3IRWP

Structure of a c-di-gmp riboswitch from v. cholerae
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
90
structure length
90
Chain Sequence
RPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U1 small nuclear ribonucleoprotein A
publication title Structural basis of ligand binding by a c-di-GMP riboswitch.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein/rna
total genus 22
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2009-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3irwP00
3BO3A 3VALA 3JB9k 1R8HA 3I56S 1ZZFA 2MMYA 1FJEB 3B4MA 5LSLA 1U1LA 2RNEA 2DGVA 4TLQA 3UD3P 2DHXA 2NZ4A 2AYBA 1VQ4S 1HA1A 1YJNS 2DK2A 3J7ZT 1JJ4A 2O3DA 4ED5A 2VOPA 4EGLA 2CPJA 2CQDA 2KXHA 2YH0A 4WFAQ 2G4BA 2N7CA 4IOAQ 2JX2A 2DB1A 1JMTA 2MZTA 3BEGB 1KC8T 2DHAA 2CPXA 1HD0A 2LEAA 5LXRA 2LEBA 2DGWA 1WHWA 2OSRA 1QVGR 1B7FA 5D77A 2MKJA 2E5JA 2M8HA 2LCWA 5GAHU 4J5OA 3MUVP 2AYGA 3P6YC 4QQBA 3NMRA 3CCVS 3UCUP 2D9PA 4V19X 1L3KA 3VAGA 1FJ7A 3MUTP 1YJ9S 2YH1A 1U1OA 3VAFA 4UQTA 4CIOA 2FPHX 2J0QD 4LIRA 4PRFA 3MD1A 3VAMA 1WEXA 1X4CA 1OWXA 2MY7A 2DNOA 4ERDA 3DLLQ 3Q2SC 3CCLS 2CQBA 4WIIA 2G0CA 2KG0A 4FXWA 2CQ1A 5DETA 2LYVA 3EX7B 1VQ6S 2X1FA 2OTJS 3U1MA 2L41A 1RKJA 1UW4A 1D8ZA 2VONA 1WHVA 1WG4A 2OIHA 2MSTA 2K8GA 1VBZA 2MXYA 2JRSA 2M9KA 2M4MA 2N3OA 1JJHA 2RS8A 2FC8A 3D2WA 1NJIT 1VC6A 2DGOA 5IM0B 2M70A 3CCES 4CQ1A 2LQ5A 1PO6A 2J76E 2D3OR 4WKRA 4Y0FA 2DNNA 2WBRA 3R1LA 3J7YU 2EVZA 2CQPA 1IQTA 2MZ1A 2RVJA 1P1TA 3R27A 1G2EA 3MURP 1Q81T 1ZH5A 1WHXA 4C7QA 1URNA 1NO8A 2CQHA 2KVIA 4IUFA 3K0JA 1RK8A 4IO9Q 3IWNC 1AUDA 2LA6A 2DIVA 4C4WA 2DO0A 1K8AT 2MGZB 1R8PA 1U1KA 2SXLA 2CPIA 2RT3A 2HGNA 2ADCA 2CPEA 2LXIA 1QM9A 2KH9A 2XNQA 2RUGA 5CXTA 3SDEB 1VBYA 1SJ3P 2CQCA 2OTLS 5DDRC 2MQMA 1M5KC 2MZQA 2YTCA 2X1BA 4TU9A 2RRBA 2MQNA 3MI7X 3R1HA 1YTYA 4WFBQ 2PEHA 5DM6Q 5HO4A 4CH1A 3CUNA 3TO8A 1OO0B 2M0GB 1VQKS 3VAKA 1X5SA 2MZJA 2F9JA 2U1AA 5FJ4A 2DNYA 1Q82T 3P3DA 1VC0A 1VQPS 3NNCA 1VQMS 1X4GA 2AD9A 2M8DB 3DXBA 2XSFA 2KYXA 4PKDB 1X4HA 1NU4A 4LMZA 1N88A 5MLCV 3BO4A 1W2BR 3RW6A 4C0OC 2DNGA 3VAHA 3US5A 2MKCA 3VAIA 2DGXA 1KOOA 2BOPA 5CYJA 1DBDA 4TU8A 2AYMA 2KG1A 3ZZZA 2RU3A 2MQOA 2F9DA 3UE2A 1UAWA 2MKKA 3PIOQ 2KFYA 2ZJPQ 3CULA 2ZJRQ 1X0FA 5DM7Q 3P49B 2PE8A 2KN4A 3BO2A 4U67Q 2KI2A 3S8SA 3NNAA 3UD4P 1X4BA 2HZCA 5LJ3Y 3CCMS 1FHTA 1U6FA 2MKIA 1WI6A 1DHMA 3LQVA 5GMKa 4WCEQ 1X5TA 3HHNB 2MJNA 5DDQC 1FO1A 3NS5A 1X4FA 2DH9A 2CPHA 2DH7A 1HD1A 3MDFA 3OW2R 1VQLS 3CMES 1VQ7S 1A7GE 3TYTA 2XB2D 1QVFR 2VODA 4W90B 1JJ2R 2KM8B 2J0SD 1WF0A 4WFNQ 3P5TL 2OJ3A 1WF2A 2KRRA 2G1DA 1SJRA 1WG1A 2E44A 1UFWA 1OIAA 5JVHQ 2XS2A 2HGLA 1WI8A 2U2FA 2JVOA 1WF1A 3CCJS 2DGTA 4LJMA 2MKHA 2I38A 3FEXB 5H1SV 3NNHA 2NLWA 4TU7A 2MZSA 2MPUA 3UCGA 2CQ3A 1KOHA 2M88A 2KRBA 2KM8C 1N8RT 2MHNA 2B0GA 4QPTA 3BS9A 3G96A 2DNZA 3G71S 3G8SA 3U1LA 2ADBA 2DNMA 2EK1A 2DH8A 4ZKAA 3CPWR 3V4MA 3CC2S 1X4DA 1H2TZ 5D78A 3RW7A 3HI9A 2DNKA 1YHQS 4YB1P 1D9AA 1FJCA 2OSQA 1SJQA 1U6BA 1H2UX 1P27B 1WEYA 2LA4A 2KXFA 2V94A 1YJWS 5GAGU 1M5VC 2MSSA 5LJ5Y 2X1AA 2QEXS 2DNLA 2DNHA 3CXCR 1WELA 2DNQA 4Y00A 1X4EA 4FXVA 3L3CA 1S72S 1Q86T 2E5IA 2I2YA 3SXLA 1WWHA 4UY8T 2KXNB 2BZ2A 1FXLA 2MQLA 3THTA 2DHGA 1K73T 2F3JA 1X4AA 3CMAS 2DGUA 2CPYA 1KD1T 3CCSS 4QU7A 2LMIA 4RU2A 2CJKA 2CPDA 1U1RA 2L08A 1U1PA 2DITA 1YIJS 2HYIB 2CQ4A 1SXLA 4YOEA 1A9NB 2GO9A 2CQIA 1VQ9S 4F02A 5DDOC 2ERRA 2X1GA 2HGMA 1FNXH 3UWTA 2RQCA 3S7RA 4F26A 4F25A 3G9CA 3ZZYA 5JVGQ 3CF5Q 1U1QA 2K3KA 1SJFA 1U1MA 1M90T 4QU6A 1X5OA 3THPA 2EK6A 2E5HA 4CH0S 1H6KX 5DDPC 1N54B 2M52A 2DGQA 2JWNA 4WF9Q 2L9WA 2KU7A 1DRZA 3B4DA 1U1NA 2DHSA 1DZ5A 3MXHP 3H2VE 3S01A 1OPIA 3G8TA 3MUMP 3EGZA 5GAEU 2XNRA 3CCQS 2KHCA 2LXUA 3ULHA 1VQ8S 1CVJA 4OZ1A 3S6EA 1VC5A 3CD6S 2Q79A 3CC7S 1O0PA 5CA5A 1VQNS 3Q2TC 2CQ2A 2DGSA 5BJRA 1SJ4P 2KT5A 2LKZA 3CTRA 2VOOA 3H2UB 5IM0A 2DNPA 2MJUA 5IQQA 4YUDA 5EN1A 2JVRA 2LECA 1PGZA 3MOJB 2CPFA 2RQ4A 2E5GA 2M7SA 4PR6A 3I55S 1M5OC 3CCRS 2UP1A 1YI2S 1VQ5S 1N52B 4A8XA 5ITHA 2M2BA 3LPYA 4IOCQ 2HVZA 2ZJQQ 2RRAA 5HL7Q 2RS2A 1XN9A 1FT8A 3TP2A 1Q7YT 2N82B 4P6QA 1ZZNA 1K9MT 1UP1A 2FHOB 2MGZA 3G6ES 4W92B 2N3LA 5GADU 3G4SS 1U2FA 2DNRA 1X5PA 3SMZA 3PIPQ 1YWXA 3IRWP 1VBXA 3FEYB 4Z2XA 5LXYA 2MQQA 2XS5A 2A3JA 3SDEA 3CCUS 2DISA 2FY1A 1WHYA 3MD3A 2QFJA 2MZRA 3CC4S 1VQOS 1WEZA 2GHPA 2XS7A 3UCZP 2YWKA 2FC9A 1BY9A 2YKAA 1YITS 2D9OA 1F9FA 2J8AA 5GVQA 4OZ0A 2AYEA 1HL6A 3NS6A 1S79A 4M5DB 1M1KT 2MKSA 2MB0B 2CPZA 4BS2A 2CQ0A 2MY8A 1M5PC 1H2VZ 2QA4S 3VAJA 3VF0B 2DIUA 2CQGA 2MQPA 3EGNA 2MYFA 3N9UC 1WTBA 1KQSR 5LSOA 1WG5A 5IFMA 2DO4A
chains in the Genus database with same CATH superfamily
2H5IB 2EKYA 4NCBA 3DOLA 2MEWA 3EPGA 1WOPA 1YJNS 2DEJA 1TVRA 3SV3A 1EIYB 3GR1A 2VOPA 1K1SA 3BH7B 5D4PA 4R0EA 3N01A 2JX2A 3C19A 2OD4A 4RU9A 3W2VA 2BQ3A 5DG8A 2QL5B 2W4CA 4NCGB 2I9SA 2HFZA 1Q79A 2NZCA 2LCWA 4OFZA 4KB7A 2V2ZA 4QQBA 2O67A 1ZBTA 4USIA 2XZDB 2POKA 1TKZB 1FD8A 1YVFA 2XULA 4ZVSB 2ZNYA 3CO0P 1NSAA 4I68A 3FBEA 3JQMA 1R0BG 4M5MA 3R5CA 3EM1A 3PW0A 5GADI 2HMIB 2XTJP 4IRKA 3U02A 3BH6B 3KTQA 3PRDA 3LANA 4R5PB 1FERA 1LK7A 4DUZJ 3NMAA 3M05A 1U09A 1VBZA 1VCTA 4IDKA 1CG2A 3ENVA 4N5SA 2HVEA 2UUAJ 3R8YA 1S6PB 4B9UA 3KLFB 4NLWA 4QIVA 4ZCMA 1YKWA 1RK8A 4ED7A 4A8SA 1AB8A 4DSEA 2VBWA 5AE1A 2V9WA 4U7UK 4DR3F 1Y9OA 1TKTB 1W7WA 1B0VA 1CJKA 4DPUA 1VK8A 4N56A 4MKAA 4DV2F 3Q0AA 1OMSA 2P6SA 3IBWA 3GCXP 4KIAA 4RW7B 2GV1A 4LF6J 2KO1A 1RADB 4XK8C 1X5SA 4ED3A 4IFYA 3HKWA 4DLGA 3QGIA 1IKXA 4ZHRA 1AFJA 2PA8D 3PJ9A 3FUYA 2E9TA 5IT9U 2H5JB 4PKDB 5J2MA 2WK4A 3RW6A 4M8LA 2IDEA 3KLEA 3DGPB 3VAIA 1TL7A 4PG5A 3CD5A 1FWLA 3BPSP 1WKLA 2KZMA 1EQ0A 1NH8A 1FJGJ 1RHJB 3QATA 3PO4A 3HMJG 1URRA 3NGSA 4UTGA 1CEZA 3EPIA 1N5YB 2OPSB 1VQLS 1TL1B 1VQ7S 3R7BB 1HPZA 3E2EA 2HZAA 4BWJA 4NLDA 1OIAA 1TMMA 4HDGA 4P74A 5H1SV 1T03A 2H51B 1UEVA 1ZAWA 4UZBA 4TU7A 2WHOA 4OJ1A 4OI3A 2KRBA 2IA6A 3V81A 1S1TA 3HVTB 2VJVA 2HAFA 4GVBB 1TL3A 2R8IA 4ICLB 2RHQB 5L9NA 5FDLB 2AT1B 5LM7E 2P2CB 2YBVA 5CYMA 4OI4A 4CTAA 4J9UE 5IT9Y 3LGHA 3UW1A 2I2YA 1MWQA 3LTOA 2YQ0A 5DJBA 1EZZB 3TI0A 2DHHA 4OX6A 1MWZA 4RJVA 2RILA 3D3BJ 2DPIA 1PBUA 1N4LA 1U1RA 1Q0NA 3FMBA 2EG1A 5CZVA 2CZVC 3F0NA 4LR7A 1SH2A 1BQMA 1XIQA 4ANCA 5IWAF 3DDIA 5D3GB 1RAHB 3CF5Q 4I7FA 1U1MA 2B9WA 4ZVRB 3OVBA 4Y34A 5KT3A 2L9WA 4J7CA 1N6QB 1FRKA 2YKMB 2PFDA 3IAS9 2PT0A 4O44A 4OLOA 3K59A 3OSNA 5GAEU 1YBAA 5BXIA 2XNRA 4MK7A 3DRSA 2B4VA 4LF2A 2COLA 4G1QA 1GNKA 2XLIA 2VL1A 4UF4A 2KT5A 5CHCB 4Y2AA 4NZ7A 1HI8A 1JXVA 2E5GA 2HLTA 1RA6A 2WW8A 5A8KA 1KQGB 1N52B 3LWLA 4A8QA 1VJQA 1NJXA 5B0CA 1X5PA 1F0XA 1Y4ZB 4OMFG 3SZ2A 1NBEB 1HR0J 1GXTA 3I87A 5ETMA 1J2VA 2D9OA 1TL4A 3DLBA 2ROGA 4NLSA 1CC8A 4EMDA 4I1TA 2MTLA 3N9UC 1WTBA 3UDLA 4USVA 2OH2A 4ZVHA 5G0RB 2V2QA 2HEKA 2RH3A 5LSLA 4HVZA 1GQEA 5B0DA 4QZVB 4OZLA 3ZZRA 1B64A 2XWXA 1IJEB 4NXNJ 4DX7A 5KFRA 2K06A 5DG9A 1HARA 3M1VB 2MZTA 3DRRA 3W5XA 1RTHA 1X60A 2HHWA 3BPDA 3VVUA 4XIUA 1UWBB 3MR3A 1VJWA 3OJUA 4C11A 3V2UC 4V19J 2YNGB 5A2QY 5HI7A 4Y2MA 3EWGA 3OL8A 1D1UA 2ZVIA 4PAAA 1JXEA 3SCKE 4OIXA 4AQYJ 2XEXA 2DPJA 1UW4A 5KFWA 5DO2A 4BWMA 4OHVA 3D2WA 4P7TA 2RKIA 4EO6A 3SQGA 5AE3A 2WBRA 1GK8A 4X4TA 3MPYA 4DR1J 3OUYB 4ED8A 2KFNA 2M3DA 1XK8A 4M5GA 1AUDA 2SXLA 4UZCA 4JV5F 1JLGB 2YQ1A 1HQ2A 1T3NA 2CWKA 3SIPB 5L1JA 2C2ZB 1RAJA 2GMLA 3IS9B 1Q95G 4ED2A 4DZDA 4ECQA 2AJ4A 2MQNA 2WONB 2XMUA 4LBPA 3LOUA 3J81j 1FKPA 4FF2A 1Q82T 4WFXA 2JLGA 3FBCA 2E7WA 4BCAA 4WXWA 1C0TB 4NX9A 2HKEA 2AD9A 2W24A 1FXDA 1V9OA 2Z56B 3MEKA 1YJTA 3TANA 1L3UA 3G82A 2A1BA 5CYJA 3I31A 3MWBA 3HHKA 1DBDA 2NXNA 2IA0A 2MQOA 1UAWA 4USTA 3M6WA 4EEYA 3UFCX 2FIUA 3NCPA 3M8QB 1QD1A 1X5TA 5I3QA 4J9VA 4DR7J 3G86A 1A7GE 4A8YA 1S99A 1N56A 4KGVB 2J0SD 3P5TL 3WHIA 5F8GA 4MTPA 4RNMA 4Q0BB 1HHSA 2AX0A 4AL5A 2HPUA 4DR5F 3AA9A 1EB0A 3MAAB 4CT8A 3IGVA 2HS4A 3BS9A 3AT1B 4P2XA 5B0AA 4CP5A 2R7WA 3OL6A 1HNWF 2EBEA 1TKDA 3BSAA 2YKOA 4C0HA 2E5LF 3MFHA 2VU5A 4BC9A 1DFDA 3GYXB 3RB6A 4LSZB 5DGBA 3UVJB 1K73T 3Q8YA 4KKOB 1NK4A 4LRFA 4F50A 5D0RA 2CZ4A 4CLPA 4NCGA 4BDPA 2V4QA 2GX8A 4ZVUB 4CLKA 2ZM6F 4K4WA 2OMLA 2K3IA 3BDEA 2GJ2A 1TKZA 5DRKA 3NOCA 3PYFA 2W7AA 1ZPWX 1U8SA 5JMNA 3BSNA 3KDOA 2R7TA 1E6YA 2HMIA 3DC2A 3I6PA 2A18A 4DQIA 3CJTA 1ZA1B 4CNYA 2IJFA 1APSA 3QAUA 4WJBA 5DZ6A 4OZJA 2KHCA 3PJWA 3MM6A 3CJKB 2DKOB 2VFVA 2Q79A 4CO5A 3ADAC 3AOAA 2CQ2A 4L6V3 3CTRA 2DR9A 3TW0A 1XR7A 3ILIA 4OJ3A 3Q83A 2VASA 3KLFA 3JAMU 1CQNA 2RRAA 3TP2A 1K9MT 4P6QA 1FRXA 4Q7AA 1JQGA 4G6VB 4FBUA 3PIPQ 4LF1A 1RWKB 1TKTA 3SFGA 3D6HB 4KHPF 4ELTA 4RO0A 4P7VA 3U27A 4JI3F 4TLRA 1ZA2B 4RW7A 4YB5A 1I5OB 3WC0A 1KVIA 3PXGa 4F3QA 1Y5LB 2AKWB 4NLVA 4LF9J 2CVEA 3LP2A 2V9KA 2UVWA 1NSQA 2X3DA 1RABB 4ECVA 2NZ4A 3ZZUA 2BMBA 1BXNA 1R0AB 4DL0C 3JSBA 4WTYA 3G8QA 2F8EX 2B9YA 2FJEB 3BEGB 1KC8T 2ZH7A 3A8KA 3EZ5A 1N5YA 2KJWA 2OPSA 3C3LA 1TL1A 1UEKA 2E9ZA 1YJ9S 2NCKL 2FD2A 3G87A 4DSIA 3VAFA 4CIOA 4EBDA 3JAMY 3Q2SC 2QSFA 4LSLA 3DCAA 3TUZC 4PXBA 1RACB 4XDDA 3V5RA 2MXYA 2M9KA 2RS8A 2P9GA 3HVTA 5HSPA 3CCTA 2VJUA 3GV5B 4GVBA 3R1LA 3GFZA 2MZ1A 3EICA 2BKNA 4LF5F 3CDAA 4ICLA 4D3GA 5FDLA 4P73A 4QBUA 4UOFA 2Y0SD 4UOHA 2B6AB 7FDRA 2D41A 2JOQA 2KTQA 3FFIA 2ZH9A 4MFBA 5JXSA 5DDRC 5D4NA 3VWSA 5CD4H 4QPXA 4Y3CA 3K89A 3O3LA 3PV8A 4WFBQ 3QIDA 3FQKA 5F0UA 2L9DA 5EDWA 5F8HA 3GIRA 2M0GB 1T0TV 4ZPVR 2BQUA 2Y3YA 4AE5A 5D3GA 2ZOGA 1WC3A 2MQ8A 5T14A 4DCJB 1M1HA 2XI3A 4OX9J 1N6QA 1U0HB 4YB6A 2PDAA 3N28A 4PQAA 2LQJA 1NK9A 2G1HA 3R5GA 3QNWB 3NS5A 2CPHA 2DH7A 4DUYJ 4Z37A 1N5QA 4WXOA 2B3TB 2XMTA 4F2RA 3M30A 5CD4A 5I42A 2UVVA 1Q8IA 4XDCA 3M7VA 3H90A 1HI1A 5GMEA 3R9LA 1RAIB 1RP5A 4C8KA 4HKQA 1T94A 4DSLA 4X2BA 1R6VA 1RUSA 3HCXA 3MGJA 4OX7A 2DNZA 2QC3A 3Q22A 4M5KA 4JI2J 3BR8A 3MTJA 3RG6A 1D9AA 2XLJA 2CG8A 3BBBA 4JOUA 5G0RA 1FDDA 5DLFA 2WVBA 2LVWA 2HFOA 2KL8A 5CQGA 1BC6A 2ZE2B 3I5BA 3M1VA 1C4CA 2B8PA 1YJ7A 2CPYA 4O0IA 1FEHA 1RT4A 4AUKA 2HQFA 2DITA 1SXLA 4U95A 2CXEA 2GO9A 4F02A 5LOQA 1UWBA 4JV0A 2GS8A 1FNXH 4KGMA 4HL9A 1IBLF 2IMOA 1S0OA 3T9ZA 3FSXA 3ENAA 3MM9B 2IM3A 3LP0B 2YNGA 3SEOA 5LSRA 1YZ7A 3PFOA 1U1NA 1TELA 3M2VB 3MFIA 3M2RA 2DVIA 1UEUA 1JWWA 4USWA 3TOQA 2A6MA 1FNMA 5E41A 1PGZA 4PR6A 4DCPB 3OUYA 4WKYA 2LDYA 2LQ9A 3TQ1A 2ZH5A 4LF4F 3SI8A 2OGUA 2RDDA 2FHOB 5F9LA 5ETQA 2VC1A 3F41A 1JLGA 1RYSA 1S0NA 1HW9A 3FEZA 2A10A 2DR5A 3BBFA 4PUOB 2WRMA 4QIFA 2H48B 3CIZA 2WONA 4K4ZA 1FESA 4DL2A 2FGOA 4B3TF 1W26A 3RBEA 1C0TA 4YDDB 3B4MA 2I0XA 1IKWB 2DHXA 2R42A 3CDEA 4ZN3A 3IGNA 5J1PA 2DK2A 2XY6A 1G4CA 2IIHA 4I6WA 3TJ9A 3U7JA 1CQMA 3CD7A 5GMDA 3E51A 2KXHA 3NBPB 2BVZA 4YDXA 1QE1A 4KPCA 3MR7A 3HSJA 5HROB 3M8QA 1HI0P 5AXLA 3SCLE 1P6TA 3C2PA 2XYGB 1L3KA 4USUA 1Y11A 1UW9A 1T9TA 3CVKA 4PG8A 4KR0B 4ZP9A 3ZZPA 4G65A 1S9EA 5JUMA 4KO0B 3MAAA 3M6VA 3FQLA 1D8ZA 3D54A 2K8GA 4N47A 2B51A 2OELA 1VC6A 1PO6A 2VKZG 2D3OR 4Y0FA 2HRUA 2W1BA 2AP6A 4DR3J 2AZ3A 2CZ9A 4U7UD 3TZYA 3RAMA 1YLXA 4DV2J 3CE8A 4HACB 5HP1B 4X65F 2UVRA 4ILMA 4HI2A 3B6BA 1LNQA 2MLZA 2KH9A 1U48A 1VBYA 2ZOMA 3UVJA 5CH7B 3OTCA 3GIMA 4KKOA 4F4WA 2HHHF 1RTIB 1YTYA 3R1HA 4EFAC 2PMZD 6AT1B 3I96A 4I0WA 5HO4A 1GX5A 3OFEA 2NS1B 4YQWA 2VFTA 3NGUA 3N5FA 3DLGB 4LMZA 4NMLA 1W2BR 4NLPA 3US5A 3EXYA 4URGA 1F9HA 4M5NA 4DSJA 3UI3A 3BO2A 3CJKA 4DX5A 1S7HA 2HZVA 4RKUC 4K7QA 3UR3C 5DDQC 2CJQA 5F9NA 5EWEA 1FO1A 3T5LA 2AJ0A 4OZ3A 3TYTA 3D6MB 2DY1A 3EVMA 2QLFB 3GFHA 3NXZA 2JFKA 1NDCA 4IG3B 4C8LA 4HI1A 4L73A 2XS2A 4A8OA 4OX8A 4LJMA 3VZIA 5FLXU 3OFGA 2NLWA 2W2MP 3N0VA 2IYIA 1FDNA 3OT9A 3GV7B 5KFLA 3J7AN 3EVOA 4GO7X 3TUPA 1U25A 2ADBA 2DNMA 2XWYA 1KR4A 4ZKAA 3DI6B 3FDSA 3N6NA 1RTJB 3HI9A 4YB1P 2IHR1 3OFHA 4CDIA 5J1EB 4ZA1A 2AHOB 2MSSA 4P10A 4Y00A 2WOMB 4HHJA 2QSWA 1R0AA 2BZ2A 4JYAF 4FVCA 4DI6A 1X9SA 3W9JA 3QSYB 3OQ2A 2HWHA 2YX1A 2CJKA 3C66A 2L08A 1U1PA 2CNKB 1PYSB 4GC6A 1UCNA 3QRQA 1DTTB 3ZXWA 3V4IB 4X84A 4A8WA 4IFVA 1IKYB 3UNGC 2VH7A 2E7XA 1U1QA 1M90T 1KRPA 4GMKA 1OY8A 4R8UB 3X3UA 3G8TA 1XNQJ 3PX4A 2D74B 1FRJA 4B3RF 5FLXY 4G3IA 4KGZB 3GFYA 1UVJA 3KLHA 2ZWPA 1UJ4A 2XG8A 2RDJA 1DURA 4DSKA 4L74A 1YI2S 4LFBJ 5ITHA 2ZJQQ 2R2UA 1NKCA 2BJ9A 2VPZB 3GZ7A 2B6AA 3R97A 2J0XA 1XBWA 3IRWP 1S59A 3AA8A 5KFPA 3C46A 3ITHB 4FF4A 3TX8A 2AGQA 3D1HA 2RD5C 2YKAA 4NL5A 2J8AA 4JV2A 1Z2LA 1DAXA 1SUQB 2QL7B 1M5SA 4IH5A 3VF0B 2CQGA 5LSOA 2KVQE 5KFAA 2BACA 1UVLA 1S6QB 1R8HA 2DTJA 4DCOB 2RNEA 4NPOA 1KONA 2AYBA 2JEFA 2ILZA 3SYZA 4AL6A 3GPAA 4ZP6A 4J91A 1SH3A 1U0HA 1CPZA 2CQDA 2K1RA 3KUEA 3MM7B 2DHAA 1RU2A 4DS5A 3Q23A 1SV5B 1JLAB 5C2GA 4DPOA 1RTZA 1R27B 3M4XA 5T41A 2E5JA 4FKYA 3P8BB 2FYXA 4WP8A 4V19X 2ZBRA 3UN5A 1IUJA 4C9DA 4RUAA 2OMOA 2RSQA 3IRXB 2XO7A 3EGVA 1X4CA 1HNVB 3J7Z5 3ZZTA 3ILLA 2HQDA 2OPPA 2FHKA 2B7CB 3LO3A 4KSEB 4U96A 2QZ8A 1VS3A 5F8JA 2EXUA 1WHVA 3MEDB 1JLQA 4ZJLA 5KTQA 4J9SA 3RRKA 2M4MA 2IJRA 3LALA 4WKRA 1IWAA 2IAJB 1P1TA 3LW5C 3MR6A 2PO4A 3DXSX 2KVIA 1RWNB 3NY0A 2R7VA 1IBMF 4B3SF 4K4VA 2UZAA 2AU0A 3IWNC 1BQNB 3RBXA 1DJ0A 3K8WA 2Z2ZA 1V6HA 4ZPTR 1RT3B 1QM9A 2C2RA 2Y1JA 3WIVA 2CQCA 2ZBIA 2FVSA 1M5KC 1K47A 4KQZA 4J9QA 2RRBA 2HWIA 4I69A 4K0KJ 4WK3A 4DL5A 3KWMA 3CDBA 5DM6Q 3FKBA 1FRMA 2BJ1A 2P5VA 1OO0B 4K4YA 1U4BA 1SKUB 4G1IA 2UXCF 1CULB 2YNIB 1BWEA 3MM9A 1RWUA 3TAMB 2G2YA 3P45B 4DV0J 3QT7A 1FRIA 2IM0A 4Z7YA 2ZHOA 3JYTB 3LA0A 2UXBF 4YY3F 1PYOB 3AB2B 2CFXA 3LQVA 3HHNB 1CJVB 2ILYA 4C3LA 3Q8SB 4TNOA 3J7YI 1X4FA 5D4OA 2DH9A 5IT4A 4YS2A 4B9NA 2XB2D 1FDBA 4PCQA 3AB4B 4C3KA 2FVCA 1RT2B 1RZMA 5JVHQ 1VHFA 3TEGA 1WF1A 2DGTA 3VHQA 3JXOA 2QLJB 1C1BB 2B4PA 2HIYA 3I0SB 4OYBA 1HNWJ 2GJIA 2Y0BB 3ONQA 3KLVA 4PUOA 4QPTA 5E3RA 1VOMA 1WD6A 2CAJA 1HBMB 2QFIA 4K50A 4PG6A 1N5VA 1Y10A 4DBQA 3G6YA 2E5LJ 3CC2S 5D78A 4QR1A 2J9DE 4WTOB 2FLPA 3R5AA 1AA1B 1FJCA 4DN9A 2QTWA 2HS3A 4ES1A 4B9TA 1RHMB 2H3EB 3HM9A 2AF6A 1IKWA 5HATA 2WVDA 1FXLA 2FVPA 3W5YA 2ZM6J 4P2FA 5L46A 2F3JA 2UUBF 5J1NA 3PY8A 4RBUA 2EC2A 4JI6F 1S6OA 4RU2A 4I56A 2XY5A 4OYIA 1NDLA 5HROA 2CQ4A 4X4OA 4JI4F 4F2SA 2X51A 3S7RA 5T7LB 2EBGA 3HD2A 2W4PA 3Q8VA 3B4DA 5AXNA 4RZRA 1E6VB 2ZHAA 3O44A 3RUBL 4OYXA 2HHXA 3IM9A 3OL7A 4PWWA 2LKZA 4DS4A 4MKVA 2EFGA 2GVZB 3LGNA 3VGUA 3KFWX 4ZLLA 1SC4B 5F0WA 3JTOA 1V3SA 4KHPJ 2ZZTA 2M2BA 4ZOSA 2EPIA 2P9CA 3KHLA 5HL7Q 2GMHA 5HP1A 1UP1A 4JI3J 2EWHA 5A8RB 3FEYB 1AT1B 2MQQA 4X64F 2XS5A 2B43A 3CCUS 4WPAA 1PILA 3O5TB 3K5LA 1RTIA 2AW0A 3TJAA 1SPBP 4BS2A 3I5AA 4FYVB 2BJDA 2YX7A 4I6YA 5K8OA 3DLGA 3H7HB 1PJ5A 5F8LA 3E01B 4CI0B 4OZ2A 1I6JA 3PKMA 3UPFA 3FJ2A 3NEKA 2CA9A 3HHLC 1IR1A 2YH0A 2G4BA 1S76D 2YWFA 1Y7PA 1YBUA 1N32F 1MG7A 2P8IA 1R0CB 3HT3A 5IV4A 4DZ6A 3QJPA 4RW8B 4NYPA 1YSJA 2HBQB 2YXLA 3MUTP 2YH1A 4MYUA 1VHIA 3I82A 4USJC 4LIRA 4WP3A 4PRFA 4IG3A 2BABA 4ERDA 4WIIA 2V8HA 1PC5A 2LYVA 2X1FA 3IR6B 4ZP7A 1F60B 2R8JA 1C1CA 5IS2A 2JRSA 1CJUB 1RAEB 2M70A 4JI8J 2LQ5A 4J9NA 2B7BB 2JLFA 3T1YF 1HHTP 3DI6A 3H4BA 3CCWA 3QYYA 2RVJA 4WK1A 1RTJA 4NZ0A 4IUFA 3T6BA 1IJFB 5J1EA 2DO0A 3DU5A 2HGNA 1HYSB 1OSCA 2WOMA 1B99A 3IXQA 3MEGB 2ALZA 1WJ9A 2MQMA 2VPWB 3PYEA 4MYTA 1TUVA 4WE1A 4P52A 2K7JA 1KTQA 2QL9B 3PO5A 4PYDA 2MZJA 3BGRA 3V4IA 1PYTA 1IKYA 2HRTA 3DHWC 5HJXA 4TN2A 4JI5J 4WFYA 3QLHA 5KFDA 5L1LA 2EG2A 3BV8A 1MMLA 4ILRA 1YRUA 4R8UA 4F8RA 3GSDA 4DR2F 1GTEA 1X4BA 4A47A 3DOMA 1FHTA 4LQ9A 5E3PA 3NKYA 4QJVA 1WDDA 4R25A 2YPZA 2B9EA 1OQ6A 1TK5A 3MMJA 3G6XA 4Q5VA 2PGCA 4W90B 3GU0A 1AZSB 5LMUF 2KT2A 4WFNQ 1D0EA 3UQSA 1D8YA 1B4SA 2JEIA 3BDPA 3SCIE 1N36F 2R2TA 1CSJA 2FJXA 1HKAA 5THWA 2I38A 3FEXB 5IC4B 4LF8F 3ITHA 4HH1A 4LF7J 4KAIA 2W2NP 5JJBA 1LW0A 2BJ3A 3PZPA 1RAFB 2W9AA 3G71S 3CT9A 4X66F 5ETPA 4N76A 2DNKA 1X9MA 1Q7LB 1SJQA 1S6QA 3ISNC 5RUBA 1BHNA 3AXKA 5L9XA 2MLYA 3KJFB 4P75A 3EVWA 4DQQA 5B0EA 4RBVA 2R7RA 4CLWA 1WWHA 2D3UA 5FD1A 1H7WA 1XMQF 3MM7A 1IBLJ 4WZQA 2BANB 1SV5A 2KYZA 1JLAA 1WKJA 4DXLA 3CMQA 3BYPA 1PC4A 1KTVA 4BLGA 1HBNB 2IDLA 4ZP8A 2ERRA 2ABYA 3AOCA 5E0OA 3D5MA 3GG1A 1JB0C 4I4BA 4FYXB 3MM8A 2G0IA 1HWLA 3IG1B 2J6UA 2K3KA 3IRXA 5ETKA 1QUPA 1HNVA 5D6GA 2BW7A 3BZQA 4JI0F 2C1EB 4IRCA 6FD1A 1OPIA 3AD8C 4IG0B 1RSCA 2Z8QA 1QAYA 2QGFB 3CCQS 4AXJA 4OZ1A 4LF4J 4DSFA 2HURA 3Q2TC 1SJ4P 4NI2B 3D4JA 2ZZMA 1R43A 2O5DA 4P71A 2Z2MA 3L9ZA 2D69A 3TJ8A 4ZPWR 4IKAA 2AGPA 4RW6B 3R7NB 4MK8A 1BQNA 1MSWD 2GW8A 2BKOA 2RE1A 4EO8A 3T5JA 1YWXA 1RT3A 1PCAA 2FTRA 1Z4UA 2DT9A 2AMCB 3CC4S 5CABA 2FDNA 1AW0A 4ECWA 1F9FA 4O4RA 2HLUA 2IVMA 2CJ9A 4F4XA 3PVXA 3QWUA 2MB0B 4C8NA 1H2VZ 3HHLB 3OLAA 4ZIWA 2MYFA 4O23A 2YX4A 1CULA 2YNIA 2J9EA 3H5SA 1VBKA 3I4PA 3TAMA 2XBPA 1LXNA 2MMYA 5ETLA 1ULRA 2HFNA 5F3TA 1LWCB 1VQ4S 4F4AA 4TQSA 4ED5A 2CJXB 5KG4A 4KPYA 2VV5A 3OHAA 4LSNA 2OSRA 3KK2A 1GMWA 3K2YA 3ET6A 1CJVA 3SSQA 2R2RA 2UV8G 1G3OA 2Q43A 1A0OB 5EX0A 2CJAA 1QAXA 3H8YA 1QY7A 2ASDA 1LK5A 1RT2A 2HBZB 1HNIB 3HSGA 3EX7B 1C1BA 4PPDA 3I0SA 4CLZA 2MLXA 3WX8A 4L72B 3HF5A 4GC7A 3GSIA 3H20A 4YHHF 2ROEA 2OEKA 1HBMA 3R27A 1A6LA 1FWPA 1GMWD 2BKPA 3BSCA 3OXLA 2ZVSA 1KDNA 3OTEA 2C3UA 4NLQA 2RUGA 1RBLA 3E8OA 2IBOA 4RLEA 1LKZA 1YK9A 1FWKA 6FDRA 4CLUA 2OD6A 3CDWA 3T1HJ 4RW4B 4I2QB 4KV8A 5T7LA 1NCLA 4QW8A 1X4GA 2XSFA 2W2PP 5HN0A 4M5JA 4FYWB 1KOOA 4PXDA 2AYMA 2CDQA 4WP9A 3OVAA 1E6VA 2BJ7A 5C42A 3HO1A 2PE8A 4U67Q 1LW2B 5LMNF 1YRTA 3P5BP 2KHDA 2ZH1A 2W2QP 1U2CA 1OYEA 5DG7A 5BR8F 1S49A 1BWVA 3IBFB 3HSDA 2VKRA 1VQSA 1HNZJ 4QWBA 4NLOA 3I0RA 2HNYA 3D0IE 5AJ3F 4PG4A 2VDHA 2ZITA 2HNDB 1SC6A 2AJQA 3GTYX 2AWZA 2VA2A 3W62A 2B0GA 4CZCA 4U6PA 1P9YA 2FVQA 4OYZA 5C25B 3KK1B 2EK1A 1XERA 2F4VJ 3V4MA 3BKTA 1YHQS 2XMVA 4JYAJ 1OS5A 4OJGA 2OSQA 3JTNA 3A3OB 4FXDA 3E01A 1S1VA 3M8YA 2YY3A 4X4RA 2V94A 4ED6A 1M5VC 4W98A 3MM5B 2DNHA 4B3MJ 2KKHA 1KP6A 2CKWA 2GIRA 5A6WA 4XAKA 2NUHA 3O2IA 2DGUA 4QU7A 3QT5A 4F4ZA 4LF6F 1UPPA 1SJ1A 8RUCA 4RR5A 5CCLA 2CNLB 4NEYA 1RAAB 1AFIA 1ZM9A 2HGMA 5EX3A 3O6QA 2IM1A 5HLFA 2C2NA 3R2DJ 4OI0A 1GTHA 5L1KA 3HVAA 4CH0S 1H72C 4B3OA 1XEZA 1KS2A 1U02A 2ZHBA 3D68A 3FRZA 3T5HA 2GQ2A 1FJGF 3IMQJ 2CRLA 4IR9A 2IM2A 3S6EA 3CC7S 4ZPBA 1HNXJ 1GFWB 3PNIA 3MOJB 1YJRA 4B08A 2FUG9 4PPZA 2HVZA 1N5SA 2RU9A 2YPYA 2G9OA 2HW3A 4ANDA 4W92B 2N3LA 1ZYQA 2DR8A 2A2DA 4PWDA 1U2FA 1HYSA 4IQMA 3R6LB 2A3JA 3MEGA 4DPXA 1WEZA 1S1XA 5KT4A 2VUGA 2F5GA 3QZ7A 2CDRB 4UUWA 2MKSA 2CPZA 5IQ6A 1S1WB 1WG5A 4FYYB 3JB9k 2UU9F 1F5BA 1VRTB 2NUUG 1SC3B 1FKAF 2Z2YB 4WIQA 1HFEL 3IBCB 2M5YA 2EC0A 3ENWA 4HDHA 4KFBB 2ZEJA 4DEZA 2LU1A 2W7OA 2LEAA 4HEA9 4H4OA 3Q89A 3D0HE 4GKKJ 1FXRA 3GP9A 3KJVB 1M0SA 1S1UB 1FJ7A 1ZPVA 3RRHA 3H25A 3W2WB 4Y2KA 1AZSA 2FPHX 3DM2A 1OWXA 1RHKB 4YR3A 1HBOA 1TFWA 3BN4A 1RKJA 2VG5B 4O4GB 4YB7A 1ZAXA 4RL1A 1H7XA 4B3SJ 2W9BB 2OLWA 1IKVB 4Q43A 3TAQA 1FVSA 3CJ2A 2C22A 2R3VA 3V6KA 4Q8FA 3FCVA 1G2EA 2MHEA 3HZEA 1F2GA 5AXKA 3L7UA 4MT1A 2GHVC 3HHDA 4X62J 1GMUA 2ZKUA 2VZ9A 4FYDA 3MPVA 1HR0F 2LXIA 3I4HX 4DPYA 2XNQA 5KFGA 2XI2A 3GMGA 4JI1F 1RWMB 2GGPB 5KG2A 4J9LA 5KFQA 2BANA 1Q53A 4CH1A 3C15A 1KQFB 1RCOB 4MIBA 4DJBA 5DQHA 2XSJB 1HQUA 3OSPA 2FJDB 3VTIA 2Z57B 3IG1A 3TZXA 2M8DB 2HWTA 2BE7D 3MCNA 4O3SA 3UD5A 3Q86A 2DNGA 3OTDA 3T41A 4NXNF 2BOPA 3M2UA 4WYWA 2V8PA 3T5KA 3UNYA 2OO4A 2UUWA 4WWSA 2VB6A 3CULA 3GJRB 2JJ4D 5DM7Q 1TR0A 3UDCA 3W3SA 2Y8WA 3HJFA 1NAQA 4NI2A 4A8MP 1FFGB 2L9NA 4I2PB 3MDFA 4XO0A 1TFYA 4I6AA 3HD1A 3CMES 3CD0A 4ZITA 1NJWA 2C2DA 4RW6A 2AJ1A 3HVRA 4ZIVA 3A8JA 3PJXA 4TKTA 4KHRA 4TQRA 4B9VA 4ECTA 3OR2A 4AQYF 2MKHA 5A2QU 3PRBA 3K5MA 2MZSA 2DRDA 3H98A 1GH8A 2MHNA 3RGIA 2C3OA 1JNZB 3KXDA 3HHLA 3GIJA 4KH0B 1PIEA 2RHSB 1R6YA 1PAUB 2W25A 4CO3A 4E2FB 2UUBJ 2FLNA 2BBEA 1NH7A 1LWCA 1U2RA 4RBTA 1IBKF 3I9V9 4FXVA 4ZMMA 3CJ3A 4LIWA 4CLLA 2H5EA 1O6XA 2BW2A 3NLCA 2HHPA 1X4AA 1MMNA 5K9FA 5B0FA 1RWOB 1BQXA 2GVDA 3DOLB 5I4MA 1RT7B 4HHHA 2HYIB 5D0HA 3D3CJ 3N5BA 4OI6A 3CCZA 3AJ1A 4TVAB 1LWEB 3UWTA 2RQCA 3DRXA 4KBIA 3OR1B 3HHLD 4X4SA 4ELUA 5JVGQ 2VIHA 4K4SA 1JLCA 2HQGA 4NA2A 5KT5A 4Y2IA 3TEHB 3QGGA 2KU7A 4B9LA 3CGIA 2X7IA 5K8MA 3SV4A 1ZM2A 1VGYA 5HVHA 2HFUA 2G2OA 3EGZA 1FCAA 3NGRA 4N8OA 2C42A 4C8ZA 3GJTB 3MHYA 3HK2A 1LOUA 2VOOA 4ECYA 2DNPA 3CJ4A 1VI7A 1V5VA 1M5OC 3CCRS 1S97A 2UP1A 4GKJF 2ZUAA 4RWWA 3GYNA 2RS2A 1H98A 4LT6A 2J6SA 4IDKB 3G4SS 3SMZA 2LFVA 4QYZJ 4USMA 1WKKA 1WSRA 2OPRA 2VICA 2W9CB 1L3TA 3OXFA 2MZRA 1MW7A 2X3GA 1FK9B 4C0BA 2R8HA 5A0YA 3BM7A 2HSEB 1SQGA 3C14B 2CQ0A 2MY8A 1TK8A 3GJSB 1AROP 3PHTA 4RW4A 3HP6A 2BQRA 4MKYA 4I2QA 1JKHB 3C6UB 4RW9B 2JH3A 3AD9C 3H5UA 2OFGX 1S5ZA 1U1LA 2XYHB 3VGTA 5I3PA 1HA1A 4RNFA 2QIFA 2O3DA 2I1RA 5GAEI 4K4XA 3D6TB 1G1XA 3FVYA 3PW2A 4ZHRB 1IM4A 3F44A 3WDOA 3JQKA 3V6HA 1NSPA 2CG4A 3QIPA 1LW2A 5J2MB 5DLGA 5GAHU 3KLEB 2RB7A 1TL7B 1F2HA 2BM1A 3M9OB 4Q45A 3T1AA 1N0VC 4JBCA 3W64A 2IFXA 4ZPDA 3M8RA 1GEHA 1S4EA 2FLOA 3MD1A 3KOAA 2DNOA 2KG0A 2HNDA 2FB0A 1GT8A 4NLTA 2EKNA 5KFMA 1X31C 3SQOP 4H54A 3AD7C 1LXJA 2OIHA 1IM6A 1B0PA 2CVIA 3AAWB 3QFHA 3DYAB 1U49A 2W8KA 1V3ZA 3I32A 1XR5A 4L3NA 5C25A 1WHXA 2HFSA 2KB2A 4ES3A 1HQEB 2C2MB 5B7WA 2V4RA 4OLPA 4J9OA 2DIVA 3V81B 4KY3A 3AJDA 1S1TB 3MM5A 3A8EA 2ZD1B 1TL3B 2R7UA 4FVMA 3PYDA 3SDEB 4GVLA 3HJVA 3AHPA 1Q16B 2WW4A 3KMQA 1KHWA 4DV1F 4CTAB 5A8WB 3ISND 3CW2C 3VV2B 1PJ6A 4LF9F 1PBAA 1L5UA 3P3DA 1KQKA 1VC0A 3PR5B 4LFAF 5KFJA 4EWTA 1NHVA 2B4OA 3O8WA 1QTNB 3D1QA 5DQGA 3L7PA 3VAHA 2V4JB 4ZS6A 1RXOB 2F65A 2GQCA 1PKUA 2YNHB 3S8SA 4DV5F 4OYPA 5LJ3Y 3QGPA 5LMUJ 5KOWA 4ANEA 1UZHA 4R5PA 4CO1A 3OW2R 1N36J 2EFQA 5HMXA 2F40A 4LF8J 3RU0A 2OJ3A 2QRRA 1UFWA 3LGMA 3W8GA 4DV7J 4DLEA 1S6PA 2OFHX 1JXLA 1SL0A 4E8UA 3Q8RB 2DD8S 2ZH3A 4X66J 4ED4A 2UV8A 3TA1A 1EETB 1N8RT 1ELOA 4HTIA 1YZ6A 1BUXA 1RE1B 4C3MA 4DV3J 4S0MA 2YKNB 1DLOB 2EFNA 4ZLPA 4KHMA 1X4DA 2N7YA 1S1WA 2XLKA 2HIQA 2BX6A 1XMQJ 2OEJA 1FRLA 2UUCF 2HK3A 1X7VA 1S7IA 5GAHI 1M1GA 5C2CA 4PXEA 3THTA 1T9WA 2XZWA 5J2QB 1B70B 5HQLA 3M32B 1YIJS 5J2NB 4DL4A 3DGPA 1N33F 4K5RA 1TKXB 4ETXA 3W9IA 4LBIA 2X1GA 3KJVA 2YWWA 1S1UA 4JI0J 2Y1RI 4F25A 3W2WA 4OZNA 1X5OA 5AT1B 4EZ9A 1UVKA 4WZMA 4DV4F 2NYHA 2JWNA 4TYAA 1RBAA 5HMWA 3OJSA 1DQ8A 4OX9F 3PEHA 4LFCF 3MXHP 2NPFA 1DY3A 3M8PB 3B82A 2DJWA 2VG5A 3POTB 2YQ3A 2LXUA 4O4GA 3H5YA 4L3KA 2W2OP 2QLBB 3NCQA 1VQNS 2W9BA 3QFWA 5LT5A 5IQQA 1SBRA 4OYMA 4UOCA 1K0VA 1RAOA 3IFEA 4DUYF 2RQ4A 2M7SA 2QT7A 4TY9A 1FKOB 3A3PB 3IWXA 1C0UB 2HVIA 3TUIC 4USKA 1RB0A 2RKIB 5GADU 5E5NA 3FSYA 1B0TA 1R7IA 1NNDA 3NP5A 2GGPA 3KG0A 4KC5A 1YITS 2C3YA 2XGQA 1HL6A 4QIWD 4NLUA 3UDEA 2DIUA 2XSJA 2K2PA 1AUSL 1MNEA 2B5JB 3I56S 3KHHA 4C97A 2XYPB 3DHXA 4NASA 1I3OB 1KKHA 4F0KA 2QMXA 2ZOFA 1JJ4A 2Y1IA 4EGLA 1FKPB 4WFAQ 1JMTA 2V68A 2CPXA 3PRVA 2RMLA 4CLFA 5M2RA 7AT1B 1WC4A 5LXRA 5KT7A 3MEEB 3BJYA 2WBMA 2M8HA 3G82B 4J5OA 1UPMB 3NMRA 2YKMA 4I2PA 4PABA 1U1OA 2GO8A 1Q8LA 1OY9A 4N8NA 2BE2B 3MAHA 4ATNA 4F3OA 1G6BA 1WEXA 2V8GA 1LFPA 3DLLQ 2CQBA 4NXMJ 3PDNA 4CLYA 4FXWA 2FJBB 5IV3A 2OEMA 4YHHJ 4DQSA 3KG1A 5KFXA 3U1MA 4CO2A 1ZOTA 2UXDJ 1ZS6A 2VONA 1TZ0A 1NKBA 3BREA 5HQMA 4QCLA 4FN5A 1SQFA 4PYAA 4UW2A 1S4FA 3CCES 2RQMA 2E9RX 3BKUA 4KTQA 2UUTA 3ZFVA 3NAIA 2QO3A 2LA6A 2ZKTA 3PCOB 4PG7A 1R8PA 3DNCA 1UZDA 4I67A 2O66A 2ADCA 1LFWA 5CXTA 2RJZA 4F36A 1KLMB 2GIFA 4HR2A 3RYLA 1SJ3P 2APOA 3BGOP 3OV7A 4PQUB 2ZDPA 3HFVA 3IN5A 1MLAA 3NWRA 2E1AA 1RT7A 3BKFA 2KZZA 1LWEA 3DDNA 3SFUA 4B9SA 2LDIA 2VG6B 1JX4A 3OR1A 2J5AA 3K57A 1FNOA 3EJMA 1VQMS 1SIZA 1FFWB 4DHVA 1OQ3A 1X4HA 1SQEA 3TWZA 5ETOA 2MKCA 5LMNJ 3W63A 4IH7A 3VQSA 1W25A 2BOAA 5BR8J 3UE2A 3JSYA 2MKKA 2ZJRQ 2HZCA 1E6YB 4M5LA 1U8WA 2MKIA 1GXLA 2C3MA 4DDFA 1S48A 5AJ3J 1XMOF 1HD1A 2OPQB 3HFKA 2MKYA 3VGSA 3HT0A 2F8MA 1QVFR 4FF1A 3K5PA 3MM6B 1RJJA 2VBZA 4ETZA 5HQ8A 4MAKA 4ZDNA 3OTOJ 2UVUA 2BRLA 2IC3B 5L1IA 1WI8A 2JVOA 2R2SA 3CCJS 3R7SB 4M95A 2R9LA 2W9CA 1HMVB 2A0FB 2CQ3A 1FK9A 4PWUA 4YR0A 3C14A 1F3FA 1NJZA 1JKHA 3G2XA 4NRUA 3QJLA 3C6UA 3IS9A 4RW9A 1GXUA 1S9GB 4FBTA 4DU8A 2H4WB 1U6BA 1UJ6A 5F8NA 1WOOA 1RQ0A 2WZ1A 2IRXA 3TR5A 1JLEB 2F8HA 1VLOA 5IOLA 2JEGA 3SXLA 1I1GA 1EAYC 2YVSA 1IN0A 5L39A 3LP2B 4F3MA 2NREA 3BYRA 3KJQB 4M1KA 3IP0A 4IO1A 2RQKA 1BD6A 4YOEA 2CQIA 5KFCA 1M5HA 4F26A 3A4TA 5E3AA 1HWKA 3DMJB 3CSKA 1H6KX 5DDPC 1N54B 3LAKA 3R6GB 3VZHA 5KG1A 1VDHA 3H2VE 3S01A 4NCAA 3H42A 2MDAA 3NCRA 2O01C 3MPUB 3CD6S 4Q0BA 3DYAA 5BJRA 4A4JA 3OTBA 4LR9A 5D8HB 4FPIA 2CPFA 4LSLB 1S12A 3KK3B 3TX0A 4MMOA 4ZVQB 3K8VA 1HQEA 2D3ZA 2XQCA 2RIJA 1XN9A 2CIMA 1FE4A 1NB7A 1GX6A 3GIIA 1RHRB 2ZD1A 3K5NA 4DG1B 4Y65A 5ETRA 5LXYA 3SDEA 3D7SB 2DISA 1D3WA 2ZBPA 2ZUGA 2GHPA 4LVNP 3KKFA 1R89A 3CJ0A 1NK5A 3TZWA 3IWLA 2UU9J 2BM0A 1M5PC 2ALYB 3FFIB 1X9WA 5A8WA 4F4KA 2YKPA 4MFBB 2IY5B 3RB0A 2VPXB 4CO4A 4OV6A 2FJWA 4ZCLA 1FJEB 2KT3A 4B17A 3HX9A 3JS9A 4A8KA 2R4FA 2V4JA 4EBCA 3GV8B 1R8BA 4FNIA 5C5JA 4IOAQ 1VYAA 2YNHA 1U47A 1NRKA 1NUEA 3KMSA 2AYGA 3PG9A 2D9PA 1EKRA 5G4DA 1J5EF 4CYUB 2PIIA 2HHVA 4ECSA 1O51A 5H9FK 4AFFA 3D1OA 2ZNZA 5H9EJ 4X4PA 2VQFF 4I64A 3SBMA 3ZTOA 1XNQF 1AYEA 2C2OB 3DLEB 1S57A 4A48A 2DXFA 5K20B 2WAQD 4H4MB 2FHJA 5KFNA 1EETA 4X4VA 3PFEA 2FC8A 1FVQA 4DOZA 3CJSA 3M30B 3TZZA 1NJIT 2J76E 2QLWA 2YKNA 4IYQA 1FEEA 5I42B 1DLOA 2V6AA 4LFBF 3OFFA 2ASYA 4HT7A 4TY8B 4FF3A 5LL6d 2PI5A 2CQHA 5DQIA 1VFJA 2BV3A 4JI1J 3Q8PB 2Y1LB 1UVMA 3RB4A 2HVDA 1H38A 3HZGA 1EX8A 3K58A 2QG9B 1MN7A 4J9PA 2CPEA 4P9SA 2IRYA 2V69A 3GWCA 4ZPAA 4HTJA 1F5AA 2PI4A 3W66A 2BR0A 5EGYA 5AXMA 2EFPA 4M5HA 2QV6A 5J2QA 4FNHA 4CLTA 2VHGA 3M32A 5HVGA 2FHJD 5J2NA 2V63A 3KUGA 3CUNA 3HFZB 1TKXA 2DNYA 2BA9A 3MAQA 2QYGA 5IWAJ 3CO9A 1LWXA 1N88A 2JNJA 3BO4A 1RT4B 3CB4A 3J81U 5DZ7A 4ZK7M 3M8PA 2RU3A 4KH1B 2KFYA 4GRSA 3POTA 1X0FA 2VPYB 3A1YG 1N34F 3KHGA 1I94F 3UD4P 1PSDA 1RI7A 1U6FA 1UJ5A 4C8YA 2C3PA 3M2RB 3E3XA 1WUUA 1FKOA 4ER8A 5ETNA 5F3ZA 3DLHA 3BR9A 1C0UA 4DQPA 1Q5YA 2E44A 1JK9B 1LEOA 3MTKA 3WIUA 4AD6A 3HPOA 1IQZA 2N4DA 4WFZA 1OJ4A 3EYZA 3BGLA 2QLXA 4DPWA 2KM8C 2WVEA 2E7VA 1XJWB 3FCWA 1IBKJ 5KG3A 2VQEF 3PTWA 2RUSA 1UKUA 2LU2A 4UUXA 1WEYA 2B5JA 1YJUA 4LRAA 4IH6A 4P2MA 2V2VA 2PMHA 3QPIA 1Q86T 3RZAA 1F6TA 3J81Y 2DHGA 1Y3KA 4J9MA 4K0KF 1KD1T 4J9KA 3IM8A 3MEEA 2WSFC 1SI9A 2NPIA 1ZM4A 2DXDA 4RUBA 2FY8A 4OI1A 1XQIA 5KFZA 3G9CA 3TNVA 1QE1B 4DV0F 2BE2A 5EWGA 3MCOA 3GCWP 2M52A 2DHSA 3K7RA 5SUHA 3CJRA 4WU2A 2HHUA 3MMCB 1YBTA 1UMJA 1VQ8S 3N6LA 4FPRA 3SCJE 2AEJA 2J9DA 4GKJJ 2NQPA 1EKSA 2DGSA 5EN1A 3EUNA 1U26A 5KFFA 3IR7B 1S9EB 3B78A 1KVKA 2XHWA 3DU6A 1UWAA 4JV5J 3W1YC 1VBXA 3RR7A 1KLMA 2CYYA 1WHYA 4PQUA 4H4KC 1VQOS 1UFLA 3VQTA 2IJNA 4PZVA 3LH2S 1CJTB 2GAHC 5K5MA 2ZE2A 1YGYA 2DO4A 2RAQA 2VG6A 1L3VA 5HANA 3RBZA 4TLQA 8ATCB 2LQBA 1Q5VA 3GIKA 2DEIA 3HULA 2BJEA 4Z7CA 3VR1A 1FX4A 4K59A 2DB1A 3LP0A 2Z30B 1ITPA 1HD0A 5KT6A 4DFMA 2LEBA 1Q78A 2JDJA 2QJ3A 3AJ2A 2JFDA 5D77A 3U1NA 1SL2A 3M2VA 1KSPA 2OPQA 4DR4F 1KVJA 1EHWA 2CJBA 1KFDA 3IA0A 1HHQA 3DKDA 1Y0HA 1S0MA 4F7VA 3C6TB 4GO5X 5K8PA 9RUBA 2IC3A 3T6JA 2G0CA 4Y28C 2OUGA 4DR5J 5BYQA 2Z0GA 1HMVA 2LXFA 2MSTA 3ZO7A 2HS0A 2GCFA 2RF2B 4MIAA 5IM0B 4OJHA 1TL5A 4YEAA 3DN9A 1K0TA 4IQXA 1IQTA 1S9GA 3EGWB 4IO9Q 1T7PA 2IYGA 2L3MA 4DL6A 2AIRB 4YMEA 2GMJA 1JLEA 5U47A 3PR4A 4DV1J 3ZZ0A 3Q24A 3UN3A 1S9FA 3IR5B 4LFAJ 4UT4A 5ETSA 2ZC3A 1QTMA 1VQKS 2VG7B 3AQPA 2XMJA 3MR2A 3NBPA 4DMZA 1J5OB 4ZPCA 3QWPA 4D3HA 1YX2A 1RGVA 2IVYA 3R5JB 3DMJA 1H3DA 3CEDA 3ZTQA 1HLWA 4DV5J 1UL3A 3PACA 1WC0A 4IFVB 1NPKA 2F9DA 5HBMB 2ZJPQ 2KN4A 1T3OA 3H4DA 1FTCA 4JP8A 4ED1A 4E98A 4QWCA 1WI6A 4MKBA 1RTDB 2J7WA 3RRGA 3MCMA 3KK3A 4KO0A 1UVIA 3HSZA 1NPPA 5E7OB 2KM8B 5C24B 3QT8A 1WF0A 2AJFE 3R5DA 1YRXA 1SJRA 2RRNA 2XM3A 3KLHB 3W60A 2Z58B 3EZOA 2E1PA 1JLBB 1EQMA 4DG1A 1OSDA 2JZ5A 3NNHA 3MOZA 3Q8QB 4HACA 4JI8F 3KJNB 3K5OA 2Y8YA 1GMVA 1QAJA 3U1LA 4QYZK 3MMAB 2UUCJ 2DH8A 1RT1B 2QE5A 3QJJA 4O3OA 4ZJQA 2V50A 2AJ2A 1H2TZ 4LUBA 4ECZA 1H2UX 2PD1A 5GAGU 2DNLA 3CXCR 1X4EA 1SKRA 3F56A 2E5IA 4KJIA 1N33J 2BRKA 2D7SA 5KFHA 3EE3A 1KFSA 1TUWA 4AXIA 3UR0A 1RT6B 3CCSS 3KYLA 2CPDA 5K14B 4CWBA 3VGVA 4JB8B 4DV4J 4OQJA 1K1QA 2DCLA 1IVZA 4WU3A 3MPWA 4F4YA 4LFCJ 2QMUB 4JI5F 4CYUA 4ZVGA 1NDKA 2YNFB 2K1RB 3W7BA 1B3TA 4ECUA 3NGKA 1MWYA 1O5JA 4ED0A 3VCDA 4FS1A 2HHTA 4QWAA 3DLEA 4O3QA 2IRUA 1KWMA 1T11A 2WCXA 3ILOA 4H4MA 4EZ6A 3BB5A 2V67A 2J9CA 4TXSA 4C2MA 1Q1KA 3QMQA 2HNZB 1SCJB 4OI2A 3H2UB 2VF3A 1T9YA 2OPPB 4DX6A 1UA0A 4M5IA 5E3QA 2HHQA 4TY8A 2ACYA 4A8XA 1RHUB 1T9UA 1JLQB 4U9RA 4LF5J 2FQQB 4AL7A 1ZZNA 3BGFA 3H40A 1T05B 3G6ES 2NYIA 1IR0A 4EK2A 1NZ8A 2GNKA 2FY1A 1VQYA 2QFJA 4LF7F 5EWFA 4PEOA 2QA4G 2XS7A 3UCZP 3IC1A 2R8KA 2B56A 4CRJA 4OZ0A 4YP3A 2QA1A 1IWGA 4M5DB 1Z2ZA 3R2CJ 2QA4S 4KE5A 1WC6A 1JNRB 3VAJA 3GFXA 5MAOA 4O0NA 1KQSR 1EARA 2ZH4A 4M94A 5ETVA 2DGVA 3EXCX 4NOHA 1DTTA 3J7ZT 4FZVA 2KDOA 4ZCIA 2N7CA 4DR6F 2ATLA 1KEKA 4ZVPB 1NK7A 1OPZA 1OYDA 1B7FA 2ZWOA 1VRUB 2MKJA 3MUVP 4NLYA 3CCVS 3JQJA 4JI7F 4ZVFA 1RKIA 1H73A 4UQTA 3LUYA 3AODA 4X4UA 3W61A 1NLKL 3QZ8A 5DETA 4DF8A 1VQ6S 2OTJS 3O1LA 1TMJA 1V3RA 3ZNJ1 1QSYA 3OPKA 5I3UB 1TUGB 1D09B 1VIOA 5GAGI 2W4DA 4J37A 2DGOA 4CQ1A 2XCAA 2FHMA 3L4BC 4DU7A 4OYOA 3MURP 2ZBCA 3IAM9 3RJMB 5KFKA 1ZH5A 1URNA 1NO8A 2I8EA 3X1LB 3PM9A 2MGZB 1SUQA 4AYBD 4NRTA 3P4UB 3BSOA 1F5CA 2DYAA 2BJ8A 4HT5A 4ITSA 3MECB 3LAMA 2VFSA 4P72A 1QAIA 4CNZA 2X1BA 2V5HG 2IVFB 1SIWB 2NR0A 5KG6A 4NWBA 3HLUA 3VAKA 3MPDA 2F9JA 2U1AA 1WC5A 1TU0B 2KYXA 4NE9C 1JLFB 1JIHA 2C2EA 3TARA 3GB0A 2DGXA 5KFUA 5IT0A 2KG1A 1XMOJ 3MMCA 1R31A 1HBUB 3PYGA 3C8YA 2GHWA 3WZ0A 2AEMA 3BQ0A 5KFSA 4FP9A 2ZC4A 3MEDA 5K8NA 3MZIA 4CM0A 4A8FA 1T9VA 2XZTB 5KAKA 2W8LA 1NK8A 1WF2A 1MMDA 2Q3PA 2F1FA 3RAQA 2IAJA 2ZH2A 2PA3A 2ZFHA 3LPEA 1KOHA 4N7TA 1Q4RA 2DCUB 1T02A 4OHXA 2C28A 4K8RA 3LP1B 1WTFA 3DLJA 2EW9A 2F4FA 4XPEA 1SC1B 1CJTA 2I5JB 4B3TJ 3KLGB 1XNRF 4DN0A 3AOBA 2OHDA 1OY6A 5M2UA 3QRPA 3L3CA 1VR6A 1IXKA 4ES2A 4UY8T 1VIXA 2IPOB 3FGVA 2MQLA 2Z4PA 2DR7A 4C98A 1TV6B 1FF2A 5KG0A 5M2PA 5KOXA 3T1HF 1WNEA 4Q2LA 2WB4A 2QYCA 1F9EB 5KFTA 1A9NB 1VQ9S 3AFGA 3M9MB 1DTQB 4QWDA 1ZTTA 2XO6A 3JYTA 1P9QC 3RB3A 3ISZA 5E2QA 2DGQA 3C6TA 5F8MA 2BE9B 4BC7A 2JEJA 1DRZA 1FE0A 1REGX 5HMZA 2E1CA 3WQPA 4N77A 3MUMP 2ZH8A 3ULHA 1CVJA 2HQIA 1NMEB 2DY9A 2RF2A 1XWLA 5CA5A 1F1BB 5IM0A 1HNZF 4O3NA 4DV6F 3W65A 3A3NB 4U8YA 2XGPA 1C1CB 2PC6A 8AT1B 1Q7YT 4ZVEA 1GAOA 3EMTA 1REVB 1PG5B 4X65J 3D9BA 1WDTA 3MD3A 1IR2A 2NSCA 1YG0A 3CJQA 3TVYA 2HHHJ 2FGCA 3NS6A 1S79A 2JSXA 3TVKA 1M1KT 3K17A 2F4VF 4NZ6A 4EYHB 2VG7A 2AQ4A 3PX0A 1ZM3A 3OVSA 2MQPA 2V8DA 3JSRA 4YFUA 3FC9A 3GILA 3WX4A 1J5OA 2LEPA 1R8CA 1ZZFA 1S77D 4LRCA 4B3MF 4WE1B 3UD3P 1EP4B 1ACMB 1D9DA 2G13A 3H2LA 2CPJA 3BGRB 4MJKA 2IBKA 1J27A 5HBMA 5KFVA 4HYKA 1J5EJ 1L3SA 4K2XA 3QLHB 2HHSA 1CBKA 2B8QA 2ZBQA 2JC1A 1WHWA 1QVGR 4KRWA 1RTDA 5FIIA 1O8BA 3ELHA 1RWVB 3V6JA 2VQFJ 1CS4B 3PW7A 3BQ2A 3VAGA 2HG4A 4K2JA 5C24A 1EJ7L 3NL0A 1TP7A 3DLKB 3EDQB 3VAMA 1HIYA 1NB2A 2XMKA 3DOMB 4RPFA 2MY7A 2VA3A 3CCLS 5IC6B 2GVZA 4ECRA 1JLBA 4QIGA 5A6PA 2DRAA 2PSZA 1HW8A 1PJ7A 2XMAA 4ZVTB 3Q8UA 3NG8A 1U0SA 1HNXF 1C4AA 3QO9B 4EI2A 1U7LA 1JJHA 2PEBA 4XPCA 2J8SA 4K4TA 2V0NA 4DWIA 2HK2A 2DNNA 5A8RA 3MMAA 2FJVA 1RT1A 3J7YU 4DUZF 3ZTRA 3R3TA 4YN3B 4BHQA 3HXMA 2QX0A 3K0JA 3LF0A 3M9NB 5F8IA 2KFZA 5AE2A 2WSCC 4C4WA 1LW0B 4OHYA 2L48A 1K8AT 4NMXA 2UUAF 2CPIA 4DFPA 3UN2A 1XR6A 5KFYA 3V6DB 4TYBA 1WOSA 2CWXA 2OKQA 1Y5NB 2HQCA 2H4YB 1S0VA 2MZQA 1RT6A 4WBFA 2HQ3A 4Q2MA 4R0JA 2PEHA 5K14A 4FDFA 4NYZA 3TO8A 3OBIA 4OZ5A 3MR5A 1MU2B 2LQ8A 5FJ4A 1CC7A 4K4UA 3NWGA 2YNFA 4ZVOB 1DQ9A 3LWMA 5KG7A 3D0GE 5B0BA 1NU4A 4M63A 3W9HA 2GQQA 2LLZA 3DGVA 1N34J 1I94J 1K44A 1G7CB 4F0HA 4DL3A 4ID8A 3RBDA 4RW8A 3H5XA 1RISA 3MM8B 3PIOQ 2G2ZA 1XTZA 3P49B 5HK4A 4U7CA 4ENOA 5L38A 4GKKF 2CNNB 4B3RJ 3OXGA 3CCMS 1FFSB 2HNZA 1WORA 1B7YB 1U6ZA 4X4NA 2MJNA 1NM2A 4CCHA 3M6XA 3M8WA 3AXMA 3SSSA 4H4KA 2VODA 4QWEA 1JJ2R 2V8VA 2G1DA 1CJUA 1T05A 4Y6IA 2C2KB 1S10A 4LR8A 4NA1A 1VMBA 1XC9A 2U2FA 2WSEC 2BDPA 5HJYA 2R7XA 2VQEJ 3UCGA 5CCMA 4K5SA 4QIEA 2XCPA 2GAGC 1Q8KA 5DS7A 2NXUA 3G96A 4M5DA 4EU0A 3CPWR 4UOGA 1BMQB 1RA7A 2J7KA 3DRYA 4NLXA 4OYWA 3KNAA 4X62F 4N41A 3QRRA 1I51B 3C16B 1IBCB 2X1AA 1WELA 1S72S 1RLDA 2GZOA 4FKXA 5IXUA 2FZCB 3UO0A 3T9NA 5KT2A 1HWJA 3D66A 4L75A 4BBYA 2W01A 1VRUA 3NS7B 2DBBA 2AEFA 4PXCA 3M8SA 5ADZA 1UETA 2O1PA 4ID5B 3FBFA 4J90A 2GA7A 2XMMA 4LSNB 2E5HA 2ATCB 1DARA 4WF9Q 3N79A 3KK2B 3ET6B 1FDAA 3GONA 1DZ5A 5B09A 2XC9A 4OHWA 1YDLA 4KGKA 4B9MA 2CNOB 4HH0A 5I3UA 1VC5A 4L76A 5H9EK 1O0PA 2Q6CA 3I5CA 1V5IB 2BXJA 3A12A 2MJUA 3HDSA 2B4UA 2LECA 3AQOA 1VISA 2E29A 5BYSA 3I55S 3M6UA 3KHRA 3QQCD 4LRDA 4IOCQ 3NAHA 4NLGA 3DFEA 1NPRA 1FT8A 1IBMJ 3KLIB 4G1PA 1UFKA 2VBYA 4V1Ak 5D15A 1UVNA 2MGZA 4NYOA 1LWFB 2QMWA 2V2KA 2CADA 3JSMB 3DDKA 3MECA 2R7OA 1H74A 2H54B 1NHUA 2YWKA 2FC9A 1FX2A 1VRQC 4NEZA 3WC2A 1SH0A 1CLFA 2HRYA 2WVFA 3CIMA 3W8PA 4Q8EA 3OD2A 5IFMA 3KNGA 3BO3A 3EZUA 3VALA 2UXCJ 3N6MA 3D6FB 1JLFA 1WSVA 2FLLA 2H9ZA 2R7QA 1HBNA 3SSRA 1MROB 4KV8B 2DXEA 4RNHA 2EFVA 4DR4J 1HBUA 3JTPA 9ATCB 3FZBA 2VDIA 2DGWA 2UXBJ 4YY3J 4UY85 3P6YC 1NK6A 3PKYA 4IG0A 4MK9A 1RT5B 3NOGA 5C42B 5KFOA 1TAQA 5DGAA 4LREA 2CQ1A 2E66A 2J6TA 1RU1A 2AGOA 4DFKA 4CO0A 1WG4A 1QLNA 3D28A 3CNQP 3I0RB 1FTRA 2NXCA 1QSSA 2N3OA 2HNYB 3GLJA 1HWIA 3GJQB 2WB1D 4F67A 4B02A 3LP1A 3CDUA 2EVZA 2CQPA 3NRBA 4QR0A 1Q81T 4C7QA 2I5JA 2A2CA 3H59A 3KLGA 5CYQB 1WC1A 2FZGB 4F04B 4NLRA 3DRPB 3PEJA 2QA2A 1P8GA 3HVWA 1Q8BA 5KFBA 4DR1F 1R3NA 5EHHA 3DOKB 2FVRA 5J2PB 4ZLNA 1TV6A 1S1VB 5L8RC 5EUHA 4HLBA 3TA2A 4JI6J 3MMBB 3I9ZA 3TAPA 2Y9HA 4DX8H 4NA3A 1DTQA 4JI4J 2QN6B 2YWHA 4ZJOA 1VQPS 3NNCA 2D3O1 4ILLA 3FNNA 5MLCV 2YKQA 3ZTSA 4C0OC 3HHEA 2FZKB 1TVRB 4QYRA 4TU8A 2OP5A 3ZZZA 5IZHA 1U45A 2AX1A 5HLFB 3W2VB 2KI2A 1ICEB 2G0JA 4B3OB 1HNIA 1KN6A 2E1MC 3TQEA 4O3RA 2B9XA 1RHQB 1VK3A 1RWWB 3PHEA 4DPTA 2KRRA 1YQHA 1WG1A 4DR7F 1REVA 2HGLA 1FI4A 3TRGA 1AXQA 2NXJA 2PFFB 2D1CA 4X64J 2LP4A 2MPUA 2M88A 3FRYA 4ZN1A 3A8IA 4DFJA 1LV5A 1NXIA 3G8SA 4PWDB 4RNOA 3QSIA 3QGHA 2BYCA 1S6UA 2LA4A 1S1XB 2WVCA 1YJWS 2ASLA 1T95A 3ILJA 4IR1A 1EP4A 1FD2A 1CJKB 3EDRB 4C48A 3BQ1A 3HKZD 3NGTA 1KHVA 3BN7A 3J80U 4YR2A 1N32J 3GQCA 3MCSA 2H1YA 4KT0C 5DDOC 4IFYB 1CS4A 4UQGA 1IKXB 2R8GA 3RAXA 2H65B 1SJFA 1Y5IB 1MN9A 2AV5A 4U8VA 4LQ3A 3THPA 4H4OB 3DLKA 4ZLJA 3ZNUA 3J7A1 2HBYB 3W5ZA 3OHBA 2Q6BA 1RLCL 5D0GA 3KG4A 2GIQA 1RWXB 3T19A 1ZAVA 2VFUA 3QO9A 3DM2B 2PMWA 4URQU 1NEEA 4WYLA 2OI2A 4DUTA 2K7KA 4YUDA 1D9FA 1ZTWA 4RWXA 2YWGA 1HBOB 2FJAB 3TVZA 3T1YJ 4OHZA 2RDIA 2Q1LA 1HPZB 2ASJA 4CM2A 4P2SA 3RR8A 2EFOA 4C6AA 3LPYA 2ZZNA 1H0HB 2N82B 3CJ5A 3N4WA 3QAEA 4DV7F 1Y00A 3NGDA 3ENQA 3KK1A 2DNRA 1SKSA 3V6DA 1T03B 2CUYA 5KG5A 1FRHA 3L95X 2EI5A 4X4QA 4MIWA 5GVQA 2AYEA 2NSBA 4DV3F 3J80Y 3IO1A 2F7VA 1MU2A 3EGNA 2IMWP 2VFRA 5HMYA 5CYMB 4JV1A 1N5TA 4W4MA 4Q44A 3R5BA 4DR6J 4QW9A 2KJVA 3C15B 1NJYA 1ROFA 2VBXA 3CJ8A 3L09A 3QT6A 1HQUB 5ETTA 2J7UA 2XHCA 2F63A 4JI7J 2BEFA 1TAUA 1C2PA 4DR2J 1RCXB 4C8OA 3RTVA 1DQAA 3BF4A 1SVDA 3M2UB 1BQMB 3UCUP 2CJYB 2E1RA 1X8DA 4ELVA 1KNZA 3KUHA 4I7FB 2J0QD 5C7PA 3FBBA 1RWPB 3TA0A 1TK0A 3L7OA 5A76A 4RX6A 1QJHA 1R8AA 4DL7A 3KDNA 4O44B 2R7SA 4OV1A 2L41A 1X0PA 4FS2A 4Y2CA 3GG0A 1SL1A 3DRSB 4G1QB 2HAIA 3T3FA 1RAGB 1JJCB 1QUVA 5B08A 3OR2B 3G6VA 4ECXA 3FSIA 2Q66A 5A8KB 3B8HA 5D4LA 1TQLA 5F41A 5KFEA 4IRDA 3FCHA 1U1KA 3C16A 2RT3A 2HFVA 2NXEA 3MF5A 3FK4A 2OTLS 2ZH6A 4LRBA 2HVHA 3ICLA 2YTCA 4DQRA 3B54A 4TU9A 3MI7X 3H0PA 1T8EA 1VRTA 1NDPA 2XY7A 2GFFA 1YJVA 4C8MA 1BGXT 2JC0A 3TUJC 1NHKL 4KFBA 2GJFA 7FD1A 5CAAA 4ID5A 5CZXA 5KFIA 4URSA 3DXBA 2GVDB 4OL8A 3CWJA 1T9XA 2N4CA 2VD3A 1BLUA 3GE9A 2P9EA 4JUZA 3FMWA 3VVTA 3ZTPA 3DRRB 3BGUA 1JLCB 4EBEA 1RTHB 3NNAA 3ZZOA 2A6OA 4WCEQ 1DHMA 5GMKa 3QBCA 4ZCKA 2JHEA 1UA1A 4C11B 3PW5A 1VLYA 2Z2LA 4QR2A 3F73A 2AZ1A 4EYIB 1QDUB 3KLIA 3ETOA 4F0MA 4NXMF 2J0WA 1IKVA 2DR6A 3P96A 1LWFA 3UDVA 3S1TA 5HVFA 1UTAA 3JSMA 1NKEA 3PX6A 3M8ZA 3OLBA 2UXDF 5D0EA 4MH8A 3GR0A 1W2IA 4HHUA 2ZDOA 3FZ2A 4KGXB 3WBZA 3OL9A 1XNRJ 3AY0A 5E3CA 4USHA 3SQGB 4CH7A 3D67A 5HAOA 2OPRB 2EEYA 3RW7A 2BUNA 4CLSA 2JL9A 1KBRA 1P27B 1QSLA 2GC8A 2KXFA 2W7PA 5A0YB 1F3VA 1HWUA 5LJ5Y 2QEXS 4JI2F 2DNQA 1Z1ZA 1MROA 1ZETA 2KXNB 2ROPA 4E0DA 3CMAS 4LVOP 4O3PA 4OYAA 5BYRA 4AT1B 4EUVA 3PW4A 2LMIA 2ACMA 1SKWA 1Y3JA 3THVA 2WTFA 5B0GA 4A46A 1NSKL 4IOBA 2YWEA 1P1LA 1LQ9A 1RT5A 1PAEX 2JLEA 1RBOB 3ZZYA 4QU6A 1TTHB 3AH6A 3GYGA 3QIPB 2EK6A 4RNNA 5H9FJ 1WACA 3BBCA 3ZC4A 4RUCA 2OAUA 4ALZA 4DV6J 1SB6A 4XTTA 4LBHA 4QOTA 4DF4A 2XMWA 1N48A 1N0UA 3A13A 2JVRA 4KYZA 1XMBA 1NK0A 2I6WA 1VQ5S 5CYQA 3OTOF 2VC0A 3DRPA 1RDRA 2V34A 5E33A 4J9RA 4Z2XA 2P6TA 3DOKA 4RUHA 5J2PA 1U24A 1BY9A 1NZAA 1FA0A 1RYRA 3ETMA 4CT9A 3MMBA 2HBRB 5SZTA 1BE4A 2PN6A 1KLNA 2DRBA
chains in the Genus database with same CATH topology
2BACA 1UVLA 4M94A 2ZH4A 1S6QB 2EKYA 1R8HA 4NCBA 2DTJA 2OFGX 3DOLA 1U1LA 2RNEA 4NPOA 2DGVA 1KONA 3EXCX 2AYBA 5I3PA 3EPGA 2JEFA 1HA1A 2ILZA 3SYZA 4NOHA 1YJNS 1DTTA 4AL6A 1TVRA 4RNFA 3J7ZT 4ZP6A 2QIFA 2KDOA 3GR1A 4FZVA 2O3DA 3SV3A 2VOPA 1K1SA 4ZCIA 1SH3A 2I1RA 1CPZA 5GAEI 4K4XA 2CQDA 1G1XA 5D4PA 3FVYA 4R0EA 3N01A 2N7CA 4ZHRB 2JX2A 2K1RA 3PW2A 1IM4A 3F44A 3MM7B 3WDOA 4DR6F 3V6HA 2ATLA 2OD4A 2DHAA 1KEKA 4RU9A 3W2VA 4DS5A 3Q23A 2BQ3A 1SV5B 5DG8A 1JLAB 2CG4A 2W4CA 4DPOA 3QIPA 1LW2A 4NCGB 2I9SA 5J2MB 5DLGA 1NK7A 1OPZA 1R27B 3M4XA 1B7FA 5T41A 2HFZA 1Q79A 1VRUB 2E5JA 2MKJA 2LCWA 4OFZA 5GAHU 3KLEB 2RB7A 4KB7A 3MUVP 4NLYA 2BM1A 4QQBA 3M9OB 3CCVS 2O67A 4Q45A 1ZBTA 4V19X 4USIA 3T1AA 1IUJA 1N0VC 4C9DA 4JI7F 2POKA 4RUAA 1TKZB 1FD8A 1YVFA 2XULA 4ZVFA 2ZNYA 4JBCA 1RKIA 2OMOA 2IFXA 2RSQA 3IRXB 4I68A 4ZPDA 3M8RA 4UQTA 2FLOA 4C4WA 3LUYA 3MD1A 2XO7A 1X4CA 1HNVB 3R5CA 3PW0A 3J7Z5 3KOAA 5GADI 2HMIB 2DNOA 3ZZTA 4X4UA 4IRKA 2OPPA 3U02A 2KG0A 2FHKA 3QZ8A 3KTQA 3PRDA 2B7CB 3LO3A 3LANA 2HNDA 2FB0A 1GT8A 4KSEB 4NLTA 5DETA 4R5PB 4DF8A 5KFMA 1VQ6S 1FERA 1LK7A 2OTJS 3O1LA 2QZ8A 4H54A 1V3RA 1VS3A 5F8JA 1WHVA 1QSYA 1LXJA 3MEDB 3OPKA 5I3UB 3NMAA 2OIHA 1JLQA 3M05A 1U09A 5KTQA 4J9SA 1VIOA 1VBZA 1B0PA 2CVIA 3AAWB 3RRKA 5GAGI 2M4MA 3DYAB 2W4DA 1U49A 4IDKA 4J37A 2W8KA 2DGOA 1CG2A 1V3ZA 3I32A 4CQ1A 2XCAA 2FHMA 1XR5A 3LALA 3ENVA 4L3NA 5C25A 4WKRA 4N5SA 1S6PB 4B9UA 2IAJB 1P1TA 3LW5C 3MURP 3MR6A 2ZBCA 3IAM9 5KFKA 1WHXA 3KLFB 1ZH5A 2PO4A 2KB2A 1NO8A 1HQEB 3DXSX 2KVIA 4NLWA 4QIVA 4ES3A 2I8EA 4ZCMA 5B7WA 4OLPA 2V4RA 4J9OA 1IBMF 2UZAA 2AU0A 4B3SF 4K4VA 1RK8A 4ED7A 3X1LB 3IWNC 4A8SA 1BQNB 2DIVA 3V81B 3PM9A 4DSEA 2VBWA 5AE1A 1DJ0A 2MGZB 2V9WA 4U7UK 3K8WA 1SUQA 1S1TB 4DR3F 1V6HA 4AYBD 4NRTA 1Y9OA 3MM5A 4ZPTR 3A8EA 2ZD1B 1TKTB 1F5CA 1B0VA 1TL3B 1RT3B 3BSOA 4HT5A 1QM9A 2R7UA 4FVMA 3MECB 3LAMA 4ITSA 2C2RA 1VK8A 2Y1JA 3SDEB 4N56A 2VFSA 4MKAA 2CQCA 2ZBIA 3AHPA 4DV2F 2FVSA 1Q16B 3Q0AA 1QAIA 1M5KC 4KQZA 2P6SA 4CNZA 2X1BA 4J9QA 3IBWA 2V5HG 2RRBA 2IVFB 2HWIA 4I69A 4KIAA 1SIWB 4RW7B 3KMQA 4WK3A 4DL5A 3KWMA 3CDBA 5DM6Q 1KHWA 2GV1A 2NR0A 5KG6A 4DV1F 1FRMA 4CTAB 4NWBA 2KO1A 3HLUA 5A8WB 3ISND 2P5VA 1OO0B 4K4YA 4XK8C 1U4BA 3VAKA 1X5SA 4ED3A 2F9JA 4IFYA 2U1AA 4LF9F 3HKWA 4G1IA 4DLGA 1L5UA 3QGIA 1IKXA 2UXCF 2YNIB 4ZHRA 1AFJA 3P3DA 2PA8D 1KQKA 1BWEA 3MM9A 1VC0A 3PR5B 1RWUA 3TAMB 5KFJA 4LFAF 2E9TA 4EWTA 2KYXA 1JLFB 4PKDB 5J2MA 1NHVA 2B4OA 3O8WA 1JIHA 2WK4A 3D1QA 3RW6A 5DQGA 2C2EA 3TARA 3L7PA 4M8LA 3VAHA 2V4JB 4ZS6A 3KLEA 1FRIA 2IM0A 3GB0A 3VAIA 2DGXA 5KFUA 2GQCA 5IT0A 2KG1A 4PG5A 3CD5A 3MMCA 2ZHOA 3JYTB 1R31A 1NH8A 2KZMA 1HBUB 2YNHB 4YY3F 2UXBF 3S8SA 4DV5F 3PO4A 3C8YA 3HMJG 1URRA 5LJ3Y 3QGPA 2GHWA 3AB2B 2CFXA 3LQVA 3HHNB 5KOWA 1CEZA 2ILYA 3Q8SB 4C3LA 4TNOA 3J7YI 3WZ0A 3EPIA 1X4FA 5D4OA 2DH9A 3BQ0A 5IT4A 1N5YB 5KFSA 4R5PA 2OPSB 4FP9A 4CO1A 3OW2R 1VQLS 4B9NA 2EFQA 1TL1B 5HMXA 1VQ7S 1HPZA 2F40A 2XB2D 2ZC4A 3MEDA 5K8NA 3MZIA 3E2EA 3RU0A 4A8FA 5KAKA 1FDBA 2W8LA 1NK8A 4PCQA 2OJ3A 3AB4B 1WF2A 2QRRA 4C3KA 1MMDA 2FVCA 1RT2B 4BWJA 4NLDA 2Q3PA 2F1FA 1UFWA 1OIAA 5JVHQ 1VHFA 3LGMA 3RAQA 4DLEA 1WF1A 4HDGA 2DGTA 1S6PA 2OFHX 1JXLA 1SL0A 2IAJA 2ZH2A 4E8UA 5H1SV 1C1BB 3Q8RB 2B4PA 2PA3A 1T03A 1UEVA 2ZFHA 2DD8S 1ZAWA 3I0SB 2ZH3A 4TU7A 2WHOA 4OJ1A 1KOHA 4OI3A 1Q4RA 2DCUB 1T02A 2KRBA 2GJIA 2UV8A 1EETB 3TA1A 1N8RT 4OHXA 3ONQA 2IA6A 3V81A 3KLVA 2C28A 4PUOA 1ELOA 4QPTA 5E3RA 4HTIA 1S1TA 3HVTB 1VOMA 4C3MA 1WD6A 4K50A 1HBMB 1TL3A 2YKNB 2R8IA 4PG6A 1N5VA 3LP1B 4DBQA 3G6YA 1DLOB 2EFNA 4ZLPA 3CC2S 4KHMA 1X4DA 1WTFA 3DLJA 2EW9A 2N7YA 5D78A 4XPEA 4QR1A 2J9DE 2FLPA 1S1WA 2I5JB 4ICLB 3KLGB 2XLKA 5L9NA 3R5AA 5FDLB 1XNRF 1FJCA 2HIQA 4DN9A 4DN0A 2HS3A 4ES1A 5CYMA 4B9TA 3HM9A 1FRLA 4OI4A 2UUCF 2AF6A 1X7VA 5GAHI 1IKWA 4CTAA 5IT9Y 5M2UA 3L3CA 4PXEA 3UW1A 2I2YA 1IXKA 4ES2A 4UY8T 1VIXA 3FGVA 1FXLA 2MQLA 2Z4PA 2FVPA 3THTA 2DR7A 2F3JA 2UUBF 5J1NA 5DJBA 4C98A 3PY8A 4RBUA 3TI0A 4OX6A 1TV6B 1MWZA 4JI6F 1S6OA 1FF2A 2RILA 2XZWA 5KG0A 2DPIA 4RU2A 5M2PA 5J2QB 1N4LA 1U1RA 4I56A 3FMBA 5KOXA 3M32B 2XY5A 3T1HF 2EG1A 1WNEA 4Q2LA 5HROA 1YIJS 2CQ4A 2WB4A 5J2NB 4DL4A 3DGPA 2QYCA 5KFTA 5CZVA 1N33F 1A9NB 2CZVC 4K5RA 1TKXB 4ETXA 1VQ9S 4X4OA 3M9MB 4JI4F 1DTQB 2X1GA 3KJVA 1SH2A 4QWDA 4F2SA 1BQMA 2X51A 1ZTTA 1S1UA 2Y1RI 3S7RA 5IWAF 4F25A 5T7LB 5D3GB 3JYTA 1P9QC 3W2WA 4OZNA 3RB3A 3CF5Q 2EBGA 3ISZA 4I7FA 5E2QA 1U1MA 1X5OA 4EZ9A 4WZMA 1UVKA 2B9WA 4DV4F 3OVBA 2W4PA 4Y34A 5KT3A 2DGQA 3C6TA 5F8MA 2JWNA 4TYAA 5HMWA 3OJSA 1DQ8A 2L9WA 4BC7A 2JEJA 4OX9F 1DRZA 1FE0A 3B4DA 5AXNA 3PEHA 4LFCF 3MXHP 2NPFA 5HMZA 1N6QB 1FRKA 2YKMB 2E1CA 3IAS9 4RZRA 4N77A 3M8PB 2PT0A 3B82A 1E6VB 4O44A 4OLOA 3MUMP 3OSNA 3K59A 2DJWA 1YBAA 2VG5A