3IRWP

Structure of a c-di-gmp riboswitch from v. cholerae
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
90
structure length
90
Chain Sequence
RPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of ligand binding by a c-di-GMP riboswitch.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein/rna
molecule keywords U1 small nuclear ribonucleoprotein A
total genus 22
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2009-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3irwP00
2EK1A 3G6ES 2DNQA 3CD6S 1K73T 4UY8T 3PIPQ 3G71S 2DNHA 1WG1A 3CF5Q 2OSQA 2XS2A 2ZJQQ 1WI8A 4QQBA 3UE2A 5GAEU 2K3KA 1UAWA 2MZQA 3MUTP 1U2FA 3CMAS 2LEBA 3NMRA 1H2TZ 2MQMA 2MYFA 1YWXA 4IOAQ 3CMES 3THPA 2MSSA 2KG1A 2EVZA 2DGTA 2MKJA 2M8DB 2KM8B 2CPHA 2CQ3A 2F9DA 2MXYA 1JJ4A 1U1OA 4W90B 5D77A 2LA4A 5GAHU 2RS2A 1Q82T 2DGXA 2FHOB 1QM9A 3MDFA 4OZ0A 2MY7A 2HYIB 4LJMA 1JJHA 3UCZP 5MLCV 2DNNA 1DZ5A 2D9PA 2KH9A 2AYMA 2QA4S 2LKZA 1FJEB 2KHCA 1HD0A 3HHNB 1ZZNA 2SXLA 1YITS 2B0GA 2CQBA 1X4DA 1QVGR 2DHXA 2X1GA 3J7YU 3ULHA 2AYEA 3SXLA 1VQLS 2VOPA 1N8RT 4J5OA 2DGQA 2MKHA 2CQ1A 1X5TA 5DDRC 3G8TA 1YHQS 2K8GA 2MZ1A 2VONA 1W2BR 1DBDA 2O3DA 3CCSS 1U1RA 4PRFA 2M7SA 3VAHA 2G1DA 5HL7Q 3CUNA 2N3LA 1SJQA 2CQPA 3Q2SC 3G4SS 1SJFA 4Z2XA 3R1HA 3SMZA 5LXRA 2DNLA 1WI6A 4Y0FA 3MD1A 1X4FA 2ADBA 2MQQA 3SDEB 5HO4A 2RVJA 1K8AT 2CQ0A 2RS8A 1P27B 2DIVA 1X5OA 3BO2A 3TP2A 2KN4A 3J7ZT 1M1KT 3VAKA 1D9AA 2DGVA 5CXTA 1KOHA 3P6YC 1X4EA 1VQ5S 1N54B 1M90T 1G2EA 1X4HA 2EK6A 2RNEA 3MD3A 2XS7A 2E5HA 2QEXS 2DNMA 2DHAA 1PGZA 3B4MA 1YJWS 2M0GB 2MB0B 2HGMA 2ERRA 5LJ3Y 2DH8A 2VODA 2AYGA 4F02A 1JJ2R 1FXLA 3CCJS 1U6BA 1N88A 2GO9A 4ED5A 2CPIA 3NNCA 2J0QD 1VQ8S 1A7GE 2CQDA 2DH7A 2HGNA 2M8HA 1OO0B 1YJNS 4CIOA 3CCRS 2D9OA 2E5JA 3L3CA 1S79A 3CTRA 2F3JA 3NNHA 2UP1A 2M9KA 5D78A 5EN1A 2DO0A 2FPHX 5GADU 2RUGA 4YUDA 1U1PA 1FO1A 2NZ4A 2M52A 3CCES 1YTYA 2L9WA 1KD1T 4C7QA 2RT3A 2XNRA 3UWTA 1SJRA 2CPDA 2LEAA 4PKDB 1VQ7S 2XS5A 3CC4S 1KOOA 2DGOA 2CQIA 2U1AA 1X4GA 4YOEA 4EGLA 1NO8A 2M2BA 3I55S 2DNYA 5GMKa 1SJ3P 3ZZYA 2ZJRQ 3P49B 1OPIA 2XNQA 1S72S 2LQ5A 4F25A 2YTCA 5DDQC 3UD4P 1WHYA 2I38A 1HL6A 2DNKA 1WG5A 2FC9A 2FC8A 2V94A 4P6QA 1X4CA 2MSTA 2MZTA 4FXVA 3US5A 3IRWP 2G4BA 1WHWA 1X5PA 4W92B 2DGWA 3N9UC 1QVFR 3TO8A 4WF9Q 2FY1A 1IQTA 2Q79A 3S7RA 2J0SD 1VQPS 2DIUA 4QU7A 1FT8A 4Y00A 3IWNC 1RK8A 1U1LA 2DNZA 2AYBA 1WTBA 2QFJA 2DHGA 4C4WA 2DNGA 4CH1A 1K9MT 1Q81T 3VALA 2MZSA 2L41A 4IO9Q 2LXUA 2DITA 4WKRA 3VAMA 3BEGB 2XB2D 2OJ3A 5GVQA 2CQ4A 2G0CA 2KXNB 2L08A 3THTA 3JB9k 4WIIA 1NU4A 2BOPA 2RQ4A 1VQOS 1X5SA 2PEHA 2MQNA 1OWXA 3H2VE 3UCUP 1M5PC 1VQKS 1FJCA 1WF2A 2DH9A 1PO6A 4LMZA 5DDOC 3BO4A 4LIRA 1XN9A 5GAGU 3S6EA 2RRBA 2MMYA 5LXYA 3CCLS 1VC5A 1VQMS 4CH0S 2MGZA 2HZCA 2M70A 1UW4A 3DXBA 2DNOA 2E5GA 5IM0B 1M5KC 1HD1A 2DGSA 3VAJA 2CQCA 3PIOQ 2RRAA 2D3OR 4RU2A 2OTJS 1FJ7A 1DRZA 3D2WA 5JVGQ 3HI9A 1VBZA 4QPTA 3OW2R 1Q86T 5H1SV 3CCQS 5JVHQ 1VQ4S 1X0FA 1NJIT 2KVIA 2MKSA 1U1QA 2CQ2A 3NNAA 1P1TA 2CPXA 4PR6A 3UD3P 5ITHA 2MZRA 5IFMA 1HA1A 3CCMS 3TYTA 3CXCR 2DO4A 3G96A 1UFWA 3CC7S 1VQNS 2J8AA 1FNXH 3VAGA 5LSLA 1YJ9S 3UCGA 1WHXA 4U67Q 1ZH5A 3K0JA 2DISA 2MGZB 5DM6Q 2X1FA 2KT5A 4UQTA 1U1MA 2KRRA 1H2UX 1VBYA 3Q2TC 3RW6A 1O0PA 2KG0A 1A9NB 4A8XA 2LMIA 3EGZA 5IQQA 4QU6A 2LCWA 4ERDA 1DHMA 1WEYA 1URNA 2NLWA 5IM0A 2CPFA 3LPYA 2LECA 3P3DA 2LA6A 2CPEA 2E44A 2MHNA 2MKCA 2CJKA 2MJUA 3CC2S 2KRBA 3MOJB 2KM8C 2RU3A 2X1AA 1VQ6S 3MI7X 2YWKA 1B7FA 3CCUS 2DNPA 1X4AA 2CQHA 2M88A 1R8HA 1ZZFA 2JX2A 4WFAQ 2KXHA 1Q7YT 5BJRA 3MUMP 3MURP 3U1LA 4WFNQ 1R8PA 1SXLA 4WFBQ 1WF1A 2DNRA 3G8SA 2MKKA 5LJ5Y 2U2FA 4TU7A 1UP1A 2VOOA 3NS6A 2N3OA 1VC6A 4F26A 1RKJA 1U1NA 2AD9A 5DDPC 4IOCQ 3BS9A 2M4MA 2MY8A 1D8ZA 1KC8T 2KU7A 2JVOA 2LYVA 1YIJS 2MQLA 3BO3A 1JMTA 2YH0A 2HGLA 4TLQA 1X4BA 2HVZA 2MZJA 4TU9A 2N82B 2DB1A 3CULA 4OZ1A 3G9CA 2LXIA 4CQ1A 3RW7A 1U6FA 3LQVA 1M5OC 2CQGA 2RQCA 2OTLS 2MJNA 2ADCA 1N52B 4M5DB 1SJ4P 1KQSR 2PE8A 4FXWA 2JVRA 5LSOA 2YKAA 3S01A 2MQPA 1WEZA 3U1MA 2DGUA 3NS5A 2MPUA 2OSRA 1YI2S 5DETA 3EGNA 1VBXA 4V19X 2JRSA 3R1LA 3H2UB 3I56S 3EX7B 3MXHP 3VAIA 2I2YA 1L3KA 2CPJA 1AUDA 2MQOA 3P5TL 4BS2A 1H2VZ 3DLLQ 5FJ4A 2KFYA 3FEXB 3ZZZA 1VQ9S 1OIAA 1H6KX 1BY9A 3VAFA 1WEXA 2KYXA 5DM7Q 3B4DA 4WCEQ 2A3JA 5CYJA 2XSFA 3CCVS 2J76E 1M5VC 3R27A 3MUVP 2GHPA 2KI2A 2CPZA 1WG4A 3S8SA 4YB1P 1WHVA 2X1BA 2ZJPQ 2CPYA 4IUFA 2MKIA 5CA5A 1WWHA 4C0OC 3CPWR 3V4MA 1F9FA 1FHTA 2E5IA 2YH1A 2WBRA 2JWNA 1WF0A 2BZ2A 2KXFA 3VF0B 3SDEA 1VC0A 2DK2A 1U1KA 2F9JA 4TU8A 1WELA 2N7CA 1CVJA 4ZKAA 3FEYB 2OIHA 2DHSA
chains in the Genus database with same CATH superfamily
4OJ3A 4OYZA 2DNQA 2NSBA 3FJ2A 2XCPA 3CD6S 1PYOB 4GVBA 4X4OA 1K73T 4ANCA 4JI5J 4PWUA 3MEEA 4UY8T 1TKTB 3K5LA 1N33F 2YNGB 2DNHA 3R5JB 2VIHA 2MQ8A 2OSQA 2XS2A 4USVA 4Y28C 2CJQA 1T02A 5IV3A 4F4XA 2K3KA 1FNMA 3E01A 2MZQA 4IH6A 4YN3B 1YDLA 2XM3A 1EETB 4RW4A 3BGRB 2HLTA 2LEBA 2OTJS 3QIPA 1PYTA 2CVEA 3HDSA 5A8KB 1H2TZ 2QTWA 3FBFA 3GSDA 4NE9C 4DV3F 5F0WA 4A8MP 4ZLPA 4ZCKA 1RACB 4H4MA 5AJ3J 2DGTA 3POTB 1BQMB 1PKUA 2C3YA 4L76A 4P7VA 5A8WB 4DV5F 1JKHB 2EFQA 1BGXT 2CQ3A 2F9DA 4PPDA 5A0YA 2XMJA 2ZUGA 3FVYA 2G13A 4QWBA 2ZH2A 1C4CA 2LA4A 1S48A 3D1QA 1O8BA 4X65F 2A2CA 2HNYB 1GX5A 4LJMA 8ATCB 3UCZP 1FESA 1I51B 3DI6A 3I87A 4GC6A 2A1BA 2ATLA 2KH9A 5ADZA 2OGUA 5HQ8A 4NA1A 3KLHB 3W9IA 4NCBA 5BR8J 5J1PA 1FJEB 1HD0A 5KFIA 1OSDA 2HLUA 4B3SJ 3QWPA 1CQNA 3QATA 3HHNB 2Y8WA 1SUQA 3NGRA 1CEZA 2IAJB 5EHHA 2VQEJ 1KONA 5L38A 2BJDA 4DV7F 3IBFB 1TKZB 2HNDA 2X1GA 4QR0A 2FB0A 4OJ1A 2PIIA 2CJAA 2VOPA 5H9FK 2B6AB 3IRXB 2B9EA 4C2MA 2DGQA 4CI0B 1X5TA 3G8TA 2IFXA 1B70B 1YHQS 5K8OA 2K8GA 2EFNA 2C2ZB 4RUCA 5AT1B 1PJ7A 3OFEA 3ET6A 4ID5A 1VRUB 3MPYA 4KFBA 2O3DA 1R0AB 2B5JA 1V3SA 2XBPA 5L39A 1FTRA 1WD6A 1Q8KA 4IFYA 2XWYA 2HWIA 3LAMA 4LR7A 1CJTB 5D6GA 3VAHA 2G1DA 1IBLF 3SCIE 4QW9A 5HL7Q 3CUNA 2N3LA 2HPUA 2PI4A 3Q2SC 1TKXB 1TVRA 3G4SS 3R1HA 2ROPA 2GQCA 4A8FA 4USUA 4RLEA 1YJTA 3MD1A 2OPPA 5L9XA 1X4FA 2HHUA 4NXMF 1HMVA 5HQLA 4V19J 4PZVA 4O3QA 2MQQA 3RB0A 3X3UA 5BXIA 4ETZA 1NJYA 1P27B 4AYBD 3B6BA 5M2PA 3DYAA 3BO2A 2FUG9 5IXUA 1CC7A 3WX4A 2LXFA 2AJQA 1AFIA 4G6VB 3J7ZT 4AL7A 1D9AA 2DGVA 2W24A 2RAQA 3W63A 5CXTA 3V6DB 3W66A 4ED4A 5LMUJ 1VQ5S 2ZH1A 3FCWA 1CJUB 4CLPA 3ZTOA 1S1XA 2G1HA 3CDBA 3MD3A 2XS7A 1UWBB 3AXMA 5CCMA 3H59A 2EFOA 5DO2A 3DRYA 4X2BA 5KOWA 3ITHA 5J2PB 1O51A 4P52A 3BYPA 2HGMA 4LBHA 4ECQA 2ERRA 4TNOA 4OMFG 3W61A 4C98A 1KDNA 3M6VA 3LGHA 4F02A 1UZHA 3DLKA 5KFAA 2CXEA 2B4VA 2XMAA 5ETNA 3KK3B 2M3DA 3M2VA 3G82B 3OHBA 1SPBP 2LP4A 5HJXA 4ES3A 4DF8A 3M2RB 2CPIA 1HBNA 3LP2A 2APOA 1NH8A 2BE7D 3DOMA 4PPZA 3M9MB 4MT1A 2UVRA 3RB3A 2GIQA 3M6UA 2OFHX 5B0FA 1FKOA 4XIUA 1EX8A 3GYXB 4L72B 4DSFA 2HGNA 1HNVB 1RHJB 3GTYX 4ZK7M 5B0GA 1J5OA 3TZYA 4F4ZA 4M95A 4XPCA 1RTIB 3NKYA 3RB6A 1N32F 3VGUA 2ZH6A 3SV3A 2F1FA 2GIRA 3CTRA 3GSIA 2F3JA 3NNHA 2A2DA 2PC6A 4C97A 3PRVA 1M1GA 3D3CJ 4WK3A 2RUGA 4DPWA 3HPOA 2BKNA 1NK9A 4U7UD 2B9XA 4YUDA 3R7SB 1GXUA 1UVKA 4TQRA 2C2KB 1U0SA 3HLUA 4ZP6A 3TA0A 1Q53A 3D1OA 3DCAA 2RHQB 3KG1A 4LSLA 1GT8A 2W7PA 5I3UA 4WBFA 3ZTRA 3I5BA 2GJFA 3IXQA 1RTHB 1KFDA 3QQCD 4ZVUB 1SL1A 1YJUA 1DARA 2PMHA 3B78A 4JI0J 2CPDA 5EDWA 4RNNA 2HFZA 3MR2A 2XS5A 4RU9A 3RBXA 2CQIA 2U1AA 3PFOA 2YKOA 1CPZA 1IJEB 3J80Y 1NO8A 1C0TA 2CRLA 2M2BA 3MR5A 3AA8A 2GJ2A 4OHVA 3VR1A 2JJ4D 5HMYA 3PR4A 2J6UA 2OD6A 1SJ3P 4JI6F 4ED8A 3H5XA 4M5HA 1OPIA 3H20A 4G1QB 4J90A 4UZBA 1G7CB 1HNVA 2XNQA 1UA1A 3PW4A 2OMLA 3LGNA 5DDQC 4WFZA 5KFDA 2EWHA 3UD4P 3PHTA 1WHYA 3HHLB 1HL6A 2NREA 1WG5A 4WJBA 3U7JA 3BH6B 3DRXA 3SBMA 4FXVA 4WE1A 3US5A 4RPFA 3WC0A 1XC9A 3IRWP 4R25A 3N0VA 4QIWD 4W92B 4C3LA 3N9UC 2ZH8A 1XR6A 2VKZG 2P6SA 2FY1A 3MGJA 1IQTA 3K5MA 1FKOB 1ZM9A 1FT8A 3EXYA 2WSCC 3CDUA 4DQRA 3TANA 4ICLB 3Q8VA 1YZ6A 5IOLA 1F2HA 4CNYA 4DPTA 4E2FB 4OZNA 5HJYA 3H40A 1WTBA 1U47A 4K50A 3AB4B 4DX6A 2K2PA 1NZ8A 1RGVA 3M2RA 2WBMA 4ED1A 2DNGA 1ZAWA 4QWEA 2XY7A 3V6DA 3G82A 3UN3A 2NSCA 1HNZJ 4OIXA 2W9BB 1OMSA 2PMWA 3X1LB 4JYAF 2LXUA 4MIWA 3VAMA 3UVJA 1IBMF 4DSEA 2IM0A 4A47A 2EKYA 2XB2D 2ZNYA 2OJ3A 1NK5A 5B0BA 2UXBF 2JHEA 3CGIA 1HBMA 1VRTB 4CLUA 5J2QA 4CCHA 1SH2A 4ALZA 4TQSA 2E1PA 1HMVB 2PEBA 3PX0A 3OT9A 2H3EB 3THTA 4GRSA 4ENOA 3JB9k 1D8YA 1PSDA 4IDKA 3M8QB 3MM7A 4ECVA 1X5SA 2OAUA 4MK8A 4ZVQB 3HT3A 3UCUP 3CJKB 1NUEA 4ZLNA 2XGPA 1PO6A 1KN6A 3OFFA 4GMKA 3CJQA 2PFDA 3K7RA 3MMAA 4W4MA 5DDOC 3ILLA 1NJWA 2J0XA 3KLFA 2YNHA 4CO0A 3K17A 4A4JA 1XN9A 5E0OA 4AT1B 4OV6A 1LWCB 2LLZA 4OYWA 1RT3B 2MMYA 5LXYA 1N5QA 1SV5A 3FGVA 1Y5LB 2RU9A 4XDCA 4XDDA 2M70A 4CH0S 1NHVA 1JLCA 2E5GA 2VG7A 4ZJOA 2WOMA 1S5ZA 2DCLA 5K20B 1TKXA 1TVRB 2V2ZA 2HNDB 1HD1A 4J9SA 3D6MB 4RU2A 3OTEA 2C2RA 3EVWA 5K8NA 1UVIA 4LF4F 3PY8A 4KC5A 3HI9A 4MJKA 4RW9B 4QYRA 5C42B 2BQUA 1G3OA 3ET6B 4ID5B 2AGQA 4CLZA 3KLHA 3CCQS 4UOCA 1SL0A 1X0FA 2GMLA 1NJIT 2MKSA 4MKAA 5EWFA 2CWXA 1H74A 2ROGA 4M63A 1DLOB 4ZITA 1R8CA 2G2YA 3LW5C 3OHAA 3TEGA 5D4LA 3U27A 3T1YF 4ZVEA 2VFTA 3P45B 5ETOA 2MZRA 4YQWA 2NXNA 2HKEA 4ZPVR 4DV5J 1FXRA 2XO7A 2EFPA 4JV1A 1HARA 2ZVSA 2ASLA 1XMOJ 4FF1A 3ZC4A 3O2IA 1VQNS 2IAJA 1RT6A 4IQXA 4TLRA 4DV2F 1RAJA 3QWUA 4BBYA 5LMUF 4TYAA 3W9JA 1UZDA 4RBVA 2FVQA 2KB2A 1C1CA 1NB2A 1WHXA 1YGYA 3BGRA 3EJMA 4U67Q 3K0JA 3RU0A 2RDIA 3HF5A 3QT5A 3AODA 4OQJA 3RG6A 5AE2A 5E7OB 4B3SF 3C3LA 4QYZJ 2X1FA 1TUWA 4KY3A 2A18A 2N4CA 4UQTA 2BQRA 4B9UA 3VQSA 4KO0A 3TVZA 3RW6A 3OL8A 4GO5X 1A9NB 4L74A 3UN5A 1BQMA 3JQKA 2EFGA 3G86A 1E6VB 2QLXA 3EGZA 3CB4A 3HFKA 4PWWA 3RBZA 2BJEA 2W4CA 1DHMA 3QIPB 3CT9A 4NLUA 5IM0A 1HLWA 3BKFA 4K2XA 4ECZA 4LF6J 2LVWA 4IRCA 2Q6BA 3ISNC 3LPYA 2HSEB 3KUGA 2CPEA 3AHPA 4K5SA 4OI4A 1S10A 2RQMA 2H48B 3CC2S 4ZVPB 1TKTA 1U09A 2I8EA 5C2CA 4QIFA 1YRUA 4LRDA 1UFLA 1MWYA 3DGVA 3GB0A 2C1EB 3W8PA 3HHDA 3NBPA 3PYDA 4KV8A 4KE5A 4M5MA 4OJGA 5E3AA 4O3PA 3ZZUA 1J5EJ 1KNZA 2YX4A 5KFZA 3QRPA 1CS4B 1YQHA 1FTCA 4I1TA 1KQKA 1V9OA 1X4AA 3GIIA 5IZHA 4OYBA 2M88A 3D5MA 2W8KA 2C2EA 1RHQB 3CJTA 4O0NA 2JX2A 2BABA 3PKMA 2HVDA 1Q8IA 1F3FA 1Q7YT 5BJRA 4WP3A 3UFCX 3SFGA 1HBUB 1BC6A 2YQ1A 2OKQA 4U8VA 2V2QA 2ZBPA 4OYPA 3SCJE 4E8UA 3J81U 1N5YA 1JWWA 2B8PA 3NXZA 4DCOB 1EKSA 1RLDA 3EVMA 4WFBQ 4RKUC 1DTTB 3OUYA 1IR0A 6AT1B 1RAOA 3K8VA 3OJSA 2R2UA 4QIGA 1NPRA 4YR3A 4DSLA 1IQZA 1UP1A 2RF2B 2CFXA 3HVTA 1CLFA 5ETTA 4KHRA 4NRUA 1TUVA 3M8YA 5HVHA 2J6SA 4JI8J 2JDJA 4CLFA 1U45A 4WIQA 4AD6A 2OUGA 1NHKL 3GIRA 2V8HA 1RBOB 3BS9A 3BPDA 3ISZA 3NGUA 3O3LA 4JI8F 4AFFA 5I42A 3H42A 1LXJA 3EZOA 3QJPA 3MMJA 5KTQA 4IRKA 3OD2A 2BYCA 1HW9A 1WKKA 3M6XA 1YBUA 2HMIA 2P5VA 1QE1B 2QSWA 3HHLD 4Q7AA 4ZPBA 2FTRA 5D0RA 5G0RA 4MK9A 2VB6A 1TAUA 3PNIA 5G0RB 5DS7A 1LWXA 4P2FA 2Y9HA 4F2RA 5B0EA 3ELHA 2FVRA 5D3GB 1EARA 3DM2B 4CQ1A 2ACYA 3PW2A 2A0FB 4F4KA 3CDAA 1U6FA 2JEIA 2HAFA 5L1KA 2CQGA 2EC2A 4TY8A 3WQPA 4X4SA 1DFDA 2B4PA 1KQSR 2FHJA 2ZD1B 3CJ8A 1RE1B 1WORA 2JVRA 1MMNA 2IRYA 2VFSA 4NLVA 5K14B 4CTAA 1VIXA 3FFIB 3H0PA 3RZAA 4FXDA 1SC1B 1RT7B 1WEZA 2EBGA 3HSJA 3PJXA 5CYQB 4OHZA 2VQFF 2OSRA 1NAQA 3IWLA 1WKLA 2HNZB 3EGNA 2J0SD 3K5OA 1VRQC 2JRSA 1T03A 3R1LA 3D3BJ 2D69A 4QWDA 1W25A 4M94A 1PC5A 2I2YA 3TZWA 3JSMB 1HNIB 2BR0A 2RKIB 3VAIA 2COLA 1HWLA 2QJ3A 4I6YA 4J9VA 4YB7A 3RR7A 3HSZA 4FZVA 3DLLQ 4NL5A 1SCJB 3F0NA 4DG1B 3JAMU 1W7WA 4JV5J 3FK4A 1V3ZA 1URRA 2R8HA 2NUHA 1Y3KA 3HVRA 4NMXA 4OV1A 7FDRA 1H6KX 1UJ4A 2B51A 3SCLE 1HWUA 2PDAA 3WHIA 1S6PB 1ZTWA 5DM7Q 1T9TA 2A3JA 4LT6A 2XSFA 4HDGA 4QYZK 4DEZA 2BX6A 5KFGA 3MUVP 3DKDA 3OR2B 2D3O1 2CPZA 2CDRB 3KJVA 3DLGB 1JXLA 4K8RA 1WHVA 1N6QB 3O44A 5KG5A 4ZIVA 4EO6A 3SZ2A 4IUFA 1MMLA 3R5AA 1H73A 2HWTA 4ES1A 5CAAA 2KYZA 4E0DA 4TXSA 2J9DA 5LL6d 3HT0A 1R6YA 1T9WA 1WWHA 3IBWA 4FYXB 3HVAA 3TUIC 4C0OC 4F0MA 3M8PB 5HN0A 1XMOF 1F9FA 2UXDJ 5F8GA 1R8BA 2XHCA 2LQJA 3NEKA 3AB2B 4DV2J 2XCAA 2FLPA 3TUJC 3OVSA 1WUUA 2F63A 2C2MB 1WF0A 2BJ9A 2BZ2A 2J7WA 1N0UA 2KXFA 2QYGA 1G4CA 3AOCA 3IS9B 3SDEA 1VC0A 4KGMA 4U8YA 3RAMA 5I4MA 1Z2ZA 2A6MA 4X4PA 3M9OB 2R2TA 3T5KA 4ED7A 4TU8A 2HFVA 2XLIA 4DR7J 5LSRA 2DR6A 4IOBA 3CD7A 1IKWB 4DV6F 1CVJA 1ITPA 3KLEA 4KSEB 1S1WB 1OPZA 1B4SA 4JBCA 4KHMA 3NY0A 3Q8SB 1B0TA 2WK4A 2DHSA 3G6ES 5AJ3F 3N6NA 3W7BA 2CDQA 4FF4A 2DRAA 5KT4A 2XMMA 4JI1F 1I5OB 1ZA2B 3D54A 4ILMA 1WC0A 3EM1A 5CYMA 2ZH5A 2RE1A 1RWMB 4IH5A 3GYNA 4ETXA 1R31A 4MFBB 2ZJQQ 3BGOP 4DFJA 4QQBA 4PQUA 3QGPA 1BMQB 1GXLA 2XZWA 3I32A 1UAWA 3I82A 2VBXA 1IKVB 3CCZA 3QNWB 1BXNA 4PYDA 5U47A 3MUTP 3P96A 1V3RA 1Y00A 5F8LA 3TZXA 3NMRA 5CHCB 3C6UB 3FDSA 1CULB 4USMA 3NMAA 3FKBA 3R7BB 1YWXA 4IG3B 4DUYJ 3W3SA 2XLKA 5C42A 3CMES 1VLOA 2M8DB 4FVCA 2KM8B 2YX7A 3GFZA 4LQ9A 3QLHB 1DURA 3PX4A 4IFVA 1UFKA 4Y2MA 1U1OA 1JJ4A 2Z2MA 3TJ9A 5E2QA 5A8RB 1JLCB 1QTNB 2VG7B 5D77A 5GAHU 2V9WA 1JLBB 2RS2A 1IBCB 2FHOB 1QM9A 3KJQB 2FJEB 4N8NA 2BW7A 4R0EA 4OZ0A 4NXMJ 1BHNA 3GFXA 1JJHA 2CJBA 4DX7A 7FD1A 1RT3A 2D9PA 1FKPB 2AYMA 5HROA 2QA4S 2Q43A 2KHCA 4USJC 1MU2B 2NXUA 4PXEA 5HVGA 1QY7A 4IR1A 3HZEA 4FBTA 4K4TA 2CQBA 4W98A 3CIZA 1Q1KA 4FKYA 2BDPA 3T5LA 1GFWB 3GMGA 2XULA 2Z30B 2DHXA 4YDXA 4F3QA 3J81Y 4QU7A 2HQGA 1N5VA 3FC9A 3C15B 3J7YU 4F0HA 5A2QU 2R7SA 3GJSB 4Q5VA 3SXLA 4BHQA 3EICA 1Q4RA 2C28A 2M5YA 2QE5A 3BH7B 3O5TB 4HTIA 4KR0B 4RJVA 4DL7A 1RT5A 3HP6A 1BD6A 3C15A 4GKKJ 1K44A 4ECYA 4OZLA 1TL3A 2R7XA 4IKAA 1TELA 2F8HA 5F8HA 2PMZD 4LSZB 1WSRA 3UVJB 1U1RA 1X9MA 4PAAA 2M7SA 1MU2A 3L4BC 1EZZB 1O5JA 1S12A 2XC9A 1FKPA 5HROB 1S59A 1HW8A 3W2VA 1SJFA 2GVDB 2P6TA 4GKKF 4FVMA 3PHEA 1Q5YA 2DKOB 2R2RA 5LXRA 2DNLA 2IHR1 3I96A 1FNOA 1Q0NA 1WI6A 3FNNA 5E33A 4C6AA 3G87A 2R7WA 1TL7A 3M30A 5AE3A 4UQGA 4USIA 5HO4A 2RVJA 4DV4J 1T95A 3HHEA 5B7WA 1VCTA 2CQ0A 2RS8A 3KJNB 3M8WA 2XYGB 5E3RA 2OHDA 4CLWA 1SKSA 4DR2F 3QLHA 3NLCA 4OI0A 1X5OA 2QMUB 4BCAA 1I94F 3N28A 5AXLA 4B17A 3RRGA 3TP2A 1XBWA 2KN4A 2V0NA 3C46A 3VAKA 3D28A 1SB6A 3SSSA 4FS1A 1YJVA 1S1WA 2J7KA 3OTDA 3ENWA 1X4EA 4P9SA 3J7AN 2BMBA 1WDDA 4ECSA 1X4HA 1CSJA 2EK6A 3FMWA 1L3VA 3KFWX 3UR3C 1SC3B 2BJ3A 1E6YB 4RW7B 3IP0A 4YB5A 4DN9A 4OL8A 5DQIA 1F1BB 5D4PA 4X4UA 1BE4A 1HR0J 2ASJA 2ZKTA 3C16A 4AQYJ 1PGZA 1TMMA 5J2MB 3IS9A 4OYAA 1YJWS 4DOZA 5LJ3Y 1D1UA 2CWKA 2FY8A 1YRTA 2DH8A 5C24A 1VQPS 2VODA 4X4NA 2EI5A 3A13A 2AJ2A 1JJ2R 2LDIA 1IWAA 5SZTA 1U6BA 1FXLA 3GJTB 2ZC3A 1N88A 4CO2A 2GO9A 4I64A 3RB4A 4CRJA 4ED0A 1A7GE 3VWSA 5IT0A 4ZLJA 5HQMA 5F3ZA 2GCFA 4URGA 4C8YA 4FS2A 3A8JA 2CUYA 4ED6A 2CQDA 1XIQA 3HSGA 8RUCA 5MAOA 5KT7A 4H4KC 2QG9B 5I3UB 1KFSA 1LWEA 3NGKA 1YJNS 2NXEA 4OYMA 1NMEB 2RD5C 4J9UE 4J91A 5JXSA 4ATNA 4UT4A 4CIOA 2R8KA 4LRBA 3KTQA 1SC6A 3Q8YA 1WJ9A 2GC8A 3P4UB 1RHMB 5AXKA 1Y7PA 1N4LA 3MEDB 1XTZA 3DXSX 2UP1A 4WZMA 3GU0A 1SBRA 2RSQA 5JJBA 3I0SA 4WXOA 1B3TA 3PG9A 4YS2A 1J2VA 1GMUA 2R7OA 3IM8A 3PYFA 3D66A 3MM5B 4NZ6A 3W60A 1WTFA 4WYWA 5GADU 2W9CA 1Y3JA 3EPIA 3KJVB 1FO1A 1N34F 2RKIA 2NZ4A 2CA9A 1H0HB 5HMWA 4TYBA 2W2NP 3GP9A 2M52A 3AAWB 4H4OB 1YTYA 4X66J 1H7XA 3D6HB 1HBOB 3BJYA 1FVQA 4K7QA 4LBIA 4C7QA 2QV6A 4S0MA 1KBRA 1S1VA 1T03B 4C8LA 2WCXA 4KIAA 5KFOA 1L5UA 2XNRA 3UWTA 2VD3A 2ZZMA 1SJRA 3AA9A 4WXWA 3BYRA 2J6TA 1HBNB 3KK2B 4OX8A 2G0IA 1NDLA 2QL7B 1NSKL 2QX0A 2QO3A 3JXOA 4QOTA 5KFHA 3M2VB 1QAIA 3R8YA 1R6VA 2O67A 3PXGa 1RT1B 5K14A 3KK3A 2IA0A 3JS9A 4I2PA 5GMKa 2RB7A 2H1YA 3M05A 1M0SA 1FRKA 1OQ3A 2KO1A 2ZFHA 2MDAA 3D68A 3IG1A 2QMWA 3T41A 4KGXB 5DZ6A 5KFPA 5HLFB 3DM2A 1JJCB 5B0AA 3SEOA 4JI6J 1RTZA 2UVWA 2BRKA 1RTDB 3C8YA 2R3VA 3C14B 2I9SA 4M5NA 1KR4A 2EG1A 1IKXA 3O1LA 5IC6B 4P6QA 1RT7A 1AT1B 2JEFA 1QE1A 3FFIA 2AJ0A 1ROFA 3I0RA 4NCGA 2ZE2B 4CTAB 4C11A 3H2LA 4AUKA 2CNOB 2CNKB 5KG1A 2Q3PA 3QZ8A 2DGWA 1MN9A 5L1IA 4PWDB 4TY8B 1KLNA 5DLFA 1H3DA 3AD9C 3A4TA 3JAMY 2VBWA 4DR1F 4WF9Q 2Q79A 1S0NA 2YBVA 1RTJA 1J27A 2PN6A 3RAQA 2D7SA 2MTLA 3RBEA 1U1LA 2KZZA 3TA2A 3JYTA 3QFHA 4O3RA 4C9DA 2VFUA 3TWZA 2QFJA 4UUXA 5DG8A 1WC1A 4CH1A 2YQ0A 4JOUA 1XJWB 2XZTB 2YKMA 3TNVA 1HYSA 2V4QA 2OPSB 3PM9A 4ZP8A 4NOHA 1RWWB 2PT0A 5L8RC 3Q22A 4NLGA 4C0HA 2DT9A 3TJAA 2C42A 4F0KA 1UEKA 4B3TF 2DRDA 4LF8F 4DJBA 4RBUA 1FX2A 1KHWA 1OS5A 2G0CA 4X62J 1ZPWX 4HVZA 2UVVA 3AXKA 1AXQA 2L08A 3ILIA 1VMBA 5IQ6A 2R7QA 3UNYA 2BOPA 3GV8B 2RQ4A 5E41A 2F40A 1K1SA 2PEHA 5IC4B 3IGVA 5HP1A 2ASDA 1FA0A 3SSRA 2W2QP 1ZM4A 4RNFA 2IC3A 3E3XA 4NYZA 1FJCA 2D3UA 4NRTA 1Q8BA 1SUQB 2C3PA 2W9AA 3LH2S 3MHYA 2VV5A 4PQAA 2FZCB 3AJ1A 4ED2A 1IKYB 4FN5A 5GAGU 1FRJA 4LRCA 2N4DA 4K4UA 2VICA 3KDNA 4Q45A 2HNYA 4G3IA 1VC5A 4J9KA 1VQMS 1WOOA 3K8WA 4RNHA 5DG9A 1RUSA 2MGZA 3WC2A 1UW4A 5IT4A 2ZZNA 2XMTA 2XSJA 4CO1A 2H65B 5IM0B 3UDVA 4ES2A 1CQMA 2ACMA 2CQCA 5IS2A 3PIOQ 4DXLA 3SQGB 5HBMB 2VBYA 1FJ7A 4KV8B 5A8WA 1RT2A 2FLLA 5DQHA 3POTA 5JVGQ 2ZBIA 3QAUA 3F41A 1RT2B 2OP5A 5SUHA 1DQAA 2R7UA 5BYQA 1VQ4S 3DMJA 3KMSA 1DQ8A 4JB8B 3QIDA 2KVIA 4LF7F 1IJFB 1FDBA 1EETA 2I1RA 5F0UA 5EX0A 1NCLA 5L46A 2H9ZA 1RA7A 5L1LA 1A0OB 2YVSA 4PR6A 2ZH9A 4DFPA 3BKTA 4PG5A 3T5HA 2FYXA 1QJHA 1U8SA 3LWLA 1RZMA 2AF6A 1C1CB 3CCTA 2XWXA 3QO9B 3TRGA 1RHKB 5HATA 3AH6A 2VHGA 4OYOA 1NK6A 1RI7A 3MEEB 2JH3A 1HQUB 1SQEA 4CWBA 3G96A 1UFWA 4ZDNA 2KKHA 2WSEC 3CXCR 1I94J 3Q8QB 1HNXF 1AFJA 2POKA 4U6PA 4DQSA 1U7LA 3OFHA 3SSQA 3VAGA 2GGPB 1JNRB 2HBQB 4KO0B 5K5MA 3WX8A 3GIJA 5CD4H 2F8EX 3AJ2A 5KAKA 4ID8A 5KFQA 5KFWA 2DR5A 4K4SA 4JI7J 5F3TA 3TAQA 2HWHA 3V4IB 2DISA 2RILA 2MGZB 2VG5B 3BQ0A 2FDNA 2LQ8A 4L3KA 1HR0F 2KT5A 2WVEA 5LMNJ 2FJVA 3OLBA 1F2GA 2BEFA 2Y0SD 3ENAA 2KRRA 5M2RA 4A8QA 4I7FA 2UXCJ 3PTWA 3KUHA 4RW9A 4A8XA 2ZM6J 3JTNA 2UUCJ 2LCWA 3VTIA 1FERA 4KAIA 3DRSB 1URNA 4I2QA 1UVMA 2QLWA 2QIFA 1MG7A 1VJQA 3K58A 4LF4J 1OYEA 1I1GA 2LA6A 2E44A 2FLNA 5ETLA 2IVFB 3KHHA 4CT9A 1LWCA 2GS8A 5A2QY 3C19A 2RQKA 4OLPA 3MEKA 4BC9A 1RHRB 1ZA1B 3MOZA 2L9NA 2RU3A 2KM8C 4NLSA 1ZBTA 4J9LA 4ZCMA 2AJFE 3LANA 2YWKA 1YX2A 2VU5A 3HULA 2ZE2A 2OPSA 4KH0B 3VCDA 4PUOB 4CNZA 4CP5A 1P9YA 4DPOA 1FK9A 4ELVA 3DC2A 4HHUA 3MM7B 2WOMB 1IN0A 3MF5A 4L75A 3BBCA 3PYEA 5FDLB 4WTOB 1IR1A 1SV5B 4PEOA 4AL5A 1FWPA 3MAHA 2Y1IA 5DGAA 3CO0P 5RUBA 3D0IE 4LVOP 2EXUA 3MURP 1HBMB 1VRTA 5J2QB 3U1LA 1NKCA 3KLFB 3OJUA 2IDEA 4WFNQ 1DTQA 2UUTA 1GTEA 1R8PA 5L1JA 1AW0A 3W64A 1VK8A 4Y2CA 2O1PA 3VHQA 3TA1A 4NLPA 5F9NA 3LF0A 4WFXA 2EPIA 5LJ5Y 4HL9A 2H54B 2U2FA 4O4RA 4X64F 2BUNA 3T9ZA 1IKXB 1XWLA 3NS6A 5E3CA 2VOOA 3HO1A 2KFNA 2QMXA 2KFZA 1Y5IB 3KLIA 4M1KA 1V5IB 2AT1B 3D67A 3OR1A 3AFGA 3DNCA 2AD9A 1P1LA 2NS1B 3EZ5A 2GMJA 2ZEJA 4MIAA 4NEZA 3OSNA 2YXLA 2FHJD 2GIFA 4URQU 4QCLA 3R2CJ 4B3RJ 5EGYA 2BJ7A 3ADAC 3K2YA 1TV6A 3KLGA 3ZTPA 2PGCA 1D8ZA 3G6VA 4AL6A 9RUBA 1RT1A 3IMQJ 3MM5A 2W9BA 3RRHA 3MR7A 1KVJA 2FVSA 2E7XA 1S9GA 2HGLA 3W5XA 4LREA 3EE3A 4DBQA 2AEJA 1JXEA 3MM9A 1N32J 1PBUA 4EU0A 1UVJA 4PXBA 1S1VB 3QBCA 1FRHA 3BKUA 3QSIA 4Q44A 4C48A 1UPPA 3L7PA 4H4OA 4NLWA 1C1BA 1JNZB 3Q89A 3RW7A 3LQVA 4I6WA 5FLXY 4C8MA 1XR7A 1QAJA 1T0TV 1CJKB 3UDEA 4KHPF 2PE8A 1UL3A 1VR6A 3GLJA 1FE4A 3V6HA 4X62F 1SIZA 4UW2A 3CMQA 1NH7A 5LSOA 4DR3F 1TR0A 2NPIA 5H9EJ 2YKAA 4MTPA 1KEKA 3R5CA 1UW9A 2CNNB 4WTYA 1QUPA 2MPUA 2ABYA 4PYAA 5DQGA 4P73A 5KFCA 3HHLA 2VG6B 3JSRA 4DR3J 1VBXA 5DLGA 1C0UB 2YPYA 5C25A 3MPWA 1UVNA 1RAFB 2E66A 3FEZA 3DLEB 3IR7B 1EQMA 4PG6A 3EX7B 2VQFJ 2VH7A 4RBTA 2NXCA 4M5DA 4UZCA 4KKOA 3DHWC 1VYAA 4N77A 2RUSA 1BWEA 1GMWA 2G9OA 4KKOB 3QMQA 5J2MA 2MQOA 3R6LB 2GAHC 1TUGB 2VG6A 4EI2A 1E6YA 4LSNA 4TVAB 2BKOA 2RRNA 4DV3J 4UOHA 1OIAA 3NCRA 2BACA 4C8NA 4F04B 4N47A 3H5YA 5EWEA 4Y2IA 5T7LB 4WCEQ 5CYJA 1UJ6A 2A10A 1S9FA 1U02A 2HHPA 5F41A 3MPDA 4Q8EA 1N33J 2KI2A 2FZGB 3JTOA 4ZA1A 4KT0C 2JZ5A 2YY3A 4MMOA 1WG4A 3S8SA 2B7BB 3NAHA 4YB1P 1TFWA 2G2ZA 3EGVA 3PJ9A 2FGOA 3SIPB 2IM2A 1ZAXA 2X1BA 4FPIA 4FYWB 2E5LF 1B99A 3DOMB 4KGKA 4K0KF 4IH7A 3GZ7A 1S77D 1MWQA 1YJ7A 4JI3J 5BYRA 2WVDA 2BBEA 1LW2A 2HFOA 2QSFA 4OZ5A 3CPWR 2E1MC 2UV8G 3AD8C 1FHTA 3DLKB 4DR7F 1KLMB 2DY9A 1RTIA 5ETMA 2GVZA 3JSYA 4CDIA 2ZHBA 3KLGB 5KFUA 2HHSA 2V8PA 1S57A 1VHFA 3CEDA 3HK2A 1RB0A 3FZBA 2UZAA 4XPEA 4K4YA 3MMBA 3OBIA 3K5NA 1XR5A 1F6TA 3ITHB 5J2PA 1TTHB 1PBAA 3S1TA 1HQEA 1S1UA 2BJ1A 2IRUA 2F9JA 2ZOFA 2JC1A 3I5AA 3FBBA 3OR1B 4HR2A 1NBEB 3HM9A 1S1XB 3R9LA 3ZZTA 1XMQF 2DHHA 1RT4B 2XMWA 4M5GA 3A3OB 2AW0A 3T1YJ 1L3UA 3FEYB 5FD1A 5LOQA 3ZXWA 2EK1A 2UUCF 1VOMA 1LOUA 4OX6A 4O3NA 3SI8A 1AUSL 4P71A 5C5JA 3M8ZA 3UO0A 3V6KA 3CJ0A 3SV4A 3PIPQ 1C2PA 3G71S 3TR5A 4RL1A 1WG1A 3CF5Q 2HHHF 2FGCA 1S6UA 1VIOA 2QA2A 2ZWPA 1FRLA 2AZ3A 3ILOA 1WI8A 3T9NA 1UTAA 3UE2A 5GAEU 1L3SA 1LWFA 1S6OA 4FP9A 3OSPA 4FF3A 5G4DA 4F50A 1U2FA 3CMAS 4HHHA 1R27B 5HVFA 4RX6A 1FRIA 4NMLA 2IYIA 2LFVA 3EDQB 3GILA 2GW8A 2MQMA 2MYFA 5HMXA 4ER8A 1XMQJ 1P8GA 4PUOA 3BBBA 4UY85 4IOAQ 3THPA 2KG1A 3E8OA 2EVZA 2HHWA 4NI2A 1EQ0A 2B5JB 2K06A 2CPHA 2R7RA 2YNFA 2MXYA 1CULA 4E98A 3A3NB 4OI1A 2YWEA 4L6V3 1S4EA 5CABA 3BGFA 1Q82T 2DGXA 3KHRA 1FE0A 1HHQA 2P2CB 4PQUB 4USHA 2MY7A 5H9EK 2HYIB 1WSVA 4NLDA 2R9LA 2IJNA 2DCUB 5A8RA 2DNNA 5MLCV 4CO5A 1DZ5A 1HWIA 3MMCA 2HK3A 3KHLA 4A48A 2LKZA 4O4GA 5KFBA 3LOUA 1ZZNA 4IFYB 1YITS 1RWXB 3N6MA 2W8LA 2HZVA 4IR9A 1R0AA 4KFBB 1ACMB 1X4DA 1QVGR 3GFHA 4B3TJ 2R42A 4CYUB 2VBZA 3DI6B 2AYEA 3UNGC 1R0BG 4N5SA 3I31A 3CJ4A 2E1RA 5HBMA 3DOLB 2VG5A 3KWMA 1U0HB 4J5OA 3WZ0A 4N56A 3V4IA 5DDRC 4MFBA 2HVHA 4P7TA 1R89A 3D0GE 5A8KA 5GAGI 3OVBA 2MZ1A 2ATCB 3OL6A 4OHWA 4CLYA 2VONA 1SQFA 1SH0A 1DBDA 3CCSS 5KFFA 3FQLA 2HHVA 3Q23A 1W2IA 2V8GA 4H4MB 1Q5VA 2DBBA 4M8LA 3HHKA 2ZH3A 4JI5F 3NP5A 1N0VC 2AU0A 1S49A 4DL2A 2AQ4A 1SJQA 2CQPA 2BJ8A 4OHXA 4TN2A 2H5IB 4UUWA 4YY3J 4Z2XA 1N48A 1TAQA 2UUWA 1N5SA 1TU0B 2C2NA 4HACB 3FQKA 3SMZA 3MECA 3WIUA 2HG4A 2GA7A 4NLOA 2BE9B 1EAYC 2ADBA 4I69A 1N36F 4QIVA 2VC0A 5GAHI 3MM6A 5HLFA 3SDEB 1CJVB 4XO0A 3A1YG 1JK9B 3PV8A 4QR1A 2XZDB 1M1HA 4EEYA 1S6PA 4CH7A 4NLTA 4DR5F 1M1KT 1JB0C 2AGPA 5L9NA 3SQGA 4LFCF 3WBZA 1XNRJ 1KOHA 3G2XA 3P6YC 1BQXA 3PZPA 5KG2A 4B9NA 1N54B 4M5KA 1M90T 2RNEA 4LF7J 2XSJB 2AP6A 4DG1A 4HKQA 2E5HA 1H38A 4ILLA 4O0IA 1KTQA 4OZ2A 3VZIA 1EP4B 2FHKA 2DNMA 2BANB 2OLWA 4A8WA 2F4VF 3BREA 3QYYA 1IVZA 3M8RA 3FUYA 4RNOA 1RYSA 3B4MA 3HFVA 3T6BA 4DL4A 2MB0B 1JLEA 3DDNA 1IKYA 4C3MA 1X9SA 4C3KA 1JLGA 4RNMA 1T94A 4NZ0A 4M5IA 3KKFA 5IV4A 1GTHA 4I0WA 4EBDA 4ZJLA 3TUPA 5KG3A 5AXMA 2VC1A 3PW0A 1WACA 2GNKA 3KJFB 5DJBA 3U1NA 4ECRA 4OX7A 3RR8A 2QT7A 3EDRB 3IGNA 5ETSA 3NNCA 2P9GA 5DG7A 5CYQA 2ALZA 1VQ8S 4NYPA 1RWUA 2KT3A 2WB4A 1S1TB 2QGFB 2AEMA 1NPKA 3DHXA 5BYSA 4RW6A 5ETRA 4X4TA 1TK0A 1FKAF 1M5SA 3JSMA 1UVLA 3BBFA 5EUHA 1V5VA 1PIEA 2ZVIA 3MEGB 3ONQA 1NZAA 1VLYA 2D9OA 2E5JA 2QLBB 4V1Ak 2JEJA 5FJ4A 2AZ1A 3TAMA 3NRBA 4RZRA 5HK4A 1SL2A 3BF4A 1HYSB 2V4JA 3KXDA 3L3CA 2HNZA 1S79A 3M32A 4ZCLA 1XK8A 2MKYA 2OEKA 2WW4A 3GG1A 3IM9A 3N5FA 4ITSA 2ZDPA 3OL9A 2M9KA 4WFYA 3CJ5A 2I0XA 3GFYA 1PC4A 5IT9Y 2FZKB 2DR9A 3EXCX 3JQJA 4DSKA 4A8YA 2ZUAA 3IAM9 1RBLA 5ETQA 1U1PA 2FLOA 1TZ0A 3ENVA 1EJ7L 5F9LA 2DEJA 1FJGJ 1R3NA 2KJVA 3MPUB 2UVUA 3PDNA 4EZ9A 3K89A 1BLUA 1MROB 2RIJA 2YNIA 2YWHA 1AB8A 1S7HA 2L9WA 4HLBA 4DX5A 1KD1T 2CVIA 1T9YA 3I0RB 4NCGB 4JUZA 3OVAA 2QN6B 2HBRB 4USWA 2NPFA 4B9TA 2HIQA 3HVTB 1Y0HA 1YKWA 2LEAA 2N7YA 3GPAA 3DRPA 3M32B 4ZP7A 4PKDB 2R2SA 3D7SB 2WZ1A 1X4GA 2MLYA 3WDOA 4YOEA 4EGLA 1B64A 4ZPDA 2Y0BB 3TAMB 2HMIB 4PCQA 3I55S 3BDEA 1ZM2A 3HCXA 1Z1ZA 2HFUA 4R5PA 5T14A 1MROA 2YNIB 3G8QA 2XLJA 4JI4J 4LQ3A 1REGX 2IVMA 5KFJA 2ZJRQ 1K0VA 1NKEA 5F8MA 2DD8S 1GEHA 1F60B 4OZJA 1VI7A 5JMNA 2GHVC 1HBUA 4X4RA 3GR0A 1UMJA 3LPEA 4HHJA 4I2PB 2XGQA 1RP5A 4F25A 1HI1A 2A6OA 4F8RA 4JI4F 4NCAA 2DJWA 1S1TA 4RUAA 1KP6A 2AIRB 2I38A 2QA1A 1Q78A 3CVKA 5D4NA 2CKWA 2J9CA 2WVFA 3ETMA 5I3QA 1ZOTA 2DNKA 3KG4A 2FC9A 4I68A 4LF1A 5KT3A 2FC8A 2GHWA 2ZH7A 1XNQJ 1VQYA 1X4CA 2MSTA 2MZTA 2YWGA 1RAEB 2IM3A 4HH0A 4M5LA 4P72A 1WC6A 2WONB 1S97A 3CWJA 1I6JA 1RDRA 4DV1J 1X5PA 3GJQB 1Z4UA 1HNWJ 2ILYA 1Y10A 2OMOA 3EVOA 1JLEB 4UOFA 3TO8A 4X65J 5D0HA 4B9VA 2YKNB 3S7RA 2DIUA 4RW6B 1HHSA 4Y00A 2BV3A 2HQFA 3GV5B 4DV1F 3J7A1 2ZOGA 3J81j 3TW0A 5CCLA 2AYBA 4ZCIA 1SIWB 1QSSA 4RWXA 4QW8A 4GVLA 3L95X 3DFEA 1CS4A 1H7WA 2E7WA 3OTCA 5K8PA 4DL3A 3TVYA 4CM0A 3MCMA 1HPZA 1VS3A 4EMDA 3VALA 1Q81T 1MW7A 1E6VA 2MZSA 3NBPB 1NEEA 1JLAB 5K9FA 2B8QA 4WKRA 4YP3A 1RXOB 2BVZA 1APSA 1GX6A 2W2OP 3QSYB 1LWEB 1IBKF 4XK8C 5KG0A 4I67A 4AXIA 4X66F 3PRBA 2CQ4A 2KXNB 1SKWA 4U7CA 3RRKA 1S0VA 3MECB 1NU4A 4DV0J 4KJIA 3N4WA 4MYUA 2OH2A 1MSWD 3QGIA 4ZP9A 4FYDA 4BDPA 1T9UA 2NYHA 4ZN3A 2MQNA 1OWXA 4R8UA 3K59A 1M5PC 3W2WA 2B4UA 2OD4A 2IMOA 4GKJF 4B9MA 1WOSA 4J37A 2EC0A 4LMZA 1RT6B 4NLQA 1FRMA 4LFAF 4KTQA 1FFSB 1CJVA 4IYQA 1BWVA 3S6EA 1U2CA 2RRBA 2QFIA 3IFEA 4EWTA 3CJRA 1S0OA 3F44A 3ENQA 9ATCB 1JXVA 1XQIA 2K1RB 2VA2A 1U0HA 2GV1A 5KT5A 3DOLA 2PA8D 3GYGA 2HZCA 4RW7A 1DLOA 4NLXA 2DNOA 3TQEA 4ZHRB 3KLVA 3P5BP 4KGZB 4MAKA 4A8OA 3HHLC 1AZSB 4F4YA 2R8JA 3C6TB 4USKA 2BA9A 3H7HB 4CLLA 4FPRA 3G6XA 3VAJA 2VFRA 2RRAA 3BPSP 4WP9A 3MM8B 2D3OR 4DL0C 5LT5A 4NEYA 5K8MA 3FSIA 2ZH4A 1DRZA 2KTQA 4DR5J 4WKYA 1VBZA 1J5EF 2VPXB 1RLCL 4QPTA 4DZDA 4O4GB 4F36A 1SVDA 1X31C 3OW2R 4A8SA 1MN7A 5H1SV 5BR8F 4UF4A 1FRXA 3JQMA 3GCXP 3QJLA 2ZKUA 4JI2J 2LDYA 2YKQA 4HH1A 3NNAA 2C3MA 4DUYF 5CQGA 4DSJA 1S9EB 5ITHA 5IFMA 4ELUA 1JLQA 2GVDA 4R0JA 4EK2A 4CYUA 4YHHJ 3CCMS 1VDHA 1N56A 1F9HA 3DLBA 2E1AA 5E3PA 3MMAB 3CC7S 4DU8A 3PYGA 1QSLA 3EMTA 1ULRA 2J8AA 1VHIA 1YG0A 2GMHA 3LP1B 4OLOA 1IBMJ 5LSLA 4ANDA 3MAAA 1ZM3A 3UCGA 3MMCB 1T9VA 4ZLLA 3H5UA 3GCWP 4MK7A 1RT5B 3M8QA 2Q6CA 1HNXJ 4FYVB 3QJJA 4IDKB 4J9PA 2R7TA 4I6AA 1L3TA 2DEIA 2Z57B 4PXDA 4MIBA 1TL5A 4P10A 3UQSA 3ZZOA 4B3OA 4OI2A 4Q0BB 4FF2A 2DR7A 4C8OA 4RWWA 1BUXA 2XHWA 4FDFA 2BRLA 4DCJB 1H2UX 2YNFB 4K59A 1HWKA 2XTJP 1ZAVA 5D4OA 1U4BA 2UUBF 1QDUB 2LMIA 2JLFA 3L09A 1TL4A 4QU6A 1X7VA 4C0BA 2V63A 3AJDA 4ERDA 5ETKA 4X64J 3DRRB 3EZUA 4DPUA 3H4DA 4PG8A 3BN7A 2CYYA 2NLWA 4WU3A 3M1VA 1VBKA 5T41A 3NOGA 3D4JA 2CPFA 1VISA 7AT1B 3PO5A 4OFZA 1HQEB 1S1UB 2LECA 5J2NA 1FWLA 4OX9J 3NWRA 3RUBL 3HJFA 2F65A 5CH7B 2MHNA 2MKCA 2CG4A 2IYGA 4DFMA 2Q66A 1R0CB 2QZ8A 4LFBF 3Q86A 4DLEA 1NM2A 4YY3F 2X1AA 2XMUA 2D3ZA 2IM1A 1VQ6S 2Z8QA 3PEHA 1D9DA 1FDAA 3GE9A 4IO1A 2VPYB 2HVIA 3R5BA 4IG3A 4KRWA 3CCUS 1LW2B 3C6UA 1RABB 4D3HA 4NX9A 2V5HG 1RT4A 2CG8A 1GQEA 1HFEL 2AMCB 3A12A 1FWKA 1R8HA 1ZZFA 2VF3A 4QZVB 5CZVA 1LW0B 1WC3A 3CJ3A 3LP0B 1D0EA 2D41A 2BQ3A 1F9EB 2RH3A 4GKJJ 3V5RA 1OY6A 2IVYA 2P9EA 2FIUA 2QYCA 2VKRA 2Y1JA 5GADI 4G1QA 4J9NA 1T3OA 3LALA 4KPCA 4OI3A 2NZCA 3N01A 5T7LA 2IMWP 2V34A 4MKYA 1U24A 3H25A 2HRYA 1WF1A 2FJDB 2GX8A 3Q8UA 1FXDA 2K7JA 5CD4A 1MLAA 2V2VA 4TU7A 4DX8H 2MKKA 1IKWA 1LFPA 3KLEB 3T1AA 4AQYF 2ZHOA 1NK8A 5F8JA 2J8SA 2N3OA 1KRPA 3D1HA 3EGWB 4F26A 3TUZC 1S7IA 2Z56B 5E3QA 1AYEA 3GIMA 1GMVA 1RKJA 2NXJA 4IOCQ 2GQQA 2K3IA 3DU6A 3I4HX 3VGSA 2DPJA 5LMNF 1FFWB 1NLKL 2AJ1A 4AXJA 4K4ZA 2PSZA 1NK7A 5IT9U 4D3GA 2HAIA 4RUBA 4LRFA 1G2EA 5HI7A 2C3UA 5KG4A 2KU7A 2JVOA 1C0TB 1C0UA 3FZ2A 5C25B 2R8IA 1YIJS 2MQLA 5KG7A 2JLEA 4Q2LA 5A6WA 3VVTA 3BO3A 4YDDB 5DGBA 1TK8A 2XY5A 5IWAF 1FVSA 4LSNB 1JIHA 1PCAA 2HVZA 2XI2A 1YJRA 3SQOP 3W1YC 3TI0A 1U49A 4LF6F 1LV5A 4USTA 2BM1A 1BQNB 3LWMA 1RTHA 3G9CA 4DR6F 2ASYA 3CDEA 1N6QA 4MKBA 3QFWA 2OPQA 2VDHA 2WRMA 4LSLB 1S99A 3FCVA 2W25A 1HI0P 2RQCA 2OTLS 4ZVOB 2XMKA 1N52B 4M5DB 3UDCA 1SJ4P 4DL6A 2AHOB 4FXWA 1WC4A 1M5HA 2I5JA 2QL9B 4NASA 1YLXA 4F4AA 2P9CA 2PA3A 2MQPA 3T5JA 3QT8A 1JX4A 3U1MA 2UV8A 2DGUA 2J7UA 1K1QA 4ECTA 4K0KJ 4Y2AA 3TQ1A 3KMQA 4FNHA 4PXCA 2RHSB 3OQ2A 5DETA 5J1EA 2UXDF 3A8IA 4V19X 2HQIA 2YWWA 4DWIA 2HHXA 3BB5A 3MXHP 1HWJA 3CJSA 1TV6B 5E5NA 2JSXA 1RWOB 4J9QA 4B3MJ 1QLNA 3BSOA 4ZVTB 1L3KA 1HHTP 3C66A 3MR6A 3M9NB 3THVA 1C1BB 1FD2A 5AE1A 2BXJA 2HS4A 1KQGB 1UJ5A 1U25A 2W7AA 3CDWA 2D1CA 4DDFA 3GQCA 1QTMA 1H2VZ 2IIHA 3GR1A 2C22A 1T3NA 3ISND 3JSBA 3MM9B 3PACA 2GZOA 4QWCA 3PW7A 2KFYA 3FEXB 4KGVB 2ZBRA 1CJUA 2G2OA 2H4WB 2Z2ZA 4PABA 2JC0A 3ZZZA 1T8EA 1VQ9S 2ZHAA 5B09A 2ZDOA 2ZZTA 1BY9A 1R7IA 4L3NA 3G6YA 1WEXA 1FCAA 2V6AA 2KYXA 1JQGA 1UCNA 6FDRA 3DYAB 3CCVS 1NHUA 3T1HF 2WB1D 4B3RF 3R27A 3PX6A 1KQFB 2GHPA 5GAEI 1S0MA 4ECUA 4DS4A 2WAQD 4JYAJ 4QR2A 3J7YI 5D0EA 1G6BA 2QA4G 2OPPB 5KG6A 1HNZF 3G8SA 1OSCA 5FDLA 2ZJPQ 2LQ9A 2MLXA 2CPYA 3ZZ0A 1UWBA 1SC4B 2Y8YA 1CC8A 2UXBJ 2DYAA 4CLTA 2E29A 1S76D 2AX1A 3BZQA 5CA5A 2XI3A 1FK9B 3J80U 5FLXU 5FIIA 2B3TB 3IBCB 1TMJA 3W65A 2KVQE 3IAS9 1DJ0A 4WP8A 4QBUA 1FDNA 1PILA 1NK0A 4URSA 2YH1A 3UW1A 2WBRA 4HI2A 2JWNA 2V2KA 2WVBA 5D15A 1PG5B 3ETOA 3HVWA 1CG2A 4O44A 4Q0BA 2Z2LA 3KDOA 5EX3A 3TX8A 5F8IA 4B3OB 2DK2A 3K57A 4DI6A 3PVXA 4LR9A 1WELA 1HIYA 4OZ3A 2DR8A 1NNDA 2WVCA 2RF2A 1H98A 2HW3A 4P2MA 1ZTTA 1IBKJ 3OUYB 2J9EA 2OIHA 2IBKA 3PO4A 3F56A 3LP1A 3R97A 2VUGA 4UTGA 2FD2A 3MCOA 2B9YA 1N5YB 3EYZA 2LU1A 4Y2KA 4DV0F 3IWXA 1TKDA 3R7NB 1RU2A 4DUZF 3A3PB 1Y11A 4G1IA 3CW2C 3EUNA 4FKXA 2AGOA 3I4PA 2B6AA 2V8VA 3BR9A 4KPYA 3R5GA 3P8BB 2FJXA 1HI8A 2NQPA 3GONA 3MTKA 1KS2A 1TKZA 1UEVA 3A8KA 1XNQF 2GGPA 2Y1LB 2J9DE 2UUBJ 1ELOA 2MSSA 4HDHA 2MKJA 3QPIA 4ZMMA 1IM6A 3MM8A 4EFAC 4ELTA 3UR0A 1HQUA 2O5DA 3T6JA 1GXTA 4DF4A 1UA0A 2H51B 2KDOA 1IR2A 4W90B 1DY3A 1P6TA 2BE2B 2ZC4A 1WDTA 4RW4B 3MCNA 5KFYA 3MDFA 1UPMB 1VJWA 3D9BA 3HFZB 1TFYA 1N36J 3FSYA 1RWKB 3DLHA 4F67A 3GG0A 1YK9A 2XEXA 4RW8A 4K4WA 2RJZA 2YNGA 3PRDA 2VQEF 4NA3A 2VL1A 1CBKA 1RAAB 3E2EA 2W1BA 3FBCA 3CNQP 2FVPA 4JI1J 2LU2A 3I9ZA 1LQ9A 3RJMB 1EKRA 4JI7F 2SXLA 3FRZA 2H4YB 2ZWOA 4OYXA 2V68A 4CO3A 2B0GA 3PW5A 3AT1B 1OY8A 5ETPA 3H90A 2XY6A 4IRDA 4OJHA 1LK5A 2HRTA 1K47A 2JNJA 3FMBA 4ZVRB 4EUVA 3CD0A 3FBEA 3QO9A 4RW8B 1IXKA 3ULHA 1SKRA 1WNEA 2W01A 3VF0B 1NRKA 2HK2A 3R6GB 1VQLS 1U6ZA 1N8RT 4OHYA 2MKHA 3UI3A 2CQ1A 2B43A 4CLSA 2Q1LA 4ZPTR 2ILZA 1RCXB 3DMJB 4OYIA 4O23A 2DY1A 3SCKE 3J7Z5 3QGHA 1W2BR 1FFGB 2FJBB 3MFIA 4J9MA 2R7VA 2KHDA 1JLAA 4PRFA 1Z2LA 3PCOB 1Y9OA 4IQMA 3A8EA 4L73A 3MAQA 5HP1B 4JV2A 2X3GA 4N76A 2VJVA 2E9RX 5IWAJ 1ZETA 4JI2F 3ZO7A 3JTPA 3M8SA 2PO4A 1NPPA 2F7VA 1AA1B 4Y0FA 3OTOF 1XNRF 2E7VA 4DS5A 1EIYB 1Q16B 4ANEA 2CNLB 3V2UC 2BE2A 3R3TA 1FEEA 1K8AT 2O66A 4F2SA 2KT2A 2OEMA 3CD5A 3HD1A 1QSYA 1SH3A 1FI4A 2CZ4A 2JOQA 3UPFA 3RBDA 4IG0A 2DIVA 2F4VJ 3H4BA 4K5RA 2VDIA 2IC3B 2HHTA 2XO6A 1OY9A 1KVKA 1SKUB 3DN9A 4QIEA 1Q8LA 4CO4A 1NXIA 1UEUA 3M7VA 1Y5NB 4CT8A 4LFCJ 3N6LA 4Q2MA 2QEXS 4EZ6A 1NSPA 4LF9J 2DHAA 4JP8A 3OXFA 4FNIA 1N34J 4PG4A 1RTJB 4YMEA 2IY5B 2UUAJ 4O44B 4B3MF 2M0GB 1RA6A 3E51A 2YNHB 4Y3CA 3CSKA 1RQ0A 3RTVA 2NR0A 3CJ2A 3KNGA 4TKTA 2IDLA 3AY0A 4DZ6A 2AYGA 4R5PB 4C11B 5B0CA 3CCJS 5KFSA 4DFKA 1S6QB 1D3WA 5JUMA 1T11A 2YKMB 3CJKA 3CO9A 4ED5A 3DRPB 3NCPA 1MNEA 2IBOA 2DXEA 2YKPA 3B54A 2BOAA 3JYTB 2J0QD 3C14A 4NLRA 2UU9F 2OPRB 1RTDA 3NL0A 1QUVA 3AOBA 2MLZA 2I6WA 4ILRA 2DH7A 4DMZA 1C4AA 5HMZA 2AV5A 2M8HA 1UWAA 1N5TA 1OO0B 1TP7A 2BKPA 3ICLA 4Z7CA 2UU9J 4LFBJ 5F8NA 2QLJB 2HVEA 3V6JA 4PWDA 3CE8A 3CCRS 2JEGA 2RDJA 4ZPWR 4MKVA 1T7PA 1D9FA 2V69A 2YWFA 3GV7B 1NJXA 1FJGF 3MR3A 3F73A 3BSAA 3KK2A 5KFMA 4B9LA 2W4PA 2OFGX 1Q7LB 1U2RA 1XERA 2C2DA 5D78A 3BGUA 2KJWA 2DO0A 5EN1A 2FPHX 4ICLA 2IA6A 4HT5A 2HZAA 2YPZA 1F5AA 4Y6IA 1HBOA 1SJ1A 3W5YA 2EFVA 3MEGA 4F7VA 2YX1A 2WTFA 4DV4F 3IG1B 4DHVA 2VPZB 1FDDA 5KFXA 3AOAA 4BC7A 4DR1J 3V81B 3IO1A 4BWMA 1KSPA 3CCES 3OV7A 3M2UB 1LNQA 1B0PA 2W9CB 3IA0A 4WE1B 4NXNJ 3Q24A 1FD8A 2RT3A 2CADA 3I0SB 3O6QA 2Z2YB 5HSPA 4DR6J 4B08A 4AE5A 3VV2B 2Z4PA 1VQ7S 3D6FB 3CC4S 1KOOA 2BW2A 1MMDA 2DGOA 3FRYA 4X4QA 2IJRA 3D6TB 4JV0A 4J9RA 4NXNF 4YR2A 4KHPJ 1VGYA 2HS0A 5GMEA 3ZTQA 2DNYA 2AEFA 2X3DA 1NSQA 4DUTA 2W2MP 3ZZYA 1LKZA 3P49B 3L7UA 3MCSA 2XYPB 2C3OA 5B08A 4ZVSB 4A8KA 1RYRA 2OPQB 5KFLA 1S72S 1X8DA 3R5DA 8AT1B 2LQ5A 1RKIA 3NWGA 2YTCA 2Z58B 5CZXA 1VQSA 1YRXA 2Y1RI 1EP4A 1REVB 2HBYB 4FYYB 4I4BA 5J1EB 5A6PA 1HNWF 3OLAA 4XTTA 4P74A 1P9QC 3MEDA 4U96A 5D0GA 2V94A 2CJYB 2Z0GA 2ZOMA 4U9RA 3HMJG 2ROEA 4XAKA 2RMLA 5B0DA 1VFJA 2I5JB 3N5BA 3ZNJ1 4Z37A 4G65A 2G4BA 1WHWA 1O6XA 4J9OA 5C24B 3M4XA 2Y3YA 1RBAA 2GAGC 4QWAA 1NKBA 1QVFR 2DVIA 3ZZPA 2JLGA 4WU2A 4WZQA 4KH1B 3MM6B 3C16B 2LQBA 2IPOB 3IC1A 5HANA 3UN2A 4RUHA 3ZNUA 1BQNA 4ZIWA 1JLFB 1W26A 4GC7A 3IWNC 1RK8A 3LTOA 2DNZA 4TY9A 5EWGA 3VGTA 4HACA 3EWGA 2J0WA 2DHGA 3TZZA 4C4WA 3B8HA 3QT6A 3GWCA 4H54A 1FF2A 3IR6B 2OEJA 1K9MT 2OO4A 2L41A 4K4XA 4IO9Q 1TL1A 2DITA 1LEOA 2EKNA 1SQGA 4BLGA 2DPIA 3HJVA 3BEGB 1J5OB 1PAUB 3PFEA 1RISA 3GJRB 3Q8PB 5GVQA 4DV6J 2E9TA 2HQ3A 2V50A 3Q83A 3NG8A 3RAXA 2OELA 2QC3A 5C2GA 3HX9A 4DQPA 1KKHA 3BM7A 3TX0A 4WIIA 2XG8A 1NK4A 1GAOA 4P2SA 1VQOS 5KFKA 2AKWB 3LP2B 4EBCA 4YFUA 3W2VB 3H2VE 4DQQA 1X9WA 1VQKS 3HD2A 2V4RA 3ILJA 1B7YB 4LIWA 1WF2A 2DH9A 3IN5A 5GMDA 1IBLJ 2K7KA 1G1XA 5ETVA 4ECXA 4P75A 4GO7X 3BO4A 1UKUA 1RHUB 3PEJA 4LIRA 1Q95G 4LVNP 4N41A 1D09B 2HS3A 1TL7B 3M30B 4KYZA 1RCOB 1XMBA 4NZ7A 3W5ZA 3CCLS 1LW0A 3LP0A 2CJ9A 1B0VA 3DXBA 1T05A 1OQ6A 3M1VB 1M5KC 1IM4A 2HHHJ 2DGSA 3Q8RB 3DOKB 4ZS6A 1AROP 1WC5A 2V8DA 4DUZJ 2UXCF 2J5AA 4FBUA 2ZBQA 4N7TA 3QRRA 4C8ZA 3D2WA 4K4VA 1KHVA 4NI2B 5KFEA 1ZH5A 2L9DA 2JL9A 5KFNA 5J1NA 1YBAA 5KFTA 1VK3A 2HURA 1Q86T 3DOKA 1TL3B 5JVHQ 4KB7A 2XMVA 4LF8J 4Y65A 1U1QA 3I5CA 2CQ2A 2EW9A 2FVCA 3MPVA 4ZOSA 3AQPA 5THWA 6FD1A 1P1TA 2IJFA 2CPXA 2C2OB 2CJXB 1LWFB 1RWPB 2ZITA 3AD7C 3LUYA 5J2NB 3UD3P 1RAGB 1JLBA 4LF5F 3MZIA 4NLYA 4B9SA 1YVFA 2UUAF 4U7UK 4ZVHA 2HQDA 1HA1A 2EEYA 3VVUA 2RDDA 3DRRA 2WW8A 3TYTA 3MAAB 5HAOA 4HT7A 1CJTA 2DO4A 1U48A 4U95A 1MWZA 3ZZRA 5KOXA 2EG2A 1FNXH 3VGVA 3DU5A 1VRUA 4DCPB 2PFFB 1U8WA 4QJVA 1YJ9S 3FCHA 4EYIB 4DPYA 2W2PP 2HEKA 1JLQB 2DTJA 2F4FA 3LA0A 1RWNB 1DAXA 2G0JA 3OFGA 2GJIA 1S9EA 4KBIA 5C7PA 1OJ4A 4ED3A 1T05B 3I6PA 5DM6Q 2V67A 2QLFB 3IRXA 3NS7B 2L3MA 4P2XA 5KFVA 1V6HA 2QRRA 1NSAA 3MMBB 3QAEA 1YBTA 4IFVB 1U1MA 1NDKA 3TJ8A 1VBYA 3Q2TC 1O0PA 2KG0A 3QT7A 2PI5A 2GVZB 2D74B 1FEHA 5DRKA 2JFKA 2QL5B 1TL1B 1KLMA 1X60A 4OX9F 5A76A 5IQQA 5KT6A 2PD1A 4X84A 4EYHB 3C6TA 3TAPA 2B4OA 4HEA9 1AZSA 1WEYA 4DR2J 1HQ2A 4NWBA 1OYDA 1IKVA 1NDPA 3HZGA 3TOQA 4UOGA 4ZHRA 4ZJQA 3NGDA 3NCQA 2IRXA 2ZBCA 1JLFA 3DDIA 3P3DA 3Q0AA 4DSIA 3MFHA 2H5JB 2CJKA 1RADB 4YEAA 2MJUA 2KRBA 5CYMB 3VQTA 4H4KA 3MOJB 1RU1A 5A0YB 1DQ9A 1JKHA 3NGSA 3KG0A 4YR0A 1RAIB 2VASA 3MI7X 3OPKA 2CIMA 4PG7A 4DL5A 1NJZA 2NUUG 1B7FA 1U26A 4ZN1A 3OTOJ 3BQ1A 4DV7J 1KVIA 2DNPA 1UETA 3N79A 2R8GA 1H72C 2AX0A 1F5BA 2CQHA 2V9KA 4J7CA 3BV8A 2ALYB 4X4VA 4CZCA 4WYLA 2HFNA 3E01B 5DZ7A 1GNKA 4HI1A 4WFAQ 3MWBA 3OTBA 3W8GA 2HBZB 2K1RA 2KXHA 3TEHB 1HKAA 2FJAB 3MUMP 4WK1A 1RSCA 3OR2A 4YHHF 3NAIA 3K5PA 4K2JA 4MYTA 1GK8A 2KL8A 2WSFC 4MH8A 3BN4A 3HKZD 4GVBB 3UD5A 2FJWA 3DLEA 2ZM6F 2W7OA 2HRUA 4DLGA 1SXLA 1LK7A 2DNRA 3M8PA 4RO0A 3W2WB 2VPWB 3QZ7A 3KOAA 1YSJA 4R8UB 2DXFA 4RR5A 3LGMA 3H5SA 1RJJA 1RWVB 3GIKA 1VC6A 2DRBA 2O01C 4HTJA 1REVA 4WPAA 3OL7A 3KNAA 1U1NA 2CZVC 3DLGA 1F0XA 4LR8A 5DDPC 4Q43A 2YKNA 3NOCA 4ZPAA 4C8KA 4O3SA 1F5CA 1WOPA 3KK1A 1CJKA 3DLJA 3V81A 2BM0A 3BSCA 1PYSB 4F4WA 2M4MA 4ECWA 1NB7A 2MY8A 3BGLA 1S4FA 1KC8T 1LFWA 2WONA 2LYVA 3CIMA 2VZ9A 4DU7A 2GQ2A 1HPZB 2VJUA 2E5LJ 2LEPA 3L7OA 5H9FJ 4KQZA 1JMTA 2YH0A 3CCWA 4TLQA 4EO8A 4WWSA 4M5JA 2JFDA 1S9GB 1X4BA 1TK5A 3PR5B 4JI3F 2MZJA 2CAJA 4TU9A 2N82B 2DB1A 4DQIA 3CULA 4OZ1A 1Y4ZB 3SYZA 4JI0F 3BDPA 4LF9F 2LXIA 3M2UA 2DXDA 5KFRA 1HNIA 1M5OC 3OXLA 2CZ9A 2MJNA 4Y34A 2H5EA 2ADCA 2FQQB 3TVKA 1QAYA 1EB0A 2WHOA 3HSDA 4NA2A 3RGIA 1IWGA 3SFUA 3ZTSA 3IR5B 3T3FA 2B56A 2MHEA 1PJ5A 2OPRA 2P8IA 4LRAA 3S01A 3PKYA 3TARA 3KLIB 4ZPCA 3O8WA 3DGPA 3NS5A 2VA3A 2HIYA 4DN0A 3OXGA 4QPXA 5KT2A 1YI2S 1QD1A 2HFSA 3H8YA 2AWZA 3MTJA 3PJWA 3WIVA 3H2UB 3I56S 5D8HB 4LF2A 2XQCA 2ZD1A 3L9ZA 3ZFVA 1DTQB 3M6WA 1GMWD 1KWMA 1RAHB 4CLKA 5AXNA 2MEWA 5I3PA 5I42B 3HXMA 4EBEA 2CPJA 3H98A 2E1CA 1Q79A 1ICEB 2GO8A 1AUDA 2HHQA 1FX4A 3D0HE 5D3GA 3P5TL 4LBPA 1LXNA 2FHMA 4OI6A 4A46A 2VFVA 1PJ6A 1T9XA 2NCKL 2X51A 1I3OB 2L48A 2XYHB 4BS2A 1GH8A 1KTVA 1ZPVA 2HQCA 4DPXA 1SI9A 3NGTA 3LO3A 2AJ4A 3DGPB 4NPOA 4HYKA 3BR8A 1S6QA 1R8AA 3VAFA 3C2PA 1ZS6A 3B82A 1WKJA 2GFFA 3B4DA 2B9WA 5LM7E 2EBEA 3LAKA 4IG0B 1K0TA 2J76E 1M5VC 2B7CB 2KZMA 1X0PA 4CM2A 4DR4F 3T1HJ 2NYIA 2R4FA 3KUEA 2YQ3A 3HKWA 2MKIA 2W4DA 3R2DJ 1YZ7A 3FSXA 4I2QB 4B02A 4Z7YA 3DRSA 2V4JB 3V4MA 1DTTA 3DDKA 4DR4J 1QAXA 1IUJA 2F8MA 2E5IA 4LUBA 3VZHA 3I9V9 4F3MA 4I7FB 3KHGA 1ZYQA 1JLGB 1A6LA 1TQLA 5M2UA 4F3OA 2F5GA 3EPGA 3KK1B 4N8OA 3QGGA 4ZVGA 3QRQA 2BANA 4YB6A 1U1KA 4I56A 3KYLA 4LF5J 1F3VA 1R43A 3AQOA 4NYOA 2X7IA 2OI2A 3T19A 3W62A 3W9HA 2N7CA 3BQ2A 4Q8FA 4JV5F 1NDCA 4G1PA 4LFAJ 3RYLA 4ZVFA 4O3OA 3UDLA 4ZKAA 2E9ZA 1PAEX 3U02A 2ZNZA 1XEZA 1EHWA 4BWJA 3BSNA
chains in the Genus database with same CATH topology
4OJ3A 2DNQA 2NSBA 3FJ2A 2XCPA 3CD6S 4X4OA 1K73T 4PWUA 3MEEA 4UY8T 1TKTB 3K5LA 1N33F 2YNGB 2DNHA 2OSQA 2XS2A 4Y28C 2CJQA 1T02A 4F4XA 2K3KA 1FNMA 3E01A 2MZQA 4IH6A 1EETB 4RW4A 3BGRB 2HLTA 2LEBA 3QIPA 2CVEA 3HDSA 5A8KB 4DV3F 1H2TZ 3GSDA 4A8MP 5F0WA 4ZLPA 4ZCKA 4H4MA 2DGTA 3POTB 1BQMB 2C3YA 4P7VA 4DV5F 5A8WB 1JKHB 2EFQA 1BGXT 2CQ3A 2F9DA 4PPDA 5A0YA 2XMJA 2ZUGA 3FVYA 2G13A 4QWBA 2ZH2A 1C4CA 2LA4A 1S48A 3D1QA 1O8BA 2A2CA 2HNYB 1GX5A 4LJMA 3UCZP 1FESA 3I87A 3DI6A 4GC6A 2ATLA 2A1BA 2KH9A 5ADZA 5HQ8A 4NA1A 3KLHB 1FJEB 5J1PA 1HD0A 5KFIA 1OSDA 2HLUA 3HHNB 3QWPA 1CQNA 1SUQA 1CEZA 2IAJB 5EHHA 1KONA 5L38A 2BJDA 4DV7F 1TKZB 2HNDA 2X1GA 4QR0A 2FB0A 4OJ1A 2PIIA 2CJAA 2VOPA 2B6AB 3IRXB 4C2MA 2DGQA 4CI0B 1X5TA 3G8TA 2IFXA 1YHQS 5K8OA 2K8GA 2EFNA 4RUCA 3OFEA 4ID5A 4KFBA 1VRUB 3MPYA 2O3DA 1R0AB 2B5JA 1V3SA 2XBPA 5L39A 1FTRA 1WD6A 4IFYA 2XWYA 2HWIA 3LAMA 5D6GA 3VAHA 1IBLF 2G1DA 3SCIE 4QW9A 5HL7Q 3CUNA 2N3LA 2HPUA 2PI4A 3Q2SC 1TKXB 1TVRA 3G4SS 3R1HA 2ROPA 2GQCA 4A8FA 4RLEA 1YJTA 3MD1A 2OPPA 5L9XA 1X4FA 2HHUA 4NXMF 1HMVA 4V19J 4O3QA 2MQQA 3RB0A 3X3UA 4ETZA 1NJYA 1P27B 4AYBD 5M2PA 3DYAA 3BO2A 2FUG9 5IXUA 1CC7A 3WX4A 2LXFA 2AJQA 1AFIA 4G6VB 3J7ZT 4AL7A 1D9AA 2DGVA 2W24A 5CXTA 3V6DB 1VQ5S 2ZH1A 1UVLA 1G2EA 1S1XA 3CDBA 3MD3A 2XS7A 1UWBB 5CCMA 3H59A 2EFOA 5DO2A 3DRYA 4X2BA 5KOWA 3ITHA 5J2PB 1O51A 2HGMA 4ECQA 2ERRA 4TNOA 4OMFG 4C98A 4F02A 3M6VA 3DLKA 5KFAA 3KK3B 2B4VA 2M3DA 3M2VA 3OHBA 4ES3A 4DF8A 3M2RB 2CPIA 1HBNA 3LP2A 2APOA 1NH8A 3DOMA 4PPZA 3M9MB 2UVRA 3RB3A 2GIQA 3M6UA 2OFHX 5B0FA 1FKOA 4XIUA 3GYXB 4L72B 4DSFA 2HGNA 1HNVB 4ZK7M 5B0GA 1J5OA 4F4ZA 4M95A 4XPCA 1RTIB 3NKYA 3RB6A 1N32F 2ZH6A 3SV3A 2F1FA 2GIRA 3CTRA 2F3JA 3NNHA 2A2DA 2PC6A 4C97A 4WK3A 2RUGA 3HPOA 1NK9A 2B9XA 4YUDA 1GXUA 1UVKA 4TQRA 3HLUA 4ZP6A 3TA0A 1Q53A 3D1OA 3DCAA 3KG1A 4LSLA 2W7PA 1GT8A 5I3UA 3I5BA 3IXQA 1RTHB 1KFDA 1SL1A 1YJUA 1DARA 2PMHA 3B78A 2CPDA 5EDWA 4RNNA 2HFZA 3MR2A 2XS5A 4RU9A 2CQIA 2U1AA 3PFOA 2YKOA 1CPZA 1IJEB 3J80Y 1NO8A 1C0TA 2CRLA 2M2BA 3MR5A 3AA8A 2GJ2A 4OHVA 3VR1A 2JJ4D 5HMYA 3PR4A 2J6UA 2OD6A 1SJ3P 4JI6F 4ED8A 3H5XA 1OPIA 3H20A 4G1QB 1G7CB 1HNVA 2XNQA 1UA1A 3PW4A 2OMLA 3LGNA 5DDQC 4WFZA 5KFDA 2EWHA 3UD4P 1WHYA 3HHLB 1HL6A 2NREA 1WG5A 4WJBA 3U7JA 3DRXA 4FXVA 4WE1A 3US5A 3WC0A 1XC9A 3IRWP 4R25A 3N0VA 4QIWD 4W92B 4C3LA 3N9UC 2ZH8A 1XR6A 2VKZG 2P6SA 2FY1A 3MGJA 1IQTA 3K5MA 1FKOB 1ZM9A 1FT8A 3EXYA 2WSCC 3CDUA 4DQRA 3TANA 4ICLB 4CNYA 4K50A 4OZNA 3H40A 1WTBA 1U47A 3AB4B 2K2PA 1RGVA 3M2RA 2WBMA 4ED1A 2DNGA 1ZAWA 4QWEA 2XY7A 3V6DA 2NSCA 4OIXA 2W9BB 3X1LB 4JYAF 2LXUA 4MIWA 3VAMA 1IBMF 4DSEA 2IM0A 4A47A 2EKYA 2XB2D 2ZNYA 2OJ3A 1NK5A 5B0BA 2UXBF 2JHEA 3CGIA 1HBMA 1VRTB 5J2QA 4CCHA 1SH2A 4ALZA 4TQSA 1HMVB 3PX0A 3THTA 3JB9k 1D8YA 1PSDA 4IDKA 3M8QB 3MM7A 4ECVA 1X5SA 2OAUA 4MK8A 3UCUP 3HT3A 3CJKB 2XGPA 1PO6A 1KN6A 3OFFA 4GMKA 3MMAA 3K7RA 5DDOC 1NJWA 2J0XA 3KLFA 2YNHA 4CO0A 4A4JA 1XN9A 5E0OA 1LWCB 2LLZA 1RT3B 2MMYA 5LXYA 1N5QA 1SV5A 3FGVA 1Y5LB 2RU9A 4XDCA 4XDDA 2M70A 4CH0S 1NHVA 1JLCA 2E5GA 2VG7A 2WOMA 2DCLA 1TKXA 1TVRB 1HD1A 2HNDB 4J9SA 4RU2A 3OTEA 2C2RA 5K8NA 1UVIA 3PY8A 4KC5A 3HI9A 4MJKA 4RW9B 4QYRA 5C42B 2BQUA 1G3OA 4ID5B 2AGQA 3KLHA 3CCQS 4UOCA 1SL0A 1X0FA 2GMLA 1NJIT 2MKSA 4MKAA 5EWFA 2ROGA 4M63A 1DLOB 3OHAA 1R8CA 2IMWP 3LW5C 5D4LA 3U27A 4ZVEA 2VFTA 2MZRA 4YQWA 4ZPVR 1FXRA 2XO7A 2EFPA 4JV1A 1HARA 2ZVSA 2ASLA 4FF1A 3ZC4A 3O2IA 1VQNS 2IAJA 1RT6A 4IQXA 4TLRA 4DV2F 1RAJA 3QWUA 4BBYA 5LMUF 4TYAA 4RBVA 2FVQA 1C1CA 2KB2A 1WHXA 1YGYA 3BGRA 4U67Q 3K0JA 3RU0A 2RDIA 3HF5A 4OQJA 4B3SF 5AE2A 5E7OB 3C3LA 4QYZJ 2X1FA 2A18A 2N4CA 4UQTA 2BQRA 4B9UA 3VQSA 4KO0A 3TVZA 3RW6A 3OL8A 4GO5X 1A9NB 1BQMA 2EFGA 3G86A 1E6VB 2QLXA 3EGZA 3CB4A 3HFKA 2BJEA 2W4CA 1DHMA 3QIPB 3CT9A 4NLUA 5IM0A 4K2XA 4ECZA 2LVWA 4IRCA 2Q6BA 3ISNC 3LPYA 2CPEA 3AHPA 4K5SA 4OI4A 1S10A 2RQMA 3CC2S 1TKTA 1U09A 2I8EA 4QIFA 1YRUA 1UFLA 1MWYA 3GB0A 3HHDA 3NBPA 4KV8A 4KE5A 4OJGA 5E3AA 3ZZUA 4O3PA 1KNZA 2YX4A 5KFZA 1YQHA 3GIIA 1FTCA 4I1TA 1KQKA 1V9OA 1X4AA 5IZHA 2M88A 3D5MA 2W8KA 2C2EA 2JX2A 2BABA 3PKMA 1Q8IA 1Q7YT 5BJRA 3UFCX 3SFGA 1HBUB 1BC6A 2OKQA 4E8UA 3SCJE 1JWWA 1N5YA 4WFBQ 3OUYA 4RKUC 1DTTB 2R2UA 1IR0A 3OJSA 3K8VA 4QIGA 4YR3A 4DSLA 1CLFA 1IQZA 1UP1A 2RF2B 2CFXA 3HVTA 4KHRA 4NRUA 1TUVA 2J6SA 2JDJA 2V8HA 3BS9A 3ISZA 3O3LA 4JI8F 4AFFA 5I42A 1LXJA 3QJPA 3MMJA 5KTQA 4IRKA 2BYCA 1HW9A 3M6XA 2HMIA 2P5VA 1QE1B 2QSWA 3HHLD 4Q7AA 4ZPBA 2FTRA 5G0RA 4MK9A 2VB6A 1TAUA 3PNIA 5G0RB 5DS7A 4F2RA 5B0EA 2FVRA 5D3GB 3DM2B 4CQ1A 2ACYA 3PW2A 4F4KA 3CDAA 1U6FA 2JEIA 5L1KA 2CQGA 4X4SA 4TY8A 2B4PA 1KQSR 2FHJA 2ZD1B 1MMNA 2JVRA 2IRYA 2VFSA 4NLVA 5K14B 4CTAA 1VIXA 3FFIB 3RZAA 4FXDA 1WEZA 1RT7B 2EBGA 3PJXA