3HVWA

Crystal structure of the ggdef domain of the pa2567 protein from pseudomonas aeruginosa, northeast structural genomics consortium target par365c
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
159
structure length
159
Chain Sequence
b'YNRLRLQEDVSLRLQRDGALTVIAADLLPLALLNTIIRTLGYPFSNDLMLEARDRIRAELPDFTLYKISPTRFGLLLPRQQQEETESVCLRLLRAFESPVVCRGIPIKANVGLGVLPLADDTLDGDQDWLRLVVSAADDARDRGVGWARYNPPLDQAQQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Diguanylate-cyclase (DGC)
publication title Northeast Structural Genomics Consortium Target PaR365C
rcsb
source organism Pseudomonas aeruginosa
molecule tags Lyase
total genus 49
structure length 159
sequence length 159
ec nomenclature
pdb deposition date 2009-06-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3hvwA00
3HHKA 1S1XA 2HNZA 3D5MA 5F8GA 1RTDB 1HMVA 3V4IA 2W7OA 4O3PA 4RW8B 3NBPA 3KJVB 5KFHA 4O3SA 3DRPB 4EBEA 1HQUA 2VG7B 5KFNA 4ED1A 2OPPA 1C0TB 2O5DA 4ZPCA 3DLEB 3OL9A 5C24A 3H5SA 4HYKA 1SV5A 1T05B 2ILYA 1EETB 2HNDA 1N48A 1RT1A 2VA2A 1HNVA 1QE1A 4K4SA 4QPXA 4RZRA 3DLKB 1S9EB 4YQWA 3BREA 1C0UA 1ZETA 4RW9B 5KFMA 2YNGB 2YNFA 4H4MA 4TN2A 3JSMA 3DI6A 5C25A 2R8HA 3TQ1A 3FSIA 4DL3A 1RTIB 1RT7B 4LSLB 5KFEA 2XGQA 3KLHB 4DL2A 4JV0A 4K4WA 2JLEA 2D7SA 1BQMA 2B6AA 1JLQB 3BR9A 3D28A 3IRXA 4KB7A 4URSA 5KFDA 4RW8A 3KLVA 3PVXA 3KJVA 3MR2A 3HVAA 3DRPA 2VG7A 3MTKA 1HYSB 1N6QB 4ECYA 2ATLA 5KFWA 1FK9B 4KFBA 3DLEA 2ZD1A 2I5JA 4DG1B 4IH5A 3BQ2A 3CJ2A 3CDEA 4RNNA 2V4RA 2FJXA 4KV8A 3SFGA 2ASLA 4NLGA 1S9EA 2I1RA 2UUWA 1JLGA 3C6UA 3TAMA 1EP4B 3ISNC 3KMSA 2E9ZA 4JV1A 1C1CB 3G6YA 3QIDA 3GIJA 3CO9A 3BSOA 2QE5A 3C6TB 4IOBA 4MIAA 1S1UB 5KG6A 3GILA 3E51A 3OLBA 4O44B 1JLQA 1QAJA 3PR4A 5KFRA 2D3ZA 3ICLA 3QO9A 4K4TA 1RT3B 3FQKA 1HYSA 2YNIB 3MECB 5KFSA 3V6DB 5KG1A 1FK9A 4RU9A 2OPRB 2C28A 2C2EA 3M8PA 2VG6B 1HPZB 3QLHB 3PW5A 4EEYA 3HKWA 2XCAA 4H54A 5J2MA 3DLGA 2ALZA 2ILZA 3PW0A 3PJXA 5DG7A 4EO6A 5KFBA 3G6XA 1IKVA 4IH6A 4F50A 2WCXA 4RW6A 4PQUB 1C1CA 4TY8B 1K1SA 3T5JA 5J2PA 1IKWB 4GC7A 3VQSA 4F4WA 1RT4B 1S1UA 3SI8A 3NGDA 4MIBA 4ZVEA 2ASDA 2HNYA 3OSPA 5EWGA 2FJWA 3EZUA 3PW2A 3H2LA 4U7CA 2BRLA 5KFGA 5EWFA 3OLAA 2IJFA 2VG5A 1U09A 1RT3A 1UWBA 1RT2B 2YNIA 2WTFA 3V6DA 4X2BA 4B3OA 1JLBB 2XI3A 4MK7A 2RKIA 4IG0B 3T5HA 4URQU 4PUOB 1HPZA 3QLHA 1IKYB 2UVWA 3OSNA 4J9PA 5T14A 4R5PB 3E01B 1TV6B 3DMJA 1TL1A 4IKAA 1JLAB 4IH7A 4IDKB 4NLTA 5KFKA 4IG3B 4PQUA 1S49A 4TY8A 1KHWA 5KFOA 1IKWA 4WE1B 4R0EA 1RT4A 3FRZA 4O3NA 4KKOB 2BANA 1RA6A 2XCPA 3DM2B 3MFHA 2D41A 4MKBA 1TKZB 1TVRA 4R8UB 1RTJA 1IKXB 5HROB 1SH3A 5KT5A 3LP2B 2E9RX 5EDWA 1DLOB 4IG0A 1MU2B 2FVSA 1S4FA 3V6KA 2XI2A 2WB4A 5EUHA 2C2DA 2AGPA 4RUAA 4QWCA 3PZPA 2FVCA 4R5PA 3E01A 1LWFA 4Q45A 2HMIB 4NCGB 4IDKA 4MH8A 1S1WA 2CJQA 3DOLB 5DGAA 4J9KA 3V81A 3KLFA 3KOAA 3DRRA 1T94A 3GIIA 3ISND 5KFIA 1J5OB 5DG8A 2J6SA 1SUQA 4I7FB 4NLYA 4KKOA 4TYBA 4FBTA 4QW9A 4O4GA 3FFIB 5C5JA 1R0AB 3DM2A 3I0SB 1S6QB 4H4OB 4WZMA 3BQ0A 4O3QA 4ED7A 4JV2A 4IR9A 2DPIA 1JKHA 1MU2A 1S1VB 3I0RA 4J9OA 1VRTA 3IGVA 4ZHRA 2VA3A 2B43A 3QGHA 3LP0B 5KFPA 4ED8A 1N4LA 4ECUA 5I42B 2HMIA 4JUZA 5HP1A 4NCGA 1REVB 2HWIA 4EBCA 3HVTB 4ED2A 3BGRB 2DPJA 4IFVB 5K14B 3OL8A 5F8NA 3QGGA 1J5OA 2IMWP 2R8IA 5DLGA 5KG2A 1S48A 1N5YB 1DTTA 3H5XA 2J6TA 1R0AA 2FLLA 5DLFA 3I0SA 1S6QA 1RTDA 2YKNB 3PW4A 2AGOA 3GV5B 3GV7B 2IM2A 2W8LA 2XC9A 1TKXB 3TVKA 4KO0B 5F8HA 1C0TA 5JUMA 4YR2A 4EO8A 3RB3A 2ASJA 5I42A 1T05A 1EETA 4NLXA 3NAHA 4WFYA 1REVA 4NRUA 5CYMB 3MEGB 4WXWA 3CJ5A 5C42B 4G1QB 5KFCA 4XO0A 5J1EB 3DLKA 3BGRA 4ZMMA 4IFVA 3CJ3A 4RW9A 2FLPA 1FKPB 2YNGA 4IQXA 4ED3A 4WZQA 2R8JA 2EC0A 3KK3B 1RTIA 1RT7A 3G86A 4LSLA 3N6NA 3KLHA 1S9FA 1S0MA 4XPEA 4ECQA 4IRDA 4Q8FA 2IAJB 4J9SA 4I2QB 2YKNA 2JEJA 4Q0BB 2WONB 3RB4A 2W9BB 1VRUB 3CDWA 3UDLA 1TKXA 4NLPA 1N6QA 4KHRA 3JYTB 3Q8QB 2XWYA 2HAIA 4ECWA 4DG1A 5HBMB 1SH0A 3CIZA 2FVRA 3I5AA 5J2NB 2R2SA 5C42A 5CYMA 5I3UB 4QWAA 2WOMB 5J1EA 3H59A 3NL0A 4K4VA 2B5JB 2BE2B 2R2UA 3UPFA 4WFZA 4NLUA 5DQIA 1BQNB 1EP4A 3IN5A 1FKPA 4RNOA 4LQ9A 4M95A 2JEIA 3KNAA 5L1JA 2AQ4A 2W7PA 5CYQB 2ZE2B 2IBKA 3T19A 4I2PB 4HKQA 1LWEB 5F8MA 3C6TA 3IGNA 4KAIA 3MR6A 4DL5A 1N56A 2JEGA 3QZ8A 3RBDA 4O44A 3OHBA 5HLFB 2WONA 2V9WA 3DRSB 2WK4A 1NHVA 1VRUA 4KBIA 3BSNA 2JC1A 5KFVA 3MEDB 3MECA 4G3IA 4Q43A 5L1LA 3Q8PB 4RW4B 3JYTA 2OPRA 1OS5A 1JLEB 1TL3B 2VG6A 3RAXA 3KHGA 3FQLA 3SFUA 2YNHB 2J6UA 1JX4A 1HARA 3CVKA 3N6MA 3M9MB 2OPQB 1HQEB 1BQNA 4RW7B 1RTHB 4QW8A 3PW7A 3RB0A 3DOKB 1RT5B 5EWEA 2AGQA 4I2PA 3LAKA 4KSEB 2JC0A 3MEEB 4NZ0A 4Y34A 4F4ZA 3KLIB 4NRTA 1Z4UA 5HLFA 4IRKA 3DRSA 4ECVA 3H4BA 4QWBA 3GYNA 3MEDA 3V81B 1FKOB 3UR0A 1RT2A 3EPGA 1QAIA 1JLFB 4RNHA 2OPSB 5KG5A 1TQLA 1JLBA 1JLEA 5L9XA 1S9GB 3HVWA 5F9NA 2JEFA 3KHRA 4PUOA 1IKYA 2YNHA 4ZVHA 5KFJA 4ZVFA 1S6PB 3LANA 5KFLA 2IC3B 1TV6A 3Q8RB 1JLAA 1HQEA 4XPCA 1DTQB 4IG3A 4J9MA 1ZTWA 1I6JA 3H98A 3EPIA 2R8GA 3DOKA 4MK9A 4ID5B 4EBDA 1HNIB 4WE1A 1MMLA 3GIKA 4K50A 2AX1A 2UVUA 2GIRA 1XR6A 4RUCA 5KFYA 4NYZA 4O4RA 5KFQA 1KHVA 2C22A 1RDRA 1XR7A 1TKZA 1FKOA 1HQUB 3CJ4A 4TYAA 4R8UA 3H5UA 2OPPB 4MK8A 4GC6A 1IKXA 4NLQA 5HROA 1T03B 3LP2A 5C24B 1DLOA 4KE5A 1S9GA 2GIQA 2HNDB 3MR3A 3LAMA 1HNVB 1QE1B 2GC8A 4ICLB 4LSNB 4ECRA 3KLGB 2UUTA 3RB6A 2IC3A 1C1BB 1C0UB 4LQ3A 3DOLA 2YKMB 3DI6B 4ZP7A 5C25B 2AU0A 4QWDA 3QZ7A 2AWZA 4Q8EA 4ID5A 4KHMA 4ZP9A 5KFTA 3LALA 3CJ0A 4FS2A 2R8KA 4I7FA 2W8KA 3I5BA 4MFBB 1BQMB 2B6AB 3IRXB 3FFIA 5KFZA 4TQRA 3IG1B 3H40A 4H4OA 4NLVA 3OHAA 1S0OA 1T03A 1SH2A 4FS1A 2FLNA 2IM3A 4KFBB 4O3RA 3V6HA 1T3NA 2ZD1B 1W25A 2I5JB 4IFYB 1S1VA 4J9NA 2W9AA 3LP0A 1S0NA 4ICLA 4LSNA 4KV8B 3KLGA 3MR5A 4K4UA 3BJYA 2AX0A 1JLGB 2RF2B 3C6UB 1C1BA 5KFUA 3TAMB 3M9NB 3HVTA 2IJNA 2WHOA 2YKMA 4NLOA 3MFIA 5K14A 2IA6A 1JLCB 5KG7A 1IM4A 1N5YA 2E9TA 4MFBA 4K4ZA 4Y3CA 2D3UA 3IG1A 3QO9B 4ECTA 2V4QA 1TP7A 4ED6A 4WXOA 4IRCA 3PJWA 4NLDA 3GQCA 4IFYA 2W9CB 3M8PB 4ECXA 5KT7A 4KO0A 2RDIA 5DQHA 1LWCB 5KG4A 4K4XA 2BQ3A 3H5YA 4OL8A 5J2MB 3DLGB 4O3OA 3MF5A 2RF2A 2HWHA 4M94A 3MEGA 4G1QA 1IKVB 3NMAA 1CSJA 4RW6B 5F9LA 2BQUA 3RBEA 5J2PB 5KG0A 3OL6A 4ZP8A 3OL7A 5KT3A 1JLCA 4YR0A 3KK3A 3PR5B 2UVRA 4PWDB 2HNYB 2V0NA 2IM0A 3KK1B 2F8EX 3KHHA 4NLSA 2IAJA 2RDJA 1LW0B 3M9OB 4I2QA 3DYAB 3Q8SB 2VG5B 4F4YA 5J2QB 4Q0BA 1UWBB 2W9BA 3KHLA 4ZVGA 4EYIB 4J9LA 4B3OB 5KT4A 4TXSA 4DL7A 2W9CA 2RKIB 2BR0A 1LWCA 3UQSA 2FVQA 1GX6A 3IS9B 5HBMA 4NLRA 1D1UA 1GX5A 3DDKA 1TL1B 3DMJB 5J2NA 5I3UA 2FJVA 3NKYA 5F8LA 1JIHA 5KFFA 2WOMA 3CDUA 1XR5A 2CKWA 2ZKUA 3ITHB 2B5JA 2BE2A 3M8QB 3T5KA 3RAQA 2R2RA 1LW2B 3BSCA 2R2TA 3BQ1A 2XGPA 3KMQA 5CYQA 2ZE2A 3G6VA 2WRMA 1LWEA 2BANB 3KK1A 3GIMA 5L1KA 2BQRA 1LW0A 4QWEA 4ZPBA 3NAIA 3DYAA 3QIPB 5KG3A 1TVRB 5J2QA 1RTJB 5F8IA 1S1TB 1S97A 4J9RA 3N6LA 1JXLA 1RAJA 4MKAA 4YR3A 5D3GB 4WYWA 4ECZA 2BRKA 4RW4A 2C2RA 4TY9A 5FDLB 2QV6A 3IS9A 1ZTTA 1TL3A 1C2PA 1LWFB 1NHUA 5JXSA 5DG9A 4U6PA 3PHEA 4IR1A 1K1QA 1RA7A 1TKTB 3KLEB 1S1WB 4J9QA 3ITHA 1HNIA 3M8QA 5KFXA 1LW2A 1YVFA 2OPQA 1KLMB 3CWJA 3DRRB 1RTHA 4RW7A 5KT2A 3KLFB 3T5LA 1S10A 1RYSA 3BSAA 4ECSA 4WFXA 3KK2B 1SUQB 2OH2A 1RT5A 4URGA 4PWDA 1RT6B 3LP1B 4TQSA 5L1IA 4O4GB 3MEEA 2UVVA 4ZPDA 4DL6A 4ED0A 4Y2CA 1S1XB 3KLIA 2HNZB 4WYLA 3I5CA 3H4DA 3QIPA 1HMVB 3V4IB 5F8JA 1S1TA 3NBPB 4EYHB 4F4XA 1RYRA 1JKHB 5D3GA 4FBUA 3I0RB 4TLRA 1JLFA 1VRTB 3T1AA 4NLWA 4ZHRB 2OPSA 4YMEA 5KT6A 2IM1A 3GV8B 4DL4A 4ZP6A 5FDLA 2FVPA 1SV5B 5DGBA 5HP1B 4YP3A 1RT1B 4ZPAA 1QUVA 1TKTA 3KLEA 1S6PA 3QYYA 3FDSA 4RNFA 5DQGA 4Q44A 4K4YA 1NNDA 4Y2AA 1KLMA 4H4MB 1DTQA 2YNFB 3JSMB 3V6JA 1D0EA 4DEZA 3KK2A 3QGIA 4RNMA 5KFAA 1RT6A 3LP1A 1DTTB 1WNEA
chains in the Genus database with same CATH superfamily
3I9V9 1OSCA 1KP6A 2FLOA 1Q5YA 5AE1A 1TAQA 5C24A 1SV5A 4HT5A 3S1TA 1Z1ZA 2B4UA 2YNGB 4H4MA 3FSIA 5KFEA 2VUGA 2KFNA 3RRHA 2GGPB 4NI2A 2O1PA 1U6ZA 2BOAA 4OJHA 2I6WA 1XMQJ 4C2MA 4PR6A 2ATLA 1S72S 3IBWA 4KV8A 3G71S 4X65J 3TAMA 3GIJA 3CO9A 4M5HA 2QSFA 2QLXA 1HYSA 3RGIA 3DOMB 2G0CA 3VGUA 1HI1A 2G1HA 2IVFB 4DBQA 4F50A 1SKSA 5C7PA 1UA0A 1XERA 1K1SA 4Y0FA 4S0MA 3NGDA 4PWDA 2V8VA 1TAUA 3OSPA 3SCLE 1N88A 1HBMA 1RT3A 2LKZA 4DPXA 4PUOB 2UVWA 2X3GA 5HJXA 4OYIA 1IR0A 2LMIA 3LPEA 2BANA 5M2RA 3QSYB 3R6LB 4MKBA 2VFSA 3IA0A 5CD4H 1Y11A 2HK2A 2Z2ZA 3P96A 1OYEA 3PZPA 3B4DA 1SB6A 2ZOGA 4I69A 3HD1A 1WF2A 2V50A 1T94A 1J5OB 4DR2F 4QYZK 1WG1A 2JNJA 4QW9A 1SPBP 1FX4A 1S6QB 1R6VA 4ED7A 1R0CB 1NSKL 1H74A 1VLOA 4B3MF 3CJ8A 2ZOFA 4F7VA 2ZDPA 3OXGA 1GMVA 1T7PA 4HH1A 2DIVA 2MZRA 1PJ6A 4EO8A 4L76A 2FQQB 4LRCA 4NLXA 2K7KA 1K0TA 3R5BA 5ETSA 3W61A 1RTIA 2L9WA 4B08A 1IUJA 5RUBA 2D69A 2XLIA 1HNZJ 3TUZC 1XNQF 1WORA 3B8HA 4WIQA 1IBLJ 3JTNA 4KHRA 3P3DA 4LFBF 4ECWA 4IYQA 4F3OA 4LUBA 3MMCB 4L75A 2DISA 3SMZA 4NLUA 4WK1A 4JI4J 1FKPA 2JX2A 2AQ4A 3MM8B 1X9MA 4KAIA 2C42A 2CQPA 2JEGA 4O44A 1U47A 1HHSA 4Q43A 1B70B 1KTQA 1RAIB 1QVGR 3KHGA 4FXVA 2YNHB 5LMNF 3RR8A 2UXBJ 2VB6A 5DM7Q 2WVEA 3ILLA 4YY3J 4JYAJ 5EWEA 3LAKA 1XNRJ 5CZVA 3PKMA 2DNNA 3OV7A 2NQPA 1VBZA 3KTQA 3HVWA 1IKYA 4GMKA 2IC3B 4HTIA 3G8TA 1RHQB 2HHSA 1WHXA 3O2IA 3W1YC 1TTHB 2CPZA 2HQIA 4M5KA 4P75A 5HROA 2XBPA 4WWSA 4KE5A 2HNDB 2CZ4A 1P1TA 4LSNB 2UUTA 4ZCIA 1MNEA 4HHUA 4JI2J 2NZCA 1VJQA 5IM0A 3QAEA 5E3CA 2CQ3A 1IN0A 5F41A 2G2ZA 4QYRA 1RXOB 2IDLA 4P73A 4YEAA 2IM3A 3V6HA 3V2UC 4J9NA 5GAEI 3ZZOA 1RBAA 5KFUA 3KDNA 4A8SA 1NZ8A 4ECTA 4ED6A 4KC5A 4KO0A 2C3OA 4F36A 2MLXA 1NK7A 3MEGA 2LDYA 2VH7A 4DUYF 4ZVQB 3L09A 4DX8H 3GFZA 3Q8SB 2W9CA 2VFUA 1B7YB 2F1FA 3BS9A 5J2NA 2NREA 2B5JA 3S01A 2G2OA 4FF2A 2DNMA 2IFXA 1MWZA 1WF0A 1DHMA 8AT1B 2CJ9A 2QG9B 5F0UA 5D77A 4WU2A 1AXQA 2R42A 2FJEB 4TY9A 1GTHA 1RAFB 2W2PP 3T5LA 1S10A 2SXLA 2OH2A 3D66A 2FHOB 3AD8C 4C97A 1VJWA 4TLRA 4U8YA 3V4MA 5FDLA 4QIFA 2CA9A 1CJKA 3FDSA 1CJVB 1SIWB 2YNFB 3OTBA 2LA6A 3LP1A 3SCJE 2YWKA 2BMBA 3MR7A 7FDRA 2VG7B 1VQ7S 1C0TB 1RWXB 4EZ9A 3BZQA 1C0UA 4LF9J 4DX5A 2H54B 4DX6A 3G2XA 2HHWA 1S99A 4B3SF 3CJ2A 5A0YB 2V4RA 3BO3A 4BCAA 2UUWA 3CC4S 1AFJA 2POKA 1C1CB 4XDDA 4M1KA 3TJ8A 4YB6A 3IMQJ 4DV0J 5KFSA 4CM0A 3TW0A 2C28A 3F73A 5J2MA 2ILZA 1FTCA 3G6XA 2WCXA 2MLYA 4MIBA 3SIPB 4C8KA 1URNA 1CVJA 2D3OR 2DRBA 3D68A 4N7TA 4C8ZA 3J80U 4ILRA 5KFKA 1S6UA 2RQ4A 1X31C 2GVDB 2ZH1A 3FEZA 1X4GA 4UY85 2K8GA 2E9RX 3W62A 2NZ4A 2DGQA 5EUHA 3Q8UA 3ET6A 1LWFA 2OD4A 4OZ2A 4ZPTR 2X1AA 2Q3PA 4KR0B 4P7TA 5JMNA 1FRMA 2KO1A 2COLA 4RUBA 4FPIA 5GADU 2VFRA 5KTQA 4LVOP 1UZHA 4P72A 2HFVA 1O0PA 3MAQA 2EXUA 4ED8A 4UUXA 1GMWA 3TX8A 3NGSA 1WC5A 4OJ1A 2OGUA 1J5OA 1NDCA 1DTTA 3H5XA 3DDNA 1U0SA 2HVIA 1S6QA 3LOUA 1SI9A 2IM2A 1FVQA 2WAQD 1TU0B 3HHLD 4KRWA 4OZNA 4BWJA 5ADZA 3N9UC 5J1EB 2Y0SD 4ZMMA 1FFGB 1NK4A 3CD0A 4J9SA 4A8XA 3KDOA 2OJ3A 4ID8A 2B4PA 1ZBTA 2V69A 1N33J 3US5A 1N6QA 3JYTB 3SQOP 4ITSA 1FDNA 2DNGA 3UDEA 1FJGF 2JZ5A 4LQ9A 2JEIA 5CYQB 4DXLA 4WTOB 1PKUA 2YH0A 2RRAA 4DHVA 4KBIA 1HR0F 1AUDA 1JLEB 1MSWD 3MM8A 4ZPWR 4Y34A 3PX0A 1S77D 2PO4A 1RT2A 1APSA 1S9GB 2VU5A 2DK2A 2YNHA 3I4PA 3IR7B 1K73T 1JLAA 1LQ9A 1RHUB 4EBDA 4K50A 2UVUA 4PEOA 5G0RB 1A0OB 3OUYA 3W64A 2HQFA 1HQUB 3FSXA 2M8HA 3BPSP 2U1AA 1FFWB 1PCAA 2IC3A 2XULA 4LQ3A 4Q8EA 3W8PA 3HF5A 1NJWA 4TQRA 1ZA2B 2JL9A 4H4OA 4PKDB 5AJ3J 4ZS6A 4GVLA 4LSNA 3EUNA 3PRVA 3C6UB 2BABA 4Y6IA 1R7IA 3P8BB 3EMTA 4P6QA 3CMQA 1W26A 1VRQC 2BQ3A 4HLBA 9RUBA 4DL0C 3RG6A 1FE4A 2CNNB 1CSJA 3KK1B 1V9OA 3TARA 4B3OB 3VGTA 2OFHX 5A76A 3UQSA 1BMQB 3IS9B 3OQ2A 2RQCA 2HVEA 4WU3A 4BC7A 2G4BA 2BJ7A 1PSDA 2WOMA 1Z2ZA 2QSWA 2DGWA 1U0HB 5F3ZA 4OV6A 3NRBA 9ATCB 4KGKA 4ZN3A 2QA4G 5K5MA 4YR3A 5H9FJ 3D6TB 4ECZA 2XZDB 2FGOA 1C2PA 5JXSA 4OI0A 2HBQB 2CPJA 3OVAA 5HN0A 1NK0A 5IC4B 1U6FA 3BO4A 1DAXA 3KLIA 3B82A 2EW9A 3JQJA 1P27B 2OPSA 1UW4A 4DS4A 5IWAF 2M5YA 3RRGA 2F4FA 1EQ0A 5KFAA 2N3LA 4BLGA 2MGZB 4MKYA 3D5MA 2VZ9A 4RW8B 4CP5A 1WEXA 3IBCB 4OIXA 2QJ3A 3TAPA 2ZEJA 3DLKB 4RW9B 3OFGA 2YNFA 3G4SS 5CCMA 2DITA 2PMZD 2VBXA 3PX6A 4K4WA 3CCES 1OY9A 2BJ3A 5LMUF 2VG7A 4WIIA 2HFUA 3SFGA 3F0NA 3JQMA 4YUDA 5I4MA 2HHTA 4FDFA 1CULB 3VV2B 4OZLA 1CG2A 4NXNF 2ADCA 4QBUA 2IRYA 5B0BA 3CJSA 2BM1A 2OEMA 3C15A 2CNLB 1B64A 4L3NA 3AT1B 1C1CA 1VHFA 3VQSA 3J80Y 1MROB 4DF4A 2XS5A 2VG5A 4YHHJ 2VFVA 2XI3A 3FBCA 3HHLC 3T6BA 3W9JA 5C2GA 4NA3A 1TV6B 1BUXA 3BEGB 4NLTA 3HD2A 2UUCF 2HHUA 4USUA 3U7JA 3JSBA 4HACB 4R8UB 3AAWB 3OR2A 1TMMA 4Z2XA 2XNRA 2BVZA 3PYEA 2QLJB 1UVJA 2PI4A 3QRRA 4J9KA 1WJ9A 2AEFA 4I56A 2J6SA 2WVCA 4FNIA 2B9YA 4GKJJ 2GVDA 1UWAA 3I96A 2UUBJ 1IQTA 3TVZA 1L3KA 1FDBA 3NP5A 1GK8A 3I0RA 3IGVA 4CZCA 3Q86A 3RRKA 4F8RA 3HZEA 1UEUA 1N0UA 4ED2A 2DNPA 2JSXA 1HNWF 3D4JA 3PW4A 4QZVB 3KNGA 4KH0B 5C42B 3CJ5A 3PDNA 3G86A 4LF2A 2GQ2A 3FKBA 2FJBB 1OO0B 3KG1A 2HAIA 1QLNA 1EB0A 2KU7A 4QWAA 5J1EA 5D4NA 2R2UA 2UP1A 1BQNB 4RNOA 3U27A 1T9WA 2DCLA 3DRSB 2QN6B 3MEDB 1H7XA 3C16B 2P8IA 3JYTA 2DH9A 2FIUA 3FQLA 1UJ4A 5HQ8A 3C8YA 1GXTA 4RW7B 2ZH3A 3CIMA 4ECVA 3DNCA 3CULA 1X5SA 1JLEA 3M8RA 4JP8A 2ASYA 4DS5A 4M5IA 3T3FA 4FXDA 4C11B 2AYGA 2HGNA 1OQ3A 3ILIA 1HI8A 4DUZJ 4JI3F 3SSRA 2JRSA 2C22A 2ALYB 1S9GA 4CO5A 2GQQA 4E0DA 3FK4A 3K5NA 3BDEA 3ZTOA 2AU0A 2J76E 4G6VB 2MTLA 3THVA 5G0RA 4M5MA 3JTPA 4WCEQ 3IG1B 4NMLA 3OHAA 1T02A 1S6OA 1W25A 2I5JB 4IFYB 4NX9A 1TZ0A 4MKVA 4OQJA 2YWWA 2ZFHA 3FMWA 1SJQA 2J8AA 4YFUA 2FJDB 4DDFA 1RWPB 4PXDA 3CJQA 2UXDJ 4CLSA 2EVZA 3UN3A 4G1QA 4DR3F 5HMZA 1RLDA 1D8YA 2VQEF 2MPUA 3PR5B 2HNYB 1SCJB 1NDKA 1NHKL 2V2KA 1M1KT 1UA1A 4OX7A 1LXJA 1RU2A 3M2RB 4CH7A 5F8LA 2FZGB 1F1BB 2XMJA 3KK1A 1VI7A 4ZJLA 1RTJB 4B02A 2BACA 4RW4A 3IS9A 1L3UA 1NHUA 3NLCA 3ENAA 3LGMA 5KFXA 4N8OA 2RUGA 5KT2A 1N36F 4X64F 2XYHB 3D0GE 4DL6A 2VOPA 2C3MA 1XIQA 4LT6A 4RWWA 4DV1J 2XSJA 1RWOB 2Z57B 1U8WA 3IAM9 5F0WA 4GKKJ 3D2WA 3BH7B 3DRPB 3IR6B 3PRBA 1OWXA 5CZXA 3QT6A 4K59A 1YZ6A 1HNVA 3NEKA 1VBYA 4G1PA 5M2UA 2DHHA 2KT5A 3HM9A 1H73A 2OHDA 2YBVA 3CJTA 3BR9A 2B6AA 4RW8A 1AROP 4HDHA 2C2MB 4P71A 3M1VA 1F3FA 2PN6A 3UR3C 2FJXA 3KG4A 2J7WA 4JV1A 3BSOA 1MG7A 2DNOA 3FQKA 3BM7A 3SCIE 5CAAA 1N0VC 3CCVS 1HPZB 5KFBA 4PQUB 4JI8J 3LH2S 2RQMA 2MKCA 1CULA 3H2LA 4PYAA 2DIUA 1KEKA 1M5OC 1U09A 4F0KA 4X2BA 3TEHB 2KXFA 2PSZA 4URQU 5CXTA 3EYZA 4J9PA 2NPFA 3E01B 3FZ2A 2ZZTA 5B0FA 1YJ9S 1FDDA 4X84A 1UPPA 1KHWA 5D4OA 1MROA 1RHMB 4E8UA 2E29A 1WUUA 3FJ2A 1S4FA 3EWGA 4Q45A 4Y2MA 1VQYA 3K17A 4MH8A 2VKZG 1Q79A 5BR8F 2G9OA 3GMGA 3KLFA 4CRJA 2D74B 1R0AB 1U1NA 4P52A 2QTWA 2DGUA 2VA3A 2V8HA 2MQLA 3GU0A 1N4LA 3M32B 4JUZA 2BYCA 1XMOJ 3E2EA 1GEHA 2GMLA 2CQCA 3ZC4A 1VR6A 3W65A 4DV5F 3GV7B 1JMTA 3GV5B 1JNRB 2B9EA 3BBFA 1X7VA 3TRGA 1HI0P 1YJVA 1EETA 1WKLA 4WXWA 4XO0A 4K5SA 3K58A 2K7JA 2DCUB 3NWRA 3CCJS 1UP1A 3PTWA 2JEJA 2V4JA 4AQYJ 2KH9A 3VAJA 4DG1A 4A47A 2FDNA 3I5AA 1FRKA 2QLWA 5C42A 1QDUB 3UPFA 4JI5F 3GG1A 2HVZA 3GG0A 1U02A 5ETQA 3KNAA 3QGPA 2RHQB 1LWEB 3HXMA 2HBYB 4CO1A 3QZ8A 4F2SA 1IBKJ 2WK4A 1DJ0A 5KFVA 2HBZB 4G3IA 2M7SA 1Y4ZB 3RAXA 2CUYA 5D4LA 2OKQA 1A7GE 1BQNA 3M6XA 4X62J 2V2QA 4M8LA 4F4ZA 1WDDA 3F56A 3OJUA 4X4UA 4NRTA 3DRSA 3H4BA 3GYNA 3MEDA 3C16A 3L7UA 3Q2TC 3WHIA 1RWUA 1VQMS 3ENVA 2A2DA 1WSRA 2HFNA 2YX1A 2J8SA 3H98A 2EC2A 1HNIB 3BBCA 5D0GA 2CQGA 3SQGA 5KFYA 4AYBD 1IKXA 1FEHA 1XMBA 5LXYA 3CF5Q 1FXLA 1W2BR 3HFVA 4UOCA 2CPXA 2E1RA 2MKIA 4QWDA 2Z2LA 4KHMA 4DV3J 2MDAA 3LALA 2YX4A 1YQHA 3WX8A 3DRXA 2MZQA 1E6VB 4FS1A 3GSDA 4O3RA 1Q8KA 1IM6A 3MR5A 4LSZB 3M9NB 1X4CA 2CJAA 2IJNA 5D0RA 4OX9F 2Z4PA 1EKSA 4FF4A 2KJVA 2YKQA 2BBEA 3QAUA 4Y3CA 2GX8A 3IG1A 1TP7A 1VQKS 5H9FK 3MOZA 3G96A 3CDBA 4IFYA 4ES3A 3CD5A 4FP9A 4LF4F 1X4EA 1RK8A 1PYOB 1KRPA 1Q8IA 3BPDA 2H1YA 1YBTA 2L3MA 2RDJA 3CCUS 2IAJA 4I2QA 5J2QB 1JB0C 1L3SA 5ETOA 2M88A 2CRLA 1EQMA 4LRAA 1J5EJ 5I3UA 2ZBRA 1QUPA 3ITHB 2JH3A 2BE2A 4LR9A 2MKSA 2ZNZA 5KG3A 3KJNB 2NS1B 1FNOA 4ILMA 2GZOA 1A6LA 3CCSS 1QM9A 3FVYA 2AT1B 2KJWA 4BDPA 1TKTB 3VWSA 2VDIA 4PQAA 2HZCA 4ECSA 5L1IA 4DV2F 1HMVB 3L9ZA 4MYUA 1JKHB 4J9QA 2QLFB 2YQ1A 4Z7YA 4J9VA 3HVRA 4L6V3 1X8DA 1S6PA 4RNFA 2VONA 3D54A 1VQSA 4DEZA 1KVIA 3CE8A 3X1LB 3EXYA 3DLLQ 2LXFA 3BR8A 2KKHA 2XS2A 4XDCA 3GE9A 1HIYA 2VQFF 2HZVA 2R8HA 4FZVA 3NGUA 4AUKA 1VBKA 4DL2A 2GV1A 3I4HX 1BQMA 3EZOA 3DRPA 3GR1A 5AXKA 4ZIVA 3LUYA 3QJPA 2AYBA 2DEIA 3DLJA 2XHWA 2OD6A 2QL9B 4DR6F 2CQ2A 4FXWA 4H4KA 2F7VA 2YWGA 2KT3A 1CJUA 3HMJG 2YVSA 2PDAA 1M5KC 2C2EA 1AYEA 1KNZA 2LA4A 3HHEA 2HURA 5B09A 4NCBA 5EWGA 2AJ2A 3D0HE 3OLAA 1V3SA 3VALA 3D67A 1X4HA 4I0WA 2M4MA 3CJRA 1HPZA 2GO9A 2PMHA 3DMJA 3TA1A 1GMWD 4PQUA 3QSIA 3MPDA 4FYXB 3GCXP 1RA6A 2XCPA 1VHIA 1V5IB 1DLOB 1H3DA 3ZTRA 3A8KA 1NK9A 3E01A 5E0OA 4LF5F 1S1WA 4CNYA 3FMBA 1VISA 2YQ3A 1SUQA 4O4GA 3FFIB 5I3PA 2XHCA 2B7BB 4IR9A 1ZYQA 4QOTA 1S1VB 3LP0B 4TNOA 4DV4J 1XJWB 1RUSA 3HVTB 4R0JA 3HHDA 1AT1B 3QT5A 1MN9A 5DLGA 1OPZA 1S48A 2DXEA 4CI0B 2X1GA 3J7A1 3IO1A 2J6TA 1R0AA 1NB2A 1ICEB 3IP0A 1Q95G 2I38A 3M32A 3C19A 1T05A 4NRUA 5A8RB 2PGCA 1IBMF 3IC1A 4CM2A 2EK1A 1G2EA 2QLBB 2EC0A 4LSLA 3MTJA 4Q8FA 2Z8QA 2HVDA 4RX6A 2WONB 1RSCA 3MM5B 3J7YI 4QR1A 5H1SV 1KLNA 1TUVA 2XWYA 1M5HA 3NCQA 1I5OB 2LXUA 1FTRA 5HO4A 1EP4A 1PG5B 4RPFA 2B56A 2K06A 3IGNA 4JI0F 2V9WA 3ZNUA 1SJ3P 1RAEB 4ZIWA 3A13A 2OPRA 3H20A 1TL3B 1IVZA 1WC4A 2DNHA 2DNLA 1NSQA 3CVKA 2MY7A 2E7VA 1XEZA 3RB0A 3W5ZA 1UVKA 1VOMA 1VFJA 2DRDA 2HSEB 1QAIA 1TQLA 3UVJB 1SKWA 2HGMA 4WE1A 4M5LA 3DCAA 3EGVA 4RUCA 1S7IA 2ZM6F 4LF1A 1KHVA 2OPPB 1QVFR 2AEMA 2GC8A 3VZIA 3QT8A 3JTOA 1D9DA 1B0VA 1B99A 3POTB 5IQ6A 1YIJS 3G82B 3I5BA 4LREA 4OYZA 4NLVA 4DQQA 2FD2A 5IT0A 1IR2A 2HRTA 1FRXA 2HIYA 3D1QA 2CQBA 2BZ2A 3DDIA 1U2RA 4K4ZA 2D3UA 2V4QA 2AZ1A 2YPYA 2HG4A 4U9RA 1GTEA 2E5IA 3ENQA 3D6HB 1QTMA 3R1HA 2VPWB 3I32A 1SBRA 1OYDA 3KK3A 1BGXT 3DFEA 4DWIA 4J7CA 1FF2A 2F8EX 1RE1B 2K1RA 2QFIA 4B3TJ 1WHYA 1Q82T 3AXMA 3HFZB 2W9BA 4ZVGA 4EYIB 2GAGC 2FVQA 1GX5A 1DQ9A 1LW2B 5E3AA 2EG2A 5AT1B 2VL1A 3G6VA 3C66A 5J2QA 3TWZA 4JI6F 2E44A 3EDQB 2QV6A 5A8KB 4ZLNA 1UW9A 3ITHA 2H65B 4Q2MA 1LFPA 1RTHA 2QIFA 1SKRA 1GMUA 1S0VA 1S1XB 4JV5F 4EYHB 1RYRA 2KFZA 4FBUA 2ROGA 1YLXA 1NSAA 4ZP6A 2UXCF 4UQGA 5DGBA 1T11A 3ZTQA 1TKTA 3QYYA 4Q44A 2DT9A 1VQ8S 1PAEX 4RNMA 1U7LA 3Q23A 1BD6A 4LF6F 1DZ5A 5F8GA 1HMVA 4ES2A 4RBUA 3H25A 2YKPA 1UVLA 4LFAF 4RZRA 3MDFA 1RWKB 3TQ1A 2JOQA 2AMCB 3IRXA 2ZOMA 3HVAA 1TK8A 2AJ1A 3PX4A 2DR8A 1NB7A 1T9UA 3CDEA 4MIWA 3EICA 2BW2A 1S57A 3QIDA 3AODA 3C6TB 1M5PC 4QYZJ 1X4DA 4EWTA 4K4TA 2VKRA 3HX9A 4LBPA 1UVIA 1R8BA 4USIA 2J0XA 2CG4A 2NYIA 4UT4A 2MSTA 3PFOA 5J2PA 1IKWB 3AA9A 2ZH6A 2OEJA 2F4VF 2MB0B 5U47A 2RQKA 2RHSB 3BGUA 1M0SA 1NKCA 4IG0B 4ANEA 1MW7A 1SJ1A 2D9PA 1I94J 2F9DA 7FD1A 4IH7A 1HD1A 4X4SA 1S49A 5L46A 1NSPA 3FRZA 3FZBA 3R27A 1SH3A 3SDEB 2XI2A 4RUAA 3LGNA 4QCLA 4LF8F 3I87A 5KFIA 3SCKE 3JAMY 5FJ4A 2ZUGA 4N77A 2MXYA 1UJ6A 4DV7F 2E7WA 3Q8YA 1F9EB 3HT0A 4USVA 3CMAS 4O3QA 1Y5LB 2RE1A 4I67A 2A2CA 1KQGB 3NNHA 3A12A 4J9OA 3W2WA 1DQ8A 3A1YG 4Y2KA 5KFPA 4ECUA 4JI1F 4EBCA 3C46A 2Q1LA 5K14B 5EX3A 5GAGU 4M5DB 2MHEA 3UD5A 1QSYA 1DARA 4DMZA 1FWLA 1LK5A 5CYMB 5C2CA 1HBOB 5KFCA 3LO3A 2EI5A 4WFNQ 2MYFA 3CJ3A 1B7FA 4ECQA 3RAMA 1LFWA 2UUAF 4Y2IA 2GFFA 2NYHA 4P2SA 1WTFA 3OBIA 2C2ZB 5HK4A 4EMDA 4BC9A 1IR1A 2M8DB 2XM3A 5A8RA 3T1HF 4K4VA 4CCHA 2DGXA 2ZE2B 2HS4A 2MQ8A 2IIHA 4OI4A 2WONA 3MM5A 1T8EA 2XMUA 3MECA 4ZVSB 1RCOB 2VG6A 3MMJA 4DV6J 5AXMA 5A8WA 1NLKL 2OUGA 1HARA 2W25A 2OPQB 2Y9HA 4WP3A 3VVUA 3ZZYA 1JLFB 2MZ1A 1F60B 4EU0A 2WW4A 2CPDA 2LLZA 1WC1A 5MAOA 2ZHAA 2GMHA 1X4AA 2GIFA 2KVQE 3R5CA 4IG3A 4J9MA 3EPIA 2UU9J 2HFZA 5F3TA 1R27B 1LNQA 4F26A 4DQRA 3ZZZA 3LP2A 5C24B 4U8VA 2B4VA 3CCMS 3HPOA 3UVJA 3LGHA 5CABA 3OTOJ 3JB9k 4F2RA 3D1HA 3CJ0A 2R8KA 2KI2A 3RTVA 4NI2B 3FCWA 4P7VA 2QA2A 3GR0A 2WVBA 4J5OA 2YWEA 1ZZFA 4KV8B 4W4MA 3TAMB 1UFLA 5D78A 2LQ8A 1TL5A 1KR4A 4KY3A 3G82A 1N5YA 1QAYA 2K3KA 4P2MA 4DPOA 2OI2A 5LL6d 4ZLJA 2MZJA 1WC0A 1FFSB 4CWBA 5HL7Q 5SZTA 3OL6A 5IZHA 2MQMA 4ZP8A 1LEOA 4PWDB 2E5LJ 1HNXF 3Q0AA 4B9LA 4UQTA 3P6YC 2KL8A 3KHLA 2MJNA 3PKYA 2KXHA 4M5JA 2VIHA 1KS2A 2ZKUA 4UZBA 1P6TA 3GSIA 3GJSB 2BANB 3GIMA 4DPWA 4PXBA 5FD1A 4DSJA 4WYWA 2N4DA 1MWQA 1U2FA 1RA7A 3I56S 4LFCJ 2Z58B 4OHWA 3MOJB 3AFGA 1LW2A 1ZAWA 2ERRA 5K8PA 3MUMP 1LKZA 5MLCV 2KHCA 1HBUA 6FDRA 3TZXA 4P10A 4K4YA 2D3O1 1RWMB 5J1NA 4LF7F 5GVQA 1RGVA 1S1XA 4Y28C 2H48B 1H6KX 4FYWB 3TR5A 1S79A 2ILYA 3A3OB 2BJ8A 5KAKA 2I8EA 3QPIA 1F5CA 4OHZA 4PG5A 3P49B 1RTIB 1T0TV 3CXCR 2V63A 3QJJA 2PFDA 2ZNYA 1H7WA 4CTAA 4O0IA 2ZD1A 5D0HA 1VK8A 4C8LA 3HFKA 3R7BB 2NLWA 4B3RJ 1H2UX 5IT9U 1CS4A 4O44B 3PR4A 4K5RA 5KFRA 1W7WA 2QZ8A 3FC9A 2FZKB 1ITPA 3UD4P 2C3PA 3M8PA 1G3OA 4ZN1A 4O0NA 4GO5X 2DBBA 2UV8G 2DHGA 1O5JA 4IH6A 4RW6A 5M2PA 5CH7B 1OIAA 2YKAA 1UWBA 5DZ6A 3VQTA 4C0HA 2XMMA 1IKYB 2CADA 1TL1A 4IKAA 1TL7A 4DR5F 1IKWA 3TAQA 1VS3A 3R5GA 5IFMA 4OI2A 2BM0A 2J0SD 5HROB 4K0KJ 1REGX 1YJNS 4IG0A 2MQQA 3B4MA 4N56A 2QRRA 1NEEA 2FVCA 1U1QA 2YY3A 1Q81T 1UVMA 1FE0A 3FNNA 2AYEA 2YH1A 4Q5VA 5BYQA 4TYBA 3TI0A 2JLFA 1X5TA 3T41A 5CA5A 2HYIB 2XWXA 2VPYB 3SDEA 2PA3A 4A8QA 2P5VA 4ANCA 4OHVA 5K8MA 1HA1A 2FLLA 1PC5A 2ROPA 5GMDA 4KO0B 3MPYA 5T7LB 3CUNA 1NCLA 2DHSA 3MEGB 3QT7A 3EVMA 2WZ1A 1YHQS 1WD6A 2XZWA 1KN6A 2BA9A 4X66J 2C2NA 4DSFA 5J2NB 5CYMA 1HBOA 1BQXA 2B5JB 1IQZA 4M95A 5L1JA 2DVIA 1D9FA 1N34F 1N56A 2ZBIA 3HKZD 1FERA 2QO3A 5L1LA 3UNYA 1B4SA 4WFBQ 3K5MA 4ALZA 3N6MA 2L41A 3MI7X 3AH6A 4DR1J 2WW8A 2JVRA 1Q86T 1VQLS 4A4JA 3ZZ0A 1XWLA 5L9XA 1URRA 5KFJA 1CJKB 5ETPA 1CLFA 1FNMA 3GIKA 1FD2A 2DY9A 1RP5A 4NYZA 4O4RA 1U45A 1E6YB 3TOQA 1FRIA 5JUMA 3RB3A 1YX2A 4A8OA 4NXMF 1QAXA 1CPZA 3N79A 3KFWX 1PIEA 1C0UB 2VASA 2HHHF 1NKBA 2LEBA 4CLFA 1RKJA 3K5OA 1FRLA 4I7FA 4YS2A 4MFBB 2XYPB 3JSYA 4LJMA 5LT5A 2H4YB 4K4UA 2RF2B 3N5BA 2WHOA 4KGXB 1O8BA 4K2JA 4DZDA 1R8AA 3PG9A 4QQBA 3L7PA 3K8WA 1HD0A 1LK7A 4CT9A 2XMTA 2BJEA 3UN5A 1SQGA 5J2MB 4CLLA 2M0GB 1RU1A 1GXUA 4C7QA 2IY5B 5KT3A 2XMWA 4YR0A 1R89A 2IM0A 4E2FB 1U1MA 3GB0A 4CO4A 5HVHA 4Q0BA 3GLJA 1SC6A 1HHTP 4OZ3A 4DL7A 2DO4A 2Y8YA 5HBMA 3CDUA 3BSCA 3BQ1A 4ED5A 2ZKTA 2WRMA 3QFHA 2GVZA 1BXNA 3QIPB 2HHVA 1V3RA 4J9RA 1RAJA 1RADB 4YDDB 1Q7YT 1BWVA 3ET6B 1LWFB 4OJGA 3PHEA 3MM6B 2IHR1 3LWLA 2UZAA 1FRJA 1FESA 4BS2A 2O01C 3KK2B 1RT5A 3B78A 3ULHA 1X60A 4ZPDA 3ETMA 4WYLA 3MMAA 1NZAA 1NH7A 3NBPB 4F4XA 4OI6A 4NLWA 4ZVUB 2FVPA 1S76D 3GJRB 1OMSA 3QGIA 2DYAA 1DTTB 3C3LA 4CLPA 3TJ9A 3P5TL 2W7OA 5KFHA 1R8CA 1VCTA 3OL9A 5E3QA 1SJ4P 3WBZA 1FCAA 3AOCA 3SV3A 1UJ5A 1KC8T 4ELTA 3ISZA 2KDOA 2DNKA 2MQNA 5IT9Y 1N6QB 4ECYA 5B08A 2ACMA 3IAS9 1MN7A 4JI7J 1U2CA 3K2YA 3O44A 4DSEA 3I82A 3QRPA 2J9DE 4XIUA 5KG6A 1N32F 1GFWB 2WSCC 2ZH9A 1KBRA 3SEOA 3V6DB 4H54A 3PW0A 4ZOSA 3AQPA 2ZHBA 3X3UA 2J9EA 1U24A 1KQSR 2DJWA 4QIEA 1N8RT 1RT2B 2XSFA 2ADBA 3OXLA 3CC7S 4KHPF 1FRHA 1JLAB 1OQ6A 3T9ZA 2PIIA 2XLKA 4KKOB 3OUYB 4F4KA 3MFHA 1WC6A 2XQCA 1YBUA 3J7ZT 3GFYA 2HMIB 3EZ5A 2B8QA 4BHQA 4HI1A 4P2FA 4NLYA 2MZTA 1NDLA 2GS8A 4H4OB 4TVAB 3BQ0A 1CEZA 4ZHRA 1VQNS 3FEXB 2RNEA 1H0HB 4FVMA 1WEYA 3QGGA 1SJFA 3UI3A 5KG2A 3PYDA 1RTDA 2YKOA 2HRUA 2DGSA 1T9YA 5DJBA 3W7BA 1K0VA 5SUHA 1SJRA 1L5UA 2XNQA 2OTLS 3N01A 4DR7J 3VGVA 2C2OB 4KTQA 4KPCA 5GAGI 2EFPA 4C8NA 3W60A 4HHJA 4B9TA 5T7LA 3CIZA 4LRBA 1WSVA 2WOMB 2DNQA 2DD8S 4I6WA 1Y5NB 1XMQF 4FKYA 2F63A 3MCSA 1K47A 4F4AA 4X65F 4DUTA 3MXHP 3Q8PB 2FUG9 3E3XA 5B0CA 2CPYA 2DXDA 2YQ0A 2D1CA 2EFQA 3TP2A 1CBKA 4QW8A 3DOKB 2AGQA 5D4PA 3KLIB 3NCRA 4MYTA 5ETLA 2QEXS 1NUEA 1QTNB 2OPSB 2MSSA 5F9NA 2AHOB 3AD9C 1ACMB 3VAHA 3JS9A 3DRYA 3S7RA 4USWA 1X0PA 1TKZA 3CJ4A 1YGYA 1FJEB 3LAMA 1TR0A 3DOLA 2OMOA 5KFTA 2W1BA 3OVBA 3BV8A 4LR8A 2NXCA 1YJ7A 2ABYA 4F3MA 1E6YA 4ZCLA 4CLWA 4USKA 1SH2A 1U1RA 4P74A 1VBXA 2QL7B 1S4EA 3KG0A 2O66A 4W92B 2IBOA 1X5OA 4FNHA 1JLCB 5KG7A 1VC5A 3CDAA 4MFBA 3CB4A 1NJXA 3T1YJ 1I51B 3R97A 2VC1A 1SL2A 3H0PA 2HVHA 3C15B 2W4DA 4CYUB 2G2YA 1B0TA 4RWXA 4B9MA 2RF2A 1DFDA 1ZM2A 2ZH5A 4DN0A 4H4KC 2VG5B 4F4YA 3GYGA 1EKRA 3GIRA 3HHLA 2BR0A 1T9TA 3DDKA 1HNZF 2C1EB 2R2RA 1IBLF 4ZPBA 3QRQA 3N4WA 3OR2B 1S97A 4JI4F 4OYOA 2PEBA 3W9HA 2WSFC 4OYBA 2EFVA 1EX8A 2IA0A 1K1QA 3M2UB 4PYDA 4LRFA 1DY3A 1RYSA 3S6EA 1FD8A 4W98A 2UXBF 3QIPA 1N5SA 3DN9A 4JYAF 4YY3F 2CQIA 3I0RB 5KT6A 4UOGA 3MM6A 5KOXA 1XNRF 3O1LA 3KK2A 3PCOB 3NBPA 1SQEA 3DLEB 1VIOA 1N48A 3MHYA 3BREA 4DL3A 4C8OA 3BB5A 1NMEB 8ATCB 3D28A 1ROFA 3HSDA 1RZMA 4JI2F 2V94A 3QMQA 4M63A 4NLGA 1JLGA 1VC6A 4AL5A 2RUSA 3QWPA 2AD9A 2JFKA 4IOBA 2ROEA 2H5EA 3AOBA 3QO9A 2L08A 4RU9A 5LSRA 4ZPVR 1RTZA 2LVWA 2R7WA 2R7QA 2R7XA 2IJFA 3V6DA 2NUUG 4OYAA 2RKIA 4JB8B 1ZM4A 2FTRA 2E5HA 3T9NA 2MKJA 1XC9A 4G1IA 4ANDA 3EGNA 2D41A 2HKEA 3UNGC 4QWCA 3CJKB 2LU1A 1YJTA 2CAJA 2JJ4D 3DRRA 4C4WA 5DS7A 4HT7A 4KKOA 5C5JA 3UCUP 4DU8A 2ZHOA 2HS0A 5HMWA 1VRTA 3SXLA 1QY7A 2KRBA 2HMIA 3T6JA 5D6GA 5HP1A 1NKEA 3ZNJ1 1GQEA 2L9NA 3OFFA 2B4OA 3LPYA 4ES1A 4YB7A 3QJLA 1ZAVA 2WB1D 4FPRA 3TUIC 4TKTA 2PA8D 5F8HA 1U8SA 1RAOA 3NAHA 4OI3A 1AFIA 4G1QB 1N5QA 4NEZA 3O3LA 1KDNA 1NXIA 2KFYA 2HEKA 3ONQA 3HZGA 1VRUB 4USJC 1NRKA 4LF9F 1TFYA 4EGLA 3H59A 5DQIA 2BXJA 4PAAA 4I2PB 4MTPA 4DL5A 5LSLA 1VMBA 4RW4B 2VBWA 4X4NA 4DV0F 1SL1A 3PW7A 4OZ0A 3MGJA 3R6GB 1Q4RA 1KQKA 1YDLA 3EPGA 4NASA 2K2PA 2XSJB 5KFLA 2R7OA 3Q8VA 3Q8RB 5GMKa 3KUEA 5DDRC 3DOKA 3NOCA 2GIRA 5BYSA 1RHKB 4LBHA 3W5XA 4YN3B 1HNVB 3KLGB 2H5IB 1C1BB 1RB0A 2RVJA 1JNZB 1X0FA 4ZCMA 3L4BC 2B6AB 2C3YA 3PJ9A 3M1VB 1D9AA 4UTGA 2W9AA 2OO4A 4ILLA 4J9UE 1XTZA 4ZDNA 2F8HA 5GAHU 2X3DA 2NSCA 3HK2A 5LXRA 3K57A 2YWHA 3KUGA 3PHTA 3GQCA 4ECXA 5IOLA 3AJDA 3MF5A 2W7AA 2HHPA 3AJ1A 1XBWA 1JLCA 3MAAA 2IYGA 1R8HA 2ZUAA 2KG0A 4CYUA 4WBFA 5KFFA 1GH8A 3W2VB 1N33F 3MEKA 3BGLA 3NMRA 2HLUA 1H2TZ 1RISA 5D3GB 4DR2J 2Z56B 2MMYA 2LQBA 4DCJB 1TMJA 3KLFB 1KLMB 3C14A 3MEEA 4I68A 4B3MJ 4N5SA 1S7HA 2VC0A 4YMEA 3UFCX 3OR1A 3BBBA 2PFFB 4E98A 2RAQA 3M2UA 1DTQA 1RACB 3JSMB 3L95X 1TUWA 4UY8T 3M6VA 1VGYA 3NXZA 2RDDA 1M5VC 3MUVP 3BGFA 4F04B 1XQIA 4ED1A 3UCGA 1VQOS 1EETB 1QE1A 1XNQJ 3KXDA 3RZAA 5C25A 3J7YU 4LFBJ 1HBNB 4ED4A 3CCTA 3CCZA 5E2QA 2D7SA 2V4JB 4FYDA 2KRRA 5KFWA 3DLEA 4PG7A 4DG1B 3P4UB 4DZ6A 2CDQA 3OFHA 3R5AA 2P9EA 3D0IE 1MMDA 1W2IA 1YRTA 2E9ZA 1T9VA 3THPA 2XB2D 5AJ3F 2Z0GA 2AF6A 3OLBA 3OPKA 5LMNJ 4HVZA 1KSPA 4USMA 4YB1P 1Y9OA 3Q83A 6AT1B 2FY8A 2H51B 2GQCA 3QLHB 3HKWA 2XCAA 2BV3A 1IKVA 3M4XA 3OT9A 3SI8A 2ASDA 4U7CA 4CT8A 1Q78A 2E5JA 1OSDA 1YKWA 3T5HA 3M8SA 1ZZNA 1FEEA 5CHCB 4BBYA 4IDKB 4R0EA 5JJBA 4UF4A 4UOFA 3SQGB 3IWLA 4WKYA 3ENWA 1TVRA 2GA7A 3A8EA 1IKXB 2FGCA 1X9WA 4NCGB 1KONA 1K44A 3V81A 1F2GA 3K8VA 4B9UA 4FBTA 2IJRA 1BWEA 4RJVA 5IT4A 4PPZA 4OHYA 1C4AA 1UEVA 2ZWPA 2B43A 2C2KB 3QGHA 3CJKA 3D6FB 1QD1A 4LR7A 3BGRB 2VD3A 1TK0A 1EAYC 4CO2A 1UMJA 1T3OA 4DUYJ 2V5HG 3PYGA 2M70A 2G1DA 3WIUA 2QMUB 1RT7A 3KLHA 3N6NA 1S0MA 3R7SB 2IAJB 2JHEA 4C0OC 4I2QB 5DO2A 3WQPA 4A8MP 1CQMA 1SIZA 1Y5IB 1YJRA 4NLPA 4HI2A 1G1XA 3RW7A 1LOUA 1YBAA 2QC3A 5I3UB 1YTYA 2BE2B 4WFZA 3R2DJ 3IN5A 4DCOB 4PPDA 5FLXU 3WC2A 4IQMA 3JSRA 2XMKA 5AE2A 3LWMA 1VRUA 3KJFB 1EIYB 3IWXA 4EI2A 4LBIA 3AB2B 2J6UA 1NPKA 2HS3A 5HJYA 2B51A 2GNKA 3F44A 2LP4A 5E3PA 4I2PA 2JC0A 2EK6A 1X9SA 2HQDA 5ETRA 1V3ZA 1FKOB 1JLBA 1U1OA 2EKNA 1UETA 4R25A 4C8MA 1S6PB 2NCKL 1UCNA 4YHHF 3CD7A 4MK9A 1PBAA 3MUTP 3GP9A 1SKUB 1N5TA 4F02A 1NJZA 3QNWB 2HAFA 2Y3YA 4LIRA 1RWVB 3AJ2A 4B3SJ 4W90B 1VLYA 1BQMB 2RSQA 5KFZA 1KFDA 3H40A 3TUJC 3OVSA 5B0GA 2OIHA 3VCDA 4GKJF 3KLGA 2K3IA 2UUBF 1C1BA 4V19J 4D3HA 2MEWA 3NGTA 4OYPA 2AV5A 3NS5A 2XTJP 1CJUB 2JLGA 4IRCA 2M9KA 5H9EK 2AIRB 2RDIA 5DQHA 4K4XA 4OL8A 2CPIA 4OLPA 3Q22A 4TU9A 5KG0A 2D9OA 1RJJA 1PGZA 1LW0B 3SBMA 1EARA 5KT4A 4NLRA 3DMJB 5D8HB 3KMQA 1LV5A 4QWEA 1HW8A 4PZVA 1Y10A 3N6LA 7AT1B 3W63A 3U1MA 3G9CA 4U6PA 2BE9B 3KLEB 1S1WB 3LA0A 3W2VA 3VZHA 2QMWA 2CQ1A 1FNXH 1SUQB 4URGA 4DN9A 4O4GB 4WP8A 3V4IB 2AJ0A 3CCRS 5D3GA 2GHWA 5D0EA 1RT1B 3MM7B 3W5YA 1QUVA 1KLMA 1HFEL 2A18A 1WNEA 3HHKA 3F41A 2EBGA 4O3PA 1T05B 4QPXA 4DUZF 1SXLA 5G4DA 3JSMA 3DI6A 4LSLB 2XGQA 5LJ3Y 2AYMA 2A6OA 4X4RA 2RRBA 5K20B 3ZZTA 1FJGJ 2R4FA 3PVXA 2LCWA 3MR2A 2DGOA 3MWBA 1DRZA 5HATA 3PO5A 4J90A 4KFBA 5EHHA 3I6PA 2UV8A 3PEHA 1EP4B 3D6MB 1HR0J 1HBNA 2MZSA 2LEAA 3GILA 5E7OB 3ICLA 3TA2A 1NBEB 2IVYA 4DPTA 4HL9A 2OPRB 2Z2MA 4NEYA 3DLGA 5HVFA 4EZ6A 4ENOA 3M7VA 1VK3A 2UXDF 4ZVEA 2DNZA 3VAFA 1D09B 1ZA1B 1CJTA 3QLHA 5T14A 3W9IA 2KYZA 1ZPWX 3TX0A 1CQNA 3BN4A 3FCHA 5KFOA 4WE1B 1GT8A 2V34A 2VV5A 4L73A 2VOOA 1WF1A 2DR5A 2ZJQQ 2XEXA 3IWNC 2X7IA 4IDKA 2NXUA 5DETA 3U02A 2E5GA 3ISND 3M30A 3I0SB 2P9GA 4ZLLA 3DHWC 2R7VA 4OV1A 2DY1A 2CZVC 4NCGA 1REVB 2NXJA 2KXNB 1YZ7A 4V1Ak 2FZCB 1PILA 4IFVB 2N7CA 4DQSA 3OL8A 5F8NA 4C48A 1CJVA 5LJ5Y 4DV1F 3AD7C 1DBDA 3GFHA 1TKXB 3TVKA 5BYRA 5KOWA 1IJEB 4WPAA 2QA1A 4GKKF 2I2YA 3OXFA 3BGRA 1KOHA 2YNGA 3KK3B 1G6BA 1Y3JA 2K1RB 3CC2S 2GGPA 1HWIA 1F9FA 2W9BB 4IO9Q 4A8FA 5FLXY 3ILJA 3R5DA 4WKRA 1Q5VA 3BH6B 2KG1A 1Q0NA 4ZITA 2DNRA 4ZVRB 3TANA 2MQPA 3RBDA 5HLFB 4EK2A 2GO8A 4I4BA 3DOMA 1IXKA 1RWNB 3L3CA 4U67Q 2DHXA 3M9MB 1RTHB 5DDQC 2HHXA 1QSLA 5IWAJ 2HRYA 1Q1KA 3B6BA 2BUNA 4NZ6A 5E41A 4M5NA 4JI8F 4KJIA 4RNHA 3IXQA 4YOEA 4OYXA 4QJVA 2L48A 2CIMA 4PUOA 4C98A 4OI1A 2FHKA 1JXVA 2R8GA 2H3EB 4NPOA 4Q7AA 2E1AA 4DLEA 4KPYA 3U1NA 1FKAF 1FKOA 1WOSA 4MK8A 4TLQA 2F65A 4K2XA 5LMUJ 2AWZA 5HVGA 2FYXA 3IRXB 4OFZA 5L9NA 3A3PB 1BC6A 2FLNA 1T3NA 4WFAQ 3VAMA 4NXNJ 3A8JA 2XYGB 1FWKA 1XMOF 4WXOA 3PJWA 3QATA 4K8RA 4NLDA 3HJVA 4C3LA 4O3OA 2HWHA 3M2VB 2KT2A 2PC6A 5J2PB 5ETNA 1P9YA 5GAHI 4KGVB 4NYPA 2GHVC 4MJKA 5HQMA 2XMVA 2EFOA 3D1OA 2UUCJ 3MMCA 3R5JB 1K9MT 3M6UA 2CKWA 3HP6A 4AQYF 4DPUA 1UAWA 3RYLA 1RHJB 2KM8C 1LW0A 2LEPA 2JDJA 2BRKA 2E66A 1WI8A 1WELA 2QYGA 5LSOA 1NK5A 1GNKA 1IBKF 3UD3P 1YVFA 2VBZA 1FA0A 3D9BA 1VQ9S 3R1LA 2EKYA 1HNWJ 3W2WB 1AW0A 2MY8A 2IM1A 4X62F 3J81U 3KLEA 2KB2A 2PE8A 1UFKA 1KVJA 1YITS 1F5BA 4DI6A 4U7UD 4OMFG 2R7TA 3V4IA 2CPFA 4O3SA 1HQ2A 3JAMU 2HNDA 1RT1A 3MM7A 1S5ZA 1S9EB 1HHQA 5KFMA 2ZZMA 2DTJA 1JLQB 4URSA 5IV3A 3WIVA 1G7CB 2FHJA 3EE3A 5J1PA 4DV3F 1HKAA 1TL4A 3J7AN 3VTIA 3ISNC 2ZWOA 1ZH5A 4OHXA 3PY8A 3NS7B 1I3OB 1HWUA 3MECB 2IRUA 2VG6B 3OTEA 5A8WB 2R7UA 3NWGA 4TY8B 3T5JA 2DGTA 4F4WA 1RT4B 3VAIA 4B17A 2F3JA 5K8OA 2GCFA 2OAUA 4PABA 3TYTA 2IRXA 3OSNA 3OFEA 3NNAA 4JI3J 2V6AA 4CH0S 4IG3B 1B3TA 1P9QC 4RL1A 4O3NA 4UUWA 1F3VA 1J5EF 3G8SA 2Y1LB 3LP2B 2J7UA 5E3RA 4HEA9 2C2DA 4LRDA 2XY6A 1YRUA 3O6QA 3AXKA 5K8NA 1Q8LA 4NMXA 2DR7A 2KN4A 4JV2A 4B9SA 3DHXA 3FUYA 1Q16B 1U4BA 5IQQA 1O51A 1BY9A 4DQIA 2ZITA 2IMWP 3RW6A 4XAKA 2B7CB 1N5YB 2LDIA 1DURA 1Y7PA 3I0SA 4DR3J 2VQEJ 4YR2A 1C0TA 2Z30B 1JQGA 2LYVA 1REVA 2FC8A 4ETZA 5IXUA 4IFVA 1XK8A 2VPXB 2R8JA 2XLJA 4U96A 1U6BA 2KZMA 1H38A 4F67A 2NPIA 1TKXA 2EFGA 3HSGA 4DSLA 4FF3A 2Y1RI 1HW9A 5A0YA 1H2VZ 3HHNB 3AHPA 3EGZA 2Q43A 1RWWB 1F9HA 2LQ5A 4UOHA 5HAOA 3DU6A 3MPVA 3EJMA 3UN2A 2JC1A 1N36J 2FC9A 1N5VA 4X64J 1JX4A 2DHAA 2C3UA 2BJ9A 4KSEB 2FY1A 4FKXA 1SVDA 5HLFA 1HBUB 2V8DA 3GPAA 4QWBA 4NL5A 2BKNA 2MLZA 2ZZNA 4I6YA 1G4CA 2CFXA 1BHNA 5D15A 2CNKB 1VQPS 2KZZA 3LW5C 5B7WA 2FB0A 5DM6Q 3QFWA 2YXLA 1KOOA 4I1TA 3KYLA 3H5UA 4GC6A 1T03B 4NLQA 3VF0B 2CXEA 2FHMA 3RB6A 2DB1A 4ZP7A 3QZ7A 4A8KA 4FS2A 3CGIA 4LIWA 3GFXA 3K59A 4DSIA 2VHGA 5ETTA 4CTAB 4B9NA 3H7HB 1S0OA 3CW2C 2ZD1B 3A8IA 3IBFB 3GCWP 3BJYA 2AX0A 1PC4A 1JJ2R 1ELOA 4NLOA 3MFIA 5LOQA 2IA6A 2MHNA 4X4PA 1CS4B 4DV4F 2Z2YB 1KQFB 3NOGA 2GMJA 4RUHA 2V68A 4IOCQ 3M8PB 3UO0A 1YJUA 3BN7A 4RW6B 5B0AA 2ZJPQ 4DF8A 3OJSA 3OL7A 3R8YA 3FCVA 3KHHA 3HULA 2RD5C 3KJQB 3IM8A 1UWBB 3ZXWA 4J9LA 2W2NP 1KTVA 1TL1B 1RQ0A 3M2VA 1RABB 5CCLA 1IWAA 3T5KA 1TL7B 3FBBA 3DLHA 5CYQA 4USTA 5L1KA 2WVFA 4KIAA 3NAIA 4DR4F 3LQVA 5BR8J 2H5JB 4N8NA 3AB4B 1X4FA 2LFVA 4RU2A 3J81Y 4YB5A 4ED0A 2HNZB 3I5CA 1V6HA 1I1GA 1F6TA 4DL4A 2ZH4A 2DR9A 2RU9A 2V2VA 4DV5J 1FWPA 5CYJA 4Q2LA 2HQGA 4D3GA 1HQUA 3HCXA 2NXEA 3IRWP 2HZAA 4RO0A 1EJ7L 3GWCA 5AE3A 3HI9A 2BJ1A 8RUCA 4TN2A 3UCZP 3GONA 3ZO7A 4DFMA 2CPHA 3H90A 1U1LA 5KFDA 2XZTB 1R43A 4JI5J 1NO8A 2HK3A 1FK9B 2IDEA 1WKJA 1ZM9A 1S9EA 3C6UA 1NH8A 1VQ6S 3KMSA 1VQ5S 1FT8A 2GHPA 4N76A 3TO8A 1AUSL 1JLQA 1QAJA 2V8GA 5ETVA 3TVYA 1YK9A 2QA4S 2W2MP 4PG8A 3H2VE 4EO6A 4RBTA 1UFWA 1WDTA 4J91A 4GC7A 4I64A 1FHTA 2QX0A 1Z2LA 3PW2A 5K9FA 4KGMA 2M3DA 4B3OA 2FJAB 1GXLA 4B3TF 2RB7A 1KVKA 4TY8A 3CTRA 3PRDA 2F8MA 1U0HA 1RT4A 1RAGB 2KHDA 2ZVIA 4PWUA 4GRSA 2A10A 3PIPQ 2XG8A 3UW1A 1MU2B 3V6KA 2WB4A 3VHQA 3BYRA 3MCMA 3KOAA 4OZJA 3GIIA 5DG8A 4I7FB 1R6YA 4CQ1A 5AXLA 2L9DA 4OX9J 4RR5A 4ZVPB 2M2BA 2HWIA 5ITHA 3RBXA 2DPJA 2E1PA 4LMZA 2RH3A 4LF4J 1HWLA 2MGZA 2YX7A 2YKNB 4FF1A 2NR0A 5EN1A 3GJTB 3HLUA 1TELA 5CD4A 3DLKA 2ZC4A 2IYIA 2VPZB 4GO7X 4RW9A 2N82B 2H9ZA 1SQFA 4ELVA 1A9NB 4Q0BB 4CNZA 2G0IA 2CZ9A 5HBMB 1SH0A 3PXGa 2X1FA 2I0XA 1J2VA 1WWHA 5IC6B 1U1KA 2Q6CA 2CJBA 2GVZB 2ZC3A 3FSYA 1NHVA 5LM7E 4NOHA 4WK3A 3WX4A 1OS5A 5A2QU 3SFUA 4HHHA 1MWYA 4DV2J 4DSKA 2GAHC 1HQEB 4DPYA 1RT5B 3CCQS 3OW2R 1SL0A 1ZPVA 3MMAB 4IRKA 2W24A 5IS2A 1FXDA 5KG5A 3MURP 4V19X 2JEFA 3RR7A 3KHRA 3O5TB 1TV6A 3FGVA 3UE2A 3R3TA 1NAQA 3ZZRA 2ZH8A 4CO3A 2AX1A 1I94F 2VQFJ 2NUHA 5KFQA 3SSQA 1RDRA 3SV4A 4HACA 4R8UA 4KH1B 4ICLB 2HHQA 1ZS6A 1B0PA 1T03A 4DR6J 4AXIA 5GADI 4L3KA 2EPIA 1RCXB 1U49A 3BKTA 4C3KA 2OSQA 1IM4A 3W8GA 5KT7A 3CD6S 1LWCB 5KG4A 2Q6BA 1OY6A 1ZAXA 3H5YA 3ZTPA 2MQOA 5F9LA 2Y1IA 1SC4B 2KM8B 2XY5A 1FJCA 2V0NA 3M9OB 3K7RA 2DGVA 2EBEA 4TXSA 2NXNA 2R3VA 2WBMA 1Y00A 4C3MA 3RBZA 5A6PA 1H98A 3CO0P 4A48A 1Q7LB 3PEJA 2NSBA 3M8QB 3UDVA 3AQOA 3ZTSA 4EFAC 2B8PA 4LF5J 4PCQA 1U26A 1RKIA 5F8IA 2IPOB 4MKAA 5L38A 2HFSA 3CWJA 4RW7A 3BSAA 4WFXA 1RT6B 2UVVA 4DV6F 3H4DA 3RJMB 4UZCA 5BJRA 1XN9A 2CJKA 4ZHRB 4IUFA 5JVHQ 4B9VA 3TQEA 5L8RC 1IJFB 4Y2AA 1RHRB 2HQCA 5HMYA 2XMAA 3D3CJ 4OZ5A 4ELUA 5HSPA 4C11A 2HNZA 1RTDB 1IBMJ 3KJVB 1R0BG 2PMWA 2WSEC 5AXNA 2UU9F 2BE7D 3DU5A 5HANA 2EFNA 3H5SA 4HYKA 2VA2A 1R31A 4F0HA 2GJ2A 3OTOF 3KLVA 2B3TB 4PG4A 3MTKA 2IVMA 3OTCA 3TUPA 2I5JA 3BQ2A 4JI0J 1LWXA 2ASLA 4BWMA 4FVCA 1FDAA 4AL6A 3G6YA 4MIAA 1WEZA 1S1UB 4WP9A 2X51A 4QIVA 2YNIB 3MZIA 2CWKA 3K5PA 1FK9A 4ZKAA 3PW5A 1RI7A 1WHVA 3BF4A 4IO1A 2CQ4A 4QR2A 3MPUB 1AZSB 2AP6A 2HNYA 3EZUA 2OFGX 5KFGA 1AB8A 2E5LF 3M2RA 1UZDA 2PEHA 1PJ7A 3CCWA 1JJHA 2KTQA 2P2CB 1UPMB 2ZM6J 2ZH7A 3VAKA 2QT7A 1M90T 3TJAA 4OYWA 3PFEA 3DM2B 1TKZB 1RTJA 2RRNA 1WG5A 4CIOA 1F0XA 2FVSA 1HWKA 2VODA 4I6AA 3MD1A 1F5AA 3DOLB 3Q2SC 4TU7A 3KKFA 4HTJA 2CVIA 3MPWA 4LFCF 2DH7A 4WZMA 1MU2A 4P9SA 5I42B 3EDRB 3CPWR 4QU6A 3OD2A 4F25A 1UVNA 4LVNP 2R8IA 1PO6A 4KYZA 2HQ3A 2W8LA 2V9KA 2BKOA 1EZZB 4WFYA 4OX6A 4OLOA 5HI7A 3SSSA 4DFJA 1ZM3A 3LF0A 3I9ZA 1S9FA 5EGYA 4IRDA 1X4BA 2YKNA 2W2QP 1AA1B 1U25A 3UDLA 3HHLB 4FN5A 2W4PA 4Z37A 2HFOA 1ULRA 4JI6J 5A2QY 4HKQA 3MR6A 3EVWA 2VICA 2OEKA 4B3RF 3VGSA 1UKUA 5CQGA 1CC8A 2VBYA 3HSJA 2LECA 4JV5J 2MJUA 3DGPB 2J9CA 5GMEA 2UXCJ 3QBCA 3NG8A 2CNOB 1C4CA 4YDXA 1Y3KA 3U1LA 3L7OA 1FJ7A 1OJ4A 2B0GA 4LF6J 2MKKA 1JJ4A 2V67A 2MKHA 2OTJS 1HQEA 5EX0A 4N41A 2HGLA 1X5PA 1NJYA 2AW0A 1SC1B 4ID5B 1T9XA 1T95A 1MMLA 3P45B 4DX7A 4LFAJ 1XR6A 1XR7A 3VVTA 3PM9A 1BE4A 3MM9B 2GIQA 4QIGA 3PO4A 4X4QA 4DOZA 1EHWA 3WC0A 4K0KF 2ATCB 4ZP9A 4RKUC 1NDPA 2HW3A 4DCPB 2OLWA 4AL7A 1PBUA 2G0JA 4ICLA 4FYVB 2JFDA 1JLGB 1MMNA 4QIWD 4N47A 1R8PA 4F0MA 3K5LA 4ERDA 1WHWA 3QO9B 4JBCA 1YRXA 2F4VJ 3NNCA 2G13A 2HPUA 1VDHA 3NMAA 4DR4J 2A3JA 1YSJA 5DDOC 3CSKA 2ZJRQ 2RKIB 2F40A 1LWCA 1YJWS 2P6TA 1D1UA 3DXBA 1H72C 2FJVA 5BXIA 3ZZUA 1S0NA 3RAQA 3H8YA 2XGPA 4X66F 2XY7A 1LWEA 2AZ3A 2N7YA 4LF8J 1S1TB 2CVEA 2E1CA 4OYMA 2C2RA 2N3OA 3M8YA 5DG9A 3ETOA 4DV7J 2AJFE 3EM1A 3M8QA 3S8SA 6FD1A 1ZETA 3DRRB 2Q66A 1KKHA 2AKWB 4JI1J 3N0VA 4Y2CA 3GYXB 2CPEA 3ILOA 1VRTB 2BKPA 3KUHA 2WVDA 4DR1F 3GV8B 3OTDA 2P9CA 2FHJD 5HP1B 4YP3A 4ZPAA 2APOA 5DQGA 3GTYX 3R7NB 1D0EA 3N28A 3AA8A 1RT6A 4ZK7M 1HNIA 3EGWB 2W2OP 2ZBCA 2E1MC 1HL6A 4DLGA 2QGFB 4AD6A 2UUAJ 4K4SA 3MAHA 2DRAA 4JV0A 1WTBA 3FBFA 4KB7A 3T1HJ 3KJVA 1E6VA 4KQZA 3KWMA 1YI2S 4J37A 4RNNA 2I1RA 2O3DA 2QE5A 3PV8A 3E51A 3EVOA 2FPHX 3MCOA 2ALZA 5HMXA 5DG7A 2J9DA 2HWTA 4G65A 1S1UA 5ETMA 5ETKA 5B0EA 2BRLA 2VJUA 2YNIA 3BDPA 3ELHA 2J5AA 2VJVA 3NGRA 4R5PB 2BOPA 4CDIA 2XO6A 3MMBB 1AZSA 1L3VA 2EWHA 1M5SA 2LQ9A 4U7UK 5EDWA 3TZZA 2A6MA 4NCAA 4O23A 3HSZA 3HO1A 2PT0A 1D8ZA 1NPPA 4AE5A 4CLYA 3DM2A 4PWWA 4K7QA 1JKHA 3H2UB 1VC0A 1NPRA 4X4VA 2I9SA 4PXCA 4ATNA 3ZFVA 2KVIA 5DLFA 2AGOA 4UW2A 2XC9A 4MAKA 3EXCX 5I42A 1HNXJ 1YG0A 4DU7A 3K89A 2RMLA 1U48A 2FLPA 4IQXA 3BYPA 4C8YA 3TNVA 2GJIA 3TZWA 2J7KA 3MAAB 3O8WA 4XPEA 3GZ7A 2AEJA 3B54A 3NS6A 3CDWA 4GVBB 2J0WA 3BO2A 4WTYA 3I55S 2CG8A 2HIQA 1BLUA 2DXFA 2W7PA 2Q79A 2IBKA 3T19A 2B9WA 2H4WB 3FRYA 4JI7F 2RT3A 3OHBA 3TZYA 2OELA 1N52B 4L72B 3PYFA 3A4TA 2Y8WA 3C14B 4QR0A 3MEEB 2YWFA 5I3QA 4U95A 3UR0A 4OX8A 5DRKA 4LF7J 5H9EJ 3OR1B 3DGVA 4C6AA 4ZVHA 4ZVFA 3G87A 2CQHA 1M1GA 3DGPA 1DTQB 2BEFA 4HDGA 2P6SA 2VFTA 2J0QD 3NY0A 2QYCA 5THWA 3PIOQ 5GAEU 4TYAA 1VIXA 1OPIA 1DLOA 2QL5B 1QE1B 4ECRA 2YKMB 5C25B 3G6ES 5HQLA 1FX2A 4ID5A 1FO1A 2A1BA 3CNQP 2O67A 3FFIA 3J81j 4NE9C 2CYYA 3MM9A 4TU8A 1S1VA 4OJ3A 1FI4A 4ZLPA 3LP0A 4IOAQ 4ZVTB 3JXOA 3HVTA 4CLZA 2HLTA 2A0FB 2E9TA 2BJDA 1V5VA 2Y1JA 4A8YA 1RAHB 1IKVB 2WBRA 3RBEA 3M8ZA 2UVRA 1OY8A 4NLSA 2OP5A 4OZ1A 3DYAB 4Y65A 2W01A 2DH8A 3DC2A 4KGZB 4DR7F 4DR5J 2PI5A 2CWXA 1GX6A 1R3NA 3NKYA 1JIHA 3FEYB 1XR5A 2N4CA 2M52A 5IV4A 1S59A 2F9JA 2DNYA 1TVRB 2CQ0A 2DO0A 1PAUB 3ZZPA 1N54B 1JWWA 1P8GA 1JXLA 2RJZA 3CEDA 1PJ5A 1TL3A 2OSRA 1TKDA 4IR1A 3TA0A 4NYOA 2YPZA 3BKUA 3LTOA 4ETXA 3V81B 1WOPA 4TQSA 3W3SA 2CDRB 4NWBA 3SZ2A 5F8JA 1S1TA 3NCPA 1P1LA 3T1AA 1SV5B 1QSSA 4WF9Q 1NNDA 2CQDA 4H4MB 2AJ4A 2BW7A 2U2FA 3DLBA 4XTTA 3D7SB 1MLAA 1QJHA 1WACA 4ER8A 3M6WA 1GAOA 4EBEA 5KFNA 2BDPA 2OPPA 2O5DA 4ZPCA 4JOUA 4ZA1A 1S12A 4YQWA 2LQJA 3QQCD 2MKYA 3POTA 3W66A 1RT7B 3KLHB 1ZOTA 2R9LA 2JLEA 2VDHA 3VR1A 1HYSB 4RBVA 4IH5A 1N34J 4AXJA 2LU2A 2GW8A 4WJBA 1NM2A 1VYAA 5FIIA 1Q8BA 3FBEA 2D3ZA 1HBMB 1RT3B 5KG1A 2W4CA 3R2CJ 2QFJA 2DR6A 4EEYA 1WOOA 3PJXA 3K0JA 1O6XA 1SC3B 4HH0A 3T1YF 2CJYB 2KYXA 2FJWA 1KFSA 1J27A 4NZ7A 5EWFA 1WG4A 2WTFA 1UL3A 1JLBB 4MK7A 3AY0A 2ZBQA 1U1PA 4Y00A 2IMOA 5A6WA 2R7RA 4A8WA 4NXMJ 4DQPA 1RAAB 1NK6A 3PACA 2ZBPA 2RS8A 2V8PA 3M8WA 2EEYA 4CO0A 2HHHJ 5KT5A 3PNIA 3MD3A 2AGPA 4R5PA 5A8KA 3IR5B 2CJQA 3MMBA 5DGAA 3HJFA 2RU3A 1HWJA 3Q24A 3H42A 2Y0BB 4ZJQA 4QPTA 2DPIA 5E5NA 1JXEA 3SYZA 4XK8C 3UDCA 2AJQA 4USHA 4CLTA 3D3BJ 1JJCB 1DQAA 2XO7A 2OMLA 4RLEA 2YTCA 2JWNA 2PD1A 4M5GA 5JVGQ 3UWTA 3G8QA 3P5BP 1NK8A 2ASJA 2XS7A 2EG1A 1TFWA 1FKPB 3MCNA 4ED3A 4WZQA 3V5RA 1K8AT 1KD1T 2B9XA 2ZDOA 3GJQB 3RB4A 3BGOP 1LXNA 3IM9A 4EUVA 3DXSX 1L3TA 3Q8QB 4NA1A 2QMXA 2FVRA 3CMES 2R2SA 1IWGA 5L39A 3WZ0A 3NL0A 4HR2A 1RBLA 3M05A 5E33A 5F8MA 3C6TA 1FVSA 1JK9B 1WKKA 4FYYB 1TUGB 3BSNA 4X4TA 2RS2A 4PRFA 4MMOA 5T41A 2R7SA 3ADAC 4GVBA 3WDOA 5DDPC 2RILA 1HLWA 1PYSB 1FXRA 5B0DA 2RIJA 4F3QA 3J7Z5 4NZ0A 1Z4UA 2JVOA 4AT1B 3LANA 3HT3A 4XPCA 1CC7A 3THTA 3EX7B 1ZTWA 1I6JA 4CH1A 2LXIA 2VF3A 5IM0B 4L74A 3R9LA 4ZCKA 3MR3A 4NA2A 4A46A 4PXEA 3JQKA 4DFKA 3CT9A 2ACYA 3DI6B 3Q89A 2W8KA 4PG6A 1UTAA 3CCLS 1Y0HA 4KFBB 1D3WA 1M1HA 3VAGA 1KWMA 3E8OA 1N32J 3AOAA 2YKMA 1UEKA 3RU0A 5K14A 3I31A 4M5DA 1TK5A 4ZVOB 2F5GA 2W9CB 4KT0C 3BKFA 3DLGB 1WI6A 4M94A 3C2PA 3TEGA 2BQUA 1NU4A 3NGKA 3N5FA 1YWXA 5DZ7A 1Q53A 4KHPJ 1IBCB 1RLCL 2V2ZA 1CJTB 1WC3A 2ZVSA 2DEJA 1VQ4S 1F2HA 4C9DA 2R2TA 4AFFA 4CLKA 2ZE2A 2X1BA 2BQRA 4Z7CA 4DJBA 3DYAA 2E7XA 4C0BA 4CLUA 3QWUA 3RUBL 2HBRB 5FDLB 1ZTTA 2GJFA 4X4OA 4P2XA 2BX6A 2CJXB 3DKDA 2OPQA 3A3NB 3LP1B 1RBOB 3HDSA 3M30B 4MT1A 1PYTA 2ZH2A 1JLFA 3IFEA 4QU7A 2DKOB 4ZJOA 3V6JA 4DFPA 1NJIT
chains in the Genus database with same CATH topology
3I9V9 3EXYA 3DLLQ 1OSCA 2LXFA 2FLOA 3BR8A 4D3GA 2KKHA 3NBPA 2XS2A 4XDCA 1HQUA 1SQEA 3GE9A 3IRWP 5AE1A 3DLEB 1TAQA 1VIOA 5C24A 1SV5A 4HT5A 1N48A 3GWCA 3S1TA 2VQFF 3MHYA 5AE3A 1Z1ZA 3BREA 3HI9A 2B4UA 2YNGB 4H4MA 4TN2A 2R8HA 3UCZP 4FZVA 3FSIA 4DL3A 4C8OA 4AUKA 5KFEA 4DL2A 3BB5A 2VUGA 4DFMA 3RRHA 2CPHA 2KFNA 2GV1A 3I4HX 2GGPB 1BQMA 3D28A 1U1LA 5KFDA 1R43A 2O1PA 1U6ZA 1ROFA 3DRPA 1NO8A 4OJHA 4JI2F 3GR1A 4PR6A 5AXKA 4C2MA 1FK9B 2V94A 2ATLA 3QMQA 1S72S 3LUYA 3IBWA 3QJPA 2AYBA 4M63A 4KV8A 1ZM9A 4NLGA 1S9EA 3G71S 1JLGA 3C6UA 3TAMA 1NH8A 3DLJA 2XHWA 1VC6A 4AL5A 2OD6A 1VQ6S 3KMSA 1VQ5S 4DR6F 3GIJA 3CO9A 3QWPA 2AD9A 2CQ2A 1FT8A 2JFKA 2GHPA 4IOBA 2ROEA 4FXWA 4N76A 2H5EA 4H4KA 3TO8A 2F7VA 2YWGA 2KT3A 1JLQA 2QSFA 3HMJG 1QAJA 2YVSA 2V8GA 3QO9A 2L08A 2QLXA 3TVYA 1HYSA 2PDAA 4RU9A 1M5KC 5LSRA 2QA4S 2C2EA 2G0CA 4ZPVR 4PG8A 1HI1A 1KNZA 3H2VE 2LA4A 3HHEA 4EO6A 5B09A 4RBTA 2IVFB 4DBQA 1UFWA 4F50A 1SKSA 1UA0A 1XERA 1K1SA 4Y0FA 4NCBA 4GC7A 2LVWA 2R7WA 4I64A 1FHTA 3NGDA 4PWDA 2V8VA 1TAUA 3OSPA 1Z2LA 5EWGA 3PW2A 3D0HE 5K9FA 2R7QA 2R7XA 3SCLE 1N88A 3OLAA 1HBMA 1V3SA 2IJFA 4KGMA 3VALA 1RT3A 3V6DA 2M3DA 2NUUG 4B3OA 1X4HA 2LKZA 4I0WA 2RKIA 2M4MA 4PUOB 1HPZA 1ZM4A 2UVWA 2FTRA 2E5HA 2GO9A 2PMHA 2FJAB 2X3GA 3DMJA 3TA1A 1GXLA 4B3TF 2RB7A 4PQUA 3T9NA 1IR0A 2MKJA 3CTRA 4TY8A 3PRDA 2F8MA 1XC9A 1RT4A 2LMIA 4G1IA 2KHDA 2BANA 5M2RA 1RA6A 2XCPA 3EGNA 2D41A 4MKBA 2VFSA 4PWUA 3IA0A 5CD4H 2A10A 3PIPQ 2XG8A 1DLOB 3UW1A 1MU2B 3P96A 3V6KA 1H3DA 2WB4A 3UNGC 4QWCA 3PZPA 3CJKB 1NK9A 3E01A 5E0OA 3B4DA 1SB6A 4LF5F 2LU1A 1YJTA 2ZOGA 1S1WA 4CNYA 3FMBA 4I69A 2JJ4D 1WF2A 3KOAA 3DRRA 1T94A 2YQ3A 4OZJA 3GIIA 1J5OB 5DG8A 4C4WA 4DR2F 5DS7A 1SUQA 4HT7A 4I7FB 4KKOA 1WG1A 4QW9A 4O4GA 3FFIB 5I3PA 1R6YA 4CQ1A 5C5JA 3UCUP 5AXLA 2L9DA 1S6QB 2B7BB 4ED7A 2ZHOA 4IR9A 1ZYQA 4QOTA 2HS0A 1S1VB 5HMWA 1VRTA 3SXLA 1QY7A 2KRBA 3LP0B 4TNOA 2HMIA 3T6JA 5D6GA 5HP1A 4B3MF 2M2BA 2HWIA 1NKEA 1GQEA 3HVTB 4R0JA 2L9NA 3OFFA 3HHDA 2B4OA 5ITHA 2DPJA 4LMZA 2ZOFA 2RH3A 1HWLA 5DLGA 1OPZA 3LPYA 4ES1A 1S48A 4CI0B 4YB7A 2ZDPA 3QJLA 2X1GA 3J7A1 1ZAVA 3IO1A 3OXGA 2MGZA 2YX7A