3TZYA

Crystal structure of a fragment containing the acyltransferase domain of pks13 from mycobacterium tuberculosis in the palmitoylated form at 2.2 a
Total Genus 179
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
179
sequence length
464
structure length
464
Chain Sequence
ELPGVTEEALRLKEAALEELAAQEVTAPLVPLAVSAFLTSRKKAAAAELADWMQSPEGQASSLESIGRSLSRRNHGRSRAVVLAHDHDEAIKGLRAVAAGKQAPNVFSVDGPVTTGPVWVLAGFGAQHRKMGKSLYLRNEVFAAWIEKVDALVQDELGYSVLELILDDAQDYGIETTQVTIFAIQIALGELLRHHGAKPAAVIGQSLGEAASAYFAGGLSLRDATRAICSRSHLMGEGEAMLFGEYIRLMALVEYSADEIREVFSDFPDLEVCVYAAPTQTVIGGPPEQVDAILARAEAEGKFARKFATKGASHTSQMDPLLGELTAELQGIKPTSPTCGIFSTVHEGRYIKPGGEPIHDVEYWKKGLRHSVYFTHGIRNAVDSGHTTFLELAPNPVALMQVALTTADAGLHDAQLIPTLARKQDEVSSMVSTMAQLYVYGHDLDIRTLFSRASGPQDYANIPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Polyketide synthase PKS13
publication title Biochemical and structural study of the atypical acyltransferase domain from the mycobacterial polyketide synthase pks13
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 179
structure length 464
sequence length 464
chains with identical sequence B
ec nomenclature ec 2.3.1.-:
pdb deposition date 2011-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00698 Acyl_transf_1 Acyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.250 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Malonyl-CoA ACP transacylase, ACP-binding 3tzyA02
3.40.366.20 Alpha Beta 3-Layer(aba) Sandwich Malonyl-Coenzyme A Acyl Carrier Protein; domain 2 Malonyl-Coenzyme A Acyl Carrier Protein; domain 2 3tzyA01
3EZOA 4RR5A 3K89A 2G2OA 3IM8A 1NM2A 2C2NA 3RGIA 4AMNA 2G2ZA 3HHDA 3CJ8A 3HJVA 2G2YA 3R97A 5DZ6A 3PTWA 4RL1A 3QATA 2JFDA 3H0PA 3R8YA 2JFKA 3TZXA 4AMPA 5DZ7A 4QBUA 3IM9A 4AMOA 2G1HA 3BV8A 1MLAA 4AMMA 3SBMA 2QC3A 3G87A 2QJ3A 3TQEA 3TZZA 3TZYA 2CUYA 2H1YA 3TZWA
chains in the Genus database with same CATH superfamily
3D5MA 3MXHP 3GMGA 1R27B 3LPEA 2E7XA 2H9ZA 5F8JA 2ILYA 4CIOA 3CCZA 2VPWB 1FJCA 5HK4A 3CMES 5L1LA 3K89A 2HFZA 2HQ3A 2LA6A 1QSSA 4JI6J 1YJTA 2DGUA 2DY1A 2DGWA 4LF1A 3DHXA 4PQAA 2DHAA 1K1SA 1U1OA 4YQWA 3QIPA 4H4OB 1QLNA 2CQ1A 1FEEA 2DD8S 1H3DA 3HZEA 1KWMA 1U4BA 3KNGA 2GIRA 4DV4F 3GJQB 1S72S 4DQQA 2ZHBA 1TV6A 4IH6A 5EN1A 1CJTB 1XMQF 2YKOA 1HD0A 4TU7A 1JLGA 3NXZA 1GXLA 1MNEA 4ZDNA 3PW2A 3G6VA 4N56A 3QRRA 4P52A 3IO1A 3NS7B 4KO0A 2CQHA 1J5OB 3S7RA 2KZZA 1IJFB 3GIKA 3HULA 2BKPA 1AROP 4PQUB 3M6VA 3Q23A 4P7TA 1XQIA 2ZEJA 1RAHB 1JLFB 1NPRA 4DS4A 4C8YA 2DNGA 3MOZA 1T94A 4FYWB 3BYPA 1ZETA 3D6HB 3LPYA 3W9JA 3W8GA 4CT9A 4X4OA 3IRXA 5J2PB 2OFGX 3C16B 4J9MA 2W1BA 2ZUAA 4X4SA 8ATCB 1NU4A 4OHXA 4DI6A 2VA3A 2OFHX 4C7QA 3A4TA 2GIQA 3NOCA 3PM9A 3W64A 3LW5C 3M6XA 3PNIA 2F4FA 4EYIB 3VR1A 4J9SA 4JI0J 4LT6A 2AJ0A 3PW0A 1TKXB 3SEOA 1KLMA 2ZOGA 2KN4A 4WCEQ 4DV5J 1HMVB 3ENAA 2BE2B 1Q79A 4NEZA 1WF2A 3VV2B 2DCLA 1TK8A 3IG1B 2WVFA 3VQSA 1LW0B 1LWXA 4DFMA 3W60A 1UVIA 4FS2A 1JJ4A 4ER8A 5F8HA 4OZLA 4YMEA 2AEFA 2I5JA 4U95A 4LQ3A 4HYKA 3HK2A 4B3MJ 2DIUA 5F3TA 1KQKA 4M5DB 3UR0A 4USHA 1SC1B 1H2VZ 4Q5VA 2EFQA 2VBXA 2ILZA 2RQKA 4DSFA 1IKWB 4WK3A 4NLPA 1ZM2A 3JYTA 1G6BA 1BXNA 2QMUB 5C2CA 4LSLA 2YXLA 1CC7A 1WHYA 1NKCA 1IXKA 3NAHA 3BQ0A 4MKBA 2FGOA 4H4MB 1WHXA 5I42A 1FE4A 2FJEB 7AT1B 4UUWA 3J7A1 1S76D 1S6OA 2U2FA 4AL6A 2DR9A 3R7BB 2RUSA 1H72C 2ZWPA 5IQ6A 5EHHA 3N6LA 5LM7E 1YWXA 5E0OA 5AXKA 2MQQA 5HBMA 4B9NA 2Y1IA 2ZUGA 4Q0BB 1Q53A 3PJXA 1S0MA 4X4QA 1KQFB 2ZM6J 4DUYJ 3M2VA 3PIOQ 1ICEB 1SC6A 3SQGB 3D6FB 1TL7B 4Z7CA 2UUWA 3KHLA 3KWMA 2VJVA 1UMJA 1EQ0A 4QW8A 2BOAA 2XZDB 2VC1A 4AMPA 1UW9A 4F4WA 5HP1B 2ZZNA 3IAM9 3THTA 4LFCJ 5J2NA 3MEGB 2UUAF 1FWLA 2NYHA 3TEGA 2J0WA 2JLEA 2XTJP 1BE4A 4K4YA 3M1VA 4ITSA 3OUYA 2KZMA 4RW7B 1RT1A 5KFDA 2RB7A 2DNQA 3L7OA 3I4HX 3RRHA 3KG1A 4I2PB 2RHQB 3MMBB 2MSSA 4BS2A 4Q2MA 1T3NA 4PKDB 2VFRA 3RBZA 2AJQA 2HHHJ 2DRDA 3LH2S 5I3PA 2XNQA 2AEMA 2XMUA 3T1YF 1UFWA 2A3JA 3GJTB 3MPVA 5I3UA 1YGYA 4IRKA 3KMQA 2OEKA 3BB5A 2VOPA 2OAUA 4P2MA 3Q8QB 3RJMB 1JLCB 2PMZD 2HWHA 1X4AA 3HSJA 2XMKA 4J9LA 1HNXJ 3KJVA 4F4AA 2C2ZB 2AIRB 4KJIA 1T9TA 2HFUA 3DLEB 4Y6IA 4I7FA 1J5EJ 3M8SA 4Y3CA 5D78A 2W25A 4DXLA 4IG0A 4X62F 3ONQA 3NNHA 5KG7A 1SH2A 1T9WA 3JTOA 1S1WA 5KFOA 5DS7A 1RKIA 1T8EA 4RNNA 2B7BB 4ETXA 3HLUA 1V5IB 4PUOB 4BHQA 3QFWA 3QAEA 2VG5B 4ZCKA 1S9FA 3C3LA 2JEFA 5CYMB 1AFJA 4GKKF 3GG1A 1WI8A 3N5BA 3HSZA 3DOKA 3AA8A 4DUZJ 2QA1A 2H5JB 2M8HA 2H4WB 4FPRA 2G0JA 4YY3F 3BEGB 1VQYA 3LQVA 4GVLA 3RBDA 2VPZB 1Q8LA 2BRKA 3ZZOA 2A6OA 2XMVA 4YB7A 4HR2A 4O3NA 2OPPA 3GPAA 2CQCA 3OVSA 3P6YC 1S5ZA 3FC9A 3W65A 1S79A 4EFAC 5DDOC 1U1MA 1R43A 1EETB 4Q8FA 4NXMJ 2JEGA 2ZH9A 2FHKA 2Z56B 2LFVA 1KVJA 3IS9A 1R8HA 4DR2F 3T19A 3WDOA 2YX7A 1ULRA 1F3FA 3TYTA 2NXCA 2M9KA 3EGWB 2HVEA 5A0YB 2GAHC 4LR7A 4OFZA 1HQEB 4RWWA 3OBIA 4OYAA 2VL1A 4RW4B 1HI1A 3HP6A 3DU6A 2K3KA 1QAXA 2QL9B 2F8HA 1WG5A 2HYIB 1VRUB 4DL5A 4CLUA 1N36F 4J9PA 1TKZA 3CXCR 2CZVC 4DV6F 1LW2B 1WACA 2CPYA 2LVWA 2R9LA 1RCXB 4ZJQA 1CQMA 5KG3A 4KSEB 2R8IA 1PC5A 2Q3PA 2KKHA 3PV8A 4XDDA 3D1QA 2BBEA 2UXCJ 2V9WA 3M8YA 4IR1A 1HR0F 3QIDA 2IYIA 4A8OA 3MECB 4LF2A 3UD5A 3O44A 3D7SB 4WK1A 3VGTA 4CO4A 4ERDA 1TL3B 3HT0A 4DSEA 3DI6B 4DPTA 4NWBA 3S6EA 1FDAA 1FKPB 2V0NA 1DQ9A 5KFGA 2RS2A 1QE1A 2BRLA 3F41A 3I32A 2DR6A 2FTRA 4X4NA 5EGYA 3QFHA 2H65B 5IZHA 4ZPAA 5E7OB 5EX3A 3W9IA 2IDLA 3B82A 1HBUB 3F56A 3VVTA 1X4CA 2MLZA 4UZBA 1PIEA 1WI6A 2WK4A 3BDEA 2BQUA 1YRTA 4B3RJ 1WC0A 3PACA 3D2WA 3D6TB 3Q83A 4USTA 1X4BA 4U96A 4GO5X 4ZVSB 4ZOSA 4R8UB 4LRFA 5GAHI 1QTNB 2IJFA 3HHDA 5J2QA 1YBTA 4AYBD 3CDWA 3MFIA 4AUKA 1R3NA 4JV5J 1Q16B 4IFYB 2O3DA 4F26A 3EICA 1N5YA 5C42B 5G0RB 3BM7A 1T05A 3MPDA 2CJAA 3Q2TC 1KDNA 3LO3A 2YKAA 3T6BA 2W8KA 3AA9A 1D9DA 3CCES 2HHUA 2WONA 4X2BA 5CYQB 3QQCD 2B0GA 5KFMA 1DTQB 3VAHA 4WE1A 2RSQA 3CDAA 1YBUA 4LSNB 5KFKA 1CS4A 2OD6A 5J1EB 4LF8J 1HI8A 2CQPA 2ZDPA 1S6QB 3KK2B 4O3RA 3LP1B 3DFEA 2MKKA 4ED0A 1FVSA 2ASDA 5EUHA 4RL1A 2XSJA 3BSCA 2YKMA 4QYZJ 4W98A 2BV3A 4UF4A 2YWGA 4RUBA 5SUHA 4Y65A 4ED1A 3SIPB 1EQMA 2FD2A 3B78A 5KTQA 4DV2J 3CO0P 5KFHA 3JSMB 2V2KA 1N33J 4RU2A 3BQ2A 3RAQA 1SC4B 5B0EA 4DR5J 3BGOP 4DV5F 4C11B 3M9NB 1RGVA 4RX6A 4WTYA 2JLFA 2G2ZA 2V8PA 1PJ7A 1LK7A 3KFWX 2GVZA 2WOMB 1N4LA 2MQNA 2QYGA 2CDQA 2C2OB 1FRHA 3QGGA 2LXFA 3PEHA 4K5RA 3G8SA 2DY9A 3GV8B 2KHDA 1C0UB 1UTAA 1EAYC 2PSZA 4F4XA 5JJBA 1JLBB 1JMTA 3H5XA 2BW2A 3VF0B 2YTCA 3M8QB 3N0VA 1I5OB 2G2OA 5E3AA 3A3OB 5D15A 5KFEA 1HNZJ 4A8QA 3BGUA 2AF6A 4H4KA 5JVHQ 2E1MC 1DURA 1ZH5A 1DTTA 3D0HE 4O44B 4NLWA 4Y34A 2PD1A 3TARA 4GKJF 2NXEA 3P5BP 3GIMA 4UY85 3TA1A 2XY6A 2DEIA 1QAIA 3LWMA 1W25A 3AFGA 2N7YA 4KAIA 5HMWA 3E01A 4BWMA 2HNYA 4DN0A 1G3OA 2C1EB 3A8EA 1Q86T 3FRZA 3BR9A 4O3SA 2MKIA 4OIXA 5F8GA 3R2CJ 2ERRA 2LQ5A 1RA7A 3MGJA 2KT3A 2C2KB 2QL7B 3UDVA 4USKA 1Q95G 1VBKA 1WEXA 4DUYF 1NHUA 1JLEA 1LFPA 5B0AA 2FLPA 2LQJA 4FBTA 2KYXA 3WHIA 3WC2A 2CPHA 2HNZB 2OPSB 4ELTA 4CT8A 1VK8A 5BYQA 3EYZA 2GZOA 2W2NP 5IT4A 4Y2KA 2AJ1A 1R7IA 5F8LA 4C4WA 3T1HF 4DX8H 4OYBA 1VOMA 1MMDA 2HRYA 2NSBA 2MZTA 3R3TA 2B51A 2JEJA 2ZWOA 2UUBJ 1WHWA 3IR6B 4ZVFA 1T95A 1UVMA 2L3MA 3HI9A 3GCXP 3CCWA 1R8CA 2FVCA 4PG5A 2Y0BB 4EI2A 4YOEA 2KFZA 2FB0A 2UXDJ 2KRBA 2FC9A 3DC2A 3N28A 1IKXB 2J9EA 4DJBA 2YKPA 3W66A 4URSA 3C19A 2E1CA 2V94A 4TN2A 2PA8D 2DIVA 2QSWA 5KFLA 3KK1B 2PE8A 1X31C 1TFWA 2BM1A 2UV8A 1H73A 2KHCA 1VQ5S 2R2SA 5CQGA 4DHVA 3OVAA 1RHRB 2QLWA 1SPBP 1FO1A 1YITS 2VZ9A 4Y00A 5D4LA 3DYAB 4K8RA 3PYGA 1ZYQA 3DGPB 1XR5A 2I9SA 3OXLA 2CVIA 3ET6B 2J9CA 4HI2A 2CNKB 2L41A 4UOCA 3KLEA 2HLTA 2YWFA 4DU7A 3W5XA 4LF7J 4DR6J 4V1Ak 1NKBA 3UWTA 2M4MA 3E8OA 4LIRA 1CJUB 1S1XA 2W24A 5HMZA 2IHR1 3F44A 3UN2A 4NYOA 2HURA 2ADBA 1FRXA 3RZAA 4KHPF 4X65J 1U24A 2HWIA 4ECUA 2Y0SD 5A8RB 2BJ3A 1IR2A 2B7CB 5CABA 1VLOA 2Q43A 4RW8B 1FFGB 3TUIC 3OQ2A 5IWAJ 3TQEA 1FTRA 4DUZF 4CH0S 3P96A 1XEZA 1RT6B 4F7VA 1HWKA 1FA0A 4EO6A 4ZN3A 2BZ2A 4UTGA 4KIAA 2GW8A 1YTYA 4OJHA 2E1AA 3MPWA 3GIRA 1Q0NA 4ZCMA 4AQYJ 3BGLA 3QSIA 4TY9A 5HMYA 3HHLD 5C25A 2D3O1 2IBOA 2MTLA 2HMIB 4NL5A 2A6MA 2JH3A 3TUZC 3RTVA 4NXMF 4Y2CA 1YJWS 3U7JA 2UV8G 3WZ0A 1U49A 4L72B 2RRBA 1RT2A 2VFSA 1PBUA 1PO6A 2Z0GA 1RU1A 1S59A 1TAQA 3F73A 1NJXA 3RB6A 4DF4A 2F9DA 2J0XA 3QZ7A 2IRUA 3HFZB 2L48A 3VGSA 4RBVA 3I5AA 1RWMB 1YRXA 1GNKA 1D9AA 1GK8A 4DL7A 1PAEX 4M95A 1CJVB 2JC1A 5KFZA 3PFEA 3PKYA 3SQOP 1KC8T 1N6QA 3QATA 2FJAB 4KPCA 5EX0A 5DZ7A 2MLYA 5FJ4A 2ZH4A 4B02A 2IJRA 1X0FA 1VQSA 3ZTOA 2KM8B 3TR5A 3WIUA 2J76E 2YKQA 3JAMU 5ADZA 2XYHB 3GV5B 4XPEA 2CWXA 2IC3B 5DG9A 5L1JA 4YB5A 1TUVA 2XMJA 2NZ4A 4DUTA 1NMEB 5DDQC 4ETZA 1T03A 2AYMA 1WF1A 2RKIA 1AW0A 5DM6Q 4DZDA 2BXJA 1YRUA 3DXSX 1H74A 5F9LA 3NGTA 5MAOA 2HLUA 2IM0A 2VF3A 1W2BR 4NA1A 4FXDA 4Q45A 3KLFB 1HL6A 2EG1A 4XIUA 1LK5A 1VLYA 4NE9C 4NLDA 4P10A 4BDPA 3E3XA 5GMDA 1U7LA 2IBKA 2PA3A 2POKA 1EX8A 1UVNA 2OD4A 1PAUB 3RAXA 5CD4H 4JV5F 2RJZA 4XPCA 2QLXA 1JIHA 2CPZA 2AP6A 2JDJA 3VAMA 3IBWA 4O3QA 1UEVA 4QW9A 3BBCA 4NZ6A 1TVRB 4DV1J 1LWEB 3CTRA 1KOOA 4NCGB 3A12A 5DGBA 3T6JA 3JSBA 1MROA 3C2PA 1BQMB 4QWDA 3SMZA 4MFBA 2RQ4A 4WKRA 3M05A 4DPOA 2VFVA 3H5UA 1WJ9A 3BPDA 1N0VC 3UNYA 5IM0A 2V4RA 1RI7A 5A8KB 2J8AA 4F25A 1WC3A 1FWKA 2OKQA 4F50A 1CULB 4ED4A 1DY3A 4AFFA 2G0CA 4IDKB 4RR5A 3T5KA 4KGKA 4K4UA 5AJ3F 3SSQA 1X9WA 2QL5B 4V19X 4K4ZA 4KHMA 1AT1B 1RDRA 2FJVA 4Q43A 2IA6A 3T5JA 2HKEA 1XNQJ 5F0WA 3CCLS 1U48A 4X66J 3I5BA 5ETTA 4DV2F 4NLRA 3RG6A 2CQ2A 2HIYA 5F8NA 5F0UA 2CG4A 4C8MA 3J81U 2A10A 1W26A 3OR1B 4OV1A 1XJWB 4AXJA 3G71S 3PO5A 4TXSA 4OL8A 1JLQA 1NK9A 1VHIA 4PAAA 3D0GE 1NDLA 3W2VB 2DNZA 2GHVC 5DQGA 2ZC4A 1QVGR 3AODA 3PJ9A 1HNIB 4B3SF 2XY7A 1Q1KA 3ITHA 3ZZPA 1RHQB 4W4MA 3T3FA 4U7CA 3MM6A 5H9FK 1S1VA 4KKOB 5I4MA 2WCXA 3SSSA 5ITHA 2XO7A 3R97A 2CXEA 2AZ3A 2VFTA 3SFUA 1A7GE 5A76A 1BQNB 2JL9A 4DLEA 3CJKB 3HHEA 3MM8B 4TY8B 2H54B 1FNXH 3OTCA 1PJ6A 2VPXB 2F40A 2YY3A 2W9CB 4CM0A 1WF0A 2R7OA 5KFUA 4IYQA 2HZVA 4ELVA 1OJ4A 3A8KA 2R7VA 3P4UB 2R7XA 4NASA 4AXIA 3FCVA 3TI0A 1RTHB 2QEXS 1RTDA 1M1GA 5LSOA 2JVOA 1C4AA 4OI6A 2V4JA 2DT9A 8RUCA 2K2PA 3UW1A 3M8ZA 5BR8J 3FZ2A 4F4ZA 4MIWA 5BXIA 3HHLA 1D09B 2GVDB 2V9KA 2ZE2B 3MHYA 4LREA 3JQKA 3EMTA 1OQ3A 1Z2ZA 4FF1A 1XMOF 3US5A 5ETMA 4A8WA 2R8KA 2EC0A 3LTOA 1KD1T 3I87A 3R5JB 1DFDA 3P45B 4DR7F 2UUBF 5E33A 3C6TB 4WFBQ 3CVKA 1LV5A 2WAQD 1WEZA 3I5CA 2GC8A 5DZ6A 2H5IB 1HD1A 4N7TA 3OXGA 1U09A 2CKWA 5LMNF 2E1PA 4CLWA 1GAOA 1ZM9A 2UXDF 3MM7A 2ACYA 2KVQE 1H7XA 4DSIA 2F63A 2IM2A 4ECRA 2YNHA 1EJ7L 1HWJA 2XULA 1R0CB 3FCHA 5FDLB 1XERA 1N34J 1NAQA 2B5JB 5EWEA 3KDOA 2GHWA 5LMUF 4A8MP 3PXGa 3PRVA 4MMOA 1KP6A 4TLQA 1SL0A 1RBLA 1RTIB 2N4CA 3FQLA 3NG8A 3EZUA 2HW3A 2R7TA 1H98A 1FX4A 5HL7Q 1IQZA 5JXSA 1LWFA 1S9GA 3PHEA 1RT4B 4C3MA 2C42A 3MFHA 2HFOA 5K14B 4OMFG 2C3UA 5FD1A 1N48A 2BEFA 3UDEA 4X64F 2YWEA 2BJ8A 2HNDA 2HFVA 3OTDA 3L4BC 1GMWD 4U8YA 4ZIWA 2UXBJ 4I2QB 5LT5A 2JC0A 3UI3A 1TK5A 4PABA 2CJYB 3FBCA 3POTA 1KHWA 1VC5A 2K1RB 4QWAA 3G6YA 4OHVA 3I6PA 4UY8T 4DOZA 2RRNA 3MCMA 4DV3J 1KVIA 2XS5A 2Y9HA 2MZQA 2QLBB 1SJ4P 4JI1F 3RW6A 3J81j 2FVRA 3N5FA 1C0TB 4FS1A 2FZCB 2C2RA 2JFDA 1HNWF 4AQYF 1NEEA 3A1YG 3DM2A 4H4OA 2N3OA 2YKNA 1TUWA 5MLCV 2BYCA 3OR2B 4HEA9 2ZJPQ 2NXUA 2GV1A 4H4KC 2W01A 3RYLA 2COLA 5GADU 4QCLA 4PEOA 4U7UD 1YZ7A 3JAMY 1Y7PA 4XK8C 3FRYA 2OGUA 1S7IA 2R4FA 1IQTA 2XB2D 2ZBRA 4WFXA 5B0GA 3UPFA 1RU2A 1TELA 2CPXA 4RW9A 3QIPB 2G2YA 3U1LA 5C24A 4PQUA 4U7UK 4ZS6A 3QRPA 2C3PA 2AJFE 4RUAA 1SV5A 1NDKA 4RKUC 4GC6A 1TV6B 2DK2A 4CDIA 4F0HA 1UJ4A 4L75A 3EWGA 2ROEA 1R0AA 5CH7B 4ZLJA 1OSDA 2EKYA 5J2PA 1SIWB 5IC6B 2F9JA 2V8GA 1BMQB 4GVBA 3AH6A 3MMJA 2CZ9A 2W9BA 4IO1A 2XM3A 2AJ2A 3CDBA 4A4JA 1RLDA 2OLWA 1HWIA 2BJEA 3RB3A 5E3QA 1NK4A 2LDIA 2LQ8A 3H20A 2PMHA 1TKXA 5B0BA 2V67A 3OXFA 4J9OA 1HMVA 3QT8A 3IRXB 2BE2A 4BCAA 5D0RA 4ID8A 3PX0A 2DGQA 3CCUS 5F8IA 2K06A 3I82A 1LW0A 4WWSA 1ZM3A 2Y3YA 5CAAA 2HAIA 4ELUA 2MHEA 1EP4A 1FCAA 4A48A 3LGNA 2FJWA 4M5DA 1SKUB 4DV4J 4M5HA 2DPIA 3DKDA 4LBIA 1KLMB 3MAAA 1XMQJ 1F5AA 2PFFB 9ATCB 1GTEA 3MM9B 4JV1A 1RHUB 2LQ9A 3ELHA 3TX0A 5E2QA 3QO9B 1HHQA 2MZJA 1JK9B 2QZ8A 2VKRA 4IFVA 4H4MA 4DCOB 1YIJS 4DQSA 4DWIA 4NYZA 5HVHA 2I5JB 3ADAC 4NOHA 2HQIA 1JB0C 1SH0A 4QPTA 3CJ0A 2DH8A 3FDSA 2RQCA 1T9YA 2A1BA 3AJDA 3HHKA 4ES1A 1TUGB 4ILMA 1IJEB 2BR0A 1ITPA 1SIZA 1NBEB 4TYAA 1U8WA 4P73A 5CHCB 3OHBA 1WHVA 3EPGA 2VBWA 3NS5A 3JYTB 1SB6A 4LSLB 2DGXA 1EHWA 3VHQA 3F0NA 4OYXA 5I42B 2P5VA 4E0DA 2B56A 2D69A 1XNQF 3L7UA 2Y8WA 4WKYA 3P5TL 2W9AA 1SKRA 2JWNA 4P74A 3ZO7A 1OY8A 3BN7A 4M1KA 3D9BA 3K5PA 4OYZA 2QA2A 4W92B 4IRDA 4FYDA 5HP1A 1C1CA 1X4GA 3IR7B 3RW7A 4K5SA 2W4PA 4A47A 5LXYA 3ULHA 2WB4A 4UOFA 3G8TA 3B6BA 1KR4A 1YJ9S 4MH8A 4O23A 3PR4A 2ZH5A 2IA0A 1YG0A 5D0EA 4PCQA 3M2VB 1FVQA 1VQ9S 1Q8IA 1NKEA 2GJFA 1OSCA 1PBAA 2C2EA 2RMLA 4EEYA 4CLKA 1VS3A 5KFFA 2W2OP 2BANA 4DMZA 4TU8A 3UD4P 3DLGB 5BYRA 3M1VB 5J1NA 3OUYB 3G4SS 2ZH1A 1RT1B 1R6YA 3OL8A 1YSJA 2UUTA 2LEBA 3O1LA 1YVFA 4LIWA 4AE5A 3HMJG 4KB7A 2GO9A 3KG0A 3RB0A 2YNIA 1SJFA 2NUHA 1FDBA 4IQXA 1NJIT 4LVOP 1NHVA 1S6PA 3SV3A 3TW0A 2XHWA 3BR8A 4X4UA 4HKQA 1NK6A 3IFEA 2VB6A 4ALZA 2ZHAA 4JUZA 1FF2A 5KFQA 3MR5A 4UQGA 2C3MA 3GQCA 1S99A 5I3UB 2DHSA 2HPUA 1FXDA 2BABA 3DLHA 2FHJA 5K8PA 2DEJA 2VG5A 4KR0B 4JI7F 3OJUA 3SYZA 2QGFB 3CWJA 5GAGU 1B4SA 5HQLA 2HHXA 4CLLA 4BBYA 4QU6A 5CYMA 1S1UB 1F5BA 4P72A 5H9EJ 2OPRA 2MGZB 2N82B 2UZAA 4I7FB 5KFCA 3G6ES 3DLKA 3DNCA 4GC7A 3S01A 2VV5A 4G6VB 1I6JA 4IG0B 4ANCA 2H3EB 2QIFA 1V5VA 1B0VA 1MU2A 1VQNS 1S1WB 2UUAJ 4EK2A 2U1AA 4NCBA 3AB2B 3QGPA 4P71A 3CNQP 2EVZA 3UVJA 1X4HA 3PW5A 3UO0A 3PFOA 4O4GA 2BVZA 4PXCA 3KMSA 3I0RB 1PKUA 2X1AA 1NCLA 4CM2A 1OPIA 1U25A 2R7SA 2VQEJ 4OX6A 3HHNB 1EARA 2HBRB 2ALYB 5EWGA 3DOKB 3DU5A 4OZ5A 3C14A 3CPWR 1Z4UA 3NOGA 3HM9A 1HNVB 2AT1B 4K59A 2W7AA 4DV7J 2RS8A 2ZJQQ 4PXBA 4S0MA 3FFIB 2GJ2A 2J7KA 4TVAB 1TL1A 4RW4A 3N01A 3GP9A 1RB0A 4NA3A 4ED3A 3L7PA 2GQQA 3LGHA 3QT7A 3VAGA 4IOAQ 2ZD1A 2UUCJ 5KG1A 4L3KA 3BBFA 4TQRA 3HKZD 4NA2A 3ZTQA 3K7RA 1LW2A 2C28A 3IS9B 4KFBB 3GLJA 4ZLNA 2IMWP 4OYWA 2D9OA 4F67A 6FD1A 3NCQA 4LRDA 4CLYA 1YJRA 2X3GA 1WC4A 4OYMA 2UXBF 5LOQA 1UWBB 1RABB 4DG1B 1RWNB 4J9RA 3V4IA 1AUDA 5GADI 3MECA 4LFBJ 2VG6A 1UWAA 2E7VA 1RK8A 1APSA 1NSPA 4HT7A 1TL3A 3MCNA 4AL5A 3V6HA 2CJ9A 4GKKJ 1FKPA 2EC2A 1T9VA 1D1UA 2NXNA 3TZZA 2QV6A 3HKWA 1Q4RA 4D3GA 4RW6A 4C8LA 4CLSA 3ZZUA 3GR1A 4CNYA 1MWYA 1O51A 1T3OA 4ZK7M 3IAS9 3QJPA 3PW7A 2KI2A 5CXTA 1AZSB 1NXIA 1WOSA 3KUEA 2R3VA 1QTMA 2B9WA 5LL6d 4ID5A 4UOGA 1QE1B 3HVRA 1T02A 2N7CA 5C42A 2GQCA 1GX5A 5G0RA 1KQSR 1RLCL 5HJYA 2WBMA 1RHJB 1XR6A 2DGOA 2NYIA 2P9EA 2VICA 1DAXA 4X4TA 2AQ4A 5DQIA 5B0CA 2QE5A 2J6SA 1E6VA 3G82A 3HJFA 3W1YC 1I1GA 1RWWB 5D0GA 4WXWA 2MQPA 4J5OA 5CYQA 4PYAA 3SCIE 1N36J 2AX0A 1X5OA 2CNOB 4DV6J 2FDNA 1SVDA 1Z1ZA 4C8ZA 2HBYB 2G0IA 5CZVA 5IOLA 3LP1A 2E9RX 2IDEA 5AE2A 2O5DA 1PGZA 2V50A 3WX8A 4F0KA 3ZFVA 1CC8A 2HQGA 3MWBA 1FNMA 3CIMA 2XWYA 4GMKA 2R8HA 1NK0A 3OL9A 4CO1A 2R2UA 2WONB 5T41A 1VRQC 3OL6A 1BQXA 3EM1A 4DL4A 2HS3A 1VRTA 4AT1B 3DDIA 3JSMA 2FVPA 2CRLA 5DG8A 4JV2A 4C11A 2LEPA 1HYSA 2AU0A 2AGOA 1VJWA 2BX6A 4K0KF 1NPKA 4ZVEA 3M8PA 2XSJB 2YKMB 5CCLA 1IN0A 3D3CJ 2GNKA 5KG5A 1ROFA 1QD1A 2DNKA 3AD9C 3VWSA 3LP2A 1Q7YT 3PRDA 3MI7X 3NGSA 5CD4A 3R1LA 2D7SA 1IBCB 1KN6A 2VBYA 5ETKA 1S4EA 2NQPA 1LWCA 2FJXA 2F8MA 2OO4A 3R8YA 3GWCA 3RUBL 4EMDA 3ISNC 1RE1B 4KY3A 3TX8A 1WUUA 4LRBA 2EFVA 4O44A 1WC6A 2M3DA 1P1LA 1HQ2A 4C0HA 4PG6A 3R6LB 4FNIA 4C6AA 4L76A 4F0MA 2DH7A 1KFDA 4I64A 2H5EA 5DLGA 3OLBA 3TAMA 3CCQS 1Y00A 1LXNA 4YR3A 3J7YU 3MAQA 4E98A 2HGLA 3UCZP 3KLHA 2IVMA 4KT0C 4K4SA 3M4XA 5GAHU 1HFEL 4NYPA 1RWUA 1NZ8A 1UEUA 2J6UA 5JVGQ 4ZLPA 5E3CA 1DTTB 3FBBA 1BGXT 4QU7A 1VJQA 2HVIA 1ZTWA 4C9DA 3B8HA 5F8MA 1HBNA 4LRAA 3I96A 1VBYA 1KHVA 1VQLS 1FE0A 1VBZA 2PC6A 3CJTA 1VGYA 3TA0A 4ECYA 2OPSA 2MXYA 3M32A 1IUJA 2GGPB 2HK3A 1GMVA 3W61A 2VFUA 1JX4A 3D0IE 1GXTA 3LUYA 3FKBA 3AD7C 2IM3A 2BQRA 4MYTA 3LP0B 2KL8A 4JI5F 5DG7A 1N5QA 1YHQS 2RU3A 2YPYA 4HI1A 2HHTA 3HVAA 2VODA 3C6UA 4HACB 2J7UA 4KE5A 1UZHA 2ZC3A 3C46A 2KVIA 2DBBA 1IBKF 4WXOA 3MEEA 3PCOB 1X7VA 1XIQA 2FIUA 3K8VA 3NBPA 2X7IA 1IKXA 4CO5A 3P49B 4KH1B 2R7QA 2MJNA 2DNYA 4C8OA 2PIIA 4DPXA 3KK1A 2R2TA 1YQHA 1JNRB 4BC7A 4D3HA 3ZZZA 1VR6A 1ZA1B 4FXVA 2OPQA 3MF5A 3QT5A 2NLWA 5GAGI 3H98A 4QQBA 5CA5A 1NNDA 4NLSA 3QMQA 4GKJJ 2BQ3A 3E51A 5HATA 4CZCA 3PG9A 4EGLA 2XNRA 3EDQB 3B4MA 2QFJA 2YNGB 3KXDA 4DZ6A 1YJNS 3H2LA 1UFKA 3PYFA 3V6DB 3BF4A 5HVFA 1FTCA 3CJRA 3FBEA 3DMJA 4U8VA 3RB4A 3W3SA 1CJUA 3WIVA 3QT6A 4B9UA 1I51B 1OYDA 3NL0A 2A0FB 1FFSB 4HVZA 4RJVA 3OW2R 2HHSA 2FGCA 3K17A 2FLOA 2CJXB 4IOBA 3GE9A 1FRJA 2OEMA 2ZVIA 3G2XA 5I3QA 1P8GA 1UCNA 1RCOB 3HSGA 5J2MA 3ILJA 3NWRA 4M63A 3ENVA 4OJ3A 1IKVA 2EWHA 2DB1A 2PN6A 3GV7B 1YDLA 1RT6A 4J7CA 3CT9A 1WG4A 3KLEB 3L09A 4M5IA 4C48A 3SDEA 3TWZA 5CZCA 3VZIA 2FY1A 4OZ0A 2JX2A 3D3BJ 1S1XB 3BGRB 4ZIVA 4DX7A 3T1HJ 3IA0A 1X9MA 4OI0A 3MR2A 4FF4A 3W8PA 4AMOA 3QSYB 3MCSA 4FPIA 1G1XA 1KOHA 4PRFA 2VQEF 4KGMA 4ZVPB 3QWUA 4U6PA 3IWLA 1FKOB 2XLKA 4ZVHA 1U0SA 2GMLA 3R7NB 4B9VA 3ZTRA 4DV7F 4L73A 4IKAA 3MTKA 1HW8A 1WORA 1WTFA 1JLAB 5D4PA 2CA9A 2AYEA 2OI2A 3GYNA 5C25B 4I4BA 5K8NA 3KJFB 2ALZA 3Q8UA 2M7SA 2UUCF 5D3GB 2VD3A 2YPZA 3VGUA 4MKYA 3EGZA 4USIA 1OYEA 4EBEA 2MKSA 1RT2B 2YH0A 5M2PA 1HPZA 1U8SA 3FUYA 2LMIA 3V81B 3I31A 1NZAA 5LJ3Y 4Z37A 4NI2A 5HO4A 1VBXA 1U47A 2VKZG 4B3TJ 1RBAA 1IKYA 4NMXA 2VJUA 4MJKA 3H8YA 4NCAA 4FP9A 3ZNJ1 1M5VC 2ZZTA 3CJSA 3KLGA 3TJ8A 3EXCX 3MAHA 4KHPJ 2EFGA 4LFBF 4YB6A 5JMNA 2DHXA 2C3OA 1HBOA 4LF9F 2NSCA 3KG4A 5KFAA 3U1NA 4XO0A 1D9FA 2VA2A 2BE9B 1CLFA 2CQ0A 3Q2SC 5KT4A 1F9FA 1P6TA 3BSAA 5A2QU 3TJAA 1VQOS 3Q8RB 4PPDA 2RDDA 3ZTSA 1UVKA 2VQFJ 3RBEA 2GHPA 4HDHA 1FNOA 1N52B 2UVWA 2YH1A 1VYAA 5B0DA 3KLFA 3L3CA 3BKFA 3CDEA 2KG1A 1BLUA 2XZTB 3CCMS 2KXNB 2LYVA 2MJUA 2AZ1A 2HFSA 1RT7A 1VQ8S 4OYIA 3W2WA 4LR9A 3OSNA 3AOAA 1S12A 5L1KA 1I94J 1U1RA 3V4MA 4OLPA 2IRXA 3FSYA 3MMCA 2NXJA 3HJVA 1RWXB 4KRWA 1B7FA 2DR5A 4UQTA 4NCGA 4ICLB 4IG3B 4C2MA 5CYJA 2BDPA 3TOQA 3BH7B 1UPPA 1FERA 2XGPA 4A8KA 3DRRB 2M2BA 1PCAA 5DDRC 5A8KA 3FGVA 3ENWA 3GFYA 3CJ4A 3Q86A 1CULA 1CEZA 2OUGA 3QBCA 1VK3A 2HS4A 2F4VF 5KT7A 2GIFA 3H25A 5IQQA 3D1OA 3CD0A 4WFAQ 1L3SA 2FQQB 1FJGJ 3UD3P 1JNZB 1MROB 5C7PA 1EIYB 4J9UE 4O4RA 2DNHA 2Z58B 4N41A 3OTEA 1VCTA 4PPZA 4NEYA 3CE8A 2DNRA 5IM0B 1M90T 1FD2A 3EZ5A 4F2SA 4K7QA 1L3TA 4URGA 4B3OA 3OR1A 1RWKB 4DV0F 2RNEA 3TAQA 1SJ1A 3KDNA 1XMBA 3BKUA 3SCLE 4OLOA 3CO9A 2CADA 4DL0C 4OHZA 3NMRA 2P6SA 3J7YI 1S0VA 1NK7A 1IBMF 1XN9A 2UVUA 4DEZA 4N8NA 1S57A 1S4FA 4KKOA 1FI4A 1F2GA 4EYHB 1YJUA 5CZXA 4OJ1A 1BQNA 1JLQB 2ZZMA 3HO1A 1N56A 1RAOA 3CJ5A 1U6FA 2W2MP 5C5JA 5LSLA 5FLXU 3MM8A 4TY8A 2RF2A 2QRRA 3PRBA 4ES3A 3M30B 2W9CA 4A8FA 3OVBA 4I6AA 4UZCA 4HDGA 3N6MA 1NSAA 4OYPA 2LEAA 3V6KA 3MM6B 1S1VB 5DQHA 3H5SA 4CRJA 2V8VA 1RTHA 5IS2A 5HANA 1SC3B 2V6AA 2HZCA 1R6VA 2PDAA 3UN3A 3J80U 3JQJA 4ECTA 4G1PA 3LF0A 1AUSL 2A18A 1URNA 1MN9A 1RT5A 2Z2ZA 3B54A 4ZLLA 1RP5A 5AJ3J 2YNFA 2GMJA 1LXJA 4F8RA 3HD1A 3QRQA 2OP5A 1VIOA 2R2RA 2D3OR 1WOPA 4E2FB 2Q6CA 2ZE2A 2LLZA 5ETRA 1NDPA 2DVIA 4Q8EA 2DITA 3BYRA 4USMA 5HLFA 1FRIA 2MQLA 1UP1A 1UVLA 3VAKA 1T9XA 2RD5C 1IVZA 2FLLA 3EGNA 1RTDB 2HHPA 4PZVA 1OQ6A 4F4KA 4N76A 2GAGC 2V4JB 1X60A 1N32J 4RBUA 5HMXA 1UA1A 1AYEA 3SBMA 2B9XA 1PSDA 2HQCA 5HROA 8AT1B 1M5KC 3HHLB 1YBAA 4ZHRA 5KFPA 1D8YA 2E9TA 4NLOA 1NH7A 2NREA 4K4VA 3H2VE 3HFVA 1CBKA 1QVFR 2JVRA 2NR0A 4B3SJ 4ECWA 1RUSA 2HBZB 1VFJA 3R5DA 2HHQA 3ILLA 3UCUP 3MOJB 2IVFB 4P7VA 2QFIA 1N0UA 9RUBA 3GYXB 1CQNA 3QLHA 4LR8A 2CQDA 2OSQA 3O6QA 4RUHA 3M2RB 3TNVA 3CW2C 3W5YA 1Q8KA 3MM7B 4OX7A 1QDUB 1RT4A 3NS6A 2CPFA 2WB1D 5K14A 2YNHB 4CO2A 1FDDA 2MKHA 4LMZA 1TMJA 3NAIA 3VZHA 2E5HA 2Q6BA 2LU1A 5L1IA 2MMYA 1HBMB 4CLPA 4M5NA 4WP8A 1DBDA 3DRXA 4ZP9A 4RO0A 2W8LA 1SBRA 3NGRA 4NRUA 3EE3A 2CZ4A 1S9EB 1Y9OA 5AT1B 4FYYB 3KKFA 1D8ZA 2DHHA 1RBOB 4RNHA 4CP5A 5GMEA 4G65A 2W7PA 2B6AB 1XMOJ 1TK0A 5HQMA 1MN7A 3IP0A 1EZZB 1XBWA 1GQEA 4PG7A 2HNDB 2E5LF 5KFYA 4DR7J 3I4PA 3Q24A 2W4CA 3JSYA 4ZA1A 1NDCA 4HTJA 2D41A 2AGQA 4DS5A 3POTB 1HI0P 1YK9A 1U2RA 4IH7A 3IR5B 1PYOB 4ZPWR 1AXQA 2KH9A 5LMNJ 3EJMA 5GMKa 3NP5A 3AJ2A 3ILIA 4ED6A 4JI4F 3KK3B 2DNPA 4NLTA 3KNAA 2QYCA 4Q44A 1L3VA 2ZBCA 4R25A 3BDPA 3C15A 3RR7A 1DJ0A 1VMBA 3CGIA 2V8DA 1SKWA 1WSVA 5A2QY 1K47A 5LMUJ 5IT0A 2XEXA 4DQPA 3DM2B 4ZP8A 1N5VA 2YKNB 4AMMA 1FD8A 2N3LA 4LUBA 5RUBA 1EB0A 3LALA 2BA9A 1S0OA 3SCJE 4QWBA 1OY6A 3JXOA 1QY7A 1HQUB 3THVA 1EKSA 1UW4A 1R8AA 2I38A 4YDXA 4ZJOA 4B3TF 2XMAA 2IY5B 4OI1A 5K9FA 2J0QD 2UP1A 5IT9U 2CQ3A 4W90B 4X64J 4JI8J 2ZFHA 2VOOA 3MM5B 4FN5A 1NB7A 2E5JA 1LOUA 3BV8A 4Y2IA 1P1TA 4RW9B 5DDPC 2MLXA 5C24B 2CJKA 3OTOF 4OZNA 1REVB 1KNZA 1UVJA 3LAKA 4R5PA 4EWTA 1K0TA 5KOWA 1SV5B 1U6ZA 4OYOA 5FIIA 4LRCA 4IOCQ 5A6PA 3DRSA 3OJSA 3CSKA 4EUVA 1SL2A 1S6UA 2LDYA 1R0AB 3H4DA 2DGVA 2F8EX 3FSXA 4GVBB 4M5GA 2ZH3A 5ETOA 1ZA2B 4JI1J 4Q7AA 2VQFF 4CI0B 2W9BB 1HNWJ 2PGCA 4DF8A 3GIJA 2RILA 3VVUA 4PWUA 3TA2A 1E6YA 2ATCB 3EUNA 4U67Q 2MYFA 1S97A 3T5HA 2CG8A 2Z30B 2HWTA 2Z2YB 3N6NA 4QIVA 3Q22A 1S49A 2RAQA 1S10A 2HVZA 4LF4J 4PYDA 1S1TA 1U2CA 3KUHA 1I94F 3MM9A 4FVMA 2HVDA 2K7KA 4DBQA 5KG4A 1TFYA 3QO9A 1DQ8A 2MQOA 1HHTP 4DU8A 5T7LA 3PDNA 3CCRS 1HWLA 2V34A 4ECQA 1Q5YA 1EP4B 2ABYA 1ZM4A 1Y4ZB 4TLRA 2BM0A 3IM8A 4OZJA 3MPUB 4B9SA 2C2NA 2AW0A 3MAAB 2ADCA 3GSIA 2ROPA 3N9UC 3G86A 3HVTB 4NXNF 5A6WA 4KGZB 1K0VA 5SZTA 3IWNC 5KFTA 3DLJA 2IPOB 2HG4A 2E7WA 2BJ9A 2MEWA 3BGFA 4IFVB 2EFPA 5KG6A 1KKHA 4NLGA 1FJGF 3DOMA 3ISND 2MY8A 4DN9A 1M0SA 2AV5A 1P9YA 4FKXA 2BMBA 4DCPB 3UFCX 1JJ2R 4IRCA 3AB4B 2BJ7A 2GQ2A 1M5HA 4K2JA 1RT3A 3MMAA 5T14A 5FLXY 1TKTB 1FRKA 1GEHA 1RWOB 2V4QA 4QBUA 5D0HA 5ETQA 4C8NA 3T1AA 2KYZA 3TQ1A 3RRKA 4ZKAA 1WEYA 1FJEB 2YQ0A 3BSNA 2J0SD 4JYAF 2OEJA 1YLXA 2H4YB 3PW4A 2YWKA 3TRGA 3DXBA 4U9RA 1Y10A 4YR2A 4B17A 4QYRA 3BSOA 3J80Y 2AMCB 4USVA 4ED2A 3RU0A 2Z2LA 3PKMA 2HRTA 1NUEA 1RHMB 1GH8A 4R0JA 2PFDA 1YJVA 1WWHA 4ILLA 1C1CB 1K8AT 4ZPDA 2VONA 2CAJA 4IO9Q 1TQLA 3DLGA 4J9KA 3TAPA 3NY0A 3BREA 1GFWB 3ZC4A 4I69A 2MQ8A 4FKYA 4WYWA 1KTVA 1LQ9A 1XWLA 4ZPBA 3DDKA 1PC4A 5DM7Q 2PO4A 2HFNA 2V69A 2WVBA 1U6BA 4C0BA 4LF5F 4OJGA 3O5TB 2F7VA 4KQZA 1HKAA 1VC6A 1KSPA 2AHOB 1T0TV 2CUYA 1UETA 4F3OA 2HHVA 1V9OA 2FPHX 4DSJA 2KM8C 1Q7LB 4F02A 2BANB 4OX9J 4YP3A 2AKWB 2I2YA 3W5ZA 1FEHA 2B9EA 1RWPB 3FJ2A 2E5IA 2J7WA 2OH2A 1Q82T 4G1QA 5CZDA 1GT8A 2RVJA 1T11A 2YNIB 1S1UA 4J91A 2DRAA 3JS9A 3TVKA 1F9HA 1H2TZ 1N5TA 1J2VA 3R9LA 2MGZA 3I9ZA 1REGX 3N79A 1S6PB 4QIFA 2IVYA 4WF9Q 1PJ5A 2BE7D 4Z7YA 3CULA 2DO0A 1KONA 4CYUA 3D54A 4OV6A 2V63A 1U0HB 4ZVRB 1N32F 2V8HA 3OTBA 2CFXA 4CNZA 4B9TA 4J37A 4USWA 3DGVA 3I0RA 4DR4F 2D9PA 4NRTA 1B0TA 4DPUA 1AFIA 2AJ4A 1XNRJ 5C2GA 1QSLA 4BLGA 2XMMA 4LBHA 4OZ3A 4JI3J 4NX9A 2OPRB 2G1DA 1SQGA 1KVKA 4MTPA 3IRWP 4KGVB 1D3WA 3G8QA 3DLKB 3QJJA 3H0PA 4CO0A 5KFXA 2VIHA 1HNVA 2SXLA 1RISA 1DLOB 4F3QA 3AT1B 3J7Z5 1MU2B 3K5MA 1TL5A 3FFIA 4ANDA 2DKOB 4WIQA 2DYAA 1TKDA 3CEDA 2EFOA 2MB0B 3UVJB 2KDOA 2UU9F 1OIAA 4YHHF 2CPIA 4O4GB 3CJQA 3GSDA 4DX6A 3QZ8A 1C1BA 3RAMA 2WTFA 1ZPVA 1RTJA 2LXIA 4I6WA 2R42A 3O2IA 2B4PA 2XLIA 2D3ZA 1DZ5A 4KFBA 4RLEA 1ZBTA 3C14B 2WZ1A 2AX1A 2DO4A 2IJNA 4NLQA 2RE1A 2VDIA 2NS1B 2XYPB 2P8IA 5H9EK 1FK9B 1WNEA 3DRPB 3DLLQ 4UUXA 3D28A 1UEKA 3MD3A 3PYDA 2VG7A 1MWZA 1TL1B 2IAJB 1UWBA 2EBGA 3EX7B 4DG1A 3MEDB 4ZPCA 3S1TA 4JI7J 1F3VA 2ZD1B 2XO6A 2HAFA 2XSFA 5DLFA 5ETSA 1L5UA 3FQKA 3IM9A 2WW4A 3GCWP 4QR0A 3JSRA 3DOLA 3K2YA 2XCPA 4KV8A 5KFJA 3ZZYA 1G7CB 4WIIA 1HA1A 1TZ0A 1BWEA 3GZ7A 2EEYA 3SFGA 3UNGC 4G3IA 2YWWA 3CD7A 5IT9Y 5DGAA 3V4IB 4NLVA 1QUVA 2VG6B 3IBCB 1VQMS 1AZSA 4URQU 4OHWA 1SXLA 2MZSA 3ZZTA 5BJRA 4USJC 3NNCA 2RT3A 5ETLA 1XR7A 2F65A 2QA4G 3MR3A 3I0SB 4JI6F 3UR3C 3HF5A 2MY7A 4RW6B 4O0IA 2QMXA 4YN3B 3LAMA 4WP9A 4YFUA 2YVSA 3PTWA 1X8DA 1OMSA 4G1IA 5AXLA 1YKWA 5LSRA 5ETNA 1LKZA 1VQ6S 1SUQA 1JKHB 4LFAJ 4P2XA 3D4JA 1G2EA 3BH6B 3SSRA 3FNNA 3X3UA 3KHGA 2KJVA 1F9EB 1UA0A 3G6XA 2KG0A 2V5HG 2L9NA 1NJYA 4ZVTB 4ID5B 4IR9A 4O3PA 2R7RA 4ZVUB 5ETVA 1SI9A 4JI8F 2M5YA 2DTJA 3H40A 3KLIA 5KFIA 4FYXB 2OMLA 5KFBA 1RXOB 4PWDA 1X5PA 4CTAA 5B0FA 1VC0A 1CJKA 4NMLA 2CPEA 2XS7A 1E6VB 3G82B 2UVRA 4YDDB 1B7YB 3KHRA 3LGMA 1PILA 1NM2A 4PXEA 2K8GA 2VDHA 1CPZA 4MAKA 1O0PA 2ZDOA 2O66A 1UAWA 4ENOA 5HI7A 1IBLJ 3FMWA 3BBBA 5F3ZA 1NJWA 4ANEA 2G4BA 3V2UC 3UN5A 2DNOA 1AB8A 4DFKA 1WC5A 2CIMA 2QTWA 2FHJD 1H2UX 4CO3A 1ZTTA 3EGVA 3CMQA 2JSXA 2VH7A 3Q8VA 5HAOA 5HSPA 5A8WB 4MIAA 3M9MB 4M5KA 4LF6J 2C22A 1U1LA 4JI0F 1RKJA 3M2UB 4RU9A 2ZBPA 3H42A 1VRTB 2JFKA 4DSLA 3OHAA 2OIHA 1CJTA 4LF4F 5B09A 1R8PA 4C3LA 2WBRA 1HYSB 4J90A 4HL9A 2ZH7A 1J5OA 2ATLA 2R8GA 4ZJLA 3M8PB 2MKJA 4HTIA 2EXUA 3NEKA 3CUNA 3NCRA 2VZ8A 1U1KA 4ATNA 3KYLA 2NZCA 2WSEC 2E9ZA 3LP2B 3A3PB 5KFRA 4B3MF 5K8OA 1JLFA 3OT9A 4MK7A 1BWVA 2HSEB 1OY9A 4ZN1A 3TZWA 1CSJA 1LWCB 4WU3A 2CQGA 1N54B 3QGIA 4FXWA 2B43A 4EZ6A 1JLGB 3UE2A 2N4DA 5KFWA 3GJSB 2KB2A 4JOUA 3CJ3A 3C16A 4KO0B 1FRLA 1TP7A 2HQDA 3H4BA 1U1QA 1MSWD 2CQIA 2IFXA 3FSIA 3L9ZA 1VQKS 3GILA 3TAMB 1C4CA 1J27A 3TVZA 4HHHA 1Y3JA 3D67A 3NLCA 2K3IA 2GGPA 1Y11A 1RHKB 4C98A 2LA4A 2F5GA 4DCJB 3KLHB 2ZOFA 2E1RA 3R7SB 4O0NA 3NNAA 1H38A 4ECZA 4ILRA 3RRGA 1MLAA 3LP0A 2EK6A 1UJ6A 3TP2A 2ACMA 4K0KJ 2MZRA 3IG1A 3Q89A 1R8BA 2ZM6F 2HVHA 4WJBA 1HBNB 3PR5B 4MYUA 3OSPA 4QR2A 4NZ7A 1BD6A 3IXQA 2AGPA 4HACA 4ZCLA 2VC0A 2EG2A 1WDDA 4WP3A 1SCJB 4RNOA 4XAKA 1FDNA 3IC1A 3M32B 3MDFA 1N5SA 3L95X 4X4RA 2PI5A 1GXUA 5BYSA 3FCWA 1B99A 1BC6A 2APOA 1NO8A 4LFCF 1JJCB 4ZPTR 1IKWA 4OZ1A 2QJ3A 4N5SA 1UL3A 2L9WA 4UW2A 2G9OA 3CCTA 4FZVA 3HPOA 4N77A 4ED7A 2HGNA 1HLWA 4DR3J 1ZAWA 2XWXA 4ZITA 2QLFB 2ZH2A 5AE3A 3C6UB 3LA0A 1FRMA 4J9QA 3CD5A 2V2QA 1NJZA 3MUTP 2YNGA 3FMBA 3MEEB 1IR1A 2GCFA 2E5GA 2B4VA 1DQAA 3MR6A 3NBPB 3V6DA 2XY5A 4PG8A 4HHJA 2HHHF 5K8MA 5L46A 2EFNA 4OX9F 4QJVA 1FX2A 4M5MA 4ZVGA 2MKCA 3FVYA 1K73T 4MK8A 1FXRA 4Q0BA 1UZDA 2OPQB 1HHSA 4WFYA 1URRA 2M52A 3WX4A 2C3YA 4F04B 1U02A 1F5CA 3SQGA 4WZQA 2RUGA 1HNXF 3MR7A 1TL7A 2JHEA 3GFXA 1F60B 2B8PA 4ECSA 4TKTA 2PI4A 3X1LB 1J5EF 1IM6A 1ELOA 3EPIA 3K0JA 4L74A 3MPYA 3DMJB 3MEGA 4DLGA 3BGRA 4JV0A 4OHYA 1A6LA 1WOOA 4RW7A 2EI5A 4N47A 5HBMB 3CMAS 4QWEA 1H0HB 1SQEA 4LQ9A 4JI5J 1OO0B 2WW8A 3K5OA 1RZMA 1L3KA 2KXFA 2KFYA 1TMMA 2L08A 2I0XA 4I2PA 1QM9A 5J2MB 1XNRF 4JI3F 4KHRA 4YEAA 1IKVB 1T7PA 3MMBA 1FKOA 1IBKJ 1DHMA 2ASLA 1ZOTA 1YI2S 1RAJA 4PWWA 2OMOA 2KO1A 3IGNA 3NWGA 3SDEB 1Q81T 3SZ2A 5J2NB 2DPJA 1RQ0A 1JLAA 4QPXA 3OLAA 2OTJS 2W2QP 4YUDA 2E29A 3U02A 4TQSA 4XDCA 1JLCA 3MURP 5D3GA 4ZP7A 5KT6A 1KBRA 2G13A 2YQ1A 3V81A 2KT5A 3DLEA 3CIZA 4RWXA 2ROGA 2FLNA 3B4DA 1NSQA 3A8IA 2FHMA 2Q66A 4I1TA 3KJNB 1UPMB 3SXLA 4CQ1A 4PUOA 2CNNB 4CH7A 1NH8A 1P27B 2QT7A 1FT8A 1UFLA 2BOPA 4RUCA 1FHTA 1T9UA 5KAKA 4OI3A 2J6TA 2JNJA 3UDCA 1KQGB 1B64A 1HW9A 3KJVB 3S8SA 3PO4A 1HPZB 4TNOA 4O3OA 2PT0A 1IR0A 4NI2B 3H2UB 1GMUA 1VQPS 1TU0B 3AXKA 5THWA 1IKYB 1FFWB 3TEHB 4QR1A 1N8RT 3QYYA 4EU0A 3O3LA 2UXCF 3VAFA 3R2DJ 3G87A 3KLGB 1QAJA 2EK1A 2KRRA 5E3PA 2MKYA 1WKKA 1RAAB 3TJ9A 1HBOB 3IMQJ 2F3JA 2GA7A 5CCMA 3GB0A 4IQMA 3AOCA 6AT1B 3KUGA 1EETA 2HGMA 3JTPA 3I55S 1VQ7S 3GONA 4TU9A 3R6GB 1A9NB 5ETPA 2Q1LA 2V2VA 4ECXA 1XC9A 3KHHA 3LWLA 2QN6B 1NRKA 3FK4A 2XCAA 5A0YA 4EBCA 1HQEA 4B3RF 4ICLA 4IG3A 2OPPB 1HIYA 3OFGA 3QWPA 4LFAF 1VRUA 1XTZA 2FC8A 1Q5VA 3DDNA 5KOXA 3DRRA 1RT7B 4IH5A 5D4NA 2JJ4D 3T5LA 2HHWA 3W2WB 2J5AA 4DL3A 1SH3A 1L3UA 3QNWB 2B3TB 3G9CA 2G1HA 3MMCB 3TO8A 3PX6A 1SL1A 3J7ZT 4EO8A 3P3DA 2CPJA 5DRKA 2FVQA 2LP4A 5IV3A 1SKSA 2M70A 1ZAVA 4HT5A 1TKZB 2FZGB 1Y5NB 4EZ9A 4ES2A 1SJRA 4LF9J 4CLTA 5AXMA 2NPIA 5HJXA 3DI6A 4K4XA 4X4VA 3GR0A 1WG1A 1IBLF 4LF8F 4AL7A 2DRBA 2MPUA 4Y2AA 4WFZA 2QG9B 1VI7A 2ZHOA 4LBPA 1RWVB 3T41A 1X4EA 2RH3A 4UT4A 1HBUA 1NLKL 4FF2A 1I3OB 2HZAA 3HDSA 2Y8YA 2ZITA 1OS5A 2YBVA 3NGUA 4RNFA 1WDTA 3QGHA 4TYBA 4LF6F 1NB2A 5J1PA 3PIPQ 3DCAA 1X5TA 2FJBB 1ZZFA 3IN5A 1N33F 4R8UA 5LXRA 4DR5F 3UDLA 2AYBA 3K5LA 1R0BG 2DNNA 3NKYA 3N4WA 2ZOMA 4IFYA 3DLBA 2O67A 4B3OB 4A46A 3ZNUA 3BKTA 1V3SA 3BZQA 1QJHA 4DDFA 3MUMP 1XK8A 3TVYA 2IMOA 2M0GB 3JB9k 2QA4S 2CQBA 2I8EA 4CH1A 4QZVB 3FBFA 4CLFA 3M30A 4PR6A 4MKAA 3TANA 2HK2A 1JXVA 4LVNP 1DTQA 3SI8A 3MZIA 1HNZF 3WQPA 4LSNA 5J2QB 5J1EA 2XI3A 4Y2MA 1S6QA 3R5CA 3PYEA 3K5NA 3KK2A 1BUXA 4WU2A 1N5YB 2B4OA 4RZRA 7FDRA 3ILOA 2XMWA 2X3DA 2JOQA 1T05B 5U47A 3BO4A 2AEJA 3CD6S 2F4VJ 2BACA 2X1BA 4ED5A 4P2SA 2F1FA 3IBFB 1Z2LA 2RF2B 1NK8A 1PYSB 1OPZA 3LOUA 1WKJA 1P9QC 4I67A 5KFNA 4WZMA 2XGQA 4WE1B 3CCJS 2AD9A 1RADB 1CS4B 4FF3A 1B0PA 1ACMB 2PEHA 4F2RA 2WOMA 2CYYA 4DV0J 3PY8A 4F3MA 4MIBA 1RT5B 4M5JA 4HH1A 2ZBIA 2Q79A 2YNFB 2LCWA 1CVJA 2IIHA 1C0UA 2XZWA 4FVCA 1RAEB 3A8JA 5K20B 3AXMA 1ZS6A 2CJQA 1JLBA 4C0OC 4C97A 4H54A 1IBMJ 3M8QA 2Z4PA 2RRAA 4J9VA 5HLFB 2CQ4A 4JI2J 3LANA 7FD1A 1TR0A 1R31A 1IWGA 3OFHA 4QIEA 1DARA 3O8WA 3PVXA 4QOTA 4I0WA 1F1BB 2GVZB 4DR3F 2RIJA 4K4TA 2RDJA 2IM1A 5HROB 2OHDA 3M2RA 5EWFA 4ZHRB 5B7WA 1Y5IB 2HIQA 3JTNA 3OFFA 3KJQB 4P9SA 4QYZK 1TTHB 4YS2A 4DR1J 4NPOA 4BWJA 2DR7A 1FWPA 3VGVA 2QMWA 2RHSB 1A0OB 4HH0A 2B9YA 1HBMA 1ZZNA 4WYLA 5KT5A 3QLHB 5KFVA 1VHFA 3U1MA 2WHOA 2LECA 1S9EA 2RQMA 2I1RA 2HNZA 4ZPVR 3KLVA 4CWBA 3HVWA 3CCSS 1ZAXA 1SQFA 2NPFA 2UVVA 3E01B 1YJ7A 2Y1LB 2HNYB 4LF7F 3UQSA 2B6AA 4DR6F 1V6HA 5IV4A 3W63A 2J9DA 1K9MT 2EW9A 2WVEA 4KH0B 1NSKL 3HCXA 3C66A 3OL7A 5IC4B 2DCUB 5D4OA 3CC2S 4X65F 3I9V9 2X51A 2DR8A 3KTQA 1JLEB 4N8OA 1YZ6A 2XI2A 3RBXA 1B3TA 4L6V3 4M5LA 4B9LA 5IWAF 4JP8A 3C8YA 2QX0A 1MW7A 4DSKA 1KS2A 2QC3A 4WPAA 3AHPA 5E3RA 3G96A 1NPPA 2ZH6A 2KFNA 4DFJA 5G4DA 3KK3A 2X1FA 2OJ3A 5D8HB 4QIGA 4BC9A 1M5SA 2BJ1A 2GX8A 2QLJB 2NCKL 1K1QA 4C8KA 2M8DB 2J8SA 3BO3A 2CWKA 3T9ZA 2QSFA 2DXEA 4K2XA 3VAIA 4Y28C 2XMTA 4WBFA 2HS0A 4DQIA 3R5AA 5GAEU 3VQTA 4A8SA 4M8LA 3OD2A 3DYAA 4OQJA 1X0PA 3DGPA 4Z2XA 1SJ3P 3ET6A 1JWWA 3BPSP 3MTJA 1HQUA 3UCGA 4RBTA 2LXUA 4DL6A 4USUA 3KOAA 4NLYA 1S7HA 2IRYA 4X84A 4KYZA 2B8QA 1U26A 3ZZ0A 3M9OB 3C15B 2EKNA 3A3NB 3MM5A 3PJWA 3VAJA 5H1SV 3T9NA 2D74B 4PG4A 2FHOB 5L9XA 3PX4A 1NHKL 2YX1A 1REVA 5A8RA 5KT3A 4PXDA 5M2UA 1W7WA 5F9NA 4WTOB 4RW8A 3JQMA 3U27A 3CJ2A 1RYSA 5D6GA 2L9DA 4RPFA 3CC7S 1KLNA 1S0NA 2DXDA 2BJDA 3NMAA 1S77D 1O5JA 4KC5A 1FXLA 1UKUA 4FBUA 3K58A 1U1NA 1U45A 1EKRA 4K50A 2E5LJ 3PHTA 1LEOA 2D3UA 4ZMMA 2GO8A 4OI2A 2HMIA 4R5PB 3EDRB 4JBCA 2KJWA 2D1CA 2MHNA 5L8RC 3DRSB 5E41A 1V3ZA 3EVMA 1Y3KA 1VDHA 4DQRA 2Y1JA 1RAIB 4JI4J 3MEKA 1X9SA 5KG2A 1B70B 4ZVQB 1Q8BA 5KG0A 2WSCC 4Y0FA 2LKZA 3GFZA 3BO2A 4UOHA 1CJVA 3ETMA 3M8RA 1E6YB 2RU9A 2PEBA 2VUGA 5B08A 3PEJA 3CJ8A 3GIIA 5KFSA 5DJBA 1BHNA 4B08A 3OFEA 3GG0A 2DXFA 3ICLA 5D77A 4I68A 3AY0A 1S1TB 3EZOA 3NGDA 3HVTA 2XBPA 4KTQA 2OSRA 3FZBA 1MG7A 3IGVA 2ZBQA 4L3NA 4FDFA 5EDWA 3HZGA 2P9CA 4DV1F 3J81Y 5T7LB 2P6TA 3IWXA 1K44A 2KTQA 3BN4A 1LFWA 2GFFA 4LJMA 3OTOJ 5DO2A 1TKTA 2IC3A 3V6JA 2K7JA 3VTIA 2DJWA 1UJ5A 2J9DE 2ZNYA 1N6QB 3D6MB 4CLZA 3EVOA 2DNMA 4X4PA 2WVCA 4P75A 2ASJA 5L9NA 4OZ2A 5GVQA 2H51B 3ZTPA 4DX5A 4DPYA 4YB1P 4R0EA 5JUMA 1TL4A 1IM4A 2Y1RI 3DOMB 1F6TA 2E44A 3HSDA 3A13A 2ZJRQ 2GMHA 4X66F 1RT3B 3TZYA 3MMAB 4AMNA 1AA1B 1H6KX 1RAFB 2MQMA 3BJYA 2XQCA 5DETA 2HQFA 3Q8YA 1T03B 2JLGA 3VALA 5HN0A 2RKIB 1GX6A 3ETOA 4GRSA 5LJ5Y 3P8BB 1NK5A 1F2HA 4IUFA 1RA6A 2FYXA 1TVRA 4DPWA 2H48B 1LWEA 5K5MA 1N88A 4CCHA 3RR8A 3ZXWA 1VIXA 2XHCA 2AYGA 3AOBA 5IXUA 4F4YA 1BQMA 1MWQA 1U1PA 2CVEA 3H5YA 1PYTA 1YX2A 2LU2A 3J7AN 1KTQA 1W2IA 1V3RA 4FYVB 1QSYA 2DGTA 3FEXB 2HEKA 1DRZA 3W9HA 3CCVS 2H1YA 2A2DA 3CDUA 4KBIA 4NXNJ 4ZCIA 2EBEA 3D1HA 2OELA 4IDKA 3VCDA 1F0XA 1GMWA 1O6XA 2ZH8A 3ZZRA 4WFNQ 1KRPA 2ZKUA 1WC1A 2VASA 3H7HB 2CPDA 4B9MA 4YR0A 2WVDA 2Z8QA 5M2RA 5H9FJ 2O1PA 4MFBB 3D68A 2ZVSA 4A8YA 2BW7A 3H90A 3TUJC 3ISZA 4HLBA 2XS2A 3SCKE 1H7WA 2KXHA 1R89A 1U0HA 2NUUG 3OPKA 5BR8F 3W62A 4JYAJ 3CF5Q 5AE1A 2HBQB 3OV7A 4J9NA 3W2VA 4G1QB 2DISA 2LQBA 3BQ1A 3NCPA 4I6YA 1KEKA 1VQ4S 2HRUA 4JB8B 1ZPWX 3QJLA 3R5BA 5HVGA 3D66A 4GO7X 2BUNA 2GS8A 1HNIA 3TZXA 3GU0A 6FDRA 2DGSA 4JI2F 1KFSA 2RDIA 4ZP6A 1DLOA 1Q78A 2WSFC 4QWCA 1MMNA 2QO3A 1WTBA 1JJHA 2OTLS 4CYUB 1RSCA 1SJQA 2W7OA 1M1KT 3WBZA 2XC9A 1Y5LB 4K4WA 2W2PP 2VU5A 1JXLA 1BY9A 2I6WA 1G4CA 2W4DA 1LNQA 3MD1A 3MCOA 1FKAF 3CJKA 3V5RA 1OWXA 1IWAA 3EXYA 3HD2A 2XYGB 2R7WA 1C2PA 2CJBA 4MT1A 4LF5J 4DR1F 4ZVOB 3DRYA 4RNMA 3AJ1A 2R7UA 2DH9A 2R8JA 2MSTA 1WSRA 3ITHB 3DN9A 5IFMA 4OI4A 4KGXB 2FJDB 2B4UA 1FK9A 1RACB 3GYGA 1N34F 3DRPA 3T1YJ 2FY8A 2IAJA 3M6WA 2P9GA 1CG2A 1QUPA 3MEDA 3AD8C 3GTYX 2FUG9 2P2CB 1MMLA 2V2ZA 2YX4A 1C1BB 1RTJB 2GVDA 3SV4A 1VISA 2V68A 4M94A 4Q2LA 3K8WA 4XTTA 4ECVA 2JEIA 4C3KA 3ENQA 2O01C 2XG8A 3PZPA 1X4FA 3MUVP 1WKLA 3HFKA 4X62J 1GTHA 2BKNA 1JXEA 4OX8A 2VG7B 3QAUA 3QPIA 3C6TA 1HWUA 4A8XA 1Y0HA 2FZKB 4EBDA 5GAEI 1RJJA 1RTZA 4DFPA 1WELA 5E5NA 3AAWB 4LSZB 3M8WA 2CNLB 3HX9A 1M5PC 4DR4J 1U2FA 1TAUA 4DV3F 3BS9A 5L38A 3DOLB 3R1HA 2KT2A 2PMWA 4KV8B 2A2CA 3M6UA 1RAGB 3E2EA 4I56A 1WD6A 2GJIA 3I0SA 5FDLA 4YY3J 3RGIA 2DNLA 2B5JA 2WRMA 4ED8A 4NZ0A 5L39A 2MZ1A 1M1HA 1X4DA 1FJ7A 1M5OC 2UU9J 3NGKA 1RTIA 1PG5B 4YHHJ 3GFHA 2XLJA 1JKHA 3TUPA 2X1GA 2BKOA 4AD6A 3Q8PB 1HARA 2C2DA 2ASYA 4DR2J 3H59A 2E66A 2ZKTA 3K59A 1QAYA 3FEZA 4FNHA 3THPA 2YQ3A 1S48A 1D0EA 1RYRA 3HT3A 4P2FA 4I2QA 2C2MB 4MKVA 2JZ5A 3EVWA 3DHWC 3Q8SB 1SUQB 2VBZA 3AQOA 2IYGA 5HQ8A 4QIWD 2K1RA 2Z57B 4HHUA 4MK9A 2FVSA 1FESA 5KT2A 3AQPA 4NLUA 3M7VA 1LWFB 1S9GB 2Z2MA 3HHLC 2DHGA 3FEYB 2M88A 3W7BA 2VPYB 4KPYA 5F41A 2EPIA 4NLXA 1C0TA 2KU7A 2YWHA 3KLIB 2JRSA 3CB4A 3GJRB 2AWZA 4F36A 4E8UA 4PWDB 2CDRB 3NRBA 4CTAB 4DL2A 1CJKB 3R5GA 3I56S 2MDAA 5A8WA 3K57A 3OR2A 2VHGA 4P6QA 3Q0AA 5AXNA 3CC4S 1JQGA 4V19J 1HR0J 2ZNZA 3WC0A 3M2UA 3HXMA 1X5SA 3R27A 1O8BA
chains in the Genus database with same CATH topology
3EZOA 4RR5A 3K89A 2G2OA 3IM8A 1NM2A 2C2NA 3RGIA 4AMNA 2G2ZA 3HHDA 3CJ8A 3HJVA 2G2YA 3R97A 5DZ6A 3PTWA 4RL1A 3QATA 2JFDA 3H0PA 3R8YA 2JFKA 3TZXA 4AMPA 5DZ7A 4QBUA 3IM9A 4AMOA 2G1HA 3BV8A 1MLAA 4AMMA 3SBMA 2QC3A 3G87A 2QJ3A 3TQEA 3TZZA 3TZYA 2CUYA 2H1YA 3TZWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EZO A;  4RR5 A;  3K89 A;  2G2O A;  3IM8 A;  1NM2 A;  2C2N A;  3RGI A;  4AMN A;  2G2Z A;  3HHD A;  3CJ8 A;  3HJV A;  2G2Y A;  3R97 A;  5DZ6 A;  3PTW A;  4RL1 A;  3QAT A;  2JFD A;  3H0P A;  3R8Y A;  2JFK A;  3TZX A;  4AMP A;  5DZ7 A;  4QBU A;  3IM9 A;  4AMO A;  2G1H A;  3BV8 A;  1MLA A;  4AMM A;  3SBM A;  2QC3 A;  3G87 A;  2QJ3 A;  3TQE A;  3TZZ A;  3TZY A;  2CUY A;  2H1Y A;  3TZW A; 
#chains in the Genus database with same CATH topology
 3D5M A;  3MXH P;  3GMG A;  1R27 B;  3LPE A;  2E7X A;  2H9Z A;  5F8J A;  2ILY A;  4CIO A;  3CCZ A;  2VPW B;  1FJC A;  5HK4 A;  3CME S;  5L1L A;  3K89 A;  2HFZ A;  2HQ3 A;  2LA6 A;  1QSS A;  4JI6 J;  1YJT A;  2DGU A;  2DY1 A;  2DGW A;  4LF1 A;  3DHX A;  4PQA A;  2DHA A;  1K1S A;  1U1O A;  4YQW A;  3QIP A;  4H4O B;  1QLN A;  2CQ1 A;  1FEE A;  2DD8 S;  1H3D A;  3HZE A;  1KWM A;  1U4B A;  3KNG A;  2GIR A;  4DV4 F;  3GJQ B;  1S72 S;  4DQQ A;  2ZHB A;  1TV6 A;  4IH6 A;  5EN1 A;  1CJT B;  1XMQ F;  2YKO A;  1HD0 A;  4TU7 A;  1JLG A;  3NXZ A;  1GXL A;  1MNE A;  4ZDN A;  3PW2 A;  3G6V A;  4N56 A;  3QRR A;  4P52 A;  3IO1 A;  3NS7 B;  4KO0 A;  2CQH A;  1J5O B;  3S7R A;  2KZZ A;  1IJF B;  3GIK A;  3HUL A;  2BKP A;  1ARO P;  4PQU B;  3M6V A;  3Q23 A;  4P7T A;  1XQI A;  2ZEJ A;  1RAH B;  1JLF B;  1NPR A;  4DS4 A;  4C8Y A;  2DNG A;  3MOZ A;  1T94 A;  4FYW B;  3BYP A;  1ZET A;  3D6H B;  3LPY A;  3W9J A;  3W8G A;  4CT9 A;  4X4O A;  3IRX A;  5J2P B;  2OFG X;  3C16 B;  4J9M A;  2W1B A;  2ZUA A;  4X4S A;  8ATC B;  1NU4 A;  4OHX A;  4DI6 A;  2VA3 A;  2OFH X;  4C7Q A;  3A4T A;  2GIQ A;  3NOC A;  3PM9 A;  3W64 A;  3LW5 C;  3M6X A;  3PNI A;  2F4F A;  4EYI B;  3VR1 A;  4J9S A;  4JI0 J;  4LT6 A;  2AJ0 A;  3PW0 A;  1TKX B;  3SEO A;  1KLM A;  2ZOG A;  2KN4 A;  4WCE Q;  4DV5 J;  1HMV B;  3ENA A;  2BE2 B;  1Q79 A;  4NEZ A;  1WF2 A;  3VV2 B;  2DCL A;  1TK8 A;  3IG1 B;  2WVF A;  3VQS A;  1LW0 B;  1LWX A;  4DFM A;  3W60 A;  1UVI A;  4FS2 A;  1JJ4 A;  4ER8 A;  5F8H A;  4OZL A;  4YME A;  2AEF A;  2I5J A;  4U95 A;  4LQ3 A;  4HYK A;  3HK2 A;  4B3M J;  2DIU A;  5F3T A;  1KQK A;  4M5D B;  3UR0 A;  4USH A;  1SC1 B;  1H2V Z;  4Q5V A;  2EFQ A;  2VBX A;  2ILZ A;  2RQK A;  4DSF A;  1IKW B;  4WK3 A;  4NLP A;  1ZM2 A;  3JYT A;  1G6B A;  1BXN A;  2QMU B;  5C2C A;  4LSL A;  2YXL A;  1CC7 A;  1WHY A;  1NKC A;  1IXK A;  3NAH A;  3BQ0 A;  4MKB A;  2FGO A;  4H4M B;  1WHX A;  5I42 A;  1FE4 A;  2FJE B;  7AT1 B;  4UUW A;  3J7A 1;  1S76 D;  1S6O A;  2U2F A;  4AL6 A;  2DR9 A;  3R7B B;  2RUS A;  1H72 C;  2ZWP A;  5IQ6 A;  5EHH A;  3N6L A;  5LM7 E;  1YWX A;  5E0O A;  5AXK A;  2MQQ A;  5HBM A;  4B9N A;  2Y1I A;  2ZUG A;  4Q0B B;  1Q53 A;  3PJX A;  1S0M A;  4X4Q A;  1KQF B;  2ZM6 J;  4DUY J;  3M2V A;  3PIO Q;  1ICE B;  1SC6 A;  3SQG B;  3D6F B;  1TL7 B;  4Z7C A;  2UUW A;  3KHL A;  3KWM A;  2VJV A;  1UMJ A;  1EQ0 A;  4QW8 A;  2BOA A;  2XZD B;  2VC1 A;  4AMP A;  1UW9 A;  4F4W A;  5HP1 B;  2ZZN A;  3IAM 9;  3THT A;  4LFC J;  5J2N A;  3MEG B;  2UUA F;  1FWL A;  2NYH A;  3TEG A;  2J0W A;  2JLE A;  2XTJ P;  1BE4 A;  4K4Y A;  3M1V A;  4ITS A;  3OUY A;  2KZM A;  4RW7 B;  1RT1 A;  5KFD A;  2RB7 A;  2DNQ A;  3L7O A;  3I4H X;  3RRH A;  3KG1 A;  4I2P B;  2RHQ B;  3MMB B;  2MSS A;  4BS2 A;  4Q2M A;  1T3N A;  4PKD B;  2VFR A;  3RBZ A;  2AJQ A;  2HHH J;  2DRD A;  3LH2 S;  5I3P A;  2XNQ A;  2AEM A;  2XMU A;  3T1Y F;  1UFW A;  2A3J A;  3GJT B;  3MPV A;  5I3U A;  1YGY A;  4IRK A;  3KMQ A;  2OEK A;  3BB5 A;  2VOP A;  2OAU A;  4P2M A;  3Q8Q B;  3RJM B;  1JLC B;  2PMZ D;  2HWH A;  1X4A A;  3HSJ A;  2XMK A;  4J9L A;  1HNX J;  3KJV A;  4F4A A;  2C2Z B;  2AIR B;  4KJI A;  1T9T A;  2HFU A;  3DLE B;  4Y6I A;  4I7F A;  1J5E J;  3M8S A;  4Y3C A;  5D78 A;  2W25 A;  4DXL A;  4IG0 A;  4X62 F;  3ONQ A;  3NNH A;  5KG7 A;  1SH2 A;  1T9W A;  3JTO A;  1S1W A;  5KFO A;  5DS7 A;  1RKI A;  1T8E A;  4RNN A;  2B7B B;  4ETX A;  3HLU A;  1V5I B;  4PUO B;  4BHQ A;  3QFW A;  3QAE A;  2VG5 B;  4ZCK A;  1S9F A;  3C3L A;  2JEF A;  5CYM B;  1AFJ A;  4GKK F;  3GG1 A;  1WI8 A;  3N5B A;  3HSZ A;  3DOK A;  3AA8 A;  4DUZ J;  2QA1 A;  2H5J B;  2M8H A;  2H4W B;  4FPR A;  2G0J A;  4YY3 F;  3BEG B;  1VQY A;  3LQV A;  4GVL A;  3RBD A;  2VPZ B;  1Q8L A;  2BRK A;  3ZZO A;  2A6O A;  2XMV A;  4YB7 A;  4HR2 A;  4O3N A;  2OPP A;  3GPA A;  2CQC A;  3OVS A;  3P6Y C;  1S5Z A;  3FC9 A;  3W65 A;  1S79 A;  4EFA C;  5DDO C;  1U1M A;  1R43 A;  1EET B;  4Q8F A;  4NXM J;  2JEG A;  2ZH9 A;  2FHK A;  2Z56 B;  2LFV A;  1KVJ A;  3IS9 A;  1R8H A;  4DR2 F;  3T19 A;  3WDO A;  2YX7 A;  1ULR A;  1F3F A;  3TYT A;  2NXC A;  2M9K A;  3EGW B;  2HVE A;  5A0Y B;  2GAH C;  4LR7 A;  4OFZ A;  1HQE B;  4RWW A;  3OBI A;  4OYA A;  2VL1 A;  4RW4 B;  1HI1 A;  3HP6 A;  3DU6 A;  2K3K A;  1QAX A;  2QL9 B;  2F8H A;  1WG5 A;  2HYI B;  1VRU B;  4DL5 A;  4CLU A;  1N36 F;  4J9P A;  1TKZ A;  3CXC R;  2CZV C;  4DV6 F;  1LW2 B;  1WAC A;  2CPY A;  2LVW A;  2R9L A;  1RCX B;  4ZJQ A;  1CQM A;  5KG3 A;  4KSE B;  2R8I A;  1PC5 A;  2Q3P A;  2KKH A;  3PV8 A;  4XDD A;  3D1Q A;  2BBE A;  2UXC J;  2V9W A;  3M8Y A;  4IR1 A;  1HR0 F;  3QID A;  2IYI A;  4A8O A;  3MEC B;  4LF2 A;  3UD5 A;  3O44 A;  3D7S B;  4WK1 A;  3VGT A;  4CO4 A;  4ERD A;  1TL3 B;  3HT0 A;  4DSE A;  3DI6 B;  4DPT A;  4NWB A;  3S6E A;  1FDA A;  1FKP B;  2V0N A;  1DQ9 A;  5KFG A;  2RS2 A;  1QE1 A;  2BRL A;  3F41 A;  3I32 A;  2DR6 A;  2FTR A;  4X4N A;  5EGY A;  3QFH A;  2H65 B;  5IZH A;  4ZPA A;  5E7O B;  5EX3 A;  3W9I A;  2IDL A;  3B82 A;  1HBU B;  3F56 A;  3VVT A;  1X4C A;  2MLZ A;  4UZB A;  1PIE A;  1WI6 A;  2WK4 A;  3BDE A;  2BQU A;  1YRT A;  4B3R J;  1WC0 A;  3PAC A;  3D2W A;  3D6T B;  3Q83 A;  4UST A;  1X4B A;  4U96 A;  4GO5 X;  4ZVS B;  4ZOS A;  4R8U B;  4LRF A;  5GAH I;  1QTN B;  2IJF A;  3HHD A;  5J2Q A;  1YBT A;  4AYB D;  3CDW A;  3MFI A;  4AUK A;  1R3N A;  4JV5 J;  1Q16 B;  4IFY B;  2O3D A;  4F26 A;  3EIC A;  1N5Y A;  5C42 B;  5G0R B;  3BM7 A;  1T05 A;  3MPD A;  2CJA A;  3Q2T C;  1KDN A;  3LO3 A;  2YKA A;  3T6B A;  2W8K A;  3AA9 A;  1D9D A;  3CCE S;  2HHU A;  2WON A;  4X2B A;  5CYQ B;  3QQC D;  2B0G A;  5KFM A;  1DTQ B;  3VAH A;  4WE1 A;  2RSQ A;  3CDA A;  1YBU A;  4LSN B;  5KFK A;  1CS4 A;  2OD6 A;  5J1E B;  4LF8 J;  1HI8 A;  2CQP A;  2ZDP A;  1S6Q B;  3KK2 B;  4O3R A;  3LP1 B;  3DFE A;  2MKK A;  4ED0 A;  1FVS A;  2ASD A;  5EUH A;  4RL1 A;  2XSJ A;  3BSC A;  2YKM A;  4QYZ J;  4W98 A;  2BV3 A;  4UF4 A;  2YWG A;  4RUB A;  5SUH A;  4Y65 A;  4ED1 A;  3SIP B;  1EQM A;  2FD2 A;  3B78 A;  5KTQ A;  4DV2 J;  3CO0 P;  5KFH A;  3JSM B;  2V2K A;  1N33 J;  4RU2 A;  3BQ2 A;  3RAQ A;  1SC4 B;  5B0E A;  4DR5 J;  3BGO P;  4DV5 F;  4C11 B;  3M9N B;  1RGV A;  4RX6 A;  4WTY A;  2JLF A;  2G2Z A;  2V8P A;  1PJ7 A;  1LK7 A;  3KFW X;  2GVZ A;  2WOM B;  1N4L A;  2MQN A;  2QYG A;  2CDQ A;  2C2O B;  1FRH A;  3QGG A;  2LXF A;  3PEH A;  4K5R A;  3G8S A;  2DY9 A;  3GV8 B;  2KHD A;  1C0U B;  1UTA A;  1EAY C;  2PSZ A;  4F4X A;  5JJB A;  1JLB B;  1JMT A;  3H5X A;  2BW2 A;  3VF0 B;  2YTC A;  3M8Q B;  3N0V A;  1I5O B;  2G2O A;  5E3A A;  3A3O B;  5D15 A;  5KFE A;  1HNZ J;  4A8Q A;  3BGU A;  2AF6 A;  4H4K A;  5JVH Q;  2E1M C;  1DUR A;  1ZH5 A;  1DTT A;  3D0H E;  4O44 B;  4NLW A;  4Y34 A;  2PD1 A;  3TAR A;  4GKJ F;  2NXE A;  3P5B P;  3GIM A;  4UY8 5;  3TA1 A;  2XY6 A;  2DEI A;  1QAI A;  3LWM A;  1W25 A;  3AFG A;  2N7Y A;  4KAI A;  5HMW A;  3E01 A;  4BWM A;  2HNY A;  4DN0 A;  1G3O A;  2C1E B;  3A8E A;  1Q86 T;  3FRZ A;  3BR9 A;  4O3S A;  2MKI A;  4OIX A;  5F8G A;  3R2C J;  2ERR A;  2LQ5 A;  1RA7 A;  3MGJ A;  2KT3 A;  2C2K B;  2QL7 B;  3UDV A;  4USK A;  1Q95 G;  1VBK A;  1WEX A;  4DUY F;  1NHU A;  1JLE A;  1LFP A;  5B0A A;  2FLP A;  2LQJ A;  4FBT A;  2KYX A;  3WHI A;  3WC2 A;  2CPH A;  2HNZ B;  2OPS B;  4ELT A;  4CT8 A;  1VK8 A;  5BYQ A;  3EYZ A;  2GZO A;  2W2N P;  5IT4 A;  4Y2K A;  2AJ1 A;  1R7I A;  5F8L A;  4C4W A;  3T1H F;  4DX8 H;  4OYB A;  1VOM A;  1MMD A;  2HRY A;  2NSB A;  2MZT A;  3R3T A;  2B51 A;  2JEJ A;  2ZWO A;  2UUB J;  1WHW A;  3IR6 B;  4ZVF A;  1T95 A;  1UVM A;  2L3M A;  3HI9 A;  3GCX P;  3CCW A;  1R8C A;  2FVC A;  4PG5 A;  2Y0B B;  4EI2 A;  4YOE A;  2KFZ A;  2FB0 A;  2UXD J;  2KRB A;  2FC9 A;  3DC2 A;  3N28 A;  1IKX B;  2J9E A;  4DJB A;  2YKP A;  3W66 A;  4URS A;  3C19 A;  2E1C A;  2V94 A;  4TN2 A;  2PA8 D;  2DIV A;  2QSW A;  5KFL A;  3KK1 B;  2PE8 A;  1X31 C;  1TFW A;  2BM1 A;  2UV8 A;  1H73 A;  2KHC A;  1VQ5 S;  2R2S A;  5CQG A;  4DHV A;  3OVA A;  1RHR B;  2QLW A;  1SPB P;  1FO1 A;  1YIT S;  2VZ9 A;  4Y00 A;  5D4L A;  3DYA B;  4K8R A;  3PYG A;  1ZYQ A;  3DGP B;  1XR5 A;  2I9S A;  3OXL A;  2CVI A;  3ET6 B;  2J9C A;  4HI2 A;  2CNK B;  2L41 A;  4UOC A;  3KLE A;  2HLT A;  2YWF A;  4DU7 A;  3W5X A;  4LF7 J;  4DR6 J;  4V1A k;  1NKB A;  3UWT A;  2M4M A;  3E8O A;  4LIR A;  1CJU B;  1S1X A;  2W24 A;  5HMZ A;  2IHR 1;  3F44 A;  3UN2 A;  4NYO A;  2HUR A;  2ADB A;  1FRX A;  3RZA A;  4KHP F;  4X65 J;  1U24 A;  2HWI A;  4ECU A;  2Y0S D;  5A8R B;  2BJ3 A;  1IR2 A;  2B7C B;  5CAB A;  1VLO A;  2Q43 A;  4RW8 B;  1FFG B;  3TUI C;  3OQ2 A;  5IWA J;  3TQE A;  1FTR A;  4DUZ F;  4CH0 S;  3P96 A;  1XEZ A;  1RT6 B;  4F7V A;  1HWK A;  1FA0 A;  4EO6 A;  4ZN3 A;  2BZ2 A;  4UTG A;  4KIA A;  2GW8 A;  1YTY A;  4OJH A;  2E1A A;  3MPW A;  3GIR A;  1Q0N A;  4ZCM A;  4AQY J;  3BGL A;  3QSI A;  4TY9 A;  5HMY A;  3HHL D;  5C25 A;  2D3O 1;  2IBO A;  2MTL A;  2HMI B;  4NL5 A;  2A6M A;  2JH3 A;  3TUZ C;  3RTV A;  4NXM F;  4Y2C A;  1YJW S;  3U7J A;  2UV8 G;  3WZ0 A;  1U49 A;  4L72 B;  2RRB A;  1RT2 A;  2VFS A;  1PBU A;  1PO6 A;  2Z0G A;  1RU1 A;  1S59 A;  1TAQ A;  3F73 A;  1NJX A;  3RB6 A;  4DF4 A;  2F9D A;  2J0X A;  3QZ7 A;  2IRU A;  3HFZ B;  2L48 A;  3VGS A;  4RBV A;  3I5A A;  1RWM B;  1YRX A;  1GNK A;  1D9A A;  1GK8 A;  4DL7 A;  1PAE X;  4M95 A;  1CJV B;  2JC1 A;  5KFZ A;  3PFE A;  3PKY A;  3SQO P;  1KC8 T;  1N6Q A;  3QAT A;  2FJA B;  4KPC A;  5EX0 A;  5DZ7 A;  2MLY A;  5FJ4 A;  2ZH4 A;  4B02 A;  2IJR A;  1X0F A;  1VQS A;  3ZTO A;  2KM8 B;  3TR5 A;  3WIU A;  2J76 E;  2YKQ A;  3JAM U;  5ADZ A;  2XYH B;  3GV5 B;  4XPE A;  2CWX A;  2IC3 B;  5DG9 A;  5L1J A;  4YB5 A;  1TUV A;  2XMJ A;  2NZ4 A;  4DUT A;  1NME B;  5DDQ C;  4ETZ A;  1T03 A;  2AYM A;  1WF1 A;  2RKI A;  1AW0 A;  5DM6 Q;  4DZD A;  2BXJ A;  1YRU A;  3DXS X;  1H74 A;  5F9L A;  3NGT A;  5MAO A;  2HLU A;  2IM0 A;  2VF3 A;  1W2B R;  4NA1 A;  4FXD A;  4Q45 A;  3KLF B;  1HL6 A;  2EG1 A;  4XIU A;  1LK5 A;  1VLY A;  4NE9 C;  4NLD A;  4P10 A;  4BDP A;  3E3X A;  5GMD A;  1U7L A;  2IBK A;  2PA3 A;  2POK A;  1EX8 A;  1UVN A;  2OD4 A;  1PAU B;  3RAX A;  5CD4 H;  4JV5 F;  2RJZ A;  4XPC A;  2QLX A;  1JIH A;  2CPZ A;  2AP6 A;  2JDJ A;  3VAM A;  3IBW A;  4O3Q A;  1UEV A;  4QW9 A;  3BBC A;  4NZ6 A;  1TVR B;  4DV1 J;  1LWE B;  3CTR A;  1KOO A;  4NCG B;  3A12 A;  5DGB A;  3T6J A;  3JSB A;  1MRO A;  3C2P A;  1BQM B;  4QWD A;  3SMZ A;  4MFB A;  2RQ4 A;  4WKR A;  3M05 A;  4DPO A;  2VFV A;  3H5U A;  1WJ9 A;  3BPD A;  1N0V C;  3UNY A;  5IM0 A;  2V4R A;  1RI7 A;  5A8K B;  2J8A A;  4F25 A;  1WC3 A;  1FWK A;  2OKQ A;  4F50 A;  1CUL B;  4ED4 A;  1DY3 A;  4AFF A;  2G0C A;  4IDK B;  4RR5 A;  3T5K A;  4KGK A;  4K4U A;  5AJ3 F;  3SSQ A;  1X9W A;  2QL5 B;  4V19 X;  4K4Z A;  4KHM A;  1AT1 B;  1RDR A;  2FJV A;  4Q43 A;  2IA6 A;  3T5J A;  2HKE A;  1XNQ J;  5F0W A;  3CCL S;  1U48 A;  4X66 J;  3I5B A;  5ETT A;  4DV2 F;  4NLR A;  3RG6 A;  2CQ2 A;  2HIY A;  5F8N A;  5F0U A;  2CG4 A;  4C8M A;  3J81 U;  2A10 A;  1W26 A;  3OR1 B;  4OV1 A;  1XJW B;  4AXJ A;  3G71 S;  3PO5 A;  4TXS A;  4OL8 A;  1JLQ A;  1NK9 A;  1VHI A;  4PAA A;  3D0G E;  1NDL A;  3W2V B;  2DNZ A;  2GHV C;  5DQG A;  2ZC4 A;  1QVG R;  3AOD A;  3PJ9 A;  1HNI B;  4B3S F;  2XY7 A;  1Q1K A;  3ITH A;  3ZZP A;  1RHQ B;  4W4M A;  3T3F A;  4U7C A;  3MM6 A;  5H9F K;  1S1V A;  4KKO B;  5I4M A;  2WCX A;  3SSS A;  5ITH A;  2XO7 A;  3R97 A;  2CXE A;  2AZ3 A;  2VFT A;  3SFU A;  1A7G E;  5A76 A;  1BQN B;  2JL9 A;  4DLE A;  3CJK B;  3HHE A;  3MM8 B;  4TY8 B;  2H54 B;  1FNX H;  3OTC A;  1PJ6 A;  2VPX B;  2F40 A;  2YY3 A;  2W9C B;  4CM0 A;  1WF0 A;  2R7O A;  5KFU A;  4IYQ A;  2HZV A;  4ELV A;  1OJ4 A;  3A8K A;  2R7V A;  3P4U B;  2R7X A;  4NAS A;  4AXI A;  3FCV A;  3TI0 A;  1RTH B;  2QEX S;  1RTD A;  1M1G A;  5LSO A;  2JVO A;  1C4A A;  4OI6 A;  2V4J A;  2DT9 A;  8RUC A;  2K2P A;  3UW1 A;  3M8Z A;  5BR8 J;  3FZ2 A;  4F4Z A;  4MIW A;  5BXI A;  3HHL A;  1D09 B;  2GVD B;  2V9K A;  2ZE2 B;  3MHY A;  4LRE A;  3JQK A;  3EMT A;  1OQ3 A;  1Z2Z A;  4FF1 A;  1XMO F;  3US5 A;  5ETM A;  4A8W A;  2R8K A;  2EC0 A;  3LTO A;  1KD1 T;  3I87 A;  3R5J B;  1DFD A;  3P45 B;  4DR7 F;  2UUB F;  5E33 A;  3C6T B;  4WFB Q;  3CVK A;  1LV5 A;  2WAQ D;  1WEZ A;  3I5C A;  2GC8 A;  5DZ6 A;  2H5I B;  1HD1 A;  4N7T A;  3OXG A;  1U09 A;  2CKW A;  5LMN F;  2E1P A;  4CLW A;  1GAO A;  1ZM9 A;  2UXD F;  3MM7 A;  2ACY A;  2KVQ E;  1H7X A;  4DSI A;  2F63 A;  2IM2 A;  4ECR A;  2YNH A;  1EJ7 L;  1HWJ A;  2XUL A;  1R0C B;  3FCH A;  5FDL B;  1XER A;  1N34 J;  1NAQ A;  2B5J B;  5EWE A;  3KDO A;  2GHW A;  5LMU F;  4A8M P;  3PXG a;  3PRV A;  4MMO A;  1KP6 A;  4TLQ A;  1SL0 A;  1RBL A;  1RTI B;  2N4C A;  3FQL A;  3NG8 A;  3EZU A;  2HW3 A;  2R7T A;  1H98 A;  1FX4 A;  5HL7 Q;  1IQZ A;  5JXS A;  1LWF A;  1S9G A;  3PHE A;  1RT4 B;  4C3M A;  2C42 A;  3MFH A;  2HFO A;  5K14 B;  4OMF G;  2C3U A;  5FD1 A;  1N48 A;  2BEF A;  3UDE A;  4X64 F;  2YWE A;  2BJ8 A;  2HND A;  2HFV A;  3OTD A;  3L4B C;  1GMW D;  4U8Y A;  4ZIW A;  2UXB J;  4I2Q B;  5LT5 A;  2JC0 A;  3UI3 A;  1TK5 A;  4PAB A;  2CJY B;  3FBC A;  3POT A;  1KHW A;  1VC5 A;  2K1R B;  4QWA A;  3G6Y A;  4OHV A;  3I6P A;  4UY8 T;  4DOZ A;  2RRN A;  3MCM A;  4DV3 J;  1KVI A;  2XS5 A;  2Y9H A;  2MZQ A;  2QLB B;  1SJ4 P;  4JI1 F;  3RW6 A;  3J81 j;  2FVR A;  3N5F A;  1C0T B;  4FS1 A;  2FZC B;  2C2R A;  2JFD A;  1HNW F;  4AQY F;  1NEE A;  3A1Y G;  3DM2 A;  4H4O A;  2N3O A;  2YKN A;  1TUW A;  5MLC V;  2BYC A;  3OR2 B;  4HEA 9;  2ZJP Q;  2NXU A;  2GV1 A;  4H4K C;  2W01 A;  3RYL A;  2COL A;  5GAD U;  4QCL A;  4PEO A;  4U7U D;  1YZ7 A;  3JAM Y;  1Y7P A;  4XK8 C;  3FRY A;  2OGU A;  1S7I A;  2R4F A;  1IQT A;  2XB2 D;  2ZBR A;  4WFX A;  5B0G A;  3UPF A;  1RU2 A;  1TEL A;  2CPX A;  4RW9 A;  3QIP B;  2G2Y A;  3U1L A;  5C24 A;  4PQU A;  4U7U K;  4ZS6 A;  3QRP A;  2C3P A;  2AJF E;  4RUA A;  1SV5 A;  1NDK A;  4RKU C;  4GC6 A;  1TV6 B;  2DK2 A;  4CDI A;  4F0H A;  1UJ4 A;  4L75 A;  3EWG A;  2ROE A;  1R0A A;  5CH7 B;  4ZLJ A;  1OSD A;  2EKY A;  5J2P A;  1SIW B;  5IC6 B;  2F9J A;  2V8G A;  1BMQ B;  4GVB A;  3AH6 A;  3MMJ A;  2CZ9 A;  2W9B A;  4IO1 A;  2XM3 A;  2AJ2 A;  3CDB A;  4A4J A;  1RLD A;  2OLW A;  1HWI A;  2BJE A;  3RB3 A;  5E3Q A;  1NK4 A;  2LDI A;  2LQ8 A;  3H20 A;  2PMH A;  1TKX A;  5B0B A;  2V67 A;  3OXF A;  4J9O A;  1HMV A;  3QT8 A;  3IRX B;  2BE2 A;  4BCA A;  5D0R A;  4ID8 A;  3PX0 A;  2DGQ A;  3CCU S;  5F8I A;  2K06 A;  3I82 A;  1LW0 A;  4WWS A;  1ZM3 A;  2Y3Y A;  5CAA A;  2HAI A;  4ELU A;  2MHE A;  1EP4 A;  1FCA A;  4A48 A;  3LGN A;  2FJW A;  4M5D A;  1SKU B;  4DV4 J;  4M5H A;  2DPI A;  3DKD A;  4LBI A;  1KLM B;  3MAA A;  1XMQ J;  1F5A A;  2PFF B;  9ATC B;  1GTE A;  3MM9 B;  4JV1 A;  1RHU B;  2LQ9 A;  3ELH A;  3TX0 A;  5E2Q A;  3QO9 B;  1HHQ A;  2MZJ A;  1JK9 B;  2QZ8 A;  2VKR A;  4IFV A;  4H4M A;  4DCO B;  1YIJ S;  4DQS A;  4DWI A;  4NYZ A;  5HVH A;  2I5J B;  3ADA C;  4NOH A;  2HQI A;  1JB0 C;  1SH0 A;  4QPT A;  3CJ0 A;  2DH8 A;  3FDS A;  2RQC A;  1T9Y A;  2A1B A;  3AJD A;  3HHK A;  4ES1 A;  1TUG B;  4ILM A;  1IJE B;  2BR0 A;  1ITP A;  1SIZ A;  1NBE B;  4TYA A;  1U8W A;  4P73 A;  5CHC B;  3OHB A;  1WHV A;  3EPG A;  2VBW A;  3NS5 A;  3JYT B;  1SB6 A;  4LSL B;  2DGX A;  1EHW A;  3VHQ A;  3F0N A;  4OYX A;  5I42 B;  2P5V A;  4E0D A;  2B56 A;  2D69 A;  1XNQ F;  3L7U A;  2Y8W A;  4WKY A;  3P5T L;  2W9A A;  1SKR A;  2JWN A;  4P74 A;  3ZO7 A;  1OY8 A;  3BN7 A;  4M1K A;  3D9B A;  3K5P A;  4OYZ A;  2QA2 A;  4W92 B;  4IRD A;  4FYD A;  5HP1 A;  1C1C A;  1X4G A;  3IR7 B;  3RW7 A;  4K5S A;  2W4P A;  4A47 A;  5LXY A;  3ULH A;  2WB4 A;  4UOF A;  3G8T A;  3B6B A;  1KR4 A;  1YJ9 S;  4MH8 A;  4O23 A;  3PR4 A;  2ZH5 A;  2IA0 A;  1YG0 A;  5D0E A;  4PCQ A;  3M2V B;  1FVQ A;  1VQ9 S;  1Q8I A;  1NKE A;  2GJF A;  1OSC A;  1PBA A;  2C2E A;  2RML A;  4EEY A;  4CLK A;  1VS3 A;  5KFF A;  2W2O P;  2BAN A;  4DMZ A;  4TU8 A;  3UD4 P;  3DLG B;  5BYR A;  3M1V B;  5J1N A;  3OUY B;  3G4S S;  2ZH1 A;  1RT1 B;  1R6Y A;  3OL8 A;  1YSJ A;  2UUT A;  2LEB A;  3O1L A;  1YVF A;  4LIW A;  4AE5 A;  3HMJ G;  4KB7 A;  2GO9 A;  3KG0 A;  3RB0 A;  2YNI A;  1SJF A;  2NUH A;  1FDB A;  4IQX A;  1NJI T;  4LVO P;  1NHV A;  1S6P A;  3SV3 A;  3TW0 A;  2XHW A;  3BR8 A;  4X4U A;  4HKQ A;  1NK6 A;  3IFE A;  2VB6 A;  4ALZ A;  2ZHA A;  4JUZ A;  1FF2 A;  5KFQ A;  3MR5 A;  4UQG A;  2C3M A;  3GQC A;  1S99 A;  5I3U B;  2DHS A;  2HPU A;  1FXD A;  2BAB A;  3DLH A;  2FHJ A;  5K8P A;  2DEJ A;  2VG5 A;  4KR0 B;  4JI7 F;  3OJU A;  3SYZ A;  2QGF B;  3CWJ A;  5GAG U;  1B4S A;  5HQL A;  2HHX A;  4CLL A;  4BBY A;  4QU6 A;  5CYM A;  1S1U B;  1F5B A;  4P72 A;  5H9E J;  2OPR A;  2MGZ B;  2N82 B;  2UZA A;  4I7F B;  5KFC A;  3G6E S;  3DLK A;  3DNC A;  4GC7 A;  3S01 A;  2VV5 A;  4G6V B;  1I6J A;  4IG0 B;  4ANC A;  2H3E B;  2QIF A;  1V5V A;  1B0V A;  1MU2 A;  1VQN S;  1S1W B;  2UUA J;  4EK2 A;  2U1A A;  4NCB A;  3AB2 B;  3QGP A;  4P71 A;  3CNQ P;  2EVZ A;  3UVJ A;  1X4H A;  3PW5 A;  3UO0 A;  3PFO A;  4O4G A;  2BVZ A;  4PXC A;  3KMS A;  3I0R B;  1PKU A;  2X1A A;  1NCL A;  4CM2 A;  1OPI A;  1U25 A;  2R7S A;  2VQE J;  4OX6 A;  3HHN B;  1EAR A;  2HBR B;  2ALY B;  5EWG A;  3DOK B;  3DU5 A;  4OZ5 A;  3C14 A;  3CPW R;  1Z4U A;  3NOG A;  3HM9 A;  1HNV B;  2AT1 B;  4K59 A;  2W7A A;  4DV7 J;  2RS8 A;  2ZJQ Q;  4PXB A;  4S0M A;  3FFI B;  2GJ2 A;  2J7K A;  4TVA B;  1TL1 A;  4RW4 A;  3N01 A;  3GP9 A;  1RB0 A;  4NA3 A;  4ED3 A;  3L7P A;  2GQQ A;  3LGH A;  3QT7 A;  3VAG A;  4IOA Q;  2ZD1 A;  2UUC J;  5KG1 A;  4L3K A;  3BBF A;  4TQR A;  3HKZ D;  4NA2 A;  3ZTQ A;  3K7R A;  1LW2 A;  2C28 A;  3IS9 B;  4KFB B;  3GLJ A;  4ZLN A;  2IMW P;  4OYW A;  2D9O A;  4F67 A;  6FD1 A;  3NCQ A;  4LRD A;  4CLY A;  1YJR A;  2X3G A;  1WC4 A;  4OYM A;  2UXB F;  5LOQ A;  1UWB B;  1RAB B;  4DG1 B;  1RWN B;  4J9R A;  3V4I A;  1AUD A;  5GAD I;  3MEC A;  4LFB J;  2VG6 A;  1UWA A;  2E7V A;  1RK8 A;  1APS A;  1NSP A;  4HT7 A;  1TL3 A;  3MCN A;  4AL5 A;  3V6H A;  2CJ9 A;  4GKK J;  1FKP A;  2EC2 A;  1T9V A;  1D1U A;  2NXN A;  3TZZ A;  2QV6 A;  3HKW A;  1Q4R A;  4D3G A;  4RW6 A;  4C8L A;  4CLS A;  3ZZU A;  3GR1 A;  4CNY A;  1MWY A;  1O51 A;  1T3O A;  4ZK7 M;  3IAS 9;  3QJP A;  3PW7 A;  2KI2 A;  5CXT A;  1AZS B;  1NXI A;  1WOS A;  3KUE A;  2R3V A;  1QTM A;  2B9W A;  5LL6 d;  4ID5 A;  4UOG A;  1QE1 B;  3HVR A;  1T02 A;  2N7C A;  5C42 A;  2GQC A;  1GX5 A;  5G0R A;  1KQS R;  1RLC L;  5HJY A;  2WBM A;  1RHJ B;  1XR6 A;  2DGO A;  2NYI A;  2P9E A;  2VIC A;  1DAX A;  4X4T A;  2AQ4 A;  5DQI A;  5B0C A;  2QE5 A;  2J6S A;  1E6V A;  3G82 A;  3HJF A;  3W1Y C;  1I1G A;  1RWW B;  5D0G A;  4WXW A;  2MQP A;  4J5O A;  5CYQ A;  4PYA A;  3SCI E;  1N36 J;  2AX0 A;  1X5O A;  2CNO B;  4DV6 J;  2FDN A;  1SVD A;  1Z1Z A;  4C8Z A;  2HBY B;  2G0I A;  5CZV A;  5IOL A;  3LP1 A;  2E9R X;  2IDE A;  5AE2 A;  2O5D A;  1PGZ A;  2V50 A;  3WX8 A;  4F0K A;  3ZFV A;  1CC8 A;  2HQG A;  3MWB A;  1FNM A;  3CIM A;  2XWY A;  4GMK A;  2R8H A;  1NK0 A;  3OL9 A;  4CO1 A;  2R2U A;  2WON B;  5T41 A;  1VRQ C;  3OL6 A;  1BQX A;  3EM1 A;  4DL4 A;  2HS3 A;  1VRT A;  4AT1 B;  3DDI A;  3JSM A;  2FVP A;  2CRL A;  5DG8 A;  4JV2 A;  4C11 A;  2LEP A;  1HYS A;  2AU0 A;  2AGO A;  1VJW A;  2BX6 A;  4K0K F;  1NPK A;  4ZVE A;  3M8P A;  2XSJ B;  2YKM B;  5CCL A;  1IN0 A;  3D3C J;  2GNK A;  5KG5 A;  1ROF A;  1QD1 A;  2DNK A;  3AD9 C;  3VWS A;  3LP2 A;  1Q7Y T;  3PRD A;  3MI7 X;  3NGS A;  5CD4 A;  3R1L A;  2D7S A;  1IBC B;  1KN6 A;  2VBY A;  5ETK A;  1S4E A;  2NQP A;  1LWC A;  2FJX A;  2F8M A;  2OO4 A;  3R8Y A;  3GWC A;  3RUB L;  4EMD A;  3ISN C;  1RE1 B;  4KY3 A;  3TX8 A;  1WUU A;  4LRB A;  2EFV A;  4O44 A;  1WC6 A;  2M3D A;  1P1L A;  1HQ2 A;  4C0H A;  4PG6 A;  3R6L B;  4FNI A;  4C6A A;  4L76 A;  4F0M A;  2DH7 A;  1KFD A;  4I64 A;  2H5E A;  5DLG A;  3OLB A;  3TAM A;  3CCQ S;  1Y00 A;  1LXN A;  4YR3 A;  3J7Y U;  3MAQ A;  4E98 A;  2HGL A;  3UCZ P;  3KLH A;  2IVM A;  4KT0 C;  4K4S A;  3M4X A;  5GAH U;  1HFE L;  4NYP A;  1RWU A;  1NZ8 A;  1UEU A;  2J6U A;  5JVG Q;  4ZLP A;  5E3C A;  1DTT B;  3FBB A;  1BGX T;  4QU7 A;  1VJQ A;  2HVI A;  1ZTW A;  4C9D A;  3B8H A;  5F8M A;  1HBN A;  4LRA A;  3I96 A;  1VBY A;  1KHV A;  1VQL S;  1FE0 A;  1VBZ A;  2PC6 A;  3CJT A;  1VGY A;  3TA0 A;  4ECY A;  2OPS A;  2MXY A;  3M32 A;  1IUJ A;  2GGP B;  2HK3 A;  1GMV A;  3W61 A;  2VFU A;  1JX4 A;  3D0I E;  1GXT A;  3LUY A;  3FKB A;  3AD7 C;  2IM3 A;  2BQR A;  4MYT A;  3LP0 B;  2KL8 A;  4JI5 F;  5DG7 A;  1N5Q A;  1YHQ S;  2RU3 A;  2YPY A;  4HI1 A;  2HHT A;  3HVA A;  2VOD A;  3C6U A;  4HAC B;  2J7U A;  4KE5 A;  1UZH A;  2ZC3 A;  3C46 A;  2KVI A;  2DBB A;  1IBK F;  4WXO A;  3MEE A;  3PCO B;  1X7V A;  1XIQ A;  2FIU A;  3K8V A;  3NBP A;  2X7I A;  1IKX A;  4CO5 A;  3P49 B;  4KH1 B;  2R7Q A;  2MJN A;  2DNY A;  4C8O A;  2PII A;  4DPX A;  3KK1 A;  2R2T A;  1YQH A;  1JNR B;  4BC7 A;  4D3H A;  3ZZZ A;  1VR6 A;  1ZA1 B;  4FXV A;  2OPQ A;  3MF5 A;  3QT5 A;  2NLW A;  5GAG I;  3H98 A;  4QQB A;  5CA5 A;  1NND A;  4NLS A;  3QMQ A;  4GKJ J;  2BQ3 A;  3E51 A;  5HAT A;  4CZC A;  3PG9 A;  4EGL A;  2XNR A;  3EDQ B;  3B4M A;  2QFJ A;  2YNG B;  3KXD A;  4DZ6 A;  1YJN S;  3H2L A;  1UFK A;  3PYF A;  3V6D B;  3BF4 A;  5HVF A;  1FTC A;  3CJR A;  3FBE A;  3DMJ A;  4U8V A;  3RB4 A;  3W3S A;  1CJU A;  3WIV A;  3QT6 A;  4B9U A;  1I51 B;  1OYD A;  3NL0 A;  2A0F B;  1FFS B;  4HVZ A;  4RJV A;  3OW2 R;  2HHS A;  2FGC A;  3K17 A;  2FLO A;  2CJX B;  4IOB A;  3GE9 A;  1FRJ A;  2OEM A;  2ZVI A;  3G2X A;  5I3Q A;  1P8G A;  1UCN A;  1RCO B;  3HSG A;  5J2M A;  3ILJ A;  3NWR A;  4M63 A;  3ENV A;  4OJ3 A;  1IKV A;  2EWH A;  2DB1 A;  2PN6 A;  3GV7 B;  1YDL A;  1RT6 A;  4J7C A;  3CT9 A;  1WG4 A;  3KLE B;  3L09 A;  4M5I A;  4C48 A;  3SDE A;  3TWZ A;  5CZC A;  3VZI A;  2FY1 A;  4OZ0 A;  2JX2 A;  3D3B J;  1S1X B;  3BGR B;  4ZIV A;  4DX7 A;  3T1H J;  3IA0 A;  1X9M A;  4OI0 A;  3MR2 A;  4FF4 A;  3W8P A;  4AMO A;  3QSY B;  3MCS A;  4FPI A;  1G1X A;  1KOH A;  4PRF A;  2VQE F;  4KGM A;  4ZVP B;  3QWU A;  4U6P A;  3IWL A;  1FKO B;  2XLK A;  4ZVH A;  1U0S A;  2GML A;  3R7N B;  4B9V A;  3ZTR A;  4DV7 F;  4L73 A;  4IKA A;  3MTK A;  1HW8 A;  1WOR A;  1WTF A;  1JLA B;  5D4P A;  2CA9 A;  2AYE A;  2OI2 A;  3GYN A;  5C25 B;  4I4B A;  5K8N A;  3KJF B;  2ALZ A;  3Q8U A;  2M7S A;  2UUC F;  5D3G B;  2VD3 A;  2YPZ A;  3VGU A;  4MKY A;  3EGZ A;  4USI A;  1OYE A;  4EBE A;  2MKS A;  1RT2 B;  2YH0 A;  5M2P A;  1HPZ A;  1U8S A;  3FUY A;  2LMI A;  3V81 B;  3I31 A;  1NZA A;  5LJ3 Y;  4Z37 A;  4NI2 A;  5HO4 A;  1VBX A;  1U47 A;  2VKZ G;  4B3T J;  1RBA A;  1IKY A;  4NMX A;  2VJU A;  4MJK A;  3H8Y A;  4NCA A;  4FP9 A;  3ZNJ 1;  1M5V C;  2ZZT A;  3CJS A;  3KLG A;  3TJ8 A;  3EXC X;  3MAH A;  4KHP J;  2EFG A;  4LFB F;  4YB6 A;  5JMN A;  2DHX A;  2C3O A;  1HBO A;  4LF9 F;  2NSC A;  3KG4 A;  5KFA A;  3U1N A;  4XO0 A;  1D9F A;  2VA2 A;  2BE9 B;  1CLF A;  2CQ0 A;  3Q2S C;  5KT4 A;  1F9F A;  1P6T A;  3BSA A;  5A2Q U;  3TJA A;  1VQO S;  3Q8R B;  4PPD A;  2RDD A;  3ZTS A;  1UVK A;  2VQF J;  3RBE A;  2GHP A;  4HDH A;  1FNO A;  1N52 B;  2UVW A;  2YH1 A;  1VYA A;  5B0D A;  3KLF A;  3L3C A;  3BKF A;  3CDE A;  2KG1 A;  1BLU A;  2XZT B;  3CCM S;  2KXN B;  2LYV A;  2MJU A;  2AZ1 A;  2HFS A;  1RT7 A;  1VQ8 S;  4OYI A;  3W2W A;  4LR9 A;  3OSN A;  3AOA A;  1S12 A;  5L1K A;  1I94 J;  1U1R A;  3V4M A;  4OLP A;  2IRX A;  3FSY A;  3MMC A;  2NXJ A;  3HJV A;  1RWX B;  4KRW A;  1B7F A;  2DR5 A;  4UQT A;  4NCG A;  4ICL B;  4IG3 B;  4C2M A;  5CYJ A;  2BDP A;  3TOQ A;  3BH7 B;  1UPP A;  1FER A;  2XGP A;  4A8K A;  3DRR B;  2M2B A;  1PCA A;  5DDR C;  5A8K A;  3FGV A;  3ENW A;  3GFY A;  3CJ4 A;  3Q86 A;  1CUL A;  1CEZ A;  2OUG A;  3QBC A;  1VK3 A;  2HS4 A;  2F4V F;  5KT7 A;  2GIF A;  3H25 A;  5IQQ A;  3D1O A;  3CD0 A;  4WFA Q;  1L3S A;  2FQQ B;  1FJG J;  3UD3 P;  1JNZ B;  1MRO B;  5C7P A;  1EIY B;  4J9U E;  4O4R A;  2DNH A;  2Z58 B;  4N41 A;  3OTE A;  1VCT A;  4PPZ A;  4NEY A;  3CE8 A;  2DNR A;  5IM0 B;  1M90 T;  1FD2 A;  3EZ5 A;  4F2S A;  4K7Q A;  1L3T A;  4URG A;  4B3O A;  3OR1 A;  1RWK B;  4DV0 F;  2RNE A;  3TAQ A;  1SJ1 A;  3KDN A;  1XMB A;  3BKU A;  3SCL E;  4OLO A;  3CO9 A;  2CAD A;  4DL0 C;  4OHZ A;  3NMR A;  2P6S A;  3J7Y I;  1S0V A;  1NK7 A;  1IBM F;  1XN9 A;  2UVU A;  4DEZ A;  4N8N A;  1S57 A;  1S4F A;  4KKO A;  1FI4 A;  1F2G A;  4EYH B;  1YJU A;  5CZX A;  4OJ1 A;  1BQN A;  1JLQ B;  2ZZM A;  3HO1 A;  1N56 A;  1RAO A;  3CJ5 A;  1U6F A;  2W2M P;  5C5J A;  5LSL A;  5FLX U;  3MM8 A;  4TY8 A;  2RF2 A;  2QRR A;  3PRB A;  4ES3 A;  3M30 B;  2W9C A;  4A8F A;  3OVB A;  4I6A A;  4UZC A;  4HDG A;  3N6M A;  1NSA A;  4OYP A;  2LEA A;  3V6K A;  3MM6 B;  1S1V B;  5DQH A;  3H5S A;  4CRJ A;  2V8V A;  1RTH A;  5IS2 A;  5HAN A;  1SC3 B;  2V6A A;  2HZC A;  1R6V A;  2PDA A;  3UN3 A;  3J80 U;  3JQJ A;  4ECT A;  4G1P A;  3LF0 A;  1AUS L;  2A18 A;  1URN A;  1MN9 A;  1RT5 A;  2Z2Z A;  3B54 A;  4ZLL A;  1RP5 A;  5AJ3 J;  2YNF A;  2GMJ A;  1LXJ A;  4F8R A;  3HD1 A;  3QRQ A;  2OP5 A;  1VIO A;  2R2R A;  2D3O R;  1WOP A;  4E2F B;  2Q6C A;  2ZE2 A;  2LLZ A;  5ETR A;  1NDP A;  2DVI A;  4Q8E A;  2DIT A;  3BYR A;  4USM A;  5HLF A;  1FRI A;  2MQL A;  1UP1 A;  1UVL A;  3VAK A;  1T9X A;  2RD5 C;  1IVZ A;  2FLL A;  3EGN A;  1RTD B;  2HHP A;  4PZV A;  1OQ6 A;  4F4K A;  4N76 A;  2GAG C;  2V4J B;  1X60 A;  1N32 J;  4RBU A;  5HMX A;  1UA1 A;  1AYE A;  3SBM A;  2B9X A;  1PSD A;  2HQC A;  5HRO A;  8AT1 B;  1M5K C;  3HHL B;  1YBA A;  4ZHR A;  5KFP A;  1D8Y A;  2E9T A;  4NLO A;  1NH7 A;  2NRE A;  4K4V A;  3H2V E;  3HFV A;  1CBK A;  1QVF R;  2JVR A;  2NR0 A;  4B3S J;  4ECW A;  1RUS A;  2HBZ B;  1VFJ A;  3R5D A;  2HHQ A;  3ILL A;  3UCU P;  3MOJ B;  2IVF B;  4P7V A;  2QFI A;  1N0U A;  9RUB A;  3GYX B;  1CQN A;  3QLH A;  4LR8 A;  2CQD A;  2OSQ A;  3O6Q A;  4RUH A;  3M2R B;  3TNV A;  3CW2 C;  3W5Y A;  1Q8K A;  3MM7 B;  4OX7 A;  1QDU B;  1RT4 A;  3NS6 A;  2CPF A;  2WB1 D;  5K14 A;  2YNH B;  4CO2 A;  1FDD A;  2MKH A;  4LMZ A;  1TMJ A;  3NAI A;  3VZH A;  2E5H A;  2Q6B A;  2LU1 A;  5L1I A;  2MMY A;  1HBM B;  4CLP A;  4M5N A;  4WP8 A;  1DBD A;  3DRX A;  4ZP9 A;  4RO0 A;  2W8L A;  1SBR A;  3NGR A;  4NRU A;  3EE3 A;  2CZ4 A;  1S9E B;  1Y9O A;  5AT1 B;  4FYY B;  3KKF A;  1D8Z A;  2DHH A;  1RBO B;  4RNH A;  4CP5 A;  5GME A;  4G65 A;  2W7P A;  2B6A B;  1XMO J;  1TK0 A;  5HQM A;  1MN7 A;  3IP0 A;  1EZZ B;  1XBW A;  1GQE A;  4PG7 A;  2HND B;  2E5L F;  5KFY A;  4DR7 J;  3I4P A;  3Q24 A;  2W4C A;  3JSY A;  4ZA1 A;  1NDC A;  4HTJ A;  2D41 A;  2AGQ A;  4DS5 A;  3POT B;  1HI0 P;  1YK9 A;  1U2R A;  4IH7 A;  3IR5 B;  1PYO B;  4ZPW R;  1AXQ A;  2KH9 A;  5LMN J;  3EJM A;  5GMK a;  3NP5 A;  3AJ2 A;  3ILI A;  4ED6 A;  4JI4 F;  3KK3 B;  2DNP A;  4NLT A;  3KNA A;  2QYC A;  4Q44 A;  1L3V A;  2ZBC A;  4R25 A;  3BDP A;  3C15 A;  3RR7 A;  1DJ0 A;  1VMB A;  3CGI A;  2V8D A;  1SKW A;  1WSV A;  5A2Q Y;  1K47 A;  5LMU J;  5IT0 A;  2XEX A;  4DQP A;  3DM2 B;  4ZP8 A;  1N5V A;  2YKN B;  4AMM A;  1FD8 A;  2N3L A;  4LUB A;  5RUB A;  1EB0 A;  3LAL A;  2BA9 A;  1S0O A;  3SCJ E;  4QWB A;  1OY6 A;  3JXO A;  1QY7 A;  1HQU B;  3THV A;  1EKS A;  1UW4 A;  1R8A A;  2I38 A;  4YDX A;  4ZJO A;  4B3T F;  2XMA A;  2IY5 B;  4OI1 A;  5K9F A;  2J0Q D;  2UP1 A;  5IT9 U;  2CQ3 A;  4W90 B;  4X64 J;  4JI8 J;  2ZFH A;  2VOO A;  3MM5 B;  4FN5 A;  1NB7 A;  2E5J A;  1LOU A;  3BV8 A;  4Y2I A;  1P1T A;  4RW9 B;  5DDP C;  2MLX A;  5C24 B;  2CJK A;  3OTO F;  4OZN A;  1REV B;  1KNZ A;  1UVJ A;  3LAK A;  4R5P A;  4EWT A;  1K0T A;  5KOW A;  1SV5 B;  1U6Z A;  4OYO A;  5FII A;  4LRC A;  4IOC Q;  5A6P A;  3DRS A;  3OJS A;  3CSK A;  4EUV A;  1SL2 A;  1S6U A;  2LDY A;  1R0A B;  3H4D A;  2DGV A;  2F8E X;  3FSX A;  4GVB B;  4M5G A;  2ZH3 A;  5ETO A;  1ZA2 B;  4JI1 J;  4Q7A A;  2VQF F;  4CI0 B;  2W9B B;  1HNW J;  2PGC A;  4DF8 A;  3GIJ A;  2RIL A;  3VVU A;  4PWU A;  3TA2 A;  1E6Y A;  2ATC B;  3EUN A;  4U67 Q;  2MYF A;  1S97 A;  3T5H A;  2CG8 A;  2Z30 B;  2HWT A;  2Z2Y B;  3N6N A;  4QIV A;  3Q22 A;  1S49 A;  2RAQ A;  1S10 A;  2HVZ A;  4LF4 J;  4PYD A;  1S1T A;  1U2C A;  3KUH A;  1I94 F;  3MM9 A;  4FVM A;  2HVD A;  2K7K A;  4DBQ A;  5KG4 A;  1TFY A;  3QO9 A;  1DQ8 A;  2MQO A;  1HHT P;  4DU8 A;  5T7L A;  3PDN A;  3CCR S;  1HWL A;  2V34 A;  4ECQ A;  1Q5Y A;  1EP4 B;  2ABY A;  1ZM4 A;  1Y4Z B;  4TLR A;  2BM0 A;  3IM8 A;  4OZJ A;  3MPU B;  4B9S A;  2C2N A;  2AW0 A;  3MAA B;  2ADC A;  3GSI A;  2ROP A;  3N9U C;  3G86 A;  3HVT B;  4NXN F;  5A6W A;  4KGZ B;  1K0V A;  5SZT A;  3IWN C;  5KFT A;  3DLJ A;  2IPO B;  2HG4 A;  2E7W A;  2BJ9 A;  2MEW A;  3BGF A;  4IFV B;  2EFP A;  5KG6 A;  1KKH A;  4NLG A;  1FJG F;  3DOM A;  3ISN D;  2MY8 A;  4DN9 A;  1M0S A;  2AV5 A;  1P9Y A;  4FKX A;  2BMB A;  4DCP B;  3UFC X;  1JJ2 R;  4IRC A;  3AB4 B;  2BJ7 A;  2GQ2 A;  1M5H A;  4K2J A;  1RT3 A;  3MMA A;  5T14 A;  5FLX Y;  1TKT B;  1FRK A;  1GEH A;  1RWO B;  2V4Q A;  4QBU A;  5D0H A;  5ETQ A;  4C8N A;  3T1A A;  2KYZ A;  3TQ1 A;  3RRK A;  4ZKA A;  1WEY A;  1FJE B;  2YQ0 A;  3BSN A;  2J0S D;  4JYA F;  2OEJ A;  1YLX A;  2H4Y B;  3PW4 A;  2YWK A;  3TRG A;  3DXB A;  4U9R A;  1Y10 A;  4YR2 A;  4B17 A;  4QYR A;  3BSO A;  3J80 Y;  2AMC B;  4USV A;  4ED2 A;  3RU0 A;  2Z2L A;  3PKM A;  2HRT A;  1NUE A;  1RHM B;  1GH8 A;  4R0J A;  2PFD A;  1YJV A;  1WWH A;  4ILL A;  1C1C B;  1K8A T;  4ZPD A;  2VON A;  2CAJ A;  4IO9 Q;  1TQL A;  3DLG A;  4J9K A;  3TAP A;  3NY0 A;  3BRE A;  1GFW B;  3ZC4 A;  4I69 A;  2MQ8 A;  4FKY A;  4WYW A;  1KTV A;  1LQ9 A;  1XWL A;  4ZPB A;  3DDK A;  1PC4 A;  5DM7 Q;  2PO4 A;  2HFN A;  2V69 A;  2WVB A;  1U6B A;  4C0B A;  4LF5 F;  4OJG A;  3O5T B;  2F7V A;  4KQZ A;  1HKA A;  1VC6 A;  1KSP A;  2AHO B;  1T0T V;  2CUY A;  1UET A;  4F3O A;  2HHV A;  1V9O A;  2FPH X;  4DSJ A;  2KM8 C;  1Q7L B;  4F02 A;  2BAN B;  4OX9 J;  4YP3 A;  2AKW B;  2I2Y A;  3W5Z A;  1FEH A;  2B9E A;  1RWP B;  3FJ2 A;  2E5I A;  2J7W A;  2OH2 A;  1Q82 T;  4G1Q A;  5CZD A;  1GT8 A;  2RVJ A;  1T11 A;  2YNI B;  1S1U A;  4J91 A;  2DRA A;  3JS9 A;  3TVK A;  1F9H A;  1H2T Z;  1N5T A;  1J2V A;  3R9L A;  2MGZ A;  3I9Z A;  1REG X;  3N79 A;  1S6P B;  4QIF A;  2IVY A;  4WF9 Q;  1PJ5 A;  2BE7 D;  4Z7Y A;  3CUL A;  2DO0 A;  1KON A;  4CYU A;  3D54 A;  4OV6 A;  2V63 A;  1U0H B;  4ZVR B;  1N32 F;  2V8H A;  3OTB A;  2CFX A;  4CNZ A;  4B9T A;  4J37 A;  4USW A;  3DGV A;  3I0R A;  4DR4 F;  2D9P A;  4NRT A;  1B0T A;  4DPU A;  1AFI A;  2AJ4 A;  1XNR J;  5C2G A;  1QSL A;  4BLG A;  2XMM A;  4LBH A;  4OZ3 A;  4JI3 J;  4NX9 A;  2OPR B;  2G1D A;  1SQG A;  1KVK A;  4MTP A;  3IRW P;  4KGV B;  1D3W A;  3G8Q A;  3DLK B;  3QJJ A;  3H0P A;  4CO0 A;  5KFX A;  2VIH A;  1HNV A;  2SXL A;  1RIS A;  1DLO B;  4F3Q A;  3AT1 B;  3J7Z 5;  1MU2 B;  3K5M A;  1TL5 A;  3FFI A;  4AND A;  2DKO B;  4WIQ A;  2DYA A;  1TKD A;  3CED A;  2EFO A;  2MB0 B;  3UVJ B;  2KDO A;  2UU9 F;  1OIA A;  4YHH F;  2CPI A;  4O4G B;  3CJQ A;  3GSD A;  4DX6 A;  3QZ8 A;  1C1B A;  3RAM A;  2WTF A;  1ZPV A;  1RTJ A;  2LXI A;  4I6W A;  2R42 A;  3O2I A;  2B4P A;  2XLI A;  2D3Z A;  1DZ5 A;  4KFB A;  4RLE A;  1ZBT A;  3C14 B;  2WZ1 A;  2AX1 A;  2DO4 A;  2IJN A;  4NLQ A;  2RE1 A;  2VDI A;  2NS1 B;  2XYP B;  2P8I A;  5H9E K;  1FK9 B;  1WNE A;  3DRP B;  3DLL Q;  4UUX A;  3D28 A;  1UEK A;  3MD3 A;  3PYD A;  2VG7 A;  1MWZ A;  1TL1 B;  2IAJ B;  1UWB A;  2EBG A;  3EX7 B;  4DG1 A;  3MED B;  4ZPC A;  3S1T A;  4JI7 J;  1F3V A;  2ZD1 B;  2XO6 A;  2HAF A;  2XSF A;  5DLF A;  5ETS A;  1L5U A;  3FQK A;  3IM9 A;  2WW4 A;  3GCW P;  4QR0 A;  3JSR A;  3DOL A;  3K2Y A;  2XCP A;  4KV8 A;  5KFJ A;  3ZZY A;  1G7C B;  4WII A;  1HA1 A;  1TZ0 A;  1BWE A;  3GZ7 A;  2EEY A;  3SFG A;  3UNG C;  4G3I A;  2YWW A;  3CD7 A;  5IT9 Y;  5DGA A;  3V4I B;  4NLV A;  1QUV A;  2VG6 B;  3IBC B;  1VQM S;  1AZS A;  4URQ U;  4OHW A;  1SXL A;  2MZS A;  3ZZT A;  5BJR A;  4USJ C;  3NNC A;  2RT3 A;  5ETL A;  1XR7 A;  2F65 A;  2QA4 G;  3MR3 A;  3I0S B;  4JI6 F;  3UR3 C;  3HF5 A;  2MY7 A;  4RW6 B;  4O0I A;  2QMX A;  4YN3 B;  3LAM A;  4WP9 A;  4YFU A;  2YVS A;  3PTW A;  1X8D A;  1OMS A;  4G1I A;  5AXL A;  1YKW A;  5LSR A;  5ETN A;  1LKZ A;  1VQ6 S;  1SUQ A;  1JKH B;  4LFA J;  4P2X A;  3D4J A;  1G2E A;  3BH6 B;  3SSR A;  3FNN A;  3X3U A;  3KHG A;  2KJV A;  1F9E B;  1UA0 A;  3G6X A;  2KG0 A;  2V5H G;  2L9N A;  1NJY A;  4ZVT B;  4ID5 B;  4IR9 A;  4O3P A;  2R7R A;  4ZVU B;  5ETV A;  1SI9 A;  4JI8 F;  2M5Y A;  2DTJ A;  3H40 A;  3KLI A;  5KFI A;  4FYX B;  2OML A;  5KFB A;  1RXO B;  4PWD A;  1X5P A;  4CTA A;  5B0F A;  1VC0 A;  1CJK A;  4NML A;  2CPE A;  2XS7 A;  1E6V B;  3G82 B;  2UVR A;  4YDD B;  1B7Y B;  3KHR A;  3LGM A;  1PIL A;  1NM2 A;  4PXE A;  2K8G A;  2VDH A;  1CPZ A;  4MAK A;  1O0P A;  2ZDO A;  2O66 A;  1UAW A;  4ENO A;  5HI7 A;  1IBL J;  3FMW A;  3BBB A;  5F3Z A;  1NJW A;  4ANE A;  2G4B A;  3V2U C;  3UN5 A;  2DNO A;  1AB8 A;  4DFK A;  1WC5 A;  2CIM A;  2QTW A;  2FHJ D;  1H2U X;  4CO3 A;  1ZTT A;  3EGV A;  3CMQ A;  2JSX A;  2VH7 A;  3Q8V A;  5HAO A;  5HSP A;  5A8W B;  4MIA A;  3M9M B;  4M5K A;  4LF6 J;  2C22 A;  1U1L A;  4JI0 F;  1RKJ A;  3M2U B;  4RU9 A;  2ZBP A;  3H42 A;  1VRT B;  2JFK A;  4DSL A;  3OHA A;  2OIH A;  1CJT A;  4LF4 F;  5B09 A;  1R8P A;  4C3L A;  2WBR A;  1HYS B;  4J90 A;  4HL9 A;  2ZH7 A;  1J5O A;  2ATL A;  2R8G A;  4ZJL A;  3M8P B;  2MKJ A;  4HTI A;  2EXU A;  3NEK A;  3CUN A;  3NCR A;  2VZ8 A;  1U1K A;  4ATN A;  3KYL A;  2NZC A;  2WSE C;  2E9Z A;  3LP2 B;  3A3P B;  5KFR A;  4B3M F;  5K8O A;  1JLF A;  3OT9 A;  4MK7 A;  1BWV A;  2HSE B;  1OY9 A;  4ZN1 A;  3TZW A;  1CSJ A;  1LWC B;  4WU3 A;  2CQG A;  1N54 B;  3QGI A;  4FXW A;  2B43 A;  4EZ6 A;  1JLG B;  3UE2 A;  2N4D A;  5KFW A;  3GJS B;  2KB2 A;  4JOU A;  3CJ3 A;  3C16 A;  4KO0 B;  1FRL A;  1TP7 A;  2HQD A;  3H4B A;  1U1Q A;  1MSW D;  2CQI A;  2IFX A;  3FSI A;  3L9Z A;  1VQK S;  3GIL A;  3TAM B;  1C4C A;  1J27 A;  3TVZ A;  4HHH A;  1Y3J A;  3D67 A;  3NLC A;  2K3I A;  2GGP A;  1Y11 A;  1RHK B;  4C98 A;  2LA4 A;  2F5G A;  4DCJ B;  3KLH B;  2ZOF A;  2E1R A;  3R7S B;  4O0N A;  3NNA A;  1H38 A;  4ECZ A;  4ILR A;  3RRG A;  1MLA A;  3LP0 A;  2EK6 A;  1UJ6 A;  3TP2 A;  2ACM A;  4K0K J;  2MZR A;  3IG1 A;  3Q89 A;  1R8B A;  2ZM6 F;  2HVH A;  4WJB A;  1HBN B;  3PR5 B;  4MYU A;  3OSP A;  4QR2 A;  4NZ7 A;  1BD6 A;  3IXQ A;  2AGP A;  4HAC A;  4ZCL A;  2VC0 A;  2EG2 A;  1WDD A;  4WP3 A;  1SCJ B;  4RNO A;  4XAK A;  1FDN A;  3IC1 A;  3M32 B;  3MDF A;  1N5S A;  3L95 X;  4X4R A;  2PI5 A;  1GXU A;  5BYS A;  3FCW A;  1B99 A;  1BC6 A;  2APO A;  1NO8 A;  4LFC F;  1JJC B;  4ZPT R;  1IKW A;  4OZ1 A;  2QJ3 A;  4N5S A;  1UL3 A;  2L9W A;  4UW2 A;  2G9O A;  3CCT A;  4FZV A;  3HPO A;  4N77 A;  4ED7 A;  2HGN A;  1HLW A;  4DR3 J;  1ZAW A;  2XWX A;  4ZIT A;  2QLF B;  2ZH2 A;  5AE3 A;  3C6U B;  3LA0 A;  1FRM A;  4J9Q A;  3CD5 A;  2V2Q A;  1NJZ A;  3MUT P;  2YNG A;  3FMB A;  3MEE B;  1IR1 A;  2GCF A;  2E5G A;  2B4V A;  1DQA A;  3MR6 A;  3NBP B;  3V6D A;  2XY5 A;  4PG8 A;  4HHJ A;  2HHH F;  5K8M A;  5L46 A;  2EFN A;  4OX9 F;  4QJV A;  1FX2 A;  4M5M A;  4ZVG A;  2MKC A;  3FVY A;  1K73 T;  4MK8 A;  1FXR A;  4Q0B A;  1UZD A;  2OPQ B;  1HHS A;  4WFY A;  1URR A;  2M52 A;  3WX4 A;  2C3Y A;  4F04 B;  1U02 A;  1F5C A;  3SQG A;  4WZQ A;  2RUG A;  1HNX F;  3MR7 A;  1TL7 A;  2JHE A;  3GFX A;  1F60 B;  2B8P A;  4ECS A;  4TKT A;  2PI4 A;  3X1L B;  1J5E F;  1IM6 A;  1ELO A;  3EPI A;  3K0J A;  4L74 A;  3MPY A;  3DMJ B;  3MEG A;  4DLG A;  3BGR A;  4JV0 A;  4OHY A;  1A6L A;  1WOO A;  4RW7 A;  2EI5 A;  4N47 A;  5HBM B;  3CMA S;  4QWE A;  1H0H B;  1SQE A;  4LQ9 A;  4JI5 J;  1OO0 B;  2WW8 A;  3K5O A;  1RZM A;  1L3K A;  2KXF A;  2KFY A;  1TMM A;  2L08 A;  2I0X A;  4I2P A;  1QM9 A;  5J2M B;  1XNR F;  4JI3 F;  4KHR A;  4YEA A;  1IKV B;  1T7P A;  3MMB A;  1FKO A;  1IBK J;  1DHM A;  2ASL A;  1ZOT A;  1YI2 S;  1RAJ A;  4PWW A;  2OMO A;  2KO1 A;  3IGN A;  3NWG A;  3SDE B;  1Q81 T;  3SZ2 A;  5J2N B;  2DPJ A;  1RQ0 A;  1JLA A;  4QPX A;  3OLA A;  2OTJ S;  2W2Q P;  4YUD A;  2E29 A;  3U02 A;  4TQS A;  4XDC A;  1JLC A;  3MUR P;  5D3G A;  4ZP7 A;  5KT6 A;  1KBR A;  2G13 A;  2YQ1 A;  3V81 A;  2KT5 A;  3DLE A;  3CIZ A;  4RWX A;  2ROG A;  2FLN A;  3B4D A;  1NSQ A;  3A8I A;  2FHM A;  2Q66 A;  4I1T A;  3KJN B;  1UPM B;  3SXL A;  4CQ1 A;  4PUO A;  2CNN B;  4CH7 A;  1NH8 A;  1P27 B;  2QT7 A;  1FT8 A;  1UFL A;  2BOP A;  4RUC A;  1FHT A;  1T9U A;  5KAK A;  4OI3 A;  2J6T A;  2JNJ A;  3UDC A;  1KQG B;  1B64 A;  1HW9 A;  3KJV B;  3S8S A;  3PO4 A;  1HPZ B;  4TNO A;  4O3O A;  2PT0 A;  1IR0 A;  4NI2 B;  3H2U B;  1GMU A;  1VQP S;  1TU0 B;  3AXK A;  5THW A;  1IKY B;  1FFW B;  3TEH B;  4QR1 A;  1N8R T;  3QYY A;  4EU0 A;  3O3L A;  2UXC F;  3VAF A;  3R2D J;  3G87 A;  3KLG B;  1QAJ A;  2EK1 A;  2KRR A;  5E3P A;  2MKY A;  1WKK A;  1RAA B;  3TJ9 A;  1HBO B;  3IMQ J;  2F3J A;  2GA7 A;  5CCM A;  3GB0 A;  4IQM A;  3AOC A;  6AT1 B;  3KUG A;  1EET A;  2HGM A;  3JTP A;  3I55 S;  1VQ7 S;  3GON A;  4TU9 A;  3R6G B;  1A9N B;  5ETP A;  2Q1L A;  2V2V A;  4ECX A;  1XC9 A;  3KHH A;  3LWL A;  2QN6 B;  1NRK A;  3FK4 A;  2XCA A;  5A0Y A;  4EBC A;  1HQE A;  4B3R F;  4ICL A;  4IG3 A;  2OPP B;  1HIY A;  3OFG A;  3QWP A;  4LFA F;  1VRU A;  1XTZ A;  2FC8 A;  1Q5V A;  3DDN A;  5KOX A;  3DRR A;  1RT7 B;  4IH5 A;  5D4N A;  2JJ4 D;  3T5L A;  2HHW A;  3W2W B;  2J5A A;  4DL3 A;  1SH3 A;  1L3U A;  3QNW B;  2B3T B;  3G9C A;  2G1H A;  3MMC B;  3TO8 A;  3PX6 A;  1SL1 A;  3J7Z T;  4EO8 A;  3P3D A;  2CPJ A;  5DRK A;  2FVQ A;  2LP4 A;  5IV3 A;  1SKS A;  2M70 A;  1ZAV A;  4HT5 A;  1TKZ B;  2FZG B;  1Y5N B;  4EZ9 A;  4ES2 A;  1SJR A;  4LF9 J;  4CLT A;  5AXM A;  2NPI A;  5HJX A;  3DI6 A;  4K4X A;  4X4V A;  3GR0 A;  1WG1 A;  1IBL F;  4LF8 F;  4AL7 A;  2DRB A;  2MPU A;  4Y2A A;  4WFZ A;  2QG9 B;  1VI7 A;  2ZHO A;  4LBP A;  1RWV B;  3T41 A;  1X4E A;  2RH3 A;  4UT4 A;  1HBU A;  1NLK L;  4FF2 A;  1I3O B;  2HZA A;  3HDS A;  2Y8Y A;  2ZIT A;  1OS5 A;  2YBV A;  3NGU A;  4RNF A;  1WDT A;  3QGH A;  4TYB A;  4LF6 F;  1NB2 A;  5J1P A;  3PIP Q;  3DCA A;  1X5T A;  2FJB B;  1ZZF A;  3IN5 A;  1N33 F;  4R8U A;  5LXR A;  4DR5 F;  3UDL A;  2AYB A;  3K5L A;  1R0B G;  2DNN A;  3NKY A;  3N4W A;  2ZOM A;  4IFY A;  3DLB A;  2O67 A;  4B3O B;  4A46 A;  3ZNU A;  3BKT A;  1V3S A;  3BZQ A;  1QJH A;  4DDF A;  3MUM P;  1XK8 A;  3TVY A;  2IMO A;  2M0G B;  3JB9 k;  2QA4 S;  2CQB A;  2I8E A;  4CH1 A;  4QZV B;  3FBF A;  4CLF A;  3M30 A;  4PR6 A;  4MKA A;  3TAN A;  2HK2 A;  1JXV A;  4LVN P;  1DTQ A;  3SI8 A;  3MZI A;  1HNZ F;  3WQP A;  4LSN A;  5J2Q B;  5J1E A;  2XI3 A;  4Y2M A;  1S6Q A;  3R5C A;  3PYE A;  3K5N A;  3KK2 A;  1BUX A;  4WU2 A;  1N5Y B;  2B4O A;  4RZR A;  7FDR A;  3ILO A;  2XMW A;  2X3D A;  2JOQ A;  1T05 B;  5U47 A;  3BO4 A;  2AEJ A;  3CD6 S;  2F4V J;  2BAC A;  2X1B A;  4ED5 A;  4P2S A;  2F1F A;  3IBF B;  1Z2L A;  2RF2 B;  1NK8 A;  1PYS B;  1OPZ A;  3LOU A;  1WKJ A;  1P9Q C;  4I67 A;  5KFN A;  4WZM A;  2XGQ A;  4WE1 B;  3CCJ S;  2AD9 A;  1RAD B;  1CS4 B;  4FF3 A;  1B0P A;  1ACM B;  2PEH A;  4F2R A;  2WOM A;  2CYY A;  4DV0 J;  3PY8 A;  4F3M A;  4MIB A;  1RT5 B;  4M5J A;  4HH1 A;  2ZBI A;  2Q79 A;  2YNF B;  2LCW A;  1CVJ A;  2IIH A;  1C0U A;  2XZW A;  4FVC A;  1RAE B;  3A8J A;  5K20 B;  3AXM A;  1ZS6 A;  2CJQ A;  1JLB A;  4C0O C;  4C97 A;  4H54 A;  1IBM J;  3M8Q A;  2Z4P A;  2RRA A;  4J9V A;  5HLF B;  2CQ4 A;  4JI2 J;  3LAN A;  7FD1 A;  1TR0 A;  1R31 A;  1IWG A;  3OFH A;  4QIE A;  1DAR A;  3O8W A;  3PVX A;  4QOT A;  4I0W A;  1F1B B;  2GVZ B;  4DR3 F;  2RIJ A;  4K4T A;  2RDJ A;  2IM1 A;  5HRO B;  2OHD A;  3M2R A;  5EWF A;  4ZHR B;  5B7W A;  1Y5I B;  2HIQ A;  3JTN A;  3OFF A;  3KJQ B;  4P9S A;  4QYZ K;  1TTH B;  4YS2 A;  4DR1 J;  4NPO A;  4BWJ A;  2DR7 A;  1FWP A;  3VGV A;  2QMW A;  2RHS B;  1A0O B;  4HH0 A;  2B9Y A;  1HBM A;  1ZZN A;  4WYL A;  5KT5 A;  3QLH B;  5KFV A;  1VHF A;  3U1M A;  2WHO A;  2LEC A;  1S9E A;  2RQM A;  2I1R A;  2HNZ A;  4ZPV R;  3KLV A;  4CWB A;  3HVW A;  3CCS S;  1ZAX A;  1SQF A;  2NPF A;  2UVV A;  3E01 B;  1YJ7 A;  2Y1L B;  2HNY B;  4LF7 F;  3UQS A;  2B6A A;  4DR6 F;  1V6H A;  5IV4 A;  3W63 A;  2J9D A;  1K9M T;  2EW9 A;  2WVE A;  4KH0 B;  1NSK L;  3HCX A;  3C66 A;  3OL7 A;  5IC4 B;  2DCU B;  5D4O A;  3CC2 S;  4X65 F;  3I9V 9;  2X51 A;  2DR8 A;  3KTQ A;  1JLE B;  4N8O A;  1YZ6 A;  2XI2 A;  3RBX A;  1B3T A;  4L6V 3;  4M5L A;  4B9L A;  5IWA F;  4JP8 A;  3C8Y A;  2QX0 A;  1MW7 A;  4DSK A;  1KS2 A;  2QC3 A;  4WPA A;  3AHP A;  5E3R A;  3G96 A;  1NPP A;  2ZH6 A;  2KFN A;  4DFJ A;  5G4D A;  3KK3 A;  2X1F A;  2OJ3 A;  5D8H B;  4QIG A;  4BC9 A;  1M5S A;  2BJ1 A;  2GX8 A;  2QLJ B;  2NCK L;  1K1Q A;  4C8K A;  2M8D B;  2J8S A;  3BO3 A;  2CWK A;  3T9Z A;  2QSF A;  2DXE A;  4K2X A;  3VAI A;  4Y28 C;  2XMT A;  4WBF A;  2HS0 A;  4DQI A;  3R5A A;  5GAE U;  3VQT A;  4A8S A;  4M8L A;  3OD2 A;  3DYA A;  4OQJ A;  1X0P A;  3DGP A;  4Z2X A;  1SJ3 P;  3ET6 A;  1JWW A;  3BPS P;  3MTJ A;  1HQU A;  3UCG A;  4RBT A;  2LXU A;  4DL6 A;  4USU A;  3KOA A;  4NLY A;  1S7H A;  2IRY A;  4X84 A;  4KYZ A;  2B8Q A;  1U26 A;  3ZZ0 A;  3M9O B;  3C15 B;  2EKN A;  3A3N B;  3MM5 A;  3PJW A;  3VAJ A;  5H1S V;  3T9N A;  2D74 B;  4PG4 A;  2FHO B;  5L9X A;  3PX4 A;  1NHK L;  2YX1 A;  1REV A;  5A8R A;  5KT3 A;  4PXD A;  5M2U A;  1W7W A;  5F9N A;  4WTO B;  4RW8 A;  3JQM A;  3U27 A;  3CJ2 A;  1RYS A;  5D6G A;  2L9D A;  4RPF A;  3CC7 S;  1KLN A;  1S0N A;  2DXD A;  2BJD A;  3NMA A;  1S77 D;  1O5J A;  4KC5 A;  1FXL A;  1UKU A;  4FBU A;  3K58 A;  1U1N A;  1U45 A;  1EKR A;  4K50 A;  2E5L J;  3PHT A;  1LEO A;  2D3U A;  4ZMM A;  2GO8 A;  4OI2 A;  2HMI A;  4R5P B;  3EDR B;  4JBC A;  2KJW A;  2D1C A;  2MHN A;  5L8R C;  3DRS B;  5E41 A;  1V3Z A;  3EVM A;  1Y3K A;  1VDH A;  4DQR A;  2Y1J A;  1RAI B;  4JI4 J;  3MEK A;  1X9S A;  5KG2 A;  1B70 B;  4ZVQ B;  1Q8B A;  5KG0 A;  2WSC C;  4Y0F A;  2LKZ A;  3GFZ A;  3BO2 A;  4UOH A;  1CJV A;  3ETM A;  3M8R A;  1E6Y B;  2RU9 A;  2PEB A;  2VUG A;  5B08 A;  3PEJ A;  3CJ8 A;  3GII A;  5KFS A;  5DJB A;  1BHN A;  4B08 A;  3OFE A;  3GG0 A;  2DXF A;  3ICL A;  5D77 A;  4I68 A;  3AY0 A;  1S1T B;  3EZO A;  3NGD A;  3HVT A;  2XBP A;  4KTQ A;  2OSR A;  3FZB A;  1MG7 A;  3IGV A;  2ZBQ A;  4L3N A;  4FDF A;  5EDW A;  3HZG A;  2P9C A;  4DV1 F;  3J81 Y;  5T7L B;  2P6T A;  3IWX A;  1K44 A;  2KTQ A;  3BN4 A;  1LFW A;  2GFF A;  4LJM A;  3OTO J;  5DO2 A;  1TKT A;  2IC3 A;  3V6J A;  2K7J A;  3VTI A;  2DJW A;  1UJ5 A;  2J9D E;  2ZNY A;  1N6Q B;  3D6M B;  4CLZ A;  3EVO A;  2DNM A;  4X4P A;  2WVC A;  4P75 A;  2ASJ A;  5L9N A;  4OZ2 A;  5GVQ A;  2H51 B;  3ZTP A;  4DX5 A;  4DPY A;  4YB1 P;  4R0E A;  5JUM A;  1TL4 A;  1IM4 A;  2Y1R I;  3DOM B;  1F6T A;  2E44 A;  3HSD A;  3A13 A;  2ZJR Q;  2GMH A;  4X66 F;  1RT3 B;  3TZY A;  3MMA B;  4AMN A;  1AA1 B;  1H6K X;  1RAF B;  2MQM A;  3BJY A;  2XQC A;  5DET A;  2HQF A;  3Q8Y A;  1T03 B;  2JLG A;  3VAL A;  5HN0 A;  2RKI B;  1GX6 A;  3ETO A;  4GRS A;  5LJ5 Y;  3P8B B;  1NK5 A;  1F2H A;  4IUF A;  1RA6 A;  2FYX A;  1TVR A;  4DPW A;  2H48 B;  1LWE A;  5K5M A;  1N88 A;  4CCH A;  3RR8 A;  3ZXW A;  1VIX A;  2XHC A;  2AYG A;  3AOB A;  5IXU A;  4F4Y A;  1BQM A;  1MWQ A;  1U1P A;  2CVE A;  3H5Y A;  1PYT A;  1YX2 A;  2LU2 A;  3J7A N;  1KTQ A;  1W2I A;  1V3R A;  4FYV B;  1QSY A;  2DGT A;  3FEX B;  2HEK A;  1DRZ A;  3W9H A;  3CCV S;  2H1Y A;  2A2D A;  3CDU A;  4KBI A;  4NXN J;  4ZCI A;  2EBE A;  3D1H A;  2OEL A;  4IDK A;  3VCD A;  1F0X A;  1GMW A;  1O6X A;  2ZH8 A;  3ZZR A;  4WFN Q;  1KRP A;  2ZKU A;  1WC1 A;  2VAS A;  3H7H B;  2CPD A;  4B9M A;  4YR0 A;  2WVD A;  2Z8Q A;  5M2R A;  5H9F J;  2O1P A;  4MFB B;  3D68 A;  2ZVS A;  4A8Y A;  2BW7 A;  3H90 A;  3TUJ C;  3ISZ A;  4HLB A;  2XS2 A;  3SCK E;  1H7W A;  2KXH A;  1R89 A;  1U0H A;  2NUU G;  3OPK A;  5BR8 F;  3W62 A;  4JYA J;  3CF5 Q;  5AE1 A;  2HBQ B;  3OV7 A;  4J9N A;  3W2V A;  4G1Q B;  2DIS A;  2LQB A;  3BQ1 A;  3NCP A;  4I6Y A;  1KEK A;  1VQ4 S;  2HRU A;  4JB8 B;  1ZPW X;  3QJL A;  3R5B A;  5HVG A;  3D66 A;  4GO7 X;  2BUN A;  2GS8 A;  1HNI A;  3TZX A;  3GU0 A;  6FDR A;  2DGS A;  4JI2 F;  1KFS A;  2RDI A;  4ZP6 A;  1DLO A;  1Q78 A;  2WSF C;  4QWC A;  1MMN A;  2QO3 A;  1WTB A;  1JJH A;  2OTL S;  4CYU B;  1RSC A;  1SJQ A;  2W7O A;  1M1K T;  3WBZ A;  2XC9 A;  1Y5L B;  4K4W A;  2W2P P;  2VU5 A;  1JXL A;  1BY9 A;  2I6W A;  1G4C A;  2W4D A;  1LNQ A;  3MD1 A;  3MCO A;  1FKA F;  3CJK A;  3V5R A;  1OWX A;  1IWA A;  3EXY A;  3HD2 A;  2XYG B;  2R7W A;  1C2P A;  2CJB A;  4MT1 A;  4LF5 J;  4DR1 F;  4ZVO B;  3DRY A;  4RNM A;  3AJ1 A;  2R7U A;  2DH9 A;  2R8J A;  2MST A;  1WSR A;  3ITH B;  3DN9 A;  5IFM A;  4OI4 A;  4KGX B;  2FJD B;  2B4U A;  1FK9 A;  1RAC B;  3GYG A;  1N34 F;  3DRP A;  3T1Y J;  2FY8 A;  2IAJ A;  3M6W A;  2P9G A;  1CG2 A;  1QUP A;  3MED A;  3AD8 C;  3GTY X;  2FUG 9;  2P2C B;  1MML A;  2V2Z A;  2YX4 A;  1C1B B;  1RTJ B;  2GVD A;  3SV4 A;  1VIS A;  2V68 A;  4M94 A;  4Q2L A;  3K8W A;  4XTT A;  4ECV A;  2JEI A;  4C3K A;  3ENQ A;  2O01 C;  2XG8 A;  3PZP A;  1X4F A;  3MUV P;  1WKL A;  3HFK A;  4X62 J;  1GTH A;  2BKN A;  1JXE A;  4OX8 A;  2VG7 B;  3QAU A;  3QPI A;  3C6T A;  1HWU A;  4A8X A;  1Y0H A;  2FZK B;  4EBD A;  5GAE I;  1RJJ A;  1RTZ A;  4DFP A;  1WEL A;  5E5N A;  3AAW B;  4LSZ B;  3M8W A;  2CNL B;  3HX9 A;  1M5P C;  4DR4 J;  1U2F A;  1TAU A;  4DV3 F;  3BS9 A;  5L38 A;  3DOL B;  3R1H A;  2KT2 A;  2PMW A;  4KV8 B;  2A2C A;  3M6U A;  1RAG B;  3E2E A;  4I56 A;  1WD6 A;  2GJI A;  3I0S A;  5FDL A;  4YY3 J;  3RGI A;  2DNL A;  2B5J A;  2WRM A;  4ED8 A;  4NZ0 A;  5L39 A;  2MZ1 A;  1M1H A;  1X4D A;  1FJ7 A;  1M5O C;  2UU9 J;  3NGK A;  1RTI A;  1PG5 B;  4YHH J;  3GFH A;  2XLJ A;  1JKH A;  3TUP A;  2X1G A;  2BKO A;  4AD6 A;  3Q8P B;  1HAR A;  2C2D A;  2ASY A;  4DR2 J;  3H59 A;  2E66 A;  2ZKT A;  3K59 A;  1QAY A;  3FEZ A;  4FNH A;  3THP A;  2YQ3 A;  1S48 A;  1D0E A;  1RYR A;  3HT3 A;  4P2F A;  4I2Q A;  2C2M B;  4MKV A;  2JZ5 A;  3EVW A;  3DHW C;  3Q8S B;  1SUQ B;  2VBZ A;  3AQO A;  2IYG A;  5HQ8 A;  4QIW D;  2K1R A;  2Z57 B;  4HHU A;  4MK9 A;  2FVS A;  1FES A;  5KT2 A;  3AQP A;  4NLU A;  3M7V A;  1LWF B;  1S9G B;  2Z2M A;  3HHL C;  2DHG A;  3FEY B;  2M88 A;  3W7B A;  2VPY B;  4KPY A;  5F41 A;  2EPI A;  4NLX A;  1C0T A;  2KU7 A;  2YWH A;  3KLI B;  2JRS A;  3CB4 A;  3GJR B;  2AWZ A;  4F36 A;  4E8U A;  4PWD B;  2CDR B;  3NRB A;  4CTA B;  4DL2 A;  1CJK B;  3R5G A;  3I56 S;  2MDA A;  5A8W A;  3K57 A;  3OR2 A;  2VHG A;  4P6Q A;  3Q0A A;  5AXN A;  3CC4 S;  1JQG A;  4V19 J;  1HR0 J;  2ZNZ A;  3WC0 A;  3M2U A;  3HXM A;  1X5S A;  3R27 A;  1O8B A; 
#chains in the Genus database with same CATH homology
 3EZO A;  4RR5 A;  3K89 A;  2G2O A;  3IM8 A;  1NM2 A;  2C2N A;  3RGI A;  4AMN A;  2G2Z A;  3HHD A;  3CJ8 A;  3HJV A;  2G2Y A;  3R97 A;  5DZ6 A;  3PTW A;  4RL1 A;  3QAT A;  2JFD A;  3H0P A;  3R8Y A;  2JFK A;  3TZX A;  4AMP A;  5DZ7 A;  4QBU A;  3IM9 A;  4AMO A;  2G1H A;  3BV8 A;  1MLA A;  4AMM A;  3SBM A;  2QC3 A;  3G87 A;  2QJ3 A;  3TQE A;  3TZZ A;  3TZY A;  2CUY A;  2H1Y A;  3TZW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...