2HNZB

Crystal structure of e138k mutant hiv-1 reverse transcriptase in complex with pett-2
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
422
structure length
399
Chain Sequence
TVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNKTPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights into mechanisms of non-nucleoside drug resistance for HIV-1 reverse transcriptases mutated at codons 101 or 138.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords Reverse transcriptase/ribonuclease H
total genus 109
structure length 399
sequence length 422
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2006-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2hnzB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2hnzB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2hnzB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2hnzB03
4QWDA 2HNZB 4B3OB 1HQUB 4I7FB 4Q0BB 1XR7A 3V6HA 2HWHA 1TVRA 2W9CA 1NNDA 4YR0A 5K14B 3QIDA 1VRUB 2J6UA 2WOMA 3IRXB 4I2QB 3SFUA 5KT3A 5C24A 1C0TA 1S6PB 2VG5A 2JLEA 5KFXA 3PHEA 4WFXA 5KG1A 1NHVA 2IC3B 4ED1A 1LW2B 4IFYB 1J5OA 3DDKA 4IDKA 5I3UB 2JC1A 4Q45A 2JEFA 1RT2A 1KLMB 2FJWA 3DM2B 4FBUA 4ECWA 2I1RA 3TAMB 4Y2AA 3OL7A 2BQUA 3V6DA 4IKAA 2D3UA 1TL3B 2XC9A 3UQSA 4F50A 3I0SB 1N48A 1RT3B 1TL1B 1HPZB 1QE1A 4KO0A 4H54A 4JV1A 3PJWA 1RA6A 3CJ3A 4ECZA 1RT5B 4OL8A 2V9WA 5D3GB 2UVWA 4M94A 1T3NA 4ECXA 3DRRB 3CJ5A 1RT6A 2AGOA 3T1AA 4J9MA 4PQUB 4EYIB 4TLRA 4DL7A 4IH6A 3GIKA 3DOKB 1FKPA 1S9FA 3LANA 4WFZA 5J1EA 4URGA 3KHHA 2UVRA 1LWFA 1RTIA 3KLGA 2ATLA 5FDLA 2IM3A 2V0NA 2CJQA 1D1UA 4Q44A 1RTHB 3OHBA 5DQIA 4NLYA 5EWGA 3N6MA 1C1CA 1KHVA 4LQ9A 3M9MB 3TQ1A 2VA2A 3KMQA 3KHLA 4IRKA 3IG1B 4KSEB 3DLEA 4Y3CA 4O3NA 1RTHA 4URSA 3RBDA 4RW4A 3KHRA 3SFGA 4O3OA 5KFPA 3LP0B 1HYSA 2C28A 1R0AA 1IKVB 2VG6B 2HMIA 5KFBA 2WTFA 4GC6A 5J2PA 2BR0A 1RTDB 1JLCA 1JLAB 3Q8QB 5JUMA 1RT6B 3FSIA 2AGQA 4DG1B 2GC8A 5HBMB 3MR5A 3HKWA 5KFSA 1SV5B 3DOLB 5DQGA 3NBPA 3CDEA 4I2PB 3BQ1A 2XCPA 3V6DB 2ZE2A 2RDJA 4KKOA 1S97A 5CYMB 3MF5A 4YR3A 2DPJA 3I0RA 2YNIA 4FS2A 2UVUA 3N6LA 4LSNA 1N4LA 1KHWA 1T03A 5EDWA 3V81A 3PW2A 4R8UA 4EO6A 1JLEB 3QIPA 3PW5A 1ZTWA 4KBIA 3OLBA 3H40A 1S1WA 1S9EB 2YKMA 3V4IB 5DQHA 1RDRA 4WE1B 1S1TB 4G3IA 5HP1B 3CDWA 1MU2B 2ILYA 4KE5A 2YKNA 3KJVB 1SV5A 3BQ0A 3ISND 4ZPDA 1JLGA 1RT7A 5DG9A 1CSJA 1C0UB 4ICLA 2RF2B 4Q8FA 4K50A 4RZRA 1S1VA 5J2PB 1HMVA 4RW9A 3CJ0A 5KG2A 4I2PA 3JYTA 2R2UA 4PUOA 3EPIA 5KFUA 2W9BB 3HHKA 2YNFB 4WFYA 4J9KA 3LP1B 1JLEA 4TN2A 4K4YA 4NLDA 3DRPA 3MTKA 4QWBA 3CJ4A 1JLBB 2DPIA 1HARA 5J2MB 3MEEA 2XCAA 3M8PB 4U7CA 4M95A 4YMEA 2XI2A 3GV5B 2WHOA 3H5UA 1LWFB 3KLGB 4KKOB 1TKXA 4NLXA 3MEDB 4RW6A 1R0AB 1HNIB 3QGHA 4TY9A 4EBCA 5HROA 4K4TA 3H4BA 4MK9A 2I5JB 3KK1A 3V6JA 2IM0A 4H4OB 1RTJA 3IG1A 2OPRA 4LQ3A 3KLIB 1JLBA 2UUWA 5KFNA 3PW7A 1REVB 5HLFA 4DG1A 4ID5A 1RTJB 1XR6A 4MIBA 5C5JA 3QO9A 3Q8SB 3KK2A 3KLIA 5KFVA 3BSCA 4RW9B 2F8EX 1EETA 4KB7A 3CWJA 4URQU 1RT4B 2IM2A 4TQRA 1HNIA 4RUAA 1U09A 4WXOA 3KLFB 3KK3B 4ICLB 4HYKA 3NL0A 1BQNA 2ASDA 2BANB 2BQ3A 2AX0A 4IFVB 3PW0A 1DLOB 3KLEA 2OPSA 1TKTB 4QWEA 3CVKA 5HROB 1LWEB 3M9NB 3DRPB 4MFBB 3MEDA 4ZP7A 3BSNA 5J1EB 3NAIA 3DOKA 4PWDA 4F4ZA 3PR4A 2IM1A 5DGBA 3E01B 3JSMB 3E51A 4YQWA 3LALA 4JUZA 1SUQB 5JXSA 5J2MA 3G6YA 4DL3A 2ZKUA 5KT4A 1C1BA 2YKNB 2WOMB 3IRXA 4I2QA 1RAJA 3CDUA 1DTTB 4ECTA 1TVRB 3H5YA 3I0RB 1TKZA 1NHUA 2W7OA 1HMVB 5KFWA 1S1TA 1FKOB 1MU2A 4ZP8A 1LW0A 1RT1B 3SI8A 3OL9A 2C2RA 1S9GB 1JLFB 5EWFA 2IBKA 1LWCA 1DTTA 4J9LA 3PVXA 3DMJB 3QGGA 3G86A 3GYNA 3DI6B 1C2PA 1LWEA 4QW9A 1T03B 1C1BB 1C0TB 1S6PA 5KT7A 4IRCA 4O3QA 1VRUA 3IGVA 4FS1A 4J9OA 2BANA 1SUQA 2OPPA 5F8LA 4ZVEA 3M9OB 5CYMA 3E01A 4NLSA 1S9EA 1W25A 5F8HA 5DG8A 3LP0A 2HNDB 4ZHRB 5C25A 4Q8EA 2IJNA 4TY8B 3BR9A 1TKZB 1TKTA 3LAKA 4ZPCA 2XGQA 4MH8A 2W7PA 1TQLA 3QO9B 1JKHA 2FJXA 1DLOA 3KLEB 5EUHA 4IH7A 4J9NA 2IA6A 5HBMA 1S1UB 4RNHA 4DL4A 1WNEA 2AWZA 4J9RA 3C6TB 5J2NB 3DRSA 3KNAA 4K4UA 2BQRA 2FVRA 1XR5A 3T5LA 4IR1A 4XPCA 4RW6B 5KFYA 3OLAA 2J6SA 3DRSB 2VG6A 2HMIB 2OH2A 4K4VA 4MFBA 4EEYA 2FVPA 1S48A 5CYQA 5J2QA 3Q8RB 3MR2A 1DTQA 1UWBA 3KLHA 4KO0B 3LAMA 1S49A 4R5PB 2XI3A 5KG7A 4FBTA 1TL3A 1S4FA 2AQ4A 2HNDA 5C25B 4IOBA 4PUOB 4NLOA 3BQ2A 2QV6A 5KFKA 1ZETA 3C6UB 3GV8B 3DYAB 3BREA 4IFYA 5DGAA 4KFBA 5F9LA 1RYRA 4RNNA 1REVA 5HLFB 4ECUA 2EC0A 3CIZA 5KT5A 5D3GA 2D41A 1RTIB 5KT6A 1HPZA 1BQMB 1QE1B 3ITHB 2V4RA 3LP2A 1S9GA 4RW7A 5KG4A 3PJXA 4RNMA 5KFTA 1N6QA 1S1VB 3QZ7A 1TKXB 3C6TA 5J2NA 2RF2A 2R2RA 4TYBA 2FLLA 1S1UA 1JLGB 1RT7B 4IDKB 5I3UA 3FQKA 4ED7A 1C0UA 2FVSA 1JKHB 4NRTA 2ZD1A 4NYZA 3H98A 3DI6A 3KJVA 4Q43A 2R8HA 4ED2A 2HAIA 4LSNB 4QW8A 3T5JA 4KAIA 2YNGA 3GIIA 5KFDA 5KFZA 2O5DA 3RAQA 4I7FA 4Q0BA 2WK4A 1S0NA 4PWDB 1RT1A 2YKMB 3V4IA 3H59A 3I5BA 3T5KA 1T05B 4ECYA 2ZE2B 4TYAA 5KFLA 3M8QA 4ECQA 4MK8A 2WB4A 3T19A 2UUTA 3DLGA 4K4XA 3RB4A 4QPXA 4IFVA 5F9NA 1IKYB 5KFJA 1MMLA 4NLWA 5L9XA 5KFGA 4F4XA 2ILZA 2VG7A 1LWCB 2YNIB 2HNZA 4B3OA 4ED6A 3QLHB 3UPFA 5HP1A 4RU9A 1JLAA 3NMAA 3HVTB 3I5CA 3OL8A 2E9RX 3G6VA 3H4DA 3NBPB 4ZVHA 4TQSA 1IKXA 5KG6A 4NLQA 3MECA 3MR3A 2B5JA 3BJYA 5DLFA 2JEIA 3BSOA 1BQNB 4NLTA 1JLCB 2D3ZA 2I5JA 3OHAA 2AX1A 4KV8B 1JLQB 4DL6A 4QWCA 2YNHB 2FVCA 3FQLA 3D5MA 5KFFA 1EP4B 4R0EA 2OPSB 2D7SA 3DLEB 3DRRA 3H5XA 2BRKA 1FK9A 2V4QA 1GX6A 2OPRB 4ECRA 5F8GA 2FVQA 2E9ZA 3UR0A 1JIHA 4EBDA 5I42B 5KG5A 1RT3A 1TL1A 3BGRA 3IS9A 4O4GA 1VRTB 1RTDA 3DYAA 1T94A 3ISNC 3NGDA 2AGPA 1JX4A 3C6UA 4JV0A 4YR2A 3BGRB 3IS9B 2OPQA 1HYSB 2C2DA 4H4MB 5C42A 3FDSA 3RAXA 3UDLA 4ID5B 4ZVFA 4O3RA 3KLVA 3MEGA 2B43A 1K1SA 1DTQB 1UWBB 3KLHB 4H4OA 1HQEA 2R2TA 5CYQB 3KOAA 3MECB 1EP4A 3CJ2A 2W9BA 5FDLB 3DM2A 3FRZA 4EO8A 1HNVA 5KT2A 3TVKA 3JYTB 3TAMA 3MR6A 5T14A 2R8GA 2R8JA 2W9AA 4WZQA 2HNYB 1RA7A 3RBEA 4ZPAA 1QAIA 4NCGA 2RKIA 5KFEA 1LW2A 1J5OB 3MEEB 4RNOA 2W8LA 2FLNA 5F8MA 5C24B 2B6AB 2R2SA 1OS5A 4Y2CA 4EBEA 3KHGA 5K14A 4ZPBA 2FLPA 4O44B 2YNFA 4NLPA 1SH3A 3QYYA 4Y34A 2GIRA 2R8KA 3H5SA 1IKWA 2BE2A 2GIQA 3NAHA 3DLKA 5KFCA 5KFHA 5L1LA 4O3SA 4F4YA 4ZHRA 4ZMMA 3HVAA 1RYSA 5KFRA 3DLKB 1KLMA 1N56A 3QIPB 5DLGA 4WZMA 2C22A 3GV7B 5DG7A 2YNGB 3H2LA 4WXWA 4QWAA 2IAJA 1N5YA 1S0MA 3V81B 2VG5B 5KG0A 5KG3A 2XGPA 2IAJB 2RKIB 1N5YB 5KFOA 4WE1A 2JEJA 2HNYA 4KHRA 2ALZA 2WONB 2QE5A 3HVTA 4K4SA 2FJVA 3T5HA 2JEGA 4MIAA 4ECVA 4ED3A 1BQMA 2VG7B 3ITHA 4R8UB 4RW8A 2ZD1B 1S6QB 4LSLA 1IM4A 2JC0A 3QGIA 3KLFA 3DLGB 3KK3A 3HVWA 4WYWA 4NLRA 3GIMA 3GILA 1S0OA 2B6AA 4H4MA 5C42B 3OL6A 3CO9A 3GQCA 3EPGA 4IQXA 1T05A 3EZUA 4RUCA 1RT4A 4NCGB 3NKYA 4KHMA 4NLUA 1N6QB 4YP3A 1FKPB 1S1XB 4U6PA 1VRTA 4O4GB 4NRUA 4ZP9A 5KFIA 3PR5B 3RB3A 3KK2B 3RB0A 3DOLA 3Q8PB 4O44A 4IG0A 5L1KA 4J9QA 4DL2A 4IG3A 1HQEB 4ZVGA 4F4WA 5F8JA 4EYHB 4XPEA 3MFHA 2WRMA 1RT5A 1TP7A 1C1CB 5J2QB 5KFMA 4ECSA 3KK1B 4MK7A 2XWYA 3IGNA 3MEGB 4DEZA 5F8NA 4GC7A 4IG0B 3QZ8A 3I5AA 1JLQA 1IKVA 1HNVB 1K1QA 3LP2B 1RT2B 4RW7B 4PQUA 4WYLA 5KFQA 4RW4B 4JV2A 1EETB 1JXLA 4R5PA 3N6NA 5I42A 2BRLA 4DL5A 5F8IA 4NZ0A 3G6XA 2IJFA 4NLVA 1SH0A 3LP1A 1FK9B 3V6KA 4RNFA 4KFBB 1GX5A 2OPQB 3I0SA 1ZTTA 1S1XA 2UVVA 4K4ZA 4J9SA 5L1JA 2CKWA 3D28A 4KV8A 2W8KA 4IH5A 2YNHA 4NLGA 1QAJA 3BSAA 2HWIA 2IMWP 2OPPB 1I6JA 2WCXA 4MKAA 2R8IA 5L1IA 2AU0A 3M8PA 2E9TA 2B5JB 1S6QA 4LSLB 5EWEA 4IG3B 3PZPA 1D0EA 1SH2A 4O4RA 3GIJA 4TY8A 4TXSA 3KMSA 2W9CB 3PW4A 3OSPA 4X2BA 3OSNA 3FFIB 4K4WA 1S1WB 1Z4UA 3ICLA 4ED8A 2WONA 1S10A 3FFIA 4O3PA 1FKOA 2IC3A 3VQSA 2C2EA 4G1QA 1QUVA 3QLHA 5KFAA 2ASLA 1IKWB 2BE2B 1TV6B 3MFIA 4MKBA 4ZP6A 1IKXB 3RB6A 1IKYA 4RW8B 3DMJA 1TV6A 2J6TA 4J9PA 4HKQA 4G1QB 2ASJA 1HQUA 2RDIA 1JLFA 4ED0A 4IR9A 4IRDA 3M8QB 3JSMA 3IN5A 1LW0B 1YVFA 2VA3A 4XO0A
chains in the Genus database with same CATH superfamily
1VJWA 2RRBA 4I67A 3ADAC 1ZZNA 4LVNP 3M1VB 2HWHA 4RO0A 3CULA 4ZVSB 2J6UA 4I2QB 2HFZA 1C0TA 2JLEA 3CJTA 3TEGA 6FDRA 2KT2A 4PQAA 4C0OC 1FNXH 1NHVA 1AUDA 3KTQA 1G3OA 1A6LA 3DDKA 3CW2C 2HVZA 2A1BA 2JEFA 1Q8LA 1KLMB 4DN0A 2JVRA 2W1BA 1HNZF 4DFJA 3A12A 4B9MA 2HHTA 4ZCIA 4OZ0A 1XNQJ 2I1RA 1N5SA 3TI0A 1NK8A 3RR8A 1TL3B 3UQSA 5CCLA 3M2VB 4C8KA 3J7AN 4KO0A 4H54A 1UETA 1GXLA 3THVA 2Z56B 2MZTA 5K8PA 1P9QC 3TZXA 5D3GB 1T3NA 4N8OA 3L95X 1JJ4A 1RT6A 2ZUGA 3T1AA 2F5GA 4EYIB 2PEBA 4LFAF 4IH6A 2QN6B 2CUYA 3LANA 1WF2A 3LA0A 4P6QA 2QLBB 3BGLA 3A3PB 4URGA 3OHBA 1R3NA 1LWFA 1OSCA 1LKZA 1S79A 1WDDA 2OGUA 2QMXA 2EPIA 3BYRA 2ATLA 1RABB 3HJFA 3HSJA 1G7CB 3GTYX 3PKMA 3GYGA 1RTHB 2HEKA 2MHEA 4CTAB 2IYGA 3R7BB 5GMDA 3M05A 1KHVA 2EKYA 2YKAA 3D6MB 1HR0F 3KMQA 5MLCV 1CJUA 3IG1B 3L09A 3DLEA 3EXCX 4Y3CA 3FGVA 3FCWA 3ET6B 4RW4A 4URSA 3BO3A 3CJSA 1EQ0A 3LP0B 3P45B 2C28A 1TK0A 5HL7Q 5CH7B 2WTFA 3PFOA 1ITPA 3UO0A 2VKZG 5D15A 1RTDB 1YBAA 3IMQJ 1HHSA 1JLAB 4NCBA 1FNOA 1FX2A 2EFOA 5JUMA 3FSIA 2AGQA 4DG1B 2GC8A 3OTEA 3VQTA 4AD6A 2DXEA 5HBMB 3HF5A 4LRAA 4OFZA 3MR5A 4F25A 1Q5VA 1SV5B 2GVDA 3P96A 4I56A 2WVBA 3T1HF 2AV5A 3MOZA 2MKCA 2M8HA 2EBGA 3FKBA 1TK5A 2XCPA 3OTOF 2KH9A 2KYZA 2XLJA 1CJTA 4KKOA 2W2PP 1D3WA 3H25A 3WHIA 2POKA 3IFEA 4Z7YA 5ETLA 1DQ8A 3J7YU 5L9NA 4LSNA 2RHSB 5EDWA 2UUAJ 1RCXB 4DCPB 1YGYA 4X65F 2H65B 3AJDA 2R7UA 5DDQC 4KBIA 3H40A 1TK8A 1S9EB 4W4MA 1IQTA 2YKMA 4Y28C 5E3QA 1MROB 2YX4A 4WE1B 5E41A 1VJQA 4G3IA 1MU2B 4HDGA 1V3ZA 1L3UA 4KE5A 4QIFA 2ZZNA 2XULA 2VBWA 2LLZA 3CMQA 2YKNA 3BQ0A 3ISND 2OSRA 2P9GA 2QMWA 1RT7A 1F9EB 2DITA 2Y0SD 4OZ3A 5EX0A 1HW8A 2X1BA 2PMZD 4WIQA 1H7XA 2U2FA 1ZH5A 1BXNA 2H1YA 4WFNQ 1V6HA 2X1AA 4XK8C 1WDTA 4QIGA 5IM0B 4DOZA 4ER8A 4FYXB 1I94J 3GR1A 3PACA 4PZVA 4RW9A 1U48A 4I2PA 3JYTA 1T9TA 2R2UA 2E1CA 2KL8A 2GX8A 1AT1B 5KFUA 2W9BB 2FHJA 4DR4F 2UXBJ 4J9KA 3LP1B 1P27B 4TN2A 1ELOA 1F9FA 3AD7C 5J2MB 2GO9A 2MPUA 1XEZA 1Q81T 1XTZA 4YMEA 1T7PA 3FEXB 5GAEI 2A0FB 3GV5B 1NK5A 1VK8A 1FT8A 1HR0J 4KKOB 4BBYA 1TKXA 1N52B 2DCLA 2LMIA 3M30A 4K8RA 4M1KA 4NLXA 2BM0A 3C16B 4FXDA 3FC9A 5AXMA 3PYEA 3T9ZA 3QT7A 2I5JB 2G1HA 4MK9A 4M5DA 2IM0A 3V6JA 1RTJA 1HNWJ 3KLIB 3K89A 3PW7A 1RU2A 3GR0A 4DG1A 3CJKB 1XR6A 4F0KA 3SSSA 4AT1B 3H20A 4OJGA 4DMZA 3BSCA 4DSJA 3WDOA 4F67A 3D6TB 1L3TA 1KOHA 2IM2A 4OJHA 4B9UA 5J1PA 1HNIA 2G2OA 4OYWA 2KG1A 3JSYA 4P73A 3MUVP 2E66A 3KK3B 3NCPA 2NYIA 2YPZA 4WK1A 1BQNA 3PW0A 3GFXA 1WC3A 4OMFG 3LPYA 3RW7A 4DR6F 1DQAA 3CCZA 4ZVTB 3I4PA 3C14B 5HROB 2LVWA 2HS4A 1R8HA 1NO8A 1UCNA 2BDPA 2MKHA 2EFGA 1DZ5A 2DNQA 1T02A 2AJ2A 3BGFA 3N28A 2AYEA 5HI7A 4CLKA 2HGLA 4X65J 3BO2A 1NSPA 3E01B 2PD1A 3IAS9 1NKCA 1HI1A 4U7UK 3HHLB 1U1OA 3LALA 4DSLA 5J2MA 3MD1A 1HIYA 1ZBTA 3OT9A 3NNCA 1SCJB 4DR3F 3MUMP 2ZKUA 2CNOB 1WHVA 2V8DA 2D3OR 2YKNB 2WOMB 2HQIA 1XMBA 1TVRB 3H5YA 4ILLA 2W7OA 3AA8A 1HMVB 2QSFA 2V8PA 3DNCA 2KU7A 1FKOB 3M6VA 1PG5B 2GCFA 3N5FA 3TUJC 2B4OA 3A8JA 4O0NA 4U9RA 4ZP8A 4DV7F 2XY6A 1NRKA 1VFJA 2KI2A 1DTTA 3D4JA 2I9SA 1Q16B 3EZOA 3ZTRA 3DMJB 3TANA 1FRHA 1O6XA 2DNNA 1T03B 1TAUA 1S6PA 5KT7A 3MZIA 5AE3A 4C0BA 4ZN1A 2J0QD 2LP4A 2NXCA 4OYIA 3IGVA 2QFJA 3Q89A 2BANA 4DX7A 2CQ2A 2CADA 5F8LA 3KXDA 5CD4H 4QZVB 4F26A 4WTOB 3H8YA 4JBCA 4ED4A 2V63A 2HNDB 5C25A 1Q8IA 4Q8EA 4K2XA 3HSDA 2YKQA 3MM5A 2VBXA 4TY8B 1TKZB 1ZOTA 1TQLA 2FJXA 3JB9k 2HBZB 1OSDA 1UJ6A 1Z1ZA 3MCSA 5HBMA 2WBRA 4GVBA 5D0HA 2LECA 4DL4A 4OYPA 4NEZA 1WG5A 3DFEA 4Q7AA 5AJ3F 3TZZA 2AWZA 2HURA 5C2CA 4J9RA 1P9YA 1REGX 2BW2A 1Y3JA 1IBKF 3AA9A 4K2JA 4K4UA 4IR1A 3T5LA 2X3GA 4NCAA 3VAKA 4RW6B 3W9JA 2PO4A 2VG6A 2OH2A 4HT7A 4MFBA 1G4CA 3GCWP 2FVPA 1RAHB 2FGOA 1LXJA 4DR5J 2JFDA 4BCAA 3U1MA 1UWBA 2XI3A 3G82B 2FHJD 1S4FA 2M7SA 2HS0A 4P7VA 2AQ4A 3NNHA 2R7QA 1FXLA 5KFKA 2MZSA 3HZGA 4X4PA 4WP3A 3T3FA 1W2IA 3TQEA 5IT4A 3DYAB 4EWTA 5DGAA 4ZVUB 1Y10A 2G0IA 1FXDA 5F9LA 1YSJA 2VPZB 1HWLA 5MAOA 5KT5A 4XDDA 5FD1A 1ROFA 2Z2YB 1D8YA 1X0PA 3TJ8A 2V4RA 3CUNA 4DR3J 4RW7A 1S9GA 2IJRA 2I6WA 5I3PA 5KG4A 4RNMA 5KFTA 1N6QA 3CCQS 1VDHA 2ZOFA 1TKXB 2DO0A 1M5PC 2CZ9A 1KRPA 1WTBA 4IOCQ 1RWUA 2HHWA 1NJYA 1NB7A 4U95A 2GAHC 4DUZF 3UE2A 3JQKA 4B9TA 3H98A 4OYOA 4Q43A 3SDEB 2HAIA 3T5JA 1HI0P 4ES3A 1ZAVA 2ZNYA 3GIIA 1WD6A 2O5DA 2VKRA 5KFZA 4I7FA 4Q0BA 2XMKA 4CLFA 3RAQA 3CNQP 3OR2A 3IRWP 1T8EA 3D67A 3CCTA 3LGNA 3NS7B 3H59A 5EGYA 1SJFA 3T5KA 2HFUA 2QGFB 2JLFA 2B8PA 4YN3B 3AT1B 2RQKA 2DH8A 5LMNJ 1OQ6A 2WB4A 3T19A 8AT1B 3DLGA 3MM8B 2QX0A 5HAOA 3V4MA 4K4XA 1FWKA 1M90T 3D7SB 3D68A 2EVZA 4USVA 5L9XA 2HIQA 4E0DA 3F73A 1NBEB 1LWCB 2MZQA 4B3OA 1RWXB 2PEHA 3SQGB 1JLAA 4UW2A 4DSFA 3LOUA 1UVJA 1KONA 1RTZA 2NR0A 2E9RX 2P6TA 2MQOA 1B64A 4DQIA 2CPEA 1UP1A 2DNKA 2V68A 2LQBA 3DKDA 1OY6A 4FVMA 1CJUB 4K5RA 4KIAA 4M5NA 3A8EA 1N54B 4EFAC 2GHPA 4NLTA 4HLBA 2D3ZA 4LMZA 2GJ2A 4LVOP 2CQ1A 4X4NA 4DLGA 4DL6A 1IBMJ 1D9AA 1QAYA 2ZBCA 3FQLA 3M2RA 1B4SA 1EP4B 3ZTQA 2Z2MA 1F3VA 5EX3A 3BPSP 4I69A 1QLNA 2UUCJ 1GAOA 3R27A 2V4QA 3GMGA 2CQ4A 1OO0B 4JI3F 2DEJA 5IQ6A 1U2RA 4LBPA 5F8GA 2HHXA 3UR0A 2HQ3A 1HBUB 2GQQA 1VRTB 3D3BJ 2XMWA 1UVNA 3ISNC 4J9UE 4WTYA 3C6UA 4JV0A 4YR2A 2FY1A 1GMWD 1HYSB 2KHDA 5LXRA 4C98A 3UDLA 4ID5B 3M8ZA 4ZVFA 4O3RA 2K06A 3KLVA 2CPJA 4RR5A 2DNYA 1SC6A 2B43A 1FNMA 2ZH9A 2AJFE 3O44A 5ETQA 3HJVA 4ES2A 3VAMA 2BE9B 4MKYA 2RRNA 3MECB 1WI6A 3KJQB 4JP8A 2W9BA 5CZXA 2Q79A 2RILA 1RXOB 2FUG9 1V5IB 1HNVA 3C8YA 2E1AA 3JYTB 4OJ3A 5KT2A 1HNWF 5T14A 2R8JA 3MM9B 2W9AA 4FYDA 1RAIB 3PJ9A 5E3AA 2B4PA 3OBIA 4DF8A 2RS8A 2J0XA 1Q8KA 1VC6A 1PJ5A 1J5OB 1SC3B 2XMVA 5F41A 5HMXA 2W8LA 1SJ3P 2I2YA 5C24B 1T95A 4Y2CA 3OVSA 4RL1A 3KHGA 4AE5A 2DHHA 2FLPA 3L7PA 5ETTA 5G0RA 4FYYB 3QYYA 2C2NA 1RCOB 1YKWA 4ZJLA 4RPFA 2BJEA 2BE2A 2N4CA 1TL4A 2HBYB 3VF0B 3M2RB 4CM2A 1BY9A 5L1LA 1U1MA 1KC8T 3BKUA 4B3TF 4ZHRA 3ENQA 3PX6A 3SSQA 2IY5B 2K2PA 3HVAA 1QVGR 1WELA 1WOOA 5DLGA 4NI2A 3BV8A 2C22A 1UPPA 4RBVA 4FKYA 2KXHA 5DETA 3JSRA 2C1EB 2JH3A 2LDIA 2VG5B 3FBEA 4QYRA 5F3TA 3D54A 4HTIA 3M8YA 3VGSA 1N5YB 2RKIB 4LBHA 5D77A 2ZJPQ 4OX8A 1U1NA 2J0SD 4A8YA 4KHRA 2QE5A 1XK8A 3HVTA 2YXLA 4OZNA 1BQMA 3ITHA 1W26A 3A8IA 4V1Ak 3N5BA 4USUA 1VQYA 2RS2A 4DPOA 2J8AA 4IO1A 4OI0A 5HMZA 3J7Z5 3MUTP 1S6QB 2JC0A 4Q44A 3GIMA 1S0OA 3MMCA 4L6V3 2B6AA 3DXBA 3EPGA 4WJBA 3VCDA 4ZCLA 3CD6S 3K5MA 1GNKA 2VUGA 2KB2A 3CJRA 1WF0A 4FXWA 1N6QB 4NLUA 2Y0BB 4U6PA 1VRTA 2UZAA 5B0CA 3PR5B 3WX8A 4JI3J 3U7JA 2HZVA 3RB0A 3DOLA 1H3DA 2C3UA 3AAWB 3AD8C 4M5MA 2MZJA 2MKJA 1LFPA 3HCXA 1FE0A 3W2VA 5A8WB 5L1KA 4JI1F 1TL7B 4WK3A 4XPEA 2KM8C 4EYHB 4DR2F 3Q8VA 3KK1B 3TR5A 1CLFA 2XSJA 3IGNA 4Y65A 2QIFA 4DEZA 2MLXA 4DV6F 4CDIA 1I51B 4GC7A 4A8OA 4IG0B 3D6FB 1MMDA 2P9CA 4HH0A 4Y2MA 2UXCJ 2Y8WA 3DGVA 1HNVB 1K1QA 3BDEA 7AT1B 2HHHF 2CWKA 3W5ZA 3GSIA 4PQUA 4RUHA 4JV2A 1LK5A 2HQGA 1X4CA 3NRBA 4KQZA 4R5PA 3N6NA 5I42A 1H98A 5IC6B 4DL5A 3FVYA 4NZ0A 4LF8J 2D74B 4J90A 1FK9B 1K47A 4IO9Q 2H4YB 4RNFA 4ZK7M 1G2EA 1SC1B 1VOMA 4Y0FA 2W7AA 2XY5A 1ZTTA 4K0KJ 4KJIA 3I6PA 2KDOA 2VBZA 4DUYF 2L3MA 3OXLA 3C16A 3QT6A 2VV5A 4IQMA 5D4OA 3LWMA 3OPKA 4NLGA 4LR9A 1WG4A 3HHDA 1QAJA 4HT5A 2ZKTA 3KFWX 1R6VA 2HWIA 4LJMA 4CH0S 2RDDA 4GRSA 2ZH8A 2GQCA 2WCXA 4MKAA 1HKAA 2V67A 5L1IA 4OI3A 2AU0A 1GT8A 1S59A 3PG9A 3I9ZA 2B7BB 1S6QA 2YTCA 4ETXA 4LF5J 4X4OA 4P2FA 3ILIA 4IG3B 3J7ZT 3OSPA 2N7CA 1AB8A 4X2BA 4I0WA 4UOFA 4A8XA 3THTA 4K4WA 2AKWB 1S1WB 4L72B 4DXLA 4JV5F 1Z4UA 4KGKA 3TWZA 2XMMA 1U1RA 1S10A 1XNRF 2DNPA 4O3PA 3CCUS 3RBXA 3VQSA 3HFVA 2IDLA 4FYVB 2C2EA 1RAFB 1IKWB 3VV2B 1SVDA 3WIVA 4MKBA 2QMUB 3MI7X 3JAMY 4U7UD 1IR1A 2ZOGA 2ZBQA 2J6TA 2W4DA 5C7PA 1EIYB 2HYIB 3OFHA 4G1QB 1I3OB 2B3TB 1TUVA 4IR9A 2EK1A 2A6OA 1LW0B 3PVXA 3EX7B 2XZTB 1NDLA 4XO0A 3FZBA 2HNZB 1RHRB 3MM9A 4N56A 3L4BC 1YG0A 2QT7A 3GJRB 1TVRA 1NNDA 5LXYA 4YR0A 2AEMA 2Q6CA 1VRUB 1NK9A 2WOMA 2PA3A 2RT3A 3C14A 3EXYA 5C24A 3ZZZA 4X62F 3LO3A 1LEOA 1LOUA 3FSXA 2HQDA 3GJQB 5KG1A 2E29A 4X64F 5GADU 2MZ1A 2WSCC 4ED1A 2HHSA 1LW2B 2ZVSA 2DGQA 3I31A 4Z2XA 4Q45A 2AYMA 2MQPA 1UZHA 2L41A 1RT2A 4YHHJ 2VL1A 1RSCA 1Q7LB 3DM2B 1UVKA 3BEGB 5F8JA 2FLNA 1AYEA 3V6DA 4F50A 2D3UA 3FBFA 3TX0A 1RT3B 2LXIA 3LQVA 1HPZB 3LPEA 2OLWA 3PJWA 5M2UA 1RA6A 4JV1A 3CJ3A 4CIOA 4OX7A 3BH7B 4QPTA 4LF4F 3CC7S 5H9EK 3DRRB 4GKKJ 1RHQB 2VONA 3Q83A 1ZZFA 2GQ2A 2XSFA 4J9MA 1XJWB 1HL6A 4FNHA 3K0JA 2GMJA 3DN9A 1T0TV 3HFZB 3N01A 4CO2A 1S9FA 5CZVA 3ZC4A 2O1PA 4PG4A 2AZ1A 2UU9J 2UVRA 1QTMA 3KLGA 1RTIA 1JMTA 2F8MA 3IAM9 4HVZA 4B3MJ 2IM3A 4ZPWR 3UWTA 5E3CA 2ZC3A 3G6ES 3LGHA 3NCQA 2E5JA 3E8OA 5EWGA 2WVDA 1C1CA 4NASA 2DGXA 3M9MB 1U1KA 1FJGF 3KHLA 4IRKA 1M5KC 3KJNB 3MPDA 1RTHA 3JQMA 2IYIA 3O8WA 3KHRA 2VQEJ 2RMLA 2M88A 2ZVIA 4YY3J 2R3VA 2XY7A 4PWWA 1SJ4P 2VG6B 3TJ9A 5KFBA 1YJUA 3DC2A 3KKFA 4JI6F 5J2PA 4CLYA 1Q82T 4JYAF 4LF7F 3GU0A 4EZ9A 2LEBA 1HD1A 3CCMS 3FSYA 4WU2A 1RT6B 1R8PA 4FDFA 3HHNB 3X3UA 2HQFA 1BWVA 3EGVA 4E98A 2RNEA 4LR8A 1RQ0A 2CDQA 4NYPA 1BMQB 1GTHA 3CIMA 4I2PB 2CJ9A 4P75A 1VQPS 3V6DB 3AQOA 3H42A 4M5LA 4B3RF 2J7KA 2CZ4A 1S97A 3BGUA 2BJ8A 3MF5A 2VOPA 1RLDA 3F44A 3I0RA 1WG1A 2ZM6F 1NAQA 2YNIA 1OPZA 1RGVA 3MPUB 3NGRA 2C3PA 3M6XA 1APSA 2A2CA 1N4LA 5DZ6A 4KY3A 3VAHA 4JYAJ 3CD5A 3PW2A 4OYZA 4DFKA 1N32F 2P9EA 1JLEB 2DY1A 2CQBA 3G2XA 1WC0A 4H4KA 3CD0A 5D0EA 5ETSA 2VFSA 2C2ZB 1VI7A 3OR1A 4PEOA 4ZPVR 3OLBA 3PW5A 1VR6A 4QOTA 5CQGA 3V4IB 3GONA 1JNZB 2PI4A 1RDRA 2VQFF 1VLOA 2VFVA 3P5BP 2M0GB 4NX9A 1N5TA 1HBNA 5LSLA 4QU7A 4DV2F 4F4KA 1CJKB 2NSCA 1PYTA 1SV5A 2GVDB 3OTOJ 2LEPA 4RJVA 4ZPDA 4C2MA 3BPDA 1JLGA 2N7YA 2KT5A 2VDHA 1NKBA 2NPFA 4J5OA 1C0UB 3OVBA 2XYHB 2LCWA 2RU9A 3JTNA 1XBWA 3NP5A 4C8MA 3R7NB 3FRYA 2K7KA 3J80U 1H7WA 4X84A 1NUEA 1UVLA 1SC4B 3ILOA 1IWGA 2Y3YA 1S1VA 5J2PB 3MPWA 4PYDA 3TJAA 2GW8A 1JXEA 5F3ZA 5GAEU 3CEDA 4PUOA 4UF4A 4WKRA 2XYGB 3GLJA 3HHKA 5G0RB 3BM7A 3T1YF 1NH7A 1JLBB 1HARA 1UFKA 4HDHA 4J37A 2D3O1 2X1GA 3M32A 1UW9A 2XI2A 3POTB 3H5UA 2G2ZA 4NYOA 2H5EA 1T11A 3S1TA 4OHYA 5ETVA 1VS3A 3MEDB 2CA9A 2CQ0A 1XQIA 3C15B 3QGHA 2GO8A 4TY9A 1Y5IB 2H54B 4LRCA 3TA1A 3H4BA 3US5A 3A1YG 3QRPA 1K8AT 4H4OB 2OPRA 3QSYB 1IBKJ 1WJ9A 2UUWA 3S6EA 4F0HA 1REVB 1ZPVA 2LU1A 3BS9A 3RAMA 4JI5J 1RTJB 2NXUA 2YKPA 1HBMB 3QO9A 2QL7B 4MIBA 3KLIA 5L38A 3Q8SB 4DSIA 1E6YB 2BYCA 5KFVA 2CPFA 2B8QA 4RW9B 2F8EX 4M5DB 4MT1A 5U47A 3FCHA 3UDVA 4ED5A 2I8EA 4ITSA 4URQU 4C8NA 6AT1B 5LSRA 4PXBA 5E5NA 3G4SS 1FKAF 5ETRA 1WEZA 2B4VA 2RB7A 2CXEA 1X9SA 4CM0A 1WUUA 1YZ7A 2J76E 3D66A 4WXOA 4OHZA 2BANB 2O01C 1AW0A 1DFDA 1DLOB 3KLEA 4KT0C 1F0XA 1ULRA 3N79A 2DK2A 4UUXA 2IVFB 5GADI 2ZEJA 2BJDA 3ZZPA 3DRPB 2DGVA 4MFBB 4UY8T 1CC8A 1JB0C 5GAGU 3NAIA 4ILMA 4C48A 3CCVS 3WIUA 3EYZA 3RRHA 3GJTB 5A8RB 3PR4A 3A8KA 5K9FA 3GWCA 2IM1A 8ATCB 3E51A 3JSMB 4KYZA 1CJVA 1DAXA 1KS2A 1FTCA 3D0GE 3IR7B 2XHWA 2WSFC 4WIIA 2C3YA 4U8YA 3TP2A 2ZH3A 3DLLQ 4DL3A 4PPDA 1CPZA 4ZN3A 3W7BA 1UA0A 4JI0J 2P5VA 3IRXA 4ECTA 1RAJA 2DTJA 1PILA 5DS7A 5KFWA 1S1TA 1FRMA 1PKUA 4DCJB 4CH1A 1VHFA 1YK9A 1RT1B 3ISZA 2ZH2A 5EWFA 1JLFB 2IBKA 4QU6A 4PG5A 3AXMA 1H2UX 3S8SA 2WAQD 1YX2A 1XMQJ 2GZOA 2QRRA 5A2QY 4UZBA 2BE7D 1UWAA 3ENAA 2G13A 1MWQA 1C1BB 1KN6A 1C0TB 4KTQA 4DR7J 4QIWD 4O3QA 4CRJA 1D8ZA 5LSOA 1NM2A 4J9OA 1VBKA 3W8PA 2DT9A 3ZZUA 1FI4A 2CNLB 3HZEA 3HD2A 1MNEA 3K5PA 3E01A 4ZIWA 5LMNF 1B0PA 2CG8A 1D09B 2R7TA 4LF1A 2AJ4A 1TFYA 5F8HA 1NJZA 2B7CB 5SUHA 1FEHA 2IJNA 4DPYA 2PE8A 3BR8A 4RBTA 1T9UA 4MH8A 3GE9A 3RR7A 1JKHA 1RWKB 1DLOA 3KLEB 1PYSB 5EUHA 4DPTA 1PO6A 1N33J 2HHUA 4OZLA 4YB5A 5BXIA 4QCLA 2MQ8A 4BWMA 1X4BA 4DPXA 2JNJA 2HPUA 3DRSA 1NZAA 1EKRA 1XR5A 2BJ1A 5A8RA 4OHVA 3KYLA 3CCSS 1KLNA 2MB0B 3O2IA 1TMMA 3R6LB 4JI8F 2HMIB 3KG0A 3ZTOA 1YRXA 3MM7A 5LL6d 4G65A 3ELHA 4B08A 2UV8A 4EEYA 4JI7J 1S48A 1SJQA 1FWLA 1X5PA 3DU5A 1FE4A 1XN9A 3Q8RB 1DTQA 3KLHA 3MR2A 4KO0B 2F3JA 2G0CA 2CQCA 4OX9J 4CTAA 1TL3A 1FVQA 3W2VB 4CLLA 2HNDA 5C25B 1RE1B 2LEAA 1RUSA 2D69A 4PUOB 2YPYA 4OYAA 4PG6A 5ETOA 3HHLD 4YEAA 4EUVA 2ZFHA 1AZSA 2QFIA 3BREA 2OTLS 1YZ6A 4Y00A 1SL0A 3BYPA 2PT0A 1IBLJ 1Q7YT 2W2MP 5IT0A 4EMDA 4KFBA 1GH8A 3T9NA 4U67Q 2DH7A 2YX1A 5HLFB 2DJWA 2DNRA 2BOPA 4C0HA 2FZKB 3RBZA 2DRAA 4B3MF 1VC0A 1ACMB 2H4WB 1ZM3A 3NCRA 3Q22A 3KG4A 3I82A 1WHWA 1HPZA 3IM8A 3SIPB 4QBUA 1BUXA 5KT6A 3R8YA 3SQOP 3OXFA 4B02A 3PJXA 1YQHA 1S1VB 1HI8A 4KC5A 3QZ7A 4YDDB 1F3FA 2ZJQQ 3UD3P 3C6TA 5HO4A 3EGWB 3FEYB 3F56A 2LKZA 2MLZA 4DCOB 3MURP 2R2RA 1U0HB 4TYBA 2FLLA 4IDKB 5I3UA 1OYDA 2MHNA 2XQCA 4ED7A 4OHXA 1JKHB 4NRTA 1PCAA 2BKOA 3QAEA 2X1FA 3TAPA 5D8HB 2KTQA 4ZLLA 5DM6Q 1KR4A 3KJVA 1PJ7A 2V8HA 4LREA 1KSPA 4QW8A 4LSNB 5KFDA 4DSKA 1OJ4A 1R43A 2V9KA 2VJUA 2FHOB 2H5JB 4DR7F 4PWDB 3MR7A 2YKMB 5KAKA 3IBFB 4R25A 4TYAA 1IR2A 2CWXA 3M8QA 5A6PA 3NOGA 4HEA9 1TMJA 2F65A 5CXTA 4C8OA 2KYXA 3FK4A 3I9V9 2CG4A 1EX8A 3KWMA 5LJ5Y 4MTPA 3AJ2A 3RB4A 1U1PA 4QPXA 2EFQA 1PSDA 1IKYB 3NWRA 4NMXA 4NLWA 5T7LB 2HVHA 3B78A 2M9KA 4WU3A 2VG7A 4J7CA 3RRGA 2MMYA 3HHLC 1YBTA 3QFHA 5HP1A 3UN3A 2ZH5A 4ED6A 4LFCF 1WF1A 3OL8A 1PBUA 1UZDA 4OI2A 4QR0A 5IWAJ 2V50A 2EI5A 4I4BA 4OZ2A 3CGIA 2BJ9A 3HDSA 4GVLA 5KG6A 3MECA 1EJ7L 2H48B 3SDEA 1SPBP 3OJUA 4C3MA 5CAAA 1WEYA 3IA0A 5B0DA 1R6YA 2AMCB 1OIAA 4DZ6A 1JLCB 4F04B 5B0EA 4NI2B 3RRKA 4JI7F 2EG1A 1SBRA 3NEKA 2XBPA 1VCTA 2A6MA 5L46A 4DV2J 1P6TA 2AX1A 2MKKA 2ZC4A 1JLQB 1Y3KA 4DV5F 2HQCA 2R7SA 2YNHB 4MIWA 1X8DA 4IYQA 3D5MA 5KFFA 2BVZA 4RWXA 3OFEA 2DHSA 2FJAB 1VHIA 2VASA 4R0EA 2OPSB 2D7SA 4Q5VA 2OJ3A 1VRQC 1X4AA 1KEKA 2QL5B 5JVHQ 2H51B 4PWUA 2JRSA 2BRKA 1BWEA 1FJEB 3R1LA 4JB8B 4CLTA 4C11B 2E9ZA 3QAUA 5AT1B 4YS2A 1RT3A 3IS9A 1T94A 1S7IA 2E44A 2Z8QA 3B8HA 2KXNB 4DS4A 1N34J 3NOCA 3NGDA 4I6AA 3ZTPA 3MAQA 4A8MP 2LDYA 4KRWA 4P2SA 2AGPA 1JX4A 2F1FA 1XIQA 4YFUA 3Q8YA 2WW4A 3GFYA 1DHMA 3FDSA 2NCKL 3RAXA 1NJXA 2YWHA 3DDNA 3K58A 4KGVB 3MEGA 2BM1A 1K1SA 3VZIA 2W2NP 2R7WA 4EZ6A 1ZPWX 2HAFA 2W2OP 2R2TA 2E5GA 1NK4A 3KOAA 1UTAA 1EP4A 5FIIA 2JX2A 3Q0AA 3DM2A 5A8WA 2PN6A 3MR6A 1VQSA 4L73A 3K57A 3CMAS 1KBRA 2R8GA 2NZ4A 1PAUB 3QNWB 5T41A 3VGUA 2HNYB 1NKEA 2RSQA 4LF8F 2CVEA 1T9VA 4NCGA 4WKYA 4Y2KA 2BX6A 3VTIA 1M1HA 3DRYA 4B9NA 2DRBA 2CIMA 2B6AB 2I38A 1KTVA 2P2CB 3UNGC 4MAKA 4O44B 1H2TZ 4NLPA 2HW3A 3MM6B 4F4AA 1ICEB 2GIRA 4MMOA 1YJ9S 3NAHA 4OZ5A 4A8FA 1MG7A 2XNQA 2FJEB 1F60B 1RYSA 2FHKA 2DNOA 3R5GA 4GO7X 5KFRA 3SCJE 2MKIA 2EKNA 2E5LJ 2MQNA 2NPIA 5DG7A 4NXMJ 1HQ2A 2HIYA 4ES1A 3GJSB 1YJWS 5BR8J 3W2WB 3FBCA 1FFSB 3V81B 1Y7PA 2MLYA 1O8BA 2OMOA 2LQ9A 1NDPA 3FCVA 5D4PA 5CA5A 1O0PA 1GXUA 4PXEA 5HMWA 2JEJA 2MQMA 4F2SA 3MD3A 2ALZA 4A8QA 1ZM9A 2WVFA 5D0GA 1HD0A 1QUPA 3TVZA 3JSBA 2FJVA 3TZWA 1Y4ZB 3EDRB 4L76A 4XTTA 5IOLA 2FD2A 4ECVA 2JJ4D 2ZDPA 1CG2A 2ADCA 2V8GA 4ZVPB 1SKRA 1YRTA 2CPXA 4RW8A 5IV3A 4DV5J 1VBYA 1JXVA 4AUKA 4LSLA 1IM4A 2F8HA 3KLFA 3DLGB 3HVWA 3MM8A 4QR1A 4NLRA 1WKJA 1MLAA 3CO0P 3VVUA 2J0WA 4H4MA 5C42B 2Z2ZA 3CO9A 3H7HB 3QT8A 2XG8A 4P10A 3QATA 1HWKA 1CJVB 2B9WA 4NCGB 3AB4B 4KHMA 4YP3A 2RVJA 4LFBJ 1CVJA 1S1XB 1L3KA 1WC4A 4ZP9A 5E3RA 1RAEB 3CSKA 2KFZA 2WSEC 3KK2B 3HK2A 4KH1B 4O44A 3R6GB 4J91A 4DL2A 1N34F 4IG3A 1HQEB 3LH2S 4HHJA 1S77D 3QSIA 2L9WA 3U02A 5HQMA 4MK7A 3MEGB 4USJC 1TL7A 1M5HA 4ZPTR 3UD4P 3EICA 1B70B 1UMJA 2GMHA 2JFKA 1CULB 4XDCA 5A0YB 4ZLNA 2V69A 3TVYA 1DRZA 1QSSA 2RH3A 2ZHAA 1QTNB 4DU7A 2OD4A 3W1YC 2IRYA 4WYLA 4OYMA 2XWXA 1VIOA 1JXLA 3QRQA 4NZ6A 2BRLA 3L7UA 2OKQA 5F8IA 2IJFA 1F5BA 3H2UB 4NLVA 5K5MA 3LP1A 2CJAA 2ROEA 4NWBA 3P4UB 1GX5A 3DHXA 3TARA 4DR4J 4CH7A 1U1LA 1NPRA 2UVVA 2KZZA 4K4ZA 4L3NA 7FD1A 5L1JA 4J9SA 4DR5F 2W8KA 4IH5A 3CMES 2YNHA 1TAQA 4USHA 3BSAA 1WACA 3AY0A 3CJQA 2IMWP 4ATNA 4LIRA 2OPPB 2K3KA 2DR9A 3DCAA 2XSJB 2E9TA 3HSZA 1NPPA 4LSLB 4F7VA 5EWEA 1KFSA 4OI4A 1FDDA 5IQQA 3TUIC 3TX8A 3EVOA 3PZPA 1SH2A 3GIJA 4TXSA 2W9CB 2ZHOA 3PW4A 1SXLA 3FFIB 1DARA 5BR8F 4NXNJ 3U1LA 2JHEA 2GNKA 4O23A 4X4RA 3Q8UA 1FKOA 2IC3A 4NMLA 2FYXA 4KGZB 2EWHA 3PM9A 4Z37A 4WP9A 2BE2B 1J2VA 4ZS6A 3HMJG 4DUYJ 2ASLA 1XC9A 2F63A 2XEXA 1O5JA 4N41A 4W90B 3KUHA 1IKXB 2QC3A 4P71A 3RB6A 4RW8B 2KRRA 3DMJA 3VALA 2ZM6J 4ZCKA 2LU2A 1H0HB 1HQUA 1RWOB 2MTLA 2A18A 2Z2LA 4OX6A 4WCEQ 4IRDA 3JSMA 3SQGA 2CQ3A 1SL1A 1LK7A 4FN5A 4B3OB 1TR0A 4OJ1A 4I7FB 4Q0BB 1DJ0A 4ZCMA 4QWDA 3V6HA 1FF2A 3QJPA 4LF2A 2V2QA 3SV4A 3QIDA 1SL2A 1F5AA 4OLPA 2QEXS 3IRXB 3SFUA 3TA0A 5KT3A 2W01A 5KFXA 2HKEA 2AJ1A 3PHEA 4RKUC 4WFXA 2VF3A 4DSEA 2KFYA 2ALYB 1J5OA 4IFYB 1FDBA 3AODA 2GHWA 4IDKA 5I3UB 2JC1A 2ZITA 3G8TA 3VWSA 4W92B 8RUCA 2RHQB 3L9ZA 4S0MA 2AJ0A 2JL9A 4PABA 3SMZA 4IKAA 2R7OA 3UN2A 2XC9A 3DLHA 2RQCA 2GJIA 4IRCA 4DV7J 1KVJA 5BYQA 1KVIA 3P5TL 2MDAA 1PC4A 2C42A 3EWGA 1RT5B 4OL8A 1HFEL 2VPYB 3EMTA 4M94A 1AROP 1R0BG 1YJRA 2OEMA 4Y6IA 3UI3A 2OAUA 4DV1F 1RWMB 2HK3A 2MY7A 2V4JA 2W24A 4DL7A 3C2PA 2VPXB 3GIKA 3DOKB 1FKPA 5HVGA 5FJ4A 3M30B 2W25A 5J1EA 2VC0A 1R89A 3PIOQ 3ETMA 5FDLA 1UVIA 2CJQA 1KP6A 1RI7A 2FJDB 3TZYA 5DQIA 4NLYA 3N6MA 2QJ3A 2QYCA 4LQ9A 1RWWB 3TQ1A 2VA2A 4YDXA 4KSEB 1L3VA 3W63A 2FLOA 1F6TA 5H9EJ 1UAWA 4CO3A 5KFPA 4O3OA 3OQ2A 2LXFA 1R0AA 2G4BA 2CQIA 2C3MA 1IKVB 2HMIA 2MGZA 4CCHA 3R2DJ 5ADZA 2LQ5A 3PO4A 1JLCA 1U6FA 2OUGA 3G71S 3M32B 2RU3A 3Q8QB 1VQ7S 3HSGA 1ZYQA 4G1PA 3C3LA 1JJCB 4ZITA 2NS1B 3HLUA 5T7LA 3HKWA 1OY9A 1MN7A 2Z0GA 2DNLA 3DOLB 2W2QP 4GO5X 4N77A 2DRDA 5KFSA 5JJBA 5THWA 4HH1A 3BQ1A 3MMAB 3TRGA 2ZH4A 2VICA 2ZE2A 1R27B 3EZ5A 2IRUA 5LT5A 5CYMB 1F2GA 4DX6A 2HBQB 4UUWA 5ETPA 5SZTA 2B56A 1LV5A 4FS2A 4AXJA 4LRDA 3J7A1 3GSDA 1AA1B 4C8YA 2UVUA 1UEKA 1T03A 1GK8A 3HXMA 2HVDA 2ADBA 4EO6A 4LF6F 4WBFA 4N5SA 4FF2A 3OTDA 4J9QA 4L74A 5GAHU 3K59A 2BUNA 1Z2ZA 1FRIA 1NH8A 3QIPA 1S12A 1ZTWA 2Z4PA 3CE8A 1UW4A 4GMKA 4CYUA 4DV4J 2YWEA 5D0RA 2JSXA 3R9LA 5DQHA 2IHR1 3HULA 2GFFA 2NQPA 2DGSA 3CDWA 4GKKF 4ANCA 2VZ9A 1HHQA 2ILYA 4KPYA 1PBAA 1DY3A 4LRBA 2G0JA 2XS7A 1KOOA 1RWVB 4OV6A 3KJVB 2NXNA 1X4EA 3AH6A 3FJ2A 4XAKA 4CO5A 4N8NA 4DV0F 1RJJA 4B3TJ 3DLBA 1IQZA 1BQXA 4ICLA 3OFFA 2XO7A 4CLWA 2E5LF 2NREA 1FRLA 2FZCB 1LXNA 5IV4A 1X4FA 4K50A 2GHVC 4RZRA 1HMVA 3IO1A 1X5SA 2K1RA 3TYTA 5HMYA 1M0SA 3NMRA 2CZVC 1FRXA 2DR6A 4USTA 5HATA 3EPIA 4WFYA 1JLEA 4K0KF 4NLDA 3DRPA 2DGUA 3NGTA 3VAGA 1NK7A 4ELVA 5B0GA 3H0PA 2CQDA 1EHWA 4MYUA 2DHGA 1RBLA 1HBOA 4U7CA 2XCAA 4M95A 1GMWA 2WHOA 2DNMA 5HJYA 1CS4A 3HP6A 1LWFB 2XZWA 3WQPA 2DEIA 2EW9A 4RW6A 1R0AB 1HNIB 1WHYA 4LIWA 3SSRA 2GAGC 1HBUA 3PRVA 4ANDA 4K4TA 4LF9F 2HBRB 4USMA 2DGTA 5HQ8A 3O3LA 3IG1A 1OPIA 1RWNB 2DGOA 4KGXB 2LYVA 2NUUG 5HQLA 4BLGA 2B9EA 1RLCL 4ID5A 1BHNA 1ZM2A 4OYBA 2XMUA 1WORA 4ZLJA 2VFRA 1PIEA 4OYXA 1EETA 3K7RA 4KB7A 4NPOA 1VQMS 1RT4B 5M2RA 4C8LA 4TQRA 3CB4A 1E6YA 3IBCB 3UDCA 1AXQA 2O3DA 1HBMA 4OX9F 4C11A 2RUSA 1PGZA 2QA2A 1RADB 3KLFB 1NDKA 4ICLB 3POTA 3PDNA 5K20B 2C3OA 4A47A 5K8NA 4HYKA 2ASDA 2BQ3A 3CJ8A 2Q66A 4IFVB 1Q8BA 1VGYA 3LF0A 1TKTB 1F5CA 4QWEA 3CVKA 1J5EF 3ZFVA 1LWEB 1Y11A 4A8SA 4C8ZA 3MEDA 4ZP7A 5HANA 5J1EB 2JWNA 1SIZA 2OI2A 3F0NA 3UFCX 3DOKA 2E5IA 1WOSA 1ZS6A 3CCJS 4YQWA 1N0VC 4ENOA 1H6KX 3OVAA 2XMJA 1DURA 4X64J 1SUQB 1CBKA 3O5TB 3FBBA 1DQ9A 4U96A 4HHUA 5HSPA 3NY0A 3G6YA 1MWZA 1HNZJ 3ZZTA 2BJ7A 3PYDA 3W66A 5BJRA 2EK6A 3RG6A 3S01A 3I0RB 1NHUA 2M3DA 4Z7CA 5EN1A 3AOAA 2N3LA 3W9IA 1MU2A 1CJTB 2ABYA 1LW0A 1X60A 3OL9A 4DR6J 1CC7A 1MROA 2C2RA 1S9GB 2E5HA 2A10A 4J9LA 4HI2A 4OLOA 4ZVOB 1JJ2R 3KJFB 3QRRA 2ATCB 3DI6B 2QSWA 1VC5A 4A48A 4JV5J 1B7FA 3A3OB 3KNGA 4P2XA 1VRUA 1U2CA 1NXIA 3ENVA 1L3SA 4FS1A 4BDPA 1SI9A 4B9VA 1U0HA 5H9FJ 2OPPA 4ETZA 5E0OA 2DXFA 4ZVEA 1AZSB 3FZ2A 5CYMA 3M9OB 1S9EA 1A0OB 1KVKA 1W25A 4FF3A 2MGZB 1VIXA 4XIUA 4JI0F 5K8MA 5E3PA 1AUSL 4M63A 3U27A 5DG8A 4ZHRB 2BZ2A 2YQ0A 1VQLS 4DZDA 1WC5A 4IOAQ 4YOEA 3V2UC 3LAKA 1TKTA 4ZPCA 1C4AA 3OXGA 2Y8YA 4JI4J 4FVCA 4N47A 4PPZA 2VQEF 3MM6A 2HRTA 1PC5A 2IDEA 3Q86A 4IH7A 4A46A 2IA6A 1RWPB 2WVCA 4RNHA 5DRKA 1JNRB 4OZ1A 1IXKA 2C2MB 2PA8D 2IVYA 2JZ5A 3C6TB 3NGSA 2H3EB 4P72A 1XMQF 5D4LA 2FY8A 2FVRA 1H2VZ 1MN9A 5DDPC 2JDJA 4MJKA 3MOJB 5KFYA 1HLWA 5LM7E 2XLKA 3DRSB 4DS5A 2RJZA 2V2ZA 3SZ2A 2E7XA 2CJYB 1K44A 1GXTA 2Z58B 3ETOA 4E8UA 2XO6A 5CYQA 1UEUA 3EDQB 3DDIA 1KTQA 5J2QA 3FNNA 4AQYF 1S49A 5KG7A 1KFDA 2KM8B 4R5PB 4FBTA 2J7UA 3X1LB 3C15A 1HNXF 2HGNA 3MM7B 4DV3J 4IOBA 4NLOA 2QV6A 2YWKA 3C6UB 3GV8B 2DR7A 2X51A 4AL7A 5DM7Q 2RD5C 4IFYA 3LUYA 4Q2LA 4CO1A 2GGPB 3HFKA 3BB5A 2HVIA 3M2UA 4RNNA 4AXIA 3W8GA 3RTVA 4ECUA 3CIZA 2V8VA 2YX7A 1RTIB 3LGMA 3CCWA 2A3JA 3B4DA 4CWBA 1GEHA 1M5VC 2OTJS 5B08A 4OI1A 3BGOP 4AFFA 4X4QA 1O51A 3RW6A 2DCUB 2OIHA 4X4VA 2RUGA 5J2NA 2LQJA 2RF2A 2QG9B 1U24A 5DDRC 3JXOA 2D9PA 1TL5A 4F02A 2RQMA 2BOAA 1RT7B 2MEWA 3JS9A 4KGMA 4D3GA 4F3QA 5I4MA 2FVSA 1X31C 2AT1B 2ZD1A 2EBEA 2GV1A 3CDAA 3KG1A 2N3OA 5GAGI 1N36F 3DI6A 1I94F 4LF7J 3ZZOA 4ED2A 1RHKB 3R5CA 4DX8H 4KAIA 2YNGA 3WZ0A 2FQQB 2OELA 3GZ7A 5AE1A 2WK4A 1NK6A 3GCXP 2QYGA 4C7QA 2BACA 1K9MT 2DB1A 1JQGA 3V4IA 3EVWA 3J7YI 4ID8A 5LMUF 3VAFA 4ECYA 4UQTA 5B7WA 5KFLA 3DOMB 2DVIA 1H74A 2GVZA 4A8WA 3K17A 1M5OC 3R1HA 2DPIA 4IFVA 1SIWB 5F9NA 4F4XA 1NMEB 1MMLA 5KFJA 2ACYA 2KKHA 5KFGA 4O0IA 1CJKA 1VMBA 2DR8A 2YNIB 4ZA1A 2XS5A 3M8WA 2CQHA 3UD5A 3UPFA 1VBZA 4C9DA 2UUBJ 3HVTB 1IUJA 2AZ3A 1FJCA 2B9XA 3OUYA 5IC4B 4UY85 3G6VA 2V2VA 1U02A 3H4DA 4TQSA 2IIHA 1IKXA 2X7IA 2KXFA 4CQ1A 3PX4A 2YQ3A 3CJKA 3IWNC 2KO1A 2B5JA 4YUDA 4DV4F 3PNIA 4M5IA 3E2EA 1GFWB 3BF4A 3MMBA 3N4WA 4H4KC 4NA2A 4M8LA 3NGKA 2Y1RI 5IT9Y 4FF4A 2D1CA 1NEEA 2A2DA 1FVSA 3OHAA 3PV8A 4CNYA 2YH0A 4RBUA 4QWCA 2FVCA 5M2PA 3CCRS 2F4VJ 2CNKB 3JTPA 3LWLA 4QYZK 5ITHA 1YITS 2AIRB 3DLEB 4LUBA 3J81j 3H5XA 5ETKA 2Y1IA 5IT9U 1MMNA 3DGPB 1FK9A 3DRXA 2Y9HA 1GX6A 2QLFB 2OPRB 3M2UB 3E3XA 3NWGA 2VDIA 3I87A 4GKJF 1JIHA 1MSWD 4OQJA 5CABA 3BGRA 2EC2A 2QA1A 4O4GA 1RTDA 1URRA 3DYAA 2J9EA 1FTRA 2GMLA 5K8OA 5HK4A 2RQ4A 1NDCA 3IS9B 2PIIA 2OPQA 3QBCA 5BYRA 4QQBA 1VBXA 4H4MB 5C42A 2K7JA 4I6YA 4FXVA 1Q78A 1WI8A 3ZXWA 2EXUA 1BE4A 4ZIVA 3QFWA 4YHHF 3HD1A 1UWBB 1S6OA 4QJVA 4DL0C 4H4OA 3D9BA 5L39A 1VLYA 3J81U 1YIJS 4FPRA 3CTRA 3CJ2A 1RB0A 5FDLB 1R8AA 2DNGA 3TVKA 2ZWPA 1R8CA 1NLKL 2YY3A 3PEHA 2M5YA 2RAQA 3N0VA 1UJ5A 2DHXA 4NE9C 4PKDB 4CO4A 5LJ3Y 5DDOC 4C3KA 4WZQA 2BEFA 3UW1A 1QAIA 3BKTA 3M4XA 5GMKa 3RBEA 3VZHA 5KFEA 1FJ7A 2ZBPA 2HZCA 5F8MA 4CZCA 2RE1A 2R2SA 1OS5A 4R0JA 4EBEA 2H9ZA 5K14A 4ZPBA 4DWIA 1SKWA 2YNFA 3PX0A 2R8KA 3H5SA 5KFCA 1S76D 2GIQA 3DLKA 4F4YA 2KZMA 1T9XA 2ZH7A 1QM9A 1N56A 3OR1B 1IVZA 2EFVA 4WZMA 1IR0A 4YY3F 3GV7B 4WXWA 3R7SB 2NUHA 5A0YA 2IAJA 2VODA 2KN4A 3L3CA 1S0MA 1ZM4A 2L48A 3B4MA 1VYAA 3T41A 5KG0A 2G2YA 4PG8A 3RU0A 5KG3A 5KFOA 1TUGB 3J80Y 3CD7A 2CJKA 4WE1A 3W9HA 2HNYA 3QWPA 2CYYA 2MSSA 5JVGQ 4JI1J 3K5LA 1NSKL 3K8VA 3D3CJ 4PR6A 2H5IB 2QZ8A 1N88A 4ED3A 3BDPA 2VG7B 3ET6A 4C3LA 2LFVA 3TAQA 1YHQS 3ZZRA 3CC4S 2ZD1B 4WYWA 4CT9A 1F9HA 1LWXA 2HFVA 2KJVA 1A9NB 1K0VA 4TU7A 5B0FA 4DX5A 3GILA 1U26A 4ELTA 3D0HE 3OL6A 1IWAA 4K59A 4E2FB 2AHOB 2SXLA 1RT4A 1I5OB 3F41A 5DJBA 4DHVA 2VU5A 4O4GB 4NRUA 2DISA 1CQMA 1FWPA 3RB3A 1B7YB 5J1NA 3Q8PB 1RAOA 2HHPA 1T9YA 1RKJA 1HW9A 4FPIA 4F4WA 3I4HX 2LQ8A 2XZDB 1OQ3A 4EK2A 5LOQA 1X4HA 2WRMA 1YJVA 1YJ7A 1B0TA 1C1CB 5IZHA 4ECSA 1UA1A 2AW0A 4CI0B 2E7VA 4I64A 1KWMA 1U4BA 4RU2A 3R5JB 4BS2A 3QZ8A 4ZKAA 2EEYA 4N76A 2V5HG 5F0WA 5C2GA 2DGWA 1UJ4A 4DJBA 4LF5F 3LP2B 1RT2B 1CULA 3KDOA 4RW4B 1HBOB 1YDLA 1QAXA 4PXDA 1TFWA 3W3SA 3G6XA 3NS5A 1U49A 1IBMF 2L08A 1RACB 3K8WA 3V6KA 4KFBB 3EM1A 5HJXA 4DPWA 3ZZ0A 1S1XA 2K1RB 5FLXY 1Z2LA 3Q24A 2MKSA 4L75A 1WSRA 5B0BA 3DU6A 2DNZA 2CKWA 3GP9A 3MEKA 1BD6A 3PCOB 2HGMA 1SKUB 4DV6J 2XTJP 2ZOMA 2LA6A 2YWGA 3CDBA 3P3DA 3NNAA 1KD1T 2R8IA 1I6JA 4DV3F 3TOQA 4I6WA 1AFIA 2R42A 3EJMA 2VC1A 2B5JB 3WC2A 4WF9Q 1M1GA 1Q95G 2ZH1A 4P2MA 3P6YC 3HHEA 1D0EA 2YH1A 1IBLF 3W64A 3OSNA 4V19X 1FFWB 4JI5F 4DDFA 1NHKL 4ED8A 1TUWA 4WFBQ 3FFIA 1SQGA 1RAAB 2C2OB 3M8SA 3OW2R 3QLHA 1GMVA 2GA7A 2PSZA 3M6UA 1TV6B 5KFAA 1R0CB 5A8KA 3MFIA 2Q1LA 2RRAA 2E1RA 1XNQF 4MYTA 1IKYA 4F0MA 2WB1D 2B0GA 3M1VA 1S5ZA 3NS6A 1KKHA 4HKQA 4KH0B 1SJRA 4J9PA 4HHHA 3IN5A 1CQNA 1YVFA 2HHVA 2N82B 2YWFA 4DN9A 1XR7A 2P6SA 1HQUB 1G1XA 4DUTA 2DH9A 2PFFB 1VQOS 1UL3A 2DD8S 2W9CA 5K14B 3TO8A 4B3SF 4DQRA 4NXNF 1U0SA 4WP8A 1QSYA 3VGVA 1S6PB 2VG5A 1RKIA 3ZNJ1 2K3IA 2XMAA 5LMUJ 1XNRJ 4RX6A 1V9OA 2C2KB 2IC3B 2UV8G 3S7RA 2FJWA 3AD9C 2QA4G 3UDEA 1FDAA 5AE2A 2DO4A 3JAMU 4ECWA 4Y2AA 3TAMB 3OL7A 2KG0A 2BQUA 4FBUA 2XB2D 2CJXB 4LRFA 3I0SB 1N48A 1TL1B 3SBMA 1QE1A 2OSQA 4PXCA 1X4GA 2KVIA 2E7WA 1SJ1A 3KDNA 3MDFA 4ECZA 2V9WA 4Q2MA 1NSQA 1K0TA 2JOQA 5IWAF 1QDUB 3I56S 2DBBA 1NU4A 3MGJA 4ECXA 3CJ5A 3M7VA 3HHLA 2CPDA 2AGOA 1VQ9S 2PC6A 4PQUB 4TLRA 1WHXA 3MAAB 2ZWOA 4WFZA 5IFMA 1G6BA 2B51A 2AYGA 2ZZMA 2KVQE 3KHHA 1K73T 3MCMA 1R8BA 2PMWA 2V0NA 1D1UA 2XMTA 1A7GE 2PMHA 5D78A 2UP1A 1URNA 5EHHA 4NOHA 2BV3A 1U7LA 3QPIA 4RUBA 2UVWA 4O3NA 2F4VF 1QY7A 5JMNA 3RBDA 2UXDJ 4DI6A 4USIA 3SFGA 3AFGA 4LR7A 1HYSA 1FESA 2FDNA 3CCES 3HI9A 2MJUA 3W5XA 4NXMF 2B4UA 3D6HB 5HVFA 3RJMB 4TU8A 4GC6A 4W98A 2HS3A 2BR0A 2UUAF 4JI2J 1UVMA 3IWXA 3O1LA 4LF4J 4CO0A 4GKJJ 4AYBD 2WVEA 1S0VA 3MMBB 4I68A 4PYAA 4DFMA 1B0VA 2QL9B 2XYPB 1NJWA 3OJSA 1N8RT 2J5AA 2Q43A 4ZDNA 1QSLA 5DQGA 1PAEX 2MQLA 3NBPA 3CT9A 3CDEA 3FUYA 3UVJA 3P8BB 5HN0A 3SV3A 2O67A 4UZCA 3A4TA 2RDJA 1T3OA 2CPIA 3G8QA 4YR3A 5CHCB 2DPJA 2NYHA 1J5EJ 4ZJQA 2F9JA 2O66A 3N6LA 1R31A 2QLJB 3QGPA 5AXKA 3RGIA 3THPA 1KHWA 2AEJA 3I32A 3V81A 3UNYA 1WKLA 4R8UA 1S72S 1TELA 3W65A 4HACB 3D2WA 4B3SJ 4ZOSA 2UXBF 1X4DA 2CPHA 3OR2B 1S1WA 3MWBA 4FYWB 4DR2J 4P9SA 4DR1J 1S1TB 5HP1B 1JK9B 3AXKA 2DNHA 5BYSA 1FERA 1OWXA 1NPKA 1S7HA 1DBDA 1IJEB 2ERRA 1FO1A 1XERA 4PCQA 4UT4A 3BH6B 1X0FA 5DG9A 2DR5A 1CSJA 2UXCF 3MMJA 2HHQA 4AL5A 3DOMA 3GPAA 2MKYA 3K5OA 4CP5A 2RF2B 2FGCA 3K2YA 7FDRA 4Q8FA 1VISA 3Q2TC 1NB2A 3MPVA 1QD1A 1S99A 1WWHA 1WKKA 3ILLA 1FRKA 3CJ0A 3ZTSA 5KG2A 2AF6A 2HK2A 2KJWA 3DXSX 2CFXA 1VK3A 2CAJA 2B9YA 2D9OA 2YNFB 4M5HA 3SCKE 4K4YA 4AL6A 1S4EA 2N4DA 3MTKA 9ATCB 4QWBA 2KT3A 3CJ4A 3G82A 2Y1JA 3RYLA 4UQGA 4MKVA 1E6VB 3A13A 4N7TA 3MEEA 2HFNA 2XHCA 3OTCA 1LQ9A 3SCLE 3M8PB 4CLZA 4CNZA 3HPOA 1LNQA 3SYZA 1KDNA 3IBWA 1XMOF 4OV1A 2F9DA 2IA0A 1B3TA 3KLGB 3V5RA 2ZJRQ 4DV0J 1VQ8S 3FEZA 3G96A 1RHJB 4M5KA 1IJFB 5HROA 4HTJA 4JI2F 1Y0HA 5I3QA 3MCOA 3KK1A 4YB1P 3R5DA 4LQ3A 1WSVA 3IWLA 1JLBA 5CCMA 1KQKA 5KFNA 5HLFA 1Q79A 1N0UA 4USKA 3VVTA 5C5JA 1XWLA 5DO2A 3KK2A 2ZNZA 2HWTA 3BN7A 5H9FK 1RHUB 1FEEA 5AXNA 3UCUP 2VFTA 3CWJA 2VOOA 4OZJA 5CYJA 2NXEA 4RUAA 4AQYJ 1YTYA 1H72C 3T1HJ 2G1DA 1U09A 4EGLA 1CEZA 3PYFA 3OTBA 2ZHBA 3NL0A 3ILJA 3TUZC 3DGPA 1HNXJ 2QA4S 1FHTA 3UR3C 4K5SA 2AX0A 3IP0A 1EAYC 2OPSA 2DIUA 4LF9J 1FFGB 2DYAA 3M9NB 3QJJA 2J9DA 5GMEA 2JLGA 3BSNA 4OIXA 2CNNB 1VQKS 1ZAXA 3PY8A 2GIFA 4PWDA 1FX4A 3MAAA 4F4ZA 5L8RC 1Q5YA 4LT6A 5DGBA 4DFPA 1W2BR 1D9FA 3GQCA 2PGCA 4JUZA 5JXSA 4CT8A 4X4TA 2AJQA 2HFOA 1TU0B 4FZVA 3QJLA 3TEHB 4ZLPA 4ZVQB 5KT4A 1GMUA 1C1BA 2CPZA 4I2QA 2FZGB 2HZAA 3CDUA 1DTTB 4L3KA 4BHQA 1TKZA 3IR5B 1X9MA 4UOCA 2OEJA 4QIVA 3QWUA 4F8RA 3R3TA 3JQJA 1U8SA 3ZZYA 3SI8A 1N33F 1SQFA 4Y2IA 3VHQA 9RUBA 1GTEA 1LWCA 2ZBIA 4KHPJ 1TTHB 1VQ5S 1Q1KA 2RIJA 3IXQA 3NLCA 3QGGA 3CC2S 1PYOB 3G86A 3GYNA 4WWSA 1C2PA 1LWEA 4QW9A 3AOCA 3MTJA 4PAAA 2Q6BA 3PRDA 4EBCA 2EG2A 1F1BB 2FC8A 2W4CA 2PDAA 2UU9F 4TNOA 1SUQA 4RWWA 4NLSA 1NSAA 2BW7A 1IN0A 3VAJA 4P7TA 2APOA 3LP0A 1IBCB 3BR9A 2XGQA 3NG8A 3MMAA 3SXLA 2W7PA 3P49B 3QO9B 5HVHA 4J9NA 3I55S 1YLXA 1S1UB 3BBFA 3PXGa 1MWYA 2DIVA 2F40A 2M2BA 4RLEA 1HWIA 3B82A 4ZJOA 1WNEA 4C97A 5J2NB 1WTFA 1N5VA 2CJBA 1SQEA 2YBVA 3ZNUA 1FXRA 1H73A 2BQRA 3KNAA 4XPCA 3EVMA 4NL5A 2XLIA 2QLXA 3G8SA 1V5VA 2ZZTA 1UFLA 3W62A 3OLAA 1X9WA 1YBUA 1FCAA 1FRJA 1V3RA 2J6SA 3C46A 4K4VA 1ZAWA 4X4UA 1RISA 2QTWA 2MQQA 5ETNA 1OYEA 4DLEA 4V19J 4B3RJ 3LAMA 3HM9A 1X7VA 2KRBA 3PTWA 2CDRB 3ULHA 3D1HA 3N9UC 4NZ7A 4X66J 3HVRA 3CCLS 5ETMA 4A8KA 5IS2A 3BQ2A 1ZETA 1X5OA 4DUZJ 1EB0A 2IBOA 4NA3A 2VBYA 3HT3A 5A76A 1FJGJ 1HA1A 2VB6A 3AQPA 4LF6J 2BABA 3GYXB 2MXYA 1VQ4S 1T9WA 3R5AA 3PKYA 4DPUA 2ASJA 2Q3PA 4QR2A 1NK0A 1ZA1B 1RYRA 2BXJA 2XS2A 2CRLA 1REVA 2EC0A 3G9CA 2LA4A 5CD4A 5D3GA 2D41A 4PRFA 2EFPA 3HKZD 2HRYA 3OUYB 1QE1B 1BQMB 3ITHB 3W61A 3LP2A 3AJ1A 1NCLA 1UKUA 3GB0A 2M52A 3PHTA 3TNVA 4P52A 1BGXT 1U47A 1SKSA 2JVOA 2COLA 1P1LA 3K5NA 3MMCB 4FP9A 3TW0A 2V6AA 1S1UA 1JLGB 1B99A 1I1GA 3FQKA 4P74A 4C6AA 3OV7A 1C0UA 3GIRA 3I96A 2HHHJ 4LFCJ 4NYZA 1YRUA 1J27A 4C4WA 4IUFA 3PEJA 5FLXU 3M2VA 1RU1A 4ILRA 2R8HA 2OP5A 2ZUAA 2FB0A 2V2KA 2FC9A 3GFHA 1EKSA 1U8WA 2IMOA 4B17A 1TKDA 2GJFA 1S0NA 1L5UA 1RT1A 3I5BA 2BBEA 4WPAA 1U25A 3B54A 4DU8A 1T05B 2BJ3A 2ZE2B 2L9DA 4ECQA 4CLUA 4MK8A 3RZAA 2UUTA 1KQGB 2HLTA 1IM6A 3D1QA 3GFZA 2OHDA 2VD3A 1S6UA 2L9NA 2FIUA 2PFDA 3OFGA 5A6WA 2ILZA 4ELUA 3FMWA 3BBCA 1PJ6A 2NZCA 4BWJA 2HNZA 2R4FA 3BBBA 2F4FA 3QLHB 2MYFA 2YVSA 4HR2A 3EUNA 4RU9A 2FJBB 3I5CA 5D4NA 3NMAA 1KQSR 5AJ3J 3Q23A 5F0UA 1UFWA 1AFJA 3NBPB 4ZVHA 3UVJB 1Q53A 1VQ6S 1BC6A 3R2CJ 4NLQA 1NJIT 3AOBA 3MR3A 4JOUA 3BJYA 2ZH6A 2Z57B 3WBZA 3MAHA 5DLFA 2JEIA 3GG1A 3BSOA 1BQNB 4DR1F 1H38A 1N5QA 2R7VA 3R5BA 1W7WA 3M6WA 2I5JA 4G1IA 2OEKA 3IM9A 3RUBL 2P8IA 2E1PA 4KV8B 3BN4A 4DF4A 2R7XA 3VR1A 3M8RA 3SCIE 3PYGA 4QYZJ 3IR6B 2BA9A 1V3SA 1YJTA 2K8GA 4UTGA 3UCGA 1JWWA 1SB6A 4TKTA 2HRUA 3DRRA 2HLUA 4LBIA 4QIEA 2UUBF 1QVFR 4F3OA 2OFGX 4ECRA 1U1QA 2MY8A 2FVQA 2YWWA 3B6BA 2AD9A 3MXHP 4EBDA 5I42B 3PRBA 5KG5A 1TL1A 1U6ZA 1RHMB 6FD1A 4TU9A 2J7WA 2CQGA 4X62J 3U1NA 2XM3A 2W4PA 1RZMA 3BGRB 1CS4B 3UN5A 3CXCR 2C2DA 3W60A 1FD2A 1XMOJ 3HX9A 2ACMA 2AP6A 3HO1A 5D6GA 2V94A 3C66A 1DTQB 3KLHB 2J9DE 1HQEA 4EU0A 2VFUA 5CYQB 3D0IE 4PG7A 1WOPA 3FRZA 4EO8A 1JJHA 1S57A 1HWUA 3CPWR 3TAMA 4F2RA 3GG0A 4F36A 1N32J 1Y5LB 1ZA2B 3DHWC 1OMSA 5G4DA 3FMBA 1RA7A 4DV1J 2OO4A 2VHGA 2OD6A 3L7OA 4ZPAA 3TA2A 2PI5A 2RKIA 1LFWA 3O6QA 1MW7A 1LW2A 2QLWA 3MEEB 4RNOA 2I0XA 1Q4RA 1EZZB 3SEOA 3LW5C 2DHAA 2AYBA 4DQPA 2WZ1A 3CF5Q 3BZQA 1SH3A 2G9OA 4A4JA 1GQEA 4I1TA 4Y34A 3DLJA 3R97A 1Y5NB 1HBNB 4NEYA 1IKWA 2IRXA 4K7QA 1C4CA 5E33A 3J81Y 1FDNA 1U2FA 3WC0A 2CPYA 5KFHA 4O3SA 2Y1LB 4ZMMA 3EGZA 2OMLA 3BO4A 3MPYA 3DLKB 1KLMA 3A3NB 3QIPB 4OHWA 3UCZP 4D3HA 4JI4F 1NZ8A 1UEVA 2YNGB 3H2LA 3QMQA 3T6BA 5RUBA 1D9DA 4QWAA 1N5YA 2ZBRA 1TZ0A 4X4SA 4JI6J 1FA0A 2HSEB 2Z30B 1KNZA 1RK8A 2M70A 2XGPA 1QJHA 2IAJB 2J8SA 3QT5A 2HVEA 2BKNA 2WONB 4CLSA 2YKOA 4YB7A 2DXDA 1Y00A 2M4MA 3AB2B 4K4SA 2AEFA 5B0AA 3T5HA 2JEGA 4MIAA 2DY9A 4HACA 1P1TA 5KOWA 1HWJA 4ANEA 4R8UB 1RBOB 3W2WA 2ZDOA 5B09A 2U1AA 3LTOA 1WC6A 3QGIA 1YI2S 3KK3A 2MSTA 4IQXA 4NA1A 4YB6A 1RP5A 4USWA 4WFAQ 1T05A 3EZUA 2WBMA 4RUCA 3NKYA 2VIHA 2M8DB 2UUCF 2VJVA 1FKPB 5IXUA 2NXJA 3OD2A 5KFIA 1WEXA 2FHMA 4LSZB 2OFHX 1M5SA 1YWXA 4F3MA 4IG0A 2CVIA 4B9SA 4ZVGA 3VAIA 2ROGA 3MFHA 1Q86T 2VQFJ 1RT5A 1TP7A 1HHTP 5J2QB 2IFXA 2VH7A 3H90A 2FPHX 4UOGA 5KFMA 2XWYA 5E7OB 3H2VE 5F8NA 3NGUA 3G87A 3JTOA 2HG4A 2ASYA 1M1KT 2X3DA 3I5AA 1JLQA 1IKVA 2GS8A 5DZ7A 4KHPF 1N36J 2XNRA 3EE3A 4RW7B 3TUPA 4M5JA 4CLPA 3HT0A 4U8VA 5KFQA 1EETB 1U45A 1FD8A 1UPMB 1WC1A 1BLUA 1E6VA 3ENWA 4UOHA 2R9LA 4LFBF 3Q2SC 2DKOB 4KR0B 1SH0A 2IVMA 4LFAJ 4EI2A 3MHYA 4GVBB 4BC9A 2HFSA 2GGPA 5KOXA 3PO5A 2MZRA 4FF1A 2OPQB 3I0SA 3PIPQ 1VQNS 3T1YJ 2NLWA 1RAGB 2J9CA 4FKXA 2BMBA 4ERDA 5GVQA 5IM0A 3D28A 1RBAA 4KV8A 4BC7A 5A2QU 2V4JB 4J9VA 4KPCA 3WX4A 1OY8A 2F7VA 3C19A 1Y9OA 4DBQA 4JI8J 3VGTA 4OI6A 1EQMA 4X66F 2UXDF 5AXLA 2CQPA 2VPWB 4DQQA 3ONQA 3M8PA 3D1OA 3KUGA 5KTQA 1YJNS 3QQCD 4G6VB 1P8GA 2V34A 1Q0NA 2KFNA 4O4RA 2QO3A 4TVAB 3MM5B 3PFEA 4TY8A 3KMSA 3ZO7A 3EGNA 3IC1A 1X5TA 2WW8A 2E1MC 2NSBA 4CYUB 3W5YA 3KUEA 3MCNA 4ZVRB 4M5GA 1EARA 3ICLA 1F2HA 3AHPA 2WONA 5GAHI 2KHCA 2ROPA 2FTRA 4G1QA 5H1SV 1QUVA 4HL9A 2IPOB 2BKPA 4FNIA 4DQSA 4B9LA 2LXUA 4ZP6A 4HI1A 2GVZB 1TV6A 2MJNA 1KQFB 3T6JA 4ALZA 5E2QA 5A8KB 2R7RA 1R7IA 3BKFA 3NXZA 2RDIA 1JLFA 4ED0A 1U6BA 3M8QB 4TLQA 2YQ1A 2EFNA 2VA3A
chains in the Genus database with same CATH topology
1VJWA 2RRBA 4I67A 1ZZNA 4LVNP 3M1VB 2HWHA 3CULA 2J6UA 4I2QB 2HFZA 1C0TA 2JLEA 6FDRA 2KT2A 4PQAA 4C0OC 1FNXH 1NHVA 1AUDA 3KTQA 1G3OA 1A6LA 3DDKA 2HVZA 2A1BA 2JEFA 1Q8LA 1KLMB 1HNZF 2JVRA 4B9MA 4DFJA 2HHTA 4ZCIA 4OZ0A 2I1RA 1N5SA 3TI0A 1NK8A 3RR8A 1TL3B 3UQSA 5CCLA 3M2VB 4C8KA 4KO0A 4H54A 1UETA 1GXLA 3THVA 2MZTA 5K8PA 1P9QC 5D3GB 1T3NA 4N8OA 3L95X 1JJ4A 1RT6A 2ZUGA 3T1AA 4EYIB 4LFAF 4IH6A 3LANA 1WF2A 4P6QA 3BGLA 4URGA 1R3NA 1LWFA 1OSCA 1LKZA 1S79A 2ATLA 2QMXA 2EPIA 3HJFA 1G7CB 3PKMA 4Q44A 1RTHB 2MHEA 4CTAB 3OHBA 2IYGA 4K4VA 3M05A 1KHVA 2EKYA 2YKAA 1HR0F 3KMQA 5MLCV 3L09A 3IG1B 4Y3CA 3DLEA 3EXCX 3FGVA 4URSA 3BO3A 4RW4A 3LP0B 2C28A 1TK0A 5HL7Q 5CH7B 2WTFA 3PFOA 2VKZG 1RTDB 1YBAA 1HHSA 1JLAB 4NCBA 1FNOA 5JUMA 2EFOA 3FSIA 2AGQA 4DG1B 2GC8A 3OTEA 3VQTA 5HBMB 3HF5A 4OFZA 3MR5A 4F25A 3P96A 1SV5B 4I56A 3T1HF 2AV5A 3MOZA 2MKCA 2M8HA 2EBGA 1TK5A 2XCPA 3OTOF 2KH9A 2KYZA 2XLJA 4KKOA 3H25A 1D3WA 2POKA 3IFEA 1DQ8A 3J7YU 5L9NA 4LSNA 5EDWA 4X65F 1YGYA 2R7UA 5DDQC 4KBIA 3H40A 1TK8A 1S9EB 1IQTA 2YKMA 4Y28C 5E3QA 1MROB 2YX4A 4WE1B 5E41A 4G3IA 1MU2B 4HDGA 1V3ZA 1L3UA 4KE5A 4QIFA 2ZZNA 2XULA 2VBWA 2LLZA 2YKNA 3BQ0A 3ISND 2OSRA 2P9GA 2QMWA 1RT7A 2Y0SD 2DITA 5EX0A 1HW8A 2X1BA 2PMZD 1H7XA 2U2FA 1ZH5A 4WFNQ 1V6HA 2X1AA 4XK8C 4QIGA 5IM0B 4DOZA 3GR1A 3PACA 4RW9A 1U48A 4I2PA 3JYTA 2E1CA 2R2UA 2GX8A 5KFUA 2W9BB 2FHJA 4DR4F 4J9KA 3LP1B 1P27B 4TN2A 1ELOA 1F9FA 5J2MB 2GO9A 2MPUA 1XEZA 1Q81T 1XTZA 4YMEA 1T7PA 3FEXB 5GAEI 3GV5B 1NK5A 1VK8A 1FT8A 4KKOB 4BBYA 2LMIA 1TKXA 1N52B 2DCLA 3M30A 4NLXA 4M1KA 2BM0A 4FXDA 5AXMA 3T9ZA 4MK9A 2I5JB 4M5DA 2IM0A 3V6JA 1RTJA 3KLIB 3PW7A 3GR0A 4DG1A 3CJKB 1XR6A 3SSSA 3H20A 4OJGA 4DMZA 3BSCA 4DSJA 3WDOA 4F67A 1L3TA 1KOHA 2IM2A 4OJHA 4B9UA 5J1PA 1HNIA 2KG1A 3JSYA 3MUVP 2E66A 3KK3B 3NCPA 2NYIA 4WK1A 1BQNA 3PW0A 3GFXA 3RW7A 4OMFG 3LPYA 4DR6F 1DQAA 3CCZA