3TZYA

Crystal structure of a fragment containing the acyltransferase domain of pks13 from mycobacterium tuberculosis in the palmitoylated form at 2.2 a
Total Genus 179
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
179
sequence length
464
structure length
464
Chain Sequence
b'ELPGVTEEALRLKEAALEELAAQEVTAPLVPLAVSAFLTSRKKAAAAELADWMQSPEGQASSLESIGRSLSRRNHGRSRAVVLAHDHDEAIKGLRAVAAGKQAPNVFSVDGPVTTGPVWVLAGFGAQHRKMGKSLYLRNEVFAAWIEKVDALVQDELGYSVLELILDDAQDYGIETTQVTIFAIQIALGELLRHHGAKPAAVIGQSLGEAASAYFAGGLSLRDATRAICSRSHLMGEGEAMLFGEYIRLMALVEYSADEIREVFSDFPDLEVCVYAAPTQTVIGGPPEQVDAILARAEAEGKFARKFATKGASHTSQMDPLLGELTAELQGIKPTSPTCGIFSTVHEGRYIKPGGEPIHDVEYWKKGLRHSVYFTHGIRNAVDSGHTTFLELAPNPVALMQVALTTADAGLHDAQLIPTLARKQDEVSSMVSTMAQLYVYGHDLDIRTLFSRASGPQDYANIPP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Polyketide synthase PKS13
publication title Biochemical and structural study of the atypical acyltransferase domain from the mycobacterial polyketide synthase pks13
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 179
structure length 464
sequence length 464
chains with identical sequence B
ec nomenclature ec 2.3.1.-:
pdb deposition date 2011-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00698 Acyl_transf_1 Acyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.250 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Malonyl-CoA ACP transacylase, ACP-binding 3tzyA02
3.40.366.20 Alpha Beta 3-Layer(aba) Sandwich Malonyl-Coenzyme A Acyl Carrier Protein; domain 2 Malonyl-Coenzyme A Acyl Carrier Protein; domain 2 3tzyA01
2G1HA 3QATA 2QC3A 2G2ZA 4RR5A 3CJ8A 3TZYA 3R97A 2G2OA 4AMOA 3G87A 3HHDA 3TZZA 3H0PA 3BV8A 3SBMA 4QBUA 3TZWA 4AMMA 3EZOA 2JFKA 3TQEA 2JFDA 1NM2A 5DZ6A 3K89A 2C2NA 3IM9A 2QJ3A 3IM8A 2G2YA 4RL1A 2H1YA 3TZXA 3RGIA 1MLAA 3R8YA 5DZ7A 3HJVA 4AMPA 4AMNA 3PTWA 2CUYA
chains in the Genus database with same CATH superfamily
3HK2A 3AHPA 1VQYA 1JKHA 2HRYA 5LSLA 4F36A 5B0BA 3RJMB 1YLXA 4DPXA 4JI1J 2J6SA 4GO7X 1RGVA 3D0HE 3CCQS 2ZBIA 1WC6A 2XS7A 2J0WA 4Y65A 3A13A 3R1HA 4O3RA 1BQXA 3GJQB 4O4GA 4QIVA 1TL3A 2D1CA 3O1LA 4Q0BB 1IKWB 4KRWA 1F3VA 3B54A 1BXNA 5GMEA 1S99A 3TRGA 3VAJA 4U67Q 3HO1A 1EAYC 2XY7A 1KD1T 2ZM6J 2JC0A 5DM7Q 1MSWD 2OELA 1HWUA 2JVRA 1VQNS 5K20B 5CHCB 3DOLA 4QWDA 2B8QA 3KHHA 3CSKA 2HS4A 2HZCA 2HVDA 1KNZA 1HBMB 3T9ZA 3ISNC 1PG5B 3DCAA 2N4CA 5HP1B 4ICLB 3M32A 1FNMA 2PMWA 1B0PA 1UCNA 4NLOA 4X84A 4EBEA 1G7CB 2GO8A 3IO1A 3KOAA 2OGUA 2R3VA 2RSQA 1IBLF 2IJRA 4ELUA 2HLTA 1IJFB 2X1AA 2YKNA 4QIGA 3ZZUA 4IR9A 3PEJA 1Q95G 4O3PA 3I0SB 3AXKA 1VRUA 2VKZG 2K1RA 3GYGA 1FA0A 5D15A 1SV5B 3MUVP 1YIJS 3RB0A 1YZ6A 3UDVA 1N8RT 1NSKL 4K0KF 1XR7A 3ITHA 4FYWB 1RU1A 3FCHA 1JQGA 2C3OA 4OZ3A 3H2VE 1FKAF 3NS5A 4DR2J 3PM9A 4PXDA 1WSRA 2J9DA 1CJKB 3C15A 1N5YB 4OV6A 3MM7A 4ZVQB 4RW8A 1KKHA 1YJVA 3R97A 1NB2A 1XMOF 4UY8T 1H74A 4RW6B 4QW8A 3E8OA 1U49A 4OZNA 5BR8F 3FRZA 3RB4A 4K4SA 4ELTA 4DFPA 4OHZA 4FXVA 1QLNA 2RNEA 1T7PA 1NSQA 2W8LA 4GVLA 3J7YU 2XB2D 1DAXA 2M52A 1LWEB 2GNKA 1IQTA 3K5MA 4J5OA 2NXCA 3R5JB 3OTCA 5K8PA 3G6VA 2RVJA 1X9MA 4CLYA 4C2MA 3I32A 3BBBA 3CCVS 4DCJB 4CT9A 5A0YB 3OFEA 2RQKA 3MR3A 5CYQB 4DX7A 3RB3A 5DRKA 4DSIA 1CC7A 4DR4J 3DLEA 2H3EB 3PX4A 4X4NA 4OHVA 3BN4A 4WBFA 3MAQA 4OHYA 4X4OA 1TL3B 3LP2A 1UEKA 4RLEA 1HW8A 2W4CA 2QA1A 4LSNB 4DN0A 4DR6F 5LXRA 1YRUA 4DEZA 4RZRA 3G8QA 1G4CA 3RRGA 5EHHA 2ADBA 1XNRJ 3KWMA 5J2QA 4NXMJ 1RXOB 2GHVC 2JLEA 3NBPA 4X64J 4FYVB 1C1BA 2MKJA 3NAHA 3GJSB 2H4YB 3BGOP 2V8HA 1B4SA 2P6TA 3M32B 2B56A 4RWWA 4YY3J 4ZVGA 1T9VA 4M63A 5KFGA 1Q86T 3DDKA 4KC5A 5LJ5Y 4NLRA 1YBAA 3GV8B 4KSEB 2DNMA 1TK8A 2EI5A 1VJWA 2DR7A 2YKNB 4NA3A 4RPFA 2CZ4A 3DM2A 2ACMA 1PC5A 1KFDA 4G1IA 1Q4RA 1FXRA 1HBNA 1VRUB 5KFJA 3Q86A 1U1PA 4MYTA 4DV7F 3ITHB 2KG1A 1SQFA 4AT1B 5IZHA 2KJWA 2W4PA 2HG4A 1NZAA 2OKQA 1JWWA 4ZK7M 1S7IA 3EMTA 4KO0A 3LQVA 4MAKA 1AROP 4LR9A 4KHRA 3MM7B 2CRLA 4ES1A 1RYSA 3PX6A 3GR1A 3KLGA 4LVOP 3N0VA 1JJ2R 3LGMA 1IBMF 5HVFA 3DRPA 2B7BB 1VBKA 3P4UB 3Q83A 4DPTA 2AJ0A 2C3YA 1Y11A 3H20A 2R8GA 4MK7A 2F65A 1YJNS 2AIRB 3QSYB 1F5AA 1YSJA 4RR5A 2B8PA 2AEJA 3H25A 3TZZA 3H0PA 2AT1B 2JRSA 4USIA 2Z2YB 3MCMA 2VC1A 3R27A 4B3RF 2H5JB 2OD4A 1M5SA 1RLDA 3CJ5A 3DLEB 3DI6B 3M2VA 2HHUA 2MQMA 1V5VA 3OL8A 4ED3A 4WFXA 1Q8BA 3SCIE 4DU8A 3RZAA 3GYNA 2BEFA 2J0SD 1JLAA 1P9QC 4DU7A 2MJUA 5CZDA 1SJ4P 3GG1A 3IN5A 5K9FA 3W62A 3RBEA 2H65B 1D0EA 5KFIA 1FO1A 1Z2LA 3CPWR 2HBYB 2IA0A 1U45A 2AYBA 3GP9A 1VMBA 3M9OB 3BO3A 3HVTA 4CNYA 5KFTA 1FRMA 3C14B 2Y1LB 1FDAA 1VBXA 1QSLA 4DZ6A 4K2JA 3HHDA 3CDEA 3CO0P 1HBUA 3VGTA 1U0SA 2M7SA 5KFXA 2LA6A 1N5SA 2G9OA 4LBHA 5KT3A 2J6TA 4O44A 3BS9A 4K5SA 4LQ3A 2GVZA 3QMQA 1JK9B 3IA0A 3SBMA 2MGZB 1CG2A 4QWAA 2DR9A 3MD1A 3GSDA 5F9LA 5HVGA 2BV3A 1M5OC 3ZTQA 4BWMA 1N36F 4TQSA 4ZLNA 5KT6A 1HBNB 1N6QA 2XULA 2AZ3A 2KT3A 5DETA 4RUCA 2F3JA 2P2CB 3EE3A 4MJKA 4PKDB 1M5PC 2HYIB 1HL6A 1ACMB 2VONA 5EWEA 4JP8A 4DV1F 3DYAB 2CVIA 3S8SA 2E5LF 2AW0A 2HSEB 2XYHB 2DH9A 4B02A 2VASA 3HSJA 4DUZF 2YWEA 3UR3C 2QIFA 1WEXA 2CQ3A 3EWGA 4LF4F 1WI8A 4AE5A 3PIPQ 2GA7A 1R7IA 2FJVA 4OX9F 1X7VA 5LMUJ 3E2EA 1VQ7S 4KPYA 1G3OA 5A8KB 2QYGA 3OSNA 1KQSR 2O01C 5AXMA 1RB0A 4NXNF 3Q8SB 5F8HA 3A8JA 2BR0A 1IWGA 3IR5B 4OYMA 2PE8A 4FF2A 3D67A 3Q8UA 3K57A 3TAPA 2RJZA 3G6XA 1R27B 4ZVRB 4RW9B 1SL2A 1HW9A 4A8MP 2QL7B 3DLGA 5M2RA 5U47A 2F8MA 2GHPA 2HMIB 5DO2A 3OXGA 2WRMA 1NK6A 2LQ9A 2E5GA 3V81A 4YB7A 2V2QA 5BXIA 1RISA 4G1QA 1JLQA 2JX2A 4L74A 4LF1A 3MMAB 2ATLA 3M2VB 2XYPB 4EO8A 1PC4A 1IKVB 2CZVC 4M5KA 4I67A 4N47A 1URNA 2C2EA 3OTDA 2AX0A 4EYHB 4U7UK 2CDQA 1U1KA 1JLAB 4ECTA 1MN7A 2VA3A 2W4DA 2AYEA 1JXVA 4OI0A 1GK8A 5EDWA 3GFZA 2UXCJ 1RTHA 3I82A 4TVAB 1AZSA 2L9NA 2QX0A 2XMVA 4ZJLA 1A0OB 3KJNB 3ENVA 3HHLD 4JV5F 2IC3A 4MKVA 5HO4A 3MR5A 3EPGA 3MEGA 1E6VB 5E3QA 4LSLA 1OWXA 3CVKA 1TU0B 2HQCA 2HEKA 4X62F 1N0UA 1EKRA 5I3QA 3OQ2A 4G6VB 2BE2A 1TQLA 2RKIB 5KG5A 4DR3F 3B8HA 2GVZB 2Y1RI 2DNHA 4ZVHA 4R8UB 1WNEA 1NHUA 4OI3A 2ERRA 2DEJA 1X9WA 1YWXA 3K5OA 4Q2LA 2EC0A 2JL9A 1TUVA 2ATCB 4DF8A 4R0JA 3LAMA 1MU2A 1E6YB 4NI2A 2ZWPA 2ZJPQ 2DJWA 2OTJS 3I56S 3FMBA 1I6JA 4ZVUB 3MURP 2ZFHA 4JI1F 3G96A 1SKWA 1HQ2A 2BRLA 4QU6A 2DO0A 1UPPA 2E7VA 3CC4S 1S6OA 1S1TA 2C2ZB 3L9ZA 4WYLA 1S9EB 4E0DA 1M5VC 4Y34A 2EBEA 1N88A 1GMUA 3OLAA 5A6PA 1WDDA 2UUAJ 3GIIA 2W1BA 4F0HA 4B9TA 3MCOA 3CJSA 3ETMA 4DV4J 1U1MA 1GTHA 1M0SA 4ANEA 2G1HA 3DDIA 2XNRA 2XY6A 1FERA 2V8VA 1VQ8S 1IKYA 3PW5A 2W9BA 4DWIA 3R6LB 2A6OA 3B6BA 2PMZD 2Z0GA 2LEAA 2DGQA 1FX4A 4HYKA 2MZQA 2ZOGA 4CTAA 1H7XA 4RBTA 3DU6A 2V2KA 3TAMA 4OI6A 3GE9A 2BJ8A 4OJ3A 1LFPA 1FJGJ 2WW4A 3VAFA 2GJFA 4RW4A 2HQGA 3LWMA 2ZUAA 3M8QA 1JLQB 3KMQA 1URRA 4N76A 5GVQA 1WC0A 4PXCA 4PPZA 3E3XA 2RU3A 3K8WA 3WIUA 3CULA 3SFUA 2HWHA 3TP2A 2DGVA 3OHBA 2GVDB 3FGVA 2LEBA 4PYDA 4Z7YA 2V69A 2R7TA 3I6PA 5F9NA 5KFCA 4USTA 3ILJA 4RBVA 1SBRA 3A3PB 3W9HA 1AZSB 3IGVA 4CO1A 3PW4A 2P5VA 1MNEA 3RAXA 2C2DA 1BQNA 3CD6S 4USWA 1AUDA 4LSLB 4DOZA 4Z2XA 4LRDA 3QLHA 5EN1A 1X0FA 2BE2B 1RAAB 2BJ3A 3MECB 2NQPA 3I4HX 3UR0A 4QYZJ 5CH7B 3FUYA 2N3OA 1PAEX 4ZJQA 1JNRB 3W61A 2OD6A 4PYAA 1MU2B 3UN5A 4HVZA 3W2WB 3N6NA 3UVJA 4NI2B 2V94A 3NWRA 4OI4A 4DL4A 4JI2F 1ROFA 3JYTB 5HBMA 2R7UA 1SCJB 2M4MA 4AQYJ 4Y2IA 5B0DA 1VHIA 4QOTA 4YHHJ 2U2FA 2MKIA 1V3ZA 4ZLPA 4DR4F 1F9EB 2HQFA 3UD5A 1C2PA 3IM9A 1VS3A 1S1TB 1WWHA 3T19A 2B5JA 2WBRA 3P96A 4OJHA 3OR2A 2HS0A 2KT5A 2D3OR 1CQMA 1FJEB 2YPYA 1ZOTA 3N5FA 5FJ4A 1NO8A 4DZDA 1XNRF 1RHJB 1BC6A 4ZDNA 1H38A 1S6PB 2NLWA 3SCKE 1LNQA 5DG9A 4X64F 2CPIA 2W2QP 1Q5VA 3UCUP 2Z2MA 1JNZB 1DURA 2OTLS 4UF4A 4DL7A 2W9AA 3MCSA 5HVHA 3FC9A 1SI9A 2Z4PA 4NYZA 3K58A 1IM6A 3BBCA 3EZ5A 2DHSA 2E29A 3R1LA 1HBOA 2A2DA 1R8HA 3R5BA 2Q79A 5DZ6A 1OJ4A 5AJ3J 5I3UA 4QYZK 4CLWA 4JI8F 2CJQA 3HFVA 1UJ5A 3HSGA 2J6UA 1QVGR 1CLFA 2CYYA 3MMJA 1C1CA 4C3KA 3KG0A 5IFMA 1S6UA 3TQ1A 4UY85 1UWBB 3S01A 3HSDA 3C6TA 2OPPA 1RCXB 1FKOA 1R0AB 2FJXA 4F8RA 4OIXA 2HW3A 3D1OA 1DJ0A 2HNDB 2Y3YA 2V2ZA 2BQRA 2G4BA 2IM0A 3T1HJ 3CCWA 2G0JA 4LFBJ 3MAHA 4B08A 4XO0A 4Z37A 2A10A 1Q5YA 2AMCB 1RK8A 3OFGA 3FSYA 2WVDA 3HT0A 1TELA 2WK4A 2KFYA 1HHTP 3M8ZA 2BJ9A 3QLHB 1CJVA 4NOHA 1RHRB 5F0WA 3F73A 1CVJA 3OV7A 4QIEA 2UU9F 4RNFA 2KVQE 2BZ2A 2RAQA 5JVGQ 4ZPBA 3RW6A 4RKUC 1IBKF 1SJ1A 3IAM9 1X31C 4Y0FA 2C3UA 4KHPJ 1XJWB 4KBIA 2N7YA 5AE2A 1DTQB 3DRRB 4RUHA 3M1VA 4ZVSB 4A8KA 2GO9A 4I2QA 1KQKA 5ETTA 2LMIA 1F0XA 4B3MJ 1KBRA 3AOAA 5BJRA 1Y00A 3QWPA 2CQGA 3JSMA 4YDDB 5ETNA 3TQEA 1ZAWA 1NKEA 1U8WA 2B5JB 3NGSA 1NU4A 2F4FA 1V3SA 2DNKA 2WVCA 4UOFA 2CPHA 2GAGC 1UFKA 1T11A 2Q6CA 5BYRA 3CMAS 3VALA 5B0AA 1NZ8A 5LL6d 4J7CA 2MEWA 1BGXT 4C48A 3L3CA 1F1BB 4O3OA 3PYDA 1IR1A 2LP4A 4LF9J 2HGMA 2PA3A 4IG3A 5E2QA 2YTCA 3PKYA 2AYMA 3G87A 1TL1A 4G3IA 2ABYA 4NRTA 2AJ2A 4CNZA 1D09B 3HFKA 5D3GB 2BDPA 3I5CA 1PGZA 4J9KA 2KRBA 2EG2A 3UWTA 3MAAA 3G86A 2R9LA 5DGBA 2BW7A 1BUXA 3SCJE 2HBZB 3PIOQ 4JI7J 2WVFA 3ILOA 2DXDA 4OYBA 3DOKA 2HFNA 3KK3A 1Q1KA 2YNFA 4FS2A 4K4UA 1PYTA 3GZ7A 5E3AA 3QZ8A 4ECRA 1S4EA 1O0PA 2G2ZA 3BSCA 1QSSA 1C1CB 2QLXA 4QPTA 4M5GA 3C6TB 1HI1A 2OPPB 3M8WA 1H2TZ 2AJFE 3TOQA 2MQQA 3PV8A 3BO2A 1IBCB 1RWOB 2E5JA 2LXUA 3IFEA 2R7SA 2VICA 2RHSB 4XDDA 4K4TA 2X1FA 3PVXA 1X4GA 5CYMA 1LK5A 1U47A 1FRLA 2H51B 4M8LA 4G1PA 1LEOA 3ILIA 1PSDA 1CJVB 4QQBA 1VLYA 1HI0P 4P75A 3C8YA 3R2CJ 5LMUF 1MWQA 5HMYA 4ATNA 3KK1A 5F8GA 1GAOA 4F4WA 3BZQA 4ZHRB 4PG6A 3FZBA 2DGTA 2V6AA 4F67A 2LXFA 1N34F 2H5EA 3HDSA 2DNLA 1FHTA 2BMBA 1DTTB 2PGCA 4WE1B 4EYIB 2ROPA 3M1VB 3US5A 5ETMA 4IFVA 2CADA 1UJ6A 1L5UA 2AEMA 2C3PA 3TX8A 1UVKA 4OZ0A 3B82A 3IC1A 1CC8A 1X4HA 2RDIA 3CD5A 2LKZA 4DUYJ 3CTRA 3LWLA 3PW7A 3ENWA 2IBKA 3SQGB 3U1NA 1EQ0A 3D1HA 2FB0A 4WK1A 2F1FA 3H98A 1RAHB 1XK8A 2BW2A 2KJVA 1YG0A 4U8YA 5KG2A 3JAMY 4OX8A 1YK9A 3M30A 4JBCA 1SQEA 6AT1B 4IR1A 5LSRA 2DITA 1RA6A 5K8MA 3R5GA 2XMTA 1BE4A 3RR8A 3F41A 3V4MA 1S12A 3W8PA 2VPZB 4CCHA 1TFYA 4A8QA 4UQGA 1HWIA 5F0UA 4ER8A 1YJTA 3ZZPA 5HI7A 1GFWB 3MR2A 2MDAA 1LOUA 4R5PB 2O67A 3TA1A 5KFFA 5IM0B 2HKEA 3BPDA 1HR0J 1JLFA 2O66A 3GCWP 3DOKB 1Y7PA 5K14B 4KH1B 1N5QA 1HWKA 2O3DA 1S0NA 2E7XA 1QAYA 4ZIVA 4CYUA 1PJ6A 1RT5A 1HQUA 2ZZMA 1HNVB 3TNVA 2XM3A 1VQOS 2HHTA 1WDTA 2HNZB 3LANA 3S6EA 5C42B 3ONQA 1YZ7A 2JC1A 4RNMA 2DTJA 4P9SA 2WOMB 1AT1B 2V4QA 3BPSP 4A8OA 1Q8KA 2KI2A 2PD1A 2HHWA 2G2YA 2RHQB 1FDBA 2LEPA 2OO4A 1PJ5A 5CYMB 3FBFA 4ECZA 1OQ6A 4ED1A 3A8EA 3BGUA 4OMFG 4LF6J 2MLYA 3W60A 3N9UC 2HPUA 4MKAA 2UUAF 1S7HA 2FUG9 1S4FA 2J76E 2BX6A 3X1LB 4DV4F 3Q8RB 3KK1B 1HNXJ 3DLKA 1ZH5A 1WG5A 4L3KA 1VFJA 1U1QA 1VGYA 5CCLA 5HMXA 3CJKA 5HATA 3QFWA 1K1QA 5CZCA 1RWMB 3PFEA 1RT6B 4PUOA 1S48A 3G4SS 2IM2A 3EGZA 4WFBQ 5KFWA 3HD1A 2DPIA 2D9PA 4KQZA 2OMOA 3NNAA 2XYGB 4CLPA 2QG9B 5GAHU 3AD8C 3KLFB 1TAQA 5A6WA 2EW9A 2M5YA 1QDUB 3TVYA 2DNOA 3MMBB 3I5AA 2B4UA 3ETOA 3H2LA 5KFHA 3T1YF 2YNGB 2ZC3A 2B6AA 2DVIA 3GILA 2F8HA 3BQ1A 3W3SA 2BE7D 4ZPAA 2KRRA 1YQHA 5DDOC 2Z8QA 1FK9A 1N52B 1YRTA 3FQLA 4Y2KA 3FFIA 3UNGC 2PT0A 4BCAA 4O4RA 3GG0A 1B70B 4OZJA 2LQ5A 4FNHA 3UO0A 4CLKA 3MTKA 4DV6J 3LF0A 2H5IB 4ZLLA 3KYLA 2MJNA 3GFYA 4DL3A 2E5HA 1KQGB 3FSIA 2DNGA 4C8OA 1WC4A 2A0FB 4KJIA 2FYXA 4PZVA 2YNHA 2G1DA 3Q89A 4X4PA 1IR2A 4N41A 1OMSA 3E51A 4J90A 3W5YA 2RH3A 4KYZA 1LWXA 4J9VA 2GMHA 3K7RA 2ZH5A 3D4JA 1GT8A 2Y0BB 1RT5B 1HQUB 3KK2A 1FE4A 1RWUA 5KTQA 1NKBA 4OHWA 3EJMA 5A8RA 4LMZA 3ZZRA 4P74A 4Q5VA 3F0NA 3TUIC 5KFDA 4UOCA 2J0XA 1RHMB 4AQYF 3TI0A 4TLQA 4CM0A 2XTJP 2XWXA 1S1UA 1X4DA 3H4BA 2CG8A 4NYOA 3MD3A 2CUYA 4X65J 1VHFA 4I7FA 4QU7A 4PWDA 3LGNA 5KFKA 2V8PA 2H4WB 4OZ2A 4NLYA 2F7VA 3CCUS 3DRYA 2DGSA 3PRBA 4X66J 4QCLA 3L7OA 2GAHC 2AJQA 1NM2A 1QVFR 3GWCA 3O2IA 3AY0A 5D4PA 1DRZA 1CJTA 3R5DA 4U7CA 5DDPC 4P71A 4ZCKA 2KU7A 5KFMA 4ZS6A 1VQ9S 4PUOB 4AMMA 5L38A 3IWLA 4EEYA 1I3OB 5FDLB 4DL6A 3G82B 3PCOB 5AJ3F 2XQCA 3R5CA 4O3SA 1JLCA 2WW8A 1M90T 4EUVA 4HL9A 2NREA 4EU0A 4DR5J 3SFGA 1HHQA 2BKOA 5JXSA 2VPWB 1JX4A 5GMDA 1Z1ZA 2B6AB 3JTOA 3CGIA 2MKYA 4J9SA 2V9WA 1REGX 3OTEA 4C8LA 5KFVA 1KFSA 4DLGA 4DMZA 4KPCA 1FI4A 3UD4P 2BKNA 2WONB 1IR0A 2HK3A 4LFBF 4ED0A 3FFIB 2RILA 3H40A 4G65A 2FZKB 2ZOFA 3VWSA 1S1WB 2VZ8A 3C6UB 1HD0A 4DR1J 4DFKA 3RB6A 5LMNF 4WXWA 4WK3A 1BD6A 5D0GA 3W65A 3B78A 2YNHB 1FT8A 2C2KB 3I5BA 3QNWB 1WKJA 1WC1A 1KS2A 1ZETA 2HHQA 2FHOB 2KZMA 1X5OA 1GXTA 1NK9A 1N56A 3UW1A 4M5DA 3MEEB 5BR8J 3QIPB 2NCKL 2APOA 1NJYA 3IM8A 5A8RB 4YR2A 1K0VA 4NWBA 3ILLA 2I8EA 3JSRA 2VBWA 2HRUA 1L3SA 2YQ3A 1VQ5S 4B3MF 1B0VA 4TY8B 3CCJS 4PQAA 3M8PB 4FBTA 4B9SA 1K44A 2C2RA 1T9YA 4URSA 4I7FB 3GPAA 1C0UA 1RAOA 3V4IB 3H7HB 2JFKA 2DK2A 1KHWA 1FFWB 2CJXB 4PWDB 3W5ZA 4IUFA 1GMVA 3L7PA 1X0PA 5D4OA 4LBPA 3M6VA 1BWVA 2FIUA 3SZ2A 2YWFA 4LF9F 5FLXU 1RWXB 2FGOA 3P45B 4KKOB 4DPWA 5EWGA 3VAIA 1A7GE 1RWVB 4FPRA 4DR6J 2JEFA 2XG8A 4NMLA 1CJTB 4NLUA 2YH1A 2YPZA 1YJ7A 1KLMB 3KUEA 3I31A 4I6WA 2GCFA 2ZWOA 2D3ZA 3G6ES 3ISND 3K89A 4ZP7A 1U2CA 4X4RA 3BYRA 4EWTA 2DD8S 4F2RA 1XMQF 2PMHA 1JLCB 1OS5A 4IOBA 1EJ7L 3CWJA 2JEJA 4ECXA 3OTBA 1NRKA 2XC9A 2KVIA 4R25A 4MK8A 2I5JB 2OLWA 4P10A 5H9FJ 4EBDA 3CCLS 3TA2A 2QL5B 1OPIA 4OZ5A 3N6LA 2CJAA 2MQNA 1T05A 2JDJA 5AXLA 4M94A 5DG8A 2JLGA 3NXZA 2FLPA 5KFLA 2W7AA 3CJQA 5H1SV 4IQXA 2GQCA 4DV7J 3T9NA 2GHWA 4WKYA 5DQIA 3RRHA 4AXJA 2V2VA 3EVWA 1RP5A 4OI2A 4KGZB 3MMCA 2J5AA 4GKJJ 4J9UE 2L3MA 3RRKA 4FF4A 1T3OA 2NXJA 3P5BP 2XZDB 3D1QA 5C2GA 2Y1IA 1U2FA 4PEOA 2CWKA 2HS3A 4MT1A 4F4KA 4J9MA 3HD2A 3MM6A 4M5DB 2HHVA 2RF2A 4IDKA 2FJWA 3UN3A 3MOJB 2WHOA 5HROB 1U09A 1S0MA 1J5EJ 3AA9A 2XMUA 2HGLA 3A4TA 5DQGA 2VODA 3M6UA 4DUYF 4F2SA 2CNKB 3CJ0A 4FPIA 3HFZB 4X4VA 4DL5A 1W26A 1P1LA 1Q7LB 3PG9A 3QPIA 4F7VA 3ET6A 3VAGA 3A8KA 5GMKa 5H9FK 1FTRA 1C0UB 5GAEU 3OTOJ 5DJBA 2QV6A 3HSZA 5KFOA 2LQ8A 2RQMA 5IV3A 2RS8A 2CWXA 4U96A 2FDNA 2FHJA 1HWJA 1T3NA 2VBZA 4ZCIA 2OFHX 1RKIA 3IBFB 1AW0A 4KGVB 2VFVA 1TUGB 4MYUA 3NY0A 3KG4A 4NZ0A 4FVMA 2HQ3A 3WX4A 2ALYB 2GMJA 1JLEB 2ZNZA 3U02A 2I1RA 3VAHA 1TKTB 2CPFA 2VG6A 1S72S 2GQ2A 3ZZ0A 1RKJA 4OYOA 3HZEA 1DQ9A 1N0VC 2MB0B 3W5XA 1LW0B 1P8GA 5E7OB 1M5HA 4OYAA 3PTWA 2ZITA 4CO5A 4I69A 2AYGA 3R7SB 3I0RB 3NOCA 4ZPTR 4YMEA 1HNWJ 1CJUA 4I6YA 3NS7B 2IVFB 3K0JA 2V9KA 3HI9A 3OL6A 2Z58B 3M2RA 5LXYA 4DX8H 3SXLA 5KAKA 1HPZB 1SH0A 3MM9A 4DV5F 4L76A 1U6ZA 4LF6F 3TVZA 4IG0B 1UP1A 1TL5A 2HVEA 2CJKA 4ERDA 3MMCB 4ANCA 3JQJA 2E5LJ 1S79A 4LSZB 4Y28C 4ED8A 4A8WA 1KQFB 3TEHB 4Q0BA 4DBQA 1IKWA 1U1NA 6FDRA 3CCMS 1MW7A 1PYOB 4NA1A 4FDFA 1FRXA 1OY8A 1NH7A 4LF4J 3KHLA 4P7VA 2P6SA 3CCZA 1RWPB 3MM6B 1YGYA 1H0HB 2OSRA 3CJRA 5J2PB 2JHEA 1FRHA 2QFIA 3ZO7A 4PWWA 2F5GA 4DQPA 3W64A 1RTJA 4Y6IA 4USHA 4X4SA 1Q78A 4ID5B 1IXKA 5HP1A 4ICLA 4WTOB 2IVYA 1UEVA 5M2PA 2EC2A 4KFBA 3RYLA 2XCPA 1NJXA 4DJBA 2SXLA 1ZM9A 1H3DA 3K8VA 1V3RA 3W63A 5A8WB 1NH8A 4CI0B 1Y10A 2DHHA 1NJZA 1ZS6A 2AGPA 2XGQA 3I0SA 3QO9A 1VR6A 1SV5A 3DHWC 2IRUA 4OYPA 3GU0A 3G2XA 3OL7A 3LO3A 3S1TA 3MWBA 1SH3A 4DV6F 5KG4A 4DV2J 5HSPA 1TKZB 1M1HA 4DSLA 4JV5J 3MM8A 3CJTA 1RWNB 1IJEB 1CJKA 2RT3A 2GS8A 1OIAA 2YQ0A 1QE1B 2IY5B 1KVJA 3L7UA 1CULA 4HDGA 1F6TA 3CCTA 4CZCA 1UL3A 2CAJA 4RW6A 1ZA1B 1Q16B 4K2XA 2MHNA 2HNYB 4DR3J 1F2HA 5L9NA 4RNHA 4CLFA 1AXQA 3MR7A 1AB8A 3T5JA 3SDEB 2HURA 5E0OA 2J9CA 1VIOA 4MFBA 1Y0HA 6FD1A 4M5JA 5B09A 3AFGA 2Q1LA 3M2RB 1JJHA 4X65F 1FD8A 5A0YA 2CPYA 3MM9B 5CYQA 2FJEB 4UUXA 2B3TB 3MZIA 1AFJA 2H9ZA 3H2UB 3OVSA 1H6KX 1T03B 3DMJA 4X66F 2D74B 3J7AN 4LSNA 3DN9A 2VG7A 3NGDA 4FNIA 3PY8A 4D3HA 2BJ1A 2LDIA 3PZPA 1CPZA 2B9YA 4PPDA 1RTZA 1NKCA 2DXFA 4YFUA 1FRKA 2DEIA 4QYRA 1XNQJ 4ENOA 1RTJB 2XLIA 4OZLA 2DNZA 4FVCA 3HZGA 3N28A 3TJAA 3J7ZT 2KH9A 2J8SA 4DR5F 3ZTPA 2O1PA 3HX9A 4DFMA 1FEHA 2EKNA 3BKFA 3MUTP 4YUDA 3J80U 3DOMB 3CJ2A 1BHNA 1T9UA 2W8KA 5KFAA 4KFBB 1P9YA 1GMWA 3D9BA 1A9NB 4LRFA 3EX7B 3H5SA 4ZVOB 3BR8A 2IJNA 2AEFA 5KFEA 3NCRA 5CQGA 3Q23A 4H4KC 3PW0A 3QJLA 2HHHJ 4X2BA 3KTQA 3GQCA 4MMOA 2VA2A 3QO9B 2LVWA 1X5SA 4UT4A 1RADB 2CPEA 2V50A 5A2QY 1I94F 2DKOB 4DR1F 4N77A 2V5HG 2R7QA 1IVZA 4JV2A 2EFNA 5KOXA 3MM8B 4C6AA 1JB0C 2L41A 2L9DA 3KJQB 3GIRA 1D9FA 5DLGA 2ASYA 1ZTWA 1CULB 4C11B 2D3O1 2V4RA 2MKHA 4CQ1A 4P72A 3GYXB 2HWIA 2VFTA 3ZZOA 1K8AT 1EHWA 3W9IA 3GONA 2POKA 1CS4B 2ZVSA 1EIYB 2FGCA 4NX9A 1FEEA 2CPXA 1RT7A 2WSEC 1WJ9A 3BKUA 3PJWA 2YKQA 4ZP8A 4C8ZA 1CEZA 3THTA 3ULHA 2D7SA 3LTOA 2XHWA 1F2GA 4M5HA 1FVQA 2HLUA 1MWZA 4MFBB 3CE8A 2R8KA 4J91A 3KDNA 4AL6A 2VV5A 1RAEB 2FVCA 2PDAA 3QT7A 3N4WA 4JI2J 1EP4A 3ZZZA 4ZN1A 2CG4A 3R7NB 3RGIA 1NDKA 3O6QA 3M6XA 5GAHI 4B17A 3R6GB 3DI6A 4USUA 3NL0A 2BACA 4KGXB 3KUGA 3AXMA 1HI8A 2FLNA 4PXEA 1KR4A 3OVAA 3DMJB 2J7WA 1Q7YT 3U1LA 4N7TA 3LUYA 1KWMA 2VG7B 2DXEA 2XLKA 4LF7F 1VQMS 1R8CA 1ELOA 4W90B 1W7WA 2KO1A 1U02A 4CH0S 3OXFA 1RDRA 3C14A 2F40A 1JLBA 2FLLA 1RT3A 1RSCA 3QRQA 4IH5A 2D3UA 3H4DA 5J1EB 2W2PP 2A3JA 4WPAA 2FTRA 2FPHX 4JUZA 3TR5A 3GLJA 2MGZA 4XK8C 4YQWA 2KB2A 4JI8J 4WCEQ 1D9DA 3Q24A 2R2SA 3KMSA 4B3TF 5C24A 3CJ8A 1NDPA 1Y4ZB 2VQEJ 2I6WA 2C42A 1SJQA 3TEGA 3QT6A 4LRCA 3EUNA 1S1VB 4RJVA 2E44A 5FLXY 3AQPA 2AJ1A 5L39A 3CD0A 3BEGB 3DLJA 3DYAA 3LOUA 4GKJF 1FX2A 3M8YA 3WIVA 2R7OA 3Q8VA 2VOPA 4F4AA 1LK7A 3UCZP 1N48A 4YP3A 4KE5A 3RBDA 5F8JA 5BYQA 2RUSA 3SV4A 2UU9J 1KONA 1HNZF 5A8KA 3D0GE 2Y8YA 1Y9OA 5F8NA 1NSPA 1H73A 5T41A 1J5EF 1VRTB 1RT7B 1V9OA 2NUHA 2BA9A 4WP8A 1SIWB 2MSSA 1UETA 1IBKJ 4CLUA 2K2PA 1QSYA 1RYRA 5EGYA 1NDCA 4HH1A 2VH7A 4QZVB 4FYXB 2OSQA 2RIJA 2DB1A 4K4YA 3EICA 2DGUA 4RW9A 2RQ4A 2YNIB 3RG6A 3A8IA 1EP4B 2M8DB 2HMIA 3D68A 3EZUA 1P6TA 3FVYA 3OTOF 2R8HA 3JXOA 2MY8A 1C4CA 3BGRA 3MMAA 1FF2A 1PCAA 5D0RA 1N54B 1IKVA 2DY1A 4DG1B 5B0GA 1SIZA 1NEEA 3W2VA 5IWAJ 3BDPA 4AMNA 2FVSA 1JXEA 4V19J 4OYIA 3ISZA 4ZN3A 5LOQA 3K5NA 2MZSA 5KFBA 3G9CA 1JLBB 2ZH8A 2CNOB 1RT3B 1BY9A 1UW9A 3GFXA 3W66A 1E6VA 1REVA 4CLTA 2DNRA 4F0MA 2CQDA 3R2DJ 4WIQA 2IDLA 3KUHA 3UQSA 4U7UD 3MHYA 1JJCB 2RKIA 4ILRA 3SV3A 3G8SA 4EZ6A 3W1YC 2BANA 4R8UA 2GMLA 3KXDA 1YITS 1SH2A 4DUTA 3ZXWA 2JLFA 3OHAA 2HBQB 1AA1B 1HNWF 2YQ1A 2R2RA 1VK8A 1U25A 2PA8D 1NHKL 5C24B 4ZPVR 4CDIA 1E6YA 3AOCA 3PR4A 3CDAA 1QY7A 4USJC 9ATCB 2JVOA 3PJ9A 3ZNJ1 1HA1A 4RL1A 4AL7A 4K59A 5KFQA 5DG7A 3TUJC 2UXBJ 3TJ9A 3ENQA 2FD2A 4PCQA 3T5HA 2JJ4D 4DPUA 1R8BA 3NCPA 1DY3A 4HT5A 2G0IA 5KFNA 1WI6A 2OFGX 4PQUB 4FKYA 4C4WA 1S9EA 4U8VA 1MMNA 1OSDA 1UKUA 3VHQA 4BLGA 3GIJA 2CIMA 4H4OB 1P27B 4QWEA 1FXDA 1LXNA 2Y1JA 4DLEA 3RUBL 4ECQA 3OFHA 5D0EA 3BB5A 2B7CB 2QTWA 3A3OB 1LXJA 1UWAA 2N82B 4FF1A 4CWBA 3HVAA 2AKWB 3ZZTA 4OYZA 1FTCA 5T14A 3VAMA 5HJXA 1N34J 5KFPA 1WKKA 4ETZA 4B9LA 2EKYA 4DV3J 3LPYA 3SQOP 2K3KA 1VQPS 3DDNA 3FEYB 2ZDOA 1OYEA 2QC3A 1JJ4A 2QSFA 4PG8A 4J9RA 3MM5B 3KG1A 4KV8A 2OPSB 1VBZA 3EDRB 1KN6A 3BGRB 1U26A 5I42B 2J8AA 5IC6B 3THPA 1PBUA 1NB7A 3PJXA 1C0TB 3RU0A 1Y5LB 5J1NA 1Y5NB 1IQZA 3MEDB 3GB0A 4FN5A 1D8ZA 5CXTA 4OL8A 3W2VB 2BE9B 1SC4B 2GVDA 3MEKA 3IBWA 2DNNA 5KFSA 3W7BA 1NK5A 2RDDA 4DV2F 3AH6A 4P2FA 2C2NA 4TKTA 2XO6A 1S5ZA 4JI0F 2NXUA 1TTHB 4PR6A 2JEGA 5HLFA 2MYFA 2OPRA 2ZKTA 3TANA 1REVB 2XBPA 3A12A 4C0OC 2XNQA 2M88A 4QPXA 1WEZA 1ICEB 3PHEA 2DYAA 3NGRA 1X5PA 2Z2ZA 4PG4A 3UPFA 2FVPA 3IS9B 1SJ3P 3MECA 2OI2A 2F9JA 2E1PA 3P8BB 2BANB 2RE1A 2XY5A 3OD2A 4MKBA 2LQJA 3IWXA 3T5LA 1WHVA 3P6YC 4P52A 4WF9Q 4RNNA 1D9AA 3CJ4A 1Q81T 5IT9U 3W2WA 2VOOA 4FYDA 2UUTA 3H42A 3R9LA 4QBUA 3FNNA 3GCXP 3CMES 2WSCC 3JYTA 2KZZA 4DL0C 2MLXA 3D0IE 3PW2A 2FHJD 3DHXA 1MMLA 3L95X 1ITPA 4IO1A 1R8AA 2M0GB 4MIWA 3C66A 4F25A 3V6HA 4MTPA 8AT1B 2PC6A 1TKDA 4TXSA 2XCAA 3PYFA 3J81j 2HFVA 3NEKA 1I1GA 2X7IA 5GAEI 3PNIA 1VK3A 2E5IA 2W2MP 2A18A 4ECYA 4RU2A 4NLDA 5THWA 3NLCA 3M9MB 1XC9A 1GXUA 3WDOA 1VLOA 4DFJA 3CUNA 1S6PA 1VC6A 4TLRA 2QMUB 1IKXB 4YEAA 1XNQF 2Q3PA 4K4XA 3JSBA 3GJTB 2QE5A 1YBTA 4ZMMA 5T7LB 3QGGA 1TMMA 2IAJA 3JQKA 3AD9C 5KG6A 2UV8G 3GV7B 2DBBA 4KV8B 1V6HA 1GEHA 1NBEB 4USKA 5F8LA 2DH7A 4N5SA 4FZVA 4KY3A 2EFVA 4M95A 3K5LA 3AD7C 3DU5A 2YXLA 1UWBA 3T1YJ 2HHHF 4CT8A 2HWTA 4IQMA 4GO5X 3MGJA 1R0AA 2R7XA 1ULRA 1VRQC 2BYCA 2BBEA 2Y9HA 2HNDA 2HVIA 3I55S 1CQNA 2MY7A 3U1MA 3MOZA 1H7WA 5IOLA 4M1KA 2V4JB 4OX6A 5HLFB 5KFUA 3LP1A 3I96A 4CLLA 1TK0A 3D6FB 3VZHA 1KVKA 4PG5A 4Y2CA 4GKKF 2OPRB 3MPYA 1RJJA 5KOWA 4TU8A 1HHSA 1S1XB 2FY8A 4BS2A 2OEMA 1RWWB 4FKXA 2P9EA 2UZAA 1HKAA 4O0NA 4ZP9A 3DGVA 3J80Y 1W25A 2Z30B 1MN9A 2W2NP 1DTQA 3QT8A 3DRRA 1T94A 3JS9A 2EFOA 3BJYA 3NCQA 3NNCA 1WG4A 1I5OB 2AJ4A 5ETPA 5HQMA 1T9TA 2J9EA 2FJDB 2YY3A 3FCWA 4CLSA 3AODA 4M5IA 1KRPA 1H98A 3IAS9 2X1GA 4ZPWR 2PN6A 5H9EJ 3J7Z5 1X9SA 4LF2A 3MPWA 3PFOA 1RQ0A 2H54B 5HAOA 4H4KA 2EWHA 1S9FA 2NUUG 2ZJRQ 3VGVA 2NYHA 3QIDA 2J7UA 3B4MA 3PO5A 2FVQA 4H4MB 3H90A 2V34A 2YWWA 4BWJA 1PYSB 2B9WA 2GFFA 1LWFA 5F8MA 1RTDA 3HJVA 2MSTA 1S76D 2QL9B 4DCOB 3DFEA 2ZOMA 4L6V3 1SVDA 2K3IA 1AFIA 1LQ9A 1WF1A 2CXEA 1IM4A 2A2CA 4YR3A 5D3GA 3HPOA 2ZH3A 4C7QA 5BYSA 4EBCA 2G13A 1HYSA 3NS6A 2CPJA 3CXCR 2HIQA 5KFYA 3A3NB 2IAJB 4Q44A 2W7OA 2IIHA 2M8HA 4I56A 3L09A 2ZH4A 5JJBA 4OQJA 1SJFA 4KH0B 4DR7J 2YKMB 2CQHA 4LF5J 2VQFJ 4O3NA 1VQKS 2VQEF 4WU2A 5J2NA 4KHMA 2ILZA 4FBUA 3FSXA 5C5JA 3G6YA 2DRAA 2V63A 5KT2A 1W2IA 3WBZA 5ADZA 3RBZA 4BC7A 2QZ8A 1VISA 4C8YA 3O8WA 3WX8A 1CSJA 5H9EK 4C98A 1G2EA 2ASDA 3LP1B 4ANDA 3BYPA 1TP7A 2KM8B 1ZM3A 3TAQA 1XTZA 1EZZB 3DGPB 3WQPA 4QR2A 5ETOA 2RQCA 4J9PA 5LMNJ 2ZHOA 1KHVA 2RUGA 4CIOA 1T9XA 1PILA 4FS1A 1I51B 1WEYA 2WTFA 1YBUA 1OY6A 2F4VJ 2G2OA 2YH0A 3H5XA 1TZ0A 4ZHRA 2L48A 2ZC4A 3IR6B 3TW0A 1JLGB 3UI3A 1RT2A 1M1GA 1GMWD 1JMTA 2GJIA 3C19A 2CQ4A 1S0OA 5D77A 1DTTA 2QLFB 4WE1A 3LP0B 2NS1B 3OUYA 1QUPA 4HEA9 2GW8A 2K7JA 1KOHA 4EK2A 1U1OA 3VAKA 4KT0C 4NMXA 2C3MA 1WC3A 2A6MA 3OR1B 3KLHB 2DGWA 3LALA 1JKHB 4F02A 1SQGA 5ETRA 2UVVA 4ZIWA 3SQGA 3V6DA 3KFWX 4NEZA 3GIMA 3C3LA 2H48B 2ASJA 1RBOB 3IRWP 2UUBF 5IWAF 1Y3KA 2DGXA 1R43A 1XR5A 1HARA 4O4GB 3OFFA 4ZA1A 1ZPWX 4TQRA 1F3FA 2ZEJA 2IA6A 2IMWP 1LWFB 3PHTA 1RTDB 2JOQA 3GR0A 3BSOA 2KYZA 3PO4A 1QD1A 2RMLA 5CZVA 3Q8YA 3QGPA 2VFRA 2ADCA 4JI3J 3AJ2A 3EZOA 4J9OA 2JFDA 4B9MA 1Z4UA 5ETKA 4R5PA 4F3OA 1HYSB 3DOLB 5IM0A 2MXYA 4NZ6A 1L3KA 2FY1A 1Y3JA 4UZBA 3CIMA 2EG1A 1XMBA 1RHKB 2UVRA 2WSFC 3M7VA 1VOMA 4I1TA 1XMQJ 5K14A 2H1YA 5IV4A 2DNYA 2ZD1A 5ETSA 2UP1A 2EPIA 1TAUA 1WACA 4LR7A 1FXLA 4DXLA 4NL5A 2FZGB 3ELHA 3KDOA 2GJ2A 1HNVA 3D28A 5HANA 2HBRB 5D0HA 3PDNA 4LIWA 5J2NB 4DL2A 2HNZA 4ZP6A 1XERA 5C42A 5HMWA 4K4ZA 3J7YI 2WOMA 2MMYA 2VZ9A 2UXBF 1FJCA 3AA8A 2LECA 4PRFA 2M70A 1MG7A 1XEZA 2K1RB 4JI4J 3VZIA 2AQ4A 1D1UA 3W9JA 2AV5A 3CO9A 4OYXA 3IG1A 4PWUA 2CPZA 2CNLB 1H2VZ 1U2RA 4ZCMA 2ALZA 2ZE2A 1DQAA 5B0EA 3CC7S 4DQQA 2PI4A 2KKHA 3C15B 4RW8B 2LXIA 2HVZA 3PX0A 4RWXA 1GX6A 3I87A 3VVUA 4ECWA 4DQRA 3FMWA 3AB2B 1RT2B 1WHYA 3EM1A 3HLUA 4GC7A 4DV3F 3CDUA 3SSQA 2LLZA 3OUYB 1FFSB 4LFCF 1RT6A 3PYGA 1RAGB 1OQ3A 5L9XA 3KHGA 5C25A 4ALZA 1FWKA 3ZNUA 5CCMA 2DIUA 4QWBA 1UEUA 1UZDA 3KLFA 5IT0A 3HVWA 3LA0A 4DN9A 3MMBA 3V6DB 4Q2MA 2NSBA 2XS5A 2R8JA 2YNGA 1X60A 3RR7A 1DBDA 3EXYA 1XBWA 1X5TA 2AGOA 2ZH9A 3G8TA 1HIYA 3HULA 1OSCA 4IRDA 1F60B 1R8PA 3LP2B 3KHRA 1UA1A 3OL9A 3HHNB 3NNHA 1S10A 2B9EA 4ES3A 3ZFVA 3HT3A 2VJUA 2EXUA 1EKSA 3TYTA 4J9LA 2B0GA 1SL1A 2J9DE 4N56A 5RUBA 1TL7A 1KP6A 5J2QB 3Q8PB 2KHCA 4IKAA 2P8IA 1SC6A 4EO6A 4EI2A 2DPJA 3NBPB 5K5MA 1X4FA 1C1BB 4NLWA 2BOAA 1SKUB 2O5DA 4ELVA 2DHAA 2ZD1B 2MKKA 3FDSA 4IFYA 1ZZNA 2FJBB 2UXDF 3QFHA 1WKLA 2GV1A 5FIIA 1PKUA 2ZH7A 3KNAA 3PRDA 2DISA 3MI7X 4ID8A 1VC0A 1QTMA 3VV2B 1IN0A 2M3DA 5CYJA 4C3MA 2XSJA 5AE1A 2YWHA 4ZITA 5AXNA 2OEKA 4WKRA 3DM2B 4C8NA 4AXIA 3PEHA 3DNCA 2XMWA 5AT1B 3NAIA 1RAFB 3P3DA 2QN6B 2PFDA 5IXUA 3ZZYA 2PO4A 3HP6A 4NLPA 3KKFA 1QTNB 2CQ0A 4O0IA 4HI1A 1OPZA 3IG1B 2COLA 4DV5J 4A4JA 4KGKA 2LQBA 3CEDA 3IWNC 3JAMU 2ZE2B 2EBGA 4KO0B 3P49B 3JSYA 1RCOB 5DM6Q 3HF5A 3PYEA 5KFRA 1FFGB 1T8EA 5J1PA 3QSIA 3KLGB 1YRXA 2AZ1A 4O3QA 2NPFA 4NRUA 4A48A 4YR0A 1QAXA 3DRPB 4KIAA 3UNYA 2HZVA 4WIIA 5E33A 3TJ8A 3PACA 1R89A 5DDQC 3BREA 3Q8QB 2ZHBA 3R7BB 4BHQA 5DLFA 3NGKA 1SC1B 4WZQA 2C28A 4JB8B 2FC9A 5I4MA 1UFLA 5E3CA 5FDLA 5IT9Y 5C25B 3G82A 3CNQP 4DV0F 1FDDA 4HH0A 3DRSA 3ZTOA 4CO0A 2BKPA 1FWLA 3QZ7A 2B4OA 3T6JA 2BM0A 1TMJA 1U0HA 2OH2A 3IXQA 4K5RA 2VFUA 4JOUA 1PAUB 5CZXA 1WELA 3EGNA 2JNJA 1T02A 2WVBA 4L75A 3BSNA 1KEKA 4RUAA 4NCAA 3DKDA 1B7YB 4GVBA 1RAIB 2WCXA 1R3NA 2WONA 1L3VA 4OZ1A 2FVRA 5ETVA 5F8IA 1C4AA 2DCUB 4OYWA 3CD7A 4FXWA 1EQMA 1S1WA 3HVTB 3C6UA 1UPMB 1TL7B 5M2UA 3TARA 1XIQA 3AQOA 2CPDA 1TVRA 1VQ6S 2WB1D 5CA5A 2V67A 4M5NA 1J2VA 1ZZFA 4S0MA 3TUZC 4HKQA 3H8YA 2OUGA 1HBUB 3GMGA 5KG3A 4UUWA 3S7RA 3QT5A 4O44B 2XO7A 1S9GA 2R4FA 4IFYB 5LT5A 1QM9A 3MEEA 1FDNA 2IRYA 3QIPA 1YJWS 4JYAF 5MLCV 3K17A 4Y3CA 4NLQA 3OVBA 5F3TA 3SSRA 2VHGA 4FXDA 1H72C 2UUCF 1TKXA 4OV1A 2NZ4A 2VD3A 4B9UA 3DXSX 1VJQA 4URGA 2XSJB 4LREA 3HHKA 2BQUA 3D5MA 1WOOA 1M5KC 1HNIA 4TY8A 4D3GA 3BQ0A 3V5RA 4LFAJ 3MR6A 1N6QB 4C0BA 1Z2ZA 3M8PA 2CNNB 3TX0A 3MCNA 4UW2A 4KTQA 4Q43A 4CP5A 2ZH6A 4DX5A 2ZJQQ 1NUEA 2PIIA 3V4IA 4NYPA 4E98A 3QQCD 1FJ7A 3FCVA 2XMKA 2VPYB 4USMA 3T5KA 2MTLA 2ASLA 1U48A 1IUJA 2CA9A 2R7RA 3IP0A 3SEOA 4KKOA 3FKBA 4TU9A 4B3SJ 3CJ3A 4URQU 1JXLA 2ZM6F 1KOOA 2VG5A 2IVMA 2OHDA 4RO0A 4F04B 1KLMA 2EK6A 4JI5J 4C9DA 3FBCA 3NRBA 2CQCA 4WP9A 1NJIT 3PRVA 2KFNA 5KFZA 3MF5A 1R6YA 1WF0A 4BBYA 4ITSA 1P1TA 3TVKA 3JTNA 4GC6A 1G6BA 3QAUA 4CH1A 4DR7F 3DRSB 1S6QA 3KLVA 4I0WA 3MFHA 4LF5F 4TY9A 3DLGB 2VQFF 1UVIA 1H2UX 2VBXA 2CQ2A 2I5JA 4DQIA 3OJSA 1NHVA 1U0HB 2W24A 2RRNA 3FJ2A 3V81B 4U6PA 4IH6A 5F41A 3WC2A 4G1QB 3BSAA 2EEYA 4LRBA 3QJPA 2WVEA 1RHUB 4HI2A 8RUCA 1X4EA 3NKYA 4GVBB 1ZAVA 3N79A 1GTEA 4UOHA 5HN0A 2OP5A 1WTFA 5GAGU 1CBKA 1WOSA 2B4VA 3HJFA 1JIHA 4E2FB 1Q82T 1RTHB 4DR2F 1I94J 3DLLQ 1WF2A 2BJ7A 4DSJA 5KT5A 4PG7A 1T0TV 1TVRB 2IC3B 8ATCB 4Y00A 5DQHA 3MEGB 2F4VF 2DR8A 2OPQA 4DI6A 1FKPA 3D3CJ 2NYIA 2EFPA 2ZKUA 5DGAA 1S9GB 2NSCA 1SXLA 4QR1A 1S57A 2GZOA 2MZ1A 1KVIA 1Q8IA 5HROA 2K06A 3C46A 2OMLA 2DNPA 3GV5B 1TKXB 4AL5A 3ICLA 3TWZA 4C8KA 2FHKA 5IS2A 4K50A 1HNIB 3VGUA 5KG1A 4A8YA 5IQQA 3GFHA 3AOBA 3VR1A 3HMJG 5EUHA 2ZBQA 1QAJA 2ZBRA 2N7CA 4OJ1A 1EARA 3T41A 3TZWA 3PKMA 3I9V9 4AD6A 2HIYA 4NLGA 3F44A 1RE1B 2HFOA 4QIWD 4V19X 4ZKAA 2JZ5A 4PABA 2HFZA 2BQ3A 3F56A 1DQ8A 1ZTTA 2J7KA 4JI3F 2VG5B 2KYXA 2YX4A 4LF7J 4BC9A 1HQEA 2ILYA 1OO0B 5B0FA 4NXMF 1YI2S 1IKYB 2QA2A 2YKAA 4RU9A 2CJBA 2W9BB 4F4YA 3NMAA 1JLEA 2LYVA 4OHXA 1TKTA 4YN3B 2XZWA 3DLBA 2E7WA 4CTAB 1S6QB 4K4VA 3TAMB 2DGOA 4XDCA 1WUUA 2AD9A 4YY3F 1LW0A 1VYAA 3EGWB 2HRTA 1VQLS 4RW4B 3M8QB 2A1BA 1BWEA 2AP6A 3I0RA 1LWCA 3GSIA 4WFNQ 1SKSA 4B3TJ 4QR0A 4R0EA 3K59A 1UTAA 4JI4F 1RBLA 1HPZA 2XMJA 1KTVA 2X51A 2FC8A 4IG0A 2VB6A 3EGVA 3OLBA 3EPIA 2OJ3A 4FF3A 3CF5Q 2XI3A 2B43A 4KAIA 1BQNB 2E1CA 1LFWA 3O3LA 2BRKA 3T6BA 2XMMA 2OPQB 1ZBTA 3TZXA 2RD5C 1U6BA 1FKPB 3P5TL 3BBFA 4WFAQ 2MZRA 3QYYA 4RW7A 1U24A 2I0XA 4NLVA 5J2PA 1FE0A 1HMVA 4ZCLA 1HNZJ 4P2MA 3CW2C 4QW9A 3MPVA 4I6AA 3QAEA 2VU5A 3VF0B 5IT4A 2QMWA 2UVWA 3UVJB 4ID5A 2FQQB 2R8IA 1BQMA 1EB0A 2IM3A 1LW2A 3CCSS 5F3ZA 4OI1A 5HBMB 3OPKA 3M4XA 2Y8WA 3M2UA 5GADU 3I9ZA 1RUSA 3AAWB 3IGNA 4ZPDA 2L9WA 3KLEA 3BN7A 5A8WA 2CQBA 2RRAA 3OR2B 4L73A 4RBUA 2Q43A 3M05A 2BM1A 1YTYA 1MWYA 2Z57B 2PSZA 2Q6BA 3D6HB 1G1XA 2LCWA 1HWLA 4UTGA 3NG8A 4LF8J 4IOCQ 4ED2A 4AMPA 1HQEB 3IRXA 3CC2S 4OFZA 1TKZA 2HZAA 2MZJA 1HD1A 1D3WA 1O51A 2JWNA 1QE1A 3R8YA 1B7FA 4USVA 3HHLC 1R0BG 4XPEA 3CDWA 2KFZA 4DDFA 3CIZA 2EVZA 1HBOB 3BKTA 1Y5IB 9RUBA 1OY9A 2HNYA 5I3UB 3T1AA 2YX7A 3CT9A 3H5UA 2E66A 1GNKA 4AUKA 5JMNA 3SDEA 4F3QA 4F26A 2IFXA 1LWCB 4I68A 3MDFA 3Q2SC 1FKOB 2MPUA 1FNOA 4ECVA 4HTIA 4QIFA 1RAJA 4AMOA 3M8RA 2OEJA 1RTIA 4YDXA 1FNXH 1N33J 2KL8A 3V6JA 3N6MA 1BMQB 2D69A 3H5YA 5HMZA 4NLTA 1T9WA 2IRXA 3OT9A 1T03A 2MLZA 4J9QA 3MFIA 1UW4A 4NLXA 2ACYA 4RW7B 4Q7AA 1XR6A 2C1EB 4PXBA 4TNOA 4YS2A 2KXNB 1HMVB 3HKWA 2QO3A 2XWYA 2K8GA 3K5PA 3BR9A 1MMDA 4F4ZA 3HXMA 1K47A 1S49A 2JSXA 2NZCA 1DFDA 3SI8A 2BABA 4B9VA 3UCGA 2MQOA 4LVNP 4IOAQ 1NMEB 1BQMB 1UA0A 7FDRA 4IH7A 1LW2B 4WU3A 4I2QB 2RU9A 1NSAA 3DOMA 3D3BJ 3QRRA 1HLWA 3M2UB 5KT4A 5I3PA 3ENAA 3V2UC 4P73A 1X4BA 1UVMA 3W8GA 3JSMB 1J27A 1PJ7A 4NASA 4UQTA 3JQMA 3KLEB 1YX2A 5D4NA 2C2MB 1MROA 2MQPA 2E1MC 2ZH2A 5ETQA 2HFSA 2W2OP 2MQ8A 4YB1P 2X3GA 2NXEA 3O44A 2IYGA 1S77D 2UXCF 3SIPB 3J7A1 2QSWA 2RB7A 5L1JA 2UVUA 3CCES 3IRXB 3D2WA 4IG3B 2FHMA 2CFXA 2JH3A 2I9SA 1TL1B 4ZJOA 4IRCA 4GMKA 4JI0J 2GIQA 3LAKA 4W4MA 3MAAB 4IRKA 2VDHA 4C11A 1EETA 2ZH1A 1YVFA 3NWGA 3BH7B 1YDLA 2N3LA 3KK3B 1NDLA 3TO8A 4O23A 2YNFB 1CS4A 2QEXS 2E1AA 4I2PA 2F9DA 1K73T 3D54A 4LFAF 1BLUA 4HHJA 3EDQB 4TU7A 2DNQA 1FCAA 5E3RA 4F0KA 1FWPA 2D41A 3C2PA 3N5BA 3BV8A 3PXGa 2WZ1A 1RTIB 3VQTA 3AB4B 4J37A 4LR8A 2VJVA 3K2YA 4WP3A 3CDBA 5DDRC 2KN4A 4RNOA 3LPEA 2ZNYA 2XS2A 4OJGA 4DHVA 5EWFA 5IC4B 4MK9A 3CMQA 2KM8C 3CCRS 2DHGA 2QJ3A 4B3SF 3TA0A 2B51A 4Q8FA 3QGIA 2WAQD 4WJBA 3RBXA 4ECUA 2LDYA 1NAQA 1LKZA 2UV8A 1RHQB 2DT9A 4ECSA 4HHUA 1ZM4A 4JI5F 1B3TA 2LU2A 4X4TA 3QWUA 4C3LA 1N4LA 3B4DA 4OLOA 4NEYA 5CD4A 4V1Ak 1S59A 5B08A 2AU0A 2MHEA 4IFVB 5J1EA 1U1LA 3HM9A 1FJGF 3J81U 3H59A 3C16A 3UE2A 1QJHA 1UAWA 1RWKB 4ZLJA 3TZYA 5DS7A 2IDEA 2W01A 2E1RA 1WTBA 4HDHA 1AYEA 4ED7A 1WD6A 2N4DA 4HTJA 3LGHA 1MROB 1FRIA 3GJRB 3M30B 2ZZNA 5LJ3Y 1FD2A 1YKWA 3AJ1A 2CQIA 1J5OA 1S1VA 1YJUA 2I38A 1F9HA 4B3OA 4TYBA 2GGPA 1NPKA 2ZBCA 3PR5B 2GC8A 4W98A 3A1YG 1VI7A 3ZTSA 5ETLA 1KDNA 4KB7A 2V0NA 5HQ8A 3JB9k 1YJRA 2GQQA 1TUWA 4GKKJ 4XPCA 3THVA 4ETXA 3TUPA 3VCDA 4XAKA 4X4QA 1EETB 1JLFB 4K4WA 4P6QA 5AE3A 3LH2S 4DSFA 3U27A 1UVJA 1O8BA 4B9NA 4ZVPB 4E8UA 1Q8LA 1MLAA 4JI6J 4I4BA 1WHXA 1VRTA 2CJ9A 4CYUB 4I2PB 1RBAA 2EFQA 1NK4A 2M2BA 4OX7A 1VC5A 4RX6A 4C97A 4JV0A 5SUHA 5KG0A 1K1SA 2QMXA 4P7TA 3V6KA 1KTQA 4HACA 5MAOA 5G0RA 1X4CA 1M1KT 2YNIA 2MKSA 3FRYA 5L1LA 4ILLA 3KJVA 1N32J 2YKPA 4EZ9A 3UDEA 4YHHF 2DO4A 2JEIA 4WFZA 2R2TA 2I2YA 3BM7A 2NPIA 4A46A 4F3MA 2VPXB 1GXLA 4DG1A 3BF4A 5D4LA 1RI7A 1U1RA 2Z56B 1F9FA 1O5JA 2LA4A 3ZTRA 2R7WA 5B7WA 4ED5A 2Z2LA 4HT7A 1QUVA 3DLKB 5A2QU 5D8HB 1KC8T 3UFCX 1WORA 2B4PA 2YKOA 2BXJA 3CJKB 2HAFA 2ZVIA 1Q79A 2R42A 1X8DA 3EXCX 2WB4A 1TV6A 2DIVA 1R6VA 3C16B 1RLCL 2FJAB 2BUNA 2CVEA 2W9CA 3N01A 2E9TA 1DHMA 4CRJA 1WHWA 4KGMA 2KHDA 1DZ5A 2KG0A 3R5AA 4NZ7A 2LU1A 3QATA 3L4BC 1B64A 3NGTA 4F50A 1IBLJ 4Y2AA 1NXIA 3OJUA 1N5TA 3MUMP 4C0HA 2HQIA 2YVSA 4ZVEA 1J5OB 3ZC4A 4B3OB 3BQ2A 1FK9B 4YB6A 2GGPB 3T1HF 3AT1B 2B9XA 3KJFB 4NLSA 4ZOSA 4RUBA 5HL7Q 2BJEA 2OAUA 2QLBB 4K0KJ 4PQUA 2DR5A 4ZVTB 5DZ7A 3OW2R 3QBCA 4H4OA 3NMRA 2MZTA 2MKCA 1VBYA 1XWLA 2NR0A 1RU2A 2BOPA 5J2MA 2XEXA 4GRSA 4U95A 1ZYQA 3UD3P 4DX6A 1RABB 2F63A 1SB6A 1XMOJ 5LM7E 2PI5A 4KHPF 5D78A 3KK2B 3D7SB 2QFJA 1NK0A 2OIHA 4CLZA 3QRPA 2K7KA 2IMOA 1ZPVA 2GIFA 1UFWA 2V8DA 4N8OA 5HQLA 3DLHA 4HACB 1WSVA 2BVZA 5G0RB 1PBAA 4Z7CA 3KJVB 3OSPA 4CO2A 4FP9A 3MM5A 2P9CA 4WYWA 2OPSA 1S1UB 1IWAA 3WZ0A 1UZHA 4XTTA 3SYZA 3KNGA 5I42A 5L46A 3KLIA 2QRRA 2EFGA 3CB4A 1DLOA 3Q22A 5EX3A 4LRAA 1C0TA 3NOGA 4DQSA 2CJYB 4LJMA 3MEDA 1V5IB 1EX8A 4A8FA 4LQ9A 2UUBJ 4UOGA 1GQEA 1ZM2A 2ZBPA 3RTVA 1N5VA 4WXOA 4LF8F 2U1AA 4C8MA 2YWGA 2KXFA 1RT1A 1KLNA 1KSPA 4M5MA 4K7QA 2QLJB 4NCBA 1RZMA 4A8SA 1B99A 2PEHA 4XIUA 2VFSA 7AT1B 2ROGA 4WWSA 5B0CA 2DR6A 1LV5A 2Q66A 5GAGI 4DPYA 1ZA2B 2AHOB 1K0TA 3IR7B 2IJFA 4EMDA 4NE9C 4JI7F 5HK4A 4X4UA 1TV6B 5E5NA 2DY9A 1VCTA 3IS9A 1XN9A 2DH8A 2ZUGA 4Y2MA 1YHQS 3DXBA 4OLPA 2W9CB 1DARA 5K8NA 3GIKA 3SCLE 5E3PA 5LSOA 3HCXA 4W92B 5IQ6A 3UDCA 4ED4A 2QLWA 1U8SA 2AWZA 2XMAA 3RAQA 1NK8A 4EGLA 1NK7A 1SKRA 2PFFB 1OYDA 3D6TB 2CKWA 1A6LA 5A76A 5E41A 2RDJA 3DC2A 4NPOA 3UN2A 2FLOA 4ZVFA 4CM2A 2KDOA 1N33F 1S0VA 2WBMA 2DHXA 2MQLA 5CD4H 2DRBA 2XI2A 2ROEA 1TR0A 4ES2A 4DS4A 1RACB 4MIAA 2G0CA 2AF6A 4DCPB 2LFVA 3QJJA 1Q0NA 1PIEA 2XSFA 2L08A 5AXKA 1W2BR 2XGPA 2VDIA 3U7JA 5J2MB 2AX1A 2IYIA 4L72B 5ITHA 3IBCB 4LUBA 2W7PA 2Y0SD 3RAMA 1WC5A 3SMZA 1IKXA 2XLJA 2GX8A 2HGNA 3VTIA 1IBMJ 2IHR1 3IMQJ 3VQSA 3X3UA 2VL1A 2HK2A 3HHLA 1APSA 1AUSL 5T7LA 2HFUA 2VKRA 2CQ1A 4LFCJ 5JVHQ 4EFAC 1TL4A 3BH6B 4CH7A 2E9RX 2VBYA 3AJDA 3EVOA 3JTPA 3OBIA 1K9MT 1TK5A 1FRJA 3KLIB 1DLOB 1NNDA 2FZCB 4Q8EA 4L3NA 4B3RJ 2BJDA 4CO3A 1RT4A 2EK1A 4ZPCA 1RT1B 4A8XA 2P9GA 1UVLA 1TFWA 4HHHA 2CZ9A 4ED6A 3Q2TC 2V68A 2HHSA 1R31A 4TN2A 1B0TA 2V4JA 3E01A 3NGUA 4U9RA 5FD1A 4TYAA 3BO4A 4NCGA 4ILMA 1S1XA 3D6MB 2HQDA 1HR0F 2R2UA 5EX0A 2YX1A 2M9KA 1GX5A 4AFFA 5HJYA 4QWCA 3FQKA 4LBIA 4FYYB 1NLKL 2CDRB 4A47A 5CAAA 3WHIA 3HHEA 5G4DA 4J9NA 1SL0A 1ZAXA 3FBBA 2VIHA 2QA4S 1VQSA 2UXDJ 4M5LA 1GH8A 4WTYA 1UVNA 3FZ2A 1NPRA 2UUWA 2YBVA 1T05B 1L3TA 1F5BA 5SZTA 7FD1A 2HHXA 2RRBA 2X1BA 4F4XA 1SUQA 3HKZD 3FK4A 3POTA 2VUGA 1U6FA 3MPUB 4QJVA 3M8SA 1N36J 1FVSA 4IO9Q 2QT7A 1VDHA 3OXLA 5L8RC 3T3FA 1SJRA 4PAAA 2KT2A 4HR2A 2GIRA 2F8EX 2NXNA 3RW7A 4DV1J 2HHPA 3EVMA 5L1IA 1U4BA 1UMJA 5GADI 2C2OB 3SSSA 3FEZA 2YWKA 4H54A 3BDEA 3M9NB 2ZHAA 3HVRA 4H4MA 4DUZJ 2CQPA 1HNXF 3WC0A 4I64A 3FBEA 1VIXA 2W25A 1SC3B 1WG1A 1RA7A 4JV1A 4P2XA 2RF2B 2J0QD 4OX9J 4IDKB 3HHLB 4KR0B 4DF4A 3R3TA 2RS2A 4BDPA 5K8OA 3GTYX 4NXNJ 4Q45A 4CO4A 4MIBA 3M6WA 2ZDPA 3MPDA 1XQIA 2X3DA 3NP5A 3MXHP 4IYQA 1HBMA 4DV0J 2VF3A 4K8RA 2PEBA 1FESA 3EYZA 5KT7A 4N8NA 4NA2A 3G71S 1NJWA 1SPBP 3D66A 2YKMA 3ET6B 4DS5A 2IPOB 1T95A 1X4AA 3VGSA 1R0CB 2QYCA 1RT4B 1PO6A 1U7LA 2IM1A 5C2CA 1O6XA 4AYBD 3FEXB 3MTJA 1NCLA 2C22A 3UDLA 1YJ9S 3ADAC 4P2SA 4MKYA 3VVTA 5C7PA 2HVHA 1S97A 2V8GA 3E01B 5JUMA 4NCGB 1NPPA 2QA4G 4DSEA 3DGPA 3DRXA 3LW5C 2E9ZA 1F5CA 4YB5A 3BGLA 2XZTB 4LIRA 2D9OA 5D6GA 1N5YA 4DPOA 2VG6B 2XHCA 1Q53A 4MH8A 4JI6F 3J81Y 1L3UA 5KG7A 5CABA 5L1KA 4YOEA 4X62J 1HFEL 1JLGA 4WZMA 2AGQA 1WOPA 4UZCA 2HAIA 4HLBA 2R7VA 2DRDA 1VQ4S 2VC0A 4JYAJ 3LP0A 3O5TB 3QGHA 4WFYA 2KXHA 2IBOA 4DSKA 1LWEA 2UUCJ 1N32F 2ZZTA 1SUQB 1CJUB 2KTQA 3I4PA 4LT6A 3POTB 1UJ4A 1QAIA 3Q0AA 2QGFB 3OR1A 3KLHA 2DCLA 3BGFA 1D8YA
chains in the Genus database with same CATH topology
2G1HA 3QATA 2QC3A 2G2ZA 4RR5A 3CJ8A 3TZYA 3R97A 2G2OA 4AMOA 3G87A 3HHDA 3TZZA 3H0PA 3BV8A 3SBMA 4QBUA 3TZWA 4AMMA 3EZOA 2JFKA 3TQEA 2JFDA 1NM2A 5DZ6A 3K89A 2C2NA 3IM9A 2QJ3A 3IM8A 2G2YA 4RL1A 2H1YA 3TZXA 3RGIA 1MLAA 3R8YA 5DZ7A 3HJVA 4AMPA 4AMNA 3PTWA 2CUYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2G1H A;  3QAT A;  2QC3 A;  2G2Z A;  4RR5 A;  3CJ8 A;  3TZY A;  3R97 A;  2G2O A;  4AMO A;  3G87 A;  3HHD A;  3TZZ A;  3H0P A;  3BV8 A;  3SBM A;  4QBU A;  3TZW A;  4AMM A;  3EZO A;  2JFK A;  3TQE A;  2JFD A;  1NM2 A;  5DZ6 A;  3K89 A;  2C2N A;  3IM9 A;  2QJ3 A;  3IM8 A;  2G2Y A;  4RL1 A;  2H1Y A;  3TZX A;  3RGI A;  1MLA A;  3R8Y A;  5DZ7 A;  3HJV A;  4AMP A;  4AMN A;  3PTW A;  2CUY A; 
#chains in the Genus database with same CATH topology
 3HK2 A;  3AHP A;  1VQY A;  1JKH A;  2HRY A;  5LSL A;  4F36 A;  5B0B A;  3RJM B;  1YLX A;  4DPX A;  4JI1 J;  2J6S A;  4GO7 X;  1RGV A;  3D0H E;  3CCQ S;  2ZBI A;  1WC6 A;  2XS7 A;  2J0W A;  4Y65 A;  3A13 A;  3R1H A;  4O3R A;  1BQX A;  3GJQ B;  4O4G A;  4QIV A;  1TL3 A;  2D1C A;  3O1L A;  4Q0B B;  1IKW B;  4KRW A;  1F3V A;  3B54 A;  1BXN A;  5GME A;  1S99 A;  3TRG A;  3VAJ A;  4U67 Q;  3HO1 A;  1EAY C;  2XY7 A;  1KD1 T;  2ZM6 J;  2JC0 A;  5DM7 Q;  1MSW D;  2OEL A;  1HWU A;  2JVR A;  1VQN S;  5K20 B;  5CHC B;  3DOL A;  4QWD A;  2B8Q A;  3KHH A;  3CSK A;  2HS4 A;  2HZC A;  2HVD A;  1KNZ A;  1HBM B;  3T9Z A;  3ISN C;  1PG5 B;  3DCA A;  2N4C A;  5HP1 B;  4ICL B;  3M32 A;  1FNM A;  2PMW A;  1B0P A;  1UCN A;  4NLO A;  4X84 A;  4EBE A;  1G7C B;  2GO8 A;  3IO1 A;  3KOA A;  2OGU A;  2R3V A;  2RSQ A;  1IBL F;  2IJR A;  4ELU A;  2HLT A;  1IJF B;  2X1A A;  2YKN A;  4QIG A;  3ZZU A;  4IR9 A;  3PEJ A;  1Q95 G;  4O3P A;  3I0S B;  3AXK A;  1VRU A;  2VKZ G;  2K1R A;  3GYG A;  1FA0 A;  5D15 A;  1SV5 B;  3MUV P;  1YIJ S;  3RB0 A;  1YZ6 A;  3UDV A;  1N8R T;  1NSK L;  4K0K F;  1XR7 A;  3ITH A;  4FYW B;  1RU1 A;  3FCH A;  1JQG A;  2C3O A;  4OZ3 A;  3H2V E;  1FKA F;  3NS5 A;  4DR2 J;  3PM9 A;  4PXD A;  1WSR A;  2J9D A;  1CJK B;  3C15 A;  1N5Y B;  4OV6 A;  3MM7 A;  4ZVQ B;  4RW8 A;  1KKH A;  1YJV A;  3R97 A;  1NB2 A;  1XMO F;  4UY8 T;  1H74 A;  4RW6 B;  4QW8 A;  3E8O A;  1U49 A;  4OZN A;  5BR8 F;  3FRZ A;  3RB4 A;  4K4S A;  4ELT A;  4DFP A;  4OHZ A;  4FXV A;  1QLN A;  2RNE A;  1T7P A;  1NSQ A;  2W8L A;  4GVL A;  3J7Y U;  2XB2 D;  1DAX A;  2M52 A;  1LWE B;  2GNK A;  1IQT A;  3K5M A;  4J5O A;  2NXC A;  3R5J B;  3OTC A;  5K8P A;  3G6V A;  2RVJ A;  1X9M A;  4CLY A;  4C2M A;  3I32 A;  3BBB A;  3CCV S;  4DCJ B;  4CT9 A;  5A0Y B;  3OFE A;  2RQK A;  3MR3 A;  5CYQ B;  4DX7 A;  3RB3 A;  5DRK A;  4DSI A;  1CC7 A;  4DR4 J;  3DLE A;  2H3E B;  3PX4 A;  4X4N A;  4OHV A;  3BN4 A;  4WBF A;  3MAQ A;  4OHY A;  4X4O A;  1TL3 B;  3LP2 A;  1UEK A;  4RLE A;  1HW8 A;  2W4C A;  2QA1 A;  4LSN B;  4DN0 A;  4DR6 F;  5LXR A;  1YRU A;  4DEZ A;  4RZR A;  3G8Q A;  1G4C A;  3RRG A;  5EHH A;  2ADB A;  1XNR J;  3KWM A;  5J2Q A;  4NXM J;  1RXO B;  2GHV C;  2JLE A;  3NBP A;  4X64 J;  4FYV B;  1C1B A;  2MKJ A;  3NAH A;  3GJS B;  2H4Y B;  3BGO P;  2V8H A;  1B4S A;  2P6T A;  3M32 B;  2B56 A;  4RWW A;  4YY3 J;  4ZVG A;  1T9V A;  4M63 A;  5KFG A;  1Q86 T;  3DDK A;  4KC5 A;  5LJ5 Y;  4NLR A;  1YBA A;  3GV8 B;  4KSE B;  2DNM A;  1TK8 A;  2EI5 A;  1VJW A;  2DR7 A;  2YKN B;  4NA3 A;  4RPF A;  2CZ4 A;  3DM2 A;  2ACM A;  1PC5 A;  1KFD A;  4G1I A;  1Q4R A;  1FXR A;  1HBN A;  1VRU B;  5KFJ A;  3Q86 A;  1U1P A;  4MYT A;  4DV7 F;  3ITH B;  2KG1 A;  1SQF A;  4AT1 B;  5IZH A;  2KJW A;  2W4P A;  2HG4 A;  1NZA A;  2OKQ A;  1JWW A;  4ZK7 M;  1S7I A;  3EMT A;  4KO0 A;  3LQV A;  4MAK A;  1ARO P;  4LR9 A;  4KHR A;  3MM7 B;  2CRL A;  4ES1 A;  1RYS A;  3PX6 A;  3GR1 A;  3KLG A;  4LVO P;  3N0V A;  1JJ2 R;  3LGM A;  1IBM F;  5HVF A;  3DRP A;  2B7B B;  1VBK A;  3P4U B;  3Q83 A;  4DPT A;  2AJ0 A;  2C3Y A;  1Y11 A;  3H20 A;  2R8G A;  4MK7 A;  2F65 A;  1YJN S;  2AIR B;  3QSY B;  1F5A A;  1YSJ A;  4RR5 A;  2B8P A;  2AEJ A;  3H25 A;  3TZZ A;  3H0P A;  2AT1 B;  2JRS A;  4USI A;  2Z2Y B;  3MCM A;  2VC1 A;  3R27 A;  4B3R F;  2H5J B;  2OD4 A;  1M5S A;  1RLD A;  3CJ5 A;  3DLE B;  3DI6 B;  3M2V A;  2HHU A;  2MQM A;  1V5V A;  3OL8 A;  4ED3 A;  4WFX A;  1Q8B A;  3SCI E;  4DU8 A;  3RZA A;  3GYN A;  2BEF A;  2J0S D;  1JLA A;  1P9Q C;  4DU7 A;  2MJU A;  5CZD A;  1SJ4 P;  3GG1 A;  3IN5 A;  5K9F A;  3W62 A;  3RBE A;  2H65 B;  1D0E A;  5KFI A;  1FO1 A;  1Z2L A;  3CPW R;  2HBY B;  2IA0 A;  1U45 A;  2AYB A;  3GP9 A;  1VMB A;  3M9O B;  3BO3 A;  3HVT A;  4CNY A;  5KFT A;  1FRM A;  3C14 B;  2Y1L B;  1FDA A;  1VBX A;  1QSL A;  4DZ6 A;  4K2J A;  3HHD A;  3CDE A;  3CO0 P;  1HBU A;  3VGT A;  1U0S A;  2M7S A;  5KFX A;  2LA6 A;  1N5S A;  2G9O A;  4LBH A;  5KT3 A;  2J6T A;  4O44 A;  3BS9 A;  4K5S A;  4LQ3 A;  2GVZ A;  3QMQ A;  1JK9 B;  3IA0 A;  3SBM A;  2MGZ B;  1CG2 A;  4QWA A;  2DR9 A;  3MD1 A;  3GSD A;  5F9L A;  5HVG A;  2BV3 A;  1M5O C;  3ZTQ A;  4BWM A;  1N36 F;  4TQS A;  4ZLN A;  5KT6 A;  1HBN B;  1N6Q A;  2XUL A;  2AZ3 A;  2KT3 A;  5DET A;  4RUC A;  2F3J A;  2P2C B;  3EE3 A;  4MJK A;  4PKD B;  1M5P C;  2HYI B;  1HL6 A;  1ACM B;  2VON A;  5EWE A;  4JP8 A;  4DV1 F;  3DYA B;  2CVI A;  3S8S A;  2E5L F;  2AW0 A;  2HSE B;  2XYH B;  2DH9 A;  4B02 A;  2VAS A;  3HSJ A;  4DUZ F;  2YWE A;  3UR3 C;  2QIF A;  1WEX A;  2CQ3 A;  3EWG A;  4LF4 F;  1WI8 A;  4AE5 A;  3PIP Q;  2GA7 A;  1R7I A;  2FJV A;  4OX9 F;  1X7V A;  5LMU J;  3E2E A;  1VQ7 S;  4KPY A;  1G3O A;  5A8K B;  2QYG A;  3OSN A;  1KQS R;  2O01 C;  5AXM A;  1RB0 A;  4NXN F;  3Q8S B;  5F8H A;  3A8J A;  2BR0 A;  1IWG A;  3IR5 B;  4OYM A;  2PE8 A;  4FF2 A;  3D67 A;  3Q8U A;  3K57 A;  3TAP A;  2RJZ A;  3G6X A;  1R27 B;  4ZVR B;  4RW9 B;  1SL2 A;  1HW9 A;  4A8M P;  2QL7 B;  3DLG A;  5M2R A;  5U47 A;  2F8M A;  2GHP A;  2HMI B;  5DO2 A;  3OXG A;  2WRM A;  1NK6 A;  2LQ9 A;  2E5G A;  3V81 A;  4YB7 A;  2V2Q A;  5BXI A;  1RIS A;  4G1Q A;  1JLQ A;  2JX2 A;  4L74 A;  4LF1 A;  3MMA B;  2ATL A;  3M2V B;  2XYP B;  4EO8 A;  1PC4 A;  1IKV B;  2CZV C;  4M5K A;  4I67 A;  4N47 A;  1URN A;  2C2E A;  3OTD A;  2AX0 A;  4EYH B;  4U7U K;  2CDQ A;  1U1K A;  1JLA B;  4ECT A;  1MN7 A;  2VA3 A;  2W4D A;  2AYE A;  1JXV A;  4OI0 A;  1GK8 A;  5EDW A;  3GFZ A;  2UXC J;  1RTH A;  3I82 A;  4TVA B;  1AZS A;  2L9N A;  2QX0 A;  2XMV A;  4ZJL A;  1A0O B;  3KJN B;  3ENV A;  3HHL D;  4JV5 F;  2IC3 A;  4MKV A;  5HO4 A;  3MR5 A;  3EPG A;  3MEG A;  1E6V B;  5E3Q A;  4LSL A;  1OWX A;  3CVK A;  1TU0 B;  2HQC A;  2HEK A;  4X62 F;  1N0U A;  1EKR A;  5I3Q A;  3OQ2 A;  4G6V B;  2BE2 A;  1TQL A;  2RKI B;  5KG5 A;  4DR3 F;  3B8H A;  2GVZ B;  2Y1R I;  2DNH A;  4ZVH A;  4R8U B;  1WNE A;  1NHU A;  4OI3 A;  2ERR A;  2DEJ A;  1X9W A;  1YWX A;  3K5O A;  4Q2L A;  2EC0 A;  2JL9 A;  1TUV A;  2ATC B;  4DF8 A;  4R0J A;  3LAM A;  1MU2 A;  1E6Y B;  4NI2 A;  2ZWP A;  2ZJP Q;  2DJW A;  2OTJ S;  3I56 S;  3FMB A;  1I6J A;  4ZVU B;  3MUR P;  2ZFH A;  4JI1 F;  3G96 A;  1SKW A;  1HQ2 A;  2BRL A;  4QU6 A;  2DO0 A;  1UPP A;  2E7V A;  3CC4 S;  1S6O A;  1S1T A;  2C2Z B;  3L9Z A;  4WYL A;  1S9E B;  4E0D A;  1M5V C;  4Y34 A;  2EBE A;  1N88 A;  1GMU A;  3OLA A;  5A6P A;  1WDD A;  2UUA J;  3GII A;  2W1B A;  4F0H A;  4B9T A;  3MCO A;  3CJS A;  3ETM A;  4DV4 J;  1U1M A;  1GTH A;  1M0S A;  4ANE A;  2G1H A;  3DDI A;  2XNR A;  2XY6 A;  1FER A;  2V8V A;  1VQ8 S;  1IKY A;  3PW5 A;  2W9B A;  4DWI A;  3R6L B;  2A6O A;  3B6B A;  2PMZ D;  2Z0G A;  2LEA A;  2DGQ A;  1FX4 A;  4HYK A;  2MZQ A;  2ZOG A;  4CTA A;  1H7X A;  4RBT A;  3DU6 A;  2V2K A;  3TAM A;  4OI6 A;  3GE9 A;  2BJ8 A;  4OJ3 A;  1LFP A;  1FJG J;  2WW4 A;  3VAF A;  2GJF A;  4RW4 A;  2HQG A;  3LWM A;  2ZUA A;  3M8Q A;  1JLQ B;  3KMQ A;  1URR A;  4N76 A;  5GVQ A;  1WC0 A;  4PXC A;  4PPZ A;  3E3X A;  2RU3 A;  3K8W A;  3WIU A;  3CUL A;  3SFU A;  2HWH A;  3TP2 A;  2DGV A;  3OHB A;  2GVD B;  3FGV A;  2LEB A;  4PYD A;  4Z7Y A;  2V69 A;  2R7T A;  3I6P A;  5F9N A;  5KFC A;  4UST A;  3ILJ A;  4RBV A;  1SBR A;  3A3P B;  3W9H A;  1AZS B;  3IGV A;  4CO1 A;  3PW4 A;  2P5V A;  1MNE A;  3RAX A;  2C2D A;  1BQN A;  3CD6 S;  4USW A;  1AUD A;  4LSL B;  4DOZ A;  4Z2X A;  4LRD A;  3QLH A;  5EN1 A;  1X0F A;  2BE2 B;  1RAA B;  2BJ3 A;  3MEC B;  2NQP A;  3I4H X;  3UR0 A;  4QYZ J;  5CH7 B;  3FUY A;  2N3O A;  1PAE X;  4ZJQ A;  1JNR B;  3W61 A;  2OD6 A;  4PYA A;  1MU2 B;  3UN5 A;  4HVZ A;  3W2W B;  3N6N A;  3UVJ A;  4NI2 B;  2V94 A;  3NWR A;  4OI4 A;  4DL4 A;  4JI2 F;  1ROF A;  3JYT B;  5HBM A;  2R7U A;  1SCJ B;  2M4M A;  4AQY J;  4Y2I A;  5B0D A;  1VHI A;  4QOT A;  4YHH J;  2U2F A;  2MKI A;  1V3Z A;  4ZLP A;  4DR4 F;  1F9E B;  2HQF A;  3UD5 A;  1C2P A;  3IM9 A;  1VS3 A;  1S1T B;  1WWH A;  3T19 A;  2B5J A;  2WBR A;  3P96 A;  4OJH A;  3OR2 A;  2HS0 A;  2KT5 A;  2D3O R;  1CQM A;  1FJE B;  2YPY A;  1ZOT A;  3N5F A;  5FJ4 A;  1NO8 A;  4DZD A;  1XNR F;  1RHJ B;  1BC6 A;  4ZDN A;  1H38 A;  1S6P B;  2NLW A;  3SCK E;  1LNQ A;  5DG9 A;  4X64 F;  2CPI A;  2W2Q P;  1Q5V A;  3UCU P;  2Z2M A;  1JNZ B;  1DUR A;  2OTL S;  4UF4 A;  4DL7 A;  2W9A A;  3MCS A;  5HVH A;  3FC9 A;  1SI9 A;  2Z4P A;  4NYZ A;  3K58 A;  1IM6 A;  3BBC A;  3EZ5 A;  2DHS A;  2E29 A;  3R1L A;  1HBO A;  2A2D A;  1R8H A;  3R5B A;  2Q79 A;  5DZ6 A;  1OJ4 A;  5AJ3 J;  5I3U A;  4QYZ K;  4CLW A;  4JI8 F;  2CJQ A;  3HFV A;  1UJ5 A;  3HSG A;  2J6U A;  1QVG R;  1CLF A;  2CYY A;  3MMJ A;  1C1C A;  4C3K A;  3KG0 A;  5IFM A;  1S6U A;  3TQ1 A;  4UY8 5;  1UWB B;  3S01 A;  3HSD A;  3C6T A;  2OPP A;  1RCX B;  1FKO A;  1R0A B;  2FJX A;  4F8R A;  4OIX A;  2HW3 A;  3D1O A;  1DJ0 A;  2HND B;  2Y3Y A;  2V2Z A;  2BQR A;  2G4B A;  2IM0 A;  3T1H J;  3CCW A;  2G0J A;  4LFB J;  3MAH A;  4B08 A;  4XO0 A;  4Z37 A;  2A10 A;  1Q5Y A;  2AMC B;  1RK8 A;  3OFG A;  3FSY A;  2WVD A;  3HT0 A;  1TEL A;  2WK4 A;  2KFY A;  1HHT P;  3M8Z A;  2BJ9 A;  3QLH B;  1CJV A;  4NOH A;  1RHR B;  5F0W A;  3F73 A;  1CVJ A;  3OV7 A;  4QIE A;  2UU9 F;  4RNF A;  2KVQ E;  2BZ2 A;  2RAQ A;  5JVG Q;  4ZPB A;  3RW6 A;  4RKU C;  1IBK F;  1SJ1 A;  3IAM 9;  1X31 C;  4Y0F A;  2C3U A;  4KHP J;  1XJW B;  4KBI A;  2N7Y A;  5AE2 A;  1DTQ B;  3DRR B;  4RUH A;  3M1V A;  4ZVS B;  4A8K A;  2GO9 A;  4I2Q A;  1KQK A;  5ETT A;  2LMI A;  1F0X A;  4B3M J;  1KBR A;  3AOA A;  5BJR A;  1Y00 A;  3QWP A;  2CQG A;  3JSM A;  4YDD B;  5ETN A;  3TQE A;  1ZAW A;  1NKE A;  1U8W A;  2B5J B;  3NGS A;  1NU4 A;  2F4F A;  1V3S A;  2DNK A;  2WVC A;  4UOF A;  2CPH A;  2GAG C;  1UFK A;  1T11 A;  2Q6C A;  5BYR A;  3CMA S;  3VAL A;  5B0A A;  1NZ8 A;  5LL6 d;  4J7C A;  2MEW A;  1BGX T;  4C48 A;  3L3C A;  1F1B B;  4O3O A;  3PYD A;  1IR1 A;  2LP4 A;  4LF9 J;  2HGM A;  2PA3 A;  4IG3 A;  5E2Q A;  2YTC A;  3PKY A;  2AYM A;  3G87 A;  1TL1 A;  4G3I A;  2ABY A;  4NRT A;  2AJ2 A;  4CNZ A;  1D09 B;  3HFK A;  5D3G B;  2BDP A;  3I5C A;  1PGZ A;  4J9K A;  2KRB A;  2EG2 A;  3UWT A;  3MAA A;  3G86 A;  2R9L A;  5DGB A;  2BW7 A;  1BUX A;  3SCJ E;  2HBZ B;  3PIO Q;  4JI7 J;  2WVF A;  3ILO A;  2DXD A;  4OYB A;  3DOK A;  2HFN A;  3KK3 A;  1Q1K A;  2YNF A;  4FS2 A;  4K4U A;  1PYT A;  3GZ7 A;  5E3A A;  3QZ8 A;  4ECR A;  1S4E A;  1O0P A;  2G2Z A;  3BSC A;  1QSS A;  1C1C B;  2QLX A;  4QPT A;  4M5G A;  3C6T B;  1HI1 A;  2OPP B;  3M8W A;  1H2T Z;  2AJF E;  3TOQ A;  2MQQ A;  3PV8 A;  3BO2 A;  1IBC B;  1RWO B;  2E5J A;  2LXU A;  3IFE A;  2R7S A;  2VIC A;  2RHS B;  4XDD A;  4K4T A;  2X1F A;  3PVX A;  1X4G A;  5CYM A;  1LK5 A;  1U47 A;  1FRL A;  2H51 B;  4M8L A;  4G1P A;  1LEO A;  3ILI A;  1PSD A;  1CJV B;  4QQB A;  1VLY A;  1HI0 P;  4P75 A;  3C8Y A;  3R2C J;  5LMU F;  1MWQ A;  5HMY A;  4ATN A;  3KK1 A;  5F8G A;  1GAO A;  4F4W A;  3BZQ A;  4ZHR B;  4PG6 A;  3FZB A;  2DGT A;  2V6A A;  4F67 A;  2LXF A;  1N34 F;  2H5E A;  3HDS A;  2DNL A;  1FHT A;  2BMB A;  1DTT B;  2PGC A;  4WE1 B;  4EYI B;  2ROP A;  3M1V B;  3US5 A;  5ETM A;  4IFV A;  2CAD A;  1UJ6 A;  1L5U A;  2AEM A;  2C3P A;  3TX8 A;  1UVK A;  4OZ0 A;  3B82 A;  3IC1 A;  1CC8 A;  1X4H A;  2RDI A;  3CD5 A;  2LKZ A;  4DUY J;  3CTR A;  3LWL A;  3PW7 A;  3ENW A;  2IBK A;  3SQG B;  3U1N A;  1EQ0 A;  3D1H A;  2FB0 A;  4WK1 A;  2F1F A;  3H98 A;  1RAH B;  1XK8 A;  2BW2 A;  2KJV A;  1YG0 A;  4U8Y A;  5KG2 A;  3JAM Y;  4OX8 A;  1YK9 A;  3M30 A;  4JBC A;  1SQE A;  6AT1 B;  4IR1 A;  5LSR A;  2DIT A;  1RA6 A;  5K8M A;  3R5G A;  2XMT A;  1BE4 A;  3RR8 A;  3F41 A;  3V4M A;  1S12 A;  3W8P A;  2VPZ B;  4CCH A;  1TFY A;  4A8Q A;  4UQG A;  1HWI A;  5F0U A;  4ER8 A;  1YJT A;  3ZZP A;  5HI7 A;  1GFW B;  3MR2 A;  2MDA A;  1LOU A;  4R5P B;  2O67 A;  3TA1 A;  5KFF A;  5IM0 B;  2HKE A;  3BPD A;  1HR0 J;  1JLF A;  2O66 A;  3GCW P;  3DOK B;  1Y7P A;  5K14 B;  4KH1 B;  1N5Q A;  1HWK A;  2O3D A;  1S0N A;  2E7X A;  1QAY A;  4ZIV A;  4CYU A;  1PJ6 A;  1RT5 A;  1HQU A;  2ZZM A;  1HNV B;  3TNV A;  2XM3 A;  1VQO S;  2HHT A;  1WDT A;  2HNZ B;  3LAN A;  3S6E A;  5C42 B;  3ONQ A;  1YZ7 A;  2JC1 A;  4RNM A;  2DTJ A;  4P9S A;  2WOM B;  1AT1 B;  2V4Q A;  3BPS P;  4A8O A;  1Q8K A;  2KI2 A;  2PD1 A;  2HHW A;  2G2Y A;  2RHQ B;  1FDB A;  2LEP A;  2OO4 A;  1PJ5 A;  5CYM B;  3FBF A;  4ECZ A;  1OQ6 A;  4ED1 A;  3A8E A;  3BGU A;  4OMF G;  4LF6 J;  2MLY A;  3W60 A;  3N9U C;  2HPU A;  4MKA A;  2UUA F;  1S7H A;  2FUG 9;  1S4F A;  2J76 E;  2BX6 A;  3X1L B;  4DV4 F;  3Q8R B;  3KK1 B;  1HNX J;  3DLK A;  1ZH5 A;  1WG5 A;  4L3K A;  1VFJ A;  1U1Q A;  1VGY A;  5CCL A;  5HMX A;  3CJK A;  5HAT A;  3QFW A;  1K1Q A;  5CZC A;  1RWM B;  3PFE A;  1RT6 B;  4PUO A;  1S48 A;  3G4S S;  2IM2 A;  3EGZ A;  4WFB Q;  5KFW A;  3HD1 A;  2DPI A;  2D9P A;  4KQZ A;  2OMO A;  3NNA A;  2XYG B;  4CLP A;  2QG9 B;  5GAH U;  3AD8 C;  3KLF B;  1TAQ A;  5A6W A;  2EW9 A;  2M5Y A;  1QDU B;  3TVY A;  2DNO A;  3MMB B;  3I5A A;  2B4U A;  3ETO A;  3H2L A;  5KFH A;  3T1Y F;  2YNG B;  2ZC3 A;  2B6A A;  2DVI A;  3GIL A;  2F8H A;  3BQ1 A;  3W3S A;  2BE7 D;  4ZPA A;  2KRR A;  1YQH A;  5DDO C;  2Z8Q A;  1FK9 A;  1N52 B;  1YRT A;  3FQL A;  4Y2K A;  3FFI A;  3UNG C;  2PT0 A;  4BCA A;  4O4R A;  3GG0 A;  1B70 B;  4OZJ A;  2LQ5 A;  4FNH A;  3UO0 A;  4CLK A;  3MTK A;  4DV6 J;  3LF0 A;  2H5I B;  4ZLL A;  3KYL A;  2MJN A;  3GFY A;  4DL3 A;  2E5H A;  1KQG B;  3FSI A;  2DNG A;  4C8O A;  1WC4 A;  2A0F B;  4KJI A;  2FYX A;  4PZV A;  2YNH A;  2G1D A;  3Q89 A;  4X4P A;  1IR2 A;  4N41 A;  1OMS A;  3E51 A;  4J90 A;  3W5Y A;  2RH3 A;  4KYZ A;  1LWX A;  4J9V A;  2GMH A;  3K7R A;  2ZH5 A;  3D4J A;  1GT8 A;  2Y0B B;  1RT5 B;  1HQU B;  3KK2 A;  1FE4 A;  1RWU A;  5KTQ A;  1NKB A;  4OHW A;  3EJM A;  5A8R A;  4LMZ A;  3ZZR A;  4P74 A;  4Q5V A;  3F0N A;  3TUI C;  5KFD A;  4UOC A;  2J0X A;  1RHM B;  4AQY F;  3TI0 A;  4TLQ A;  4CM0 A;  2XTJ P;  2XWX A;  1S1U A;  1X4D A;  3H4B A;  2CG8 A;  4NYO A;  3MD3 A;  2CUY A;  4X65 J;  1VHF A;  4I7F A;  4QU7 A;  4PWD A;  3LGN A;  5KFK A;  2V8P A;  2H4W B;  4OZ2 A;  4NLY A;  2F7V A;  3CCU S;  3DRY A;  2DGS A;  3PRB A;  4X66 J;  4QCL A;  3L7O A;  2GAH C;  2AJQ A;  1NM2 A;  1QVF R;  3GWC A;  3O2I A;  3AY0 A;  5D4P A;  1DRZ A;  1CJT A;  3R5D A;  4U7C A;  5DDP C;  4P71 A;  4ZCK A;  2KU7 A;  5KFM A;  4ZS6 A;  1VQ9 S;  4PUO B;  4AMM A;  5L38 A;  3IWL A;  4EEY A;  1I3O B;  5FDL B;  4DL6 A;  3G82 B;  3PCO B;  5AJ3 F;  2XQC A;  3R5C A;  4O3S A;  1JLC A;  2WW8 A;  1M90 T;  4EUV A;  4HL9 A;  2NRE A;  4EU0 A;  4DR5 J;  3SFG A;  1HHQ A;  2BKO A;  5JXS A;  2VPW B;  1JX4 A;  5GMD A;  1Z1Z A;  2B6A B;  3JTO A;  3CGI A;  2MKY A;  4J9S A;  2V9W A;  1REG X;  3OTE A;  4C8L A;  5KFV A;  1KFS A;  4DLG A;  4DMZ A;  4KPC A;  1FI4 A;  3UD4 P;  2BKN A;  2WON B;  1IR0 A;  2HK3 A;  4LFB F;  4ED0 A;  3FFI B;  2RIL A;  3H40 A;  4G65 A;  2FZK B;  2ZOF A;  3VWS A;  1S1W B;  2VZ8 A;  3C6U B;  1HD0 A;  4DR1 J;  4DFK A;  3RB6 A;  5LMN F;  4WXW A;  4WK3 A;  1BD6 A;  5D0G A;  3W65 A;  3B78 A;  2YNH B;  1FT8 A;  2C2K B;  3I5B A;  3QNW B;  1WKJ A;  1WC1 A;  1KS2 A;  1ZET A;  2HHQ A;  2FHO B;  2KZM A;  1X5O A;  1GXT A;  1NK9 A;  1N56 A;  3UW1 A;  4M5D A;  3MEE B;  5BR8 J;  3QIP B;  2NCK L;  2APO A;  1NJY A;  3IM8 A;  5A8R B;  4YR2 A;  1K0V A;  4NWB A;  3ILL A;  2I8E A;  3JSR A;  2VBW A;  2HRU A;  1L3S A;  2YQ3 A;  1VQ5 S;  4B3M F;  1B0V A;  4TY8 B;  3CCJ S;  4PQA A;  3M8P B;  4FBT A;  4B9S A;  1K44 A;  2C2R A;  1T9Y A;  4URS A;  4I7F B;  3GPA A;  1C0U A;  1RAO A;  3V4I B;  3H7H B;  2JFK A;  2DK2 A;  1KHW A;  1FFW B;  2CJX B;  4PWD B;  3W5Z A;  4IUF A;  1GMV A;  3L7P A;  1X0P A;  5D4O A;  4LBP A;  3M6V A;  1BWV A;  2FIU A;  3SZ2 A;  2YWF A;  4LF9 F;  5FLX U;  1RWX B;  2FGO A;  3P45 B;  4KKO B;  4DPW A;  5EWG A;  3VAI A;  1A7G E;  1RWV B;  4FPR A;  4DR6 J;  2JEF A;  2XG8 A;  4NML A;  1CJT B;  4NLU A;  2YH1 A;  2YPZ A;  1YJ7 A;  1KLM B;  3KUE A;  3I31 A;  4I6W A;  2GCF A;  2ZWO A;  2D3Z A;  3G6E S;  3ISN D;  3K89 A;  4ZP7 A;  1U2C A;  4X4R A;  3BYR A;  4EWT A;  2DD8 S;  4F2R A;  1XMQ F;  2PMH A;  1JLC B;  1OS5 A;  4IOB A;  1EJ7 L;  3CWJ A;  2JEJ A;  4ECX A;  3OTB A;  1NRK A;  2XC9 A;  2KVI A;  4R25 A;  4MK8 A;  2I5J B;  2OLW A;  4P10 A;  5H9F J;  4EBD A;  3CCL S;  3TA2 A;  2QL5 B;  1OPI A;  4OZ5 A;  3N6L A;  2CJA A;  2MQN A;  1T05 A;  2JDJ A;  5AXL A;  4M94 A;  5DG8 A;  2JLG A;  3NXZ A;  2FLP A;  5KFL A;  2W7A A;  3CJQ A;  5H1S V;  4IQX A;  2GQC A;  4DV7 J;  3T9N A;  2GHW A;  4WKY A;  5DQI A;  3RRH A;  4AXJ A;  2V2V A;  3EVW A;  1RP5 A;  4OI2 A;  4KGZ B;  3MMC A;  2J5A A;  4GKJ J;  4J9U E;  2L3M A;  3RRK A;  4FF4 A;  1T3O A;  2NXJ A;  3P5B P;  2XZD B;  3D1Q A;  5C2G A;  2Y1I A;  1U2F A;  4PEO A;  2CWK A;  2HS3 A;  4MT1 A;  4F4K A;  4J9M A;  3HD2 A;  3MM6 A;  4M5D B;  2HHV A;  2RF2 A;  4IDK A;  2FJW A;  3UN3 A;  3MOJ B;  2WHO A;  5HRO B;  1U09 A;  1S0M A;  1J5E J;  3AA9 A;  2XMU A;  2HGL A;  3A4T A;  5DQG A;  2VOD A;  3M6U A;  4DUY F;  4F2S A;  2CNK B;  3CJ0 A;  4FPI A;  3HFZ B;  4X4V A;  4DL5 A;  1W26 A;  1P1L A;  1Q7L B;  3PG9 A;  3QPI A;  4F7V A;  3ET6 A;  3VAG A;  3A8K A;  5GMK a;  5H9F K;  1FTR A;  1C0U B;  5GAE U;  3OTO J;  5DJB A;  2QV6 A;  3HSZ A;  5KFO A;  2LQ8 A;  2RQM A;  5IV3 A;  2RS8 A;  2CWX A;  4U96 A;  2FDN A;  2FHJ A;  1HWJ A;  1T3N A;  2VBZ A;  4ZCI A;  2OFH X;  1RKI A;  3IBF B;  1AW0 A;  4KGV B;  2VFV A;  1TUG B;  4MYU A;  3NY0 A;  3KG4 A;  4NZ0 A;  4FVM A;  2HQ3 A;  3WX4 A;  2ALY B;  2GMJ A;  1JLE B;  2ZNZ A;  3U02 A;  2I1R A;  3VAH A;  1TKT B;  2CPF A;  2VG6 A;  1S72 S;  2GQ2 A;  3ZZ0 A;  1RKJ A;  4OYO A;  3HZE A;  1DQ9 A;  1N0V C;  2MB0 B;  3W5X A;  1LW0 B;  1P8G A;  5E7O B;  1M5H A;  4OYA A;  3PTW A;  2ZIT A;  4CO5 A;  4I69 A;  2AYG A;  3R7S B;  3I0R B;  3NOC A;  4ZPT R;  4YME A;  1HNW J;  1CJU A;  4I6Y A;  3NS7 B;  2IVF B;  3K0J A;  2V9K A;  3HI9 A;  3OL6 A;  2Z58 B;  3M2R A;  5LXY A;  4DX8 H;  3SXL A;  5KAK A;  1HPZ B;  1SH0 A;  3MM9 A;  4DV5 F;  4L76 A;  1U6Z A;  4LF6 F;  3TVZ A;  4IG0 B;  1UP1 A;  1TL5 A;  2HVE A;  2CJK A;  4ERD A;  3MMC B;  4ANC A;  3JQJ A;  2E5L J;  1S79 A;  4LSZ B;  4Y28 C;  4ED8 A;  4A8W A;  1KQF B;  3TEH B;  4Q0B A;  4DBQ A;  1IKW A;  1U1N A;  6FDR A;  3CCM S;  1MW7 A;  1PYO B;  4NA1 A;  4FDF A;  1FRX A;  1OY8 A;  1NH7 A;  4LF4 J;  3KHL A;  4P7V A;  2P6S A;  3CCZ A;  1RWP B;  3MM6 B;  1YGY A;  1H0H B;  2OSR A;  3CJR A;  5J2P B;  2JHE A;  1FRH A;  2QFI A;  3ZO7 A;  4PWW A;  2F5G A;  4DQP A;  3W64 A;  1RTJ A;  4Y6I A;  4USH A;  4X4S A;  1Q78 A;  4ID5 B;  1IXK A;  5HP1 A;  4ICL A;  4WTO B;  2IVY A;  1UEV A;  5M2P A;  2EC2 A;  4KFB A;  3RYL A;  2XCP A;  1NJX A;  4DJB A;  2SXL A;  1ZM9 A;  1H3D A;  3K8V A;  1V3R A;  3W63 A;  5A8W B;  1NH8 A;  4CI0 B;  1Y10 A;  2DHH A;  1NJZ A;  1ZS6 A;  2AGP A;  2XGQ A;  3I0S A;  3QO9 A;  1VR6 A;  1SV5 A;  3DHW C;  2IRU A;  4OYP A;  3GU0 A;  3G2X A;  3OL7 A;  3LO3 A;  3S1T A;  3MWB A;  1SH3 A;  4DV6 F;  5KG4 A;  4DV2 J;  5HSP A;  1TKZ B;  1M1H A;  4DSL A;  4JV5 J;  3MM8 A;  3CJT A;  1RWN B;  1IJE B;  1CJK A;  2RT3 A;  2GS8 A;  1OIA A;  2YQ0 A;  1QE1 B;  2IY5 B;  1KVJ A;  3L7U A;  1CUL A;  4HDG A;  1F6T A;  3CCT A;  4CZC A;  1UL3 A;  2CAJ A;  4RW6 A;  1ZA1 B;  1Q16 B;  4K2X A;  2MHN A;  2HNY B;  4DR3 J;  1F2H A;  5L9N A;  4RNH A;  4CLF A;  1AXQ A;  3MR7 A;  1AB8 A;  3T5J A;  3SDE B;  2HUR A;  5E0O A;  2J9C A;  1VIO A;  4MFB A;  1Y0H A;  6FD1 A;  4M5J A;  5B09 A;  3AFG A;  2Q1L A;  3M2R B;  1JJH A;  4X65 F;  1FD8 A;  5A0Y A;  2CPY A;  3MM9 B;  5CYQ A;  2FJE B;  4UUX A;  2B3T B;  3MZI A;  1AFJ A;  2H9Z A;  3H2U B;  3OVS A;  1H6K X;  1T03 B;  3DMJ A;  4X66 F;  2D74 B;  3J7A N;  4LSN A;  3DN9 A;  2VG7 A;  3NGD A;  4FNI A;  3PY8 A;  4D3H A;  2BJ1 A;  2LDI A;  3PZP A;  1CPZ A;  2B9Y A;  4PPD A;  1RTZ A;  1NKC A;  2DXF A;  4YFU A;  1FRK A;  2DEI A;  4QYR A;  1XNQ J;  4ENO A;  1RTJ B;  2XLI A;  4OZL A;  2DNZ A;  4FVC A;  3HZG A;  3N28 A;  3TJA A;  3J7Z T;  2KH9 A;  2J8S A;  4DR5 F;  3ZTP A;  2O1P A;  3HX9 A;  4DFM A;  1FEH A;  2EKN A;  3BKF A;  3MUT P;  4YUD A;  3J80 U;  3DOM B;  3CJ2 A;  1BHN A;  1T9U A;  2W8K A;  5KFA A;  4KFB B;  1P9Y A;  1GMW A;  3D9B A;  1A9N B;  4LRF A;  3EX7 B;  3H5S A;  4ZVO B;  3BR8 A;  2IJN A;  2AEF A;  5KFE A;  3NCR A;  5CQG A;  3Q23 A;  4H4K C;  3PW0 A;  3QJL A;  2HHH J;  4X2B A;  3KTQ A;  3GQC A;  4MMO A;  2VA2 A;  3QO9 B;  2LVW A;  1X5S A;  4UT4 A;  1RAD B;  2CPE A;  2V50 A;  5A2Q Y;  1I94 F;  2DKO B;  4DR1 F;  4N77 A;  2V5H G;  2R7Q A;  1IVZ A;  4JV2 A;  2EFN A;  5KOX A;  3MM8 B;  4C6A A;  1JB0 C;  2L41 A;  2L9D A;  3KJQ B;  3GIR A;  1D9F A;  5DLG A;  2ASY A;  1ZTW A;  1CUL B;  4C11 B;  2D3O 1;  2V4R A;  2MKH A;  4CQ1 A;  4P72 A;  3GYX B;  2HWI A;  2VFT A;  3ZZO A;  1K8A T;  1EHW A;  3W9I A;  3GON A;  2POK A;  1CS4 B;  2ZVS A;  1EIY B;  2FGC A;  4NX9 A;  1FEE A;  2CPX A;  1RT7 A;  2WSE C;  1WJ9 A;  3BKU A;  3PJW A;  2YKQ A;  4ZP8 A;  4C8Z A;  1CEZ A;  3THT A;  3ULH A;  2D7S A;  3LTO A;  2XHW A;  1F2G A;  4M5H A;  1FVQ A;  2HLU A;  1MWZ A;  4MFB B;  3CE8 A;  2R8K A;  4J91 A;  3KDN A;  4AL6 A;  2VV5 A;  1RAE B;  2FVC A;  2PDA A;  3QT7 A;  3N4W A;  4JI2 J;  1EP4 A;  3ZZZ A;  4ZN1 A;  2CG4 A;  3R7N B;  3RGI A;  1NDK A;  3O6Q A;  3M6X A;  5GAH I;  4B17 A;  3R6G B;  3DI6 A;  4USU A;  3NL0 A;  2BAC A;  4KGX B;  3KUG A;  3AXM A;  1HI8 A;  2FLN A;  4PXE A;  1KR4 A;  3OVA A;  3DMJ B;  2J7W A;  1Q7Y T;  3U1L A;  4N7T A;  3LUY A;  1KWM A;  2VG7 B;  2DXE A;  2XLK A;  4LF7 F;  1VQM S;  1R8C A;  1ELO A;  4W90 B;  1W7W A;  2KO1 A;  1U02 A;  4CH0 S;  3OXF A;  1RDR A;  3C14 A;  2F40 A;  1JLB A;  2FLL A;  1RT3 A;  1RSC A;  3QRQ A;  4IH5 A;  2D3U A;  3H4D A;  5J1E B;  2W2P P;  2A3J A;  4WPA A;  2FTR A;  2FPH X;  4JUZ A;  3TR5 A;  3GLJ A;  2MGZ A;  4XK8 C;  4YQW A;  2KB2 A;  4JI8 J;  4WCE Q;  1D9D A;  3Q24 A;  2R2S A;  3KMS A;  4B3T F;  5C24 A;  3CJ8 A;  1NDP A;  1Y4Z B;  2VQE J;  2I6W A;  2C42 A;  1SJQ A;  3TEG A;  3QT6 A;  4LRC A;  3EUN A;  1S1V B;  4RJV A;  2E44 A;  5FLX Y;  3AQP A;  2AJ1 A;  5L39 A;  3CD0 A;  3BEG B;  3DLJ A;  3DYA A;  3LOU A;  4GKJ F;  1FX2 A;  3M8Y A;  3WIV A;  2R7O A;  3Q8V A;  2VOP A;  4F4A A;  1LK7 A;  3UCZ P;  1N48 A;  4YP3 A;  4KE5 A;  3RBD A;  5F8J A;  5BYQ A;  2RUS A;  3SV4 A;  2UU9 J;  1KON A;  1HNZ F;  5A8K A;  3D0G E;  2Y8Y A;  1Y9O A;  5F8N A;  1NSP A;  1H73 A;  5T41 A;  1J5E F;  1VRT B;  1RT7 B;  1V9O A;  2NUH A;  2BA9 A;  4WP8 A;  1SIW B;  2MSS A;  1UET A;  1IBK J;  4CLU A;  2K2P A;  1QSY A;  1RYR A;  5EGY A;  1NDC A;  4HH1 A;  2VH7 A;  4QZV B;  4FYX B;  2OSQ A;  2RIJ A;  2DB1 A;  4K4Y A;  3EIC A;  2DGU A;  4RW9 A;  2RQ4 A;  2YNI B;  3RG6 A;  3A8I A;  1EP4 B;  2M8D B;  2HMI A;  3D68 A;  3EZU A;  1P6T A;  3FVY A;  3OTO F;  2R8H A;  3JXO A;  2MY8 A;  1C4C A;  3BGR A;  3MMA A;  1FF2 A;  1PCA A;  5D0R A;  1N54 B;  1IKV A;  2DY1 A;  4DG1 B;  5B0G A;  1SIZ A;  1NEE A;  3W2V A;  5IWA J;  3BDP A;  4AMN A;  2FVS A;  1JXE A;  4V19 J;  4OYI A;  3ISZ A;  4ZN3 A;  5LOQ A;  3K5N A;  2MZS A;  5KFB A;  3G9C A;  1JLB B;  2ZH8 A;  2CNO B;  1RT3 B;  1BY9 A;  1UW9 A;  3GFX A;  3W66 A;  1E6V A;  1REV A;  4CLT A;  2DNR A;  4F0M A;  2CQD A;  3R2D J;  4WIQ A;  2IDL A;  3KUH A;  3UQS A;  4U7U D;  3MHY A;  1JJC B;  2RKI A;  4ILR A;  3SV3 A;  3G8S A;  4EZ6 A;  3W1Y C;  2BAN A;  4R8U A;  2GML A;  3KXD A;  1YIT S;  1SH2 A;  4DUT A;  3ZXW A;  2JLF A;  3OHA A;  2HBQ B;  1AA1 B;  1HNW F;  2YQ1 A;  2R2R A;  1VK8 A;  1U25 A;  2PA8 D;  1NHK L;  5C24 B;  4ZPV R;  4CDI A;  1E6Y A;  3AOC A;  3PR4 A;  3CDA A;  1QY7 A;  4USJ C;  9ATC B;  2JVO A;  3PJ9 A;  3ZNJ 1;  1HA1 A;  4RL1 A;  4AL7 A;  4K59 A;  5KFQ A;  5DG7 A;  3TUJ C;  2UXB J;  3TJ9 A;  3ENQ A;  2FD2 A;  4PCQ A;  3T5H A;  2JJ4 D;  4DPU A;  1R8B A;  3NCP A;  1DY3 A;  4HT5 A;  2G0I A;  5KFN A;  1WI6 A;  2OFG X;  4PQU B;  4FKY A;  4C4W A;  1S9E A;  4U8V A;  1MMN A;  1OSD A;  1UKU A;  3VHQ A;  4BLG A;  3GIJ A;  2CIM A;  4H4O B;  1P27 B;  4QWE A;  1FXD A;  1LXN A;  2Y1J A;  4DLE A;  3RUB L;  4ECQ A;  3OFH A;  5D0E A;  3BB5 A;  2B7C B;  2QTW A;  3A3O B;  1LXJ A;  1UWA A;  2N82 B;  4FF1 A;  4CWB A;  3HVA A;  2AKW B;  3ZZT A;  4OYZ A;  1FTC A;  5T14 A;  3VAM A;  5HJX A;  1N34 J;  5KFP A;  1WKK A;  4ETZ A;  4B9L A;  2EKY A;  4DV3 J;  3LPY A;  3SQO P;  2K3K A;  1VQP S;  3DDN A;  3FEY B;  2ZDO A;  1OYE A;  2QC3 A;  1JJ4 A;  2QSF A;  4PG8 A;  4J9R A;  3MM5 B;  3KG1 A;  4KV8 A;  2OPS B;  1VBZ A;  3EDR B;  1KN6 A;  3BGR B;  1U26 A;  5I42 B;  2J8A A;  5IC6 B;  3THP A;  1PBU A;  1NB7 A;  3PJX A;  1C0T B;  3RU0 A;  1Y5L B;  5J1N A;  1Y5N B;  1IQZ A;  3MED B;  3GB0 A;  4FN5 A;  1D8Z A;  5CXT A;  4OL8 A;  3W2V B;  2BE9 B;  1SC4 B;  2GVD A;  3MEK A;  3IBW A;  2DNN A;  5KFS A;  3W7B A;  1NK5 A;  2RDD A;  4DV2 F;  3AH6 A;  4P2F A;  2C2N A;  4TKT A;  2XO6 A;  1S5Z A;  4JI0 F;  2NXU A;  1TTH B;  4PR6 A;  2JEG A;  5HLF A;  2MYF A;  2OPR A;  2ZKT A;  3TAN A;  1REV B;  2XBP A;  3A12 A;  4C0O C;  2XNQ A;  2M88 A;  4QPX A;  1WEZ A;  1ICE B;  3PHE A;  2DYA A;  3NGR A;  1X5P A;  2Z2Z A;  4PG4 A;  3UPF A;  2FVP A;  3IS9 B;  1SJ3 P;  3MEC A;  2OI2 A;  2F9J A;  2E1P A;  3P8B B;  2BAN B;  2RE1 A;  2XY5 A;  3OD2 A;  4MKB A;  2LQJ A;  3IWX A;  3T5L A;  1WHV A;  3P6Y C;  4P52 A;  4WF9 Q;  4RNN A;  1D9A A;  3CJ4 A;  1Q81 T;  5IT9 U;  3W2W A;  2VOO A;  4FYD A;  2UUT A;  3H42 A;  3R9L A;  4QBU A;  3FNN A;  3GCX P;  3CME S;  2WSC C;  3JYT A;  2KZZ A;  4DL0 C;  2MLX A;  3D0I E;  3PW2 A;  2FHJ D;  3DHX A;  1MML A;  3L95 X;  1ITP A;  4IO1 A;  1R8A A;  2M0G B;  4MIW A;  3C66 A;  4F25 A;  3V6H A;  4MTP A;  8AT1 B;  2PC6 A;  1TKD A;  4TXS A;  2XCA A;  3PYF A;  3J81 j;  2HFV A;  3NEK A;  1I1G A;  2X7I A;  5GAE I;  3PNI A;  1VK3 A;  2E5I A;  2W2M P;  2A18 A;  4ECY A;  4RU2 A;  4NLD A;  5THW A;  3NLC A;  3M9M B;  1XC9 A;  1GXU A;  3WDO A;  1VLO A;  4DFJ A;  3CUN A;  1S6P A;  1VC6 A;  4TLR A;  2QMU B;  1IKX B;  4YEA A;  1XNQ F;  2Q3P A;  4K4X A;  3JSB A;  3GJT B;  2QE5 A;  1YBT A;  4ZMM A;  5T7L B;  3QGG A;  1TMM A;  2IAJ A;  3JQK A;  3AD9 C;  5KG6 A;  2UV8 G;  3GV7 B;  2DBB A;  4KV8 B;  1V6H A;  1GEH A;  1NBE B;  4USK A;  5F8L A;  2DH7 A;  4N5S A;  4FZV A;  4KY3 A;  2EFV A;  4M95 A;  3K5L A;  3AD7 C;  3DU5 A;  2YXL A;  1UWB A;  3T1Y J;  2HHH F;  4CT8 A;  2HWT A;  4IQM A;  4GO5 X;  3MGJ A;  1R0A A;  2R7X A;  1ULR A;  1VRQ C;  2BYC A;  2BBE A;  2Y9H A;  2HND A;  2HVI A;  3I55 S;  1CQN A;  2MY7 A;  3U1M A;  3MOZ A;  1H7W A;  5IOL A;  4M1K A;  2V4J B;  4OX6 A;  5HLF B;  5KFU A;  3LP1 A;  3I96 A;  4CLL A;  1TK0 A;  3D6F B;  3VZH A;  1KVK A;  4PG5 A;  4Y2C A;  4GKK F;  2OPR B;  3MPY A;  1RJJ A;  5KOW A;  4TU8 A;  1HHS A;  1S1X B;  2FY8 A;  4BS2 A;  2OEM A;  1RWW B;  4FKX A;  2P9E A;  2UZA A;  1HKA A;  4O0N A;  4ZP9 A;  3DGV A;  3J80 Y;  1W25 A;  2Z30 B;  1MN9 A;  2W2N P;  1DTQ A;  3QT8 A;  3DRR A;  1T94 A;  3JS9 A;  2EFO A;  3BJY A;  3NCQ A;  3NNC A;  1WG4 A;  1I5O B;  2AJ4 A;  5ETP A;  5HQM A;  1T9T A;  2J9E A;  2FJD B;  2YY3 A;  3FCW A;  4CLS A;  3AOD A;  4M5I A;  1KRP A;  1H98 A;  3IAS 9;  2X1G A;  4ZPW R;  2PN6 A;  5H9E J;  3J7Z 5;  1X9S A;  4LF2 A;  3MPW A;  3PFO A;  1RQ0 A;  2H54 B;  5HAO A;  4H4K A;  2EWH A;  1S9F A;  2NUU G;  2ZJR Q;  3VGV A;  2NYH A;  3QID A;  2J7U A;  3B4M A;  3PO5 A;  2FVQ A;  4H4M B;  3H90 A;  2V34 A;  2YWW A;  4BWJ A;  1PYS B;  2B9W A;  2GFF A;  1LWF A;  5F8M A;  1RTD A;  3HJV A;  2MST A;  1S76 D;  2QL9 B;  4DCO B;  3DFE A;  2ZOM A;  4L6V 3;  1SVD A;  2K3I A;  1AFI A;  1LQ9 A;  1WF1 A;  2CXE A;  1IM4 A;  2A2C A;  4YR3 A;  5D3G A;  3HPO A;  2ZH3 A;  4C7Q A;  5BYS A;  4EBC A;  2G13 A;  1HYS A;  3NS6 A;  2CPJ A;  3CXC R;  2HIQ A;  5KFY A;  3A3N B;  2IAJ B;  4Q44 A;  2W7O A;  2IIH A;  2M8H A;  4I56 A;  3L09 A;  2ZH4 A;  5JJB A;  4OQJ A;  1SJF A;  4KH0 B;  4DR7 J;  2YKM B;  2CQH A;  4LF5 J;  2VQF J;  4O3N A;  1VQK S;  2VQE F;  4WU2 A;  5J2N A;  4KHM A;  2ILZ A;  4FBU A;  3FSX A;  5C5J A;  3G6Y A;  2DRA A;  2V63 A;  5KT2 A;  1W2I A;  3WBZ A;  5ADZ A;  3RBZ A;  4BC7 A;  2QZ8 A;  1VIS A;  4C8Y A;  3O8W A;  3WX8 A;  1CSJ A;  5H9E K;  4C98 A;  1G2E A;  2ASD A;  3LP1 B;  4AND A;  3BYP A;  1TP7 A;  2KM8 B;  1ZM3 A;  3TAQ A;  1XTZ A;  1EZZ B;  3DGP B;  3WQP A;  4QR2 A;  5ETO A;  2RQC A;  4J9P A;  5LMN J;  2ZHO A;  1KHV A;  2RUG A;  4CIO A;  1T9X A;  1PIL A;  4FS1 A;  1I51 B;  1WEY A;  2WTF A;  1YBU A;  1OY6 A;  2F4V J;  2G2O A;  2YH0 A;  3H5X A;  1TZ0 A;  4ZHR A;  2L48 A;  2ZC4 A;  3IR6 B;  3TW0 A;  1JLG B;  3UI3 A;  1RT2 A;  1M1G A;  1GMW D;  1JMT A;  2GJI A;  3C19 A;  2CQ4 A;  1S0O A;  5D77 A;  1DTT A;  2QLF B;  4WE1 A;  3LP0 B;  2NS1 B;  3OUY A;  1QUP A;  4HEA 9;  2GW8 A;  2K7J A;  1KOH A;  4EK2 A;  1U1O A;  3VAK A;  4KT0 C;  4NMX A;  2C3M A;  1WC3 A;  2A6M A;  3OR1 B;  3KLH B;  2DGW A;  3LAL A;  1JKH B;  4F02 A;  1SQG A;  5ETR A;  2UVV A;  4ZIW A;  3SQG A;  3V6D A;  3KFW X;  4NEZ A;  3GIM A;  3C3L A;  2H48 B;  2ASJ A;  1RBO B;  3IRW P;  2UUB F;  5IWA F;  1Y3K A;  2DGX A;  1R43 A;  1XR5 A;  1HAR A;  4O4G B;  3OFF A;  4ZA1 A;  1ZPW X;  4TQR A;  1F3F A;  2ZEJ A;  2IA6 A;  2IMW P;  1LWF B;  3PHT A;  1RTD B;  2JOQ A;  3GR0 A;  3BSO A;  2KYZ A;  3PO4 A;  1QD1 A;  2RML A;  5CZV A;  3Q8Y A;  3QGP A;  2VFR A;  2ADC A;  4JI3 J;  3AJ2 A;  3EZO A;  4J9O A;  2JFD A;  4B9M A;  1Z4U A;  5ETK A;  4R5P A;  4F3O A;  1HYS B;  3DOL B;  5IM0 A;  2MXY A;  4NZ6 A;  1L3K A;  2FY1 A;  1Y3J A;  4UZB A;  3CIM A;  2EG1 A;  1XMB A;  1RHK B;  2UVR A;  2WSF C;  3M7V A;  1VOM A;  4I1T A;  1XMQ J;  5K14 A;  2H1Y A;  5IV4 A;  2DNY A;  2ZD1 A;  5ETS A;  2UP1 A;  2EPI A;  1TAU A;  1WAC A;  4LR7 A;  1FXL A;  4DXL A;  4NL5 A;  2FZG B;  3ELH A;  3KDO A;  2GJ2 A;  1HNV A;  3D28 A;  5HAN A;  2HBR B;  5D0H A;  3PDN A;  4LIW A;  5J2N B;  4DL2 A;  2HNZ A;  4ZP6 A;  1XER A;  5C42 A;  5HMW A;  4K4Z A;  3J7Y I;  2WOM A;  2MMY A;  2VZ9 A;  2UXB F;  1FJC A;  3AA8 A;  2LEC A;  4PRF A;  2M70 A;  1MG7 A;  1XEZ A;  2K1R B;  4JI4 J;  3VZI A;  2AQ4 A;  1D1U A;  3W9J A;  2AV5 A;  3CO9 A;  4OYX A;  3IG1 A;  4PWU A;  2CPZ A;  2CNL B;  1H2V Z;  1U2R A;  4ZCM A;  2ALZ A;  2ZE2 A;  1DQA A;  5B0E A;  3CC7 S;  4DQQ A;  2PI4 A;  2KKH A;  3C15 B;  4RW8 B;  2LXI A;  2HVZ A;  3PX0 A;  4RWX A;  1GX6 A;  3I87 A;  3VVU A;  4ECW A;  4DQR A;  3FMW A;  3AB2 B;  1RT2 B;  1WHY A;  3EM1 A;  3HLU A;  4GC7 A;  4DV3 F;  3CDU A;  3SSQ A;  2LLZ A;  3OUY B;  1FFS B;  4LFC F;  1RT6 A;  3PYG A;  1RAG B;  1OQ3 A;  5L9X A;  3KHG A;  5C25 A;  4ALZ A;  1FWK A;  3ZNU A;  5CCM A;  2DIU A;  4QWB A;  1UEU A;  1UZD A;  3KLF A;  5IT0 A;  3HVW A;  3LA0 A;  4DN9 A;  3MMB A;  3V6D B;  4Q2M A;  2NSB A;  2XS5 A;  2R8J A;  2YNG A;  1X60 A;  3RR7 A;  1DBD A;  3EXY A;  1XBW A;  1X5T A;  2AGO A;  2ZH9 A;  3G8T A;  1HIY A;  3HUL A;  1OSC A;  4IRD A;  1F60 B;  1R8P A;  3LP2 B;  3KHR A;  1UA1 A;  3OL9 A;  3HHN B;  3NNH A;  1S10 A;  2B9E A;  4ES3 A;  3ZFV A;  3HT3 A;  2VJU A;  2EXU A;  1EKS A;  3TYT A;  4J9L A;  2B0G A;  1SL1 A;  2J9D E;  4N56 A;  5RUB A;  1TL7 A;  1KP6 A;  5J2Q B;  3Q8P B;  2KHC A;  4IKA A;  2P8I A;  1SC6 A;  4EO6 A;  4EI2 A;  2DPJ A;  3NBP B;  5K5M A;  1X4F A;  1C1B B;  4NLW A;  2BOA A;  1SKU B;  2O5D A;  4ELV A;  2DHA A;  2ZD1 B;  2MKK A;  3FDS A;  4IFY A;  1ZZN A;  2FJB B;  2UXD F;  3QFH A;  1WKL A;  2GV1 A;  5FII A;  1PKU A;  2ZH7 A;  3KNA A;  3PRD A;  2DIS A;  3MI7 X;  4ID8 A;  1VC0 A;  1QTM A;  3VV2 B;  1IN0 A;  2M3D A;  5CYJ A;  4C3M A;  2XSJ A;  5AE1 A;  2YWH A;  4ZIT A;  5AXN A;  2OEK A;  4WKR A;  3DM2 B;  4C8N A;  4AXI A;  3PEH A;  3DNC A;  2XMW A;  5AT1 B;  3NAI A;  1RAF B;  3P3D A;  2QN6 B;  2PFD A;  5IXU A;  3ZZY A;  2PO4 A;  3HP6 A;  4NLP A;  3KKF A;  1QTN B;  2CQ0 A;  4O0I A;  4HI1 A;  1OPZ A;  3IG1 B;  2COL A;  4DV5 J;  4A4J A;  4KGK A;  2LQB A;  3CED A;  3IWN C;  3JAM U;  2ZE2 B;  2EBG A;  4KO0 B;  3P49 B;  3JSY A;  1RCO B;  5DM6 Q;  3HF5 A;  3PYE A;  5KFR A;  1FFG B;  1T8E A;  5J1P A;  3QSI A;  3KLG B;  1YRX A;  2AZ1 A;  4O3Q A;  2NPF A;  4NRU A;  4A48 A;  4YR0 A;  1QAX A;  3DRP B;  4KIA A;  3UNY A;  2HZV A;  4WII A;  5E33 A;  3TJ8 A;  3PAC A;  1R89 A;  5DDQ C;  3BRE A;  3Q8Q B;  2ZHB A;  3R7B B;  4BHQ A;  5DLF A;  3NGK A;  1SC1 B;  4WZQ A;  2C28 A;  4JB8 B;  2FC9 A;  5I4M A;  1UFL A;  5E3C A;  5FDL A;  5IT9 Y;  5C25 B;  3G82 A;  3CNQ P;  4DV0 F;  1FDD A;  4HH0 A;  3DRS A;  3ZTO A;  4CO0 A;  2BKP A;  1FWL A;  3QZ7 A;  2B4O A;  3T6J A;  2BM0 A;  1TMJ A;  1U0H A;  2OH2 A;  3IXQ A;  4K5R A;  2VFU A;  4JOU A;  1PAU B;  5CZX A;  1WEL A;  3EGN A;  2JNJ A;  1T02 A;  2WVB A;  4L75 A;  3BSN A;  1KEK A;  4RUA A;  4NCA A;  3DKD A;  1B7Y B;  4GVB A;  1RAI B;  2WCX A;  1R3N A;  2WON A;  1L3V A;  4OZ1 A;  2FVR A;  5ETV A;  5F8I A;  1C4A A;  2DCU B;  4OYW A;  3CD7 A;  4FXW A;  1EQM A;  1S1W A;  3HVT B;  3C6U A;  1UPM B;  1TL7 B;  5M2U A;  3TAR A;  1XIQ A;  3AQO A;  2CPD A;  1TVR A;  1VQ6 S;  2WB1 D;  5CA5 A;  2V67 A;  4M5N A;  1J2V A;  1ZZF A;  4S0M A;  3TUZ C;  4HKQ A;  3H8Y A;  2OUG A;  1HBU B;  3GMG A;  5KG3 A;  4UUW A;  3S7R A;  3QT5 A;  4O44 B;  2XO7 A;  1S9G A;  2R4F A;  4IFY B;  5LT5 A;  1QM9 A;  3MEE A;  1FDN A;  2IRY A;  3QIP A;  1YJW S;  4JYA F;  5MLC V;  3K17 A;  4Y3C A;  4NLQ A;  3OVB A;  5F3T A;  3SSR A;  2VHG A;  4FXD A;  1H72 C;  2UUC F;  1TKX A;  4OV1 A;  2NZ4 A;  2VD3 A;  4B9U A;  3DXS X;  1VJQ A;  4URG A;  2XSJ B;  4LRE A;  3HHK A;  2BQU A;  3D5M A;  1WOO A;  1M5K C;  1HNI A;  4TY8 A;  4D3G A;  3BQ0 A;  3V5R A;  4LFA J;  3MR6 A;  1N6Q B;  4C0B A;  1Z2Z A;  3M8P A;  2CNN B;  3TX0 A;  3MCN A;  4UW2 A;  4KTQ A;  4Q43 A;  4CP5 A;  2ZH6 A;  4DX5 A;  2ZJQ Q;  1NUE A;  2PII A;  3V4I A;  4NYP A;  4E98 A;  3QQC D;  1FJ7 A;  3FCV A;  2XMK A;  2VPY B;  4USM A;  3T5K A;  2MTL A;  2ASL A;  1U48 A;  1IUJ A;  2CA9 A;  2R7R A;  3IP0 A;  3SEO A;  4KKO A;  3FKB A;  4TU9 A;  4B3S J;  3CJ3 A;  4URQ U;  1JXL A;  2ZM6 F;  1KOO A;  2VG5 A;  2IVM A;  2OHD A;  4RO0 A;  4F04 B;  1KLM A;  2EK6 A;  4JI5 J;  4C9D A;  3FBC A;  3NRB A;  2CQC A;  4WP9 A;  1NJI T;  3PRV A;  2KFN A;  5KFZ A;  3MF5 A;  1R6Y A;  1WF0 A;  4BBY A;  4ITS A;  1P1T A;  3TVK A;  3JTN A;  4GC6 A;  1G6B A;  3QAU A;  4CH1 A;  4DR7 F;  3DRS B;  1S6Q A;  3KLV A;  4I0W A;  3MFH A;  4LF5 F;  4TY9 A;  3DLG B;  2VQF F;  1UVI A;  1H2U X;  2VBX A;  2CQ2 A;  2I5J A;  4DQI A;  3OJS A;  1NHV A;  1U0H B;  2W24 A;  2RRN A;  3FJ2 A;  3V81 B;  4U6P A;  4IH6 A;  5F41 A;  3WC2 A;  4G1Q B;  3BSA A;  2EEY A;  4LRB A;  3QJP A;  2WVE A;  1RHU B;  4HI2 A;  8RUC A;  1X4E A;  3NKY A;  4GVB B;  1ZAV A;  3N79 A;  1GTE A;  4UOH A;  5HN0 A;  2OP5 A;  1WTF A;  5GAG U;  1CBK A;  1WOS A;  2B4V A;  3HJF A;  1JIH A;  4E2F B;  1Q82 T;  1RTH B;  4DR2 F;  1I94 J;  3DLL Q;  1WF2 A;  2BJ7 A;  4DSJ A;  5KT5 A;  4PG7 A;  1T0T V;  1TVR B;  2IC3 B;  8ATC B;  4Y00 A;  5DQH A;  3MEG B;  2F4V F;  2DR8 A;  2OPQ A;  4DI6 A;  1FKP A;  3D3C J;  2NYI A;  2EFP A;  2ZKU A;  5DGA A;  1S9G B;  2NSC A;  1SXL A;  4QR1 A;  1S57 A;  2GZO A;  2MZ1 A;  1KVI A;  1Q8I A;  5HRO A;  2K06 A;  3C46 A;  2OML A;  2DNP A;  3GV5 B;  1TKX B;  4AL5 A;  3ICL A;  3TWZ A;  4C8K A;  2FHK A;  5IS2 A;  4K50 A;  1HNI B;  3VGU A;  5KG1 A;  4A8Y A;  5IQQ A;  3GFH A;  3AOB A;  3VR1 A;  3HMJ G;  5EUH A;  2ZBQ A;  1QAJ A;  2ZBR A;  2N7C A;  4OJ1 A;  1EAR A;  3T41 A;  3TZW A;  3PKM A;  3I9V 9;  4AD6 A;  2HIY A;  4NLG A;  3F44 A;  1RE1 B;  2HFO A;  4QIW D;  4V19 X;  4ZKA A;  2JZ5 A;  4PAB A;  2HFZ A;  2BQ3 A;  3F56 A;  1DQ8 A;  1ZTT A;  2J7K A;  4JI3 F;  2VG5 B;  2KYX A;  2YX4 A;  4LF7 J;  4BC9 A;  1HQE A;  2ILY A;  1OO0 B;  5B0F A;  4NXM F;  1YI2 S;  1IKY B;  2QA2 A;  2YKA A;  4RU9 A;  2CJB A;  2W9B B;  4F4Y A;  3NMA A;  1JLE A;  2LYV A;  4OHX A;  1TKT A;  4YN3 B;  2XZW A;  3DLB A;  2E7W A;  4CTA B;  1S6Q B;  4K4V A;  3TAM B;  2DGO A;  4XDC A;  1WUU A;  2AD9 A;  4YY3 F;  1LW0 A;  1VYA A;  3EGW B;  2HRT A;  1VQL S;  4RW4 B;  3M8Q B;  2A1B A;  1BWE A;  2AP6 A;  3I0R A;  1LWC A;  3GSI A;  4WFN Q;  1SKS A;  4B3T J;  4QR0 A;  4R0E A;  3K59 A;  1UTA A;  4JI4 F;  1RBL A;  1HPZ A;  2XMJ A;  1KTV A;  2X51 A;  2FC8 A;  4IG0 A;  2VB6 A;  3EGV A;  3OLB A;  3EPI A;  2OJ3 A;  4FF3 A;  3CF5 Q;  2XI3 A;  2B43 A;  4KAI A;  1BQN B;  2E1C A;  1LFW A;  3O3L A;  2BRK A;  3T6B A;  2XMM A;  2OPQ B;  1ZBT A;  3TZX A;  2RD5 C;  1U6B A;  1FKP B;  3P5T L;  3BBF A;  4WFA Q;  2MZR A;  3QYY A;  4RW7 A;  1U24 A;  2I0X A;  4NLV A;  5J2P A;  1FE0 A;  1HMV A;  4ZCL A;  1HNZ J;  4P2M A;  3CW2 C;  4QW9 A;  3MPV A;  4I6A A;  3QAE A;  2VU5 A;  3VF0 B;  5IT4 A;  2QMW A;  2UVW A;  3UVJ B;  4ID5 A;  2FQQ B;  2R8I A;  1BQM A;  1EB0 A;  2IM3 A;  1LW2 A;  3CCS S;  5F3Z A;  4OI1 A;  5HBM B;  3OPK A;  3M4X A;  2Y8W A;  3M2U A;  5GAD U;  3I9Z A;  1RUS A;  3AAW B;  3IGN A;  4ZPD A;  2L9W A;  3KLE A;  3BN7 A;  5A8W A;  2CQB A;  2RRA A;  3OR2 B;  4L73 A;  4RBU A;  2Q43 A;  3M05 A;  2BM1 A;  1YTY A;  1MWY A;  2Z57 B;  2PSZ A;  2Q6B A;  3D6H B;  1G1X A;  2LCW A;  1HWL A;  4UTG A;  3NG8 A;  4LF8 J;  4IOC Q;  4ED2 A;  4AMP A;  1HQE B;  3IRX A;  3CC2 S;  4OFZ A;  1TKZ A;  2HZA A;  2MZJ A;  1HD1 A;  1D3W A;  1O51 A;  2JWN A;  1QE1 A;  3R8Y A;  1B7F A;  4USV A;  3HHL C;  1R0B G;  4XPE A;  3CDW A;  2KFZ A;  4DDF A;  3CIZ A;  2EVZ A;  1HBO B;  3BKT A;  1Y5I B;  9RUB A;  1OY9 A;  2HNY A;  5I3U B;  3T1A A;  2YX7 A;  3CT9 A;  3H5U A;  2E66 A;  1GNK A;  4AUK A;  5JMN A;  3SDE A;  4F3Q A;  4F26 A;  2IFX A;  1LWC B;  4I68 A;  3MDF A;  3Q2S C;  1FKO B;  2MPU A;  1FNO A;  4ECV A;  4HTI A;  4QIF A;  1RAJ A;  4AMO A;  3M8R A;  2OEJ A;  1RTI A;  4YDX A;  1FNX H;  1N33 J;  2KL8 A;  3V6J A;  3N6M A;  1BMQ B;  2D69 A;  3H5Y A;  5HMZ A;  4NLT A;  1T9W A;  2IRX A;  3OT9 A;  1T03 A;  2MLZ A;  4J9Q A;  3MFI A;  1UW4 A;  4NLX A;  2ACY A;  4RW7 B;  4Q7A A;  1XR6 A;  2C1E B;  4PXB A;  4TNO A;  4YS2 A;  2KXN B;  1HMV B;  3HKW A;  2QO3 A;  2XWY A;  2K8G A;  3K5P A;  3BR9 A;  1MMD A;  4F4Z A;  3HXM A;  1K47 A;  1S49 A;  2JSX A;  2NZC A;  1DFD A;  3SI8 A;  2BAB A;  4B9V A;  3UCG A;  2MQO A;  4LVN P;  4IOA Q;  1NME B;  1BQM B;  1UA0 A;  7FDR A;  4IH7 A;  1LW2 B;  4WU3 A;  4I2Q B;  2RU9 A;  1NSA A;  3DOM A;  3D3B J;  3QRR A;  1HLW A;  3M2U B;  5KT4 A;  5I3P A;  3ENA A;  3V2U C;  4P73 A;  1X4B A;  1UVM A;  3W8G A;  3JSM B;  1J27 A;  1PJ7 A;  4NAS A;  4UQT A;  3JQM A;  3KLE B;  1YX2 A;  5D4N A;  2C2M B;  1MRO A;  2MQP A;  2E1M C;  2ZH2 A;  5ETQ A;  2HFS A;  2W2O P;  2MQ8 A;  4YB1 P;  2X3G A;  2NXE A;  3O44 A;  2IYG A;  1S77 D;  2UXC F;  3SIP B;  3J7A 1;  2QSW A;  2RB7 A;  5L1J A;  2UVU A;  3CCE S;  3IRX B;  3D2W A;  4IG3 B;  2FHM A;  2CFX A;  2JH3 A;  2I9S A;  1TL1 B;  4ZJO A;  4IRC A;  4GMK A;  4JI0 J;  2GIQ A;  3LAK A;  4W4M A;  3MAA B;  4IRK A;  2VDH A;  4C11 A;  1EET A;  2ZH1 A;  1YVF A;  3NWG A;  3BH7 B;  1YDL A;  2N3L A;  3KK3 B;  1NDL A;  3TO8 A;  4O23 A;  2YNF B;  1CS4 A;  2QEX S;  2E1A A;  4I2P A;  2F9D A;  1K73 T;  3D54 A;  4LFA F;  1BLU A;  4HHJ A;  3EDQ B;  4TU7 A;  2DNQ A;  1FCA A;  5E3R A;  4F0K A;  1FWP A;  2D41 A;  3C2P A;  3N5B A;  3BV8 A;  3PXG a;  2WZ1 A;  1RTI B;  3VQT A;  3AB4 B;  4J37 A;  4LR8 A;  2VJV A;  3K2Y A;  4WP3 A;  3CDB A;  5DDR C;  2KN4 A;  4RNO A;  3LPE A;  2ZNY A;  2XS2 A;  4OJG A;  4DHV A;  5EWF A;  5IC4 B;  4MK9 A;  3CMQ A;  2KM8 C;  3CCR S;  2DHG A;  2QJ3 A;  4B3S F;  3TA0 A;  2B51 A;  4Q8F A;  3QGI A;  2WAQ D;  4WJB A;  3RBX A;  4ECU A;  2LDY A;  1NAQ A;  1LKZ A;  2UV8 A;  1RHQ B;  2DT9 A;  4ECS A;  4HHU A;  1ZM4 A;  4JI5 F;  1B3T A;  2LU2 A;  4X4T A;  3QWU A;  4C3L A;  1N4L A;  3B4D A;  4OLO A;  4NEY A;  5CD4 A;  4V1A k;  1S59 A;  5B08 A;  2AU0 A;  2MHE A;  4IFV B;  5J1E A;  1U1L A;  3HM9 A;  1FJG F;  3J81 U;  3H59 A;  3C16 A;  3UE2 A;  1QJH A;  1UAW A;  1RWK B;  4ZLJ A;  3TZY A;  5DS7 A;  2IDE A;  2W01 A;  2E1R A;  1WTB A;  4HDH A;  1AYE A;  4ED7 A;  1WD6 A;  2N4D A;  4HTJ A;  3LGH A;  1MRO B;  1FRI A;  3GJR B;  3M30 B;  2ZZN A;  5LJ3 Y;  1FD2 A;  1YKW A;  3AJ1 A;  2CQI A;  1J5O A;  1S1V A;  1YJU A;  2I38 A;  1F9H A;  4B3O A;  4TYB A;  2GGP A;  1NPK A;  2ZBC A;  3PR5 B;  2GC8 A;  4W98 A;  3A1Y G;  1VI7 A;  3ZTS A;  5ETL A;  1KDN A;  4KB7 A;  2V0N A;  5HQ8 A;  3JB9 k;  1YJR A;  2GQQ A;  1TUW A;  4GKK J;  4XPC A;  3THV A;  4ETX A;  3TUP A;  3VCD A;  4XAK A;  4X4Q A;  1EET B;  1JLF B;  4K4W A;  4P6Q A;  5AE3 A;  3LH2 S;  4DSF A;  3U27 A;  1UVJ A;  1O8B A;  4B9N A;  4ZVP B;  4E8U A;  1Q8L A;  1MLA A;  4JI6 J;  4I4B A;  1WHX A;  1VRT A;  2CJ9 A;  4CYU B;  4I2P B;  1RBA A;  2EFQ A;  1NK4 A;  2M2B A;  4OX7 A;  1VC5 A;  4RX6 A;  4C97 A;  4JV0 A;  5SUH A;  5KG0 A;  1K1S A;  2QMX A;  4P7T A;  3V6K A;  1KTQ A;  4HAC A;  5MAO A;  5G0R A;  1X4C A;  1M1K T;  2YNI A;  2MKS A;  3FRY A;  5L1L A;  4ILL A;  3KJV A;  1N32 J;  2YKP A;  4EZ9 A;  3UDE A;  4YHH F;  2DO4 A;  2JEI A;  4WFZ A;  2R2T A;  2I2Y A;  3BM7 A;  2NPI A;  4A46 A;  4F3M A;  2VPX B;  1GXL A;  4DG1 A;  3BF4 A;  5D4L A;  1RI7 A;  1U1R A;  2Z56 B;  1F9F A;  1O5J A;  2LA4 A;  3ZTR A;  2R7W A;  5B7W A;  4ED5 A;  2Z2L A;  4HT7 A;  1QUV A;  3DLK B;  5A2Q U;  5D8H B;  1KC8 T;  3UFC X;  1WOR A;  2B4P A;  2YKO A;  2BXJ A;  3CJK B;  2HAF A;  2ZVI A;  1Q79 A;  2R42 A;  1X8D A;  3EXC X;  2WB4 A;  1TV6 A;  2DIV A;  1R6V A;  3C16 B;  1RLC L;  2FJA B;  2BUN A;  2CVE A;  2W9C A;  3N01 A;  2E9T A;  1DHM A;  4CRJ A;  1WHW A;  4KGM A;  2KHD A;  1DZ5 A;  2KG0 A;  3R5A A;  4NZ7 A;  2LU1 A;  3QAT A;  3L4B C;  1B64 A;  3NGT A;  4F50 A;  1IBL J;  4Y2A A;  1NXI A;  3OJU A;  1N5T A;  3MUM P;  4C0H A;  2HQI A;  2YVS A;  4ZVE A;  1J5O B;  3ZC4 A;  4B3O B;  3BQ2 A;  1FK9 B;  4YB6 A;  2GGP B;  3T1H F;  3AT1 B;  2B9X A;  3KJF B;  4NLS A;  4ZOS A;  4RUB A;  5HL7 Q;  2BJE A;  2OAU A;  2QLB B;  4K0K J;  4PQU A;  2DR5 A;  4ZVT B;  5DZ7 A;  3OW2 R;  3QBC A;  4H4O A;  3NMR A;  2MZT A;  2MKC A;  1VBY A;  1XWL A;  2NR0 A;  1RU2 A;  2BOP A;  5J2M A;  2XEX A;  4GRS A;  4U95 A;  1ZYQ A;  3UD3 P;  4DX6 A;  1RAB B;  2F63 A;  1SB6 A;  1XMO J;  5LM7 E;  2PI5 A;  4KHP F;  5D78 A;  3KK2 B;  3D7S B;  2QFJ A;  1NK0 A;  2OIH A;  4CLZ A;  3QRP A;  2K7K A;  2IMO A;  1ZPV A;  2GIF A;  1UFW A;  2V8D A;  4N8O A;  5HQL A;  3DLH A;  4HAC B;  1WSV A;  2BVZ A;  5G0R B;  1PBA A;  4Z7C A;  3KJV B;  3OSP A;  4CO2 A;  4FP9 A;  3MM5 A;  2P9C A;  4WYW A;  2OPS A;  1S1U B;  1IWA A;  3WZ0 A;  1UZH A;  4XTT A;  3SYZ A;  3KNG A;  5I42 A;  5L46 A;  3KLI A;  2QRR A;  2EFG A;  3CB4 A;  1DLO A;  3Q22 A;  5EX3 A;  4LRA A;  1C0T A;  3NOG A;  4DQS A;  2CJY B;  4LJM A;  3MED A;  1V5I B;  1EX8 A;  4A8F A;  4LQ9 A;  2UUB J;  4UOG A;  1GQE A;  1ZM2 A;  2ZBP A;  3RTV A;  1N5V A;  4WXO A;  4LF8 F;  2U1A A;  4C8M A;  2YWG A;  2KXF A;  1RT1 A;  1KLN A;  1KSP A;  4M5M A;  4K7Q A;  2QLJ B;  4NCB A;  1RZM A;  4A8S A;  1B99 A;  2PEH A;  4XIU A;  2VFS A;  7AT1 B;  2ROG A;  4WWS A;  5B0C A;  2DR6 A;  1LV5 A;  2Q66 A;  5GAG I;  4DPY A;  1ZA2 B;  2AHO B;  1K0T A;  3IR7 B;  2IJF A;  4EMD A;  4NE9 C;  4JI7 F;  5HK4 A;  4X4U A;  1TV6 B;  5E5N A;  2DY9 A;  1VCT A;  3IS9 A;  1XN9 A;  2DH8 A;  2ZUG A;  4Y2M A;  1YHQ S;  3DXB A;  4OLP A;  2W9C B;  1DAR A;  5K8N A;  3GIK A;  3SCL E;  5E3P A;  5LSO A;  3HCX A;  4W92 B;  5IQ6 A;  3UDC A;  4ED4 A;  2QLW A;  1U8S A;  2AWZ A;  2XMA A;  3RAQ A;  1NK8 A;  4EGL A;  1NK7 A;  1SKR A;  2PFF B;  1OYD A;  3D6T B;  2CKW A;  1A6L A;  5A76 A;  5E41 A;  2RDJ A;  3DC2 A;  4NPO A;  3UN2 A;  2FLO A;  4ZVF A;  4CM2 A;  2KDO A;  1N33 F;  1S0V A;  2WBM A;  2DHX A;  2MQL A;  5CD4 H;  2DRB A;  2XI2 A;  2ROE A;  1TR0 A;  4ES2 A;  4DS4 A;  1RAC B;  4MIA A;  2G0C A;  2AF6 A;  4DCP B;  2LFV A;  3QJJ A;  1Q0N A;  1PIE A;  2XSF A;  2L08 A;  5AXK A;  1W2B R;  2XGP A;  2VDI A;  3U7J A;  5J2M B;  2AX1 A;  2IYI A;  4L72 B;  5ITH A;  3IBC B;  4LUB A;  2W7P A;  2Y0S D;  3RAM A;  1WC5 A;  3SMZ A;  1IKX A;  2XLJ A;  2GX8 A;  2HGN A;  3VTI A;  1IBM J;  2IHR 1;  3IMQ J;  3VQS A;  3X3U A;  2VL1 A;  2HK2 A;  3HHL A;  1APS A;  1AUS L;  5T7L A;  2HFU A;  2VKR A;  2CQ1 A;  4LFC J;  5JVH Q;  4EFA C;  1TL4 A;  3BH6 B;  4CH7 A;  2E9R X;  2VBY A;  3AJD A;  3EVO A;  3JTP A;  3OBI A;  1K9M T;  1TK5 A;  1FRJ A;  3KLI B;  1DLO B;  1NND A;  2FZC B;  4Q8E A;  4L3N A;  4B3R J;  2BJD A;  4CO3 A;  1RT4 A;  2EK1 A;  4ZPC A;  1RT1 B;  4A8X A;  2P9G A;  1UVL A;  1TFW A;  4HHH A;  2CZ9 A;  4ED6 A;  3Q2T C;  2V68 A;  2HHS A;  1R31 A;  4TN2 A;  1B0T A;  2V4J A;  3E01 A;  3NGU A;  4U9R A;  5FD1 A;  4TYA A;  3BO4 A;  4NCG A;  4ILM A;  1S1X A;  3D6M B;  2HQD A;  1HR0 F;  2R2U A;  5EX0 A;  2YX1 A;  2M9K A;  1GX5 A;  4AFF A;  5HJY A;  4QWC A;  3FQK A;  4LBI A;  4FYY B;  1NLK L;  2CDR B;  4A47 A;  5CAA A;  3WHI A;  3HHE A;  5G4D A;  4J9N A;  1SL0 A;  1ZAX A;  3FBB A;  2VIH A;  2QA4 S;  1VQS A;  2UXD J;  4M5L A;  1GH8 A;  4WTY A;  1UVN A;  3FZ2 A;  1NPR A;  2UUW A;  2YBV A;  1T05 B;  1L3T A;  1F5B A;  5SZT A;  7FD1 A;  2HHX A;  2RRB A;  2X1B A;  4F4X A;  1SUQ A;  3HKZ D;  3FK4 A;  3POT A;  2VUG A;  1U6F A;  3MPU B;  4QJV A;  3M8S A;  1N36 J;  1FVS A;  4IO9 Q;  2QT7 A;  1VDH A;  3OXL A;  5L8R C;  3T3F A;  1SJR A;  4PAA A;  2KT2 A;  4HR2 A;  2GIR A;  2F8E X;  2NXN A;  3RW7 A;  4DV1 J;  2HHP A;  3EVM A;  5L1I A;  1U4B A;  1UMJ A;  5GAD I;  2C2O B;  3SSS A;  3FEZ A;  2YWK A;  4H54 A;  3BDE A;  3M9N B;  2ZHA A;  3HVR A;  4H4M A;  4DUZ J;  2CQP A;  1HNX F;  3WC0 A;  4I64 A;  3FBE A;  1VIX A;  2W25 A;  1SC3 B;  1WG1 A;  1RA7 A;  4JV1 A;  4P2X A;  2RF2 B;  2J0Q D;  4OX9 J;  4IDK B;  3HHL B;  4KR0 B;  4DF4 A;  3R3T A;  2RS2 A;  4BDP A;  5K8O A;  3GTY X;  4NXN J;  4Q45 A;  4CO4 A;  4MIB A;  3M6W A;  2ZDP A;  3MPD A;  1XQI A;  2X3D A;  3NP5 A;  3MXH P;  4IYQ A;  1HBM A;  4DV0 J;  2VF3 A;  4K8R A;  2PEB A;  1FES A;  3EYZ A;  5KT7 A;  4N8N A;  4NA2 A;  3G71 S;  1NJW A;  1SPB P;  3D66 A;  2YKM A;  3ET6 B;  4DS5 A;  2IPO B;  1T95 A;  1X4A A;  3VGS A;  1R0C B;  2QYC A;  1RT4 B;  1PO6 A;  1U7L A;  2IM1 A;  5C2C A;  1O6X A;  4AYB D;  3FEX B;  3MTJ A;  1NCL A;  2C22 A;  3UDL A;  1YJ9 S;  3ADA C;  4P2S A;  4MKY A;  3VVT A;  5C7P A;  2HVH A;  1S97 A;  2V8G A;  3E01 B;  5JUM A;  4NCG B;  1NPP A;  2QA4 G;  4DSE A;  3DGP A;  3DRX A;  3LW5 C;  2E9Z A;  1F5C A;  4YB5 A;  3BGL A;  2XZT B;  4LIR A;  2D9O A;  5D6G A;  1N5Y A;  4DPO A;  2VG6 B;  2XHC A;  1Q53 A;  4MH8 A;  4JI6 F;  3J81 Y;  1L3U A;  5KG7 A;  5CAB A;  5L1K A;  4YOE A;  4X62 J;  1HFE L;  1JLG A;  4WZM A;  2AGQ A;  1WOP A;  4UZC A;  2HAI A;  4HLB A;  2R7V A;  2DRD A;  1VQ4 S;  2VC0 A;  4JYA J;  3LP0 A;  3O5T B;  3QGH A;  4WFY A;  2KXH A;  2IBO A;  4DSK A;  1LWE A;  2UUC J;  1N32 F;  2ZZT A;  1SUQ B;  1CJU B;  2KTQ A;  3I4P A;  4LT6 A;  3POT B;  1UJ4 A;  1QAI A;  3Q0A A;  2QGF B;  3OR1 A;  3KLH A;  2DCL A;  3BGF A;  1D8Y A; 
#chains in the Genus database with same CATH homology
 2G1H A;  3QAT A;  2QC3 A;  2G2Z A;  4RR5 A;  3CJ8 A;  3TZY A;  3R97 A;  2G2O A;  4AMO A;  3G87 A;  3HHD A;  3TZZ A;  3H0P A;  3BV8 A;  3SBM A;  4QBU A;  3TZW A;  4AMM A;  3EZO A;  2JFK A;  3TQE A;  2JFD A;  1NM2 A;  5DZ6 A;  3K89 A;  2C2N A;  3IM9 A;  2QJ3 A;  3IM8 A;  2G2Y A;  4RL1 A;  2H1Y A;  3TZX A;  3RGI A;  1MLA A;  3R8Y A;  5DZ7 A;  3HJV A;  4AMP A;  4AMN A;  3PTW A;  2CUY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...