3TZYA

Crystal structure of a fragment containing the acyltransferase domain of pks13 from mycobacterium tuberculosis in the palmitoylated form at 2.2 a
Total Genus 179
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
179
sequence length
464
structure length
464
Chain Sequence
ELPGVTEEALRLKEAALEELAAQEVTAPLVPLAVSAFLTSRKKAAAAELADWMQSPEGQASSLESIGRSLSRRNHGRSRAVVLAHDHDEAIKGLRAVAAGKQAPNVFSVDGPVTTGPVWVLAGFGAQHRKMGKSLYLRNEVFAAWIEKVDALVQDELGYSVLELILDDAQDYGIETTQVTIFAIQIALGELLRHHGAKPAAVIGQSLGEAASAYFAGGLSLRDATRAICSRSHLMGEGEAMLFGEYIRLMALVEYSADEIREVFSDFPDLEVCVYAAPTQTVIGGPPEQVDAILARAEAEGKFARKFATKGASHTSQMDPLLGELTAELQGIKPTSPTCGIFSTVHEGRYIKPGGEPIHDVEYWKKGLRHSVYFTHGIRNAVDSGHTTFLELAPNPVALMQVALTTADAGLHDAQLIPTLARKQDEVSSMVSTMAQLYVYGHDLDIRTLFSRASGPQDYANIPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Polyketide synthase PKS13
publication title Biochemical and structural study of the atypical acyltransferase domain from the mycobacterial polyketide synthase pks13
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 179
structure length 464
sequence length 464
chains with identical sequence B
ec nomenclature ec 2.3.1.-:
pdb deposition date 2011-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00698 Acyl_transf_1 Acyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.250 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Malonyl-CoA ACP transacylase, ACP-binding 3tzyA02
3.40.366.20 Alpha Beta 3-Layer(aba) Sandwich Malonyl-Coenzyme A Acyl Carrier Protein; domain 2 Malonyl-Coenzyme A Acyl Carrier Protein; domain 2 3tzyA01
2QC3A 2JFKA 2G2ZA 4QBUA 2JFDA 4RR5A 4AMNA 2H1YA 2G1HA 4RL1A 3TZXA 3TZWA 3HHDA 4AMOA 3TZYA 3IM8A 3R97A 3TQEA 5DZ6A 4AMPA 2QJ3A 3RGIA 3CJ8A 3SBMA 3TZZA 4AMMA 3BV8A 2C2NA 1NM2A 3EZOA 3G87A 2G2OA 3QATA 3K89A 3PTWA 2CUYA 3HJVA 3R8YA 1MLAA 5DZ7A 3IM9A 2G2YA 3H0PA
chains in the Genus database with same CATH superfamily
1RTJA 2K8GA 1NKBA 2F40A 3BO3A 2D74B 3CT9A 3GCWP 4LF4J 2HSEB 2J0WA 4PQUB 2M8HA 2DNOA 1NJZA 4J9PA 4LFAJ 2IFXA 5KT4A 1UFWA 2RDIA 5IT9Y 4NA2A 4LBPA 4JI2F 2FUG9 1EP4B 3D3BJ 3D6TB 3MDFA 1UVJA 1MROA 4ZJLA 5CXTA 2W7OA 3DRPB 2HVIA 3GU0A 5T7LA 4NCGA 2Q3PA 3H0PA 2ZH5A 5A8WA 4F8RA 3MCNA 1HNIA 2PA3A 1P9YA 2XGPA 3TW0A 1OWXA 1SI9A 1T9YA 2XYHB 3HVRA 3CCZA 1SH3A 1PBAA 4DR1F 5C2CA 4I69A 4OJ3A 3H59A 3Q8QB 1VRUB 1FFWB 2KT5A 1E6VB 2PIIA 1HHTP 8AT1B 4K4YA 3M7VA 3T1AA 3EZUA 2BMBA 5GMEA 1EB0A 5CCLA 3US5A 2C3OA 1Q8BA 3DCAA 2W2MP 2HQ3A 3QATA 3LO3A 4NLRA 3BBFA 4Y2IA 2MGZA 3FDSA 4K7QA 5CD4A 2QV6A 2DRBA 1U0SA 4DUZJ 3RBEA 1REGX 4IYQA 4UOGA 2IM2A 3ZNUA 2GIRA 2VONA 3CJRA 3PDNA 2V67A 4TVAB 5IQ6A 1QE1B 1NK6A 1RAAB 1WJ9A 2OJ3A 3RB6A 4R8UB 3BEGB 2V0NA 3Q8UA 4NX9A 3ZTRA 3UD4P 4XDCA 2F7VA 2ZC3A 5AXLA 4F2SA 3H40A 1ZZNA 3HFKA 1WHYA 4C0HA 2EFVA 4TYBA 3VHQA 2HGMA 3CIMA 5KFAA 4YR3A 2DVIA 3IAM9 3SYZA 2HWHA 3UNGC 1HI0P 4FS1A 1WF1A 3KXDA 1S1WB 1SKUB 1KKHA 3NY0A 4JI3J 2I5JA 3ZFVA 4PWDA 1K8AT 1U4BA 3MF5A 1PC5A 2HIQA 5DDOC 2FGOA 2FD2A 1F5AA 2ASYA 3GMGA 2R9LA 1X4GA 2ZH6A 5KFDA 3BKFA 3B54A 4X4VA 1AZSB 1DQ8A 2BDPA 2CPYA 4C8LA 4P75A 1NM2A 2DHXA 3G96A 2Y8YA 3FEZA 1HWLA 2JC1A 5GAHI 2M3DA 1NEEA 5L1IA 2Z30B 1P8GA 3PY8A 1QAYA 1T0TV 5J1EA 3HHLA 4B08A 3W5YA 3JAMY 2XSJB 2AJ1A 3U02A 2FIUA 3JQJA 3PKYA 2R7WA 1BE4A 1ZTTA 2AEMA 1U6ZA 1RAGB 5HMYA 5I4MA 2YX4A 5EX0A 5LXRA 4RNFA 3LW5C 4W4MA 1WUUA 2W2PP 4X65F 2QX0A 5DO2A 1JNZB 4LSLA 4TYAA 4LRDA 4BCAA 3MMJA 2HAFA 3GJQB 4DPXA 4WK1A 3L9ZA 1LWFB 3H2UB 3ICLA 4G65A 2F9JA 2E9ZA 5CYJA 1Q78A 2F9DA 1YX2A 4DL5A 3E8OA 1RTDB 5D0RA 4GC7A 1YRUA 2ROPA 1MG7A 2Z2MA 4LRBA 4P9SA 1IKXB 1WSRA 1Z2LA 3K57A 3MURP 4FPRA 2ZNYA 5MLCV 2GC8A 5ETMA 2JEJA 3DHXA 4LF5J 1TL5A 1WTFA 2OPQA 4NCAA 1C1BB 4QZVB 5KAKA 4QW9A 2CNKB 3BH6B 1XMQF 1WOPA 3BGFA 3JB9k 4LVNP 3TYTA 2QLFB 4ED3A 3RW6A 3NRBA 4UF4A 3GG0A 5EN1A 1N0UA 1RJJA 3I32A 1TKZB 2DXEA 1ROFA 2DNHA 1AA1B 2W8KA 3V4IB 3CW2C 2UUCF 4LREA 1XR5A 3DXBA 3RAMA 4I64A 3J81j 1HYSB 3CDUA 3VF0B 5M2RA 3W62A 4LVOP 4B02A 4HKQA 1HQEB 2KJVA 3SCIE 3UR3C 3CVKA 2FVRA 2D9PA 4OZ2A 1L3VA 3CJKB 3CWJA 1WC1A 4YS2A 4ZVPB 1VC0A 2D3OR 2N82B 1JLCB 2U2FA 4DF4A 3C14A 1N34J 2CAJA 2MKKA 4OJHA 3MPVA 3GIMA 4UY8T 4ZHRA 5DS7A 4M5MA 3I9V9 3R7NB 5K8OA 1SPBP 4PQUA 1MN9A 2VBYA 4CI0B 3IWXA 1OY6A 4M5LA 4GKJJ 4NXMF 2QA1A 4DUYF 2RF2B 1RT1B 2DNNA 1WDTA 3WC0A 3VGTA 4B3TJ 1AT1B 2GZOA 1EP4A 4WBFA 2LVWA 3D1QA 2HHXA 2Y9HA 2EW9A 2UU9J 3M8PB 2D69A 1MSWD 3M9NB 3FKBA 2J8SA 3JYTB 4JI1F 3EPIA 1V3ZA 4DX6A 2BE9B 2LA6A 1NHKL 4TLQA 2MHNA 1PIEA 1RAIB 1NSKL 3FCWA 3A8EA 5IQQA 4OFZA 1YI2S 4IFVB 2OPPB 1N48A 2C3YA 1VRUA 4WPAA 1E6VA 1EIYB 4PG5A 1PCAA 1MMDA 1YJWS 4PXCA 3ILJA 4PWUA 3TVYA 4GKKF 4KB7A 3KG0A 1T9UA 3TAMA 2YQ3A 2FHKA 3TUPA 3DN9A 1GQEA 3ZZOA 1DURA 3F0NA 3G8QA 4GVLA 1Z4UA 2R7XA 2VF3A 5DGAA 3PW5A 5ETSA 4Q5VA 4TLRA 4NOHA 4R8UA 4IOBA 1U1MA 1NUEA 2FVCA 4KHPJ 3IG1B 3PYGA 3EM1A 2FZKB 5JVHQ 3A3NB 2K06A 4AE5A 2HS4A 1V6HA 2HBQB 4F0HA 2XY6A 3AAWB 4CQ1A 2WVFA 2ZZTA 3OXLA 4IFYA 4P6QA 3SI8A 5HSPA 5H1SV 1U2RA 4YB1P 3HX9A 4AMMA 2OFGX 1F2GA 2HYIB 1S1WA 2Y0SD 1TKXA 2ZVSA 5D3GB 2VFSA 3P8BB 3X1LB 2K3KA 5LXYA 4RX6A 4YUDA 2BXJA 1SUQB 4AXJA 3D1OA 4DV5J 1R8BA 4OMFG 4UOCA 2O3DA 4FKXA 1AZSA 4HT7A 3NGUA 1JKHA 4KKOB 2DIUA 1R8AA 5E33A 1QLNA 3EGNA 4QWCA 4I2QB 4ZPCA 1NHVA 1SIWB 1FKPB 1QUPA 1PAEX 3FBFA 2KM8B 1C0UB 1N32J 2ZOFA 4PYDA 3JTOA 3CMQA 2W01A 3TANA 3DLLQ 3P49B 2CIMA 1BUXA 3R5AA 1RCXB 3BSAA 2G0IA 4I6WA 5DRKA 1UW9A 1S6OA 1TMJA 3QGPA 2COLA 2V50A 2R8KA 1LQ9A 3MM5B 4JI2J 1WWHA 3D0IE 3MGJA 4DSIA 1N5VA 1SJ4P 2ZDPA 2FVSA 3I56S 1KVIA 5CZDA 4MK9A 3W8PA 2FJWA 3CJQA 3W2WB 3T5KA 4ZITA 2DHHA 1KSPA 5J1PA 2HFNA 3R5CA 1OIAA 5D4NA 5H9FK 3UI3A 1TUGB 4DDFA 3MUVP 1HW8A 1HD1A 1NXIA 1IKXA 1KOHA 2L9WA 3SDEA 2QLBB 1C1CB 1DTQA 3S1TA 1FRKA 1W26A 2CPJA 1GXLA 1T3NA 3I5BA 4DSJA 1ZYQA 4Q2MA 1SQFA 1N54B 1IBLJ 5IXUA 1H73A 3CJ2A 2FDNA 2DNPA 2R7TA 1HNZF 4RBTA 1KVJA 1RDRA 1Y7PA 3HM9A 2R2SA 3BQ1A 2YH0A 4J9QA 3AHPA 2YNGA 1VS3A 4F3MA 4KGXB 1N5TA 1SB6A 2AX0A 5F0WA 2RMLA 4Q8FA 4F4KA 1VQ5S 1HWJA 5CABA 1K1QA 2NUUG 3ISND 4IG3B 1TKZA 5DDQC 4TQRA 2ZNZA 1NHUA 5HVGA 1Z2ZA 4A8WA 1GTHA 3V4IA 1OSDA 4USUA 2HW3A 4LFCF 1YGYA 2HNDB 5T41A 3CCES 3MMBA 4F04B 5HMWA 2E5LF 3ZXWA 1T9TA 3QJLA 1Y5IB 2W4PA 4PABA 3CJKA 1FA0A 1UJ5A 2RQKA 2MHEA 1UVIA 2DH7A 3LQVA 3QLHA 3O1LA 3CE8A 5BJRA 1M5VC 1TU0B 3PHTA 4J5OA 2GQQA 2B5JB 1Q86T 1HNXJ 1I51B 1F3FA 5FIIA 1R0AB 1T11A 2IM3A 2XHCA 2RF2A 1WC5A 1RT1A 4U7UK 2GAHC 2ADCA 3K5OA 2P9EA 1LWEB 1WELA 4ECRA 3M8PA 2FC8A 4JB8B 1KOOA 3JYTA 4BWMA 2NSBA 2CADA 1UA0A 1FJ7A 3U27A 1Y5NB 3Q8VA 1D9DA 1IR0A 2FHJD 5HP1B 1EKRA 4IFVA 3CCQS 2OPPA 3AA9A 1NJIT 4H54A 3BQ2A 2XS5A 4K4VA 4QR2A 4QU6A 2DNKA 1WEYA 1UEVA 1R3NA 4A8KA 2BX6A 3QFWA 3FBEA 2HGLA 3PO4A 4M1KA 1U1RA 1VQ8S 4O23A 4ID5B 1RKJA 3LWLA 3PYDA 4DUTA 3I87A 1WHVA 2IPOB 1K0TA 2CPXA 1ICEB 1U02A 4NZ6A 4PZVA 4WIIA 2IAJB 4B9UA 2XQCA 4RR5A 5HATA 3QFHA 5KG0A 4B9TA 3FNNA 1QSLA 4RJVA 4CLZA 1VISA 1L3KA 2XMTA 4RW6B 3J81Y 2IYGA 1BWEA 1RZMA 3GR0A 3K5LA 4EK2A 2UXBF 5E5NA 3IS9B 2MTLA 1P6TA 2AJ4A 1RYSA 2QLJB 4ZIVA 2R2TA 1HMVB 3G8TA 2RQ4A 3ZZ0A 3EUNA 1R8CA 5DGBA 1J27A 4DPTA 2VKRA 3HLUA 4IOCQ 1LW2B 1VQ4S 3D54A 2F65A 1XR7A 3OW2R 4U67Q 2N3OA 5AJ3F 1HQ2A 1B64A 4GVBB 3IBWA 2LDIA 7FDRA 4B9VA 2F4VJ 5E3AA 1SUQA 3ZZYA 4FS2A 2B51A 4DWIA 2G0JA 4ES1A 2B6AB 3D3CJ 5A0YB 3RGIA 4Q8EA 3P3DA 2QGFB 1ITPA 2BJDA 2E1AA 3J80Y 1CG2A 1SV5B 1YJTA 1FKPA 2QLXA 1NCLA 1HNVA 2QEXS 1C0UA 2YX1A 2V4JB 5F41A 2ZEJA 4EBEA 1UTAA 2BJ3A 7AT1B 2PMZD 2BE2B 1FHTA 2I38A 1JLBB 4IRKA 2YKNB 3KHRA 3I4PA 4AQYF 2M88A 5C42B 4PRFA 3MR6A 4DCOB 3H4DA 1JWWA 2YVSA 4DUYJ 2Y0BB 3EWGA 2RHSB 2DTJA 2R3VA 4HHJA 2WRMA 5GAGI 4DR4F 1NK7A 3MM5A 3C6TB 2C3MA 2EVZA 1T05B 1ZM3A 1TUVA 2MSSA 5CHCB 4KTQA 3QIDA 4JI1J 3BGRA 3PJXA 4R0JA 1RUSA 1OY8A 3KLGB 1RBAA 3SCLE 2JHEA 3R97A 3IR7B 5KG2A 2HG4A 4DSEA 5CCMA 3C6UB 5FLXY 5HLFB 2B9EA 2EFOA 4ANCA 1VBYA 3M2UB 5LMUF 1C1CA 2RT3A 2XB2D 2XG8A 2UUWA 1JXVA 1RYRA 1V3SA 2YKMA 2HGNA 1RHJB 2PEBA 5EGYA 2JSXA 1QSYA 4KGZB 2BEFA 2ZKTA 4KPCA 2AZ1A 4X4RA 4OX8A 1YBTA 1HD0A 4ZLPA 4NZ0A 1IQZA 2WAQD 1O0PA 2A6OA 1FJCA 3I5AA 2HFUA 3MMCA 3PIOQ 2NREA 1VFJA 2CNNB 2YNIB 2A2CA 1W2IA 4KE5A 4DR3F 4F67A 1FNMA 2K7JA 2CUYA 1LWCB 5KFMA 2ZE2B 1CS4B 4XTTA 5C25A 4J9LA 4OQJA 1TZ0A 1Q7LB 2ZBQA 5RUBA 1LV5A 2GVZB 2ZM6F 2W1BA 4OYMA 1U7LA 2OMOA 4QWBA 1RT7B 4KC5A 1CJKB 1FJEB 2HNDA 4Z2XA 4IQXA 1AW0A 5DETA 3OV7A 3HVWA 1WTBA 3DOLB 1P1LA 4KGMA 3FCHA 3VAHA 2WSEC 3SSQA 1NPPA 2RDJA 3V81A 1VQKS 3TOQA 2IVFB 3H20A 5D0EA 2DR5A 1WF0A 1L5UA 4MK8A 3CD5A 1U49A 2QT7A 3UFCX 4ZJOA 2EFQA 4K4ZA 2B5JA 3I0RB 2EG1A 1XC9A 1S5ZA 4IO9Q 2W2NP 1ZAWA 3PRDA 1R0AA 3DMJB 1ZPWX 2XY7A 2MB0B 3P4UB 3TEGA 2UV8A 2VFVA 4JI4F 4ED1A 1LWEA 1FE0A 1U8WA 1TV6B 1S0NA 2OO4A 3DLHA 2J9EA 3M30B 4L72B 1ZA2B 4CLFA 1VC6A 1MU2A 2AJ2A 1DAXA 3PVXA 3JSRA 3CCLS 1HFEL 2DB1A 3PV8A 1RWWB 1FD2A 3RB3A 5F9LA 5HP1A 2KYXA 1U0HB 4U8YA 2E7XA 4PAAA 4F36A 1NKEA 3VGUA 2DHGA 4I68A 3MM9B 3ZZRA 5FJ4A 3TI0A 2I1RA 4DR5F 1EQ0A 2J8AA 4JUZA 3W7BA 2E1PA 2XWXA 4K4WA 4ID5A 1BXNA 1HNWF 3SZ2A 3ET6B 2D3ZA 3FEXB 1B99A 4DSLA 1TL3B 2IAJA 4MIAA 1U09A 4LR9A 1IR1A 4B3RJ 1F9FA 1RAOA 2OPSB 2C2EA 1C0TA 4ZVSB 4RW6A 3M9MB 3DLJA 2QMWA 4LR7A 1T02A 4USVA 4Y28C 4IQMA 3PG9A 4LMZA 2WW8A 1DLOB 3IS9A 1N5YA 5F3ZA 2L48A 2BJ1A 4ED6A 1TL1B 3E01B 1HMVA 3K5NA 2VQFF 3BDPA 1GTEA 3D5MA 2ZVIA 2WONB 2CJYB 4LF2A 4OZNA 3V4MA 5IWAF 3VGSA 3NWRA 2OTLS 2PEHA 2DISA 3CXCR 4HH1A 1KR4A 4ZLLA 2VPXB 3U7JA 1LEOA 1LXJA 4LSZB 2DY9A 3M4XA 4CWBA 4GVBA 3EGVA 1KQSR 3W66A 4P10A 3QQCD 5B0EA 1SJFA 1X4FA 2B9WA 2BJEA 5B0DA 5HQMA 5H9EK 4AFFA 2UUBF 5IT0A 3H2LA 4UQGA 2I8EA 2CPDA 1VQLS 1HARA 3IGNA 5A0YA 1JJHA 5EWFA 1DY3A 4QJVA 1U25A 1Y10A 1FEEA 5LJ3Y 3BKTA 1S97A 3JSMB 3CJ3A 1PSDA 4OI2A 1Q4RA 2HLTA 4ECYA 2V4JA 2GJFA 4KBIA 5LT5A 3MUTP 1CJTB 1K73T 2BE2A 2DGWA 2MXYA 4EU0A 2G1HA 3HVTB 3DRYA 2YKNA 2QYGA 3IRWP 3N6MA 5C42A 4ECQA 3AXMA 1WHWA 1O6XA 1FK9B 2R4FA 3C16B 5ETNA 4M63A 1IBCB 4RWXA 1LOUA 2X3GA 1TKTB 3C6TA 2JEIA 3K0JA 5L1LA 4DV6F 1T05A 3BBBA 2J6TA 1M1HA 4ITSA 2RQCA 1TELA 5JUMA 1N33F 2ZDOA 1HBOB 1PKUA 3SSSA 3C46A 5KOXA 4I1TA 2KJWA 3M6UA 4NXNF 2VZ9A 4R0EA 3M05A 4N8NA 3S7RA 3C6UA 2IRXA 4ZP6A 1YHQS 5HLFA 4XAKA 3I82A 2BZ2A 2FLOA 3L7UA 4WXOA 2Z58B 1YSJA 4X66F 1U6BA 2YKPA 3V2UC 1Y00A 1I94F 2FJEB 1HPZB 5FD1A 1PYOB 1YTYA 1UWBB 2DJWA 4DQSA 1ZAVA 2HHUA 4V1Ak 1HWIA 1UFLA 3QWUA 3HD1A 2ROGA 3PYEA 4C9DA 5DQGA 4ID8A 3QT6A 3M32B 3W5ZA 5CZXA 4A8FA 2YNIA 2HK3A 1D3WA 3QZ8A 3KLEA 3PRVA 3R6GB 2B0GA 4HDGA 2YX7A 3AD7C 4EO6A 3CULA 2BABA 2ZE2A 1CS4A 1RQ0A 2FLLA 4ETXA 4URQU 5DM6Q 3M8WA 3OR2B 2BACA 3HJVA 4C97A 2GVZA 1RT7A 1D09B 4ZPBA 4CZCA 3OLAA 2AZ3A 4LIWA 4OI0A 3ZTQA 4GO7X 5KFPA 5J2QA 3DOLA 3A12A 3OFFA 3V5RA 4JI5F 1Y3JA 1U1OA 3J81U 5A76A 2QRRA 1X5TA 5CYQA 4DR7J 3C2PA 1IKYB 2RUGA 4RZRA 1RWVB 4U7CA 3CNQP 4PPZA 2AJFE 4ED5A 4PUOB 4M5DA 4JV5F 1RBLA 1XJWB 1VRQC 2DGVA 2MMYA 2WCXA 1G4CA 4KGVB 1D0EA 3FK4A 3BGUA 1FDBA 4DV0F 4K4UA 4P2MA 2IJNA 2LDYA 3SSRA 2PGCA 4AQYJ 3M30A 2E9RX 3NGSA 3THVA 5B0GA 2BM1A 1U2CA 2PT0A 3OSPA 2JEFA 2PI4A 1NRKA 3POTA 5BYSA 4F4ZA 3NNAA 1YJNS 2XI3A 1EETB 2UVVA 1JIHA 1PO6A 3BR9A 1N6QB 2OSQA 4DR4J 3NGDA 1RWPB 5KFFA 4BC7A 1Y0HA 2XO7A 3D0HE 3NS6A 4DFPA 2RJZA 1J5OB 3GONA 3QO9A 3HP6A 1I5OB 2ILYA 3TJ9A 1AFJA 1NPKA 3EVMA 5J2NB 2QA2A 3CC7S 2HHPA 2BA9A 1D8YA 1F60B 3ET6A 3GFHA 1SJQA 1N8RT 1TL3A 2YPYA 4G1QB 2P2CB 3IWLA 1I3OB 1YWXA 2WOMB 3GSIA 3L7PA 1DRZA 2VPWB 4DU8A 4QYRA 4HHUA 5KFEA 1NPRA 2RVJA 1IBKJ 4LF4F 2DNYA 2G4BA 2BJ9A 1IN0A 4C8NA 1QAIA 4HI2A 3VCDA 1XMOJ 3ENWA 2XLJA 1TKDA 3OJSA 1TL1A 3KJNB 2KH9A 4LFAF 3GG1A 2IVYA 2IJFA 3E01A 3BH7B 2HVEA 4OYBA 3K7RA 4NA1A 1WI8A 2QN6B 4M5GA 3CMAS 3KTQA 2A6MA 1HI1A 2H3EB 2L3MA 2MZTA 2WONA 2ZD1B 1IJEB 3OHAA 3FZBA 4DR3J 3NEKA 4Q2LA 2QSWA 3LOUA 4X62J 4HYKA 1NDPA 3GFXA 3V6KA 2R7RA 3NNHA 4LRFA 4DCJB 3Q8PB 3RBXA 2XZTB 1NK8A 4DS5A 3CGIA 2OLWA 5C5JA 1SIZA 5CH7B 3QJPA 5HN0A 2EXUA 3M8SA 4AD6A 3TVKA 4MKBA 4CH7A 3TX0A 5A2QU 3TUZC 1QSSA 2HFVA 2VICA 3VAIA 3SMZA 4EYHB 4C6AA 1V3RA 4E2FB 2ALZA 2PD1A 2CRLA 2HRUA 1N5SA 2HHWA 1Q1KA 3PM9A 3VVUA 2QLWA 4ZCLA 4F4YA 3HVTA 3S01A 4KR0B 1RI7A 2CQ4A 2E9TA 3LTOA 1LK7A 1F2HA 1YJ7A 3DLGB 4CLUA 3VWSA 1XNRJ 1UL3A 4J9OA 2GMHA 3HK2A 3DGPB 2LXFA 1FK9A 4XIUA 3TAPA 1F5BA 2BANB 3C16A 1Y11A 4JI4J 1IKWB 2KXNB 1TKTA 4LF1A 4YP3A 3VAMA 1VK8A 4CO3A 1KC8T 2OD4A 1Q79A 3AA8A 1XNQJ 3TR5A 4OI3A 4N5SA 2KFNA 1VC5A 2BJ7A 2ZWOA 4KFBB 3SCJE 1HBOA 5DG7A 2YBVA 1Q0NA 4JI3F 4IDKA 2HMIB 4WWSA 3HHKA 4OZ3A 3JSYA 2HFOA 2YKOA 1W25A 4I6YA 4MT1A 1UWAA 1S49A 4FYXB 2MPUA 2H9ZA 5ETQA 3KG1A 5I3UB 1CPZA 1HBNA 1S9EB 2E7VA 1S6QB 3IBCB 2D3O1 2MZQA 2AEFA 1SKSA 4URSA 2VPZB 1QY7A 1UWBA 1FX2A 2XBPA 3BGOP 4YEAA 3UD5A 2BKNA 3KOAA 2AW0A 3HD2A 4Y2MA 4YY3J 4C3MA 2CVEA 2N7YA 1X5PA 3QIPB 1VHFA 3UPFA 3M32A 3W63A 4NI2A 1Q8IA 2IBOA 2C2OB 3LH2S 3Q83A 2C22A 2VFTA 3O6QA 3CC2S 3H5UA 1KHWA 1TVRB 2ZITA 2JH3A 1UFKA 5K9FA 1PJ7A 3GV8B 2Y8WA 5A8KB 4PKDB 1PAUB 1KQKA 2GHVC 2IM0A 2W7PA 3AD8C 3OR2A 4NPOA 4M5KA 1VLOA 5IV4A 1H2VZ 4CCHA 4ZLJA 4YN3B 4DV1J 4D3GA 4QWDA 1MMLA 3J7ZT 2K3IA 1VIOA 2X1BA 1RWNB 1C4AA 2PC6A 4J9VA 5I3PA 2IMOA 1SH2A 3DRRB 3C15B 1RADB 1WG4A 2V69A 4M5NA 3K17A 1JLAB 1IKYA 2HZAA 2ZH1A 1H2UX 3S8SA 4LJMA 3ADAC 1RHUB 3OQ2A 2CZ4A 1FEHA 1QUVA 4PUOA 3HJFA 5J2PB 3VZIA 3M2RB 3FVYA 1F1BB 1OQ6A 2MZSA 3QT5A 4LRAA 2DNMA 1G7CB 2GO9A 3H8YA 3V6DA 3MECB 3CB4A 1HBUB 4F3QA 3FQLA 4JYAJ 3ITHB 2BM0A 3MR3A 1BQMB 2FJBB 3KLIA 1P1TA 2RRAA 4FBUA 2DHAA 1ZM9A 4O3NA 4U95A 3N79A 3I55S 3RRGA 2RILA 2W4DA 4P7TA 1YBAA 1EETA 3RBZA 1VQ7S 1N6QA 2AT1B 2CQDA 4O4GB 2G1DA 3JQKA 4DV6J 3CJ4A 5EWEA 4AYBD 4KY3A 2YWEA 3OTEA 2RIJA 4QYZJ 4ECWA 4XPCA 2ZH3A 1M0SA 1NDCA 5CYMA 4DHVA 4NXNJ 1CULA 1TL4A 4ZLNA 2V2VA 2Y1JA 2VD3A 5KT6A 4RUCA 1YQHA 1R43A 2HVDA 3A3OB 5HVHA 1U1KA 2EPIA 1VLYA 2BOAA 1BGXT 4X66J 5A6PA 1VQMS 4WZMA 4ECUA 4HL9A 3MWBA 3CJ5A 4KAIA 4QIGA 1RWXB 5HAOA 2KN4A 2AWZA 2GW8A 3OVSA 4OZ5A 4GKJF 4C8ZA 3FGVA 4TY9A 3BR8A 2YNHA 4DPYA 2VV5A 3T5LA 4RW7B 4B3TF 1VYAA 2VL1A 3BBCA 1U1LA 3BDEA 2UU9F 1GFWB 2ZD1A 4UUWA 1RA7A 1GXTA 1J5EJ 1X4BA 1CQNA 5ETOA 1SH0A 2E5IA 2JLFA 3ILLA 4RW9A 1RXOB 3DYAB 3W61A 1GMWD 4Q44A 1ZA1B 4J9NA 1FNXH 1X9SA 1FTCA 5K14A 1M5KC 3AJ2A 1IQTA 2R8HA 3R7BB 4BBYA 1R8HA 3BSCA 2VG5A 5KFWA 2DH8A 3UCGA 1NK9A 2F8MA 3EVOA 3EXCX 3MCOA 4EI2A 3NXZA 4JI8J 2L9DA 2CG8A 3M9OB 1VQ6S 2R7OA 2RS8A 1AYEA 3K8VA 1G3OA 5BYRA 5KFXA 4OI1A 2BQ3A 5KFQA 4F02A 3PYFA 3T1HJ 1RU2A 3K8WA 2DEJA 2R8IA 2CZVC 4EFAC 3DLGA 4F2RA 1H6KX 1O8BA 2R7SA 3AT1B 2GMJA 4O4RA 3EZ5A 4FKYA 3DGPA 2XMVA 4ILRA 3QNWB 4WF9Q 2BANA 2W4CA 2IBKA 3LALA 1IJFB 2B7BB 4Q45A 5D4LA 3CJSA 5ITHA 3MEDB 4TN2A 2JFDA 1RT3B 4A48A 5KT3A 1WC4A 2XGQA 2HMIA 4I6AA 1KDNA 4CH0S 1X5SA 2FJXA 4J9KA 2KT3A 2QFJA 3Q22A 2HWTA 1ELOA 2NXCA 5HBMA 2IRYA 4C0BA 5I3UA 4DV5F 1RA6A 1S9EA 1TK8A 1S6QA 2G13A 2BR0A 1BC6A 5D77A 3WHIA 5GAEU 4YMEA 2Z8QA 2YNFB 3O44A 4HACA 3WIUA 2V2QA 3ILIA 3PCOB 3MZIA 3NLCA 3OFGA 1UEUA 5F9NA 3F73A 1AB8A 2M2BA 3UCZP 3QIPA 4JI6F 2R7VA 2GA7A 4EO8A 3R27A 4N8OA 4OHWA 2ZOGA 3S6EA 4YDXA 4CDIA 1JMTA 4A8YA 3LPEA 2MQOA 3AQOA 1FTRA 3T5JA 4FPIA 4ENOA 2FZCB 3WIVA 3IN5A 2ZH2A 1SL0A 5A8KA 3K59A 2ZHAA 2B9XA 2BBEA 4ICLA 5LSLA 2UP1A 3M8RA 3UCUP 3CDEA 1WOOA 1SJ1A 1VK3A 4OX6A 1WC0A 4WP8A 4URGA 4K8RA 4L75A 1FJGF 1WC6A 5IT4A 4K2JA 4WXWA 1RHQB 3MR7A 3ONQA 3MR2A 2JL9A 3F44A 5HK4A 5D4OA 4ANEA 1UJ4A 3C3LA 3DRRA 5ETPA 1RTHB 1S76D 4FP9A 4OZ1A 3G8SA 1S1VB 3DU6A 3I6PA 4I4BA 1HA1A 1JLAA 2NS1B 2GNKA 2GS8A 4IRDA 1EHWA 3RRHA 5GVQA 2E1CA 2XYPB 2I0XA 1S77D 1S59A 4K59A 3M2RA 3OVAA 3TJ8A 1IBLF 2KDOA 2RD5C 2XULA 3LAKA 3MECA 1KRPA 4LBHA 3Q24A 1M5HA 2HZCA 3P5BP 3ITHA 5DDPC 3DLEB 3PW7A 2N3LA 5THWA 2BOPA 2E44A 2PI5A 1UETA 4KH1B 2YTCA 3G6VA 2Q43A 2FVPA 4NRTA 2K2PA 2MQ8A 4O4GA 3MD1A 5D8HB 2RS2A 1OSCA 1WC3A 2QG9B 3IBFB 1VBKA 3D66A 4BC9A 4DS4A 4O44B 3DGVA 2HKEA 2DK2A 1IWAA 3MEKA 1APSA 1HLWA 2RE1A 3GJTB 1S9FA 3TP2A 4NZ7A 3R5GA 3N9UC 2CNLB 4U7UD 4OHYA 1UVLA 4QOTA 4FYDA 2LQ5A 5D78A 1NZ8A 4IH6A 1IXKA 4OV1A 5KT2A 5JXSA 2GQCA 5GMKa 2NQPA 4YB5A 4GMKA 3LP0A 1HNXF 1ZTWA 1UP1A 4DV2J 2VPYB 1H7WA 2ZZMA 3DFEA 2O66A 2YQ0A 1KFDA 4KPYA 4DFMA 1D9FA 4DG1B 3BYPA 3TUIC 1VJQA 4OI4A 2FZGB 3NS7B 1HHQA 4ED4A 5KFIA 4P52A 1GK8A 2MLZA 3DU5A 1VQSA 3UVJB 2H5IB 3FFIB 5HROB 3VTIA 3RB4A 3K5MA 1VJWA 5E7OB 4JV0A 1DTTB 4DL6A 3BSOA 1KS2A 2UUAJ 3DYAA 2GVDB 4RW8B 3ZZUA 2FLPA 1RT6B 3T9NA 4UW2A 3X3UA 3MTJA 3EZOA 2CJQA 4YQWA 3PRBA 2QTWA 1XMBA 3MOZA 3VGVA 4ED0A 2H1YA 3N4WA 3EDQB 2YWHA 3CCJS 2ZJRQ 2FY1A 4XK8C 1CQMA 2DRAA 1S6PB 2R2RA 3WZ0A 3MEGB 3RR7A 1HBMA 5KFKA 1UPPA 5ETVA 4J9RA 1RCOB 4EMDA 3J7AN 4Y65A 1NDKA 2CJ9A 5IM0B 4CLYA 5CAAA 4K5RA 2B8QA 1T94A 5GAHU 2OPRB 2PA8D 2VG6B 2D41A 3MMAB 3NNCA 1HHSA 2LXUA 5E3RA 1FF2A 3UDCA 1RT4B 2C2DA 2HAIA 5HANA 2DBBA 3C8YA 2YPZA 4E98A 3MEDA 1ULRA 4CT8A 3D6FB 4LRCA 4FF4A 4HH0A 4MTPA 1RT3A 4X4NA 3DRSB 1VGYA 3SCKE 2CPFA 1EARA 1KONA 3QGGA 2VUGA 1GMWA 2AV5A 4K50A 2F4VF 5IV3A 2HNZA 3TARA 4A4JA 1NSAA 1RT5B 2ADBA 3OL7A 4X64J 1RGVA 3PX6A 3OTCA 3PHEA 4V19X 1R89A 1T9WA 1TAUA 2YNFA 1N36F 4FF1A 5M2UA 2DXFA 4TQSA 3AQPA 4IKAA 2FY8A 4H4MB 4L73A 1VBXA 5GADI 2OSRA 2NXUA 2FLNA 1FKAF 3G86A 1F9EB 3EGZA 2ZBIA 4O3PA 1FVQA 2G9OA 2OELA 1B7FA 2M5YA 4M5JA 4QWAA 2NZCA 3KJFB 1MMNA 3E3XA 4KV8B 2X3DA 1JX4A 2C42A 4DV3J 4O3RA 3T1YF 2UVRA 2R7QA 4ZVQB 2C2KB 3M1VB 2RU9A 3THPA 4FYVB 4BHQA 1JLFB 3SEOA 3DRPA 3IR5B 1KEKA 4C11B 3BB5A 4NLXA 2OTJS 1NKCA 2BKOA 2WBRA 1TK0A 1U1QA 3R5BA 5ETKA 2PN6A 3RR8A 1Q8LA 1X0PA 5BR8F 2E5HA 1S72S 3DNCA 2BW7A 3CD0A 4CLWA 2X7IA 3KMQA 1S1VA 2BVZA 3A8IA 1PYTA 2IHR1 1U45A 2XMWA 1JXEA 5ETTA 3MTKA 1A0OB 3D7SB 3DI6B 3UW1A 2XZDB 4ED2A 2HLUA 2NXEA 1W7WA 1RU1A 1QDUB 2P6SA 2PFFB 2J6UA 2O5DA 4K4XA 2OFHX 3BO2A 1S4FA 2DNQA 2MKIA 2KB2A 3Q23A 4X84A 2C28A 1QE1A 1RTJB 2KT2A 2JVRA 3CCMS 4WP9A 1OY9A 5L1KA 4KQZA 1FXDA 2N7CA 5KFRA 3L09A 5LJ5Y 1S12A 5L39A 1KLNA 2CQ2A 3HDSA 4WFXA 3Q8SB 2YH1A 4PG4A 4O44A 4UQTA 2LEAA 1N4LA 1QTNB 4FDFA 1FRJA 4DFJA 1EQMA 4QIVA 1MROB 2C3PA 3NAIA 3WBZA 3KNGA 1S9GB 5A8WB 1HQUB 1PJ6A 2NLWA 3K5PA 9RUBA 4H4KA 1FESA 3VR1A 1DBDA 4YB6A 2CFXA 1JXLA 5KT5A 2G2OA 4O0IA 3GYNA 3HHNB 4DR2J 1UPMB 1SKRA 3ILOA 4MMOA 1RWUA 2I9SA 2VC0A 2H65B 3TZXA 4YFUA 2GGPB 3BN7A 4RU9A 2MQNA 2KI2A 4CLSA 2M0GB 2VFUA 2XSJA 1LKZA 1KLMB 3H2VE 4JI6J 3A8JA 2CJAA 2PO4A 2HPUA 2VIHA 3UVJA 3FFIA 5B0AA 3NP5A 3IR6B 4N7TA 3H5XA 2AGQA 1C4CA 1DTTA 2LQ9A 2DNGA 2YQ1A 4H4OB 4EBDA 2GVDA 2HQGA 4RW8A 3RBDA 1H3DA 4PEOA 4F25A 1LWFA 2HQFA 2VJUA 3A1YG 3HHEA 1RP5A 1GX5A 1FJGJ 1AROP 2PDAA 1RAHB 1RTDA 4OV6A 2ZH9A 4RW4B 1DARA 4KYZA 1FXLA 4OHZA 4ALZA 1GNKA 3MEGA 4N76A 2XHWA 1PYSB 4B3RF 2OKQA 1JQGA 4WJBA 1FWLA 1URRA 4C8MA 1LFWA 5KFHA 1UW4A 3R9LA 2V5HG 3FEYB 1HI8A 2XMJA 3UDVA 5IM0A 3W64A 4USHA 3H42A 3KUGA 2V4RA 3SV3A 2OPRA 5J1EB 5HL7Q 1A9NB 1S1XB 3WDOA 2HNYB 3BSNA 5HJYA 3MMAA 1MN7A 1C1BA 4ZK7M 1VRTB 3QT7A 1RT4A 3RJMB 1LWXA 4A8QA 2MY7A 2KU7A 4CLPA 2XZWA 2B43A 5F8IA 1S10A 4MFBB 4OYIA 4ECVA 4Y3CA 3IC1A 4HT5A 3HZEA 4FVMA 4NLTA 3IGVA 1KN6A 2E66A 3M2VB 1T9VA 2J76E 1M90T 2CQPA 4EWTA 3KK3B 2DYAA 2VA2A 2R2UA 2J6SA 1TP7A 1HYSA 4W92B 3QRRA 2GFFA 1Y3KA 3AOBA 4K0KJ 1HQEA 3QWPA 4CIOA 4H4MA 6AT1B 1FDDA 2VC1A 4OYWA 4WZQA 2M8DB 5DDRC 1JLCA 1IM6A 3NOGA 4LF9J 4WIQA 1K44A 2R42A 4TU8A 3GSDA 4OYPA 2HHSA 2FJVA 3KJVB 4IH7A 2AD9A 4KV8A 2ZHBA 5F8GA 3IA0A 2KRBA 4HTIA 3AOAA 1IBMJ 2EFPA 3NCQA 3MI7X 3O2IA 1ZS6A 2F3JA 4RL1A 3F41A 2ZOMA 4S0MA 1JLFA 3Q8RB 2AIRB 3MM8B 4WTOB 3QGHA 2J5AA 4C11A 1GT8A 3IFEA 2A10A 3DC2A 4PWWA 3CIZA 1FDAA 4DN9A 1KD1T 4LQ9A 4F4AA 4ZMMA 5DLFA 5HVFA 5GMDA 2CQGA 2N4CA 3LAMA 4NLYA 3HF5A 2WBMA 3G82B 4PG6A 4NMLA 3PW4A 3DI6A 2KKHA 4X4QA 1MWQA 4WKRA 2VQEJ 4DL4A 4UUXA 3EDRB 2OHDA 3AODA 2P5VA 3DDNA 4CH1A 4DMZA 3GILA 3GR1A 3KFWX 4DV4F 4ER8A 2DGTA 1SKWA 5LMNJ 3TJAA 3WQPA 3OSNA 1X0FA 4ZHRB 3MPUB 2FGCA 2CVIA 3RZAA 1AFIA 4Q43A 2WVDA 2B8PA 3UN3A 2AF6A 1CVJA 4DPOA 1F9HA 3IG1A 1NK5A 4MAKA 1HL6A 1B0PA 1SC1B 3KLHB 2V8PA 3PJWA 3QMQA 2ZKUA 1M5PC 3MPYA 3I31A 2J7WA 1K1SA 1IKVB 4XO0A 4LSNB 2P9CA 3EMTA 3NWGA 3HFZB 3NS5A 2XO6A 2V9WA 1S9GA 2XCPA 5D3GA 4QPTA 1HQUA 1PG5B 2QA4G 5A6WA 3N5FA 4LT6A 1RABB 1REVB 3ULHA 2RSQA 2AYBA 1GMUA 4FF2A 4JI7J 4DR7F 2PSZA 3DOKB 4HTJA 3CEDA 4ZA1A 2EFNA 4QW8A 3GYXB 5E3QA 2Z56B 4KKOA 3KK1B 2XM3A 1S6UA 1N36J 4I2QA 2W9AA 1RE1B 4IUFA 1OPIA 1CC8A 2G2YA 1DHMA 3ENVA 2GGPA 2WHOA 4V19J 3TAMB 3OD2A 1LNQA 1RKIA 1Y5LB 1KLMA 3WC2A 3V6HA 4P7VA 2LQ8A 4P2XA 4ECSA 1O51A 4P2SA 4C98A 4B9SA 3GP9A 2XS2A 2FTRA 2VA3A 4BDPA 2ZFHA 5F3TA 1VHIA 1H0HB 4HI1A 2QYCA 3T1YJ 1Q16B 4CLTA 4RBVA 3NAHA 4JI0J 4H4OA 2OI2A 2W7AA 1UVMA 3AXKA 1VQPS 5F8JA 4LFBJ 2HHTA 2RB7A 1KQFB 2V4QA 4DCPB 2LQBA 4TNOA 4EBCA 3M6XA 2GV1A 5KG3A 3W2WA 2ATLA 3MCMA 1IM4A 4OJ1A 4IFYB 4NRUA 3G9CA 4ECXA 2DXDA 3WX8A 2EKYA 2XY5A 2B4UA 3J7Z5 3G6YA 3ZC4A 4Y0FA 5BR8J 1EJ7L 4Z7YA 1TKXB 2R8GA 3KWMA 4RW4A 3W9HA 1EX8A 4F50A 2C2NA 3ELHA 2MQLA 2XS7A 2C1EB 2EKNA 4FNIA 4J9SA 4G1IA 4U8VA 4RUBA 2ZBPA 1TFWA 4DJBA 1IBKF 1JKHB 2FJAB 1OS5A 5D0GA 2KHCA 1QTMA 1T9XA 4OX9J 5A2QY 5DG8A 1XMOF 1U47A 3ETOA 1LW0B 3A3PB 1S1XA 3CDWA 2HNYA 3TQEA 3PX0A 4NCBA 1OQ3A 2UXDF 1YKWA 1B0TA 3E2EA 1VRTA 3QPIA 1IVZA 1CBKA 1VQOS 5D15A 2GCFA 1GX6A 1WACA 4NLSA 1NK4A 3CDBA 1O5JA 4WFAQ 4X62F 4MFBA 1H74A 4WKYA 3PFOA 1K47A 1WEZA 2IJRA 2DEIA 4IG3A 1UA1A 2MDAA 3HMJG 3M2VA 5GAGU 1E6YB 1MWYA 3AD9C 3KK3A 3UQSA 4R5PB 2A1BA 1T8EA 3JS9A 4C3KA 2B56A 2XTJP 3T3FA 3MR5A 1CJVB 1NJWA 2JX2A 3HI9A 4EZ9A 5CQGA 5B09A 2AMCB 2A18A 1RLDA 3KDOA 3W9IA 5F8NA 3NMAA 4OJGA 2OUGA 3D28A 1GAOA 5KOWA 3OL8A 1NU4A 2OAUA 1FCAA 3EYZA 2OP5A 3SDEB 1KBRA 3HSJA 2UUTA 3OFEA 3D0GE 3M8QB 5K8NA 1DTQB 3N6LA 4OL8A 1BQNB 3KJVA 1VCTA 1XNRF 3DLKB 2DT9A 1OPZA 4OYOA 3MM7B 5IC4B 2OMLA 4F4XA 1X4CA 3KLVA 3OTOF 4KRWA 4UOHA 4NLPA 2VJVA 1WORA 1SCJB 4CO1A 4PXEA 1RTIB 3HULA 2G2ZA 3MM8A 1XNQF 1ZM2A 5KG1A 1JLEB 2OD6A 1WI6A 4WP3A 2YNGB 3UDEA 5BYQA 4R25A 1YG0A 2RDDA 4ZCKA 4QU7A 1TAQA 2LEBA 4NASA 4Y34A 4KHMA 3TA1A 1QVGR 2QL7B 3PJ9A 2WVBA 1OO0B 5H9FJ 2O01C 1HR0J 3G82A 1RAFB 3MMBB 3U1NA 2BUNA 4MYUA 1RT2B 3HPOA 3B78A 5DZ6A 4JP8A 3PR5B 2GIQA 4YY3F 5T14A 5AE2A 3EJMA 3QLHB 5KFTA 4KJIA 4K5SA 1HWUA 3FUYA 3QJJA 3IP0A 3IRXB 2N4DA 2AP6A 4I0WA 3N28A 5LSRA 3PIPQ 3SQGB 3GB0A 5K8MA 2HIYA 1FE4A 1XERA 4J91A 3ISZA 3DHWC 2V6AA 1JLGB 2IYIA 2NYIA 2CDQA 2WVEA 3KLHA 2DIVA 4K4SA 5K20B 2V94A 3TZZA 3ZZZA 4G3IA 5EWGA 1YJUA 1BWVA 4AXIA 4DV7J 3HKWA 5JJBA 1IKVA 2RNEA 2NUHA 1LW2A 4GO5X 4LSNA 2JJ4D 4DV1F 3ENAA 4FF3A 1NO8A 1TMMA 2FHJA 2MKHA 5AE1A 1REVA 3PNIA 2MZ1A 4B3SJ 5EHHA 3DOKA 1UCNA 2KL8A 1S4EA 3ZNJ1 3BV8A 2POKA 2B6AA 4CP5A 4ZVRB 3CTRA 2Z0GA 3ENQA 3KK1A 1UVKA 1EKSA 4ZPWR 3HXMA 1SV5A 3UD3P 8ATCB 1VDHA 1SQEA 1U1NA 1FRHA 4A47A 2DNLA 3DRXA 1MNEA 2GMLA 2CPEA 4AL6A 4DR6J 4X4PA 2KTQA 4PR6A 3UR0A 1RHRB 4RWWA 2CJXB 4FYYB 1G2EA 4JYAF 1JLBA 1NAQA 3HHLC 4KIAA 2A2DA 1TR0A 3LF0A 2RRBA 1U2FA 2DITA 2DGUA 2MY8A 1M1GA 1ZAXA 3GJRB 3PXGa 4ES2A 1XR6A 1KFSA 2UXCF 4LF8J 3B8HA 3JTNA 2XMMA 5KFVA 2BE7D 2J9DE 2W9BB 1EAYC 3TZYA 4AMPA 2QSFA 4B3MJ 4ZVOB 3FMWA 1NDLA 4ELUA 5F8LA 4EUVA 5IC6B 4ZIWA 1R7IA 2Q79A 3Q2SC 4NA3A 3LP2B 2F63A 4OI6A 1RACB 3KLGA 3DDKA 1NMEB 3K2YA 1XN9A 4PG8A 4P72A 1TTHB 1X9WA 4DOZA 4OLOA 3R2CJ 4ES3A 1FFSB 3KLFB 4M95A 3MAQA 1RB0A 3M8YA 1PJ5A 7FD1A 2HBRB 2HHHJ 1RHMB 3EICA 3M2UA 1RAJA 3CC4S 1JJ4A 4MK7A 4Y2CA 3D6HB 4UT4A 2KXHA 3R6LB 1AUDA 1JK9B 4RNNA 2I2YA 4USJC 2NR0A 2H5JB 2V8VA 5G0RB 2ASDA 5DQHA 3GIIA 1LW0A 4FNHA 1CC7A 3OFHA 1HNVB 3W9JA 3P45B 4DV4J 3Q2TC 2GHWA 1LXNA 1XWLA 5KG4A 4XPEA 3G6XA 1D8ZA 2GX8A 1PILA 2MLXA 3K58A 1FDNA 2MQPA 3QYYA 4CYUB 1J5EF 2JLGA 2L41A 1Q95G 2J0QD 2MEWA 1LWCA 4F26A 3OLBA 3PX4A 5EUHA 1T95A 2ZZNA 1KVKA 2YWGA 4TXSA 1EZZB 2JEGA 2XMUA 3SBMA 2DNRA 1FNOA 2W2OP 3ETMA 4FYWB 4I2PB 5L1JA 5F0UA 5FDLB 2DNZA 1E6YA 4UTGA 2LLZA 4OZ0A 4JOUA 1CJKA 4R5PA 4BWJA 1OMSA 1W2BR 3BGRB 2YXLA 5MAOA 5U47A 5CZCA 2F4FA 3CJ8A 1CJVA 4DPUA 2CXEA 3TAQA 4JI8F 2DD8S 4WYLA 2FC9A 4DR1J 1WG1A 4M5IA 2NYHA 1VR6A 2ATCB 2YWWA 4RKUC 5IZHA 8RUCA 3FCVA 4G6VB 3FRYA 5C2GA 2ASJA 1YLXA 3D68A 3FMBA 1L3SA 2CA9A 5HQ8A 3T1HF 2V8HA 3I0RA 3M8QA 4P2FA 3ZTPA 1BQNA 2CQ3A 4USMA 4YHHF 3VALA 1FXRA 3DLKA 2QE5A 4QIWD 2GO8A 2YKMB 3DMJA 5IT9U 3MM7A 4QIEA 2MKJA 3CD7A 2QMXA 3QZ7A 2KG1A 4DLEA 1U6FA 2A0FB 4DPWA 3KG4A 2HRYA 2LMIA 5B0FA 4OHXA 1TV6A 3MAHA 4ATNA 4HVZA 4YR2A 2M9KA 4B9NA 1RTIA 3MMCB 5L9XA 5L46A 3KKFA 4AL5A 3T6JA 2KFZA 1JLEA 4ZPTR 1S1TB 3CD6S 4MKVA 3SV4A 3C66A 1U0HA 2EG2A 2RQMA 2BV3A 3SFUA 3W2VB 5I42B 3MXHP 3MM9A 1Q53A 3K89A 5C25B 4X4UA 1M1KT 5BXIA 3BZQA 1R0CB 4DI6A 4DX8H 4DQIA 3KUHA 2CJKA 4RUHA 3DKDA 2W24A 1F0XA 4OLPA 5E2QA 4DX7A 5CA5A 1XQIA 2V9KA 4CLKA 3BREA 1RT2A 4JBCA 3V81B 1S0MA 2CPHA 5D6GA 2JLEA 3UDLA 3BO4A 2OPSA 1X4DA 3RYLA 5IOLA 4HHHA 2ZC4A 1CLFA 4ERDA 3CCTA 2DRDA 4DFKA 3IRXA 4YOEA 2Y1IA 4MIBA 5DZ7A 4HLBA 2ILZA 5AXNA 3SQGA 1DLOA 4ANDA 5KFZA 2HQDA 2HEKA 4MKYA 3A4TA 2AX1A 2XNRA 1JLGA 1JB0C 2DGOA 4I7FB 2C2ZB 4MYTA 2UXDJ 2KRRA 2Q66A 2XMKA 3ZTOA 4J9UE 1R31A 2P6TA 1UVNA 2ZUGA 2VASA 3NGTA 1MU2B 4Z7CA 1YITS 4O3QA 2QC3A 2JNJA 1QVFR 4X65J 4TU7A 1Y9OA 3SQOP 5E41A 2Y3YA 3EVWA 1SL2A 1QAXA 3LP1B 3FSXA 2FYXA 3H7HB 2ZWPA 2FJDB 1WDDA 3HSGA 2F5GA 2Z2ZA 4H4KC 2AJ0A 2MKCA 1MW7A 4AMNA 5KFLA 1SJRA 2CZ9A 1IUJA 2IM1A 1V5VA 1VIXA 4G1PA 3JSMA 2MJNA 1V5IB 1QD1A 3JAMU 1YJVA 2WVCA 2XCAA 3MPWA 6FDRA 4J9MA 1CJTA 2W2QP 1X60A 1RAEB 3RW7A 1C0TB 4TU9A 2OEKA 4PPDA 1XTZA 2HWIA 1H2TZ 3EX7B 2SXLA 1YRXA 4Y00A 1N5YB 2M7SA 4N77A 2Q6CA 1D9AA 3R7SB 1NH8A 2W9BA 4HR2A 2ZH8A 2DR8A 3LGNA 3SXLA 3OTOJ 4RUAA 2HFZA 4BS2A 5LM7E 2JC0A 5B0CA 3HT0A 2YWFA 3P96A 2IA0A 2K7KA 3IM8A 1XMQJ 4CM2A 2XYGB 2MJUA 1Q82T 3LUYA 4M94A 3LP2A 4IOAQ 3Q86A 1OJ4A 2CJBA 4J37A 1KQGB 4K2XA 1VMBA 4WFBQ 3U1MA 1SVDA 1FFGB 3KLFA 2B4PA 4DSKA 5HO4A 3TQ1A 3CCRS 2UUCJ 4IO1A 3T19A 1P27B 3D1HA 3RU0A 2IDLA 2L08A 3DLBA 1HPZA 4AMOA 3CO9A 3HKZD 3KMSA 5G0RA 4DV2F 3PR4A 1OYDA 3PTWA 3HSDA 3LGMA 1FRIA 1X8DA 2A3JA 4USTA 2ROEA 4PCQA 3BQ0A 5LSOA 5J2MB 3L7OA 1VQ9S 3HO1A 3VAGA 2X1AA 2HS0A 3A8KA 5AXKA 1L3UA 3F56A 3I9ZA 2DO4A 4CYUA 3RAXA 2DR6A 5HMXA 4FXVA 4CO4A 4NXMJ 1NSQA 2WW4A 1KP6A 3GV7B 1RK8A 1KTVA 1MLAA 2UUAF 2MZRA 2JOQA 2ZH7A 2EFGA 3AY0A 4I2PA 5FDLA 3TA0A 4X4SA 3MCSA 3GV5B 3O8WA 4Y2KA 1FKOB 2Q6BA 1YVFA 2M4MA 3GFYA 3RAQA 2YKAA 4PXBA 2HQIA 3PW2A 4ZVEA 5H9EJ 2NXNA 2DGSA 2DPIA 2HURA 2KXFA 2QIFA 2O1PA 1YZ6A 5ETLA 2PMHA 2HHQA 4EYIB 3N01A 2CDRB 2FVQA 5KG5A 4WFNQ 3I5CA 4ECTA 4GKKJ 6FD1A 4NWBA 4DN0A 1T7PA 4ZKAA 5KFUA 2ZBRA 2VU5A 3THTA 1WEXA 3ZTSA 3VQTA 4CNYA 2IC3B 3C19A 1QJHA 3BYRA 2X51A 4OZJA 2EBGA 2LU2A 2XLIA 2HRTA 2CG4A 4DZ6A 1MWZA 4Y2AA 3CUNA 2ZJPQ 2KVQE 3CDAA 3MEEB 3H5YA 3AJ1A 2OH2A 2JVOA 2XMAA 3FRZA 1S1TA 1ZETA 2NSCA 2UXCJ 4CT9A 3TZWA 4TKTA 1HW9A 2NZ4A 3KHLA 1NJYA 1X9MA 3CF5Q 2HBZB 2IRUA 4QR0A 1G1XA 3KLEB 1XK8A 3W2VA 1UJ6A 1WOSA 5I42A 2HFSA 5L9NA 1J5OA 2AYGA 1NNDA 4EZ6A 3KNAA 4DL2A 3OTBA 4ZP7A 5HMZA 1BMQB 3G2XA 5J2NA 4X64F 4ZCMA 5KFSA 3KK2B 1T3OA 3HT3A 4A8XA 4LR8A 2WSFC 3Q0AA 3FSYA 2J9CA 5J2QB 3P6YC 2VFRA 1NB2A 2ACYA 4G1QA 1UZDA 3GTYX 4CO0A 2WOMA 5HQLA 4ZPVR 2M52A 5DG9A 2HQCA 3UN2A 5CYQB 2Y1RI 2G0CA 4C3LA 3E51A 2DR9A 3UE2A 2W25A 2WB1D 3U1LA 3TA2A 2F8HA 3BJYA 1PC4A 4AUKA 2E29A 4M5DB 1KWMA 1WSVA 2OGUA 4NMXA 2Z57B 2CQCA 2CQ0A 2ZH4A 5KFNA 4DV3F 2DR7A 4I7FA 2AU0A 2H51B 3HHDA 3GQCA 3AH6A 1VQYA 3J7YI 5LOQA 2GJ2A 4N47A 3OJUA 2F1FA 3LANA 3PACA 5CD4H 5DM7Q 4KH0B 1WKKA 4NLOA 4USIA 3N6NA 1RHKB 5C24B 3POTB 3D67A 1ZPVA 5DJBA 4ZVGA 3W60A 2CPZA 3JSBA 1NK0A 5KFGA 4F0KA 3R5DA 4KT0C 3LP1A 1A6LA 1CSJA 2XC9A 2VBZA 1V9OA 2AKWB 3TEHB 2EI5A 3QRQA 3OVBA 3QO9B 2HVHA 5EDWA 4NYPA 2VDHA 3NKYA 1M5OC 4CNZA 3M6VA 2GIFA 2V34A 2DH9A 5ADZA 3OUYB 3R2DJ 1NZAA 2P9GA 2KVIA 4OYZA 4K4TA 5SUHA 3NGRA 1TL7B 2OIHA 4L3NA 2U1AA 4ZP9A 2KM8C 3EGWB 1SC4B 3TUJC 2VB6A 4KSEB 2MQMA 4YHHJ 1FVSA 3G71S 4NLVA 5E3PA 4B9LA 3HSZA 2LKZA 2B4VA 1JJCB 5E0OA 2HZVA 2QZ8A 4EEYA 1IKWA 3PZPA 2C3UA 1HNZJ 1H38A 1B70B 4FXWA 2QA4S 2IIHA 2WSCC 3J7YU 4XDDA 4KFBA 1NBEB 2ERRA 3QT8A 5B7WA 4C8KA 2NPFA 2H54B 1PBUA 1U24A 3TWZA 2D7SA 4LQ3A 4DSFA 4DLGA 4DQQA 3GJSB 3N5BA 4DR2F 2ZHOA 4LFCJ 1RWOB 1U48A 1Q5YA 1Q7YT 2E5LJ 2ZJQQ 1Q8KA 3QGIA 4OIXA 3LGHA 3ZZTA 2R7UA 4GC6A 4YR0A 1R6YA 5F8HA 4N56A 1OYEA 2RKIB 5J2MA 5CZVA 4GRSA 2EC2A 5E3CA 3W65A 2KYZA 2Q1LA 1TVRA 4IH5A 3HCXA 3W5XA 2I6WA 1PGZA 1VQNS 3R1LA 2LFVA 2KFYA 4FN5A 4RO0A 1NJXA 3CO0P 2E1RA 2MKYA 2ALYB 4DL3A 5L38A 2QO3A 5B0BA 1Z1ZA 1I6JA 4B17A 4O3SA 3IAS9 1A7GE 2UV8G 1FKOA 1S79A 1YIJS 5C7PA 4LF7F 4YDDB 2DKOB 4ZS6A 4LIRA 2V2KA 3OTDA 1FO1A 1GXUA 3N0VA 2AGOA 5KFBA 3C15A 4IDKB 4WE1B 1JJ2R 4D3HA 4QYZK 4PYAA 1B3TA 3GFZA 4DQPA 2YKQA 4ZOSA 3IWNC 3GYGA 4USKA 5KT7A 3VVTA 1HBNB 2AJQA 2MZJA 4RBUA 3SFGA 3D9BA 4L76A 3CCUS 2W8LA 1NSPA 1ZZFA 1VOMA 3L95X 5DQIA 1DJ0A 2VG7B 5J2PA 3L3CA 2V63A 2YWKA 1I1GA 2DGQA 4B3OB 3UNYA 4DQRA 2X1FA 2IC3A 3KHHA 5LL6d 1FWPA 3GIJA 2VOOA 1HBUA 2VBXA 3BN4A 3GPAA 4PG7A 1BQMA 3RB0A 1B7YB 4A8OA 4EGLA 2UXBJ 4NI2B 2BKPA 3MEEA 3H98A 1H72C 1HKAA 1BD6A 2JZ5A 4L74A 1P9QC 3PFEA 2FQQB 5AXMA 1BY9A 2BQUA 4QBUA 4ELVA 2PE8A 5KFYA 4LF6F 4Q7AA 4DEZA 1S48A 3PEHA 1S0VA 2B7CB 5D4PA 2L9NA 2HHVA 1FI4A 2AEJA 1JNRB 3H5SA 5JVGQ 1R0BG 4ZCIA 3ISNC 1YJ9S 1WKLA 3KK2A 4K0KF 5AJ3J 1T03B 3Q89A 3WX4A 4F0MA 4FZVA 1S7HA 1S7IA 3DXSX 1FWKA 2LEPA 4DZDA 1BHNA 5K8PA 3KUEA 4J7CA 4O0NA 1X5OA 1K9MT 2NPIA 2M70A 2PFDA 4LF9F 1HWKA 2AHOB 1SL1A 4J90A 4NYZA 4DL7A 5KG6A 3MPDA 3AB2B 1DZ5A 2UZAA 2WK4A 4C4WA 2LQJA 3OHBA 3T5HA 1X31C 1LFPA 3NG8A 4U9RA 2RRNA 4RW7A 3BKUA 2VDIA 1IBMF 3V6DB 1B4SA 2CWXA 2V8DA 2MQQA 2WTFA 2YY3A 3KLIB 2VZ8A 4WYWA 4QPXA 2JRSA 3MAAB 4NL5A 2LCWA 4ZN1A 3VAJA 5C24A 4UZCA 1NLKL 2PMWA 4MKAA 4BLGA 1WHXA 5J1NA 2BJ8A 1J2VA 1WG5A 2H4WB 5JMNA 3VV2B 3CMES 3T6BA 2VKZG 5IFMA 2RHQB 4WCEQ 1TFYA 2Z2LA 2FHMA 3J80U 4NYOA 3DOMB 2LU1A 1XBWA 2KG0A 1K0VA 3OT9A 5CYMB 1F5CA 3P5TL 3CJ0A 1RLCL 4WTYA 1VI7A 4JV1A 2VQEF 3OUYA 3G87A 5ETRA 1CULB 3FSIA 4NEZA 1TQLA 2AYEA 2LYVA 2UVWA 5KFJA 1RBOB 1TL7A 5K5MA 2FHOB 1RWMB 5LMNF 5LMUJ 2DCLA 2AYMA 4PQAA 5KG7A 3VQSA 4X2BA 4DBQA 2JFKA 2GHPA 2JDJA 3MFIA 3HVAA 2H5EA 5KFCA 1F6TA 3R5JB 1UKUA 3FBBA 3JQMA 3BGLA 1DQAA 4WU2A 1SC3B 4AL7A 2Y1LB 2YNHB 4M8LA 3M8ZA 4MJKA 3PO5A 4JV2A 4ZVUB 3MFHA 4KO0B 1WD6A 1YDLA 4Y6IA 1R27B 2OEJA 4NE9C 4F7VA 3MM6B 1TK5A 2HBYB 1FX4A 1N56A 1F3VA 2B3TB 2J0XA 4Z37A 5FLXU 2ABYA 3QBCA 1WF2A 2D1CA 3HZGA 1B0VA 4IRCA 4Q0BB 2KO1A 4RW9B 3QSIA 2K1RB 4B9MA 1HIYA 3A13A 2VHGA 4JI7F 2BQRA 5K14B 1M5SA 2ZM6J 2MYFA 4TY8B 2CNOB 1WNEA 4LBIA 1X7VA 5EX3A 2XI2A 2EEYA 4L6V3 2VG5B 2XWYA 1X4AA 1QAJA 3OL9A 2XNQA 3B6BA 2VH7A 1S1UB 3NMRA 3UN5A 2VBWA 2B4OA 4DUZF 2RKIA 1N5QA 2JWNA 3QAUA 4C2MA 3FBCA 4CRJA 4IG0B 2UVUA 2MLYA 1U26A 3DM2B 3NGKA 4UY85 1GMVA 2D9OA 3R3TA 1LK5A 4LUBA 3T9ZA 4ZP8A 4I56A 3V6JA 4KHRA 3KHGA 1JLQB 4RPFA 3VAKA 1S0OA 1SC6A 3DDIA 2QFIA 3QSYB 4F3OA 4MH8A 2OEMA 3BS9A 4F4WA 4ILLA 4JI0F 3B4DA 2ASLA 3BPDA 3OXFA 3FJ2A 4LFBF 5AE3A 3HFVA 1XIQA 3MOJB 1KNZA 3JXOA 1Y4ZB 4ED7A 4PXDA 2NCKL 4KGKA 3NL0A 3SIPB 2FPHX 1SXLA 3O3LA 1UMJA 3H25A 2W9CB 3FZ2A 3B4MA 1RTHA 1IR2A 4WE1A 2Z4PA 4ZDNA 3OXGA 3KJQB 3BM7A 3LPYA 2ACMA 1FRLA 3B82A 1RISA 3AJDA 4DR5J 4O3OA 5A8RB 1CJUB 5HBMB 1ZM4A 3OR1B 3BF4A 4AT1B 3G4SS 2ZUAA 3I0SB 2VOPA 2IA6A 2VG7A 3J7A1 1HNWJ 4QIFA 1YRTA 4OX9F 4HACB 5AT1B 4B3OA 2V68A 1CEZA 3ZZPA 2C2MB 3GE9A 3CJTA 4CTAB 2B9YA 3NBPB 5D0HA 1FERA 2X1GA 3DLEA 5GADU 1AXQA 2CPIA 3EXYA 4WK3A 1DFDA 3GIKA 4UOFA 3TVZA 3PKMA 5M2PA 4P73A 2QMUB 2EBEA 3G6ES 2IY5B 1FT8A 2O67A 4MIWA 4DX5A 2LA4A 3EE3A 1N0VC 2VQFJ 4USWA 1FRXA 9ATCB 4C7QA 3CCVS 4A46A 1G6BA 2EC0A 4ICLB 1UZHA 2C2RA 3PW0A 4NLQA 1L3TA 2HVZA 5T7LB 4NCGB 5IWAJ 4W90B 4UZBA 2BRLA 3IXQA 4ZVTB 1HNIB 3GCXP 1H7XA 4WU3A 1SJ3P 1T03A 4C48A 3CCSS 3VZHA 4QCLA 1BLUA 2NXJA 1TUWA 3ZO7A 4FVCA 4OX7A 2CQIA 3RRKA 5IS2A 3CCWA 1H98A 2UUBJ 2P8IA 2GQ2A 3RUBL 5SZTA 2DGXA 1RWKB 3CSKA 4ED8A 2DHSA 3FC9A 1YK9A 2J7KA 2MGZB 3Q8YA 4RNMA 3HHLD 2IDEA 2AGPA 5HJXA 2DO0A 3RTVA 4DG1A 2XLKA 2DCUB 5G4DA 4E0DA 4LF5F 1R8PA 2BW2A 3OL6A 4WFYA 3NCPA 1KTQA 2CWKA 2IVMA 2CQHA 4M5HA 2KHDA 2CKWA 4HEA9 5HROA 1S57A 2J7UA 2RH3A 3MAAA 3CPWR 3GIRA 3H4BA 2VODA 2ZBCA 5L8RC 2FB0A 3TX8A 3OBIA 3GLJA 5HI7A 4CLLA 1RT6A 3QRPA 4N41A 2APOA 4ETZA 4FBTA 4LF7J 1ZBTA 2EK1A 1GH8A 4DF8A 4WFZA 1C2PA 5DLGA 1IWGA 3DOMA 4QQBA 1N33J 1HR0F 2GAGC 4OHVA 1X4HA 2WB4A 2I5JB 4C0OC 3IO1A 2LECA 1N52B 3I4HX 1S6PA 4PWDB 1UAWA 4NLDA 2J9DA 4ZVHA 3M6WA 1D1UA 2LXIA 2QL9B 3W8GA 2BRKA 2RAQA 1AUSL 1GEHA 4RU2A 1XEZA 1N34F 3T41A 4OZLA 1VBZA 4NLWA 3UWTA 2DPJA 3IMQJ 5KTQA 2LP4A 4FXDA 1I94J 1ZOTA 3MHYA 3LP0B 3KYLA 1U8SA 4HDHA 3BPSP 4CO5A 2GJIA 3QAEA 2CYYA 2V8GA 3HHLB 1UEKA 2VG6A 3LWMA 4U96A 1FRMA 5I3QA 2D3UA 2RUSA 3AFGA 2QJ3A 2E7WA 4DV7F 3O5TB 4KO0A 4A8MP 2MSTA 2E1MC 4A8SA 1KHVA 3UO0A 4DU7A 1NH7A 3MM6A 3DRSA 4ZVFA 3AOCA 1N88A 5KFOA 4LF6J 4DL0C 3R1HA 3D4JA 4Q0BA 3D2WA 4ZPAA 4LSLB 4QR1A 3MUMP 2K1RA 4NLGA 1Q5VA 4B3SF 4W98A 1RT5A 1YZ7A 3KDNA 2E5JA 5GAEI 1SBRA 4TY8A 2V2ZA 4ZN3A 1X4EA 4CM0A 3W3SA 3JTPA 3OPKA 2RU3A 3I96A 4C8YA 2AQ4A 4JI5J 3W1YC 3NCRA 2F8EX 4DR6F 1S1UA 1YJRA 3PEJA 3AB4B 3L4BC 4P71A 5B08A 1HBMB 2CQBA 3EPGA 4ZJQA 2Z2YB 4DXLA 4IG0A 2EWHA 2HK2A 2WZ1A 3DM2A 1ZH5A 2J0SD 4JV5J 2KZMA 1BQXA 4ELTA 4OYAA 1JLQA 2XEXA 2H4YB 4LF8F 1SQGA 3M1VA 3D6MB 2QL5B 2MKSA 1RTZA 4KHPF 4RLEA 4CO2A 3VAFA 4DV0J 4B3MF 2EK6A 1URNA 2OPQB 4RNHA 3MD3A 2IMWP 4OYXA 2XSFA 1ACMB 1FD8A 3IM9A 3GZ7A 4IR9A 4NEYA 1WKJA 1S99A 2H48B 1R6VA 4L3KA 3TNVA 4RNOA 5F8MA 2W9CA 4E8UA 3TO8A 1DQ9A 1NB7A 1U1PA 4P74A 4ZPDA 2HS3A 2KZZA 1QM9A 3FQKA 4YB7A 5A8RA 1CJUA 2HHHF 2HNZB 3OR1A 4ECZA 4X4TA 3I0SA 3NOCA 2R8JA 4U6PA 3RG6A 3TRGA 2BYCA 4I67A 1Q81T 4NLUA 4QWEA 4CTAA 3H90A 4C8OA 2E5GA 4IR1A 4X4OA 3NBPA 2CQ1A 1N32F 4ILMA 3C14B 3GWCA 1YBUA 1RSCA 3LA0A 3R8YA 2DY1A
chains in the Genus database with same CATH topology
2QC3A 2JFKA 2G2ZA 4QBUA 2JFDA 4RR5A 4AMNA 2H1YA 2G1HA 4RL1A 3TZXA 3TZWA 3HHDA 4AMOA 3TZYA 3IM8A 3R97A 3TQEA 5DZ6A 4AMPA 2QJ3A 3RGIA 3CJ8A 3SBMA 3TZZA 4AMMA 3BV8A 2C2NA 1NM2A 3EZOA 3G87A 2G2OA 3QATA 3K89A 3PTWA 2CUYA 3HJVA 3R8YA 1MLAA 5DZ7A 3IM9A 2G2YA 3H0PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QC3 A;  2JFK A;  2G2Z A;  4QBU A;  2JFD A;  4RR5 A;  4AMN A;  2H1Y A;  2G1H A;  4RL1 A;  3TZX A;  3TZW A;  3HHD A;  4AMO A;  3TZY A;  3IM8 A;  3R97 A;  3TQE A;  5DZ6 A;  4AMP A;  2QJ3 A;  3RGI A;  3CJ8 A;  3SBM A;  3TZZ A;  4AMM A;  3BV8 A;  2C2N A;  1NM2 A;  3EZO A;  3G87 A;  2G2O A;  3QAT A;  3K89 A;  3PTW A;  2CUY A;  3HJV A;  3R8Y A;  1MLA A;  5DZ7 A;  3IM9 A;  2G2Y A;  3H0P A; 
#chains in the Genus database with same CATH topology
 1RTJ A;  2K8G A;  1NKB A;  2F40 A;  3BO3 A;  2D74 B;  3CT9 A;  3GCW P;  4LF4 J;  2HSE B;  2J0W A;  4PQU B;  2M8H A;  2DNO A;  1NJZ A;  4J9P A;  4LFA J;  2IFX A;  5KT4 A;  1UFW A;  2RDI A;  5IT9 Y;  4NA2 A;  4LBP A;  4JI2 F;  2FUG 9;  1EP4 B;  3D3B J;  3D6T B;  3MDF A;  1UVJ A;  1MRO A;  4ZJL A;  5CXT A;  2W7O A;  3DRP B;  2HVI A;  3GU0 A;  5T7L A;  4NCG A;  2Q3P A;  3H0P A;  2ZH5 A;  5A8W A;  4F8R A;  3MCN A;  1HNI A;  2PA3 A;  1P9Y A;  2XGP A;  3TW0 A;  1OWX A;  1SI9 A;  1T9Y A;  2XYH B;  3HVR A;  3CCZ A;  1SH3 A;  1PBA A;  4DR1 F;  5C2C A;  4I69 A;  4OJ3 A;  3H59 A;  3Q8Q B;  1VRU B;  1FFW B;  2KT5 A;  1E6V B;  2PII A;  1HHT P;  8AT1 B;  4K4Y A;  3M7V A;  3T1A A;  3EZU A;  2BMB A;  5GME A;  1EB0 A;  5CCL A;  3US5 A;  2C3O A;  1Q8B A;  3DCA A;  2W2M P;  2HQ3 A;  3QAT A;  3LO3 A;  4NLR A;  3BBF A;  4Y2I A;  2MGZ A;  3FDS A;  4K7Q A;  5CD4 A;  2QV6 A;  2DRB A;  1U0S A;  4DUZ J;  3RBE A;  1REG X;  4IYQ A;  4UOG A;  2IM2 A;  3ZNU A;  2GIR A;  2VON A;  3CJR A;  3PDN A;  2V67 A;  4TVA B;  5IQ6 A;  1QE1 B;  1NK6 A;  1RAA B;  1WJ9 A;  2OJ3 A;  3RB6 A;  4R8U B;  3BEG B;  2V0N A;  3Q8U A;  4NX9 A;  3ZTR A;  3UD4 P;  4XDC A;  2F7V A;  2ZC3 A;  5AXL A;  4F2S A;  3H40 A;  1ZZN A;  3HFK A;  1WHY A;  4C0H A;  2EFV A;  4TYB A;  3VHQ A;  2HGM A;  3CIM A;  5KFA A;  4YR3 A;  2DVI A;  3IAM 9;  3SYZ A;  2HWH A;  3UNG C;  1HI0 P;  4FS1 A;  1WF1 A;  3KXD A;  1S1W B;  1SKU B;  1KKH A;  3NY0 A;  4JI3 J;  2I5J A;  3ZFV A;  4PWD A;  1K8A T;  1U4B A;  3MF5 A;  1PC5 A;  2HIQ A;  5DDO C;  2FGO A;  2FD2 A;  1F5A A;  2ASY A;  3GMG A;  2R9L A;  1X4G A;  2ZH6 A;  5KFD A;  3BKF A;  3B54 A;  4X4V A;  1AZS B;  1DQ8 A;  2BDP A;  2CPY A;  4C8L A;  4P75 A;  1NM2 A;  2DHX A;  3G96 A;  2Y8Y A;  3FEZ A;  1HWL A;  2JC1 A;  5GAH I;  2M3D A;  1NEE A;  5L1I A;  2Z30 B;  1P8G A;  3PY8 A;  1QAY A;  1T0T V;  5J1E A;  3HHL A;  4B08 A;  3W5Y A;  3JAM Y;  2XSJ B;  2AJ1 A;  3U02 A;  2FIU A;  3JQJ A;  3PKY A;  2R7W A;  1BE4 A;  1ZTT A;  2AEM A;  1U6Z A;  1RAG B;  5HMY A;  5I4M A;  2YX4 A;  5EX0 A;  5LXR A;  4RNF A;  3LW5 C;  4W4M A;  1WUU A;  2W2P P;  4X65 F;  2QX0 A;  5DO2 A;  1JNZ B;  4LSL A;  4TYA A;  4LRD A;  4BCA A;  3MMJ A;  2HAF A;  3GJQ B;  4DPX A;  4WK1 A;  3L9Z A;  1LWF B;  3H2U B;  3ICL A;  4G65 A;  2F9J A;  2E9Z A;  5CYJ A;  1Q78 A;  2F9D A;  1YX2 A;  4DL5 A;  3E8O A;  1RTD B;  5D0R A;  4GC7 A;  1YRU A;  2ROP A;  1MG7 A;  2Z2M A;  4LRB A;  4P9S A;  1IKX B;  1WSR A;  1Z2L A;  3K57 A;  3MUR P;  4FPR A;  2ZNY A;  5MLC V;  2GC8 A;  5ETM A;  2JEJ A;  3DHX A;  4LF5 J;  1TL5 A;  1WTF A;  2OPQ A;  4NCA A;  1C1B B;  4QZV B;  5KAK A;  4QW9 A;  2CNK B;  3BH6 B;  1XMQ F;  1WOP A;  3BGF A;  3JB9 k;  4LVN P;  3TYT A;  2QLF B;  4ED3 A;  3RW6 A;  3NRB A;  4UF4 A;  3GG0 A;  5EN1 A;  1N0U A;  1RJJ A;  3I32 A;  1TKZ B;  2DXE A;  1ROF A;  2DNH A;  1AA1 B;  2W8K A;  3V4I B;  3CW2 C;  2UUC F;  4LRE A;  1XR5 A;  3DXB A;  3RAM A;  4I64 A;  3J81 j;  1HYS B;  3CDU A;  3VF0 B;  5M2R A;  3W62 A;  4LVO P;  4B02 A;  4HKQ A;  1HQE B;  2KJV A;  3SCI E;  3UR3 C;  3CVK A;  2FVR A;  2D9P A;  4OZ2 A;  1L3V A;  3CJK B;  3CWJ A;  1WC1 A;  4YS2 A;  4ZVP B;  1VC0 A;  2D3O R;  2N82 B;  1JLC B;  2U2F A;  4DF4 A;  3C14 A;  1N34 J;  2CAJ A;  2MKK A;  4OJH A;  3MPV A;  3GIM A;  4UY8 T;  4ZHR A;  5DS7 A;  4M5M A;  3I9V 9;  3R7N B;  5K8O A;  1SPB P;  4PQU A;  1MN9 A;  2VBY A;  4CI0 B;  3IWX A;  1OY6 A;  4M5L A;  4GKJ J;  4NXM F;  2QA1 A;  4DUY F;  2RF2 B;  1RT1 B;  2DNN A;  1WDT A;  3WC0 A;  3VGT A;  4B3T J;  1AT1 B;  2GZO A;  1EP4 A;  4WBF A;  2LVW A;  3D1Q A;  2HHX A;  2Y9H A;  2EW9 A;  2UU9 J;  3M8P B;  2D69 A;  1MSW D;  3M9N B;  3FKB A;  2J8S A;  3JYT B;  4JI1 F;  3EPI A;  1V3Z A;  4DX6 A;  2BE9 B;  2LA6 A;  1NHK L;  4TLQ A;  2MHN A;  1PIE A;  1RAI B;  1NSK L;  3FCW A;  3A8E A;  5IQQ A;  4OFZ A;  1YI2 S;  4IFV B;  2OPP B;  1N48 A;  2C3Y A;  1VRU A;  4WPA A;  1E6V A;  1EIY B;  4PG5 A;  1PCA A;  1MMD A;  1YJW S;  4PXC A;  3ILJ A;  4PWU A;  3TVY A;  4GKK F;  4KB7 A;  3KG0 A;  1T9U A;  3TAM A;  2YQ3 A;  2FHK A;  3TUP A;  3DN9 A;  1GQE A;  3ZZO A;  1DUR A;  3F0N A;  3G8Q A;  4GVL A;  1Z4U A;  2R7X A;  2VF3 A;  5DGA A;  3PW5 A;  5ETS A;  4Q5V A;  4TLR A;  4NOH A;  4R8U A;  4IOB A;  1U1M A;  1NUE A;  2FVC A;  4KHP J;  3IG1 B;  3PYG A;  3EM1 A;  2FZK B;  5JVH Q;  3A3N B;  2K06 A;  4AE5 A;  2HS4 A;  1V6H A;  2HBQ B;  4F0H A;  2XY6 A;  3AAW B;  4CQ1 A;  2WVF A;  2ZZT A;  3OXL A;  4IFY A;  4P6Q A;  3SI8 A;  5HSP A;  5H1S V;  1U2R A;  4YB1 P;  3HX9 A;  4AMM A;  2OFG X;  1F2G A;  2HYI B;  1S1W A;  2Y0S D;  1TKX A;  2ZVS A;  5D3G B;  2VFS A;  3P8B B;  3X1L B;  2K3K A;  5LXY A;  4RX6 A;  4YUD A;  2BXJ A;  1SUQ B;  4AXJ A;  3D1O A;  4DV5 J;  1R8B A;  4OMF G;  4UOC A;  2O3D A;  4FKX A;  1AZS A;  4HT7 A;  3NGU A;  1JKH A;  4KKO B;  2DIU A;  1R8A A;  5E33 A;  1QLN A;  3EGN A;  4QWC A;  4I2Q B;  4ZPC A;  1NHV A;  1SIW B;  1FKP B;  1QUP A;  1PAE X;  3FBF A;  2KM8 B;  1C0U B;  1N32 J;  2ZOF A;  4PYD A;  3JTO A;  3CMQ A;  2W01 A;  3TAN A;  3DLL Q;  3P49 B;  2CIM A;  1BUX A;  3R5A A;  1RCX B;  3BSA A;  2G0I A;  4I6W A;  5DRK A;  1UW9 A;  1S6O A;  1TMJ A;  3QGP A;  2COL A;  2V50 A;  2R8K A;  1LQ9 A;  3MM5 B;  4JI2 J;  1WWH A;  3D0I E;  3MGJ A;  4DSI A;  1N5V A;  1SJ4 P;  2ZDP A;  2FVS A;  3I56 S;  1KVI A;  5CZD A;  4MK9 A;  3W8P A;  2FJW A;  3CJQ A;  3W2W B;  3T5K A;  4ZIT A;  2DHH A;  1KSP A;  5J1P A;  2HFN A;  3R5C A;  1OIA A;  5D4N A;  5H9F K;  3UI3 A;  1TUG B;  4DDF A;  3MUV P;  1HW8 A;  1HD1 A;  1NXI A;  1IKX A;  1KOH A;  2L9W A;  3SDE A;  2QLB B;  1C1C B;  1DTQ A;  3S1T A;  1FRK A;  1W26 A;  2CPJ A;  1GXL A;  1T3N A;  3I5B A;  4DSJ A;  1ZYQ A;  4Q2M A;  1SQF A;  1N54 B;  1IBL J;  5IXU A;  1H73 A;  3CJ2 A;  2FDN A;  2DNP A;  2R7T A;  1HNZ F;  4RBT A;  1KVJ A;  1RDR A;  1Y7P A;  3HM9 A;  2R2S A;  3BQ1 A;  2YH0 A;  4J9Q A;  3AHP A;  2YNG A;  1VS3 A;  4F3M A;  4KGX B;  1N5T A;  1SB6 A;  2AX0 A;  5F0W A;  2RML A;  4Q8F A;  4F4K A;  1VQ5 S;  1HWJ A;  5CAB A;  1K1Q A;  2NUU G;  3ISN D;  4IG3 B;  1TKZ A;  5DDQ C;  4TQR A;  2ZNZ A;  1NHU A;  5HVG A;  1Z2Z A;  4A8W A;  1GTH A;  3V4I A;  1OSD A;  4USU A;  2HW3 A;  4LFC F;  1YGY A;  2HND B;  5T41 A;  3CCE S;  3MMB A;  4F04 B;  5HMW A;  2E5L F;  3ZXW A;  1T9T A;  3QJL A;  1Y5I B;  2W4P A;  4PAB A;  3CJK A;  1FA0 A;  1UJ5 A;  2RQK A;  2MHE A;  1UVI A;  2DH7 A;  3LQV A;  3QLH A;  3O1L A;  3CE8 A;  5BJR A;  1M5V C;  1TU0 B;  3PHT A;  4J5O A;  2GQQ A;  2B5J B;  1Q86 T;  1HNX J;  1I51 B;  1F3F A;  5FII A;  1R0A B;  1T11 A;  2IM3 A;  2XHC A;  2RF2 A;  1WC5 A;  1RT1 A;  4U7U K;  2GAH C;  2ADC A;  3K5O A;  2P9E A;  1LWE B;  1WEL A;  4ECR A;  3M8P A;  2FC8 A;  4JB8 B;  1KOO A;  3JYT A;  4BWM A;  2NSB A;  2CAD A;  1UA0 A;  1FJ7 A;  3U27 A;  1Y5N B;  3Q8V A;  1D9D A;  1IR0 A;  2FHJ D;  5HP1 B;  1EKR A;  4IFV A;  3CCQ S;  2OPP A;  3AA9 A;  1NJI T;  4H54 A;  3BQ2 A;  2XS5 A;  4K4V A;  4QR2 A;  4QU6 A;  2DNK A;  1WEY A;  1UEV A;  1R3N A;  4A8K A;  2BX6 A;  3QFW A;  3FBE A;  2HGL A;  3PO4 A;  4M1K A;  1U1R A;  1VQ8 S;  4O23 A;  4ID5 B;  1RKJ A;  3LWL A;  3PYD A;  4DUT A;  3I87 A;  1WHV A;  2IPO B;  1K0T A;  2CPX A;  1ICE B;  1U02 A;  4NZ6 A;  4PZV A;  4WII A;  2IAJ B;  4B9U A;  2XQC A;  4RR5 A;  5HAT A;  3QFH A;  5KG0 A;  4B9T A;  3FNN A;  1QSL A;  4RJV A;  4CLZ A;  1VIS A;  1L3K A;  2XMT A;  4RW6 B;  3J81 Y;  2IYG A;  1BWE A;  1RZM A;  3GR0 A;  3K5L A;  4EK2 A;  2UXB F;  5E5N A;  3IS9 B;  2MTL A;  1P6T A;  2AJ4 A;  1RYS A;  2QLJ B;  4ZIV A;  2R2T A;  1HMV B;  3G8T A;  2RQ4 A;  3ZZ0 A;  3EUN A;  1R8C A;  5DGB A;  1J27 A;  4DPT A;  2VKR A;  3HLU A;  4IOC Q;  1LW2 B;  1VQ4 S;  3D54 A;  2F65 A;  1XR7 A;  3OW2 R;  4U67 Q;  2N3O A;  5AJ3 F;  1HQ2 A;  1B64 A;  4GVB B;  3IBW A;  2LDI A;  7FDR A;  4B9V A;  2F4V J;  5E3A A;  1SUQ A;  3ZZY A;  4FS2 A;  2B51 A;  4DWI A;  2G0J A;  4ES1 A;  2B6A B;  3D3C J;  5A0Y B;  3RGI A;  4Q8E A;  3P3D A;  2QGF B;  1ITP A;  2BJD A;  2E1A A;  3J80 Y;  1CG2 A;  1SV5 B;  1YJT A;  1FKP A;  2QLX A;  1NCL A;  1HNV A;  2QEX S;  1C0U A;  2YX1 A;  2V4J B;  5F41 A;  2ZEJ A;  4EBE A;  1UTA A;  2BJ3 A;  7AT1 B;  2PMZ D;  2BE2 B;  1FHT A;  2I38 A;  1JLB B;  4IRK A;  2YKN B;  3KHR A;  3I4P A;  4AQY F;  2M88 A;  5C42 B;  4PRF A;  3MR6 A;  4DCO B;  3H4D A;  1JWW A;  2YVS A;  4DUY J;  2Y0B B;  3EWG A;  2RHS B;  2DTJ A;  2R3V A;  4HHJ A;  2WRM A;  5GAG I;  4DR4 F;  1NK7 A;  3MM5 A;  3C6T B;  2C3M A;  2EVZ A;  1T05 B;  1ZM3 A;  1TUV A;  2MSS A;  5CHC B;  4KTQ A;  3QID A;  4JI1 J;  3BGR A;  3PJX A;  4R0J A;  1RUS A;  1OY8 A;  3KLG B;  1RBA A;  3SCL E;  2JHE A;  3R97 A;  3IR7 B;  5KG2 A;  2HG4 A;  4DSE A;  5CCM A;  3C6U B;  5FLX Y;  5HLF B;  2B9E A;  2EFO A;  4ANC A;  1VBY A;  3M2U B;  5LMU F;  1C1C A;  2RT3 A;  2XB2 D;  2XG8 A;  2UUW A;  1JXV A;  1RYR A;  1V3S A;  2YKM A;  2HGN A;  1RHJ B;  2PEB A;  5EGY A;  2JSX A;  1QSY A;  4KGZ B;  2BEF A;  2ZKT A;  4KPC A;  2AZ1 A;  4X4R A;  4OX8 A;  1YBT A;  1HD0 A;  4ZLP A;  4NZ0 A;  1IQZ A;  2WAQ D;  1O0P A;  2A6O A;  1FJC A;  3I5A A;  2HFU A;  3MMC A;  3PIO Q;  2NRE A;  1VFJ A;  2CNN B;  2YNI B;  2A2C A;  1W2I A;  4KE5 A;  4DR3 F;  4F67 A;  1FNM A;  2K7J A;  2CUY A;  1LWC B;  5KFM A;  2ZE2 B;  1CS4 B;  4XTT A;  5C25 A;  4J9L A;  4OQJ A;  1TZ0 A;  1Q7L B;  2ZBQ A;  5RUB A;  1LV5 A;  2GVZ B;  2ZM6 F;  2W1B A;  4OYM A;  1U7L A;  2OMO A;  4QWB A;  1RT7 B;  4KC5 A;  1CJK B;  1FJE B;  2HND A;  4Z2X A;  4IQX A;  1AW0 A;  5DET A;  3OV7 A;  3HVW A;  1WTB A;  3DOL B;  1P1L A;  4KGM A;  3FCH A;  3VAH A;  2WSE C;  3SSQ A;  1NPP A;  2RDJ A;  3V81 A;  1VQK S;  3TOQ A;  2IVF B;  3H20 A;  5D0E A;  2DR5 A;  1WF0 A;  1L5U A;  4MK8 A;  3CD5 A;  1U49 A;  2QT7 A;  3UFC X;  4ZJO A;  2EFQ A;  4K4Z A;  2B5J A;  3I0R B;  2EG1 A;  1XC9 A;  1S5Z A;  4IO9 Q;  2W2N P;  1ZAW A;  3PRD A;  1R0A A;  3DMJ B;  1ZPW X;  2XY7 A;  2MB0 B;  3P4U B;  3TEG A;  2UV8 A;  2VFV A;  4JI4 F;  4ED1 A;  1LWE A;  1FE0 A;  1U8W A;  1TV6 B;  1S0N A;  2OO4 A;  3DLH A;  2J9E A;  3M30 B;  4L72 B;  1ZA2 B;  4CLF A;  1VC6 A;  1MU2 A;  2AJ2 A;  1DAX A;  3PVX A;  3JSR A;  3CCL S;  1HFE L;  2DB1 A;  3PV8 A;  1RWW B;  1FD2 A;  3RB3 A;  5F9L A;  5HP1 A;  2KYX A;  1U0H B;  4U8Y A;  2E7X A;  4PAA A;  4F36 A;  1NKE A;  3VGU A;  2DHG A;  4I68 A;  3MM9 B;  3ZZR A;  5FJ4 A;  3TI0 A;  2I1R A;  4DR5 F;  1EQ0 A;  2J8A A;  4JUZ A;  3W7B A;  2E1P A;  2XWX A;  4K4W A;  4ID5 A;  1BXN A;  1HNW F;  3SZ2 A;  3ET6 B;  2D3Z A;  3FEX B;  1B99 A;  4DSL A;  1TL3 B;  2IAJ A;  4MIA A;  1U09 A;  4LR9 A;  1IR1 A;  4B3R J;  1F9F A;  1RAO A;  2OPS B;  2C2E A;  1C0T A;  4ZVS B;  4RW6 A;  3M9M B;  3DLJ A;  2QMW A;  4LR7 A;  1T02 A;  4USV A;  4Y28 C;  4IQM A;  3PG9 A;  4LMZ A;  2WW8 A;  1DLO B;  3IS9 A;  1N5Y A;  5F3Z A;  2L48 A;  2BJ1 A;  4ED6 A;  1TL1 B;  3E01 B;  1HMV A;  3K5N A;  2VQF F;  3BDP A;  1GTE A;  3D5M A;  2ZVI A;  2WON B;  2CJY B;  4LF2 A;  4OZN A;  3V4M A;  5IWA F;  3VGS A;  3NWR A;  2OTL S;  2PEH A;  2DIS A;  3CXC R;  4HH1 A;  1KR4 A;  4ZLL A;  2VPX B;  3U7J A;  1LEO A;  1LXJ A;  4LSZ B;  2DY9 A;  3M4X A;  4CWB A;  4GVB A;  3EGV A;  1KQS R;  3W66 A;  4P10 A;  3QQC D;  5B0E A;  1SJF A;  1X4F A;  2B9W A;  2BJE A;  5B0D A;  5HQM A;  5H9E K;  4AFF A;  2UUB F;  5IT0 A;  3H2L A;  4UQG A;  2I8E A;  2CPD A;  1VQL S;  1HAR A;  3IGN A;  5A0Y A;  1JJH A;  5EWF A;  1DY3 A;  4QJV A;  1U25 A;  1Y10 A;  1FEE A;  5LJ3 Y;  3BKT A;  1S97 A;  3JSM B;  3CJ3 A;  1PSD A;  4OI2 A;  1Q4R A;  2HLT A;  4ECY A;  2V4J A;  2GJF A;  4KBI A;  5LT5 A;  3MUT P;  1CJT B;  1K73 T;  2BE2 A;  2DGW A;  2MXY A;  4EU0 A;  2G1H A;  3HVT B;  3DRY A;  2YKN A;  2QYG A;  3IRW P;  3N6M A;  5C42 A;  4ECQ A;  3AXM A;  1WHW A;  1O6X A;  1FK9 B;  2R4F A;  3C16 B;  5ETN A;  4M63 A;  1IBC B;  4RWX A;  1LOU A;  2X3G A;  1TKT B;  3C6T A;  2JEI A;  3K0J A;  5L1L A;  4DV6 F;  1T05 A;  3BBB A;  2J6T A;  1M1H A;  4ITS A;  2RQC A;  1TEL A;  5JUM A;  1N33 F;  2ZDO A;  1HBO B;  1PKU A;  3SSS A;  3C46 A;  5KOX A;  4I1T A;  2KJW A;  3M6U A;  4NXN F;  2VZ9 A;  4R0E A;  3M05 A;  4N8N A;  3S7R A;  3C6U A;  2IRX A;  4ZP6 A;  1YHQ S;  5HLF A;  4XAK A;  3I82 A;  2BZ2 A;  2FLO A;  3L7U A;  4WXO A;  2Z58 B;  1YSJ A;  4X66 F;  1U6B A;  2YKP A;  3V2U C;  1Y00 A;  1I94 F;  2FJE B;  1HPZ B;  5FD1 A;  1PYO B;  1YTY A;  1UWB B;  2DJW A;  4DQS A;  1ZAV A;  2HHU A;  4V1A k;  1HWI A;  1UFL A;  3QWU A;  3HD1 A;  2ROG A;  3PYE A;  4C9D A;  5DQG A;  4ID8 A;  3QT6 A;  3M32 B;  3W5Z A;  5CZX A;  4A8F A;  2YNI A;  2HK3 A;  1D3W A;  3QZ8 A;  3KLE A;  3PRV A;  3R6G B;  2B0G A;  4HDG A;  2YX7 A;  3AD7 C;  4EO6 A;  3CUL A;  2BAB A;  2ZE2 A;  1CS4 A;  1RQ0 A;  2FLL A;  4ETX A;  4URQ U;  5DM6 Q;  3M8W A;  3OR2 B;  2BAC A;  3HJV A;  4C97 A;  2GVZ A;  1RT7 A;  1D09 B;  4ZPB A;  4CZC A;  3OLA A;  2AZ3 A;  4LIW A;  4OI0 A;  3ZTQ A;  4GO7 X;  5KFP A;  5J2Q A;  3DOL A;  3A12 A;  3OFF A;  3V5R A;  4JI5 F;  1Y3J A;  1U1O A;  3J81 U;  5A76 A;  2QRR A;  1X5T A;  5CYQ A;  4DR7 J;  3C2P A;  1IKY B;  2RUG A;  4RZR A;  1RWV B;  4U7C A;  3CNQ P;  4PPZ A;  2AJF E;  4ED5 A;  4PUO B;  4M5D A;  4JV5 F;  1RBL A;  1XJW B;  1VRQ C;  2DGV A;  2MMY A;  2WCX A;  1G4C A;  4KGV B;  1D0E A;  3FK4 A;  3BGU A;  1FDB A;  4DV0 F;  4K4U A;  4P2M A;  2IJN A;  2LDY A;  3SSR A;  2PGC A;  4AQY J;  3M30 A;  2E9R X;  3NGS A;  3THV A;  5B0G A;  2BM1 A;  1U2C A;  2PT0 A;  3OSP A;  2JEF A;  2PI4 A;  1NRK A;  3POT A;  5BYS A;  4F4Z A;  3NNA A;  1YJN S;  2XI3 A;  1EET B;  2UVV A;  1JIH A;  1PO6 A;  3BR9 A;  1N6Q B;  2OSQ A;  4DR4 J;  3NGD A;  1RWP B;  5KFF A;  4BC7 A;  1Y0H A;  2XO7 A;  3D0H E;  3NS6 A;  4DFP A;  2RJZ A;  1J5O B;  3GON A;  3QO9 A;  3HP6 A;  1I5O B;  2ILY A;  3TJ9 A;  1AFJ A;  1NPK A;  3EVM A;  5J2N B;  2QA2 A;  3CC7 S;  2HHP A;  2BA9 A;  1D8Y A;  1F60 B;  3ET6 A;  3GFH A;  1SJQ A;  1N8R T;  1TL3 A;  2YPY A;  4G1Q B;  2P2C B;  3IWL A;  1I3O B;  1YWX A;  2WOM B;  3GSI A;  3L7P A;  1DRZ A;  2VPW B;  4DU8 A;  4QYR A;  4HHU A;  5KFE A;  1NPR A;  2RVJ A;  1IBK J;  4LF4 F;  2DNY A;  2G4B A;  2BJ9 A;  1IN0 A;  4C8N A;  1QAI A;  4HI2 A;  3VCD A;  1XMO J;  3ENW A;  2XLJ A;  1TKD A;  3OJS A;  1TL1 A;  3KJN B;  2KH9 A;  4LFA F;  3GG1 A;  2IVY A;  2IJF A;  3E01 A;  3BH7 B;  2HVE A;  4OYB A;  3K7R A;  4NA1 A;  1WI8 A;  2QN6 B;  4M5G A;  3CMA S;  3KTQ A;  2A6M A;  1HI1 A;  2H3E B;  2L3M A;  2MZT A;  2WON A;  2ZD1 B;  1IJE B;  3OHA A;  3FZB A;  4DR3 J;  3NEK A;  4Q2L A;  2QSW A;  3LOU A;  4X62 J;  4HYK A;  1NDP A;  3GFX A;  3V6K A;  2R7R A;  3NNH A;  4LRF A;  4DCJ B;  3Q8P B;  3RBX A;  2XZT B;  1NK8 A;  4DS5 A;  3CGI A;  2OLW A;  5C5J A;  1SIZ A;  5CH7 B;  3QJP A;  5HN0 A;  2EXU A;  3M8S A;  4AD6 A;  3TVK A;  4MKB A;  4CH7 A;  3TX0 A;  5A2Q U;  3TUZ C;  1QSS A;  2HFV A;  2VIC A;  3VAI A;  3SMZ A;  4EYH B;  4C6A A;  1V3R A;  4E2F B;  2ALZ A;  2PD1 A;  2CRL A;  2HRU A;  1N5S A;  2HHW A;  1Q1K A;  3PM9 A;  3VVU A;  2QLW A;  4ZCL A;  4F4Y A;  3HVT A;  3S01 A;  4KR0 B;  1RI7 A;  2CQ4 A;  2E9T A;  3LTO A;  1LK7 A;  1F2H A;  1YJ7 A;  3DLG B;  4CLU A;  3VWS A;  1XNR J;  1UL3 A;  4J9O A;  2GMH A;  3HK2 A;  3DGP B;  2LXF A;  1FK9 A;  4XIU A;  3TAP A;  1F5B A;  2BAN B;  3C16 A;  1Y11 A;  4JI4 J;  1IKW B;  2KXN B;  1TKT A;  4LF1 A;  4YP3 A;  3VAM A;  1VK8 A;  4CO3 A;  1KC8 T;  2OD4 A;  1Q79 A;  3AA8 A;  1XNQ J;  3TR5 A;  4OI3 A;  4N5S A;  2KFN A;  1VC5 A;  2BJ7 A;  2ZWO A;  4KFB B;  3SCJ E;  1HBO A;  5DG7 A;  2YBV A;  1Q0N A;  4JI3 F;  4IDK A;  2HMI B;  4WWS A;  3HHK A;  4OZ3 A;  3JSY A;  2HFO A;  2YKO A;  1W25 A;  4I6Y A;  4MT1 A;  1UWA A;  1S49 A;  4FYX B;  2MPU A;  2H9Z A;  5ETQ A;  3KG1 A;  5I3U B;  1CPZ A;  1HBN A;  1S9E B;  2E7V A;  1S6Q B;  3IBC B;  2D3O 1;  2MZQ A;  2AEF A;  1SKS A;  4URS A;  2VPZ B;  1QY7 A;  1UWB A;  1FX2 A;  2XBP A;  3BGO P;  4YEA A;  3UD5 A;  2BKN A;  3KOA A;  2AW0 A;  3HD2 A;  4Y2M A;  4YY3 J;  4C3M A;  2CVE A;  2N7Y A;  1X5P A;  3QIP B;  1VHF A;  3UPF A;  3M32 A;  3W63 A;  4NI2 A;  1Q8I A;  2IBO A;  2C2O B;  3LH2 S;  3Q83 A;  2C22 A;  2VFT A;  3O6Q A;  3CC2 S;  3H5U A;  1KHW A;  1TVR B;  2ZIT A;  2JH3 A;  1UFK A;  5K9F A;  1PJ7 A;  3GV8 B;  2Y8W A;  5A8K B;  4PKD B;  1PAU B;  1KQK A;  2GHV C;  2IM0 A;  2W7P A;  3AD8 C;  3OR2 A;  4NPO A;  4M5K A;  1VLO A;  5IV4 A;  1H2V Z;  4CCH A;  4ZLJ A;  4YN3 B;  4DV1 J;  4D3G A;  4QWD A;  1MML A;  3J7Z T;  2K3I A;  1VIO A;  2X1B A;  1RWN B;  1C4A A;  2PC6 A;  4J9V A;  5I3P A;  2IMO A;  1SH2 A;  3DRR B;  3C15 B;  1RAD B;  1WG4 A;  2V69 A;  4M5N A;  3K17 A;  1JLA B;  1IKY A;  2HZA A;  2ZH1 A;  1H2U X;  3S8S A;  4LJM A;  3ADA C;  1RHU B;  3OQ2 A;  2CZ4 A;  1FEH A;  1QUV A;  4PUO A;  3HJF A;  5J2P B;  3VZI A;  3M2R B;  3FVY A;  1F1B B;  1OQ6 A;  2MZS A;  3QT5 A;  4LRA A;  2DNM A;  1G7C B;  2GO9 A;  3H8Y A;  3V6D A;  3MEC B;  3CB4 A;  1HBU B;  4F3Q A;  3FQL A;  4JYA J;  3ITH B;  2BM0 A;  3MR3 A;  1BQM B;  2FJB B;  3KLI A;  1P1T A;  2RRA A;  4FBU A;  2DHA A;  1ZM9 A;  4O3N A;  4U95 A;  3N79 A;  3I55 S;  3RRG A;  2RIL A;  2W4D A;  4P7T A;  1YBA A;  1EET A;  3RBZ A;  1VQ7 S;  1N6Q A;  2AT1 B;  2CQD A;  4O4G B;  2G1D A;  3JQK A;  4DV6 J;  3CJ4 A;  5EWE A;  4AYB D;  4KY3 A;  2YWE A;  3OTE A;  2RIJ A;  4QYZ J;  4ECW A;  4XPC A;  2ZH3 A;  1M0S A;  1NDC A;  5CYM A;  4DHV A;  4NXN J;  1CUL A;  1TL4 A;  4ZLN A;  2V2V A;  2Y1J A;  2VD3 A;  5KT6 A;  4RUC A;  1YQH A;  1R43 A;  2HVD A;  3A3O B;  5HVH A;  1U1K A;  2EPI A;  1VLY A;  2BOA A;  1BGX T;  4X66 J;  5A6P A;  1VQM S;  4WZM A;  4ECU A;  4HL9 A;  3MWB A;  3CJ5 A;  4KAI A;  4QIG A;  1RWX B;  5HAO A;  2KN4 A;  2AWZ A;  2GW8 A;  3OVS A;  4OZ5 A;  4GKJ F;  4C8Z A;  3FGV A;  4TY9 A;  3BR8 A;  2YNH A;  4DPY A;  2VV5 A;  3T5L A;  4RW7 B;  4B3T F;  1VYA A;  2VL1 A;  3BBC A;  1U1L A;  3BDE A;  2UU9 F;  1GFW B;  2ZD1 A;  4UUW A;  1RA7 A;  1GXT A;  1J5E J;  1X4B A;  1CQN A;  5ETO A;  1SH0 A;  2E5I A;  2JLF A;  3ILL A;  4RW9 A;  1RXO B;  3DYA B;  3W61 A;  1GMW D;  4Q44 A;  1ZA1 B;  4J9N A;  1FNX H;  1X9S A;  1FTC A;  5K14 A;  1M5K C;  3AJ2 A;  1IQT A;  2R8H A;  3R7B B;  4BBY A;  1R8H A;  3BSC A;  2VG5 A;  5KFW A;  2DH8 A;  3UCG A;  1NK9 A;  2F8M A;  3EVO A;  3EXC X;  3MCO A;  4EI2 A;  3NXZ A;  4JI8 J;  2L9D A;  2CG8 A;  3M9O B;  1VQ6 S;  2R7O A;  2RS8 A;  1AYE A;  3K8V A;  1G3O A;  5BYR A;  5KFX A;  4OI1 A;  2BQ3 A;  5KFQ A;  4F02 A;  3PYF A;  3T1H J;  1RU2 A;  3K8W A;  2DEJ A;  2R8I A;  2CZV C;  4EFA C;  3DLG A;  4F2R A;  1H6K X;  1O8B A;  2R7S A;  3AT1 B;  2GMJ A;  4O4R A;  3EZ5 A;  4FKY A;  3DGP A;  2XMV A;  4ILR A;  3QNW B;  4WF9 Q;  2BAN A;  2W4C A;  2IBK A;  3LAL A;  1IJF B;  2B7B B;  4Q45 A;  5D4L A;  3CJS A;  5ITH A;  3MED B;  4TN2 A;  2JFD A;  1RT3 B;  4A48 A;  5KT3 A;  1WC4 A;  2XGQ A;  2HMI A;  4I6A A;  1KDN A;  4CH0 S;  1X5S A;  2FJX A;  4J9K A;  2KT3 A;  2QFJ A;  3Q22 A;  2HWT A;  1ELO A;  2NXC A;  5HBM A;  2IRY A;  4C0B A;  5I3U A;  4DV5 F;  1RA6 A;  1S9E A;  1TK8 A;  1S6Q A;  2G13 A;  2BR0 A;  1BC6 A;  5D77 A;  3WHI A;  5GAE U;  4YME A;  2Z8Q A;  2YNF B;  3O44 A;  4HAC A;  3WIU A;  2V2Q A;  3ILI A;  3PCO B;  3MZI A;  3NLC A;  3OFG A;  1UEU A;  5F9N A;  3F73 A;  1AB8 A;  2M2B A;  3UCZ P;  3QIP A;  4JI6 F;  2R7V A;  2GA7 A;  4EO8 A;  3R27 A;  4N8O A;  4OHW A;  2ZOG A;  3S6E A;  4YDX A;  4CDI A;  1JMT A;  4A8Y A;  3LPE A;  2MQO A;  3AQO A;  1FTR A;  3T5J A;  4FPI A;  4ENO A;  2FZC B;  3WIV A;  3IN5 A;  2ZH2 A;  1SL0 A;  5A8K A;  3K59 A;  2ZHA A;  2B9X A;  2BBE A;  4ICL A;  5LSL A;  2UP1 A;  3M8R A;  3UCU P;  3CDE A;  1WOO A;  1SJ1 A;  1VK3 A;  4OX6 A;  1WC0 A;  4WP8 A;  4URG A;  4K8R A;  4L75 A;  1FJG F;  1WC6 A;  5IT4 A;  4K2J A;  4WXW A;  1RHQ B;  3MR7 A;  3ONQ A;  3MR2 A;  2JL9 A;  3F44 A;  5HK4 A;  5D4O A;  4ANE A;  1UJ4 A;  3C3L A;  3DRR A;  5ETP A;  1RTH B;  1S76 D;  4FP9 A;  4OZ1 A;  3G8S A;  1S1V B;  3DU6 A;  3I6P A;  4I4B A;  1HA1 A;  1JLA A;  2NS1 B;  2GNK A;  2GS8 A;  4IRD A;  1EHW A;  3RRH A;  5GVQ A;  2E1C A;  2XYP B;  2I0X A;  1S77 D;  1S59 A;  4K59 A;  3M2R A;  3OVA A;  3TJ8 A;  1IBL F;  2KDO A;  2RD5 C;  2XUL A;  3LAK A;  3MEC A;  1KRP A;  4LBH A;  3Q24 A;  1M5H A;  2HZC A;  3P5B P;  3ITH A;  5DDP C;  3DLE B;  3PW7 A;  2N3L A;  5THW A;  2BOP A;  2E44 A;  2PI5 A;  1UET A;  4KH1 B;  2YTC A;  3G6V A;  2Q43 A;  2FVP A;  4NRT A;  2K2P A;  2MQ8 A;  4O4G A;  3MD1 A;  5D8H B;  2RS2 A;  1OSC A;  1WC3 A;  2QG9 B;  3IBF B;  1VBK A;  3D66 A;  4BC9 A;  4DS4 A;  4O44 B;  3DGV A;  2HKE A;  2DK2 A;  1IWA A;  3MEK A;  1APS A;  1HLW A;  2RE1 A;  3GJT B;  1S9F A;  3TP2 A;  4NZ7 A;  3R5G A;  3N9U C;  2CNL B;  4U7U D;  4OHY A;  1UVL A;  4QOT A;  4FYD A;  2LQ5 A;  5D78 A;  1NZ8 A;  4IH6 A;  1IXK A;  4OV1 A;  5KT2 A;  5JXS A;  2GQC A;  5GMK a;  2NQP A;  4YB5 A;  4GMK A;  3LP0 A;  1HNX F;  1ZTW A;  1UP1 A;  4DV2 J;  2VPY B;  1H7W A;  2ZZM A;  3DFE A;  2O66 A;  2YQ0 A;  1KFD A;  4KPY A;  4DFM A;  1D9F A;  4DG1 B;  3BYP A;  3TUI C;  1VJQ A;  4OI4 A;  2FZG B;  3NS7 B;  1HHQ A;  4ED4 A;  5KFI A;  4P52 A;  1GK8 A;  2MLZ A;  3DU5 A;  1VQS A;  3UVJ B;  2H5I B;  3FFI B;  5HRO B;  3VTI A;  3RB4 A;  3K5M A;  1VJW A;  5E7O B;  4JV0 A;  1DTT B;  4DL6 A;  3BSO A;  1KS2 A;  2UUA J;  3DYA A;  2GVD B;  4RW8 B;  3ZZU A;  2FLP A;  1RT6 B;  3T9N A;  4UW2 A;  3X3U A;  3MTJ A;  3EZO A;  2CJQ A;  4YQW A;  3PRB A;  2QTW A;  1XMB A;  3MOZ A;  3VGV A;  4ED0 A;  2H1Y A;  3N4W A;  3EDQ B;  2YWH A;  3CCJ S;  2ZJR Q;  2FY1 A;  4XK8 C;  1CQM A;  2DRA A;  1S6P B;  2R2R A;  3WZ0 A;  3MEG B;  3RR7 A;  1HBM A;  5KFK A;  1UPP A;  5ETV A;  4J9R A;  1RCO B;  4EMD A;  3J7A N;  4Y65 A;  1NDK A;  2CJ9 A;  5IM0 B;  4CLY A;  5CAA A;  4K5R A;  2B8Q A;  1T94 A;  5GAH U;  2OPR B;  2PA8 D;  2VG6 B;  2D41 A;  3MMA B;  3NNC A;  1HHS A;  2LXU A;  5E3R A;  1FF2 A;  3UDC A;  1RT4 B;  2C2D A;  2HAI A;  5HAN A;  2DBB A;  3C8Y A;  2YPZ A;  4E98 A;  3MED A;  1ULR A;  4CT8 A;  3D6F B;  4LRC A;  4FF4 A;  4HH0 A;  4MTP A;  1RT3 A;  4X4N A;  3DRS B;  1VGY A;  3SCK E;  2CPF A;  1EAR A;  1KON A;  3QGG A;  2VUG A;  1GMW A;  2AV5 A;  4K50 A;  2F4V F;  5IV3 A;  2HNZ A;  3TAR A;  4A4J A;  1NSA A;  1RT5 B;  2ADB A;  3OL7 A;  4X64 J;  1RGV A;  3PX6 A;  3OTC A;  3PHE A;  4V19 X;  1R89 A;  1T9W A;  1TAU A;  2YNF A;  1N36 F;  4FF1 A;  5M2U A;  2DXF A;  4TQS A;  3AQP A;  4IKA A;  2FY8 A;  4H4M B;  4L73 A;  1VBX A;  5GAD I;  2OSR A;  2NXU A;  2FLN A;  1FKA F;  3G86 A;  1F9E B;  3EGZ A;  2ZBI A;  4O3P A;  1FVQ A;  2G9O A;  2OEL A;  1B7F A;  2M5Y A;  4M5J A;  4QWA A;  2NZC A;  3KJF B;  1MMN A;  3E3X A;  4KV8 B;  2X3D A;  1JX4 A;  2C42 A;  4DV3 J;  4O3R A;  3T1Y F;  2UVR A;  2R7Q A;  4ZVQ B;  2C2K B;  3M1V B;  2RU9 A;  3THP A;  4FYV B;  4BHQ A;  1JLF B;  3SEO A;  3DRP A;  3IR5 B;  1KEK A;  4C11 B;  3BB5 A;  4NLX A;  2OTJ S;  1NKC A;  2BKO A;  2WBR A;  1TK0 A;  1U1Q A;  3R5B A;  5ETK A;  2PN6 A;  3RR8 A;  1Q8L A;  1X0P A;  5BR8 F;  2E5H A;  1S72 S;  3DNC A;  2BW7 A;  3CD0 A;  4CLW A;  2X7I A;  3KMQ A;  1S1V A;  2BVZ A;  3A8I A;  1PYT A;  2IHR 1;  1U45 A;  2XMW A;  1JXE A;  5ETT A;  3MTK A;  1A0O B;  3D7S B;  3DI6 B;  3UW1 A;  2XZD B;  4ED2 A;  2HLU A;  2NXE A;  1W7W A;  1RU1 A;  1QDU B;  2P6S A;  2PFF B;  2J6U A;  2O5D A;  4K4X A;  2OFH X;  3BO2 A;  1S4F A;  2DNQ A;  2MKI A;  2KB2 A;  3Q23 A;  4X84 A;  2C28 A;  1QE1 A;  1RTJ B;  2KT2 A;  2JVR A;  3CCM S;  4WP9 A;  1OY9 A;  5L1K A;  4KQZ A;  1FXD A;  2N7C A;  5KFR A;  3L09 A;  5LJ5 Y;  1S12 A;  5L39 A;  1KLN A;  2CQ2 A;  3HDS A;  4WFX A;  3Q8S B;  2YH1 A;  4PG4 A;  4O44 A;  4UQT A;  2LEA A;  1N4L A;  1QTN B;  4FDF A;  1FRJ A;  4DFJ A;  1EQM A;  4QIV A;  1MRO B;  2C3P A;  3NAI A;  3WBZ A;  3KNG A;  1S9G B;  5A8W B;  1HQU B;  1PJ6 A;  2NLW A;  3K5P A;  9RUB A;  4H4K A;  1FES A;  3VR1 A;  1DBD A;  4YB6 A;  2CFX A;  1JXL A;  5KT5 A;  2G2O A;  4O0I A;  3GYN A;  3HHN B;  4DR2 J;  1UPM B;  1SKR A;  3ILO A;  4MMO A;  1RWU A;  2I9S A;  2VC0 A;  2H65 B;  3TZX A;  4YFU A;  2GGP B;  3BN7 A;  4RU9 A;  2MQN A;  2KI2 A;  4CLS A;  2M0G B;  2VFU A;  2XSJ A;  1LKZ A;  1KLM B;  3H2V E;  4JI6 J;  3A8J A;  2CJA A;  2PO4 A;  2HPU A;  2VIH A;  3UVJ A;  3FFI A;  5B0A A;  3NP5 A;  3IR6 B;  4N7T A;  3H5X A;  2AGQ A;  1C4C A;  1DTT A;  2LQ9 A;  2DNG A;  2YQ1 A;  4H4O B;  4EBD A;  2GVD A;  2HQG A;  4RW8 A;  3RBD A;  1H3D A;  4PEO A;  4F25 A;  1LWF A;  2HQF A;  2VJU A;  3A1Y G;  3HHE A;  1RP5 A;  1GX5 A;  1FJG J;  1ARO P;  2PDA A;  1RAH B;  1RTD A;  4OV6 A;  2ZH9 A;  4RW4 B;  1DAR A;  4KYZ A;  1FXL A;  4OHZ A;  4ALZ A;  1GNK A;  3MEG A;  4N76 A;  2XHW A;  1PYS B;  4B3R F;  2OKQ A;  1JQG A;  4WJB A;  1FWL A;  1URR A;  4C8M A;  1LFW A;  5KFH A;  1UW4 A;  3R9L A;  2V5H G;  3FEY B;  1HI8 A;  2XMJ A;  3UDV A;  5IM0 A;  3W64 A;  4USH A;  3H42 A;  3KUG A;  2V4R A;  3SV3 A;  2OPR A;  5J1E B;  5HL7 Q;  1A9N B;  1S1X B;  3WDO A;  2HNY B;  3BSN A;  5HJY A;  3MMA A;  1MN7 A;  1C1B A;  4ZK7 M;  1VRT B;  3QT7 A;  1RT4 A;  3RJM B;  1LWX A;  4A8Q A;  2MY7 A;  2KU7 A;  4CLP A;  2XZW A;  2B43 A;  5F8I A;  1S10 A;  4MFB B;  4OYI A;  4ECV A;  4Y3C A;  3IC1 A;  4HT5 A;  3HZE A;  4FVM A;  4NLT A;  3IGV A;  1KN6 A;  2E66 A;  3M2V B;  1T9V A;  2J76 E;  1M90 T;  2CQP A;  4EWT A;  3KK3 B;  2DYA A;  2VA2 A;  2R2U A;  2J6S A;  1TP7 A;  1HYS A;  4W92 B;  3QRR A;  2GFF A;  1Y3K A;  3AOB A;  4K0K J;  1HQE A;  3QWP A;  4CIO A;  4H4M A;  6AT1 B;  1FDD A;  2VC1 A;  4OYW A;  4WZQ A;  2M8D B;  5DDR C;  1JLC A;  1IM6 A;  3NOG A;  4LF9 J;  4WIQ A;  1K44 A;  2R42 A;  4TU8 A;  3GSD A;  4OYP A;  2HHS A;  2FJV A;  3KJV B;  4IH7 A;  2AD9 A;  4KV8 A;  2ZHB A;  5F8G A;  3IA0 A;  2KRB A;  4HTI A;  3AOA A;  1IBM J;  2EFP A;  3NCQ A;  3MI7 X;  3O2I A;  1ZS6 A;  2F3J A;  4RL1 A;  3F41 A;  2ZOM A;  4S0M A;  1JLF A;  3Q8R B;  2AIR B;  3MM8 B;  4WTO B;  3QGH A;  2J5A A;  4C11 A;  1GT8 A;  3IFE A;  2A10 A;  3DC2 A;  4PWW A;  3CIZ A;  1FDA A;  4DN9 A;  1KD1 T;  4LQ9 A;  4F4A A;  4ZMM A;  5DLF A;  5HVF A;  5GMD A;  2CQG A;  2N4C A;  3LAM A;  4NLY A;  3HF5 A;  2WBM A;  3G82 B;  4PG6 A;  4NML A;  3PW4 A;  3DI6 A;  2KKH A;  4X4Q A;  1MWQ A;  4WKR A;  2VQE J;  4DL4 A;  4UUX A;  3EDR B;  2OHD A;  3AOD A;  2P5V A;  3DDN A;  4CH1 A;  4DMZ A;  3GIL A;  3GR1 A;  3KFW X;  4DV4 F;  4ER8 A;  2DGT A;  1SKW A;  5LMN J;  3TJA A;  3WQP A;  3OSN A;  1X0F A;  4ZHR B;  3MPU B;  2FGC A;  2CVI A;  3RZA A;  1AFI A;  4Q43 A;  2WVD A;  2B8P A;  3UN3 A;  2AF6 A;  1CVJ A;  4DPO A;  1F9H A;  3IG1 A;  1NK5 A;  4MAK A;  1HL6 A;  1B0P A;  1SC1 B;  3KLH B;  2V8P A;  3PJW A;  3QMQ A;  2ZKU A;  1M5P C;  3MPY A;  3I31 A;  2J7W A;  1K1S A;  1IKV B;  4XO0 A;  4LSN B;  2P9C A;  3EMT A;  3NWG A;  3HFZ B;  3NS5 A;  2XO6 A;  2V9W A;  1S9G A;  2XCP A;  5D3G A;  4QPT A;  1HQU A;  1PG5 B;  2QA4 G;  5A6W A;  3N5F A;  4LT6 A;  1RAB B;  1REV B;  3ULH A;  2RSQ A;  2AYB A;  1GMU A;  4FF2 A;  4JI7 J;  4DR7 F;  2PSZ A;  3DOK B;  4HTJ A;  3CED A;  4ZA1 A;  2EFN A;  4QW8 A;  3GYX B;  5E3Q A;  2Z56 B;  4KKO A;  3KK1 B;  2XM3 A;  1S6U A;  1N36 J;  4I2Q A;  2W9A A;  1RE1 B;  4IUF A;  1OPI A;  1CC8 A;  2G2Y A;  1DHM A;  3ENV A;  2GGP A;  2WHO A;  4V19 J;  3TAM B;  3OD2 A;  1LNQ A;  1RKI A;  1Y5L B;  1KLM A;  3WC2 A;  3V6H A;  4P7V A;  2LQ8 A;  4P2X A;  4ECS A;  1O51 A;  4P2S A;  4C98 A;  4B9S A;  3GP9 A;  2XS2 A;  2FTR A;  2VA3 A;  4BDP A;  2ZFH A;  5F3T A;  1VHI A;  1H0H B;  4HI1 A;  2QYC A;  3T1Y J;  1Q16 B;  4CLT A;  4RBV A;  3NAH A;  4JI0 J;  4H4O A;  2OI2 A;  2W7A A;  1UVM A;  3AXK A;  1VQP S;  5F8J A;  4LFB J;  2HHT A;  2RB7 A;  1KQF B;  2V4Q A;  4DCP B;  2LQB A;  4TNO A;  4EBC A;  3M6X A;  2GV1 A;  5KG3 A;  3W2W A;  2ATL A;  3MCM A;  1IM4 A;  4OJ1 A;  4IFY B;  4NRU A;  3G9C A;  4ECX A;  2DXD A;  3WX8 A;  2EKY A;  2XY5 A;  2B4U A;  3J7Z 5;  3G6Y A;  3ZC4 A;  4Y0F A;  5BR8 J;  1EJ7 L;  4Z7Y A;  1TKX B;  2R8G A;  3KWM A;  4RW4 A;  3W9H A;  1EX8 A;  4F50 A;  2C2N A;  3ELH A;  2MQL A;  2XS7 A;  2C1E B;  2EKN A;  4FNI A;  4J9S A;  4G1I A;  4U8V A;  4RUB A;  2ZBP A;  1TFW A;  4DJB A;  1IBK F;  1JKH B;  2FJA B;  1OS5 A;  5D0G A;  2KHC A;  1QTM A;  1T9X A;  4OX9 J;  5A2Q Y;  5DG8 A;  1XMO F;  1U47 A;  3ETO A;  1LW0 B;  3A3P B;  1S1X A;  3CDW A;  2HNY A;  3TQE A;  3PX0 A;  4NCB A;  1OQ3 A;  2UXD F;  1YKW A;  1B0T A;  3E2E A;  1VRT A;  3QPI A;  1IVZ A;  1CBK A;  1VQO S;  5D15 A;  2GCF A;  1GX6 A;  1WAC A;  4NLS A;  1NK4 A;  3CDB A;  1O5J A;  4WFA Q;  4X62 F;  4MFB A;  1H74 A;  4WKY A;  3PFO A;  1K47 A;  1WEZ A;  2IJR A;  2DEI A;  4IG3 A;  1UA1 A;  2MDA A;  3HMJ G;  3M2V A;  5GAG U;  1E6Y B;  1MWY A;  3AD9 C;  3KK3 A;  3UQS A;  4R5P B;  2A1B A;  1T8E A;  3JS9 A;  4C3K A;  2B56 A;  2XTJ P;  3T3F A;  3MR5 A;  1CJV B;  1NJW A;  2JX2 A;  3HI9 A;  4EZ9 A;  5CQG A;  5B09 A;  2AMC B;  2A18 A;  1RLD A;  3KDO A;  3W9I A;  5F8N A;  3NMA A;  4OJG A;  2OUG A;  3D28 A;  1GAO A;  5KOW A;  3OL8 A;  1NU4 A;  2OAU A;  1FCA A;  3EYZ A;  2OP5 A;  3SDE B;  1KBR A;  3HSJ A;  2UUT A;  3OFE A;  3D0G E;  3M8Q B;  5K8N A;  1DTQ B;  3N6L A;  4OL8 A;  1BQN B;  3KJV A;  1VCT A;  1XNR F;  3DLK B;  2DT9 A;  1OPZ A;  4OYO A;  3MM7 B;  5IC4 B;  2OML A;  4F4X A;  1X4C A;  3KLV A;  3OTO F;  4KRW A;  4UOH A;  4NLP A;  2VJV A;  1WOR A;  1SCJ B;  4CO1 A;  4PXE A;  1RTI B;  3HUL A;  2G2Z A;  3MM8 A;  1XNQ F;  1ZM2 A;  5KG1 A;  1JLE B;  2OD6 A;  1WI6 A;  4WP3 A;  2YNG B;  3UDE A;  5BYQ A;  4R25 A;  1YG0 A;  2RDD A;  4ZCK A;  4QU7 A;  1TAQ A;  2LEB A;  4NAS A;  4Y34 A;  4KHM A;  3TA1 A;  1QVG R;  2QL7 B;  3PJ9 A;  2WVB A;  1OO0 B;  5H9F J;  2O01 C;  1HR0 J;  3G82 A;  1RAF B;  3MMB B;  3U1N A;  2BUN A;  4MYU A;  1RT2 B;  3HPO A;  3B78 A;  5DZ6 A;  4JP8 A;  3PR5 B;  2GIQ A;  4YY3 F;  5T14 A;  5AE2 A;  3EJM A;  3QLH B;  5KFT A;  4KJI A;  4K5S A;  1HWU A;  3FUY A;  3QJJ A;  3IP0 A;  3IRX B;  2N4D A;  2AP6 A;  4I0W A;  3N28 A;  5LSR A;  3PIP Q;  3SQG B;  3GB0 A;  5K8M A;  2HIY A;  1FE4 A;  1XER A;  4J91 A;  3ISZ A;  3DHW C;  2V6A A;  1JLG B;  2IYI A;  2NYI A;  2CDQ A;  2WVE A;  3KLH A;  2DIV A;  4K4S A;  5K20 B;  2V94 A;  3TZZ A;  3ZZZ A;  4G3I A;  5EWG A;  1YJU A;  1BWV A;  4AXI A;  4DV7 J;  3HKW A;  5JJB A;  1IKV A;  2RNE A;  2NUH A;  1LW2 A;  4GO5 X;  4LSN A;  2JJ4 D;  4DV1 F;  3ENA A;  4FF3 A;  1NO8 A;  1TMM A;  2FHJ A;  2MKH A;  5AE1 A;  1REV A;  3PNI A;  2MZ1 A;  4B3S J;  5EHH A;  3DOK A;  1UCN A;  2KL8 A;  1S4E A;  3ZNJ 1;  3BV8 A;  2POK A;  2B6A A;  4CP5 A;  4ZVR B;  3CTR A;  2Z0G A;  3ENQ A;  3KK1 A;  1UVK A;  1EKS A;  4ZPW R;  3HXM A;  1SV5 A;  3UD3 P;  8ATC B;  1VDH A;  1SQE A;  1U1N A;  1FRH A;  4A47 A;  2DNL A;  3DRX A;  1MNE A;  2GML A;  2CPE A;  4AL6 A;  4DR6 J;  4X4P A;  2KTQ A;  4PR6 A;  3UR0 A;  1RHR B;  4RWW A;  2CJX B;  4FYY B;  1G2E A;  4JYA F;  1JLB A;  1NAQ A;  3HHL C;  4KIA A;  2A2D A;  1TR0 A;  3LF0 A;  2RRB A;  1U2F A;  2DIT A;  2DGU A;  2MY8 A;  1M1G A;  1ZAX A;  3GJR B;  3PXG a;  4ES2 A;  1XR6 A;  1KFS A;  2UXC F;  4LF8 J;  3B8H A;  3JTN A;  2XMM A;  5KFV A;  2BE7 D;  2J9D E;  2W9B B;  1EAY C;  3TZY A;  4AMP A;  2QSF A;  4B3M J;  4ZVO B;  3FMW A;  1NDL A;  4ELU A;  5F8L A;  4EUV A;  5IC6 B;  4ZIW A;  1R7I A;  2Q79 A;  3Q2S C;  4NA3 A;  3LP2 B;  2F63 A;  4OI6 A;  1RAC B;  3KLG A;  3DDK A;  1NME B;  3K2Y A;  1XN9 A;  4PG8 A;  4P72 A;  1TTH B;  1X9W A;  4DOZ A;  4OLO A;  3R2C J;  4ES3 A;  1FFS B;  3KLF B;  4M95 A;  3MAQ A;  1RB0 A;  3M8Y A;  1PJ5 A;  7FD1 A;  2HBR B;  2HHH J;  1RHM B;  3EIC A;  3M2U A;  1RAJ A;  3CC4 S;  1JJ4 A;  4MK7 A;  4Y2C A;  3D6H B;  4UT4 A;  2KXH A;  3R6L B;  1AUD A;  1JK9 B;  4RNN A;  2I2Y A;  4USJ C;  2NR0 A;  2H5J B;  2V8V A;  5G0R B;  2ASD A;  5DQH A;  3GII A;  1LW0 A;  4FNH A;  1CC7 A;  3OFH A;  1HNV B;  3W9J A;  3P45 B;  4DV4 J;  3Q2T C;  2GHW A;  1LXN A;  1XWL A;  5KG4 A;  4XPE A;  3G6X A;  1D8Z A;  2GX8 A;  1PIL A;  2MLX A;  3K58 A;  1FDN A;  2MQP A;  3QYY A;  4CYU B;  1J5E F;  2JLG A;  2L41 A;  1Q95 G;  2J0Q D;  2MEW A;  1LWC A;  4F26 A;  3OLB A;  3PX4 A;  5EUH A;  1T95 A;  2ZZN A;  1KVK A;  2YWG A;  4TXS A;  1EZZ B;  2JEG A;  2XMU A;  3SBM A;  2DNR A;  1FNO A;  2W2O P;  3ETM A;  4FYW B;  4I2P B;  5L1J A;  5F0U A;  5FDL B;  2DNZ A;  1E6Y A;  4UTG A;  2LLZ A;  4OZ0 A;  4JOU A;  1CJK A;  4R5P A;  4BWJ A;  1OMS A;  1W2B R;  3BGR B;  2YXL A;  5MAO A;  5U47 A;  5CZC A;  2F4F A;  3CJ8 A;  1CJV A;  4DPU A;  2CXE A;  3TAQ A;  4JI8 F;  2DD8 S;  4WYL A;  2FC9 A;  4DR1 J;  1WG1 A;  4M5I A;  2NYH A;  1VR6 A;  2ATC B;  2YWW A;  4RKU C;  5IZH A;  8RUC A;  3FCV A;  4G6V B;  3FRY A;  5C2G A;  2ASJ A;  1YLX A;  3D68 A;  3FMB A;  1L3S A;  2CA9 A;  5HQ8 A;  3T1H F;  2V8H A;  3I0R A;  3M8Q A;  4P2F A;  3ZTP A;  1BQN A;  2CQ3 A;  4USM A;  4YHH F;  3VAL A;  1FXR A;  3DLK A;  2QE5 A;  4QIW D;  2GO8 A;  2YKM B;  3DMJ A;  5IT9 U;  3MM7 A;  4QIE A;  2MKJ A;  3CD7 A;  2QMX A;  3QZ7 A;  2KG1 A;  4DLE A;  1U6F A;  2A0F B;  4DPW A;  3KG4 A;  2HRY A;  2LMI A;  5B0F A;  4OHX A;  1TV6 A;  3MAH A;  4ATN A;  4HVZ A;  4YR2 A;  2M9K A;  4B9N A;  1RTI A;  3MMC B;  5L9X A;  5L46 A;  3KKF A;  4AL5 A;  3T6J A;  2KFZ A;  1JLE A;  4ZPT R;  1S1T B;  3CD6 S;  4MKV A;  3SV4 A;  3C66 A;  1U0H A;  2EG2 A;  2RQM A;  2BV3 A;  3SFU A;  3W2V B;  5I42 B;  3MXH P;  3MM9 A;  1Q53 A;  3K89 A;  5C25 B;  4X4U A;  1M1K T;  5BXI A;  3BZQ A;  1R0C B;  4DI6 A;  4DX8 H;  4DQI A;  3KUH A;  2CJK A;  4RUH A;  3DKD A;  2W24 A;  1F0X A;  4OLP A;  5E2Q A;  4DX7 A;  5CA5 A;  1XQI A;  2V9K A;  4CLK A;  3BRE A;  1RT2 A;  4JBC A;  3V81 B;  1S0M A;  2CPH A;  5D6G A;  2JLE A;  3UDL A;  3BO4 A;  2OPS A;  1X4D A;  3RYL A;  5IOL A;  4HHH A;  2ZC4 A;  1CLF A;  4ERD A;  3CCT A;  2DRD A;  4DFK A;  3IRX A;  4YOE A;  2Y1I A;  4MIB A;  5DZ7 A;  4HLB A;  2ILZ A;  5AXN A;  3SQG A;  1DLO A;  4AND A;  5KFZ A;  2HQD A;  2HEK A;  4MKY A;  3A4T A;  2AX1 A;  2XNR A;  1JLG A;  1JB0 C;  2DGO A;  4I7F B;  2C2Z B;  4MYT A;  2UXD J;  2KRR A;  2Q66 A;  2XMK A;  3ZTO A;  4J9U E;  1R31 A;  2P6T A;  1UVN A;  2ZUG A;  2VAS A;  3NGT A;  1MU2 B;  4Z7C A;  1YIT S;  4O3Q A;  2QC3 A;  2JNJ A;  1QVF R;  4X65 J;  4TU7 A;  1Y9O A;  3SQO P;  5E41 A;  2Y3Y A;  3EVW A;  1SL2 A;  1QAX A;  3LP1 B;  3FSX A;  2FYX A;  3H7H B;  2ZWP A;  2FJD B;  1WDD A;  3HSG A;  2F5G A;  2Z2Z A;  4H4K C;  2AJ0 A;  2MKC A;  1MW7 A;  4AMN A;  5KFL A;  1SJR A;  2CZ9 A;  1IUJ A;  2IM1 A;  1V5V A;  1VIX A;  4G1P A;  3JSM A;  2MJN A;  1V5I B;  1QD1 A;  3JAM U;  1YJV A;  2WVC A;  2XCA A;  3MPW A;  6FDR A;  4J9M A;  1CJT A;  2W2Q P;  1X60 A;  1RAE B;  3RW7 A;  1C0T B;  4TU9 A;  2OEK A;  4PPD A;  1XTZ A;  2HWI A;  1H2T Z;  3EX7 B;  2SXL A;  1YRX A;  4Y00 A;  1N5Y B;  2M7S A;  4N77 A;  2Q6C A;  1D9A A;  3R7S B;  1NH8 A;  2W9B A;  4HR2 A;  2ZH8 A;  2DR8 A;  3LGN A;  3SXL A;  3OTO J;  4RUA A;  2HFZ A;  4BS2 A;  5LM7 E;  2JC0 A;  5B0C A;  3HT0 A;  2YWF A;  3P96 A;  2IA0 A;  2K7K A;  3IM8 A;  1XMQ J;  4CM2 A;  2XYG B;  2MJU A;  1Q82 T;  3LUY A;  4M94 A;  3LP2 A;  4IOA Q;  3Q86 A;  1OJ4 A;  2CJB A;  4J37 A;  1KQG B;  4K2X A;  1VMB A;  4WFB Q;  3U1M A;  1SVD A;  1FFG B;  3KLF A;  2B4P A;  4DSK A;  5HO4 A;  3TQ1 A;  3CCR S;  2UUC J;  4IO1 A;  3T19 A;  1P27 B;  3D1H A;  3RU0 A;  2IDL A;  2L08 A;  3DLB A;  1HPZ A;  4AMO A;  3CO9 A;  3HKZ D;  3KMS A;  5G0R A;  4DV2 F;  3PR4 A;  1OYD A;  3PTW A;  3HSD A;  3LGM A;  1FRI A;  1X8D A;  2A3J A;  4UST A;  2ROE A;  4PCQ A;  3BQ0 A;  5LSO A;  5J2M B;  3L7O A;  1VQ9 S;  3HO1 A;  3VAG A;  2X1A A;  2HS0 A;  3A8K A;  5AXK A;  1L3U A;  3F56 A;  3I9Z A;  2DO4 A;  4CYU A;  3RAX A;  2DR6 A;  5HMX A;  4FXV A;  4CO4 A;  4NXM J;  1NSQ A;  2WW4 A;  1KP6 A;  3GV7 B;  1RK8 A;  1KTV A;  1MLA A;  2UUA F;  2MZR A;  2JOQ A;  2ZH7 A;  2EFG A;  3AY0 A;  4I2P A;  5FDL A;  3TA0 A;  4X4S A;  3MCS A;  3GV5 B;  3O8W A;  4Y2K A;  1FKO B;  2Q6B A;  1YVF A;  2M4M A;  3GFY A;  3RAQ A;  2YKA A;  4PXB A;  2HQI A;  3PW2 A;  4ZVE A;  5H9E J;  2NXN A;  2DGS A;  2DPI A;  2HUR A;  2KXF A;  2QIF A;  2O1P A;  1YZ6 A;  5ETL A;  2PMH A;  2HHQ A;  4EYI B;  3N01 A;  2CDR B;  2FVQ A;  5KG5 A;  4WFN Q;  3I5C A;  4ECT A;  4GKK J;  6FD1 A;  4NWB A;  4DN0 A;  1T7P A;  4ZKA A;  5KFU A;  2ZBR A;  2VU5 A;  3THT A;  1WEX A;  3ZTS A;  3VQT A;  4CNY A;  2IC3 B;  3C19 A;  1QJH A;  3BYR A;  2X51 A;  4OZJ A;  2EBG A;  2LU2 A;  2XLI A;  2HRT A;  2CG4 A;  4DZ6 A;  1MWZ A;  4Y2A A;  3CUN A;  2ZJP Q;  2KVQ E;  3CDA A;  3MEE B;  3H5Y A;  3AJ1 A;  2OH2 A;  2JVO A;  2XMA A;  3FRZ A;  1S1T A;  1ZET A;  2NSC A;  2UXC J;  4CT9 A;  3TZW A;  4TKT A;  1HW9 A;  2NZ4 A;  3KHL A;  1NJY A;  1X9M A;  3CF5 Q;  2HBZ B;  2IRU A;  4QR0 A;  1G1X A;  3KLE B;  1XK8 A;  3W2V A;  1UJ6 A;  1WOS A;  5I42 A;  2HFS A;  5L9N A;  1J5O A;  2AYG A;  1NND A;  4EZ6 A;  3KNA A;  4DL2 A;  3OTB A;  4ZP7 A;  5HMZ A;  1BMQ B;  3G2X A;  5J2N A;  4X64 F;  4ZCM A;  5KFS A;  3KK2 B;  1T3O A;  3HT3 A;  4A8X A;  4LR8 A;  2WSF C;  3Q0A A;  3FSY A;  2J9C A;  5J2Q B;  3P6Y C;  2VFR A;  1NB2 A;  2ACY A;  4G1Q A;  1UZD A;  3GTY X;  4CO0 A;  2WOM A;  5HQL A;  4ZPV R;  2M52 A;  5DG9 A;  2HQC A;  3UN2 A;  5CYQ B;  2Y1R I;  2G0C A;  4C3L A;  3E51 A;  2DR9 A;  3UE2 A;  2W25 A;  2WB1 D;  3U1L A;  3TA2 A;  2F8H A;  3BJY A;  1PC4 A;  4AUK A;  2E29 A;  4M5D B;  1KWM A;  1WSV A;  2OGU A;  4NMX A;  2Z57 B;  2CQC A;  2CQ0 A;  2ZH4 A;  5KFN A;  4DV3 F;  2DR7 A;  4I7F A;  2AU0 A;  2H51 B;  3HHD A;  3GQC A;  3AH6 A;  1VQY A;  3J7Y I;  5LOQ A;  2GJ2 A;  4N47 A;  3OJU A;  2F1F A;  3LAN A;  3PAC A;  5CD4 H;  5DM7 Q;  4KH0 B;  1WKK A;  4NLO A;  4USI A;  3N6N A;  1RHK B;  5C24 B;  3POT B;  3D67 A;  1ZPV A;  5DJB A;  4ZVG A;  3W60 A;  2CPZ A;  3JSB A;  1NK0 A;  5KFG A;  4F0K A;  3R5D A;  4KT0 C;  3LP1 A;  1A6L A;  1CSJ A;  2XC9 A;  2VBZ A;  1V9O A;  2AKW B;  3TEH B;  2EI5 A;  3QRQ A;  3OVB A;  3QO9 B;  2HVH A;  5EDW A;  4NYP A;  2VDH A;  3NKY A;  1M5O C;  4CNZ A;  3M6V A;  2GIF A;  2V34 A;  2DH9 A;  5ADZ A;  3OUY B;  3R2D J;  1NZA A;  2P9G A;  2KVI A;  4OYZ A;  4K4T A;  5SUH A;  3NGR A;  1TL7 B;  2OIH A;  4L3N A;  2U1A A;  4ZP9 A;  2KM8 C;  3EGW B;  1SC4 B;  3TUJ C;  2VB6 A;  4KSE B;  2MQM A;  4YHH J;  1FVS A;  3G71 S;  4NLV A;  5E3P A;  4B9L A;  3HSZ A;  2LKZ A;  2B4V A;  1JJC B;  5E0O A;  2HZV A;  2QZ8 A;  4EEY A;  1IKW A;  3PZP A;  2C3U A;  1HNZ J;  1H38 A;  1B70 B;  4FXW A;  2QA4 S;  2IIH A;  2WSC C;  3J7Y U;  4XDD A;  4KFB A;  1NBE B;  2ERR A;  3QT8 A;  5B7W A;  4C8K A;  2NPF A;  2H54 B;  1PBU A;  1U24 A;  3TWZ A;  2D7S A;  4LQ3 A;  4DSF A;  4DLG A;  4DQQ A;  3GJS B;  3N5B A;  4DR2 F;  2ZHO A;  4LFC J;  1RWO B;  1U48 A;  1Q5Y A;  1Q7Y T;  2E5L J;  2ZJQ Q;  1Q8K A;  3QGI A;  4OIX A;  3LGH A;  3ZZT A;  2R7U A;  4GC6 A;  4YR0 A;  1R6Y A;  5F8H A;  4N56 A;  1OYE A;  2RKI B;  5J2M A;  5CZV A;  4GRS A;  2EC2 A;  5E3C A;  3W65 A;  2KYZ A;  2Q1L A;  1TVR A;  4IH5 A;  3HCX A;  3W5X A;  2I6W A;  1PGZ A;  1VQN S;  3R1L A;  2LFV A;  2KFY A;  4FN5 A;  4RO0 A;  1NJX A;  3CO0 P;  2E1R A;  2MKY A;  2ALY B;  4DL3 A;  5L38 A;  2QO3 A;  5B0B A;  1Z1Z A;  1I6J A;  4B17 A;  4O3S A;  3IAS 9;  1A7G E;  2UV8 G;  1FKO A;  1S79 A;  1YIJ S;  5C7P A;  4LF7 F;  4YDD B;  2DKO B;  4ZS6 A;  4LIR A;  2V2K A;  3OTD A;  1FO1 A;  1GXU A;  3N0V A;  2AGO A;  5KFB A;  3C15 A;  4IDK B;  4WE1 B;  1JJ2 R;  4D3H A;  4QYZ K;  4PYA A;  1B3T A;  3GFZ A;  4DQP A;  2YKQ A;  4ZOS A;  3IWN C;  3GYG A;  4USK A;  5KT7 A;  3VVT A;  1HBN B;  2AJQ A;  2MZJ A;  4RBU A;  3SFG A;  3D9B A;  4L76 A;  3CCU S;  2W8L A;  1NSP A;  1ZZF A;  1VOM A;  3L95 X;  5DQI A;  1DJ0 A;  2VG7 B;  5J2P A;  3L3C A;  2V63 A;  2YWK A;  1I1G A;  2DGQ A;  4B3O B;  3UNY A;  4DQR A;  2X1F A;  2IC3 A;  3KHH A;  5LL6 d;  1FWP A;  3GIJ A;  2VOO A;  1HBU A;  2VBX A;  3BN4 A;  3GPA A;  4PG7 A;  1BQM A;  3RB0 A;  1B7Y B;  4A8O A;  4EGL A;  2UXB J;  4NI2 B;  2BKP A;  3MEE A;  3H98 A;  1H72 C;  1HKA A;  1BD6 A;  2JZ5 A;  4L74 A;  1P9Q C;  3PFE A;  2FQQ B;  5AXM A;  1BY9 A;  2BQU A;  4QBU A;  4ELV A;  2PE8 A;  5KFY A;  4LF6 F;  4Q7A A;  4DEZ A;  1S48 A;  3PEH A;  1S0V A;  2B7C B;  5D4P A;  2L9N A;  2HHV A;  1FI4 A;  2AEJ A;  1JNR B;  3H5S A;  5JVG Q;  1R0B G;  4ZCI A;  3ISN C;  1YJ9 S;  1WKL A;  3KK2 A;  4K0K F;  5AJ3 J;  1T03 B;  3Q89 A;  3WX4 A;  4F0M A;  4FZV A;  1S7H A;  1S7I A;  3DXS X;  1FWK A;  2LEP A;  4DZD A;  1BHN A;  5K8P A;  3KUE A;  4J7C A;  4O0N A;  1X5O A;  1K9M T;  2NPI A;  2M70 A;  2PFD A;  4LF9 F;  1HWK A;  2AHO B;  1SL1 A;  4J90 A;  4NYZ A;  4DL7 A;  5KG6 A;  3MPD A;  3AB2 B;  1DZ5 A;  2UZA A;  2WK4 A;  4C4W A;  2LQJ A;  3OHB A;  3T5H A;  1X31 C;  1LFP A;  3NG8 A;  4U9R A;  2RRN A;  4RW7 A;  3BKU A;  2VDI A;  1IBM F;  3V6D B;  1B4S A;  2CWX A;  2V8D A;  2MQQ A;  2WTF A;  2YY3 A;  3KLI B;  2VZ8 A;  4WYW A;  4QPX A;  2JRS A;  3MAA B;  4NL5 A;  2LCW A;  4ZN1 A;  3VAJ A;  5C24 A;  4UZC A;  1NLK L;  2PMW A;  4MKA A;  4BLG A;  1WHX A;  5J1N A;  2BJ8 A;  1J2V A;  1WG5 A;  2H4W B;  5JMN A;  3VV2 B;  3CME S;  3T6B A;  2VKZ G;  5IFM A;  2RHQ B;  4WCE Q;  1TFY A;  2Z2L A;  2FHM A;  3J80 U;  4NYO A;  3DOM B;  2LU1 A;  1XBW A;  2KG0 A;  1K0V A;  3OT9 A;  5CYM B;  1F5C A;  3P5T L;  3CJ0 A;  1RLC L;  4WTY A;  1VI7 A;  4JV1 A;  2VQE F;  3OUY A;  3G87 A;  5ETR A;  1CUL B;  3FSI A;  4NEZ A;  1TQL A;  2AYE A;  2LYV A;  2UVW A;  5KFJ A;  1RBO B;  1TL7 A;  5K5M A;  2FHO B;  1RWM B;  5LMN F;  5LMU J;  2DCL A;  2AYM A;  4PQA A;  5KG7 A;  3VQS A;  4X2B A;  4DBQ A;  2JFK A;  2GHP A;  2JDJ A;  3MFI A;  3HVA A;  2H5E A;  5KFC A;  1F6T A;  3R5J B;  1UKU A;  3FBB A;  3JQM A;  3BGL A;  1DQA A;  4WU2 A;  1SC3 B;  4AL7 A;  2Y1L B;  2YNH B;  4M8L A;  3M8Z A;  4MJK A;  3PO5 A;  4JV2 A;  4ZVU B;  3MFH A;  4KO0 B;  1WD6 A;  1YDL A;  4Y6I A;  1R27 B;  2OEJ A;  4NE9 C;  4F7V A;  3MM6 B;  1TK5 A;  2HBY B;  1FX4 A;  1N56 A;  1F3V A;  2B3T B;  2J0X A;  4Z37 A;  5FLX U;  2ABY A;  3QBC A;  1WF2 A;  2D1C A;  3HZG A;  1B0V A;  4IRC A;  4Q0B B;  2KO1 A;  4RW9 B;  3QSI A;  2K1R B;  4B9M A;  1HIY A;  3A13 A;  2VHG A;  4JI7 F;  2BQR A;  5K14 B;  1M5S A;  2ZM6 J;  2MYF A;  4TY8 B;  2CNO B;  1WNE A;  4LBI A;  1X7V A;  5EX3 A;  2XI2 A;  2EEY A;  4L6V 3;  2VG5 B;  2XWY A;  1X4A A;  1QAJ A;  3OL9 A;  2XNQ A;  3B6B A;  2VH7 A;  1S1U B;  3NMR A;  3UN5 A;  2VBW A;  2B4O A;  4DUZ F;  2RKI A;  1N5Q A;  2JWN A;  3QAU A;  4C2M A;  3FBC A;  4CRJ A;  4IG0 B;  2UVU A;  2MLY A;  1U26 A;  3DM2 B;  3NGK A;  4UY8 5;  1GMV A;  2D9O A;  3R3T A;  1LK5 A;  4LUB A;  3T9Z A;  4ZP8 A;  4I56 A;  3V6J A;  4KHR A;  3KHG A;  1JLQ B;  4RPF A;  3VAK A;  1S0O A;  1SC6 A;  3DDI A;  2QFI A;  3QSY B;  4F3O A;  4MH8 A;  2OEM A;  3BS9 A;  4F4W A;  4ILL A;  4JI0 F;  3B4D A;  2ASL A;  3BPD A;  3OXF A;  3FJ2 A;  4LFB F;  5AE3 A;  3HFV A;  1XIQ A;  3MOJ B;  1KNZ A;  3JXO A;  1Y4Z B;  4ED7 A;  4PXD A;  2NCK L;  4KGK A;  3NL0 A;  3SIP B;  2FPH X;  1SXL A;  3O3L A;  1UMJ A;  3H25 A;  2W9C B;  3FZ2 A;  3B4M A;  1RTH A;  1IR2 A;  4WE1 A;  2Z4P A;  4ZDN A;  3OXG A;  3KJQ B;  3BM7 A;  3LPY A;  2ACM A;  1FRL A;  3B82 A;  1RIS A;  3AJD A;  4DR5 J;  4O3O A;  5A8R B;  1CJU B;  5HBM B;  1ZM4 A;  3OR1 B;  3BF4 A;  4AT1 B;  3G4S S;  2ZUA A;  3I0S B;  2VOP A;  2IA6 A;  2VG7 A;  3J7A 1;  1HNW J;  4QIF A;  1YRT A;  4OX9 F;  4HAC B;  5AT1 B;  4B3O A;  2V68 A;  1CEZ A;  3ZZP A;  2C2M B;  3GE9 A;  3CJT A;  4CTA B;  2B9Y A;  3NBP B;  5D0H A;  1FER A;  2X1G A;  3DLE A;  5GAD U;  1AXQ A;  2CPI A;  3EXY A;  4WK3 A;  1DFD A;  3GIK A;  4UOF A;  3TVZ A;  3PKM A;  5M2P A;  4P73 A;  2QMU B;  2EBE A;  3G6E S;  2IY5 B;  1FT8 A;  2O67 A;  4MIW A;  4DX5 A;  2LA4 A;  3EE3 A;  1N0V C;  2VQF J;  4USW A;  1FRX A;  9ATC B;  4C7Q A;  3CCV S;  4A46 A;  1G6B A;  2EC0 A;  4ICL B;  1UZH A;  2C2R A;  3PW0 A;  4NLQ A;  1L3T A;  2HVZ A;  5T7L B;  4NCG B;  5IWA J;  4W90 B;  4UZB A;  2BRL A;  3IXQ A;  4ZVT B;  1HNI B;  3GCX P;  1H7X A;  4WU3 A;  1SJ3 P;  1T03 A;  4C48 A;  3CCS S;  3VZH A;  4QCL A;  1BLU A;  2NXJ A;  1TUW A;  3ZO7 A;  4FVC A;  4OX7 A;  2CQI A;  3RRK A;  5IS2 A;  3CCW A;  1H98 A;  2UUB J;  2P8I A;  2GQ2 A;  3RUB L;  5SZT A;  2DGX A;  1RWK B;  3CSK A;  4ED8 A;  2DHS A;  3FC9 A;  1YK9 A;  2J7K A;  2MGZ B;  3Q8Y A;  4RNM A;  3HHL D;  2IDE A;  2AGP A;  5HJX A;  2DO0 A;  3RTV A;  4DG1 A;  2XLK A;  2DCU B;  5G4D A;  4E0D A;  4LF5 F;  1R8P A;  2BW2 A;  3OL6 A;  4WFY A;  3NCP A;  1KTQ A;  2CWK A;  2IVM A;  2CQH A;  4M5H A;  2KHD A;  2CKW A;  4HEA 9;  5HRO A;  1S57 A;  2J7U A;  2RH3 A;  3MAA A;  3CPW R;  3GIR A;  3H4B A;  2VOD A;  2ZBC A;  5L8R C;  2FB0 A;  3TX8 A;  3OBI A;  3GLJ A;  5HI7 A;  4CLL A;  1RT6 A;  3QRP A;  4N41 A;  2APO A;  4ETZ A;  4FBT A;  4LF7 J;  1ZBT A;  2EK1 A;  1GH8 A;  4DF8 A;  4WFZ A;  1C2P A;  5DLG A;  1IWG A;  3DOM A;  4QQB A;  1N33 J;  1HR0 F;  2GAG C;  4OHV A;  1X4H A;  2WB4 A;  2I5J B;  4C0O C;  3IO1 A;  2LEC A;  1N52 B;  3I4H X;  1S6P A;  4PWD B;  1UAW A;  4NLD A;  2J9D A;  4ZVH A;  3M6W A;  1D1U A;  2LXI A;  2QL9 B;  3W8G A;  2BRK A;  2RAQ A;  1AUS L;  1GEH A;  4RU2 A;  1XEZ A;  1N34 F;  3T41 A;  4OZL A;  1VBZ A;  4NLW A;  3UWT A;  2DPJ A;  3IMQ J;  5KTQ A;  2LP4 A;  4FXD A;  1I94 J;  1ZOT A;  3MHY A;  3LP0 B;  3KYL A;  1U8S A;  4HDH A;  3BPS P;  4CO5 A;  2GJI A;  3QAE A;  2CYY A;  2V8G A;  3HHL B;  1UEK A;  2VG6 A;  3LWM A;  4U96 A;  1FRM A;  5I3Q A;  2D3U A;  2RUS A;  3AFG A;  2QJ3 A;  2E7W A;  4DV7 F;  3O5T B;  4KO0 A;  4A8M P;  2MST A;  2E1M C;  4A8S A;  1KHV A;  3UO0 A;  4DU7 A;  1NH7 A;  3MM6 A;  3DRS A;  4ZVF A;  3AOC A;  1N88 A;  5KFO A;  4LF6 J;  4DL0 C;  3R1H A;  3D4J A;  4Q0B A;  3D2W A;  4ZPA A;  4LSL B;  4QR1 A;  3MUM P;  2K1R A;  4NLG A;  1Q5V A;  4B3S F;  4W98 A;  1RT5 A;  1YZ7 A;  3KDN A;  2E5J A;  5GAE I;  1SBR A;  4TY8 A;  2V2Z A;  4ZN3 A;  1X4E A;  4CM0 A;  3W3S A;  3JTP A;  3OPK A;  2RU3 A;  3I96 A;  4C8Y A;  2AQ4 A;  4JI5 J;  3W1Y C;  3NCR A;  2F8E X;  4DR6 F;  1S1U A;  1YJR A;  3PEJ A;  3AB4 B;  3L4B C;  4P71 A;  5B08 A;  1HBM B;  2CQB A;  3EPG A;  4ZJQ A;  2Z2Y B;  4DXL A;  4IG0 A;  2EWH A;  2HK2 A;  2WZ1 A;  3DM2 A;  1ZH5 A;  2J0S D;  4JV5 J;  2KZM A;  1BQX A;  4ELT A;  4OYA A;  1JLQ A;  2XEX A;  2H4Y B;  4LF8 F;  1SQG A;  3M1V A;  3D6M B;  2QL5 B;  2MKS A;  1RTZ A;  4KHP F;  4RLE A;  4CO2 A;  3VAF A;  4DV0 J;  4B3M F;  2EK6 A;  1URN A;  2OPQ B;  4RNH A;  3MD3 A;  2IMW P;  4OYX A;  2XSF A;  1ACM B;  1FD8 A;  3IM9 A;  3GZ7 A;  4IR9 A;  4NEY A;  1WKJ A;  1S99 A;  2H48 B;  1R6V A;  4L3K A;  3TNV A;  4RNO A;  5F8M A;  2W9C A;  4E8U A;  3TO8 A;  1DQ9 A;  1NB7 A;  1U1P A;  4P74 A;  4ZPD A;  2HS3 A;  2KZZ A;  1QM9 A;  3FQK A;  4YB7 A;  5A8R A;  1CJU A;  2HHH F;  2HNZ B;  3OR1 A;  4ECZ A;  4X4T A;  3I0S A;  3NOC A;  2R8J A;  4U6P A;  3RG6 A;  3TRG A;  2BYC A;  4I67 A;  1Q81 T;  4NLU A;  4QWE A;  4CTA A;  3H90 A;  4C8O A;  2E5G A;  4IR1 A;  4X4O A;  3NBP A;  2CQ1 A;  1N32 F;  4ILM A;  3C14 B;  3GWC A;  1YBU A;  1RSC A;  3LA0 A;  3R8Y A;  2DY1 A; 
#chains in the Genus database with same CATH homology
 2QC3 A;  2JFK A;  2G2Z A;  4QBU A;  2JFD A;  4RR5 A;  4AMN A;  2H1Y A;  2G1H A;  4RL1 A;  3TZX A;  3TZW A;  3HHD A;  4AMO A;  3TZY A;  3IM8 A;  3R97 A;  3TQE A;  5DZ6 A;  4AMP A;  2QJ3 A;  3RGI A;  3CJ8 A;  3SBM A;  3TZZ A;  4AMM A;  3BV8 A;  2C2N A;  1NM2 A;  3EZO A;  3G87 A;  2G2O A;  3QAT A;  3K89 A;  3PTW A;  2CUY A;  3HJV A;  3R8Y A;  1MLA A;  5DZ7 A;  3IM9 A;  2G2Y A;  3H0P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...