1TVRB

Hiv-1 rt/9-cl tibo
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
427
structure length
427
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Aspartyl protease
molecule keywords REVERSE TRANSCRIPTASE
publication title Crystal structures of 8-Cl and 9-Cl TIBO complexed with wild-type HIV-1 RT and 8-Cl TIBO complexed with the Tyr181Cys HIV-1 RT drug-resistant mutant.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 (clone 12)
total genus 87
structure length 427
sequence length 427
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1996-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1tvrB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1tvrB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1tvrB03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1tvrB02
4NRTA 2W9CB 3HVAA 4ECXA 4RW8B 5DGBA 5EUHA 1VRTB 4DL3A 3CJ5A 4R5PB 1TP7A 2W7PA 4O3RA 2W9BB 1S1WA 5F8MA 4KFBB 1ZTWA 4HKQA 3H5SA 1D1UA 1IKXB 1S9EB 4PWDB 3BGRB 5C24A 1W25A 2UVWA 4ID5A 4IKAA 4RNHA 3UQSA 1QE1B 4ZPBA 2ILYA 2FJXA 4O44A 3DRRB 3FFIA 3CDUA 3LAKA 4IG3B 5KT2A 1BQNB 3HVWA 2R2TA 1GX5A 3GV5B 3QLHB 4WE1A 3T19A 3ITHB 2OPPB 1HARA 5KFYA 2WK4A 5JUMA 4J9PA 4TQSA 4EYIB 1NHVA 3V6DB 2J6TA 2YNIB 3QO9B 4NCGA 4YQWA 5HROA 1S10A 2C2DA 1S4FA 4Q8EA 4WZMA 3NL0A 2BE2B 1RTHA 3H5XA 2IJFA 3DLEB 3BSOA 4J9MA 4ZVGA 5KFJA 2D3ZA 2XWYA 3DRPA 3IG1B 5KFMA 4Q0BA 3NAHA 2WHOA 5KFXA 3KNAA 1TKZB 2JEIA 3CIZA 1TVRA 1TKTA 5J2MB 4KO0B 4I2QA 4ECZA 1HPZA 4PQUB 2GIQA 4ZP9A 3KLGB 5I42B 1FKOA 1RTJB 3H5YA 1S48A 4K4WA 4YP3A 3MECA 2ZKUA 3CWJA 4WXWA 5KT6A 3GV7B 3H4DA 1S1VA 1IM4A 4RW7A 2DPJA 3PW4A 2ASDA 1JLAB 4KHMA 4H4OA 2WOMB 4JV2A 3DM2A 4R0EA 3RB4A 5KFLA 3QIDA 1RT7B 4G1QA 4Q45A 5KFEA 1S1XB 5CYMB 5KFFA 3C6UA 3CJ4A 1HNIA 1MMLA 2IAJA 5C5JA 1QUVA 4ZPAA 3OL7A 1S1WB 4O4GA 4ZVFA 2W7OA 1T94A 3OHAA 4J9OA 5KFVA 4IRCA 4NLPA 2FVCA 4DL7A 4RU9A 1C0TA 1RYSA 2R8KA 3MEDA 1RT2A 4KE5A 4M95A 3RAXA 2DPIA 3EPGA 1RTIA 1JIHA 4YR3A 2W9CA 5KT7A 5L1JA 1JLQA 2CJQA 4RW8A 4DL2A 4WE1B 4F4WA 3BSNA 5L1LA 2W9BA 3KOAA 2HNDB 1DTTA 4KBIA 1IKXA 4NLRA 1DTQA 4PWDA 4URGA 4F50A 4ED1A 2JLEA 4QWAA 2JEJA 3I5CA 4MKBA 1RTDA 3UDLA 4LQ9A 1J5OA 1RTHB 1JLBA 3Q8RB 2VG6B 3DRRA 1HMVA 4MK8A 5KFPA 1HQEB 3OHBA 3RB3A 2AQ4A 3QLHA 1S6PB 4IQXA 4URSA 4NLDA 3ITHA 2OPPA 4WFYA 3H4BA 1DLOA 4Q0BB 5T14A 3G86A 4IRKA 5EWGA 2YNIA 4NLSA 4LSNA 1N56A 3PHEA 4ZP7A 1RA7A 3M8QB 4I2QB 1N6QA 5DG8A 3T5KA 5DGAA 2BE2A 2HMIA 4Y34A 1FK9A 4PUOA 4ECYA 3BJYA 3DLEA 3TVKA 1FKOB 2R8HA 2BQUA 1SH2A 4WYWA 5HBMA 3IG1A 2HWIA 1S1VB 1LW0A 3GV8B 5KFOA 1S1UA 5F8NA 5J2MA 1C0UB 1UWBB 1XR6A 2ILZA 2WRMA 1S6QB 4H54A 3KLVA 3DM2B 2XGPA 2IA6A 1JLEB 4PQUA 4TQRA 4G1QB 1R0AB 2V0NA 1N48A 4IRDA 2OPRA 2ASLA 4F4YA 1EETB 2AGPA 1RYRA 1HNIB 5HLFB 4O4GB 1KHWA 3CJ2A 4KAIA 4NLOA 5DQGA 2I5JA 1RT2B 1RT7A 1REVA 3MEDB 5F8GA 2EC0A 2HWHA 2XI2A 1RTIB 1S1XA 1LW2A 5CYMA 4TYAA 5DQIA 3UPFA 2ZD1B 5DLGA 1JLQB 5KG5A 3Q8QB 2XGQA 2JEFA 3NMAA 3QZ8A 4K4UA 3M8PB 2XI3A 3UR0A 3SFGA 4IG0B 5K14A 2RDIA 1YVFA 4XPCA 3MEEA 1TQLA 1DTTB 5KFGA 2UVVA 1DTQB 1T05A 4IFVA 3H59A 1RT6B 2YKNA 3I5BA 4MH8A 1RTDB 1GX6A 3QGGA 1ZTTA 1J5OB 5KT5A 2BR0A 4GC7A 1JLBB 2JC0A 4ZVEA 1HMVB 3RAQA 3GIJA 1LWFA 4RZRA 2ZE2B 1K1SA 3JYTB 4NLGA 1IKWA 1Z4UA 3MF5A 2IM1A 2FVQA 2IM2A 4R8UB 4TY8B 1DLOB 1RT4A 1HQUB 2RF2A 2HNDA 3T5JA 1JLCB 2VG5A 2AX1A 4NLYA 4LSNB 3V6JA 4Q43A 2FLLA 3MTKA 4K50A 1N6QB 5EWFA 2HMIB 1FK9B 4PUOB 2VG6A 3KLIB 3QYYA 2FJVA 4F4ZA 1HQEA 4MIAA 2AWZA 5KG2A 3V4IA 4RUAA 4GC6A 1CSJA 1S6PA 1FKPA 4DL4A 5HBMB 1LW0B 4I2PB 1I6JA 3HKWA 1LWCA 2UUTA 2O5DA 1S1UB 3BSCA 3PJXA 4O4RA 5KG4A 5F9LA 4ED2A 1LWEB 4J9SA 5C42B 4TXSA 3M8QA 4NRUA 3KK3B 2ASJA 3CDWA 4Y3CA 3OSNA 1JLFB 3T5HA 3IGNA 3KHRA 2OPRB 1VRUA 3E01B 1RT1A 2IM0A 4IH6A 4KHRA 3DLGB 1XR5A 3PR5B 2W8LA 2C2EA 4I7FA 4JV0A 5KFKA 4WZQA 3DOLA 3KLFA 1OS5A 2YNHB 3GQCA 5DQHA 2V9WA 2V4RA 1SV5A 4MIBA 1C0UA 1UWBA 4QWBA 3CVKA 5KT3A 1S6QA 2I5JB 4NLQA 3OL6A 1JLEA 4IOBA 1REVB 1R0AA 4O3NA 2JC1A 4DL5A 3CDEA 3KMQA 1LW2B 1EETA 3DLKB 3V6KA 4EBCA 3D28A 4NZ0A 5KFCA 2E9ZA 5K14B 3BSAA 5HLFA 3MEEB 5J1EA 3N6LA 4YR2A 2BQ3A 2IJNA 1QAJA 2WONA 1T05B 4IFVB 4ICLB 4WFZA 1QAIA 2YKNB 2QE5A 1JXLA 5KFTA 2IC3A 5J2NB 4O3QA 3DI6B 2WB4A 1SH3A 5KFAA 2ZD1A 4TYBA 1LWFB 3G6VA 4K4ZA 4TY9A 1IKWB 3M8PA 3LALA 3LP0B 3E51A 2HNZA 4IG0A 3NBPB 2R2UA 3BQ0A 3VQSA 1RT4B 5KFBA 2RF2B 2HAIA 1RT5B 3T5LA 2WTFA 2VG5B 2ALZA 2AGOA 1C1CB 2HNYB 3NKYA 2J6UA 2IMWP 1RT6A 4Q44A 4QWDA 4ECQA 4ECUA 3Q8SB 4FS1A 3PW2A 4IR1A 4ECSA 2ZE2A 3V4IB 3JYTA 4IH7A 3G6YA 2I1RA 1S0OA 1FKPB 3C6TB 4RW6A 4O3SA 4R8UA 4TY8A 4B3OB 1HQUA 2YNGA 3GYNA 5L1IA 1JLCA 1LWCB 3H40A 2W9AA 3TQ1A 2C28A 2BRLA 5KFZA 2IBKA 3QIPB 1IKVA 3M9MB 4YR0A 4LQ3A 5KFWA 3KLIA 5C25A 2GC8A 4QW8A 4MKAA 3DYAA 3PVXA 1MU2A 2XC9A 5KFRA 1VRUB 4IH5A 4X2BA 4IFYA 3FRZA 1RT1B 2IM3A 2RDJA 3SI8A 5D3GB 1S1TA 4ED6A 4I7FB 3GILA 3RB6A 3QZ7A 3OSPA 4I2PA 2R8IA 3DOLB 3KLFB 1JKHA 4ED3A 1SV5B 1LWEA 2R8GA 5C42A 3KK3A 3EZUA 4QW9A 3MFHA 1JLFA 5F8HA 4TN2A 3PW5A 3E01A 3TAMB 3ISND 3DOKA 3JSMA 2AX0A 3DLGA 5KG6A 4WFXA 5EDWA 3MFIA 4K4SA 1TKXA 3PJWA 2UVUA 5J1EB 2YNHA 2YKMB 2WONB 1HNVB 4ECVA 1RDRA 4G3IA 4XPEA 2B43A 2IC3B 3RBDA 1N4LA 3G6XA 1T03A 4ZPCA 3I0SB 4XO0A 5KFNA 5JXSA 5DLFA 1T3NA 4EO8A 3Q8PB 3DLKA 3BQ1A 3ISNC 5I3UB 2HNZB 1N5YB 1K1QA 2YNFB 2VG7A 3LP2B 4TLRA 3M9NB 2V4QA 4ECWA 4RW9B 5FDLA 4J9QA 2BANB 4ICLA 3IRXB 1JX4A 4EO6A 4MK9A 5J2NA 5KG1A 3DI6A 4U6PA 5HP1A 5DG9A 1RAJA 5F8LA 3HVTA 4FBTA 5J2QB 2UVRA 3KLEB 3I0RA 1RT3B 3CJ3A 2B5JA 2OH2A 2RKIB 3LP0A 4RW4A 2AGQA 4RW6B 4K4VA 3NBPA 4QWEA 1S0MA 2JEGA 1BQMA 1SUQA 3CO9A 2YNGB 4ZPDA 1RT5A 1C1CA 2HNYA 3KHLA 3LAMA 4JV1A 4HYKA 1ZETA 1IKVB 4ED8A 4ZHRA 4QPXA 3DMJA 5F9NA 5C25B 1KHVA 3DYAB 5J2PB 1MU2B 3V6HA 4IFYB 3BREA 4WYLA 5DG7A 3C6TA 2UUWA 1TL1B 4ZP6A 4KV8B 2GIRA 5L1KA 1S1TB 4B3OA 3KK2A 1KLMA 3IS9A 4WXOA 3MR3A 3MR5A 1JKHB 4MFBA 4MK7A 2OPSB 3QIPA 3MEGB 2CKWA 4FBUA 4NLVA 4ED7A 4IDKB 1S9FA 4DG1A 3QGHA 4O3OA 2W8KA 1EP4A 3FSIA 3DOKB 3JSMB 1TL3B 5D3GA 3I5AA 5KFDA 4K4YA 3V81B 1TKXB 4IR9A 1S49A 4KB7A 1IKYB 1S9GA 3KHHA 5KFSA 1RA6A 1NHUA 5KFHA 2FJWA 1TV6A 3PZPA 3BR9A 4ZVHA 4U7CA 3PW0A 1JLGA 1T03B 2D3UA 3H2LA 3KLHB 3NGDA 3OL8A 2C22A 3TAMA 5KFQA 3FQLA 3RBEA 4M94A 2VG7B 3SFUA 4KKOA 3DDKA 4J9KA 5FDLB 1SH0A 4NLUA 3DRSB 2D7SA 2YKMA 3KK1B 3LP1A 4RNOA 1HNVA 4NLTA 3NAIA 4RNMA 4NLXA 4F4XA 2F8EX 4Q8FA 4H4MB 3GIMA 3I0SA 1C1BA 5HP1B 4RNFA 3PR4A 3KMSA 4J9NA 3HVTB 1C2PA 3I0RB 5CYQA 2B5JB 2FVPA 4RW4B 4LSLA 5I3UA 1N5YA 1HYSB 2B6AA 3KJVB 2YNFA 3LP2A 5KFUA 3MR2A 1BQMB 1SUQB 2OPQB 4RW9A 4EEYA 4Y2CA 2BANA 4JUZA 3IRXA 4FS2A 4EBDA 3T1AA 4ZHRB 4OL8A 3DMJB 4Y2AA 4K4XA 5J2QA 4DEZA 3KLEA 4ZMMA 1RT3A 5C24B 3QGIA 2RKIA 4ID5B 3OL9A 2E9TA 1S0NA 3M9OB 5F8JA 5KG0A 3OLAA 3GIKA 4O44B 3KK2B 1KLMB 3FFIB 3IS9B 2AU0A 3N6MA 5L9XA 1VRTA 4MFBB 4R5PA 3N6NA 2WCXA 3IN5A 1U09A 3H5UA 5F8IA 4KSEB 4KFBA 5J2PA 4ECTA 1D0EA 1S9EA 3BGRA 3HHKA 4DG1B 4NCGB 3KHGA 1EP4B 4DL6A 2XCAA 5HROB 1TL1A 4KV8A 1QE1A 3OLBA 2XCPA 4ZP8A 1S9GB 4IG3A 1BQNA 4NLWA 2OPSA 3H98A 4EBEA 5KT4A 3MEGA 1TV6B 2FLPA 3DRPB 1NNDA 1JLGB 3BQ2A 3PW7A 2R8JA 3V6DA 4IDKA 1TVRB 1TKTB 3QO9A 2ATLA 3LANA 1TL3A 1HPZB 4K4TA 2D41A 3V81A 4KKOB 2R2RA 1IKYA 4J9LA 4EYHB 3IGVA 3LP1B 4J9RA 3ICLA 3MECB 5EWEA 4QWCA 5KG7A 2FVSA 3RB0A 2FLNA 2VA2A 1C1BB 1TKZA 3KLHA 4RW7B 3EPIA 4ECRA 4URQU 4O3PA 3D5MA 4KO0A 4H4OB 5CYQB 4ED0A 2R2SA 4NYZA 4LSLB 5KFIA 2QV6A 3GIIA 2B6AB 1S97A 2VA3A 2BRKA 3DRSA 3KLGA 5I42A 3KK1A 1RTJA 3C6UB 1XR7A 3MR6A 3FDSA 2IAJB 4H4MA 4YMEA 2E9RX 5KG3A 4RUCA 3FQKA 2J6SA 1JLAA 4RNNA 2WOMA 2C2RA 2BQRA 1WNEA 3CJ0A 1HYSA 1C0TB 3KJVA 2OPQA 2FVRA
chains in the Genus database with same CATH superfamily
2FYXA 4O3RA 2W4DA 1IKXB 3UD4P 3BGRB 4C11A 4TVAB 4ID5A 4DUYJ 2EEYA 3CDUA 2GFFA 2R2TA 4LR8A 2R9LA 3PDNA 4WZMA 1I94J 3DDIA 2QSWA 3D3CJ 4ZVGA 2FJEB 2VBYA 2NCKL 4CO0A 2QLJB 1BMQB 1N5SA 1FKOA 2O1PA 5HQLA 2HK2A 3KFWX 4FF1A 3AD8C 4QBUA 3QIDA 3DRYA 5BJRA 4G1QA 2VH7A 2CQGA 5EX3A 5C5JA 3K57A 1HBMA 3A13A 1C4AA 1WDTA 4X64F 4F4KA 5L1JA 4WE1B 3HSJA 3BDEA 4ZVOB 1B4SA 4Y65A 2RRAA 2BX6A 2VG6B 3P5TL 4P74A 5FJ4A 4Z37A 3NNCA 4DFJA 1FJGJ 1DLOA 1RA7A 2JHEA 1T9YA 1H2UX 2BQUA 5B09A 4HL9A 4OX7A 5KFOA 3TNVA 3SQGB 3GYXB 4DPTA 1HD1A 1YBUA 1MW7A 3SZ2A 3IM8A 5ETPA 3OXLA 2Z0GA 4J9VA 5E3CA 2E7XA 5GMDA 2EC0A 2HWHA 5E3AA 2VPWB 2XGQA 3LH2S 4USTA 1TQLA 1DTQB 4HT5A 1RAFB 3QGGA 4DSLA 1F2HA 4DR3J 1AB8A 4AD6A 3JTNA 2FD2A 2IM1A 4LF7F 4B08A 1XTZA 4TY8B 1HQUB 1WEZA 2HNDA 2ZM6J 6AT1B 1JNRB 4UUXA 5EWFA 2HMIB 3M1VB 1HNXF 3R1HA 1R8AA 1ZZNA 5A8RB 1R8HA 4X4OA 3P45B 3LWLA 1UZHA 1MMDA 4ZKAA 2ASJA 4LF6J 1PAUB 3K5LA 2CZ9A 5KFKA 3I32A 2J7WA 2DHAA 2W24A 1KTVA 1JLEA 2DHHA 2X1FA 2RUSA 3R3TA 3R5GA 4AXIA 4ZIVA 3I4PA 2IC3A 3ILLA 1N36F 1WOPA 3OR1B 3BQ0A 3HHEA 3O3LA 1SJ3P 2YNGA 2LDYA 3BGFA 3MDFA 3H40A 3ET6B 1M1KT 2IVMA 4DCPB 1R0BG 4UZCA 2NS1B 5EHHA 5FLXY 1S1TA 4DV3F 3OSPA 1JKHA 3EVMA 5B7WA 3CJQA 2Z30B 2JNJA 3MFIA 3W3SA 1T7PA 2PA3A 2HBQB 2HVZA 1AZSA 4YFUA 3RBDA 3J81U 1V5VA 5DLFA 2H5JB 3M9NB 4QZVB 4DR1J 1R6YA 3D2WA 2YKQA 2WVFA 5KG1A 1LV5A 4ZLLA 2B5JA 1VR6A 4MJKA 3HCXA 1HI8A 4QWEA 4M5LA 1WKKA 3BPSP 4HYKA 2VDIA 3WIUA 3QWUA 3RJMB 1E6YA 3FCHA 1S79A 4ZP6A 3BV8A 4WXOA 3MR5A 1HQ2A 2CKWA 1RSCA 3CCSS 4FNHA 3RBZA 3GG1A 4O3OA 1EP4A 1RWNB 5HATA 4FVMA 1YJTA 4TU9A 1S49A 2GGPB 2DIVA 3ETOA 2NYHA 1XEZA 2RAQA 4M63A 2UUAF 2F4FA 1YJWS 1ZPWX 1NDLA 4Q8FA 4J9NA 3WBZA 5CYQA 5G0RB 2YNFA 3LP2A 1WKJA 3MCOA 1AROP 4C8YA 5GADI 5F8JA 1U2CA 2N4DA 2GHWA 1G1XA 1GT8A 3HM9A 2RU3A 2H4YB 5KAKA 1N54B 5HROB 1Q5YA 1Y5NB 3CCES 2RHQB 3J7A1 2R7TA 4GMKA 2FLPA 1KDNA 2RHSB 3V81A 2A3JA 4CYUA 1KOOA 1TFYA 1Y11A 2FLNA 5KOXA 4LSLB 1S99A 2VA3A 2V2KA 3KK1A 3HMJG 4DSEA 3FDSA 3LA0A 3B4MA 3Q22A 2KFNA 4ANDA 4JV5F 1WF0A 1FVSA 3ZTRA 3J7Z5 4ECXA 2NR0A 2OMLA 3W65A 3AB4B 1N0VC 3OR2A 1GQEA 2GQCA 4YB1P 3QLHB 4LF9F 4L76A 3FBCA 2V4JA 2ZZMA 2D3O1 2RRBA 3AXMA 4I2QA 3AJ1A 4JI3J 1R6VA 1C4CA 1K8AT 3GV7B 2KT5A 4L3NA 4XDCA 5A0YA 3NOGA 2HS3A 3CB4A 4R0EA 2XZDB 1UJ6A 1NK4A 1S77D 3ZTQA 2X3DA 4CTAB 4FF3A 2X3GA 3MMBA 4ZVFA 3D9BA 5HI7A 4DUZF 1LK7A 1VC5A 4PWDA 3VAKA 3N4WA 4CDIA 5KFPA 4F3OA 1XNRJ 2OIHA 2J8SA 2V8VA 1YJVA 2ZNYA 3MPUB 1X0FA 3NWRA 4X4QA 2HLTA 4ECYA 1UA0A 3U1MA 2J9DA 3C16B 5DO2A 1REGX 1S1UA 2MQOA 3GFYA 3C14B 1HW8A 1RWXB 4KQZA 2CQIA 5ETLA 4NEZA 2MQNA 3IFEA 4UTGA 5B0EA 2LQBA 3NMAA 2JEFA 2XI3A 1VFJA 3I31A 3KUHA 2HHVA 3MEEA 2Y3YA 4OZNA 1ACMB 3AOAA 2QZ8A 4KHPF 1Z4UA 4NX9A 2YQ0A 1Y4ZB 4CWBA 2YH1A 4L6V3 2DO0A 1XNQF 2GS8A 2W2QP 2XNQA 1KFSA 1HQEA 5KG2A 1T11A 2MXYA 1Q53A 3QFHA 3GSDA 2MKCA 2UZAA 2NXEA 5H1SV 2P6TA 2CJAA 3LGNA 2U1AA 3PR5B 2UXDJ 1OS5A 3FBBA 4ZCIA 2OEMA 1FX4A 2B7CB 5D0EA 1NSAA 1L3TA 2CQPA 4DF8A 5E0OA 2DNOA 5J1EA 2BOAA 3MM6A 4DPXA 2R7OA 4ZVUB 2OHDA 5HQ8A 1VIXA 1SKUB 2QT7A 2ZBPA 3OJUA 1FVQA 5KFBA 2OUGA 1TL4A 2AGOA 3MMAB 4WFNQ 2DR7A 2E5JA 4Y28C 5IS2A 5LMNF 4IH7A 2BRLA 2G1DA 3HHLD 1FJEB 2MKSA 1MU2A 4IFYA 2OSQA 3J7AN 3DNCA 3HHLC 3MFHA 1JLFA 2XO6A 3DOKA 2WONB 4I67A 2DIUA 3N5BA 1VBXA 4UF4A 3QGPA 3TEGA 3DLKA 5I3UB 2HNZB 1KTQA 3TUIC 2BKPA 4NA1A 2G2YA 2HBZB 4DN0A 1RWKB 2F63A 4QPXA 2ZH6A 5D4LA 3GU0A 5DG7A 4LF4F 2QL5B 1B0VA 3GTYX 5A2QY 5ETVA 4LF2A 3TUZC 1BY9A 3AJ2A 1IKYB 2N7CA 2FJWA 2DBBA 2GJ2A 1DRZA 5JVGQ 1HNVA 4RNMA 3OTEA 1W7WA 4H4MB 4YEAA 3UVJA 3I0RB 3MD1A 3M2UA 3D66A 3MMCA 5IFMA 4Y2CA 1WI8A 1MG7A 3BGOP 4K4XA 2DNQA 3GZ7A 1RISA 2LQ9A 3N6MA 7FD1A 4OZ3A 3W63A 2Q43A 3WC0A 4NZ7A 3HHKA 2E1MC 2V9KA 3TZWA 4I68A 5A8WA 4DV6J 1WC6A 4J9LA 3EWGA 2I0XA 4NXMF 3WDOA 3EVOA 5GAGU 1C1BB 2FIUA 4N8OA 4ED0A 2J8AA 4NYZA 5KFIA 2WSEC 2QV6A 2CYYA 3OTDA 3KLGA 1ITPA 1QSLA 2C42A 1VMBA 2CADA 2WOMA 4FXVA 4HTJA 4N77A 1CJKA 1RQ0A 4LFAJ 1RACB 2W7PA 2W9BB 1BXNA 2HWTA 1ZTWA 4FZVA 2YPYA 4ZPBA 2FJXA 3A3PB 3ISZA 1VHIA 4F3MA 4J9PA 3PCOB 3I9ZA 4GRSA 1RWMB 4DV5F 1NKCA 5D4NA 3CGIA 4OJ1A 1RTHA 4LF5F 1V5IB 3DRPA 3R7SB 2CPYA 1TR0A 3CIZA 3GJTB 2H9ZA 1FD8A 4ECZA 3W1YC 2GIQA 1NB7A 1RTJB 1RHUB 2HHTA 4Y2IA 3CD0A 3DGPB 2VKRA 1HHSA 1KVJA 2UP1A 1S1WB 4I6WA 2PO4A 4DL7A 1RYSA 1RT2A 2M0GB 3EPGA 4YR3A 4DR6F 4RW8A 4DL2A 1HI1A 3LUYA 1DTTA 2ZDOA 2XNRA 3UDLA 4X65F 2JDJA 4C3KA 2LQ5A 4Q0BB 1JK9B 2MJNA 2FY1A 5E33A 1YTYA 1LW0A 2XLIA 2B9EA 2F8MA 2ILZA 3A3NB 1IBKF 4A8OA 1FEHA 4OYWA 4PQUA 4LRFA 1R0AB 5MLCV 3PX4A 3IR7B 4QR0A 2DRDA 1RI7A 2NUUG 2W2OP 1HNWJ 3AHPA 1UWAA 3QZ8A 3GFXA 2KRBA 2RDIA 1NK7A 3EDQB 2Z2LA 2UVVA 3I56S 1SVDA 2RD5C 1HW9A 2L48A 4CT9A 5SUHA 4FPRA 4RR5A 2FVQA 5HJXA 3N0VA 1N6QB 3LPEA 4B9SA 4PXBA 4FN5A 4LRAA 1N8RT 1S6PA 1TL5A 1DBDA 3BSCA 4LSZB 1KONA 3KHRA 3E01B 1Z2LA 3BGUA 2XO7A 2C2EA 1HWLA 4JV0A 2YNHB 1S6QA 4O3NA 1VQNS 4EUVA 2QA1A 2O01C 3FZ2A 2V2QA 2XMWA 2IPOB 3N6LA 4M5DA 4BBYA 2IHR1 4TNOA 4K8RA 4RX6A 1C1CB 4OLOA 2IMWP 4DV4J 1J2VA 2MZSA 3TJ9A 1S0OA 1DJ0A 4OZ0A 4A46A 2CJYB 3KUEA 2CUYA 2YY3A 2BMBA 4CH7A 2ZH8A 4B3TJ 3OTOJ 1AT1B 3BKUA 3IBWA 3TAMB 3DOMB 4RWWA 1CC8A 1TL7B 2EG1A 3I87A 1YIJS 3X1LB 4ETZA 3CC7S 2O67A 2JJ4D 4FNIA 1X8DA 1TK0A 3PYGA 5HP1A 3HJFA 2QEXS 2JWNA 2HQFA 1K44A 2G0IA 3U7JA 2U2FA 3HVRA 1CLFA 1TAUA 5C25B 3UI3A 3KYLA 3BREA 2NXNA 4DQIA 3IS9A 3MR3A 4PG4A 4F67A 2OELA 2NXJA 4AUKA 4ED7A 1F3FA 3BBCA 2DHXA 4FPIA 3C19A 3IBFB 1FRHA 3BR9A 4LVNP 2UUCJ 3H2LA 5D0HA 2C22A 3CC2S 1VBKA 5CABA 1SH0A 3KXDA 2GMLA 4F4XA 4W90B 4O0NA 3JB9k 2RILA 1OPIA 1HYSB 3EGNA 5H9EK 1RUSA 1RCOB 3KTQA 1KR4A 1G4CA 4EEYA 3M7VA 5E7OB 3A8EA 4MYTA 1H2TZ 1N32J 2KFZA 1NH8A 3UNYA 5KG0A 3OLAA 2JLFA 1TKDA 2CIMA 4JI0F 2XTJP 3Q8YA 2QLFB 1H74A 2KT3A 3N6NA 4TKTA 2FZGB 3SDEB 4NCGB 2MKIA 1FKAF 2J9DE 4RUHA 3MEGA 1TV6B 1UEUA 2IVYA 4J5OA 1TL3A 1EZZB 3CC4S 4RW7B 1U6FA 3P6YC 1UJ4A 1SI9A 3G8QA 4MT1A 4JI7J 2UXCF 1JJ2R 1ELOA 2DITA 1SL0A 2MQ8A 4Z2XA 1D8YA 1QE1B 3VAGA 2YWEA 4O44A 1O51A 3ITHB 2WK4A 2QMUB 2C3PA 3D0IE 3EXYA 5HMXA 2HYIB 4J9MA 2MEWA 4QIEA 4UZBA 4U67Q 3A1YG 5GMEA 3H4DA 1RAAB 2XB2D 3AD7C 1S7IA 4KHMA 1RAHB 3MM9A 4G65A 3TQEA 3TVYA 2WVCA 1S1XB 1IR0A 3N28A 1HNIA 4UOCA 2VQEJ 5GVQA 4O4GA 4V19X 1VQ4S 2FVCA 2DPIA 4N8NA 1UW4A 2HEKA 4P7VA 1IKXA 2MSTA 4R25A 3MAHA 1NK6A 1N5VA 3JAMY 3ZZUA 1U47A 3RR8A 2VBZA 4NLSA 4YHHF 3PHEA 3DU6A 2AEJA 2BW2A 4HTIA 4Y34A 4QIFA 2N82B 1WUUA 2PSZA 3KG1A 1YI2S 4NCAA 2IA6A 2GX8A 4IRDA 2WVBA 2YBVA 3TZYA 2FHKA 5HLFB 1M5VC 1HWJA 4CZCA 5ETMA 3PFOA 3S01A 4DV1F 2A18A 3FSYA 1VRQC 2AYBA 2XS5A 2BA9A 4NLGA 1R8CA 2HPUA 2FLLA 3OXFA 2PMWA 3BPDA 2KFYA 2VJVA 1Q0NA 1FK9B 3DFEA 2VG6A 4F0MA 1U8SA 3DKDA 3Q0AA 2VUGA 4JI1F 2YX7A 4QOTA 2UUTA 4ED2A 3PJXA 5AT1B 4MKVA 4E8UA 3BDPA 2P5VA 1NXIA 4LBPA 4OI1A 3OSNA 2PFDA 4P9SA 2R7QA 5T41A 4YOEA 1SV5A 5KT3A 4IOBA 2M9KA 3M8SA 2GW8A 5IWAF 4YR2A 3NGUA 1T05B 5H9FK 1JXLA 4U8VA 2ZH3A 1LWFB 1SJFA 3ZTPA 3R6GB 1IKWB 4TY9A 3VQSA 1RADB 1T95A 1WC4A 3T9ZA 3W66A 1YZ6A 4HDGA 2ZBCA 3Q23A 3PW2A 4IR1A 1OYDA 3TEHB 4TY8A 1HQUA 2VD3A 4OYMA 2AD9A 2GC8A 1HWKA 5SZTA 3DYAA 1XQIA 3FRZA 4RBUA 3GILA 3QZ7A 2XMMA 3K5NA 3VGTA 4QJVA 3K5OA 1UFLA 3BYRA 5KG6A 5EDWA 1WHYA 4DL0C 1QAYA 1HIYA 3A12A 5JXSA 2K2PA 2E5LJ 2VG7A 3TA0A 5F0UA 4OZ2A 4JYAJ 3OR1A 1RT3B 3FMBA 4NA2A 4NA3A 1HNZJ 4JV1A 4ED8A 1W2IA 4B3RJ 2GIRA 4NASA 2BYCA 1A6LA 2CNOB 4DPOA 2EW9A 4CM0A 1TELA 1KQKA 4DOZA 3NNHA 3TX8A 4ZJLA 1B70B 2UXBJ 1H38A 2P2CB 5FDLB 2D7SA 4RNOA 2K7KA 3PR4A 1YJRA 3GCXP 3CCRS 1J5EF 1LXJA 2EBGA 2OFGX 2XM3A 4A4JA 2LQ8A 3FFIB 3THVA 1D0EA 1S9EA 1SC6A 1RKJA 3GWCA 1Q86T 1UEKA 3ENQA 1S76D 2GMJA 4EBEA 2H51B 5AE1A 5T7LB 3VVTA 1TVRB 2ATLA 1GK8A 3MOJB 3R9LA 2R7WA 2GGPA 5LSLA 1XERA 4F02A 2J5AA 1TKZA 1QM9A 2R2SA 3PNIA 1AFJA 4K7QA 2BRKA 4BLGA 2YPZA 3EVWA 1URRA 1ZAXA 1R27B 5KG3A 3FQKA 1IM6A 2MY8A 1HBOA 2F8HA 3NRBA 3HDSA 5ETSA 2W2NP 4F25A 4DV7J 1W25A 1IUJA 3OPKA 2DNGA 5KT2A 3V6DB 4P52A 4B3MF 5HROA 1QUPA 3HHLB 3M2RB 5E3RA 3NAHA 5KFXA 2KHDA 4PCQA 4FYWB 3DLLQ 3AODA 4JI2J 3H5YA 4K4WA 3GMGA 3S7RA 2RQCA 4P7TA 3PIPQ 1Q82T 4NE9C 1NRKA 4XIUA 2L9NA 3MPDA 3TJAA 4NLRA 1YQHA 2MPUA 3I5CA 4Y2MA 1HMVA 5CD4A 3QLHA 5T14A 1MN7A 5EWGA 4C8NA 2ZH2A 3VHQA 3NXZA 1HA1A 1CJUA 3QATA 1XN9A 4E2FB 2J76E 1WEYA 2MLYA 1JJCB 4YY3J 3OFEA 2J0WA 1C0UB 1XR6A 3M2VA 2PN6A 3V4MA 2ASLA 4M8LA 2W4CA 5DQGA 1X4GA 4U95A 2F5GA 5DQIA 3IO1A 3UPFA 1BUXA 1ULRA 4CTAA 2HGLA 5E3QA 1ZAVA 1FWKA 4FYDA 3I5BA 5LMUJ 4MH8A 2BR0A 1XMBA 2VPZB 3N9UC 3OFGA 4I6AA 3QNWB 3IC1A 1ZM4A 2PIIA 3T5JA 2VG5A 2B4OA 2VQFJ 1O0PA 4J9SA 2AV5A 5GMKa 5CYJA 1M5OC 3T5HA 1EB0A 2MMYA 4LF1A 2E66A 4WZQA 2V4RA 1BLUA 3R7BB 1RP5A 3C14A 2V50A 3CJKA 5AXKA 2E9ZA 5L46A 5L38A 4GKKJ 4ICLB 3EXCX 3NCPA 3P8BB 1F5AA 1JXVA 2KRRA 3IAM9 2LXIA 3A4TA 3MCSA 1I5OB 2RMLA 1KC8T 1CULA 1Y10A 1VQSA 3CNQP 4RW6A 1V3RA 3PRDA 1GXLA 4C48A 2AZ3A 4PPZA 2IBKA 4S0MA 2RT3A 1U6BA 1RU2A 5HJYA 1VDHA 1GMVA 1BWVA 1ZYQA 4IH5A 1RT1B 2C2OB 2E44A 4HDHA 3KLFB 3MUTP 3NGRA 3B6BA 2DGTA 1UFWA 4EZ6A 2H4WB 1AW0A 4P2MA 4G3IA 4KPYA 3RG6A 3IP0A 4DUTA 4CO3A 1N52B 4PABA 2OEJA 3MWBA 2Y8YA 3HFKA 2KXFA 4ZJOA 4J9QA 2AKWB 1X5PA 3BBFA 2UVRA 3CJ3A 2X1GA 2OH2A 4K4VA 2IY5B 3UD3P 4YB7A 3HK2A 1P6TA 1K0VA 4PYAA 3TW0A 4C98A 4OJ3A 3SXLA 3CDBA 5AE3A 1AUDA 2XWXA 2AJFE 3QBCA 3K58A 4FYVB 1NSQA 2CXEA 4IR9A 3CJTA 1WF2A 2RQ4A 4JP8A 4ZVQB 5JVHQ 1T03B 3KLHB 2XZWA 4DQQA 3LQVA 3W60A 4KKOA 3HD1A 3SSRA 5CHCB 3GIMA 1M5SA 1C2PA 5I3UA 3KJVB 3JTOA 2ZDPA 1WOSA 3FCWA 4ZHRB 3QAUA 2Y9HA 5J1PA 4ZCLA 4UY8T 5D4OA 2YQ1A 3H5UA 1G6BA 5DZ6A 5BXIA 4DG1B 3TZZA 1JQGA 1U1MA 2EK6A 1IQZA 4X4SA 2KYXA 2ZBIA 3EE3A 3H98A 4NLWA 2OTJS 2FZKB 4K0KF 2DNNA 4NI2B 1PAEX 3LANA 1IKYA 4K59A 2N7YA 4LVOP 2VICA 1GEHA 3H7HB 2G0JA 1Q7YT 4ANCA 4H4MA 2J6SA 2RUGA 3JQJA 1WNEA 4DS4A 2G2OA 4EK2A 3R2CJ 3GPAA 3CD7A 3W61A 5F8MA 1EHWA 3DLHA 4M5HA 2V6AA 1BQNB 2ZZNA 3D54A 2R7XA 3BGLA 2RU9A 1NZ8A 3IAS9 2C2DA 1S4FA 4E0DA 3DLEB 3WX4A 1Y3JA 5HL7Q 2Y8WA 1S7HA 2HRYA 1MMNA 3BS9A 5ETQA 3M6UA 4I1TA 3HZEA 2ZC4A 2M70A 2A2CA 4EGLA 5KT6A 4JV2A 5KFLA 5KFEA 2V69A 3CJ4A 3K8VA 1FJ7A 4FYYB 3M30B 1FX2A 4OHVA 1RTIA 1JIHA 1HBUA 4KH1B 4I6YA 1Q8BA 3BSNA 2E1CA 2W9BA 1OWXA 5B0FA 4A8QA 1WG5A 2MSSA 3WZ0A 1U48A 3VQTA 1LEOA 3L09A 4NCBA 4U7UK 2BJ7A 5FD1A 2HVEA 4IUFA 1UFKA 4OYBA 3UR3C 4BWMA 1SH2A 4UOFA 5CZVA 2W4PA 1SB6A 3QJPA 1LWXA 3DM2B 1NPRA 2V0NA 1TMJA 2BOPA 4YN3B 1OY9A 1N34J 4PPDA 2VF3A 3D6MB 5EN1A 1OSDA 3MEDB 1REVA 2ZD1B 1JLQB 3DGPA 2E29A 1PKUA 5KFGA 1TUVA 2XZTB 2IDLA 4B9VA 1XMOF 2JVOA 2MZJA 4FVCA 4W4MA 2ZE2B 2IM2A 5A8KB 3AQOA 3MTKA 4MIWA 1D8ZA 1FKPA 1TTHB 4OX9F 4FF2A 5ETNA 4I2PB 3HKWA 4O4RA 5KG4A 4CRJA 2R7SA 3NCRA 1VBYA 1VRUA 2C3MA 4J90A 4IH6A 2UU9F 2WBMA 2DR5A 2DYAA 3DOLA 4QWBA 2OD6A 1R0AA 3TA2A 1HBNB 1QTNB 2FHJD 2F1FA 4MYUA 3LPYA 2FY8A 3D28A 5KFCA 1QLNA 1TUGB 1BE4A 1FNMA 3AOBA 2DD8S 4I64A 1URNA 4GKJJ 2QFIA 3Q8SB 3GG0A 3D1OA 4B3OB 4QCLA 2EPIA 4OHYA 3W9JA 1RAEB 1G3OA 2XC9A 3EZ5A 5D3GB 1F9HA 3HLUA 2PMZD 2EI5A 2L3MA 1S0VA 2DNZA 3QSYB 1GTEA 3E01A 3A8KA 3UDCA 2YNHA 2BVZA 3G6XA 3R5JB 3RR7A 4EO8A 4DHVA 1NHKL 1NPPA 4EO6A 4F04B 3TI0A 4FBTA 3EGVA 1M90T 5L39A 4PYDA 1C1CA 2Q6BA 1MWYA 3U27A 3VAMA 3MM5B 2BV3A 2K1RB 4DX7A 3MHYA 2Q6CA 2B51A 3FSIA 3JSMB 5HMZA 3T3FA 1VQYA 1F2GA 2B4VA 4XK8C 3PZPA 2D3UA 3OL8A 3RW6A 3TAMA 3DOMA 3FQLA 2ZOGA 2C2MB 1TL7A 5E41A 3LP1A 2G2ZA 1ZZFA 1Y0HA 4NLXA 1FWPA 3HVTB 1TFWA 2FVPA 2I9SA 1JMTA 1BQMB 2B9YA 2F4VF 4OL8A 2MQQA 4DSIA 3T1YF 2POKA 4DEZA 4ZMMA 3MI7X 3GE9A 2NSCA 4CCHA 3KK2B 1U45A 1U09A 2UUBF 4WIIA 2OEKA 2E1RA 1U1OA 4LMZA 2EKNA 4ZP8A 1S9GB 1TKTB 5IOLA 2H5EA 4WPAA 4ZCKA 4J9RA 3KG0A 4BC9A 1NDPA 3DLJA 5EWEA 3RB0A 5KOWA 4ECRA 3CCQS 3DU5A 4OZ5A 4DN9A 1H72C 3GIIA 2B6AB 1RHKB 5EGYA 3PTWA 5I42A 4RL1A 2IAJB 1KD1T 5AJ3F 2M7SA 1HYSA 4C8KA 3J7YU 2DJWA 4OZJA 2MKHA 3MD3A 2EFNA 2IMOA 5CD4H 1Q79A 1A9NB 4KH0B 1NK0A 3D67A 3LAKA 1YG0A 1GX5A 2PI5A 3DXSX 1KQGB 3BN4A 3FK4A 2O3DA 4NCGA 4YQWA 3CIMA 5JJBA 2BBEA 3CW2C 3AA9A 4O23A 3FEZA 3BEGB 4CNZA 2M8DB 4KTQA 3CWJA 3FVYA 3NEKA 4B9LA 1VLYA 2ZKTA 4I56A 4RW7A 2CJBA 3GJQB 2N3LA 3RB4A 1RT7B 4X66J 2LDIA 4OI0A 1OQ6A 4ZPAA 2DGSA 1Y7PA 1T94A 4DR2F 1I3OB 2RH3A 3RBXA 3UDEA 4KBIA 4URGA 2KH9A 4LQ9A 1J5OA 1AFIA 2Z56B 2XY5A 4IQXA 3ITHA 5I3PA 1MROB 1X9SA 2KT2A 1CQNA 3T5KA 3H42A 1FKOB 2CPXA 2DHGA 5LM7E 4OJHA 2NPFA 4WYWA 5HBMA 1IWGA 4RPFA 2XGPA 4G1QB 1VOMA 1N48A 4N5SA 2E7VA 4K5RA 1KHWA 1RWVB 4CI0B 1Y3KA 2I5JA 4F7VA 1WJ9A 1S1XA 1LW2A 2EFPA 3B78A 1ICEB 1YVFA 1RT6B 2YKAA 1S72S 2KN4A 4R8UB 1DLOB 4XDDA 4FKYA 2AX1A 3FC9A 2G0CA 1KOHA 3PIOQ 1RABB 3KLIB 4MIAA 3MTJA 4WK3A 1D09B 3CSKA 4DL4A 2EBEA 4I0WA 1YRUA 2KZMA 4TXSA 6FDRA 3CDWA 1WSRA 2CFXA 5M2RA 1Q16B 1U4BA 3DLGB 1X5OA 4Q2MA 2GAHC 4KGMA 3QQCD 1NLKL 3UCZP 3WHIA 2JC1A 1FF2A 2KJVA 4DL5A 3CD5A 1X4HA 3Q86A 1GXTA 3CO0P 5EX0A 2ZVIA 3HT0A 5HLFA 1WACA 2QE5A 5J2NB 3O6QA 5B0DA 2DGOA 2HFZA 2J6UA 4ECQA 1ZOTA 2F9DA 3NOCA 1WELA 4PXDA 3C6TB 3QMQA 5DJBA 1SJQA 2KI2A 3JQKA 2FC9A 3VGVA 2XYHB 4DJBA 2AP6A 2IM3A 3RB6A 1IN0A 4Y2KA 4ZCMA 2XMTA 2HQDA 3TX0A 4X64J 1S59A 5DRKA 2IC3B 4XO0A 1H7XA 5HMYA 2J7KA 3AA8A 1WKLA 5B0BA 3DN9A 2HKEA 4JI8F 4USUA 2AT1B 4P72A 3IXQA 1FXLA 3CO9A 2YNGB 3KHLA 5D6GA 2Z58B 5F9NA 1KHVA 5J2PB 3ETMA 4HHHA 1D9DA 3HX9A 1S1TB 2E5GA 1KLMA 5A6PA 3SYZA 1JKHB 4GO7X 4MFBA 4CLFA 1VS3A 4M5MA 1S9FA 2W8KA 4K4YA 3CCTA 2IJRA 2CPZA 1OPZA 4OX8A 4ZVHA 4M5GA 2CPEA 1M1HA 3IA0A 3UDVA 2Q66A 5GAHU 4C2MA 3IWXA 3SEOA 4LF7J 2XS2A 2B5JB 4DLGA 3W5XA 1HNXJ 2GV1A 2HBRB 4RO0A 1NB2A 1RT3A 3QGIA 1E6YB 2E9TA 1O8BA 5ETTA 3GFZA 2AU0A 3AH6A 1HR0F 1VHFA 2K06A 4R5PA 2WCXA 2OAUA 4KSEB 4P2FA 4KFBA 1WOOA 4NXNF 1EP4B 2XCAA 1U0HA 4RUBA 3OLBA 2XCPA 4IG3A 2CQ4A 2R8JA 1N33F 3QO9A 3O44A 3ZC4A 4B3SF 1Q78A 5IT9Y 2KDOA 3IGVA 1N36J 3MECB 4F0KA 2VV5A 1CC7A 4URQU 4O3PA 5CYQB 3L4BC 3HFZB 2W2PP 3OUYB 1UVJA 2QYCA 2CPFA 1JLAA 2XY7A 3ZO7A 2VBXA 2DCUB 2W9CB 3AY0A 4DL3A 2ZH5A 1FESA 5DETA 1YSJA 4DV3J 2HGNA 3VZIA 3KKFA 3UQSA 4J91A 3FFIA 3T1HF 2JL9A 4FDFA 4DFMA 1EQMA 4WTYA 1RK8A 2CNLB 2ERRA 4ZS6A 1XC9A 1WG1A 3IG1B 1FEEA 2NPIA 4ZJQA 1QTMA 1TVRA 3GSIA 3M8WA 2YVSA 2OLWA 4NYOA 5LSRA 1JB0C 2V8PA 1IM4A 5BR8F 3BM7A 5CQGA 3J80Y 2NSBA 3ZXWA 2RE1A 2QTWA 1QUVA 3ENWA 3BKFA 5HMWA 2YKOA 3OR2B 3RAXA 2YWWA 2V2VA 2CJXB 2I6WA 1RTDA 2G4BA 5HN0A 2V4JB 1JLBA 4UUWA 4CLPA 2RRNA 2XSJB 1RLCL 4HI2A 1R7IA 2OKQA 4LSNA 3W5YA 4MMOA 2LMIA 2LYVA 4I2QB 2UUAJ 1HWUA 1XMQF 5LOQA 2CZ4A 3HHLA 3D6TB 3RTVA 2J7UA 3ELHA 3FUYA 3G71S 3GV8B 4DX5A 1UVMA 1QY7A 3T9NA 3CT9A 3NS6A 4TQRA 1FJCA 2HVIA 1RWOB 1T9TA 2OI2A 3JSRA 3MMBB 4ZVRB 4W98A 4ZK7M 4OV6A 2H48B 3F56A 1D3WA 3UR0A 2GJIA 2BJ3A 2GQQA 2HHHF 2I2YA 3E8OA 4KPCA 4DSJA 1B0TA 3RZAA 2Z4PA 5K20B 3V4IA 2Z2ZA 2QN6B 1LQ9A 1AXQA 1M1GA 1S1UB 2R4FA 5C42B 1IBLF 3MAAA 2DGVA 2WW8A 3C2PA 2H3EB 4JV5J 1WEXA 3R5CA 1U7LA 1L3UA 3M05A 3THPA 1C0UA 3OL6A 3R27A 4D3GA 5RUBA 4JBCA 3CCMS 3MEEB 4LFBF 2BQ3A 2IRXA 4WTOB 2B8QA 7AT1B 3BZQA 1NKBA 4LF9J 3LP0B 4HHUA 1SC1B 1RT5B 3TJ8A 2ALZA 2JZ5A 2BE9B 1UVLA 3D1HA 2HLUA 2AJQA 2ZH1A 2LCWA 3MZIA 4DWIA 2QA2A 2RB7A 5D4PA 5F3TA 3ISND 4CT8A 5J1EB 3PY8A 4DUZJ 4ECVA 4LRDA 2JRSA 4C0OC 2NUHA 3BQ1A 3ISNC 2OTLS 3MPYA 3CMAS 4RW9B 1X31C 4ICLA 1VJWA 1JX4A 3VF0B 3SIPB 5DG9A 5CCMA 4X4NA 1RAOA 2JEGA 2BJDA 2M3DA 1RZMA 4P2SA 1NU4A 1MU2B 3NP5A 2EVZA 4IFYB 4ZN3A 3OBIA 3OFHA 3TYTA 3CEDA 2OPSB 3PX0A 5KTQA 1NJWA 3DOKB 1T8EA 4DV0F 4L75A 1RA6A 3WC2A 1KSPA 4B9UA 1MWQA 5KFQA 2EK1A 3SFUA 2EKYA 5ETOA 2HVHA 5LXYA 1OYEA 4KHPJ 2V94A 4LUBA 1XNQJ 5KFUA 1PIEA 2FB0A 2YXLA 3ILJA 2YWFA 2CQHA 5IC6B 2RNEA 3F73A 2I8EA 3BH7B 1QSYA 3BO3A 2OJ3A 2B9XA 4DDFA 2IRUA 2ACMA 3ADAC 1Y5IB 3NMRA 4DQPA 3LGHA 4QR1A 3F0NA 2IVFB 3PW7A 4C0BA 4C9DA 1X4AA 5A6WA 1RU1A 3I4HX 4X4PA 1DQ9A 4K4TA 4V1Ak 3K5MA 2VFUA 4M5JA 3NLCA 3IBCB 3KLHA 3UVJB 4KO0A 2CQ3A 3M2UB 3MMCB 2ZH9A 2WVDA 3NGSA 5LMNJ 1DY3A 1LOUA 4NL5A 1LFPA 4H4KC 3KJVA 4IO1A 1D9AA 3KG4A 5B0GA 5DGBA 1X7VA 2AJ1A 3Q2SC 2UVWA 1YJUA 2E5IA 1KEKA 3W8PA 3IM9A 5ADZA 1O6XA 3SQOP 5A8WB 4Q8EA 1T9XA 1X0PA 1E6VA 6FD1A 5KFMA 2JFKA 3KLGB 3UN3A 1CJVB 2MZ1A 2ZKUA 1U02A 1S1VA 1QVFR 4QIGA 3PW4A 2OP5A 2WOMB 4OYZA 3HZGA 1IBMF 4AL6A 5CYMB 5KFFA 3HPOA 3UO0A 4LF4J 4CLWA 4KE5A 2AJ0A 4QR2A 2D69A 5KT7A 5HK4A 3U1LA 1RTHB 2FTRA 3Q8RB 3RB3A 1FDAA 1RGVA 3H4BA 3M32A 4DR4F 3G82A 3M8QB 3S6EA 4PUOA 3L7UA 3DLEA 3TVKA 4CO4A 2B3TB 1U2FA 4W92B 2A1BA 2J9EA 4ED5A 3BB5A 1UW9A 4HACB 4DR5F 5IM0B 3HSDA 4DX6A 4O0IA 3G8SA 2AJ2A 3I96A 3NY0A 3CF5Q 4NLOA 1RT2B 3MEKA 4JI4F 3M8PB 4F26A 4LFCF 1DTTB 4WKYA 2VC1A 4IFVA 3PHTA 2YKNA 3M30A 2JC0A 1PBUA 2LKZA 1RT4A 2RF2A 1V3SA 4DFPA 4NXMJ 4DQSA 4F4ZA 4PQAA 2HS0A 4GC6A 3ZZPA 1YJ7A 2DISA 2AF6A 1LW0B 4CIOA 1LWCA 2A2DA 1LWEB 4NRUA 4A8XA 2D74B 4ZPTR 2XSFA 4LBHA 1T9VA 4C8MA 1UPMB 2IIHA 2GVDA 1BQXA 4CLYA 1V9OA 4EBCA 3PEHA 2B56A 1QAJA 2XG8A 2HGMA 3UD5A 3DI6B 2ZD1A 4DV5J 4UOGA 2HNYB 4QWDA 4LF5J 4DV2F 2ZHOA 1Q8IA 2ZE2A 4AXJA 4P10A 1B0PA 1I1GA 2ZHAA 5L1IA 4AQYF 5A8KA 1IKVA 4LQ3A 1ZM2A 3FCVA 2CQBA 4I2PA 4QQBA 3CMQA 1MNEA 2DGXA 2J9CA 1KFDA 2PEBA 4ANEA 4K4SA 1TKXA 4M5DB 1RTZA 3R5AA 1R31A 4DR6J 1HBNA 4L72B 3JSYA 4CO5A 4ZIWA 4X65J 1JWWA 4Z7CA 3C66A 1KKHA 2R3VA 2BM0A 5F8LA 1GTHA 5J2QB 3VALA 4RW4A 4EFAC 3PV8A 1U2RA 4C3LA 3DMJA 1WDDA 1WORA 2L41A 4B3OA 1NJIT 1IBKJ 2CQ0A 1X4FA 4OLPA 1X9MA 1QD1A 3M8YA 1VYAA 5D3GA 4DZDA 2W7AA 4ITSA 5KFSA 2PI4A 1FDDA 4USJC 1RAGB 3T6BA 1KLNA 4DR7F 2GO8A 4ATNA 1YDLA 4WF9Q 2KG0A 5IQ6A 2KJWA 3EGZA 4NLUA 3T6JA 2P9CA 5HP1B 4G6VB 1LK5A 3RAQA 4A48A 4OHXA 4N56A 3X3UA 1V3ZA 3QT6A 3MAQA 3OV7A 4OYOA 3IS9B 1VRTA 1SC3B 5IQQA 4EI2A 2W25A 5IC4B 2XHCA 2B0GA 2ZJQQ 2K1RA 3H20A 2QO3A 1XBWA 2XULA 4ES1A 4A8YA 3B8HA 1RHRB 1L3SA 1EAYC 3JSBA 1SBRA 2VA2A 2MZQA 2NLWA 4X4UA 3UCGA 3QT7A 3EM1A 4A8FA 1L3VA 4YMEA 3GJRB 2G9OA 2CAJA 2GZOA 2KO1A 2HZAA 3HVAA 4QIWD 3K5PA 2B7BB 1FO1A 2YKPA 1D1UA 3MUVP 3I55S 3M4XA 1PO6A 1DQ8A 4EYIB 1KVKA 2YNIB 2BACA 5DS7A 1S10A 3NL0A 4X62F 2FHMA 2VFRA 2AHOB 3J81Y 3BSOA 4JI5F 1MWZA 2FLOA 2WHOA 1TKTA 1LKZA 2F9JA 1RE1B 1FERA 2HQ3A 5B08A 2KL8A 3UN5A 4AE5A 4RJVA 1NBEB 4ZN1A 5ETRA 2HFUA 2ASDA 3IWLA 1B7YB 1PYSB 1TAQA 4GVBA 4KYZA 2IA0A 4KT0C 2IAJA 3OL7A 2LU1A 5F3ZA 2VFTA 3D4JA 3EGWB 4Q7AA 3DXBA 2DHSA 3W7BA 3US5A 4OI6A 1Q95G 4F8RA 2FUG9 1PGZA 2Y0SD 2BJEA 2VIHA 3FKBA 4LR9A 1XIQA 2ZC3A 1IXKA 2UV8A 2R7VA 2E5HA 2EFQA 1U1QA 2BUNA 4ZP7A 1TU0B 3ILOA 1G2EA 1U1PA 5DG8A 4OFZA 4JI6F 2R8HA 2ALYB 3DHXA 4LF8F 3MUMP 5F8NA 2L9WA 1UWBB 3MM9B 3BN7A 3VAIA 1YWXA 1RHQB 1GMUA 3TZXA 2OPRA 2DKOB 2AGPA 1HNIB 3Q8VA 4YDDB 5A2QU 3W2WB 4O4GB 3SSQA 3CJ2A 1TUWA 4JI0J 1RT7A 5KG5A 3SMZA 4CQ1A 2NXUA 5K14A 2HQIA 2P6SA 4U9RA 3H59A 4ZVPB 2WB1D 1GX6A 1ZTTA 2V8HA 2ZBRA 3C3LA 1JJ4A 1VQOS 3O5TB 1JLCB 4NLYA 3OVAA 4K50A 1UP1A 1I6JA 1MROA 2PE8A 1P8GA 4OI3A 3KK3B 3N79A 1PYOB 4XAKA 3MPWA 4WK1A 1U8WA 4PXCA 2UXCJ 4I7FA 1B3TA 4L74A 4RKUC 2WZ1A 1RWUA 1YLXA 2LEAA 1FI4A 2K3IA 4PZVA 3GB0A 1P1TA 1NMEB 3OXGA 5DDPC 3BKTA 5KFAA 4TYBA 4ELUA 3K17A 4K2XA 1OSCA 2DGQA 4CLLA 3GFHA 3NKYA 4J7CA 1RT6A 3TO8A 3G6YA 2I1RA 2SXLA 2EC2A 4ZOSA 4R8UA 1L5UA 8ATCB 2CQDA 3CCZA 3JQMA 4DBQA 3QIPB 3B54A 3CCWA 3JXOA 4GO5X 2Z2MA 3QJLA 5KFWA 3KLIA 3PVXA 5KFRA 4OI2A 2YTCA 3LWMA 4DUYF 1SV5B 4PAAA 2JOQA 4N7TA 3VVUA 3PW5A 3DLGA 4WFXA 2YKMB 3KJNB 1I94F 1N4LA 3I0SB 5KFNA 3K7RA 4TLRA 2I38A 2HFNA 2FQQB 3HD2A 5J2NA 1RAJA 3MM7B 1UETA 2RKIB 1FT8A 4YHHJ 2QL9B 1EJ7L 1SUQA 1R89A 3LAMA 1B64A 5LJ3Y 1FNXH 3DYAB 2CQ1A 2QRRA 1SKRA 3C6TA 2RS8A 4KIAA 4KV8B 1S4EA 2MKJA 3BF4A 5AXMA 2F40A 1ZA2B 1FFSB 1RHMB 3ONQA 3I5AA 5KFDA 3OJSA 2FPHX 2HFVA 4WWSA 1JLGA 3RW7A 3NGDA 1FJGF 4P75A 4M94A 4DV1J 2VG7B 1ZA1B 2CQ2A 3DRSB 1UEVA 1PC4A 3KDNA 2LECA 1PG5B 3Q2TC 3UNGC 1MSWD 1NDKA 1P1LA 4LREA 4QYZJ 2QLWA 2XYGB 1Q1KA 3VV2B 4JI1J 1S0NA 1WF1A 3HFVA 1VIOA 4K2JA 2HIQA 3PG9A 1NM2A 3VZHA 1U6ZA 5J2PA 1VLOA 3PM9A 3SCJE 3BGRA 3KHGA 2HHSA 2VJUA 4U7UD 1OJ4A 4ZVTB 4DR3F 1NNDA 2LA6A 1GFWB 5IWAJ 3L7OA 2ZM6F 1HPZB 5K8MA 4PKDB 5GADU 5KG7A 3G2XA 4H4OB 2DXDA 2YX4A 2DNHA 2ZZTA 2VOOA 1LXNA 1RCXB 2ZUAA 4LF6F 2C2RA 3CJ0A 2MLZA 1GMWD 4FP9A 2PD1A 2C3YA 3CJ5A 2OFHX 3HXMA 1S9EB 1XWLA 1VQ5S 3SCIE 2KM8C 2CPDA 5FIIA 1S5ZA 4WE1A 5KFYA 1NHVA 3GYGA 4TU8A 2KVQE 2BE2B 3R1LA 4KRWA 3PXGa 2M2BA 1AUSL 3ZTOA 2D3ZA 1YJNS 5ETKA 1TKZB 2COLA 2JEIA 3PJ9A 5J2MB 1MN9A 3OQ2A 3MECA 2HZVA 1WC0A 2C2NA 3JS9A 4MTPA 2OD4A 1S6UA 3G6ES 1HBOB 1NEEA 3SQGA 1FRJA 2ASYA 3OUYA 3PYDA 3W2VB 2W7OA 1GXUA 2HURA 5KFVA 4IRCA 2YX1A 4RU9A 1XK8A 2BEFA 4M95A 2W9CA 3KOAA 1DTQA 4DR1F 1KQSR 2EFOA 2HW3A 1UJ5A 5M2PA 4KGXB 3HKZD 5DGAA 2HMIA 3M1VA 4MAKA 2XMUA 1TK5A 2DXFA 5A8RA 3IG1A 2F7VA 1APSA 1FTRA 2V5HG 1J5EJ 1EETB 2MKKA 4OX6A 1S12A 4PWUA 1HHQA 5DLGA 3EDRB 1R8PA 5K9FA 3SFGA 4IG0B 1A0OB 4IQMA 3FEXB 1YBAA 3BO4A 4ZVEA 1HMVB 1FHTA 2QMWA 5DM6Q 1RWWB 1SJ1A 4Q43A 3S8SA 3TP2A 4X4VA 5D15A 3ENAA 3W5ZA 1CJUB 5LJ5Y 2XSJA 2AYMA 4ID8A 4BDPA 2DXEA 3OFFA 5F9LA 1T0TV 3ET6A 1HL6A 3M2VB 1FNOA 2R7UA 1FDNA 1FFGB 3D6HB 1KQFB 2PDAA 5GAEI 3GQCA 4IOAQ 5IV4A 3CDEA 2LFVA 3V6KA 4DU7A 2IJNA 3POTB 3AJDA 5HANA 3G6VA 1IJFB 4HH0A 2Y1IA 3W8GA 4B3MJ 3NBPB 2VG5B 5LT5A 3AOCA 1NK5A 3TAPA 1H7WA 1P9QC 4FS1A 5L8RC 1SKSA 4ECSA 3TQ1A 3ILIA 2DNKA 2KKHA 2FGOA 2IRYA 1SJRA 4MKAA 4ED6A 3O2IA 1WG4A 4NEYA 4M5NA 5C42A 1VQPS 1OO0B 3EZUA 3CJKB 4NMLA 3HHNB 2B43A 4CLUA 1B99A 2VZ9A 3Q83A 3LO3A 1N5YB 2BANB 4JI3F 4LJMA 1CULB 3LP0A 1VK3A 5G0RA 4RW6B 4ELTA 1RT5A 1VCTA 4DX8H 4OIXA 4OV1A 2LQJA 4WYLA 4A8WA 2UUWA 2ROGA 4USKA 4IDKB 2KXNB 1H73A 4OYPA 4BHQA 5KFHA 3JAMU 1XNRF 2ZJPQ 2VONA 5CAAA 3TARA 5K8NA 3PFEA 4ES2A 2VKZG 3U02A 4LSLA 1VQLS 3MR2A 2OPQB 4RW9A 1KWMA 4JUZA 1EIYB 1GH8A 2LEPA 2DRAA 1SQGA 2KB2A 3M9OB 1JJHA 1H6KX 2K7JA 3QT8A 1NDCA 4ZDNA 5J1NA 1VQ8S 3DCAA 2HSEB 3UFCX 4AL7A 2M52A 4ERDA 4DPUA 2OPSA 1QAXA 4ZITA 2Z8QA 3CTRA 4LT6A 3CXCR 1F0XA 3A3OB 4KKOB 3ZNJ1 3SCKE 3BBBA 3ICLA 3EJMA 3EPIA 3D5MA 1YX2A 3I82A 1RBAA 4B17A 1IR1A 2B4PA 3C6UB 4PG6A 2AYEA 3R6LB 1HI0P 3FEYB 2UXDF 4HT7A 2W2MP 1C0TB 5IXUA 1DURA 4QU6A 5EUHA 4USIA 3MGJA 2LP4A 1TK8A 2F65A 4DSFA 4DFKA 2ILYA 3EYZA 4ILLA 3T19A 5JUMA 2OPPB 2J6TA 2IJFA 3SCLE 3G87A 3HSZA 2XWYA 4QIVA 3ZTSA 4YP3A 3C16A 4WXWA 3DC2A 2M88A 3EX7B 2QC3A 4LRCA 3ZZRA 1Z1ZA 4Q45A 1RAIB 4YB5A 2V8GA 2FHJA 2ZEJA 1WC1A 4J9OA 1LFWA 3KWMA 2ZWPA 3P4UB 2MQMA 3CCLS 3MM8B 4B9NA 2DR6A 5K5MA 2FGCA 4URSA 1SXLA 4X4RA 4IRKA 3D68A 3CMES 2MHEA 2EXUA 3D0HE 2MYFA 3FZBA 1NZAA 2BKOA 3CCJS 3VAHA 4H54A 4QU7A 2FDNA 1V6HA 3UWTA 4B02A 1CJVA 4F4YA 4RWXA 7FDRA 2WAQD 4LRBA 4OYAA 2DH8A 5F8GA 1RTIB 5CYMA 2W8LA 1HBUB 2GCFA 1WHWA 4USHA 3GJSB 4K0KJ 1UL3A 2GIFA 3MMAA 3QYYA 1H0HB 3HHDA 4N47A 3PYFA 5HAOA 3G4SS 2O5DA 2XEXA 3M8QA 1YGYA 4Y3CA 1M5KC 3IGNA 2IM0A 4KHRA 3E2EA 3CCUS 2CJ9A 3P96A 5LSOA 2DT9A 4HACA 5E2QA 2CVEA 1REVB 5IM0A 3GR1A 2A10A 2Y1JA 2CG4A 3BO2A 3A8IA 3HP6A 2QFJA 2WONA 3WQPA 1VQMS 4DV6F 2HFOA 3B82A 5KFTA 4O3QA 2R7RA 2C1EB 4C4WA 3M8PA 2HNZA 2WBRA 3CD6S 2BM1A 2HQCA 1FKPB 4DXLA 4F4AA 1UCNA 2BE7D 2IBOA 2DH9A 4HR2A 4LFAF 1VRUB 2VDHA 2W1BA 5F41A 3SI8A 3LW5C 3PKMA 3DOLB 1K73T 5U47A 1P27B 1LWEA 3RAMA 4QW9A 3G96A 2Z2YB 3RU0A 5F8HA 2V63A 2AX0A 3TA1A 4B9TA 1X4DA 2ACYA 3R2DJ 4ETXA 1RDRA 4XPEA 4ZPCA 3Q8PB 2V67A 3IRXB 2DTJA 4MK9A 1Q81T 3DI6A 3MR7A 4U6PA 3PYEA 3I0RA 5DDOC 3GP9A 3TANA 1RBOB 4E98A 2HNYA 2RSQA 1BWEA 1VISA 1KBRA 3NCQA 4C8OA 3HULA 1U24A 2CG8A 1TL1B 5L1KA 1AYEA 3SV4A 3M6WA 4FBUA 1N5TA 1UKUA 3RRKA 3AT1B 4YUDA 2D9OA 4KB7A 1ZM3A 1NHUA 1L3KA 4U7CA 2OMOA 4ZPWR 5D0GA 4I69A 5E3PA 3PO5A 4AT1B 1ROFA 2BXJA 2Y0BB 1XMOJ 3NAIA 4IYQA 3MCNA 1C1BA 2DB1A 1UVIA 3PX6A 4DI6A 5HVFA 1U1KA 4FS2A 2DNRA 5J2QA 4OX9J 5C24B 4U8YA 1VK8A 3WIVA 1HNWF 5M2UA 4ER8A 1FFWB 4FXWA 2UU9J 2IYIA 4UT4A 1SQFA 2QMXA 2EG2A 1SIWB 2MGZB 1RJJA 5D0RA 4USMA 3FSXA 4NOHA 5DZ7A 4Q5VA 2VFVA 2Q3PA 3TWZA 1YJ9S 1Y9OA 2R2RA 1YRTA 2QX0A 4EYHB 3LP1B 1F9EB 1NUEA 1CS4B 2GVZB 1U1RA 2HRUA 2VODA 3C46A 1RTJA 4V19J 4C8LA 3H0PA 4HHJA 2HBYB 2HVDA 1YHQS 4HH1A 2E7WA 2KXHA 1S1WA 4IKAA 1T02A 4LIWA 3DRRB 3GV5B 4JOUA 1HARA 3NS7B 3DLBA 3OTBA 4PG8A 2JX2A 4PG7A 4DV4F 5KFJA 1F3VA 4Q0BA 1PSDA 3KNAA 4WCEQ 4EZ9A 1DFDA 2P9EA 1F6TA 1HHTP 1BD6A 5I42B 1FE0A 1S48A 1BGXT 2PEHA 2DPJA 3HJVA 3V2UC 2ABYA 1SCJB 4B3TF 4DPWA 3OTOF 4F3QA 4FF4A 2BZ2A 2J0XA 4PEOA 4D3HA 2XMKA 3FMWA 3CUNA 1CEZA 2BKNA 2KYZA 2ZJRQ 5L1LA 3DRXA 2QIFA 2JLEA 4QWAA 2OGUA 4NWBA 1NAQA 2HK3A 2GJFA 4MK8A 2AQ4A 1A7GE 2YNIA 2DEJA 5HVHA 4YB6A 2VPXB 1N6QA 4MKYA 3TAQA 2HWIA 2LU2A 2EWHA 3KLVA 2F4VJ 1YITS 4DQRA 3T1YJ 2GHPA 4C8ZA 3C15B 1UVKA 2VBWA 3NS5A 1LNQA 4K4UA 4I4BA 2UUCF 2UUBJ 2HHPA 1X5SA 3AFGA 1QJHA 1J5OB 1K0TA 3JYTB 3MF5A 3PO4A 3PRBA 2RS2A 1NPKA 2NQPA 4BS2A 4G1IA 4CO1A 2VB6A 1OQ3A 4KGKA 2AWZA 4RUAA 1N32F 5HBMB 2YWHA 4CLZA 1SIZA 3W9IA 2V34A 4OHZA 5D77A 5AJ3J 1Y5LB 3UCUP 2GA7A 3ZZTA 5DQHA 1N0UA 1UWBA 2I5JB 4NLQA 1LW2B 2B9WA 4HI1A 3D1QA 2ADCA 3W2WA 3EMTA 1PJ5A 2N4CA 3DHWC 2N3OA 3QJJA 1YKWA 3P5BP 4K4ZA 3E51A 2H1YA 2R2UA 4X84A 2A6OA 3T5LA 2KM8B 1Q7LB 2NZ4A 4JB8B 3I9V9 2CWXA 3L3CA 2Q79A 4JI7F 2D9PA 3RGIA 2CJKA 2HHXA 1JLCA 4J37A 2W9AA 2V68A 2P9GA 4EWTA 4YR0A 5C25A 4OI4A 4X2BA 2RDJA 2VASA 2X1BA 1JXEA 3KK3A 2CZVC 2VOPA 1ZS6A 3O1LA 4TN2A 4WP9A 4DR2J 1ZH5A 1WHVA 3W62A 5I4MA 4L73A 2HRTA 4ED4A 4ALZA 1Q8LA 4OZ1A 3SV3A 1M0SA 2CNNB 4F36A 4NMXA 1TMMA 1KP6A 2BJ1A 2F3JA 4ECWA 1RLDA 4GVLA 4ELVA 3KLEB 2QA4G 2VL1A 4ENOA 2AGQA 4ZPDA 4HVZA 4WBFA 3TRGA 2CDQA 1ZETA 4Y6IA 2VQEF 3V6HA 2Z57B 3ZNUA 3QIPA 3SDEA 1P9YA 2CDRB 1RWPB 3AD9C 1CJTB 5CA5A 1TV6A 4NZ6A 2J0SD 3NNAA 2XQCA 2JH3A 2PC6A 2YKMA 2PFFB 4WKRA 4M5KA 3I0SA 4RNFA 3KMSA 2MQLA 3M6XA 1DARA 1SJ4P 2MDAA 1UTAA 4F2SA 3K89A 3MMJA 3RRGA 4AFFA 4DF4A 5GAEU 3MM7A 1FWLA 4C11B 2RKIA 4ID5B 3LGMA 5THWA 1KLMB 1YBTA 4K5SA 4MFBB 2ATCB 4WIQA 2HG4A 4DLEA 1OIAA 4KV8A 1QE1A 2XLJA 1U26A 4DPYA 1H2VZ 5KT4A 3NGTA 3J7YI 3FNNA 2K8GA 2DRBA 3IR6B 5L9NA 9RUBA 3K0JA 1K47A 2C2KB 2K3KA 1DHMA 1H3DA 4KGZB 3DRSA 2CVIA 3CJ8A 1HBMB 4ZLPA 3RRHA 3IRWP 2AMCB 2XLKA 5B0CA 1FE4A 1S57A 4R5PB 1Z2ZA 2LLZA 4KFBB 4HKQA 2NXCA 4DSKA 4RNHA 1T9WA 4L3KA 1U0HB 1GAOA 3K8WA 3KJQB 1F60B 4IG3B 2W01A 1RXOB 4TQSA 5C7PA 1PJ7A 3QO9B 2PMHA 2YH0A 2LEBA 3OTCA 2PGCA 4WP3A 4PRFA 3KUGA 1QVGR 1RBLA 1XJWB 1S6OA 4UY85 1HPZA 1NK8A 4WU2A 3TOQA 3V5RA 4JI8J 3GCWP 4A8KA 2QJ3A 3BYPA 1JLAB 2AJ4A 4H4OA 1SL1A 2MLXA 3G9CA 2JSXA 3UN2A 3NGKA 2LXUA 3OHAA 5H9EJ 3T41A 4C0HA 1Y00A 3VTIA 2QLXA 3N01A 5IV3A 2CJQA 3SSSA 2ZNZA 2HNDB 4F50A 2E5LF 4ED1A 2GNKA 4YDXA 4JYAF 3G86A 1U1LA 1N56A 1ZM9A 1HNZF 2RDDA 2BE2A 1FK9A 4WJBA 3BJYA 4IO9Q 1Q5VA 3H8YA 2L9DA 3LTOA 4B3RF 5J2MA 1JLEB 2H54B 1HLWA 4FKXA 2HZCA 2VU5A 2C3UA 2UXBF 1HR0J 4P73A 4TYAA 2ZFHA 2HFSA 3W2VA 4NXNJ 2DK2A 4UOHA 1T05A 2DVIA 1RTDB 1JLBB 4CNYA 1K9MT 4A47A 3GIJA 1LWFA 1IKWA 1N33J 2KHCA 2MTLA 4B3SJ 4KY3A 4LSNB 2NYIA 4Z7YA 1EARA 1U1NA 4CH0S 2DGWA 2FJVA 1I51B 2HS4A 4ES3A 1CSJA 5B0AA 4TU7A 2B4UA 1IBCB 1ZPVA 4QYRA 1NSPA 4A8MP 4J9UE 2V9WA 3F41A 4MIBA 3CVKA 2V8DA 1AZSB 4CLTA 2HAFA 3TVZA 1EETA 3BSAA 3VR1A 3T1HJ 2WB4A 1SH3A 2M5YA 2VFSA 3F44A 4IG0A 2HAIA 2JFDA 4Q44A 2ZH4A 4WU3A 2OSRA 3V4IB 1QDUB 3AB2B 3GYNA 3QSIA 5HO4A 3MURP 3MAAB 1WD6A 5BR8J 4DV7F 2VC0A 2R8IA 2CA9A 4BWJA 1WC5A 5D8HB 1NO8A 1OY6A 2ROEA 3BH6B 3Q89A 1NJZA 3PJWA 2ZITA 2DY1A 4BC7A 3WX8A 3QPIA 1FRKA 2XMJA 1T3NA 4PWWA 4CM2A 1K1QA 4H4KA 2YNFB 3LP2B 2V4QA 5FDLA 4JI2F 3POTA 4CO2A 1WTFA 2AW0A 3NBPA 2IFXA 3ULHA 4OJGA 1PYTA 3RUBL 5HSPA 1XMQJ 4C3MA 2HHWA 3CJSA 2IYGA 3FJ2A 5GAHI 4ZLNA 1VQ9S 3EUNA 1VC6A 4UW2A 4RLEA 4ZPVR 2R42A 3R8YA 3Q8UA 4OYXA 3V81B 2CNKB 4CYUB 5CZXA 4PXEA 3FBFA 5T7LA 1FRMA 2WSCC 5C2CA 5BYRA 3ZFVA 4Q2LA 3DDKA 2HHHJ 2YQ3A 3KK1B 4P6QA 4ZVSB 3PACA 5CXTA 4YY3F 1BHNA 1N5YA 5G4DA 2C2ZB 1IWAA 3PKYA 3TUJC 2BANA 5H9FJ 3QRPA 4EBDA 3T1AA 3MOZA 4Y2AA 1F5BA 1X4CA 3K2YA 1HD0A 3OL9A 1VBZA 2P8IA 1IBLJ 5L9XA 5DDRC 3Q24A 2BDPA 3CE8A 1W2BR 1ZAWA 2ROPA 2L08A 1AA1B 3EZOA 3R97A 5LMUF 1R8BA 3V6DA 4IDKA 1YRXA 4LFBJ 2KTQA 2KVIA 5K8OA 1NCLA 3M2RA 4QWCA 5A0YB 2VQFF 3W64A 2DR9A 1XR7A 4U96A 2E9RX 4FYXB 4RUCA 4KC5A 4RNNA 2BQRA 2XYPB 1SQEA 3AQPA 2OPQA 2FVRA 4EU0A 2JLGA 1PC5A 1TP7A 2ZOFA 3MCMA 3H5SA 2LXFA 4XTTA 3R5DA 4PWDB 1M5HA 4GKKF 4NYPA 2DNMA 4KJIA 3B4DA 2RIJA 4LBIA 2DNYA 4RBVA 2CQCA 2QSFA 2ZBQA 1WWHA 1U25A 3LOUA 1NSKL 4KO0B 3HT3A 1DQAA 4ZP9A 3OVBA 3JTPA 3VAFA 4AYBD 3K59A 5I3QA 2DNLA 3UE2A 1PJ6A 2C3OA 2MY7A 1U49A 1YK9A 3C6UA 3CDAA 2O66A 1MMLA 3CCVS 2DCLA 4CLKA 2D1CA 2YWGA 1C0TA 4F4WA 3VGUA 1X9WA 4G1PA 2EFVA 4RU2A 4DV0J 2JEJA 3AAWB 4OMFG 1FRLA 1HQEB 1FRXA 2M4MA 1E6VB 2OPPA 2RQKA 4WFYA 4AL5A 4UQGA 3R7NB 2XS7A 4QPTA 3PRVA 1S1VB 3IR5B 2WRMA 2KU7A 2BJ8A 5JMNA 4P71A 4KAIA 3MM6B 3Q8QB 2FJDB 2KZZA 1X5TA 1WTBA 1KN6A 5KT5A 4GC7A 2QYGA 4RZRA 1K1SA 2LA4A 1VJQA 3M32B 3MM8A 3VAJA 3G82B 3HSGA 2HQGA 4PUOB 4LR7A 2RJZA 2ZWOA 4BCAA 3H2VE 1NH7A 3QAEA 3S1TA 4DMZA 1JLFB 1RT1A 2XMVA 1IQTA 8AT1B 3KLFA 4Y0FA 2NZCA 4C97A 1F9FA 1TZ0A 4ZA1A 5AXLA 4YS2A 3DLKB 3GONA 4NZ0A 1NJYA 3ENVA 4CP5A 4IFVB 2YKNB 2MKYA 2NREA 5IT9U 3H2UB 3HF5A 3MXHP 3LALA 2BABA 1R43A 1RT4B 2RF2B 4OHWA 3VGSA 2WTFA 1SKWA 4ECUA 1UAWA 2MB0B 1R3NA 5IT4A 1HKAA 4O3SA 4ILMA 5E5NA 1LWCB 3SBMA 3PEJA 4M1KA 5KFZA 2GAGC 3P3DA 1WI6A 1QSSA 4ED3A 1IBMJ 2R8GA 5CH7B 2GVDB 5D78A 1FRIA 3IWNC 5AXNA 3P49B 2FZCB 2XBPA 1FXRA 2VHGA 1HNVB 3KNGA 2DEIA 1T03A 1D9FA 1IVZA 2ZH7A 3IMQJ 5IT0A 4OYIA 1VQ6S 2X7IA 1UMJA 3QFWA 4HEA9 3OD2A 1IR2A 3CPWR 3AXKA 2HHQA 4DR4J 1RB0A 1S0MA 3J80U 2AZ1A 4TLQA 1IKVB 2DO4A 4ZHRA 1PCAA 2CPJA 1MLAA 3FRYA 4FXDA 1PILA 4DR5J 4MK7A 1UA1A 2J0QD 4NLVA 1CVJA 2LVWA 4DG1A 1TKXB 1KRPA 5BYQA 3KHHA 3D3BJ 1X4EA 3M6VA 3PW0A 4JI4J 3L9ZA 4NI2A 4LFCJ 2ZHBA 2ZVSA 1FD2A 2GMHA 4J9KA 1N88A 1F5CA 2F8EX 1M5PC 2KG1A 1VQ7S 1H98A 5FLXU 4RW4B 3E3XA 2PT0A 1CJKB 2MHNA 3IRXA 3O8WA 3DMJB 3KJFB 1N34F 4EMDA 1NKEA 1VQKS 2FJAB 4HLBA 1Q8KA 3R5BA 5F8IA 1BC6A 2CRLA 1FXDA 1WSVA 1IJEB 4DL6A 1TL1A 2GQ2A 3OW2R 1OY8A 1UPPA 1BQNA 2MZRA 1G7CB 5LL6d 3DRPB 3BQ2A 3ZZYA 3W9HA 4C6AA 1FDBA 1UZDA 2ZOMA 2D41A 1RHJB 4USVA 2A6MA 2FVSA 5DDQC 5ITHA 1T9UA 3DGVA 5CCLA 1S97A 3L95X 5A76A 1HWIA 3MR6A 3NG8A 4DV2J 3CULA 2G1HA 2Y1LB 9ATCB 3GR0A 3U1NA 4AQYJ 2Y1RI 4NRTA 3THTA 4RW8B 1VRTB 1SC4B 5C24A 5C2GA 1DZ5A 2OO4A 3HO1A 1NJXA 3QRRA 4PR6A 3HVWA 5MAOA 3VWSA 8RUCA 2HIYA 3H5XA 4GKJF 1SL2A 2MGZA 5AE2A 4WFAQ 2PA8D 1YZ7A 4PQUB 2CWKA 2FJBB 2V2ZA 1CS4A 2GVZA 4A8SA 2ZUGA 3DM2A 5DM7Q 3LF0A 2A0FB 1KVIA 2RVJA 5HVGA 3ZZ0A 2EFGA 2XMAA 2Q1LA 3VCDA 1CQMA 4C7QA 3FBEA 4OQJA 4NLPA 2R8KA 3MEDA 2XY6A 1JLQA 4DS5A 1SPBP 1Q4RA 2XHWA 2AEMA 3UW1A 1R0CB 2MJUA 3BR8A 4MKBA 3I6PA 3DRRA 4WFBQ 4KR0B 3OHBA 1S6PB 1J27A 4NLDA 1WC3A 1KNZA 4DR7J 1EX8A 2QG9B 2WW4A 1CG2A 2CPHA 4KGVB 2DR8A 3CJRA 1EKSA 1S6QB 5LXRA 3GIRA 4CLSA 1KS2A 4GVBB 2ADBA 1B7FA 4DCJB 1RYRA 1EKRA 4OZLA 1VC0A 2M8HA 2BJ9A 2XI2A 3D7SB 2C28A 4UQTA 5HQMA 1X4BA 3C8YA 4XPCA 2YWKA 1W26A 2UV8G 3GLJA 2B8PA 1UVNA 2WSFC 3G8TA 3V6JA 2H65B 1NK9A 1N5QA 4F0HA 4USWA 2MQPA 2QA4S 2OPRB 2IDEA 1XR5A 4Y00A 1EQ0A 3ZZZA 4P2XA 3J7ZT 3KMQA 5K14B 3EICA 3ZZOA 4N41A 4WFZA 1QAIA 3C15A 4QYZK 3MPVA 2H5IB 1GNKA 2DGUA 1X60A 4X62J 1U0SA 4JI5J 3JYTA 3D0GE 3L7PA 5GAGI 3OVSA 3J81j 3M9MB 2G13A 4QW8A 1F1BB 4I7FB 2RQMA 3MM5A 5IZHA 2HHUA 4B9MA 2X1AA 2QL7B 3JSMA 2UVUA 4R0JA 3NWGA 1FCAA 4M5IA 1ZBTA 4DU8A 4CH1A 1WHXA 1VGYA 3HVTA 3RYLA 1BQMA 2BW7A 3KDOA 4DCOB 4JI6J 4X66F 1GMWA 4F2RA 1HFEL 2FC8A 4LF8J 1CPZA 4RBTA 3KK2A 3QRQA 2GHVC 2DY9A 3MEGB 2APOA 2E1PA 3QGHA 2D3OR 2CPIA 1TL3B 2VPYB 2FHOB 2X51A 1S9GA 3H25A 1FA0A 1VI7A 3RBEA 1DAXA 2DNPA 4ILRA 2GO9A 3QT5A 4NLTA 3HI9A 3M8ZA 2AEFA 1JNZB 3QWPA 2B6AA 3H90A 1SUQB 2QGFB 4DZ6A 4LIRA 2E1AA 3KLEA 3GIKA 1CBKA 4O44B 3TUPA 2AYGA 3IN5A 3D6FB 1OMSA 2MZTA 3FGVA 4ECTA 4PG5A 5F0WA 4ZLJA 1O5JA 3TR5A 3A8JA 2QLBB 2JVRA 1JLGB 5K8PA 1RKIA 4X4TA 3DDNA 2AIRB 1CJTA 1FTCA 5BYSA 1PBAA 3OT9A 4WP8A 4IOCQ 3N5FA 1T3OA 4NPOA 4N76A 2WVEA 3M8RA 2DH7A
chains in the Genus database with same CATH topology
4HH1A 2E7WA 2F8HA 5B0GA 5DGBA 1X7VA 2KXHA 2AJ1A 3NRBA 3Q2SC 1S1WA 4O3RA 2W4DA 3HDSA 4F25A 1IKXB 3UD4P 3BGRB 4C11A 1W25A 1IUJA 2UVWA 4ID5A 1T02A 1YJUA 3OPKA 4IKAA 2E5IA 4LIWA 3DRRB 2DNGA 3CDUA 3GV5B 4JOUA 2GFFA 1KEKA 2R2TA 5KT2A 1HARA 3DLBA 5ADZA 3V6DB 3OTBA 4PG8A 2JX2A 2R9LA 4B3MF 5A8WB 5HROA 3PDNA 4Q8EA 4WZMA 1QUPA 4PG7A 1X0PA 4DV4F 3HHLB 2QSWA 4ZVGA 5KFJA 1E6VA 2FJEB 3M2RB 5E3RA 6FD1A 5KFMA 4Q0BA 1PSDA 3NAHA 2KHDA 5KFXA 4WCEQ 4EZ9A 2VBYA 3KNAA 4PCQA 1DFDA 3DLLQ 4CO0A 2P9EA 2JFKA 1HHTP 1BD6A 1N5SA 3KLGB 5I42B 1FKOA 1FE0A 3H5YA 1S48A 4K4WA 2MZ1A 2O1PA 2ZKUA 1BGXT 3GMGA 1S1VA 1QVFR 2PEHA 4QIGA 2DPJA 3PW4A 2OP5A 2WOMB 3KFWX 4FF1A 3V2UC 2ABYA 3QIDA 3DRYA 3HZGA 4QBUA 4G1QA 5BJRA 1IBMF 4AL6A 5CYMB 5KFFA 4B3TF 2VH7A 3OTOF 3S7RA 3HPOA 2RQCA 4F3QA 2CQGA 5EX3A 4P7TA 2BZ2A 2J0XA 5C5JA 4FF4A 3K57A 4D3HA 2XMKA 3FMWA 3PIPQ 1HBMA 1Q82T 3CUNA 1C4AA 4X64F 1CEZA 1NRKA 4KE5A 4XIUA 2L9NA 4F4KA 2AJ0A 2KYZA 4QR2A 5KT7A 5L1JA 4WE1B 2ZJRQ 5L1LA 3DRXA 4NLRA 3BDEA 2QIFA 1YQHA 2MPUA 2JLEA 4QWAA 4NWBA 3I5CA 3U1LA 1NAQA 1RTHB 2FTRA 4Y2MA 4Y65A 2VG6B 3Q8RB 3P5TL 1HMVA 2RRAA 4MK8A 5FJ4A 3RB3A 2AQ4A 1A7GE 1FDAA 1RGVA 3QLHA 4Z37A 3NNCA 3H4BA 4DFJA 1DLOA 5T14A 5EWGA 3M32A 2YNIA 4DR4F 4C8NA 2ZH2A 1RA7A 4YB6A 3M8QB 2VPXB 1HA1A 1N6QA 2JHEA 3S6EA 4PUOA 3DLEA 3TVKA 1XN9A 4MKYA 1H2UX 2BQUA 3TAQA 2J76E 4CO4A 1WEYA 5B09A 2HWIA 2B3TB 4HL9A 1U2FA 4W92B 4OX7A 2LU2A 3OFEA 5KFOA 2A1BA 2J9EA 2EWHA 1C0UB 2J0WA 1XR6A 3KLVA 3BB5A 4ED5A 3TNVA 3M2VA 3SQGB 3GYXB 5IM0B 4DR5F 1HD1A 2PN6A 1MW7A 1YITS 3V4MA 2ASLA 4M8LA 4O0IA 3G8SA 4DQRA 3SZ2A 3OXLA 3I96A 2GHPA 2Z0GA 4C8ZA 3CF5Q 2W4CA 4NLOA 5DQGA 5E3CA 1UVKA 1RT2B 2VBWA 2E7XA 2EC0A 1X4GA 2HWHA 3MEKA 5E3AA 5DQIA 3NS5A 2VPWB 3IO1A 3UPFA 2XGQA 3LH2S 4I4BA 2UUCF 4K4UA 4JI4F 3M8PB 4F26A 1ULRA 4CTAA 2HGLA 5E3QA 4LFCF 2HHPA 1X5SA 1TQLA 1DTTB 4WKYA 1ZAVA 2VC1A