2HNZB

Crystal structure of e138k mutant hiv-1 reverse transcriptase in complex with pett-2
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
422
structure length
399
Chain Sequence
TVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNKTPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights into mechanisms of non-nucleoside drug resistance for HIV-1 reverse transcriptases mutated at codons 101 or 138.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords Reverse transcriptase/ribonuclease H
total genus 109
structure length 399
sequence length 422
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2006-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2hnzB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2hnzB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2hnzB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2hnzB03
4LQ9A 3SFGA 3H5YA 4ECYA 3LAKA 1EP4B 5KFPA 2FVPA 3DRSA 1HYSA 3PZPA 4HKQA 2DPJA 4ZPDA 4ECSA 4KSEB 4URQU 1TP7A 4O3NA 3GYNA 4Q8FA 3ISNC 1JX4A 3I0SA 3CDWA 5D3GB 4QWDA 2FJWA 3GV8B 4I2QA 4KHRA 4NLTA 5KFQA 3H59A 4ED2A 4ICLA 4NCGB 1J5OA 4ZPCA 3MEDA 1KHVA 3DMJA 3QIPA 1QAIA 1JLBA 3G86A 4NLUA 1HPZB 3DRPA 1VRTA 5EWEA 1RT1B 2OPQB 5KT2A 2W9CB 4F4ZA 1RTHB 4MK9A 1HQUA 2FVSA 1BQMB 3MECA 4NLSA 3JYTB 1TQLA 3Q8QB 2FLNA 3KK2B 5DGAA 1DLOA 2WCXA 1S1TA 3BJYA 4WE1A 2FJVA 2HNYA 1SH3A 1W25A 3Q8RB 2QE5A 4M95A 4R5PA 3CJ3A 4FS1A 4ECQA 3DRRB 4RW7A 2W8LA 2XI2A 4EEYA 2XCAA 3DLGB 3RB0A 1S10A 3IGNA 2RF2A 1HMVB 3ISND 5KFZA 2V4RA 4IH7A 4WZMA 4FBTA 1RYRA 2AX1A 1RT2B 4G1QB 3CO9A 5DQGA 3DI6A 2WHOA 1C2PA 4Y3CA 4QWAA 2OPPA 4K4TA 3HVTB 3KLHA 3KLIA 2JEGA 2IA6A 3OLBA 2VA3A 5KT6A 4NLYA 2BR0A 4ZP9A 4GC6A 4K4WA 2JLEA 5CYMA 1REVB 4XPEA 4NLWA 5L1JA 5KFWA 2IAJA 3V4IB 5KT4A 3M8QB 3KK2A 4ED6A 4MK8A 4O4GA 5KG6A 4ZP8A 4ZHRB 2JEFA 5KFJA 3CDUA 4RUAA 2XC9A 1HNVB 3PJXA 2DPIA 2OPSA 2ZE2B 3QIPB 1C0UB 4DEZA 4K50A 3FDSA 1FK9A 1RT4A 4ED0A 3NBPB 1RT7B 3C6UA 3GIIA 4IDKB 5KFGA 1XR6A 2E9TA 3LP1B 3CDEA 2AX0A 1D0EA 5KFHA 3T5JA 4RW7B 3OL8A 4WYLA 2XCPA 5KFKA 1RTDB 2C2DA 3G6YA 1K1QA 1TL3A 3V6KA 2R8JA 1C1BB 1S1XB 4IG3A 5I42A 4PUOA 1S1WB 2O5DA 5J1EA 3GIJA 3Q8SB 3C6TA 3HHKA 1JLGA 2I5JB 3KJVB 2W9CA 3DMJB 1S1UA 1JLGB 2I5JA 4QWCA 2FLPA 4TXSA 4NCGA 1T03B 4EBEA 2OPRA 2ZD1A 1ZTTA 4I2PB 1OS5A 3I5CA 3RB6A 5KFBA 5HBMA 4ED8A 1JLAB 2FLLA 2YNGA 5F8HA 3EPGA 5EWGA 4RW8B 4WZQA 3FFIB 5FDLB 4O4RA 4EO6A 1SUQB 3MR6A 4IOBA 1Z4UA 3QGHA 4TY8B 2BRKA 3BQ0A 3PW0A 3IS9B 3MF5A 2YKMB 3PR5B 2JC0A 1BQNA 1TVRB 4QWEA 3MR5A 3C6TB 5KG0A 3DLEB 3RB4A 4NLRA 2RKIB 5CYQB 5J2PB 4MH8A 5C25A 4O3PA 2HAIA 4IDKA 3VQSA 4JV2A 3KLFB 3H98A 5L1IA 3N6LA 5KFXA 4KKOA 5C24B 3V6DB 4YMEA 3HKWA 5HP1B 2J6TA 1S6QA 2VG7A 5KFAA 3NGDA 3KLGA 1JIHA 5J2QA 4R8UA 5J1EB 1NHUA 4KFBB 5T14A 4IFVA 3DI6B 5HROA 3M8QA 2WTFA 1HNVA 4RW6A 3IRXA 1GX6A 1RA6A 2V0NA 3DM2B 2BE2B 2HWHA 3BSCA 4ZP7A 4QW9A 4KV8B 1RT3B 4H4MB 3TAMB 4WXOA 4K4YA 2HMIB 3TAMA 2D3ZA 3I0RA 4DL7A 5DG8A 4F4WA 4WE1B 4URSA 1RAJA 4X2BA 2XGPA 1S9GA 1ZETA 4ECUA 3CJ4A 3PW5A 2UVWA 2UVUA 3HVWA 4WYWA 1RTHA 1I6JA 4O3OA 4R0EA 3KLGB 4IFYB 1RT1A 5KFEA 3DRPB 2ASJA 1QE1B 4F4XA 4PQUA 4O3SA 1IKYA 2IC3B 3FQKA 2HWIA 1JLFB 4R5PB 1IKYB 1RT5B 2IC3A 1HQEB 1JKHA 2HNYB 3KNAA 3JSMB 3RAQA 5KG4A 3HVTA 2V4QA 3OL6A 2WONB 4J9RA 4NRTA 4TYAA 3QZ7A 1RT2A 4G1QA 4URGA 4XO0A 2R8IA 4ECXA 3V6HA 1BQMA 3MECB 3IGVA 5EDWA 2B6AA 3ICLA 4J9KA 4LSNB 4ZVHA 3GQCA 4I2QB 1HPZA 2QV6A 3N6MA 2FVRA 4ED3A 5F8JA 1RT5A 4K4XA 1RT3A 1TL1A 2YNHA 4H4MA 4KAIA 2HNZA 1IKWB 3KLFA 3H5SA 3M8PA 1S1TB 3I0SB 2I1RA 5KFRA 3DOKA 1YVFA 3QLHB 4NLQA 2ILYA 3FRZA 3OL7A 4RNMA 4R8UB 5KT3A 3QYYA 5K14A 3BSAA 4I7FB 1RTIB 1JLCB 5KFMA 3DOLA 3KK1B 5KFFA 5C24A 3V6DA 5DQIA 1SH0A 3CIZA 1CSJA 3H4DA 1FKPB 5L1KA 4GC7A 1UWBA 3QGIA 2UVVA 1JXLA 3GIKA 4IG3B 1IM4A 1MU2A 1S6PB 2F8EX 2GIRA 1S9EB 2V9WA 1RDRA 2YKNA 2IM3A 4TY9A 1RTJA 2FJXA 1N56A 2BE2A 1S97A 2IMWP 2JC1A 3MEGB 2RDJA 5KFNA 4RU9A 5JXSA 1HARA 3PW2A 4PWDA 2BQ3A 3KHLA 1LWEA 3IG1A 5KFIA 4RW9B 3BSNA 5HP1A 2ZE2A 3MEEB 4NLPA 3KJVA 4DL2A 2J6UA 4Q44A 4I7FA 3DYAA 3D5MA 1S48A 1JLAA 5KFUA 2IM2A 1C1CA 3KK3B 2W7OA 5C25B 5J2NA 1EETA 3KHGA 1NNDA 4DL4A 3T5HA 2ASLA 2ILZA 1HNIA 2ZD1B 1RTDA 1T03A 2RKIA 5F8LA 2HNZB 2R8HA 2XWYA 5KFDA 4Q45A 4J9NA 3LP1A 4KO0B 3BGRA 1IKVB 4NRUA 3IG1B 1JLCA 2FVQA 4ZP6A 5L1LA 2ALZA 4ZVEA 1T05B 4WFXA 4J9SA 2JEJA 4WFZA 3UQSA 2C22A 4PWDB 2WRMA 4RW8A 3T5LA 2OPSB 5DLGA 4Q0BA 1RTIA 2WONA 4KE5A 4EYHB 1TL3B 2ASDA 4ECVA 3N6NA 5EWFA 2YKNB 3MTKA 1HMVA 2B43A 4JV1A 1HQEA 3C6UB 4KBIA 4NLDA 3DRRA 3ITHA 2B6AB 1JLFA 2UUTA 5DQHA 1TV6A 5KT7A 2R8KA 4Q8EA 4DG1A 3NKYA 4IQXA 3OHAA 4KB7A 3CJ0A 3BQ2A 1K1SA 4JUZA 4K4ZA 1S1XA 5I42B 5DG9A 4HYKA 1S0OA 2R2UA 4ZMMA 1DTQB 2IAJB 5DGBA 4Y2AA 4DL5A 1LWFB 3KLEA 2AWZA 4IG0B 2W7PA 1RT6B 4MK7A 4ECTA 3I5BA 3G6XA 1TL1B 2YNHB 3LAMA 3BR9A 1LWCA 1S1VB 2R2TA 4ZPAA 5KFTA 5F8IA 3JSMA 1N4LA 3BSOA 3KLIB 3KLVA 3MR2A 1XR7A 3QIDA 5KFCA 1C0UA 3MR3A 2AU0A 4ZVGA 2CJQA 4H54A 3UDLA 4ZHRA 4QPXA 3NAHA 5EUHA 2OPQA 1S6QB 4LSLA 4IH6A 1MMLA 5I3UB 3DDKA 1SH2A 1S1VA 3PW7A 5F9LA 3NL0A 2BANA 3QZ8A 1VRUA 1QE1A 4RW6B 5KFSA 2HNDB 4EYIB 3KK3A 3KLHB 2W8KA 5J2PA 2OH2A 3V81A 2OPPB 5HLFB 2BQUA 3IRXB 4DG1B 1QUVA 2JEIA 4RW9A 5JUMA 3H40A 5J2MB 4IRCA 1NHVA 2RF2B 2AGQA 3KMSA 2VG7B 3FFIA 5FDLA 2GIQA 4ED1A 2UVRA 4MFBA 2W9BB 1LWCB 2YNFB 3RAXA 4RNNA 1GX5A 3KOAA 1S0MA 4IG0A 4K4VA 3TVKA 1LWFA 3KLEB 2C2RA 1C0TB 3PW4A 1U09A 1N6QA 2FVCA 1EETB 4IH5A 4Q0BB 1MU2B 1S6PA 5F8GA 4I2PA 3IS9A 3NMAA 1IKXB 1TKXB 4ID5B 3PR4A 1S9FA 3LP2A 4O44A 1N5YA 2VG6B 3PJWA 4IR9A 3MEEA 4H4OA 3BGRB 4ZVFA 3DOLB 1N5YB 3RB3A 5C42B 2YNGB 3GILA 3CJ2A 4TY8A 4RW4B 3ITHB 3T5KA 1LWEB 1FKOA 1TKTA 4IRDA 3E01B 4PUOB 3QO9A 4QW8A 2J6SA 3LP0B 1JLEA 5J2NB 4NZ0A 4TN2A 1C1BA 3LP0A 1N6QB 1JLQB 3QO9B 4RNFA 5CYQA 3KMQA 3CVKA 3SI8A 4J9OA 1WNEA 1JLQA 3UR0A 4RNHA 1S9EA 3KHRA 3H5UA 3HVAA 1S49A 2C28A 3DRSB 1HYSB 4O44B 1LW2B 2OPRB 3DLKA 2D41A 1T05A 1RA7A 2C2EA 5C42A 5J2MA 1LW2A 3DLKB 2IM0A 3T19A 4Y34A 3KK1A 4G3IA 4KO0A 4IR1A 4J9MA 4RUCA 1TKZA 4YR0A 1TKXA 1IKXA 5HBMB 1S1WA 4O4GB 4Y2CA 3FSIA 4NLGA 5F8MA 1LW0A 2IJNA 4RNOA 1C1CB 4MFBB 3Q8PB 2W9BA 4YR2A 1C0TA 3V6JA 1DTTA 3LANA 2CKWA 1IKWA 4RW4A 3MFIA 2XI3A 1FK9B 2BQRA 4J9PA 4PQUB 5KG7A 2B5JB 3T1AA 4ED7A 4U6PA 3OHBA 2VA2A 3LP2B 1RT7A 4EBCA 2YNIA 3UPFA 4ZPBA 3DOKB 3IN5A 1S9GB 4B3OA 2HNDA 4TQSA 2ZKUA 3EZUA 2BRLA 1KHWA 4TYBA 4MIBA 1N48A 3BREA 5F9NA 5I3UA 4FS2A 1VRUB 4WFYA 4FBUA 2AGOA 1RT6A 1RT4B 3H4BA 1RYSA 2R8GA 2XGQA 4MKAA 2WK4A 1DTQA 1R0AA 3SFUA 3GIMA 4IFVB 5HROB 5C5JA 3V81B 5HLFA 4TQRA 2IM1A 4LQ3A 4KHMA 3TQ1A 2EC0A 4K4UA 4TLRA 3V4IA 1D1UA 2B5JA 3M8PB 3OL9A 3CJ5A 5CYMB 3BQ1A 4EBDA 4ICLB 1J5OB 5F8NA 4MKBA 2VG5B 4OL8A 4NLXA 4O3QA 3RBDA 2D7SA 3M9NB 4LSLB 5KG3A 4NLOA 4LSNA 3CWJA 4KV8A 2W9AA 4Q43A 4M94A 1HQUB 3DM2A 2GC8A 4XPCA 3OLAA 3DLEA 2AQ4A 3H5XA 1DLOB 4F4YA 1TVRA 4MIAA 1ZTWA 3I5AA 3JYTA 3PVXA 4NLVA 2YNIB 4ECRA 5KG5A 1SUQA 3PHEA 3DLGA 1JLBB 4NYZA 3M9OB 1JKHB 1T94A 2VG5A 5KFLA 3MEDB 1DTTB 2UUWA 2WB4A 2R2RA 4IFYA 4KFBA 3KHHA 3NAIA 4YP3A 5L9XA 4DL3A 1VRTB 1S0NA 1S1UB 2IBKA 1R0AB 4H4OB 2YKMA 2RDIA 4JV0A 4KKOB 4J9QA 5DG7A 1TV6B 5KFYA 1SV5B 2WOMB 4ID5A 3I0RB 4IKAA 3EPIA 2HMIA 1HNIB 1IKVA 3GV7B 5D3GA 4RZRA 3G6VA 2AGPA 3RBEA 4U7CA 2YNFA 3M9MB 4B3OB 5KG2A 1JLEB 1T3NA 1QAJA 4DL6A 1EP4A 3MFHA 1UWBB 1TKTB 3H2LA 4EO8A 4YQWA 2E9RX 2E9ZA 2R2SA 3NBPA 5J2QB 2ATLA 1KLMB 4ECZA 4J9LA 4F50A 2VG6A 3FQLA 3D28A 4ECWA 5KFOA 3OSPA 5K14B 3QGGA 3OSNA 4IRKA 1RTJB 3QLHA 5DLFA 4O3RA 1LW0B 4K4SA 3MEGA 5KG1A 1S4FA 2D3UA 3E01A 1XR5A 3LALA 1REVA 1FKOB 1TKZB 2BANB 3E51A 1SV5A 2WOMA 4WXWA 1FKPA 3DYAB 4YR3A 5KT5A 1BQNB 3GV5B 2IJFA 4QWBA 1KLMA 5KFVA
chains in the Genus database with same CATH superfamily
3UDVA 4LJMA 3HT0A 5BJRA 5KFPA 2FVPA 1WWHA 1HYSA 3AXKA 3MI7X 3PZPA 4HKQA 4OYXA 4LVOP 2YY3A 3CC2S 2Z8QA 4HHUA 1EKRA 3IBWA 3QBCA 5A8KA 3ILLA 3PO4A 4KSEB 2WSCC 4URQU 5H9EK 1HBUB 2DH9A 2K3KA 4Q8FA 3AOBA 3ISNC 4I69A 4PR6A 3QRPA 3U27A 2OI2A 1SPBP 3L7UA 1O6XA 4ZPCA 4DR3J 1DQ9A 6FDRA 3AJ1A 5EWEA 3R2DJ 3F44A 2HGNA 2EKNA 2JWNA 2XMMA 4A8FA 3M30B 1RTHB 1A7GE 2HBQB 2HHXA 1BQMB 4NLSA 2CA9A 2XY6A 4TVAB 3DDIA 5DGAA 2I38A 1TAQA 4YS2A 4FF3A 5HI7A 4B9SA 5E5NA 2HVDA 4ENOA 3PFEA 3CJ3A 4CRJA 2DHAA 1F6TA 3OQ2A 4M5HA 4RW7A 1NJWA 2V94A 3AFGA 3N79A 1S72S 1BY9A 2F7VA 4DBQA 5B0GA 1IWAA 4DV1F 4M5DB 1AW0A 4DV1J 4TKTA 5KFZA 2H4YB 5LL6d 3I55S 1NK0A 3AB4B 2A2DA 1RT2B 3CO9A 4N76A 1JNRB 2IDEA 4WJBA 1VC5A 1SL1A 2BACA 3VAIA 2DHGA 4A8OA 3HVTB 1S59A 2JEGA 3LUYA 2IA6A 4MKVA 3VTIA 1J2VA 1XC9A 4MMOA 2ZZNA 2HGLA 2CG4A 4D3GA 2JLEA 4NLWA 4BC9A 4ZLPA 5KFWA 3VAGA 1VCTA 3AA8A 2JVOA 3MD3A 3G8SA 5L38A 4P7TA 4XK8C 2XS2A 2GMHA 4O4GA 2L41A 3PRVA 4ZHRB 1CPZA 2YQ0A 4QIVA 5KFJA 1HBMB 4A8SA 1HNVB 3TA0A 2FQQB 3ZFVA 2DPIA 2OPSA 2LMIA 3QIPB 1GXUA 1PKUA 1RBAA 3MZIA 2QN6B 3BB5A 3FDSA 1RT4A 1SBRA 2NPFA 5M2UA 2GO8A 2DGTA 2RQKA 4MAKA 1XNQF 4Z7CA 2DO4A 2ZJRQ 2B3TB 5KFGA 2MJUA 3CJSA 1WC4A 3QPIA 1MMDA 1DHMA 2AX0A 4ED4A 4RW7B 1Q7LB 3MXHP 2XLKA 1WEXA 3HP6A 3Q23A 2YXLA 2J8SA 3PYEA 2UV8A 1K1QA 1RP5A 2XMVA 4P2FA 1S1XB 1S99A 1TELA 3W65A 3OUYA 3CUNA 1S1WB 4RL1A 2XLIA 5J1EA 3JQKA 3C6TA 4OYIA 3ILIA 3R2CJ 3OXGA 4LBHA 3BZQA 1PAUB 4DPUA 1FWPA 4NCGA 2QLWA 2DNNA 1YSJA 2XYGB 4XAKA 3OW2R 2DR6A 4EBEA 4TU8A 4I2PB 3I5CA 1NB2A 3MMCB 1RWNB 2Z2MA 2ROGA 5BR8F 2DGUA 5HBMA 2QFJA 2KFYA 4ED8A 1JLAB 5F8HA 1QSSA 2DITA 4HLBA 5EWGA 4B02A 4RW8B 1CEZA 3ISZA 4RUHA 4IOBA 2VBYA 1KVJA 3QGHA 3A3NB 1KKHA 3DGVA 4TY8B 3M8YA 4ZIWA 6AT1B 2EFPA 1X4EA 5RUBA 2YKMB 1M1GA 1RZMA 1LFWA 2GS8A 2JC0A 2NZCA 2ABYA 4W4MA 1DQAA 2CWXA 4DX5A 4WF9Q 1Q81T 2ZH5A 5CYQB 5D4OA 5J2PB 2K7JA 4MH8A 1MN9A 5C25A 2N7YA 3OPKA 3DOMB 2KJVA 4O3PA 3C46A 3GP9A 3CJKB 2FYXA 4KHPJ 1JJHA 2B7CB 2PSZA 2LP4A 1NAQA 3JTOA 5L39A 4CO2A 2R7WA 4RU2A 1UETA 1BMQB 1D8YA 2E5GA 1K0TA 1YIJS 1JNZB 3EE3A 1NK4A 4KJIA 1JIHA 1NH7A 1H74A 1OSCA 4LUBA 1RACB 4LFAJ 2VQEJ 3C2PA 2VICA 2W2MP 3MM8A 5T14A 4IFVA 3DI6B 5HROA 2F4FA 4NI2A 1HNVA 1GX6A 3BDPA 3DRYA 1XK8A 3BSCA 1UEVA 2M0GB 1NJIT 3JXOA 5HMXA 4Y65A 4OZ5A 3NNCA 4H4MB 3GR1A 1MW7A 4BLGA 1HI8A 1WHWA 2FC8A 2MQNA 3NS5A 4NA1A 1SI9A 3MM9A 4OJGA 3V5RA 3OJSA 4DL7A 4OX6A 4NXMF 1PBUA 1PJ6A 4CT8A 4WFNQ 4F4WA 1Q7YT 4URSA 1RAJA 2XGPA 1ZPWX 4C11A 5HMZA 2MB0B 1KDNA 1SIWB 2UUAF 4Y0FA 1RU2A 4HH0A 4HI1A 4CO5A 4P6QA 1RTHA 1GQEA 1WHXA 4CP5A 1XNRJ 5KFEA 3DU5A 3BJYA 3M6UA 3D54A 1QE1B 4LRDA 2JL9A 2KDOA 2ZC4A 1IKYA 2M2BA 4FZVA 3U1LA 2B56A 1GXLA 2B9WA 4AQYJ 2CUYA 2LEBA 4K59A 3T1HJ 3KNAA 2HNYB 3MAAA 2KXHA 2QT7A 1FRIA 2CG8A 4JV5J 1FVQA 2V63A 1X9MA 4C8OA 1ROFA 2R7RA 1P6TA 1EJ7L 2OHDA 2V4QA 2ZBCA 3EGNA 4KR0B 2XEXA 2WONB 4OYBA 5ETSA 4J9RA 1WG5A 4TYAA 1N8RT 4XO0A 1AYEA 2E44A 1WF0A 1M5OC 3V6HA 3MECB 1SIZA 2AJFE 2UU9F 5EDWA 3ICLA 4PG5A 2YVSA 3SYZA 2B8PA 2AYEA 3GFYA 3VGTA 4F3QA 4L6V3 1KQKA 1H2VZ 1FRJA 1RT3A 1TL1A 1EKSA 3EM1A 4J90A 2NUUG 5E41A 3R1HA 2BXJA 3H5SA 3PX6A 2KN4A 3M8PA 4LFBF 1LOUA 3SDEA 3BN4A 2E5LF 4LF6J 2VFVA 4ATNA 2MGZB 5KFRA 3HPOA 4DOZA 3DOKA 4NLQA 3OL7A 3MDFA 5L9NA 5KT3A 6FD1A 2HFVA 1V3ZA 1FWLA 1N5SA 2DGSA 1RTIB 1JLCB 3QYYA 3SIPB 3OV7A 1S0VA 3KK1B 2G2YA 4GC7A 4X4QA 2QLBB 4OYZA 1N54B 3AB2B 2BMBA 4EWTA 3W8GA 4X64F 2GGPB 4WP8A 1MU2A 1S6PB 3M4XA 2GIRA 2V9WA 5LMUF 1RWMB 1TUGB 3MUTP 2MQLA 2PFFB 2YWFA 1TK5A 2FJXA 4ELTA 1OIAA 2JC1A 1X4FA 5AXNA 2HHWA 3G8QA 4RU9A 1HARA 4PWDA 2BKPA 4P73A 4PAAA 1LWEA 3V4MA 4RUBA 1RWXB 2Q1LA 4M5MA 2OTJS 3IG1A 1WSVA 3NY0A 5HP1A 2ZE2A 5CCMA 4NLPA 2VD3A 5ETLA 2K7KA 3HX9A 4I7FA 3DYAA 3D5MA 2C2OB 2IVFB 2C2MB 5KFUA 2QSFA 3GJRB 4OZ3A 3TQEA 3OTOJ 3CCWA 2IM2A 1C1CA 5A8RB 4GKJF 4CI0B 2ASLA 1EX8A 4DL4A 1HNIA 1RTDA 1NMEB 4UTGA 2R8HA 1J5EJ 1AB8A 3ZTSA 5KFDA 2G0CA 2PO4A 4J9NA 4KO0B 1UFKA 3M6XA 2YWHA 1QVFR 1IKVB 2V9KA 3IG1B 4LBPA 4LFCF 4WFXA 2MZRA 3I4HX 1SCJB 4KPCA 2C22A 2KT3A 3AQPA 4HL9A 1ZM3A 1RU1A 3VF0B 1XTZA 4YHHF 1WTBA 1IBMF 4GVBB 5DDQC 5KAKA 1RGVA 2DNGA 1HI1A 3OXLA 4P72A 3MTKA 4OMFG 4PG8A 2XMKA 2ZBRA 3K0JA 3FMBA 2BE7D 4DR1J 4RO0A 4NLDA 4DFKA 1YQHA 5KT7A 1E6YB 2KM8B 1FA0A 4HVZA 1URNA 2GVDA 4Q8EA 3NKYA 3G9CA 5D78A 4JI4J 1UJ4A 3C14B 4PRFA 2JFKA 4USHA 2WW8A 2BKOA 2YTCA 3DCAA 2IAJB 2M3DA 4Y2AA 3KLEA 2AWZA 2AJ2A 4PKDB 3T3FA 4ECTA 2YNHB 3LPEA 2UV8G 1QTNB 3AJ2A 1R8HA 4ZPAA 1ULRA 3JSMA 3BGOP 4AXJA 1U0HB 1AT1B 1S5ZA 3U1MA 2G2ZA 1NZ8A 1F5AA 4ZVOB 3KLVA 1KTQA 1UW4A 3MR2A 2RUGA 4OFZA 2DCUB 1IR2A 4XDDA 2QA1A 3MCMA 1FE0A 1M5KC 3N4WA 2MKYA 4WK3A 2E1MC 1PJ7A 4USWA 4Y6IA 3UI3A 1O0PA 3ENWA 3MCSA 2OPQA 1S6QB 2V5HG 4X4RA 4DR7J 5I3UB 4WKYA 3I32A 3Q8UA 3K5LA 4HH1A 3GJTB 4LVNP 2BANA 1KONA 3OR1B 3PW7A 5DETA 2C2NA 3M6WA 1QE1A 3BKTA 2HIYA 4Y2IA 5KFSA 5A8RA 2OMOA 3T9ZA 5D0RA 2MLZA 4CLKA 4ZN3A 4CWBA 2BA9A 2DISA 3IXQA 2Q3PA 3PYDA 2AIRB 3LA0A 4DHVA 2ZM6F 4JI4F 4KTQA 1HBOA 1B7FA 1NK8A 4DV4J 4X4UA 2DXFA 2B7BB 1QUVA 3Q2SC 5CZVA 3RGIA 5J2MB 3H40A 1B3TA 1U26A 3JSYA 1WI6A 1NHVA 2M7SA 2DH7A 2AGQA 3KMSA 2KXFA 2VG7B 3FFIA 1S0NA 1F9HA 2B4UA 2HBRB 2W9BB 4F0HA 1U47A 3M05A 4MTPA 2H51B 4DJBA 1UA0A 4UT4A 4DV6J 2W4PA 1RWWB 5G0RA 3PV8A 2GVZB 2AZ1A 1U09A 1N6QA 1PAEX 2DH8A 3D7SB 1WORA 3EVWA 2VL1A 4PG4A 4XIUA 4OZNA 5LXYA 1EAYC 1VJQA 3PR4A 5B0AA 5KOWA 3RYLA 5LXRA 1SKWA 3AA9A 3HDSA 1N5YA 4DUYJ 3CW2C 1VQMS 3MEEA 4H4OA 1IBLF 2GVDB 4PWUA 2FPHX 1VQSA 4G65A 4WU2A 2YNGB 4OYMA 3CJ2A 3TEHB 4RW4B 4YB7A 5AE2A 2QLFB 4UQGA 4FVMA 1RCOB 3E01B 1T9VA 2Z57B 4PUOB 3H4DA 4OX9F 2JX2A 3M32B 5FIIA 3LP0A 1N6QB 1YG0A 4ZCKA 4F0KA 3DLHA 3C3LA 5CYQA 4OHYA 2MY8A 4OJ1A 3BKFA 1ZAXA 1M1HA 1S49A 3DRSB 1WOPA 2MZ1A 1LW2B 2OPRB 3NWRA 3W60A 4ELVA 2PEHA 2BBEA 1LW2A 3LGHA 3Q8YA 1U49A 3T19A 1I94F 4G3IA 1HLWA 1UJ6A 2NUHA 3O5TB 3U02A 2VH7A 4X66F 4RUCA 4J9MA 1TKZA 2AJ0A 2I6WA 2KHDA 4NLGA 3HF5A 1FERA 2PD1A 1CJTA 1C1CB 2YPZA 3SZ2A 1E6VB 3ELHA 2GVZA 3SCKE 1RHMB 3IAM9 4RWWA 3E8OA 4RW4A 5E3PA 2IDLA 2BQRA 1FK9B 4PQUB 5B0BA 1TAUA 2RVJA 4OJHA 4Z37A 3OD2A 3LP2B 3I87A 3OHBA 1JB0C 1KQGB 2HRTA 1X4GA 5AXLA 4JI5F 3NLCA 3GB0A 1RKJA 1MSWD 3JSRA 3MOJB 3EWGA 4B3OA 2HNDA 1FRKA 1PYOB 1DAXA 2VPYB 4TQSA 3EZUA 3W2WA 4OZ1A 2M52A 1JJ2R 2VONA 4TYBA 4WK1A 2HK3A 1FVSA 1N33J 1SKSA 3MMAB 1B64A 3NCPA 3G82B 3WHIA 4YUDA 1I1GA 1K9MT 4P74A 1L3VA 1FFSB 5IV4A 3M2RB 4GKJJ 1RYSA 1OPIA 2AEJA 3MM7B 3R6LB 2WK4A 2R7VA 4JI0J 4ZDNA 4C3MA 5HLFA 4ZN1A 1TR0A 5E3AA 3PY8A 2AJ1A 2N4DA 3CJ8A 2GJFA 3N28A 4Y00A 1Q82T 4LQ3A 1QM9A 2CZ9A 2EC0A 1D1UA 3M8PB 2WVEA 3MM6B 3PACA 3TZYA 4ZJLA 3AY0A 3PEJA 2YKOA 1J5OB 1D9DA 2HS4A 4MKBA 3Q2TC 4CM2A 2BDPA 1X5TA 3S8SA 1RXOB 2K2PA 4K7QA 4DCJB 3G4SS 3GR0A 1YZ7A 4LSNA 3CWJA 4NLOA 4M94A 2QRRA 3MPUB 4U9RA 4V1Ak 4ZLNA 4DR2F 1N33F 3DM2A 2VASA 4XPCA 2VFUA 3SCJE 2AQ4A 4CTAB 4JI7F 3UW1A 4MIAA 2ACYA 1ZAVA 2LQ9A 2NXUA 4ZITA 2C3PA 3M2UB 4AFFA 1I51B 1UTAA 5E3QA 2UXCJ 2MEWA 1UWAA 3PHEA 4JI8F 3SV4A 3D1QA 1JKHB 4IO1A 1T94A 2VG5A 3D66A 5A0YB 1VGYA 5H9FJ 2HQIA 2FHMA 1VQ8S 1RQ0A 4KGVB 3DXSX 5D77A 3P49B 5B0EA 3ULHA 1KQSR 3X1LB 2DHSA 4KFBA 3BYPA 3U7JA 1RADB 1U6BA 1D09B 3DLLQ 1H7WA 4B3MF 2VPZB 4EUVA 4X66J 1BC6A 4H4OB 2RDIA 4QZVB 3D2WA 3CD6S 3KFWX 1IJFB 5DG7A 2NPIA 4OYWA 2EC2A 4IKAA 4C8YA 4CO3A 1O51A 2QA4G 2VFSA 3GV7B 4RZRA 2OMLA 4OI4A 2PA3A 2HVHA 3R7SB 1YJ9S 4M5GA 3TUIC 5FLXY 5L8RC 3ZZOA 3NP5A 3HFKA 1PYSB 2XY5A 3G96A 1RAFB 2PA8D 3WX4A 1EZZB 4U7CA 1HNXJ 4JI3F 1WF2A 4PPDA 5KG2A 2OTLS 2HPUA 2E9RX 2QMUB 1UWBB 4UOGA 3H2LA 3OFEA 4YQWA 2KHCA 3CCJS 1S57A 2OAUA 3GYGA 2P6SA 1RCXB 2UXBF 2J76E 3FQLA 3CMQA 5KFOA 3OSPA 5AJ3J 3W2VA 2IIHA 1IBLJ 5DO2A 1OMSA 2ATCB 2RHQB 2O3DA 4CZCA 3BV8A 3QRRA 1LW0B 2OUGA 2QYCA 2A10A 5KG1A 1S4FA 2F4VF 3SXLA 2FHJA 3E51A 1OJ4A 1ZPVA 1HNXF 2JRSA 1TUVA 4NWBA 1SV5A 2RB7A 4WXWA 1FKPA 3DYAB 2ZOFA 4QOTA 2XY7A 5KT5A 4YFUA 3MUMP 4F4KA 1KLMA 3GCXP 5KFVA 2KT2A 3H5YA 1VBZA 3NGUA 4Z7YA 1EP4B 1FJGJ 5BXIA 3CJRA 3ETMA 4XDCA 5HQLA 3H8YA 4LBIA 2AF6A 4DU8A 3MPYA 4X4OA 1CVJA 2K06A 2LDIA 4ZPDA 3OFHA 5DS7A 5K20B 4DSFA 2Y9HA 1T9YA 2MMYA 1NSAA 1FI4A 3GYNA 5F0WA 4DV7F 3SDEB 2V2VA 4AUKA 1JX4A 3MAAB 5D3GB 2VKZG 3UO0A 3GV8B 4I2QA 4KHRA 3SV3A 4ED2A 4NCGB 1KHVA 2L48A 3MUVP 1IQTA 3DMJA 3QIPA 1QAIA 4EMDA 1HPZB 2RS2A 1HNZF 3AHPA 2IVYA 2OPQB 5KT2A 3F73A 3CMES 4ED5A 4K2XA 2GMJA 1GMUA 3MECA 1RHJB 4H4KA 3JYTB 4WKRA 4RLEA 3EYZA 2FLNA 2B0GA 3KK2B 3AAWB 3W5XA 1S1TA 4PCQA 4WE1A 1SH3A 2ZBPA 4C7QA 4CYUB 3LPYA 4TU7A 1GT8A 2B8QA 2QE5A 1OYEA 2Z56B 2WVBA 4DX7A 4ECQA 2W8LA 3NGSA 2XI2A 4MYTA 2DEJA 3ZC4A 3DLGB 4EEYA 3RB0A 2NREA 1LKZA 2KYZA 3M2VA 1HW9A 2RF2A 1HMVB 1CS4A 2H48B 3ENAA 3PRDA 3R5CA 4OQJA 2DR8A 4CH1A 3ZTOA 5EX3A 4C0OC 4BC7A 4FBTA 3IWLA 2AX1A 4A8KA 4ZPVR 3EGWB 3DI6A 2D9OA 5D0HA 2AZ3A 1WI8A 2OPPA 2BM0A 4Y3CA 2XMTA 4L75A 4BS2A 2GQ2A 3KWMA 1UAWA 1VIOA 3KLIA 3OLBA 4F2SA 1YRXA 4NLYA 4JI0F 2PT0A 3O3LA 2F9DA 3ZO7A 4K4WA 1JJCB 1HNWJ 5CYMA 5IM0A 2Z0GA 4XPEA 5L1JA 2EFGA 3V4IB 3VGVA 2O1PA 5KT4A 5CD4A 3KK2A 5KG6A 3MOZA 2FLOA 4ZP8A 2Z30B 1NBEB 1PIEA 1UEUA 1V3RA 4GVBA 4I6AA 4L76A 2JEFA 1Y5NB 1R31A 5HQ8A 2ZE2B 1U8SA 3P3DA 3MURP 1C0UB 5CAAA 4LF9J 3D6MB 4P7VA 4FYWB 1DY3A 5LSRA 5ETPA 4IDKB 2VFRA 1FCAA 1XR6A 4DFPA 1X0FA 3CDEA 4U96A 2HHUA 1FX2A 1NO8A 2YKPA 3L95X 2QZ8A 4PG7A 2PDAA 1OPZA 2BX6A 4P2XA 5KFKA 4ERDA 1RTDB 1RLCL 2COLA 1TL3A 4ALZA 4U7UK 3V6KA 3KUGA 1W2BR 4DQPA 3TA1A 2UZAA 2O5DA 2KXNB 2WW4A 3OFFA 2W24A 3VV2B 4X4PA 3EZOA 3M30A 1WSRA 3Q8SB 2FHOB 3GIJA 2NCKL 5HSPA 3HHKA 3B8HA 3L3CA 3KJVB 1U1KA 3N01A 1TFWA 1S1UA 2P9EA 3HK2A 3THTA 2EFQA 3PRBA 4O0IA 4IOAQ 2OPRA 2ZD1A 3N9UC 3P45B 3CJKA 3JAMU 1Q5YA 3RB6A 1L3UA 2KI2A 4FF1A 3HKZD 4WBFA 3OVSA 5A8KB 2HBZB 3UWTA 2HGMA 4HTJA 3RUBL 1VS3A 2ZZMA 2GQQA 2FLLA 3J80U 3BBBA 2KYXA 1WKJA 2WBMA 5CD4H 2YBVA 2J5AA 3E3XA 3VVUA 2OFHX 2OIHA 1R8BA 4O4RA 4OHVA 2SXLA 3H42A 2BJ9A 3IS9B 3MF5A 3VAMA 1BQNA 1PG5B 1N52B 3C6TB 3SSRA 3RB4A 2Q66A 1A0OB 2G0JA 2VUGA 2RKIB 1P9YA 2OO4A 3QMQA 3OR2B 3RRGA 2YWWA 4USKA 4IOCQ 4I64A 2F8HA 1AZSB 3ZZRA 5A2QY 3VQSA 4NE9C 2X1FA 1LNQA 1SC3B 4PEOA 3R97A 1H7XA 1C4CA 4G6VB 3V6DB 2MZJA 3GTYX 3HKWA 4YMEA 4O0NA 5KFAA 4DCPB 2HFSA 4B9UA 2VBZA 4A4JA 1NHUA 3CCLS 2DHXA 2UP1A 2LYVA 4DV5F 3SQGA 1K73T 4KFBB 2MSSA 5CZXA 2ZFHA 3M8QA 4CLLA 2ADCA 2V0NA 5HL7Q 4ZP7A 3KUHA 3O1LA 4KV8B 1U2FA 4WXOA 4CLPA 4DV0J 1H6KX 4JV5F 4K4YA 4TLQA 3I0RA 2VC0A 3MM5A 3V2UC 5DG8A 2CJAA 3DXBA 3M2UA 4CNYA 3LWLA 4WFBQ 3J7A1 4QYZK 3CD7A 2GCFA 1S9GA 1ZETA 4F36A 3PW5A 1NUEA 3Q89A 5EX0A 2BW2A 4WYWA 1VQOS 2UVUA 1I6JA 1R3NA 4O3OA 4F04B 3AT1B 1RT1A 2V34A 5ETQA 3CMAS 2HFUA 2MKCA 5GADI 2CZ4A 7FD1A 2IC3B 1T9UA 3FQKA 2XTJP 4KH0B 4LRFA 4CLWA 2W25A 2IC3A 2Y1RI 1SJ4P 1HQEB 2HWTA 3ET6A 1IXKA 1B0TA 5GAHI 2LA4A 3B78A 4FYXB 4FNHA 2OJ3A 4JI5J 1Y0HA 3P5BP 2MKKA 5LMUJ 1JJ4A 8AT1B 1JWWA 3F56A 1VQLS 3OL6A 1K47A 2B9XA 1RSCA 2K1RA 4K5SA 2R8IA 4URGA 4ECXA 4BDPA 1BWEA 3TZWA 4QQBA 1BQMA 3DC2A 2XSFA 1BWVA 3IGVA 1YJRA 2CQ1A 4G1PA 4V19J 2VOOA 3ENVA 3GQCA 1T8EA 2ZOMA 1VQYA 1Y11A 3N6MA 2QV6A 3KNGA 4MYUA 2CNLB 1Y7PA 1IKWB 3FBEA 1WC1A 3H0PA 1OSDA 2NXCA 4DR3F 1L3TA 1S1TB 4C8LA 3M8WA 4A8MP 1FJGF 3NEKA 4OJ3A 2ZWOA 3THVA 4LR8A 2F1FA 3QLHB 2DNMA 1FNOA 2ILYA 3DN9A 3FRZA 4C8ZA 4R8UB 2CDRB 2ZDPA 5D4PA 1SKUB 4O23A 3S6EA 5CA5A 5KFMA 1ZZFA 1P1LA 3V6DA 3D9BA 4PQAA 4C3LA 1SH0A 2BJEA 5L1KA 1T9XA 5AE3A 2HFZA 1N32J 4C6AA 3M6VA 4U7UD 4NCAA 5DDPC 1S9EB 1KVIA 3RRKA 5K8NA 2YKNA 2IM3A 2H4WB 4TY9A 4P75A 5HVHA 4LF8F 2BKNA 3M1VA 2EFVA 1S97A 2R7XA 3MEGB 1Q5VA 2ROPA 3GJQB 3HHLC 3PW2A 3JS9A 1W7WA 1PC4A 3TEGA 3KHLA 5LMNF 1AUDA 3FNNA 1N0UA 3BSNA 4RW9B 4JI3J 2PGCA 3ONQA 3KJVA 2J6UA 2HRYA 4Q44A 3WC2A 2HQCA 3NGRA 4UZBA 2IPOB 4DQSA 5IT9Y 4X84A 2YWKA 2DEIA 2JZ5A 3BF4A 3KK3B 1AZSA 1EETA 2ZWPA 5G4DA 2H1YA 4P52A 1WJ9A 2LXUA 2ILZA 2PE8A 2ZD1B 3H7HB 3QQCD 1T03A 1BE4A 1XWLA 1HL6A 2B4VA 4MJKA 5F41A 4NEYA 1UVMA 2XB2D 2DIVA 1G7CB 1LQ9A 1SJQA 4Q45A 2R3VA 2AJ4A 3K59A 2X1GA 4JI6F 5GAEI 3TZXA 2FIUA 2ALZA 3R27A 2AYBA 2FJBB 2ZH7A 2VDIA 2W4DA 5D4LA 2JEJA 1N32F 2WRMA 3WC0A 3LOUA 4ZS6A 2OPSB 1MWZA 4HTIA 1RTIA 1OO0B 1HBMA 2AP6A 2RMLA 5A8WA 5KTQA 4NPOA 2F63A 3NMRA 5EWFA 2DR9A 1HMVA 3TARA 2MKJA 3IR5B 3C6UB 2ZC3A 1B0VA 4KBIA 1NK6A 3ITHA 2B6AB 5DQHA 2D1CA 4QBUA 2OSRA 3MAHA 1VQ4S 4NXNF 4DV4F 3QJPA 1CG2A 2AHOB 2HURA 3NCRA 3FBBA 4KC5A 3BS9A 1WF1A 5IC4B 2HHSA 3T6JA 4NYPA 3BQ2A 1PJ5A 2DNLA 1L3KA 4L74A 1K1SA 1SC6A 3TYTA 2ROEA 3CC4S 4K4ZA 4Q2LA 2O66A 2K1RB 2R2UA 2J8AA 1DQ8A 3R7NB 4FXVA 3SBMA 2W7PA 1BUXA 4MK7A 3W62A 3I5BA 2KTQA 3BSOA 2CNKB 3CE8A 1URRA 3VAJA 4DR5F 1N4LA 3FSXA 4DR4F 2YX1A 1U1MA 3ZZ0A 2QIFA 1H72C 3CO0P 5C2GA 2GMLA 4WTYA 3QIDA 5KFCA 1X9SA 1C0UA 4M5IA 3O8WA 1QY7A 2VV5A 1DARA 1EQ0A 1U02A 3I4PA 3NAHA 1JQGA 4BBYA 1U1QA 2IYIA 1MMLA 4V19X 4JBCA 2HFOA 1UW9A 3D4JA 2P5VA 5F9LA 3KDNA 3QZ8A 3UCZP 2QC3A 2J0WA 2LCWA 4YDDB 2W1BA 2HNDB 1GFWB 1YLXA 3KLHB 2W8KA 4GMKA 5HLFB 1KS2A 4FYDA 1RTZA 3RR7A 2XULA 2HAFA 1R8CA 2FJEB 3N0VA 3DKDA 3BDEA 2FB0A 4QYZJ 2JEIA 3FK4A 5LM7E 1ZZNA 5T7LB 2RF2B 1CS4B 1HW8A 2XG8A 1VRQC 5FDLA 1XN9A 1E6VA 4GO5X 4ZK7M 5LJ3Y 3TJAA 1LWCB 2V4JA 3HHLD 5HK4A 1GX5A 4RNNA 2LVWA 1FXDA 3T6BA 2W01A 1VQ7S 4LF2A 4QIEA 4NCBA 1LWFA 4DZDA 1K8AT 1C0TB 3PW4A 1Q8KA 5CQGA 5K8PA 1F3VA 2QTWA 4NL5A 3CT9A 3M7VA 4IH5A 3W61A 5B0CA 1S77D 2AV5A 3J81j 2G4BA 2MXYA 1EHWA 4KT0C 3PO5A 2E1PA 3LP2A 2HLTA 2QL7B 3DOLB 4ZCMA 3GE9A 2BOPA 3GILA 1FJCA 1U1RA 4P9SA 1MROA 3HMJG 4ER8A 3WQPA 2J6SA 3LP0B 1VHIA 1Y3KA 1FDDA 5J2NB 1GMVA 3O6QA 1C1BA 3Q8VA 2Z2YB 4MIWA 1JLQB 4NMLA 4OYPA 3W5YA 2MHNA 1I5OB 2DCLA 4F26A 4RNFA 2E29A 2ALYB 2MJNA 4I6WA 1WNEA 1CJKA 3UR0A 3GFXA 3W9HA 1S9EA 2BEFA 3KHRA 3P4UB 1V6HA 3HVAA 3NXZA 4A8QA 2C28A 1G1XA 3CCQS 3DLKA 1U2RA 4IUFA 2CVEA 1T05A 1RA7A 5C42A 2IM0A 3VVTA 3VGSA 4YB1P 1FJ7A 2FJDB 3HJVA 1X60A 2F8MA 4IR9A 1VR6A 2RQMA 4YR0A 2J7WA 1HD0A 2XM3A 3FSIA 4DR2J 2OD6A 1WG1A 3JB9k 1MN7A 1SXLA 4M8LA 4RNOA 3Q8PB 2DGQA 2XQCA 3D0GE 4C3KA 2PMWA 5K9FA 3LANA 2W4CA 3LF0A 4QR1A 3A12A 3Q0AA 1UFWA 2EPIA 2Z2LA 1H73A 1YRTA 3A8JA 3GCWP 4HT5A 4J9PA 3T1AA 3KKFA 2KG0A 2B4PA 4U6PA 2BVZA 4EBCA 3TAPA 4RJVA 1X31C 5LT5A 2FC9A 3DOKB 1XBWA 3IN5A 4LF9F 5HMYA 3GU0A 2DNKA 3VWSA 2XMWA 2XO7A 3K5NA 2RIJA 2QA2A 2HQ3A 3BREA 5F9NA 4J9UE 5I3UA 4CDIA 1VRUB 3G82A 2VQFJ 4FBUA 2KZZA 5IT0A 2XSJA 1L3SA 1RT6A 2R8GA 5ADZA 1FEEA 3H4BA 4HACB 1RAHB 1VJWA 1IR1A 4U8YA 5H1SV 5GMEA 3FC9A 4DL0C 5F3TA 5C5JA 3QSIA 1YI2S 3FCHA 1X4CA 2IM1A 1F9EB 3OXFA 3N5FA 1N34F 1MWQA 2FZKB 3KYLA 2JFDA 2MQMA 4TLRA 4LRAA 5DDOC 3TQ1A 2B5JA 1HWKA 3OL9A 3K8WA 4HT7A 1FDNA 3CJ5A 2KG1A 3BQ1A 2POKA 4DUZF 4EBDA 1KLNA 4S0MA 4OL8A 4NLXA 3W1YC 2V69A 2DHHA 3J81Y 3UD4P 1FHTA 4WIQA 1HBNB 3IAS9 5GAGU 3MMAA 2DXDA 1GXTA 1UFLA 2O67A 4OI3A 2W9AA 2M8DB 2W2PP 5LSLA 3CCSS 1NRKA 1I3OB 2MHEA 4GVLA 4DX8H 2AYGA 3EVMA 3H5XA 2FY1A 1VQKS 4YEAA 5HAOA 4CTAA 3JYTA 3C66A 1K0VA 2YNIB 3NRBA 5KG5A 4ECRA 2LECA 3POTA 1SUQA 1DFDA 2NYHA 1ICEB 2V6AA 4HDGA 1XMOJ 1R7IA 2HHVA 3NCQA 4WU3A 5FLXU 1RWPB 4B3TJ 4YHHJ 1AA1B 3BGUA 1NJXA 2R2RA 5IWAJ 1KR4A 2FGOA 2B4OA 2ASYA 3MM8B 5JVGQ 2RT3A 1OY9A 2NLWA 1UA1A 3W8PA 3NAIA 4YP3A 2DK2A 1V5VA 2DRAA 4B3RF 2IBKA 2JHEA 4IO9Q 2H9ZA 2CJBA 1C4AA 4KKOB 2V8VA 4CLYA 2ZUGA 4N56A 3PIOQ 5KFYA 4ZCIA 2WOMB 4J9QA 4CO1A 3EPIA 2HMIA 1UCNA 2M5YA 2Y0BB 2AGPA 2UUCJ 1CJTB 1MLAA 4NA2A 2EG2A 4JI2F 3HHDA 2YH1A 1PSDA 1Y5LB 4LREA 4M5JA 4B3OB 2DB1A 2RSQA 1D9FA 3MFHA 3FRYA 1TKTB 4EO8A 1Z1ZA 3A3OB 4DN0A 5J2QB 3NBPA 2LQJA 2DT9A 3PYGA 3QT8A 4F67A 1NKCA 5GAGI 4KPYA 3CSKA 4J9LA 4DV3J 4ILRA 2VG6A 2V8HA 3AOAA 2KRBA 5HMWA 4ECWA 4DSJA 3PDNA 5K14B 2JSXA 3HULA 1TL4A 1SL2A 3RBXA 2MQOA 5CXTA 4LF8J 4IRKA 2UXBJ 3MMBA 1KFSA 4LT6A 3FEXB 1MROB 1XR5A 1TKZB 2BANB 3OR1A 2WOMA 1QAXA 3K17A 5ITHA 4X4SA 2C1EB 2H65B 3QSYB 3GV5B 4QWBA 2W9CB 2DTJA 1UVLA 1S6OA 3E2EA 1VLYA 3SFGA 2MKHA 2HK2A 5DDRC 3LAKA 2XS5A 4M1KA 2MYFA 2E5LJ 2W2QP 3GYXB 2OLWA 3KXDA 2JH3A 5AXMA 4LF6F 2EBGA 2L9WA 3SCLE 1HBOB 2JVRA 2ZDOA 3R5BA 4OI1A 1HHQA 2DPJA 4ECSA 4B9NA 1SJ3P 2B9YA 5JVHQ 2M9KA 3W63A 3JTNA 4LF7J 4AL5A 2BJ3A 2FJWA 1B7YB 3FBCA 3IFEA 1Q8IA 3H59A 4M5NA 1J5OA 3K58A 2RD5C 3MEDA 1IBKJ 1Q53A 3CD5A 1F60B 1HNWF 4RPFA 1VRTA 4RKUC 3J7YI 2DIUA 1HQUA 2FVSA 1ZA2B 2E5IA 2FD2A 3KG4A 3Q8QB 1X5PA 4DF4A 1Q86T 2HVIA 2CPFA 1RAGB 2HRUA 2FJVA 3R1LA 2HNYA 4ZVSB 1BLUA 3RAMA 5GAEU 1HA1A 4AYBD 3Q8RB 4M95A 4FS1A 3G8TA 4HHHA 4IQMA 1HHTP 2OKQA 5M2PA 1B4SA 4CH0S 1X5OA 4DR6J 1HWJA 3VCDA 3A8KA 3CCVS 2EK6A 2OP5A 2HQDA 2IRXA 4OZLA 3TNVA 2V4RA 1RI7A 1CULB 3F0NA 3G6ES 2UUAJ 3LTOA 1GMWD 1D8ZA 1NK5A 4C4WA 4C11B 1PC5A 1U4BA 5U47A 4LR7A 3ZTQA 4FF2A 1UVJA 4HACA 2IBOA 2C42A 1LFPA 4K4TA 3KLHA 2CQ3A 3CDBA 2EXUA 3TRGA 5EHHA 1R89A 2PMHA 3ADAC 3FEZA 2GZOA 4DZ6A 9RUBA 1W2IA 1N88A 1REVB 1M5SA 2VKRA 2IAJA 4DSKA 3GSDA 3M8QB 4DV5J 3MEKA 1H2UX 2FZCB 2YX4A 3QFWA 4MK8A 5CYJA 1VLOA 3J7Z5 1YBTA 3C15B 2XMAA 2VQEF 1NM2A 3CDUA 2XC9A 3RW6A 1WC6A 2OEKA 1F0XA 2LA6A 1KOOA 2M70A 3ZNJ1 3OTEA 5IZHA 4K50A 1NSQA 1Y4ZB 5H9FK 2EI5A 2HIQA 2RQCA 3C6UA 3X3UA 4EFAC 4DN9A 3DOMA 5BYRA 4DV0F 5GMKa 3C8YA 1D0EA 1BGXT 1OWXA 3QT6A 1VFJA 4KGZB 5KFHA 4DV2F 4WYLA 2NSCA 1GMWA 1SJFA 5T41A 1FRMA 1R43A 3FCWA 2U1AA 2R8JA 1NDKA 1OQ6A 4FYVB 1SKRA 1C1BB 5E0OA 2IY5B 3TJ8A 3UN2A 1U1OA 2GGPA 2CJ9A 4PUOA 3KTQA 2Y8YA 5ETRA 2NZ4A 2D3OR 4NYOA 5AT1B 4JOUA 1YJNS 4RWXA 1JLGA 2I5JB 3JSBA 1SC4B 1WC0A 4I67A 1YDLA 3VAHA 1PBAA 4ES1A 1RLDA 4QWCA 2FLPA 1VIXA 2HS0A 2LU1A 1I94J 1T03B 2G1DA 2DGXA 3I96A 1ZTTA 4NX9A 1OS5A 2DRBA 1RB0A 2DJWA 1ZS6A 2WSEC 4UUWA 3EUNA 4LF5J 2R7TA 4FPIA 4Y28C 1GNKA 2JDJA 3UCGA 1P27B 3QATA 2DNPA 4JI2J 2CPXA 3SMZA 5FDLB 2UUCF 5B0FA 3A4TA 4EO6A 3MR6A 3B4DA 1U1NA 1NPRA 3HD2A 2HHHF 5K8OA 2FDNA 3BQ0A 1YX2A 2VC1A 3FZ2A 1Q95G 3P8BB 3PR5B 3MR5A 3CCES 1TVRB 4NMXA 3H25A 5KG0A 3DLEB 3EDQB 1HHSA 2YQ1A 3US5A 4FVCA 2LDYA 4GO7X 1LXJA 2Y8WA 3AH6A 3OBIA 4QIWD 1HI0P 4DSLA 2WZ1A 2HAIA 4IDKA 2DNHA 4JV2A 2ZBIA 2LEPA 3KLFB 1XEZA 2X7IA 5DM6Q 3H98A 4WFAQ 5L1IA 3R5JB 2HKEA 3N6LA 4B3TF 4GKKJ 3HSJA 2CPYA 2ZBQA 1VBKA 2ZNYA 1S6QA 2VG7A 2RRAA 4X4NA 4NA3A 1XMOF 2GIFA 2W2NP 4R8UA 5J1EB 2X3GA 4WWSA 5HO4A 4RW6A 4L73A 2X3DA 3DM2B 4PYDA 4KGXB 3RW7A 3MCNA 3NS6A 4EZ9A 5E3RA 1RT3B 4WPAA 2LKZA 2LXFA 4B17A 3PHTA 1KOHA 2FUG9 4B3SJ 2V8GA 3K5PA 3MM6A 1YJ7A 3LW5C 2B51A 5AXKA 4DUZJ 4A8XA 4ECUA 3CJ4A 1YJVA 3PKMA 3EGZA 2XS7A 8RUCA 4DPXA 3Q83A 1WEYA 3KLGB 2OELA 4IFYB 1XERA 3SSSA 3A8IA 3DRPB 4M5DA 3IM9A 2ASJA 2DVIA 4YOEA 4O3SA 2IYGA 4QYRA 4E0DA 1CULA 2HWIA 4CM0A 2MLXA 3RTVA 1IKYB 1FXLA 3JSMB 3RAQA 5KG4A 3MWBA 3MCOA 1TZ0A 2G9OA 1N5QA 3HVTA 1MWYA 1IUJA 3PKYA 2RE1A 2V67A 2G2OA 3EJMA 1Q16B 1HNZJ 1U6ZA 3IM8A 4NRTA 4RR5A 3QZ7A 1RT2A 2NYIA 1X4HA 2HYIB 2DYAA 2X1BA 3THPA 3R7BB 2B6AA 2ZJQQ 1G2EA 4I2QB 2VIHA 4LFAF 2FVRA 4ED3A 3HZEA 1S76D 3PJ9A 4K4XA 4H4MA 2FZGB 1E6YA 4KAIA 3ZZZA 4DUTA 2V2ZA 5LJ5Y 1B99A 5F3ZA 2AKWB 2CQCA 4UW2A 1Q0NA 3I0SB 4ZPWR 3MMCA 5L46A 1KVKA 1T9WA 1RISA 2QMWA 3W64A 4LF7F 3AJDA 3PTWA 4WCEQ 5DZ6A 5K14A 3BSAA 3R5AA 1SQFA 1FRHA 2C3OA 3CCMS 3CIZA 1FKPB 4OHWA 5BYQA 2VBWA 4DPYA 4ZKAA 5IFMA 2OD4A 2F4VJ 2PEBA 3QGIA 2UVVA 1XMQJ 2UXCF 1JXLA 2MKSA 1RDRA 1H98A 4WP9A 2EG1A 1GH8A 1RTJA 3OR2A 3QWPA 3VR1A 1N56A 4X65F 5H9EJ 2CPEA 3VAKA 3IA0A 3W2VB 2RDJA 2CFXA 3TANA 1J5EF 2ZEJA 3A1YG 3NS7B 1R8PA 2CVIA 5DZ7A 5JXSA 2BV3A 5KFNA 2MSTA 4DF8A 2X1AA 2BQ3A 3DU6A 4R0JA 4OX9J 1PILA 2KH9A 1XQIA 2MY7A 1U7LA 3MEEB 2H5EA 1PYTA 1Y3JA 4L72B 4NZ6A 4X65J 4PYAA 1S48A 1X5SA 1JLAA 2A18A 3GG0A 5GADU 2V50A 5C25B 1QUPA 5A2QU 1NNDA 3T5HA 3UFCX 2APOA 2RKIA 5F8LA 5E7OB 2XWYA 4EGLA 2CRLA 4Z2XA 3BGRA 1WELA 3CPWR 2Q6BA 3AXMA 3IBCB 4NRUA 2FVQA 4HI2A 5L1LA 1RWKB 3FCVA 3GZ7A 2A6OA 3BGLA 2QMXA 4C8MA 4K5RA 2C2ZB 4WFZA 3B4MA 2IJRA 4JI1F 3OUYB 3I9ZA 3T5LA 4Q0BA 1VBXA 2WONA 4KE5A 1TL3B 4WP3A 4F25A 3JQJA 2ASDA 4ECVA 2BUNA 3N6NA 5B7WA 1WTFA 2YKNB 3L7OA 3EICA 2B43A 2RU9A 2EK1A 4JV1A 1ZA1B 4OLOA 1HQEA 2VJUA 2C2KB 4ETZA 2M88A 2MQ8A 4FDFA 2UUTA 3H2VE 4OIXA 2N82B 1TV6A 1QD1A 2GAGC 4F0MA 3ILJA 1U45A 5IV3A 4DG1A 1EQMA 1WUUA 2CJYB 2QJ3A 5D0EA 4ANDA 3OHAA 2QL5B 3D68A 4KB7A 4DSEA 4IQXA 2KRRA 1YRUA 3CJ0A 1LXNA 4DQRA 4JUZA 1S1XA 1X4AA 4OLPA 5DG9A 2A6MA 2J0XA 3TUJC 2FY8A 2GQCA 1DTQB 1NU4A 2GX8A 5DGBA 4A47A 4DL5A 2BJ1A 1LWFB 1A6LA 4IG0B 1NDCA 1RT6B 1WHYA 1SJRA 3G6XA 3WX8A 3LAMA 3BR9A 3ENQA 1K44A 1LWCA 1S1VB 1FEHA 3HD1A 5KFTA 1BD6A 2ZITA 1REGX 3KLIB 1VMBA 3QWUA 3K5MA 2NSBA 1H2TZ 3TW0A 3MR3A 4UY85 4ZVGA 1M5VC 2AEFA 1UVNA 2CJQA 3QJJA 4H54A 4DLGA 1R0BG 2XYHB 4ZHRA 5M2RA 3UDLA 2G1HA 5HANA 4QPXA 3FKBA 5EUHA 1RHUB 1RWUA 1ZOTA 2C3YA 2N3OA 3M2VB 4PXBA 1O5JA 3RJMB 4LSLA 4IH6A 2DNQA 2GW8A 2IRUA 3CD0A 3DDKA 3FGVA 1S1VA 3IC1A 4W98A 1Q78A 2ZH3A 1FD8A 2LXIA 1PO6A 2XSJB 3KUEA 1DZ5A 2CPZA 4A8YA 1IQZA 3TOQA 4NXNJ 2KZMA 1VRUA 4CYUA 2QO3A 3KJNB 1WD6A 4RW6B 4PXDA 4EYIB 3T41A 1UZDA 2VQFF 4ZVPB 1VI7A 4UY8T 5J2PA 2HVEA 2Q79A 4I56A 2AW0A 4KH1B 3V81A 2OPPB 4JB8B 2BQUA 2D3O1 3IRXB 4DWIA 2KFNA 3ZNUA 3GWCA 2AJQA 4DG1B 4RW9A 3C16A 4AT1B 2QEXS 2QYGA 2JOQA 3CEDA 4CO0A 2ZH2A 3DHWC 1YK9A 3BBCA 3CXCR 4USVA 4ED1A 2GIQA 1F5BA 4L3NA 2UVRA 3VZHA 1KTVA 2ZOGA 4JI6J 3TUPA 2YNFB 2CADA 1CJKB 1UVKA 4PABA 2N7CA 2HW3A 1S0MA 4IG0A 2PN6A 4K4VA 2C2RA 5A6WA 1KEKA 2FVCA 1EETB 1FXRA 5F8GA 1VC0A 4I2PA 3L09A 3HI9A 1IKXB 1TKXB 3NMAA 5I3QA 4ID5B 2Q43A 5EN1A 1ZM4A 3AD7C 1SQEA 4ZVFA 3BGRB 1KFDA 4L3KA 2NXJA 1CLFA 1R27B 2RU3A 2J9DA 2Z2ZA 4J9VA 4TY8A 4YB5A 3ITHB 1FKOA 2KVQE 3OFGA 4OX8A 3EZ5A 5A6PA 4QW8A 3DHXA 4C98A 3OVAA 2J9EA 4LIWA 2H5IB 2CPDA 1YZ6A 4TNOA 1RJJA 3CVKA 4J9OA 1NKEA 4RNHA 4P2SA 4UZCA 2CWKA 2MQQA 3BBFA 3H5UA 3LGMA 2DGVA 3MR7A 3TAQA 4F3MA 1HKAA 1O8BA 1Q8LA 3KDOA 3TVZA 2CZVC 1VBYA 2C2EA 1QSLA 3A8EA 3C16B 1YGYA 2MKIA 2E7WA 3UVJB 4RBUA 1Y5IB 3QAUA 2LU2A 2Z58B 3EXYA 4FKXA 4ID8A 4PXCA 4DV6F 5JMNA 1TKXA 1IKXA 5EGYA 1S1WA 1N36J 4Y2KA 3HSDA 1NH8A 1YITS 5F8MA 4EZ6A 1CJUA 1LW0A 2IJNA 5AE1A 2W9BA 1NJZA 1S12A 4YR2A 2DBBA 1VISA 2CKWA 1IKWA 2E66A 4U67Q 2RRBA 2XI3A 3P5TL 5LSOA 5KG7A 1AXQA 3LWMA 2RQ4A 4ED7A 4ZA1A 3HXMA 2VA2A 4CLTA 2ZM6J 1F5CA 3BPDA 4HHJA 2XYPB 5IC6B 1LK5A 2UU9J 3IR6B 1XIQA 4FXDA 3ZZUA 5J1NA 3PX0A 1UMJA 1QJHA 1FE4A 1RK8A 3UNYA 2BRLA 2ZH8A 1U8WA 2RS8A 4MIBA 5C2CA 4N5SA 5A0YA 2VF3A 1YWXA 1UZHA 1VQPS 4FS2A 4WFYA 1KP6A 2AGOA 2V8PA 1M1KT 1NSPA 4N47A 2DKOB 3CNQP 5D0GA 2XGQA 3CJTA 1CJVB 3D0IE 1DTQA 2G13A 3LH2S 3R6GB 2R7OA 2IFXA 1KQFB 3MPDA 4C8NA 3SFUA 2PMZD 3GIMA 4JI7J 4UF4A 4F2RA 4TQRA 4CT9A 4K4UA 4KGMA 5C7PA 2XLJA 3GPAA 5CYMB 5IM0B 4OHXA 2VOPA 5F8NA 1WC5A 2CQDA 4M63A 2VG5B 3T9NA 3B54A 4O3QA 3RBZA 3T1YF 3RBDA 3M9NB 1VQNS 3MAQA 3JAMY 2ZH4A 4ILLA 4KV8A 3WIUA 4Q43A 1CQMA 2GAHC 4QR0A 1HQUB 1ZBTA 2GC8A 2WVCA 3DLEA 3OLAA 1FFWB 1DLOB 2KU7A 2L9NA 2NXEA 1TVRA 2GNKA 3BM7A 3H90A 3I5AA 3J7ZT 4F4YA 1IBKF 2DNZA 4QCLA 1P8GA 2J9CA 1RAAB 1X7VA 4NLVA 3D6FB 4ETXA 5IXUA 3DLGA 2RAQA 2V2KA 3ET6B 2HG4A 2XHCA 3L7PA 3NWGA 4OYOA 5KFLA 4AD6A 1Y9OA 3PW0A 3OTCA 1D9AA 3K7RA 1DTTB 2HFNA 1UEKA 4PG6A 1IBMJ 1X8DA 2UUWA 3IO1A 4LF4F 4KHPF 1WOSA 4OZ2A 3TO8A 4IFYA 3I31A 2ZHOA 3KHHA 1RBOB 1GEHA 4J5OA 1OQ3A 3HHLA 2WAQD 3QT7A 3QGPA 1T9TA 2CYYA 5CABA 3CCUS 2MTLA 4DL3A 1VRTB 3B82A 1S1UB 1Q1KA 3BH6B 1HWIA 2YKMA 3R3TA 2DNYA 3DRXA 4ITSA 1FESA 2IRYA 3DGPA 3ZTRA 1TV6B 2JLFA 2AYMA 5HVFA 1SV5B 2EFNA 2BJ8A 1KBRA 2I8EA 3I0RB 2VB6A 2VBXA 3IR7B 1HNIB 4N77A 4CLSA 1Y10A 3MHYA 1U6FA 5ETNA 3OTOF 4AXIA 3G6VA 1ITPA 4XTTA 3IBFB 3RBEA 5DJBA 3GMGA 4USMA 3HM9A 4MT1A 2HBYB 2H3EB 3TA2A 2YNFA 1JLEB 3MPVA 4ES2A 4USTA 1QAJA 1T3NA 3GONA 4DL6A 1FO1A 2E9ZA 1AFJA 2VU5A 1KLMB 1LWXA 2E1CA 1U24A 2MZSA 2P2CB 4UOCA 3WBZA 3RR8A 3QGGA 1BXNA 1N5TA 2G0IA 2GO9A 5BYSA 3OSNA 3F41A 2WSFC 4O3RA 2B9EA 2I2YA 3TZZA 1L5UA 1HD1A 3MEGA 2WB1D 3E01A 3I6PA 1REVA 1QTMA 2W7AA 4IRCA 2DNRA 1GAOA 3PYFA 1RKIA 2KL8A 4ES3A 5B09A 1S79A 3CCRS 2CJKA 4B3MJ 2VJVA 1DBDA 4ZVQB 2OFGX 3DDNA 3OT9A 5ETMA 4DMZA 3TX8A 3ZZPA 1FNMA 3D1OA 5IOLA 4LQ9A 4ECYA 2FTRA 1DRZA 2KVIA 3DRSA 1RAIB 2PFDA 2DGWA 3MD1A 4K2JA 2AD9A 3CIMA 1M90T 4LFBJ 1NKBA 1V5IB 2BABA 2DGOA 1IVZA 2UUBJ 2Y1JA 4K0KJ 1TP7A 1FF2A 2VPWB 4O3NA 4JI8J 3OVBA 3I0SA 3CDWA 3PNIA 4B9TA 1N0VC 2MZTA 4QWDA 1UP1A 4NLTA 5KFQA 1V3SA 4ICLA 1BHNA 3O44A 4W90B 4LRCA 3HFVA 3G86A 4DFMA 1CBKA 1JLBA 4NLUA 4BWJA 3DRPA 3J7YU 2F3JA 1RT1B 4LRBA 2GHWA 4DQQA 2NR0A 4IYQA 4F4ZA 1YJWS 2OEMA 4MK9A 3CDAA 2MDAA 5E3CA 1TQLA 1FT8A 3BGFA 7FDRA 2CIMA 1DLOA 2WCXA 1OY8A 4M5KA 2BOAA 2ZH9A 3QJLA 1B0PA 1W25A 2LQ5A 2JJ4D 1TFYA 4R5PA 2CAJA 2CPIA 4LR9A 3L9ZA 4NASA 3DRRB 4CQ1A 4DPOA 1HWUA 1P1TA 2P8IA 1XNRF 2XCAA 3NOCA 1RE1B 4C9DA 4I68A 1S10A 5I4MA 3IGNA 3KG1A 3ISND 4IH7A 4DS5A 3J7AN 4WZMA 1RYRA 2DD8S 4G1QB 2HZAA 3CGIA 5IQ6A 1UL3A 5DQGA 4OHZA 2ZKTA 2WHOA 3PM9A 4NXMJ 1C2PA 4QWAA 4R25A 3O2IA 4QIFA 4X62J 3HHNB 4F7VA 4WTOB 1F9FA 1TL7B 3KJFB 2EVZA 1FTCA 2VA3A 5KT6A 2BR0A 4ZP9A 2F40A 1M5PC 2K3IA 4GC6A 4C0BA 3M8SA 5E2QA 1LV5A 4QJVA 2QX0A 2NXNA 2W2OP 1TMJA 4NI2B 4ED6A 1SJ1A 3HCXA 5ETOA 1HIYA 3CJQA 5HQMA 4ELUA 4DV7J 1M5HA 4JYAJ 1HR0J 1YJTA 2Z4PA 4RUAA 3G2XA 4GRSA 3PJXA 3TP2A 4X4VA 3S7RA 2RHSB 1RUSA 4F8RA 2D9PA 3W3SA 2OSQA 4DEZA 4UUXA 1FK9A 2N3LA 4DR1F 3NBPB 4ED0A 4JI1J 2R7UA 1NHKL 1RT7B 3GIIA 1R6YA 4DPWA 5B08A 2KM8C 2V68A 3MMBB 3WZ0A 3LP1B 5GAHU 3T5JA 2E9TA 5HN0A 3OL8A 2XCPA 4ZVTB 4DXLA 2C2DA 3G6YA 4I1TA 3M32A 2HLUA 2IVMA 2VHGA 2J9DE 5I42A 4IG3A 1FRXA 4FXWA 4RBVA 2BM1A 2LEAA 2XZDB 5GMDA 4A8WA 4LFCJ 2AEMA 2PIIA 1HFEL 2EW9A 3NGTA 2QSWA 2ZVSA 2W9CA 1RHQB 3QT5A 3DMJB 5AJ3F 1JLGB 2I5JA 4ILMA 2BE9B 1N5VA 2N4CA 4TXSA 1IN0A 4DR7F 1T11A 1YBAA 3ETOA 3EVOA 2J7KA 4YY3J 2QA4S 1EIYB 3CC7S 4YY3F 3TWZA 4PWWA 2R4FA 5KFBA 2FHKA 2Y0SD 3GIRA 2YNGA 3QAEA 2BW7A 4KRWA 3TVYA 3EPGA 2R7SA 1T95A 4ZPTR 4WZQA 2L08A 3FFIB 4LF5F 1SUQB 3UDEA 1EB0A 2KKHA 2VPXB 1Z4UA 2JNJA 2KB2A 2RDDA 3D3BJ 2BRKA 3PEHA 4FYYB 4EU0A 2CQPA 4FN5A 4I4BA 3BO4A 2LFVA 1IM6A 3PIPQ 1S7IA 3EX7B 3NNAA 4QWEA 2CQ0A 2HZCA 2ERRA 2HHHJ 4NLRA 3W9JA 4BHQA 2F65A 2ZNZA 5CH7B 4X64J 1Q79A 1TUWA 1SVDA 4ZLLA 2FJAB 3MGJA 1UVIA 2EKYA 3GFHA 2XBPA 5KFXA 4KKOA 2CQGA 2CNOB 5C24B 1TK0A 4B3RJ 5HP1B 1F2HA 1WOOA 4KGKA 2J6TA 5DRKA 3NGDA 3S1TA 3KLGA 4FP9A 5J2QA 2DY9A 1MMNA 4DSIA 2VDHA 4JYAF 3GFZA 3JQMA 2J0SD 2OEJA 3K57A 4B9MA 2WTFA 3IRXA 1RA6A 2BE2B 2HWHA 2GV1A 3C15A 3SCIE 2MQPA 1Q4RA 4NZ7A 4QW9A 2DR7A 2E5HA 3TAMB 3PCOB 4FF4A 3KG0A 1UJ5A 2CPHA 3R5DA 4B9LA 3MMJA 5D4NA 2HMIB 3TAMA 2D3ZA 4X62F 3HVRA 2A3JA 5GVQA 1FD2A 2CQHA 2HEKA 5SZTA 4Q2MA 1KRPA 1ZM9A 1G4CA 3EDRB 4WE1B 4X2BA 1X4BA 4ZVUB 4DDFA 4LMZA 3NOGA 2YH0A 2OGUA 2UVWA 4A46A 3HVWA 2CQ4A 3FBFA 1U2CA 4R0EA 4FNIA 1BQXA 1FX4A 3D0HE 3DLJA 2CJXB 1DJ0A 3CB4A 3T1HF 9ATCB 1X9WA 2ZUAA 4PQUA 3MM7A 4W92B 4DQIA 1ZAWA 1NK7A 1JLFB 4UOHA 4R5PB 1TL5A 7AT1B 5K5MA 1RT5B 2DXEA 1JKHA 5B0DA 3VAFA 2VZ9A 2R7QA 2PC6A 2YQ3A 3POTB 4DU7A 3BYRA 3W66A 2DO0A 3KJQB 4OI6A 2GA7A 3K8VA 3RZAA 3C14A 3ILOA 4I0WA 4AL6A 1R6VA 2UXDJ 1QDUB 4ZVRB 4G1QA 4DCOB 2D74B 4K8RA 1OY6A 1U0SA 5THWA 2F5GA 4J9KA 4UQTA 1NJYA 1D3WA 1SL0A 4LSNB 4ZVHA 1Z2LA 2HZVA 1HPZA 4KIAA 1AROP 2ZH6A 2QG9B 2RRNA 1AFIA 3HSZA 5F8JA 1RT5A 4E2FB 2O01C 5HVGA 1XJWB 2YNHA 3EMTA 3UNGC 2HNZA 1SQGA 2Q6CA 3KLFA 2CPJA 3FUYA 4J37A 3HJFA 2EFOA 3I82A 2I1RA 1FTRA 1S6UA 1MG7A 1YVFA 3GJSB 2I0XA 3OJUA 1IWGA 5CHCB 4Q7AA 4RNMA 4DLEA 4I7FB 1KWMA 3DOLA 1NZAA 5KFFA 5C24A 5DQIA 4OZJA 4A48A 1CSJA 1WDDA 3HZGA 2P6TA 4BCAA 1VK3A 3TJ9A 4E98A 1A9NB 3J80Y 3FSYA 1UWBA 1TMMA 3G87A 4FKYA 2CXEA 4N8OA 3GIKA 4IG3B 4H4KC 1IM4A 4Q5VA 2F8EX 3J81U 1CJUB 1U48A 1N36F 1R8AA 2EEYA 2H5JB 4C0HA 1H0HB 2BE2A 2XO6A 2IMWP 3W2WB 2E5JA 2Y1LB 1JK9B 2I9SA 2HQGA 2ZVIA 3N5BA 3K5OA 5D15A 3UVJA 3VGUA 3H20A 2LQBA 5LMNJ 1VYAA 4CNZA 5T7LA 3BN7A 4QU6A 5KFIA 2XHWA 4DL2A 2BJ7A 3D6HB 1WKLA 3CTRA 1T02A 5LOQA 1IJEB 4M5LA 4DV3F 4DUYF 1UKUA 2XNQA 2GFFA 3QFHA 2W7OA 5J2NA 3KHGA 3FMWA 4U95A 2WVFA 4NEZA 1WHVA 3CULA 2HNZB 2C3UA 2E7VA 3AD8C 2EWHA 3LP1A 3GLJA 4RBTA 4ZP6A 1JLCA 3CF5Q 1YTYA 2L3MA 4ZVEA 1T05B 1AUSL 1WC3A 2YX7A 4J9SA 3UQSA 4PWDB 4F3OA 2IA0A 3IWXA 4RW8A 1T7PA 4LF4J 5DLGA 5E33A 3R5GA 4EYHB 1DURA 2A2CA 3RRHA 1QAYA 2LQ8A 4USIA 4BWMA 4D3HA 1QVGR 1JXEA 2WBRA 3SEOA 4YN3B 1HR0F 2HVZA 3FJ2A 1XNQJ 1WDTA 1NXIA 3JTPA 1RAEB 1X0PA 5FJ4A 3DRRA 1NK9A 2R8KA 1JLFA 4N7TA 2ZJPQ 3GSIA 4YDXA 3DGPB 3OTBA 1NCLA 3SSQA 1Z2ZA 1TL7A 3A13A 3HT3A 4QU7A 2DRDA 2IMOA 1YKWA 1ELOA 2CQBA 5HATA 1VDHA 2BJDA 2VFTA 2XWXA 2J7UA 1FRLA 2NQPA 5I42B 2X51A 1S0OA 2H54B 4ZMMA 2AT1B 2QLXA 4OX7A 4OYAA 5IT4A 2GHVC 5G0RB 3UN3A 2M8HA 1HWLA 2RILA 3M2RA 2E7XA 3S01A 3UE2A 2ZHAA 1TL1B 1SB6A 5F8IA 2R2TA 1U0HA 4F4AA 3PXGa 3UCUP 8ATCB 4UOFA 4PXEA 2KO1A 4YB6A 1NLKL 1XR7A 2KJWA 2RNEA 2PI5A 1T3OA 2AU0A 1NB7A 1YBUA 1H38A 3RG6A 4LSZB 3NG8A 2Y3YA 2CNNB 1N34J 4ZIVA 4MKYA 3W9IA 2XNRA 3IP0A 4KYZA 3BH7B 1SH2A 4IRDA 1RBLA 1Q8BA 3HSGA 3NL0A 2CDQA 1VQ5S 4ZLJA 4CLZA 1H3DA 4B3SF 1VQ9S 5J1PA 3KK3A 1TU0B 1WKKA 2OH2A 4DS4A 1APSA 1GK8A 2E1AA 3WIVA 4K0KF 3UN5A 4EI2A 3HO1A 4ANEA 4ANCA 3ZXWA 2E1RA 3U1NA 5JUMA 2U2FA 3FZBA 1V9OA 3MM5B 5MAOA 1NSKL 1OYDA 3DFEA 3FVYA 5HJXA 4C2MA 4MFBA 4J91A 1RHKB 4X4TA 1KC8T 1CC8A 2HHQA 3RAXA 3KOAA 2A1BA 2YWGA 3ZZTA 3M1VB 3TVKA 3KLEB 2CQIA 3K89A 3M8ZA 5A8WB 1FJEB 4TU9A 1RWVB 3W5ZA 1FKAF 4ZJOA 4Q0BB 4CIOA 1MU2B 1S6PA 2BZ2A 4C8KA 4F02A 3IS9A 1WG4A 2WVDA 3Q24A 4KQZA 1S9FA 1NDPA 1JMTA 4O44A 1UPPA 2VG6B 3PJWA 1NDLA 4ZJQA 3RB3A 3CCZA 3AD9C 2MPUA 1N5YB 4OV6A 4PZVA 4DFJA 5C42B 3T5KA 1LWEB 2RUSA 1ACMB 1TKTA 1HQ2A 1RHRB 3AOCA 1YJUA 3HHEA 3TR5A 3QO9A 4C97A 3AQOA 3D1HA 2YKAA 1JLEA 1FDBA 1R0CB 4LF1A 4NZ0A 1RABB 4TN2A 3QO9B 5ETVA 5IQQA 3KMQA 4QIGA 3SI8A 1JLQA 5SUHA 4EK2A 3UR3C 1VHFA 4P10A 1HYSB 4O44B 4C48A 2D41A 5ETTA 3EGVA 4WIIA 2YWEA 3TUZC 5F0UA 5J2MA 3DLKB 2BYCA 3UDCA 2ZH1A 3H2UB 4Y34A 3KK1A 3WDOA 1QLNA 4KO0A 4P2MA 3IWNC 1VQ6S 4IR1A 3HHLB 2MZQA 5HBMB 4Y2CA 4O4GB 4QR2A 1FWKA 1XMQF 2PI4A 1HBNA 3EXCX 4MFBB 5IWAF 3M8RA 1C0TA 3V6JA 1DTTA 3PG9A 1LK7A 3MFIA 3BEGB 2XMJA 1TTHB 4E8UA 5IS2A 3R8YA 2B5JB 1UPMB 1WEZA 2DNOA 4RX6A 3W7BA 4DV2J 1RT7A 4CLUA 3MTJA 2V8DA 1VOMA 2EBEA 2YPYA 2YNIA 3HFZB 3Q86A 4DI6A 2GJIA 3UPFA 4ZPBA 1RWOB 1S9GB 1CQNA 2ZKUA 1F3FA 2HSEB 4OI2A 5FD1A 1NPPA 1KHWA 1B70B 3BKUA 1F2GA 1T0TV 3L4BC 1U1LA 1N48A 2KFZA 4ZOSA 3P96A 3UD3P 2QFIA 3FEYB 1NEEA 2KT5A 2XZTB 5IT9U 2IHR1 4DR4J 2FGCA 1RT4B 2ACMA 4HR2A 4AQYF 3QRQA 1QSYA 2L9DA 3C19A 4MKAA 1R0AA 2R9LA 4OI0A 1J27A 3I9V9 1S7HA 4CO4A 4IFVB 5HROB 3RU0A 3VALA 2Y1IA 3V81B 1CC7A 5CCLA 3D3CJ 4N8NA 3I56S 1VK8A 2VODA 2GJ2A 4KHMA 2FHJD 2MGZA 3T1YJ 2DR5A 1KSPA 4CLFA 3V4IA 4U8VA 2F9JA 3Q22A 4ICLB 3TX0A 1X4DA 4PPZA 3PFOA 3TI0A 2D7SA 2HQFA 4LSLB 2CQ2A 2XZWA 2DY1A 1G3OA 3BPSP 3LO3A 4KY3A 5KG3A 4DX6A 1YHQS 2AMCB 4DR5J 1M0SA 1XMBA 1TK8A 4QPTA 4ZCLA 3PX4A 4USUA 2ZZTA 4G1IA 2MLYA 2R42A 3BO2A 1ZTWA 4CH7A 3VHQA 1EARA 1KNZA 3PVXA 4JP8A 1GTEA 5D6GA 1PGZA 3NNHA 5ETKA 3K2YA 2GHPA 4HEA9 1JLBB 2HHPA 4NYZA 3M9OB 5DM7Q 4HDHA 1FNXH 2RJZA 1KD1T 3G71S 3MEDB 5KOXA 3OTDA 2NS1B 1G6BA 2D69A 4LIRA 5K8MA 2WB4A 4N41A 1KN6A 1IR0A 1LEOA 5JJBA 2J0QD 2XMUA 2V2QA 2RH3A 4J7CA 3SQGB 3BR8A 3GG1A 3DLBA 2QGFB 4OZ0A 1IBCB 3IMQJ 4NOHA 3R9LA 5L9XA 2UUBF 1GTHA 1R0AB 4GKKF 1CJVA 1MNEA 4JV0A 2A0FB 3ZTPA 1U25A 2JLGA 4B9VA 4I6YA 4ID5A 2M4MA 3MM9B 3SQOP 3NGKA 2YKQA 1IKVA 3A3PB 5D3GA 3VZIA 5A76A 2HHTA 2ZHBA 2QL9B 5HJYA 4CCHA 1RAOA 1ZH5A 1HBUA 4Y2MA 4OV1A 1PCAA 3D67A 3VQTA 3CCTA 1W26A 1JXVA 1S4EA 4F4XA 4USJC 1U1PA 1FDAA 2V4JB 3QNWB 5BR8J 3M9MB 1F1BB 1ZM2A 1EP4A 3UD5A 3LGNA 4DR6F 2R2SA 1FFGB 2C3MA 2ATLA 3D6TB 3LQVA 5MLCV 2HS3A 4ECZA 4F50A 3D28A 4P71A 1ZYQA 2K8GA 4AL7A 1TKDA 3HLUA 1P9QC 5I3PA 4DPTA 3P6YC 3DNCA 1RTJB 3QLHA 3ZZYA 5DLFA 3BO3A 4FPRA 4AE5A 4K4SA 3B6BA 2UXDF 5D8HB 2ADBA 2D3UA 1NPKA 3LALA 1FKOB 2LLZA 3AODA 4HYKA 1VC6A 4YR3A 1WACA 1Y00A 3MPWA 1SC1B 3IRWP 2QLJB 1BQNB 4B08A 2P9GA 2IJFA 2P9CA
chains in the Genus database with same CATH topology
4LJMA 5BJRA 5KFPA 2FVPA 1WWHA 1HYSA 3MI7X 3PZPA 4HKQA 4LVOP 2YY3A 3CC2S 2Z8QA 3IBWA 3PO4A 5A8KA 4KSEB 2WSCC 4URQU 1HBUB 2DH9A 2K3KA 4Q8FA 3ISNC 4I69A 4PR6A 3U27A 4ZPCA 1DQ9A 6FDRA 3AJ1A 5EWEA 3F44A 2HGNA 2JWNA 2XMMA 4A8FA 3M30B 1RTHB 1A7GE 2HHXA 1BQMB 4NLSA 2XY6A 5DGAA 2I38A 1TAQA 4FF3A 5HI7A 4B9SA 5E5NA 3PFEA 3CJ3A 2DHAA 3OQ2A 4RW7A 1NJWA 2V94A 3N79A 1S72S 1BY9A 2F7VA 4DBQA 5B0GA 4DV1F 1AW0A 4M5DB 4TKTA 5KFZA 5LL6d 3I55S 1NK0A 3AB4B 2A2DA 1RT2B 3CO9A 4N76A 1JNRB 4WJBA 1VC5A 1SL1A 2BACA 3VAIA 2DHGA 4A8OA 3HVTB 2JEGA 3LUYA 2IA6A 3VTIA 1XC9A 1J2VA 4MMOA 2ZZNA 2HGLA 2CG4A 4D3GA 2JLEA 4NLWA 4BC9A 4ZLPA 5KFWA 3VAGA 3AA8A 2JVOA 3MD3A 3G8SA 5L38A 4P7TA 4XK8C 2XS2A 2GMHA 4O4GA 4ZHRB 1CPZA 4QIVA 5KFJA 1HBMB 4A8SA 1HNVB 3TA0A 2DPIA 3ZFVA 2OPSA 2LMIA 3QIPB 1GXUA 5M2UA 3MZIA 3BB5A 3FDSA 1RT4A 1SBRA 2NPFA 2GO8A 2DGTA 2RQKA 4MAKA 1XNQF 2DO4A 2ZJRQ 2B3TB 5KFGA 2MJUA 3QPIA 3MXHP 1MMDA 1DHMA 2AX0A 4RW7B 1Q7LB 2XLKA 1WEXA 3HP6A 3Q23A 2UV8A 1K1QA 1RP5A 2XMVA 3OUYA 1S1XB 1S99A 3CUNA 1S1WB 2XLIA 5J1EA 3C6TA 3OXGA 3BZQA 4NCGA 2QLWA 2DNNA 1YSJA 4XAKA 4EBEA 3OW2R 4I2PB 3I5CA 3MMCB 2Z2MA 2ROGA 5BR8F 2DGUA 5HBMA 2QFJA 2KFYA 4ED8A 1JLAB 5F8HA 1QSSA 2DITA 4HLBA 5EWGA 4B02A 4RW8B 1CEZA 3ISZA 4RUHA 4IOBA 2VBYA 1KVJA 3QGHA 4TY8B 2EFPA 1X4EA 2YKMB 2JC0A 1LFWA 2ABYA 1DQAA 4WF9Q 1Q81T 2ZH5A 5CYQB 5D4OA 5J2PB 2K7JA 4MH8A 2N7YA 5C25A 3OPKA 4O3PA 2KJVA 3C46A 3CJKB 1JJHA 2B7CB 2PSZA 3JTOA 1NAQA 5L39A 2R7WA 4CO2A 4RU2A 1D8YA 1UETA 1K0TA 2E5GA 1YIJS 1JNZB 1NK4A 4KJIA 1JIHA 1NH7A 1OSCA 4LUBA 3C2PA 3MM8A 5T14A 4IFVA 3DI6B 5HROA 1HNVA 1GX6A 3BDPA 3DRYA 1XK8A 3BSCA 1UEVA 2M0GB 1NJIT 5HMXA 4Y65A 4OZ5A 3NNCA 4H4MB 3GR1A 1MW7A 4JI5F 1HI8A 1WHWA 2FC8A 2MQNA 3NS5A 4NA1A 1SI9A 3MM9A 4OJGA 3OJSA 4DL7A 4OX6A 4NXMF 4CT8A 4WFNQ 4F4WA 1Q7YT 4URSA 1RAJA 2XGPA 1ZPWX 4C11A 5HMZA 2MB0B 1SIWB 2UUAF 4Y0FA