2KHDA

Solution nmr structure of vc_a0919 from vibrio cholerae. northeast structural genomics consortium target vcr52
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
108
structure length
108
Chain Sequence
b'MSNQTCVENEVCEACGCAGEIGFIIREGDDVAEVSLFGSDKAHLEGKLAEYISLAKQVYANVEYEVAPVADNATELHARFKFEVSAEKLIFELKTRALARLEHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein VC_A0919
publication title Solution NMR structure of VC_A0919 from Vibrio cholerae. Northeast Structural Genomics Consortium Target VcR52.
rcsb
source organism Vibrio cholerae o1 biovar el tor str. n16961
molecule tags Structural genomics, unknown function
total genus 19
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2009-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04175 DUF406 Protein of unknown function (DUF406)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.860 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2khdA00
5B7WA 2K3IA 2JZ5A 1IN0A 2KHDA
chains in the Genus database with same CATH superfamily
3J7AN 1RBOB 1LOUA 3LPYA 1FT8A 4YB5A 1L3VA 1WWHA 4OX9J 4DPUA 4F2RA 2XWYA 3DXSX 3ENQA 5GVQA 2VODA 5HMYA 2VPZB 1E6YB 4CT9A 3MUVP 1YKWA 3SSSA 1VBKA 1WC0A 1JLQA 1UWBB 4KGZB 1U09A 2AP6A 1ZAVA 4HACB 2FHOB 4ECYA 3VWSA 5JXSA 4MK7A 4TU7A 3HFKA 2ZD1B 5DG9A 4LVOP 3DHWC 2QLFB 2KRRA 2FJAB 4X62F 3M8QA 2BM1A 4DWIA 2G0CA 2P6TA 4LRBA 2D3OR 1GX6A 3FCVA 2X3DA 2OD4A 4IO9Q 3I0RA 4JI2F 4JI5F 3W61A 4DV3F 2DVIA 4IR9A 3M2UA 3OVBA 4Y34A 2RF2B 1X9SA 2XYGB 2C2RA 1NKEA 2JLEA 3NCRA 1TTHB 4PYAA 2CQBA 2H65B 2PMHA 3NWRA 1VFJA 2VQEF 1Y11A 4AT1B 2Z2YB 1OSDA 4PQUB 4LF7F 2KO1A 3BPDA 1JNRB 1TKXB 4X4RA 3K5OA 5C2GA 3NKYA 5DM6Q 2ZDOA 3G9CA 1S9GB 3MMCB 4RJVA 5IWAF 2BUNA 4DS4A 3HHNB 4ZVFA 1Z1ZA 3D2WA 3A8EA 1YQHA 4RNHA 1WTFA 4RNFA 1E6VB 3I87A 3KG1A 3UCGA 2XB2D 2QMUB 4IH7A 1R8PA 3H5XA 2NXNA 4IRCA 2Z0GA 2VFUA 3QJJA 3CIZA 4IUFA 2XO7A 3GFYA 1FRIA 1RHJB 1VYAA 3MUMP 4YEAA 4DR5F 2V34A 1R8CA 3C14B 3THVA 1VQMS 1TKZB 2YWGA 3DOMB 3EWGA 2N3OA 2VA3A 2GJFA 3CJRA 4KIAA 5CCLA 2MHEA 1XMOJ 2IC3B 1H7XA 4IRKA 5C24B 2YX1A 4ID5B 1V3SA 4NRTA 1NSPA 2R7QA 2RRAA 1NJIT 2DJWA 2A6MA 2HNDA 3E8OA 1SJFA 5KFZA 2NYIA 2W1BA 3TZYA 4H4OA 5RUBA 1FX2A 2PE8A 3N28A 2AV5A 3K59A 4WK1A 3VGSA 4JV0A 3OTCA 4WWSA 5LSOA 3CC2S 2RQKA 4JI0F 1XNRF 1VLOA 2NLWA 1CS4A 3E51A 5F0UA 3G87A 4A8WA 2B0GA 2C28A 4FXWA 4OMFG 2O67A 3CMAS 4UOFA 2AT1B 1UAWA 1RTIA 5KFWA 4CH0S 2ATLA 3H25A 1KTVA 1F9HA 1VR6A 1CC7A 4RW7A 5F41A 4MIBA 3KJQB 3QT8A 2HURA 4A8OA 1HNZF 3I55S 5KFIA 3D54A 1Q8LA 2BM0A 5I3UA 2WONB 1T95A 2ADCA 3OJUA 2DT9A 1WELA 2ADBA 5E3QA 3V6KA 4Y00A 4AFFA 2AEJA 3ZXWA 5CD4H 2BANB 5G4DA 3M8YA 1RLCL 2EK1A 2ZH8A 2BW2A 2LECA 3PO4A 1S1XB 3NRBA 3QRRA 2KDOA 5DDQC 3K5NA 1S59A 1V3ZA 3MD1A 4ZPDA 1IVZA 3GV7B 5F8HA 3MMAB 1FRHA 1PSDA 4N8OA 5EWFA 3MFHA 5HMZA 5DGBA 2N7CA 3NLCA 2UXCF 3U1MA 2MKKA 1H73A 3B4DA 5IZHA 1RAEB 4N41A 1YRTA 2YX7A 2CJQA 1TKTB 3JXOA 3GIRA 3OFHA 5KFXA 3BBBA 3PHEA 2GV1A 3BH7B 1JJHA 4LBHA 1TVRB 2DITA 4GKJF 2UVVA 2V0NA 2WAQD 1SUQA 5FLXY 4ITSA 3J7YU 4A8MP 2VG7B 1UCNA 1H72C 1ZBTA 3IRXA 2HLUA 1N8RT 3SCLE 4PYDA 5HBMA 1NSQA 3PW0A 7FD1A 2W24A 1DTQA 5KAKA 2LQ8A 4KH1B 2AZ3A 4F0HA 5E33A 1KVIA 4HVZA 1R8AA 1EB0A 2ZH4A 4LVNP 2R9LA 1HQUA 4PWUA 4YN3B 3OUYA 2L41A 5FD1A 1UTAA 1U48A 4V19X 4DOZA 1CULB 2VQFJ 1R0CB 1NPRA 2NS1B 1QTNB 2MDAA 3LAKA 3GIIA 1NUEA 4ZCMA 1S49A 3V6DB 1DZ5A 4OI6A 4DLGA 3FVYA 2XMUA 2XWXA 5DZ7A 5K14A 1HBNB 4FXVA 1EHWA 2GO9A 4OZJA 4CLUA 1Q1KA 1TL3B 5I3QA 2BQ3A 5LM7E 2M5YA 1W25A 2XLKA 4ZPWR 4FNHA 4JBCA 4LF5F 1U0SA 3PX4A 5AXKA 1S97A 3PIOQ 4ZPTR 4UUXA 2FZGB 3L3CA 1Y5NB 3PEJA 4ELTA 1RWKB 5JMNA 1FKPB 1DQ8A 1R0AB 2DNHA 4ZS6A 4IG3A 5J2NA 2PT0A 4H4KC 1HL6A 1R89A 1GMUA 3U1LA 1XMQJ 1IQZA 3F56A 4NA1A 1RP5A 1BQMA 2FZKB 2FB0A 3C6TB 5IQQA 3CJ8A 3UCUP 2DTJA 2BR0A 1KQKA 2C22A 4RPFA 2OPSA 1B0VA 3IM9A 3UN2A 4L72B 3M8PB 2QA4S 1MMLA 3QT7A 3HSGA 4Y6IA 2V4JB 2JVOA 3I9ZA 4F4WA 4OX6A 5H1SV 4OZ0A 2HZVA 1GTEA 2H5JB 4IOAQ 2CNOB 3VGUA 3J7YI 5LMUF 2DHGA 1JLGB 4CO1A 2EG2A 2IM3A 5KT3A 4NCGB 3ILLA 4JI6F 4GKKJ 3FBEA 3K5LA 1AZSA 3L7UA 3PZPA 4ZLPA 3ISNC 3HHLA 1U2FA 3N0VA 4LF8F 2L08A 2ZFHA 2D9PA 4B3MF 2YY3A 5EHHA 1X9MA 4KGMA 1G1XA 2ZWPA 4MIAA 2IFXA 2YPZA 2YH1A 1CQNA 3HO1A 2P9EA 2HHHJ 4NLSA 2GS8A 2ASJA 4LIWA 1TFWA 4NI2B 4RBTA 3IN5A 3DGPB 1E6YA 4DR4J 1VK3A 2NR0A 1U1OA 5C42A 1EQMA 3D4JA 5KFQA 1IR2A 2UUTA 5GAEU 1UWBA 2AGPA 2AX1A 1RWUA 2WBMA 4HACA 2CXEA 4NOHA 2ZKTA 3TOQA 1PCAA 2ZD1A 4P10A 1IKWA 3DLEB 2EFGA 3N6MA 2H48B 3LUYA 3MCMA 1Q7YT 1D09B 3N6LA 3W5ZA 3DLJA 3TJAA 3CJSA 1X5PA 2VD3A 3JQMA 1D3WA 1KP6A 5J1EA 4FKYA 5THWA 1KKHA 2ZZMA 3W8PA 2YQ3A 2RF2A 4Q0BB 4AQYF 4FZVA 4O44A 3IGNA 2H4WB 3R5GA 2FHKA 4OI3A 4DUYJ 1JNZB 3CJKB 4KY3A 4B3SF 5KFKA 3D7SB 2W7AA 4O3NA 3GYNA 4QR2A 4JI4F 2KT2A 4ETZA 1RTDB 3PFEA 4PQUA 3G2XA 2YH0A 2KG0A 4DL5A 1XIQA 4PXCA 3EE3A 2ZNZA 1DFDA 1TKXA 3M6VA 1X0PA 1UVMA 4DSFA 1VQKS 1KOOA 1RXOB 2YWFA 2BJDA 2C3PA 1B7FA 1S9GA 3MMCA 2W2PP 1PJ6A 4Q8EA 1C2PA 3QGIA 2IHR1 4KQZA 4I4BA 1QLNA 3AJ2A 4YR2A 5HP1B 3PW4A 1TZ0A 1Z2ZA 9ATCB 4OX8A 5J2PA 4LQ9A 1E6VA 3DRYA 3DYAB 4MYUA 1QAYA 4J9VA 2VG5B 3DDKA 1WKLA 4DV1F 5DJBA 4ZVRB 2ZNYA 2CQIA 3NNCA 3UN5A 3IAM9 4CH7A 4DX6A 4KGVB 3BGRB 1OY9A 3C14A 1TKZA 3SCKE 2G1HA 5HVHA 3QRPA 3NEKA 3BSNA 4DSEA 1JX4A 5GAGU 2VBXA 2IC3A 4XAKA 2XZWA 2MSTA 2VG6B 4EYIB 4ID5A 4LMZA 4C6AA 3P49B 3GU0A 4C48A 1IN0A 2MJNA 2C2ZB 3VAIA 3PY8A 5GAEI 3M05A 4MT1A 1UPPA 4NXNJ 3GP9A 5LT5A 1WC3A 1IQTA 3Q24A 5D4NA 2HAIA 1R8HA 2L48A 2HVDA 2OELA 2EW9A 5A8KB 3MOJB 4OHXA 4TY9A 4EBEA 5HVGA 1Y3KA 2LEPA 3EX7B 2D3O1 1HYSB 4OIXA 1TAUA 4IKAA 4OX7A 1U26A 4OLPA 3DCAA 1NJZA 3O5TB 3J81j 4K2XA 4JYAJ 2QMXA 4B3OB 4LRDA 5HJYA 2RIJA 2AU0A 3B78A 1NKBA 4QYZK 2VBZA 3PRBA 4QIGA 3KK2B 3LWLA 4C8KA 1Q0NA 2EVZA 1OS5A 4PPDA 2R7UA 2VC1A 3TAQA 2RDDA 3HVWA 4OX9F 2LA6A 1RKIA 1ZPVA 4XO0A 5H9FK 1H7WA 4DBQA 3AB2B 4W98A 3J7ZT 3CUNA 2CJKA 2RU3A 1S6PB 3QQCD 3HD2A 4WP8A 1R8BA 1I51B 2C3UA 5EWGA 1A9NB 1LK5A 2ZHOA 2CJBA 3MUTP 1A6LA 4BLGA 4UOHA 3W64A 2BANA 1MROB 2QTWA 5JJBA 1S1XA 4OV6A 4HH1A 2HFNA 4K4YA 3T1HJ 1Y3JA 1UFKA 2YXLA 2GFFA 1OMSA 3MAHA 2DR9A 3HJVA 3MMAA 2J0WA 2CQGA 2JC0A 3V81B 4ECSA 2BJEA 3NOGA 3ICLA 2LQBA 1T03A 1IBMF 4Z7YA 2F3JA 1DAXA 1FDDA 4YMEA 2E5GA 1AUSL 3W60A 2F8HA 1X4AA 1TKTA 1S0OA 4WP3A 3RR8A 2KHDA 3BYRA 1RABB 2B4OA 4PWDB 3TANA 3R5CA 1N0UA 2LEAA 1W7WA 5KFFA 4ATNA 1HHTP 1QAJA 1TVRA 1N54B 5GAGI 4LF9J 1FE4A 4F0KA 3JTNA 2XLJA 1XEZA 3KWMA 2AW0A 3MPVA 2IMWP 3AA9A 2EFQA 3FC9A 5K20B 3DGVA 2JNJA 2BE9B 1HHQA 3AJ1A 4DN9A 4OFZA 4F50A 1FHTA 4I7FB 1VBZA 4DLEA 1T7PA 3TA1A 2HIYA 2H5IB 2HNZB 3K58A 2OPRB 4N7TA 2FHJA 5L1IA 3CC7S 1RHKB 2I8EA 4J5OA 4P72A 3P45B 1CULA 2LQJA 3ZZTA 3TVKA 1F1BB 4ZJOA 1G2EA 2QX0A 1MN7A 1SC4B 2F4VF 3V6DA 3EM1A 3QWUA 2NREA 4DR6J 3L09A 4UF4A 3RBXA 2WCXA 1NHKL 4KFBB 1UVJA 2HVZA 2RRBA 1HBNA 3R5AA 2HYIB 2JX2A 1N36F 4GC7A 1TUGB 1TL3A 2OFGX 3CT9A 5KOWA 1BGXT 2CYYA 2Y8WA 4EBDA 5EDWA 2B3TB 2Y1LB 7AT1B 2WW8A 1FE0A 2M7SA 1YK9A 1LW0B 1M5KC 4C3KA 2HVIA 1GFWB 1RHRB 1X31C 2K8GA 4C8MA 4DCPB 3CPWR 3BM7A 1FKPA 2IRUA 1K44A 4DCJB 3E2EA 4IG0B 2VFRA 3D0IE 1TP7A 2QYCA 3D6MB 2A1BA 2EFPA 4MTPA 2Z58B 2QL5B 3C6TA 2MYFA 3MAAB 5BR8J 4ZVQB 3LAMA 1Y00A 2JDJA 1CBKA 2H3EB 2W2MP 3ELHA 2KT5A 3DRXA 3GILA 1T9UA 2ZE2B 1UFWA 3PG9A 4F02A 3M8PA 5KT6A 4MMOA 2LA4A 4X2BA 3V5RA 2V4JA 1RWXB 3H4DA 3KG4A 2EBGA 4RZRA 2I2YA 1OO0B 1SVDA 2OKQA 1UPMB 3MM6B 2J0SD 1F0XA 1JLGA 4CI0B 2JEIA 4ILRA 3TQEA 2XMWA 3J80U 4NCGA 4ZLNA 3IRWP 4Y2MA 4FYDA 3S8SA 2PI4A 1NCLA 2N7YA 2A0FB 4DMZA 4P7TA 1ZS6A 3H59A 2IVYA 3ZZOA 2HK3A 1BHNA 4XIUA 4CTAB 3NP5A 2WVCA 1QJHA 4DR7F 2F63A 1VLYA 5AT1B 4YP3A 4ES3A 4QIWD 4TN2A 3POTB 3LF0A 1H2VZ 4Y2CA 2HHVA 2V69A 1RTZA 3BR8A 1TL1B 1FNXH 1I94J 3N5FA 2B7BB 1M1KT 2J7WA 3I0SB 5HL7Q 4OHWA 3TX8A 4NI2A 3RG6A 5T14A 4O4GB 3DGPA 1SKUB 2HHTA 3LP0B 2IRYA 5E3PA 4ILMA 2C2OB 2XTJP 4WBFA 3M8RA 4U7CA 2LDIA 4LF1A 3I31A 3LPEA 2CQHA 2DXFA 2NPIA 3JQJA 1RT3B 3HFVA 2KFNA 1F2HA 4KRWA 5DO2A 1MSWD 5LJ3Y 1F6TA 3HULA 3O44A 2OPPB 1SIWB 2HQCA 3LW5C 5D0EA 2ZH2A 4Z2XA 4BHQA 1FJ7A 4Q0BA 3QMQA 3M1VB 4WFXA 3AFGA 3BQ2A 1SH2A 4ZIWA 1ZTTA 3B8HA 4DPYA 5ETPA 1B70B 4MIWA 4B3RJ 2F65A 4CNYA 5KFRA 2XMKA 4NLQA 3TZXA 3TJ8A 2WSFC 2XMVA 1RTDA 3ZZZA 3VQTA 3Q8QB 4FYVB 1M1HA 4GVBB 1SQEA 3FGVA 4M5HA 3Q8YA 2MQQA 2NXUA 3PRDA 3UCZP 3VALA 3BYPA 1CJVB 4AYBD 3MM8B 4EWTA 5D0GA 3W9JA 3JYTA 1X4CA 4RW6B 3CEDA 2JRSA 3BO3A 4B08A 4F36A 2KZMA 1RWPB 3HMJG 4E8UA 2QA2A 3DYAA 4RLEA 4P73A 4UQTA 2QLWA 2YWKA 4ZP6A 2AGOA 4NLWA 2IRXA 1XMQF 3BKTA 1VGYA 2YBVA 2XY6A 3ADAC 3EGVA 2MQNA 2V68A 2VKZG 4QCLA 3BGRA 2J5AA 2PMWA 3CCZA 4P2SA 1S1WB 3WIUA 4C11B 1K1SA 4YOEA 2CZVC 2VG6A 4MYTA 1GXLA 2NZCA 2VPXB 1A7GE 4NZ6A 2MZJA 3MEGB 3SSRA 4ZVEA 1LXNA 1SPBP 4DSKA 4QW8A 2W7PA 5A8KA 4CO4A 1PYTA 2FC8A 2A6OA 3MEKA 2R2SA 1QAXA 1SV5B 2MKYA 2VB6A 2KFYA 3GSIA 3L4BC 1CLFA 1G3OA 3CWJA 1KD1T 2DRAA 1HYSA 2HHXA 3W2WB 1RBLA 4URGA 3FEXB 1QUPA 3KJVA 3WZ0A 4MH8A 5LMNJ 2HRUA 3KLIB 1TMMA 1X4HA 3KMQA 2P5VA 4QYZJ 1RK8A 2LXIA 3KK2A 5FJ4A 3TWZA 3FBFA 4IDKB 2YNGB 2M9KA 2RDIA 3NY0A 1I5OB 3GFHA 2I1RA 3HHLD 3KNGA 5AJ3J 2BJ3A 4I67A 1S1VB 5H9FJ 1K0VA 2VL1A 4DR4F 2E1RA 3A13A 1S6PA 5DQHA 1UJ4A 1S1TB 1Y0HA 2V2ZA 5ETKA 2IJFA 5FDLB 3D6FB 4PG7A 2XG8A 1SBRA 1KN6A 3OT9A 3TA0A 2FJVA 1GMVA 4N5SA 1MROA 2VOPA 2XNQA 4ECTA 1WG1A 1IKVB 3KUGA 3Q8SB 1NDPA 4HEA9 4V19J 4CLYA 2UUCJ 1S9EB 3D5MA 1RDRA 3LTOA 1S0MA 2HVHA 2UXBJ 3T1YJ 3C6UB 3VF0B 1YSJA 2NQPA 1HIYA 2NUHA 3MR2A 4E2FB 4C8ZA 2OHDA 4DV2J 5DDOC 4KHPF 3QSYB 5FLXU 1YX2A 4EO8A 4DR1J 2BE7D 4C97A 3R27A 4J9OA 4FYYB 4RBUA 1HR0J 4DFPA 3VZHA 5BYQA 1MW7A 3DMJB 3HVTB 4LR8A 2DNNA 4A8YA 3IO1A 1VRUB 4Q2LA 2B5JB 1HWJA 4RU9A 1BY9A 1UETA 1AW0A 1KQFB 1HFEL 1RU1A 4NMLA 2AWZA 4WK3A 2FUG9 2YNIB 4B9SA 4I7FA 4I6YA 4H4KA 2HNZA 3SV3A 2OPRA 3TVZA 1YITS 2QRRA 1VBXA 1NAQA 4F25A 5J2QB 3NNHA 3PR4A 1T94A 2YNHA 1Y7PA 1PKUA 2DGSA 3JS9A 4F4XA 2QZ8A 2G2ZA 2IMOA 4S0MA 2IYGA 2HLTA 5HATA 1RT4B 2E5HA 4LRFA 3N5BA 2CQ3A 3HF5A 4KFBA 4DFKA 2YWWA 3MOZA 4JI5J 3WX8A 5KFCA 2I5JB 2WK4A 4PCQA 2MHNA 3W1YC 4LIRA 3NS7B 2KYXA 3D3CJ 2HW3A 2YKOA 5CH7B 2XCAA 4NXNF 1YIJS 4LSLB 3C8YA 3M6WA 2AJFE 3FEYB 4MKAA 4NA3A 5EX3A 2VQEJ 3KK3B 4M5GA 3NNAA 1LW0A 4C3LA 2W25A 2DH7A 4I2QB 4CLWA 3ISZA 5HO4A 1VJWA 3W63A 1ZTWA 1JXLA 1U49A 3KYLA 1OSCA 1YI2S 2ZBCA 3MWBA 5E5NA 4C8OA 3V2UC 1EQ0A 2MZRA 4DV6F 3LGHA 1U4BA 1N32F 2DNOA 3MMBB 2GJ2A 5IT9U 3FDSA 4NLGA 3HP6A 1FNMA 3SDEB 5D4PA 1MU2B 2XI3A 2E5JA 2ZE2A 5KFMA 4CO2A 4CIOA 3MURP 2RH3A 1LQ9A 1P9YA 2HQ3A 3IS9B 4DQRA 4OJGA 1YVFA 3MM7B 3IBCB 3MM6A 5BJRA 2B56A 2RILA 2EXUA 2E66A 2Q43A 1MLAA 5KFSA 2IY5B 3QFWA 3RUBL 3PNIA 3T1AA 1BQXA 3T1HF 3RRGA 2DGVA 4DV7F 1Q8IA 3OR1B 4HTJA 4JI8J 1YG0A 4KB7A 2AJQA 1GX5A 3NGKA 4CTAA 3PKYA 2KI2A 4CT8A 3F41A 1AYEA 3H2UB 4ZK7M 2R42A 2RUSA 3UO0A 2CUYA 3OXFA 4U95A 1N6QB 1N5VA 5KFOA 3PR5B 3POTA 1NK0A 3QZ7A 1F5AA 1VQYA 4ECQA 1TL1A 1MG7A 1S48A 4M5MA 1F9FA 3NBPB 2CG4A 3I0SA 4MJKA 2ROEA 1MWQA 4RUAA 2U2FA 2YKPA 2MGZB 3LP0A 1VQNS 2ZM6F 1H2UX 4CZCA 2R7XA 2Y1RI 5E3AA 3AY0A 2PA3A 2ZKUA 3LOUA 2GVDB 2OLWA 4TU9A 1MWZA 5B08A 2H4YB 2DBBA 1JB0C 1RT3A 2HG4A 1S79A 2WSCC 2BJ8A 3MZIA 1S0VA 2UV8A 3ZZPA 2AEMA 4JB8B 2K2PA 3P96A 4ZPBA 1HNZJ 5IOLA 5AXNA 3RB0A 2OPPA 3CCJS 3RRHA 2DY1A 2DXDA 1U2RA 1QD1A 2FVCA 1WSVA 4RU2A 2W2NP 3OTEA 1IXKA 1KFDA 3ZTQA 3M1VA 3U1NA 3FRYA 2DCUB 4RNMA 5L9NA 1MWYA 1CJKB 4QR1A 5K8OA 3L7OA 3DM2B 1M5HA 1LNQA 2MKCA 2BZ2A 1NLKL 2MKHA 1NJXA 4UZBA 4DR6F 2L9DA 2P9GA 3VAMA 3KK1B 1VDHA 5HANA 3PYDA 4ZCKA 2FHJD 2VV5A 3I0RB 3HZGA 4GVBA 4K4WA 4TXSA 1U7LA 5EGYA 2FD2A 3ENWA 2C2KB 4QOTA 2V8DA 2PD1A 1ROFA 3OFGA 4ZPVR 4NYPA 1CJVA 4DPTA 3ZNJ1 3BKUA 4ZCLA 3UWTA 3MM8A 4OYOA 2N82B 3THTA 1NDCA 1F2GA 4RW4B 3RYLA 2DHHA 2XEXA 4DX7A 4I64A 2AZ1A 4RW6A 2IA6A 1EZZB 3M7VA 2N4CA 2I6WA 2IAJB 4F4ZA 2VJVA 1F9EB 4EZ9A 2BW7A 4OZ3A 6FD1A 3ULHA 3TYTA 2XMJA 5SUHA 1V9OA 3MPUB 2FJWA 1HW8A 3DDNA 2FGCA 4MK8A 2C42A 2RKIB 9RUBA 2QEXS 5BR8F 2ZDPA 3RBEA 4Z37A 1NPKA 1W2BR 4ANDA 2JFKA 2D3UA 1S1WA 5F0WA 4HYKA 3C15B 3MCSA 1U1LA 3V6JA 2CPXA 1WC6A 2KH9A 4YQWA 2NXCA 3MEGA 3SXLA 3FBCA 1TK8A 3H5UA 3M32B 4X4UA 1G7CB 2KJVA 5AXLA 2CQ0A 2ZC3A 2MB0B 5F8JA 1SV5A 2R2UA 4M5LA 3QBCA 2V8GA 4QU6A 3GV5B 3G6YA 2JLFA 3W2WA 1TELA 4YS2A 4PXEA 2ZOGA 4NE9C 1N5YB 5AE3A 4A8FA 4NCBA 2EK6A 2MKSA 3WBZA 2VDHA 4OYIA 4NLPA 3SQOP 1TL7A 4RW8B 5D15A 1AROP 1YBUA 5I3PA 4IDKA 2YNGA 2AYBA 4LT6A 1VQ8S 2B4UA 5DLGA 4ZHRA 4ZVSB 2GA7A 2X1FA 4WIIA 3GFZA 1S1TA 4OHZA 2AJ4A 4WIQA 2ZBQA 1ZH5A 5FDLA 1D1UA 4RUCA 1T9TA 4W4MA 3HX9A 1BD6A 4X4OA 3SQGB 3X3UA 4OL8A 3K2YA 1EKSA 1IKVA 2CJ9A 2QE5A 3PTWA 3DLBA 4W90B 3OQ2A 2Q6CA 1S76D 2PFFB 1KONA 1WJ9A 2Z4PA 4OZNA 3TO8A 5E3RA 5KFGA 1S9EA 3BB5A 4QQBA 2YQ1A 3NCPA 3R6LB 5ETNA 4TLQA 5KG3A 5F8IA 5LSRA 1TV6B 1Y5IB 4CLTA 1FRKA 4EEYA 1DQ9A 1OIAA 3SBMA 2DGXA 1FWPA 3C6UA 1S77D 3MAQA 2YPYA 4DPXA 1Q5YA 2DGTA 5LMUJ 1U02A 3CCMS 3CCSS 4RX6A 3ENAA 4K0KJ 4ECRA 3UNYA 2MLXA 5KT4A 2FIUA 4X64J 1BMQB 1QVGR 3GV8B 4IFVA 5KFJA 3AH6A 4LF8J 3DMJA 1RAFB 3HVTA 4B3MJ 2Y0BB 1KDNA 1GXTA 1FO1A 1VRUA 2B5JA 3D66A 4DL3A 4K4XA 3BSOA 2QYGA 4DV5J 1R6YA 2M4MA 2UU9F 4ZN3A 2MLZA 4ZITA 3MTJA 3QIPB 1XBWA 4PABA 2HFSA 3CDEA 2YNIA 2Q3PA 4JUZA 3HSJA 4E98A 4YDDB 2NSBA 4F26A 3A8IA 4CO3A 1XK8A 3EMTA 2WVBA 4RUBA 5HI7A 4YUDA 3NL0A 1TUVA 5DDRC 2CPDA 3GCWP 1IR1A 3W8GA 3P6YC 5J2QA 2FC9A 1O6XA 3RAQA 1RAIB 2X1AA 1FDBA 2E9ZA 1RISA 4KGKA 3G96A 3ITHA 1RT4A 4WCEQ 1HNIA 2A2CA 1HKAA 1U24A 3VVUA 1RT5A 3E01B 2Z57B 5C25B 3QATA 2KM8B 2JLGA 3MR6A 3GMGA 1YGYA 3CCQS 4LSLA 4CLPA 2HFUA 4AD6A 3T5KA 3G6ES 4B3SJ 5B7WA 1DQAA 3KK3A 4R8UB 1RUSA 3TJ9A 4KKOB 4JI4J 1Q4RA 3S6EA 4I2QA 2V8VA 3TNVA 1P8GA 1IUJA 3AB4B 5CA5A 1LEOA 4H54A 4OYZA 4UOCA 3SIPB 5LMNF 5DGAA 2HK2A 1HQEB 3UVJA 3GQCA 2EKNA 3CJ0A 4NYZA 2XNRA 1RAJA 3Q2SC 1O51A 1U6ZA 3AD7C 3H5YA 2HBRB 4FYXB 1YRUA 2PC6A 1N0VC 2VFVA 3CE8A 4J9UE 1UEVA 2ZHBA 3MMBA 4EGLA 3CF5Q 1BC6A 3DOLA 5AJ3F 5DLFA 3TA2A 1RWMB 1NZ8A 3SDEA 1MU2A 2XC9A 4X4SA 2OFHX 1IM4A 1HWIA 2BQRA 1YZ7A 5G0RA 1SJ4P 4K8RA 1CJTB 2OSRA 5CYMB 1VQ6S 3M9OB 5BYSA 1V5VA 3GWCA 2FJXA 3IS9A 3IG1B 3MM7A 3RR7A 1K73T 2XO6A 1L3TA 4WXOA 1EARA 4F4KA 1OQ6A 1BQNB 2J76E 2MLYA 4ZOSA 4QR0A 1WOSA 4WPAA 4DQQA 1NK6A 1ZPWX 1KWMA 2QLXA 3LQVA 4PXBA 4A47A 1U1MA 4USHA 2OPQB 2DNGA 1ZYQA 3KNAA 4YB1P 1T3NA 2BBEA 3OR1A 4OI4A 4P2FA 4J9QA 2HWHA 2X7IA 3KKFA 2X1GA 1LK7A 2ZJRQ 2KG1A 2HS0A 4WFAQ 2IBOA 4TQRA 1LFPA 2Y1JA 1N4LA 3CNQP 3NGRA 1SH3A 1VHFA 3HZEA 4DV2F 1EETB 5E0OA 3P5TL 4DQIA 4RWXA 1FJEB 4DR1F 3GYGA 3NBPA 1U6FA 3VAGA 4DL2A 5ETTA 4P2XA 1CJUB 1UL3A 2MGZA 2B9YA 2UP1A 3CIMA 2VU5A 2GVDA 2DPIA 3MMJA 2IIHA 2LKZA 4HLBA 5M2PA 1RZMA 2M8DB 3DLKB 4OJ3A 1OY6A 1RSCA 4U96A 1KR4A 5LOQA 2DXEA 4HHUA 2ZBIA 2ASLA 5C42B 3D6TB 3PXGa 2RVJA 4C9DA 2HRTA 2BYCA 2Z2LA 2ZH1A 2VIHA 4ECXA 2O66A 3A3OB 2QT7A 2I9SA 1DURA 3P5BP 2P9CA 3I5AA 5J2MB 1X4GA 1IKWB 1CJKA 3DM2A 3TAPA 2B6AB 2PI5A 3UDCA 1R27B 3HSDA 3ZO7A 2MKIA 3KK1A 3SYZA 5J1EB 2QMWA 4LSZB 3R3TA 4LF6J 1CEZA 4PXDA 3OBIA 1S0NA 4G6VB 3QIDA 4TY8B 4RW9B 4P74A 4O3OA 2L9NA 5HSPA 4KT0C 4FPIA 2M88A 1WNEA 3FMBA 4O44B 4UW2A 3HSZA 8AT1B 3GJQB 4DR3J 2R8IA 2AQ4A 1IBMJ 4EMDA 4RW4A 3KG0A 3W9HA 2FVRA 2DIUA 1VRQC 2FGOA 1RHMB 3BSAA 3KXDA 1FXRA 2IAJA 4EK2A 4BCAA 2E9RX 1JK9B 4PUOA 2EWHA 4C4WA 3P8BB 4URSA 1FX4A 2MY7A 2DGQA 1TFYA 3MPYA 2E1MC 3AOBA 2KTQA 3RTVA 3ISND 2RKIA 4AL6A 5CYJA 4FP9A 5HVFA 2QL7B 4JOUA 3F44A 3PW7A 1A0OB 5J2PB 3PYFA 4WFNQ 3KLVA 3O3LA 1PBAA 5GAHU 3C15A 3LALA 4KH0B 2CJAA 5CZXA 5K8MA 3R1HA 3IWXA 4JI3F 1IBCB 3KUEA 2UV8G 3BGUA 4FVMA 2HEKA 3M32A 2YKAA 1XN9A 2F4VJ 5B0FA 4XTTA 4NLRA 4LR9A 3CJQA 1B0TA 5LXYA 2ABYA 4DFMA 2ASYA 1WDDA 2XGQA 3GCXP 5IQ6A 3HKZD 2YKMB 3F73A 1N36J 2J7UA 3NS5A 1N5YA 4JI8F 3KHLA 2M70A 2V2VA 4USMA 4Z7CA 2QL9B 4RW8A 2BXJA 1QSLA 2ZH7A 3B4MA 1QAIA 1VQLS 3VCDA 2KXNB 3R2CJ 1HBUB 4USWA 2FJBB 2WVDA 3PCOB 4HH0A 4BDPA 4YY3J 3MDFA 1RBAA 4DUZJ 3ZZ0A 2ZBRA 2VOOA 3UPFA 3TR5A 1LWXA 1WSRA 1FI4A 1W2IA 6AT1B 4KTQA 1UZDA 5F8GA 2AYEA 2DEJA 2E7XA 1K47A 1UW4A 4KPCA 4R5PB 5CD4A 2H1YA 1H74A 3IGVA 3OSNA 3SQGA 1DJ0A 2OEKA 3IR7B 3T3FA 4ZA1A 1H0HB 4DSLA 2ERRA 2G13A 3QLHB 1M90T 2POKA 3AXKA 5B0DA 1TV6A 1DBDA 4DZDA 1GTHA 2EC0A 2MXYA 3A12A 3R9LA 4O23A 2MZQA 3IR6B 3FMWA 2OTJS 1VCTA 4NZ7A 5A6WA 1T05B 1BE4A 1VJQA 2BMBA 2CPZA 2B9XA 2CG8A 3TAMB 1R3NA 2E5IA 2CNLB 3OFFA 2OSQA 2ZH3A 2J6TA 3TP2A 1NK8A 2FQQB 3H8YA 2V2QA 2DHXA 2W8LA 3SI8A 4OYMA 2RU9A 2E29A 4ZPAA 3VR1A 1FD8A 3ZZYA 4ZLLA 5KG4A 5GAHI 4DR7J 2VFTA 2MMYA 1X0FA 1T03B 1CVJA 3TUIC 2F5GA 3QIPA 3GZ7A 5K9FA 3TUJC 4UOGA 2E1PA 2QC3A 3QT6A 1ICEB 1D8YA 3RZAA 2CPFA 3MF5A 2R3VA 3UN3A 1F3FA 1UKUA 3W5YA 4DL7A 3TEGA 3R7NB 3U27A 4QW9A 2UVRA 2ZOFA 4O0IA 2WVFA 2F8EX 1APSA 5CAAA 2J8SA 1KQSR 3TQ1A 1UMJA 4DSJA 3Q23A 1RU2A 1GQEA 3KLGB 1NSAA 3HD1A 4WTYA 3GYXB 3E01A 2J6UA 2KL8A 4P6QA 3M8WA 3CCWA 3OD2A 2NPFA 1O8BA 4C8NA 5C25A 4J37A 3E3XA 2CFXA 3W3SA 2WOMB 2DB1A 2C3MA 3D0GE 3QO9B 4DQPA 4R8UA 2ALYB 3I4PA 2HQIA 4KKOA 2U1AA 4B9NA 4K59A 1NNDA 4KJIA 1VQ7S 3I96A 3IFEA 2FVPA 1RT7B 1CG2A 3T41A 3FKBA 1WHYA 2J0QD 3GLJA 4RL1A 1HQEA 3EYZA 1B3TA 3DKDA 4U6PA 3HLUA 1IKYB 5MAOA 4RO0A 3TUPA 4LJMA 5B09A 2Q6BA 1Q79A 5IT0A 1G6BA 3B6BA 1EX8A 4ED1A 2PEHA 2D1CA 2AMCB 1FNOA 1VMBA 4I1TA 4HI1A 2C2DA 3DHXA 1UA0A 3RGIA 3IWLA 1SXLA 2GW8A 1D9AA 5E3CA 4URQU 1CJTA 3FFIA 5CYMA 2J7KA 2CQ1A 1Q7LB 3IG1A 2VASA 3WC0A 4Y3CA 1RWNB 3IM8A 3PW5A 4ZVUB 1SJQA 4DQSA 1BQNA 1ULRA 1WF1A 2GJIA 3I32A 3OR2B 1UP1A 2HRYA 3BBCA 4Y0FA 2V4QA 5HROA 2OPQA 1H2TZ 4HDHA 5A76A 4P75A 2K7JA 2V2KA 5GADU 3RRKA 5LXRA 4DL0C 1SB6A 1I3OB 1RJJA 3NS6A 4C7QA 4I2PB 4ETXA 4XPCA 4TYBA 3EXCX 4K0KF 1U45A 1EETA 3B54A 4XK8C 3I9V9 1FWLA 1T9XA 3AOAA 4V1Ak 4X64F 2CDRB 2ZVSA 3C2PA 1CJUA 3H0PA 1WF2A 1CC8A 1UVLA 1NDKA 1NB7A 2BDPA 5I42A 2F40A 5CCMA 4ENOA 1LV5A 2J9EA 3TX0A 3OXLA 1YDLA 4PG5A 3X1LB 1Y5LB 3CO9A 4QWCA 4DV5F 1MMDA 3ENVA 2D9OA 1S1UA 3DLKA 2WRMA 1S72S 1C0TB 3H2VE 1KRPA 2LFVA 5L38A 2DNQA 4X4PA 2A3JA 2RRNA 2VUGA 3T5HA 4DV0F 4ID8A 1BUXA 1NPPA 1U47A 1YJRA 3JSRA 1SL2A 4CLLA 4QU7A 4QBUA 5J2MA 3HM9A 3PEHA 4NLUA 3LO3A 2B6AA 3OJSA 3CW2C 3KHRA 2M3DA 1AXQA 3HKWA 4F3MA 2RT3A 1KLMB 3HVAA 2A2DA 1NJWA 3RAMA 4TY8A 4RW9A 3QGGA 5JVHQ 4U8YA 1YLXA 4J90A 2Z2ZA 5CHCB 3DOKB 4CDIA 3H5SA 2YVSA 4BBYA 3DRSB 3BQ1A 4KHPJ 4Q5VA 4NZ0A 4H4MA 1OJ4A 1WG4A 1LWEB 3TZWA 3GB0A 3R7SB 1B7YB 2B8PA 4KR0B 3BREA 3RW6A 2HWTA 4P7VA 1N48A 2K3KA 4TYAA 2ZJPQ 1SL1A 3ET6A 3JTPA 2XLIA 4J9LA 1XWLA 5DZ6A 5JVGQ 5L46A 3JYTB 4A8QA 4KHRA 1NZAA 1F60B 3CJ3A 4N56A 1RI7A 1UA1A 2XY5A 3KLFB 1KC8T 3QJPA 1S99A 1RAOA 2GIFA 4ZJLA 4XDDA 3JAMU 4NWBA 4WFYA 2LXFA 1JLBB 3HHEA 4JV5J 2BE2B 2LCWA 5GMDA 2DCLA 2K3IA 3MI7X 2CA9A 4AE5A 1QDUB 3OTDA 2CJYB 3ZTPA 3LWMA 4LF4J 4KO0B 1P27B 4ILLA 3GIJA 1VQPS 1JMTA 3C3LA 1VC5A 4USTA 1ZOTA 2B43A 3DLHA 2YKMA 2E5LJ 3MHYA 1X9WA 3T5LA 2V8PA 4ZMMA 3MPDA 4U9RA 3SCIE 4IRDA 4JI7F 1S12A 5LJ5Y 2D74B 1UVNA 1FRXA 1XR6A 1VQ9S 3C19A 4L75A 5D3GA 1NDLA 3OL7A 4OYAA 4DUTA 4NRUA 1PYSB 2HHQA 5EUHA 1YHQS 2O3DA 1HBUA 2ZHAA 3GONA 1ZAXA 2BKPA 3EVWA 1WORA 2XYPB 5D4OA 3K5MA 3FCWA 3KJVB 3EXYA 2J8AA 3EZOA 2YTCA 3OHAA 3KTQA 1D9DA 2MSSA 3D1QA 5KFTA 2C2MB 3HI9A 3CULA 4R5PA 5A8WA 2XULA 3D1OA 3ZZRA 2LMIA 4DV6J 3RB4A 3HT3A 2LXUA 1N32J 4ZKAA 2VA2A 1C1CB 5F3ZA 3CGIA 3QLHA 4NCAA 2E7VA 2M52A 1KLNA 4K5RA 1YJVA 2ZWOA 1WEXA 1NMEB 2F1FA 1U0HB 4CQ1A 4ZVTB 2DR5A 2KXHA 1T05A 2DD8S 2DGOA 1WF0A 1ZA1B 3TAMA 1FVQA 2R7WA 1KSPA 3K89A 1LW2B 1ZA2B 4C2MA 2E1CA 2GMLA 3N6NA 4K4TA 3GJRB 2NXEA 3JQKA 4LF6F 2JC1A 4DV7J 1YRXA 2ZZTA 2R2TA 4X4NA 3TZZA 5A2QU 4DR3F 1NH7A 4WFBQ 5D4LA 2F9DA 1YBAA 1VI7A 2RHQB 3O6QA 2GX8A 3J80Y 3PJ9A 2W9CA 4P71A 2XSJA 3S1TA 4IFYB 4WE1B 1V6HA 3MM9B 1JLAB 2B4PA 2ZM6J 4AUKA 4YR3A 2RMLA 2X3GA 2HFOA 1YZ6A 2YKNB 2Q1LA 1B64A 4ZIVA 1R31A 2XSFA 4ZP7A 2UXDJ 2FJEB 5AE1A 1RGVA 3KHHA 1HBMB 4PG4A 1CQMA 1XR5A 4DU8A 3SZ2A 3CD7A 3S01A 2DK2A 3BQ0A 4X66J 3KLGA 5KTQA 3W5XA 3J81U 1QUVA 3I4HX 4K5SA 1ZM4A 3TARA 3K57A 1U1RA 4KAIA 2V8HA 3PYEA 3MR5A 2WOMA 1QTMA 2V5HG 2NXJA 2H5EA 2YNHB 3K7RA 1P6TA 3QO9A 3Q89A 1SKRA 3BGOP 3P3DA 1HPZB 2MZSA 4L74A 1DTTB 5K8PA 3D9BA 5LSLA 5ETLA 4F8RA 1M5VC 1X5OA 1FRJA 1RT7A 5D0HA 4ERDA 3EDQB 3VQSA 2FVQA 1RTJA 4EYHB 2RNEA 4ED6A 4RNNA 2IVMA 5EN1A 1IKYA 1ZAWA 3QZ8A 5CQGA 2F9JA 2Q79A 3VAJA 2HIQA 1CPZA 5HAOA 3Q8RB 1K1QA 4OLOA 4TQSA 4NLYA 5ETSA 4YY3F 3RW7A 4DUZF 2JOQA 3HHDA 3T9ZA 4USUA 4NYOA 1QSSA 3BGFA 2AHOB 3GPAA 1HD0A 2V94A 4QIEA 4ZDNA 3UQSA 4LFAJ 3BZQA 2LP4A 5KG0A 5KT5A 3UD4P 3WDOA 4UT4A 5F8MA 4D3GA 1UVKA 1BWEA 1P1TA 3FZ2A 2K1RB 4ZJQA 4K4UA 4LSNB 4F2SA 2QV6A 3K5PA 4DU7A 4CP5A 3OR2A 1T9WA 2Y1IA 1IJFB 3UW1A 1WEYA 4M5JA 2BACA 5HLFB 3MM5B 3WC2A 2W4PA 5IM0B 2UVWA 4CCHA 5B0CA 3CMES 1KOHA 1KNZA 2Z8QA 1PC5A 4A46A 2DRBA 5CZVA 3ONQA 3CVKA 4IOCQ 4BC9A 4DV4F 2JSXA 4X4TA 1U8WA 4B17A 1N33F 3Q8UA 4ICLA 4ECWA 4FVCA 4FF2A 4I2PA 4CWBA 3EDRB 4F7VA 1FTRA 3RAXA 3DN9A 4P9SA 2ZUGA 4DPOA 4KBIA 5A8RB 1Y10A 5KFVA 3FSXA 2C3OA 2R2RA 4Y2KA 2WZ1A 4LRCA 5D77A 1QY7A 2PFDA 3Q8VA 4YR0A 4ED0A 2BJ1A 2IJRA 4PRFA 4D3HA 5HQ8A 1K8AT 3NGTA 4IQMA 4FS1A 4O4RA 5DG7A 1TAQA 1MMNA 2BJ9A 1N5QA 1C0TA 3FUYA 2J6SA 1WKJA 2NUUG 1RAGB 2PMZD 2ZITA 2CPIA 1KHVA 2V6AA 3AQOA 3IBWA 5J1NA 1HI0P 4EBCA 3CD6S 1EP4B 3A4TA 2P8IA 3H40A 4UY8T 2XMAA 2M8HA 2V4RA 5SZTA 4OI2A 3DXBA 2ZZNA 1HBOB 5LL6d 2JHEA 1HI1A 1U8SA 2R8KA 4HR2A 3MFIA 1KLMA 3KJFB 3BH6B 3C46A 3FRZA 3NOCA 2ILYA 3MGJA 2HS3A 1PG5B 1HMVB 4EU0A 4YB7A 1FDAA 4ED3A 3D6HB 4O3RA 2BOAA 3DOKA 5HQLA 3H98A 4X65F 4OJHA 2XMTA 3DRSA 4X84A 3B82A 4QZVB 1JLEB 1LXJA 2QJ3A 2UVUA 2EFOA 3LA0A 1LWEA 2XHWA 3AXMA 3GJSB 3CB4A 1U6BA 4QPXA 4U8VA 1RCXB 4L76A 2OAUA 2CQ2A 2HKEA 1LWFB 3MECA 4QWDA 3VAHA 4J9NA 2J9CA 3OTOJ 1C1BB 1AFIA 2J0XA 1H98A 5KG6A 2UU9J 3EGZA 1C4AA 5D0RA 2HNYA 3PV8A 2VPYB 3LP2B 3GG1A 2BJ7A 2COLA 3KLFA 2I0XA 1IWAA 5IS2A 4B02A 3VAFA 1HI8A 5KFHA 3D68A 1HNWJ 4U67Q 1SI9A 1QM9A 1JLBA 2KFZA 2BE2A 1GH8A 3G6VA 5F9LA 2BOPA 2B9EA 4C8YA 2RUGA 3HXMA 2GMJA 2W9BB 4K50A 2VZ9A 3VTIA 4KO0A 2PGCA 3AAWB 1RWVB 1ZETA 3AD8C 3R8YA 1N34J 1T8EA 1MN9A 2W4DA 2GMHA 3BN4A 1T0TV 4C0OC 2KZZA 1BLUA 4G1QA 1RT1B 4HTIA 5KG1A 1NRKA 4FNIA 5B0EA 3CCLS 3PACA 1NK7A 4PWWA 2E7WA 2M2BA 4EFAC 4MAKA 3DRRB 3O1LA 2H51B 1SQGA 4GC6A 4OQJA 2B4VA 5ITHA 3QAUA 3NMAA 1U25A 3M2RB 1WOOA 1ACMB 4OV1A 4Q8FA 1DLOB 3TVYA 2WVEA 4GO7X 5KOXA 1N88A 5L39A 4M5DB 2KKHA 2KHCA 3C16B 2YKQA 3QRQA 4NXMJ 2QG9B 1TL7B 1K0TA 3R5BA 1GT8A 5ETQA 4AXIA 1Y9OA 2CPJA 4P2MA 3DI6B 1DARA 5A0YB 4YHHF 1J5OB 3CDAA 4DL4A 1C1CA 4PR6A 4ZHRB 4ES2A 1FESA 4J91A 1XQIA 3LH2S 2E9TA 3FNNA 4DZ6A 3M4XA 1FK9B 3H4BA 1U0HA 1JJ2R 4WJBA 1TU0B 2ZVIA 3CD5A 1WC4A 1HNXF 4E0DA 2QGFB 1NH8A 2ACMA 2AIRB 1LW2A 2HBYB 5FIIA 5IT9Y 3CSKA 4FDFA 4FYWB 1FXLA 1RT6B 3QAEA 4NEZA 1FA0A 3UI3A 2JWNA 3ZTSA 4WU2A 1S9FA 2MKJA 3PRVA 3DLLQ 4ZVGA 2W01A 2MTLA 1Q53A 2R7TA 2W7OA 4IFYA 2AJ0A 4WE1A 4IFVB 1VQ5S 4FXDA 4CLFA 3MM9A 1JLAA 2QSWA 2G0IA 3VHQA 1S6QB 4ELVA 2YKNA 4PAAA 4G1IA 2DNZA 4QWEA 2HHPA 1H38A 5ETRA 5ETOA 2RAQA 1HBMA 5KFYA 4XPEA 1YBTA 4PZVA 1B0PA 3JSMB 1HWKA 1VISA 1ZM3A 3VVTA 3KLHB 3AA8A 2OI2A 3HVRA 1LWCB 3TRGA 4JV5F 3ZZUA 2HWIA 2C2NA 3EPGA 4FPRA 4DR2F 4QIFA 4CO5A 4DL6A 2PEBA 1S7IA 4A4JA 1AA1B 5I4MA 3BSCA 3I82A 1HPZA 2CVEA 3CTRA 4LF4F 1IR0A 4M5IA 1DTTA 3SFUA 2VHGA 3ITHB 3QGPA 1HNIB 3BEGB 3IMQJ 2E5LF 2IA0A 1RT5B 2FPHX 1IBKF 3NGSA 3M6XA 5K5MA 2UUAF 2B7CB 3FSYA 3V4IB 5DG8A 2DISA 5KFBA 1JIHA 3AHPA 4G1PA 1IBLJ 3FSIA 1HHSA 1RKJA 3BO4A 3N01A 3I56S 5HK4A 2CQ4A 4OYXA 2ATCB 1X8DA 3BO2A 2GHPA 1KEKA 2QIFA 4K2JA 3LGNA 2C2EA 1JJCB 3UVJB 2GNKA 3MPWA 3OL9A 1SKWA 1P9QC 2MQ8A 3LP1B 2O1PA 2P2CB 1FVSA 5EWEA 3OPKA 4EI2A 2K1RA 3W2VB 1XMBA 4IR1A 2DYAA 2AD9A 4JV2A 2GIQA 4LSNA 4ES1A 3K8WA 3M9MB 2M0GB 1HNVB 1FJGF 2ZJQQ 4K4ZA 3DOLB 2VONA 3HJFA 1KHWA 1RAHB 3THPA 1Q8BA 4G65A 5HLFA 3K0JA 3MM5A 5IM0A 4MKVA 5G0RB 4TLRA 4I6WA 3PVXA 3DOMA 4JI3J 4Q44A 1KVJA 2O5DA 1MNEA 2JL9A 5F9NA 2WB4A 1SQFA 5C24A 5M2UA 1RCOB 3A8KA 1GK8A 1PILA 3IA0A 5A8RA 4A8XA 3L7PA 4L6V3 1WI8A 3MEEB 2UUBF 1PGZA 4RUHA 2JFDA 5BXIA 2ASDA 1ELOA 4YDXA 3L95X 1AFJA 4C8LA 2CADA 2FHMA 2HZCA 3MD3A 1R43A 3G8QA 3QT5A 4B3TJ 4OI0A 1N5TA 3KHGA 1WHXA 4I6AA 1OY8A 3CDWA 3D0HE 3UE2A 3KLEB 2HMIB 1AB8A 2IDEA 1NK4A 4RR5A 2HPUA 1R6VA 5JUMA 1IKXB 1Q16B 1EP4A 3FQKA 3G82B 2FLLA 3K17A 5IC6B 5HJXA 2F8MA 1SL0A 2R4FA 2KRBA 2B8QA 2WONA 1PAUB 2UXDF 2KVIA 1HBOA 4IQXA 2BA9A 3ZTRA 3Q8PB 4DF4A 5C5JA 1PAEX 4DG1B 1N52B 3WX4A 1OQ3A 1RLDA 2VH7A 4IOBA 4Q2MA 2ROGA 4QWBA 5HN0A 3M2VB 4X66F 4OZ2A 1UJ6A 7FDRA 3SSQA 2V67A 1NBEB 4CM2A 5A6PA 4AL5A 3T5JA 4EZ6A 2IVFB 3R2DJ 4HHJA 1HMVA 1VRTB 1O5JA 4A8KA 2GGPB 2XI2A 4PG8A 2VDIA 5B0AA 1TK0A 1PJ7A 3FJ2A 3SFGA 2JVRA 5E2QA 1JLEA 1OPIA 4ECVA 2OIHA 3UDLA 3SEOA 1WDTA 4KSEB 4M5NA 4ZVOB 2MZTA 1SJ3P 2GAGC 3PJWA 2D69A 4KPYA 1WKKA 2IM1A 3WQPA 2NCKL 1NM2A 5K8NA 4I0WA 3CCVS 1J5EJ 2VBWA 1LWFA 3GTYX 3GSDA 4X4QA 1C1BA 3IAS9 3OLBA 3A3PB 1M5SA 1WOPA 2R8JA 3W9IA 1C4CA 3LP2A 3OVAA 2VG7A 3MEDB 1X4DA 2FTRA 1TL4A 3DLGB 4LFBJ 5HQMA 4PUOB 3NGUA 1YJNS 1VOMA 4LFAF 2DIVA 2CIMA 2BV3A 1S5ZA 3T6BA 3C66A 3MXHP 3H90A 4NLXA 2W9BA 1B4SA 4R25A 3T19A 5U47A 2G9OA 1N5SA 4Y2AA 3JSYA 4CYUB 1LKZA 1JXEA 1TUWA 3GJTB 3MR7A 6FDRA 1P1LA 1RT1A 3HT0A 4FN5A 4NPOA 1VIOA 1PYOB 3BDPA 5L9XA 2CZ4A 3DFEA 4TKTA 3ILJA 4CRJA 1XMOF 1NB2A 4M8LA 2AJ1A 3DRRA 2IBKA 3EJMA 2HHSA 1GEHA 5L8RC 4CM0A 3M2RA 2HFZA 3IXQA 1RHQB 1NHUA 4DFJA 1DLOA 1JLFB 2R8GA 4G3IA 1NK9A 1RHUB 3CDUA 3DRPB 2IPOB 1GMWA 4M5DA 1NHVA 3C16A 2MQOA 5ADZA 4BS2A 1J2VA 3BN7A 1JLCB 5AE2A 5KT2A 4UUWA 2RS2A 1PIEA 3M8ZA 4LREA 1R0AA 4DJBA 3DI6A 3CJ4A 3S7RA 4AXJA 1GXUA 1RE1B 2W4CA 5A0YA 2GHWA 2QSFA 1J5OA 1Q86T 5KG5A 4I68A 2Z56B 2EBEA 3AOCA 4IO1A 2CQCA 1FCAA 4OYPA 2FLOA 4PPZA 2OMLA 3MTKA 4LQ3A 3H42A 5KFUA 2CQPA 4TNOA 4IH5A 3V6HA 1HWUA 1FK9A 1R7IA 3QSIA 1SJRA 3AQPA 2DKOB 1D0EA 2JH3A 1UEKA 2DNRA 2GQQA 2DO4A 3DC2A 1S6UA 2DR7A 5DRKA 1Q81T 3W7BA 1SJ1A 3G8SA 4BC7A 2ZH9A 3OTBA 1AUDA 3PFOA 4JV1A 1ZM9A 1Q95G 1T02A 4GMKA 3MCOA 1RT6A 2JEJA 3R7BB 4M94A 3U7JA 2J9DE 1FJCA 2IM0A 3UFCX 2BVZA 1Q8KA 3UD3P 2R7RA 2V50A 4KV8B 4M1KA 4I69A 2WTFA 3R1LA 1WTBA 4N8NA 2A18A 4WTOB 4RKUC 2AKWB 2ILZA 3Q0AA 1M5OC 2FLPA 2Y8YA 4DPWA 3J7Z5 2G2YA 4XDCA 2LU2A 3PW2A 3BF4A 1VQ4S 1OPZA 2DPJA 4DI6A 1URNA 1S6QA 3OSPA 4ZN1A 4Q7AA 1XNQJ 4Y65A 3W66A 2LVWA 5H9EK 1RT2B 3OTOF 1XJWB 4QPTA 1AT1B 2KJWA 3L9ZA 3JSMA 4NX9A 2JEFA 1HW9A 4MFBB 5IXUA 4O3SA 1XR7A 1S7HA 3CJ2A 3M30B 3DLEA 3Q86A 2PA8D 2QFJA 3KLHA 4DV0J 1HNWF 3MCNA 1HA1A 1LWCA 3M8SA 4RWWA 3QFHA 1WHWA 3OV7A 2FYXA 3PO5A 3D28A 4OZLA 3HPOA 4UQGA 1RA6A 1TL5A 2KT3A 2KYZA 2QFIA 2VQFF 4Q45A 1QSYA 1OYDA 1N34F 1SC1B 2NZ4A 3CJKA 3ILIA 2HGMA 3H7HB 2CVIA 1FFGB 4U7UD 4OI1A 4FF4A 2B51A 2DNKA 5D78A 2OJ3A 1S4EA 1FEEA 3V4IA 3I5BA 1HD1A 3CCRS 4PQAA 1UZHA 2LYVA 4C0HA 2XYHB 3Q2TC 2RD5C 3RB6A 4X4VA 1RWOB 4WYWA 4BWJA 1IM6A 2XZTB 2OMOA 2APOA 2XBPA 4DX5A 3CCUS 1TMJA 2FJDB 4PEOA 5HP1A 3NCQA 3P4UB 1X60A 4FF3A 2ZEJA 3LANA 4NXMF 3CCES 3LP1A 4WXWA 3EICA 8ATCB 3VGVA 2RQ4A 4EUVA 3W2VA 3JTOA 2W2QP 3BGLA 1YJ9S 3CXCR 2VG5A 2DH9A 2ZH5A 3PHTA 3OHBA 3TUZC 1HNVA 2LDYA 1SC3B 4HT7A 1FDNA 5T41A 5CYQB 5J1PA 1U1PA 3M9NB 1KVKA 3OL8A 3FFIB 5KFNA 2MPUA 4B9UA 4ANCA 2ALZA 1HLWA 2BKOA 1W26A 2D3ZA 4ZVPB 1H3DA 3EGNA 1FKOB 4DS5A 3G6XA 4HHHA 3UR0A 1FFWB 2JZ5A 5HROB 2N3LA 1T9VA 4ECUA 5F3TA 3MEEA 1YJTA 3QPIA 2L3MA 4JI7J 2QO3A 3ZTOA 3IC1A 4GKKF 2C3YA 2YNFB 4IYQA 3GG0A 5M2RA 4DXLA 2C1EB 5KFLA 2OP5A 1RQ0A 2MZ1A 4YB6A 3HDSA 4AL7A 1RA7A 5IFMA 2J9DA 2EC2A 5T7LB 1REVB 4B3OA 3KFWX 3MR3A 1HQ2A 2AF6A 2YWEA 4JI1J 3FEZA 4B9TA 4J7CA 3G8TA 2RQCA 3KLEA 2HMIA 3PX0A 3GIMA 4LF2A 2H54B 3AODA 5I42B 1IKXA 2XMMA 3G82A 2HHHF 4QJVA 4J9KA 3G86A 4HL9A 3WIVA 4USJC 1S1UB 2QN6B 1LFWA 4DG1A 2R7OA 3TI0A 3NWGA 4LBPA 1C0UB 2CPEA 5IC4B 1RWWB 3AJDA 3KUHA 3M2VA 2CKWA 5BYRA 1VRTA 2EI5A 4O3PA 2GQCA 1Z4UA 3KOAA 2FY1A 2GGPA 1WEZA 2HFVA 4U7UK 1QE1B 2AYMA 2K7KA 4DX8H 2HQGA 1X7VA 3QNWB 5GMEA 3N9UC 3HFZB 3CJTA 1WACA 1KBRA 3V81A 8RUCA 4MKBA 2FVSA 1HARA 2KB2A 2OD6A 4DUYF 1KTQA 1S6OA 2HBQB 4ED7A 4USKA 4LFCJ 4ELUA 4UY85 3SCJE 4PWDA 1VQSA 3UDEA 1X4FA 3U02A 2W9AA 4N76A 1R0BG 2DHSA 1RAAB 1IBLF 5C7PA 1CSJA 4M95A 1OYEA 3FBBA 4H4MB 2DEIA 5KG7A 1Q82T 4KYZA 3MEDA 1F3VA 1VQOS 3DLGA 2D41A 3O2IA 4WP9A 2AJ2A 1NK5A 1RTHB 3PJXA 2RJZA 4OZ5A 3ET6B 1VK8A 2V9KA 2UZAA 2MEWA 4BWMA 4ZVHA 2DH8A 5C2CA 5KG2A 3A1YG 2RB7A 1VS3A 4NA2A 1DHMA 2PO4A 2DHAA 3PX6A 1NO8A 2XQCA 4CH1A 4DCOB 4CYUA 3DU6A 2VC0A 4B9MA 4NLOA 4X62J 1PO6A 1T3OA 2CPYA 4WZMA 1Q5VA 3QWPA 1UWAA 2DNYA 1BWVA 3EPIA 1Z2LA 4IH6A 4JI2J 5L1KA 4MKYA 3FK4A 2MQMA 4DV3J 4F3QA 1L3KA 4YFUA 3KDNA 2PDAA 1KFSA 4F04B 1GAOA 1NU4A 5IV3A 4ZPCA 4F67A 2RSQA 2YWHA 2UUWA 4ED8A 3GR1A 1U1KA 3EZ5A 2BRLA 5GMKa 1JLFA 2DNMA 3BV8A 1FKAF 1NEEA 2D7SA 3ZC4A 3DRPA 1VIXA 3KDOA 4F4AA 3G4SS 1O0PA 3SV4A 3A3NB 1KS2A 2RDJA 4LF7J 5D3GB 5CXTA 5HMWA 1JLCA 4EO6A 2RHSB 4NASA 3NG8A 4FKXA 3W65A 4UTGA 3IR5B 4IG0A 4JYAF 3UR3C 2MQLA 3RU0A 4B3TF 2XY7A 3FCHA 2ZH6A 3VGTA 3O8WA 5KT7A 4ED4A 3CCTA 2BRKA 4CLKA 2RQMA 3BJYA 1I6JA 5IWAJ 3R97A 2NSCA 3MAAA 2IM2A 4R0EA 1FFSB 3UD5A 3UNGC 2QA1A 4LBIA 1Y4ZB 2MJUA 4RBVA 2PIIA 4FS2A 1YWXA 2QLJB 1HWLA 1PC4A 3DDIA 2ZC4A 4TVAB 1S10A 1IWGA 3AT1B 1U1NA 1TR0A 5A8WB 2JEGA 2HSEB 2DNPA 1M0SA 1NKCA 1JKHB 2FZCB 1KQGB 2EEYA 4R0JA 5MLCV 2Y3YA 3HHKA 4OZ1A 3KJNB 3F0NA 1WC1A 4B9LA 1I1GA 2KM8C 2HAFA 4OYBA 2FDNA 4DR5J 1RADB 4DF8A 2IDLA 4DV4J 3BKFA 1YJWS 1N33J 2G4BA 2CJXB 3DNCA 3NGDA 3BR9A 2H9ZA 3OL6A 4USVA 1F5BA 2WHOA 2DR6A 2XM3A 2GVZB 1EKRA 4OHVA 3VAKA 3OVSA 2GCFA 3US5A 4KV8A 2MY8A 5KFPA 2OEJA 2GZOA 3DU5A 5L1JA 2BKNA 2BQUA 3PKMA 3EGWB 4J9MA 2OO4A 2CNNB 2XS7A 4JI0J 1XNRJ 4P52A 3CD0A 4WFZA 1U2CA 1UW9A 5AXMA 1SKSA 4O4GA 1JJ4A 1J5EF 1RT2A 5H9EJ 4LF9F 3WHIA 1SIZA 4TU8A 1FF2A 3PM9A 2W9CB 2XSJB 1J27A 4MFBA 4UZCA 1V3RA 3M30A 2R7VA 4LFBF 2GC8A 4O0NA 2HBZB 4NL5A 4JP8A 2AGQA 2DR8A 3ZNUA 1EJ7L 3HCXA 1SH0A 3BBFA 1VHIA 1BXNA 1U1QA 3ZFVA 2BX6A 2KVQE 1JLQB 3EVMA 1JXVA 1X4BA 2B9WA 2BABA 3NMRA 3CDBA 1ITPA 2VPWB 3HK2A 2A10A 4GO5X 2HQDA 1PBUA 3RB3A 3AD9C 2HZAA 3R5DA 4NMXA 3M8QB 1TKDA 3D67A 5DETA 1H6KX 2G0JA 1WHVA 2Q66A 1V5IB 2CWXA 3M2UB 1M1GA 4QWAA 4X65J 1D8ZA 3IP0A 2W8KA 1RYSA 3G71S 4OYWA 2KU7A 5DDPC 2EG1A 4NEYA 3HHLC 2UXCJ 2XZDB 5DS7A 1L3UA 4W92B 2JJ4D 2EKYA 2VJUA 2ZUAA 1RTJB 2Z30B 4C0BA 4RNOA 2V9WA 2PSZA 2IJNA 2OGUA 4NLTA 5IV4A 1DY3A 1ZZFA 4L3KA 2CWKA 5EX0A 4GKJJ 2OUGA 1YTYA 3VZIA 4CO0A 3K8VA 1GMWD 4A48A 3I6PA 5CYQA 2AX0A 2E1AA 1FD2A 3D3BJ 4J9SA 3NAIA 2WSEC 5E41A 4LRAA 1IJEB 4C11A 3RBDA 2LQ9A 4ER8A 4J9RA 2DNLA 4ECZA 1FKOA 3T9NA 4NLDA 4Y2IA 2GAHC 3N79A 2ZBPA 4M63A 4O3QA 3J7A1 4DHVA 1SC6A 2Y0SD 4CNZA 2AEFA 3R6GB 1FTCA 4N47A 3OLAA 1X5TA 3JAMY 3FQLA 3ILOA 2N4DA 3GE9A 2YNFA 5ETVA 2XS5A 2HGLA 2DRDA 4ICLB 2R7SA 3TEHB 2HQFA 1S57A 4ANEA 1UVIA 5T7LA 1REVA 5D6GA 5B0GA 3KLIA 2FLNA 2HNDB 1L5UA 3CJ5A 5B0BA 2IYIA 4Y28C 4H4OB 4LF5J 4GRSA 2HVEA 3EZUA 2CPHA 1X5SA 4ED2A 1G4CA 1FRLA 1B99A 4WYLA 3IBFB 3I5CA 2LQ5A 2DO0A 1I94F 2VBYA 1CS4B 3R5JB 3GFXA 3N4WA 1XNQF 1S1VA 4USIA 1FEHA 3CMQA 5IT4A 3QYYA 1NJYA 2Z2MA 4YHHJ 4K4VA 1RTIB 2RE1A 5KFEA 5KFAA 3QJLA 2CZ9A 1C0UA 3BS9A 2XCPA 2ACYA 3EUNA 4PKDB 4K7QA 4RW7B 5DQIA 3OW2R 3ETMA 2QA4G 4WZQA 1QVFR 4B9VA 1K9MT 4HDGA 3T6JA 4KGXB 1WG5A 3A8JA 1HNXJ 5I3UB 4F3OA 1QE1A 2HS4A 5KFDA 2WB1D 1M5PC 3UDVA 5F8NA 3ETOA 1WUUA 1XC9A 2E44A 2DGWA 2X1BA 3CO0P 1EIYB 4FBUA 1XERA 3H20A 2CAJA 4J9PA 4B3RF 2FY8A 2CNKB 4L3NA 2WBRA 4JI6J 3JSBA 1WC5A 2BEFA 2KXFA 2RS8A 3D1HA 1D9FA 1ZM2A 2OTLS 4CLZA 4PG6A 2EPIA 1UFLA 3BPSP 4C98A 2ROPA 3Q22A 3RJMB 1RB0A 3OFEA 2I38A 4HKQA 3KMSA 4WU3A 3GR0A 2VKRA 4ALZA 1T9YA 4DN0A 2GIRA 2ZOMA 4DEZA 4K4SA 5DQGA 4KHMA 2CQDA 1Q78A 3IWNC 1TQLA 4LR7A 2AYGA 1RTHA 4DSIA 1UEUA 5GADI 2G1DA 5A2QY 1X4EA 3MECB 2OH2A 3SMZA 3PIPQ 3PDNA 2VICA 2LEBA 3NXZA 1SUQB 2HNYB 5F8LA 5E7OB 1FXDA 4ED5A 3IRXB 2L9WA 1YJUA 5HBMB 4ZP9A 5HMXA 3TW0A 1TK5A 1DTQB 1SCJB 1JQGA 4CLSA 2W2OP 2XGPA 1FWKA 4DR2J 3QGHA 4FF1A 2F7VA 2V63A 3RBZA 1HQUB 2I5JA 3OUYB 3OXGA 4AQYJ 4C3MA 2GHVC 5D8HB 1RACB 4N77A 2SXLA 4G1QB 4HI2A 5CABA 3VV2B 1NSKL 2HGNA 3J81Y 2G2OA 1IBKJ 1REGX 4A8SA 4M5KA 1WI6A 2KN4A 4F0MA 4L73A 2XS2A 5K14B 2GO8A 2OEMA 2UUAJ 4OHYA 1F5CA 3H2LA 1S4FA 3GIKA 1FRMA 1NXIA 1N56A 4OJ1A 4GVLA 3JB9k 2YX4A 2HHUA 2LU1A 4JI1F 4LUBA 1L3SA 2O01C 2K06A 4I56A 1ZZNA 5L1LA 3Q83A 4MK9A 1RYRA 2GQ2A 3V4MA 3EVOA 2F4FA 4QYRA 1DRZA 4IG3B 5J2NB 1EAYC 2HHWA 1JKHA 4ZP8A 2NYHA 4Q43A 1JWWA 4QIVA 1URRA 4NLVA 3FZBA 1FJGJ 4DV1J 2VFSA 1BQMB 2Y9HA 5DM7Q 3W62A 3PYGA 2EFNA 2X51A 4FBTA 4HT5A 3LGMA 2P6SA 1YJ7A 2LLZA 1WD6A 2MQPA 5ETMA 2UUCF 1VC6A 2DGUA 2OPSB 1GNKA 1OWXA 3CC4S 4KC5A 1VBYA 2GVZA 3BDEA 2CRLA 2R8HA 1UJ5A 4ZCIA 2QLBB 1XTZA 2CDQA 2YQ0A 2UXBF 2EFVA 3T1YF 2XHCA 3M6UA 3NAHA 4DDFA 4F4YA 1PJ5A 1N6QA 4KE5A 4WKYA 1FERA 2UUBJ 2DY9A 1T11A 4WF9Q 4LFCF 1AZSB 2WW4A 2VF3A 3HHLB 4WKRA 4ZLJA 1HR0F 2PN6A 1VC0A
chains in the Genus database with same CATH topology
5MAOA 4X4QA 1X4HA 3GSDA 1C1BA 3IAS9 4LJMA 3OLBA 5B09A 3KMQA 2P5VA 2Q6BA 1M5SA 2R8JA 1Q79A 1LOUA 4QYZJ 1RK8A 2LXIA 3KK2A 5IT0A 3LPYA 5FJ4A 1G6BA 4IDKB 2YNGB 2M9KA 4ED1A 1C4CA 2RDIA 2PEHA 3LP2A 3OVAA 2VG7A 1FT8A 3MEDB 2D1CA 1X4DA 2FTRA 3GFHA 1TL4A 2I1RA 3HHLD 4YB5A 1FNOA 1VMBA 4I1TA 4HI1A 3KNGA 3DLGB 1L3VA 1WWHA 4I67A 2C2DA 4PUOB 4F2RA 1YJNS 1VOMA 3DHXA 2XWYA 3DXSX 1UA0A 1S1VB 3ENQA 5GVQA 5H9FJ 2DIVA 2VL1A 5HMYA 4LFAF 2VODA 3IWLA 4DR4F 1SXLA 2E1RA 2GW8A 1D9AA 2VPZB 1E6YB 2CIMA 5E3CA 4CT9A 4URQU 1S6PA 2BV3A 5DQHA 1UJ4A 3MUVP 3FFIA 1S1TB 1Y0HA 5CYMA 3SSSA 3T6BA 2J7KA 2CQ1A 3C66A 3MXHP 1Q7LB 2IJFA 5FDLB 1JLQA 4NLXA 1UWBB 4R25A 3IG1A 2W9BA 2VASA 3WC0A 4Y3CA 3T19A 3PW5A 1U09A 5U47A 2AP6A 2G9OA 4PG7A 1ZAVA 1SJQA 2XG8A 1SBRA 1N5SA 4Y2AA 1KN6A 1BWEA 2FHOB 3JSYA 4ECYA 4DQSA 3VWSA 5JXSA 4MK7A 1BQNA 1ULRA 4TU7A 3HFKA 3TA0A 2FJVA 1WF1A 2ZD1B 5DG9A 4N5SA 1MROA 2GJIA 4LVOP 3I32A 2VOPA 2XNQA 3DHWC 3OR2B 4ECTA 1LKZA 1JXEA 1UP1A 1IKVB 1WG1A 2FJAB 2KRRA 2HRYA 4Y0FA 4X62F 3Q8SB 2V4QA 3M8QA 5HROA 6FDRA 1P1LA 1RT1A 2BM1A 4HEA9 4DWIA 4V19J 2G0CA 2OPQA 4FN5A 1H2TZ 4NPOA 2P6TA 4HDHA 1VIOA 2D3OR 1GX6A 3BDPA 5L9XA 2K7JA 1S9EB 2OD4A 2V2KA 5GADU 4IO9Q 2CZ4A 3RRKA 3I0RA 4JI2F 5LXRA 4DL0C 3DFEA 4JI5F 4DV3F 2DVIA 1SB6A 3D5MA 3M2UA 4TKTA 4IR9A 1RDRA 3OVBA 4Y34A 1XMOF 2RF2B 1S0MA 1RJJA 3NS6A 1X9SA 2HVHA 4M8LA 4C7QA 4I2PB 4ETXA 4XPCA 3C6UB 2AJ1A 2C2RA 3DRRA 3VF0B 1YSJA 1NKEA 2IBKA 4TYBA 3EXCX 2NQPA 2JLEA 2HHSA 2NUHA 3NCRA 5L8RC 3MR2A 4K0KF 4C8ZA 1U45A 1EETA 3M2RA 4XK8C 5DDOC 2CQBA 4KHPF 3I9V9 2HFZA 2PMHA 3IXQA 4X64F 1NHUA 4DFJA 1DLOA 1VFJA 1JLFB 2VQEF 2R8GA 4G3IA 1NK9A 4EO8A 4C97A 3CDUA 3R27A 3DRPB 2ZVSA 3C2PA 4M5DA 1WF2A 1OSDA 1NHVA 4PQUB 1CC8A 4LF7F 2MQOA 4J9OA 2KO1A 5ADZA 4RBUA 1UVLA 4DFPA 3VZHA 4BS2A 5BYQA 1J2VA 1NB7A 1MW7A 2BDPA 5I42A 3BN7A 1JLCB 3DMJB 1JNRB 2F40A 3HVTB 5AE2A 5KT2A 5CCMA 4UUWA 1LV5A 2J9EA 2RS2A 2DNNA 1TKXB 4A8YA 3OXLA 3IO1A 4X4RA 1VRUB 3K5OA 4Q2LA 4PG5A 1R0AA 3X1LB 4DJBA 2B5JB 1Y5LB 3DI6A 3CJ4A 3CO9A 3S7RA 3NKYA 4AXJA 4QWCA 5DM6Q 1GXUA 1HWJA 2ZDOA 4DV5F 1MMDA 2W4CA 1BY9A 3ENVA 5A0YA 1UETA 2GHWA 4RU9A 2QSFA 2D9OA 1J5OA 1Q86T 1S1UA 5KG5A 3G9CA 1S9GB 3MMCB 4I68A 3DLKA 2EBEA 1AW0A 2WRMA 4IO1A 5IWAF 1S72S 2CQCA 1FCAA 1C0TB 1KQFB 1HFEL 2FLOA 3H2VE 4PPZA 1KRPA 2OMLA 4NMLA 2AWZA 2BUNA 5L38A 4DS4A 4WK3A 2FUG9 3MTKA 3HHNB 2YNIB 1Z1ZA 4ZVFA 4B9SA 4LQ3A 2DNQA 5KFUA 4I7FA 4X4PA 2A3JA 4I6YA 3D2WA 4H4KA 2RRNA 2CQPA 4TNOA 3A8EA 4IH5A 1YQHA 2VUGA 3T5HA 3V6HA 2HNZA 4RNHA 1HWUA 1FK9A 4DV0F 1R7IA 1WTFA 1SJRA 3AQPA 1E6VB 2OPRA 4RNFA 4ID8A 3SV3A 3I87A 3KG1A 3TVZA 3UCGA 4IH7A 1U47A 2XB2D 1R8PA 1D0EA 1YJRA 2JH3A 3H5XA 2DNRA 1YITS 4IRCA 2QRRA 3JSRA 2GQQA 1SL2A 2Z0GA 4QU7A 2DO4A 3DC2A 1S6UA 4QBUA 5J2MA 2VFUA 3HM9A 2DR7A 5DRKA 1Q81T 3QJJA 3CIZA 1VBXA 3PEHA 4IUFA 2XO7A 1NAQA 4F25A 3GFYA 3W7BA 4NLUA 5J2QB 3NNHA 3LO3A 2B6AA 3PR4A 1SJ1A 1T94A 2YNHA 3OJSA 1FRIA 3G8SA 1Y7PA 2DGSA 3KHRA 4F4XA 2QZ8A 2M3DA 2IMOA 3MUMP 1AXQA 4BC7A 3HKWA 4YEAA 4F3MA 2ZH9A 2IYGA 3OTBA 2HLTA 1AUDA 4DR5F 3PFOA 1RT4B 4JV1A 1R8CA 3THVA 1VQMS 1ZM9A 2E5HA 1TKZB 2YWGA 3N5BA 1T02A 2CQ3A 4GMKA 2RT3A 1KLMB 3HF5A 2N3OA 3HVAA 4KFBA 2VA3A 1RT6A 2JEJA 2A2DA 1NJWA 4DFKA 3MOZA 3RAMA 4M94A 4TY8A 4KIAA 4RW9A 3QGGA 1K0VA 3U7JA 5CCLA 2MHEA 2J9DE 5KFCA 2I5JB 2WK4A 5JVHQ 1FJCA 2IM0A 2MHNA 4PCQA 3UFCX 2IC3B 1H7XA 4IRKA 4LIRA 5C24B 2BVZA 2YX1A 4ID5B 1V3SA 4NRTA 2KYXA 5CHCB 2HW3A 3UD3P 2YKOA 2R7RA 2R7QA 2RRAA 3DOKB 1NJIT 2DJWA 5CH7B 3H5SA 2YVSA 4BBYA 2XCAA 4NXNF 4KV8B 4LSLB 1YIJS 4M1KA 3DRSB 2HNDA 3C8YA 3E8OA 4I69A 2WTFA 1SJFA 3M6WA 3BQ1A 3R1LA 1WTBA 2AJFE 4N8NA 5KFZA 2A18A 2NYIA 4RKUC 3FEYB 2ILZA 3Q0AA 1M5OC 4MKAA 4H4OA 4NA3A 2PE8A 5EX3A 4Q5VA 3KK3B 4NZ0A 3N28A 4H4MA 2FLPA 2AV5A 3NNAA 1LW0A 1WG4A 4C3LA 3J7Z5 1LWEB 3K59A 4WK1A 2W25A 3GB0A 2DH7A 4I2QB 4XDCA 3ISZA 5HO4A 1VJWA 4JV0A 3OTCA 2LU2A 5LSOA 4KR0B 3CC2S 3PW2A 2RQKA 4JI0F 1ZTWA 1XNRF 3BF4A 3BREA 1JXLA 3RW6A 2NLWA 2HWTA 3KYLA 1U49A 1VQ4S 1OPZA 4P7VA 1OSCA 2DPJA 3E51A 5F0UA 1YI2S 4A8WA 1URNA 1N48A 1S6QA 2K3KA 4TYAA 2ZBCA 3MWBA 2ZJPQ 2B0GA 3OSPA 5E5NA 4Q7AA 4Y65A 1SL1A 4C8OA 2LVWA 2C28A 1RT2B 3V2UC 3OTOF 3JTPA 4FXWA 4OMFG 2O67A 2XLIA 3CMAS 1XWLA 4J9LA 1UAWA 4QPTA 1RTIA 2MZRA 5KFWA 2KJWA 4CH0S 2ATLA 3H25A 5JVGQ 1KTVA 4DV6F 3JYTB 4A8QA 4KHRA 3JSMA 4NX9A 2JEFA 1NZAA 1HW9A 4MFBB 1U4BA 5IXUA 4O3SA 1N32F 1XR7A 2DNOA 1F60B 1CC7A 1S7HA 3MMBB 4RW7A 2GJ2A 3CJ2A 3CJ3A 5F41A 4MIBA 3M30B 4N56A 1RI7A 3DLEA 1UA1A 2PA8D 3FDSA 2XY5A 4NLGA 3HP6A 2QFJA 1FNMA 3KLFB 3KLHA 1KC8T 3QJPA 1HNWF 3SDEB 4A8OA 5D4PA 1MU2B 1S99A 2XI3A 2E5JA 1HNZF 1HA1A 1LWCA 3I55S 2ZE2A 4XDDA 5KFIA 3M8SA 4NWBA 4WFYA 2LXFA 5KFMA 3D54A 1Q8LA 2BM0A 4CO2A 4CIOA 1JLBB 4RWWA 3HHEA 2BE2B 1WHWA 5I3UA 2WONB 3MURP 1T95A 2LCWA 2DCLA 2ADCA 2K3IA 2RH3A 3OJUA 3OV7A 1LQ9A 2DT9A 3MI7X 2HQ3A 3IS9B 3PO5A 3D28A 4OZLA 4DQRA 1WELA 3HPOA 4OJGA 4UQGA 1YVFA 1RA6A 5E3QA 3V6KA 3MM7B 4Y00A 2ADBA 4AE5A 1TL5A 2KT3A 3MM6A 4AFFA 2KYZA 3OTDA 5BJRA 3LWMA 2VQFF 4KO0B 4Q45A 1P27B 5CD4H 2B56A 3GIJA 1QSYA 4ILLA 1VQPS 2RILA 1JMTA 2BANB 1N34F 3C3LA 2E66A 5G4DA 1VC5A 2Q43A 2EK1A 2NZ4A 2ZH8A 2BW2A 3CJKA 2LECA 3PO4A 5KFSA 1ZOTA 1S1XB 2B43A 2HGMA 3NRBA 3DLHA 2YKMA 3MHYA 3PNIA 1X9WA 3T1AA 1BQXA 2CVIA 3T5LA 3T1HF 4ZMMA 3RRGA 2KDOA 4U9RA 5DDQC 3K5NA 3SCIE 2DGVA 4IRDA 4DV7F 4JI7F 4OI1A 1Q8IA 4FF4A 3OR1B 4HTJA 5LJ5Y 2B51A 2D74B 1V3ZA 1YG0A 3MD1A 4KB7A 1FRXA 1XR6A 2DNKA 1UVNA 1VQ9S 1GX5A 4ZPDA 3NGKA 2AJQA 5D78A 2OJ3A 4CTAA 5D3GA 3GV7B 5F8HA 1FEEA 3MMAB 3V4IA 3PKYA 1FRHA 3I5BA 3OL7A 1HD1A 1PSDA 4N8OA 2KI2A 4CT8A 3CCRS 5EWFA 3F41A 4NRUA 4PQAA 3MFHA 2LYVA 4C0HA 5HMZA 2HHQA 3H2UB 4ZK7M 5EUHA 5DGBA 2N7CA 1YHQS 3Q2TC 2O3DA 3NLCA 3OXFA 2RD5C 3RB6A 1N6QB 1N5VA 3U1MA 5KFOA 2MKKA 3PR5B 2UXCF 3POTA 1NK0A 4X4VA 4WYWA 1HBUA 3B4DA 3QZ7A 4BWJA 5IZHA 1F5AA 1VQYA 4ECQA 2ZHAA 1TL1A 2OMOA 2APOA 2XBPA 4N41A 1YRTA 1ZAXA 2YX7A 1S48A 2CJQA 1TKTB 3CCUS 1F9FA 3NBPB 2CG4A 3I0SA 2FJDB 5D4OA 4MJKA 3K5MA 2ROEA 3OFHA 3KJVB 5KFXA 5HP1A 4RUAA 3NCQA 3EXYA 4FF3A 3PHEA 2GV1A 2U2FA 1JJHA 2YKPA 2MGZB 3LP0A 1VQNS 2J8AA 3LANA 4NXMF 2ZM6F 3CCES 1H2UX 3LP1A 4WXWA 2YTCA 3OHAA 1TVRB 3KTQA 4CZCA 2R7XA 2Y1RI 5E3AA 1D9DA 2RQ4A 2MSSA 2DITA 3D1QA 4GKJF 3AY0A 5KFTA 2UVVA 2PA3A 2V0NA 4EUVA 3HI9A 3CULA 2WAQD 3W2VA 4R5PA 1SUQA 5A8WA 2ZKUA 2XULA 3D1OA 3JTOA 2OLWA 3BGLA 3LOUA 3ZZRA 4ITSA 5FLXY 2LMIA 4TU9A 3J7YU 1YJ9S 3CXCR 1MWZA 2VG5A 2DH9A 2ZH5A 5B08A 2DBBA 1JB0C 1RT3A 3RB4A 4A8MP 2VG7B 3OHBA 2HG4A 1S79A 3TUZC 1HNVA 2LXUA 2WSCC 2LDYA 3HT3A 4WZMA 1ZBTA 3IRXA 4ZKAA 3MZIA 2I2YA 2HLUA 2UV8A 1S0VA 1N8RT 2VA2A 1C1CB 3SCLE 5HBMA 3ZZPA 3PW0A 4HT7A 7FD1A 5F3ZA 2W24A 3CGIA 1FDNA 5T41A 2K2PA 3P96A 4ZPBA 5CYQB 3QLHA 5AXNA 4NCAA 1DTQA 5KAKA 2M52A 3RB0A 5J1PA 1KLNA 2OPPA 4K5RA 1U1PA 5E33A 1KVIA 1YJVA 3M9NB 4HVZA 3OL8A 1WEXA 3CCJS 3RRHA 1R8AA 3FFIB 5KFNA 1U2RA 2MPUA 2FVCA 4RU2A 2ZH4A 4LVNP 4B9UA 2F1FA 2R9LA 3OTEA 1HQUA 4PWUA 2ALZA 4CQ1A 1IXKA 2L41A 3OUYA 2DR5A 1KFDA 5FD1A 3M1VA 2KXHA 3U1NA 1T05A 2D3ZA 2DD8S 2DGOA 1WF0A 1U48A 4V19X 4DOZA 1H3DA 3EGNA 3FRYA 2DCUB 4RNMA 3TAMA 5L9NA 1FKOB 1MWYA 1FVQA 4DS5A 2NS1B 3G6XA 2R7WA 2MDAA 3LAKA 4QR1A 5K8OA 3L7OA 3DM2B 1M5HA 1KSPA 3UR0A 3GIIA 2JZ5A 1LW2B 5HROB 2MKCA 2BZ2A 4ZCMA 4C2MA 2E1CA 1S49A 2GMLA 2N3LA 3N6NA 3V6DB 2MKHA 1NJXA 1DZ5A 4K4TA 4DR6F 2L9DA 2P9GA 5F3TA 3VAMA 4ECUA 3KK1B 3MEEA 4OI6A 1YJTA 3QPIA 4ZCKA 4LF6F 2JC1A 2FHJD 4DLGA 3FVYA 2L3MA 2XMUA 2VV5A 2QO3A 1YRXA 3I0RB 2XWXA 3IC1A 4GKKF 2C3YA 3HZGA 4K4WA 4TXSA 2YNFB 4IYQA 3GG0A 5K14A 1HBNB 5M2RA 2R2TA 4FXVA 1U7LA 5KFLA 2OP5A 4X4NA 1RQ0A 5EGYA 2MZ1A 2GO9A 4OZJA 4YB6A 2FD2A 3ENWA 3HDSA 1Q1KA 1TL3B 5I3QA 4AL7A 4DR3F 4QOTA 1RA7A 5IFMA 2J9DA 2BQ3A 1NH7A 4WFBQ 5D4LA 2V8DA 5T7LB 1REVB 2F9DA 2PD1A 1YBAA 1VI7A 1ROFA 2M5YA 3OFGA 4ZPVR 4NYPA 3O6QA 4B3OA 3KFWX 1W25A 2XLKA 4ZCLA 4ZPWR 4FNHA 4JBCA 3UWTA 3MM8A 3MR3A 2N82B 2GX8A 3THTA 3J80Y 4LF5F 1F2GA 4RW4B 2W9CA 2AF6A 2YWEA 3FEZA 3PX4A 4B9TA 5AXKA 3RYLA 3G8TA 2RQCA 2XEXA 1S97A 2XSJA 3KLEA 2HMIA 3PIOQ 3PX0A 3S1TA 3GIMA 4I64A 4IFYB 4ZPTR 4UUXA 4WE1B 4RW6A 2IA6A 1V6HA 3L3CA 1Y5NB 3PEJA 3MM9B 1JLAB 2B4PA 2N4CA 5I42B 1IKXA 2IAJB 4ELTA 2XMMA 2HHHF 4F4ZA 4QJVA 4AUKA 4J9KA 3G86A 4EZ9A 4YR3A 1FKPB 2RMLA 2X3GA 1DQ8A 1R0AB 2HFOA 2DNHA 6FD1A 2YKNB 3ULHA 4ZS6A 2Q1LA 4IG3A 3TYTA 1B64A 5J2NA 2XMJA 2PT0A 4H4KC 5SUHA 1HL6A 1V9OA 4HL9A 1R89A 2FJWA 1R31A 2XSFA 3U1LA 1HW8A 3DDNA 2FGCA 4USJC 1S1UB 4ZP7A 4MK8A 2C42A 1LFWA 1IQZA 3F56A 2FJEB 4NA1A 1RP5A 5AE1A 1BQMA 4DG1A 2RKIB 1RGVA 2R7OA 3KHHA 3TI0A 2FB0A 1HBMB 4PG4A 1CQMA 3NWGA 1XR5A 1C0UB 2CPEA 3C6TB 2QEXS 5IQQA 5BR8F 3SZ2A 3CD7A 3S01A 2DK2A 2ZDPA 3BQ0A 3UCUP 3M2VA 2DTJA 3RBEA 4Z37A 2BR0A 1W2BR 1KQKA 2CKWA 3KLGA 5KTQA 2JFKA