3HVWA

Crystal structure of the ggdef domain of the pa2567 protein from pseudomonas aeruginosa, northeast structural genomics consortium target par365c
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
159
structure length
159
Chain Sequence
YNRLRLQEDVSLRLQRDGALTVIAADLLPLALLNTIIRTLGYPFSNDLMLEARDRIRAELPDFTLYKISPTRFGLLLPRQQQEETESVCLRLLRAFESPVVCRGIPIKANVGLGVLPLADDTLDGDQDWLRLVVSAADDARDRGVGWARYNPPLDQAQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Northeast Structural Genomics Consortium Target PaR365C
rcsb
source organism Pseudomonas aeruginosa
molecule tags Lyase
molecule keywords Diguanylate-cyclase (DGC)
total genus 49
structure length 159
sequence length 159
ec nomenclature
pdb deposition date 2009-06-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3hvwA00
4LQ9A 4K4VA 4IRKA 2IM2A 1MU2A 3T19A 3KK3A 4K50A 3V6DB 3TAMA 3GILA 1S1TB 4O3RA 4DG1A 2XWYA 2BR0A 2R2UA 2V0NA 1TVRB 2ZKUA 3DLGB 4I2PA 1FKOA 3GYNA 1HNVB 2YNFB 5KFUA 3T5LA 5KFGA 5DGAA 4QWCA 2BRKA 2YKNB 3G6YA 3IS9A 2F8EX 4O4RA 1ZTWA 1N5YB 5F8LA 1RAJA 4NLTA 3HHKA 3N6LA 3T1AA 3GV8B 2W9CA 3EPIA 4EBDA 3I5CA 3PW7A 1RTIA 4IDKB 1RT1B 4RW7B 4O3OA 5J2NB 3I5AA 5EWEA 3BQ1A 1QUVA 4TYAA 4ECQA 1WNEA 3T5HA 3DM2B 4WFZA 3QO9A 4URGA 5DLGA 4K4UA 4MIAA 3DYAA 3DRRB 1T3NA 3BQ0A 4WYWA 1JLBA 4NZ0A 3PHEA 3BJYA 4IRDA 4MK9A 1IKWB 1JLQB 1IKVA 4NYZA 1QAIA 2W9BA 3M9OB 5KFTA 5KT2A 1HARA 3GV5B 1IKWA 2JEIA 2IC3A 1BQNB 4ZHRA 4IFYA 5F8MA 2R8KA 2VG7B 3KOAA 5DG7A 2ZE2A 4LSLA 3NAIA 4RNHA 3QO9B 4XPCA 2IM1A 3DYAB 4ZPCA 4ZVFA 3SI8A 1TP7A 1HQUA 4KFBA 2R2RA 1NHUA 2W9AA 2XI2A 3CDUA 2B5JA 4IG3B 3OL6A 3M9MB 3JYTA 2J6SA 1NHVA 1C1BB 1JLFB 4PWDB 2CJQA 5DQIA 4H4OA 1HNVA 1S48A 2YNFA 3FFIA 5C24A 3PR5B 3KHGA 4ZHRB 5KFXA 1XR7A 4DL4A 1REVA 2IC3B 1FK9B 2UUTA 3H4DA 1S1UA 4HKQA 1S1WA 4G1QB 3KLIB 1N6QA 1LW0B 4YR2A 1R0AA 2VG6A 4MKAA 4MFBB 4QPXA 2ILZA 4XPEA 3KHLA 3JSMA 3PJXA 5KFOA 4KO0B 1RTDA 1BQMA 3DOLB 4GC6A 1MMLA 4YP3A 3C6TA 5KFKA 5KT4A 2OPSA 3ISND 2J6UA 1S1VB 4O44A 2IA6A 4J9QA 2FLPA 4NCGB 2AX1A 3RAXA 3BQ2A 1RT4B 1XR5A 3DI6B 3QIPB 4Y3CA 3BR9A 4TY9A 5DQGA 2R8JA 4QW8A 4ED1A 4M94A 4Q8EA 3PW0A 4MKBA 5KG2A 1S0MA 1GX5A 3MR3A 3LP2A 3G86A 1RT3B 4IG0B 4URSA 3KLHB 2IM0A 3IS9B 1S0OA 4JV2A 1QAJA 2W7OA 2OPRB 4WE1B 3FDSA 4ECSA 4Q8FA 5T14A 2R8IA 1RT5B 4KKOB 5F9NA 3QLHA 4F4WA 5F9LA 5KG7A 1RTJB 4IRCA 2XCPA 4ZPAA 3H5XA 2HWIA 4K4TA 2DPIA 1VRUA 4J9MA 3H59A 3V81B 1LWEA 1D1UA 1S6QB 3JSMB 4TYBA 2XI3A 4FBTA 5KG1A 1BQMB 5KFWA 1S4FA 4RW6B 2D3ZA 4RW4B 4NLOA 1C0TB 5F8HA 4RW8B 4RUCA 4J9PA 2ATLA 3LAKA 2RKIA 4EO6A 3GQCA 1VRTB 4LSNA 4RU9A 3RB4A 1N56A 1RT6A 5KT7A 1CSJA 1RA7A 5KFBA 2HWHA 3PR4A 5KG3A 3CIZA 3CJ4A 3QGIA 3KK2B 5KT5A 5KFQA 4K4ZA 1RTHA 1C1BA 2UVRA 3V4IB 4RNOA 3NMAA 1JLFA 4PWDA 3UQSA 3CWJA 3M8PA 2FJWA 3MF5A 3KMQA 4RNNA 3BSOA 3QZ8A 1JKHB 2HNDA 4YR0A 2W9CB 2FVPA 2JLEA 1T94A 3LP0B 5DG9A 1HQUB 5KFAA 3OLBA 3V4IA 5KFPA 1S0NA 3I0RA 3MFIA 1RT7A 4IH7A 2ILYA 2R8GA 2YNHB 2R2SA 4K4SA 4J9KA 2VG7A 2V9WA 1C0UA 4GC7A 4MIBA 2C2EA 1RT2A 4F50A 4R5PB 4RNMA 2WB4A 1JLQA 4ID5A 3MFHA 1T05B 4KHRA 3CJ0A 4ECTA 2C22A 1C0TA 2J6TA 1RT2B 3H98A 4OL8A 3DMJB 1SUQB 3KLVA 3IGVA 2AGOA 4IKAA 3KJVB 2ASJA 3MEEB 5DGBA 5KFFA 4Y34A 5JUMA 1IKYB 4NLPA 3I0RB 3RBDA 3HVTB 2GIRA 2IJNA 4Q0BA 2YKMB 4KHMA 1Z4UA 5KFSA 1RT1A 2UUWA 3QGGA 4WE1A 5HLFA 3M8QB 5I3UB 3OL8A 4WFXA 3MEGB 5C42A 5F8JA 3NGDA 4RZRA 3PW5A 2YKNA 3MEDB 3HVAA 2XGPA 1TQLA 3M8QA 4Q45A 1N5YA 2B6AA 2RF2A 3GV7B 3NL0A 2QE5A 3DLKB 1XR6A 1TKZB 1ZETA 2ASLA 2WK4A 2D41A 4KAIA 4ICLB 1S1VA 2BRLA 3ITHA 4O44B 4ED7A 4RW4A 1RA6A 4ED6A 1HNIB 5J2QA 4YR3A 1TV6B 5F8IA 1NNDA 4M95A 4QWBA 2EC0A 5KG0A 1RYRA 4Q44A 4KO0A 3ITHB 4ED2A 1RTDB 3MTKA 5F8GA 3DLEA 3D28A 4QW9A 3CDEA 4EEYA 3OL7A 5D3GB 2FVQA 1FK9A 3QZ7A 4FBUA 4KB7A 1S1WB 4ZPBA 2B6AB 2RF2B 3E01B 3CDWA 4IOBA 2IM3A 4TY8A 3OLAA 2FJXA 2JC0A 3TVKA 2JEJA 5KT3A 4TXSA 4ECUA 5JXSA 3PW4A 3HKWA 1LW2B 4KBIA 5L1IA 3FSIA 4K4XA 2CKWA 2OPPA 5DQHA 1U09A 3DRSB 4KE5A 3BSNA 4KFBB 1IKYA 2OPQA 4DL7A 1TL3B 3KK1B 3QIDA 3Q8RB 3NKYA 4XO0A 4IFYB 4JV0A 5EUHA 3KLGA 2FVCA 4NLWA 3E51A 1LWCA 4ECXA 4B3OB 3DMJA 1SH2A 2I1RA 3I0SB 4I7FB 3UR0A 5KG4A 5L1JA 5C25A 2W8KA 5CYQA 4DL6A 5KG5A 3CJ2A 3IG1B 1KLMA 3MECB 4IH5A 4WXOA 4IR9A 5HBMA 1KHVA 4FS1A 3EZUA 4B3OA 5CYQB 2V4RA 5CYMA 1HMVB 3IRXA 1J5OA 4O3SA 2AQ4A 3KNAA 3NBPB 5F8NA 4MK8A 4H4OB 2ZD1A 1EETB 4O4GB 1TL3A 3GIJA 3RB6A 5HLFB 1HQEA 4X2BA 1RTIB 4MK7A 2I5JB 3RBEA 2E9TA 4NRTA 5J2PB 5HP1B 5I42A 2XGQA 1EETA 4WZQA 1EP4A 2C2RA 2HNYB 3CJ5A 5DLFA 3E01A 3NAHA 1DTTA 4TLRA 1YVFA 3TQ1A 1JLEA 4JUZA 2IAJB 2ASDA 4I2PB 4I2QB 4RW6A 1S10A 4IFVA 4RW8A 1C1CA 4NLXA 5KT6A 3M9NB 1S6PA 4RW9B 2XCAA 2IJFA 5C25B 3KLEA 1N4LA 3CO9A 3DOLA 5FDLB 4G3IA 4FS2A 1LWEB 1C1CB 1JLBB 3Q8SB 1TV6A 2HNZA 2GC8A 3UDLA 3OHAA 4PQUA 1JLCA 1S1UB 4R8UB 1REVB 4O3QA 1TKZA 4NLUA 3SFGA 5KFRA 3V6JA 2AU0A 3DLKA 3H5SA 4JV1A 1QE1A 1IKXA 5KFJA 3BSAA 4ECZA 3CVKA 3QYYA 5HROA 2C2DA 4DL3A 1RT3A 4IG0A 5I3UA 4LQ3A 2I5JA 2UVWA 2W7PA 3RB0A 1JLGB 4ZVEA 1RT4A 3MR6A 4WZMA 4NCGA 2ZD1B 3DI6A 2WTFA 2HNZB 3MR5A 3DLEB 1S1XA 1N48A 4PUOB 4PQUB 4EYHB 1ZTTA 1TL1A 3KMSA 4IR1A 1BQNA 2D3UA 4NLYA 3SFUA 3MR2A 1S6PB 4ECWA 4IFVB 3KLFB 3H5YA 5J2QB 4RW9A 2R8HA 4F4XA 5K14A 1RDRA 4F4ZA 1IKVB 4H4MA 2VG6B 2UVVA 2VG5A 4ZP7A 4R5PA 4G1QA 3I0SA 4I7FA 4J9RA 1DTTB 2AWZA 3T5JA 3C6UB 1JLAB 4WXWA 2FLLA 3UPFA 1TKXA 3DRRA 1SH3A 3KK1A 2QV6A 4ZVHA 2R2TA 1RT7B 5J2PA 5HP1A 1HYSB 1S49A 2ALZA 1S9EA 4RUAA 5J2NA 1K1QA 3DOKB 4ZVGA 3G6XA 2IMWP 3FQLA 2YNIA 3M8PB 1JKHA 2HNDB 5KFIA 5KFZA 2YKMA 3IN5A 4YMEA 5J2MB 2BQ3A 1HYSA 3LANA 2ZE2B 4WYLA 4ZP8A 1HMVA 3IRXB 4LSLB 3C6UA 3FRZA 1SUQA 1J5OB 2BANB 1TVRA 1TKTA 1T03A 2IBKA 1S9GB 2BQUA 1T05A 2BANA 3KHRA 2IAJA 2B43A 5KG6A 1MU2B 3VQSA 1UWBB 2BE2B 4NLVA 5EWGA 4IH6A 3KK3B 3OSNA 1HNIA 2JEFA 1VRUB 3IGNA 3DDKA 1S1XB 4PUOA 2AGPA 5J2MA 1DLOB 1EP4B 1HPZA 5J1EB 2V4QA 3PVXA 3H2LA 4IDKA 4RW7A 5KFVA 2OPRA 3QLHB 5KFEA 1LW2A 2OPPB 1S9EB 4DEZA 4ECVA 2WCXA 3RB3A 3LALA 2FLNA 2HMIB 3H4BA 1IKXB 3LP2B 3KLHA 3KK2A 3NBPA 4TN2A 5EWFA 1JIHA 4NLQA 2AGQA 5L9XA 4LSNB 1JXLA 5D3GA 3KLFA 1KLMB 3MECA 2E9ZA 4H54A 1S1TA 3GIMA 2YNGA 3V6DA 5L1KA 3KHHA 1LW0A 1R0AB 2E9RX 4MFBA 2W8LA 1RTJA 3D5MA 4ICLA 4KKOA 4QWAA 3RAQA 2FVSA 4WFYA 2HAIA 4O3PA 3OL9A 3HVWA 5KFHA 3MEGA 5C42B 3Q8QB 5KFCA 5I42B 3V6KA 4F4YA 1QE1B 5HROB 2WONB 4TY8B 5EDWA 2HMIA 1SV5B 2RDIA 2WOMA 3LP1A 2JC1A 3BREA 5KFYA 2B5JB 4IG3A 4ED0A 4Q0BB 2WRMA 3HVTA 4O4GA 1HPZB 4R8UA 4J9NA 1SH0A 1JLCB 3GIKA 3T5KA 5J1EA 2DPJA 4R0EA 4TQRA 4NLRA 2OPSB 1KHWA 3KJVA 2JEGA 5CYMB 2C28A 1UWBA 2BE2A 3KLEB 2D7SA 1LWFB 4ZP9A 3DRPB 2YNGB 5FDLA 4J9LA 2RKIB 5KFDA 2W9BB 5KFNA 3PJWA 3IG1A 4EBEA 1JLEB 4EBCA 1TKTB 4ID5B 4I2QA 1GX6A 3DRPA 4O3NA 1S9GA 1T03B 1FKPA 1OS5A 4K4WA 3OHBA 4ZMMA 3V81A 4KSEB 2HNYA 3N6NA 2YNHA 4DL5A 1W25A 3BSCA 4KV8B 1RT5A 4U6PA 3JYTB 4K4YA 3H40A 1HQEB 4MH8A 2WOMB 3QGHA 2WONA 3N6MA 2VA3A 5C5JA 4ECRA 4KV8A 3H5UA 3ICLA 4DG1B 4TQSA 3Q8PB 5L1LA 3MEEA 1RTHB 3ISNC 4IQXA 1JLAA 1FKPB 4NLGA 1TKXB 3DLGA 5KFMA 1VRTA 4ED3A 3QIPA 1IM4A 1RT6B 3I5BA 2WHOA 5K14B 5HBMB 2O5DA 3LAMA 4Y2CA 4Y2AA 1LWFA 4Q43A 1D0EA 4DL2A 3TAMB 4J9SA 3KLGB 4URQU 4ZP6A 1C0UB 4QWEA 1S6QA 4EYIB 1LWCB 2AX0A 4U7CA 2BQRA 3EPGA 2RDJA 1TL1B 2FJVA 4RNFA 1S9FA 3G6VA 2UVUA 3KLIA 1N6QB 3DM2A 1JLGA 2OPQB 3LP0A 3DRSA 4ED8A 2YNIB 1DTQB 4NLSA 1SV5A 1RYSA 3FFIB 3DOKA 5C24B 1K1SA 3BGRA 3LP1B 4NRUA 4NLDA 3MEDA 3V6HA 3PW2A 4YQWA 2VA2A 4EO8A 4HYKA 3PZPA 2XC9A 5DG8A 1S97A 2OH2A 3CJ3A 1DTQA 3BGRB 1FKOB 3GIIA 4ZPDA 4ECYA 2FVRA 4J9OA 1DLOA 2VG5B 3FQKA 3OSPA 2GIQA 4H4MB 1JX4A 3C6TB 5KFLA 4QWDA 1I6JA 1C2PA
chains in the Genus database with same CATH superfamily
4UT4A 2DR5A 1KQGB 1EX8A 1MWYA 1O51A 3P8BB 4IRKA 3KK3A 3GPAA 2VQFJ 3LGMA 4QOTA 4P2SA 5IWAJ 4DG1A 1B0TA 5CQGA 4CM2A 4CRJA 3RUBL 2V8PA 3MXHP 2V0NA 2NXCA 2ZKUA 4Y65A 1TAQA 1X4EA 4C9DA 3N01A 4I68A 3J7YI 4DF4A 4RBTA 2L3MA 1SI9A 1UAWA 3CDAA 3ET6A 1VOMA 5KFUA 4DMZA 2BRKA 2YKNB 3BO4A 4O4RA 2F8EX 2HAFA 1ZTWA 1NLKL 2BZ2A 2PMHA 1ACMB 2IHR1 3HHKA 3T1AA 3DDNA 3ZZPA 3BPDA 5IV3A 5IZHA 4N76A 2VZ9A 2RU9A 3UVJA 4X64F 5GAHU 3GV8B 1FKAF 1RI7A 2HURA 4EBDA 5HLFB 2RNEA 5L9NA 3N79A 1RHUB 1V5VA 2HLTA 3BV8A 3UCZP 3SBMA 4K4UA 5HSPA 3T41A 3G2XA 4PXEA 2V69A 3R7NB 3JTNA 4WYWA 2I6WA 3W3SA 3SDEB 4NZ0A 2MSTA 4FNIA 4RO0A 3DLHA 3BJYA 3G8SA 1UVNA 2M7SA 2HVZA 5ETKA 4MK9A 2HEKA 1IKWB 1IKVA 1AROP 4L6V3 2AYGA 2DNQA 5KFTA 5KT2A 2LDYA 1AYEA 2XSJA 1M5HA 4JI6J 4ZHRA 4IFYA 3RJMB 2PA8D 2CQIA 5DG7A 2C3PA 2ZE2A 1WKKA 2DNLA 3QO9B 4RNHA 1RU2A 3K59A 3H8YA 4X4NA 2MZJA 2GZOA 4ZVFA 4FYVB 3O5TB 1TP7A 3M8ZA 1VQMS 2UXDF 3I32A 4KFBA 1X4BA 5E3QA 4CLPA 1NHUA 4ZN3A 2C2ZB 3PY8A 2XI2A 3CDUA 2M88A 3R1HA 3JYTA 2J6SA 4OX7A 2BVZA 3FBBA 3GE9A 4PWDB 5A0YA 3HD1A 5DQIA 3FCVA 4FF3A 4JI3J 1XWLA 4H4OA 1RAEB 1S48A 2YNFA 3PR5B 4V19X 3OFFA 1RAGB 2R4FA 1X4AA 4K2XA 3MD3A 3V5RA 1U6FA 1N6QA 4OJ3A 4M5MA 2VG6A 4OV6A 2ZM6J 4XPEA 1CS4A 2JOQA 1BY9A 2VBXA 2CYYA 4MFBB 3SIPB 3KHLA 1UW4A 3JSMA 4P52A 3D1OA 3NP5A 4A48A 1RB0A 1BQMA 2M0GB 1XNQJ 4GC6A 3OTBA 2L41A 3CCJS 1S6UA 2DIVA 4JI2J 4YP3A 3C6TA 2V94A 1P9YA 3LWMA 4O44A 2KM8C 1VQ4S 4J9QA 2JNJA 2FLPA 4WK3A 1P27B 1H7WA 2GFFA 4NCGB 2XLJA 1RT4B 4Y3CA 2R8JA 2PSZA 2D3OR 1JJCB 2IBOA 4YDXA 1VRQC 3VZHA 4CP5A 2CXEA 4YEAA 4Q8EA 3PW0A 2YX7A 4N56A 4IG0B 2KDOA 5LXYA 4I67A 2JLGA 2Z8QA 3P49B 4NCAA 4XIUA 1NM2A 4PQAA 2W7OA 4ZCIA 4OYIA 4JV1A 4C8KA 4KKOB 5HVFA 3QLHA 2E7VA 2W2OP 2PEHA 2WSEC 3H5XA 4LBHA 2DKOB 3V81B 2WZ1A 2XSJB 1D1UA 1TFWA 4DQQA 4LFBJ 4FBTA 1BQMB 2Y1JA 5KFWA 3CSKA 4LT6A 1XNRJ 3B4MA 3OV7A 4RW8B 2XMWA 5B0CA 3GQCA 1U8SA 4E98A 3JAMU 3RB4A 3I55S 2E1MC 4HHJA 5EX3A 5KFBA 1B4SA 3PR4A 2VD3A 1F5BA 3CIZA 3GWCA 3TA0A 3QGIA 1IBKJ 2NLWA 3RW7A 5KT5A 3D6MB 1RTHA 1C1BA 2XYPB 4K4ZA 2UVRA 1UFLA 3NMAA 4DR5F 4UZBA 4LR8A 4ZDNA 4PWDA 2KFZA 2FJWA 1RAFB 4ZVTB 3MF5A 3DLLQ 1YKWA 3BSOA 1UJ5A 3GYGA 1VQ5S 1JKHB 4F25A 3EX7B 2FVPA 3LP0B 5AJ3F 2AJ1A 5KFAA 3V4IA 5SZTA 3FCHA 1S0NA 3I0RA 4OYZA 3MFIA 4CH7A 1WDTA 4F8RA 1SJ4P 4K0KF 4XDDA 4GC7A 1Z1ZA 1NK6A 4JI7J 5D4NA 1AB8A 5ETSA 1URNA 4LF1A 2DJWA 4B9MA 4C8YA 4ID5A 3MFHA 1T05B 1SJ1A 2ZUAA 1U8WA 1UEKA 3TAQA 3MM6A 2J6TA 1XMBA 2CWXA 2ZVIA 1BC6A 2VQFF 4OL8A 3DMJB 3I4HX 5LSLA 4X65J 3CD6S 1NJWA 1WOOA 3ZTQA 3IR7B 4IKAA 5MLCV 3H42A 3MEEB 2Q79A 3KJVB 1CLFA 1RZMA 2XG8A 4Y34A 1HNXJ 2Y0SD 4I4BA 3CE8A 3R2DJ 2GIRA 2KT2A 1FJEB 2V8GA 3FJ2A 4GMKA 3M6UA 4USTA 5K8PA 5KFSA 3KUGA 5FJ4A 2MLYA 5HLFA 4CM0A 1Q8LA 4WFXA 1WKLA 2FYXA 4L74A 4Q5VA 1CJTB 3QFWA 2QA4S 3VAIA 3HT3A 5F8JA 1FTCA 2C2KB 1TQLA 5D0RA 1VQ8S 1VR6A 1XR6A 1YZ7A 1ZS6A 2AKWB 1TKZB 4K7QA 3VAHA 2I2YA 2ZJPQ 1UVMA 2WK4A 5D4PA 3SSRA 9RUBA 1VI7A 1Q86T 2HRUA 4HI1A 4DR4F 3RRKA 2Z2MA 1H72C 4RW4A 4GVBB 4ED6A 3L95X 1S72S 3QNWB 3D0HE 4USKA 4M95A 3AOAA 4QWBA 2DNKA 3HLUA 4WTOB 2AEFA 5HJYA 4AQYJ 2A2CA 4ZIWA 1RTDB 4BC9A 3MTKA 4QW9A 4FXWA 5D3GB 3J81U 3MCOA 4DV3J 2GVZA 3GG0A 4FBUA 4FDFA 4QU6A 1RABB 4Y00A 2AJFE 3E01B 2E7XA 2Z57B 4IOBA 4WIIA 1LOUA 5ADZA 4E0DA 2HQFA 3ULHA 1RAOA 3OLAA 2JC0A 3M8RA 4FYDA 4WPAA 3EXCX 3A3OB 3QRRA 1VQOS 1ZAXA 3AY0A 5D0GA 2LQ9A 2VIHA 4ANCA 4HL9A 4DV1F 4I1TA 1HNZJ 2FHOB 4KTQA 1FHTA 3D1HA 1AXQA 4I6AA 2DR9A 4DPXA 2YKAA 1VK8A 3OD2A 1TL3B 5A6PA 2E1RA 3NKYA 4XO0A 4JV0A 1RGVA 1VHIA 2ADCA 1SH2A 3I0SB 3IXQA 3R97A 3MAAA 5C25A 2W8KA 5L1JA 3O2IA 4DL6A 1EIYB 4PPDA 4IH5A 1KLMA 2OKQA 2FLOA 4A8WA 3OTDA 1N54B 4M5NA 4LF2A 2XO7A 4FS2A 2V4RA 3EXYA 5DDOC 2ZZTA 2QLFB 3H7HB 5A8KA 2GIFA 4X4QA 4ER8A 4DR7J 3MPWA 2E29A 3A1YG 3CNQP 4RUBA 2EFVA 4C7QA 1I51B 4MK8A 1JB0C 5I4MA 1NJIT 1QDUB 1HWUA 4MMOA 2CWKA 4WU3A 4F7VA 1F0XA 1EETB 2ZD1A 4ZCKA 3GIJA 4F2SA 3DKDA 1N34J 4GKJF 4JI0F 3VTIA 1DFDA 5I3QA 2F7VA 1H74A 4DS4A 4X2BA 1RTIB 2B51A 3KG0A 5ETRA 3T1YJ 2IDLA 1EETA 2B4VA 5JMNA 3BM7A 2C2RA 3M1VA 3OT9A 2IFXA 2YQ0A 3E01A 3D3BJ 2K8GA 3TA1A 2EI5A 2MKJA 1B0VA 1YVFA 2DGUA 2WBMA 2NUHA 3RYLA 4DZ6A 2BJ1A 3BO2A 3TQ1A 3IP0A 4I2QB 1DZ5A 4RW6A 1S10A 4B3TF 2CA9A 4IFVA 2IA0A 1C1CA 4KYZA 1S6PA 1K47A 2YY3A 4RW9B 5C25B 4LF6F 3D4JA 5FDLB 1OJ4A 3O6QA 1F2HA 4ZVOB 1F9FA 1LWEB 1FJGF 3RG6A 4ZS6A 4X66F 2ZITA 3EGVA 1S57A 3HHLA 2DXFA 3G8QA 1NSQA 5BYRA 1PILA 4CYUA 5E41A 4DSJA 3T6JA 1QSLA 2DXEA 2ROPA 4R8UB 1TKZA 2M8HA 3K17A 2GA7A 4DUTA 4EZ6A 4KH1B 5KFJA 3BSAA 4W98A 2GHVC 3M2VB 4J7CA 4LFAJ 3QT8A 3IAS9 1Q8KA 4DL3A 1NPKA 1RT3A 4L76A 2CQHA 1FRLA 2UVWA 2O67A 2KXHA 1HWIA 5CAAA 3TVZA 3FC9A 4Y28C 3HM9A 2GHPA 1JXEA 3A8IA 2KVQE 3MTJA 4RUHA 2Q43A 1XERA 4FYYB 2HBQB 2E5HA 3G71S 1SC1B 4PQUB 1TAUA 2MQLA 2G9OA 1M90T 5AXKA 1BQNA 2WAQD 1KVJA 3MWBA 3CJSA 5RUBA 1N32F 4PEOA 4ECWA 2B56A 3ENAA 3ILJA 3TNVA 2HK3A 4JYAJ 3K5PA 3K89A 2R8HA 5HJXA 1HQ2A 8ATCB 1RJJA 2W4CA 1BWEA 3BDEA 1U0SA 4G1QA 1WOPA 4OJ1A 3L7PA 4J90A 1DTTB 2CPHA 4J9RA 4UY8T 1JLAB 1HR0J 3ZNJ1 5K20B 1H98A 2V68A 1FCAA 2BKOA 1UMJA 2J9CA 2RB7A 3DC2A 3KK1A 2NZCA 4ZVHA 2MEWA 4QIVA 3FBEA 3PHTA 2MGZA 5HP1A 1CJTA 3S1TA 1HWKA 2ALZA 3OBIA 2XMAA 2LQJA 1S59A 2Y8WA 3R5DA 1K1QA 2IRYA 3UI3A 4WCEQ 1CULA 3WZ0A 2XMMA 5L46A 2UXBF 1HWLA 1RWUA 3FMWA 5KFIA 5GADU 2BQ3A 3W5YA 1HNXF 5HMXA 2QL9B 5T7LB 4LFCF 4WYLA 3S01A 1YRUA 1HMVA 3IRXB 4LSLB 4ZVRB 5A6WA 3G6ES 4JI8J 3EM1A 1TVRA 3QBCA 3EVMA 2IBKA 3FZ2A 4F3MA 2Y1LB 4WWSA 2QRRA 2BQUA 3AD8C 1DURA 3OXLA 2GO9A 3UD5A 2QLWA 4O23A 1DHMA 2Q6CA 5GAEI 2B43A 1CBKA 1MU2B 3PDNA 1UWBB 2BE2B 5KG6A 3AFGA 3VQSA 2VFRA 3OSNA 2ZZNA 2JEFA 3DDKA 3L4BC 2AGPA 1ZA2B 4PG5A 4CO5A 1DLOB 1EP4B 1HPZA 3PVXA 1UPPA 3H2LA 2K2PA 4IDKA 2YWEA 1WHYA 4ZVQB 3VALA 1S9EB 1SL0A 3M2UB 2BKPA 3FUYA 3LALA 3RB3A 1TR0A 2PIIA 2KTQA 3TUZC 2XSFA 4PXCA 4OYXA 4ZIVA 3KLHA 5H9EK 5IT9Y 1JIHA 4NLQA 3OTOJ 1XK8A 2OEJA 4P73A 5L9XA 2DR8A 1D9DA 2HS4A 3MZIA 3KLFA 3MECA 1EB0A 1RHRB 4H54A 4C97A 1S1TA 1NKBA 1CJKA 3LUYA 4DV4J 5L1KA 3ZZUA 4ELVA 4W92B 4OMFG 2ZC3A 2DIUA 1UL3A 2H65B 2OSRA 1EAYC 3PCOB 1SL1A 1IJFB 1KOOA 1Q53A 2XS5A 4DX5A 3G82A 4OIXA 4KKOA 2DNNA 4WFYA 1JQGA 5E2QA 2KH9A 4FYWB 1ZM2A 3HVWA 4JI7F 5KFHA 1IXKA 2P6TA 1RBAA 5C42B 3Q8QB 4C8ZA 2EKYA 3V6KA 3PXGa 4Z37A 5IM0B 4F4YA 4OZLA 5EDWA 2KJWA 1SV5B 3J81Y 2HMIA 2HVDA 2PMWA 4ED0A 1OY9A 1HNWF 2WRMA 1BGXT 2JSXA 4TU7A 4DV4F 1HIYA 1HPZB 1BWVA 2DGTA 1MN9A 2MKSA 2MKHA 2XY5A 1KN6A 1R43A 3HPOA 4Y0FA 3T5KA 1U49A 2DPJA 4TQRA 1GQEA 3KLGB 2H54B 1FDDA 2MKKA 4NMLA 1YBAA 2NXJA 5D78A 3TUIC 3VAMA 1B7YB 1UWBA 2BE2A 2DHSA 3R27A 3CULA 2JFDA 3K5MA 1LWFB 2H4WB 2KB2A 1CJKB 4X84A 4ZP9A 4BHQA 2QEXS 2RKIB 4MKVA 2V8HA 5GADI 2QG9B 3PJWA 4KGKA 1OSCA 4EBEA 1JLEB 1KSPA 3QJLA 1XBWA 3FEYB 1RLDA 2CNLB 1IBMJ 2LA6A 3OR1A 3TX8A 4I6YA 1IBCB 5IC4B 1V6HA 5B0GA 4KSEB 2BW2A 2CJKA 3PO4A 3Q83A 3T1HF 2X1BA 2BABA 5E3RA 2F63A 7FD1A 3NRBA 1H2TZ 2R7WA 4OZNA 4DWIA 4ED4A 2KFYA 2YX4A 3NNHA 3JYTB 1N5SA 5HO4A 1U1LA 2HFNA 3BDPA 2E1PA 3R8YA 4UUWA 3PX4A 1FX4A 3QGHA 4FNHA 1ULRA 2WONA 2QA1A 2VC0A 2M52A 3R5GA 2HVIA 1WKJA 2CNKB 3HZGA 3LA0A 2CQBA 2J9DE 4HR2A 5CCLA 5KOXA 3Q8PB 4ECRA 2ZWPA 3HHLD 4WP8A 1JLAA 4LSZB 3K5LA 1TUVA 5KFMA 3JQMA 5A8RA 2X1AA 1O8BA 3NOGA 5AXMA 4HACB 5HBMB 1S4EA 2XMJA 2YPYA 2GJ2A 1OSDA 1F5CA 2DO4A 1WTFA 2MZRA 3WC0A 3CCSS 1D0EA 1K0VA 2E5GA 2HPUA 2MZQA 1KEKA 3TAMB 4LF9F 1Y9OA 3HJVA 3AOBA 1M1GA 2YQ3A 3EE3A 3M7VA 3MPDA 2DR6A 3HDSA 3WIUA 1RISA 4QWEA 2BQRA 2RDJA 1SC6A 4LRBA 4QR0A 1U2CA 3GU0A 1B70B 3PM9A 3G6VA 4UUXA 2JLFA 3B82A 2ZDOA 4KPCA 4IOAQ 3W5ZA 3CJRA 2L48A 1TZ0A 3DRSA 3VCDA 1RYSA 3FFIB 4DQPA 4NXNF 1N5VA 3V6HA 4JI4J 2VA2A 4Q7AA 4WKYA 4HYKA 3PZPA 2XC9A 2Z2YB 5DG8A 1H7XA 3CCES 3CJ3A 2CZ4A 1RWMB 3D0IE 3ET6B 1NDPA 1YRTA 2BJ7A 2W01A 4F0KA 1WWHA 4I6WA 4YB6A 2DNMA 4ZPDA 3F73A 4CYUB 4NXNJ 3NXZA 4B3RF 5D0HA 2IDEA 5AXLA 4AL6A 4JV5F 2RVJA 4GO7X 4CTAB 2Y3YA 4DPWA 4DG1B 2DH8A 2W24A 3QAUA 4OLOA 5HL7Q 2L9WA 4K4VA 4UZCA 4GKKF 5CH7B 2HW3A 4WP3A 2IY5B 2EFNA 3V6DB 2ZH8A 3TAMA 3U1LA 4LUBA 1CJUA 1TTHB 3BZQA 2X51A 3GILA 1M5VC 3ZTOA 3G8TA 3J80U 2BR0A 2E66A 3DLGB 1PAEX 4I2PA 5EGYA 1UVKA 1FKOA 3A3PB 2DVIA 2CVIA 1LK7A 4USIA 2IMOA 5DGAA 3MUVP 4USHA 5B7WA 3TAPA 5F8LA 1RAJA 2GQQA 3N6LA 2X7IA 4R0JA 3W66A 1NK9A 2IIHA 2CQGA 2YWHA 2IMWP 4RW7B 5J2NB 3DHXA 3I5AA 5EWEA 3BQ1A 3B8HA 2RRNA 3T5HA 1WNEA 1DAXA 3DM2B 4WFZA 2HVHA 4FXDA 2CJXB 4MIAA 1MSWD 3DYAA 4FF1A 3DRRB 3KUEA 1T3NA 2A3JA 2KU7A 3HSZA 3BQ0A 2HFOA 2UV8G 2OH2A 1U1KA 3HSDA 4Q2LA 1WF0A 2J7UA 3CJKA 4FVCA 4BS2A 4OHWA 1JLQB 1WC5A 3FRYA 1Q5YA 1HFEL 1WF1A 3B6BA 2W9BA 1VQKS 2AJ0A 2ASYA 3QQCD 4IUFA 2G13A 2OI2A 3R9LA 3LOUA 2HYIB 2JEIA 4USMA 2ZOFA 3KOAA 2VG7B 1F60B 2FHKA 4CLLA 3ZO7A 2HK2A 1J2VA 3MMBA 4X4OA 1HNWJ 1VIOA 3LTOA 2IM1A 2ZBRA 2ZH6A 3WC2A 4ZPCA 1WC6A 3VWSA 3SI8A 2D69A 1HQUA 1NAQA 1SVDA 3AD9C 4YHHJ 1K73T 4LFBF 3VGVA 3KNGA 2L9DA 4X62J 3OL6A 1EKSA 1Y00A 1DARA 3M9MB 1S7HA 2JHEA 1Q79A 2EFOA 1EKRA 2YX1A 4DJBA 3HJFA 5DDPC 2RQMA 5C24A 1D9FA 4RKUC 2B9XA 4RX6A 1KTQA 3EICA 5ETMA 5F0UA 1XR7A 4PR6A 4DL4A 1REVA 4KPYA 5ETOA 5GMKa 1HBOA 1S1UA 2HG4A 1S1WA 3OR2A 5E5NA 3KLIB 4KR0B 4DV6F 4LFAF 3T5LA 3KWMA 4QPXA 2XWXA 1DQAA 3KFWX 4KO0B 3X3UA 3CMAS 2KXFA 2N3LA 2BM0A 2M70A 2J7KA 1UP1A 2MY7A 4NYOA 5F41A 1SJFA 4FXVA 5KT4A 2WSFC 3ISND 2YQ1A 4OYPA 5BJRA 2AX1A 1U02A 2HIYA 1FDNA 3W64A 1H2VZ 2CQ1A 1FX2A 4K0KJ 3VGUA 5AE1A 1R8CA 1MN7A 3HFZB 2NS1B 5CD4A 3CB4A 3FEZA 3J81j 4MKBA 4L73A 2QLBB 1GX5A 5KG2A 4DV7J 2FZCB 3KLHB 2HLUA 3G86A 4C8OA 4JV2A 3MDFA 2GAGC 2G1DA 3R5BA 5B0EA 4ES2A 1X7VA 2IRXA 2OPRB 3FDSA 4WE1B 2KG1A 3KG1A 5T14A 3PYGA 2R8IA 2BM1A 3CEDA 4F4WA 5F9LA 1RTJB 1AZSB 2VFTA 2HWIA 5G0RB 5IC6B 2BUNA 2ACYA 3HFVA 4FF2A 4J9MA 4JI0J 1EZZB 1WI8A 3ZTSA 1NKEA 4ZPTR 2XI3A 5DM6Q 3MM6B 2MZTA 1RWXB 1S4FA 2D3ZA 2J8AA 4RW4B 1C0TB 5F8HA 3ILOA 4J9PA 2DR7A 2R7TA 3LAKA 4H4KC 2OD4A 5A8RB 4YR0A 2AJ2A 1U25A 1N56A 2RRBA 5KT7A 3I4PA 3MURP 5KG3A 3AXKA 1GXUA 3GTYX 2FZGB 3KK2B 3K0JA 5KFQA 1TMMA 3V4IB 2VU5A 4RNOA 1JLFA 3M8PA 3UO0A 1Q7YT 3T9ZA 2W9CB 1HBUA 2JLEA 5DG9A 2JRSA 2NPIA 3OLBA 1NXIA 2DNOA 1EHWA 2QLXA 1VBYA 2DHAA 1CQMA 1KOHA 4H4KA 4UQTA 1K8AT 4JYAF 2XMTA 2Q6BA 4HEA9 2FGCA 4DU7A 2R7OA 5DETA 4OLPA 2XMKA 2VH7A 4J9KA 1V9OA 1L3UA 2NSCA 3UCUP 4L72B 1SXLA 1S5ZA 3LGNA 2UU9F 4DV7F 2VL1A 3PEJA 2XNRA 4KHRA 3SSQA 3CCUS 3CJ0A 1C0TA 2GO8A 2K3KA 2H1YA 5F3TA 3H98A 4C8LA 2DTJA 3VAGA 2UXCF 4L75A 1UWAA 2K1RB 2F4FA 4PRFA 2ZM6F 4M5IA 5KFFA 2BEFA 5JUMA 1F1BB 2YXLA 1IKYB 3BGFA 4NLPA 3I0RB 3MM9B 4RWXA 5G0RA 3CD0A 4EMDA 4ZCMA 1RSCA 3TWZA 1KRPA 1FTRA 5HN0A 1Z4UA 2CPIA 1MWZA 2WVCA 2J5AA 1QM9A 3IM9A 3QGGA 3M8QB 1NB2A 3QMQA 3CJ8A 3C19A 3GONA 4WE1A 4QBUA 3OL8A 5C42A 1RBOB 3FSXA 4QQBA 3PW5A 3MEDB 1VC5A 4B02A 2OMOA 2ZC4A 1N5YA 1VCTA 1DQ9A 2B6AA 2RF2A 3DLKB 2E5IA 1TELA 2I8EA 2EC2A 2V8VA 5ETVA 4IOCQ 4ZITA 2AV5A 2Q1LA 2LFVA 4HT5A 2IYGA 3A8JA 3MEKA 2BRLA 4KAIA 4O44B 3IM8A 2SXLA 1Q82T 3KTQA 1RA6A 1ZPVA 2PI5A 5F8IA 4DQRA 1N88A 2XZWA 5KG0A 4Q44A 4KO0A 1Y3JA 1RU1A 1O0PA 4WKRA 1LK5A 2KKHA 3SEOA 1WHWA 5B0BA 2GX8A 1S1WB 1OY8A 4ZPBA 4A8SA 2B6AB 2RF2B 1S99A 2R7RA 3RRGA 4IR9A 1SIWB 4A8KA 2RMLA 5D4LA 2E1CA 3GP9A 5A76A 3N28A 5A0YB 2FJXA 3MM8A 3AB2B 3TVKA 5IM0A 1G3OA 1VJQA 3POTA 2JEJA 5KT3A 2LCWA 1REGX 3PW4A 2XZTB 3HKWA 3X1LB 3I9ZA 2CKWA 5K9FA 2OPPA 5DQHA 1C4CA 3BSNA 4QYZK 1KLNA 2DNZA 1IKYA 2WVDA 1SC3B 3DLBA 4GRSA 2B8PA 2LKZA 1NDKA 3QIDA 3UR3C 4DFKA 3Q8RB 4IFYB 5EUHA 1HA1A 1NSAA 2LXIA 1LWCA 4JB8B 4NLWA 5K5MA 4EI2A 4I7FB 2I1RA 2KFNA 4B3RJ 4NXMF 4O0IA 3TZZA 5KG5A 3IG1B 3MECB 4CCHA 2CRLA 4WXOA 1IUJA 1KQFB 3WX8A 2BYCA 1X4DA 3Q23A 4FS1A 1X5SA 3D54A 1FRHA 3EZUA 3LQVA 4OHVA 4U7UK 4CNZA 3GJTB 3ILIA 5CYMA 1MW7A 1HMVB 2DY9A 3IRXA 5M2UA 2K3IA 4GO5X 2AQ4A 3KNAA 1W2BR 3TZWA 3OQ2A 4QU7A 2KYZA 3NGSA 4A8XA 4H4OB 2XM3A 2N3OA 3CC4S 1FEHA 1S0VA 1WHVA 4O4GB 1TL3A 1YX2A 3UN3A 3P96A 1HQEA 1CVJA 3M2UA 5DDQC 2APOA 1U2RA 2YWFA 3HF5A 3IR6B 1QD1A 2LLZA 8RUCA 2ZH5A 3RBEA 2FB0A 3PRDA 4NRTA 5HP1B 2UU9J 2XGQA 1EP4A 5JJBA 4X4RA 3CJ5A 3V4MA 3VZIA 4WFBQ 3DFEA 2MMYA 2EWHA 2K06A 1DTTA 2E5LJ 4TLRA 2VFVA 3EZOA 3DDIA 3G87A 2AF6A 2B9WA 4I2PB 5IWAF 3GMGA 1FJ7A 2Q66A 1FJCA 3IR5B 3CJQA 2ZKTA 2OJ3A 2NPFA 2XCAA 5D77A 3KLEA 5LXRA 3FBFA 1F9EB 1UVLA 3DOLA 4OI1A 1Y0HA 3TRGA 4G3IA 3MAHA 1E6YB 1X9WA 3RW6A 3Q8SB 3TX0A 3CC2S 1AFIA 4GVLA 2GC8A 4J91A 1QJHA 1NPPA 3MCMA 1F3FA 5HMZA 3C16B 4CDIA 2VBZA 2ZZMA 1FE4A 4O3QA 2FC9A 1YK9A 2QT7A 4D3HA 1M5OC 3JTPA 3H5SA 4NA3A 3KDOA 4KGZB 1V3RA 3FBCA 3NLCA 3MPUB 2MXYA 3TUJC 1WG5A 3QGPA 4PAAA 2AD9A 2R42A 1NMEB 1Z2LA 2RQKA 4X65F 3MGJA 4WZMA 1LNQA 3DI6A 3UDEA 2CUYA 2PDAA 5LMUJ 1N48A 2QO3A 4PUOB 1ZTTA 1GK8A 3JSBA 1U1RA 1WTBA 2UXDJ 2CDQA 2D3UA 2FGOA 2G0JA 3C8YA 2JJ4D 2KXNB 3S6EA 1S6PB 2Y1IA 4NI2A 4ID8A 4IFVB 3UD4P 5J2QB 4BDPA 1VIXA 2KZZA 1U0HA 2FQQB 2VBYA 1RDRA 3D1QA 1RK8A 2CPDA 5FLXY 1X9SA 1QLNA 1F3VA 2VG5A 1KS2A 2NREA 4I7FA 1MROB 4OYAA 3I6PA 3CMQA 1GEHA 2YWKA 3BS9A 4JBCA 4OYWA 3HSJA 4B3SF 2F8MA 1D8YA 3HK2A 5A8WA 1SH3A 1HHTP 4M8LA 2QV6A 1PJ7A 2QL7B 4C0HA 4CLKA 1EQMA 2DRBA 1HYSB 1YHQS 1FD8A 3Q2SC 2BJEA 2DNRA 3J7AN 3C2PA 1JKHA 4OI4A 5J2MB 2NXEA 3LANA 4AFFA 5ETPA 3UN5A 2MHEA 1LFWA 3MMBB 3TJ9A 1NJYA 3HP6A 2ZH1A 5A8KB 2H5JB 2RUGA 3C6UA 5LMNF 4KY3A 1SUQA 3Q2TC 1PJ5A 1UPMB 2DGOA 2BANB 3L09A 4U96A 5J1NA 1Q78A 4CI0B 1NSPA 9ATCB 3TOQA 2VQEJ 1DQ8A 2DCUB 4CLYA 4DI6A 1IJEB 2ZOMA 4J9UE 4P9SA 2BANA 3E3XA 3W1YC 2VJUA 1Q95G 5EWGA 4JI1F 1NUEA 4NLVA 1VRUB 4M63A 1S1XB 1ZAWA 3KDNA 1UETA 4OZ5A 5J2MA 1X4FA 3AODA 2V4QA 4ZPWR 3TJAA 4RW7A 2WVFA 2DHHA 2JVOA 3QLHB 2OPPB 3PX0A 1FJGJ 2ZHBA 1CEZA 4DSFA 2G0IA 4Z2XA 2AIRB 2FY1A 2HMIB 3NNAA 3W9HA 2P5VA 1IKXB 5LM7E 3EJMA 3IWLA 4NX9A 2V50A 1AT1B 1X5OA 1YJNS 2OAUA 4Q2MA 4X62F 3T1HJ 2I38A 1CPZA 1OQ3A 4LSNB 1P1LA 2XZDB 3BKUA 3DNCA 2GNKA 4BWMA 1KLMB 2YKQA 5GMDA 5ETNA 4ZJQA 2FJDB 1NDLA 4AD6A 4GVBA 3KHHA 2HWTA 2W7AA 3NS5A 3O44A 1PYTA 1J27A 1LXJA 2GW8A 1CS4B 4MFBA 4NYPA 2AEJA 4DUZJ 1D9AA 3RAQA 1J5EJ 2G4BA 3THTA 3AJ2A 2EFPA 2VPXB 4O3PA 2DEJA 2KG0A 3OL9A 2DCLA 1NH8A 2IVFB 2AEMA 2RRAA 2HGNA 3BH7B 3FEXB 1ELOA 1WORA 1FFSB 3VGSA 5K8NA 5HROB 1T3OA 5I42B 1UVJA 2WOMA 4JI6F 3IC1A 3HMJG 2MJUA 3BREA 2PGCA 4K5SA 4TLQA 2R7UA 1FFWB 1VHFA 1JNRB 1FNOA 2GVZB 1JLCB 3GIKA 1RCOB 3CIMA 3ZZOA 1N36J 1QAXA 2M3DA 2WVEA 4NLRA 2DO0A 4QIWD 5ETLA 2IJRA 4K59A 5B08A 3KLEB 1PSDA 1GMVA 3SCKE 4TVAB 1T9VA 1D3WA 3DRPB 2XULA 2UUAF 4EZ9A 3QT6A 1CC8A 4AQYF 1QY7A 3MMJA 5E3AA 2MZ1A 1VBZA 2VOPA 2G0CA 3CF5Q 3DRPA 5ITHA 2P9GA 4IO1A 1NK0A 1N8RT 3I31A 1LWXA 1DY3A 1PJ6A 1OS5A 4RR5A 4X64J 1ZYQA 4LFCJ 2JFKA 1G6BA 3NS6A 3N6NA 3GZ7A 4A46A 4DL5A 2HHVA 1LQ9A 1T9XA 2RD5C 3IBCB 3K2YA 1KDNA 1W25A 3BSCA 3PFOA 5T7LA 4KV8B 4EU0A 4U6PA 2BXJA 4U7UD 3ENWA 2NQPA 1JXVA 1HQEB 3H40A 2AW0A 2EKNA 1AUDA 4OZ3A 2WOMB 3BR8A 4CO1A 1CULB 4YN3B 1TL4A 1H2UX 4PWWA 1H6KX 4KV8A 3ZZRA 3G9CA 3US5A 2H51B 2QC3A 1AFJA 1RADB 3MEEA 2BJ3A 4AL7A 5KAKA 4IQXA 4NLGA 2EBEA 1LV5A 3QT7A 3OR1B 2F1FA 2RS8A 5L39A 4ED3A 4OX9F 1H0HB 1UFKA 2UUBJ 4LRDA 5K14B 2F4VF 2F65A 2OGUA 3NGUA 1YSJA 2ZHAA 2CNOB 3OUYB 3OJSA 1LWFA 2CQ4A 1F2GA 1OIAA 2AJQA 1KQSR 3CCLS 1WDDA 4HT7A 4DUYJ 2AX0A 4Y2MA 1XMQJ 3MUMP 2QSFA 2F9JA 4DFMA 3KLIA 2UVUA 3HVRA 3ENQA 1E6VA 4M5KA 4YDDB 2OPQB 1FDAA 3LP0A 4ED8A 2C3MA 1JJ2R 1DTQB 1SV5A 5C24B 1H73A 1K1SA 1AA1B 1V5IB 3BGRA 3PRVA 3D67A 3PW2A 3W60A 3MM8B 3NNCA 4DLGA 5D4OA 1RLCL 4NZ6A 3PNIA 4M5DB 4C0OC 4F3OA 3HKZD 1ZAVA 1Q16B 1IN0A 2BKNA 2C1EB 2QTWA 2JX2A 2YKPA 3P3DA 3OTCA 3ZZZA 2DISA 5IFMA 5EX0A 2BDPA 4OZ1A 4N5SA 2FVRA 5LT5A 2GIQA 3RU0A 1JX4A 3C6TB 3JXOA 4BC7A 3MM7B 1Q0NA 1VFJA 4KH0B 4LQ9A 5IV4A 2IM2A 3DCAA 2ACMA 2PA3A 3T19A 2RE1A 7AT1B 1HD1A 2HGMA 1ROFA 1WSVA 3JB9k 2KT3A 1PYSB 1VQNS 2HZCA 4PPZA 3B78A 2B3TB 2G2YA 2FDNA 2K7JA 3EGNA 4DR5J 3PX6A 3HCXA 2DGWA 4DHVA 1AW0A 2P8IA 1DBDA 3BYPA 5DZ7A 2BJ9A 3GYNA 2YNFB 3JS9A 3AQPA 3QFHA 2C42A 4CO4A 1XMOJ 4JI5F 4O3SA 4OX9J 2FZKB 3NCQA 3UDVA 5E33A 2ADBA 3M05A 4CH1A 4HVZA 4KQZA 4PYAA 2ZBQA 3I5CA 3PW7A 1RTIA 2FTRA 1RT1B 2QGFB 4IDKB 4N7TA 4O3OA 3WDOA 2MPUA 1QUVA 4TYAA 4CO0A 4OX8A 5L8RC 3QO9A 1VYAA 1WUUA 3KG4A 2BE7D 3HULA 1U1MA 3CUNA 1VMBA 3TYTA 4IRDA 4LF7J 2Z30B 5LL6d 1JWWA 2V5HG 4NYZA 1QAIA 4Z7CA 1RHJB 1U0HB 3M30B 3M9OB 1YQHA 1CJUB 1R0BG 1Y7PA 4F67A 3CCWA 1GMWD 3GV5B 2POKA 4JI2F 5F8MA 2R8KA 2KL8A 3AD7C 4CTAA 3NAIA 4XPCA 1YJWS 1R89A 2RQ4A 3DYAB 4P7TA 4WK1A 1HBUB 4X4UA 3F41A 2HHHJ 2COLA 3GYXB 3MUTP 2R2RA 1FD2A 3UVJB 2U1AA 2W9AA 2B5JA 2L08A 5ETTA 1NHVA 2BW7A 2B4PA 3Q86A 4F2RA 5A2QY 2IVYA 2CJQA 3GJQB 2V8DA 1RP5A 2QJ3A 4ETXA 1LKZA 1OPZA 3I96A 4Y2KA 5A8WB 1Q8IA 3FFIA 3OVAA 3KHGA 4B17A 1N33J 2W25A 1SQFA 4ZHRB 3MAQA 1RKJA 2VICA 3HHDA 1B0PA 3UW1A 3H4DA 4B3SJ 1LW0B 2JWNA 1R0AA 4LF7F 2L9NA 4MTPA 4Z7YA 1T7PA 2ZUGA 2XYGB 4MJKA 1N52B 5KFOA 4DUZF 4DR2J 3DOLB 4CQ1A 1NK8A 1RTDA 2Y9HA 2UXBJ 5IT9U 1MMLA 2NZ4A 3HZEA 4LR7A 5IT4A 1CG2A 2OPSA 4NASA 1P8GA 1K44A 1U1OA 3TW0A 4KIAA 1L3KA 2P9EA 3M2RA 2EEYA 1XR5A 3DI6B 1WSRA 4RWWA 3W2WA 3BR9A 1RWVB 4TY9A 5DQGA 1ZZNA 4QW8A 3R5JB 4WP9A 5F0WA 3OTEA 4QIFA 1OMSA 4OHZA 2AJ4A 3AA8A 3PTWA 3A13A 3MR3A 3SQGA 1PC5A 4DX7A 2FUG9 1LXNA 2ROEA 2VASA 3SQOP 4GKJJ 1S0OA 2EG1A 4LF8J 3SXLA 2GS8A 1URRA 1UJ4A 1UA1A 1WACA 1X31C 3MOZA 2DH9A 3EYZA 4PG8A 1NO8A 5F9NA 3FMBA 4PYDA 5KG7A 3V6JA 2D3O1 3W63A 4ZPAA 5CCMA 4K4TA 2P6SA 1X0PA 3H59A 5BYSA 4Y2IA 4DF8A 1VQ6S 1RACB 5HVHA 3LPEA 1AUSL 4A8QA 5KG1A 2DRDA 4FPRA 1OQ6A 4RW6B 4NLOA 4RUCA 2E5JA 2QX0A 3LH2S 4NZ7A 5IOLA 2RKIA 4YY3F 4EO6A 1VLOA 2ZH7A 2QIFA 2KO1A 2ZBIA 1JNZB 1LEOA 4F02A 1BLUA 3D68A 1CSJA 1RA7A 1WJ9A 4N8NA 5DZ6A 3WIVA 4CT8A 3CJ4A 1PIEA 2BA9A 4JOUA 4DV3F 1HI8A 1VJWA 1UFWA 3BGOP 1Q4RA 3DU6A 4DV6J 1BHNA 3CC7S 3KJQB 5B0FA 3UQSA 3CWJA 3ZZYA 4IYQA 1W7WA 3C15A 3KMQA 3ZZTA 3EDRB 1DJ0A 3CCTA 1UZDA 2I0XA 2DNHA 1N5QA 3OPKA 1B3TA 2FPHX 3QATA 4CLFA 1FNMA 3JSYA 5KFPA 2X3DA 4B08A 1RT7A 4IH7A 2R8GA 2OMLA 2R2SA 1C0UA 4F26A 4ZK7M 2NR0A 5U47A 3L7UA 3SCJE 1RCXB 2F8HA 2HQIA 4ALZA 1VDHA 1HD0A 3ZTRA 4RNMA 4TU9A 3NGTA 1JLQA 4F50A 4NA2A 2GHWA 4K2JA 4USUA 2MKCA 4DOZA 1RHMB 1RT2B 3M6VA 2DT9A 2W2QP 4S0MA 2PI4A 4DR6F 1WD6A 2OELA 2QYGA 2Z4PA 2MSSA 3GG1A 3N9UC 3UWTA 4AYBD 4UOGA 2W2MP 2ASJA 4CNYA 5DGBA 1RWOB 4FYXB 3HVTB 2F9DA 4ENOA 2C3UA 4LF4F 4Q0BA 2YKMB 3R6LB 4J37A 4PZVA 1RT1A 1RAIB 1ZBTA 3BH6B 1VLYA 2CQPA 5I3UB 1SQEA 4EGLA 1RHKB 3A3NB 1OYDA 2PMZD 5AJ3J 4M5HA 4RZRA 2HZAA 3NGDA 1NU4A 4PCQA 1I1GA 3HVAA 5A2QU 4Q45A 3M8QA 2NSBA 4LBPA 2R7XA 2HVEA 2QE5A 4ZJOA 4C98A 2MB0B 3EZ5A 1ZETA 2WBRA 2ASLA 2OD6A 1E6VB 1PBUA 1ITPA 2MQQA 4ZA1A 4LJMA 3G82B 4AE5A 5IT0A 1S1VA 3CTRA 2IVMA 2MLZA 3DGVA 2LEPA 2MY8A 4MAKA 1Y3KA 4YR3A 1TV6B 2DHGA 3QT5A 3TARA 1HNZF 4QR2A 5LJ5Y 2N7YA 1NNDA 4IO9Q 4ZLPA 2EC0A 4PXBA 3WHIA 4EK2A 3JSRA 3DLEA 1FWKA 5AXNA 5F8GA 2FVQA 2C3YA 4LF5F 3R6GB 1FK9A 2QA2A 3QZ7A 1PYOB 2RT3A 5CZXA 3Q24A 1T95A 2ZNZA 4HHHA 1NH7A 3CDWA 4V1Ak 3N5BA 1G2EA 1PG5B 2J8SA 3R5AA 4TY8A 1L3VA 3NGKA 2EPIA 3U1MA 1RUSA 2EG2A 4ECUA 5JXSA 2HQCA 1C4AA 1LW2B 4KBIA 2DGVA 2HFSA 3TR5A 4K4XA 4D3GA 1IBKF 2XY7A 3OVBA 4KFBB 2JDJA 2DGXA 2OPQA 1H3DA 2PO4A 2CNNB 3PACA 3KK1B 2KT5A 3GB0A 2HBYB 3MCNA 4HTJA 4C3MA 3BF4A 3Q0AA 2VHGA 3KLGA 2E5LF 2E1AA 2E7WA 4DPYA 3GIRA 3E51A 4DPTA 4ECXA 1S77D 1VISA 4B3OB 4CT9A 4FKXA 1JJHA 1XC9A 3CJ2A 3BBCA 1Q1KA 3ZNUA 2W4PA 1I94F 1CC7A 1KHVA 2LECA 1ZZFA 2R7QA 4F0MA 2LXFA 2A6MA 1K9MT 5CYQB 3RR8A 4B3OA 2HBZB 2CQ3A 1KNZA 5GAGI 3PFEA 5CZVA 3W9JA 1ZA1B 4DR3J 3SDEA 5F8NA 1T9YA 3FGVA 3CDBA 5HQ8A 3RB6A 1U48A 3AT1B 2AHOB 4C6AA 3M8SA 3EUNA 1FXDA 4RLEA 5M2RA 1X4GA 2DXDA 3UE2A 3BN4A 3Q8VA 1HW9A 1WELA 1YJTA 1YZ6A 3FKBA 4MK7A 2ROGA 3OFGA 2E9TA 5J2PB 1F5AA 4C8MA 5I42A 2DNYA 2BJDA 1YJ9S 4U95A 4WZQA 5F3ZA 2MGZB 3CD5A 4P72A 3J7Z5 2NYHA 3PYFA 5DLFA 4XDCA 3NAHA 4ES1A 1SIZA 3NOCA 2XEXA 3IAM9 3J7YU 3E8OA 4DR1J 1S6OA 1JLEA 2D9PA 2FC8A 1ZM4A 2VB6A 3HHLB 2XY6A 5KT6A 2QMUB 3EVOA 2HRYA 5LMNJ 3TANA 3IFEA 5THWA 2JH3A 1N34F 3QJJA 2ZBCA 3CO9A 1VC6A 1TK5A 1O6XA 4N41A 1GFWB 3NCPA 1X4CA 4FP9A 1C1CB 1JLBB 4PXDA 1XTZA 2HNZA 3K5OA 4HTIA 1HHQA 2LQBA 3EWGA 4PQUA 4ERDA 3M6WA 1JLCA 1HBOB 1S1UB 3DRYA 3D9BA 3PJ9A 4OI0A 1REVB 4YB7A 4JI3F 4RBVA 1GNKA 1NSKL 2AU0A 3B54A 1KFSA 3RAMA 3D2WA 4NMXA 4DSLA 1IKXA 4XTTA 4ECZA 1IQZA 1WI6A 1YJUA 2G2OA 1KVIA 2LDIA 1JK9B 5HROA 4ZOSA 1U1NA 5AE2A 1Q5VA 5I3UA 4LQ3A 1NEEA 2CJAA 2W7PA 4DQSA 1NKCA 4HH1A 2R3VA 3RB0A 4DR7F 2EVZA 3M32B 1JLGB 4QIGA 1RT4A 4W4MA 3MR6A 3C14A 4NCGA 3H25A 2FHJA 2MKYA 2ZD1B 3DXSX 4RU2A 4BWJA 2MQMA 4DCPB 2WTFA 3DLEB 1S1XA 1YWXA 4F04B 7FDRA 3MR5A 1TK8A 1NZAA 1TL1A 2QYCA 3VQTA 4CO2A 2UP1A 5DRKA 2ZH3A 2UUCJ 4IR1A 5MAOA 3SFUA 3W9IA 1P1TA 3KLFB 1GTEA 2F5GA 4RW9A 4F4XA 3P5BP 5AE3A 4RBUA 4LREA 4H4MA 3MAAB 4CZCA 4ZP7A 4R5PA 1BE4A 1FXRA 3I0SA 2CPJA 5CD4H 4EBCA 3C6UB 3GR0A 5GVQA 4WXWA 4F0HA 2QSWA 3UPFA 3W7BA 3TI0A 1TKXA 3DRRA 2KZMA 2J76E 5J1PA 4DV5J 1U45A 2DHXA 4EWTA 2R2TA 1LFPA 3OXGA 2VPYB 1S9EA 4RUAA 5J2NA 1F9HA 3DOKB 3G6XA 2YNIA 5KFZA 2HNDB 4NE9C 1KD1T 2R7SA 2YKMA 3ZC4A 4YMEA 4NEZA 1HYSA 3QPIA 2QA4G 2MZSA 1P9QC 4N8OA 2ZE2B 4FPIA 2ZFHA 2LU1A 5K8OA 4ZP8A 2ZWOA 3N5FA 5E3CA 3WQPA 3FRZA 2G2ZA 1QSYA 3GFXA 4HDGA 4USJC 2NXNA 4DCOB 4DQIA 1TKTA 4FKYA 4OYBA 2YH0A 1S9GB 3W65A 1Y10A 2LVWA 3RRHA 2QL5B 3C66A 2LMIA 3OFEA 4NI2B 2IAJA 2BJ8A 2EBGA 3KKFA 3TA2A 1RBLA 4IH6A 5BYQA 3CJKB 3IGNA 4OHXA 2LA4A 2EK6A 3O3LA 1BXNA 3QWPA 2YPZA 1FA0A 1A0OB 3PV8A 1OWXA 4PUOA 2KVIA 5LMUF 3F44A 4DSEA 3B4DA 5J1EB 2EFQA 5K8MA 4N77A 3I82A 5KFVA 3IRWP 3PRBA 5KFEA 1RKIA 4DEZA 4ECVA 2HFUA 3HHEA 2WCXA 4ZPVR 5H9FK 1B99A 1FVSA 2WW4A 3WBZA 2M5YA 1IBLF 3H4BA 3J7ZT 3CGIA 3LP2B 1U2FA 2I9SA 3NBPA 5E3PA 4TN2A 1WC1A 3HO1A 1T11A 5EWFA 2XBPA 2HRTA 3W2WB 2AGQA 1KC8T 1SPBP 4NXMJ 3LW5C 2HFZA 1JXLA 2CZ9A 2LEAA 5D3GA 3GLJA 3BGUA 1YI2S 2E9ZA 3P5TL 2YNGA 4A4JA 3GIMA 3JQKA 1GMUA 3V6DA 1FRIA 2Q3PA 1R7IA 2RJZA 1HR0F 1EQ0A 2H5EA 4RPFA 1LW0A 1R0AB 4ELUA 2E9RX 2DD8S 2RH3A 2V2QA 1FFGB 1FRKA 1U47A 1NK7A 2HHSA 3NCRA 4TU8A 1YJRA 1N32J 2LQ8A 2DBBA 2YTCA 2HAIA 4M1KA 4P6QA 3TZXA 4C11A 4OI6A 1MLAA 2CFXA 2KYXA 4WIQA 2WVBA 4OZJA 5DDRC 3MEGA 3Q89A 3DHWC 4BBYA 2WONB 4B9UA 3SV4A 1Q8BA 2RDIA 3HI9A 3ZZ0A 2JC1A 5LOQA 4QCLA 4IG3A 5B0AA 5HMYA 1UJ6A 3AXMA 3DXBA 1Q81T 1SKRA 5HQMA 3ZFVA 1NK4A 4O4GA 3TP2A 4DV5F 1JJ4A 3PIOQ 1NZ8A 4DCJB 2ZH9A 1FNXH 3OFHA 2N4CA 3PEHA 4FZVA 4MYTA 3HHNB 2OPSB 1EARA 2XHCA 3KJVA 5CYMB 2C28A 1U24A 3KUHA 5JVHQ 2FJEB 4LIRA 2D7SA 1FERA 2VDIA 4KGXB 3OTOF 4PG4A 2YNGB 2KM8B 5L38A 3CCRS 4J9LA 2XHWA 2VC1A 1SL2A 4P7VA 3IG1A 3L7OA 4X66J 2V2KA 2HQ3A 2PT0A 2YWGA 1TKTB 2ZOGA 3IO1A 4ID5B 1GX6A 4I56A 4O3NA 5FLXU 1KONA 1OPIA 1T03B 2AYEA 1OO0B 3OHBA 4OI2A 1T02A 3V81A 1TFYA 1NB7A 3GCXP 3TQEA 1M1KT 8AT1B 1U26A 1YLXA 1HHSA 2V63A 2LXUA 4U8VA 4WFAQ 2DK2A 2V4JB 2W2NP 3ETMA 3LGHA 4TNOA 4LVNP 4A8YA 1KFDA 3V2UC 2QLJB 4OHYA 2M2BA 2ZH4A 3O1LA 2VA3A 2VUGA 3MM5B 1FEEA 4B3MF 5C5JA 3NMRA 3H5UA 3ICLA 2DH7A 4F4KA 1RTHB 2ABYA 2MDAA 3ISZA 1FKPB 2XYHB 5I3PA 4F3QA 2XQCA 1PKUA 1TL7A 1VRTA 3P6YC 4USVA 4AXJA 1IM4A 5DS7A 2QZ8A 3I5BA 4C0BA 2WHOA 1HW8A 2MQOA 2O1PA 1N36F 2O5DA 4LR9A 4UY85 5HI7A 2XS7A 4Y2AA 3CJTA 2FIUA 2UUCF 1S7IA 1TL5A 2CG8A 4J9SA 2ATCB 2HFVA 2K7KA 1WHXA 3IBFB 4URQU 4DPUA 1LWCB 5IS2A 4EYIB 4U7CA 4B9LA 2VBWA 2FJVA 3GCWP 1S9FA 4ZLJA 1N6QB 3ILLA 5LSOA 3GSIA 1JLGA 3M4XA 1X5PA 4ZN1A 3SV3A 3BKTA 2YNIB 4NLSA 4OQJA 1T9WA 4DN9A 3CCZA 2AZ3A 3DOKA 2NYIA 1KR4A 2CQDA 3O8WA 1TMJA 3MEDA 4NLDA 5DO2A 4YQWA 2OIHA 3K7RA 3FNNA 1OYEA 3DOMA 2HHQA 3POTB 2ZNYA 4DDFA 2H3EB 4ZJLA 4DSKA 2Y1RI 1WEXA 2MYFA 3MR7A 1S97A 2H9ZA 1Q7LB 1DTQA 3VHQA 3UFCX 3S8SA 4I0WA 1FWLA 3BBFA 3H2UB 3HSGA 5IXUA 1YG0A 4L3KA 2OO4A 1DLOA 2VF3A 1SJQA 4H4MB 1YITS 1MWQA 2G1HA 2ZEJA 5KFLA 4B9NA 2HS0A 1HARA 3G96A 3K58A 1I6JA 3AJ1A 3EVWA 4DL0C 4DX8H 1MU2A 4DSIA 2U2FA 1IR1A 1S1TB 2LEBA 4O3RA 1HI1A 3RTVA 4B3MJ 4JI4F 2OSQA 2XWYA 1YRXA 2R2UA 1PCAA 3FVYA 2MTLA 1TVRB 5KOWA 4ATNA 3VR1A 1R8BA 1TL7B 1HNVB 3JQJA 2ZDPA 3VAJA 2BV3A 2GMJA 4M5LA 5KFGA 4QWCA 1U1QA 3G6YA 3IS9A 1NDCA 4K50A 2V34A 1R6VA 2RU3A 1N5YB 3N4WA 3MD1A 4NLTA 3MPVA 2IRUA 2X3GA 1R6YA 4UW2A 4BCAA 4DN0A 4ZLNA 4XK8C 5HMWA 4LF4J 3E2EA 2WW8A 3CD7A 2W9CA 3Q8YA 4LF9J 3EPIA 1HL6A 3DRXA 2ZBPA 1RAHB 2DY1A 3THPA 1RWPB 2B7CB 4ECQA 3R2CJ 5EHHA 4G1PA 3THVA 1L3SA 4WU2A 2KHDA 2RIJA 4URGA 5DLGA 2HQDA 1JLBA 2VQEF 4PWUA 2B9EA 3PHEA 4R25A 4C3KA 4X4VA 2IYIA 1WG1A 1XMOF 5B09A 1U4BA 3R1LA 2DEIA 2WSCC 4CO3A 4DPOA 2LP4A 2HZVA 2B4UA 2F40A 2FD2A 4QPTA 2H48B 1IKWA 1GT8A 3R5CA 4DV2J 2IC3A 2OP5A 1R31A 1BQNB 2GMHA 4LSLA 1D8ZA 1RE1B 4JI5J 1AZSA 1SB6A 4YY3J 4M5JA 2CAJA 3VV2B 2GQCA 2XMVA 4DFJA 3ADAC 2KHCA 3AB4B 3D7SB 3HT0A 1FWPA 3UD3P 3DN9A 4P75A 2J0SD 1N0UA 1X4HA 4IG3B 2GMLA 1S76D 1C1BB 1JLFB 2OTLS 3M2VA 3CMES 1UEVA 1PAUB 1HNVA 2B9YA 4AUKA 1RWKB 2HS3A 5KFXA 1IR2A 3JTOA 2IC3B 1FK9B 1KKHA 2IPOB 2LU2A 2UUTA 4G6VB 4LIWA 4OI3A 2A1BA 4G1QB 3GFHA 5CA5A 4HKQA 3W5XA 5HQLA 4YR2A 4MKAA 4OV1A 3GJSB 2ILZA 4DLEA 3PJXA 3S7RA 2XTJP 2X1FA 4ILMA 5D15A 2NUUG 4ZKAA 2J6UA 1UZHA 5KFKA 1GH8A 1S1VB 2IA6A 3IA0A 3RAXA 4FVMA 2HKEA 2RHQB 4X4TA 3BQ2A 4CLZA 1IBLJ 2KN4A 3A8KA 2DGSA 3QIPB 1S12A 3M6XA 4HDHA 5CABA 4ED1A 2CZVC 4M94A 1X5TA 4CLWA 3M1VB 1KVKA 1S0MA 4LVOP 4OX6A 3LP2A 1RT3B 4URSA 2DNGA 2IM0A 2UZAA 4U9RA 4KJIA 1A7GE 3IS9B 1WEYA 3DU5A 3UNYA 1KP6A 4A8FA 4LMZA 1W2IA 2GVDB 2V67A 1QAJA 2OHDA 4CIOA 4Q8FA 4ECSA 1I3OB 4C4WA 1IM6A 1HBNB 1RT5B 4NL5A 4IRCA 1WC3A 3IMQJ 1W26A 2ZJQQ 2XCPA 2EXUA 3QRQA 1RWNB 1SCJB 2XMUA 2DPIA 1VRUA 2VOOA 2OUGA 1IQTA 1LWEA 2HHTA 2FY8A 1S6QB 3JSMB 1BMQB 4TYBA 5GAHI 4WFNQ 1HI0P 5GMEA 2MKIA 4B9VA 4JV5J 2ALYB 1ICEB 1YBTA 2RS2A 4ES3A 3RR7A 1G1XA 1MMDA 2ATLA 2R7VA 1VRTB 3GFYA 4LSNA 4RU9A 5H9EJ 1RT6A 3L9ZA 4NEYA 5C2CA 4NCBA 1FRXA 1UW9A 2HWHA 2GAHC 2VJVA 4UOCA 4UOHA 5SUHA 2CG4A 3DOMB 4P2FA 1T05A 1FRJA 4RNNA 4LF8F 3QZ8A 2HNDA 2V4JA 3AQOA 1EJ7L 1V3SA 4AT1B 3EMTA 1T94A 3KJFB 4JP8A 1HQUB 3U1NA 4NPOA 4C3LA 3AHPA 2A18A 3IWNC 1Z2ZA 1D09B 5HK4A 4CH0S 4OYMA 2BBEA 2ILYA 3Q8UA 2YNHB 1X60A 5C7PA 5GAGU 4UQGA 2VG7A 2VDHA 2V9WA 2JZ5A 4MIBA 4OJGA 3AOCA 2C2EA 1U6BA 2XB2D 1R8PA 2NXUA 3GR1A 4J5OA 1RT2A 3ELHA 4UOFA 2XO6A 4YOEA 4R5PB 1HBMA 2WB4A 2HBRB 2A2DA 2C22A 4ECTA 4FF4A 4HHUA 3KJNB 1X9MA 4P2XA 3BEGB 2PE8A 1YGYA 1T9UA 1SUQB 2HQGA 3KLVA 3IGVA 2DYAA 5JVGQ 1WOSA 2AGOA 5DJBA 1IR0A 2PN6A 1N33F 3BPSP 1Y5IB 3MCSA 2RILA 3RBDA 1IBMF 4AL5A 3CO0P 2IJNA 4OFZA 4KHMA 3D6FB 4KHPF 4DZDA 2UUWA 5FIIA 3H0PA 2J7WA 3D3CJ 5T41A 3C15B 4DV1J 1OY6A 1A9NB 1RXOB 4ZVPB 2UV8A 3MEGB 3R7SB 2FHJD 3VGTA 2J9EA 4DXLA 2YKNA 3LPYA 3AAWB 3VVUA 2N4DA 2XGPA 1UA0A 3ONQA 3VF0B 5LSRA 3TEGA 3NL0A 3GV7B 3ENVA 1G4CA 4UF4A 2O66A 1SC4B 4DBQA 5CHCB 2D41A 4F36A 1MROA 1YIJS 4ICLB 4OZ2A 3ITHA 4ED7A 3KXDA 2B8QA 1M5PC 2RDDA 2QN6B 1E6YA 3K8WA 1HNIB 5J2QA 4FN5A 1F6TA 4DV0J 3F0NA 3W62A 4DR1F 1MMNA 2MQNA 1L3TA 1RYRA 3H90A 2RAQA 3ITHB 5LJ3Y 4ED2A 4PKDB 1SKUB 2EFGA 3D28A 4EEYA 3CDEA 3GFZA 3OL7A 1FVQA 4LRAA 1FRMA 2M9KA 3KYLA 4KB7A 2OFHX 5FD1A 4G65A 2GJIA 4DUYF 2M4MA 2YWWA 1T0TV 2IM3A 2CJYB 3FZBA 2QFJA 3EDQB 5HANA 1R8HA 1UTAA 1VBKA 4TXSA 3SQGB 5E0OA 3D0GE 4A47A 5CYJA 5L1IA 1VBXA 2C3OA 6AT1B 2CQ2A 3FSIA 4WTYA 2UXCJ 4DR3F 2VPZB 1M0SA 1U09A 2BOAA 1MNEA 3A4TA 3DRSB 4KE5A 3T1YF 1IVZA 3CCMS 3CCVS 3TEHB 3M2RB 3I87A 4M5GA 4DL7A 2H4YB 3DGPB 1UCNA 2ZH2A 4I64A 5DM7Q 2CQ0A 1I5OB 1QVGR 5HAOA 1H38A 1A6LA 2FVCA 1SJ3P 1FE0A 3QJPA 2XNQA 4YFUA 3DMJA 1TUGB 3A12A 3UR0A 5EN1A 3SMZA 5KG4A 3WX4A 4QYZJ 5CYQA 3PKYA 4A8OA 3AA9A 1YBUA 4DR4J 4HACA 5HBMA 2KJVA 4U67Q 3QRPA 1ZM9A 2QMWA 1QTNB 3NEKA 3MMAB 2YVSA 1J5OA 2DITA 3LO3A 1ZOTA 4KHPJ 2V2ZA 3TZYA 2RHSB 3NBPB 1XQIA 2CVEA 2CPYA 1VC0A 2MQ8A 2H5IB 4MKYA 1WC0A 3T9NA 2C2MB 5B0DA 3HXMA 1SKWA 3CPWR 1YJVA 3W8GA 4C8NA 4X4PA 3PKMA 2I5JB 1IWAA 4QR1A 4N47A 3TJ8A 2CQCA 2EK1A 2HHXA 3ZTPA 2OTJS 2YKOA 2HNYB 4LF5J 1NHKL 2RUSA 1ZH5A 4WF9Q 4QJVA 2FJBB 4DFPA 1PBAA 1BQXA 2A6OA 1S79A 1ZPWX 1Y4ZB 2KRBA 1RTZA 5IQ6A 1ZM3A 1GXLA 3PYDA 4JUZA 2IAJB 1QAYA 2ASDA 2J9DA 2UUAJ 5IQQA 1VK3A 3M30A 2VFUA 4PG6A 3M9NB 4RW8A 4NLXA 2IJFA 2AP6A 1M5SA 3C3LA 1N4LA 3K8VA 3MM7A 4YS2A 2N7CA 2HGLA 4IQMA 2CPEA 3EGZA 2HHWA 1TV6A 4ZVUB 1YJ7A 2F4VJ 3UDLA 3OHAA 4KT0C 4ITSA 3BO3A 2BACA 4YB5A 2CIMA 3P4UB 2B0GA 2PD1A 4NLUA 3SFGA 2GVDA 2W4DA 2X1GA 5KFRA 2BX6A 3DLKA 2KI2A 3GJRB 4P71A 4ETZA 4OJHA 1HWJA 1KTVA 4PG7A 1QE1A 2GGPB 2RQCA 1Y11A 2C2OB 3FSYA 4CLSA 1L5UA 3CVKA 3QYYA 4HLBA 4KGMA 2C2DA 3SZ2A 4IG0A 1CQNA 4QZVB 2I5JA 5D6GA 4ZLLA 2OEKA 1GMWA 3QAEA 2VONA 4DR6J 4EUVA 4ZVEA 1BUXA 3MM9A 3R3TA 2HHPA 4NWBA 1M1HA 3PYEA 1XMQF 2HNZB 4O0NA 4EYHB 3TUPA 2DRAA 3H20A 3KMSA 3NG8A 2VV5A 4CLUA 2QMXA 3BBBA 3MMAA 4NLYA 3MR2A 1NPRA 2PEBA 3H5YA 1RHQB 3PIPQ 5K14A 4F4ZA 3A8EA 1IKVB 1NJZA 1Y5LB 4F4AA 2VG6B 1FT8A 2UVVA 2XS2A 2AWZA 2Z58B 4JI8F 1HKAA 1R8AA 1YDLA 3M32A 1VS3A 4OZ0A 4YHHF 1VQ7S 2FLLA 1GAOA 1JMTA 3FCWA 5D0EA 3RBZA 2O3DA 2XLKA 2RSQA 3DGPA 4M5DA 2QFIA 2CPFA 1DRZA 1RT7B 5J2PA 1S49A 4LF6J 1PC4A 2HIQA 4LRFA 3W8PA 4C48A 2WB1D 4ANEA 4ZVGA 2Y0BB 3FQLA 1Y5NB 3M8PB 2GQ2A 2VKRA 2Z2LA 4TKTA 3DLJA 3IN5A 3HHLC 2XLIA 2DB1A 3GSDA 2VKZG 1WF2A 2OEMA 3MHYA 1FESA 1T9TA 4QIEA 4G1IA 4CWBA 2J0XA 2K1RA 2PC6A 1J5EF 3BKFA 2C2NA 4DV0F 1J5OB 1T03A 2AT1B 4EFAC 5CXTA 4OYOA 3OUYA 2D74B 2AYBA 1K0TA 4V19J 3KHRA 1U7LA 2B4OA 3OVSA 2HHUA 3BN7A 3KK3B 1NCLA 3QSIA 4QYRA 2P9CA 1KQKA 1HNIA 1R3NA 2MHNA 2JVRA 1FF2A 1WC4A 3HD2A 2Z56B 5D8HB 3RZAA 3T5JA 2E44A 3SYZA 1NK5A 4DS5A 3OJUA 2MLXA 2OPRA 4LRCA 4YB1P 1LW2A 2CJ9A 2ZVSA 3F56A 4P10A 3Q22A 2FLNA 1SBRA 1TUWA 1R27B 6FD1A 2Z0GA 3SCLE 2YH1A 1T8EA 1XNRF 4PABA 1PGZA 5M2PA 2VPWB 2W1BA 4MIWA 1VQSA 4WJBA 3KK2A 1RAAB 1QUPA 1GTHA 3NWRA 4XAKA 4C11B 3C46A 1RQ0A 4MYUA 1X0FA 4GKKJ 2A10A 4UTGA 2LQ5A 1TK0A 1VQYA 2VFSA 3SCIE 1U1PA 1IWGA 3ETOA 3K57A 2AMCB 4E8UA 3IWXA 4P2MA 3NWGA 2W2PP 2GJFA 3QWUA 1MG7A 2ZHOA 4L3NA 3TVYA 1UVIA 1APSA 1WEZA 1SJRA 3IBWA 2R9LA 1VGYA 2FJAB 3MPYA 3NS7B 4K8RA 3RBXA 2KRRA 3LF0A 5G4DA 1I94J 2NCKL 3OR2B 1TKDA 4B3TJ 2AYMA 2BE9B 1RTJA 2W8LA 1V3ZA 2D1CA 2DNPA 3D5MA 4ICLA 4NA1A 5HVGA 4QWAA 1VQLS 1WG4A 2HHHF 2OFGX 4ELTA 1B64A 4KRWA 3ZXWA 2HSEB 3M8YA 3EGWB 5KFCA 1QE1B 2GGPA 4CLTA 4TY8B 1QSSA 2AZ1A 4ED5A 1NRKA 3T6BA 1SQGA 3LP1A 3D6TB 5KFYA 2N82B 2B5JB 3HFKA 3I56S 3CT9A 3L3CA 5ETQA 3QSYB 3HVTA 1XNQF 4Q0BB 3U7JA 4R8UA 3J80Y 1N0VC 4J9NA 1SH0A 1X8DA 3W2VA 5J1EA 2ERRA 1XN9A 4R0EA 1XEZA 4MT1A 2BMBA 1HLWA 1KHWA 2JEGA 4JI1J 3MOJB 3W61A 5E7OB 2JL9A 5FDLA 4DX6A 1PO6A 2J0QD 2V6AA 3CW2C 3OW2R 5KFDA 2W9BB 1QVFR 5KFNA 1GXTA 1BD6A 4ILRA 1XIQA 5H9FJ 3PG9A 1HBMB 3UDCA 3OXFA 4I2QA 1S9GA 4ILLA 3JAMY 1FO1A 1VQPS 4DU8A 3BB5A 1FKPA 4U8YA 5AT1B 4P74A 4ZMMA 4K4WA 4USWA 4AXIA 2HNYA 1U6ZA 2YNHA 3W2VB 3MM5A 3BYRA 2GCFA 4J9VA 1CJVB 1HBNA 1RT5A 3MMCA 4I69A 5BR8J 5GAEU 4K4YA 2DGQA 3BGLA 1FI4A 3HX9A 4MH8A 2BOPA 6FDRA 2Y8YA 3N6MA 2J0WA 3AJDA 3T3FA 1FDBA 3M8WA 1CJVA 3MMCB 4HI2A 3I9V9 5L1LA 4TQSA 4BLGA 4B9SA 4W90B 3U02A 2M8DB 3ISNC 1SKSA 3K5NA 4B9TA 3UNGC 1TKXB 3DLGA 5BXIA 2CJBA 3QIPA 1RT6B 2O01C 3FK4A 4K5RA 4KGVB 1P6TA 2CADA 3H2VE 3UN2A 3LWLA 3LAMA 2GV1A 4Y2CA 1VQ9S 1QTMA 1FXLA 4Q43A 2PFFB 1XJWB 3VVTA 5H1SV 2PFDA 4DL2A 1KBRA 3MI7X 4Y6IA 1N5TA 1C0UB 4NOHA 1S6QA 4ZP6A 4YUDA 3RGIA 3J7A1 2D9OA 3NY0A 4RL1A 3EPGA 1R0CB 1TL1B 3P45B 2Z2ZA 4RNFA 5C2GA 1M5KC 2LYVA 2MQPA 4DR2F 1RWWB 4LBIA 2VODA 3VAKA 2CPZA 3DM2A 2B7BB 2YBVA 1YTYA 1UKUA 2A0FB 2CPXA 2FHMA 2MJNA 1UEUA 1NBEB 3C14B 4KC5A 4RJVA 4WBFA 4ZCLA 3SSSA 5KTQA 2FVSA 3NGRA 4K4SA 2P2CB 3LP1B 4HH0A 4NRUA 1TU0B 3U27A 4EO8A 2F3JA 5BR8F 3CXCR 3N0VA 4E2FB 1O5JA 3G4SS 1KWMA 5HATA 3TO8A 3CCQS 4A8MP 3R7BB 1G7CB 3UCGA 2V2VA 3BGRB 4ANDA 4X4SA 1FKOB 3VAFA 3AH6A 3C16A 3GIIA 4DV2F 4ZVSB 4ECYA 1NJXA 3D66A 3PO5A 2EW9A 4J9OA 2VG5B 3FQKA 2ZJRQ 3D6HB 2OLWA 4C2MA 3OSPA 2V9KA 2UUBF 4QWDA 1B7FA 2CDRB 1C2PA
chains in the Genus database with same CATH topology
2DR5A 1KQGB 1MWYA 4IRKA 1O51A 3KK3A 3LGMA 4QOTA 4P2SA 4DG1A 1B0TA 5CQGA 3MXHP 2V0NA 2ZKUA 4Y65A 1TAQA 1X4EA 4C9DA 3N01A 4I68A 3J7YI 4DF4A 4RBTA 2L3MA 1SI9A 1UAWA 3CDAA 5KFUA 1VOMA 4DMZA 3BO4A 2BRKA 2YKNB 3T5LA 4O4RA 2F8EX 1ZTWA 2UU9F 2BZ2A 2PMHA 2IHR1 3HHKA 3T1AA 3DDNA 3ZZPA 5IZHA 4N76A 2VZ9A 2RU9A 1FKAF 4X64F 5GAHU 3GV8B 1RI7A 4EBDA 5HLFB 2RNEA 5L9NA 3N79A 2HLTA 3UCZP 4K4UA 4PXEA 3JTNA 4WYWA 3W3SA 3SDEB 4NZ0A 2MSTA 4FNIA 3DLHA 3BJYA 3G8SA 1UVNA 2M7SA 2HVZA 4MK9A 1IKWB 1IKVA 1AROP 4L6V3 2AYGA 2DNQA 5KFTA 5KT2A 2LDYA 2XSJA 1M5HA 4ZHRA 4IFYA 2PA8D 2CQIA 5DG7A 2C3PA 2ZE2A 2DNLA 3QO9B 4RNHA 3K59A 4X4NA 3H8YA 2MZJA 4ZVFA 3O5TB 1TP7A 1VQMS 2UXDF 3I32A 4KFBA 1X4BA 5E3QA 1NHUA 3PY8A 3CDUA 2XI2A 2M88A 3R1HA 3JYTA 2J6SA 4OX7A 2BVZA 3GE9A 4PWDB 5A0YA 5DQIA 4FF3A 1XWLA 4H4OA 2YNFA 1S48A 3PR5B 4V19X 3OFFA 2R4FA 1X4AA 4K2XA 3MD3A 3V5RA 1U6FA 1N6QA 4OJ3A 2VG6A 4XPEA 2JOQA 4MFBB 1BY9A 2VBXA 2CYYA 3KHLA 1UW4A 3JSMA 4A48A 3D1OA 3NP5A 2M0GB 1BQMA 4GC6A 3OTBA 2L41A 3CCJS 1S6UA 2DIVA 4YP3A 3C6TA 2V94A 3LWMA 4O44A 2KM8C 1VQ4S 4J9QA 2FLPA 4WK3A 1P27B 1H7WA 2GFFA 4NCGB 2XLJA 1RT4B 4Y3CA 2R8JA 2PSZA 2D3OR 2IBOA 4YDXA 3VZHA 4YEAA 4Q8EA 3PW0A 2YX7A 4N56A 4IG0B 2KDOA 5LXYA 4I67A 2JLGA 2Z8QA 3P49B 4NCAA 4XIUA 4PQAA 2W7OA 4ZCIA 4JV1A 4C8KA 4KKOB 3QLHA 2WSEC 2PEHA 3H5XA 3V81B 2XSJB 1D1UA 1TFWA 4DQQA 4FBTA 1BQMB 2Y1JA 5KFWA 3CSKA 4LT6A 3B4MA 3OV7A 4RW8B 2XMWA 5B0CA 3GQCA 1U8SA 4E98A 3RB4A 3I55S 2E1MC 4HHJA 5EX3A 5KFBA 3PR4A 2VD3A 1F5BA 3CIZA 3GWCA 3TA0A 3QGIA 2NLWA 3RW7A 5KT5A 4K4ZA 1RTHA 1C1BA 2UVRA 1UFLA 3NMAA 4DR5F 4ZDNA 4PWDA 2KFZA 2FJWA 3MF5A 3DLLQ 3BSOA 1UJ5A 1VQ5S 1JKHB 4F25A 3EX7B 2FVPA 3LP0B 5AJ3F 2AJ1A 5KFAA 3V4IA 5SZTA 3FCHA 1S0NA 3I0RA 3MFIA 4CH7A 4F8RA 1SJ4P 4K0KF 4XDDA 4GC7A 1Z1ZA 1NK6A 5D4NA 1URNA 4B9MA 2DJWA 4C8YA 4ID5A 3MFHA 1T05B 1SJ1A 3TAQA 2J6TA 3MM6A 1XMBA 1BC6A 2VQFF 4OL8A 3DMJB 3I4HX 5LSLA 3CD6S 1NJWA 3IR7B 4IKAA 5MLCV 3KJVB 3MEEB 2Q79A 1CLFA 2XG8A 4Y34A 2Y0SD 4I4BA 3CE8A 2GIRA 2KT2A 1FJEB 2V8GA 3FJ2A 4GMKA 3M6UA 5K8PA 5KFSA 5FJ4A 5HLFA 1Q8LA 4WFXA 4Q5VA 3VAIA 2QA4S 5F8JA 3HT3A 1FTCA 1TQLA