The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
19
|
sequence length |
108
|
structure length |
108
|
Chain Sequence |
MSNQTCVENEVCEACGCAGEIGFIIREGDDVAEVSLFGSDKAHLEGKLAEYISLAKQVYANVEYEVAPVADNATELHARFKFEVSAEKLIFELKTRALARLEHHHHHH
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Solution NMR structure of VC_A0919 from Vibrio cholerae. Northeast Structural Genomics Consortium Target VcR52.
rcsb |
| molecule tags |
Structural genomics, unknown function
|
| source organism |
Vibrio cholerae o1 biovar el tor str. n16961
|
| molecule keywords |
Uncharacterized protein VC_A0919
|
| total genus |
19
|
| structure length |
108
|
| sequence length |
108
|
| ec nomenclature | |
| pdb deposition date | 2009-04-02 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF04175 | DUF406 | Protein of unknown function (DUF406) |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | 2-Layer Sandwich | Alpha-Beta Plaits | Alpha-Beta Plaits |
