3IM8A

Crystal structure of mcat from streptococcus pneumoniae
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
305
structure length
305
Chain Sequence
KTAFLFAGQGAQYLGMGRDFYDQYPIVKETIDRASQVLGYDLRYLIDTEEDKLNQTRYTQPAILATSVAIYRLLQEKGYQPDMVAGLSLGEYSALVASGALDFEDAVALVAKRGAYMEEAAPADSGKMVAVLNTPVEVIEEACQKASELGVVTPANYNTPAQIVIAGEVVAVDRAVELLQEAGAKRLIPLKVSGPFHTSLLEPASQKLAETLAQVSFSDFTCPLVGNTEAAVMQKEDIAQLLTRQVKEPVRFYESIGVMQEAGISNFIEIGPGKVLSGFVKKIDQTAHLAHVEDQASLVALLEKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Malonyl acyl carrier protein transacylase
publication title New design platform for malonyl-CoA-acyl carrier protein transacylase
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Transferase
total genus 109
structure length 305
sequence length 305
ec nomenclature ec 2.3.1.39: [Acyl-carrier-protein] S-malonyltransferase.
pdb deposition date 2009-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00698 Acyl_transf_1 Acyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.250 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Malonyl-CoA ACP transacylase, ACP-binding 3im8A02
3.40.366.10 Alpha Beta 3-Layer(aba) Sandwich Malonyl-Coenzyme A Acyl Carrier Protein; domain 2 Malonyl-Coenzyme A Acyl Carrier Protein, domain 2 3im8A01
5DZ6A 4RL1A 4RR5A 3R8YA 4QBUA 2VZ8A 2C2NA 3EZOA 3CJ8A 3R97A 2VKZG 2QO3A 3TZXA 2H1YA 3G87A 3TZZA 5CZCA 2G2YA 3K89A 3SBMA 2G2OA 3TQEA 3RGIA 2VZ9A 2CUYA 3H0PA 3IM8A 3HMJG 3HHDA 5CZDA 3PTWA 2HG4A 3TZYA 2PFFB 3TZWA 1NM2A 2JFKA 1MLAA 5DZ7A 2QJ3A 2JFDA 2G1HA 2QC3A 3IM9A 2G2ZA 2UV8G 3BV8A 3HJVA 3QATA
chains in the Genus database with same CATH superfamily
1XBWA 1BUXA 5FJ4A 2VBXA 2BE2B 1YVFA 4ILLA 4NLPA 3B78A 5DM7Q 1PYOB 2ZM6J 2E1MC 1T05A 4ID5B 3FZ2A 1TL7A 5DZ6A 3WX8A 2ZOMA 2ZH9A 2OD4A 1WOPA 1HLWA 4FNIA 1PCAA 4FPIA 2EFQA 1D8YA 4Q8FA 4NCGB 4J9VA 5F8HA 5LL6d 2OLWA 1SJRA 3M8QB 4M5GA 1MN9A 5D0GA 2FVQA 2QYGA 4USHA 2AYBA 5D4PA 2BJEA 1J5EJ 2MKHA 1L3VA 4KGMA 2CPHA 1URNA 3C6UA 1R8AA 3ET6A 3HLUA 3ZTSA 4DX7A 2W2QP 4FKYA 4IKAA 4LBPA 2XMTA 3T5KA 2JDJA 2PDAA 5CXTA 2R9LA 4DQIA 4B3MJ 2XGPA 2GMJA 1HI8A 1S0NA 3KXDA 1SKUB 4I6WA 2DGVA 5I4MA 3TA2A 2WB4A 2SXLA 2DBBA 2HS4A 3QMQA 3I4PA 1WUUA 3HXMA 2EFNA 3RRGA 4MFBB 5DM6Q 3C15B 1FNXH 2VB6A 5E7OB 4CTAB 3VAMA 2UXCF 3HVAA 2ZKUA 4TN2A 1WNEA 2K3KA 4ED5A 2DT9A 5SZTA 2P9GA 2E44A 1WOOA 3FCWA 2FHJD 3C16A 1XR6A 2F63A 2VA2A 5D4OA 3R2DJ 3WZ0A 3N9UC 1CJKB 1RAJA 4LRAA 3LUYA 1UAWA 5T41A 4P2MA 4DV4F 3DXSX 3TWZA 3J80U 2IM1A 5K9FA 3HSJA 1RABB 2XZDB 1LW2B 2FLNA 3D54A 3CD7A 1HMVA 4X4QA 1OSDA 1KR4A 4KH0B 3U1NA 3DLKA 5JXSA 4TYAA 4K5RA 1SL0A 4C4WA 4FKXA 3HHLA 1RADB 2WVCA 3Q23A 2G2OA 3RAMA 2VPYB 5CD4H 1N5TA 2B5JB 3J7YU 3QT7A 2RQMA 1DHMA 5AJ3F 3NCQA 3DM2A 2MY8A 2WW4A 4RNHA 2BQ3A 3I0SB 4J37A 2O67A 1U4BA 4KO0B 2MGZA 1Y10A 2HPUA 3CJ0A 2HHWA 2AEJA 2APOA 4C7QA 2IAJB 1Y3KA 3LALA 2BRLA 3FZBA 2UV8G 2C28A 3QYYA 2H5EA 1TP7A 3KK3B 4D3HA 2XCPA 1RT6B 2QL5B 1KP6A 4ECRA 4LF6F 4UT4A 3CWJA 3CMES 3CCLS 2HVEA 3CCUS 3BGRB 3BYPA 1O0PA 4IH5A 4B3OA 2XMUA 5AT1B 1U1KA 1R3NA 5HQLA 1R89A 2LP4A 2EC0A 1U0HB 4X4TA 2XLJA 3LPYA 3MPWA 4MYUA 1EP4B 1WDTA 1WC1A 3R7NB 4MTPA 2FY8A 2L48A 4LSLB 2MQMA 3SCKE 3MMAA 2W1BA 3AODA 2JRSA 2AYMA 5F0UA 2KRBA 3U7JA 1U26A 2ROPA 3LGHA 1NK6A 3CJRA 4QWBA 3BEGB 3TZWA 3ZNJ1 3KJVA 2WRMA 1X4AA 2DH7A 2GFFA 3I6PA 1VISA 2HIYA 2CQIA 4NRTA 2R7TA 2W4CA 2V4JB 4OYBA 1NBEB 5A8WA 2AMCB 5AXLA 3KYLA 2ZZMA 2RRBA 3DRSB 3A3NB 2FVRA 3AQOA 1YX2A 4I69A 3NNAA 2C2NA 1CULB 3QT6A 4PYDA 1RHMB 3W8GA 1PJ5A 2JEIA 4WYWA 1XEZA 2UUAF 1F9EB 1TKXB 5GMDA 2HVIA 4DV7F 2COLA 2VKZG 2KM8B 1NJZA 2VPZB 4Y65A 2RF2A 2G0IA 4KHRA 2RNEA 1TQLA 3PR5B 2XZWA 3TAMB 3G8TA 1CJUA 1JLEA 1KONA 5B0DA 1XMQJ 2G1HA 1OS5A 3CJKA 2YH1A 3GFZA 3FDSA 3TANA 1LW0A 3CJ4A 2YBVA 4CNZA 4AMNA 2ERRA 1X8DA 2HGNA 1B7FA 2VASA 2OIHA 2M5YA 4CNYA 5D0RA 1YZ7A 1XN9A 4K59A 1V6HA 2Y1RI 3E3XA 3FQLA 2ZZNA 3GFXA 4DUYF 2JLFA 2ZHBA 4DUZJ 3DKDA 2LQ9A 1RKIA 2DXFA 4FYXB 3CVKA 4LF9F 3KFWX 1ZZNA 3IR7B 4CRJA 1TK8A 4OZNA 3OJUA 4AQYF 2QA1A 5IT4A 5KT3A 2AJQA 5KT6A 4WP8A 2NZCA 2XHCA 1WORA 4IFYB 3LQVA 1RWMB 1UEKA 3PJWA 1ZH5A 1JJHA 1H6KX 3KNAA 2JWNA 1U1NA 4FVCA 1B64A 2XMWA 2FJVA 3SSSA 1KKHA 4I7FA 1V3SA 5HLFB 5IC6B 3T5LA 3CSKA 3UDVA 2IFXA 4KGVB 4ZJOA 3M9OB 2MSSA 4K4TA 1LOUA 3GE9A 4P73A 1WD6A 3Q83A 2MTLA 4ECZA 5A2QY 4HTJA 1NK8A 2CWKA 4CLYA 5ETOA 1HBUB 2HBYB 3A13A 1KOHA 4LF7F 3PO5A 5M2RA 4OYPA 4M5MA 3BH6B 2XSJB 3V4IB 1Q53A 3RAQA 3K7RA 4WE1B 2L08A 4HHJA 5KT4A 2Y8WA 2FC9A 2OMOA 2PEBA 2WZ1A 3FC9A 3RB4A 4A8XA 2XHWA 2XM3A 4ECSA 1M1GA 3TA1A 2V8DA 3J81U 5ETSA 1KQFB 3K5NA 1X9MA 3US5A 1KTQA 1JX4A 3I32A 1YJVA 5E41A 3V5RA 3BPDA 5RUBA 5KFBA 4DLGA 1RT2B 3N28A 4DPTA 2MDAA 1TL3B 1RA7A 5LXRA 2DXEA 1MLAA 3H98A 4M5DA 2J8AA 3MM5A 1VOMA 1T8EA 2F4VF 3BZQA 2N4DA 1FWKA 2DNHA 1N0VC 3RGIA 5KFRA 4EYHB 3HVWA 4OZ5A 3JQJA 1HNZJ 4DQRA 3ILJA 4FVMA 2KZMA 4JI6F 1F3VA 3DDKA 1WEXA 3GV5B 1FXLA 1PKUA 4HYKA 2VF3A 1SJQA 2YWKA 3AFGA 1KHWA 1N5YA 1Q8BA 2QA4S 4N41A 1ULRA 4H4OA 5CZDA 3M9MB 4NXNF 2MJNA 2DGSA 5IC4B 4ECUA 3M32A 1LXJA 2GJFA 2KJWA 3E01A 3CD6S 1RISA 4E98A 2DGWA 3WC0A 3VGTA 2J8SA 3C14B 4PWDB 1S72S 2L3MA 3EVWA 4YB1P 1XR7A 1K0TA 5D0EA 3O2IA 3OD2A 4LF5J 3V6KA 4ZPTR 6FD1A 3QLHA 4B9UA 3DLHA 1FD2A 2DCUB 2PT0A 4FPRA 2YKMB 1IR0A 2EI5A 4J90A 2EFPA 4DL2A 3MFIA 5E3AA 1I94J 4U7CA 4UZBA 1WG1A 2VQEF 1TFYA 3IBFB 1VQ6S 4X65J 3QAUA 5HROA 4M5HA 4M5JA 4YR3A 5KFDA 2GS8A 1CJVB 4L6V3 3ULHA 3M2VB 3DYAA 1RAOA 3CT9A 2GCFA 2UVWA 3PYFA 5J2NA 3V81A 1S6UA 3TI0A 4IOBA 2R8IA 2EFVA 3MXHP 2DHGA 5EUHA 5A0YA 1MU2B 4W4MA 3PFOA 1SJ1A 4ZP9A 2LXUA 1MMDA 2MLZA 3TUIC 2QE5A 3UQSA 1UVNA 1S79A 5DLFA 2VG5A 4OI2A 1NDCA 2X7IA 1NPPA 5GAEI 2EKNA 2MHEA 2GIFA 4K4SA 3UD5A 3H5YA 4P75A 2RU3A 1LWXA 4E0DA 1UPMB 3FVYA 3CO9A 1R6VA 4HR2A 3UR3C 2RQKA 3EXCX 3CCJS 3FGVA 4JB8B 1VIXA 2KHDA 5FLXY 2W2MP 3QFWA 4NA2A 1IKYA 2CQ0A 4YQWA 4K4UA 1S9FA 1CJTA 2W2PP 1LEOA 1LWFB 1SJ3P 5HJYA 1GQEA 3D4JA 4LR9A 4EWTA 1RB0A 3RB3A 1H7XA 3TQEA 1VC5A 4DPOA 1VLYA 1S1VA 2XBPA 2VBZA 3IGVA 1X4FA 2ZDOA 2OPQB 3I82A 4PG6A 1GFWB 1C2PA 2ZNZA 3GJSB 2RMLA 1W7WA 2V8VA 4PRFA 3Q86A 1TV6A 1RWOB 1VLOA 1JXEA 1NSPA 4J9UE 4JV5J 4N8NA 5F8MA 5I3UB 2FHOB 1FNOA 1M5KC 2IBKA 1SUQA 3A8KA 1T02A 3K0JA 2NQPA 5K20B 1WG5A 2CQDA 2HMIA 4OZ2A 3QO9A 1XNRJ 3HO1A 1NPKA 5HQ8A 2DY1A 1KLMA 3D6MB 2HQFA 1K0VA 1VHIA 1JMTA 5E3PA 4RX6A 3VTIA 2GAGC 4ICLB 5IM0B 1YJTA 4GMKA 3B8HA 1PC5A 2CG4A 1SI9A 4F04B 5KOWA 3Q8SB 4FNHA 2F9DA 3R5AA 2C3YA 1R8PA 2IMOA 2PSZA 2WB1D 1JLBA 4X4SA 3L7PA 2UUCF 4AE5A 2Z30B 4P74A 4EBCA 3T6BA 2IHR1 3O8WA 1M90T 2XNQA 4U95A 4O4GB 3MR5A 1R0AB 2E29A 2DGQA 4JI7F 2VOPA 2C2RA 3FK4A 5K8MA 4O3RA 2QMUB 3EDQB 1S6PB 3H2LA 4DV3F 2HW3A 2VG7A 3FUYA 2ZH8A 4B3RF 5C42A 3PHEA 3LGNA 4DSEA 1OY8A 3CNQP 3U1LA 1HI0P 4LF8F 2NXJA 1CQMA 2B7CB 1LWEB 2DNGA 3VAKA 2BKOA 5LJ3Y 4USUA 4DF4A 3BR9A 2BEFA 2DH8A 4NLTA 1X9SA 4Y00A 4J9LA 1FX2A 2YTCA 4DV0F 1N34J 2RQCA 4N56A 3I96A 1RTDA 1YRXA 3HHLD 3ISZA 2QRRA 2BV3A 3N0VA 2M9KA 4DL6A 2R8HA 1Q16B 1F5AA 4UY8T 5IXUA 1FRMA 5HBMB 2HLUA 2VG6B 2MZQA 1Y3JA 3GFYA 1TUGB 4ELTA 4HL9A 1AFIA 3M8PA 3NS7B 1UP1A 1RAEB 1VK3A 2L9NA 3M05A 4A8OA 3DU6A 4L3KA 3IG1B 1XMBA 1T3NA 3NAHA 1HR0J 2XLKA 3R97A 2DGXA 2PMZD 1X4HA 5IQQA 2F8MA 5J2MA 3NRBA 1C1BB 4AL6A 3ZNUA 2I38A 4BBYA 6FDRA 4ZLJA 1EZZB 1B0TA 2V5HG 4TLRA 1N56A 3DOLB 3SFGA 1RHRB 1WC5A 3NAIA 3D67A 1YITS 3AA8A 2R7QA 3OXGA 1X5SA 4A8YA 2RRAA 1S48A 2C2MB 5CD4A 2DIVA 2PO4A 4N5SA 1R27B 3G8SA 4HI2A 1P9QC 2WSEC 2C3PA 4LRBA 5FDLA 2MQLA 4IFVB 1TTHB 1TKTB 1H3DA 4IYQA 4V19J 5A2QU 3LA0A 3KKFA 4I64A 1JLAB 3GILA 5DLGA 3PRVA 5DJBA 3LANA 1RT5A 4UQGA 3HJVA 2R2UA 3CJ5A 5CQGA 1Y7PA 4LR8A 4NYZA 5J1EB 3KLFB 1S0MA 1WF2A 2BM1A 5F8LA 3ZTPA 1WHYA 2XMVA 4IO9Q 1HNVB 1MMLA 2EK6A 1RKJA 2XYGB 5HVFA 2J76E 5B08A 4ZMMA 1A0OB 1PILA 3G6XA 3ENAA 3TAPA 1UA0A 2ZH4A 3SMZA 3KUHA 2E9ZA 2YKNB 2MKKA 5C24A 4PABA 4NYOA 2UV8A 2E66A 2HNZA 1FK9A 1S7HA 4N7TA 3BDPA 4MAKA 3FSIA 4PPZA 2OAUA 2BMBA 5CA5A 3QZ8A 5GMEA 3V6DB 3PRBA 4DR2J 2RD5C 2ZD1B 2BW7A 4ZN3A 3QIDA 1QAJA 4ZLNA 3MOZA 3W9JA 1ZAVA 5EGYA 1FCAA 3I9V9 2B4UA 2OPPB 3R7SB 4C2MA 3GU0A 5KFEA 3MPUB 2V8PA 4IG3B 1LKZA 5B0GA 2OD6A 3DLLQ 2YKOA 3C19A 4LSNA 1T9XA 4ID5A 4WKYA 1U1LA 2XYHB 4DPWA 3AHPA 1SVDA 3OTCA 2HQCA 1Q8LA 1P8GA 5HI7A 1WI6A 1I5OB 2EKYA 1ZTTA 4B08A 5LMNF 4AUKA 5HL7Q 2UVVA 2AJ0A 3J7YI 1YI2S 2YWEA 2MZJA 3M8QA 4C0HA 1B3TA 2MLXA 1ICEB 2B4VA 1MROB 3NY0A 2OPRB 4P72A 1AZSB 1KLNA 4F0HA 4C3KA 1Q7YT 3M1VA 3DGPA 2FVPA 4C6AA 2P2CB 3FJ2A 5H9FJ 3RYLA 1MWYA 3NGUA 4J9PA 2FZKB 1IKVA 4N8OA 4OI4A 5GAHI 1C1CB 2N3LA 5MLCV 3D28A 4Q44A 4JI2J 3JSMB 4RBTA 2OUGA 3NG8A 1T9WA 4AFFA 2KRRA 4RUAA 3LOUA 3ITHB 2DNQA 3NGSA 4JI8J 4NLGA 1VS3A 3DRXA 5THWA 2HBZB 2VC0A 3LP2A 3PY8A 3KMQA 4GC6A 3H8YA 4CTAA 1T05B 4ANCA 3OL7A 1VQ8S 3ENVA 4RUHA 2MKCA 4WFBQ 3QBCA 1Q79A 2MSTA 3QFHA 1S10A 2B8QA 5IWAJ 4B9LA 1U8WA 1MWQA 2RE1A 4UQTA 3AJ2A 3QRRA 1FJGF 1EARA 2F8EX 1ZM4A 4BCAA 9ATCB 2D3O1 1Y4ZB 3KG1A 3P5TL 1NH8A 1LW2A 2EWHA 3C6UB 3ET6B 4LIRA 3I56S 4DZDA 1YLXA 3QT8A 5FLXU 2AT1B 3QGGA 4P7TA 4ED6A 3PNIA 3MR7A 4CLTA 3W5YA 1REVA 4LF7J 1CQNA 4HTIA 1WHXA 3GV8B 3IO1A 5DG7A 4EZ9A 4AL5A 1R8CA 3DOMA 1SC1B 1QAIA 2I0XA 5DDQC 3D0GE 3S01A 1HFEL 3UD3P 3I0SA 3FFIA 1TK0A 5B0BA 4KO0A 2F7VA 1D0EA 5KFKA 3D0HE 4GKJJ 2IAJA 2G0JA 4ECTA 2HHUA 2ZEJA 4ZCIA 3Q8VA 1BHNA 1YDLA 3FMBA 2CZ9A 4ED8A 2AHOB 4AYBD 4ER8A 2QA4G 1D1UA 2HSEB 3W7BA 1Q8IA 4DR6J 4UOFA 1FF2A 4OI3A 4WZQA 2HHVA 2PI4A 4F50A 3C16B 4WU3A 1CLFA 2FZCB 3PKYA 2QMXA 3IR6B 3R5BA 2N7YA 2KH9A 2GQCA 2BJ3A 2V67A 4NXMJ 1YBTA 2VL1A 5C2CA 2VIHA 2WBRA 1HHSA 2EBEA 4CM2A 2HRTA 3RBDA 1XC9A 2C3MA 2AV5A 1HMVB 1RCOB 3MUMP 3DLKB 3T1HJ 1S1UA 4KGZB 4FBTA 5CCLA 2W9CA 4CLSA 3K59A 3UDLA 1RHKB 3UVJA 1OO0B 2QSWA 3HHLB 2CJQA 3KG0A 1C4CA 4C9DA 1LK7A 5EWEA 1XNQF 3RUBL 3LWMA 3KHRA 4CI0B 2QT7A 4UTGA 2QA2A 3B82A 4DHVA 1SQFA 4QIWD 5EWGA 1HPZB 2K3IA 2YKQA 3ISNC 4LREA 5C2GA 3HFKA 3HKWA 3K89A 2MGZB 3MFHA 2V4JA 2ILYA 3MAHA 1ZOTA 4F0KA 2NYHA 3KDNA 5L38A 1X4CA 4I6YA 4DN0A 1W2BR 4F36A 3OJSA 3R8YA 1ZM3A 1NZ8A 4Q45A 2FLLA 1CULA 3TVKA 2VD3A 2BXJA 3G6ES 2WVDA 3EJMA 2PMWA 3SIPB 1E6YA 1FO1A 4B3OB 2D3OR 1WKJA 2ROEA 3SQGA 5DDRC 3K58A 1YIJS 2DNPA 3BKUA 5HSPA 4C8ZA 3OV7A 1J2VA 4UUWA 3OBIA 3MMBA 2E1AA 4WP3A 1HD1A 3GG1A 5JVGQ 2YWHA 2KG1A 2PC6A 1BQNA 3M8WA 3OUYB 1VQMS 2E5GA 4DPUA 5LM7E 5A76A 3CDUA 4X4RA 1RAFB 2BM0A 3T1YF 4KIAA 3PDNA 5K5MA 2F5GA 3KLEA 1N36J 2A6OA 2C42A 3HVTB 2W8LA 3KJVB 1JIHA 3PVXA 3WX4A 2O01C 2UU9F 3QATA 1M5VC 2Y8YA 3D6FB 3JAMY 2HHHJ 4JI0F 4NE9C 2FZGB 1U49A 3KK1B 4LRDA 3CJ2A 2DEJA 3MUVP 1MNEA 4CO2A 1V5IB 2B8PA 5ETNA 3I5AA 4X62F 2XMMA 3PCOB 1D9DA 4KRWA 3CJSA 3O3LA 2CQ2A 4HDHA 3NL0A 4IQMA 1VQ9S 1X5PA 5HLFA 2C2ZB 1UVLA 4F2SA 3MECB 3QIPA 4K4YA 2R8JA 4R0JA 3CJTA 2VBWA 4C11B 2LQ5A 1VCTA 2VBYA 1CJUB 1JLEB 1FNMA 3HZEA 5L39A 3CJKB 2PMHA 4ENOA 3CC7S 3TRGA 1LW0B 2DXDA 2BACA 4IG0A 4PXBA 3GSDA 1WJ9A 4OYZA 2XSJA 2HFSA 3V4IA 5D15A 3OXLA 3HM9A 4ZA1A 1Q4RA 4WE1A 1XQIA 2CXEA 4H54A 5ETTA 4ETZA 4B3TF 2DO4A 3GG0A 2AGOA 3QRQA 4MK9A 2ZH1A 1QLNA 2WHOA 4KAIA 1UCNA 2P6TA 1U7LA 1P6TA 3DC2A 2DCLA 5ETRA 3BSOA 2RUGA 2AU0A 3BKTA 5J2QA 1NK7A 3KLGA 1T9YA 4QW8A 3PYDA 5C5JA 3QSIA 2OSQA 3GTYX 3H25A 4P2SA 3MEEA 1Q81T 4ZVSB 2AX1A 2R7XA 4I7FB 1WHVA 2HVZA 5GMKa 3I87A 2BZ2A 4DR7F 4C8KA 1FTRA 2LXFA 4OYIA 3G96A 4DFJA 4LFCF 1VQNS 3MM9A 4RW7A 2IJRA 4ED2A 2OP5A 3SSQA 1CS4B 3GIMA 4Z2XA 2RB7A 2RDIA 3IRXB 1IJEB 2W7AA 3KHGA 3DLEA 3I9ZA 1P9YA 1SH2A 2BA9A 4QIFA 4ZPBA 1Q82T 3GWCA 2W9BB 4P71A 1RQ0A 2G9OA 1FRKA 2IVMA 2QZ8A 2EPIA 1S9EA 1MN7A 4QU6A 1TUWA 3X3UA 3DI6B 3ZZUA 2DO0A 4DV6J 2CNNB 4OX9J 4PCQA 1R8BA 2OFHX 4M5NA 4X64F 3FCHA 4K4XA 4ZP7A 2RDJA 5BYSA 3KG4A 2GJIA 2ZHOA 2CJAA 3BN4A 2FTRA 3THTA 2XCAA 4IO1A 1D3WA 2ZJPQ 3H20A 2UUTA 2A2DA 3IR5B 1Z2LA 2LDIA 3WQPA 3C46A 1FT8A 1N5YB 3N5FA 5G0RA 4CO5A 1XMOF 4U7UK 4X2BA 5CZCA 4H4OB 2R7UA 1ZS6A 1FVQA 5D4NA 2UUBJ 3MEKA 2HHXA 3CC4S 4R8UB 2MLYA 2VFVA 1FFGB 1SH0A 1AUDA 1X4DA 3NGKA 2Z2LA 2VODA 4F67A 2J7WA 1YJUA 3ZZTA 3NKYA 3FKBA 3E01B 2JLGA 3MPVA 3CC2S 4ECYA 2FVCA 4X4PA 4DV2J 1GX6A 4URSA 5M2PA 1M5HA 4TY9A 1YJRA 2NS1B 3DRPA 1RBAA 2W01A 3EDRB 4DR4F 1GX5A 2HAFA 4KHPJ 1HNXJ 3QLHB 2DD8S 3V6HA 4I2PA 3CMQA 1YQHA 2GNKA 4OHXA 4ID8A 3W9IA 1OY6A 3K5PA 1UJ6A 9RUBA 2ASJA 4FF1A 2KFNA 5HROB 1UFWA 1S12A 5L1JA 5HJXA 1X4EA 4P2FA 1NXIA 4L3NA 4ZK7M 2OPQA 5IT9U 1TVRA 1WKLA 1NSKL 2JC0A 5KFLA 2H5JB 2MQPA 4DQSA 2E5IA 3ZZRA 3GB0A 3VALA 3DMJA 2FGCA 3V81B 3ENWA 3VGUA 1JLCA 1TL5A 3JYTA 2LCWA 1GMUA 3PXGa 5HATA 1FXDA 4DS5A 2V0NA 1U48A 1QDUB 2V94A 2VG5B 3SCLE 1V3RA 3QJPA 1SC3B 3NWRA 3GLJA 2R2RA 1FKOA 4ICLA 2Y0SD 1KFDA 3EMTA 2LVWA 3VF0B 1IXKA 2G0CA 2UXBF 5B0FA 4TQRA 5KTQA 3PZPA 1TFWA 4LFAF 2FIUA 2GAHC 1TMMA 3CTRA 2H48B 1CJTB 1VQPS 2M88A 4OX7A 2AKWB 3IAS9 1F2GA 1T9UA 3NOCA 1UVIA 1S1VB 4A8WA 4F3OA 1FDAA 4LF2A 2YPYA 1R0AA 1JB0C 2AP6A 4K0KJ 4Y6IA 2BUNA 2VOOA 1UZDA 1X4GA 3NEKA 2XLIA 2UVRA 3AD8C 5BYRA 4GVBA 1SUQB 3AH6A 4OJHA 1RU2A 3U1MA 1DQAA 3AOBA 1TK5A 5A8RA 2PEHA 2DISA 3Q22A 1YSJA 4GKKF 4JI3F 1OY9A 3G87A 2FPHX 4UOCA 3MR3A 4QIEA 2YXLA 1TAQA 3QO9B 2IRXA 2CJYB 3KJQB 1KLMB 3FEYB 1J5OB 2CFXA 4V1Ak 2CJ9A 1K44A 1RLCL 1TL4A 2HZCA 1OJ4A 4PQUB 2YNHB 2MEWA 1S9GA 4N77A 1S0OA 4CO0A 5K8PA 4WCEQ 3GONA 4RW4A 3B4MA 5HBMA 3G71S 1ZPWX 3TW0A 3KJFB 1JLBB 1B0VA 2HWIA 1EKRA 5DQGA 3ZXWA 3H4DA 4I56A 3ETOA 4I68A 4QR2A 4E8UA 1AB8A 4NA1A 2JVOA 3QPIA 1UETA 2GV1A 2KXNB 2LYVA 2MZTA 4ZPDA 2Z4PA 1HNWF 3TEHB 4DDFA 2Q3PA 4WWSA 5C42B 3FBFA 5A6PA 1C1BA 3BV8A 2EK1A 1K1QA 1SC4B 2J6SA 3ZTRA 4B02A 4KV8B 2BE9B 3HHKA 1SBRA 1X0PA 3G9CA 4L75A 4WTOB 4DBQA 2QFJA 1NSAA 3BGOP 2GO9A 3OTOF 1DY3A 4X66F 5KFSA 4ZVUB 4IFVA 1RTDB 5HO4A 4QWCA 3TP2A 4HACB 4EUVA 4MK8A 1EQMA 2P9CA 3VV2B 1ZZFA 3D66A 4DSLA 1RWXB 1N33F 2MQ8A 1ZBTA 1N4LA 4ILRA 4YB7A 1JLAA 2P8IA 2ZH3A 1YJWS 2FLPA 4S0MA 1UKUA 2UXDF 3M8PB 4P7VA 4ES1A 5KFTA 4RW6A 2KKHA 2IRUA 2Y1JA 3CPWR 1WTFA 4KR0B 4U8VA 1OYDA 4Z37A 1BMQB 1HNIB 4G1QA 3BBCA 1F6TA 2MQNA 5GADI 3MWBA 1HWUA 2OI2A 5J2MB 3L95X 3S1TA 4FF2A 4DXLA 1R0BG 3B6BA 3TO8A 3NGTA 1NU4A 1WG4A 1YJ9S 1DURA 1VQ5S 2JEFA 4F2RA 3JTOA 3IP0A 4X4UA 1RZMA 2E5JA 5L9NA 2ZD1A 3L09A 3CCWA 4ILMA 1IR1A 2XS7A 2CQGA 1KQSR 2R42A 3FCVA 4KFBB 2RSQA 3RRKA 1RJJA 1S6OA 3RB6A 4C8YA 5FDLB 4F4WA 1BQMA 3F44A 2MYFA 4M8LA 1ZA1B 3GCXP 2BQUA 2ATCB 3DN9A 2XQCA 1IKXA 2WW8A 1VYAA 2OSRA 1NJXA 3LAMA 2LDYA 2AQ4A 1W2IA 4PG8A 1RT5B 4XPCA 2E5LJ 1RYRA 1KBRA 1PSDA 1KS2A 2XMJA 3RZAA 1R8HA 4PR6A 3OL9A 2L9DA 1MROA 3IS9A 3F41A 3MZIA 3CW2C 3MMCA 1T0TV 4PKDB 1Q78A 4RNMA 3W2WA 5C24B 4OHWA 3RW7A 4QIVA 4ANDA 1H98A 2PA3A 4USMA 1Y0HA 3Q8RB 4DL7A 5AE3A 4ED7A 1GXUA 4LIWA 2HZAA 4MJKA 3F56A 4ZKAA 1SKRA 3AJDA 1QM9A 3MR2A 1KHVA 3P49B 2ZUGA 2KZZA 1UA1A 3JTPA 2J5AA 5HANA 4DG1B 3Q8YA 5L1KA 2GHPA 1G4CA 2QO3A 3T1YJ 1RWWB 2DKOB 3P8BB 4PZVA 2BBEA 3H90A 4XO0A 3N5BA 2MPUA 2YX4A 4LSNB 5FD1A 1VDHA 3LAKA 2MKJA 4JV2A 2D1CA 2UU9J 4CLFA 4F8RA 4YY3J 4DS4A 2ZC3A 2HVDA 3VAFA 1QE1B 3JXOA 1S59A 4UZCA 4NWBA 4PQAA 3LP1A 3TZZA 3AD7C 3TA0A 5LSLA 4JV1A 2CQCA 4WK3A 1LNQA 1NZAA 1S1XA 2HBRB 2BW2A 2ZWOA 3SQOP 2KJVA 3BGFA 3W5XA 2ZE2A 1B99A 4HDGA 5HMWA 1KRPA 3OT9A 5GVQA 1CC8A 4TU9A 1NAQA 3GYGA 3OFGA 3M1VB 3QAEA 2YNFA 3DGPB 4NA3A 4NLUA 2IM0A 4Y28C 2OFGX 4NOHA 2VQFF 3ZZ0A 5KG2A 4RBVA 3LP0A 2AYGA 2PD1A 4WTYA 1IKVB 1G2EA 2CRLA 1YJ7A 3R5GA 1TAUA 4B3SJ 4RWWA 4QIGA 2CJXB 2VHGA 5JMNA 1KQGB 2CVEA 2IMWP 2J0QD 3GQCA 2GQ2A 3PW0A 3CJQA 1VMBA 1WC3A 1YTYA 5DS7A 1ZTWA 1PBUA 4LFBF 2ZM6F 3LP2B 2VZ8A 2DNNA 1S1TB 2W25A 1VQKS 4RL1A 3NOGA 1Q5YA 3KHLA 3CCZA 3OFFA 3R5DA 2A18A 3GIJA 5LMUF 3D6TB 5DZ7A 1QUPA 4DR3J 2X1AA 5EX3A 3TUPA 1URRA 5KFNA 5KFUA 1W26A 3AD9C 2V63A 4DPYA 2L41A 2UZAA 1QJHA 1J5EF 1SCJB 2NYIA 1IKWA 1SC6A 2V2ZA 2FY1A 1W25A 1S49A 5ADZA 3GIIA 4FP9A 2HRUA 2IA0A 1N5VA 1N88A 4B3MF 2FVSA 4MIAA 1K8AT 4M63A 3ZTOA 3BSNA 3O5TB 2NXNA 3M2RA 3PIOQ 2FUG9 1REVB 1RAHB 3GYNA 3EUNA 4R5PA 1JQGA 3DU5A 3DOMB 3MEGA 2CG8A 4DR5F 4RW9B 4QW9A 4PUOA 3ZO7A 3ZZPA 1HPZA 4C8NA 3THVA 4OZ0A 1HARA 3FFIB 4ZHRA 1KDNA 3EGNA 2FLOA 1S6QB 2BVZA 1QTMA 2RU9A 2IBOA 1NDKA 2HS0A 3T1AA 1LFPA 5HAOA 1ZA2B 1GMVA 3A1YG 2ASYA 1U0SA 4Q2LA 2CQ1A 2VV5A 1VQ7S 3HHEA 4YB5A 2R8KA 4C3LA 3JQMA 2YQ1A 5BR8F 3NMAA 1TU0B 1MMNA 2IJFA 3QT5A 2EFOA 2W8KA 2VJUA 3PTWA 4M95A 4M1KA 4CLWA 3T3FA 2D3UA 2IC3A 1S76D 2I1RA 4JI5J 3MD3A 4AXJA 3H2VE 4RUBA 1FDDA 1S1UB 1FJCA 4F7VA 1R31A 3VVTA 2QX0A 3CUNA 2IM3A 2W9CB 3UVJB 3OUYA 4Q8EA 2M4MA 2PE8A 4G6VB 3C66A 3RTVA 1X7VA 2GVZA 1WC0A 2GX8A 3CD5A 4X4VA 2HFVA 3TVZA 4C0BA 1NDPA 4IH7A 3HVTA 3N6NA 1JNRB 2XY5A 3THPA 1SV5B 2VDIA 4O44A 2FJEB 1ZPVA 2CJKA 4P10A 2EBGA 2HFOA 1NUEA 2DHHA 4NLXA 3DLBA 2XYPB 1KSPA 1I1GA 3KK1A 3IM8A 5JJBA 4DQQA 4OZ1A 4WXWA 2H3EB 4LJMA 2ROGA 1UL3A 2O1PA 2LXIA 3ILOA 4OZ3A 4MH8A 2HKEA 2CQPA 3LGMA 2XMAA 2Y9HA 4WFYA 1E6YB 3HVRA 3MAQA 3SQGB 1OSCA 2DHXA 3MECA 1UW9A 1FRLA 2B9XA 3EWGA 1U2RA 4C11A 4JYAF 3D9BA 5HMYA 2C22A 3MMBB 4B9NA 2ASDA 3KLHB 1AW0A 2Q6CA 2ZZTA 2CNOB 3OLAA 1BQNB 5HVGA 2CKWA 4OYOA 3PW4A 1HBMB 5E0OA 3KLEB 2QLWA 4ZS6A 2DVIA 5DG9A 4CT8A 2O66A 2OEJA 3TUJC 2DNLA 1C0UA 3EVOA 1VRUA 1KOOA 4DFKA 4MK7A 4HHHA 4HH0A 4NEZA 4AL7A 1EAYC 3HSZA 2HS3A 4YR2A 2N3OA 1YRUA 1Q5VA 1RHJB 3P4UB 2Q66A 1R7IA 3KTQA 3CDBA 4BWJA 1OIAA 5F9NA 4LFAJ 5KFXA 1U6FA 1IM4A 5IS2A 3WHIA 1WC6A 5B09A 3QJLA 1NPRA 2BJDA 2V2QA 1FRJA 3H7HB 1RWKB 3QIPB 2XO6A 4IDKB 4AMMA 1XMQF 4TLQA 2LEBA 1FKPA 2HNDA 4A4JA 1CS4A 2HBQB 2E9RX 3BO3A 3IRXA 2JJ4D 1SKSA 1H2TZ 4IG0B 4ZCLA 3F73A 4G1PA 2U2FA 2HGLA 3RBZA 3RR8A 1RAIB 2YX1A 2Z8QA 5CYJA 1K9MT 4EI2A 4HH1A 3NLCA 1R0CB 4DLEA 1EQ0A 5C25A 4KSEB 4YB6A 1VQ4S 3M8SA 5F0WA 3PRDA 3W2VA 4J5OA 2W9BA 2Z0GA 4DUZF 5CYMB 3K5OA 2H9ZA 3LO3A 2Z2YB 1VBZA 4TXSA 3G86A 4USIA 1IBKJ 2XTJP 3OSPA 1F2HA 1SQGA 4ZJLA 3DI6A 3CCTA 5J2QB 3PG9A 1ROFA 3KLGB 2CNLB 4HEA9 4KPYA 3MURP 2LLZA 2R7OA 4RNNA 5J1PA 2CIMA 2UUWA 3MEEB 4MIWA 1RWUA 3H4BA 4FS1A 4ZPCA 1JXVA 2WTFA 3NCRA 5T7LB 4F4XA 2QFIA 4A8MP 5IT0A 2DYAA 2AW0A 3MM9B 2V4RA 4RW7B 2ZVIA 5DETA 2YQ0A 1EB0A 5ITHA 1JLQA 3DLEB 2HFNA 4R8UA 2HQIA 1RE1B 2VONA 2YKAA 4C3MA 3KOAA 2OMLA 4K8RA 2NSCA 2EW9A 2WCXA 3PW5A 3E2EA 1WWHA 2XO7A 1EHWA 2PFFB 3P96A 3E51A 3MM7A 4QWAA 1S9EB 3G6VA 3A8IA 4JOUA 1S5ZA 1IBLJ 2HAIA 3TJ9A 3QJJA 2PFDA 4YFUA 3T9NA 1DJ0A 3OL6A 1DTTA 1JJ4A 2C2KB 2DRAA 2FJAB 3PHTA 3PX6A 1S7IA 4LBIA 4Y2KA 3TZXA 2N82B 3H40A 4KGKA 5CCMA 3UWTA 4C8MA 1HNZF 2BANA 2DNMA 3CCES 4EO6A 1RDRA 2OELA 1UFKA 3I0RA 3AB2B 2Y3YA 3BF4A 3MCNA 3M7VA 2OH2A 4K2XA 4KHMA 2C2DA 4ITSA 2QL7B 5CHCB 3EYZA 2FHKA 4OHVA 2OJ3A 2RT3A 5G0RB 1Q0NA 3M30A 3N6LA 1U09A 3NXZA 2ZBPA 3UFCX 1QVGR 1TL1A 1SB6A 3GIRA 3EGWB 4DSJA 1RTIA 4DR1J 3OPKA 3OTDA 5DDPC 2BQRA 5T14A 5A6WA 5MAOA 4YDXA 2ACMA 2B6AA 3NNHA 2M3DA 4B9SA 4ZVGA 1K47A 1M0SA 1HQUB 2BJ1A 5KG3A 2F9JA 3DRPB 4LF5F 2ZBQA 4B9VA 2O5DA 2K1RB 2Q79A 3A3PB 3P6YC 3KLIA 4LF4F 4YR0A 2M0GB 3ISND 4EU0A 4RU2A 1N48A 4CH1A 3BJYA 1I94F 4BC7A 4I2PB 5KFAA 3PR4A 4X65F 1X31C 2IIHA 2HNYA 4DX6A 1ZAXA 2VFSA 2H54B 4O3PA 1IVZA 2DR5A 1H72C 3K8VA 3TAQA 4USJC 5C7PA 2FDNA 3R9LA 1TVRB 2X3GA 2D74B 1RT1A 4KB7A 5LSRA 3N79A 5EHHA 3BQ0A 4PXDA 1APSA 3OR1B 3ILIA 3FMWA 3DMJB 4KTQA 2W2NP 4JI1J 2BOPA 4BC9A 1FRIA 1JLCB 4DV1J 4EO8A 1AROP 1DRZA 3JYTB 3VGVA 3JTNA 2HLTA 1Z2ZA 5D3GA 1B0PA 3S8SA 2GW8A 2LU1A 3GP9A 4Y0FA 4CIOA 5J1NA 2CPDA 4OYXA 2WSCC 5KFJA 1J5OA 4NZ0A 2VA3A 1FKOB 4PQUA 1EETB 1HWJA 2YNHA 5B0EA 2XG8A 3SXLA 3A4TA 3MTJA 5F9LA 2RVJA 4ES2A 2K7KA 4YS2A 1UWAA 3I5BA 3SI8A 4BWMA 1HQEB 2ZH7A 4JUZA 3M8ZA 1BE4A 1TMJA 1NHVA 2JL9A 2AIRB 1JK9B 2EC2A 3TARA 2DRDA 2ZH6A 1RLDA 4H4KC 1N5QA 3FSXA 2J0XA 2ZKTA 4U7UD 4OJ3A 1U8SA 2BX6A 2J7KA 3V2UC 2FJWA 1Q95G 4FYDA 3ICLA 4P6QA 3J81Y 4JV5F 1ELOA 3DOKA 3BGLA 2RUSA 5L9XA 2GGPA 4GVBB 5H9EK 4KV8A 1UEUA 3GPAA 1NM2A 2JFKA 5A8RB 2B0GA 1XNRF 3HCXA 1HWKA 4OYMA 4P52A 1DFDA 1AT1B 4EBDA 1AXQA 1U1QA 3IA0A 1SL2A 2OPSA 5AXKA 4DU7A 1X9WA 4OHZA 1G6BA 4HACA 1S9GB 4NLSA 5BJRA 1TKZB 3W5ZA 2B9YA 3LW5C 4RW4B 5HP1A 4LFBJ 1OQ3A 2GVDA 1G7CB 1FJEB 2UXCJ 1Y9OA 3MPDA 2JHEA 1CG2A 1OYEA 3QWPA 3MHYA 2V8GA 2YWWA 5LMUJ 2X1BA 1EX8A 4USKA 1HNIA 4WJBA 4LT6A 2MKIA 2CQ4A 1NO8A 1RHQB 3UN5A 1T3OA 3H0PA 5CZXA 3N01A 4DSIA 3PM9A 5K14B 4DV4J 1RT7A 3CIZA 1BQXA 3CDWA 4J9KA 4OZJA 2WONA 4WPAA 4ELUA 4WFAQ 1DQ9A 4PG7A 1N34F 2ZH2A 4FF3A 4KFBA 4JP8A 2EVZA 1BLUA 4EGLA 4FXWA 4DEZA 3BKFA 1FEHA 3CULA 1YKWA 3PV8A 5AJ3J 1WDDA 4DR5J 2BJ7A 3MMJA 1FERA 4TNOA 1GEHA 4A8SA 3OVAA 2V4QA 4O3QA 2I2YA 3UW1A 2WOMA 4HT5A 3OFEA 3H5UA 3JQKA 1L3TA 2K7JA 3CCRS 2DK2A 2W7PA 1QUVA 1RYSA 1S57A 4NPOA 1CBKA 1NH7A 2WVEA 1Q1KA 1XTZA 3S7RA 4RW6B 2WBMA 4OMFG 3R6GB 2OTLS 1VGYA 1LWCA 1JNZB 2X51A 2OTJS 4IH6A 2AEFA 1HR0F 2AJ2A 3J7ZT 3HDSA 3HMJG 3NGRA 1VQOS 3M6XA 4G1QB 4JBCA 4LF6J 2XI3A 1S97A 1NMEB 3MD1A 4BS2A 1K73T 5BR8J 3HKZD 3PACA 4QJVA 2H65B 3HK2A 1YK9A 3RW6A 3QZ7A 2D69A 1SQEA 1WSVA 3BDEA 1VBXA 2CPIA 5AE2A 2DNKA 2IVFB 1U2FA 2V9KA 5EWFA 3HD2A 4QCLA 3R6LB 3MM8B 3PYEA 3VAGA 4K4WA 3FQKA 4DG1A 2ATLA 4CLPA 2F8HA 3W8PA 5F3ZA 1BQMB 4ECWA 1H38A 4WIIA 2I6WA 5SUHA 4DMZA 4NI2A 1F0XA 2IA6A 3UD4P 2NZ4A 1IKXB 2R7RA 4F25A 4DL4A 5DGBA 3NNCA 4DL0C 3MCSA 5GAHU 1QE1A 2KTQA 2C2EA 1RT3A 1JKHA 4ZP6A 5HK4A 4RZRA 2HQDA 1NKBA 1KD1T 3A12A 2AWZA 2HWTA 1UVKA 3W62A 2MXYA 3C2PA 3OHBA 1XK8A 4A47A 3BBFA 5M2UA 1HQ2A 4U6PA 2B9EA 1GXLA 3GJTB 1RHUB 3I5CA 3BGUA 2NUHA 3IS9B 1XJWB 4NX9A 3MEDB 1LFWA 2NUUG 3MMCB 2UUAJ 3OTBA 3AA9A 2DEIA 4DV7J 1S99A 3W2WB 2HHQA 3GYXB 5KG1A 4ZN1A 3R3TA 3C6TA 5KFWA 4URQU 2PA8D 5KFIA 4JI4F 4JYAJ 2KI2A 4DR2F 2V68A 4TU8A 1KVJA 3VQTA 3W65A 2EFGA 4J9SA 2IRYA 3VZHA 3K8WA 1U24A 3W66A 7FDRA 2Q43A 2DPIA 4Q0BB 3ZC4A 1TUVA 1XWLA 2Y1IA 1NJIT 5I42B 5FIIA 2XY6A 2KXHA 2V8HA 1ZM2A 2XNRA 2G13A 2DHSA 3TEGA 2ZVSA 1S1TA 3G82A 3OSNA 1E6VB 3I55S 4DUYJ 4J9QA 1P1LA 2R8GA 1FHTA 4X84A 2QTWA 4Y2IA 1WHWA 2MZSA 4LF9J 4CO3A 4AQYJ 3LP1B 4I0WA 1RT4A 1RBLA 2AJ4A 1S1XB 4DUTA 2CPYA 5BYQA 2KL8A 4F26A 1NK4A 3VR1A 2JNJA 4RU9A 5HQMA 2JH3A 4PPDA 3MM6A 2I5JA 2ZE2B 1MWZA 4QYZJ 3KWMA 2GIRA 3D6HB 3RBEA 3EZUA 1X60A 4Y2AA 2YNFB 1V5VA 1PAUB 4NCAA 2R4FA 1RBOB 2RKIA 3IXQA 4DN9A 3P3DA 3LP0B 2PN6A 4EMDA 3PO4A 1YWXA 4MKBA 4QBUA 5CH7B 2KU7A 3OQ2A 4A46A 4CDIA 1RU1A 4JI2F 1JLFB 5H1SV 4AMOA 2QV6A 1VQSA 1NLKL 4OL8A 3CXCR 1N0UA 2WVFA 4RW9A 4JI8F 4QWEA 1XERA 4RR5A 3MTKA 4MKAA 1BWVA 3PKMA 2W4DA 1FX4A 2LKZA 4DCJB 1O6XA 3KK2A 5U47A 2XGQA 2AZ1A 1S6QA 1QTNB 2KVQE 3MPYA 2H5IB 2ACYA 1T11A 5KG6A 5IWAF 3UI3A 4R25A 2V34A 1UFLA 3I31A 3OVBA 3N4WA 3LH2S 2YNGA 3TX0A 2MQQA 1IM6A 3VZIA 5JVHQ 1GNKA 4EYIB 3UPFA 1JLGA 5E2QA 2F4VJ 3KJNB 3OHAA 1IKWB 2QC3A 3PX4A 5LSOA 2NXUA 3R5JB 1UWBA 2ALYB 1U2CA 3DDNA 2KT3A 3GCWP 1D8ZA 4JI6J 3OTEA 2M70A 4PWUA 5D77A 3M2RB 1VQLS 3CCQS 2AX0A 2CYYA 4J9MA 3AOCA 2WSFC 1WELA 4R5PB 5KFMA 2ZHAA 3MEGB 4NXNJ 4EK2A 2OKQA 1HW9A 3ZFVA 4PUOB 1U6BA 2NREA 2IYGA 4YMEA 4WKRA 1S4FA 1RA6A 1X5OA 4YOEA 1SV5A 4GKJF 2FC8A 2P5VA 4ZHRB 3SV4A 1N8RT 3OVSA 1T03B 5A8KA 1NKCA 1RTHA 4DR6F 2DRBA 4IR1A 4KC5A 4M5LA 2IY5B 4F02A 2W7OA 1U45A 4CO4A 1NJYA 1YJNS 5F8JA 1F5BA 1TZ0A 2A2CA 4NXMF 1ZETA 3O44A 2HGMA 4ZPWR 3DLGA 2QGFB 5IFMA 2VQEJ 3UCUP 5B7WA 4GO5X 3R2CJ 2BJ9A 1ZYQA 2HG4A 3M4XA 4FZVA 2IC3B 4L72B 3RJMB 3T1HF 2KM8C 4PXEA 1NHKL 1LQ9A 2AD9A 3KLHA 5D0HA 4ZVPB 1F9HA 3TOQA 2NPFA 5LJ5Y 4TKTA 3TNVA 1MW7A 4L74A 3BQ2A 1ACMB 1RI7A 1GMWA 1YHQS 2LFVA 1QSSA 5IZHA 3W9HA 2YY3A 2GVZB 2F4FA 2XZTB 1HBMA 2GHWA 4ALZA 1VRTB 2KFZA 2LEAA 3MF5A 4O44B 2FJBB 3KLVA 5DQHA 2GC8A 2R3VA 2ABYA 3HT3A 2LQJA 1L3UA 2NCKL 3QGIA 4M5IA 1HI1A 2AJFE 4FYVB 4ZVFA 3GZ7A 3I4HX 4D3GA 2A0FB 4LF4J 5DQIA 3MGJA 2YH0A 1SIZA 1OWXA 5HMXA 4O0IA 1H73A 3VVUA 1D09B 1HWIA 1Y5LB 2XWYA 5EX0A 1SH3A 1QAXA 1F9FA 4KKOA 4WYLA 5I3QA 5KFPA 3OR2A 2AYEA 4ED3A 2GMLA 3N6MA 4IDKA 4RPFA 1KQKA 1HL6A 1DLOB 1L3SA 4MIBA 2J6UA 4OFZA 2MQOA 2Z2MA 3FNNA 5KFGA 2H1YA 4C0OC 3B54A 2JEJA 4B17A 3IC1A 3EXYA 1N36F 2M7SA 1VBKA 3RG6A 1YG0A 1WC4A 2QL9B 2B51A 2DPJA 2ADBA 5CYMA 3KNGA 4NLYA 1C0UB 1SPBP 4O0NA 2HHHF 1VRUB 2IVYA 1HHQA 8AT1B 3J81j 2ADCA 3VAIA 1I3OB 1UPPA 1FI4A 1NDLA 2QIFA 3TJ8A 3DGVA 3A3OB 1X4BA 4EFAC 1QY7A 3NP5A 1WEYA 4DL5A 3PJXA 5DDOC 2GZOA 4GO7X 1VRQC 2MY7A 4W92B 2OGUA 1DARA 3CCMS 2RIJA 4PWWA 4NLOA 3HSGA 3CJ8A 3PJ9A 2UUCJ 3CDAA 4XTTA 2X1FA 4IR9A 5T7LA 5KOXA 4QR1A 4PEOA 4KYZA 2E7XA 1NCLA 1OPIA 3IM9A 3SSRA 1IWGA 1HA1A 4USVA 3DHXA 1FKPB 2QLJB 1PAEX 2HNDB 2J9DE 2ZJRQ 4I1TA 3CDEA 1T7PA 4IRDA 3W1YC 4JI7J 3VAJA 1CVJA 1HBNA 4DV3J 4TY8B 1T95A 2HHSA 5E33A 4B3RJ 4UOHA 4QYRA 1B7YB 2F1FA 2L9WA 4PG5A 5ETMA 2XC9A 2RDDA 5BXIA 1NNDA 3K17A 4LF8J 1N6QA 5C25B 2DHAA 3W2VB 4WIQA 3AJ1A 2VFRA 3SYZA 2CJBA 5J2PB 1S1WB 5KT2A 2PIIA 3EZ5A 4DV0J 1QVFR 1C0TA 2V6AA 3T41A 4U67Q 4DSKA 3R1LA 4Q2MA 2CAJA 3D7SB 5AXMA 1QSYA 1S4EA 1UJ5A 4MT1A 5KFCA 4ATNA 4BLGA 3PW7A 1R43A 3G6YA 2WK4A 4J91A 4H4KA 1V9OA 4CQ1A 4ED1A 3EM1A 3EZOA 2AGQA 1FFWB 4AD6A 4P9SA 3KDOA 2QN6B 2N7CA 2ZH5A 4WZMA 4DJBA 3VCDA 4WFNQ 4CLLA 2GO8A 1REGX 1BY9A 2HK3A 2YNIA 3U02A 4EBEA 4DCPB 1JLQB 1RP5A 4DL3A 4IUFA 4HKQA 1TELA 3BQ1A 2XMKA 3SDEA 4CCHA 1HYSB 2AEMA 1Z1ZA 2LMIA 4LMZA 3SV3A 4NCBA 3SCJE 4CYUA 4RNOA 5LOQA 3POTB 4KH1B 4U96A 3CCSS 2DGOA 2DNRA 1IR2A 4DZ6A 2D3ZA 3HP6A 2AZ3A 1NEEA 1HQUA 3MM7B 4QPXA 3BSCA 2ZITA 3QGPA 4Y3CA 3JSBA 4DOZA 5KT5A 1H7WA 4DV6F 4OX9F 3FEZA 1NK0A 2K1RA 3T19A 4USTA 5CABA 2MKSA 4F4AA 1D9AA 4OLOA 3L7UA 3ELHA 2E7VA 3BSAA 2PGCA 1DTTB 2LQBA 4E2FB 2JC1A 3R5CA 1OQ6A 3J7Z5 2M8DB 2J7UA 1C4AA 3AXKA 4GC7A 4I2QB 4J9RA 2RS2A 4Q5VA 1IQZA 4U9RA 3VHQA 2BANB 2KXFA 1H0HB 1HWLA 2IDLA 4C97A 2Z57B 4NMLA 3I0RB 1RWPB 4B9TA 2RH3A 2V50A 3DNCA 3OR1A 2IDEA 3WDOA 1U02A 2UUBF 2B3TB 1DZ5A 3M30B 1M5OC 1FVSA 3S6EA 1DTQA 2QSFA 1TL1B 4RNFA 3D5MA 5HN0A 1H2UX 1RTIB 2W24A 1PO6A 3NMRA 4DX5A 3KMSA 2LEPA 3OFHA 4A8KA 1RTJA 2B6AB 2R2TA 4DV2F 1NK9A 2FB0A 3J7A1 3Q8QB 3M6VA 5B0CA 2CQ3A 3T9ZA 3QGHA 3AT1B 1EETA 1A9NB 2YVSA 3UO0A 1WF1A 4AXIA 4KHPF 1HNXF 1YGYA 1SXLA 3KLIB 2VPXB 5CYQA 2GQQA 3OXFA 2B4PA 3M2UA 1HQEA 4CLZA 1FE0A 2Z2ZA 2QLXA 1Y5NB 3NS6A 3KUEA 1X5TA 2DR8A 4TYBA 5F8NA 3DRRA 3NBPA 3BR8A 1SL1A 2HNYB 4ZPAA 1U1MA 1DAXA 1Z4UA 3J7AN 3G4SS 5LMNJ 1VR6A 4H4MB 2BJ8A 4ZCMA 3Q24A 5GAGU 3MAAA 1RCXB 3IWLA 3SZ2A 2ZJQQ 1RT1B 4RW8B 1T9TA 4UF4A 2Q6BA 1HBOA 4M94A 4OJGA 2MB0B 3IWNC 2JVRA 1FJ7A 4LRCA 1GXTA 2YQ3A 1RAAB 2VUGA 2KHCA 4ZVRB 1V3ZA 1RACB 2OEKA 2MHNA 4OYWA 4JI4J 5D3GB 1AUSL 4I4BA 2QYCA 3JB9k 2RILA 4IOAQ 4Z7YA 1F3FA 3HFVA 4QPTA 2Z56B 1A6LA 1SJ4P 4GVLA 4EEYA 2Y1LB 2EXUA 4YP3A 1UMJA 2B7BB 3GJRB 2C3OA 3D1QA 1TKZA 2XY7A 4L76A 4K4VA 2C3UA 3R1HA 2BE2A 1F60B 3TZYA 4HHUA 1VHFA 1VJWA 3HD1A 3SFUA 3L9ZA 3GMGA 3SEOA 5JUMA 3HX9A 4DFMA 3M6UA 2VZ9A 3MCMA 4NLQA 3Q0AA 4NMXA 4K2JA 1U47A 1RK8A 2P9EA 4OV6A 2EEYA 3W63A 4ED4A 4K7QA 4NCGA 4K0KF 5HMZA 1RGVA 4PYAA 4LQ9A 1FJGJ 2HWHA 1YBUA 2DB1A 3JAMU 1M1HA 4O3NA 5K14A 3A8JA 3DFEA 3JSRA 5DO2A 3DOKB 4ERDA 3M9NB 1N54B 5IV4A 2A3JA 2GGPB 4X4OA 2DTJA 2DY9A 4USWA 3CCVS 1UZHA 4ZVEA 2FGOA 2HQGA 2J9EA 2V2KA 4QZVB 5EDWA 1FRHA 1EKSA 1YBAA 1F1BB 2OPSB 1GT8A 4DWIA 5GADU 2CPXA 2FQQB 2DH9A 4XDDA 4V19X 1HW8A 1VQYA 2GHVC 4MFBA 2NR0A 4HT7A 3C15A 2VC1A 2DR9A 4ES3A 1KTVA 2CZ4A 5HP1B 2BKPA 1OMSA 4BHQA 4CH0S 3D0IE 2GVDB 3QRPA 1PYSB 3CMAS 4TU7A 1TL7B 3R7BB 1FXRA 2RHQB 3D1HA 5L8RC 1RSCA 4L73A 5ETVA 4XDCA 2C1EB 2E1PA 2HRYA 3IBCB 1VC6A 2K06A 2XI2A 3K5MA 2DNZA 1CJKA 1XIQA 2BRKA 3GR1A 3H2UB 2VICA 1I6JA 1PJ6A 1GTHA 1L5UA 1S77D 1TKDA 1BWEA 5L1IA 1RT7B 4WU2A 2HEKA 3L4BC 2AJ1A 4NLWA 3CGIA 2YKPA 3RAXA 3VQSA 2MZRA 3EE3A 2WONB 4CLUA 3HT0A 2V2VA 1U1OA 3RBXA 1FTCA 2A6MA 3HULA 3H5XA 4WP9A 2B5JA 3MM8A 3BB5A 5F41A 3CB4A 1IQTA 3IRWP 2HYIB 3PX0A 3V4MA 1XNQJ 5CAAA 1GMWD 3Q89A 3TUZC 5IT9Y 4WF9Q 2R7VA 5IOLA 1VIOA 4YHHF 1WSRA 2WOMB 3MOJB 1GK8A 3U27A 3GV7B 1L3KA 1FA0A 4ZLPA 3ILLA 1O5JA 4KGXB 3VAHA 4CLKA 3KK3A 4GRSA 3H42A 1RT6A 2AF6A 3LF0A 4ZCKA 1LK5A 3Q2SC 4J7CA 2CADA 1N32F 1LWCB 4ZOSA 4UUXA 3EGVA 3BGRA 3HI9A 3ZTQA 4RBUA 3L7OA 3X1LB 4JV0A 3MEDA 1XR5A 4K4ZA 3MDFA 3PFEA 3UN2A 1ZAWA 4KY3A 5EN1A 1U0HA 1YRTA 1UW4A 3H5SA 3TQ1A 1N5SA 1EP4A 1IBCB 5DG8A 4RO0A 3CD0A 2KG0A 4LSLA 4P2XA 4Q0BA 3QNWB 3UDCA 4CZCA 5I42A 3AB4B 4DV5F 5K8OA 1RAGB 3OW2R 3DM2B 2W2OP 4I6AA 2X1GA 2KO1A 2CQBA 5LXYA 2BDPA 1FDNA 3IFEA 3ZZZA 2W9AA 1MG7A 2XWXA 4LQ3A 2CPFA 4NI2B 1E6VA 2FD2A 1GH8A 1OPZA 5L1LA 2DJWA 4WFZA 2UVUA 1WKKA 2ILZA 4OHYA 2M52A 4FF4A 2E5LF 4ANEA 3D68A 5H9EJ 4JI0J 1AA1B 1RWNB 3DRSA 4K5SA 3EPGA 3A8EA 1RT3B 3PW2A 1JKHB 4NLRA 3WIVA 3GSIA 4QQBA 3UE2A 2NLWA 4OI1A 1IBMF 4F4YA 3PEHA 1SJFA 4X62J 3Q2TC 3TR5A 2NPIA 1NB2A 3EVMA 5HVHA 2M8HA 1TKXA 2H51B 1FD8A 2B56A 4KPCA 1AFJA 4ELVA 1KC8T 1N52B 3TAMA 3C6TB 4CT9A 4OYAA 5KAKA 1JLFA 3TYTA 3EPIA 1RXOB 3BPSP 1LV5A 3AOAA 3MMAB 2ZUAA 2FJDB 4ECQA 5KFVA 4DSFA 2CQHA 4FYWB 3AQPA 4HI1A 2DR6A 2ZBIA 2H4YB 2KB2A 2BE7D 4CO1A 2OO4A 4IRCA 3CO0P 4OX6A 1U25A 4LR7A 3IWXA 3G82B 4B3TJ 2IYIA 5B0AA 2AGPA 3MUTP 4YY3F 1B4SA 1G1XA 5A8WB 1H74A 4ZLLA 2GJ2A 3DHWC 3BBBA 1WF0A 2RQ4A 4F4ZA 3OL8A 2XSFA 1RT4B 2FHMA 4IFYA 4U8YA 2YWFA 4XIUA 4B9MA 1JJ2R 1UEVA 4CP5A 2ZWPA 3V6JA 2IPOB 2JOQA 4G65A 4Y34A 2IJNA 2HZVA 1Y11A 1SIWB 3MM6B 2I5JB 4F4KA 1FEEA 3ZZOA 1JWWA 3BN7A 5KFHA 1CPZA 4J9NA 3T5JA 4DR7J 2BOAA 2RF2B 3EGZA 2VPWB 4XPEA 2LECA 2RKIB 5E3CA 5G4DA 4PAAA 4LFCJ 1P1TA 2XEXA 1HBUA 4KE5A 1BGXT 1VJQA 4NL5A 4B3SF 3D2WA 3DXBA 1Q7LB 2R7SA 3W3SA 4Z7CA 4Q43A 3HFZB 3HHLC 2JFDA 2CDQA 2QLFB 4OI0A 4IRKA 3RR7A 2OHDA 1D9FA 3ETMA 2NXCA 3KK2B 2R2SA 1GTEA 1CC7A 2I9SA 4FS2A 3RB0A 1T03A 1GAOA 4QWDA 2JX2A 4FDFA 4DR3F 1U1PA 2P6SA 7AT1B 1Q8KA 3HHNB 4RUCA 1RT2A 3MCOA 2HHTA 5E5NA 3WBZA 2IM2A 2G1DA 1TL3A 4X64J 3UCGA 2YNGB 1FWLA 2LA4A 1AYEA 1NB7A 1O8BA 4Y2MA 2GMHA 1JLGB 2N4CA 4J9OA 4ZVHA 4OZLA 4DF8A 1UWBB 2Y0BB 2KYXA 1YZ6A 1WACA 2KN4A 2K8GA 2CWXA 4UW2A 2W4PA 4W98A 5KFFA 4ZP8A 2CPZA 8RUCA 2YPZA 2A10A 4ECXA 3LTOA 3WC2A 5K8NA 1LXNA 1XMOJ 1EJ7L 4WFXA 5AXNA 1QD1A 5ETKA 2G2YA 2CVIA 5F8GA 4OJ1A 3T6JA 2ZNYA 1VRTA 5E3QA 1TR0A 2KYZA 5LT5A 3C14A 1KVIA 4PWDA 4UY85 5DRKA 2VFUA 2CPEA 2CUYA 1WTBA 2FHJA 5A8KB 1DQ8A 1RTHB 3GJQB 1PJ7A 1VI7A 5KT7A 3LWLA 2D9OA 2CNKB 4DR4J 2YKMA 3CEDA 5D6GA 4NLVA 1SKWA 1UVMA 4KJIA 2ZBRA 2G4BA 4M5DB 1P27B 3BREA 3MM5B 4C8LA 4NZ6A 2LQ8A 2DNOA 2K2PA 2RHSB 3DLGB 4FBUA 2B4OA 4WK1A 4JI5F 4ZPVR 1WI8A 2E9TA 1KN6A 1DLOA 1CJVA 1Y00A 2D41A 2E5HA 2FYXA 3M2VA 4LSZB 4KT0C 4LF1A 4WXOA 5D8HB 2D7SA 2HURA 3B4DA 4R0EA 4C48A 1HIYA 1KEKA 2HQ3A 3M8RA 1MU2A 1PGZA 2KDOA 2D9PA 2RJZA 3E8OA 5KFZA 3UDEA 4EZ6A 2YWGA 3JSYA 2X3DA 2MKYA 3M32B 2BABA 1NHUA 4W90B 3C3LA 4OIXA 3OLBA 1CEZA 4Y2CA 4ED0A 3SCIE 4F0MA 3PEJA 1J27A 2EG1A 2KVIA 4TQSA 5KG0A 1K1SA 2E7WA 2UXBJ 2EG2A 3FRZA 5KFQA 3D1OA 3P45B 5AE1A 1KFSA 2J6TA 5IV3A 3AAWB 2YX7A 2HHPA 3VGSA 2FJXA 3DCAA 1H2VZ 1LWFA 4OV1A 2V69A 5F8IA 1NSQA 4KKOB 3CJ3A 3AY0A 4ZJQA 3OR2B 2RAQA 4X4NA 4MKYA 4MYTA 4F3QA 4HVZA 4N47A 4DPXA 5D4LA 4RJVA 4AMPA 1IJFB 1KNZA 2RS8A 3QQCD 8ATCB 3DYAB 1A7GE 1PYTA 5J2NB 2BKNA 2ALZA 3KUGA 4TY8A 5KFOA 3MR6A 2G2ZA 5I3UA 3TVYA 5A0YB 1FE4A 4RKUC 1VBYA 4URGA 1QAYA 3K5LA 3CIMA 4O4RA 2Z58B 4FN5A 2O3DA 4ZVTB 3G2XA 2ZC4A 3NWGA 2QMWA 1QSLA 4GKKJ 4JI3J 3T5HA 3O6QA 2NXEA 3NCPA 2DIUA 4QR0A 2M2BA 5J2PA 3HPOA 3DDIA 7FD1A 1S1WA 3J80Y 1JJCB 5IM0A 3IMQJ 3DLJA 1U6ZA 2LA6A 4FYYB 2B9WA 2JZ5A 1IKYB 2GIQA 2PI5A 3IAM9 2CA9A 2NSBA 3L3CA 2JLEA 3HHDA 3K2YA 2HIQA 3HJFA 4DX8H 3GR0A 2DR7A 2A1BA 1B70B 2HFUA 4CM0A 4XAKA 2ZBCA 1IWAA 4PXCA 4OLPA 5D78A 3SBMA 2ZOGA 3WIUA 1I51B 1KWMA 3RRHA 4DQPA 4O4GA 1CSJA 2ZOFA 2F65A 3P5BP 2F3JA 3FBCA 1UJ4A 2VH7A 1HD0A 1NK5A 1HKAA 1S6PA 4YN3B 4O3SA 1TV6B 2VU5A 1U1RA 4I67A 1G3OA 4O23A 1HNWJ 4N76A 1HBNB 1PG5B 2CPJA 2BYCA 1FKAF 1FWPA 3H59A 1HYSA 4YEAA 1LWEA 4UOGA 3D3CJ 1N6QB 2VJVA 3ENQA 1FFSB 3IGNA 4RLEA 1WEZA 2HMIB 3POTA 4YDDB 3MI7X 3DRYA 3W61A 4OX8A 1IBKF 5KG5A 3GFHA 4G3IA 4MKVA 5F3TA 3OTOJ 3BM7A 4X66J 4XK8C 2JEGA 1C0TB 5GAGI 1HHTP 2E1CA 2B43A 2MZ1A 1IN0A 4A48A 3UNGC 3FSYA 4DFPA 2VG6A 1N33J 5H9FK 2MJUA 1O51A 2ZFHA 1ZM9A 3BH7B 3HF5A 1IUJA 2UXDJ 3UCZP 4Q7AA 4I2QA 4G1IA 5GAEU 4CH7A 3R27A 1M5SA 2U1AA 4ZVOB 2POKA 1RUSA 3FRYA 4A8FA 3IG1A 2C2OB 2VDHA 4LRFA 4NEYA 4NASA 4ZVQB 4M5KA 2YNIB 4C8OA 2QLBB 2VG7B 2XS2A 1PBAA 3TX8A 3LPEA 4FXVA 3SDEB 3DOLA 5ETPA 5CZVA 5I3PA 2BR0A 3ONQA 2WVBA 4CYUB 4LVOP 4PG4A 3EX7B 3O1LA 3K57A 4NYPA 2QG9B 3NS5A 1IBLF 3IN5A 2MMYA 5KG7A 3CF5Q 3F0NA 3M8YA 2CZVC 3C8YA 4F3MA 4LVNP 1TKTA 5ETLA 4QYZK 1F5CA 4RWXA 3FBEA 3UNYA 2R7WA 1UVJA 3VWSA 2Q1LA 2DGUA 3G8QA 4YHHJ 2ASLA 5DGAA 1JXLA 4DI6A 1VFJA 3M6WA 1KVKA 1DBDA 3NGDA 4OQJA 2XS5A 4ECVA 2UP1A 5L46A 5J1EA 4YUDA 3KLFA 4BDPA 2HVHA 1FDBA 5E3RA 1M5PC 1HNVA 2F40A 1WOSA 1N32J 1T9VA 3Q8UA 4H4MA 5KG4A 3BO4A 2LU2A 3PIPQ 4RW8A 2YKNA 1M1KT 1T94A 2DNYA 4DR1F 2DGTA 1DTQB 1VK8A 2RRNA 4TVAB 4ETXA 3Q8PB 1X0FA 4HLBA 4O3OA 3V6DA 1PC4A 2ZDPA 4QU7A 2QEXS 1RTJB 3FEXB 3ADAC 4IOCQ 3IBWA 5IQ6A 3KHHA 4IQXA 4CWBA 1FRXA 3PYGA 2OPPA 4C98A 3RU0A 4MMOA 4ZDNA 4NLDA 2J9CA 4AT1B 4DV5J 4DCOB 4LBHA 4IG3A 3CE8A 2J0WA 5CYQB 2HK2A 2GA7A 1S0VA 3M2UB 4LUBA 1BD6A 4QOTA 1FESA 1Y5IB 2VFTA 2KFYA 1NJWA 3DRRB 3NBPB 4KBIA 3QSYB 2J9DA 3HZGA 5KFYA 3ZZYA 1EIYB 3TJAA 4NZ7A 4DU8A 1VC0A 1Q86T 3HSDA 3BYRA 1IBMJ 4ZIVA 3UR0A 3JS9A 2XB2D 5ETQA 3MAAB 2OEMA 1UTAA 4ZITA 1BC6A 2WAQD 2OPRA 2VKRA 4KQZA 1AZSA 2QJ3A 4JI1F 4OI6A 2JSXA 4A8QA 3W64A 2E1RA 4ZIWA 2DITA 4DV1F 1HBOB 3EICA 4FXDA 1PIEA 2HNZB 1RTZA 1FK9B 1RWVB 2KT2A 2J0SD 3AXMA 2H4WB 2HFZA 2VQFJ 1ITPA 1MSWD 1C1CA 3GIKA 4NRUA 1NRKA 1NKEA 3D3BJ 1BXNA 4K50A 3W60A 3QWUA 3BS9A 2CDRB 3JSMA 2KT5A 2I8EA 1R6YA 6AT1B 2XULA 3UN3A 3FBBA 3ITHA 4WBFA 2V9WA 3BO2A
chains in the Genus database with same CATH topology
5DZ6A 4RL1A 4RR5A 3R8YA 4QBUA 2VZ8A 2C2NA 3EZOA 3CJ8A 3R97A 2VKZG 2QO3A 3TZXA 2H1YA 3G87A 3TZZA 5CZCA 2G2YA 3K89A 3SBMA 2G2OA 3TQEA 3RGIA 2VZ9A 2CUYA 3H0PA 3IM8A 3HMJG 3HHDA 5CZDA 3PTWA 2HG4A 3TZYA 2PFFB 3TZWA 1NM2A 2JFKA 1MLAA 5DZ7A 2QJ3A 2JFDA 2G1HA 2QC3A 3IM9A 2G2ZA 2UV8G 3BV8A 3HJVA 3QATA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DZ6 A;  4RL1 A;  4RR5 A;  3R8Y A;  4QBU A;  2VZ8 A;  2C2N A;  3EZO A;  3CJ8 A;  3R97 A;  2VKZ G;  2QO3 A;  3TZX A;  2H1Y A;  3G87 A;  3TZZ A;  5CZC A;  2G2Y A;  3K89 A;  3SBM A;  2G2O A;  3TQE A;  3RGI A;  2VZ9 A;  2CUY A;  3H0P A;  3IM8 A;  3HMJ G;  3HHD A;  5CZD A;  3PTW A;  2HG4 A;  3TZY A;  2PFF B;  3TZW A;  1NM2 A;  2JFK A;  1MLA A;  5DZ7 A;  2QJ3 A;  2JFD A;  2G1H A;  2QC3 A;  3IM9 A;  2G2Z A;  2UV8 G;  3BV8 A;  3HJV A;  3QAT A; 
#chains in the Genus database with same CATH topology
 1XBW A;  1BUX A;  5FJ4 A;  2VBX A;  2BE2 B;  1YVF A;  4ILL A;  4NLP A;  3B78 A;  5DM7 Q;  1PYO B;  2ZM6 J;  2E1M C;  1T05 A;  4ID5 B;  3FZ2 A;  1TL7 A;  5DZ6 A;  3WX8 A;  2ZOM A;  2ZH9 A;  2OD4 A;  1WOP A;  1HLW A;  4FNI A;  1PCA A;  4FPI A;  2EFQ A;  1D8Y A;  4Q8F A;  4NCG B;  4J9V A;  5F8H A;  5LL6 d;  2OLW A;  1SJR A;  3M8Q B;  4M5G A;  1MN9 A;  5D0G A;  2FVQ A;  2QYG A;  4USH A;  2AYB A;  5D4P A;  2BJE A;  1J5E J;  2MKH A;  1L3V A;  4KGM A;  2CPH A;  1URN A;  3C6U A;  1R8A A;  3ET6 A;  3HLU A;  3ZTS A;  4DX7 A;  2W2Q P;  4FKY A;  4IKA A;  4LBP A;  2XMT A;  3T5K A;  2JDJ A;  2PDA A;  5CXT A;  2R9L A;  4DQI A;  4B3M J;  2XGP A;  2GMJ A;  1HI8 A;  1S0N A;  3KXD A;  1SKU B;  4I6W A;  2DGV A;  5I4M A;  3TA2 A;  2WB4 A;  2SXL A;  2DBB A;  2HS4 A;  3QMQ A;  3I4P A;  1WUU A;  3HXM A;  2EFN A;  3RRG A;  4MFB B;  5DM6 Q;  3C15 B;  1FNX H;  2VB6 A;  5E7O B;  4CTA B;  3VAM A;  2UXC F;  3HVA A;  2ZKU A;  4TN2 A;  1WNE A;  2K3K A;  4ED5 A;  2DT9 A;  5SZT A;  2P9G A;  2E44 A;  1WOO A;  3FCW A;  2FHJ D;  3C16 A;  1XR6 A;  2F63 A;  2VA2 A;  5D4O A;  3R2D J;  3WZ0 A;  3N9U C;  1CJK B;  1RAJ A;  4LRA A;  3LUY A;  1UAW A;  5T41 A;  4P2M A;  4DV4 F;  3DXS X;  3TWZ A;  3J80 U;  2IM1 A;  5K9F A;  3HSJ A;  1RAB B;  2XZD B;  1LW2 B;  2FLN A;  3D54 A;  3CD7 A;  1HMV A;  4X4Q A;  1OSD A;  1KR4 A;  4KH0 B;  3U1N A;  3DLK A;  5JXS A;  4TYA A;  4K5R A;  1SL0 A;  4C4W A;  4FKX A;  3HHL A;  1RAD B;  2WVC A;  3Q23 A;  2G2O A;  3RAM A;  2VPY B;  5CD4 H;  1N5T A;  2B5J B;  3J7Y U;  3QT7 A;  2RQM A;  1DHM A;  5AJ3 F;  3NCQ A;  3DM2 A;  2MY8 A;  2WW4 A;  4RNH A;  2BQ3 A;  3I0S B;  4J37 A;  2O67 A;  1U4B A;  4KO0 B;  2MGZ A;  1Y10 A;  2HPU A;  3CJ0 A;  2HHW A;  2AEJ A;  2APO A;  4C7Q A;  2IAJ B;  1Y3K A;  3LAL A;  2BRL A;  3FZB A;  2UV8 G;  2C28 A;  3QYY A;  2H5E A;  1TP7 A;  3KK3 B;  4D3H A;  2XCP A;  1RT6 B;  2QL5 B;  1KP6 A;  4ECR A;  4LF6 F;  4UT4 A;  3CWJ A;  3CME S;  3CCL S;  2HVE A;  3CCU S;  3BGR B;  3BYP A;  1O0P A;  4IH5 A;  4B3O A;  2XMU A;  5AT1 B;  1U1K A;  1R3N A;  5HQL A;  1R89 A;  2LP4 A;  2EC0 A;  1U0H B;  4X4T A;  2XLJ A;  3LPY A;  3MPW A;  4MYU A;  1EP4 B;  1WDT A;  1WC1 A;  3R7N B;  4MTP A;  2FY8 A;  2L48 A;  4LSL B;  2MQM A;  3SCK E;  3MMA A;  2W1B A;  3AOD A;  2JRS A;  2AYM A;  5F0U A;  2KRB A;  3U7J A;  1U26 A;  2ROP A;  3LGH A;  1NK6 A;  3CJR A;  4QWB A;  3BEG B;  3TZW A;  3ZNJ 1;  3KJV A;  2WRM A;  1X4A A;  2DH7 A;  2GFF A;  3I6P A;  1VIS A;  2HIY A;  2CQI A;  4NRT A;  2R7T A;  2W4C A;  2V4J B;  4OYB A;  1NBE B;  5A8W A;  2AMC B;  5AXL A;  3KYL A;  2ZZM A;  2RRB A;  3DRS B;  3A3N B;  2FVR A;  3AQO A;  1YX2 A;  4I69 A;  3NNA A;  2C2N A;  1CUL B;  3QT6 A;  4PYD A;  1RHM B;  3W8G A;  1PJ5 A;  2JEI A;  4WYW A;  1XEZ A;  2UUA F;  1F9E B;  1TKX B;  5GMD A;  2HVI A;  4DV7 F;  2COL A;  2VKZ G;  2KM8 B;  1NJZ A;  2VPZ B;  4Y65 A;  2RF2 A;  2G0I A;  4KHR A;  2RNE A;  1TQL A;  3PR5 B;  2XZW A;  3TAM B;  3G8T A;  1CJU A;  1JLE A;  1KON A;  5B0D A;  1XMQ J;  2G1H A;  1OS5 A;  3CJK A;  2YH1 A;  3GFZ A;  3FDS A;  3TAN A;  1LW0 A;  3CJ4 A;  2YBV A;  4CNZ A;  4AMN A;  2ERR A;  1X8D A;  2HGN A;  1B7F A;  2VAS A;  2OIH A;  2M5Y A;  4CNY A;  5D0R A;  1YZ7 A;  1XN9 A;  4K59 A;  1V6H A;  2Y1R I;  3E3X A;  3FQL A;  2ZZN A;  3GFX A;  4DUY F;  2JLF A;  2ZHB A;  4DUZ J;  3DKD A;  2LQ9 A;  1RKI A;  2DXF A;  4FYX B;  3CVK A;  4LF9 F;  3KFW X;  1ZZN A;  3IR7 B;  4CRJ A;  1TK8 A;  4OZN A;  3OJU A;  4AQY F;  2QA1 A;  5IT4 A;  5KT3 A;  2AJQ A;  5KT6 A;  4WP8 A;  2NZC A;  2XHC A;  1WOR A;  4IFY B;  3LQV A;  1RWM B;  1UEK A;  3PJW A;  1ZH5 A;  1JJH A;  1H6K X;  3KNA A;  2JWN A;  1U1N A;  4FVC A;  1B64 A;  2XMW A;  2FJV A;  3SSS A;  1KKH A;  4I7F A;  1V3S A;  5HLF B;  5IC6 B;  3T5L A;  3CSK A;  3UDV A;  2IFX A;  4KGV B;  4ZJO A;  3M9O B;  2MSS A;  4K4T A;  1LOU A;  3GE9 A;  4P73 A;  1WD6 A;  3Q83 A;  2MTL A;  4ECZ A;  5A2Q Y;  4HTJ A;  1NK8 A;  2CWK A;  4CLY A;  5ETO A;  1HBU B;  2HBY B;  3A13 A;  1KOH A;  4LF7 F;  3PO5 A;  5M2R A;  4OYP A;  4M5M A;  3BH6 B;  2XSJ B;  3V4I B;  1Q53 A;  3RAQ A;  3K7R A;  4WE1 B;  2L08 A;  4HHJ A;  5KT4 A;  2Y8W A;  2FC9 A;  2OMO A;  2PEB A;  2WZ1 A;  3FC9 A;  3RB4 A;  4A8X A;  2XHW A;  2XM3 A;  4ECS A;  1M1G A;  3TA1 A;  2V8D A;  3J81 U;  5ETS A;  1KQF B;  3K5N A;  1X9M A;  3US5 A;  1KTQ A;  1JX4 A;  3I32 A;  1YJV A;  5E41 A;  3V5R A;  3BPD A;  5RUB A;  5KFB A;  4DLG A;  1RT2 B;  3N28 A;  4DPT A;  2MDA A;  1TL3 B;  1RA7 A;  5LXR A;  2DXE A;  1MLA A;  3H98 A;  4M5D A;  2J8A A;  3MM5 A;  1VOM A;  1T8E A;  2F4V F;  3BZQ A;  2N4D A;  1FWK A;  2DNH A;  1N0V C;  3RGI A;  5KFR A;  4EYH B;  3HVW A;  4OZ5 A;  3JQJ A;  1HNZ J;  4DQR A;  3ILJ A;  4FVM A;  2KZM A;  4JI6 F;  1F3V A;  3DDK A;  1WEX A;  3GV5 B;  1FXL A;  1PKU A;  4HYK A;  2VF3 A;  1SJQ A;  2YWK A;  3AFG A;  1KHW A;  1N5Y A;  1Q8B A;  2QA4 S;  4N41 A;  1ULR A;  4H4O A;  5CZD A;  3M9M B;  4NXN F;  2MJN A;  2DGS A;  5IC4 B;  4ECU A;  3M32 A;  1LXJ A;  2GJF A;  2KJW A;  3E01 A;  3CD6 S;  1RIS A;  4E98 A;  2DGW A;  3WC0 A;  3VGT A;  2J8S A;  3C14 B;  4PWD B;  1S72 S;  2L3M A;  3EVW A;  4YB1 P;  1XR7 A;  1K0T A;  5D0E A;  3O2I A;  3OD2 A;  4LF5 J;  3V6K A;  4ZPT R;  6FD1 A;  3QLH A;  4B9U A;  3DLH A;  1FD2 A;  2DCU B;  2PT0 A;  4FPR A;  2YKM B;  1IR0 A;  2EI5 A;  4J90 A;  2EFP A;  4DL2 A;  3MFI A;  5E3A A;  1I94 J;  4U7C A;  4UZB A;  1WG1 A;  2VQE F;  1TFY A;  3IBF B;  1VQ6 S;  4X65 J;  3QAU A;  5HRO A;  4M5H A;  4M5J A;  4YR3 A;  5KFD A;  2GS8 A;  1CJV B;  4L6V 3;  3ULH A;  3M2V B;  3DYA A;  1RAO A;  3CT9 A;  2GCF A;  2UVW A;  3PYF A;  5J2N A;  3V81 A;  1S6U A;  3TI0 A;  4IOB A;  2R8I A;  2EFV A;  3MXH P;  2DHG A;  5EUH A;  5A0Y A;  1MU2 B;  4W4M A;  3PFO A;  1SJ1 A;  4ZP9 A;  2LXU A;  1MMD A;  2MLZ A;  3TUI C;  2QE5 A;  3UQS A;  1UVN A;  1S79 A;  5DLF A;  2VG5 A;  4OI2 A;  1NDC A;  2X7I A;  1NPP A;  5GAE I;  2EKN A;  2MHE A;  2GIF A;  4K4S A;  3UD5 A;  3H5Y A;  4P75 A;  2RU3 A;  1LWX A;  4E0D A;  1UPM B;  3FVY A;  3CO9 A;  1R6V A;  4HR2 A;  3UR3 C;  2RQK A;  3EXC X;  3CCJ S;  3FGV A;  4JB8 B;  1VIX A;  2KHD A;  5FLX Y;  2W2M P;  3QFW A;  4NA2 A;  1IKY A;  2CQ0 A;  4YQW A;  4K4U A;  1S9F A;  1CJT A;  2W2P P;  1LEO A;  1LWF B;  1SJ3 P;  5HJY A;  1GQE A;  3D4J A;  4LR9 A;  4EWT A;  1RB0 A;  3RB3 A;  1H7X A;  3TQE A;  1VC5 A;  4DPO A;  1VLY A;  1S1V A;  2XBP A;  2VBZ A;  3IGV A;  1X4F A;  2ZDO A;  2OPQ B;  3I82 A;  4PG6 A;  1GFW B;  1C2P A;  2ZNZ A;  3GJS B;  2RML A;  1W7W A;  2V8V A;  4PRF A;  3Q86 A;  1TV6 A;  1RWO B;  1VLO A;  1JXE A;  1NSP A;  4J9U E;  4JV5 J;  4N8N A;  5F8M A;  5I3U B;  2FHO B;  1FNO A;  1M5K C;  2IBK A;  1SUQ A;  3A8K A;  1T02 A;  3K0J A;  2NQP A;  5K20 B;  1WG5 A;  2CQD A;  2HMI A;  4OZ2 A;  3QO9 A;  1XNR J;  3HO1 A;  1NPK A;  5HQ8 A;  2DY1 A;  1KLM A;  3D6M B;  2HQF A;  1K0V A;  1VHI A;  1JMT A;  5E3P A;  4RX6 A;  3VTI A;  2GAG C;  4ICL B;  5IM0 B;  1YJT A;  4GMK A;  3B8H A;  1PC5 A;  2CG4 A;  1SI9 A;  4F04 B;  5KOW A;  3Q8S B;  4FNH A;  2F9D A;  3R5A A;  2C3Y A;  1R8P A;  2IMO A;  2PSZ A;  2WB1 D;  1JLB A;  4X4S A;  3L7P A;  2UUC F;  4AE5 A;  2Z30 B;  4P74 A;  4EBC A;  3T6B A;  2IHR 1;  3O8W A;  1M90 T;  2XNQ A;  4U95 A;  4O4G B;  3MR5 A;  1R0A B;  2E29 A;  2DGQ A;  4JI7 F;  2VOP A;  2C2R A;  3FK4 A;  5K8M A;  4O3R A;  2QMU B;  3EDQ B;  1S6P B;  3H2L A;  4DV3 F;  2HW3 A;  2VG7 A;  3FUY A;  2ZH8 A;  4B3R F;  5C42 A;  3PHE A;  3LGN A;  4DSE A;  1OY8 A;  3CNQ P;  3U1L A;  1HI0 P;  4LF8 F;  2NXJ A;  1CQM A;  2B7C B;  1LWE B;  2DNG A;  3VAK A;  2BKO A;  5LJ3 Y;  4USU A;  4DF4 A;  3BR9 A;  2BEF A;  2DH8 A;  4NLT A;  1X9S A;  4Y00 A;  4J9L A;  1FX2 A;  2YTC A;  4DV0 F;  1N34 J;  2RQC A;  4N56 A;  3I96 A;  1RTD A;  1YRX A;  3HHL D;  3ISZ A;  2QRR A;  2BV3 A;  3N0V A;  2M9K A;  4DL6 A;  2R8H A;  1Q16 B;  1F5A A;  4UY8 T;  5IXU A;  1FRM A;  5HBM B;  2HLU A;  2VG6 B;  2MZQ A;  1Y3J A;  3GFY A;  1TUG B;  4ELT A;  4HL9 A;  1AFI A;  3M8P A;  3NS7 B;  1UP1 A;  1RAE B;  1VK3 A;  2L9N A;  3M05 A;  4A8O A;  3DU6 A;  4L3K A;  3IG1 B;  1XMB A;  1T3N A;  3NAH A;  1HR0 J;  2XLK A;  3R97 A;  2DGX A;  2PMZ D;  1X4H A;  5IQQ A;  2F8M A;  5J2M A;  3NRB A;  1C1B B;  4AL6 A;  3ZNU A;  2I38 A;  4BBY A;  6FDR A;  4ZLJ A;  1EZZ B;  1B0T A;  2V5H G;  4TLR A;  1N56 A;  3DOL B;  3SFG A;  1RHR B;  1WC5 A;  3NAI A;  3D67 A;  1YIT S;  3AA8 A;  2R7Q A;  3OXG A;  1X5S A;  4A8Y A;  2RRA A;  1S48 A;  2C2M B;  5CD4 A;  2DIV A;  2PO4 A;  4N5S A;  1R27 B;  3G8S A;  4HI2 A;  1P9Q C;  2WSE C;  2C3P A;  4LRB A;  5FDL A;  2MQL A;  4IFV B;  1TTH B;  1TKT B;  1H3D A;  4IYQ A;  4V19 J;  5A2Q U;  3LA0 A;  3KKF A;  4I64 A;  1JLA B;  3GIL A;  5DLG A;  3PRV A;  5DJB A;  3LAN A;  1RT5 A;  4UQG A;  3HJV A;  2R2U A;  3CJ5 A;  5CQG A;  1Y7P A;  4LR8 A;  4NYZ A;  5J1E B;  3KLF B;  1S0M A;  1WF2 A;  2BM1 A;  5F8L A;  3ZTP A;  1WHY A;  2XMV A;  4IO9 Q;  1HNV B;  1MML A;  2EK6 A;  1RKJ A;  2XYG B;  5HVF A;  2J76 E;  5B08 A;  4ZMM A;  1A0O B;  1PIL A;  3G6X A;  3ENA A;  3TAP A;  1UA0 A;  2ZH4 A;  3SMZ A;  3KUH A;  2E9Z A;  2YKN B;  2MKK A;  5C24 A;  4PAB A;  4NYO A;  2UV8 A;  2E66 A;  2HNZ A;  1FK9 A;  1S7H A;  4N7T A;  3BDP A;  4MAK A;  3FSI A;  4PPZ A;  2OAU A;  2BMB A;  5CA5 A;  3QZ8 A;  5GME A;  3V6D B;  3PRB A;  4DR2 J;  2RD5 C;  2ZD1 B;  2BW7 A;  4ZN3 A;  3QID A;  1QAJ A;  4ZLN A;  3MOZ A;  3W9J A;  1ZAV A;  5EGY A;  1FCA A;  3I9V 9;  2B4U A;  2OPP B;  3R7S B;  4C2M A;  3GU0 A;  5KFE A;  3MPU B;  2V8P A;  4IG3 B;  1LKZ A;  5B0G A;  2OD6 A;  3DLL Q;  2YKO A;  3C19 A;  4LSN A;  1T9X A;  4ID5 A;  4WKY A;  1U1L A;  2XYH B;  4DPW A;  3AHP A;  1SVD A;  3OTC A;  2HQC A;  1Q8L A;  1P8G A;  5HI7 A;  1WI6 A;  1I5O B;  2EKY A;  1ZTT A;  4B08 A;  5LMN F;  4AUK A;  5HL7 Q;  2UVV A;  2AJ0 A;  3J7Y I;  1YI2 S;  2YWE A;  2MZJ A;  3M8Q A;  4C0H A;  1B3T A;  2MLX A;  1ICE B;  2B4V A;  1MRO B;  3NY0 A;  2OPR B;  4P72 A;  1AZS B;  1KLN A;  4F0H A;  4C3K A;  1Q7Y T;  3M1V A;  3DGP A;  2FVP A;  4C6A A;  2P2C B;  3FJ2 A;  5H9F J;  3RYL A;  1MWY A;  3NGU A;  4J9P A;  2FZK B;  1IKV A;  4N8O A;  4OI4 A;  5GAH I;  1C1C B;  2N3L A;  5MLC V;  3D28 A;  4Q44 A;  4JI2 J;  3JSM B;  4RBT A;  2OUG A;  3NG8 A;  1T9W A;  4AFF A;  2KRR A;  4RUA A;  3LOU A;  3ITH B;  2DNQ A;  3NGS A;  4JI8 J;  4NLG A;  1VS3 A;  3DRX A;  5THW A;  2HBZ B;  2VC0 A;  3LP2 A;  3PY8 A;  3KMQ A;  4GC6 A;  3H8Y A;  4CTA A;  1T05 B;  4ANC A;  3OL7 A;  1VQ8 S;  3ENV A;  4RUH A;  2MKC A;  4WFB Q;  3QBC A;  1Q79 A;  2MST A;  3QFH A;  1S10 A;  2B8Q A;  5IWA J;  4B9L A;  1U8W A;  1MWQ A;  2RE1 A;  4UQT A;  3AJ2 A;  3QRR A;  1FJG F;  1EAR A;  2F8E X;  1ZM4 A;  4BCA A;  9ATC B;  2D3O 1;  1Y4Z B;  3KG1 A;  3P5T L;  1NH8 A;  1LW2 A;  2EWH A;  3C6U B;  3ET6 B;  4LIR A;  3I56 S;  4DZD A;  1YLX A;  3QT8 A;  5FLX U;  2AT1 B;  3QGG A;  4P7T A;  4ED6 A;  3PNI A;  3MR7 A;  4CLT A;  3W5Y A;  1REV A;  4LF7 J;  1CQN A;  4HTI A;  1WHX A;  3GV8 B;  3IO1 A;  5DG7 A;  4EZ9 A;  4AL5 A;  1R8C A;  3DOM A;  1SC1 B;  1QAI A;  2I0X A;  5DDQ C;  3D0G E;  3S01 A;  1HFE L;  3UD3 P;  3I0S A;  3FFI A;  1TK0 A;  5B0B A;  4KO0 A;  2F7V A;  1D0E A;  5KFK A;  3D0H E;  4GKJ J;  2IAJ A;  2G0J A;  4ECT A;  2HHU A;  2ZEJ A;  4ZCI A;  3Q8V A;  1BHN A;  1YDL A;  3FMB A;  2CZ9 A;  4ED8 A;  2AHO B;  4AYB D;  4ER8 A;  2QA4 G;  1D1U A;  2HSE B;  3W7B A;  1Q8I A;  4DR6 J;  4UOF A;  1FF2 A;  4OI3 A;  4WZQ A;  2HHV A;  2PI4 A;  4F50 A;  3C16 B;  4WU3 A;  1CLF A;  2FZC B;  3PKY A;  2QMX A;  3IR6 B;  3R5B A;  2N7Y A;  2KH9 A;  2GQC A;  2BJ3 A;  2V67 A;  4NXM J;  1YBT A;  2VL1 A;  5C2C A;  2VIH A;  2WBR A;  1HHS A;  2EBE A;  4CM2 A;  2HRT A;  3RBD A;  1XC9 A;  2C3M A;  2AV5 A;  1HMV B;  1RCO B;  3MUM P;  3DLK B;  3T1H J;  1S1U A;  4KGZ B;  4FBT A;  5CCL A;  2W9C A;  4CLS A;  3K59 A;  3UDL A;  1RHK B;  3UVJ A;  1OO0 B;  2QSW A;  3HHL B;  2CJQ A;  3KG0 A;  1C4C A;  4C9D A;  1LK7 A;  5EWE A;  1XNQ F;  3RUB L;  3LWM A;  3KHR A;  4CI0 B;  2QT7 A;  4UTG A;  2QA2 A;  3B82 A;  4DHV A;  1SQF A;  4QIW D;  5EWG A;  1HPZ B;  2K3I A;  2YKQ A;  3ISN C;  4LRE A;  5C2G A;  3HFK A;  3HKW A;  3K89 A;  2MGZ B;  3MFH A;  2V4J A;  2ILY A;  3MAH A;  1ZOT A;  4F0K A;  2NYH A;  3KDN A;  5L38 A;  1X4C A;  4I6Y A;  4DN0 A;  1W2B R;  4F36 A;  3OJS A;  3R8Y A;  1ZM3 A;  1NZ8 A;  4Q45 A;  2FLL A;  1CUL A;  3TVK A;  2VD3 A;  2BXJ A;  3G6E S;  2WVD A;  3EJM A;  2PMW A;  3SIP B;  1E6Y A;  1FO1 A;  4B3O B;  2D3O R;  1WKJ A;  2ROE A;  3SQG A;  5DDR C;  3K58 A;  1YIJ S;  2DNP A;  3BKU A;  5HSP A;  4C8Z A;  3OV7 A;  1J2V A;  4UUW A;  3OBI A;  3MMB A;  2E1A A;  4WP3 A;  1HD1 A;  3GG1 A;  5JVG Q;  2YWH A;  2KG1 A;  2PC6 A;  1BQN A;  3M8W A;  3OUY B;  1VQM S;  2E5G A;  4DPU A;  5LM7 E;  5A76 A;  3CDU A;  4X4R A;  1RAF B;  2BM0 A;  3T1Y F;  4KIA A;  3PDN A;  5K5M A;  2F5G A;  3KLE A;  1N36 J;  2A6O A;  2C42 A;  3HVT B;  2W8L A;  3KJV B;  1JIH A;  3PVX A;  3WX4 A;  2O01 C;  2UU9 F;  3QAT A;  1M5V C;  2Y8Y A;  3D6F B;  3JAM Y;  2HHH J;  4JI0 F;  4NE9 C;  2FZG B;  1U49 A;  3KK1 B;  4LRD A;  3CJ2 A;  2DEJ A;  3MUV P;  1MNE A;  4CO2 A;  1V5I B;  2B8P A;  5ETN A;  3I5A A;  4X62 F;  2XMM A;  3PCO B;  1D9D A;  4KRW A;  3CJS A;  3O3L A;  2CQ2 A;  4HDH A;  3NL0 A;  4IQM A;  1VQ9 S;  1X5P A;  5HLF A;  2C2Z B;  1UVL A;  4F2S A;  3MEC B;  3QIP A;  4K4Y A;  2R8J A;  4R0J A;  3CJT A;  2VBW A;  4C11 B;  2LQ5 A;  1VCT A;  2VBY A;  1CJU B;  1JLE B;  1FNM A;  3HZE A;  5L39 A;  3CJK B;  2PMH A;  4ENO A;  3CC7 S;  3TRG A;  1LW0 B;  2DXD A;  2BAC A;  4IG0 A;  4PXB A;  3GSD A;  1WJ9 A;  4OYZ A;  2XSJ A;  2HFS A;  3V4I A;  5D15 A;  3OXL A;  3HM9 A;  4ZA1 A;  1Q4R A;  4WE1 A;  1XQI A;  2CXE A;  4H54 A;  5ETT A;  4ETZ A;  4B3T F;  2DO4 A;  3GG0 A;  2AGO A;  3QRQ A;  4MK9 A;  2ZH1 A;  1QLN A;  2WHO A;  4KAI A;  1UCN A;  2P6T A;  1U7L A;  1P6T A;  3DC2 A;  2DCL A;  5ETR A;  3BSO A;  2RUG A;  2AU0 A;  3BKT A;  5J2Q A;  1NK7 A;  3KLG A;  1T9Y A;  4QW8 A;  3PYD A;  5C5J A;  3QSI A;  2OSQ A;  3GTY X;  3H25 A;  4P2S A;  3MEE A;  1Q81 T;  4ZVS B;  2AX1 A;  2R7X A;  4I7F B;  1WHV A;  2HVZ A;  5GMK a;  3I87 A;  2BZ2 A;  4DR7 F;  4C8K A;  1FTR A;  2LXF A;  4OYI A;  3G96 A;  4DFJ A;  4LFC F;  1VQN S;  3MM9 A;  4RW7 A;  2IJR A;  4ED2 A;  2OP5 A;  3SSQ A;  1CS4 B;  3GIM A;  4Z2X A;  2RB7 A;  2RDI A;  3IRX B;  1IJE B;  2W7A A;  3KHG A;  3DLE A;  3I9Z A;  1P9Y A;  1SH2 A;  2BA9 A;  4QIF A;  4ZPB A;  1Q82 T;  3GWC A;  2W9B B;  4P71 A;  1RQ0 A;  2G9O A;  1FRK A;  2IVM A;  2QZ8 A;  2EPI A;  1S9E A;  1MN7 A;  4QU6 A;  1TUW A;  3X3U A;  3DI6 B;  3ZZU A;  2DO0 A;  4DV6 J;  2CNN B;  4OX9 J;  4PCQ A;  1R8B A;  2OFH X;  4M5N A;  4X64 F;  3FCH A;  4K4X A;  4ZP7 A;  2RDJ A;  5BYS A;  3KG4 A;  2GJI A;  2ZHO A;  2CJA A;  3BN4 A;  2FTR A;  3THT A;  2XCA A;  4IO1 A;  1D3W A;  2ZJP Q;  3H20 A;  2UUT A;  2A2D A;  3IR5 B;  1Z2L A;  2LDI A;  3WQP A;  3C46 A;  1FT8 A;  1N5Y B;  3N5F A;  5G0R A;  4CO5 A;  1XMO F;  4U7U K;  4X2B A;  5CZC A;  4H4O B;  2R7U A;  1ZS6 A;  1FVQ A;  5D4N A;  2UUB J;  3MEK A;  2HHX A;  3CC4 S;  4R8U B;  2MLY A;  2VFV A;  1FFG B;  1SH0 A;  1AUD A;  1X4D A;  3NGK A;  2Z2L A;  2VOD A;  4F67 A;  2J7W A;  1YJU A;  3ZZT A;  3NKY A;  3FKB A;  3E01 B;  2JLG A;  3MPV A;  3CC2 S;  4ECY A;  2FVC A;  4X4P A;  4DV2 J;  1GX6 A;  4URS A;  5M2P A;  1M5H A;  4TY9 A;  1YJR A;  2NS1 B;  3DRP A;  1RBA A;  2W01 A;  3EDR B;  4DR4 F;  1GX5 A;  2HAF A;  4KHP J;  1HNX J;  3QLH B;  2DD8 S;  3V6H A;  4I2P A;  3CMQ A;  1YQH A;  2GNK A;  4OHX A;  4ID8 A;  3W9I A;  1OY6 A;  3K5P A;  1UJ6 A;  9RUB A;  2ASJ A;  4FF1 A;  2KFN A;  5HRO B;  1UFW A;  1S12 A;  5L1J A;  5HJX A;  1X4E A;  4P2F A;  1NXI A;  4L3N A;  4ZK7 M;  2OPQ A;  5IT9 U;  1TVR A;  1WKL A;  1NSK L;  2JC0 A;  5KFL A;  2H5J B;  2MQP A;  4DQS A;  2E5I A;  3ZZR A;  3GB0 A;  3VAL A;  3DMJ A;  2FGC A;  3V81 B;  3ENW A;  3VGU A;  1JLC A;  1TL5 A;  3JYT A;  2LCW A;  1GMU A;  3PXG a;  5HAT A;  1FXD A;  4DS5 A;  2V0N A;  1U48 A;  1QDU B;  2V94 A;  2VG5 B;  3SCL E;  1V3R A;  3QJP A;  1SC3 B;  3NWR A;  3GLJ A;  2R2R A;  1FKO A;  4ICL A;  2Y0S D;  1KFD A;  3EMT A;  2LVW A;  3VF0 B;  1IXK A;  2G0C A;  2UXB F;  5B0F A;  4TQR A;  5KTQ A;  3PZP A;  1TFW A;  4LFA F;  2FIU A;  2GAH C;  1TMM A;  3CTR A;  2H48 B;  1CJT B;  1VQP S;  2M88 A;  4OX7 A;  2AKW B;  3IAS 9;  1F2G A;  1T9U A;  3NOC A;  1UVI A;  1S1V B;  4A8W A;  4F3O A;  1FDA A;  4LF2 A;  2YPY A;  1R0A A;  1JB0 C;  2AP6 A;  4K0K J;  4Y6I A;  2BUN A;  2VOO A;  1UZD A;  1X4G A;  3NEK A;  2XLI A;  2UVR A;  3AD8 C;  5BYR A;  4GVB A;  1SUQ B;  3AH6 A;  4OJH A;  1RU2 A;  3U1M A;  1DQA A;  3AOB A;  1TK5 A;  5A8R A;  2PEH A;  2DIS A;  3Q22 A;  1YSJ A;  4GKK F;  4JI3 F;  1OY9 A;  3G87 A;  2FPH X;  4UOC A;  3MR3 A;  4QIE A;  2YXL A;  1TAQ A;  3QO9 B;  2IRX A;  2CJY B;  3KJQ B;  1KLM B;  3FEY B;  1J5O B;  2CFX A;  4V1A k;  2CJ9 A;  1K44 A;  1RLC L;  1TL4 A;  2HZC A;  1OJ4 A;  4PQU B;  2YNH B;  2MEW A;  1S9G A;  4N77 A;  1S0O A;  4CO0 A;  5K8P A;  4WCE Q;  3GON A;  4RW4 A;  3B4M A;  5HBM A;  3G71 S;  1ZPW X;  3TW0 A;  3KJF B;  1JLB B;  1B0V A;  2HWI A;  1EKR A;  5DQG A;  3ZXW A;  3H4D A;  4I56 A;  3ETO A;  4I68 A;  4QR2 A;  4E8U A;  1AB8 A;  4NA1 A;  2JVO A;  3QPI A;  1UET A;  2GV1 A;  2KXN B;  2LYV A;  2MZT A;  4ZPD A;  2Z4P A;  1HNW F;  3TEH B;  4DDF A;  2Q3P A;  4WWS A;  5C42 B;  3FBF A;  5A6P A;  1C1B A;  3BV8 A;  2EK1 A;  1K1Q A;  1SC4 B;  2J6S A;  3ZTR A;  4B02 A;  4KV8 B;  2BE9 B;  3HHK A;  1SBR A;  1X0P A;  3G9C A;  4L75 A;  4WTO B;  4DBQ A;  2QFJ A;  1NSA A;  3BGO P;  2GO9 A;  3OTO F;  1DY3 A;  4X66 F;  5KFS A;  4ZVU B;  4IFV A;  1RTD B;  5HO4 A;  4QWC A;  3TP2 A;  4HAC B;  4EUV A;  4MK8 A;  1EQM A;  2P9C A;  3VV2 B;  1ZZF A;  3D66 A;  4DSL A;  1RWX B;  1N33 F;  2MQ8 A;  1ZBT A;  1N4L A;  4ILR A;  4YB7 A;  1JLA A;  2P8I A;  2ZH3 A;  1YJW S;  2FLP A;  4S0M A;  1UKU A;  2UXD F;  3M8P B;  4P7V A;  4ES1 A;  5KFT A;  4RW6 A;  2KKH A;  2IRU A;  2Y1J A;  3CPW R;  1WTF A;  4KR0 B;  4U8V A;  1OYD A;  4Z37 A;  1BMQ B;  1HNI B;  4G1Q A;  3BBC A;  1F6T A;  2MQN A;  5GAD I;  3MWB A;  1HWU A;  2OI2 A;  5J2M B;  3L95 X;  3S1T A;  4FF2 A;  4DXL A;  1R0B G;  3B6B A;  3TO8 A;  3NGT A;  1NU4 A;  1WG4 A;  1YJ9 S;  1DUR A;  1VQ5 S;  2JEF A;  4F2R A;  3JTO A;  3IP0 A;  4X4U A;  1RZM A;  2E5J A;  5L9N A;  2ZD1 A;  3L09 A;  3CCW A;  4ILM A;  1IR1 A;  2XS7 A;  2CQG A;  1KQS R;  2R42 A;  3FCV A;  4KFB B;  2RSQ A;  3RRK A;  1RJJ A;  1S6O A;  3RB6 A;  4C8Y A;  5FDL B;  4F4W A;  1BQM A;  3F44 A;  2MYF A;  4M8L A;  1ZA1 B;  3GCX P;  2BQU A;  2ATC B;  3DN9 A;  2XQC A;  1IKX A;  2WW8 A;  1VYA A;  2OSR A;  1NJX A;  3LAM A;  2LDY A;  2AQ4 A;  1W2I A;  4PG8 A;  1RT5 B;  4XPC A;  2E5L J;  1RYR A;  1KBR A;  1PSD A;  1KS2 A;  2XMJ A;  3RZA A;  1R8H A;  4PR6 A;  3OL9 A;  2L9D A;  1MRO A;  3IS9 A;  3F41 A;  3MZI A;  3CW2 C;  3MMC A;  1T0T V;  4PKD B;  1Q78 A;  4RNM A;  3W2W A;  5C24 B;  4OHW A;  3RW7 A;  4QIV A;  4AND A;  1H98 A;  2PA3 A;  4USM A;  1Y0H A;  3Q8R B;  4DL7 A;  5AE3 A;  4ED7 A;  1GXU A;  4LIW A;  2HZA A;  4MJK A;  3F56 A;  4ZKA A;  1SKR A;  3AJD A;  1QM9 A;  3MR2 A;  1KHV A;  3P49 B;  2ZUG A;  2KZZ A;  1UA1 A;  3JTP A;  2J5A A;  5HAN A;  4DG1 B;  3Q8Y A;  5L1K A;  2GHP A;  1G4C A;  2QO3 A;  3T1Y J;  1RWW B;  2DKO B;  3P8B B;  4PZV A;  2BBE A;  3H90 A;  4XO0 A;  3N5B A;  2MPU A;  2YX4 A;  4LSN B;  5FD1 A;  1VDH A;  3LAK A;  2MKJ A;  4JV2 A;  2D1C A;  2UU9 J;  4CLF A;  4F8R A;  4YY3 J;  4DS4 A;  2ZC3 A;  2HVD A;  3VAF A;  1QE1 B;  3JXO A;  1S59 A;  4UZC A;  4NWB A;  4PQA A;  3LP1 A;  3TZZ A;  3AD7 C;  3TA0 A;  5LSL A;  4JV1 A;  2CQC A;  4WK3 A;  1LNQ A;  1NZA A;  1S1X A;  2HBR B;  2BW2 A;  2ZWO A;  3SQO P;  2KJV A;  3BGF A;  3W5X A;  2ZE2 A;  1B99 A;  4HDG A;  5HMW A;  1KRP A;  3OT9 A;  5GVQ A;  1CC8 A;  4TU9 A;  1NAQ A;  3GYG A;  3OFG A;  3M1V B;  3QAE A;  2YNF A;  3DGP B;  4NA3 A;  4NLU A;  2IM0 A;  4Y28 C;  2OFG X;  4NOH A;  2VQF F;  3ZZ0 A;  5KG2 A;  4RBV A;  3LP0 A;  2AYG A;  2PD1 A;  4WTY A;  1IKV B;  1G2E A;  2CRL A;  1YJ7 A;  3R5G A;  1TAU A;  4B3S J;  4RWW A;  4QIG A;  2CJX B;  2VHG A;  5JMN A;  1KQG B;  2CVE A;  2IMW P;  2J0Q D;  3GQC A;  2GQ2 A;  3PW0 A;  3CJQ A;  1VMB A;  1WC3 A;  1YTY A;  5DS7 A;  1ZTW A;  1PBU A;  4LFB F;  2ZM6 F;  3LP2 B;  2VZ8 A;  2DNN A;  1S1T B;  2W25 A;  1VQK S;  4RL1 A;  3NOG A;  1Q5Y A;  3KHL A;  3CCZ A;  3OFF A;  3R5D A;  2A18 A;  3GIJ A;  5LMU F;  3D6T B;  5DZ7 A;  1QUP A;  4DR3 J;  2X1A A;  5EX3 A;  3TUP A;  1URR A;  5KFN A;  5KFU A;  1W26 A;  3AD9 C;  2V63 A;  4DPY A;  2L41 A;  2UZA A;  1QJH A;  1J5E F;  1SCJ B;  2NYI A;  1IKW A;  1SC6 A;  2V2Z A;  2FY1 A;  1W25 A;  1S49 A;  5ADZ A;  3GII A;  4FP9 A;  2HRU A;  2IA0 A;  1N5V A;  1N88 A;  4B3M F;  2FVS A;  4MIA A;  1K8A T;  4M63 A;  3ZTO A;  3BSN A;  3O5T B;  2NXN A;  3M2R A;  3PIO Q;  2FUG 9;  1REV B;  1RAH B;  3GYN A;  3EUN A;  4R5P A;  1JQG A;  3DU5 A;  3DOM B;  3MEG A;  2CG8 A;  4DR5 F;  4RW9 B;  4QW9 A;  4PUO A;  3ZO7 A;  3ZZP A;  1HPZ A;  4C8N A;  3THV A;  4OZ0 A;  1HAR A;  3FFI B;  4ZHR A;  1KDN A;  3EGN A;  2FLO A;  1S6Q B;  2BVZ A;  1QTM A;  2RU9 A;  2IBO A;  1NDK A;  2HS0 A;  3T1A A;  1LFP A;  5HAO A;  1ZA2 B;  1GMV A;  3A1Y G;  2ASY A;  1U0S A;  4Q2L A;  2CQ1 A;  2VV5 A;  1VQ7 S;  3HHE A;  4YB5 A;  2R8K A;  4C3L A;  3JQM A;  2YQ1 A;  5BR8 F;  3NMA A;  1TU0 B;  1MMN A;  2IJF A;  3QT5 A;  2EFO A;  2W8K A;  2VJU A;  3PTW A;  4M95 A;  4M1K A;  4CLW A;  3T3F A;  2D3U A;  2IC3 A;  1S76 D;  2I1R A;  4JI5 J;  3MD3 A;  4AXJ A;  3H2V E;  4RUB A;  1FDD A;  1S1U B;  1FJC A;  4F7V A;  1R31 A;  3VVT A;  2QX0 A;  3CUN A;  2IM3 A;  2W9C B;  3UVJ B;  3OUY A;  4Q8E A;  2M4M A;  2PE8 A;  4G6V B;  3C66 A;  3RTV A;  1X7V A;  2GVZ A;  1WC0 A;  2GX8 A;  3CD5 A;  4X4V A;  2HFV A;  3TVZ A;  4C0B A;  1NDP A;  4IH7 A;  3HVT A;  3N6N A;  1JNR B;  2XY5 A;  3THP A;  1SV5 B;  2VDI A;  4O44 A;  2FJE B;  1ZPV A;  2CJK A;  4P10 A;  2EBG A;  2HFO A;  1NUE A;  2DHH A;  4NLX A;  3DLB A;  2XYP B;  1KSP A;  1I1G A;  3KK1 A;  3IM8 A;  5JJB A;  4DQQ A;  4OZ1 A;  4WXW A;  2H3E B;  4LJM A;  2ROG A;  1UL3 A;  2O1P A;  2LXI A;  3ILO A;  4OZ3 A;  4MH8 A;  2HKE A;  2CQP A;  3LGM A;  2XMA A;  2Y9H A;  4WFY A;  1E6Y B;  3HVR A;  3MAQ A;  3SQG B;  1OSC A;  2DHX A;  3MEC A;  1UW9 A;  1FRL A;  2B9X A;  3EWG A;  1U2R A;  4C11 A;  4JYA F;  3D9B A;  5HMY A;  2C22 A;  3MMB B;  4B9N A;  2ASD A;  3KLH B;  1AW0 A;  2Q6C A;  2ZZT A;  2CNO B;  3OLA A;  1BQN B;  5HVG A;  2CKW A;  4OYO A;  3PW4 A;  1HBM B;  5E0O A;  3KLE B;  2QLW A;  4ZS6 A;  2DVI A;  5DG9 A;  4CT8 A;  2O66 A;  2OEJ A;  3TUJ C;  2DNL A;  1C0U A;  3EVO A;  1VRU A;  1KOO A;  4DFK A;  4MK7 A;  4HHH A;  4HH0 A;  4NEZ A;  4AL7 A;  1EAY C;  3HSZ A;  2HS3 A;  4YR2 A;  2N3O A;  1YRU A;  1Q5V A;  1RHJ B;  3P4U B;  2Q66 A;  1R7I A;  3KTQ A;  3CDB A;  4BWJ A;  1OIA A;  5F9N A;  4LFA J;  5KFX A;  1U6F A;  1IM4 A;  5IS2 A;  3WHI A;  1WC6 A;  5B09 A;  3QJL A;  1NPR A;  2BJD A;  2V2Q A;  1FRJ A;  3H7H B;  1RWK B;  3QIP B;  2XO6 A;  4IDK B;  4AMM A;  1XMQ F;  4TLQ A;  2LEB A;  1FKP A;  2HND A;  4A4J A;  1CS4 A;  2HBQ B;  2E9R X;  3BO3 A;  3IRX A;  2JJ4 D;  1SKS A;  1H2T Z;  4IG0 B;  4ZCL A;  3F73 A;  4G1P A;  2U2F A;  2HGL A;  3RBZ A;  3RR8 A;  1RAI B;  2YX1 A;  2Z8Q A;  5CYJ A;  1K9M T;  4EI2 A;  4HH1 A;  3NLC A;  1R0C B;  4DLE A;  1EQ0 A;  5C25 A;  4KSE B;  4YB6 A;  1VQ4 S;  3M8S A;  5F0W A;  3PRD A;  3W2V A;  4J5O A;  2W9B A;  2Z0G A;  4DUZ F;  5CYM B;  3K5O A;  2H9Z A;  3LO3 A;  2Z2Y B;  1VBZ A;  4TXS A;  3G86 A;  4USI A;  1IBK J;  2XTJ P;  3OSP A;  1F2H A;  1SQG A;  4ZJL A;  3DI6 A;  3CCT A;  5J2Q B;  3PG9 A;  1ROF A;  3KLG B;  2CNL B;  4HEA 9;  4KPY A;  3MUR P;  2LLZ A;  2R7O A;  4RNN A;  5J1P A;  2CIM A;  2UUW A;  3MEE B;  4MIW A;  1RWU A;  3H4B A;  4FS1 A;  4ZPC A;  1JXV A;  2WTF A;  3NCR A;  5T7L B;  4F4X A;  2QFI A;  4A8M P;  5IT0 A;  2DYA A;  2AW0 A;  3MM9 B;  2V4R A;  4RW7 B;  2ZVI A;  5DET A;  2YQ0 A;  1EB0 A;  5ITH A;  1JLQ A;  3DLE B;  2HFN A;  4R8U A;  2HQI A;  1RE1 B;  2VON A;  2YKA A;  4C3M A;  3KOA A;  2OML A;  4K8R A;  2NSC A;  2EW9 A;  2WCX A;  3PW5 A;  3E2E A;  1WWH A;  2XO7 A;  1EHW A;  2PFF B;  3P96 A;  3E51 A;  3MM7 A;  4QWA A;  1S9E B;  3G6V A;  3A8I A;  4JOU A;  1S5Z A;  1IBL J;  2HAI A;  3TJ9 A;  3QJJ A;  2PFD A;  4YFU A;  3T9N A;  1DJ0 A;  3OL6 A;  1DTT A;  1JJ4 A;  2C2K B;  2DRA A;  2FJA B;  3PHT A;  3PX6 A;  1S7I A;  4LBI A;  4Y2K A;  3TZX A;  2N82 B;  3H40 A;  4KGK A;  5CCM A;  3UWT A;  4C8M A;  1HNZ F;  2BAN A;  2DNM A;  3CCE S;  4EO6 A;  1RDR A;  2OEL A;  1UFK A;  3I0R A;  3AB2 B;  2Y3Y A;  3BF4 A;  3MCN A;  3M7V A;  2OH2 A;  4K2X A;  4KHM A;  2C2D A;  4ITS A;  2QL7 B;  5CHC B;  3EYZ A;  2FHK A;  4OHV A;  2OJ3 A;  2RT3 A;  5G0R B;  1Q0N A;  3M30 A;  3N6L A;  1U09 A;  3NXZ A;  2ZBP A;  3UFC X;  1QVG R;  1TL1 A;  1SB6 A;  3GIR A;  3EGW B;  4DSJ A;  1RTI A;  4DR1 J;  3OPK A;  3OTD A;  5DDP C;  2BQR A;  5T14 A;  5A6W A;  5MAO A;  4YDX A;  2ACM A;  2B6A A;  3NNH A;  2M3D A;  4B9S A;  4ZVG A;  1K47 A;  1M0S A;  1HQU B;  2BJ1 A;  5KG3 A;  2F9J A;  3DRP B;  4LF5 F;  2ZBQ A;  4B9V A;  2O5D A;  2K1R B;  2Q79 A;  3A3P B;  3P6Y C;  3KLI A;  4LF4 F;  4YR0 A;  2M0G B;  3ISN D;  4EU0 A;  4RU2 A;  1N48 A;  4CH1 A;  3BJY A;  1I94 F;  4BC7 A;  4I2P B;  5KFA A;  3PR4 A;  4X65 F;  1X31 C;  2IIH A;  2HNY A;  4DX6 A;  1ZAX A;  2VFS A;  2H54 B;  4O3P A;  1IVZ A;  2DR5 A;  1H72 C;  3K8V A;  3TAQ A;  4USJ C;  5C7P A;  2FDN A;  3R9L A;  1TVR B;  2X3G A;  2D74 B;  1RT1 A;  4KB7 A;  5LSR A;  3N79 A;  5EHH A;  3BQ0 A;  4PXD A;  1APS A;  3OR1 B;  3ILI A;  3FMW A;  3DMJ B;  4KTQ A;  2W2N P;  4JI1 J;  2BOP A;  4BC9 A;  1FRI A;  1JLC B;  4DV1 J;  4EO8 A;  1ARO P;  1DRZ A;  3JYT B;  3VGV A;  3JTN A;  2HLT A;  1Z2Z A;  5D3G A;  1B0P A;  3S8S A;  2GW8 A;  2LU1 A;  3GP9 A;  4Y0F A;  4CIO A;  5J1N A;  2CPD A;  4OYX A;  2WSC C;  5KFJ A;  1J5O A;  4NZ0 A;  2VA3 A;  1FKO B;  4PQU A;  1EET B;  1HWJ A;  2YNH A;  5B0E A;  2XG8 A;  3SXL A;  3A4T A;  3MTJ A;  5F9L A;  2RVJ A;  4ES2 A;  2K7K A;  4YS2 A;  1UWA A;  3I5B A;  3SI8 A;  4BWM A;  1HQE B;  2ZH7 A;  4JUZ A;  3M8Z A;  1BE4 A;  1TMJ A;  1NHV A;  2JL9 A;  2AIR B;  1JK9 B;  2EC2 A;  3TAR A;  2DRD A;  2ZH6 A;  1RLD A;  4H4K C;  1N5Q A;  3FSX A;  2J0X A;  2ZKT A;  4U7U D;  4OJ3 A;  1U8S A;  2BX6 A;  2J7K A;  3V2U C;  2FJW A;  1Q95 G;  4FYD A;  3ICL A;  4P6Q A;  3J81 Y;  4JV5 F;  1ELO A;  3DOK A;  3BGL A;  2RUS A;  5L9X A;  2GGP A;  4GVB B;  5H9E K;  4KV8 A;  1UEU A;  3GPA A;  1NM2 A;  2JFK A;  5A8R B;  2B0G A;  1XNR F;  3HCX A;  1HWK A;  4OYM A;  4P52 A;  1DFD A;  1AT1 B;  4EBD A;  1AXQ A;  1U1Q A;  3IA0 A;  1SL2 A;  2OPS A;  5AXK A;  4DU7 A;  1X9W A;  4OHZ A;  1G6B A;  4HAC A;  1S9G B;  4NLS A;  5BJR A;  1TKZ B;  3W5Z A;  2B9Y A;  3LW5 C;  4RW4 B;  5HP1 A;  4LFB J;  1OQ3 A;  2GVD A;  1G7C B;  1FJE B;  2UXC J;  1Y9O A;  3MPD A;  2JHE A;  1CG2 A;  1OYE A;  3QWP A;  3MHY A;  2V8G A;  2YWW A;  5LMU J;  2X1B A;  1EX8 A;  4USK A;  1HNI A;  4WJB A;  4LT6 A;  2MKI A;  2CQ4 A;  1NO8 A;  1RHQ B;  3UN5 A;  1T3O A;  3H0P A;  5CZX A;  3N01 A;  4DSI A;  3PM9 A;  5K14 B;  4DV4 J;  1RT7 A;  3CIZ A;  1BQX A;  3CDW A;  4J9K A;  4OZJ A;  2WON A;  4WPA A;  4ELU A;  4WFA Q;  1DQ9 A;  4PG7 A;  1N34 F;  2ZH2 A;  4FF3 A;  4KFB A;  4JP8 A;  2EVZ A;  1BLU A;  4EGL A;  4FXW A;  4DEZ A;  3BKF A;  1FEH A;  3CUL A;  1YKW A;  3PV8 A;  5AJ3 J;  1WDD A;  4DR5 J;  2BJ7 A;  3MMJ A;  1FER A;  4TNO A;  1GEH A;  4A8S A;  3OVA A;  2V4Q A;  4O3Q A;  2I2Y A;  3UW1 A;  2WOM A;  4HT5 A;  3OFE A;  3H5U A;  3JQK A;  1L3T A;  2K7J A;  3CCR S;  2DK2 A;  2W7P A;  1QUV A;  1RYS A;  1S57 A;  4NPO A;  1CBK A;  1NH7 A;  2WVE A;  1Q1K A;  1XTZ A;  3S7R A;  4RW6 B;  2WBM A;  4OMF G;  3R6G B;  2OTL S;  1VGY A;  1LWC A;  1JNZ B;  2X51 A;  2OTJ S;  4IH6 A;  2AEF A;  1HR0 F;  2AJ2 A;  3J7Z T;  3HDS A;  3HMJ G;  3NGR A;  1VQO S;  3M6X A;  4G1Q B;  4JBC A;  4LF6 J;  2XI3 A;  1S97 A;  1NME B;  3MD1 A;  4BS2 A;  1K73 T;  5BR8 J;  3HKZ D;  3PAC A;  4QJV A;  2H65 B;  3HK2 A;  1YK9 A;  3RW6 A;  3QZ7 A;  2D69 A;  1SQE A;  1WSV A;  3BDE A;  1VBX A;  2CPI A;  5AE2 A;  2DNK A;  2IVF B;  1U2F A;  2V9K A;  5EWF A;  3HD2 A;  4QCL A;  3R6L B;  3MM8 B;  3PYE A;  3VAG A;  4K4W A;  3FQK A;  4DG1 A;  2ATL A;  4CLP A;  2F8H A;  3W8P A;  5F3Z A;  1BQM B;  4ECW A;  1H38 A;  4WII A;  2I6W A;  5SUH A;  4DMZ A;  4NI2 A;  1F0X A;  2IA6 A;  3UD4 P;  2NZ4 A;  1IKX B;  2R7R A;  4F25 A;  4DL4 A;  5DGB A;  3NNC A;  4DL0 C;  3MCS A;  5GAH U;  1QE1 A;  2KTQ A;  2C2E A;  1RT3 A;  1JKH A;  4ZP6 A;  5HK4 A;  4RZR A;  2HQD A;  1NKB A;  1KD1 T;  3A12 A;  2AWZ A;  2HWT A;  1UVK A;  3W62 A;  2MXY A;  3C2P A;  3OHB A;  1XK8 A;  4A47 A;  3BBF A;  5M2U A;  1HQ2 A;  4U6P A;  2B9E A;  1GXL A;  3GJT B;  1RHU B;  3I5C A;  3BGU A;  2NUH A;  3IS9 B;  1XJW B;  4NX9 A;  3MED B;  1LFW A;  2NUU G;  3MMC B;  2UUA J;  3OTB A;  3AA9 A;  2DEI A;  4DV7 J;  1S99 A;  3W2W B;  2HHQ A;  3GYX B;  5KG1 A;  4ZN1 A;  3R3T A;  3C6T A;  5KFW A;  4URQ U;  2PA8 D;  5KFI A;  4JI4 F;  4JYA J;  2KI2 A;  4DR2 F;  2V68 A;  4TU8 A;  1KVJ A;  3VQT A;  3W65 A;  2EFG A;  4J9S A;  2IRY A;  3VZH A;  3K8W A;  1U24 A;  3W66 A;  7FDR A;  2Q43 A;  2DPI A;  4Q0B B;  3ZC4 A;  1TUV A;  1XWL A;  2Y1I A;  1NJI T;  5I42 B;  5FII A;  2XY6 A;  2KXH A;  2V8H A;  1ZM2 A;  2XNR A;  2G13 A;  2DHS A;  3TEG A;  2ZVS A;  1S1T A;  3G82 A;  3OSN A;  1E6V B;  3I55 S;  4DUY J;  4J9Q A;  1P1L A;  2R8G A;  1FHT A;  4X84 A;  2QTW A;  4Y2I A;  1WHW A;  2MZS A;  4LF9 J;  4CO3 A;  4AQY J;  3LP1 B;  4I0W A;  1RT4 A;  1RBL A;  2AJ4 A;  1S1X B;  4DUT A;  2CPY A;  5BYQ A;  2KL8 A;  4F26 A;  1NK4 A;  3VR1 A;  2JNJ A;  4RU9 A;  5HQM A;  2JH3 A;  4PPD A;  3MM6 A;  2I5J A;  2ZE2 B;  1MWZ A;  4QYZ J;  3KWM A;  2GIR A;  3D6H B;  3RBE A;  3EZU A;  1X60 A;  4Y2A A;  2YNF B;  1V5V A;  1PAU B;  4NCA A;  2R4F A;  1RBO B;  2RKI A;  3IXQ A;  4DN9 A;  3P3D A;  3LP0 B;  2PN6 A;  4EMD A;  3PO4 A;  1YWX A;  4MKB A;  4QBU A;  5CH7 B;  2KU7 A;  3OQ2 A;  4A46 A;  4CDI A;  1RU1 A;  4JI2 F;  1JLF B;  5H1S V;  4AMO A;  2QV6 A;  1VQS A;  1NLK L;  4OL8 A;  3CXC R;  1N0U A;  2WVF A;  4RW9 A;  4JI8 F;  4QWE A;  1XER A;  4RR5 A;  3MTK A;  4MKA A;  1BWV A;  3PKM A;  2W4D A;  1FX4 A;  2LKZ A;  4DCJ B;  1O6X A;  3KK2 A;  5U47 A;  2XGQ A;  2AZ1 A;  1S6Q A;  1QTN B;  2KVQ E;  3MPY A;  2H5I B;  2ACY A;  1T11 A;  5KG6 A;  5IWA F;  3UI3 A;  4R25 A;  2V34 A;  1UFL A;  3I31 A;  3OVB A;  3N4W A;  3LH2 S;  2YNG A;  3TX0 A;  2MQQ A;  1IM6 A;  3VZI A;  5JVH Q;  1GNK A;  4EYI B;  3UPF A;  1JLG A;  5E2Q A;  2F4V J;  3KJN B;  3OHA A;  1IKW B;  2QC3 A;  3PX4 A;  5LSO A;  2NXU A;  3R5J B;  1UWB A;  2ALY B;  1U2C A;  3DDN A;  2KT3 A;  3GCW P;  1D8Z A;  4JI6 J;  3OTE A;  2M70 A;  4PWU A;  5D77 A;  3M2R B;  1VQL S;  3CCQ S;  2AX0 A;  2CYY A;  4J9M A;  3AOC A;  2WSF C;  1WEL A;  4R5P B;  5KFM A;  2ZHA A;  3MEG B;  4NXN J;  4EK2 A;  2OKQ A;  1HW9 A;  3ZFV A;  4PUO B;  1U6B A;  2NRE A;  2IYG A;  4YME A;  4WKR A;  1S4F A;  1RA6 A;  1X5O A;  4YOE A;  1SV5 A;  4GKJ F;  2FC8 A;  2P5V A;  4ZHR B;  3SV4 A;  1N8R T;  3OVS A;  1T03 B;  5A8K A;  1NKC A;  1RTH A;  4DR6 F;  2DRB A;  4IR1 A;  4KC5 A;  4M5L A;  2IY5 B;  4F02 A;  2W7O A;  1U45 A;  4CO4 A;  1NJY A;  1YJN S;  5F8J A;  1F5B A;  1TZ0 A;  2A2C A;  4NXM F;  1ZET A;  3O44 A;  2HGM A;  4ZPW R;  3DLG A;  2QGF B;  5IFM A;  2VQE J;  3UCU P;  5B7W A;  4GO5 X;  3R2C J;  2BJ9 A;  1ZYQ A;  2HG4 A;  3M4X A;  4FZV A;  2IC3 B;  4L72 B;  3RJM B;  3T1H F;  2KM8 C;  4PXE A;  1NHK L;  1LQ9 A;  2AD9 A;  3KLH A;  5D0H A;  4ZVP B;  1F9H A;  3TOQ A;  2NPF A;  5LJ5 Y;  4TKT A;  3TNV A;  1MW7 A;  4L74 A;  3BQ2 A;  1ACM B;  1RI7 A;  1GMW A;  1YHQ S;  2LFV A;  1QSS A;  5IZH A;  3W9H A;  2YY3 A;  2GVZ B;  2F4F A;  2XZT B;  1HBM A;  2GHW A;  4ALZ A;  1VRT B;  2KFZ A;  2LEA A;  3MF5 A;  4O44 B;  2FJB B;  3KLV A;  5DQH A;  2GC8 A;  2R3V A;  2ABY A;  3HT3 A;  2LQJ A;  1L3U A;  2NCK L;  3QGI A;  4M5I A;  1HI1 A;  2AJF E;  4FYV B;  4ZVF A;  3GZ7 A;  3I4H X;  4D3G A;  2A0F B;  4LF4 J;  5DQI A;  3MGJ A;  2YH0 A;  1SIZ A;  1OWX A;  5HMX A;  4O0I A;  1H73 A;  3VVU A;  1D09 B;  1HWI A;  1Y5L B;  2XWY A;  5EX0 A;  1SH3 A;  1QAX A;  1F9F A;  4KKO A;  4WYL A;  5I3Q A;  5KFP A;  3OR2 A;  2AYE A;  4ED3 A;  2GML A;  3N6M A;  4IDK A;  4RPF A;  1KQK A;  1HL6 A;  1DLO B;  1L3S A;  4MIB A;  2J6U A;  4OFZ A;  2MQO A;  2Z2M A;  3FNN A;  5KFG A;  2H1Y A;  4C0O C;  3B54 A;  2JEJ A;  4B17 A;  3IC1 A;  3EXY A;  1N36 F;  2M7S A;  1VBK A;  3RG6 A;  1YG0 A;  1WC4 A;  2QL9 B;  2B51 A;  2DPJ A;  2ADB A;  5CYM A;  3KNG A;  4NLY A;  1C0U B;  1SPB P;  4O0N A;  2HHH F;  1VRU B;  2IVY A;  1HHQ A;  8AT1 B;  3J81 j;  2ADC A;  3VAI A;  1I3O B;  1UPP A;  1FI4 A;  1NDL A;  2QIF A;  3TJ8 A;  3DGV A;  3A3O B;  1X4B A;  4EFA C;  1QY7 A;  3NP5 A;  1WEY A;  4DL5 A;  3PJX A;  5DDO C;  2GZO A;  4GO7 X;  1VRQ C;  2MY7 A;  4W92 B;  2OGU A;  1DAR A;  3CCM S;  2RIJ A;  4PWW A;  4NLO A;  3HSG A;  3CJ8 A;  3PJ9 A;  2UUC J;  3CDA A;  4XTT A;  2X1F A;  4IR9 A;  5T7L A;  5KOX A;  4QR1 A;  4PEO A;  4KYZ A;  2E7X A;  1NCL A;  1OPI A;  3IM9 A;  3SSR A;  1IWG A;  1HA1 A;  4USV A;  3DHX A;  1FKP B;  2QLJ B;  1PAE X;  2HND B;  2J9D E;  2ZJR Q;  4I1T A;  3CDE A;  1T7P A;  4IRD A;  3W1Y C;  4JI7 J;  3VAJ A;  1CVJ A;  1HBN A;  4DV3 J;  4TY8 B;  1T95 A;  2HHS A;  5E33 A;  4B3R J;  4UOH A;  4QYR A;  1B7Y B;  2F1F A;  2L9W A;  4PG5 A;  5ETM A;  2XC9 A;  2RDD A;  5BXI A;  1NND A;  3K17 A;  4LF8 J;  1N6Q A;  5C25 B;  2DHA A;  3W2V B;  4WIQ A;  3AJ1 A;  2VFR A;  3SYZ A;  2CJB A;  5J2P B;  1S1W B;  5KT2 A;  2PII A;  3EZ5 A;  4DV0 J;  1QVF R;  1C0T A;  2V6A A;  3T41 A;  4U67 Q;  4DSK A;  3R1L A;  4Q2M A;  2CAJ A;  3D7S B;  5AXM A;  1QSY A;  1S4E A;  1UJ5 A;  4MT1 A;  5KFC A;  4ATN A;  4BLG A;  3PW7 A;  1R43 A;  3G6Y A;  2WK4 A;  4J91 A;  4H4K A;  1V9O A;  4CQ1 A;  4ED1 A;  3EM1 A;  3EZO A;  2AGQ A;  1FFW B;  4AD6 A;  4P9S A;  3KDO A;  2QN6 B;  2N7C A;  2ZH5 A;  4WZM A;  4DJB A;  3VCD A;  4WFN Q;  4CLL A;  2GO8 A;  1REG X;  1BY9 A;  2HK3 A;  2YNI A;  3U02 A;  4EBE A;  4DCP B;  1JLQ B;  1RP5 A;  4DL3 A;  4IUF A;  4HKQ A;  1TEL A;  3BQ1 A;  2XMK A;  3SDE A;  4CCH A;  1HYS B;  2AEM A;  1Z1Z A;  2LMI A;  4LMZ A;  3SV3 A;  4NCB A;  3SCJ E;  4CYU A;  4RNO A;  5LOQ A;  3POT B;  4KH1 B;  4U96 A;  3CCS S;  2DGO A;  2DNR A;  1IR2 A;  4DZ6 A;  2D3Z A;  3HP6 A;  2AZ3 A;  1NEE A;  1HQU A;  3MM7 B;  4QPX A;  3BSC A;  2ZIT A;  3QGP A;  4Y3C A;  3JSB A;  4DOZ A;  5KT5 A;  1H7W A;  4DV6 F;  4OX9 F;  3FEZ A;  1NK0 A;  2K1R A;  3T19 A;  4UST A;  5CAB A;  2MKS A;  4F4A A;  1D9A A;  4OLO A;  3L7U A;  3ELH A;  2E7V A;  3BSA A;  2PGC A;  1DTT B;  2LQB A;  4E2F B;  2JC1 A;  3R5C A;  1OQ6 A;  3J7Z 5;  2M8D B;  2J7U A;  1C4A A;  3AXK A;  4GC7 A;  4I2Q B;  4J9R A;  2RS2 A;  4Q5V A;  1IQZ A;  4U9R A;  3VHQ A;  2BAN B;  2KXF A;  1H0H B;  1HWL A;  2IDL A;  4C97 A;  2Z57 B;  4NML A;  3I0R B;  1RWP B;  4B9T A;  2RH3 A;  2V50 A;  3DNC A;  3OR1 A;  2IDE A;  3WDO A;  1U02 A;  2UUB F;  2B3T B;  1DZ5 A;  3M30 B;  1M5O C;  1FVS A;  3S6E A;  1DTQ A;  2QSF A;  1TL1 B;  4RNF A;  3D5M A;  5HN0 A;  1H2U X;  1RTI B;  2W24 A;  1PO6 A;  3NMR A;  4DX5 A;  3KMS A;  2LEP A;  3OFH A;  4A8K A;  1RTJ A;  2B6A B;  2R2T A;  4DV2 F;  1NK9 A;  2FB0 A;  3J7A 1;  3Q8Q B;  3M6V A;  5B0C A;  2CQ3 A;  3T9Z A;  3QGH A;  3AT1 B;  1EET A;  1A9N B;  2YVS A;  3UO0 A;  1WF1 A;  4AXI A;  4KHP F;  1HNX F;  1YGY A;  1SXL A;  3KLI B;  2VPX B;  5CYQ A;  2GQQ A;  3OXF A;  2B4P A;  3M2U A;  1HQE A;  4CLZ A;  1FE0 A;  2Z2Z A;  2QLX A;  1Y5N B;  3NS6 A;  3KUE A;  1X5T A;  2DR8 A;  4TYB A;  5F8N A;  3DRR A;  3NBP A;  3BR8 A;  1SL1 A;  2HNY B;  4ZPA A;  1U1M A;  1DAX A;  1Z4U A;  3J7A N;  3G4S S;  5LMN J;  1VR6 A;  4H4M B;  2BJ8 A;  4ZCM A;  3Q24 A;  5GAG U;  3MAA A;  1RCX B;  3IWL A;  3SZ2 A;  2ZJQ Q;  1RT1 B;  4RW8 B;  1T9T A;  4UF4 A;  2Q6B A;  1HBO A;  4M94 A;  4OJG A;  2MB0 B;  3IWN C;  2JVR A;  1FJ7 A;  4LRC A;  1GXT A;  2YQ3 A;  1RAA B;  2VUG A;  2KHC A;  4ZVR B;  1V3Z A;  1RAC B;  2OEK A;  2MHN A;  4OYW A;  4JI4 J;  5D3G B;  1AUS L;  4I4B A;  2QYC A;  3JB9 k;  2RIL A;  4IOA Q;  4Z7Y A;  1F3F A;  3HFV A;  4QPT A;  2Z56 B;  1A6L A;  1SJ4 P;  4GVL A;  4EEY A;  2Y1L B;  2EXU A;  4YP3 A;  1UMJ A;  2B7B B;  3GJR B;  2C3O A;  3D1Q A;  1TKZ A;  2XY7 A;  4L76 A;  4K4V A;  2C3U A;  3R1H A;  2BE2 A;  1F60 B;  3TZY A;  4HHU A;  1VHF A;  1VJW A;  3HD1 A;  3SFU A;  3L9Z A;  3GMG A;  3SEO A;  5JUM A;  3HX9 A;  4DFM A;  3M6U A;  2VZ9 A;  3MCM A;  4NLQ A;  3Q0A A;  4NMX A;  4K2J A;  1U47 A;  1RK8 A;  2P9E A;  4OV6 A;  2EEY A;  3W63 A;  4ED4 A;  4K7Q A;  4NCG A;  4K0K F;  5HMZ A;  1RGV A;  4PYA A;  4LQ9 A;  1FJG J;  2HWH A;  1YBU A;  2DB1 A;  3JAM U;  1M1H A;  4O3N A;  5K14 A;  3A8J A;  3DFE A;  3JSR A;  5DO2 A;  3DOK B;  4ERD A;  3M9N B;  1N54 B;  5IV4 A;  2A3J A;  2GGP B;  4X4O A;  2DTJ A;  2DY9 A;  4USW A;  3CCV S;  1UZH A;  4ZVE A;  2FGO A;  2HQG A;  2J9E A;  2V2K A;  4QZV B;  5EDW A;  1FRH A;  1EKS A;  1YBA A;  1F1B B;  2OPS B;  1GT8 A;  4DWI A;  5GAD U;  2CPX A;  2FQQ B;  2DH9 A;  4XDD A;  4V19 X;  1HW8 A;  1VQY A;  2GHV C;  4MFB A;  2NR0 A;  4HT7 A;  3C15 A;  2VC1 A;  2DR9 A;  4ES3 A;  1KTV A;  2CZ4 A;  5HP1 B;  2BKP A;  1OMS A;  4BHQ A;  4CH0 S;  3D0I E;  2GVD B;  3QRP A;  1PYS B;  3CMA S;  4TU7 A;  1TL7 B;  3R7B B;  1FXR A;  2RHQ B;  3D1H A;  5L8R C;  1RSC A;  4L73 A;  5ETV A;  4XDC A;  2C1E B;  2E1P A;  2HRY A;  3IBC B;  1VC6 A;  2K06 A;  2XI2 A;  3K5M A;  2DNZ A;  1CJK A;  1XIQ A;  2BRK A;  3GR1 A;  3H2U B;  2VIC A;  1I6J A;  1PJ6 A;  1GTH A;  1L5U A;  1S77 D;  1TKD A;  1BWE A;  5L1I A;  1RT7 B;  4WU2 A;  2HEK A;  3L4B C;  2AJ1 A;  4NLW A;  3CGI A;  2YKP A;  3RAX A;  3VQS A;  2MZR A;  3EE3 A;  2WON B;  4CLU A;  3HT0 A;  2V2V A;  1U1O A;  3RBX A;  1FTC A;  2A6M A;  3HUL A;  3H5X A;  4WP9 A;  2B5J A;  3MM8 A;  3BB5 A;  5F41 A;  3CB4 A;  1IQT A;  3IRW P;  2HYI B;  3PX0 A;  3V4M A;  1XNQ J;  5CAA A;  1GMW D;  3Q89 A;  3TUZ C;  5IT9 Y;  4WF9 Q;  2R7V A;  5IOL A;  1VIO A;  4YHH F;  1WSR A;  2WOM B;  3MOJ B;  1GK8 A;  3U27 A;  3GV7 B;  1L3K A;  1FA0 A;  4ZLP A;  3ILL A;  1O5J A;  4KGX B;  3VAH A;  4CLK A;  3KK3 A;  4GRS A;  3H42 A;  1RT6 A;  2AF6 A;  3LF0 A;  4ZCK A;  1LK5 A;  3Q2S C;  4J7C A;  2CAD A;  1N32 F;  1LWC B;  4ZOS A;  4UUX A;  3EGV A;  3BGR A;  3HI9 A;  3ZTQ A;  4RBU A;  3L7O A;  3X1L B;  4JV0 A;  3MED A;  1XR5 A;  4K4Z A;  3MDF A;  3PFE A;  3UN2 A;  1ZAW A;  4KY3 A;  5EN1 A;  1U0H A;  1YRT A;  1UW4 A;  3H5S A;  3TQ1 A;  1N5S A;  1EP4 A;  1IBC B;  5DG8 A;  4RO0 A;  3CD0 A;  2KG0 A;  4LSL A;  4P2X A;  4Q0B A;  3QNW B;  3UDC A;  4CZC A;  5I42 A;  3AB4 B;  4DV5 F;  5K8O A;  1RAG B;  3OW2 R;  3DM2 B;  2W2O P;  4I6A A;  2X1G A;  2KO1 A;  2CQB A;  5LXY A;  2BDP A;  1FDN A;  3IFE A;  3ZZZ A;  2W9A A;  1MG7 A;  2XWX A;  4LQ3 A;  2CPF A;  4NI2 B;  1E6V A;  2FD2 A;  1GH8 A;  1OPZ A;  5L1L A;  2DJW A;  4WFZ A;  2UVU A;  1WKK A;  2ILZ A;  4OHY A;  2M52 A;  4FF4 A;  2E5L F;  4ANE A;  3D68 A;  5H9E J;  4JI0 J;  1AA1 B;  1RWN B;  3DRS A;  4K5S A;  3EPG A;  3A8E A;  1RT3 B;  3PW2 A;  1JKH B;  4NLR A;  3WIV A;  3GSI A;  4QQB A;  3UE2 A;  2NLW A;  4OI1 A;  1IBM F;  4F4Y A;  3PEH A;  1SJF A;  4X62 J;  3Q2T C;  3TR5 A;  2NPI A;  1NB2 A;  3EVM A;  5HVH A;  2M8H A;  1TKX A;  2H51 B;  1FD8 A;  2B56 A;  4KPC A;  1AFJ A;  4ELV A;  1KC8 T;  1N52 B;  3TAM A;  3C6T B;  4CT9 A;  4OYA A;  5KAK A;  1JLF A;  3TYT A;  3EPI A;  1RXO B;  3BPS P;  1LV5 A;  3AOA A;  3MMA B;  2ZUA A;  2FJD B;  4ECQ A;  5KFV A;  4DSF A;  2CQH A;  4FYW B;  3AQP A;  4HI1 A;  2DR6 A;  2ZBI A;  2H4Y B;  2KB2 A;  2BE7 D;  4CO1 A;  2OO4 A;  4IRC A;  3CO0 P;  4OX6 A;  1U25 A;  4LR7 A;  3IWX A;  3G82 B;  4B3T J;  2IYI A;  5B0A A;  2AGP A;  3MUT P;  4YY3 F;  1B4S A;  1G1X A;  5A8W B;  1H74 A;  4ZLL A;  2GJ2 A;  3DHW C;  3BBB A;  1WF0 A;  2RQ4 A;  4F4Z A;  3OL8 A;  2XSF A;  1RT4 B;  2FHM A;  4IFY A;  4U8Y A;  2YWF A;  4XIU A;  4B9M A;  1JJ2 R;  1UEV A;  4CP5 A;  2ZWP A;  3V6J A;  2IPO B;  2JOQ A;  4G65 A;  4Y34 A;  2IJN A;  2HZV A;  1Y11 A;  1SIW B;  3MM6 B;  2I5J B;  4F4K A;  1FEE A;  3ZZO A;  1JWW A;  3BN7 A;  5KFH A;  1CPZ A;  4J9N A;  3T5J A;  4DR7 J;  2BOA A;  2RF2 B;  3EGZ A;  2VPW B;  4XPE A;  2LEC A;  2RKI B;  5E3C A;  5G4D A;  4PAA A;  4LFC J;  1P1T A;  2XEX A;  1HBU A;  4KE5 A;  1BGX T;  1VJQ A;  4NL5 A;  4B3S F;  3D2W A;  3DXB A;  1Q7L B;  2R7S A;  3W3S A;  4Z7C A;  4Q43 A;  3HFZ B;  3HHL C;  2JFD A;  2CDQ A;  2QLF B;  4OI0 A;  4IRK A;  3RR7 A;  2OHD A;  1D9F A;  3ETM A;  2NXC A;  3KK2 B;  2R2S A;  1GTE A;  1CC7 A;  2I9S A;  4FS2 A;  3RB0 A;  1T03 A;  1GAO A;  4QWD A;  2JX2 A;  4FDF A;  4DR3 F;  1U1P A;  2P6S A;  7AT1 B;  1Q8K A;  3HHN B;  4RUC A;  1RT2 A;  3MCO A;  2HHT A;  5E5N A;  3WBZ A;  2IM2 A;  2G1D A;  1TL3 A;  4X64 J;  3UCG A;  2YNG B;  1FWL A;  2LA4 A;  1AYE A;  1NB7 A;  1O8B A;  4Y2M A;  2GMH A;  1JLG B;  2N4C A;  4J9O A;  4ZVH A;  4OZL A;  4DF8 A;  1UWB B;  2Y0B B;  2KYX A;  1YZ6 A;  1WAC A;  2KN4 A;  2K8G A;  2CWX A;  4UW2 A;  2W4P A;  4W98 A;  5KFF A;  4ZP8 A;  2CPZ A;  8RUC A;  2YPZ A;  2A10 A;  4ECX A;  3LTO A;  3WC2 A;  5K8N A;  1LXN A;  1XMO J;  1EJ7 L;  4WFX A;  5AXN A;  1QD1 A;  5ETK A;  2G2Y A;  2CVI A;  5F8G A;  4OJ1 A;  3T6J A;  2ZNY A;  1VRT A;  5E3Q A;  1TR0 A;  2KYZ A;  5LT5 A;  3C14 A;  1KVI A;  4PWD A;  4UY8 5;  5DRK A;  2VFU A;  2CPE A;  2CUY A;  1WTB A;  2FHJ A;  5A8K B;  1DQ8 A;  1RTH B;  3GJQ B;  1PJ7 A;  1VI7 A;  5KT7 A;  3LWL A;  2D9O A;  2CNK B;  4DR4 J;  2YKM A;  3CED A;  5D6G A;  4NLV A;  1SKW A;  1UVM A;  4KJI A;  2ZBR A;  2G4B A;  4M5D B;  1P27 B;  3BRE A;  3MM5 B;  4C8L A;  4NZ6 A;  2LQ8 A;  2DNO A;  2K2P A;  2RHS B;  3DLG B;  4FBU A;  2B4O A;  4WK1 A;  4JI5 F;  4ZPV R;  1WI8 A;  2E9T A;  1KN6 A;  1DLO A;  1CJV A;  1Y00 A;  2D41 A;  2E5H A;  2FYX A;  3M2V A;  4LSZ B;  4KT0 C;  4LF1 A;  4WXO A;  5D8H B;  2D7S A;  2HUR A;  3B4D A;  4R0E A;  4C48 A;  1HIY A;  1KEK A;  2HQ3 A;  3M8R A;  1MU2 A;  1PGZ A;  2KDO A;  2D9P A;  2RJZ A;  3E8O A;  5KFZ A;  3UDE A;  4EZ6 A;  2YWG A;  3JSY A;  2X3D A;  2MKY A;  3M32 B;  2BAB A;  1NHU A;  4W90 B;  3C3L A;  4OIX A;  3OLB A;  1CEZ A;  4Y2C A;  4ED0 A;  3SCI E;  4F0M A;  3PEJ A;  1J27 A;  2EG1 A;  2KVI A;  4TQS A;  5KG0 A;  1K1S A;  2E7W A;  2UXB J;  2EG2 A;  3FRZ A;  5KFQ A;  3D1O A;  3P45 B;  5AE1 A;  1KFS A;  2J6T A;  5IV3 A;  3AAW B;  2YX7 A;  2HHP A;  3VGS A;  2FJX A;  3DCA A;  1H2V Z;  1LWF A;  4OV1 A;  2V69 A;  5F8I A;  1NSQ A;  4KKO B;  3CJ3 A;  3AY0 A;  4ZJQ A;  3OR2 B;  2RAQ A;  4X4N A;  4MKY A;  4MYT A;  4F3Q A;  4HVZ A;  4N47 A;  4DPX A;  5D4L A;  4RJV A;  4AMP A;  1IJF B;  1KNZ A;  2RS8 A;  3QQC D;  8ATC B;  3DYA B;  1A7G E;  1PYT A;  5J2N B;  2BKN A;  2ALZ A;  3KUG A;  4TY8 A;  5KFO A;  3MR6 A;  2G2Z A;  5I3U A;  3TVY A;  5A0Y B;  1FE4 A;  4RKU C;  1VBY A;  4URG A;  1QAY A;  3K5L A;  3CIM A;  4O4R A;  2Z58 B;  4FN5 A;  2O3D A;  4ZVT B;  3G2X A;  2ZC4 A;  3NWG A;  2QMW A;  1QSL A;  4GKK J;  4JI3 J;  3T5H A;  3O6Q A;  2NXE A;  3NCP A;  2DIU A;  4QR0 A;  2M2B A;  5J2P A;  3HPO A;  3DDI A;  7FD1 A;  1S1W A;  3J80 Y;  1JJC B;  5IM0 A;  3IMQ J;  3DLJ A;  1U6Z A;  2LA6 A;  4FYY B;  2B9W A;  2JZ5 A;  1IKY B;  2GIQ A;  2PI5 A;  3IAM 9;  2CA9 A;  2NSB A;  3L3C A;  2JLE A;  3HHD A;  3K2Y A;  2HIQ A;  3HJF A;  4DX8 H;  3GR0 A;  2DR7 A;  2A1B A;  1B70 B;  2HFU A;  4CM0 A;  4XAK A;  2ZBC A;  1IWA A;  4PXC A;  4OLP A;  5D78 A;  3SBM A;  2ZOG A;  3WIU A;  1I51 B;  1KWM A;  3RRH A;  4DQP A;  4O4G A;  1CSJ A;  2ZOF A;  2F65 A;  3P5B P;  2F3J A;  3FBC A;  1UJ4 A;  2VH7 A;  1HD0 A;  1NK5 A;  1HKA A;  1S6P A;  4YN3 B;  4O3S A;  1TV6 B;  2VU5 A;  1U1R A;  4I67 A;  1G3O A;  4O23 A;  1HNW J;  4N76 A;  1HBN B;  1PG5 B;  2CPJ A;  2BYC A;  1FKA F;  1FWP A;  3H59 A;  1HYS A;  4YEA A;  1LWE A;  4UOG A;  3D3C J;  1N6Q B;  2VJV A;  3ENQ A;  1FFS B;  3IGN A;  4RLE A;  1WEZ A;  2HMI B;  3POT A;  4YDD B;  3MI7 X;  3DRY A;  3W61 A;  4OX8 A;  1IBK F;  5KG5 A;  3GFH A;  4G3I A;  4MKV A;  5F3T A;  3OTO J;  3BM7 A;  4X66 J;  4XK8 C;  2JEG A;  1C0T B;  5GAG I;  1HHT P;  2E1C A;  2B43 A;  2MZ1 A;  1IN0 A;  4A48 A;  3UNG C;  3FSY A;  4DFP A;  2VG6 A;  1N33 J;  5H9F K;  2MJU A;  1O51 A;  2ZFH A;  1ZM9 A;  3BH7 B;  3HF5 A;  1IUJ A;  2UXD J;  3UCZ P;  4Q7A A;  4I2Q A;  4G1I A;  5GAE U;  4CH7 A;  3R27 A;  1M5S A;  2U1A A;  4ZVO B;  2POK A;  1RUS A;  3FRY A;  4A8F A;  3IG1 A;  2C2O B;  2VDH A;  4LRF A;  4NEY A;  4NAS A;  4ZVQ B;  4M5K A;  2YNI B;  4C8O A;  2QLB B;  2VG7 B;  2XS2 A;  1PBA A;  3TX8 A;  3LPE A;  4FXV A;  3SDE B;  3DOL A;  5ETP A;  5CZV A;  5I3P A;  2BR0 A;  3ONQ A;  2WVB A;  4CYU B;  4LVO P;  4PG4 A;  3EX7 B;  3O1L A;  3K57 A;  4NYP A;  2QG9 B;  3NS5 A;  1IBL F;  3IN5 A;  2MMY A;  5KG7 A;  3CF5 Q;  3F0N A;  3M8Y A;  2CZV C;  3C8Y A;  4F3M A;  4LVN P;  1TKT A;  5ETL A;  4QYZ K;  1F5C A;  4RWX A;  3FBE A;  3UNY A;  2R7W A;  1UVJ A;  3VWS A;  2Q1L A;  2DGU A;  3G8Q A;  4YHH J;  2ASL A;  5DGA A;  1JXL A;  4DI6 A;  1VFJ A;  3M6W A;  1KVK A;  1DBD A;  3NGD A;  4OQJ A;  2XS5 A;  4ECV A;  2UP1 A;  5L46 A;  5J1E A;  4YUD A;  3KLF A;  4BDP A;  2HVH A;  1FDB A;  5E3R A;  1M5P C;  1HNV A;  2F40 A;  1WOS A;  1N32 J;  1T9V A;  3Q8U A;  4H4M A;  5KG4 A;  3BO4 A;  2LU2 A;  3PIP Q;  4RW8 A;  2YKN A;  1M1K T;  1T94 A;  2DNY A;  4DR1 F;  2DGT A;  1DTQ B;  1VK8 A;  2RRN A;  4TVA B;  4ETX A;  3Q8P B;  1X0F A;  4HLB A;  4O3O A;  3V6D A;  1PC4 A;  2ZDP A;  4QU7 A;  2QEX S;  1RTJ B;  3FEX B;  3ADA C;  4IOC Q;  3IBW A;  5IQ6 A;  3KHH A;  4IQX A;  4CWB A;  1FRX A;  3PYG A;  2OPP A;  4C98 A;  3RU0 A;  4MMO A;  4ZDN A;  4NLD A;  2J9C A;  4AT1 B;  4DV5 J;  4DCO B;  4LBH A;  4IG3 A;  3CE8 A;  2J0W A;  5CYQ B;  2HK2 A;  2GA7 A;  1S0V A;  3M2U B;  4LUB A;  1BD6 A;  4QOT A;  1FES A;  1Y5I B;  2VFT A;  2KFY A;  1NJW A;  3DRR B;  3NBP B;  4KBI A;  3QSY B;  2J9D A;  3HZG A;  5KFY A;  3ZZY A;  1EIY B;  3TJA A;  4NZ7 A;  4DU8 A;  1VC0 A;  1Q86 T;  3HSD A;  3BYR A;  1IBM J;  4ZIV A;  3UR0 A;  3JS9 A;  2XB2 D;  5ETQ A;  3MAA B;  2OEM A;  1UTA A;  4ZIT A;  1BC6 A;  2WAQ D;  2OPR A;  2VKR A;  4KQZ A;  1AZS A;  2QJ3 A;  4JI1 F;  4OI6 A;  2JSX A;  4A8Q A;  3W64 A;  2E1R A;  4ZIW A;  2DIT A;  4DV1 F;  1HBO B;  3EIC A;  4FXD A;  1PIE A;  2HNZ B;  1RTZ A;  1FK9 B;  1RWV B;  2KT2 A;  2J0S D;  3AXM A;  2H4W B;  2HFZ A;  2VQF J;  1ITP A;  1MSW D;  1C1C A;  3GIK A;  4NRU A;  1NRK A;  1NKE A;  3D3B J;  1BXN A;  4K50 A;  3W60 A;  3QWU A;  3BS9 A;  2CDR B;  3JSM A;  2KT5 A;  2I8E A;  1R6Y A;  6AT1 B;  2XUL A;  3UN3 A;  3FBB A;  3ITH A;  4WBF A;  2V9W A;  3BO2 A; 
#chains in the Genus database with same CATH homology
 5DZ6 A;  4RL1 A;  4RR5 A;  3R8Y A;  4QBU A;  2VZ8 A;  2C2N A;  3EZO A;  3CJ8 A;  3R97 A;  2VKZ G;  2QO3 A;  3TZX A;  2H1Y A;  3G87 A;  3TZZ A;  5CZC A;  2G2Y A;  3K89 A;  3SBM A;  2G2O A;  3TQE A;  3RGI A;  2VZ9 A;  2CUY A;  3H0P A;  3IM8 A;  3HMJ G;  3HHD A;  5CZD A;  3PTW A;  2HG4 A;  3TZY A;  2PFF B;  3TZW A;  1NM2 A;  2JFK A;  1MLA A;  5DZ7 A;  2QJ3 A;  2JFD A;  2G1H A;  2QC3 A;  3IM9 A;  2G2Z A;  2UV8 G;  3BV8 A;  3HJV A;  3QAT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...