3TZYA

Crystal structure of a fragment containing the acyltransferase domain of pks13 from mycobacterium tuberculosis in the palmitoylated form at 2.2 a
Total Genus 179
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
179
sequence length
464
structure length
464
Chain Sequence
ELPGVTEEALRLKEAALEELAAQEVTAPLVPLAVSAFLTSRKKAAAAELADWMQSPEGQASSLESIGRSLSRRNHGRSRAVVLAHDHDEAIKGLRAVAAGKQAPNVFSVDGPVTTGPVWVLAGFGAQHRKMGKSLYLRNEVFAAWIEKVDALVQDELGYSVLELILDDAQDYGIETTQVTIFAIQIALGELLRHHGAKPAAVIGQSLGEAASAYFAGGLSLRDATRAICSRSHLMGEGEAMLFGEYIRLMALVEYSADEIREVFSDFPDLEVCVYAAPTQTVIGGPPEQVDAILARAEAEGKFARKFATKGASHTSQMDPLLGELTAELQGIKPTSPTCGIFSTVHEGRYIKPGGEPIHDVEYWKKGLRHSVYFTHGIRNAVDSGHTTFLELAPNPVALMQVALTTADAGLHDAQLIPTLARKQDEVSSMVSTMAQLYVYGHDLDIRTLFSRASGPQDYANIPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Biochemical and structural study of the atypical acyltransferase domain from the mycobacterial polyketide synthase pks13
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
molecule keywords Polyketide synthase PKS13
total genus 179
structure length 464
sequence length 464
chains with identical sequence B
ec nomenclature ec 2.3.1.-:
pdb deposition date 2011-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00698 Acyl_transf_1 Acyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.250 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Malonyl-CoA ACP transacylase, ACP-binding 3tzyA02
3.40.366.20 Alpha Beta 3-Layer(aba) Sandwich Malonyl-Coenzyme A Acyl Carrier Protein; domain 2 Malonyl-Coenzyme A Acyl Carrier Protein; domain 2 3tzyA01
3IM9A 2QJ3A 4AMNA 3EZOA 3R97A 5DZ6A 3TQEA 2CUYA 3RGIA 3CJ8A 4RR5A 3BV8A 4AMOA 3QATA 3TZWA 3HHDA 3HJVA 2C2NA 2H1YA 4AMMA 2G2YA 4RL1A 3TZZA 2G2ZA 3PTWA 4QBUA 2JFDA 2QC3A 3R8YA 3IM8A 2G2OA 3TZXA 1MLAA 4AMPA 2JFKA 3SBMA 5DZ7A 3TZYA 2G1HA 3K89A 3H0PA 1NM2A 3G87A
chains in the Genus database with same CATH superfamily
1NO8A 3T1HF 4DR7J 1X8DA 4ATNA 1GMWA 4CNZA 2AU0A 3JQMA 1WOSA 3PO5A 2XMKA 4B9LA 1W26A 3QPIA 3B6BA 2ZZTA 2GMHA 1U09A 4JV1A 3GJRB 2LDYA 3EX7B 2V8VA 3IGNA 4RX6A 5MAOA 3BSCA 3M1VB 1WF1A 2EBEA 1N56A 1RT3B 4CM2A 1U1OA 1LV5A 2CPZA 3HFVA 3G2XA 3PR4A 2KFNA 2AF6A 2GIRA 2VIHA 1SQGA 3FQLA 1QVFR 1WHWA 2QYGA 1Q8KA 1TL1A 3CEDA 2FHJD 5B09A 3P45B 1GH8A 5M2PA 5CABA 4WYWA 1EETB 4KV8A 3VCDA 2E1CA 1KVKA 2HFUA 1JLEB 3P3DA 3T1HJ 3E8OA 3LP1B 2E29A 5T7LA 4ZIVA 1KNZA 4X62F 2C2OB 1TL5A 4DR3J 1U49A 4PXDA 1C2PA 1DLOB 4O4GA 2HNYA 3RBXA 2DD8S 2DB1A 2H1YA 3MPVA 1NJIT 3P4UB 3SFGA 4EK2A 5SZTA 3F44A 1JKHB 4WK1A 5ETPA 1XQIA 2EFVA 4YS2A 3OUYB 3AQOA 1D09B 2ASYA 1G1XA 1VC6A 2B6AA 4C9DA 2B9YA 4B9SA 3ZZ0A 3EE3A 2OFHX 1RTHA 1HBNB 3BO3A 4DV6J 4OZ1A 3FFIA 4PQAA 3ZZRA 5KAKA 3CCLS 2P9CA 3AA8A 3M8SA 3GIRA 2MQOA 2KTQA 5CZDA 3EVOA 1HWKA 2V34A 1AB8A 2RKIB 2V67A 3QJLA 1CJUA 2FJBB 4ETZA 3Q8UA 3UDLA 3CD0A 3UR3C 2XHWA 4FXVA 1RT3A 3ZTPA 4X4SA 4DR4F 3I0RB 5A2QY 4C3MA 4RW6B 4ER8A 1QAYA 4FKYA 4TU9A 2B8PA 3HHDA 2ZZMA 2FIUA 3W8GA 1P9YA 4F4XA 1UCNA 3I9V9 4EEYA 1J5EJ 2JEJA 4QBUA 3RB6A 4I7FA 2IA0A 2NUUG 3DLBA 1CPZA 3V81A 1O6XA 2GVDA 2WVEA 4MYUA 1U26A 3FDSA 4QR2A 3H4DA 1KQGB 5B0AA 2Y1RI 1TMJA 3OLAA 3KDOA 3DMJA 3EZUA 3FCHA 2B4PA 2LQBA 3FKBA 3LH2S 4DI6A 2RQCA 1N5YB 2GA7A 2XI3A 1JLFA 2JDJA 2M0GB 5C24A 2QLWA 4JI5J 4JV2A 1JJHA 1HD1A 3VVUA 2LXFA 1FE0A 1S0NA 1ZZFA 2EEYA 1TL3B 3GIIA 4NEYA 3BSOA 1N36J 1NMEB 2KRRA 4RUAA 2OH2A 2HZCA 1YIJS 2OTLS 1KONA 1RK8A 4DQPA 5L1LA 1VQYA 3CD5A 3DKDA 5E3AA 4F3OA 1V6HA 3K7RA 1Z1ZA 3ZNJ1 4PCQA 3D1HA 1RWVB 1MN7A 2BJ7A 2EFGA 1QAXA 1TQLA 2G13A 2KXHA 2V94A 1UEUA 2YX7A 3A4TA 3W2WB 4HL9A 1QSLA 2HYIB 2E5LJ 3GV8B 1S72S 5L1KA 4DWIA 1SQFA 2OEKA 4Z7CA 2CQGA 3PYGA 4ZLJA 3J81U 2RSQA 1RHJB 4DL5A 2A6MA 4KIAA 1SC4B 4J9VA 2M4MA 2GJ2A 3HCXA 3ADAC 4QWCA 3R2CJ 4DUTA 8AT1B 2DXEA 2HURA 1DURA 1R8AA 4RW8B 3R9LA 2CQ1A 2FPHX 4USUA 2XMWA 2FVRA 4Q2MA 1WNEA 4ILMA 4K0KF 3DLEB 3W2VB 3FBEA 1WELA 2GGPA 1ZTTA 4KH1B 1F6TA 1RBLA 3S01A 3R7BB 4YR2A 1LQ9A 1OMSA 1YGYA 1U1LA 3T5JA 4LFCF 5I4MA 3R5BA 4X2BA 2HFSA 4CLPA 1VRTA 1VQLS 3NG8A 3G82B 1IKXB 4Q5VA 2HBZB 1VRUB 1RDRA 4JI0F 1UP1A 2IC3B 5D0EA 2GVZA 1S6OA 5GAHU 3MPWA 4W92B 3J81Y 1X0PA 4LSLB 4TY9A 3CCSS 1GXTA 2MMYA 2OEMA 4DR2F 3DNCA 2XMJA 1EP4B 1FX2A 2HBRB 2R2UA 4KPYA 2UXBJ 1X9SA 4WP8A 3UDCA 1CJVB 1BQNA 4P71A 1G2EA 4GMKA 3H40A 5L1JA 2C28A 4P2MA 1B7FA 1VR6A 5L39A 4MK9A 1UMJA 4EI2A 2DJWA 4RNMA 3G96A 2Q66A 5CQGA 2HNZB 2FUG9 4JOUA 2EG1A 2V4JA 3K8WA 3PW7A 1ZM2A 1TUVA 4KJIA 2ZC4A 4CT9A 4I4BA 5K9FA 4C8OA 3T9NA 2YKMA 3PCOB 2OSQA 3TJ9A 5DM6Q 3CPWR 1CLFA 1MN9A 2LU2A 4JI8F 4ELVA 5J1EA 1OY6A 3MD1A 2CQ3A 3QLHB 2B43A 3SSRA 4CQ1A 4TQSA 4MH8A 1H3DA 2OKQA 2OPQB 3W5ZA 5C7PA 2OELA 2QGFB 1Y0HA 4Y6IA 2I5JA 3SQGB 3OHAA 4DUYJ 4N77A 2GO8A 2GGPB 4OYXA 4USTA 3H2VE 1ELOA 5KTQA 5LXYA 1U6FA 4M5DA 4DR3F 1RACB 1FWKA 2ZNYA 3OD2A 1FD8A 1Y00A 4CI0B 4NMLA 4CTAA 5EWFA 2VPWB 2YNFA 5F8LA 5AE3A 3KLHB 3UNYA 3FVYA 2F8HA 4EU0A 3IM9A 3I55S 4DV3F 4X64J 2HHUA 3L95X 4WP9A 4ES2A 2L08A 3HHLB 2CNNB 4DS5A 4K5RA 1QE1A 2HS0A 2NZCA 2JSXA 1HYSB 2B9XA 3PNIA 4NCGA 5ADZA 3T5LA 4HEA9 2G2ZA 3TI0A 2KT3A 1I94F 2DNYA 3I4HX 4MIWA 1MROA 2Y9HA 1AA1B 2J7WA 2E44A 2GQCA 2N7YA 2XLIA 1C0UB 1KHVA 3MAHA 1LWFB 4NOHA 5IWAF 3CCZA 3JSYA 2ZH6A 1KD1T 3TJAA 1C0TB 1WUUA 2CG4A 3MEEA 1TKZB 3DDNA 2D3UA 5JVHQ 3OJUA 2E1MC 1WSVA 4MMOA 4S0MA 2MSTA 2Q79A 3V2UC 2HHHJ 1N5TA 1SKUB 1CG2A 1VIOA 2NUHA 2F40A 1BC6A 1U1NA 4HVZA 1SH3A 1TTHB 2FZGB 4DV2J 4LJMA 1N6QA 1CULB 3PYEA 3SQGA 5IV4A 3W5YA 1YRXA 3JTOA 4ZLPA 4J37A 1HR0J 4EMDA 2JEIA 4LF7J 3GFHA 3HZEA 4OX9F 2VC0A 2IM0A 2ZH7A 2ZH4A 2Z2LA 3BQ1A 3DXSX 3FC9A 4OZNA 4RNHA 4L6V3 2EI5A 4C7QA 3QYYA 1RTHB 1PIEA 4WTOB 1IJEB 1NSKL 2PMWA 4MKBA 4OIXA 4KGXB 5KG4A 3TVZA 3R5DA 1U8SA 2FHMA 3H98A 3W60A 2P9GA 2MKCA 2BJEA 1FEHA 3TJ8A 1SV5A 4CH1A 2ROGA 4MTPA 2Z2MA 3RRHA 1S9GB 1TVRB 4P9SA 4TY8B 2OIHA 2BZ2A 2EFOA 4JV5J 4WU2A 1QLNA 4KO0B 4EUVA 1DLOA 2AJ2A 2JL9A 1VJWA 1GQEA 1RA6A 3IGVA 3MWBA 4FDFA 1GT8A 2DNKA 4NL5A 5EHHA 4AXIA 5CZVA 1B0VA 3DRPA 4U67Q 2DYAA 2HVEA 2GVDB 3A3OB 1ZAXA 4OX8A 4Q8EA 2V9WA 2L9WA 3CO0P 3UQSA 1IBCB 4K4SA 5A8RB 2HQDA 2QZ8A 2HFNA 3PX4A 1X5SA 2KKHA 1NSAA 2QG9B 3AHPA 3QGGA 4H4OA 1SJ3P 2WBMA 1YBUA 2XSJA 2R7UA 4TQRA 3TA2A 3DLEA 2MZ1A 2ZD1A 2A3JA 1Q5VA 3CW2C 3CDUA 4DPYA 1N32F 5FIIA 3KXDA 1PSDA 1KR4A 3IP0A 3Q2TC 1Y3JA 3C6TB 3X1LB 1KLNA 2J8AA 1APSA 1IBMF 2DNNA 2BUNA 1CJKA 3DM2B 1VFJA 3DOMB 4PWUA 4ALZA 2W9CA 3EYZA 2ZITA 2HQFA 3C15B 4G65A 1NEEA 2D41A 3AY0A 1KRPA 1RT7A 5B0DA 2Z8QA 1FNOA 4UZBA 5H9FJ 3MR2A 4U9RA 3CCJS 5JXSA 1WACA 3HD1A 4BBYA 1VQ8S 4WTYA 1Y5NB 2BRKA 5I3PA 2J8SA 3BR9A 2QA4S 3LW5C 4ENOA 3MCOA 1OYDA 4WIQA 3HHKA 4BC7A 4LF9J 2V4RA 2HGMA 3A8KA 3BKUA 3NY0A 3NCPA 1WOOA 2IM3A 2ZUGA 1HHTP 2FHJA 4MJKA 3QT5A 1VQ5S 3FQKA 1DZ5A 3EGVA 3QBCA 5D78A 1UVJA 2Z2YB 2YWEA 3DCAA 4UUWA 4O3PA 4AL5A 4PWWA 4P6QA 2V0NA 3RGIA 4WU3A 5H9EJ 3UWTA 2E7XA 1XC9A 2DGVA 3JS9A 3S1TA 4AMMA 4IOCQ 1KS2A 3QLHA 3QJJA 2RQ4A 2LXIA 4ZS6A 3KLIA 1C4CA 1VIXA 4V19J 3KLEB 3GR0A 1LWFA 1FI4A 2LKZA 4QU7A 3N9UC 2G2OA 1HIYA 1FDNA 4JI1J 2WVDA 4B08A 4UT4A 4X4VA 1S0OA 4F0MA 2KU7A 2NSCA 3MFHA 3ETOA 3CCWA 4OHYA 2CIMA 4ZVUB 2ZH8A 4IO9Q 3SEOA 4C0BA 9RUBA 1IKWA 4EBEA 3ENQA 2OPPA 5HVHA 3FUYA 4A4JA 1QAJA 1RABB 4R8UA 1FDDA 3SDEB 1DTQB 2UUAF 5IV3A 2IPOB 5CZXA 4PABA 4OYWA 3PRDA 4WYLA 4YP3A 3V4IB 4Q44A 2X1AA 2AJFE 2J9DA 4Q45A 1U47A 1NK7A 4YY3F 2VF3A 2W4CA 4NASA 3UDEA 3ZNUA 3J80Y 2IYGA 3NGUA 1NK6A 2Z57B 1H72C 4OMFG 1FK9B 3L7OA 3KJVB 1Q78A 1IBMJ 3D67A 1WWHA 2OUGA 3EDQB 2GJFA 5ETQA 3MUVP 2X51A 2M5YA 2Y3YA 3QWUA 2PA3A 1K1SA 2D74B 4OFZA 5IM0A 3CC4S 1X4FA 3JAMU 3ET6B 3ONQA 1A9NB 3KJFB 2F3JA 4J9SA 5G4DA 3S8SA 5IT9U 2J9CA 5ITHA 4M94A 3J7A1 1M5OC 1UZDA 1E6YA 5KT7A 4RU9A 2XS2A 5BR8F 1YSJA 2F5GA 4OZJA 4WIIA 2XHCA 2R7VA 3GJSB 2AGQA 4PAAA 1NJYA 1R3NA 1UVKA 4M5JA 2DGTA 2HAFA 3HHEA 3GE9A 5IT4A 2RAQA 1BE4A 3BYRA 1RT2A 2W4PA 4MT1A 5HQMA 1RT6A 4CDIA 1Q8LA 3HJVA 3HM9A 3SQOP 4JI2J 2L41A 2ZHOA 2MLXA 5KFTA 5IZHA 3UDVA 3PW2A 5KG2A 1S77D 2ZH1A 4EZ6A 2YNHB 1ZBTA 1QSSA 1FD2A 1HWLA 2AGPA 2OPQA 4IH7A 5D0RA 3OTBA 1TL4A 2JFKA 1V3SA 3CJRA 2XLJA 1F5AA 1NSPA 1S48A 1L3UA 4ID5B 1VQOS 2R8JA 3I31A 3R1HA 2YKMB 3WQPA 1KQKA 1LWCA 5CAAA 4K50A 2M7SA 2CJKA 4WE1B 1Z4UA 4DV7F 2XSFA 4ZPBA 1NLKL 3DYAA 1HNIB 2M2BA 4UQGA 4U95A 2IRXA 3VAKA 1RJJA 3BPDA 5CA5A 5DZ6A 3GWCA 3M32B 5IXUA 1HPZB 2KG0A 4DL6A 4QWEA 1U7LA 5F8MA 2DNPA 1U1MA 2K06A 5K8PA 1VBYA 1RTDB 2JLGA 3MMAA 1KLMB 2W8LA 4ZJOA 2CRLA 3FRZA 1FF2A 3IM8A 3BKFA 3KLGB 1N34F 4LQ9A 3HVTB 5KFKA 1S5ZA 4OL8A 4LRFA 4QWBA 1C0UA 3RAMA 2BXJA 2EBGA 1T9YA 3FCVA 4FP9A 1RU2A 1NBEB 2FJAB 2GAGC 2G0CA 4OHZA 4JYAJ 4RWWA 1X4GA 1TR0A 4B3MF 4KBIA 1PG5B 1KC8T 3M8QB 3CCQS 1KVJA 4I67A 2F65A 4XPCA 3K17A 2DVIA 5LJ5Y 2V9KA 2LEPA 5EUHA 5EX0A 3H4BA 4I0WA 3KWMA 5EWEA 2G1DA 1V3ZA 2AMCB 1WEXA 2FHKA 2JC1A 2WW8A 2OMOA 2JWNA 3BBFA 3ILOA 2BX6A 3BQ2A 2GHVC 3KFWX 2XMAA 3IBFB 5HVGA 1NJZA 4RL1A 3W61A 1RAEB 1U48A 4OYOA 2NQPA 4DU8A 4G1IA 2W24A 2A6OA 2R9LA 3IWLA 1A6LA 1JB0C 2AX1A 4CRJA 3N01A 3M9MB 3OW2R 3C46A 1FJGJ 4B3RJ 4KR0B 2VG7B 4QQBA 3J80U 3OVSA 4FYWB 5GVQA 1PJ6A 4KYZA 5J2NA 2CPXA 2A2CA 4YFUA 2QL7B 3GFZA 3DGVA 2FYXA 5HP1B 1IBKJ 1I5OB 5KG1A 3QO9B 3Q8RB 1DJ0A 4DX6A 4IFVB 5DDOC 4QW9A 2PEHA 3J7ZT 1NHUA 3CB4A 4Q2LA 3HSJA 4RW8A 4WFYA 4X84A 1RWKB 3KJNB 1IR0A 2HWTA 4IYQA 5GADI 2E5HA 5SUHA 2KYZA 4HACA 2KDOA 5I3UB 3FSYA 3I87A 3AAWB 5HN0A 5DQIA 3P6YC 1TU0B 4HH1A 2IVMA 3TEHB 4NLVA 4CYUB 2BJ1A 1H38A 1RE1B 3BBBA 3NRBA 1Q5YA 2KVIA 4F26A 1OPZA 3C2PA 3ENVA 1JXVA 2ZJPQ 3RW7A 4ZHRA 4RNOA 4I2PA 3LP1A 5KT4A 3K5MA 1VHFA 2NPFA 2JRSA 1VQSA 4X4OA 4HHHA 4PQUA 3LP0B 3PKMA 2UUCF 3K5PA 2R8KA 4B17A 1HD0A 2LEBA 3OSNA 2PI4A 1H2VZ 3PACA 2N4CA 1Y9OA 2B5JA 3KJVA 2L3MA 2LQ5A 3C6UB 3N6MA 1Z2ZA 2M88A 3I5BA 3AQPA 4J90A 1FRIA 2VU5A 4QYZK 2OD4A 4QIWD 1IBLJ 4LF6F 2CUYA 2QIFA 1H2TZ 2VQEJ 1FKOA 3IBCB 4Z37A 4QCLA 4N56A 2OTJS 1FFSB 3L7UA 4G1PA 2ADBA 4CNYA 4LVNP 1FKPB 3GLJA 2XBPA 3VGSA 3F0NA 3KDNA 3M8RA 4HHUA 1C1BA 2WRMA 1GMVA 2Y8WA 2GC8A 3OTCA 4ZITA 4UZCA 1D9AA 1HI1A 3MF5A 1N5VA 3I0RA 3M8YA 3AOCA 3UNGC 1ICEB 2WVCA 3GJTB 1R27B 2BABA 4M5IA 4DZDA 3W66A 2DPJA 5J1EB 2J6UA 3MCSA 3RZAA 4RLEA 1W2BR 1NUEA 4OI0A 2VOPA 4ZVEA 2UZAA 5BR8J 4O3RA 1RTDA 1SXLA 4ICLB 3W9IA 2CFXA 3KHHA 4FYDA 5EN1A 2XMVA 4ECSA 1S4EA 2MQLA 3GCXP 1O8BA 5DLFA 2F4FA 2VDIA 1WJ9A 3H5UA 4B9MA 2QFIA 1YI2S 1YITS 5DG8A 1UVIA 3PRBA 2HPUA 3EJMA 1JLFB 4FNIA 3VV2B 1DQ9A 3I4PA 1RISA 3M6VA 4F4YA 4LF5J 1SI9A 3TA1A 3RB3A 3MOJB 1SVDA 3OBIA 1PAUB 4OLOA 2UUWA 1UWBA 2RJZA 2K1RA 1N0UA 3OTDA 3KNAA 2IYIA 2RU3A 2UXCF 2BEFA 4BCAA 1BWVA 3LALA 4B3TJ 1E6YB 2RT3A 1ZS6A 1REGX 2ZJQQ 4UY85 4PUOB 2Y8YA 4PRFA 3D28A 4DCPB 4XK8C 2J9DE 1VRUA 3OXLA 2A18A 2HHTA 3JAMY 1FTCA 3ILIA 1HKAA 1TFWA 2R2RA 5IFMA 1FXRA 2YWHA 3OL8A 1KVIA 3G71S 4QIFA 1Q1KA 3HSZA 4Y0FA 3MEEB 5GMEA 1WDDA 2KHCA 5C2CA 1HW9A 4ZCKA 3I0SB 2DR9A 3GV7B 2WONA 2BA9A 3I5CA 2E5JA 5DQGA 2VJUA 3NS7B 5JMNA 2F4VJ 1Y5IB 3TZXA 4EO8A 2KL8A 2CQHA 2F1FA 1T9VA 5KFOA 2QMWA 5EX3A 1O51A 1CJTA 5L38A 1S49A 4WKRA 2BJ9A 1N5QA 1UTAA 2MLYA 3CD6S 3AODA 3HX9A 3RG6A 4TU7A 3QIDA 1U4BA 4BLGA 3A3PB 1XMQJ 4LF6J 2HBQB 4XTTA 3RUBL 4FXWA 5DDPC 3NGRA 4OX7A 2H65B 4FKXA 1Q86T 2SXLA 3PX0A 1EP4A 2NXNA 4WFBQ 3FSIA 4LF4J 1S7HA 2XEXA 4NLOA 1RBAA 2OD6A 3PHEA 5KFCA 3TUJC 1ZOTA 3UO0A 1FRJA 5KT6A 2DY9A 4TU8A 3QSYB 2AYGA 2G2YA 5K8OA 5KG6A 1WTBA 1AZSB 1JLGB 3U27A 2PGCA 3AXKA 3BGUA 4M5LA 4R25A 4WPAA 5BJRA 3BO4A 3RB0A 1HQEA 1YJ9S 1ZH5A 3KG1A 3J81j 1DAXA 1MWZA 5J2QB 1B64A 1UVNA 3IC1A 1T3OA 4LRBA 1MLAA 3AJ1A 1ULRA 4TN2A 2DEJA 3B82A 4WCEQ 2C2EA 4H4KC 1KFSA 4X66F 1WC6A 3MTJA 1MMDA 3ZZYA 2AW0A 5A6PA 2RNEA 1AFIA 1WI6A 3WZ0A 1JLAA 2CPYA 3KUHA 4C98A 1PCAA 4H4KA 4DSEA 2MPUA 2BE2A 2ROPA 4LSZB 1LXJA 3RAQA 2F4VF 2F9JA 4ZVQB 4DG1A 2CPJA 5D4OA 3TUZC 3DRSB 3OR1A 2IMWP 4RBTA 1FT8A 2BQRA 5D8HB 1JNRB 3Q2SC 3BF4A 5CD4H 1D8ZA 4ELTA 2ZJRQ 5AXLA 3C16B 4B3OB 1BQMB 4PYDA 5LL6d 1QD1A 3GR1A 5HBMB 4JUZA 4IQXA 3AB2B 3O5TB 4OI3A 1C1BB 2LP4A 3DYAB 1ZPVA 2UU9F 3UPFA 3CJ0A 3LWMA 2CWKA 1U1PA 2YY3A 3TX0A 3W3SA 1K73T 4P2FA 2CJXB 3UD5A 2RB7A 2JX2A 5DLGA 5CYQA 3QRQA 1I3OB 3M9NB 5D0GA 4ECUA 3DRRA 1T11A 4NMXA 5E5NA 2BRLA 4R5PB 2W1BA 2R7WA 3PW4A 4UY8T 1WKLA 2VFTA 3LA0A 3CJSA 4GVLA 2B4OA 3RBZA 4JI7J 3D7SB 3PIOQ 4RUHA 4HTIA 3JSRA 2E7WA 4DV0J 4BHQA 2CQ2A 4JI6F 1GEHA 2D69A 1ZA2B 3QIPB 3GG0A 4C4WA 2BANB 3K5LA 1BY9A 2MLZA 3MAAA 2CPHA 4ZVRB 4X66J 2W2QP 4IR9A 3NGTA 4C3KA 4H4MB 3EMTA 5G0RB 1NPPA 4ECVA 4B3OA 4YDDB 2FB0A 4LFAF 3KG0A 2K7JA 4IRKA 2A0FB 3M6WA 3W1YC 3MCNA 5E3PA 2DGSA 3NNHA 1CEZA 3C66A 1FTRA 1HNVA 1NDPA 3OR2B 1SKSA 4DV2F 5HQ8A 5KFZA 2LLZA 1I1GA 1RT1A 2ACMA 3PFEA 3H59A 4U7UK 3KG4A 1TL7A 5KFUA 2LECA 4FF4A 1IWAA 3OL9A 4X4QA 4P2XA 4AUKA 2IM1A 1SC3B 4W4MA 3ETMA 2ZBPA 4M8LA 1LWEA 4Q7AA 4CLYA 5LOQA 4N5SA 1YJNS 1TKTB 5D77A 4F4KA 4DQRA 1XNRJ 2KJVA 4ZPWR 4U8VA 3Q23A 5HP1A 3TARA 2UXDF 1VHIA 1EETA 2EXUA 3HT0A 3M30B 2BKPA 4NXMJ 2FLPA 2C3YA 2NXEA 2UXDJ 5AE1A 1RAFB 5CYJA 4DU7A 2CPFA 3P49B 4USVA 4MFBB 1F9EB 1RAAB 3F73A 4GVBB 1OPIA 1QAIA 2H5JB 2VQFF 1S76D 2V4QA 3KUEA 1M5PC 1RBOB 5C25B 1FHTA 1F9FA 4Q43A 3EZ5A 3VAMA 1NH8A 2M8HA 5ETNA 1K1QA 3H8YA 4RWXA 1FX4A 2LQJA 3IXQA 1LNQA 3NOCA 3LUYA 4GO5X 4PUOA 1R7IA 3H90A 4NE9C 4K59A 3N6LA 2C3PA 1WI8A 2CQ0A 3MAAB 1JLEA 2CQBA 3T5HA 4E98A 2WCXA 3O1LA 2AEMA 2BJ8A 4X64F 2RIJA 2VJVA 1H7WA 4FF1A 3HD2A 4NA2A 3CMAS 3CCES 2AYBA 2V69A 3DHXA 2AV5A 2MTLA 3FCWA 5LT5A 3MI7X 1KTQA 4RR5A 2XGQA 1JLGA 1N33J 3ZO7A 3C19A 1V9OA 3M9OB 2YKOA 3IG1B 1N0VC 1FFWB 4QPXA 4X65J 3SSQA 2HZAA 1EX8A 3I0SA 5FLXU 2WBRA 2GW8A 3TW0A 5A0YA 2W9AA 3W63A 4DLGA 2V6AA 3DMJB 5ETTA 4R0JA 1VC5A 1N32J 4ANCA 2W01A 5KOWA 4WZMA 1OSCA 1UPPA 2VG5B 3H0PA 2WOMA 3G8QA 2E5GA 4A8XA 2DNQA 4I7FB 5A8WA 5KOXA 2XY7A 3DLHA 1XIQA 3BGRB 2ZOMA 5D4LA 4JV0A 5B0BA 3IA0A 4UQTA 4F25A 2GAHC 4LREA 1A7GE 3LAKA 1HNIA 3DOKB 3O3LA 4CLUA 1YKWA 4DV4J 3GMGA 4OYIA 5KFYA 2J0SD 4DX7A 2C3MA 4D3GA 2H48B 2VBZA 5J2QA 4NXNJ 3T3FA 1FDBA 2O1PA 4IFYB 1J5EF 2QMXA 5CD4A 2O3DA 2XB2D 2JVOA 1YK9A 2D3O1 1WF0A 2MHEA 4Y65A 1ZZNA 3ZTSA 1SBRA 3R3TA 3JSMA 2BV3A 1JLAB 2E7VA 4JV5F 3D9BA 3TVYA 3WX8A 4DR4J 3T6BA 2WONB 3Q24A 1S7IA 4ZVOB 4WXOA 1DHMA 4A8QA 1U1QA 2B6AB 2CQIA 4NI2A 2YH1A 1YBAA 2HNDB 2YKAA 2ZWOA 3Q89A 4NLRA 1T7PA 4A8YA 1NK4A 1S1UB 2PSZA 4IG0B 4C2MA 3VZHA 3CF5Q 4AYBD 4KSEB 1IBLF 4YHHJ 2RS8A 2VC1A 4QZVB 5KFXA 5FLXY 2I0XA 3NS6A 4LBPA 4RUCA 3G8TA 3JTNA 3NNCA 5LMUJ 3C14A 1RWXB 2JVRA 5B0CA 4HR2A 3NP5A 1P27B 4I2QA 2FJXA 1F5BA 3OSPA 3FEXB 2W2PP 4PG8A 2MZJA 2K2PA 4KV8B 4USMA 3K57A 4ELUA 5IT9Y 3O2IA 2ZDOA 2MKKA 2XCAA 3HF5A 5LMUF 1HQEB 2GMLA 4CWBA 2FJVA 2CDRB 3G6ES 2VFVA 2CNKB 3JTPA 1BD6A 2CQDA 4P75A 3SCKE 1CVJA 3H5XA 1P9QC 1ROFA 5MLCV 2DNMA 2J5AA 2MKSA 5ETOA 3CUNA 4JI4F 1IKYB 1AFJA 2F7VA 3UCZP 2ZBCA 3J7YU 4LQ3A 1JKHA 3OUYA 2FDNA 3M2RB 1NM2A 2UUTA 3ISNC 1U25A 4ED1A 2HHXA 3CDBA 2YNGB 3D0HE 3RR7A 3TAMB 3J7YI 3D54A 3CDAA 4CP5A 1YWXA 2WOMB 2Z0GA 3BH7B 1WD6A 1IUJA 4TLRA 1X31C 4N8NA 1XEZA 4DS4A 2QYCA 3R27A 1RWNB 4NLYA 1T95A 2VPZB 2DGOA 4IO1A 4NI2B 4ZCMA 1JJ4A 1UA0A 5HLFA 4JI3F 4P7VA 2PMZD 4M5MA 4P72A 3R8YA 1LEOA 2VV5A 1MMLA 2CPDA 2J7KA 5KG0A 3VAHA 2OPSA 3M2VA 4DV1F 1SL2A 2R7SA 4LMZA 4LR7A 4CM0A 5A8KB 4JI3J 2GO9A 1RZMA 1RTIB 5B0GA 3CJKB 1KTVA 5LSLA 3AOAA 2HW3A 3M30A 2VUGA 4YB1P 2WK4A 1YZ6A 1O0PA 5F3TA 1SQEA 2B5JB 5FDLB 2KB2A 1K44A 4ED4A 4EWTA 3Q22A 2HMIA 1S4FA 4LFBF 1S1VB 1WEYA 2ILZA 5DDQC 4K4TA 1KBRA 2BMBA 2JJ4D 2MDAA 1JLCA 3GYXB 3HVWA 6FDRA 1F5CA 3C15A 3AD7C 3I5AA 1UFWA 4GRSA 5RUBA 4O44B 2ALZA 1PGZA 3OPKA 1YTYA 3BDPA 2ASDA 4ED5A 3A12A 2MQNA 4GVBA 2CZ9A 2QSFA 4B9UA 2PMHA 4WXWA 2JFDA 3B4MA 3NGKA 2C2RA 4LRDA 1YJ7A 4ZCIA 2FGCA 3TA0A 5DETA 2MGZB 1F2GA 4OJGA 3BM7A 2Q6CA 1B0TA 2GFFA 3QAUA 2DITA 4P52A 4TVAB 1Q7LB 3SCLE 2V2QA 3WBZA 5LMNF 3D6MB 2FVQA 3OFEA 3G6YA 4OYZA 1YRTA 4ZIWA 2JLEA 2BACA 5JJBA 4FPIA 1NK8A 4J9UE 2AT1B 1RHMB 1HBMA 1TL7B 2RRAA 1S79A 4N8OA 2KM8B 3D66A 2ZH2A 1XNQF 2HRUA 4NZ0A 2QV6A 4ZP6A 1T05B 3BDEA 2W2NP 3FBBA 3PJXA 3C6UA 2HHQA 1NHVA 3RU0A 1M0SA 1L3VA 4ED8A 5A2QU 3T1YF 4HI1A 4NCBA 1HYSA 7FD1A 3D5MA 4ZJQA 4G6VB 2O01C 4DN0A 4F4ZA 2R4FA 3GSDA 1X4DA 1CJVA 4H4MA 4FS1A 3HHNB 4P10A 3GG1A 7AT1B 1Y7PA 2Z58B 4L73A 3MEGB 3VGVA 2UVVA 2KXFA 4Y2CA 5HMZA 1Q95G 3CDWA 2A2DA 3C8YA 3SMZA 4LSLA 1KQSR 1RT5B 4OV6A 5KFRA 4Q0BB 1ITPA 1DTTA 1URRA 3CO9A 2PI5A 2H5EA 1YVFA 3NCQA 1GX5A 4F7VA 2RVJA 2NPIA 3AH6A 2DH9A 1S9FA 2AZ1A 1QY7A 2IJRA 1IXKA 1S12A 3T41A 5D3GB 1S1XA 2N82B 1Z2LA 1JIHA 2DNLA 2E1RA 1HNVB 2EKYA 5AXKA 2RMLA 3H25A 1H7XA 5I3QA 4DFJA 4A8FA 2QL9B 2LVWA 2BE7D 3VGUA 4HTJA 4KT0C 1R8HA 4UOFA 2A1BA 1EHWA 4BWMA 2MZQA 4J9QA 3RRGA 3NMAA 3MEDB 4UW2A 4AL6A 4KO0A 3KHLA 2IAJA 2J76E 1FJ7A 1VQMS 4GKKF 2HHVA 5T41A 1QDUB 2YBVA 3MR7A 2MYFA 3KHGA 2XY6A 3B78A 1R0AA 1IBKF 2XWXA 1S1TB 2WSCC 4I6WA 3CJ5A 4KPCA 4LVOP 4ZPDA 1OQ3A 2YNGA 3CJTA 4FN5A 3K59A 2B7CB 1RXOB 2L9DA 2HG4A 3CJQA 2ROEA 2PO4A 4DV1J 4E0DA 4I2QB 5F41A 5LJ3Y 3W2WA 4J9MA 4P7TA 3D3BJ 2L9NA 2V50A 2YWWA 2IBOA 2WTFA 2HQ3A 1X5TA 4XO0A 1M1KT 4A47A 1HBMB 3N28A 4C8MA 4DR2J 3CSKA 4J7CA 3PEHA 3UD4P 4FBTA 4CCHA 1G3OA 4F3QA 5A8KA 2R8HA 4IH6A 3CULA 3DFEA 3NEKA 3MUMP 4NA1A 2OMLA 1VS3A 2AYEA 3CXCR 4X4RA 3HKWA 2ZHBA 2FLOA 2IMOA 4ZKAA 2VG5A 3PG9A 3B4DA 4JBCA 4B3SJ 2B9EA 1LWCB 4PXEA 2VH7A 1QTNB 4ZVPB 4G1QB 1YJWS 3TAPA 2XZTB 5KG5A 3E2EA 3ILJA 1R6VA 1U8WA 2HS3A 2ZEJA 2YQ1A 4Y2IA 3PXGa 1EQMA 4FYXB 4O0IA 2CXEA 3BGRA 5GAEI 1E6VA 1KDNA 3CDEA 3D0GE 3HT3A 2PT0A 2R2SA 3PW0A 4DR5F 4WWSA 2V2ZA 4RW9B 3TX8A 3GFXA 3QRRA 4NX9A 2K3KA 3CCVS 4CIOA 3MM9B 1CQMA 1BQNB 1AZSA 4QW8A 3FZBA 1MG7A 2OI2A 1XMQF 2E5LF 2CNOB 1SH2A 4CO3A 4XPEA 3DI6A 5C42B 1H73A 3M7VA 1HWIA 1LW0A 4IDKB 2BQUA 1EJ7L 3A8JA 3HP6A 1PC4A 2CVIA 3IS9A 2P6TA 3KNGA 1WG5A 4PPDA 5KFQA 5KFDA 3RBDA 1RI7A 4URGA 4JI6J 2B56A 1F0XA 1IVZA 1YQHA 2ZNZA 4MIAA 4NRUA 4J9RA 3PX6A 2HBYB 2QJ3A 4O44A 5KFGA 3TQEA 2I9SA 1JLCB 3VHQA 4CO0A 2HHSA 1B4SA 1DY3A 2CJBA 1MWYA 3RBEA 2AP6A 5IS2A 4K4XA 1S6QA 3ZZTA 4ETXA 4NXNF 3QT6A 2E9RX 2AD9A 2ZD1B 3HFKA 1YJRA 3FSXA 3GJQB 1TVRA 4TY8A 4ZPAA 2YKPA 2XTJP 2CQPA 3VTIA 5KFEA 4IH5A 2YKNA 4ED0A 3CJ2A 3WIUA 4CLWA 1HI0P 2B8QA 3GB0A 4RBUA 3KK1A 1CJKB 5AJ3F 4DSLA 2RDDA 2HVZA 1AUSL 2VBYA 1DQ8A 1WSRA 3CCUS 4DL3A 2JEGA 3GQCA 1VC0A 2ILYA 4AQYF 4QIGA 3OL7A 1REVA 2UV8G 3QZ8A 1PJ7A 3MEGA 3MFIA 1WORA 5E7OB 2APOA 3IR6B 1I6JA 4K2JA 4JI4J 6AT1B 2FZCB 2MSSA 3V6HA 2J6TA 2PC6A 4FPRA 4OQJA 3W8PA 4KKOA 3QWPA 1SKRA 2JHEA 1CJTB 4DPXA 4MIBA 1RLDA 2EFNA 2GQ2A 4ZHRB 1SL1A 1VQ4S 4LF7F 4DPOA 4D3HA 2VFSA 3EICA 1RT5A 2U2FA 4DR5J 3TZYA 2HRYA 2RHQB 4HDHA 4CLKA 3L4BC 3J7AN 4HKQA 4IG3B 4J9PA 4PWDA 2HVIA 4CH0S 3G6XA 3I6PA 1YBTA 3AJDA 3FMWA 2WVFA 4PEOA 3UVJB 4YUDA 4IOBA 2XMTA 2IFXA 3LPEA 2GX8A 3SDEA 3T9ZA 1BMQB 2BKOA 3M8PB 5DJBA 4CO4A 2XC9A 2XLKA 4BC9A 3BZQA 4GKJF 4M5GA 3UN2A 3GONA 4NYZA 4O23A 3CJ8A 5IT0A 1HNXF 5GAGI 3GCWP 1S6UA 3MR5A 4B3SF 1YJVA 3US5A 3Q8QB 1TELA 1RTZA 2VQEF 1JX4A 2MQQA 4HHJA 3KLGA 1NDCA 3F56A 3VZIA 5ETVA 3LANA 3JYTB 5J2MA 4WFAQ 4QJVA 2QFJA 2HFZA 2K1RB 4NLTA 1G6BA 2QX0A 1TUGB 5KFAA 4J9KA 2DR7A 4IR1A 3G4SS 4K0KJ 1F9HA 1MWQA 1TAQA 1VDHA 3NLCA 2RHSB 5DRKA 2D9PA 2F63A 5CCLA 5F8IA 4ED7A 2WB4A 4DQIA 3M8QA 5J1PA 1WC1A 1EKSA 3NXZA 1HQUA 2V63A 3V6KA 1FWPA 3HSDA 4KHPJ 3IG1A 3EGWB 4OYMA 4QYZJ 4DF4A 3D0IE 3P5BP 3ZXWA 2MGZA 2AGOA 1LKZA 1SL0A 2W9BA 5L46A 3HJFA 2FY1A 2ZKTA 2COLA 4HI2A 3J7Z5 3NKYA 1M5KC 2C1EB 1B0PA 4F0KA 4Y34A 5DDRC 3O6QA 3LQVA 1AT1B 1IQZA 1CQNA 2HNYB 3D68A 3B8HA 4RW9A 2GV1A 2XCPA 1B3TA 4DCJB 5ETLA 3AOBA 4GKKJ 3KYLA 1W25A 2EK1A 1LWXA 5DG7A 2ZM6F 2QTWA 4FF3A 3FJ2A 2DIVA 2NLWA 3L7PA 4JI7F 3POTA 3DLKA 4L72B 5HATA 1S9GA 2H51B 2B51A 4TKTA 2AYMA 2I5JB 4DCOB 3ELHA 5F9NA 1U45A 4JI5F 2KHDA 1HWUA 4OZLA 3ZC4A 3DM2A 4CH7A 1OO0B 4KRWA 2EVZA 5HVFA 1N88A 4URSA 3ZZZA 3KMQA 4ECTA 1OQ6A 2JZ5A 4CTAB 1EKRA 2VODA 3OVAA 2J0XA 1NCLA 5LM7E 3KK2A 1ZPWX 2POKA 3K2YA 5H9FK 3LP2A 2DTJA 3QO9A 4A48A 4AD6A 1N4LA 4AMOA 2O5DA 4V1Ak 5HI7A 3ZZUA 4YB6A 2RU9A 2CWXA 2YWFA 2HHPA 4ID5A 3QSIA 2V8HA 4EBCA 4LRAA 4KB7A 1M5SA 2MQMA 2XO6A 2VQFJ 3FGVA 3V5RA 4LR9A 1SB6A 2VD3A 2Z30B 5IOLA 4I56A 2DNGA 1RHUB 2YNFB 2C2DA 3I9ZA 4I64A 3LAMA 1VQNS 3IRXB 3WIVA 1GXLA 4NXMF 3IWNC 4DN9A 1SCJB 3RTVA 1R89A 3MAQA 3WX4A 3DLLQ 3D1QA 2M70A 4YB5A 3Q0AA 2LA6A 3DU6A 3IR7B 2FC9A 9ATCB 5KT5A 2LQ8A 2IAJB 2JH3A 1OY9A 4L3KA 4M5DB 3TAMA 3PZPA 1EIYB 4HT5A 1ZETA 2DCLA 2C2KB 2ZBIA 3TR5A 5D4NA 1M90T 5A76A 4LF9F 3QATA 1NKEA 4AT1B 3TWZA 4ECWA 1TKDA 1RAJA 1IKYA 2GVZB 3THTA 2X1GA 4A8SA 1RYRA 2HWIA 3BR8A 1KSPA 1TKZA 5AXNA 1S1WA 2AWZA 1IKVB 3HHLD 4URQU 2RQKA 2NZ4A 2AJ0A 3MPYA 3EM1A 1KLMA 3HKZD 4DSFA 1PYTA 2H54B 1T03B 4ECRA 1UFKA 1D8YA 1U2CA 1NJXA 3GILA 2FVPA 3LP2B 3BKTA 2DHXA 4OYBA 3RW6A 3GU0A 4ID8A 3ULHA 5CZCA 2QMUB 1Q82T 2I8EA 2KVQE 2JC0A 1HNZF 4K4VA 4UUXA 5DG9A 3MR3A 2DNOA 3G87A 4ITSA 1FDAA 4ICLA 4O3NA 4BDPA 3G9CA 4X4NA 2UP1A 2J0WA 1VISA 5J2PA 1U0HA 2BKNA 4DPUA 2AJQA 3OXGA 4KTQA 4KGKA 3S6EA 2ACYA 3R6LB 1NB2A 1TKXB 3ET6A 2D7SA 2PFFB 3OT9A 1FCAA 1NPKA 4RZRA 2MEWA 3MD3A 2N3OA 1RWOB 4ZVHA 2HNDA 3UCGA 3EDRB 3EUNA 4WF9Q 3L9ZA 2IC3A 2BOAA 1VJQA 3NOGA 4K4WA 4L74A 3BPSP 1X0FA 4N76A 4GO7X 1R8PA 1YX2A 1H98A 1HQUB 1X4EA 2UU9J 1K0TA 1JLBA 1RP5A 4PG4A 5B0EA 1P1TA 3TAQA 4YN3B 1SKWA 3ZTQA 4PQUB 2OPSB 3ZTOA 1RU1A 2W9BB 1BHNA 2B4UA 2WSFC 1UEVA 3V81B 4TNOA 4LBIA 2KO1A 1LK7A 3M2UA 3PDNA 4C11A 1X60A 5JUMA 1IM6A 3VALA 4ECYA 3A13A 3AA9A 3MECA 2HK2A 4F2SA 1WG4A 1KN6A 2MZSA 1FNMA 2VL1A 1S97A 1H0HB 1YJUA 4MYTA 3VGTA 2KM8C 2WVBA 2DNZA 2FJDB 4F36A 2B7BB 2R2TA 3CVKA 3MMCA 2ZC3A 3PV8A 4OZ5A 5I3UA 2BE9B 3VQSA 1XTZA 2C42A 3O44A 5EGYA 1RA7A 2ZH9A 2BQ3A 4LF8F 4NZ6A 3R5AA 5HMXA 5KFWA 3CCTA 4XDCA 4DPTA 4LR8A 4HYKA 1L3KA 5E2QA 1MU2B 2FVCA 3F41A 2B0GA 1NH7A 4OI4A 1UJ4A 3D6TB 4KGVB 4WBFA 3HMJG 2H3EB 1S99A 2KZMA 2HLTA 4LF4F 4H4OB 4DDFA 4I68A 4FS2A 4Y28C 1NDLA 2MXYA 2JEFA 3LGNA 2FGOA 1BXNA 2KI2A 2KN4A 1T9UA 1VI7A 2YQ3A 2XULA 3EZOA 3MHYA 2QRRA 1WC3A 3I82A 1VLOA 1HBOA 1OIAA 2V2VA 4F3MA 2RRBA 1LXNA 1FERA 4N41A 3LF0A 4NRTA 3R5JB 3QJPA 3G86A 4FYVB 1VMBA 5H1SV 2DNRA 4XAKA 1LK5A 2QN6B 2K8GA 1OJ4A 1U0SA 1YRUA 5KT3A 4CT8A 4U6PA 5D3GA 1UAWA 5K14B 1XERA 3DLKB 4FYYB 2VICA 4EYIB 1N6QB 3ENWA 1FEEA 2DO0A 2BM1A 3OVBA 2OPRB 2UUCJ 2FQQB 1X4HA 5THWA 4C8KA 4IG3A 4PWDB 3W62A 3DGPA 4KHMA 3CNQP 3BB5A 1S9EA 1VRQC 2O67A 2CA9A 3FEZA 3M1VA 2X7IA 4ZVSB 5HQLA 4GC6A 4Q8FA 2FLNA 3JQJA 1VK3A 2RUSA 3ISZA 4BWJA 5L9XA 4DFPA 4YR3A 3V4IA 2H9ZA 1VCTA 3ZFVA 4DXLA 1TL1B 4C6AA 1HBNA 2Q1LA 2JOQA 4MK8A 5ETKA 1VQPS 2UXCJ 2HHWA 2BBEA 3M05A 4F04B 4NLPA 3CGIA 4QR0A 2HRTA 2LDIA 2KXNB 1N36F 2WZ1A 3H2UB 1GFWB 1W2IA 5T7LB 4CO2A 3PYDA 4IKAA 4WFNQ 3DRRB 4NLGA 3G6VA 1BWEA 1VBZA 1WKKA 4OZ2A 5F9LA 1HQ2A 1HA1A 3PFOA 3QFWA 1S6PA 2GQQA 4DL0C 4ZP9A 3I96A 3C6TA 3QT8A 3KTQA 4QU6A 1N33F 1SV5B 4DV5F 4QIEA 2H4YB 4YR0A 1H2UX 1NHKL 2UUAJ 4KE5A 4AL7A 1QSYA 1L5UA 4ZCLA 1MU2A 4DSJA 2M52A 5D0HA 2GMJA 2XSJB 1RQ0A 3DLGB 3M8PA 2VOOA 3C16A 3CC2S 1CC7A 3TZWA 4YOEA 4RNNA 4KHRA 4LUBA 4L3NA 3AD8C 4YMEA 1ZM4A 1RHKB 1LFPA 3GSIA 4USHA 2CKWA 2X1FA 1S1WB 1CS4A 3K0JA 2PEBA 5FJ4A 1RLCL 3BREA 2HQGA 1RCXB 2RS2A 2QLXA 3ZZOA 2CG8A 4O4RA 3OTEA 3GYGA 1M5HA 3PEJA 3OXFA 3SV3A 2B4VA 2V2KA 1S1UA 2X3GA 3FBFA 1RT6B 1SJQA 3EWGA 3PYFA 3AD9C 3E01B 3SCIE 1XNRF 1OSDA 1V5VA 1JJ2R 1AROP 1U0HB 1CJUB 4ZPTR 1XNQJ 4B9TA 4DG1B 2IDEA 3MM9A 2VG6A 5AE2A 4DSIA 1Y3KA 1VBXA 5IC4B 2YWGA 2ZBQA 2ZBRA 4ES3A 4JB8B 2ZVIA 2XMUA 3Q86A 2YH0A 3PR5B 3UFCX 4R0EA 8ATCB 1DRZA 5CCMA 2ATCB 2F8EX 3QAEA 5LMNJ 4KH0B 2V8GA 5KG7A 2FLLA 5DGBA 1ZM3A 4LFAJ 3AT1B 1NB7A 2FJEB 2HHHF 3HVTA 4OV1A 2YKNB 1QE1B 2CJQA 5GAHI 2J0QD 2HSEB 1FJGF 4KHPF 2YTCA 3NGDA 4RBVA 1IWGA 1NRKA 4KFBA 2ZOGA 1MROB 4N7TA 1L3TA 1Y5LB 3NNAA 3BGLA 3MEDA 3T5KA 3M4XA 4PG7A 1Y10A 1LW0B 1PAEX 1RT4A 4IDKA 3JB9k 5C25A 2GHWA 2ASJA 3PHTA 3L3CA 2RH3A 3HZGA 1GK8A 1IR2A 2HGNA 1R0AB 1G4CA 3DRXA 4CLLA 1R6YA 1RUSA 5KFBA 1I94J 4JI2F 2HLUA 3R7SB 3E3XA 1Q8BA 4YQWA 4RW4A 3GIMA 4QR1A 2HQIA 3QRPA 1R31A 2Z4PA 1KOHA 2QA2A 4NLSA 3R7NB 2XM3A 3HPOA 3KOAA 4B3RF 4DV3J 4PPZA 2ADCA 3PO4A 1S6QB 3BO2A 4KGZB 1XMOJ 3RRKA 2M8DB 3M6UA 1QJHA 5K8NA 5HMYA 3AFGA 4AMPA 2VA2A 4ILLA 2F8MA 5HK4A 3VAJA 1YLXA 3Q8PB 1PJ5A 1EQ0A 3PJWA 1TK8A 2PE8A 2C3OA 2VFUA 3BGOP 4DUYF 2DR6A 4ZOSA 1C4AA 4R8UB 2DGWA 4W98A 2R8IA 3OTOF 1AYEA 3MZIA 1RB0A 3DLJA 4U8YA 5G0RA 3LWLA 3MECB 1UZHA 3MUTP 4O3SA 5A8WB 4NYPA 3LGHA 2EPIA 3LO3A 3THPA 4ZA1A 2NREA 2G9OA 2IIHA 2DK2A 3U1MA 4YY3J 5K20B 5L1IA 4KFBB 4LF2A 3PTWA 2WHOA 3IMQJ 3KLFB 2DT9A 2EFPA 4QPTA 2W25A 2FJWA 3D6HB 4CO5A 5A0YB 4XIUA 4KC5A 1RSCA 1TKTA 3IRWP 2UUBJ 2DXDA 4U7CA 4K4ZA 4OZ3A 3OV7A 2QSWA 1E6VB 2RDIA 3BSAA 4ZLNA 1EARA 3SSSA 2N4DA 2UXBF 4WFZA 1RWMB 1ZA1B 2RD5C 1WC5A 3VWSA 1R8BA 5F8GA 2VONA 2L48A 1SIZA 3OR2A 2R7XA 5E3CA 1U2FA 2HQCA 3ICLA 4JI1F 4PG5A 4AXJA 2KT5A 1NDKA 4YHHF 5CYMA 1NU4A 2IVYA 3HSGA 3PRVA 3FRYA 1NXIA 4ZLLA 2UV8A 2AHOB 5U47A 1BLUA 3JQKA 2E9TA 3W9HA 2NR0A 3PVXA 3LTOA 1C1CA 5IWAJ 3V4MA 5BYSA 1DQAA 4G3IA 3QMQA 1KHWA 4JP8A 1TUWA 4ECXA 3POTB 1GMUA 2MHNA 2GCFA 5J2MB 3SBMA 1NZAA 1D3WA 3FZ2A 1HBUB 2NCKL 1MMNA 3MM6A 2BDPA 1HNWJ 2IY5B 2HVDA 5ETRA 3R1LA 2HGLA 4NLDA 3R2DJ 3P96A 4X4PA 1WHVA 4J91A 1F3FA 3GYNA 4NLWA 4ZVFA 4C0HA 3KLFA 3HVRA 4IOAQ 2NXCA 2Z2ZA 4LBHA 5HAOA 1FJEB 1RAGB 3NAHA 2XMMA 2ASLA 4K2XA 1R8CA 3C3LA 2P6SA 2CVEA 1J5OA 3HVAA 2XQCA 2RQMA 2EWHA 4PKDB 1X9MA 1T02A 2E1AA 1T9WA 1HMVA 2LXUA 3DOLB 3M8WA 3U1NA 4DQSA 1RHQB 4DFKA 4JI8J 2FD2A 5F8NA 4DLEA 1UWBB 3TUIC 3QGHA 1S10A 1C0TA 4K7QA 5HANA 5E33A 3UR0A 2B3TB 2XNQA 2OP5A 1PILA 1S1VA 2RKIA 2ZKUA 4F8RA 1HLWA 3VAFA 2C2ZB 4OHWA 2VA3A 4NPOA 4ED3A 2HS4A 3GIKA 4FXDA 3N5BA 3BS9A 1FKAF 2FVSA 5EWGA 2GHPA 3PM9A 4OHVA 5KFMA 2GIFA 5KFPA 2XG8A 2MKIA 3QZ7A 3Q8SB 3QT7A 2WW4A 5F0WA 2R3VA 3IR5B 2R7OA 4H54A 1N54B 3BN7A 3MM6B 3DDIA 2KYXA 4O3OA 1Q4RA 1U02A 2IRUA 3FNNA 2DHSA 1RT4B 2XYPB 2W8KA 4A8KA 2Q3PA 4RW7B 4HDGA 2DRAA 1PBAA 3BYPA 4OLPA 1U24A 2K3IA 3TP2A 3K5OA 2XZWA 3TNVA 4E2FB 1NK0A 2CPIA 3B54A 1X7VA 4DR1F 3NGSA 5KT2A 3K58A 3TO8A 3MM5A 1ZYQA 2MQPA 3M8ZA 1T05A 4G1QA 4EZ9A 1HI8A 2F9DA 1SJRA 1F60B 3QGPA 1P6TA 3NS5A 5ETMA 1FRKA 2HEKA 4OJ3A 1FKOB 1RAHB 2CQCA 4IQMA 4M5NA 1HR0F 5D15A 1DFDA 3DLGA 1RADB 3BV8A 4KQZA 5GAGU 2DR5A 2BJDA 4F0HA 2K7KA 1VK8A 2XO7A 5HL7Q 3KKFA 4NA3A 3OFHA 3X3UA 1NJWA 4F50A 1RCOB 2D9OA 2FZKB 3KK1B 3C14B 4DR6F 3QQCD 3AXMA 2XNRA 5A8RA 2D3ZA 3M2VB 5F0UA 3CTRA 3U1LA 4DOZA 2KFYA 3KK3B 4DEZA 4O3QA 2G1HA 4F2RA 2U1AA 1TFYA 2OGUA 3UCUP 4C97A 5KFHA 4X4TA 5HROA 5HLFB 1JQGA 1HMVB 3W7BA 2YVSA 1REVB 4ZN1A 3BQ0A 5IQQA 4F4WA 2XS5A 1RHRB 3D3CJ 2R7RA 2HMIB 2MB0B 2EC2A 3KLEA 1URNA 4DX5A 4I6AA 3CCRS 2Y0SD 3RAXA 1S0MA 2W7AA 4K8RA 2CJYB 1WOPA 2P9EA 2ZH5A 2W9CB 2DH7A 4ED2A 1NSQA 1EZZB 2YPZA 1KQFB 3VVTA 2UVRA 3TQ1A 5CH7B 2DBBA 4DR1J 1G7CB 5F8HA 1N48A 2KFZA 1A0OB 1XK8A 2HKEA 2HWHA 3IRXA 3KUGA 3N79A 3KK2B 5KFLA 4FF2A 3CIZA 3NWRA 2IM2A 3MM5B 4YB7A 2MKHA 2KRBA 2QL5B 4USJC 4P74A 4A46A 1NKBA 2VG6B 1N5SA 2DPIA 1QM9A 3DOKA 4N47A 3AB4B 3CE8A 3V6JA 3EPGA 1OS5A 5L9NA 3R5CA 1OYEA 4ED6A 3T1AA 1UW9A 1VBKA 3BH6B 4IFYA 3UI3A 2LFVA 3EPIA 4PXBA 2CAJA 2OJ3A 3D2WA 2YPYA 2LCWA 5GMDA 3VF0B 2PFDA 2MKYA 1Q8IA 3OFGA 4ZMMA 3CC7S 3VAGA 1PYSB 1T9TA 5CXTA 1YDLA 5GADU 1TAUA 4DUZJ 1FRLA 1UWAA 4P73A 4ZPVR 1HHSA 4KY3A 1HBOB 3N0VA 5BYRA 1YJTA 3ZZPA 3WDOA 4EFAC 2CZVC 3KK3A 3UE2A 4FVMA 3IO1A 2DHAA 2LA4A 1H74A 2M3DA 3GIJA 3CCMS 1FNXH 1B7YB 1DTQA 2E5IA 2DIUA 1UETA 2O66A 4PR6A 2HZVA 4Y2AA 2XWYA 3CT9A 4YEAA 5DS7A 2RF2B 5I42A 1JNZB 2AJ1A 3IBWA 5KFNA 1D9DA 2XZDB 2KZZA 1ZTWA 1KWMA 2OHDA 3MXHP 3DRYA 2OPRA 2Y1IA 1DARA 4HT7A 2CJAA 1VQ6S 3LPYA 2PD1A 3EGZA 2NS1B 2BW2A 4LSNA 1BQXA 3OHBA 3HDSA 2ZFHA 4WJBA 3HK2A 2FTRA 4L76A 2ZH3A 1JJCB 1RTJA 3GPAA 4XDDA 4DL7A 4IUFA 2G4BA 1ZAWA 3EVMA 2RRNA 1FRXA 4UOCA 4U96A 4DV7J 3OL6A 2UVUA 4I69A 5LSOA 4AMNA 7FDRA 1CBKA 2CADA 2Q6BA 4MKAA 5F8JA 4Q0BA 2A10A 2C2NA 3VAIA 1J5OB 1N5YA 4ZP7A 5M2UA 3I32A 1NK5A 3H5YA 2VPXB 1NAQA 1UJ6A 4WE1A 3MMBA 2DGXA 4LRCA 3IFEA 1N52B 1UPMB 3W5XA 4NEZA 3BJYA 1KOOA 3HLUA 2YWKA 3GV5B 1UEKA 3KMSA 1Q7YT 2XYGB 2I2YA 1S1XB 1QUPA 2VZ9A 3ILLA 5L8RC 4NCAA 3T6JA 1M1GA 3H7HB 3R5GA 2HIQA 4WKYA 3BN4A 5K5MA 3ZTRA 4C8NA 2MZTA 4OHXA 4USIA 3MM8B 3TOQA 2D1CA 4AFFA 4DR6J 1PKUA 2AZ3A 4USKA 1BUXA 1MNEA 1RT1B 3N4WA 3Q8VA 3TVKA 1T3NA 1D1UA 4QIVA 4WZQA 1AW0A 1NNDA 2R7QA 3LP0A 1RT2B 4OJ1A 2X3DA 4ZP8A 5IC6B 5KG3A 4B3TF 3Q8YA 1Y4ZB 4ECQA 4CZCA 1U1RA 2ZZNA 1S6PB 2CNLB 5DO2A 2KJWA 2ZDPA 1DTTB 1V3RA 5AT1B 4DHVA 4K4YA 2BE2B 1F3VA 3BEGB 4DL2A 3WC2A 2AKWB 3M2UB 3U02A 3MM7B 4C11B 3R6GB 4C3LA 1F1BB 4LSNB 1D9FA 4LF8J 2R7TA 2QE5A 3SZ2A 1WDTA 4OX6A 5FDLA 1ACMB 2LYVA 3A8IA 4OYPA 4NLQA 1UA1A 3TRGA 3LOUA 5BYQA 1U6BA 2BYCA 2XGPA 3OJSA 5JVGQ 4ZDNA 1NZ8A 2AIRB 1YZ7A 1FK9A 2BJ3A 4OI2A 2DRDA 3VQTA 1VQ7S 1PC5A 4FBUA 5LSRA 1RAOA 2FC8A 4J5OA 4NZ7A 1HPZA 1GXUA 2DO4A 2VZ8A 2WB1D 1V5IB 2HFVA 5DGAA 1HARA 1RTIA 2P5VA 3MMAB 3CJKA 3RJMB 5KFSA 5GAEU 2VG7A 3OLBA 4EO6A 2QA4G 1CULA 3SXLA 2DNHA 3QIPA 1RAIB 1C1CB 2ZVSA 1R0BG 5T14A 3SV4A 4JI0J 3GZ7A 2C22A 1GAOA 2OEJA 3QNWB 5J1NA 2GZOA 3MPUB 1HFEL 4TYBA 3KHRA 2DHGA 3NCRA 5E3RA 4LFCJ 1GMWD 4LIWA 4R5PA 3CJ3A 3WHIA 2VDHA 3SI8A 1FRHA 1HBUA 1TMMA 2LU1A 1NK9A 2VBXA 1M5VC 1VQKS 1WEZA 5LXRA 1JWWA 2QO3A 2EKNA 5J2NB 4RNFA 2BM0A 2EFQA 4CLFA 3R97A 3LGMA 1Y11A 2YNHA 4X65F 1WF2A 1FWLA 1NPRA 3O8WA 1SJFA 1XWLA 3DC2A 1H6KX 2IJNA 3I56S 2HFOA 1EB0A 5C24B 2ATLA 1TP7A 4X62J 2XYHB 4DF8A 3HO1A 3DU5A 3JSMB 3G8SA 2EK6A 4E8UA 2EG2A 2OO4A 1ZAVA 2OLWA 4F02A 3DHWC 3NBPA 1FA0A 2H5IB 2MY8A 4NLXA 3KJQB 3W64A 5D6GA 5B08A 3M32A 4RPFA 1FFGB 1RKJA 4B9NA 5K8MA 4ZVTB 1NKCA 3IN5A 3JSBA 3RR8A 1SUQA 3M2RA 2QLBB 5GMKa 1Q0NA 3DDKA 5A6WA 4DX8H 5HO4A 3H20A 4RW7A 4IRCA 2MJUA 1GX6A 1N8RT 3Q83A 4K4UA 5KFIA 3RYLA 3UD3P 1U1KA 3DI6B 5C42A 3PKYA 2AEFA 4EBDA 4OYAA 1SJ1A 1VYAA 2NYIA 3H5SA 3T1YJ 4ES1A 3BGFA 1FVSA 1Q81T 1EAYC 2ABYA 2QA1A 4J9NA 3L09A 4OJHA 2OFGX 2DGQA 4UOHA 1IJFB 2QLJB 1WC0A 3W65A 5I42B 1T8EA 2E9ZA 1LW2B 1BQMA 2MQ8A 1KFDA 4ZJLA 3IAS9 1SC6A 3ITHB 4KKOB 3PW5A 2OSRA 3RB4A 1IKWB 1WHXA 1UVMA 2Q43A 2J7UA 1FRMA 3H42A 5DQHA 2EC0A 1S59A 1FKPA 1T0TV 3MPDA 2OAUA 4ERDA 4O4GB 4WFXA 2GJIA 4DJBA 4EGLA 1AUDA 2YQ0A 4C8ZA 2NSBA 3D6FB 4FZVA 1FESA 4LF1A 4C0OC 2YNIB 5E0OA 4NYOA 4B3MJ 4DQQA 1CC8A 1SH0A 2XI2A 1KEKA 4JYAF 2HK3A 1S1TA 4DV6F 1IKXA 4GC7A 1FE4A 2IHR1 4K5SA 4CLZA 1IQTA 4M1KA 3UVJA 2IBKA 2X1BA 4YDXA 2QEXS 2W2MP 4AQYJ 1N34J 4DV0F 3E01A 2DY1A 4OX9J 4J9LA 3GFYA 2DHHA 4FNHA 4RJVA 5C2GA 2IA6A 5CHCB 1OY8A 4PG6A 1B99A 1IR1A 1S9EB 1XMBA 1GTHA 2ERRA 2YX4A 1YHQS 1JXEA 3ENAA 4X4UA 2LQ9A 3SFUA 2CZ4A 1O5JA 3SIPB 3UN5A 4ZN3A 3CD7A 1XMOF 3PY8A 4CYUA 3JYTA 4DMZA 1GTEA 1SIWB 3HI9A 2OPPB 2G0IA 2W2OP 2ZUAA 2BW7A 3CWJA 3HFZB 3IAM9 4ANDA 1SJ4P 5F3ZA 4Y00A 2R8GA 2JLFA 6FD1A 4I2PB 1HNWF 4F67A 1SUQB 1LW2A 1UFLA 2MKJA 1IN0A 1SC1B 3TZZA 1K9MT 1JXLA 2GIQA 1MSWD 3OQ2A 4NLUA 5IQ6A 2CPEA 2VKRA 2PDAA 4LT6A 4AE5A 4USWA 2N7CA 4QWAA 1LWEB 3DOMA 5C5JA 3A3NB 4DFMA 1D0EA 2V5HG 4C8YA 4B02A 2BANA 1S57A 2NYHA 2PA8D 1QUVA 3HHLC 2VBWA 5HJXA 2KH9A 2DH8A 3E51A 3FFIB 3K89A 5HMWA 1W7WA 4EYHB 4A8MP 2AQ4A 2Y1JA 2RILA 3DGPB 1WKJA 3DXBA 3UN3A 4TXSA 2W7PA 2VHGA 4GKJJ 3MM8A 2C2MB 5EDWA 4DR7F 2M9KA 3EGNA 1Q53A 3ISND 3UW1A 3CMES 2Z56B 1YG0A 3DOLA 3FBCA 2GS8A 4TLQA 2NXUA 1BGXT 3CMQA 4Z2XA 1IM4A 3FEYB 1CS4B 2B9WA 1F2HA 5B0FA 2I6WA 3P5TL 3THVA 2EW9A 2DISA 1XR7A 1JMTA 1X9WA 1TV6B 3V6DB 3BBCA 1PO6A 2IRYA 4QYRA 1PYOB 1XJWB 2IDLA 2DR8A 2UUBF 4B9VA 1M1HA 2BR0A 1XR6A 2KT2A 4M63A 3FMBA 3MGJA 4MKVA 4PXCA 1HHQA 1RT7B 1XR5A 2PIIA 4NWBA 1HW8A 2FY8A 3MDFA 2QT7A 1RKIA 1FXDA 1JLQB 2LMIA 2W4DA 2ZE2A 4M5HA 5CYMB 4MFBA 2ZOFA 3TYTA 1UVLA 1KKHA 1U2RA 1K0VA 3MCMA 5B7WA 4ZK7M 4DBQA 4DUZF 2G0JA 1X5OA 4ILRA 3EVWA 4Y2KA 1JLBB 4IRDA 3NL0A 3OTOJ 2V8PA 4W90B 4KGMA 4MKYA 3S7RA 3W9JA 1MW7A 3DRPB 3GP9A 5D4PA 2BVZA 4ZPCA 5HSPA 1B70B 2ALYB 2DGUA 2RE1A 3NAIA 4RW6A 1KP6A 4I6YA 8RUCA 2Y1LB 4I1TA 4V19X 2ZHAA 2XS7A 4LFBJ 5AXMA 1FO1A 4ANEA 1UW4A 1VGYA 5BXIA 1P8GA 2VPYB 3MM7A 2QC3A 3FK4A 2IVFB 1R0CB 4QWDA 5DM7Q 2Y0BB 3NBPB 2IJFA 4A8OA 4DV4F 3TANA 4FVCA 2J6SA 4RO0A 3MMBB 4C8LA 2GNKA 2KG1A 3HULA 4Z7YA 4UOGA 1RWUA 3KLVA 1Q16B 2MY7A 5HBMA 4C48A 3EXCX 3NWGA 2AX0A 1GNKA 1XBWA 2V8DA 4MK7A 3NMRA 1X5PA 2ZWPA 3SCJE 4DPWA 3K5NA 1LOUA 1HL6A 2R42A 4OZ0A 4LF5F 1JK9B 3M6XA 2ZM6J 3QGIA 1RWPB 4RW4B 4HACB 5ETSA 1HNZJ 2W7OA 3QFHA 3A1YG 1RGVA 4KAIA 1AXQA 5CYQB 4BS2A 1PBUA 4L75A 4Y2MA 3TEGA 3VR1A 1I51B 1UJ5A 2WSEC 4ZVGA 1UL3A 4U7UD 1JLQA 2ZE2B 1WG1A 1DBDA 2RUGA 4RKUC 4P2SA 5FD1A 2WAQD 3SYZA 1VQ9S 1X4AA 1J27A 3CJ4A 5M2RA 5J2PB 2DCUB 2AJ4A 4MAKA 3ITHA 1SPBP 5E3QA 4J9OA 3EXYA 1R43A 4WP3A 1FJCA 4TYAA 1LFWA 4F4AA 2BOPA 3IS9B 3K8VA 1IKVA 1QTMA 5KFJA 1WTFA 3MURP 2YNIA 1K8AT 4HH0A 3HXMA 2DKOB 3H2LA 5HROB 3N5FA 4IFVA 3U7JA 1T03A 3DRSA 3OR1B 4NCGB 1RWWB 2VASA 2HNZA 2UVWA 2YXLA 3KLIB 5HJYA 3MTKA 1CSJA 3MEKA 4IG0A 1J2VA 2HVHA 1VOMA 4RUBA 1HWJA 1VRTB 1L3SA 2YX1A 1HNXJ 3MMCB 1TL3A 2I1RA 1WHYA 1QVGR 4UF4A 4M95A 4M5KA 1X4CA 3JXOA 3OFFA 2P8IA 1OWXA 4PZVA 2CQ4A 2RF2A 4CLTA 3BSNA 1TKXA 5DZ7A 4DL4A 2V68A 1U6ZA 3HHLA 2C3UA 3IWXA 3CIMA 1RYSA 3N6NA 4OI1A 1TZ0A 4ECZA 3PJ9A 2AEJA 2MJNA 4Y3CA 2DXFA 1VLYA 4UTGA 3KLHA 1RTJB 2YKQA 2D3OR 1T94A 4O0NA 4QOTA 3MOZA 3AJ2A 2RDJA 4DSKA 1ZM9A 2QLFB 4DV5J 1S0VA 1FXLA 4CLSA 4OI6A 2I38A 3MR6A 2V4JB 3W2VA 3TUPA 2LEAA 3G82A 1K47A 2PN6A 2H4WB 4HLBA 2FHOB 5IM0B 1WC4A 2E66A 2CDQA 2CJ9A 5E41A 1P1LA 1X4BA 1TK5A 2CYYA 2VFRA 4RU2A 3P8BB 3D1OA 2DRBA 1TK0A 4WK3A 2VB6A 2J9EA 2HIYA 5KFVA 3PIPQ 2HAIA 1FVQA 3D4JA 2XY5A 1UKUA 3T19A 4LIRA 4PYAA 1T9XA 1XN9A 2P2CB 4A8WA 1Q79A 2MZRA 3WC0A 5AJ3J 5KFFA 3MMJA 3GTYX 2E1PA 3A8EA 3DN9A 2VKZG 1TV6A 2JNJA 4CO1A 2DEIA 3V6DA 2N3LA 2NXJA 4DZ6A 5H9EK 5K14A
chains in the Genus database with same CATH topology
3IM9A 2QJ3A 4AMNA 3EZOA 3R97A 5DZ6A 3TQEA 2CUYA 3RGIA 3CJ8A 4RR5A 3BV8A 4AMOA 3QATA 3TZWA 3HHDA 3HJVA 2C2NA 2H1YA 4AMMA 2G2YA 4RL1A 3TZZA 2G2ZA 3PTWA 4QBUA 2JFDA 2QC3A 3R8YA 3IM8A 2G2OA 3TZXA 1MLAA 4AMPA 2JFKA 3SBMA 5DZ7A 3TZYA 2G1HA 3K89A 3H0PA 1NM2A 3G87A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IM9 A;  2QJ3 A;  4AMN A;  3EZO A;  3R97 A;  5DZ6 A;  3TQE A;  2CUY A;  3RGI A;  3CJ8 A;  4RR5 A;  3BV8 A;  4AMO A;  3QAT A;  3TZW A;  3HHD A;  3HJV A;  2C2N A;  2H1Y A;  4AMM A;  2G2Y A;  4RL1 A;  3TZZ A;  2G2Z A;  3PTW A;  4QBU A;  2JFD A;  2QC3 A;  3R8Y A;  3IM8 A;  2G2O A;  3TZX A;  1MLA A;  4AMP A;  2JFK A;  3SBM A;  5DZ7 A;  3TZY A;  2G1H A;  3K89 A;  3H0P A;  1NM2 A;  3G87 A; 
#chains in the Genus database with same CATH topology
 1NO8 A;  3T1H F;  4DR7 J;  1X8D A;  4ATN A;  1GMW A;  4CNZ A;  2AU0 A;  3JQM A;  1WOS A;  3PO5 A;  2XMK A;  4B9L A;  1W26 A;  3QPI A;  3B6B A;  2ZZT A;  2GMH A;  1U09 A;  4JV1 A;  3GJR B;  2LDY A;  3EX7 B;  2V8V A;  3IGN A;  4RX6 A;  5MAO A;  3BSC A;  3M1V B;  1WF1 A;  2EBE A;  1N56 A;  1RT3 B;  4CM2 A;  1U1O A;  1LV5 A;  2CPZ A;  3HFV A;  3G2X A;  3PR4 A;  2KFN A;  2AF6 A;  2GIR A;  2VIH A;  1SQG A;  3FQL A;  1QVF R;  1WHW A;  2QYG A;  1Q8K A;  1TL1 A;  3CED A;  2FHJ D;  5B09 A;  3P45 B;  1GH8 A;  5M2P A;  5CAB A;  4WYW A;  1EET B;  4KV8 A;  3VCD A;  2E1C A;  1KVK A;  2HFU A;  1JLE B;  3P3D A;  3T1H J;  3E8O A;  3LP1 B;  2E29 A;  5T7L A;  4ZIV A;  1KNZ A;  4X62 F;  2C2O B;  1TL5 A;  4DR3 J;  1U49 A;  4PXD A;  1C2P A;  1DLO B;  4O4G A;  2HNY A;  3RBX A;  2DD8 S;  2DB1 A;  2H1Y A;  3MPV A;  1NJI T;  3P4U B;  3SFG A;  4EK2 A;  5SZT A;  3F44 A;  1JKH B;  4WK1 A;  5ETP A;  1XQI A;  2EFV A;  4YS2 A;  3OUY B;  3AQO A;  1D09 B;  2ASY A;  1G1X A;  1VC6 A;  2B6A A;  4C9D A;  2B9Y A;  4B9S A;  3ZZ0 A;  3EE3 A;  2OFH X;  1RTH A;  1HBN B;  3BO3 A;  4DV6 J;  4OZ1 A;  3FFI A;  4PQA A;  3ZZR A;  5KAK A;  3CCL S;  2P9C A;  3AA8 A;  3M8S A;  3GIR A;  2MQO A;  2KTQ A;  5CZD A;  3EVO A;  1HWK A;  2V34 A;  1AB8 A;  2RKI B;  2V67 A;  3QJL A;  1CJU A;  2FJB B;  4ETZ A;  3Q8U A;  3UDL A;  3CD0 A;  3UR3 C;  2XHW A;  4FXV A;  1RT3 A;  3ZTP A;  4X4S A;  4DR4 F;  3I0R B;  5A2Q Y;  4C3M A;  4RW6 B;  4ER8 A;  1QAY A;  4FKY A;  4TU9 A;  2B8P A;  3HHD A;  2ZZM A;  2FIU A;  3W8G A;  1P9Y A;  4F4X A;  1UCN A;  3I9V 9;  4EEY A;  1J5E J;  2JEJ A;  4QBU A;  3RB6 A;  4I7F A;  2IA0 A;  2NUU G;  3DLB A;  1CPZ A;  3V81 A;  1O6X A;  2GVD A;  2WVE A;  4MYU A;  1U26 A;  3FDS A;  4QR2 A;  3H4D A;  1KQG B;  5B0A A;  2Y1R I;  1TMJ A;  3OLA A;  3KDO A;  3DMJ A;  3EZU A;  3FCH A;  2B4P A;  2LQB A;  3FKB A;  3LH2 S;  4DI6 A;  2RQC A;  1N5Y B;  2GA7 A;  2XI3 A;  1JLF A;  2JDJ A;  2M0G B;  5C24 A;  2QLW A;  4JI5 J;  4JV2 A;  1JJH A;  1HD1 A;  3VVU A;  2LXF A;  1FE0 A;  1S0N A;  1ZZF A;  2EEY A;  1TL3 B;  3GII A;  4NEY A;  3BSO A;  1N36 J;  1NME B;  2KRR A;  4RUA A;  2OH2 A;  2HZC A;  1YIJ S;  2OTL S;  1KON A;  1RK8 A;  4DQP A;  5L1L A;  1VQY A;  3CD5 A;  3DKD A;  5E3A A;  4F3O A;  1V6H A;  3K7R A;  1Z1Z A;  3ZNJ 1;  4PCQ A;  3D1H A;  1RWV B;  1MN7 A;  2BJ7 A;  2EFG A;  1QAX A;  1TQL A;  2G13 A;  2KXH A;  2V94 A;  1UEU A;  2YX7 A;  3A4T A;  3W2W B;  4HL9 A;  1QSL A;  2HYI B;  2E5L J;  3GV8 B;  1S72 S;  5L1K A;  4DWI A;  1SQF A;  2OEK A;  4Z7C A;  2CQG A;  3PYG A;  4ZLJ A;  3J81 U;  2RSQ A;  1RHJ B;  4DL5 A;  2A6M A;  4KIA A;  1SC4 B;  4J9V A;  2M4M A;  2GJ2 A;  3HCX A;  3ADA C;  4QWC A;  3R2C J;  4DUT A;  8AT1 B;  2DXE A;  2HUR A;  1DUR A;  1R8A A;  4RW8 B;  3R9L A;  2CQ1 A;  2FPH X;  4USU A;  2XMW A;  2FVR A;  4Q2M A;  1WNE A;  4ILM A;  4K0K F;  3DLE B;  3W2V B;  3FBE A;  1WEL A;  2GGP A;  1ZTT A;  4KH1 B;  1F6T A;  1RBL A;  3S01 A;  3R7B B;  4YR2 A;  1LQ9 A;  1OMS A;  1YGY A;  1U1L A;  3T5J A;  4LFC F;  5I4M A;  3R5B A;  4X2B A;  2HFS A;  4CLP A;  1VRT A;  1VQL S;  3NG8 A;  3G82 B;  1IKX B;  4Q5V A;  2HBZ B;  1VRU B;  1RDR A;  4JI0 F;  1UP1 A;  2IC3 B;  5D0E A;  2GVZ A;  1S6O A;  5GAH U;  3MPW A;  4W92 B;  3J81 Y;  1X0P A;  4LSL B;  4TY9 A;  3CCS S;  1GXT A;  2MMY A;  2OEM A;  4DR2 F;  3DNC A;  2XMJ A;  1EP4 B;  1FX2 A;  2HBR B;  2R2U A;  4KPY A;  2UXB J;  1X9S A;  4WP8 A;  3UDC A;  1CJV B;  1BQN A;  4P71 A;  1G2E A;  4GMK A;  3H40 A;  5L1J A;  2C28 A;  4P2M A;  1B7F A;  1VR6 A;  5L39 A;  4MK9 A;  1UMJ A;  4EI2 A;  2DJW A;  4RNM A;  3G96 A;  2Q66 A;  5CQG A;  2HNZ B;  2FUG 9;  4JOU A;  2EG1 A;  2V4J A;  3K8W A;  3PW7 A;  1ZM2 A;  1TUV A;  4KJI A;  2ZC4 A;  4CT9 A;  4I4B A;  5K9F A;  4C8O A;  3T9N A;  2YKM A;  3PCO B;  2OSQ A;  3TJ9 A;  5DM6 Q;  3CPW R;  1CLF A;  1MN9 A;  2LU2 A;  4JI8 F;  4ELV A;  5J1E A;  1OY6 A;  3MD1 A;  2CQ3 A;  3QLH B;  2B43 A;  3SSR A;  4CQ1 A;  4TQS A;  4MH8 A;  1H3D A;  2OKQ A;  2OPQ B;  3W5Z A;  5C7P A;  2OEL A;  2QGF B;  1Y0H A;  4Y6I A;  2I5J A;  3SQG B;  3OHA A;  4DUY J;  4N77 A;  2GO8 A;  2GGP B;  4OYX A;  4UST A;  3H2V E;  1ELO A;  5KTQ A;  5LXY A;  1U6F A;  4M5D A;  4DR3 F;  1RAC B;  1FWK A;  2ZNY A;  3OD2 A;  1FD8 A;  1Y00 A;  4CI0 B;  4NML A;  4CTA A;  5EWF A;  2VPW B;  2YNF A;  5F8L A;  5AE3 A;  3KLH B;  3UNY A;  3FVY A;  2F8H A;  4EU0 A;  3IM9 A;  3I55 S;  4DV3 F;  4X64 J;  2HHU A;  3L95 X;  4WP9 A;  4ES2 A;  2L08 A;  3HHL B;  2CNN B;  4DS5 A;  4K5R A;  1QE1 A;  2HS0 A;  2NZC A;  2JSX A;  1HYS B;  2B9X A;  3PNI A;  4NCG A;  5ADZ A;  3T5L A;  4HEA 9;  2G2Z A;  3TI0 A;  2KT3 A;  1I94 F;  2DNY A;  3I4H X;  4MIW A;  1MRO A;  2Y9H A;  1AA1 B;  2J7W A;  2E44 A;  2GQC A;  2N7Y A;  2XLI A;  1C0U B;  1KHV A;  3MAH A;  1LWF B;  4NOH A;  5IWA F;  3CCZ A;  3JSY A;  2ZH6 A;  1KD1 T;  3TJA A;  1C0T B;  1WUU A;  2CG4 A;  3MEE A;  1TKZ B;  3DDN A;  2D3U A;  5JVH Q;  3OJU A;  2E1M C;  1WSV A;  4MMO A;  4S0M A;  2MST A;  2Q79 A;  3V2U C;  2HHH J;  1N5T A;  1SKU B;  1CG2 A;  1VIO A;  2NUH A;  2F40 A;  1BC6 A;  1U1N A;  4HVZ A;  1SH3 A;  1TTH B;  2FZG B;  4DV2 J;  4LJM A;  1N6Q A;  1CUL B;  3PYE A;  3SQG A;  5IV4 A;  3W5Y A;  1YRX A;  3JTO A;  4ZLP A;  4J37 A;  1HR0 J;  4EMD A;  2JEI A;  4LF7 J;  3GFH A;  3HZE A;  4OX9 F;  2VC0 A;  2IM0 A;  2ZH7 A;  2ZH4 A;  2Z2L A;  3BQ1 A;  3DXS X;  3FC9 A;  4OZN A;  4RNH A;  4L6V 3;  2EI5 A;  4C7Q A;  3QYY A;  1RTH B;  1PIE A;  4WTO B;  1IJE B;  1NSK L;  2PMW A;  4MKB A;  4OIX A;  4KGX B;  5KG4 A;  3TVZ A;  3R5D A;  1U8S A;  2FHM A;  3H98 A;  3W60 A;  2P9G A;  2MKC A;  2BJE A;  1FEH A;  3TJ8 A;  1SV5 A;  4CH1 A;  2ROG A;  4MTP A;  2Z2M A;  3RRH A;  1S9G B;  1TVR B;  4P9S A;  4TY8 B;  2OIH A;  2BZ2 A;  2EFO A;  4JV5 J;  4WU2 A;  1QLN A;  4KO0 B;  4EUV A;  1DLO A;  2AJ2 A;  2JL9 A;  1VJW A;  1GQE A;  1RA6 A;  3IGV A;  3MWB A;  4FDF A;  1GT8 A;  2DNK A;  4NL5 A;  5EHH A;  4AXI A;  5CZV A;  1B0V A;  3DRP A;  4U67 Q;  2DYA A;  2HVE A;  2GVD B;  3A3O B;  1ZAX A;  4OX8 A;  4Q8E A;  2V9W A;  2L9W A;  3CO0 P;  3UQS A;  1IBC B;  4K4S A;  5A8R B;  2HQD A;  2QZ8 A;  2HFN A;  3PX4 A;  1X5S A;  2KKH A;  1NSA A;  2QG9 B;  3AHP A;  3QGG A;  4H4O A;  1SJ3 P;  2WBM A;  1YBU A;  2XSJ A;  2R7U A;  4TQR A;  3TA2 A;  3DLE A;  2MZ1 A;  2ZD1 A;  2A3J A;  1Q5V A;  3CW2 C;  3CDU A;  4DPY A;  1N32 F;  5FII A;  3KXD A;  1PSD A;  1KR4 A;  3IP0 A;  3Q2T C;  1Y3J A;  3C6T B;  3X1L B;  1KLN A;  2J8A A;  1APS A;  1IBM F;  2DNN A;  2BUN A;  1CJK A;  3DM2 B;  1VFJ A;  3DOM B;  4PWU A;  4ALZ A;  2W9C A;  3EYZ A;  2ZIT A;  2HQF A;  3C15 B;  4G65 A;  1NEE A;  2D41 A;  3AY0 A;  1KRP A;  1RT7 A;  5B0D A;  2Z8Q A;  1FNO A;  4UZB A;  5H9F J;  3MR2 A;  4U9R A;  3CCJ S;  5JXS A;  1WAC A;  3HD1 A;  4BBY A;  1VQ8 S;  4WTY A;  1Y5N B;  2BRK A;  5I3P A;  2J8S A;  3BR9 A;  2QA4 S;  3LW5 C;  4ENO A;  3MCO A;  1OYD A;  4WIQ A;  3HHK A;  4BC7 A;  4LF9 J;  2V4R A;  2HGM A;  3A8K A;  3BKU A;  3NY0 A;  3NCP A;  1WOO A;  2IM3 A;  2ZUG A;  1HHT P;  2FHJ A;  4MJK A;  3QT5 A;  1VQ5 S;  3FQK A;  1DZ5 A;  3EGV A;  3QBC A;  5D78 A;  1UVJ A;  2Z2Y B;  2YWE A;  3DCA A;  4UUW A;  4O3P A;  4AL5 A;  4PWW A;  4P6Q A;  2V0N A;  3RGI A;  4WU3 A;  5H9E J;  3UWT A;  2E7X A;  1XC9 A;  2DGV A;  3JS9 A;  3S1T A;  4AMM A;  4IOC Q;  1KS2 A;  3QLH A;  3QJJ A;  2RQ4 A;  2LXI A;  4ZS6 A;  3KLI A;  1C4C A;  1VIX A;  4V19 J;  3KLE B;  3GR0 A;  1LWF A;  1FI4 A;  2LKZ A;  4QU7 A;  3N9U C;  2G2O A;  1HIY A;  1FDN A;  4JI1 J;  2WVD A;  4B08 A;  4UT4 A;  4X4V A;  1S0O A;  4F0M A;  2KU7 A;  2NSC A;  3MFH A;  3ETO A;  3CCW A;  4OHY A;  2CIM A;  4ZVU B;  2ZH8 A;  4IO9 Q;  3SEO A;  4C0B A;  9RUB A;  1IKW A;  4EBE A;  3ENQ A;  2OPP A;  5HVH A;  3FUY A;  4A4J A;  1QAJ A;  1RAB B;  4R8U A;  1FDD A;  3SDE B;  1DTQ B;  2UUA F;  5IV3 A;  2IPO B;  5CZX A;  4PAB A;  4OYW A;  3PRD A;  4WYL A;  4YP3 A;  3V4I B;  4Q44 A;  2X1A A;  2AJF E;  2J9D A;  4Q45 A;  1U47 A;  1NK7 A;  4YY3 F;  2VF3 A;  2W4C A;  4NAS A;  3UDE A;  3ZNU A;  3J80 Y;  2IYG A;  3NGU A;  1NK6 A;  2Z57 B;  1H72 C;  4OMF G;  1FK9 B;  3L7O A;  3KJV B;  1Q78 A;  1IBM J;  3D67 A;  1WWH A;  2OUG A;  3EDQ B;  2GJF A;  5ETQ A;  3MUV P;  2X51 A;  2M5Y A;  2Y3Y A;  3QWU A;  2PA3 A;  1K1S A;  2D74 B;  4OFZ A;  5IM0 A;  3CC4 S;  1X4F A;  3JAM U;  3ET6 B;  3ONQ A;  1A9N B;  3KJF B;  2F3J A;  4J9S A;  5G4D A;  3S8S A;  5IT9 U;  2J9C A;  5ITH A;  4M94 A;  3J7A 1;  1M5O C;  1UZD A;  1E6Y A;  5KT7 A;  4RU9 A;  2XS2 A;  5BR8 F;  1YSJ A;  2F5G A;  4OZJ A;  4WII A;  2XHC A;  2R7V A;  3GJS B;  2AGQ A;  4PAA A;  1NJY A;  1R3N A;  1UVK A;  4M5J A;  2DGT A;  2HAF A;  3HHE A;  3GE9 A;  5IT4 A;  2RAQ A;  1BE4 A;  3BYR A;  1RT2 A;  2W4P A;  4MT1 A;  5HQM A;  1RT6 A;  4CDI A;  1Q8L A;  3HJV A;  3HM9 A;  3SQO P;  4JI2 J;  2L41 A;  2ZHO A;  2MLX A;  5KFT A;  5IZH A;  3UDV A;  3PW2 A;  5KG2 A;  1S77 D;  2ZH1 A;  4EZ6 A;  2YNH B;  1ZBT A;  1QSS A;  1FD2 A;  1HWL A;  2AGP A;  2OPQ A;  4IH7 A;  5D0R A;  3OTB A;  1TL4 A;  2JFK A;  1V3S A;  3CJR A;  2XLJ A;  1F5A A;  1NSP A;  1S48 A;  1L3U A;  4ID5 B;  1VQO S;  2R8J A;  3I31 A;  3R1H A;  2YKM B;  3WQP A;  1KQK A;  1LWC A;  5CAA A;  4K50 A;  2M7S A;  2CJK A;  4WE1 B;  1Z4U A;  4DV7 F;  2XSF A;  4ZPB A;  1NLK L;  3DYA A;  1HNI B;  2M2B A;  4UQG A;  4U95 A;  2IRX A;  3VAK A;  1RJJ A;  3BPD A;  5CA5 A;  5DZ6 A;  3GWC A;  3M32 B;  5IXU A;  1HPZ B;  2KG0 A;  4DL6 A;  4QWE A;  1U7L A;  5F8M A;  2DNP A;  1U1M A;  2K06 A;  5K8P A;  1VBY A;  1RTD B;  2JLG A;  3MMA A;  1KLM B;  2W8L A;  4ZJO A;  2CRL A;  3FRZ A;  1FF2 A;  3IM8 A;  3BKF A;  3KLG B;  1N34 F;  4LQ9 A;  3HVT B;  5KFK A;  1S5Z A;  4OL8 A;  4LRF A;  4QWB A;  1C0U A;  3RAM A;  2BXJ A;  2EBG A;  1T9Y A;  3FCV A;  4FP9 A;  1RU2 A;  1NBE B;  2FJA B;  2GAG C;  2G0C A;  4OHZ A;  4JYA J;  4RWW A;  1X4G A;  1TR0 A;  4B3M F;  4KBI A;  1PG5 B;  1KC8 T;  3M8Q B;  3CCQ S;  1KVJ A;  4I67 A;  2F65 A;  4XPC A;  3K17 A;  2DVI A;  5LJ5 Y;  2V9K A;  2LEP A;  5EUH A;  5EX0 A;  3H4B A;  4I0W A;  3KWM A;  5EWE A;  2G1D A;  1V3Z A;  2AMC B;  1WEX A;  2FHK A;  2JC1 A;  2WW8 A;  2OMO A;  2JWN A;  3BBF A;  3ILO A;  2BX6 A;  3BQ2 A;  2GHV C;  3KFW X;  2XMA A;  3IBF B;  5HVG A;  1NJZ A;  4RL1 A;  3W61 A;  1RAE B;  1U48 A;  4OYO A;  2NQP A;  4DU8 A;  4G1I A;  2W24 A;  2A6O A;  2R9L A;  3IWL A;  1A6L A;  1JB0 C;  2AX1 A;  4CRJ A;  3N01 A;  3M9M B;  3OW2 R;  3C46 A;  1FJG J;  4B3R J;  4KR0 B;  2VG7 B;  4QQB A;  3J80 U;  3OVS A;  4FYW B;  5GVQ A;  1PJ6 A;  4KYZ A;  5J2N A;  2CPX A;  2A2C A;  4YFU A;  2QL7 B;  3GFZ A;  3DGV A;  2FYX A;  5HP1 B;  1IBK J;  1I5O B;  5KG1 A;  3QO9 B;  3Q8R B;  1DJ0 A;  4DX6 A;  4IFV B;  5DDO C;  4QW9 A;  2PEH A;  3J7Z T;  1NHU A;  3CB4 A;  4Q2L A;  3HSJ A;  4RW8 A;  4WFY A;  4X84 A;  1RWK B;  3KJN B;  1IR0 A;  2HWT A;  4IYQ A;  5GAD I;  2E5H A;  5SUH A;  2KYZ A;  4HAC A;  2KDO A;  5I3U B;  3FSY A;  3I87 A;  3AAW B;  5HN0 A;  5DQI A;  3P6Y C;  1TU0 B;  4HH1 A;  2IVM A;  3TEH B;  4NLV A;  4CYU B;  2BJ1 A;  1H38 A;  1RE1 B;  3BBB A;  3NRB A;  1Q5Y A;  2KVI A;  4F26 A;  1OPZ A;  3C2P A;  3ENV A;  1JXV A;  2ZJP Q;  3RW7 A;  4ZHR A;  4RNO A;  4I2P A;  3LP1 A;  5KT4 A;  3K5M A;  1VHF A;  2NPF A;  2JRS A;  1VQS A;  4X4O A;  4HHH A;  4PQU A;  3LP0 B;  3PKM A;  2UUC F;  3K5P A;  2R8K A;  4B17 A;  1HD0 A;  2LEB A;  3OSN A;  2PI4 A;  1H2V Z;  3PAC A;  2N4C A;  1Y9O A;  2B5J A;  3KJV A;  2L3M A;  2LQ5 A;  3C6U B;  3N6M A;  1Z2Z A;  2M88 A;  3I5B A;  3AQP A;  4J90 A;  1FRI A;  2VU5 A;  4QYZ K;  2OD4 A;  4QIW D;  1IBL J;  4LF6 F;  2CUY A;  2QIF A;  1H2T Z;  2VQE J;  1FKO A;  3IBC B;  4Z37 A;  4QCL A;  4N56 A;  2OTJ S;  1FFS B;  3L7U A;  4G1P A;  2ADB A;  4CNY A;  4LVN P;  1FKP B;  3GLJ A;  2XBP A;  3VGS A;  3F0N A;  3KDN A;  3M8R A;  4HHU A;  1C1B A;  2WRM A;  1GMV A;  2Y8W A;  2GC8 A;  3OTC A;  4ZIT A;  4UZC A;  1D9A A;  1HI1 A;  3MF5 A;  1N5V A;  3I0R A;  3M8Y A;  3AOC A;  3UNG C;  1ICE B;  2WVC A;  3GJT B;  1R27 B;  2BAB A;  4M5I A;  4DZD A;  3W66 A;  2DPJ A;  5J1E B;  2J6U A;  3MCS A;  3RZA A;  4RLE A;  1W2B R;  1NUE A;  4OI0 A;  2VOP A;  4ZVE A;  2UZA A;  5BR8 J;  4O3R A;  1RTD A;  1SXL A;  4ICL B;  3W9I A;  2CFX A;  3KHH A;  4FYD A;  5EN1 A;  2XMV A;  4ECS A;  1S4E A;  2MQL A;  3GCX P;  1O8B A;  5DLF A;  2F4F A;  2VDI A;  1WJ9 A;  3H5U A;  4B9M A;  2QFI A;  1YI2 S;  1YIT S;  5DG8 A;  1UVI A;  3PRB A;  2HPU A;  3EJM A;  1JLF B;  4FNI A;  3VV2 B;  1DQ9 A;  3I4P A;  1RIS A;  3M6V A;  4F4Y A;  4LF5 J;  1SI9 A;  3TA1 A;  3RB3 A;  3MOJ B;  1SVD A;  3OBI A;  1PAU B;  4OLO A;  2UUW A;  1UWB A;  2RJZ A;  2K1R A;  1N0U A;  3OTD A;  3KNA A;  2IYI A;  2RU3 A;  2UXC F;  2BEF A;  4BCA A;  1BWV A;  3LAL A;  4B3T J;  1E6Y B;  2RT3 A;  1ZS6 A;  1REG X;  2ZJQ Q;  4UY8 5;  4PUO B;  2Y8Y A;  4PRF A;  3D28 A;  4DCP B;  4XK8 C;  2J9D E;  1VRU A;  3OXL A;  2A18 A;  2HHT A;  3JAM Y;  1FTC A;  3ILI A;  1HKA A;  1TFW A;  2R2R A;  5IFM A;  1FXR A;  2YWH A;  3OL8 A;  1KVI A;  3G71 S;  4QIF A;  1Q1K A;  3HSZ A;  4Y0F A;  3MEE B;  5GME A;  1WDD A;  2KHC A;  5C2C A;  1HW9 A;  4ZCK A;  3I0S B;  2DR9 A;  3GV7 B;  2WON A;  2BA9 A;  3I5C A;  2E5J A;  5DQG A;  2VJU A;  3NS7 B;  5JMN A;  2F4V J;  1Y5I B;  3TZX A;  4EO8 A;  2KL8 A;  2CQH A;  2F1F A;  1T9V A;  5KFO A;  2QMW A;  5EX3 A;  1O51 A;  1CJT A;  5L38 A;  1S49 A;  4WKR A;  2BJ9 A;  1N5Q A;  1UTA A;  2MLY A;  3CD6 S;  3AOD A;  3HX9 A;  3RG6 A;  4TU7 A;  3QID A;  1U4B A;  4BLG A;  3A3P B;  1XMQ J;  4LF6 J;  2HBQ B;  4XTT A;  3RUB L;  4FXW A;  5DDP C;  3NGR A;  4OX7 A;  2H65 B;  4FKX A;  1Q86 T;  2SXL A;  3PX0 A;  1EP4 A;  2NXN A;  4WFB Q;  3FSI A;  4LF4 J;  1S7H A;  2XEX A;  4NLO A;  1RBA A;  2OD6 A;  3PHE A;  5KFC A;  3TUJ C;  1ZOT A;  3UO0 A;  1FRJ A;  5KT6 A;  2DY9 A;  4TU8 A;  3QSY B;  2AYG A;  2G2Y A;  5K8O A;  5KG6 A;  1WTB A;  1AZS B;  1JLG B;  3U27 A;  2PGC A;  3AXK A;  3BGU A;  4M5L A;  4R25 A;  4WPA A;  5BJR A;  3BO4 A;  3RB0 A;  1HQE A;  1YJ9 S;  1ZH5 A;  3KG1 A;  3J81 j;  1DAX A;  1MWZ A;  5J2Q B;  1B64 A;  1UVN A;  3IC1 A;  1T3O A;  4LRB A;  1MLA A;  3AJ1 A;  1ULR A;  4TN2 A;  2DEJ A;  3B82 A;  4WCE Q;  2C2E A;  4H4K C;  1KFS A;  4X66 F;  1WC6 A;  3MTJ A;  1MMD A;  3ZZY A;  2AW0 A;  5A6P A;  2RNE A;  1AFI A;  1WI6 A;  3WZ0 A;  1JLA A;  2CPY A;  3KUH A;  4C98 A;  1PCA A;  4H4K A;  4DSE A;  2MPU A;  2BE2 A;  2ROP A;  4LSZ B;  1LXJ A;  3RAQ A;  2F4V F;  2F9J A;  4ZVQ B;  4DG1 A;  2CPJ A;  5D4O A;  3TUZ C;  3DRS B;  3OR1 A;  2IMW P;  4RBT A;  1FT8 A;  2BQR A;  5D8H B;  1JNR B;  3Q2S C;  3BF4 A;  5CD4 H;  1D8Z A;  4ELT A;  2ZJR Q;  5AXL A;  3C16 B;  4B3O B;  1BQM B;  4PYD A;  5LL6 d;  1QD1 A;  3GR1 A;  5HBM B;  4JUZ A;  4IQX A;  3AB2 B;  3O5T B;  4OI3 A;  1C1B B;  2LP4 A;  3DYA B;  1ZPV A;  2UU9 F;  3UPF A;  3CJ0 A;  3LWM A;  2CWK A;  1U1P A;  2YY3 A;  3TX0 A;  3W3S A;  1K73 T;  4P2F A;  2CJX B;  3UD5 A;  2RB7 A;  2JX2 A;  5DLG A;  5CYQ A;  3QRQ A;  1I3O B;  3M9N B;  5D0G A;  4ECU A;  3DRR A;  1T11 A;  4NMX A;  5E5N A;  2BRL A;  4R5P B;  2W1B A;  2R7W A;  3PW4 A;  4UY8 T;  1WKL A;  2VFT A;  3LA0 A;  3CJS A;  4GVL A;  2B4O A;  3RBZ A;  4JI7 J;  3D7S B;  3PIO Q;  4RUH A;  4HTI A;  3JSR A;  2E7W A;  4DV0 J;  4BHQ A;  2CQ2 A;  4JI6 F;  1GEH A;  2D69 A;  1ZA2 B;  3QIP B;  3GG0 A;  4C4W A;  2BAN B;  3K5L A;  1BY9 A;  2MLZ A;  3MAA A;  2CPH A;  4ZVR B;  4X66 J;  2W2Q P;  4IR9 A;  3NGT A;  4C3K A;  4H4M B;  3EMT A;  5G0R B;  1NPP A;  4ECV A;  4B3O A;  4YDD B;  2FB0 A;  4LFA F;  3KG0 A;  2K7J A;  4IRK A;  2A0F B;  3M6W A;  3W1Y C;  3MCN A;  5E3P A;  2DGS A;  3NNH A;  1CEZ A;  3C66 A;  1FTR A;  1HNV A;  1NDP A;  3OR2 B;  1SKS A;  4DV2 F;  5HQ8 A;  5KFZ A;  2LLZ A;  1I1G A;  1RT1 A;  2ACM A;  3PFE A;  3H59 A;  4U7U K;  3KG4 A;  1TL7 A;  5KFU A;  2LEC A;  4FF4 A;  1IWA A;  3OL9 A;  4X4Q A;  4P2X A;  4AUK A;  2IM1 A;  1SC3 B;  4W4M A;  3ETM A;  2ZBP A;  4M8L A;  1LWE A;  4Q7A A;  4CLY A;  5LOQ A;  4N5S A;  1YJN S;  1TKT B;  5D77 A;  4F4K A;  4DQR A;  1XNR J;  2KJV A;  4ZPW R;  4U8V A;  3Q23 A;  5HP1 A;  3TAR A;  2UXD F;  1VHI A;  1EET A;  2EXU A;  3HT0 A;  3M30 B;  2BKP A;  4NXM J;  2FLP A;  2C3Y A;  2NXE A;  2UXD J;  5AE1 A;  1RAF B;  5CYJ A;  4DU7 A;  2CPF A;  3P49 B;  4USV A;  4MFB B;  1F9E B;  1RAA B;  3F73 A;  4GVB B;  1OPI A;  1QAI A;  2H5J B;  2VQF F;  1S76 D;  2V4Q A;  3KUE A;  1M5P C;  1RBO B;  5C25 B;  1FHT A;  1F9F A;  4Q43 A;  3EZ5 A;  3VAM A;  1NH8 A;  2M8H A;  5ETN A;  1K1Q A;  3H8Y A;  4RWX A;  1FX4 A;  2LQJ A;  3IXQ A;  1LNQ A;  3NOC A;  3LUY A;  4GO5 X;  4PUO A;  1R7I A;  3H90 A;  4NE9 C;  4K59 A;  3N6L A;  2C3P A;  1WI8 A;  2CQ0 A;  3MAA B;  1JLE A;  2CQB A;  3T5H A;  4E98 A;  2WCX A;  3O1L A;  2AEM A;  2BJ8 A;  4X64 F;  2RIJ A;  2VJV A;  1H7W A;  4FF1 A;  3HD2 A;  4NA2 A;  3CMA S;  3CCE S;  2AYB A;  2V69 A;  3DHX A;  2AV5 A;  2MTL A;  3FCW A;  5LT5 A;  3MI7 X;  1KTQ A;  4RR5 A;  2XGQ A;  1JLG A;  1N33 J;  3ZO7 A;  3C19 A;  1V9O A;  3M9O B;  2YKO A;  3IG1 B;  1N0V C;  1FFW B;  4QPX A;  4X65 J;  3SSQ A;  2HZA A;  1EX8 A;  3I0S A;  5FLX U;  2WBR A;  2GW8 A;  3TW0 A;  5A0Y A;  2W9A A;  3W63 A;  4DLG A;  2V6A A;  3DMJ B;  5ETT A;  4R0J A;  1VC5 A;  1N32 J;  4ANC A;  2W01 A;  5KOW A;  4WZM A;  1OSC A;  1UPP A;  2VG5 B;  3H0P A;  2WOM A;  3G8Q A;  2E5G A;  4A8X A;  2DNQ A;  4I7F B;  5A8W A;  5KOX A;  2XY7 A;  3DLH A;  1XIQ A;  3BGR B;  2ZOM A;  5D4L A;  4JV0 A;  5B0B A;  3IA0 A;  4UQT A;  4F25 A;  2GAH C;  4LRE A;  1A7G E;  3LAK A;  1HNI A;  3DOK B;  3O3L A;  4CLU A;  1YKW A;  4DV4 J;  3GMG A;  4OYI A;  5KFY A;  2J0S D;  4DX7 A;  2C3M A;  4D3G A;  2H48 B;  2VBZ A;  5J2Q A;  4NXN J;  3T3F A;  1FDB A;  2O1P A;  4IFY B;  1J5E F;  2QMX A;  5CD4 A;  2O3D A;  2XB2 D;  2JVO A;  1YK9 A;  2D3O 1;  1WF0 A;  2MHE A;  4Y65 A;  1ZZN A;  3ZTS A;  1SBR A;  3R3T A;  3JSM A;  2BV3 A;  1JLA B;  2E7V A;  4JV5 F;  3D9B A;  3TVY A;  3WX8 A;  4DR4 J;  3T6B A;  2WON B;  3Q24 A;  1S7I A;  4ZVO B;  4WXO A;  1DHM A;  4A8Q A;  1U1Q A;  2B6A B;  2CQI A;  4NI2 A;  2YH1 A;  1YBA A;  2HND B;  2YKA A;  2ZWO A;  3Q89 A;  4NLR A;  1T7P A;  4A8Y A;  1NK4 A;  1S1U B;  2PSZ A;  4IG0 B;  4C2M A;  3VZH A;  3CF5 Q;  4AYB D;  4KSE B;  1IBL F;  4YHH J;  2RS8 A;  2VC1 A;  4QZV B;  5KFX A;  5FLX Y;  2I0X A;  3NS6 A;  4LBP A;  4RUC A;  3G8T A;  3JTN A;  3NNC A;  5LMU J;  3C14 A;  1RWX B;  2JVR A;  5B0C A;  4HR2 A;  3NP5 A;  1P27 B;  4I2Q A;  2FJX A;  1F5B A;  3OSP A;  3FEX B;  2W2P P;  4PG8 A;  2MZJ A;  2K2P A;  4KV8 B;  4USM A;  3K57 A;  4ELU A;  5IT9 Y;  3O2I A;  2ZDO A;  2MKK A;  2XCA A;  3HF5 A;  5LMU F;  1HQE B;  2GML A;  4CWB A;  2FJV A;  2CDR B;  3G6E S;  2VFV A;  2CNK B;  3JTP A;  1BD6 A;  2CQD A;  4P75 A;  3SCK E;  1CVJ A;  3H5X A;  1P9Q C;  1ROF A;  5MLC V;  2DNM A;  2J5A A;  2MKS A;  5ETO A;  3CUN A;  4JI4 F;  1IKY B;  1AFJ A;  2F7V A;  3UCZ P;  2ZBC A;  3J7Y U;  4LQ3 A;  1JKH A;  3OUY A;  2FDN A;  3M2R B;  1NM2 A;  2UUT A;  3ISN C;  1U25 A;  4ED1 A;  2HHX A;  3CDB A;  2YNG B;  3D0H E;  3RR7 A;  3TAM B;  3J7Y I;  3D54 A;  3CDA A;  4CP5 A;  1YWX A;  2WOM B;  2Z0G A;  3BH7 B;  1WD6 A;  1IUJ A;  4TLR A;  1X31 C;  4N8N A;  1XEZ A;  4DS4 A;  2QYC A;  3R27 A;  1RWN B;  4NLY A;  1T95 A;  2VPZ B;  2DGO A;  4IO1 A;  4NI2 B;  4ZCM A;  1JJ4 A;  1UA0 A;  5HLF A;  4JI3 F;  4P7V A;  2PMZ D;  4M5M A;  4P72 A;  3R8Y A;  1LEO A;  2VV5 A;  1MML A;  2CPD A;  2J7K A;  5KG0 A;  3VAH A;  2OPS A;  3M2V A;  4DV1 F;  1SL2 A;  2R7S A;  4LMZ A;  4LR7 A;  4CM0 A;  5A8K B;  4JI3 J;  2GO9 A;  1RZM A;  1RTI B;  5B0G A;  3CJK B;  1KTV A;  5LSL A;  3AOA A;  2HW3 A;  3M30 A;  2VUG A;  4YB1 P;  2WK4 A;  1YZ6 A;  1O0P A;  5F3T A;  1SQE A;  2B5J B;  5FDL B;  2KB2 A;  1K44 A;  4ED4 A;  4EWT A;  3Q22 A;  2HMI A;  1S4F A;  4LFB F;  1S1V B;  1WEY A;  2ILZ A;  5DDQ C;  4K4T A;  1KBR A;  2BMB A;  2JJ4 D;  2MDA A;  1JLC A;  3GYX B;  3HVW A;  6FDR A;  1F5C A;  3C15 A;  3AD7 C;  3I5A A;  1UFW A;  4GRS A;  5RUB A;  4O44 B;  2ALZ A;  1PGZ A;  3OPK A;  1YTY A;  3BDP A;  2ASD A;  4ED5 A;  3A12 A;  2MQN A;  4GVB A;  2CZ9 A;  2QSF A;  4B9U A;  2PMH A;  4WXW A;  2JFD A;  3B4M A;  3NGK A;  2C2R A;  4LRD A;  1YJ7 A;  4ZCI A;  2FGC A;  3TA0 A;  5DET A;  2MGZ B;  1F2G A;  4OJG A;  3BM7 A;  2Q6C A;  1B0T A;  2GFF A;  3QAU A;  2DIT A;  4P52 A;  4TVA B;  1Q7L B;  3SCL E;  2V2Q A;  3WBZ A;  5LMN F;  3D6M B;  2FVQ A;  3OFE A;  3G6Y A;  4OYZ A;  1YRT A;  4ZIW A;  2JLE A;  2BAC A;  5JJB A;  4FPI A;  1NK8 A;  4J9U E;  2AT1 B;  1RHM B;  1HBM A;  1TL7 B;  2RRA A;  1S79 A;  4N8O A;  2KM8 B;  3D66 A;  2ZH2 A;  1XNQ F;  2HRU A;  4NZ0 A;  2QV6 A;  4ZP6 A;  1T05 B;  3BDE A;  2W2N P;  3FBB A;  3PJX A;  3C6U A;  2HHQ A;  1NHV A;  3RU0 A;  1M0S A;  1L3V A;  4ED8 A;  5A2Q U;  3T1Y F;  4HI1 A;  4NCB A;  1HYS A;  7FD1 A;  3D5M A;  4ZJQ A;  4G6V B;  2O01 C;  4DN0 A;  4F4Z A;  2R4F A;  3GSD A;  1X4D A;  1CJV A;  4H4M A;  4FS1 A;  3HHN B;  4P10 A;  3GG1 A;  7AT1 B;  1Y7P A;  2Z58 B;  4L73 A;  3MEG B;  3VGV A;  2UVV A;  2KXF A;  4Y2C A;  5HMZ A;  1Q95 G;  3CDW A;  2A2D A;  3C8Y A;  3SMZ A;  4LSL A;  1KQS R;  1RT5 B;  4OV6 A;  5KFR A;  4Q0B B;  1ITP A;  1DTT A;  1URR A;  3CO9 A;  2PI5 A;  2H5E A;  1YVF A;  3NCQ A;  1GX5 A;  4F7V A;  2RVJ A;  2NPI A;  3AH6 A;  2DH9 A;  1S9F A;  2AZ1 A;  1QY7 A;  2IJR A;  1IXK A;  1S12 A;  3T41 A;  5D3G B;  1S1X A;  2N82 B;  1Z2L A;  1JIH A;  2DNL A;  2E1R A;  1HNV B;  2EKY A;  5AXK A;  2RML A;  3H25 A;  1H7X A;  5I3Q A;  4DFJ A;  4A8F A;  2QL9 B;  2LVW A;  2BE7 D;  3VGU A;  4HTJ A;  4KT0 C;  1R8H A;  4UOF A;  2A1B A;  1EHW A;  4BWM A;  2MZQ A;  4J9Q A;  3RRG A;  3NMA A;  3MED B;  4UW2 A;  4AL6 A;  4KO0 A;  3KHL A;  2IAJ A;  2J76 E;  1FJ7 A;  1VQM S;  4GKK F;  2HHV A;  5T41 A;  1QDU B;  2YBV A;  3MR7 A;  2MYF A;  3KHG A;  2XY6 A;  3B78 A;  1R0A A;  1IBK F;  2XWX A;  1S1T B;  2WSC C;  4I6W A;  3CJ5 A;  4KPC A;  4LVO P;  4ZPD A;  1OQ3 A;  2YNG A;  3CJT A;  4FN5 A;  3K59 A;  2B7C B;  1RXO B;  2L9D A;  2HG4 A;  3CJQ A;  2ROE A;  2PO4 A;  4DV1 J;  4E0D A;  4I2Q B;  5F41 A;  5LJ3 Y;  3W2W A;  4J9M A;  4P7T A;  3D3B J;  2L9N A;  2V50 A;  2YWW A;  2IBO A;  2WTF A;  2HQ3 A;  1X5T A;  4XO0 A;  1M1K T;  4A47 A;  1HBM B;  3N28 A;  4C8M A;  4DR2 J;  3CSK A;  4J7C A;  3PEH A;  3UD4 P;  4FBT A;  4CCH A;  1G3O A;  4F3Q A;  5A8K A;  2R8H A;  4IH6 A;  3CUL A;  3DFE A;  3NEK A;  3MUM P;  4NA1 A;  2OML A;  1VS3 A;  2AYE A;  3CXC R;  4X4R A;  3HKW A;  2ZHB A;  2FLO A;  2IMO A;  4ZKA A;  2VG5 A;  3PG9 A;  3B4D A;  4JBC A;  4B3S J;  2B9E A;  1LWC B;  4PXE A;  2VH7 A;  1QTN B;  4ZVP B;  4G1Q B;  1YJW S;  3TAP A;  2XZT B;  5KG5 A;  3E2E A;  3ILJ A;  1R6V A;  1U8W A;  2HS3 A;  2ZEJ A;  2YQ1 A;  4Y2I A;  3PXG a;  1EQM A;  4FYX B;  4O0I A;  2CXE A;  3BGR A;  5GAE I;  1E6V A;  1KDN A;  3CDE A;  3D0G E;  3HT3 A;  2PT0 A;  2R2S A;  3PW0 A;  4DR5 F;  4WWS A;  2V2Z A;  4RW9 B;  3TX8 A;  3GFX A;  3QRR A;  4NX9 A;  2K3K A;  3CCV S;  4CIO A;  3MM9 B;  1CQM A;  1BQN B;  1AZS A;  4QW8 A;  3FZB A;  1MG7 A;  2OI2 A;  1XMQ F;  2E5L F;  2CNO B;  1SH2 A;  4CO3 A;  4XPE A;  3DI6 A;  5C42 B;  1H73 A;  3M7V A;  1HWI A;  1LW0 A;  4IDK B;  2BQU A;  1EJ7 L;  3A8J A;  3HP6 A;  1PC4 A;  2CVI A;  3IS9 A;  2P6T A;  3KNG A;  1WG5 A;  4PPD A;  5KFQ A;  5KFD A;  3RBD A;  1RI7 A;  4URG A;  4JI6 J;  2B56 A;  1F0X A;  1IVZ A;  1YQH A;  2ZNZ A;  4MIA A;  4NRU A;  4J9R A;  3PX6 A;  2HBY B;  2QJ3 A;  4O44 A;  5KFG A;  3TQE A;  2I9S A;  1JLC B;  3VHQ A;  4CO0 A;  2HHS A;  1B4S A;  1DY3 A;  2CJB A;  1MWY A;  3RBE A;  2AP6 A;  5IS2 A;  4K4X A;  1S6Q A;  3ZZT A;  4ETX A;  4NXN F;  3QT6 A;  2E9R X;  2AD9 A;  2ZD1 B;  3HFK A;  1YJR A;  3FSX A;  3GJQ B;  1TVR A;  4TY8 A;  4ZPA A;  2YKP A;  2XTJ P;  2CQP A;  3VTI A;  5KFE A;  4IH5 A;  2YKN A;  4ED0 A;  3CJ2 A;  3WIU A;  4CLW A;  1HI0 P;  2B8Q A;  3GB0 A;  4RBU A;  3KK1 A;  1CJK B;  5AJ3 F;  4DSL A;  2RDD A;  2HVZ A;  1AUS L;  2VBY A;  1DQ8 A;  1WSR A;  3CCU S;  4DL3 A;  2JEG A;  3GQC A;  1VC0 A;  2ILY A;  4AQY F;  4QIG A;  3OL7 A;  1REV A;  2UV8 G;  3QZ8 A;  1PJ7 A;  3MEG A;  3MFI A;  1WOR A;  5E7O B;  2APO A;  3IR6 B;  1I6J A;  4K2J A;  4JI4 J;  6AT1 B;  2FZC B;  2MSS A;  3V6H A;  2J6T A;  2PC6 A;  4FPR A;  4OQJ A;  3W8P A;  4KKO A;  3QWP A;  1SKR A;  2JHE A;  1CJT B;  4DPX A;  4MIB A;  1RLD A;  2EFN A;  2GQ2 A;  4ZHR B;  1SL1 A;  1VQ4 S;  4LF7 F;  4DPO A;  4D3H A;  2VFS A;  3EIC A;  1RT5 A;  2U2F A;  4DR5 J;  3TZY A;  2HRY A;  2RHQ B;  4HDH A;  4CLK A;  3L4B C;  3J7A N;  4HKQ A;  4IG3 B;  4J9P A;  4PWD A;  2HVI A;  4CH0 S;  3G6X A;  3I6P A;  1YBT A;  3AJD A;  3FMW A;  2WVF A;  4PEO A;  3UVJ B;  4YUD A;  4IOB A;  2XMT A;  2IFX A;  3LPE A;  2GX8 A;  3SDE A;  3T9Z A;  1BMQ B;  2BKO A;  3M8P B;  5DJB A;  4CO4 A;  2XC9 A;  2XLK A;  4BC9 A;  3BZQ A;  4GKJ F;  4M5G A;  3UN2 A;  3GON A;  4NYZ A;  4O23 A;  3CJ8 A;  5IT0 A;  1HNX F;  5GAG I;  3GCW P;  1S6U A;  3MR5 A;  4B3S F;  1YJV A;  3US5 A;  3Q8Q B;  1TEL A;  1RTZ A;  2VQE F;  1JX4 A;  2MQQ A;  4HHJ A;  3KLG A;  1NDC A;  3F56 A;  3VZI A;  5ETV A;  3LAN A;  3JYT B;  5J2M A;  4WFA Q;  4QJV A;  2QFJ A;  2HFZ A;  2K1R B;  4NLT A;  1G6B A;  2QX0 A;  1TUG B;  5KFA A;  4J9K A;  2DR7 A;  4IR1 A;  3G4S S;  4K0K J;  1F9H A;  1MWQ A;  1TAQ A;  1VDH A;  3NLC A;  2RHS B;  5DRK A;  2D9P A;  2F63 A;  5CCL A;  5F8I A;  4ED7 A;  2WB4 A;  4DQI A;  3M8Q A;  5J1P A;  1WC1 A;  1EKS A;  3NXZ A;  1HQU A;  2V63 A;  3V6K A;  1FWP A;  3HSD A;  4KHP J;  3IG1 A;  3EGW B;  4OYM A;  4QYZ J;  4DF4 A;  3D0I E;  3P5B P;  3ZXW A;  2MGZ A;  2AGO A;  1LKZ A;  1SL0 A;  2W9B A;  5L46 A;  3HJF A;  2FY1 A;  2ZKT A;  2COL A;  4HI2 A;  3J7Z 5;  3NKY A;  1M5K C;  2C1E B;  1B0P A;  4F0K A;  4Y34 A;  5DDR C;  3O6Q A;  3LQV A;  1AT1 B;  1IQZ A;  1CQN A;  2HNY B;  3D68 A;  3B8H A;  4RW9 A;  2GV1 A;  2XCP A;  1B3T A;  4DCJ B;  5ETL A;  3AOB A;  4GKK J;  3KYL A;  1W25 A;  2EK1 A;  1LWX A;  5DG7 A;  2ZM6 F;  2QTW A;  4FF3 A;  3FJ2 A;  2DIV A;  2NLW A;  3L7P A;  4JI7 F;  3POT A;  3DLK A;  4L72 B;  5HAT A;  1S9G A;  2H51 B;  2B51 A;  4TKT A;  2AYM A;  2I5J B;  4DCO B;  3ELH A;  5F9N A;  1U45 A;  4JI5 F;  2KHD A;  1HWU A;  4OZL A;  3ZC4 A;  3DM2 A;  4CH7 A;  1OO0 B;  4KRW A;  2EVZ A;  5HVF A;  1N88 A;  4URS A;  3ZZZ A;  3KMQ A;  4ECT A;  1OQ6 A;  2JZ5 A;  4CTA B;  1EKR A;  2VOD A;  3OVA A;  2J0X A;  1NCL A;  5LM7 E;  3KK2 A;  1ZPW X;  2POK A;  3K2Y A;  5H9F K;  3LP2 A;  2DTJ A;  3QO9 A;  4A48 A;  4AD6 A;  1N4L A;  4AMO A;  2O5D A;  4V1A k;  5HI7 A;  3ZZU A;  4YB6 A;  2RU9 A;  2CWX A;  2YWF A;  2HHP A;  4ID5 A;  3QSI A;  2V8H A;  4EBC A;  4LRA A;  4KB7 A;  1M5S A;  2MQM A;  2XO6 A;  2VQF J;  3FGV A;  3V5R A;  4LR9 A;  1SB6 A;  2VD3 A;  2Z30 B;  5IOL A;  4I56 A;  2DNG A;  1RHU B;  2YNF B;  2C2D A;  3I9Z A;  4I64 A;  3LAM A;  1VQN S;  3IRX B;  3WIV A;  1GXL A;  4NXM F;  3IWN C;  4DN9 A;  1SCJ B;  3RTV A;  1R89 A;  3MAQ A;  3WX4 A;  3DLL Q;  3D1Q A;  2M70 A;  4YB5 A;  3Q0A A;  2LA6 A;  3DU6 A;  3IR7 B;  2FC9 A;  9ATC B;  5KT5 A;  2LQ8 A;  2IAJ B;  2JH3 A;  1OY9 A;  4L3K A;  4M5D B;  3TAM A;  3PZP A;  1EIY B;  4HT5 A;  1ZET A;  2DCL A;  2C2K B;  2ZBI A;  3TR5 A;  5D4N A;  1M90 T;  5A76 A;  4LF9 F;  3QAT A;  1NKE A;  4AT1 B;  3TWZ A;  4ECW A;  1TKD A;  1RAJ A;  1IKY A;  2GVZ B;  3THT A;  2X1G A;  4A8S A;  1RYR A;  2HWI A;  3BR8 A;  1KSP A;  1TKZ A;  5AXN A;  1S1W A;  2AWZ A;  1IKV B;  3HHL D;  4URQ U;  2RQK A;  2NZ4 A;  2AJ0 A;  3MPY A;  3EM1 A;  1KLM A;  3HKZ D;  4DSF A;  1PYT A;  2H54 B;  1T03 B;  4ECR A;  1UFK A;  1D8Y A;  1U2C A;  1NJX A;  3GIL A;  2FVP A;  3LP2 B;  3BKT A;  2DHX A;  4OYB A;  3RW6 A;  3GU0 A;  4ID8 A;  3ULH A;  5CZC A;  2QMU B;  1Q82 T;  2I8E A;  2KVQ E;  2JC0 A;  1HNZ F;  4K4V A;  4UUX A;  5DG9 A;  3MR3 A;  2DNO A;  3G87 A;  4ITS A;  1FDA A;  4ICL A;  4O3N A;  4BDP A;  3G9C A;  4X4N A;  2UP1 A;  2J0W A;  1VIS A;  5J2P A;  1U0H A;  2BKN A;  4DPU A;  2AJQ A;  3OXG A;  4KTQ A;  4KGK A;  3S6E A;  2ACY A;  3R6L B;  1NB2 A;  1TKX B;  3ET6 A;  2D7S A;  2PFF B;  3OT9 A;  1FCA A;  1NPK A;  4RZR A;  2MEW A;  3MD3 A;  2N3O A;  1RWO B;  4ZVH A;  2HND A;  3UCG A;  3EDR B;  3EUN A;  4WF9 Q;  3L9Z A;  2IC3 A;  2BOA A;  1VJQ A;  3NOG A;  4K4W A;  4L74 A;  3BPS P;  1X0F A;  4N76 A;  4GO7 X;  1R8P A;  1YX2 A;  1H98 A;  1HQU B;  1X4E A;  2UU9 J;  1K0T A;  1JLB A;  1RP5 A;  4PG4 A;  5B0E A;  1P1T A;  3TAQ A;  4YN3 B;  1SKW A;  3ZTQ A;  4PQU B;  2OPS B;  3ZTO A;  1RU1 A;  2W9B B;  1BHN A;  2B4U A;  2WSF C;  1UEV A;  3V81 B;  4TNO A;  4LBI A;  2KO1 A;  1LK7 A;  3M2U A;  3PDN A;  4C11 A;  1X60 A;  5JUM A;  1IM6 A;  3VAL A;  4ECY A;  3A13 A;  3AA9 A;  3MEC A;  2HK2 A;  4F2S A;  1WG4 A;  1KN6 A;  2MZS A;  1FNM A;  2VL1 A;  1S97 A;  1H0H B;  1YJU A;  4MYT A;  3VGT A;  2KM8 C;  2WVB A;  2DNZ A;  2FJD B;  4F36 A;  2B7B B;  2R2T A;  3CVK A;  3MMC A;  2ZC3 A;  3PV8 A;  4OZ5 A;  5I3U A;  2BE9 B;  3VQS A;  1XTZ A;  2C42 A;  3O44 A;  5EGY A;  1RA7 A;  2ZH9 A;  2BQ3 A;  4LF8 F;  4NZ6 A;  3R5A A;  5HMX A;  5KFW A;  3CCT A;  4XDC A;  4DPT A;  4LR8 A;  4HYK A;  1L3K A;  5E2Q A;  1MU2 B;  2FVC A;  3F41 A;  2B0G A;  1NH7 A;  4OI4 A;  1UJ4 A;  3D6T B;  4KGV B;  4WBF A;  3HMJ G;  2H3E B;  1S99 A;  2KZM A;  2HLT A;  4LF4 F;  4H4O B;  4DDF A;  4I68 A;  4FS2 A;  4Y28 C;  1NDL A;  2MXY A;  2JEF A;  3LGN A;  2FGO A;  1BXN A;  2KI2 A;  2KN4 A;  1T9U A;  1VI7 A;  2YQ3 A;  2XUL A;  3EZO A;  3MHY A;  2QRR A;  1WC3 A;  3I82 A;  1VLO A;  1HBO A;  1OIA A;  2V2V A;  4F3M A;  2RRB A;  1LXN A;  1FER A;  4N41 A;  3LF0 A;  4NRT A;  3R5J B;  3QJP A;  3G86 A;  4FYV B;  1VMB A;  5H1S V;  2DNR A;  4XAK A;  1LK5 A;  2QN6 B;  2K8G A;  1OJ4 A;  1U0S A;  1YRU A;  5KT3 A;  4CT8 A;  4U6P A;  5D3G A;  1UAW A;  5K14 B;  1XER A;  3DLK B;  4FYY B;  2VIC A;  4EYI B;  1N6Q B;  3ENW A;  1FEE A;  2DO0 A;  2BM1 A;  3OVB A;  2OPR B;  2UUC J;  2FQQ B;  1X4H A;  5THW A;  4C8K A;  4IG3 A;  4PWD B;  3W62 A;  3DGP A;  4KHM A;  3CNQ P;  3BB5 A;  1S9E A;  1VRQ C;  2O67 A;  2CA9 A;  3FEZ A;  3M1V A;  2X7I A;  4ZVS B;  5HQL A;  4GC6 A;  4Q8F A;  2FLN A;  3JQJ A;  1VK3 A;  2RUS A;  3ISZ A;  4BWJ A;  5L9X A;  4DFP A;  4YR3 A;  3V4I A;  2H9Z A;  1VCT A;  3ZFV A;  4DXL A;  1TL1 B;  4C6A A;  1HBN A;  2Q1L A;  2JOQ A;  4MK8 A;  5ETK A;  1VQP S;  2UXC J;  2HHW A;  2BBE A;  3M05 A;  4F04 B;  4NLP A;  3CGI A;  4QR0 A;  2HRT A;  2LDI A;  2KXN B;  1N36 F;  2WZ1 A;  3H2U B;  1GFW B;  1W2I A;  5T7L B;  4CO2 A;  3PYD A;  4IKA A;  4WFN Q;  3DRR B;  4NLG A;  3G6V A;  1BWE A;  1VBZ A;  1WKK A;  4OZ2 A;  5F9L A;  1HQ2 A;  1HA1 A;  3PFO A;  3QFW A;  1S6P A;  2GQQ A;  4DL0 C;  4ZP9 A;  3I96 A;  3C6T A;  3QT8 A;  3KTQ A;  4QU6 A;  1N33 F;  1SV5 B;  4DV5 F;  4QIE A;  2H4Y B;  4YR0 A;  1H2U X;  1NHK L;  2UUA J;  4KE5 A;  4AL7 A;  1QSY A;  1L5U A;  4ZCL A;  1MU2 A;  4DSJ A;  2M52 A;  5D0H A;  2GMJ A;  2XSJ B;  1RQ0 A;  3DLG B;  3M8P A;  2VOO A;  3C16 A;  3CC2 S;  1CC7 A;  3TZW A;  4YOE A;  4RNN A;  4KHR A;  4LUB A;  4L3N A;  3AD8 C;  4YME A;  1ZM4 A;  1RHK B;  1LFP A;  3GSI A;  4USH A;  2CKW A;  2X1F A;  1S1W B;  1CS4 A;  3K0J A;  2PEB A;  5FJ4 A;  1RLC L;  3BRE A;  2HQG A;  1RCX B;  2RS2 A;  2QLX A;  3ZZO A;  2CG8 A;  4O4R A;  3OTE A;  3GYG A;  1M5H A;  3PEJ A;  3OXF A;  3SV3 A;  2B4V A;  2V2K A;  1S1U A;  2X3G A;  3FBF A;  1RT6 B;  1SJQ A;  3EWG A;  3PYF A;  3AD9 C;  3E01 B;  3SCI E;  1XNR F;  1OSD A;  1V5V A;  1JJ2 R;  1ARO P;  1U0H B;  1CJU B;  4ZPT R;  1XNQ J;  4B9T A;  4DG1 B;  2IDE A;  3MM9 A;  2VG6 A;  5AE2 A;  4DSI A;  1Y3K A;  1VBX A;  5IC4 B;  2YWG A;  2ZBQ A;  2ZBR A;  4ES3 A;  4JB8 B;  2ZVI A;  2XMU A;  3Q86 A;  2YH0 A;  3PR5 B;  3UFC X;  4R0E A;  8ATC B;  1DRZ A;  5CCM A;  2ATC B;  2F8E X;  3QAE A;  5LMN J;  4KH0 B;  2V8G A;  5KG7 A;  2FLL A;  5DGB A;  1ZM3 A;  4LFA J;  3AT1 B;  1NB7 A;  2FJE B;  2HHH F;  3HVT A;  4OV1 A;  2YKN B;  1QE1 B;  2CJQ A;  5GAH I;  2J0Q D;  2HSE B;  1FJG F;  4KHP F;  2YTC A;  3NGD A;  4RBV A;  1IWG A;  1NRK A;  4KFB A;  2ZOG A;  1MRO B;  4N7T A;  1L3T A;  1Y5L B;  3NNA A;  3BGL A;  3MED A;  3T5K A;  3M4X A;  4PG7 A;  1Y10 A;  1LW0 B;  1PAE X;  1RT4 A;  4IDK A;  3JB9 k;  5C25 A;  2GHW A;  2ASJ A;  3PHT A;  3L3C A;  2RH3 A;  3HZG A;  1GK8 A;  1IR2 A;  2HGN A;  1R0A B;  1G4C A;  3DRX A;  4CLL A;  1R6Y A;  1RUS A;  5KFB A;  1I94 J;  4JI2 F;  2HLU A;  3R7S B;  3E3X A;  1Q8B A;  4YQW A;  4RW4 A;  3GIM A;  4QR1 A;  2HQI A;  3QRP A;  1R31 A;  2Z4P A;  1KOH A;  2QA2 A;  4NLS A;  3R7N B;  2XM3 A;  3HPO A;  3KOA A;  4B3R F;  4DV3 J;  4PPZ A;  2ADC A;  3PO4 A;  1S6Q B;  3BO2 A;  4KGZ B;  1XMO J;  3RRK A;  2M8D B;  3M6U A;  1QJH A;  5K8N A;  5HMY A;  3AFG A;  4AMP A;  2VA2 A;  4ILL A;  2F8M A;  5HK4 A;  3VAJ A;  1YLX A;  3Q8P B;  1PJ5 A;  1EQ0 A;  3PJW A;  1TK8 A;  2PE8 A;  2C3O A;  2VFU A;  3BGO P;  4DUY F;  2DR6 A;  4ZOS A;  1C4A A;  4R8U B;  2DGW A;  4W98 A;  2R8I A;  3OTO F;  1AYE A;  3MZI A;  1RB0 A;  3DLJ A;  4U8Y A;  5G0R A;  3LWL A;  3MEC B;  1UZH A;  3MUT P;  4O3S A;  5A8W B;  4NYP A;  3LGH A;  2EPI A;  3LO3 A;  3THP A;  4ZA1 A;  2NRE A;  2G9O A;  2IIH A;  2DK2 A;  3U1M A;  4YY3 J;  5K20 B;  5L1I A;  4KFB B;  4LF2 A;  3PTW A;  2WHO A;  3IMQ J;  3KLF B;  2DT9 A;  2EFP A;  4QPT A;  2W25 A;  2FJW A;  3D6H B;  4CO5 A;  5A0Y B;  4XIU A;  4KC5 A;  1RSC A;  1TKT A;  3IRW P;  2UUB J;  2DXD A;  4U7C A;  4K4Z A;  4OZ3 A;  3OV7 A;  2QSW A;  1E6V B;  2RDI A;  3BSA A;  4ZLN A;  1EAR A;  3SSS A;  2N4D A;  2UXB F;  4WFZ A;  1RWM B;  1ZA1 B;  2RD5 C;  1WC5 A;  3VWS A;  1R8B A;  5F8G A;  2VON A;  2L48 A;  1SIZ A;  3OR2 A;  2R7X A;  5E3C A;  1U2F A;  2HQC A;  3ICL A;  4JI1 F;  4PG5 A;  4AXJ A;  2KT5 A;  1NDK A;  4YHH F;  5CYM A;  1NU4 A;  2IVY A;  3HSG A;  3PRV A;  3FRY A;  1NXI A;  4ZLL A;  2UV8 A;  2AHO B;  5U47 A;  1BLU A;  3JQK A;  2E9T A;  3W9H A;  2NR0 A;  3PVX A;  3LTO A;  1C1C A;  5IWA J;  3V4M A;  5BYS A;  1DQA A;  4G3I A;  3QMQ A;  1KHW A;  4JP8 A;  1TUW A;  4ECX A;  3POT B;  1GMU A;  2MHN A;  2GCF A;  5J2M B;  3SBM A;  1NZA A;  1D3W A;  3FZ2 A;  1HBU B;  2NCK L;  1MMN A;  3MM6 A;  2BDP A;  1HNW J;  2IY5 B;  2HVD A;  5ETR A;  3R1L A;  2HGL A;  4NLD A;  3R2D J;  3P96 A;  4X4P A;  1WHV A;  4J91 A;  1F3F A;  3GYN A;  4NLW A;  4ZVF A;  4C0H A;  3KLF A;  3HVR A;  4IOA Q;  2NXC A;  2Z2Z A;  4LBH A;  5HAO A;  1FJE B;  1RAG B;  3NAH A;  2XMM A;  2ASL A;  4K2X A;  1R8C A;  3C3L A;  2P6S A;  2CVE A;  1J5O A;  3HVA A;  2XQC A;  2RQM A;  2EWH A;  4PKD B;  1X9M A;  1T02 A;  2E1A A;  1T9W A;  1HMV A;  2LXU A;  3DOL B;  3M8W A;  3U1N A;  4DQS A;  1RHQ B;  4DFK A;  4JI8 J;  2FD2 A;  5F8N A;  4DLE A;  1UWB B;  3TUI C;  3QGH A;  1S10 A;  1C0T A;  4K7Q A;  5HAN A;  5E33 A;  3UR0 A;  2B3T B;  2XNQ A;  2OP5 A;  1PIL A;  1S1V A;  2RKI A;  2ZKU A;  4F8R A;  1HLW A;  3VAF A;  2C2Z B;  4OHW A;  2VA3 A;  4NPO A;  4ED3 A;  2HS4 A;  3GIK A;  4FXD A;  3N5B A;  3BS9 A;  1FKA F;  2FVS A;  5EWG A;  2GHP A;  3PM9 A;  4OHV A;  5KFM A;  2GIF A;  5KFP A;  2XG8 A;  2MKI A;  3QZ7 A;  3Q8S B;  3QT7 A;  2WW4 A;  5F0W A;  2R3V A;  3IR5 B;  2R7O A;  4H54 A;  1N54 B;  3BN7 A;  3MM6 B;  3DDI A;  2KYX A;  4O3O A;  1Q4R A;  1U02 A;  2IRU A;  3FNN A;  2DHS A;  1RT4 B;  2XYP B;  2W8K A;  4A8K A;  2Q3P A;  4RW7 B;  4HDG A;  2DRA A;  1PBA A;  3BYP A;  4OLP A;  1U24 A;  2K3I A;  3TP2 A;  3K5O A;  2XZW A;  3TNV A;  4E2F B;  1NK0 A;  2CPI A;  3B54 A;  1X7V A;  4DR1 F;  3NGS A;  5KT2 A;  3K58 A;  3TO8 A;  3MM5 A;  1ZYQ A;  2MQP A;  3M8Z A;  1T05 A;  4G1Q A;  4EZ9 A;  1HI8 A;  2F9D A;  1SJR A;  1F60 B;  3QGP A;  1P6T A;  3NS5 A;  5ETM A;  1FRK A;  2HEK A;  4OJ3 A;  1FKO B;  1RAH B;  2CQC A;  4IQM A;  4M5N A;  1HR0 F;  5D15 A;  1DFD A;  3DLG A;  1RAD B;  3BV8 A;  4KQZ A;  5GAG U;  2DR5 A;  2BJD A;  4F0H A;  2K7K A;  1VK8 A;  2XO7 A;  5HL7 Q;  3KKF A;  4NA3 A;  3OFH A;  3X3U A;  1NJW A;  4F50 A;  1RCO B;  2D9O A;  2FZK B;  3KK1 B;  3C14 B;  4DR6 F;  3QQC D;  3AXM A;  2XNR A;  5A8R A;  2D3Z A;  3M2V B;  5F0U A;  3CTR A;  3U1L A;  4DOZ A;  2KFY A;  3KK3 B;  4DEZ A;  4O3Q A;  2G1H A;  4F2R A;  2U1A A;  1TFY A;  2OGU A;  3UCU P;  4C97 A;  5KFH A;  4X4T A;  5HRO A;  5HLF B;  1JQG A;  1HMV B;  3W7B A;  2YVS A;  1REV B;  4ZN1 A;  3BQ0 A;  5IQQ A;  4F4W A;  2XS5 A;  1RHR B;  3D3C J;  2R7R A;  2HMI B;  2MB0 B;  2EC2 A;  3KLE A;  1URN A;  4DX5 A;  4I6A A;  3CCR S;  2Y0S D;  3RAX A;  1S0M A;  2W7A A;  4K8R A;  2CJY B;  1WOP A;  2P9E A;  2ZH5 A;  2W9C B;  2DH7 A;  4ED2 A;  1NSQ A;  1EZZ B;  2YPZ A;  1KQF B;  3VVT A;  2UVR A;  3TQ1 A;  5CH7 B;  2DBB A;  4DR1 J;  1G7C B;  5F8H A;  1N48 A;  2KFZ A;  1A0O B;  1XK8 A;  2HKE A;  2HWH A;  3IRX A;  3KUG A;  3N79 A;  3KK2 B;  5KFL A;  4FF2 A;  3CIZ A;  3NWR A;  2IM2 A;  3MM5 B;  4YB7 A;  2MKH A;  2KRB A;  2QL5 B;  4USJ C;  4P74 A;  4A46 A;  1NKB A;  2VG6 B;  1N5S A;  2DPI A;  1QM9 A;  3DOK A;  4N47 A;  3AB4 B;  3CE8 A;  3V6J A;  3EPG A;  1OS5 A;  5L9N A;  3R5C A;  1OYE A;  4ED6 A;  3T1A A;  1UW9 A;  1VBK A;  3BH6 B;  4IFY A;  3UI3 A;  2LFV A;  3EPI A;  4PXB A;  2CAJ A;  2OJ3 A;  3D2W A;  2YPY A;  2LCW A;  5GMD A;  3VF0 B;  2PFD A;  2MKY A;  1Q8I A;  3OFG A;  4ZMM A;  3CC7 S;  3VAG A;  1PYS B;  1T9T A;  5CXT A;  1YDL A;  5GAD U;  1TAU A;  4DUZ J;  1FRL A;  1UWA A;  4P73 A;  4ZPV R;  1HHS A;  4KY3 A;  1HBO B;  3N0V A;  5BYR A;  1YJT A;  3ZZP A;  3WDO A;  4EFA C;  2CZV C;  3KK3 A;  3UE2 A;  4FVM A;  3IO1 A;  2DHA A;  2LA4 A;  1H74 A;  2M3D A;  3GIJ A;  3CCM S;  1FNX H;  1B7Y B;  1DTQ A;  2E5I A;  2DIU A;  1UET A;  2O66 A;  4PR6 A;  2HZV A;  4Y2A A;  2XWY A;  3CT9 A;  4YEA A;  5DS7 A;  2RF2 B;  5I42 A;  1JNZ B;  2AJ1 A;  3IBW A;  5KFN A;  1D9D A;  2XZD B;  2KZZ A;  1ZTW A;  1KWM A;  2OHD A;  3MXH P;  3DRY A;  2OPR A;  2Y1I A;  1DAR A;  4HT7 A;  2CJA A;  1VQ6 S;  3LPY A;  2PD1 A;  3EGZ A;  2NS1 B;  2BW2 A;  4LSN A;  1BQX A;  3OHB A;  3HDS A;  2ZFH A;  4WJB A;  3HK2 A;  2FTR A;  4L76 A;  2ZH3 A;  1JJC B;  1RTJ A;  3GPA A;  4XDD A;  4DL7 A;  4IUF A;  2G4B A;  1ZAW A;  3EVM A;  2RRN A;  1FRX A;  4UOC A;  4U96 A;  4DV7 J;  3OL6 A;  2UVU A;  4I69 A;  5LSO A;  4AMN A;  7FDR A;  1CBK A;  2CAD A;  2Q6B A;  4MKA A;  5F8J A;  4Q0B A;  2A10 A;  2C2N A;  3VAI A;  1J5O B;  1N5Y A;  4ZP7 A;  5M2U A;  3I32 A;  1NK5 A;  3H5Y A;  2VPX B;  1NAQ A;  1UJ6 A;  4WE1 A;  3MMB A;  2DGX A;  4LRC A;  3IFE A;  1N52 B;  1UPM B;  3W5X A;  4NEZ A;  3BJY A;  1KOO A;  3HLU A;  2YWK A;  3GV5 B;  1UEK A;  3KMS A;  1Q7Y T;  2XYG B;  2I2Y A;  1S1X B;  1QUP A;  2VZ9 A;  3ILL A;  5L8R C;  4NCA A;  3T6J A;  1M1G A;  3H7H B;  3R5G A;  2HIQ A;  4WKY A;  3BN4 A;  5K5M A;  3ZTR A;  4C8N A;  2MZT A;  4OHX A;  4USI A;  3MM8 B;  3TOQ A;  2D1C A;  4AFF A;  4DR6 J;  1PKU A;  2AZ3 A;  4USK A;  1BUX A;  1MNE A;  1RT1 B;  3N4W A;  3Q8V A;  3TVK A;  1T3N A;  1D1U A;  4QIV A;  4WZQ A;  1AW0 A;  1NND A;  2R7Q A;  3LP0 A;  1RT2 B;  4OJ1 A;  2X3D A;  4ZP8 A;  5IC6 B;  5KG3 A;  4B3T F;  3Q8Y A;  1Y4Z B;  4ECQ A;  4CZC A;  1U1R A;  2ZZN A;  1S6P B;  2CNL B;  5DO2 A;  2KJW A;  2ZDP A;  1DTT B;  1V3R A;  5AT1 B;  4DHV A;  4K4Y A;  2BE2 B;  1F3V A;  3BEG B;  4DL2 A;  3WC2 A;  2AKW B;  3M2U B;  3U02 A;  3MM7 B;  4C11 B;  3R6G B;  4C3L A;  1F1B B;  4LSN B;  1D9F A;  4LF8 J;  2R7T A;  2QE5 A;  3SZ2 A;  1WDT A;  4OX6 A;  5FDL A;  1ACM B;  2LYV A;  3A8I A;  4OYP A;  4NLQ A;  1UA1 A;  3TRG A;  3LOU A;  5BYQ A;  1U6B A;  2BYC A;  2XGP A;  3OJS A;  5JVG Q;  4ZDN A;  1NZ8 A;  2AIR B;  1YZ7 A;  1FK9 A;  2BJ3 A;  4OI2 A;  2DRD A;  3VQT A;  1VQ7 S;  1PC5 A;  4FBU A;  5LSR A;  1RAO A;  2FC8 A;  4J5O A;  4NZ7 A;  1HPZ A;  1GXU A;  2DO4 A;  2VZ8 A;  2WB1 D;  1V5I B;  2HFV A;  5DGA A;  1HAR A;  1RTI A;  2P5V A;  3MMA B;  3CJK A;  3RJM B;  5KFS A;  5GAE U;  2VG7 A;  3OLB A;  4EO6 A;  2QA4 G;  1CUL A;  3SXL A;  2DNH A;  3QIP A;  1RAI B;  1C1C B;  2ZVS A;  1R0B G;  5T14 A;  3SV4 A;  4JI0 J;  3GZ7 A;  2C22 A;  1GAO A;  2OEJ A;  3QNW B;  5J1N A;  2GZO A;  3MPU B;  1HFE L;  4TYB A;  3KHR A;  2DHG A;  3NCR A;  5E3R A;  4LFC J;  1GMW D;  4LIW A;  4R5P A;  3CJ3 A;  3WHI A;  2VDH A;  3SI8 A;  1FRH A;  1HBU A;  1TMM A;  2LU1 A;  1NK9 A;  2VBX A;  1M5V C;  1VQK S;  1WEZ A;  5LXR A;  1JWW A;  2QO3 A;  2EKN A;  5J2N B;  4RNF A;  2BM0 A;  2EFQ A;  4CLF A;  3R97 A;  3LGM A;  1Y11 A;  2YNH A;  4X65 F;  1WF2 A;  1FWL A;  1NPR A;  3O8W A;  1SJF A;  1XWL A;  3DC2 A;  1H6K X;  2IJN A;  3I56 S;  2HFO A;  1EB0 A;  5C24 B;  2ATL A;  1TP7 A;  4X62 J;  2XYH B;  4DF8 A;  3HO1 A;  3DU5 A;  3JSM B;  3G8S A;  2EK6 A;  4E8U A;  2EG2 A;  2OO4 A;  1ZAV A;  2OLW A;  4F02 A;  3DHW C;  3NBP A;  1FA0 A;  2H5I B;  2MY8 A;  4NLX A;  3KJQ B;  3W64 A;  5D6G A;  5B08 A;  3M32 A;  4RPF A;  1FFG B;  1RKJ A;  4B9N A;  5K8M A;  4ZVT B;  1NKC A;  3IN5 A;  3JSB A;  3RR8 A;  1SUQ A;  3M2R A;  2QLB B;  5GMK a;  1Q0N A;  3DDK A;  5A6W A;  4DX8 H;  5HO4 A;  3H20 A;  4RW7 A;  4IRC A;  2MJU A;  1GX6 A;  1N8R T;  3Q83 A;  4K4U A;  5KFI A;  3RYL A;  3UD3 P;  1U1K A;  3DI6 B;  5C42 A;  3PKY A;  2AEF A;  4EBD A;  4OYA A;  1SJ1 A;  1VYA A;  2NYI A;  3H5S A;  3T1Y J;  4ES1 A;  3BGF A;  1FVS A;  1Q81 T;  1EAY C;  2ABY A;  2QA1 A;  4J9N A;  3L09 A;  4OJH A;  2OFG X;  2DGQ A;  4UOH A;  1IJF B;  2QLJ B;  1WC0 A;  3W65 A;  5I42 B;  1T8E A;  2E9Z A;  1LW2 B;  1BQM A;  2MQ8 A;  1KFD A;  4ZJL A;  3IAS 9;  1SC6 A;  3ITH B;  4KKO B;  3PW5 A;  2OSR A;  3RB4 A;  1IKW B;  1WHX A;  1UVM A;  2Q43 A;  2J7U A;  1FRM A;  3H42 A;  5DQH A;  2EC0 A;  1S59 A;  1FKP A;  1T0T V;  3MPD A;  2OAU A;  4ERD A;  4O4G B;  4WFX A;  2GJI A;  4DJB A;  4EGL A;  1AUD A;  2YQ0 A;  4C8Z A;  2NSB A;  3D6F B;  4FZV A;  1FES A;  4LF1 A;  4C0O C;  2YNI B;  5E0O A;  4NYO A;  4B3M J;  4DQQ A;  1CC8 A;  1SH0 A;  2XI2 A;  1KEK A;  4JYA F;  2HK3 A;  1S1T A;  4DV6 F;  1IKX A;  4GC7 A;  1FE4 A;  2IHR 1;  4K5S A;  4CLZ A;  1IQT A;  4M1K A;  3UVJ A;  2IBK A;  2X1B A;  4YDX A;  2QEX S;  2W2M P;  4AQY J;  1N34 J;  4DV0 F;  3E01 A;  2DY1 A;  4OX9 J;  4J9L A;  3GFY A;  2DHH A;  4FNH A;  4RJV A;  5C2G A;  2IA6 A;  5CHC B;  1OY8 A;  4PG6 A;  1B99 A;  1IR1 A;  1S9E B;  1XMB A;  1GTH A;  2ERR A;  2YX4 A;  1YHQ S;  1JXE A;  3ENA A;  4X4U A;  2LQ9 A;  3SFU A;  2CZ4 A;  1O5J A;  3SIP B;  3UN5 A;  4ZN3 A;  3CD7 A;  1XMO F;  3PY8 A;  4CYU A;  3JYT A;  4DMZ A;  1GTE A;  1SIW B;  3HI9 A;  2OPP B;  2G0I A;  2W2O P;  2ZUA A;  2BW7 A;  3CWJ A;  3HFZ B;  3IAM 9;  4AND A;  1SJ4 P;  5F3Z A;  4Y00 A;  2R8G A;  2JLF A;  6FD1 A;  4I2P B;  1HNW F;  4F67 A;  1SUQ B;  1LW2 A;  1UFL A;  2MKJ A;  1IN0 A;  1SC1 B;  3TZZ A;  1K9M T;  1JXL A;  2GIQ A;  1MSW D;  3OQ2 A;  4NLU A;  5IQ6 A;  2CPE A;  2VKR A;  2PDA A;  4LT6 A;  4AE5 A;  4USW A;  2N7C A;  4QWA A;  1LWE B;  3DOM A;  5C5J A;  3A3N B;  4DFM A;  1D0E A;  2V5H G;  4C8Y A;  4B02 A;  2BAN A;  1S57 A;  2NYH A;  2PA8 D;  1QUV A;  3HHL C;  2VBW A;  5HJX A;  2KH9 A;  2DH8 A;  3E51 A;  3FFI B;  3K89 A;  5HMW A;  1W7W A;  4EYH B;  4A8M P;  2AQ4 A;  2Y1J A;  2RIL A;  3DGP B;  1WKJ A;  3DXB A;  3UN3 A;  4TXS A;  2W7P A;  2VHG A;  4GKJ J;  3MM8 A;  2C2M B;  5EDW A;  4DR7 F;  2M9K A;  3EGN A;  1Q53 A;  3ISN D;  3UW1 A;  3CME S;  2Z56 B;  1YG0 A;  3DOL A;  3FBC A;  2GS8 A;  4TLQ A;  2NXU A;  1BGX T;  3CMQ A;  4Z2X A;  1IM4 A;  3FEY B;  1CS4 B;  2B9W A;  1F2H A;  5B0F A;  2I6W A;  3P5T L;  3THV A;  2EW9 A;  2DIS A;  1XR7 A;  1JMT A;  1X9W A;  1TV6 B;  3V6D B;  3BBC A;  1PO6 A;  2IRY A;  4QYR A;  1PYO B;  1XJW B;  2IDL A;  2DR8 A;  2UUB F;  4B9V A;  1M1H A;  2BR0 A;  1XR6 A;  2KT2 A;  4M63 A;  3FMB A;  3MGJ A;  4MKV A;  4PXC A;  1HHQ A;  1RT7 B;  1XR5 A;  2PII A;  4NWB A;  1HW8 A;  2FY8 A;  3MDF A;  2QT7 A;  1RKI A;  1FXD A;  1JLQ B;  2LMI A;  2W4D A;  2ZE2 A;  4M5H A;  5CYM B;  4MFB A;  2ZOF A;  3TYT A;  1UVL A;  1KKH A;  1U2R A;  1K0V A;  3MCM A;  5B7W A;  4ZK7 M;  4DBQ A;  4DUZ F;  2G0J A;  1X5O A;  4ILR A;  3EVW A;  4Y2K A;  1JLB B;  4IRD A;  3NL0 A;  3OTO J;  2V8P A;  4W90 B;  4KGM A;  4MKY A;  3S7R A;  3W9J A;  1MW7 A;  3DRP B;  3GP9 A;  5D4P A;  2BVZ A;  4ZPC A;  5HSP A;  1B70 B;  2ALY B;  2DGU A;  2RE1 A;  3NAI A;  4RW6 A;  1KP6 A;  4I6Y A;  8RUC A;  2Y1L B;  4I1T A;  4V19 X;  2ZHA A;  2XS7 A;  4LFB J;  5AXM A;  1FO1 A;  4ANE A;  1UW4 A;  1VGY A;  5BXI A;  1P8G A;  2VPY B;  3MM7 A;  2QC3 A;  3FK4 A;  2IVF B;  1R0C B;  4QWD A;  5DM7 Q;  2Y0B B;  3NBP B;  2IJF A;  4A8O A;  4DV4 F;  3TAN A;  4FVC A;  2J6S A;  4RO0 A;  3MMB B;  4C8L A;  2GNK A;  2KG1 A;  3HUL A;  4Z7Y A;  4UOG A;  1RWU A;  3KLV A;  1Q16 B;  2MY7 A;  5HBM A;  4C48 A;  3EXC X;  3NWG A;  2AX0 A;  1GNK A;  1XBW A;  2V8D A;  4MK7 A;  3NMR A;  1X5P A;  2ZWP A;  3SCJ E;  4DPW A;  3K5N A;  1LOU A;  1HL6 A;  2R42 A;  4OZ0 A;  4LF5 F;  1JK9 B;  3M6X A;  2ZM6 J;  3QGI A;  1RWP B;  4RW4 B;  4HAC B;  5ETS A;  1HNZ J;  2W7O A;  3QFH A;  3A1Y G;  1RGV A;  4KAI A;  1AXQ A;  5CYQ B;  4BS2 A;  1PBU A;  4L75 A;  4Y2M A;  3TEG A;  3VR1 A;  1I51 B;  1UJ5 A;  2WSE C;  4ZVG A;  1UL3 A;  4U7U D;  1JLQ A;  2ZE2 B;  1WG1 A;  1DBD A;  2RUG A;  4RKU C;  4P2S A;  5FD1 A;  2WAQ D;  3SYZ A;  1VQ9 S;  1X4A A;  1J27 A;  3CJ4 A;  5M2R A;  5J2P B;  2DCU B;  2AJ4 A;  4MAK A;  3ITH A;  1SPB P;  5E3Q A;  4J9O A;  3EXY A;  1R43 A;  4WP3 A;  1FJC A;  4TYA A;  1LFW A;  4F4A A;  2BOP A;  3IS9 B;  3K8V A;  1IKV A;  1QTM A;  5KFJ A;  1WTF A;  3MUR P;  2YNI A;  1K8A T;  4HH0 A;  3HXM A;  2DKO B;  3H2L A;  5HRO B;  3N5F A;  4IFV A;  3U7J A;  1T03 A;  3DRS A;  3OR1 B;  4NCG B;  1RWW B;  2VAS A;  2HNZ A;  2UVW A;  2YXL A;  3KLI B;  5HJY A;  3MTK A;  1CSJ A;  3MEK A;  4IG0 A;  1J2V A;  2HVH A;  1VOM A;  4RUB A;  1HWJ A;  1VRT B;  1L3S A;  2YX1 A;  1HNX J;  3MMC B;  1TL3 A;  2I1R A;  1WHY A;  1QVG R;  4UF4 A;  4M95 A;  4M5K A;  1X4C A;  3JXO A;  3OFF A;  2P8I A;  1OWX A;  4PZV A;  2CQ4 A;  2RF2 A;  4CLT A;  3BSN A;  1TKX A;  5DZ7 A;  4DL4 A;  2V68 A;  1U6Z A;  3HHL A;  2C3U A;  3IWX A;  3CIM A;  1RYS A;  3N6N A;  4OI1 A;  1TZ0 A;  4ECZ A;  3PJ9 A;  2AEJ A;  2MJN A;  4Y3C A;  2DXF A;  1VLY A;  4UTG A;  3KLH A;  1RTJ B;  2YKQ A;  2D3O R;  1T94 A;  4O0N A;  4QOT A;  3MOZ A;  3AJ2 A;  2RDJ A;  4DSK A;  1ZM9 A;  2QLF B;  4DV5 J;  1S0V A;  1FXL A;  4CLS A;  4OI6 A;  2I38 A;  3MR6 A;  2V4J B;  3W2V A;  3TUP A;  2LEA A;  3G82 A;  1K47 A;  2PN6 A;  2H4W B;  4HLB A;  2FHO B;  5IM0 B;  1WC4 A;  2E66 A;  2CDQ A;  2CJ9 A;  5E41 A;  1P1L A;  1X4B A;  1TK5 A;  2CYY A;  2VFR A;  4RU2 A;  3P8B B;  3D1O A;  2DRB A;  1TK0 A;  4WK3 A;  2VB6 A;  2J9E A;  2HIY A;  5KFV A;  3PIP Q;  2HAI A;  1FVQ A;  3D4J A;  2XY5 A;  1UKU A;  3T19 A;  4LIR A;  4PYA A;  1T9X A;  1XN9 A;  2P2C B;  4A8W A;  1Q79 A;  2MZR A;  3WC0 A;  5AJ3 J;  5KFF A;  3MMJ A;  3GTY X;  2E1P A;  3A8E A;  3DN9 A;  2VKZ G;  1TV6 A;  2JNJ A;  4CO1 A;  2DEI A;  3V6D A;  2N3L A;  2NXJ A;  4DZ6 A;  5H9E K;  5K14 A; 
#chains in the Genus database with same CATH homology
 3IM9 A;  2QJ3 A;  4AMN A;  3EZO A;  3R97 A;  5DZ6 A;  3TQE A;  2CUY A;  3RGI A;  3CJ8 A;  4RR5 A;  3BV8 A;  4AMO A;  3QAT A;  3TZW A;  3HHD A;  3HJV A;  2C2N A;  2H1Y A;  4AMM A;  2G2Y A;  4RL1 A;  3TZZ A;  2G2Z A;  3PTW A;  4QBU A;  2JFD A;  2QC3 A;  3R8Y A;  3IM8 A;  2G2O A;  3TZX A;  1MLA A;  4AMP A;  2JFK A;  3SBM A;  5DZ7 A;  3TZY A;  2G1H A;  3K89 A;  3H0P A;  1NM2 A;  3G87 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...