7A 4UZBA 1FDBA 4K4WA 5KOXA 2OO4A 3QJJA 1X9SA 5ETMA 1I6JA 1OWXA 2YNGB 2ZH8A 3F73A 3ILIA 3W3SA 2FJAB 2J9DA 3NGUA 2EWHA 1RAFB 2M7SA 1TV6B 3DXBA 1WDDA 1YJUA 1DQ9A 4QQBA 3LWMA 5F8HA 2XQCA 2V2ZA 2IVFB 1V5VA 4YR0A 2Y8YA 2H5EA 1YDLA 4AE5A 4GC6A 4DV2F 3NWGA 2EC0A 4Y2MA 3B6BA 4C8LA 1M1KT 5KFDA 4LQ9A 3M7VA 2AF6A 1IKXA 1GT8A 2JLFA 3ULHA 3CJKB 2RT3A 2KYZA 2ZWOA 1YG0A 1S59A 3VQTA 1APSA 5DDPC 3C3LA 4C4WA 2CJKA 3PCOB 4L73A 5GAEU 2RS8A 1YJWS 1R8BA 3BGLA 4LBHA 4ECUA 1M0SA 2UUBJ 2YWFA 1W25A 2HFSA 4USWA 2IDLA 2F5GA 5J1PA 2MQ8A 2KG0A 1T94A 1PGZA 3Q8PB 5LMNF 2DNPA 2BJDA 2GW8A 2R2UA 1KRPA 4XAKA 4ZLNA 3PACA 1NK5A 1RTJB 3NGSA 3R5AA 2OPSA 1I3OB 1S1WB 4X64F 2JC0A 5G0RB 4DR6J 3HKZD 4PXCA 1UFWA 5D3GA 4A8QA 1RBOB 3OFEA 3PKYA 3ZZOA 1NUEA 3KK3B 1NJXA 4B3TF 1ZPVA 4URQU 1FWPA 2AQ4A 2WCXA 2J0WA 5HI7A 5J2MB 4LF4F 4OYZA 2R8IA 3DLKB 3BB5A 1VQPS 3PIOQ 3QFHA 1EZZB 2CYYA 5HK4A 2HGNA 4F3MA 4IR9A 1M1HA 3KYLA 3OTOJ 1U2FA 3DRXA 3VCDA 1WC4A 4RBUA 1FD8A 3BQ2A 4QU7A 1S12A 1XC9A 3WDOA 2D3UA 5C5JA 1TP7A 2GO8A 3RAXA 1AYEA 3PZPA 1WC6A 2RDDA 2G0JA 2D1CA 2W9CB 4FBTA 2CPYA 5ETKA 3KLFB 4OZ1A 4ZPDA 2PIIA 5ETRA 2RF2A 4NXMF 2Z57B 1O6XA 2F65A 2OEKA 1G3OA 1NO8A 4Y6IA 3SXLA 1AB8A 3ILLA 1QY7A 1JJCB 1WHVA 2YX4A 4LSNA 4CP5A 2Q79A 3OTEA 3P4UB 3M2UA 3M6XA 1SC3B 2HRUA 3DN9A 2EFNA 2PT0A 3GJRB 1D8ZA 3I0SA 4GVLA 3H7HB 5LMUJ 3DFEA 1XK8A 2HVDA 4ED6A 1P1TA 3NXZA 4DX5A 2DBBA 3OUYA 4L75A 2OPQA 5A8WA 4C0OC 1M5VC 4EU0A 4YN3B 2PMWA 4EUVA 2ABYA 2DPJA 3PEHA 2HNYA 2BQUA 1KKHA 4QW8A 2C2EA 2JVRA 3MMAB 3QZ7A 2RS2A 3CD7A 4HTIA 4ED2A 2XSJA 1S6QA 1BWVA 1EB0A 1VCTA 2VPZB 2QG9B 3TUZC 2KT3A 1T9XA 1C0UB 4ZCMA 2K1RA 5GAGU 3CCSS 2B4OA 3K5MA 4DCOB 4I6WA 2AEFA 1FX2A 2A6MA 4NA2A 3ENVA 2ZH9A 1TKXA 2KU7A 2KI2A 5AJ3J 4DLGA 2BM0A 3OL7A 4J91A 1JLEA 3SSQA 5T14A 3QGHA 2F8HA 2HQ3A 1RHJB 2B4PA 3PEJA 4DCJB 3MM7B 1XMQJ 2UVVA 4F04B 2I9SA 4Y0FA 1T03A 3HCXA 2JEGA 1D8YA 3AOAA 4MT1A 5B7WA 1LOUA 2CQ4A 3KG1A 3IRXA 5T41A 2KL8A 3H5XA 1I94F 2HNDB 4CLLA 2AJFE 1GK8A 3Q8RB 3R1HA 2XG8A 3JXOA 1UFLA 3MECA 4NZ7A 2BJ1A 2IRYA 4DQIA 5HJXA 2UXDJ 4RR5A 1UA1A 2XZTB 1NCLA 1VC6A 2J9CA 4OIXA 2CJXB 1Q4RA 5LOQA 5F8GA 4YEAA 2QZ8A 5LSLA 2NZCA 1VBYA 2E9ZA 1XN9A 1ACMB 2D3O1 3NOCA 1FJGJ 4TLQA 3KJNB 4NE9C 2Q66A 2JX2A 1HD1A 3NMAA 3I6PA 1RXOB 4CTAA 3HLUA 3RB3A 3SV4A 4USTA 4OI0A 4IQMA 1UWBB 4HR2A 3MUVP 3G8SA 1HNZF 1CJKA 5EHHA 1SUQB 1FKAF 4IR1A 4IH5A 2I6WA 1NDLA 1AUDA 2MHEA 4OQJA 3TW0A 4ENOA 2FLPA 1U48A 3BSCA 1JLGB 3G8QA 3BGUA 2YX1A 2POKA 3AA8A 3HF5A 3QZ8A 4J90A 1AZSA 2E5HA 4A4JA 2VJVA 5B0CA 1RHUB 1HBUB 5K8OA 2XO6A 1NBEB 2HAFA 1W26A 4B9MA 1IXKA 4LBIA 1HFEL 4FF1A 4DU8A 2DHXA 2QO3A 4ZVQB 1E6YB 3DI6B 3PJ9A 2LA6A 4JYAF 2V2QA 3L4BC 2YNHB 1UFKA 2QSFA 2BA9A 1FT8A 3RR7A 3SSRA 1C1CA 3S7RA 4DUYJ 4TY9A 2EFQA 3FSXA 4PZVA 2J5AA 1RBLA 3FCWA 5IC6B 4Z37A 3P5TL 3BYPA 4ITSA 1OMSA 4LFAJ 3FBFA 2X1AA 4LRAA 3KNAA 1VQNS 2W9BB 2XZWA 4WWSA 1A0OB 2VQEJ 2O67A 3Q2TC 5CYMB 3CIMA 3QLHB 3KLEB 2FHMA 1TKZB 2N3OA 2Z2ZA 2R4FA 3KMSA 5HVFA 3QT8A 1RQ0A 2ZH2A 3D7SB 3TVZA 3PDNA 2GHPA 1YJRA 1Q7LB 5IOLA 2VPYB 1LWCA 1SC4B 4OX8A 3IAM9 1YI2S 2IVYA 2XLIA 2RD5C 3LTOA 1GQEA 1IBKF 6FD1A 2ZM6J 2PSZA 4C11B 2M9KA 2M3DA 5DZ7A 4CQ1A 1VMBA 1WJ9A 3BEGB 3I82A 2FVQA 1MU2A 1U1KA 4DS5A 4LSLA 5L46A 4IFVB 2Y0SD 2OD4A 2J0XA 4U6PA 2QLJB 3K5LA 3R5JB 3H90A 3NNHA 2QL7B 3J7ZT 2XO7A 3D3BJ 3DMJA 1B0TA 1U6ZA 2LYVA 3K8VA 5HO4A 1DLOA 3PR4A 2DR8A 3H42A 1EETA 5L39A 1JJ2R 2YKNA 3EGNA 2XB2D 4OZLA 2ADCA 3OHAA 1QAJA 2V9WA 4UOHA 1AUSL 4DV3F 2HG4A 3CJ0A 3MAAA 3BSOA 4OI2A 4AXJA 4NCGA 2G0IA 4O3PA 2NR0A 2K06A 3NMRA 4LVOP 1B4SA 1CS4A 2FVSA 3RG6A 1KNZA 3M05A 1FRXA 2CJ9A 3FMWA 3M6VA 3HD2A 4RUCA 1L3SA 4Q2LA 4ANDA 4MMOA 4E2FB 3DLGB 3TO8A 1HQUA 2MKIA 4C48A 3IXQA 4KHMA 4FS2A 4QZVB 3UO0A 3W9IA 3GIMA 3M2VA 5IV4A 4UOGA 2XBPA 4ZN1A 5ETPA 4F2SA 4CO2A 4PCQA 4ECSA 2YVSA 4NI2A 1Y7PA 1Q5VA 4RU9A 2FJVA 3C14B 2G9OA 3UWTA 1BY9A 3KJVA 2GNKA 1N0VC 1S1TA 1IKWA 2UV8A 2VC1A 1RCOB 5EX0A 1SJ3P 3QRQA 3UVJA 2QV6A 5CA5A 3LOUA 1R8PA 5A8RA 4BWMA 1HBNA 1IUJA 2ZH6A 3K5OA 5DJBA 1HI8A 1YBTA 7FD1A 2MKKA 3GPAA 3G4SS 3OFGA 1SKUB 3AXKA 5B0GA 3OR2A 5J1EB 3SYZA 5L38A 3NGKA 4KT0C 2W2MP 3EPGA 4DU7A 3HT3A 3D66A 1S72S 3EZUA 3RR8A 1U6FA 3CMQA 3DLEA 2IRXA 4DOZA 3JYTA 4IKAA 4OHYA 4DSJA 2J8SA 2FJDB 4WTOB 4ZLPA 2ZBRA 3F0NA 2HNZA 2ASLA 4A8WA 2G4BA 4ZPVR 5D15A 2G2OA 4NX9A 4RO0A 1Q8LA 1ZM4A 1V3ZA 5KFYA 1N8RT 4JI7F 4NLQA 1B7YB 5HLFA 2XI2A 1NK9A 2YKMA 4DX6A 1RAIB 4RL1A 1HNIB 4RNMA 1FRHA 4JB8B 1HARA 5E3CA 4WP8A 3HJFA 5DGAA 3GIJA 2LQJA 2V8VA 1B0PA 1YJ9S 1VS3A 2XM3A 4QYRA 2I5JB 3MCOA 1VBZA 3R5GA 1WKLA 1CJVA 3PY8A 3WX8A 1NKBA 4AQYF 5DG9A 3T1YJ 3BO2A 4CRJA 1JKHA 3F56A 2X1GA 2OEJA 1RT2A 1HHSA 4QR1A 2HBQB 4IDKA 2AW0A 4LREA 3TZWA 3QO9A 3MPVA 2HQGA 2MQPA 4ZA1A 4DV7F 3QQCD 3W5ZA 3TI0A 3BKUA 3PTWA 2QFIA 2AV5A 2HFUA 2IDEA 4W92B 4K0KF 4TXSA 4HACA 1WD6A 4WYLA 4WBFA 4O44B 1YSJA 2R2RA 3IN5A 3W7BA 2OIHA 2OELA 2B0GA 1R31A 4WF9Q 1RE1B 3TEGA 1F9HA 2XS2A 5DETA 5K20B 4F4WA 1T9YA 2CQIA 1NDPA 3QMQA 4DR1F 4AL7A 3K5NA 2XMVA 3T41A 3FEZA 3FSIA 2QIFA 2PE8A 5D6GA 1FI4A 3G6VA 2E7WA 4LT6A 1RTIA 4EGLA 2LECA 1P27B 2V8HA 2NZ4A 2QFJA 2ASDA 1CBKA 3NWRA 2WHOA 2RDIA 5CABA 1UJ5A 4X4NA 2LEAA 3PFEA 3FC9A 2JC1A 3J7YI 3PW2A 2B56A 4KGXB 2LXUA 3IBFB 1C1BA 4JV1A 4ZVRB 3T5JA 3C6TB 4GMKA 3T9NA 1UA0A 4UOCA 1RT1B 3MHYA 3SI8A 2CQDA 4OLPA 1U1NA 3SCLE 4ECTA 1Q8IA 4UOFA 2C3PA 2DIVA 2HURA 2MLYA 3CJRA 3ZZRA 1WWHA 1S79A 1XNQJ 4UY85 4Y2IA 3W2WA 1SV5A 5J2NA 1BMQB 4NOHA 5DM6Q 2VH7A 3O1LA 3TOQA 4DG1A 4OYIA 4EI2A 3UN2A 2HPUA 3UE2A 3IWXA 3QGGA 3LQVA 1YZ6A 3LGHA 3UDCA 3CUNA 4P75A 2A0FB 4ALZA 2R7WA 2V8DA 2IM0A 2KM8C 1FFWB 3IC1A 2E1CA 2W4CA 1OIAA 1Y10A 4K2XA 3KMQA 4DR5J 3MFHA 4KKOA 2YKPA 2DR5A 3FQLA 5KT3A 1CJUA 4ED4A 1IKXB 4RW7B 1X31C 3H4DA 1SJQA 4B3MF 2D74B 1RTHA 1OSDA 4ETZA 5EDWA 3GWCA 1KSPA 2E66A 3IGNA 3I31A 5HQMA 2H1YA 1VK8A 4RX6A 1RLDA 4MJKA 4HH0A 3BBCA 2X7IA 3GFHA 2ALYB 3NP5A 4DCPB 4CLWA 2CQGA 3OTBA 3KUHA 2HRTA 4DSIA 3BGFA 3BZQA 2GVDA 3EVMA 4MKVA 4FVCA 5FIIA 2BJEA 2GIQA 2XY6A 1NKCA 1PSDA 3DRSA 4DR3J 1IKVB 5JUMA 2DGTA 3M6UA 3PHEA 2HFOA 3PYEA 1FJEB 3H0PA 4C7QA 1Y11A 4DPOA 5AXNA 2DY1A 4ZN3A 2VKZG 1TMMA 3GU0A 4PYDA 2MJNA 2F4VJ 5AE3A 3K17A 1R8HA 5I4MA 2MEWA 1H2TZ 4G1IA 3L7OA 5JVGQ 3MTJA 1U24A 4PXBA 5IC4B 2Z58B 4HYKA 2J0QD 2M0GB 3FMBA 2H9ZA 1FEHA 4M95A 4J9VA 1QAYA 4XTTA 3RYLA 3ZTRA 2YXLA 2O3DA 3JTNA 1GMUA 4LQ3A 2B5JA 2HVEA 3GJTB 1X4CA 2RF2B 2ALZA 2H4YB 1QAXA 4V1Ak 1T02A 3VAMA 3PYFA 1ZZNA 2AU0A 4N76A 4LSNB 1N33F 3KLIA 2W7AA 4OJ1A 2FHKA 4ECZA 3O2IA 1BXNA 3M2UB 1U02A 3CDWA 2EW9A 2ZKUA 4ZITA 1NSPA 3BSAA 2JRSA 2Q6CA 3WX4A 1NKEA 3I0SB 3N01A 3L3CA 2M4MA 4LIRA 5KFPA 2VZ9A 4DL6A 2FC9A 3OT9A 2LLZA 3K5PA 5L1IA 2OPQB 3HHDA 2H5IB 1RHKB 1T11A 2DPIA 4EK2A 2FVPA 1PJ7A 1GMWD 3LW5C 1U25A 5IXUA 1RHMB 1K1SA 3HHKA 2AJ0A 2XTJP 2XSJB 2DGXA 4FYXB 4WPAA 2W4PA 4M5GA 2WONA 5KT2A 2XHWA 4OYPA 2FVCA 4Q2MA 5A8KA 2K1RB 2QA4G 1VR6A 4B9VA 1S49A 2RQKA 5KT4A 2GAGC 4NRTA 1KFSA 4F0KA 4ER8A 3NOGA 2R7SA 1TKXB 1SJRA 2GQ2A 4LR9A 2EXUA 1JXEA 1VISA 4PRFA 1JLEB 1YJ7A 2APOA 1FDDA 2YY3A 4JI3J 3EM1A 2FYXA 4ECRA 4RZRA 2ZBPA 4ZIVA 1T03B 4OYOA 2RE1A 3TR5A 3UD4P 1RBAA 3IRXB 3BO4A 3NKYA 5A2QY 1KVKA 2WSFC 2AKWB 5K5MA 2JFKA 2DJWA 2B51A 3MECB 4WFAQ 1KQSR 2CKWA 1QM9A 3HZEA 1JIHA 4NLDA 5DGBA 3DGVA 4HHJA 2LQ8A 2VUGA 6AT1B 2AWZA 3SQOP 3OL6A 4J9UE 4CH1A 2FHOB 3F41A 1HPZA 2QMWA 2PO4A 1FK9B 3ADAC 4CTAB 1R43A 2CQ3A 4U9RA 2CDRB 4U8YA 1KTQA 3POTA 3OL9A 3NAHA 3SV3A 1RWVB 4KJIA 2ZH4A 1CJKB 4K7QA 3RB6A 3CD6S 2FZGB 1YJTA 2BR0A 3CCUS 2AJQA 5IT4A 1ZZFA 1MROA 1YLXA 1UW9A 1IQZA 2K2PA 3MM6A 3D28A 2K8GA 4RPFA 5DLFA 2UVRA 1VLOA 3SSSA 2VFUA 3HVWA 3PVXA 3EICA 4JI5F 1QUPA 4IQXA 1AZSB 2OAUA 1H98A 3GV8B 1Y4ZB 3WBZA 1RK8A 3TZZA 3FEXB 2GAHC 4M8LA 4ED8A 1EARA 3N79A 4USMA 3AH6A 4DN9A 1HNXF 3GZ7A 4M63A 3M30A 2DVIA 2VOPA 3HFKA 2CPIA 4E98A 1DURA 5GMKa 2HZCA 3KUEA 9ATCB 1BHNA 2V8GA 3G82A 4KBIA 2PMZD 3TJ9A 3CCRS 1ZM2A 2VDIA 3Q86A 2VFSA 1C1CB 2IM2A 2V68A 2H5JB 4LRCA 3FNNA 1FWKA 4DZ6A 5HATA 4A8XA 3LA0A 1PC4A 2HHUA 4DV6J 1AW0A 1S0OA 4PUOA 5L9XA 4NCAA 1U45A 2E44A 1ZM9A 2DCLA 4UF4A 1IBMF 5LXRA 3ILOA 2BKNA 1LK7A 2J7UA 5L8RC 3ZO7A 1TU0B 1Y5IB 4WP3A 1OS5A 2DEJA 1SKRA 4HLBA 1P8GA 3G2XA 4FZVA 1TTHB 2RB7A 1WEXA 3THTA 4OZNA 2Q3PA 4FPIA 4Y2KA 1LWCB 2OJ3A 2XYGB 3Q2SC 1LWXA 3GIKA 4QYZJ 1MLAA 3N28A 4JI8J 2Y9HA 1ZS6A 4V19X 1XR6A 4Q5VA 4YB5A 1XTZA 2WOMA 3S6EA 3M8YA 3MMJA 4F8RA 1MU2B 3BR8A 5F9NA 2ROPA 5EWGA 3ZZUA 2XSFA 3M1VB 1J5EF 5T7LA 2G13A 2EKYA 2LMIA 4DR7F 3OLBA 1LWEA 1N0UA 3DMJB 1M5SA 1VRUA 3AD9C 1VK3A 2HWTA 3PO5A 3CJTA 4OJGA 2XMAA 1F5AA 3M6WA 1EETB 1N5VA 2OSQA 3TX0A 2R3VA 4LR8A 4MFBA 3A8EA 5LM7E 2MDAA 5FDLA 3MPWA 4OX9F 3MAAB 3BGRA 3I32A 4NCGB 4LVNP 1KEKA 3QWPA 2OHDA 2CNOB 2UUCF 3OXLA 3GLJA 4QWDA 4LIWA 2N7YA 4QCLA 2A6OA 1CS4B 1QE1A 2PI5A 3SCJE 1N5YA 4FKXA 3P49B 3P6YC 1JJ4A 1RB0A 3MAQA 2UU9J 3MFIA 1XWLA 2LQ5A 1HQUB 3DRPA 4H4MA 2WBMA 1NAQA 3M8RA 4ZPAA 3V81A 2AP6A 2Z0GA 3M2VB 2LVWA 3KK2A 5DQGA 1UVMA 3MUMP 3QIPA 1G2EA 4RLEA 1BQNA 4NI2B 4J9RA 3BH7B 3MOZA 4HHHA 1VQOS 1VRQC 3GV7B 4C8ZA 3MCSA 1H6KX 3MURP 1T3NA 1H2VZ 2OGUA 1S1TB 1KLMB 1IKWB 3PW0A 4P2FA 4C2MA 5E3QA 4BBYA 4Y28C 1NB2A 2WBRA 4KGZB 4F0HA 5F41A 1QVFR 2B7BB 1HBNB 1NDKA 2COLA 2GJ2A 4HDGA 3R5CA 4H54A 4NLSA 2JWNA 2CQ1A 5CD4H 1HBOA 4PABA 1NXIA 1N34J 3OR2B 2ACMA 1EJ7L 3Q89A 3MOJB 3RAQA 3SIPB 3H5UA 1BWEA 2YNFB 4TNOA 4C8OA 3DLEB 1AXQA 1X4DA 1H0HB 3JYTB 2CJAA 1ZAXA 3ZZZA 1PO6A 4GKJJ 3NCPA 4CLSA 1L3VA 4ANCA 5BYQA 2HNZB 4LFBJ 3DXSX 4I7FB 1GX6A 4ZP9A 4LF5F 1F3FA 5KG0A 3VAFA 3H5SA 3MCMA 3T1HJ 1PBUA 3UD3P 1JB0C 4DJBA 3KHHA 2YKMB 2IC3B 3VGVA 1WKKA 2DO4A 4J7CA 4EWTA 5B0BA 4ED0A 4B9SA 3HT0A 5HANA 2HBZB 3W8PA 1N36F 2YQ1A 3AA9A 5F8MA 1HW8A 2P2CB 3W64A 3LF0A 2RJZA 1CJVB 3DDIA 2ILZA 3W65A 3FBBA 1JKHB 4PYAA 1G7CB 2FLNA 4CO5A 4C8KA 3KLHA 3ENQA 3PXGa 4IDKB 2KYXA 1KP6A 4G6VB 2KXFA 1LW2B 4DSKA 2Z2MA 2R9LA 3QO9B 4NL5A 2YH0A 1K9MT 2QYCA 1EIYB 2XGPA 3HHLC 5CQGA 2H54B 1TKTB 3CCLS 3GYXB 2Y1IA 2MZJA 2QLBB 3NY0A 2K7KA 4ETXA 4C3KA 3BR9A 3V4IA 3MMCB 4HACB 2U2FA 1SVDA 3M8SA 4HKQA 2FY1A 2KT5A 2PA3A 1RYSA 5DO2A 5AT1B 2MHNA 4PXEA 2WSCC 2OFHX 4L6V3 1TL1A 3QRRA 4X62F 3P5BP 1UVJA 2HHXA 3GYGA 5DQHA 1Y3JA 1RTIB 1AT1B 2DGWA 2X1BA 1B7FA 3L7PA 1IKYA 4DLEA 3T19A 3W66A 5AXLA 4WXOA 4KFBA 2RDJA 2JZ5A 4GVBA 4CIOA 3RBEA 4PG6A 1U1RA 5F0WA 4USIA 4JI1F 1TK0A 1S1VA 4ZPBA 1C1BB 1FXRA 1H7XA 1UKUA 5E0OA 3CJ4A 3KJFB 3AQOA 3S01A 2PD1A 4LF6F 4JI6F 4KC5A 1C0TA 1U0HB 2AGOA 1KFDA 1UWAA 3MEEA 2NUUG 3CE8A 2ZJRQ 4ES3A 2HVIA 2AT1B 2O5DA 3RTVA 3ZC4A 2RUSA 4Z7CA 4YHHJ 3R2CJ 4GRSA 3W62A 1XERA 2CWKA 3NGTA 3W2WB 1SV5B 5J2NB 4Q0BA 2HS4A 3H2LA 5BR8J 4DI6A 2DNLA 2Z30B 4DG1B 2BVZA 2A10A 1VQ4S 2ACYA 3RW6A 1OPIA 4K4ZA 1VIOA 1S77D 3TUIC 2NUHA 4UQGA 5GAHU 2VODA 3CDAA 3HVRA 4FPRA 4YDDB 2JNJA 2VG5A 1CJUB 3SMZA 1NNDA 2FD2A 5KG5A 1RTHB 2VFVA 5I3PA 3N9UC 3A12A 1KTVA 3BV8A 3ZZTA 1RTDB 2HWIA 5ETOA 2F4FA 4N8OA 2FDNA 4QU6A 3K2YA 1WTBA 3AY0A 1TK8A 1KQGB 2B6AB 2HHHJ 3ITHA 2EK6A 1TL7A 3PW4A 2UVUA 4S0MA 2IBKA 3X1LB 3OHBA 3TAQA 1N54B 3G8TA 2PFFB 4EBDA 2QN6B 4PEOA 5C2CA 4XIUA 4NLRA 1R6VA 2LU2A 3DRSB 2OD6A 4JI0F 2RHQB 3CF5Q 4X84A 4EFAC 1YJVA 4R25A 4ERDA 3UW1A 5HMYA 2QL9B 5F3ZA 2RMLA 2MGZB 4QIGA 1QD1A 4DBQA 5IS2A 2P8IA 2BABA 2GIRA 3NGRA 4DL4A 1PYOB 2HFVA 3O44A 4I68A 4CM2A 3K0JA 2Y1JA 2MKJA 3LP2A 4Y2CA 4ZPCA 4CLKA 3C2PA 4XDCA 4QIVA 1U0SA 2MKHA 3ZZYA 1URRA 2ASYA 5F8IA 1X0FA 2V4JA 2DGOA 3RZAA 3E01A 2KJVA 1N88A 3FUYA 3LGNA 4QPXA 3L09A 2O01C 3MEGA 2H4WB 1RDRA 3BS9A 5HP1A 4X66F 4BDPA 2ATCB 1X0PA 3V6KA 2R7RA 1FNXH 1H38A 8AT1B 2R7TA 1BUXA 3SEOA 1B70B 1N6QA 4L74A 1HR0F 3FBCA 4NEZA 3KLIB 3SQGA 4XDDA 5KFVA 1U4BA 3P8BB 4DPXA 2VOOA 2OKQA 3FK4A 2YQ0A 4URSA 2DH7A 5AXMA 5KT7A 2XEXA 2BKPA 1HNVA 2V2VA 3E3XA 4PQUA 2HGLA 1PILA 4I6YA 3SCIE 3HVAA 3LUYA 4WFYA 1TUVA 3NEKA 2HQDA 3U27A 4DSEA 1N5QA 1KD1T 4KY3A 3HSDA 2VASA 2EBGA 1Q82T 3H2VE 5AXKA 2PA8D 1CEZA 3VV2B 1PYSB 5B09A 2XLJA 2I0XA 1Q8BA 1WI8A 1YRTA 4LF9F 4LF8J 2WK4A 2KFZA 5IWAJ 2CPEA 1FJCA 4N77A 2WRMA 3EVWA 4TU8A 4DL0C 1LW0B 2WONB 1JLCA 3H40A 5A8KB 1X8DA 1IM4A 2CQBA 4DPYA 4MH8A 4JI4J 4NLPA 5CD4A 4FBUA 1DZ5A 3CIZA 1WUUA 1RHRB 4DQSA 4Z2XA 2WZ1A 1B0VA 2I8EA 4H4OA 2WB4A 3VVTA 1SKSA 2GZOA 3PW7A 3NBPA 1K47A 1N32F 2B3TB 5ADZA 1S7IA 5D4NA 2VQFJ 3MPYA 1RZMA 4KV8A 4YY3J 1S1XA 3SFUA 1K0TA 3HHNB 1VQ8S 2VIHA 4WFZA 2E5JA 2B43A 3PW5A 3U1NA 3CJ3A 4ZVHA 1PCAA 4EBCA 2CQHA 2EK1A 2ZVIA 1UVLA 4X4SA 2Y0BB 1L5UA 3VHQA 1N56A 3M8QA 3RRHA 3DCAA 2HHPA 2B4UA 2W7PA 1HPZB 5MAOA 1HBMA 5ETSA 5K8MA 2A3JA 4RW8A 1FD2A 4DN0A 3W2VA 3KHLA 2N7CA 3R7NB 1WEYA 1XNRF 4CH7A 4CO0A 1JXLA 2DEIA 1BLUA 4TYAA 3OVAA 3EXCX 3M32A 2LQ9A 2UXBF 1MROB 4A8YA 3GONA 4U8VA 2D3OR 1VIXA 3MM6B 3ISNC 2YKOA 4ZVGA 4OX7A 5CXTA 3PV8A 3DOMB 5AE1A 5HQ8A 1IN0A 3PR5B 1VYAA 2MY7A 4USUA 2SXLA 4ECWA 1FX4A 5L1LA 3JSMA 2LXFA 1M5PC 1P1LA 4RW6A 2F63A 2BV3A 4OMFG 2C3YA 1RUSA 1RACB 2MLXA 1PG5B 2W2QP 2C3MA 3T3FA 3T9ZA 2D69A 3LP0A 1DTQA 3N5FA 3GR0A 5EGYA 1LKZA 1KN6A 1IR0A 4DV5F 4LF2A 2AIRB 3M30B 1F3VA 3CW2C 2MZQA 4DL2A 3HX9A 4O23A 1S9EA 2BRLA 4YOEA 3G82B 4M5KA 2NSBA 2ZUGA 2B9WA 1WHXA 4DR4F 5KFAA 1S4FA 1KHWA 4CZCA 2JLEA 4J9OA 2HZVA 4FS1A 3ISZA 4B3SF 3PKMA 4QIEA 1VQKS 4CNZA 2GIFA 3V6HA 1ZA1B 1CC7A 4JV0A 4LF7F 3Q8QB 2P9EA 1R89A 2MQOA 4JV5J 1TV6A 1MWQA 2NPIA 3C8YA 5KTQA 2A2CA 3AOCA 2ZZNA 1NHVA 4N47A 2Y1RI 2IY5B 4JOUA 4DR2F 3HI9A 1B3TA 1RWNB 4BC9A 2XCPA 1ZTTA 1NZ8A 1D9FA 1YKWA 8ATCB 4K4TA 1KOHA 4ZVUB 1RABB 2EPIA 4DDFA 3FQKA 2DNQA 2UVWA 2BANA 4DPTA 1DTTB 4RW4A 2DGQA 2UZAA 4ZLJA 5F0UA 2DXFA 2CNLB 5EX3A 4B3RJ 3VAGA 5KG7A 2VG7B 3K89A 3C6UB 3CVKA 4XPEA 4GKKF 2WTFA 1N5TA 3AAWB 3IRWP 1D3WA 3KUGA 1EP4A 3W9HA 1Q95G 2F9JA 4RBTA 4K4UA 2WOMB 1WG1A 4CLPA 3MR6A 1RLCL 3CXCR 1FJ7A 3OJUA 2YH1A 1R0CB 4RUAA 2JSXA 5T7LB 5EN1A 2K3KA 3ZTQA 1S9GA 1U47A 3A8KA 4KE5A 2CPXA 3R6GB 5HMWA 1J5OA 1VRUB 1FESA 2MB0B 4LRBA 3DLHA 1FXDA 4NLTA 1KQFB 1WI6A 3AD8C 4MFBB 1D09B 3D68A 1RADB 5FDLB 1S0VA 4OZ0A 5C42A 3FCVA 3TEHB 5E41A 3BGRB 3IGVA 3SFGA 1RWXB 2M52A 4P2MA 2W2OP 2KN4A 2JH3A 3IFEA 1HWKA 1Q5YA 5CCMA 5CYJA 4ES2A 3NG8A 1N48A 2A1BA 1QE1B 3R9LA 3K57A 4MTPA 2A18A 4XK8C 2WVEA 4DV1J 3OXGA 4ZHRA 4PG7A 2MSSA 3BQ0A 4JBCA 4U7CA 1RYRA 2HRYA 1J2VA 1S6PA 2R7VA 2HQFA 3ETMA 4NXNF 3DRPB 3TNVA 1FO1A 4H4MB 4RNFA 3V81B 3D6HB 3KK2B 1XMOF 1NK8A 3OVSA 3QIPB 1BQNB 3O5TB 3R6LB 3FJ2A 1Q7YT 2HHQA 5IZHA 1UVIA 1P6TA 5BXIA 4OJHA 3RBXA 2M8DB 3EZOA 3P96A 4KGVB 4J9MA 2ZBIA 2E7VA 5HVGA 1YWXA 3N4WA 4O3QA
chains in the Genus database with same CATH topology
1TKDA 5I3QA 1T8EA 4L3NA 4DV0F 4DFJA 2XMJA 3QGPA 2KZMA 3L3CA 1Y5LB 2M4MA 4LIRA 5KFPA 2R7UA 2VZ9A 2CVEA 3NCRA 1F0XA 4RW9A 4G1QA 5A8RB 5KG3A 4DL6A 2DRBA 4Y2AA 2FC9A 1KN6A 4PWDA 4K4XA 3CEDA 2PDAA 3THPA 4ELUA 4Q8EA 4NZ6A 3IG1A 2LLZA 3K5PA 2ZJQQ 5L1IA 4K50A 2OPQB 3BREA 4TY8A 4LJMA 3HHDA 4WKYA 2GCFA 3K58A 2DNGA 4OI6A 5DG8A 4X4VA 4OX6A 1YITS 2DPIA 4EEYA 2BZ2A 3DOLA 4PPZA 3HHLB 1LXNA 3ENWA 2FVPA 3PFOA 2VG6A 5K8NA 4KR0B 2KTQA 3M2RB 4NYPA 3EZ5A 3LW5C 1KQKA 5J1EA 1BGXT 1U25A 2JLGA 2XS5A 5IXUA 2JOQA 4DWIA 1HNWF 2UXCF 2YNFA 3MMBA 1K1SA 1K8AT 1B64A 3MM9A 4N56A 2AYBA 1R7IA 2GFFA 4DFKA 3CPWR 4WU2A 3HHKA 2DGUA 2AJ0A 3HKWA 1SH0A 4ED7A 2XSJB 2DGXA 2YWKA 3I55S 3VQSA 2LA4A 3CC7S 2W4PA 5BYRA 2WONA 5KT2A 2ZH3A 1BQXA 2XHWA 5B0FA 1GXTA 4BHQA 2FVCA 4I2QA 4Q2MA 5HMXA 2IJNA 2QA1A 1VHFA 5C24A 5A8KA 3H5YA 1FHTA 1C0UA 4I7FA 3HK2A 2K1RB 2QA4G 3I87A 4AYBD 2W8KA 4O3NA 4B9VA 1S49A 2CPHA 2RQKA 2Z2LA 2RQ4A 3OFHA 5KFTA 1F5BA 4NRTA 5KT4A 5L1KA 1KFSA 2R8GA 4R0EA 1JLFA 2R7SA 3D1HA 1TKXB 1UJ6A 4CH0S 1SJRA 4ECXA 4O0IA 4NZ0A 2GQ2A 5K14B 5HROA 2ATLA 1SB6A 1FRIA 2EVZA 3GE9A 5D4LA 1JX4A 4PG4A 1JXEA 2N3LA 3CC2S 2L41A 1H2UX 1UEUA 3LAMA 4PRFA 3I4PA 1JLEB 2IC3A 2VFRA 2APOA 3GB0A 4NRUA 1GX5A 4J37A 2AX0A 2IYGA 4DUZF 1FDDA 3Q24A 5KFLA 1TL4A 1XR5A 2JVOA 2YY3A 2R8JA 4Q7AA 3O3LA 4YP3A 1FTRA 5HLFB 3OR1A 4ECQA 3EYZA 4ECRA 1FRLA 4RZRA 4Y65A 3TP2A 1JLBA 1LFWA 5GAHI 2GMJA 3HMJG 1FNOA 1HNIA 5CZXA 4AFFA 3OV7A 5GADU 2FJWA 1T03B 2HMIA 4ES1A 2Z8QA 3S1TA 2KFYA 3AJ1A 1QUVA 3I5BA 2RE1A 5KFSA 3TR5A 3UD4P 3HHEA 3M9MB 3JTOA 3FFIB 3IRXB 5H9FJ 2I5JA 3BO4A 3NKYA 5KG6A 3FEYB 2HQIA 5A2QY 2HIQA 4J9SA 2WSFC 3MR5A 1VC5A 3Q0AA 5K5MA 3CDUA 1Y5NB 2JFKA 4QWBA 3KLHB 1S0NA 2DK2A 5THWA 2CPDA 2DJWA 2B51A 4B9UA 3MECB 4FF4A 3LPYA 1S48A 4WFAQ 1LW2A 1RT2B 3DRRB 3SDEB 4F02A 1KQSR 2CKWA 1QM9A 2EG1A 2XNRA 2RUGA 1SI9A 3HZEA 4GO5X 3HPOA 4DSLA 4DV4F 1JLAB 2VBYA 2R7OA 1TKTA 1MMLA 1ZOTA 3CMAS 1X4GA 1JIHA 4NLDA 2PEHA 3U7JA 5DGBA 2OTJS 4HHJA 3OPKA 3ICLA 2VUGA 4KO0B 1REVB 3E51A 2FC8A 3V4IB 2AWZA 3MMCA 4WK1A 4KHRA 3OL6A 3EUNA 1T05A 1ELOA 5E3RA 4U67Q 1WHWA 4CH1A 2ZITA 3QAEA 2GQCA 4CO3A 3TVYA 4K5RA 4DV6F 1TVRA 1NH7A 1XEZA 2DRAA 4M5DA 4J9QA 1UP1A 1JMTA 4PKDB 3PM9A 2FHOB 3F41A 1HPZA 2QMWA 4HH1A 4TQSA 2J76E 5FD1A 2PO4A 4ZKAA 3G6XA 4O44A 3GV5B 1FE4A 1TAQA 5EUHA 1RGVA 1FK9B 3I5CA 3MWBA 1R43A 2CQ3A 4U9RA 1HWUA 4PWUA 4CTAB 2L08A 2NREA 1KTQA 1X4HA 5IT0A 2FJXA 1WF2A 4QR2A 3POTA 4O4GA 4IFYB 3OL9A 3NAHA 2DH9A 4NLXA 3SV3A 1TL1B 5L1JA 2XULA 5DG7A 4KJIA 3HVTB 4A8SA 1SBRA 2ZH4A 1H3DA 3J80Y 1UETA 4I0WA 2BBEA 3RB6A 3CD6S 2XMWA 1FA0A 3DOKB 3NS5A 1IQTA 1JLQB 3IO1A 1YJTA 1VQMS 1F9FA 2ZD1A 5K9FA 5IT4A 4X4TA 3CCUS 4Q43A 2BR0A 1FXLA 2AJQA 4KAIA 1ZZFA 5LJ3Y 1MROA 5U47A 3K8WA 2OP5A 1O0PA 4OV1A 1RKJA 1IQZA 3SZ2A 2K2PA 3E2EA 5E33A 5M2UA 2IYIA 1JJHA 3MM6A 3D28A 2K8GA 1FKOA 3DM2A 4IG3B 5KFFA 4IOAQ 5DLFA 2UVRA 1IKYB 3SSSA 1U26A 2FHJD 1DARA 5I42A 2VFUA 3HVWA 3PVXA 3CJ2A 4ZDNA 3FRYA 4KFBB 4JI5F 1Q16B 1V3SA 2HLUA 4F3QA 4ED5A 4KHPF 1QUPA 4IQXA 3D54A 4ZP6A 1HMVB 1NK0A 2GC8A 1X5PA 2RILA 1VQ6S 4CO4A 3MGJA 4JI8F 4DS4A 3CULA 2OAUA 1H98A 4P2SA 1VQLS 4HL9A 1HYSB 2PC6A 2X3GA 4OFZA 3IBWA 1VLYA 3GV8B 1Y4ZB 1S1VB 3WBZA 5I3UA 1RK8A 3MD1A 1X4AA 3FEXB 3K59A 4ZPTR 4M8LA 2R8KA 2O1PA 1RT6A 4ED8A 3G86A 2UUBF 3FRZA 4NWBA 3AQPA 1ZH5A 1V3RA 3GYNA 3LP1A 3N79A 1N52B 2BOPA 3MI7X 1M5HA 5IQQA 1CSJA 4JI2F 3NNCA 2ZDOA 4Y00A 3AH6A 3GR1A 4D3HA 1C0TB 4ILRA 4DN9A 1HNXF 3A1YG 3C6TA 3DHWC 1U1OA 4FF3A 3CCJS 1DTQB 4YB7A 3MEEB 2VA2A 1RT1A 3GZ7A 4M63A 4FXWA 3DYAB 3MEDA 2IFXA 2J0SD 4F2RA 2J8AA 4KRWA 5SUHA 4B08A 3M30A 1NJWA 2DVIA 2VOPA 1FKPB 4NYZA 3UCUP 4FF2A 4IH6A 3HFKA 1SH2A 1UVKA 3CT9A 2CPIA 2N82B 3EGWB 4E98A 1FVQA 4TU7A 1E6YA 1A6LA 1DURA 1Z4UA 3I5AA 3LAKA 1FDBA 4WK3A 5GMKa 4EYHB 3U1MA 3MD3A 2HZCA 2XS7A 4OI3A 4K4WA 2UP1A 5KOXA 2GGPB 2V8GA 3NLCA 4KBIA 2ZBCA 3D0IE 2PMZD 4Q0BB 2OO4A 3CCRS 3QJJA 5IQ6A 1ZM2A 1X9SA 1I6JA 2GX8A 1OWXA 3CD5A 2IMOA 2VFSA 1C1CB 2IM2A 3VAKA 2YNGB 3R3TA 2ZH8A 3F73A 3OW2R 3W3SA 2FJAB 1Q79A 2J9DA 2FLOA 4D3GA 3FNNA 4DX8H 4DR6F 2OH2A 2ADBA 4A8XA 4WZMA 3D0GE 4EO8A 2MQNA 3NNAA 2KB2A 1TAUA 2ZVSA 1PC4A 2EWHA 2HHUA 3US5A 2M7SA 2U1AA 1S0OA 4A48A 4ECVA 1AW0A 4PUOA 1TV6B 5M2RA 1FRKA 5L9XA 2GHVC 3DXBA 4NCAA 1YJUA 3OJSA 1U45A 3GG0A 1DQ9A 2E44A 5E2QA 4WZQA 4QQBA 1ZM9A 3LWMA 3M4XA 5F8HA 2DCLA 3OXFA 2IVFB 4A46A 1DAXA 4F4ZA 4MK7A 1IBMF 4YR0A 2B7CB 3BSNA 3H4BA 4DFPA 2H5EA 5LXRA 3UR0A 1X7VA 4WJBA 4AE5A 2VG5B 4DV2F 3L95X 4GC6A 1LK7A 2J7UA 2FHJA 3NWGA 5L8RC 2EC0A 1MWZA 5HBMA 4Y2MA 3OTOF 1Y5IB 4C8LA 4KKOB 1M1KT 3DC2A 1L3KA 1OS5A 5KFDA 1VOMA 4LQ9A 1YRUA 4IG0B 2ZH5A 1R8AA 3R1LA 1SKRA 4Q45A 3CC4S 4PG8A 2AF6A 4HLBA 2RU3A 1IKXA 1GT8A 1P8GA 5DQIA 2J6SA 4IRKA 2JLFA 2UU9F 3ULHA 2ZE2A 4FZVA 3CJKB 4ICLA 2VB6A 2RT3A 2KYZA 2RB7A 1WEXA 3G9CA 3THTA 4OZNA 1YG0A 1RTDA 2MZTA 3DLJA 2Q3PA 1TFWA 2D9PA 3VQTA 4Y2KA 4EZ6A 1LWCB 1APSA 2OJ3A 1WHYA 3Q2SC 3CDBA 5DDPC 5BJRA 3GIKA 4QYZJ 2ZFHA 1GXLA 3N28A 3TAMB 3C3LA 2I38A 4V19X 2B6AA 1XR6A 1ZPWX 3ITHB 5IM0A 2CJKA 4C4WA 4C11A 5DS7A 4Q5VA 4YB5A 1XTZA 5GAEU 2RS8A 4HVZA 1P9QC 4OHXA 1YJWS 1R8BA 1LFPA 2WOMA 3BGLA 3S6EA 3VZHA 3V6DA 4ECUA 1M0SA 3MMJA 4F8RA 1XMBA 2YWFA 1MU2B 1W25A 3BR8A 3PRBA 5F9NA 2ROPA 5EWGA 3ZZUA 1ROFA 2IJFA 1F60B 2XSFA 3M1VB 1J5EF 2GJIA 3KG0A 2AGPA 5J1PA 2VBWA 3PRDA 2KG0A 1T94A 5T7LA 1PGZA 2YTCA 3Q8PB 5LMNF 1K0VA 2DNPA 2G13A 2DHAA 4CT9A 2BJDA 2GW8A 2R2UA 2EKYA 1DQ8A 3QYYA 1G6BA 1KRPA 2K7JA 2LMIA 4DR7F 3M8PA 4IYQA 2PMHA 3OLBA 4XAKA 2IVMA 1LWEA 1N0UA 4M1KA 3DMJB 1M5SA 2QSWA 4QIWD 4B3OA 1VRUA 2DNHA 1VK3A 4U7UK 5LMUF 2HWTA 3PACA 3PO5A 1NK5A 1RTJB 1VJWA 4OJGA 3R5AA 2OPSA 1F5AA 2MGZA 3VWSA 3M6WA 1S1WB 3IR7B 4B17A 4X64F 5B0EA 1EETB 1N5VA 4G1PA 4R8UB 2OSQA 2AX1A 2BRKA 2KKHA 4MFBA 3HM9A 3A8EA 3DLLQ 2WAQD 2JC0A 1R0AA 3IS9B 5G0RB 5KT5A 2MDAA 1W2IA 1X9MA 2YNIA 2HGMA 1N34F 5FDLA 1VRTA 3ONQA 1LQ9A 3MPWA 3HKZD 4PXCA 4OX9F 5H1SV 1UFWA 3GIIA 5D3GA 5G4DA 4A8QA 4N5SA 3LP2B 3ZZ0A 3BGRA 3I32A 1ZM3A 3OFEA 3GG1A 4IH7A 3PKYA 2D7SA 3FSYA 4LVNP 4NCGB 1KEKA 3Q22A 3ZZOA 3QWPA 3KK3B 1NJXA 5D77A 1RT5B 2LEPA 5LJ5Y 2UUCF 1X5TA 3OXLA 4B3TF 1ZPVA 4URQU 4QWDA 4LIWA 1CC8A 2AQ4A 2N7YA 2E29A 2WCXA 3MM5B 2ZH7A 4QCLA 3CCQS 4R5PA 2J0WA 5HI7A 1T95A 3J7YU 5J2MB 4LF4F 5KT6A 4I67A 3CO9A 5EWFA 1QE1A 2R8IA 2PI5A 2V4JB 3DLKB 1O51A 2QLWA 3BB5A 3HHLD 1RT4B 3SCJE 5F8NA 1VQPS 1N5YA 4AXIA 2CQ2A 3PIOQ 2XC9A 4QIFA 3E01B 1BD6A 2CYYA 1FNMA 2HLTA 2HGNA 3P49B 4GKJF 4F3MA 1S7HA 4IR9A 2RKIA 3KYLA 2MKCA 3P6YC 3MEGB 2ZNZA 2C42A 1JJ4A 1SC6A 1U2FA 4RNNA 3DRXA 2ZJPQ 3VCDA 1CVJA 4LFBF 1R8CA 4RBUA 3V4MA 1FD8A 4RWWA 2OMOA 3BQ2A 3HZGA 4QU7A 2M8HA 1XC9A 3MAQA 3MFIA 4B9TA 2C2RA 1XWLA 3WDOA 2D3UA 2LQ5A 1HQUB 1S6OA 3DRPA 5C5JA 2L9DA 4H4MA 2OMLA 2WBMA 1NAQA 2KRRA 1TP7A 2GO8A 3RAXA 3M8RA 4ZPAA 3T1HF 3PZPA 3V81A 3AB4B 4I2PA 4A8MP 5FLXY 3RAMA 2XY7A 3NCQA 2AP6A 2Z0GA 3M2VB 5AJ3F 2LVWA 1TL3B 3KK2A 2D1CA 3UCZP 2W9CB 4OL8A 5DQGA 1UVMA 3DRYA 3MUMP 4FBTA 2CPYA 3P3DA 3QIPA 2DGSA 4RLEA 3OL8A 2B5JB 3KLFB 3H25A 1G2EA 1BQNA 2DITA 4OZ1A 4ZPDA 2PIIA 4J9RA 3MOZA 3PX0A 2DNKA 5IFMA 1S1UA 1N6QB 2RF2A 1KS2A 4NXMF 4YUDA 1VQOS 2J7KA 3GV7B 5D4OA 3SQGB 1SJ4P 4GC7A 1XMQF 4C3MA 4FYDA 1G3OA 4C8ZA 1NO8A 3MCSA 4Y6IA 3SXLA 1H6KX 4ELVA 3MURP 1QY7A 2XLKA 1WHVA 1T3NA 4PPDA 1WF0A 2YX4A 4LSNA 1H2VZ 1HNVB 3BDPA 2DNOA 2HHTA 1S1TB 1KLMB 1IKWB 2OPRA 3PW0A 4UQTA 4J9PA 1Y00A 4C2MA 2Q79A 4OHVA 2CZVC 4ZMMA 4PQUB 5E3QA 4BBYA 4Y28C 3VAJA 2CPJA 5C25A 2WBRA 3OTEA 3D0HE 2RH3A 2DISA 3M6XA 3M2UA 5F41A 2HRUA 3DN9A 2EFNA 2PT0A 4HT5A 2N4CA 2VBXA 5GVQA 4ID5B 1QVFR 2GMLA 2B7BB 3U02A 1U1QA 1RT3A 1D8ZA 1HBNB 3I0SA 1SIZA 2COLA 2GJ2A 4HDGA 2K3IA 3R5CA 3DFEA 1XK8A 4YB1P 4H54A 1HWIA 4PXDA 4ED6A 1LWFB 4NLSA 1P1TA 1PC5A 3TUJC 2UXDF 2ILYA 2JWNA 2CQ1A 5CD4H 1HBOA 2DBBA 1U1LA 2JEIA 1ZAVA 2BM1A 4GO7X 2CDQA 4WFNQ 3OUYA 1S0MA 2OPQA 3NGDA 5A8WA 4C0OC 1M5VC 3OR2B 4EU0A 1N5SA 4DQRA 5E3PA 3MR2A 4K4VA 2JDJA 4EUVA 4MIBA 1HWJA 2ABYA 3HHLA 2B9XA 3UPFA 2DPJA 1RKIA 3D1OA 2Q43A 3MOJB 4QWEA 1FJGF 3PEHA 4IO1A 3KOAA 2DNNA 3RAQA 3M2RA 2HNYA 3H5UA 2NXUA 4WE1B 2BQUA 4QW8A 1BWEA 4I6AA 4Q8FA 2YNFB 4TNOA 2C2EA 4IRCA 4C8OA 1WELA 2JVRA 3PO4A 3DLEB 3MMAB 3QZ7A 2RS2A 1AXQA 1X4DA 4NLOA 1H0HB 4F25A 3B8HA 1LW0A 3JYTB 3CD7A 4HTIA 1JLCB 2CJAA 2MZRA 4ED2A 1ZAXA 3ZZZA 3B4MA 2XSJA 1PO6A 1S6QA 1W2BR 1Z1ZA 2HS0A 5KAKA 3JSRA 2XI3A 2EFVA 3I4HX 3NCPA 2VPZB 4A8FA 1L3VA 2JFDA 3TUZC 1VQYA 2AD9A 3OFFA 4M94A 4W90B 1KOOA 2KT3A 5BYQA 2HNZB 3DXSX 1C0UB 4I7FB 4ZCMA 2K1RA 3N0VA 2HFNA 1GX6A 5GAGU 3CCSS 2B4OA 4ZP9A 4EO6A 2XGQA 2ZH1A 1NH8A 3K5MA 4LF5F 2IM1A 5KG0A 3OBIA 3VAFA 4I6WA 2CQPA 2NYIA 4NA2A 3QIDA 3TX8A 3ENVA 5AE2A 2ZH9A 1TKXA 3H5SA 4YB6A 2KU7A 4ZS6A 3T1AA 2HAIA 4H4OB 5K14A 3KKFA 4AUKA 3UD3P 2KI2A 4DLGA 1JB0C