3HVWA

Crystal structure of the ggdef domain of the pa2567 protein from pseudomonas aeruginosa, northeast structural genomics consortium target par365c
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
159
structure length
159
Chain Sequence
YNRLRLQEDVSLRLQRDGALTVIAADLLPLALLNTIIRTLGYPFSNDLMLEARDRIRAELPDFTLYKISPTRFGLLLPRQQQEETESVCLRLLRAFESPVVCRGIPIKANVGLGVLPLADDTLDGDQDWLRLVVSAADDARDRGVGWARYNPPLDQAQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Lyase
molecule keywords Diguanylate-cyclase (DGC)
publication title Northeast Structural Genomics Consortium Target PaR365C
rcsb
source organism Pseudomonas aeruginosa
total genus 49
structure length 159
sequence length 159
ec nomenclature
pdb deposition date 2009-06-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3hvwA00
1FK9A 1RAJA 3MEGB 3MEEB 3KLVA 1XR6A 2RDIA 1LWEB 4EEYA 4RNOA 4KKOB 4K4VA 2R2SA 3KLIB 4KV8B 4YR0A 2BR0A 4WFYA 5EUHA 4FBTA 5KFXA 2HNYB 1TL1A 3KK2B 1S9EB 5C42B 2HNZB 4MFBA 1JIHA 3ITHB 2R2RA 4NLRA 4YQWA 2O5DA 3MTKA 2FJVA 2AX0A 3KLGB 2IMWP 2B6AA 4M95A 2IM1A 3FSIA 2QE5A 4IH7A 4Y3CA 1VRTA 1RYRA 2D7SA 4H4MA 4O4GB 3TVKA 5KFEA 5C5JA 2C2RA 1WNEA 1IKXB 4MIBA 4ZPAA 4FBUA 3DMJA 3HVTB 3PJWA 1RTHB 2JEFA 3LP1A 3NBPA 4TN2A 3RAQA 4JV0A 1RTDB 4RW7A 2FLNA 3N6NA 5J2QB 4ECUA 2JEJA 4ICLA 4K50A 5F9NA 1N6QA 3G6YA 4H54A 2WONA 1TKTB 4NLQA 5DQHA 4RU9A 4LSNA 5KFFA 4B3OB 4QWCA 1HQUA 1HNVA 4RNNA 5KG3A 1S9GB 4K4SA 5KFNA 4I2PB 4ECQA 1JLQB 4ZPBA 2ASDA 3LP2B 4DEZA 5F8IA 3HVAA 2YKMA 4TLRA 3JSMB 1RTIA 2OPSB 3CJ3A 4IDKA 4J9NA 1TV6B 3OL9A 1LWFB 3BREA 4URSA 1JLBA 2BE2B 2F8EX 2W8LA 4DL6A 1IM4A 1JLGA 4KB7A 2AGOA 4K4ZA 2IAJB 1KLMB 4QWEA 5FDLB 3OLBA 1T05B 1HQEA 1SH0A 1MMLA 5HBMA 1FKOB 1TKXA 4RNFA 3I0RB 5I42A 3MECA 2W9BB 2HWHA 1U09A 3DRRB 4LSLB 5KFIA 3UR0A 5KFWA 3T19A 3BGRA 4WZQA 5CYMB 3SFGA 2R8JA 1IKVB 1JKHB 4H4OA 1EETA 2FVQA 5HLFA 4EBDA 3I0SB 1S6QA 1VRUA 4Q0BA 1RT2B 2OPQB 4NYZA 5KFGA 3CWJA 3DOKA 4YR3A 1LW0B 1T94A 1QE1A 2FJXA 3IGNA 2D41A 3BSOA 4DL2A 1LW2A 3H59A 4QPXA 1S49A 4IRKA 4NCGB 1SH2A 5F8MA 4ED2A 4WE1A 3V4IB 2XGPA 3BSCA 5J1EB 4EYHB 2IJNA 1SH3A 4DG1A 4Q43A 4EBCA 4K4TA 1IKYB 5KFUA 1TKZA 3V6HA 3PZPA 1D1UA 4Y2CA 1S1UB 2R8GA 5DG8A 5KFVA 2RKIA 3GV8B 3IS9B 1C0TA 1DLOA 1MU2B 1SV5B 3GV7B 1BQMB 4EYIB 4ZHRA 1FK9B 2GIRA 5DLGA 4ED1A 4ED0A 4Q8FA 4KAIA 1EP4B 4R8UA 4O3RA 5CYQA 4PUOA 3H2LA 3EPIA 4PWDA 1K1QA 3LAMA 3H98A 3PR4A 4IR1A 2R8KA 5KFRA 4ZVGA 3DOLA 3H40A 4ECZA 1RT7A 2WHOA 2ZE2A 5C24A 2UVVA 2AX1A 1JLEA 3LALA 5KFSA 2XC9A 2VA2A 1RT5A 2JC0A 3C6UA 2V4RA 2C2EA 1RT6A 4O44A 2HNDA 1TL1B 1T03A 4WZMA 4MFBB 3M8PA 4URGA 2UUWA 2UUTA 2W9CA 3DRSA 4MKAA 4NLXA 3MR5A 4ECYA 2VA3A 1JLCA 2B6AB 3KK3A 3H5XA 1S48A 2B43A 5DGBA 3V6DA 4J9KA 4KBIA 1VRTB 3DI6B 4O4RA 4GC6A 4H4MB 5KG2A 2ZD1A 3V6JA 2V9WA 1S4FA 1OS5A 3FRZA 4EO6A 4RW4A 3I5CA 4IFVA 3DMJB 4J9RA 5DQIA 4J9QA 5C25A 3LP1B 3NBPB 4RW7B 2V4QA 2DPIA 4QW9A 2C28A 1YVFA 5HP1A 4ICLB 1N6QB 1QAIA 1C0UA 2IM0A 2WONB 3E51A 4QW8A 5F9LA 3G6XA 4LSNB 1HQUB 1HNVB 3Q8RB 2JLEA 3HKWA 3LP0A 4O3NA 4Q45A 2R2UA 4DL5A 4DL4A 4K4YA 2YNIA 2YKMB 4LQ3A 5EDWA 1RTIB 2HWIA 4IDKB 4O3PA 3GV5B 2I1RA 4Q44A 1JLBB 3D5MA 2UVWA 1S9FA 3GYNA 2YNFA 2V0NA 5DQGA 2UVUA 1HQEB 2B5JA 1JLFA 5HBMB 4TY8A 4ZVFA 4YP3A 1TL3A 3JYTA 1TKXB 3BQ1A 5I42B 1DTTB 2BRLA 3MECB 3V6KA 3QYYA 2YKNA 5KT4A 3BGRB 5KFCA 4RW9A 1EETB 5HLFB 2HAIA 3QIPA 1S6QB 1VRUB 3DLGA 3DLKA 4Q0BB 5KG4A 2WOMB 3DOKB 4O3OA 3BSNA 2BQUA 2DPJA 1QE1B 1DTQA 3QGHA 2AGPA 3RB3A 4O3SA 4ECXA 3IG1A 1RA6A 3OL8A 1LW2B 1J5OA 3BR9A 4KHMA 4QWAA 1FKPA 2FVPA 2IJFA 2CJQA 3M8QA 1S1XA 4WE1B 3MR3A 2IC3A 3DLEA 1RA7A 4DG1B 4J9MA 1REVA 2VG6A 3DYAA 1TKZB 3PW0A 3V81A 4WXOA 3PHEA 4KFBA 3QZ8A 2RKIB 3EZUA 1RDRA 1C0TB 1DLOB 2ILZA 4XPCA 4F4YA 4ZHRB 5KFYA 3KHLA 4KSEB 4ID5A 4R8UB 3NGDA 3IN5A 1D0EA 4PUOB 5KG0A 5J2PA 4ZP8A 4PWDB 3CO9A 1RT7B 2ZE2B 4MK8A 5C24B 4DL3A 1RYSA 1JLEB 2UVRA 3E01A 1C1BA 4ZP7A 1RT5B 4ZPDA 3C6UB 2XGQA 1ZETA 1RT6B 4O44B 5D3GA 2HNDB 4LQ9A 1T03B 1R0AA 1LWCA 3M8PB 4I7FA 2W9CB 3DRSB 3CJ4A 3FFIA 4R5PA 1JLCB 2RF2A 3KK3B 3M9OB 4TYAA 5KFHA 3N6LA 1TVRA 3MFIA 3KHGA 4TYBA 3V6DB 1S97A 5KFZA 2GIQA 4GC7A 2HNZA 4R0EA 4ZMMA 2ZD1B 2FLPA 4PQUA 4KO0A 4DL7A 3G86A 4RW4B 4IFVB 3GILA 2R8IA 1S1VA 4IOBA 2YNGA 5C25B 3CJ2A 1N48A 3RAXA 5KFPA 5F8JA 2XCAA 1QAJA 5HP1B 4ZVHA 2WCXA 4MH8A 5KG7A 1C0UB 3CJ5A 4J9SA 3KJVA 5DLFA 1T3NA 3KK1A 2BANA 5F8LA 4NRUA 1S1TA 5KT5A 4J9OA 2IM3A 4RW8A 5J2NA 3PW4A 1JXLA 2IBKA 2FVCA 2YNIB 1S6PA 2E9RX 3CDWA 3M9MB 3UQSA 4NZ0A 3QO9A 3UDLA 5DG7A 4IH5A 2YNFB 3M9NB 3KLHA 1GX6A 2I5JA 5EWGA 4IG0A 4XPEA 3FQKA 1I6JA 3RB6A 4IH6A 3QGGA 3KLEA 3PW2A 4OL8A 2B5JB 1JLFB 4TY8B 1TL3B 2OPRA 1TQLA 2YKNB 4ZP9A 3H5SA 3ICLA 4WXWA 4U7CA 4QWDA 2ALZA 3QLHA 4RW9B 4RUAA 3OLAA 3KMQA 2IM2A 5J2MA 2FLLA 4RW6A 3Q8PB 3QIPB 1CSJA 2VG5A 4NLOA 4YR2A 3ISNC 3N6MA 2D3ZA 3DLGB 3DLKB 4F4ZA 3DM2A 3KNAA 1N56A 4NRTA 5L1KA 2ASLA 2XI3A 3IG1B 2W9AA 4NLSA 4NLWA 5HROA 1J5OB 1IKVA 1JKHA 3NMAA 2FJWA 3QIDA 1FKPB 3M8QB 1HMVA 1S1XB 2FVRA 4IR9A 1IKWA 3H5UA 3HHKA 1N4LA 3LAKA 2IC3B 3DLEB 4G1QA 1W25A 1XR7A 2VG6B 3DYAB 4NLYA 3V81B 2W7OA 3BJYA 1S0NA 5KT2A 2OPPA 1JLGB 3TAMA 3RB0A 1JLAA 1Z4UA 3SFUA 2AGQA 4K4WA 5F8HA 4WYWA 5KFQA 5JXSA 1HNIA 2IA6A 4ID5B 3TQ1A 1QUVA 1RTJA 5J2PB 3BQ2A 2CKWA 3BSAA 3RB4A 5KT7A 2WTFA 5KT3A 5I3UA 2ASJA 1S0OA 4IG3A 1SUQA 3E01B 1C1BB 3NAHA 4H4OB 5D3GB 2J6SA 2VG7A 1EP4A 1HYSA 1R0AB 1LWCB 4I7FB 3C6TA 3MFHA 2WK4A 5KFBA 1UWBA 4EO8A 1NNDA 2EC0A 2WRMA 3FFIB 2QV6A 5DGAA 4R5PB 1BQNA 3H4BA 2RF2B 5KG5A 3DDKA 1HPZA 5K14A 1RT3A 1TVRB 4QWBA 3OL6A 5L1LA 4ECTA 4FS1A 2XWYA 1JX4A 4PQUB 4KO0B 2HMIA 4F4WA 1C1CA 4TY9A 4RNHA 1K1SA 1S1VB 3OSNA 4G3IA 1KHVA 1N5YA 2YNGB 3KMSA 4O3QA 3FDSA 5KG1A 3PW5A 2J6UA 4J9LA 4F4XA 2JEIA 3DI6A 2C2DA 4NLTA 1RT4A 3OHBA 3KLFA 3KJVB 1ZTTA 3KK1B 2BANB 4Y2AA 4ZPCA 5F8GA 3DRPA 1S1WA 1S1TB 1RT1A 4RW8B 4I2QA 5J2NB 5KFAA 2YNHA 3LANA 5KFLA 4NLGA 3IRXA 5CYQB 1S6PB 3MEDA 4EBEA 1NHVA 4IFYA 3IGVA 3DOLB 2JC1A 4JUZA 3GIIA 2W7PA 3QO9B 3H4DA 3ISND 2J6TA 4JV2A 3FQLA 3KLHB 3MEGA 3MEEA 4MK7A 2I5JB 4IG0B 3T5JA 3NKYA 1LWEA 2XCPA 3KLEB 4IRCA 4NLDA 2OPRB 3MR2A 4WFZA 5KFTA 2ATLA 4ECRA 4K4UA 1GX5A 1NHUA 4KKOA 4WFXA 3T5HA 2JEGA 3KLIA 1XR5A 4KV8A 3QLHB 3OHAA 4ECSA 4ED8A 5J2MB 5L1JA 2HNYA 4J9PA 4RW6B 3KK2A 1S9EA 2VG5B 5C42A 4ED7A 3ITHA 3SI8A 3DM2B 1DTTA 3GIMA 4JV1A 3KLGA 3OSPA 2BQRA 4KE5A 3KHHA 3RBDA 4IKAA 5HROB 5F8NA 4O4GA 5L1IA 3I5BA 4RNMA 3Q8SB 3T5KA 1IKXA 3QZ7A 4NLVA 2WOMA 1HMVB 5KG6A 3HVTA 5L9XA 3Q8QB 3GIJA 1IKWB 1RTHA 1S10A 2R2TA 3GIKA 3LP0B 4FS2A 3PVXA 1TP7A 4KHRA 3UPFA 1RTDA 4M94A 4G1QB 5J2QA 2E9TA 1BQMA 2AWZA 3PW7A 1TKTA 5DG9A 1S0MA 4B3OA 4HYKA 2BRKA 2ILYA 4MKBA 4URQU 2OPPB 3CJ0A 3TAMB 1JLAB 1S9GA 3T1AA 4I2PA 5KFMA 1JLQA 2RDJA 3NL0A 1HNIB 1HARA 1C2PA 3LP2A 3JYTB 2C22A 4TQSA 4IRDA 4HKQA 2FVSA 3G6VA 4IQXA 1RTJB 3JSMA 2OPSA 1TV6A 1LWFA 2BE2A 4Y34A 3MR6A 5I3UB 2AQ4A 4IG3B 2IAJA 1KLMA 1SUQB 3I5AA 5FDLA 3KOAA 2VG7B 3NAIA 3HVWA 3QGIA 4K4XA 1T05A 1HYSB 1FKOA 3PJXA 3C6TB 3I0RA 1ZTWA 3BQ0A 1UWBB 3MF5A 4YMEA 1DTQB 3DRRA 4LSLA 2W9BA 3EPGA 2AU0A 3H5YA 5EWFA 1BQNB 1HPZB 5CYMA 5K14B 1RT3B 4RZRA 4ECVA 4TQRA 3VQSA 3I0SA 4NLPA 5KFKA 1RT2A 2OPQA 5KFJA 4F50A 2OH2A 3RBEA 1LW0A 2HMIB 3CDUA 1C1CB 4U6PA 1KHWA 2GC8A 2XI2A 2E9ZA 2W8KA 1N5YB 3GQCA 1REVB 4ECWA 4NLUA 3KHRA 4ED3A 3KLFB 1RT4B 5EWEA 4NCGA 2BQ3A 4KFBB 4WYLA 4X2BA 2WB4A 3V4IA 4TXSA 5T14A 4Q8EA 3DRPB 1S1WB 5J1EA 3PR5B 4XO0A 1RT1B 2R8HA 4I2QB 3D28A 2YNHB 3T5LA 4MK9A 3IRXB 4ZP6A 5KFOA 5KFDA 3CIZA 1IKYA 5KT6A 3MEDB 4MIAA 3CVKA 5JUMA 1S1UA 2ZKUA 4IFYB 4RUCA 3OL7A 3IS9A 3CDEA 1MU2A 1SV5A 4ZVEA 2D3UA 4ED6A
chains in the Genus database with same CATH superfamily
1L3TA 2J5AA 3K59A 3PHTA 1V6HA 4X64F 2XSJA 2J9DA 2R2SA 3KLIB 2C3YA 1TL1A 3THPA 3U1MA 3HJFA 4FXVA 2FJVA 2B6AA 3IFEA 2EXUA 3TVKA 5KFEA 2QX0A 3HVTB 1MROB 3NBPA 2KHDA 2N3OA 4K50A 2Y0SD 3L7UA 5D77A 2GVZA 2HK3A 4JV5F 1QAXA 4DEZA 4TLRA 2C42A 1KD1T 2XWXA 2DR8A 4WIQA 1T05B 1HQEA 3IMQJ 2HFSA 2BJ8A 1UMJA 1YK9A 1FRKA 1SC6A 1YLXA 5HI7A 4I0WA 1V3RA 2PMWA 4CO1A 4OHZA 4LR7A 1NDCA 3OD2A 1SL0A 3PIOQ 4NCGB 4HH1A 3I82A 2DNGA 1SKWA 4N5SA 3J7AN 1PG5B 1HNZF 4X4VA 3CJRA 2AEJA 3BGUA 2JRSA 3GPAA 2X3GA 3GV7B 3OFHA 2AHOB 4ED0A 3EMTA 1NK6A 3H40A 4X4RA 2AX1A 5KFSA 4O23A 1NRKA 1RT6A 4WZMA 1NBEB 2KH9A 1IR1A 1HFEL 2JJ4D 1QY7A 5HANA 4IOCQ 4C3KA 5CCMA 3L7PA 1S4FA 4ED5A 5AXKA 3M6XA 2C28A 2CPYA 4YOEA 4CO2A 1CBKA 4LQ3A 1Q8BA 1KQSR 2JOQA 1WSVA 2RAQA 4HH0A 3D4JA 3QYYA 2R9LA 1T95A 2I38A 2HHVA 1R3NA 5J1PA 2CQ1A 3CD5A 1RA6A 2AYEA 5GAEU 2J76E 2FVPA 3VZHA 3I96A 5AE1A 2VG6A 3V81A 4J9VA 3QZ8A 1IBKF 3C2PA 4JBCA 1O5JA 4M5DB 3CMAS 5MAOA 4ETXA 1R0AA 4I7FA 2W9CB 4R5PA 3JQKA 3OR1B 3MM5A 1W2BR 2HNZA 2ZD1B 2FLPA 4X65J 2FPHX 2AP6A 5DM6Q 2YWKA 4ZOSA 4ZVHA 2WCXA 4EGLA 3VTIA 2BANA 2RU9A 1S1TA 1JXLA 2DHHA 4GO5X 4ZVUB 3M9MB 2CJ9A 4NE9C 3M9NB 1Z1ZA 5EWGA 2MZRA 4OZ1A 3P5TL 4JI6J 4ES2A 4ZP9A 4F3MA 1I94J 1PBUA 2YWEA 2D3ZA 3GJQB 2BJEA 3AOCA 4NLSA 2ZOFA 1FKPB 1ZAXA 2NXUA 5ETPA 1GXTA 1YDLA 2VBYA 4NYPA 1N33F 2KTQA 4NLYA 1QDUB 4PG4A 2QLFB 3AODA 2ABYA 4UZBA 1OY6A 1K73T 1HWUA 1R6VA 5DDOC 5GVQA 1KTQA 2HVHA 5KT7A 2WTFA 3WZ0A 2E5GA 3U27A 1F5AA 4F04B 1HNXJ 2J0QD 1BQNA 4ANDA 2GQQA 3SXLA 2XWYA 3MM7B 4C8KA 1BGXT 2VPWB 3O6QA 3FBBA 3KMSA 1SPBP 2DGUA 5FD1A 2XO6A 4F0MA 5D15A 3KJVB 1HBOB 4F3QA 2W25A 4RW8B 3K17A 3LANA 3NS5A 4CO4A 4IFYA 3ZNJ1 3J7YU 2CWXA 3FQLA 3KLHB 4QR0A 1PBAA 3T5JA 4ILRA 4NLDA 2UXCJ 5KFTA 1UA0A 4KV8A 3W7BA 5J2MB 2HRYA 1S4EA 2EFPA 1DTTA 4DX8H 2EPIA 2BQRA 2IVFB 1R0CB 4ZLJA 4NX9A 4DBQA 1RTHA 5DZ6A 3RR8A 1VQYA 3CJKB 1N54B 1QAYA 1TKTA 1Y5NB 4MKBA 1XEZA 4A47A 3VR1A 4I2PA 4DR5J 2Q66A 2YQ0A 2M8DB 4M5HA 5BYRA 4N47A 1YX2A 3KOAA 3BPDA 4OX8A 4KC5A 2W9BA 2MKCA 3UN3A 1DJ0A 3M2RB 2ZBQA 1SI9A 4DUYJ 4BWJA 3BEGB 2O1PA 3P6YC 3MCNA 3TX8A 3A3NB 4N7TA 3W63A 1T9WA 1PIEA 4JI2F 4B3RJ 2FLOA 4DCJB 1GEHA 4QR2A 1OJ4A 4DV4J 3NNHA 3A13A 4Q2MA 2CDRB 4C0BA 2VPYB 2ZKTA 1NLKL 1U1PA 4JYAJ 3NG8A 2MLXA 2PIIA 3PIPQ 3NS6A 5C5JA 4MIBA 1SL2A 4LFBJ 3G6YA 4QYZK 2NXEA 2WONA 1AUDA 1B3TA 1HQUA 5KFNA 1G1XA 2YVSA 4K4ZA 3SCIE 1KLMB 4QIWD 1F9FA 2HQDA 3BKTA 3W9HA 2CJXB 3BGRA 1JKHB 4NYZA 1WHYA 2DO4A 2D41A 1LW2A 4ID8A 2A6OA 2QGFB 4I69A 1PYTA 2B9YA 1RU2A 4DV7F 1RLDA 4K4TA 1MU2B 4R25A 4A8SA 3MZIA 1N5TA 2FJAB 2XSJB 3HFZB 2JZ5A 3TZYA 1LFPA 2VA2A 2XC9A 4OYZA 1TL1B 4OJGA 1P9YA 4OI0A 2MQMA 2ADBA 1XMBA 2B6AB 2F1FA 5A0YA 3BM7A 3V6JA 3EVWA 2CNNB 3NBPB 2H5JB 3VAGA 2CJKA 2GVZB 1RAGB 2L41A 4RX6A 3TP2A 2YKPA 4J91A 3TUPA 3Q2SC 1NJYA 4LR8A 3MCMA 1HQEB 2V2KA 3V6KA 1ZM9A 5KT4A 1FERA 1Q78A 4OHXA 1UKUA 4OYXA 3IG1A 5MLCV 1IBMF 4ER8A 3Q8VA 3DLEA 4N8NA 2M52A 3HD2A 3EZUA 2V34A 1V3SA 1F9EB 3CTRA 1HR0J 2NYIA 4KY3A 2ASYA 2DISA 1R8CA 4AE5A 1XNRF 5GMKa 2QSWA 2BKPA 1RT6B 1VBXA 4B3SF 1VQKS 3EJMA 2KYZA 2QSFA 3M9OB 4TYAA 1R89A 5KFZA 2HHHF 4ZMMA 2AD9A 3EGZA 5FLXY 2CJYB 1VBYA 4C8NA 2GCFA 5T41A 2XMKA 5KG7A 1U48A 1Q53A 3EGWB 1J5EJ 3JTNA 1NK9A 4PWUA 1VGYA 3PW4A 2CIMA 4NXNF 2AZ3A 1Y00A 5K8PA 1WORA 5THWA 3VAKA 4BC7A 2NREA 2KYXA 1O0PA 4WXWA 3WIVA 1K0VA 4RUAA 4RW6A 1X31C 2Z30B 2DHAA 4C4WA 2FY1A 1GTEA 2K7KA 1CQNA 2DNZA 2Y1JA 3CULA 3MMJA 4JI4F 2VG6B 5DRKA 3V81B 2BA9A 4JI7J 2ZDOA 1WG4A 2IRXA 3THTA 4CNZA 4LBPA 1LV5A 1LNQA 4ILLA 2VG7A 1R0AB 3M6WA 2AMCB 4I7FB 4R5PB 3L4BC 3DDKA 1SQFA 3OL6A 3CCES 3MM5B 4IYQA 2UUAJ 4DR3J 3R5DA 3R6LB 4I1TA 1IBLF 3KLFA 2OEKA 5E3AA 5E3CA 2BANB 1S1TB 1KEKA 4B02A 3T6BA 2B51A 1T0TV 3DOLB 1EX8A 2RH3A 2WVCA 4DOZA 2Z0GA 3R5BA 2XCPA 1R8AA 1NHUA 4LF1A 3OHAA 3HSDA 1F9HA 3BBCA 3ITHA 1RHKB 3PEHA 3W60A 2YTCA 4RPFA 2NYHA 4RNMA 3Q8SB 2OTLS 1I51B 4IOAQ 2R2TA 4DXLA 4DSLA 4M94A 2PA8D 3GFHA 3IC1A 5LSLA 1RAFB 3SEOA 3MWBA 3CO0P 3HFKA 3CJ0A 3KDNA 2CQDA 2LXIA 3TUIC 2WB1D 5JMNA 3PKYA 1KONA 2GJ2A 1BQNB 5CYMA 4TQRA 5D0HA 5KFJA 2JL9A 2CG4A 2CQHA 2ZHOA 4M8LA 3VALA 1WC6A 2BQ3A 4WYLA 2EKNA 1GH8A 2WW8A 2BUNA 4XO0A 1NAQA 3RBZA 1WC5A 4MK9A 4IFYB 4BLGA 4JI0F 5LL6d 3G87A 3J81Y 2HFOA 3N28A 2UUCJ 3F73A 4KV8B 4DR2F 1U24A 2W2PP 4M95A 1KVJA 2V69A 1RTHB 3NCPA 2WBMA 1RTZA 2FLNA 3Q0AA 4DS5A 2V4JA 4CIOA 1TKTB 4I2PB 4KRWA 3B78A 4DFKA 1YIJS 4Y6IA 4NOHA 4BCAA 4URSA 4KB7A 1KS2A 4USUA 2QLJB 5ETRA 5HBMA 3BO4A 4JI5J 2W9BB 5B0FA 5L46A 1S6QA 3F0NA 1RCXB 3A8JA 4BWMA 2PO4A 3PNIA 1SH2A 2XGPA 3TX0A 1ULRA 4Q43A 2AF6A 2Y1LB 3W62A 2GHVC 2DYAA 2XZWA 1M1KT 3JSYA 4R8UA 4ZS6A 4YUDA 3LAMA 3GCWP 2R8KA 2E7XA 4ECZA 2ZE2A 3SSQA 2ZNYA 4EI2A 3G6ES 1EIYB 2DITA 4JP8A 4URGA 3VGTA 1X60A 3NP5A 4J9KA 5E7OB 4EO6A 2V4QA 2DPIA 2R7RA 4B9VA 2WONB 1HQUB 2VQEJ 4AYBD 4NI2A 5EDWA 2X3DA 4WF9Q 3GV5B 1KP6A 3HJVA 1QUPA 3M7VA 2V0NA 1CPZA 3QBCA 3MMBA 2CFXA 1X4GA 1TL3A 5IT4A 3LF0A 5GAGI 3BGRB 2YWHA 2VFTA 1GQEA 4OLOA 1LW2B 4DV2F 2MTLA 1HWIA 3E3XA 4L6V3 3PW0A 1SIWB 3EM1A 3SQGA 2HHUA 3N01A 1RZMA 3W2WA 1XMOJ 4ZJQA 2WAQD 4Z2XA 2E44A 1C1BA 3H7HB 2E5JA 4RBTA 2ZH8A 1UVLA 4M63A 4U8VA 2GIQA 5A0YB 4MIWA 5IT0A 2NXNA 3DLLQ 3L3CA 2BVZA 1T3NA 1EKSA 5J2NA 2FVCA 1HLWA 2GAHC 2KG0A 4IH5A 2QT7A 3OTOF 3AFGA 3QT5A 3CEDA 2DNHA 1OIAA 2P9EA 5CAAA 1UEVA 3BGOP 3UNGC 1Y3JA 3TANA 2VL1A 1ZPWX 1H3DA 3IG1B 1VQLS 4W92B 3FC9A 1U4BA 3Q8YA 2GQCA 4IR9A 4USKA 3DGPA 5A2QU 3DLEB 2MY7A 2KJWA 5ADZA 2XY6A 5KT2A 4V1Ak 2OKQA 1CC7A 3M8ZA 4ELUA 3RB4A 3LUYA 3H0PA 2HG4A 1YQHA 4M5LA 1T9YA 7AT1B 2WRMA 3E8OA 5L1LA 4ECTA 1FA0A 3K0JA 4R0JA 4CH7A 4DR1J 4O3QA 3PW5A 5CZVA 1GMVA 2LKZA 1F60B 4ZPCA 1OYDA 5D4PA 4P74A 4DHVA 5EX3A 2OELA 1RHQB 2QMWA 3ISND 1WOPA 1WDDA 3EXCX 3NKYA 4DSEA 3BBFA 4B3TJ 4BBYA 1WJ9A 2JEGA 2B9WA 2HNYA 5D0RA 4RW6B 3K8WA 4K2XA 3SSRA 3KHHA 2SXLA 1PO6A 1BUXA 3HCXA 3QZ7A 2O67A 4FS2A 2V5HG 1TP7A 3UPFA 3RBXA 3HF5A 2CPHA 3F41A 4URQU 2KFNA 1C2PA 1KSPA 3TA0A 3G6VA 1NKEA 1Y0HA 1JXVA 1W7WA 2K1RA 5L8RC 2VG7B 3H25A 2XZTB 3BQ0A 4DL0C 4EWTA 3TQEA 1U1RA 5CD4H 1RABB 4CRJA 4U95A 4YB1P 3KLFB 2XEXA 2HVIA 2KXHA 2MB0B 1WOSA 4HHHA 3IS9A 1FXLA 2KVIA 2HS0A 3OR2A 2DBBA 4FBTA 2RSQA 2H51B 3ITHB 4YQWA 2I8EA 5B0GA 2QE5A 4KGZB 3UR3C 1VRTA 2D7SA 2C2RA 3C66A 2HHQA 1VLOA 4ITSA 4MMOA 1TUVA 2E1MC 1ZM3A 2BW7A 4RNNA 3OXLA 1VFJA 3A1YG 3W5ZA 2NLWA 2CQIA 2KKHA 1JLBA 4DJBA 1D09B 1JLGA 1YWXA 4LRFA 3AJ1A 3DRXA 2CQ0A 2HWHA 5KFWA 1RWVB 5CYMB 2ACYA 3DOKA 2LQJA 4DL2A 1NO8A 4LBHA 5G4DA 1WUUA 1TUGB 4WE1A 1H7XA 3BSCA 5IT9U 3D68A 2CXEA 2OLWA 5H9EJ 1B7FA 4ZHRA 4O3RA 3H2LA 4B9SA 1RQ0A 2CA9A 2C2EA 4C98A 2CNOB 3EVMA 2Y8YA 3JSRA 3R7BB 3QWPA 4A8XA 1OS5A 1D8YA 1X4HA 2G9OA 5IV3A 1QAIA 2V4JB 3R3TA 2G1DA 2JVRA 1FEEA 4UTGA 2AYMA 4P2FA 2MQOA 1S6UA 2ZZNA 4L75A 2CPFA 1EB0A 4O0IA 2Z56B 5HBMB 5GAHI 3C46A 2B4PA 3MM8A 1RE1B 1S6QB 4O3OA 2UXBF 4GKKJ 3RJMB 1J5OA 2UU9J 2P6SA 2CJQA 3A4TA 3T1YF 4ZIWA 1U47A 4KFBA 1L3UA 2YBVA 4DN0A 4UOFA 4R8UB 2G0JA 2WVDA 2ZE2B 1JMTA 4YHHJ 3N6LA 1X8DA 5AJ3J 3UN2A 1IWGA 3CUNA 4KO0A 1X5OA 3PEJA 5A8WA 1WG1A 3NRBA 4MH8A 3PCOB 3FNNA 4NI2B 2BJ7A 4DV6F 1SJ3P 3HSZA 1UFWA 3MMBB 4OYMA 1TL3B 2NSBA 1KVKA 3EXYA 3H5SA 3DRYA 3D1QA 1WI6A 1WELA 3DKDA 2K2PA 3BGLA 1OPIA 1L3VA 3Q22A 2W9AA 1U02A 2M9KA 2F40A 2XG8A 3QIDA 3Q2TC 5J1NA 1IKWA 3H5UA 4DR6F 3ZZPA 1D9FA 2HVEA 2LECA 1UW9A 3WC0A 1F1BB 2O66A 3J7A1 3SQGB 1HNIA 2JVOA 3W2WB 2KXNB 2L48A 1NEEA 2DY1A 4QYRA 1TL4A 3HM9A 1UPMB 1C1BB 3P4UB 4FYDA 3C6TA 2WK4A 3NOGA 1N5SA 4W98A 5F0WA 1FT8A 4U96A 4F4WA 4A8KA 2LA6A 5H1SV 2VIHA 3P96A 2OMLA 1VQ8S 1FTCA 5J2NB 2YNHA 3WHIA 5E3PA 2M3DA 2FHJA 3GJRB 4IRCA 1IJFB 2GV1A 5IM0A 5GAGU 1GX5A 4KKOA 5L1JA 2XSFA 3LGMA 4DSKA 1VQNS 4YB6A 1M5KC 4JV1A 3A3PB 1YJNS 3TVYA 3R6GB 2ZH5A 2L3MA 3HHDA 5EN1A 1SJ1A 2EG2A 3LP0B 3DGPB 2W7AA 1S0MA 2BRKA 3V2UC 1OYEA 4DFJA 1YG0A 4IRDA 4TQSA 2F4VF 1NSAA 4F3OA 2AJFE 3CIMA 3MR6A 1X4DA 2E7VA 5HMYA 3JSBA 1U0HA 4DCOB 3K5OA 1DTQB 4N41A 4EU0A 1UFKA 1O8BA 3VQSA 2K8GA 3C8YA 1U8SA 5DJBA 3G4SS 1TUWA 2J7WA 1KHWA 2HURA 5ETTA 3GQCA 4NLUA 5EWEA 3E2EA 3BBBA 4PYDA 5SUHA 2BW2A 1AUSL 4ZIVA 4DF8A 3PX0A 2Q79A 5LXRA 2GMHA 2HNYB 3P5BP 4OV1A 3W66A 4GKJF 4NLRA 5CZXA 2QYGA 2ZOGA 4Y3CA 2P5VA 3N4WA 2VODA 5T7LA 2OD4A 4TN2A 4M5MA 2QO3A 4DUYF 4H54A 4RU9A 5KFFA 2WBRA 3Q8UA 1VDHA 5IV4A 4CLYA 1U1KA 3LW5C 3OL9A 1CG2A 2Z57B 3R5AA 1KQGB 2K1RB 1MMLA 2HBYB 1KFSA 4H4OA 2JSXA 4Q0BA 3CWJA 3QSIA 2DRBA 2AJQA 4LF6J 2DD8S 1U6ZA 1DBDA 3IR6B 2VOPA 1SJQA 4Q7AA 5KFUA 1VR6A 4K7QA 3IS9B 3RW6A 1REGX 1AXQA 2HZCA 1S72S 2YXLA 3NNAA 2WHOA 3OR2B 1IR0A 1JLEA 2JC0A 3DRSA 4MKAA 1UVIA 2BM1A 2OEJA 3CDBA 3G8SA 1VRTB 4ANEA 4RW4A 1KTVA 2E1PA 3R5GA 1S6OA 5L9NA 5HP1A 3GONA 2N4CA 3EYZA 2DNLA 4YS2A 4DL5A 5H9FJ 4DL4A 3I31A 2HWIA 1LFWA 1JLBB 4LF4F 2DNYA 4ZVFA 5FIIA 2BRLA 4ZLLA 3KUHA 3HHNB 1H74A 2BYCA 2RHSB 3DOKB 1FRLA 2DPJA 1URNA 3WDOA 2I9SA 3V5RA 5SZTA 4DV0F 2F7VA 3M8QA 4WE1B 4OHYA 4C3LA 2IC3A 4C9DA 3DYAA 2XULA 4NWBA 3QFHA 1CQMA 1RDRA 4OYAA 1HWKA 4F4YA 4ZHRB 3C16A 4V19X 4ZLNA 3NEKA 3D6HB 2CNLB 3TA2A 4PZVA 4OI1A 4DUZF 1CEZA 3GE9A 3MFIA 1P1LA 4X66J 1RAIB 1VISA 1HHTP 3RAXA 1QAJA 2EEYA 1X5SA 2KVQE 4J9OA 3DDIA 4DX5A 1X7VA 3VF0B 5D4NA 1S6PA 2E9RX 1XTZA 2GMLA 3CDWA 2I5JA 5I3PA 4QZVB 3QGGA 1UL3A 1YBAA 2VJVA 2JDJA 2DNKA 3MM8B 2IM2A 2PE8A 1RWNB 1M5OC 2EFOA 4LF5J 1T9UA 2XI3A 4USTA 1YRTA 1J5OB 4HHUA 2E1RA 3R2DJ 1HNWJ 4DV5J 3POTA 8RUCA 3AXMA 3EDRB 1BC6A 4PQAA 3DLJA 1EQ0A 4DQQA 2AV5A 4A8WA 3MPWA 4C7QA 3OW2R 2FGCA 3ILLA 1YJ9S 1VI7A 3BSAA 2A10A 4IG3A 1SUQA 1SJ4P 2J6SA 3TUJC 6AT1B 2DXDA 1B64A 1JB0C 1RT3A 2DK2A 1FDNA 1Y5IB 2NXJA 4LRAA 4KO0B 2XMAA 2M2BA 1Z2ZA 4ZA1A 2JEIA 3ILOA 1EKRA 5KAKA 4NLGA 5IWAF 2JFDA 4PEOA 4JI7F 1CC8A 1LWEA 2OJ3A 5GAHU 2M0GB 3W64A 3WBZA 1HIYA 4NCBA 1XR5A 1FO1A 2DHSA 1FDAA 1R27B 2W2OP 3SMZA 5F41A 2ZWPA 2VPZB 1IKWB 4DR3F 2VONA 2MKHA 4HYKA 3VAFA 3NL0A 3HHEA 1HNIB 2D3O1 3W9JA 1LWFA 4A8MP 3C6TB 2B3TB 3NGSA 5EWFA 1IBCB 1SCJB 1Q7YT 4PG5A 1Q8LA 1H6KX 3VWSA 3LPYA 4JI3J 3T1HF 4QIEA 3CCRS 2YNHB 4ZP6A 3A3OB 3HPOA 3KTQA 1S1UA 2YKQA 4RUCA 4WFAQ 4ED6A 3G9CA 1XR6A 1XC9A 1Y7PA 3AB2B 5IM0B 1Y10A 2R7WA 4KKOB 2J9EA 1MSWD 2W4CA 2IMWP 1MMNA 1G3OA 4DWIA 3KJFB 2EFNA 2RQMA 3K89A 5A8KA 3LP1A 6FDRA 3EE3A 1M5HA 4I4BA 2VPXB 1HBUA 4QWCA 1VJWA 1D9AA 1JJHA 4ECQA 3EZOA 2YKMA 2YKAA 1ZAWA 5L38A 2KG1A 4DQIA 4QJVA 4DMZA 4USIA 2R7QA 1VQ6S 4H4KA 2CQPA 1B4SA 1VRUA 2VD3A 1CJTA 4YR3A 1YI2S 1PILA 2WVEA 3H59A 2ZH9A 4AXJA 3CCWA 1N5QA 1M1HA 3AQOA 2YX7A 2BX6A 1BWVA 2R8GA 5DG8A 2X1BA 2V2QA 1UETA 1DLOA 1HA1A 3ENVA 4QIGA 4USHA 4LT6A 1NPKA 5CYQA 3WX4A 5HQ8A 2R7TA 4CLTA 4O44A 1S59A 2BZ2A 3MR5A 1ROFA 3H5XA 3V6DA 2W4DA 4P7TA 4O4RA 1RWWB 1WI8A 3D54A 2FZKB 1FFWB 5T7LB 2XYPB 3SV4A 3IWNC 3NCQA 3G8QA 3TUZC 4CI0B 1ZAVA 4K59A 2YNIA 2IJRA 1Z2LA 2YNFA 5LJ5Y 3DHXA 1FRMA 2I0XA 3ZTOA 1TL5A 2VDIA 4U9RA 4DR4J 2VUGA 1JNZB 2XMMA 1IWAA 2BEFA 4ES3A 4Q0BB 2X51A 4DV3F 2BQUA 5FLXU 1GXUA 1S1XA 1H2VZ 1EQMA 1DY3A 3OTBA 2DH7A 1U45A 1WG5A 5HK4A 1QM9A 4X4TA 1YJVA 2ZBPA 5KG0A 1S0VA 1SKSA 2RJZA 1JLEB 3BS9A 5D3GA 4LQ9A 5I3QA 2YX4A 3DRSB 2L9WA 1TVRA 5B0DA 2KFYA 2OHDA 4DL7A 4RW4B 3D6MB 2BM0A 2ZBRA 2ZFHA 4B08A 4CT9A 1EHWA 5HP1B 1FFSB 3CJ5A 4J9SA 3W61A 1YSJA 1N0VC 4G1PA 2J0SD 1VHFA 3MM9A 1GFWB 5CHCB 2HQFA 4OL8A 3VV2B 3MDFA 5B0EA 2BV3A 1H0HB 1YJRA 1W2IA 1FJGF 4ZPVR 2E5LJ 2ZJRQ 2M7SA 1TMJA 1G2EA 2HGNA 2Q6CA 3QMQA 1TMMA 3M8QB 3FZ2A 2LEBA 1I1GA 2IC3B 4KHPF 4FN5A 3L09A 3DYAB 3QGPA 4I64A 1C4CA 3R1LA 3J81j 5H9EK 1HI1A 4WYWA 3VCDA 4M5KA 2IA6A 4NASA 1N52B 4UY85 4OYPA 4JI1F 1A0OB 4P52A 5HMWA 3CCJS 4BS2A 2BKOA 1NNDA 3NY0A 2VQFJ 4FS1A 7FDRA 2BJ1A 4N8OA 4DUTA 2YWFA 5KOXA 4UY8T 2XNQA 4B3MF 2DCLA 4Y2AA 5F8GA 5IXUA 1RT1A 1S6PB 1YZ7A 2I5JB 1UEKA 1XMQJ 3TAQA 2IFXA 3TEHB 2RE1A 3NGUA 2ZH3A 1UJ6A 1GAOA 2FJDB 4RL1A 1XQIA 4QCLA 1P9QC 4IQMA 3POTB 2C3UA 1ACMB 1FRJA 1ZOTA 4KHRA 5J2QA 1X0FA 1XWLA 3PFEA 1MMDA 5IC6B 3MD1A 1AW0A 3MMCA 4RUHA 3J81U 3D7SB 5C2CA 3JYTB 1PJ7A 1BY9A 2OPSA 3MOZA 3H8YA 2CZ4A 1VBKA 3NGRA 4IG3B 1SUQB 5LMNJ 5D78A 1N5VA 3ZZZA 4O0NA 3DRRA 1Y3KA 1RT3B 3OXGA 3IWXA 2XBPA 1Q79A 1LW0A 3CDUA 1TKDA 3KYLA 2XMTA 4UOCA 4ED3A 4F67A 3VAJA 1SJRA 1WF0A 4NXMJ 4A8QA 4NA1A 3T5LA 1IKYA 5JUMA 1X4EA 3KLVA 2IA0A 1LWEB 4HT5A 3HLUA 3MGJA 1N36J 3DC2A 1KN6A 2ZBCA 2O5DA 4DPYA 3RRGA 2IM1A 4H4MA 3Q89A 2PMZD 2FDNA 1U1NA 1B0TA 3DGVA 5DQHA 2H9ZA 3D3CJ 3P3DA 2EW9A 2MJUA 4C6AA 2O3DA 1RTIA 3NGKA 1LWFB 1B0VA 3LWLA 4DL6A 3PX4A 2ZHBA 5HQMA 2FC9A 2QYCA 4OYOA 1U09A 3VGSA 1KKHA 5DETA 3IGNA 1U7LA 3NWRA 5AT1B 1HWJA 4X64J 2IJNA 2IVYA 1S1UB 1CJUA 5F3TA 4ED1A 1NK0A 1AT1B 5KFRA 4DFPA 1PGZA 1BWEA 5C24A 2DH9A 4PWWA 4CM2A 1G6BA 2D9OA 4IFVA 3GMGA 5A8KB 3LP1B 1T02A 5A8RA 3AHPA 1S7IA 4DX6A 5AXNA 1HBUB 5CXTA 4DU8A 4O3NA 3T9NA 1TL7A 2YKMB 1VC0A 2UP1A 2DGVA 3BQ1A 1LKZA 3O8WA 1UCNA 4B9TA 3LO3A 1PC4A 1WACA 2HEKA 1VRUB 1HNZJ 1CJTB 3RB3A 4ECXA 2XLIA 1OSDA 2IJFA 3M32A 4H4KC 2Q6BA 3HP6A 4YDDB 3PHEA 1HQ2A 1DLOB 2QTWA 2UUBJ 3PRDA 3M8SA 3KHLA 3K58A 5D8HB 5IFMA 1IVZA 2PDAA 2E5HA 1RYSA 3E01A 2XGQA 4O44B 4CLSA 3CJ4A 3FFIA 2NZCA 3V6DB 4ZCMA 3DLBA 2EK1A 3G86A 3Q23A 2R8IA 3GYXB 5HVFA 2PI4A 3THVA 4PABA 4F0HA 3CCSS 3QAUA 3LQVA 2YNIB 2CG8A 2PFFB 3FBCA 5HVHA 2YNFB 1NK7A 3RB6A 4IH6A 3AOBA 3LGHA 2MLYA 1U25A 5E41A 2Q43A 4P2SA 1HHQA 3DM2A 2PT0A 2IYGA 1IQTA 3JAMY 1JKHA 3TZZA 1IBKJ 2J8AA 4GMKA 2KHCA 2HQ3A 1S1XB 2FVRA 3RRKA 1N4LA 3LAKA 5CYJA 2HHXA 1X0PA 4KGKA 5KFQA 5JXSA 3FMBA 2EWHA 4OHVA 1KFDA 4WIIA 5D3GB 3TEGA 4X4NA 4OX9F 3CD6S 2Y1RI 3K5LA 2DNNA 1TVRB 1QVFR 3SV3A 2HMIA 1VRQC 1C1CA 3UCZP 3OSNA 5KG1A 2EVZA 4F4XA 5AE3A 2QFJA 4PPZA 4OJ1A 3DRPA 2GJIA 5KFLA 3MM9B 4OZJA 4PXEA 2J6TA 3MEEA 2OUGA 2HS3A 2W2MP 1AZSA 2CQCA 1VQ7S 4HACA 4P2MA 1R0BG 4ED7A 1N33J 4CM0A 1S10A 1MN7A 3T1AA 1WSRA 4ZVQB 2VKRA 1VIXA 1NSKL 3MF5A 3ZNUA 1F5BA 2HGMA 1FEHA 3ZTQA 2B0GA 4RZRA 4L73A 1RHRB 3MUTP 1XK8A 3I0SA 1NDPA 4F50A 1X5TA 1S5ZA 4XAKA 3MMAB 2E9ZA 2Y8WA 1C4AA 2FZGB 1F3VA 3MCSA 2WB4A 5JVGQ 1RT1B 4WFBQ 2IHR1 2DEIA 5LOQA 1U1OA 3CVKA 3C3LA 4ZVEA 2PA3A 3ZC4A 2Z2ZA 2JX2A 4OIXA 3MAQA 1DARA 1GXLA 4WFYA 1FE0A 5BR8F 5CA5A 3CJTA 2N7YA 4USWA 2RQCA 3T3FA 2AKWB 1YRUA 1SB6A 5J2QB 2C2OB 4ICLA 1N6QA 3S6EA 2DHGA 2HQGA 3MMCB 2ZITA 1S99A 2V8VA 3TZWA 1QVGR 2CYYA 2NSCA 4F4AA 2OPSB 4TVAB 4X84A 4ZN1A 4LIWA 3I32A 2OSQA 4MAKA 4M1KA 2ZH2A 3DRRB 2P6TA 2DGSA 2R8JA 3PO4A 3QJLA 3NNCA 3D9BA 1LW0B 3I4HX 1FNXH 1WC3A 4JI2J 2W4PA 3QRQA 2HZAA 3D66A 1IKYB 1NKBA 5DLGA 4HDHA 2DR5A 1EP4B 4DZ6A 3PR4A 3DOLA 4JI8F 4ENOA 1RWPB 2HNDA 1T03A 2LU2A 2ZH6A 3AA9A 4KBIA 4H4MB 3FBEA 2KRRA 3CCQS 4OYIA 3I5CA 4J9RA 1T9TA 5DQIA 5K5MA 5C25A 4CLPA 4X4QA 4K5SA 1ZA1B 3LOUA 4QW8A 2DNRA 5E5NA 1IM6A 1LXNA 4K4YA 1Q95G 2Z58B 1P1TA 1RTIB 1YHQS 2OFHX 3D5MA 4YY3F 5DQGA 3D1OA 3X3UA 3UWTA 4F36A 4C8YA 1ZM4A 4DV1F 3DLKA 4DV7J 3QGHA 2X7IA 1D8ZA 3OUYA 2Q1LA 5BJRA 2MSSA 4WXOA 2HRUA 1CJUB 2BBEA 1MNEA 3D0HE 2QG9B 2KU7A 2DH8A 3AB4B 5C24B 4DL3A 5LT5A 4LFCF 2CJBA 4IO9Q 3CC7S 4WP3A 1QLNA 5IQ6A 2ACMA 3W5XA 3TR5A 4IFVB 1G7CB 1S1VA 4IOBA 1FVSA 5A8RB 5F8JA 3VZIA 1VOMA 2CZVC 1H2UX 4I6AA 2PC6A 4UW2A 2CVIA 2IBKA 1TL7B 3UQSA 4OI2A 1GX6A 1I6JA 2XZDB 4M5NA 2HS4A 1TQLA 2ALZA 3OLAA 4LF8F 2HQIA 2HHWA 4CWBA 1N56A 1BD6A 2MYFA 5HROA 5CD4A 2I2YA 3M32B 4DU7A 1HMVA 1Y4ZB 1RWKB 4X66F 1RXOB 2L08A 4W4MA 3BJYA 3TAMA 3N9UC 4B3SJ 3MM6A 1FDDA 2YH1A 1RTJA 2CKWA 1FHTA 1A7GE 5EX0A 3B82A 2ASJA 3EWGA 2HHHJ 3E01B 3M8YA 5B08A 2EK6A 3N0VA 4YN3B 2FTRA 2LP4A 3FFIB 2QV6A 5DGAA 3NOCA 1CJKA 3BF4A 4NXNJ 4GVLA 3FDSA 5M2UA 2VV5A 3C19A 3VQTA 1T9VA 4JUZA 4K0KF 4MK7A 3RUBL 2HYIB 4U8YA 3DM2B 1CLFA 4JI4J 2VDHA 2EFGA 3Q86A 2OD6A 3RBDA 2LDIA 3AJ2A 4USVA 1WOOA 2F9DA 1FE4A 1FXDA 2HFNA 2W2NP 3HD1A 2RRBA 4C8MA 4PKDB 4F26A 1NM2A 1NSQA 3FK4A 2QFIA 3LP2A 4IQXA 2XO7A 1TV6A 5B0AA 2ZWOA 4ANCA 4ZITA 3CXCR 3PJXA 3M30A 2DO0A 4ILMA 4YMEA 1IBLJ 4CP5A 2DGTA 1PAUB 4DFMA 5HAOA 4F8RA 1H38A 2OPQA 3CCLS 3RBEA 2HMIB 1C1CB 3H42A 4UZCA 4QYZJ 1REVB 2QLXA 1F0XA 1HI8A 5LSOA 2POKA 3DRPB 3PR5B 2VICA 3TARA 2NZ4A 3MAHA 1SIZA 1RAJA 3MEEB 4ZPWR 5A76A 4A8FA 2H5EA 1AZSB 2BABA 1EARA 3FUYA 4HACB 2PFDA 2MZSA 3HXMA 2UXDF 3S1TA 1N34J 2AEMA 2E29A 2RILA 2LLZA 4XDCA 4EFAC 3DMJA 2JEFA 1YJ7A 4JV0A 5IS2A 2JLFA 3TYTA 4JI3F 1TAUA 1P8GA 3M2VA 2KI2A 1WC0A 4P72A 3MXHP 3HKZD 1NK8A 5ETQA 3ETMA 4AXIA 2QMUB 5DM7Q 3HSJA 2KT3A 3I0SB 1PCAA 3KXDA 4IO1A 4HDGA 1RWOB 3ZZOA 4HEA9 3UDVA 4Y00A 2EI5A 4JI0J 9ATCB 2F5GA 1Q81T 3UVJA 5ETKA 1YTYA 3PZPA 2AIRB 2XTJP 4FXDA 2HKEA 1YBUA 1EJ7L 4PUOA 4W90B 5EGYA 2MZTA 1VQ5S 3W2VA 1K44A 4CYUA 4DZDA 4OI6A 2Y3YA 5DGBA 4OZLA 1PJ6A 4X62F 2FUG9 2RQ4A 4J9QA 1K0TA 4ICLB 1N6QB 3R7SB 2CZ9A 1HI0P 3G6XA 4WPAA 3O44A 3HKWA 4FKYA 5JVHQ 4WKRA 2XQCA 3SCKE 5GADI 1M90T 3KG0A 2FD2A 3ZTSA 3PV8A 3HFVA 2RUSA 2MGZA 2DEJA 5LJ3Y 1NPRA 2HBZB 3QIPA 1RUSA 1GTHA 2WOMB 1QSSA 1V3ZA 2VB6A 4YDXA 1YZ6A 1OO0B 2XYHB 1X4AA 4G1IA 3MR3A 4ATNA 3Q83A 5AXMA 3ZFVA 2DNPA 2BE7D 4AL6A 2GGPA 1ICEB 4CLUA 4KSEB 3IN5A 1D0EA 4PAAA 3CC2S 3I9V9 4RU2A 3L95X 1KQFB 2JH3A 2HNDB 1T03B 2A2CA 1RGVA 2VF3A 2OAUA 3KHGA 3OTCA 3BH7B 5C25B 3CJ2A 1FD8A 5KFPA 2GW8A 1B99A 3PXGa 5KT5A 4WFNQ 3PACA 4OFZA 3ZXWA 3BN4A 4GVBA 2M88A 5DG7A 1WWHA 3IBFB 2GAGC 1FD2A 3MAAA 2P9CA 4DV2J 3WC2A 1BLUA 5B09A 4OJHA 2QLBB 1CSJA 4NLOA 4YR2A 5LMUF 3DLKB 2JFKA 3QT6A 2HIYA 3HSGA 1FXRA 3I6PA 2NXCA 5K8OA 4P75A 1N0UA 3OUYB 4G1QA 4ED4A 2W7OA 4FP9A 1S0NA 3ENWA 1Z4UA 2G2ZA 5F8HA 3BKUA 2MKIA 4KIAA 3UW1A 2IMOA 2Z4PA 2CADA 4X4OA 2XM3A 1HHSA 3MFHA 5KG5A 1WEZA 1K9MT 1RU1A 3FCWA 3VVTA 2PEHA 4TY9A 1S1VB 1VC6A 2E5LF 4XIUA 3WIUA 4PG8A 1RT4A 1A6LA 2YH0A 4C8ZA 2DIVA 3CT9A 4OZ5A 3OTOJ 5ETLA 2EBEA 3O1LA 2G13A 4AQYF 4JV2A 1FRIA 2BJ3A 4OHWA 1NHKL 3T9ZA 2V9KA 3T5HA 3SCJE 1IUJA 3OSPA 4QIFA 5HROB 2HLTA 5F8NA 2R4FA 1VLYA 2VQFF 1HMVB 5CCLA 5IOLA 2DIUA 4L74A 4F2SA 2R7OA 1RTDA 3NLCA 4B9NA 3JB9k 2NUHA 2CPZA 3TAMB 1S9GA 1JLQA 3MM6B 2PSZA 1RTJB 1SJFA 2XS2A 2BMBA 5FDLA 1RAHB 2ZBIA 1FKOA 3M1VA 4CLZA 3PY8A 3AOAA 4I68A 1CJKB 3PYDA 4FPIA 4FPRA 3ZO7A 2C2NA 3IXQA 2MZ1A 1Q4RA 1AFJA 3PYGA 3UN5A 5KFDA 3CIZA 4MIAA 3ZZUA 4AL7A 1Q16B 5ETSA 2AYBA 3S01A 3QATA 1ITPA 1OY9A 2MKYA 1S77D 3O3LA 1Y5LB 4LF7F 1U0SA 1T11A 3AD9C 1JIHA 2A3JA 4XDDA 4RWWA 4WP8A 2N4DA 2FB0A 3HT3A 4RW7A 3IAM9 2F3JA 5F9NA 3RW7A 4OI3A 2H1YA 3KDOA 4LRCA 2ASDA 3LP2B 3HVAA 2OTJS 1TK8A 2FHMA 1TV6B 2W8LA 4F7VA 2AGOA 2RRAA 4FNHA 2LQ9A 5HMZA 2HAFA 1VQSA 1SH0A 2JNJA 1M5SA 3CCUS 3M30B 3MECA 3LTOA 1YITS 1MWYA 1GNKA 2ZEJA 1WDTA 1IKVB 2Z8QA 2AYGA 3W9IA 2OPQB 5KFGA 2RT3A 4AFFA 3FJ2A 4FNIA 4RBUA 3KWMA 4IRKA 1VYAA 1HD1A 4N77A 2V50A 4LRDA 3CCVS 4P73A 2B56A 1EZZB 2UVVA 3RYLA 2DKOB 3LALA 1HW9A 4OZ3A 2D9PA 4S0MA 5ETVA 4X4SA 1B0PA 1OY8A 4GC6A 3O2IA 3JXOA 2V2VA 2RNEA 3DMJB 4EK2A 4ZPTR 3KUGA 2H54B 3LH2S 3IR7B 1SC1B 2ATCB 4PG7A 1CVJA 1JK9B 1LWXA 3N79A 1UJ5A 4CQ1A 1UWAA 2YWWA 3LP0A 4Q45A 2IRYA 2KM8B 1AYEA 3PDNA 3M2VB 3CE8A 4KT0C 2I1RA 1S9FA 1U1LA 4U7UK 2KM8C 3L7OA 3C14A 4RW9A 1URRA 3OTDA 2UZAA 1JNRB 1DTQA 2OP5A 1CJVA 1RADB 3R27A 4LF9F 4DPUA 3PG9A 4KHMA 4ZCKA 1UZHA 4CLWA 3UVJB 3ISZA 3ZTPA 3FMWA 2KZMA 1XIQA 3KJNB 1ZZFA 2MQQA 4PUOB 3BPSP 4F2RA 4OV6A 2LXUA 1XNQF 3W2VB 2YPYA 2HPUA 4CYUB 3AD7C 4PQUA 2F8MA 2CPXA 2ZJQQ 1GT8A 1M0SA 3OJUA 1FRXA 4EZ6A 5DLFA 2PGCA 4D3GA 3O5TB 4NZ0A 3OT9A 3QRPA 2UXBJ 1DRZA 1JWWA 2UUBF 4L76A 2MGZB 4DCPB 3MUVP 2V67A 3QIPB 2VG5A 3ISNC 3T1YJ 1KQKA 4PG6A 1NXIA 4NRTA 2BOPA 4JB8B 1LK7A 1LK5A 3OQ2A 2VOOA 3DCAA 2VFSA 1N32F 3FEYB 2DJWA 2VFUA 3K7RA 2GGPB 5F3ZA 3K57A 4N56A 3BQ2A 1Q8KA 2D69A 5I4MA 3VAHA 5KT3A 2ZDPA 4EO8A 3H4BA 2XMVA 3GIRA 4C3MA 3X1LB 1N5YA 1FCAA 4B17A 4N76A 4DV6J 2C1EB 3A8KA 2QJ3A 1S1WA 2MSTA 1UEUA 4DR7F 4LFAJ 3CJQA 2ZH7A 4GVBB 1VBZA 5GADU 1RHJB 5AE2A 3SIPB 1TAQA 2M4MA 2CUYA 4AUKA 1OWXA 3MR2A 4WFZA 3MAAB 1U6FA 1S12A 4J9PA 1K47A 5C42A 4DR6J 4NYOA 3J80Y 1FNOA 1SKUB 5KG6A 3HK2A 3W5YA 3F56A 4G1QB 2ZUAA 3M8RA 3DXBA 3GZ7A 3PW7A 2HSEB 2WSFC 5KFMA 3VAMA 2C22A 2QRRA 2DNOA 3SDEA 1KC8T 3QGIA 3RZAA 4WKYA 3DNCA 3I0RA 2XHCA 2Z2LA 1VJQA 3EICA 4K8RA 2J9CA 4U6PA 1RBAA 3OJSA 1RAAB 1RT4B 4X2BA 3V4IA 4TXSA 4P7VA 4C8LA 1SV5A 2V8PA 3CB4A 4Z7CA 1FK9A 2VHGA 3AY0A 1FI4A 1XJWB 3HO1A 4YR0A 4NEYA 1V5VA 2R2RA 1ZA2B 3FSIA 2KRBA 4DQPA 1T8EA 4QU6A 9RUBA 2F4VJ 2EKYA 1RTDB 2H4YB 2JEJA 5DZ7A 3BO2A 2DB1A 2HWTA 5KG3A 1S9GB 4K4SA 4P9SA 4WTYA 1JLQB 3TO8A 3IAS9 2HVDA 5FDLB 4ZVRB 3OLBA 3PX6A 1FKOB 3M1VB 1BHNA 2MKKA 2L9DA 4WK1A 2B9XA 4WK3A 2DR9A 5E3RA 4ZJLA 1PKUA 3UO0A 1QE1A 2BDPA 3SQOP 4DPXA 2BKNA 3RGIA 2XMWA 3ENAA 4PYAA 4Y2CA 5KFVA 2CJAA 2DT9A 2N3LA 4GKJJ 5GMDA 2VH7A 3S8SA 2M8HA 1K1QA 3QWUA 2F63A 2D1CA 2UUWA 2MDAA 1VMBA 1X5PA 4DPWA 3P8BB 3DI6B 1RWUA 4ZLPA 2ZOMA 1YKWA 5HJYA 4RW7B 1HL6A 5HMXA 2IM0A 4ZCIA 1IN0A 3A8IA 3CD7A 4PXCA 4QBUA 4X65F 4CLLA 3VGUA 4PRFA 4Q44A 3D2WA 2HBQB 5DDPC 1DFDA 4TY8A 3MECB 2KXFA 2CNKB 2YKNA 1YJUA 5KFCA 3NXZA 2ROGA 3DLGA 2G0IA 3BSNA 1O51A 5B0BA 3GG1A 1PAEX 2ZZTA 4JI6F 3FBFA 2MMYA 1I94F 1U1MA 5D0GA 4WCEQ 1YRXA 2GIFA 1NCLA 2WVBA 5EHHA 2R7SA 4ID5A 3CCZA 4ZP8A 2XHWA 1FTRA 3IA0A 3M4XA 3SCLE 1LWCA 1FJEB 5D6GA 2LCWA 3QPIA 3RRHA 3JAMU 4A46A 3HI9A 3TWZA 4C11A 3GILA 2LU1A 2YNGA 3IRWP 1R31A 1N48A 1HNXF 2W1BA 4LF4J 2V8DA 2E1CA 3SBMA 5K9FA 3LWMA 2HVZA 2E7WA 2OI2A 3MHYA 3B4MA 2RVJA 3PYEA 2F8HA 3FQKA 3KLEA 2RS2A 1E6VA 5E33A 2J6UA 4DV0J 3C14B 3QLHA 4RW9B 8ATCB 2G2OA 4F4ZA 2GQ2A 4NZ6A 1Q5YA 1HBMA 4HI1A 5HO4A 1UVKA 2UXCF 1F2HA 1CJVB 1RB0A 1TFWA 4DQSA 3BYPA 3G82A 3GFXA 3SZ2A 2CWKA 2JHEA 1JLAA 4DUZJ 2CPEA 4CNYA 2MZQA 4DR5F 5KFBA 1SC4B 3IM8A 2APOA 2K3KA 1W26A 2RMLA 4ALZA 3MEKA 2AW0A 4PQUB 4C2MA 1XN9A 4J9LA 1UVMA 2ADCA 1N88A 2GVDA 3GJTB 5KFAA 5G0RA 3ZZTA 4EBEA 4C0HA 4K2JA 2H3EB 2HLUA 4ZJOA 4UF4A 4ED8A 1PYSB 2VG5B 4B3RF 1D3WA 3KLGA 4DV4F 4O4GA 4CLKA 3K5NA 5L1IA 1IKXA 4JYAF 4M5JA 2NUUG 2E9TA 1SQGA 1HBNA 3IBCB 3UE2A 4LFBF 4Y34A 1RKIA 1NSPA 3PTWA 4LSLA 4ECVA 2GJFA 5IWAJ 2W8KA 1N5YB 2N82B 2LQ5A 1B70B 4MJKA 4NEZA 2FJEB 2QIFA 1S1WB 2K7JA 3UD5A 3R7NB 1NB7A 4RJVA 2ZKUA 2DGWA 4OX6A 2GFFA 2LQ8A 1J2VA 2MQPA 3CDAA 4QR1A 1NH7A 4KQZA 1UVNA 5C42B 2HNZB 1VCTA 2XMJA 2OFGX 4IH7A 1BQXA 1U26A 2KFZA 4ZPAA 5D4OA 3M6UA 3CMQA 1QJHA 2V2ZA 2RUGA 4NLQA 2MJNA 3R9LA 4L3KA 4ZPBA 3IR5B 1MW7A 5BYQA 5F8IA 4IDKA 3CJ3A 3BREA 4EZ9A 5CH7B 3SDEB 2YX1A 1TKXA 3I0RB 5I42A 4RO0A 3T1HJ 2R7XA 3T19A 3QJPA 1RP5A 3SFGA 4KPCA 2LQBA 1KRPA 4QQBA 3EUNA 1N34F 3V4IB 4EBCA 1D1UA 2V8GA 1C0TA 1SV5B 2GNKA 1M5PC 2JWNA 3QT7A 1FK9B 2GHWA 2GIRA 4KAIA 1LQ9A 1DZ5A 2C2ZB 1NZ8A 3GR1A 1HR0F 3DOMA 2J9DE 1NJIT 3KK3A 1S48A 2GO8A 2M5YA 2HQCA 5HQLA 4IUFA 5DS7A 4QW9A 3D0IE 1YVFA 3I87A 2ZUGA 3R8YA 4QU7A 4ELTA 1DQ8A 3GP9A 1J5EF 3JYTA 4WU3A 1DTTB 4TU9A 1NU4A 3G71S 3BDEA 2NR0A 5LXYA 1X4CA 4O3SA 1QE1B 1KVIA 4LVOP 3JQMA 2R42A 3FSYA 2FY8A 1RA7A 1NPPA 4PXDA 1UJ4A 2EFVA 2ILZA 1AROP 1FWKA 2H48B 1R8BA 1E6YA 2G0CA 5J2PA 3OBIA 3GFYA 4P10A 1RBOB 3TZXA 1QSYA 1X9WA 1L3KA 5KFHA 1F6TA 4TYBA 3PRBA 5KTQA 2CQBA 2A0FB 3ADAC 5LM7E 3M2UA 2DNQA 5F8LA 3BYRA 3TJ9A 4F4KA 3AAWB 2UUAF 1UZDA 1QSLA 4DV3J 2B4UA 1VS3A 3RG6A 4TY8B 3TAPA 4LIRA 1M5VC 2PN6A 2GZOA 4DQRA 2YKNB 1NB2A 4LMZA 5DO2A 3KNAA 3DLGB 3A12A 4OYWA 2WZ1A 4OZ0A 4OYBA 4NLWA 4J37A 3NMAA 1S79A 3BKFA 2VASA 4FYWB 1CS4A 4NZ7A 1W25A 1XR7A 2AT1B 3HT0A 4ID5B 2VBZA 3RU0A 3NAHA 2HRTA 1LWCB 2B9EA 1UWBA 2J0XA 3CW2C 4AT1B 1JX4A 4C11B 3U1NA 2YNGB 2KO1A 3A8EA 3ET6A 2C2DA 1YJTA 1TK5A 4ZK7M 1ZTTA 1LOUA 2MHEA 1FJGJ 2W7PA 3MEGA 3KLEB 2ATLA 1E6VB 4Z37A 5ITHA 3QLHB 4FF1A 4AD6A 5CABA 4KH1B 3K8VA 4KHPJ 2B7CB 3MR7A 1HBMB 2UUCF 4IKAA 1UW4A 1OSCA 3I5BA 3T5KA 3Q8QB 4HHJA 3ZZYA 3G82B 2YPZA 1U1QA 3OPKA 3HZGA 3RAMA 2YKOA 4JI1J 3UD4P 5E2QA 1X4BA 1JLAB 1YJWS 2RU3A 2VU5A 2NS1B 3C15A 4F25A 3KFWX 2NCKL 2RD5C 1ZTWA 3EPGA 2A18A 4B3MJ 4YFUA 1VQMS 1TU0B 1PC5A 2C3OA 1R6YA 3HDSA 3K2YA 1NH8A 4M5IA 1RISA 4PR6A 3B8HA 1ELOA 3I4PA 1MWZA 2YQ1A 4JI5F 4ECWA 3TOQA 2GVDB 2ZHAA 4Q8EA 2ZM6J 3MPDA 5U47A 5J1EA 2R8HA 3FKBA 5KFOA 5G0RB 1BQMA 3H2UB 1WD6A 3BN7A 4MFBA 4F0KA 1NZAA 1RSCA 4LVNP 4DLGA 3KLGB 2HZVA 2QA1A 1NDLA 1R8PA 4O4GB 1VK3A 2IDEA 1IKXB 3TNVA 3N5FA 3PJWA 1U49A 3RAQA 4ECUA 1HBNB 3UCUP 2F8EX 1IM4A 2DR6A 4QWEA 3CF5Q 2IYIA 2VKZG 1PJ5A 2VQEF 5KFIA 4LSLB 2NPIA 1IJEB 1ZZNA 3PKMA 3AH6A 5D0EA 2ZJPQ 2HGLA 1BE4A 5F8MA 3OVAA 3BGFA 4I6YA 3PM9A 5CQGA 4Y28C 2H65B 3GWCA 1FRHA 3ZZRA 4LJMA 2J7UA 1BXNA 5K8MA 4NLXA 4ECYA 3UNYA 1XMOF 2MLZA 5BYSA 4GRSA 3OV7A 1FJ7A 3ETOA 2CQ3A 5HATA 2OSRA 1C0UA 3E51A 3OFFA 4B9LA 1Q5VA 4ELVA 3TJ8A 1SKRA 2Y0BB 4FF2A 4KH0B 2LFVA 4IDKB 4O3PA 3KUEA 3DU6A 2R7VA 2XMUA 3GB0A 3K5MA 2B5JA 3KG4A 4XTTA 1TKXB 5I42B 2QA4S 1KBRA 1I3OB 4DF4A 2AJ2A 4E0DA 4NMLA 3BR9A 3AXKA 3H20A 2ZC4A 1VQ9S 3MMAA 1TZ0A 4C8OA 2BJDA 4P71A 1O6XA 5ETNA 1C0TB 2LVWA 3BDPA 8AT1B 2IPOB 5KFYA 2XLKA 3K5PA 3RR7A 4MK8A 5K20B 1Y11A 1ZETA 1TFYA 3UDEA 1U6BA 2P9GA 3DOMB 4XK8C 4CH0S 2RF2A 1VIOA 3KK3B 3D6FB 4GC7A 3FZBA 3I55S 3BR8A 1P27B 2PMHA 5B7WA 2LEAA 2ZNZA 4DR1F 1KNZA 3AJDA 5ETOA 1RK8A 1T7PA 3EVOA 1CULA 4DS4A 1EAYC 4IG0A 2W01A 1WHXA 3G2XA 3N6MA 4B3TF 4HLBA 2YY3A 5M2PA 2FJWA 1NMEB 4NCAA 1NK4A 5E3QA 3HHKA 3JQJA 3OFGA 2ZH1A 3AA8A 3KJQB 3ELHA 2QL9B 3RB0A 2AGQA 1E6YB 4K4WA 1QUVA 1DURA 5J2PB 1FESA 1BMQB 1EP4A 5IZHA 3LGNA 1HPZA 4WJBA 3S7RA 4P6QA 3GYGA 4A8YA 1K1SA 2F9JA 2YWGA 3OHBA 2DTJA 3M2UB 4FYYB 1OQ6A 2IDLA 1NHVA 2E66A 2JC1A 2IBOA 3HZEA 4LUBA 5HJXA 1IXKA 4ERDA 3VHQA 3MURP 4ECRA 4K4UA 2R7UA 4WFXA 4ECSA 3KK2A 1S9EA 2U2FA 4KR0B 3EZ5A 3W3SA 1MWQA 4NLVA 3RTVA 1CS4B 4CLFA 3VGVA 3D1HA 4U7UD 3T6JA 4B3OA 2ILYA 4OX9J 4PXBA 3QRRA 4RR5A 3QNWB 4ZCLA 4HKQA 4FF4A 2FVSA 3JSMA 2BACA 4LFAF 2AQ4A 2IAJA 3MPYA 1NJZA 3NMRA 4K4XA 4Y0FA 1UWBB 5KFKA 2RHQB 5BXIA 2ZVSA 3CMES 3ET6B 4E98A 4JV5J 4WU2A 1T9XA 1XERA 1V5IB 3ILIA 1A9NB 3JTOA 3MEGB 6FD1A 4OZNA 3NCRA 2LDYA 1HWLA 4UOHA 2MXYA 2RS8A 4EEYA 2NQPA 3DHWC 4OZ2A 4RNOA 4K4VA 4X4UA 2UV8G 2Y9HA 4KPYA 5KFXA 3OXFA 3DN9A 4ZN3A 3I56S 2OO4A 2G1HA 1KDNA 1TR0A 2F4FA 2Y1IA 3TA1A 3N6NA 4OJ3A 2DCUB 2U1AA 4LSNA 4HTJA 5DDQC 4E8UA 1HNVA 2K3IA 3VAIA 3C15B 4L3NA 2FJBB 3W65A 4LBIA 3UR0A 3CCTA 1EETA 1JJCB 2FGOA 2GO9A 4RUBA 3BSOA 3DDNA 4QPXA 2R3VA 4MT1A 4USJC 4A8OA 5J1EB 1SH3A 4DG1A 3OFEA 2ALYB 2XS5A 1WEXA 4CCHA 4GKKF 3V6HA 2UU9F 2RKIA 5BR8J 1BQMB 4EYIB 4Q8FA 3H98A 4CT8A 1RT7A 4NA2A 1WTFA 4Q2LA 1VHIA 3C6UA 2V4RA 2VFRA 4MFBB 2UUTA 5L39A 1JLCA 1FX4A 2KL8A 2J0WA 3FRZA 4WBFA 2XNRA 4YHHF 2KZZA 1S76D 2WSEC 3TJAA 5AJ3F 2LA4A 2CPDA 3FRYA 2ZH4A 3GYNA 2CVEA 1R7IA 3NS7B 3TRGA 1JLFA 3GSIA 2OGUA 3AT1B 4UT4A 1PYOB 1U2RA 3WQPA 3NWGA 3KG1A 5K8NA 1KLNA 5C2GA 4QWAA 4Q5VA 2CQ4A 1WTBA 1RI7A 1REVA 4JI8J 2MQNA 4PCQA 4A4JA 3IWLA 3U7JA 2RB7A 4EMDA 2ZVIA 5H9FK 3UFCX 1U2FA 2UVRA 4UQGA 4YB7A 2RIJA 4ZP7A 2DGQA 2F65A 4DPOA 2J7KA 5HL7Q 2H4WB 1UA1A 4R0EA 4DDFA 2KB2A 5IQQA 1GMUA 4YY3J 1C0UB 4ES1A 3KK1A 2HW3A 1OPZA 2MY8A 1B7YB 2IM3A 3W8PA 2CQ2A 2LEPA 4DV1J 3DU5A 3PW2A 2B5JB 3F44A 2OPRA 1V9OA 2GX8A 4M5GA 1FX2A 3ICLA 1YBTA 1JXEA 3KMQA 2BXJA 3UCGA 2RRNA 2UV8A 4DSJA 1FKAF 5L1KA 3OVBA 3CD0A 2CAJA 2MQLA 1RAOA 2X1AA 1X9SA 3G8TA 2KT5A 2EC2A 1NDKA 3U1LA 3QJJA 4LFCJ 2OPPA 2V6AA 1JLGB 3D3BJ 4TKTA 2QEXS 3DLHA 4Y2IA 4QOTA 1VQPS 3NGTA 5I3UA 1S0OA 4FVMA 3KKFA 1GMWA 1HYSA 3J80U 2EC0A 2HBRB 3H2VE 2RF2B 4BC9A 3VVUA 4RNHA 3CNQP 4G3IA 1ZYQA 1XBWA 3CGIA 2QA2A 5E0OA 3FSXA 3IRXA 5LSRA 4ETZA 4WTOB 3KNGA 4LF8J 3H4DA 1KR4A 1CULB 4IG0B 3QT8A 2K06A 1VK8A 1RWMB 3P49B 1FF2A 4LSZB 3N5BA 3GIMA 1QTNB 4KE5A 1ZM2A 2WOMA 3IO1A 5L9XA 3GIJA 2QA4G 3R5JB 3PVXA 2XLJA 2AWZA 2DRAA 4J7CA 2DHXA 5F0UA 4UOGA 2BE2A 4MKVA 3FGVA 2HIQA 3EGNA 4HVZA 3H5YA 1VQOS 1HPZB 4ZVSB 4Y2KA 4V19J 2VZ9A 1RT2A 1RACB 3KHRA 4DI6A 4I67A 4K0KJ 4KFBB 4KYZA 2VC0A 3IP0A 4P2XA 3QFWA 1SBRA 5HSPA 2O01C 5KT6A 4LF6F 4HT7A 4QIVA 2PD1A 2M70A 2V8HA 5HN0A 3BZQA 3T41A 3GJSB 3KK2B 1S9EB 2V94A 2VBWA 1NJWA 5B0CA 5A8WB 2AX0A 2QL5B 1NJXA 2JLGA 1RYRA 2G2YA 1NK5A 4FBUA 4GO7X 1U8WA 3D0GE 1VQ4S 2BJ9A 4B3OB 1Q8IA 4OI4A 2VBXA 2BOAA 3GTYX 3ULHA 2OEMA 1RAEB 3JSMB 2VFVA 4J9NA 5D4LA 1SXLA 4BDPA 2DRDA 2IAJB 2C2MB 3M8WA 4F02A 4RNFA 3SSSA 1TELA 2QL7B 3UI3A 4WZQA 4MTPA 2FVQA 5HLFA 1K8AT 1IQZA 2LXFA 1KWMA 3U02A 2CPJA 1N8RT 4ED2A 2FYXA 4I6WA 2XY7A 4X4PA 3DXSX 2FHOB 2X1GA 1TKZA 1I5OB 2A1BA 2GA7A 3GV8B 3G96A 3BV8A 2UXDJ 3EPIA 4PWDA 2FHJD 2QC3A 3ENQA 4CTAA 4IR1A 1RT5A 3M8PA 2MQ8A 1G4CA 3LPEA 1IBMJ 4NMXA 1WKLA 2IVMA 2N7CA 5KG2A 3PYFA 1WEYA 4KTQA 2ROPA 4DN9A 1P6TA 4LSNB 3GLJA 1HNVB 2JLEA 2EFQA 1XNRJ 4DSIA 3I9ZA 1FWLA 2UVWA 3R5CA 4J5OA 2P8IA 4YP3A 3UDCA 2I6WA 1UAWA 4YEAA 4PPDA 1EETB 3FCHA 3FCVA 3L9ZA 3TW0A 2AGPA 2HHSA 1R8HA 1RHMB 2C2KB 4WWSA 4HTIA 2HFUA 1M1GA 2W2QP 4DG1B 4LF5F 2MPUA 4K5RA 5AXLA 2KDOA 2RKIB 1HKAA 5RUBA 4XPCA 2GS8A 1FWPA 1HNWF 4DV5F 3NGDA 1U0HB 2IIHA 3R1HA 4J90A 4UUWA 4CO0A 4X62J 4DPTA 1RT7B 4ZPDA 3C6UB 4RKUC 1DQAA 4Y2MA 2QZ8A 3QQCD 1JLCB 2AZ1A 2MHNA 3IM9A 1JJ2R 1S97A 3MPVA 2AJ1A 4QPTA 2V63A 1F2GA 4CO5A 1SVDA 3FVYA 4RBVA 2HHPA 2WSCC 3MPUB 4NRUA 5KOWA 1FNMA 1SQEA 2GMJA 3HX9A 3QO9A 3UDLA 4XPEA 3CC4S 4UUXA 1JLFB 1Q82T 1YGYA 4U7CA 4DSFA 3P45B 1ZPVA 3OTEA 2FLLA 3Q8PB 5JJBA 3ZZ0A 2CQGA 3MTJA 4RWXA 2ASLA 2QN6B 3M05A 1IKVA 3D6TB 1S57A 3ILJA 4NL5A 4MKYA 3MOJB 4LRBA 3R2CJ 2B7BB 4ZVOB 2PI5A 3HHLA 2MZJA 3SFUA 1SC3B 3TQ1A 4G6VB 1WC4A 2DNMA 4KGXB 4H4OB 4OMFG 1KOHA 1UP1A 5K14A 2LYVA 2PEBA 1RBLA 4E2FB 1UVJA 2C3PA 1ZBTA 1Q1KA 4NLTA 3B4DA 3KK1B 4I2QA 5A2QY 2L9NA 3MEDA 1L3SA 4B9UA 3IGVA 2FIUA 5LMUJ 2IRUA 1LXJA 2DGXA 2OPRB 3KLIA 4NA3A 2VC1A 5A6PA 2MKJA 3SI8A 1GMWD 1HW8A 1FJCA 3CCMS 3MI7X 4JOUA 4BHQA 2E1AA 3CJ8A 4OLPA 2EG1A 3HVTA 1MROA 3GIKA 2OMOA 2QMXA 2KT2A 1AB8A 1SL1A 2OPPB 2B8QA 1HARA 4HI2A 3MD3A 2OIHA 4DR2J 1RHUB 3GR0A 5I3UB 3CSKA 4CH1A 4CZCA 4I56A 1JQGA 3NAIA 3BH6B 1T05A 1HYSB 1UPPA 3M6VA 2E5IA 5DDRC 3IBWA 1Q7LB 3Q24A 4ZVPB 2OH2A 1AFIA 2X1FA 2AEFA 2HFZA 5GAEI 4AQYJ 4NCGA 3PO5A 2GHPA 3LA0A 1UFLA 3C16B 3D28A 3IRXB 1R43A 2CPIA 1LEOA 3CDEA 1APSA 2D3UA 1FFGB 2RDIA 4UQTA 1J27A 4LR9A 1U2CA 2ROEA 1Q0NA 1FVQA 2BR0A 5EUHA 2Z2YB 3MTKA 2H5IB 2DXEA 4DLEA 4TLQA 1WNEA 2G4BA 2A2DA 4AL5A 3UD3P 4KGMA 4Z7YA 2RDDA 1RKJA 1ZS6A 1WKJA 2HK2A 3AQPA 1Y9OA 1RJJA 3JS9A 1OMSA 2ZM6F 1WF2A 4LF2A 2BE2B 2XS7A 4CDIA 2D74B 3PRVA 3B6BA 1TTHB 1Q86T 2FQQB 1H98A 4C97A 4EBDA 4TU7A 1ZH5A 1RT2B 2WW4A 1T94A 2FJXA 2XYGB 1QTMA 2XB2D 1GK8A 1KOOA 3OVSA 4ZKAA 2IY5B 4DR4F 3EX7B 1WKKA 1S49A 1MN9A 4FYVB 1DQ9A 4EYHB 2B4OA 4LF7J 3J7Z5 2DGOA 1JJ4A 1H2TZ 1X4FA 2FZCB 4Y65A 4M5DA 4ZVGA 4C0OC 4EUVA 3HMJG 2C3MA 1WHWA 2MKSA 1QD1A 2W9CA 2VA3A 3J7ZT 3DFEA 2B43A 3OR1A 2ZC3A 2ZD1A 2V9WA 3GSDA 3ZTRA 1HD0A 2BE9B 5F9LA 3Q8RB 1UTAA 4YB5A 1RLCL 2V68A 2D3OR 2R2UA 3GFZA 5IT9Y 2WVFA 3J7YI 2AJ0A 1H7WA 3MCOA 1VC5A 1TK0A 2DXFA 2UVUA 3EDQB 3TI0A 3MUMP 1D9DA 2AJ4A 3BB5A 5HLFB 2HAIA 2KN4A 2HFVA 5KG4A 2B8PA 2EBGA 5ETMA 5IC4B 3OL8A 4HL9A 7FD1A 1FKPA 5GMEA 1F3FA 5A6WA 1MLAA 2QLWA 4FYXB 4J9MA 4U67Q 1DAXA 3AD8C 1TKZB 4WP9A 2RQKA 2XY5A 1X9MA 4PWDB 4CTAB 3CO9A 2MEWA 4FDFA 1RT5B 2CRLA 3M8PB 2Q3PA 3QAEA 4B9MA 3PJ9A 1NUEA 5FJ4A 3V4MA 3MM7A 1F5CA 3CJSA 3PFOA 2B4VA 3QSYB 1T3OA 2XCAA 3KJVA 3GG0A 1HBOA 4RW8A 4KJIA 1H73A 3EGVA 3KLHA 4CO3A 2DVIA 4OQJA 3HULA 4LF9J 4QWDA 3H90A 5J2MA 1PSDA 1XMQF 3GCXP 2ERRA 4OX7A 1RWXB 4L72B 4KGVB 3CJKA 1RCOB 1IR2A 2CDQA 4ZDNA 4C48A 4DX7A 3US5A 1XNQJ 4A48A 1WC1A 3WX8A 1WHVA 4MYTA 1AA1B 1NKCA 2FHKA 2W24A 3FEZA 2YQ3A 1DHMA 3JTPA 4D3HA 4QWBA 3BO3A 4TNOA 2Z2MA 5LMNF 1KHVA 3M2RA 4MYUA 4TU8A 3DI6A 3R97A 2J8SA 5CYQB 3GIIA 3HHLD 3QO9B 1FDBA 3W1YC 3GU0A 2LMIA 4NXMF 2VJUA 4HR2A 1WF1A 4FXWA 2COLA 2KJVA 3CPWR 1N32J 3HVRA 4G65A 2NPFA 2FC8A 2DY9A 1N36F 2P2CB 4J9UE 4LREA 1L5UA 5HVGA 2ZZMA 3HHLB 5DG9A 4RLEA 4USMA 2RDJA 2A6MA 4NPOA 2HHTA 4FF3A 3FEXB 1KLMA 3I5AA 3HHLC 3HVWA 3B54A 4ZVTB 4FKXA 2AU0A 3W8GA 1MG7A 5K14B 2DR7A 3D67A 4NLPA 4FZVA 1H72C 5C7PA 1OQ3A 4DR7J 2GC8A 2XI2A 5M2RA 3ONQA 5T14A 3SYZA 4I2QB 1S7HA 4FVCA 3MEDB 3OL7A 1MU2A 3TVZA
chains in the Genus database with same CATH topology
1RAJA 3MEEB 4ZPWR 4A8FA 2H5EA 1L3TA 2J5AA 3H2UB 3K59A 1V6HA 4X64F 2XSJA 1WD6A 4DF8A 3PX0A 2J9DA 2Q79A 5LXRA 2R2SA 3KLIB 3BN7A 2BABA 2GMHA 2HNYB 2C3YA 1TL1A 3THPA 4OV1A 3U1MA 4MFBA 3HJFA 1NZAA 4GKJF 4LVNP 4NLRA 5CZXA 4FXVA 4DLGA 2MZSA 2ZOGA 3HXMA 3KLGB 2FJVA 2B6AA 3IFEA 2UXDF 2QA1A 4Y3CA 3S1TA 1R8PA 2P5VA 2E29A 2RILA 4O4GB 3N4WA 3TVKA 1VK3A 5KFEA 1IKXB 2LLZA 4XDCA 3TNVA 4EFAC 3N5FA 3DMJA 3HVTB 5T7LA 3PJWA 2JEFA 2VODA 1U49A 1MROB 3NBPA 2OD4A 4TN2A 3RAQA 4JV0A 2KHDA 2QO3A 4ECUA 5IS2A 2JLFA 2N3OA 4K50A 3TYTA 4H54A 1HBNB 2Y0SD 5D77A 4RU9A 4DUYF 4JI3F 5KFFA 1TAUA 2WBRA 1P8GA 4JV5F 1QAXA 3M2VA 4DEZA 1U1KA 2KI2A 3LW5C 4TLRA 3UCUP 2C42A 3OL9A 1KD1T 3MXHP 3HKZD 1CG2A 1NK8A 2F8EX 1IM4A 3R5AA 4AXIA 1KQGB 2K1RB 2XWXA 4QWEA 5DM7Q 2DR8A 3CF5Q 2IYIA 2VKZG 1T05B 1HQEA 1MMLA 1UMJA 2VQEF 1FRKA 1KFSA 5KFIA 4LSLB 1SC6A 2KT3A 2NPIA 1IJEB 4H4OA 2JSXA 5HI7A 1ZZNA 3I0SB 4I0WA 4Q0BA 3PKMA 1V3RA 4IO1A 4HDGA 3CWJA 4CO1A 4OHZA 3AH6A 2DRBA 2AJQA 3ZZOA 2DD8S 1SL0A 1U6ZA 1DBDA 2ZJPQ 3PIOQ 2HGLA 4HEA9 3IR6B 2VOPA 4NCGB 4HH1A 4Y00A 3I82A 5F8MA 1SJQA 3OVAA 2EI5A 2DNGA 1SKWA 4N5SA 1Q81T 1HNZF 3BGFA 4Q7AA 4I6YA 4X4VA 5KFUA 3BGUA 3PZPA 3PM9A 1YTYA 2JRSA 4FXDA 3IS9B 2X3GA 5CQGA 3RW6A 3GV7B 3OFHA 1AXQA 4ED0A 2HZCA 4PUOA 1NK6A 1S72S 4Y28C 3GWCA 1FRHA 4W90B 5EGYA 3H40A 4X4RA 3NNAA 2WHOA 3ZZRA 3OR2B 2AX1A 1IR0A 1JLEA 2MZTA 5KFSA 4O23A 3W2VA 2JC0A 1VQ5S 1NRKA 1RT6A 4LJMA 2J7UA 4OI6A 4WZMA 2KH9A 3DRSA 1HFEL 2JJ4D 4MKAA 4NLXA 5K8MA 1QY7A 4ECYA 1UVIA 2BM1A 5DGBA 1XMOF 4OZLA 3CDBA 3G8SA 1VRTB 4X62F 4IOCQ 4C3KA 5CCMA 5BYSA 2FUG9 3L7PA 1S4FA 3OV7A 4RW4A 5AXKA 2RQ4A 1KTVA 4ED5A 1FJ7A 3ETOA 4J9QA 2CQ3A 3M6XA 1K0TA 1S6OA 5L9NA 2C28A 5HP1A 2CPYA 4ICLB 2OSRA 1N6QB 1C0UA 2N4CA 3E51A 1HI0P 3G6XA 4YOEA 3OFFA 4B9LA 3EYZA 3O44A 2DNLA 4CO2A 4ELVA 3HKWA 1SKRA 4DL5A 4FF2A 5JVHQ 5H9FJ 4DL4A 3I31A 4WKRA 4LQ3A 1Q8BA 4IDKB 2HWIA 1KQSR 3SCKE 1LFWA 4O3PA 5GADI 1M90T 1JLBB 3DU6A 3KG0A 2R7VA 2XMUA 3GB0A 2FD2A 3PV8A 2DNYA 4LF4F 2JOQA 3K5MA 2B5JA 3KG4A 4ZVFA 1TKXB 4HH0A 2BRLA 5FIIA 5I42B 2MGZA 2QA4S 5LJ3Y 3QYYA 2R9LA 1T95A 2I38A 2HHVA 1R3NA 3QIPA 3HHNB