3IM8A

Crystal structure of mcat from streptococcus pneumoniae
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
305
structure length
305
Chain Sequence
b'KTAFLFAGQGAQYLGMGRDFYDQYPIVKETIDRASQVLGYDLRYLIDTEEDKLNQTRYTQPAILATSVAIYRLLQEKGYQPDMVAGLSLGEYSALVASGALDFEDAVALVAKRGAYMEEAAPADSGKMVAVLNTPVEVIEEACQKASELGVVTPANYNTPAQIVIAGEVVAVDRAVELLQEAGAKRLIPLKVSGPFHTSLLEPASQKLAETLAQVSFSDFTCPLVGNTEAAVMQKEDIAQLLTRQVKEPVRFYESIGVMQEAGISNFIEIGPGKVLSGFVKKIDQTAHLAHVEDQASLVALLEKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Malonyl acyl carrier protein transacylase
publication title New design platform for malonyl-CoA-acyl carrier protein transacylase
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Transferase
total genus 109
structure length 305
sequence length 305
ec nomenclature ec 2.3.1.39: [Acyl-carrier-protein] S-malonyltransferase.
pdb deposition date 2009-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00698 Acyl_transf_1 Acyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.250 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Malonyl-CoA ACP transacylase, ACP-binding 3im8A02
3.40.366.10 Alpha Beta 3-Layer(aba) Sandwich Malonyl-Coenzyme A Acyl Carrier Protein; domain 2 Malonyl-Coenzyme A Acyl Carrier Protein, domain 2 3im8A01
2C2NA 3CJ8A 2VKZG 2PFFB 3PTWA 5DZ6A 2QJ3A 3RGIA 3BV8A 2QO3A 2QC3A 3HJVA 5CZCA 3TZXA 3SBMA 3TZWA 3IM9A 4RL1A 2G2ZA 2UV8G 2VZ9A 2VZ8A 3H0PA 1NM2A 1MLAA 2HG4A 2G2OA 3TZYA 3TZZA 2G1HA 4RR5A 2JFKA 2H1YA 3R97A 3EZOA 3G87A 2JFDA 3QATA 4QBUA 5CZDA 3HHDA 2CUYA 5DZ7A 3HMJG 3R8YA 3K89A 3IM8A 3TQEA 2G2YA
chains in the Genus database with same CATH superfamily
1DQ9A 2V69A 2WVBA 4PPZA 4DV5J 4ANDA 3SV3A 5HSPA 4JBCA 3MR2A 3ISND 2CADA 4KH1B 4C0OC 4DX8H 1QE1B 2ATCB 4HT7A 3GIMA 3TZXA 3ZZYA 3L7PA 4JV5F 2RQCA 3HO1A 2GCFA 4O3NA 3CIZA 3O6QA 5KFQA 1RDRA 3DN9A 1H2VZ 1QTNB 5KT3A 2OUGA 4YP3A 3THTA 5HQMA 2V4JB 1NSAA 5IXUA 2RDDA 4PRFA 3KG1A 3EICA 4R0JA 4RBTA 4DWIA 2FVPA 2IHR1 4Z7CA 1OPIA 2DGOA 1TU0B 3HULA 4TY8B 2XBPA 3PYEA 4NLSA 3KJNB 5T14A 1NDPA 1PO6A 3HHEA 3LAKA 2DGTA 2LQJA 3Q22A 3BDEA 1X31C 1X0FA 2ZH5A 1SC3B 3X3UA 3NNAA 4DR5J 2BE9B 4ZPDA 2IM0A 1XNRJ 3UD5A 4LFBJ 2MZQA 1MROA 1CJTB 3IR7B 2HIYA 3PXGa 4ED0A 4NXNF 1UVIA 3ITHB 4QPTA 5CQGA 1S1TB 1J5EF 2ZJRQ 4GKJJ 3GONA 1RUSA 4RW9A 4X4NA 4WP8A 1AXQA 3MOJB 2HQIA 4CCHA 5GMDA 5E3CA 3DHXA 2NXEA 3D2WA 2OAUA 4JB8B 4Q2MA 1VK8A 4Q43A 3A3PB 5E3QA 3K5MA 5FIIA 4KY3A 5F8IA 4UOCA 3FBCA 1IN0A 4NLYA 4ZMMA 3WQPA 2ZHOA 2ADCA 4ICLA 1VR6A 4DSJA 4EZ9A 4IFYA 4Q5VA 3JAMU 3W65A 3EUNA 5D3GA 2EVZA 2G9OA 3HSGA 2W2NP 1IR1A 2Z2LA 3GIKA 4NX9A 2R4FA 3V6KA 2HHWA 4X4SA 3QT8A 1RAGB 2CFXA 4X4UA 2BJ9A 3FRZA 4IH6A 1JLGA 1BY9A 4E2FB 1V3RA 1WJ9A 2DD8S 2RDJA 1F5CA 4JV1A 1ZTTA 1VQ7S 5A2QU 4DU7A 2Z30B 4NE9C 3TEGA 3IM9A 4DZDA 1WACA 2DNMA 2YVSA 2V2QA 4DV0F 4DN9A 2BDPA 3FC9A 1KOHA 3NGTA 4HACB 3AHPA 4ZPVR 1Y4ZB 1XMQF 3GWCA 5CCLA 5DM7Q 2VG6B 4ILRA 2CQBA 2OFHX 3C16A 3QFHA 1N34F 3GMGA 2RS8A 1U1KA 1RYRA 5H1SV 1FJEB 1FRLA 1M1HA 2MGZA 4ZVRB 1KTVA 3EZ5A 4R8UB 5D0GA 2PEHA 1UA1A 1TMMA 4LF5J 2W7PA 4CT8A 3C3LA 1HNXJ 1OY8A 3N6MA 3R7BB 2HFVA 1FX2A 1VLOA 5KFMA 1LW2B 1S1UB 5J2PA 1JK9B 3PX6A 1U4BA 5U47A 3VQSA 2IA0A 4DPUA 3K59A 2C2MB 3CJSA 4HDHA 1EP4A 2J7KA 3WX8A 4F36A 4ZCIA 3JQKA 4MIAA 1OSCA 1JXEA 3F56A 1FE4A 2AX1A 1F9FA 4DSLA 4ZJQA 5HLFB 4PXCA 2VFVA 1ZBTA 1WEXA 4JI6F 2OPRB 1NK7A 4HYKA 2CPFA 2XYHB 3EXCX 4OHWA 1R0CB 2C2OB 2UV8A 4WK3A 4QR2A 1C0TB 1X5OA 2GMJA 4C3LA 2QEXS 1RU2A 1TFWA 1S77D 2QL5B 3HKWA 4HHHA 2FJVA 3N4WA 1U0HB 2C3UA 4ID5B 2GHWA 3D9BA 2MEWA 1Q4RA 1UL3A 2XZDB 4QYZK 2LXUA 2QN6B 1YJNS 1FTCA 3C15A 2J8SA 2FDNA 4HH0A 4J9QA 2GO8A 2YNIA 2CJXB 4DQPA 2W4PA 1JX4A 5A8WA 3HX9A 4WFYA 1S79A 2J9EA 3PR5B 2FHJD 4C8LA 1HNWF 2DR5A 3W5XA 5IV4A 4A8MP 2WB4A 1J5OB 1WDDA 4IDKB 1FK9B 4RW6B 3G8TA 4UW2A 1SL1A 1AA1B 4Y00A 5AE2A 2QSWA 4K50A 4MIBA 4OYMA 2HHTA 3J81j 1LEOA 1U6FA 4CI0B 3VF0B 1NHUA 4C8OA 1X9MA 4P7VA 2NCKL 3M6WA 2H4YB 2H51B 1XNQF 2K1RA 4AMMA 1HKAA 4W92B 4LT6A 1X0PA 3QGGA 1ZM9A 2JL9A 4U96A 4DS4A 1RXOB 2POKA 1LWEA 3DLEA 3KLEA 1BD6A 5C7PA 1FJCA 2L41A 2I2YA 5HN0A 3PACA 2JFKA 5IV3A 2XMWA 3FZ2A 3J7AN 5IT9U 1VLYA 5M2RA 4N47A 3R5BA 3F73A 1Q82T 3T5KA 3RRKA 4K8RA 5JUMA 3VGSA 3CDEA 4MKAA 2LU2A 5KFFA 3MPVA 3SV4A 3ADAC 2E9ZA 3OD2A 2VKZG 2BJ7A 3MURP 3K5OA 1YDLA 1HHQA 2YWEA 5J1EA 2KVQE 3KK3A 3NXZA 4BC9A 4N7TA 2ACMA 1LQ9A 2AP6A 5KFDA 3K8WA 1JXVA 1RHQB 1OY6A 1RJJA 3IC1A 1S57A 2F9DA 1F2HA 3BH7B 1FO1A 1HD0A 2QMXA 2CKWA 4DCOB 4F3QA 4ZHRB 1ICEB 5KT5A 1UEUA 3IR5B 1JLEA 1TUVA 2V68A 2CQ4A 3PX0A 1VQ5S 2JWNA 5J2NB 3FNNA 3PKMA 4PG7A 2R2SA 1K0TA 1WUUA 2DR7A 1QUVA 2GIFA 2Y1LB 4X4VA 2QYGA 4DV3F 4F50A 4WPAA 3RBZA 3P45B 1GK8A 4M5DA 5E0OA 2VB6A 2VL1A 3KJQB 4AD6A 3AJDA 4WFZA 3OTDA 3SQGB 3BBCA 2DO0A 1KQKA 2X1FA 2YWGA 4X64F 4FP9A 3MUVP 4R25A 4QIFA 2ADBA 2Y8WA 4NYZA 3FMBA 4F0MA 3MCSA 1TKDA 2KJWA 3OXGA 5JVGQ 3KYLA 4L3NA 2CZ4A 2BV3A 1B7YB 5KG5A 2UUTA 1UTAA 2IRXA 5KT7A 1PBUA 2AIRB 3VGVA 1HBNA 1JLCB 3DLGB 2ZH6A 3PHEA 1GH8A 2FLLA 1FCAA 4UTGA 2BRLA 5C5JA 4DI6A 2HHSA 5ITHA 5F3ZA 1EIYB 4DLEA 3E3XA 3NL0A 4DSFA 3MM6A 3DRPB 2KXFA 4ECVA 4TY9A 3CCWA 4USMA 3RW6A 5E5NA 3HP6A 4B3TF 2PMWA 3HVTB 3DNCA 4H4MB 3CT9A 3ILLA 3L3CA 1H6KX 2VDIA 1S9GB 1YJRA 1FA0A 1RHMB 4KHPJ 1KS2A 2HQFA 2YWFA 4F4KA 1MSWD 2MKKA 2G1HA 2CG4A 5CA5A 3HD1A 3VR1A 1X4DA 3H2LA 1QAYA 5K8MA 2KXHA 1JLAB 3V2UC 2LCWA 1S1XA 2LQ9A 5GAEI 3AOBA 2OIHA 3J7ZT 4AMOA 3UD4P 4O4RA 3T5HA 2FLOA 4C8ZA 4G1QB 2DEIA 3M30A 4FXWA 5J2PB 4PR6A 4LR9A 2LEAA 3PG9A 3CCMS 1WOPA 4F0KA 4NEZA 4LFCF 2FLNA 1EP4B 4IRCA 2B6AA 2J5AA 3TEHB 4WKRA 3MM7A 2YNGA 2ZD1B 2R42A 3C6TA 2D69A 4NLQA 4A8SA 4ER8A 3FBBA 3CJ8A 4IH7A 1IKYA 2YNHA 1U49A 4AXIA 1RCOB 3KUEA 3NY0A 2E5LJ 4PG5A 4HT5A 3AY0A 3GG0A 3MECA 1VISA 3LF0A 2DGXA 3VAKA 1HBUB 3SFGA 2I5JB 3TI0A 4EWTA 1Y7PA 1UEVA 4O4GA 1S0OA 4X66F 3GJSB 1OQ3A 3SEOA 2DYAA 3U1LA 4ES1A 3W2VA 1RTDA 1RE1B 4OX7A 4LIWA 5C42B 3GJRB 1EB0A 1TUGB 4UUWA 3UVJA 3BO3A 3TAPA 3EZUA 2ZWOA 2O01C 1MLAA 2IYGA 3EDRB 2V2VA 2DKOB 5DG8A 4RUCA 1NKCA 2F8EX 3SDEB 4I7FB 2DVIA 1WD6A 4FYXB 1X4HA 3PJ9A 5A8RA 2FZKB 4ZJLA 4OHXA 3H90A 2KHCA 3CXCR 4HKQA 1UP1A 3EMTA 4NLVA 2HHXA 2IC3A 2MTLA 1RT6B 2NUHA 4IG0A 4IFVA 1FFSB 1PG5B 3BDPA 3NCPA 4CYUB 3M32A 2RF2A 3DXBA 3TAMB 4XPCA 5H9EJ 2V9WA 3HJFA 2EI5A 5ETNA 5FDLA 5HANA 4DR4J 3CDBA 4DR3F 1TL3B 4JI1F 1Y3KA 2OH2A 4EGLA 3T19A 5KG0A 2XCAA 4ZVQB 2RRBA 2AYBA 3FCHA 1B0TA 3GCXP 2QO3A 3L09A 3OHBA 4USHA 2PI4A 1T9YA 3W3SA 2B9YA 1OQ6A 3D5MA 4JI5J 2YKOA 4A8OA 1N5TA 2VJUA 5EGYA 2UUCF 2Z58B 2RSQA 2EFQA 2BR0A 4NCAA 1D3WA 4M5LA 2WSCC 1P1TA 2VPXB 2LEPA 4LFAF 4DS5A 3CJKA 3MPWA 1NUEA 3J7YU 4Y3CA 5B0CA 2UXDF 2KT2A 2M8DB 5I3UB 3CWJA 1W7WA 4AYBD 4K0KF 5HVHA 3UFCX 1DQAA 2YKMA 2H9ZA 3BV8A 3D0IE 5IT4A 2KVIA 3WBZA 2UZAA 2KI2A 4N41A 3IWNC 2F5GA 3H20A 2YWWA 2G13A 2HRYA 2APOA 5GMKa 2XS7A 1VQLS 3TUZC 1R6YA 2VONA 2MQNA 3ET6B 4LSLA 2PGCA 2K2PA 1AUDA 3G2XA 3OFHA 3M6UA 2HURA 1S72S 4IO9Q 4DPXA 4NLTA 3SCJE 2X7IA 2R7WA 2HNDA 3P8BB 5LMNF 2EKNA 1T3OA 4OIXA 2L08A 3OR1A 2ZH4A 4FPIA 4K4YA 2UVVA 3JTOA 2J0SD 3Q2SC 5MLCV 3C14A 4DLGA 4FF2A 4C8YA 2M88A 3NBPB 3MDFA 4FKXA 1U2CA 2HLTA 3K17A 1QM9A 5KG1A 3A8IA 1RB0A 4ZK7M 2CQDA 3OSNA 3PW5A 1L3VA 3VVTA 1X4AA 4LF4J 1N0VC 2AYEA 4F3MA 2DNZA 2W25A 2Z2ZA 5F8LA 5BR8F 3P96A 1FRJA 3DMJA 3DRRB 2CVEA 1HYSA 1C0UA 4AQYJ 1XMBA 1RTJA 3AB2B 3IS9A 2XMVA 2E66A 3G6XA 3H5YA 3UNYA 4OI4A 3AA9A 3MCNA 4CO0A 4OI2A 4J9PA 1N5QA 2ZBIA 1IWAA 1T9WA 5GAGI 3FSIA 2CUYA 1UCNA 3CCES 4PZVA 1HQEB 2XC9A 4CLPA 3U27A 2W8LA 1IBKF 2XY7A 3A4TA 4C7QA 7FDRA 2HQDA 4NLDA 2AD9A 2LFVA 2FB0A 1HNIB 1ZPVA 3UI3A 5ETTA 4Z7YA 3OUYA 2B9EA 4OX6A 3DRSA 2GGPB 2UUAJ 1JIHA 4CO2A 2KH9A 3MUMP 4WFAQ 3DXSX 3TAQA 1YZ6A 1LW0A 5KFNA 2NZCA 3PCOB 4KHMA 2ZH2A 2Y3YA 4QCLA 3ZNUA 4JOUA 2AMCB 4MIWA 4B08A 4CWBA 4NOHA 2FJWA 2V50A 3D6TB 2GX8A 5I3QA 2E9RX 4AXJA 2WOMA 2L3MA 2QTWA 3IRWP 4V19X 2VC0A 2QMUB 2UV8G 1XMOF 4P2XA 1RAAB 1TAQA 3QJLA 1JQGA 3IMQJ 1CS4A 3CPWR 2PO4A 4O0IA 4KIAA 3JXOA 2RJZA 2OPQA 2UXBJ 4WZMA 3T1HF 1FWLA 2GAHC 2H5JB 3BQ2A 3M30B 4LSNB 4NLRA 1S59A 4NA3A 3NAIA 2K3IA 2PA8D 2NXJA 3K5NA 2J8AA 3CCVS 5F41A 4DPYA 3MMCA 2M52A 4DG1A 2DPJA 5HMWA 4LF9J 1ITPA 3D28A 4CH7A 1RWKB 5D0HA 5HP1B 3GFYA 4I67A 2BKOA 3OTOF 4UY85 3SSQA 2E9TA 1IKWB 1KHWA 2N3OA 1WC4A 4E98A 3D66A 1JLQA 3BPDA 1S1VB 5T7LA 1N32J 4OZ2A 3ZZPA 3PZPA 2HMIA 3JYTA 1LFWA 5KFYA 3AODA 1IKXB 2DXFA 1RHJB 3CE8A 3MUTP 5EN1A 2OPPB 4JYAJ 2B56A 2DR9A 4ZPTR 3MEGB 2YBVA 2YXLA 4DV2F 4DV5F 3DHWC 1TL7B 4NI2A 3ZFVA 1VK3A 3W1YC 3JSRA 2W2PP 3ZO7A 1NKEA 1SH0A 3VAIA 3D1OA 5A6PA 1FVSA 3I5BA 3M2RB 2XSFA 2KRRA 1QSSA 1ZH5A 2C3MA 2FVRA 1HBMA 3KWMA 5A8KB 1JLBA 2W9BB 2C2ZB 5D77A 1TMJA 2JHEA 2F1FA 1S76D 4NASA 2W4DA 3CULA 3BKUA 2ZBQA 4L6V3 3R5GA 3RAMA 2LDIA 3VVUA 1T05B 3MMAB 1W2BR 4JI7J 2PEBA 3M9NB 5C24A 5A0YB 3OTEA 2ZWPA 3IWXA 5ADZA 2CNKB 1M1KT 1IR0A 1SKWA 4CLSA 2VOOA 5K14B 3GLJA 1L3TA 1DY3A 2G2OA 1RI7A 2Y8YA 5KFSA 3QO9A 3FSYA 2B9XA 4NLWA 1FKPA 4RLEA 3D6HB 5D4NA 2FJBB 1S9FA 3CCJS 1S7HA 3EWGA 3OVBA 4LFBF 2GVZB 3U7JA 1N52B 2N82B 1RYSA 1GXTA 4KFBA 4QZVB 1UVNA 4LVOP 3MM5A 1CQNA 4YY3J 2ZBRA 4WP9A 3LUYA 4CO3A 1FNMA 4GKJF 5KFUA 2DGUA 4DV7J 5IC4B 2H54B 2YKNB 4DL4A 4DDFA 1YZ7A 1K44A 4PWUA 6FD1A 2NYHA 2RE1A 4DU8A 2PI5A 4JI4J 3M8QA 5DDQC 4DR6J 2C3YA 2FJAB 2C1EB 4URSA 3CJQA 1RZMA 5J1PA 5KFGA 1UVKA 1RWPB 1F3FA 3SCLE 2JRSA 2YKQA 4PQUB 3M8PA 3MAHA 1FF2A 1TKXB 3UR3C 4M5NA 1CC8A 3Q24A 4NPOA 2KHDA 2VFSA 1Y5IB 2XWXA 1AB8A 3WDOA 2J0XA 1GTEA 1MG7A 3G87A 4DSEA 2QFJA 2B51A 1AZSA 1HQUA 4X62F 1L3SA 5HBMA 2LQBA 3HHNB 4EYIB 4X65J 3I55S 1P1LA 4DUTA 1X4CA 1DARA 1U6ZA 4ANEA 2GQCA 3BSCA 2HHQA 2BQRA 2BOAA 3CNQP 1V9OA 1SKRA 1Y9OA 1FRXA 4DR2F 2EC0A 1HWIA 1WG5A 4X2BA 1FDDA 3P5TL 2XNRA 4PYAA 2AKWB 1K73T 2RHQB 2C2DA 2RHSB 2A6OA 3JSBA 1N33F 4ZA1A 1RKJA 3ENQA 3GV5B 3Q89A 3OBIA 3ETOA 3DC2A 2QL7B 1IKVA 1OO0B 5KFEA 3QFWA 2DXEA 4QIGA 2KKHA 1OYEA 4A8KA 1HD1A 1YJUA 4U8YA 4O0NA 2ZEJA 4OV1A 3OTBA 4DL0C 1SBRA 4LF5F 2FGCA 1HNXF 1LWCA 5HJYA 4ES3A 4NA1A 2GVDB 2VKRA 3CD0A 3PTWA 1OWXA 1T9XA 4WTYA 1NJZA 1VQNS 2VF3A 1O0PA 1RTJB 1B0VA 2C28A 2BBEA 2CQ0A 4XDCA 2HWIA 4M95A 2FC8A 5C25B 1MWYA 2HNZB 4Q8FA 3NRBA 4KBIA 1BE4A 3OL6A 1OPZA 4ILMA 5AXNA 1SC1B 2OD4A 1CULB 1X7VA 1N5VA 1NLKL 4USUA 2IDLA 3LTOA 2MY7A 1C1BA 4WYLA 1RAIB 1FFGB 3MPYA 2BZ2A 2RVJA 3R2CJ 3OUYB 4F2RA 3D7SB 2U2FA 4RW7A 3KK1B 3M2VB 2DT9A 3NGUA 1M5OC 1Z1ZA 3R6LB 4PCQA 4LF6F 5KG6A 5DGAA 1WEYA 2YQ3A 4NCGB 5HQ8A 3RB3A 5KFCA 5IQQA 2A10A 4NLGA 4C3KA 3ISNC 4FXDA 5K8NA 4OI1A 5HAOA 2W24A 1GT8A 1SUQB 2FJXA 2KM8B 3QGHA 3OL9A 4LBPA 5D4OA 3PIOQ 1C4AA 3KNAA 1RTHA 1Q86T 2F9JA 5KFIA 1N6QB 1SL2A 1SPBP 2BABA 2GHVC 2UU9J 4U67Q 2VBZA 3OV7A 3RBDA 1UA0A 2DHXA 1NB2A 1M5SA 1NK0A 4K7QA 2X51A 3GIJA 4RW8A 4DQSA 1RTZA 1KHVA 2D9OA 2MDAA 3ETMA 2DPIA 1EARA 4KC5A 2V34A 5F0UA 1N48A 5J1NA 1XC9A 3DU5A 2RQMA 1BHNA 3SSSA 4GKKJ 4ZLPA 4ZP6A 3KHLA 2VPZB 5ETMA 4QWCA 3BN7A 4P9SA 2F8MA 3HZGA 3M2UB 1T8EA 3KJVA 3QAUA 1MN9A 4FPRA 4E8UA 4KT0C 3S7RA 4ALZA 3RBEA 2XS5A 2OP5A 1KLMB 3HFZB 2DHAA 3MR7A 1RT7A 3Q8UA 2CXEA 4LR8A 2VHGA 3QGIA 1B99A 3PW0A 5B0GA 2OSQA 2GJ2A 4DV4F 3QGPA 4E0DA 3G82A 5D6GA 1Q16B 4ID8A 4J9UE 4Q7AA 3IGVA 5ETSA 4WK1A 2FVSA 2W1BA 3TWZA 5ETVA 5KFXA 4I1TA 1RISA 4Q0BA 2A3JA 3DM2A 4J9MA 3MMBA 3VAMA 2WTFA 1S6PA 3KLIA 4P72A 3POTA 1U1RA 5K9FA 1N5SA 1QJHA 2ROGA 4ZS6A 1TL1A 2N4DA 3TARA 4RWXA 4WU2A 1RT1A 2BM0A 3BR8A 4ENOA 1KQSR 4MK7A 5DG7A 4R5PA 4OZ3A 3ISZA 5B0AA 3W61A 2BYCA 2QA4G 3GSIA 1T03B 2B0GA 3PO5A 2W2MP 2VBWA 4CO4A 1M0SA 3QO9B 4JI3F 3I0SB 2XCPA 1S48A 4DXLA 1N54B 4DV6J 2C3PA 3FVYA 2G2YA 5F8NA 5HO4A 4DL6A 7AT1B 5K8PA 1IR2A 1CJKA 4IG3A 4NLOA 3D67A 3E01B 1VC5A 1VQ9S 2VA3A 3HVWA 1B7FA 3MXHP 3TUJC 5IM0A 2HW3A 2QL9B 2BJEA 4ECWA 3J7A1 3N5FA 4KQZA 2DK2A 2OTJS 5B0DA 4H54A 5D0RA 1YJTA 1H3DA 2W2OP 3HSJA 2ZE2B 3BB5A 3BYRA 2CJBA 2MXYA 2HBZB 3D54A 1X8DA 3EVOA 1G6BA 1HHSA 3AOAA 4I68A 4JV2A 5IS2A 1VBYA 1UVMA 4OJ1A 4YOEA 3KK2A 5DLGA 4B9LA 4USIA 4KGMA 3JB9k 1VIOA 2F4VF 1KKHA 3RGIA 1RABB 1V5IB 2HS4A 1F5BA 2CJQA 4MK8A 4FVCA 5B09A 1RAHB 4I64A 4U95A 4ZPBA 5HBMB 2GHPA 4A8XA 1NHVA 2R8GA 3U1MA 2IJFA 1T0TV 3IAM9 1NB7A 1ACMB 4RNOA 2DRAA 3AJ2A 3NGDA 3RB6A 4KR0B 4U6PA 1E6YB 2XLKA 3A13A 3CDAA 3NOCA 5IQ6A 1V3SA 1A6LA 3GIIA 1X4GA 3NS7B 2ZVIA 4A8WA 2J6UA 1QE1A 1UJ5A 2J6TA 3CCQS 2BW7A 1ZM3A 4DPTA 5AJ3J 4DBQA 2R7QA 4ED5A 1RT3B 2XMMA 5DS7A 2D9PA 2DNYA 4M5GA 3K7RA 2GQ2A 2N4CA 2DB1A 3PFOA 4YB5A 1RWVB 1K0VA 2RD5C 1RWWB 2L48A 1FXDA 1UW9A 2VQFJ 2P9EA 1NJYA 3RB0A 4Y28C 2F63A 1DJ0A 3KLGB 3G9CA 3MAQA 2F40A 1PJ6A 4O3RA 1I94F 4C11B 3T5LA 4TY8A 1VBKA 3MPUB 3FQLA 4WWSA 2EBEA 3CJ2A 1WF2A 5B08A 3NNHA 2Q1LA 1LWXA 2DTJA 1E6VB 3QMQA 1HW8A 1VQPS 3TO8A 2AJQA 4OX9F 1CJTA 2LXIA 2DRBA 2HZAA 1A9NB 1UPPA 2ZKUA 3ITHA 2JDJA 1RAJA 4GRSA 1S1TA 1X5PA 1QD1A 1C1BB 1I1GA 4PXBA 2Q66A 3N79A 4RBVA 3ZZ0A 3DI6A 2R8HA 2HS0A 3GILA 2WRMA 2DITA 3C8YA 1QTMA 3HFVA 3Q23A 3LGNA 3C2PA 3CDUA 2XWYA 5CYMB 2W7OA 4WU3A 3I5AA 2UVUA 4B17A 3W9JA 1FDBA 4USVA 2I1RA 3ZTQA 3MEDA 4BC7A 3BJYA 3PR4A 4JUZA 1TKTB 5EUHA 2DEJA 1I51B 1ZA1B 1IQZA 3GG1A 2HVHA 4OHYA 5KFKA 2JNJA 5LMUF 3RYLA 4PWWA 3ZZRA 3Q8YA 3NKYA 3GPAA 1YJ7A 2CPDA 4A47A 5CZDA 2J0QD 1RQ0A 2DR6A 3CJ3A 4JV5J 1REVB 1H7WA 4RW8B 5K20B 2NUUG 5HVGA 2UVRA 5B0FA 4B9SA 2IIHA 4C8MA 1U8WA 3GQCA 1I6JA 2AJ0A 4OYPA 4KGXB 5DETA 2Y1JA 4WE1B 4AMNA 2X3GA 2ZITA 1SC4B 2N3LA 2IPOB 5D0EA 1RK8A 5AE1A 2PC6A 2D7SA 4M5HA 4CNZA 4HACA 4ZLNA 1L3UA 1M1GA 1QUPA 2HAIA 2VG6A 3TVYA 4RKUC 4ECSA 2ASDA 1KBRA 2R2TA 1ZPWX 5B0EA 3OPKA 3M05A 4JI2J 2YX4A 1HNVA 4NMLA 4R8UA 3W7BA 4NXNJ 3P49B 1KN6A 1D9AA 4CM2A 1J5EJ 2XO6A 1HR0F 1LW2A 1S1UA 4X4OA 2NPFA 1S0MA 4YB6A 3AD9C 2CA9A 2O5DA 3J7Z5 1TK8A 1NM2A 1WNEA 3X1LB 1VI7A 5CH7B 4DEZA 4KKOA 2CPYA 3FMWA 3J81U 4DUYF 1S6OA 2OEKA 1YJWS 5HLFA 4K59A 1SCJB 3J80U 2K7JA 1HHTP 2VV5A 2CQGA 1T94A 2E7WA 4DFJA 4CO5A 2OPRA 3ZTRA 1ULRA 1C0TA 4C48A 3DFEA 1WG1A 1Q1KA 3IR6B 4JI8F 2XI3A 4OHZA 4AT1B 5EX0A 1PYTA 1RAOA 4ED7A 1VRQC 4J9SA 9ATCB 3QATA 3D68A 1U0HA 4ECXA 4ID5A 3JTPA 2AYGA 5JMNA 3KNGA 1BQXA 2YX1A 5J2QB 3ZZOA 4PKDB 1TFYA 3CCUS 1WC5A 1CSJA 5ETOA 2XYPB 3UCUP 2MQLA 2DH8A 3CD6S 2XMJA 3PKYA 3PY8A 1EAYC 2DXDA 2XS2A 4LMZA 2QIFA 4F4AA 3AOCA 3RAQA 3BO2A 3NS6A 1F2GA 1FD8A 1J5OA 3P4UB 1EQMA 1KTQA 1FK9A 1WKJA 4IDKA 4RW6A 2GIQA 5CCMA 4DUZF 4WJBA 1DBDA 2YH1A 2EW9A 4YEAA 1EETB 1TVRA 4RW4B 4G3IA 5KAKA 2FJEB 2C2KB 5HI7A 3HXMA 2HLUA 5FLXU 3L95X 4ETZA 1BQMA 4NZ7A 8RUCA 3LAMA 2EEYA 5GAHI 3BO4A 1N5YB 1XJWB 1LOUA 1VOMA 4QR0A 2E5GA 4YS2A 4C4WA 5EWGA 4QU6A 4DFKA 4KE5A 5AXMA 2MY8A 2D3O1 1X5TA 3MFHA 5I4MA 5HATA 1YQHA 4JI6J 1IBLJ 2GJIA 1ZYQA 5DO2A 4TU7A 3BPSP 3CJ4A 1Q8BA 1N88A 4Y34A 3NEKA 2WW8A 2XGPA 2HK2A 5HROB 1RADB 3BYPA 2B5JA 3ZZTA 2W9CB 5ETKA 1DURA 3GFZA 1SL0A 3DOLB 4ANCA 4DR7F 3THVA 2FTRA 2GZOA 2LQ8A 3SSRA 4MKYA 1UMJA 4OI6A 3TA2A 1DZ5A 3QWPA 4QWDA 4MAKA 1J27A 4WF9Q 1NSPA 2E1PA 4PYDA 2VPWB 4ZVPB 1U7LA 3NWGA 3UW1A 1MN7A 3NOGA 3QLHB 2KM8C 3QZ7A 2BKNA 3EE3A 3VHQA 2OEMA 1HNWJ 2UUBF 1HWUA 4Q44A 1NK9A 3Q2TC 2VFTA 3DCAA 2PIIA 2COLA 2IM2A 3MEEB 3WC2A 1I5OB 1UZHA 1T11A 1VHIA 3FZBA 4ZOSA 1WC6A 1RAFB 3F44A 3NGRA 4TVAB 4ZHRA 3G6ES 5AT1B 4S0MA 4NCBA 4ZN1A 1S9EB 3IG1A 3T9NA 2YKPA 2B43A 2V0NA 5J2NA 1NDCA 1SQFA 3OSPA 4RJVA 1XNQJ 2WZ1A 3TQ1A 3FFIB 4KRWA 3S1TA 3NMAA 4UT4A 2PFDA 4A8QA 3BKFA 1G7CB 3BKTA 3I31A 3AD8C 1GTHA 3M8RA 4ZVSB 3SQGA 3TOQA 3DI6B 3MD1A 4LJMA 4F4XA 3FUYA 2MQ8A 5J2MA 3MF5A 1RP5A 1WTFA 4HH1A 2VBYA 3MCOA 3H25A 5GAGU 2VD3A 2RQKA 4P2MA 2JC0A 5LOQA 1JLCA 3DLGA 5KG7A 4IRDA 3BBFA 1R0AA 3MEDB 1YRUA 1YRTA 2MQOA 4OZJA 2ERRA 3JSMA 1P9YA 2QJ3A 1W26A 2UP1A 4MMOA 1YTYA 4L74A 4LF7J 4M8LA 5H9FK 2P6TA 1SH2A 2VICA 3FBFA 3SXLA 5AE3A 4FVMA 3VZHA 5EX3A 2IVFB 4KSEB 2FZCB 4JI7F 3DRPA 3T1YJ 4J90A 3HKZD 3DOKB 3A12A 1U26A 1RBAA 2WW4A 4WYWA 3HVTA 2R3VA 3W2WB 2DNRA 4H4MA 3KKFA 4LIRA 1ZM2A 3K2YA 1S9GA 1S4FA 3O1LA 1NK5A 1QDUB 3PYGA 2ZM6J 2HWHA 5CYQB 2HZVA 4F67A 3IXQA 4H4OB 2HQCA 1UETA 3CGIA 2KDOA 5E3RA 3T3FA 4YY3F 5GADI 1JLAA 2IAJB 3FKBA 1NKBA 1HNVB 4DV3J 4Y6IA 5HQLA 4G65A 3K0JA 3M9OB 1JLFA 5CZCA 2RMLA 2OPSA 2RRNA 5CAAA 5ETQA 3GYNA 3ZXWA 2MLXA 2P6SA 3FJ2A 4G1QA 1RHUB 2AW0A 4JI4F 1HNZF 4X64J 3MGJA 3US5A 2CNOB 2PN6A 1FX4A 4ES2A 5D4PA 1Q79A 1S6QB 1IVZA 4IUFA 2MZ1A 4KKOB 3W63A 1SIWB 2HHUA 1S5ZA 2LKZA 1K8AT 5GMEA 4AMPA 2ZD1A 2Y0SD 3FGVA 3BSOA 1EHWA 2GQQA 5F8GA 4BDPA 2V4QA 3DOMB 2FD2A 2R7SA 4DMZA 4CLTA 3GV8B 5KFTA 1HA1A 1RKIA 1HBUA 2VG7B 2I5JA 2G0JA 1JJCB 1RGVA 1FJGF 2RUSA 2LXFA 2CPEA 2GNKA 3V6DB 2EK1A 1GFWB 1FESA 4J9OA 3IO1A 4OI3A 4CH0S 4B3TJ 2QT7A 2A2DA 2QLJB 5C42A 3FEXB 2EFPA 2XSJB 1S10A 4DN0A 4GVLA 5KFAA 2NXUA 3V81B 3SFUA 2MLYA 3NGSA 2NPIA 1R8BA 3G6YA 4L75A 4PXDA 1O8BA 1UWAA 1VHFA 4OYXA 3SDEA 4I7FA 1TR0A 4FS1A 2AF6A 4FKYA 3SCIE 1ZM4A 1VRTB 4YHHF 3JS9A 2HHHF 3QPIA 3WHIA 2FVQA 5L1IA 5DDOC 4QYZJ 2XMAA 1RT6A 1VQOS 1CQMA 3G96A 4Y2KA 1GMWD 5KOWA 2VPYB 4F4YA 3I56S 4CYUA 1TL5A 1TVRB 4N77A 3I0RA 2O1PA 3HHDA 1KQGB 4ZN3A 1D9DA 3TAMA 3IRXB 4MTPA 4CTAB 1S99A 3HHLB 3T6JA 1BWEA 2NXNA 5KFLA 2HK3A 3PIPQ 2GFFA 1BQMB 1TL3A 4B3SF 3KMSA 4F8RA 4EI2A 4J9NA 1MU2B 4PWDB 2KZMA 1KONA 2R2RA 4LFCJ 4C8NA 4DL2A 1BQNB 2MPUA 4ECTA 2L9NA 1R8HA 3BGFA 2CQ2A 1H38A 2V5HG 4O3QA 4WP3A 2R8JA 1H73A 2CDQA 4QBUA 5G0RA 1YWXA 2NZ4A 5KFVA 5KG3A 4JI0F 4Y2IA 3S6EA 2GMHA 1ZETA 2HS3A 1PKUA 2VOPA 1TV6B 1A7GE 2B5JB 1WTBA 1U0SA 2OMLA 3RRHA 3EGWB 3VGUA 2MZTA 1FFWB 3CD7A 2MSTA 2EC2A 1VFJA 3VAFA 4X66J 4F4ZA 4WFXA 1XTZA 9RUBA 1ZZFA 1U1NA 1IBMF 4ZIWA 2WBMA 4LF8F 2B7BB 3I9V9 1KNZA 5I3UA 2IDEA 2RRAA 2CWKA 4QWEA 1HMVB 2BE7D 1OYDA 2R7TA 2BA9A 2A0FB 1NSQA 2BW2A 2DRDA 2R7UA 2ZUGA 3EGZA 2DHSA 2XI2A 1WEZA 2BM1A 2RNEA 1W2IA 1WC0A 1R6VA 2XHWA 3DDNA 2VQEJ 2EFNA 5HMXA 4LR7A 4PUOB 3ET6A 3CCSS 2Y0BB 4GKKF 2B9WA 2BXJA 2OD6A 3IG1B 3E2EA 2AWZA 1CJVB 4W98A 1RTIB 4ZVOB 5DJBA 3G71S 1Y3JA 2MKJA 3MAAA 2WHOA 2IM1A 3GE9A 2FY1A 2VUGA 5GVQA 3IWLA 2FIUA 4DR3J 3B4DA 2E29A 1RWMB 3NS5A 4JI1J 2MZRA 4P52A 1MMLA 3HI9A 8AT1B 1EQ0A 3NBPA 4FBUA 3GSDA 4YMEA 1LWFB 2NREA 3TZZA 4EBDA 2XHCA 3P6YC 2JLEA 4UQTA 1WELA 2B3TB 2DNOA 1EKSA 2LDYA 4IH5A 2AT1B 5J2MB 4LF2A 3QRRA 3RAXA 1CEZA 5B7WA 3GFHA 2OTLS 2H1YA 2JSXA 3AB4B 1ZS6A 2ZH9A 1EZZB 3DRRA 4YR0A 3AFGA 3C66A 3TVKA 2C3OA 1P9QC 2MZJA 3TQEA 2WVCA 3MM9B 4A46A 2UUCJ 4M94A 3B78A 4UUXA 5KT2A 5IT0A 3MM8B 2FHOB 1V5VA 1NXIA 2XY5A 1R0AB 1QAIA 4NLXA 4RO0A 4LFAJ 2X1BA 4ED6A 3JSMB 2V2ZA 4NEYA 3IN5A 2E7XA 2UXDJ 3KHHA 2U1AA 4RL1A 1HQEA 3BQ0A 1Y11A 3PVXA 2M70A 4HLBA 3AQPA 2YTCA 1DHMA 3DRYA 4YR2A 1OIAA 1HNIA 2MKIA 4QIEA 4K4XA 1PILA 4GC7A 1NH8A 2GGPA 2AQ4A 5LJ3Y 3PJWA 3LA0A 2AGQA 3N0VA 1NJXA 4OJGA 2IVMA 2CYYA 1NK8A 4AFFA 2FHJA 3HVRA 2ALZA 4IR9A 1WKKA 2GC8A 3ZC4A 2CNNB 2DBBA 2MKHA 3ILOA 3KHGA 1WDTA 2YY3A 4DV1J 4MFBB 1GMUA 2H3EB 2KU7A 5IWAF 3SQOP 4NXMF 5ETLA 3I4PA 4I4BA 5IOLA 4CZCA 3OLBA 1YLXA 3BBBA 3OTCA 5LMNJ 4OYBA 1FVQA 5CHCB 4DPOA 2HG4A 3QSYB 4IKAA 4N56A 1F9EB 1SV5B 1JLFB 2OPSB 4W90B 1IQTA 2HFNA 5RUBA 2OFGX 3ENWA 2FPHX 4LSNA 2VFUA 2Z56B 3CIMA 2AEMA 2MB0B 4ZLLA 2YPYA 1LV5A 3MI7X 2MSSA 4OZ1A 2CJ9A 1VRUA 4KJIA 3TA0A 3GR1A 2BJ3A 2HZCA 4Q45A 3TP2A 2O66A 4YN3B 3PW2A 4CLLA 3ICLA 1PCAA 5ETPA 4YFUA 3SYZA 5AXLA 5HP1A 1UVLA 4W4MA 1FDAA 1G3OA 4YUDA 1VQ4S 1IKWA 3O44A 4PABA 4B3OA 4ATNA 1P27B 4D3GA 3RRGA 3ZZUA 3AJ1A 3CJTA 1SXLA 3PYDA 1S1VA 4ZPWR 4FYVB 2LLZA 3HMJG 3KLHB 3OFGA 2OJ3A 2WCXA 2AJ1A 1IKXA 4J37A 1N56A 2G0IA 2OPPA 3DDKA 2CZ9A 3MEGA 4TXSA 3OJUA 1NDKA 2V6AA 2FC9A 1Y5NB 1JKHB 2CPZA 1TL7A 1KR4A 3HHKA 1YIJS 3LALA 4IOAQ 2VC1A 3PW4A 3SZ2A 1FTRA 2ROPA 3ZZZA 3M2RA 4MH8A 1S97A 2O3DA 4RUBA 3D1QA 5A8KA 2W9BA 3TRGA 1HL6A 2HVDA 5HK4A 4B3RF 1WOOA 2IMWP 3DYAA 1VDHA 3NNCA 4DHVA 5I42B 1Y00A 2ASYA 3HSZA 2DHGA 1YBAA 2DNLA 3UO0A 3KLFB 2F8HA 4Y2CA 1T05A 3MMAA 3B82A 3Q8PB 1OJ4A 1XMOJ 3R27A 3UPFA 5A0YA 4I2QB 3GZ7A 2MLZA 1TELA 5K14A 4UZCA 4CQ1A 3I0RB 1FWPA 1WORA 3T1HJ 1SJ4P 2AZ1A 3NAHA 4IYQA 1K9MT 2Q6BA 1RBLA 2ZKTA 4HTIA 1P8GA 4B9TA 4DR1J 5D8HB 4FNHA 3C6UA 2GVZA 2ZC4A 1GQEA 5LL6d 1N36J 3MR5A 5L1LA 3KLVA 1GEHA 3K5PA 5KT4A 1O6XA 4L73A 2I38A 4F7VA 3OTOJ 5G0RB 1WHYA 3M1VB 4TQSA 5G4DA 3LP1B 4I6YA 4CIOA 2YKNA 5THWA 2DIVA 4J7CA 4TYBA 4J9LA 1S4EA 3HJVA 2IJNA 1DTTA 2HGLA 4KV8B 2AZ3A 4LSZB 4RX6A 3CW2C 3UD3P 1R0BG 4EBCA 4KPCA 1NPRA 4ZVEA 4LRCA 1WC1A 4XAKA 1D8YA 1SB6A 3QSIA 2MQMA 4ELTA 4PQUA 4DV2J 2BQUA 1TKXA 2V63A 4ZP8A 4ZPAA 4BWMA 3QJPA 4N76A 4P75A 1PC5A 3B4MA 3R97A 2ZVSA 3OFEA 4KO0B 1YBTA 1FI4A 4F0HA 2H5EA 5DG9A 3JAMY 1XK8A 1RT4B 1HPZB 3TZWA 2XLIA 2MHEA 3MCMA 4J9VA 3RTVA 1FT8A 4J9KA 3CUNA 3ILIA 1SJRA 3CDWA 3P5BP 3GTYX 5L8RC 2RKIA 1KDNA 2F65A 5KFOA 1CG2A 1R27B 2DNKA 5F8HA 4IOBA 4OLPA 5CZXA 5A2QY 3MAAB 1FNXH 2V4RA 3D6FB 4C0HA 3BH6B 2JJ4D 2CG8A 5FD1A 1UWBB 4OZLA 4C9DA 7FD1A 4JI2F 3F0NA 1VS3A 1KOOA 4CNYA 2ZZMA 3L7UA 1RCXB 4XO0A 3KUHA 3W9IA 4K5RA 2IMOA 2GVDA 3KG4A 4UQGA 2CQPA 2R8IA 5K5MA 2X3DA 4MT1A 1AYEA 2ZHBA 3BREA 1HFEL 2NR0A 5C25A 3G8QA 1YBUA 1DLOB 2HNZA 4QIVA 1V6HA 3U02A 4IO1A 2QLXA 1JWWA 4FXVA 1X5SA 3PYFA 3QIPB 4NA2A 3KFWX 1CULA 4ZLJA 1GX6A 3TX0A 4ECYA 3RZAA 2NSCA 3ILJA 1R8CA 4DFMA 1H74A 2HIQA 4X62J 2MZSA 1R89A 3MTJA 2YWHA 3KK1A 3M2VA 3VWSA 2KL8A 3MZIA 2D3UA 5HJXA 1IWGA 4V19J 1M5HA 1H7XA 1U02A 2KG0A 2Z4PA 4NCGA 2WAQD 1FKOA 4ECRA 4TYAA 3VAGA 4K4UA 4EEYA 5E3PA 3B6BA 1X4BA 2YNFB 4DR2J 1HWJA 3HD2A 1SUQA 3RR7A 3A8EA 3T6BA 4P71A 3EPIA 4B3MF 3H5XA 4EK2A 1N33J 1VIXA 2SXLA 3ULHA 1N6QA 2QC3A 3B54A 1FRHA 2L9WA 4PG6A 2CQCA 3O2IA 4K4WA 1WWHA 2B4UA 1R8AA 2M9KA 3LW5C 3HVAA 1Z2LA 1DFDA 1HARA 1RT2B 2BOPA 1G4CA 1NBEB 1HIYA 3UCZP 2EFGA 4HTJA 2HWTA 5IC6B 1VRUB 2QZ8A 2FVCA 3M9MB 4F02A 2FQQB 3M2UA 1U1QA 1WG4A 4A48A 4HL9A 4EZ6A 4U8VA 3GFXA 1V3ZA 3Q8RB 1XN9A 1KVIA 2DY1A 5F0WA 1KLMA 3K58A 3HHLC 3HZEA 2PA3A 3A3OB 3EVMA 3UDLA 1QSYA 4B3OB 3EX7B 3C19A 2VZ8A 3D3CJ 1WSRA 2BRKA 3GYGA 2NYIA 2Z0GA 1IBLF 2CQHA 3KOAA 4BWJA 2JFDA 3V6HA 2ILZA 5IT9Y 4Q8EA 2MJNA 2Y9HA 2IBOA 2RS2A 4LBHA 1T9UA 2CQIA 3OVSA 4XDDA 3W5YA 3Q8SB 1NSKL 2ACYA 4KGVB 2NLWA 4LF6J 1Q81T 3QWUA 3DLKA 2ATLA 2Q43A 1U25A 1IBCB 3M6VA 1ELOA 1SQGA 3H5SA 3L4BC 2G0CA 1WHXA 1M5PC 2E1RA 2MQPA 3DYAB 4WZQA 1HLWA 2HGNA 1B70B 4OI0A 1FEHA 3CMES 2OSRA 4LQ3A 4O23A 3VCDA 1S0VA 4P74A 2CPXA 4ZJOA 4RUAA 1HQ2A 4WXWA 2R8KA 4K4ZA 3NLCA 2AJFE 2FUG9 1SI9A 3CC2S 1B0PA 1T03A 3AXKA 1WSVA 1NCLA 2GIRA 4ZVUB 4UOHA 1OSDA 3I0SA 3BSAA 2E5IA 2RB7A 3CSKA 2ZOGA 3PFEA 5CZVA 2A1BA 3UE2A 1HBOB 3BR9A 4DR5F 2BANB 1Q53A 4EMDA 1DTQB 1XNRF 3C6UB 2RH3A 3E01A 2DGWA 3LP0B 1XWLA 2RUGA 1QSLA 2JH3A 3W64A 4I2PB 3RG6A 3V5RA 3W8GA 3EZOA 1T3NA 1CPZA 4CO1A 4C97A 2N7CA 1WI8A 5LJ5Y 1DTTB 3RR8A 4DQQA 2ZE2A 3OR2B 2YQ0A 1S1WA 5GAHU 4DV4J 3IA0A 5KOXA 2I9SA 1VQYA 1RWXB 2WB1D 2JVRA 3ZNJ1 2HVIA 3CCZA 1PIEA 1U8SA 1VC0A 3UQSA 2R2UA 2ZFHA 4WXOA 1QVFR 1R3NA 4OZNA 4Y0FA 3TJAA 2ZNYA 1Q7LB 1JXLA 3CO0P 4LF7F 2B7CB 1U6BA 3LGMA 1CC7A 3IBFB 1W25A 3FSXA 3R2DJ 1BMQB 1URRA 2XULA 3JQJA 3T1YF 2G4BA 4B9MA 1IM4A 6AT1B 1N4LA 3OFFA 1KRPA 2XMKA 4GVBA 2RKIB 1JJHA 3W5ZA 1TQLA 1E6YA 1U48A 2HPUA 1LKZA 2XM3A 3H2UB 2DIUA 3H4BA 2IRYA 1MWZA 3OLAA 2J9CA 1WOSA 2ZM6F 4JI3J 4KGZB 3UN3A 2R7VA 2XQCA 5A6WA 4OV6A 8ATCB 2LMIA 4GO7X 3MR6A 3I32A 2OEJA 3GJTB 3CO9A 1MROB 1RT3A 4DX6A 2KG1A 3BQ1A 3R7NB 3OXFA 2B4OA 2HFOA 1B3TA 4RW9B 2RT3A 1HI0P 3PNIA 2R7RA 2MKCA 1G1XA 3KLGA 3PJXA 5E33A 3SI8A 3KUGA 1SJQA 2OHDA 4C11A 4ZPCA 3N28A 1MNEA 1OY9A 4FDFA 5KFJA 4KPYA 4FS2A 4EBEA 1NK4A 4ICLB 2ZDPA 1EX8A 1E6VA 4IFYB 2ZDOA 4IOCQ 3QJJA 2CQ3A 1I3OB 2F4VJ 3QT7A 5D3GB 1GAOA 2KXNB 3BGLA 2VA2A 2AGOA 5BYSA 2QE5A 3EGNA 4Z37A 1H72C 3GIRA 3GJQB 2BX6A 1ZZNA 2F4FA 4K4TA 1JLGB 2H4WB 3W66A 3R6GB 2DCUB 1Y0HA 4F3OA 5CYMA 4ETXA 1FKOB 4WBFA 4FF1A 1HI8A 3H59A 3Q8QB 2RIJA 4ED3A 4B9UA 1FEEA 4PG4A 2VIHA 2DNNA 1U47A 1TKTA 3MD3A 3HT3A 1YRXA 1RLCL 1JNRB 2GJFA 3I87A 2E1CA 3BGRA 2CPJA 4EYHB 5IZHA 1TL4A 3FEYB 3DDIA 3Q8VA 2J9DE 1XEZA 1KSPA 3C16B 1KFDA 1REVA 1U45A 4OL8A 2MGZB 1IUJA 3NCQA 4DSIA 1FHTA 3EPGA 1AFJA 4NYPA 4KGKA 3QIDA 2XMTA 1A0OB 2PFFB 4K4SA 3H5UA 1NO8A 3M8WA 3KHRA 3UWTA 5GADU 2XNQA 4WE1A 1URNA 2RQ4A 4IQXA 2R7OA 5D4LA 2C2NA 1I94J 4U9RA 4XTTA 1T95A 1PGZA 3CTRA 3GP9A 4MJKA 2M7SA 5KFRA 3DU6A 4OMFG 2OGUA 2K3KA 4OX9J 5KFZA 2H5IB 1RA7A 4DX5A 4C8KA 3HM9A 2ZBCA 2DNPA 4USTA 1UFKA 2C2EA 2LEBA 2JVOA 3A1YG 2NXCA 3KDOA 3TW0A 3BGOP 2UUWA 1U1PA 1D0EA 2KTQA 1KWMA 1ROFA 2AU0A 3DLKB 4BS2A 4FF3A 1RHRB 3DRXA 2AX0A 3C15B 3K5LA 5CABA 6FDRA 2P9CA 3K8VA 4LBIA 2YNIB 5L9NA 2B8PA 3MPDA 3H42A 2EWHA 4HDGA 5A8WB 1KEKA 1S7IA 5H9EK 2PE8A 3ZTSA 1SJ3P 1AROP 2K8GA 1HI1A 3WX4A 5B0BA 5LMUJ 2ASLA 2ZZTA 4CLKA 1YG0A 3IFEA 4LUBA 3C46A 1UJ4A 2VQEF 4WIQA 4ZVHA 2W7AA 1RWOB 5LM7E 2V8HA 4DL3A 4USJC 3V4IA 5J2QA 3H0PA 3H4DA 3D6MB 4CDIA 3UDCA 2PSZA 4RZRA 2HBYB 2KO1A 5DZ6A 2HKEA 3SIPB 2KZZA 3SBMA 1KLNA 2XY6A 1N0UA 1TTHB 4HI2A 1FXRA 2K1RB 1NJIT 4IRKA 4X4TA 1C4CA 3PDNA 2PMHA 1FNOA 2JLFA 3R5DA 1WF0A 1LWEB 2B4VA 5KFWA 4CLWA 2XYGB 3DLEB 3KLEB 3OVAA 2QLFB 1N8RT 3S8SA 1JMTA 4I6AA 2JOQA 1YJ9S 4HEA9 4I69A 3VV2B 3QZ8A 3EDQB 1S1WB 2EPIA 1G2EA 4M5MA 3RU0A 1EETA 2JC1A 5ETRA 4RW4A 1K47A 4BBYA 2GS8A 3T5JA 4U7CA 3UNGC 2VG5A 1HR0J 1TZ0A 3MHYA 3BEGB 1PJ5A 4K5SA 2RU3A 3WIUA 3DGPA 3IBWA 4DCPB 1TK0A 1N5YA 3MFIA 2IY5B 4DUYJ 5J1EB 2BMBA 3ZTPA 3CCRS 2ZC3A 3KK3B 4DPWA 4IQMA 2VU5A 1PBAA 1VQ6S 2NS1B 4P10A 5M2PA 4QW9A 4A8YA 3AH6A 1RWNB 2Q79A 1JB0C 2D3OR 3KXDA 4GVBB 2ABYA 1SKUB 5HROA 4NL5A 4JI8J 2HBQB 2W9CA 4DZ6A 4CH1A 3D1HA 3NWRA 2HNYA 4KHPF 3DOLA 4K2XA 2IYIA 4DV1F 2OLWA 1JLEB 2JEGA 3FCVA 2JEJA 3IGNA 3KJFB 1F0XA 1UEKA 4X84A 1NPKA 5LXRA 3UDVA 2QLWA 4TN2A 1K1SA 2IVYA 1LXNA 2CPHA 1FXLA 2M0GB 5JXSA 2V9KA 3MEKA 2Z2YB 3QLHA 4N8OA 4M5DB 3TUPA 1LXJA 1APSA 2GAGC 2MQQA 3R5AA 1BC6A 4K2JA 1DRZA 2DGQA 2XG8A 2UXCJ 4OYWA 2VJVA 3BS9A 3G8SA 4OZ0A 1CLFA 1VGYA 2ROEA 1NNDA 3MEEA 2CWXA 1S0NA 4DUZJ 3CB4A 1NZ8A 3CCLS 2DY9A 1S9EA 2ZZNA 1TKZA 3VTIA 1IM6A 2HFUA 3VAJA 4ELVA 3D0HE 2B8QA 3LANA 4WIIA 5L46A 2K7KA 1HBNB 3PO4A 1YVFA 2CAJA 2QMWA 4ZP9A 3Q86A 3CEDA 1Q8KA 1VYAA 3OHAA 3W60A 2KN4A 4FYYB 3L9ZA 3FFIA 3HHLD 1WHWA 3WIVA 1PYOB 4G1IA 2JX2A 2XLJA 2E5LF 3EM1A 4O44A 3H2VE 1JNZB 3QAEA 1D9FA 1SJ1A 4QYRA 1TK5A 2HQGA 4ECQA 4WKYA 3MM6B 5C2GA 2EK6A 2WVEA 3I9ZA 1UFWA 2W8KA 4MK9A 4OFZA 4PXEA 3TANA 2ALYB 1YSJA 3VALA 3QQCD 2CJAA 1D1UA 2XZWA 2ZNZA 3P3DA 2LYVA 3O5TB 4L3KA 2FHKA 4DR7J 4HHUA 5E2QA 3JQMA 4ED8A 2FZGB 3I5CA 3BGRB 2FGOA 1ZTWA 2EFVA 2GW8A 2ZH7A 3CD5A 2HRUA 3R3TA 3NG8A 1LNQA 4PG8A 3M8ZA 1S1XB 2GA7A 2ZH8A 3RB4A 4CLUA 1AFIA 3DOKA 4B9NA 3CMQA 2LU1A 1JJ2R 4YB7A 3CC4S 4UOGA 3IBCB 3W2WA 1RSCA 4EU0A 2UUBJ 3GB0A 4BLGA 2CPIA 2JEFA 1BWVA 3EJMA 1ZAWA 4OJ3A 3G6VA 4DR4F 2ZH3A 3EVWA 2RU9A 4OZ5A 4J5OA 4AL7A 2XMUA 4A8FA 1FKAF 3ONQA 3GYXB 2M8HA 4DR1F 4XK8C 5CYQA 3QBCA 2B6AB 4IR1A 1HWKA 2IA6A 2WONA 4H4OA 1N36F 3MM7B 1L5UA 2YNGB 4USWA 2KB2A 3C6TB 4BCAA 2VBXA 4OHVA 2IAJA 1IKYB 4GO5X 1GNKA 2YNHB 4JI5F 3UCGA 3WZ0A 3JTNA 2EG1A 4C0BA 4J91A 3MECB 2HBRB 2J7UA 4GMKA 2CNLB 3HFKA 5DDRC 5KG4A 4PEOA 1VBZA 4YQWA 3K57A 4O4GB 2KT3A 5CD4A 3W2VB 4H4KC 3FQKA 1S6QA 2EG2A 1RTDB 4QPXA 3OQ2A 1YHQS 2E7VA 3EGVA 3TNVA 1PSDA 1Q78A 1IJFB 3UVJB 4LREA 2X1GA 3ELHA 2ZJPQ 4G1PA 4URQU 4F25A 4DOZA 3HT0A 1M90T 4X4RA 2OKQA 1NU4A 2QLBB 3DOMA 4I56A 3PHTA 2Q3PA 4PPDA 4YB1P 5A8RB 4P73A 3A8JA 1EKRA 1NZAA 5CD4H 5EWFA 1H2UX 1UZDA 2VG7A 1UJ6A 4RNNA 2IC3B 3OT9A 5F8MA 3V6DA 1F5AA 4ZCLA 4IG0B 4IFVB 2R7XA 1U1MA 3V4IB 3H8YA 2QX0A 2VDHA 2RILA 5BYRA 2I6WA 2DGVA 2EBGA 4LQ9A 1GMVA 5E41A 3M32B 3UDEA 4QR1A 2RF2B 5L1KA 1VBXA 3MMJA 2XSJA 3NMRA 1FDNA 2AJ2A 4KTQA 5FDLB 3V81A 5D15A 3D4JA 5M2UA 2E44A 2FHMA 4DV0J 1AT1B 5KG2A 2ZH1A 2ZOMA 3KDNA 2MKSA 4HVZA 4NYOA 1VRTA 4TLRA 3M4XA 1XMQJ 1ZOTA 3OXLA 3QNWB 3AQOA 1N34J 4F26A 4LF4F 2E1AA 2IBKA 2D1CA 4C6AA 4ZCMA 4ILLA 4L76A 3SMZA 4AQYF 1T9TA 3R5JB 1YGYA 5E3AA 5DDPC 3IRXA 4CTAA 2VG5B 2BVZA 3E8OA 3HHLA 5DLFA 1GX5A 1HNZJ 2W01A 1RT5A 1T02A 2Z2MA 3DGPB 2LP4A 3CJKB 5L39A 2QFIA 1VQSA 2ILYA 1MU2A 1O51A 4PWDA 2M3DA 1F3VA 5F3TA 3M8YA 1BQNA 3PRVA 3G4SS 4KHRA 4V1Ak 4P2FA 2HSEB 1Y10A 4RNMA 1UKUA 3GCWP 4N5SA 2DH7A 1RBOB 4DL7A 2YKMB 4Y65A 1D09B 3BN4A 4HHJA 3DLBA 3IP0A 2WVDA 4NMXA 2LA6A 2UUAF 3R5CA 4F2SA 1TV6A 2VASA 3PM9A 3DLJA 1FJGJ 4O3SA 4LSLB 1M5KC 3DLHA 2HNYB 3LPEA 1WF1A 1WKLA 3I82A 5JVHQ 1U1LA 4OLOA 1REGX 4ZVGA 1Q5YA 3EXYA 4OYIA 3TX8A 4AL5A 3GV7B 2FYXA 1Q95G 2HNDB 2WVFA 4ECUA 1VJQA 1HMVA 3PW7A 3OR1B 4CT9A 1NRKA 5LSRA 1QAJA 4O3OA 3C14B 2AEFA 2W2QP 1LK7A 4RPFA 1R7IA 4DQIA 3VGTA 4X4PA 4XIUA 1R43A 2MHNA 5KT6A 4DF8A 4YHHJ 2UXBF 1NAQA 2V8DA 3UN5A 2HAFA 2YWKA 2HHHJ 2P8IA 2YQ1A 2ZUAA 3Q0AA 5DM6Q 1PAUB 4PUOA 3L7OA 1MW7A 4ED4A 2P9GA 3FBEA 1X60A 1TP7A 1F9HA 3DMJB 4QU7A 5L9XA 1UW4A 1HYSB 1C0UB 1CJVA 1QAXA 2HQ3A 1RTIA 4EUVA 5I3PA 1TKZB 3IS9B 4LF9F 1PAEX 4A4JA 3K89A 4P6QA 3G86A 4DSKA 4TLQA 2CIMA 4TNOA 4B3SJ 3W8PA 5EDWA 3R1LA 4G6VB 3PEJA 1LWFA 3UR0A 4O44B 2J6SA 2QV6A 2MJUA 1Z4UA 1N32F 1KD1T 3TJ9A 5F8JA 3N6LA 4UOFA 2JEIA 2HHPA 2Y1RI 4NZ0A 3LH2S 4F4WA 3BSNA 4JYAF 4P7TA 4CLZA 2BE2A 1D8ZA 4M5JA 4JI0J 4LVNP 3DRSB 2MKYA 4EFAC 3MM9A 3S01A 3N01A 3CC7S 1LW0B 3OL7A 4C3MA 3MM8A 4U7UD 2C42A 3LPYA 4CM0A 4WCEQ 3HF5A 2XO7A 3TA1A 2EFOA 2D3ZA 1XQIA 4X4QA 4OYOA 1IBMJ 2YKAA 1FWKA 4LF8J 3TR5A 5E7OB 1NK6A 1MWQA 5KTQA 4ZVTB 2KFNA 2WOMB 1B4SA 1Q7YT 3PEHA 1EJ7L 1SH3A 3OW2R 1RWUA 4EO8A 1CS4B 1YITS 3TVZA 5BYQA 5KFBA 2KT5A 2OPQB 4OJHA 1VQ8S 5D78A 3O8WA 4RUHA 3R7SB 3TYTA 1KC8T 2IFXA 4KYZA 1ZA2B 5H9FJ 4WFNQ 1SQEA 2D74B 2XB2D 1SJFA 4MFBA 1TAUA 2BJDA 2IM3A 4UF4A 2AV5A 3IAS9 3BGUA 3MMCB 4FNIA 3WC0A 2KFZA 2WONB 2KYXA 3FRYA 2DISA 4DG1B 3BM7A 1H2TZ 2N7YA 4AE5A 1T7PA 1KP6A 1U1OA 2QSFA 1CVJA 1F6TA 4C98A 2BKPA 1XIQA 4B02A 1MMDA 2J9DA 4QQBA 3PX4A 4DV7F 1C1CA 3LQVA 3MOZA 1JLQB 1BUXA 1SV5A 4HI1A 4F04B 2MYFA 5T7LB 2QYCA 2HMIB 3JYTB 2W9AA 4DR6F 4QWBA 3THPA 4LRAA 4ERDA 4WFBQ 1H98A 3IM8A 2GV1A 4RNFA 4C2MA 5DRKA 3A8KA 3E51A 3QRPA 4NWBA 1QY7A 4CP5A 4NI2B 5A76A 3HK2A 4QWAA 4AL6A 2XGQA 4QJVA 2XZTB 1YX2A 4MYUA 4CLYA 2QRRA 2JLGA 3R9LA 1KFSA 2CVIA 1Q8LA 3LP2A 2DO4A 2CDRB 1HBMB 2M2BA 4Q2LA 1JLBB 1XERA 5C2CA 5K8OA 3LOUA 4X65F 3KLHA 2BACA 5LT5A 2HFZA 3ZTOA 2DH9A 2WSFC 4J9RA 2XTJP 4BHQA 5C24B 1SKSA 4RU9A 1GXLA 4FYDA 4TU9A 1JKHA 4DQRA 1FE0A 1RA6A 2ZOFA 2E5HA 3CVKA 4ZVFA 2GO9A 4NRTA 4PAAA 1FKPB 2J76E 1L3KA 1K1QA 4ZDNA 3GR0A 2IJRA 1X4FA 3V6JA 2CJYB 1CBKA 5IWAJ 4NXMJ 1Q0NA 4KFBB 3D0GE 1S49A 5I42A 2E1MC 3MM5B 5HVFA 1FRIA 3JSYA 3KLFA 2QG9B 3LWMA 3QRQA 3R1HA 1XR7A 2VFRA 2HRTA 3DKDA 4ITSA 2QA4S 4OYAA 3FEZA 2BJ1A 4I2QA 1RU1A 2AHOB 2Z57B 1WC3A 2LVWA 2RDIA 1DAXA 2FY8A 2C22A 5JJBA 4ED2A 3M8QB 3OL8A 4KAIA 1Q5VA 2V8VA 3CF5Q 1F1BB 1U24A 3PV8A 1VMBA 2W4CA 1RT5B 5DQHA 5DGBA 1S6UA 4GC6A 3M8PB 3W62A 2PT0A 3CJ0A 4JV0A 3CMAS 3I6PA 1IXKA 2OMOA 1ZAXA 4AUKA 4FZVA 2VH7A 3PRDA 5LSOA 4M5IA 1HQUB 1AZSB 4MYTA 4YDDB 3J7YI 4ZKAA 2GMLA 3VZIA 3M1VA 2H48B 3LP1A 3HCXA 3KG0A 3TUIC 2BUNA 4O3PA 2PDAA 2ASJA 3A3NB 4NZ6A 1BLUA 4KV8A 3BZQA 4D3HA 4ZP7A 2A2CA 2HGMA 5SUHA 2D41A 2KRBA 2VODA 1CJUA 2YH0A 2BEFA 2F7VA 4DCJB 4FF4A 3FK4A 2DR8A 2NQPA 5FJ4A 3D3BJ 2FJDB 2G1DA 1Y5LB 4KO0A 4QW8A 3VQTA 3I4HX 4FN5A 5T41A 2G2ZA 1RT4A 2WBRA 2E5JA 4UZBA 2UU9F 1HPZA 1RAEB 3QT6A 1QVGR 1IKVB 4I6WA 4B3RJ 1TUWA 3RBXA 4TU8A 1XR6A 2BJ8A 1HW9A 4DL5A 3H7HB 2UVWA 1LWCB 2V4JA 2LQ5A 1BXNA 1FD2A 3GU0A 2ZHAA 1X4EA 4LRFA 2L9DA 4MKVA 4NRUA 2YX7A 2O67A 3B8HA 2OELA 2DGSA 3VAHA 1B64A 1GXUA 5KFHA 2QA2A 3M6XA 1UWBA 2EXUA 2FLPA 2RAQA 3LO3A 1VJWA 1RACB 4P2SA 4CRJA 4WTOB 4PQAA 3DLLQ 2V2KA 3AD7C 5BXIA 2JZ5A 2IRUA 2CZVC 5EWEA 1OMSA 1KQFB 3CJRA 3H98A 3UN2A 2BE2B 2HEKA 1JJ4A 5SZTA 2CRLA 2LECA 4RW7B 2LA4A 1X9WA 4LF1A 1AW0A 2F3JA 4KB7A 2DNGA 5MAOA 3W9HA 1RLDA 3ENVA 3RUBL 2HFSA 2I8EA 5BJRA 1DLOA 4RR5A 4ZIVA 3MTKA 2H65B 5EHHA 1U2FA 3J81Y 3QIPA 1F60B 2KYZA 2MMYA 1KVJA 4I0WA 2A18A 4K0KJ 3J80Y 2EKYA 2AJ4A 3TZYA 1RTHB 2YPZA 3AA8A 3PRBA 3R8YA 4HR2A 3KMQA 1VC6A 5IFMA 1UAWA 1SVDA 3TJ8A 2K06A 1Z2ZA 2KJVA 2P5VA 3F41A 2DJWA 2NSBA 1ZAVA 1NEEA 1UPMB 4ELUA 2DNQA 4URGA 4DV6F 4LRBA 3U1NA 2YNFA 3RW7A 2OO4A 4KH0B 2V67A 5CYJA 2OI2A 4UY8T 5CXTA 2HVZA 4NLPA 2HYIB 1U09A 2V8PA 3T9ZA 3KJVB 2XEXA 5GAEU 1WI6A 1GMWA 1M5VC 1H0HB 3OJSA 3FCWA 1S12A 4ZITA 4OYZA 2C2RA 4N8NA 3AT1B 1Q8IA 2Z8QA 3LWLA 5KFPA 1C1CB 1RT7B 3NP5A 5F9NA 2CJKA 2AEJA 2J7WA 1FJ7A 3NGKA 1YKWA 1T9VA 3CJ5A 2WK4A 4ZCKA 5HMYA 2B4PA 5DQGA 1LFPA 3BF4A 4RNHA 2AYMA 1RT2A 1DQ8A 1HWLA 2WSEC 4DJBA 4FBTA 1YJVA 2J0WA 3G82B 1IJEB 5BR8J 1VQKS 4YR3A 3HLUA 1FRMA 4TQRA 4DF4A 3O3LA 5LXYA 1VQMS 1WHVA 5FLXY 4Q0BB 3LP2B 3DM2B 2PMZD 3MMBB 1C2PA 1YK9A 2QGFB 1S6PB 3KLIB 3FDSA 4B9VA 2VZ9A 1BGXT 3POTB 1RHKB 3CCTA 5AXKA 3EYZA 3MWBA 1TL1B 1NDLA 4Z2XA 1KVKA 1O5JA 4YDXA 1IBKJ 5DZ7A 1UVJA 1RT1B 2Y1IA 4JP8A 4OX8A 4ED1A 4R5PB 3AXMA 4M1KA 1R31A 4DFPA 2ZJQQ 3N9UC 4RWWA 5HL7Q 3I96A 4USKA 3QT5A 1J2VA 4M5KA 3HPOA 2P2CB 5L38A 4K4VA 2HHVA 3NCRA 4ECZA 4NLUA 2M4MA 1AUSL 2AGPA 5AJ3F 4LRDA 1XBWA 3DGVA 1CJKB 3AAWB 1P6TA 4IG3B 3T41A 3LGHA 1SC6A 4U7UK 3KTQA 2M5YA 1SIZA 4B3MJ 1UFLA 1PC4A 1NPPA 3HDSA 4FYWB 2DCLA 5IM0B 3ENAA 4RBUA 2DHHA 2PD1A 2VQFF 2UXCF 1FRKA 1NH7A 1FERA 4L72B 4M63A 1MMNA 1QLNA 1PYSB 3M8SA 1VCTA 2HVEA 1R8PA 3M7VA 1NHKL 4MKBA 3SCKE 3H40A 4CLFA 3HSDA 4OQJA 3RJMB 1U2RA 4Y2AA 4TKTA 3N5BA 1HBOA 1OS5A 1YI2S 2BANA 4XPEA 1XR5A 1DTQA 3KK2B 5DQIA 2DNHA 4R0EA 2QA1A 3LP0A 1NJWA 1NMEB 4Y2MA 5F9LA 3QYYA 3T1AA 1X9SA 2V8GA 4I2PA 3MR3A 2Q6CA 5L1JA 2CQ1A 1LK5A 4H4KA 4EO6A 2BQ3A 2R9LA 1PJ7A 4QIWD 2X1AA 5HMZA 2I0XA 2ZBPA 3N6NA 4QOTA 5LSLA 3Q83A 3OR2A 3V4MA 2V94A 4DX7A 2A6MA 4RU2A 1CJUB 2KFYA
chains in the Genus database with same CATH topology
2C2NA 3CJ8A 2VKZG 2PFFB 3PTWA 5DZ6A 2QJ3A 3RGIA 3BV8A 2QO3A 2QC3A 3HJVA 5CZCA 3TZXA 3SBMA 3TZWA 3IM9A 4RL1A 2G2ZA 2UV8G 2VZ9A 2VZ8A 3H0PA 1NM2A 1MLAA 2HG4A 2G2OA 3TZYA 3TZZA 2G1HA 4RR5A 2JFKA 2H1YA 3R97A 3EZOA 3G87A 2JFDA 3QATA 4QBUA 5CZDA 3HHDA 2CUYA 5DZ7A 3HMJG 3R8YA 3K89A 3IM8A 3TQEA 2G2YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C2N A;  3CJ8 A;  2VKZ G;  2PFF B;  3PTW A;  5DZ6 A;  2QJ3 A;  3RGI A;  3BV8 A;  2QO3 A;  2QC3 A;  3HJV A;  5CZC A;  3TZX A;  3SBM A;  3TZW A;  3IM9 A;  4RL1 A;  2G2Z A;  2UV8 G;  2VZ9 A;  2VZ8 A;  3H0P A;  1NM2 A;  1MLA A;  2HG4 A;  2G2O A;  3TZY A;  3TZZ A;  2G1H A;  4RR5 A;  2JFK A;  2H1Y A;  3R97 A;  3EZO A;  3G87 A;  2JFD A;  3QAT A;  4QBU A;  5CZD A;  3HHD A;  2CUY A;  5DZ7 A;  3HMJ G;  3R8Y A;  3K89 A;  3IM8 A;  3TQE A;  2G2Y A; 
#chains in the Genus database with same CATH topology
 1DQ9 A;  2V69 A;  2WVB A;  4PPZ A;  4DV5 J;  4AND A;  3SV3 A;  5HSP A;  4JBC A;  3MR2 A;  3ISN D;  2CAD A;  4KH1 B;  4C0O C;  4DX8 H;  1QE1 B;  2ATC B;  4HT7 A;  3GIM A;  3TZX A;  3ZZY A;  3L7P A;  4JV5 F;  2RQC A;  3HO1 A;  2GCF A;  4O3N A;  3CIZ A;  3O6Q A;  5KFQ A;  1RDR A;  3DN9 A;  1H2V Z;  1QTN B;  5KT3 A;  2OUG A;  4YP3 A;  3THT A;  5HQM A;  2V4J B;  1NSA A;  5IXU A;  2RDD A;  4PRF A;  3KG1 A;  3EIC A;  4R0J A;  4RBT A;  4DWI A;  2FVP A;  2IHR 1;  4Z7C A;  1OPI A;  2DGO A;  1TU0 B;  3HUL A;  4TY8 B;  2XBP A;  3PYE A;  4NLS A;  3KJN B;  5T14 A;  1NDP A;  1PO6 A;  3HHE A;  3LAK A;  2DGT A;  2LQJ A;  3Q22 A;  3BDE A;  1X31 C;  1X0F A;  2ZH5 A;  1SC3 B;  3X3U A;  3NNA A;  4DR5 J;  2BE9 B;  4ZPD A;  2IM0 A;  1XNR J;  3UD5 A;  4LFB J;  2MZQ A;  1MRO A;  1CJT B;  3IR7 B;  2HIY A;  3PXG a;  4ED0 A;  4NXN F;  1UVI A;  3ITH B;  4QPT A;  5CQG A;  1S1T B;  1J5E F;  2ZJR Q;  4GKJ J;  3GON A;  1RUS A;  4RW9 A;  4X4N A;  4WP8 A;  1AXQ A;  3MOJ B;  2HQI A;  4CCH A;  5GMD A;  5E3C A;  3DHX A;  2NXE A;  3D2W A;  2OAU A;  4JB8 B;  4Q2M A;  1VK8 A;  4Q43 A;  3A3P B;  5E3Q A;  3K5M A;  5FII A;  4KY3 A;  5F8I A;  4UOC A;  3FBC A;  1IN0 A;  4NLY A;  4ZMM A;  3WQP A;  2ZHO A;  2ADC A;  4ICL A;  1VR6 A;  4DSJ A;  4EZ9 A;  4IFY A;  4Q5V A;  3JAM U;  3W65 A;  3EUN A;  5D3G A;  2EVZ A;  2G9O A;  3HSG A;  2W2N P;  1IR1 A;  2Z2L A;  3GIK A;  4NX9 A;  2R4F A;  3V6K A;  2HHW A;  4X4S A;  3QT8 A;  1RAG B;  2CFX A;  4X4U A;  2BJ9 A;  3FRZ A;  4IH6 A;  1JLG A;  1BY9 A;  4E2F B;  1V3R A;  1WJ9 A;  2DD8 S;  2RDJ A;  1F5C A;  4JV1 A;  1ZTT A;  1VQ7 S;  5A2Q U;  4DU7 A;  2Z30 B;  4NE9 C;  3TEG A;  3IM9 A;  4DZD A;  1WAC A;  2DNM A;  2YVS A;  2V2Q A;  4DV0 F;  4DN9 A;  2BDP A;  3FC9 A;  1KOH A;  3NGT A;  4HAC B;  3AHP A;  4ZPV R;  1Y4Z B;  1XMQ F;  3GWC A;  5CCL A;  5DM7 Q;  2VG6 B;  4ILR A;  2CQB A;  2OFH X;  3C16 A;  3QFH A;  1N34 F;  3GMG A;  2RS8 A;  1U1K A;  1RYR A;  5H1S V;  1FJE B;  1FRL A;  1M1H A;  2MGZ A;  4ZVR B;  1KTV A;  3EZ5 A;  4R8U B;  5D0G A;  2PEH A;  1UA1 A;  1TMM A;  4LF5 J;  2W7P A;  4CT8 A;  3C3L A;  1HNX J;  1OY8 A;  3N6M A;  3R7B B;  2HFV A;  1FX2 A;  1VLO A;  5KFM A;  1LW2 B;  1S1U B;  5J2P A;  1JK9 B;  3PX6 A;  1U4B A;  5U47 A;  3VQS A;  2IA0 A;  4DPU A;  3K59 A;  2C2M B;  3CJS A;  4HDH A;  1EP4 A;  2J7K A;  3WX8 A;  4F36 A;  4ZCI A;  3JQK A;  4MIA A;  1OSC A;  1JXE A;  3F56 A;  1FE4 A;  2AX1 A;  1F9F A;  4DSL A;  4ZJQ A;  5HLF B;  4PXC A;  2VFV A;  1ZBT A;  1WEX A;  4JI6 F;  2OPR B;  1NK7 A;  4HYK A;  2CPF A;  2XYH B;  3EXC X;  4OHW A;  1R0C B;  2C2O B;  2UV8 A;  4WK3 A;  4QR2 A;  1C0T B;  1X5O A;  2GMJ A;  4C3L A;  2QEX S;  1RU2 A;  1TFW A;  1S77 D;  2QL5 B;  3HKW A;  4HHH A;  2FJV A;  3N4W A;  1U0H B;  2C3U A;  4ID5 B;  2GHW A;  3D9B A;  2MEW A;  1Q4R A;  1UL3 A;  2XZD B;  4QYZ K;  2LXU A;  2QN6 B;  1YJN S;  1FTC A;  3C15 A;  2J8S A;  2FDN A;  4HH0 A;  4J9Q A;  2GO8 A;  2YNI A;  2CJX B;  4DQP A;  2W4P A;  1JX4 A;  5A8W A;  3HX9 A;  4WFY A;  1S79 A;  2J9E A;  3PR5 B;  2FHJ D;  4C8L A;  1HNW F;  2DR5 A;  3W5X A;  5IV4 A;  4A8M P;  2WB4 A;  1J5O B;  1WDD A;  4IDK B;  1FK9 B;  4RW6 B;  3G8T A;  4UW2 A;  1SL1 A;  1AA1 B;  4Y00 A;  5AE2 A;  2QSW A;  4K50 A;  4MIB A;  4OYM A;  2HHT A;  3J81 j;  1LEO A;  1U6F A;  4CI0 B;  3VF0 B;  1NHU A;  4C8O A;  1X9M A;  4P7V A;  2NCK L;  3M6W A;  2H4Y B;  2H51 B;  1XNQ F;  2K1R A;  4AMM A;  1HKA A;  4W92 B;  4LT6 A;  1X0P A;  3QGG A;  1ZM9 A;  2JL9 A;  4U96 A;  4DS4 A;  1RXO B;  2POK A;  1LWE A;  3DLE A;  3KLE A;  1BD6 A;  5C7P A;  1FJC A;  2L41 A;  2I2Y A;  5HN0 A;  3PAC A;  2JFK A;  5IV3 A;  2XMW A;  3FZ2 A;  3J7A N;  5IT9 U;  1VLY A;  5M2R A;  4N47 A;  3R5B A;  3F73 A;  1Q82 T;  3T5K A;  3RRK A;  4K8R A;  5JUM A;  3VGS A;  3CDE A;  4MKA A;  2LU2 A;  5KFF A;  3MPV A;  3SV4 A;  3ADA C;  2E9Z A;  3OD2 A;  2VKZ G;  2BJ7 A;  3MUR P;  3K5O A;  1YDL A;  1HHQ A;  2YWE A;  5J1E A;  2KVQ E;  3KK3 A;  3NXZ A;  4BC9 A;  4N7T A;  2ACM A;  1LQ9 A;  2AP6 A;  5KFD A;  3K8W A;  1JXV A;  1RHQ B;  1OY6 A;  1RJJ A;  3IC1 A;  1S57 A;  2F9D A;  1F2H A;  3BH7 B;  1FO1 A;  1HD0 A;  2QMX A;  2CKW A;  4DCO B;  4F3Q A;  4ZHR B;  1ICE B;  5KT5 A;  1UEU A;  3IR5 B;  1JLE A;  1TUV A;  2V68 A;  2CQ4 A;  3PX0 A;  1VQ5 S;  2JWN A;  5J2N B;  3FNN A;  3PKM A;  4PG7 A;  2R2S A;  1K0T A;  1WUU A;  2DR7 A;  1QUV A;  2GIF A;  2Y1L B;  4X4V A;  2QYG A;  4DV3 F;  4F50 A;  4WPA A;  3RBZ A;  3P45 B;  1GK8 A;  4M5D A;  5E0O A;  2VB6 A;  2VL1 A;  3KJQ B;  4AD6 A;  3AJD A;  4WFZ A;  3OTD A;  3SQG B;  3BBC A;  2DO0 A;  1KQK A;  2X1F A;  2YWG A;  4X64 F;  4FP9 A;  3MUV P;  4R25 A;  4QIF A;  2ADB A;  2Y8W A;  4NYZ A;  3FMB A;  4F0M A;  3MCS A;  1TKD A;  2KJW A;  3OXG A;  5JVG Q;  3KYL A;  4L3N A;  2CZ4 A;  2BV3 A;  1B7Y B;  5KG5 A;  2UUT A;  1UTA A;  2IRX A;  5KT7 A;  1PBU A;  2AIR B;  3VGV A;  1HBN A;  1JLC B;  3DLG B;  2ZH6 A;  3PHE A;  1GH8 A;  2FLL A;  1FCA A;  4UTG A;  2BRL A;  5C5J A;  4DI6 A;  2HHS A;  5ITH A;  5F3Z A;  1EIY B;  4DLE A;  3E3X A;  3NL0 A;  4DSF A;  3MM6 A;  3DRP B;  2KXF A;  4ECV A;  4TY9 A;  3CCW A;  4USM A;  3RW6 A;  5E5N A;  3HP6 A;  4B3T F;  2PMW A;  3HVT B;  3DNC A;  4H4M B;  3CT9 A;  3ILL A;  3L3C A;  1H6K X;  2VDI A;  1S9G B;  1YJR A;  1FA0 A;  1RHM B;  4KHP J;  1KS2 A;  2HQF A;  2YWF A;  4F4K A;  1MSW D;  2MKK A;  2G1H A;  2CG4 A;  5CA5 A;  3HD1 A;  3VR1 A;  1X4D A;  3H2L A;  1QAY A;  5K8M A;  2KXH A;  1JLA B;  3V2U C;  2LCW A;  1S1X A;  2LQ9 A;  5GAE I;  3AOB A;  2OIH A;  3J7Z T;  4AMO A;  3UD4 P;  4O4R A;  3T5H A;  2FLO A;  4C8Z A;  4G1Q B;  2DEI A;  3M30 A;  4FXW A;  5J2P B;  4PR6 A;  4LR9 A;  2LEA A;  3PG9 A;  3CCM S;  1WOP A;  4F0K A;  4NEZ A;  4LFC F;  2FLN A;  1EP4 B;  4IRC A;  2B6A A;  2J5A A;  3TEH B;  4WKR A;  3MM7 A;  2YNG A;  2ZD1 B;  2R42 A;  3C6T A;  2D69 A;  4NLQ A;  4A8S A;  4ER8 A;  3FBB A;  3CJ8 A;  4IH7 A;  1IKY A;  2YNH A;  1U49 A;  4AXI A;  1RCO B;  3KUE A;  3NY0 A;  2E5L J;  4PG5 A;  4HT5 A;  3AY0 A;  3GG0 A;  3MEC A;  1VIS A;  3LF0 A;  2DGX A;  3VAK A;  1HBU B;  3SFG A;  2I5J B;  3TI0 A;  4EWT A;  1Y7P A;  1UEV A;  4O4G A;  1S0O A;  4X66 F;  3GJS B;  1OQ3 A;  3SEO A;  2DYA A;  3U1L A;  4ES1 A;  3W2V A;  1RTD A;  1RE1 B;  4OX7 A;  4LIW A;  5C42 B;  3GJR B;  1EB0 A;  1TUG B;  4UUW A;  3UVJ A;  3BO3 A;  3TAP A;  3EZU A;  2ZWO A;  2O01 C;  1MLA A;  2IYG A;  3EDR B;  2V2V A;  2DKO B;  5DG8 A;  4RUC A;  1NKC A;  2F8E X;  3SDE B;  4I7F B;  2DVI A;  1WD6 A;  4FYX B;  1X4H A;  3PJ9 A;  5A8R A;  2FZK B;  4ZJL A;  4OHX A;  3H90 A;  2KHC A;  3CXC R;  4HKQ A;  1UP1 A;  3EMT A;  4NLV A;  2HHX A;  2IC3 A;  2MTL A;  1RT6 B;  2NUH A;  4IG0 A;  4IFV A;  1FFS B;  1PG5 B;  3BDP A;  3NCP A;  4CYU B;  3M32 A;  2RF2 A;  3DXB A;  3TAM B;  4XPC A;  5H9E J;  2V9W A;  3HJF A;  2EI5 A;  5ETN A;  5FDL A;  5HAN A;  4DR4 J;  3CDB A;  4DR3 F;  1TL3 B;  4JI1 F;  1Y3K A;  2OH2 A;  4EGL A;  3T19 A;  5KG0 A;  2XCA A;  4ZVQ B;  2RRB A;  2AYB A;  3FCH A;  1B0T A;  3GCX P;  2QO3 A;  3L09 A;  3OHB A;  4USH A;  2PI4 A;  1T9Y A;  3W3S A;  2B9Y A;  1OQ6 A;  3D5M A;  4JI5 J;  2YKO A;  4A8O A;  1N5T A;  2VJU A;  5EGY A;  2UUC F;  2Z58 B;  2RSQ A;  2EFQ A;  2BR0 A;  4NCA A;  1D3W A;  4M5L A;  2WSC C;  1P1T A;  2VPX B;  2LEP A;  4LFA F;  4DS5 A;  3CJK A;  3MPW A;  1NUE A;  3J7Y U;  4Y3C A;  5B0C A;  2UXD F;  2KT2 A;  2M8D B;  5I3U B;  3CWJ A;  1W7W A;  4AYB D;  4K0K F;  5HVH A;  3UFC X;  1DQA A;  2YKM A;  2H9Z A;  3BV8 A;  3D0I E;  5IT4 A;  2KVI A;  3WBZ A;  2UZA A;  2KI2 A;  4N41 A;  3IWN C;  2F5G A;  3H20 A;  2YWW A;  2G13 A;  2HRY A;  2APO A;  5GMK a;  2XS7 A;  1VQL S;  3TUZ C;  1R6Y A;  2VON A;  2MQN A;  3ET6 B;  4LSL A;  2PGC A;  2K2P A;  1AUD A;  3G2X A;  3OFH A;  3M6U A;  2HUR A;  1S72 S;  4IO9 Q;  4DPX A;  4NLT A;  3SCJ E;  2X7I A;  2R7W A;  2HND A;  3P8B B;  5LMN F;  2EKN A;  1T3O A;  4OIX A;  2L08 A;  3OR1 A;  2ZH4 A;  4FPI A;  4K4Y A;  2UVV A;  3JTO A;  2J0S D;  3Q2S C;  5MLC V;  3C14 A;  4DLG A;  4FF2 A;  4C8Y A;  2M88 A;  3NBP B;  3MDF A;  4FKX A;  1U2C A;  2HLT A;  3K17 A;  1QM9 A;  5KG1 A;  3A8I A;  1RB0 A;  4ZK7 M;  2CQD A;  3OSN A;  3PW5 A;  1L3V A;  3VVT A;  1X4A A;  4LF4 J;  1N0V C;  2AYE A;  4F3M A;  2DNZ A;  2W25 A;  2Z2Z A;  5F8L A;  5BR8 F;  3P96 A;  1FRJ A;  3DMJ A;  3DRR B;  2CVE A;  1HYS A;  1C0U A;  4AQY J;  1XMB A;  1RTJ A;  3AB2 B;  3IS9 A;  2XMV A;  2E66 A;  3G6X A;  3H5Y A;  3UNY A;  4OI4 A;  3AA9 A;  3MCN A;  4CO0 A;  4OI2 A;  4J9P A;  1N5Q A;  2ZBI A;  1IWA A;  1T9W A;  5GAG I;  3FSI A;  2CUY A;  1UCN A;  3CCE S;  4PZV A;  1HQE B;  2XC9 A;  4CLP A;  3U27 A;  2W8L A;  1IBK F;  2XY7 A;  3A4T A;  4C7Q A;  7FDR A;  2HQD A;  4NLD A;  2AD9 A;  2LFV A;  2FB0 A;  1HNI B;  1ZPV A;  3UI3 A;  5ETT A;  4Z7Y A;  3OUY A;  2B9E A;  4OX6 A;  3DRS A;  2GGP B;  2UUA J;  1JIH A;  4CO2 A;  2KH9 A;  3MUM P;  4WFA Q;  3DXS X;  3TAQ A;  1YZ6 A;  1LW0 A;  5KFN A;  2NZC A;  3PCO B;  4KHM A;  2ZH2 A;  2Y3Y A;  4QCL A;  3ZNU A;  4JOU A;  2AMC B;  4MIW A;  4B08 A;  4CWB A;  4NOH A;  2FJW A;  2V50 A;  3D6T B;  2GX8 A;  5I3Q A;  2E9R X;  4AXJ A;  2WOM A;  2L3M A;  2QTW A;  3IRW P;  4V19 X;  2VC0 A;  2QMU B;  2UV8 G;  1XMO F;  4P2X A;  1RAA B;  1TAQ A;  3QJL A;  1JQG A;  3IMQ J;  1CS4 A;  3CPW R;  2PO4 A;  4O0I A;  4KIA A;  3JXO A;  2RJZ A;  2OPQ A;  2UXB J;  4WZM A;  3T1H F;  1FWL A;  2GAH C;  2H5J B;  3BQ2 A;  3M30 B;  4LSN B;  4NLR A;  1S59 A;  4NA3 A;  3NAI A;  2K3I A;  2PA8 D;  2NXJ A;  3K5N A;  2J8A A;  3CCV S;  5F41 A;  4DPY A;  3MMC A;  2M52 A;  4DG1 A;  2DPJ A;  5HMW A;  4LF9 J;  1ITP A;  3D28 A;  4CH7 A;  1RWK B;  5D0H A;  5HP1 B;  3GFY A;  4I67 A;  2BKO A;  3OTO F;  4UY8 5;  3SSQ A;  2E9T A;  1IKW B;  1KHW A;  2N3O A;  1WC4 A;  4E98 A;  3D66 A;  1JLQ A;  3BPD A;  1S1V B;  5T7L A;  1N32 J;  4OZ2 A;  3ZZP A;  3PZP A;  2HMI A;  3JYT A;  1LFW A;  5KFY A;  3AOD A;  1IKX B;  2DXF A;  1RHJ B;  3CE8 A;  3MUT P;  5EN1 A;  2OPP B;  4JYA J;  2B56 A;  2DR9 A;  4ZPT R;  3MEG B;  2YBV A;  2YXL A;  4DV2 F;  4DV5 F;  3DHW C;  1TL7 B;  4NI2 A;  3ZFV A;  1VK3 A;  3W1Y C;  3JSR A;  2W2P P;  3ZO7 A;  1NKE A;  1SH0 A;  3VAI A;  3D1O A;  5A6P A;  1FVS A;  3I5B A;  3M2R B;  2XSF A;  2KRR A;  1QSS A;  1ZH5 A;  2C3M A;  2FVR A;  1HBM A;  3KWM A;  5A8K B;  1JLB A;  2W9B B;  2C2Z B;  5D77 A;  1TMJ A;  2JHE A;  2F1F A;  1S76 D;  4NAS A;  2W4D A;  3CUL A;  3BKU A;  2ZBQ A;  4L6V 3;  3R5G A;  3RAM A;  2LDI A;  3VVU A;  1T05 B;  3MMA B;  1W2B R;  4JI7 J;  2PEB A;  3M9N B;  5C24 A;  5A0Y B;  3OTE A;  2ZWP A;  3IWX A;  5ADZ A;  2CNK B;  1M1K T;  1IR0 A;  1SKW A;  4CLS A;  2VOO A;  5K14 B;  3GLJ A;  1L3T A;  1DY3 A;  2G2O A;  1RI7 A;  2Y8Y A;  5KFS A;  3QO9 A;  3FSY A;  2B9X A;  4NLW A;  1FKP A;  4RLE A;  3D6H B;  5D4N A;  2FJB B;  1S9F A;  3CCJ S;  1S7H A;  3EWG A;  3OVB A;  4LFB F;  2GVZ B;  3U7J A;  1N52 B;  2N82 B;  1RYS A;  1GXT A;  4KFB A;  4QZV B;  1UVN A;  4LVO P;  3MM5 A;  1CQN A;  4YY3 J;  2ZBR A;  4WP9 A;  3LUY A;  4CO3 A;  1FNM A;  4GKJ F;  5KFU A;  2DGU A;  4DV7 J;  5IC4 B;  2H54 B;  2YKN B;  4DL4 A;  4DDF A;  1YZ7 A;  1K44 A;  4PWU A;  6FD1 A;  2NYH A;  2RE1 A;  4DU8 A;  2PI5 A;  4JI4 J;  3M8Q A;  5DDQ C;  4DR6 J;  2C3Y A;  2FJA B;  2C1E B;  4URS A;  3CJQ A;  1RZM A;  5J1P A;  5KFG A;  1UVK A;  1RWP B;  1F3F A;  3SCL E;  2JRS A;  2YKQ A;  4PQU B;  3M8P A;  3MAH A;  1FF2 A;  1TKX B;  3UR3 C;  4M5N A;  1CC8 A;  3Q24 A;  4NPO A;  2KHD A;  2VFS A;  1Y5I B;  2XWX A;  1AB8 A;  3WDO A;  2J0X A;  1GTE A;  1MG7 A;  3G87 A;  4DSE A;  2QFJ A;  2B51 A;  1AZS A;  1HQU A;  4X62 F;  1L3S A;  5HBM A;  2LQB A;  3HHN B;  4EYI B;  4X65 J;  3I55 S;  1P1L A;  4DUT A;  1X4C A;  1DAR A;  1U6Z A;  4ANE A;  2GQC A;  3BSC A;  2HHQ A;  2BQR A;  2BOA A;  3CNQ P;  1V9O A;  1SKR A;  1Y9O A;  1FRX A;  4DR2 F;  2EC0 A;  1HWI A;  1WG5 A;  4X2B A;  1FDD A;  3P5T L;  2XNR A;  4PYA A;  2AKW B;  1K73 T;  2RHQ B;  2C2D A;  2RHS B;  2A6O A;  3JSB A;  1N33 F;  4ZA1 A;  1RKJ A;  3ENQ A;  3GV5 B;  3Q89 A;  3OBI A;  3ETO A;  3DC2 A;  2QL7 B;  1IKV A;  1OO0 B;  5KFE A;  3QFW A;  2DXE A;  4QIG A;  2KKH A;  1OYE A;  4A8K A;  1HD1 A;  1YJU A;  4U8Y A;  4O0N A;  2ZEJ A;  4OV1 A;  3OTB A;  4DL0 C;  1SBR A;  4LF5 F;  2FGC A;  1HNX F;  1LWC A;  5HJY A;  4ES3 A;  4NA1 A;  2GVD B;  2VKR A;  3CD0 A;  3PTW A;  1OWX A;  1T9X A;  4WTY A;  1NJZ A;  1VQN S;  2VF3 A;  1O0P A;  1RTJ B;  1B0V A;  2C28 A;  2BBE A;  2CQ0 A;  4XDC A;  2HWI A;  4M95 A;  2FC8 A;  5C25 B;  1MWY A;  2HNZ B;  4Q8F A;  3NRB A;  4KBI A;  1BE4 A;  3OL6 A;  1OPZ A;  4ILM A;  5AXN A;  1SC1 B;  2OD4 A;  1CUL B;  1X7V A;  1N5V A;  1NLK L;  4USU A;  2IDL A;  3LTO A;  2MY7 A;  1C1B A;  4WYL A;  1RAI B;  1FFG B;  3MPY A;  2BZ2 A;  2RVJ A;  3R2C J;  3OUY B;  4F2R A;  3D7S B;  2U2F A;  4RW7 A;  3KK1 B;  3M2V B;  2DT9 A;  3NGU A;  1M5O C;  1Z1Z A;  3R6L B;  4PCQ A;  4LF6 F;  5KG6 A;  5DGA A;  1WEY A;  2YQ3 A;  4NCG B;  5HQ8 A;  3RB3 A;  5KFC A;  5IQQ A;  2A10 A;  4NLG A;  4C3K A;  3ISN C;  4FXD A;  5K8N A;  4OI1 A;  5HAO A;  2W24 A;  1GT8 A;  1SUQ B;  2FJX A;  2KM8 B;  3QGH A;  3OL9 A;  4LBP A;  5D4O A;  3PIO Q;  1C4A A;  3KNA A;  1RTH A;  1Q86 T;  2F9J A;  5KFI A;  1N6Q B;  1SL2 A;  1SPB P;  2BAB A;  2GHV C;  2UU9 J;  4U67 Q;  2VBZ A;  3OV7 A;  3RBD A;  1UA0 A;  2DHX A;  1NB2 A;  1M5S A;  1NK0 A;  4K7Q A;  2X51 A;  3GIJ A;  4RW8 A;  4DQS A;  1RTZ A;  1KHV A;  2D9O A;  2MDA A;  3ETM A;  2DPI A;  1EAR A;  4KC5 A;  2V34 A;  5F0U A;  1N48 A;  5J1N A;  1XC9 A;  3DU5 A;  2RQM A;  1BHN A;  3SSS A;  4GKK J;  4ZLP A;  4ZP6 A;  3KHL A;  2VPZ B;  5ETM A;  4QWC A;  3BN7 A;  4P9S A;  2F8M A;  3HZG A;  3M2U B;  1T8E A;  3KJV A;  3QAU A;  1MN9 A;  4FPR A;  4E8U A;  4KT0 C;  3S7R A;  4ALZ A;  3RBE A;  2XS5 A;  2OP5 A;  1KLM B;  3HFZ B;  2DHA A;  3MR7 A;  1RT7 A;  3Q8U A;  2CXE A;  4LR8 A;  2VHG A;  3QGI A;  1B99 A;  3PW0 A;  5B0G A;  2OSQ A;  2GJ2 A;  4DV4 F;  3QGP A;  4E0D A;  3G82 A;  5D6G A;  1Q16 B;  4ID8 A;  4J9U E;  4Q7A A;  3IGV A;  5ETS A;  4WK1 A;  2FVS A;  2W1B A;  3TWZ A;  5ETV A;  5KFX A;  4I1T A;  1RIS A;  4Q0B A;  2A3J A;  3DM2 A;  4J9M A;  3MMB A;  3VAM A;  2WTF A;  1S6P A;  3KLI A;  4P72 A;  3POT A;  1U1R A;  5K9F A;  1N5S A;  1QJH A;  2ROG A;  4ZS6 A;  1TL1 A;  2N4D A;  3TAR A;  4RWX A;  4WU2 A;  1RT1 A;  2BM0 A;  3BR8 A;  4ENO A;  1KQS R;  4MK7 A;  5DG7 A;  4R5P A;  4OZ3 A;  3ISZ A;  5B0A A;  3W61 A;  2BYC A;  2QA4 G;  3GSI A;  1T03 B;  2B0G A;  3PO5 A;  2W2M P;  2VBW A;  4CO4 A;  1M0S A;  3QO9 B;  4JI3 F;  3I0S B;  2XCP A;  1S48 A;  4DXL A;  1N54 B;  4DV6 J;  2C3P A;  3FVY A;  2G2Y A;  5F8N A;  5HO4 A;  4DL6 A;  7AT1 B;  5K8P A;  1IR2 A;  1CJK A;  4IG3 A;  4NLO A;  3D67 A;  3E01 B;  1VC5 A;  1VQ9 S;  2VA3 A;  3HVW A;  1B7F A;  3MXH P;  3TUJ C;  5IM0 A;  2HW3 A;  2QL9 B;  2BJE A;  4ECW A;  3J7A 1;  3N5F A;  4KQZ A;  2DK2 A;  2OTJ S;  5B0D A;  4H54 A;  5D0R A;  1YJT A;  1H3D A;  2W2O P;  3HSJ A;  2ZE2 B;  3BB5 A;  3BYR A;  2CJB A;  2MXY A;  2HBZ B;  3D54 A;  1X8D A;  3EVO A;  1G6B A;  1HHS A;  3AOA A;  4I68 A;  4JV2 A;  5IS2 A;  1VBY A;  1UVM A;  4OJ1 A;  4YOE A;  3KK2 A;  5DLG A;  4B9L A;  4USI A;  4KGM A;  3JB9 k;  1VIO A;  2F4V F;  1KKH A;  3RGI A;  1RAB B;  1V5I B;  2HS4 A;  1F5B A;  2CJQ A;  4MK8 A;  4FVC A;  5B09 A;  1RAH B;  4I64 A;  4U95 A;  4ZPB A;  5HBM B;  2GHP A;  4A8X A;  1NHV A;  2R8G A;  3U1M A;  2IJF A;  1T0T V;  3IAM 9;  1NB7 A;  1ACM B;  4RNO A;  2DRA A;  3AJ2 A;  3NGD A;  3RB6 A;  4KR0 B;  4U6P A;  1E6Y B;  2XLK A;  3A13 A;  3CDA A;  3NOC A;  5IQ6 A;  1V3S A;  1A6L A;  3GII A;  1X4G A;  3NS7 B;  2ZVI A;  4A8W A;  2J6U A;  1QE1 A;  1UJ5 A;  2J6T A;  3CCQ S;  2BW7 A;  1ZM3 A;  4DPT A;  5AJ3 J;  4DBQ A;  2R7Q A;  4ED5 A;  1RT3 B;  2XMM A;  5DS7 A;  2D9P A;  2DNY A;  4M5G A;  3K7R A;  2GQ2 A;  2N4C A;  2DB1 A;  3PFO A;  4YB5 A;  1RWV B;  1K0V A;  2RD5 C;  1RWW B;  2L48 A;  1FXD A;  1UW9 A;  2VQF J;  2P9E A;  1NJY A;  3RB0 A;  4Y28 C;  2F63 A;  1DJ0 A;  3KLG B;  3G9C A;  3MAQ A;  2F40 A;  1PJ6 A;  4O3R A;  1I94 F;  4C11 B;  3T5L A;  4TY8 A;  1VBK A;  3MPU B;  3FQL A;  4WWS A;  2EBE A;  3CJ2 A;  1WF2 A;  5B08 A;  3NNH A;  2Q1L A;  1LWX A;  2DTJ A;  1E6V B;  3QMQ A;  1HW8 A;  1VQP S;  3TO8 A;  2AJQ A;  4OX9 F;  1CJT A;  2LXI A;  2DRB A;  2HZA A;  1A9N B;  1UPP A;  2ZKU A;  3ITH A;  2JDJ A;  1RAJ A;  4GRS A;  1S1T A;  1X5P A;  1QD1 A;  1C1B B;  1I1G A;  4PXB A;  2Q66 A;  3N79 A;  4RBV A;  3ZZ0 A;  3DI6 A;  2R8H A;  2HS0 A;  3GIL A;  2WRM A;  2DIT A;  3C8Y A;  1QTM A;  3HFV A;  3Q23 A;  3LGN A;  3C2P A;  3CDU A;  2XWY A;  5CYM B;  2W7O A;  4WU3 A;  3I5A A;  2UVU A;  4B17 A;  3W9J A;  1FDB A;  4USV A;  2I1R A;  3ZTQ A;  3MED A;  4BC7 A;  3BJY A;  3PR4 A;  4JUZ A;  1TKT B;  5EUH A;  2DEJ A;  1I51 B;  1ZA1 B;  1IQZ A;  3GG1 A;  2HVH A;  4OHY A;  5KFK A;  2JNJ A;  5LMU F;  3RYL A;  4PWW A;  3ZZR A;  3Q8Y A;  3NKY A;  3GPA A;  1YJ7 A;  2CPD A;  4A47 A;  5CZD A;  2J0Q D;  1RQ0 A;  2DR6 A;  3CJ3 A;  4JV5 J;  1REV B;  1H7W A;  4RW8 B;  5K20 B;  2NUU G;  5HVG A;  2UVR A;  5B0F A;  4B9S A;  2IIH A;  4C8M A;  1U8W A;  3GQC A;  1I6J A;  2AJ0 A;  4OYP A;  4KGX B;  5DET A;  2Y1J A;  4WE1 B;  4AMN A;  2X3G A;  2ZIT A;  1SC4 B;  2N3L A;  2IPO B;  5D0E A;  1RK8 A;  5AE1 A;  2PC6 A;  2D7S A;  4M5H A;  4CNZ A;  4HAC A;  4ZLN A;  1L3U A;  1M1G A;  1QUP A;  2HAI A;  2VG6 A;  3TVY A;  4RKU C;  4ECS A;  2ASD A;  1KBR A;  2R2T A;  1ZPW X;  5B0E A;  3OPK A;  3M05 A;  4JI2 J;  2YX4 A;  1HNV A;  4NML A;  4R8U A;  3W7B A;  4NXN J;  3P49 B;  1KN6 A;  1D9A A;  4CM2 A;  1J5E J;  2XO6 A;  1HR0 F;  1LW2 A;  1S1U A;  4X4O A;  2NPF A;  1S0M A;  4YB6 A;  3AD9 C;  2CA9 A;  2O5D A;  3J7Z 5;  1TK8 A;  1NM2 A;  1WNE A;  3X1L B;  1VI7 A;  5CH7 B;  4DEZ A;  4KKO A;  2CPY A;  3FMW A;  3J81 U;  4DUY F;  1S6O A;  2OEK A;  1YJW S;  5HLF A;  4K59 A;  1SCJ B;  3J80 U;  2K7J A;  1HHT P;  2VV5 A;  2CQG A;  1T94 A;  2E7W A;  4DFJ A;  4CO5 A;  2OPR A;  3ZTR A;  1ULR A;  1C0T A;  4C48 A;  3DFE A;  1WG1 A;  1Q1K A;  3IR6 B;  4JI8 F;  2XI3 A;  4OHZ A;  4AT1 B;  5EX0 A;  1PYT A;  1RAO A;  4ED7 A;  1VRQ C;  4J9S A;  9ATC B;  3QAT A;  3D68 A;  1U0H A;  4ECX A;  4ID5 A;  3JTP A;  2AYG A;  5JMN A;  3KNG A;  1BQX A;  2YX1 A;  5J2Q B;  3ZZO A;  4PKD B;  1TFY A;  3CCU S;  1WC5 A;  1CSJ A;  5ETO A;  2XYP B;  3UCU P;  2MQL A;  2DH8 A;  3CD6 S;  2XMJ A;  3PKY A;  3PY8 A;  1EAY C;  2DXD A;  2XS2 A;  4LMZ A;  2QIF A;  4F4A A;  3AOC A;  3RAQ A;  3BO2 A;  3NS6 A;  1F2G A;  1FD8 A;  1J5O A;  3P4U B;  1EQM A;  1KTQ A;  1FK9 A;  1WKJ A;  4IDK A;  4RW6 A;  2GIQ A;  5CCM A;  4DUZ F;  4WJB A;  1DBD A;  2YH1 A;  2EW9 A;  4YEA A;  1EET B;  1TVR A;  4RW4 B;  4G3I A;  5KAK A;  2FJE B;  2C2K B;  5HI7 A;  3HXM A;  2HLU A;  5FLX U;  3L95 X;  4ETZ A;  1BQM A;  4NZ7 A;  8RUC A;  3LAM A;  2EEY A;  5GAH I;  3BO4 A;  1N5Y B;  1XJW B;  1LOU A;  1VOM A;  4QR0 A;  2E5G A;  4YS2 A;  4C4W A;  5EWG A;  4QU6 A;  4DFK A;  4KE5 A;  5AXM A;  2MY8 A;  2D3O 1;  1X5T A;  3MFH A;  5I4M A;  5HAT A;  1YQH A;  4JI6 J;  1IBL J;  2GJI A;  1ZYQ A;  5DO2 A;  4TU7 A;  3BPS P;  3CJ4 A;  1Q8B A;  1N88 A;  4Y34 A;  3NEK A;  2WW8 A;  2XGP A;  2HK2 A;  5HRO B;  1RAD B;  3BYP A;  2B5J A;  3ZZT A;  2W9C B;  5ETK A;  1DUR A;  3GFZ A;  1SL0 A;  3DOL B;  4ANC A;  4DR7 F;  3THV A;  2FTR A;  2GZO A;  2LQ8 A;  3SSR A;  4MKY A;  1UMJ A;  4OI6 A;  3TA2 A;  1DZ5 A;  3QWP A;  4QWD A;  4MAK A;  1J27 A;  4WF9 Q;  1NSP A;  2E1P A;  4PYD A;  2VPW B;  4ZVP B;  1U7L A;  3NWG A;  3UW1 A;  1MN7 A;  3NOG A;  3QLH B;  2KM8 C;  3QZ7 A;  2BKN A;  3EE3 A;  3VHQ A;  2OEM A;  1HNW J;  2UUB F;  1HWU A;  4Q44 A;  1NK9 A;  3Q2T C;  2VFT A;  3DCA A;  2PII A;  2COL A;  2IM2 A;  3MEE B;  3WC2 A;  1I5O B;  1UZH A;  1T11 A;  1VHI A;  3FZB A;  4ZOS A;  1WC6 A;  1RAF B;  3F44 A;  3NGR A;  4TVA B;  4ZHR A;  3G6E S;  5AT1 B;  4S0M A;  4NCB A;  4ZN1 A;  1S9E B;  3IG1 A;  3T9N A;  2YKP A;  2B43 A;  2V0N A;  5J2N A;  1NDC A;  1SQF A;  3OSP A;  4RJV A;  1XNQ J;  2WZ1 A;  3TQ1 A;  3FFI B;  4KRW A;  3S1T A;  3NMA A;  4UT4 A;  2PFD A;  4A8Q A;  3BKF A;  1G7C B;  3BKT A;  3I31 A;  3AD8 C;  1GTH A;  3M8R A;  4ZVS B;  3SQG A;  3TOQ A;  3DI6 B;  3MD1 A;  4LJM A;  4F4X A;  3FUY A;  2MQ8 A;  5J2M A;  3MF5 A;  1RP5 A;  1WTF A;  4HH1 A;  2VBY A;  3MCO A;  3H25 A;  5GAG U;  2VD3 A;  2RQK A;  4P2M A;  2JC0 A;  5LOQ A;  1JLC A;  3DLG A;  5KG7 A;  4IRD A;  3BBF A;  1R0A A;  3MED B;  1YRU A;  1YRT A;  2MQO A;  4OZJ A;  2ERR A;  3JSM A;  1P9Y A;  2QJ3 A;  1W26 A;  2UP1 A;  4MMO A;  1YTY A;  4L74 A;  4LF7 J;  4M8L A;  5H9F K;  2P6T A;  1SH2 A;  2VIC A;  3FBF A;  3SXL A;  5AE3 A;  4FVM A;  3VZH A;  5EX3 A;  2IVF B;  4KSE B;  2FZC B;  4JI7 F;  3DRP A;  3T1Y J;  4J90 A;  3HKZ D;  3DOK B;  3A12 A;  1U26 A;  1RBA A;  2WW4 A;  4WYW A;  3HVT A;  2R3V A;  3W2W B;  2DNR A;  4H4M A;  3KKF A;  4LIR A;  1ZM2 A;  3K2Y A;  1S9G A;  1S4F A;  3O1L A;  1NK5 A;  1QDU B;  3PYG A;  2ZM6 J;  2HWH A;  5CYQ B;  2HZV A;  4F67 A;  3IXQ A;  4H4O B;  2HQC A;  1UET A;  3CGI A;  2KDO A;  5E3R A;  3T3F A;  4YY3 F;  5GAD I;  1JLA A;  2IAJ B;  3FKB A;  1NKB A;  1HNV B;  4DV3 J;  4Y6I A;  5HQL A;  4G65 A;  3K0J A;  3M9O B;  1JLF A;  5CZC A;  2RML A;  2OPS A;  2RRN A;  5CAA A;  5ETQ A;  3GYN A;  3ZXW A;  2MLX A;  2P6S A;  3FJ2 A;  4G1Q A;  1RHU B;  2AW0 A;  4JI4 F;  1HNZ F;  4X64 J;  3MGJ A;  3US5 A;  2CNO B;  2PN6 A;  1FX4 A;  4ES2 A;  5D4P A;  1Q79 A;  1S6Q B;  1IVZ A;  4IUF A;  2MZ1 A;  4KKO B;  3W63 A;  1SIW B;  2HHU A;  1S5Z A;  2LKZ A;  1K8A T;  5GME A;  4AMP A;  2ZD1 A;  2Y0S D;  3FGV A;  3BSO A;  1EHW A;  2GQQ A;  5F8G A;  4BDP A;  2V4Q A;  3DOM B;  2FD2 A;  2R7S A;  4DMZ A;  4CLT A;  3GV8 B;  5KFT A;  1HA1 A;  1RKI A;  1HBU A;  2VG7 B;  2I5J A;  2G0J A;  1JJC B;  1RGV A;  1FJG F;  2RUS A;  2LXF A;  2CPE A;  2GNK A;  3V6D B;  2EK1 A;  1GFW B;  1FES A;  4J9O A;  3IO1 A;  4OI3 A;  4CH0 S;  4B3T J;  2QT7 A;  2A2D A;  2QLJ B;  5C42 A;  3FEX B;  2EFP A;  2XSJ B;  1S10 A;  4DN0 A;  4GVL A;  5KFA A;  2NXU A;  3V81 B;  3SFU A;  2MLY A;  3NGS A;  2NPI A;  1R8B A;  3G6Y A;  4L75 A;  4PXD A;  1O8B A;  1UWA A;  1VHF A;  4OYX A;  3SDE A;  4I7F A;  1TR0 A;  4FS1 A;  2AF6 A;  4FKY A;  3SCI E;  1ZM4 A;  1VRT B;  4YHH F;  3JS9 A;  2HHH F;  3QPI A;  3WHI A;  2FVQ A;  5L1I A;  5DDO C;  4QYZ J;  2XMA A;  1RT6 A;  1VQO S;  1CQM A;  3G96 A;  4Y2K A;  1GMW D;  5KOW A;  2VPY B;  4F4Y A;  3I56 S;  4CYU A;  1TL5 A;  1TVR B;  4N77 A;  3I0R A;  2O1P A;  3HHD A;  1KQG B;  4ZN3 A;  1D9D A;  3TAM A;  3IRX B;  4MTP A;  4CTA B;  1S99 A;  3HHL B;  3T6J A;  1BWE A;  2NXN A;  5KFL A;  2HK3 A;  3PIP Q;  2GFF A;  1BQM B;  1TL3 A;  4B3S F;  3KMS A;  4F8R A;  4EI2 A;  4J9N A;  1MU2 B;  4PWD B;  2KZM A;  1KON A;  2R2R A;  4LFC J;  4C8N A;  4DL2 A;  1BQN B;  2MPU A;  4ECT A;  2L9N A;  1R8H A;  3BGF A;  2CQ2 A;  1H38 A;  2V5H G;  4O3Q A;  4WP3 A;  2R8J A;  1H73 A;  2CDQ A;  4QBU A;  5G0R A;  1YWX A;  2NZ4 A;  5KFV A;  5KG3 A;  4JI0 F;  4Y2I A;  3S6E A;  2GMH A;  1ZET A;  2HS3 A;  1PKU A;  2VOP A;  1TV6 B;  1A7G E;  2B5J B;  1WTB A;  1U0S A;  2OML A;  3RRH A;  3EGW B;  3VGU A;  2MZT A;  1FFW B;  3CD7 A;  2MST A;  2EC2 A;  1VFJ A;  3VAF A;  4X66 J;  4F4Z A;  4WFX A;  1XTZ A;  9RUB A;  1ZZF A;  1U1N A;  1IBM F;  4ZIW A;  2WBM A;  4LF8 F;  2B7B B;  3I9V 9;  1KNZ A;  5I3U A;  2IDE A;  2RRA A;  2CWK A;  4QWE A;  1HMV B;  2BE7 D;  1OYD A;  2R7T A;  2BA9 A;  2A0F B;  1NSQ A;  2BW2 A;  2DRD A;  2R7U A;  2ZUG A;  3EGZ A;  2DHS A;  2XI2 A;  1WEZ A;  2BM1 A;  2RNE A;  1W2I A;  1WC0 A;  1R6V A;  2XHW A;  3DDN A;  2VQE J;  2EFN A;  5HMX A;  4LR7 A;  4PUO B;  3ET6 A;  3CCS S;  2Y0B B;  4GKK F;  2B9W A;  2BXJ A;  2OD6 A;  3IG1 B;  3E2E A;  2AWZ A;  1CJV B;  4W98 A;  1RTI B;  4ZVO B;  5DJB A;  3G71 S;  1Y3J A;  2MKJ A;  3MAA A;  2WHO A;  2IM1 A;  3GE9 A;  2FY1 A;  2VUG A;  5GVQ A;  3IWL A;  2FIU A;  4DR3 J;  3B4D A;  2E29 A;  1RWM B;  3NS5 A;  4JI1 J;  2MZR A;  4P52 A;  1MML A;  3HI9 A;  8AT1 B;  1EQ0 A;  3NBP A;  4FBU A;  3GSD A;  4YME A;  1LWF B;  2NRE A;  3TZZ A;  4EBD A;  2XHC A;  3P6Y C;  2JLE A;  4UQT A;  1WEL A;  2B3T B;  2DNO A;  1EKS A;  2LDY A;  4IH5 A;  2AT1 B;  5J2M B;  4LF2 A;  3QRR A;  3RAX A;  1CEZ A;  5B7W A;  3GFH A;  2OTL S;  2H1Y A;  2JSX A;  3AB4 B;  1ZS6 A;  2ZH9 A;  1EZZ B;  3DRR A;  4YR0 A;  3AFG A;  3C66 A;  3TVK A;  2C3O A;  1P9Q C;  2MZJ A;  3TQE A;  2WVC A;  3MM9 B;  4A46 A;  2UUC J;  4M94 A;  3B78 A;  4UUX A;  5KT2 A;  5IT0 A;  3MM8 B;  2FHO B;  1V5V A;  1NXI A;  2XY5 A;  1R0A B;  1QAI A;  4NLX A;  4RO0 A;  4LFA J;  2X1B A;  4ED6 A;  3JSM B;  2V2Z A;  4NEY A;  3IN5 A;  2E7X A;  2UXD J;  3KHH A;  2U1A A;  4RL1 A;  1HQE A;  3BQ0 A;  1Y11 A;  3PVX A;  2M70 A;  4HLB A;  3AQP A;  2YTC A;  1DHM A;  3DRY A;  4YR2 A;  1OIA A;  1HNI A;  2MKI A;  4QIE A;  4K4X A;  1PIL A;  4GC7 A;  1NH8 A;  2GGP A;  2AQ4 A;  5LJ3 Y;  3PJW A;  3LA0 A;  2AGQ A;  3N0V A;  1NJX A;  4OJG A;  2IVM A;  2CYY A;  1NK8 A;  4AFF A;  2FHJ A;  3HVR A;  2ALZ A;  4IR9 A;  1WKK A;  2GC8 A;  3ZC4 A;  2CNN B;  2DBB A;  2MKH A;  3ILO A;  3KHG A;  1WDT A;  2YY3 A;  4DV1 J;  4MFB B;  1GMU A;  2H3E B;  2KU7 A;  5IWA F;  3SQO P;  4NXM F;  5ETL A;  3I4P A;  4I4B A;  5IOL A;  4CZC A;  3OLB A;  1YLX A;  3BBB A;  3OTC A;  5LMN J;  4OYB A;  1FVQ A;  5CHC B;  4DPO A;  2HG4 A;  3QSY B;  4IKA A;  4N56 A;  1F9E B;  1SV5 B;  1JLF B;  2OPS B;  4W90 B;  1IQT A;  2HFN A;  5RUB A;  2OFG X;  3ENW A;  2FPH X;  4LSN A;  2VFU A;  2Z56 B;  3CIM A;  2AEM A;  2MB0 B;  4ZLL A;  2YPY A;  1LV5 A;  3MI7 X;  2MSS A;  4OZ1 A;  2CJ9 A;  1VRU A;  4KJI A;  3TA0 A;  3GR1 A;  2BJ3 A;  2HZC A;  4Q45 A;  3TP2 A;  2O66 A;  4YN3 B;  3PW2 A;  4CLL A;  3ICL A;  1PCA A;  5ETP A;  4YFU A;  3SYZ A;  5AXL A;  5HP1 A;  1UVL A;  4W4M A;  1FDA A;  1G3O A;  4YUD A;  1VQ4 S;  1IKW A;  3O44 A;  4PAB A;  4B3O A;  4ATN A;  1P27 B;  4D3G A;  3RRG A;  3ZZU A;  3AJ1 A;  3CJT A;  1SXL A;  3PYD A;  1S1V A;  4ZPW R;  4FYV B;  2LLZ A;  3HMJ G;  3KLH B;  3OFG A;  2OJ3 A;  2WCX A;  2AJ1 A;  1IKX A;  4J37 A;  1N56 A;  2G0I A;  2OPP A;  3DDK A;  2CZ9 A;  3MEG A;  4TXS A;  3OJU A;  1NDK A;  2V6A A;  2FC9 A;  1Y5N B;  1JKH B;  2CPZ A;  1TL7 A;  1KR4 A;  3HHK A;  1YIJ S;  3LAL A;  4IOA Q;  2VC1 A;  3PW4 A;  3SZ2 A;  1FTR A;  2ROP A;  3ZZZ A;  3M2R A;  4MH8 A;  1S97 A;  2O3D A;  4RUB A;  3D1Q A;  5A8K A;  2W9B A;  3TRG A;  1HL6 A;  2HVD A;  5HK4 A;  4B3R F;  1WOO A;  2IMW P;  3DYA A;  1VDH A;  3NNC A;  4DHV A;  5I42 B;  1Y00 A;  2ASY A;  3HSZ A;  2DHG A;  1YBA A;  2DNL A;  3UO0 A;  3KLF B;  2F8H A;  4Y2C A;  1T05 A;  3MMA A;  3B82 A;  3Q8P B;  1OJ4 A;  1XMO J;  3R27 A;  3UPF A;  5A0Y A;  4I2Q B;  3GZ7 A;  2MLZ A;  1TEL A;  5K14 A;  4UZC A;  4CQ1 A;  3I0R B;  1FWP A;  1WOR A;  3T1H J;  1SJ4 P;  2AZ1 A;  3NAH A;  4IYQ A;  1K9M T;  2Q6B A;  1RBL A;  2ZKT A;  4HTI A;  1P8G A;  4B9T A;  4DR1 J;  5D8H B;  4FNH A;  3C6U A;  2GVZ A;  2ZC4 A;  1GQE A;  5LL6 d;  1N36 J;  3MR5 A;  5L1L A;  3KLV A;  1GEH A;  3K5P A;  5KT4 A;  1O6X A;  4L73 A;  2I38 A;  4F7V A;  3OTO J;  5G0R B;  1WHY A;  3M1V B;  4TQS A;  5G4D A;  3LP1 B;  4I6Y A;  4CIO A;  2YKN A;  5THW A;  2DIV A;  4J7C A;  4TYB A;  4J9L A;  1S4E A;  3HJV A;  2IJN A;  1DTT A;  2HGL A;  4KV8 B;  2AZ3 A;  4LSZ B;  4RX6 A;  3CW2 C;  3UD3 P;  1R0B G;  4EBC A;  4KPC A;  1NPR A;  4ZVE A;  4LRC A;  1WC1 A;  4XAK A;  1D8Y A;  1SB6 A;  3QSI A;  2MQM A;  4ELT A;  4PQU A;  4DV2 J;  2BQU A;  1TKX A;  2V63 A;  4ZP8 A;  4ZPA A;  4BWM A;  3QJP A;  4N76 A;  4P75 A;  1PC5 A;  3B4M A;  3R97 A;  2ZVS A;  3OFE A;  4KO0 B;  1YBT A;  1FI4 A;  4F0H A;  2H5E A;  5DG9 A;  3JAM Y;  1XK8 A;  1RT4 B;  1HPZ B;  3TZW A;  2XLI A;  2MHE A;  3MCM A;  4J9V A;  3RTV A;  1FT8 A;  4J9K A;  3CUN A;  3ILI A;  1SJR A;  3CDW A;  3P5B P;  3GTY X;  5L8R C;  2RKI A;  1KDN A;  2F65 A;  5KFO A;  1CG2 A;  1R27 B;  2DNK A;  5F8H A;  4IOB A;  4OLP A;  5CZX A;  5A2Q Y;  3MAA B;  1FNX H;  2V4R A;  3D6F B;  4C0H A;  3BH6 B;  2JJ4 D;  2CG8 A;  5FD1 A;  1UWB B;  4OZL A;  4C9D A;  7FD1 A;  4JI2 F;  3F0N A;  1VS3 A;  1KOO A;  4CNY A;  2ZZM A;  3L7U A;  1RCX B;  4XO0 A;  3KUH A;  3W9I A;  4K5R A;  2IMO A;  2GVD A;  3KG4 A;  4UQG A;  2CQP A;  2R8I A;  5K5M A;  2X3D A;  4MT1 A;  1AYE A;  2ZHB A;  3BRE A;  1HFE L;  2NR0 A;  5C25 A;  3G8Q A;  1YBU A;  1DLO B;  2HNZ A;  4QIV A;  1V6H A;  3U02 A;  4IO1 A;  2QLX A;  1JWW A;  4FXV A;  1X5S A;  3PYF A;  3QIP B;  4NA2 A;  3KFW X;  1CUL A;  4ZLJ A;  1GX6 A;  3TX0 A;  4ECY A;  3RZA A;  2NSC A;  3ILJ A;  1R8C A;  4DFM A;  1H74 A;  2HIQ A;  4X62 J;  2MZS A;  1R89 A;  3MTJ A;  2YWH A;  3KK1 A;  3M2V A;  3VWS A;  2KL8 A;  3MZI A;  2D3U A;  5HJX A;  1IWG A;  4V19 J;  1M5H A;  1H7X A;  1U02 A;  2KG0 A;  2Z4P A;  4NCG A;  2WAQ D;  1FKO A;  4ECR A;  4TYA A;  3VAG A;  4K4U A;  4EEY A;  5E3P A;  3B6B A;  1X4B A;  2YNF B;  4DR2 J;  1HWJ A;  3HD2 A;  1SUQ A;  3RR7 A;  3A8E A;  3T6B A;  4P71 A;  3EPI A;  4B3M F;  3H5X A;  4EK2 A;  1N33 J;  1VIX A;  2SXL A;  3ULH A;  1N6Q A;  2QC3 A;  3B54 A;  1FRH A;  2L9W A;  4PG6 A;  2CQC A;  3O2I A;  4K4W A;  1WWH A;  2B4U A;  1R8A A;  2M9K A;  3LW5 C;  3HVA A;  1Z2L A;  1DFD A;  1HAR A;  1RT2 B;  2BOP A;  1G4C A;  1NBE B;  1HIY A;  3UCZ P;  2EFG A;  4HTJ A;  2HWT A;  5IC6 B;  1VRU B;  2QZ8 A;  2FVC A;  3M9M B;  4F02 A;  2FQQ B;  3M2U A;  1U1Q A;  1WG4 A;  4A48 A;  4HL9 A;  4EZ6 A;  4U8V A;  3GFX A;  1V3Z A;  3Q8R B;  1XN9 A;  1KVI A;  2DY1 A;  5F0W A;  1KLM A;  3K58 A;  3HHL C;  3HZE A;  2PA3 A;  3A3O B;  3EVM A;  3UDL A;  1QSY A;  4B3O B;  3EX7 B;  3C19 A;  2VZ8 A;  3D3C J;  1WSR A;  2BRK A;  3GYG A;  2NYI A;  2Z0G A;  1IBL F;  2CQH A;  3KOA A;  4BWJ A;  2JFD A;  3V6H A;  2ILZ A;  5IT9 Y;  4Q8E A;  2MJN A;  2Y9H A;  2IBO A;  2RS2 A;  4LBH A;  1T9U A;  2CQI A;  3OVS A;  4XDD A;  3W5Y A;  3Q8S B;  1NSK L;  2ACY A;  4KGV B;  2NLW A;  4LF6 J;  1Q81 T;  3QWU A;  3DLK A;  2ATL A;  2Q43 A;  1U25 A;  1IBC B;  3M6V A;  1ELO A;  1SQG A;  3H5S A;  3L4B C;  2G0C A;  1WHX A;  1M5P C;  2E1R A;  2MQP A;  3DYA B;  4WZQ A;  1HLW A;  2HGN A;  1B70 B;  4OI0 A;  1FEH A;  3CME S;  2OSR A;  4LQ3 A;  4O23 A;  3VCD A;  1S0V A;  4P74 A;  2CPX A;  4ZJO A;  4RUA A;  1HQ2 A;  4WXW A;  2R8K A;  4K4Z A;  3NLC A;  2AJF E;  2FUG 9;  1SI9 A;  3CC2 S;  1B0P A;  1T03 A;  3AXK A;  1WSV A;  1NCL A;  2GIR A;  4ZVU B;  4UOH A;  1OSD A;  3I0S A;  3BSA A;  2E5I A;  2RB7 A;  3CSK A;  2ZOG A;  3PFE A;  5CZV A;  2A1B A;  3UE2 A;  1HBO B;  3BR9 A;  4DR5 F;  2BAN B;  1Q53 A;  4EMD A;  1DTQ B;  1XNR F;  3C6U B;  2RH3 A;  3E01 A;  2DGW A;  3LP0 B;  1XWL A;  2RUG A;  1QSL A;  2JH3 A;  3W64 A;  4I2P B;  3RG6 A;  3V5R A;  3W8G A;  3EZO A;  1T3N A;  1CPZ A;  4CO1 A;  4C97 A;  2N7C A;  1WI8 A;  5LJ5 Y;  1DTT B;  3RR8 A;  4DQQ A;  2ZE2 A;  3OR2 B;  2YQ0 A;  1S1W A;  5GAH U;  4DV4 J;  3IA0 A;  5KOX A;  2I9S A;  1VQY A;  1RWX B;  2WB1 D;  2JVR A;  3ZNJ 1;  2HVI A;  3CCZ A;  1PIE A;  1U8S A;  1VC0 A;  3UQS A;  2R2U A;  2ZFH A;  4WXO A;  1QVF R;  1R3N A;  4OZN A;  4Y0F A;  3TJA A;  2ZNY A;  1Q7L B;  1JXL A;  3CO0 P;  4LF7 F;  2B7C B;  1U6B A;  3LGM A;  1CC7 A;  3IBF B;  1W25 A;  3FSX A;  3R2D J;  1BMQ B;  1URR A;  2XUL A;  3JQJ A;  3T1Y F;  2G4B A;  4B9M A;  1IM4 A;  6AT1 B;  1N4L A;  3OFF A;  1KRP A;  2XMK A;  4GVB A;  2RKI B;  1JJH A;  3W5Z A;  1TQL A;  1E6Y A;  1U48 A;  2HPU A;  1LKZ A;  2XM3 A;  3H2U B;  2DIU A;  3H4B A;  2IRY A;  1MWZ A;  3OLA A;  2J9C A;  1WOS A;  2ZM6 F;  4JI3 J;  4KGZ B;  3UN3 A;  2R7V A;  2XQC A;  5A6W A;  4OV6 A;  8ATC B;  2LMI A;  4GO7 X;  3MR6 A;  3I32 A;  2OEJ A;  3GJT B;  3CO9 A;  1MRO B;  1RT3 A;  4DX6 A;  2KG1 A;  3BQ1 A;  3R7N B;  3OXF A;  2B4O A;  2HFO A;  1B3T A;  4RW9 B;  2RT3 A;  1HI0 P;  3PNI A;  2R7R A;  2MKC A;  1G1X A;  3KLG A;  3PJX A;  5E33 A;  3SI8 A;  3KUG A;  1SJQ A;  2OHD A;  4C11 A;  4ZPC A;  3N28 A;  1MNE A;  1OY9 A;  4FDF A;  5KFJ A;  4KPY A;  4FS2 A;  4EBE A;  1NK4 A;  4ICL B;  2ZDP A;  1EX8 A;  1E6V A;  4IFY B;  2ZDO A;  4IOC Q;  3QJJ A;  2CQ3 A;  1I3O B;  2F4V J;  3QT7 A;  5D3G B;  1GAO A;  2KXN B;  3BGL A;  2VA2 A;  2AGO A;  5BYS A;  2QE5 A;  3EGN A;  4Z37 A;  1H72 C;  3GIR A;  3GJQ B;  2BX6 A;  1ZZN A;  2F4F A;  4K4T A;  1JLG B;  2H4W B;  3W66 A;  3R6G B;  2DCU B;  1Y0H A;  4F3O A;  5CYM A;  4ETX A;  1FKO B;  4WBF A;  4FF1 A;  1HI8 A;  3H59 A;  3Q8Q B;  2RIJ A;  4ED3 A;  4B9U A;  1FEE A;  4PG4 A;  2VIH A;  2DNN A;  1U47 A;  1TKT A;  3MD3 A;  3HT3 A;  1YRX A;  1RLC L;  1JNR B;  2GJF A;  3I87 A;  2E1C A;  3BGR A;  2CPJ A;  4EYH B;  5IZH A;  1TL4 A;  3FEY B;  3DDI A;  3Q8V A;  2J9D E;  1XEZ A;  1KSP A;  3C16 B;  1KFD A;  1REV A;  1U45 A;  4OL8 A;  2MGZ B;  1IUJ A;  3NCQ A;  4DSI A;  1FHT A;  3EPG A;  1AFJ A;  4NYP A;  4KGK A;  3QID A;  2XMT A;  1A0O B;  2PFF B;  4K4S A;  3H5U A;  1NO8 A;  3M8W A;  3KHR A;  3UWT A;  5GAD U;  2XNQ A;  4WE1 A;  1URN A;  2RQ4 A;  4IQX A;  2R7O A;  5D4L A;  2C2N A;  1I94 J;  4U9R A;  4XTT A;  1T95 A;  1PGZ A;  3CTR A;  3GP9 A;  4MJK A;  2M7S A;  5KFR A;  3DU6 A;  4OMF G;  2OGU A;  2K3K A;  4OX9 J;  5KFZ A;  2H5I B;  1RA7 A;  4DX5 A;  4C8K A;  3HM9 A;  2ZBC A;  2DNP A;  4UST A;  1UFK A;  2C2E A;  2LEB A;  2JVO A;  3A1Y G;  2NXC A;  3KDO A;  3TW0 A;  3BGO P;  2UUW A;  1U1P A;  1D0E A;  2KTQ A;  1KWM A;  1ROF A;  2AU0 A;  3DLK B;  4BS2 A;  4FF3 A;  1RHR B;  3DRX A;  2AX0 A;  3C15 B;  3K5L A;  5CAB A;  6FDR A;  2P9C A;  3K8V A;  4LBI A;  2YNI B;  5L9N A;  2B8P A;  3MPD A;  3H42 A;  2EWH A;  4HDG A;  5A8W B;  1KEK A;  1S7I A;  5H9E K;  2PE8 A;  3ZTS A;  1SJ3 P;  1ARO P;  2K8G A;  1HI1 A;  3WX4 A;  5B0B A;  5LMU J;  2ASL A;  2ZZT A;  4CLK A;  1YG0 A;  3IFE A;  4LUB A;  3C46 A;  1UJ4 A;  2VQE F;  4WIQ A;  4ZVH A;  2W7A A;  1RWO B;  5LM7 E;  2V8H A;  4DL3 A;  4USJ C;  3V4I A;  5J2Q A;  3H0P A;  3H4D A;  3D6M B;  4CDI A;  3UDC A;  2PSZ A;  4RZR A;  2HBY B;  2KO1 A;  5DZ6 A;  2HKE A;  3SIP B;  2KZZ A;  3SBM A;  1KLN A;  2XY6 A;  1N0U A;  1TTH B;  4HI2 A;  1FXR A;  2K1R B;  1NJI T;  4IRK A;  4X4T A;  1C4C A;  3PDN A;  2PMH A;  1FNO A;  2JLF A;  3R5D A;  1WF0 A;  1LWE B;  2B4V A;  5KFW A;  4CLW A;  2XYG B;  3DLE B;  3KLE B;  3OVA A;  2QLF B;  1N8R T;  3S8S A;  1JMT A;  4I6A A;  2JOQ A;  1YJ9 S;  4HEA 9;  4I69 A;  3VV2 B;  3QZ8 A;  3EDQ B;  1S1W B;  2EPI A;  1G2E A;  4M5M A;  3RU0 A;  1EET A;  2JC1 A;  5ETR A;  4RW4 A;  1K47 A;  4BBY A;  2GS8 A;  3T5J A;  4U7C A;  3UNG C;  2VG5 A;  1HR0 J;  1TZ0 A;  3MHY A;  3BEG B;  1PJ5 A;  4K5S A;  2RU3 A;  3WIU A;  3DGP A;  3IBW A;  4DCP B;  1TK0 A;  1N5Y A;  3MFI A;  2IY5 B;  4DUY J;  5J1E B;  2BMB A;  3ZTP A;  3CCR S;  2ZC3 A;  3KK3 B;  4DPW A;  4IQM A;  2VU5 A;  1PBA A;  1VQ6 S;  2NS1 B;  4P10 A;  5M2P A;  4QW9 A;  4A8Y A;  3AH6 A;  1RWN B;  2Q79 A;  1JB0 C;  2D3O R;  3KXD A;  4GVB B;  2ABY A;  1SKU B;  5HRO A;  4NL5 A;  4JI8 J;  2HBQ B;  2W9C A;  4DZ6 A;  4CH1 A;  3D1H A;  3NWR A;  2HNY A;  4KHP F;  3DOL A;  4K2X A;  2IYI A;  4DV1 F;  2OLW A;  1JLE B;  2JEG A;  3FCV A;  2JEJ A;  3IGN A;  3KJF B;  1F0X A;  1UEK A;  4X84 A;  1NPK A;  5LXR A;  3UDV A;  2QLW A;  4TN2 A;  1K1S A;  2IVY A;  1LXN A;  2CPH A;  1FXL A;  2M0G B;  5JXS A;  2V9K A;  3MEK A;  2Z2Y B;  3QLH A;  4N8O A;  4M5D B;  3TUP A;  1LXJ A;  1APS A;  2GAG C;  2MQQ A;  3R5A A;  1BC6 A;  4K2J A;  1DRZ A;  2DGQ A;  2XG8 A;  2UXC J;  4OYW A;  2VJV A;  3BS9 A;  3G8S A;  4OZ0 A;  1CLF A;  1VGY A;  2ROE A;  1NND A;  3MEE A;  2CWX A;  1S0N A;  4DUZ J;  3CB4 A;  1NZ8 A;  3CCL S;  2DY9 A;  1S9E A;  2ZZN A;  1TKZ A;  3VTI A;  1IM6 A;  2HFU A;  3VAJ A;  4ELV A;  3D0H E;  2B8Q A;  3LAN A;  4WII A;  5L46 A;  2K7K A;  1HBN B;  3PO4 A;  1YVF A;  2CAJ A;  2QMW A;  4ZP9 A;  3Q86 A;  3CED A;  1Q8K A;  1VYA A;  3OHA A;  3W60 A;  2KN4 A;  4FYY B;  3L9Z A;  3FFI A;  3HHL D;  1WHW A;  3WIV A;  1PYO B;  4G1I A;  2JX2 A;  2XLJ A;  2E5L F;  3EM1 A;  4O44 A;  3H2V E;  1JNZ B;  3QAE A;  1D9F A;  1SJ1 A;  4QYR A;  1TK5 A;  2HQG A;  4ECQ A;  4WKY A;  3MM6 B;  5C2G A;  2EK6 A;  2WVE A;  3I9Z A;  1UFW A;  2W8K A;  4MK9 A;  4OFZ A;  4PXE A;  3TAN A;  2ALY B;  1YSJ A;  3VAL A;  3QQC D;  2CJA A;  1D1U A;  2XZW A;  2ZNZ A;  3P3D A;  2LYV A;  3O5T B;  4L3K A;  2FHK A;  4DR7 J;  4HHU A;  5E2Q A;  3JQM A;  4ED8 A;  2FZG B;  3I5C A;  3BGR B;  2FGO A;  1ZTW A;  2EFV A;  2GW8 A;  2ZH7 A;  3CD5 A;  2HRU A;  3R3T A;  3NG8 A;  1LNQ A;  4PG8 A;  3M8Z A;  1S1X B;  2GA7 A;  2ZH8 A;  3RB4 A;  4CLU A;  1AFI A;  3DOK A;  4B9N A;  3CMQ A;  2LU1 A;  1JJ2 R;  4YB7 A;  3CC4 S;  4UOG A;  3IBC B;  3W2W A;  1RSC A;  4EU0 A;  2UUB J;  3GB0 A;  4BLG A;  2CPI A;  2JEF A;  1BWV A;  3EJM A;  1ZAW A;  4OJ3 A;  3G6V A;  4DR4 F;  2ZH3 A;  3EVW A;  2RU9 A;  4OZ5 A;  4J5O A;  4AL7 A;  2XMU A;  4A8F A;  1FKA F;  3ONQ A;  3GYX B;  2M8H A;  4DR1 F;  4XK8 C;  5CYQ A;  3QBC A;  2B6A B;  4IR1 A;  1HWK A;  2IA6 A;  2WON A;  4H4O A;  1N36 F;  3MM7 B;  1L5U A;  2YNG B;  4USW A;  2KB2 A;  3C6T B;  4BCA A;  2VBX A;  4OHV A;  2IAJ A;  1IKY B;  4GO5 X;  1GNK A;  2YNH B;  4JI5 F;  3UCG A;  3WZ0 A;  3JTN A;  2EG1 A;  4C0B A;  4J91 A;  3MEC B;  2HBR B;  2J7U A;  4GMK A;  2CNL B;  3HFK A;  5DDR C;  5KG4 A;  4PEO A;  1VBZ A;  4YQW A;  3K57 A;  4O4G B;  2KT3 A;  5CD4 A;  3W2V B;  4H4K C;  3FQK A;  1S6Q A;  2EG2 A;  1RTD B;  4QPX A;  3OQ2 A;  1YHQ S;  2E7V A;  3EGV A;  3TNV A;  1PSD A;  1Q78 A;  1IJF B;  3UVJ B;  4LRE A;  2X1G A;  3ELH A;  2ZJP Q;  4G1P A;  4URQ U;  4F25 A;  4DOZ A;  3HT0 A;  1M90 T;  4X4R A;  2OKQ A;  1NU4 A;  2QLB B;  3DOM A;  4I56 A;  3PHT A;  2Q3P A;  4PPD A;  4YB1 P;  5A8R B;  4P73 A;  3A8J A;  1EKR A;  1NZA A;  5CD4 H;  5EWF A;  1H2U X;  1UZD A;  2VG7 A;  1UJ6 A;  4RNN A;  2IC3 B;  3OT9 A;  5F8M A;  3V6D A;  1F5A A;  4ZCL A;  4IG0 B;  4IFV B;  2R7X A;  1U1M A;  3V4I B;  3H8Y A;  2QX0 A;  2VDH A;  2RIL A;  5BYR A;  2I6W A;  2DGV A;  2EBG A;  4LQ9 A;  1GMV A;  5E41 A;  3M32 B;  3UDE A;  4QR1 A;  2RF2 B;  5L1K A;  1VBX A;  3MMJ A;  2XSJ A;  3NMR A;  1FDN A;  2AJ2 A;  4KTQ A;  5FDL B;  3V81 A;  5D15 A;  3D4J A;  5M2U A;  2E44 A;  2FHM A;  4DV0 J;  1AT1 B;  5KG2 A;  2ZH1 A;  2ZOM A;  3KDN A;  2MKS A;  4HVZ A;  4NYO A;  1VRT A;  4TLR A;  3M4X A;  1XMQ J;  1ZOT A;  3OXL A;  3QNW B;  3AQO A;  1N34 J;  4F26 A;  4LF4 F;  2E1A A;  2IBK A;  2D1C A;  4C6A A;  4ZCM A;  4ILL A;  4L76 A;  3SMZ A;  4AQY F;  1T9T A;  3R5J B;  1YGY A;  5E3A A;  5DDP C;  3IRX A;  4CTA A;  2VG5 B;  2BVZ A;  3E8O A;  3HHL A;  5DLF A;  1GX5 A;  1HNZ J;  2W01 A;  1RT5 A;  1T02 A;  2Z2M A;  3DGP B;  2LP4 A;  3CJK B;  5L39 A;  2QFI A;  1VQS A;  2ILY A;  1MU2 A;  1O51 A;  4PWD A;  2M3D A;  1F3V A;  5F3T A;  3M8Y A;  1BQN A;  3PRV A;  3G4S S;  4KHR A;  4V1A k;  4P2F A;  2HSE B;  1Y10 A;  4RNM A;  1UKU A;  3GCW P;  4N5S A;  2DH7 A;  1RBO B;  4DL7 A;  2YKM B;  4Y65 A;  1D09 B;  3BN4 A;  4HHJ A;  3DLB A;  3IP0 A;  2WVD A;  4NMX A;  2LA6 A;  2UUA F;  3R5C A;  4F2S A;  1TV6 A;  2VAS A;  3PM9 A;  3DLJ A;  1FJG J;  4O3S A;  4LSL B;  1M5K C;  3DLH A;  2HNY B;  3LPE A;  1WF1 A;  1WKL A;  3I82 A;  5JVH Q;  1U1L A;  4OLO A;  1REG X;  4ZVG A;  1Q5Y A;  3EXY A;  4OYI A;  3TX8 A;  4AL5 A;  3GV7 B;  2FYX A;  1Q95 G;  2HND B;  2WVF A;  4ECU A;  1VJQ A;  1HMV A;  3PW7 A;  3OR1 B;  4CT9 A;  1NRK A;  5LSR A;  1QAJ A;  4O3O A;  3C14 B;  2AEF A;  2W2Q P;  1LK7 A;  4RPF A;  1R7I A;  4DQI A;  3VGT A;  4X4P A;  4XIU A;  1R43 A;  2MHN A;  5KT6 A;  4DF8 A;  4YHH J;  2UXB F;  1NAQ A;  2V8D A;  3UN5 A;  2HAF A;  2YWK A;  2HHH J;  2P8I A;  2YQ1 A;  2ZUA A;  3Q0A A;  5DM6 Q;  1PAU B;  4PUO A;  3L7O A;  1MW7 A;  4ED4 A;  2P9G A;  3FBE A;  1X60 A;  1TP7 A;  1F9H A;  3DMJ B;  4QU7 A;  5L9X A;  1UW4 A;  1HYS B;  1C0U B;  1CJV A;  1QAX A;  2HQ3 A;  1RTI A;  4EUV A;  5I3P A;  1TKZ B;  3IS9 B;  4LF9 F;  1PAE X;  4A4J A;  3K89 A;  4P6Q A;  3G86 A;  4DSK A;  4TLQ A;  2CIM A;  4TNO A;  4B3S J;  3W8P A;  5EDW A;  3R1L A;  4G6V B;  3PEJ A;  1LWF A;  3UR0 A;  4O44 B;  2J6S A;  2QV6 A;  2MJU A;  1Z4U A;  1N32 F;  1KD1 T;  3TJ9 A;  5F8J A;  3N6L A;  4UOF A;  2JEI A;  2HHP A;  2Y1R I;  4NZ0 A;  3LH2 S;  4F4W A;  3BSN A;  4JYA F;  4P7T A;  4CLZ A;  2BE2 A;  1D8Z A;  4M5J A;  4JI0 J;  4LVN P;  3DRS B;  2MKY A;  4EFA C;  3MM9 A;  3S01 A;  3N01 A;  3CC7 S;  1LW0 B;  3OL7 A;  4C3M A;  3MM8 A;  4U7U D;  2C42 A;  3LPY A;  4CM0 A;  4WCE Q;  3HF5 A;  2XO7 A;  3TA1 A;  2EFO A;  2D3Z A;  1XQI A;  4X4Q A;  4OYO A;  1IBM J;  2YKA A;  1FWK A;  4LF8 J;  3TR5 A;  5E7O B;  1NK6 A;  1MWQ A;  5KTQ A;  4ZVT B;  2KFN A;  2WOM B;  1B4S A;  1Q7Y T;  3PEH A;  1EJ7 L;  1SH3 A;  3OW2 R;  1RWU A;  4EO8 A;  1CS4 B;  1YIT S;  3TVZ A;  5BYQ A;  5KFB A;  2KT5 A;  2OPQ B;  4OJH A;  1VQ8 S;  5D78 A;  3O8W A;  4RUH A;  3R7S B;  3TYT A;  1KC8 T;  2IFX A;  4KYZ A;  1ZA2 B;  5H9F J;  4WFN Q;  1SQE A;  2D74 B;  2XB2 D;  1SJF A;  4MFB A;  1TAU A;  2BJD A;  2IM3 A;  4UF4 A;  2AV5 A;  3IAS 9;  3BGU A;  3MMC B;  4FNI A;  3WC0 A;  2KFZ A;  2WON B;  2KYX A;  3FRY A;  2DIS A;  4DG1 B;  3BM7 A;  1H2T Z;  2N7Y A;  4AE5 A;  1T7P A;  1KP6 A;  1U1O A;  2QSF A;  1CVJ A;  1F6T A;  4C98 A;  2BKP A;  1XIQ A;  4B02 A;  1MMD A;  2J9D A;  4QQB A;  3PX4 A;  4DV7 F;  1C1C A;  3LQV A;  3MOZ A;  1JLQ B;  1BUX A;  1SV5 A;  4HI1 A;  4F04 B;  2MYF A;  5T7L B;  2QYC A;  2HMI B;  3JYT B;  2W9A A;  4DR6 F;  4QWB A;  3THP A;  4LRA A;  4ERD A;  4WFB Q;  1H98 A;  3IM8 A;  2GV1 A;  4RNF A;  4C2M A;  5DRK A;  3A8K A;  3E51 A;  3QRP A;  4NWB A;  1QY7 A;  4CP5 A;  4NI2 B;  5A76 A;  3HK2 A;  4QWA A;  4AL6 A;  2XGQ A;  4QJV A;  2XZT B;  1YX2 A;  4MYU A;  4CLY A;  2QRR A;  2JLG A;  3R9L A;  1KFS A;  2CVI A;  1Q8L A;  3LP2 A;  2DO4 A;  2CDR B;  1HBM B;  2M2B A;  4Q2L A;  1JLB B;  1XER A;  5C2C A;  5K8O A;  3LOU A;  4X65 F;  3KLH A;  2BAC A;  5LT5 A;  2HFZ A;  3ZTO A;  2DH9 A;  2WSF C;  4J9R A;  2XTJ P;  4BHQ A;  5C24 B;  1SKS A;  4RU9 A;  1GXL A;  4FYD A;  4TU9 A;  1JKH A;  4DQR A;  1FE0 A;  1RA6 A;  2ZOF A;  2E5H A;  3CVK A;  4ZVF A;  2GO9 A;  4NRT A;  4PAA A;  1FKP B;  2J76 E;  1L3K A;  1K1Q A;  4ZDN A;  3GR0 A;  2IJR A;  1X4F A;  3V6J A;  2CJY B;  1CBK A;  5IWA J;  4NXM J;  1Q0N A;  4KFB B;  3D0G E;  1S49 A;  5I42 A;  2E1M C;  3MM5 B;  5HVF A;  1FRI A;  3JSY A;  3KLF A;  2QG9 B;  3LWM A;  3QRQ A;  3R1H A;  1XR7 A;  2VFR A;  2HRT A;  3DKD A;  4ITS A;  2QA4 S;  4OYA A;  3FEZ A;  2BJ1 A;  4I2Q A;  1RU1 A;  2AHO B;  2Z57 B;  1WC3 A;  2LVW A;  2RDI A;  1DAX A;  2FY8 A;  2C22 A;  5JJB A;  4ED2 A;  3M8Q B;  3OL8 A;  4KAI A;  1Q5V A;  2V8V A;  3CF5 Q;  1F1B B;  1U24 A;  3PV8 A;  1VMB A;  2W4C A;  1RT5 B;  5DQH A;  5DGB A;  1S6U A;  4GC6 A;  3M8P B;  3W62 A;  2PT0 A;  3CJ0 A;  4JV0 A;  3CMA S;  3I6P A;  1IXK A;  2OMO A;  1ZAX A;  4AUK A;  4FZV A;  2VH7 A;  3PRD A;  5LSO A;  4M5I A;  1HQU B;  1AZS B;  4MYT A;  4YDD B;  3J7Y I;  4ZKA A;  2GML A;  3VZI A;  3M1V A;  2H48 B;  3LP1 A;  3HCX A;  3KG0 A;  3TUI C;  2BUN A;  4O3P A;  2PDA A;  2ASJ A;  3A3N B;  4NZ6 A;  1BLU A;  4KV8 A;  3BZQ A;  4D3H A;  4ZP7 A;  2A2C A;  2HGM A;  5SUH A;  2D41 A;  2KRB A;  2VOD A;  1CJU A;  2YH0 A;  2BEF A;  2F7V A;  4DCJ B;  4FF4 A;  3FK4 A;  2DR8 A;  2NQP A;  5FJ4 A;  3D3B J;  2FJD B;  2G1D A;  1Y5L B;  4KO0 A;  4QW8 A;  3VQT A;  3I4H X;  4FN5 A;  5T41 A;  2G2Z A;  1RT4 A;  2WBR A;  2E5J A;  4UZB A;  2UU9 F;  1HPZ A;  1RAE B;  3QT6 A;  1QVG R;  1IKV B;  4I6W A;  4B3R J;  1TUW A;  3RBX A;  4TU8 A;  1XR6 A;  2BJ8 A;  1HW9 A;  4DL5 A;  3H7H B;  2UVW A;  1LWC B;  2V4J A;  2LQ5 A;  1BXN A;  1FD2 A;  3GU0 A;  2ZHA A;  1X4E A;  4LRF A;  2L9D A;  4MKV A;  4NRU A;  2YX7 A;  2O67 A;  3B8H A;  2OEL A;  2DGS A;  3VAH A;  1B64 A;  1GXU A;  5KFH A;  2QA2 A;  3M6X A;  1UWB A;  2EXU A;  2FLP A;  2RAQ A;  3LO3 A;  1VJW A;  1RAC B;  4P2S A;  4CRJ A;  4WTO B;  4PQA A;  3DLL Q;  2V2K A;  3AD7 C;  5BXI A;  2JZ5 A;  2IRU A;  2CZV C;  5EWE A;  1OMS A;  1KQF B;  3CJR A;  3H98 A;  3UN2 A;  2BE2 B;  2HEK A;  1JJ4 A;  5SZT A;  2CRL A;  2LEC A;  4RW7 B;  2LA4 A;  1X9W A;  4LF1 A;  1AW0 A;  2F3J A;  4KB7 A;  2DNG A;  5MAO A;  3W9H A;  1RLD A;  3ENV A;  3RUB L;  2HFS A;  2I8E A;  5BJR A;  1DLO A;  4RR5 A;  4ZIV A;  3MTK A;  2H65 B;  5EHH A;  1U2F A;  3J81 Y;  3QIP A;  1F60 B;  2KYZ A;  2MMY A;  1KVJ A;  4I0W A;  2A18 A;  4K0K J;  3J80 Y;  2EKY A;  2AJ4 A;  3TZY A;  1RTH B;  2YPZ A;  3AA8 A;  3PRB A;  3R8Y A;  4HR2 A;  3KMQ A;  1VC6 A;  5IFM A;  1UAW A;  1SVD A;  3TJ8 A;  2K06 A;  1Z2Z A;  2KJV A;  2P5V A;  3F41 A;  2DJW A;  2NSB A;  1ZAV A;  1NEE A;  1UPM B;  4ELU A;  2DNQ A;  4URG A;  4DV6 F;  4LRB A;  3U1N A;  2YNF A;  3RW7 A;  2OO4 A;  4KH0 B;  2V67 A;  5CYJ A;  2OI2 A;  4UY8 T;  5CXT A;  2HVZ A;  4NLP A;  2HYI B;  1U09 A;  2V8P A;  3T9Z A;  3KJV B;  2XEX A;  5GAE U;  1WI6 A;  1GMW A;  1M5V C;  1H0H B;  3OJS A;  3FCW A;  1S12 A;  4ZIT A;  4OYZ A;  2C2R A;  4N8N A;  3AT1 B;  1Q8I A;  2Z8Q A;  3LWL A;  5KFP A;  1C1C B;  1RT7 B;  3NP5 A;  5F9N A;  2CJK A;  2AEJ A;  2J7W A;  1FJ7 A;  3NGK A;  1YKW A;  1T9V A;  3CJ5 A;  2WK4 A;  4ZCK A;  5HMY A;  2B4P A;  5DQG A;  1LFP A;  3BF4 A;  4RNH A;  2AYM A;  1RT2 A;  1DQ8 A;  1HWL A;  2WSE C;  4DJB A;  4FBT A;  1YJV A;  2J0W A;  3G82 B;  1IJE B;  5BR8 J;  1VQK S;  4YR3 A;  3HLU A;  1FRM A;  4TQR A;  4DF4 A;  3O3L A;  5LXY A;  1VQM S;  1WHV A;  5FLX Y;  4Q0B B;  3LP2 B;  3DM2 B;  2PMZ D;  3MMB B;  1C2P A;  1YK9 A;  2QGF B;  1S6P B;  3KLI B;  3FDS A;  4B9V A;  2VZ9 A;  1BGX T;  3POT B;  1RHK B;  3CCT A;  5AXK A;  3EYZ A;  3MWB A;  1TL1 B;  1NDL A;  4Z2X A;  1KVK A;  1O5J A;  4YDX A;  1IBK J;  5DZ7 A;  1UVJ A;  1RT1 B;  2Y1I A;  4JP8 A;  4OX8 A;  4ED1 A;  4R5P B;  3AXM A;  4M1K A;  1R31 A;  4DFP A;  2ZJQ Q;  3N9U C;  4RWW A;  5HL7 Q;  3I96 A;  4USK A;  3QT5 A;  1J2V A;  4M5K A;  3HPO A;  2P2C B;  5L38 A;  4K4V A;  2HHV A;  3NCR A;  4ECZ A;  4NLU A;  2M4M A;  1AUS L;  2AGP A;  5AJ3 F;  4LRD A;  1XBW A;  3DGV A;  1CJK B;  3AAW B;  1P6T A;  4IG3 B;  3T41 A;  3LGH A;  1SC6 A;  4U7U K;  3KTQ A;  2M5Y A;  1SIZ A;  4B3M J;  1UFL A;  1PC4 A;  1NPP A;  3HDS A;  4FYW B;  2DCL A;  5IM0 B;  3ENA A;  4RBU A;  2DHH A;  2PD1 A;  2VQF F;  2UXC F;  1FRK A;  1NH7 A;  1FER A;  4L72 B;  4M63 A;  1MMN A;  1QLN A;  1PYS B;  3M8S A;  1VCT A;  2HVE A;  1R8P A;  3M7V A;  1NHK L;  4MKB A;  3SCK E;  3H40 A;  4CLF A;  3HSD A;  4OQJ A;  3RJM B;  1U2R A;  4Y2A A;  4TKT A;  3N5B A;  1HBO A;  1OS5 A;  1YI2 S;  2BAN A;  4XPE A;  1XR5 A;  1DTQ A;  3KK2 B;  5DQI A;  2DNH A;  4R0E A;  2QA1 A;  3LP0 A;  1NJW A;  1NME B;  4Y2M A;  5F9L A;  3QYY A;  3T1A A;  1X9S A;  2V8G A;  4I2P A;  3MR3 A;  2Q6C A;  5L1J A;  2CQ1 A;  1LK5 A;  4H4K A;  4EO6 A;  2BQ3 A;  2R9L A;  1PJ7 A;  4QIW D;  2X1A A;  5HMZ A;  2I0X A;  2ZBP A;  3N6N A;  4QOT A;  5LSL A;  3Q83 A;  3OR2 A;  3V4M A;  2V94 A;  4DX7 A;  2A6M A;  4RU2 A;  1CJU B;  2KFY A; 
#chains in the Genus database with same CATH homology
 2C2N A;  3CJ8 A;  2VKZ G;  2PFF B;  3PTW A;  5DZ6 A;  2QJ3 A;  3RGI A;  3BV8 A;  2QO3 A;  2QC3 A;  3HJV A;  5CZC A;  3TZX A;  3SBM A;  3TZW A;  3IM9 A;  4RL1 A;  2G2Z A;  2UV8 G;  2VZ9 A;  2VZ8 A;  3H0P A;  1NM2 A;  1MLA A;  2HG4 A;  2G2O A;  3TZY A;  3TZZ A;  2G1H A;  4RR5 A;  2JFK A;  2H1Y A;  3R97 A;  3EZO A;  3G87 A;  2JFD A;  3QAT A;  4QBU A;  5CZD A;  3HHD A;  2CUY A;  5DZ7 A;  3HMJ G;  3R8Y A;  3K89 A;  3IM8 A;  3TQE A;  2G2Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...