2HNZB

Crystal structure of e138k mutant hiv-1 reverse transcriptase in complex with pett-2
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
422
structure length
399
Chain Sequence
TVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNKTPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Reverse transcriptase/ribonuclease H
publication title Structural insights into mechanisms of non-nucleoside drug resistance for HIV-1 reverse transcriptases mutated at codons 101 or 138.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 109
structure length 399
sequence length 422
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2006-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2hnzB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2hnzB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2hnzB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2hnzB03
1NNDA 4TY8A 1RT5B 1CSJA 2B6AB 3DYAA 4EO8A 5T14A 1RT3B 3OHBA 2FJWA 3NBPB 2W8LA 3MEEB 1FKPA 4NLDA 5KFZA 1IKYB 1KHVA 4RW6B 5D3GA 1W25A 4JUZA 1S9EB 5KFJA 2W9CB 4J9PA 4ED6A 4ED0A 3CDEA 4MFBA 5EWEA 3QO9A 2ALZA 2R8KA 2AGPA 2HNDB 2VG7A 3BQ2A 2JEGA 2WRMA 3CJ2A 1S1VA 1TV6A 4O3QA 4KO0A 3BR9A 5HBMA 2HNYB 5C42A 4WE1A 1S1WA 1D1UA 4MKBA 3QIDA 3LAMA 3V6DA 3C6UA 3MR3A 4WYLA 5KFWA 4EEYA 1TVRA 3IRXB 2FJXA 4EYHB 3MEGA 4DL2A 3OSPA 2R8IA 2GIRA 2BANB 4R0EA 3V81A 5F8IA 5KG0A 3SI8A 4NYZA 1HNVB 4IR1A 3KLEA 4TY9A 4R8UB 3BGRA 4YP3A 2BE2A 3IG1A 4PUOA 4TLRA 2YKNA 5HP1A 1TQLA 1IKVB 4I2QB 1J5OB 1LW2B 3OL7A 1RT5A 4LSLB 3N6NA 2B6AA 5KG4A 2RDJA 3NMAA 4ZHRB 5KFQA 1RT3A 1I6JA 4KAIA 3RB4A 3NBPA 4LSNB 1RT2B 3MEEA 3KK1A 4OL8A 4Q0BB 3CJ5A 2BQUA 2XGQA 1IKYA 3RAXA 1S9EA 2QV6A 4ZVHA 3M9MB 2W9CA 4K50A 5C5JA 1JLAB 4WFXA 4QWAA 1C1BB 2AGOA 3GV5B 2ZD1B 1RTJB 2HNYA 2CKWA 4WZQA 3UR0A 4F4XA 2ASDA 4FBUA 3KLIB 3OHAA 5DQIA 1S9GB 2HAIA 3KHGA 3RBEA 2WK4A 3IRXA 5FDLB 1TKZA 4EBDA 2JLEA 2V0NA 2HMIB 5DG9A 3PJWA 4M95A 1DTTA 2BANA 2IM2A 2IM3A 2VA2A 3PR4A 3Q8PB 3QLHB 4R8UA 3T5LA 4ECSA 4FBTA 4B3OB 1IKVA 4I2QA 1J5OA 1LW2A 2FVPA 1K1SA 1RDRA 4LSLA 1HQUB 3MR2A 4RZRA 1T3NA 3H5YA 3IGNA 4ZHRA 5KT4A 3I0RB 1FK9A 4LSNA 4LQ3A 1RT2A 4Q0BA 4J9LA 2QE5A 5KFRA 5KG6A 4WFYA 4GC6A 5J2PB 3GIJA 1HYSB 5L9XA 4MK7A 3DLGB 1JLAA 1SH0A 1C1BA 4ZMMA 1QE1B 4HYKA 1IKXA 1LWEB 4IKAA 5L1JA 2ZD1A 1RTJA 1GX6A 5EDWA 1BQNB 4ED3A 4NLVA 3KLIA 5HLFB 2JEJA 1ZETA 4NLUA 4H4OB 4ZPAA 5FDLA 4JV2A 4FS2A 5I42B 2HMIA 5KFUA 1R0AB 4NLQA 3BQ1A 1JIHA 5KG3A 5I3UB 1S1TB 3DI6B 1EETA 3IN5A 3GIKA 4J9OA 3QLHA 4G3IA 3GILA 2VG5B 4U7CA 3G6XA 4J9RA 4H4MB 4B3OA 5KFLA 5KT5A 3MFIA 1HQUA 1N48A 3PW7A 5D3GB 2OPSB 1S1XB 3GQCA 5C25B 5EWFA 4JV0A 2YNIB 3I0RA 4K4YA 2JC0A 5F8LA 4KKOB 2W9BB 4IH6A 3QZ7A 4NLYA 2AU0A 4ZPBA 3DRPB 4WXOA 5J2PA 5KFKA 5KFCA 3QGHA 4J9SA 3DLGA 1RA6A 3CVKA 5KFPA 3PW4A 1QE1A 2B5JB 3V6DB 4F4WA 1LWEA 2XCPA 5F9LA 2RDIA 3CDUA 3H59A 1BQNA 5KFTA 2WTFA 3V81B 4FS1A 5HLFA 4Q8EA 5KT3A 3MECB 4H4OA 3T1AA 4ID5B 4URQU 5I42A 4Y3CA 2J6UA 1R0AA 4TXSA 4DL7A 3BJYA 5I3UA 5KFOA 3GIIA 1S1TA 3DI6A 2FVCA 5C24B 4RUAA 3FFIB 4NLXA 2VG5A 4K4XA 5J2MB 4O3PA 4H4MA 3KK1B 4NLRA 3SFUA 2J6SA 4EO6A 5L1IA 5DQHA 2OPSA 1S1XA 2D3UA 5C25A 2YNHB 4XO0A 3NKYA 2YNIA 4KE5A 4KHMA 5KFGA 4Q44A 4MIAA 2R2SA 1C2PA 4ZP9A 3FQLA 4KKOA 3PZPA 2W9BA 4NRUA 2R2UA 2BRLA 4ECTA 5KFVA 4NLOA 3HKWA 3DRPA 1RTDB 3I5CA 5J1EB 1RYRA 4DL5A 1JLEB 2UVRA 3DMJB 3KLGB 3V4IB 2C28A 3M9NB 3H5SA 3KJVA 1RAJA 2V9WA 2B5JA 3T19A 3NAIA 4MK8A 1TKZB 1SH2A 1DTTB 3KK3B 3KHRA 1HNIB 3MR5A 5L1KA 2C2RA 3BREA 4O3OA 1S10A 3HVTB 2UVVA 2AGQA 3MECA 3SFGA 4ID5A 1UWBB 5DLFA 3DDKA 3MTKA 4DL3A 2FLNA 3EPGA 3I5BA 2ATLA 4O3SA 3V6KA 5C24A 3FFIA 1RT4B 4Q43A 3G86A 4IG3B 1FK9B 5J2MA 1JKHB 2HWHA 2UUWA 3Q8RB 2R8GA 2GC8A 1YVFA 4RW4B 1TP7A 2W7OA 5J2NB 4J9QA 2YNHA 4EBEA 5DLGA 4K4UA 1RTIB 4ICLB 1JLQB 1S6QB 4EYIB 5F8NA 4RNFA 3CIZA 1IKXB 1RTDA 4ZPCA 5J1EA 1MU2B 1JLEA 3TVKA 4Q8FA 3DMJA 3KLGA 3V4IA 2IM1A 3CDWA 1KHWA 3MEDB 2OH2A 3E01B 4WYWA 1C0TB 3NGDA 5KFNA 1S0OA 3H2LA 3DM2B 3BSOA 3PW2A 3Q8QB 1QAIA 4H54A 3GIMA 2DPJA 4DG1A 1KLMB 3KK3A 1HNIA 4IRKA 3D5MA 3HVTA 3LP2B 1EETB 3ICLA 2I5JB 3PJXA 1UWBA 5EWGA 4O4GB 4I7FA 4EBCA 5KFMA 1LWCB 1N6QB 1SH3A 1RT7B 2I1RA 2WHOA 2C2DA 2UVUA 2D7SA 1RT4A 1TKXA 4IG3A 1RTHB 1JKHA 2RKIB 3E51A 3QGGA 4IH7A 3DOLB 5KFHA 4ED1A 3RAQA 4RW4A 2O5DA 3GV7B 3V6HA 5J2NA 4YMEA 4X2BA 5KFAA 3ITHB 1RTIA 4NLGA 4ICLA 1JLQA 1S6QA 2WOMB 3GYNA 5KG2A 2OPQB 4XPCA 3KLFB 4GC7A 1MU2A 4IG0B 1IKWB 3FQKA 3MEDA 4ECZA 1JLCB 3E01A 4ZPDA 1C0TA 4URGA 3OSNA 1DTQB 2IC3B 3DM2A 3KHLA 4RNHA 3VQSA 1S0MA 3KOAA 2ZE2B 1KLMA 2HNZB 2XI2A 3LP2A 3RB3A 3OLAA 2I5JA 4HKQA 3CJ0A 4IFYB 4WFZA 2JEIA 4O4GA 1DLOB 2IAJB 5F8HA 1LWCA 1N6QA 3PR5B 1SUQB 4NLSA 3H40A 1RT7A 3LP0B 1S49A 1RTHA 4O44A 2RKIA 4KBIA 2W7PA 3DOLA 3T5KA 3OL8A 3TAMB 2R2TA 4URSA 3I5AA 5KG5A 3IS9B 4F50A 1EP4B 5DGAA 4ZP7A 1XR6A 2D3ZA 1RA7A 3ITHA 3NL0A 1JLFB 3KMSA 2UVWA 2WOMA 5KG7A 3KJVB 2OPQA 3QGIA 3QIPB 3KLFA 1K1QA 2JC1A 4O3NA 4IG0A 3UPFA 1IKWA 4KFBB 2HWIA 4WXWA 2FLLA 4ZP8A 1TL1B 3DLEB 1T03B 4O4RA 5DQGA 1JLCA 3DRSB 4NRTA 2ZKUA 1DTQA 2IC3A 3DOKB 3HVWA 2JEFA 4QWEA 2ZE2A 2HNZA 4RW8B 4NLPA 2EC0A 1QUVA 4YQWA 4O3RA 4J9KA 3HHKA 4IDKB 4ECXA 2WB4A 1S97A 4IFYA 5KFSA 3H5XA 1DLOA 2IAJA 2WCXA 5KFYA 3GV8B 4IQXA 2XC9A 2ASJA 1IM4A 1SUQA 4IH5A 3M8PB 3CO9A 3LP0A 3N6LA 5DG8A 3TQ1A 2R8JA 1LW0B 4TQSA 4RW7B 1BQMB 3TAMA 4TYBA 4I2PB 3G6VA 3IS9A 4PQUB 1EP4A 3LAKA 4QPXA 4QWDA 2ILYA 5JUMA 5DGBA 4Y2AA 1JLFA 2BR0A 4RNOA 4TN2A 3QIPA 4QW9A 4K4VA 2AQ4A 2C22A 1NHUA 4NCGB 4ZVGA 2XWYA 5KFDA 3OLBA 4KFBA 4RNMA 2VG6B 4DG1B 5KFIA 2IM0A 1TL1A 3DLEA 1T03A 4Y2CA 3DRSA 1Z4UA 1GX5A 5KT6A 3DOKA 3OL9A 2WONB 2B43A 5CYQB 4RW8A 3UDLA 4I7FB 3KMQA 4ZVEA 3HVAA 3LANA 1C0UB 4IDKA 3EZUA 1TKXB 3N6MA 2V4RA 4K4ZA 1HPZB 1C1CB 2FLPA 5F9NA 1S0NA 3M8PA 1XR7A 1OS5A 1XR5A 1SV5B 2XGPA 1LW0A 4MH8A 4RW7A 3CJ3A 4ECYA 4R5PB 1BQMA 3D28A 3KHHA 4I2PA 4KHRA 4PQUA 4MK9A 4NZ0A 3MFHA 3T5HA 3CJ4A 2FVSA 2OPPB 3PW5A 3H5UA 2OPRB 4IFVB 2F8EX 4MKAA 3V6JA 5F8MA 5J2QB 1N4LA 5KFEA 4RNNA 1RT6B 3BQ0A 3OL6A 4NCGA 4K4TA 4IRCA 4KV8B 4XPEA 1S48A 4ECRA 1MMLA 2VG6A 5F8JA 2BQ3A 5KT2A 4KSEB 3FRZA 3JSMB 4M94A 4YR3A 5K14B 2IA6A 4MIBA 4RW9B 4K4WA 4ECQA 4RW6A 3BSNA 1T05B 2WONA 2FVQA 3IGVA 4Y34A 5CYQA 2IMWP 3DLKB 2BRKA 4U6PA 2HNDA 4J9NA 1JLGB 3QZ8A 3H98A 3KNAA 1S6PB 3BSCA 1C0UA 3BSAA 4ZVFA 5KT7A 3LP1B 4O44B 1HMVB 1HPZA 3H4DA 3G6YA 3I0SB 1C1CA 2AWZA 4F4ZA 3PHEA 2YKMB 3ISND 1TL3B 3JYTB 4ZP6A 1SV5A 3PVXA 2C2EA 3NAHA 4DEZA 4TYAA 1JLBB 2BQRA 2IJNA 4KB7A 4R5PA 3UQSA 4JV1A 1HNVA 2YNFB 1LWFB 2OPPA 1N5YB 5KFFA 2OPRA 4IFVA 4QWBA 3DRRB 4G1QB 2IJFA 5J2QA 1RT1B 4Q45A 1ZTTA 1RT6A 1VRTB 1JX4A 1FKOB 4KV8A 5HROB 4RU9A 1S1UB 3JSMA 5K14A 1HQEB 1REVB 5L1LA 5JXSA 2RF2B 1TKTB 4RW9A 2ILZA 5KFXA 4PWDB 5KFBA 3RB0A 1T05A 1ZTWA 1S9FA 2D41A 2E9RX 3DLKA 1VRUB 2YNGB 1D0EA 3H4BA 1NHVA 2CJQA 5DG7A 1U09A 1JLGA 3ISNC 1S6PA 4IRDA 3LP1A 3KK2B 1HMVA 3T5JA 3C6TB 3Q8SB 2V4QA 4NLWA 5KG1A 3I0SA 2AX0A 4WZMA 5CYMB 2XI3A 2YKMA 2FJVA 4NLTA 1S9GA 1TL3A 3KLHB 3JYTA 1WNEA 2J6TA 4K4SA 3M8QB 3MF5A 4QW8A 4F4YA 1JLBA 3MR6A 3PW0A 4ED8A 4TY8B 1S4FA 2YNFA 1N5YA 1LWFA 3DYAB 3LALA 3RB6A 2W8KA 2AX1A 4YR0A 3DRRA 2R2RA 4G1QA 5EUHA 4QWCA 1RT1A 4ED2A 2XCAA 4DL6A 2ASLA 1VRTA 1FKPB 1FKOA 5F8GA 3CWJA 1N56A 1RYSA 2R8HA 1JXLA 4LQ9A 3RBDA 2VA3A 5HROA 3FDSA 3EPIA 1S1UA 4MFBB 4ECUA 3QO9B 1HQEA 1REVA 1HARA 2GIQA 2RF2A 1TKTA 2VG7B 4ED7A 2IBKA 4PWDA 3M9OB 2E9TA 1S1VB 1TV6B 4YR2A 4DL4A 4KO0B 5HBMB 1T94A 4IOBA 3FSIA 1HYSA 1VRUA 2YNGA 3KLVA 5C42B 4WE1B 1S1WB 4J9MA 3C6UB 1TVRB 4ECVA 2DPIA 3KK2A 3C6TA 3MEGB 2UUTA 5CYMA 1QAJA 4TQRA 4IR9A 3KLHA 4ECWA 2E9ZA 4RUCA 3KLEB 3BGRB 3M8QA 2BE2B 3IG1B 3QYYA 4PUOB 2FVRA 2YKNB 5HP1B 2W9AA
chains in the Genus database with same CATH superfamily
4CZCA 1NK0A 2JFDA 5T14A 1N8RT 3OD2A 4IOCQ 4LVNP 3Q8VA 2KXFA 4DJBA 2ALZA 4O0NA 4DR1J 1VQLS 2QYGA 4MKBA 5HQMA 2AKWB 1YTYA 1L3UA 1FEEA 4OJ1A 1Q7YT 4Y2KA 1TTHB 3HI9A 1MSWD 2FYXA 5D15A 2DNRA 2J0QD 1S7HA 3RAXA 1K0TA 1MWQA 4BC9A 2V0NA 1KQKA 1DTTA 3FC9A 3ZZOA 2VA2A 1S77D 1U45A 4I4BA 1RDRA 2J9CA 3I0RB 3FCHA 2UU9F 4JYAF 5ETPA 3KJQB 1EAYC 5JJBA 1TU0B 3FCVA 3MM5A 5LSLA 1P1LA 3W1YC 4WWSA 1NO8A 5L1JA 4ED3A 3N5FA 2AJQA 4HI1A 4DR3F 1YIJS 2BUNA 4RL1A 5I42B 3DI6B 2A2DA 4DU8A 1T9UA 2A0FB 2OPSB 4CH0S 2JC0A 4QOTA 3O5TB 2PMZD 1RA6A 3I87A 3MPVA 2CQ0A 1KFSA 1XMQJ 4NPOA 1BQNA 3M2RB 5HLFA 1Q53A 2VD3A 1VLYA 2LCWA 4DCOB 4O3PA 1CC8A 2OTLS 5DQHA 2CQBA 5KFGA 2R2SA 5IV3A 2HSEB 5I4MA 1GAOA 3CPWR 1RTDB 5J1EB 1LFPA 1NDPA 3GSDA 3MAAA 3D9BA 4U7UK 1EQ0A 2WZ1A 3W9HA 3GLJA 2RVJA 1IR2A 1F2GA 2HHPA 1VHFA 3JB9k 2ZOFA 2YNHA 2CXEA 3OFGA 1FX4A 4NXNF 3TA0A 3RYLA 1M5PC 4M8LA 4WU3A 1HNIA 2GVZA 3BEGB 4B3SF 2VDIA 3GWCA 1B0VA 3EVOA 3LA0A 3E51A 5KFHA 2EFOA 3EVWA 2VQFJ 1TELA 3PDNA 2XHWA 3KNGA 1WTFA 3LW5C 3WZ0A 1RE1B 3UD5A 1JLCB 3TI0A 4URGA 1UJ4A 4X4OA 2RAQA 5CHCB 4DSJA 2W4DA 1KLMA 1CBKA 2FC9A 4WFZA 4IFYB 4O4GA 3FK4A 4RBVA 3OR2A 4CRJA 2CWKA 5HMXA 2K1RA 3PEJA 2OPQA 3DGPA 1UCNA 3RRGA 3MZIA 2AJ0A 3BGUA 2MXYA 1WKLA 2KYXA 3TZZA 2G0JA 4EZ6A 4ER8A 3DDNA 2ZKUA 3VHQA 2ZUAA 1PBUA 2ZE2A 3T9NA 3FCWA 1I51B 2Z2MA 3RRKA 3LUYA 2NSCA 2V2VA 1RABB 2PSZA 1T95A 4RW7B 3ENWA 5LMUF 4PQUB 1FCAA 1R8PA 2B4UA 2G0IA 4K4VA 3R97A 3F73A 4P52A 3IM8A 4DPXA 5L38A 4CM2A 1H38A 3BDPA 3CDAA 2EFVA 4CQ1A 3Q83A 3JSRA 3ZC4A 3R5GA 1OS5A 1RCOB 3QSIA 2BV3A 3MUVP 1LW0A 2YWHA 2BM0A 4MH8A 1ZZFA 4IFVB 2F8EX 2ZH2A 5F8MA 2J0SD 1N88A 2UXDJ 2K3IA 2UUCF 3ZTPA 1C0UA 2HRUA 3ZTSA 2CG4A 1TL3B 4ZP6A 4M5HA 1J5EJ 5JVGQ 1ZH5A 3M6UA 3C16A 4O0IA 2ILZA 4ATNA 2E9RX 2Q3PA 1VRUB 1P1TA 1HWJA 2P9CA 2CQ1A 3KJFB 2L41A 2P6TA 1DARA 3H7HB 1IWAA 1R7IA 1T7PA 4F8RA 1ZA1B 2HLTA 3DRRA 4QWCA 2XMJA 2B9EA 2OEKA 2R8HA 4DV0F 3UNYA 1SCJB 1VLOA 4HR2A 5HQ8A 1NDCA 1S1WB 1RWXB 1DQAA 2QA1A 4WK1A 4PG6A 2MKYA 4ECWA 4RUCA 3LH2S 2HIQA 1FDNA 1RT5B 4X4SA 3K5PA 1SC6A 4OLPA 2M5YA 1FKPA 1W25A 5AJ3J 5KFJA 1S9EB 3Q22A 3CDEA 1VR6A 3CB4A 2HFOA 2CG8A 2VFRA 4CLKA 4QQBA 4OFZA 2W2OP 4QPTA 5IOLA 2NCKL 2DNKA 4EYHB 2IY5B 4NASA 4NYZA 4QR2A 3IG1A 3OL7A 1LW2B 2QA2A 3R2CJ 4FDFA 2BQUA 2XGQA 2EKNA 3ONQA 2F65A 5D4NA 5G0RB 2YX1A 3UNGC 1NKEA 4FBUA 5IM0A 4EBDA 2P6SA 1FD8A 2IM2A 1WSRA 4ECSA 3MTJA 4RZRA 3OVSA 2P9EA 4X62F 1RBAA 3BKFA 4LFBJ 4JV2A 2K7KA 3OR1A 2P5VA 3L4BC 2VG5B 4J9RA 2HFSA 2JL9A 3SV3A 1HQUA 2CQDA 3BKTA 3TVZA 3ENVA 4CLLA 5J2PA 3KFWX 4DV3F 1QE1A 1UZHA 2MGZB 4ID5B 2CJ9A 1S1TA 4K4XA 2JVRA 4JBCA 3DCAA 2AMCB 4KHMA 1FJGF 1U1KA 3PZPA 2W9BA 1XBWA 1MMDA 2UVRA 4AYBD 3LF0A 2MZQA 2V9WA 1UW9A 2W7AA 3BREA 1LXNA 2ZZTA 2DR6A 3EJMA 4DL3A 4KGVB 3HF5A 2MEWA 4WKRA 4DPWA 1TP7A 1NMEB 5J2NB 1FESA 2DRBA 4EYIB 2QSFA 4LRBA 2IYIA 3BYRA 1MU2B 5DDPC 3TUZC 2PA8D 1RSCA 4XDCA 4DV2F 2VOPA 1RISA 3TO8A 2DB1A 3ZZTA 3GIMA 5DJBA 2RU3A 1YBAA 3HVTA 5CYJA 2LA4A 2J8AA 4JI5J 4UW2A 2LKZA 4DV7J 4ICLA 3GJTB 2R7UA 1P9YA 1ZYQA 1VJWA 2PI4A 4LR7A 3I55S 2HHXA 3DU6A 1RKJA 4AL7A 4BDPA 4CT9A 1VIOA 2AYGA 1WC3A 1UETA 2W7PA 1VQ4S 1U6ZA 2LXIA 4CLPA 4ZP7A 2BDPA 1UP1A 1JXVA 9ATCB 4DQPA 3BS9A 3MXHP 2XQCA 1RHQB 5J1PA 2EC0A 4J9KA 4AUKA 1K44A 3M8PB 4CLFA 4F3OA 1RHJB 4P9SA 3BR8A 2GQQA 5DM6Q 1YJNS 4P74A 4DG1B 2AJ4A 4ZVUB 1U48A 1H74A 4DR7F 2ZNYA 3M1VB 3KMQA 1CJKB 4JI6F 3FEXB 2ZJPQ 3EZ5A 1Q8BA 4B3MJ 4CNZA 5D0EA 4R5PB 3CE8A 1JQGA 4PXEA 1HI8A 1VBZA 1NLKL 5H9FJ 4OMFG 4DHVA 4CLZA 2RIJA 4ALZA 4X64F 1WG5A 1Z2LA 1LK5A 4ETZA 4QYZK 4RW6A 3DXSX 2IMWP 2A6MA 2MY8A 4U9RA 3WHIA 3ENQA 4ELUA 3Q2SC 3D2WA 2DO4A 2KFZA 1JLBB 2RRNA 4AD6A 1B3TA 1ZM3A 1N5YB 1ZTTA 4BBYA 3IXQA 1S1UB 4RW9A 2D41A 1R3NA 5DG7A 3QNWB 3B8HA 5IQQA 4UUXA 2V6AA 1FF2A 5DZ7A 3D0HE 4QIFA 5AXLA 4NLTA 4K4SA 2HHSA 4PG8A 4G1QA 2MB0B 2ASLA 1VRTA 5F8GA 1N5VA 4LQ9A 4ECUA 2GIQA 2V4JA 1HNZF 5D0RA 2POKA 2V8VA 5CABA 4ECVA 4ZJQA 5I3PA 1VOMA 2LP4A 4P2XA 2FVRA 3BBCA 2CPIA 1M1KT 3ZZYA 1Y00A 1NJWA 1FEHA 2QIFA 3EDQB 2DTJA 1A9NB 5HBMA 3U1NA 4RU2A 5C42A 1GXUA 2CPXA 2FJXA 5F8IA 1HNVB 4XDDA 3GCXP 2BX6A 2R42A 5KG4A 2RDJA 4ZPVR 1M90T 2OJ3A 2DXFA 5MAOA 2QV6A 3MM5B 2AGOA 4NL5A 2NUUG 2FLOA 1RAOA 4A8KA 3P5BP 3R9LA 3PKYA 1VQOS 3G8QA 4QU6A 1OWXA 5E33A 2H4WB 1KR4A 1PJ6A 1LK7A 3H8YA 2PE8A 4KHPJ 3SSSA 2HZCA 1WOPA 4V19J 4NEZA 2XEXA 3HO1A 3TARA 2XMMA 3DC2A 1GX6A 1BQNB 3JTPA 5HLFB 3MMJA 3VWSA 1YHQS 2Z58B 4OQJA 1R8CA 3NY0A 5BJRA 3ET6A 3GILA 5K8PA 4B3OA 2GV1A 3PY8A 2BE9B 4IH6A 3I32A 1D3WA 1QLNA 2Z2YB 2CQHA 4ANDA 3MAAB 2XCPA 2R7RA 2ERRA 3R5CA 3T41A 1XMQF 3ILLA 1ICEB 3RTVA 4PYAA 2PIIA 2QT7A 4USVA 5A8KA 4YEAA 4H4MA 2FIUA 4C8LA 5C25A 2YNHB 1C2PA 2D3O1 3MD1A 1NPKA 2B9XA 5HVFA 2HLUA 3KJVA 4GKJJ 2DGVA 3VALA 4OYAA 4OZLA 2VFVA 1HNIB 5L1KA 2HHWA 3QT8A 2GVZB 4M5KA 3GG0A 3FFIA 2E7WA 1FXRA 4EGLA 4DUYJ 1WDDA 4TVAB 5DLGA 5F8NA 2ADCA 3MPDA 2VH7A 1YJVA 2OH2A 5K8OA 3Q8QB 1KLMB 3N9UC 1PILA 2UXCF 1Q82T 1BHNA 3I6PA 4O4GB 3SCLE 4ZIVA 3J7AN 3W5YA 2I8EA 3CC4S 3RAQA 1Q8IA 3V6HA 2K1RB 5F3TA 1XQIA 3GYNA 3ILOA 2OPQB 3VAGA 2VQFF 1FFWB 3D66A 2APOA 5AE2A 4L6V3 1C0TA 2ZE2B 3PV8A 1Q5YA 1B0PA 4ES1A 4WJBA 1N6QA 2DGXA 4KBIA 1V5IB 2DH8A 4UUWA 2ZNZA 2HKEA 1MW7A 1RA7A 1S79A 3NL0A 3AJ1A 1M1HA 3L9ZA 1KOHA 3HCXA 2FLLA 4ZVTB 2VJVA 4NLPA 2R9LA 4Y65A 4DPUA 3KWMA 4RUBA 3SBMA 4HH1A 5LJ5Y 1LW0B 1PIEA 4UF4A 1B4SA 2YWWA 4P2FA 2CADA 3PFEA 4TN2A 3G6ES 3OLBA 2FDNA 4XK8C 2EKYA 4NA2A 2EFQA 3DOKA 3OL9A 1DFDA 1RHMB 5EX3A 3FVYA 1C0UB 2GMHA 1S0NA 1MG7A 4OI6A 1RKIA 3MFHA 4F4AA 1SC4B 5BYSA 2RS2A 3C16B 3BQ0A 4K4TA 3R1HA 1RUSA 4I6WA 3G87A 1RADB 5FLXY 3IGVA 1R0BG 5EGYA 4J5OA 3B54A 2KKHA 1T9WA 2GMLA 1S72S 1YX2A 2OO4A 2PMWA 1U02A 1J5EF 4KQZA 5KFFA 3DRRB 1CC7A 1R8BA 3HFZB 5KFBA 1N52B 3M8ZA 2VU5A 2CJYB 2DNZA 1WC6A 1R27B 2AX0A 4OYZA 2XB2D 3UR3C 1FKPB 2EK1A 1KTQA 1REVA 1NPRA 2E9TA 4OZ2A 2HHTA 3UI3A 2ZH9A 2GO8A 5AE1A 2DPIA 2H9ZA 3CCSS 4C0BA 2VBZA 3IG1B 2HK3A 4ZVOB 4DN9A 1Y5NB 5K8NA 4ZN1A 2LFVA 2PEBA 1RZMA 3TR5A 1N34F 4DV4J 4GO7X 5D3GA 1M0SA 2XLKA 5AJ3F 4HDHA 4QBUA 4R25A 3JQKA 5IM0B 3C6UA 3IBWA 1XIQA 3HSDA 1HWLA 4X4NA 5KOXA 3BGRA 1P9QC 1GFWB 1F3VA 3EDRB 3CO0P 4M1KA 3D1HA 2QL7B 1SKUB 4WFXA 4QWAA 2HBQB 3W8PA 4LF6J 2CKWA 2ZH3A 3PO4A 2V34A 1S9GB 2WSCC 3VQTA 5IT4A 3M8WA 4ZITA 5F41A 3TUIC 3OR1B 1FWPA 1EKRA 1IKVA 1F1BB 3MR2A 3TA2A 2XLIA 1HQUB 2B51A 1FK9A 1IJFB 2QE5A 4CCHA 3PTWA 5J2PB 1F9HA 3BZQA 5BR8F 3HHDA 1QE1B 1NK6A 5EDWA 3D0GE 4LFBF 1SJ4P 2JEJA 3P3DA 2G13A 1YITS 3J80Y 2J7WA 1GTHA 1WG4A 1S1TB 3QPIA 3PXGa 1FRLA 4AFFA 2XM3A 3OJSA 3MAHA 2CDRB 2AYMA 2N3OA 2W9BB 3D4JA 4LF9F 2JFKA 5DDOC 3FBEA 4GO5X 4OX6A 3TZXA 4HEA9 4WTYA 5FD1A 3GR0A 2RUGA 4RBTA 1IXKA 4FNIA 5L46A 1HI1A 3WC2A 4KE5A 4V1Ak 1VQ9S 3JAMU 2J0XA 4ECTA 3DRPA 4Y00A 3M9NB 1UVLA 1PC4A 4NA3A 1U8WA 1TKZB 5CZVA 4L3KA 1SL2A 2XS5A 3HVTB 3MPWA 1WKKA 3T1YJ 5C2GA 2FLNA 4LMZA 2ATLA 2UUWA 2R8GA 1KQSR 4K4UA 2NXNA 4ICLB 2XSFA 2M2BA 3RRHA 2DPJA 1L5UA 3HZEA 1XNQJ 1VGYA 3GMGA 2MQLA 2FHJD 1YJWS 4BC7A 2ZDOA 5IC4B 3P96A 4YDXA 4B02A 4DBQA 1PYOB 4CWBA 3VQSA 5K5MA 1RAEB 2M70A 1AT1B 3MI7X 5F8HA 2A18A 4TU8A 2XSJA 2HFNA 4AT1B 4F50A 4NX9A 3ITHA 4L72B 3CUNA 1SIWB 1CPZA 4G1PA 3U27A 3A1YG 2M88A 2M9KA 2E5LJ 1OPIA 3NRBA 3BGOP 4O3RA 1VQKS 2OTJS 1WTBA 2CQIA 2KG0A 2NXJA 2E5JA 1FXLA 4DV1F 1RLCL 1L3TA 3QFHA 5GAGU 4X65J 3LAKA 2Y1IA 4QWDA 1ELOA 4I0WA 2C22A 3MUTP 3EXYA 2FPHX 3DLEA 1T03A 2M7SA 3R7SB 1CS4A 2DH7A 4DR4F 1SQGA 3QGPA 2XGPA 1BD6A 1NZAA 3CJ3A 4WIIA 1BQMA 4GVBA 2BZ2A 4B3MF 4FPRA 1B0TA 2ZVSA 1N36J 4RW9B 3M6VA 2ZOMA 4DX6A 3Q2TC 2ZFHA 2HNDA 3QZ8A 3H98A 2B4OA 4FP9A 3H4DA 3PRDA 4JV1A 2YKPA 4FN5A 4UZCA 4G1QB 1VRTB 1KVJA 2AIRB 2ATCB 4NZ7A 2UUAF 2V4JB 1VCTA 2HS0A 3LPYA 3I82A 3IRWP 1HNWJ 1CJUA 4F36A 2V4QA 5B0DA 1ZA2B 1QM9A 3DXBA 2J6TA 1HD0A 1AFJA 2HQIA 5HANA 1RB0A 3AJDA 1VQ6S 5EUHA 2R2RA 1YJ9S 5E3PA 1RT1A 4RPFA 1FKOA 3GFXA 1JK9B 2YPYA 4NOHA 1TKTA 2N3LA 1WC5A 5HBMB 2CPJA 4IOBA 1HYSA 2X3GA 3KLVA 5C42B 4IO1A 5D77A 2A1BA 2FJAB 4HVZA 4WP9A 4I6AA 2J7KA 4LF4J 2WSFC 1XMOF 2FUG9 2BJ3A 2OP5A 4EO8A 2XY6A 3C2PA 4NLDA 4K4ZA 3CJQA 4OI3A 4CO1A 2DGOA 2IMOA 3DHXA 1HFEL 1F3FA 4L3NA 2ZC3A 5A76A 4WYLA 1IWGA 4C0HA 5HN0A 3SI8A 3TX8A 1H2UX 3UD3P 4IR1A 2QX0A 4YP3A 4P2MA 2YKNA 3Q23A 4LF7J 4X4VA 2FB0A 4KAIA 1FFGB 2RHQB 3RB4A 1FWKA 2NLWA 2UV8G 1F2HA 3K8WA 3H90A 3THTA 3PACA 2DCUB 1HA1A 2F3JA 2V94A 3JS9A 3WX4A 3KHGA 3M8RA 2Z2ZA 2OGUA 5DM7Q 1H98A 3ET6B 1FO1A 5HK4A 1NK8A 3O3LA 4B3OB 3D6TB 3AB4B 4PXDA 2LXFA 5B7WA 3Q0AA 4DSEA 4LSNA 5KG6A 5A6WA 5THWA 1N54B 2AYBA 4Z37A 3KLIA 1N33J 1RXOB 4AE5A 5KFUA 2KH9A 5A8KB 5ITHA 5D6GA 4H4KA 4H4MB 4Y6IA 4UY85 5C25B 2Y0BB 5F8LA 2AW0A 1I94F 3PX6A 2R7WA 3UCGA 2HZAA 4B9TA 4LIRA 4FS1A 2ZH6A 5LMNJ 5GAGI 3FFIB 4F2SA 4DS4A 4AQYJ 2LEPA 4ZP9A 4KKOA 2RJZA 2C3OA 5ETLA 2X7IA 4DL5A 3O1LA 1NUEA 4M5DA 3T19A 4EU0A 8AT1B 2QLJB 2LECA 1XN9A 2BJ9A 4CYUA 2Z56B 2ZBPA 2VDHA 2RE1A 1K0VA 1OMSA 2Y1JA 5AE3A 2W2MP 2IM1A 3CDWA 3KDNA 1RGVA 3GJRB 1PGZA 1C0TB 1QSYA 3KK3A 2F8HA 2C2MB 4QIGA 5KFMA 1N6QB 1RT4A 3A3NB 1KQGB 2AV5A 1OQ3A 4L74A 3AHPA 1B70B 1RTIA 4XPCA 1LXJA 3ILIA 2RUSA 3KOAA 3CCWA 1I3OB 1RT7A 2EBGA 1RTHA 2VL1A 2YKAA 2NYHA 3T5KA 3AXKA 3HD1A 1F5BA 2CJXB 3KMSA 2WVFA 1J27A 3M6XA 2GX8A 3G4SS 4ELTA 3HX9A 4ZLPA 3DOKB 1H6KX 3DKDA 3QAUA 5D78A 3ZZPA 4L75A 3H5XA 1DLOA 4MKYA 3A3PB 2MLXA 3Q86A 3IA0A 1CLFA 1RBLA 4LVOP 4YY3J 3HHLC 2Q43A 4ZVGA 1U8SA 2AZ1A 3FUYA 3BGFA 1VK8A 3UCZP 1X7VA 3CJKA 5EHHA 2B7CB 3SQOP 4E8UA 1VBKA 1X4BA 1DURA 4A8YA 1WF0A 2ZJRQ 1Y11A 4ECYA 3D28A 2IDEA 4I6YA 1M5VC 2OMOA 3PFOA 1BMQB 5KFEA 4RNNA 4U8YA 1H7WA 5SUHA 3DU5A 4XPEA 1SJRA 2IA6A 4MIBA 4K4WA 4ZLJA 2F4VJ 2KDOA 2RNEA 2FVQA 2WONA 1HWIA 3NMRA 3KG1A 1CEZA 4ZVFA 2IFXA 2MKJA 1C1CA 4AXIA 1NH7A 3A8IA 1OQ6A 3K2YA 1CQNA 2B9WA 5IS2A 3OTDA 1Q5VA 4KGXB 1CJVB 4OHXA 5L1LA 1REVB 5JXSA 2VKRA 2HHQA 2MZRA 1S9FA 3DLKA 1WD6A 2EFPA 1WHXA 3HVRA 3IMQJ 1HMVA 2YKMA 2VFUA 2ZH5A 3VAJA 2YNFA 3LALA 2JNJA 1EHWA 4MT1A 2VUGA 5JMNA 3CWJA 2NZ4A 3QMQA 4OZ5A 4PWDA 4EZ9A 1VQ5S 2BJEA 1T9XA 3C6UB 2RQMA 3KK2A 3Q8YA 2OMLA 2PC6A 3KLHA 3BGRB 1BXNA 4LF1A 1FRKA 5I3QA 2W2QP 2OFHX 1KHVA 3CCJS 4DV4F 4YB7A 2VG7A 3TYTA 3MR7A 4OHZA 3EYZA 4IUFA 4X66J 3VGVA 3X3UA 2J9EA 5HP1A 1RWUA 1IKVB 4F4KA 5CD4H 2RS8A 1X31C 2NSBA 2YX7A 1UPPA 2QN6B 3MWBA 4QYZJ 4P10A 1YRXA 3M2VA 2ZH8A 3WC0A 5C5JA 2VICA 2HNYA 2CPFA 2QLFB 1GQEA 1IQZA 2M8HA 5H9FK 2CVIA 3EGVA 3TWZA 1N32J 1U49A 2FVPA 1HHQA 4ZHRA 4WFYA 4CO2A 3OTOJ 1YQHA 4C11A 1U1RA 3K5LA 1Q79A 4LRCA 1C1BA 4ZMMA 2K7JA 1FDDA 2BJDA 2ZD1A 2V8GA 2Z57B 3LTOA 4C0OC 3LPEA 4FS2A 5KG3A 1PSDA 3TZYA 3ZFVA 3CC7S 2NYIA 1U6FA 4M5JA 1N48A 3PEHA 1GK8A 1KN6A 2E5HA 4ZPBA 3DRPB 3UDEA 3QGHA 2G4BA 4DFMA 1AUDA 2R7TA 3FSYA 4LRDA 4CP5A 5KFTA 2B9YA 4FKXA 4DV6J 4QIEA 3K7RA 4UY8T 1CULA 2DGQA 4RUAA 3QFWA 1JWWA 1NCLA 3Q24A 3MOJB 4EO6A 2E66A 2YNIA 3GZ7A 1FX2A 2MJNA 3FQLA 1XK8A 3JSBA 7AT1B 4HTIA 1DY3A 2J0WA 1UWAA 2R7QA 4Y2MA 3H42A 2XO7A 1YG0A 1G6BA 2XMWA 3M30A 1U0SA 1X4CA 3I5BA 3V6KA 5C24A 4Y28C 3T1YF 5J2MA 2GC8A 4J9QA 4EBEA 3T1HJ 2DNNA 1YJRA 1KHWA 2XULA 2VJUA 3R5BA 4B9SA 2LVWA 2OAUA 1FDAA 2R4FA 3EVMA 2C42A 2JDJA 4IRKA 3K59A 3KJNB 2RMLA 4EBCA 3CCMS 3AA9A 2XSJB 2B4PA 1RWOB 3PCOB 2JRSA 3ITHB 1S6QA 5HVHA 2EFGA 4LFAJ 3QJLA 3OSNA 3QWUA 2GVDA 1S0MA 1ZAVA 9RUBA 2QZ8A 4TU9A 2ZKTA 3K0JA 1QY7A 3T9ZA 2V67A 3VAMA 2AJFE 1CJTA 1AYEA 4TLQA 4L73A 2D1CA 2HYIB 5E41A 3LWMA 1PC5A 2DD8S 1IKWA 4CLUA 3NCPA 3DLEB 1T03B 1SJFA 4OYOA 2E5LF 2FY8A 3ZZRA 2XWXA 3IFEA 1LOUA 2ASJA 4LRAA 3SEOA 1C4CA 2MLYA 4NXMJ 2YXLA 4TQSA 1QAXA 5L9NA 1BQMB 4GVBB 5U47A 2O1PA 2AF6A 3P5TL 4X65F 3QIPA 1OY8A 1ROFA 1BC6A 2YBVA 1PAEX 3OXFA 2YKQA 1QVGR 4M5NA 4Z7YA 2GO9A 5CH7B 1VC0A 1F5AA 2ZHAA 2CUYA 5T7LA 2HG4A 3CJ4A 1YI2S 4NCGA 4PQAA 4USWA 4PABA 3OTCA 2KT5A 4DR6F 4JI2F 5IFMA 3LQVA 1FWLA 3KNAA 2ZHBA 3BSCA 1CJUB 5F3ZA 4F4ZA 3C8YA 2BQRA 1WG1A 3UQSA 1NSKL 1WF1A 1H73A 4FXWA 2IJFA 1RT1B 3PO5A 1FKOB 4YS2A 4DSLA 2VV5A 2ZZMA 4HHHA 4DWIA 1TKTB 1U09A 3ADAC 1JJCB 2WW4A 1HNWF 2XI3A 3MM9A 2RRAA 3JYTA 1R0CB 2IIHA 5AXMA 4W90B 1R8HA 1NDKA 1GNKA 3LGMA 1FKAF 1X5PA 3HSJA 2RF2A 5F0WA 1T94A 5AXNA 4K2JA 3K5MA 5CYMA 1R43A 3JSYA 2YKNB 4LUBA 2R7VA 4LF4F 3UO0A 3RBZA 2FJWA 2WBRA 2JH3A 1TK0A 2LQ9A 1VS3A 4ED0A 2XS7A 3QO9A 1JXEA 3BQ2A 3HD2A 4KO0A 3BR9A 1FNOA 4PR6A 3HT0A 2B0GA 5KFWA 1TVRA 5BXIA 2HHHJ 3PM9A 1YBTA 4TLRA 4LF7F 1OSDA 1S6UA 4E98A 4LSNB 1IKYA 3QSYB 1M5HA 3NOCA 5KOWA 4JI8J 4CO3A 1SKWA 2CIMA 3SQGA 4MKVA 4M63A 1XNRJ 3L7OA 3KLIB 3I4HX 3EGNA 4M95A 3P49B 2YX4A 2IM3A 4USHA 1KSPA 4I2QA 2DHAA 4C2MA 3IGNA 3ULHA 2UUBF 4B3RJ 1TFYA 1RTJA 3AH6A 3CCTA 1YKWA 3CEDA 5DETA 1FA0A 2ZWPA 2QL5B 3F41A 1S4EA 2GHPA 3PW7A 1IBLJ 4KKOB 1U2FA 2WW8A 1IBMJ 2DITA 4NLYA 1HBOA 1H2VZ 5KFCA 2ZITA 4M5DB 4G65A 1ZM9A 3QRPA 4WFBQ 5CCLA 3T1AA 4NZ6A 2J6UA 4F0MA 2BYCA 2WVBA 5LMNF 4CYUB 2I0XA 4YB1P 3I56S 3KK1B 1FVQA 2J6SA 4AQYF 2D9OA 5CA5A 2IRYA 4NRUA 3R6GB 1RYRA 3UCUP 2HEKA 1MMNA 3KK3B 3OXGA 3MECA 4FYDA 3EPGA 1BE4A 1RT4B 1S6OA 3W2WA 3ZO7A 3A13A 1GXTA 1RTIB 2M4MA 3AQPA 1JLEA 4WYWA 4C8KA 1MWZA 3C46A 4DG1A 3W65A 3DRYA 3IWXA 1D9DA 2V8PA 2G0CA 1RT7B 4EMDA 2HAFA 3GIRA 1RTHB 4LRFA 2O5DA 4A4JA 3HULA 1WELA 2QSWA 4Q2LA 1VQ7S 2CJAA 2C2KB 3PHTA 4ZPDA 2YWFA 4OX7A 3GSIA 2YWGA 3N01A 3CJ8A 2ZZNA 1DLOB 1LWXA 1WEZA 2X1BA 1U47A 4MYUA 3OL8A 3MM6A 2FHOB 4F67A 2BBEA 3HPOA 5DDRC 2HWIA 4WXWA 3EGZA 1NJZA 2MQQA 2HNZA 3N5BA 3CJKB 3J81Y 1YJUA 2DR8A 4LFCJ 1VISA 3HHKA 2FZGB 3VVUA 1DHMA 4OHWA 5HL7Q 2XY5A 3CO9A 2FGOA 4NI2A 2DEIA 1GXLA 3G6VA 1VRQC 1UAWA 4Y2AA 3M32A 2MKHA 4QW9A 5KFIA 2XLJA 3C66A 2Y1LB 4B9NA 5LL6d 2WONB 3MPYA 3N6MA 1C1CB 4KGMA 1DRZA 1XR7A 2MMYA 1ACMB 3PW5A 3AD8C 4OX9F 2XNRA 1KFDA 2UV8A 2XTJP 2BQ3A 3NS7B 1RP5A 4PXBA 4KRWA 3DLKB 3QAEA 2F4VF 1WEXA 1L3KA 3RR8A 2DY1A 2XZDB 1IBKJ 4O44B 1HMVB 2YH0A 2YKMB 1PBAA 4PRFA 2C2EA 3NAHA 4PAAA 4JI0F 4C3KA 2C3MA 1HNVA 2YNFB 3RGIA 1R8AA 3CCLS 3VF0B 4E0DA 1VMBA 4PWDB 3CULA 4F04B 5HATA 3SCJE 2R7OA 2ROEA 1JLGA 3VR1A 2CNNB 3KK2B 3P8BB 4C97A 5GVQA 4ID8A 1WWHA 3KLHB 2KZMA 3MF5A 3DRXA 3F56A 2L9DA 4ENOA 2UXBJ 3UW1A 4F7VA 3OVAA 2VG7B 4Y2IA 4DL4A 2ZEJA 1PCAA 4QR0A 2GAHC 2Y0SD 4D3GA 1T3OA 2EFNA 3VAHA 5HP1B 2IBOA 2N82B 3CCES 3M2VB 3TX0A 3OT9A 1HWUA 2JEGA 2OD6A 2HNYB 2Z0GA 4ES2A 4C8OA 5A2QY 4QR1A 3MEGA 2MHNA 3C3LA 4X66F 2OHDA 1D9FA 1TK8A 4AL5A 1EARA 3N6NA 4ZHRB 3C14A 3CJ5A 3AT1B 4DXLA 4C11B 3MOZA 1SJ1A 1C1BB 2RRBA 3FSXA 2OD4A 2ZD1B 2W24A 2BM1A 5DQIA 3DLJA 4G6VB 1B64A 5DG9A 3UN5A 5EN1A 4N8OA 1KLNA 4NMLA 4UQTA 4LSLA 4LBPA 2Q1LA 4LQ3A 5L9XA 4HL9A 1JLAA 3OTOF 3CGIA 2KG1A 4HT5A 5CQGA 3GP9A 1O6XA 2FGCA 1CULB 3IN5A 3I9ZA 1WI8A 1HR0J 3MFIA 2JHEA 2HBZB 2YNIB 3TQEA 3NNAA 2GHVC 2DT9A 3E8OA 4Z2XA 4LF5J 4J9VA 3V6DB 4F4WA 3ZTQA 2NXEA 4UOFA 2GGPA 4Y3CA 1RWVB 2AHOB 2ZM6J 2CNOB 5I3UA 3M30B 1Z2ZA 3W64A 2FVCA 5C24B 5J2MB 5L1IA 1Y0HA 4LBIA 2FZCB 4NLOA 3I5CA 1IVZA 1Y9OA 2H48B 4K7QA 3AQOA 2CPHA 4WP8A 4JI1J 3PYDA 2AGQA 4MYTA 4N56A 5GMDA 4DX7A 2I38A 1YZ6A 4HLBA 3AAWB 3I4PA 3W8GA 4GMKA 2CQ3A 1X9MA 1S6QB 5M2UA 3WIVA 3MMCA 3NNHA 2DBBA 3AXMA 2QGFB 2ABYA 5GAHU 2GVDB 5LJ3Y 3QRRA 2Y3YA 4IOAQ 1F9EB 3S1TA 3TVYA 1VFJA 4USJC 3R5JB 4JYAJ 5FJ4A 1CJTB 4IG3A 3NG8A 3K5NA 4IH7A 1U1PA 4F26A 1SPBP 3Q89A 1WC4A 3RAMA 3BB5A 2ZHOA 5KG2A 1IKWB 2CNLB 2M52A 3FQKA 4DF4A 3E01A 1NZ8A 4LFAF 3KHLA 4RWXA 5IV4A 2BVZA 4PWUA 3LP2A 2L3MA 3OLAA 4KH1B 3PR5B 3FZ2A 1D09B 3AB2B 1YSJA 4URSA 3TUPA 2WOMA 3QIPB 5B0GA 2JC1A 3O8WA 1Q4RA 4O4RA 4DSFA 1DTQA 3CD5A 4OZ1A 4J37A 2XYHB 4IH5A 2R8JA 1U4BA 2H65B 2GQCA 3RU0A 4KR0B 1L3VA 4NXMF 5T7LB 1KQFB 4DOZA 3MMBA 3HHLA 4NCGB 1O5JA 5ETRA 2QFJA 1ZM2A 1TL1A 5C7PA 3HLUA 4XIUA 3R2DJ 2JZ5A 1NRKA 5IZHA 2GW8A 4CLYA 4RW8A 3HVAA 2QLBB 2DXDA 2EW9A 2LDIA 3JAMY 2XNQA 1XR5A 2VF3A 2F5GA 1WKJA 3SCIE 2A6OA 1VJQA 2W2NP 4UTGA 3FMWA 1X8DA 3V6JA 3OPKA 4C8NA 4ECQA 2MQMA 3J81j 2N7CA 1HPZA 1SL0A 3VAKA 2HRYA 3MCSA 3MM9B 3JYTB 4KB7A 7FDRA 1M1GA 4FF4A 5J2QA 4WFNQ 1PKUA 1UJ5A 1FJ7A 1ZZNA 2RF2B 4HACA 2ZUGA 2XO6A 3BO2A 2CJQA 3A8JA 4MIWA 2HQ3A 2LQ8A 3B6BA 3GU0A 5CYMB 2OELA 1S9GA 1WNEA 3D1OA 2HGNA 1LWFA 4H4KC 5HMZA 2EBEA 1S76D 3QO9B 2IBKA 4KO0B 1RU1A 2CVEA 2PD1A 4OJGA 2H3EB 1NK9A 3CDBA 2CPYA 5LMUJ 1TVRB 1PG5B 3H2VE 2G2OA 3OHBA 2AJ1A 1EIYB 4ETXA 5KFZA 1IKYB 1TAQA 2C3YA 4J9PA 1U1NA 2KO1A 1F0XA 2WB1D 2AGPA 4B3TJ 4OV6A 4USKA 3SQGB 2DO0A 5IT0A 2CA9A 3I9V9 3MR3A 3LAMA 4OZNA 4RUHA 4LR9A 2HHHF 1TQLA 4I2QB 2B6AA 1V3RA 4ZCIA 3NMAA 1I6JA 1S59A 4YHHF 3MEEA 5GAEU 2UUCJ 1JMTA 3M9MB 5GAHI 3TEGA 2N7YA 1NB7A 5JVHQ 1X4EA 3TW0A 4JI8F 1RTJB 4WZQA 2J5AA 1T9YA 5HJYA 3I96A 1TKZA 3ZTOA 3PJWA 3TZWA 2E7VA 2DHSA 3FMBA 3VCDA 4LSZB 1P27B 5CCMA 1HBOB 3GIJA 1KRPA 4B3RF 3RZAA 5LT5A 2QFIA 1MN7A 1ZETA 4NLUA 3PJ9A 1M5SA 2HMIA 3BQ1A 1S0VA 2PGCA 4JI4J 3GIKA 5IWAF 3EUNA 4DV0J 1Y7PA 2RQ4A 1WC1A 1PYTA 2CPZA 1H2TZ 4ED5A 5HO4A 5HJXA 2G2YA 3DLGA 5KAKA 3PW4A 1EX8A 2HVIA 3V81B 3MECB 4B08A 5KFOA 2IHR1 1FE0A 4NLXA 4Q7AA 2GS8A 2WAQD 4NLRA 1GMVA 3IP0A 5A0YA 1S1XA 1KBRA 4ZDNA 3W2WB 3IWLA 2R2UA 1JLEB 4EI2A 3H5SA 1K47A 4A8FA 2LYVA 3NAIA 4PKDB 4OYBA 4OI0A 4O3OA 1B7FA 2WSEC 1UW4A 2LDYA 1WF2A 1ZS6A 4KT0C 4JV5F 3GG1A 1X4FA 3D54A 2CQ2A 3KDOA 2LMIA 4ZCLA 2W4PA 2W7OA 4LF2A 1REGX 1IKXB 2HGLA 4WP3A 2Y8YA 2LEAA 1RAAB 1OYDA 3NGDA 3H2LA 4FVMA 1H7XA 3R8YA 5MLCV 2BJ1A 1EETB 4FYXB 1R6YA 3R5DA 4OI4A 1SH3A 3FKBA 2WHOA 2C2DA 2D7SA 2X1FA 4RW4A 3MM6B 4N8NA 1MWYA 4I1TA 5KFAA 1E6YA 4GC7A 2GCFA 4DUZJ 5CZXA 3ZTRA 5B08A 3HXMA 3PX4A 3IR6B 3G8SA 4DV5J 3W3SA 2HNZB 1F6TA 1TUWA 4L76A 3C15A 1X5SA 4RKUC 3BBBA 1HNXF 4NI2B 4DV3J 2P9GA 3OUYA 2GJFA 2D3ZA 3M32B 1UVNA 1MLAA 3IWNC 2FZKB 1RJJA 4DQIA 1QJHA 1HW8A 3PIPQ 5D4LA 4RX6A 2LU1A 3DGVA 1JNZB 3SDEA 5RUBA 1AB8A 3ZNJ1 1S97A 2IAJA 4LFCF 1FJGJ 4ZCKA 3TQ1A 4FXVA 1NK4A 2M8DB 1UA1A 3CIMA 4ZPWR 3ELHA 4TYBA 4DR5J 4WPAA 5ETNA 3NGTA 3CMAS 4ZA1A 2HQGA 1KNZA 1GH8A 1Q95G 1T8EA 3SSQA 4X84A 2MQOA 2GA7A 3HDSA 1G1XA 4DR1F 3GE9A 3R7NB 1N0UA 1KEKA 3BO3A 3CTRA 5GAEI 4DV2J 3K5OA 3VGUA 5D4PA 2DNLA 4C8ZA 3GYXB 3FJ2A 1R89A 1Y10A 4YB5A 5L39A 1JLGB 1UEVA 2MZJA 4A8MP 1IUJA 1A7GE 3FNNA 1P8GA 3SMZA 4Q45A 2E1PA 3M8SA 5E3RA 2E29A 1RT6A 2OIHA 1I1GA 2HQFA 2CFXA 4DX5A 1D9AA 2GIFA 4QZVB 2CPEA 3TA1A 2V63A 2DCLA 3KKFA 1XEZA 3BF4A 1UFLA 3PW0A 2W8KA 1QDUB 1RYSA 2UXBF 1BQXA 2K2PA 3FDSA 1HQEA 4BWMA 4FVCA 2LQBA 2BACA 1ZPWX 1Y5LB 5HMYA 3L3CA 3MEGB 2NZCA 4JP8A 3M8QA 2HZVA 4S0MA 1CQMA 3OTBA 3C14B 4DR7J 3N79A 1XWLA 2EI5A 2PFDA 2VPWB 3BKUA 2BABA 3IAM9 2HIYA 2VFSA 4WE1A 2IPOB 1D1UA 3HFKA 2HS4A 4USMA 5KG0A 1S7IA 3KLEA 1B7YB 2KL8A 2CQGA 4LSLB 3OW2R 3O6QA 4DU7A 1RT3A 1FXDA 4OL8A 5IC6B 3EMTA 2KJWA 4K50A 1JLAB 2DR7A 2UP1A 4OLOA 3RBEA 2OLWA 1HQ2A 3QATA 3G96A 2GAGC 3TANA 1U6BA 3Q8PB 4KTQA 3T5LA 3OXLA 2AEJA 1J5OA 3RW7A 1J2VA 2IYGA 4I67A 2P2CB 1T3NA 1AFIA 4FKYA 2ZC4A 4ZVPB 3LWLA 3GONA 1M5OC 2ADBA 2J7UA 2YPZA 4P7VA 3GFZA 3EWGA 3LGHA 4KH0B 2GGPB 5I3UB 3OBIA 5KFLA 3IO1A 1HR0F 1HNZJ 4W98A 5B09A 3H20A 3NS6A 3QZ7A 4BHQA 4C3LA 1TL5A 2AYEA 5KFKA 1OO0B 4YUDA 3RG6A 3CVKA 2KU7A 1Z1ZA 3AOAA 1FRXA 2JLFA 4GKKJ 2ZH1A 3GIIA 2D3OR 3QWPA 2ZM6F 2OEMA 2WVEA 4Q44A 4WTOB 3V5RA 4NMXA 2F7VA 3HKWA 3NGKA 3OV7A 2A3JA 3MMCB 4CO4A 3NOGA 2G1DA 4PPDA 2R7XA 3CCQS 2C2RA 4JI1F 3K8VA 1UFKA 3HP6A 3SIPB 1VQNS 4IQMA 4IG3B 2HWHA 3CSKA 1UPMB 3OJUA 2AP6A 5GADU 2ZH4A 3DMJA 3KLGA 2FHKA 3E01B 1YBUA 3NP5A 3ZZZA 2KXHA 1UEKA 1LEOA 4HI2A 1UTAA 3LP2B 3CCZA 3PJXA 2E1AA 3IR5B 2UXDF 1XMBA 4OIXA 1JKHA 4P7TA 2XYPB 3GV7B 4YMEA 3PX0A 2WOMB 2E1CA 3CJTA 1QTNB 3D6FB 1DTQB 1SL1A 2VC1A 4FF2A 4DFPA 5BYRA 2I5JA 1S99A 1F5CA 4GRSA 2RKIA 3N0VA 1VBYA 5IQ6A 3MMBB 3HHLB 4LT6A 1TL1B 2DNHA 2CAJA 3OFEA 4RW8B 1CJVA 4FYWB 1QUVA 1X4GA 4ECXA 1OYEA 3IR7B 2F40A 2CQ4A 4YOEA 3IS9A 1WHWA 3RBXA 2BOPA 4ITSA 1BWEA 2R3VA 1E6VA 2YY3A 3PIOQ 4ERDA 5KFDA 3VAIA 1RAGB 2BW2A 2IM0A 1Z4UA 5A8RA 4UOCA 4I7FB 3WDOA 2LEBA 3LANA 1U24A 1TKXB 1HPZB 1QSSA 5F9NA 3UDCA 1RU2A 5E3QA 2DRDA 4I2PA 3T5HA 4MK9A 3PYEA 5J2QB 2M3DA 3OL6A 3NWRA 3CNQP 3CJSA 4IRCA 3CC2S 2UXCJ 1S48A 2VG6A 4J90A 2MSTA 3JQJA 2DHHA 1WACA 4HACB 2Z8QA 4EFAC 3PYFA 4JI3J 4Q2MA 3G2XA 4CH7A 1AZSA 5D8HB 1LWFB 1YJTA 4DLEA 4KY3A 1NDLA 4KC5A 3OFHA 2QLXA 2NQPA 2LQ5A 2NREA 5M2RA 2HWTA 4ZJLA 3UWTA 3S7RA 4DCPB 1S6PA 3LP1A 5D4OA 1K9MT 1OY9A 5E7OB 4J9UE 4F3MA 4M5MA 1VI7A 4C98A 2C2NA 4DSIA 1VQ8S 3MUMP 2XCAA 4DL6A 2HPUA 1JXLA 2VA3A 3EPIA 3PYGA 2B7BB 2J8SA 3TEHB 1H3DA 4IR9A 2ASYA 1WOOA 2BJ7A 5HSPA 4P71A 3BSNA 5LM7E 2BEFA 2B6AB 3MEEB 4JUZA 2H54B 3U02A 4MFBA 3U1LA 2R8KA 1Q1KA 2ZVIA 2OI2A 4B3TF 4P2SA 1HBUA 4A8XA 1VC5A 1UZDA 1Q81T 4N77A 4TY9A 1IJEB 5GADI 1KKHA 3MDFA 1RCXB 2KT2A 1FD2A 3TNVA 3BV8A 1K8AT 4DR2J 3R3TA 3SYZA 3RJMB 2NPIA 1RK8A 4RO0A 3IRXA 2JLEA 2HMIB 2BANA 2DIVA 5IT9Y 1Y5IB 3AFGA 1HW9A 1FERA 1XERA 1RT2A 4JI5F 3DLGB 4ZVRB 2VBWA 1Q7LB 4DV7F 6AT1B 2CZ9A 5FDLA 2O01C 3AOCA 4USIA 2BKOA 3CD6S 4JI4F 2MY7A 3G8TA 1V3ZA 2KJVA 1S1XB 5A0YB 4AL6A 2XZWA 2Q6BA 2AU0A 4QU7A 2E5IA 4HH0A 2HBRB 4C8YA 1NM2A 1UFWA 1YJ7A 1VK3A 4WBFA 3DN9A 3BJYA 3ZZUA 1WUUA 1FRMA 2MKCA 1N34J 1V5VA 2EG1A 2HK2A 3UDVA 2AT1B 5LSOA 2QLWA 4XO0A 3BDEA 3PNIA 4ZJOA 4HDGA 1X0PA 3F44A 3VZIA 1GMWD 4OHYA 2GFFA 2UVVA 5DRKA 4RW4B 1FT8A 1Q8KA 1Y4ZB 1E6YB 3EE3A 1RHUB 1BY9A 3VVTA 3BSOA 2VASA 2FJEB 3C15B 3L09A 3UE2A 1N5TA 4FYVB 5BR8J 4ED1A 4PG5A 3OUYB 4X2BA 1UA0A 1ZBTA 1R31A 4Y0FA 2KT3A 2GMJA 3W9IA 4ZVSB 1BWVA 4DUZF 2KVIA 3UFCX 3SDEB 3D3BJ 3D7SB 4DV5F 4AXJA 3O44A 2EG2A 2FD2A 2MPUA 2IAJB 3MM7A 1SI9A 4LF9J 3DOLA 2R2TA 4U95A 2ZBRA 3KLFA 1U1LA 4O3NA 2GJIA 2JEFA 3KG0A 1NH8A 3E3XA 2QMWA 4YQWA 2WB4A 2IA0A 1U1QA 3GV8B 2EVZA 1SUQA 4K5RA 3LP0A 5DG8A 4BLGA 2HFUA 1X9WA 3EXCX 3B4MA 4F25A 3N4WA 4DR5F 2WVCA 2AQ4A 2DNYA 2XMVA 1VDHA 2JOQA 3DRSA 1GX5A 1JNRB 2PFFB 4FYYB 2VHGA 2H4YB 1O8BA 3W63A 3MM8A 1TL7B 2BKNA 5E3CA 2U1AA 1RT6B 4PZVA 5FIIA 1A0OB 5D0GA 4NEYA 4ECRA 2VB6A 3CJRA 5KT2A 3K17A 1KONA 4M94A 5E3AA 4YR3A 1IQTA 5DDQC 1OJ4A 5K20B 5CYQA 4ZLNA 3G6YA 3F0NA 5KTQA 4DEZA 2H5IB 2OPRA 2F9DA 1HQEB 1MROB 2U2FA 4KHPF 4BCAA 1N5QA 2OUGA 1D0EA 2RU9A 3O2IA 3ISNC 2Y9HA 3QT6A 1NEEA 4CIOA 3M8QB 4QW8A 1YK9A 2HBYB 1B99A 5A6PA 2PDAA 2CZVC 1U1MA 3CXCR 1N56A 2DH9A 2DHGA 2RD5C 1MN9A 3J7Z5 3G82A 4WE1B 4DV1J 4J9MA 3C6TA 2UUTA 1QAJA 3KLEB 4OJ3A 2ALYB 4TY8A 3CMQA 1CSJA 3LOUA 1RT3B 3DNCA 2W8LA 3IM9A 2UZAA 3X1LB 1WC0A 4DR4J 2WRMA 1VHIA 3NCQA 4TU7A 4EEYA 1HBNA 4DL2A 4GKJF 4E2FB 2GIRA 1TUVA 3TJ9A 2E7XA 2BE2A 1OIAA 1J5OB 1NK5A 5KFQA 1XTZA 3KK1A 2W9CA 4FF1A 4DUYF 2YQ1A 4C3MA 2B4VA 2ASDA 2VKZG 3U7JA 4R8UA 1EZZB 1TZ0A 4DL0C 3HM9A 2OEJA 4A8QA 4PXCA 2UUAJ 2DXEA 1LKZA 4Q0BA 1AUSL 1FRHA 3TOQA 2NXUA 2O66A 4J9OA 3QLHA 4PEOA 3J7A1 4U7CA 3POTA 2PN6A 5KT5A 2ACMA 2JSXA 4WXOA 3HFVA 1RBOB 1ZAXA 5KFPA 1LWEA 2CQCA 2HS3A 2FJDB 1XMOJ 2FHMA 1HD1A 2J9DE 2HVZA 4GKKF 2MZTA 4DQSA 3NKYA 2K3KA 2OSRA 3G71S 3DMJB 3KLGB 3FZBA 2C28A 5H9EK 3WBZA 4EK2A 4B9LA 2CNKB 1DTTB 1S10A 2I6WA 4CO0A 3SFGA 3CW2C 1JKHB 5DO2A 3VGSA 4RNFA 1UVIA 4P73A 1SQFA 2XYGB 1QAIA 1U25A 1RHRB 1U26A 2MHEA 2I5JB 1AW0A 1KTVA 1FNXH 4J7CA 3GJSB 2RKIB 1KWMA 1RAIB 3QQCD 4W92B 5EX0A 4WF9Q 2KB2A 2XY7A 2WVDA 3W5XA 2QMXA 2XI2A 2NPFA 3J81U 4HKQA 2JEIA 2DIUA 1NAQA 1BLUA 3WQPA 2N4DA 2IVFB 3CCUS 4X4QA 1ZOTA 4O44A 1I94J 3CCRS 4DPYA 3IS9B 4ZCMA 4JOUA 2UVWA 4DI6A 1E6VB 1HWKA 2PMHA 2CZ4A 1X4AA 3IAS9 2VC0A 4ZP8A 1S57A 1JJHA 1TFWA 5A8RB 4K5SA 1X9SA 5KFSA 2BJ8A 1RWNB 5ETSA 1SKRA 3TAMA 4I2PB 2QYCA 3M6WA 3WX8A 2DNMA 3ILJA 4RNOA 4MTPA 2XWYA 2AJ2A 2VG6B 2YTCA 4I68A 1DQ8A 2DVIA 1A6LA 4OYMA 3EZUA 2FLPA 2FJBB 2VBYA 2V8DA 1AZSB 4WU2A 2FQQB 2DNPA 2LQJA 4RJVA 2KRBA 1PAUB 1U1OA 2ZH7A 1WHYA 2MYFA 3IBCB 4XTTA 4KSEB 2AEFA 1ZM4A 2DNOA 2FC8A 1LFWA 3OR2B 1S6PB 4XAKA 3LP1B 2MLZA 2VOOA 2V9KA 2MZ1A 4LF6F 4JI3F 3BYPA 4TYAA 1TAUA 1YRUA 3DGPB 3W7BA 2OPPA 1VYAA 2R7SA 2IRUA 1EJ7L 1IM6A 4OI1A 3L95X 2VPYB 2XMUA 5KFXA 3N28A 2LXUA 2RQKA 5CXTA 3GJQB 4NLWA 3I0SA 5HVGA 1NXIA 4F4YA 2SXLA 2RQCA 6FDRA 2BE7D 3KUEA 4ED8A 2CJKA 1S4FA 3RB6A 2VIHA 3JTNA 1HHTP 2Y8WA 4DCJB 3LO3A 4MFBB 4ZLLA 2VQEJ 3US5A 3AA8A 2YNGA 2F1FA 4F0HA 1HBUB 5A2QU 3HSGA 4HHUA 4TQRA 1HIYA 2MKSA 1UVKA 2XBPA 4KJIA 5F0UA 5ETQA 1N5SA 3J7ZT 4HTJA 2BA9A 3ISZA 2VBXA 1QVFR 2X3DA 5IXUA 5EWEA 2MKIA 5LSRA 1S1VA 3QIDA 3V6DA 2PT0A 2KXNB 3IRXB 3KUGA 3MHYA 2BANB 4R0EA 5BYQA 2MQ8A 1Q0NA 3MD3A 3B82A 1HI0P 3GYGA 1RT2B 2LU2A 3V4MA 4MJKA 3HHNB 3B4DA 2N4CA 1KVIA 3JQMA 3S6EA 1FTRA 4DR2F 1YRTA 3UR0A 4F4XA 2F4FA 2MDAA 3P45B 2C2ZB 4F0KA 5FDLB 4D3HA 2QA4S 3DLHA 3KXDA 4WCEQ 1XNQF 3VZHA 1HHSA 3S01A 1X4DA 4DN0A 1RTZA 4J9LA 1SH0A 4KGKA 1U2RA 4U96A 4IKAA 3A3OB 4PG4A 2W25A 2QA4G 3QJPA 3PG9A 3W66A 1YZ7A 3DFEA 2VPZB 4PCQA 4NCBA 3D6MB 1RWPB 5GMKa 4JV0A 2ZOGA 2IJRA 2DK2A 4C6AA 3CDUA 3H59A 2WTFA 4ANEA 2Q66A 1R0AA 4K8RA 4P6QA 4DL7A 2VONA 5A8WA 4OV1A 3M2UA 3SFUA 2F9JA 1N0VC 2DNQA 1RQ0A 4A8WA 4YFUA 2QC3A 4IYQA 2B5JA 1H72C 1SH2A 1UKUA 1KDNA 2B3TB 1JJ4A 1DBDA 2CRLA 2RDDA 1SBRA 3MURP 2K8GA 3MCOA 3MMAA 3TVKA 3V4IA 2E44A 5KFNA 1SJ3P 2C3PA 3D5MA 3ICLA 2KZZA 1UWBA 1ULRA 1FTCA 3MM7B 3T3FA 1N36F 1APSA 4JI7J 3DOLB 4ZN3A 3FBCA 5DS7A 1JLQA 3KLFB 4U67Q 3MEDA 3GCWP 4ECZA 2NS1B 4X4UA 1FJCA 2PA3A 1NU4A 4KPCA 3CJ0A 3P6YC 1LWCA 1SUQB 3LP0B 1W7WA 1S49A 3W62A 1HBMA 2RSQA 3BN7A 3BM7A 3H2UB 2H5JB 1SQEA 1QUPA 5K8MA 3DRSB 3M8YA 3QRQA 2IC3A 1OSCA 1Q78A 1VQPS 2KHDA 2COLA 2Q6CA 1F60B 2G9OA 4WK3A 3CMES 2WCXA 3JXOA 4ZPTR 3MM8B 2KVQE 1KS2A 2XMKA 2DEJA 1U0HA 1YGYA 4QPXA 4KGZB 2BR0A 3HT3A 4LBHA 3W9JA 1NHUA 3ZXWA 4KFBA 4ANCA 2OFGX 5KT6A 4ELVA 2H1YA 2B43A 5CYQB 3UDLA 4N7TA 4ZVEA 1HLWA 4IDKA 2V4RA 3T6JA 4BWJA 5B0BA 1AROP 2O67A 3KHHA 4NZ0A 5LXRA 2OPRB 4MKAA 3MAQA 4M5GA 3RUBL 1UEUA 5LOQA 5F8JA 3NGRA 2KHCA 2MSSA 2BRKA 1RLDA 3BH6B 5KT7A 4DPOA 1PO6A 1WJ9A 3ISND 1IR0A 1SV5A 3R7BB 1KP6A 3DLLQ 3TAQA 4NA1A 4LF8J 3K58A 3MCNA 3QT7A 4RU9A 3JSMA 2RHSB 2IVMA 2I9SA 5ETKA 1T05A 1ZTWA 3G82B 3H4BA 1DZ5A 1LNQA 3UD4P 4KPYA 3C6TB 3Q8SB 5KG1A 2FJVA 4K0KJ 1N33F 1L3SA 2KFNA 1EQMA 4TY8B 4NYPA 4X4TA 2YQ0A 1FE4A 2RB7A 1HKAA 5E0OA 4QIVA 3FEYB 3W5ZA 3S8SA 2E1RA 2NXCA 2DNGA 1HBNB 4CO5A 1LV5A 1T9TA 4A46A 2JJ4D 2E9ZA 2B56A 2BE2B 3ENAA 3BN4A 3DYAA 4GVLA 4ED6A 4RW6B 2W9CB 2DGUA 2HHUA 2V2ZA 3CJ2A 4DPTA 2CWXA 4PWWA 1YWXA 1XC9A 3BPSP 3OSPA 3G9CA 2VPXB 3V81A 3TUJC 4R8UB 4C8MA 2DRAA 3CCVS 2EK6A 1VC6A 3WIUA 3NBPA 2DYAA 2W4CA 4Q0BB 4P72A 4DR6J 4JI2J 2GHWA 4U7UD 1TR0A 4UT4A 2HFZA 4C9DA 2QMUB 8ATCB 1Y3JA 4OI2A 3EICA 4N47A 3QLHB 2W1BA 4KYZA 3TP2A 3Q8UA 3POTB 1S12A 5KT4A 4N41A 4QJVA 1RACB 4MK7A 4LJMA 1IKXA 1LWEB 4YN3B 3LGNA 4NLVA 3NLCA 4ZPAA 3BH7B 4NLQA 1JIHA 2PEHA 1EETA 2WBMA 4CM0A 3G6XA 3AY0A 1I5OB 3NCRA 5EWFA 2X51A 4HHJA 1RWKB 3A12A 1TMMA 3HJFA 4CT8A 4J9SA 1OY6A 2OSQA 3OTEA 2D9PA 5F9LA 3HHLD 5KT3A 4H4OA 4URQU 4ZS6A 1IR1A 2K06A 4NE9C 2ROGA 4MIAA 2BRLA 2BKPA 2QJ3A 1RAJA 2BW7A 1RWMB 4QYRA 4YY3F 3VTIA 1V6HA 3THVA 2E5GA 5DLFA 3U1MA 2EPIA 5B0AA 2B8QA 4O3SA 4LIWA 4W4MA 5E2QA 2XMTA 1TKDA 2RH3A 4OZ3A 3OVBA 1T9VA 2DJWA 4OJHA 3TAPA 4FPIA 4FXDA 4H54A 1DJ0A 1QAYA 2PI5A 4OYIA 5EWGA 2UUBJ 1TMJA 4K2XA 4USUA 1URNA 4C7QA 3CD7A 4RR5A 3W2VA 2Q79A 2RILA 2ZWOA 2IVYA 3EZOA 1FRJA 2VZ9A 5GMEA 2KM8B 3PKMA 2X1GA 3DM2A 4RNHA 2YVSA 4DZDA 1O0PA 2C3UA 1T0TV 2KN4A 4PPZA 1LQ9A 3UVJA 5J1NA 3TAMB 2E1MC 2VODA 1ZPVA 2ZBIA 2HFVA 3KJVB 2IDLA 4NWBA 4IG0A 4V19X 2HW3A 2MQPA 3VAFA 3DLBA 2XG8A 2DR5A 4IQXA 2XC9A 1IM4A 4NCAA 3N6LA 1SC1B 3GR1A 1VIXA 4RBUA 1X5OA 4CLTA 1FJEB 1EP4A 5JUMA 5DGBA 4OYXA 1JLFA 3D6HB 4CI0B 1UVMA 3A8EA 4ZKAA 4RNMA 1PJ7A 1X60A 4C48A 3CF5Q 3CT9A 3DOMA 4X4PA 3ZZ0A 2JVOA 3HKZD 4C4WA 3H25A 1RAHB 3ETOA 2GQ2A 1P6TA 2KI2A 3HMJG 2OPPB 5ETOA 4F3QA 1Y3KA 3PRBA 1KOOA 4Y34A 3AJ2A 4DFJA 4J9NA 4ZOSA 3MPUB 3AD7C 3I0SB 2AWZA 4LR8A 4B9UA 4KIAA 2NR0A 4KV8A 1TUGB 1N32F 5K14A 5B0CA 4CTAA 3RB0A 2HVHA 2YNGB 2ROPA 2FHJA 1NJIT 4ED4A 4WZMA 3K57A 1RHKB 2XS2A 1S5ZA 3GB0A 2HQDA 3FBBA 1GMUA 5HI7A 3GPAA 1QTMA 1SXLA 5HROA 4ES3A 4ED7A 3M9OB 1S1VB 4YR2A 2IRXA 3FSIA 3RW6A 2MTLA 2VQEF 5AXKA 1H0HB 3FGVA 4B9VA 1U7LA 3J7YU 4A8SA 1G4CA 1KC8T 5HQLA 4UQGA 4TKTA 3P4UB 4FF3A 3OQ2A 4DV6F 1NSPA 2A10A 4WFAQ 2AD9A 2Z2LA 1TV6A 4O3QA 5ETTA 2D69A 1JB0C 4N5SA 3VV2B 2R8IA 2A2CA 4K59A 3BPDA 2CPDA 4OX9J 1GMWA 4PUOA 1IN0A 1QD1A 2FY1A 2J76E 4DS5A 2M0GB 4ILRA 1HL6A 1X5TA 1VBXA 1NKCA 3T1HF 4JI0J 3OHAA 1C4AA 2JX2A 2HAIA 2CJBA 2L08A 2WK4A 4MAKA 2JWNA 4M5LA 4ZIWA 3NNCA 2XMAA 3UN3A 1NSQA 4MMOA 1K1SA 2UU9J 1YLXA 4NYOA 2L48A 4GC6A 1NBEB 3DDIA 1ZAWA 1UJ6A 2F63A 4DR3J 2PO4A 1R0AB 2V8HA 2D74B 5B0EA 4OHVA 4G3IA 5A8WB 3A8KA 3HHEA 1JJ2R 3M2UB 3VGTA 2QEXS 2DR9A 5D3GB 2EC2A 3GQCA 4K4YA 3I0RA 1WHVA 3SCKE 4WKYA 7FD1A 2B5JB 5ADZA 5I42A 2KYZA 4TXSA 1V3SA 3DI6A 2OPSA 1G7CB 2Y1RI 1URRA 3QBCA 3MMAB 3L7UA 5KFVA 4ILMA 3V4IB 3GFYA 4MK8A 2V68A 4HT7A 3M2RA 1NSAA 3MR5A 3KHRA 2DHXA 1UWBB 2DGWA 1NK7A 3DDKA 3MTKA 5FLXU 2F8MA 1D8ZA 1FI4A 3G86A 1FK9B 4F02A 3Q8RB 1YVFA 4NXNJ 1JLQB 2Z4PA 2DGSA 1RTDA 3FRYA 5J1EA 3MEDB 4YDDB 1S0OA 3HZGA 1F9FA 4B3SJ 4QCLA 1SIZA 4I7FA 1LWCB 3EX7B 2UVUA 2FTRA 2ZDPA 1TKXA 3QGGA 2L9NA 1HBMB 4JI7F 2O3DA 3K89A 5K9FA 3AOBA 1PJ5A 4NLGA 2LLZA 3KYLA 4QIWD 3AODA 4UOHA 2W01A 2QG9B 2HVEA 1Q16B 2GNKA 1AA1B 2IC3B 1WDTA 4LREA 1DAXA 3BBFA 3EM1A 4NLSA 3H40A 3GFHA 2YKOA 5KG5A 1U0HB 3I5AA 5DGAA 1XR6A 3NXZA 1K1QA 1BUXA 2YQ3A 3W61A 2AEMA 4KFBB 1SKSA 1JLCA 3J7YI 3JTOA 3RR7A 3ETMA 3E2EA 3NS5A 4IDKB 4IFYA 2GZOA 3W60A 2H5EA 1EKSA 4TNOA 5H9EJ 2ILYA 2RT3A 4PG7A 4R0JA 3SSRA 4N76A 5E5NA 4OX8A 2MQNA 2JLGA 4YB6A 1EB0A 3NGSA 3R6LB 2V50A 2BOAA 2HGMA 2EXUA 4IO9Q 1X4HA 3I31A 2H51B 1SB6A 3FBFA 5DZ6A 5ETMA 4B17A 3CD0A 3M7VA 1SV5B 1T11A 4RW7A 2KRRA 1CVJA 4I64A 4KHRA 4PQUA 3NWGA 2FVSA 3H5UA 4OZJA 3BGLA 1N4LA 4UZBA 1NHKL 3HSZA 1MNEA 1DQ9A 1MMLA 3FRZA 3JSMB 1K73T 2G2ZA 1T05B 3QT5A 3FEZA 4U6PA 5AT1B 2V2QA 2QRRA 3R27A 5CD4A 3PVXA 1XNRF 3MCMA 3J80U 4IFVA 4I69A 4U8VA 1FNMA 4LF8F 1W2BR 4ZVQB 5CAAA 4CDIA 3KTQA 1GTEA 4CH1A 4Q5VA 1NKBA 5B0FA 4OZ0A 2ZBQA 2Z30B 4OYPA 5L8RC 3SV4A 3T5JA 4ILLA 1TL3A 2MZSA 3MR6A 4K0KF 1D8YA 3DYAB 3OFFA 4YR0A 3MGJA 4DZ6A 2ZJQQ 2HURA 3RBDA 1CS4B 3D68A 1IBLF 4UOGA 1VRUA 1IBMF 3D67A 4DUTA 1VQSA 1NNDA 2DISA 2VFTA 3NBPB 4M5IA 4F2RA 2BMBA 2HNDB 3B78A 1S1WA 1BGXT 1PYSB 5C2CA 3HJVA 2W2PP 3T6BA 5IT9U 1RT5A 1S9EA 4ZVHA 2EEYA 3GV5B 5G4DA 1WOSA 3SZ2A 3PRVA 4DF8A 3M4XA 1VQYA 1OPZA 3ZNUA 2C1EB 3PR4A 4FBTA 3BO4A 4Q8EA 1LW2A 5SZTA 3H5YA 2OKQA 5T41A 4X62J 1M5KC 2XZTB 3HK2A 5KFRA 2MJUA 1O51A 1VQMS 2HVDA 2YWKA 1HYSB 2BXJA 1Q8LA 4HYKA 5G0RA 1T02A 2HRTA 4DQQA 2DKOB 4H4OB 1RI7A 2QL9B 4OYWA 2C2OB 1SJQA 1W2IA 4CLSA 4EUVA 1QSLA 1W26A 2ACYA 5LXYA 2RDIA 1UL3A 1NJXA 2DY9A 2KM8C 4P75A 4G1IA 4FNHA 4FZVA 2DGTA 1U2CA 2VG5A 3D3CJ 2L9WA 4B9MA 3MEKA 2D3UA 6FD1A 3UN2A 4DQRA 1FVSA 2MGZA 4ID5A 1G3OA 1X0FA 4YHHJ 4Q43A 4PYDA 4X4RA 2KTQA 2V69A 3W2VB 2XHCA 3CIZA 4ZPCA 1AXQA 2NUHA 4Q8FA 2AZ3A 4JB8B 4ZK7M 3DM2B 3PW2A 1NJYA 1SC3B 3KG4A 3AD9C 2P8IA 5H1SV 3IBFB 4EWTA 1WI6A 1WORA 3UVJB 1IBKF 5J2NA 2YH1A 4BS2A 2ZBCA 1TL7A 4RLEA 1TK5A 1MU2A 4IG0B 5ETVA 2HHVA 2EWHA 5IWAJ 3RB3A 4A8OA 4DDFA 1FFSB 4USTA 4DFKA 1ITPA 2G1HA 1EP4B 1FDBA 1UVJA 4WIQA 1RAFB 1JLFB 3TJ8A 5KG7A 3QGIA 2QTWA 3UPFA 1CG2A 3TRGA 5DQGA 4NRTA 3DOMB 3HVWA 4QWEA 4DSKA 3IC1A 3R1LA 1MROA 1XJWB 5KFYA 2HQCA 1KVKA 1WEYA 1NB2A 3SXLA 5M2PA 2B8PA 4Y2CA 4Z7CA 4JV5J 4JI6J 2CYYA 2V2KA 4J91A 1R6VA 4O23A 3L7PA 3QJJA 4CNYA 3M8PA 5D0HA 2QO3A 3D0IE 2X1AA 4X64J 2I2YA 5HMWA 1TL4A 3THPA 4DLGA 3C19A 2LA6A 4KV8B 3GTYX 2CDQA 5K14B 3NEKA 4CTAB 4RWWA 3M1VA 3TJAA 3M05A 1SVDA 1CJKA 1GEHA 1Q86T 3BSAA 4CLWA 3PHEA 4DX8H 1V9OA 1WSVA 3H0PA 3D1QA 2J9DA 1UMJA 2IJNA 4R5PA 2YWEA 2CQPA 2GJ2A 4QWBA 3R5AA 1JX4A 4DMZA 3NGUA 5HAOA 5HROB 1HNXJ 1NHVA 4A48A 1G2EA 4IRDA 1RWWB 3KUHA 8RUCA 4A47A 2MKKA 2V5HG 1JLBA 3EGWB 1GT8A 1N5YA 2AX1A 4ED2A 3V2UC 4I56A 1YDLA 1S1UA 1FHTA 1HARA 1TV6B 2KFYA 1NPPA 4LF5F 1IBCB 3A4TA 1FRIA 1KD1T 3QYYA 4PUOB 2I1RA 3DHWC 2W9AA
chains in the Genus database with same CATH topology
2OP5A 4CZCA 1NK0A 2JFDA 5F0UA 4EO8A 5T14A 1N8RT 3OHBA 1N5SA 2XY6A 4IOCQ 2AJ1A 3J7ZT 3C2PA 4ETXA 4HTJA 4NLDA 4LVNP 1IKYB 2BA9A 1TAQA 2C3YA 3ISZA 2VBXA 5KFZA 4J9PA 2KXFA 1U1NA 1QVFR 5IXUA 4DJBA 4OI3A 5EWEA 2MKIA 2KO1A 1F0XA 2ALZA 2WB1D 4CO1A 2DGOA 2AGPA 2IMOA 3DHXA 1HFEL 1S1VA 5LSRA 3SQGB 2DO0A 5IT0A 4L3NA 1VQLS 3I9V9 4MKBA 2ZC3A 3QIDA 3LAMA 3V6DA 2PT0A 3MR3A 4WYLA 2KXNB 3IRXB 4C0HA 1YTYA 5HN0A 1L3UA 4OZNA 3MHYA 2BANB 4R0EA 3SI8A 1FEEA 3TX8A 4OJ1A 5BYQA 1H2UX 1Q7YT 3UD3P 4RUHA 4Y2KA 4IR1A 4F4KA 4YP3A 3HI9A 2HHHF 1MSWD 2YKNA 1TQLA 3Q23A 4I2QB 3MD3A 4X4VA 2B6AA 3B82A 2FB0A 1V3RA 4ZCIA 1HI0P 3NMAA 1I6JA 4KAIA 2DNRA 3RB4A 2J0QD 4YHHF 1RT2B 3MEEA 2LU2A 3V4MA 4MJKA 2NLWA 5GAEU 3HHNB 1JMTA 1S7HA 3RAXA 3B4DA 3M9MB 5GAHI 1K0TA 2UV8G 2N4CA 2N7YA 1NB7A 1KVIA 5JVHQ 3S6EA 1X4EA 1FTRA 3K8WA 4DR2F 1YRTA 3TW0A 4JI8F 1RTJB 3THTA 4WZQA 2J5AA 3PACA 3UR0A 2DCUB 4F4XA 1HA1A 2F3JA 2V94A 2MDAA 3I96A 3WX4A 3KHGA 5FDLB 3M8RA 4BC9A 1TKZA 4D3HA 2V0NA 1KQKA 3PJWA 1DTTA 2QA4S 3DLHA 2VA2A 3ZZOA 1S77D 5DM7Q 1H98A 2DHSA 1FO1A 1U45A 4I4BA 1NK8A 3O3LA 4WCEQ 4B3OB 1XNQF 1RDRA 3VZHA 2J9CA 3AB4B 4PXDA 2LXFA 3FMBA 5B7WA 3Q0AA 1HHSA 3S01A 1X4DA 4DN0A 3VCDA 3I0RB 4DSEA 3FCHA 1P27B 5CCMA 4LSNA 2UU9F 4JYAF 4J9LA 5KG6A 1HBOB 5A6WA 5THWA 5JJBA 3GIJA 1N54B 3MM5A 1SH0A 4KGKA 1KRPA 1U2RA 5LSLA 4B3RF 1P1LA 2AYBA 3RZAA 4IKAA 1NO8A 5LT5A 5L1JA 4Z37A 4ED3A 4PG4A 3N5FA 2AJQA 4HI1A 3KLIA 2W25A 1ZETA 4NLUA 1M5SA 4DR3F 1YIJS 2BUNA 2QA4G 5I42B 2HMIA 5KFUA 4AE5A 5A8KB 2KH9A 3BQ1A 3QJPA 1S0VA 2PGCA 3DI6B 5ITHA 3GIKA 5IWAF 2A2DA 5D6GA 3DFEA 4H4KA 2VPZB 3EUNA 4H4MB 4PCQA 4NCBA 1Y7PA 2RQ4A 5GMKa 4Y6IA 2OPSB 4UY85 4CH0S 5C25B 4JV0A 2JC0A 2CPZA 4QOTA 5F8LA 2AW0A 1H2TZ 3O5TB 4ED5A 2PMZD 5HO4A 1I94F 2ZOGA 3PX6A 3DLGA 2DK2A 5KAKA 1RA6A 3I87A 2R7WA 3PW4A 3MPVA 2CQ0A 1KFSA 3UCGA 4NPOA 3CDUA 3H59A 1BQNA 4LIRA 4B9TA