2HNZB

Crystal structure of e138k mutant hiv-1 reverse transcriptase in complex with pett-2
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
422
structure length
399
Chain Sequence
b'TVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNKTPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase/ribonuclease H
publication title Structural insights into mechanisms of non-nucleoside drug resistance for HIV-1 reverse transcriptases mutated at codons 101 or 138.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 109
structure length 399
sequence length 422
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2006-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2hnzB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2hnzB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2hnzB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2hnzB03
4GC6A 3KLHB 2FVPA 3CJ0A 3IG1A 3LAMA 5KFAA 1RT1B 1W25A 4G1QB 1S1WA 2OPQA 5KG2A 4ZPAA 1YVFA 4ECVA 5KFTA 4ZP7A 4K4SA 5JUMA 2DPIA 4M95A 5DLFA 2IM1A 3MR5A 3NGDA 3M9NB 5L1KA 2R2RA 3GIJA 1I6JA 4LSLA 1IKXA 3QGHA 4Q44A 3G6YA 2WHOA 5I42B 1RT4A 2FVSA 1JIHA 2D41A 2BANA 2XCPA 4WZQA 3BQ0A 3IRXA 3I5BA 4EYHB 4TLRA 3V4IA 2R8JA 3KMQA 3I0SA 1SH0A 4LSNB 5EUHA 3MECB 1K1SA 1TP7A 4RUCA 5J2QB 1BQNA 1RTJB 3BREA 3I5CA 3OL9A 3PR5B 2R8HA 3JSMB 3NBPA 3LP2A 4XO0A 4J9MA 1XR6A 4ECRA 1JLBB 1N48A 1S0MA 1MU2B 2V9WA 3N6NA 2OPPA 3KLIB 4QWBA 1RYRA 4JV2A 4IR1A 4U6PA 4NLPA 1JLGA 2IM0A 1JLCB 1C1CA 3DOLB 4KFBA 2OPRB 3KHRA 1RT7A 4KV8A 3C6UA 4Q43A 1SH2A 3HKWA 2IMWP 2YNFB 2WTFA 3BGRA 1EETB 4WE1B 3DMJB 5CYMA 1RT3B 3CO9A 4ECUA 4IOBA 5EWFA 2XC9A 3E01B 4R5PA 4ECWA 2BQ3A 1K1QA 1S49A 4O3NA 2AGOA 4XPCA 1HQEA 3I0RA 4RW9B 4KHRA 4DG1B 3KLHA 3DDKA 1JXLA 5C25A 2W8KA 4ED3A 2IA6A 4ECZA 1RA6A 4J9RA 5KFHA 2FJVA 2R2SA 5DQHA 3TQ1A 1TL1B 5K14A 4H4MB 2UUWA 3MFIA 3OL6A 3KLVA 1VRTB 3BQ1A 1TL3A 4NLGA 5J2MA 4RNFA 4R0EA 5F8GA 4PWDB 4PQUA 2B6AA 3KJVB 3CJ3A 2VA3A 1S1XA 5DG9A 2VG7B 2XWYA 5F8NA 1SUQA 5KFDA 2UVWA 3MECA 2YNIB 1N4LA 5KFZA 4NLWA 1BQMA 5J2QA 2FVCA 4JV1A 1LW2B 2ATLA 2HWIA 4NLXA 1VRUB 2HNYA 4YQWA 4MFBB 1MU2A 5KFBA 2B43A 3DM2A 1S1TB 4R8UA 2R8KA 4RZRA 4RNHA 2DPJA 4MIBA 5KFYA 2XI2A 1JLCA 1C2PA 1HMVB 3ICLA 1FK9A 1C0UB 2F8EX 2RF2B 2ASLA 3HVTA 1DTQB 4HKQA 2XCAA 4J9KA 4JV0A 4IFVB 1S1VA 2YNFA 1LWCA 4K4VA 4WE1A 3TVKA 5D3GB 3OLAA 1GX5A 4EBEA 4IRDA 3MEDA 4O4RA 4RUAA 4K4XA 4K4YA 2IM2A 2BRKA 3MEEB 1N5YB 2W9CA 4ZPCA 4DG1A 3TAMB 2I5JB 1S6QB 1CSJA 1S97A 2W9AA 1HQUB 1ZETA 1RA7A 1S4FA 4J9SA 4MK7A 4TQRA 4F4WA 4F4XA 3D28A 1C1BB 2YKMA 1J5OB 2WOMA 3UDLA 4H4MA 1RT2B 1NHVA 3JYTB 2RDJA 4ZVEA 4WYWA 2IC3B 2GIRA 1DLOB 1TQLA 3FQKA 4DEZA 3KMSA 1JLFB 4B3OB 1FKOB 2AQ4A 3DYAA 4ZP8A 3KJVA 3PW7A 3MFHA 4IH7A 2BR0A 2FLPA 4YR0A 2HNDA 5JXSA 4KKOB 3DLKB 4ZVGA 4TY8B 3LAKA 2ILZA 3QO9B 1QAJA 3KLGA 5DG7A 4NLQA 4ZMMA 2E9RX 5KFVA 3DRPB 3LP1B 1S10A 5F8JA 2IJNA 1RTHA 3PHEA 1VRUA 3RAXA 3SFGA 2YKNA 1KLMA 1WNEA 2R2UA 3KLEB 4ECQA 5J2NA 5HP1A 4EO6A 1JKHB 4RW7B 1HPZB 5KT5A 3OL7A 4RW8B 3QZ7A 1C0UA 5I3UB 4QWAA 2CKWA 3KK2B 4LQ9A 3EPGA 1DTQA 3LP0B 1R0AB 3BQ2A 4LQ3A 5HBMA 4ED7A 5D3GA 5J1EB 3MF5A 5KFQA 3MTKA 3QYYA 2JLEA 2BE2B 1TKXA 2QE5A 2HMIA 3PZPA 3PJXA 4YR3A 3MEEA 3RBDA 4ICLA 4RW4B 2ALZA 5C42B 4DL5A 4EYIB 2JEFA 4NLOA 1DTTB 4ZP9A 4IDKA 1JLQB 1S6QA 1JLEB 2I5JA 3KK1A 3NAHA 3FRZA 4YR2A 4NCGA 1QE1B 1N6QA 4O44B 1C1BA 4Q45A 1LWFB 3IS9B 1J5OA 3BJYA 2IAJA 1HNVB 3OSPA 4IG0B 3EPIA 2ZD1B 1RT6B 3T5JA 5KFKA 3H40A 4NRTA 1HNIA 3FFIA 3UR0A 4YP3A 1DLOA 3V6JA 1JLFA 4QWDA 4IG3B 3NL0A 1IKVA 1SV5B 4I2PA 3C6TA 4KBIA 3QGGA 5KFRA 2O5DA 3H2LA 4PUOA 1TKZB 5F8HA 5KFWA 2E9TA 4RW6B 3KHGA 3QIDA 1C0TB 2HNZA 4WZMA 3M8QB 2CJQA 3OLBA 5EWEA 3DRPA 2AGQA 3DLEB 3NKYA 1FKPB 4MIAA 4O3PA 4NRUA 2R2TA 1UWBB 3CDUA 3H4BA 1RT1A 2AWZA 3GQCA 5F8LA 5KFCA 2XGPA 4G1QA 5C24B 2YNGB 1KHVA 2WCXA 1JKHA 2V4RA 1HPZA 2QV6A 4NLSA 1JLAB 4FS1A 4NLDA 4RW8A 4KSEB 2E9ZA 2XGQA 4JUZA 3KK2A 2FVQA 1R0AA 4NYZA 2ASDA 4KO0B 4ED2A 5I42A 4O4GB 4TN2A 4I2QB 2EC0A 3PW0A 4Q0BB 4WFYA 4Y3CA 3M9OB 4URQU 3GILA 2BRLA 4RU9A 1S9GB 4RW4A 4KB7A 4EO8A 1XR7A 1ZTWA 5KFMA 3BSAA 1DTTA 1HARA 4LSNA 4J9QA 3KK3B 4FBTA 5KFNA 3OHBA 2I1RA 4K4ZA 3CJ5A 1RTJA 1S6PB 2WONB 4Q8FA 2IM3A 3SFUA 3GIIA 3V6HA 3JSMA 4ED6A 4IRCA 4F4YA 1RTIB 1JLBA 2GC8A 4O44A 1TV6B 3V6DB 4I7FB 3IS9A 3KLIA 1TVRB 1IKWB 3DOKB 1RT6A 1RT5B 5KFPA 3G6VA 3H5YA 2B5JB 5DGBA 3DOLA 4K4UA 2OPRA 2FJXA 4H54A 3QZ8A 4ZHRB 5KFUA 4IG3A 5CYQB 4DL6A 4ZVFA 4H4OB 1S48A 1EETA 2HAIA 3QGIA 3DMJA 3V81B 4KHMA 1IKYB 4MKBA 1TKZA 1RT3A 2HWHA 2W9BB 2OH2A 5KG6A 4TQSA 2UUTA 1C0TA 3RB4A 3DRSB 3E01A 3ITHB 4MH8A 3FDSA 2ASJA 1S0NA 1RDRA 1LW0B 4KAIA 3GIMA 4FS2A 2JEGA 2YNHB 4RW9A 4Y34A 5KFFA 3RB6A 4K4WA 2YNGA 1S1WB 2OPQB 4X2BA 3CIZA 1JLAA 3NMAA 2D3UA 3SI8A 4IRKA 3CVKA 4ID5B 4OL8A 1TL1A 1IM4A 4LSLB 1IKXB 1VRTA 4TYBA 3FSIA 5KT4A 1N56A 2RKIB 2C22A 3BR9A 3IRXB 4I2QA 4URGA 5J2PB 4PWDA 4DL4A 1T3NA 2VA2A 1T03B 3T19A 1S9GA 3LALA 5FDLB 3V4IB 4NLRA 2VG7A 4ED1A 2OPSB 2BQUA 3I0SB 2C28A 1Z4UA 2WB4A 3KK3A 5KFJA 3RAQA 2YNIA 5EDWA 4J9PA 4Q8EA 3RB0A 1S6PA 1LW2A 2WONA 3KOAA 3DLGB 3QIPB 3I5AA 3NBPB 3LP2B 1RTIA 2WRMA 2XI3A 4MFBA 2W8LA 1TV6A 3V6DA 4I7FA 4ECYA 4ED8A 1S1TA 2BQRA 1JLGB 3PR4A 1QUVA 3Q8RB 2B5JA 1C1CB 1HMVA 4KFBB 5KT3A 2UVUA 4MKAA 4ZHRA 1RT7B 2V0NA 5KG1A 2RF2A 3C6UB 4M94A 3IN5A 3GV8B 4IFVA 3PJWA 2AGPA 3BSOA 3D5MA 3ISND 1IKYA 5CYMB 3RBEA 4QWCA 3MR3A 3H5UA 4IKAA 3ITHA 1N5YA 1T05B 3G6XA 3CJ2A 1RYSA 3TAMA 5C25B 4QW9A 2IBKA 2R8GA 3UQSA 1HQUA 4WXOA 2FVRA 2GIQA 3FQLA 3H5XA 3T5HA 4KE5A 4ID5A 3PVXA 5K14B 1RT2A 4DL3A 3JYTA 3KHHA 2IC3A 2RKIA 1TL3B 3EZUA 2C2EA 5J2MB 5KFEA 2JEJA 5F8MA 1MMLA 4B3OA 1FKOA 5J2PA 4PQUB 2B6AB 2VG5B 1TKTB 1T03A 3V6KA 1S1XB 5L1JA 5KT7A 1LWEB 5FDLA 2D3ZA 4WFZA 3OSNA 1JX4A 2OPSA 4ZVHA 4KKOA 3GV5B 4U7CA 3DLKA 4J9LA 4EBDA 1S9EB 1SUQB 4TY8A 2JC0A 3H5SA 3IGNA 4FBUA 3QO9A 3N6LA 3E51A 3HHKA 1BQMB 2AX1A 3LP1A 3DLGA 1RTDB 3QIPA 3DRRB 2HNYB 2IJFA 5L9XA 3KLEA 4NLVA 4IR9A 2UVVA 4K50A 3DM2B 1D0EA 4XPEA 2WK4A 1HYSB 3BSCA 4R8UB 2AU0A 3QLHB 3KLFB 4NLTA 5DG8A 4RW7A 4HYKA 3CDWA 1U09A 1FK9B 5I3UA 5L1IA 2C2DA 2FLLA 2UVRA 3HVTB 3LP0A 4IH5A 3OL8A 3KNAA 4NLUA 4ECTA 1S1VB 3GYNA 4RNMA 1LWCB 1S9FA 5J1EA 3UPFA 4WFXA 4ZPBA 3MEDB 5HROB 1S1UB 2BE2A 3N6MA 3GV7B 5DGAA 3H59A 3T5KA 2ZE2B 4QW8A 1T05A 1REVB 3CDEA 4Y2CA 5C42A 2W9CB 3CWJA 4G3IA 5KG5A 4ECSA 4O3RA 3BSNA 1JLQA 5KG3A 1JLEA 2W7OA 4ECXA 4EEYA 1QE1A 3DI6B 5DQGA 4QPXA 4DL7A 3MEGB 4MK8A 4WXWA 5KFIA 4TYAA 1LWFA 2YKMB 2WOMB 4TY9A 1HNVA 4IFYB 4IG0A 2FLNA 5KFLA 2ZD1A 4O3SA 5F9NA 1EP4B 2R8IA 3PW2A 4DL2A 1NNDA 1T94A 1GX6A 3PW5A 3DYAB 3Q8PB 2VG6B 3MR6A 2VG5A 1TKTA 4J9NA 3G86A 4ED0A 1LWEA 1SV5A 2HNDB 4ZP6A 1S9EA 4IH6A 5F8IA 4RW6A 3KLGB 3H98A 3M8QA 5KG0A 3M8PB 3DLEA 5L1LA 1FKPA 1RTDA 5HLFB 1RTHB 3DRRA 2RDIA 1XR5A 2YKNB 1KLMB 3MR2A 5DLGA 1D1UA 1UWBA 3IG1B 5J2NB 3T1AA 1S0OA 5HP1B 1HYSA 1KHWA 4IQXA 3QLHA 5C24A 3KLFA 4O3OA 4WYLA 4Y2AA 2J6TA 5KFSA 2JC1A 2C2RA 4QWEA 4KO0A 5HBMB 4K4TA 2D7SA 3HVWA 5F9LA 2V4QA 5KFOA 1RT4B 3CJ4A 3PW4A 2BANB 4O4GA 5HROA 1S1UA 4MK9A 4Q0BA 1TKXB 4YMEA 2ZE2A 2HMIB 4GC7A 3H4DA 5KFGA 5KG7A 2J6UA 4ICLB 1REVA 3M9MB 4NZ0A 1QAIA 2JEIA 2FJWA 4ZPDA 3GIKA 1NHUA 4IDKB 4EBCA 3KK1B 5KFXA 4NCGB 1BQNB 3DI6A 4O3QA 1N6QB 3VQSA 2AX0A 3HVAA 3Q8SB 3RB3A 3MEGA 2OPPB 5KT2A 1TVRA 2IAJB 4IFYA 1ZTTA 1OS5A 3OHAA 1IKWA 3DOKA 3NAIA 1RT5A 4TXSA 5KG4A 1EP4A 5C5JA 5KT6A 1HNIB 3FFIB 3T5LA 3Q8QB 4J9OA 3IGVA 4KV8B 5EWGA 4F50A 2VG6A 4URSA 5DQIA 5CYQA 1IKVB 4I2PB 4H4OA 3C6TB 3BGRB 1RAJA 4F4ZA 3V81A 5T14A 2ZKUA 4PUOB 2W9BA 1SH3A 2W7PA 4RNOA 3ISNC 2HNZB 2J6SA 3LANA 3DRSA 4R5PB 3M8PA 2ILYA 3KHLA 1LW0A 4NLYA 5HLFA 4RNNA 1HQEB 2YNHA 3I0RB
chains in the Genus database with same CATH superfamily
2BM1A 1S1WA 4ECVA 2B4OA 2DPIA 5DLFA 4KGVB 3M9NB 4PXEA 1IKXA 4ZOSA 4OJ1A 1U0HB 1UJ4A 3G6YA 3TJ9A 5K8OA 4YHHF 3AY0A 2NYIA 5IM0B 2XMJA 3CE8A 1BQNA 4CZCA 2MZQA 1S0MA 1XR6A 4QWBA 1RYRA 1NK9A 2X3GA 3R2DJ 2HHHJ 1YRTA 1UVJA 1YG0A 3R27A 3ILIA 4V19J 1NK7A 2MQMA 3VAGA 4OX6A 5CH7B 3MPWA 3PRVA 1PAUB 3CJ3A 3JSRA 3DKDA 4ZA1A 4KH1B 1SUQA 4DR4J 3DHWC 4UOGA 4NA3A 3NGKA 1RTZA 3QAUA 2R8KA 3NCPA 3RR7A 1X7VA 4LFCJ 1HMVB 2Y0BB 1C0UB 1ZM9A 1BGXT 2BJ7A 3KUEA 2DKOB 4B3RJ 5GADI 3FSXA 3CXCR 4F26A 2UUBF 2WSEC 5E3CA 4K5RA 1JLFB 3FUYA 3PW7A 1Q86T 5LM7E 2AT1B 1WD6A 3DDIA 3ENVA 1NK4A 1F3FA 2ZM6J 4JI1F 3U27A 3AH6A 3QZ7A 3BQ2A 4CT8A 5KFQA 1Y0HA 4ICLA 4NLOA 1JLEB 4ZVPB 1T02A 3QQCD 4DFJA 4RUBA 2DRAA 3PX4A 1X0FA 3Q83A 4ZS6A 3N28A 3FCHA 1TKZB 1FF2A 2HNZA 3M8WA 2AGQA 1KP6A 4NRUA 1U1KA 2SXLA 2XGPA 2WCXA 3C14B 3C3LA 4JI6F 1R0AA 1QD1A 1SJ4P 1U0HA 1N88A 1FNOA 3S6EA 3GILA 4PG8A 5IM0A 1VQYA 1FTRA 2I1RA 2BKOA 3NMRA 2EBGA 2CG8A 1N5QA 4H54A 3ENWA 1KBRA 1NCLA 1RAOA 1B0TA 3H25A 3NRBA 3BBCA 4I6AA 2UUTA 2XG8A 2LXIA 3CT9A 1U47A 4X4TA 2BZ2A 4X2BA 1JLAA 4USKA 3TZWA 2ZJPQ 2V8PA 2QGFB 5B0CA 2OIHA 4C2MA 3CF5Q 1L3SA 3P49B 2EFGA 3EJMA 5DDOC 2DR7A 3PR4A 1HMVA 4MKAA 1KEKA 3LW5C 4KY3A 4C11B 3P5BP 2DO4A 2BJ9A 2D9OA 3KWMA 4FN5A 4QW9A 2IBKA 2R8GA 2E7WA 2VBWA 2XZWA 4ZITA 2D3ZA 3CJKB 2OPSA 4K59A 4U7CA 4WK3A 2JC0A 3QIPA 1D0EA 1TMJA 1IQZA 1FK9B 3F0NA 4NA2A 4I4BA 2CVEA 2Z58B 1KRPA 3BGLA 1H72C 5F41A 2FD2A 2RU3A 1JLEA 2E1MC 4QPXA 3MWBA 2OKQA 1XMOJ 3KG0A 1G1XA 1ZA1B 3H98A 1XTZA 1RZMA 2BW2A 1TMMA 3OD2A 1LNQA 3V4MA 3LWLA 5HP1B 3C14A 2J6TA 3HFKA 4DQSA 1Y9OA 2J6UA 1NKBA 1NEEA 2Z0GA 3GWCA 1FDAA 3U1LA 2V8DA 4KV8B 3CCJS 2QFIA 4TVAB 3C6TB 4ELUA 2Y3YA 2ZKUA 1HD1A 3ISNC 2G2OA 4TU8A 2LQJA 4LF5J 4DUYF 3Q2SC 2PSZA 3CJ0A 2MHEA 5KG2A 1RABB 4C3MA 4LIRA 1FEEA 2FJAB 2ZH4A 4XTTA 2XSFA 2R8JA 2C2NA 5BJRA 2W2MP 4RUCA 1H7WA 2WVDA 3IBWA 5IV4A 1VC0A 2B8QA 1JLCB 4DV3F 1CPZA 3UD4P 3RRKA 4LT6A 2OSRA 4C11A 5EWFA 1VHFA 2W8KA 2G1HA 3DHXA 3MR7A 2FJVA 3AOCA 2HRUA 3BQ1A 1PC4A 3CJKA 3G8TA 2HBZB 1M5PC 4KPYA 1FDNA 5HL7Q 1C2PA 1FK9A 3GB0A 2ASLA 1RGVA 4K4VA 1WKKA 2M2BA 3MPYA 3AJ1A 4CLKA 3GE9A 3QRQA 3CMAS 3HF5A 4YY3F 1VK3A 1WEYA 1S4FA 1J5OB 1NPKA 4DR2J 1F5BA 5DO2A 3CJTA 3LAKA 2CQHA 2MKKA 1HL6A 5ETVA 5HP1A 2C42A 4QWAA 4BBYA 2UXCF 4AXJA 1PILA 2W2OP 5L38A 1U1RA 3FGVA 3SQGB 4L6V3 4L3KA 4CRJA 1VQ5S 4O44B 2PMWA 1R6YA 1H2VZ 4UQGA 1UW9A 2ZWPA 4USJC 2R7TA 4UQTA 2CDQA 3C6TA 2XBPA 5KFRA 3L7UA 3H2LA 1RU1A 4ZCIA 5KFWA 4RW6B 3J81Y 2NXJA 3OLBA 3NKYA 2OEKA 3TA0A 1VDHA 2ZBIA 2H65B 2AWZA 2XWXA 1BUXA 5LJ3Y 2HZVA 4RLEA 2ASDA 5MLCV 3R5JB 3PRDA 2HLTA 4USMA 4IRCA 3IS9A 4L3NA 2CRLA 2I0XA 5KFPA 3R7NB 4M5DB 3I4PA 3RR8A 4IG3A 2JWNA 4H4OB 3P3DA 1OSCA 2OH2A 1TL7B 2CWKA 3MCOA 3TQEA 4KAIA 3CCUS 1K73T 2XY7A 5LXRA 3RB6A 1YX2A 2CPIA 1N52B 2ZH9A 1H98A 1QSSA 1EB0A 2XULA 3MCSA 3IRXB 1VIOA 1DBDA 3T19A 3V4IB 3VQTA 1VQPS 3HZEA 2QZ8A 2DH9A 4A8KA 3RB0A 1WHXA 2O1PA 2D1CA 4HLBA 3IN5A 4DXLA 4UOHA 3I9ZA 3H5UA 3THVA 3ITHA 4GRSA 4P7VA 2DEIA 2UUAJ 4A47A 4WXOA 1HBUB 3K8VA 4ILLA 4LRFA 3UWTA 5J2MB 5LMUJ 1UZHA 1RK8A 3P8BB 3R7SB 1WKLA 2VONA 4K8RA 2AX1A 1X5SA 3DLGA 4NASA 1RHKB 2OAUA 3HP6A 1Q53A 4B9UA 2IIHA 4DLEA 4ZPBA 1QSLA 3W7BA 4RR5A 4HL9A 5K9FA 2LLZA 2V63A 4A8XA 5JVGQ 3SQGA 2KJVA 3NS5A 5HQ8A 4CLLA 2DR9A 2ZHOA 1UFKA 2AJ1A 1ZOTA 4WFBQ 2YQ0A 1X4BA 4ZJQA 4MAKA 2DYAA 4OJHA 3MGJA 5IXUA 1NDCA 4RW6A 2WSFC 2O66A 4M5HA 3BGUA 3PTWA 4HVZA 4U8VA 4U96A 4MMOA 5HQMA 3OTOJ 2CADA 3HHDA 3TOQA 2HHHF 5GADU 3M9MB 4DPYA 4ANEA 4RBUA 2ZNYA 1HQ2A 3KUGA 1X4DA 4TXSA 1HNIB 1RAGB 4M5DA 3FBBA 2XS2A 2PEBA 3PIOQ 1IKVB 4H4OA 3OTBA 4F4ZA 2N7CA 1VQSA 1NM2A 4ITSA 3M8PA 2NXEA 1YJ9S 3K59A 2FVPA 5DJBA 4DR4F 3SMZA 3HMJG 4CLWA 3L4BC 4ZP7A 4M95A 3TVZA 2YQ3A 2GVZB 5L1KA 3NGTA 1I6JA 4C8OA 3QT8A 1NZAA 4LR9A 3IRXA 2MSTA 4NEYA 4LFCF 3V4IA 3BREA 3EVWA 3I5CA 4B3RF 1AYEA 2ZJRQ 1S59A 2LXUA 3BO2A 3KDNA 3FVYA 3HKWA 2YNFB 3PXGa 3BDPA 1ELOA 3DMJB 5RUBA 1JQGA 3MM7B 3D68A 5DZ7A 2CPXA 1RWXB 2BQ3A 4XPCA 3I0RA 2ZC4A 4RW9B 3HXMA 3HK2A 2QMWA 4ECZA 1RA6A 4ETZA 4A8QA 1HBUA 5H9EJ 1U1MA 2MQOA 3MFIA 2ZM6F 2HVEA 4L72B 5J2MA 4R0EA 4OYWA 6AT1B 2G0CA 4QR2A 5KFYA 3ICLA 3GP9A 2LDIA 4DU7A 4J9KA 2FJDB 2JZ5A 1N34J 5BXIA 2AZ1A 2W7AA 2AYEA 2BRKA 1CBKA 3QRRA 2MZTA 5U47A 1TK5A 1N36J 4W90B 4H4MA 1RT2B 3X1LB 1RHMB 2LECA 4GKJJ 3NGRA 1NMEB 1YGYA 3HSZA 3AJ2A 3FMWA 4KKOB 4CYUA 3RW6A 3BH6B 4DV2F 1HWIA 3K57A 3KLEB 1FNXH 2IRUA 1YJTA 2MQQA 3H8YA 1XERA 1WC1A 1FX4A 2DNPA 3SV3A 1HBMB 1X4GA 3QT7A 4LF7J 3J7YI 3PACA 1A9NB 2I5JA 1JJCB 2DVIA 2OUGA 1H74A 2LDYA 2XMAA 1UEVA 1Y00A 1HNIA 2NUUG 4QWDA 4P7TA 1IKVA 1UKUA 3QGGA 2O5DA 2IYGA 3QIDA 3EDRB 1KFSA 2LEPA 1FKPB 3GQCA 1QTNB 1KHVA 5C24B 3Q23A 2QEXS 2XY5A 2GVZA 2KXHA 3B78A 2XM3A 3FBFA 1U49A 3PHTA 3A1YG 4HDGA 4WFYA 4PPZA 4ZKAA 4RW4A 1KOHA 1ZTWA 2QTWA 2XZDB 3MPVA 5KFNA 2DY1A 3QRPA 4PG5A 3V6DB 2QC3A 1TVRB 1IKWB 3T9ZA 1T95A 2YPZA 3BKTA 2QMXA 3G82A 2BJDA 3DMJA 5HK4A 3MM7A 4B02A 1V6HA 3RRGA 1LW0B 4RW9A 4OYOA 4Y34A 5MAOA 2DHHA 2H4WB 1U2FA 2IVYA 4NI2A 4OZ2A 2H54B 4DR7J 2C3PA 5KT4A 3VVTA 5JJBA 4NLRA 4OHZA 1HFEL 2RU9A 2GHVC 3PYGA 2VICA 2WRMA 2BX6A 3DFEA 5D78A 2E44A 1HNZF 1O8BA 2AGPA 1XMOF 5AT1B 4GKKJ 3LO3A 3M2UA 3UE2A 2COLA 1TR0A 3RBXA 1YDLA 3K0JA 2CJKA 2QA1A 2YWWA 1RT2A 2OLWA 2YKQA 1TZ0A 2J9DE 4J90A 4KKOA 9ATCB 3UNYA 1BQMB 4L73A 1H2UX 5L9XA 3KLEA 1X4FA 2WAQD 3FCWA 1U09A 4CLPA 3C15B 3G2XA 4ZPWR 1UP1A 1S9FA 1HBMA 2K7JA 3KKFA 2HIQA 4ECSA 4OYMA 3RU0A 4O3RA 4EEYA 4CCHA 2NXCA 3EZ5A 2L41A 4WXWA 4LF5F 1KC8T 5CABA 1HHQA 4ALZA 4FNIA 4F0HA 1FKPA 4P9SA 4OYPA 2B4PA 2X1BA 1KLMB 4M5MA 2NPFA 1RQ0A 3AD9C 4NXMJ 2DNYA 5C24A 1H38A 1RWPB 3HD2A 4IO1A 5CZXA 2RMLA 3PW4A 2GQCA 5LJ5Y 2ZE2A 2GGPB 2FJWA 4ZPDA 3DN9A 4B3SJ 4CH1A 4P2FA 2AMCB 2AX0A 4PR6A 3EXCX 5K8NA 1TVRA 1IKWA 5KT6A 4I67A 3DNCA 3T5LA 3BDEA 4LF9J 3D0IE 2G2ZA 2GIFA 4LRDA 1TL4A 4O0IA 3I4HX 2W7PA 1CQMA 3ENQA 1LW0A 2UP1A 4OHXA 4M8LA 1YBUA 2QA2A 1S12A 3FEZA 3O8WA 4K4SA 1GQEA 5I42B 4A8YA 1YJ7A 1HNWF 1RAHB 2ACYA 2F1FA 3KMQA 2HQFA 4LSNB 1OYDA 2OGUA 5G4DA 3PR5B 1JLBB 1FD8A 4K2JA 4NLPA 4DL0C 4J9UE 1FKAF 4ZN1A 2BJ8A 2IMWP 1RHRB 4NMXA 2EFQA 2JFDA 3M6UA 4R5PA 1AXQA 1K1QA 1WF0A 2AGOA 3N9UC 4YFUA 3LOUA 3MOZA 2IA6A 5DQHA 5C2CA 1V5VA 4ETXA 3LPYA 1TL1B 1BWEA 1XNQJ 4EI2A 2GZOA 2MTLA 2XYGB 4QBUA 1BQMA 4YB6A 1LFWA 4F3MA 2XI2A 2QX0A 1T8EA 2RF2B 4C6AA 4DR3J 3C15A 1GX5A 3VAIA 4I56A 1KQGB 2WBMA 1WSRA 1S6QB 4DF8A 4F4XA 4YS2A 3BZQA 5AXMA 3B54A 2HVDA 4IH7A 3NNCA 3UR3C 2GJIA 3HI9A 2DO0A 2ILZA 4NLQA 2WVFA 3TW0A 3PHEA 1KLMA 1WNEA 4KT0C 2O3DA 3L7PA 1PIEA 3K2YA 4BS2A 2NSCA 2CKWA 2GW8A 4ED7A 5D3GA 1MSWD 4OLOA 2HEKA 4P2MA 3RBDA 3UW1A 2GGPA 2WZ1A 4QYZJ 3NAHA 1X9SA 3FRZA 4WKYA 4ZIWA 4F3OA 4LBPA 1T3OA 1LWFB 3BJYA 3BO3A 3TUIC 2KN4A 1FI4A 4NRTA 1ZAXA 2ZZMA 3TZZA 4I68A 3S1TA 4QR0A 2CJXB 2E9TA 1FDDA 2ZOGA 3D3CJ 4AE5A 4O3PA 3DLHA 4OYBA 4ZVRB 5D0GA 1K9MT 1PG5B 5I42A 4LJMA 4I2QB 2AP6A 4Z2XA 4URQU 1EX8A 4LSNA 2QG9B 4DU8A 2DGUA 2IM3A 2ROGA 1JLBA 5B0FA 1TV6B 5LMNJ 3R5DA 1SJ1A 3DDNA 2UUAF 3TA1A 2XMMA 1Q81T 5LMUF 2CQ3A 1RBLA 2LKZA 1NK0A 3GIMA 1QAXA 2HQCA 4NXNJ 3M32B 4K4WA 4ZCLA 2PMZD 1WC3A 3SI8A 2JLGA 1TL1A 4V1Ak 2A18A 4RKUC 5GMEA 2RKIB 5T7LB 3D7SB 3SSSA 4QIVA 4YDXA 1J27A 1RTIA 4DSIA 1UFWA 3ELHA 1UJ5A 3EZOA 1IN0A 2HYIB 3K58A 1IM6A 2FY8A 2RF2A 4X66J 2PMHA 3JSBA 2BABA 3B4MA 2M7SA 2Q6CA 1SQGA 5SUHA 3SXLA 5IOLA 3TVYA 2JEJA 2UXBJ 2K7KA 5LOQA 2B6AB 1S1XB 1LWEB 4ZVHA 2CQ4A 2DT9A 5A8KB 1IR2A 4FXVA 4TNOA 1WWHA 1PYTA 3CC7S 1RTDB 1U26A 2CZ4A 2BXJA 2PI4A 3H2VE 2UVVA 3QLHB 4NLTA 3ZZRA 2FLLA 1Z2ZA 3SZ2A 1K44A 1NJYA 2LCWA 3N0VA 4DSJA 3DU5A 3CDEA 1REVB 4Y2CA 2HVIA 3NG8A 5KG5A 3CDAA 5B0GA 5DQGA 2R7WA 1LWFA 2LYVA 2F40A 5FLXY 1X0PA 4DZDA 3AB4B 3CSKA 3A12A 2JHEA 3R97A 3MM6B 4HHHA 2Z8QA 1QVGR 3EXYA 4CQ1A 3KLFA 4O3OA 4WYLA 5GVQA 2JC1A 5FJ4A 1UEUA 5KFOA 2BANB 3CD7A 2W24A 3RGIA 1H3DA 2JEIA 3A8EA 3W9JA 2G0IA 1UETA 2AEMA 3HVAA 4I6YA 1OS5A 4IFYA 1ZTTA 1KTVA 4QYRA 2XSJB 2MB0B 2J7UA 2ZWOA 1EP4A 1J5EF 5CD4H 2IFXA 1VYAA 4F50A 2Z2ZA 3AAWB 3W2WB 5ETLA 2X1GA 4PUOB 3M8SA 5B0EA 5HATA 2ILYA 5HLFA 1C4CA 1BHNA 3IG1A 3LAMA 2QRRA 5KFAA 3M32A 4UOCA 3CPWR 3NOGA 4JB8B 1NSKL 2JL9A 1JIHA 5GAHI 3J7YU 1CJTA 1N34F 4H4KC 2FHJD 1K1SA 5IFMA 1SB6A 3OL9A 1U1OA 4C4WA 4OX7A 2OPPA 3KLIB 3TUPA 3EM1A 1IJEB 3I6PA 5DS7A 1SH2A 1X60A 1RISA 3LF0A 1N36F 1OJ4A 1H0HB 4GKJF 2ACMA 1DARA 4ECWA 4BHQA 4EMDA 3FC9A 2A3JA 1WJ9A 3W60A 1FEHA 3CCSS 3Q8YA 1VRTB 2CVIA 5LXYA 2B6AA 1S1XA 3PKMA 5KFDA 1R7IA 5J2QA 2ATLA 2H1YA 4LF7F 1NJXA 2FGCA 1NSAA 2L3MA 1N54B 2BJEA 4LUBA 3PX0A 2AF6A 5G0RB 1F9FA 2YWHA 4MYTA 4ILRA 2ATCB 4UUXA 2IM2A 2M88A 1SPBP 4F7VA 1KNZA 5HSPA 3WC2A 3OVAA 4MT1A 1WC5A 2NXNA 3IR6B 4LF2A 4ZVEA 4WP9A 2HKEA 1S7HA 2OTLS 3OR1B 4N47A 2O01C 2AEFA 5E7OB 4ZVGA 4YB1P 4A46A 3MM6A 4KGMA 1QTMA 3M2VB 4J91A 3SFGA 4EO6A 3OFFA 1M5SA 1ZPVA 3TRGA 3M30B 1DTQA 3EUNA 2MKSA 2F5GA 2H3EB 2JLEA 1DRZA 3CW2C 1VS3A 1XK8A 4YR2A 3MI7X 1QE1B 5CQGA 4L75A 6FDRA 2Z2MA 3T1HF 2CYYA 1V3SA 4ZCMA 5A8RA 2P9EA 4DR7F 4Z7CA 1VIXA 4PUOA 1PGZA 4QIEA 1Q5YA 3M6VA 3HO1A 3MMJA 2CQPA 3G8SA 3KK2A 4KO0B 2GVDA 2NZCA 3KUHA 4ERDA 1DTTA 4CNYA 4GKKF 1HD0A 2LVWA 2B7CB 3RG6A 2VJVA 2GAGC 4F4YA 1M1HA 2GC8A 4I7FB 3FEXB 3KLIA 4DQPA 2QLFB 4AQYJ 3O6QA 1X4AA 4KGZB 1ULRA 2B5JB 3QZ8A 2R7OA 4ZHRB 3IWXA 2W2QP 1IKYB 4YB5A 4AL5A 1NPRA 4C8MA 5KG6A 1C0TA 2ASJA 4AYBD 2RS8A 4K5SA 1N32J 2OPQB 3NMAA 1BQXA 3WHIA 1VRTA 2F9DA 1OIAA 4LFAJ 2HW3A 1T03B 1IJFB 4ED1A 1I5OB 4BLGA 1RUSA 3KOAA 3NBPB 2XI3A 1DJ0A 4ECYA 3DOMA 4DF4A 5HVFA 3IFEA 8RUCA 1TUGB 4Z7YA 2HGMA 2QSWA 3OW2R 4BWJA 3CJ2A 4CM0A 3K5PA 3UQSA 3CO0P 1U45A 1OY8A 2HQGA 4WFNQ 4LF4J 3ZNJ1 1D9AA 3SCIE 3M6WA 3OR1A 3FJ2A 4X4OA 1VQOS 2VD3A 2RRAA 1KQSR 3M2VA 3DM2B 4B3SF 4DCJB 3M30A 2HQDA 2C2DA 2V69A 1RAEB 3QBCA 3IAM9 1QLNA 2YH0A 3OR2B 1LK5A 3AHPA 2C3YA 1KDNA 3LQVA 4HTJA 1ITPA 1H6KX 1QE1A 2E5GA 3NWRA 5F9NA 3HHLD 2JDJA 4NX9A 3MR6A 3HJVA 1WEZA 1UEKA 4JOUA 2VQEJ 2R9LA 3VAMA 3GG1A 1HYSA 4IQXA 3MUVP 2MKIA 4AUKA 2MSSA 4KO0A 3JTNA 3M6XA 2AYBA 2Y1IA 3FBCA 4YMEA 2HMIB 3CD0A 4NZ0A 3KK1B 3MEGA 3CCQS 4ZDNA 2RQMA 4OZLA 2B56A 5A2QU 2V4JB 4DZ6A 1XNQF 3D66A 3CCTA 2W2PP 4WIIA 2QA4G 3KLHB 3WIUA 5CAAA 4Y0FA 2OPQA 1Y4ZB 2RSQA 3NGDA 1SJFA 3M2RB 2FVSA 4WZQA 4K2XA 4DR3F 4OJ3A 3EDQB 3A8JA 1SBRA 1M5VC 2R8HA 3NBPA 2J7WA 3BYPA 4J9MA 4NCAA 4AL7A 1AUDA 5ETMA 1RWWB 4ZJLA 3DOLB 5ETPA 1O0PA 3ZTSA 5D0RA 2PN6A 4O3NA 4LRBA 4ED3A 3J7A1 4D3HA 4DN9A 3R6GB 1U24A 1EKRA 1T9XA 3MECA 3IWNC 2AJFE 4WJBA 4MFBB 4DJBA 4RUHA 2HHTA 3DM2A 1RHQB 1TKDA 1FXDA 4KR0B 4KH0B 2L08A 1YJVA 1G4CA 2XS5A 4K4XA 2M3DA 3GFHA 4DFKA 8AT1B 3HX9A 1HQUB 4F4WA 1UL3A 1C1BB 1NO8A 3AD8C 2WVEA 5J1NA 1PO6A 3KTQA 1VLYA 3O3LA 1UTAA 2KT2A 1A0OB 5JXSA 2J5AA 4B08A 4MKYA 3DRPB 3SQOP 4I69A 4CO3A 1F1BB 1HPZB 3TARA 1SQFA 1Q7LB 3TEHB 5LMNF 1NBEB 5IT9U 3BN7A 1CC7A 2HMIA 2PIIA 5C42B 4DL5A 3DGPB 1ROFA 2JEFA 4N7TA 3KK1A 3BR8A 1M0SA 5DM6Q 4Q45A 1LQ9A 5KFKA 1DLOA 1Q8IA 1Q78A 2J0XA 1V9OA 1PSDA 2V4JA 1SKRA 4M5JA 3RRHA 2Y8WA 2VOPA 2U1AA 2IVMA 2P6TA 1FXLA 3QGPA 1ZM2A 3HPOA 1HBNB 4A8OA 1WG4A 3M2RA 1WHVA 2V67A 2H9ZA 4P73A 1KWMA 1S9GB 4X66F 4DWIA 4FBTA 3FBEA 3H7HB 3UVJA 2ZH7A 1D9FA 3U7JA 2XHWA 4LFBJ 1S6OA 3DOLA 2MJNA 3OTEA 2LEAA 4DFPA 2V68A 3QGIA 2N3LA 2HWHA 1WC4A 4P6QA 3IXQA 1Q8LA 4F2SA 1N8RT 1R89A 2EK6A 3TANA 2J9DA 2YNGA 1WTFA 3CIZA 3CVKA 3LGHA 3CTRA 4C9DA 4DX7A 2JRSA 2WB4A 4MIWA 1KVKA 3D9BA 4MFBA 2FLOA 2XB2D 5CCMA 2BQRA 1FE4A 4KFBB 2CNLB 3Q0AA 1NDKA 1BC6A 1GMWD 2G4BA 3MR3A 3BKUA 4IKAA 4CLTA 4QQBA 3IM8A 3GJRB 2J76E 3MAAA 1HQUA 1XJWB 1VBYA 3PVXA 1V5IB 2X1FA 5GAHU 3CCVS 2VASA 3CJSA 5D77A 2D69A 1Q8KA 1S9EB 2WK4A 4OZ1A 2YKPA 3HVTB 4PRFA 3G9CA 2R7RA 3OVBA 2H5EA 5AXNA 4Q7AA 5C42A 4G1IA 3DGPA 3NS7B 2KKHA 5JVHQ 4G3IA 4IOAQ 5KG3A 1F5AA 1F9HA 1HNXJ 1QY7A 4OI2A 1P9QC 2R8IA 1NNDA 1AFJA 3PW5A 5HMWA 5DDRC 2VG6B 3Q8PB 3SCLE 3HDSA 3UFCX 2E7VA 3DC2A 3RJMB 1NB7A 5M2PA 2KHDA 2M4MA 1U8SA 5LSOA 4CP5A 2ZHAA 2Y1JA 1U1LA 2OO4A 1VQ4S 1VBKA 4PXBA 3P96A 4ZLPA 3PV8A 2C3OA 5KT2A 2HS3A 1V3RA 5HMXA 3N5FA 2MZSA 4OJGA 1NKCA 4GC6A 3TEGA 4C3LA 1W25A 2PT0A 1VGYA 2VV5A 2PFFB 2HGNA 2BA9A 2XYHB 2LQ8A 4NEZA 2X7IA 2CUYA 3H42A 3P5TL 2AW0A 4XIUA 2DNKA 2D9PA 3VGVA 4X4RA 1F2GA 1ZZNA 1IWGA 5HN0A 5HVGA 1YJRA 4KFBA 2GHWA 3KHRA 4Q2LA 2WTFA 3BGRA 2W4CA 4F0MA 4RJVA 4ZVSB 4RU2A 2HFNA 1JXLA 2R2SA 1L3KA 4P71A 2ZBRA 2DIVA 2UUWA 3B6BA 3M4XA 4HT5A 1U7LA 5F8GA 3WBZA 3KJQB 4ZLNA 5F8NA 2FHOB 4CTAB 3VGSA 2NCKL 4Y6IA 2HWIA 4NLXA 2UXCJ 2B43A 5ETOA 1NPPA 2C2ZB 4X64F 5FD1A 3HHEA 3HVTA 2DXDA 2XCAA 1NZ8A 1VISA 3HHNB 2HS0A 2DGWA 4DSFA 4QYZK 2VFTA 4OYXA 1PBUA 4DG1A 2HHQA 2IYIA 1WOSA 2Z57B 1T9VA 1NHVA 1KR4A 2GMHA 3D4JA 2AQ4A 3KJVA 3C16B 2FLPA 2KRBA 1UZDA 3HLUA 1FJCA 2M8DB 4USUA 4ZCKA 1VRUA 1UA1A 2YX7A 1JKHB 4U67Q 1Q95G 4LQ3A 4AQYF 3PZPA 2BUNA 4YR3A 3MEEA 5C7PA 4EYIB 1DQ8A 3QMQA 4DR6F 1QSYA 1I1GA 3WZ0A 2F9JA 2LXFA 3T5JA 3UR0A 1N32F 4B9TA 3W2VA 4ZVUB 3NL0A 3FKBA 5IC4B 2QJ3A 4KBIA 4PG7A 2HZCA 3SIPB 2K1RB 2RE1A 2AJ2A 1WACA 1D09B 4QCLA 4NLSA 4RW8A 2XGQA 1YRXA 2Q66A 3GYGA 4N8NA 5A2QY 4RU9A 1DHMA 4K4ZA 5F3TA 2Q3PA 2ZVIA 1S6PB 4Q8FA 1FRMA 3DGVA 2KO1A 2VPWB 4P2SA 4C48A 3G4SS 2E29A 2KTQA 4IOCQ 2E1CA 3WX4A 1E6YB 2MKJA 4LRCA 4B9MA 3EVMA 4LF4F 2HPUA 2VIHA 2QL5B 2A0FB 4ID5B 2Y1RI 2A10A 4QIWD 1ZBTA 2OEMA 1SQEA 4FZVA 2Z2LA 1GTEA 2JVOA 5GMKa 1X5TA 2GA7A 3RAQA 3MXHP 3UD5A 4FF1A 1R31A 2CJBA 5F3ZA 4ED8A 2FIUA 3HCXA 2RQ4A 3Q8RB 1NRKA 1E6VB 3D5MA 3AFGA 2QFJA 2CPZA 1RYSA 4FYWB 2LU2A 1FRKA 3NNHA 2VQEF 3M8RA 2YWFA 3AA8A 4UF4A 5I3PA 3D1OA 1VQ6S 1M1KT 3EZUA 5GMDA 2DGVA 2XMVA 2EK1A 1XIQA 2UZAA 5J2PA 3NWGA 3V6KA 2XO6A 1UVMA 3H5SA 3OXFA 2B7BB 3W3SA 2RHSB 3DRRB 4GVBB 2EFPA 2CPHA 2AU0A 3K5OA 1DY3A 3KFWX 4ECTA 4C0HA 5HROB 3T9NA 2QSFA 3R1LA 1WG5A 3MM8B 1AT1B 3R9LA 2A2CA 2NS1B 5KFLA 3MCNA 5L39A 4G1PA 2VC1A 2YWKA 2YTCA 3QFHA 1KKHA 5IT9Y 4ZP6A 5F8IA 2KYZA 4ZVTB 3M1VA 3ZTPA 5HVHA 2WB1D 1FHTA 4OI1A 1ZA2B 4CO5A 1CC8A 3GIKA 1NHUA 1IBKJ 3DI6A 1N6QB 1B7YB 2HURA 2FY1A 3C8YA 1VJWA 3FFIB 4DHVA 1N0VC 2Z56B 5E2QA 3MM9B 3P6YC 4FF4A 1BD6A 4C0OC 4AD6A 3BV8A 1RT1B 4G1QB 1YVFA 1K0VA 2R2RA 2PGCA 1RT4A 2IDEA 1BY9A 2OSQA 3SYZA 5EUHA 2EXUA 1IBCB 5ITHA 4IR1A 2RAQA 3MM5A 3QT6A 3C19A 1E6VA 4LVNP 1KS2A 5D0EA 4IOBA 3GCXP 2MQ8A 4KHRA 2PEHA 1CJUB 2G1DA 4ANCA 3CCZA 2NZ4A 3W61A 2JNJA 1XMBA 3OUYB 4DV2J 4PWDB 5KOXA 5DG9A 3HHLC 2DXFA 4PWWA 3FZBA 4FXDA 4DI6A 2UVWA 1N4LA 1LW2B 4GVBA 3O44A 1R27B 1S1TB 5EX3A 2ZOFA 4MIBA 4Z37A 2E1PA 3TI0A 3OLAA 4IRDA 2OMOA 2XTJP 4N76A 2F8HA 3MM8A 1G3OA 3RBZA 3OTDA 4L76A 3MMBB 2GIRA 2IRXA 4YN3B 1IXKA 4JI4J 3CD5A 1R8PA 2VKZG 2CQDA 1GFWB 1C0UA 1AA1B 1F3VA 2JSXA 4LFBF 3MF5A 4DR1J 3NGSA 4XAKA 3MPDA 2BEFA 2XEXA 2F4FA 3GJTB 5B0BA 2AIRB 2Q79A 1N6QA 3MMCB 1R43A 4OI3A 1CQNA 4IG0B 5THWA 1RT6B 3FFIA 4OQJA 3MPUB 1JLFA 3MM9A 4WTOB 3GFXA 4JI2F 3M8QB 1FVSA 2HHWA 3D0GE 1RT1A 4G1QA 2ZBQA 2H4YB 4KSEB 2EFOA 4KIAA 2OD6A 2FHMA 2FUG9 2BRLA 1G7CB 1KSPA 5KFMA 3KK3B 2MGZB 1F5CA 2WONB 1HNZJ 4LR8A 1MG7A 4UW2A 4Y28C 2HZAA 2HK2A 4DL6A 2CQGA 2HAIA 5DDQC 4AL6A 1TKZA 3FK4A 3QT5A 3HT0A 5J1PA 1FVQA 3D0HE 3RB4A 3DRSB 4FS2A 2YNHB 2CJ9A 4M5GA 4HH1A 3PCOB 1CJUA 3QPIA 5EX0A 3JAMU 4DMZA 2C1EB 4LSZB 4G6VB 2JJ4D 3E8OA 7FDRA 4PWDA 5FDLB 1XWLA 2L48A 5BYSA 1TUWA 5E0OA 1LW2A 3QAEA 3LP2B 3R8YA 1YLXA 1S1TA 4QJVA 4F8RA 2XMTA 3PJWA 1HNXF 3BSOA 4DV4F 2GMJA 1GNKA 2FHJA 4QWCA 1T9UA 1SXLA 3F73A 3G6XA 2KYXA 2RHQB 1FE0A 1L3VA 3VAFA 4DLGA 3T5HA 2WVBA 3MDFA 3MMBA 5KFEA 1MMLA 3ILOA 2VG5B 2HS4A 3TX0A 4RBTA 2ASYA 4DQRA 3DLJA 1CJVB 2R7VA 4BCAA 1X4EA 3IBFB 2ZH5A 3UI3A 1WKJA 4IH5A 1LWCB 1P8GA 4YDDB 1VHIA 1ZPWX 3RTVA 2Z2YB 8ATCB 4A8WA 2XHCA 4YEAA 2ZVSA 3N79A 5BYRA 3U1NA 4IG0A 2OEJA 3A3OB 3OQ2A 1RLDA 2MJUA 1CS4B 2M8HA 4ED0A 3TWZA 4IH6A 3W9HA 1FRJA 4HDHA 3PRBA 3M8QA 4Y65A 4UOFA 2ZJQQ 4PWUA 2HBQB 2MLZA 1W2IA 1HNWJ 2VF3A 4K4TA 4LF8J 3CIMA 1NSQA 3QSIA 1A6LA 2L9WA 3I9V9 2MGZA 2BBEA 2VBYA 3MD3A 1ACMB 5ETQA 3VQSA 3POTB 1Q5VA 3L95X 3OHAA 1MN7A 1SI9A 4TKTA 1VI7A 3D67A 1ZM3A 2X51A 3DRSA 1GH8A 2EW9A 2QO3A 5AJ3J 1HQEB 2YNHA 4OV6A 3D54A 3CCMS 3HHLB 1R3NA 2VOOA 1Q16B 1CVJA 4EK2A 3BQ0A 3DCAA 5IV3A 4JI0J 1EJ7L 4E0DA 4CO1A 1VR6A 1EKSA 5E3RA 3LP2A 2CPEA 4FYDA 1MU2B 3ILJA 5D4PA 4B9SA 4KV8A 4PZVA 4JBCA 4WE1B 4UTGA 1RT3B 1TAQA 4ECUA 3ZZYA 3KG4A 4P10A 5B08A 2CWXA 5KFHA 1XBWA 3JXOA 3ZTOA 1RWUA 4F4AA 4NE9C 3ULHA 1YKWA 2XWYA 1OY9A 4NLWA 2POKA 1BXNA 3EVOA 1AROP 3ZC4A 1UA0A 1CJVA 5D4NA 2I38A 1JLCA 2CZ9A 3KJFB 1T9WA 4JV0A 1AZSB 1LWCA 4O4RA 2W9AA 1W26A 1YQHA 4MK7A 1NK8A 2LU1A 5HJYA 1D3WA 3ET6B 1FKOB 4ZP8A 4U9RA 2MKYA 1WHYA 3F44A 3DLKB 5CHCB 2HQIA 2U2FA 3D6TB 1JWWA 1FNMA 2ZKTA 1T11A 5DZ6A 5J1EB 2KFNA 3Q8VA 3J80Y 3OFEA 1WF2A 1NB2A 3POTA 5KTQA 1HLWA 4E98A 2DGSA 1J5OA 2LA6A 2OP5A 3BH7B 2QIFA 2JLFA 2ZHBA 1W7WA 5F8HA 3VF0B 2K3KA 3NLCA 1UWBB 2IBOA 3H4BA 5F8LA 5KFCA 3VZIA 3I82A 1HI0P 3ZZOA 3HHLA 1FWLA 2ZDPA 3G6ES 2DCLA 5HJXA 5M2UA 3BSAA 1VK8A 1YBAA 1GMVA 3CJ5A 1Q7YT 4F2RA 4X62J 2IY5B 4O44A 1B64A 1JXVA 3O5TB 3MMAB 4X4NA 5DGBA 3I55S 9RUBA 2RQCA 5IZHA 3M8YA 1RT3A 1IBMF 2MQNA 2JEGA 1IR0A 3UDEA 4NOHA 1FJGF 5KFFA 3HKZD 3ZZUA 4BWMA 3VTIA 3OJSA 3RYLA 3BS9A 4DQIA 3I31A 2C28A 5KFJA 1EQ0A 2GO8A 1RHUB 3MOJB 1FWPA 3C6UB 1PJ5A 2DNHA 3W5ZA 4M94A 1MWQA 3GV8B 4P72A 3GONA 1TL7A 4NYPA 1O5JA 4UY85 1T05B 3MEKA 3CJQA 1WUUA 4N8OA 5C25B 1SJ3P 1MWZA 2F7VA 5IQ6A 1Y10A 1FKOA 2P6SA 3ET6A 1R8CA 1TKTB 5KT7A 4RPFA 3DLKA 1RSCA 2IRYA 3CCRS 3IAS9 2EI5A 4R8UB 3CGIA 5D0HA 3IR7B 1IBKF 5F0UA 3VAJA 3NP5A 4USIA 3HJFA 1VQ8S 5J1EA 4JYAJ 1S1UB 3SSQA 3GV7B 2HFZA 4QW8A 3I87A 3BN4A 2B8PA 1J5EJ 2BYCA 3QATA 4O3SA 1GX6A 3UN2A 2FQQB 2GQ2A 1HKAA 4JI7J 2ZZTA 2CQIA 1S77D 1RTHB 1UMJA 1XR5A 1UWBA 1KFDA 4F02A 4OLPA 1GXLA 2KT5A 4QWEA 2D7SA 5F9LA 2V4QA 1NAQA 5AE3A 5KFGA 3TX8A 4IDKB 4W4MA 1BQNB 4MTPA 1RE1B 2ZZNA 2XNRA 3MMAA 2EVZA 4CM2A 2W2NP 1OWXA 3J81j 4FNHA 5EWGA 2EFVA 4FVCA 1HWJA 2HFVA 2WSCC 1SH3A 5CA5A 3QFWA 2FJBB 2BOAA 4RWWA 3JB9k 1X9MA 2ZNZA 1S76D 5FLXU 1FO1A 4HHJA 2F65A 2XCPA 1I3OB 1SH0A 1H73A 3JTPA 2Y1LB 3RUBL 3TUJC 3BGOP 1N48A 3JAMY 2DNQA 2CNKB 3C6UA 3UN5A 1X31C 1U1NA 2DEJA 5H9FK 2YWGA 4J7CA 2BJ3A 1S0VA 5C25A 2D3O1 3IC1A 2M70A 4JI4F 4AT1B 2I2YA 4RNFA 2MXYA 2I8EA 2N4DA 4U95A 1LXJA 3E3XA 1IQTA 1CULB 4C98A 1TK0A 4DR1F 3R5CA 4R8UA 2WW8A 1RHJB 4OZJA 1FXRA 4DUTA 3DXSX 3VAHA 1XN9A 2Y0SD 4LBHA 2YNFA 3LA0A 4EBEA 1D8YA 2HWTA 4OMFG 4Q5VA 3T1HJ 4FPIA 4ZPCA 1VC6A 5FIIA 3BEGB 4CLZA 4C8YA 1QUPA 1GMWA 1TQLA 3FQKA 2ZFHA 4YR0A 2OFGX 5F8JA 1RTHA 4M1KA 5K5MA 3B82A 4USVA 4WWSA 4C7QA 4DPXA 2VBZA 3WC0A 3AXKA 3EPGA 3LP0B 1R0AB 3NNAA 2RIJA 2AZ3A 3QYYA 1I94F 1TAUA 4B3MJ 3I56S 2KVQE 1LV5A 4IDKA 4F0KA 3EE3A 1SKUB 1HNVB 2VODA 1K47A 1R8BA 3A3PB 2ZUAA 5KAKA 3K8WA 5IS2A 1T0TV 3JQMA 3T1YJ 4ILMA 5EWEA 3PG9A 3QJLA 2F8MA 5IT4A 2BDPA 1JLAB 3CC4S 2QT7A 1WSVA 3IP0A 5HANA 1HA1A 2DCUB 2YBVA 2B51A 3W5XA 2HBYB 3G6VA 3EYZA 2KRRA 2FJXA 4HI1A 3C66A 1IBLJ 3W63A 4USHA 1TK8A 4TQSA 2RNEA 2DNOA 2DJWA 3LTOA 4OL8A 2VFVA 2BM0A 1YRUA 1N56A 1WTBA 3ZXWA 2P9GA 2OPSB 1CULA 3GFZA 4WTYA 1JJHA 3QIPB 5DRKA 2W8LA 3CD6S 3V6DA 4OYIA 1QJHA 5KT3A 3S7RA 1N5SA 3R1HA 3PY8A 2VPXB 4WU2A 4A8SA 4LRAA 4NA1A 3U1MA 2HRYA 1MMDA 1SVDA 3FQLA 3TJ8A 2CPDA 2B9WA 2E5HA 5F8MA 2KT3A 4PQUB 4UT4A 1JX4A 1RXOB 1BMQB 3J7Z5 4LF8F 3A13A 3AT1B 3IM9A 4CLUA 3UDCA 3Q89A 2DRBA 1QM9A 2FHKA 3MZIA 3LP0A 2G13A 1S1VB 1SL2A 1F6TA 3MEDB 1SJQA 3H59A 5ETTA 2KDOA 3IMQJ 2AV5A 2M52A 1R6VA 4ECXA 3D1QA 5AJ3F 1HNVA 3PW2A 2KVIA 2Q1LA 4B9VA 4JI8J 1RLCL 2FYXA 2RDDA 1CEZA 3BM7A 5D6GA 2FTRA 2E1RA 1LEOA 3KG1A 2B9YA 5KG0A 3GJQB 3FCVA 2RDIA 4JI0F 4HH0A 3ONQA 2X1AA 2ROPA 4FPRA 2Z4PA 2VC0A 4A8FA 1S72S 2AHOB 2V8HA 3D6MB 1QAIA 4HACB 1HI1A 4PG4A 2EEYA 4FYXB 3R5GA 2IAJB 1NKEA 3PYFA 2LQ9A 5DQIA 5T14A 2J6SA 2HHVA 4I1TA 1FJ7A 3Q2TC 1P6TA 3DRXA 4ZPAA 2E1AA 3FNNA 4UY8T 2C2MB 3W62A 2OJ3A 2BKNA 1UW4A 2ZITA 2KFZA 3FEYB 4L74A 3JSMB 1MMNA 3N6NA 3G8QA 3MTJA 2OPRB 4ZVOB 2VQFF 2KG1A 4Q43A 4QZVB 1EETB 1LWXA 1HHTP 1ZYQA 3FMBA 4OHVA 1X4HA 4JI3J 3EGVA 1C4AA 2HIYA 3TQ1A 3OL6A 2CNOB 4PQUA 1PJ6A 3Q86A 3ISZA 1JNZB 1Y5NB 2UV8A 4ZVQB 3PO5A 4YQWA 3LH2S 3K89A 5E3QA 1EHWA 3IRWP 3M05A 2PC6A 2F8EX 5IWAF 5LSLA 4V19X 4IFVB 1S1VA 3MEDA 3LGMA 3VGUA 2ZH2A 3HSGA 1B0VA 1KLNA 1WI8A 1RA7A 4J5OA 4TQRA 3JSYA 5EGYA 3OTCA 3DXBA 4X4QA 2XLJA 2VDHA 4DQQA 3LPEA 4ES2A 1NXIA 1AUSL 4BC7A 5KFVA 1S10A 2R2UA 4RW7B 4X62F 3H2UB 4C3KA 3NOCA 5L9NA 3PX6A 3PJXA 3VAKA 4HACA 2UUCJ 1S6QA 2LP4A 2BW7A 2B4VA 4E2FB 4NZ6A 3IS9B 2IAJA 1UVIA 3H40A 4DUZF 4R25A 4YP3A 3V6JA 1YZ7A 4PCQA 4IG3B 2RQKA 1GMUA 2JOQA 4MIAA 1PYOB 4X65J 2V4RA 1RB0A 2MLXA 3NGUA 1KQKA 4Y3CA 5KOWA 3M9OB 3R3TA 1XR7A 1PJ7A 2F4VJ 4PEOA 2HHUA 1WF1A 3SFUA 3GIIA 3JSMA 4ED6A 2MZJA 1BLUA 4F04B 1CJKB 1RKIA 4B17A 2OPRA 1CG2A 4C8LA 5CCLA 4DV0J 1FDBA 1S99A 2HFOA 1EETA 4CO4A 2XMKA 1ZAVA 4MH8A 3ITHB 1LKZA 2DNNA 3DLLQ 2FZKB 1WI6A 3GJSB 4X84A 1IM4A 1VQLS 4I2QA 4URGA 1KVJA 1XNRJ 2VBXA 3TZXA 1YHQS 3E2EA 3I0SB 3UDVA 4J9PA 3H20A 4JYAF 2RRBA 3DLGB 1TV6A 3PFOA 2R3VA 3MAHA 2UVUA 5KG1A 3GG0A 4IFVA 3L09A 3ZZZA 3GSIA 3H0PA 2HHPA 2GJFA 4JI7F 4W92B 2YKOA 3CMQA 5ETKA 3H5XA 4KE5A 1RP5A 2RKIA 2CQ2A 2R7SA 3ZZPA 5T7LA 1SKWA 5L1JA 4JV5F 3E51A 1P1LA 2QLWA 3BGFA 2Z30B 2BE9B 4K50A 2DXEA 4RW7A 4RO0A 4D3GA 5IC6B 2XNQA 3PIPQ 1S57A 4CLYA 5DGAA 2IJRA 3T5KA 2UXDJ 2OHDA 4DL7A 1Y11A 4X4PA 2RUGA 1FX2A 1QDUB 3MHYA 5L46A 2WOMB 4TY9A 1X4CA 1PYSB 4DV5F 4J9VA 2KM8C 1LWEA 2RJZA 5A8KA 3D3BJ 3M8PB 1RTDA 1XC9A 1D1UA 2QA4S 2YPYA 3ILLA 3JQKA 2Q6BA 1KHWA 3QLHA 3K5NA 3K5MA 2RT3A 1N33J 3IO1A 3I32A 3BBBA 1M90T 5KG7A 2BE7D 1REVA 1JXEA 1B7FA 1P1TA 4CIOA 4NCGB 2AJ4A 3U02A 2QLXA 3PKYA 1CJKA 2W4DA 2V50A 1KQFB 3VV2B 2ZH3A 1J2VA 3AD7C 3KHLA 2FLNA 3I0RB 3W5YA 4YB7A 1TFYA 2J8SA 2D41A 2BANA 1A7GE 4EYHB 4TLRA 1V3ZA 3BBFA 1TUVA 3I0SA 4X64J 3UCUP 2CNNB 1TP7A 1RTJB 4FF3A 1SC6A 2BJ1A 3J7AN 2V9WA 2BV3A 4JV2A 2XSJA 3J7ZT 2C2OB 3W2WA 2GMLA 2MZRA 3AODA 5EN1A 4KGXB 2A1BA 2V6AA 4NL5A 2GAHC 1UCNA 2N3OA 1DFDA 3M8ZA 2FB0A 1H2TZ 4H4MB 2UU9J 1WDDA 1RWVB 2YX1A 3C46A 4CYUB 2CG4A 2ABYA 3CNQP 4B3MF 2LMIA 2IPOB 4HR2A 4RNHA 2DPJA 2AJQA 2G0JA 3AQPA 4DR6J 4CO0A 3QJJA 1LXNA 1NSPA 2NQPA 1U1QA 2I5JB 5B0AA 2YXLA 1CSJA 1Q4RA 1T9TA 3T1YF 1ZETA 3OV7A 4IQMA 2WOMA 4M5KA 2CPFA 2IC3B 4B3OB 2GJ2A 4ES1A 2EFNA 2A6MA 2HQ3A 3RAXA 1N5TA 3IA0A 5DDPC 2ZH1A 2KG0A 3OVSA 4OX9J 3SDEB 1U6FA 4LQ9A 3BPSP 2CPJA 5G0RA 2BE2B 1BE4A 2KXNB 1S5ZA 3JQJA 2Y8YA 4RW4B 2FGOA 2CPYA 4ANDA 1IBLF 4LF6J 4NCGA 2QYCA 2C2KB 4S0MA 2B9XA 1RWKB 2IVFB 3G82B 4DSEA 5E5NA 4TU9A 1F0XA 2RH3A 3A4TA 3TO8A 4FS1A 4KYZA 2E9ZA 4NI2B 1Q79A 4WP8A 4NYZA 3TJAA 4ED2A 4FVMA 4TN2A 1APSA 4UUWA 4X4UA 2XMUA 5I4MA 4Y2MA 1RTJA 3C2PA 4CWBA 1ZS6A 1MNEA 3DOKB 3NCRA 2MDAA 3TAPA 5CYQB 4ZVFA 3M2UB 4MKBA 2DK2A 4CLFA 2CQ1A 1S0NA 4ELTA 2ERRA 1RDRA 4DR5J 2BKPA 1FFWB 5M2RA 2XLKA 3A3NB 2D3UA 1QVFR 2JX2A 1DZ5A 4TYBA 3N5BA 2C22A 4P75A 2BQUA 3LALA 4HTIA 1T7PA 2XZTB 2C3MA 4DN0A 2A2DA 1Z1ZA 2QL7B 5A8WB 4RX6A 4I7FA 4B9LA 2B5JA 3UCZP 4P74A 4ZHRA 3CULA 2J8AA 1IKYA 4B3TJ 2DHGA 2HFUA 2W4PA 3SV4A 4CI0B 4JI8F 2FVRA 2GIQA 1VFJA 1RWOB 1RKJA 3HD1A 2KM8B 2K3IA 2MQPA 5AE2A 2QMUB 3KHHA 4EGLA 2IC3A 1TL3B 3OT9A 2GX8A 4B3OA 5LT5A 4CT9A 1SIWB 1T03A 2AYMA 4XDDA 4WFZA 3GV5B 3HFVA 4FBUA 4GO5X 2J0QD 2P5VA 3O1LA 2NREA 2HNYB 7AT1B 2K8GA 3PM9A 3GMGA 3CDWA 5L1IA 3SDEA 4NLUA 3GYNA 4N41A 1L5UA 2DHXA 2BE2A 5T41A 2ZE2B 1HBOB 3NS6A 1JJ4A 3BSNA 3RZAA 4N56A 3D1HA 1VQ7S 5CZVA 5A6WA 1SC4B 4TYAA 2YKMB 3ZO7A 2MY8A 4ER8A 5BR8J 1SJRA 4WPAA 3PYEA 2H5IB 2VFSA 4IUFA 3QJPA 2GV1A 1RI7A 3KLGB 3W1YC 1VQKS 5L1LA 3OPKA 2L9DA 3MR2A 2Y9HA 5DLGA 5J2NB 1P9YA 4Y2AA 2OELA 4PAAA 4A8MP 5H1SV 3OR2A 3WDOA 1TKXB 1Y3KA 4GC7A 4ID8A 4FKXA 2PA8D 4IYQA 5KFXA 1TELA 3L9ZA 4WFAQ 3DOKA 2DIUA 5C5JA 2J7KA 3Q8QB 3IGVA 4JI3F 2MPUA 2DY9A 5ETRA 5CYQA 2DR6A 4M63A 1RAJA 2HHXA 1DQ9A 4R5PB 2V9KA 1WC0A 4CH7A 1HR0J 2V5HG 4USWA 3GIJA 2CJYB 4H4KA 3R2CJ 3IR5B 2L9NA 3V5RA 1Q0NA 3BB5A 2EG2A 3T41A 4I64A 4PXDA 3HZGA 2VHGA 3N4WA 4DX6A 5A8WA 4ECRA 2AYGA 2IM0A 1ZAWA 3CB4A 1XMQJ 1MWYA 3CO9A 3TUZC 4YOEA 4NMLA 1RCOB 2DHSA 3KLHA 3TNVA 1VQNS 4FYVB 2DH7A 3VZHA 3M7VA 1TL3A 4XDCA 3Q8UA 1S6UA 2P9CA 2WVCA 4ED5A 2VG7B 3VGTA 2YNIB 2DNRA 2FDNA 4OX8A 2HNYA 5KFBA 2QN6B 3CJRA 4RZRA 2UUCF 3ZNUA 4C8ZA 4GVLA 5D3GB 4QR1A 1Y3JA 1N5YB 1HBOA 4Q2MA 2IMOA 5E33A 4J9SA 5E3AA 2YKMA 2V8VA 4X4SA 4X65F 4OV1A 3VCDA 4JI2J 4ZLLA 4NZ7A 3KDOA 3UN3A 4TY8B 4ZK7M 3KLGA 4ZMMA 4OFZA 4OYAA 1U0SA 5J2NA 3MAQA 1TL5A 2F4VF 1WDTA 2HK3A 1EQMA 3G96A 1TFWA 1MW7A 5GAGI 4ZPTR 1IWAA 1O51A 1TKXA 2QE5A 4DV0F 1B70B 4HT7A 4ED4A 4Y00A 1JLQB 4EWTA 5ADZA 2ROEA 4DV6J 1PAEX 1C1BA 1WOOA 1G2EA 1WEXA 2CQBA 4JI5J 1I51B 3PEJA 3TAQA 1HI8A 1S4EA 2MY7A 3AOBA 4WZMA 3T6JA 3DRPA 4DR2F 3EMTA 1XNRF 1VOMA 4QPTA 1H7XA 1HPZA 2X3DA 1NH7A 4OZNA 5HAOA 1D9DA 2XO7A 5ETSA 4DPWA 4O4GB 2EC0A 1Y5LB 4KB7A 4EO8A 2ZH6A 3HSDA 1K8AT 4GO7X 1RTIB 4DV4J 4N5SA 5A0YB 1IUJA 2GCFA 2KZMA 5KFUA 2PO4A 4KHMA 3PEHA 5CD4A 2KFYA 2DD8S 2YKAA 5A6PA 3AA9A 1ZZFA 3CJ8A 1HBNA 2MYFA 2VFUA 4OZ3A 3FSIA 1U48A 2G9OA 2BVZA 1T3NA 3WX8A 1S9GA 3JS9A 2VG7A 1YWXA 1L3UA 1F9EB 2YNIA 1HW8A 3LGNA 3LWMA 2JH3A 4N77A 3W9IA 2UXDF 5B7WA 1VC5A 1GXUA 2GHPA 1JLGB 3CCLS 2ZEJA 4K0KJ 5IT0A 4M5LA 2M9KA 2RILA 1FRLA 3RBEA 1N5YA 4KPCA 2E66A 1OYEA 4AXIA 2IHR1 1X9WA 4DX5A 1N33F 4J9LA 4TY8A 3ZZ0A 1JJ2R 2VL1A 2J0SD 1UVKA 2HRTA 4IR9A 3BSCA 1L3TA 3KLFB 4OI6A 2HLUA 2UVRA 2GQQA 2J9CA 3GZ7A 4LMZA 2ZBPA 1Y5IB 2W9CB 1IR1A 1R8AA 1YK9A 1JLQA 3AQOA 4MK8A 4IFYB 2YWEA 1EP4B 3OFHA 4DL2A 1FD2A 2HVZA 3SCJE 4DBQA 4J9NA 3QWPA 4KTQA 2HNDB 1S9EA 5DM7Q 2FPHX 4F67A 5HLFB 2YKNB 2V34A 3IG1B 4ENOA 2MKCA 5KFSA 2C2RA 4FYYB 1GT8A 4O4GA 4OHYA 4MK9A 1CJTB 2NPIA 2GNKA 4U7UK 1RBAA 4EBCA 1M1GA 3R5AA 5H9FJ 3Q8SB 2OPPB 5A0YA 2VG6A 1DURA 2PFDA 2UU9F 4DV1J 2DGQA 3EGNA 4LIWA 3EGZA 2BACA 2PA3A 2DTJA 4K7QA 2XS7A 1FA0A 4Q44A 2DNZA 4WKRA 4Y2IA 3OTOF 1HWLA 5J2QB 1RCXB 2NXUA 4ZLJA 4U6PA 1JLGA 2FZGB 2VH7A 3K17A 4DOZA 3GPAA 4DPTA 1SL0A 3CUNA 2XC9A 4A4JA 1S49A 1FTCA 3BF4A 5DETA 3CDBA 2VFRA 2F3JA 1KONA 3HVRA 1P27B 3NEKA 1HHSA 4OX9F 2R4FA 4CLSA 3SCKE 4R0JA 4FP9A 1YSJA 1KTQA 1NLKL 2FVCA 2V2KA 1TTHB 1DQAA 2FJEB 2B9EA 4LF6F 2V2ZA 4PXCA 4RWXA 1DTQB 4QIGA 2H5JB 3RAMA 1YTYA 3F56A 3GLJA 2W9CA 4KRWA 1NJZA 3UDLA 2AD9A 1FCAA 4WYWA 5A8RB 5GAEI 2XYPB 2HNDA 1SL1A 4CTAA 3QO9B 1JNRB 4O0NA 4WBFA 2E9RX 1UWAA 2YKNA 3W64A 3L3CA 4ECQA 3HSJA 4F4KA 2YH1A 3OL7A 3VVUA 5I3UB 3KK2B 3IBCB 1X5PA 2GVDB 2DISA 2K2PA 1MN9A 3QSYB 3WIVA 3R5BA 3OXLA 3NCQA 1DTTB 4ZP9A 4DV7J 1AB8A 2ALYB 5D4OA 1PBAA 2E7XA 3AB2B 4DR5F 1RACB 3KJNB 2HBRB 1IBMJ 2EKYA 2W01A 3C16A 1FJGJ 3HFZB 3KHGA 1VQMS 3KYLA 1C0TB 2VPYB 2EG1A 3DLEB 4EZ6A 3FRYA 4CO2A 2R2TA 3CDUA 1XQIA 1JKHA 4ZJOA 4QU7A 4NLDA 1W2BR 2DGXA 4JUZA 4C8KA 3GR1A 1T9YA 1FFGB 3OBIA 4Q0BB 1VBXA 4WK1A 4B3TF 3UD3P 2XY6A 4LF1A 1AW0A 3DOMB 3BO4A 2NUHA 3D2WA 3H5YA 4K4UA 2BOPA 2G2YA 3J80U 2V8GA 1S48A 2CJAA 2K1RA 1R0BG 5CYJA 2KL8A 4KHPJ 1F60B 4DPUA 4CH0S 2AJ0A 1N0UA 4CNZA 4FF2A 1B4SA 4LSLB 1PKUA 3HM9A 1URNA 1YJNS 3QWUA 2VA2A 1VCTA 5LSRA 5EHHA 1Z4UA 1BWVA 5EDWA 1WOPA 3LUYA 1S6PA 4LBIA 4LREA 2EPIA 1G6BA 3ZTRA 1C1CB 3MCMA 2V0NA 1RT7B 1E6YA 4HEA9 1XEZA 1Q1KA 2NR0A 4LVOP 1PC5A 5BR8F 1YJWS 3GTYX 1MLAA 4ID5A 4QU6A 5K14B 1SC3B 3NY0A 2O67A 2CIMA 3IGNA 3QO9A 3N6LA 2NLWA 1LFPA 4QIFA 4EFAC 2DGOA 4PKDB 1HYSB 5DG8A 4HYKA 2XLIA 5I3UA 2JVRA 3OL8A 2YQ1A 2R7UA 4WFXA 3N6MA 2NYHA 1NUEA 3NXZA 3TZYA 3EWGA 2CQ0A 4EU0A 3MEGB 2KB2A 4WIQA 5KFIA 2DGTA 4YUDA 1T94A 4HHUA 1HR0F 3DYAB 2EWHA 3CCES 1SKSA 2MZ1A 1B99A 1VQ9S 3DLEA 3DRRA 1S0OA 3A8KA 2CDRB 1KOOA 2OD4A 5K8PA 1WORA 2RB7A 3EICA 1NDLA 1FESA 1VRQC 2MLYA 3CJ4A 1O6XA 5HROA 1R0CB 4Q0BA 4TLQA 3TYTA 3VWSA 2DHAA 3H4DA 2IA0A 1XMQF 1EAYC 2KH9A 5JMNA 2ZOMA 5L8RC 1CLFA 4A48A 2KJWA 1VMBA 3T6BA 3Q24A 3NAIA 5KG4A 1REGX 3W8PA 4URSA 3RW7A 2OFHX 4I2PB 4DSLA 1GEHA 1LK7A 5AXKA 5K8MA 3LANA 4NLYA 1UJ6A 5BYQA 3HT3A 2ZDOA 5KFTA 5LL6d 5GAGU 3US5A 5IQQA 4LSLA 3QGHA 2W25A 4NXMF 1X8DA 2APOA 3I5BA 1OQ3A 2R42A 1B3TA 3SSRA 1ZM4A 2HVHA 1RADB 3MECB 1DAXA 1KD1T 3PNIA 1C1CA 4OI0A 1RT7A 3TP2A 2RUSA 4NCBA 3ENAA 5B09A 3UNGC 1FRHA 2AKWB 1UFLA 3E01B 2E5LJ 4LF9F 2HSEB 4AFFA 4J9RA 1F2HA 2FC9A 5K14A 1RBOB 2F63A 2DNLA 3B4DA 1Z2LA 4OHWA 5KFZA 3KXDA 4JV1A 3K7RA 5C2GA 2DR8A 4YHHJ 1I94J 1YITS 4ZIVA 4DFMA 2E5IA 1JB0C 5D15A 4DV6F 2QLBB 3TVKA 4JI5F 4DDFA 3TAMB 5E41A 3WQPA 3PDNA 3D28A 2AEJA 3JYTB 3GSDA 1DLOB 3OUYA 2RVJA 3DYAA 1RAIB 2BR0A 4LR7A 1QAJA 5H9EK 5K20B 1OSDA 1NK6A 3PFEA 4JP8A 5KT5A 2WBRA 1U02A 3L7OA 2OTJS 2OI2A 3MD1A 3TR5A 3CEDA 3UVJB 2D3OR 2ZH8A 2V94A 2DITA 1X5OA 2ZD1B 3EPIA 1FRIA 3I96A 1RWMB 1OPZA 1Q82T 2H51B 1U2CA 3GR0A 4I2PA 4TU7A 3CCWA 2R7QA 1IVZA 1KN6A 1URRA 2UUBJ 3GCWP 2YNGB 2LQBA 1GAOA 2FVQA 2VZ9A 3IWLA 3R6LB 3VR1A 3PW0A 4K0KF 3FZ2A 2RS2A 1B0PA 4JI1J 1HWKA 4NWBA 4FKYA 3MMCA 3V6HA 4E8UA 4WF9Q 1RT6A 2J0WA 2HGLA 4KGKA 1U4BA 1KVIA 2RRNA 3V81B 3UCGA 2W9BB 2DR5A 3E01A 2KZZA 3GIRA 2DB1A 4F36A 3GU0A 2CA9A 2Q43A 4WP3A 3MAAB 1VBZA 4G65A 3CC2S 3MUMP 2D74B 4DS4A 5AXLA 1M5HA 2VKRA 4PPDA 1U2RA 3Q22A 3KK3A 2K06A 2GS8A 2WONA 1WHWA 4C8NA 4JI6J 3I5AA 3ZZTA 3P4UB 4U8YA 4OZ0A 1FJEB 5AE1A 1QUVA 2CAJA 3DLBA 2ZC3A 1RJJA 4CDIA 1YI2S 3ISND 5CYMB 2PE8A 2M5YA 3G71S 1NHKL 4KJIA 3PJ9A 2HHSA 3TAMA 1RWNB 3THPA 1U1PA 2N4CA 3JYTA 4NXNF 3ETOA 2DNMA 4UZBA 4PABA 5HO4A 1SIZA 3BKFA 5FDLA 2GFFA 1D8ZA 4U7UD 3KNGA 4EBDA 2PDAA 3TA2A 2EKNA 2KI2A 4NLVA 2MEWA 4XPEA 4KQZA 1YBTA 1R8HA 4I6WA 4F3QA 4RNMA 2YY3A 1S7IA 3UPFA 1TU0B 1UAWA 1K0TA 2MKHA 3CWJA 1ICEB 2LEBA 4PYAA 4ZN3A 5HMYA 2CQCA 4DV1F 3ADAC 4FXWA 2H48B 2ZD1A 2IDLA 1GXTA 3W66A 2VG5A 4I0WA 1Y7PA 5D4LA 2EBEA 2UXBF 3OXGA 3GFYA 1HW9A 3T1AA 1OO0B 3K5LA 3H90A 4MYUA 5HBMB 3HVWA 4C0BA 1OY6A 5SZTA 4OI4A 1FRXA 1FT8A 1WELA 5HQLA 1U6BA 2VQFJ 2V2VA 1GK8A 3X3UA 3T3FA 3RB3A 2P8IA 3P45B 4O23A 4J9OA 1YIJS 1CS4A 2V2QA 5GAEU 2I6WA 2W1BA 4OIXA 3BGRB 3V81A 2W9BA 1JK9B 2WW4A 1NJWA 2MHNA 1ZH5A 2CXEA 3V2UC 3AXMA 2MQLA 5JUMA 2IM1A 3MR5A 1UPPA 1M5OC 4EZ9A 1HWUA 2WHOA 4NPOA 2YX4A 5IWAJ 4XO0A 4DCOB 3W8GA 1RAFB 1SCJB 2I9SA 3AOAA 1VLOA 1EIYB 4MKVA 4PQAA 5CYMA 1NJIT 4DPOA 1OPIA 4RBVA 3UO0A 1HQEA 4DG1B 1MROB 3DDKA 3MURP 1YJUA 2DBBA 1UPMB 3EGWB 4P2XA 5F0WA 3KLVA 2KXFA 3CMES 1U8WA 4NLGA 2P2CB 4UZCA 3KJVB 2VA3A 3G87A 4DUYJ 4DCPB 3OFGA 3VALA 2XMWA 4OZ5A 1VRUB 1MU2A 2VB6A 1WG1A 4ES3A 4DV7F 1N5VA 3FSYA 3ZTQA 4PYDA 3N01A 4HKQA 4WE1A 4RUAA 4K4YA 3MEEB 2DRDA 1Q8BA 1S97A 4DUZJ 2LFVA 4DV3J 1NU4A 3THTA 3DRYA 2RDJA 2B4UA 3ZFVA 4DEZA 3KMSA 3W2VB 3MFHA 4W98A 2ZBCA 5DG7A 3MUTP 4F25A 1EARA 3LP1B 1FFSB 2IJNA 2BMBA 2VJUA 3F41A 2R7XA 2UV8G 4WU3A 1YZ6A 4RW8B 2M0GB 4FDFA 1LOUA 3O2IA 5HBMA 1AZSA 4X4VA 3MTKA 3OJUA 2ALZA 2LA4A 2PD1A 3S01A 4KHPF 3D6FB 3OSPA 2KU7A 4QOTA 3SEOA 1WC6A 1SV5B 4YY3J 1OQ6A 2N7YA 1NK5A 2CJQA 2HG4A 2B0GA 4XK8C 3AJDA 2DH8A 2QV6A 1RU2A 1M5KC 2QYGA 3W65A 3ETMA 2C3UA 5B0DA 1NH8A 4J9QA 1HARA 3OHBA 1EZZB 5HMZA 1RT5B 2VU5A 3VHQA 3JTOA 4NYOA 4ZPVR 4Y2KA 2J9EA 2HFSA 3FDSA 1UVLA 2FZCB 1MROA 3BPDA 4EUVA 3BYRA 1OMSA 1S1WB 2ADBA 4BC9A 2CFXA 4IRKA 1UVNA 1GTHA 2HAFA 1IKXB 4JV5J 2RD5C 5E3PA 4C97A 1U25A 3BR9A 5J2PB 4DL4A 5CXTA 1FWKA 4Q8EA 3SBMA 7FD1A 4ATNA 4J37A 4DSKA 1PCAA 2XQCA 1RAAB 1NDPA 2YVSA 3DU6A 4WCEQ 4DX8H 4KC5A 4M5IA 1SC1B 1JMTA 4DV5J 4DL3A 2QL9B 2C2EA 1FERA 3OSNA 1VJQA 1SUQB 4B9NA 2E5JA 2VDIA 3HHKA 4LFAF 3LP1A 2IJFA 4OYZA 3M1VB 2CZVC 3S8SA 2ZUGA 2DNGA 2ADCA 1S79A 5ETNA 3PYDA 1U6ZA 3HULA 4M5NA 5D8HB 1T05A 4RL1A 2W7OA 3PO4A 3DI6B 2QLJB 2VUGA 2GO9A 2MMYA 5A76A 1TKTA 3G86A 1SV5A 2NSBA 2LQ5A 4PG6A 4P52A 1QAYA 4HI2A 2PI5A 4ELVA 3QNWB 3D6HB 1HIYA 3B8HA 4GMKA 5I3QA 1RT4B 3A8IA 1S1UA 4USTA 2A6OA 4ICLB 3J81U 3GYXB 2OMLA 4O3QA 3R7BB 2KHCA 4DS5A 2FC8A 2N82B 2E5LF 3MM5B 3KNAA 1RT5A 1AFIA 5HI7A 6FD1A 2EC2A 4BDPA 2JFKA 4MJKA 4RNOA 2HNZB 2B3TB 3EX7B 2VPZB 4IO9Q 4RNNA
chains in the Genus database with same CATH topology
2BM1A 3IG1A 3LAMA 2QRRA 2V9KA 5KFAA 3M32A 4UOCA 3CPWR 4CH7A 1S1WA 2V5HG 4ECVA 2B4OA 2DPIA 5DLFA 3HHLB 1R3NA 3M9NB 2VOOA 4PXEA 3GIJA 1Q16B 1IKXA 4H4KA 4ZOSA 1CVJA 4OJ1A 3IR5B 2L9NA 1UJ4A 2JL9A 3V5RA 3G6YA 1JIHA 5K8OA 4YHHF 3BB5A 3BQ0A 2EG2A 3DCAA 5GAHI 3J7YU 4I64A 3AY0A 2NYIA 4PXDA 3HZGA 4E0DA 5IM0B 3N4WA 1N34F 4H4KC 2FHJD 1K1SA 2XMJA 3CE8A 4CO1A 5IFMA 1BQNA 1SB6A 3OL9A 4CZCA 5A8WA 4ECRA 5E3RA 3LP2A 2CPEA 2MZQA 1XR6A 1U1OA 1S0MA 4FYDA 4C4WA 1MU2B 4OX7A 2OPPA 3KLIB 5D4PA 4QWBA 1RYRA 2AYGA 1NK9A 2X3GA 4B9SA 2IM0A 1ZAWA 1IJEB 3CB4A 4KV8A 3I6PA 5DS7A 1SH2A 1RISA 3LF0A 1N36F 4JBCA 4WE1B 1MWYA 1RT3B 3CO9A 1YRTA 1TAQA 4ECUA 3TUZC 1H0HB 1UVJA 4GKJF 1DARA 4ECWA 4YOEA 1YG0A 4BHQA 4NMLA 2DHSA 3R27A 3KLHA 3KG4A 3ZZYA 5B08A 3TNVA 2A3JA 1VQNS 4V19J 5KFHA 1NK7A 2DH7A 1XBWA 2MQMA 3VAGA 1FEHA 3VZHA 4OX6A 3CCSS 5CH7B 1VRTB 1RWUA 1TL3A 4XDCA 2CVIA 3MPWA 5LXYA 2B6AA 1S6UA 2P9CA 3CJ3A 3JSRA 4ZA1A 1S1XA 3ULHA 4ED5A 2VG7B 3PKMA 2XWYA 1SUQA 5KFDA 3DHWC 2YNIB 2DNRA 1R7IA 4NLWA 2POKA 5J2QA 2FDNA 4NA3A 2ATLA 4OX8A 2HNYA 3NGKA 4LF7F 5KFBA 1AROP 3ZC4A 3QAUA 1NJXA 2R8KA 3NCPA 1UA0A 4RZRA 2FGCA 5D4NA 2UUCF 3RR7A 4C8ZA 1X7VA 2I38A 1JLCA 1HMVB 2L3MA 1N54B 2BJEA 4LUBA 1C0UB 1ZM9A 4JV0A 3PX0A 1BGXT 1LWCA 2AF6A 5G0RB 5D3GB 1F9FA 2YWHA 4MYTA 4ILRA 4O4RA 4QR1A 4UUXA 2IM2A 1Y3JA 1N5YB 1HBOA 2M88A 5GADI 4Q2MA 1KNZA 2W9AA 2IMOA 3WC2A 1YQHA 3OVAA 5E33A 4J9SA 3FSXA 4MK7A 3CXCR 5E3AA 4F26A 1NK8A 2YKMA 2V8VA 2LU1A 2E5LF 3IR6B 2UUBF 4X4SA 2WSEC 1D3WA 4ZVEA 4X65F 4OV1A 5E3CA 4K5RA 3VCDA 1JLFB 1FKOB 1S7HA 4ZP8A 4NZ7A 3PW7A 1Q86T 2OTLS 4U9RA 3OR1B 1WHYA 3F44A 3DLKB 1WD6A 2O01C 5CHCB 4TY8B 5E7OB 4ZVGA 4N47A 2HQIA 2U2FA 4A46A 3MM6A 4KGMA 4ZK7M 3KLGA 1JWWA 1QTMA 3ENVA 4ZMMA 1NK4A 4OFZA 1FNMA 3M2VB 3SFGA 5J2NA 2ZKTA 1TL5A 3MAQA 4JI1F 2F4VF 4EO6A 3OFFA 1M5SA 1ZPVA 3TRGA 3U27A 3AH6A 3M30B 3QZ7A 3G96A <