2KHDA

Solution nmr structure of vc_a0919 from vibrio cholerae. northeast structural genomics consortium target vcr52
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
108
structure length
108
Chain Sequence
MSNQTCVENEVCEACGCAGEIGFIIREGDDVAEVSLFGSDKAHLEGKLAEYISLAKQVYANVEYEVAPVADNATELHARFKFEVSAEKLIFELKTRALARLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein VC_A0919
publication title Solution NMR structure of VC_A0919 from Vibrio cholerae. Northeast Structural Genomics Consortium Target VcR52.
rcsb
source organism Vibrio cholerae o1 biovar el tor str. n16961
molecule tags Structural genomics, unknown function
total genus 19
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2009-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04175 DUF406 Protein of unknown function (DUF406)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.860 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2khdA00
1IN0A 2JZ5A 5B7WA 2KHDA 2K3IA
chains in the Genus database with same CATH superfamily
5KG0A 3DHXA 5ETQA 3VV2B 1XMQF 3CDEA 3JQKA 2B4OA 2D9OA 4PUOA 4NLGA 3KLGA 3MEEA 4TVAB 2M5YA 3U1NA 4KHPJ 3BR8A 1T9YA 3OT9A 1VDHA 2YNIA 3W5ZA 2R7OA 4DX8H 1B70B 1VK8A 3FSXA 1OY9A 1RT1A 1K8AT 4ELVA 1PBAA 1RTDA 2RF2B 2R8HA 1HR0J 2NLWA 1T05B 2CPXA 3NBPA 3ZTRA 1Y3KA 4CLYA 1U2FA 1C1BB 1I3OB 5DGBA 3KOAA 5ETPA 2W9CA 2C28A 4F4AA 3K0JA 3EXCX 1CS4A 2BBEA 4GC7A 3K5MA 2HFNA 4ELTA 1LW2B 5HK4A 2CAJA 4USJC 2ZHBA 2XBPA 4DHVA 4OYWA 3ENVA 5LSOA 3M8RA 2HBYB 3WBZA 2BW2A 1F9EB 2DTJA 3HVTB 3ZNUA 3T9ZA 1SIWB 5FLXY 3BKFA 4DSEA 2OD6A 4ANCA 1KVJA 1RP5A 2ZZMA 4K4UA 3TYTA 4WIIA 2CQ1A 1KQGB 4QR1A 2BKNA 3QPIA 1P9YA 1L5UA 1AT1B 4Y0FA 1JLQB 1LNQA 4B08A 4F25A 2J8SA 3J7Z5 3LALA 3PW2A 4KPCA 5BR8J 4KBIA 2CDQA 1S0OA 3QSIA 3H2VE 5A8KA 5C24B 2HBRB 3HHLD 2I5JB 3LP2B 9ATCB 1RWOB 2Q66A 2D69A 4OYIA 3D1HA 4X4OA 3G96A 2P9CA 3W61A 5E5NA 1KNZA 3TVKA 2A2CA 2CFXA 1TUWA 1OQ3A 1EETA 1LEOA 2GGPB 3NXZA 2FLOA 2XZDB 4FVMA 3EE3A 3NGTA 4LF6F 4DG1A 1VI7A 4PWDA 4L6V3 1L3UA 2XWXA 5E3RA 3B8HA 5IT0A 4TQSA 1WSVA 1S1VB 5CYJA 3R5BA 3OFGA 3CCRS 2OPQA 3AA9A 3HJVA 2AGPA 1OIAA 1RTHA 3ENAA 1YKWA 2XNRA 2W2MP 4C8ZA 4DU8A 1MROA 4LT6A 5IXUA 2ZJRQ 2H9ZA 4Q2MA 4RNOA 3N6LA 3GIKA 4KYZA 4JYAJ 1DTTA 2AJ1A 2HK3A 2GO9A 2Y1LB 1WHVA 1ZM9A 2HMIA 2CUYA 3V6DA 1FCAA 4KTQA 1CJKA 1RISA 1VRUA 3T1AA 2R7WA 3UQSA 1KLMA 1FWLA 2DR5A 1FDNA 2RUSA 3KLIB 3ZZYA 2YWGA 2B51A 5ETTA 4LFAF 2LXIA 4F3OA 5I42A 2HW3A 4HKQA 3DOMA 3CCZA 2XSFA 4CTAA 5LOQA 1IN0A 4FP9A 1SUQA 1S9GA 4DR5F 1VGYA 2YKAA 4OJ1A 2HVDA 4DR2F 2FC9A 4IUFA 1BMQB 5HMYA 2ROPA 4YP3A 4OV1A 3MM5A 5GMDA 1CSJA 3W7BA 1HNIB 3KK2B 1TK8A 4UOFA 1W7WA 2DEJA 1P8GA 2H4YB 1TKZB 4C8NA 2KJWA 2NXUA 4DV1J 4OZ5A 3IS9A 4ZIWA 1XN9A 2RE1A 3H7HB 4OYAA 4L73A 1NB7A 1S77D 2QC3A 1IR0A 3IAS9 3OUYB 4MTPA 3GJTB 2BE9B 1GEHA 2UVWA 1KQKA 2HFVA 1CULA 4TYAA 4U95A 1P1LA 3I0SA 1FKAF 4DFJA 3CDBA 5KOXA 2BJ3A 1HBUA 4YUDA 3MAAA 1HQEA 5HBMB 3CULA 2B5JB 3C15B 4CO1A 1GX6A 3FJ2A 1SH0A 2RUGA 5EWGA 2V8GA 2EC2A 1DLOB 1Q79A 2IFXA 2MZTA 1OWXA 3CSKA 3D67A 1LWCA 2EKYA 2CZ9A 3CMQA 4MYUA 4Q45A 4FPIA 2I2YA 3BQ0A 2XULA 3LO3A 3PG9A 3VR1A 4DUTA 5KOWA 5A2QY 2MKHA 5FD1A 3AOCA 1IBLJ 2VONA 3DGVA 5DG8A 3TEHB 1LKZA 2CWXA 2VBYA 1D8YA 3R5DA 3G87A 2OI2A 5KFMA 2BJDA 5F41A 1DTQA 1RUSA 2BJ9A 2V2VA 3NP5A 3QIPB 3EGWB 2C22A 2OHDA 1AUSL 3RR8A 1R6VA 4DF4A 4R0JA 1HI0P 4K50A 1QAJA 2JEFA 3H5UA 4DV4J 4QOTA 3PVXA 4IR9A 4WE1B 4PG7A 1NKEA 3FBEA 1F6TA 3O3LA 1RGVA 1Y5IB 4DZDA 2C2RA 5J2PB 1CC7A 1S0MA 1I94F 2DR6A 4P72A 4C6AA 2R7QA 4RLEA 1QUVA 4O3NA 1U25A 3NGSA 1G7CB 2JC0A 4EZ6A 2XS5A 2J6TA 1KKHA 2KKHA 1Q7LB 3K5LA 4JI8J 1M1HA 2FJEB 3RBEA 2Q6BA 3L7UA 2VPWB 1RBAA 1ZAWA 5A8RA 4NPOA 5D3GA 3FCVA 4OZJA 3BJYA 4QU7A 3E2EA 5G0RA 3R7NB 2MLXA 4JI2J 2Q43A 1FRHA 3LUYA 2RS2A 1F3VA 5K8PA 1HBOB 3HHLA 4I56A 4DOZA 4CM0A 1U0HA 2POKA 4RW8A 3IRWP 1YJUA 4PABA 3IBWA 2OAUA 1IKXB 3CD7A 3TA1A 2OH2A 2DGUA 5HJXA 1HBMB 3M8QB 3HDSA 3K8VA 1S6QA 2X1FA 3TI0A 1WDTA 2AX1A 1LWFA 1KVIA 2F63A 1BQMA 1T3OA 1TAUA 2VFSA 4JI0F 1VJWA 3PXGa 3CF5Q 2DNQA 5J2NB 2DNRA 3MMCB 2YQ1A 1RWNB 3MR5A 3PCOB 1NK4A 2PT0A 1IBMJ 2XY7A 1VQ8S 4CLKA 5FLXU 3BGLA 3JSRA 4NLYA 4FPRA 1M5SA 2ZEJA 1QSYA 3PW5A 1VIOA 2CQ2A 2EFGA 4F02A 1Q81T 3OFFA 3E01B 3D1OA 2FVPA 4K4ZA 4LRFA 2QN6B 2LECA 2HQDA 4OJGA 1FD2A 2J9DE 1EZZB 1HIYA 2JLFA 4DR3F 1HWKA 3IP0A 1G6BA 2KYZA 1L3SA 2XLKA 4DR1J 4QWBA 1FKPA 1F5CA 1NO8A 2CJQA 2AT1B 4LR8A 3O8WA 2YNFA 2YWKA 1UVLA 5F9NA 4WXOA 3GR0A 1T03B 2IDEA 4LBHA 4U9RA 4QW9A 3IM9A 3QIDA 3HFVA 4CO0A 3UWTA 3JYTA 3DI6B 2ALYB 2RAQA 1E6VA 3KXDA 1VQ9S 4O4GB 1M5OC 3GV5B 1T7PA 4HHHA 1Y0HA 5BYSA 1WEYA 2DGVA 1GXUA 3BPSP 2LFVA 2HBZB 2EXUA 2V2QA 3VGTA 1G2EA 1QAXA 3LGHA 4B3OB 1KTVA 3ADAC 5B7WA 1BHNA 4M5GA 1X0PA 1KSPA 5KG2A 1RT5B 1SJRA 2HURA 4GRSA 1P1TA 3SSRA 3N4WA 5GAEI 2GVZB 1RXOB 3TUZC 3GYNA 4DR6J 2X1BA 1RU1A 3UN2A 4NZ7A 1AFJA 3JQJA 3QAEA 9RUBA 2QLFB 1HMVB 1Y5NB 2F3JA 3VVUA 1UW4A 3EZUA 4X66J 1WKJA 5RUBA 1UZHA 1IKYB 4N47A 2MQPA 2XNQA 3UN3A 1U8WA 5BXIA 2MY8A 4N7TA 3W2VB 5H9EK 1KOHA 2KL8A 3OFHA 1OY8A 3US5A 3VZIA 4JOUA 2KFZA 4KGKA 3H2UB 3W64A 1T9TA 4NZ6A 5D8HB 2ZNYA 3H8YA 1RBLA 4UUWA 3C8YA 3I9V9 3CJSA 2ZHOA 3B4MA 2RQKA 4WIQA 2UUBF 4ZP7A 1C0UA 1FX4A 1LWEA 3Q8SB 4H4MA 5LJ3Y 2LEBA 4DN9A 2CPDA 2PEHA 4U96A 4ZS6A 4X2BA 4QWAA 3SBMA 4CWBA 4RUCA 2NUUG 1S1XB 2DISA 4WP9A 2KZZA 2I38A 4N56A 3JAMU 4XDCA 2EFQA 4F0HA 2BQ3A 2GQCA 1WORA 2DNHA 1S1WA 1S4EA 3P5BP 4YB1P 3DRRB 3R2CJ 1KN6A 3Q0AA 3SYZA 2H1YA 5E3QA 4BDPA 1JLCB 3HVWA 1YRUA 2DIUA 1UWBA 2MMYA 4C4WA 1XMOJ 4X4PA 3TAMA 1FDBA 3EXYA 3NOCA 3GFXA 1S0NA 2RRBA 2PMZD 2MJNA 1XR7A 1RKIA 4DCPB 1NJXA 4I7FB 3PHTA 3IGNA 2EG1A 1N52B 2XZWA 1K73T 2VG6B 3AJ1A 4TLQA 1YLXA 5J2QB 4ZPWR 1NHVA 1V3RA 2Z8QA 3VWSA 3CW2C 1R8PA 2ZD1A 5KT3A 2WB1D 4X64J 3B82A 2PD1A 8AT1B 4ECRA 1QAIA 2CQ3A 4R25A 3HHEA 5CYQA 3DU5A 1YZ6A 1GXTA 1RAJA 1N6QB 1N34J 4YR2A 4LSNB 2D3O1 3CDWA 5F8HA 1RWPB 1UAWA 3UVJB 2Q79A 3NMAA 2ASJA 4DX5A 4PG6A 4AQYF 1FFSB 4MFBB 4NXNJ 3BGFA 3PYGA 4EZ9A 5JXSA 2WVFA 2KB2A 1J5OA 2VASA 4X65J 5I3QA 2Y1RI 2BOAA 2DR9A 2AX0A 2HNYA 2HHTA 1H2TZ 1VC0A 3CJKA 3L7OA 4CDIA 5DRKA 3DM2A 2CPJA 1N56A 4QPXA 2UUCJ 1TUVA 3DCAA 3MM9B 3RRHA 4USHA 5AXKA 1F0XA 2XMAA 2O01C 1AFIA 4KT0C 4C8LA 5DM7Q 2XS7A 2J0WA 4IG3A 4IFYB 3QWUA 1JJ4A 4IKAA 3CC2S 1RHKB 5HN0A 2IA6A 1MU2B 3A3NB 1M5VC 4NLPA 2EG2A 3MCMA 4PXCA 1RQ0A 3F44A 2AGOA 2J9CA 3PW4A 3C2PA 1RSCA 3LPEA 1SKWA 1SPBP 3DMJA 1UJ6A 2UXDF 5LSLA 3S6EA 3IWXA 2ZJQQ 4IDKA 3FEZA 1WSRA 1FFWB 2AYEA 3FMBA 3QO9A 4M94A 3GFZA 1ZZNA 4O3QA 3H0PA 2PI5A 3POTA 4P71A 2MEWA 4B3TF 4RU2A 4ILMA 4IFVB 4CRJA 2MQOA 3PEJA 4IQMA 5T7LB 2WSFC 3EDQB 2Y1JA 1RE1B 1ZTWA 5ETNA 1HBNB 5HVHA 3V81A 2CPEA 2G2ZA 1HNWF 4LBIA 3FQLA 3DOKB 2MGZA 5HAOA 3HSZA 4OI4A 5HANA 4LF9J 4M95A 4WFNQ 4RW9B 2LXFA 5HQ8A 3IR7B 4N41A 1HA1A 1QE1B 4R5PA 2AP6A 1VC6A 3M9OB 2XG8A 3D4JA 5GAHU 4DPYA 1QM9A 2GHVC 1NSPA 2CPHA 3JTNA 2D74B 3BSAA 2XCAA 2QFIA 4LIRA 5CD4A 1XNQJ 2OFHX 3A3PB 4R0EA 2HHSA 4GKKJ 1S9FA 1UFLA 2KM8C 2IJFA 4RKUC 4M1KA 3VHQA 1FT8A 1FEEA 3G2XA 1HLWA 5KFZA 2AHOB 3MZIA 1RTIB 4N76A 3WQPA 5IWAF 3M9MB 1S1UA 4GKJF 2H65B 2EFVA 1ZYQA 3MOZA 2WRMA 4C8KA 4ZHRA 2UUWA 3AQPA 1OPIA 2BJ8A 5HQLA 4I0WA 3GV7B 4ZCKA 1UFWA 2RF2A 2XSJB 4WZQA 3R9LA 1PCAA 2XB2D 1U6BA 5H9EJ 3R6LB 2XCPA 3I82A 3IC1A 4RUAA 1U1NA 5DS7A 4DV0J 1MW7A 3N5FA 5IQQA 2UXCJ 1PJ5A 5A0YB 2V9KA 1T9VA 3NAHA 3QQCD 1FI4A 4ZVHA 4CIOA 1HFEL 3SSSA 1VQ7S 4KO0B 2CQGA 2DR7A 4CH0S 5LM7E 1H72C 4Z2XA 2IJRA 2YXLA 2WVDA 3UW1A 1U7LA 3MF5A 2EKNA 4LF2A 3KJVB 1Q78A 4GVLA 4ZA1A 3TX0A 3T19A 1WKKA 1D9DA 4ECZA 3OHAA 3CCJS 4Y2IA 3OQ2A 4XO0A 3PRDA 7FDRA 3U27A 3UD5A 2ZH7A 3TW0A 4DF8A 5K14A 2IA0A 3CJ0A 3Q8RB 1DQAA 4KH0B 2MSTA 3UNYA 2IVMA 1VOMA 2VC0A 2Z58B 1SJFA 2GVDB 5D4NA 3DLEA 3EMTA 3HZEA 4X4UA 4KHPF 2GHPA 4B9UA 3SZ2A 2YKMA 5B08A 2CQCA 1JLQA 4V1Ak 2MZJA 3RZAA 2WTFA 1TZ0A 4EYHB 2AEFA 1FK9A 4USWA 5BJRA 1AYEA 3OL8A 4OZNA 5B0DA 1X7VA 3WX4A 2NYHA 1RAEB 4RW7B 2I5JA 4ID5A 1TL1B 3LP2A 4PPZA 1VQMS 3PX6A 2KVIA 4FF4A 1HR0F 2CPIA 3KHHA 4UZBA 2ZHAA 3H42A 2NSBA 4WKYA 3GIMA 3N0VA 3GIIA 2VJUA 1YBAA 4Y65A 4RNHA 2KVQE 2HFUA 1B3TA 4ED4A 4ED5A 2QFJA 4A8KA 2MKKA 2VG5B 2L9WA 3MCNA 3T1YJ 5CHCB 4WF9Q 3RAXA 2I9SA 4HI2A 2R7RA 2GO8A 1S1VA 1LW0A 1ZPVA 4HDHA 3SQGA 2Y0SD 3TVYA 1R8AA 1UEKA 4YN3B 1B99A 2MY7A 3PO4A 4URGA 1QTNB 1TV6B 1H2VZ 1JNZB 3N01A 4KR0B 4DR4J 3W60A 3NOGA 1OY6A 2QT7A 2GX8A 3BSOA 4LREA 1HWUA 2MB0B 4DPXA 2ZOMA 4XPEA 1B7YB 2JRSA 1VBKA 3Q83A 1JXVA 3CCMS 3BS9A 4WK3A 1C2PA 2HHQA 3MUMP 2RHSB 3K5PA 2P9EA 4M5DA 3ZFVA 4PUOB 3MEEB 4F2SA 1O5JA 2HHWA 3VGVA 5BR8F 1WD6A 2YNIB 2V69A 4OYPA 5D0RA 3KG1A 1ZA1B 2PMHA 1RT1B 1NJYA 3QWPA 1RTDB 1HPZA 1M5KC 3OL7A 4F3QA 2VBXA 1Z2LA 3MEKA 3H20A 2CNOB 2PO4A 1A6LA 3H5XA 2JVRA 3NGRA 1K44A 4P7TA 2ZUAA 4K5RA 5HMXA 2AJFE 1KRPA 3NBPB 1U49A 3SV4A 1U1KA 3OTDA 1HNIA 1V3SA 2OMOA 4KPYA 2M52A 3GE9A 2DO4A 4I6WA 5HLFB 3MDFA 2DNMA 3MPYA 3RU0A 1CS4B 3SCLE 4YOEA 2HAIA 2P6TA 1S49A 2KYXA 3HVRA 5L8RC 4MIAA 2CG8A 2NZCA 4O3SA 1WG1A 1Q8KA 1V5IB 3HHKA 1H98A 1R8BA 2JC1A 4J9UE 2VBWA 2HBQB 4DCJB 3BR9A 4JYAF 2D7SA 3VQSA 2VUGA 4RJVA 2KU7A 2K06A 4HT7A 1SI9A 4A8MP 3KUGA 3Q22A 1HQ2A 4HYKA 2DO0A 2XWYA 1YITS 3RB3A 2B5JA 4RW4A 2PSZA 4USVA 5KFEA 1YJTA 3UNGC 3HO1A 1DLOA 1NNDA 3K7RA 1HARA 2QA1A 5LT5A 1UA0A 4RWWA 2QLXA 4LMZA 4CT9A 2IM0A 3KMSA 5KFOA 2KTQA 3WZ0A 5DDPC 2FVQA 1XTZA 3IR6B 2VPYB 4C8YA 2WW4A 2H4WB 4Y00A 3JS9A 4K4XA 2ZBPA 3HXMA 4MKVA 3UI3A 4HEA9 2C1EB 2NYIA 5BYRA 3SV3A 1VR6A 1EETB 5J1NA 4I4BA 1MN9A 4PAAA 2WVEA 3QIPA 3MPWA 4NYOA 1H74A 4DG1B 4DV1F 4PWDB 5F0UA 4DV6J 4MKYA 5HQMA 1N32J 1ZETA 5B0EA 2WHOA 4HHJA 1WOPA 2PFDA 2OPQB 3RG6A 2VICA 2ASYA 3CE8A 3TJ9A 3NMRA 1HD1A 3ITHA 4YS2A 1ZAVA 5J2PA 1MROB 3M8PA 1RAOA 5IS2A 1EB0A 2OO4A 2L08A 1EAYC 1X4CA 1FJCA 1LOUA 1S5ZA 1MSWD 1WC5A 4F4WA 1DTTB 2R9LA 3U7JA 2AF6A 2ZM6J 3KDOA 2J7KA 2V2KA 2W2QP 2HMIB 3V6DB 4PPDA 1VMBA 4OI6A 3PX0A 1YQHA 1FJEB 1PGZA 1CJKB 4AL5A 4CO2A 2H5IB 4NA1A 2ZUGA 2IYIA 1VRUB 2XMWA 1WF0A 5KFRA 4I68A 3ILOA 1KLMB 4DV5J 1N5QA 4LF7J 1AXQA 3QRPA 3TUJC 2JX2A 1U2CA 5DG9A 3R97A 2PDAA 4NLVA 2BYCA 2OPPB 3CDUA 2D41A 1IBLF 1NBEB 4Y34A 2HRTA 4NRUA 3DOMB 4F26A 3CEDA 3ZZOA 2E9TA 1IKXA 4CTAB 1RWMB 2GV1A 1NDLA 1SUQB 4TXSA 4FYXB 4UQGA 3V4MA 3PW0A 5IC6B 1U48A 1RCOB 4Q0BA 4ITSA 3UPFA 3A4TA 2F9DA 3BGOP 3DKDA 4B3MJ 5J2NA 3L4BC 1KWMA 1UVIA 3DLBA 2IM3A 3CJTA 4JV1A 4ECUA 3PRVA 4O3OA 2K1RB 5EWFA 4RWXA 2DVIA 4OLPA 5AE3A 1NDKA 4ZCIA 3IS9B 4DV4F 3AQOA 4FNHA 1EX8A 3W3SA 4JBCA 1G3OA 3QBCA 3P5TL 3M9NB 2E44A 2FJXA 4ECSA 2W1BA 3R5AA 3W9JA 2Z0GA 5KT6A 4U7CA 4IOAQ 4DI6A 4YQWA 2KRBA 2H5JB 2HLTA 1CULB 4RBTA 3UN5A 2J0XA 3FEYB 2HQIA 3I0SB 1JXEA 3CD5A 4A4JA 2NCKL 2C2KB 1HBUB 4M63A 1SJ3P 3MAAB 4P2MA 4F2RA 1T03A 3C16A 4JI8F 2DHAA 4ATNA 2N3LA 1HWIA 3OVBA 2J0SD 3QGIA 3DI6A 2E7VA 4O4GA 4KGVB 4PXDA 1QY7A 4JI2F 1WG4A 4FBTA 4Z37A 3L95X 3AB4B 1B64A 5CYMB 2IVYA 4I69A 1LWCB 3RB4A 3LANA 1RABB 2X7IA 1NM2A 2UUTA 2H51B 3K57A 3FZ2A 1FWPA 5BYQA 3FRYA 3U02A 4B3OA 1NJIT 4YFUA 2XGPA 2B9YA 4EBCA 1WC4A 1TVRA 2E5HA 2JNJA 2GVZA 4OI2A 3OJSA 3GP9A 3I87A 1HNVA 4LRAA 3D0GE 1KVKA 1DTQB 4OHYA 3BQ1A 1I51B 4G1QA 3ICLA 1HWLA 2E7WA 2NXJA 3FC9A 4LSZB 2IM1A 5CA5A 4NMLA 5GADU 5CCMA 4OI0A 2J7WA 2XO7A 2WBRA 3KUEA 4Q7AA 1X5OA 2DGOA 3ZO7A 1K9MT 2MZQA 2AYBA 3R6GB 3I4HX 3EZ5A 4DR1F 4A46A 4U6PA 1UVMA 4MKAA 3M2UB 1RT6A 3DLHA 3OVAA 3AD8C 4NZ0A 4JI6J 1VFJA 2Y8WA 1HL6A 4ECQA 4C97A 3VAGA 3C6UB 3IGVA 3LTOA 3H4DA 2FVCA 4A8OA 1NK5A 4DQRA 5A8RB 3BBCA 4QQBA 2K3IA 5B0BA 1N36J 1V6HA 1X4DA 1R89A 3J7A1 3WIVA 3MUVP 2EW9A 2WAQD 1TMMA 1LXJA 1YVFA 1FEHA 5K5MA 2ZH6A 1RWKB 4N77A 2LU2A 5LMUJ 2CJAA 2IJNA 3BPDA 4ZP6A 3SQOP 1JLCA 2XY6A 3J7AN 1RLDA 4DR6F 5IOLA 2DHGA 4YHHJ 1G1XA 1BQMB 4KY3A 2BV3A 4QJVA 4X66F 2R42A 1YK9A 2ZZTA 2DCUB 3UDEA 2QMXA 4RNFA 4OI3A 3D28A 4CLPA 2JLEA 5J1PA 4NLQA 2PFFB 3JXOA 2PI4A 3EYZA 4ANDA 3GYXB 5B09A 3J80U 3WC2A 3CCQS 1ULRA 4MIWA 2I0XA 3G8TA 2ZBCA 3LH2S 3ZZRA 4OZ2A 5MLCV 2DGWA 5HVGA 1KLNA 1FKPB 1HI1A 1IQTA 5LL6d 3BSCA 4LSNA 3M6WA 4LBPA 2DH8A 5FJ4A 3CVKA 4EFAC 5HO4A 1PKUA 1XR5A 1WHWA 3UVJA 4DQIA 3JYTB 3BGRB 4DLGA 2FLLA 1VBYA 1E6VB 2KHCA 3ENWA 3CO0P 1QJHA 2CZVC 2GW8A 1DQ8A 3FCHA 3VAFA 2XMVA 4WCEQ 1FWKA 2PN6A 1XQIA 4NCGB 1VHFA 2D9PA 5C5JA 4B3SJ 4I2PA 2IRUA 3D3CJ 3GONA 2HFSA 4X84A 4LVNP 3FFIA 2LP4A 4BLGA 2J7UA 4DPWA 2M8DB 2BJ7A 1U1MA 4UT4A 2AZ3A 1XMOF 1RWWB 1S99A 2IRXA 3KLEA 3FZBA 2ILZA 5EHHA 2ROGA 4NCAA 4XAKA 2Z2YB 3CJ4A 5K8OA 1X8DA 4UOGA 4ECVA 4J9PA 3P8BB 2LKZA 1WOOA 2HHVA 4IH6A 3CPWR 4NA3A 1WF2A 1YIJS 1NJWA 3Q23A 3VAMA 1OQ6A 3NL0A 3G6ES 5EX3A 1REGX 3HD2A 3PJXA 2EK1A 2R8KA 4X64F 2RU3A 4FBUA 2HRUA 4LF4J 4DV2J 3QGGA 1EP4B 2BZ2A 3MD1A 4NWBA 2QRRA 3DGPA 3HVAA 2HWTA 3DLGB 1C0UB 2J8AA 1N34F 3NNCA 3M2VA 2GIQA 1IKVA 1BQXA 5M2PA 5KFWA 1HYSA 2KT5A 4A47A 2HGMA 4UZCA 2GJFA 4ZVRB 3GMGA 3DLJA 4F4KA 2G4BA 2FD2A 4N5SA 3VAIA 4Y6IA 1K1SA 1W26A 2X3DA 4NXNF 1PYSB 3DOKA 3I5BA 4IRKA 3SFGA 3FGVA 4X65F 1FD8A 1S1WB 3T9NA 1CJUA 1H6KX 5KTQA 4AL7A 4FDFA 1FFGB 4MK7A 5FIIA 1X4AA 2AEJA 1FRKA 4OX6A 1QE1A 2UUCF 3NCPA 5L1JA 2YX4A 4DFMA 4HTIA 1UWBB 2FY1A 3TAMB 2W9BB 5KFBA 4U8YA 2G2YA 5K8NA 2LA6A 2K3KA 4GMKA 2QO3A 1JLBB 4GVBB 4WFXA 1F5AA 2V0NA 2IMWP 3B54A 2DNZA 2M2BA 4JV0A 3I96A 3L3CA 3T6BA 3MR7A 4EUVA 2BXJA 3QMQA 1DQ9A 3MMJA 1SJ1A 4DSFA 1KTQA 4A8QA 4ZCLA 3DRYA 4WK1A 3BBFA 1MWQA 3NRBA 2PA8D 4A8FA 2ZD1B 2FYXA 2HZVA 2C2MB 3RR7A 1ITPA 3KHLA 5D78A 1LV5A 1SH2A 5HVFA 5CYQB 1D1UA 5THWA 5IC4B 4NEZA 3CJ3A 3CJQA 2QMUB 1MMNA 2XMUA 2XI3A 4PWWA 4DLEA 5D0GA 4FXDA 2IVFB 4J37A 1P9QC 1QVFR 2AJ2A 4OI1A 2VV5A 3QNWB 5LMNJ 4LSLA 3GFHA 4LF9F 1J5OB 1VC5A 2DH7A 4NASA 2HNYB 5DETA 3NWRA 3CJKB 2P5VA 3UD4P 4QYZK 1Y11A 3DM2B 2QL5B 1VQYA 3IWNC 4F4XA 2GNKA 2B6AA 2IRYA 3DRSB 1C1CA 1TKXA 1AZSA 3BO2A 1XNQF 4OHVA 3PW7A 4IG3B 1JXLA 3G6YA 4GKKF 4Q8EA 4OYXA 2W24A 4OJHA 4F0MA 3ZXWA 1W25A 1NPPA 3TAPA 1TL5A 1NK6A 3OPKA 1U8SA 3HJFA 1HHQA 1S9EA 2QA4S 2MKCA 3BDPA 1FRXA 4W90B 2YNHA 3KJFB 3DMJB 2PC6A 4IDKB 4ZK7M 2WBMA 5FDLA 3VALA 2VZ9A 3QO9B 1JLFA 1TL1A 3POTB 3OVSA 3AFGA 4GO5X 2QG9B 3NNHA 5LXRA 1F9FA 4DV0F 5KFIA 3UD3P 1VLOA 4KKOA 3B78A 2KH9A 3HSJA 2UXCF 1S1TA 3GYGA 2HSEB 4MYTA 3V81B 5ITHA 4NRTA 5HROB 3Q2SC 2EC0A 4ES3A 2MGZB 2OKQA 1N88A 4AXIA 3ILJA 1EHWA 2GMHA 5KFJA 4JB8B 5KFUA 4Z7YA 3J81Y 3MR6A 1X5TA 4DX6A 2G13A 5L38A 1JLAA 1UKUA 4R5PB 3HK2A 2UUAJ 4Y28C 4X4RA 1WC0A 1RHMB 4M5NA 4ZN3A 4USMA 2XY5A 2HYIB 4ED1A 2CPZA 4EU0A 1GQEA 4DSLA 4EI2A 4PQUB 2HPUA 2R2SA 2Y8YA 3IMQJ 5IQ6A 2W7AA 1R7IA 1RCXB 3DLKB 1A9NB 5KT7A 1ZTTA 2YQ3A 2APOA 3EVWA 1S1UB 3TX8A 3LQVA 5KFPA 4XIUA 1Y9OA 3V6JA 5EDWA 3G9CA 2MQLA 1MLAA 1RAFB 1REVA 1N33J 3DC2A 4ZLJA 1VQKS 2E9ZA 3W1YC 2N7CA 3RB6A 4ZHRB 1RACB 2VC1A 3MCOA 1KHVA 2IAJB 5A8WB 1S4FA 2J76E 2HS0A 3MXHP 1HHSA 1IUJA 3KJNB 2DH9A 3AB2B 1XK8A 4WYWA 4ZVTB 2CQHA 2HG4A 3CCLS 2OEKA 1O0PA 3T1YF 1KQFB 5AT1B 4ZDNA 2I6WA 3VGSA 1N5SA 5HLFA 2VDHA 3DDNA 1CEZA 2VF3A 2DRBA 1PC5A 4ZKAA 5F8MA 3EWGA 3OR1A 5KG1A 2N4CA 4NLOA 3PY8A 4DR4F 1X5SA 2BE7D 2BR0A 4ZLNA 3L09A 3VGUA 1NJZA 1TL7B 2YY3A 4YDXA 2LA4A 1QAYA 4L3NA 3BO4A 1NSQA 4D3HA 2B4VA 2YKQA 3K58A 2Z2ZA 5K14B 2RRNA 3HD1A 1KFSA 4J9QA 4Y2AA 4LFCJ 5KFTA 3GWCA 1FDAA 1FESA 2M0GB 3AJ2A 3DLEB 1IJFB 1YDLA 4U67Q 1TU0B 1DAXA 2YKMB 1S10A 1AUDA 2XO6A 3SXLA 3RW7A 1FK9B 4DV3J 4HACA 3H25A 1NAQA 4H4KC 2W9AA 1SBRA 4WFAQ 1F5BA 1RB0A 1RWVB 1IWGA 3EDRB 5SZTA 4ID5B 4N8OA 4OJ3A 5L1LA 4CLFA 1VBZA 1AW0A 3TJAA 1FTCA 4IRCA 1NRKA 5IV3A 4K4TA 2DPJA 1FJGJ 2WOMB 1T3NA 2DRDA 4JI3J 2E1CA 1WTBA 2MZ1A 3PZPA 4LUBA 1NSKL 4FYWB 2W01A 4Y2CA 4AL6A 3TQ1A 4P73A 1UWAA 5F3ZA 3PV8A 1LW0B 3SQGB 1RAAB 2Z56B 3H2LA 3M4XA 4LFBJ 3UO0A 3U1LA 3N6MA 1WI6A 2ERRA 3TEGA 4W98A 1WHXA 2B9EA 3MURP 3BEGB 1IJEB 3QZ7A 3B6BA 3MR2A 4FF3A 1N5VA 2MQMA 3A8IA 3HM9A 2OGUA 2U1AA 3GIRA 4DX7A 1OMSA 1V5VA 3DDIA 1WDDA 4HH0A 3NGKA 1NZAA 1PJ6A 2RQMA 2VA2A 3FBCA 3MFIA 1RA7A 3MEDB 4M5DB 5U47A 7AT1B 1QD1A 1U0SA 3DRPB 3R8YA 1WOSA 2Z4PA 3P96A 4I64A 2QIFA 4RW6B 3UFCX 2CDRB 3TP2A 1FE0A 3OTOJ 1TTHB 2OPPA 1I1GA 1CJTA 4O4RA 3GQCA 3BSNA 5JMNA 1B0TA 2DBBA 4QWCA 3FK4A 3M8YA 1HPZB 3M05A 2HLUA 3C19A 1NU4A 5E0OA 1MWYA 2FC8A 1ZOTA 3Q8UA 3PJ9A 3GSDA 1RI7A 3O2IA 2XHWA 5D0EA 3MAHA 1ACMB 2OMLA 2HWHA 2UXBJ 4DV6F 1TK5A 1WELA 3CD0A 2UVRA 2HS4A 4W92B 1N32F 2VG7A 2K1RA 1T95A 5GAGI 4K8RA 2EPIA 2F40A 4P10A 1TMJA 3J81j 2JEGA 1NK8A 1FERA 3M8WA 1RT7A 2Y3YA 1XR6A 2YWFA 4B9LA 3UCZP 4X4NA 3KK1A 1C0TA 2KFYA 4K4WA 1UTAA 4DL0C 3S7RA 5D77A 2X3GA 3K5NA 3KWMA 1TFYA 3PKMA 2XYPB 2LLZA 3ETMA 4GO7X 2ZM6F 1BC6A 2O66A 2G0CA 1HQUA 3C14A 2GQQA 3UDVA 1NZ8A 2BJ1A 4RW4B 3E8OA 3J7YU 2NSCA 3A8KA 3QLHA 3W5YA 4ZPDA 3IA0A 3H5SA 1KBRA 2V4JB 4DV5F 1RADB 5CAAA 4LF7F 4C8OA 5ETSA 2CXEA 5DM6Q 3TWZA 3RBZA 2JFKA 5CYMA 3NCRA 3QZ8A 1RT2B 3WC0A 2CJKA 1VQSA 3BN7A 2Z2LA 5KFVA 2HRYA 2ABYA 2MTLA 1EQ0A 4IG0A 1H7XA 5AJ3J 3J81U 2BVZA 2WK4A 2ZITA 1GFWB 2DNGA 2VKRA 3OXFA 4ECWA 1NDCA 4B3MF 3SCKE 2OD4A 2DIVA 3D66A 3C66A 1MMLA 4H4OA 2V94A 1BY9A 2AGQA 3PKYA 1NSAA 4G6VB 2V2ZA 2HZAA 2ZWOA 5CCLA 2RILA 1HWJA 4IR1A 4LRBA 4BC7A 2WVCA 3KUHA 4A8WA 1RYSA 2G1DA 3H98A 3MR3A 3H90A 1Q8BA 2F65A 1NH8A 4E0DA 4TKTA 4X62J 2FZGB 2MXYA 2CNNB 2CQBA 3ITHB 1Q5VA 4MK9A 3M8PB 2D3OR 3CO9A 2CJ9A 3CNQP 4PRFA 3CUNA 2CYYA 3IO1A 2CKWA 5EN1A 2WONA 3GCXP 3J7ZT 3M2UA 3V6KA 4M5KA 2OPRB 1TELA 4FN5A 1FNOA 3RTVA 4ED6A 3Q8VA 4DQPA 3C6UA 2N3OA 1UL3A 3G82A 1FA0A 4W4MA 2IHR1 1D9FA 1N48A 5IM0A 5KFAA 1XNRJ 2R7VA 4ALZA 4KSEB 3KMQA 2BQUA 2E1PA 2VKZG 3W63A 3ZTPA 1U24A 1WKLA 4ZOSA 2GJ2A 1RTJA 2FIUA 2FDNA 4Q0BB 4YR0A 1NK7A 2YPYA 4IOCQ 2M8HA 1JB0C 3H59A 1WUUA 4JI1J 4OZ0A 5DDRC 3N5BA 3C3LA 2JHEA 4J90A 3EX7B 3EUNA 4M5MA 5L9XA 1YGYA 3CB4A 3FEXB 1FO1A 1YWXA 3TO8A 2DPIA 1GT8A 1URNA 1JKHB 5CQGA 4A8XA 3MM7A 5ETVA 1XIQA 2DK2A 3TZWA 4URQU 5AXNA 2XLIA 3W5XA 4TU9A 3PFOA 4ZPCA 2RJZA 2N7YA 1ICEB 3CCWA 1UP1A 1I6JA 2AQ4A 4PKDB 4WBFA 2O3DA 4OZ1A 3QT8A 1NHKL 4X4QA 4JI6F 2ZC4A 2RS8A 3Q86A 1Q16B 3C16B 3ETOA 3WX8A 4DJBA 1FE4A 4ZVQB 4WP8A 1M90T 3BGRA 1GXLA 1RK8A 2DEIA 4QCLA 1N36F 4K4YA 4YEAA 2BKOA 2AD9A 1Q4RA 3GTYX 4CNZA 2J6SA 4NCGA 2BX6A 3H4BA 4QZVB 3EPIA 1S6PB 3BBBA 4FVCA 4LR9A 3I55S 5LMUF 4QIGA 2IBKA 2N4DA 3OTEA 4HDGA 5CABA 5L1IA 1R0AA 2V8VA 3HULA 1TVRB 1H7WA 2E66A 1YJNS 3QJJA 2CPYA 2J6UA 4B9SA 4YMEA 4DFKA 4PCQA 3RAQA 1HNVB 4MK8A 1VCTA 3D3BJ 1SQEA 4G1QB 5HMZA 3E3XA 1S0VA 5T41A 4EBDA 2NQPA 2E1AA 2R2TA 1N5TA 3ONQA 4G3IA 3OTCA 1DZ5A 3GSIA 4F4ZA 1U6ZA 2FJBB 2BRKA 3Q24A 4Q2LA 3GIJA 1H2UX 3HZGA 4XDDA 4X4TA 2VQFJ 2DKOB 2CJBA 4JV5J 3W8PA 1EP4A 3GPAA 3M1VB 4YY3J 2Q6CA 3DLGA 2JH3A 4Q43A 4M8LA 3KJQB 1RT6B 1VISA 2RDIA 2L3MA 2ACMA 2W4DA 1OS5A 1CQMA 2HQGA 4CCHA 2QLBB 2V63A 2B56A 3FSIA 3EGZA 2B4PA 4ERDA 4C3LA 2CJYB 2ZH3A 2XGQA 1V3ZA 4EEYA 2B7CB 2C2ZB 4WWSA 4B3SF 2GC8A 1FF2A 3AH6A 2R8GA 5KT2A 3MFHA 1OJ4A 4CYUA 4ZLPA 2CIMA 3GJSB 1TAQA 3ZZUA 2DNPA 5EUHA 2KDOA 5E3CA 1JJHA 3QYYA 3X1LB 3NGUA 2EBGA 3MPDA 4JUZA 2JWNA 5E7OB 4ZPAA 2BE2B 2W9BA 2I8EA 3AA8A 2G9OA 5LJ5Y 1O6XA 4C9DA 4KIAA 2FJWA 1BQNA 2DNLA 4GVBA 1JLBA 1A0OB 4E2FB 5KG4A 1FDDA 1IM6A 5DZ6A 4PQAA 5E33A 5C7PA 1S57A 1GTEA 4U7UD 5JVGQ 2QTWA 1XEZA 3O1LA 2JLGA 1EARA 3ZZ0A 4WFBQ 2HVIA 2YBVA 1FNMA 4DUYJ 4LF4F 4K2JA 1WACA 1DBDA 2MKJA 2UU9J 1UMJA 2ZH1A 3SFUA 1S12A 3EICA 1D09B 3ISNC 2E1RA 1IVZA 2B3TB 4ZJOA 5DJBA 2NXEA 1SKUB 1RJJA 5A2QU 4NE9C 4IQXA 4FXWA 1P6TA 2QV6A 1IXKA 2LDIA 1U1PA 1U02A 4WFZA 2BJEA 3VZHA 4CNYA 4KRWA 1ZZFA 5J2MA 1YHQS 4YB5A 4E8UA 3BV8A 3CJ5A 3M2RA 2CA9A 5ETKA 2VOPA 4K5SA 4KHMA 1R3NA 2EFNA 3Q8PB 2YNGB 2QLJB 4I2PB 3OLAA 1DY3A 1PG5B 2VQEJ 3Q2TC 4KC5A 3FFIB 3K2YA 2LQJA 3LGNA 3EJMA 2FZCB 3QT7A 2CPFA 2ZOFA 4HH1A 1NH7A 4NLDA 3KLEB 4U8VA 4O44A 3DRSA 5L9NA 2ADBA 3QFWA 3T1HJ 3MEGA 2VFVA 4A8SA 3NKYA 2RDDA 1H38A 3V4IA 2AV5A 1FRLA 4FZVA 4J7CA 3ZNJ1 4JP8A 3D0HE 2DNNA 2B4UA 2HHXA 4I2QB 3OLBA 2DY1A 1IBCB 4CP5A 4UQTA 2UVUA 3IWLA 2V67A 1JX4A 3SCJE 2IYGA 4OZ3A 2MPUA 1N5YA 3N6NA 5F8GA 5DDQC 2F1FA 4CLZA 1K1QA 2MKYA 3PDNA 3DGPB 1R0BG 2VU5A 4F0KA 3NS5A 1NMEB 4P9SA 3M2VB 2A0FB 1IKVB 2BANA 3MHYA 1HYSB 1JJCB 3AHPA 1EIYB 2MQ8A 4NEYA 1APSA 1PJ7A 4WXWA 2DNYA 2EBEA 1HW8A 5HROA 3R5GA 5LMNF 4OHWA 2KG1A 3A8EA 3TUIC 3F0NA 1S72S 4CO3A 4H54A 5EWEA 4WPAA 2YKPA 2HHPA 5GAHI 1CJUB 1TKTA 3D5MA 2FB0A 3TARA 5AXLA 5IT9Y 5ADZA 1KONA 3I4PA 1CJVB 2BOPA 1OO0B 3B4DA 3FKBA 3M7VA 2A6MA 2K7JA 3QRRA 1OPZA 4MAKA 1VBXA 1XBWA 4C98A 4KFBB 4PQUA 2KRRA 1V9OA 3HI9A 1CVJA 1HI8A 1EJ7L 4DL2A 1IQZA 3DLKA 1WC3A 3VAKA 3RRGA 4TN2A 5HATA 1NKBA 1RBOB 1PYTA 1VQ5S 4MH8A 2NPIA 5CZXA 1PBUA 3JB9k 3MTKA 2E9RX 4TY9A 2O5DA 2DXEA 1HNXJ 2KM8B 3IXQA 3MPUB 2IAJA 2UV8A 5A8WA 2W4PA 8ATCB 1EKRA 2OELA 2PEBA 5A76A 3UR3C 5HP1A 4O3PA 2DNOA 2VHGA 4E98A 3N9UC 2VA3A 5IV4A 2XM3A 2AKWB 2HS3A 4LSLB 1KR4A 4ED3A 3HF5A 2BACA 2B8QA 2VDIA 4B02A 3HLUA 2DGXA 3RBXA 4R8UA 4ED2A 3QGHA 2W2NP 3SMZA 2UUAF 1S97A 4F36A 3PX4A 3JTOA 3KK3B 1PIEA 2D1CA 3DU6A 2CADA 4AE5A 2B6AB 1NPRA 1TL7A 1YJRA 3BKTA 3P45B 1C1CB 2FVRA 2NR0A 1TKXB 3ZTOA 1AZSB 3QFHA 4L76A 1L3VA 2XMJA 2SXLA 5JVHQ 1R43A 3MM8A 1OSDA 3BGUA 2ZBRA 3I0RB 3RRKA 1NHUA 4DXLA 1PC4A 4OX7A 2YKNA 1D8ZA 2DB1A 5C2CA 3T3FA 1S9EB 4LQ9A 2M7SA 3K17A 1SQGA 3MECA 1N8RT 1R27B 3IR5B 2YNHB 3SIPB 1N33F 4C7QA 1Q53A 2V50A 4IO9Q 2K2PA 2XMTA 4DUZJ 2EFPA 5FDLB 1JLFB 8RUCA 2ADCA 2HFZA 4DWIA 1X4BA 1VYAA 2EWHA 3VF0B 4O3RA 3KLVA 3EZOA 2AZ1A 4TY8A 4NL5A 2ALZA 1RLCL 1S6UA 3JAMY 1JLGA 2HNZA 3OJUA 1NLKL 2QEXS 2KZMA 4KKOB 4OX9J 2K8GA 4H4KA 1S1TB 2WOMA 3T6JA 2Z57B 4PG8A 1BE4A 2JL9A 3GZ7A 1BWVA 1KS2A 1RZMA 3D6TB 4USTA 1Q8LA 4DSIA 3DOLA 1YRTA 1SB6A 3MMBA 3WIUA 2GCFA 3CGIA 2ZH5A 1HW9A 3PM9A 4DR7J 3LWMA 2VODA 3KFWX 1DJ0A 1JLAB 5GAGU 2ZBIA 3K5OA 3NAIA 2F7VA 4ENOA 1MNEA 4M5HA 3UDLA 2R7UA 1SVDA 3GJRB 2DT9A 3JSMB 4C8MA 1K0VA 4LFCF 5C25A 1X9SA 2P8IA 3R1HA 3OW2R 3BREA 2QX0A 4M5LA 3MEDA 4BS2A 4HHUA 4JV2A 5H1SV 3MWBA 3DRPA 2YPZA 4ELUA 1G4CA 3LP0A 1HKAA 1BXNA 1DRZA 4DFPA 4DV3F 5DLGA 1E6YB 4DL5A 1TL3A 3MM6A 4RW6A 3D0IE 1YTYA 1REVB 2EVZA 3TOQA 4F04B 1JLEB 1N0UA 4X4SA 5KFXA 4FNIA 3UR0A 1YJ7A 3Q8YA 2LQ8A 2F8MA 5CD4H 3NGDA 1LQ9A 3CCUS 1FRIA 2V68A 4M5IA 4K0KJ 4DL7A 4FS2A 1FJGF 4JI3F 5B0GA 4ZVSB 4DPOA 2G0JA 2XZTB 2RT3A 4AFFA 2ZWPA 1RA6A 1SIZA 4LR7A 3BO3A 4NA2A 4WFYA 4ZP9A 4NI2A 5KFHA 4J9MA 3EGNA 1F60B 1M0SA 3BN4A 4JI4J 1UJ4A 1U1RA 1KFDA 4CM2A 3TR5A 3OR1B 2OTJS 1NXIA 2ZKUA 5KAKA 4LFBF 4FF2A 3JSBA 1SV5A 2YH0A 3CC7S 2R7XA 4Z7CA 4EO8A 1RAHB 1FX2A 3LW5C 2OPSA 3ZTSA 1WJ9A 1ZBTA 1Q82T 2LCWA 3GFYA 2R7SA 1HNZJ 1RAIB 2LYVA 2W8KA 1TK0A 1JNRB 4LF5J 4Q44A 4ILRA 1SC4B 2E5LJ 1Q7YT 4ECXA 2KG0A 4O23A 3ET6B 1GMVA 1LK7A 4NXMJ 2V4JA 4QU6A 3M6XA 4J5OA 5HL7Q 2AIRB 2H5EA 2DR8A 4FKYA 3GCWP 4OZLA 2NZ4A 3OTOF 5LXYA 4HACB 1RT2A 2FY8A 1MN7A 5DQGA 3MUTP 5KFLA 1XWLA 1BGXT 3PR4A 2HVHA 1SL0A 2G2OA 3M30A 2RKIB 3K89A 5IT9U 3D6MB 5D0HA 2PA3A 4C11B 4CZCA 3OD2A 3G71S 2UXBF 3KLFA 4MJKA 4LF8J 1VRTB 4CO5A 3MMAA 2XYGB 2P6SA 3FBFA 3R7SB 1VQLS 3TANA 3CCTA 2DY9A 4J9NA 2X51A 5M2UA 3PR5B 2V8HA 2LQ9A 2PIIA 1BUXA 4OFZA 1RT4B 3PO5A 1SC3B 2XTJP 3QRQA 2R2RA 3PJWA 1VRQC 1W2BR 4LF1A 1NPKA 4ETXA 4OYOA 4S0MA 1IM4A 3QAUA 2D3UA 3BKUA 1NCLA 2OPRA 1RT3A 2C3UA 3PIOQ 4FYDA 2KT2A 2ATLA 2FHJD 2VPXB 3H5YA 2HHUA 2F8HA 3TJ8A 1U6FA 3IBFB 2GIFA 2QYCA 2FVSA 1NB2A 4RUBA 1PAEX 4TLRA 3ISND 3ELHA 1U45A 4C0BA 1UA1A 3V2UC 2Y0BB 1TR0A 4D3GA 2I1RA 3HP6A 2GAHC 3DFEA 3W66A 1FNXH 1CJTB 2A1BA 5AJ3F 3HMJG 3D7SB 2HIQA 5L39A 4BBYA 5I3UB 2QZ8A 1WEXA 4HL9A 5D4PA 1CBKA 1CLFA 3TZYA 2NREA 2KO1A 5IZHA 2FGOA 2RSQA 4PEOA 4PG4A 2YWWA 3IFEA 4U7UK 4NLUA 1BWEA 2RU9A 2ZH2A 2IIHA 4OIXA 4FYYB 1YG0A 5GAEU 2VG7B 1L3KA 2KT3A 4ZLLA 3CXCR 1JKHA 2MKSA 2GS8A 1UVKA 5F9LA 5C2GA 4X62F 4L74A 2VH7A 4C48A 4EWTA 1RT7B 1DURA 3VVTA 4JI7J 3KK1B 3M32B 2GHWA 1C0TB 2XI2A 3RAMA 2O1PA 3DNCA 4L72B 4ED8A 1O51A 2MSSA 3MTJA 2DHSA 4OHXA 4MKBA 3UCUP 3QT5A 3KNGA 3W9HA 4EYIB 5DGAA 3C46A 3A3OB 2L9DA 4USIA 1HQUB 3C14B 2HNDB 2HWIA 2HVEA 4RUHA 2CWKA 1SKSA 4OV6A 7FD1A 1WEZA 3QLHB 2JEJA 3GB0A 2XS2A 1IWAA 1N4LA 3C6TA 1NEEA 3IAM9 3THVA 3AD9C 2JDJA 2HGNA 1XNRF 2UZAA 2CNKB 4NMXA 2FJDB 2U2FA 3SDEB 3D6HB 2DITA 4DDFA 2KXFA 1S6PA 2JZ5A 3NS7B 2DRAA 4IG0B 5C42A 3GLJA 2BDPA 3ZC4A 3FDSA 4CT8A 4RNMA 1KOOA 2VFUA 1QSSA 4JI1F 5GADI 5F8JA 1J5EJ 3HSGA 5KFKA 5HJYA 3CTRA 4H4OB 3KNAA 2NXCA 3BB5A 2B9XA 3HKWA 3W2WA 4QW8A 3KG4A 4KB7A 5A6WA 2VPZB 2ZE2A 1IBMF 5E41A 3W9IA 4OYZA 4AUKA 1Y3JA 1YJWS 1RWUA 4RR5A 4F50A 3ULHA 2FTRA 3T5LA 3DXSX 2EK6A 2ZNZA 1Q0NA 1S59A 1J27A 1FKOA 3M6UA 1Y5LB 4CLSA 3F56A 1LXNA 2E7XA 1X31C 2FLNA 1FXRA 4CH1A 4Q5VA 2QE5A 1U47A 2QJ3A 2LMIA 2C2DA 3A1YG 1YRXA 2W2PP 3OR2B 3PIPQ 2E5JA 2W7PA 4OYBA 4C0HA 3AT1B 3M1VA 3NCQA 3LWLA 1L3TA 2CQ4A 3HFZB 2WONB 4G1PA 4B3RJ 2QYGA 2Y1IA 3LAMA 5K9FA 2F4VJ 1NUEA 3G6XA 2XYHB 4WTOB 2X1AA 3R1LA 4YR3A 4M5JA 4DCOB 4IH5A 4J9OA 3HSDA 4WTYA 4O0NA 4PWUA 2AYGA 3DHWC 5AE1A 3G82B 1N0VC 2KXHA 2FQQB 2R3VA 4IRDA 4FF1A 4NLTA 5B0AA 4A48A 5IM0B 1URRA 4ICLA 2G0IA 2DGSA 2RB7A 3PRBA 4KJIA 2UV8G 2IC3A 3AOAA 3T5JA 4KHRA 4J9LA 4J9SA 2J5AA 3E51A 1U1OA 1Q95G 2CVIA 1YJ9S 4DZ6A 3DN9A 1RTJB 2BE2A 2FJAB 2V6AA 5KFFA 4CI0B 2YWEA 2H3EB 1FRJA 3MI7X 4UOHA 3N79A 5CH7B 5DQHA 2ZH9A 3V5RA 2PE8A 1ROFA 5K20B 1PO6A 1IKWA 4KV8A 3IG1A 5KFSA 3TQEA 1QTMA 4TU8A 2GZOA 3CJ2A 5H9FK 2GA7A 3MM7B 1R6YA 2AYMA 3I56S 3KDNA 2JSXA 4NLWA 4QIWD 4QPTA 2VQFF 4JV5F 2JEIA 2J9EA 2OTLS 3DYAA 4YY3F 4UY85 5KT4A 4TNOA 1AA1B 2KFNA 5D4OA 2CVEA 4QWDA 1WHYA 2FHJA 3DDKA 1VQOS 4AXJA 2GMJA 1YJVA 4ZITA 5J1EA 1YI2S 2A2DA 1C4CA 4WKRA 2IMOA 2W7OA 3W62A 4LRDA 1R8HA 3LP1B 2QMWA 1B0PA 2HVZA 4C0OC 1GX5A 3W65A 2YNGA 1VIXA 3QT6A 2OFGX 2Z2MA 3I6PA 4NLXA 1UVJA 3OL9A 4TYBA 4F4YA 3NNAA 4QIVA 1R0AB 3QSYB 2M3DA 3MOJB 3EVMA 4NX9A 3BYPA 3D6FB 5DDOC 3VAJA 2DXDA 3K59A 2WZ1A 1GNKA 2HHHJ 2C3PA 2J9DA 2OSQA 4WJBA 5KG6A 3IBCB 3O44A 2CJXB 3M8SA 4G65A 2AU0A 2YKOA 3NS6A 3VCDA 4DQSA 2QA4G 1KQSR 2OJ3A 1HD0A 3RGIA 4CLUA 4I2QA 5M2RA 1X4FA 4DUYF 2UU9F 3P4UB 3KTQA 4NYZA 1S79A 3GJQB 4P2FA 4QR0A 4L3KA 4K2XA 3BDEA 3OXLA 3OV7A 2KXNB 4X4VA 2FHOB 4CQ1A 4JI5J 1U1LA 1T05A 2UP1A 5MAOA 1ZM2A 1KD1T 5A6PA 1MWZA 1IBKJ 3LOUA 3HX9A 1OSCA 4RL1A 1C1BA 2A10A 2XHCA 5KG3A 1VS3A 6FD1A 1FVQA 1UPPA 4FXVA 4DV7J 3PNIA 1B0VA 3DRXA 2M70A 2YTCA 3UCGA 3PEHA 2QL7B 2FHMA 2VQEF 4CYUB 1LW2A 1GMUA 4MMOA 4HVZA 3OL6A 2RRAA 4B9NA 2GFFA 2JJ4D 1CJVA 1AB8A 3G86A 2MJUA 1U26A 4TQRA 3HVTA 3T1HF 2GAGC 3QJPA 1BQNB 4KFBA 3THPA 1JK9B 4ANEA 3HHNB 2WSEC 5G4DA 3KLHB 1T9XA 2CQDA 4BCAA 3R3TA 2MKIA 1XMQJ 2CQPA 3UDCA 4RBVA 1NK0A 2COLA 4RBUA 3GV8B 2RQCA 4ZCMA 2HQCA 4YB7A 5C24A 3HFKA 4DS4A 4XPCA 1F3FA 2F8EX 3TA2A 4P2XA 4HR2A 4DN0A 2V8DA 2QGFB 4ZVEA 2ZDOA 2ZJPQ 4OMFG 1U4BA 1T0TV 3F41A 1Y7PA 2GGPA 2OEJA 4FYVB 1IR2A 3CCSS 2QSFA 2B0GA 4KGXB 2FPHX 3D2WA 4EMDA 4QIFA 1Y00A 2HFOA 5J2MB 4DL6A 3M2RB 3W8GA 4PR6A 2MDAA 1S48A 3I31A 1YBTA 2E29A 2XMKA 3O5TB 5JUMA 3VQTA 2RD5C 3TAQA 3IRXB 2AW0A 4URSA 1SCJB 4ZN1A 3U1MA 3CIMA 4QWEA 2IM2A 5HSPA 3BYRA 3KK3A 2Q1LA 2OP5A 3LPYA 3GG1A 1W2IA 3JSYA 4ZIVA 5ETMA 1XC9A 3AAWB 3ZZPA 4O44B 1XERA 3WHIA 1PILA 4ECYA 3MEGB 4EK2A 3PFEA 4P75A 2XQCA 1T11A 4K4SA 1X60A 4I6YA 1KDNA 3I9ZA 1SH3A 2UVVA 3V4IB 4UY8T 1ZM4A 1F2GA 5ETOA 2MQQA 3KLGB 3I0RA 4F8RA 4PZVA 3OSNA 3OFEA 4G1IA 2J0QD 3KLIA 2LQBA 1X9MA 3I5CA 2OLWA 1AROP 2L48A 4QIEA 1F9HA 4DQQA 2HZCA 5D4LA 4ZVFA 1N5YB 1HNXF 5KFNA 3RUBL 4AD6A 5H9FJ 1WTFA 2VFRA 3DLLQ 3GR1A 3CJRA 3D54A 3G4SS 2DNKA 4Q8FA 2BANB 4J9RA 3RBDA 4K7QA 2HIYA 2ZDPA 4BWJA 3KK2A 2L41A 2W9CB 1TKZA 2BQRA 4LF6J 1ELOA 3NY0A 3CD6S 2IY5B 2DD8S 2DHXA 5L46A 3FCWA 2ZH4A 4RPFA 1TKTB 1VJQA 1EKSA 3S1TA 4CLTA 3OUYA 2O67A 4P74A 1DFDA 1RHUB 4NLRA 6FDRA 3GU0A 1U09A 2LDYA 1S76D 2M88A 3JSMA 2H48B 3PYDA 3UE2A 3TA0A 2R8IA 2R2UA 3T5HA 5DZ7A 1U2RA 5HBMA 3C15A 3DXBA 3J80Y 1GK8A 4ES1A 2A3JA 3QJLA 4PYAA 2B9WA 1I5OB 4CLWA 4CH7A 4OLOA 5EGYA 3HHDA 4RX6A 2Y9HA 2ZC3A 3OSPA 2MLYA 3Q89A 1E6YA 4DUZF 4K59A 4YB6A 5A8KB 4WU2A 4USKA 1WC1A 1JLEA 2QL9B 4LFAJ 2V8PA 3CT9A 3SEOA 2XC9A 2NXNA 2A6OA 3M8ZA 4DS5A 3ILLA 5K8MA 3BF4A 3BZQA 2MQNA 1S7IA 1RKJA 4DR5J 2VBZA 4F7VA 4DR2J 5HP1B 3I5AA 4DPTA 1EQMA 4OX9F 2ZKTA 5KG5A 2ROEA 2XLJA 4ED7A 4K4VA 3FQKA 3D1QA 3TZXA 1U1QA 2K7KA 3T41A 1YSJA 3VTIA 1QDUB 4UUXA 1WC6A 4DR7F 4AT1B 4R8UB 4WE1A 1KEKA 1Q8IA 1R31A 1SQFA 1RTHB 3F73A 4EO6A 2BUNA 4V19J 1SJ4P 1FXLA 4WZMA 2B7BB 2C2EA 1PYOB 2FGCA 3VAHA 1VK3A 1VQNS 4CLLA 4PXBA 5HI7A 1BD6A 1T94A 2F5GA 1TFWA 3EVOA 1VQPS 3R5JB 1OYDA 2EI5A 4OX8A 3MM8B 2ZH8A 2MZRA 2BEFA 1SL2A 2C3MA 2JFDA 4B9MA 4KAIA 3ET6A 2BM0A 5T14A 2YKNB 1D3WA 3HT3A 1UPMB 3CDAA 1SL1A 3OTBA 2GMLA 1JIHA 3MECB 3S8SA 2MLZA 5B0FA 1HBOA 2HAFA 4I1TA 2XMMA 2YWHA 2NPFA 5I42B 3NG8A 4F3MA 2PMWA 4A8YA 5KFDA 3KG0A 1QVGR 2KHDA 1WNEA 3V6HA 1UZDA 1S9GB 3FMWA 1RU2A 1HBMA 5SUHA 3M8QA 4Y2MA 4TY8B 3AOBA 2ZFHA 2RKIA 3R5CA 4K0KF 4DSJA 1F1BB 3MM5B 5ETRA 1JLGB 2HNZB 4LRCA 4C11A 2HGLA 5DLFA 4FKXA 4HLBA 3MMCA 2R7TA 2KJVA 2PGCA 5ETLA 1VRTA 3QGPA 2ASDA 4JI4F 1FVSA 1GAOA 1WG5A 4ZVGA 3JQMA 3RYLA 1T8EA 4ZPTR 3DOLB 2AJQA 1O8BA 3TZZA 3MMBB 2V9WA 1OYEA 2WVBA 1IR1A 2C2OB 3E01A 4ZJLA 1RT4A 1KP6A 1Q5YA 3MAQA 4WU3A 2ASLA 1C4AA 1I94J 1RDRA 1HNZF 1K0TA 5B0CA 4LF5F 4C3KA 2E5LF 2KN4A 1HQEB 5C25B 4ER8A 1P27B 4DSKA 5F8LA 2ATCB 3EGVA 4DU7A 4LIWA 2R8JA 4QYZJ 4NXMF 3CCVS 1Q1KA 4ZVPB 2ZVSA 1ZAXA 3AJDA 3KYLA 3OXGA 5HMWA 1R8CA 2MHEA 3LP0B 4NOHA 4F67A 4QYRA 1TL3B 2E1MC 3MM6B 2P2CB 1YBUA 2VIHA 1RYRA 1Z2ZA 3M6VA 4PXEA 4IOBA 1RT5A 6AT1B 5I3UA 3EM1A 2RNEA 2V4QA 2NUHA 4KGZB 5GVQA 1T9WA 1VQ6S 1K47A 2YX1A 4LF8F 3L7PA 4NCBA 1D9AA 1HMVA 3PHEA 4JI0J 1H0HB 4YDDB 1IKYA 2ZBQA 3LGMA 3X3UA 4NI2B 2C42A 3GILA 4ZVOB 3PYEA 2RDJA 3AODA 1D0EA 2Q3PA 2X1GA 3W2VA 2F4FA 2ZVIA 1KC8T 3FUYA 2FHKA 4ED0A 3MD3A 3CC4S 1S7HA 1SV5B 3NWGA 3WDOA 3M32A 4QR2A 4AYBD 1QUPA 3J7YI 2OPSB 4ZVUB 4DR3J 1X5PA 5JJBA 3AD7C 1SKRA 3HHLC 3ZTQA 2BA9A 1JJ2R 4LVOP 2BMBA 5KG7A 2HNDA 5E3AA 2DYAA 2RVJA 1CC8A 4V19X 2YVSA 2LU1A 2QLWA 4QBUA 1S1XA 4C2MA 3NLCA 1WF1A 4RZRA 1UVNA 4DL4A 1MG7A 4DMZA 5D3GB 5G0RB 2IPOB 1SXLA 4UW2A 1J2VA 3SDEA 3HHLB 3DRRA 2MHNA 1S6OA 4P6QA 1U0HB 2M9KA 4RW8B 3TRGA 5DO2A 4BHQA 3O6QA 2B8PA 5KFCA 2HEKA 2WB4A 1Z1ZA 1TL4A 4B17A 3THTA 3ILIA 3M30B 1S6QB 3BH6B 1H3DA 4P7VA 1FTRA 1LWFB 4ILLA 3EPGA 1VQ4S 3KLFB 2HQ3A 3LF0A 2EFOA 4I7FA 2M4MA 1UEVA 3MMAB 4P2SA 4PYDA 4DL3A 2BRLA 5D15A 1GMWD 2GIRA 3AXMA 3KKFA 3OBIA 2VG6A 3A12A 3CIZA 4KH1B 5J2QA 5KFQA 4JI7F 4ZMMA 2FUG9 3CJ8A 1F2HA 5CZVA 4FS1A 2KI2A 1UFKA 3R27A 4EBEA 1QLNA 2AWZA 3IN5A 2D3ZA 2W25A 2WSCC 2FLPA 3TUPA 4WYLA 3OR2A 2JVOA 1NK9A 4O0IA 3NEKA 2UUBJ 3S01A 3SSQA 2YNFB 1HHTP 1N6QA 3G6VA 5IT4A 3SCIE 1RT3B 2F9JA 1UW9A 4NLSA 3HPOA 3KHRA 2CQ0A 1VLYA 5F0WA 2ZOGA 1RHJB 1LFPA 3G8QA 4MFBA 3BH7B 2YX7A 2H54B 3P49B 4KQZA 2G1HA 1TKDA 3CWJA 4ID8A 1DHMA 4OL8A 4HTJA 5E3PA 2N82B 1X4HA 4P52A 1Z4UA 3PYFA 3IM8A 1ZS6A 2DXFA 2LQ5A 5F8NA 1Q86T 4J91A 2V4RA 4ETZA 2WW8A 1J5EF 3FBBA 3MM9A 4RU9A 4XK8C 5E2QA 3MCSA 1SJQA 4IFYA 3T5KA 1ZH5A 1PSDA 1MU2A 4DPUA 2LXUA 1RHQB 2L9NA 5IFMA 3ENQA 1R0CB 3OHBA 2QA2A 2LEAA 2AEMA 1SC1B 5KFGA 3RW6A 3N28A 4UOCA 3CMES 2ZZNA 1UEUA 2GJIA 1M1GA 1X4EA 1UCNA 4B3RF 1A7GE 1LWEB 4ZPVR 4H4MB 1VHIA 1YZ7A 4IFVA 2VL1A 3AY0A 2F4VF 5T7LA 1TP7A 2QSWA 4LQ3A 1HBNA 3FVYA 3JTPA 2BABA 5D6GA 4Y3CA 2W8LA 2RH3A 5AXMA 1WI8A 1UETA 4IO1A 3C6TB 4J9VA 2HQFA 1MMDA 1GTHA 3LP1A 2W2OP 3FNNA 4RNNA 4AQYJ 4RW9A 4OYMA 2C3YA 1XMBA 2LEPA 1X0FA 3KHGA 5KT5A 2JOQA 3QATA 4WP3A 3P3DA 3D9BA 4CO4A 5C42B 4TU7A 2BW7A 4YHHF 2HKEA 2VJVA 2DHHA 4BWMA 3Q8QB 3BQ2A 4ZJQA 1M5PC 1FXDA 3G8SA 2IBOA 3W2WB 2FZKB 2V5HG 4ECTA 3R7BB 2MYFA 2ZE2B 4ZPBA 2GQ2A 1N54B 2DGQA 4NYPA 4L75A 2VOOA 5F3TA 4Y2KA 1RTIA 1LK5A 2IDLA 1FKOB 1FHTA 2DGTA 1RWXB 1H73A 2YH1A 1SC6A 2OEMA 1B4SA 2BM1A 1RAGB 2CG4A 3GG0A 2UXDJ 4PG5A 3BM7A 2E5IA 2CNLB 3A8JA 1TUGB 2FJVA 4HT5A 2XSJA 3H40A 2OUGA 1ZPWX 3HCXA 4B3TJ 4HI1A 5F8IA 3AXKA 4ZP8A 1XJWB 3LAKA 3P6YC 4OHZA 4MIBA 1LWXA 3ISZA 2C2NA 5A0YA 1KHWA 1HNWJ 2VFTA 4KO0A 5DQIA 2W4CA 1JQGA 5EX0A 2OSRA 4ICLB 5I4MA 4J9KA 4GC6A 3ZZZA 2IC3B 3TVZA 2C3OA 3KJVA 4XTTA 1Y10A 4USUA 1UJ5A 1FJ7A 1BLUA 4C3MA 2ACYA 2AJ4A 1X9WA 1ZA2B 1RHRB 4I6AA 2HHHF 3CCES 1ZM3A 4KE5A 5I3PA 3R2DJ 3LA0A 2CQIA 1T9UA 2OIHA 1TQLA 1NDPA 2Z30B 3ZZTA 3FRZA 3HT0A 1IKWB 2DJWA 4KV8B 3HKZD 3L9ZA 3IG1B 2GVDA 1GMWA 4DBQA 3KLHA 4N8NA 4BC9A 4DEZA 2EEYA 1M5HA 2CRLA 1JMTA 5GMKa 4B9VA 1CG2A 5KFYA 5IWAJ 1LFWA 4MT1A 2E5GA 4GKJJ 4UF4A 4IYQA 1T02A 1RTZA 4DV2F 3MPVA 2YQ0A 1QSLA 2VB6A 4RW7A 3D68A 3DYAB 3SI8A 2A18A 1Y4ZB 1YX2A 4JI5F 4RO0A 2RIJA 2RMLA 1IBKF 4KGMA 4EGLA 2DCLA 2AJ0A 5L1KA 3CMAS 3TNVA 2RHQB 1WWHA 2AMCB 2BKPA 4UTGA 1FRMA 5J1EB 3RJMB 3RB0A 4DV7F 3MGJA 3A13A 4I67A 2VG5A 1PAUB 5AE2A 1B7FA 5GMEA 1JWWA 2P9GA 2NS1B 5DG7A 2V34A 1M1KT 2LVWA 4LJMA 2HK2A 4B9TA 3I32A 3FSYA 4IH7A 2XEXA 1NKCA 1CPZA 3PTWA 3IRXA 1TV6A 1DARA 3PACA 3K8WA 1CQNA 2MZSA 2VD3A 5LSRA 2WCXA 2B43A 2R4FA 4ES2A 2CZ4A 2RQ4A 5CXTA 4OQJA 1GH8A 2ILYA 1X4GA
chains in the Genus database with same CATH topology
5KG0A 2VBWA 3DHXA 3BR9A 3CJ2A 4JYAF 2GA7A 2MXYA 2D7SA 2CQBA 3VQSA 2VUGA 3MM7B 1R6YA 3ITHB 2AYMA 3I56S 2KU7A 1XMQF 4MK9A 3CDEA 4A8MP 4HT7A 1SI9A 3M8PB 2JSXA 4NLWA 2B4OA 3Q22A 2D9OA 2D3OR 3CO9A 2CJ9A 4QIWD 4PUOA 4QPTA 2DO0A 2XWYA 3MEEA 3KLGA 4HYKA 2M5YA 4NLGA 4PRFA 1YITS 2VQFF 3U1NA 3RB3A 2B5JA 3CUNA 2CYYA 4JV5F 3IO1A 2CKWA 2JEIA 3BR8A 4RW4A 5EN1A 2PSZA 2WONA 3J7ZT 2J9EA 2OTLS 3M2UA 5KFEA 3V6KA 3DYAA 4YY3F 1YJTA 3UNGC 4UY85 3HO1A 2OPRB 2YNIA 1DLOA 5KT4A 1NNDA 3K7RA 4TNOA 2R7OA 4DX8H 2KFNA 1HARA 1VK8A 3FSXA 2QA1A 5D4OA 5LT5A 2CVEA 4FN5A 4RWWA 1UA0A 1RT1A 1FNOA 3RTVA 4ED6A 4QWDA 1K8AT 4ELVA 4DQPA 3C6UA 1WHYA 2QLXA 4LMZA 4CT9A 2FHJA 3DDKA 2N3OA 1UL3A 1RTDA 1VQOS 4AXJA 2IM0A 1FA0A 2GMJA 2RF2B 1YJVA 3KMSA 2IHR1 5KFOA 5J1EA 2R8HA 1YI2S 2A2DA 1C4CA 1D9FA 2KTQA 2NLWA 1T05B 1N48A 4WKRA 3WZ0A 5DDPC 2IMOA 5IM0A 2FVQA 5KFAA 2CPXA 1XTZA 2R7VA 3IR6B 4ALZA 2W7OA 2VPYB 4C8YA 4KSEB 3NBPA 1Y3KA 4Y00A 3KMQA 4K4XA 1R8HA 3HXMA 2BQUA 1U2FA 3LP1B 3UI3A 2VKZG 1C1BB 2QMWA 4HEA9 1B0PA 2HVZA 4C0OC 5DGBA 2NYIA 1U24A 3KOAA 5BYRA 1GX5A 2YNGA 3SV3A 1VIXA 2W9CA 2C28A 2OFGX 1EETB 2Z2MA 5J1NA 3I6PA 4NLXA 4I4BA 4ZOSA 2GJ2A 1UVJA 1RTJA 3K0JA 3EXCX 2FIUA 2BBEA 2FDNA 4Q0BB 3OL9A 4GC7A 3QIPA 3MPWA 4YR0A 1NK7A 4NYOA 3K5MA 4IOCQ 2M8HA 4TYBA 1JB0C 3H59A 4DG1B 4F4YA 4QIVA 4DV1F 3NNAA 2HFNA 1R0AB 4PWDB 4OZ0A 5F0UA 5DDRC 3N5BA 4ELTA 3C3LA 4MKYA 1LW2B 2M3DA 2JHEA 4USJC 2ZHBA 2XBPA 1ZETA 3EX7B 3EUNA 5L9XA 3MOJB 4NX9A 5B0EA 4DHVA 1YGYA 2WHOA 5DDOC 3VAJA 3CB4A 3ENVA 3FEXB 1FO1A 5LSOA 4HHJA 3M8RA 1YWXA 3K59A 2OPQB 1GNKA 2C3PA 3TO8A 3WBZA 2J9DA 2OSQA 2DPIA 4WJBA 1GT8A 5KG6A 2BW2A 1URNA 2ASYA 1JKHB 2DTJA 3O44A 5CQGA 4A8XA 3M8SA 3CE8A 2AU0A 3NMRA 3HVTB 3MM7A 2YKOA 1HD1A 3ITHA 3NS6A 1ZAVA 3VCDA 4DQSA 5J2PA 1MROB 3M8PA 2DK2A 3T9ZA 2QA4G 1KQSR 1SIWB 5FLXY 2OJ3A 5IS2A 2OO4A 1HD0A 4URQU 5AXNA 4DSEA 2L08A 2OD6A 2XLIA 1KVJA 1X4CA 1FJCA 4I2QA 1LOUA 1MSWD 1RP5A 5M2RA 4F4WA 1DTTB 2ZZMA 2R9LA 1X4FA 4DUYF 4K4UA 3U7JA 3TYTA 4TU9A 2AF6A 3PFOA 4WIIA 2CQ1A 2RJZA 4ZPCA 2J7KA 2UU9F 1KQGB 4QR1A 3KTQA 2V2KA 4NYZA 2HMIB 2N7YA 3QPIA 1L5UA 4Y0FA 3V6DB 3CCWA 4PPDA 1JLQB 1UP1A 1I6JA 1VMBA 4OI6A 4B08A 3PX0A 2AQ4A 1YQHA 4F25A 1FJEB 4PKDB 1PGZA 1S79A 4AL5A 4CO2A 2O3DA 4NA1A 2ZUGA 2IYIA 1VRUB 3J7Z5 4OZ1A 2XMWA 3LALA 4JI6F 4X4QA 3PW2A 2ZC4A 4QR0A 1WF0A 5KFRA 4I68A 4KBIA 2RS8A 4K2XA 1Q16B 2CDQA 3BDEA 1S0OA 3OXLA 1KLMB 3OV7A 2KXNB 3H2VE 5A8KA 2FHOB 5C24B 4X4VA 3ETOA 1N5QA 4DJBA 4CQ1A 1FE4A 3HHLD 1U1LA 1AXQA 2I5JB 1T05A 2UP1A 5MAOA 3LP2B 1ZM2A 1KD1T 5A6PA 1MWZA 2Q66A 3TUJC 1M90T 3BGRA 2JX2A 1GXLA 3LOUA 1RK8A 3D1HA 3HX9A 4X4OA 5DG9A 3G96A 2P9CA 4QCLA 2PDAA 4NLVA 1OSCA 2BYCA 1N36F 5E5NA 4K4YA 2OPPB 4YEAA 1KNZA 3CDUA 2D41A 1IBLF 4Y34A 3TVKA 1C1BA 2A10A 4NRUA 5KG3A 1VS3A 2AD9A 4F26A 3CEDA 6FD1A 3ZZOA 2E9TA 1IKXA 1FVQA 4CTAB 2A2CA 2CFXA 1Q4RA 2GV1A 4CNZA 1OQ3A 2J6SA 1SUQB 4TXSA 4NCGA 3H4BA 4FXVA 1EETA 4UQGA 2GGPB 3PNIA 1B0VA 4QZVB 3V4MA 3DRXA 3EPIA 1S6PB 2FLOA 4FVCA 4FVMA 3PW0A 3I55S 5LMUF 1U48A 2M70A 2YTCA 4Q0BA 4ITSA 4QIGA 3UPFA 4LF6F 2F9DA 3UCGA 3PEHA 2IBKA 2N4DA 3OTEA 2FHMA 4DG1A 4HDGA 5L1IA 1VI7A 2V8VA 2VQEF 1R0AA 4PWDA 4L6V3 1TVRB 1H7WA 2E66A 1YJNS 1L3UA 1LW2A 2XWXA 3QJJA 2CPYA 5E3RA 3B8HA 5J2NA 2J6UA 5IT0A 4B9SA 4TQSA 4MMOA 3DLBA 1UVIA 1S1VB 4YMEA 2IM3A 4HVZA 5CYJA 3OL6A 2RRAA 4DFKA 4JV1A 4ECUA 3R5BA 3OFGA 3CCRS 4B9NA 4PCQA 3RAQA 2OPQA 4O3OA 2GFFA 3AA9A 2JJ4D 1HNVB 2K1RB 4MK8A 5EWFA 4RWXA 2AGPA 3G86A 2MJUA 2DVIA 1SQEA 4G1QB 1OIAA 4OLPA 5HMZA 5AE3A 1RTHA 4ZCIA 3IS9B 3E3XA 3AQOA 4DV4F 1S0VA 2XNRA 1U26A 4TQRA 3HVTA 3T1HF 4FNHA 4C8ZA 5T41A 4EBDA 1MROA 4LT6A 5IXUA 3QJPA 3W3SA 4JBCA 2NQPA 2E1AA 1BQNB 2ZJRQ 4KFBA 1G3OA 3P5TL 3M9NB 2R2TA 3THPA 1N5TA 2H9ZA 1JK9B 2E44A 4Q2MA 4RNOA 2FJXA 4ECSA 3N6LA 3ONQA 3GIKA 3R5AA 4G3IA 3OTCA 2Z0GA 1DTTA 5KT6A 2WSEC 2AJ1A 1DZ5A 3HHNB 2GO9A 5G4DA 4U7CA 3KLHB 4IOAQ 4YQWA 4F4ZA 2CQDA 2KRBA 4BCAA 3R3TA 2MKIA 2HLTA 1U6ZA 2FJBB 2BRKA 4RBTA 1WHVA 2J0XA 1ZM9A 3Q24A 2HMIA 4Q2LA 3GIJA 3FEYB 1H2UX 3V6DA 2HQIA 2CQPA 3HZGA 3I0SB 4XDDA 3UDCA 4X4TA 4RBVA 1FCAA 4QU6A 4KTQA 2CJBA 1JXEA 3CD5A 4A4JA 1NK0A 1HBUB 1RISA 2COLA 4M63A 1VRUA 1EP4A 4RBUA 1SJ3P 3GV8B 3T1AA 2RQCA 2R7WA 4ZCMA 4F2RA 1T03A 4YB7A 3M1VB 3UQSA 1KLMA 2Q6CA 3DLGA 4JI8F 2DHAA 5C24A 4ATNA 3HFKA 2N3LA 2DR5A 4DS4A 1FDNA 4XPCA 3KLIB 2F8EX 2JH3A 3ZZYA 4Q43A 1HWIA 4M8LA 3OVBA 2J0SD 3TA2A 1RT6B 3QGIA 2YWGA 2RDIA 3DI6A 2B51A 2L3MA 4LFAF 2W4DA 1OS5A 4O4GA 4PXDA 1CQMA 1QY7A 2LXIA 4DN0A 4JI2F 4CCHA 2V8DA 4F3OA 1WG4A 5I42A 4FBTA 4Z37A 3L95X 4HKQA 2HW3A 3AB4B 1B64A 3DOMA 3CCZA 2ZDOA 5CYMB 4ZVEA 2B56A 2IVYA 2XSFA 4I69A 1LWCB 2ZJPQ 4CTAA 4OMFG 3RB4A 1IN0A 3FSIA 3LANA 1U4BA 3EGZA 4FP9A 1SUQA 2B4PA 2UUTA 1S9GA 3F41A 3K57A 4ERDA 4C3LA 3FZ2A 1Y7PA 4DR5F 2GGPA 5BYQA 2ZH3A 1VGYA 2YKAA 4OJ1A 3FRYA 3U02A 4B3OA 4DR2F 2FC9A 2XGQA 1V3ZA 1NJIT 3CCSS 4IUFA 2QSFA 4EEYA 2B0GA 2B7CB 4B3SF 2GC8A 1FF2A 2FPHX 5HMYA 3AH6A 2ROPA 4YFUA 3D2WA 2XGPA 2R8GA 4YP3A 2B9YA 4QIFA 5KT2A 1Y00A 2HFOA 3MFHA 4EBCA 4OV1A 3MM5A 5J2MB 1TVRA 4ZLPA 1CSJA 2CIMA 2E5HA 1TAQA 3ZZUA 3W7BA 4DL6A 2DNPA 1HNIB 5EUHA 2KDOA 3M2RB 5E3CA 1JJHA 4PR6A 3QYYA 4OI2A 2MDAA 1S48A 3I31A 3KK2B 1TK8A 3X1LB 3OJSA 2E29A 3I87A 1P8GA 1HNVA 2XMKA 3O5TB 1TKZB 5JUMA 2EBGA 4JUZA 4C8NA 2KJWA 2NXUA 2JWNA 5E7OB 3D0GE 3VQTA 2RD5C 1DTQB 4OZ5A 4ZPAA 3BQ1A 2BE2B 4G1QA 3IRXB 3TAQA 4OHYA 3IS9A 2AW0A 3ICLA 4URSA 1HWLA 2W9BA 2I8EA 1XN9A 3AA8A 2RE1A 2E7WA 2G9OA 3U1MA 3CIMA 4QWEA 5LJ5Y 2IM1A 5CA5A 2IM2A 4C9DA 4KIAA 2FJWA 3KK3A 1NB7A 1S77D 2Q1LA 1BQNA 4NMLA 2DNLA 2OP5A 3LPYA 1JLBA 5GADU 5CCMA 3GG1A 1W2IA 1IR0A 3JSYA 4OI0A 2J7WA 3IAS9 3OUYB 2XO7A 2WBRA 1XC9A 3AAWB 4MTPA 3ZZPA 4O44B 1XERA 4Q7AA 1PILA 4ECYA 5KG4A 1FDDA 3MEGB 4PQAA 2UVWA 1X5OA 1KQKA 3PFEA 5E33A 2DGOA 4TYAA 1P1LA 4K4SA 1K9MT 2MZQA 1GTEA 4I6YA 5JVGQ 3I0SA 3I9ZA 2AYBA 1SH3A 1FKAF 2UVVA 3V4IB 4DFJA 3CDBA 3I4HX 5KOXA 4UY8T 1ZM4A 1F2GA 1HBUA 1XEZA 3O1LA 2JLGA 2HVIA 3ZZ0A 4WFBQ 3EZ5A 4DR1F 2MQQA 1FNMA 3KLGB 3I0RA 4YUDA 4F8RA 1HQEA 5HBMB 3OSNA 3CULA 3OFEA 4LF4F 2B5JB 4A46A 4CO1A 4U6PA 1WACA 1DBDA 2MKJA 4G1IA 1GX6A 2J0QD 1UVMA 4MKAA 1UMJA 2ZH1A 3KLIA 3SFUA 2LQBA 3FJ2A 1X9MA 1SH0A 3M2UB 3I5CA 3ISNC 2E1RA 2RUGA 2OLWA 1AROP 1RT6A 2V8GA 2L48A 5EWGA 3DLHA 1DLOB 4QIEA 3OVAA 2B3TB 4DQQA 4NZ0A 1Q79A 2HZCA 1VFJA 2IFXA 1HL6A 4ECQA 5D4LA 4ZVFA 5DJBA 1N5YB 4C97A 2MZTA 1HNXF 5KFNA 1OWXA 3CSKA 1RJJA 3VAGA 1LWCA 3C6UB 2EKYA 3IGVA 3H4DA 2FVCA 4A8OA 4MYUA 1NK5A 4IQXA 5H9FJ 1WTFA 4Q45A 4DQRA 2VFRA 4FXWA 3DLLQ 3GR1A 3D54A 5A8RB 1P6TA 2QV6A 2I2YA 3BQ0A 1IXKA 2XULA 2LDIA 3LO3A 4QQBA 1U1PA 2K3IA 4WFZA 2BJEA 3VR1A 3VZHA 2DNKA 5B0BA 5KOWA 3G4SS 1V6HA 1X4DA 2MKHA 4CNYA 5FD1A 5A2QY 4Q8FA 2BANB 4KRWA 1R89A 4J9RA 3RBDA 1ZZFA 3J7A1 3MUVP 2VONA 5J2MA 2EW9A 2WAQD 2ZDPA 1YHQS 5DG8A 4YB5A 4E8UA 1LXJA 3CJ5A 1LKZA 2VBYA 3M2RA 4BWJA 1YVFA 2VOPA 4K5SA 1FEHA 1D8YA 4KHMA 5K5MA 3R5DA 1R3NA 3KK2A 2L41A 2ZH6A 4N77A 2LU2A 2CJAA 2EFNA 2IJNA 2YNGB 3Q8PB 2W9CB 4ZP6A 1TKZA 2BQRA 1JLCA 4I2PB 5KFMA 2XY6A 1ELOA 2BJDA 5F41A 3OLAA 1DTQA 4DR6F 3CD6S 3Q2TC 2DD8S 2DHXA 2DHGA 4KC5A 3FFIB 3NP5A 3QIPB 3K2YA 2LQJA 2ZH4A 3LGNA 1G1XA 1BQMB 3EGWB 1TKTB 2C22A 2BV3A 4QJVA 2CPFA 4X66F 3RR8A 2ZOFA 3S1TA 4HH1A 1NH7A 4NLDA 3OUYA 3KLEB 4DF4A 2DCUB 4R0JA 1HI0P 4O44A 4K50A 1QAJA 3DRSA 5L9NA 2O67A 2JEFA 3H5UA 2QMXA 4QOTA 4OI3A 4RNFA 3D28A 3PVXA 2ADBA 1DFDA 3MEGA 4IR9A 4WE1B 4NLRA 2VFVA 2JLEA 4A8SA 4PG7A 5J1PA 6FDRA 1NKEA 4NLQA 2PFFB 2PI4A 3EYZA 3GYXB 3O3LA 1RGVA 5B09A 3NKYA 1U09A 1Y5IB 2LDYA 1S76D 2C2RA 1H38A 3V4IA 2M88A 3JSMA 2AV5A 5J2PB 1FRLA 4FZVA 1CC7A 3UE2A 1S0MA 3TA0A 1I94F 3WC2A 2R8IA 2R2UA 3T5HA 1U2RA 3CCQS 5HBMA 2R7QA 1ULRA 3D0HE 4MIWA 2DNNA 2B4UA 3DXBA 2HHXA 4I2QB 3OLBA 2I0XA 4RLEA 3G8TA 2ZBCA 3LH2S 3J80Y 4ES1A 2A3JA 3QJLA 3ZZRA 1QUVA 4UQTA 4O3NA 2UVUA 1U25A 3IWLA 2B9WA 1JX4A 3SCJE 1G7CB 2JC0A 4CH7A 5MLCV 4OLOA 5EGYA 2DGWA 2IYGA 3HHDA 1KLNA 4EZ6A 2MPUA 2XS5A 2J6TA 1FKPB 1HI1A 1IQTA 4RX6A 1N5YA 2KKHA 1Q7LB 3N6NA 5LL6d 5F8GA 2ZC3A 3OSPA 3K5LA 3BSCA 5DDQC 2F1FA 1K1QA 3PDNA 4LSNA 1E6YA 3M6WA 4DUZF 2FJEB 4K59A 3RBEA 2Q6BA 2DH8A 5FJ4A 2VPWB 4YB6A 3CVKA 5A8KB 1ZAWA 4WU2A 3NS5A 5A8RA 4EFAC 4NPOA 1JLEA 5HO4A 5D3GA 3M2VB 4OZJA 3BJYA 1XR5A 1WHWA 4QU7A 1IKVB 3CT9A 2BANA 5G0RA 4DQIA 3MHYA 1HYSB 3E2EA 2Q43A 3SEOA 1FRHA 3BGRB 3LUYA 2XC9A 3JYTB 4DLGA 2FLLA 3AHPA 2RS2A 1VBYA 5K8PA 1E6VB 1HBOB 2KHCA 3ENWA 3HHLA 4I56A 4DOZA 4DS5A 1APSA 1QJHA 2CZVC 3BF4A 2GW8A 2MQNA 1DQ8A 2POKA 3BZQA 3FCHA 4RW8A 4WXWA 1RKJA 2DNYA 2VBZA 3IRWP 1YJUA 3VAFA 2XMVA 3IBWA 2EBEA 2OAUA 1HW8A 5HROA 1IKXB 4WCEQ 5LMNF 5HP1B 4OHWA 3I5AA 2PN6A 4NCGB 2KG1A 3CD7A 1VHFA 2D9PA 4OX9F 5C5JA 3A8EA 4I2PA 3TA1A 3TUIC 2OH2A 2IRUA 2DGUA 4X84A 1HBMB 2ZKTA 3M8QB