2O3DA

Structure of human sf2/asf rna recognition motif 2 (rrm2)
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
113
structure length
113
Chain Sequence
MAPRGRYGPPSRRSENRVVVSGLPPSGSWQDLKDHMREAGDVCYADVYRDGTGVVEFVRKEDMTYAVRKLDNTKFRSHEGETAYIRVKVDGPRSPSYGRSRSRSRSRSRSLEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Splicing factor, arginine/serine-rich 1
publication title Structural and functional analysis of RNA and TAP binding to SF2/ASF.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 11
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 2006-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2o3dA01
2M0GB 2DNLA 2ADCA 2DISA 1CVJA 2DHSA 2KG1A 5HO4A 2OTJS 3VAJA 2CQ2A 2MQNA 2D9PA 3VAHA 1SJ3P 2YKAA 1VQ9S 2V94A 3CUNA 2F9DA 3LPYA 1OPIA 2FHOB 1PO6A 2AYMA 2YH0A 1JJHA 3NNHA 2LYVA 3OW2R 2RRBA 3SXLA 3UCZP 2PEHA 3PIPQ 2RS8A 1VQOS 1Q86T 1UFWA 3G96A 1WHYA 1FJCA 2MPUA 2CJKA 2N82B 3BO3A 2CPXA 2RQ4A 2MKKA 1R8HA 4C4WA 2ZJPQ 1SJQA 3CCUS 4IOAQ 1U6FA 1HA1A 4IO9Q 2KVIA 1X5PA 1KD1T 2CQBA 2DHAA 3TO8A 2EK6A 1IQTA 3S8SA 1NJIT 4RU2A 4M5DB 2LEBA 2CQPA 3BO4A 2DIUA 1XN9A 2RT3A 3CCQS 2VONA 1VQLS 2MSSA 1VQMS 2RVJA 1S72S 2CPFA 5GMKa 5CXTA 1M1KT 3CCRS 1VC5A 2M8HA 2JVOA 1NO8A 3CCSS 3R1HA 3THPA 2KXHA 3ZZZA 1YHQS 4W90B 2A3JA 2CQ1A 1SJFA 1WF1A 2F3JA 1Q82T 5BJRA 3R1LA 3B4MA 3L3CA 3CPWR 2UP1A 3R27A 1VBYA 4CH1A 2CQDA 5LXYA 2ZJQQ 3VAFA 3EX7B 1U1PA 2ZJRQ 2KRRA 1OWXA 2XSFA 2MQQA 2DGWA 2E5IA 1VQKS 1Q81T 2HYIB 4LIRA 5MLCV 3MDFA 3VAKA 1YJWS 5DM6Q 2XB2D 2MY7A 1N52B 4ERDA 1P27B 3CC4S 1WEZA 5IM0B 2MKHA 2YTCA 1QVGR 2OSQA 2MZSA 2OJ3A 4TU7A 1U1QA 1FHTA 2CQGA 1ZH5A 2KI2A 4QQBA 1FNXH 1VQ4S 2KHCA 2MQOA 3NNCA 3V4MA 2O3DA 3G4SS 1WHWA 4F26A 5GADU 2DHXA 1X0FA 2CQ4A 1VQNS 4WCEQ 4CH0S 3CMAS 1U1OA 4WFBQ 3VAMA 1YJNS 3P3DA 3CCMS 2LKZA 3I56S 3CCLS 1H2UX 1OO0B 2L41A 3P6YC 1NU4A 4QU6A 2JWNA 3EGNA 1M5KC 2DNRA 1RKJA 2MYFA 2YWKA 3G6ES 2DGTA 2CPEA 1VQ5S 1N88A 1UW4A 5GVQA 2LQ5A 4ED5A 4PKDB 2QFJA 2MKIA 2DK2A 2MHNA 2XNQA 1WTBA 3D2WA 1M5OC 2CQIA 2DIVA 2MZQA 2EVZA 1K9MT 3MD1A 4Y00A 1B7FA 4U67Q 1U1RA 1VQ6S 1HD1A 2D9OA 3MOJB 2DO0A 1G2EA 3U1LA 2MXYA 2AD9A 2DGSA 2KT5A 1JMTA 2NZ4A 1YIJS 2MZ1A 2X1FA 2QEXS 2BZ2A 2OTLS 1WI6A 2MKJA 4PR6A 3G8TA 3H2UB 4WFAQ 2RU3A 3TP2A 4YUDA 1FJ7A 2KG0A 3MURP 4F25A 2AYBA 5DETA 2DH7A 3B4DA 3MUVP 1VQPS 1U1MA 2L08A 1Q7YT 5D78A 2XS2A 1A7GE 1X4DA 1X4AA 4FXWA 2J8AA 2WBRA 3FEXB 1FJEB 2J0QD 1VBZA 2VOOA 2VODA 5DDQC 1ZZFA 4YB1P 2DHGA 1X4GA 3G8SA 2ADBA 2LCWA 5JVGQ 3IRWP 4PRFA 4BS2A 2KYXA 2HGNA 2DGXA 1SJ4P 2CPYA 2B0GA 2AYGA 1WWHA 4Y0FA 3TYTA 2LXIA 2DGVA 1KOOA 3SMZA 2X1BA 1X4FA 2M70A 3MUMP 2DNKA 2L9WA 4ZKAA 4OZ1A 2MZJA 3UD3P 3DXBA 1M5PC 3J7ZT 3CC2S 1P1TA 2KH9A 2I38A 1U1LA 3CC7S 2KU7A 4QPTA 1WELA 2GO9A 2U2FA 4EGLA 1DZ5A 4W92B 5JVHQ 2K8GA 5IQQA 1YJ9S 2OSRA 1WF2A 2JVRA 4J5OA 2FC9A 2XNRA 2KXFA 1FXLA 2MJNA 3CXCR 2I2YA 3G9CA 3S6EA 2LEAA 2DNYA 2DGQA 1O0PA 2RUGA 3Q2TC 1HL6A 1WI8A 3LQVA 3CMES 2DO4A 3P49B 2N3OA 1X4CA 1X5TA 3J7YU 4P6QA 4YOEA 1DRZA 2MGZA 2AYEA 4IUFA 2M8DB 1X5OA 2DH9A 1YTYA 2OIHA 2J76E 4WKRA 3CCJS 2DNOA 1R8PA 5DM7Q 2U1AA 2E5JA 3FEYB 1WEXA 3NNAA 1S79A 5GAGU 5DDOC 3UE2A 5GAHU 2M2BA 1U1KA 2MQMA 3EGZA 2M88A 4TLQA 1WG5A 4WIIA 3VF0B 2LECA 1AUDA 4V19X 2KN4A 2MZRA 2BOPA 5HL7Q 2JRSA 1N8RT 1SXLA 5ITHA 4CIOA 1KC8T 1VBXA 1URNA 3S01A 2MKSA 1DHMA 3UCGA 2CQHA 4FXVA 3UD4P 2DNZA 1RK8A 3NMRA 2DH8A 4LJMA 2HGLA 2DNNA 3NS5A 3SDEA 3P5TL 1X4HA 3NS6A 2F9JA 3MD3A 1K8AT 2X1AA 1K73T 3U1MA 2XS7A 2X1GA 3CF5Q 3JB9k 1M5VC 3UCUP 1YI2S 1WG4A 1WHXA 1OIAA 5H1SV 2M52A 1F9FA 3H2VE 2MQPA 2DNMA 2GHPA 3THTA 1FO1A 1A9NB 2KM8C 5LSOA 2CQ0A 2M7SA 3CULA 5DDRC 2CPJA 1L3KA 2JX2A 5LSLA 5LXRA 5CA5A 4QU7A 2HGMA 1H2VZ 1UP1A 2MB0B 2CPHA 1YITS 2XS5A 2M4MA 4TU8A 1VC6A 1KOHA 3RW7A 3RW6A 2MQLA 4F02A 3VAGA 1JJ4A 2LMIA 1X4EA 2G0CA 5LJ3Y 2ERRA 2PE8A 1U1NA 3I55S 1HD0A 2RS2A 1WF0A 2KM8B 2Q79A 1BY9A 1U2FA 3ZZYA 4UY8T 2FPHX 2HZCA 1JJ2R 4C0OC 2MJUA 2MGZB 2MZTA 1VQ7S 4C7QA 3S7RA 2M9KA 3DLLQ 3HI9A 3VALA 2E5HA 2D3OR 2J0SD 3CTRA 3Q2SC 3G71S 2DNPA 2NLWA 2RQCA 1M90T 3VAIA 2E44A 2RRAA 1DBDA 1U6BA 2MMYA 1PGZA 2G4BA 1KQSR 2FY1A 4OZ0A 1WHVA 2MSTA 4LMZA 2MY8A 1W2BR 3US5A 4WFNQ 2E5GA 2CQCA 2KXNB 3CCES 4IOCQ 1WG1A 2YH1A 1H2TZ 3UWTA 3MUTP 2EK1A 1ZZNA 1WEYA 5CYJA 2DITA 4CQ1A 1UAWA 3HHNB 2K3KA 4WF9Q 1H6KX 2LA4A 1X4BA 2SXLA 1VC0A 2DNGA 1QVFR 2FC8A 1VQ8S 3BEGB 3MI7X 2DNHA 3SDEB 2LXUA 5D77A 3K0JA 3CD6S 4TU9A 3CCVS 1YWXA 1D8ZA 2G1DA 2N7CA 2MKCA 5EN1A 3IWNC 3MXHP 1FT8A 2CPZA 2CQ3A 5GAEU 3N9UC 4A8XA 2KRBA 2N3LA 1X5SA 1D9AA 5IM0A 5LJ5Y 1QM9A 3ULHA 2CPIA 5IFMA 5DDPC 3BO2A 1N54B 1SJRA 4Z2XA 3BS9A 2VOPA 4UQTA 2LA6A 2DNQA 2HVZA 2DGOA 3PIOQ 5FJ4A 2DB1A 2KFYA 2QA4S 2CPDA 2RNEA 2DGUA
chains in the Genus database with same CATH superfamily
1VRUA 1AW0A 3KJVA 3HSDA 4F3QA 3DOMA 4P2XA 4HI2A 2YX1A 5C25A 3JS9A 1YJVA 2B9XA 4R8UA 3V4IA 3IAM9 4ZVTB 4ZN1A 2FUG9 2IAJB 1SIZA 1DJ0A 4OHXA 3F73A 1HA1A 4CI0B 2OPPA 2DHAA 3CCQS 1VQMS 2YNHB 5KFZA 1RTIB 1RHMB 3CCRS 4P10A 1XQIA 4CM0A 2JVOA 3R1HA 3BKTA 2YNFB 1OJ4A 1JNRB 4F4KA 4USHA 1WKLA 2K1RA 2WW8A 4DJBA 2QYGA 3R27A 2CQDA 4OYAA 2ZJQQ 3HFKA 5HQMA 2XSFA 1QDUB 1GTHA 1IBKJ 3SQOP 4OI3A 1QVGR 3ZZTA 2XZWA 3CNQP 2NR0A 1VQ4S 3BSOA 1NDKA 3V4MA 4LBIA 2O3DA 3VZIA 1TUWA 2CQ4A 2W9BA 4Q8FA 2KJWA 3OHAA 1S1XA 4ICLB 3P6YC 1YBAA 3OFGA 4JI2F 4KV8B 3VVUA 4ZCKA 4YP3A 3DYAB 4JI4F 1K1QA 1RU1A 1S57A 1REVA 1T94A 4K4TA 2WK4A 5KFTA 1RHUB 3JYTA 4JV2A 2WRMA 4I7FB 3UI3A 1VQ6S 2D9OA 4F67A 3OFHA 2NZ4A 2OTLS 1F3FA 1TAUA 3NLCA 1M1HA 1F2HA 4GKJF 1AZSA 4DCJB 4YHHJ 1IKWB 3TVZA 1X4DA 3DRSA 4NLUA 5L9XA 2W2OP 1W2IA 2BV3A 1RWXB 1YLXA 4JOUA 4HHHA 4JI3F 4JI7F 1FESA 1HNIB 2PMWA 4OYPA 1KOOA 3DRRA 4ZPWR 4HACB 4URGA 3DXSX 3ITHA 3IGNA 2OPRB 3UDVA 3W66A 5EUHA 2GAHC 4JYAJ 1WF2A 3OL6A 2FC9A 4OZLA 1GXUA 3TVYA 3O8WA 1GH8A 1SH0A 3SEOA 1M5HA 4OI4A 1RT3A 4DV3F 3D3CJ 4DV5F 4DV1F 2HHHF 1LWXA 2W7PA 1TU0B 4P6QA 1RT6A 1FDBA 4JV0A 1LW2A 1UA1A 1TKXA 1Y5LB 2Y8WA 1R8PA 3BBBA 4NLDA 4FBUA 3CW2C 3TW0A 2V9KA 3DLGB 1S12A 4DL2A 5KT2A 1QUPA 5GAHU 1WC4A 2DHHA 2EFGA 3ILJA 4TLQA 3PVXA 8ATCB 3PW4A 4TNOA 5G0RB 3CJ8A 3MWBA 1HHSA 2C42A 2DNZA 1RK8A 4ETZA 2GX8A 1S1UB 3FSXA 3LOUA 4QIWD 3FKBA 2LEPA 2VBXA 1H72C 1Y4ZB 3TA0A 4F3MA 4DPXA 1GTEA 2BUNA 4H4OA 2VG7B 2XMUA 2CQ0A 4TLRA 4EK2A 1FJGF 2CPHA 1S6QA 3HJFA 1Y5NB 3RW7A 4DG1B 3I32A 2XMKA 4GO7X 4OHYA 3GYXB 5F9NA 2HLTA 1HNVB 3T6JA 5KFGA 4EUVA 3QFHA 1RWWB 1JLBB 1TZ0A 3EDRB 3CTRA 4NXNF 4DX6A 1DBDA 2NYHA 2BMBA 1UMJA 2GGPA 4DPYA 4O3OA 1JLEA 2VDHA 5K8NA 4WPAA 3I9ZA 1JLGA 1UKUA 2VB6A 1QVFR 2BQ3A 3E8OA 5D77A 2RDDA 2COLA 1P1LA 4U7UK 1NZ8A 3QSYB 1FT8A 2ZVSA 4CT8A 1NK8A 2HQGA 1Y9OA 4K2XA 1B64A 2JL9A 3QNWB 2W1BA 1WKKA 3QMQA 4IH7A 2GCFA 4S0MA 4USJC 1N54B 1WJ9A 2GFFA 3PIOQ 3FK4A 2KFYA 4KGXB 4NA2A 2AIRB 2YWFA 1T05A 1LXNA 1NDLA 4X4OA 2YH0A 3NNHA 3UCZP 4P52A 1G3OA 1S4FA 1WHYA 3EVWA 1ZTTA 3BO3A 1FEEA 4E2FB 4WFXA 3GIKA 3M2UA 1SJQA 2CADA 4DPOA 1R0CB 5EDWA 4GKKF 1NK4A 4ETXA 4ZJOA 1XNRF 3MPWA 4OJGA 2B4VA 4X64J 4OZ2A 3QIPB 1ZM2A 3N6LA 3TARA 2WOMA 1D9DA 1WF1A 3OL9A 1PKUA 2F3JA 3KXDA 3TUZC 1F5CA 1YQHA 2AMCB 1PYSB 4PXEA 3OUYB 4N8NA 5DM6Q 3PFOA 2CG8A 2Y1RI 2DXFA 3ZZOA 2W01A 3NGSA 5CZVA 3FDSA 2BANA 3IR7B 2UUTA 3JQMA 3MMCB 1Q95G 4CLPA 4I2QA 1YZ6A 2H5JB 2V8PA 3D4JA 4NCGA 4DQIA 3R5AA 3Q8SB 2GC8A 3HK2A 3TI0A 1X0PA 1UJ4A 4K4WA 4E8UA 2VU5A 2I6WA 3Q8PB 3PRVA 2RU3A 2BDPA 1KNZA 2OD6A 2R2UA 3B4DA 3MUVP 2DR9A 5A6PA 1TL1A 5LOQA 4NL5A 3T1HF 3LA0A 3PO5A 3J80Y 3PTWA 4EMDA 3HX9A 3J81U 4DL0C 5JVGQ 2RKIB 3CWJA 3DLEB 2B0GA 2NXUA 2M5YA 3MPUB 5LL6d 4KH1B 3WX8A 2EFOA 2WHOA 3GPAA 3MOZA 3C6UA 3K57A 2L9WA 4ZKAA 3A3NB 2HQ3A 5D4OA 3BSAA 1S9GA 2I38A 2A10A 1VIOA 3KWMA 1LOUA 2I8EA 3QYYA 4YY3F 1TL4A 1CLFA 4M5NA 3PW2A 3QRPA 1AFJA 2LEAA 1WSRA 4RW4B 1DFDA 1RACB 2XZTB 3EYZA 4QWEA 1KQGB 1S7HA 1VIXA 3P49B 4O0IA 2N7YA 3E3XA 4IUFA 2M8DB 4IH6A 2DH9A 2OIHA 2ZH3A 5T14A 1IJEB 3O6QA 2KL8A 4CNZA 1XWLA 2LQBA 2BOPA 3NGTA 4G1PA 2R7XA 3H0PA 1U2RA 4WYWA 5ETRA 2FVRA 3R5BA 1FXDA 1EB0A 3CD7A 2G2OA 2F9JA 1GK8A 1K73T 4UT4A 1FNOA 1WDTA 1H38A 4AD6A 4OHVA 2YWEA 4ZLLA 1A9NB 1V5IB 4KPYA 1SI9A 3KG1A 3KK3A 1N32J 1TMMA 5CA5A 4TQSA 3HSGA 4ZITA 1U26A 4TU8A 1UPPA 4DV0J 5HLFA 2V69A 4ECTA 2VC0A 4YMEA 4RNMA 3TAPA 3GJTB 4UY8T 3GG0A 1UVLA 1JJ2R 4G1QA 3POTB 2GMLA 3D67A 3S7RA 1TKZB 2ILZA 3GJRB 2D3OR 2J0SD 4I69A 5B0AA 1M1GA 5B09A 5E3QA 1FX4A 2G9OA 1WHVA 4Y2IA 1PCAA 3J7YI 3QGGA 4JI0F 3MTJA 2YH1A 1S1WB 4F4YA 2IMWP 5KT4A 5KAKA 2VJVA 4UY85 1EQMA 3C19A 4YR0A 2WVDA 3O3LA 1ZAXA 2UXCJ 1S76D 2DEIA 1KEKA 5GAEU 3N9UC 3C16B 2HFUA 5KFHA 2KRBA 3NCPA 2CJXB 3MAAA 1X5SA 3T5HA 2AF6A 3EXCX 3H5YA 2F63A 3FVYA 1L5UA 5CD4A 3MMAA 4DEZA 3MEEA 4UQTA 3VR1A 2ZH9A 1Q1KA 2HHVA 4U9RA 1CVJA 1T3NA 4YEAA 2IRUA 2YKAA 3MEGB 5AE2A 4TYAA 3IRXB 3NMAA 1UCNA 1KFSA 5DS7A 1HLWA 3KUGA 1UFWA 1N34J 2MKKA 2HHWA 2V63A 5FDLA 3NG8A 3TO8A 2HBYB 4RU2A 3TQEA 4N5SA 4DV6J 2C3OA 1PJ6A 4ZLPA 4L74A 2YX7A 5FIIA 1U09A 3PYGA 3IWXA 2FVPA 5KFYA 4B3OB 3JXOA 3RTVA 4IYQA 2UP1A 4CH1A 4P9SA 3JTPA 4J9OA 4I1TA 1YJWS 2XB2D 5JMNA 3F41A 3I4PA 4A47A 1HNZF 2UUAF 1FVSA 6FD1A 2QC3A 1U1QA 4JV5F 1EHWA 2KHCA 3J81j 1LK7A 4PCQA 2MQOA 3CVKA 2KB2A 3BH7B 4K4VA 3RZAA 2PI5A 3D6TB 3AXKA 4F0HA 1NJYA 3MM5B 1OO0B 2L41A 2MLYA 2JWNA 3EGNA 3KJFB 3CJ0A 5KFPA 4PKDB 1WTBA 3ENAA 3DMJA 2J0WA 1WOPA 2BR0A 1XMQJ 4OMFG 2R2RA 6FDRA 3GV5B 2BKOA 3BJYA 4PR6A 2J7KA 4NRUA 2BJ9A 2KG0A 4OZ3A 3RGIA 1RJJA 3C6TA 1HNWJ 3DDIA 4UUWA 1G4CA 5HMYA 1V5VA 4WE1B 1C2PA 2NXNA 3BF4A 3AOCA 4TY8A 2M3DA 1S1TA 2UXBJ 3PKYA 4RBVA 1N0VC 1N33J 1FTRA 3R5CA 2GMJA 2YNIB 3MAHA 3CC7S 5J2QA 2WONA 1K0TA 3D6HB 2OSRA 4KHPJ 2JVRA 3OVBA 3B6BA 3D0IE 1UVNA 4RUBA 2EKNA 3N6NA 1JLCB 3W2VB 4F0MA 1Q8BA 3K5MA 2VQEJ 4L3KA 3RBEA 4USVA 4U7UD 1DLOB 1IKXA 1Q5VA 2VJUA 1P6TA 5HATA 3BREA 3BGLA 3MM9B 2BW7A 4C0BA 1VJQA 4WIIA 2HBQB 3JAMY 2RMLA 1RTDB 1KONA 4H4MB 5ITHA 2E9ZA 2HURA 1RBOB 5LMUF 2AWZA 4JI5J 2GIRA 1R0BG 4JUZA 1TAQA 3FFIA 3H5SA 3ZTOA 1PSDA 2DNNA 5DZ6A 1X4HA 5T41A 4NRTA 3QRQA 2KYZA 5KFLA 1T02A 2CXEA 1HBMB 4QOTA 5ETOA 3KLVA 3RBZA 1H74A 2KZZA 4CCHA 3R5GA 2APOA 4DWIA 1FWLA 5LSLA 1L3UA 2W4PA 4KGVB 4IRKA 1MU2A 3W1YC 2P2CB 2MQLA 4F02A 3VAGA 4CLSA 1U1NA 3CE8A 2Q79A 2KZMA 3CT9A 1NSKL 2V4QA 1UJ5A 4FDFA 1VQ7S 5KT3A 4ECUA 2JSXA 4NLGA 2QMXA 2E5HA 1LW0B 2RQCA 2AKWB 1M90T 2MLXA 1RWPB 1KQSR 2VH7A 1HBUA 1MN7A 2PMZD 3US5A 2KXNB 5HJXA 1NM2A 4DQRA 4ZCLA 1WEYA 4YB5A 5KG0A 2HIYA 2QL9B 2K3KA 2LA4A 4Q8EA 3W3SA 5KFCA 3QAEA 4AQYF 2DRDA 2DNHA 4RW6B 1KP6A 3GLJA 2CQ3A 4C3LA 4USIA 1O5JA 2VD3A 3BDEA 5CQGA 1QM9A 1T0TV 2DR7A 1Y3KA 5DDPC 4EZ6A 5D0EA 2J8SA 4USUA 3JSMB 4KR0B 2HWIA 4U96A 1OPZA 2O66A 2DISA 1S1VB 2KG1A 5C42A 1T9VA 3I96A 3SV3A 1R31A 2R4FA 2XMMA 5I42A 4ID5A 2LDYA 2D74B 2CPXA 1IKYB 1RT1A 2ZE2B 2G13A 2FZGB 3HLUA 1TL3A 3HPOA 2KT3A 1VJWA 4P2MA 3LW5C 2VONA 2RRNA 1Q8KA 3AODA 1YSJA 3M9MB 5EX3A 5KFRA 2WB4A 1O6XA 2M8HA 5AE1A 3THPA 2EG2A 3GWCA 1TL7A 3DI6B 5LM7E 1HNXJ 1HBNA 1KBRA 1S9EB 4MFBA 3CPWR 1F0XA 1XMOJ 5LXYA 2ZOFA 2MQQA 3LGHA 1NPKA 5A2QY 4ERDA 1LWFB 2AJ0A 4X62J 1SH3A 4NLPA 3DFEA 4CO4A 3BKUA 3I9V9 4PWWA 3HM9A 2XMVA 2JNJA 2YWGA 4WCEQ 2W2NP 3CMAS 4FS1A 1IR1A 1B3TA 1YJNS 3K5OA 2R7VA 1GMVA 1VMBA 3N0VA 3T5LA 4DHVA 3EXYA 2G2YA 1C1CA 2BRKA 4L3NA 2FHMA 4Y3CA 1R0AA 1RYSA 2DIVA 2MZQA 5KFDA 4UOGA 3IG1B 2OPPB 2VA2A 2IBKA 1RWMB 3T9ZA 3OHBA 2EC0A 3MCSA 5MAOA 2K7KA 2V4JA 4HTJA 4IOBA 5E3AA 4IDKA 2GVZB 4PXDA 2V2QA 2J8AA 2AJQA 1NB2A 2K1RB 3TAMB 2W8LA 1PAEX 1JLQA 3NOGA 4LFCF 3KMSA 4ECRA 5DGBA 2QN6B 2DGVA 3RRKA 4PUOA 1X4FA 4ENOA 2DKOB 3Q83A 2J7WA 1KR4A 4ZOSA 4LR8A 5K14A 2W9BB 3K2YA 5JVHQ 4B9UA 3IO1A 1GFWB 1GMWD 5IV3A 5LMNJ 3TEGA 1JNZB 4K2JA 3CXCR 4DUZJ 3S6EA 2ZHAA 1REVB 3CJ3A 2CG4A 3JYTB 2BYCA 4RUHA 1RT2A 3CMES 2B9YA 4KHMA 4A8OA 1WC3A 1I94J 2D69A 3E01A 1DQ9A 2HRUA 3Q24A 2WCXA 3J7AN 1JQGA 4F50A 4GKKJ 4ZP7A 1WKJA 5F0WA 1JLAB 4DR5F 3HO1A 3SQGA 1MNEA 1U1KA 2ATLA 2CYYA 4LF6J 1E6VA 4V19X 4B3RJ 3W63A 1UW9A 2ZH7A 4CIOA 2F8MA 3BZQA 3OR2A 3EWGA 3CD5A 2HAFA 1SQGA 5HROA 3IC1A 3SDEA 2BW2A 5DQGA 1KSPA 2AZ1A 4KB7A 2JLFA 3N01A 3P45B 4JB8B 1IBLF 1TV6A 4Z37A 3Q23A 4K0KJ 3ITHB 5HJYA 1U25A 3R3TA 2L9NA 2NXEA 3R5DA 3HHKA 2KM8C 2E1MC 1JWWA 4RU9A 1S5ZA 1OYDA 2V8DA 1H2VZ 2ZDOA 1JX4A 5K8MA 2QJ3A 1L3VA 3W8PA 2A6MA 1LK5A 1Y7PA 4OYIA 4DL4A 4EI2A 2HMIA 4LF9J 1VYAA 4C0OC 1RAEB 1RT6B 3W61A 1LW2B 3HI9A 4Q45A 3ZZUA 1TKXB 1XJWB 3G6VA 2DNPA 3MPVA 2VBZA 2CKWA 5L38A 3HJVA 1DARA 1SL2A 1N36F 4DX7A 3K5LA 3TUIC 2A18A 1G7CB 1WG1A 3BPDA 2ATCB 4MK9A 1T03B 3PRDA 1V3ZA 1C0TA 3I0SA 4KKOA 3H25A 4CLFA 3MXHP 2UV8G 4OI0A 1UVIA 2UV8A 2MEWA 2N3LA 1J5EF 1RA6A 2R7OA 3ZXWA 4WU2A 2VASA 3QFWA 3GFXA 4H4OB 3QGHA 1KLMB 5ETNA 2JEGA 2CPDA 1S6QB 3CO0P 3N5FA 4ZLNA 2OTJS 2MQNA 3MECA 4HT7A 4B3SJ 3X3UA 2E5LF 2FHOB 1IUJA 2RRBA 3MTKA 2YKQA 4U6PA 3DRXA 2RQ4A 4MKYA 5IWAJ 1B7YB 1RKIA 2KVIA 3CJQA 4WZMA 1ZBTA 2I5JA 2GGPB 4FKXA 4DV7F 1UA0A 1VK8A 1Q82T 4ZHRA 4DU8A 4ILLA 3R7SB 2EKYA 4RW7B 2JEFA 4FVMA 1NHUA 1EKSA 2W2PP 4O44B 2JC0A 4KJIA 2XO7A 3GYNA 1TFYA 3BQ1A 2UXDF 4TU7A 2KI2A 3PY8A 2Q6BA 2KT2A 1D8YA 3G4SS 1CBKA 4XIUA 3V81A 1VFJA 4ZA1A 4GVLA 4ZPCA 4URQU 3BSNA 4TXSA 4IFVA 1FDAA 4TY9A 2DNRA 4ZPVR 2JLEA 1FX2A 1SCJB 4DPTA 2LQ5A 3ICLA 4BHQA 3AQPA 2KJVA 1EP4A 4KGMA 5KFMA 1K9MT 3M2UB 1TELA 4DN9A 4KHRA 3E2EA 1VHIA 3B78A 1RHRB 4J37A 3T9NA 3AA9A 1RT5A 3EPIA 4ZK7M 3DLBA 3FRYA 4KPCA 1FJ7A 1UJ6A 3LAKA 3VQTA 2XMTA 3GIIA 2BJ7A 1U1MA 2YVSA 1RWKB 2E1AA 1EIYB 4ZPAA 4EBEA 3QT7A 3MMJA 3I87A 4ZCIA 4JI0J 2WBRA 1NKCA 1JXVA 2VODA 3DOKB 2DHGA 3RRGA 1S99A 4PG4A 4OX9F 1OYEA 4E0DA 3IBFB 1S4EA 4X4NA 5CYMA 4ALZA 1S0VA 4DR7F 3KG0A 3HVWA 1SPBP 3KUEA 3FCWA 4HR2A 2FVSA 4H54A 1V6HA 2W2MP 4ECXA 3JSYA 3IS9B 4O0NA 4RW8A 2C2KB 5B08A 4DUYJ 2KU7A 3KLIA 1DZ5A 4YR3A 5D0GA 1ELOA 2WB1D 3UR3C 2QA4G 2E29A 2AV5A 3CJ5A 3RR7A 1SBRA 4ANDA 2VKRA 2H65B 5L1JA 4QW9A 2W9CB 2VDIA 4B9TA 3J7YU 3KLEA 4OJ3A 4YOEA 5HVHA 3OR1A 2DT9A 2B4PA 3BM7A 3ENWA 3HULA 3AOAA 1ZETA 1TMJA 3BGRB 3FEYB 1WEXA 2B4UA 1TL1B 3AH6A 2FIUA 3EGWB 1PYTA 3EGZA 1AUDA 4FF2A 3HVTA 3M6XA 4QIGA 3T19A 4DR2J 4AL7A 4B3TJ 3NMRA 5KTQA 2KFNA 2ASJA 4NLYA 3OXLA 3U1MA 2IDEA 3GJQB 2JZ5A 2RHQB 3C6UB 3T3FA 2YWWA 2HRTA 2HNYA 1RLDA 4ZN3A 3T5JA 2QLFB 3QIDA 2FJAB 4RW9B 4QU7A 2CIMA 4IR1A 1VC6A 5LJ3Y 4L75A 1KDNA 1HD0A 2Q1LA 2BE2A 3UNYA 1TUVA 3F44A 1QSYA 4O4GB 4QZVB 2BJDA 1Y00A 1K0VA 2XMWA 3G71S 4X65J 1FK9B 3R8YA 2MMYA 4L76A 2OI2A 4LMZA 2W7OA 5A8KA 2POKA 4LF4F 3PX6A 3W9HA 4IOCQ 3R2DJ 4BC9A 3MUTP 1NDCA 3D54A 1MG7A 4F4WA 4ED7A 5DO2A 1DQAA 1B70B 3ILLA 5C24A 5E5NA 2HVIA 2C3YA 4C11A 4LSNB 2G1DA 4NA1A 5SZTA 5EN1A 3S1TA 4LBHA 4CO1A 4A8XA 1DAXA 5IM0A 2YX4A 3D9BA 5LJ5Y 1U49A 2F4VJ 1Z2LA 2EFVA 2UUCF 5FLXU 1MN9A 1AXQA 3EZ5A 1W26A 1YG0A 2HG4A 1UTAA 4CO2A 5EWFA 2QA4S 5HLFB 2DNLA 2OPQA 4DX5A 3VAJA 2X3DA 3RRHA 1VQ9S 4DX8H 1JKHA 2AYMA 3AT1B 2PEHA 2HFSA 3DOLA 4G1QB 2VIHA 4O3RA 2MPUA 1KLNA 2BM1A 1IXKA 2IVFB 3B82A 4XPCA 4ZLJA 2XY5A 4PG8A 2LLZA 3O1LA 1VQLS 3GCXP 1ZM3A 2HFVA 4DL5A 3GFYA 3TJ9A 2Q3PA 2D3UA 2GW8A 1SUQA 3LP1A 3GMGA 5JXSA 5BJRA 3B4MA 1LWCA 3Q8RB 2IJNA 3M32B 4M5DA 2O5DA 2R7WA 2KRRA 1RXOB 2HYIB 4ES2A 3Q89A 3MAAB 4EEYA 2C28A 2MKHA 2VFUA 2J6TA 3MMAB 5KFNA 3MEEB 1FNXH 2IYGA 4IR9A 2DHXA 1J5OA 3C66A 1VQNS 1GEHA 2FVQA 4K7QA 4HH0A 4KGZB 2CPEA 3QO9A 4DSEA 4BBYA 4ZJQA 3D2WA 2WW4A 3WX4A 1QUVA 1ULRA 2DGSA 4RWXA 4JI8J 4DV2F 4ID8A 4JI6F 3NGRA 3V6DB 3QLHA 2Y8YA 1IBMF 3X1LB 4KO0B 3RB6A 1S48A 3OD2A 5ADZA 3G8SA 3MEDA 2ADBA 5KG6A 3M8SA 4B3MF 5F3ZA 3M8WA 2HNDA 4CDIA 3GQCA 1HFEL 2V67A 3M9OB 3FSIA 3SMZA 3MUMP 3KLGA 2OFHX 1QTMA 3DXBA 5KFJA 3TUPA 1FA0A 1GMWA 3PG9A 1R3NA 1IN0A 2FLPA 4OZNA 1VRQC 1FXLA 2XTJP 2G0JA 2GAGC 3H7HB 3DMJB 3D1QA 2FDNA 5K9FA 1S77D 1PAUB 3DN9A 1F5AA 1S9FA 1PYOB 1ZM4A 1QAXA 4Y28C 1N5QA 2UUBF 2MQMA 3C6TB 4EWTA 4LT6A 4FN5A 4IG3B 2ZEJA 4GVBB 1UPMB 3MM7A 1MSWD 4B9SA 4O23A 4ED6A 5H9EJ 4ELUA 3PJWA 5F0UA 3P5TL 1CULA 1HMVA 3GYGA 4ED0A 2W9AA 3M9NB 3BN4A 4V1Ak 1SQFA 2ALYB 1WTFA 1FO1A 4GC7A 4YN3B 2HW3A 3WIUA 2WONB 3LANA 2VG5B 1XNQJ 4NEZA 4KQZA 3JQJA 3UW1A 2FJVA 2MB0B 2XS5A 1VHFA 1JXEA 3LP2A 3I55S 4O3QA 3V6KA 3W5YA 1T9UA 3MCOA 5H9EK 2FPHX 4C7QA 3NS7B 3VGTA 4OIXA 4ELTA 1HKAA 3ISNC 4ZVUB 4LR7A 2LQ9A 3CGIA 1PGZA 2OHDA 2QFIA 1UL3A 2MY8A 2IY5B 3VZHA 1D0EA 2AJFE 3UNGC 3C3LA 1N5VA 1S59A 4PYDA 4O3PA 4ZVRB 4USKA 2AJ1A 3FFIB 1NCLA 1U0HB 5HP1A 3IWNC 2HVHA 2R8KA 2AX1A 3HFZB 2ZC4A 2QGFB 4YB6A 2E1PA 5AXMA 1F9EB 2A0FB 4DI6A 1RYRA 1VLYA 2VHGA 4P73A 3CCZA 1SJRA 1TKTB 4LF8J 1NPRA 2AW0A 1HHTP 1WC1A 3ISND 4M63A 2HS3A 4Q0BA 1YJ7A 4I6AA 3NCRA 4A8KA 3GG1A 2GJIA 1SJ3P 5L1KA 2F9DA 4WBFA 2LYVA 3SXLA 2GIQA 2ZBCA 4ZVFA 3MR3A 1XC9A 1HWUA 3IR5B 4FYYB 1U6FA 4FP9A 3H20A 3QATA 1IQTA 2VV5A 4M95A 1GXTA 3CJKA 1OQ6A 4PPZA 4G6VB 2C2OB 3TX0A 3BB5A 5CXTA 3HHLB 4K4ZA 3D7SB 4LFBF 1ACMB 2PMHA 1VC5A 2AHOB 2FTRA 3OTOJ 1NO8A 4WTOB 3WDOA 5IZHA 4OX8A 2IFXA 5KG7A 2Y1LB 2IAJA 2A3JA 2CQ1A 3L3CA 3QGPA 2ZD1B 2I0XA 2ZH2A 3VAFA 5BR8F 1XEZA 1WEZA 3FJ2A 4H4KC 1CJUB 1FKOB 4OJHA 3HCXA 3EPGA 3HT0A 4LFAF 1SKUB 1F5BA 1FDNA 1PJ5A 2Z2ZA 4F26A 2FJXA 3H59A 3VAMA 3RU0A 3P3DA 3GTYX 1TL5A 4MYTA 3F56A 2XQCA 5C42B 2MYFA 3ZTSA 2DGTA 1TK8A 2BVZA 2QFJA 2HQFA 2DK2A 2MKIA 4ID5B 4OYWA 3P96A 1BQNB 1REGX 5CABA 4ICLA 4ES1A 2R8JA 4Y2AA 3RJMB 3BR9A 3FC9A 4IG0A 3VVTA 5I3UB 4YQWA 5E3RA 4F25A 4DR6F 3W65A 4J9NA 4XDDA 3W5XA 2UVVA 1TL7B 4CLZA 4I7FA 2RDJA 5E3CA 1HBNB 3HZEA 3DRPB 5J1EB 3MZIA 7AT1B 3SCIE 3IRWP 1NBEB 4Z7YA 5F8LA 2XLKA 3DCAA 4C8YA 1T11A 1CQNA 1ZS6A 4OHZA 1P1TA 1WELA 2U2FA 3RAQA 4C8LA 5IQQA 2Q43A 4EO8A 1CJTA 4QIEA 2ZH4A 4ECZA 2XNRA 2BKNA 2QZ8A 1HHQA 2VG6A 1R0AB 2WVFA 4MKBA 4E98A 1B99A 4DQPA 2OPRA 2GHWA 3QT6A 2C1EB 3EMTA 2DYAA 1S0MA 1T9XA 4RNOA 1YTYA 2CRLA 2M2BA 1SV5B 4C98A 1X31C 1O51A 3O44A 3PX0A 2A6OA 5BYSA 2XY7A 3C2PA 3UCGA 3KHLA 2K7JA 2B51A 4J7CA 1JLQB 2PC6A 2X1GA 1WG4A 3L7OA 3G87A 5G0RA 3W60A 5F8HA 5K14B 5HANA 3DM2A 2P6SA 4F4ZA 1OSCA 1HR0F 2KFZA 2QSWA 1S1UA 4D3HA 2HPUA 3LAMA 1NRKA 1KOHA 2DY9A 1X4EA 3GJSB 2H54B 3MMBA 1RT2B 2FYXA 2EC2A 1APSA 1FD2A 1TR0A 4BC7A 2Z4PA 2MZTA 3E01B 3DLLQ 4F3OA 2RB7A 3SBMA 4ZIVA 1N4LA 3SQGB 4OZ0A 2CWKA 2B3TB 2CQCA 4X66J 2ZNZA 1MWZA 2GZOA 1BQXA 2YKMA 2FLNA 3BQ0A 2B4OA 4I6WA 5ETLA 1RAAB 4CQ1A 1H6KX 2AEJA 3GR1A 3VTIA 1JLBA 1ICEB 3UDCA 1FTCA 6AT1B 2C2DA 1VQ8S 4Y65A 3SDEB 2LXUA 4OX9J 3CCVS 4LSZB 1KFDA 4ZVGA 3LGMA 5L8RC 5L39A 1D9AA 4C48A 2IM3A 5HQLA 3ONQA 3MCNA 4DZDA 3BPSP 3JSBA 4NE9C 4O3SA 3KLHB 2HQIA 4JI1J 4LIWA 3NBPB 2DB1A 3TZYA 3P4UB 2F1FA 2R2TA 1WNEA 3K89A 2VPXB 1QSSA 3C15B 3IBWA 5AXNA 5E0OA 2HMIB 1SL1A 3ZTQA 3CDUA 3W2WB 3IN5A 5KT7A 1VQOS 3QRRA 2GNKA 5AT1B 1D1UA 4ILRA 2AZ3A 2RD5C 2ZJPQ 4IOAQ 3H90A 5DLGA 4RX6A 2CQBA 1OMSA 3W5ZA 3QT5A 3BO4A 3EZOA 1P8GA 3EICA 1ZTWA 3OLBA 1GMUA 3QGIA 4OYOA 4QR1A 1FEHA 4FYXB 4DOZA 2VBYA 3UN3A 1C0TB 3GSIA 2UU9J 3I0SB 1GXLA 4OYZA 2EPIA 1D9FA 3H98A 5CYQA 4YHHF 3AA8A 4J9UE 3QIPA 3C14B 1RHQB 2B7BB 2OSQA 4OLPA 3V6HA 1FHTA 4F0KA 2B43A 4LRFA 1FI4A 1TVRB 2I1RA 3CCMS 2XYHB 4GO5X 3OUYA 2Y3YA 3L7UA 1N88A 2OGUA 1F6TA 1NLKL 1LV5A 1RWVB 1RISA 3PZPA 5KFFA 4U67Q 1R8BA 4JYAF 3M1VB 3D1OA 2PEBA 2KT5A 1Q5YA 2MZ1A 2BZ2A 1HQUB 4C2MA 1FF2A 5DETA 3VGSA 4K8RA 1NK9A 1WOOA 2XLJA 3SSRA 3D0HE 4HHJA 2HLUA 2DXEA 1FJEB 2VOOA 3TUJC 1XMBA 3M4XA 4YB1P 3AB2B 3TJ8A 1FWKA 5F3TA 3UO0A 4PWUA 2QV6A 4J9QA 4MJKA 5A8WA 5A8RB 2QX0A 4BS2A 1U45A 4CLWA 2AYGA 3AY0A 2LXIA 4O4RA 3M6WA 5AJ3J 1W25A 2X1BA 5IV4A 2QL7B 4LF7J 1BC6A 1U8SA 1HPZA 1JXLA 1CEZA 2BEFA 3DKDA 1UETA 2WAQD 1VCTA 3BV8A 3EGVA 2K3IA 3EVMA 1YJ9S 4IFVB 1KRPA 2DEJA 2UVWA 1X60A 4LF5J 4A8QA 4PQUB 3G2XA 1DTQB 1AROP 1X4CA 1RBAA 1DRZA 4JV1A 3J81Y 3T6BA 2J9DE 1RT5B 3GR0A 2ILYA 1Q0NA 1FNMA 4QR2A 1R7IA 1UEVA 4RW4A 1OY9A 5LT5A 2AX0A 3ELHA 2FVCA 1SXLA 3AJ1A 4F2RA 1RTHA 1CJVB 3BKFA 1URNA 1B4SA 5C5JA 5J2NA 2CQHA 2H5EA 4A46A 4PEOA 2FQQB 3KOAA 4LJMA 5L1IA 3F0NA 4CM2A 3QJLA 3CF5Q 1VRTB 1YI2S 3CJ4A 2D41A 4TQRA 4P2SA 1KN6A 2C22A 1O8BA 5LSOA 3EE3A 2M7SA 5DDRC 2PT0A 4HKQA 1N5YB 3QBCA 2P5VA 2PDAA 1FVQA 5M2RA 4IO1A 1RWOB 3EM1A 4PXBA 2VZ9A 3PNIA 2Z56B 4J9KA 2XSJB 3RUBL 4CH7A 1HYSA 4K4SA 2D3O1 2NLWA 4M5KA 4RR5A 4DL3A 2D7SA 1YJTA 3KK1A 2C3UA 1W2BR 4ZVPB 3KK2B 4QWDA 2HK2A 4K5RA 5A0YA 3POTA 2QO3A 3PACA 1HI0P 1RT4B 2PN6A 2GQCA 1EKRA 3A3OB 4X64F 4IFYB 4R0EA 4J90A 1G6BA 4J9MA 3ETMA 3DLKA 3T1YJ 3CCTA 4PWDA 2VPZB 5KG2A 5L46A 2HNYB 3RB0A 1S1WA 1RAFB 1JIHA 1KVKA 4UF4A 1MLAA 5KFWA 1AB8A 5D8HB 1IM6A 3PV8A 3H5XA 2DGUA 3OPKA 3AFGA 2BKPA 2C2ZB 2CQ2A 3ET6B 5ETSA 1NK5A 2ABYA 2W24A 2YKPA 5ETKA 4I6YA 1Q86T 3AD8C 1FE4A 1FJCA 3PXGa 2DRBA 5EWGA 3NRBA 2B7CB 4DLGA 3H42A 2ACYA 2RT3A 2GJ2A 2HHPA 2MSSA 5A8KB 4QWCA 3MEGA 3IRXA 3PFEA 2OH2A 4OV1A 1UFLA 2JEIA 4QBUA 3CCSS 1SKRA 3L09A 5F8IA 2CVEA 2L3MA 4F4AA 5IS2A 4C11B 3PJ9A 3L4BC 4CLUA 1K1SA 1MW7A 3K8WA 5MLCV 2NSBA 4BCAA 3M8QB 4K59A 1N52B 2ZZTA 3OSPA 5IM0B 3I82A 2QLBB 5KT6A 3MR7A 1HBOA 3HDSA 4HL9A 1ZH5A 4J9RA 4B3OA 2DD8S 4M5JA 2MLZA 1LFPA 2BXJA 3EVOA 2XWYA 2RE1A 4NLQA 3VGVA 1P9YA 1JKHB 1RDRA 4MAKA 1EETA 2BQRA 2J9EA 1FKPB 3IM8A 4B17A 3MOJB 3D68A 5F41A 3MM5A 4H4KA 2OP5A 2MTLA 3MURP 1U2CA 4IQMA 2VUGA 1SKSA 2CNNB 4MKAA 4EBCA 2CZ4A 4FXWA 4CP5A 3LP1B 5DDQC 3PYDA 2B5JA 1X4GA 4DR1J 4WZQA 2NUHA 1RTJB 2D3ZA 3NWGA 4FPIA 1FRHA 4DR3J 4WKYA 4V19J 3NY0A 1QE1B 3M30B 4DF8A 2DR6A 2V0NA 1K47A 3KTQA 1RT7A 2VFVA 3MEKA 3MFHA 4WE1A 1NJZA 3OL7A 3NAHA 1M5PC 2CDRB 5F8GA 2K8GA 2EWHA 2JFDA 2OMOA 3R7NB 4DDFA 4ZPTR 1Q8LA 4KFBA 3QO9B 3TA2A 2OEMA 4AL5A 3G9CA 4MTPA 1YZ7A 1N32F 4PXCA 1R89A 1LKZA 2PFDA 1CC7A 4QWAA 3V5RA 4DV0F 4P2FA 1PBAA 1FRLA 2IMOA 2QLWA 4NI2B 5DQIA 2WVCA 1ZOTA 2WVEA 3G8QA 1LXJA 5K5MA 1KQFB 5GAGU 3UE2A 2FY8A 3GIRA 2L9DA 3W2VA 3QLHB 1WG5A 1AA1B 4WWSA 2V2VA 1KC8T 2MKSA 5B0FA 3MEDB 2UVUA 1DLOA 4FXVA 2PI4A 1AYEA 4TYBA 2HNDB 2CVIA 3M2RA 4NLTA 1E6YB 3JB9k 1RTDA 5AE3A 3H2VE 4H4MA 3THVA 2F8HA 2UUWA 3THTA 5IT9U 3DGPA 3FUYA 3QSIA 1FCAA 3DU6A 2IVMA 4EYHB 2UXCF 2YQ3A 2CPJA 4LVOP 1MROB 4M5LA 4NPOA 3PRBA 1S49A 5DJBA 3TQ1A 2ERRA 4RKUC 3PCOB 2ZM6J 2Z2MA 2R8GA 3IAS9 5KG1A 2RS2A 3HP6A 5KFVA 4WTYA 3CDAA 4DCPB 1RAGB 2AP6A 3LH2S 3E51A 2O01C 3Q2SC 4CYUA 2F7VA 4KIAA 3GILA 1U6BA 3R6GB 3BN7A 2HWHA 4AUKA 1HWLA 4WFNQ 2CJQA 1N34F 2LQJA 2JEJA 1ZPWX 2CJ9A 4DV4J 1WD6A 4A8MP 2SXLA 1LW0A 1F60B 1FRIA 2X7IA 2B8PA 5J2MB 2FC8A 4C8KA 4HYKA 3PHTA 4DV6F 1GAOA 2IPOB 4NYPA 1CULB 2K06A 1HMVB 4ITSA 3GIMA 3AOBA 2OPSB 1BLUA 2XM3A 1L3SA 2N7CA 2CPZA 4OYBA 1RADB 4ZVOB 1N6QA 3GZ7A 3BO2A 4DBQA 3N6MA 2DNQA 2HBRB 4WXWA 2C2MB 4RW6A 2RNEA 2M0GB 2ADCA 1ZYQA 5HO4A 3VAHA 2KO1A 1DTTA 4QW8A 1U7LA 4AYBD 2NZCA 5J1NA 2H48B 4CO3A 3KYLA 2ZUAA 3JSMA 3KKFA 5KFIA 3G82B 2ZKTA 1R8HA 4DR4J 4LSLB 1N56A 1KD1T 1UVMA 3SIPB 2V9WA 1S6PA 2BACA 4FF4A 1BMQB 2OELA 2HSEB 1FFWB 3IFEA 4NLSA 1IKYA 2ZE2A 1B0VA 3AQOA 4F2SA 4UQGA 1WORA 3R1LA 4A8SA 3D28A 5D3GB 1T9WA 4B9NA 3K17A 2BM0A 1Q81T 1HNWF 2MQ8A 2MY7A 1P27B 4C8OA 5F9LA 1BQMB 3PEJA 2MZSA 3HZGA 2VFRA 1SQEA 1S9EA 3OTEA 4UW2A 1WHWA 4R5PB 1H73A 1X0FA 4WFBQ 4DPUA 2J7UA 4LF1A 2UXBF 3CCLS 4YB7A 3HMJG 1LWFA 5DLFA 2W8KA 1N33F 2G1HA 4WU3A 2P9CA 4OZJA 1M5OC 3I6PA 5ETVA 1D09B 4KHPF 1RUSA 5DG7A 1S10A 1JMTA 1YIJS 2PFFB 2QEXS 3G8TA 3K7RA 3CJKB 4ES3A 1R6VA 4YUDA 3B8HA 3BQ2A 2L08A 4Y2CA 1RAJA 1A7GE 4U8VA 3VQSA 4A48A 2VQEF 4FF3A 3OVAA 2YQ1A 2J0QD 1VBZA 2BE7D 3IG1A 3ZC4A 3MM8A 2RUSA 2QL5B 2LCWA 4J9VA 5ETPA 3RB3A 1QAYA 4PRFA 5DRKA 1B0TA 3SCJE 1WWHA 3TYTA 5J1PA 2YNGA 3UDLA 2GVZA 3KHHA 4N56A 3PHEA 3KJQB 3OLAA 1NB7A 1BWEA 4UZCA 2DNKA 5ETMA 2R7TA 4JI5F 4JI2J 3UD3P 4I67A 3TAMA 4JI4J 2H4WB 3GSDA 1BD6A 4P71A 3SFGA 1X9MA 2IYIA 4NZ0A 3LP0B 4DF4A 2KXFA 3FQLA 2ZBIA 4RL1A 3L95X 1PJ7A 4GKJJ 2JJ4D 4WFZA 2NSCA 1N0UA 3MPDA 4GMKA 1WC5A 3CDEA 3QZ7A 3N4WA 2XMJA 5ETQA 3OTBA 2IA6A 2F4FA 2JHEA 4IG0B 3I0RB 2E5JA 1YRXA 4HH1A 4WP9A 1RQ0A 2E7XA 2GS8A 4JI3J 4JI7J 2FGOA 4DFPA 2LECA 3U1NA 1KWMA 3NGUA 3GFZA 3D6FB 2RF2B 2LU2A 2IVYA 3RYLA 4P7TA 3UVJB 3MR2A 2DPIA 2ZZNA 3UD4P 1RAIB 1JLAA 4EU0A 3IMQJ 1SJ1A 4M5MA 5H1SV 1RI7A 3WC2A 1F9FA 2RHSB 2QMWA 4USTA 4DV3J 2UZAA 2Z30B 4DV5J 4DV1J 3GFHA 1G1XA 1T3OA 2HHHJ 1CJTB 3DNCA 4Z7CA 5J2PB 3WC0A 3KLFB 4BWJA 3A13A 3DDNA 2VG6B 4ZMMA 2C2RA 2N4CA 3DC2A 1GX6A 3FNNA 3TOQA 3BGUA 1D3WA 2IIHA 5HAOA 5AXLA 3SZ2A 4WJBA 2VICA 2K2PA 4J91A 4QR0A 5D4PA 3OJSA 3AHPA 2AEMA 3NWRA 2HBZB 4ATNA 1NPPA 4DSLA 1XR5A 3UWTA 3GV7B 2Y9HA 2QA2A 4RNFA 1JK9B 4MKVA 4X4QA 4MIAA 3MF5A 1RBLA 3CCWA 3K5NA 2CNLB 4G3IA 1FJGJ 1VRUB 3M8RA 3KJVB 3PW5A 4FYDA 1HNXF 3DOMB 4KY3A 3ZZ0A 5C25B 5IC6B 2NUUG 5DG8A 1XMOF 3DM2B 4R8UB 3V4IB 1T03A 2HVZA 2DGOA 1YKWA 3D1HA 5JJBA 4X62F 1JJCB 4NXNJ 3MMBB 2EW9A 3LPYA 2LDIA 4K4UA 4C3KA 2JFKA 4NA3A 4X4VA 2RS8A 2AT1B 4TN2A 3HHLC 2FJEB 2ZKUA 1IM4A 1S97A 4M5HA 1KLMA 4UOHA 2BOAA 2PGCA 3HD2A 4TVAB 2FJWA 4MIBA 2EK6A 4M5IA 2XI2A 3EDQB 4ZIWA 1TTHB 2YKMB 2QLXA 3GCWP 3CDWA 1FD8A 4J9SA 2HS4A 1MMLA 3OTDA 2YPZA 2F8EX 1SJFA 2HZAA 4IH5A 2R7RA 2ZZMA 3DRYA 3EX7B 1VQKS 3K59A 1S1XB 3FZBA 3MDFA 1R27B 1SB6A 2HIQA 4DN0A 1KKHA 1N48A 2XI3A 2F5GA 1VR6A 3GP9A 2NPFA 2CQGA 4EYIB 3HHLD 1H0HB 4C3MA 1GQEA 3FSYA 3L9ZA 1RCXB 4AXIA 4CZCA 3M8YA 4RW7A 1U1OA 3OSNA 4O44A 2WSEC 1XNRJ 4ED5A 1AZSB 1XK8A 3HFVA 4ED2A 4TKTA 5F8NA 2C3PA 3DRSB 3ISZA 5LMNF 4AFFA 2X1FA 1M0SA 4WXOA 4DUZF 2DXDA 2H3EB 4AE5A 1BGXT 3VWSA 3BGFA 4C9DA 5B7WA 3BGOP 2VPWB 3ZO7A 5D78A 1XERA 3DRRB 3Q8UA 3KUHA 1I94F 1TK5A 2IJFA 4ILMA 2AJ4A 2ZHOA 2Z8QA 1YBTA 1RU2A 2QIFA 5CYQB 2KYXA 4LF6F 2V34A 1SJ4P 2XZDB 4B3RF 3Q22A 4Y0FA 8RUCA 2V8HA 9ATCB 1NKBA 4DU7A 2M70A 3M2VA 1FE0A 1RT3B 2XY6A 4P74A 4UTGA 3DOKA 5I3QA 3J7ZT 2N4DA 3WBZA 5KFEA 4W4MA 2VA3A 2EFQA 4NXMF 4K0KF 1KS2A 3RAMA 5G4DA 1DY3A 3TX8A 2Y1IA 2ZVIA 2VF3A 3M05A 2XYGB 1QAIA 2RUGA 3IS9A 3WIVA 1BUXA 4HLBA 2GQ2A 3O2IA 2BABA 3T1HJ 2J76E 4Q43A 3J7Z5 4Q2LA 5DM7Q 4LF9F 3GU0A 2HK3A 3LPEA 1CS4A 3LUYA 2GQQA 2HQCA 3VF0B 2W9CA 3FRZA 4LRAA 4Q7AA 2HFNA 1VOMA 5HBMA 3SCLE 1XTZA 1NH8A 3QWUA 4ZPBA 2PSZA 2FLOA 4NZ7A 5A8WB 1PILA 4R25A 4DQSA 1RLCL 3BGRA 3TAQA 3NS5A 2BJEA 5EWEA 4OHWA 5C7PA 3EUNA 2X1AA 2NXJA 4WK3A 1HW8A 4KE5A 4WYLA 4YY3J 1HPZB 2ZBRA 4BDPA 2C3MA 4NCAA 1SVDA 1U4BA 3T41A 3QQCD 2J9DA 2JX2A 4NLXA 2KKHA 1RAOA 1JJ4A 1HWJA 1WF0A 1Q4RA 1JLEB 5AXKA 4FYWB 2FZKB 3OTCA 4LQ3A 1FKAF 2C2EA 3U27A 3CDBA 1YX2A 4RW9A 3A8JA 1JLGB 4WP8A 4B3SF 1SIWB 4ZVSB 2XYPB 4DUTA 4HHUA 3SSQA 2IJRA 1X8DA 5EGYA 4I64A 2ZOMA 1FRXA 2V2ZA 4O4GA 2VPYB 1RTHB 3WZ0A 5IWAF 4HVZA 4LRBA 5J2NB 1IJFB 1TK0A 3VCDA 4DL7A 2X51A 5HK4A 1BXNA 4C8ZA 2V68A 1FK9A 2V4RA 2NPIA 3CD6S 2BE9B 1NHKL 3DLHA 2ASDA 2FZCB 2XMAA 1T05B 2QSFA 3NAIA 3KNAA 5F8JA 1WC0A 3NCQA 4YDDB 3ULHA 3H2LA 2F40A 5U47A 1T8EA 3BS9A 2VOPA 5CD4H 4ELVA 2LA6A 4LSNA 3SFUA 3KDOA 1QY7A 1CJKA 3LF0A 4QYZJ 4LVNP 2RIJA 2VFTA 5CCMA 1GNKA 3MM6A 1SC4B 4OI6A 1HYSB 5IT0A 4LR9A 4JP8A 2WOMB 1YDLA 4C4WA 3M6VA 4QYRA 4ZJLA 1IKVA 3KK1B 2KDOA 2E1RA 1PBUA 5EX0A 1XN9A 3HHEA 5CH7B 2CPFA 3R5JB 3PR4A 2XCPA 2BJ8A 5A0YB 4X4UA 2E66A 5FLXY 3ZZZA 5I4MA 1OQ3A 2BANB 1CG2A 2VBWA 4QYZK 2CFXA 3HXMA 4I2QB 3CJSA 2OD4A 3DLKB 2DGWA 1U47A 4PWDB 4NCGB 4LQ9A 3ILIA 4B08A 5HQ8A 1P9QC 1AT1B 4RZRA 4Y34A 5BYRA 3A8IA 3GONA 3D0GE 3J80U 3W9IA 3M32A 1Q16B 2LKZA 4RUAA 2V50A 3P5BP 4QU6A 3WQPA 2CJYB 1DURA 1NH7A 4DUYF 3OBIA 5HVFA 1HD1A 4I2PA 3PEHA 3I31A 2O1PA 5BXIA 3MGJA 5B0CA 4RLEA 5FD1A 3TP2A 5L1LA 7FD1A 3HKWA 3IWLA 4MK7A 3CO9A 2D1CA 1ZA1B 2AGQA 4LRCA 3Q86A 3NP5A 2B6AA 1HNZJ 4K4YA 5HMXA 2UUAJ 4UOCA 1S9GB 2GHVC 4JV5J 2V6AA 1I51B 3V6DA 2HHSA 2WTFA 2ROEA 4NLWA 3IP0A 2YKNA 1HBOB 4DR2F 4KO0A 2MZJA 3BYPA 4B3TF 2HS0A 4CNYA 1YBUA 4DLEA 4PZVA 1RP5A 1U1LA 1JLFA 2Z2LA 4EGLA 5CZXA 1BWVA 1RAHB 3IA0A 1CPZA 2XG8A 2F65A 1EX8A 4DZ6A 1EETB 5T7LA 2RU9A 3TZWA 1IWAA 2GMHA 1MWQA 1YK9A 1HL6A 1WI8A 2XHCA 3DHXA 2LU1A 1C0UA 3A12A 2DTJA 5A76A 5M2PA 3TANA 2B9WA 2MDAA 4WKRA 2DNOA 3TR5A 1ZAVA 2U1AA 4CLLA 4LBPA 5E7OB 3TZZA 1GT8A 3R6LB 4OV6A 1X9WA 2Z2YB 5HSPA 3TNVA 4I4BA 4X65F 2AEFA 1VGYA 2EG1A 5IOLA 5JUMA 2B5JB 2FJDB 5I3PA 2VL1A 2E9RX 3KK3B 2QMUB 2HEKA 1K8AT 1M5VC 4IG3A 4GVBA 1RT7B 4DSJA 1HW9A 3ZNJ1 2DNMA 2L48A 4UZBA 2IBOA 4W98A 4C8NA 3HVRA 1U8WA 4NMXA 5GMDA 4ANCA 2FD2A 3K58A 2ROPA 1UP1A 3WHIA 3FBBA 4KFBB 4LREA 2M4MA 2F4VF 2A1BA 3FMWA 4OFZA 1BY9A 2J9CA 3ZZYA 4QJVA 2YY3A 2HNZA 2JDJA 3UDEA 2VG5A 3RG6A 1VDHA 4ZP8A 3VALA 4B9LA 4KC5A 3N28A 3VAIA 3FCHA 5LMUJ 1IQZA 2CJBA 3DDKA 1VISA 4ZP9A 5E3PA 1C1BA 3RB4A 3AB4B 3UN2A 4IQXA 3CJTA 3TRGA 3U02A 2IRYA 5KFBA 4WP3A 4P7VA 2XGPA 4CT9A 3K0JA 3M2RB 4YR2A 2YQ0A 1D8ZA 5KOXA 3TWZA 1HQEA 1Z1ZA 3Q8YA 4N47A 3DGPB 2CPIA 2EI5A 1CC8A 3VGUA 3ZTRA 3FBEA 3U7JA 2R3VA 1TUGB 3TA1A 4OX7A 1U0HA 1RA7A 1VQSA 4ECQA 5FDLB 3KMQA 2ZWPA 3UN5A 2FHJD 2V94A 1OPIA 5HN0A 4ED4A 2GV1A 1RGVA 2R7UA 4HDGA 1TKTA 1I1GA 2ZOGA 3KHRA 4CYUB 2A2CA 3OFEA 2HKEA 1BHNA 2LEBA 4AQYJ 2RVJA 2OUGA 5GMKa 5KG3A 2ZFHA 3FEZA 3DLJA 3PW7A 3AJ2A 1YHQS 4JI8F 1QTNB 4U95A 2NXCA 5DZ7A 3AJDA 2ZJRQ 4AL6A 1X9SA 4NEYA 1OWXA 4ZDNA 2E5IA 3VAKA 2GVDA 3HHLA 2XBPA 1N6QB 3C8YA 4MMOA 4X4TA 3M8PA 2ZD1A 2XWXA 1RZMA 2YKOA 4CH0S 1C4AA 2DCUB 3ZTPA 1H2UX 3GV8B 4KRWA 1DTTB 1ZPVA 1R43A 3G6ES 1CJUA 1FKOA 4AXJA 4DQQA 2LVWA 2MHNA 2PIIA 4RWWA 1B7FA 3FBCA 2DO0A 1G2EA 3R2CJ 3LWMA 2MXYA 1LWEA 2AD9A 2IC3A 1NZAA 3IGVA 1S6PB 1K44A 3RBXA 1W7WA 1UVKA 3TJAA 4TY8B 1S1TB 2DCLA 4ZP6A 1BQNA 1R8AA 1WSVA 1AFIA 2QA1A 3R9LA 5J2QB 4DSKA 3SCKE 7FDRA 5I3UA 2HGNA 1AUSL 3BH6B 1YRUA 3K8VA 3A8KA 1WACA 4USMA 1OY6A 4LRDA 4GC6A 3UPFA 3JAMU 1J27A 3DRPA 5J1EA 2R8IA 1UWBA 4CWBA 3CC2S 4OZ5A 1IKXB 4ZPDA 3CJRA 2IHR1 5KG5A 2DGQA 4FNHA 1KVIA 5GADI 1XNQF 4JBCA 2VQFF 4EZ9A 2OLWA 1X5TA 1EJ7L 4PYAA 3MAQA 2MGZA 2JOQA 2AYEA 2ZITA 1NK6A 4OJ1A 4UOFA 4DPWA 2DRAA 5GAGI 2Z58B 2J6SA 3HSJA 3NNAA 3CMQA 1S79A 1PC5A 5DDOC 3KDNA 4OI1A 4WIQA 3ZFVA 4LFCJ 2M88A 3I5BA 2FB0A 4O3NA 1IR2A 2CWXA 4RBUA 3KG4A 1HARA 3MM8B 4L6V3 4XK8C 4HEA9 2BA9A 1XR7A 1MU2B 2CNOB 1TKDA 1SV5A 2YNGB 2V2KA 1QJHA 3M8ZA 1IVZA 3DHWC 1WHXA 3MPYA 1NSQA 4EO6A 4B02A 2OMLA 1R8CA 1NJWA 1ZA2B 5LXRA 2ACMA 4CTAA 1URRA 3QPIA 2HZVA 1HBUB 4Y6IA 2IA0A 2P9GA 4DR5J 1FERA 4LF8F 1WOSA 2MJUA 3FZ2A 4N76A 3OV7A 2M9KA 3ZZRA 1NXIA 3FMBA 2QT7A 1QD1A 4YS2A 2OAUA 4CLKA 3M6UA 1UFKA 2C2NA 3OJUA 2MSTA 2YNHA 3B54A 4OYMA 2CDQA 1RTIA 4GRSA 1RWUA 1H2TZ 1IBLJ 2W4DA 2ALZA 4DMZA 2DY1A 2YNFA 4ZVEA 5DQHA 1X4BA 4XAKA 3BEGB 2XCAA 4NOHA 1YWXA 3OTOF 4IKAA 5K8OA 5C2GA 3UR0A 4FYVB 1CQMA 4X4SA 5I42B 4OL8A 1OY8A 5D4NA 2W25A 3IR6B 1RT1B 5FJ4A 3ZZPA 4B9VA 1YVFA 1TL3B 3DU5A 8AT1B 1FRKA 2B56A 3N79A 4NXMJ 4ECSA 3CIMA 3CUNA 1PO6A 4KV8A 5A2QU 1SL0A 1JJHA 2J0XA 3DYAA 4LF2A 1N36J 4YDXA 3KLHA 2CJKA 3NBPA 5KFXA 4PQAA 4MFBB 4IO9Q 3R7BB 3QZ8A 2FGCA 4N77A 3C15A 3VV2B 2AGPA 1S72S 3NOCA 1TFWA 3W2WA 1M1KT 2XULA 1UZDA 2V8VA 1IKWA 3SV4A 2KXHA 1NDPA 1NK0A 1J5EJ 5IQ6A 1LNQA 2YXLA 4DSIA 2YPYA 2GIFA 1A6LA 2IM0A 3QAUA 1U1PA 1HNIA 4KGKA 4K50A 1Z2ZA 1UEKA 3CC4S 1C1CB 1V3SA 2H4YB 3JQKA 4OQJA 4HACA 4NWBA 4QQBA 2CJAA 2E5LJ 2XO6A 4RBTA 4K4XA 1T9TA 1SC6A 2J5AA 2VFSA 4NCBA 3UQSA 2YWKA 3NGKA 3C14A 2I9SA 2V4JB 3MCMA 5HVGA 1NHVA 3A1YG 4ZVHA 2XNQA 4IDKB 3MD1A 5H9FJ 3BSCA 2H51B 4DV7J 4K5SA 5F8MA 1TVRA 4N8OA 1R6YA 4QCLA 1VQYA 3H2UB 1T9YA 2Q66A 4ER8A 2AYBA 1HWIA 2BRLA 3VHQA 3RAXA 3DLGA 4C8MA 2AU0A 1FXRA 4KBIA 3BBFA 4PUOB 1X4AA 2CZ9A 3GB0A 1N5TA 3ILOA 1UEUA 3M1VA 1ZZFA 4C0HA 1RWNB 5THWA 2UXDJ 1VS3A 1HQUA 3JTNA 1S6OA 1Q8IA 4NLRA 4HT5A 5DGAA 3GE9A 5H9FK 4EFAC 3G86A 3OQ2A 1NK7A 3Q0AA 4YFUA 3NKYA 2ZH8A 4DXLA 1KVJA 3AD7C 3PDNA 1ZAWA 1EQ0A 2BJ3A 2JC1A 4USWA 4PAAA 5HI7A 4L73A 2VG7A 4W92B 5A8RA 1M5SA 4F4XA 5K8PA 2KHDA 3H8YA 4J5OA 2CNKB 2RH3A 3OT9A 3I5CA 4ANEA 2Y0SD 2Y0BB 4DG1A 1RCOB 1BE4A 2ZNYA 1O0PA 2HHTA 1E6VB 3Q2TC 3LQVA 3NXZA 1HNVA 1I6JA 1NSPA 4FBTA 3OR2B 3BBCA 3KFWX 1LEOA 5HROB 1KTVA 2GJFA 1V9OA 2EBGA 1A0OB 4PQUA 3CB4A 4FXDA 1TV6B 1NSAA 1DTQA 4J9PA 4DR7J 4U8YA 4ZCMA 1N8RT 1VBXA 4F7VA 4MT1A 4CLYA 4Q2MA 2HFZA 4HTIA 2CZVC 4X66F 4P75A 1VI7A 1IBKF 1S0NA 4M8LA 3M2VB 2ZBQA 2NQPA 1F3VA 2DR8A 3EJMA 1CJVA 1IWGA 2ASYA 3KNGA 3P8BB 2AJ2A 1FRMA 3HF5A 5CHCB 2OO4A 5D0HA 4F8RA 3JTOA 4DSFA 2HGMA 1N5SA 1VRTA 4ECWA 1VBKA 3I4HX 2EBEA 1NAQA 2PE8A 4M1KA 2R8HA 3OXGA 3OFFA 3IBCB 2ZDPA 4ECVA 4JI1F 2ZHBA 4KAIA 3KJNB 4XO0A 4EBDA 1N5YA 4WK1A 5KFAA 1MMDA 1IBCB 2G4BA 1CS4B 5L9NA 2W7AA 4KKOB 4A8WA 4QPXA 3I5AA 3T5KA 1Y3JA 2LP4A 2WBMA 5HBMB 2WSFC 1ZZNA 3CSKA 2XSJA 3HHNB 4WF9Q 1NKEA 4ZVQB 1RHKB 2Z0GA 3MI7X 5GAHI 3ENQA 2LFVA 3FQKA 2ZH5A 9RUBA 2MKCA 2Z57B 3KK2A 5KFSA 2FHKA 3MECB 1Q79A 2ZC3A 2EEYA 5IFMA 2PA3A 1RT4A 4NLVA 2UU9F 5EHHA 5B0BA 4IFYA 2XHWA 4QIVA 3IM9A 2VC1A 3MMCA 2FHJA 1VK3A 2Y1JA 2E7VA 4C6AA 3QJPA 2DHSA 3UFCX 3RBDA 3PX4A 2I5JB 2FLLA 2ZWOA 2J6UA 1PC4A 3PIPQ 5IT4A 3KHGA 3G96A 2ZUGA 4LF4J 4RUCA 4Y2MA 2DPJA 2N82B 3PM9A 1T7PA 3CCUS 3GIJA 4KH0B 4ZHRB 1WUUA 2R9LA 4XDCA 2V5HG 2CQPA 3ET6A 2DIUA 2X3GA 3D3BJ 3PR5B 1SH2A 1U02A 1YJUA 4N41A 4I68A 4P72A 1OSDA 4W90B 1MWYA 2HHXA 1VBYA 2UUCJ 4M5GA 3R97A 3V81B 2RKIA 3DLEA 4MYUA 4M94A 2EFPA 1PG5B 1NUEA 4QWBA 1F1BB 4NYZA 2FJBB 1JB0C 4I0WA 1EP4B 4X84A 2IDLA 3NNCA 5RUBA 2ASLA 2RILA 5B0DA 1Z4UA 5LSRA 1CJKB 2GA7A 2XGQA 1Y10A 5AJ3F 3I56S 3O5TB 1NU4A 3M8QA 4LF7F 1M5KC 2QTWA 1RKJA 1HIYA 5KFKA 1VQ5S 2OEKA 5GVQA 4DFMA 4RNHA 2ROGA 3MM6B 2CQIA 2YBVA 2EVZA 2UVRA 1U1RA 5M2UA 1LQ9A 4LF5F 4ED3A 4MK8A 1IKVB 2AQ4A 2HVDA 4J9LA 2MKJA 1S0OA 4CLTA 4FNIA 4PG5A 4DFJA 3ENVA 5IC4B 5CYMB 1ITPA 1H7XA 2E1CA 3PYFA 1MMNA 1FKPA 3FEXB 4N7TA 4IRDA 2P6TA 4RW8B 2H1YA 1U0SA 1XBWA 1RABB 4DFKA 3KLIB 2DGXA 1RTZA 1EARA 4Y2KA 3TEHB 1SC3B 2CUYA 2XC9A 2HWTA 4OZ1A 5GMEA 2RSQA 5A6WA 3N5BA 3KLEB 4QPTA 1RTJA 3FGVA 2GO9A 3OR1B 4CO0A 1GX5A 3PJXA 4MIWA 4FPRA 4DS4A 1QE1A 3M30A 4URSA 2MJNA 2BX6A 4DV2J 2DNYA 3LGNA 2QLJB 4JI6J 3HVTB 2N3OA 4I2PB 2H9ZA 3PYEA 3JSRA 2HHQA 1TKZA 2W2QP 1PIEA 1IBMJ 4X2BA 4PG6A 4NX9A 3W64A 2XLIA 3SI8A 3MR6A 4B3MJ 3AAWB 5KG4A 3LALA 2KN4A 2MZRA 2B6AB 5BYQA 1U6ZA 4DL6A 4OX6A 3S01A 1DHMA 1I3OB 1Y0HA 4NI2A 2DR5A 4OI2A 2R7QA 2HGLA 4HI1A 3MD3A 1QAJA 2E9TA 3CD0A 3EZUA 2YKNB 3UCUP 2RDIA 3OXFA 1OIAA 3C16A 2A2DA 3W62A 1SC1B 3CIZA 2HHUA 2M52A 1F2GA 2BE2B 4C97A 2EFNA 2GHPA 1EZZB 3AD9C 5CAAA 1LFWA 2RAQA 1JLFB 2P8IA 3A3PB 1UVJA 3CJ2A 2YWHA 3CULA 2DBBA 2OFGX 3T1YF 3NL0A 1HWKA 1E6YA 1YITS 5T7LB 2LQ8A 3BYRA 2G0CA 1KQKA 2G2ZA 2HRYA 4ED1A 3SSSA 2G0IA 2UUBJ 2HZCA 1YGYA 1C0UB 1NNDA 1FWPA 1MROA 4UUXA 2DVIA 5C24B 2R42A 3G6YA 3HKZD 3DGVA 3NEKA 3H40A 2RRAA 4RNNA 4RJVA 2BBEA 3LO3A 4HDHA 2NCKL 5IT9Y 2B9EA 3QT8A 4PG7A 5CYJA 1UAWA 1U24A 2WSCC 1VC0A 2RJZA 2DNGA 4KYZA 1KTQA 4TU9A 3D66A 4Q44A 5HMWA 2OPQB 4WFYA 1XR6A 5KFUA 2EXUA 3G6XA 4A8FA 2QYCA 4ZS6A 3DOLB 2MKYA 5J2MA 1H98A 2NREA 1Q78A 1YRTA 3K5PA 2OPSA 4G1IA 2D9PA 3SYZA 1F9HA 4NMLA 4IRCA 3OW2R 4F36A 2HNZB 4NASA 4FF1A 1DQ8A 4FKYA 3MHYA 4DCOB 4RO0A 4A8YA 3V2UC 2VQFJ 1SUQB 1HI8A 1X5PA 3L7PA 1LWCB 5HMZA 1V3RA 3S8SA 1NJIT 4M5DB 5ETTA 3ETOA 4U7CA 2P9EA 5KFOA 1C1BB 4CRJA 4G65A 3M7VA 1L3TA 1QSLA 1I5OB 1NEEA 3TVKA 1C4CA 1RE1B 1WC6A 3G82A 5KOWA 5KFQA 4CO5A 4LSLA 2Q6CA 1J5OB 1RSCA 4LIRA 1HQEB 4ECYA 1S6UA 3D6MB 2RQKA 2DJWA 1KHVA 2YTCA 1S7IA 2OJ3A 4DR1F 2W4CA 1B0PA 2IM1A 2IRXA 5GADU 4FZVA 4DR3F 2YNIA 5D3GA 4X4RA 5GAEI 3Q8VA 3LTOA 3PKMA 3QJJA 3TZXA 5DG9A 5C2CA 2GO8A 1ROFA 2LXFA 1BQMA 1UW4A 2R7SA 5D6GA 1JLCA 3HSZA 5D4LA 1YJRA 2ZH6A 3W7BA 4Y00A 4R5PA 4LFBJ 3U1LA 2O67A 3AXMA 3PW0A 1WI6A 4WFAQ 5K20B 2ZH1A 4XTTA 2KTQA 2DH7A 1VQPS 1WDDA 3UD5A 5IXUA 5B0EA 1EAYC 1Q7YT 3MM9A 2XS2A 3H4BA 5BR8J 3KLGB 4KT0C 1RB0A 2VKZG 2OKQA 4QIFA 2KVQE 4FVCA 4LFAJ 1UZHA 1U48A 1Q53A 5D0RA 2GVDB 1KHWA 2CPYA 4I56A 3OVSA 5B0GA 4PPDA 1SKWA 3H4DA 1RHJB 5E33A 3M8PB 1IR0A 4B9MA 4OYXA 1HBMA 1CSJA 4ED8A 1T95A 1HI1A 2KH9A 1VLOA 3HD1A 2V8GA 3V6JA 2PD1A 1FRJA 5KT5A 3HT3A 3MFIA 5E41A 2I2YA 2RQMA 4R0JA 3BR8A 2HVEA 4MH8A 4DR6J 3MR5A 3PO4A 2DO4A 4NZ6A 1Y11A 4A4JA 1LWEB 2IC3B 3MM7B 1FDDA 1X5OA 3CCJS 2ZM6F 3LP0A 1H7WA 4KSEB 3C46A 2HQDA 4NYOA 4D3GA 3D5MA 2ZBPA 3LWLA 3FBFA 2NYIA 5HL7Q 2JRSA 4AT1B 4OLOA 3BDPA 3NGDA 2PA8D 5SUHA 1NMEB 3I0RA 2QG9B 2DH8A 2R2SA 4FS2A 2PO4A 3NS6A 5E2QA 4DV4F 2XS7A 2HFOA 1FFSB 4LUBA 2B8QA 2E7WA 2RF2A 3LP2B 2MQPA 1UWBB 2H5IB 3W9JA 3UVJA 3W8GA 2CA9A 3CEDA 1L3KA 1TQLA 3HVAA 4NLOA 1HQ2A 2BJ1A 2NS1B 2AGOA 4Q5VA 3RW6A 2LMIA 1S1VA 2WVBA 3RR8A 2HAIA 2QE5A 4X4PA 2KM8B 5CCLA 1X7VA 1U2FA 4BLGA 2OEJA 2WZ1A 1XMQF 3A4TA 2MGZB 5J2PA 3QWPA 3KLFA 3Q8QB 1J2VA 2E44A 5HP1B 2JLGA 2FY1A 1XIQA 1NJXA 2CAJA 2E5GA 1H3DA 4PABA 3CCES 2XEXA 1FFGB 4DR4F 1ZM9A 2EK1A 4DS5A 3ADAC 2DITA 3DI6A 1Y5IB 1UWAA 3ZNUA 2MHEA 3HHDA 2IM2A 4Q0BB 1HR0J 2QRRA 3H5UA 3A8EA 5D15A 4KTQA 1TP7A 3J7A1 3FCVA 2BQUA 2JH3A 4RPFA 1QLNA 1Q7LB 4XPEA 3OL8A 1OS5A 4F04B 4L72B 4BWMA 4Z2XA 3T1AA 4CTAB 3IXQA
chains in the Genus database with same CATH topology
3OPKA 1VRUA 3N5FA 2OTJS 2CQ2A 2MQNA 3MECA 1AW0A 3KJVA 4HT7A 4F3QA 1NK5A 2FHJD 2V94A 3X3UA 3DOMA 2E5LF 1OPIA 2FHOB 5HN0A 2ABYA 4HI2A 2YX1A 5C25A 2W24A 1IUJA 2RRBA 3MTKA 2YKPA 4I6YA 1YJVA 2GV1A 1RGVA 2R7UA 4HDGA 1TKTA 2YKQA 4U6PA 2B9XA 4R8UA 3V4IA 1I1GA 3IAM9 1Q86T 1FE4A 2ZOGA 1FJCA 3DRXA 3PXGa 2FUG9 3KHRA 2RQ4A 2DRBA 2IAJB 1SIZA 5EWGA 4MKYA 1DJ0A 3NRBA 2B7CB 4OHXA 4DLGA 3F73A 1HA1A 2A2CA 3OFEA 1RKIA 2KVIA 2OPPA 4CI0B 2DHAA 2ACYA 4WZMA 1ZBTA 2LEBA 2RT3A 2GJ2A 2I5JA 3CCQS 2HHPA 2MSSA 2YNHB 5A8KB 3MEGA 2RVJA 4QWCA 1VQMS 5KFZA 1RTIB 3IRXA 2GGPB 5GMKa 3PFEA 4DV7F 3CCRS 2OH2A 4OV1A 1UFLA 5KG3A 2JEIA 4QBUA 2JVOA 2ZFHA 3CCSS 3R1HA 2YNFB 3FEZA 1UA0A 1JNRB 3DLJA 3L09A 5F8IA 1SKRA 4USHA 4F4KA 2CVEA 3PW7A 3AJ2A 1YHQS 2L3MA 4JI8F 5IS2A 2K1RA 2WW8A 1VK8A 1Q82T 4ZHRA 4DJBA 4C11B 4ILLA 2EKYA 3R27A 2CQDA 4RW7B 2ZJQQ 2ZJRQ 4AL6A 3HFKA 1X9SA 2JEFA 1OWXA 2XSFA 4ZDNA 2E5IA 1K1SA 1MW7A 3K8WA 1GTHA 1NHUA 4FVMA 5MLCV 3VAKA 2NSBA 3HHLA 4BCAA 3M8QB 4K59A 1N52B 4O44B 2XBPA 1N6QB 2JC0A 3OSPA 5IM0B 4KJIA 3I82A 4OI3A 2XO7A 3C8YA 1QVGR 3GYNA 5KT6A 3ZZTA 3BQ1A 1TFYA 4MMOA 2XZWA 1HBOA 2UXDF 3HDSA 4TU7A 4HL9A 4X4TA 1ZH5A 2KI2A 2NR0A 3PY8A 1VQ4S 3M8PA 3BSOA 2Q6BA 2KT2A 4J9RA 1D8YA 2DD8S 4B3OA 3V4MA 2O3DA 3VZIA 3G4SS 1LFPA 2ZD1A 2BXJA 2CQ4A 2XWXA 2YKOA 4CH0S 1C4AA 2XWYA 2W9BA 4Q8FA 2KJWA 4XIUA 3V81A 1VFJA 4ZA1A 4ZPCA 2DCUB 4URQU 1S1XA 3OHAA 4ICLB 3BSNA 1H2UX 2RE1A 4TXSA 3GV8B 4IFVA 4NLQA 3P6YC 1FDAA 4TY9A 4KRWA 1DTTB 1YBAA 2DNRA 4ZPVR 1ZPVA 2JLEA 1R43A 3OFGA 3G6ES 4JI2F 1JKHB 4KV8B 1FKOA 1RDRA 4ZCKA 4MAKA 1EETA 4AXJA 4YP3A 3DYAB 4JI4F 1K1QA 2LQ5A 3ICLA 4BHQA 4DQQA 3AQPA 2BQRA 2KJVA 2LVWA 2MHNA 1REVA 1EP4A 4KGMA 1T94A 5KFMA 4K4TA 2WK4A 5KFTA 2PIIA 4RWWA 1K9MT 3JYTA 2J9EA 4JV2A 1FKPB 2WRMA 1B7FA 3M2UB 4I7FB 3UI3A 1VQ6S 2D9OA 4B17A 3MOJB 4DN9A 2DO0A 1G2EA 4KHRA 4F67A 3OFHA 3LWMA 2MXYA 1LWEA 5F41A 2AD9A 3E2EA 2IC3A 1NZAA 2NZ4A 3B78A 4J37A 3IGVA 3MM5A 3T9NA 4H4KA 1S6PB 2OP5A 3AA9A 1RT5A 2OTLS 3EPIA 4ZK7M 3DLBA 1TAUA 3FRYA 3NLCA 1UVKA 1FJ7A 3MURP 1UJ6A 4GKJF 3LAKA 4IQMA 3VQTA 4TY8B 2XMTA 3GIIA 1U1MA 1S1TB 2YVSA 2DCLA 2E1AA 2VUGA 1SKSA 4ZP6A 1IKWB 1BQNA 4MKAA 4ZPAA 3TVZA 4EBEA 1X4DA 3MMJA 1R8AA 3I87A 2CZ4A 4EBCA 3DRSA 4ZCIA 4NLUA 4FXWA 2WBRA 1NKCA 1AFIA 2VODA 3LP1B 5DDQC 3DOKB 5L9XA 2QA1A 1W2IA 2DHGA 3RRGA 2BV3A 1S99A 1X4GA 2B5JA 4PG4A 4WZQA 4OX9F 2NUHA 1RTJB 4JOUA 2D3ZA 5J2QB 4DSKA 4E0DA 3NWGA 4JI3F 3SCKE 7FDRA 4JI7F 1FESA 5I3UA 1FRHA 2HGNA 4X4NA 1HNIB 1YRUA 3K8VA 4WKYA 4V19J 5CYMA 4ALZA 1QE1B 1S0VA 3KG0A 1WACA 3M30B 4DR7F 3HVWA 4DF8A 1KOOA 3DRRA 2V0NA 4ZPWR 4GC6A 3KTQA 1RT7A 4URGA 2VFVA 3DXSX 3MEKA 3UPFA 3MFHA 4H54A 2FVSA 4WE1A 3ITHA 1V6HA 1NJZA 4ECXA 3DRPA 3NAHA 5J1EA 3JSYA 3IS9B 3OL7A 2R8IA 1M5PC 1UWBA 3IGNA 4RW8A 3CC2S 2OPRB 5B08A 2KU7A 5EUHA 4OZ5A 3KLIA 1DZ5A 5F8GA 2K8GA 4YR3A 2EWHA 2JFDA 2OMOA 1WF2A 1ELOA 1IKXB 2WB1D 3OL6A 2FC9A 4OZLA 1GXUA 3UR3C 4DDFA 4ZPTR 1Q8LA 2QA4G 3TVYA 2E29A 2AV5A 4KFBA 3O8WA 1GH8A 3QO9B 3TA2A 4ZPDA 1SH0A 2IHR1 3SEOA 4AL5A 3G9CA 3CJ5A 5KG5A 3RR7A 1M5HA 2DGQA 4FNHA 4OI4A 1RT3A 4MTPA 1SBRA 5GADI 4DV3F 1KVIA 4DV5F 4DV1F 2VKRA 5L1JA 4QW9A 1XNQF 2W9CB 2HHHF 4B9TA 1N32F 4JBCA 4PXCA 2W7PA 1R89A 2VQFF 4EZ9A 1LKZA 2OLWA 1X5TA 3J7YU 3KLEA 4P6QA 1CC7A 4OJ3A 1RT6A 4YOEA 1FDBA 4JV0A 2MGZA 3MAQA 2JOQA 4QWAA 2AYEA 2ZITA 3V5RA 1NK6A 3OR1A 4DV0F 4OJ1A 1FRLA 1LW2A 2DT9A 2IMOA 2B4PA 2QLWA 3BM7A 3ENWA 5DQIA 1UA1A 1ZETA 1TKXA 1Y5LB 1ZOTA 3G8QA 2DRAA 1R8PA 4NLDA 3BGRB 4FBUA 1LXJA 3FEYB 5GAGI 3TW0A 1WEXA 5K5MA 2B4UA 2V9KA 3DLGB 2J6SA 1KQFB 3NNAA 1S79A 1PC5A 5GAGU 1TL1B 1QUPA 3AH6A 4OI1A 2FIUA 3EGWB 3UE2A 5KT2A 5GAHU 2EFGA 2L9DA 3W2VA 3ZFVA 3EGZA 2M88A 3QLHB 1WG5A 4TLQA 1AUDA 3I5BA 4FF2A 2FB0A 3HVTA 4O3NA 3PVXA 3PW4A 4RBUA 3M6XA 4TNOA 3KG4A 5G0RB 1KC8T 1HARA 3MM8B 3MWBA 2MKSA 5B0FA 4QIGA 4L6V3 1HHSA 2C42A 4XK8C 3MEDB 3T19A 2UVUA 1DLOA 4FXVA 2PI4A 4AL7A 2DNZA 4HEA9 1RK8A 3NMRA 4ETZA 4TYBA 2GX8A 2BA9A 2HNDB 1S1UB 5KTQA 2CVIA 2KFNA 3FSXA 2ASJA 1XR7A 4NLYA 3LOUA 3M2RA 3OXLA 1MU2B 1E6YB 4NLTA 1TKDA 1SV5A 3U1MA 4QIWD 2YNGB 2V2KA 1QJHA 3JB9k 2LEPA 3DHWC 2JZ5A 2VBXA 1RTDA 1WHXA 3MPYA 3C6UB 3T3FA 1Y4ZB 3TA0A 4EO6A 5AE3A 3H2VE 4H4MA 4B02A 4F3MA 3THVA 2HNYA 2F8HA 2UUWA 3THTA 1GTEA 2BUNA 3DGPA 3T5JA 2OMLA 1FCAA 1R8CA 3DU6A 2IVMA 4H4OA 4EYHB 2VG7B 1NJWA 2XMUA 2CQ0A 4TLRA 2UXCF 3QIDA 2YQ3A 2CPJA 4LVOP 1FJGF 1MROB 5LXRA 2FJAB 4RW9B 4QU7A 4NPOA 2CIMA 3PRBA 4IR1A 2CPHA 4CTAA 1URRA 1VC6A 1S6QA 3HJFA 1Y5NB 3RW7A 1S49A 5DJBA 3TQ1A 4DG1B 3I32A 3QPIA 5LJ3Y 4RKUC 2ERRA 1HBUB 2XMKA 4GO7X 4Y6IA 2Z2MA 1HD0A 2R8GA 2Q1LA 3IAS9 2BE2A 5KG1A 2IA0A 2P9GA 2RS2A 4OHYA 4LF8F 1FERA 3HP6A 1TUVA 3F44A 3GYXB 1QSYA 5KFVA 2HLTA 5F9NA 4WTYA 1HNVB 4O4GB 3T6JA 2MJUA 3CDAA 5KFGA 4QZVB 3FZ2A 2AP6A 4EUVA 4N76A 2BJDA 1Y00A 3OV7A 2M9KA