2KHDA

Solution nmr structure of vc_a0919 from vibrio cholerae. northeast structural genomics consortium target vcr52
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
108
structure length
108
Chain Sequence
MSNQTCVENEVCEACGCAGEIGFIIREGDDVAEVSLFGSDKAHLEGKLAEYISLAKQVYANVEYEVAPVADNATELHARFKFEVSAEKLIFELKTRALARLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution NMR structure of VC_A0919 from Vibrio cholerae. Northeast Structural Genomics Consortium Target VcR52.
rcsb
source organism Vibrio cholerae o1 biovar el tor str. n16961
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein VC_A0919
total genus 19
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2009-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04175 DUF406 Protein of unknown function (DUF406)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.860 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2khdA00
2K3IA 5B7WA 2KHDA 1IN0A 2JZ5A
chains in the Genus database with same CATH superfamily
2FDNA 1AFIA 3BKFA 3O2IA 3NWGA 1VIXA 2RS8A 3W8GA 2ZDOA 5HMYA 2KI2A 3RGIA 1FNOA 2Q43A 3MUTP 3QNWB 2Z58B 3AQOA 3L7PA 3MEEA 4CLLA 3EX7B 4WZMA 1FWPA 1NRKA 5AXKA 3SFGA 4JI2J 2DJWA 1ELOA 3W8PA 1YVFA 3CEDA 2F9JA 2EC2A 3DI6A 4ETXA 1VQNS 3O1LA 2X1BA 3DLEB 3Q8PB 2CQ2A 5CH7B 4PUOA 2KJWA 5KT4A 4KV8A 4MH8A 1S9FA 1V3RA 1EJ7L 1X4EA 2G2OA 2CWXA 1Q7YT 3IWNC 4XPCA 3LGMA 1FK9B 3VZIA 2ZOMA 4HHUA 3CC2S 2C2DA 1LFPA 1VHFA 3UN3A 1VMBA 2D9PA 5L46A 5C2CA 1U7LA 3BSAA 5D4PA 3MURP 4IG3B 4UOHA 1S1XA 1GQEA 2R9LA 3DRRB 1GAOA 1RBAA 1ZAXA 3SSQA 2PT0A 4R8UB 1RAEB 5KG7A 4X62F 1RBOB 2YNIA 1P6TA 2VFUA 2NLWA 3F56A 3NAIA 4J9MA 3T6JA 1EQMA 3TA1A 5I42B 4OX7A 2FZGB 2AJFE 4NRUA 2LQBA 1NHKL 4C9DA 4Q44A 2VV5A 5U47A 5L38A 2MQQA 3NG8A 4OI0A 4NMXA 1Q5VA 2ALYB 4GMKA 3UE2A 2W8KA 1IBKJ 3GV8B 3D68A 3QLHB 2XCPA 3LUYA 1IBLF 4X4QA 1AFJA 4TU8A 3ZZUA 4RKUC 2EFVA 2IC3A 5D78A 1LFWA 1JLFA 1YJTA 4LF8J 4I69A 2EFPA 3H40A 1E6YA 1UWBA 2V8HA 3A13A 2NYIA 3GR1A 3I0SA 3L09A 4DG1B 3G4SS 2JC0A 5DG7A 1WACA 4NOHA 3BO2A 4B9MA 2BKNA 2FB0A 3IS9A 2HGLA 3ET6B 4CLYA 3N79A 1L3VA 3Q22A 3M6WA 2QSWA 3F41A 4NLWA 3CCMS 3GSDA 4LFCJ 5B0FA 2C2EA 1N36F 2YKNB 1SL0A 4CNYA 2D9OA 3SCJE 3V4IA 1W26A 1PAUB 3M8PA 2BBEA 4F7VA 3MEGA 1VK8A 4JI7J 4DPTA 4QBUA 4ID5A 4DSIA 4DEZA 4FXWA 2Y1IA 4DUTA 5IOLA 3OHAA 4NI2A 1ITPA 4KC5A 4KAIA 1FWKA 1RXOB 3OR1B 4DPXA 2HHQA 2YKOA 2KFZA 2MQNA 3KG1A 4IFVB 5CZXA 2RUGA 4DV5F 2HWIA 4CM2A 5D0GA 2E1CA 2CG8A 3AJDA 2WSEC 1UVMA 3BYPA 1NJZA 5J2MA 4NLQA 4U67Q 2XGQA 1TL7A 4DX8H 5AJ3J 1M5OC 3GE9A 3TZXA 3R7SB 3IFEA 3D28A 4WF9Q 2ZC3A 3QSYB 1OWXA 3D1HA 2KFYA 1EETB 1RWUA 4NZ0A 4QZVB 2MZSA 4CTAA 2VJVA 2IJFA 4FF4A 3IRXB 3KHLA 4DR4F 2IM0A 5LL6d 1X60A 4DR7J 4DSFA 3R5BA 1MN9A 1HNVB 1NPPA 2MPUA 2QX0A 3R9LA 2W9CA 2MLZA 2D3OR 5LXYA 2BJ8A 4IOAQ 4UUXA 4OHZA 5KFIA 2GJ2A 3MCMA 2BOAA 4O3NA 5RUBA 1JLCA 2Z30B 4ES3A 4A8WA 4LF2A 4N8OA 1RAOA 2ZKUA 5HMZA 3LO3A 1UCNA 2ZDPA 3H8YA 3FFIB 1JLAA 4UUWA 4Y2IA 2IJRA 5GVQA 4EGLA 4ECZA 4DR7F 2C2KB 1N54B 1B0TA 3NOCA 4GRSA 1RWNB 1HNWF 2GX8A 2RVJA 1RHJB 4KFBA 3W65A 2QMWA 2YVSA 4JUZA 4DL4A 2P2CB 5IXUA 1HNXF 2IRUA 4ZHRB 4TQRA 2GC8A 3RR7A 4TYAA 4G1IA 3M8YA 4ITSA 5HK4A 5DQHA 3GB0A 1PYOB 1JLQA 4KFBB 2WW4A 3T3FA 4IH7A 1D9DA 4ZVEA 1A6LA 2WB1D 1S1TB 2B56A 3NNAA 1M5PC 2DR8A 5A8RB 3Q86A 2BJEA 1DTTB 4F36A 3G6YA 1G1XA 1PYTA 4FNHA 2UUAF 4J9NA 3M6XA 3D6FB 3CIMA 5KFVA 4BBYA 4KHPF 1RGVA 3KUGA 1D3WA 3H7HB 2DRDA 4R5PB 1OQ3A 2H3EB 2AV5A 3P5TL 1YQHA 1REVA 4QPXA 5HMWA 2GAGC 2WVEA 2XCAA 1S6PA 3Q89A 2QLBB 3O5TB 1Y7PA 2B5JA 4IH6A 1CJTA 3GIIA 2PI4A 3BPDA 1BQMA 1FX4A 2VG6A 3QIPB 2B6AA 1OS5A 3NGUA 4O44A 2WVDA 4CLTA 4X65F 1TL7B 3WBZA 1KQSR 3OD2A 3H2UB 5GMKa 4DUZF 1SQFA 1R6YA 2D3UA 1AB8A 2VC0A 3CDWA 2VZ9A 2ASYA 3PHTA 2VG7A 1CJKB 2DGUA 2YH0A 4L3KA 2R2TA 4IRDA 1RAAB 4RW6A 1NDKA 1TKXA 3EMTA 1HD0A 2B8QA 1PJ6A 2Y0SD 3KUEA 4DX5A 2VKRA 2Q3PA 3QSIA 4DUYF 2ZNYA 2D74B 4F4XA 2FVRA 3VQTA 1LW2B 2F8EX 2JOQA 2JL9A 3B6BA 1Q82T 1T9YA 1I3OB 5DGBA 3WZ0A 3VAMA 1TV6B 1S4EA 1CS4B 1RA6A 1TVRB 2AX0A 2ZVIA 2V6AA 2DNYA 3CCRS 2YWKA 2O01C 3RU0A 2LA6A 5KFNA 4F04B 1S76D 3N0VA 4HHJA 1N0UA 1S99A 3R5GA 3ILLA 3CE8A 4WYLA 1DLOB 2VFTA 4AD6A 3CD6S 2QO3A 2YPZA 5BYSA 2V4JB 5IC6B 2UP1A 4FP9A 2N7YA 1R0CB 2GVDA 4QW8A 3OXFA 4KGKA 4I2PA 1RTDA 5F8NA 3CJ4A 5DQGA 1AZSA 3M4XA 1OYEA 3BZQA 3AD9C 1NDLA 5K8NA 1FDNA 3Q8UA 4OJHA 3W2VB 5KFLA 2BR0A 1HI0P 3GWCA 1M90T 1Q8BA 1VBKA 1S7IA 2LEAA 4KPCA 4Q2LA 4KR0B 1SUQB 3VVTA 2RD5C 5DDOC 3FQLA 4FYVB 2MKIA 2PI5A 1S97A 4OI1A 1LQ9A 3FDSA 1TZ0A 1SC1B 3JSMA 2ERRA 3GLJA 4F2RA 2I5JB 3RRKA 4P2FA 3PW2A 1S72S 2J6UA 2UXCJ 2XHWA 1Y11A 1Z2ZA 3KKFA 1F3FA 4KO0A 3MM6A 2OEKA 4WBFA 4OQJA 3S1TA 2N4CA 1G3OA 2OD4A 3LPEA 3CWJA 3M7VA 3MMCB 3DRYA 5ETTA 4BCAA 2FGOA 2B4UA 4HL9A 3MEKA 2YNHA 4NLYA 2QA1A 2W01A 1RK8A 5AT1B 4DWIA 1KNZA 1FDAA 4I6WA 3MR2A 1Y10A 1KKHA 3CCUS 2G4BA 2GAHC 4P52A 2VPWB 1D1UA 3BM7A 5AXMA 2GJIA 3VAHA 7FD1A 3JQKA 4K4UA 2QLWA 5D4LA 4DPUA 2FIUA 5KG6A 1YG0A 2DNLA 2E7VA 1O5JA 2Y1JA 3HHLC 2BA9A 4U7UK 1QAIA 3DOKB 4NCGB 2IMWP 5IWAF 2MHEA 1N33F 4M95A 1VC0A 1B0VA 3PDNA 1IR2A 2CPZA 1PC5A 2CPIA 5DQIA 4JI1F 1HQ2A 1QM9A 1RLCL 2H4YB 4IH5A 1OYDA 2J6SA 4JP8A 4YFUA 1N6QB 2AWZA 4JI4F 3W1YC 1KD1T 4YUDA 2MQLA 4OX8A 5DLGA 2DY9A 3HXMA 3A8JA 3OL6A 1NK8A 2XZDB 1UA1A 3M2UB 3CJKB 4LRBA 1HBMA 1UW9A 2HNZA 1RE1B 3GFHA 1ROFA 4C0BA 4DN9A 4LRDA 2CPXA 1H74A 4EU0A 5HSPA 2B51A 5A76A 2BRLA 1MMLA 5KG1A 3K58A 3CF5Q 1JLGA 4FKXA 3BV8A 3LWLA 4X84A 4WKRA 4KBIA 4I7FB 3TX0A 4CLFA 2FLNA 1TFYA 1MWYA 1WG1A 4ZPDA 2HHTA 2Z2MA 4NCAA 2DD8S 1IJFB 4C0OC 4YR3A 3OTBA 1N5QA 4USHA 2H5EA 1W2BR 1SJ3P 5E7OB 2IVYA 4RW7A 4TLRA 1BMQB 2KXFA 2UV8G 1KFDA 5HVGA 4K4TA 2EPIA 2UXDJ 1S48A 1HNZF 2QYGA 2EFGA 2KXNB 2R8HA 3POTB 2AGOA 4LF8F 5CYMB 1Z1ZA 4USVA 1S6QA 3MPDA 2LXUA 3ENVA 1WORA 2UVRA 3PJ9A 1VR6A 3LP2B 2JDJA 4GKJJ 4MFBB 1K47A 2BVZA 1H6KX 2GS8A 2ILZA 5B0AA 1T11A 9ATCB 1U4BA 1HNZJ 1FVSA 4ED6A 4ED1A 1JLGB 5B0GA 2I8EA 4ZCKA 4DXLA 4A8YA 1KONA 3BGUA 5A8KB 4ZVGA 1N36J 5MLCV 2CPYA 5C7PA 3GU0A 1WEXA 3HFVA 2HHHJ 1HWKA 4QOTA 3DXSX 1SB6A 4AL6A 4RL1A 1VQSA 2KFNA 3DRSB 5CA5A 1U0SA 3L4BC 1E6VA 1ZOTA 1VDHA 5J2NB 4I1TA 4DX6A 5F8IA 5KG4A 3RTVA 3BKUA 1IKVB 4CM0A 4OI3A 4ECSA 3CC7S 1IBMJ 3EICA 1PSDA 3NP5A 4Z7YA 1RTHB 3BDEA 4CLKA 2W9BA 4DV5J 2KO1A 4ILMA 3UR0A 3G8TA 1QUPA 4ZOSA 1XEZA 4QQBA 2XM3A 4A47A 2F4FA 4DV4F 1YJRA 3ZTPA 1WI8A 3N6LA 3NCPA 2KHCA 1EHWA 3J7YU 4ZVUB 2ADCA 2VU5A 1HQEA 1JQGA 2E66A 2EFNA 3NWRA 4IOBA 4NA2A 1ZA1B 3HX9A 4WJBA 3TVYA 4CH7A 2VBWA 4TYBA 3JYTA 3BO3A 4B3SJ 2Z8QA 4NWBA 3BSNA 2HRUA 2EKNA 3FSYA 4NLUA 4DV2J 2UUBJ 4NX9A 1ZPVA 2PSZA 2MB0B 4K4SA 4FYXB 4OHXA 3L7OA 4C97A 4K2JA 5HVHA 1UFLA 4CLSA 2QLJB 3VGTA 1JIHA 1Q8KA 4WTOB 2XSFA 3PX4A 4JV0A 1S1XB 2L3MA 2DGTA 4OZ0A 2VFVA 1WHYA 1HQUA 2J9DE 3ONQA 3RRGA 1H3DA 1RT1A 2VQFF 2W24A 3PG9A 1SKWA 2ZC4A 2DIUA 4TY8A 4Y2MA 1FD8A 2HVDA 1P27B 3K5MA 2JEFA 4C8OA 3OL9A 4Y2AA 3IXQA 2MXYA 5KOWA 2W1BA 2NSCA 4ZVOB 4DR4J 5JJBA 2OKQA 4RBTA 4U8YA 3S8SA 2XS2A 3U7JA 2A1BA 2CIMA 5B0CA 1T03A 4OHYA 1EARA 4HH1A 2FD2A 4Y3CA 4USWA 3SYZA 2O67A 3CULA 2R7WA 3T5JA 3HFKA 3GSIA 4EK2A 4QWDA 3RB3A 2DHAA 3DRPB 4QJVA 3ELHA 4DR3F 2GVDB 3GIRA 2LLZA 1VRUB 4WXOA 2OUGA 5IS2A 2W8LA 3CPWR 2IBKA 4B3TJ 4MAKA 1FI4A 3IGVA 4K59A 3OL7A 1MMNA 1TU0B 4I56A 1UVLA 1HI1A 1UWAA 1WSRA 3V2UC 3VF0B 2GV1A 1RT6A 1J5OB 4AXIA 4F0MA 2GIQA 2P9CA 3FBFA 3HULA 3M2RA 3N6MA 4V19X 3F0NA 4M5KA 2VOOA 1R27B 4S0MA 1Y3KA 3AOCA 1RZMA 4X4RA 1K73T 5B09A 2HFOA 2CRLA 1FJ7A 3MR6A 4FZVA 1RSCA 5B7WA 3KK2B 1DHMA 2ROPA 5K8OA 1XQIA 2CQIA 2Y0BB 2XWXA 1RADB 1QSSA 3H5YA 2BEFA 2C1EB 2HBRB 3NGDA 4UW2A 5I3QA 1FJGF 3W2WB 4HEA9 1SC3B 2JC1A 3W9JA 5DDPC 4Q0BA 5AE1A 1CSJA 1RT5B 2CPFA 1U8WA 2M3DA 5L9NA 2DPJA 2A6MA 2FC8A 4MYTA 4L73A 1B7YB 4EI2A 1VBXA 4KB7A 4ZCIA 2Z2YB 3CJ5A 4ZPWR 5DGAA 1DARA 2ADBA 4TNOA 3JQJA 4RUBA 4H4KC 1A7GE 5HAOA 4UOGA 3W5YA 1TUWA 1TK8A 2KZMA 5GMEA 2BX6A 2HGMA 4CH0S 4WFZA 3W2VA 3KLEA 3QWUA 4R5PA 3VCDA 2XMWA 4NLPA 2CFXA 1XMOJ 1NM2A 1RB0A 3A8KA 5E3QA 1HNIA 1X9WA 1KWMA 2RNEA 4KKOB 4ZP7A 4ZKAA 4N5SA 1U2CA 2ACYA 4DL0C 2HZCA 2HNYA 2JEGA 3E01B 4YDDB 4HVZA 3KJVA 4LSLA 1LK7A 1WTFA 1NHUA 1RWVB 1MU2A 3PHEA 4KSEB 3HFZB 4LFBJ 2IPOB 1TAQA 2AU0A 1JWWA 2JLFA 3OL8A 1RT2A 4F02A 4WYWA 3W64A 3QGHA 1PILA 4H4MB 1TVRA 4ZVHA 3R7NB 2N3LA 3THTA 5DETA 3ZFVA 3EVMA 4DR6J 3FMWA 2BE2B 2KVIA 4LR8A 5F9LA 2V67A 1X9MA 2RHSB 5T14A 2UU9F 1U47A 1RT2B 1H98A 1UETA 3CD0A 2NYHA 4JI8F 1U02A 3HZEA 2W7PA 2Y1LB 4U9RA 3WC2A 2X1AA 4EZ9A 2C2OB 2RQMA 4B3MF 2QN6B 1FEEA 4ZLLA 3T1HJ 3P49B 2XMTA 4JV5J 3GFXA 3FEYB 3JTPA 1UKUA 2QIFA 4M1KA 4HDHA 5LOQA 1NJYA 1YSJA 5ETKA 1X5TA 1QSLA 4NXMF 2VF3A 4M5DA 1BY9A 1M0SA 1NEEA 2DR6A 3FSXA 4LBHA 1IVZA 1WWHA 2YQ0A 1EETA 3MAAB 4U7CA 2V9WA 2ZH8A 2M8HA 4MYUA 5BJRA 5F8MA 1X0FA 4DSLA 3MOZA 4C8ZA 5KFSA 1SL2A 2MKHA 5LSOA 1N5YB 1S77D 4TXSA 5KT2A 4ZPAA 1U24A 3TP2A 1V5VA 7AT1B 1V5IB 5IV4A 2V68A 3TZYA 2GO8A 2U1AA 3ILOA 4UY85 4HLBA 1DZ5A 5L39A 2ZUAA 1HYSB 4H54A 4JI2F 5IWAJ 1B0PA 1N33J 4QR0A 1K1SA 3D0HE 5D3GA 4YR2A 4LQ9A 1SV5A 4JBCA 4ZIVA 1R0AA 2WONA 3NAHA 1HFEL 4EFAC 3PM9A 4IR9A 4LT6A 4I7FA 4CO4A 2PEHA 3DLGB 4NZ7A 1Y5IB 2XTJP 3QT5A 2FJEB 4CLZA 4U6PA 2W9AA 4B9LA 4ID5B 1UZHA 2ZWOA 5KFUA 3T19A 1X4AA 3IMQJ 3X1LB 1K0TA 1NJWA 3M8PB 4DS4A 1N34F 3G6XA 3ITHB 4ZJLA 2XYPB 2IVMA 3PRVA 4NLVA 5J2QB 2HNYB 3DN9A 3ZTOA 3CCZA 2BQ3A 1R8CA 2ZZMA 2KXHA 1FKPB 2Y3YA 4G6VB 4QIVA 3B4MA 4EBEA 4DG1A 4DQRA 1NJIT 4P74A 1NB7A 4F4YA 3DOKA 2Z57B 4NCGA 1HNVA 4NLOA 5DM7Q 2QA4G 2XEXA 3GJSB 4P10A 1U6BA 1OIAA 2PA3A 3K5OA 1IWAA 4FVMA 2RB7A 1MROB 3AAWB 3M8WA 2FJBB 3RG6A 2ZH4A 5LMUJ 3LH2S 1N48A 4OYIA 1QJHA 1L5UA 2N7CA 4HDGA 4KE5A 4LUBA 2XS5A 2NZCA 1TKTB 1A0OB 4DOZA 1YWXA 1HW9A 4NLRA 3BGLA 1X31C 1FVQA 1HBNB 3GJQB 5CYJA 3HVRA 3CCSS 2QSFA 2W2OP 3C2PA 2V2VA 2ZE2A 3TA2A 3DU5A 4PKDB 3GV5B 2DEIA 2MGZA 2C3UA 3QJJA 1WC4A 1S12A 5HP1A 3QZ7A 1R6VA 5HN0A 1FRLA 3NS6A 2UV8A 2HBQB 2UXBF 3OLBA 4OYAA 4M5IA 4URGA 1JKHA 3HI9A 5K5MA 3CVKA 1MN7A 3MAHA 5C25B 4UOFA 3SV4A 2HVHA 3UCGA 3HSJA 1IBKF 1RKJA 1Y00A 3VHQA 4PXDA 3CXCR 3G6VA 4B17A 1OMSA 2BANB 3PRDA 4LJMA 4YQWA 2D1CA 2HFUA 4JI7F 1UVJA 2XSJA 3CT9A 3MD1A 1EAYC 2RRNA 4PQUB 4H4KA 3R1HA 5F3TA 3R2DJ 3R97A 1TQLA 4E8UA 3FK4A 4DLGA 2DY1A 1G4CA 3G82B 3MPYA 4LF6J 3ENQA 3TYTA 4I2PB 2RH3A 3TQEA 1RTDB 2OPQA 3CO9A 4LF7J 2E5IA 2GQCA 2PMWA 3R5AA 5C42A 1Q1KA 3HF5A 3MI7X 3US5A 4OX9J 5E3CA 3NS5A 3C6UB 4U8VA 2J0QD 5J1EB 4NYZA 2B0GA 3N01A 4K2XA 2V63A 4RW9A 4DF8A 3DC2A 5A0YB 3HHEA 2LMIA 5GADU 2G13A 4V1Ak 1QD1A 4C2MA 4RO0A 4N8NA 4QWCA 3KLHB 2FVQA 1RQ0A 1MMDA 3PFOA 2DNOA 1G7CB 3PW5A 2KT5A 1P9QC 1TK0A 1PBAA 4BDPA 2R7SA 2HKEA 3KWMA 3UNYA 3QYYA 4RNHA 2DPIA 3EZOA 4L72B 1TL1A 3G6ES 1XMBA 1Q4RA 2H51B 4C98A 3RR8A 2J8AA 2CVEA 2DYAA 2LKZA 2NXEA 2QYCA 4CIOA 5HLFB 1NK9A 5L8RC 3C46A 1TAUA 2AGQA 1XC9A 1DBDA 3QFHA 1B70B 3AJ2A 3CMAS 5AJ3F 2JWNA 1VIOA 2AMCB 5KFJA 2HHXA 4IG3A 3OXGA 1HBNA 3JSYA 1VQYA 1VRQC 2XZWA 2R7XA 1T9UA 1S6QB 3D0IE 4J9UE 3TR5A 3HCXA 3BBBA 2AHOB 3KLIA 2VG6B 4ECWA 1T05A 2KVQE 5FLXU 2MKKA 2VBXA 4GKKF 3N5BA 4LBPA 1N52B 4IRCA 3CGIA 4CDIA 1V6HA 2AD9A 3GPAA 3SDEA 3H59A 4GC6A 3C3LA 2QC3A 1RJJA 1DQ8A 1HI8A 3ZTRA 4KJIA 2G1DA 2FJVA 1Y5LB 4EYHB 4WFAQ 1WUUA 3DI6B 2Y9HA 1S1WB 2V4RA 1S6UA 3QIDA 1TR0A 1RU2A 4DV3F 3MF5A 1J27A 2IYIA 2V50A 5A8WB 2BE7D 5A2QY 1ZM4A 5B08A 5J2QA 2GO9A 2MTLA 3NGSA 3SSSA 1OY6A 4L6V3 1U25A 3SMZA 1KEKA 1YLXA 4ED3A 4K50A 4KHMA 3SZ2A 3M2UA 3EXCX 4Y6IA 4LRAA 4JI6F 2UZAA 3CDAA 1M5HA 3HP6A 2IRYA 2FHKA 4O4GB 5DO2A 3OVAA 1FJGJ 5I3PA 2GCFA 1C0UA 4O0IA 3I6PA 5FIIA 1NKBA 2DVIA 4NXNJ 2OPSA 5GADI 2HS4A 3BQ0A 1EX8A 2QV6A 3EGNA 5HANA 3FNNA 4OLOA 3V5RA 4FVCA 4ES1A 5GAEI 2RKIB 3L7UA 1R8PA 3OLAA 4BWJA 1UJ5A 4KGXB 3T5HA 2RUSA 2ALZA 1F60B 1PGZA 2POKA 3OTEA 1F2HA 4P2MA 3L95X 4USJC 1XN9A 3R8YA 3PIOQ 1VQ9S 1JLBA 3HHKA 2AYGA 2HYIB 1U1KA 2V5HG 4XPEA 4B08A 2EG2A 3CNQP 4YDXA 4R25A 4CTAB 5M2PA 2OI2A 2DR5A 3QJLA 5T7LA 2B9XA 1CC7A 1O6XA 2HFNA 2ZEJA 3ZTQA 1S4FA 2EFQA 3Q24A 1RLDA 4A8KA 3OQ2A 3WIUA 2HIQA 4QR1A 3SCKE 2A18A 1WDTA 2M0GB 1F3VA 3M32A 4ID8A 1N88A 4E2FB 5JMNA 5FLXY 4WFBQ 4DSKA 2FZCB 3ENWA 4MTPA 3I0RA 2PDAA 4QIGA 3WDOA 4K5SA 4AUKA 1PG5B 4NLXA 2L9DA 2RMLA 2W7AA 3FZ2A 4QIWD 4ZVTB 2R7TA 1HWLA 3C15B 4FDFA 4OZJA 2CQ0A 3SBMA 4Y2CA 3HK2A 4HHHA 5EUHA 2WSFC 1QTMA 5A0YA 4J9QA 3EPGA 1RWOB 5D4OA 5LMNJ 3C6TA 3B78A 1PC4A 1MNEA 5IT4A 3CTRA 3K5NA 4B3MJ 4XO0A 2VQEF 3I31A 3EUNA 3QQCD 3GYGA 1RHMB 5C42B 3HT3A 3VQSA 3IA0A 4Y34A 5L1JA 3J7ZT 3H90A 1VC5A 4K4XA 2DTJA 2J6TA 2J7KA 2FHOB 4KGMA 1KTVA 2HMIA 2M2BA 3U1MA 3CCLS 4NZ6A 4YR0A 1KVIA 3BR9A 4X66J 2Q6BA 3V6KA 4DR6F 1R31A 4RNOA 1GNKA 2B8PA 2N3OA 2IDLA 4LF5J 1TTHB 1FF2A 1E6YB 1UWBB 2XBPA 3I0SB 1H2VZ 4KRWA 3KJNB 4FS1A 3NLCA 2DNNA 1IQZA 3UI3A 2I2YA 1Q53A 3AOBA 2MQ8A 1UAWA 2HS0A 4MIAA 2ZOGA 1S9EA 2ACMA 1SJ4P 1KFSA 4TY9A 3ZZOA 2UXCF 3PIPQ 1SC4B 4ZK7M 4X4OA 1HPZA 3KK3A 3P8BB 3TOQA 4P71A 5KT7A 3PACA 4MKYA 4B3OA 1HD1A 1IBCB 2FTRA 4DQQA 1WEYA 1UA0A 4I68A 4PRFA 1UMJA 5DZ6A 4JI0F 4V19J 1EP4A 4QU6A 3BBFA 4KYZA 4MKVA 1NU4A 3HZGA 4CI0B 4DDFA 1REGX 5HROA 3W62A 1N34J 1R8HA 2CPJA 3DRRA 3GFYA 1L3TA 3R3TA 1DY3A 2BV3A 4DV0J 2IAJB 2WSCC 4X4VA 2XLIA 3HVAA 3AY0A 3CJ2A 3VAFA 2DGXA 2UVVA 3O3LA 3SIPB 3HHLB 2X1GA 1UVKA 4ZITA 4DL3A 3SV3A 2V4JA 2MKCA 4ECRA 1RT6B 4ILRA 1J5OA 2HS3A 1JX4A 4ZIWA 2GHVC 1DJ0A 1VRTB 1B3TA 4AXJA 1H0HB 1OSDA 5HJYA 1JJ2R 2P6TA 2YKPA 3QT6A 4RW9B 1FCAA 1YGYA 2RIJA 4YB7A 3U1NA 1WEZA 2CQ3A 2HAIA 3C6UA 1JLEA 1MLAA 2X3GA 1NJXA 1NXIA 4JI1J 2ATLA 2E9TA 1RUSA 4LFBF 4WE1A 2M5YA 3OBIA 2P6SA 1WG5A 2ROEA 2N82B 2XMKA 1T02A 2XMUA 5KFHA 2BQRA 1U1MA 2QTWA 3I9ZA 3NBPB 2RQ4A 4NYOA 2W2NP 2X7IA 2Z0GA 1IM6A 2ZH6A 1XMQJ 2OFGX 3GJRB 4PABA 4P73A 1H38A 3Q2TC 3DLGA 3C6TB 2LA4A 2O3DA 2VBYA 3SQGA 4CO1A 3S6EA 2WK4A 2HBYB 2XSJB 2R2RA 4PQUA 2AT1B 1SV5B 4K4WA 4ANEA 1C1BB 3SCIE 4X62J 2VICA 2OFHX 4BHQA 3TZZA 1RT1B 1RWMB 2YPYA 4DR1F 4OYOA 1YJ9S 2C42A 3IBFB 3I55S 2WAQD 4X4NA 4ANDA 2J0WA 7FDRA 1UPMB 4N76A 3H2LA 4ZLPA 4NMLA 2JZ5A 1Q81T 4A48A 2OLWA 3M8ZA 5HVFA 2Q79A 3TUJC 1CJUB 2LECA 4C11B 5GAHI 2L48A 1GXLA 2QE5A 1FD2A 4RPFA 5A8RA 1VQ5S 5DJBA 2HQIA 1HKAA 4F0HA 3J7YI 1S1TA 3W5XA 3JYTB 4ICLB 1C1CA 1HQEB 2EWHA 3RAMA 3QGIA 3HSZA 4OX9F 1VQ4S 2BKPA 1N5SA 1WDDA 3VGVA 3D3BJ 4DI6A 3FQKA 1FT8A 2J0XA 4UT4A 1B4SA 3C66A 2JFDA 1GTHA 2V2QA 3SFUA 2OPPB 3UCZP 2DH7A 1J5EF 1N32F 1TKDA 4WK1A 4QU7A 5MAOA 3M8QA 4QWEA 3R5DA 2Z2ZA 1ULRA 3TEHB 3U02A 1WC6A 4C48A 1XR5A 1SH3A 4IDKA 4YS2A 5IQ6A 1JMTA 5F0UA 4CNZA 1E6VB 5BXIA 1YX2A 3ISNC 5GAHU 2BM0A 2ZD1A 3ZNJ1 1LWEA 1UTAA 2YKNA 3P96A 3M9OB 4L75A 1I5OB 1GTEA 5H9FJ 3C19A 4Y65A 3T9ZA 2U2FA 4ECTA 3MM8B 1NH7A 1VJQA 3CJTA 3LPYA 1T3OA 2QG9B 1X5OA 3H4BA 3OJUA 2BKOA 2PA8D 4KKOA 3IM8A 3KLGA 5A8WA 2KN4A 1NK5A 1NK0A 1U09A 4DV2F 1U6FA 2XY7A 2UUBF 4NEZA 4ELTA 1UL3A 2CXEA 2NXNA 3BPSP 3LANA 2CQ1A 2WONB 4TU7A 4C8NA 2NPFA 4W4MA 4I2QA 2R7VA 2RE1A 1UJ6A 3G87A 2HG4A 4PPDA 3HVTB 3ZTSA 2E7WA 1UW4A 4NEYA 4RW7B 3CJQA 2CJYB 3TO8A 2XYGB 1WC1A 2RAQA 3ETOA 2NS1B 4TU9A 3Q83A 4J9SA 2AZ1A 2C3MA 1ZTWA 2C2ZB 5L1KA 2IY5B 1GMVA 1O8BA 3F44A 4O4RA 3T1AA 3TAMA 6FD1A 4C0HA 4J5OA 5KT5A 2JSXA 2R3VA 2FJDB 1FO1A 3LQVA 3MMBA 4IQMA 4ZS6A 3W2WA 3HMJG 4WIIA 2ZM6F 3EJMA 5DDQC 5KFBA 4OJ3A 2K06A 3KLGB 3J80Y 5ETPA 4IOCQ 5IM0B 3V6DB 3R7BB 2G0JA 4KY3A 1DTQA 1SH2A 3KK2A 2E5GA 1KBRA 2NQPA 3K8WA 1TL1B 2YWFA 5KFAA 2PMHA 4ZPCA 4FF2A 4URQU 3OUYA 3I56S 1FJCA 1BGXT 3BSOA 2K8GA 2DT9A 1FK9A 6AT1B 4A8MP 5K20B 1M5KC 3FUYA 4FPIA 2JFKA 3ENAA 2XLJA 4MIWA 2YX7A 3M8QB 3AT1B 3UDEA 2WTFA 4PZVA 3K59A 2J7UA 4LR9A 3AQPA 4ED5A 2HHSA 5C5JA 1R8BA 1VRUA 1X0PA 4DUZJ 2RQKA 3ZZRA 4X4TA 2FQQB 2QJ3A 2VIHA 2UUAJ 1AUSL 3Q23A 4A8SA 3MEEB 2VHGA 1IQTA 3OVBA 4U95A 3BH6B 1JLEB 1QAXA 4NLDA 4PG7A 1VQ7S 1I6JA 4ANCA 1GMWD 3CJSA 4WFYA 1MSWD 2R7RA 1S9GA 2IA0A 3ZO7A 1RTJA 4C11A 2VPXB 1TUVA 2D3ZA 1VQKS 1HNIB 4YB1P 1IKYB 4DFJA 4K4ZA 2KB2A 2ASJA 4DS5A 3J80U 2OO4A 3H0PA 3M05A 3Q8VA 4P7TA 1WELA 4LMZA 3I9V9 2M88A 4OHWA 3UDCA 1FRXA 1M5SA 1AROP 2EFOA 4CP5A 3J7Z5 3SSRA 3OHBA 2V4QA 2QEXS 2DHHA 4B9TA 1RTIA 5CCLA 2MZQA 1JNRB 1HBOA 3A8EA 1S0VA 5KFZA 3QRQA 1P1TA 2J9EA 2BW2A 4L3NA 1SQGA 5IZHA 3BQ2A 1IKYA 3TAPA 4LFAF 4JV5F 3TVKA 4CYUA 4Q0BB 4CZCA 1FRHA 3NNCA 2ZBCA 2A6OA 2EEYA 5SZTA 2FUG9 2GMJA 3BEGB 3BJYA 2ILYA 4PUOB 4LREA 3IN5A 3CDBA 3DGPA 4LF1A 5D6GA 1RKIA 2EBEA 3VAIA 3NBPA 1JJ4A 3PKYA 2Y8YA 3D1QA 4PG6A 1S9EB 3N28A 4J9RA 5KG0A 1C4AA 2MMYA 4WE1B 3T1HF 2F4VJ 2MSSA 5KG2A 3DLLQ 5AXNA 2XYHB 2DGOA 3JB9k 2F7VA 2XULA 4PR6A 2X1FA 2MJUA 1FE0A 2F65A 1FKOB 3EWGA 3ILIA 2E5LJ 2VA3A 5LXRA 4G3IA 3AOAA 1FFGB 1X5SA 2CZVC 2QLXA 1RBLA 2CZ4A 4Z7CA 3EZ5A 2ZHAA 1HHQA 1W7WA 4WXWA 5ETSA 2F4VF 4N7TA 3DM2B 4DV7F 5KFQA 1CS4A 3UVJB 3W66A 5F8HA 2NXCA 4YOEA 3HHLA 2I6WA 3PX0A 3OUYB 1LW2A 1CQNA 4IO1A 3K17A 3PVXA 3I87A 3MM7B 2ZITA 3MMAA 4X66F 1U1RA 5A8KA 4B3RJ 1XNRJ 4NLTA 1JXEA 3FBBA 2OEMA 1CVJA 1X9SA 1FDDA 1KR4A 1RWWB 3GTYX 2DIVA 3LALA 3S01A 2NZ4A 5CYQB 1Q8IA 2V94A 3PCOB 1K9MT 2HLTA 1T0TV 2P5VA 4UF4A 3UD4P 2VB6A 1LW0A 3D66A 3M1VA 2ZH9A 4JV1A 1SJRA 5M2RA 1H2TZ 4USMA 4ETZA 2YY3A 3I5CA 5I3UB 4CQ1A 1R0BG 1NZAA 2PEBA 1P1LA 1UFKA 2MLXA 1S6PB 4EBDA 1BE4A 2DGVA 1Y9OA 2NSBA 3FEZA 1S1VA 5A6WA 2YKQA 2XMJA 3CCTA 4J7CA 3DDIA 1M1GA 2HSEB 3A3PB 4FYYB 4X64J 1U48A 5HMXA 3OR2A 4EUVA 1V3ZA 3HD1A 3DLJA 2PO4A 4IYQA 5KFGA 2ZH2A 4C7QA 4ZCMA 2ABYA 4Q43A 1KC8T 2AZ3A 1SC6A 1YJ7A 2QMUB 5LSRA 4MJKA 3OTOJ 1JXVA 4LIWA 5AE2A 3CCQS 1SI9A 3ISZA 1F9FA 3C16B 4DV6J 3MM8A 3UCUP 3LTOA 5CYQA 2KU7A 3UN2A 4OZ5A 5L1IA 4CCHA 3P6YC 1LWEB 3KUHA 3FBCA 2FLLA 2F9DA 2V0NA 3D1OA 4ECXA 2YTCA 2MJNA 4PG4A 1FKAF 1QUVA 2JX2A 3CCWA 1NPRA 3QBCA 3GIJA 2EK1A 1RTHA 2M52A 5E3PA 4DCJB 1RISA 1FRKA 1KHVA 3NMRA 1JLAB 2K1RB 3GCWP 4H4MA 2QGFB 3DM2A 3NXZA 1GT8A 2I9SA 5KFDA 2KL8A 3T5KA 4DU8A 5J2NA 1D9FA 3TUPA 1VLOA 4ECQA 4ER8A 2UXBJ 2DCLA 2W2PP 1NBEB 2DHSA 1TMJA 3CO0P 2EXUA 3C16A 1QVFR 4QWBA 2B9EA 1C1CB 4W90B 3KYLA 3ZZTA 2F8MA 2FY1A 2IYGA 1K44A 3E01A 3NEKA 4ZLJA 5L9XA 2HHHF 3FC9A 3OT9A 3W61A 3AA8A 2GVZB 1WKJA 2JVOA 3Q8YA 4H4OA 5ETNA 3R2CJ 2ZNZA 2R4FA 3KDNA 2MZRA 4J9VA 1RTZA 1DURA 1RWPB 3GIMA 1VBZA 2VPZB 3HD2A 9RUBA 2VA2A 2GA7A 1HHSA 5ETOA 2LXIA 3POTA 2L41A 1HW8A 3CJ3A 1U1OA 2RU3A 1NK7A 2QFJA 1UZDA 2LQ9A 2RRBA 3CSKA 2XNRA 1D9AA 3MD3A 2DB1A 4DFKA 3GV7B 2RKIA 1C1BA 2YQ1A 4LRFA 1W25A 2FHJD 4ELUA 1R3NA 3BBCA 3H42A 4DZ6A 3QJPA 2JH3A 2XHCA 4I64A 1Q5YA 4ENOA 4R0JA 3UW1A 1GMUA 2BJ9A 3MHYA 4KT0C 4RNNA 2VONA 1SVDA 4F0KA 2VKZG 3PZPA 2MYFA 1YK9A 4NRTA 2E1AA 1URRA 2FLOA 2KHDA 3A8IA 4DN0A 1AUDA 2M8DB 5H9FK 1GMWA 2C2NA 3FCHA 3HJFA 2JEIA 3CJKA 1L3SA 1MWQA 1S9GB 3THPA 1RU1A 1IM4A 1V3SA 2J5AA 2OPRA 3QGGA 1UVNA 3UPFA 1R89A 4J91A 4F4ZA 3TI0A 2CQCA 2KH9A 3VAJA 1FDBA 4N41A 1CC8A 2YKMB 3DLKA 4DV1F 4HYKA 1XNQF 1G2EA 3BREA 1I51B 1FXLA 1UEUA 1XBWA 1PIEA 1VRTA 4FN5A 2ZJQQ 2IRXA 3BB5A 2YQ3A 2X51A 3V4MA 1IUJA 3SDEB 3TJ9A 2V8PA 2HRTA 1S1UA 3G82A 4RJVA 4QWAA 4IR1A 4ALZA 2VODA 4M5MA 3IR6B 1T7PA 3OXLA 3MR5A 3W3SA 5EWEA 2C22A 1WJ9A 3KMSA 4DU7A 3GP9A 2XGPA 1S0OA 3I5BA 4RU2A 4MT1A 4A8OA 3DHWC 2IM1A 3K57A 1Y3JA 5M2UA 1Q8LA 2QA2A 4UQGA 2R8KA 2YNHB 4P7VA 5EWFA 1HBOB 1NNDA 1PBUA 1VI7A 2I38A 4WU3A 5HLFA 1HPZB 2BJ3A 3KK3B 4Z37A 2HBZB 2ZJRQ 1HWIA 2B5JB 2OELA 2VH7A 3MFIA 2UUCJ 4ILLA 3E2EA 4PXBA 1REVB 4GKKJ 3R5CA 3OVSA 2PFFB 3AXMA 3BN7A 1X5PA 3JSMB 1F9EB 3VR1A 4OHVA 3HJVA 3MR7A 2MGZB 2H5JB 2RS2A 1RTJB 3PRBA 1S0NA 3HVTA 4ZN3A 1APSA 1O0PA 1SUQA 3AODA 3QT8A 1BWEA 2BQUA 5ETRA 1WOSA 3MXHP 2G2ZA 2HZVA 2B4PA 1H7WA 2IM3A 1S7HA 3M30B 4I6AA 3U27A 1TK5A 3LGNA 2HMIB 1BWVA 3IBWA 1FFWB 2YXLA 3LP0A 5D15A 5IC4B 2OPQB 2R2SA 4LIRA 1NPKA 3S7RA 1XIQA 4JI6J 4PYAA 1NH8A 2B9WA 3D6TB 3UD5A 2P9GA 4DCPB 4ZP6A 2DGWA 4EO8A 1RT3A 4ZVQB 2BACA 2ZD1B 3MOJB 3T6BA 1ZAVA 2E1MC 3MDFA 3G71S 2K7KA 4LF9F 3Q8QB 3BQ1A 2V8GA 2RJZA 3M9NB 4TN2A 3BSCA 1TV6A 1T9WA 2ZZTA 4IG0A 4MK7A 3L3CA 3PYFA 3QRPA 1JKHB 2AJ4A 1B99A 4WK3A 4O23A 1SBRA 3ZXWA 3CD7A 3R27A 2AYMA 2XNQA 3O44A 4RBVA 1RI7A 4UTGA 5FD1A 5HATA 3M8SA 3KHRA 5HP1B 3TAQA 3RB4A 4RNMA 1CPZA 3TUZC 4QYZJ 3HDSA 3UD3P 2OJ3A 2APOA 4RU9A 4USUA 1EQ0A 3X3UA 3LP2A 5LMNF 4Y2KA 2R7OA 1NSPA 2EG1A 2RT3A 1BHNA 5E3RA 5BR8J 2RRAA 3UN5A 4RW8B 1FRJA 2A10A 1EKSA 1HMVA 3TWZA 1JXLA 5ADZA 1ICEB 1U26A 2LFVA 5DG8A 1MROA 1CJUA 4DR2J 1VQPS 5DM6Q 1U1PA 1ZAWA 4NPOA 1S79A 3ISND 4I2QB 1FRIA 1F5CA 4DMZA 5KFPA 3Q8RB 3OR1A 5BR8F 3NY0A 2FY8A 1AYEA 2IBOA 1X7VA 1ZH5A 1IKWA 1PYSB 2MQOA 3NMAA 3MAAA 2B7CB 3CMES 5K9FA 1QE1A 1XJWB 1SH0A 2Y1RI 2QLFB 1RT7B 5KFEA 1NMEB 2VG5B 3EDQB 3UR3C 1C0UB 3GMGA 2HQDA 1FXDA 3D6HB 4Q5VA 1TKZB 2J7WA 2VQEJ 2R8IA 1I94J 3ITHA 4I0WA 4K4YA 4DL2A 1QSYA 2E1PA 2IFXA 4ECYA 1UEVA 1LNQA 2AEMA 1R7IA 2VD3A 1NKCA 1DQAA 2CQ4A 4OLPA 2C2RA 2R7UA 2G2YA 3G9CA 2OEJA 2V2ZA 1SIZA 2BE2A 3DLHA 2CKWA 4K8RA 4C3KA 2DNRA 2XG8A 3N4WA 2DXDA 3BO4A 1ZM3A 2WVBA 1XERA 3MZIA 3AXKA 4DSEA 2LEPA 2FC9A 4ATNA 2ZFHA 3GG0A 3RYLA 3ULHA 5H9EJ 3H98A 3P5BP 1FWLA 1MU2B 4P2SA 2YWGA 3FBEA 1FFSB 3RJMB 2ZH3A 1D8ZA 2UUWA 2LXFA 4ICLA 2DNHA 4ZP9A 5J1NA 3MFHA 1ZPWX 2J9CA 2CQBA 2QA4S 2KDOA 2ZBQA 2E5JA 1RABB 2KM8C 1N5YA 3H20A 3DOMB 5F41A 3TA0A 4E0DA 4RWWA 2PFDA 3KLFB 1LOUA 2ZH5A 1KVJA 1F1BB 2ZKTA 4LF4J 3TJAA 2GMLA 2CDRB 4M5DB 3KLEB 1P9YA 2RDIA 4G1QA 5F0WA 5THWA 4DV6F 2UUTA 4W92B 1C2PA 2DGSA 3MMCA 2A0FB 4GVBB 5ETVA 1RAGB 2HW3A 3LP1B 3K5PA 2QT7A 4EZ6A 3MM6B 1SPBP 4YN3B 3PFEA 1VFJA 4CLUA 2DRBA 4DPWA 5D4NA 4F3QA 3J81j 4OYWA 4QCLA 5EX0A 5KG3A 3H5SA 4X64F 2AJQA 3P45B 4FXVA 1HARA 3GYXB 3KDOA 1RHKB 3ZC4A 1YIJS 4OZ3A 3R6GB 2A2CA 2XWYA 2XMVA 2BABA 2YNGB 4OMFG 2HVZA 2CNOB 1Q0NA 1SCJB 2VUGA 4F4WA 2HLUA 2BJ7A 1ZZFA 3QFWA 4OJGA 4QW9A 4RUCA 1SIWB 3GIKA 4O3SA 2UXDF 1Q78A 3G8QA 2D41A 4DQIA 1RHUB 3K7RA 1NSAA 5EWGA 1RYSA 1BUXA 1IR0A 3VZHA 2F5GA 2H54B 2RHQB 2HHPA 4EWTA 4RBUA 3RW6A 1VOMA 5F8JA 2D7SA 2DHXA 2W25A 2M70A 3ET6A 2GHPA 3NGKA 4XIUA 2W2MP 2BM1A 2G1HA 2XMMA 3NL0A 3KNAA 1BQXA 1Y5NB 1RWXB 4FKYA 5E5NA 3PW7A 3FRYA 4JYAJ 4IQXA 2MDAA 3W9HA 1IKXB 1S10A 3NCRA 3TRGA 1S5ZA 4QIEA 2HHVA 1P8GA 5DG9A 3DRPA 4PYDA 4CT8A 2W4PA 1VQLS 2CUYA 3C14B 1UVIA 3QLHA 4FPRA 3HM9A 2YKAA 3KFWX 2O66A 3GFZA 2CJBA 1IBMF 4HH0A 4DQPA 2VJUA 4ZPVR 4ELVA 2FVCA 4GKJF 4PQAA 3HSGA 3HVWA 2KTQA 2AQ4A 3DDNA 3G86A 3HSDA 2NR0A 4LSZB 3DCAA 4DZDA 5FDLA 3LP1A 4B3OB 2VOPA 3NGTA 5K8MA 3BGRB 5KFMA 4TY8B 3TVZA 2BJ1A 3EXYA 3QIPA 2H65B 4IUFA 2QL9B 2H9ZA 4MKAA 1HQUB 1TMMA 4WP9A 4ED4A 5F8GA 1CJTB 3HT0A 4MMOA 4DL5A 3CCVS 5GAEU 2CJKA 3QAUA 4KH0B 2UU9J 3GCXP 4ZPBA 4ES2A 2HRYA 2FJXA 1RA7A 3PTWA 3JS9A 1V9OA 5F9NA 3VV2B 5IT9Y 2EVZA 1LWXA 2XZTB 1FKPA 2AEFA 2WVCA 3SCLE 4YMEA 1YHQS 1EB0A 1SKUB 2QFIA 3H4DA 3CMQA 4YY3F 1NDPA 5LJ5Y 5HBMB 4FYDA 5CZVA 2E1RA 4J9PA 1T8EA 4IFYB 4USIA 4ZVPB 4B3SF 2YWWA 3KK1A 1RHQB 1U49A 2XLKA 1FEHA 2ZOFA 3N5FA 4KH1B 3T1YF 1J2VA 2HEKA 4O3RA 4ZHRA 1MWZA 1QVGR 4XK8C 4XDCA 2YNFB 2AJ1A 3GONA 2KT2A 1DQ9A 3HKWA 3HHLD 1NSKL 2F63A 3KNGA 4OYMA 2YNGA 3QZ8A 1NK4A 1IKVA 3UNGC 1B7FA 2RILA 5G0RB 4YB5A 2FJWA 2BRKA 3TW0A 1VQ6S 4X4UA 3MM9A 1VYAA 4RW4A 3TNVA 2OAUA 2VG5A 2GIFA 2ZVSA 3DHXA 3RW7A 2AP6A 4U7UD 1KOHA 1CEZA 3J81U 2R7QA 1QE1B 5HL7Q 2WBRA 5KFKA 3G2XA 2O1PA 2PC6A 2RSQA 2IIHA 1IKWB 4GVBA 1SJ1A 3WQPA 3IO1A 4CLWA 4M63A 4EEYA 1XK8A 1KRPA 1S1VB 4G1QB 3I96A 3SQOP 2DR7A 4MFBA 2GMHA 3LF0A 2KM8B 5IT9U 2QMXA 2JJ4D 3OFFA 3KLIB 2ZBPA 3TAMB 4IO9Q 1KQFB 3K0JA 3KJFB 5AE3A 5E3AA 2VFSA 2Z4PA 3IC1A 2SXLA 2MQPA 4XTTA 4B3TF 1M1HA 4P75A 4C8YA 1F9HA 3MECB 4A46A 2VDHA 4KQZA 1ZTTA 2R42A 4Q7AA 1XWLA 1WF1A 4P72A 1YKWA 1YJVA 2HWTA 3ILJA 4DJBA 4URSA 3TEGA 4X65J 5L1LA 3HO1A 4C8KA 4NI2B 3MTJA 2CPHA 3NS7B 4PEOA 2CQPA 3GQCA 4IG0B 2L9NA 3M8RA 2BW7A 4F67A 1KQKA 3WIVA 2BE9B 4AYBD 3KLHA 2V8VA 3B82A 4X4PA 1NK6A 4FBUA 1SXLA 1IR1A 1YBAA 3B54A 3D6MB 4XDDA 4NXNF 4DUYJ 1KLNA 1RAHB 2MEWA 4ZJQA 5KOXA 1JJHA 1Q86T 3VTIA 4F26A 2Q66A 3PNIA 3ZZ0A 5J1EA 5B0BA 4LVNP 4R0EA 3OTCA 3VGUA 5JVGQ 8ATCB 3M9MB 2NXJA 1HR0F 3DYAB 4RUAA 5EGYA 2V69A 1RT7A 1Y0HA 3KK1B 1FTRA 2KYXA 2VC1A 3QO9A 4A8FA 3VALA 3K2YA 3LP0B 4U96A 3DGPB 4OYPA 5CD4A 4J9OA 2A2DA 3E3XA 2XMAA 4F8RA 3M30A 3PJXA 5IV3A 2E9RX 3MM5B 2C28A 2BZ2A 4DBQA 3M2VA 3EDRB 2YBVA 4KGZB 3DMJA 3FVYA 4MK9A 2K3KA 4TVAB 1S59A 5CABA 4DLEA 3FCVA 4F25A 1C0TB 3TZWA 3CC4S 1U2FA 3RBXA 4W98A 2ZH1A 2KYZA 4CRJA 2A3JA 4EBCA 1FNXH 4UZCA 5HI7A 2OTLS 1WHXA 1ZBTA 4Y28C 4YHHF 4NE9C 2WW8A 5D0HA 2GHWA 3ZNUA 1KN6A 4NASA 4AL7A 3MMJA 1WKLA 4HI2A 3KG4A 2IJNA 2Z2LA 2XC9A 4LF5F 1D09B 4R8UA 4RX6A 2RQCA 4J9KA 4KO0B 2AW0A 2HURA 2RU9A 4DR2F 1OY8A 2DNZA 2EK6A 3OW2R 4NXMJ 3D2WA 2B3TB 1ZA2B 5K14B 2D3O1 2KJVA 4KPYA 3P4UB 1K1QA 4ZPTR 2Y8WA 3DLBA 3B8HA 1C0TA 4OI6A 3W9IA 4USKA 1YJWS 5B0DA 1UP1A 3CJRA 1L3KA 2VDIA 4ZA1A 1RT3B 3SQGB 1NAQA 2MKSA 4WP3A 4KV8B 2DRAA 3Q8SB 2KZZA 2CADA 4KIAA 4GO5X 3I32A 1RHRB 3D7SB 5H9EK 2FLPA 2AIRB 4F2SA 1HLWA 3DLEA 3IWXA 2P8IA 3WX8A 4WIQA 1QAYA 2DKOB 3LA0A 4O3QA 4M5HA 2X3DA 3H2VE 4HACB 3DLKB 3I4HX 3JTNA 3ADAC 2HK3A 4ZMMA 2PN6A 1DLOA 1T03B 2F1FA 2DH9A 2N4DA 5KFOA 1OPIA 4OL8A 3VAGA 5FJ4A 1LKZA 1YBTA 3HKZD 4E98A 2HFVA 1YTYA 4DPOA 4JOUA 1NSQA 4JI5J 1CJVB 1FERA 2AEJA 2PGCA 4C8MA 4OYXA 1HHTP 2GQQA 3DOLA 1KHWA 3MCSA 1ACMB 2V2KA 2ZHOA 5J2PB 2RDJA 3IR7B 4WFXA 3MMBB 1VS3A 2RDDA 3PW4A 2ATCB 1WOPA 1FRMA 2AYEA 4JI3J 2ZUGA 5B0EA 5C2GA 5F8LA 1H72C 4P2XA 4OFZA 2M9KA 3IG1A 1RDRA 2HGNA 4RW6B 1H2UX 1UPPA 3TJ8A 3W7BA 4BC9A 4D3HA 4YP3A 2AJ2A 3DDKA 4DV0F 4Y00A 2M7SA 1Q95G 3HPOA 2YH1A 3AB4B 3V6HA 5KT6A 2DXFA 1N5TA 1TELA 1EP4B 3A3NB 1RAIB 1WG4A 1JNZB 1TKTA 2DNKA 2VFRA 1KVKA 2B4VA 3EVWA 1JJCB 3OTOF 2OHDA 3GILA 3CJ8A 3EYZA 2DXEA 4WU2A 3KLFA 2J9DA 5AXLA 5CCMA 5LT5A 3MUMP 3AA9A 2LQJA 3NKYA 1NUEA 5E41A 2HZAA 2NXUA 5HQ8A 3GG1A 1LWCB 3UFCX 2J76E 4YEAA 1IXKA 5KFRA 3VGSA 2HFSA 4CH1A 4OV1A 1OO0B 2Q1LA 1EZZB 4OX6A 1KLMB 3VVUA 2FHJA 2AJ0A 1Q16B 2WOMB 2HAFA 1U6ZA 1YZ6A 1Z4UA 5GMDA 5LMUF 2B9YA 3AB2B 1GK8A 2DBBA 2K1RA 4K5RA 2CNLB 2E44A 2WVFA 5CAAA 5ITHA 1FNMA 2BXJA 2CJAA 4MK8A 1KSPA 4QYZK 2HNDB 5D77A 4LFCF 3NNHA 4AQYF 1YITS 2MY8A 3HHNB 1G6BA 2CJ9A 1AA1B 4P9SA 2VG7B 2QL7B 1QDUB 3MEDA 1RT4A 3IRWP 5JXSA 1TL4A 2QZ8A 3D54A 4IFYA 5CQGA 1RACB 4J90A 4RZRA 4HKQA 2JHEA 2HHUA 2DEJA 1VK3A 5HBMA 4TQSA 3OV7A 3C15A 1AT1B 2FVSA 1HYSA 2KG1A 5E2QA 5KFFA 2FJAB 1R8AA 2EI5A 4M5LA 2L08A 2OMOA 2KRBA 2WCXA 3V81A 3CJ0A 1CULA 3JTOA 3G96A 2GW8A 4ED8A 3IRXA 4P6QA 2OTJS 4OZ1A 4HTJA 3F73A 1HL6A 3PV8A 4XAKA 1VCTA 2B4OA 3PYDA 4LVOP 4M94A 1HMVB 2GVZA 4H4OB 2ZZNA 1WC3A 3OFEA 3BGRA 3JAMU 2J8SA 1J5EJ 1N32J 5FDLB 4AFFA 4LF7F 4CWBA 1RT4B 1JLBB 2DNPA 3D4JA 3I5AA 3IM9A 3PR4A 4QYRA 4WFNQ 5JVHQ 1VC6A 1JB0C 1KP6A 1NDCA 4DL6A 3CD5A 1F5BA 5KAKA 3OFHA 4N77A 2OSQA 1BXNA 4WCEQ 2XB2D 5LSLA 3RUBL 1QLNA 1U8SA 4N47A 2UVWA 2RF2B 1GXTA 3QAEA 1RCOB 3TX8A 4HTIA 1TFWA 2OPSB 4L76A 4WWSA 2E29A 4I6YA 5DZ7A 2XO7A 2GIRA 3UVJA 1IKXA 3ETMA 1PJ5A 4TLQA 1HA1A 2H4WB 3PY8A 4DR5J 1UEKA 1PJ7A 4PCQA 3JSRA 2UUCF 3GJTB 1NZ8A 4DR3J 2VQFJ 1FKOA 1SKRA 4ZVRB 4JB8B 1U0HA 4OZNA 3BYRA 4Z2XA 3J7A1 4I67A 3I4PA 4BWMA 2V34A 4NCBA 4PG8A 5IQQA 1JLFB 1VQMS 2XY5A 4ERDA 1U2RA 2GFFA 2IC3B 1UJ4A 2K2PA 3PYEA 3BGFA 2OGUA 1SL1A 1TL3A 4LR7A 4GVLA 1NB2A 2ZHBA 3LGHA 1CBKA 5KFTA 3ZZZA 1U1QA 2IVFB 3TQ1A 2CZ9A 5GAGI 4F50A 3VAKA 2I5JA 3H25A 2JVRA 3DGVA 4DFMA 1T05B 2E9ZA 3CCJS 1FX2A 4I4BA 5KFYA 2KKHA 1LW0B 3M1VB 2DGQA 4OYBA 5I4MA 2HPUA 3WHIA 1D8YA 2DNQA 2H1YA 3MEGB 3H5UA 4A8QA 4N56A 4O3PA 2MQMA 1HWJA 2OP5A 2CVIA 5EX3A 1QTNB 3MM7A 1AZSB 1OQ6A 4L74A 2KT3A 2Z56B 1HNWJ 4DQSA 1R43A 2F3JA 3MPWA 3DOMA 4WKYA 2BJDA 3KXDA 3MGJA 1RP5A 4HR2A 3UQSA 4HACA 1VHIA 4A4JA 3EM1A 4ZVFA 4UY8T 2HQGA 3AH6A 1X4DA 3D3CJ 3E51A 2LU1A 4LSNB 4C3LA 5BYRA 2MZ1A 1T3NA 3A4TA 2WZ1A 4ECUA 4ZVSB 4LF9J 1I94F 2DR9A 1KTQA 1S6OA 1WD6A 3CDEA 4YB6A 5HQLA 3KHHA 3T5LA 1X4GA 5BYQA 1T9TA 2HIYA 3LAMA 4Q2MA 3AFGA 3BR8A 1GX6A 2L9WA 3UO0A 2NPIA 4CO0A 1LK5A 2G0IA 3FCWA 4YHHJ 1T95A 2FYXA 4M5GA 3DRSA 3AJ1A 3FJ2A 1WTBA 2W4CA 2CWKA 4CLPA 1VLYA 1XMOF 1IN0A 1VQ8S 1AXQA 1TKZA 2YX4A 4NA3A 4B9UA 3M32B 2BANA 1NHVA 1SQEA 1X8DA 4ZP8A 2BUNA 1WC5A 3CDUA 1QAJA 1O51A 2CDQA 3W63A 4BS2A 3J7AN 4DPYA 3D9BA 3PJWA 1KOOA 4ZLNA 1PO6A 2DNGA 3MCNA 1VJWA 4FS2A 3N6NA 4F4AA 2FHMA 4AT1B 2OMLA 1CLFA 3E8OA 4HT7A 1YDLA 2CNKB 3JQMA 8RUCA 2E5HA 2PE8A 1S0MA 2MSTA 1RCXB 3M2VB 2ZE2B 2ZWPA 2I0XA 1HWUA 3PEJA 3MM5A 1Q7LB 3O6QA 1TL3B 2R2UA 6FDRA 1CQMA 2LVWA 2YWEA 3VWSA 2VL1A 1NO8A 1M5VC 2CAJA 5E33A 2OSRA 3C8YA 3RAQA 2DISA 2PIIA 4F4KA 2GQ2A 2LQ8A 2C3YA 3KHGA 5F3ZA 2HQFA 3D0GE 5C24A 2MHNA 4BC7A 3RRHA 1U0HB 1X4CA 3EVOA 3FRZA 1BLUA 3LAKA 3MTKA 4O4GA 4DHVA 2W9BB 3MCOA 3N9UC 5CHCB 2M4MA 1WSVA 3AHPA 5KFXA 2FZKB 3BGOP 2OIHA 1KQGB 2COLA 4PWWA 4C4WA 1HIYA 1EIYB 1PKUA 1N8RT 3MUVP 2C3OA 1X4FA 4A8XA 3FFIA 1RAFB 2ZJPQ 4C8LA 4O3OA 2WOMA 5SUHA 1FESA 2AYBA 3QMQA 2AKWB 4JI4J 3EGVA 4DF4A 1DTQB 1TUGB 1HBUB 1LXJA 4CO3A 5IM0A 3V6DA 1YJNS 3MECA 3R5JB 4DX7A 2CPDA 4PXCA 3KLVA 1AW0A 1SJQA 5C24B 4QR2A 3TANA 1OJ4A 4M5JA 2D69A 2HVEA 4CO2A 4Q45A 4LF4F 5LM7E 1R0AB 3BS9A 1GXUA 5CYMA 3RB6A 2HWHA 1IJEB 2FVPA 2EC0A 4JI3F 1ZM2A 4FF1A 1VBYA 5EDWA 2DK2A 3OR2B 2CNNB 3IG1B 2QL5B 5CXTA 2PMZD 4EMDA 4DFPA 1DFDA 2BYCA 3DFEA 4NL5A 4ECVA 3A3OB 1K0VA 3V81B 2CG4A 5J2PA 1VQOS 4QIFA 4FYWB 3LWMA 2XI2A 1MG7A 4RW4B 1FTCA 4HI1A 4MIBA 2W4DA 4J9LA 2YX1A 4DR1J 2JLEA 4M8LA 1Y4ZB 1SKSA 3TUIC 3MPVA 3MR3A 1IBLJ 2HNZB 3ICLA 1NLKL 4KGVB 1WHWA 2GNKA 2R8GA 3HLUA 2V9KA 5D8HB 5H1SV 3MAQA 2YNFA 3V4IB 4FF3A 3MEDB 1XMQF 2LEBA 2IM2A 3PYGA 4HT5A 4OI4A 3UWTA 3V6JA 1KDNA 5G4DA 3G8SA 1F2GA 3P3DA 4B02A 3K89A 5LJ3Y 4PWDA 3IS9B 3IAS9 3I82A 3NRBA 1DAXA 1WC0A 4IDKB 3BDPA 3Q0AA 4PG5A 3NGRA 1BQNA 5DS7A 2C3PA 1WF2A 1WKKA 1K8AT 4AE5A 4UQTA 2OPPA 1RAJA 2LDIA 4OIXA 2NCKL 4JYAF 1YJUA 5ETLA 4RUHA 2EW9A 4QPTA 4TKTA 5J1PA 4LF6F 2HHWA 1XTZA 4LSNA 2IHR1 3QRRA 5ETMA 2AGPA 2YKMA 1KLMA 3DXBA 3T9NA 4ZN1A 4LSLB 1L3UA 3AD8C 3KJVB 1N0VC 3BF4A 3KG0A 4O0NA 4AQYJ 4CO5A 2E7XA 5C25A 1YRTA 2GJFA 2MLYA 1B64A 2K7JA 1FA0A 3QT7A 3CCES 2DO4A 1M1KT 3EGWB 2F8HA 4K7QA 4OJ1A 1F5AA 1LWFB 2BMBA 3EPIA 3EE3A 3M6UA 1TKXB 2CA9A 1YBUA 5HROB 2ROGA 3FSIA 5D0RA 4DV1J 1D0EA 5DRKA 1XNQJ 1CJKA 5IT0A 4DCOB 2G9OA 4WTYA 1N6QA 3O8WA 2AX1A 3FGVA 3IAM9 2AF6A 4NLGA 4F3MA 3OFGA 4UOCA 3KOAA 1YRUA 2B6AB 4DV4J 1RTIB 1XR6A 4OI2A 2CJXB 2DCUB 2LQ5A 5EHHA 1DRZA 1RT5A 4CT9A 1S1UB 3DMJB 2R8JA 3PW0A 1JK9B 1FJEB 3RB0A 2F40A 4NLSA 2UVUA 1URNA 3OJSA 5GAGU 4NYPA 4DR5F 3KTQA 2K3IA 5A2QU 1MW7A 4YY3J 3PO4A 4FBTA 4DL7A 1LWFA 1CJVA 2OH2A 2CJQA 1WOOA 3DKDA 4WPAA 1RYRA 3QO9B 3W60A 4ED2A 3A1YG 3OTDA 4ED7A 4Q8EA 5JUMA 1Q79A 2FGCA 3DYAA 3R1LA 1LEOA 2ZH7A 2CQGA 2BOPA 3ZZYA 2ZM6J 3NOGA 2DITA 3M2RB 1VISA 3T1YJ 1F0XA 2OPRB 3PXGa 1JLQB 3TARA 1T9VA 4KTQA 3H5XA 2QRRA 5HO4A 2ZBRA 4Q8FA 4M5NA 3SXLA 2WB4A 5KTQA 4B9VA 4EYIB 2JRSA 3KJQB 1W2IA 3W5ZA 3SEOA 3PO5A 3JXOA 2LP4A 3RAXA 4DSJA 3RBZA 3THVA 1SJFA 3DU6A 4FXDA 1BQNB 4USTA 2IMOA 3BN4A 3GYNA 3PX6A 1EKRA 4B9SA 4K0KJ 3IR5B 2JNJA 2RF2A 4G65A 2IAJA 5HQMA 2CPEA 4PWDB 4BLGA 3FKBA 2VASA 3IWLA 2YWHA 5D3GB 1A9NB 1BC6A 3BH7B 2CQHA 5K14A 2WRMA 1HNXJ 1IWGA 1N5VA 2ZBIA 2G0CA 3EZUA 3K8VA 3J81Y 3PKMA 3KMQA 1NCLA 1N56A 3QWPA 1WHVA 4K0KF 5KT3A 2W9CB 2VBZA 3HHDA 2W2QP 3M6VA 3QGPA 2LDYA 4DV3J 1U45A 2HQCA 5A6PA 1WI6A 1X4BA 4OYZA 1BQMB 3IBCB 4O44B 4OZLA 5KG5A 3PR5B 2MZJA 3UDLA 4AL5A 1ZETA 3CW2C 1WF0A 5ETQA 1OPZA 1NKEA 1OY9A 1Z2LA 4PPZA 4OZ2A 2KRRA 1LXNA 2B7BB 2CYYA 2EKYA 5T7LB 1C4CA 1QY7A 1ZS6A 3WC0A 1GFWB 3RZAA 4KHPJ 4ED0A 1CULB 4B9NA 2GZOA 2MKJA 4ZDNA 3Q2SC 1U1LA 3JAMY 2GGPA 3D67A 4PAAA 3FEXB 4PWUA 1FE4A 1DTTA 3WX4A 3ZZPA 5KFCA 1ZZNA 2ASLA 3FZBA 3CIZA 1T94A 3PEHA 4UZBA 2J0SD 2CQDA 4IFVA 5CD4H 2DH8A 4KHRA 1H73A 1VGYA 2H48B 2XQCA 5EN1A 3A12A 4FNIA 2KG0A 3JSBA 1KS2A 2DO0A 4G1PA 3IP0A 2WBMA 1X4HA 2JEJA 4JV2A 2V8DA 4OV6A 3OSNA 1YI2S 4D3GA 2IA6A 1PAEX 2HNDA 2DNMA 3MPUB 3MWBA 4MKBA 3MMAB 3FMBA 4Y0FA 1HR0J 1BD6A 1ZM9A 4RR5A 4RWXA 4WZQA 3AD7C 2HQ3A 2MY7A 2OD6A 2DHGA 2LYVA 4J37A 2PD1A 5IFMA 1F6TA 1I1GA 2XI3A 3CB4A 2W7OA 2VPYB 1JLCB 2ASDA 1U1NA 3B4DA 3NCQA 1WNEA 1S49A 4F3OA 2WHOA 4LQ3A 2GGPB 3GZ7A 3I0RB 2FPHX 1S1WA 4LBIA 4C3MA 4JI8J 1RWKB 2Q6CA 2EBGA 2IDEA 4LFAJ 5DDRC 3RBEA 1TP7A 2LCWA 4X4SA 1FXRA 1LWCA 2MKYA 4RNFA 2NREA 2XY6A 3EGZA 4DV7J 2O5DA 4ZCLA 4ZJOA 8AT1B 2HVIA 2I1RA 4PXEA 1N4LA 1PCAA 4RW8A 3T41A 2XS7A 4GO7X 4K4VA 1GX5A 3DNCA 2HK2A 3L9ZA 3QPIA 5I3UA 1ZYQA 2BDPA 2H5IB 3GR0A 4EO6A 4RLEA 5K8PA 5J2MB 3CUNA 5DLFA 5I42A 3D5MA 1TL5A 4WP8A 1FHTA 2MZTA 1XR7A 1T9XA 2P9EA 3OPKA 1YRXA 4CYUB 3SI8A 2YNIB 2NUHA 5KFWA 4X2BA 5E0OA 2E5LF 2C2MB 3OSPA 3LW5C 4C6AA 1UFWA 2B43A 4LRCA 3IGNA 3K5LA 1HBUA 1LV5A 3BKTA 4JI0J 3C14A 5T41A 4NA1A 3R6LB 1GH8A 1YZ7A 3DRXA 5D0EA 3QATA 3RBDA 1S57A 4IRKA 2HFZA 4IKAA 2JLGA 4JI5F 3U1LA 5HJXA 3MM9B 2XO6A 1CG2A 1H7XA 3DOLB 1OSCA 1GEHA 2LU2A 3UDVA 4GC7A 5G0RA 4B3RF 1XNRF 1HBMB 2NUUG 3LOUA
chains in the Genus database with same CATH topology
2FDNA 1AFIA 3O2IA 3NWGA 1VIXA 2RS8A 2ZDOA 5HMYA 2KI2A 1N6QA 1FNOA 2Q43A 3MUTP 3AQOA 3L7PA 3MEEA 3EX7B 4WZMA 5AXKA 1NRKA 3SFGA 2DJWA 1ELOA 1YVFA 3CEDA 2F9JA 3DI6A 4ETXA 1VQNS 3O1LA 2X1BA 3DLEB 3Q8PB 2CQ2A 5CH7B 4PUOA 2KJWA 5KT4A 4KV8A 4MH8A 1S9FA 1V3RA 1X4EA 1Q7YT 4XPCA 3LGMA 1FK9B 3VZIA 2ZOMA 3CC2S 2C2DA 1LFPA 1VHFA 1VMBA 2D9PA 1U7LA 3BSAA 5D4PA 3MURP 4IG3B 1S1XA 1GQEA 2R9LA 3DRRB 1GAOA 1ZAXA 3SSQA 2PT0A 4R8UB 4X62F 5KG7A 2YNIA 1P6TA 2VFUA 2NLWA 3F56A 3NAIA 4J9MA 3T6JA 3TA1A 5I42B 4OX7A 2AJFE 4NRUA 2LQBA 4C9DA 4Q44A 2VV5A 5U47A 5L38A 2MQQA 3NG8A 4OI0A 4GMKA 3UE2A 2W8KA 3GV8B 3QLHB 2XCPA 3LUYA 1IBLF 4X4QA 1AFJA 4TU8A 3ZZUA 4RKUC 2EFVA 2IC3A 5D78A 1LFWA 1JLFA 1YJTA 4I69A 2EFPA 3H40A 1E6YA 1UWBA 2V8HA 3GR1A 2NYIA 3I0SA 3L09A 4DG1B 3G4SS 1IBKF 2JC0A 5DG7A 1WACA 4NOHA 3BO2A 4B9MA 2FB0A 3IS9A 2HGLA 3N79A 1L3VA 3Q22A 3M6WA 2QSWA 3F41A 4NLWA 3CCMS 3GSDA 5B0FA 2C2EA 1N36F 2YKNB 1SL0A 4CNYA 2D9OA 3SCJE 3V4IA 3M8PA 2BBEA 3MEGA 1VK8A 4QBUA 4ID5A 4DSIA 4DEZA 4FXWA 2Y1IA 3OHAA 4KC5A 4KAIA 2HHQA 3OR1B 2KFZA 2YKOA 2MQNA 3KG1A 4IFVB 5CZXA 2RUGA 4DV5F 2HWIA 2E1CA 2WSEC 1UVMA 1NJZA 5J2MA 4NLQA 4U67Q 2XGQA 4DX8H 1M5OC 3GE9A 3IFEA 3D28A 4WF9Q 2ZC3A 1OWXA 3D1HA 2KFYA 1EETB 1RWUA 4NZ0A 4QZVB 2MZSA 4CTAA 2IJFA 4FF4A 3IRXB 3KHLA 4DR4F 2IM0A 5LL6d 4DSFA 3R5BA 2W9CA 1HNVB 2D3OR 2MPUA 5LXYA 4IOAQ 4UUXA 4OHZA 5KFIA 2GJ2A 4O3NA 3K5LA 5F8JA 4W90B 1JLCA 4ES3A 4A8WA 4N8OA 5HMZA 2ZKUA 3LO3A 2ZDPA 5GVQA 3H8YA 3FFIB 1JLAA 4UUWA 4Y2IA 4EGLA 4ECZA 4DR7F 1N54B 1B0TA 2GX8A 2RVJA 4KFBA 2QMWA 2YVSA 4JUZA 4DL4A 5IXUA 1HNXF 2IRUA 4ZHRB 4TQRA 2GC8A 3RR7A 4TYAA 4G1IA 4ITSA 5DQHA 3GB0A 1JLQA 4KFBB 3T3FA 4IH7A 1D9DA 4ZVEA 1A6LA 2WB1D 1S1TB 2B56A 3NNAA 1M5PC 2DR8A 5A8RB 2BJEA 1DTTB 3G6YA 1G1XA 4FNHA 2UUAF 4J9NA 3M6XA 5KFVA 3CIMA 4BBYA 4KHPF 1RGVA 1D3WA 4R5PB 1OQ3A 2AV5A 3P5TL 1YQHA 1REVA 4QPXA 5HMWA 2XCAA 1S6PA 3O5TB 1Y7PA 2B5JA 4IH6A 3GIIA 2PI4A 1BQMA 3QIPB 2VG6A 4O44A 2B6AA 1OS5A 4X65F 1KQSR 3WBZA 5GMKa 3H2UB 4DUZF 1R6YA 2D3UA 2VC0A 3CDWA 2VZ9A 2ASYA 4IRDA 2VG7A 2DGUA 2YH0A 2R2TA 4RW6A 1TKXA 1HD0A 2Y0SD 2VKRA 2Q3PA 4DUYF 4F4XA 2ZNYA 2D74B 2FVRA 3VQTA 1LW2B 2F8EX 2JOQA 2JL9A 1Q82T 5DGBA 3WZ0A 3VAMA 1TV6B 1TVRB 1RA6A 2AX0A 2DNYA 3CCRS 2YWKA 2O01C 3RU0A 2LA6A 5KFNA 1S76D 3N0VA 4HHJA 1N0UA 1S99A 3CE8A 4WYLA 1DLOB 2VFTA 3CD6S 2QO3A 5BYSA 2V4JB 2UP1A 4FP9A 2N7YA 4QW8A 3OXFA 4KGKA 4I2PA 1RTDA 5F8NA 3CJ4A 5DQGA 3M4XA 3BZQA 5K8NA 1FDNA 4OJHA 3W2VB 5KFLA 2BR0A 1HI0P 3GWCA 1M90T 1Q8BA 2LEAA 4Q2LA 4KR0B 1SUQB 2RD5C 5DDOC 3FQLA 2MKIA 2PI5A 1S97A 1LQ9A 3FDSA 1TZ0A 3JSMA 2ERRA 4F2RA 2I5JB 3RRKA 3PW2A 2J6UA 1S72S 2XHWA 1Z2ZA 3KKFA 4KO0A 3MM6A 3S1TA 4OQJA 2N4CA 1G3OA 2OD4A 1I94F 3CWJA 2QEXS 3MMCB 3DRYA 4BCAA 2FGOA 2B4UA 4HL9A 3MEKA 2YNHA 4NLYA 2QA1A 4DWIA 1RK8A 4JV5F 1KNZA 1FDAA 4I6WA 3MR2A 3CCUS 2G4BA 2VPWB 1D1UA 3BM7A 5AXMA 2GJIA 3VAHA 7FD1A 4K4UA 2QLWA 5D4LA 2FIUA 5KG6A 1YG0A 2DNLA 1O5JA 2Y1JA 3HHLC 2BA9A 4U7UK 1QAIA 3DOKB 4NCGB 2IMWP 5IWAF 2MHEA 1N33F 4M95A 1VC0A 1B0VA 3PDNA 2CPZA 1PC5A 2CPIA 5DQIA 4JI1F 2E9TA 1QM9A 4IH5A 2J6SA 4YFUA 1N6QB 2AWZA 4JI4F 1KD1T 4YUDA 2MQLA 4OX8A 5DLGA 3HXMA 1NK8A 3OL6A 1UA1A 3M2UB 3CJKB 1HBMA 2HNZA 3GFHA 1ROFA 4C0BA 4DN9A 4EU0A 2CPXA 3K58A 2B51A 2BRLA 1MMLA 5KG1A 4WKRA 3CF5Q 1JLGA 3LWLA 4X84A 4KBIA 4I7FB 2FLNA 1TFYA 1MWYA 1WG1A 4ZPDA 2HHTA 2Z2MA 4NCAA 2DD8S 1IJFB 4C0OC 4YR3A 3OTBA 1N5QA 4USHA 2H5EA 1W2BR 1SJ3P 5E7OB 2IVYA 4RW7A 4TLRA 2KXFA 2UV8G 1KFDA 4K4TA 2EPIA 1S48A 1HNZF 2EFGA 2KXNB 2R8HA 3POTB 2AGOA 4LF8F 5CYMB 1Z1ZA 1S6QA 2LXUA 3ENVA 2UVRA 3LP2B 2JDJA 4MFBB 2BVZA 1H6KX 2ILZA 5B0AA 1U4BA 1FVSA 4ED6A 4ED1A 1JLGB 5B0GA 2I8EA 4ZCKA 4A8YA 1KONA 3BGUA 5A8KB 4ZVGA 5MLCV 2CPYA 1WEXA 1HWKA 4QOTA 3DXSX 1SB6A 4AL6A 2KFNA 1VQSA 3DRSB 5CA5A 1E6VA 1ZOTA 5J2NB 4I1TA 5F8IA 5KG4A 3RTVA 1IKVB 4OI3A 4ECSA 3CC7S 1PSDA 3NP5A 1RTHB 3BDEA 2W9BA 4ILMA 2KO1A 3UR0A 3G8TA 1QUPA 4ZOSA 1XEZA 4QQBA 4A47A 4DV4F 1YJRA 1WI8A 3N6LA 3NCPA 2KHCA 3J7YU 2ADCA 1HQEA 2E66A 2EFNA 4IOBA 4WJBA 4NA2A 4OI1A 3TVYA 3HX9A 4CH7A 3JYTA 2VBWA 4TYBA 3BO3A 2Z8QA 4NWBA 3BSNA 2HRUA 3FSYA 4NLUA 4NX9A 1ZPVA 2PSZA 2MB0B 4K4SA 4OHXA 3L7OA 4C97A 1UFLA 1JIHA 2XSFA 3PX4A 4JV0A 1S1XB 2L3MA 2DGTA 4OZ0A 2VFVA 1WHYA 1HQUA 2J9DE 3ONQA 3RRGA 1H3DA 1RT1A 2VQFF 2W24A 1SKWA 2ZC4A 2DIUA 4TY8A 4Y2MA 1FD8A 1P27B 3K5MA 2JEFA 4C8OA 3OL9A 4Y2AA 3IXQA 2MXYA 5KOWA 2NSCA 5JJBA 2OKQA 4RBTA 3S8SA 2XS2A 3U7JA 2A1BA 2CIMA 5B0CA 1T03A 4HH1A 3CULA 2FD2A 4Y3CA 3SYZA 2O67A 2R7WA 3T5JA 3HFKA 4QWDA 3RB3A 2DHAA 3DRPB 4QJVA 4DR3F 2W8LA 2LLZA 1VRUB 4WXOA 5IS2A 3CPWR 2IBKA 4MAKA 3IGVA 4K59A 3OL7A 1MMNA 4I56A 1UVLA 1HI1A 3V2UC 3VF0B 2GV1A 1RT6A 1J5OB 4AXIA 2GIQA 2P9CA 4V19X 3M2RA 3N6MA 2VOOA 1R27B 1Y3KA 4X4RA 1K73T 5B09A 2HFOA 2CRLA 1FJ7A 3MR6A 4FZVA 5B7WA 3KK2B 1DHMA 2ROPA 5K8OA 2CQIA 2XWXA 1QSSA 3H5YA 3NGDA 4UW2A 5I3QA 1FJGF 3W2WB 4HEA9 2JC1A 5DDPC 4Q0BA 5AE1A 1CSJA 1RT5B 2CPFA 5L9NA 2M3DA 2DPJA 2FC8A 4MYTA 1VBXA 4KB7A 4ZCIA 3CJ5A 4ZPWR 5DGAA 1DARA 2ADBA 4TNOA 4H4KC 1A7GE 2KZMA 1TK8A 2HGMA 4CH0S 4WFZA 3W2VA 3KLEA 3QWUA 4R5PA 3VCDA 2XMWA 4NLPA 2CFXA 5E3QA 1HNIA 1X9WA 2RNEA 4KKOB 4ZP7A 4ZKAA 4N5SA 2ACYA 4DL0C 2HZCA 2HNYA 2JEGA 3E01B 4YDDB 4HVZA 3KJVA 4LSLA 1LK7A 1WTFA 1NHUA 3PHEA 1MU2A 4KSEB 1TAQA 2AU0A 1JWWA 2JLFA 3OL8A 1RT2A 4WYWA 3QGHA 1PILA 4H4MB 1TVRA 4ZVHA 3THTA 2N3LA 5DETA 3ZFVA 3FMWA 2BE2B 2KVIA 5F9LA 1X9MA 2UU9F 5T14A 1U47A 1RT2B 1H98A 1UETA 3CD0A 4JI8F 2W7PA 3HZEA 1NK5A 4U9RA 3WC2A 2X1AA 4EZ9A 2RQMA 4B3MF 3P49B 1FEEA 2XMTA 3GFXA 3FEYB 3JTPA 1UKUA 2QIFA 4M1KA 4HDHA 1NJYA 1YSJA 1X5TA 1QSLA 4NXMF 4M5DA 1BY9A 1M0SA 1NEEA 3FSXA 1WWHA 4U7CA 1EETA 2V9WA 2ZH8A 2M8HA 4MYUA 5BJRA 5F8MA 1X0FA 4DSLA 3MOZA 4C8ZA 5KFSA 1SL2A 2MKHA 5LSOA 1N5YB 1S77D 4TXSA 5KT2A 4ZPAA 1U24A 3TP2A 4UY85 2GO8A 2U1AA 4HLBA 1DZ5A 5L39A 1HYSB 4H54A 4JI2F 1B0PA 4QR0A 1K1SA 3D0HE 5D3GA 4YR2A 4LQ9A 1SV5A 4JBCA 1R0AA 2WONA 3NAHA 1HFEL 4EFAC 3PM9A 4IR9A 4LT6A 4I7FA 4CO4A 2PEHA 3DLGB 4NZ7A 1Y5IB 2XLKA 2FJEB 4U6PA 2W9AA 4B9LA 4ID5B 5KFUA 3T19A 1X4AA 3X1LB 1K0TA 1NJWA 3M8PB 4DS4A 1N34F 3G6XA 3ITHB 2IVMA 4NLVA 5J2QB 2HNYB 3DN9A 3CCZA 2BQ3A 1R8CA 2ZZMA 2KXHA 1FKPB 4G6VB 4QIVA 4EBEA 3B4MA 4DQRA 4DG1A 1NJIT 1NB7A 4F4YA 3DOKA 4NCGA 4NLOA 1HNVA 5DM7Q 2QA4G 2XEXA 1U6BA 1OIAA 2PA3A 3K5OA 4FVMA 2RB7A 1MROB 3AAWB 2ZH4A 2FJBB 3LH2S 1N48A 1QJHA 1L5UA 2N7CA 4HDGA 4KE5A 4LUBA 2XS5A 1TKTB 4DOZA 1YWXA 1HW9A 4NLRA 3BGLA 5CYJA 1FVQA 1HBNB 3HVRA 3CCSS 2QSFA 3C2PA 3TA2A 2ZE2A 3DU5A 4PKDB 3GV5B 2MGZA 3QJJA 2C3UA 5HP1A 3QZ7A 5HN0A 1FRLA 3NS6A 2UV8A 2UXBF 3OLBA 4URGA 1JKHA 3HI9A 5K5MA 3CVKA 3MAHA 5C25B 2HVHA 3SV4A 3UCGA 1RKJA 1Y00A 3CXCR 4PXDA 3G6VA 4B17A 4JI7F 2BANB 3PRDA 4LJMA 4YQWA 2D1CA 1UVJA 4PQUB 2XSJA 3CT9A 3MD1A 2RRNA 4H4KA 3R1HA 5F3TA 1TQLA 4E8UA 4DLGA 3MPYA 3ENQA 3TYTA 4I2PB 2RH3A 1RTDB 2OPQA 3CO9A 2E5IA 2GQCA 3R5AA 5C42A 1Q1KA 3HF5A 3MI7X 3US5A 5E3CA 3NS5A 3C6UB 2J0QD 5J1EB 4NYZA 2B0GA 3N01A 4K2XA 4DF8A 4RW9A 3DC2A 5A0YB 3HHEA 2LMIA 5GADU 2G13A 4C2MA 4N8NA 4QWCA 3KLHB 2FVQA 1RQ0A 1MMDA 3PFOA 2DNOA 1G7CB 3PW5A 2KT5A 1P9QC 1TK0A 2R7SA 4BDPA 3KWMA 3QYYA 4RNHA 2DPIA 4L72B 3RR8A 1TL1A 3G6ES 1XMBA 1Q4RA 4C98A 4OHYA 2J8AA 2CVEA 1TAUA 2LKZA 2QYCA 4CIOA 5HLFB 1NK9A 3C46A 5L8RC 2AGQA 1XC9A 1DBDA 3CMAS 3AJ2A 5AJ3F 2JWNA 1VIOA 5KFJA 2HHXA 4IG3A 3OXGA 1HBNA 3JSYA 1VQYA 2XZWA 2R7XA 1S6QB 3D0IE 3TR5A 4ECWA 3KLIA 1T05A 2VG6B 2MKKA 2VBXA 4GKKF 3N5BA 1N52B 4IRCA 3CGIA 1V6HA 2AD9A 3SDEA 3H59A 4GC6A 3C3LA 1RJJA 1DQ8A 1HI8A 4KJIA 2G1DA 2FJVA 1Y5LB 4EYHB 4WFAQ 3DI6B 1S1WB 2V4RA 1S6UA 3QIDA 1TR0A 4DV3F 3MF5A 2IYIA 5A2QY 5J2QA 5A8WB 1ZM4A 5B08A 1VQKS 2GO9A 3SSSA 1KEKA 1S10A 4L6V3 1U25A 3SMZA 4ED3A 4K50A 4KHMA 3SZ2A 3M2UA 3EXCX 4Y6IA 4JI6F 2UZAA 3CDAA 1M5HA 3HP6A 2IRYA 2FHKA 4O4GB 5DO2A 3OVAA 5I3PA 2GCFA 1C0UA 4O0IA 3I6PA 5FIIA 1NKBA 2DVIA 2OPSA 5GADI 2HS4A 3BQ0A 2QV6A 3EGNA 3FNNA 4OLOA 3V5RA 4FVCA 4ES1A 5GAEI 2RKIB 1R8PA 3OLAA 4BWJA 1UJ5A 3T5HA 2ALZA 1F60B 1PGZA 2POKA 3OTEA 1VQ9S 3L95X 4USJC 1XN9A 3PIOQ 1JLBA 3HHKA 2AYGA 2HYIB 1U1KA 2V5HG 4XPEA 4B08A 2EG2A 4YDXA 5M2PA 4R25A 4CTAB 2DR5A 3QJLA 5T7LA 2B9XA 1CC7A 2HFNA 1S4FA 2EFQA 3Q24A 4A8KA 3OQ2A 2HIQA 4QR1A 3SCKE 2A18A 2M0GB 3M32A 4DSKA 4ID8A 5FLXY 1N88A 4WFBQ 4MTPA 3ENWA 3I0RA 2PDAA 4QIGA 3WDOA 4K5SA 4AUKA 4NLXA 2L9DA 2RMLA 2W7AA 3FZ2A 4QIWD 2R7TA 1HWLA 4OZJA 2CQ0A 3HK2A 4Y2CA 5EUHA 2WSFC 1QTMA 5A0YA 4J9QA 3EPGA 5D4OA 3C6TA 3B78A 1PC4A 1MNEA 5IT4A 3CTRA 3K5NA 4XO0A 2VQEF 3I31A 3EUNA 5C42B 3HT3A 3VQSA 3IA0A 4Y34A 5L1JA 3J7ZT 1VC5A 4K4XA 2DTJA 2J6TA 2J7KA 2FHOB 4KGMA 1KTVA 2HMIA 2M2BA 3U1MA 3CCLS 4NZ6A 4YR0A 1KVIA 3BR9A 2Q6BA 3V6KA 4DR6F 1R31A 4RNOA 1GNKA 2N3OA 1FF2A 1E6YB 1UWBB 2XBPA 3I0SB 1H2VZ 4KRWA 4FS1A 3NLCA 2DNNA 1IQZ