3IM8A

Crystal structure of mcat from streptococcus pneumoniae
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
305
structure length
305
Chain Sequence
KTAFLFAGQGAQYLGMGRDFYDQYPIVKETIDRASQVLGYDLRYLIDTEEDKLNQTRYTQPAILATSVAIYRLLQEKGYQPDMVAGLSLGEYSALVASGALDFEDAVALVAKRGAYMEEAAPADSGKMVAVLNTPVEVIEEACQKASELGVVTPANYNTPAQIVIAGEVVAVDRAVELLQEAGAKRLIPLKVSGPFHTSLLEPASQKLAETLAQVSFSDFTCPLVGNTEAAVMQKEDIAQLLTRQVKEPVRFYESIGVMQEAGISNFIEIGPGKVLSGFVKKIDQTAHLAHVEDQASLVALLEKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title New design platform for malonyl-CoA-acyl carrier protein transacylase
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Transferase
molecule keywords Malonyl acyl carrier protein transacylase
total genus 109
structure length 305
sequence length 305
ec nomenclature ec 2.3.1.39: [Acyl-carrier-protein] S-malonyltransferase.
pdb deposition date 2009-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00698 Acyl_transf_1 Acyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.250 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Malonyl-CoA ACP transacylase, ACP-binding 3im8A02
3.40.366.10 Alpha Beta 3-Layer(aba) Sandwich Malonyl-Coenzyme A Acyl Carrier Protein; domain 2 Malonyl-Coenzyme A Acyl Carrier Protein, domain 2 3im8A01
3R97A 2G2OA 2G2ZA 3RGIA 3TZXA 2VZ8A 2JFKA 2QJ3A 3CJ8A 3H0PA 1MLAA 1NM2A 3QATA 4QBUA 3TZZA 3PTWA 5CZDA 3TZYA 4RR5A 2JFDA 3R8YA 2C2NA 2HG4A 2CUYA 3K89A 2PFFB 3IM8A 5DZ6A 2UV8G 3TQEA 2H1YA 2G2YA 3TZWA 2VKZG 3IM9A 3BV8A 4RL1A 3EZOA 3SBMA 5DZ7A 5CZCA 2VZ9A 3HHDA 3HJVA 2QO3A 3G87A 3HMJG 2QC3A 2G1HA
chains in the Genus database with same CATH superfamily
5IV3A 2J8AA 3KLVA 2NXEA 2G2ZA 4PWUA 4U7CA 2IVFB 2KYXA 5GADI 3G6XA 2BQ3A 5ETKA 1UWBA 2EFOA 2LEPA 3RR7A 4JI1F 2F5GA 3MM8A 2BYCA 4Z2XA 1U1RA 4WU2A 3D54A 2VJVA 2EK6A 4OFZA 2V0NA 5HBMA 3KK1B 3BO4A 3D4JA 3QFHA 3KLHB 2ZDOA 3RZAA 3DOKB 1NKBA 1IJEB 2MKHA 4ED7A 1KTQA 5KFGA 5KT6A 1N32F 3G6YA 1VJWA 5L8RC 3ZZYA 3UCZP 3G87A 1N0VC 1RWPB 4KH1B 4OJHA 4GC7A 1JJ2R 1HQUB 1FX2A 4URGA 2AYGA 2YPZA 2C3PA 4B3SJ 4RKUC 1PC5A 2D7SA 3Q86A 3ZZTA 1R89A 4R0EA 5E3AA 4F04B 3MCOA 2R3VA 4FYYB 2BE2B 5HQLA 1REVA 4DV6F 3ISND 3KMSA 5K8OA 3SXLA 3TQEA 5FDLA 1D9FA 3HSJA 1NNDA 2ZOGA 3CCTA 2PEHA 3C14A 2R8GA 2NQPA 1Y5NB 2R42A 2B51A 3DC2A 4B3OA 3OUYB 1GXLA 1R8HA 3M8QB 3IFEA 5HATA 1X4AA 4B02A 1WJ9A 2X3GA 3UO0A 4C7QA 2CJXB 3G6VA 2YNGA 4ERDA 3FMBA 4YS2A 4LSLB 3MFHA 1SQGA 4FXVA 4S0MA 1N6QB 2DVIA 4M5MA 4FYDA 1IKWB 1EETA 1VC0A 1VGYA 1RTJA 4NLWA 1M1GA 3CJTA 2JEIA 2RAQA 3D3CJ 4DR2J 4NASA 3BKUA 2DR5A 4WK3A 2KT3A 1T9UA 1JKHB 2H65B 2QLJB 3FKBA 5B7WA 1P1TA 1J5EJ 3OXLA 2EFNA 1XN9A 5DRKA 5KFFA 3QZ8A 4K4SA 1GTEA 4RUCA 1RISA 3NGSA 4IFYB 4YB1P 1J5OA 5J1EB 2ZH3A 1KLMB 4X4NA 3HPOA 4X4TA 5DM6Q 3EXCX 4MTPA 2UXDJ 3C15A 4HR2A 4QPTA 3JTPA 5KFHA 4IDKA 5E2QA 4I4BA 3SCKE 2CJ9A 4IFYA 2W2MP 3OFFA 4GMKA 2XS2A 2N3OA 1NSAA 3ZTOA 2V8PA 2GMJA 3TO8A 3GR1A 1RT2B 3G8QA 3HO1A 1MWQA 5ADZA 2C3OA 3ZXWA 3UE2A 2G0IA 2OPPA 3KLIB 1B64A 2OAUA 2PMWA 1PAUB 2V5HG 3VZHA 2PN6A 1PYTA 3T1HF 4ID8A 3MAHA 3TVYA 5LSOA 1AFIA 2OUGA 3BS9A 2DNQA 3N6MA 4NLYA 3TOQA 4DV4F 4O3RA 2NZ4A 3KNGA 1N52B 4ZVGA 4U95A 3P6YC 2EG1A 2VPZB 2MYFA 4FPIA 4RBVA 1F9EB 2RUGA 2AHOB 3UDEA 4G6VB 2E1MC 3HDSA 1K8AT 1BMQB 2BJEA 1C0UB 2J7UA 1BD6A 3LA0A 5K14A 5E33A 2RQCA 1GFWB 3JSRA 2Y9HA 2FLNA 2DHGA 1FXDA 4DBQA 4DCPB 7FD1A 4WFBQ 4FVCA 4O3QA 4CCHA 1RLDA 2BJ1A 1IBCB 2KTQA 2IM2A 2GCFA 5CZXA 3TZXA 2YQ3A 2CQHA 4DSJA 4ILLA 1RHMB 2ZC4A 2ZOMA 2CQIA 2P9EA 4Y2KA 4ZVUB 4HVZA 4NA2A 1FKOA 5HLFA 2C2EA 4GO5X 4MKAA 4OYAA 4C8OA 1KHVA 3CIZA 1SC1B 1SIWB 2ZH1A 4F02A 4UUXA 4NE9C 2OIHA 2UUAJ 1ZOTA 4Q0BA 2HHSA 1Q8IA 5D4PA 2WOMB 2F1FA 1XR7A 3IR7B 1VDHA 2W7OA 4ER8A 1WC3A 2I9SA 3BYPA 4PWWA 1KR4A 4J9OA 2AD9A 2FGCA 1E6YA 1GK8A 1AUDA 1HD1A 2M9KA 5A8WB 5L9XA 4ZOSA 2V9WA 2K8GA 4BC9A 2E7XA 4YEAA 4AT1B 2XY5A 4C9DA 3KUHA 3QPIA 1ULRA 4P10A 2V2KA 2OEJA 3FQLA 1RHJB 2CZ4A 4CNZA 1HNIB 4EZ9A 4U7UD 3OPKA 1T11A 4CQ1A 4AFFA 1TKZA 2FZCB 2ACYA 1ZA1B 2XZTB 5BR8F 1ZTWA 1VC5A 3AJ2A 3NGUA 3IXQA 4G1IA 3TWZA 4Z7YA 3AOBA 3N5FA 3CJ2A 3EVOA 4I1TA 4GVBB 4RW6A 5LMNF 3ENAA 2ZBQA 4LSZB 3VAKA 5GAEI 2UVUA 4I6WA 3OL8A 3K89A 5CYMA 3Q8QB 2W2NP 2MJNA 4DR1J 2CVIA 2VQFJ 2DPJA 2YWHA 2O3DA 5ITHA 1FX4A 4U67Q 3T1YF 2A6OA 2B7BB 1QE1B 1DQ9A 2AEJA 2HFOA 4TY8A 2V4RA 4X4VA 4X4PA 2JEJA 3M8YA 3GE9A 4WCEQ 4P7TA 4HHUA 5I3UB 4UY8T 5F9NA 4EYHB 2MQNA 1VLYA 2KZZA 1SKWA 2HRYA 4L76A 4NLXA 4JUZA 5HMYA 4OX9F 1YDLA 4A8OA 4C3KA 2VFTA 3O44A 2W2OP 2KFYA 3FCHA 1IKYB 1GX6A 2B4OA 3I32A 4ZVQB 1FESA 3FFIA 3G8SA 3PW0A 1SVDA 1BQMA 3CT9A 2CA9A 4BLGA 1MSWD 3TJ9A 1NSKL 2HVHA 3M6VA 5AJ3F 2B3TB 3I82A 3WZ0A 1IXKA 2GA7A 4Q8FA 3KNAA 1T7PA 2FJAB 1CQNA 4N47A 4P6QA 1NJYA 3BKTA 1IKWA 1EETB 2FC8A 3IRWP 4DR4J 3I5BA 1BLUA 2KT5A 1X7VA 2V8HA 1HHTP 2MQMA 2DNPA 3MOJB 1XTZA 1V9OA 2FJDB 2V4JB 4JI1J 4F67A 4FNIA 1KRPA 5C2CA 3J7YI 3QO9A 1A6LA 3QGPA 3ZTSA 4EBCA 2V2ZA 2O5DA 1VBZA 2OEKA 1B7YB 3GYGA 3ULHA 1NJIT 4EUVA 4PQUB 1X4FA 3A8JA 2EWHA 3W5XA 1KLMA 4PWDA 3E01B 3BSCA 1DTQB 3H2LA 4DL6A 2CQCA 1WSRA 1TL7A 1MROA 2HZAA 2OJ3A 3KLGB 4JYAJ 3GFYA 3WHIA 1DJ0A 3MEDA 3MOZA 5CQGA 2E1CA 1XMQJ 2DHAA 2QSWA 5LXYA 1RADB 2D41A 3M2VB 1DTQA 2HEKA 1O8BA 2QLXA 1N54B 3G86A 1KONA 2PO4A 2DNKA 2OPPB 3GB0A 5IOLA 1WC4A 1WKKA 2D69A 1TL3A 3PJXA 4EO8A 5KOXA 1S9EB 3P96A 5AXMA 3J81j 4X4UA 2CRLA 2KM8C 2HIQA 1FK9A 1NZ8A 3M6XA 2CPYA 3KK3B 3H25A 2LECA 1ZA2B 2EC2A 2FGOA 2LFVA 1R8BA 3MM7B 1EAYC 4LR8A 2JWNA 4CI0B 3M4XA 3S01A 5KG4A 4H4MB 1KQFB 3HHNB 2HGNA 1Y9OA 4YHHF 5EGYA 1N4LA 4R5PB 5KT5A 2AJ0A 4NLTA 4Y2CA 2YWEA 4KQZA 3MWBA 2DYAA 3GG0A 2P5VA 2YKMB 4FYVB 4O4RA 2Q79A 2MLZA 3AA8A 3BN7A 1C0UA 1RAEB 3I5CA 4BBYA 2X1FA 4M5HA 2CJKA 2W01A 3J7Z5 1HBMA 5G4DA 4UUWA 3T19A 2E44A 2PFDA 4KGKA 1BY9A 2CQPA 3DI6B 3PNIA 2YKNB 4M5NA 2Y8YA 1JLFA 4UZBA 1VLOA 1S1XB 3D66A 1R43A 4NRUA 5HLFB 4B3RF 1HYSA 1OS5A 3HHDA 1N5TA 2MZQA 4KH0B 4LF8J 2FC9A 3OW2R 3GPAA 4ZLJA 1VBXA 1RAIB 2AV5A 5IC6B 1RZMA 2XMKA 5IZHA 2UXDF 2QLWA 4USVA 3DRRA 3TVKA 2MJUA 4C6AA 1EHWA 4B3OB 1SL1A 3E51A 5CD4A 1RE1B 2DNNA 2P6TA 1JLEA 5GAHU 4QYZK 1PJ5A 4O3PA 4DX8H 4ECZA 3RW7A 2GO9A 2YNGB 1LKZA 1Y10A 3MM5B 3DRRB 2W7PA 5LM7E 1CJVA 2HZVA 3LP2B 4N76A 4Y2MA 5DQHA 4WF9Q 4KIAA 3OR2B 4TXSA 4LF7J 2UXCF 3V2UC 2U1AA 3M32B 3BGRA 2P2CB 1RHKB 3AAWB 2R7XA 1WKLA 3FDSA 4NMXA 4RL1A 1GEHA 4F8RA 2DEJA 3P45B 4O4GA 2HVIA 1ZPWX 4RW6B 1X9SA 1SIZA 1X8DA 3DLGA 1MROB 3CDUA 1N33J 1YBUA 3CDEA 2HQFA 2LCWA 1FEHA 2WB4A 3DCAA 4J37A 4CLFA 2FLPA 3D3BJ 3EM1A 3DN9A 1D1UA 1NUEA 1OSDA 3M1VA 3F56A 1Q8LA 4IG0A 1O0PA 1V6HA 3Q83A 1MMLA 2MGZA 3GMGA 2VFRA 2IIHA 5C42A 2PC6A 1VQ9S 3TA1A 1FO1A 3SV3A 4P2XA 2LVWA 3OL7A 2ZFHA 4LF4J 3TARA 2DPIA 1IVZA 2XO7A 3VAFA 2AYBA 3HVWA 2Z30B 3UI3A 2FTRA 4RR5A 4OYPA 5IT9U 1N36F 4ED4A 1YZ6A 2HWIA 1V3ZA 3WC0A 3DGPB 2N4DA 4LF6J 4K0KF 2JLEA 1URNA 3HXMA 3R2CJ 3D6FB 1L5UA 5A0YB 4ECWA 2RH3A 3MM7A 1OO0B 2K1RB 3HHKA 3K5PA 4C0BA 3SYZA 2ASDA 3W64A 2BQRA 2QMUB 3E2EA 2XWYA 4L74A 3M8ZA 1LWEB 2C3YA 4DQRA 3QT8A 3C8YA 5IT0A 1R8AA 1BQMB 3SDEB 3L7PA 1CULA 1ZM4A 3CVKA 4LBPA 5ETSA 1SJ1A 2VG5A 1CQMA 2UP1A 1RKJA 1W26A 2PI4A 2MTLA 4B17A 4CT9A 1RT4B 4FF4A 4QYRA 4RW8A 3CF5Q 3PEJA 2UXBF 2CPJA 2XBPA 4L3KA 4OLOA 3PRVA 5T41A 1CJKB 2VDHA 2MKCA 4K2JA 2CQ1A 2FPHX 1RT4A 4M5JA 3QO9B 2MY8A 3I6PA 3PX6A 3D0GE 3BPSP 6FDRA 1N48A 1Q4RA 2L9DA 1TAQA 3NGKA 5BR8J 1HQ2A 2IBKA 4NLGA 1M5VC 5KG1A 2B9EA 2RJZA 1Q86T 1TTHB 3VTIA 1FKPB 3A1YG 1BWVA 4B3TJ 2CVEA 3KJVB 4LVNP 1FD8A 3CDWA 5L1LA 2ASYA 3WX4A 3V4MA 2VC0A 4YB7A 1HWLA 2ZKTA 2ZUGA 1Y3JA 4DX7A 3BKFA 4LF2A 3OJUA 5KFXA 3IAS9 4C11B 2XGQA 3SV4A 5C5JA 1HI1A 4PPDA 2CJAA 2Z0GA 2BA9A 2F40A 3K5LA 2ERRA 1BE4A 4QU7A 4LR7A 4WWSA 1XIQA 2HAIA 4G65A 4LFAF 2J6SA 5DG8A 1UVMA 4OX9J 2B9WA 4P2MA 1X5OA 3LF0A 1VQ5S 1IUJA 3D6TB 3PW7A 4WXOA 2QMWA 1WDTA 4U8VA 2WSEC 4P2FA 4PXEA 1AXQA 1P9YA 3TX0A 1HL6A 4ANDA 1ZTTA 1H38A 2HHPA 5C42B 3Q8RB 1HNWF 2XB2D 4GVBA 4E98A 5ETTA 2OSRA 1FTCA 3M30A 4DFJA 1Y4ZB 1H2VZ 2FVCA 3AT1B 3MM9A 4ZIWA 2GO8A 1YK9A 5JUMA 3DRPB 4HTIA 3JQJA 1KS2A 4A8XA 2YNHB 3LAKA 5CZVA 3KJFB 4NA3A 2KXHA 2UVWA 4CO4A 2CPXA 4TY8B 3UNGC 1S7IA 3QSYB 2MHNA 3UFCX 2WRMA 2RS8A 2BX6A 5DZ6A 2BV3A 3ETOA 3IAM9 2E7WA 3IG1B 4F0MA 2ACMA 4NLRA 4ICLA 2G2YA 3ZC4A 1QD1A 2YKAA 1W2IA 3D6MB 4I0WA 1S10A 3KHHA 2DGOA 4WBFA 4BDPA 4E0DA 5E7OB 1XK8A 3KUEA 2IDEA 4F4KA 2IYGA 4Y00A 3R7BB 3PVXA 2HBYB 4XK8C 2O66A 3LQVA 2Y8WA 2R8HA 4A8YA 4ZVEA 5C25A 2HNZA 3EXYA 4CIOA 2CG8A 4LVOP 3OFGA 2PA8D 2DCLA 1VQSA 5KG7A 5J2NA 2PI5A 1S6PB 3L3CA 4DSLA 4TYBA 1H7WA 1EP4A 2IC3B 4G1QA 3MR7A 4P75A 3G4SS 3C2PA 2CWKA 3U27A 3CC7S 4UF4A 1D9AA 3FBCA 2PE8A 2OTLS 1RT7A 3JSMA 1S0OA 4I68A 4WK1A 5D0EA 1EP4B 2ZWPA 4G1QB 2IA6A 1NSPA 2QGFB 1NB7A 4J9QA 1YVFA 1QUVA 3PEHA 4OZJA 4CLTA 2WHOA 1DARA 4DX6A 2Q43A 3Q8VA 3UR3C 3R9LA 4CO0A 2E9RX 2RHQB 1XMBA 5F8NA 3I0RB 4QIWD 3M2VA 3BQ1A 3UWTA 3WIVA 2X3DA 4NLUA 3PKYA 4W4MA 1DFDA 4MFBB 3BSAA 4C97A 5DQGA 1PBAA 4UQTA 1IKXB 2BZ2A 3GU0A 3PV8A 2AU0A 1KQSR 2IAJB 1TL3B 1S9EA 2C2NA 3J7A1 1I51B 1X4BA 3QRQA 4LF8F 1WEYA 1AYEA 1T9XA 3KWMA 3SDEA 3TNVA 1WUUA 1T05B 2XMUA 4WTYA 2KVIA 3DDKA 2O67A 3N6NA 1ZPVA 1N5YB 4GKKF 3DRPA 2OKQA 3O8WA 1H73A 2FZGB 4ZLLA 2CDQA 2ZH6A 4W92B 3OVSA 3MPDA 3P8BB 2HK3A 4IH6A 1U25A 3SQGB 4K4WA 5CYJA 2J6TA 2YKMA 4AL5A 2RKIB 5AXKA 3SCJE 1RT5A 2XEXA 3MCMA 2MQPA 5F8MA 5THWA 3RAXA 1RA6A 4P72A 3MM6A 1VIOA 4OZNA 3QZ7A 3HT0A 1KOHA 4CTAA 1O6XA 1PAEX 4M94A 4K2XA 1FRMA 1S1UB 2YBVA 4WJBA 3FSXA 4KO0A 2ZHBA 2AKWB 1S1XA 1TK8A 2KU7A 1OY6A 3I0SA 4LF5F 2CNNB 1WF1A 3FBEA 4CTAB 2AW0A 4A8SA 1JK9B 2H1YA 4ED8A 1MU2B 4JI8F 1EZZB 2AGQA 3EE3A 4LSNB 1H7XA 2HHUA 3ZO7A 4ZP7A 4C11A 4DR7J 3IWXA 5KFWA 2B9YA 2OEMA 4LQ9A 4UTGA 1FJ7A 2VA3A 1S6PA 1T02A 2ZNYA 3PYGA 1YJUA 4CWBA 3OHBA 2R2SA 4M1KA 1YRTA 2HHHJ 3HK2A 5DDQC 2XG8A 3F73A 3G96A 2UU9J 2HRTA 4P74A 5KFQA 2IRUA 4ANEA 4DUYJ 3D1OA 2HHWA 2XMAA 2D1CA 4ZVFA 2F4VF 1XEZA 1YJWS 3CC2S 1T3NA 2EPIA 4O4GB 3NBPB 1F3FA 2ZM6F 4NXMF 1QVFR 3AD7C 1G2EA 3H8YA 1VBYA 2A10A 2C2KB 2MHEA 2XHCA 3ENVA 2F8MA 3M1VB 2UXBJ 5F9LA 1K0TA 1F60B 4MAKA 4ILMA 4NXNJ 1XWLA 2J9DA 3OLBA 2GVZA 1HNZJ 4RU9A 4MKBA 1WOOA 1UPMB 2A0FB 3G82A 3TYTA 1IR0A 1YSJA 2W4DA 2BKPA 3MEKA 4NYZA 3DGPA 2FZKB 3EX7B 3PYDA 3IG1A 4A8KA 3DKDA 2FJBB 1HR0F 1UEKA 2HQ3A 1UJ4A 2M3DA 2VFUA 2CG4A 2XMJA 1S72S 3W3SA 1SB6A 2DR6A 3FGVA 2CQ0A 1FWPA 1LWEA 1U0SA 1FHTA 5F41A 5K8MA 2K7JA 3CGIA 3LO3A 3GFZA 3MEGA 3W60A 4NLQA 2J6UA 4UOHA 4O3OA 3CCUS 3TAQA 3L95X 1V5VA 1WHXA 5D78A 1GAOA 4IRCA 2AX0A 5J2NB 1CVJA 4WFYA 3VAMA 1I5OB 4QYZJ 2M8DB 2OPSB 4K59A 1Y5LB 3KJQB 1NPKA 4NWBA 4OI2A 4WIQA 2N4CA 1HQEB 2H4YB 2OD4A 4OV1A 1JB0C 5D0HA 2GQCA 5I3QA 4M63A 2KM8B 3D9BA 4DL5A 2B4VA 4RLEA 3CD6S 4HACA 4MIBA 4QPXA 2LXFA 1FJGJ 3O1LA 1H72C 3FUYA 2B5JA 2ZE2B 3IP0A 4B3MJ 1QM9A 5ETVA 5G0RA 3H5SA 1GXUA 4X66J 1YITS 4PAAA 4DV3F 1HNWJ 2ZZTA 2W2QP 3E3XA 3TZYA 3KJVA 1RACB 1RAAB 2LMIA 2RT3A 3R5BA 2WCXA 4CO2A 4IR9A 2MKYA 1SC4B 2ZE2A 1SH3A 2QT7A 3PM9A 5KFVA 3BQ2A 5A8KB 2IPOB 4WP9A 3DLLQ 2HQDA 3CD5A 3OL6A 2YWKA 5E3QA 2EEYA 4DPXA 1WEXA 1VQ4S 3LPYA 1V3SA 4ZCIA 1P6TA 5JJBA 4MFBA 3BZQA 4OYWA 2APOA 3SCLE 1FNXH 2HHQA 1YRUA 4NCGA 2AYEA 4PABA 1K73T 2QTWA 3VGTA 4DQSA 4DUZJ 4P71A 2Q3PA 1HNXF 3NBPA 3SZ2A 4NCAA 2PGCA 1U1PA 2OPRB 2W2PP 1NK6A 4ELTA 2XI3A 2DIUA 3SQOP 5B0CA 5KT3A 3VR1A 3W2WA 3OTOF 2RKIA 3TA0A 2R7RA 3P4UB 2A18A 1RJJA 1X60A 3G82B 1HNVB 1U09A 3D6HB 2K06A 3H98A 4F25A 3TQ1A 5KFPA 3BSNA 3RRKA 1X31C 2X1GA 4MT1A 3VQTA 4HTJA 2JNJA 3W2WB 5IM0A 1NJWA 1M5PC 1DHMA 2B9XA 1PSDA 3CNQP 4RUAA 1MMDA 2C28A 1S1UA 1F6TA 2CZ9A 1FEEA 2FJEB 4RNHA 3UW1A 5SZTA 1KC8T 3CD0A 3HULA 5IQQA 3CO9A 2Z8QA 4JI7F 2IM1A 2AWZA 2O01C 1DQAA 5H1SV 4KKOB 1AUSL 2HBZB 1S79A 2RB7A 2VBWA 2ZOFA 4AYBD 2IA0A 2BW2A 1Q16B 1A9NB 2Y1JA 3CCVS 3VGSA 3U02A 5KFKA 5EHHA 3UN5A 1DLOB 5HVFA 2MPUA 2V2VA 5K20B 1WSVA 2V9KA 3HHLA 3W8GA 2HGLA 3NAIA 1C4AA 4KKOA 3GJTB 3M8PA 4M5LA 1Y7PA 4C98A 2DBBA 3EZ5A 4QCLA 3HHLD 2MQLA 4XAKA 3L09A 3KDOA 4XO0A 5JVGQ 1YTYA 3V6JA 4OZ1A 1NJXA 3Q0AA 4DQPA 4C8MA 1VFJA 1OYDA 1RWXB 2FLOA 5DDRC 2EW9A 1FWLA 2W8KA 3I96A 2B5JB 2DNGA 3EJMA 4ETXA 4DV1J 3CEDA 2Z58B 1FA0A 1S5ZA 3S7RA 4TU9A 4ILRA 2YVSA 5B08A 4BC7A 2C2RA 2GW8A 2DHSA 2E9TA 4N56A 2XSJB 4RUHA 4ZP8A 4R8UB 5HMZA 2AQ4A 3UCUP 1CJTA 4KT0C 4PR6A 4DPTA 1X4HA 4O23A 3M9MB 3ITHA 3QGHA 4DL3A 2QL9B 2V34A 4FF3A 2DGUA 1YKWA 1N5SA 2OD6A 2ZITA 5L1IA 4PXDA 5IC4B 5EWEA 4KFBA 2OMOA 4IFVB 3R1HA 4DL4A 4KTQA 3I0RA 3UPFA 1L3VA 4CLZA 3W5YA 1OY8A 1R8CA 1RK8A 1TUGB 1LWXA 2BXJA 2FQQB 2QZ8A 2VD3A 4YB6A 1YZ7A 2C42A 3DLKA 2LU2A 2N3LA 3GFHA 4CYUB 2GV1A 4IQMA 2R7WA 3MMCA 5A2QU 3MR2A 5KT2A 2WVFA 3HI9A 4EMDA 5DDOC 3UD4P 2KYZA 2GQQA 2QA1A 3M6UA 3I87A 1WTBA 1WELA 1Z1ZA 3NNCA 1ITPA 2CPIA 3CD7A 4LF5J 1IBLF 3MR6A 3P49B 1TKTB 1URRA 4X4RA 4DFPA 2UVRA 2DR7A 3T5KA 4JI6J 3RRGA 2CFXA 2ZJPQ 1R31A 4V1Ak 3I5AA 2ZBCA 1FD2A 2LP4A 3T5JA 2Y1LB 3RB6A 1JLGB 2IRXA 1KFSA 4L3NA 2UUWA 2UUBF 4Q45A 3NP5A 1N56A 1KHWA 2OLWA 2VFSA 4QIVA 4I7FB 1QAIA 4LF9J 4N41A 1SJ3P 2J9CA 2DITA 3D28A 1ZM9A 8AT1B 3JB9k 2IRYA 1S76D 4W90B 2C2MB 1LV5A 2C22A 3DFEA 3D68A 3A3NB 1V3RA 2UU9F 3SFUA 3GIRA 3VVTA 1UAWA 4DUYF 1L3UA 3VVUA 5LMUF 4F3QA 1FRHA 1O51A 2HNYB 2F4VJ 3QYYA 2RSQA 2HVZA 3V4IA 4PUOB 4YR0A 4B9VA 1KWMA 4ZPTR 3W65A 4NXMJ 1JJHA 3DRSB 3AD9C 2CAJA 4IRKA 1TMJA 1R27B 2VASA 5D4NA 4F26A 3OQ2A 1I6JA 5A8KA 1G4CA 1T9WA 2BANA 5L46A 2V63A 2PEBA 4GKJJ 2VZ8A 3MCNA 1WF2A 2R7QA 5D77A 4EFAC 5HMWA 2P9GA 3QATA 4LJMA 1MWZA 3BBCA 1U8SA 4LSNA 4RW4A 1X9WA 2XS5A 2Q6BA 5GAGU 4JI2F 1R0AA 4ED1A 4IQXA 2MQOA 2D74B 2BANB 2RILA 1VJQA 2HFUA 1NU4A 2UV8G 3IC1A 5BXIA 2NPIA 3S8SA 5F8GA 1PGZA 2LYVA 2WSFC 5CXTA 3CPWR 1HWJA 2ZBIA 3BM7A 2DTJA 2LQ8A 4ES1A 4ES3A 4QIEA 2DRAA 3DXSX 1YJRA 2OPRA 4CLPA 3MM8B 2L41A 4DR5J 4DR7F 4K4VA 2HNDA 2WAQD 3NWGA 1KKHA 3DOLB 1FCAA 1SH0A 1SUQA 3MMAA 3NXZA 3S6EA 4I56A 3VWSA 2PSZA 2QX0A 3AXMA 2VG7A 4OQJA 4DR6F 1S9GA 2IMWP 3GIJA 3CJKB 3KK2B 1WG4A 1PKUA 3HKWA 5J2MB 3V5RA 4CO1A 1FFGB 2FHOB 3BDEA 2R7SA 4B08A 5KAKA 4BWJA 3PYEA 3ZNUA 2RF2B 3QRRA 2VDIA 1UL3A 4ZJOA 5J2MA 1WF0A 2D3UA 2UUTA 4C48A 3L9ZA 3IRXB 2F8HA 3OFEA 3CCLS 1WD6A 2GJ2A 4FKXA 4NI2B 3SMZA 4DUTA 1VQ7S 2BDPA 5EUHA 1FDDA 2RF2A 4O44B 1HMVA 1S48A 3Q23A 2QRRA 3DGVA 3KDNA 4J9RA 1B0VA 2XSFA 3M2RB 1FFWB 1B0TA 1PIEA 2VIHA 3WC2A 1OWXA 1J27A 1B99A 3HHLB 3DRXA 4LT6A 1S49A 4HHJA 1RBAA 4O44A 2XM3A 4CLYA 4M5IA 3IBFB 4X64J 1SKRA 3HMJG 2KL8A 4DHVA 1OPIA 1U2CA 2G0CA 2ZJRQ 1PCAA 1IBMJ 3K5OA 2MZTA 1UETA 2I1RA 3TJ8A 3P5TL 3I56S 1DURA 1NM2A 3K7RA 3J80Y 1QLNA 1Q53A 1RAJA 1RA7A 2HK2A 3QLHA 1P9QC 1A7GE 5HN0A 4ED2A 3UN2A 4C0OC 1Y3KA 1BGXT 5FIIA 2XLJA 4DSKA 1VQYA 1IM6A 3KJNB 5F3ZA 1CSJA 2PMZD 5GADU 4AL7A 4QWEA 2VPYB 3KOAA 4F4AA 1X5SA 2C1EB 4UW2A 2X1BA 3OTOJ 1RI7A 3BH6B 3CCZA 5ETNA 5EWFA 4GO7X 1RTDB 4CM0A 2HYIB 1S1TB 1RT3A 3DOMB 5K8PA 3FSIA 1XNRJ 3CJ4A 3V6DB 4K50A 4LMZA 1JXLA 5B09A 4KPYA 3BJYA 2DNZA 4IOBA 2CJYB 4TLQA 5J2QB 1RTHA 3CJ8A 2JRSA 3OR1A 2MSSA 4IRDA 2BJ8A 4OLPA 4OZ3A 2WW4A 4DPUA 1RT2A 5FD1A 2ZH8A 2RVJA 3U1NA 1NXIA 4ZJLA 2I8EA 3T41A 4JI7J 5IQ6A 1D3WA 5J2QA 2XY7A 1KSPA 3M9NB 4OHYA 1TKTA 3DYAB 3HVTB 3JSYA 4KGVB 1OQ3A 3I4HX 1E6VB 4FNHA 3TAMA 1ICEB 2MEWA 1RUSA 1U6ZA 1RP5A 3EZOA 3MI7X 2CADA 3DDNA 3DHWC 4ZVTB 2LXUA 1JLGA 3FVYA 3TUJC 2VQEF 4ECUA 3RRHA 1KNZA 1HPZB 2J9DE 2FLLA 4WFXA 1R0CB 2HS0A 2XC9A 2LQJA 4NLPA 4YMEA 4IH5A 4DV0F 4LBIA 4FXWA 2AX1A 5F8IA 4OL8A 3RW6A 1AFJA 4CH1A 1RBOB 1HKAA 3CJSA 5T7LA 3FK4A 3J80U 4H4KA 1C1CB 2JJ4D 3B8HA 1KN6A 2WVEA 4H4OA 2P8IA 3AOCA 3US5A 3NS6A 4XDDA 4JOUA 2NSBA 3AB4B 4Y65A 2DNOA 5K5MA 1SC3B 2YTCA 2ZBRA 1VOMA 2RRNA 3PXGa 2EC0A 2XMMA 5HAOA 4ANCA 3QJPA 1KDNA 3T5LA 3BB5A 3EGWB 1BHNA 3PY8A 2J7KA 4KHRA 4LUBA 2RDIA 1UWAA 3NG8A 1Y11A 2FB0A 3CCJS 2KJWA 2F63A 4NRTA 4DL2A 1XNQJ 1TQLA 3GG1A 4X84A 4USMA 4X65J 3V81A 3F44A 1UZHA 1NK5A 3M6WA 3ZFVA 1N34J 1HW9A 2EKNA 1HI8A 3M8PB 3H2UB 3B4DA 2DB1A 2KKHA 1IR1A 4X62F 4Y6IA 3Q2SC 4ECSA 2R8JA 1SKSA 4MK8A 4QBUA 2H48B 1WOPA 1PYSB 4LSLA 4KHPJ 2LEAA 1Y0HA 1AB8A 2K7KA 3IR5B 2GQ2A 3EGVA 3LP1B 4RNOA 4DV7F 1SL2A 1X9MA 3CMES 1WI6A 2M8HA 5HP1A 5GAEU 1H2TZ 1WACA 1U8WA 2W24A 3LGHA 2HFZA 4WYWA 3NGDA 1FWKA 2VG7B 2KH9A 1S9GB 3WQPA 1KVJA 3ILJA 3VAJA 5GVQA 1U47A 3W1YC 4IOAQ 4PYAA 1U1MA 4RO0A 3DOMA 1PG5B 1WC6A 1HLWA 3D0IE 5RUBA 1NB2A 5D4OA 4LF9F 1AT1B 1NDCA 5AXLA 2JX2A 3VZIA 5A8RB 3G9CA 1YQHA 4DPYA 1YBTA 2BJ3A 4FS1A 1XR6A 4ES2A 2XNQA 3NMRA 3Q22A 4NZ0A 2JOQA 4F50A 4U7UK 3C6TA 1VR6A 2MB0B 3DLEA 1C1BB 3NGTA 4F7VA 2LEBA 4ED5A 4NI2A 1B70B 5DG7A 4RX6A 2ATLA 1S1VB 1JJCB 1SQEA 1SV5A 5AE2A 1JLAA 5KFSA 5KFNA 4CYUA 1F5CA 2KXNB 2W4CA 4I2QA 4XIUA 4RBUA 5CABA 3CSKA 1WHWA 3CULA 4ID5A 2NUHA 1UMJA 2R4FA 3BR9A 5C24A 4YY3F 4V19X 1NRKA 2B43A 1JLAB 2H54B 3CCQS 1NAQA 1EJ7L 5CCLA 4C4WA 2HURA 2V8GA 4ID5B 2PD1A 2OFHX 2LXIA 5FLXU 1S6OA 2DXFA 3B54A 3DU6A 5FDLB 1WC0A 4JI2J 4LFCJ 5E5NA 2VBZA 3W2VB 3HD2A 2H4WB 2BUNA 2KI2A 3K17A 1LWCA 2CXEA 2G13A 3M8QA 2E5JA 1WG1A 3IGNA 3TW0A 2IFXA 3J7ZT 4EYIB 2XS7A 2HW3A 2BRLA 3LP0B 2BOAA 2ZJQQ 4YFUA 1LFWA 3NEKA 5I42A 4OZLA 1UTAA 2FHJA 1XQIA 1W2BR 4K7QA 1NH8A 4KGMA 4DLGA 3I9ZA 3MAAB 2ZHOA 4GC6A 1UVNA 4DR6J 3OFHA 1XERA 2ABYA 4Q43A 4JP8A 3HF5A 5H9EK 3A3PB 3HD1A 4MKVA 3BN4A 2A2CA 1TL7B 2NLWA 4QQBA 3C3LA 3R2DJ 2QLFB 5HANA 3V6DA 3CWJA 2JZ5A 1D8YA 4WZMA 2BJ9A 3BYRA 5DLGA 4JI5J 1SI9A 4DS4A 1RYSA 4F3OA 3MAQA 4Q0BB 1AZSA 4WE1B 3N79A 1WI8A 3J81Y 2BOPA 3A4TA 2DK2A 2NYIA 4WIIA 3C15B 4PCQA 1FRJA 4ELUA 1I94F 4IDKB 2H5IB 1E6YB 3GYNA 2E29A 1NHKL 1VMBA 1FNMA 4IH7A 5HP1B 4USWA 4QIFA 1S4FA 1FXRA 1IN0A 2XWXA 1HARA 2VBYA 1S6QB 2YX7A 2ZVSA 1FK9B 3MPYA 4WE1A 3TZZA 3KLEB 1UVKA 3KK3A 1Q7LB 3NNAA 3DOKA 1EIYB 2YNIA 2WW8A 4HEA9 4X64F 5D3GB 3Q8UA 4URQU 1S4EA 2F9JA 3UDVA 3THVA 1IBMF 5E3PA 2MZSA 1IBKJ 1UWBB 3R6LB 3EZUA 5T7LB 1F2GA 4F2SA 5KFLA 1F3VA 4AQYF 2DO0A 1RT1B 5AE1A 2PT0A 4USUA 3TA2A 1NBEB 5CZCA 1U6FA 2OPQA 3H7HB 1RU1A 4K5SA 5KFMA 4W98A 1U4BA 4RJVA 3GV8B 1WHVA 2HWHA 3BO2A 4TU8A 6FD1A 5KT4A 2BRKA 5HI7A 1VQ6S 2G2OA 2ZH2A 1OSCA 1LXJA 1KOOA 2GHVC 4A47A 8ATCB 1RYRA 3C14B 4YUDA 4E8UA 3HSDA 5D0GA 3N9UC 2Z2YB 1VS3A 3A13A 3M2RA 4FPRA 4DR3J 1XMOF 2CUYA 3R3TA 4LBHA 3NMAA 2JC0A 3JXOA 4DLEA 1SJ4P 5GMKa 1HQUA 2PMHA 3KHRA 1IKYA 3PZPA 2KJVA 1NCLA 1NHUA 1H0HB 1IQTA 4CLKA 4OI4A 1L3KA 3C19A 3THTA 2I38A 1QUPA 2ZD1B 2AIRB 1T9VA 4O3SA 1JLEB 2H5EA 3T1HJ 1KVKA 1REVB 2B7CB 2G9OA 3ETMA 2IYIA 3H5UA 4TVAB 2BQUA 2QE5A 3LP0A 1XBWA 2XNRA 1KQGB 2CIMA 1FDAA 5I42B 5KTQA 5U47A 4KR0B 2ZD1A 2W9AA 5KG6A 4RW9B 3GIMA 2GIQA 3DLJA 3JYTA 2QV6A 1OJ4A 5HO4A 2LQBA 4HT5A 1JLQB 4ZVHA 2CZVC 1BQXA 2V4JA 3KTQA 3D1QA 2QJ3A 3AA9A 2VQEJ 2AJQA 2EBEA 5KOWA 2UVVA 1EARA 3KG0A 2U2FA 3Q8PB 5IT4A 2YWFA 1R6YA 3ICLA 3JYTB 4DV0J 2B6AA 3RAQA 4B9LA 1N32J 5GAGI 4PQUA 1RB0A 1FDBA 1NDPA 1AW0A 3GLJA 4XTTA 2J7WA 1RT3B 1K1QA 2KHDA 2NUUG 3DLEB 1U2FA 4FN5A 1NPRA 3JQMA 4L6V3 5J2PB 3AHPA 2ZH5A 3UR0A 1HBOB 4B3SF 2XCAA 2CJQA 3QJLA 1WTFA 2ZH9A 3OT9A 2UUAF 4OHVA 3QAUA 5BYSA 1C4CA 4DV6J 4ECRA 5CA5A 1QE1A 3H40A 2VG6A 2VPXB 2YNIB 2DO4A 3SSSA 3W8PA 2CQ2A 2K3KA 2YXLA 5E3CA 4A4JA 3H4BA 5LT5A 5I3UA 1T03A 4RWWA 4DG1B 1E6VA 2NS1B 3MPVA 2MZ1A 3N28A 1GMWA 2VOPA 3MGJA 1FRKA 1UKUA 1UCNA 1N34F 2CNLB 1T03B 3EGZA 3RJMB 3T9NA 4N8OA 2WVDA 5IT9Y 3AD8C 3QGGA 3QT6A 4TNOA 2R7VA 4USJC 3UN3A 4OYOA 5DDPC 3QWPA 4RZRA 3MR3A 2D3O1 1IWGA 1CJKA 4NYOA 3LGNA 1VRUB 2UV8A 4QW9A 3K2YA 4ZPWR 4DV7J 1TK0A 4IO1A 4WU3A 4DJBA 4U8YA 5I4MA 5AXNA 1D8ZA 2PDAA 3HJVA 2HFSA 4OYMA 2HHVA 4QOTA 2VQFF 2ROEA 2IM0A 4NOHA 3DI6A 2F3JA 3C6UA 3GTYX 4DCOB 1RHUB 2BE2A 2G1HA 2G0JA 5LSRA 3OD2A 4LREA 3DM2A 4ZN1A 1LW0B 2RQ4A 1F9FA 4MK7A 1NK8A 3VALA 2B56A 3CCWA 5CYQB 2H3EB 2FVRA 1DZ5A 1TL4A 4G1PA 3C16B 3OHAA 3BGFA 5M2PA 1RAOA 3PHEA 2KHCA 4IOCQ 1HW8A 3CE8A 4DPOA 2HMIB 2E7VA 1CG2A 2DNMA 3BPDA 5MAOA 1YJ7A 4F36A 3GJQB 1GH8A 3C46A 2QLBB 2NCKL 3PFEA 3UDCA 3CCMS 4KBIA 2DKOB 4KC5A 4PG5A 2XYGB 1S6QA 1JLQA 3MEEB 4UOFA 3WIUA 5DS7A 3GJSB 4YY3J 2L9NA 3LP1A 2NXUA 3GFXA 3H59A 4N7TA 2GVDB 2DT9A 1QAYA 4DFKA 4HDGA 3JS9A 1B4SA 3JTNA 2D9PA 4CLLA 2Q1LA 1P1LA 1VIXA 2DNHA 5L1KA 3BBBA 4N5SA 1CJUA 2BMBA 3DLGB 3HX9A 3BDPA 1UEVA 4YN3B 1JIHA 3MPUB 3TAPA 2MKSA 4IG0B 4DOZA 4KB7A 3KUGA 1X5PA 5L39A 3G71S 1M0SA 1QAXA 4ZLPA 3EPIA 3C6TB 3W9HA 4DZ6A 3H42A 5HVHA 2V8VA 5C2GA 1F5AA 4PG4A 2VG6B 2IJRA 3BV8A 3LTOA 1S7HA 2FHMA 5CYMB 3KKFA 4J90A 3ZZRA 1GXTA 3OBIA 3ILLA 3KLIA 1GQEA 4OI3A 3NAHA 1JX4A 4DG1A 1U26A 4Q2LA 5A0YA 3WX8A 3HT3A 4F4YA 3PFOA 1JLFB 2QC3A 3A12A 1QSYA 1HA1A 1QJHA 4TLRA 5D4LA 5FJ4A 1S12A 1FJCA 4AE5A 1HYSB 1I1GA 3VAGA 5B0EA 2XGPA 4F0KA 1WORA 4YOEA 3PYFA 1FE0A 3VV2B 1M90T 3AODA 3CB4A 1T8EA 1BWEA 2OH2A 4M5KA 1Q0NA 1RTJB 3HVRA 4H54A 4Z37A 2G4BA 1B7FA 1U2RA 1RU2A 2D9OA 4AMMA 1NK7A 2SXLA 3DM2B 2ZDPA 2OFGX 2OP5A 3GSIA 3LP2A 1JKHA 4OHZA 5LMNJ 5H9EJ 3B6BA 4AMOA 3CJ0A 1FKOB 1LK5A 1RT7B 3M32A 2I5JA 4Q44A 1YG0A 2FIUA 1J5OB 3NS7B 4DPWA 1R0BG 1IBKF 1D09B 5E3RA 2R7OA 5M2UA 3FEYB 1XJWB 4J9PA 3T1YJ 1VI7A 4AQYJ 4CLSA 2YWGA 2JLGA 1RHRB 1C2PA 4ELVA 4IR1A 1UJ5A 1IR2A 2G1DA 4B3RJ 5KG5A 2W9BA 2I5JB 5A2QY 4PG7A 2MGZB 4J9MA 3RR8A 3BGUA 1GMVA 2XMVA 3E01A 3OVAA 3RB4A 1X4GA 4C8KA 4ZDNA 1HFEL 2FY8A 1NPPA 2XTJP 3LH2S 3R6GB 1RCXB 3M8SA 2GVDA 2XMWA 3R7NB 1HNIA 3A8EA 2XMTA 2Q6CA 1TKDA 2JH3A 1XMOJ 2Z56B 4E2FB 4DR3F 3QBCA 3TR5A 3L4BC 2J0WA 2I6WA 1RCOB 1NZAA 2K1RA 3SEOA 4LF7F 3HSGA 3AB2B 3NGRA 2NXJA 5D3GA 3MPWA 2HZCA 4OIXA 2COLA 5HJYA 4KRWA 3RGIA 1BC6A 3ENWA 2IDLA 2QL7B 1TKXA 4OX8A 3VQSA 4OJ1A 1N33F 2GIFA 2YKNA 4N8NA 3R8YA 1VQMS 1UFKA 1VQOS 1TMMA 1U0HB 2CNKB 2N7YA 3B4MA 3LW5C 3R5CA 4HLBA 1LOUA 2M52A 4ZCLA 4R5PA 3CJQA 4IKAA 4JI0J 1JMTA 1TKXB 4WXWA 4NPOA 3W63A 3FBBA 1U48A 2QA4G 4B9NA 3PW5A 1A0OB 2EI5A 2HAFA 1U24A 4LF4F 1EKSA 3DDIA 1U0HA 2J76E 4NYPA 4Y34A 3M8WA 1AA1B 1CC8A 1FRLA 2QFIA 1Z2ZA 5CYQA 1Q1KA 1WC5A 2M4MA 3FQKA 4ZVOB 4K4TA 5E41A 1XMQF 4LF6F 2Z2MA 2X1AA 4K0KJ 4ICLB 1MU2A 2H9ZA 1JJ4A 5ETQA 1MG7A 1GMWD 3A3OB 4TQRA 3OSNA 4ECVA 3QWUA 1UA0A 1CJVB 4EU0A 2DJWA 4NZ7A 3G6ES 4DS5A 2BACA 2DRDA 4Q2MA 3MMJA 4O0NA 5DO2A 2PIIA 2R8IA 5M2RA 1Q7YT 1JLCA 3Q24A 3BGRB 4WPAA 4ZVSB 2DHXA 2E5LJ 4ENOA 3JAMU 2XULA 2YQ0A 4Q5VA 3MEEA 2BM1A 5KG2A 5KFJA 4QJVA 2FD2A 3H2VE 5B0GA 2EFPA 4ECYA 2QA4S 4PXBA 2E5GA 2ADCA 2L9WA 1Q8BA 2HWTA 2ZKUA 3CJRA 4I64A 1GTHA 1M1HA 1TKZB 2EG2A 4YHHJ 3V6KA 2NZCA 1S0NA 1TR0A 5J1NA 4DQIA 4R0JA 2VF3A 3EYZA 1ZBTA 3LWLA 3CCES 1EKRA 3AY0A 4RNFA 4OJGA 3RTVA 2AF6A 1TELA 3GIIA 5B0AA 3UNYA 1WHYA 2AEMA 4P9SA 2M2BA 4UOCA 5HVGA 3NY0A 1WWHA 1C0TB 3AJ1A 3BQ0A 2ZWOA 4B3TF 3AFGA 3SCIE 5KFRA 4X2BA 2A1BA 1H98A 2Y0BB 1MLAA 3DMJA 3DRYA 4EEYA 1M5OC 2RMLA 2R2RA 3R5JB 5HSPA 5KFYA 3VF0B 4C8ZA 3PW4A 2E66A 2ATCB 1N0UA 4DR5F 3X1LB 4F0HA 2MQQA 4X4SA 1CULB 2DY9A 5BYQA 4CLUA 2GNKA 2EFQA 3FFIB 4LRFA 4LFAJ 1T0TV 3AOAA 3V6HA 1U49A 3T6JA 2AJFE 1LEOA 4NLSA 3T3FA 4Y28C 4NA1A 2HRUA 1RWUA 5F0UA 3MTKA 3I55S 2UXCJ 2DCUB 1JNZB 4I67A 3SQGA 1D0EA 2CDRB 4AMPA 2WVBA 1HBUB 2V67A 4ZPDA 5C25B 3J7AN 3N0VA 4MMOA 2JVOA 5K14B 3JQKA 3PR5B 3T5HA 1TU0B 4KGZB 1FRXA 1UP1A 2CWXA 2RD5C 1YIJS 4KSEB 4M8LA 3EVMA 1JLBB 3AQOA 4ZS6A 1TV6A 2XYPB 4QZVB 1J2VA 1KEKA 2RRAA 1RLCL 2R2TA 1F0XA 4DDFA 3J81U 1TFYA 1ELOA 2AEFA 4PEOA 2DIVA 3ILIA 5F8LA 1SL0A 4PWDB 1K1SA 1VCTA 2BEFA 2KB2A 5DJBA 5KFTA 2AGOA 5LJ3Y 3I0SB 5D6GA 2W9BB 1KD1T 4AXIA 3MEDB 1N36J 1CS4A 1Z2LA 4MJKA 3Q2TC 1JQGA 3NOGA 1SCJB 2F65A 1JWWA 1CBKA 2HMIA 1LWFB 2Z57B 4PXCA 4Q7AA 2JHEA 4AXJA 4CDIA 1CLFA 2BW7A 1S6UA 5GMEA 3KLFA 4RNMA 2ALYB 1ZAVA 2J8SA 2VPWB 3GCWP 4USKA 1S9FA 6AT1B 4MYTA 2Y3YA 3N6LA 4G3IA 5L9NA 1M5SA 1RAGB 1TL5A 3ZZOA 2IM3A 4UQGA 3Q8SB 1RGVA 5K9FA 2LU1A 3TZWA 4H4MA 1VYAA 1NKCA 4NMLA 3OSPA 4LRDA 2NREA 2VUGA 2ZVIA 2AJ4A 2LLZA 2WVCA 1LK7A 2AZ3A 3LWMA 2PA3A 1C0TA 3QSIA 4ZPVR 4WFAQ 2L3MA 4RW7A 3FNNA 2ZC3A 1N8RT 2WTFA 1Q79A 2UZAA 2E9ZA 1DAXA 1N5YA 4LFBF 2BBEA 1FT8A 3M05A 2WK4A 4ED3A 1IWAA 2LKZA 1WC1A 4JV0A 4USHA 2VHGA 3EGNA 2Y1IA 4WKRA 1RSCA 4FF1A 1DQ8A 4JV5F 3M30B 4LQ3A 1WOSA 2BR0A 2KDOA 3JTOA 2B8QA 3PTWA 1VRQC 4YP3A 1ZZNA 5JXSA 2DH8A 2YH1A 2JVRA 4ZKAA 3FCVA 3KG4A 3IN5A 1FF2A 1RHQB 2HQCA 1H74A 4C2MA 2IJFA 2E5HA 3GWCA 3O2IA 4J9UE 4OI1A 3RAMA 4CP5A 5A6PA 2VG5B 4IUFA 2HPUA 1N5QA 2GS8A 4AD6A 3OV7A 1HBNA 1FI4A 5DGAA 4DZDA 2IHR1 1PILA 2VC1A 3N4WA 4RW8B 2V50A 3RBXA 3UD3P 4FBTA 1JLCB 5DETA 1B0PA 2Y0SD 4PPZA 3NCPA 5ETMA 9ATCB 4C8YA 1IQZA 3NS5A 3WBZA 4R25A 4P7VA 5ETLA 2ZH4A 3MD1A 2ADBA 3CW2C 2WZ1A 3MM5A 2QFJA 1JXVA 5MLCV 1ZM3A 2P6SA 4GKKJ 2EKYA 5IFMA 2JDJA 2DHHA 4QU6A 3LUYA 1VQLS 2I0XA 1P27B 2FJWA 2W25A 4ZCKA 1FKPA 4B9TA 3CDBA 2XSJA 4M95A 2FHKA 3O6QA 4QWCA 3ADAC 2RDJA 2M0GB 4R8UA 2QEXS 4JV1A 5F3TA 1CJTB 2CPHA 2RQMA 2XZWA 3G2XA 2RDDA 4EO6A 4OX7A 4EWTA 2HBQB 4ZPCA 3IWNC 4PKDB 1YI2S 1LWFA 5E0OA 3ONQA 4LIRA 4C3LA 3KLGA 5ETOA 4NCBA 2VZ9A 1MN7A 2MKIA 2CKWA 3PW2A 2Z2ZA 4P2SA 4JI0F 3CJ3A 1X0PA 2AJ2A 2OO4A 4JI8J 1Q5YA 2C2ZB 3Q89A 1S59A 2VBXA 4DL7A 1WNEA 3DLBA 2N7CA 1NK0A 1S99A 1S57A 2FVQA 1PC4A 3U1LA 4M5GA 1QTMA 4KYZA 3AQPA 3W66A 3BR8A 4JI4F 3TX8A 2ZZNA 1KBRA 1T9TA 1UW4A 1D9DA 3POTB 2LDYA 3KG1A 4M5DB 2C2DA 3K8WA 3KHGA 4RU2A 3HKZD 2VONA 4UZCA 3HHLC 5DG9A 3PIOQ 1G3OA 1ZAWA 3HZEA 4J9VA 5LL6d 3VGUA 1VQNS 3HJFA 3ZTRA 4I7FA 2E5LF 3OXGA 4ATNA 1BXNA 1Z4UA 2YX1A 2RS2A 3ZZ0A 5GMDA 5LXRA 4F4WA 1Q78A 2YWWA 5B0DA 3TUZC 1NEEA 3LALA 3SI8A 3FMWA 1HBMB 1KP6A 3B78A 3HVAA 4FP9A 3OJSA 2R2UA 1TV6B 1F1BB 2RUSA 3RUBL 2VICA 2KN4A 4CT8A 1SKUB 2J0XA 4MIAA 4DQQA 1HQEA 3CIMA 4QR0A 5A6WA 2EFVA 5IV4A 1VRTB 1OQ6A 2HFNA 2HG4A 3PRDA 4QIGA 3UDLA 1S77D 3PKMA 1HBNB 2XYHB 2DH9A 2EFGA 3AJDA 3C66A 3L7UA 3MM6B 4FDFA 4Z7CA 1ZYQA 2D3ZA 1CS4B 2GHWA 4PQAA 2HGMA 1SC6A 2C2OB 1VBKA 1VRTA 2HNZB 1HR0J 2ROPA 1TP7A 2J9EA 3MFIA 2AP6A 4DSEA 1RKIA 4RWXA 3ZZZA 3D1HA 1RWMB 4OV6A 2V94A 1IM4A 2RNEA 1T3OA 7FDRA 2DY1A 3CDAA 4J7CA 1RAHB 3QGIA 4YQWA 4YR3A 3EPGA 1TUWA 3OR2A 1MWYA 2XLKA 4B9SA 2KG0A 3CO0P 2EBGA 4NCGB 1HWKA 3ELHA 5AT1B 3ET6A 3OLAA 1ZS6A 1UA1A 4RW7B 1ZH5A 3IM8A 2YKPA 4OI6A 5HL7Q 4XPEA 2R9LA 2H51B 3I31A 3M7VA 5H9FJ 2ASJA 4ECTA 4OJ3A 1SJRA 2Z4PA 4B3MF 4WYLA 3ET6B 1RAFB 4C0HA 4X66F 1YX2A 2YNHA 4HI2A 4DV3J 2LA6A 4GRSA 2KFNA 3DMJB 1DRZA 3PX0A 3UCGA 2OELA 4A8MP 1S1WB 2OTJS 2RE1A 1IJFB 2VJUA 2DGQA 2I2YA 2PFFB 1RTZA 2ZUAA 3KFWX 3DLKB 4DV5F 4OYZA 1WKJA 2CQBA 5EDWA 3POTA 4M5DA 2GZOA 4CH7A 4DMZA 2WB1D 2AJ1A 3H0PA 3HFVA 3W7BA 3MDFA 4WZQA 3RU0A 2A2DA 3IO1A 3M2UB 4IG3B 3TRGA 4Y0FA 1VQ8S 2R7UA 3D5MA 2DNRA 4HL9A 2B0GA 4DUZF 2KZMA 2M88A 1PBUA 4PZVA 5KFEA 4YDXA 3LAMA 3W5ZA 5KFBA 2NXNA 3BH7B 3TANA 3RB3A 5ETPA 4I2PB 1HI0P 2FHJD 2W9CA 3QMQA 5CHCB 4XDCA 1IKVA 5B0BA 4HYKA 5HROA 3EMTA 3MEGB 2DXEA 4L73A 3QLHB 1HBUA 1FFSB 5DZ7A 4ZJQA 4RPFA 3TEGA 4BHQA 2HHHF 2FDNA 2IC3A 5LOQA 1XC9A 2KRRA 2O1PA 2ZM6J 2W8LA 4I2PA 3MUTP 3UQSA 4Y2IA 1JLBA 1G6BA 2Y1RI 2RIJA 3H90A 4IYQA 2DGSA 4LRCA 3R97A 1TAUA 2HHTA 5T14A 2QYGA 1OY9A 1RWVB 1XR5A 2MY7A 2MKKA 1BQNB 5A8WA 3CC4S 4NXNF 4YDDB 1X4CA 4DEZA 3V4IB 2D3OR 1RWKB 5DLFA 2R8KA 4ZLNA 1OYEA 5IS2A 4LR9A 2ASLA 4LFBJ 1HNZF 2EVZA 3AXKA 3ZTQA 3A8IA 2QMXA 4HT7A 4HDHA 1NDKA 2CQGA 4UT4A 1TFWA 1VK3A 1G1XA 1BQNA 3SFGA 1MW7A 3PRBA 2KXFA 4ZVPB 4DN9A 3EWGA 4JV5J 1VHIA 3O3LA 2UUCF 1X5TA 4OZ5A 3P5BP 3ZNJ1 3CCSS 1FRIA 2MZRA 1IKXA 1FVSA 3T9ZA 3FSYA 2ILYA 2IAJA 1VQKS 3QIPB 3KLFB 2DGTA 1WDDA 4C8NA 2CYYA 3J7YU 2W1BA 3DYAA 3GCXP 2HQIA 3HVTA 3MMCB 4WP3A 2IJNA 4QWBA 3HCXA 4ZK7M 2NR0A 2NXCA 1YRXA 2DEIA 1N5VA 1NLKL 1ACMB 1I3OB 2GGPA 3QIPA 4RUBA 3DOLA 3W62A 2XO6A 1SUQB 2M5YA 3OXFA 1HIYA 2HFVA 2V4QA 4DV1F 4URSA 2BKOA 3GQCA 2YQ1A 3DHXA 4LFCF 2J5AA 5CCMA 1YJVA 3MM9B 3VCDA 4EI2A 1HWIA 1MN9A 2JEFA 2ZBPA 1S1WA 3BBFA 1FJGF 3F41A 3W9JA 3FC9A 2ZH7A 4C8LA 5D15A 5CD4H 5F8JA 3QJJA 4KHMA 3SBMA 3VAIA 4J9NA 3H5YA 3TUPA 5K8NA 4PRFA 4OMFG 1S0MA 4HH1A 4EGLA 2XQCA 3CMQA 3FRZA 3P3DA 4KO0B 4ECQA 1RDRA 4CZCA 3CUNA 3GV7B 3HHEA 3HLUA 2GMLA 1NHVA 3GP9A 3BF4A 4PUOA 3HP6A 1YLXA 4DN0A 1FVQA 4WP8A 1SQFA 3PO5A 3QFWA 3QRPA 2QG9B 2V2QA 1YJ9S 3VHQA 2GFFA 3PX4A 1KVIA 3TUIC 3LOUA 2HVDA 4NL5A 3KHLA 1IBLJ 3K0JA 2DNYA 4HHHA 4KE5A 2IY5B 2GJFA 3EICA 4DSIA 4ALZA 1REGX 4JI6F 2WSCC 3D2WA 5CH7B 2ROGA 3TJAA 1U7LA 2M7SA 4ECXA 1HNXJ 1T9YA 3NNHA 3GILA 2UUBJ 2DXDA 3BGOP 4JI4J 3RBDA 2V68A 2H5JB 3EVWA 3ZZPA 8RUCA 1R6VA 5G0RB 4EK2A 4KAIA 4ZP6A 4K4ZA 2BE9B 4MK9A 1DTTB 3D0HE 3PG9A 4TQSA 1ROFA 1U45A 2VODA 3OTEA 1K0VA 1CPZA 1Q82T 3TP2A 3JSMB 4WFZA 4KFBB 4KV8B 3HFKA 3PR4A 4ZVRB 3MMAB 1YGYA 2JFKA 2LQ5A 1U1OA 4F2RA 3MZIA 2VFVA 1U02A 1X4DA 3HFZB 3IR6B 3K57A 2BJDA 2JFDA 1SBRA 4PYDA 3TVZA 3CJ5A 1UVLA 3IWLA 3TEHB 3TI0A 2HKEA 4DU7A 1NO8A 4ZN3A 2XY6A 3MMBA 4BWMA 5GAHI 2C3UA 3DNCA 3EUNA 5DM7Q 4USIA 1MMNA 4I6YA 3RBEA 2LQ9A 3EDRB 4LF1A 3E8OA 3R27A 1OIAA 3W9IA 3OVBA 3IA0A 4I2QB 4NEYA 4Y3CA 3RBZA 3THPA 2KO1A 1MNEA 1Q95G 2CQDA 1U1LA 5EN1A 5EX0A 4JI3F 2QL5B 4EZ6A 1N88A 2WBRA 2CPDA 4DXLA 3SSRA 2CQ3A 3RYLA 4ETZA 1Y5IB 3MD3A 4K8RA 5JMNA 2QIFA 5IWAJ 4HI1A 5JVHQ 1T05A 3I9V9 4PG8A 2F9DA 1VHFA 4JV2A 3A8KA 3K5MA 1F9HA 4EBEA 2XLIA 1SXLA 5KFAA 1JNRB 1TVRA 1UFWA 4U96A 3AH6A 4NZ6A 4NX9A 4OYIA 1HPZA 2QYCA 3SSQA 4C3MA 5HQ8A 2GJIA 2OI2A 4MH8A 1HHQA 1RT6B 2AYMA 4RBTA 5IM0B 2DR9A 2CQ4A 2VA2A 2EK1A 3NCRA 1RT5B 2YX4A 3PIPQ 1HWUA 4ZIVA 3MUMP 4FBUA 2A3JA 2BKNA 4YR2A 2V6AA 1SH2A 4HACB 2L48A 1SJQA 4NLDA 1QDUB 3BO3A 4AMNA 3RB0A 3OTCA 3PHTA 4WTOB 1NJZA 4OZ0A 2ILZA 2BE7D 1GNKA 1Y00A 3MF5A 1FXLA 1TL1B 2VKRA 1FTRA 4OX6A 4ZHRA 2L08A 3F0NA 2BABA 4L75A 5J1PA 1YWXA 2YPYA 5FLXY 2OGUA 1H2UX 5L38A 1QSLA 4PG6A 1NSQA 1QY7A 4O3NA 2M70A 4OYXA 4ZA1A 5BJRA 3VAHA 1TL1A 4OHXA 3UD5A 4CNYA 4ZHRB 1RTDA 2RRBA 5EWGA 2IVMA 4A8QA 2QN6B 2K3IA 5ETRA 2VH7A 3NL0A 3NOCA 3FZBA 2CPFA 4P73A 2AT1B 2CPEA 1UVJA 2IVYA 1WG5A 2XZDB 3NLCA 1TK5A 1LFPA 1HD0A 4DV2J 2AGPA 1BUXA 4DV5J 3BGLA 2KFZA 1NMEB 2HHXA 2FUG9 2K2PA 1DTTA 2RQKA 4ZPBA 1CEZA 4QW8A 3H5XA 4B9UA 4J91A 3KLEA 5KFCA 3GV5B 2Z2LA 4P52A 2VL1A 3ENQA 4JI3J 5H9FK 4KV8A 3FRYA 2GGPB 3PJ9A 3W61A 5LJ5Y 1NK4A 1V5IB 2CJBA 2VB6A 2GMHA 3QT7A 5SUHA 3ZTPA 1QVGR 1RTIA 1Q5VA 4ITSA 4OHWA 5L1JA 1ZETA 2DGWA 2JL9A 2VKZG 5KFDA 4DSFA 1YJNS 3OL9A 4DI6A 1NH7A 1LQ9A 3HZGA 4IFVA 2XI2A 1X0FA 4NLVA 2FY1A 1EQMA 2HS3A 5LMUJ 3IGVA 5D8HB 3NWRA 5A8RA 5HQMA 1LNQA 4J9KA 1UFLA 2YNFA 2HS4A 2DNLA 1HMVB 2MSTA 4DF4A 5B0FA 4CLWA 2GVZB 4CH0S 3QIDA 2MQ8A 4QR1A 3H20A 2X7IA 2LDIA 4ZPAA 4BCAA 3IBWA 1QTNB 2DD8S 4V19J 3CTRA 4TYAA 2YNFB 2KRBA 4JB8B 3RG6A 4U6PA 3GZ7A 3R1LA 4GKJF 2WBMA 2ZNZA 2ZHAA 1Q81T 2DISA 2GAHC 1S0VA 1EX8A 3CMAS 1DLOA 1DY3A 1T95A 3M2UA 4IG3A 5HK4A 1PYOB 2VOOA 1K9MT 1ZZFA 2EXUA 4CO3A 1RT6A 4MYUA 4X4QA 1ZAXA 4K5RA 2NSCA 3ISZA 1L3SA 2UUCJ 4CM2A 3V81B 1M5HA 3M9OB 2W9CB 2IMOA 4FXDA 4HH0A 1RBLA 1IKVB 1G7CB 3LPEA 4OZ2A 5HROB 1U1QA 1N6QA 1UZDA 1PO6A 1RWNB 2OPSA 1LWCB 3CCRS 4RW9A 3PCOB 2MLXA 4BS2A 1VK8A 2LA4A 3WDOA 2E1RA 2DGXA 4K4YA 1TZ0A 2BVZA 3DRSA 4FVMA 2ZEJA 4D3HA 3MHYA 3QAEA 3LGMA 3MURP 4DR4F 1EB0A 2P9CA 3CXCR 7AT1B 3NCQA 5F0WA 2HSEB 3ITHB 4IO9Q 4U9RA 1TUVA 5EX3A 4ZMMA 4OI0A 4J5OA 4Y2AA 2BM0A 1LXNA 2GHPA 1LW2B 3FEXB 5KFIA 4TY9A 2W7AA 5KFZA 3GIKA 4OYBA 3MMBB 5F8HA 3FCWA 2Q66A 1XNQF 2BJ7A 2GIRA 1NK9A 4X65F 1AZSB 1ZM2A 3D7SB 4KY3A 2FVPA 3TAMB 1C1BA 1UPPA 4J9SA 2RHSB 3GONA 2AMCB 2CPZA 3MECA 4DU8A 1H6KX 2HNDB 4FZVA 4N77A 4CRJA 3MR5A 4YB5A 2B4PA 3VGVA 4X62J 3HM9A 2X51A 1AROP 1APSA 2J0SD 3KYLA 1RTIB 1JXEA 2GAGC 1KTVA 2MZJA 2QSFA 3BREA 1H3DA 2GX8A 3R5AA 4A46A 4DCJB 3CJKA 2HBRB 2VV5A 4DR2F 4KHPF 1RWOB 1TVRB 3MUVP 1J5EF 3EDQB 3R5DA 4K4XA 5D0RA 1CC7A 4H4KC 2MXYA 3SIPB 2QO3A 2E5IA 4H4OB 3T6BA 4FKYA 4F3MA 1F5BA 1RXOB 2HLTA 1K47A 1RABB 2V8DA 3R7SB 5DGBA 2MDAA 5KT7A 3IRXA 2ALZA 2FJVA 4MIWA 4MKYA 1HNVA 1O5JA 1RT1A 3FBFA 4ED6A 1PJ7A 3W2VA 1KQKA 1NDLA 3ILOA 3MTJA 1UEUA 1SJFA 4O0IA 2MKJA 3Q8YA 3PO4A 4I6AA 4XPCA 3C6UB 5HJXA 3PJWA 4DWIA 1C1CA 1R8PA 2B8PA 5BYRA 4WFNQ 2OMLA 3IMQJ 2CNOB 3PACA 2AZ1A 2V69A 1LW0A 5C7PA 2HQGA 3GYXB 3IM9A 5CAAA 4RNNA 1XNRF 1YJTA 3QNWB 4LRAA 1OMSA 5I3PA 3L7OA 1HHSA 3T1AA 4TU7A 3C16A 4DF8A 2F8EX 3BEGB 2FVSA 4RW4B 4DV4J 4F4ZA 1FKAF 1KLNA 4WKYA 2WOMA 1NKEA 2RU3A 3FZ2A 3HSZA 4QR2A 2NPFA 3OUYA 1VQPS 1KFDA 3OTBA 1W25A 4UOGA 4Q8EA 4NEZA 3KMQA 2HIYA 5KFOA 4UY85 2E1PA 2J0QD 5A76A 3H4DA 2JC1A 3DLHA 4K4UA 4F4XA 3NKYA 4LRBA 1P8GA 4DL0C 4FS2A 5IWAF 1R3NA 2N82B 4KJIA 3O5TB 1UW9A 2KVQE 1B3TA 3NRBA 3DU5A 1M5KC 4FF2A 3D67A 4LIWA 5KG3A 1DBDA 3KK2A 4A48A 5HMXA 1S1TA 1CJUB 3JAMY 2JSXA 2HVEA 3ISNC 3K58A 1S97A 2DGVA 4ZCMA 1GMUA 4TKTA 3N01A 1OPZA 2B6AB 3LANA 2B4UA 5AE3A 2KG1A 1X4EA 5HBMB 3OR1B 3KK1A 2YKQA 1U6BA 2MLYA 4HKQA 4I69A 2E1AA 4ZITA 3KLHA 4KGXB 3X3UA 4DFMA 1W7WA 2HLUA 4L72B 3KXDA 2VU5A 2FYXA 4USTA 1K44A 2F4FA 3OTDA 1RQ0A 3DXBA 3R5GA 1RWWB 4NLOA 2OPQB 4JI5F 1U1NA 5CZDA 4FYXB 2GC8A 4AL6A 5IXUA 2DR8A 2JLFA 3QQCD 3FJ2A 4GVLA 5LSLA 4B9MA 3N5BA 2XCPA 2JEGA 1S1VA 1SV5B 1YBAA 2C3MA 1I94J 3BSOA 4JBCA 5DQIA 2IBOA 4EBDA 3ZZUA 2YY3A 3U7JA 3MCSA 1M1KT 2YKOA 5KG0A 1QSSA 3GJRB 5C24B 4J9LA 1VISA 4X4OA 2A6MA 1EQ0A 3JSBA 3I4PA 3M8RA 1QAJA 2KT2A 4A8WA 4DV2F 1Q8KA 1UJ6A 4QWAA 4D3GA 4DR1F 2ZZMA 3K5NA 3IBCB 2NYHA 2DRBA 1FE4A 1VRUA 1FERA 2WONA 1GT8A 1FNOA 4TN2A 3UVJB 2DH7A 2HNYA 3K59A 1R7IA 1UVIA 3IS9A 4CO5A 2FJXA 3S1TA 1YHQS 4ZP9A 4DX5A 4QWDA 4JYAF 2R7TA 3MXHP 1PJ6A 9RUBA 1FJEB 2WONB 1LW2A 1WEZA 1GX5A 1L3TA 3K8VA 1F2HA 3UVJA 3G8TA 2MMYA 3FEZA 2YH0A 4AUKA 3IS9B 2OHDA 1FDNA 3B82A 3MAAA 4KPCA 3QT5A 5KFUA 3GR0A 3U1MA 4ED0A 2XHWA 5J1EA 1RTHB 2POKA 3PDNA 1VC6A 2RU9A 4A8FA 3GSDA 1T94A 5AJ3J 1R0AB 1SPBP 2OSQA 5J2PA 3MECB 4FYWB 1U1KA 2F7VA 2W4PA 1HBOA 2QA2A
chains in the Genus database with same CATH topology
3R97A 2G2OA 2G2ZA 3RGIA 3TZXA 2VZ8A 2JFKA 2QJ3A 3CJ8A 3H0PA 1MLAA 1NM2A 3QATA 4QBUA 3TZZA 3PTWA 5CZDA 3TZYA 4RR5A 2JFDA 3R8YA 2C2NA 2HG4A 2CUYA 3K89A 2PFFB 3IM8A 5DZ6A 2UV8G 3TQEA 2H1YA 2G2YA 3TZWA 2VKZG 3IM9A 3BV8A 4RL1A 3EZOA 3SBMA 5DZ7A 5CZCA 2VZ9A 3HHDA 3HJVA 2QO3A 3G87A 3HMJG 2QC3A 2G1HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3R97 A;  2G2O A;  2G2Z A;  3RGI A;  3TZX A;  2VZ8 A;  2JFK A;  2QJ3 A;  3CJ8 A;  3H0P A;  1MLA A;  1NM2 A;  3QAT A;  4QBU A;  3TZZ A;  3PTW A;  5CZD A;  3TZY A;  4RR5 A;  2JFD A;  3R8Y A;  2C2N A;  2HG4 A;  2CUY A;  3K89 A;  2PFF B;  3IM8 A;  5DZ6 A;  2UV8 G;  3TQE A;  2H1Y A;  2G2Y A;  3TZW A;  2VKZ G;  3IM9 A;  3BV8 A;  4RL1 A;  3EZO A;  3SBM A;  5DZ7 A;  5CZC A;  2VZ9 A;  3HHD A;  3HJV A;  2QO3 A;  3G87 A;  3HMJ G;  2QC3 A;  2G1H A; 
#chains in the Genus database with same CATH topology
 5IV3 A;  2J8A A;  3KLV A;  2NXE A;  2G2Z A;  4PWU A;  4U7C A;  2IVF B;  2KYX A;  5GAD I;  3G6X A;  2BQ3 A;  5ETK A;  1UWB A;  2EFO A;  2LEP A;  3RR7 A;  4JI1 F;  2F5G A;  3MM8 A;  2BYC A;  4Z2X A;  1U1R A;  4WU2 A;  3D54 A;  2VJV A;  2EK6 A;  4OFZ A;  2V0N A;  5HBM A;  3KK1 B;  3BO4 A;  3D4J A;  3QFH A;  3KLH B;  2ZDO A;  3RZA A;  3DOK B;  1NKB A;  1IJE B;  2MKH A;  4ED7 A;  1KTQ A;  5KFG A;  5KT6 A;  1N32 F;  3G6Y A;  1VJW A;  5L8R C;  3ZZY A;  3UCZ P;  3G87 A;  1N0V C;  1RWP B;  4KH1 B;  4OJH A;  4GC7 A;  1JJ2 R;  1HQU B;  1FX2 A;  4URG A;  2AYG A;  2YPZ A;  2C3P A;  4B3S J;  4RKU C;  1PC5 A;  2D7S A;  3Q86 A;  3ZZT A;  1R89 A;  4R0E A;  5E3A A;  4F04 B;  3MCO A;  2R3V A;  4FYY B;  2BE2 B;  5HQL A;  1REV A;  4DV6 F;  3ISN D;  3KMS A;  5K8O A;  3SXL A;  3TQE A;  5FDL A;  1D9F A;  3HSJ A;  1NND A;  2ZOG A;  3CCT A;  2PEH A;  3C14 A;  2R8G A;  2NQP A;  1Y5N B;  2R42 A;  2B51 A;  3DC2 A;  4B3O A;  3OUY B;  1GXL A;  1R8H A;  3M8Q B;  3IFE A;  5HAT A;  1X4A A;  4B02 A;  1WJ9 A;  2X3G A;  3UO0 A;  4C7Q A;  2CJX B;  3G6V A;  2YNG A;  4ERD A;  3FMB A;  4YS2 A;  4LSL B;  3MFH A;  1SQG A;  4FXV A;  4S0M A;  1N6Q B;  2DVI A;  4M5M A;  4FYD A;  1IKW B;  1EET A;  1VC0 A;  1VGY A;  1RTJ A;  4NLW A;  1M1G A;  3CJT A;  2JEI A;  2RAQ A;  3D3C J;  4DR2 J;  4NAS A;  3BKU A;  2DR5 A;  4WK3 A;  2KT3 A;  1T9U A;  1JKH B;  2H65 B;  2QLJ B;  3FKB A;  5B7W A;  1P1T A;  1J5E J;  3OXL A;  2EFN A;  1XN9 A;  5DRK A;  5KFF A;  3QZ8 A;  4K4S A;  1GTE A;  4RUC A;  1RIS A;  3NGS A;  4IFY B;  4YB1 P;  1J5O A;  5J1E B;  2ZH3 A;  1KLM B;  4X4N A;  3HPO A;  4X4T A;  5DM6 Q;  3EXC X;  4MTP A;  2UXD J;  3C15 A;  4HR2 A;  4QPT A;  3JTP A;  5KFH A;  4IDK A;  5E2Q A;  4I4B A;  3SCK E;  2CJ9 A;  4IFY A;  2W2M P;  3OFF A;  4GMK A;  2XS2 A;  2N3O A;  1NSA A;  3ZTO A;  2V8P A;  2GMJ A;  3TO8 A;  3GR1 A;  1RT2 B;  3G8Q A;  3HO1 A;  1MWQ A;  5ADZ A;  2C3O A;  3ZXW A;  3UE2 A;  2G0I A;  2OPP A;  3KLI B;  1B64 A;  2OAU A;  2PMW A;  1PAU B;  2V5H G;  3VZH A;  2PN6 A;  1PYT A;  3T1H F;  4ID8 A;  3MAH A;  3TVY A;  5LSO A;  1AFI A;  2OUG A;  3BS9 A;  2DNQ A;  3N6M A;  4NLY A;  3TOQ A;  4DV4 F;  4O3R A;  2NZ4 A;  3KNG A;  1N52 B;  4ZVG A;  4U95 A;  3P6Y C;  2EG1 A;  2VPZ B;  2MYF A;  4FPI A;  4RBV A;  1F9E B;  2RUG A;  2AHO B;  3UDE A;  4G6V B;  2E1M C;  3HDS A;  1K8A T;  1BMQ B;  2BJE A;  1C0U B;  2J7U A;  1BD6 A;  3LA0 A;  5K14 A;  5E33 A;  2RQC A;  1GFW B;  3JSR A;  2Y9H A;  2FLN A;  2DHG A;  1FXD A;  4DBQ A;  4DCP B;  7FD1 A;  4WFB Q;  4FVC A;  4O3Q A;  4CCH A;  1RLD A;  2BJ1 A;  1IBC B;  2KTQ A;  2IM2 A;  2GCF A;  5CZX A;  3TZX A;  2YQ3 A;  2CQH A;  4DSJ A;  4ILL A;  1RHM B;  2ZC4 A;  2ZOM A;  2CQI A;  2P9E A;  4Y2K A;  4ZVU B;  4HVZ A;  4NA2 A;  1FKO A;  5HLF A;  2C2E A;  4GO5 X;  4MKA A;  4OYA A;  4C8O A;  1KHV A;  3CIZ A;  1SC1 B;  1SIW B;  2ZH1 A;  4F02 A;  4UUX A;  4NE9 C;  2OIH A;  2UUA J;  1ZOT A;  4Q0B A;  2HHS A;  1Q8I A;  5D4P A;  2WOM B;  2F1F A;  1XR7 A;  3IR7 B;  1VDH A;  2W7O A;  4ER8 A;  1WC3 A;  2I9S A;  3BYP A;  4PWW A;  1KR4 A;  4J9O A;  2AD9 A;  2FGC A;  1E6Y A;  1GK8 A;  1AUD A;  1HD1 A;  2M9K A;  5A8W B;  5L9X A;  4ZOS A;  2V9W A;  2K8G A;  4BC9 A;  2E7X A;  4YEA A;  4AT1 B;  2XY5 A;  4C9D A;  3KUH A;  3QPI A;  1ULR A;  4P10 A;  2V2K A;  2OEJ A;  3FQL A;  1RHJ B;  2CZ4 A;  4CNZ A;  1HNI B;  4EZ9 A;  4U7U D;  3OPK A;  1T11 A;  4CQ1 A;  4AFF A;  1TKZ A;  2FZC B;  2ACY A;  1ZA1 B;  2XZT B;  5BR8 F;  1ZTW A;  1VC5 A;  3AJ2 A;  3NGU A;  3IXQ A;  4G1I A;  3TWZ A;  4Z7Y A;  3AOB A;  3N5F A;  3CJ2 A;  3EVO A;  4I1T A;  4GVB B;  4RW6 A;  5LMN F;  3ENA A;  2ZBQ A;  4LSZ B;  3VAK A;  5GAE I;  2UVU A;  4I6W A;  3OL8 A;  3K89 A;  5CYM A;  3Q8Q B;  2W2N P;  2MJN A;  4DR1 J;  2CVI A;  2VQF J;  2DPJ A;  2YWH A;  2O3D A;  5ITH A;  1FX4 A;  4U67 Q;  3T1Y F;  2A6O A;  2B7B B;  1QE1 B;  1DQ9 A;  2AEJ A;  2HFO A;  4TY8 A;  2V4R A;  4X4V A;  4X4P A;  2JEJ A;  3M8Y A;  3GE9 A;  4WCE Q;  4P7T A;  4HHU A;  5I3U B;  4UY8 T;  5F9N A;  4EYH B;  2MQN A;  1VLY A;  2KZZ A;  1SKW A;  2HRY A;  4L76 A;  4NLX A;  4JUZ A;  5HMY A;  4OX9 F;  1YDL A;  4A8O A;  4C3K A;  2VFT A;  3O44 A;  2W2O P;  2KFY A;  3FCH A;  1IKY B;  1GX6 A;  2B4O A;  3I32 A;  4ZVQ B;  1FES A;  3FFI A;  3G8S A;  3PW0 A;  1SVD A;  1BQM A;  3CT9 A;  2CA9 A;  4BLG A;  1MSW D;  3TJ9 A;  1NSK L;  2HVH A;  3M6V A;  5AJ3 F;  2B3T B;  3I82 A;  3WZ0 A;  1IXK A;  2GA7 A;  4Q8F A;  3KNA A;  1T7P A;  2FJA B;  1CQN A;  4N47 A;  4P6Q A;  1NJY A;  3BKT A;  1IKW A;  1EET B;  2FC8 A;  3IRW P;  4DR4 J;  3I5B A;  1BLU A;  2KT5 A;  1X7V A;  2V8H A;  1HHT P;  2MQM A;  2DNP A;  3MOJ B;  1XTZ A;  1V9O A;  2FJD B;  2V4J B;  4JI1 J;  4F67 A;  4FNI A;  1KRP A;  5C2C A;  3J7Y I;  3QO9 A;  1A6L A;  3QGP A;  3ZTS A;  4EBC A;  2V2Z A;  2O5D A;  1VBZ A;  2OEK A;  1B7Y B;  3GYG A;  3ULH A;  1NJI T;  4EUV A;  4PQU B;  1X4F A;  3A8J A;  2EWH A;  3W5X A;  1KLM A;  4PWD A;  3E01 B;  3BSC A;  1DTQ B;  3H2L A;  4DL6 A;  2CQC A;  1WSR A;  1TL7 A;  1MRO A;  2HZA A;  2OJ3 A;  3KLG B;  4JYA J;  3GFY A;  3WHI A;  1DJ0 A;  3MED A;  3MOZ A;  5CQG A;  2E1C A;  1XMQ J;  2DHA A;  2QSW A;  5LXY A;  1RAD B;  2D41 A;  3M2V B;  1DTQ A;  2HEK A;  1O8B A;  2QLX A;  1N54 B;  3G86 A;  1KON A;  2PO4 A;  2DNK A;  2OPP B;  3GB0 A;  5IOL A;  1WC4 A;  1WKK A;  2D69 A;  1TL3 A;  3PJX A;  4EO8 A;  5KOX A;  1S9E B;  3P96 A;  5AXM A;  3J81 j;  4X4U A;  2CRL A;  2KM8 C;  2HIQ A;  1FK9 A;  1NZ8 A;  3M6X A;  2CPY A;  3KK3 B;  3H25 A;  2LEC A;  1ZA2 B;  2EC2 A;  2FGO A;  2LFV A;  1R8B A;  3MM7 B;  1EAY C;  4LR8 A;  2JWN A;  4CI0 B;  3M4X A;  3S01 A;  5KG4 A;  4H4M B;  1KQF B;  3HHN B;  2HGN A;  1Y9O A;  4YHH F;  5EGY A;  1N4L A;  4R5P B;  5KT5 A;  2AJ0 A;  4NLT A;  4Y2C A;  2YWE A;  4KQZ A;  3MWB A;  2DYA A;  3GG0 A;  2P5V A;  2YKM B;  4FYV B;  4O4R A;  2Q79 A;  2MLZ A;  3AA8 A;  3BN7 A;  1C0U A;  1RAE B;  3I5C A;  4BBY A;  2X1F A;  4M5H A;  2CJK A;  2W01 A;  3J7Z 5;  1HBM A;  5G4D A;  4UUW A;  3T19 A;  2E44 A;  2PFD A;  4KGK A;  1BY9 A;  2CQP A;  3DI6 B;  3PNI A;  2YKN B;  4M5N A;  2Y8Y A;  1JLF A;  4UZB A;  1VLO A;  1S1X B;  3D66 A;  1R43 A;  4NRU A;  5HLF B;  4B3R F;  1HYS A;  1OS5 A;  3HHD A;  1N5T A;  2MZQ A;  4KH0 B;  4LF8 J;  2FC9 A;  3OW2 R;  3GPA A;  4ZLJ A;  1VBX A;  1RAI B;  2AV5 A;  5IC6 B;  1RZM A;  2XMK A;  5IZH A;  2UXD F;  2QLW A;  4USV A;  3DRR A;  3TVK A;  2MJU A;  4C6A A;  1EHW A;  4B3O B;  1SL1 A;  3E51 A;  5CD4 A;  1RE1 B;  2DNN A;  2P6T A;  1JLE A;  5GAH U;  4QYZ K;  1PJ5 A;  4O3P A;  4DX8 H;  4ECZ A;  3RW7 A;  2GO9 A;  2YNG B;  1LKZ A;  1Y10 A;  3MM5 B;  3DRR B;  2W7P A;  5LM7 E;  1CJV A;  2HZV A;  3LP2 B;  4N76 A;  4Y2M A;  5DQH A;  4WF9 Q;  4KIA A;  3OR2 B;  4TXS A;  4LF7 J;  2UXC F;  3V2U C;  2U1A A;  3M32 B;  3BGR A;  2P2C B;  1RHK B;  3AAW B;  2R7X A;  1WKL A;  3FDS A;  4NMX A;  4RL1 A;  1GEH A;  4F8R A;  2DEJ A;  3P45 B;  4O4G A;  2HVI A;  1ZPW X;  4RW6 B;  1X9S A;  1SIZ A;  1X8D A;  3DLG A;  1MRO B;  3CDU A;  1N33 J;  1YBU A;  3CDE A;  2HQF A;  2LCW A;  1FEH A;  2WB4 A;  3DCA A;  4J37 A;  4CLF A;  2FLP A;  3D3B J;  3EM1 A;  3DN9 A;  1D1U A;  1NUE A;  1OSD A;  3M1V A;  3F56 A;  1Q8L A;  4IG0 A;  1O0P A;  1V6H A;  3Q83 A;  1MML A;  2MGZ A;  3GMG A;  2VFR A;  2IIH A;  5C42 A;  2PC6 A;  1VQ9 S;  3TA1 A;  1FO1 A;  3SV3 A;  4P2X A;  2LVW A;  3OL7 A;  2ZFH A;  4LF4 J;  3TAR A;  2DPI A;  1IVZ A;  2XO7 A;  3VAF A;  2AYB A;  3HVW A;  2Z30 B;  3UI3 A;  2FTR A;  4RR5 A;  4OYP A;  5IT9 U;  1N36 F;  4ED4 A;  1YZ6 A;  2HWI A;  1V3Z A;  3WC0 A;  3DGP B;  2N4D A;  4LF6 J;  4K0K F;  2JLE A;  1URN A;  3HXM A;  3R2C J;  3D6F B;  1L5U A;  5A0Y B;  4ECW A;  2RH3 A;  3MM7 A;  1OO0 B;  2K1R B;  3HHK A;  3K5P A;  4C0B A;  3SYZ A;  2ASD A;  3W64 A;  2BQR A;  2QMU B;  3E2E A;  2XWY A;  4L74 A;  3M8Z A;  1LWE B;  2C3Y A;  4DQR A;  3QT8 A;  3C8Y A;  5IT0 A;  1R8A A;  1BQM B;  3SDE B;  3L7P A;  1CUL A;  1ZM4 A;  3CVK A;  4LBP A;  5ETS A;  1SJ1 A;  2VG5 A;  1CQM A;  2UP1 A;  1RKJ A;  1W26 A;  2PI4 A;  2MTL A;  4B17 A;  4CT9 A;  1RT4 B;  4FF4 A;  4QYR A;  4RW8 A;  3CF5 Q;  3PEJ A;  2UXB F;  2CPJ A;  2XBP A;  4L3K A;  4OLO A;  3PRV A;  5T41 A;  1CJK B;  2VDH A;  2MKC A;  4K2J A;  2CQ1 A;  2FPH X;  1RT4 A;  4M5J A;  3QO9 B;  2MY8 A;  3I6P A;  3PX6 A;  3D0G E;  3BPS P;  6FDR A;  1N48 A;  1Q4R A;  2L9D A;  1TAQ A;  3NGK A;  5BR8 J;  1HQ2 A;  2IBK A;  4NLG A;  1M5V C;  5KG1 A;  2B9E A;  2RJZ A;  1Q86 T;  1TTH B;  3VTI A;  1FKP B;  3A1Y G;  1BWV A;  4B3T J;  2CVE A;  3KJV B;  4LVN P;  1FD8 A;  3CDW A;  5L1L A;  2ASY A;  3WX4 A;  3V4M A;  2VC0 A;  4YB7 A;  1HWL A;  2ZKT A;  2ZUG A;  1Y3J A;  4DX7 A;  3BKF A;  4LF2 A;  3OJU A;  5KFX A;  3IAS 9;  4C11 B;  2XGQ A;  3SV4 A;  5C5J A;  1HI1 A;  4PPD A;  2CJA A;  2Z0G A;  2BA9 A;  2F40 A;  3K5L A;  2ERR A;  1BE4 A;  4QU7 A;  4LR7 A;  4WWS A;  1XIQ A;  2HAI A;  4G65 A;  4LFA F;  2J6S A;  5DG8 A;  1UVM A;  4OX9 J;  2B9W A;  4P2M A;  1X5O A;  3LF0 A;  1VQ5 S;  1IUJ A;  3D6T B;  3PW7 A;  4WXO A;  2QMW A;  1WDT A;  4U8V A;  2WSE C;  4P2F A;  4PXE A;  1AXQ A;  1P9Y A;  3TX0 A;  1HL6 A;  4AND A;  1ZTT A;  1H38 A;  2HHP A;  5C42 B;  3Q8R B;  1HNW F;  2XB2 D;  4GVB A;  4E98 A;  5ETT A;  2OSR A;  1FTC A;  3M30 A;  4DFJ A;  1Y4Z B;  1H2V Z;  2FVC A;  3AT1 B;  3MM9 A;  4ZIW A;  2GO8 A;  1YK9 A;  5JUM A;  3DRP B;  4HTI A;  3JQJ A;  1KS2 A;  4A8X A;  2YNH B;  3LAK A;  5CZV A;  3KJF B;  4NA3 A;  2KXH A;  2UVW A;  4CO4 A;  2CPX A;  4TY8 B;  3UNG C;  1S7I A;  3QSY B;  2MHN A;  3UFC X;  2WRM A;  2RS8 A;  2BX6 A;  5DZ6 A;  2BV3 A;  3ETO A;  3IAM 9;  2E7W A;  3IG1 B;  4F0M A;  2ACM A;  4NLR A;  4ICL A;  2G2Y A;  3ZC4 A;  1QD1 A;  2YKA A;  1W2I A;  3D6M B;  4I0W A;  1S10 A;  3KHH A;  2DGO A;  4WBF A;  4BDP A;  4E0D A;  5E7O B;  1XK8 A;  3KUE A;  2IDE A;  4F4K A;  2IYG A;  4Y00 A;  3R7B B;  3PVX A;  2HBY B;  4XK8 C;  2O66 A;  3LQV A;  2Y8W A;  2R8H A;  4A8Y A;  4ZVE A;  5C25 A;  2HNZ A;  3EXY A;  4CIO A;  2CG8 A;  4LVO P;  3OFG A;  2PA8 D;  2DCL A;  1VQS A;  5KG7 A;  5J2N A;  2PI5 A;  1S6P B;  3L3C A;  4DSL A;  4TYB A;  1H7W A;  1EP4 A;  2IC3 B;  4G1Q A;  3MR7 A;  4P75 A;  3G4S S;  3C2P A;  2CWK A;  3U27 A;  3CC7 S;  4UF4 A;  1D9A A;  3FBC A;  2PE8 A;  2OTL S;  1RT7 A;  3JSM A;  1S0O A;  4I68 A;  4WK1 A;  5D0E A;  1EP4 B;  2ZWP A;  4G1Q B;  2IA6 A;  1NSP A;  2QGF B;  1NB7 A;  4J9Q A;  1YVF A;  1QUV A;  3PEH A;  4OZJ A;  4CLT A;  2WHO A;  1DAR A;  4DX6 A;  2Q43 A;  3Q8V A;  3UR3 C;  3R9L A;  4CO0 A;  2E9R X;  2RHQ B;  1XMB A;  5F8N A;  3I0R B;  4QIW D;  3M2V A;  3BQ1 A;  3UWT A;  3WIV A;  2X3D A;  4NLU A;  3PKY A;  4W4M A;  1DFD A;  4MFB B;  3BSA A;  4C97 A;  5DQG A;  1PBA A;  4UQT A;  1IKX B;  2BZ2 A;  3GU0 A;  3PV8 A;  2AU0 A;  1KQS R;  2IAJ B;  1TL3 B;  1S9E A;  2C2N A;  3J7A 1;  1I51 B;  1X4B A;  3QRQ A;  4LF8 F;  1WEY A;  1AYE A;  1T9X A;  3KWM A;  3SDE A;  3TNV A;  1WUU A;  1T05 B;  2XMU A;  4WTY A;  2KVI A;  3DDK A;  2O67 A;  3N6N A;  1ZPV A;  1N5Y B;  4GKK F;  3DRP A;  2OKQ A;  3O8W A;  1H73 A;  2FZG B;  4ZLL A;  2CDQ A;  2ZH6 A;  4W92 B;  3OVS A;  3MPD A;  3P8B B;  2HK3 A;  4IH6 A;  1U25 A;  3SQG B;  4K4W A;  5CYJ A;  2J6T A;  2YKM A;  4AL5 A;  2RKI B;  5AXK A;  3SCJ E;  1RT5 A;  2XEX A;  3MCM A;  2MQP A;  5F8M A;  5THW A;  3RAX A;  1RA6 A;  4P72 A;  3MM6 A;  1VIO A;  4OZN A;  3QZ7 A;  3HT0 A;  1KOH A;  4CTA A;  1O6X A;  1PAE X;  4M94 A;  4K2X A;  1FRM A;  1S1U B;  2YBV A;  4WJB A;  3FSX A;  4KO0 A;  2ZHB A;  2AKW B;  1S1X A;  1TK8 A;  2KU7 A;  1OY6 A;  3I0S A;  4LF5 F;  2CNN B;  1WF1 A;  3FBE A;  4CTA B;  2AW0 A;  4A8S A;  1JK9 B;  2H1Y A;  4ED8 A;  1MU2 B;  4JI8 F;  1EZZ B;  2AGQ A;  3EE3 A;  4LSN B;  1H7X A;  2HHU A;  3ZO7 A;  4ZP7 A;  4C11 A;  4DR7 J;  3IWX A;  5KFW A;  2B9Y A;  2OEM A;  4LQ9 A;  4UTG A;  1FJ7 A;  2VA3 A;  1S6P A;  1T02 A;  2ZNY A;  3PYG A;  1YJU A;  4CWB A;  3OHB A;  2R2S A;  4M1K A;  1YRT A;  2HHH J;  3HK2 A;  5DDQ C;  2XG8 A;  3F73 A;  3G96 A;  2UU9 J;  2HRT A;  4P74 A;  5KFQ A;  2IRU A;  4ANE A;  4DUY J;  3D1O A;  2HHW A;  2XMA A;  2D1C A;  4ZVF A;  2F4V F;  1XEZ A;  1YJW S;  3CC2 S;  1T3N A;  2EPI A;  4O4G B;  3NBP B;  1F3F A;  2ZM6 F;  4NXM F;  1QVF R;  3AD7 C;  1G2E A;  3H8Y A;  1VBY A;  2A10 A;  2C2K B;  2MHE A;  2XHC A;  3ENV A;  2F8M A;  3M1V B;  2UXB J;  5F9L A;  1K0T A;  1F60 B;  4MAK A;  4ILM A;  4NXN J;  1XWL A;  2J9D A;  3OLB A;  2GVZ A;  1HNZ J;  4RU9 A;  4MKB A;  1WOO A;  1UPM B;  2A0F B;  3G82 A;  3TYT A;  1IR0 A;  1YSJ A;  2W4D A;  2BKP A;  3MEK A;  4NYZ A;  3DGP A;  2FZK B;  3EX7 B;  3PYD A;  3IG1 A;  4A8K A;  3DKD A;  2FJB B;  1HR0 F;  1UEK A;  2HQ3 A;  1UJ4 A;  2M3D A;  2VFU A;  2CG4 A;  2XMJ A;  1S72 S;  3W3S A;  1SB6 A;  2DR6 A;  3FGV A;  2CQ0 A;  1FWP A;  1LWE A;  1U0S A;  1FHT A;  5F41 A;  5K8M A;  2K7J A;  3CGI A;  3LO3 A;  3GFZ A;  3MEG A;  3W60 A;  4NLQ A;  2J6U A;  4UOH A;  4O3O A;  3CCU S;  3TAQ A;  3L95 X;  1V5V A;  1WHX A;  5D78 A;  1GAO A;  4IRC A;  2AX0 A;  5J2N B;  1CVJ A;  4WFY A;  3VAM A;  1I5O B;  4QYZ J;  2M8D B;  2OPS B;  4K59 A;  1Y5L B;  3KJQ B;  1NPK A;  4NWB A;  4OI2 A;  4WIQ A;  2N4C A;  1HQE B;  2H4Y B;  2OD4 A;  4OV1 A;  1JB0 C;  5D0H A;  2GQC A;  5I3Q A;  4M63 A;  2KM8 B;  3D9B A;  4DL5 A;  2B4V A;  4RLE A;  3CD6 S;  4HAC A;  4MIB A;  4QPX A;  2LXF A;  1FJG J;  3O1L A;  1H72 C;  3FUY A;  2B5J A;  2ZE2 B;  3IP0 A;  4B3M J;  1QM9 A;  5ETV A;  5G0R A;  3H5S A;  1GXU A;  4X66 J;  1YIT S;  4PAA A;  4DV3 F;  1HNW J;  2ZZT A;  2W2Q P;  3E3X A;  3TZY A;  3KJV A;  1RAC B;  1RAA B;  2LMI A;  2RT3 A;  3R5B A;  2WCX A;  4CO2 A;  4IR9 A;  2MKY A;  1SC4 B;  2ZE2 A;  1SH3 A;  2QT7 A;  3PM9 A;  5KFV A;  3BQ2 A;  5A8K B;  2IPO B;  4WP9 A;  3DLL Q;  2HQD A;  3CD5 A;  3OL6 A;  2YWK A;  5E3Q A;  2EEY A;  4DPX A;  1WEX A;  1VQ4 S;  3LPY A;  1V3S A;  4ZCI A;  1P6T A;  5JJB A;  4MFB A;  3BZQ A;  4OYW A;  2APO A;  3SCL E;  1FNX H;  2HHQ A;  1YRU A;  4NCG A;  2AYE A;  4PAB A;  1K73 T;  2QTW A;  3VGT A;  4DQS A;  4DUZ J;  4P71 A;  2Q3P A;  1HNX F;  3NBP A;  3SZ2 A;  4NCA A;  2PGC A;  1U1P A;  2OPR B;  2W2P P;  1NK6 A;  4ELT A;  2XI3 A;  2DIU A;  3SQO P;  5B0C A;  5KT3 A;  3VR1 A;  3W2W A;  3OTO F;  2RKI A;  3TA0 A;  2R7R A;  3P4U B;  2A18 A;  1RJJ A;  1X60 A;  3G82 B;  1HNV B;  1U09 A;  3D6H B;  2K06 A;  3H98 A;  4F25 A;  3TQ1 A;  5KFP A;  3BSN A;  3RRK A;  1X31 C;  2X1G A;  4MT1 A;  3VQT A;  4HTJ A;  2JNJ A;  3W2W B;  5IM0 A;  1NJW A;  1M5P C;  1DHM A;  2B9X A;  1PSD A;  3CNQ P;  4RUA A;  1MMD A;  2C28 A;  1S1U A;  1F6T A;  2CZ9 A;  1FEE A;  2FJE B;  4RNH A;  3UW1 A;  5SZT A;  1KC8 T;  3CD0 A;  3HUL A;  5IQQ A;  3CO9 A;  2Z8Q A;  4JI7 F;  2IM1 A;  2AWZ A;  2O01 C;  1DQA A;  5H1S V;  4KKO B;  1AUS L;  2HBZ B;  1S79 A;  2RB7 A;  2VBW A;  2ZOF A;  4AYB D;  2IA0 A;  2BW2 A;  1Q16 B;  1A9N B;  2Y1J A;  3CCV S;  3VGS A;  3U02 A;  5KFK A;  5EHH A;  3UN5 A;  1DLO B;  5HVF A;  2MPU A;  2V2V A;  5K20 B;  1WSV A;  2V9K A;  3HHL A;  3W8G A;  2HGL A;  3NAI A;  1C4A A;  4KKO A;  3GJT B;  3M8P A;  4M5L A;  1Y7P A;  4C98 A;  2DBB A;  3EZ5 A;  4QCL A;  3HHL D;  2MQL A;  4XAK A;  3L09 A;  3KDO A;  4XO0 A;  5JVG Q;  1YTY A;  3V6J A;  4OZ1 A;  1NJX A;  3Q0A A;  4DQP A;  4C8M A;  1VFJ A;  1OYD A;  1RWX B;  2FLO A;  5DDR C;  2EW9 A;  1FWL A;  2W8K A;  3I96 A;  2B5J B;  2DNG A;  3EJM A;  4ETX A;  4DV1 J;  3CED A;  2Z58 B;  1FA0 A;  1S5Z A;  3S7R A;  4TU9 A;  4ILR A;  2YVS A;  5B08 A;  4BC7 A;  2C2R A;  2GW8 A;  2DHS A;  2E9T A;  4N56 A;  2XSJ B;  4RUH A;  4ZP8 A;  4R8U B;  5HMZ A;  2AQ4 A;  3UCU P;  1CJT A;  4KT0 C;  4PR6 A;  4DPT A;  1X4H A;  4O23 A;  3M9M B;  3ITH A;  3QGH A;  4DL3 A;  2QL9 B;  2V34 A;  4FF3 A;  2DGU A;  1YKW A;  1N5S A;  2OD6 A;  2ZIT A;  5L1I A;  4PXD A;  5IC4 B;  5EWE A;  4KFB A;  2OMO A;  4IFV B;  3R1H A;  4DL4 A;  4KTQ A;  3I0R A;  3UPF A;  1L3V A;  4CLZ A;  3W5Y A;  1OY8 A;  1R8C A;  1RK8 A;  1TUG B;  1LWX A;  2BXJ A;  2FQQ B;  2QZ8 A;  2VD3 A;  4YB6 A;  1YZ7 A;  2C42 A;  3DLK A;  2LU2 A;  2N3L A;  3GFH A;  4CYU B;  2GV1 A;  4IQM A;  2R7W A;  3MMC A;  5A2Q U;  3MR2 A;  5KT2 A;  2WVF A;  3HI9 A;  4EMD A;  5DDO C;  3UD4 P;  2KYZ A;  2GQQ A;  2QA1 A;  3M6U A;  3I87 A;  1WTB A;  1WEL A;  1Z1Z A;  3NNC A;  1ITP A;  2CPI A;  3CD7 A;  4LF5 J;  1IBL F;  3MR6 A;  3P49 B;  1TKT B;  1URR A;  4X4R A;  4DFP A;  2UVR A;  2DR7 A;  3T5K A;  4JI6 J;  3RRG A;  2CFX A;  2ZJP Q;  1R31 A;  4V1A k;  3I5A A;  2ZBC A;  1FD2 A;  2LP4 A;  3T5J A;  2Y1L B;  3RB6 A;  1JLG B;  2IRX A;  1KFS A;  4L3N A;  2UUW A;  2UUB F;  4Q45 A;  3NP5 A;  1N56 A;  1KHW A;  2OLW A;  2VFS A;  4QIV A;  4I7F B;  1QAI A;  4LF9 J;  4N41 A;  1SJ3 P;  2J9C A;  2DIT A;  3D28 A;  1ZM9 A;  8AT1 B;  3JB9 k;  2IRY A;  1S76 D;  4W90 B;  2C2M B;  1LV5 A;  2C22 A;  3DFE A;  3D68 A;  3A3N B;  1V3R A;  2UU9 F;  3SFU A;  3GIR A;  3VVT A;  1UAW A;  4DUY F;  1L3U A;  3VVU A;  5LMU F;  4F3Q A;  1FRH A;  1O51 A;  2HNY B;  2F4V J;  3QYY A;  2RSQ A;  2HVZ A;  3V4I A;  4PUO B;  4YR0 A;  4B9V A;  1KWM A;  4ZPT R;  3W65 A;  4NXM J;  1JJH A;  3DRS B;  3AD9 C;  2CAJ A;  4IRK A;  1TMJ A;  1R27 B;  2VAS A;  5D4N A;  4F26 A;  3OQ2 A;  1I6J A;  5A8K A;  1G4C A;  1T9W A;  2BAN A;  5L46 A;  2V63 A;  2PEB A;  4GKJ J;  2VZ8 A;  3MCN A;  1WF2 A;  2R7Q A;  5D77 A;  4EFA C;  5HMW A;  2P9G A;  3QAT A;  4LJM A;  1MWZ A;  3BBC A;  1U8S A;  4LSN A;  4RW4 A;  1X9W A;  2XS5 A;  2Q6B A;  5GAG U;  4JI2 F;  1R0A A;  4ED1 A;  4IQX A;  2MQO A;  2D74 B;  2BAN B;  2RIL A;  1VJQ A;  2HFU A;  1NU4 A;  2UV8 G;  3IC1 A;  5BXI A;  2NPI A;  3S8S A;  5F8G A;  1PGZ A;  2LYV A;  2WSF C;  5CXT A;  3CPW R;  1HWJ A;  2ZBI A;  3BM7 A;  2DTJ A;  2LQ8 A;  4ES1 A;  4ES3 A;  4QIE A;  2DRA A;  3DXS X;  1YJR A;  2OPR A;  4CLP A;  3MM8 B;  2L41 A;  4DR5 J;  4DR7 F;  4K4V A;  2HND A;  2WAQ D;  3NWG A;  1KKH A;  3DOL B;  1FCA A;  1SH0 A;  1SUQ A;  3MMA A;  3NXZ A;  3S6E A;  4I56 A;  3VWS A;  2PSZ A;  2QX0 A;  3AXM A;  2VG7 A;  4OQJ A;  4DR6 F;  1S9G A;  2IMW P;  3GIJ A;  3CJK B;  3KK2 B;  1WG4 A;  1PKU A;  3HKW A;  5J2M B;  3V5R A;  4CO1 A;  1FFG B;  2FHO B;  3BDE A;  2R7S A;  4B08 A;  5KAK A;  4BWJ A;  3PYE A;  3ZNU A;  2RF2 B;  3QRR A;  2VDI A;  1UL3 A;  4ZJO A;  5J2M A;  1WF0 A;  2D3U A;  2UUT A;  4C48 A;  3L9Z A;  3IRX B;  2F8H A;  3OFE A;  3CCL S;  1WD6 A;  2GJ2 A;  4FKX A;  4NI2 B;  3SMZ A;  4DUT A;  1VQ7 S;  2BDP A;  5EUH A;  1FDD A;  2RF2 A;  4O44 B;  1HMV A;  1S48 A;  3Q23 A;  2QRR A;  3DGV A;  3KDN A;  4J9R A;  1B0V A;  2XSF A;  3M2R B;  1FFW B;  1B0T A;  1PIE A;  2VIH A;  3WC2 A;  1OWX A;  1J27 A;  1B99 A;  3HHL B;  3DRX A;  4LT6 A;  1S49 A;  4HHJ A;  1RBA A;  4O44 A;  2XM3 A;  4CLY A;  4M5I A;  3IBF B;  4X64 J;  1SKR A;  3HMJ G;  2KL8 A;  4DHV A;  1OPI A;  1U2C A;  2G0C A;  2ZJR Q;  1PCA A;  1IBM J;  3K5O A;  2MZT A;  1UET A;  2I1R A;  3TJ8 A;  3P5T L;  3I56 S;  1DUR A;  1NM2 A;  3K7R A;  3J80 Y;  1QLN A;  1Q53 A;  1RAJ A;  1RA7 A;  2HK2 A;  3QLH A;  1P9Q C;  1A7G E;  5HN0 A;  4ED2 A;  3UN2 A;  4C0O C;  1Y3K A;  1BGX T;  5FII A;  2XLJ A;  4DSK A;  1VQY A;  1IM6 A;  3KJN B;  5F3Z A;  1CSJ A;  2PMZ D;  5GAD U;  4AL7 A;  4QWE A;  2VPY B;  3KOA A;  4F4A A;  1X5S A;  2C1E B;  4UW2 A;  2X1B A;  3OTO J;  1RI7 A;  3BH6 B;  3CCZ A;  5ETN A;  5EWF A;  4GO7 X;  1RTD B;  4CM0 A;  2HYI B;  1S1T B;  1RT3 A;  3DOM B;  5K8P A;  3FSI A;  1XNR J;  3CJ4 A;  3V6D B;  4K50 A;  4LMZ A;  1JXL A;  5B09 A;  4KPY A;  3BJY A;  2DNZ A;  4IOB A;  2CJY B;  4TLQ A;  5J2Q B;  1RTH A;  3CJ8 A;  2JRS A;  3OR1 A;  2MSS A;  4IRD A;  2BJ8 A;  4OLP A;  4OZ3 A;  2WW4 A;  4DPU A;  1RT2 A;  5FD1 A;  2ZH8 A;  2RVJ A;  3U1N A;  1NXI A;  4ZJL A;  2I8E A;  3T41 A;  4JI7 J;  5IQ6 A;  1D3W A;  5J2Q A;  2XY7 A;  1KSP A;  3M9N B;  4OHY A;  1TKT A;  3DYA B;  3HVT B;  3JSY A;  4KGV B;  1OQ3 A;  3I4H X;  1E6V B;  4FNH A;  3TAM A;  1ICE B;  2MEW A;  1RUS A;  1U6Z A;  1RP5 A;  3EZO A;  3MI7 X;  2CAD A;  3DDN A;  3DHW C;  4ZVT B;  2LXU A;  1JLG A;  3FVY A;  3TUJ C;  2VQE F;  4ECU A;  3RRH A;  1KNZ A;  1HPZ B;  2J9D E;  2FLL A;  4WFX A;  1R0C B;  2HS0 A;  2XC9 A;  2LQJ A;  4NLP A;  4YME A;  4IH5 A;  4DV0 F;  4LBI A;  4FXW A;  2AX1 A;  5F8I A;  4OL8 A;  3RW6 A;  1AFJ A;  4CH1 A;  1RBO B;  1HKA A;  3CJS A;  5T7L A;  3FK4 A;  3J80 U;  4H4K A;  1C1C B;  2JJ4 D;  3B8H A;  1KN6 A;  2WVE A;  4H4O A;  2P8I A;  3AOC A;  3US5 A;  3NS6 A;  4XDD A;  4JOU A;  2NSB A;  3AB4 B;  4Y65 A;  2DNO A;  5K5M A;  1SC3 B;  2YTC A;  2ZBR A;  1VOM A;  2RRN A;  3PXG a;  2EC0 A;  2XMM A;  5HAO A;  4ANC A;  3QJP A;  1KDN A;  3T5L A;  3BB5 A;  3EGW B;  1BHN A;  3PY8 A;  2J7K A;  4KHR A;  4LUB A;  2RDI A;  1UWA A;  3NG8 A;  1Y11 A;  2FB0 A;  3CCJ S;  2KJW A;  2F63 A;  4NRT A;  4DL2 A;  1XNQ J;  1TQL A;  3GG1 A;  4X84 A;  4USM A;  4X65 J;  3V81 A;  3F44 A;  1UZH A;  1NK5 A;  3M6W A;  3ZFV A;  1N34 J;  1HW9 A;  2EKN A;  1HI8 A;  3M8P B;  3H2U B;  3B4D A;  2DB1 A;  2KKH A;  1IR1 A;  4X62 F;  4Y6I A;  3Q2S C;  4ECS A;  2R8J A;  1SKS A;  4MK8 A;  4QBU A;  2H48 B;  1WOP A;  1PYS B;  4LSL A;  4KHP J;  2LEA A;  1Y0H A;  1AB8 A;  2K7K A;  3IR5 B;  2GQ2 A;  3EGV A;  3LP1 B;  4RNO A;  4DV7 F;  1SL2 A;  1X9M A;  3CME S;  1WI6 A;  2M8H A;  5HP1 A;  5GAE U;  1H2T Z;  1WAC A;  1U8W A;  2W24 A;  3LGH A;  2HFZ A;  4WYW A;  3NGD A;  1FWK A;  2VG7 B;  2KH9 A;  1S9G B;  3WQP A;  1KVJ A;  3ILJ A;  3VAJ A;  5GVQ A;  1U47 A;  3W1Y C;  4IOA Q;  4PYA A;  1U1M A;  4RO0 A;  3DOM A;  1PG5 B;  1WC6 A;  1HLW A;  3D0I E;  5RUB A;  1NB2 A;  5D4O A;  4LF9 F;  1AT1 B;  1NDC A;  5AXL A;  2JX2 A;  3VZI A;  5A8R B;  3G9C A;  1YQH A;  4DPY A;  1YBT A;  2BJ3 A;  4FS1 A;  1XR6 A;  4ES2 A;  2XNQ A;  3NMR A;  3Q22 A;  4NZ0 A;  2JOQ A;  4F50 A;  4U7U K;  3C6T A;  1VR6 A;  2MB0 B;  3DLE A;  1C1B B;  3NGT A;  4F7V A;  2LEB A;  4ED5 A;  4NI2 A;  1B70 B;  5DG7 A;  4RX6 A;  2ATL A;  1S1V B;  1JJC B;  1SQE A;  1SV5 A;  5AE2 A;  1JLA A;  5KFS A;  5KFN A;  4CYU A;  1F5C A;  2KXN B;  2W4C A;  4I2Q A;  4XIU A;  4RBU A;  5CAB A;  3CSK A;  1WHW A;  3CUL A;  4ID5 A;  2NUH A;  1UMJ A;  2R4F A;  3BR9 A;  5C24 A;  4YY3 F;  4V19 X;  1NRK A;  2B43 A;  1JLA B;  2H54 B;  3CCQ S;  1NAQ A;  1EJ7 L;  5CCL A;  4C4W A;  2HUR A;  2V8G A;  4ID5 B;  2PD1 A;  2OFH X;  2LXI A;  5FLX U;  1S6O A;  2DXF A;  3B54 A;  3DU6 A;  5FDL B;  1WC0 A;  4JI2 J;  4LFC J;  5E5N A;  2VBZ A;  3W2V B;  3HD2 A;  2H4W B;  2BUN A;  2KI2 A;  3K17 A;  1LWC A;  2CXE A;  2G13 A;  3M8Q A;  2E5J A;  1WG1 A;  3IGN A;  3TW0 A;  2IFX A;  3J7Z T;  4EYI B;  2XS7 A;  2HW3 A;  2BRL A;  3LP0 B;  2BOA A;  2ZJQ Q;  4YFU A;  1LFW A;  3NEK A;  5I42 A;  4OZL A;  1UTA A;  2FHJ A;  1XQI A;  1W2B R;  4K7Q A;  1NH8 A;  4KGM A;  4DLG A;  3I9Z A;  3MAA B;  2ZHO A;  4GC6 A;  1UVN A;  4DR6 J;  3OFH A;  1XER A;  2ABY A;  4Q43 A;  4JP8 A;  3HF5 A;  5H9E K;  3A3P B;  3HD1 A;  4MKV A;  3BN4 A;  2A2C A;  1TL7 B;  2NLW A;  4QQB A;  3C3L A;  3R2D J;  2QLF B;  5HAN A;  3V6D A;  3CWJ A;  2JZ5 A;  1D8Y A;  4WZM A;  2BJ9 A;  3BYR A;  5DLG A;  4JI5 J;  1SI9 A;  4DS4 A;  1RYS A;  4F3O A;  3MAQ A;  4Q0B B;  1AZS A;  4WE1 B;  3N79 A;  1WI8 A;  3J81 Y;  2BOP A;  3A4T A;  2DK2 A;  2NYI A;  4WII A;  3C15 B;  4PCQ A;  1FRJ A;  4ELU A;  1I94 F;  4IDK B;  2H5I B;  1E6Y B;  3GYN A;  2E29 A;  1NHK L;  1VMB A;  1FNM A;  4IH7 A;  5HP1 B;  4USW A;  4QIF A;  1S4F A;  1FXR A;  1IN0 A;  2XWX A;  1HAR A;  2VBY A;  1S6Q B;  2YX7 A;  2ZVS A;  1FK9 B;  3MPY A;  4WE1 A;  3TZZ A;  3KLE B;  1UVK A;  3KK3 A;  1Q7L B;  3NNA A;  3DOK A;  1EIY B;  2YNI A;  2WW8 A;  4HEA 9;  4X64 F;  5D3G B;  3Q8U A;  4URQ U;  1S4E A;  2F9J A;  3UDV A;  3THV A;  1IBM F;  5E3P A;  2MZS A;  1IBK J;  1UWB B;  3R6L B;  3EZU A;  5T7L B;  1F2G A;  4F2S A;  5KFL A;  1F3V A;  4AQY F;  2DO0 A;  1RT1 B;  5AE1 A;  2PT0 A;  4USU A;  3TA2 A;  1NBE B;  5CZC A;  1U6F A;  2OPQ A;  3H7H B;  1RU1 A;  4K5S A;  5KFM A;  4W98 A;  1U4B A;  4RJV A;  3GV8 B;  1WHV A;  2HWH A;  3BO2 A;  4TU8 A;  6FD1 A;  5KT4 A;  2BRK A;  5HI7 A;  1VQ6 S;  2G2O A;  2ZH2 A;  1OSC A;  1LXJ A;  1KOO A;  2GHV C;  4A47 A;  8ATC B;  1RYR A;  3C14 B;  4YUD A;  4E8U A;  3HSD A;  5D0G A;  3N9U C;  2Z2Y B;  1VS3 A;  3A13 A;  3M2R A;  4FPR A;  4DR3 J;  1XMO F;  2CUY A;  3R3T A;  4LBH A;  3NMA A;  2JC0 A;  3JXO A;  4DLE A;  1SJ4 P;  5GMK a;  1HQU A;  2PMH A;  3KHR A;  1IKY A;  3PZP A;  2KJV A;  1NCL A;  1NHU A;  1H0H B;  1IQT A;  4CLK A;  4OI4 A;  1L3K A;  3C19 A;  3THT A;  2I38 A;  1QUP A;  2ZD1 B;  2AIR B;  1T9V A;  4O3S A;  1JLE B;  2H5E A;  3T1H J;  1KVK A;  1REV B;  2B7C B;  2G9O A;  3ETM A;  2IYI A;  3H5U A;  4TVA B;  2BQU A;  2QE5 A;  3LP0 A;  1XBW A;  2XNR A;  1KQG B;  2CIM A;  1FDA A;  5I42 B;  5KTQ A;  5U47 A;  4KR0 B;  2ZD1 A;  2W9A A;  5KG6 A;  4RW9 B;  3GIM A;  2GIQ A;  3DLJ A;  3JYT A;  2QV6 A;  1OJ4 A;  5HO4 A;  2LQB A;  4HT5 A;  1JLQ B;  4ZVH A;  2CZV C;  1BQX A;  2V4J A;  3KTQ A;  3D1Q A;  2QJ3 A;  3AA9 A;  2VQE J;  2AJQ A;  2EBE A;  5KOW A;  2UVV A;  1EAR A;  3KG0 A;  2U2F A;  3Q8P B;  5IT4 A;  2YWF A;  1R6Y A;  3ICL A;  3JYT B;  4DV0 J;  2B6A A;  3RAQ A;  4B9L A;  1N32 J;  5GAG I;  4PQU A;  1RB0 A;  1FDB A;  1NDP A;  1AW0 A;  3GLJ A;  4XTT A;  2J7W A;  1RT3 B;  1K1Q A;  2KHD A;  2NUU G;  3DLE B;  1U2F A;  4FN5 A;  1NPR A;  3JQM A;  4L6V 3;  5J2P B;  3AHP A;  2ZH5 A;  3UR0 A;  1HBO B;  4B3S F;  2XCA A;  2CJQ A;  3QJL A;  1WTF A;  2ZH9 A;  3OT9 A;  2UUA F;  4OHV A;  3QAU A;  5BYS A;  1C4C A;  4DV6 J;  4ECR A;  5CA5 A;  1QE1 A;  3H40 A;  2VG6 A;  2VPX B;  2YNI B;  2DO4 A;  3SSS A;  3W8P A;  2CQ2 A;  2K3K A;  2YXL A;  5E3C A;  4A4J A;  3H4B A;  5LT5 A;  5I3U A;  1T03 A;  4RWW A;  4DG1 B;  1E6V A;  2NS1 B;  3MPV A;  2MZ1 A;  3N28 A;  1GMW A;  2VOP A;  3MGJ A;  1FRK A;  1UKU A;  1UCN A;  1N34 F;  2CNL B;  1T03 B;  3EGZ A;  3RJM B;  3T9N A;  4N8O A;  2WVD A;  5IT9 Y;  3AD8 C;  3QGG A;  3QT6 A;  4TNO A;  2R7V A;  4USJ C;  3UN3 A;  4OYO A;  5DDP C;  3QWP A;  4RZR A;  3MR3 A;  2D3O 1;  1IWG A;  1CJK A;  4NYO A;  3LGN A;  1VRU B;  2UV8 A;  4QW9 A;  3K2Y A;  4ZPW R;  4DV7 J;  1TK0 A;  4IO1 A;  4WU3 A;  4DJB A;  4U8Y A;  5I4M A;  5AXN A;  1D8Z A;  2PDA A;  3HJV A;  2HFS A;  4OYM A;  2HHV A;  4QOT A;  2VQF F;  2ROE A;  2IM0 A;  4NOH A;  3DI6 A;  2F3J A;  3C6U A;  3GTY X;  4DCO B;  1RHU B;  2BE2 A;  2G1H A;  2G0J A;  5LSR A;  3OD2 A;  4LRE A;  3DM2 A;  4ZN1 A;  1LW0 B;  2RQ4 A;  1F9F A;  4MK7 A;  1NK8 A;  3VAL A;  2B56 A;  3CCW A;  5CYQ B;  2H3E B;  2FVR A;  1DZ5 A;  1TL4 A;  4G1P A;  3C16 B;  3OHA A;  3BGF A;  5M2P A;  1RAO A;  3PHE A;  2KHC A;  4IOC Q;  1HW8 A;  3CE8 A;  4DPO A;  2HMI B;  2E7V A;  1CG2 A;  2DNM A;  3BPD A;  5MAO A;  1YJ7 A;  4F36 A;  3GJQ B;  1GH8 A;  3C46 A;  2QLB B;  2NCK L;  3PFE A;  3UDC A;  3CCM S;  4KBI A;  2DKO B;  4KC5 A;  4PG5 A;  2XYG B;  1S6Q A;  1JLQ A;  3MEE B;  4UOF A;  3WIU A;  5DS7 A;  3GJS B;  4YY3 J;  2L9N A;  3LP1 A;  2NXU A;  3GFX A;  3H59 A;  4N7T A;  2GVD B;  2DT9 A;  1QAY A;  4DFK A;  4HDG A;  3JS9 A;  1B4S A;  3JTN A;  2D9P A;  4CLL A;  2Q1L A;  1P1L A;  1VIX A;  2DNH A;  5L1K A;  3BBB A;  4N5S A;  1CJU A;  2BMB A;  3DLG B;  3HX9 A;  3BDP A;  1UEV A;  4YN3 B;  1JIH A;  3MPU B;  3TAP A;  2MKS A;  4IG0 B;  4DOZ A;  4KB7 A;  3KUG A;  1X5P A;  5L39 A;  3G71 S;  1M0S A;  1QAX A;  4ZLP A;  3EPI A;  3C6T B;  3W9H A;  4DZ6 A;  3H42 A;  5HVH A;  2V8V A;  5C2G A;  1F5A A;  4PG4 A;  2VG6 B;  2IJR A;  3BV8 A;  3LTO A;  1S7H A;  2FHM A;  5CYM B;  3KKF A;  4J90 A;  3ZZR A;  1GXT A;  3OBI A;  3ILL A;  3KLI A;  1GQE A;  4OI3 A;  3NAH A;  1JX4 A;  4DG1 A;  1U26 A;  4Q2L A;  5A0Y A;  3WX8 A;  3HT3 A;  4F4Y A;  3PFO A;  1JLF B;  2QC3 A;  3A12 A;  1QSY A;  1HA1 A;  1QJH A;  4TLR A;  5D4L A;  5FJ4 A;  1S12 A;  1FJC A;  4AE5 A;  1HYS B;  1I1G A;  3VAG A;  5B0E A;  2XGP A;  4F0K A;  1WOR A;  4YOE A;  3PYF A;  1FE0 A;  3VV2 B;  1M90 T;  3AOD A;  3CB4 A;  1T8E A;  1BWE A;  2OH2 A;  4M5K A;  1Q0N A;  1RTJ B;  3HVR A;  4H54 A;  4Z37 A;  2G4B A;  1B7F A;  1U2R A;  1RU2 A;  2D9O A;  4AMM A;  1NK7 A;  2SXL A;  3DM2 B;  2ZDP A;  2OFG X;  2OP5 A;  3GSI A;  3LP2 A;  1JKH A;  4OHZ A;  5LMN J;  5H9E J;  3B6B A;  4AMO A;  3CJ0 A;  1FKO B;  1LK5 A;  1RT7 B;  3M32 A;  2I5J A;  4Q44 A;  1YG0 A;  2FIU A;  1J5O B;  3NS7 B;  4DPW A;  1R0B G;  1IBK F;  1D09 B;  5E3R A;  2R7O A;  5M2U A;  3FEY B;  1XJW B;  4J9P A;  3T1Y J;  1VI7 A;  4AQY J;  4CLS A;  2YWG A;  2JLG A;  1RHR B;  1C2P A;  4ELV A;  4IR1 A;  1UJ5 A;  1IR2 A;  2G1D A;  4B3R J;  5KG5 A;  2W9B A;  2I5J B;  5A2Q Y;  4PG7 A;  2MGZ B;  4J9M A;  3RR8 A;  3BGU A;  1GMV A;  2XMV A;  3E01 A;  3OVA A;  3RB4 A;  1X4G A;  4C8K A;  4ZDN A;  1HFE L;  2FY8 A;  1NPP A;  2XTJ P;  3LH2 S;  3R6G B;  1RCX B;  3M8S A;  2GVD A;  2XMW A;  3R7N B;  1HNI A;  3A8E A;  2XMT A;  2Q6C A;  1TKD A;  2JH3 A;  1XMO J;  2Z56 B;  4E2F B;  4DR3 F;  3QBC A;  3TR5 A;  3L4B C;  2J0W A;  2I6W A;  1RCO B;  1NZA A;  2K1R A;  3SEO A;  4LF7 F;  3HSG A;  3AB2 B;  3NGR A;  2NXJ A;  5D3G A;  3MPW A;  2HZC A;  4OIX A;  2COL A;  5HJY A;  4KRW A;  3RGI A;  1BC6 A;  3ENW A;  2IDL A;  2QL7 B;  1TKX A;  4OX8 A;  3VQS A;  4OJ1 A;  1N33 F;  2GIF A;  2YKN A;  4N8N A;  3R8Y A;  1VQM S;  1UFK A;  1VQO S;  1TMM A;  1U0H B;  2CNK B;  2N7Y A;  3B4M A;  3LW5 C;  3R5C A;  4HLB A;  1LOU A;  2M52 A;  4ZCL A;  4R5P A;  3CJQ A;  4IKA A;  4JI0 J;  1JMT A;  1TKX B;  4WXW A;  4NPO A;  3W63 A;  3FBB A;  1U48 A;  2QA4 G;  4B9N A;  3PW5 A;  1A0O B;  2EI5 A;  2HAF A;  1U24 A;  4LF4 F;  1EKS A;  3DDI A;  1U0H A;  2J76 E;  4NYP A;  4Y34 A;  3M8W A;  1AA1 B;  1CC8 A;  1FRL A;  2QFI A;  1Z2Z A;  5CYQ A;  1Q1K A;  1WC5 A;  2M4M A;  3FQK A;  4ZVO B;  4K4T A;  5E41 A;  1XMQ F;  4LF6 F;  2Z2M A;  2X1A A;  4K0K J;  4ICL B;  1MU2 A;  2H9Z A;  1JJ4 A;  5ETQ A;  1MG7 A;  1GMW D;  3A3O B;  4TQR A;  3OSN A;  4ECV A;  3QWU A;  1UA0 A;  1CJV B;  4EU0 A;  2DJW A;  4NZ7 A;  3G6E S;  4DS5 A;  2BAC A;  2DRD A;  4Q2M A;  3MMJ A;  4O0N A;  5DO2 A;  2PII A;  2R8I A;  5M2R A;  1Q7Y T;  1JLC A;  3Q24 A;  3BGR B;  4WPA A;  4ZVS B;  2DHX A;  2E5L J;  4ENO A;  3JAM U;  2XUL A;  2YQ0 A;  4Q5V A;  3MEE A;  2BM1 A;  5KG2 A;  5KFJ A;  4QJV A;  2FD2 A;  3H2V E;  5B0G A;  2EFP A;  4ECY A;  2QA4 S;  4PXB A;  2E5G A;  2ADC A;  2L9W A;  1Q8B A;  2HWT A;  2ZKU A;  3CJR A;  4I64 A;  1GTH A;  1M1H A;  1TKZ B;  2EG2 A;  4YHH J;  3V6K A;  2NZC A;  1S0N A;  1TR0 A;  5J1N A;  4DQI A;  4R0J A;  2VF3 A;  3EYZ A;  1ZBT A;  3LWL A;  3CCE S;  1EKR A;  3AY0 A;  4RNF A;  4OJG A;  3RTV A;  2AF6 A;  1TEL A;  3GII A;  5B0A A;  3UNY A;  1WHY A;  2AEM A;  4P9S A;  2M2B A;  4UOC A;  5HVG A;  3NY0 A;  1WWH A;  1C0T B;  3AJ1 A;  3BQ0 A;  2ZWO A;  4B3T F;  3AFG A;  3SCI E;  5KFR A;  4X2B A;  2A1B A;  1H98 A;  2Y0B B;  1MLA A;  3DMJ A;  3DRY A;  4EEY A;  1M5O C;  2RML A;  2R2R A;  3R5J B;  5HSP A;  5KFY A;  3VF0 B;  4C8Z A;  3PW4 A;  2E66 A;  2ATC B;  1N0U A;  4DR5 F;  3X1L B;  4F0H A;  2MQQ A;  4X4S A;  1CUL B;  2DY9 A;  5BYQ A;  4CLU A;  2GNK A;  2EFQ A;  3FFI B;  4LRF A;  4LFA J;  1T0T V;  3AOA A;  3V6H A;  1U49 A;  3T6J A;  2AJF E;  1LEO A;  4NLS A;  3T3F A;  4Y28 C;  4NA1 A;  2HRU A;  1RWU A;  5F0U A;  3MTK A;  3I55 S;  2UXC J;  2DCU B;  1JNZ B;  4I67 A;  3SQG A;  1D0E A;  2CDR B;  4AMP A;  2WVB A;  1HBU B;  2V67 A;  4ZPD A;  5C25 B;  3J7A N;  3N0V A;  4MMO A;  2JVO A;  5K14 B;  3JQK A;  3PR5 B;  3T5H A;  1TU0 B;  4KGZ B;  1FRX A;  1UP1 A;  2CWX A;  2RD5 C;  1YIJ S;  4KSE B;  4M8L A;  3EVM A;  1JLB B;  3AQO A;  4ZS6 A;  1TV6 A;  2XYP B;  4QZV B;  1J2V A;  1KEK A;  2RRA A;  1RLC L;  2R2T A;  1F0X A;  4DDF A;  3J81 U;  1TFY A;  1ELO A;  2AEF A;  4PEO A;  2DIV A;  3ILI A;  5F8L A;  1SL0 A;  4PWD B;  1K1S A;  1VCT A;  2BEF A;  2KB2 A;  5DJB A;  5KFT A;  2AGO A;  5LJ3 Y;  3I0S B;  5D6G A;  2W9B B;  1KD1 T;  4AXI A;  3MED B;  1N36 J;  1CS4 A;  1Z2L A;  4MJK A;  3Q2T C;  1JQG A;  3NOG A;  1SCJ B;  2F65 A;  1JWW A;  1CBK A;  2HMI A;  1LWF B;  2Z57 B;  4PXC A;  4Q7A A;  2JHE A;  4AXJ A;  4CDI A;  1CLF A;  2BW7 A;  1S6U A;  5GME A;  3KLF A;  4RNM A;  2ALY B;  1ZAV A;  2J8S A;  2VPW B;  3GCW P;  4USK A;  1S9F A;  6AT1 B;  4MYT A;  2Y3Y A;  3N6L A;  4G3I A;  5L9N A;  1M5S A;  1RAG B;  1TL5 A;  3ZZO A;  2IM3 A;  4UQG A;  3Q8S B;  1RGV A;  5K9F A;  2LU1 A;  3TZW A;  4H4M A;  1VYA A;  1NKC A;  4NML A;  3OSP A;  4LRD A;  2NRE A;  2VUG A;  2ZVI A;  2AJ4 A;  2LLZ A;  2WVC A;  1LK7 A;  2AZ3 A;  3LWM A;  2PA3 A;  1C0T A;  3QSI A;  4ZPV R;  4WFA Q;  2L3M A;  4RW7 A;  3FNN A;  2ZC3 A;  1N8R T;  2WTF A;  1Q79 A;  2UZA A;  2E9Z A;  1DAX A;  1N5Y A;  4LFB F;  2BBE A;  1FT8 A;  3M05 A;  2WK4 A;  4ED3 A;  1IWA A;  2LKZ A;  1WC1 A;  4JV0 A;  4USH A;  2VHG A;  3EGN A;  2Y1I A;  4WKR A;  1RSC A;  4FF1 A;  1DQ8 A;  4JV5 F;  3M30 B;  4LQ3 A;  1WOS A;  2BR0 A;  2KDO A;  3JTO A;  2B8Q A;  3PTW A;  1VRQ C;  4YP3 A;  1ZZN A;  5JXS A;  2DH8 A;  2YH1 A;  2JVR A;  4ZKA A;  3FCV A;  3KG4 A;  3IN5 A;  1FF2 A;  1RHQ B;  2HQC A;  1H74 A;  4C2M A;  2IJF A;  2E5H A;  3GWC A;  3O2I A;  4J9U E;  4OI1 A;  3RAM A;  4CP5 A;  5A6P A;  2VG5 B;  4IUF A;  2HPU A;  1N5Q A;  2GS8 A;  4AD6 A;  3OV7 A;  1HBN A;  1FI4 A;  5DGA A;  4DZD A;  2IHR 1;  1PIL A;  2VC1 A;  3N4W A;  4RW8 B;  2V50 A;  3RBX A;  3UD3 P;  4FBT A;  1JLC B;  5DET A;  1B0P A;  2Y0S D;  4PPZ A;  3NCP A;  5ETM A;  9ATC B;  4C8Y A;  1IQZ A;  3NS5 A;  3WBZ A;  4R25 A;  4P7V A;  5ETL A;  2ZH4 A;  3MD1 A;  2ADB A;  3CW2 C;  2WZ1 A;  3MM5 A;  2QFJ A;  1JXV A;  5MLC V;  1ZM3 A;  2P6S A;  4GKK J;  2EKY A;  5IFM A;  2JDJ A;  2DHH A;  4QU6 A;  3LUY A;  1VQL S;  2I0X A;  1P27 B;  2FJW A;  2W25 A;  4ZCK A;  1FKP A;  4B9T A;  3CDB A;  2XSJ A;  4M95 A;  2FHK A;  3O6Q A;  4QWC A;  3ADA C;  2RDJ A;  2M0G B;  4R8U A;  2QEX S;  4JV1 A;  5F3T A;  1CJT B;  2CPH A;  2RQM A;  2XZW A;  3G2X A;  2RDD A;  4EO6 A;  4OX7 A;  4EWT A;  2HBQ B;  4ZPC A;  3IWN C;  4PKD B;  1YI2 S;  1LWF A;  5E0O A;  3ONQ A;  4LIR A;  4C3L A;  3KLG A;  5ETO A;  4NCB A;  2VZ9 A;  1MN7 A;  2MKI A;  2CKW A;  3PW2 A;  2Z2Z A;  4P2S A;  4JI0 F;  3CJ3 A;  1X0P A;  2AJ2 A;  2OO4 A;  4JI8 J;  1Q5Y A;  2C2Z B;  3Q89 A;  1S59 A;  2VBX A;  4DL7 A;  1WNE A;  3DLB A;  2N7C A;  1NK0 A;  1S99 A;  1S57 A;  2FVQ A;  1PC4 A;  3U1L A;  4M5G A;  1QTM A;  4KYZ A;  3AQP A;  3W66 A;  3BR8 A;  4JI4 F;  3TX8 A;  2ZZN A;  1KBR A;  1T9T A;  1UW4 A;  1D9D A;  3POT B;  2LDY A;  3KG1 A;  4M5D B;  2C2D A;  3K8W A;  3KHG A;  4RU2 A;  3HKZ D;  2VON A;  4UZC A;  3HHL C;  5DG9 A;  3PIO Q;  1G3O A;  1ZAW A;  3HZE A;  4J9V A;  5LL6 d;  3VGU A;  1VQN S;  3HJF A;  3ZTR A;  4I7F A;  2E5L F;  3OXG A;  4ATN A;  1BXN A;  1Z4U A;  2YX1 A;  2RS2 A;  3ZZ0 A;  5GMD A;  5LXR A;  4F4W A;  1Q78 A;  2YWW A;  5B0D A;  3TUZ C;  1NEE A;  3LAL A;  3SI8 A;  3FMW A;  1HBM B;  1KP6 A;  3B78 A;  3HVA A;  4FP9 A;  3OJS A;  2R2U A;  1TV6 B;  1F1B B;  2RUS A;  3RUB L;  2VIC A;  2KN4 A;  4CT8 A;  1SKU B;  2J0X A;  4MIA A;  4DQQ A;  1HQE A;  3CIM A;  4QR0 A;  5A6W A;  2EFV A;  5IV4 A;  1VRT B;  1OQ6 A;  2HFN A;  2HG4 A;  3PRD A;  4QIG A;  3UDL A;  1S77 D;  3PKM A;  1HBN B;  2XYH B;  2DH9 A;  2EFG A;  3AJD A;  3C66 A;  3L7U A;  3MM6 B;  4FDF A;  4Z7C A;  1ZYQ A;  2D3Z A;  1CS4 B;  2GHW A;  4PQA A;  2HGM A;  1SC6 A;  2C2O B;  1VBK A;  1VRT A;  2HNZ B;  1HR0 J;  2ROP A;  1TP7 A;  2J9E A;  3MFI A;  2AP6 A;  4DSE A;  1RKI A;  4RWX A;  3ZZZ A;  3D1H A;  1RWM B;  4OV6 A;  2V94 A;  1IM4 A;  2RNE A;  1T3O A;  7FDR A;  2DY1 A;  3CDA A;  4J7C A;  1RAH B;  3QGI A;  4YQW A;  4YR3 A;  3EPG A;  1TUW A;  3OR2 A;  1MWY A;  2XLK A;  4B9S A;  2KG0 A;  3CO0 P;  2EBG A;  4NCG B;  1HWK A;  3ELH A;  5AT1 B;  3ET6 A;  3OLA A;  1ZS6 A;  1UA1 A;  4RW7 B;  1ZH5 A;  3IM8 A;  2YKP A;  4OI6 A;  5HL7 Q;  4XPE A;  2R9L A;  2H51 B;  3I31 A;  3M7V A;  5H9F J;  2ASJ A;  4ECT A;  4OJ3 A;  1SJR A;  2Z4P A;  4B3M F;  4WYL A;  3ET6 B;  1RAF B;  4C0H A;  4X66 F;  1YX2 A;  2YNH A;  4HI2 A;  4DV3 J;  2LA6 A;  4GRS A;  2KFN A;  3DMJ B;  1DRZ A;  3PX0 A;  3UCG A;  2OEL A;  4A8M P;  1S1W B;  2OTJ S;  2RE1 A;  1IJF B;  2VJU A;  2DGQ A;  2I2Y A;  2PFF B;  1RTZ A;  2ZUA A;  3KFW X;  3DLK B;  4DV5 F;  4OYZ A;  1WKJ A;  2CQB A;  5EDW A;  3POT A;  4M5D A;  2GZO A;  4CH7 A;  4DMZ A;  2WB1 D;  2AJ1 A;  3H0P A;  3HFV A;  3W7B A;  3MDF A;  4WZQ A;  3RU0 A;  2A2D A;  3IO1 A;  3M2U B;  4IG3 B;  3TRG A;  4Y0F A;  1VQ8 S;  2R7U A;  3D5M A;  2DNR A;  4HL9 A;  2B0G A;  4DUZ F;  2KZM A;  2M88 A;  1PBU A;  4PZV A;  5KFE A;  4YDX A;  3LAM A;  3W5Z A;  5KFB A;  2NXN A;  3BH7 B;  3TAN A;  3RB3 A;  5ETP A;  4I2P B;  1HI0 P;  2FHJ D;  2W9C A;  3QMQ A;  5CHC B;  4XDC A;  1IKV A;  5B0B A;  4HYK A;  5HRO A;  3EMT A;  3MEG B;  2DXE A;  4L73 A;  3QLH B;  1HBU A;  1FFS B;  5DZ7 A;  4ZJQ A;  4RPF A;  3TEG A;  4BHQ A;  2HHH F;  2FDN A;  2IC3 A;  5LOQ A;  1XC9 A;  2KRR A;  2O1P A;  2ZM6 J;  2W8L A;  4I2P A;  3MUT P;  3UQS A;  4Y2I A;  1JLB A;  1G6B A;  2Y1R I;  2RIJ A;  3H90 A;  4IYQ A;  2DGS A;  4LRC A;  3R97 A;  1TAU A;  2HHT A;  5T14 A;  2QYG A;  1OY9 A;  1RWV B;  1XR5 A;  2MY7 A;  2MKK A;  1BQN B;  5A8W A;  3CC4 S;  4NXN F;  4YDD B;  1X4C A;  4DEZ A;  3V4I B;  2D3O R;  1RWK B;  5DLF A;  2R8K A;  4ZLN A;  1OYE A;  5IS2 A;  4LR9 A;  2ASL A;  4LFB J;  1HNZ F;  2EVZ A;  3AXK A;  3ZTQ A;  3A8I A;  2QMX A;  4HT7 A;  4HDH A;  1NDK A;  2CQG A;  4UT4 A;  1TFW A;  1VK3 A;  1G1X A;  1BQN A;  3SFG A;  1MW7 A;  3PRB A;  2KXF A;  4ZVP B;  4DN9 A;  3EWG A;  4JV5 J;  1VHI A;  3O3L A;  2UUC F;  1X5T A;  4OZ5 A;  3P5B P;  3ZNJ 1;  3CCS S;  1FRI A;  2MZR A;  1IKX A;  1FVS A;  3T9Z A;  3FSY A;  2ILY A;  2IAJ A;  1VQK S;  3QIP B;  3KLF B;  2DGT A;  1WDD A;  4C8N A;  2CYY A;  3J7Y U;  2W1B A;  3DYA A;  3GCX P;  2HQI A;  3HVT A;  3MMC B;  4WP3 A;  2IJN A;  4QWB A;  3HCX A;  4ZK7 M;  2NR0 A;  2NXC A;  1YRX A;  2DEI A;  1N5V A;  1NLK L;  1ACM B;  1I3O B;  2GGP A;  3QIP A;  4RUB A;  3DOL A;  3W62 A;  2XO6 A;  1SUQ B;  2M5Y A;  3OXF A;  1HIY A;  2HFV A;  2V4Q A;  4DV1 F;  4URS A;  2BKO A;  3GQC A;  2YQ1 A;  3DHX A;  4LFC F;  2J5A A;  5CCM A;  1YJV A;  3MM9 B;  3VCD A;  4EI2 A;  1HWI A;  1MN9 A;  2JEF A;  2ZBP A;  1S1W A;  3BBF A;  1FJG F;  3F41 A;  3W9J A;  3FC9 A;  2ZH7 A;  4C8L A;  5D15 A;  5CD4 H;  5F8J A;  3QJJ A;  4KHM A;  3SBM A;  3VAI A;  4J9N A;  3H5Y A;  3TUP A;  5K8N A;  4PRF A;  4OMF G;  1S0M A;  4HH1 A;  4EGL A;  2XQC A;  3CMQ A;  3FRZ A;  3P3D A;  4KO0 B;  4ECQ A;  1RDR A;  4CZC A;  3CUN A;  3GV7 B;  3HHE A;  3HLU A;  2GML A;  1NHV A;  3GP9 A;  3BF4 A;  4PUO A;  3HP6 A;  1YLX A;  4DN0 A;  1FVQ A;  4WP8 A;  1SQF A;  3PO5 A;  3QFW A;  3QRP A;  2QG9 B;  2V2Q A;  1YJ9 S;  3VHQ A;  2GFF A;  3PX4 A;  1KVI A;  3TUI C;  3LOU A;  2HVD A;  4NL5 A;  3KHL A;  1IBL J;  3K0J A;  2DNY A;  4HHH A;  4KE5 A;  2IY5 B;  2GJF A;  3EIC A;  4DSI A;  4ALZ A;  1REG X;  4JI6 F;  2WSC C;  3D2W A;  5CH7 B;  2ROG A;  3TJA A;  1U7L A;  2M7S A;  4ECX A;  1HNX J;  1T9Y A;  3NNH A;  3GIL A;  2UUB J;  2DXD A;  3BGO P;  4JI4 J;  3RBD A;  2V68 A;  2H5J B;  3EVW A;  3ZZP A;  8RUC A;  1R6V A;  5G0R B;  4EK2 A;  4KAI A;  4ZP6 A;  4K4Z A;  2BE9 B;  4MK9 A;  1DTT B;  3D0H E;  3PG9 A;  4TQS A;  1ROF A;  1U45 A;  2VOD A;  3OTE A;  1K0V A;  1CPZ A;  1Q82 T;  3TP2 A;  3JSM B;  4WFZ A;  4KFB B;  4KV8 B;  3HFK A;  3PR4 A;  4ZVR B;  3MMA B;  1YGY A;  2JFK A;  2LQ5 A;  1U1O A;  4F2R A;  3MZI A;  2VFV A;  1U02 A;  1X4D A;  3HFZ B;  3IR6 B;  3K57 A;  2BJD A;  2JFD A;  1SBR A;  4PYD A;  3TVZ A;  3CJ5 A;  1UVL A;  3IWL A;  3TEH B;  3TI0 A;  2HKE A;  4DU7 A;  1NO8 A;  4ZN3 A;  2XY6 A;  3MMB A;  4BWM A;  5GAH I;  2C3U A;  3DNC A;  3EUN A;  5DM7 Q;  4USI A;  1MMN A;  4I6Y A;  3RBE A;  2LQ9 A;  3EDR B;  4LF1 A;  3E8O A;  3R27 A;  1OIA A;  3W9I A;  3OVB A;  3IA0 A;  4I2Q B;  4NEY A;  4Y3C A;  3RBZ A;  3THP A;  2KO1 A;  1MNE A;  1Q95 G;  2CQD A;  1U1L A;  5EN1 A;  5EX0 A;  4JI3 F;  2QL5 B;  4EZ6 A;  1N88 A;  2WBR A;  2CPD A;  4DXL A;  3SSR A;  2CQ3 A;  3RYL A;  4ETZ A;  1Y5I B;  3MD3 A;  4K8R A;  5JMN A;  2QIF A;  5IWA J;  4HI1 A;  5JVH Q;  1T05 A;  3I9V 9;  4PG8 A;  2F9D A;  1VHF A;  4JV2 A;  3A8K A;  3K5M A;  1F9H A;  4EBE A;  2XLI A;  1SXL A;  5KFA A;  1JNR B;  1TVR A;  1UFW A;  4U96 A;  3AH6 A;  4NZ6 A;  4NX9 A;  4OYI A;  1HPZ A;  2QYC A;  3SSQ A;  4C3M A;  5HQ8 A;  2GJI A;  2OI2 A;  4MH8 A;  1HHQ A;  1RT6 B;  2AYM A;  4RBT A;  5IM0 B;  2DR9 A;  2CQ4 A;  2VA2 A;  2EK1 A;  3NCR A;  1RT5 B;  2YX4 A;  3PIP Q;  1HWU A;  4ZIV A;  3MUM P;  4FBU A;  2A3J A;  2BKN A;  4YR2 A;  2V6A A;  1SH2 A;  4HAC B;  2L48 A;  1SJQ A;  4NLD A;  1QDU B;  3BO3 A;  4AMN A;  3RB0 A;  3OTC A;  3PHT A;  4WTO B;  1NJZ A;  4OZ0 A;  2ILZ A;  2BE7 D;  1GNK A;  1Y00 A;  3MF5 A;  1FXL A;  1TL1 B;  2VKR A;  1FTR A;  4OX6 A;  4ZHR A;  2L08 A;  3F0N A;  2BAB A;  4L75 A;  5J1P A;  1YWX A;  2YPY A;  5FLX Y;  2OGU A;  1H2U X;  5L38 A;  1QSL A;  4PG6 A;  1NSQ A;  1QY7 A;  4O3N A;  2M70 A;  4OYX A;  4ZA1 A;  5BJR A;  3VAH A;  1TL1 A;  4OHX A;  3UD5 A;  4CNY A;  4ZHR B;  1RTD A;  2RRB A;  5EWG A;  2IVM A;  4A8Q A;  2QN6 B;  2K3I A;  5ETR A;  2VH7 A;  3NL0 A;  3NOC A;  3FZB A;  2CPF A;  4P73 A;  2AT1 B;  2CPE A;  1UVJ A;  2IVY A;  1WG5 A;  2XZD B;  3NLC A;  1TK5 A;  1LFP A;  1HD0 A;  4DV2 J;  2AGP A;  1BUX A;  4DV5 J;  3BGL A;  2KFZ A;  1NME B;  2HHX A;  2FUG 9;  2K2P A;  1DTT A;  2RQK A;  4ZPB A;  1CEZ A;  4QW8 A;  3H5X A;  4B9U A;  4J91 A;  3KLE A;  5KFC A;  3GV5 B;  2Z2L A;  4P52 A;  2VL1 A;  3ENQ A;  4JI3 J;  5H9F K;  4KV8 A;  3FRY A;  2GGP B;  3PJ9 A;  3W61 A;  5LJ5 Y;  1NK4 A;  1V5I B;  2CJB A;  2VB6 A;  2GMH A;  3QT7 A;  5SUH A;  3ZTP A;  1QVG R;  1RTI A;  1Q5V A;  4ITS A;  4OHW A;  5L1J A;  1ZET A;  2DGW A;  2JL9 A;  2VKZ G;  5KFD A;  4DSF A;  1YJN S;  3OL9 A;  4DI6 A;  1NH7 A;  1LQ9 A;  3HZG A;  4IFV A;  2XI2 A;  1X0F A;  4NLV A;  2FY1 A;  1EQM A;  2HS3 A;  5LMU J;  3IGV A;  5D8H B;  3NWR A;  5A8R A;  5HQM A;  1LNQ A;  4J9K A;  1UFL A;  2YNF A;  2HS4 A;  2DNL A;  1HMV B;  2MST A;  4DF4 A;  5B0F A;  4CLW A;  2GVZ B;  4CH0 S;  3QID A;  2MQ8 A;  4QR1 A;  3H20 A;  2X7I A;  2LDI A;  4ZPA A;  4BCA A;  3IBW A;  1QTN B;  2DD8 S;  4V19 J;  3CTR A;  4TYA A;  2YNF B;  2KRB A;  4JB8 B;  3RG6 A;  4U6P A;  3GZ7 A;  3R1L A;  4GKJ F;  2WBM A;  2ZNZ A;  2ZHA A;  1Q81 T;  2DIS A;  2GAH C;  1S0V A;  1EX8 A;  3CMA S;  1DLO A;  1DY3 A;  1T95 A;  3M2U A;  4IG3 A;  5HK4 A;  1PYO B;  2VOO A;  1K9M T;  1ZZF A;  2EXU A;  4CO3 A;  1RT6 A;  4MYU A;  4X4Q A;  1ZAX A;  4K5R A;  2NSC A;  3ISZ A;  1L3S A;  2UUC J;  4CM2 A;  3V81 B;  1M5H A;  3M9O B;  2W9C B;  2IMO A;  4FXD A;  4HH0 A;  1RBL A;  1IKV B;  1G7C B;  3LPE A;  4OZ2 A;  5HRO B;  1U1Q A;  1N6Q A;  1UZD A;  1PO6 A;  1RWN B;  2OPS A;  1LWC B;  3CCR S;  4RW9 A;  3PCO B;  2MLX A;  4BS2 A;  1VK8 A;  2LA4 A;  3WDO A;  2E1R A;  2DGX A;  4K4Y A;  1TZ0 A;  2BVZ A;  3DRS A;  4FVM A;  2ZEJ A;  4D3H A;  3MHY A;  3QAE A;  3LGM A;  3MUR P;  4DR4 F;  1EB0 A;  2P9C A;  3CXC R;  7AT1 B;  3NCQ A;  5F0W A;  2HSE B;  3ITH B;  4IO9 Q;  4U9R A;  1TUV A;  5EX3 A;  4ZMM A;  4OI0 A;  4J5O A;  4Y2A A;  2BM0 A;  1LXN A;  2GHP A;  1LW2 B;  3FEX B;  5KFI A;  4TY9 A;  2W7A A;  5KFZ A;  3GIK A;  4OYB A;  3MMB B;  5F8H A;  3FCW A;  2Q66 A;  1XNQ F;  2BJ7 A;  2GIR A;  1NK9 A;  4X65 F;  1AZS B;  1ZM2 A;  3D7S B;  4KY3 A;  2FVP A;  3TAM B;  1C1B A;  1UPP A;  4J9S A;  2RHS B;  3GON A;  2AMC B;  2CPZ A;  3MEC A;  4DU8 A;  1H6K X;  2HND B;  4FZV A;  4N77 A;  4CRJ A;  3MR5 A;  4YB5 A;  2B4P A;  3VGV A;  4X62 J;  3HM9 A;  2X51 A;  1ARO P;  1APS A;  2J0S D;  3KYL A;  1RTI B;  1JXE A;  2GAG C;  1KTV A;  2MZJ A;  2QSF A;  3BRE A;  1H3D A;  2GX8 A;  3R5A A;  4A46 A;  4DCJ B;  3CJK A;  2HBR B;  2VV5 A;  4DR2 F;  4KHP F;  1RWO B;  1TVR B;  3MUV P;  1J5E F;  3EDQ B;  3R5D A;  4K4X A;  5D0R A;  1CC7 A;  4H4K C;  2MXY A;  3SIP B;  2QO3 A;  2E5I A;  4H4O B;  3T6B A;  4FKY A;  4F3M A;  1F5B A;  1RXO B;  2HLT A;  1K47 A;  1RAB B;  2V8D A;  3R7S B;  5DGB A;  2MDA A;  5KT7 A;  3IRX A;  2ALZ A;  2FJV A;  4MIW A;  4MKY A;  1HNV A;  1O5J A;  1RT1 A;  3FBF A;  4ED6 A;  1PJ7 A;  3W2V A;  1KQK A;  1NDL A;  3ILO A;  3MTJ A;  1UEU A;  1SJF A;  4O0I A;  2MKJ A;  3Q8Y A;  3PO4 A;  4I6A A;  4XPC A;  3C6U B;  5HJX A;  3PJW A;  4DWI A;  1C1C A;  1R8P A;  2B8P A;  5BYR A;  4WFN Q;  2OML A;  3IMQ J;  2CNO B;  3PAC A;  2AZ1 A;  2V69 A;  1LW0 A;  5C7P A;  2HQG A;  3GYX B;  3IM9 A;  5CAA A;  4RNN A;  1XNR F;  1YJT A;  3QNW B;  4LRA A;  1OMS A;  5I3P A;  3L7O A;  1HHS A;  3T1A A;  4TU7 A;  3C16 A;  4DF8 A;  2F8E X;  3BEG B;  2FVS A;  4RW4 B;  4DV4 J;  4F4Z A;  1FKA F;  1KLN A;  4WKY A;  2WOM A;  1NKE A;  2RU3 A;  3FZ2 A;  3HSZ A;  4QR2 A;  2NPF A;  3OUY A;  1VQP S;  1KFD A;  3OTB A;  1W25 A;  4UOG A;  4Q8E A;  4NEZ A;  3KMQ A;  2HIY A;  5KFO A;  4UY8 5;  2E1P A;  2J0Q D;  5A76 A;  3H4D A;  2JC1 A;  3DLH A;  4K4U A;  4F4X A;  3NKY A;  4LRB A;  1P8G A;  4DL0 C;  4FS2 A;  5IWA F;  1R3N A;  2N82 B;  4KJI A;  3O5T B;  1UW9 A;  2KVQ E;  1B3T A;  3NRB A;  3DU5 A;  1M5K C;  4FF2 A;  3D67 A;  4LIW A;  5KG3 A;  1DBD A;  3KK2 A;  4A48 A;  5HMX A;  1S1T A;  1CJU B;  3JAM Y;  2JSX A;  2HVE A;  3ISN C;  3K58 A;  1S97 A;  2DGV A;  4ZCM A;  1GMU A;  4TKT A;  3N01 A;  1OPZ A;  2B6A B;  3LAN A;  2B4U A;  5AE3 A;  2KG1 A;  1X4E A;  5HBM B;  3OR1 B;  3KK1 A;  2YKQ A;  1U6B A;  2MLY A;  4HKQ A;  4I69 A;  2E1A A;  4ZIT A;  3KLH A;  4KGX B;  3X3U A;  4DFM A;  1W7W A;  2HLU A;  4L72 B;  3KXD A;  2VU5 A;  2FYX A;  4UST A;  1K44 A;  2F4F A;  3OTD A;  1RQ0 A;  3DXB A;  3R5G A;  1RWW B;  4NLO A;  2OPQ B;  4JI5 F;  1U1N A;  5CZD A;  4FYX B;  2GC8 A;  4AL6 A;  5IXU A;  2DR8 A;  2JLF A;  3QQC D;  3FJ2 A;  4GVL A;  5LSL A;  4B9M A;  3N5B A;  2XCP A;  2JEG A;  1S1V A;  1SV5 B;  1YBA A;  2C3M A;  1I94 J;  3BSO A;  4JBC A;  5DQI A;  2IBO A;  4EBD A;  3ZZU A;  2YY3 A;  3U7J A;  3MCS A;  1M1K T;  2YKO A;  5KG0 A;  1QSS A;  3GJR B;  5C24 B;  4J9L A;  1VIS A;  4X4O A;  2A6M A;  1EQ0 A;  3JSB A;  3I4P A;  3M8R A;  1QAJ A;  2KT2 A;  4A8W A;  4DV2 F;  1Q8K A;  1UJ6 A;  4QWA A;  4D3G A;  4DR1 F;  2ZZM A;  3K5N A;  3IBC B;  2NYH A;  2DRB A;  1FE4 A;  1VRU A;  1FER A;  2WON A;  1GT8 A;  1FNO A;  4TN2 A;  3UVJ B;  2DH7 A;  2HNY A;  3K59 A;  1R7I A;  1UVI A;  3IS9 A;  4CO5 A;  2FJX A;  3S1T A;  1YHQ S;  4ZP9 A;  4DX5 A;  4QWD A;  4JYA F;  2R7T A;  3MXH P;  1PJ6 A;  9RUB A;  1FJE B;  2WON B;  1LW2 A;  1WEZ A;  1GX5 A;  1L3T A;  3K8V A;  1F2H A;  3UVJ A;  3G8T A;  2MMY A;  3FEZ A;  2YH0 A;  4AUK A;  3IS9 B;  2OHD A;  1FDN A;  3B82 A;  3MAA A;  4KPC A;  3QT5 A;  5KFU A;  3GR0 A;  3U1M A;  4ED0 A;  2XHW A;  5J1E A;  1RTH B;  2POK A;  3PDN A;  1VC6 A;  2RU9 A;  4A8F A;  3GSD A;  1T94 A;  5AJ3 J;  1R0A B;  1SPB P;  2OSQ A;  5J2P A;  3MEC B;  4FYW B;  1U1K A;  2F7V A;  2W4P A;  1HBO A;  2QA2 A; 
#chains in the Genus database with same CATH homology
 3R97 A;  2G2O A;  2G2Z A;  3RGI A;  3TZX A;  2VZ8 A;  2JFK A;  2QJ3 A;  3CJ8 A;  3H0P A;  1MLA A;  1NM2 A;  3QAT A;  4QBU A;  3TZZ A;  3PTW A;  5CZD A;  3TZY A;  4RR5 A;  2JFD A;  3R8Y A;  2C2N A;  2HG4 A;  2CUY A;  3K89 A;  2PFF B;  3IM8 A;  5DZ6 A;  2UV8 G;  3TQE A;  2H1Y A;  2G2Y A;  3TZW A;  2VKZ G;  3IM9 A;  3BV8 A;  4RL1 A;  3EZO A;  3SBM A;  5DZ7 A;  5CZC A;  2VZ9 A;  3HHD A;  3HJV A;  2QO3 A;  3G87 A;  3HMJ G;  2QC3 A;  2G1H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...