2HNZB

Crystal structure of e138k mutant hiv-1 reverse transcriptase in complex with pett-2
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
422
structure length
399
Chain Sequence
TVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNKTPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase/ribonuclease H
publication title Structural insights into mechanisms of non-nucleoside drug resistance for HIV-1 reverse transcriptases mutated at codons 101 or 138.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 109
structure length 399
sequence length 422
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2006-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2hnzB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2hnzB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2hnzB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2hnzB03
1LWFA 2E9RX 3MEDB 1RT1A 2R2RA 1WNEA 1REVA 1JLAA 5J2NB 1VRTA 3KMQA 4ZHRB 4ECYA 4ZP7A 3ITHA 4H4MB 1RT6A 4LSLA 3FFIB 3KLIA 3V4IA 2C28A 3N6LA 3C6UB 4IH6A 4KHMA 1FK9A 4NRUA 5C25A 4ID5A 4ED6A 1R0AA 1DTQA 2ILYA 4EO6A 4JV2A 1TKZB 2DPIA 2ZKUA 1JLBA 1IKXA 2WONB 2I1RA 3RB3A 3KK1B 4FBTA 2D3ZA 5KFRA 2FJXA 4G1QB 1N5YA 4NLDA 5F8HA 5KG7A 4IH5A 4F4ZA 5L9XA 4O4GB 3FDSA 4K4TA 3V6HA 2BQ3A 3QO9A 4KAIA 5KFGA 4ECQA 5KFNA 2BQRA 1LW2A 5J2MB 2W7OA 4NZ0A 2J6SA 2R8JA 3KOAA 5KFVA 2YNIB 2RKIB 3JSMA 4TQSA 4IR1A 1S1UA 2VG6A 2FLLA 1S6PB 1RT4A 1IKVA 2ZE2A 3LP2B 2IC3B 4MFBB 2BE2A 3NAHA 4MKAA 3RBEA 3KLGA 1S9EA 5KFXA 1J5OA 1DLOB 2W9CB 4NCGA 4WE1B 1UWBB 4ECZA 2HNYA 3HHKA 3M8PA 1HNVA 3TAMA 1S9GB 1KHWA 2R2TA 2WRMA 4TN2A 5F8MA 3G6YA 3T5HA 1QE1A 1JLFB 2HNDB 4IG0A 3KHLA 3V6KA 4ZPAA 3RB6A 4IRKA 1NHUA 3DLEB 1RA6A 3HVAA 4O3NA 2R8GA 5KG1A 4R5PA 3OL7A 1XR7A 4Q0BB 3I5AA 1N48A 4KV8B 1MU2B 5D3GB 4TYAA 4WFYA 3SFGA 4QWCA 3PHEA 2F8EX 3KHRA 1IKYB 1RTIA 5DGBA 5DG7A 4RZRA 2W9AA 2R2UA 2UUTA 4RW6A 3OL8A 3M8QB 5HP1B 3N6NA 5FDLA 3NL0A 3DOKB 1HMVB 4RW9A 1CSJA 4ECWA 3T5JA 4IFYB 1TP7A 4Y2CA 4G3IA 4I2QA 5DG8A 3LALA 3KLFA 5KFTA 3C6TB 3RAQA 2IJNA 2OPSA 3DLGB 1ZTTA 2VA3A 5KFMA 2YNFA 2IA6A 2C22A 1BQMB 4DEZA 2YKNA 1JIHA 1TKTB 1KLMB 2OH2A 3KLEA 3N6MA 2WB4A 1XR5A 4YR2A 4MIAA 2IAJB 4M94A 4MIBA 2RF2A 4J9NA 4DL3A 4MH8A 2XCAA 3JYTA 3KNAA 5J2PA 3BQ1A 3DI6B 2YNHB 5CYMB 2HNZA 3GQCA 1C0UB 5J1EA 4O3PA 3IRXA 4K4YA 3DM2B 4NLOA 2I5JB 1TKXA 2AGOA 1RT5B 2CJQA 5F8NA 3G6XA 4WXOA 4IRCA 4KO0A 1N6QA 4K4UA 3TQ1A 3DLKA 2B5JA 3H5SA 1C1BB 4ZVEA 5I3UB 5CYQA 3NKYA 1LW0A 3PJWA 4TY8A 2OPRA 1BQNB 5KT6A 3LP1B 3KK3A 3PW2A 2VG5B 1TV6B 1RT2A 4O3OA 3PR5B 2WTFA 1S1WB 2YKMA 2ZD1B 4K50A 3OLAA 3PJXA 3T19A 3OL6A 4PUOA 4Q43A 4EBCA 4J9PA 3Q8PB 1C1CB 4R8UA 5KFOA 2XCPA 5EWFA 1S97A 3CJ2A 5EDWA 5EUHA 3BQ2A 4ED8A 5DLFA 5F8LA 4RW4A 4IFVB 3MR6A 2CKWA 3DRRA 3PZPA 3HVTB 1TL1A 4NYZA 2JEIA 2C2EA 1LWEA 3DRSB 4RW8A 4K4WA 3QLHB 4XPEA 5L1JA 2B6AB 3OSNA 3Q8QB 1D0EA 3QZ8A 2UVWA 2RDIA 5DQGA 2DPJA 2IM1A 1C0TA 1JLQB 3HVWA 3BGRB 3CDUA 1VRUA 2C2RA 1RT7A 3T1AA 5F9LA 2VG7A 3EPIA 3BQ0A 2OPQB 5HBMA 4ZVFA 3PW7A 4DG1A 3KLHB 1LWCA 1RA7A 4EBDA 3MEEA 1OS5A 1HQEA 4NLXA 2WCXA 2AX0A 1HPZB 2JEJA 4ZP6A 2W8KA 1S0NA 3ISND 4LSNB 5C42B 1RT3A 4H4OA 5F8JA 4NLSA 2XGPA 3GV5B 1RTDA 3MEGA 4QW8A 4URSA 3DOLA 3NBPB 4EBEA 4ZVHA 1S6QB 1KHVA 2BR0A 4NLUA 3H5UA 3KJVA 5KT5A 3I0RA 2B43A 2JC0A 3H5XA 4WZQA 4KKOA 4ED2A 3MR3A 3KHHA 2FLPA 4WZMA 5T14A 1T05B 4QWDA 2V9WA 2QE5A 4O3SA 3GIMA 4ECRA 2V0NA 5KFYA 5L1IA 4XO0A 4DL2A 4K4SA 3IGNA 2ATLA 4ZMMA 3BJYA 1LWFB 1RT1B 5DQIA 1REVB 1JLAB 4ZP8A 4GC7A 1S1TA 1RAJA 1VRTB 4LQ9A 4WXWA 1JLEA 1S0OA 4NLRA 4TQRA 3KK2A 1RTHA 5F9NA 1RT6B 5L1LA 4LSLB 4MKBA 1DTTA 3KLIB 2R2SA 3V4IB 2OPPA 4U7CA 4QW9A 1FK9B 4IG3B 4IOBA 4IDKA 5C25B 1QAJA 3BREA 4ID5B 4TLRA 4JUZA 4YP3A 1R0AB 1DTQB 1TL3A 1TQLA 4LQ3A 3OLBA 4K4VA 5KFUA 5KFEA 5EWEA 1JLBB 3CDEA 4NLGA 4MFBA 2BANB 3MFIA 1IKXB 2JEFA 4Y2AA 3NGDA 4RNFA 3QIPA 3EPGA 3H59A 1N5YB 3LP0A 1MMLA 1TVRB 3RB4A 4JV0A 4YMEA 3QO9B 4J9KA 5KFDA 1LW2B 4R0EA 4Q8EA 1HNIA 3JSMB 1RDRA 1S1UB 2VG6B 1RT4B 1IKVB 2ZE2B 2ILZA 2ASDA 3MECB 3DMJA 1S9EB 5J2QA 4RW7A 3GV8B 4NCGB 5I42A 2EC0A 4Y3CA 2HNYB 3E51A 3M8PB 1HNVB 4KFBA 3E01A 4QPXA 5DLGA 1QAIA 3MF5A 2AU0A 1QE1B 4IG0B 4ICLA 3IS9A 4EYHB 4QWAA 2BRKA 4DL5A 4ECXA 4F50A 5JXSA 4R5PB 2C2DA 4OL8A 5KG5A 2FVQA 3DYAA 1S9FA 2ASLA 2IAJA 3CDWA 4KBIA 1RTIB 4WYLA 4GC6A 3IG1B 4RW6B 3CWJA 1QUVA 5FDLB 4RNHA 2D7SA 2FLNA 3QGGA 2IBKA 4I2QB 3PW4A 3KLFB 4O44B 1JLGA 2QV6A 2OPSB 4ZP9A 2IM3A 4DL7A 2YNFB 2I5JA 2FJVA 3LANA 5K14A 2YKNB 5KFKA 4B3OA 1SUQB 4I2PA 1JLCA 4TY9A 4I7FB 1GX6A 5KFIA 3OHAA 2RF2B 1HYSA 1SV5A 3DRPB 1HQUA 3D5MA 1S1XA 1FKOA 3OHBA 4NLQA 1BQNA 3JYTB 1YVFA 5KT2A 5J2PB 2WK4A 2VG5A 3FQKA 5KFQA 4PQUA 4ZPCA 2HNZB 4URGA 5J1EB 4DL4A 3H5YA 3IRXB 1IM4A 4ECVA 1TKXB 1I6JA 4ED3A 2WOMA 3GILA 4EYIB 5HROA 5C24A 1RTJA 1ZTWA 1N6QB 4NLTA 3I0SA 1EETA 3DLKB 2B5JB 3SFUA 4ECTA 4FS1A 3PVXA 5CYQB 4TY8B 1LW0B 1C2PA 5KG0A 2O5DA 2OPRB 4J9QA 4F4WA 4NLPA 2HAIA 5JUMA 5HLFA 4NLYA 3IN5A 4KSEB 1EP4A 1RT2B 3G86A 4PWDA 2YKMB 3V81A 3QGHA 4J9LA 3V6JA 3BSCA 2FJWA 1T03B 2HMIB 1RYSA 4PUOB 4YR3A 1JKHA 1SH2A 4O3RA 3EZUA 3TVKA 1S1VA 2IJFA 4RUCA 5KFPA 1Z4UA 2V4QA 4IQXA 4RW4B 4K4ZA 1SH0A 1N4LA 4FS2A 2FVRA 3MTKA 3V6DA 2OPQA 1IKWA 5KFLA 1TL1B 1LWEB 5KFZA 4RW8B 2W9BA 3Q8RB 4RU9A 1FKPB 3MFHA 3ISNC 2D41A 3FQLA 1C0TB 4QWEA 5C42A 2BRLA 2XI2A 1W25A 2VA2A 3MEDA 1VRUB 2R8KA 1S4FA 1RT7B 3CO9A 2YNGB 5J2NA 2VG7B 3MR2A 4JV1A 3M9OB 4Q45A 4ZHRA 5HBMB 4DG1B 4YQWA 3T5LA 3PW5A 2GIQA 1LWCB 4H4MA 4K4XA 3SI8A 3GIKA 3FFIA 3MEEB 2ASJA 3BSAA 3C6UA 1HQEB 2WHOA 3MR5A 5KG4A 5KFBA 4MK9A 4O3QA 3KLVA 1TKZA 4KHRA 1RT3B 4H4OB 3I5BA 3ICLA 1RTDB 3MEGB 5KG3A 2AGQA 2WONA 4H54A 2XGQA 3DOLB 3KK1A 3H2LA 4HYKA 4HKQA 4G1QA 3KJVB 2XI3A 4F4XA 2FVSA 1JX4A 3ITHB 2RDJA 3I0RB 3LAMA 2FVPA 3Q8SB 4ED1A 1ZETA 4KKOB 4O4GA 3H4BA 4WYWA 3FRZA 3BR9A 3UDLA 4J9MA 3H40A 5J2MA 2AGPA 4IG3A 5KFWA 1T3NA 3QIDA 2HWIA 2YNIA 2RKIA 4J9RA 1XR6A 4Q8FA 1S6PA 3LP2A 1N56A 2J6TA 2IC3A 2GIRA 4TYBA 2BANA 2W9CA 1DLOA 1S1TB 4WE1A 1UWBA 1JLEB 4RUAA 5DQHA 5KFHA 1S9GA 3H98A 3KK2B 3OL9A 1RTHB 4IH7A 1JLFA 2HNDA 1TVRA 4ZPDA 4QWBA 4U6PA 1DTTB 3RBDA 3DLEA 2OPPB 5DGAA 4IDKB 4RNNA 5KFJA 4Q0BA 1TL3B 4MK7A 4KV8A 1MU2A 5D3GA 4EEYA 2BE2B 3PW0A 3KLGB 1IKYA 4ZVGA 5EWGA 2BQUA 1J5OB 4RNOA 2V4RA 2GC8A 3MECA 4X2BA 3QIPB 3H4DA 3M8QA 5HP1A 3TAMB 3DOKA 1HMVA 4NRTA 4IFYA 2JLEA 3LP0B 2FVCA 4FBUA 5KFAA 4XPCA 2W7PA 3T5KA 5KT3A 3C6TA 2XWYA 3DLGA 4MK8A 3CJ3A 1BQMA 4WFZA 1TKTA 1KLMA 5KT4A 2E9ZA 2JEGA 1HNIB 3BSNA 1K1QA 1D1UA 3CVKA 4NLWA 4F4YA 3DMJB 1RYRA 5J2QB 4RW7B 1GX5A 5I42B 4ZPBA 4RW9B 3IG1A 2R8IA 3DI6A 2YNHA 4KFBB 3E01B 5CYMA 1C0UA 5DG9A 2E9TA 3CIZA 5KFSA 3VQSA 4ICLB 3CJ0A 3IS9B 3D28A 3DM2A 2IM0A 4EO8A 3BSOA 4O44A 5KG6A 1RT5A 4Q44A 3KLEB 4URQU 3CJ4A 3DYAB 3KHGA 1SUQA 1C1BA 1JXLA 5I3UA 4I7FA 4WFXA 2J6UA 3NAIA 4ECSA 3DRPA 4J9OA 3LP1A 4KE5A 3PR4A 1TV6A 2XC9A 1S1WA 2ZD1A 2IM2A 2JC1A 1NHVA 4KB7A 3UPFA 1JLGB 4ED0A 1C1CA 3RB0A 3QZ7A 1S48A 4KO0B 5K14B 4B3OB 4I2PB 4IFVA 1JLCB 4M95A 3HKWA 2IMWP 1HYSB 3HVTA 1SV5B 5F8GA 1HQUB 3DRSA 1S1XB 1FKOB 3KK3B 3QLHA 3M9MB 3DDKA 2B6AA 2ALZA 4YR0A 1K1SA 4PQUB 4O4RA 2UVRA 4IR9A 4RNMA 2HMIA 1T03A 4R8UB 1JLQA 1T94A 3G6VA 1S10A 5L1KA 3BGRA 5KT7A 3I5CA 2WOMB 5KG2A 5HROB 4IKAA 5C24B 1S49A 1RTJB 4DL6A 3I0SB 1EETB 3DRRB 3UQSA 2W8LA 1U09A 5KFFA 3KLHA 3FSIA 3KMSA 1S0MA 4Y34A 5HLFB 2UUWA 3UR0A 3RAXA 1NNDA 1EP4B 2D3UA 4TXSA 4PWDB 1HPZA 3V81B 1FKPA 4NLVA 3OSPA 1HARA 3CJ5A 4LSNA 3QGIA 1JKHB 4ECUA 5F8IA 4J9SA 1S1VB 3NBPA 2UVUA 1S6QA 2YNGA 3M9NB 3GV7B 2AQ4A 3LAKA 4IRDA 2HWHA 3V6DB 2R8HA 1IKWB 4ED7A 2UVVA 3GYNA 3NMAA 1SH3A 5KFCA 1T05A 2AX1A 3IGVA 2W9BB 3QYYA 2AWZA 3GIIA 3GIJA 5C5JA
chains in the Genus database with same CATH superfamily
2EG1A 3DC2A 1IQZA 2AEFA 3KLIA 2QLJB 5A8RB 5CZXA 5E2QA 1TL4A 2X1BA 2C3MA 4BC7A 4X4PA 1GTEA 3HF5A 4LR9A 1SL0A 4KPYA 2XS5A 2HFZA 5ETSA 2EKYA 1UETA 3NCRA 1U2CA 3THTA 5FD1A 1CJTB 3PG9A 2R8GA 2DKOB 2MQLA 2R7QA 3I5AA 4UY8T 3VAHA 1VQYA 1B0PA 2ZH6A 4DQRA 3HT3A 3T5JA 1TK5A 3ILIA 4DPUA 2VA3A 2XZWA 2J9CA 5K20B 5GAHU 1QAXA 5T7LB 1R7IA 2BJ9A 3CCZA 2E7XA 3DLKA 3T6JA 5D15A 4JI4J 5I3UB 4RJVA 4BWJA 4C11A 1X5PA 3Q8PB 3CJ2A 5M2PA 4X64J 4Y2IA 2C2EA 3ZNUA 2JVRA 3CC4S 1C0TA 4V1Ak 5F9LA 1RCOB 1YRTA 1DRZA 3ZZUA 2YWKA 4N8OA 1T9UA 1HPZB 4P2MA 4JI8J 3OPKA 4W98A 4FXVA 3GV5B 2J7UA 1YJNS 1KHVA 4KGMA 2HQDA 3I0RA 4WZQA 4XDDA 3KHHA 4ANEA 2QE5A 4B3RJ 2EBGA 3FJ2A 2NXEA 3IA0A 3BDEA 7FDRA 4TVAB 3K58A 1DTTA 3V4IB 2KL8A 4LQ3A 2Y1LB 1MSWD 4ZIWA 5H9EJ 4PYAA 1NJXA 2HRTA 4WBFA 2F4VJ 2DHHA 2N7YA 4I64A 1WSVA 4R0EA 4EWTA 1TUWA 2K3IA 3W60A 1RT4B 2A6MA 5AXMA 2CPHA 3DMJA 1HBNB 3IR5B 4X4RA 4QPXA 1DQ8A 2C1EB 1RP5A 1FEEA 2LKZA 5L38A 5IT9U 4IQMA 4A8OA 3W7BA 2UV8G 1S76D 2VZ9A 5FDLB 2G2YA 3KLFB 3P96A 2OTLS 1JLCA 2O67A 4FVMA 3JTNA 2V67A 1HNWF 1V5IB 4RBUA 4URGA 3C46A 1SJ1A 4F4WA 2RSQA 3OD2A 2NXNA 2EK1A 1T03B 1ZM4A 3BN7A 1OPIA 4IQXA 2VJUA 2E5IA 1NBEB 2W9BA 4RU9A 1YSJA 3LQVA 3FQLA 1OYDA 1RT7B 3LO3A 1SKRA 2ZWOA 2DR9A 4ELUA 2ASJA 4OLOA 3F41A 3IWXA 4O3QA 2AGQA 2M8HA 2M3DA 2VL1A 2JLGA 3BR9A 2B56A 2F4FA 2DGUA 1XR6A 4F3OA 5HQMA 2OSQA 3BF4A 5LL6d 2YWWA 4C2MA 3J81j 2LQ9A 2E1PA 5ETPA 5KFJA 3M8RA 3OVAA 2F5GA 3LPEA 3TJ9A 1HBNA 2RQMA 4FBUA 2G4BA 1N54B 1X5SA 3EICA 1GX5A 4RW9B 2LQJA 2C2NA 3VV2B 3DM2A 4DV7F 1NH8A 2LEBA 2DHGA 2MKYA 1N33F 3TO8A 2LEAA 2XLJA 2ZOGA 3E8OA 3CJ8A 3G8QA 4IO1A 2MLYA 4DV2J 2YQ0A 4DSLA 4GO7X 4C6AA 4O4RA 1T03A 1X5TA 1NK0A 3J7YI 2O1PA 2WOMB 2KM8C 5KG2A 3ILLA 1NKBA 5LM7E 3MMBB 4CRJA 1OQ6A 2JFKA 2HFUA 4E2FB 1YJRA 4OI4A 2ZC3A 2FJBB 3DU5A 3BYRA 1U49A 4KGXB 1FK9A 1VS3A 5B7WA 2J9DA 5FJ4A 3DKDA 2B9XA 2MKJA 2HS4A 3L4BC 4CO5A 2D3ZA 5CCLA 4HTIA 3J7Z5 2NSCA 4LRBA 1N36J 4F36A 2CQ2A 3OR2B 2RHSB 3I32A 2NS1B 2WRMA 2UZAA 4FP9A 1QE1A 2YWFA 1Z2LA 3CCTA 1RTIA 4KR0B 5DG7A 3A13A 3IC1A 5CXTA 3M8QB 2P6SA 4RW9A 3DLGB 3CJRA 4J9UE 5LT5A 4DXLA 1XR5A 3BZQA 1G2EA 4Q2MA 2HHHJ 2QC3A 2EBEA 4PG4A 3MMCA 5BXIA 3IRXA 2IRUA 4DV5J 1X9WA 4ZVEA 1Y3JA 2W7AA 3OLAA 1VQNS 1HHQA 1LNQA 4KGVB 1NAQA 4ZDNA 3O6QA 2I6WA 3OSNA 2J8AA 2UXDF 5M2RA 2QJ3A 1Y10A 2YTCA 2YY3A 1S72S 2QEXS 3KLHB 2VODA 4I4BA 3I9ZA 2NZCA 2XGPA 1S5ZA 4MTPA 3P4UB 1WKLA 3KJVA 5KT5A 4WZMA 2FLPA 3PX0A 2WSCC 2WW8A 1NZAA 1H74A 1MLAA 1Y7PA 2Y1IA 1B4SA 2CZ9A 1DTQB 1XNRF 2N4DA 4CDIA 1S7IA 1BXNA 1YZ6A 4EZ6A 1Q5VA 1Y3KA 2DRBA 1Q82T 4X4VA 1YJ7A 3M6VA 2AW0A 3W8GA 3DU6A 3IS9A 1HKAA 3J80Y 5A6WA 4LBPA 1NSAA 4O0IA 2V63A 3LANA 3AD7C 1I5OB 4I2PA 2MXYA 3X3UA 4NLQA 3D66A 1SQEA 2M0GB 3NGRA 1ZM9A 2FUG9 3MWBA 4D3GA 4P72A 3N28A 1RTJA 1HNZJ 3I0SA 3U1MA 5CYQB 3RTVA 2O5DA 1EP4A 3G86A 2DCLA 3UN2A 3IWNC 3GMGA 4FPRA 1SPBP 2E1AA 2HW3A 4ZS6A 3ISNC 3P5BP 1KS2A 3CSKA 5DM7Q 4JV1A 2MZSA 3M1VB 3C14B 3GIKA 3CJKA 2V8GA 3R5AA 3IWLA 4H4OB 2LEPA 3UVJB 3EZ5A 3H2LA 4B02A 4F4XA 1HD1A 1N32J 3LAMA 4ES1A 5HMYA 4CQ1A 2HHPA 4ZCLA 4ETXA 2IC3A 3SCIE 2QT7A 3ILJA 4Q0BA 3US5A 5D3GA 3AY0A 4Y0FA 2XB2D 4DV0F 1HI0P 3R5JB 1FX2A 1X4EA 3S8SA 4CT9A 3CTRA 1N34F 1RBOB 1RLDA 1XMOF 4NLWA 3QWPA 3R2DJ 2J9DE 4C8MA 4EO8A 1SJQA 1VLOA 3GCWP 3AJ2A 2AJ1A 1JJCB 2Q79A 4KC5A 4J9OA 1RJJA 4KE5A 4ZVRB 2XC9A 1FE4A 1FI4A 4QYZJ 1BLUA 3R5BA 3CULA 5IQQA 3NNHA 4DOZA 2GMJA 4IFVA 4M95A 1HD0A 3TARA 2FTRA 1LK5A 3MPUB 4OZ2A 2BDPA 4RNMA 3IM9A 2QO3A 5C24B 3E2EA 1EETB 3AD9C 2MGZB 4Y34A 2UUWA 3MMJA 3EGWB 3GYXB 2XLKA 2GA7A 5CA5A 1F60B 2LFVA 3WC2A 4BS2A 1RT1A 2CPZA 4H4MB 2GVZB 2ZNZA 1DJ0A 5A6PA 2UUAF 2W2NP 2OELA 3I4PA 2KVIA 4N5SA 2WONB 1U6FA 4DPWA 2RILA 2XEXA 3GR1A 3J81Y 5KFGA 2QYGA 2J6SA 1V6HA 2RKIB 2E1CA 2VG6A 4QYZK 1WOSA 3T9ZA 1HBUB 3LW5C 5IXUA 2GAGC 3M8PA 4IRKA 2V5HG 2CQBA 4OI2A 3KUHA 2MQQA 1IKYB 4A8FA 2W9AA 2XYPB 4PG8A 1UKUA 3DOKB 4ECWA 1VR6A 5DRKA 4CIOA 5KFMA 1FNOA 3CJTA 2X7IA 1Y5NB 4OI6A 2CNKB 4ZLNA 3BQ1A 4H4KC 4ZVQB 4HH0A 1C0UB 1WC3A 3OR1A 3CCMS 2IMOA 3S6EA 2AGOA 4ED5A 1IUJA 3RUBL 4IRCA 3TI0A 7AT1B 1WDDA 4LRCA 2GJIA 3JTOA 4EBCA 3R5CA 4UF4A 1VYAA 2CZ4A 2XCPA 3EGZA 4GKJF 1RGVA 1APSA 4HL9A 1Q16B 4ZN3A 1IM6A 2VQFF 1X0PA 5HBMA 4DG1A 4NCBA 2PD1A 2HHTA 4NXMF 2E7VA 2W8KA 4LSNB 4JYAF 4FYWB 3AFGA 3CE8A 2FY1A 2PEBA 4OHVA 2GVZA 1YLXA 1GMVA 3OJSA 4LJMA 1WKJA 1VHIA 1Z2ZA 4DUZJ 2LXIA 2DD8S 4FXDA 4I0WA 2CDQA 2CVIA 5G0RB 4DUYF 4LSLB 3MDFA 1YJ9S 4IOBA 5C25B 3OLBA 5KFUA 4GKKF 1WG4A 4Y2AA 1HBUA 1WTBA 4ZPWR 4HT7A 3D6FB 4JV0A 3QO9B 4KH0B 1LW2B 4Q8EA 3MM6A 2DVIA 1GXTA 4RW7A 3MCSA 3RAMA 2B8QA 4DQQA 1QAIA 2ZBPA 3T1HJ 4UQGA 2XBPA 4Y65A 2FVQA 1UEUA 1Y5IB 3CDWA 4KBIA 2EG2A 1OMSA 3KJQB 4RW6B 1FRLA 3LF0A 2MY7A 2Y8WA 4Q7AA 2L08A 4F67A 2YKNB 3TUIC 4TY9A 3OHAA 2RF2B 1TK0A 1UFKA 3PYFA 2QG9B 3GG0A 3K89A 4DPOA 2BE9B 2HWTA 3IO1A 4WP9A 1N6QB 1RISA 3PVXA 5A2QY 2GO9A 1KVIA 1VQ9S 5JUMA 3DDNA 2HEKA 1JKHA 2MHEA 5LOQA 7FD1A 1LFPA 4QOTA 1QM9A 2CZVC 4B3TF 4A8SA 3ZC4A 3K57A 3Q8RB 1IQTA 3I96A 3R1HA 4X66J 2BE7D 1S4FA 3HHDA 3M9OB 4YQWA 4K4XA 3P6YC 1WORA 2DNQA 4EK2A 2K7KA 1RABB 2RDJA 3A8KA 4O4GA 5G0RA 2QL7B 1CJVB 3H4BA 1NZ8A 3H40A 5KFWA 4J9RA 1XWLA 4Q8FA 3O8WA 1AW0A 1JLEB 3H98A 5DM6Q 2K3KA 1JLFA 4U6PA 4RLEA 5DGAA 4AQYF 4ZVGA 4DS4A 1E6VA 1UZDA 1IJEB 4NRTA 4IFYA 2E1MC 2FVCA 4OYAA 3CCUS 1HNIB 4RWWA 3HVRA 3BSOA 4P73A 1RT5A 3KLEB 2B51A 5E41A 1QSYA 2RQ4A 1S79A 4DR1J 3MCNA 3NAIA 2B4OA 1YHQS 1TV6A 1S1WA 2ZD1A 3CW2C 2BJ7A 2DYAA 2J5AA 2KO1A 4JBCA 4USMA 2GHWA 1WWHA 2KYXA 5F8GA 2Q1LA 2Y3YA 1AROP 1S10A 2Q6CA 1PC4A 2XSJB 2CDRB 1SL1A 1NK7A 1X4DA 5HLFB 2D3UA 1UA1A 4NLVA 2X3DA 1TUGB 1J2VA 3M9NB 1GK8A 2AQ4A 3ZNJ1 2R8HA 4CCHA 2FHJA 4ID8A 3AB2B 1RBLA 3DLBA 1VDHA 2ZNYA 2XM3A 3BPDA 2JVOA 1I1GA 2ZOMA 3ZZYA 2EEYA 5BYSA 2I2YA 3GJTB 2FHOB 3RB3A 2ABYA 4ZVOB 5L9XA 3FDSA 1UA0A 1QTMA 5KFNA 2WVCA 3KOAA 1T9VA 5EN1A 1T9WA 2BJ3A 3RBEA 4A46A 2HNYA 4QZVB 3T5HA 2QRRA 3MM7B 3OL7A 3M8SA 2AKWB 2MKHA 1IWGA 2AJQA 1FRXA 1ZTTA 2HFSA 1TKTB 1KFSA 3KLEA 1CS4A 4NASA 3AQPA 2D69A 3MM5B 5CYMB 2YNHB 5J1EA 5LMNF 1G3OA 1VHFA 2DBBA 1FXRA 2HURA 1FJ7A 5ETLA 2YWEA 4KH1B 2F7VA 1TL7B 2P5VA 1SKWA 5EDWA 2XSJA 3MR6A 3NLCA 1B3TA 2EI5A 5DQGA 4LF6F 1WEYA 2VBZA 2FQQB 2OKQA 3GJRB 1D3WA 5L39A 4C98A 1BMQB 5GMKa 4USWA 4ZLJA 2WCXA 3OBIA 2DCUB 5C42B 1S6QB 4HVZA 4M5MA 1P1TA 2V9WA 2DNPA 4JI3J 4ZMMA 1HBOB 1NO8A 5DQIA 4ZP8A 1RAJA 2XTJP 4WJBA 2RD5C 2HZVA 3SCLE 5L1LA 5E5NA 1KFDA 3MPVA 3HI9A 4OI1A 4OYBA 1UMJA 3H59A 1KN6A 3M4XA 3UCGA 3K59A 2ZBRA 4HTJA 4NCGB 4OHYA 2V6AA 4KFBA 3E01A 3NWRA 1P6TA 2HHVA 2R7TA 1QLNA 5KG5A 3DYAA 3QNWB 1NJZA 3QJLA 3D3BJ 5I3QA 3MPYA 3P49B 1RWNB 2CPXA 2P6TA 3MZIA 2JL9A 2HZCA 5DDRC 2DNZA 4O44B 3R5GA 8RUCA 1RAAB 2KFZA 5IT9Y 2ZC4A 1HQUA 2EFGA 4OHXA 1NK5A 4DL4A 1ZPVA 1PKUA 4NXNJ 2DNHA 4J9QA 1LW0B 1D9FA 6FD1A 3IN5A 1RT2B 1NEEA 1KTQA 2V8HA 3V6JA 5J1PA 3BSCA 2DR5A 1EX8A 1EJ7L 3TVKA 3ULHA 2VBXA 2R7XA 1TL1B 3ET6A 4ZVPB 4PG7A 5C42A 1VRUB 2KFNA 2ZITA 4LSZB 1H7WA 1LWCB 5ETTA 3R8YA 4F4AA 3ICLA 4B9TA 4CM2A 4C0HA 2AJ4A 4LBHA 2DITA 3K17A 1RWUA 4ED1A 3POTA 1NLKL 4J9MA 2HWIA 2ZBIA 1XNQF 1S1TB 3AA9A 4PPZA 4KYZA 2F65A 3QRRA 1I94F 3LA0A 1SQFA 2RUGA 4MK7A 4LF1A 2ZKTA 3OFEA 2MLXA 3PW0A 2V4RA 2HQCA 1DAXA 1Q8IA 1ZA1B 2CPYA 5KT3A 2R3VA 2NXCA 3SBMA 2B8PA 3MUTP 3L95X 3DCAA 2N82B 1N5VA 4YOEA 4X84A 1H6KX 5HO4A 2R8IA 5DG9A 2GW8A 2FHMA 3CT9A 4O44A 3BS9A 4CNYA 3PACA 1Q1KA 2J6UA 3HFVA 1DURA 3CCQS 5GAGU 3Q83A 3RB0A 5IT4A 1RCXB 3W2VB 2KT5A 1FKOB 4U96A 2B6AA 4YR0A 4PQUB 1R31A 4ALZA 5KT7A 5HROB 2W8LA 4FF2A 4DCOB 1Q5YA 4OZJA 2R7SA 1NNDA 1QSLA 1R8PA 1X8DA 4ECUA 5GAEI 3W1YC 3PRVA 4C8ZA 2M2BA 1VBKA 4IRDA 2ZH8A 3M32B 1SH3A 2FYXA 4JI4F 3SQOP 2DH7A 4DSFA 1MG7A 5IV3A 1PO6A 4ZHRB 1A6LA 5CABA 2XHCA 3HMJG 2KFYA 3EVMA 2MQNA 1U0HA 2M52A 2C2MB 1PC5A 1CJKB 2IRXA 5GADI 4JI0J 4HHHA 3AT1B 5J2MB 1VK3A 2YNIB 4CYUB 4JI8F 3TW0A 4DX8H 4TN2A 1HNVA 5F8MA 1P8GA 3DLEB 4O3NA 4KV8B 1S59A 1SXLA 1FCAA 5D4OA 2R9LA 3NL0A 5ADZA 1FJGJ 4G3IA 3VR1A 2YNFA 4AL6A 2CNOB 2KJWA 2WB4A 2ACMA 4M94A 1H2VZ 3ENVA 1WEXA 3QRPA 2MKCA 2F4VF 4X4NA 2EK6A 1AA1B 3NKYA 1CC7A 3ZZRA 1RZMA 3G9CA 4RW4A 1S57A 3IR6B 1ACMB 3JQJA 1LWEA 4U7UK 2MKSA 3Q8QB 2BJ8A 2FGCA 2F40A 2IM1A 4DL0C 4DFKA 1AFIA 5K8OA 2XMJA 1IWAA 3TVZA 4C8KA 3BQ0A 4OYXA 3MEEA 1HQEA 4BLGA 2J0QD 4B3MJ 4EUVA 1HHTP 3R2CJ 4I68A 3HKZD 1WSRA 2MHNA 2ZH3A 4YHHJ 1O5JA 4U8VA 2HIQA 2V0NA 4K4SA 1B7FA 5IS2A 2XMMA 3NNAA 1RSCA 4RKUC 4WXWA 2VQEJ 2QSWA 2MZTA 4IDKA 4ID5B 1R0AB 1VFJA 2PFFB 2A2CA 4P2FA 3J7A1 3VTIA 1N5YB 3LP0A 3KXDA 2ROEA 4C3MA 2OD4A 2V4JA 4FPIA 1IKVB 1S9EB 5J2QA 4UTGA 2RS2A 2AU0A 1L3VA 4EYHB 5JXSA 4R5PB 3W61A 4ZPTR 5ITHA 1QUVA 4USKA 1YJUA 3QT6A 3TAQA 4BDPA 1NK8A 1KQKA 4FYVB 1U25A 5KT2A 3Q2SC 4F7VA 2PFDA 1NH7A 1RK8A 2FY8A 5A8WB 4NLTA 3SCJE 1KEKA 4QJVA 3IXQA 4RUCA 3ZZTA 2IJFA 3E3XA 4HI2A 3NEKA 5KFLA 2HRYA 1PYTA 3TEGA 5IQ6A 4X4OA 1UVJA 3FSXA 2XI2A 4CZCA 2VA2A 3MEDA 2H5EA 1XMBA 4WKYA 1NDKA 1FRHA 2GIQA 2JZ5A 3H2UB 2DO4A 2Q6BA 1TKZA 4KHRA 3J7YU 2ZHOA 2ZZNA 5B0GA 3FRZA 3BO3A 1XMOJ 3A3NB 3SSRA 1WDTA 1DLOA 1UWBA 3R1LA 3CMAS 2HNDA 2CJYB 2GNKA 1MU2A 2FD2A 3ENAA 4KHPF 2HLTA 1FNXH 2IVMA 1HMVA 2JLEA 2ATCB 4LBIA 4RX6A 2XWYA 1K1QA 2HQFA 4F4YA 1O6XA 2VONA 4GVBA 3DI6A 3CUNA 3HHNB 1SJ4P 3W5ZA 3BDPA 1GMUA 3A8IA 1Q7LB 1SC3B 1RAOA 1N36F 2GAHC 2OHDA 2GV1A 1DZ5A 4WFXA 4WIIA 9ATCB 2W2QP 1NHVA 2X3GA 3UPFA 3GU0A 3D2WA 1FNMA 4QPTA 5A8WA 5ETOA 4HACA 1WI6A 4IO9Q 3DOMB 3BGRA 3DGPA 2RS8A 1FRJA 2VIHA 2UUAJ 1AB8A 1VGYA 4DV1J 1WG1A 5CH7B 1GXUA 1RBAA 3CJ5A 3FBBA 2CXEA 3CO0P 4LIWA 3FUYA 3HFZB 3V6DB 2VHGA 3T1YJ 2WSFC 2CIMA 3IGVA 2KXHA 1RACB 3TUPA 3BKFA 1RE1B 1JLAA 5J2NB 1VRTA 1K0VA 1RT6A 1A7GE 4B17A 3C6UB 3CC7S 4DWIA 2RJZA 2CNLB 2ZFHA 2XNRA 4OYIA 1RLCL 3KG1A 4ECQA 2W7OA 4HDHA 4LF4J 2D3OR 3BR8A 2K1RB 2UP1A 3AOBA 2W9CB 3CB4A 5D4PA 3HHKA 3PW5A 2MKIA 1GAOA 3W5XA 4C3KA 1RA6A 3G8SA 4N77A 2F8EX 1VIXA 5B0DA 2XY7A 4F02A 3FEXB 3M2VA 1L3SA 3M30A 2KB2A 2B7BB 4RUHA 4UOCA 3EYZA 3EZOA 3Q8VA 4DSKA 3OTEA 2QA2A 2CQIA 4C8OA 4OZLA 2VQFJ 1RUSA 1TKXA 3G87A 2DK2A 3H5SA 4FF1A 3VZHA 5JMNA 4JYAJ 3QSIA 4Q43A 2RDDA 4G65A 3SDEB 3BQ2A 5DLFA 5F8LA 1URRA 3C66A 1U2RA 3DRSB 4F2RA 5BYRA 2QLBB 3HVWA 4LFAJ 3M6UA 4OMFG 3O2IA 1HR0J 4URSA 3CCJS 3NBPB 4ZVHA 4RUBA 5M2UA 3JSBA 2DXFA 2B43A 1HNZF 3S1TA 4DLGA 4NEZA 4I56A 2GHPA 2EPIA 1YJTA 2CPEA 5KOWA 1VC0A 2FJAB 1ITPA 3K0JA 2VH7A 5HVFA 4I67A 1UW9A 1DQ9A 1WOPA 5D78A 4XTTA 1JLBB 4CLPA 2K1RA 3N79A 4YMEA 1U2FA 3JSMB 3GV8B 4M5NA 5SZTA 1F5BA 1N32F 3DFEA 4P75A 4DR4J 2ASLA 3MAQA 4DBQA 2ERRA 4CO2A 4I2QB 2OPSB 4ZP9A 4V19J 5K14A 3BGOP 5KFIA 3EDRB 3HHLD 3JYTB 2H5IB 3UD4P 5J2PB 2PGCA 5JJBA 1WC6A 1I6JA 3GILA 4HR2A 1LEOA 5A0YB 4ECTA 1R8HA 2KZMA 1OYEA 3ZZ0A 2QGFB 3OFFA 5IZHA 3NS6A 1XQIA 4PUOB 4TU8A 2Y8YA 1UVLA 3BBBA 2AF6A 5DS7A 3H0PA 4DFJA 2WB1D 2BRLA 2VKRA 4Q45A 3JS9A 1Q8BA 3FFIA 1F6TA 1GEHA 3I31A 5DDPC 2IRYA 4H54A 4HKQA 4G1QA 4CTAA 1K47A 2RUSA 3T9NA 3GR0A 4X65F 4LVNP 4FYYB 4UQTA 2ZBCA 3HHLB 2GFFA 2OPPB 2OFGX 1YKWA 1U1QA 2LU1A 3N4WA 1TL3B 5ETRA 4Y28C 1M5VC 2GC8A 3HDSA 3QIPB 4G6VB 1BWEA 4NA3A 2WW4A 4WPAA 2SXLA 4DQPA 1KLMA 2OSRA 1E6YA 3BSNA 2V2ZA 4X4UA 3SIPB 1FXLA 3DDIA 2OEKA 1B70B 3A3OB 2HGNA 3MOJB 5AE2A 3U1NA 3CJ4A 1U47A 2KDOA 3CCES 1WTFA 1JLGB 1G4CA 3K2YA 4ZVTB 2GMLA 4DI6A 3HKWA 5A8KB 1HYSB 4NZ7A 2Z2MA 3QLHA 3VVUA 4WK3A 1X4AA 2QA4G 1NCLA 4KGKA 2GCFA 3D7SB 1T94A 2RB7A 1GXLA 1OY9A 3NOGA 1XMQJ 3BGUA 4PWDB 2R7UA 1S1VB 5ETMA 3D0IE 4W4MA 3NMAA 2ADBA 1R6VA 1T05A 2D1CA 4ZLLA 2E5HA 4DN0A 3AJ1A 5LJ3Y 4CH1A 1WNEA 1REVA 1ZZNA 1FFGB 1WJ9A 4ECYA 1HI8A 2C28A 4IH6A 3G4SS 4LFBJ 2AP6A 1N5SA 2DPIA 4RO0A 5L9NA 4KJIA 1JXEA 3G71S 3HHLA 4U7UD 2FJXA 3PIPQ 5F8HA 1YBAA 3V6HA 5KFVA 4QIEA 1S6PB 3LP2B 3TEHB 2LVWA 4WE1B 1C4AA 4ZITA 1ZETA 1WOOA 3NWGA 3RB6A 4M5DB 1CULA 4B9VA 2DY9A 3TUJC 3LGMA 2XY5A 4L73A 5L8RC 5DGBA 2UUTA 4NYOA 4N47A 4WFBQ 4DEZA 2CQCA 1X4BA 2YX4A 2OIHA 4X4TA 3GQCA 2HNZA 3HULA 1I3OB 2HHQA 3HJVA 2ADCA 2DNNA 1Q95G 1VMBA 1WELA 1X4HA 3M2RB 3JSRA 2E5JA 3UD5A 5B09A 2IHR1 4J9PA 1C1CB 3T1HF 2DHAA 4F4KA 4NI2A 4F04B 5B0AA 2ZZTA 1TK8A 1TL5A 4RW8A 3K7RA 3IBWA 3GSIA 4C48A 1M5SA 1M5KC 2M9KA 3VAGA 2WVDA 5EX3A 2C2RA 3T1AA 2VG7A 2LU2A 2K8GA 1IBMJ 3F56A 2KKHA 2L48A 4ZCIA 3ISND 3F73A 3FCHA 2ZH1A 3MEGA 1EKRA 4NLUA 1Y4ZB 3H5UA 3LWLA 1ICEB 4YB7A 4DPYA 3QWUA 1WUUA 3BJYA 2BYCA 2PC6A 3F0NA 2XMAA 3P3DA 2YKQA 3OXGA 3KLIB 4JUZA 4B3SJ 6AT1B 4K4VA 2RRNA 5EWEA 4M5GA 4X66F 4WCEQ 1F0XA 3CCWA 2N3OA 3W2WA 3TJAA 3AJDA 4J9KA 1FD8A 3QQCD 4U67Q 4LF9J 2ILZA 3B8HA 4MIWA 4MMOA 1KP6A 4JI2J 3E51A 2O66A 2YH1A 4F50A 4OV1A 2L9DA 2DO0A 5D0HA 4K5SA 3AOCA 1GX6A 1H7XA 1T9TA 4USVA 1S1XA 4PXDA 1AYEA 4M5LA 4ES3A 3H5YA 5C7PA 3ZZOA 3DLKB 4OJHA 2OEMA 4YUDA 3CD6S 1FWPA 4C11B 5K8PA 2XQCA 3EWGA 3GSDA 4O3RA 2HVZA 1N5TA 2V4QA 5L46A 3PEHA 4K4ZA 3ZTRA 1BHNA 3VGUA 4CLSA 2DRAA 4DR1F 1FKPB 4JP8A 1TZ0A 2C3PA 1C0TB 4QWEA 5B08A 2YNGB 3C16A 3RRGA 4F25A 1HHSA 4N8NA 5AE1A 2MQ8A 3QAUA 3MAHA 1SL2A 3KK1A 4HYKA 1KONA 4I69A 2FVSA 4OZ0A 3ITHB 3W5YA 3I0RB 2FVPA 2IBOA 3VVTA 1YJWS 3RG6A 3SV4A 4YFUA 2J0WA 3NXZA 5SUHA 1CLFA 2QSFA 4UZBA 4ZJQA 3EXYA 4QIWD 1S9GA 5IWAF 1DTTB 3TZWA 4WKRA 3FMWA 3PHTA 2R7RA 5D6GA 4DF8A 2DH9A 4PYDA 5GAGI 4LFCJ 3CJ3A 4WFZA 4QBUA 4YEAA 4M5JA 4EZ9A 3CVKA 3DMJB 4DJBA 4AT1B 1A9NB 1Y5LB 2G9OA 4USHA 1FHTA 3CIZA 5KFSA 2L41A 4K59A 1H3DA 1EHWA 1CJUA 3PR4A 5E7OB 1UVNA 4DX6A 3O3LA 4OJ3A 2A2DA 1S48A 2H48B 2CG4A 1JLCB 3IBFB 4Y6IA 1HWIA 3ZTSA 3DDKA 1ZA2B 3PCOB 2Y9HA 4IR9A 1HFEL 3ONQA 5L1KA 3FSIA 1FKPA 1KOOA 2VV5A 2YNGA 2UVVA 1MMNA 5HATA 4W90B 3FZBA 2W9BB 4WU3A 4N7TA 3QYYA 3NGSA 2AYBA 1H2TZ 1LOUA 4LT6A 5C5JA 4UOHA 2E9RX 3FBFA 3WC0A 3EX7B 1PJ6A 2OFHX 1PCAA 2BVZA 2IIHA 4ZP7A 1P1LA 3ITHA 2MQPA 2DNKA 4IUFA 1YTYA 5D0RA 3Q22A 3HX9A 4NLDA 4IH5A 4F4ZA 5ETQA 2ZE2A 3HSZA 2FJDB 1HNXJ 4OIXA 3GIRA 1XR7A 2IA0A 1A0OB 5FIIA 2EKNA 4JI3F 3ZTQA 3MM9A 4DR6J 1XN9A 1VLYA 3QAEA 2VPZB 1F2HA 3LALA 3GPAA 5I3PA 5KFTA 1RWMB 4B9SA 3BKUA 4P74A 1JIHA 4J9NA 4MIAA 2FPHX 3SCKE 3N5FA 2HHWA 1HA1A 2H51B 4O3PA 4TLQA 4XK8C 3DM2B 3ZTPA 3G8TA 2GQQA 2R4FA 2B5JA 4TY8A 2RVJA 2OPRA 4CO1A 4AL5A 1IR2A 1S97A 1KQGB 1PAUB 3B78A 1FVQA 1X4GA 1YDLA 2HAFA 2ZZMA 4GRSA 2GGPA 1VC5A 2ZHBA 3SMZA 2OAUA 3MPWA 2NPFA 5BR8F 3QRQA 2B3TB 1UL3A 1RT3A 5EX0A 4NXNF 2I0XA 4XO0A 1GNKA 2M8DB 1OSCA 1IR0A 2VFSA 3KK2A 3FSYA 4OZ5A 1FK9B 3QFWA 3M2UA 2WZ1A 1MMLA 1O51A 4FVCA 1NKEA 3GJQB 3SQGA 4DR2J 5D8HB 2ASDA 3OTCA 1KVJA 5KAKA 2AV5A 1XC9A 4QQBA 2EC0A 3W8PA 1OIAA 4QYRA 2UXBJ 1QE1B 3HSGA 1RTIB 4WYLA 4EI2A 1NSPA 3PW4A 3ENWA 3PYDA 2QV6A 2XS2A 2FJVA 4JI5F 2CADA 4M5IA 2DNGA 4PWUA 4JI1F 3OHBA 3WX4A 3HHLC 2C2ZB 2NR0A 3BEGB 3MMCB 3S01A 3IRXB 4ECVA 1BY9A 4ZK7M 3AHPA 4FF4A 2OMOA 1V9OA 1FESA 5KG0A 1XEZA 2R7OA 3M05A 1N8RT 1WACA 2KN4A 1TELA 1FRKA 1PAEX 2B4VA 4DPXA 2ZBQA 3RBZA 4F26A 2Z57B 3SSQA 3TZZA 4FDFA 3HHEA 1KKHA 2YQ1A 3N9UC 1K0TA 3TAPA 2H5JB 2HYIB 2KVQE 4KHPJ 3EJMA 4ITSA 2QMXA 2ZH4A 3KJVB 1JX4A 5GAEU 3R6LB 1M5OC 1AXQA 4ZPDA 4EU0A 1DHMA 3JSYA 1U1KA 4I6YA 4RNOA 1EQMA 1Q4RA 4QIGA 3H4DA 5HP1A 3I87A 3GFYA 4QIVA 1TAQA 2PMHA 3L3CA 3OFHA 4YDXA 3H7HB 5KT4A 3GFZA 1TMJA 1SBRA 2HVEA 3TOQA 1QVGR 2CUYA 2YPZA 5GADU 3IS9B 1OO0B 3P45B 4Q44A 3LGNA 4URQU 4JI0F 3QGPA 1QTNB 3FEYB 3KHGA 1ZBTA 2W2PP 4LF7F 2BJEA 4UOFA 3LP1A 2E7WA 2ROPA 2RQKA 3PYEA 2LCWA 2J7KA 3B4DA 4I2PB 1R8CA 1ZH5A 1SJFA 1BD6A 4NPOA 3BB5A 1FJGF 1JLQA 3I5CA 2M5YA 3RBXA 1RTJB 4DL6A 3I0SB 4HI1A 1U4BA 1ZM2A 1TTHB 2KTQA 2V50A 1EP4B 4NA1A 4TXSA 1PGZA 2QFJA 5F8IA 3BGFA 2UVUA 4LMZA 2KT2A 2VD3A 2HWHA 3M6WA 2XYHB 1IBLJ 1M1GA 1T7PA 2AWZA 1AZSA 5ETVA 1FT8A 4WU2A 2X1AA 4LVOP 2WAQD 4KGZB 3TRGA 1KDNA 3CJKB 2LDYA 3TANA 6FDRA 1IBCB 1IKXA 1D8ZA 3HCXA 5AJ3J 1LV5A 1SC1B 2ZUGA 1V5VA 4K4TA 1S99A 4PWWA 3N5BA 2BQRA 4UY85 4NL5A 2IC3B 2APOA 4B3MF 5KFXA 3M8WA 2EXUA 1GMWD 4IG0A 4CP5A 4ZPAA 4DR3F 1YRUA 4YHHF 2A10A 4Q0BB 1N48A 5D3GB 3SFGA 1LXJA 3MM8A 3G82A 2ROGA 4YY3J 4OZNA 2MPUA 2VQEF 3T3FA 2IA6A 4MIBA 1URNA 4MH8A 4DF4A 2W01A 3H8YA 1CEZA 5B0BA 4DV6J 2CJQA 4ZLPA 2LLZA 4K4UA 2RQCA 3PW2A 4ES2A 2DGWA 4O3OA 3FZ2A 2YKMA 2YWGA 3T19A 2XMVA 5GMEA 2BW2A 5EUHA 4ZKAA 4IFVB 2KYZA 3VHQA 5FLXU 4LF8F 2UVWA 1HI1A 2DPJA 2HZAA 3QT8A 2KU7A 2KXNB 4DFPA 1S6OA 4EFAC 5D4NA 1QD1A 1MW7A 4J90A 3TA0A 2CFXA 3DOLA 4EBEA 2MY8A 4ED2A 4QWDA 4ECRA 5KFYA 2IDLA 3H20A 1B64A 1RT1B 1S7HA 1LQ9A 5DETA 5JVHQ 3C15A 1FJEB 3UDCA 4BC9A 4TQRA 3OVSA 1RTHA 3O44A 1SC4B 5KFEA 2Y1RI 2FZKB 4C0OC 3PO5A 2FHKA 3GWCA 1HW8A 8ATCB 3ENQA 2VG6B 3PFOA 5DLGA 3M8PB 4ICLA 2FC9A 2ZJRQ 3KWMA 4CLYA 4NE9C 2YVSA 2J76E 4CLLA 1G7CB 1M0SA 2EVZA 5F0UA 3MHYA 4DL7A 4QR1A 4OZ3A 2F63A 1EB0A 4W92B 1RU2A 1FEHA 4ZPCA 3NP5A 3OR1B 4MJKA 3WBZA 4RPFA 4BHQA 3ADAC 2E44A 1JNZB 1CPZA 2HBZB 1BUXA 1EIYB 1NU4A 1IKWA 3BO2A 4KPCA 4P6QA 1GMWA 4X65J 3MFHA 3GYGA 1RKJA 1KR4A 1FKAF 2FLOA 5HBMB 3G96A 4DG1B 3KYLA 1HWLA 3BSAA 3MAAA 4QR0A 3PYGA 3AA8A 2HK2A 3HD2A 5KG3A 2G0IA 3WQPA 2Q43A 2ZJPQ 1YX2A 2DR7A 4HHJA 4DV1F 1U6ZA 2W4PA 1RKIA 1HL6A 3HZEA 4GMKA 3IMQJ 2MSSA 1IN0A 2MQMA 2YPYA 3OL9A 4OHWA 3T1YF 4CM0A 2Z8QA 2P9GA 2V69A 2KH9A 4PAAA 4X2BA 3N01A 4J5OA 3C3LA 3C6TA 1BQMA 2PT0A 3MM6B 4DCPB 1D1UA 4RW7B 2EC2A 4ZPBA 3D28A 3UFCX 3K5PA 1NPPA 4LF4F 1C1BA 3GCXP 2J8SA 3CMQA 1UW4A 3PKMA 2G2OA 1N5QA 1FFWB 3HVTA 4TNOA 3BN4A 4FZVA 2HFOA 4IKAA 1S49A 3UR0A 1FXDA 3MMAA 2UUCF 4CO3A 2DR8A 3OSPA 2CG8A 1FE0A 3QGIA 5E3CA 1JKHB 1JJ2R 3NGUA 4J9SA 4WTOB 2KJVA 2AHOB 2HVDA 2QL5B 3L7UA 3MTJA 4WF9Q 1LWFA 2FGOA 1J27A 3OW2R 4U95A 3JQKA 4Q5VA 3OFGA 2DXDA 2AYEA 2B0GA 3R7SB 5K9FA 2I1RA 5AXLA 3JQMA 4DSJA 1U1MA 3B6BA 4O4GB 4LFAF 1Q81T 2JOQA 2BW7A 5D0GA 3UI3A 1RHMB 2ZVIA 3ELHA 4TQSA 1S1UA 4MFBB 1HR0F 1Q0NA 3MR7A 3J7ZT 1JLFB 3O5TB 4KTQA 2ZOFA 1VJWA 1T8EA 4TYAA 3PHEA 3CJQA 2RT3A 1E6VB 4F0MA 2VBYA 4IFYB 4FNIA 2FHJD 3VALA 2DHSA 4GVLA 4OX6A 4N76A 2I5JB 5GMDA 1RT5B 2B9YA 4WXOA 3RR7A 2FJEB 3AB4B 4CLUA 5IM0A 3R27A 2YKAA 1K9MT 1TV6B 2VF3A 1S1WB 2ZD1B 2Z58B 4K50A 5EWFA 1XIQA 3FEZA 3I55S 2HLUA 4DR4F 2VOPA 4NMXA 1NB7A 3VAIA 1SJRA 3QZ8A 2RDIA 4ELVA 2VPWB 2PMWA 4Y2KA 4PEOA 4DCJB 3HSDA 4PG5A 4DQIA 2WVBA 1KNZA 1M5HA 5CZVA 3KKFA 3TQEA 2NUHA 4NLSA 3U1LA 1RTDA 2U2FA 4WIQA 1YRXA 3H5XA 4KKOA 3H25A 2NSBA 1DQAA 2FIUA 3DXSX 2C3YA 1S0OA 2VC0A 3BBCA 1VRQC 2LQ8A 1ZYQA 1FWLA 3IBCB 3X1LB 2WSEC 3IRWP 1PYOB 4MFBA 2L3MA 4OLPA 5IOLA 1TVRB 4OX9J 1RHRB 2HS0A 3PNIA 3DLLQ 3CD5A 5I42A 2HNYB 1GT8A 4QWAA 2XWXA 4MT1A 2VASA 2ZM6F 2Z30B 2BMBA 3MOZA 3FGVA 2HBQB 2HK3A 2YXLA 2I5JA 2CPIA 3AOAA 1SJ3P 4B3OA 1SUQB 1CS4B 4IOAQ 3FBCA 1SKSA 1SV5A 1U48A 3D5MA 4CLKA 3FQKA 5J1EB 5HI7A 1R8AA 2Z56B 1KVKA 2RE1A 2YBVA 2ZDPA 2GS8A 3SFUA 2VUGA 4NYPA 2KG0A 2XMUA 4A48A 1RQ0A 3V81A 2YQ3A 4C4WA 1EKSA 2ZVSA 2BKOA 1Z4UA 4MKVA 3EMTA 2BKPA 3M7VA 2DEIA 3AQOA 3HPOA 1VQ6S 2RNEA 1WKKA 3CCVS 1NK4A 2AZ3A 3CO9A 2PMZD 1FERA 1IJFB 2V8PA 3FBEA 5IWAJ 2B9EA 2B7CB 1UFLA 1MMDA 1RWVB 2WHOA 5A8RA 5F41A 5KG4A 5KFBA 4OQJA 1WHYA 4K7QA 2CQ3A 2K06A 2D9OA 3BGLA 3EUNA 1WC0A 4HT5A 2YKPA 1QUPA 3UDLA 2AJFE 1XMQF 3CDBA 2XLIA 1N56A 1U1PA 2Z2LA 5KFHA 2VFUA 1TVRA 2DGVA 1CJTA 2CPDA 1M1KT 4WP3A 2PA3A 1K8AT 2BQUA 1YJVA 1J5OB 3TZXA 3O1LA 4XDCA 5KFAA 4XPCA 1R89A 2YKOA 2MTLA 3JAMU 3QSYB 4LFBF 5T7LA 1IR1A 1HW9A 2M7SA 2DHXA 5BYQA 4KFBB 3E01B 1XBWA 2HGLA 3GB0A 3FVYA 3AD8C 1L3UA 2CJXB 1H72C 1MWYA 4DR5J 1UJ4A 3UNGC 3BYPA 3DYAB 4KT0C 4N41A 1SUQA 5I3UA 3M8ZA 1SCJB 3VF0B 5LSLA 3SZ2A 3QZ7A 4KO0B 4CLTA 1SC6A 2XMTA 1HQUB 3FMBA 1K1SA 4R8UB 1NRKA 1VQLS 3DHXA 2DGSA 5H9EK 1HPZA 3B82A 3GZ7A 4PQAA 5RUBA 3LAKA 4JV5J 3ET6B 3MPDA 3CD7A 2KZZA 3GIIA 3IP0A 2CQ1A 5HQLA 4H4KA 4KIAA 3RRKA 5CYJA 3V4IA 3N6LA 4KHMA 2ILYA 4CLFA 2BOAA 3PDNA 4FBTA 3POTB 4AXJA 2BQ3A 1IBMF 4NZ0A 4L3KA 1RT4A 1UAWA 1TAUA 1OPZA 3Q0AA 1J5OA 1VQOS 4ECZA 1S0NA 2N3LA 2J7WA 3AODA 1WEZA 4L74A 1UEKA 2QMWA 3EE3A 1KTVA 2HHSA 1G1XA 3IR7B 2DNMA 1N0UA 2QL9B 5FDLA 1X4FA 3KLFA 5LSRA 1M5PC 2V94A 2AYMA 1Y9OA 4V19X 2IAJB 3THPA 4OFZA 4B3SF 1ZZFA 3OQ2A 4PG6A 2MDAA 3ZTOA 1F9EB 4K4YA 4DFMA 2OD6A 4U9RA 4KO0A 3HT0A 5EGYA 5BR8J 2DJWA 4LF9F 3PR5B 2HQGA 3W62A 4F8RA 5HMWA 3PJXA 4JI2F 1J5EJ 4R8UA 3PY8A 1VJQA 2CKWA 2DEJA 1HQ2A 2JEIA 5JVGQ 2IY5B 2B6AB 2HRUA 4ZA1A 5THWA 3GG1A 1RT7A 4E98A 3EPIA 3MCOA 1X7VA 2D3O1 2JEJA 2BV3A 1U0SA 2JDJA 3D0GE 1B0VA 3MR3A 1T11A 2BABA 5IV4A 4FF3A 3FNNA 3D6MB 3IGNA 1S0VA 3UR3C 4GC7A 2CRLA 3CF5Q 3OTOF 1TQLA 5CCMA 4K5RA 3W9HA 1U0HB 1LXNA 2JEFA 4RNFA 3UN5A 2PIIA 4JI5J 2PA8D 1FDNA 2LXFA 4B9LA 4JI1J 1KC8T 2RIJA 4NEYA 3MI7X 1HNVB 1TR0A 3CC2S 4NX9A 4ZCMA 4P7TA 3H42A 2MLZA 2IAJA 5AXKA 3IG1B 2CPJA 2UUBJ 2VDHA 4LF5J 2FLNA 2UV8A 2WVFA 1NXIA 4UUXA 2YNFB 1PILA 2ZDOA 5KFKA 4ZPVR 4CH7A 2NREA 2IYIA 2ZEJA 2MZQA 5KFQA 1QDUB 2E1RA 1RAIB 3R9LA 3EVOA 1UJ5A 2WOMA 2XYGB 2BZ2A 2B4UA 1ZTWA 2LQ5A 4LFCF 4ED4A 1FDDA 4RL1A 5C2CA 3MMBA 3CPWR 4J9LA 3EVWA 3BH6B 1R27B 4RW4B 3KFWX 1N4LA 2UXCJ 1Q53A 1LWEB 5D4LA 1F5AA 1U7LA 1L3TA 1KOHA 2LP4A 2R8KA 4NOHA 1YITS 2W4CA 3MEEB 1HQEB 2DH8A 3N0VA 2I38A 4MK9A 3BO4A 3TX8A 4ILRA 2XGQA 1T9XA 1P27B 3CXCR 1CQNA 1MNEA 4K0KJ 3OR2A 3QIDA 2XSFA 4A8YA 4OYMA 4ERDA 1WF1A 2AEJA 3I82A 3RBDA 9RUBA 4IDKB 3RU0A 4LF7J 2BKNA 2UU9J 3M8QA 3GONA 3UE2A 3LP0B 3CEDA 2OGUA 2I9SA 2BBEA 3DLGA 3MD1A 2Y0BB 4ZVUB 1FA0A 1KQSR 2V4JB 5J2QB 4JOUA 3IG1A 2F9DA 1MWZA 2RRBA 3CJ0A 2GO8A 4Y00A 3C2PA 4OV6A 3CJSA 1N88A 1DY3A 3HM9A 2LXUA 3LOUA 4KB7A 1HNXF 3W9IA 2C42A 3M9MB 1SQGA 4PRFA 4DR6F 1RWWB 2JSXA 3LGHA 4B9NA 3HLUA 3K5OA 1ZAVA 3FKBA 3OXLA 3KLHA 2MEWA 2GQCA 3JB9k 1IBKJ 1RB0A 2PE8A 4R0JA 1F2GA 2AX1A 2NXJA 5CAAA 1NJIT 1F3VA 3MEDB 2IVYA 2R2RA 3D6TB 2HQ3A 4OX8A 4DR3J 4A8XA 1U02A 3HFKA 1DTQA 1TKZB 4K2JA 1F9HA 3RGIA 1DARA 2FC8A 5KFRA 4QU7A 5KG7A 2Z4PA 1H38A 2HKEA 4ER8A 3HO1A 2AJ2A 4MKAA 3K8WA 3ZZZA 1DLOB 1U1OA 1UWBB 1RHUB 4WFNQ 4TU7A 3KHLA 2HNDB 1ZAWA 3V6KA 3HVAA 5KG1A 2MJNA 1MU2B 5MAOA 1CC8A 1OSDA 3OL8A 1VCTA 1HMVB 3Q89A 1ZOTA 5DG8A 5HAOA 2BXJA 1PIEA 2CVEA 5HJYA 2HBRB 3N6MA 5G4DA 1HLWA 4P2SA 4LF8J 4X62F 2P9EA 4WP8A 2Q3PA 4GVBB 3DI6B 3TJ8A 4NLOA 1SB6A 5F8NA 1GQEA 1OQ3A 4PCQA 5CYQA 3PJWA 2CWXA 4DR2F 1X9MA 2ZH5A 2L9WA 2QLXA 2CAJA 2UXBF 2GHVC 5B0FA 3TR5A 2G0JA 4HACB 3AH6A 1RWOB 4DV3J 4XPEA 1O8BA 1F1BB 2CJ9A 3BGRB 2COLA 3DGPB 1YZ7A 5FLXY 1D9DA 4OYWA 3R3TA 3M1VA 2WBRA 3C14A 3MEKA 5K8NA 3OT9A 5D0EA 4H4OA 3LWMA 2DTJA 1NDCA 3UVJA 3MXHP 2CPFA 2BR0A 1FRMA 2RMLA 5DJBA 3W65A 2PO4A 1K44A 3H90A 4O3SA 3T41A 3G6ES 3L7PA 2BJ1A 2DRDA 4CWBA 1JLAB 4G1PA 3ETMA 1VRTB 2JH3A 2H4WB 4NLRA 1RT6B 2R2SA 1QAJA 3VQTA 2V2QA 4J9VA 3UN3A 2B4PA 3MD3A 1F3FA 3MFIA 1OWXA 4WFAQ 2J9EA 1BE4A 4CLWA 1O0PA 1HWUA 5KFDA 2ZHAA 1FRIA 1U6BA 2MB0B 1YK9A 1FF2A 3DRYA 1NDLA 4Z37A 4OX7A 3VGVA 1HWJA 4AFFA 2DNRA 2QYCA 4OL8A 1H98A 5LMUJ 1VI7A 3W3SA 3HZGA 1WC4A 1NPKA 2GVDB 3M2VB 4RNHA 3QGGA 4YB6A 3M30B 2BA9A 3ETOA 2G1DA 2LDIA 4YDDB 3DRPB 4LREA 3UCZP 2LA4A 4I1TA 4L72B 1TKXB 4ED3A 3D1HA 2DIVA 5C24A 2L9NA 1EETA 1LWXA 4FS1A 2MMYA 2MGZA 2OLWA 3NGKA 3PO4A 3Q8UA 2N7CA 3VCDA 1WF0A 3NCPA 5KOXA 2H4YB 2YX1A 1SH0A 3CGIA 3IM8A 5KFZA 1HWKA 2NLWA 1Y0HA 1R3NA 2HIYA 4JB8B 5LSOA 2XMKA 2KT3A 5CQGA 4B9MA 2CA9A 4H4MA 3SI8A 2VKZG 5DDOC 5IFMA 2N4CA 2X51A 3KLVA 5IC4B 4DR7F 2J0SD 2WONA 2XI3A 3WIUA 2OMLA 3Q8SB 4NMLA 3A12A 1RADB 4PXBA 2AGPA 1UPMB 2RKIA 3BPSP 3MURP 4TYBA 1NDPA 3BBFA 3BH7B 1IBLF 4IYQA 2BEFA 1VOMA 1JQGA 4DMZA 1IKYA 5EWGA 3DOKA 2BM0A 5HANA 3DLHA 1S12A 2E5LF 1GTHA 2GVDA 4FKYA 1C0UA 5AJ3F 3QMQA 5LJ5Y 2W1BA 2AEMA 1U8WA 1P9QC 2IDEA 3DRPA 2KRBA 2UUCJ 5B0EA 2MZ1A 3UDEA 3Q23A 4ED0A 5K14B 3U7JA 2VDIA 3TP2A 2CJAA 2QIFA 4OI3A 2C3UA 2EFOA 4YY3F 2HPUA 3R7NB 5CD4H 4E8UA 4CT8A 2Y1JA 2EFVA 3QJPA 2HFNA 1VQPS 3TVYA 4LSNA 4DV6F 1UEVA 1NMEB 4ILMA 3KJFB 3DN9A 4USIA 1YBTA 3WZ0A 2XMWA 3TNVA 2E29A 2BM1A 3AXKA 1RWKB 3EXCX 4BWMA 4LSLA 3FFIB 3OTBA 2WBMA 2XY6A 4NRUA 5C25A 1PBUA 4G1QB 4CTAB 1VQ4S 2VB6A 4DDFA 3QO9A 1LW2A 1GFWB 3D1OA 1FTRA 3I6PA 4TKTA 2QTWA 1VBXA 3TYTA 2JHEA 3BM7A 5E0OA 5LXRA 3NOCA 1P9YA 1V3SA 4AD6A 4AUKA 4RW6A 4RBTA 4Y2CA 5DZ6A 2IJNA 2C22A 2YKNA 1KLMB 3ZO7A 1E6YB 2RF2A 2MSTA 2XCAA 3VZIA 1TFWA 4GO5X 5ETKA 3A3PB 4JI7F 2JNJA 2HS3A 1N6QA 2HVHA 4ZN1A 2H65B 4CI0B 1EARA 1FTCA 3CNQP 2WTFA 3OL6A 3SYZA 3AAWB 1YI2S 4ED8A 1T3OA 3R6GB 3PZPA 5HSPA 2JLFA 4K4WA 3QLHB 3BV8A 3VAJA 4CO0A 1D0EA 2F9JA 4P9SA 1RU1A 4MYUA 2AJ0A 1RWPB 4ZVFA 3PW7A 2XG8A 3R5DA 2GX8A 1FO1A 1OS5A 1SIZA 4JI6F 4J37A 4C9DA 3PFEA 5F0WA 3D4JA 2VPYB 1CJVA 1T05B 4USUA 3OV7A 2VC1A 3H2VE 2FZCB 1FX4A 1REVB 1JLEA 2XO7A 5F9NA 2V8VA 4QW9A 2PSZA 5GAHI 3UCUP 5AT1B 1R6YA 2ZM6J 4NLGA 3KTQA 2OEJA 3RB4A 4HHUA 2QX0A 1R43A 1RAHB 2O01C 4DZ6A 1HNIA 2V9KA 3S7RA 4F2SA 1NM2A 2BRKA 1G6BA 4ECXA 1CULB 1DFDA 1JJHA 2AMCB 4ZOSA 3QFHA 1S9FA 3OVBA 5D77A 1XERA 2CYYA 2KXFA 3D1QA 3G2XA 2IBKA 3UWTA 1H73A 2IM3A 2OI2A 2GZOA 1YBUA 2JRSA 1YVFA 2HNZB 2CWKA 4Y2MA 1D9AA 1BC6A 3Q2TC 2HBYB 2AIRB 1C2PA 2HAIA 5HLFA 2DGQA 2A6OA 4RU2A 4J91A 2DR6A 5KTQA 1RYSA 2HMIB 1UCNA 5KFPA 4NI2B 4FNHA 2FVRA 3L09A 3MTKA 5HVHA 4RW8B 1OJ4A 3DXBA 3NY0A 1DBDA 3OXFA 2W4DA 2VG7B 3MR2A 2Y0SD 2Q66A 4UT4A 1B0TA 2DT9A 2R42A 4DU8A 3K5LA 1VQ5S 1B99A 3GJSB 3MEGB 1JK9B 1F9FA 4P10A 4LRDA 1QAYA 3L7OA 4DSEA 1QVFR 1W7WA 3LH2S 2EFQA 4DV4F 1NUEA 1NK6A 3MM7A 4OYZA 1YG0A 3EM1A 4XIUA 2LYVA 3FCWA 4USJC 3LTOA 3VWSA 4A8QA 1HNWJ 4IOCQ 3W2WB 2KG1A 3T5KA 4ZJOA 3R7BB 1TKTA 2E9ZA 4AE5A 1AUSL 3FC9A 2VBWA 3QBCA 5HK4A 3MM5A 5CYMA 2YNHA 3VQSA 2IM0A 3JAMY 3V4MA 5KG6A 2DB1A 1CQMA 2AYGA 2HHXA 4UZCA 4ANCA 3IAS9 3RJMB 2JC1A 2Z2ZA 1TL7A 4U8YA 4ATNA 2D74B 3V2UC 3TX0A 1S1XB 2W2MP 3M6XA 3UNYA 2DGTA 1D8YA 3SEOA 2HMIA 5K8MA 2QMUB 4FKXA 3PXGa 2GQ2A 4RR5A 5KFFA 2XZDB 3QPIA 1WHWA 3DRXA 2R7WA 2H9ZA 1HARA 1UWAA 4LIRA 4UW2A 1S6QA 2HSEB 2FB0A 5KFCA 1HBOA 3GIJA 2IVFB 4F3QA 3WIVA 3VAMA 3U27A 5AXNA 3C16B 3LPYA 5IT0A 4DLEA 2CQHA 3K5MA 4C8YA 2IYGA 3J7AN 1VIOA 1SIWB 4JV2A 4EO6A 1JMTA 2RH3A 3PJ9A 5HJXA 1T95A 3KUEA 3KK1B 1N0VC 1VK8A 4DV7J 2W24A 4N56A 2QA4S 4KAIA 1NSKL 4A8WA 2MJUA 4P52A 4IR1A 1N33J 2FLLA 5C2GA 3PRBA 2ZH7A 4NCGA 3G6YA 1S9GB 1KHWA 2R2TA 1ZPWX 5U47A 2OUGA 4CO4A 4DUTA 1NHUA 2EWHA 1RHKB 4M1KA 3CCRS 4QWCA 4D3HA 2R2UA 1CSJA 3R97A 4ELTA 1UJ6A 2K2PA 1OY6A 2BX6A 2A3JA 3JXOA 4HLBA 4OX9F 2WVEA 4I6WA 2M70A 3JTPA 1LW0A 3MGJA 1FVSA 1CJUB 5KT6A 2A1BA 2KRRA 4NA2A 1RT2A 1WC1A 3T6BA 2I8EA 1UVMA 1TL1A 3HD1A 4ZJLA 4NCAA 1OY8A 3PX6A 1ZAXA 1JB0C 1VRUA 8AT1B 1WG5A 4YS2A 2VJVA 2JJ4D 2OPQB 4YN3B 3GE9A 2FDNA 1LWCA 4EBDA 4J7CA 3OTOJ 3TWZA 2AX0A 4X4QA 2ACYA 2QN6B 3ZXWA 5F8JA 5B0CA 2V34A 3LUYA 4R25A 3QJJA 4X64F 2RU3A 1K73T 3GIMA 4USTA 3MUMP 1W2BR 3U02A 2P8IA 4ZVSB 1CVJA 3Q86A 5HL7Q 2KHDA 1RAEB 2HVIA 2ALYB 1S1TA 2DXEA 4MKBA 1TMMA 1X9SA 5J1NA 3RRHA 3D0HE 3DLJA 3SXLA 1U1NA 3I56S 3EPGA 3HP6A 1EZZB 5H9FJ 1S77D 1RTZA 2V2VA 3W64A 4B3RF 2ZE2B 2W2OP 2E5GA 2VPXB 4ENOA 3MM9B 4GC6A 2DGOA 4L6V3 2M4MA 2UXDJ 3CWJA 4FN5A 1Y00A 4B9UA 3W2VA 2EFNA 2NUUG 1FWKA 1FKOA 1RAGB 4WWSA 2GJFA 2MZJA 4PQUA 5E3RA 3F44A 1IM4A 4K8RA 3SSSA 3CCLS 3D67A 4DPTA 4UOGA 5HROA 2B5JB 3AXMA 4TY8B 2OPRB 1FJCA 3WDOA 3QGHA 2NQPA 2V8DA 4DR5F 1LFWA 5CHCB 2OPQA 3M32A 3VGTA 2XULA 2GGPB 2PDAA 1XNRJ 2D41A 2RAQA 1REGX 1LKZA 4DX7A 5H1SV 3PV8A 1U24A 4C8NA 5H9FK 1UP1A 2VFTA 4ZHRA 2E66A 4A8MP 3T5LA 4OZ1A 1JWWA 1YGYA 3PRDA 4Z7YA 1FDAA 3MR5A 4ZIVA 2DIUA 4NZ6A 2BOPA 1RT3B 3I5BA 2D9PA 1AFJA 1Q8KA 1CJKA 3A8EA 4MKYA 1MN9A 4LR8A 5J2MA 1JXVA 1PJ7A 3UO0A 2YNIA 3KDOA 4CYUA 4CNZA 4A47A 2OO4A 3KK2B 4IH7A 4ZCKA 2CNNB 3DLEA 4JV5F 1RXOB 4KV8A 3CIMA 4QCLA 2BE2B 2VFVA 3NRBA 3M2UB 3KG4A 4RBVA 2A0FB 4MK8A 3THVA 3HSJA 1PG5B 3B4MA 3SQGB 1MN7A 4ETZA 2H54B 4P7VA 1WC5A 3IAM9 5DZ7A 1U1LA 3NMRA 4C3LA 3DHWC 3QATA 1M90T 1WF2A 2ZH9A 2F3JA 2KHCA 4RWXA 3PKYA 2PEHA 1PJ5A 2ASYA 2UVRA 3UW1A 3G6VA 1XTZA 1W2IA 4X4SA 1U09A 3KMSA 2X1GA 3OUYB 2DGXA 3PX4A 2H1YA 3PEJA 2DNLA 5E3QA 1PYSB 2LECA 3GV7B 1Q79A 4DV2F 1T02A 2QZ8A 2DY1A 1VQSA 4OJGA 1V3ZA 5F3ZA 4DV0J 1QY7A 1IXKA 1YIJS 1J5EF 2CQDA 3KMQA 2MYFA 1N34J 2IJRA 1ZS6A 2U1AA 3TUZC 3CCSS 4ID5A 2JWNA 4F0KA 1R0AA 2ZKUA 4C0BA 4G1IA 1VQKS 1X5OA 2AD9A 1N5YA 1FDBA 2ZH2A 2CQ0A 2C2OB 3ZZPA 4LUBA 2R8JA 1IKVA 4X62J 2BE2A 4ANDA 1S9EA 2QLWA 5HMZA 1WHXA 3KDNA 4R5PA 1KRPA 2F8HA 3KHRA 3CDAA 3VAFA 1RI7A 4RZRA 1TFYA 1GH8A 4PR6A 3N6NA 5HP1B 4QIFA 4KY3A 1SVDA 2HQIA 2PI4A 2PN6A 1RHJB 4YR2A 2VICA 1BWVA 2JFDA 1WD6A 1NPRA 3G6XA 3TQ1A 2ZUAA 1BQNB 3LP1B 3KUGA 4HEA9 2XS7A 2BJDA 1TU0B 2VFRA 1QSSA 2FZGB 2G0CA 2IPOB 5L1JA 4QR2A 2HHHF 3W63A 3OUYA 3B54A 2UUBF 1Q8LA 3PTWA 1JLQB 4LF5F 4YB1P 4DV5F 3I4HX 4O23A 2VOOA 4NLXA 5I4MA 2XO6A 2JC0A 4DN9A 4UUWA 1LK7A 2HGMA 2ATLA 5CD4A 1AZSB 2CQPA 1X0FA 3I9V9 2BACA 3DGVA 4L3NA 2UXCF 4U7CA 4YP3A 4PXEA 4M8LA 1D09B 1UVKA 1IKXB 5ETNA 3NGDA 4PZVA 4QU6A 4L76A 3W9JA 5HVGA 1RDRA 4Z2XA 3J80U 3MECB 5A76A 4Y3CA 3CMES 4IG0B 2DISA 1NK9A 5DDQC 2C2DA 4GKJJ 4K0KF 3MM8B 3Q24A 1VBYA 3G82B 1V3RA 4DU7A 3RW6A 4C7QA 5LXYA 3MCMA 1MWQA 4FXWA 2V2KA 2G2ZA 5DO2A 1H2UX 4NXMJ 1BQNA 3OJUA 2WK4A 3UD3P 2UU9F 3DOMA 1JJ4A 4KQZA 2ZJQQ 1HBMB 3EGNA 2HFVA 3KNGA 3M8YA 1Z1ZA 2XNQA 1U45A 4MAKA 2YKMB 2GJ2A 4DR7J 3EGVA 1X31C 1VQMS 4YR3A 1SH2A 3VAKA 2XHWA 4TU9A 4DUYJ 4FS2A 3V6DA 3HK2A 4PPDA 4GKKJ 2OTJS 1B7YB 1NJWA 1W25A 1MROB 5J2NA 4OI0A 2XZTB 4B08A 3C6UA 1XK8A 2K7JA 3DOLB 2V68A 2VU5A 2QA1A 3SV3A 1NSQA 1M1HA 1ROFA 1VQ8S 3K8VA 2J6TA 2E5LJ 2W9CA 1EAYC 3C15B 1IBKF 5DQHA 5IC6B 5BJRA 1RTHB 2DNOA 3GLJA 2NPIA 4Q2LA 2MKKA 2MQOA 4DSIA 2CQGA 5E3PA 3KLGB 4K2XA 5E3AA 3MECA 5HMXA 3TAMB 1SI9A 1Q78A 2W7PA 4KRWA 2NYHA 3K5NA 2BUNA 4C8LA 1RHQB 1FD2A 1RYRA 1JNRB 1VQ7S 2E9TA 4EGLA 4ICLB 2LA6A 3ZFVA 2YWHA 2OJ3A 4Z7CA 4B3TJ 1JXLA 1NHKL 4M5KA 3OTDA 4ECSA 3A8JA 4E0DA 4LRAA 3HXMA 2JX2A 4M5HA 2IM2A 1T9YA 1VISA 3L9ZA 1HBMA 3SDEA 5HQ8A 4A4JA 4HH1A 3A4TA 3DRSA 3KK3B 2ALZA 5K5MA 4BCAA 1TKDA 3P5TL 3DRRB 1I51B 4DQSA 2CJKA 1S4EA 1L5UA 1MROA 3NBPA 4DHVA 5E33A 2QLFB 2F1FA 1IKWB 1F5CA 3GYNA 1ELOA 4AQYJ 3NNCA 3D6HB 5T41A 4ILLA 3D3CJ 2ZWPA 1C4CA 4YB5A 2O3DA 3MAAB 3FRYA 4DV3F 3J81U 4ED6A 3ISZA 1U26A 1JLBA 3CD0A 4LF2A 3QT7A 1PSDA 1EQ0A 1BGXT 3D54A 1KBRA 1U8SA 5MLCV 1NJYA 3JSMA 3NAHA 3KLGA 5HN0A 3TAMA 2PI5A 2MZRA 4P2XA 4JI7J 2W25A 4OYOA 2KM8B 4WFYA 3RR8A 3RW7A 4A8KA 1H0HB 3GTYX 1TP7A 1YWXA 4WTYA 2C2KB 2M88A 4XAKA 4I2QA 1FFSB 3C6TB 3RAQA 2OPSA 1BQMB 1L3KA 2OH2A 1RAFB 1X4CA 2P9CA 4DL3A 3GFXA 1UVIA 3KNAA 3JYTA 5J2PA 1R0CB 4FYDA 1CG2A 2POKA 5A0YA 5EHHA 3DNCA 1C1BB 4FYXB 2RHQB 3KK3A 3IFEA 2VG5B 4JI6J 1WHVA 4PUOA 5KFOA 5F3TA 1PBAA 4O0NA 3PIOQ 3DRRA 2AZ1A 3HVTB 4NYZA 1VC6A 5LMUF 1RWXB 1KLNA 4L75A 2YH0A 2EFPA 3UDVA 3CDUA 3TA1A 3VGSA 1RA7A 3NG8A 3RZAA 3MMAB 3NS5A 4ZP6A 1BQXA 3GP9A 4QW8A 4DZDA 4PABA 5T14A 4PKDB 5L1IA 4DL2A 4WK1A 3KJNB 3Q8YA 2RRAA 3FCVA 3GFHA 1LWFB 1AT1B 2J0XA 4MYTA 4LQ9A 3C19A 1CBKA 2F8MA 3FK4A 2OPPA 4IG3B 3BREA 4TLRA 1TL3A 4AL7A 3CDEA 2BANB 3QIPA 5LMNJ 2NCKL 2G13A 4F3MA 2X1FA 1VBZA 4LRFA 1S1UB 3WX8A 4DUZF 2C3OA 3BKTA 1NKCA 1NB2A 3MF5A 3NCQA 4DL5A 1R8BA 1R0BG 4LF6J 1SKUB 3D9BA 3QT5A 2D7SA 2HG4A 1T0TV 1JLGA 1Y11A 4DX5A 4NWBA 4I7FB 5A8KA 1HYSA 1TUVA 1UZHA 1UFWA 2CQ4A 5A2QU 2VG5A 4HDGA 2RU9A 1N52B 2GMHA 2Z2YB 2NYIA 1KSPA 4EYIB 5IM0B 2NZ4A 1ZM3A 4NLPA 3P8BB 4NLYA 4KSEB 4PWDA 4F0HA 2FJWA 3EZUA 1W26A 1S1VA 1YQHA 4EMDA 3A1YG 3D68A 4C97A 4CH0S 1AUDA 4P71A 2HHUA 1Q7YT 2LMIA 2CJBA 3NGTA 1U1RA 4DV4J 1ULRA 4S0MA 2H3EB 3RYLA 1RTDB 2Z0GA 2EW9A 4KKOB 4WYWA 4IG3A 1T3NA 2A18A 1S6PA 3LP2A 2KI2A 2GIRA 2BANA 4WE1A 4RUAA 1WI8A 4QWBA 4M5DA 4AYBD 4RNNA 1XJWB 3V5RA 1Q86T 4EEYA 2QFIA 1KWMA 1QJHA 2IFXA 2YX7A 3NS7B 2P2CB 2JEGA 3PM9A 2LQBA 4DS5A 3C8YA 3W66A 5I42B 5GVQA 4OHZA 3MUVP 3M2RA 4I7FA 3ILOA 2R7VA 2OP5A 1KD1T 3HJFA 1C1CA 2DNYA 4B3OB 2AT1B 2G1HA 5AE3A 4LR7A 4I6AA 2IMWP 2GIFA 1SV5B 1KQFB 4M63A 3KG0A 1UTAA 3EDQB 4OJ1A 3UQSA 1S0MA 3RAXA 1XNQJ 3TZYA 3V81B 3TA2A 2NXUA 3WHIA 1IVZA 4BBYA 2B9WA 1S6UA 4CLZA 4AXIA 1X60A 4ED7A 1UPPA 1I94J 4PXCA 1HIYA 4OYPA
chains in the Genus database with same CATH topology
2XMWA 2EG1A 3TNVA 2E29A 1FT8A 1PO6A 3DC2A 4ZHRB 2BM1A 1IQZA 1A6LA 4WU2A 2X1AA 4LVOP 3EXCX 2WAQD 4BWMA 4LSLA 3FFIB 3OTBA 3KLIA 2LDYA 2WBMA 3CJKB 3TRGA 3HMJG 4NRUA 5A8RB 3TANA 5C25A 5CZXA 2KFYA 5E2QA 2MQNA 1TL4A 6FDRA 2M52A 2X1BA 2C3MA 1IKXA 1D8ZA 4BC7A 4X4PA 1GTEA 1PC5A 4G1QB 2IRXA 3HF5A 4CTAB 5GADI 1LV5A 1VQ4S 2ZUGA 4K4TA 2VB6A 1SL0A 1S99A 4DDFA 3QO9A 4KPYA 2XS5A 3N5BA 2BQRA 1LW2A 2HFZA 5J2MB 1VK3A 4UY85 3D1OA 1FTRA 2EKYA 2YNIB 3I6PA 4TKTA 1UETA 3NCRA 4NL5A 2IC3B 4JI8F 2APOA 1VBXA 4B3MF 5KFXA 3TYTA 2JHEA 3TW0A 4DX8H 4TN2A 1HNVA 3BM7A 5E0OA 3THTA 5F8MA 1P8GA 5FD1A 4IG0A 5LXRA 4ZPAA 4DR3F 1YRUA 3DLEB 4O3NA 4YHHF 2R8GA 2A10A 2MQLA 4Q0BB 2R7QA 3I5AA 1N48A 4KV8B 4UY8T 5D3GB 1SXLA 1V3SA 3SFGA 4AUKA 3VAHA 1LXJA 1FCAA 3MM8A 1VQYA 1B0PA 2ZH6A 5D4OA 4DQRA 4RW6A 3HT3A 2R9LA 3NL0A 5ADZA 2ROGA 3T5JA 1TK5A 4RBTA 4Y2CA 4G3IA 4OZNA 2MPUA 3VR1A 2IJNA 2VQEF 3T3FA 2VA3A 2XZWA 2J9CA 2YNFA 4AL6A 2IA6A 2C22A 2YKNA 2KJWA 1KLMB 5GAHU 2WB4A 1E6YB 4MIBA 4M94A 1URNA 2RF2A 2MSTA 1H2VZ 1QAXA 3ENVA 4MH8A 4DF4A 5T7LB 2XCAA 3VZIA 1WEXA 3H8YA 1R7IA 1TFWA 1CEZA 3CCZA 4GO5X 2E7XA 2MKCA 5B0BA 2F4VF 4X4NA 2EK6A 2CJQA 4JI7F 4ZLPA 2LLZA 2HS3A 1N6QA 4K4UA 2HVHA 3DLKA 3T6JA 5I3UB 3NKYA 4CI0B 2RQCA 1CC7A 4BWJA 3PW2A 4ES2A 1FTCA 4C11A 2DGWA 4O3OA 2WTFA 3FZ2A 2YKMA 1X5PA 2YWGA 3ZZRA 3T19A 3OL6A 3SYZA 3Q8PB 2XMVA 3AAWB 2BW2A 3CJ2A 5M2PA 5EUHA 4ZKAA 1YI2S 3G9CA 4ED8A 4RW4A 4IFVB 1T3OA 3IR6B 4Y2IA 2KYZA 3PZPA 2JLFA 2C2EA 1LWEA 4LF8F 4K4WA 3QLHB 2JVRA 3VAJA 4CO0A 4U7UK 3CC4S 2MKSA 3Q8QB 1D0EA 2UVWA 1HI1A 2DPJA 2FGCA 2F40A 2IM1A 4DL0C 1C0TA 2KU7A 4DFKA 2KXNB 1AFIA 5K8OA 2XMJA 3TVZA 5F9LA 1YRTA 2F9JA 4DFPA 1DRZA 4C8KA 1S6OA 3ZZUA 3BQ0A 4MYUA 2AJ0A 2YWKA 4ZVFA 3PW7A 4N8OA 2XG8A 3MEEA 3R5DA 2GX8A 1FO1A 1OS5A 4EFAC 1SIZA 1HQEA 5D4NA 4JI6F 1HPZB 3OPKA 4J37A 2J0QD 4C9DA 1MW7A 4FXVA 3TA0A 4EUVA 1HHTP