1TVRB

Hiv-1 rt/9-cl tibo
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
427
structure length
427
Chain Sequence
b'PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords REVERSE TRANSCRIPTASE
publication title Crystal structures of 8-Cl and 9-Cl TIBO complexed with wild-type HIV-1 RT and 8-Cl TIBO complexed with the Tyr181Cys HIV-1 RT drug-resistant mutant.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 (clone 12)
molecule tags Aspartyl protease
total genus 87
structure length 427
sequence length 427
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1996-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1tvrB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1tvrB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1tvrB03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1tvrB02
4K4SA 1T05B 3ITHA 3DMJA 3NBPB 1S6PB 4KFBA 4RW6B 5F8GA 3V81B 3ISNC 1SH2A 2XGQA 4JV0A 1HMVB 4URGA 2HMIA 1LWCA 4DL3A 3DYAB 1JLAA 3UR0A 4J9KA 1JX4A 2IM1A 3IRXB 4K4YA 5C5JA 4KV8B 2WONB 1HQEA 1FKOA 2V4QA 2OPQA 5KFQA 5KFSA 1KLMA 4RW4A 3OSNA 1N4LA 1RT5A 3GQCA 2AGOA 4TY9A 1DTQA 3NKYA 3D5MA 1J5OB 3EPGA 4RW7A 3OLBA 3RB4A 5DLFA 4DL7A 1S6QB 3QO9A 3E51A 5CYQB 4LSLA 4WFYA 3DM2A 5HLFA 3T5KA 3LP0B 2JEJA 1JLBA 1FK9A 1UWBB 3SFUA 5HP1B 5I3UB 5C24B 5J2NA 3NGDA 3I0RB 5F8HA 5KFPA 3HVTB 4KHRA 4MKBA 4MK7A 2JEGA 1W25A 1RT3B 3QGHA 2XGPA 4NLGA 4ECUA 2VA3A 1BQMA 1SV5B 2BE2B 2W7OA 1LWEA 2HWIA 4ZMMA 3M9MB 1QAJA 5K14B 3CVKA 2UVUA 4IDKB 5I42A 4EO6A 4J9MA 4ED6A 3H59A 3KLFB 4IR1A 2YKNA 2D41A 3I5CA 1REVB 4KB7A 5KG4A 3PVXA 4I2PA 4HYKA 2IA6A 4IRCA 3DRRA 3N6LA 5F8LA 3DLEB 2OPSB 1RA7A 4Y34A 1JLQA 3GILA 4ECRA 4WXWA 3KLEA 1IKYB 3T1AA 1N5YA 5KFTA 3BR9A 1NNDA 4R8UA 3LP1A 3GIIA 5C42B 5J2QB 5FDLB 1HPZB 1S10A 4I2QB 5KFVA 4MK8A 4WE1B 4IG0B 1EETA 5KFHA 4RW9B 4XO0A 4ZHRA 2VA2A 3GYNA 2UVRA 5J2MA 2AQ4A 4NLSA 3QGIA 3KOAA 2C2DA 4URSA 2C28A 4LSNB 5F8JA 5L1IA 3MEEA 3KK2A 4JV2A 4YR3A 5DQIA 3DRPA 3MFHA 1N6QA 4K4ZA 4RW8B 3BSOA 4ICLB 4MIAA 2BRLA 2CJQA 1RYSA 2UUWA 2FVSA 4TXSA 3GIKA 4J9LA 4ECQA 5KT3A 3OL6A 1JLEB 3TAMA 3QLHB 2HNZB 1S9GA 1S97A 2B6AB 4IOBA 3JYTB 5KFKA 1RT1B 2FLNA 1N48A 3KLIA 3ISND 1FKPA 2B5JB 4URQU 4QWBA 3KK1B 2VG6A 1DLOB 3M8QB 1RTDA 4TQRA 1LW0B 3G6VA 4R5PB 4GC7A 3T5LA 1SUQA 1IKWB 3BGRA 2ILZA 4KE5A 3M8PA 3CWJA 1HQUB 2XI2A 1S1WB 2I5JA 3UDLA 3QIPB 4YMEA 3FSIA 4DG1A 5KFLA 1TVRB 2VG5A 4NLWA 2YNFB 4J9PA 3Q8RB 1ZTTA 2IAJA 3SI8A 2RKIA 4F50A 1IKXB 2JLEA 4NLXA 5DGBA 3KK3A 3OHAA 2EC0A 2YNHA 3MEDB 3PW4A 4PUOB 3CJ3A 2R8HA 1HYSB 4J9NA 4IG3A 3BQ1A 1ZETA 4ZVFA 4IQXA 3V6DA 1HARA 4ECVA 3Q8PB 1RTJB 2R8GA 3KLGB 5CYMA 4U6PA 4Q8FA 4YQWA 1TQLA 1C0UA 4KSEB 1LW2B 4Q0BB 2W8KA 3BQ2A 4TY8A 1S1UA 1DTTB 1IKVA 3V4IB 4KKOA 3ICLA 1SH3A 4WXOA 4ZPBA 3MFIA 3KHRA 3NMAA 4ECSA 3KHLA 5KFMA 2YNIB 5KFJA 5DG7A 2BQUA 3IGVA 3MR5A 1C0TB 4TN2A 3OL8A 2FVPA 2F8EX 2GIRA 4Y2AA 2RF2B 4EBEA 4J9SA 2YNGA 4ECTA 3RB6A 2WHOA 1LWFA 3EPIA 1XR7A 1T3NA 3MEGA 4ZVHA 3DLKA 4XPEA 2GC8A 1TV6A 2BRKA 4QW9A 3M9NB 3LALA 4G1QB 1EP4B 3HKWA 3QYYA 4J9QA 3ITHB 2AWZA 3DMJB 4NRUA 5F8MA 4DL2A 4IFVA 4EYHB 1XR6A 2FLLA 3OSPA 1LWCB 2W9CA 1TKZA 3I0SA 2UVVA 5DLGA 3MECA 3KJVA 1T05A 2FVCA 3FQLA 3H98A 3NBPA 3NAHA 3KNAA 1FKOB 1RT2B 4RZRA 5C25A 3C6UA 2OPRA 3V81A 2IM0A 1HMVA 1RT7A 1KLMB 1S9EB 4IFYA 4NCGA 2WRMA 3V6HA 3DYAA 4Q8EA 2BANA 1DTQB 5KFRA 2HNYA 1SH0A 2R8JA 3BSCA 1QUVA 3CJ4A 4ZPDA 3IRXA 1VRUB 4O4GB 2WONA 3QO9B 1K1SA 4EBDA 2JEIA 1Z4UA 5EWFA 4LSLB 4WYWA 4O3RA 4KBIA 2GIQA 4IH5A 4H54A 4O3QA 2W9BB 2AX0A 4XPCA 1JLFB 5L1KA 4RNNA 5J2NB 3HVAA 1J5OA 4NRTA 4NLDA 4EBCA 2XCAA 4WZQA 2OH2A 2RDIA 4NLVA 4Q44A 3C6TA 4NLPA 1RT4B 3LP0A 2JEFA 5I3UA 2V9WA 1LWEB 3IG1A 3I0RA 4H4MA 2FJWA 4HKQA 3HVTA 2VG7B 1R0AB 1D0EA 5KG1A 5KG6A 4Q45A 3I5BA 5I42B 1QE1B 1U09A 2XCPA 3DI6B 3H4DA 2AGPA 5JUMA 1RT6B 3KMQA 3Q8SB 3T19A 5KT5A 2ASLA 2BQ3A 2BE2A 4PWDA 3N6MA 4G3IA 3IGNA 4WYLA 1JLQB 3H5YA 1S1VB 4MH8A 3H5UA 5K14A 3KLEB 1K1QA 2QV6A 1JKHA 2FVQA 3QGGA 4Y3CA 4Y2CA 5L1JA 3LP1B 3KLFA 4RU9A 1XR5A 2IM2A 5KFGA 3G6YA 2ZD1B 5HROB 4KAIA 1RTIA 5EUHA 4ZPCA 3D28A 1BQNB 4YP3A 1EETB 3IN5A 1VRTB 3DLEA 4ZP9A 4ZHRB 1CSJA 1KHWA 2O5DA 4KHMA 1IKYA 1RA6A 2FLPA 5J2MB 4I7FA 4B3OB 3PJWA 4ZVGA 3H5XA 4O3OA 2HWHA 2IC3B 5KT4A 5FDLA 4KO0A 1RDRA 1I6JA 4MK9A 3BQ0A 1S1XA 4X2BA 5KFIA 4IG0A 3IS9B 2AGQA 1MU2B 3PJXA 3DRPB 3H5SA 4NLQA 2FJVA 3PHEA 4ZVEA 1N6QB 1HNVA 1QAIA 4M95A 2R8IA 3DLGA 5KFZA 4K50A 1JLGA 4WZMA 1TL1A 2BR0A 4LSNA 2ZE2B 3GIJA 4O3NA 4ED1A 2ALZA 1TL3B 3I5AA 3TAMB 4O3SA 4RW8A 3LP2B 1T03B 1S9GB 4F4YA 4F4WA 4ID5B 4EO8A 5D3GB 4DL5A 1RYRA 2HNDB 3LAMA 2ILYA 5KFWA 1RTDB 3FFIB 2WOMB 2D7SA 2JC0A 3EZUA 4DL6A 1SUQB 4YR2A 4U7CA 3CJ5A 3QLHA 4QWEA 2HNZA 3M8PB 5J1EB 1S49A 2B6AA 3TVKA 2I5JB 4ZPAA 1RT1A 2OPPA 3DOKA 2VG5B 2B5JA 5F8NA 3KK1A 3HHKA 3M8QA 5KFEA 1LW0A 4JUZA 4R5PA 1IKWA 1C1BB 5L1LA 5L9XA 3RBDA 4MFBB 3UQSA 3KLHA 3DRSB 1IM4A 5J2PB 3QIPA 3V6KA 2RDJA 4ECYA 3DDKA 2FJXA 4IG3B 4GC6A 3V6DB 3E01B 3JSMA 1HNIA 3N6NA 5CYMB 2B43A 4QWDA 1IKXA 1JLCA 1TKXA 4FBUA 1C0UB 3BSAA 3KHHA 4ED7A 4K4UA 3MEDA 3DOLA 1S1UB 1IKVB 4PUOA 4KKOB 5EDWA 1KHVA 2YKMB 5KFYA 2R2RA 4WFXA 4QPXA 5DQHA 1C2PA 3MR6A 4NZ0A 4QW8A 4O44A 1RTJA 1TKTB 4K4XA 3FDSA 4M94A 5KFAA 3RAXA 2JC1A 1LW2A 4Q0BA 4F4ZA 1MMLA 4H4OB 3LANA 4PQUB 1DTTA 1GX6A 3OL7A 1C1CB 5HBMA 2WCXA 5JXSA 3CO9A 4NLTA 1TV6B 4MIBA 3GIMA 3H2LA 3OL9A 4KFBB 1JIHA 2XWYA 5KFNA 4IRKA 1S9FA 3CJ2A 2HMIB 1JLAB 1S1TA 4ZP8A 1RTHA 3OHBA 2DPJA 2J6UA 4ECZA 2QE5A 4O3PA 1HQEB 2ASDA 1S6PA 4RW6A 2W9AA 2OPQB 5EWGA 5KG5A 2D3ZA 1EP4A 4RW4B 5F8IA 1RT5B 3MECB 3KJVB 5KFXA 2R2UA 4JV1A 5KFCA 5C25B 3C6UB 2OPRB 4RW7B 1ZTWA 1RT7B 4IFYB 2FVRA 4NCGB 4TLRA 4KV8A 4IRDA 4K4TA 2BANB 3MF5A 2W8LA 2HNYB 3DM2B 5HLFB 4IH6A 4FS2A 4LQ3A 1JLBB 1FK9B 3FRZA 4QWCA 2AU0A 4RUAA 1RT2A 2WB4A 5DGAA 4RNFA 4IKAA 1S9EA 3H40A 3TQ1A 4Q43A 1S6QA 2HAIA 3G6XA 3PW5A 5CYQA 4RNMA 1VRUA 1WNEA 1UWBA 4O4GA 2XI3A 5KG7A 1BQMB 5HP1A 5DG8A 4ED2A 5C24A 2ASJA 1TP7A 3PW7A 3RBEA 3C6TB 4YR0A 3CDWA 2ATLA 2DPIA 1S48A 1S0MA 2W9BA 3SFGA 1JLFA 4NLOA 5KT6A 3IG1B 1RT3A 2YKNB 4H4MB 3QZ7A 5KG0A 3CIZA 1SV5A 4FS1A 4I2PB 3CDUA 3DRRB 5F9NA 1RT4A 3NAIA 5EWEA 4IDKA 1N5YB 4WFZA 2C22A 4R8UB 4PWDB 3QIDA 2XC9A 1D1UA 4K4VA 2VG7A 1R0AA 1REVA 1S4FA 1JKHB 1QE1A 3BJYA 3DI6A 2OPSA 1RT6A 4NLYA 4K4WA 3T5JA 2WTFA 1RTIB 4MKAA 1NHVA 4QWAA 3MR3A 5F9LA 5C42A 5J2QA 1HPZA 4I2QA 3HVWA 1S1VA 2UVWA 3CJ0A 3KLVA 4WE1A 3T5HA 4I7FB 1T94A 3V6JA 4RW9A 3RB3A 2E9TA 3MEEB 2ZKUA 3KK2B 2E9RX 4KO0B 2ZD1A 5HROA 1S1XB 1YVFA 1BQNA 2IM3A 2W7PA 1VRTA 3Q8QB 2D3UA 2BQRA 3PZPA 3OLAA 1N56A 2C2EA 4RNOA 4J9OA 4B3OA 4TYAA 1HNVB 4O4RA 3KHGA 2IC3A 4F4XA 4ZP6A 3DLGB 5KT2A 1JLGB 2R8KA 1TL1B 3M9OB 3LAKA 2UUTA 3BREA 1GX5A 3IS9A 4ICLA 3PR5B 3UPFA 3PW2A 1MU2A 3NL0A 3FQKA 4R0EA 3KLIB 4EYIB 1FKPB 2CKWA 2VG6B 4DL4A 1S0NA 1JLEA 1NHUA 4TYBA 3H4BA 2WK4A 3BGRB 2IMWP 2ZE2A 3G86A 4DEZA 4J9RA 3JYTA 1TL3A 4DG1B 4ED8A 2I1RA 1DLOA 3LP2A 1T03A 3MTKA 5T14A 2IBKA 3PW0A 3QZ8A 2IAJB 4ID5A 3RAQA 5D3GA 2RKIB 2OPPB 4IH7A 3GV7B 2HNDA 3DOKB 2R2TA 1HQUA 3KK3B 1S1WA 2YNHB 4RUCA 3FFIA 2WOMA 4ECWA 3PR4A 1TVRA 4NLUA 2YNFA 5KFUA 4ECXA 5J1EA 5KFDA 3KLHB 4IR9A 3BSNA 4NLRA 4TY8B 5KG3A 2J6SA 3JSMB 1HNIB 4OL8A 1C1BA 1HYSA 3GV5B 2IJNA 3GV8B 1JLCB 2V0NA 1TKXB 4ED0A 4FBTA 4MFBA 1JXLA 1S0OA 4LQ9A 1OS5A 3DRSA 3DOLB 3KLGA 5J2PA 5KFFA 5DQGA 4ED3A 5KG2A 2V4RA 5DG9A 4O44B 3V4IA 3E01A 3VQSA 2C2RA 2YNGB 4ZP7A 4RNHA 2R2SA 1LWFB 5KFBA 3MEGB 2YNIA 3DLKB 4EEYA 1RAJA 2J6TA 2YKMA 3MR2A 5KFOA 5HBMB 4TQSA 1C0TA 2IJFA 3CDEA 2AX1A 1TKTA 2RF2A 3KMSA 4IFVB 4NYZA 3RB0A 4H4OA 2E9ZA 4PQUA 5KT7A 1S1TB 2W9CB 1TKZB 1C1CA 3I0SB 1RTHB 4G1QA
chains in the Genus database with same CATH superfamily
4WP8A 2IHR1 2C2OB 2EEYA 5ETQA 1DY3A 2F8HA 3OPKA 1CS4A 4PG6A 2H65B 1N4LA 1KS2A 4CLKA 4ZLJA 1J5OB 3RRKA 1CVJA 5HP1B 4WK3A 5I3UB 5C24B 5J2NA 3C15A 1SV5B 2HRYA 2IJRA 1Z1ZA 2UVUA 3M7VA 4J9MA 3RRHA 4OLOA 1L3TA 3NS5A 1S7HA 4HLBA 3GILA 3T1AA 1N5YA 1HNWF 1NK7A 1FTRA 2PEHA 4I2QB 1E6VA 3O1LA 3DNCA 5KFVA 2DR7A 2EFPA 1XERA 5IV3A 3GYNA 2ZBPA 3K57A 2AYMA 5IWAJ 4QR0A 2VDIA 2KVQE 5D0RA 1MROA 2HNZB 2B6AB 2R7VA 1FKPA 3D0HE 3M8QB 2AYBA 1HQUB 1S1WB 3FSIA 3MPVA 3PKYA 3GFZA 1U45A 1IKXB 2P8IA 2YNHA 5D0EA 4B9UA 3KLGB 4F0HA 3VAHA 2W8KA 4YHHJ 2WVBA 1I5OB 3F0NA 3MEKA 4X4SA 1KNZA 2GVDA 2QO3A 3M8ZA 2NLWA 2P6SA 2JWNA 5F8MA 4LF9F 3DMJB 3UW1A 4FF2A 2L48A 3H98A 3KNAA 2DHSA 4KGXB 3ZZOA 4FNHA 3MUMP 2GMLA 1H7WA 4V19J 4KGVB 3BSCA 3R7BB 2ZVSA 4LSLB 2VFSA 1YITS 4O3RA 1W2BR 2W9BB 5L1KA 4WZQA 1GXLA 4B08A 2UXDJ 3PM9A 1URRA 4B9VA 4L3NA 1U0HB 5AXLA 3VGUA 1IR0A 2DNPA 5KG6A 4Q45A 1T3OA 5I42B 3CCVS 1X7VA 4MAKA 1MMNA 2IA0A 1NEEA 3EGZA 3KLFA 1VQOS 1OPIA 1RTIA 2XS7A 3UWTA 4BCAA 3DLEA 2OMLA 5LSOA 2AD9A 3TP2A 4PRFA 3O8WA 4DR5F 2BJ9A 1QSSA 4MK9A 2MQMA 4OI3A 1N6QB 4M95A 2EC2A 3HLUA 4Z7CA 1FJ7A 3LPYA 2UU9J 3UN5A 2HNDB 3CJ5A 4OI4A 1S49A 4B3TJ 1WOOA 3M6VA 2HFOA 2CRLA 1IJEB 4F67A 1IKWA 3AT1B 5ITHA 4MFBB 4DN9A 1HI0P 1URNA 1NCLA 3W1YC 1X4HA 4PQAA 3JQKA 2HLUA 2BX6A 4RBTA 5DQHA 4UOGA 2V2KA 1Q79A 3MOJB 4YN3B 3I4HX 1H3DA 3OL7A 4CO5A 3GSIA 3MWBA 5LMUJ 2RD5C 1HR0F 2ZHOA 2QE5A 2O67A 4G1PA 4OHVA 1O6XA 2YKAA 2NPFA 1NDKA 4X64J 1NJZA 2J8AA 1SXLA 2LXFA 3DM2B 3D6FB 3TUIC 4FYXB 3G8TA 1S9EA 1HD0A 3ONQA 4G6VB 1Y00A 2HZAA 1IR2A 5HL7Q 2GVZA 1WTFA 2MJUA 2VC0A 3DRRB 1KONA 4KR0B 2J7WA 4JI7F 4DV6F 1S4FA 3SDEB 5A6PA 2H5EA 4Y00A 3G4SS 2NXEA 4NPOA 3AH6A 5T7LA 2AHOB 4DQQA 2ZD1A 3QJPA 1SB6A 1GH8A 3ZZ0A 5HANA 4J9OA 4B3OA 4NZ7A 4OI6A 1JLGB 2XNQA 2BJEA 1W2IA 1FCAA 2QSFA 2F9DA 3N0VA 1YQHA 4CM2A 3MTKA 4KHPJ 4E2FB 4RUCA 1AZSA 2R7QA 3AOAA 3FBCA 2YNFA 4E98A 2DHXA 2KM8C 2X3DA 3HHLD 1C1BA 2V0NA 2JVOA 2ZH5A 1PSDA 1RHRB 3BDPA 4FDFA 3MEGB 3NS6A 3VQTA 4Y2KA 3NNHA 5A2QY 3BGOP 2RF2A 1FDBA 4MYUA 3RB0A 4DPYA 1MLAA 1C1CA 4LRBA 1TAQA 1XBWA 4J90A 4CP5A 2K06A 1OYDA 3FCVA 5HVGA 2W2MP 2PMWA 5CH7B 5KFSA 4RW4A 2LEBA 3CUNA 4GRSA 4F2SA 1NK5A 2YWEA 4CO2A 2G0JA 1OWXA 1IBKF 3QGHA 4NLGA 2G1HA 2COLA 1XWLA 5K14B 5J1PA 3TO8A 4ED6A 2FUG9 2YKNA 2HHXA 1RKJA 1T9YA 3SQGA 1JMTA 2E7XA 1V5IB 4JI5F 1RCXB 5J2MA 3KOAA 4RUHA 1F9EB 2Z30B 2C2DA 1JB0C 2DXDA 2VPWB 4YR3A 3EM1A 5ETRA 1SKRA 2H9ZA 1FRMA 2BKPA 2K2PA 3OL6A 1HL6A 1S9GA 1NJWA 3K7RA 4QWBA 4E0DA 5AE1A 5A8WA 3SI8A 3HHLB 3CJ3A 4PCQA 3HZGA 4HT7A 2R8HA 2HZCA 1IKVA 3CCSS 4DR7F 2X7IA 4ECTA 2MMYA 4X4QA 2VQFJ 1HI8A 1TKDA 3LALA 3HKWA 3C14A 4WCEQ 1LWCB 2W9CA 5CAAA 3I0SA 2HVHA 4EMDA 3NBPA 4WBFA 1FE0A 2GS8A 2QFIA 2XTJP 1JK9B 1RJJA 3C3LA 4K8RA 2A1BA 2JEIA 5EWFA 2GIQA 2H48B 1KC8T 1LWXA 2ZH6A 1WC0A 4KPYA 2NZ4A 4DX7A 2EFGA 3GMGA 2M3DA 3MCSA 1DBDA 1YKWA 5CQGA 1F1BB 4FKXA 3WQPA 4Y2CA 1SKWA 4CO1A 5KFGA 2ABYA 3M8YA 4DX6A 1G6BA 2NYHA 2FQQB 1U1RA 2P6TA 2D69A 4DN0A 3ZTQA 1HNVA 1MMDA 2VBZA 2GV1A 1HWKA 3R3TA 1R8CA 3GIJA 2J5AA 2CJBA 4WTYA 1B7YB 3TX8A 2QFJA 4U7CA 3QLHA 4AD6A 2J76E 5CXTA 4CLWA 4U8VA 2LMIA 2RDJA 1VCTA 3C46A 2GQ2A 2Y8YA 1UL3A 2ZBQA 3GIRA 3D68A 3VAFA 4DJBA 4DDFA 2WW8A 1UMJA 1PBUA 2HGMA 1NZ8A 4LFCJ 3LA0A 2HMIB 2B3TB 3ZTRA 1WOSA 4ES2A 2J6UA 1JWWA 3KJVB 3V5RA 5JVHQ 4LF5J 3UR3C 2V9KA 2ZWOA 1W26A 4K4TA 4CWBA 2HNYB 3AD8C 3R6LB 3FRZA 1VLOA 3SQOP 2JRSA 1UWBA 2GMJA 1CQMA 3C6TB 2V4JB 4I2PB 3K5OA 1KFSA 1QDUB 4IDKA 1Q95G 3DI6A 4DPOA 3KDOA 4ZVSB 3V6JA 2C3MA 4USKA 3OFHA 3NY0A 1N52B 3CB4A 3D54A 4F4XA 2DGXA 1D8ZA 2IRYA 2QA1A 3DLBA 4USTA 4N41A 1GX5A 4ICLA 2JL9A 1S6UA 1FDNA 3BYPA 4B9NA 2CQ0A 3PW0A 1V9OA 3AA9A 2WOMA 1TUVA 5EGYA 3KLHB 1HQ2A 2HYIB 4C11A 3KXDA 2J6SA 1HYSA 3EXCX 2YQ1A 3QAUA 3J81j 1SKSA 2YNIA 4DR4F 2AZ1A 5CZVA 3MR2A 5HBMB 4V19X 4CNYA 4FYVB 2MTLA 3UNYA 1F5CA 2Z56B 3TARA 1Q7LB 4DSFA 5F8GA 2XQCA 4JI0J 1HMVB 2EVZA 1EJ7L 3PRVA 4DR2F 4X62F 2IRUA 1HQEA 1ZOTA 2I6WA 3M1VA 5AE3A 2CQGA 4OYXA 1NK8A 2ZFHA 5F8HA 4KHRA 4MK7A 1YBAA 3FKBA 3DRYA 1WWHA 3PACA 4DQRA 5BYQA 1F9HA 1REVB 2V67A 2QA4G 3GIIA 1FRLA 1X9WA 4NLSA 4URSA 2X51A 5F8JA 3K59A 5CA5A 3Q2SC 2QLXA 2I2YA 2MPUA 1HW9A 4TXSA 3MAQA 2BABA 2IYIA 2PFFB 1RU2A 3QJJA 2HS4A 1JLEB 2H3EB 3W7BA 1N48A 2DY1A 2CIMA 4PYDA 4F3OA 2JLEA 2MHNA 3PW4A 2LP4A 3DGPA 3V6DA 4IQMA 5ETNA 3NMAA 4FVCA 3KHLA 3M6XA 2BQUA 2DGTA 2DHGA 4HT5A 4JI8J 1RQ0A 3SXLA 3OV7A 2CQ1A 1HNZF 2BBEA 4J9QA 3POTA 3VVTA 2XHWA 1T05A 3FQLA 1RT2B 4LRAA 2AV5A 1VHIA 2WONA 2OSQA 1Q5YA 3CGIA 5HMXA 4BHQA 3QSIA 3JAMU 4NLDA 3WX8A 2OAUA 2OH2A 1TFWA 4P7TA 4LR8A 1UFKA 3HVTA 2OP5A 1MNEA 2HW3A 2MLYA 2N7YA 5KT5A 1UZHA 4PWDA 2W4CA 4J5OA 5HROB 2BEFA 3MAAA 3D28A 4MJKA 4FYWB 1RSCA 2O5DA 3UFCX 1VDHA 1HNXJ 2G0CA 1YJNS 1IJFB 3HSGA 2VKRA 2DR9A 4GO5X 3QT6A 2G13A 4OZ1A 1SQGA 2WSEC 3W3SA 4ID5B 1SIWB 5D3GB 3MM5B 5KFWA 1H6KX 2IDLA 5BR8F 2Z58B 4X84A 1UVMA 4ZPAA 1SJ3P 2B5JA 3BB5A 4Z2XA 2CJ9A 1IBMF 5L1LA 3UQSA 1IM4A 3IR6B 2HVEA 5GAEU 4YY3F 3FVYA 4QPXA 3G82B 3GG1A 4NCBA 3MCOA 5E3RA 3JTNA 4YB7A 4F2RA 3E2EA 2BE9B 4OZNA 1EKRA 1VC5A 3GE9A 4UF4A 5D8HB 1KQKA 1U4BA 3PTWA 1AUSL 2GQCA 4HTJA 3TVYA 1NPKA 2MKYA 2HQDA 2RAQA 2KZMA 2LU1A 2HAIA 1B0VA 3W60A 2FHJA 2QMUB 1HD1A 1N33F 4DFJA 3U1MA 2CG4A 4OYIA 1G1XA 1K47A 3CD5A 2CNOB 1KP6A 4NI2B 3UCUP 3J7AN 1NXIA 2Y3YA 4P2FA 2VG7A 1IBLF 3MR3A 4DV1F 1LQ9A 4OYBA 2CJXB 3OJSA 5IFMA 1KQSR 1H38A 2OD6A 4MTPA 2ZDOA 3OLAA 1YRTA 4RNOA 3R1LA 2WVDA 4O4RA 4G65A 4NMXA 3ZXWA 1NK9A 2WVEA 1MSWD 3FQKA 3CCMS 2R3VA 5HMZA 3H4BA 1U1MA 2KFZA 3BGRB 2IMWP 3Q0AA 2MZSA 1G4CA 3LP2A 4DU8A 2CWXA 4ECXA 2HIQA 1Y3JA 3JSMB 2IJNA 2LEAA 4LQ9A 2M4MA 3DRSA 3QAEA 2ZZTA 1RWWB 2R2SA 1LWFB 3GP9A 2EK6A 2XMKA 4GKKF 4HDGA 3I6PA 1DJ0A 3I32A 2Y8WA 2HLTA 4PQUA 1RWNB 3PJ9A 2EWHA 4ZJLA 1BLUA 1JLAA 2KYZA 1A7GE 5KOWA 2ZH3A 4KV8B 3OSNA 1I94F 2HS0A 4TY9A 5DRKA 1S6QB 3C16A 2Y0BB 3DRXA 3GFHA 3WBZA 2E1AA 2N4DA 3FMWA 4LF4F 4OI0A 3OR1A 2Y0SD 4JBCA 4JI3F 3M2RB 2B9WA 2ZOFA 2ZH9A 3AQOA 2MKIA 2ZOGA 3BGFA 2Z2YB 4RKUC 2AEJA 2WBMA 4UT4A 2RDDA 4ZITA 3A3NB 4OIXA 5L1IA 3OTOF 1M5VC 2RUGA 1RBAA 4DFMA 2UUWA 3B54A 5A8KA 4URQU 2VG6A 2VJUA 2I5JA 4DG1A 1KDNA 1QVGR 2YH0A 2MKCA 2KU7A 1VS3A 4PUOB 4P75A 2V34A 1ZETA 4ECVA 2DIUA 2KI2A 4HI1A 2XBPA 2F5GA 2P9EA 3V4IB 3D4JA 3U1NA 4WJBA 4QU7A 3C8YA 5KFMA 2HFSA 3MR5A 3OL8A 4OHWA 4DBQA 1FJGJ 2MLXA 1XR7A 3OVBA 4CH0S 4M5DA 4W98A 4DL2A 2ZEJA 4LFAJ 1ZM4A 1NMEB 1YDLA 4FPIA 1VK8A 2UXDF 4TKTA 1DTQB 1ZAVA 4O4GB 4EBDA 1HWJA 3B4DA 1FX4A 3GLJA 3GWCA 4KPCA 4Z7YA 3M30A 2OUGA 2VUGA 1R0AB 1O0PA 1QE1B 4QQBA 1N5TA 3HCXA 1SI9A 3IGNA 2B4OA 3H5YA 1Q1KA 4F7VA 4EWTA 2HQGA 2NSCA 4ZPCA 1UEVA 4YP3A 3IN5A 2U2FA 1IKYA 3PYGA 1R0CB 4OZLA 2IC3B 1N0UA 1U6FA 3BQ0A 1PAUB 3BM7A 2NUUG 2W2PP 3ZFVA 2HFZA 1Z2LA 2R8IA 1RISA 3ILLA 2W24A 1TL3B 1KSPA 2ZKTA 3N4WA 2B8PA 3DXSX 3FFIB 1H0HB 1N5SA 2DH8A 1FXRA 2BXJA 3KUEA 4DV5J 1BWEA 4R5PA 5F0UA 2O1PA 1FEEA 1KQFB 3R97A 3N6NA 2VBYA 4FBUA 1C0UB 4K4UA 4DR6J 1RWPB 4QW8A 1YGYA 2DGVA 2JC1A 2UXBJ 2LXUA 5E5NA 3DXBA 1RABB 3O44A 3D9BA 2VU5A 2ZH7A 3GIMA 1U49A 2CZ4A 4L76A 3KWMA 4ZIWA 3DKDA 1YRXA 5IT4A 4OI1A 2D3ZA 3ZO7A 4DSKA 5F8IA 3CD7A 3HHEA 4FNIA 3Q2TC 4QWCA 3C66A 2KYXA 5CYQA 2HBQB 1S79A 3SFGA 1JLFA 5DM7Q 1KQGB 4H4MB 2A6MA 3NEKA 3A13A 4CI0B 1N5YB 4WFZA 1Q7YT 2ZH2A 2YWGA 4P10A 2OPSA 1RT6A 2VICA 1AROP 2AJ0A 3TAPA 1H2VZ 3FZ2A 4I7FB 2ZKUA 4ZVQB 4WPAA 3EVWA 2BQRA 1Q0NA 1TK8A 1M1GA 1XK8A 3OXGA 4CTAB 4IOAQ 3DOMA 1VQPS 2HWTA 3IS9A 1HNWJ 1FKPB 2IY5B 5D0GA 4JI4F 3WHIA 3SCLE 3RGIA 1T03A 3UVJA 4IH7A 2OPPB 2R2TA 2YNHB 2VIHA 1WD6A 4PWUA 2DR8A 3LW5C 3HJVA 4F3MA 2ZH8A 1GTHA 5AJ3F 1V6HA 3FJ2A 5KFFA 2GAGC 1NM2A 4ED3A 2RS8A 4X4RA 2GVDB 1TMJA 2CQHA 2XSFA 1NKBA 3I9ZA 4F4KA 4I68A 4NL5A 3EE3A 1VQLS 4PEOA 4NYZA 1FRIA 2GQQA 4H4OA 2E9ZA 3BN7A 5KT7A 5C7PA 1WI6A 4G1QA 4B9MA 1S6PB 3PFOA 4DL3A 1UEKA 3UN2A 4DV3F 2IM1A 3K5PA 3NOCA 4LVNP 1ZAXA 2MHEA 4ETXA 3OFFA 1X5TA 2KG1A 4IO9Q 3CF5Q 4LF9J 2XYGB 5HVFA 4KGMA 3VAIA 4ETZA 2AT1B 3EGVA 4K0KJ 2JZ5A 1DQ9A 1L3UA 5EX3A 3KLFB 2RRAA 3RYLA 3D67A 3DLEB 2QSWA 4ZCLA 3KLEA 2ZUAA 4TU7A 5C42B 2RT3A 2AW0A 4XO0A 4I67A 3HFZB 2DNLA 4PG8A 1IR1A 3MEEA 4LRDA 1MW7A 1P9QC 3GIKA 5KT3A 5F3TA 2NYIA 1QM9A 2CPXA 1Q82T 4DR5J 4P52A 3HX9A 1IKWB 2XI2A 3AB4B 4NX9A 2LQ5A 5DDQC 1VQNS 2A0FB 2HURA 4A47A 1CJTB 5DGBA 4YB5A 1MWYA 2DK2A 4YQWA 4HH1A 4TY8A 1SH3A 1HBOB 1IVZA 5IC4B 1RWXB 5HK4A 4Y2AA 3QATA 1WSVA 1PJ6A 1T3NA 1R8HA 4KH0B 2V6AA 3MAHA 4DPXA 3ITHB 4QIGA 2M2BA 3S6EA 4X4OA 5DLGA 2UVVA 2HG4A 2QL5B 3V81A 3C6UA 3V6HA 1S9EB 1K0TA 1D9FA 1QUVA 2G4BA 4IH5A 1NSKL 4YDDB 1QD1A 4QU6A 3RUBL 3MUVP 3BV8A 2UUBF 9RUBA 4NLPA 3THTA 2E44A 4QIVA 3A1YG 1SQFA 1E6YA 5HI7A 4M63A 2LVWA 2BE2A 1YI2S 3A8EA 4ZVPB 2FVQA 1F5AA 2LXIA 5T7LB 3PY8A 2ZD1B 3NGKA 4ZHRB 1KWMA 4B3OB 1WELA 3HP6A 5FDLA 4KO0A 1RDRA 2MXYA 4IG0A 2BACA 2AGQA 1HIYA 4JI7J 4DV6J 3U27A 1VI7A 1VBZA 2Z2ZA 1RCOB 5CD4H 2DXFA 2F8MA 3I5AA 1YBUA 4NWBA 2KXHA 4LSZB 5B0CA 4EGLA 1SUQB 3X3UA 2RVJA 4ZPVR 4C7QA 3K58A 1TMMA 1C1BB 1UJ4A 4B3RF 4IG3B 5CYMB 2UUCF 1S1UB 3CIMA 3LWMA 1RTJA 1SKUB 1C1CB 1HA1A 1QY7A 4NLTA 2HHWA 4O0NA 5AE2A 1VQYA 3OUYA 3OL9A 1VQ7S 4C8NA 2B4UA 1XQIA 1S1TA 4O3PA 1CPZA 1HBNA 1Y5IB 4RW4B 3TQEA 3T9ZA 1LV5A 2JSXA 4K5SA 1WC4A 1PJ7A 1T02A 3O6QA 3F56A 4HHUA 2H4YB 1TELA 3FGVA 4DL0C 4KJIA 4UY8T 2K7KA 3RBEA 4F25A 2DPIA 4J9VA 3I56S 2YKNB 1RE1B 2EBEA 4ANDA 1QTNB 3QIDA 3SQGB 1D1UA 2XYHB 4DUZJ 2DH7A 3UO0A 2EKNA 2QMXA 5F9LA 1HPZA 1M5KC 4BDPA 4A46A 2AP6A 3AJ1A 5LXRA 3Q8QB 1VMBA 4M5IA 1M5PC 2JLGA 1TL1B 3LAKA 1FO1A 4X4PA 2HGLA 1ZBTA 2CZ9A 5B0AA 4JI5J 4DEZA 1FRXA 4RX6A 2M52A 3ZZZA 1DLOA 2IBKA 3DOKB 3RZAA 2XYPB 1NDLA 8RUCA 2Z0GA 1U2RA 2QZ8A 1HNIB 4FBTA 2ROPA 1FHTA 2HPUA 5DQGA 1MG7A 1RI7A 2NPIA 2C2RA 1JJ4A 2IVYA 2J6TA 1C0TA 2BYCA 1SCJB 2ZBIA 5LMNF 2OFHX 3C14B 2W9CB 3A8KA 3I0SB 1Y5LB 3NBPB 5CHCB 4DPWA 1GMWD 4WFAQ 1VJQA 4DR7J 3JS9A 2KFNA 3V2UC 3TA2A 3BH6B 5DLFA 1YZ6A 2ATCB 1FK9A 3NRBA 1OMSA 1TAUA 1GQEA 4A8OA 1RT3B 1U26A 1BQMA 2W7OA 1YRUA 1LWEA 1R6VA 4GKJF 3A12A 4IR1A 2PDAA 4WP9A 3N6LA 5F8LA 4WXWA 4TU8A 3HVRA 3ZNJ1 2IMOA 1SPBP 3EWGA 4TLQA 2KT5A 4AL5A 1S57A 2CPIA 2PC6A 4JV2A 3MFHA 4MIAA 3P5BP 1RYSA 1S99A 4MYTA 3QLHB 1Q8LA 4OYWA 4UTGA 1OJ4A 1S77D 1EAYC 1TVRB 4CT9A 1AW0A 1WHWA 1QAXA 2RKIA 1FF2A 1FXLA 2V50A 1O51A 5IQ6A 1WDDA 4KSEB 4J7CA 3ZTSA 4KKOA 2GIFA 1P6TA 1SL1A 2CAJA 1BQXA 2FVPA 2QJ3A 2YNGA 5GADI 4Y6IA 3CCTA 3LO3A 1KOHA 4Y0FA 2AMCB 4K5RA 1O5JA 4D3GA 3M6UA 2CQCA 1RT7A 4RLEA 2R8JA 2WVFA 4BLGA 3QO9B 3WX4A 4ZPWR 4DQSA 4H54A 4DV0F 1CC7A 1RWOB 4NRTA 1VQ4S 3ILIA 3FSYA 3VV2B 2R7OA 4YDXA 2XCPA 3DI6B 2C3UA 3NLCA 2OTLS 3VAKA 2FD2A 2LQ8A 3N6MA 4F3QA 3NWRA 3P4UB 2L9NA 3QJLA 4PYAA 4KAIA 1N5VA 2VONA 2HGNA 1CSJA 1RA6A 5G0RA 5GAGI 2RE1A 2Q1LA 2XMWA 3R2CJ 3ISZA 4LF8F 1UWAA 2DNNA 4RW8A 2JHEA 1TU0B 3P8BB 4DL5A 2WOMB 2QIFA 4L3KA 5IXUA 5DS7A 1Q4RA 2IYGA 2BJ7A 1U1LA 1FFGB 1FD2A 2F1FA 2CYYA 2QX0A 1TKXA 3TZZA 4ZOSA 3NCPA 4K4XA 1TUWA 4OZ3A 4Q0BA 3H7HB 4ER8A 3T1HF 4HI2A 2XLIA 2Y1JA 1VC0A 4CLUA 5IOLA 3EX7B 1XMQF 1K44A 2HHHF 1HQEB 5EWGA 1PYSB 3MECB 2DNGA 1EKSA 4DR4J 3K5NA 4P73A 4X4NA 3FEZA 4LQ3A 4DF4A 3H8YA 2KN4A 2HVZA 3SCKE 3P6YC 5HP1A 5C24A 1S0MA 1FFSB 4DR2J 4X62J 2C3PA 3TZWA 3GR1A 1M0SA 1SV5A 2DTJA 3PDNA 5F9NA 2CNLB 2FC9A 3FMBA 2UXCF 5FJ4A 3BJYA 2QLWA 4I2QA 1VQ6S 3CJ0A 2C2NA 4P71A 1YVFA 2YPZA 4C2MA 2CNNB 3UCZP 3SEOA 1NO8A 2R8KA 1G2EA 2J0WA 1MN7A 3PW2A 1OYEA 1MU2A 2K8GA 2XMJA 5GAEI 1WUUA 3VTIA 1S0NA 2DBBA 3LGMA 2MZ1A 3FRYA 1D8YA 4F36A 2DNMA 3GSDA 3PXGa 2DR5A 1HQUA 1S1WA 1Q8KA 4ECWA 3DGPB 4Q7AA 2QEXS 4MKYA 5J1EA 1U2CA 4C0OC 3VGSA 5KG3A 4CRJA 3GV5B 1JXLA 2Q43A 3KLGA 2WZ1A 2CPDA 4HTIA 3W2WB 2ZJQQ 2NXJA 1RTHB 3DN9A 2Z57B 1T05B 4XDDA 3DMJA 1X0FA 4RW6B 2I8EA 3ISNC 5A0YB 2UV8A 5I4MA 3L09A 2WONB 5KFQA 1M5SA 1SJQA 3GJRB 2J9CA 2KVIA 1RHUB 3EPGA 3BEGB 4I69A 1HNZJ 3DFEA 4LSLA 4U8YA 3M6WA 4ILRA 3JSBA 3DU5A 3DDNA 3HVTB 1ZM3A 4H4KA 3J7A1 4FZVA 1U0HA 5I42A 1NPPA 2FY1A 2E5LF 5AXKA 1FT8A 2N3LA 4KB7A 1UCNA 1LFWA 3G71S 2ROEA 4C0HA 3MI7X 1UJ5A 3T6JA 5DQIA 1SC3B 1N6QA 1B99A 3MPWA 2ALYB 3D3BJ 4DQIA 4YFUA 4NYPA 3JYTB 2FLNA 1HLWA 2B5JB 1HW8A 4TQRA 4L73A 2EFNA 4YMEA 5FLXU 4J9PA 2PI4A 3FBBA 1OQ3A 1SJFA 1S0VA 2ZJRQ 4DFPA 4M5GA 2D3O1 3W8PA 3D6TB 1Y3KA 5BR8J 3ICLA 2MGZA 4NA3A 4DPTA 4LFAF 1UPPA 1PC5A 4QJVA 1IBMJ 2R4FA 4DCOB 5LJ5Y 3DLKA 4XPEA 3RU0A 3JSYA 1C4CA 4IFVA 4YY3J 2FLLA 2IIHA 2AIRB 1TK0A 4XK8C 1F3FA 3SMZA 4AQYF 3CXCR 5DO2A 2A18A 2KRRA 1IBCB 2WRMA 1KLMB 4OI2A 1SH0A 1C4AA 4WYWA 4O3QA 1V5VA 3JXOA 5B0DA 3NG8A 2MKKA 3BKTA 3K17A 3LP0A 3IBWA 1R8BA 2JX2A 4N5SA 3QWUA 3I0RA 2VG7B 1DAXA 1TTHB 3OR2A 1YTYA 5KFOA 1K1QA 5L1JA 4L75A 3SDEA 3BGUA 3WC0A 1J27A 4ZLPA 3P45B 1N33J 1WG4A 4KHMA 4ZVGA 2BE7D 2HHQA 3ZZYA 3PJXA 3AJ2A 3PHEA 5KFZA 4DCJB 1JLGA 3WDOA 1IBLJ 2C42A 2DNKA 3ZTPA 4U96A 4DV1J 1WACA 1ZZNA 3LP2B 2E5JA 2ILYA 2F4VF 4G1IA 3CCLS 4M5LA 3FZBA 3TVKA 4R0JA 3EDQB 2DO4A 4DX8H 3Q8VA 1LW0A 2N7CA 2VOPA 3DRSB 1UKUA 3QIPA 3M2UB 2DY9A 2HRUA 3KG1A 2CG8A 4GC6A 5L46A 4UQTA 2HHUA 3THPA 1KHVA 3CC4S 2V8HA 4M94A 1LW2A 2DITA 4PQUB 3L3CA 4DLEA 1TV6B 1ZH5A 4C8OA 2D1CA 2V69A 2HRTA 1JLAB 3W5YA 4EU0A 1M1KT 1FDAA 1P9YA 2CXEA 5KFCA 1ZTWA 1ICEB 4NCGB 4GKKJ 1R43A 3C16B 4A8FA 5HQMA 4JV5J 3NNAA 3DLJA 3TQ1A 3H40A 3GFXA 3MTJA 2XI3A 3O5TB 5A6WA 3L7OA 4P74A 3KJNB 3NWGA 3CDWA 2ATLA 2HHSA 2OSRA 2Q6CA 4DCPB 4C8YA 3DCAA 1FRKA 4GO7X 2QRRA 1I94J 5DDPC 3NAIA 3W65A 4X65F 5EWEA 2OGUA 4DI6A 2IVFB 1WORA 1RZMA 2AKWB 4NLYA 2WTFA 2D9OA 1S1VA 1UFLA 2E9TA 5H9FJ 2A3JA 4LF4J 1S1XB 3VF0B 1BQNA 1FJCA 1PYOB 2RQCA 4JI3J 3SIPB 2C2EA 1BY9A 3EZOA 3GB0A 4OX9F 3BREA 2XMVA 4HH0A 5A8KB 3MR7A 3CJKA 4I0WA 4EYIB 2XY5A 3BO4A 4PABA 2VG6B 2Z2MA 3PO5A 1X4DA 1PBAA 3RW6A 4DG1B 4DR1F 1WC5A 3GV7B 3OTOJ 4C97A 3TZXA 2V8GA 3HHLA 2KXNB 1WC3A 4AT1B 2W1BA 1JLCB 5J2PA 3T6BA 2FDNA 2DGUA 1BE4A 1KOOA 2WVCA 4DSLA 4M5DB 1RAGB 3HF5A 5IQQA 3OXFA 3RR7A 1KTQA 2EW9A 1WEXA 2RMLA 3R5DA 1DURA 1LWCA 4QIFA 1RHJB 1WOPA 2L3MA 2G2OA 3RJMB 2V63A 2VV5A 4HR2A 4FF1A 3PX6A 1CBKA 4K0KF 3RB4A 4LRCA 3AODA 1YJ7A 2KZZA 2BKNA 2Y1LB 4OZ0A 3PX4A 3DHXA 1RB0A 3CDAA 3M8RA 1RWMB 2D3OR 1BXNA 4HACB 1VFJA 2OD4A 4HYKA 4ILLA 1I51B 4ECRA 1IKYB 2AZ3A 1CULA 4LF7F 3KFWX 5ETLA 1GMUA 2OTJS 2RQ4A 2C28A 2EPIA 2HFNA 4I56A 3BSOA 2CJQA 3PRDA 4OZ5A 1R0BG 3HI9A 1NU4A 9ATCB 2KB2A 4IOBA 4FF4A 4R5PB 2ZWPA 2R7WA 4YEAA 3UI3A 1HHQA 4NLWA 5IV4A 2ADCA 3BQ1A 5HMYA 1AFJA 4ZCKA 2QL7B 4F02A 2E66A 1F3VA 4W90B 1R8PA 4BC7A 4TNOA 4I6AA 5A8RA 2GIRA 1B0TA 3RB6A 3VGVA 2MZQA 3EVMA 2J0SD 3GZ7A 3QYYA 2VDHA 3A3PB 3R5AA 4I4BA 1TKZA 1HHTP 3KJVA 2FVCA 1NDCA 1FKOB 1OSCA 2CNKB 3N5FA 4X4VA 2HNYA 2DNHA 3MGJA 1Z4UA 4ES1A 3OD2A 2EG2A 2AX0A 1JLFB 3HVAA 5GMKa 2RDIA 4NLVA 4Q44A 3C6TA 2CQ3A 1JNRB 3HFVA 4KIAA 3R2DJ 1X4GA 2LECA 2BA9A 2ZNYA 1D0EA 5KG1A 3I5BA 1RT6B 4D3HA 2BQ3A 2CPFA 3IP0A 2M8HA 1WJ9A 4N7TA 2DKOB 3I87A 1Y0HA 1XR5A 2IM2A 5H9FK 1WKJA 2FLPA 4LBIA 1I6JA 5KFIA 1FD8A 4QR1A 3IS9B 1NKCA 4ED1A 4XIUA 5IT0A 1T03B 4F4YA 3UVJB 2UP1A 2F7VA 4NCAA 3L4BC 3KJFB 1OO0B 4OYMA 5K20B 1LK7A 3JQMA 4PG7A 1K73T 5L9XA 3KLHA 4N8NA 2UUAJ 3DDKA 2KTQA 2FJXA 1HKAA 2X1BA 5GMEA 3AJDA 4JI4J 5L9NA 2MQPA 1WG1A 4DUTA 1RK8A 5SUHA 5KFYA 3MR6A 1UA0A 2CVIA 1UVLA 1PC4A 5KFAA 2CQBA 1MMLA 4H4OB 3M2VB 5HBMA 2GCFA 1GEHA 2XWYA 4Q2MA 3VWSA 5AJ3J 3ET6A 2W9AA 4OMFG 1EP4A 1HHSA 5B0EA 5C25B 5KFKA 4TLRA 3KYLA 5HQ8A 1X60A 2XLKA 2BANB 3MF5A 2ZOMA 1Q8BA 1HBMA 2WB4A 2CPZA 2JJ4D 1S7IA 4Q43A 2QA2A 2CQDA 4ERDA 2LA4A 1D3WA 1WNEA 4GMKA 4YR0A 4DV3J 1T95A 4LT6A 4DUZF 2YY3A 3KKFA 3MMBB 5LM7E 3CDUA 1TL7A 1VISA 4ELTA 3IM9A 1REVA 3E8OA 1JKHB 4CYUA 2HQ3A 5DETA 4NOHA 1FNOA 4F4AA 3IM8A 3MM9B 1T94A 2DRAA 2ZJPQ 3MEEB 1WHYA 5BYRA 2PMZD 2E9RX 4NA2A 5D78A 3KJQB 2XNRA 5KT2A 1U8WA 5E7OB 3D7SB 3FNNA 4R0EA 2GHVC 1OIAA 3ZZTA 1JLEA 2C2ZB 3G86A 3MMCA 5CZXA 2BJ8A 5H9EK 2RSQA 3RAQA 3AAWB 1W7WA 3J80U 2E5GA 1WTBA 2GA7A 1KVIA 5KFUA 1P27B 3Q86A 2DRDA 2GX8A 4TY8B 4ILMA 3CO0P 2PT0A 3H90A 1OS5A 2VC1A 1RHKB 1U48A 3CDEA 2VJVA 2X1GA 1TKTA 3US5A 2OEMA 2RJZA 3GJTB 1CJKA 1P8GA 4IUFA 3V81B 2XLJA 4URGA 4JI1F 5LJ3Y 3R9LA 1JX4A 1JXEA 3BH7B 4Q2LA 2OPQA 1XNRF 3GG0A 1QSLA 4NXMF 2AYEA 1B7FA 4ZLLA 3OLBA 4FXDA 2OI2A 3E51A 2ZM6F 2MQOA 2XHCA 2QG9B 4AE5A 3MMAB 4DZ6A 2VA3A 2BE2B 3S7RA 3D0IE 3CVKA 4EO6A 2YBVA 3U1LA 3JTOA 2NR0A 4IRCA 1YWXA 3W5ZA 2RRNA 5EX0A 2PEBA 5FDLB 2UUBJ 3QRPA 4WE1B 4IG0B 5KFHA 2YWHA 3OT9A 2AQ4A 3H25A 1VQMS 3QFHA 4QCLA 4DV7F 1MWZA 2XMMA 3F41A 1FI4A 1T8EA 1FA0A 4CLYA 2FIUA 2LKZA 5ETVA 2E7VA 3MCNA 3MM5A 2YWKA 2HKEA 1RAFB 2XM3A 2FJEB 2POKA 3S1TA 2ZH4A 4USJC 1UJ6A 1PCAA 3CMQA 3QSYB 1PO6A 5GVQA 3D66A 4FYYB 6FD1A 3Q8PB 1RTJB 4U6PA 4JI2F 3G82A 4ECSA 1GK8A 3I96A 3FCHA 3OUYB 2A2DA 3G8SA 3D1HA 4B3RJ 1SC4B 2QTWA 1HBNB 2DH9A 2UUCJ 2QGFB 1WKKA 4BWJA 4PWWA 2QLBB 3B82A 4I64A 5IC6B 4EYHB 2MSSA 2FJDB 4Z37A 2OHDA 3NAHA 2GAHC 2IM0A 2J7UA 3DYAA 1DZ5A 5AXMA 1B3TA 3TW0A 1WC6A 2VPYB 4KBIA 4K2JA 4EBCA 4JOUA 3HM9A 5L38A 2MY8A 4OYAA 1RXOB 7FDRA 4TU9A 1RKIA 4NI2A 1J5EF 2HK2A 1NSPA 3GCWP 3KG4A 1JLQB 1FERA 2QV6A 1NAQA 4USMA 3HPOA 1U1QA 4OLPA 4UZCA 5AXNA 2HWHA 5KT4A 4S0MA 1FWPA 2YQ3A 2E1MC 5B09A 3DRPB 4K50A 4WZMA 2PFDA 4LSNA 1QUPA 3TEHB 1KVJA 5HN0A 3TAMB 2OMOA 2H5JB 4F4WA 2DHHA 4ZKAA 1RHQB 1RTDB 1J2VA 1JXVA 3CCQS 3TA1A 2Y9HA 3M8PB 3LUYA 3BBBA 2MB0B 2AJ2A 2BJ1A 5KFEA 3AXKA 5LT5A 3MM6B 3JSMA 2B43A 2HQFA 3GU0A 2B7CB 1C2PA 2HAFA 1KFDA 1DTTA 1XEZA 1U1PA 1RAOA 3S8SA 5E33A 4B3MF 2Q6BA 4ZP8A 1FRHA 2DPJA 2JH3A 4N77A 2XY6A 2OPRB 4IFYB 4ZK7M 4KV8A 3I9V9 4B3SF 5LMNJ 1FK9B 2AU0A 1YBTA 4RNFA 1S6QA 3G6XA 1WDTA 1BQMB 4C9DA 2CFXA 1TP7A 1XTZA 2RHSB 1FESA 3SV4A 2LLZA 4NMLA 4K4VA 1NBEB 2AEMA 4MKAA 1NHVA 1H72C 3G96A 1U47A 4OZJA 1ZA2B 2YKPA 1VRTA 2D3UA 4GKJJ 3M8WA 3L7UA 4TYAA 1A9NB 1TK5A 2JNJA 5B08A 1G3OA 3NL0A 4NA1A 3IAS9 4K59A 5JVGQ 1Q78A 2D74B 2RKIB 3EGWB 3OVSA 4NZ6A 3AD7C 5LL6d 2B56A 2CVEA 2G1DA 4OX6A 3QT5A 2GGPA 4PG5A 3TA0A 3V4IA 2GJFA 2J9EA 2YNGB 1RWUA 1RAJA 3CEDA 4M5NA 4TQSA 5DDRC 3KMSA 3RAMA 3AHPA 3GJQB 2HQIA 4RPFA 1T9VA 4GVLA 4J9KA 1ZM9A 5GMDA 5LSLA 4K4YA 1U1KA 4PXDA 3EDRB 3GYXB 2DGWA 1DTQA 3NKYA 3M05A 4RW7A 2OKQA 1LOUA 4CO4A 1F6TA 3HMJG 2V2ZA 3T5KA 1WI8A 3UE2A 4DLGA 2RU9A 5KFPA 3OTDA 3BKUA 1W25A 4O0IA 2V68A 4FP9A 4K2XA 2VBWA 4QYZK 4DV0J 4Y34A 2OIHA 3KUHA 4ZS6A 2HZVA 1QVFR 1U24A 4MMOA 2UVRA 4PXCA 2RS2A 3MMJA 3KK2A 2XZWA 2W4DA 4RW8B 4M8LA 3DLLQ 4ZJOA 3FEYB 4LF6F 3CCRS 4XAKA 4U95A 3NGTA 2CQIA 2ZH1A 1S6OA 2NUHA 1CJVA 3CCJS 4LF8J 2IAJA 2MY7A 2Y1RI 3HD2A 3OHAA 2H1YA 2BM0A 3NGRA 1LEOA 4J9NA 4IQXA 2P2CB 5HQLA 1HARA 1C0UA 4Q0BB 1BGXT 4ID8A 3HT3A 2JFKA 5M2UA 4WXOA 4F0KA 5KFJA 3W63A 2ZBCA 1Y4ZB 3R7SB 4EUVA 2BRKA 4DSIA 2FHMA 5DZ6A 4BC9A 1NH7A 3ETMA 4MKVA 2B51A 4XTTA 3FBFA 3TEGA 1NJXA 4W4MA 2ZNZA 2MZJA 4Q8EA 4ZCIA 3T1HJ 5D4LA 2HS3A 1XMQJ 2HHHJ 2ZC3A 2B7BB 2NSBA 1ZZFA 5F0WA 3TUJC 4H4MA 3W64A 3T19A 2ASLA 5JMNA 3ZZRA 4YB1P 2L9DA 3LP1B 2FGCA 4IO1A 2UZAA 3CCWA 4OV1A 1RBOB 1UFWA 1EETB 4ZP9A 2E1PA 4I7FA 1N0VC 3IA0A 4F0MA 4C3MA 4C8ZA 4I1TA 1MU2B 2UXCJ 4CTAA 1N32F 2BW2A 4O23A 1VRQC 4EO8A 4CDIA 5J1EB 1X8DA 2YPYA 2OPPA 4JYAF 2VG5B 1H2TZ 1FJEB 3MPUB 3KK1A 5JJBA 3O3LA 2KL8A 4FXWA 2ACMA 1LKZA 3BF4A 3KHHA 1ZPWX 1VIXA 1T9WA 4WFXA 4C3KA 1R8AA 3RAXA 4EFAC 1UVKA 4DF8A 3CO9A 3UDEA 4MIBA 4IRKA 2I38A 1UVJA 2JOQA 4JI6F 4JV5F 1S6PA 3A8JA 2M9KA 4PR6A 3W2VA 4CLTA 4FS2A 2QA4S 3AOBA 3PW5A 1S59A 3N5BA 1D9DA 2J0XA 4UZBA 4EZ6A 4J37A 3S01A 1GNKA 4EZ9A 4X4TA 5KT6A 3IG1B 2DGSA 2RIJA 4L72B 1BUXA 3BPSP 3VCDA 1RT4A 4U7UK 4NE9C 3PRBA 4DOZA 1YSJA 4LFBF 3H2UB 5C42A 2UVWA 2XZTB 3LH2S 4DX5A 3LGHA 4A48A 2PI5A 2W7PA 3NCQA 5DZ7A 2E5LJ 3QPIA 1N34F 4F26A 3PV8A 3DLGB 3SBMA 2UUTA 1UW9A 2E1RA 2CKWA 2WK4A 3LOUA 5K9FA 2ZE2A 1FFWB 4M5KA 4CLSA 4OFZA 1XMOF 3C2PA 3BPDA 1N88A 2VFTA 2VZ9A 4LVOP 2BM1A 3TJ9A 4NLUA 7AT1B 4L6V3 1S72S 1CJTA 4ENOA 4OL8A 2F63A 2MGZB 3GV8B 3DOLB 2RHQB 4O44B 3VQSA 1HBOA 2EG1A 3DLKB 2Z2LA 2YKMA 2MSTA 2ERRA 3AFGA 2WBRA 4ANEA 2J7KA 4OHZA 2W4PA 4IFVB 3ZTOA 3EMTA 4HEA9 3FUYA 2FLOA 1F5BA 4K4SA 4KH1B 3ITHA 4LJMA 3MPYA 3NOGA 3QRRA 2LQ9A 5C5JA 2RNEA 1KKHA 2HBRB 1PILA 2AGOA 4QZVB 4ZIVA 3KG0A 1IN0A 3D5MA 2VD3A 3HKZD 3LP0B 3SFUA 3I0RB 3CE8A 5D6GA 4MKBA 4AQYJ 2KHCA 3OR2B 2V8DA 1N54B 4ZMMA 1TL4A 3MM8B 4ZN3A 4OZ2A 5HVHA 3PVXA 3NGSA 2M0GB 2DIVA 3TNVA 5J2QB 2MLZA 3J80Y 4RW9B 4ZHRA 1UETA 4DSEA 4N56A 2FHKA 2J9DE 4PPDA 5HMWA 2LU2A 4C48A 1WKLA 2CUYA 5E3PA 1RAEB 3OJUA 1L3KA 2FZGB 3ENVA 2QLJB 3G6VA 4GC7A 1LW0B 3T5LA 1SUQA 2RRBA 1SC6A 3CWJA 3IC1A 3M32A 5SZTA 3QIPB 5HJXA 3Q8RB 4WP3A 4F50A 3KK3A 2EC0A 2L08A 2ASYA 2J8SA 1P1TA 1CEZA 4IG3A 1VBYA 2LDYA 4B9SA 2R8GA 5CYMA 2QLFB 2F4VJ 3W9IA 1TQLA 1LW2B 4YUDA 1S1UA 3NP5A 5DG7A 5D77A 2BUNA 4LR9A 3IGVA 2Z4PA 2WHOA 1ZM2A 5A76A 2IPOB 5D15A 1VK3A 3MHYA 3J7ZT 1KD1T 3SSRA 5E3CA 2MQNA 2KXFA 4RZRA 1CS4B 2W25A 3TR5A 2VKZG 4DWIA 3CJ4A 4CQ1A 3IRXA 3PIOQ 1K1SA 4YB6A 2BOAA 1FX2A 5HAOA 1EARA 1NB7A 4RNNA 5J2NB 4FVMA 3C15B 4A8YA 2QMWA 1X0PA 1YJTA 3UNGC 2M8DB 3TJAA 1UA1A 1NSAA 1AFIA 4WYLA 4OHXA 1S1VB 4ELUA 4B02A 2AEFA 3MM7A 2OELA 1SJ4P 1E6VB 3QRQA 1BQNB 3G9CA 3H0PA 4O3OA 3CJQA 2E7WA 1PGZA 1FKAF 4LIWA 4X65J 3CJKB 2KKHA 2ZITA 1KRPA 2BV3A 1TL1A 5MAOA 3W66A 1RACB 1JQGA 2DNYA 2PA8D 3ELHA 3MUTP 4O3SA 1MROB 1SVDA 3VGTA 2E5IA 2R7XA 1NK4A 2UUAF 1KLNA 3D3CJ 3J7Z5 4QWEA 1ZA1B 1YJVA 4JP8A 4DXLA 1RT1A 1X9MA 3DOKA 3G6ES 1XMBA 4OX9J 2EXUA 4OJHA 5J2PB 2ZHAA 3V6KA 1VIOA 3T1YF 2YWFA 1HNIA 4FYDA 4ED7A 5D4PA 4DR1J 2DD8S 4PZVA 3BDEA 4PKDB 4OV6A 1RTZA 2VHGA 2WCXA 2XS5A 2MKSA 2AJFE 2DXEA 1F9FA 1M1HA 1P1LA 1VC6A 5I3QA 8AT1B 2V94A 1T7PA 1BWVA 5KFXA 2CPHA 4IRDA 1AYEA 2QN6B 2NZCA 3PCOB 1K0VA 4IH6A 5L39A 2GO8A 1T9UA 1RAAB 4J9UE 5K8MA 2VBXA 3W9JA 1RT3A 4ZVOB 4FS1A 4RO0A 2K1RA 4ANCA 1IUJA 1CULB 4ATNA 1IQZA 4K4WA 3JQJA 1RTIB 3RRGA 2R7UA 4RR5A 4RWWA 3KUGA 2XWXA 3ULHA 1N56A 1F0XA 4N76A 5HJYA 1XNQF 2KDOA 3VAMA 1SL0A 3TAQA 1JJCB 4LF7J 4C0BA 4OYPA 3P96A 4H4KC 2AJQA 2K7JA 2LYVA 5T14A 1U02A 2HHPA 1REGX 1Y7PA 1TVRA 2X3GA 3PNIA 5KFDA 4IR9A 4OHYA 2DGQA 3BSNA 2O3DA 3GONA 2B9XA 3W5XA 3NCRA 1RU1A 4ED0A 3I4PA 3HK2A 2C3YA 4DU7A 1HBUA 2E5HA 5A8RB 4CH7A 6FDRA 3K5MA 2AX1A 1K8AT 1S12A 2EFQA 1TKZB 1GMWA 5CABA 3DC2A 1SH2A 4A4JA 3UR0A 3CSKA 3PX0A 4CM0A 4C8KA 4C8LA 2F40A 1RT5A 3SYZA 4DL7A 2MKJA 3QO9A 5FIIA 3QQCD 5HLFA 4C6AA 1JLBA 2GVZB 2XY7A 5BYSA 1ZS6A 1NK6A 4DR3F 4L74A 2HVDA 3EXYA 3NXZA 4OJ1A 5KFTA 4EI2A 4R8UA 4MK8A 1RP5A 1LK5A 1VOMA 1HWUA 3PFEA 4KTQA 1N36F 1X4AA 2R7TA 4ECQA 5J1NA 2UV8G 1IQTA 2APOA 2LFVA 3WC2A 1RUSA 3ISND 1JJHA 2YVSA 2A10A 1AZSB 2YTCA 2YNFB 5K8PA 3P49B 3BR8A 2HVIA 4ZPTR 3RG6A 1U8SA 1Y10A 5K5MA 3MFIA 3BBFA 3KHRA 2NCKL 4AXIA 5ETOA 4QOTA 1VLYA 1DRZA 4TN2A 3Q89A 2F8EX 4EBEA 2RF2B 3ET6B 3JTPA 4QIWD 4ZVHA 4QW9A 2GC8A 4NXNF 3CJTA 3JAMY 2RH3A 1KVKA 1WF0A 1EP4B 4NRUA 3NMRA 2CPYA 2F65A 3VZHA 3MECA 3EJMA 3K8WA 4QYRA 1HBMB 3EUNA 3NNCA 1NDPA 2OFGX 3OTBA 4ZPDA 5GADU 1VQ8S 3CW2C 2ZZMA 1NRKA 4XPCA 2DGOA 3D6HB 3EZ5A 3FSXA 1TL7B 1VQSA 2PN6A 1YG0A 3QMQA 4CYUB 4LF2A 4PXBA 2NQPA 1TFYA 3CCES 3W62A 3H5UA 2H5IB 1B4SA 4RU9A 3EYZA 5J2MB 1LFPA 3PYFA 1X5OA 1LNQA 1FDDA 1Z2ZA 1FXDA 4NLQA 1QAIA 2HK3A 4QPTA 2JVRA 3MMCB 1S9GB 3CCUS 2JC0A 1Q53A 4UOHA 5GAGU 4GVBA 4KC5A 5A8WB 2RQKA 1DQ8A 4WWSA 1ELOA 4JUZA 3RBDA 2F3JA 4C98A 2LA6A 1YIJS 3HT0A 5U47A 1Y11A 2NXCA 3MEDA 1IKVB 3MXHP 3H42A 1TKTB 1H7XA 1XIQA 4UUWA 4UY85 5JXSA 3W2WA 1CJKB 4AL6A 3HXMA 2PSZA 2JLFA 3AXMA 1RTHA 3CPWR 1HFEL 4RW6A 2MQQA 2OPQB 5A0YA 1FEHA 2R2UA 2ZBRA 4DV2F 3P5TL 2W8LA 1QJHA 4RUAA 2FJAB 1R27B 3HHLC 1NZAA 3ILJA 1VRUA 5KG7A 2DR6A 4ED2A 4WTOB 2H54B 4JI1J 4NLOA 1XNRJ 5KG0A 4NXMJ 3HHDA 3M8SA 3G87A 2XC9A 2E29A 2PA3A 2ZM6J 4X66F 3TI0A 5DDOC 1R6YA 3T5HA 1RLDA 4RL1A 1HNVB 3VAGA 5D4OA 5IM0A 1A6LA 3UPFA 3H20A 4WU2A 6AT1B 1N8RT 2EI5A 1NHUA 4KT0C 3IMQJ 4HDHA 4FXVA 1U6ZA 3JYTA 2PD1A 3OFEA 1WG5A 4ITSA 2QC3A 3FK4A 2N3OA 1UPMB 2XB2D 4DV7J 1NKEA 5M2PA 3HO1A 2R7SA 2DEIA 1M5HA 4OJGA 3E01A 3L7PA 2DNOA 1SQEA 3CC2S 4KGZB 1IWGA 2IJFA 2YXLA 4CH1A 1KTVA 1EZZB 1O8BA 1CJUA 3ETOA 3CT9A 3Q8YA 4KFBA 3B8HA 5E0OA 2XGQA 3K5LA 4JI2J 3DYAB 2L41A 5IZHA 3VALA 4WFBQ 3JB9k 4WIQA 2GHPA 1KLMA 1T0TV 1U6BA 2W2QP 2SXLA 2JEJA 1UWBB 3NGDA 3DDIA 2JEGA 2CZVC 1F2HA 4DUYF 4E8UA 1AB8A 3THVA 3M9MB 4IDKB 5ETTA 3I5CA 2IA6A 3OFGA 4UOCA 1KEKA 3BR9A 1S10A 4RU2A 3JSRA 2VA2A 1SC1B 2EKYA 3MURP 4DZDA 2M7SA 1J5EJ 1PG5B 4CLFA 4LSNB 3R27A 2DYAA 4ICLB 2BRLA 2VFRA 2XSJA 3LWLA 4LRFA 3T41A 4DV4F 3KLIA 1V3ZA 1H2UX 1WEYA 4DQPA 5T41A 5BJRA 5KFLA 3HFKA 4LBHA 3UD4P 3J81U 3DLHA 4NLXA 3SV3A 4C11B 3M2UA 1HYSB 4B9TA 4BBYA 4Q8FA 2HHTA 5LSRA 5KTQA 2QT7A 2V2QA 1DTTB 2MYFA 2J0QD 2YNIB 4KQZA 1NHKL 3CD0A 5GAHU 2GFFA 1A0OB 1TV6A 3TX0A 3M9NB 2XZDB 3N01A 2AWZA 1AUDA 1IWAA 1XR6A 3J7YU 1BC6A 3QNWB 1GTEA 4NCGA 3RTVA 1GAOA 3ILOA 3M1VB 4Q5VA 4B3MJ 5K8NA 5C2GA 2MKHA 3TANA 4DHVA 1J5OA 1X4CA 3GR0A 4DPUA 1OPZA 2JEFA 1OY8A 2CA9A 5I3UA 2FJWA 4B17A 4OX7A 4B3SJ 2VFVA 1XN9A 5IWAF 4WIIA 4OYZA 5EUHA 3U02A 1VRTB 2DNQA 2HFVA 1S1XA 4X2BA 1VGYA 3IXQA 3QT8A 5K8OA 4YOEA 3ZC4A 1HWLA 2CPEA 4O3NA 4TVAB 2N82B 3R5BA 2FYXA 3FBEA 3RBZA 3UCGA 1FTCA 2G0IA 2VQEJ 4YHHF 4RBUA 2HNZA 2CJAA 2B6AA 1RLCL 2RB7A 3M8QA 1NK0A 3W8GA 1UAWA 5AT1B 2M70A 2GGPB 4ECYA 7FD1A 1R3NA 3V6DB 4OYOA 4QWDA 1IKXA 1JLCA 3B78A 3D1OA 3BSAA 1VYAA 2KT3A 1WHVA 3HHNB 1H73A 3EICA 1UP1A 2VODA 4BWMA 5C2CA 3IRWP 4HHHA 3GYGA 3POTB 3HSDA 3OHBA 1ZYQA 1Q16B 4ECZA 2CDQA 3L9ZA 4OJ3A 4PG4A 5EHHA 2BVZA 2XEXA 4RW7B 4DL4A 3HSZA 5DGAA 3K0JA 3DHWC 4CLLA 3TUPA 4RNMA 2DRBA 3IO1A 3OBIA 1NPRA 4U7UD 2XMAA 2FHJD 2W9BA 2Y1IA 3B4MA 3LF0A 3RW7A 1XJWB 4HACA 2C22A 4PWDB 2NS1B 2JFDA 2B4PA 2QYGA 2ZHBA 4ALZA 3T5JA 2B9YA 3SCJE 3MAAB 3MOZA 1JJ2R 2UU9F 3RB3A 3KK2B 3GTYX 1U1NA 3PZPA 5IT9U 4ZN1A 4B3TF 1CLFA 5ETPA 2HHVA 4USWA 2GNKA 3PYDA 1T9TA 3OW2R 4QBUA 1IM6A 3QT7A 5H1SV 1CJVB 2BJDA 4WKRA 3L95X 3ADAC 2IAJB 4AYBD 2IRXA 2HNDA 3PR4A 1DHMA 3BKFA 2NREA 4LF6J 3K2YA 3N79A 4B9LA 5LMUF 4U67Q 4MFBA 4WKYA 5DG9A 4ZDNA 4X64F 1U25A 2C3OA 3MDFA 4A8WA 1X9SA 1UZDA 3IR5B 4JV0A 2R9LA 4Y2MA 2RU3A 3PEJA 1S4EA 2Q3PA 5HATA 1FKOA 3GQCA 2XS2A 1ZAWA 1ROFA 4CCHA 3G2XA 1SL2A 3DM2A 3PKMA 1EHWA 2WAQD 2CQ4A 5G4DA 1GMVA 3CCZA 5F3ZA 2V5HG 1QAJA 5M2RA 1YX2A 2D41A 3LGNA 4DSJA 1OQ6A 1K9MT 4WF9Q 5KG4A 3FEXB 3DRRA 1SJ1A 1NNDA 4ES3A 4M5MA 1GXUA 3FCWA 1I1GA 3DGVA 4KHPF 4LR7A 3N9UC 4K4ZA 4AXJA 1Q5VA 2P5VA 4USVA 1D9AA 3ENWA 2RQMA 5B0GA 3KK1B 1WF1A 1S76D 4J91A 1N32J 1ZTTA 5HSPA 4ED5A 1TR0A 3QFWA 1NH8A 4LMZA 2KG0A 2OEKA 4RJVA 1H74A 2K3KA 4ZPBA 2VF3A 4HL9A 1YJRA 3CDBA 3CJRA 1H98A 4JYAJ 4J9SA 3M2VA 3MEGA 2WSFC 3VHQA 3MZIA 2YKOA 4UOFA 3W2VB 2YX4A 2QYCA 3UD3P 3SSSA 3KTQA 5C25A 1RHMB 2BMBA 3SSQA 1PAEX 3HZEA 2BANA 1PYTA 1HWIA 3T9NA 4JI6J 3UDVA 5DJBA 3BN4A 2HBYB 2V8PA 3AB2B 1RT4B 2KT2A 1PIEA 5B7WA 4CZCA 4M5JA 4PPZA 3D0GE 2IDEA 3MMBA 1U2FA 1GT8A 3OR1B 2FHOB 1U09A 3H4DA 1RWVB 5JUMA 3Q8SB 3IBCB 1MWQA 2QL9B 3UD5A 4G3IA 4R25A 5K14A 1JKHA 2RILA 4Y3CA 1FVSA 4YS2A 2BKOA 1KHWA 3MM9A 2LQJA 1X5PA 2FTRA 1YJ9S 2VFUA 1RADB 1QTMA 4USHA 4LFBJ 2ZE2B 3KNGA 2MDAA 3OTEA 1ACMB 4N47A 3PEHA 3B6BA 5IS2A 4C4WA 1RYRA 3BBCA 1NLKL 3EZUA 1GXTA 2JDJA 3W61A 2I5JB 1N34J 1EQ0A 4P72A 5F8NA 2O66A 3I31A 4FN5A 2VQFF 1YHQS 5CD4A 2DB1A 5EDWA 1XMOJ 2YKMB 2VPXB 4F4ZA 2GJ2A 3LANA 2XMTA 3H2LA 2VL1A 1X4FA 2H4WB 4W92B 2G2ZA 2L9WA 4M5HA 3WZ0A 2I0XA 1F60B 1ULRA 4F04B 1FVQA 1HR0J 5E2QA 4IKAA 2DJWA 5E3QA 3IBFB 3M30B 3MMAA 1VBXA 4I6WA 4N8OA 3ZZUA 2FY8A 4V1Ak 2CQ2A 3IAM9 5B0FA 4WE1A 3KLVA 3D1QA 4P9SA 4LREA 2MEWA 2BZ2A 2WSCC 4NYOA 2H51B 2KFYA 1HI1A 3CD6S 1WC1A 1UTAA 2XMUA 3D6MB 3M32B 4J9RA 5DM6Q 4ED8A 2I1RA 3LPEA 4DMZA 4AFFA 1U0SA 2KH9A 2OEJA 1SJRA 3KK3B 4C3LA 3AOCA 5H9EJ 4LFCF 4HHJA 1QAYA 3EGNA 1VBKA 2HQCA 3IR7B 3HULA 2V4RA 3OQ2A 4RNHA 4ZVRB 4LF5F 1FE4A 1NB2A 2DISA 4WFNQ 1BMQB 3M4XA 4DFKA 3IFEA 2X1AA 3T3FA 4P2MA 5RUBA 3CNQP 2F4FA 2HMIA 1VR6A 3IRXB 4EK2A 2CADA 3ENQA 4ZLNA 2V4QA 1M5OC 4NASA 2A2CA 3R5GA 3R5JB 1CC8A 3R1HA 5CYQB 4WFYA 4MT1A 3BGLA 1RBLA 1FNMA 3V4MA 5KAKA 1X31C 4X4UA 2XGPA 3IWNC 4RUBA 5D0HA 5ETMA 5BXIA 1BHNA 2O01C 1MN9A 3H59A 3MM7B 3RR8A 2V4JA 4I2PA 4UQGA 4BS2A 1IBKJ 2OPSB 1RA7A 1JLQA 1V3RA 3VAJA 3MPDA 2IBOA 3G8QA 3DOMB 1AA1B 3DRPA 3Q23A 1YZ7A 4J9LA 3HJFA 4U9RA 4UW2A 3TAMA 3ZZPA 1RT1B 3BO3A 1RTDA 4QR2A 3O2IA 3M8PA 2CWKA 1Q8IA 2BJ3A 2FZCB 2OJ3A 2A6OA 4ZCMA 2CJKA 2AJ4A 2DNZA 4ZVFA 1R7IA 3MM6A 3MD3A 2DVIA 3BQ2A 4JI0F 5HO4A 3WIVA 1FWKA 1UW4A 2DCUB 3EPIA 4FF3A 2P9CA 3T1YJ 3VVUA 4G1QB 2GHWA 4AUKA 3OSPA 2D9PA 3HD1A 2OPRA 1HMVA 4IFYA 1WSRA 2HIYA 3TJ8A 3I82A 3I55S 1Q81T 3U7JA 4LUBA 2XCAA 4QIEA 3VZIA 2YH1A 4F8RA 2VASA 2K1RB 1L5UA 1GFWB 3R6GB 1DFDA 4CLPA 4HKQA 4A8XA 3QGPA 2AGPA 4WK1A 3KMQA 3ENAA 1X4EA 1RAHB 2F9JA 3PYEA 3KLEB 3ZNUA 1AT1B 1BD6A 1TUGB 2W01A 5FD1A 2LQBA 5CCMA 2K3IA 3PJWA 3H5XA 3J81Y 1L3SA 2FB0A 4LBPA 3Q8UA 3H5SA 2FJVA 2G9OA 2NXUA 2BR0A 4NEZA 2X1FA 1S5ZA 2DO0A 3QWPA 4PXEA 1UEUA 3LAMA 3R5CA 2FJBB 2D7SA 2GO9A 4MIWA 3A3OB 4IYQA 1XNQJ 4JI8F 1T11A 2DEJA 2YWWA 2BW7A 3CMES 1LXNA 1HBUB 2EBGA 4KRWA 4A8QA 3TOQA 5LXYA 2HSEB 3N28A 1VQKS 5KFNA 1S9FA 2PIIA 4RBVA 1B64A 3AD9C 5KG5A 1RT5B 2XG8A 3C6UB 2FVRA 5LOQA 5ADZA 5L8RC 5HLFB 2CQPA 4JB8B 1JLBB 2RUSA 2HBZB 1RT2A 1Y9OA 4KY3A 2GMHA 2CDRB 5A2QU 2PO4A 1S48A 3QZ7A 2AYGA 1HNXF 1E6YB 2MJNA 2OO4A 4P6QA 2PE8A 3UDCA 4R8UB 4KYZA 2V2VA 2HFUA 2J9DA 3NS7B 1APSA 1NUEA 4QWAA 3HVWA 3R8YA 4DR3J 5E3AA 2M5YA 2WB1D 4KO0B 5HROA 1ZPVA 3A8IA 2IM3A 3KDNA 3TUZC 2C1EB 1XC9A 2EFVA 3KHGA 3M9OB 2AJ1A 1NJIT 3PR5B 1RWKB 2ZUGA 3HDSA 2CPJA 3BZQA 3H2VE 4I6YA 3QZ8A 4ID5A 5D3GA 2FPHX 1N36J 3TRGA 1TZ0A 3CMAS 4NLRA 2DCLA 2FZKB 2W2OP 4P2XA 2MZRA 3GFYA 2Q79A 1R89A 2Z8QA 5KG2A 5KFBA 4AL7A 2B8QA 1JNZB 2NXNA 2P9GA 2VB6A 4NEYA 1B70B 3NGUA 1S1TB 3X1LB 1VQ9S 3CJ8A 3Q22A 3SZ2A 1R31A 1I3OB 1G7CB 3PHTA 4NXNJ 4KGKA 2R42A 4USIA 3QBCA 1YJUA 1OSDA 2B9EA 2C2KB 1IXKA 3EVOA 5IT9Y 1WHXA 3RBXA 1OY6A 4ECUA 1EIYB 3FC9A 2HWIA 4XDCA 2YX7A 2IFXA 1VJWA 1CG2A 3BYRA 4DS5A 5I3PA 3W9HA 3SCIE 1RAIB 3LP1A 1HPZB 2B4VA 1EETA 4QYZJ 1KR4A 2N4CA 3QGIA 5FLXY 4FKYA 2ROGA 4P2SA 1WF2A 2FVSA 3TVZA 2FC8A 5F41A 4GVBB 1OY9A 1S97A 2IVMA 1DLOB 1AXQA 3BGRA 2ILZA 4KE5A 2KJWA 3E3XA 3UDLA 2VG5A 3IWLA 2PMHA 1N5QA 2LCWA 2EK1A 3MEDB 2ZVIA 2EFOA 4LIRA 2ZZNA 2G2YA 2W7AA 1U1OA 2MZTA 2GJIA 2R7RA 3MD1A 4A8MP 5CYJA 2U1AA 3CJSA 2I9SA 1C0TB 2M88A 1LWFA 3LQVA 3Q24A 3DU6A 2YX1A 1WEZA 3CC7S 3GCXP 1NSQA 1B0PA 1M90T 1DARA 5KFRA 5MLCV 1Y5NB 1VQ5S 1VRUB 5CCLA 2E1CA 4USUA 2MQ8A 1YK9A 4Y28C 3HSJA 1SBRA 4HVZA 2V9WA 1LWEB 3IG1A 4DV2J 5EN1A 4Y65A 3IWXA 4WU3A 4Y2IA 1FWLA 3R7NB 2ZC4A 4ELVA 1EX8A 3K89A 3CULA 4MH8A 2VOOA 3TWZA 3QGGA 3M2RA 3G6YA 4CIOA 2GZOA 4ZJQA 4K7QA 2Q66A 3F73A 1NJYA 2ACYA 2YKQA 5IM0B 2V8VA 4ZVEA 2VQEF 3A4TA 4PAAA 4OQJA 3DLGA 4X66J 1KBRA 1V3SA 4CO3A 1PJ5A 4P7VA 2ALZA 1UVIA 4RWXA 1EQMA 3Q83A 4ZVUB 1ITPA 5GAHI 4DL6A 3OXLA 4YR2A 5B0BA 4M1KA 2DNRA 3D2WA 2BDPA 3HHKA 2YQ0A 1FJGF 1QSYA 2FGOA 3GPAA 3J7YI 3E01B 2BOPA 5KOXA 1RGVA 2KO1A 3DOLA 4PUOA 4KKOB 4OX8A 3TYTA 1FRJA 2R2RA 4NZ0A 4O44A 1EB0A 3FDSA 1GX6A 1QLNA 2XO6A 3PG9A 1CJUB 3K8VA 4KFBB 2C2MB 1JIHA 1FNXH 3CJ2A 3BS9A 4UUXA 2HEKA 2ASDA 2KRBA 4JV1A 8ATCB 3LTOA 3PIPQ 1RT7B 1SIZA 2XULA 2PGCA 3C19A 1VHFA 2GW8A 3CTRA 2LDIA 2VPZB 2WW4A 4O4GA 5DG8A 2ASJA 2ADBA 3PW7A 2B0GA 2VH7A 1UVNA 3PO4A 3VR1A 5THWA 4CNZA 2DHAA 3CIZA 4ZVTB 3F44A 1TL5A 2KM8B 1DQAA 1X4BA 3GJSB 2W2NP 2OLWA 3MM8A 3OTCA 1PKUA 1R0AA 4ED4A 1Q86T 1QE1A 3AY0A 1U7LA 1YJWS 5J2QA 4IOCQ 2KJVA 5ETSA 4RW9A 4DUYJ 5G0RB 3WIUA 2MQLA 1LXJA 5E41A 2IC3A 2LEPA 4ZP6A 2XSJB 3BO2A 2CJYB 4DV5F 1F2GA 5ETKA 4DS4A 3KLIB 4FPRA 3AQPA 4TYBA 1TL3A 3UN3A 4CO0A 4DR6F 3OVAA 2ZDPA 3FFIA 2UXBF 4C8MA 1X5SA 1YLXA 4A8KA 4CLZA 1TKXB 4DV4J 1S0OA 4A8SA 1CQNA 2DT9A 3AA8A 4ZP7A 3TZYA 1D09B 4LF1A 1L3VA 4EEYA 1KN6A 5D4NA 3P3DA 2XO7A 2KHDA 4CT8A 2AF6A 4ZA1A 3MCMA 1T9XA
chains in the Genus database with same CATH topology
3ETOA 2IHR1 3CT9A 1S6PB 4KFBA 1P8GA 3B8HA 4IUFA 3V81B 5E0OA 2XGQA 2XLJA 4URGA 3PFOA 3K5LA 4DL3A 3DYAB 2L41A 5IZHA 4JI1F 4DV3F 5LJ3Y 1JX4A 1JXEA 2IM1A 3VALA 3K5PA 2F8HA 4WFBQ 4Q2LA 3JB9k 2OPQA 1XNRF 3OPKA 4LVNP 4PG6A 2GHPA 1KLMA 3GG0A 1ZAXA 2MHEA 1N4LA 4ETXA 1QSLA 4NXMF 3OFFA 1KS2A 1U6BA 1X5TA 2KG1A 4IO9Q 2AYEA 1J5OB 1B7FA 3OLBA 3CF5Q 4FXDA 3RRKA 2SXLA 3E51A 2JEJA 2ZM6F 1UWBB 1CVJA 5HP1B 4KGMA 5I3UB 5C24B 5J2NA 4WK3A 2MQOA 3NGDA 3VAIA 4AE5A 4ETZA 2JEGA 3MMAB 2CZVC 2VA3A 1SV5B 2BE2B 2HRYA 4DUYF 2JZ5A 4E8UA 3THVA 3S7RA 1DQ9A 3D0IE 3M9MB 1L3UA 5EX3A 3CVKA 1Z1ZA 2UVUA 4IDKB 4EO6A 4J9MA 3U1LA 3RRHA 4OLOA 3KLFB 1L3TA 3NS5A 3I5CA 1S7HA 4HLBA 3JTOA 2NR0A 2RRAA 2IA6A 3RYLA 4IRCA 3OFGA 1YWXA 3DLEB 2QSWA 3GILA 4ZCLA 4UOCA 3KLEA 3T1AA 2RRNA 1N5YA 5EX0A 1KEKA 1HNWF 1NK7A 3BR9A 1FTRA 4TU7A 5C42B 2RT3A 5FDLB 2PEHA 2AW0A 1S10A 4I2QB 1E6VA 3O1LA 3DNCA 5KFVA 2DR7A 2EFPA 4RU2A 4WE1B 4IG0B 1XERA 5KFHA 4XO0A 3JSRA 2VA2A 4I67A 3GYNA 2DNLA 4PG8A 2YWHA 2AQ4A 2EKYA 3MURP 3K57A 2M7SA 4LSNB 3H25A 1VQMS 3MEEA 4QCLA 3R27A 2AYMA 4DV7F 4ICLB 1MWZA 2BRLA 2XMMA 1MW7A 1P9QC 3F41A 4QR0A 2VFRA 3GIKA 1T8EA 5KT3A 1FA0A 5F3TA 2NYIA 2FIUA 2LKZA 2XSJA 1QM9A 3LWLA 1MROA 2CPXA 2HNZB 1Q82T 2B6AB 4DV4F 2R7VA 3KLIA 3MM5A 1FKPA 2YWKA 3D0HE 3M8QB 3HX9A 1V3ZA 1H2UX 1IKWB 1WEYA 2FJEB 2AYBA 4DQPA 1HQUB 2XI2A 1S1WB 2POKA 5T41A 5BJRA 3AB4B 4NX9A 2LQ5A 3FSIA 3MPVA 3S1TA 5KFLA 5DDQC 1VQNS 2ZH4A 3HFKA 4USJC 3UD4P 1UJ6A 3DLHA 3PKYA 3GFZA 1U45A 4A47A 1IKXB 4NLXA 5DGBA 1PO6A 2YNHA 3SV3A 5GVQA 4C11B 3M2UA 4YB5A 1HYSB 4B9TA 4B9UA 4BBYA 1MWYA 2DK2A 6FD1A 3Q8PB 1RTJB 3KLGB 4U6PA 4Q8FA 4YQWA 2HHTA 5LSRA 4HH1A 5KTQA 2QT7A 2W8KA 3VAHA 4TY8A 1DTTB 1SH3A 1HBOB 4JI2F 2MYFA 4ECSA 2J0QD 3I96A 2YNIB 4KQZA 3FCHA 3OUYB 3CD0A 3MEKA 5GAHU 4X4SA 1KNZA 2GFFA 2A2DA 2QO3A 4Y2AA 3G8SA 3D1HA 1T3NA 1TV6A 1R8HA 1HBNB 2DH9A 3M9NB