2O3DA

Structure of human sf2/asf rna recognition motif 2 (rrm2)
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
113
structure length
113
Chain Sequence
MAPRGRYGPPSRRSENRVVVSGLPPSGSWQDLKDHMREAGDVCYADVYRDGTGVVEFVRKEDMTYAVRKLDNTKFRSHEGETAYIRVKVDGPRSPSYGRSRSRSRSRSRSLEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Splicing factor, arginine/serine-rich 1
publication title Structural and functional analysis of RNA and TAP binding to SF2/ASF.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 11
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 2006-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2o3dA01
3IRWP 1U1MA 2KH9A 1U1PA 3VAFA 3HHNB 2M8HA 2DNPA 5ITHA 1HL6A 1X4DA 5CYJA 3CCMS 3VAKA 2X1BA 2KG1A 1YJWS 5JVHQ 2FC9A 2MHNA 3DLLQ 1WI6A 1JJ2R 2I38A 2LA4A 3P6YC 3CCQS 1VC0A 4Y00A 2DGOA 3THTA 2BOPA 2F3JA 2CPEA 5GMKa 2RVJA 2F9JA 1O0PA 1XN9A 1OO0B 1FHTA 1NU4A 3G8SA 2MZ1A 3VALA 1KC8T 3NNCA 1X4AA 2DNMA 4UY8T 3NS5A 2VOPA 1FJEB 2E5IA 1WG5A 2CQDA 2YH0A 2DH8A 2MQMA 2X1FA 2CQCA 2DGUA 2G4BA 5IQQA 2DB1A 2CQ4A 2KU7A 2DHXA 3P49B 2LKZA 3BEGB 2VOOA 3CC4S 5IM0A 3MD1A 3UCZP 2DNOA 3VAJA 2LMIA 2MB0B 1HD1A 2M9KA 2DNQA 2AD9A 4CH1A 3THPA 4ED5A 4C7QA 1QVGR 2VODA 2XNQA 1U6BA 1X5OA 2DHAA 2L08A 2LQ5A 2MQLA 5DDOC 1N8RT 5GAEU 5HO4A 1WHVA 1ZH5A 1X5PA 2FY1A 3VAIA 2XS7A 2DNYA 1WG4A 3MD3A 2DHSA 2DNGA 2CQ1A 3PIPQ 2OTJS 1VC6A 1OIAA 2MQOA 4PR6A 2LXIA 2XB2D 3OW2R 2SXLA 3G9CA 1WHXA 2M70A 3RW7A 1K8AT 3U1MA 4TU7A 1UP1A 2DISA 2PE8A 3MDFA 2DGWA 4F25A 2DNLA 2DITA 2DGQA 2EK1A 1SJFA 4CQ1A 1U2FA 3CULA 1JJ4A 2DNNA 4WFNQ 4LJMA 2RU3A 2EVZA 2GHPA 2QFJA 1WEXA 3UD3P 3V4MA 2LXUA 1WHYA 2LYVA 1U1RA 4J5OA 2DGSA 3ULHA 3LQVA 1FT8A 3CF5Q 1HA1A 1R8HA 1W2BR 2U1AA 2J0QD 2KXNB 1BY9A 1Q86T 4C0OC 2DO0A 5GADU 3P5TL 4IUFA 1X4BA 2KM8C 2OJ3A 2DIUA 5GVQA 2MGZB 1QVFR 4IO9Q 3TYTA 2RRAA 1SJRA 1YIJS 2XS2A 3Q2SC 3EX7B 3R27A 2G0CA 5HL7Q 1YI2S 1WTBA 3CC7S 4Y0FA 1WF1A 4WFAQ 2MKCA 4RU2A 5DDRC 3G71S 2XS5A 2M2BA 1U1NA 3MXHP 2DGXA 3US5A 2KG0A 1H6KX 2V94A 2KRBA 5FJ4A 2MKHA 1HD0A 1SJ3P 1VBZA 3G96A 1IQTA 2CQ3A 4M5DB 3JB9k 2MKSA 2MSSA 1M5VC 3K0JA 3BS9A 3BO3A 3CCRS 3SXLA 2MZJA 2ADCA 1M5OC 4QU7A 1A9NB 2YKAA 3G8TA 2ADBA 1VQMS 1ZZFA 2X1GA 2MKJA 3CCVS 3ZZZA 2XNRA 3B4MA 3HI9A 5D77A 2RQCA 3NNAA 2MJNA 2MZTA 3S01A 1CVJA 2MKIA 5LXRA 2FC8A 3S8SA 3S6EA 4TU9A 1QM9A 2N3LA 3H2VE 5GAGU 2I2YA 2JVOA 2AYMA 5LSOA 2M8DB 2K3KA 3I56S 1WEZA 3UE2A 1N54B 1M5KC 2B0GA 2RQ4A 2E5JA 2A3JA 2G1DA 3CMAS 1PO6A 1VQ6S 5CXTA 2DNHA 3B4DA 1H2VZ 1DZ5A 2Q79A 3U1LA 1M5PC 2EK6A 2NLWA 3NS6A 1VQ4S 2MZRA 4W92B 1SXLA 2JWNA 1D9AA 2KYXA 1X4EA 2KM8B 2CPJA 2MZQA 2DH7A 1KOHA 1U1OA 1YJNS 3UCGA 4ZKAA 2DO4A 1VQ5S 1VQLS 1P1TA 1VQOS 3NMRA 2MQNA 2BZ2A 3UWTA 4PRFA 1VBYA 2MY7A 1P27B 1U1LA 3CCLS 5IM0B 1S72S 5BJRA 2U2FA 1DBDA 2HGLA 1WG1A 1X5TA 2JRSA 2K8GA 2OSRA 3SMZA 3TP2A 3MUTP 2ZJPQ 2QEXS 2XSFA 2DK2A 2PEHA 3MI7X 5EN1A 2KVIA 1YWXA 3ZZYA 1YHQS 1VC5A 1FNXH 1JJHA 3NNHA 1VQ7S 2KHCA 5DM7Q 1FO1A 5CA5A 4OZ1A 2KT5A 3CTRA 2YTCA 2KXFA 2KRRA 2YH1A 4W90B 1WWHA 4QQBA 2HVZA 1PGZA 3P3DA 4Z2XA 2L41A 5JVGQ 4TLQA 2VONA 1WI8A 2UP1A 2CPDA 2D3OR 2HYIB 4F02A 5IFMA 1M1KT 1H2TZ 3CMES 1Q82T 1WF0A 4WIIA 2MKKA 4OZ0A 3EGZA 2MY8A 1DRZA 4U67Q 3CCUS 1NJIT 2LCWA 3EGNA 2ZJQQ 2DNKA 1X4FA 1F9FA 2CPFA 3BO2A 1KQSR 2M52A 2KN4A 1B7FA 2MQQA 3CCJS 2LEAA 2N3OA 3VF0B 2OIHA 2AYBA 5D78A 3CUNA 4WFBQ 1KOOA 1UFWA 2CQPA 1U6FA 1OPIA 2KI2A 3L3CA 2J76E 2J8AA 1R8PA 2AYGA 2DGVA 4YB1P 3MUMP 1KD1T 2OTLS 4A8XA 2N7CA 1FJ7A 1ZZNA 4FXVA 2MPUA 3CXCR 1VQPS 1K9MT 1M90T 1RKJA 1YITS 2RS8A 4QPTA 4IOCQ 3CD6S 1UAWA 2O3DA 4CIOA 2OSQA 2CQ2A 2DIVA 2FHOB 3H2UB 2JVRA 2MXYA 2HZCA 4BS2A 2E5HA 4PKDB 2CPZA 1WF2A 1VQ9S 1Q81T 2CJKA 2CQBA 2N82B 1SJ4P 2CPXA 4P6QA 3SDEA 3TO8A 2M0GB 3D2WA 2CQGA 3IWNC 4YUDA 2L9WA 2CPIA 2RRBA 3BO4A 1X4CA 2CPHA 1D8ZA 1WELA 5LXYA 2HGNA 4TU8A 2E5GA 1UW4A 2DH9A 2ERRA 3MOJB 3VAGA 2RT3A 2MJUA 1YTYA 2LEBA 2YWKA 4WF9Q 2CQHA 1RK8A 2MQPA 4C4WA 3N9UC 3FEXB 2E44A 3CPWR 4EGLA 2M4MA 3S7RA 4LMZA 1X0FA 1VBXA 1NO8A 4YOEA 3J7ZT 3G4SS 1X4HA 1YJ9S 2CQIA 3MURP 2X1AA 1FJCA 4F26A 1N52B 3CC2S 2AYEA 2KFYA 3SDEB 3UD4P 2WBRA 5DM6Q 3I55S 3PIOQ 4V19X 3R1HA 1URNA 2RUGA 4ERDA 2FPHX 1JMTA 3CCES 2MYFA 1WEYA 5DETA 4QU6A 2JX2A 5LJ3Y 3VAMA 1H2UX 2M7SA 1SJQA 2NZ4A 2CQ0A 2F9DA 2LECA 2MMYA 2D9OA 3Q2TC 1Q7YT 3VAHA 2QA4S 1VQKS 3LPYA 2KXHA 2GO9A 1L3KA 2D9PA 2MGZA 3CCSS 1X5SA 2CPYA 3MUVP 2DNZA 1N88A 1G2EA 4CH0S 3DXBA 3R1LA 5H1SV 1U1QA 2MSTA 5DDQC 1OWXA 3UCUP 1FXLA 5DDPC 5MLCV 2DNRA 3FEYB 1U1KA 3RW6A 4UQTA 2J0SD 4WKRA 1A7GE 3G6ES 2HGMA 1DHMA 2DGTA 3J7YU 2MZSA 4WCEQ 1S79A 2RS2A 1VQ8S 1WHWA 2DHGA 5LJ5Y 2M88A 4LIRA 2LA6A 4FXWA 5LSLA 1X4GA 5GAHU 4IOAQ 2RNEA 2ZJRQ 1K73T 1AUDA 1VQNS
chains in the Genus database with same CATH superfamily
2VIHA 1YRUA 1S6OA 5CYJA 4NPOA 4NCBA 1TZ0A 2RHQB 4OJGA 2BE7D 3VR1A 3I31A 1TL4A 1J27A 4A8QA 3G8SA 1OY8A 2X51A 1F9HA 2A1BA 1BWEA 1ULRA 3ISZA 2YH0A 3VHQA 2B7BB 3FDSA 3E51A 2AKWB 1RBOB 2JC0A 1XNRF 5K8PA 2ZBRA 1J5OA 3KLFA 3KFWX 3K5NA 2LMIA 4ED5A 4X64J 3KKFA 1H74A 2ZD1B 2MQLA 3KJNB 3HSZA 1WHVA 4GRSA 3M9NB 4FKYA 2XSJB 4KPCA 2FY1A 3OL7A 4OJ1A 1N6QB 4CWBA 4YS2A 1WDTA 3EICA 4X66J 1YJVA 1NK7A 2ZWOA 5ETLA 3ILOA 4DUZJ 3UR3C 2RDJA 2I0XA 3TA0A 3OT9A 2HW3A 3CWJA 2JSXA 4O44B 3AT1B 4KHMA 1KNZA 1X9MA 5HVHA 3IFEA 2DNNA 1NSPA 2GJFA 5L39A 3AD7C 4RKUC 3M1VB 4FPRA 1GTEA 3DLJA 1DURA 4NX9A 1XNQJ 5IV3A 3HZGA 3R2DJ 2YWHA 4EEYA 1BY9A 3HSGA 3MM6A 2FYXA 1GMUA 4J9PA 3O6QA 2CDRB 2FGOA 5C2GA 5ETMA 3C6UA 2E1RA 5KAKA 4UOHA 1VJWA 3PM9A 5EHHA 2XCPA 5DDRC 1EARA 3BPDA 3LP0A 4DF4A 4I6AA 4NI2A 2J0WA 2F65A 2J6UA 3ZZRA 4PUOB 1KHVA 2C1EB 1T9YA 4OYMA 3DN9A 1XNRJ 2HQCA 1NPRA 2X1GA 3DNCA 2Z4PA 3FCVA 3HI9A 3GR1A 1CVJA 2EFQA 3S8SA 4F2RA 2QLXA 3IWLA 2OELA 2PMWA 2YX4A 2E7XA 1VQ6S 5CXTA 1F1BB 4ID5B 4OX9J 3B4DA 1H2VZ 2E66A 2PD1A 3W63A 3NS6A 1NXIA 2W8LA 3QQCD 3UNGC 1JB0C 1RA6A 1JJCB 3UQSA 4YDDB 2MQNA 2WOMB 2MY7A 1S72S 1T9WA 1RWWB 1X31C 2JC1A 3HJVA 3SQOP 3HFKA 4NCAA 1YJRA 1YWXA 4O23A 4OZ1A 1RWPB 3M6VA 1VLOA 3M2VA 2KRRA 1EQ0A 4DSLA 3I0RA 4DR3F 2N7YA 2ZH8A 4N56A 2IM0A 2CPDA 4JUZA 5IT4A 2OI2A 1PCAA 1Q8LA 5KFBA 4I67A 4J9KA 5HI7A 2ZZTA 2ZJQQ 2DNKA 1TKTA 2R8HA 3IS9A 2F8HA 4OYWA 1S1VA 3IAS9 2BANA 2ZH1A 4K0KF 3CUNA 5B09A 2AP6A 2BR0A 2J76E 4L76A 1RWNB 1OS5A 2ZC3A 5FIIA 1CS4A 2W9CA 1UAWA 4F0MA 3LO3A 4WFYA 4G6VB 1WF2A 4K4ZA 4IR9A 1WKKA 4URQU 2QA4G 4P6QA 1RCOB 3UN5A 4DFKA 1L3UA 2VKRA 1XEZA 4PWDB 2QFIA 3KLIB 3DCAA 1ZPVA 1DTTA 3HT3A 3BV8A 1Y9OA 1U47A 3QGGA 1T9VA 1X0FA 1DFDA 3MM5B 3TZYA 2LU2A 5K8OA 4DV2J 2D3UA 2PMZD 3CC2S 3E01A 3GP9A 1T94A 4X4TA 4DR3J 1CG2A 2NSBA 3HKWA 4GMKA 1IM4A 4HACB 3FEZA 4K2XA 2GAGC 3N5FA 2D9OA 3B78A 5J1NA 4LF2A 3ILLA 3J7A1 1EP4A 1TL7A 4B02A 3M32A 1OWXA 3I0SB 1FXLA 3CVKA 3R5GA 2CVEA 4UQTA 2Y1LB 4WKRA 4B3OA 4LR8A 4U7CA 2MZSA 4WCEQ 4TYBA 4YB5A 2HLUA 4IOAQ 3U1NA 3M05A 5AXNA 2NXNA 4AL7A 4C11B 4CLZA 1U8WA 2ZHOA 2FJEB 3CCQS 1AT1B 3EDRB 3IRXB 2RQKA 4OZ2A 3GIKA 3SEOA 1F2HA 2R2UA 3GYXB 2NS1B 1C4CA 2B8QA 2F4FA 2X1FA 1YZ7A 2YNIA 3VZIA 3WHIA 4EMDA 1RSCA 3MD1A 1JQGA 4CH1A 4CTAA 1QVGR 2RD5C 2GMHA 4DV6J 3TWZA 3OPKA 4MK9A 3E8OA 3RBXA 3H5UA 1S1TA 4CCHA 5DQHA 3Q8UA 5AE2A 1I1GA 4F25A 2DNLA 5LL6d 2EK1A 3M2RA 3D68A 3DLHA 1LW0A 3KK1B 3I4PA 1PG5B 4ZVRB 2ASLA 1WKLA 4KFBA 4E98A 3MCSA 2FJVA 3U27A 1FT8A 5KFEA 1RUSA 5F41A 2H5IB 1EETB 3D0IE 3SV4A 4B9LA 5B0BA 2KXNB 2IYIA 1QAXA 3E3XA 3NGUA 2RKIA 1YG0A 5GADU 3PW0A 2OJ3A 1WSRA 4I2QA 5B0FA 1F3VA 3ITHB 3SCLE 4ID8A 2W01A 2HHXA 4OZJA 1YI2S 4F0HA 4DL7A 1RT3A 2IM2A 1LXJA 2VQEF 2YNFB 4XDDA 2DGXA 5ETSA 4NLTA 2AZ3A 3FZ2A 3GYNA 3L7UA 2CQ3A 3RB3A 2MTLA 1WC5A 2MSSA 2XY7A 1TAUA 4IG0B 4K59A 4UTGA 3B4MA 3ZTSA 1YQHA 1R6VA 1FRLA 3KLHA 4DHVA 4USWA 3M8ZA 4PWWA 3W66A 2CUYA 2OO4A 1H73A 4I7FB 1QY7A 3NOGA 5HROB 4K4VA 2W7OA 4USIA 2HMIB 3V6HA 1TL5A 1VBYA 1P27B 4C8OA 2GVZB 3TR5A 1M5HA 1TMJA 4C48A 4FF2A 2VG5A 2PEHA 4PAAA 3D67A 4GVLA 2DXDA 1YHQS 5CZVA 1MROB 4UZBA 3LPEA 1VHIA 2HK2A 5IC4B 2WSFC 3DLEB 3ZTOA 1LWEB 3LH2S 3A12A 1M1GA 3A1YG 1U7LA 4B9VA 2IDEA 1S0OA 4O4RA 3DRYA 4ED6A 2P6TA 4D3HA 2WONB 2VQEJ 2DEJA 4U67Q 3RB6A 2GCFA 3ZO7A 4X4QA 3PO5A 1Y5NB 3MCOA 3HT0A 3FSIA 4J9NA 3RBZA 3CCJS 4EBCA 2LEAA 4OMFG 4LT6A 3DMJA 3TNVA 5HMZA 3V6DB 1FF2A 1BQNA 2MDAA 2IMWP 2MEWA 3FKBA 3TEHB 4U7UK 3MAAB 4QW8A 1TK0A 1HR0F 2GQ2A 3CXCR 1YITS 2RS8A 4PXDA 1JXLA 4IOCQ 1E6YB 4OYPA 1JXEA 4OYZA 2P9CA 5CQGA 1FKPB 4ZP9A 4YR2A 2HHQA 2GNKA 1Q81T 1FRJA 1IWGA 2CJKA 8ATCB 3HMJG 3EVMA 2RDDA 4NRUA 1T9XA 3IWNC 3M8PB 4X2BA 1HBUB 1X4CA 2ZH2A 1D8ZA 4RW7B 1FRMA 3L9ZA 1RHRB 4O0NA 1JLGA 3HFZB 1NO8A 1WTFA 1X4HA 5B08A 3A8EA 4F26A 1REVB 4YN3B 3OFFA 1EKRA 2L3MA 3PIOQ 1PYTA 5AXKA 3ZFVA 4K50A 1YKWA 2FZGB 2R7OA 1SJQA 2GHWA 3J7Z5 1F0XA 5C42B 2MGZA 2OFHX 4C8MA 3DXBA 3K5PA 4O3QA 2QYGA 1LWFA 3FEYB 2B6AA 1RI7A 4JI6F 5M2RA 1L3VA 3IGVA 1QTMA 3CCTA 2R2TA 2A10A 2FUG9 3TVZA 2B7CB 5ETNA 1HR0J 5CD4A 3HF5A 3BGFA 1UKUA 4ZLJA 2DPJA 4IH6A 5T14A 2B5JB 1RTZA 1WNEA 2PO4A 2GQQA 2ZE2A 4AD6A 1IR2A 4CLUA 1BXNA 4IFYA 3ISNC 3KK3A 1CJUB 3K17A 4Q5VA 1C0UA 1ZAVA 3QO9B 2V8VA 3MEGB 2W2OP 3TW0A 2G4BA 5L9XA 2CZ4A 2ALZA 2LKZA 2WVFA 4IKAA 1AUSL 4RZRA 1V9OA 2DNOA 2HVEA 1K0TA 4N7TA 2IYGA 2LQ5A 5DDOC 1FNMA 3LW5C 1RHMB 3SI8A 1JLAA 2GIQA 5KFQA 3PFOA 2BYCA 1G4CA 1OIAA 4PR6A 3OW2R 1WHXA 4RNNA 4UOGA 3TJ9A 2HQ3A 2DISA 4JI5J 4CYUB 1OPZA 4JI6J 2BE2A 1HQUA 3GSIA 4X4PA 4ZVQB 1EHWA 4NLQA 1JLFA 1CJKB 2FIUA 3H5YA 4C8NA 4ZPVR 1S99A 1HNIB 3FSYA 4LF4F 1S10A 1NHVA 3DYAB 1QAYA 4UF4A 4C0OC 1X4BA 4DL6A 4IO9Q 1X7VA 4F8RA 4QYRA 2G0CA 2GMLA 3G71S 2ZH3A 1X9SA 1B0VA 1SKRA 4WTYA 1IQTA 2EI5A 2VG7B 4JI3J 2P9EA 1HHSA 1F5AA 1JLEB 1ZPWX 2KZZA 2XHWA 3BQ2A 2YWGA 1ZZFA 2GQCA 4RNFA 5DJBA 2XNRA 1JLBA 2J9EA 4IDKA 4Y2KA 2MZTA 5C25A 1QM9A 2N3LA 1GQEA 4OV6A 3B8HA 3KJVA 2V69A 5EWFA 1DZ5A 1U2CA 3O2IA 3GZ7A 2CPJA 3M30A 5J2MA 4EO8A 5IC6B 3DKDA 4L72B 3TP2A 2XSFA 2I5JA 2C22A 2ROGA 5THWA 4TY8A 5D4NA 1P6TA 1RT4A 1DJ0A 5KT4A 2ZBPA 1VLYA 4QQBA 3DDKA 5K5MA 2AGQA 2VONA 2D3OR 5IFMA 1PJ6A 1DRZA 4RBTA 2YKMB 4OV1A 2VG6B 4NXMJ 2VPZB 2ROPA 2ZEJA 2AYBA 2G2OA 4I1TA 3KLEB 4YB7A 2KI2A 3NGRA 4N8NA 4ANDA 2HAIA 2DGVA 4JP8A 2AT1B 2IAJB 3K8VA 5I3UA 2OTLS 4MTPA 1WD6A 1C1CA 1GXLA 2N4DA 3WQPA 4LRDA 2DR8A 2MXYA 2FVCA 3I9ZA 3CGIA 3OXLA 3KK2B 4DR2F 4W98A 1PJ7A 1MMNA 3MOJB 4F36A 4B9NA 4ZLPA 4KGVB 3PG9A 4B9SA 3C15B 3IG1A 4EGLA 2HHPA 1HPZB 2XYHB 1SQFA 4J37A 1KQKA 3PW4A 2JEIA 3UD4P 4A4JA 1RTHB 1NK5A 3G6XA 3HULA 2DY1A 3NS7B 4LVNP 4ETZA 2C2NA 2M7SA 4ED4A 2A6MA 1Q7YT 3JSBA 2GO9A 4DV0J 3CCSS 2ZNYA 3H20A 1RAIB 3CD0A 2QL9B 3UCUP 3AOCA 1VFJA 3V4IA 1CJTA 1AW0A 1P8GA 3HLUA 2KL8A 2Q3PA 3A8KA 4LVOP 1VR6A 1Q16B 1JIHA 4DG1B 1UMJA 2DR7A 1HNXF 4FXWA 1Q7LB 2XI2A 3NWRA 3FK4A 3PV8A 1U1MA 3VAFA 1UVIA 4MJKA 3KDNA 1B0PA 3ELHA 3HP6A 5FDLA 5L1IA 2C2ZB 4DR2J 3P6YC 2BOPA 3AY0A 5GMKa 4ZA1A 2F9JA 1XN9A 3SCKE 2UVUA 3KNAA 2OGUA 3HD1A 2VOPA 1SIWB 1SC3B 2YKNB 2W2NP 3DLKA 3MM8A 1I51B 3PNIA 4USUA 1TK5A 4K8RA 4IH5A 2VOOA 1T05B 3NGSA 4IR1A 3THPA 1D1UA 3DRRA 3DOLA 3RTVA 2VODA 1UEVA 1HARA 3W3SA 4OIXA 3EXYA 2FGCA 2E9RX 4WK3A 1FVSA 2BJ1A 4C8KA 4QWBA 4G1IA 3CJKA 3PIPQ 3K59A 1SUQB 5J2QB 4FYWB 1N5VA 3OTDA 4ZOSA 2M70A 5CABA 2CIMA 4DOZA 4CLYA 1HMVB 1AXQA 2A2DA 5G0RA 5HMWA 3LGNA 1N32J 1F5CA 2W9AA 1UZHA 1S6QB 1HNXJ 4JI2J 1WEXA 3BH7B 1U1RA 4B3MF 1W26A 1R8HA 3I5BA 4DUTA 4F7VA 1Y3JA 3BSNA 4C98A 2EFVA 4WXOA 1T3OA 4BC9A 2VKZG 4GKKF 5GVQA 4CO2A 4DR4F 1BE4A 4XTTA 2VPWB 1GFWB 2EWHA 2C3MA 1RTJA 4ZP8A 5D6GA 4X4RA 2XS5A 2PGCA 1RISA 2RH3A 5H9FK 3HZEA 3NBPA 3BGOP 3DLGB 5EX0A 4MT1A 1RT2B 4QU7A 3D7SB 1O51A 1H7XA 2ZOGA 1SKSA 3CCVS 5D77A 4HTIA 1MU2A 2CA9A 4H54A 3BKTA 5LSOA 3LP0B 3UE2A 3T1HF 4NI2B 2FVPA 5KTQA 3BQ0A 1BLUA 4ICLA 5C5JA 2V68A 3MMAA 1KVIA 2NLWA 4Q0BA 5B0CA 4NASA 3H90A 2IM3A 1UFLA 1TL1A 2Q6CA 3NMRA 1RAJA 2KFNA 3LA0A 3UFCX 1T95A 3NXZA 4B3MJ 2E9TA 1KVKA 1FDDA 4R0EA 1YZ6A 4QR0A 2XWXA 3AJ2A 3LANA 4I2PA 2V9KA 4X4VA 4P73A 5KFVA 3UDEA 2OLWA 2YTCA 2Y0BB 1U0SA 1RE1B 5HANA 4X65J 4RX6A 2CZ9A 3M6XA 2DRAA 4WIIA 2GV1A 3OJSA 1YDLA 2HEKA 4J91A 1B7FA 2OIHA 3FC9A 4JV5F 3PHEA 5HQMA 1NH8A 1U8SA 1OPIA 1R8PA 4LUBA 3MUMP 1VIXA 4B3SF 1L3SA 3AJDA 5K8MA 4RNHA 1IBKF 3T1HJ 2ZD1A 2JVRA 2HHHJ 1K47A 1NKCA 5BYSA 1K1SA 2N82B 3ZTQA 2XSJA 2CPXA 3PACA 5E2QA 1R0AB 1N6QA 2IM1A 2CPIA 3JAMU 3KMSA 2ERRA 2AIRB 2D3O1 4O44A 4WF9Q 1RWMB 2ZH4A 3FEXB 2XQCA 1HNZF 4P9SA 3S7RA 2ZZNA 4H4KA 4NOHA 3KHGA 2Y1JA 4PG6A 1KDNA 3M1VA 3IC1A 2UVRA 5IT9U 3UD5A 3BSAA 1GNKA 4JV1A 3SFGA 4FVCA 1S12A 2NZ4A 4X4UA 3TVKA 3N6NA 3H0PA 1URRA 3JYTB 4S0MA 4UZCA 3IAM9 4LRAA 4CM0A 4V19J 5DDPC 1UCNA 3HKZD 2DNRA 4JV5J 1PKUA 4A8FA 1E6VB 1UJ5A 3H7HB 2L9NA 1CULA 3FCHA 2LQBA 4PUOA 5HATA 1OYDA 5GAHU 2FHJD 1VYAA 3IM8A 1IBKJ 1T03B 5ITHA 4ZVSB 2XHCA 3M32B 1IJEB 2HNZB 4M95A 1HI0P 4KJIA 3IN5A 4CZCA 5A6WA 4Y00A 3GONA 3POTB 3THTA 2XCAA 4N47A 1YBAA 2GVDB 1VK3A 4ID5A 3VALA 4CLWA 3M6WA 4WYLA 4F0KA 3THVA 1NZ8A 5A8WB 2IC3A 2XZTB 5KFFA 3GV8B 1HNZJ 2GO8A 5DO2A 5IQQA 7FD1A 3GE9A 4R25A 2WOMA 2G9OA 4OYOA 1S6PB 4AL6A 3CC4S 2L48A 2QGFB 4TVAB 4YFUA 3CDAA 2L08A 2UUCF 2AGOA 4OI2A 1UVJA 2ZDPA 1RHJB 2VC0A 2DD8S 2YNIB 3RW7A 3PY8A 2VD3A 2PE8A 5KG2A 4FNIA 2AJ4A 3JS9A 2VA3A 2PI5A 1JJ4A 3H98A 1ICEB 3AH6A 4DV1F 2B43A 1EX8A 3DGVA 1WHYA 1FKOA 2G2ZA 4DMZA 2DGSA 3D1HA 3PKYA 3LQVA 1O6XA 3NGDA 4YDXA 2FHJA 2UVVA 1NPKA 3I9V9 1PAUB 3M2RB 1WC1A 2XS2A 1TKXB 3PZPA 4NCGB 1R27B 4USHA 4ILLA 4OI1A 3PO4A 3AFGA 3MXHP 3J7YI 4DV7J 4Q43A 1QSSA 4PXCA 3WC0A 5FJ4A 5ETTA 1VBZA 3GJSB 4K2JA 2LP4A 4PWDA 3H5SA 2O01C 3T1AA 5BR8J 2C3PA 3KLIA 1MG7A 3CDEA 4FP9A 5L9NA 2W4DA 4I2QB 1RYRA 1FRHA 2YKAA 2RDIA 2UUCJ 3BN7A 3SCIE 2PEBA 4CO0A 3QFHA 5DG8A 2KZMA 4NZ7A 1UWAA 2L9DA 5E0OA 4HACA 2J6SA 1LW2A 1X0PA 4IG3B 3GFHA 1KOHA 2EBGA 1ZTWA 2CDQA 4DV1J 3FQLA 3I0SA 3KLHB 1RAOA 2U2FA 2JRSA 2QEXS 3M4XA 3PVXA 4YY3F 1RXOB 5CYQB 2KHCA 4KIAA 3Q8YA 1OSDA 3CTRA 4DV5F 1FDAA 1SB6A 4LSZB 2W7PA 4YP3A 3Q22A 3CMQA 1SKUB 4Z7CA 2GX8A 4C11A 2MY8A 3RGIA 2LCWA 3EGNA 1ZAXA 3VGSA 2R2SA 3IRXA 2M52A 3QSYB 3MPVA 4BBYA 3CJSA 1PC5A 4OJHA 2CQPA 1RHKB 3L3CA 3OTEA 4J9RA 3M6UA 3KHLA 3QIPA 4PXBA 2JHEA 2NQPA 5GAHI 1ZM3A 2VBXA 3SBMA 2C2RA 2FLPA 4LF8J 2F63A 4FXVA 2YY3A 1KLMB 1RKJA 2JLFA 1C4AA 1TV6B 2UUBF 4CIOA 2DIVA 1WSVA 4OX8A 4DF8A 2OPQB 1XMQF 4Y2MA 3W2VB 1SJ4P 4C2MA 1B7YB 3TO8A 1YRTA 4P52A 5DG9A 1Y7PA 4DLEA 3J81U 4RL1A 5C7PA 3OHBA 4GVBB 4OJ3A 1FX4A 4HT5A 2MQPA 1VBXA 3KK1A 2F4VF 4WK1A 2GHVC 1Y4ZB 4Y6IA 4DV5J 3IBFB 2Z8QA 3BBCA 3AOBA 1VIOA 3HO1A 2C28A 4BDPA 1EETA 1BC6A 4OQJA 2K2PA 4C97A 1RYSA 1C2PA 3SQGB 2ZH9A 4P2FA 1FA0A 5IXUA 2KXHA 3ITHA 3O8WA 3DDNA 1M5SA 3K5MA 3VVTA 3ZZOA 2YNFA 2HKEA 3EUNA 2UVWA 4NZ0A 4KGKA 1HIYA 3G86A 1EIYB 2UUBJ 4IG0A 2RQMA 3N28A 3VAKA 2W7AA 2UXBJ 2CRLA 1LWFB 2MHNA 1J5EF 1XMQJ 4DZ6A 2AJQA 5KG5A 2LA4A 2IIHA 2CPEA 3L7PA 3O3LA 2BKNA 4JOUA 3KJQB 1FHTA 4UY8T 4I7FA 1U02A 1BQMB 3I6PA 5HROA 2IY5B 3MFHA 5E3QA 1F2GA 5F8MA 2NREA 2CQCA 2HMIA 2F4VJ 4X4OA 2BRLA 4PYDA 4U9RA 3HHEA 2AX1A 1FRKA 3UO0A 2GVZA 3UCZP 3AA8A 2B8PA 2DHAA 1N8RT 3PW7A 3AAWB 5ETKA 1ZH5A 3O5TB 4ECXA 2QMXA 1KFDA 1MROA 2VC1A 4M5HA 3VAIA 2HNYB 2HVHA 1WG4A 3IR6B 2CQ1A 5DQGA 1VMBA 1LFPA 3DLEA 1TQLA 3HM9A 1LWEA 2XB2D 2ZOFA 1HI1A 3GYGA 4MKVA 4DX5A 1VDHA 1R8AA 4CT8A 2JLGA 2W8KA 2XEXA 1FWKA 4WFNQ 3MTKA 2LU1A 4LJMA 1JLAB 1KHWA 4PG4A 4LFBF 3UI3A 3V6DA 2J9DE 2DKOB 2WB4A 4EFAC 2RAQA 1SL2A 2H48B 4UW2A 2WBMA 3VGTA 3MAAA 2DO0A 3D3BJ 2KM8C 3QT5A 1E6YA 1BWVA 1O5JA 1IKYB 1FKPA 4CO4A 4NLVA 1WF1A 2HPUA 3M8WA 2LXFA 1S1XB 5EWGA 4NWBA 1H6KX 2WB1D 1NSQA 1K1QA 2JEGA 3M8PA 4G1PA 3AA9A 1HBUA 3IO1A 5IV4A 3GIIA 1U49A 4RW7A 3Q8PB 3DHXA 2FZKB 3CCRS 3SXLA 2AU0A 4ZVOB 1UVKA 1ACMB 3EE3A 4AXIA 2B4PA 1F5BA 1REVA 4Y65A 3M8RA 2E1PA 2OPRB 2QV6A 2V2QA 4LF7F 4Q8FA 2DNHA 4ED0A 2EK6A 4R0JA 4USMA 5A2QU 4YR0A 2BUNA 2NPIA 2V2VA 1HHTP 2KM8B 4F4WA 1N36F 4B3RF 3PYDA 5HJYA 5C42A 1ZOTA 1IQZA 2DO4A 2QL5B 4X62F 2GIFA 2O66A 4P2MA 1VK8A 1Q78A 4FYXB 4ZVUB 4LFBJ 3RJMB 2IJNA 5T41A 2BM1A 3ISND 2AEFA 1S57A 4YR3A 2ZJPQ 4YB6A 4B08A 4MIWA 4GKJF 1CEZA 5KFAA 1UA0A 4I68A 1Q5YA 2CJBA 1V5VA 1AZSA 4OL8A 3EVOA 4DQRA 2KKHA 3D6HB 2KXFA 4RR5A 3MEKA 3DU5A 4Z7YA 4ZJQA 2B5JA 3MMJA 5AJ3J 4FF4A 4F02A 2KB2A 2W9BA 5B0DA 4DI6A 4PQUB 2ATLA 4E8UA 5ADZA 2I5JB 4J7CA 2EKYA 3TAMA 2RMLA 5CCMA 2GJ2A 5F8LA 1CJUA 4NRTA 2RILA 3C46A 2CNNB 3BR9A 3M8QB 3QO9A 5KFOA 3MEGA 1S49A 1ZZNA 4WXWA 2A18A 3OL6A 2FD2A 5AT1B 4M5JA 3CD6S 2O3DA 2V2ZA 2FHOB 4IO1A 5LT5A 4LF7J 4IOBA 1XWLA 4BWJA 2CQBA 1N36J 3SDEA 4B3RJ 2EBEA 3V6KA 1HWIA 5I3UB 2I1RA 2CPHA 3AXMA 3UVJA 3SSRA 4JI7F 1FDNA 4CYUA 3BGUA 1N5TA 4BHQA 4GKJJ 3N4WA 3CPWR 1CJKA 5KFDA 5J1PA 3JAMY 2HS3A 4QIGA 1R3NA 2WK4A 4ZVTB 3A8IA 4N76A 2V63A 1VI7A 2MYFA 3VAMA 2RUSA 2W25A 3A3PB 4ZVPB 3O44A 2DCLA 4ZPAA 5KFNA 3MUVP 5IT9Y 2OFGX 1XK8A 1FFWB 1UVNA 1TUVA 5F8IA 1F60B 5D0GA 2CADA 4JI0F 3BSCA 3VQSA 2VG7A 2RU9A 1JLEA 2PIIA 2M5YA 4ECQA 3PTWA 5J2NA 1YJ7A 3EXCX 3M2UB 1GXUA 4QW9A 1QD1A 4QYZJ 3DLLQ 5KT3A 3PEHA 1FESA 3VZHA 3JSRA 3JSMB 4RBUA 1NZAA 2JFKA 4HT7A 1CQMA 4JI7J 2LFVA 2QE5A 5KG1A 5CYMB 2XO6A 4ED8A 5CD4H 4F2SA 5DLFA 2UU9J 3EWGA 2VV5A 4KKOB 2OD6A 5C2CA 3PRVA 2AD9A 2J7WA 2XNQA 1GX6A 2OUGA 1P1LA 4MFBB 4CLLA 2ZBQA 4Q2MA 2FHKA 4QWEA 4B9UA 3MMCA 1RABB 2DNYA 1RAAB 4W4MA 3SZ2A 4Y2CA 5IQ6A 2R8KA 3G9CA 3PR4A 1SPBP 3MMBB 4EBDA 3CJ0A 3TOQA 4LBIA 3C3LA 2DGQA 1DLOB 1U2FA 3CULA 1X60A 4ZIVA 5B7WA 4JI0J 2YKMA 3D1OA 1TL3B 4QCLA 2RU3A 2C3OA 3TX8A 4QR1A 2VG6A 1HBNB 1WOSA 2LXUA 3EM1A 3MOZA 3ULHA 3KLEA 4QIEA 1XMOF 2IAJA 4Q45A 3OUYB 1KEKA 4G65A 3MFIA 2B4UA 1QTNB 3H40A 4Q44A 1H38A 3NAIA 4DV4F 3T1YF 1LK5A 3KK2A 1U1NA 1S7IA 3RR7A 3TVYA 3GV7B 4AQYF 3PYGA 5JXSA 4F3QA 4ZCMA 3NKYA 3VVUA 4DQIA 3BS9A 4HHJA 2FJBB 1VQMS 4TN2A 3C15A 1HPZA 1R89A 1TP7A 2F7VA 4U7UD 3BDEA 4EYHB 3S6EA 3LWMA 2RIJA 1UVLA 1RTHA 3DDIA 5D4OA 5HP1B 2E9ZA 1FRIA 2B9YA 2KHDA 4NLWA 2VICA 2H3EB 1QDUB 5D4LA 5KFLA 3FBFA 4DR6J 4ZLLA 5JJBA 4ZCKA 4ZS6A 3TZXA 1GK8A 4AT1B 3G87A 3HVAA 4DUYF 2R7UA 1SI9A 1DBDA 1WG1A 4NLXA 2WSCC 1D09B 2R4FA 5GAEI 2KVIA 4DG1A 1LKZA 1RZMA 2JFDA 1VQ7S 2EFGA 5DM7Q 5CA5A 3HX9A 2KT5A 1WWHA 1I94F 3ZNUA 5ETPA 1VBKA 2EFOA 4WFZA 1CPZA 1M1KT 4OFZA 3CMES 3QPIA 4K4SA 1CLFA 4DV3F 4LRFA 2UUTA 2HNDB 2E1CA 2YKOA 4MKBA 2YWFA 2YKNA 4QYZK 1S6UA 3HFVA 4F4KA 3PFEA 2N7CA 1N5SA 3WX4A 3R8YA 1K9MT 1M90T 1T05A 3D54A 3GFZA 4FPIA 3G6YA 4DPWA 4JBCA 1NDKA 5EDWA 1Q8BA 4H4KC 3TA1A 2DEIA 2CPZA 5KFMA 3EPGA 3FVYA 1SUQA 4YUDA 5J2QA 2BOAA 2WHOA 3CJ4A 3QJLA 3K89A 3CD5A 1TAQA 2HGNA 1HMVA 4ZN1A 2V9WA 3UW1A 1CSJA 4ZJOA 5KFSA 2XC9A 4LFCJ 1RWUA 5DS7A 3PYEA 3J81Y 3LGMA 1S6QA 3MURP 4FF1A 2BXJA 4HVZA 2WVEA 1I94J 3ICLA 4EWTA 2RUGA 2HHVA 3PJWA 5LJ3Y 2IRUA 2HQIA 1JKHB 4NLYA 2LQJA 5A8RB 5HN0A 1NUEA 2P2CB 4DV3J 3GCXP 5KG4A 1DY3A 1L3KA 1R7IA 2H5EA 4NLUA 1IBMJ 2BKOA 3RW6A 3BM7A 1IKVB 4IQMA 2QYCA 1ZM2A 1S79A 1S0MA 1ZETA 3W8GA 4MYTA 2VASA 3KMQA 2IFXA 4H4OB 3DLGA 1VQNS 1RT2A 2CAJA 1FDBA 2HFUA 1HQEB 2ZH7A 5JVHQ 1RT1B 2I38A 2DT9A 1S0NA 1C0TB 1HNWF 2PFFB 2CVIA 5A8KB 1CULB 2BA9A 1HLWA 2O67A 2CJYB 2QC3A 2C42A 1WG5A 3H2LA 3BGRB 1SH0A 2WW8A 1ZAWA 4IYQA 2KYZA 1LFWA 2QLBB 3F44A 4NXNF 3C14B 1OQ6A 4DBQA 3CO9A 1KQFB 3CJ8A 1I5OB 4CRJA 2VU5A 2B4VA 6AT1B 5KG7A 2IC3B 1S1UB 2A0FB 2XS7A 2OTJS 2ZHBA 2OMOA 4RW4A 5KFXA 2Y8WA 5B0GA 4WTOB 4ELUA 2F40A 2HRYA 3PR5B 3MDFA 3KUEA 2R8JA 5MAOA 3EZUA 4OZ5A 2BJ7A 2W4CA 4DFMA 3X3UA 1MLAA 1N33F 2NXEA 2QFJA 3UD3P 4Y34A 1XR7A 2LYVA 4KHPF 4PG5A 2BVZA 2U1AA 1HW8A 4O3RA 5KFTA 4KT0C 5K9FA 1Q86T 3JTNA 6FDRA 1RTIB 2BABA 3R5CA 2IRXA 4BC7A 2RRAA 2OD4A 4ED3A 5KFUA 1FKOB 2Q1LA 1TKZA 2M2BA 3US5A 1HKAA 2XWYA 2VDHA 1R0AA 3MPWA 2BW7A 1VRUB 4C0HA 1TFYA 1HD0A 1HWKA 4CO5A 4QR2A 3OR1A 3LP1B 3H59A 5EWEA 2NUUG 4NXNJ 2ADCA 4NYOA 4ECUA 3G8TA 2I6WA 1MWYA 2MKJA 2K3IA 2FVRA 2J6TA 2LEPA 4IFVB 3H2VE 4TY9A 5D0HA 2VFRA 3ILJA 4DFJA 3MAQA 2EXUA 2AJ0A 2WAQD 4W92B 1S1WB 3FUYA 4ANEA 1RTDA 4QWAA 5HSPA 3JYTA 4ETXA 3E2EA 5EUHA 3D1QA 2FQQB 3PEJA 1N33J 1EJ7L 4M8LA 1AFJA 5IM0B 3FQKA 5A2QY 2OSRA 1A0OB 4KHPJ 2DK2A 2ILYA 2VJVA 1E6VA 4KBIA 2HWIA 2V4RA 1VC5A 2F8EX 2QO3A 1LW2B 4M5KA 4F4ZA 4FKXA 1T03A 1WI8A 2UP1A 4WZQA 2HNZA 3Q83A 1WF0A 1U45A 4K0KJ 2MKKA 4JV0A 4E2FB 2ROEA 2C2EA 3POTA 4RPFA 3GB0A 3TQ1A 2GVDA 1U25A 4PABA 4PXEA 2DHHA 3LF0A 5A8WA 4F67A 3RZAA 3JXOA 2J8SA 1S6PA 1GEHA 2YQ0A 4RUHA 3OLBA 3L4BC 4KE5A 2YNGB 4ANCA 2WCXA 4PYAA 3D2WA 3TUPA 1ITPA 3KXDA 2G13A 5HLFB 3QIPB 1G1XA 2RRBA 2XMJA 2DH9A 3GIMA 4KQZA 2H51B 3KLGB 5L8RC 2CQHA 3VGUA 4DS5A 3LP2B 3OBIA 3TA2A 2AYEA 2IMOA 2VQFF 4I69A 2MLYA 3R1HA 3VCDA 4DN0A 1NK6A 3CCZA 1IUJA 1L5UA 2E7VA 2DNZA 5E7OB 1FI4A 2R7XA 1TKXA 2VPXB 5MLCV 4F4AA 1NSAA 2KT3A 4NCGA 3DOKB 5DGBA 1AROP 4AE5A 2RF2B 1PSDA 2H4YB 2COLA 3SSQA 3H5XA 2NXJA 3IRWP 1U1PA 2GGPA 1DTQA 1RWKB 3QT6A 2XULA 4M63A 4EZ6A 3FFIB 4L3KA 1SL1A 3ETMA 2XMMA 4DR5F 3RRGA 4KV8B 2DGOA 2ZBCA 3H25A 2MHEA 1TVRB 1SBRA 4TNOA 2FZCB 2YBVA 3NNCA 5F3ZA 4IG3A 2E5IA 4USJC 5E3RA 2A2CA 4L74A 1IM6A 5KOWA 2MQMA 4YMEA 4U95A 3RRHA 1UJ6A 1R0CB 1RHQB 3BEGB 1OY6A 3Q23A 3DRSB 4HYKA 1EB0A 4LF6F 1FD2A 3VAJA 2M9KA 2Y9HA 4WU2A 2P6SA 5CYQA 3R7BB 5K14B 2YQ1A 4NLGA 3ENQA 3NWGA 2FVSA 3HHLC 2HLTA 2MQOA 3C6TB 4K4XA 4P75A 1ZM9A 2GS8A 4CQ1A 3PYFA 4O3OA 1RT6B 2FVQA 4M5IA 2MQ8A 2IPOB 2HURA 3FRZA 4CDIA 1HA1A 3GIJA 4QPXA 3QLHB 3W9JA 3RUBL 3T19A 2IDLA 4DR5J 1YVFA 3W64A 3GWCA 1KLMA 3TZWA 1TV6A 3TYTA 3WZ0A 1WC3A 3BN4A 3IM9A 1YJTA 2OPQA 1FTRA 2W2QP 3W2VA 1N0VC 3HHLB 9ATCB 4GVBA 3R9LA 4LF6J 3NY0A 3N0VA 4OZNA 3HSJA 3IP0A 2MKIA 3JTPA 1T3NA 1WEZA 3NMAA 3KOAA 1B3TA 3I5AA 2UV8A 2OPSB 3N5BA 5HQLA 3SQGA 4A8MP 1QAJA 1YJNS 4DL5A 1VQ5S 1VQLS 3QSIA 3U7JA 1KLNA 2MLXA 3T9ZA 3J7AN 1IBLF 2K8GA 5LSRA 1VRQC 3MI7X 3ZZPA 4HH0A 5E3CA 1REGX 1XQIA 2GFFA 1VOMA 5LMUF 1C1BB 2L41A 2PI4A 3LGHA 3D5MA 4HHHA 4QIFA 3LOUA 2C3UA 1IJFB 4FVMA 2C2DA 2FJDB 2J7UA 1P9YA 1Q4RA 3MM9B 4QJVA 1WUUA 1NJIT 2ZITA 3HVTB 1XR5A 3M8YA 3F41A 2BX6A 4JYAF 1AZSB 4X4SA 1U48A 3VF0B 4PCQA 4WFBQ 1KOOA 4XAKA 1BQMA 1WORA 1RADB 4RBVA 1JNRB 2W1BA 2BM0A 4DWIA 1WJ9A 4OX6A 5GADI 3ET6B 2W9BB 2MPUA 2DVIA 4QPTA 1EAYC 3EGVA 3D4JA 3OHAA 3QRRA 3IR5B 3DM2B 3FGVA 3F0NA 3R3TA 3TAMB 4TYAA 4LF5F 5AXLA 2HNYA 3MF5A 1ZA1B 2KVQE 4TU8A 4ZVFA 1KTVA 1IBLJ 1H0HB 1A6LA 4USTA 1S48A 2ASYA 1QAIA 1VGYA 4JI8F 3J7ZT 2JZ5A 5JUMA 3SDEB 2GW8A 1WC6A 3ADAC 4HI1A 4U8VA 3BBFA 3VGVA 1JMTA 4QU6A 1NDCA 4KSEB 4A48A 3UVJB 2UXDF 2K06A 3SSSA 4DCPB 4NMLA 2CPYA 1IKYA 3I4HX 2J5AA 4YQWA 1ZTTA 3K58A 1QLNA 4YHHF 4MK7A 2J0SD 3QAEA 4DQQA 1S1XA 1JWWA 3ZXWA 3BBBA 3GQCA 2ZDOA 3NRBA 3RAMA 4X4NA 3TAPA 4O3PA 3P5BP 3FZBA 3M7VA 4P7TA 3D6FB 3EMTA 3MEDB 2KH9A 2VUGA 2DNPA 3UPFA 1X4DA 2HBZB 4N5SA 1MWQA 5J2PB 3AOAA 3AQPA 2Y8YA 3CJQA 2DR9A 2F3JA 2OPRA 3C8YA 1O0PA 1NU4A 4WPAA 2H1YA 1WKJA 2JJ4D 2UV8G 1F3FA 1B70B 2DH8A 5J2NB 2CQ4A 1YJUA 2QLFB 3MECA 2DHXA 4JI8J 2VZ9A 1HD1A 2FDNA 4OX7A 2VH7A 2C2MB 1B64A 3OR2B 1OY9A 1P9QC 3A3NB 1F9EB 1LWCB 2UZAA 3MD3A 4USKA 1RT5B 1VC6A 3TAQA 3AXKA 1FRXA 4DL4A 2YX1A 4DSKA 2K7JA 4YHHJ 5ETRA 4PQUA 4LF4J 2IVMA 2JEJA 4Y2AA 1PILA 4X66F 4DQPA 4DUZF 2Y3YA 4OI4A 5EGYA 2IA0A 4CLKA 3PDNA 5T7LA 4O4GB 3MMCB 2OMLA 1S9GB 3AQOA 1VCTA 3M8QA 1AA1B 3BB5A 4H4MB 3AJ1A 3LAMA 4K4TA 3P5TL 4IUFA 2XYPB 1XNQF 3R27A 3QWPA 2H65B 5HL7Q 1WTBA 1EKSA 3CC7S 5KG6A 3CB4A 3BGLA 3ETOA 4NYZA 3DLBA 1M5VC 4QIVA 5H9FJ 4DS4A 4J9MA 2MZJA 3LWLA 5F9NA 2ADBA 4ZVEA 1HBMB 2KTQA 2ZNZA 1KONA 1UETA 2I2YA 3EYZA 4PZVA 3AB2B 1PO6A 3TRGA 3T5HA 4FBTA 1CBKA 4LSNB 3O1LA 3EGWB 2LLZA 2JWNA 1D9AA 3D66A 2DJWA 5HVGA 2P9GA 3VV2B 4LSLB 3DRPA 3FMBA 3VWSA 5B0AA 2AJ2A 3EVWA 1JNZB 2D7SA 4OX9F 4C9DA 1N56A 1T0TV 1OMSA 4V1Ak 3MUTP 3F73A 1SC1B 3G6VA 2VHGA 1FNXH 2HQFA 5ETOA 4N8OA 3QATA 2XI3A 1H98A 1S9EB 4TLQA 1TMMA 3M2UA 3W5ZA 3H42A 2AMCB 3BYRA 4J9OA 3CEDA 2XLIA 1X4FA 3JSMA 4KO0A 1XC9A 3X1LB 5D78A 3OFHA 2OAUA 3D6TB 1LOUA 3M8SA 5CYMA 3NCRA 4C8ZA 1SC4B 3RRKA 2NSCA 1HYSB 2AQ4A 1AYEA 4KKOA 2G2YA 4FZVA 4BS2A 4MFBA 2UUAF 2BJ8A 4MK8A 4NLPA 4WFXA 3BJYA 1UPPA 2Z2MA 4HL9A 1R8BA 3MMBA 2G0IA 3GCWP 3Q89A 2XLJA 1YTYA 4LR7A 2NR0A 2YWKA 1RLDA 3KG4A 4C4WA 1DLOA 2YXLA 2WVCA 3CSKA 1BQXA 1KR4A 2HZAA 2PA8D 1TL3A 1FVQA 5E41A 3DHWC 3GLJA 2HSEB 3JQKA 1SL0A 3PJ9A 1HBNA 1VRTB 2D69A 4LR9A 2HZVA 1UEKA 4RW9B 4G1QB 1K44A 2JX2A 1FK9B 5E3PA 2QA2A 4DV2F 1FFSB 2CQ0A 1MMLA 3OUYA 3Q2TC 3OL9A 4F4XA 3GIRA 3DGPB 4HDGA 4IH7A 3ZTPA 1WDDA 1GT8A 4I0WA 2LDYA 4M5GA 2BDPA 3G6ES 5E33A 2XZWA 2RS2A 1WHWA 3OJUA 4MAKA 1GH8A 2QRRA 3L95X 5L46A 3C66A 1LQ9A 3CT9A 1BHNA 2EEYA 4ZCIA 4UUXA 4ZJLA 2AJ1A 1PBAA 1R6YA 1HL6A 3AODA 4R8UA 1NK4A 4A8WA 2UUAJ 2X1BA 1CJVB 2YPZA 1SVDA 1T11A 3T9NA 5D3GB 5HP1A 1Z2LA 3S1TA 3WDOA 4LBHA 2FB0A 1RWOB 1Q1KA 3NS5A 4DPUA 5L38A 1KQGB 3DXSX 4RW8B 2KDOA 1HNVA 2CKWA 4UT4A 1UEUA 2YPYA 2HWTA 4QOTA 3MPDA 5GMEA 4C7QA 1XJWB 4DL0C 1X5OA 4CLPA 1ZYQA 1ZA2B 2V4JB 3UN2A 2VFSA 3U02A 2SXLA 4DV6F 1K8AT 2IRYA 4P72A 2R8IA 2DGWA 3KDOA 4ES2A 3FBBA 3I32A 1B4SA 3N6LA 1EZZB 4GO5X 3NEKA 2HNDA 4G3IA 4ZVGA 3RR8A 2HHTA 3V4MA 3TX0A 4WWSA 4GKKJ 4Q8EA 4QZVB 3PX0A 4DR4J 4RW4B 3CF5Q 1W2BR 2J0QD 1CC8A 1JXVA 1PC4A 3MR2A 1YIJS 3PRDA 1IKXB 4KGZB 2JDJA 2MKCA 3IA0A 2DTJA 3V81B 1NM2A 1SJ3P 2B9EA 3G96A 2XGPA 3NCPA 5K20B 2H9ZA 4J90A 2HQGA 2CJQA 3Q8QB 1XERA 2MJNA 1X8DA 1N0UA 5M2UA 1TKZB 5B0EA 5HBMB 4P10A 2HIYA 1Z1ZA 3J80U 4KRWA 2Y1IA 4O0IA 3BYPA 3U1LA 3OR1B 4A47A 4AYBD 1SXLA 1JKHA 1ZS6A 5A8RA 1TKDA 5KT5A 3I5CA 2FJAB 5L1JA 5I42B 3W61A 3UWTA 2QLWA 4D3GA 3CO0P 1SH2A 1U1LA 3CCLS 2E1MC 5DLGA 3MR5A 2YKQA 3QT8A 4F4YA 1IKVA 5EN1A 2HBYB 5E3AA 3ZZYA 4KC5A 2APOA 4ILMA 1Q53A 3SYZA 3RB0A 1RTDB 4XIUA 4H4OA 2V2KA 3GMGA 1Z4UA 1HQEA 2GJIA 4A8OA 1RT1A 3W9HA 2XMVA 1FE4A 2HVIA 4CH7A 1S77D 1C0TA 1RA7A 5A8KA 2CPFA 2HS4A 3BO2A 4B3SJ 2KN4A 4JV2A 2MQQA 1H72C 5DZ6A 4EBEA 5KG3A 3Q86A 3VQTA 2X7IA 3V5RA 1KWMA 3R5JB 3BGRA 5KFZA 3G82B 1NLKL 3P4UB 4A8XA 4N41A 1KFSA 1VQPS 1QJHA 4WBFA 4P74A 3C14A 2Z2LA 1FCAA 1Y10A 4U6PA 4OHXA 1JLCB 4B17A 4DJBA 1VQ9S 3NAHA 4IRCA 5BYQA 2HFNA 1S1UA 3R5BA 1T9TA 3CJRA 2ACYA 2R7SA 1NB2A 2YNHB 1WELA 2E5GA 4XPCA 1UW4A 2N4CA 4RW6B 4UQGA 4P7VA 2VJUA 3G4SS 1G3OA 1F6TA 3MEEA 4J9VA 4KYZA 3QJPA 2CG4A 5AXMA 2ABYA 3CW2C 3JQMA 4C0BA 4NLRA 3CCES 4OI3A 2MMYA 1RTIA 4ED1A 2QA4S 1SIZA 2MLZA 4L3NA 5G4DA 2D9PA 3QWUA 2OP5A 3Q8SB 3R1LA 1S97A 5H1SV 3MGJA 3W2WA 4JI4F 4DDFA 3QT7A 2QA1A 1UWBB 2C2OB 1LEOA 4U96A 2DGTA 3F56A 1VRUA 2XMUA 4CLFA 2DHGA 5KT2A 3GG0A 1KVJA 2RNEA 4QIWD 5KFWA 3LP1A 1U0HB 1K73T 3TANA 3EZOA 3FMWA 4WKYA 2XMWA 4M5MA 4FYDA 1T7PA 3MCNA 3IGNA 1WI6A 4IFVA 4OHYA 3PX6A 2VF3A 4KPYA 3K2YA 2BRKA 4B9TA 1FTCA 3GFXA 1SQGA 1S1WA 3CJ2A 1RDRA 1QE1B 2GGPB 1DTQB 1RU1A 4DZDA 1T02A 3T5KA 3QRQA 5IM0A 5KFPA 4R5PB 4DPXA 2DY9A 5D0RA 3BDPA 1S76D 3OVSA 2ZBIA 2M3DA 2ZM6F 3QZ7A 5AE3A 5HO4A 1S4FA 5F0UA 3CE8A 4CM2A 4KGXB 1GTHA 3QNWB 8RUCA 3MR6A 2DNGA 3PW2A 4USVA 1RACB 2BEFA 1MMDA 3GG1A 1T9UA 4JI4J 4FXDA 4EZ9A 2DXEA 1UP1A 4TU7A 1U6ZA 1UW9A 4I4BA 3GJTB 5F8JA 1HWJA 5F0WA 2W24A 1Q0NA 2ACMA 2BE9B 4JI5F 2GHPA 5ETQA 3K57A 2V0NA 1RT7A 3HPOA 4J5OA 2W2MP 4OYBA 3GU0A 2GC8A 1JLQB 4L6V3 3KTQA 3KYLA 5KT6A 1ZM4A 3KNGA 3DI6B 2ZHAA 1PIEA 2RJZA 3DC2A 5LMNF 4DU7A 2H4WB 3FRYA 5FD1A 3OSPA 3Q2SC 4OHVA 4DL2A 5HMXA 2XMKA 5C24B 2YNGA 2CJXB 2V5HG 5HLFA 5KFGA 1NMEB 2R2RA 3MZIA 2Q6BA 4TXSA 2OPPB 1A9NB 1S0VA 2BV3A 3KLGA 3KLVA 3TUIC 3ZZZA 3G2XA 4DCJB 5L1KA 1NSKL 2ZM6J 4JI3F 2ATCB 2PSZA 3RAXA 2R7VA 1NDPA 3JSYA 2DPIA 5F8NA 2R9LA 3LP2A 4TU9A 1XR6A 2YWEA 2M8DB 4ZLNA 3DOMB 2CJ9A 2G1DA 3CMAS 2OEJA 4LFAF 1TR0A 2EFPA 2VA2A 1VQ4S 2MZRA 3TQEA 2HFZA 1UTAA 5H9EJ 2B56A 1X4EA 3M9OB 3TEGA 3FSXA 2FLNA 4YY3J 3FNNA 1P1TA 3N79A 1VQOS 2AJFE 1NK0A 3CDBA 3C16B 4CI0B 4PRFA 4ITSA 2NXUA 5KFCA 5BJRA 3A3OB 3DOKA 3SMZA 2RF2A 1OYEA 3W9IA 2W2PP 2HRTA 2DCUB 1FO1A 5IS2A 4DSEA 4F3OA 1N5YB 5LMNJ 3P3DA 1RCXB 4DQSA 5JVGQ 2V50A 4I6YA 4GC6A 4ECRA 4CP5A 4K4UA 2ZZMA 2HYIB 2YWWA 1IWAA 1YBUA 2HVDA 1Y0HA 3FFIA 5F9LA 4PQAA 1XMBA 1O8BA 4KV8A 1BUXA 3T3FA 1SV5B 1TVRA 1F9FA 2XY6A 2BQRA 3UDVA 2R8GA 3HHKA 3HHLD 2N3OA 2AX0A 3BREA 3TZZA 2V8PA 1NK9A 4WU3A 4NXMF 1VHFA 3DRSA 5L1LA 1FFGB 1G7CB 4DEZA 2CQ2A 5IT0A 3QFWA 4NLOA 2O5DA 3MM7B 3MPYA 4LFAJ 1UL3A 2HK3A 5KFHA 5K14A 2B51A 4NMXA 1FD8A 1VS3A 2R7RA 1PBUA 1V3RA 4OYIA 2CQGA 4ZPBA 2QZ8A 1YX2A 2HFSA 3AB4B 1YK9A 3C6TA 3OTBA 4PG8A 2ASJA 2Z30B 1T8EA 2MKYA 2XG8A 3VAGA 1K0VA 3D9BA 3GPAA 2AV5A 2DBBA 4JB8B 2D3ZA 1RT6A 1IKWA 1ELOA 5KFKA 1H7WA 1NBEB 4L73A 4V19X 1RAGB 4URGA 1WEYA 2CWKA 3SV3A 3QLHA 3NGTA 4C3KA 2ZFHA 3UNYA 1NJYA 1N4LA 3HSDA 4LQ3A 1U1QA 1NNDA 3GR0A 4ED2A 1U1KA 2G0JA 1NEEA 4AL5A 4DV0F 1DHMA 5SZTA 3HHLA 2Z58B 4OHZA 1FX2A 4M1KA 1XIQA 1I6JA 4WE1B 5IWAF 3B6BA 2HBQB 2VBWA 3W62A 1J5EJ 1UA1A 1X4GA 1D8YA 1YBTA 1DARA 1AUDA 2NPFA 4OZ3A 7FDRA 2KG1A 2FC9A 2D1CA 2WVBA 3ZZ0A 1VC0A 5KFJA 2XY5A 4ZHRB 2QSWA 1M1HA 1MSWD 1RBLA 2VBYA 3R97A 2KJVA 1DQ8A 2FY8A 1X4AA 2OPSA 5E5NA 4AXJA 4J9SA 4K4YA 4J9LA 3NOCA 2DB1A 2V8GA 1XTZA 2X3GA 4WJBA 2MB0B 2JH3A 1HBOA 4RUCA 4FYYB 1D9DA 5H9EK 1NPPA 3SCJE 5IZHA 2AEJA 2DHSA 2HHSA 3T5LA 3HVRA 1C1BA 3MECB 3U1MA 1RJJA 2WSEC 3ZZTA 1LV5A 3TARA 1NJWA 3QJJA 1FEHA 3MM9A 3HVTA 4C6AA 3PX4A 1NJXA 5IWAJ 2BKPA 2EVZA 4ELTA 2K1RA 2E1AA 4RWXA 2V34A 3BKFA 3SFUA 5KFRA 1N32F 4DR1F 4HKQA 4M5DA 2HIQA 4JI2F 3ET6A 4KGMA 3HJFA 4DR7F 2ASDA 2GA7A 5J1EB 3EX7B 3DM2A 5A0YB 3CD7A 3B54A 5T7LB 5F3TA 4ZPDA 2V94A 3MR7A 3QGIA 2KRBA 2MKHA 3UDCA 4OYAA 1U26A 3K0JA 2QIFA 5DGAA 1D3WA 2X3DA 1NH7A 3GJRB 4OLOA 1NRKA 2WZ1A 3ONQA 3T5JA 3MHYA 5GAGU 2JVOA 2K3KA 4NE9C 3I82A 3QGPA 4NZ6A 2QG9B 2E5JA 3P45B 3QIDA 2A3JA 4X62J 1NHKL 4EUVA 3OVAA 2JL9A 1M5PC 2EW9A 2HRUA 1FXRA 2Q66A 2DH7A 4WP3A 4ECYA 3RAQA 2EFNA 1VQYA 4ZKAA 3MTJA 2J9CA 2FJXA 3J80Y 3CJTA 2ZUGA 4A8KA 1J5OB 3KLFB 2HGLA 4MYUA 1X5TA 5CCLA 4DR1J 6FD1A 1B99A 3DRPB 2HVZA 4GC7A 3HD2A 3MEDA 4DR7J 2PC6A 2Z2YB 3EDQB 3W5YA 5J2PA 2BACA 4NA1A 1V3ZA 1Q82T 3Q8VA 3HCXA 3CDUA 5HVFA 1VQSA 3H4BA 3MCMA 1KQSR 4X65F 2I9SA 2E5LF 1FKAF 2F5GA 2P8IA 2PDAA 3GSDA 4ZP6A 1PYOB 1UPMB 3JTOA 3D28A 4OLPA 4YEAA 2B3TB 3GJQB 2IBKA 3MM6B 1FJ7A 1YRXA 1IR0A 3M9MB 2KJWA 1FJGF 3PW5A 4LREA 2OSQA 1U4BA 3C6UB 3H2UB 1VJQA 3TJ8A 2HZCA 2V8HA 5HAOA 2J0XA 4KO0B 3NP5A 3OR2A 3Q24A 4JI1F 1LWCA 4XK8C 4OI0A 1RT5A 2HHHF 1Q79A 3BO4A 3R6GB 4J9QA 4PPDA 1B0TA 4NEYA 5A6PA 1KP6A 3OXFA 3N9UC 1IN0A 1Q8IA 1R31A 4LMZA 5KFYA 2RHSB 4RJVA 5ETVA 4ECVA 1QSYA 4A46A 4O4GA 1RLCL 4X84A 3LAKA 4HHUA 1S9GA 4ERDA 2AGPA 2ZOMA 4H4MA 2OKQA 3ZZUA 2ZH5A 4KAIA 3OSNA 3BKUA 1G2EA 2AHOB 2E5LJ 3KG0A 2V6AA 1HHQA 4ZK7M 2A6OA 2BQ3A 2EKNA 2E7WA 3MWBA 1NKEA 3EZ5A 2HGMA 2VFVA 3J7YU 3D0HE 1IXKA 2PFDA 2AEMA 5CZXA 3M2VB 4OI6A 3BSOA 3MPUB 1FJGJ 3OFGA 2BW2A 3I0RB 3OTOF 5JMNA 2GAHC 2M8HA 4MIAA 4CLSA 1HBMA 4JI1J 2B9WA 2NUHA 3HDSA 5D15A 1TKTB 3IS9B 1OO0B 4DSJA 4ZPWR 1MWZA 1S1VB 3TJAA 2BANB 4LSNA 4PWUA 1FJEB 3OLAA 4LSLA 1GMWD 4HH1A 4R8UB 7AT1B 5I4MA 2KU7A 2LQ8A 2DYAA 1IVZA 2RE1A 1CS4B 2VB6A 2W9CB 1NHUA 4PEOA 4C3LA 2NYIA 4DX6A 4NA2A 4FYVB 5GAGI 1LNQA 1TUWA 5FLXU 2FTRA 3P8BB 1HNVB 1S9EA 2K7KA 2LXIA 1S7HA 2CNKB 3VTIA 1Q8KA 2DITA 3OQ2A 1DTTB 3R2CJ 2EPIA 1W7WA 2DR5A 1XMOJ 2R7QA 3DU6A 2XZDB 3NGKA 3E01B 2IJFA 3OTOJ 2ALYB 5LOQA 4ZP7A 2YVSA 4DSIA 4DV4J 1HYSA 3T1YJ 2BQUA 1RB0A 3KHRA 1GXTA 1SJRA 1EP4B 1TL7B 4DX7A 4AQYJ 2XLKA 1WOPA 3QGHA 2PN6A 3WC2A 4B3OB 2FHMA 3PKMA 5F8GA 2ZKTA 2PA3A 3RYLA 2MKSA 1U2RA 2IA6A 1GMWA 1UVMA 4LQ9A 5KOXA 3BO3A 1LWXA 4DV7F 2IVYA 1W2IA 2Z57B 4ELVA 3ENVA 2ZVIA 5BR8F 2F8MA 2FC8A 2DRBA 1VRTA 1JK9B 4O3SA 3J81j 3RBEA 1N54B 1M5KC 2B0GA 4ZN3A 4RW9A 4G1QA 2GIRA 1FK9A 1QSLA 4DUYJ 2XMAA 3SIPB 2CXEA 3C2PA 5AE1A 4IRKA 3DGPA 2BJDA 2OEMA 3GILA 1HQ2A 1LK7A 1RHUB 4ALZA 1FEEA 4Q2LA 4CTAB 2HAFA 8AT1B 4U8YA 4F3MA 4Y2IA 4HDHA 1JJHA 3IMQJ 3NNHA 2VL1A 1TUGB 4DU8A 1XBWA 1MN9A 1S1TB 4EU0A 2HQDA 3ZC4A 3KUHA 1H2TZ 1CJVA 4C3MA 2Z0GA 1ROFA 1FXDA 3PCOB 1AFIA 1UFKA 4URSA 5BYRA 5D3GA 1LW0B 2QT7A 4DFPA 4ECZA 4Y3CA 4NLDA 4KFBB 4DXLA 1HI8A 4XDCA 4LIWA 4ECWA 2EG2A 4FNHA 2H5JB 3K7RA 2J8AA 4RW8A 1TTHB 5I3QA 4YB1P 2RKIB 2KT2A 3WIUA 1Q5VA 5EX3A 1FWLA 2DXFA 2RSQA 2JNJA 4TKTA 1U24A 5HMYA 4DN9A 4HI2A 1SCJB 1BD6A 4PKDB 3MM5A 1AB8A 1RT3B 4IQXA 4LF8F 2V4JA 1KTQA 2FJWA 2ZUAA 5D0EA 4RNMA 2M0GB 2H54B 1HWLA 2Z56B 1S5ZA 4DSFA 4FN5A 1EQMA 1NB7A 3ILIA 3BZQA 2POKA 2D74B 2WVDA 1W25A 3W1YC 2M4MA 4RU9A 4RO0A 2CQIA 2WRMA 5CHCB 4KR0B 5F8HA 1UJ4A 2FPHX 1Y11A 2UUWA 5SUHA 2F9DA 2LECA 2VBZA 2JEFA 1RKIA 3H4DA 3LPYA 3OXGA 2G1HA 4M5NA 4NA3A 1MW7A 1N88A 4CH0S 2OEKA 1IKXA 5DDQC 4KB7A 3MEEB 2WW4A 2DRDA 1FERA 2VG5B 3V81A 2BJEA 4XO0A 3T6JA 4BLGA 4HLBA 1VQ8S 3OTCA 5LJ5Y 4LIRA 3KG1A 2LA6A 4ECSA 3NCQA 1HNWJ 3HHNB 2AF6A 3CCMS 3W2WB 4ZIWA 3BH6B 4O3NA 1PJ5A 2VPYB 3MR3A 5HBMA 4AFFA 2LVWA 1NJZA 2UXBF 3DMJB 1KC8T 2DNMA 3GTYX 2CNLB 1BQNB 2CQDA 1YLXA 1RAEB 5I42A 2C3YA 5DRKA 3QYYA 4UY85 1Q95G 1Y5LB 1U6BA 2FLOA 5KFIA 3I87A 2NXCA 1X5PA 3KHHA 1DQ9A 4NYPA 2HWHA 2XM3A 4DLGA 2ZH6A 2HHWA 1DAXA 1KRPA 2CJAA 2QN6B 3N6MA 4QWDA 4K5RA 2CFXA 2QMWA 1JLGB 3CNQP 1MN7A 2NYHA 4ZPTR 3C19A 4L75A 3G82A 4F04B 1S4EA 2BBEA 5CAAA 1Y5IB 4ZMMA 3KUGA 1KKHA 4MKYA 2P5VA 2B9XA 3BQ1A 2MGZB 1OQ3A 1QVFR 3OFEA 4ZVHA 4EO6A 1JLCA 4I6WA 4Y0FA 2B6AB 5HJXA 4RU2A 1RT7B 4ER8A 2KG0A 3RU0A 1L3TA 2Y1RI 3NG8A 2HHUA 3PJXA 2F1FA 4EK2A 3AHPA 2YNHA 3LTOA 2J9DA 2XBPA 4RW6A 5DQIA 1M5OC 2KFZA 1DQAA 4TQSA 2R42A 1Y3KA 4NEZA 3NNAA 3FCWA 3RG6A 1TFWA 4Y28C 1HW9A 5HQ8A 3A4TA 5LXRA 2ZE2B 2AYMA 3I56S 4ZITA 2QJ3A 4IFYB 1VISA 1M0SA 3KK3B 2Q79A 4P71A 4KHRA 1S59A 2CWXA 2KYXA 1C0UB 4RNOA 4HEA9 3UCGA 2IHR1 3ZNJ1 3IWXA 4Z37A 2BZ2A 4FS2A 4K7QA 3W5XA 5DG7A 3ZTRA 4KH1B 3R6LB 2WONA 1UWBA 1BMQB 2ZC4A 3TUZC 3CIZA 4BWMA 2W4PA 2IBOA 3IXQA 2YH1A 1U0HA 4ES1A 1PGZA 1Y00A 4Z2XA 4CO3A 1BGXT 2QMUB 3PHTA 2BE2B 1HQUB 1JLFB 3CCUS 5AJ3F 3ENAA 4LRBA 4UOCA 3KWMA 1KBRA 4DPOA 1SKWA 3FJ2A 2ILZA 2AZ1A 1U6FA 1UZDA 4ZDNA 2OH2A 4ES3A 4CO1A 1QE1A 2AYGA 1SH3A 5M2PA 1KD1T 2CNOB 4MH8A 3TUJC 2JOQA 3QRPA 3WX8A 3Q0AA 1OSCA 4R5PA 3CDWA 2D41A 4ED7A 4RUBA 4FBUA 2E5HA 5A76A 1RBAA 2L9WA 1QUVA 4KTQA 3WBZA 2O1PA 1GMVA 1KSPA 3W7BA 4KH0B 2RT3A 2VQFJ 2EG1A 4LRCA 2HFOA 3BR8A 1JLBB 1SC6A 2E44A 3D3CJ 4IDKB 3K8WA 5D8HB 5C25B 1YJ9S 2X1AA 2CG8A 1N52B 4M5LA 4MKAA 5DM6Q 4NL5A 3I55S 2Q43A 4TLRA 1URNA 2XYGB 1MNEA 1RWVB 1NKBA 3KJVB 3ENWA 3G8QA 2EC0A 1JLQA 1GAOA 3Q8RB 3LALA 3VAHA 4DX8H 4EYIB 3M30B 3DI6A 5J2MB 3IR7B 2VDIA 1KN6A 4M94A 3L09A 1X5SA 1N5QA 1IKWB 1TU0B 2MSTA 4RUAA 3OVBA 5C24A 1N48A 2JLEA 1U09A 4I56A 4TY8B 2KO1A 1RT4B 2M88A 2VFUA 4K5SA 4B9MA 3HK2A 2OPPA 2R7WA 3EJMA 4KY3A 1YJWS 3UN3A 4BCAA 1JJ2R 5HK4A 1CC7A 2LDIA 9RUBA 4WP9A 4WP8A 1N34F 2RVJA 3DOMA 5I3PA 1WACA 2MZ1A 4B3TF 3UR0A 2QL7B 1R43A 3B82A 4DPTA 2DGUA 4XPEA 1X9WA 3P49B 2RRNA 3C16A 1C1CB 2HS0A 4LF1A 4E0DA 2J7KA 2DNQA 3QBCA 1WOOA 3JQJA 4A8SA 5GAEU 2UU9F 1IR1A 4UOFA 1V5IB 2AW0A 1HNIA 1V3SA 1N5YA 4WIQA 3DYAA 4QWCA 3T41A 2Z2ZA 3DRXA 4IRDA 3D6MB 3K5LA 2YKPA 3FBCA 5FLXY 1RAHB 1SJFA 1QUPA 3CCWA 3OD2A 1HBOB 5RUBA 3IG1B 5CH7B 4FF3A 1SV5A 1APSA 4P2SA 3R7SB 1SJ1A 3V2UC 2QSFA 1PAEX 4ATNA 2V4QA 3GFYA 5KG0A 2YQ3A 4A8YA 4HR2A 1PYSB 2BJ3A 2HBRB 1D0EA 2UXCF 3N01A 4WZMA 2OHDA 1NK8A 4C8YA 2DIUA 2PMHA 4WYWA 4MIBA 1N34J 2WTFA 3MM7A 4B3TJ 3V4IB 1CJTB 2K1RB 2CZVC 3EPIA 4WFAQ 1OJ4A 3WIVA 2LQ9A 3AD8C 4PPZA 4RLEA 2R7TA 4M5DB 3P96A 2ZKUA 1NCLA 3JB9k 4P2XA 4ECTA 2BJ9A 1GX5A 1FE0A 3RBDA 5K8NA 1D9FA 2HG4A 2XGQA 5FDLB 2RQCA 1YSJA 3S01A 4DPYA 2B4OA 2PT0A 3K5OA 3PRBA 3BF4A 4ZCLA 2RQ4A 4ILRA 1HWUA 3OV7A 3MAHA 5DZ7A 2MZQA 4C8LA 4MMOA 4CNYA 2XMTA 2HFVA 1U1OA 3DLKB 3MM8B 2IVFB 5IOLA 1TELA 3CJ3A 2QX0A 4DL3A 4UUWA 4RWWA 1RQ0A 2AWZA 3PXGa 3W65A 3W60A 3DRRB 3DOLB 5LMUJ 3R5DA 1CQNA 3IBCB 4PG7A 4DR6F 3QAUA 2GMJA 4WE1A 3NL0A 2UXCJ 3IBWA 1J2VA 3CJKB 4W90B 3DFEA 4K4WA 3CIMA 2C2KB 1YGYA 4JYAJ 2V8DA 4FDFA 5U47A 1KS2A 5G0RB 5KT7A 2VFTA 3EGZA 1RGVA 4OZ0A 2XO7A 2E29A 1TK8A 4LF9F 2IJRA 1G6BA 2GZOA 4ZHRA 2V67A 4LBPA 1H3DA 3QMQA 4DCOB 2RB7A 3KJFB 1SQEA 2FLLA 3A13A 1V6HA 1UFWA 4CNZA 5BXIA 1FWPA 2ZWPA 1IBCB 3UDLA 3I96A 4AUKA 1RAFB 2NZCA 2I8EA 4LF5J 3QZ8A 2CYYA 4ENOA 4ZPCA 4OZLA 3TI0A 3V6JA 3HXMA 3L7OA 1RU2A 3FBEA 5GMDA 3CJ5A 1RTJB 4N77A 3H8YA 1WC4A 4QBUA 3AD9C 1R0BG 2DR6A 2R3VA 4EI2A 1Z2ZA 3NBPB 5LM7E 5LXYA 1RWXB 2YX7A 4FS1A 2MJUA 3D0GE 2LEBA 1RK8A 4TQRA 1I3OB 3R5AA 3OL8A 1ZBTA 4YOEA 1FJCA 3BPSP 2Y0SD 1MU2B 2UXDJ 4HTJA 2KFYA 3HHDA 1FNOA 2WBRA 4OHWA 4X64F 4LFCF 1R8CA 1WC0A 4ICLB 3LUYA 3GV5B 1RP5A 4I64A 5DETA 1HFEL 3MMAB 4Q0BB 1H2UX 2QLJB 1NAQA 3NLCA 1S9FA 3R7NB 4LF9J 1VQKS 2NCKL 1TL1B 3RB4A 2BMBA 2QTWA 5J1EA 5A0YA 1NDLA 4GO7X 4F50A 2EC2A 1JX4A 2XTJP 4CLTA 3HVWA 1A7GE 1LXNA 3T6BA 5D4PA 4Q7AA 3W8PA 4NLSA 4OYXA 3A8JA 4I2PB 1IBMF 5LSLA 2ZVSA 2ZJRQ 4CT9A 4J9UE
chains in the Genus database with same CATH topology
3IRWP 1U1PA 1T03B 2GGPA 1DTQA 5ITHA 1YRUA 1S6OA 2XULA 3M32B 5CYJA 4M63A 4NPOA 7FDRA 1IJEB 1TZ0A 4NCBA 2KG1A 2FC9A 2HNZB 2D1CA 4EZ6A 3FFIB 1HI0P 4M95A 4KJIA 3IN5A 4CZCA 5A6WA 1SL1A 2XMMA 4DR5F 3RRGA 4KV8B 4OJGA 4Y00A 3ZZ0A 2DGOA 1VC0A 5KFJA 2XY5A 3POTB 3THTA 4ZHRB 2XCAA 2ZBCA 2QSWA 3VR1A 3H25A 2MHEA 3I31A 1TVRB 1SBRA 1TL4A 2VBYA 4N47A 1MSWD 1YBAA 2KJVA 4A8QA 4TNOA 1VK3A 1DQ8A 3G8SA 4ID5A 3VALA 3NNCA 1X4AA 2X51A 2OPSA 3M6WA 4WYLA 5F3ZA 3THVA 2A1BA 4IG3A 2E5IA 2IC3A 5E5NA 5A8WB 1BWEA 4USJC 1ULRA 3ISZA 4AXJA 5KFFA 5E3RA 2A2CA 4J9SA 4K4YA 2YH0A 5KOWA 2MQMA 4J9LA 3GV8B 2B7BB 4YMEA 3FDSA 3RRHA 1UJ6A 2GO8A 5DO2A 5IQQA 2DB1A 3E51A 7FD1A 2V8GA 1XTZA 3BEGB 3GE9A 3Q23A 2JC0A 4R25A 2WOMA 3DRSB 2G9OA 4HYKA 1XNRF 2X3GA 1S6PB 4AL6A 3CC4S 5K8PA 4LF6F 1FD2A 2L48A 1J5OA 3KLFA 3KFWX 3K5NA 4WJBA 2LMIA 3VAJA 4YFUA 2JH3A 2MB0B 2M9KA 4ED5A 1HBOA 4RUCA 3CDAA 3KKFA 2ZD1B 4WU2A 2L08A 2MQLA 2P6SA 1D9DA 5CYQA 2UUCF 1WHVA 3M9NB 3SCJE 2XSJB 5IZHA 5K14B 2FY1A 4NLGA 3OL7A 4OJ1A 2AGOA 3ENQA 4OI2A 2DHSA 1N6QB 3NWGA 2HHSA 1UVJA 3T5LA 2FVSA 3HHLC 3HVRA 2ZDPA 2HLTA 1C1BA 2MQOA 1YJVA 2VC0A 1NK7A 2DD8S 3C6TB 2YNIB 3MECB 3UR3C 2RDJA 2I0XA 4K4XA 3RW7A 3U1MA 3PY8A 1RJJA 2VD3A 3TA0A 2PE8A 2WSEC 5KG2A 3ZZTA 2HW3A 4FNIA 2AJ4A 3CWJA 1LV5A 2JSXA 3TARA 1ZM9A 4O44B 2VA3A 1NJWA 2PI5A 4CQ1A 4KHMA 3QJJA 1FEHA 3MM9A 1KNZA 1X9MA 1JJ4A 3IFEA 3HVTA 2DNNA 4O3OA 1RT6B 3PX4A 3H98A 2FVQA 5L39A 1NJXA 2EVZA 3AH6A 4RKUC 4ELTA 4DV1F 2B43A 2K1RA 2E1AA 3FRZA 1WHYA 1FKOA 3M1VB 4RWXA 4FPRA 1GTEA 4DMZA 3DLJA 1DURA 2DGSA 3D1HA 3LQVA 4NX9A 3PKYA 3SFUA 5KFRA 1HA1A 1N32F 3NGDA 3GIJA 3HZGA 4DR1F 4QPXA 2YWHA 3QLHB 4EEYA 4HKQA 4YDXA 2FHJA 1BY9A 4M5DA 2HIQA 2UVVA 4JI2F 3MM6A 3I9V9 3T19A 1YVFA 4J9PA 3O6QA 3GWCA 1KLMA 2FGOA 3M2RB 4KGMA 3HJFA 1TV6A 3TYTA 2XS2A 4DR7F 2ASDA 3WZ0A 2GA7A 3C6UA 5J1EB 3EX7B 3DM2A 1TKXB 5A0YB 3BN4A 2E1RA 3CD7A 3PZPA 5KAKA 1YJTA 1VJWA 4NCGB 3PM9A 5T7LB 1R27B 4USHA 5EHHA 4ILLA 2OPQA 2XCPA 1FTRA 5DDRC 4OI1A 3W2VA 1N0VC 3PO4A 5F3TA 3MXHP 4ZPDA 3LP0A 3J7YI 4DF4A 2V94A 4Q43A 1QSSA 4I6AA 3HHLB 4PXCA 2J0WA 3QGIA 3WC0A 2J6UA 2KRBA 3ZZRA 5FJ4A 2MKHA 3UDCA 1VBZA 4PUOB 1KHVA 4PWDA 3DN9A 2O01C 3H5SA 3T1AA 2C3PA 1U26A 3KLIA 3K0JA 3CDEA 4FP9A 5L9NA 2QIFA 5DGAA 2W4DA 4I2QB 1D3WA 1RYRA 1FRHA 2YKAA 1NH7A 2X1GA 3DNCA 2Z4PA 2RDIA 3HI9A 3N0VA 4OLOA 4OZNA 1NRKA 3GR1A 3ONQA 1CVJA 2EFQA 3BN7A 3SCIE 2MKIA 3T5JA 3S8SA 3JTPA 3MHYA 4CO0A 2QLXA 4F2RA 5GAGU 5DG8A 2JVOA 2KZMA 1T3NA 3IWLA 2K3KA 4NZ7A 1WEZA 3I82A 3NMAA 3QGPA 4NZ6A 2L9DA 2E5JA 2YX4A 3QIDA 2A3JA 2E7XA 1VQ6S 5E0OA 4EUVA 5CXTA 4ID5B 3KOAA 3OVAA 2JL9A 3B4DA 1H2VZ 2E66A 3I5AA 2J6SA 2PD1A 2UV8A 1LW2A 1X0PA 1M5PC 2OPSB 3N5BA 3NS6A 2EW9A 2HRUA 1FXRA 4IG3B 2W8LA 2Q66A 3SQGA 3GFHA 2DH7A 4A8MP 1KOHA 1QAJA 1YJNS 4DL5A 3UNGC 4ECYA 3RAQA 2EBGA 2EFNA 1ZTWA 1VQYA 4ZKAA 2CDQA 3MTJA 2J9CA 1VQ5S 1JB0C 1VQLS 1RA6A 3UQSA 4YDDB 2MQNA 2WOMB 2FJXA 3J80Y 3U7JA 1KLNA 2MY7A 3FQLA 3T9ZA 2ZUGA 3I0SA 3KLHB 4A8KA 1J5OB 3KLFB 1S72S 2U2FA 1IBLF 2JRSA 2HGLA 2K8GA 1X5TA 4MYUA 5CCLA 2QEXS 5LSRA 3M4XA 2JC1A 3MI7X 3PVXA 3HFKA 3ZZPA 4YY3F 4NCAA 1YJRA 1YWXA 5CYQB 4HH0A 2KHCA 4KIAA 4O23A 5E3CA 6FD1A 2GFFA 4OZ1A 1OSDA 3CTRA 4DV5F 3M6VA 3M2VA 2KRRA 1FDAA 1VOMA 3DRPB 4DSLA 5LMUF 2HVZA 1C1BB 3I0RA 4GC7A 4DR3F 2N7YA 3MEDA 2L41A 2ZH8A 2PI4A 2PC6A 4N56A 1SB6A 2IM0A 3D5MA 4QIFA 2W7PA 2CPDA 4YP3A 3LOUA 3Q22A 2C3UA 5J2PA 4JUZA 2BACA 1IJFB 5IT4A 4NA1A 1V3ZA 1Q82T 4FVMA 2C2DA 2FJDB 2GX8A 2J7UA 4C11A 2MY8A 1Q8LA 1Q4RA 3MM9B 4QJVA 5KFBA 3CDUA 4I67A 1NJIT 4J9KA 5HI7A 2ZITA 3HVTB 2LCWA 3EGNA 1XR5A 1ZAXA 2ZJQQ 1VQSA 2DNKA 3F41A 1TKTA 2R2SA 2R8HA 3IRXA 3IS9A 3H4BA 4JYAF 1KQSR 2M52A 4X65F 2I9SA 2E5LF 1FKAF 3MPVA 2F8HA 1S1VA 3IAS9 4X4SA 1U48A 2PDAA 3VF0B 2BANA 4BBYA 2ZH1A 1PC5A 3GSDA 4OJHA 4PCQA 4ZP6A 4K0KF 3CUNA 4WFBQ 1KOOA 5B09A 2CQPA 1BQMA 2AP6A 3JTOA 4XAKA 3D28A 4OLPA 4RBVA 4YEAA 2BR0A 3L3CA 2B3TB 2J76E 3OTEA 3M6UA 4J9RA 1JNRB 3KHLA 3QIPA 4PXBA 2JHEA 2BM0A 4DWIA 5GAHI 2IBKA 2NQPA 1ZM3A 4OX6A 5GADI 2VBXA 2C2RA 3MM6B 2FLPA 1FJ7A 1OS5A 4FXVA 2W9BB 1YRXA 1IR0A 2MPUA 2YY3A 3M9MB 1KLMB 2KJWA 2ZC3A 5FIIA 1RKJA 2DVIA 4QPTA 3PW5A 2JLFA 1FJGF 2W9CA 1C4AA 1TV6B 1UAWA 2UUBF 3LO3A 4CIOA 2OSQA 1U4BA 2DIVA 3C6UB 3IR5B 3OHAA 3DM2B 3H2UB 4WFYA 2HZCA 2V8HA 3FGVA 3R3TA 4OX8A 4G6VB 3TAMB 4DF8A 2J0XA 4KO0B 1WF2A 4TYAA 4K4ZA 3NP5A 4LF5F 3OR2A 2OPQB 5AXLA 3Q24A 4JI1F 1XMQF 4Y2MA 4IR9A 3W2VB 1SJ4P 4URQU 2QA4G 2HNYA 3TO8A 4P6QA 4C2MA 1LWCA 4XK8C 3MF5A 1YRTA 4DFKA 4OI0A 1L3UA 1RT5A 5DG9A 1Y7PA 2HHHF 2VKRA 1Q79A 4DLEA 3OHBA 1XEZA 4OJ3A 4PWDB 3BO4A 4J9QA 3KLIB 4TU8A 3DCAA 4PPDA 1B0TA 4ZVFA 1KTVA 1H0HB 1ZPVA 5A6PA 1DTTA 3OXFA 3HT3A 1A6LA 1Y9OA 1U47A 4HT5A 2MQPA 3N9UC 3QGGA 1S48A 1IN0A 1Q8IA 2ASYA 1QAIA 1R31A 4LMZA 1X0FA 1VBXA 3KK1A 1DFDA 2F4VF 1VGYA 3MM5B