3IRWP

Structure of a c-di-gmp riboswitch from v. cholerae
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
90
structure length
90
Chain Sequence
RPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein/rna
molecule keywords U1 small nuclear ribonucleoprotein A
publication title Structural basis of ligand binding by a c-di-GMP riboswitch.
pubmed doi rcsb
source organism Homo sapiens
total genus 22
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2009-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3irwP00
4W92B 4M5DB 1U1OA 3CC2S 2BOPA 2X1AA 2CQ1A 3CC4S 4P6QA 3CF5Q 4WF9Q 2DNZA 2CQ4A 1U6FA 2EVZA 1AUDA 3TO8A 3MOJB 2LECA 2XS7A 1WELA 1DRZA 5GADU 2GO9A 1WHXA 2MGZB 4UQTA 1CVJA 1K8AT 4YUDA 1JMTA 1YTYA 3I56S 3PIOQ 1U1MA 3CCSS 4QU6A 1X5PA 2L41A 2YWKA 1KC8T 2F9JA 5HL7Q 3G96A 1X4AA 1FJEB 3V4MA 2MZQA 1PGZA 2E5IA 2LEAA 3EGNA 2Q79A 5LXRA 1FXLA 2N3LA 3NNCA 2DH7A 4LIRA 4ZKAA 2MQOA 2U2FA 2OSQA 2U1AA 1FJ7A 1VQ9S 4YOEA 4V19X 2CQGA 1HL6A 2CPDA 1U1LA 4ERDA 1KQSR 1JJHA 2DNMA 2D9PA 3U1MA 5IM0B 3CCES 1DHMA 4IO9Q 1YJ9S 1M5OC 2F9DA 2MGZA 3SDEA 2MZTA 1UFWA 1WG1A 1VQKS 3IRWP 1H2UX 2KVIA 4A8XA 1RK8A 4J5OA 1SJ4P 3ULHA 4CIOA 3VAJA 2K8GA 1N54B 2SXLA 2L9WA 5GVQA 1WEYA 1F9FA 2N7CA 2FY1A 2RVJA 2LMIA 2X1FA 2DNRA 1HD1A 1Q81T 2EK6A 2HGNA 3MI7X 3CUNA 3VALA 2OTJS 2MQLA 2DGQA 1OPIA 1DZ5A 1N52B 3THTA 2M7SA 5LJ5Y 3THPA 3MD3A 1WEXA 2E5JA 1VQMS 3MUVP 1ZZNA 1WI6A 2DNPA 1U2FA 4WFAQ 2RS2A 2RRAA 1VBXA 1VBYA 2MZ1A 1NJIT 2KG0A 1OO0B 2DITA 3CD6S 5DETA 1D9AA 2KU7A 3MD1A 3H2UB 2M2BA 3P5TL 3P6YC 2MSTA 3LPYA 5GAHU 2LEBA 2MPUA 2MQQA 2AYMA 1G2EA 4FXWA 2CQ3A 2HGLA 1X4BA 3BO2A 4LJMA 2KHCA 3CTRA 5DDQC 2AYEA 4OZ0A 1URNA 2LXIA 2CQHA 2K3KA 5H1SV 4WFBQ 1YJNS 2ZJQQ 2DNGA 2CJKA 3MXHP 2XS2A 2MJNA 5LSOA 4QQBA 2ADCA 4CH1A 1VQOS 3ZZZA 2CQCA 1H2TZ 1WHWA 2KG1A 1VQ6S 2DNHA 2OTLS 3CCUS 2AYGA 1FNXH 3D2WA 1VC5A 2I2YA 1B7FA 2E5GA 2PEHA 2MY7A 2MZJA 4F26A 3NNHA 3MDFA 4W90B 1WHYA 1FO1A 2KRBA 2PE8A 3VF0B 1RKJA 1R8HA 1U1QA 3NMRA 3UCZP 1SJFA 1SXLA 1S72S 2MKJA 1QM9A 3R1HA 2VOPA 2LYVA 2CQIA 2ADBA 1BY9A 2JRSA 1YJWS 1X4FA 1DBDA 1P1TA 2DH8A 3IWNC 5IFMA 2M88A 1PO6A 3P49B 1VQ5S 1VQ4S 3CCVS 5LJ3Y 4IOCQ 2CPHA 1WF2A 1JJ2R 2BZ2A 2RS8A 5D77A 2DISA 2AD9A 3G8TA 3UD3P 3CMES 1Q86T 1X5SA 2MZSA 5JVHQ 1VQ7S 2LKZA 2DK2A 3HI9A 1X4DA 2MKCA 2CPJA 1WTBA 2MKHA 3EGZA 1KOOA 3LQVA 2DNKA 1YI2S 2O3DA 2MKIA 2N82B 2X1GA 1VQPS 3CXCR 2E44A 4C7QA 2F3JA 2VONA 3BEGB 2M9KA 1Q7YT 5DM6Q 3TP2A 2DGTA 1KOHA 2QEXS 1D8ZA 2OSRA 1X4CA 2MXYA 2MKKA 3CCLS 4Z2XA 1S79A 2RUGA 2L08A 4PKDB 2D3OR 2M70A 1JJ4A 1OIAA 2DGOA 5IM0A 4TU9A 2ERRA 3FEYB 3R27A 1U1KA 4PRFA 2M0GB 2DO4A 2DNQA 2AYBA 2DNLA 2KM8C 1M5KC 3Q2TC 4FXVA 2KXHA 3B4DA 5DDPC 3NNAA 2GHPA 3OW2R 3CULA 1UAWA 2KI2A 3S6EA 2ZJPQ 1ZH5A 5BJRA 2RQCA 2B0GA 1K73T 2CPIA 1U6BA 2HVZA 2DHAA 2KM8B 5GAGU 2XS5A 2JVOA 2MQNA 3UD4P 2FPHX 2DH9A 1L3KA 2MQPA 3UE2A 5D78A 2UP1A 2RT3A 1QVFR 3U1LA 4OZ1A 4C0OC 2CQ0A 2RQ4A 1SJ3P 3S8SA 1VQNS 1HA1A 5CXTA 1NO8A 4RU2A 1UW4A 1YWXA 1H2VZ 2FC9A 3UWTA 3SXLA 3BO3A 3MUMP 3VAKA 3I55S 3EX7B 1HD0A 2YTCA 1N88A 2DGSA 5DDOC 2LXUA 5MLCV 5LSLA 4WFNQ 2N3OA 2DGVA 2J8AA 4WIIA 3BO4A 3CC7S 3TYTA 4Y0FA 2HZCA 2VODA 2MY8A 2KYXA 3UCGA 5ITHA 1WG5A 2XNQA 4Y00A 3N9UC 2QFJA 3MUTP 2DNNA 1VBZA 2MB0B 1WHVA 4BS2A 5IQQA 2DNYA 3K0JA 4F02A 2NZ4A 2CQPA 3G4SS 3CPWR 1M5PC 1P27B 1U1PA 2EK1A 3G6ES 2M52A 2CPFA 2NLWA 2KFYA 5LXYA 2MHNA 2JWNA 1SJQA 2VOOA 1YHQS 3L3CA 3VAGA 3HHNB 3BS9A 4TU8A 1U1RA 2ZJRQ 4QU7A 2MJUA 1YITS 2DHSA 3SDEB 1K9MT 4CQ1A 2DGXA 1NU4A 5JVGQ 2G4BA 3H2VE 3VAFA 3PIPQ 1VC0A 2J76E 1YIJS 1U1NA 5CYJA 2CPEA 5CA5A 1WWHA 4IOAQ 2KXNB 2WBRA 2RRBA 2RU3A 3Q2SC 3VAMA 4YB1P 1Q82T 4CH0S 4U67Q 3VAIA 5FJ4A 2MSSA 1UP1A 3VAHA 2CQ2A 2MMYA 5DDRC 3NS6A 1WF0A 1M90T 3US5A 2DO0A 3B4MA 2V94A 2LCWA 4UY8T 2XSFA 3G71S 2DNOA 1VQLS 1FJCA 2KH9A 4TU7A 2M4MA 2DHXA 3SMZA 4QPTA 2J0QD 2CPXA 2CPZA 2MZRA 2J0SD 2KRRA 2MKSA 2CQBA 2DGWA 2DB1A 3G8SA 4PR6A 2LA4A 2X1BA 2JVRA 4ED5A 2OIHA 2KN4A 2G1DA 1OWXA 3CCJS 2LA6A 2HGMA 3JB9k 1X5OA 2MYFA 3ZZYA 2DHGA 2FHOB 1SJRA 1FT8A 1X0FA 2D9OA 5EN1A 2YH0A 1WI8A 5DM7Q 1M1KT 3J7ZT 3DLLQ 4IUFA 3CMAS 2JX2A 4LMZA 2M8HA 2OJ3A 3R1LA 3J7YU 1A7GE 1ZZFA 5HO4A 3CCQS 4C4WA 1FHTA 1WF1A 2XNRA 1IQTA 2CQDA 5GAEU 2QA4S 4TLQA 3P3DA 3MURP 2LQ5A 2YKAA 2M8DB 3CCMS 2G0CA 1VQ8S 1WG4A 3UCUP 2XB2D 1VC6A 4EGLA 1QVGR 2CPYA 3S01A 3DXBA 3G9CA 1X4HA 1O0PA 1W2BR 2HYIB 2DIUA 2YH1A 4F25A 1X5TA 3FEXB 2E5HA 4WKRA 1WEZA 2DIVA 1A9NB 1X4EA 2FC8A 2RNEA 1M5VC 1H6KX 2KXFA 1N8RT 2DGUA 3CCRS 1KD1T 3NS5A 2KT5A 2A3JA 3S7RA 3RW7A 1R8PA 3RW6A 1X4GA 1XN9A 4WCEQ 2I38A 5GMKa 2MQMA
chains in the Genus database with same CATH superfamily
3K5LA 5DZ6A 4Y6IA 2OGUA 1HWJA 4WF9Q 3CJ0A 1PYOB 4ZS6A 2KYZA 2M5YA 5BYSA 2F65A 1YRTA 4LSNB 3HKWA 3R2CJ 4UQTA 2QL9B 1LWEB 3KLFA 1XIQA 2OPRA 1X4AA 5F3TA 1U09A 2AV5A 4DR2J 1WC6A 3M8QA 3OSNA 3OV7A 4B02A 3HFKA 1VQ9S 1RT7B 1FFSB 1S12A 3KLGB 3SZ2A 3CCES 1M5OC 1O6XA 5LL6d 1Q5VA 4B3TF 3M9MB 1HARA 1MROA 1TKZB 1TKDA 5HATA 1S1TA 4OZNA 2F4VJ 2LP4A 4ITSA 4QIFA 2JHEA 1P6TA 3GJSB 4DV0J 3GZ7A 1RTHA 1HWLA 3KMQA 4HHUA 4K2XA 2M7SA 3ZO7A 2QMWA 3PW7A 1WTFA 2RS2A 3UVJA 5DLFA 1RTIB 2OD4A 1F0XA 2C3UA 2AGOA 1MWZA 3QIPB 3GILA 4LF9F 3EVMA 2MPUA 4LJMA 4HHJA 1URNA 5H1SV 3OFHA 4USWA 1NKCA 3W2VA 4EBDA 3MXHP 5AT1B 5E3QA 2HIQA 4PG8A 3T9NA 1QAYA 1CS4B 3GYGA 2FD2A 4C8KA 2QJ3A 2Y0SD 1FO1A 1U45A 2PE8A 3VF0B 1PJ6A 5HK4A 3HVRA 3HKZD 1SVDA 5KFRA 1MN7A 3WC0A 3I4HX 2OH2A 2JRSA 1TL5A 2XMWA 1N5YB 1T9TA 3HD2A 2KZMA 1HI1A 4NCGB 1KNZA 2UVVA 3HHKA 4KTQA 5C42A 2P6SA 3A3PB 1UVMA 2N82B 4HI1A 3MMJA 3D0IE 3DOMB 1PILA 4OI2A 5E33A 4RW4A 2QEXS 4DX8H 2RUGA 2C3MA 3HSDA 4NCBA 2G0JA 5IM0A 1RT1A 4TQRA 3MM6B 2ATCB 2DNLA 3B4DA 4TKTA 1E6VB 1Q79A 1GQEA 1KWMA 2KI2A 5BXIA 2GHVC 3C8YA 4PG5A 4LIWA 3MFHA 3T6JA 4C8OA 2FGCA 2HBQB 5LMNF 2RJZA 5T14A 2ZVIA 2DH9A 3A8JA 5HVGA 3EYZA 5KFAA 2GV1A 2HHHF 4DU8A 2PMWA 2FVCA 2MKYA 5F8HA 1AB8A 1HD0A 4MKAA 2E5LF 4J9MA 2AW0A 2GW8A 3DCAA 1I94J 1WG5A 2BACA 1TL3B 4UF4A 3T6BA 1JWWA 4DFPA 4WTYA 2ACYA 4RW9A 3E8OA 4K4YA 4OX6A 2BJDA 5DLGA 1P27B 1U1PA 3K8WA 2BM1A 5KFFA 4Q5VA 3KLIB 3RU0A 4DL3A 4NLQA 4CQ1A 5JVGQ 3VAFA 3HP6A 2DR9A 1N32J 4V19J 4O0IA 2XHWA 3MMBA 2IBOA 3I31A 2MSSA 1UP1A 2R7TA 4I7FA 5KFJA 2LU2A 1FJCA 2K7KA 4P9SA 1SIZA 2HFUA 2Y8WA 1NNDA 1URRA 3H8YA 1ZPWX 4J9RA 4HLBA 1OYDA 5D0GA 3HK2A 5C25A 3R8YA 5U47A 2NPIA 2LQBA 5B0DA 4A8MP 1SL1A 2HGMA 4F0HA 5KT6A 3F41A 2V2VA 1B0TA 5CD4A 4A8QA 4WPAA 1L3TA 1U25A 1XR6A 1R8BA 3C66A 1G1XA 4IH7A 3VTIA 3CCQS 2CNNB 1IQTA 4J7CA 1QDUB 2YKAA 4K4WA 2OEKA 2XWYA 2HG4A 2FLNA 4ZHRB 2ZDPA 3EPIA 2VICA 4OHZA 1PYTA 1TKXB 3PX0A 1BWEA 4QWBA 1RTJA 3AD9C 1N8RT 3MOZA 5L38A 1CJTB 1QUPA 2YVSA 1M1HA 3MGJA 1R8PA 1GMVA 2CVIA 3N6NA 4I6AA 4LR7A 5F0WA 1F5AA 4DUTA 1HNWJ 4YDDB 3NP5A 4IG0B 4CO0A 3BGFA 3DDNA 2F4FA 3G86A 3GLJA 1S1VB 2FVPA 3A13A 4OV1A 3QNWB 4AYBD 2KDOA 1VJQA 5T41A 3PM9A 2U1AA 1ZAVA 4KGKA 1Q8KA 2CQGA 1LXNA 3PV8A 1RZMA 5KAKA 2F7VA 1JB0C 1H2UX 3QO9B 4X62J 2IPOB 3OVSA 3NLCA 1KQFB 4RUBA 4ZP8A 4ED2A 2KFNA 1HD1A 4KHRA 1XJWB 2F4VF 1UL3A 2FJEB 2PC6A 4KHMA 1HYSB 1RBLA 2XCAA 3PFEA 2FJXA 1ZZNA 4C8YA 1WI6A 4NLWA 1EAYC 4ZCLA 2ZDOA 2R3VA 3MD1A 4TY8B 2EEYA 2XHCA 3BYRA 4J9QA 4FXDA 4H4KC 3CDWA 2LXIA 2K3KA 1RT6A 1DQ8A 1RT2B 4J91A 1F1BB 2ADCA 2VBYA 2ASLA 1U48A 2YBVA 2H4WB 2PEHA 4NLUA 2FHJA 1RKJA 2NREA 4DV7F 3K7RA 1T02A 3DRYA 1X0PA 4M5NA 4OX8A 3DM2B 1BC6A 3G82B 3OL9A 2CQIA 1RE1B 4PXDA 4FS2A 4YR2A 3R5AA 1NHVA 4MYUA 5AE3A 3KG0A 1YX2A 2QMUB 2NS1B 3CCVS 4DR1J 2DISA 3UD3P 5KFXA 2AX0A 2MKCA 2XSJB 1LFPA 3DOKB 3LQVA 1G3OA 5KFBA 2JZ5A 2HBRB 3D28A 2ILYA 1TMJA 2X3GA 2YWHA 1TV6B 4ED3A 4PKDB 3RBXA 2WVDA 1TZ0A 4X64J 2ERRA 4QIGA 1U1KA 2M0GB 5L39A 3TVKA 3BKUA 5HVFA 1FA0A 2EKYA 1NDKA 1EQMA 6FDRA 1VHIA 1S6QB 2HVZA 5GAGU 2KO1A 2CXEA 4B3RF 5EX3A 1WC0A 3OFGA 3FNNA 3HHLC 4A8OA 1C1CA 3AXKA 3V81A 5D78A 3E01B 2EC0A 3PX4A 4G1QB 2EFQA 2F8HA 2HQIA 3P96A 1KQKA 2LXUA 1U8WA 5KFQA 5CD4H 4C3KA 5KFOA 4Y2AA 3NGSA 5HSPA 3MUTP 2W4CA 4KT0C 5DQIA 5J1EA 2DNYA 4UUWA 4ECRA 3KDOA 1X7VA 2UVWA 1YG0A 2C2RA 4JV5J 2PA8D 1R0BG 3OXGA 1S59A 2V68A 1BGXT 2RDIA 2VOOA 1L5UA 3PYGA 5IV4A 1SV5A 1QE1A 3PIPQ 4DF4A 2ASYA 3MAAA 5HAOA 2DR8A 1WWHA 3POTB 3IR6B 5CHCB 3NGTA 2W8LA 2LDIA 2MMYA 1NRKA 5A76A 5ETTA 2DKOB 2Q43A 2LCWA 4TU7A 3QRPA 4NXMJ 2BX6A 4F7VA 1LWXA 5ETSA 5HROA 3W64A 4WU3A 1NH8A 2G9OA 3W2WA 3GIIA 1KLNA 4MKBA 2V6AA 3C15A 5KOWA 3R1LA 3CJKA 4QYZK 2RKIA 3BGUA 5DGAA 1ELOA 2E7VA 4N8NA 3PNIA 1O51A 2VFVA 4JI7J 3HZGA 3MF5A 1E6YB 1FXDA 1IBMJ 1OS5A 3T1AA 1PG5B 1RABB 3ENQA 2IDEA 4J9PA 5RUBA 1SC4B 5KFIA 4RBVA 3RB3A 3H2LA 1A6LA 2MQMA 3CC2S 3N0VA 2VFUA 2DNZA 1K1SA 2IC3B 1UEKA 1OQ3A 4JI8J 3TO8A 3DLHA 4YY3J 1U0HA 4KPCA 1BQNA 4F36A 1AXQA 3I9V9 4YB5A 1KQGB 3CCSS 1HNWF 3V4MA 2VPWB 4IO1A 5LXRA 1UETA 3NNCA 3CJQA 1S1UB 2UU9F 2XI2A 1GTEA 1HBMB 5KFGA 4DQSA 3Q8UA 1KQSR 4Y65A 1GX5A 3GR0A 1RLCL 3T5KA 4XO0A 2VPZB 2UUBF 4WWSA 4Y2KA 2AU0A 1K44A 3EE3A 2PD1A 3I5AA 3MEEB 1ZA1B 4NMXA 4X62F 3ITHA 5HBMB 3KYLA 2QYGA 3G6VA 1SH3A 1HR0J 5EWEA 1QTNB 1VBXA 2FQQB 4K4TA 4B9VA 3H5XA 5T7LB 4B3MF 1C1BA 4C0HA 2V2QA 4LF7J 3RUBL 4DPTA 1D0EA 3LPYA 2QLXA 3U1NA 3PRVA 4AD6A 3GU0A 3JXOA 4XTTA 1Y3KA 4IG3B 1S4EA 3VHQA 7FD1A 2C2OB 5JXSA 1FDNA 2ZM6J 2ZH3A 2AYGA 1PJ5A 1KS2A 3BSOA 3NMRA 4NLVA 1TK8A 2R2SA 2R7XA 5KFYA 2CZVC 4H4KA 4WK3A 2M88A 4KE5A 6AT1B 5CYMB 4RUHA 1VQ5S 1VQ4S 5B7WA 3CW2C 2B4VA 1Q86T 1X5SA 2UUAJ 3MM9A 2W4PA 3MEDB 2BR0A 4DR1F 1WNEA 3N5FA 2OKQA 3GV8B 3F44A 2CRLA 3H59A 4JI0F 1NSPA 3CNQP 5D15A 5I3QA 1ZPVA 2XULA 3JSYA 2ZZNA 2QIFA 4Q8FA 3HHDA 2EC2A 3R27A 4DPUA 1AA1B 2HZAA 3R5GA 5G4DA 2BOAA 4OV6A 5KT5A 2NPFA 4X4TA 1S7HA 3R5BA 2WTFA 1RWXB 1GX6A 3BV8A 1GNKA 2D1CA 2MQPA 4ANCA 4ZCMA 3OFFA 1SQEA 5AXNA 1HA1A 1G4CA 4DQQA 4DBQA 4U96A 1LEOA 1Z1ZA 4K7QA 3MUMP 2C2ZB 2JFKA 4WKYA 4N7TA 4FYWB 3QBCA 4FYDA 2G2ZA 1DY3A 3H0PA 3OTOJ 4WFNQ 2N3OA 5KG2A 2HZCA 2RF2A 1RACB 4GC7A 2B9EA 2FY8A 4ELTA 5F0UA 1VBZA 1WHVA 4BS2A 3HHLA 2VBZA 4GKKF 1DJ0A 3H5SA 1F3VA 1JKHB 3CJ4A 4IYQA 2V34A 3TQ1A 3UN2A 4C6AA 1HMVA 2M52A 2NLWA 4ZPCA 2ZBPA 1LKZA 3Q8PB 1U1RA 4JV5F 2OUGA 4LBPA 2R9LA 2QSFA 3CGIA 3NMAA 1C4AA 3GSIA 3TX0A 2WBRA 3TJ8A 2YNGA 4HH1A 2AX1A 2CFXA 3QGHA 1NDLA 2Z2YB 3KG1A 4JI2J 1CULA 2M4MA 2BJ7A 1EETA 4URSA 2VFRA 2MZRA 3ILIA 1KVJA 3W8PA 4P7TA 1I3OB 3HFVA 3SQGA 3J80U 4EMDA 1HNIB 1TFWA 2LA6A 4NXMF 2UXCJ 3T41A 2ASDA 2HNYA 1S9EB 5EN1A 1WI8A 1YZ6A 4MJKA 1FESA 4LF8F 2VG7B 1XBWA 4AL7A 4FS1A 2JLEA 2YWWA 3FSYA 2XB2D 2AEMA 3IGNA 5E3RA 1YRXA 3OT9A 4FYVB 2DPJA 4I68A 4I1TA 3FEXB 3C6UA 4WFXA 3MFIA 4ZIVA 5KFZA 2FIUA 3CJ5A 2DGUA 2QC3A 3S7RA 1X4GA 2OPQB 3UI3A 3OUYA 4NRUA 2J6UA 2X1AA 2G2YA 3CB4A 3GPAA 1R43A 2EVZA 3VR1A 3PXGa 3MOJB 3HD1A 1T9XA 4ZJQA 2GO9A 4O0NA 1WHXA 1CVJA 2DHHA 1HQEA 1U1MA 1R0AA 4JI8F 1KR4A 2OFGX 5DZ7A 3DMJA 2R8JA 1BXNA 2CA9A 4FVCA 2M3DA 3IRXA 4KGZB 2B8PA 2DR6A 2OELA 5B0AA 1JNRB 4P74A 2R7RA 4ILRA 1HPZB 3Q22A 1Y5LB 4ZVFA 4ECUA 1N54B 3O8WA 1JLEB 2SXLA 4YHHJ 1RT7A 1HNVB 3KLGA 1VIOA 3PYDA 4RJVA 1I1GA 2Y8YA 4ECTA 4OJGA 4ZOSA 5DS7A 3CEDA 4DPXA 4RKUC 3MD3A 2E5JA 1TKZA 2YNIB 2X3DA 2ZH8A 2IFXA 4JI1J 2HK3A 2ZC4A 4NX9A 4FZVA 1MWQA 2ZH5A 5E41A 2IM2A 3BO2A 2JNJA 1LW0B 3DOLA 2AJQA 2A10A 3WQPA 4RWWA 3LOUA 1ZAWA 4PWWA 1PCAA 4XDCA 2UVRA 3GB0A 3QIPA 2UV8A 4OQJA 3PFOA 4LFBJ 3QFHA 5A8RB 2ZM6F 5L1LA 1X4FA 1CS4A 4P73A 4C97A 2P6TA 1DBDA 1M0SA 5BR8J 1T7PA 3P49B 4IOCQ 4XK8C 1WF2A 3QATA 3CMES 3KNAA 2LFVA 4IH6A 2W7PA 2JC1A 2EG1A 4XDDA 1WTBA 4IQMA 2L9DA 1RT3B 5J2QB 1S1WA 1N5YA 2UUAF 3LA0A 2MKKA 4NYPA 2L08A 1CJVB 1VRUB 3M8YA 2C2DA 1IXKA 2FVSA 1H73A 2C2EA 4NXNF 3Q2TC 2VV5A 3R3TA 3OR2B 3DOMA 3CULA 4J9NA 1OMSA 2XEXA 2HKEA 4OIXA 1R8AA 1H72C 2NXCA 2XMJA 3PO4A 3LP1B 3M2VB 3MM6A 2UP1A 3LTOA 1SJ3P 3NG8A 3KLEA 2ZE2B 1IR0A 2DCLA 1Q1KA 5JJBA 1X31C 4H4OA 1NDCA 1FVSA 2NUUG 2CG8A 4MK9A 3SIPB 3R7SB 4O3NA 3VGSA 4OI1A 2V50A 2EK1A 3V6JA 4CCHA 2VD3A 5LXYA 1YBTA 2E9RX 2DRDA 4QIEA 3NEKA 2ZHAA 4KGVB 5HMWA 1DLOB 2VQFJ 4IRCA 3MM8A 1VC0A 2GIQA 1M1GA 1RU1A 3WX4A 2DR5A 5D3GB 1X9SA 3OTEA 2BE2B 2B3TB 2V94A 2IIHA 2GIFA 5CABA 4HACB 3SMZA 4ZJLA 3WIUA 1D9DA 1KFSA 1P1LA 3UVJB 2QG9B 3KMSA 2JEJA 4PZVA 4PR6A 3PRBA 2JVRA 1F9EB 1WC1A 3KHHA 2FHOB 4PQUB 2V63A 5F41A 3PZPA 2E9TA 2ILZA 3CO0P 4RR5A 4LMZA 2VC0A 2PI4A 2W25A 3W2VB 4A4JA 4DR3J 1VQ8S 3UCUP 4JI5J 3B82A 2Y1LB 1AUSL 2RAQA 4QIWD 5EX0A 1I5OB 3EM1A 1F2HA 2E5HA 1OSCA 1CQNA 4DV1J 5L1JA 5KG6A 3NRBA 1LNQA 2LQ8A 1Q8LA 2QL5B 5LT5A 1UVKA 3HO1A 1VRTB 3KJVA 2DTJA 4PXEA 4ZHRA 2CQ1A 4OYOA 4B3OA 2AZ3A 3TJ9A 4Z7YA 2E1AA 4MAKA 5L9NA 4FP9A 3TOQA 1CJTA 2XMMA 3RRKA 1TK5A 2L41A 2FVRA 2F9JA 4N47A 4LBIA 2Q79A 3V6DB 4M94A 3DLEA 4KQZA 3FQLA 4F0MA 4LR9A 5IM0B 2HZVA 2HQFA 1YJ9S 2F9DA 1S1VA 2IRUA 3NGUA 1S5ZA 4NZ6A 3IBCB 2F40A 4DL4A 4Q2LA 2W7OA 3EUNA 4XIUA 2L9WA 4BC7A 2FY1A 3FCWA 3D1HA 2DNRA 4J9VA 4RO0A 4CO4A 2CJYB 1VJWA 3QO9A 3KK2B 1TK0A 1QAXA 2RRAA 1Y5NB 4F4WA 1VOMA 1U24A 3KOAA 3MCNA 4YQWA 2E1CA 2GZOA 2P5VA 5DETA 1YQHA 3PKYA 2VIHA 1RGVA 4CLTA 4JI1F 1FJGJ 3K5PA 1KTQA 1JXLA 1HYSA 4ECZA 4LF4J 3IG1A 5I3UB 2ZJQQ 2LDYA 1ZM3A 3ISND 2CJXB 1VQ6S 4TY8A 2BVZA 5CH7B 3D7SB 3LUYA 2CWXA 4WTOB 2O1PA 3TJAA 1N56A 4NLOA 4X65F 2YPYA 4JBCA 4EUVA 3MMBB 1YJWS 1RAGB 3MZIA 3PEHA 1T0TV 2D7SA 1DTQA 4I7FB 4ES2A 3N5BA 1Y10A 3LPEA 1U26A 4F3MA 2W1BA 1NHUA 4LUBA 3G82A 3EGZA 4ZPDA 1LK7A 5EWFA 4C8MA 1SKSA 1S57A 1MU2B 4HL9A 4KBIA 1CJUB 3CCLS 1FD2A 4Z2XA 4IR1A 3PR4A 2FLLA 3AODA 4OX9J 1TUVA 3QIDA 1YDLA 2XSJA 1UEVA 2AYBA 2UUTA 3HT0A 4X4NA 2HBYB 1HBOB 2FZCB 4WYWA 2H5EA 2MTLA 4NI2A 1M5SA 3CMQA 2XG8A 4U8VA 1YZ7A 2AJ4A 2MQNA 4I2PA 4UY85 3UDEA 2ZH2A 1N5VA 2FPHX 1RAJA 3JTPA 1L3KA 3R97A 4K50A 2CQ0A 4PCQA 1S6PA 3HSGA 1FX4A 4TNOA 3V6HA 3DYAA 4QBUA 4A8WA 5E7OB 3A8EA 2Q66A 4K8RA 1RTZA 1S6QA 3UN3A 3PG9A 1S0VA 5D8HB 1RWMB 4DSJA 2MHEA 5ITHA 4Y00A 2YKPA 1RT5A 1UPMB 4X4VA 3GCWP 4ELVA 4PEOA 2ZH4A 4M5JA 4I56A 3IWLA 3RG6A 3M8ZA 4G1QA 1EHWA 3MPWA 4DR7J 4Y28C 4DN0A 1KVIA 1BE4A 2FHJD 1T95A 3BGRB 4AT1B 1Z2ZA 1R31A 3IR5B 4QR1A 3TNVA 2BW7A 4D3GA 1I51B 3AOBA 3ILOA 1Q82T 4DHVA 5L1IA 2JLGA 2ZD1B 1EZZB 4G3IA 5DDRC 2DR7A 4TN2A 5A2QY 1Y11A 2XSFA 1FK9A 2BJ3A 3M30B 4KKOA 1MNEA 1RCXB 4L6V3 1TAQA 4QR0A 3RBZA 1O8BA 5KG7A 2DGWA 2PIIA 1RYRA 2LA4A 2HHXA 5DG8A 2YPZA 4IR9A 4V1Ak 1X5OA 4C9DA 3RYLA 1ZM2A 4M5GA 4X2BA 1RWPB 2UXDJ 3DLLQ 2CDQA 3MPVA 2DCUB 2QFIA 3LWMA 1W25A 1YKWA 3GYXB 4DXLA 3ENWA 2EI5A 4OZJA 1H98A 4DR3F 4AL6A 5THWA 2DT9A 2BANB 2WAQD 1KTVA 2VKZG 3AJ1A 4C3MA 4ECWA 3HCXA 3MR2A 1E6YA 4FN5A 1XNQF 3CC4S 1F5CA 1RU2A 2K2PA 2F5GA 1WOPA 3I9ZA 2HQ3A 4QR2A 5GADU 3M8RA 2GVZA 1F3FA 4ZLPA 1ZAXA 2DY1A 4NASA 2IC3A 3HT3A 3KK1B 2CPDA 1JJHA 4ANEA 2ZVSA 1F5BA 4E2FB 3SDEA 2KVQE 1DARA 2J8SA 3UO0A 3Q8YA 3IRWP 2J9EA 4A8XA 3VAJA 1SKWA 1S1UA 2B8QA 2ABYA 1Q95G 2VJVA 5ETRA 2LMIA 2RU9A 4OYAA 3CUNA 3EDQB 2OTJS 1YSJA 2HMIB 3ZTPA 3V81B 3DDIA 4O3RA 4LF6J 5LJ5Y 1NK4A 4NOHA 1WEXA 1VQMS 2QN6B 2OLWA 2ZBIA 4RNFA 3MEEA 2PI5A 4OYZA 2KU7A 2V8VA 2V2ZA 2KB2A 5J2PB 5HBMA 1R8CA 2A2CA 3W3SA 4ZPWR 4QWDA 1R6YA 2J7KA 5LSOA 1FJGF 3SSRA 4PYAA 5T7LA 2WB1D 4ATNA 1C2PA 2ZH7A 2DNHA 3EJMA 4KHPJ 2WVCA 2XC9A 4LF4F 1PYSB 2AJ0A 1OY8A 5L46A 3TW0A 4KSEB 4MIBA 1QE1B 3ETMA 5ADZA 5FLXU 1QM9A 3D3CJ 4RW6A 4K4UA 5LMUJ 2VDHA 4WIQA 5HI7A 2Q6BA 4BC9A 4NRTA 2R2UA 1YI2S 3T19A 4B9NA 1JLCB 2F3JA 2C28A 2GAHC 2CJAA 5CYMA 1X4CA 2FZGB 3RAQA 1K0TA 1WKJA 1EJ7L 3M32B 4TU9A 3C15B 2XZWA 4M95A 2A1BA 2BJEA 4BHQA 2HQGA 5JMNA 1RAHB 5CYQB 4OX9F 4LF5J 1WDTA 1PAEX 2HHVA 4C8NA 2DHAA 1RT4A 1NDPA 3NOGA 5AJ3F 3K58A 2JVOA 4KPYA 1DQAA 1RJJA 4LBHA 3FVYA 3OXFA 3HZEA 1TR0A 2HQCA 4ETZA 2QLWA 1JXVA 4LF1A 3BO3A 1MMNA 3M05A 2IVFB 1T8EA 4IFVA 2R8IA 2YWEA 4NEZA 4Y0FA 2B9YA 3VCDA 4I64A 1CG2A 4QCLA 3Q8QB 3OLBA 5EWGA 3TA2A 4L3NA 3A3NB 3G6ES 3LF0A 3TUZC 2HWIA 2EFPA 4U6PA 4NLRA 2R2TA 3CJ2A 4XPCA 2AJFE 4O4RA 3KLVA 4FF3A 1KHWA 3MCOA 3ZZ0A 1JKHA 1VISA 3M1VA 1HW8A 2BKOA 2CPEA 5AE1A 1G6BA 4F4KA 3QYYA 5D4OA 1FEHA 1VGYA 4B3TJ 1IKWA 4HTIA 2DNOA 2B5JB 2G13A 4HH0A 4E8UA 5E5NA 4WP8A 2YKNA 1V5VA 1H38A 2E7WA 2WONA 2G1DA 1WKLA 1IM6A 1C1BB 4S0MA 3ZZYA 2GIRA 2DHGA 1JXEA 1FT8A 1L3VA 1HNXJ 3MR6A 3I87A 4USMA 3J7ZT 1APSA 1HW9A 4C4WA 2O5DA 3C16A 4C3LA 3Q8SB 1B70B 3FMBA 3MURP 4I4BA 1HNIA 4DN9A 3R5JB 1AROP 2HAFA 1S9EA 2QYCA 1X5TA 3NAHA 4KGXB 2FZKB 1X9WA 2HVIA 1HQ2A 1RHMB 1NSAA 4K5RA 3FCHA 1W7WA 3ZC4A 4R0EA 2VPYB 2DY9A 3R7NB 3SEOA 2XMKA 1UMJA 3R5CA 2QT7A 2J5AA 3HHLD 3IFEA 1WELA 4F4ZA 1KSPA 2ZEJA 4QW9A 4RU9A 3PIOQ 4ANDA 5A6PA 1D3WA 2OPQA 1FJEB 3DLKB 3GIMA 4ZPVR 4LIRA 1RUSA 1YLXA 2E7XA 3QLHB 1JLFA 8ATCB 2VF3A 1FJ7A 4WK1A 3D54A 4OX7A 4DCPB 3FRZA 1RLDA 1B64A 2BJ9A 2HLUA 1FWLA 4C11B 4OL8A 4ICLA 3PR5B 1IKVB 3JTOA 3BH7B 2HWHA 3AD7C 4Y34A 2HQDA 3KJFB 1PC4A 4PWDB 1OPIA 2GAGC 2HFOA 5HQ8A 1HFEL 3THTA 2I9SA 4ED8A 4CO1A 1HPZA 3GQCA 5LMNJ 4K5SA 3EXYA 3IBWA 1RADB 1UVJA 1LFWA 4DMZA 1TU0B 1D9AA 4LF6F 1HNVA 1J5OB 2RF2B 3P5TL 2QLJB 5I42B 4CLKA 3HHLB 2YX7A 3NBPA 4MIWA 5KFKA 4U95A 3M2UB 1VQOS 4ELUA 1HMVB 1Q78A 2CQCA 4F3OA 1FE0A 1V3SA 4OHYA 4FDFA 2FTRA 1EIYB 3MPUB 3BQ2A 1N5TA 2H5IB 2DXFA 2XYGB 4DV2J 2IHR1 3CSKA 2GFFA 4USUA 3HF5A 5KFVA 4DQRA 2V4JA 4JP8A 3AFGA 4R0JA 4EBCA 3IA0A 3M2RB 1F6TA 1CULB 4OZ5A 1NB7A 1S6OA 5A8RA 4C0BA 1XEZA 1FNOA 2O3DA 2MKIA 2X1GA 3CXCR 2ZUGA 5H9EJ 1S79A 2CG4A 3MR3A 2M70A 4DPYA 3FZBA 2DEIA 2XMVA 2VU5A 4ZK7M 3NWGA 1RT3A 4M5MA 1KRPA 1M5KC 2KXHA 5B0CA 3I5BA 3OTDA 2JC0A 1UAWA 3S6EA 2IM3A 2ROGA 4CNYA 4IOBA 2HNZA 5C7PA 4M5LA 1N33J 3F56A 2XS5A 1CJVA 1X8DA 5M2UA 1VRUA 2HHUA 1MMLA 4DFKA 4ZA1A 5HMYA 1QVFR 3B8HA 1D09B 1KLMB 4EEYA 3JAMY 2OPSB 2Z0GA 3SXLA 2AF6A 3EMTA 2PEBA 3TA0A 4DX5A 2VODA 3Q8VA 5KG0A 4CLUA 2C2NA 3J81Y 3LP1A 2D3O1 3NGRA 3MR5A 1T03B 2N4DA 1R0AB 3I82A 2QA1A 1U6ZA 2ZE2A 3DMJB 4NLDA 1XQIA 1CC8A 1RHKB 3IRXB 2H1YA 1BQMB 1DTTB 4RWXA 1GH8A 3VAGA 1PJ7A 1IBLJ 4QU7A 3CE8A 1H3DA 5KG4A 5B0FA 2AMCB 2NR0A 2W2PP 4CYUA 4NA2A 7FDRA 3V4IA 2CJQA 2RU3A 1VLOA 4YR0A 4CH0S 4CRJA 2CQ2A 4OZ2A 4PYDA 4HT5A 3OSPA 1IM4A 1DLOA 4WZMA 1QLNA 2WB4A 1V5IB 2Z2MA 3CWJA 2X1BA 2OIHA 5J2MB 5D3GA 1RDRA 2DXEA 5H9FK 2BE2A 1ZOTA 1VHFA 1SJRA 3D6FB 1F9HA 1V3RA 1AW0A 3QQCD 3NAIA 1MLAA 4HACA 1RI7A 4IUFA 3DLBA 3DOLB 3GSDA 2R42A 2BKPA 5IWAF 1HNXF 1UFKA 1OQ6A 4DR4F 5K8PA 3SBMA 3DXBA 1FWKA 1YVFA 4PQUA 1RA7A 4JOUA 5K5MA 4ZPBA 2WSEC 1ZBTA 3LANA 2DIVA 2RNEA 3K2YA 2ZH6A 3MAQA 2OAUA 4LFCF 2MLYA 4DV7J 3HVTA 2W2QP 3CD7A 4M5DB 3GIRA 4FF1A 3J7A1 4DG1B 3TZZA 4F4YA 4OZ3A 3IM9A 1IKYB 2XCPA 2LECA 1YRUA 4JI3F 2Y1IA 3GIJA 3IWXA 5J2NA 4CO2A 1FWPA 3L09A 2GQ2A 1S1WB 1VRTA 3JTNA 5HQMA 3DRSA 1ICEB 5F8GA 4CT8A 3BKTA 3CDBA 1QSYA 1S76D 1SUQB 3QZ7A 4ED1A 3FK4A 4DX7A 1REGX 4HTJA 1WJ9A 3ENAA 3RRHA 3V6DA 4F0KA 4URQU 4RPFA 1FERA 4CM0A 4ECQA 2PSZA 4OFZA 1WEYA 3QWPA 1V3ZA 3EVWA 5IT9Y 4BDPA 4KR0B 3AY0A 4USJC 3P8BB 5IS2A 2HRYA 4LRBA 5KG5A 4KRWA 4B3RJ 2XM3A 3OL6A 1C4CA 2QMXA 4H4MB 3KK3A 4HKQA 3KLEB 5E2QA 2OPPA 2KG0A 3NOCA 2CJ9A 3CD6S 2H65B 3JSBA 2L9NA 2WVFA 4K4VA 2GGPB 4CDIA 3E3XA 2BV3A 5EUHA 1TQLA 4H4OB 5HANA 4USVA 2HGLA 3KK2A 2I8EA 2AEFA 2DNGA 1IJEB 3BPDA 1FX2A 4OJHA 3MM5A 4CH1A 3MAHA 3DLGA 1IWAA 3MTJA 3DRPA 1Y3JA 3TA1A 2MY7A 1FD8A 1RXOB 3SV3A 5F8MA 2W4DA 3MM8B 5I3UA 2FGOA 4QWEA 2YX1A 3P4UB 2RIJA 3IN5A 5ETMA 1RTDA 4YDXA 3BBCA 3TARA 4DV2F 4ETXA 5GMDA 4LQ9A 1EP4B 3QGIA 1DURA 3OXLA 1X4DA 4QYRA 1HHSA 4RW7B 5IT0A 4A8YA 1SH0A 1VQPS 1NAQA 3QT8A 2C3PA 3BEGB 2M9KA 2Y1JA 4IH5A 4ZVGA 2W8KA 1SKRA 3BSCA 3RRGA 1VRQC 4ED6A 4J9SA 1X9MA 3IXQA 4N56A 3JSMA 4B3SF 5CZVA 2WOMA 4FXVA 1UJ4A 3AB4B 1VQSA 1MU2A 3M8SA 3UDVA 1CJUA 2KM8B 2QSWA 1R3NA 3TQEA 4AFFA 1RB0A 2VG6B 4F2SA 2I1RA 3QZ8A 1Z4UA 4U7UK 5HLFA 3K59A 1N33F 5C5JA 1HBOA 4I2QB 3AOCA 2FC9A 4KY3A 2R2RA 3KJVB 3UWTA 2RQKA 3V5RA 5K8NA 2DGSA 1IQZA 4B3OB 3NCPA 2VJUA 4HDHA 4YB6A 3ZZUA 3THVA 1RAFB 4ZPAA 2BRKA 1N34J 3RAXA 3DLEB 1LV5A 2KFYA 3MPYA 4KFBA 4DZDA 1HLWA 1U2CA 2HVHA 5GAEI 3TZXA 3N79A 2PMHA 2UU9J 1BMQB 2KL8A 3ZFVA 2DGXA 5DRKA 2NYHA 3HULA 4ZCKA 2FJDB 4KC5A 4N77A 3LW5C 1XC9A 2J0XA 1NK6A 3HLUA 3NY0A 3PJXA 1IBLF 3PY8A 2UUBJ 3C6TA 2B4UA 1M90T 3BGRA 5CCMA 4Y2CA 5HP1B 1F2GA 4WJBA 4OMFG 5KTQA 4NL5A 4NMLA 1YK9A 2GMHA 1SB6A 1T9VA 5CAAA 5IQ6A 2ZD1A 4MIAA 2MYFA 2VFTA 3OTBA 4B9MA 2ZWOA 1X0FA 3M30A 1UVLA 3OVAA 1UZDA 4B3MJ 1A7GE 5HO4A 3SSQA 3IG1B 1MW7A 4DFJA 2K1RA 3QSIA 4ZDNA 3QRRA 3R2DJ 2LU1A 1VC6A 2LXFA 2OP5A 4CLLA 3S01A 4EBEA 2D41A 1O0PA 2PA3A 4HT7A 2HURA 2YH1A 3G8QA 3PKMA 1WEZA 4YB7A 4Y2IA 2JDJA 1SBRA 2KJVA 2VASA 3FBCA 5KFCA 1FDDA 4JYAF 2I38A 1K9MT 4NEYA 2J9CA 1DTQB 4K4XA 2N7YA 3F73A 1RP5A 4OHWA 2NXJA 1TMMA 3PYFA 4EK2A 2IAJB 3GV5B 2E1RA 3Q0AA 2BANA 2F63A 4ZVEA 3M6UA 1JIHA 3W8GA 1X5PA 2NUHA 1EKRA 7AT1B 3S1TA 4NYOA 3D1QA 1R6VA 3DRRA 2N4CA 4R8UB 4V19X 2WZ1A 4U7UD 3EVOA 2L3MA 4JI0J 2JLFA 1EQ0A 2JOQA 3RR8A 5GMEA 2KVIA 2E9ZA 4W98A 3NGKA 1XTZA 2YY3A 4NI2B 1T9YA 2J6TA 4ZLLA 3KK1A 4FVMA 2X1FA 2ACMA 5E3PA 3GE9A 4DSIA 4I2PB 5E0OA 4DV6F 3THPA 1S6PB 1U2FA 1IR1A 3DYAB 3QJLA 5LSRA 1MN9A 2GVDB 2W2MP 4USTA 2BJ8A 4PG7A 3VGVA 1O5JA 5HQLA 3IS9B 1CJKB 3D0HE 3E2EA 1DAXA 3GWCA 2HMIA 1VMBA 2BKNA 4CTAA 3GJQB 1RT5B 2VG5A 4GKJF 3CT9A 4EU0A 5F3ZA 2AYEA 4OZ0A 4RW8A 2CJKA 3Q89A 1WOOA 3GFZA 3N4WA 4QQBA 5L1KA 3ZZZA 4GKKJ 2Z58B 5J2PA 2I2YA 1TAUA 3CCZA 3A8KA 1HKAA 5CZXA 2KRBA 4P71A 3SV4A 4EI2A 2KTQA 1Q5YA 4DUZJ 1GMWA 2ADBA 3H90A 3SYZA 3MHYA 3HFZB 4RNMA 4LVNP 1HI0P 5IFMA 4OI0A 4ZN1A 5FIIA 3OR1B 2CPHA 2UUCJ 2EFGA 2LQJA 1IWGA 1FK9B 2AGQA 4KKOB 4ZLNA 3ZZRA 5C2GA 1KDNA 3PW0A 1FFWB 3GG1A 3TZWA 2Y9HA 3NGDA 3H7HB 1QJHA 4Q44A 3TUPA 1IJFB 4URGA 3TX8A 3U7JA 3UR3C 2XGQA 1HWUA 2K3IA 1IBKF 2DGOA 3P45B 1IR2A 1RAIB 4DV4F 3RBDA 3QFWA 1U8SA 3O3LA 3BB5A 1JLCA 5BJRA 2RQCA 5GADI 4LF8J 2PFFB 4OYIA 4O4GB 4JI6F 3M32A 1PBAA 3D9BA 4GVBB 3KHRA 4P2XA 3K8VA 1CQMA 4UW2A 5CYQA 4CZCA 5M2RA 1YWXA 2LLZA 3T1HF 4FNHA 4DLEA 1N88A 1YGYA 3JS9A 5LSLA 3BO4A 3KG4A 3CC7S 1FRMA 3TYTA 2MY8A 1SC6A 3M6WA 3BGLA 1GFWB 3AQOA 2GVZB 4DFMA 5K8MA 5B0BA 2XTJP 1LWCB 1M5PC 3J81j 3BR9A 2CAJA 3BJYA 1FKPA 4ZP9A 3J7YI 2HPUA 4ZVUB 4Q2MA 2BEFA 3RGIA 2YXLA 3GJRB 1N34F 3SDEB 5ETKA 2VUGA 4ECYA 4DI6A 2R8HA 3M6VA 3GIKA 2VH7A 1T05B 3ONQA 3DU6A 1Y9OA 3D5MA 4I69A 1ULRA 1H74A 1DFDA 2KRRA 3PJWA 1CPZA 1M5HA 2GQCA 2KT2A 1OWXA 1CSJA 1C0UB 4DOZA 1ZETA 5DJBA 2D9OA 1LW2B 2B5JA 1WC5A 2E1MC 5K9FA 2J9DE 4ER8A 2CVEA 3M8PB 2JX2A 3MEKA 2YKQA 2BE7D 3RZAA 1WF1A 5A0YB 2EW9A 4QYZJ 3L95X 3UW1A 1LQ9A 1FI4A 5A8KB 2NSBA 2Y1RI 2V69A 1Q8IA 3PO5A 4AXIA 1X4EA 2C42A 1H6KX 4AE5A 4USKA 3IR7B 1KD1T 5K14A 3NS5A 2KT5A 2F8EX 2ZBCA 2HFNA 2IRXA 1RWOB 4RW6B 1Q16B 4F2RA 1KKHA 3CF5Q 1HBUA 1WC3A 1TVRB 2B4PA 4HI2A 4LSLB 4ZVPB 1HBNB 4U8YA 2ROPA 3KHGA 5KG1A 2PFDA 3EGNA 2IBKA 5GAHI 4PABA 2ROEA 1S6UA 4YOEA 3MM7B 2D9PA 2RB7A 3TZYA 4JV0A 3DRXA 4ILMA 1DHMA 4NZ0A 4GO7X 3AT1B 4FPIA 3C19A 5ETNA 1WG1A 2ATLA 3FSIA 3DLKA 3PEJA 1FF2A 2HLTA 2XMTA 1S9GA 1RT4B 3QLHA 4NXNJ 1F9FA 3KLHA 2YNHA 3VALA 4PUOA 3KFWX 2DGQA 2OD6A 3W66A 2HRTA 3FDSA 4C11A 2RSQA 2DJWA 3MUVP 2PT0A 4CO3A 1VBYA 4DZ6A 4BCAA 1IKVA 4IFVB 1OO0B 1P9YA 3D3BJ 3O1LA 1N0VC 4PWDA 1G2EA 4O3SA 2Y3YA 1YBUA 3JSRA 3UQSA 1AYEA 4C2MA 3QGGA 3H4DA 4YN3B 4NPOA 2ZNYA 4PXCA 3CCUS 4MH8A 1FNXH 3D2WA 5KFWA 1VC5A 1J5OA 1B7FA 5HJYA 4CM2A 3UNGC 2MZJA 3GR1A 5I42A 1R8HA 3D6TB 2UXBF 2C22A 3V2UC 3TAMB 4KV8B 1Y7PA 3M1VB 3LH2S 3M2UA 4FNIA 4QOTA 1K47A 1UPPA 2DH8A 4DUZF 1QAJA 3OD2A 4G1PA 1IKWB 1S7IA 4IRDA 2MZSA 3MTKA 3M6XA 4DR6F 1N36F 4OYBA 2YKNB 2AHOB 4EZ6A 4WP9A 2UUCF 2QRRA 4PQAA 3MMCB 3C46A 2D69A 3HXMA 2WONB 1H7XA 2DGTA 1Y5IB 1QSLA 1RAAB 4IQXA 3M2RA 3L7OA 4MTPA 4DX6A 3JQMA 2Z4PA 3ICLA 4PRFA 3IBFB 4DR5J 4WZQA 1XMQJ 4I0WA 2DNQA 3C16B 2KM8C 3PW2A 1PAUB 5F8JA 4J37A 3R7BB 2GHPA 3ZZPA 2B4OA 2IA0A 1PKUA 2B0GA 1UCNA 4DUYF 5C2CA 2BXJA 1AZSB 3TVYA 3CJ8A 2AQ4A 2F8MA 2R7QA 1J5EF 3QRQA 5C24B 4KB7A 4P75A 1X60A 1UVIA 3N01A 4TYBA 1S49A 1UW4A 2OI2A 3I0RB 3QMQA 4KH1B 5I4MA 2J8AA 3UDLA 1D9FA 1RWKB 3M9OB 4IFYB 2I5JB 1UKUA 2C3OA 2MB0B 5IQQA 4ID5B 1KLMA 4X4PA 2C3YA 2OPSA 1RBOB 5AXKA 4B08A 4J9OA 3LGHA 3PHEA 1JLFB 2R7OA 4LFAF 2WBMA 5DQGA 2MJUA 2H5JB 1T03A 4WFYA 3R6LB 4ICLB 3Q8RB 4DSKA 2LVWA 4ED4A 3FBEA 2RRBA 4YB1P 1FTRA 4RNOA 1OSDA 1UTAA 3GFYA 2WCXA 1BQMA 3A8IA 1DTTA 2CZ9A 3G71S 4OI3A 4NA1A 1S10A 5M2PA 3BDEA 1PBUA 2DB1A 3G8SA 2KN4A 1WUUA 3CCJS 4P7VA 5KFPA 1Q0NA 2GMJA 3T5LA 4GRSA 1NZ8A 1NPPA 2HNDB 1JNZB 3NBPB 1UJ6A 2M8HA 1ZZFA 2RRNA 3NS7B 3P3DA 1XNRF 1PIEA 5J2MA 3PJ9A 2G0CA 4QW8A 2RHSB 4BLGA 1XR7A 1NKBA 1HQUA 4DSLA 4OLPA 5BYQA 2VA2A 2H4YB 1TL4A 1M5VC 4OHXA 3VGUA 2AJ1A 2BJ1A 2A3JA 1GTHA 2A18A 2V4JB 3ETOA 1SI9A 3JYTB 3TR5A 4X65J 3MMAA 1FE4A 3I4PA 1WC4A 3W60A 1VLYA 1DRZA 1NPKA 5A8WA 2QLFB 1UEUA 4YUDA 4QU6A 3U27A 3G96A 2MZQA 1PGZA 4ZITA 4M5DA 1MWYA 3GFXA 4ZKAA 4DG1A 2HAIA 3M7VA 2QZ8A 1FKOB 1IKYA 4ERDA 1VQYA 2IJRA 1FRIA 1TTHB 3H40A 5KFHA 1W2IA 2XBPA 3I96A 1LOUA 3BM7A 2K8GA 2ZITA 3I6PA 3BKFA 2HNZB 5GVQA 4M1KA 2HHTA 1SUQA 5JUMA 5D6GA 2PGCA 2P9CA 4OLOA 4U9RA 5DGBA 3T3FA 3DKDA 1NSKL 8AT1B 5K8OA 3B54A 4WE1A 3FGVA 1Z2LA 1WACA 2EXUA 4RZRA 1N5SA 1KEKA 3H2UB 3KJNB 2VQEJ 2LEBA 2AYMA 4FXWA 2KHCA 5DDQC 3EWGA 2YNFB 1EKSA 4H4MA 5FDLA 1P9QC 2HVEA 2MJNA 1TL1A 5D4NA 1ZS6A 4XAKA 1WOSA 1FVQA 2J7UA 2KG1A 1HWKA 2NXEA 1FRJA 4GO5X 2GGPA 2IRYA 3I0SB 2J9DA 1PC5A 2CADA 2FJWA 1SXLA 2MKJA 1N4LA 4CYUB 3LP0B 3V4IB 3KJQB 2AP6A 3BBFA 1B3TA 2GNKA 2IDLA 4WFZA 5D77A 1S1XB 1Y4ZB 4LRDA 3OL7A 1VQ7S 2DK2A 3NXZA 4DR2F 3VZIA 4CLFA 4RBUA 4WBFA 4C7QA 2AJ2A 1SL0A 5DM6Q 3DLJA 2B43A 4B17A 4USIA 1YJTA 3OFEA 1S0NA 1EP4A 4ZCIA 3FEYB 2YX4A 1JK9B 4ZLJA 4RW7A 3P5BP 4DV0F 2IJNA 2ZHOA 1UWBA 1K73T 5J1PA 4C48A 4DR5F 2POKA 1XMQF 2GJIA 3AJ2A 3UD5A 3CDAA 3Q23A 5KFEA 3DXSX 2IM0A 3H42A 4YS2A 4JI4J 4RU2A 3HVTB 2QL7B 3VAKA 3KKFA 2HHQA 1C0TA 5DDOC 4M63A 5MLCV 2IVYA 4UZCA 2VG6A 4MKYA 1XNQJ 3QAEA 2CZ4A 1S9FA 2E29A 5J2NB 4J9KA 3OLAA 4I2QA 4MYTA 5B0EA 2CQPA 1Y00A 4O3OA 1A0OB 2DYAA 4MMOA 3DRSB 4QJVA 2G2OA 1GK8A 1LWFA 1J27A 3HPOA 2CDRB 3HHNB 4DL7A 2ZJRQ 2A6MA 1UFLA 4TQSA 1SJ1A 2G4BA 4KYZA 2GC8A 1RA6A 2KXNB 3Q2SC 1YJ7A 3D0GE 3VAHA 3ENVA 2Q6CA 2FHMA 4UY8T 4HEA9 1U0SA 2KH9A 3CDUA 4FYXB 3EGWB 4RUCA 4ECVA 5L9XA 3KK3B 1UZHA 4DU7A 3FBFA 2ZH1A 3BBBA 2OPPB 4ALZA 3W7BA 5HP1A 2GCFA 4J9LA 3W63A 3NKYA 4X4RA 2P9EA 3UFCX 3KDNA 1L3SA 2B7CB 2R7UA 4YFUA 5GAEU 4QIVA 3X3UA 3H20A 3MM5B 1IBCB 2EPIA 3DLGB 4NA3A 1XERA 2V8GA 2CPYA 5D4LA 3G9CA 3DRPB 4O44B 4NWBA 3GFHA 1A9NB 1VI7A 1HHQA 2BW2A 3CCRS 2BE9B 3KNGA 1RTDB 1I94F 4UOCA 2R7VA 1SPBP 2IA6A 2BOPA 4K4SA 1V6HA 4P2MA 1TKTA 5ETQA 2HFSA 1VK8A 1U6FA 2FB0A 3C2PA 2L48A 2CKWA 2ZKUA 3SI8A 3QJPA 4DPWA 4IDKB 2DPIA 2W9AA 2BABA 1IKXA 2R7WA 1YBAA 2RDJA 5A6WA 3OL8A 1D1UA 1JLGA 1JJCB 4MT1A 4FKXA 3GG0A 4FKYA 1RSCA 1VFJA 3C14A 4DSEA 5D4PA 2VL1A 1U1LA 4EZ9A 3HVWA 3TVZA 2IAJA 3JSMB 5HMXA 1N32F 4IO9Q 2O67A 2V67A 2WOMB 3R6GB 3LALA 4PXBA 3TEGA 1GMUA 2NCKL 5EGYA 1FDBA 1CEZA 3HSZA 3VVUA 2B51A 4R8UA 4BWMA 3TANA 2WW4A 4LREA 3E51A 5KT4A 1FNMA 2HGNA 2C2KB 3X1LB 1XMOJ 1DZ5A 5HLFB 5AJ3J 2P2CB 2DXDA 5KT2A 1RBAA 4RX6A 3MECA 2JEIA 2MZ1A 1QD1A 2EFOA 2I6WA 2C1EB 3BF4A 2K7JA 1NMEB 2W2OP 1YJNS 2ZHBA 1N6QB 4LRCA 2GVDA 2VQEF 2MQ8A 2DEJA 4KFBB 3IS9A 2XYPB 1CJKA 5F9NA 4L74A 2V9KA 4ECSA 2E5GA 2EFNA 4DS5A 3RB6A 4F8RA 3R9LA 1SJFA 1H0HB 3CJ3A 4UT4A 3RTVA 3DGPB 2BYCA 1NK8A 3N28A 3C6TB 4Q43A 1TL7A 5LJ3Y 2W9BA 2BZ2A 2RS8A 3HHEA 3FUYA 3PW4A 3SFGA 4FF4A 4UUXA 4AQYJ 1W26A 2QA2A 3FZ2A 4CO5A 1EARA 3DHWC 1U47A 3NCRA 3OR1A 4HYKA 1FRXA 1KONA 2D3ZA 5K20B 1SQGA 3IM8A 3D67A 4X4SA 2YKMB 3FFIA 1UJ5A 3AA8A 1KFDA 3TAPA 2K1RB 3IMQJ 1EB0A 1K0VA 3NNAA 2Y0BB 4CI0B 2ZJPQ 3N6MA 3CD5A 4ZPTR 3PVXA 2DBBA 3J80Y 3CD0A 4JV1A 3RR7A 4DV3J 4TY9A 3U1LA 4OZ1A 3HM9A 3PHTA 2RQ4A 4OJ3A 1VQNS 5ETOA 3ZNUA 3O2IA 4LRAA 3I55S 2V8HA 4CNZA 4O4GA 3IO1A 4JI4F 2HRUA 4CLYA 3UCGA 1JLAA 1Q7LB 2DNNA 2QTWA 4GVBA 5B09A 4MFBB 4EYHB 1JX4A 4P2FA 1T11A 3AD8C 4NLTA 3CPWR 2EKNA 1IVZA 3DRRB 1OYEA 2HS4A 4NCAA 2MHNA 1YHQS 3L3CA 4I6WA 2QX0A 3BZQA 4UOFA 3MEGA 2V5HG 4OJ1A 3LP2B 2XWXA 3H2VE 2E1PA 4UOHA 1LXJA 2ZFHA 1GMWD 2COLA 1YIJS 4F04B 1RHJB 5CA5A 1LWCA 5KT3A 4UOGA 2HS3A 2Q3PA 1T9UA 2EBGA 1NLKL 5KFUA 3IAM9 1ZTTA 1NK9A 2VBWA 2DHXA 3IP0A 2HK2A 2CPZA 5SZTA 4EO6A 1EX8A 3PTWA 1T05A 2PDAA 4DJBA 4X64F 2B6AA 2PO4A 2CNLB 4ZVSB 1I6JA 1VBKA 3ZTQA 4CTAB 2JSXA 1M1KT 2VG5B 4K2JA 1N5QA 2KZZA 3J7YU 4RW8B 1VR6A 1FHTA 4UZBA 2M8DB 3CCMS 4N41A 2HHPA 3LAMA 3DN9A 4GVLA 1C0UA 3GMGA 1YJUA 2IYGA 1SC1B 1JLQA 1LW2A 1WKKA 3ZNJ1 3CCTA 3M8PA 4DL6A 2DRBA 1BHNA 3DNCA 3LGNA 3VGTA 5A0YA 3G2XA 4AUKA 3OJSA 2HVDA 4HDGA 1XN9A 1FEEA 3A12A 2VFSA 2YQ0A 3UPFA 1PSDA 4R25A 5A8KA 1ZYQA 3CO9A 3LO3A 5CQGA 1NK0A 1REVA 3GJTB 4KJIA 1F60B 2QV6A 4ZVHA 2IMOA 2MGZB 5IT4A 3JQKA 1FXLA 4A8SA 5KT7A 5A2QU 1B7YB 1NZAA 2PN6A 4W4MA 4QWAA 1TVRA 4F4AA 1HL6A 1AT1B 3U1MA 3TWZA 2W24A 1OJ4A 4LSLA 1HBNA 1SCJB 2MZTA 3L9ZA 2X51A 2AWZA 4O23A 2JL9A 2FYXA 3EDRB 1RK8A 1SJ4P 2WRMA 2HFVA 3LAKA 4BBYA 3UN5A 3W1YC 1NK5A 2N7CA 2RVJA 3MM7A 4M5IA 1Q81T 2EK6A 3U02A 2MQLA 2QLBB 1T94A 3EPGA 3ZXWA 2R4FA 4AXJA 3AHPA 1NJIT 1XMOF 1UWAA 4X4UA 2RMLA 3ET6B 4H54A 2MEWA 5J1NA 5DG7A 1TUWA 2MSTA 5GAHU 5EHHA 2OEMA 2BQRA 5F8NA 1NBEB 4JI7F 5BYRA 2NYIA 5L8RC 2V8PA 4YR3A 4DQIA 1IBMF 1NSQA 4WYLA 1WHWA 2CJBA 1FKPB 4GC6A 2CWKA 5DQHA 3NNHA 3FEZA 3BN7A 3D66A 4X84A 3OVBA 4ZVQB 3UCZP 4DDFA 2NZCA 3NWRA 3DI6B 1BY9A 2XZDB 2JFDA 4YY3F 4YP3A 4DSFA 1JJ2R 3QPIA 5IXUA 1U4BA 1DQ9A 1TFYA 3HVAA 4LSNA 3TAMA 4KV8A 1VS3A 4OI4A 3QT7A 2VHGA 1ZTWA 1LWEA 3CIZA 4OHVA 3SCIE 1Q7YT 4AQYF 1KOHA 4F3QA 2ZZTA 2OMOA 2OFHX 4YMEA 1JJ4A 4OYWA 4DV5J 3AQPA 1FFGB 1U7LA 4FYYB 2DO4A 2HIYA 3UR0A 1K1QA 4RNHA 3SCJE 4DCOB 4KO0B 3MMCA 5AE2A 5DDPC 2WVEA 4LRFA 3ISZA 2WVBA 2VC1A 1U6BA 4E98A 2FDNA 3TUJC 5IWAJ 3W9IA 2O01C 3SCLE 5G0RB 1BLUA 4DR4J 1HR0F 4NLPA 1S48A 5CCLA 2OEJA 1Q8BA 5K14B 2XY6A 4ECXA 4LF7F 4K0KJ 1RTIA 4DV3F 2YTCA 1AZSA 1HBUB 3TEHB 1NH7A 4M8LA 4LFCJ 2WK4A 3W9HA 3L4BC 2KYXA 5C24A 3K0JA 1FRLA 3AH6A 3KWMA 3ZTRA 2NZ4A 2NQPA 3I0RA 4JI3J 2JH3A 2UV8G 1U2RA 3MCMA 3VZHA 4F4XA 3D4JA 3GYNA 4IFYA 2I5JA 2V4RA 2DHSA 2V8DA 4ID5A 1BD6A 4DS4A 2J76E 4CP5A 1U49A 4R5PB 1S9GB 2G1HA 3VAMA 3KLHB 2YNHB 1JLBB 4NCGA 4FBUA 3TI0A 4PUOB 1SH2A 1XMBA 2CPXA 3D1OA 3G6XA 1BUXA 2EWHA 3GTYX 2KKHA 1B0PA 2MKSA 4LF2A 2W9CB 3QT5A 2MLZA 1QTMA 4HHHA 3WDOA 1VYAA 4NLYA 3CJTA 4CLPA 1RAOA 3F0NA 1VK3A 2A2DA 2W2NP 4M5HA 2IM1A 1UW9A 1RWNB 1ROFA 4Q0BB 2XNRA 1RWWB 1E6VA 4J9UE 1QVGR 5KOXA 4DL2A 1X4HA 4A47A 3KHLA 2HYIB 2Z2ZA 3DGVA 1FRHA 4F25A 5D0RA 4WKRA 2Q1LA 2HNDA 4P72A 4K4ZA 3OTOF 3KLFB 3RW6A 4WCEQ 2OPRB 1NJYA 1IN0A 2H3EB 3M8QB 1UVNA 4P6QA 2CQ4A 3GP9A 3BSAA 3T9ZA 2XS7A 1TL3A 1ZA2B 2C2MB 1SKUB 1MROB 4ENOA 1KC8T 4L3KA 4PPDA 4HR2A 1S1TB 3ELHA 3JYTA 3FJ2A 4TLRA 4X66J 2BUNA 4FF2A 2DNMA 1RTHB 3KLIA 4L72B 4QZVB 1VQKS 2AIRB 4QPXA 4WP3A 2IYIA 4CIOA 4JI2F 1D8YA 2Z56B 3O6QA 4B3SJ 1FKOA 2ZBRA 4OI6A 5HN0A 2R7SA 4LT6A 5E3CA 4NE9C 2UXCF 2DNPA 4WFAQ 2P9GA 2WSCC 5KFNA 4NZ7A 4CT9A 3KTQA 4LQ3A 4ZP7A 5FD1A 2V4QA 4EYIB 1SC3B 2MQQA 2UUWA 2CQ3A 4CLWA 8RUCA 1Q53A 2G0IA 4XPEA 2CQHA 3IGVA 3RAMA 3T1YJ 2XS2A 2ALZA 3CCWA 2CUYA 1ZM4A 3WIVA 1QSSA 1TKXA 4B9TA 1U1QA 2PMZD 5C42B 3G87A 9RUBA 2BM0A 2YNFA 5KFTA 3H98A 3FCVA 4WXWA 4AL5A 1NHKL 2VB6A 3RBEA 2YQ1A 3T5JA 4KGMA 1N48A 1R7IA 1P1TA 2HSEB 4RW4B 3I0SA 2GQQA 3H25A 3M4XA 5JVHQ 4IG0A 2LKZA 1RT1B 4I6YA 3H5YA 1QAIA 1XWLA 2VPXB 3LP0A 2CPJA 1T3OA 2LQ9A 2DNKA 3TP2A 5DG9A 2OSRA 3L7UA 5D0HA 4QWCA 1S1XA 2NXUA 4PWUA 3LGMA 2KT3A 3FKBA 3DU5A 3N6LA 2X7IA 4A8FA 4CH7A 4YHHF 3NCQA 3EZ5A 4DV5F 3OW2R 2BQ3A 3Q86A 1ZH5A 2XI3A 2YWFA 2RE1A 1R27B 4C8ZA 4ZN3A 1JQGA 2XY5A 4HVZA 1HQUB 4CLZA 2ZOGA 1OY9A 1WSRA 2A6OA 1RHUB 4OZLA 3S8SA 4RW9B 3WZ0A 3CJRA 1H2VZ 4A8KA 1UA1A 1QUVA 2IJFA 2EBEA 3MMAB 3IAS9 4WIIA 4JYAJ 4RNNA 3AJDA 4LR8A 2XNQA 3N9UC 3PW5A 4K0KF 2XYHB 4C8LA 3CIMA 5A8WB 5IC4B 3BN4A 3BGOP 3G4SS 5KFSA 1RT2A 3PACA 1S77D 1GT8A 2B9XA 1NK7A 4LFBF 1U02A 2JWNA 1SJQA 4TU8A 1FKAF 3GCXP 1YITS 3DM2A 5E3AA 5BR8F 3DDKA 4ZIWA 2GX8A 5C25B 3W5XA 2CIMA 1XK8A 4RUAA 4O3QA 3NS6A 1UA0A 2DO0A 3QGPA 3B4MA 1P8GA 3J7AN 5KFLA 4QPTA 2AGPA 2CQBA 3DOKA 2BBEA 4I67A 2YQ3A 4DV6J 4WE1B 2Z2LA 4CLSA 2KFZA 1J2VA 1MMDA 1TV6A 4Y2MA 5DM7Q 5H9FJ 1RTJB 3CMAS 3JAMU 2YWGA 3WHIA 5FDLB 2QA4S 1TL1B 3D68A 4DPOA 4GKJJ 1WG4A 3W9JA 2JJ4D 2B9WA 3J81U 2B7BB 1W2BR 5KFDA 4TVAB 2NSCA 1B99A 2FC8A 3FC9A 2KXFA 3E01A 4RBTA 3RB0A 5HVHA 2XLIA 2DRAA 3UDCA 4W92B 1QY7A 3VWSA 2BMBA 1NJXA 4O44A 2RHQB 4LVOP 2F1FA 3C3LA 2OO4A 4USHA 2WHOA 2P8IA 4PG4A 3W65A 4PAAA 2VDIA 1NXIA 4EO8A 1JMTA 1YTYA 3I56S 5HL7Q 1YJVA 1BQXA 2E5IA 2LEAA 5FLXY 2ZUAA 2N3LA 2MQOA 2U2FA 2OSQA 2JEFA 4NLSA 3A3OB 3EXCX 1H7WA 2VQFF 3AXMA 4LSZB 3ADAC 3PCOB 4PG6A 5IOLA 4IDKA 2VA3A 3BDPA 1V9OA 4Y3CA 4IRKA 1IBKJ 4X66F 4J5OA 4DL5A 1FRKA 5B0GA 1UWBB 3POTA 2FVQA 4DQPA 3MR7A 3W62A 4DV4J 3K57A 3TUIC 4L76A 4DF8A 4DWIA 2EFVA 1AFIA 1OY6A 3QWUA 1N52B 2HBZB 3D6MB 1RT6B 4JI6J 3Q24A 3JQJA 2I0XA 3QJJA 1C0TB 1RYSA 3RJMB 2CNOB 3A4TA 2GMLA 2M2BA 3T1HJ 2AT1B 1BWVA 4DLGA 1RCOB 1SQFA 1X4BA 1VCTA 3CTRA 4WXOA 4RL1A 4JI5F 4WFBQ 4ZMMA 2AKWB 3M9NB 1H2TZ 2V9WA 4DV1F 1NB2A 1LWFB 3I32A 1HI8A 2HS0A 3W5YA 3FSXA 1TP7A 2QGFB 1HNZJ 4F26A 2A0FB 3T1YF 1GXLA 2Z57B 3EZOA 4B9UA 5B08A 2CYYA 4UQGA 4Q45A 9ATCB 1S99A 1S72S 3EZUA 1FTCA 2ZOFA 3PYEA 5GAGI 2APOA 2XO7A 4L73A 1N6QA 3R1HA 2LYVA 2H51B 1HHTP 2ZKTA 3WX8A 6FD1A 2HFZA 4KAIA 3IWNC 1T3NA 1PO6A 4TYAA 2AD9A 4OYPA 3T5HA 2RDDA 2HW3A 3WBZA 1N0UA 2MKHA 2E66A 1KOOA 4ES3A 1NJWA 3DGPA 5IT9U 2DD8S 2FUG9 4O3PA 1D8ZA 4ID8A 1HBMA 4ZVTB 5LOQA 2D3OR 3V6KA 3H4BA 1GXTA 1OIAA 3ZTSA 1C1CB 1S0OA 1RWUA 2FJBB 3OJUA 2Z30B 2FJAB 5F8LA 3KUHA 3FBBA 3DC2A 2ALYB 2YKMA 1AFJA 3G6YA 3UD4P 3RB4A 2DVIA 2RT3A 4C0OC 5J1EB 2XLJA 4F67A 3DHXA 1NO8A 1MSWD 3EX7B 2W01A 3QAUA 4DCJB 1TKTB 4KH0B 2FJVA 2R8GA 4ED0A 2OHDA 2QFJA 2O66A 1OPZA 2WSFC 5IC6B 2HHSA 1SV5B 1IKXB 4F02A 3B78A 2QO3A 3MAAB 2VBXA 4L75A 1JLGB 1LK5A 2HEKA 4UTGA 2XMUA 4IG3A 2XLKA 3C14B 2H54B 1Q4RA 2QA4G 1KP6A 5ETPA 3HSJA 3HJFA 1HWIA 4MKVA 3M8WA 1GAOA 1S97A 3MWBA 4MFBA 1T9WA 2OMLA 1NU4A 3BSNA 1L3UA 5IZHA 3OPKA 3AOAA 3KXDA 1FXRA 1U1NA 5HROB 4F50A 4N5SA 3BPSP 3VAIA 5FJ4A 3W2WB 1FCAA 4JB8B 1VQLS 4JUZA 3LP2A 3MEDA 3EICA 3CJKB 2J0SD 1SL2A 2IMWP 2RKIB 3W5ZA 3MECB 4ED7A 4ED5A 3W61A 5KG3A 1B4SA 2BA9A 1KN6A 3O44A 4E0DA 4B9LA 2YH0A 4ZP6A 1R0CB 2OJ3A 2GHWA 4P52A 2CQDA 4TLQA 3LWLA 5F8IA 3BQ0A 2DIUA 3A1YG 3VV2B 3AB2B 4G1IA 2V2KA 3KUGA 1U0HB 3QSYB 2ZNZA 4WU2A 1NJZA 1GEHA 1BQNB 4M5KA 2GJFA 3RW7A 4RLEA 3OHBA 3HMJG 2UXBJ 3CDEA 1U1OA 4X4OA 3OHAA 1TL7B 2W9BB 3FQKA 1AUDA 2H9ZA 2J7WA 3K5MA 4NLXA 2HWTA 4DR7F 4G65A 2ZBQA 2FLOA 1K8AT 2RQMA 2VKRA 1FDAA 1G7CB 2YWKA 2KHDA 3O5TB 2VZ9A 4P10A 2DH7A 4DR6J 1N36J 4IKAA 3HX9A 3CJSA 2J6SA 2B56A 2RD5C 1RHRB 3ITHB 3ILLA 2V0NA 3FFIB 2MGZA 3K89A 4MK7A 2GO8A 1UFWA 3OTCA 2ZH9A 3BREA 3SFUA 2Z8QA 4K59A 3ULHA 1RAEB 5HMZA 2IY5B 2MLXA 4N8OA 1RHQB 3BQ1A 2AEJA 3PDNA 2XQCA 3QT6A 3MI7X 4N76A 4DUYJ 1NM2A 2QE5A 1TELA 4NYZA 1J5EJ 1WORA 1HIYA 4DEZA 4LF9J 2RUSA 1CBKA 3AA9A 2ASJA 5EDWA 2DITA 3H5UA 2BDPA 2UXDF 2ZOMA 2GA7A 4ZJOA 2J0WA 4YEAA 1JLAB 1RQ0A 3P6YC 3EGVA 2ZC3A 4Q8EA 3ZZOA 3VQTA 1NEEA 2GS8A 3WC2A 2VG7A 1VIXA 4J90A 3PX6A 1VDHA 1KVKA 1MG7A 2R8KA 3ET6A 3D6HB 2OTLS 3HDSA 1Y0HA 4U7CA 3MDFA 4W90B 1WHYA 1NKEA 2CNKB 2HHWA 3MEGB 2UVUA 3MM9B 3R5DA 4LFAJ 1HNZF 2VOPA 4FBTA 1CC7A 2IVMA 2XY7A 2FHKA 1WDDA 2RILA 3G8TA 2MDAA 3TRGA 1WD6A 3SCKE 4EWTA 3GV7B 3GONA 1R89A 3HI9A 2ZZMA 3DI6A 4Z37A 5AXMA 2W7AA 5H9EK 2E44A 1CLFA 2VONA 2B6AB 3K5OA 3BH6B 2BQUA 4G6VB 2MXYA 5I3PA 3ILJA 3IC1A 1KHVA 4JV2A 2WW8A 5HJXA 4GMKA 4Z7CA 2CPIA 2AZ1A 2NXNA 5F9LA 4D3HA 4FPRA 1JLEA 2HHHJ 2FLPA 1JLQB 2XO6A 3ZZTA 5ETVA 1XNRJ 2XZTB 4X4QA 3I5CA 1YJRA 2JEGA 2E5LJ 3UE2A 3TAQA 1NPRA 3AAWB 2K06A 3FRYA 4EFAC 4KO0A 5CXTA 1TUGB 4NLGA 2YNIA 3ZTOA 3BR8A 4BWJA 5G0RA 2DGVA 4ZVOB 2KJWA 1REVB 5DO2A 3J7Z5 1WSVA 1ACMB 1LW0A 3BYPA 2GJ2A 4KHPF 1ITPA 5ETLA 4ILLA 1SIWB 4PPZA 3OQ2A 2YNGB 2CPFA 3OBIA 5LM7E 3VQSA 1S0MA 4B9SA 1ZM9A 3FMWA 2YKOA 3NL0A 3BS9A 1EETB 3CVKA 5LMUF 5IV3A 2RH3A 5AXLA 5CYJA 4IOAQ 3SQGB 4OYXA 2H48B 1IUJA 3SQOP 4U67Q 4TXSA 1WF0A 2XGPA 3US5A 3HJVA 4KIAA 2XMAA 3Q83A 3MPDA 2HNYB 1NCLA 3K5NA 2J0QD 3PRDA 1KBRA 1RWVB 4A48A 4R5PA 3ISNC 1S4FA 4CWBA 5J2QA 4DL0C 1XR5A 4ZVRB 2UZAA 4ES1A 1JLBA 3JB9k 3KUEA 2BRLA 1NUEA 2D3UA 4A46A 3VVTA 4LF5F 4P2SA 3C6UB 5D0EA 4MK8A 2LQ5A 3OR2A 3B6BA 1RISA 2W9CA 4C98A 3DFEA 4EGLA 3OUYB 1RKIA 2ZWPA 2LEPA 3SSSA 1GXUA 4Q7AA 2EG2A 2D74B 4OYMA 5MAOA 3M2VA 4Q0BA 5SUHA 3MCSA 1HQEB 3UNYA 3K17A 3L7PA 5GMKa 1B0VA 5KFMA
chains in the Genus database with same CATH topology
2VFSA 3K5LA 2J9CA 4Y6IA 3UPFA 2DTJA 4PXEA 1DTQB 1PSDA 4R25A 4ZHRA 5A8KA 2CQ1A 4K4XA 1ZYQA 1HWJA 4WF9Q 3CJ0A 4ZS6A 2KYZA 2N7YA 4B3OA 2M5YA 3F73A 1RP5A 3CO9A 3LO3A 4OHWA 5BYSA 1YRTA 4LSNB 5CQGA 1NK0A 1REVA 2IAJB 4KJIA 3GV5B 2E1RA 1F60B 2E1AA 4MAKA 2QV6A 5L9NA 2BANA 2IMOA 3HKWA 4FP9A 4ZVHA 4ZVEA 3TOQA 3M6UA 2MGZB 4UQTA 5IT4A 1JIHA 2XMMA 3RRKA 1TK5A 1LWEB 3KLFA 1X5PA 2NUHA 2L41A 2FVRA 2F9JA 4N47A 2OPRA 1X4AA 5F3TA 1U09A 2Q79A 3S1TA 1FXLA 4A8SA 5KT7A 2AV5A 4NYOA 3V6DB 3M8QA 3OSNA 3D1QA 3OV7A 4B02A 1NZAA 3DRRA 3DLEA 4M94A 2N4CA 4KQZA 2PN6A 3HFKA 3FQLA 4R8UB 4QWAA 1TVRA 1VQ9S 4V19X 1HL6A 1RT7B 2L3MA 3KLGB 3U1MA 5IM0B 3SZ2A 3CCES 2W24A 2JLFA 1YJ9S 4LSLA 1M5OC 2F9DA 2JOQA 5LL6d 1HBNA 4B3TF 3RR8A 2MZTA 3M9MB 1HARA 1S1VA 2X51A 2AWZA 4O23A 1MROA 2JL9A 1TKZB 2IRUA 2KVIA 1TKDA 4NZ6A 1RK8A 2F40A 1S1TA 4OZNA 1SJ4P 2WRMA 2E9ZA 4DL4A 3NGKA 1XTZA 3LAKA 4ITSA 4Q2LA 2W7OA 3EUNA 4QIFA 4XIUA 2YY3A 2JHEA 4BBYA 1P6TA 2J6TA 2L9WA 4BC7A 1NK5A 2N7CA 3KK1A 2FY1A 2RVJA 3MM7A 4FVMA 2X1FA 3D1HA 5E3PA 3GE9A 4DSIA 2DNRA 3GZ7A 4I2PB 1Q81T 2EK6A 1RTHA 5E0OA 3U02A 2MQLA 4CO4A 1HWLA 1T94A 3KMQA 4DV6F 4K2XA 2M7SA 3THPA 1VJWA 3EPGA 2QMWA 1S6PB 3QO9A 3KK2B 1TK0A 1QAXA 3PW7A 1WTFA 2R4FA 1U2FA 4AXJA 3DYAB 2RS2A 2RRAA 1Y5NB 3AHPA 1VOMA 1U24A 4F4WA 3QJLA 5LSRA 3KOAA 1NJIT 5DLFA 1RTIB 1XMOF 4YQWA 2E1CA 2OD4A 4X4UA 2P5VA 5DETA 1F0XA 4PG7A 2C3UA 2RMLA 1YQHA 1O5JA 2AGOA 3IS9B 3PKYA 1MWZA 3D0HE 4H54A 5J1NA 3E2EA 3QIPB 3GILA 5DG7A 1DAXA 1RGVA 2MSTA 3GWCA 5GAHU 1VMBA 5EHHA 2HMIA 4JI1F 4LF9F 2MPUA 3K5PA 4CTAA 1KTQA 1RT5B 1JXLA 2VG5A 1HYSA 4GKJF 4LJMA 4HHJA 3CT9A 4EU0A 2BQRA 5F3ZA 2AYEA 4OZ0A 4ECZA 1URNA 4RW8A 5H1SV 3OFHA 4JI7F 5F8NA 1NKCA 5BYRA 3IG1A 5I3UB 2ZJQQ 3W2VA 2CJKA 4EBDA 3MXHP 5E3QA 3GFZA 2NYIA 5L8RC 3N4WA 2LDYA 2HIQA 4QQBA 4YR3A 4PG8A 1ZM3A 3ISND 3T9NA 5L1KA 4DQIA 1IBMF 1QAYA 3ZZZA 4WYLA 1WHWA 2CJBA 1VQ6S 4TY8A 1FKPB 4GC6A 2FD2A 2BVZA 4C8KA 2Y0SD 5J2PA 5CH7B 2I2YA 5DQHA 1TAUA 3CCZA 3LUYA 3FEZA 3NNHA 3BN7A 4X84A 5CZXA 1FO1A 3OVBA 2KRBA 1U45A 2PE8A 3VF0B 3SV4A 2O1PA 3UCZP 3HVRA 3HKZD 2KTQA 1N56A 4DDFA 5KFRA 4NLOA 3WC0A 4X65F 4JBCA 3DI6B 3I4HX 4EUVA 2OH2A 2ADBA 1BY9A 2JRSA 2JFDA 3MMBB 1YJWS 3SYZA 3MZIA 3PEHA 3MHYA 1TL5A 2XMWA 4YY3F 4YP3A 1N5YB 4RNMA 4LVNP 1HI0P 2D7SA 5IFMA 1U1MA 4OI0A 1DTQA 5FIIA 3OR1B 4I7FB 4ES2A 2KZMA 1HI1A 4NCGB 1KNZA 2UVVA 3N5BA 4DSFA 2CPHA 1JJ2R 3QPIA 2EFGA 5IXUA 2LQJA 1U4BA 1FK9B 1U26A 2AGQA 1DQ9A 4F3MA 1TFYA 3HHKA 3HVAA 4KKOB 4LSNA 3ZZRA 4KTQA 3TAMA 4KV8A 5C42A 2P6SA 1NHUA 1VS3A 3PW0A 4LUBA 4OI4A 1UVMA 1ZTWA 3EGZA 4ZPDA 1LWEA 3GG1A 1LK7A 3NGDA 3CIZA 4OHVA 4HI1A 2N82B 3MMJA 4C8MA 3SCIE 5EWFA 3D0IE 1SKSA 1QJHA 4Q44A 1MU2B 1PILA 4OI2A 4HL9A 5E33A 4KBIA 1Q7YT 4AQYF 1IJFB 4RW4A 1KOHA 4URGA 2QEXS 4DX8H 3TX8A 3CCLS 1FD2A 4F3QA 3U7JA 4Z2XA 2RUGA 3UR3C 2XGQA 4IR1A 2C3MA 3PR4A 2FLLA 1HWUA 2OMOA 2OFHX 4YMEA 1JJ4A 2K3IA 1IBKF 4NCBA 1TUVA 2DGOA 3QIDA 5IM0A 3AQPA 1RT1A 4TQRA 1U7LA 2DO4A 2XSJA 3MM6B 1UEVA 3UR0A 1K1QA 2AYBA 4DV4F 4RNHA 2DNLA 3RBDA 2UUTA 3SCJE 4X4NA 1U8SA 1HBOB 3O3LA 3B4DA 4WYWA 4KO0B 3MMCA 4TKTA 2H5EA 5AE2A 1E6VB 1Q79A 3BB5A 5DDPC 1JLCA 1GQEA 2KI2A 3ISZA 5BJRA 2RQCA 2VC1A 5GADI 2GHVC 1U6BA 4E98A 2FDNA 3C8YA 4PG5A 3TUJC 4LIWA 1M5SA 2PFFB 2O01C 3MFHA 2XG8A 3SCLE 5G0RB 3T6JA 4C8OA 4O4GB 2FGCA 1BLUA 2AJ4A 1HR0F 2MQNA 4I2PA 4JI6F 3M32A 5LMNF 4UY85 2RJZA 2ZH2A 5T14A 4NLPA 1N5VA 1S48A 1RAJA 2DH9A 1L3KA 2FPHX 3JTPA 5CCLA 3EYZA 5KFAA 2GV1A 1Q8BA 3KHRA 3K8VA 5K14B 4K50A 2XY6A 2HHHF 1CQMA 2CQ0A 4PCQA 4UW2A 4ECXA 1S6PA 5CYQA 4CZCA 2FVCA 4TNOA 5M2RA 3V6HA 3DYAA 1YWXA 2LLZA 5F8HA 4QBUA 4A8WA 3T1HF 5E7OB 4FNHA 4LF7F 3A8EA 2Q66A 1RTIA 4DLEA 1S6QA 4DV3F 1HD0A 4MKAA 2E5LF 2YTCA 1N88A 4J9MA 2AW0A 1S0VA 1HBUB 1NH7A 1YGYA 5LSLA 2GW8A 5D8HB 4M8LA 2WK4A 3BO4A 3KG4A 3CC7S 1FRMA 3TYTA 3DCAA 2MY8A 4DSJA 2KYXA 2MHEA 5ITHA 1SC6A 1WG5A 3M6WA 5C24A 3BGLA 4Y00A 2BACA 2YKPA 1TL3B 3AQOA 1RT5A 3T6BA 4DFMA 1JWWA 4X4VA 4DFPA 5K8MA 1FRLA 4WTYA 2ACYA 3AH6A 3KWMA 5B0BA 4ELVA 3K0JA 4RW9A 2ZH4A 4I56A 3IWLA 3E8OA 4K4YA 2NZ4A 4OX6A 2BJDA 2NQPA 4G1QA 3MPWA 3I0RA 1LWCB 2JH3A 5DLGA 2UV8G 1M5PC 1P27B 1U1PA 4Y28C 4DN0A 1KVIA 3BR9A 3K8WA 3BJYA 2BM1A 5KFFA 1U2RA 1FKPA 4ZP9A 4Q5VA 3J7YI 2FHJD 2HPUA 4Q2MA 3VZHA 1T95A 3BGRB 3KLIB 4F4XA 3RU0A 3GYNA 4IFYA 2I5JA 1Z2ZA 4NLQA 2V4RA 4DL3A 1N34F 2DHSA 3SDEB 2V8DA 4ID5A 4CQ1A 5JVGQ 1BD6A 4DS4A 3VAFA 1R31A 3IR5B 2VUGA 4QR1A 4ECYA 2J76E 3HP6A 1U49A 3TNVA 4R5PB 2DR9A 1S9GB 4V19J 4O0IA 2XHWA 2R8HA 4D3GA 3MMBA 2IBOA 3VAMA 1Q82T 3M6VA 3GIKA 4DHVA 5L1IA 2JLGA 2VH7A 3I31A 1T05B 2MSSA 3KLHB 2ZD1B 1UP1A 2YNHB 3ONQA 4I7FA 4G3IA 1JLBB 2R7TA 4NCGA 5DDRC 3DU6A 5KFJA 2DR7A 4FBUA 4TN2A 1Y9OA 3TI0A 4PUOB 1SH2A 2LU2A 5A2QY