2HNZB

Crystal structure of e138k mutant hiv-1 reverse transcriptase in complex with pett-2
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
422
structure length
399
Chain Sequence
TVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNKTPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase/ribonuclease H
publication title Structural insights into mechanisms of non-nucleoside drug resistance for HIV-1 reverse transcriptases mutated at codons 101 or 138.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 109
structure length 399
sequence length 422
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2006-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2hnzB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2hnzB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2hnzB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2hnzB03
2YNHB 4KO0A 3TAMB 2ASDA 2YNHA 2IA6A 1LWCB 4I2PB 1LWEB 1LW2B 3TAMA 5I3UB 1REVB 3KK2A 1C1CB 4H4MB 5J2MB 1LWCA 1LWEA 1LW2A 5I3UA 4ZP9A 1REVA 2D41A 3OSPA 1C1CA 4H4MA 3MEEA 4KE5A 4ED1A 2J6SA 4U6PA 4ED3A 2RKIB 1RT2B 3BREA 4R8UB 4K4ZA 1S0OA 3Q8PB 4TLRA 3QIDA 2BR0A 2RKIA 1RT2A 3Q8SB 4R8UA 4URSA 4WXWA 2XWYA 1S9GA 3KLFB 1MU2B 3IG1B 4KB7A 4DL5A 1JLFA 2HNYB 4IG0B 5KFCA 2AX0A 1JLAA 4IKAA 3IG1A 4WE1B 2HNYA 2IAJB 3IRXB 1Z4UA 2V9WA 2BQUA 2ZKUA 1U09A 2IAJA 3IRXA 1S0MA 4QWDA 4EYHB 1JLEB 3H2LA 5KFSA 2VG6B 3LP0B 3JYTA 3FFIB 1TVRB 4IQXA 3T5JA 2VG6A 3LP0A 3PHEA 3FFIA 2IJFA 2FJVA 3QLHB 5DLFA 3RB3A 3M8PB 1VRUB 4LSLB 3FDSA 4NCGB 1S49A 2AQ4A 2BANA 3QLHA 3FSIA 2JC0A 3M8PA 2W9BB 3MEGB 1TKXB 1VRUA 4LSLA 2E9ZA 4NCGA 2B6AB 4IR9A 2FVRA 3PW7A 1S0NA 3MEGA 1TKXA 3BSNA 4KHMA 2ZE2B 2B6AA 1HYSB 3DOKB 1HMVB 3DRSB 2ZE2A 4IH7A 5DQIA 2V0NA 3V81B 5HLFB 1HMVA 2OPRB 3DRSA 3LAKA 4ICLB 3V81A 4DL4A 5HLFA 2OPRA 4EBDA 4WFZA 1KLMB 3MTKA 3SFGA 4MFBB 3LP1B 3GV7B 3T5KA 5KG5A 1N5YB 3T5HA 3DI6A 5L1JA 4MFBA 5KG1A 1RT5B 1IKYB 5KFNA 5EUHA 4TQRA 1N5YA 3CJ3A 5F8NA 1HARA 4J9PA 1RT5A 4I7FB 1IKYA 3I5CA 2BQRA 3V6HA 5I42B 3QIPB 5KFTA 5KT2A 4I7FA 4M94A 2JLEA 4FS1A 5I42A 3QIPA 5HP1B 3PW5A 3QZ7A 2B43A 2XGPA 3GYNA 3PW0A 4IRDA 3KLGB 4YMEA 5HP1A 4ECSA 5J2PA 2W8KA 3CIZA 4PUOB 5T14A 1S1XB 3KLGA 3UQSA 4GC6A 3OHBA 2I5JA 5KFMA 1HQUB 1RTIB 5F8GA 2HNDB 5KFBA 4F50A 4ZP8A 2OH2A 4IG3B 4ECRA 3NL0A 4XO0A 1HQUA 1RTIA 2HNDA 4NLQA 3T1AA 1GX5A 3CO9A 1JKHB 5HROB 4O3NA 4K4SA 1S1UB 4RNOA 1JKHA 4ID5B 3CJ2A 1QAJA 3GV5B 2JEGA 1HQEB 2RF2B 3ISND 5HROA 5F8JA 1S1UA 3G6VA 3QO9B 5L1LA 1HQEA 2J6UA 5C5JA 4RUCA 3QO9A 2UUTA 3CDUA 3MR3A 3GILA 3TQ1A 3I0SB 2JC1A 4RZRA 4QWEA 3SI8A 4EBCA 4ZPBA 2VA2A 3PZPA 3I0SA 3T5LA 3OLBA 3RBEA 2CKWA 2R8HA 4LQ9A 3HVTB 5KFGA 1EETB 4JV2A 4ECXA 5KFZA 5F8MA 2WOMB 4URQU 1RA7A 3HVTA 4KFBB 4FBTA 5KFVA 4Q8EA 5K14B 5KFRA 1N6QB 4LQ3A 3PW4A 4RNMA 4TY8B 4ZPAA 5K14A 1N6QA 4RW8B 5F8HA 4NLWA 3H5XA 4ZP7A 2GIQA 4IFVB 4NRUA 4TY8A 5F9NA 3RAQA 4KO0B 1S97A 3SFUA 4IFVA 1XR6A 2CJQA 4IDKB 1SH3A 3E51A 4J9MA 1SV5B 2AWZA 5KFUA 4O3QA 4TXSA 4J9LA 4ED2A 3KK2B 1BQMB 1RT3B 3KK1B 4IDKA 1SV5A 2IC3B 2R2SA 4ZPCA 1BQMA 1RT3A 3ISNC 3KK1A 2IMWP 3KOAA 3MEEB 3IS9A 5KFPA 3H5YA 2IC3A 1FKOB 2W9AA 4PQUB 3BGRB 5F9LA 5DG9A 1FKOA 4G3IA 4PQUA 1LWFB 3BGRA 4XPCA 4WFXA 5F8LA 3DYAA 3OLAA 3BSCA 2J6TA 5KFFA 2YNGB 1LWFA 1S9GB 3KK3B 5KT6A 3KHLA 3BQ1A 2FLPA 1ZTWA 3NAHA 2UVVA 1JLFB 3H5SA 1C0UB 2YNGA 1JLAB 3KK3A 4QW9A 3UPFA 1C0UA 4TY9A 1S10A 2FVSA 3BQ0A 1J5OB 4Q43A 1TQLA 3GIKA 1J5OA 5DGBA 2WHOA 3JYTB 4F4WA 4J9QA 2R2RA 2WCXA 4ZP6A 3PR4A 3KLEB 3H40A 2DPJA 1JIHA 1S9EB 2XC9A 3KLVA 1TKTA 3KMQA 3KLEA 5DLGA 2BANB 5C24A 2BRLA 2R2UA 3ITHB 1S9EA 4O3SA 4IH5A 3ITHA 3Q8RB 2W8LA 4O4RA 1RT7B 1D0EA 4Q8FA 2FVCA 5KT4A 4DG1B 5CYQB 1RT7A 3KLHB 4ECQA 5C42A 4DG1A 5CYQA 4RW9A 5JUMA 4JV1A 4DEZA 3KLHA 1LW0A 3I5BA 1T03B 2XI3A 3KJVB 1JLGB 5KFQA 3T19A 4NLVA 3QZ8A 3DLEA 3G6YA 4DL6A 2R8GA 1TP7A 1T03A 2AU0A 3DI6B 1JLGA 5C25B 3KJVA 3OL6A 4IH6A 4J9OA 4IOBA 3BSAA 2YKMB 2AGOA 1T94A 5C25A 3GIMA 4F4YA 5J2NB 5KT5A 1N48A 2YKMA 4Y2AA 3KHGA 4PWDB 1SH2A 1K1SA 5KT3A 5J2NA 4NLUA 4K4TA 1DLOB 4PWDA 5KG2A 4O44B 4QWCA 1RT6A 1JX4A 1DLOA 4O44A 4ED6A 5J2PB 3CJ5A 3NMAA 3CJ0A 2V4RA 2D3ZA 4F4XA 1K1QA 2HWHA 2IM0A 3KHHA 3OL7A 4TYBA 2I5JB 4O3PA 2ZD1B 4EO6A 3M9NB 2AGQA 3MF5A 1D1UA 3FQLA 2ZD1A 4RNHA 2BE2B 3H59A 5J1EB 1W25A 4NLXA 4EYIB 3MR6A 3M8QB 2BE2A 4RW4B 5J1EA 2C2EA 3MEDB 1RTHB 3GV8B 1EP4B 1NHVA 5J2QB 3M8QA 3N6LA 4RW4A 4DL2A 4RNFA 3DM2B 3MEDA 1RTHA 2FVPA 1EP4A 3CDWA 4RNNA 5J2QA 3MECB 3I0RB 3QYYA 2ALZA 3DM2A 4URGA 4G1QB 2C22A 3QGIA 3MECA 3I0RA 4ZVGA 1S1WA 3BQ2A 2OPQB 5F8IA 2ASJA 3H5UA 2VG7B 3LALA 4G1QA 1RAJA 2C2RA 1MMLA 4QPXA 2OPQA 3H98A 2VG7A 2IM2A 3VQSA 5EWFA 4YQWA 1JLCA 3UR0A 1I6JA 4MKAA 3KHRA 1RYRA 1TKZB 4WZQA 4OL8A 5L9XA 5KFXA 5KG3A 4ECTA 3RB6A 1C2PA 1RTDB 1TKZA 1QUVA 4ED7A 4IFYB 4NYZA 1UWBA 2YNFA 4GC7A 1RTDA 2HNZA 4ZMMA 4IFYA 1C0TB 1TL1B 1SUQA 3HVAA 3BR9A 3KMSA 1RTJB 5KFLA 2XCPA 2WTFA 4RU9A 1C0TA 1TL1A 2V4QA 2D3UA 5KG4A 1S6PA 1RTJA 3FQKA 5D3GA 2XGQA 4YP3A 5L1IA 4ECYA 3IN5A 1S48A 3LP2B 3RB0A 2R8KA 1QAIA 1IM4A 4H4OB 4KV8B 4K4UA 4HKQA 3IS9B 5KFYA 3E01B 2ILYA 4R5PB 3LP2A 4H4OA 4KV8A 2OPSB 1S6QB 3E01A 5KFHA 5DG8A 4R5PA 3N6NA 5L1KA 4ZHRB 3G86A 2OPSA 3DYAB 1XR7A 1S6QA 3LAMA 4IR1A 2QE5A 4ZHRA 3OHAA 3V6DB 4TN2A 3DLKB 3KLIB 5DG7A 3V6DA 1RT1B 4QWBA 4O4GA 3DLKA 4X2BA 2W7OA 3H4DA 1C1BA 3DMJB 3KLIA 1RT4B 1RT1A 2WRMA 5KFIA 4XPEA 1KHWA 2O5DA 1QE1B 3DMJA 4QW8A 3DLGB 1RT4A 3LANA 4YR0A 2C2DA 2GC8A 3NBPB 1RA6A 4Q45A 1QE1A 5JXSA 3DLGA 4I2PA 4MH8A 3V4IB 3HHKA 3NBPA 4O3RA 1S1TB 4KBIA 5J2MA 2JEIA 3V4IA 1TKTB 4NLDA 4Q44A 3EPGA 1YVFA 3C6TB 1S1TA 5C24B 1KHVA 4YR3A 5KFDA 2C28A 5DQHA 3MR5A 4KAIA 5KFKA 2E9RX 3GIJA 2VA3A 3C6TA 3D5MA 2WB4A 3DRRB 5KG7A 1FK9B 3N6MA 3IGVA 3I5AA 3RAXA 2FLLA 3EPIA 4NLGA 2UVRA 2ASLA 3DRRA 1FK9A 1HNIB 2HMIB 2WK4A 1S1VB 4K50A 2WONB 3ICLA 4WYWA 4J9RA 3KLFA 1MU2A 4K4VA 2R8IA 1HNIA 4IG0A 1DTQB 2HMIA 3GQCA 3G6XA 1S1VA 4ED8A 5C42B 2WONA 5KFJA 4YR2A 4RW9B 4WE1A 4K4WA 1DTQA 1LW0B 2ILZA 3HKWA 3M9MB 2UVUA 4DL7A 4K4XA 2R8JA 2GIRA 3DLEB 2FVQA 4NZ0A 4J9SA 5FDLB 2ATLA 4WXOA 4QWAA 1NHUA 1N56A 3PJWA 1JLEA 5KG0A 2R2TA 3BSOA 1T3NA 1TVRA 5FDLA 4M95A 4KSEB 1IKXB 2JEJA 3DOLB 1NNDA 3CVKA 4ECZA 3D28A 2B5JB 4TYAA 1IKXA 2YNIB 5HBMB 4EBEA 1IKVB 4FBUA 3NAIA 4MK7A 3DOLA 4RUAA 2W9BA 1VRTB 1T05B 2B5JA 3TVKA 3H4BA 3BJYA 1RT6B 2YNIA 5HBMA 4RW7B 1IKVA 3MFIA 5KT7A 1VRTA 1T05A 1WNEA 4RW7A 1HYSA 3C6UB 1HPZB 3DOKA 5DQGA 2AGPA 1N4LA 2FLNA 4WYLA 3C6UA 1HPZA 4ED0A 4I2QB 1S4FA 3DDKA 2AX1A 4IRCA 4ICLA 4I2QA 4MK9A 2FJWA 4NLSA 4EEYA 3UDLA 2D7SA 2VG5B 4KHRA 1KLMA 3OL8A 5EWGA 4Y2CA 2F8EX 4Y34A 4ZVEA 2VG5A 3LP1A 1ZETA 2W9CB 3RB4A 3V6KA 5EDWA 1TV6B 4NLPA 4ZVFA 1S9FA 2W9CA 2RDJA 2I1RA 3CDEA 1TV6A 4LSNB 4NLYA 3KNAA 4U7CA 5DGAA 4MK8A 1S1WB 4JUZA 4J9NA 4LSNA 5KG6A 4ECUA 4O3OA 2E9TA 1XR5A 3PW2A 2DPIA 2UUWA 1R0AB 3MR2A 1JLCB 4F4ZA 2W7PA 4IRKA 4MIBA 2IM3A 1IKWB 5CYMB 4PUOA 1R0AA 1S1XA 3CJ4A 3MFHA 3PJXA 4EO8A 4MKBA 1RYSA 1IKWA 5CYMA 2JEFA 4WFYA 4ECVA 1ZTTA 4WZMA 3IGNA 4ZVHA 4H54A 4ZPDA 4IG3A 4TQSA 3QGHA 3PR5B 3RBDA 1UWBB 2YNFB 2BRKA 4NRTA 5KFEA 1JLBB 2HNZB 3JSMB 3PVXA 1HNVB 2HAIA 1JXLA 1SUQB 1TL3B 4KKOB 4J9KA 4HYKA 4ID5A 1JLBA 3JSMA 1RDRA 1HNVA 2RF2A 2XI2A 1JLQB 1TL3A 4KKOA 1S6PB 2XCAA 3GIIA 3NKYA 5D3GB 4NLOA 3V6JA 1DTTB 1JLQA 4B3OB 4ECWA 3HVWA 1OS5A 3DRPB 1DTTA 4NLTA 4JV0A 4B3OA 1CSJA 2FJXA 2EC0A 4Q0BB 3OL9A 2IJNA 3DRPA 2UVWA 4RW6B 2YKNB 4Q0BA 1FKPB 2OPPB 3CWJA 4DL3A 4RW6A 2IBKA 1EETA 2YKNA 1FKPA 2OPPA 2WOMA 2IM1A 4KFBA 2RDIA 4Y3CA 5KFWA 4FS2A 1GX6A 1SH0A 2HWIA 5KFAA 3NGDA 2BQ3A 3M9OB 1BQNB 3QGGA 4O4GB 3EZUA 2QV6A 4MIAA 4K4YA 1C1BB 4RW8A 4NLRA 5EWEA 1BQNA 3FRZA 5KFOA 3Q8QB 3OSNA 4R0EA
chains in the Genus database with same CATH superfamily
2YNHB 3Q8YA 2PI4A 5I3UB 4DS4A 4H4MB 4XAKA 1LW2A 2D41A 4ED1A 1CULB 1WWHA 2A10A 1NB7A 3F41A 4G6VB 4FF3A 1S59A 1S9GA 1MU2B 1RCXB 2AX0A 5LT5A 3UO0A 3HJVA 4FYXB 2H4WB 2I0XA 3T5JA 3FFIA 4N47A 4DFMA 2BANA 3LGNA 4LSLA 2G1DA 5A8RA 3K5OA 4LREA 1IWGA 1X9MA 3LP1B 2DNRA 4M63A 4TQRA 1WEZA 4J9PA 4I56A 3MM6B 4DCOB 2G4BA 3S7RA 2ZC3A 4USTA 2XGPA 3HK2A 2RRNA 4D3HA 3R5AA 3D66A 2KL8A 2O01C 2BJ7A 3DKDA 3C19A 3M1VB 1S1UA 2JDJA 2VFUA 3PXGa 4QWEA 3HP6A 1Z1ZA 3BV8A 4CYUA 3B6BA 4F0HA 4G1PA 5K14A 2PMHA 2VFVA 4KO0B 1WHWA 2ZBQA 4J9LA 1RT3B 3KK1B 3CCRS 3ISNC 1SC4B 4UT4A 4B3SF 3OLAA 1NRKA 1LWFA 1CBKA 2RU9A 2KG0A 2ZVSA 1DZ5A 5LOQA 1J5OB 4Q43A 4ZIWA 5BYRA 3A3PB 3O8WA 3HHLA 2OP5A 6FD1A 3ENAA 5C42A 3IR6B 1LW0A 1BQXA 2MKHA 3G6YA 3ZZPA 2VFSA 2OEMA 3DI6B 2NUUG 2V2VA 2GQ2A 1SH2A 1T8EA 4NLUA 2KDOA 2M9KA 1DLOB 2WVEA 4H4KC 3CJ5A 4XK8C 1QY7A 1YDLA 2KXHA 3I31A 2OO4A 3M9NB 1U48A 2QL7B 3M6XA 1HBOA 2DNGA 4EYIB 4DV1F 4DR2J 4RNFA 1GFWB 3PDNA 2A6MA 1YJRA 4G1QB 3P5BP 3GWCA 2HRUA 4V1Ak 2EEYA 1JLCA 2XNQA 1TK5A 1TL7A 2R7WA 4CLWA 1QUVA 5CABA 4C11A 2RRBA 3SSQA 1RABB 5D3GA 2M8HA 4JYAJ 1W2BR 1RWKB 2V68A 3B78A 5L1KA 2ZH6A 2BKNA 2DTJA 2DNMA 4ANDA 1S6QA 4DZ6A 3JTPA 4ZHRA 1GXLA 1UWAA 1N36F 1F1BB 4E0DA 3EX7B 4YDDB 2HS4A 3BEGB 1F5CA 2FHOB 1S1TB 2JEIA 4DR1F 4YR3A 1HLWA 2QO3A 2E9RX 1FK9B 1S7IA 4WIQA 1XNRJ 1HNIB 2C1EB 4ILRA 3MAAA 3MMCB 2WBMA 2Q1LA 2IDEA 3BO3A 3H4BA 2HGMA 3C16A 3TVKA 3BJYA 4USUA 4X62J 1S4EA 4OIXA 4N7TA 3D2WA 2SXLA 3RW6A 1D8ZA 5IV4A 4ICLA 3ILOA 2DGQA 2VG5B 3RJMB 4B9TA 3AQPA 1WG1A 1HNWJ 4ZVFA 1S9FA 2I1RA 4Q2MA 4U7CA 1S1WB 4NA3A 1A7GE 4MAKA 3GFXA 3NG8A 3PIPQ 2XYGB 1VQ5S 1IKWB 4N5SA 2YWWA 2RJZA 1T11A 3W5XA 3J7ZT 2YNFB 2BRKA 4CO4A 3JSMB 1YZ7A 5B0BA 4X4RA 2K1RA 1HWIA 2JWNA 2IHR1 1VRQC 1PYOB 1FKPB 4OYPA 4LIRA 4F2RA 3MMJA 2VPYB 4R0EA 3LOUA 3FEXB 2CNLB 3MD1A 1FRIA 4ZP9A 3W60A 2UXCF 1F6TA 5KAKA 2K3IA 3QWUA 3B8HA 2N3OA 3IRXB 3KDOA 1KBRA 2HLUA 4KPCA 1HNXJ 1TVRB 1QVFR 1BWVA 3CCES 4C8MA 2W9BB 2NSBA 2XB2D 3MEGA 3LTOA 4KHMA 2ZE2B 3UWTA 2VQEJ 2AJQA 3DRSB 1HR0F 1FDNA 3T1HJ 5EX3A 2HPUA 4EBDA 4YY3J 3OVBA 5GADI 4CLPA 4LRAA 5CCMA 1IBKF 1VGYA 3IA0A 1Y5LB 1SKSA 3AD7C 2JOQA 2JSXA 1XQIA 3Q8VA 4GVLA 3HFZB 2GO9A 2JFDA 3NGTA 4NLQA 3Q22A 2MSTA 1OQ6A 3C15B 1YRUA 1HQEB 1Y11A 1M1KT 3FEZA 1LFPA 4OHXA 1UPMB 3CDUA 3GILA 4RZRA 1QDUB 1FWLA 4ECXA 2YXLA 4M5GA 2Q79A 4DV5F 4F25A 4IFVB 4XTTA 4TKTA 2GGPA 4DQIA 2HHVA 1UP1A 2XM3A 4PQUB 4WK3A 4CO3A 1FEHA 2J6TA 3ZZUA 1YHQS 2C42A 3MXHP 3NAHA 2QEXS 1TFYA 2P9GA 3K57A 3DLLQ 4B02A 1U47A 1WHXA 2GHWA 3MUTP 5T7LA 4LF2A 2GCFA 2CQBA 2RQMA 1PO6A 2WHOA 2IRXA 3TYTA 4PXDA 4ZDNA 2MLXA 1ZZFA 2MKCA 5IFMA 4PG7A 2BACA 4NZ7A 4LF9J 1M5PC 5KT4A 5CYQB 3AOAA 3EE3A 3BO4A 1NPPA 3CJQA 1WTBA 4RW9A 1YJWS 2VV5A 1KQSR 3D1HA 4DL6A 1JLGB 4HACB 5C25B 2EKNA 2H1YA 4IOBA 1HWJA 1T94A 2AJ2A 4ATNA 5HMZA 3J7YU 2AMCB 5KG2A 3NS7B 5GMDA 2I5JB 4OZLA 4B3TF 4DSKA 4NA1A 2ACMA 2B8QA 1RXOB 5J2QB 3NOCA 4RNNA 3SCKE 2QSWA 2OPQB 3W2WA 3RRKA 1NSPA 5D0RA 2QTWA 4MKAA 5LMNF 2DNKA 2J9DE 1S12A 3A12A 4NOHA 4ED7A 1O8BA 1CPZA 3IWXA 4P9SA 3L09A 2XSFA 4ZVQB 3T41A 1R27B 4AQYF 2P8IA 5RUBA 3DLKA 1XC9A 4LFBJ 2O5DA 4QW8A 2ZHOA 3GJRB 2XS7A 5EGYA 3O44A 3D5MA 2RSQA 2CVEA 4DV4J 1V3ZA 3ICLA 4QIEA 1PC5A 4WE1A 1WKJA 4FKXA 1DTQA 2QRRA 3CC4S 2D3OR 2DNYA 4EWTA 3DC2A 3UN2A 3CVKA 1VRTB 2W7AA 4KJIA 2N82B 5E2QA 1JNZB 3W7BA 1WNEA 4TLQA 3DOKA 1X4GA 1WKKA 2PE8A 2XYPB 1RE1B 1X60A 2W25A 3NWRA 2ZDOA 3CCVS 3TR5A 4NZ6A 4ZCIA 4NMLA 4DXLA 3UDLA 3PYGA 1URRA 1RQ0A 3LQVA 2RDJA 4LR9A 4OYOA 4A8MP 1Q16B 4MK8A 3D6TB 3I87A 2C3OA 4LMZA 2DCUB 4MKBA 1CJTB 4X66J 2Q66A 1UZHA 1DJ0A 1JQGA 3HHDA 1FEEA 3MI7X 1VFJA 4CTAB 2B4UA 1WOPA 2ZH9A 4ENOA 4ECWA 4XDCA 5AXLA 5CQGA 2AJ4A 2UVWA 3JSYA 3QAEA 1EETA 4CLKA 3W66A 2M4MA 3GSIA 5GVQA 2HS0A 1TL5A 2BQ3A 3EZUA 4RW8A 1BQNA 2B9EA 1EIYB 1UL3A 1VJQA 4DFPA 2ASDA 3EUNA 3QT5A 4I2PB 1YWXA 1D9AA 2RQ4A 4LFAF 5AT1B 2GHPA 4Q2LA 3HDSA 5A6PA 1TTHB 1U25A 1EZZB 5M2PA 4K2XA 2F8MA 2UUBJ 1NEEA 3IG1A 1T9WA 2KJVA 1QVGR 4W98A 3HKZD 2V9WA 3OPKA 2IAJA 1HI0P 3JYTA 3QLHB 4C3KA 1RK8A 4DX6A 4CLZA 2B4OA 3RRHA 2R4FA 2E9ZA 2YH1A 3QPIA 2HIQA 3B4MA 3LAKA 4MFBB 4C7QA 4JI6F 3TUIC 5GAEI 5F8NA 4WFBQ 1F9EB 2M8DB 4J5OA 1VQ4S 5A2QU 3CGIA 5HP1A 2AZ1A 5J2PA 4ZJQA 3KLGA 4GC6A 2XYHB 2CJBA 4XO0A 1FESA 3LUYA 3GJSB 1KFSA 1FWKA 2VONA 4NA2A 1QAJA 1VYAA 2ZUGA 1SL2A 2CAJA 5HN0A 2ZKTA 3HVTB 2GFFA 1VS3A 2FIUA 4CLFA 2DR9A 3WX4A 2CDRB 1UEVA 1GNKA 4FYVB 4M5LA 1MMDA 1XR6A 4LRBA 3PKMA 4TXSA 4I6YA 1SV5A 3H42A 3ENWA 5KFPA 4U9RA 5ADZA 3N9UC 1ZPWX 5FLXU 3BGRA 4DSJA 4WFXA 3IWLA 5BR8J 1S9GB 3VALA 3TQEA 3FMBA 4TNOA 1CVJA 3AXMA 2Z2LA 4FYWB 4F4WA 1N54B 2R2RA 2HQCA 2FTRA 2NCKL 3WC2A 1BXNA 3JQKA 2BANB 1SIZA 2J5AA 4U8YA 3NEKA 4JI5J 2MGZA 2CJ9A 3A3NB 2GVDB 2KG1A 1JJCB 1U8SA 3D1QA 3AJDA 3DLEA 2CPHA 4C98A 5KT3A 5J2NA 4X4PA 1UVLA 2HFUA 1VIXA 1SL0A 3CJ0A 4RBTA 4C6AA 3KHHA 3EYZA 1EX8A 3O2IA 3FQLA 3DGPA 3H59A 5J1EB 2WSEC 3M8QB 1T9XA 3BB5A 3R6GB 3CUNA 2HHTA 2DB1A 3MD3A 5F8IA 4QPXA 2J0XA 3O6QA 4DS5A 3BZQA 4ELVA 5F41A 5J1PA 3T3FA 3R5JB 3NGKA 3GR1A 3HZEA 3KHRA 1TKZB 1Y00A 4IFYB 1UFKA 2I38A 3M2UA 4ZMMA 4PR6A 3K58A 5EX0A 3KMSA 3RG6A 1EAYC 5JVHQ 4X84A 4LJMA 2PA3A 4HTIA 1XEZA 2VODA 3Q24A 3G87A 4E98A 3KJNB 4OHWA 2H9ZA 5ETQA 1C1BA 1REGX 5KFIA 1RA6A 3TRGA 3ONQA 3DLGA 2F8HA 3GTYX 3OTEA 3UN5A 3C6TB 1FFGB 3KTQA 1SQGA 2F3JA 2QA2A 1RP5A 4OX8A 5KOWA 3IGVA 2AD9A 2V8VA 3EXCX 4OI1A 4FNHA 5C42B 2H51B 2DITA 1LW0B 2HS3A 3HKWA 5HQ8A 2ATLA 1KVIA 4DR2F 2XMJA 4LF7J 1KOHA 1IKXB 2EFGA 5B0EA 5HBMB 3UNYA 3DOLA 2B5JA 1FNMA 2YNIA 1RAGB 2Q6CA 4QPTA 2FLNA 4WYLA 5AE1A 3DDKA 1FNOA 1T0TV 2NXEA 2R42A 4EEYA 4DDFA 1CC8A 2LECA 4Y2CA 1KN6A 1ZETA 1T7PA 1CJVA 2FUG9 2D69A 2RHQB 4L72B 2W9CA 2KHDA 4JYAF 4X65F 2MDAA 2RB7A 1JLCB 3M6UA 2Y0SD 4PXBA 3N79A 3PR5B 4YN3B 4C11B 1X8DA 4ES3A 2RDDA 4OYIA 2IVMA 4A8WA 2FJAB 1ZAVA 2XCAA 1TL3A 3GIIA 2AV5A 5D3GB 3ET6B 4KHPJ 1ZOTA 2CYYA 5L46A 4PEOA 2PA8D 4B3OA 1CSJA 2EC0A 1Q82T 2AEFA 1HKAA 1QM9A 5AE3A 2VOPA 4PKDB 1VHIA 2B9WA 1XNRF 3I9V9 3BS9A 5KFAA 4KGMA 2DR8A 4KGKA 1OSCA 1XK8A 1S57A 2NLWA 4QIGA 2UV8G 3MURP 5IC4B 1LWCB 1LWEB 3DOMA 4OI6A 2HBYB 3W8PA 2C3MA 4U6PA 1Y3JA 3ENQA 3Q8PB 2YPZA 4X62F 4ZKAA 2HNYA 3PACA 1Z2ZA 1UPPA 2HFOA 1GMWA 2FY1A 1HNWF 1ITPA 2YWGA 2A0FB 3LH2S 5B0CA 4JOUA 5B0FA 3HHLC 3V81B 4ICLB 2OPRA 5ITHA 3DLBA 4OYWA 4F3OA 4WFAQ 1NPRA 4JI2J 1JJ2R 3OBIA 1F3VA 3U1NA 3PYFA 1LEOA 1S0VA 2Y1IA 2CNNB 2ZH3A 1URNA 2A3JA 2XY6A 3RTVA 4QIWD 2HNDB 4JI7J 4ECRA 2QLFB 4ZK7M 1U2RA 1LKZA 1FRXA 2DIUA 5ETLA 1N32F 2J6UA 2MKIA 3TNVA 3RBEA 3RBZA 4NYPA 3VGVA 4Q8EA 3BGFA 1SI9A 1N5VA 4TY8B 4ZPAA 1GAOA 3ETOA 1HNXF 2MLYA 4NMXA 4HI1A 4DR3J 2CJQA 5DG7A 1H98A 4P7VA 2Z56B 3CCTA 3KOAA 3H5YA 1VMBA 1XMQJ 1FKOA 3MPWA 3BSCA 3T9NA 2DISA 2DD8S 2VQEF 3DU6A 2GQCA 3T1HF 4TY9A 2FVSA 3TEHB 2CJYB 3DCAA 2FDNA 4YY3F 5DGBA 3BGUA 4P71A 4DV6J 4UOCA 3OXLA 2BUNA 1X7VA 4I64A 2ZBIA 4IUFA 4A48A 5DM6Q 4JV1A 4Y2KA 5DM7Q 3R2CJ 2D9PA 4IH6A 1OWXA 4PWDB 1RGVA 4QBUA 4O44B 3AXKA 3K17A 2V4RA 2KT3A 1YGYA 3SCIE 1SJ3P 2ZD1A 2GVZB 3JXOA 3C14A 3MEDA 1RTHA 2KKHA 3MCOA 3U1LA 3I0RB 2G2ZA 3RR8A 1MMLA 3K59A 3UNGC 1T3OA 3ZTQA 4HHJA 2XSJA 4PXEA 5KG3A 2LU1A 4ECTA 1C2PA 3CC2S 2GJIA 3HLUA 2GGPB 3S6EA 4JBCA 2V4QA 2IA0A 4AT1B 4OI2A 2GX8A 4R5PB 2MKYA 1NZ8A 5DG8A 4LF9F 2OPSA 3FEYB 4F02A 1RHRB 1O51A 3EMTA 4DWIA 4PYDA 5T7LB 2VOOA 1RT1A 4IQMA 3NBPA 3EGWB 3V4IA 4NLDA 1SJ1A 4USKA 2VQFJ 3IBCB 2ZOMA 1M5KC 2P9EA 1KONA 2FHJA 2DVIA 4ES1A 2FLLA 3DRRA 1S1VB 1MLAA 4WYWA 3RW7A 2P6TA 4LRFA 4RW9B 2FD2A 2Z30B 5FDLB 2ZVIA 3PJWA 1JLEA 2J0SD 2DR6A 1U6FA 3OD2A 4TYAA 3EM1A 1R6YA 1EQ0A 2NQPA 1T05B 1SC6A 2HQ3A 1UJ5A 2ROGA 5C2GA 9RUBA 3C6UB 3PV8A 5DQGA 2XZTB 1FDDA 5CYJA 4I2QA 4ER8A 2YTCA 2GAHC 4W4MA 1FX2A 1MROB 1X4AA 3D3CJ 3H2UB 4MKYA 3BH7B 1DQAA 4FF4A 3K7RA 5KG6A 7AT1B 5ETNA 1PBAA 3MR2A 5CYMB 3D0IE 3HFKA 2RVJA 4KTQA 1UVNA 3QGHA 1KS2A 4QYZJ 4NRTA 4LFBF 3EDQB 1HNVB 1K8AT 4DL0C 4ETXA 1RACB 4RW6B 3M30A 3TI0A 5GMEA 5LSRA 2QJ3A 2CJKA 2OPPA 3AA9A 5IT9U 2HYIB 4YFUA 2QYCA 1A9NB 3CCLS 3HD1A 3M8SA 3PYDA 2JRSA 3TZWA 2MHNA 3BREA 3HFVA 1PJ5A 1EHWA 2J7KA 4URSA 4WXWA 2XWYA 3C3LA 1YK9A 4OZNA 4WE1B 3LPYA 1K0TA 1RWXB 2VD3A 4CP5A 4NXMF 1RAIB 5KFSA 1FCAA 2IJFA 3RB3A 1U0HB 2I8EA 3PO5A 4YS2A 3DOKB 4XIUA 2AP6A 3R5GA 2G1HA 3OFGA 1BMQB 4DL4A 5HLFA 1WKLA 3T5KA 1MN9A 2DNNA 5KG1A 4IOCQ 1ROFA 2DNPA 2MKJA 3R5DA 1U24A 3CF5Q 3V6HA 1NDCA 2JHEA 4PWUA 4OFZA 2H65B 1S99A 2PDAA 4KGZB 3OHBA 2NR0A 1SQFA 1B70B 3AOBA 1RWUA 3MM5A 3A8JA 4Y2MA 3Q0AA 5HROB 2M5YA 5ETOA 3OUYA 1HD0A 4HHHA 2JC1A 4CLYA 5LXRA 1IJEB 5HQLA 4UQTA 2CKWA 1AROP 1EETB 3LW5C 1QJHA 2V4JB 1N6QB 3PW4A 4P7TA 4RW8B 3W5YA 3QBCA 2ZM6F 3SBMA 4IDKB 1SH3A 1U1KA 2FJBB 3D3BJ 2OMLA 4DV0J 2Y9HA 4CH0S 5F8LA 2YH0A 3HSDA 3BH6B 2FZKB 4FYDA 3W63A 2PD1A 1TQLA 4CH1A 3GIKA 2KM8B 1X5SA 2W1BA 3JYTB 3PEJA 1H73A 3CIMA 1HL6A 2JFKA 4ELUA 1SBRA 2V2KA 1M5SA 4YB1P 2HZAA 1S9EA 3DN9A 4GKJF 2CQ0A 1UA0A 4DG1B 1RT7A 5H9EK 4QZVB 1AW0A 3I5BA 1BWEA 4NLVA 1TP7A 4ZPWR 1GMVA 3KYLA 4H4KA 5GMKa 2KRRA 2XNRA 1YJUA 1UJ4A 5J2PB 3NMAA 1YBUA 4PPZA 3MM7A 3MF5A 1P9YA 2QL5B 1U49A 5HVHA 4ZA1A 1EP4B 3K5NA 3I4PA 1FE4A 2ALZA 3DM2A 3HPOA 1D9FA 2VG7A 4AXJA 3MHYA 3I6PA 2HHXA 5BR8F 3M05A 2COLA 2W2NP 4V19J 2Z8QA 2C3YA 4WP8A 4X4OA 2YX7A 1U2CA 2P6SA 4GC7A 5LXYA 2WW4A 1RTJB 3K0JA 1C0TA 1TL1A 4B9VA 1S6PA 1S48A 3ULHA 1YBTA 3E01B 2GO8A 1YLXA 2MZSA 4KV8A 4WWSA 4FKYA 4JI5F 4K8RA 5K9FA 3P96A 2LQBA 2ROPA 3VHQA 1ZBTA 1KHWA 1FVSA 2OI2A 3LANA 2VC1A 1Q53A 3LF0A 1WELA 3M2RA 2E66A 4KY3A 5KFDA 2CQ2A 3QQCD 3R9LA 2VA3A 1RWNB 2QLBB 5THWA 2ASLA 3MM9A 1TAUA 4M5DB 1CQNA 1CC7A 4ZN1A 1QTMA 3MMBA 3DLEB 1NK5A 1LOUA 1D3WA 2HK3A 2X1GA 1OPZA 5B08A 2V8GA 3V4MA 2YQ3A 1U26A 1VQLS 2R7UA 4IO1A 1FTCA 1QAXA 1HPZA 1FJEB 2V63A 3OL8A 3EXYA 2B9YA 2F8EX 4Y34A 4ZVEA 2JVOA 1MWQA 3M8WA 4I69A 4DHVA 1FXDA 3KNAA 5DGAA 2QN6B 3CCZA 2DPIA 3TA0A 1NK9A 3AT1B 1R0AA 2RAQA 4ECVA 4F0MA 3G8TA 1W26A 1JK9B 5KFEA 2C2MB 2VBZA 2Q43A 1W2IA 4J9KA 2RF2A 1RWOB 3VVTA 4KC5A 3HVWA 3HM9A 1ACMB 1KOOA 5LSOA 4Q0BA 3OJUA 1S76D 2HG4A 2VPWB 4IYQA 2CPEA 4DV1J 1IBLJ 1C1BB 2EWHA 4OV6A 3GP9A 2YY3A 4E2FB 4LF7F 4CQ1A 3P49B 4KE5A 1F2GA 4ED3A 1S0OA 1RU2A 4AFFA 2WVFA 2N4DA 3UD3P 4CZCA 4WCEQ 2ZH5A 4UZBA 3LP0A 5DLFA 3M8PA 4QJVA 3PW7A 3KXDA 2NXNA 4FXWA 1S72S 2ZBPA 2KTQA 1HMVB 3SXLA 4WFZA 2WSCC 3MTKA 3SFGA 1RHUB 4OYZA 2L48A 3T5HA 4NPOA 2KT2A 3TJ9A 4LVNP 4KHPF 3DDNA 3I5CA 2BBEA 5I42A 1VQNS 4MT1A 2DR5A 3P8BB 4L73A 1RKJA 2N4CA 2DGSA 2F7VA 2G0IA 1JKHA 4Y6IA 8AT1B 2MB0B 3GG1A 2DEJA 2QA4S 2VA2A 3I0SA 2H3EB 1XERA 4JV2A 5F8MA 1XMBA 4YDXA 4DF4A 4DJBA 1AFIA 2PEBA 5F8HA 3H5XA 2GIQA 1U2FA 2Z57B 1FI4A 1LWXA 3KJFB 3PRVA 1QSYA 1BQMA 2WAQD 3IS9A 1ZA1B 2IC3A 2MY8A 2W9AA 3CCWA 1OIAA 3BQ1A 2YNGA 1WC4A 1I51B 4N77A 1VJWA 5HL7Q 3JB9k 2KB2A 4JI2F 2LQ9A 3MCMA 2CJXB 3OR2A 4F7VA 3I9ZA 3ITHB 1T9UA 4ZVPB 3PTWA 4DV3F 3T1YJ 4CM0A 4KQZA 1IQTA 1NJIT 1JXEA 4LBPA 4JI7F 4DQPA 3KJVB 2XBPA 1RWWB 3RR7A 3JQJA 3QT8A 4P72A 2YKMB 1UVKA 1X9SA 2O3DA 3WC0A 4UOHA 1FRLA 2A1BA 2NXCA 2EG2A 3JSBA 2CPDA 3PRDA 1NK6A 3FZBA 3M6VA 4HTJA 4RWXA 4AL7A 1DARA 1YI2S 1WG5A 3I55S 2PN6A 4RW4B 3DFEA 2K2PA 4DR3F 2H5EA 3ZZ0A 5G0RB 3ADAC 3K2YA 3G9CA 2RNEA 5HATA 4X4UA 1XMQF 1VQSA 3JTOA 1K44A 4ZCMA 3H0PA 4F67A 5EHHA 1QD1A 1VQYA 3EZOA 2CQHA 4Y0FA 3TANA 5KFLA 3W5ZA 2WTFA 2Z4PA 3FCWA 3BO2A 4DV6F 1IBKJ 1NSAA 3M6WA 2RS8A 4DU8A 2UV8A 3UDVA 4C8LA 2N7CA 2F9JA 3LP2A 2ERRA 1RB0A 4P2SA 1OY6A 1CJKA 2X51A 4TU8A 4TN2A 4ETZA 2XLKA 5D78A 3V6DA 4LIWA 4USHA 3M8RA 1SVDA 4OMFG 2XMMA 4B9SA 4FDFA 2V34A 2P5VA 4Q45A 5JXSA 3X3UA 1I3OB 3OFHA 4A8KA 4Q44A 3CJTA 3S1TA 2OJ3A 3TZZA 4DUYJ 2WB4A 5F3TA 2XMAA 3IXQA 2VB6A 1TR0A 2BW2A 2MYFA 3FBCA 2WONA 2GHVC 2BEFA 3M9MB 5E3AA 4QWAA 3BSOA 5I3PA 1SJQA 1YJ7A 2B3TB 3TP2A 2DHSA 4DX7A 2B0GA 3U02A 1N4LA 3MM8B 1SKRA 2VH7A 1YRXA 1S4FA 4C8NA 1RCOB 4MK9A 5L38A 5EWGA 4PG5A 2J0QD 2MQMA 3C14B 1R8PA 4F3QA 3MPVA 2DNQA 3GMGA 4LSNB 2CWKA 4O3OA 2KO1A 3SDEB 3AH6A 2LVWA 2DT9A 1RSCA 1VBYA 4U96A 3ZNJ1 1JXLA 3D54A 4CLTA 2KFYA 2MQOA 2DK2A 1RAHB 4ANEA 2R7RA 3DRPB 2VQFF 2FJXA 2IBKA 4FS2A 4Y3CA 1IBCB 3W3SA 1KQGB 3DHWC 2HURA 1CJUB 4DV7J 4KT0C 5CZVA 2G9OA 2B4PA 3MGJA 1C1CB 2J6SA 2RKIB 4K4ZA 3UN3A 2LMIA 5LMNJ 4WPAA 1VK8A 2W01A 1HIYA 2YKOA 1JLFA 3UVJA 4O0IA 4LF4J 4B3RJ 4IKAA 5A8WA 1S0MA 1JLEB 3A8KA 1HBUA 3QT7A 3GYXB 1AA1B 2Q3PA 2FPHX 2FYXA 2IYIA 4YB7A 1SC1B 2EW9A 1B3TA 4IO9Q 1J27A 4PAAA 2UXBF 2VPXB 4M5NA 6AT1B 1AXQA 1IWAA 1MSWD 2MQPA 1VQ8S 2XO6A 1ZAWA 1IKYA 1WTFA 2DKOB 3IFEA 2NPFA 5DETA 3MPDA 3LGMA 3CIZA 1JJHA 2UXDJ 5LSLA 1MW7A 1RTIB 2GV1A 4YOEA 5AJ3J 2F9DA 3SQGA 3NL0A 1T02A 2BV3A 2DXEA 2OUGA 2JEGA 2PMWA 2XQCA 4DU7A 2CG8A 2DRAA 3DU5A 1FF2A 1VCTA 1YTYA 2LQ8A 1UTAA 2CIMA 2KJWA 4OV1A 3M30B 4K59A 3HSZA 3R8YA 2RE1A 4Z7YA 4DZDA 2WVDA 2ACYA 2KXFA 5KFVA 3D67A 3W2VA 4QCLA 1SKUB 2Z0GA 2FJDB 3RAQA 3SSRA 2LYVA 5HK4A 1EQMA 2VASA 4ZVSB 2LXFA 3DYAA 1IR2A 4DR6J 3KK3A 1C0UA 2IMOA 2I2YA 5B7WA 4CRJA 4PQAA 3AFGA 4HDGA 3CCJS 4OJGA 4LRDA 3KMQA 2DY1A 5C24A 1CS4A 2EC2A 3PJ9A 5AE2A 3R5BA 2HVIA 4OZ3A 4O4RA 1GEHA 3M8ZA 5GAEU 4N56A 4ECQA 1QSLA 2DRBA 2VJUA 2R8GA 5B0GA 2DXFA 1KLNA 5A8KB 4TU7A 3AQOA 1M90T 2CADA 2V9KA 1SXLA 3J7YI 3UFCX 2VFRA 5D4LA 3MECB 3PEHA 2CFXA 3AA8A 2ZFHA 4DV0F 4A46A 2ZOFA 4JB8B 2E1AA 5KFXA 4MKVA 2XULA 2MQNA 4HHUA 1RTDB 2IFXA 4JI6J 2HNZA 3PY8A 1KRPA 4RU9A 3DRYA 4H4OB 1NKBA 2ILYA 1JMTA 1BLUA 3KUEA 2PEHA 1NKEA 1RT4B 2WRMA 4P73A 1UEUA 1HBMB 4F0KA 4K5RA 5KG7A 3EPIA 1C4CA 3GQCA 3R5CA 5KFJA 3QRPA 3PG9A 3HT0A 4LF6J 2BM0A 4BBYA 5K8OA 3BN7A 2DR7A 4AYBD 3VGUA 3KFWX 2PO4A 1NNDA 4RUAA 4CLUA 1NCLA 4A8YA 3MFIA 1TK0A 1IKVA 2AIRB 2DGVA 4RW7A 1X9WA 4CO2A 4FXDA 3QT6A 4IRCA 2BOAA 2FHKA 4ZPVR 4QOTA 4K2JA 2QT7A 3ILIA 1NSKL 2B56A 4NLPA 1OMSA 4CO5A 2ATCB 3PW2A 2V94A 1V3SA 3EJMA 4MIBA 4CLSA 2JEFA 2KXNB 3UCZP 3PVXA 3CCUS 1Q86T 2JNJA 1S6PB 5IM0A 4DR4F 2OAUA 4DPTA 4JV0A 1DURA 2EI5A 1WACA 2F4VF 2YKNA 2V2QA 4DPXA 4DPUA 2IM1A 2RDIA 5KFWA 1SH0A 1W7WA 2UZAA 1SKWA 4MIAA 2IY5B 1VQOS 3TAMB 3EGVA 1KQFB 2YNHA 4ZLJA 1B0TA 5I3UA 5ETSA 3LPEA 3OSPA 4H4MA 1ZM4A 3FUYA 3MDFA 5J1NA 3QIDA 4M1KA 4DUTA 3A8EA 2KI2A 3MMBB 4BLGA 2VG6B 2VIHA 3R6LB 3KUGA 3CPWR 1TKXB 3DHXA 2FVRA 2IVFB 2HK2A 3A4TA 4BS2A 1IVZA 3HVRA 2ZEJA 3GCWP 2L3MA 4KRWA 1IR0A 3NRBA 1N5YB 5L1JA 1HARA 3QATA 3MAQA 4M94A 3MM6A 1FO1A 2Z2ZA 4F4KA 4J9UE 5LMUJ 4OZ0A 3NNHA 4JI0F 1QTNB 1NJZA 1HQUB 2V2ZA 2OH2A 1IBLF 1FJGJ 3GE9A 1R8BA 2RT3A 4O3NA 3OTDA 5L8RC 2RF2B 3M1VA 3IBFB 3K89A 4KR0B 3TQ1A 1H72C 4D3GA 1B4SA 1KNZA 1NPKA 4Y00A 2A2DA 1PSDA 3RZAA 1FA0A 2DHGA 1KR4A 1HWLA 4Y28C 2DH7A 1VIOA 3IM9A 4O3QA 5KFUA 4X65J 4EGLA 1RT3A 3KK1A 1VC6A 5DZ7A 5DS7A 2E5JA 3O5TB 1OY9A 3ENVA 4EFAC 4QU7A 1J5OA 3KLEB 2DPJA 2BRLA 4RBVA 2CPXA 1GTEA 3GJTB 3W9IA 2W8LA 3PM9A 3GCXP 1CQMA 2J9CA 1T03B 2ZJRQ 2R7QA 4F4YA 4WIIA 2XMKA 2ZHBA 4DOZA 1DLOA 3IR7B 1HHSA 3OL7A 2QMWA 4C8OA 2AGQA 2GNKA 2YBVA 3BR8A 2KYXA 3W9JA 1GMUA 3POTB 2C3PA 4ZVGA 4G1QA 1VOMA 3UR0A 4OL8A 5L9XA 1GXUA 4FNIA 3QNWB 2OEKA 1RHJB 1UW9A 3CJKB 2BE9B 2YVSA 1N5TA 2LEAA 2D3UA 5KG4A 3W65A 2ZITA 2R8KA 1EKSA 3RB0A 1YITS 3IS9B 2K7KA 1D09B 2N7YA 1XIQA 2BJ3A 3T1YF 4MTPA 2F40A 2YWHA 4O4GA 1P1TA 1TUWA 3DMJB 4XPEA 4DBQA 3OVAA 3UD4P 1YIJS 3VVUA 1KD1T 4MH8A 1KTQA 1N32J 4O3RA 1IUJA 2DO4A 2MQQA 1S1TA 2C28A 2MSSA 3EGZA 3NNCA 5KFKA 1RKIA 1UMJA 4KAIA 1XBWA 4MMOA 1T9VA 3RAXA 1FK9A 1NZAA 1HNIA 2EFPA 1WF2A 2ILZA 2PMZD 3CDAA 3TX8A 3M2VB 5E3CA 2R2TA 2OLWA 1YX2A 4RLEA 3NGSA 2JEJA 3QSYB 3BBBA 3HF5A 3NAIA 1CG2A 4OZ5A 4USMA 3TW0A 1EKRA 1KVKA 5D4NA 3J7AN 3Q8UA 4KYZA 2DGWA 3D1OA 3CT9A 5IQ6A 4HDHA 2VG5A 1AUSL 1G4CA 1D9DA 1TV6B 2C2NA 3UD5A 1B99A 4RUHA 1UJ6A 3TUPA 2HGNA 2ZOGA 4HH0A 1IKWA 2CJAA 4LVOP 4ILLA 2HHSA 1NSQA 2IYGA 3JSMA 2CQDA 2NXJA 5SZTA 4MYTA 3GZ7A 1FXLA 3R27A 4KH1B 5JVGQ 4DUYF 3HSJA 2JH3A 5DRKA 1FKPA 4LF1A 3FRZA 2AYEA 1REVB 1U1QA 3MEEA 1V3RA 4YEAA 1RT2B 4R8UB 2BR0A 3G71S 1VQ6S 2VKRA 2P2CB 3Q86A 4CNZA 2Z2MA 5M2RA 1P27B 1NJWA 3IRXA 4I0WA 1KSPA 2QIFA 4IQXA 1FJCA 2FJVA 1SC3B 5M2UA 1VRUB 4RL1A 5B0DA 4NCGB 3B4DA 3FSIA 4DQSA 1E6VB 2B6AB 5HMXA 4M5KA 2ZE2A 4A8OA 3ZTSA 3DRSA 3PFEA 4CT8A 2KN4A 1T95A 3PX4A 4LFCJ 1RT5B 1Q8KA 5KFNA 5IC6B 4I7FB 3QIPB 1MWYA 1OPIA 1VLOA 3NS6A 2VF3A 4IRDA 3WQPA 4ECSA 1YQHA 2OGUA 5LJ3Y 3D0HE 3P3DA 4F50A 2ALYB 1SQEA 2HLTA 2XHWA 3NCPA 3CO9A 4DV7F 1Q4RA 3CJ2A 3C15A 2ASYA 5L9NA 3QO9B 1HQEA 5C5JA 3G6ES 2YKPA 4ZPBA 3F56A 2R8HA 1CLFA 1KFDA 2EKYA 2ZUAA 5KFZA 2HHWA 2VU5A 4PRFA 4LF4F 4B3RF 3R7NB 2BDPA 3V2UC 1CEZA 3L7OA 4IFVA 4ED2A 5HMYA 2Y0BB 1JJ4A 3UI3A 3U27A 1VBXA 1TZ0A 4PQUA 3MMAB 2CQPA 2OD4A 2OTLS 1JLFB 3TUZC 3OV7A 4QW9A 2QFIA 3CSKA 4DSFA 3VCDA 2C2ZB 2RRAA 4ILMA 5DLGA 2R2UA 4PABA 1K9MT 1V6HA 3BM7A 2FVCA 2UXDF 3KLHB 5CYQA 5AJ3F 3WZ0A 2X7IA 4F3MA 9ATCB 2LEBA 4EZ9A 1JLGA 1UVJA 5C25A 3GIMA 4L76A 3OJSA 4K4TA 1IBMJ 1JX4A 3KUHA 1PCAA 4U67Q 3QGPA 3TZYA 3MUMP 4ID8A 4N76A 4NXMJ 2BE2B 2W4DA 5DJBA 3VV2B 1LQ9A 2NYHA 4M8LA 5J2QA 1OSDA 2B51A 3E8OA 1VISA 3H5UA 2CDQA 1RAJA 4X64F 3R3TA 1PJ6A 3GG0A 2OPQA 2BVZA 3MOZA 3A13A 3MCNA 3UDEA 4DR6F 1RYRA 4JI8F 4I67A 3W2VB 3QRQA 4YB5A 4Q7AA 4DCPB 3BKTA 1RWVB 2A6OA 1FRJA 3CW2C 2GAGC 2XGQA 5L1IA 1YKWA 2AYMA 1IM4A 3W62A 3D9BA 3DYAB 1XR7A 3CD7A 4X4TA 1ZS6A 3L7UA 3KLIB 5AXKA 1GT8A 3H4DA 1H2UX 2AZ3A 1QE1B 3DNCA 4YR0A 1WC6A 3DLJA 1X4HA 1RHQB 1YVFA 5C24B 5GAHI 3K5MA 5DQHA 3MR5A 3ZZYA 2HMIB 3M8YA 3KLFA 5K8MA 2GJ2A 2M3DA 2IVYA 4ED8A 1XMOF 3TOQA 2HWTA 2C2KB 2ZM6J 3RGIA 1RWPB 1S0NA 3RU0A 1MG7A 2Y1LB 4ECZA 3D28A 1GQEA 2M0GB 4EBEA 4MK7A 3SI8A 1ZM3A 3T5LA 5B0AA 4OX7A 1FFWB 4X4QA 1VRTA 3CE8A 2MPUA 1TUGB 2AX1A 1U1PA 1E6YA 2IJRA 5A0YA 4C0HA 4OHYA 2M70A 4B08A 4GKJJ 3DDIA 1IXKA 1VBZA 4OHVA 3K8VA 2ZDPA 3VGTA 2EBGA 1VQMS 1Y0HA 2E5LJ 3CMAS 4P2FA 1CJTA 3DGVA 4LF5J 4IG3A 5BJRA 3RBDA 5MAOA 1JLBB 2HNZB 4ERDA 4KKOB 2BM1A 4RUBA 1JLQB 4CTAA 1DTTB 4U95A 4JP8A 2CNOB 3ZTOA 3AD8C 2IJNA 1VQ9S 2X1BA 3UW1A 3QSIA 2KZMA 4K5SA 2EVZA 1RISA 3QGGA 1VC5A 2BJEA 3IAM9 4NLRA 5B09A 1NK4A 4LF6F 2MZRA 1LW2B 2AF6A 3EVOA 2RHSB 4TLRA 3Q8SB 2ZJPQ 4BDPA 4DL5A 1OO0B 1JLAA 2MLZA 2HQGA 3FFIB 2LLZA 3R1HA 3CD6S 2QLWA 1BD6A 2X3GA 3PFOA 4LSLB 2AQ4A 3QLHA 2VHGA 4OZ1A 4RBUA 2XEXA 4ZJOA 3VGSA 5A8RB 3BN4A 3HHEA 3BF4A 1FFSB 2V0NA 4MIWA 4QU6A 1G7CB 3MTJA 2BZ2A 3NOGA 5KG5A 4MFBA 2HSEB 3UCUP 3SMZA 3PW5A 2W24A 2L41A 1H2VZ 1EJ7L 3N4WA 4A47A 5D15A 1FVQA 3JQMA 1NK7A 2VPZB 1NB2A 3L95X 1DAXA 1WD6A 3DLHA 3AY0A 4K4SA 1S1UB 1S79A 4RNOA 2LDIA 1H38A 5IM0B 1MNEA 5A2QY 1S5ZA 3BKUA 4CYUB 3OLBA 4LQ9A 2D3O1 1WJ9A 1RA7A 3HVTA 4M5JA 5K14B 4ZLPA 1X5PA 1Y7PA 2ADBA 4ZPCA 4CT9A 1U8WA 4F4AA 1LWFB 1DQ9A 2WVBA 5HQMA 1TFWA 3KHLA 2YX4A 3G82A 2HHHJ 4QYRA 4JV5J 1FE0A 1HA1A 1GH8A 4IOAQ 2XS5A 2F5GA 4J9QA 3I82A 2X1AA 5F0UA 2KYZA 3HHLB 5FLXY 4O3SA 2KH9A 3VR1A 3T9ZA 1TL4A 1OJ4A 2P9CA 2XHCA 1VDHA 5LMUF 2RUGA 4LUBA 1F5BA 4P10A 1BUXA 2E5HA 2GVDA 2RQKA 1FJGF 5KFQA 3T6JA 4LF8J 3OL6A 3BSAA 5IOLA 1Q81T 5LM7E 5KTQA 3MWBA 1VC0A 1HW9A 3THVA 3NGRA 2YPYA 4EMDA 1P9QC 3P45B 1XWLA 1FD8A 3JTNA 1XNQJ 4LR8A 2XG8A 4EO6A 1HBOB 3NXZA 3TWZA 3IRWP 3LA0A 2RU3A 2UUAJ 6FDRA 1T9YA 5J1EA 3M8QA 3WIVA 1WF1A 4I6AA 1TL7B 1TAQA 2QZ8A 1TKZA 4C2MA 4AXIA 3C8YA 4IFYA 3D4JA 1H7WA 1N33J 3MCSA 1UVMA 4ZLLA 2HEKA 1S6QB 4ZHRB 3G86A 1Y4ZB 2R7XA 4NCBA 5IS2A 4DQRA 3OR1A 4PWWA 1NJYA 2Z58B 1M1GA 2M88A 3PHTA 1L3VA 4YUDA 3FMWA 5H9FK 4DN9A 1G2EA 2BA9A 3C6TA 1TELA 4ZN3A 2XWXA 1H6KX 3I96A 2L08A 4KPYA 3MAAB 3G6XA 2YKAA 3AAWB 2ZJQQ 4K4WA 3CJRA 2HBQB 2BOPA 2UVUA 1KTVA 1NHUA 5H9EJ 2QLJB 4OYAA 4KSEB 2HAFA 1U6ZA 1ZZNA 3C16B 1IKXA 3US5A 1YJ9S 5HBMA 1L3UA 1HYSA 1R7IA 4I6WA 2X3DA 1KKHA 4UY8T 1Q5VA 1Q8BA 1NBEB 4X4SA 1HHTP 3CC7S 2HFVA 4DV3J 2XZDB 4X4NA 2AJ0A 1H7XA 3AODA 3VZHA 1S1XA 3BYRA 4F04B 1VQPS 3MEKA 4OJHA 4B9UA 2QA1A 2B7CB 2K1RB 4HYKA 4C48A 3NKYA 2WB1D 1PAEX 3ET6A 4NLTA 2IDLA 3KKFA 4KFBA 1DRZA 2FQQB 1S6UA 4O4GB 2HVZA 3MOJB 2R7TA 1YZ6A 1HBNA 3MUVP 2AKWB 3AJ1A 1KDNA 5FJ4A 1LWCA 4BWJA 1LWEA 2L9DA 1U1LA 4C9DA 4KH0B 3AJ2A 1NDPA 2GZOA 5KFCA 2Y8YA 2RUSA 1VQ7S 2JLGA 4P2MA 2AYBA 5FIIA 2GIFA 2H5JB 4ZIVA 2KFZA 3MEGB 1UW4A 3MPYA 3ZFVA 1IR1A 5HSPA 3ILLA 4ZCKA 3R1LA 2XMWA 3FBFA 3V81A 4S0MA 1B7YB 4WU2A 2RMLA 4UW2A 4C3MA 2CQ4A 4CCHA 3CCQS 2XS2A 1VK3A 2BX6A 3ZZTA 3MR7A 2MXYA 5ETTA 2B43A 3GYNA 3NCQA 3A3OB 1L3KA 2ZZNA 2MJUA 2HNDA 4RU2A 3GV5B 5F8JA 1X0PA 2CZ4A 1WUUA 2E5GA 4BWMA 2BJ9A 3PZPA 3PX6A 3TZXA 1IN0A 2CVIA 5IZHA 2KRBA 3HI9A 2MY7A 1QSSA 2EFOA 5CHCB 2A18A 4TY8A 3J81j 3FRYA 5F9NA 4CI0B 3IAS9 1PKUA 2R2SA 4JI4J 3MEEB 1C4AA 1X0FA 2N3LA 3HJFA 3QJPA 2UVVA 1AZSA 3H5SA 3Q2TC 1Y5IB 2BXJA 4NI2A 1H3DA 1DFDA 1DQ8A 4LFCF 5E3QA 4L74A 1KC8T 4IH5A 2XLIA 4KGXB 1D0EA 4UF4A 4USVA 4GVBA 3PYEA 3PKYA 4C0BA 1HQ2A 4J9VA 2AU0A 3CULA 1FERA 1WDTA 4Y2AA 4C97A 4PWDA 5C2CA 3QAUA 5LJ5Y 3M7VA 4O44A 4ED6A 1S77D 1RHKB 3G8QA 3PIOQ 1WC3A 1NAQA 1L3TA 2C2OB 4WKYA 4OI3A 3L3CA 2G0JA 2FLOA 2FVPA 1UKUA 2GVZA 3VAGA 3GFHA 3W2WB 3I0RA 3TVYA 3EICA 1G6BA 4YB6A 2BW7A 3H98A 3LO3A 2DHXA 2JZ5A 1UFWA 2UXBJ 3FCVA 1Q8IA 1UWBA 1Q8LA 2XCPA 4A4JA 3EDRB 4YP3A 1FJ7A 2J0WA 1J5EJ 4R5PA 1R31A 3KJQB 2DGTA 3Q83A 3FNNA 3AHPA 4C0OC 3DLKB 2AW0A 1X5OA 1EARA 1ZH5A 4WTOB 3OXGA 4NEZA 2NUHA 5J2MA 3QFHA 3DXBA 4DUZJ 1KHVA 4EU0A 1IBMF 4Y2IA 2AEJA 2B9XA 1X31C 1DTQB 1S1VA 4YR2A 5ETKA 3FZ2A 4K4XA 4J91A 3NLCA 4DR5J 2J7WA 5FDLA 1P1LA 1HI8A 1T05A 1FNXH 3P6YC 1WSRA 3C6UA 2OFGX 1NMEB 3ZC4A 3SCLE 4KHRA 1ZYQA 1WF0A 2HFNA 3RB4A 4WK1A 2LCWA 5CA5A 3UDCA 1MROA 4NLYA 3VF0B 2DO0A 4JUZA 1PYSB 2OFHX 3EZ5A 4F8RA 7FD1A 1K73T 5A6WA 5CYMA 3GIRA 3BBCA 3VAKA 1GK8A 4N41A 1H0HB 2LEPA 5I4MA 2QG9B 2ZWOA 5F3ZA 1HNVA 2PFDA 3FKBA 3V6JA 2CPZA 3FVYA 1R8AA 1OS5A 5BYQA 1FWPA 4RW6A 1FT8A 4OZJA 5IV3A 3O3LA 4Y65A 3M9OB 1BQNB 2RH3A 2QV6A 3TO8A 4YHHJ 1F3FA 3AB4B 3KK2A 1GMWD 3KNGA 2AYGA 4NXNJ 1PAUB 5IT9Y 1AYEA 4UY85 3M32A 3KLFB 3IG1B 5CD4H 4WFNQ 4C8ZA 2IAJB 1Z4UA 3K5PA 2GMLA 3SSSA 1FKAF 1PYTA 2ZKUA 1WC1A 3A8IA 4ZVUB 3H2LA 1SPBP 2ZHAA 4A8QA 2DNOA 3PO4A 4KIAA 3FDSA 3R97A 1U0HA 1FRMA 1S7HA 3PX0A 2H4YB 2FC8A 1TKDA 2E5LF 4LF5F 2J9EA 4CO1A 1E6YB 2OKQA 3C66A 4BCAA 5A0YB 2HIYA 3GV7B 3I4HX 4P2XA 1A6LA 2MTLA 3HO1A 5KT2A 5HP1B 3PW0A 3KLGB 4YMEA 5HJYA 4OI0A 1UFLA 4IG3B 1PILA 3NGUA 3TEGA 3X1LB 4CLLA 3IO1A 5HROA 2DCLA 1R0CB 2NS1B 3G6VA 5L1LA 2UUCJ 2LQ5A 1NO8A 4PXCA 1U02A 1U1MA 2CQ3A 5KFGA 4URQU 2V4JA 1N6QA 2KZZA 1S97A 5IT4A 3SCJE 1SV5B 4DX8H 4IDKA 3CTRA 1R0BG 4LBHA 3BGRB 5F9LA 3BGLA 3FSXA 2CPIA 1HW8A 5ETVA 2K06A 3W61A 3THPA 1JLAB 2F65A 1FX4A 5ETRA 3U7JA 5CD4A 4DR4J 1Q78A 3GR0A 5IQQA 3KDNA 4FPIA 2WVCA 1OYEA 2XC9A 1TKTA 3MZIA 3D6FB 4B9MA 1VHFA 2F4VJ 2MGZB 2HKEA 2V67A 1X4FA 4LSZB 4DG1A 5HI7A 2KFNA 5JUMA 3J7Z5 1FTRA 2GJFA 5GAGI 4J9OA 3D6HB 5AXMA 5J2NB 2M7SA 1WI6A 3OTCA 5D8HB 2ZC4A 3TA2A 2I9SA 3D68A 4TYBA 3DGPB 1RTZA 3IR5B 3IM8A 3OTOF 4RNHA 1W25A 3RUBL 2C2EA 2DBBA 5L39A 3GONA 4DL2A 1EP4A 3BDPA 3IP0A 2QGFB 1U1RA 1HFEL 3BQ2A 1RHMB 4FPRA 5IT0A 1NK0A 2X1FA 4ED4A 1F0XA 3QJLA 4PG6A 1L5UA 2HHHF 4ZPTR 4GRSA 3M2UB 3H25A 3TARA 4JV5F 2FY8A 5D0HA 3BR9A 3CCSS 3S8SA 2W4CA 1V9OA 5K20B 1RTJA 4ECYA 1QAIA 1VR6A 4LRCA 3E01A 3GU0A 5DDOC 4JI0J 3V5RA 2KT5A 2FGCA 2FHJD 4JI1J 2QE5A 3G82B 4X2BA 4J90A 4FYYB 2EK1A 3VAMA 3DLGB 4LF8F 5JMNA 2GC8A 4B9LA 4OJ1A 3S01A 2PSZA 4QIFA 3G4SS 4O23A 2LKZA 3FK4A 3N6MA 2LDYA 3CJ8A 2PI5A 1XNQF 2R8IA 4IG0A 4M5DA 3IWNC 2UUAF 1V5IB 1RBOB 1WOOA 2GIRA 3NNAA 3GJQB 2BE7D 1U1NA 3DOLB 2B5JB 5IXUA 2YNIB 1NM2A 4KGVB 2O67A 2DIVA 1NU4A 4R25A 1FDAA 2Y8WA 2AGPA 2F63A 4EZ6A 2BABA 4NASA 1KLMA 1CJVB 2EXUA 3HZGA 2R9LA 2W9CB 3V6KA 5EDWA 1N33F 4RO0A 1TMJA 3F44A 1JB0C 4J9NA 4E8UA 4J37A 3WHIA 1XR5A 1I94J 2CPJA 2G2OA 4PUOA 4OX9J 4EO8A 2MZJA 1ZTTA 3NY0A 4ZVHA 4DSLA 4TQSA 2ZZMA 1G3OA 4EK2A 2EK6A 2G0CA 3QJJA 2XLJA 1TL3B 4ID5A 2E1PA 2V8PA 2IRYA 3PNIA 4B3OB 3SZ2A 2MJNA 2CPYA 2R7OA 2GA7A 4GKKJ 4DL3A 2LFVA 2PGCA 2VUGA 3Q23A 3GYGA 4M5MA 5KOXA 3OR1B 3WDOA 4DPOA 2QSFA 1FXRA 3DOMB 1ZM2A 4UOFA 3R2DJ 1VI7A 4J7CA 3F0NA 1PG5B 1FRKA 3FCHA 3IMQJ 1U6BA 2QMUB 2MEWA 4K7QA 1M1HA 2HNYB 3OVSA 2AT1B 3H7HB 3CB4A 4ED5A 1Y5NB 3K5LA 4GO7X 5GADU 1ULRA 5CAAA 1HYSB 4IH7A 2Y1RI 3I32A 1HMVA 2OPRB 2WBRA 5HAOA 3Q89A 1NDKA 2NXUA 3L4BC 2FC9A 5HANA 3OFFA 4CWBA 4OYBA 2JX2A 5KFTA 2PFFB 2WW8A 1S1XB 1VLYA 3UQSA 1O5JA 4ZOSA 1B7FA 5KFMA 1N34J 3B82A 5KFBA 1YBAA 4DX5A 3E2EA 4G1IA 4OZ2A 2FJEB 1B0VA 1LK5A 1TMMA 3ISND 1JXVA 2LXUA 2D1CA 1YJTA 2M2BA 1U45A 1LK7A 4P74A 4FXVA 4KFBB 4A8XA 4ZP7A 1HBNB 4NRUA 2L9WA 5D4PA 4DV2J 3SFUA 2QFJA 4CH7A 1FKOB 4RX6A 1G1XA 3CO0P 4G3IA 4WF9Q 1A0OB 3BQ0A 5IWAJ 2L9NA 3ZO7A 3IC1A 4ZP6A 2OHDA 2AJFE 2VBXA 3KLVA 2NREA 2UU9J 3ZZOA 3ITHA 4CDIA 1NLKL 4UQGA 4Q8FA 1TU0B 1HNZJ 3EWGA 1KEKA 2XI3A 3QZ8A 2UP1A 1RZMA 4DSIA 3KJVA 1RADB 5KT5A 4USIA 2YKMA 1PIEA 1K1SA 2FHMA 4QWCA 2ZH7A 1RT6A 4F4XA 2HZVA 4O0NA 1MMNA 2ZD1B 1RAAB 4QR2A 2IIHA 4OJ3A 3MEDB 1RTHB 4RW4A 1DY3A 4RPFA 4URGA 5HMWA 5G0RA 3W9HA 4JI4F 3QGIA 2G13A 5CCLA 1Q1KA 3LALA 1K0VA 5EWFA 1SJRA 4YQWA 3HT3A 2XSJB 5D6GA 1R3NA 4WZQA 2PT0A 3RB6A 3LGHA 3WBZA 1U7LA 1X4EA 2GQQA 1SUQA 2BMBA 2J76E 3SYZA 3IN5A 4W92B 2WZ1A 1F2HA 2DEIA 3THTA 2OPSB 1VBKA 2J7UA 5E3RA 4DPYA 1AZSB 2R3VA 4RR5A 1RT1B 4NI2B 4QWBA 3F73A 2H5IB 2C2DA 2RILA 3NBPB 4Z37A 3V4IB 2HVEA 4KBIA 1PJ7A 2EFQA 3CMES 4OI4A 4W90B 2OTJS 3DRRB 2V50A 3I5AA 4NLGA 3AB2B 4LR7A 3FJ2A 1HHQA 4Z2XA 4K4VA 4K50A 4GVBB 2E1CA 5BXIA 4NE9C 2QA4G 3C2PA 2R8JA 5D0GA 4M95A 3G2XA 4L3KA 4NCAA 1OY8A 2OSRA 4NEYA 5CXTA 4P6QA 1N88A 3QWPA 4I2QB 2R7VA 3MM8A 2FJWA 4NLSA 3QFWA 4JI3J 2W2MP 1X4DA 3GB0A 1BC6A 3NWGA 4OYXA 3J80U 1H74A 1Q0NA 5K8PA 4LSNA 1J5EF 2YX1A 3VTIA 2UUWA 2D74B 4F4ZA 1M5HA 4IRKA 4M5IA 3SDEA 1F60B 5JJBA 4WFYA 1HWKA 3N01A 4WU3A 1UWBB 1Z2LA 3OT9A 4B3MJ 4EUVA 1RDRA 2JLFA 2ZZTA 2ZBCA 1FHTA 1J2VA 3GPAA 4DUZF 3DRPA 1LXNA 3TJAA 2OPPB 4C8KA 4C4WA 2WOMA 3TAQA 1GX6A 4OHZA 5GAHU 4PYAA 4HEA9 4L3NA 1CJUA 4DR5F 1F5AA 2IA6A 5J2MB 1NK8A 1IM6A 4X64J 1U1OA 1C1CA 2EFNA 3KG1A 3OFEA 2HBRB 2F4FA 2RKIA 3TVZA 4JI8J 1NH7A 1LV5A 3UCGA 3QMQA 2DHHA 2MKKA 1U09A 2YWKA 7FDRA 5AXNA 3PHEA 4U8VA 2JC0A 4IR9A 3ISZA 2OEJA 1D8YA 4LBIA 3ZXWA 5HLFB 2CRLA 3VWSA 4WTYA 3ZZZA 2NPIA 4DMZA 2H48B 4NYOA 2VDIA 2JLEA 3PRBA 1AFJA 1RI7A 5HVGA 1IJFB 1FDBA 1K47A 1UA1A 1XMOJ 5E5NA 4HLBA 3MM5B 5F8GA 1R6VA 3KG4A 1RTIA 1BY9A 2RD5C 2VZ9A 1GX5A 4YHHF 3OUYB 2POKA 1JWWA 2LA4A 4TU9A 4USWA 3J80Y 2HBZB 2DGOA 4NXNF 4PCQA 3VQTA 1Q7LB 5F0WA 3KWMA 4DV4F 5KFRA 2LA6A 4RNMA 3P4UB 4NLWA 3H20A 2ZWPA 3HCXA 2CUYA 1ZPVA 2GMJA 3E51A 3FBEA 2AWZA 1SL1A 3KK2B 4FF2A 1NDLA 2B8PA 1NJXA 2IMWP 1U0SA 4PG4A 4AL6A 2YQ1A 1LXJA 3E3XA 5KFFA 3M32B 5KT6A 1ZTWA 1LFWA 4DR7J 3UPFA 1DBDA 3I56S 1S10A 2C3UA 4ZCLA 2DY9A 1SJ4P 1JIHA 1S9EB 5K8NA 4LT6A 1RT7B 2CQIA 1ELOA 4X66F 5T41A 3P5TL 4DLEA 3AD9C 2FB0A 3FC9A 2YWFA 1WI8A 4UUXA 2KU7A 3KHGA 5ETMA 2UUCF 5A8KA 3RYLA 2H54B 3TJ8A 2HRYA 3HHNB 3MM7B 2W4PA 3FGVA 1RU1A 1Y9OA 1D1UA 3GFZA 3MR6A 3L7PA 3DM2B 2Z2YB 4OLPA 4HT7A 1HI1A 3MECA 2ASJA 2VG7B 2DRDA 2XY5A 4NL5A 4P75A 3UR3C 1GTHA 3H8YA 1I6JA 1SJFA 4I68A 2UUBF 4L6V3 4NYZA 3ZNUA 2FGOA 1RTDA 2XMVA 3OW2R 1C0TB 1TL1B 3Q2SC 2HHPA 2LQJA 3ELHA 5E7OB 4F36A 4KV8B 1WG4A 4CM2A 5KFYA 4BC9A 4H4OA 4U7UD 4ZITA 1QLNA 3N6NA 2PIIA 4B9NA 3LAMA 2MQLA 1WC0A 3OHAA 3RRGA 4I1TA 5U47A 4DN0A 2G2YA 1RT4A 1N8RT 1RWMB 3M2RB 1TKTB 1HBMA 1CULA 3GIJA 2YKQA 3MM9B 1QUPA 4K0KJ 2WK4A 3H90A 3JS9A 3VAHA 4J9RA 3T6BA 1MU2A 2YQ0A 1AB8A 4A8SA 4C8YA 3QRRA 1VQKS 3NMRA 4ZVRB 4J9SA 2FVQA 4WXOA 5HJXA 2OD6A 1KQKA 3M4XA 1XJWB 3VAJA 1X4CA 1NUEA 1GXTA 5KT7A 3JSRA 1HPZB 1UAWA 4OYMA 2CG4A 3DRXA 1UCNA 5DDQC 2CA9A 3WX8A 3LP1A 1RBLA 1SCJB 2XMTA 1NHKL 3CDEA 3AOCA 1FRHA 4DCJB 1IQZA 4DI6A 1N5QA 2HHQA 1R0AB 2GW8A 3CJ4A 4JI1F 3MFHA 4H54A 2HAIA 2DGXA 2EBEA 2VBYA 1YJVA 4Q0BB 3J81U 2VFTA 2B4VA 2APOA 2XTJP 1T9TA 3NGDA 2HWIA 2U2FA 4CIOA 1RAEB 3OSNA 3Q8QB 4KO0A 5SUHA 3TAMA 3EVWA 1RAFB 4ZVTB 1NXIA 3NS5A 4IG0B 2XY7A 2YWEA 1F9FA 8RUCA 4EYHB 1APSA 2OELA 3LP0B 3ZTPA 3H2VE 4ZS6A 2VG6A 3M8PB 2HQFA 2HFSA 1S49A 1HD1A 2KM8C 2E7VA 4B3SJ 4AL5A 1TKXA 1I94F 2BKPA 3WIUA 5E41A 5DQIA 4OX9F 4OX6A 3BYPA 2GS8A 4NX9A 1KLMB 2KVIA 2KVQE 4WBFA 3DI6A 4ES2A 3CD0A 5EUHA 1N5YA 5BYSA 4N8NA 5I42B 5D4OA 2W2OP 2ZNYA 3RAMA 3QZ7A 2NYIA 2W8KA 4GKKF 4PUOB 2LU2A 3CJSA 2R7SA 2JL9A 2CNKB 2CXEA 4ZP8A 1PBUA 2JJ4D 1HQUA 4ITSA 1JKHB 3BPSP 2V6AA 5H1SV 1FD2A 4ID5B 1KP6A 2QC3A 4RUCA 3MR3A 3FBBA 2OSQA 3I0SB 2HVHA 4FBTA 4LQ3A 1PGZA 1Q7YT 3VAFA 4GMKA 1H2TZ 1M5VC 2EFVA 3BDEA 2Q6BA 1BQMB 2IC3B 2V8HA 4ANCA 2VICA 1X4BA 3R7BB 1WEXA 5DG9A 3J81Y 4DLGA 2YNGB 4F26A 2E44A 2GMHA 3K8WA 3OR2B 3PR4A 3U1MA 4WKRA 1Q95G 3H40A 3KLEA 1ZAXA 3OTBA 2MZ1A 2VBWA 4QQBA 4UUWA 1TK8A 4FF1A 1N36J 5DDRC 1N34F 3MMCA 3EVMA 2VKZG 2WSFC 3W1YC 3MAHA 3CCMS 3T19A 2AJ1A 1T03A 1AUDA 8ATCB 5E33A 2CZVC 2MHEA 2AGOA 5D77A 4DR1J 2J9DA 3JAMU 2AEMA 3IBWA 3ZZRA 1RAOA 1P6TA 3TA1A 2IM0A 4HT5A 1N52B 4NLXA 3SQOP 3TUJC 5I3QA 3GV8B 4DV2F 3N6LA 2EG1A 4A8FA 3CDWA 1BHNA 1S1WA 3VAIA 3POTA 3CNQP 2MZTA 4QYZK 1Q5YA 4QIVA 2I6WA 2CQGA 3N5BA 4DSEA 2YNFA 5IWAF 4WJBA 2K8GA 3HVAA 1P8GA 4FP9A 3CJKA 3FQKA 3HD2A 3LP2B 4K4UA 4HKQA 2UU9F 1YJNS 1CJKB 3PCOB 3G96A 2J8SA 3BGOP 5D0EA 4X4VA 1RBAA 3V6DB 1B0PA 5G4DA 2HRTA 1WHVA 2MMYA 4G65A 1HNZF 3CEDA 3DMJA 1M5OC 4MYUA 1WHYA 1I5OB 4R0JA 3HHKA 2U1AA 5FD1A 2HZCA 2DNLA 4BC7A 4V19X 1WC5A 2UVRA 3SIPB 2WONB 1UZDA 2OIHA 3G8SA 4USJC 1UVIA 4DL7A 2NZ4A 4NZ0A 5KG0A 1T3NA 3M2VA 1BGXT 1TVRA 1Y3KA 3N0VA 4PPDA 2UXCJ 2W9BA 1RT6B 2QMXA 4P52A 1KWMA 4DFJA 2E7WA 1TUVA 1V5VA 4EI2A 1MWZA 1Y10A 4QR1A 1TV6A 3SV4A 3JAMY 4OQJA 1O6XA 4ECUA 4CNYA 3NP5A 2JVRA 2BJ8A 3CXCR 2W7PA 1ZM9A 3SV3A 3C46A 3PJXA 1RYSA 3L9ZA 2IPOB 1HR0J 4WZMA 1LNQA 1RJJA 4OLOA 4ZJLA 2VJVA 1SUQB 3O1LA 2E5IA 1WORA 2XO7A 4HL9A 2CQCA 3N28A 3W64A 4F2SA 2ZBRA 3TX0A 3D0GE 4XDDA 1WOSA 2DHAA 1YG0A 2ZH1A 2OMOA 4AD6A 4WP3A 2BJ1A 1I1GA 4RKUC 2DH9A 5ETPA 1X5TA 1KVJA 3NCRA 3UE2A 4HI2A 4PG8A 1ZA2B 3W8GA 3VZIA 1O0PA 1REVA 2CZ9A 1R43A 4ZVOB 3HHLD 1UETA 4Z7CA 1RT2A 5H9FJ 3R7SB 4R8UA 3CDBA 2HFZA 3UVJB 3OQ2A 4KB7A 5A8WB 4U7UK 5E3PA 4DV5J 2BQUA 4JI3F 1HBUB 4QWDA 3MPUB 2BJDA 2VDHA 3BBFA 4TVAB 3D6MB 2HQDA 1AT1B 3TAPA 1VRUA 2J8AA 4NCGA 1SB6A 1EB0A 1E6VA 3BSNA 3CMQA 1YSJA 2B6AA 4DQQA 5CH7B 3A1YG 2W2QP 3ZTRA 5K5MA 5CZXA 1ICEB 2QX0A 4HACA 4B3MF 2XZWA 2QLXA 4AE5A 1XN9A 1IKYB 3CJ3A 3D7SB 1RT5A 2QL9B 4RWWA 2BQRA 4I7FA 4FS1A 3QIPA 2CWXA 3GFYA 5T14A 3KG0A 3SQGB 2I5JA 1L3SA 4MJKA 4CO0A 3ETMA 2RIJA 2M52A 3T1AA 5LL6d 2MKSA 2XMUA 4DPWA 2VC0A 3BKFA 4BHQA 3QO9A 2UUTA 5E0OA 4M5HA 4EBCA 4FVMA 2WOMB 4B3TJ 4DF8A 1WDDA 3HULA 1OQ3A 4J9MA 2PC6A 4HH1A 5A76A 4B17A 5HO4A 4UTGA 1RLCL 2CPFA 1N5SA 2ROEA 2DYAA 1R8HA 4XPCA 2VL1A 3KK3B 2FLPA 3MMAA 1C0UB 4I4BA 1XTZA 2KHCA 5DZ6A 3HX9A 3EGNA 3LWMA 3GSDA 2WCXA 3BPDA 1CS4B 2E1RA 2IRUA 2DJWA 4GO5X 2HVDA 3Q8RB 5C7PA 2DGUA 4L75A 2CQ1A 4NWBA 4AQYJ 4Q5VA 2W2PP 2DNZA 4DEZA 3KLHA 5MLCV 3N5FA 2ZH8A 1DHMA 2E1MC 1N48A 2DXDA 1YRTA 2D3ZA 1K1QA 1RLDA 2HWHA 4O3PA 4WP9A 5EN1A 3FSYA 3ILJA 4ELTA 2BE2A 4FZVA 2DNHA 1NHVA 3SEOA 3QYYA 4ALZA 1JNRB 2E29A 2O1PA 2C22A 1Q79A 2C2RA 2EPIA 3VQSA 1UEKA 2ABYA 2IM2A 2BKOA 1WEYA 4ZLNA 1N0UA 3J7A1 2V69A 2A2CA 1R8CA 1MN7A 4DR7F 2ZH4A 2E7XA 3OXFA 3CD5A 2LP4A 2B7BB 3HMJG 2ZNZA 2HHUA 5KFHA 4UZCA 2FZCB 3B54A 2ADCA 2AHOB 4IR1A 1OYDA 4AUKA 4N8OA 2ZH2A 2W7OA 3KLIA 1NH8A 1PC4A 5HVFA 1HWUA 2Y3YA 1QE1A 2HW3A 4I2PA 3EPGA 4HR2A 2K7JA 2MZQA 3DXSX 3RBXA 2NZCA 5DO2A 5GAGU 2RS2A 2IBOA 2HMIA 1F9HA 3HSGA 4DFKA 1S6OA 2V5HG 1N56A 2NSCA 1QAYA 4FVCA 4LFAJ 2HGLA 1SIWB 1IKVB 4FBUA 5DDPC 1M0SA 4RW7B 3LWLA 4HVZA 2F1FA 1WSVA 4ED0A 2QYGA 1N0VC 2D7SA 2BYCA 2LXIA 1U4BA 2MQ8A 2E9TA 4FN5A 2RQCA 4QR0A 3HXMA 2IM3A 1B64A 2K3KA 4C3LA 3IGNA 4RJVA 4ZPDA 2DH8A 2HQIA 1JLBA 2XI2A 4KKOA 2D9OA 4NLOA 2V8DA 1JLQA 2O66A 1DTTA 3OL9A 1R89A 2YKNB 4PZVA 3CWJA 3OTOJ 1RUSA 4K0KF 4UOGA 3GLJA 1NKCA 1BE4A 4K4YA 5EWEA 5KFOA 2FZGB 2Y1JA
chains in the Genus database with same CATH topology
2YNHB 3M8SA 1ZM2A 2PI4A 5I3UB 1REVB 4DS4A 2JRSA 4H4MB 4XAKA 1VI7A 1LW2A 2D41A 1U1QA 3MEEA 4ED1A 1V3RA 1FRKA 3FCHA 4YEAA 1RT2B 1WWHA 2A10A 2MHNA 3BREA 4R8UB 2BR0A 1NB7A 1U6BA 3F41A 2J7KA 4URSA 4G6VB 3G71S 4WXWA 4FF3A 1VQ6S 2XWYA 3C3LA 1S9GA 2VKRA 1MU2B 2HNYB 2AX0A 4OZNA 4WE1B 3LPYA 5LT5A 4CNZA 2Z2MA 5M2RA 1K0TA 1P27B 3OVSA 1NJWA 2VD3A 3IRXA 4I0WA 4NXMF 1KSPA 2QIFA 3CB4A 5KFSA 4ED5A 4IQXA 2I0XA 3T5JA 3FFIA 1FCAA 2IJFA 2FJVA 1Y5NB 3K5LA 3RB3A 2I8EA 1FJCA 5M2UA 1VRUB 5B0DA 4N47A 4NCGB 4DFMA 3B4DA 3PO5A 2BANA 3FSIA 4GO7X 3LGNA 4DQSA 1E6VB 5GADU 4LSLA 1ULRA 2B6AB 5HMXA 1HYSB 2G1DA 3DOKB 4XIUA 2AP6A 4IH7A 2ZE2A 2Y1RI 3K5OA 3I32A 3OFGA 5A8RA 4A8OA 1HMVA 2OPRB 3DRSA 2WBRA 3PFEA 4DL4A 4CT8A 2KN4A 5HLFA 1T95A 3PX4A 1X9MA 3LP1B 3T5KA 2DNRA 2NXUA 4IOCQ 2DNNA 5KG1A 4M63A 1RT5B 2FC9A 1ROFA 5KFNA 4TQRA 2DNPA 3OFFA 1WEZA 4J9PA 4I7FB 2MKJA 3R5DA 1U24A 2JX2A 4I56A 3MM6B 3CF5Q 3QIPB 1MWYA 5KFTA 3V6HA 2JHEA 2G4BA 1OPIA 4PWUA 4OFZA 3S7RA 2ZC3A 2PFFB 3NS6A 2XGPA 4IRDA 2WW8A 4ECSA 2RRNA 4D3HA 3R5AA 3HK2A 1YQHA 1S99A 5LJ3Y 1S1XB 1VLYA 3UQSA 2O01C 1O5JA 4ZOSA 2PDAA 3OHBA 1B7FA 2NR0A 3D0HE 3P3DA 5KFMA 3B82A 5KFBA 1YBAA 4F50A 1RWUA 3MM5A 3E2EA 4G1IA 1SQEA 2HLTA 2XHWA 3NCPA 4Y2MA 3CO9A 4DV7F 2FJEB 1B0VA 1Q4RA 1LK5A 3Q0AA 5HROB 3M1VB 3CJ2A 3ISND 2M5YA 1S1UA 2ASYA 3OUYA 1HD0A 2JDJA 5L9NA 2VFUA 3QO9B 1HQEA 3PXGa 2LXUA 2D1CA 1YJTA 5C5JA 3G6ES 2YKPA 2JC1A 4QWEA 3HP6A 4ZPBA 5LXRA 2M2BA 1IJEB 1U45A 3F56A 4UQTA 2CKWA 2R8HA 1LK7A 1CLFA 1Z1ZA 1AROP 1EETB 1KFDA 2EKYA 1QJHA 3LW5C 4FXVA 5KFZA 2HHWA 4KFBB 4G1PA 2V4JB 4A8XA 4PRFA 1N6QB 4LF4F 4B3RF 3PW4A 2BDPA 5K14A 2PMHA 4P7TA 4RW8B 3V2UC 4ZP7A 1HBNB 4NRUA 2VFVA 1CEZA 4KO0B 2L9WA 5D4PA 3L7OA 3SFUA 4IFVA 2QFJA 2ZM6F 4IDKB 1SH3A 4ED2A 1WHWA 4J9LA 1U1KA 5HMYA 1RT3B 3KK1B 3CCRS 3ISNC 4CH7A 1JJ4A 2FJBB 3UI3A 1FKOB 3U27A 4RX6A 1G1XA 2OMLA 4CH0S