3IM8A

Crystal structure of mcat from streptococcus pneumoniae
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
305
structure length
305
Chain Sequence
KTAFLFAGQGAQYLGMGRDFYDQYPIVKETIDRASQVLGYDLRYLIDTEEDKLNQTRYTQPAILATSVAIYRLLQEKGYQPDMVAGLSLGEYSALVASGALDFEDAVALVAKRGAYMEEAAPADSGKMVAVLNTPVEVIEEACQKASELGVVTPANYNTPAQIVIAGEVVAVDRAVELLQEAGAKRLIPLKVSGPFHTSLLEPASQKLAETLAQVSFSDFTCPLVGNTEAAVMQKEDIAQLLTRQVKEPVRFYESIGVMQEAGISNFIEIGPGKVLSGFVKKIDQTAHLAHVEDQASLVALLEKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Malonyl acyl carrier protein transacylase
publication title New design platform for malonyl-CoA-acyl carrier protein transacylase
pubmed doi rcsb
source organism Streptococcus pneumoniae
total genus 109
structure length 305
sequence length 305
ec nomenclature ec 2.3.1.39: [Acyl-carrier-protein] S-malonyltransferase.
pdb deposition date 2009-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00698 Acyl_transf_1 Acyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.250 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Malonyl-CoA ACP transacylase, ACP-binding 3im8A02
3.40.366.10 Alpha Beta 3-Layer(aba) Sandwich Malonyl-Coenzyme A Acyl Carrier Protein; domain 2 Malonyl-Coenzyme A Acyl Carrier Protein, domain 2 3im8A01
3SBMA 2QJ3A 2G2ZA 3TZXA 2CUYA 2QO3A 2G2OA 2QC3A 4RL1A 2UV8G 3RGIA 5DZ7A 3HJVA 2VZ8A 2G1HA 3PTWA 2VZ9A 2VKZG 3TZZA 3R97A 1NM2A 2G2YA 3H0PA 1MLAA 3G87A 4RR5A 2H1YA 5DZ6A 3R8YA 3HMJG 5CZCA 3HHDA 3TQEA 3BV8A 3TZWA 2JFKA 3EZOA 2PFFB 3K89A 4QBUA 3TZYA 3IM8A 2JFDA 5CZDA 3IM9A 2HG4A 3CJ8A 2C2NA 3QATA
chains in the Genus database with same CATH superfamily
3IWXA 4LJMA 2LCWA 3ILIA 4DV5J 4QPXA 4NLWA 4A8SA 1TVRA 3OBIA 4BLGA 3QIPB 4ICLA 2FJVA 4EGLA 1M5PC 5KFDA 1WHVA 1RTHA 3HJFA 4OJ1A 1VBYA 2RHSB 5AT1B 2VG7A 1S9GA 3H8YA 2DXDA 4DPWA 3GR1A 5HBMA 2IHR1 1H2TZ 1JLGB 4V19X 2O3DA 1S9EB 1GK8A 2VBXA 2XSFA 4OYAA 4LRCA 2W2OP 4OLPA 5KOWA 3DGPB 2IRYA 3HHKA 2CJXB 4O3QA 3VGSA 1SL0A 4QWEA 2RE1A 2CPYA 2MSSA 3M8QB 4Y3CA 4QQBA 1Y11A 3H2UB 5CD4A 4OX7A 2MQLA 4USMA 3FRZA 3CDAA 3ENWA 4BS2A 1Y3JA 3S6EA 2EW9A 3UQSA 2HQCA 1JIHA 5DQGA 4YY3F 2CJAA 1Q8KA 1MSWD 1HBOB 1TL1A 4B9MA 4LFAJ 1F1BB 2OPRB 2O1PA 3W9HA 5KT4A 3MMCB 3O2IA 1VQYA 5D15A 4QPTA 3NGRA 1S72S 4F4XA 2DCUB 1JLAB 1RZMA 1IJFB 4A46A 4RW4A 5FD1A 2YX4A 3QIDA 3TA1A 1JLEA 2JEIA 2F5GA 3EGVA 3LAKA 2X3GA 2XEXA 3PTWA 3I4HX 2GW8A 3T1YF 4N56A 4RU9A 4N8OA 3IAS9 1RAIB 3DMJA 2IY5B 4CTAB 2V8GA 3CPWR 1TMJA 2B9YA 2Y8YA 1QLNA 3CWJA 4NLSA 4NXNF 3FBFA 1M1HA 4OI4A 3NMRA 2JEGA 3CJSA 5HATA 2VG6B 3M6WA 4MYTA 5HMWA 4J5OA 3Q89A 2XMKA 4QU6A 4PG4A 1N32F 4FPIA 3L7UA 4DI6A 3NKYA 4OV1A 1NLKL 5B0AA 2E5LF 3OSNA 5K8MA 1B4SA 1RAGB 2RSQA 3H7HB 5CZXA 1HWJA 3OVSA 3CXCR 1SPBP 4JBCA 2RU9A 4FPRA 1HL6A 3RZAA 1SI9A 3DLHA 1AW0A 4F4ZA 4LF5J 3C16A 5HJYA 1D0EA 2QA1A 1KLMB 1H6KX 1X5TA 1YJRA 2UP1A 5ETKA 2R7SA 2ZNZA 1RWPB 2EEYA 1G7CB 4L75A 1CJKB 2ROGA 2UUWA 4AXIA 3MM6A 4NI2B 4R25A 2MQPA 4C8ZA 1TL4A 4EBCA 4ZCKA 2BQUA 3SSQA 3SCIE 4AQYJ 1E6VA 2IVFB 3LPEA 3HDSA 4Y2CA 1RTDA 3M2VA 1WACA 1SJ3P 5KFFA 4B17A 3HZGA 2MZTA 1JLQA 1I51B 1F9EB 1CS4B 3TAMB 1Y4ZB 2OSQA 1P1TA 1N36J 2OUGA 3OVBA 5KFGA 2O01C 4I67A 3H5SA 4OZ1A 3CD0A 3RAXA 3ZTPA 5IQQA 3B6BA 5M2RA 2EBGA 1DTQB 4HT7A 2BEFA 8ATCB 3MEDB 4DV5F 2V2QA 2PT0A 2ILYA 2FUG9 1SV5A 1XBWA 1RT5B 2HHUA 4M8LA 3GFYA 4MAKA 3HULA 1NO8A 3DXBA 3MCMA 2GJIA 3L7PA 3PFOA 1HWKA 1UTAA 4FYXB 4C3MA 3MM7B 3PW5A 3BEGB 4EO6A 1FKOA 4OZLA 4KAIA 1ULRA 5HMZA 1PJ7A 1S6PA 4CDIA 3J7ZT 5MLCV 3CCTA 2E44A 3LGHA 5KFMA 2EFGA 4NOHA 4WFBQ 3Q2SC 1GMWA 1VQNS 2V6AA 4ZA1A 2D1CA 3GLJA 4IR9A 1SKUB 1H74A 2H65B 2F4FA 5F9NA 1NSAA 2ZJPQ 2DK2A 3ILLA 1MWYA 3N6NA 4FVCA 4OHZA 3PKMA 2CKWA 2DNGA 4HT5A 5ETQA 1DHMA 1NH7A 3MGJA 2OD4A 4LFAF 3C8YA 1N0VC 3CGIA 5KFZA 2AYEA 2HLTA 4FYVB 3BREA 2BV3A 4IFVA 3Q8RB 4ECSA 3H4DA 2PC6A 2LEAA 1T05B 4B3MF 4MKBA 4Y65A 4TY8B 3TI0A 5B09A 3ISZA 4CLZA 5EDWA 1ZPWX 1VLOA 3OHAA 1L3KA 3PW0A 3CVKA 1MU2A 2KG0A 4ECYA 2KFZA 1X4EA 3LPYA 4KYZA 2R2SA 5GAEU 1RHMB 3GFZA 3F41A 1EAYC 3DRYA 3MHYA 3VAHA 1XN9A 1YBAA 3AOCA 4LRBA 1EKRA 2VB6A 1YZ6A 4OYMA 2ZE2B 4OJGA 2VPWB 4NA1A 2K7KA 1FK9B 1J2VA 1M5KC 3C6UA 4CO1A 4IQXA 3DRPA 4IH5A 4IRDA 3OD2A 2W24A 2AJ2A 2EXUA 5HK4A 2MZQA 3OTCA 4PG6A 1TK0A 3ZFVA 1GMUA 4ETXA 1EHWA 4NLUA 1NMEB 1ZM4A 4LR8A 4OYZA 2YPYA 2E1RA 1QY7A 5BXIA 4L72B 5H9FK 3CB4A 2KYZA 1IQZA 4JI4J 1FJ7A 3NGKA 1UFKA 7FDRA 4A48A 2OEMA 3W1YC 2UXCJ 3CJRA 4WZMA 3BO3A 1S1XA 4X4PA 2XMJA 4C98A 3DHXA 3K89A 1NKEA 4X64J 4IG3B 2VOOA 4P2MA 3A3NB 4AMMA 1FKPA 4WTYA 1ZM3A 4B9NA 4E98A 3CEDA 2ZKUA 2OGUA 2R7TA 4TNOA 2ZOGA 1IR2A 3V81A 5C42A 3HHEA 2QYCA 3MR3A 3PEHA 1KVKA 1WI6A 3JYTB 2Y1LB 3PJ9A 1M5OC 3KK3B 3QRPA 4DG1A 2YNIA 4WF9Q 3TQEA 3TZWA 4HTJA 2E1CA 1NJIT 4GO5X 1IR0A 4ZP6A 2E29A 1X60A 3G82B 3ZNJ1 2W7OA 1VQPS 3PO4A 3BGRA 2E66A 3P96A 1YLXA 2I8EA 1TK8A 1N36F 2P6TA 1GAOA 4ECZA 4M63A 4XPEA 3U1NA 3ITHA 3HCXA 5HP1A 2J0SD 3QYYA 1HNIB 1WEZA 2P9EA 1HQUB 3CCJS 2DH8A 3R2CJ 1FE0A 2HRTA 1U1KA 4WK3A 1PBAA 2DHAA 2PN6A 3HFZB 4B9UA 2BQ3A 1T9TA 3M8YA 2QC3A 3KNAA 4WE1A 1BQNB 1GTEA 4NE9C 3GB0A 3JAMU 2VASA 3T6JA 4ZVPB 4A8WA 2CQ2A 1FKAF 1ZAWA 2UVWA 2DD8S 1D9DA 3EE3A 3MR6A 4UUWA 4IFYB 1HHSA 2WRMA 2Y9HA 3G6YA 2LYVA 3FCHA 2XG8A 3Q0AA 5L8RC 2KHCA 2XBPA 1SQFA 2E9RX 5EGYA 2XGPA 1TV6A 4BDPA 1X0PA 1B70B 3DOKA 1X9MA 1LWXA 5J2PA 3CCQS 2J8SA 1PYTA 1VQ7S 4H4OB 4JV5J 1FERA 4UT4A 4C0HA 2IRUA 3GG1A 3OUYB 2WVBA 1RT3A 4DV6J 4F4AA 1BD6A 3PIPQ 3UD4P 1VHIA 1T03B 1HBNB 3BDEA 2AGOA 5JMNA 3MPYA 4GC7A 3HKZD 1S1VA 4GKJJ 3CJ0A 2V4QA 4R0EA 2AYBA 3MM8B 1URRA 3J80Y 2HS0A 1F5AA 2LXIA 1DQAA 2RF2B 2FZGB 3MR5A 2WBMA 1UETA 3MECA 2F40A 5D4LA 2LMIA 2DXFA 2A3JA 2OPQB 3MEEB 1AUSL 3W9IA 4KRWA 3PY8A 2V34A 4FYWB 3NGTA 2DRBA 2XLIA 2RQKA 5KFJA 3NXZA 3AJ2A 3VHQA 1UMJA 2H1YA 3FGVA 1WG1A 3R8YA 2VQEJ 4GO7X 4HTIA 3I82A 3UVJA 3BSCA 4X4OA 1GXLA 2EFPA 5BYQA 3PIOQ 1FNXH 3KHLA 1L5UA 4EK2A 3T9ZA 3R5AA 4TU7A 3EMTA 4WP8A 5KFSA 1REVA 1RP5A 5KFCA 1VS3A 4PG7A 3W3SA 4NYPA 2DR5A 3NCQA 2L3MA 2DVIA 3DYAB 3BR9A 3GIMA 1IM4A 3GCWP 2F7VA 1QSYA 1M1KT 3ENAA 3OHBA 4KFBB 4IYQA 1Z4UA 2UXCF 4G6VB 2ZOMA 2NR0A 1S10A 4ID5A 2KH9A 3HT3A 3FQKA 1T8EA 3GIKA 2VUGA 1FDBA 4X64F 4P2XA 3BV8A 2DPIA 2HVHA 4ZPWR 1N48A 1RTZA 2RQ4A 4EZ6A 1X4FA 1FJCA 4DV1J 1UVIA 2RU3A 3FCWA 1S1TB 4PG5A 4Y00A 3W65A 1KP6A 5I3UA 1XMOJ 3AHPA 4Y28C 4CO3A 2DGSA 3ET6B 1VGYA 1BMQB 3OLBA 5EN1A 5LL6d 3KUGA 3BN4A 4DFMA 5F8HA 2R2RA 2IM3A 1B3TA 3EVWA 3BKFA 1FA0A 2ROEA 1LW2B 5IV4A 2MKCA 1R27B 4ZVTB 2BRLA 1LFWA 1CLFA 1B99A 4R8UB 2PE8A 4OI1A 3IBCB 2BDPA 3ZZTA 3QO9A 3IMQJ 1ACMB 1KOOA 4TYAA 1U0HA 2YY3A 4LVOP 5A8WA 3X3UA 3BQ0A 1RKJA 1SC6A 3US5A 4E0DA 3V4IB 2A6OA 4KKOB 2HHTA 4MYUA 2ZBRA 4JI1J 5RUBA 4MKYA 5L1KA 2LU2A 1CJVB 3HHNB 1GQEA 4A8FA 2V50A 2Q3PA 3RJMB 1XK8A 1FWPA 2BE9B 3THTA 2VFUA 1S1UB 3KWMA 4JB8B 1SQEA 2FD2A 3PJXA 1D8ZA 4QBUA 2VA2A 3TANA 4LBIA 1OIAA 1SC1B 1DTTA 2ZKTA 1X4HA 2JLGA 2J9DE 1NBEB 4JI8J 1F6TA 1V3ZA 5I3QA 3BS9A 1N34F 5GAEI 3ILJA 2XI2A 3AQPA 2LLZA 1Q4RA 3R5CA 3TEHB 2W9BA 4DL2A 3A3OB 4Y2MA 1NHVA 4JV5F 1DRZA 4ZIVA 2RS8A 1VC0A 3K5OA 1SJFA 3I6PA 2YKAA 5L9NA 5HVHA 3J81Y 5LXYA 1N6QB 3SCKE 3TW0A 2JEJA 4FVMA 4CH0S 4ELUA 2MKYA 1RHKB 1Z2ZA 3RG6A 2W9CA 4XO0A 3DNCA 1AYEA 5T7LA 2MQOA 3V6KA 2AHOB 4D3GA 1H38A 3MOJB 1NEEA 2HAIA 2KU7A 4RNNA 4HH1A 2C28A 1VCTA 4N41A 4I56A 1S6QB 3SQGA 4F50A 3FNNA 1F2HA 2D3O1 4IOCQ 5GMKa 5M2UA 3Q8PB 4M94A 2N7CA 4OYXA 3BGOP 3MUMP 3RB4A 1FVQA 4WJBA 1T02A 5IXUA 3U27A 5HVFA 2HFUA 2X1FA 2DNOA 1FJGJ 3DRRA 3JQKA 3Q8UA 1SV5B 3OLAA 1RCXB 1FT8A 3JSRA 4F0KA 1X9WA 5KG7A 4DQQA 1FRXA 3SYZA 1U1OA 3G8TA 1B7FA 2VQEF 4CLFA 3M9MB 2VJVA 1WUUA 4B9VA 2FGCA 1TKZB 1RBAA 5F41A 2DH9A 5B0EA 1HQEB 3AJ1A 2DT9A 3VWSA 2ZH8A 1LWCB 1FDAA 4M95A 2AU0A 2KXHA 1Q8IA 2CWKA 1UVLA 1B64A 1B0TA 3GV5B 3UCZP 3SSRA 4DL0C 1HWIA 3DFEA 2RILA 3D0GE 1QAIA 1GNKA 4LBHA 4O44B 4O4GA 3N4WA 3E51A 2KZMA 2M88A 4PQUB 2FVSA 1HNVA 4C8MA 1NKBA 1WI8A 4QIWD 2FLNA 5F8LA 1HWUA 1U8WA 4P52A 1XMOF 1JLFB 4B3OA 2J7WA 2J76E 1EJ7L 3MXHP 1TKTA 2R7QA 1V9OA 1MU2B 2UV8A 1AZSA 2NZ4A 1YGYA 2FJBB 3BO2A 3Q22A 4TY9A 1RLCL 3K0JA 4EI2A 1URNA 2WCXA 3DLLQ 3GP9A 1YDLA 1R8BA 2CQ3A 4N47A 1S77D 2EFNA 3M2RB 3W61A 4AT1B 3ZZ0A 2PEHA 4KBIA 2OEKA 5FDLB 3OTOF 2W9AA 2D3UA 3F44A 2PI5A 1MMLA 3IRXB 2WSFC 4B3TJ 2GZOA 2ZH5A 3LWMA 1FXLA 5DG8A 4JI1F 9RUBA 4IG0B 2QLXA 1GTHA 4TLRA 4DX5A 4ANEA 3O6QA 1WEYA 3WX8A 2ZUAA 2QV6A 4LRDA 1S97A 4P7TA 2KT2A 2RMLA 2V8VA 2ACYA 2W8KA 2GHWA 2CPEA 4CLWA 4NZ7A 1SCJB 4BBYA 2IDEA 2BYCA 4PQAA 4DR4J 2BM0A 1TMMA 1JJ4A 3ZZUA 1EETA 3J81j 4FKYA 3AFGA 4JI8F 3SI8A 4L76A 4CYUA 4ZHRB 4ELTA 2HBZB 2UVUA 4TXSA 3UE2A 2B6AA 2DH7A 2PEBA 2MJNA 2ZH2A 4HI1A 4J9SA 5HQ8A 3IO1A 1X8DA 2CQCA 4DL5A 2BXJA 4LF7J 1P9QC 1NB2A 1RISA 5ETTA 1RA7A 1F60B 2NXUA 3WIUA 5DM6Q 1HI8A 3Q8YA 1YJWS 1YRUA 3UN5A 4O3NA 2YNFA 4DV7J 1U25A 4J90A 1CQMA 2OFHX 4M5IA 2XLJA 2DR9A 4DF8A 1A7GE 3KOAA 2BACA 2KFYA 1IBMJ 2IC3A 3T5LA 2UUTA 3UI3A 1YTYA 2QG9B 4CO5A 2GO8A 3OW2R 1HD0A 1FRMA 3MM9A 4HR2A 5KG2A 2MGZB 5EUHA 3BQ1A 3ISNC 4TU9A 4KO0A 1IKWB 2F1FA 3C2PA 1T9UA 3KXDA 2FB0A 4B3RJ 5CYQB 2EBEA 3D6HB 1NPRA 3JS9A 5E3CA 3LTOA 3QBCA 4OLOA 2RHQB 1Y5IB 2KT5A 2B56A 3TUPA 3O5TB 4QIGA 5F8MA 1S57A 4DOZA 1OQ6A 5J2PB 1R3NA 5LMUF 1D9AA 1GX6A 2FVPA 3UDVA 2YWGA 1XQIA 3Q23A 2FVQA 4CO2A 1OWXA 3HT0A 1RT1A 2HHQA 5C5JA 2WTFA 2JL9A 1SC4B 3CC2S 1VISA 1RI7A 3MM5A 3D0IE 3QT7A 3EZUA 4MH8A 1WC1A 4CH7A 3QLHB 2PSZA 2XSJA 4H4KC 1KFSA 3EUNA 2Y8WA 4QJVA 2ZNYA 3KLGA 2JSXA 2POKA 1CC8A 1UEKA 3UD5A 1N54B 1HLWA 1QAYA 4DJBA 4X4VA 1S5ZA 3P45B 2XY7A 4USTA 4YQWA 3OTEA 1EIYB 5CZVA 5F8JA 3H40A 4FP9A 2LU1A 1HYSB 2FJEB 3H98A 2MSTA 2LQ5A 3D3CJ 4LF9J 2RDJA 1UPPA 1FTCA 3FQLA 1AFIA 3U1MA 1KOHA 1RWOB 2IA6A 3MMBA 1P9YA 2ASYA 4GVBB 1H3DA 2B7BB 2DHGA 2IVMA 1F5BA 2ASLA 2FJWA 2IAJB 4JYAJ 2K7JA 3ZZPA 1RYRA 1NJYA 3TVKA 1NK8A 4O0NA 3RUBL 2KT3A 1VMBA 2VU5A 2ZWOA 1T11A 5BR8F 2MTLA 3QWUA 5SUHA 1HHTP 4JI3F 4USHA 5EWFA 4I69A 3M8PB 1RT2A 1ITPA 4DL6A 4QIVA 4A4JA 3D7SB 1N5YB 5LJ3Y 4CLYA 1PG5B 4UQTA 1TFYA 5ETRA 5ETOA 2FVRA 4GRSA 4KPCA 2GGPA 3DU6A 5DGAA 3HSJA 2QA4S 2M0GB 4F0HA 5A6PA 3FBEA 1HBUA 1EARA 4EWTA 2IBKA 2FVCA 2YVSA 4DR4F 4DV0J 2AX0A 4F04B 1O0PA 3H5UA 1V5VA 3C6TB 3CCLS 1PCAA 3DOMB 1DURA 2YKNA 5K20B 3S8SA 5C24A 1JNZB 4OYOA 3CDBA 3JSYA 1NK0A 4XIUA 2CADA 1JX4A 4LF7F 4F25A 3AAWB 1X7VA 4QU7A 1RAEB 2R9LA 1YK9A 3MEGB 3DLKA 2H5EA 4X4NA 4CIOA 2ZJQQ 5LXRA 4U8YA 2C2DA 4EUVA 1S49A 2LDYA 1RA6A 3OTDA 3J7Z5 4DV7F 2E7VA 2H48B 1HNWJ 3NG8A 2Q43A 4QWBA 2HK3A 4F4KA 2Z2LA 3H25A 3KYLA 1ZZFA 2E9TA 1IBLJ 5KFPA 2CYYA 4O4RA 4TU8A 1YKWA 2OEJA 1IBMF 3P49B 3NGSA 1RYSA 3QIPA 3MTKA 1ZPVA 4X4QA 4MJKA 2CZVC 2FLPA 4P73A 2HWHA 2MJUA 3H90A 1ZA1B 4GMKA 2F9DA 3HK2A 1JLGA 1S9EA 4OJHA 1D8YA 2CNKB 3DGPA 3GCXP 3AA8A 2XZTB 1RXOB 2HNZB 1S4EA 3LH2S 2CUYA 2F3JA 1ZH5A 2J0WA 1TL3B 3M8QA 4MKAA 3MPWA 1V3RA 4ATNA 3DDKA 2QFJA 5L1IA 2M8HA 1CJUB 1S0OA 1S12A 3KDOA 1VJWA 3AB4B 3MMAB 1G3OA 4B9LA 2R3VA 1ZETA 2QL7B 3BBFA 4LSLB 3TEGA 1HBOA 4NRUA 2CVEA 3AD8C 1RABB 2OPRA 4LFBJ 4MFBA 2KVQE 1YVFA 2VONA 1DLOB 2W9CB 3DC2A 4X4SA 2XULA 1RWKB 3D9BA 2AX1A 2YWFA 1ELOA 4J9VA 4ALZA 1JLAA 3OFGA 4ES1A 2OD6A 1S6OA 4LIWA 5SZTA 5ETSA 2LA6A 3ZTQA 1UA1A 3GFHA 1T9XA 1YJNS 4DSJA 2DNLA 2QLBB 4BWMA 1VI7A 4UUXA 3AXMA 4NXMJ 2ZH1A 4ZITA 4KGKA 4LF9F 2L9DA 2WOMB 1VLYA 2V63A 4CTAA 4DL7A 2ZM6J 1L3TA 1R7IA 5KG3A 1WKJA 2F4VF 4ZKAA 1RQ0A 1RHUB 2C2NA 4PAAA 3TAQA 1KNZA 3SV3A 3IP0A 1GMWD 4AYBD 2EK6A 2HURA 4CT9A 2VG6A 4JI0J 4J9KA 3ZZZA 1NJZA 2D3ZA 1WDDA 1PSDA 4YDXA 5AE1A 4MMOA 5IWAJ 4S0MA 1OSDA 2J9EA 2AEJA 3T5JA 2VH7A 5B0DA 2DB1A 4M5LA 4RWXA 2JHEA 1KTQA 2Q66A 4ED2A 5F8GA 2CXEA 3PCOB 2W7AA 4UOCA 5J2NB 3TX8A 1T95A 1M90T 4AL6A 4YR2A 3IM8A 2KO1A 3CCVS 2YQ3A 1PIEA 4RX6A 3BDPA 1F0XA 3L9ZA 1DBDA 1P6TA 1FE4A 4NLGA 4ECVA 2R7XA 2VKRA 4O4GB 1KLMA 3MCNA 1HNVB 1CJKA 4JUZA 1YJ7A 3H59A 2MQQA 2B4PA 4K7QA 4NI2A 1NAQA 5J2QB 1FWLA 2MZSA 1TL7B 4R0JA 3QT5A 4B3OB 1T9YA 3NS5A 5IT9Y 3LGMA 1PAEX 5HAOA 3R7NB 3BM7A 4GVLA 4Y2KA 4ZK7M 3V6DA 1CS4A 1FF2A 3TAMA 5LSRA 4DSEA 2IJRA 5THWA 2X1AA 1P8GA 1TUGB 4ECQA 2OFGX 2Y1RI 3HP6A 2KL8A 4ZJLA 1OJ4A 4PABA 5D8HB 3EXCX 1T3OA 1SIWB 4OX9J 3GTYX 3M4XA 2QL9B 1EKSA 2VFTA 3PHEA 2DR6A 1IBLF 1J5OA 2NPFA 1VK3A 5IS2A 4U7CA 4RBTA 4AL7A 2RAQA 4K0KJ 1FD2A 1VQ8S 1HBMB 1RT5A 4Y0FA 4C7QA 1JKHB 5B0FA 4FS1A 4IH6A 3CMAS 5IM0B 4ZPAA 2HQ3A 2HHHF 1UZHA 4NLVA 3MM7A 1NKCA 2W8LA 4RWWA 1OY6A 2C2KB 1WTFA 1JLBB 4Q2MA 1QTNB 5EX3A 4DPOA 2HG4A 6FD1A 2L41A 2IVYA 1YHQS 3QGIA 5IT4A 3GJRB 2G9OA 1N0UA 2HYIB 3UPFA 1U1PA 1H7XA 2FHJA 2B6AB 1PAUB 2VC1A 2JC1A 2FY8A 3V6JA 3IA0A 2MLZA 2BJDA 4FS2A 3T5HA 3V5RA 4HVZA 1NCLA 2BE2B 4IDKB 1PO6A 3BBBA 3DLBA 4LFBF 1I94F 2DGXA 1IBCB 2AWZA 4DR6J 5FLXU 4OX6A 1T05A 3I0RB 4F4YA 2WSEC 4TY8A 3OL8A 3DRSB 1QVGR 4BHQA 1Q86T 2OELA 2L08A 4P9SA 2XY6A 3G9CA 1C0TB 4C3KA 3N9UC 3CIMA 2PD1A 3MZIA 1KTVA 3HHLC 4DQRA 2X3DA 1T0TV 4NXMF 4JI5J 3IWLA 1NZAA 2JLEA 4NLTA 3TP2A 2IBOA 4K5RA 3R1LA 2IPOB 2EFOA 1Y00A 2ZM6F 4UOGA 2B51A 2ZE2A 3PW2A 2E7WA 4RW9B 1FK9A 1HIYA 5F9LA 3C14B 1F2GA 4JI6J 3SCJE 4LF8J 4MIAA 3QT8A 2MB0B 3BQ2A 1VQMS 1RWXB 4JI0F 4OZ3A 2ZH9A 5GAGI 3GPAA 2BQRA 4M5MA 1TK5A 4ELVA 1GFWB 4TLQA 5AJ3J 1Q5YA 2I5JB 5D0RA 4O3PA 4PR6A 5IWAF 3DOLB 2J5AA 1UEUA 4NCGB 1UAWA 1AT1B 4ZOSA 2ACMA 3NGDA 4EZ9A 2C1EB 2Y0BB 1O8BA 4KE5A 3POTB 3HHDA 1S7HA 1WSRA 4YY3J 4E2FB 2ZH4A 1UA0A 5M2PA 3MURP 2CFXA 2DNZA 2IDLA 2AP6A 1IKYB 4IG3A 4F02A 2V2VA 2I2YA 4FKXA 2MDAA 2DBBA 1IWAA 3OR1B 2VL1A 4FXVA 1G6BA 4RKUC 2G2ZA 2PFDA 3TUJC 2XHWA 1R8HA 3KLGB 4USIA 2RH3A 1N88A 3TQ1A 1NDCA 1X5PA 2V8DA 3JYTA 5GAHI 5HQMA 1S99A 2HFOA 3TNVA 4RL1A 3KK3A 4UTGA 4ED1A 1PYSB 4PYDA 2NLWA 1ZM2A 2PMWA 4WIIA 2CDQA 3G82A 2W4CA 2J7KA 3HHLB 3RW6A 2Z2ZA 1HI0P 1T7PA 3NS7B 1VBZA 3D5MA 3W5XA 4ZPDA 4ZJOA 2R2UA 3PV8A 3EPIA 4XDDA 1HI1A 1FXDA 1K8AT 4ZCIA 4P71A 2L9NA 1HNIA 3OXGA 1HQUA 4WKYA 1DQ9A 3I0SB 3W64A 4OX9F 1SIZA 4X66F 3NCRA 4KC5A 1FEEA 2NUUG 1N32J 1BQNA 3IFEA 2AD9A 2ABYA 4NLYA 3OT9A 2E5LJ 4K0KF 3SZ2A 2DKOB 4IFYA 2B43A 4OHVA 4X2BA 4YHHF 2YBVA 3CTRA 1KRPA 4K4ZA 3OXFA 2J6TA 3HXMA 2RVJA 4K4TA 1NK6A 2AW0A 4R5PB 5ETNA 2F65A 3J7A1 4I6AA 2KG1A 3SXLA 3BBCA 3OTBA 2GJFA 5A0YB 1TQLA 2APOA 3W66A 3M9NB 2JH3A 4H4OA 1HARA 3PRDA 2OAUA 5HO4A 3E8OA 2CPJA 4CLUA 4QYZK 2MLYA 4DFPA 5HANA 2QE5A 1NPPA 4OZ2A 2GMJA 2JC0A 3OUYA 4QZVB 4FDFA 3QWPA 3PRVA 3HF5A 4WFNQ 3QFHA 2HBYB 2W4DA 2Z56B 1KD1T 2W2MP 1T03A 1X4DA 3G86A 4I6YA 1HBNA 1TTHB 3QAEA 3CC7S 1LNQA 5HLFB 4RW7B 1M5SA 3K59A 4FNIA 5ETPA 2Y0SD 4CO4A 3KNGA 1WC0A 3MM8A 3CJKB 1FWKA 1Q95G 4ED7A 4AE5A 2VV5A 2RF2A 4U7UD 4OZ5A 2ZBCA 1XR7A 3K5MA 2HBQB 4KH0B 4DZ6A 2BRKA 1JMTA 4V1Ak 1Y7PA 2OPQA 1NK9A 3MEEA 1RWNB 3UCUP 2QL5B 3GILA 4OX8A 3HKWA 1CSJA 3WDOA 1BY9A 4H54A 1NDLA 4JI5F 2YNHB 4O23A 2O67A 4QYZJ 2HKEA 5K14B 4OFZA 3R1HA 7FD1A 2XWXA 1BGXT 5JJBA 3N6LA 2Z8QA 2RDIA 2R8IA 4JI6F 1WG4A 5CZDA 4LF8F 1U2FA 3PW4A 2X1BA 5JUMA 2CPHA 1RB0A 5EHHA 3A8EA 4M5JA 1IUJA 2CZ4A 5BYRA 3TZZA 5AJ3F 4FNHA 2YX1A 2KXNB 2PA8D 4PG8A 3D2WA 4C3LA 1UZDA 4G65A 1C0UB 3DYAA 3QJLA 1U4BA 4OI3A 3D28A 1N56A 5HVGA 2G0IA 2X51A 4HI2A 4ZVQB 3A12A 2EVZA 4QYRA 4KFBA 2HRUA 3M32B 4HH0A 1FEHA 4ZP7A 2ZOFA 3CIZA 2AGQA 1MROB 5E0OA 3TUZC 4MFBB 4NMXA 1C4AA 1V3SA 3NL0A 4N76A 4DLEA 2KKHA 2ZITA 1G1XA 4B3MJ 1LWFB 1S1TA 2RRBA 3DCAA 3A13A 3ET6A 1DZ5A 3I5AA 1IKVB 1MMDA 2QN6B 1K1QA 4ZPBA 5J2MB 2ZVSA 5D6GA 4DV3J 3ETOA 2IFXA 4DFJA 2Z2YB 4B08A 3TZXA 4AD6A 2CNOB 2LDIA 3L09A 1LW2A 3M1VB 3M6UA 2CQBA 1VIOA 1R8CA 3AD7C 1N5SA 4R8UA 3F73A 3IG1B 3OJSA 1TKXB 1WC6A 2MKHA 3MCOA 1T94A 1OSCA 1IM6A 2ZUGA 3LP2B 2WB1D 2ZC3A 1QTMA 3OV7A 1ZM9A 3V4IA 4KKOA 3TX0A 4ZN1A 2VG5B 1GEHA 3N0VA 4KGZB 4J9PA 4NLDA 1CJVA 2XGQA 4RW6B 5LMNJ 4KR0B 1MW7A 1VHFA 1TUWA 1WOSA 3K17A 3M6VA 3HZEA 1S1UA 3MTJA 3SDEB 3EYZA 3ZTRA 4B9TA 4W92B 1XMQJ 1EZZB 2RT3A 3VAIA 2RNEA 2CPZA 4DFKA 3KKFA 1KQGB 3HFKA 1IKXB 5DLFA 1C1CB 1QVFR 3PNIA 2O66A 5ITHA 3GONA 1RAFB 1RGVA 3JTNA 3IR5B 5KTQA 5FIIA 3FZ2A 1SL2A 1JXVA 3X1LB 1OYDA 5GMDA 2D9PA 2CPDA 1N6QA 2Q1LA 1WHWA 3R27A 2HNDB 4DZDA 3HMJG 5AXNA 3TOQA 4M5DB 3W9JA 2J6SA 1LV5A 1NU4A 4NLXA 2JZ5A 2WK4A 3NWGA 4Q0BB 5KG0A 2HBRB 3LWLA 4DR1J 2YKMB 3D4JA 1WELA 3V6DB 2AGPA 1QAJA 3BSNA 2QLJB 2HPUA 3QJJA 1AUDA 4PXDA 5T14A 4Q45A 3VZHA 2BKOA 2HHVA 2M8DB 1S6QA 1KLNA 5KG6A 4USVA 2AIRB 1TELA 2C2RA 2VPXB 2JDJA 2W7PA 5F3ZA 2GX8A 2HWIA 2R8JA 1O5JA 2LQBA 2EC0A 3W60A 4DDFA 3J80U 4PKDB 5GMEA 4NWBA 1VQKS 3P8BB 1J5OB 2VZ8A 4EU0A 4DN9A 4UY8T 4FYYB 2XLKA 5HMXA 2E5IA 3H20A 4ZVOB 2DNMA 3LP1B 1VQ5S 3MI7X 3VGVA 3ILOA 2VQFJ 2B7CB 2W01A 4ILRA 4HACB 3OL9A 1UEVA 2J8AA 2DNNA 2C22A 3NAHA 3KJVB 3JXOA 4DF4A 2AYMA 3E01B 1TKZA 4OMFG 3KHRA 1KDNA 1DAXA 2V4JB 1HQEA 1NDKA 4C8KA 3MDFA 5DM7Q 5E3AA 1LWCA 4L74A 3HVRA 5A2QY 3T6BA 3KJFB 5HROB 1SJ4P 1WD6A 2DGOA 3K8WA 2VFSA 2R7UA 4ES2A 3UN3A 4NEZA 4Y34A 4WU2A 3NRBA 3D3BJ 2FZKB 3LANA 4O44A 4UW2A 3DLEB 3MUVP 3M6XA 3MUTP 3IC1A 2EPIA 2NQPA 2W4PA 1NSPA 3WZ0A 4QR0A 4PQUA 2V67A 1VQ4S 1KSPA 3H2LA 5LJ5Y 1WC3A 1FFGB 2GMLA 4C0OC 2CQGA 2N3LA 2MZJA 1UW9A 1JLFA 1UFWA 5KFQA 3HD1A 1WKLA 2QT7A 2ZC4A 4RPFA 3VAKA 4J9RA 1S59A 1U48A 4DV3F 2HS3A 1EQ0A 3DI6B 3TZYA 2ALYB 2XS7A 4WZQA 3NS6A 4YP3A 1IN0A 4WXOA 3M2RA 2YX7A 2OI2A 1R89A 2CPXA 3LA0A 4BCAA 4KHPJ 2M9KA 5FDLA 1UL3A 1VQSA 1VQOS 2HVDA 4U6PA 3IRXA 2IYGA 4XAKA 1XNRF 3NCPA 1F9FA 2E5GA 4IRKA 1W2IA 1YJTA 3PXGa 3M8WA 4FXWA 4IG0A 1V6HA 3JQMA 1WHXA 3G71S 4V19J 1YX2A 5IC4B 1Q1KA 2CZ9A 2U1AA 5DO2A 3GZ7A 3HM9A 3CT9A 2KZZA 5LMNF 5HL7Q 3R3TA 3IR6B 1PC5A 2MY8A 5EWEA 2G1DA 4L3NA 1U6FA 3GYXB 4OIXA 3RGIA 4X4RA 2MQ8A 4ED3A 1XMQF 1BXNA 2VD3A 4O3RA 2XYGB 1UPMB 2OMLA 1R8PA 2UXDF 4CLSA 1W25A 2IYIA 2ZD1B 4RJVA 3QGGA 5ETLA 5E5NA 1YG0A 4YR3A 5DRKA 4ZHRA 3HVTB 2J9DA 4YUDA 5C2GA 4N77A 1J5EJ 3G6VA 4HEA9 3JSMB 2AJ1A 3CF5Q 5K5MA 4OZ0A 3W2VB 5I3PA 2GCFA 4YFUA 3NBPB 3E3XA 2R8GA 2GV1A 3QRQA 1EX8A 1VC5A 2HMIB 1CPZA 2DY9A 3B78A 2ALZA 1Y9OA 4DR1F 3RW7A 1QM9A 3J81U 2UVRA 1QSSA 3THVA 1UJ5A 4P74A 4U95A 2YNGB 1XC9A 4ZP9A 3MAAB 2B0GA 4B02A 2NREA 2K8GA 3P5BP 4H4MA 1WEXA 2YKPA 3QSYB 1IQTA 2MGZA 2LEBA 2HSEB 4PPDA 3ZO7A 2CIMA 2QA4G 2XHCA 1IKWA 3H5YA 4EEYA 4PCQA 4DUZF 4DR5F 4CT8A 3M2UB 2NYIA 2JFDA 2FJXA 2VQFF 2Q6CA 3NEKA 5CYQA 3TRGA 2LXFA 3OFEA 2M3DA 2GMHA 1NK7A 1U7LA 3FDSA 2JVOA 1MLAA 2U2FA 2UUCJ 2QIFA 1TFWA 2IRXA 3PR5B 2XNRA 3GIIA 4DR2J 4JI2F 1RWMB 1N34J 1L3VA 2C2OB 4ITSA 3KHHA 1FRKA 4URQU 5I42B 1K9MT 1H98A 1MNEA 3T3FA 1SQGA 4WP9A 4LF6J 2Z30B 2JLFA 1O6XA 3CDUA 5L39A 1LKZA 1GT8A 3LQVA 4ZS6A 2A10A 2DGWA 3QLHA 2XI3A 4I64A 3I31A 2ROPA 1CBKA 4C9DA 4X65F 3MD3A 4DPTA 4OYBA 3PYDA 3CJ2A 3B8HA 5HI7A 1WG5A 2BANB 4LUBA 4FF3A 5C2CA 3BJYA 4K4YA 4FN5A 1YQHA 2YKOA 2G1HA 4RBVA 4LT6A 1WTBA 4ILLA 1UP1A 2B4VA 4PWUA 3DLGA 4I1TA 4OI0A 9ATCB 4X4TA 3I32A 1HW8A 1NXIA 5G4DA 4FZVA 2FC8A 3OR2B 2V68A 2M7SA 1HYSA 2XY5A 4PUOB 3TVZA 4A8XA 3FVYA 3I5BA 1HW9A 2D69A 3D66A 2AJQA 4DU8A 1ROFA 1S0NA 5GADU 3RBXA 3NWRA 1RT4B 2JVRA 4TKTA 2HGNA 4LF4J 2OIHA 4O0IA 4IQMA 2Z58B 3FZBA 4UOHA 3JTOA 3ZZYA 4G3IA 4GVBA 3KLIB 2IAJA 2DGVA 2XM3A 2R7RA 4KHPF 3TYTA 1A0OB 4PPZA 1PYOB 4YB1P 3ENVA 3BSAA 1U2RA 4A8KA 2C2EA 4QR1A 1FNOA 4KPYA 1YITS 1NK5A 2UV8G 2PIIA 2FLOA 2C3OA 3BGFA 4C11B 3M8PA 4TQRA 1E6YB 3QAUA 3KK1B 4LFCJ 1VQLS 3CCES 2GHPA 4A47A 5D77A 1N5YA 3MFHA 4ZLJA 3V6HA 1EB0A 2AZ1A 3CCRS 1PJ6A 4F3OA 2RS2A 1U45A 3BGUA 3GIRA 1W26A 4I2QB 1FRIA 1C1BB 5KT6A 4DR7J 3AJDA 3PKYA 3KLHB 2HNYB 3P4UB 4G1QB 2VBZA 1G4CA 1PGZA 1LXJA 2KYXA 4UF4A 1CULB 4HKQA 3LF0A 2UXBJ 3Q83A 3RBZA 1K0TA 3NNCA 3C6TA 4H4KA 4K2JA 2XYPB 3DOMA 5KFHA 1RE1B 3UNYA 3VAMA 4JI7F 3NAIA 4WTOB 1J5EF 3MR2A 2I9SA 6FDRA 7AT1B 4KGXB 2EKYA 1KKHA 3T5KA 2M52A 2OPSB 3MEGA 2Z4PA 2B4OA 4K59A 4ZVSB 3R2DJ 2C42A 2HQFA 1HPZB 3PX4A 5DLGA 4QCLA 2DR7A 3HVWA 1LOUA 2J6UA 3OL7A 1IBKF 3OTOJ 1VOMA 2W25A 3QGPA 2ADCA 3PG9A 3W2WB 2FIUA 4Y6IA 4F7VA 1HWLA 1S0VA 4USWA 2HEKA 4O3SA 1S4FA 3LAMA 3CW2C 1U1NA 1HFEL 4DQSA 5D4NA 3RR8A 1VJQA 3AQOA 2R8KA 1U8SA 4IO9Q 2DTJA 4DQIA 1ZZNA 1JJHA 2V5HG 1MN7A 5G0RB 3EGWB 2VOPA 2GHVC 2HGLA 2VBWA 1WF0A 2UVVA 3VGUA 2RJZA 2HNZA 2CQIA 2OTJS 2AJ4A 2MYFA 4PXEA 5CCMA 1TL3A 1AXQA 2D9OA 3Q86A 4CLTA 5LOQA 2UUCF 3LOUA 4ZLLA 3V4MA 1CJUA 5DQIA 2DYAA 4DR2F 3OFFA 3HSDA 3MMAA 4NYZA 3EZ5A 4URGA 1RADB 2XYHB 3VVTA 4KGVB 1UJ4A 2Z0GA 2FTRA 4LSLA 4LF6F 1UVKA 3I9ZA 2V2KA 4LRFA 1V5IB 3FFIB 5KG4A 1DLOA 3AOAA 1U6BA 4CZCA 2BOAA 5C25B 2CRLA 5AE3A 4EFAC 2QMWA 1X4CA 1JQGA 3BSOA 2NXJA 5FLXY 3WIVA 4YB5A 4DUTA 3R6LB 2HW3A 1QSLA 1FNMA 1QAXA 2OH2A 4U67Q 2YPZA 1TU0B 1S79A 2KXFA 1M1GA 4RU2A 4BC7A 4DS5A 1H2VZ 2BOPA 4ZVGA 3C3LA 1NSKL 1GXTA 3KLEB 4UOFA 2XNQA 1SVDA 3GV7B 2V69A 4ZVRB 1B0VA 2WOMA 3D1QA 2WVEA 2A2DA 2WVDA 4DPYA 3M8RA 1F5CA 4LF4F 2GVDB 1OPIA 5K8OA 5CHCB 5A6WA 4CLPA 2ATCB 2RKIB 3KLVA 2QJ3A 1FO1A 4AUKA 3M05A 4OV6A 3H0PA 5KFUA 1CJTB 2CQPA 3O1LA 1KHVA 2KFNA 3K8VA 2K1RB 4MIWA 4HLBA 2FGOA 5AE2A 4OI6A 2FHJD 5CYJA 3Q2TC 2DISA 4F8RA 1RWVB 3CCZA 4KQZA 1HHQA 2H4WB 5J1NA 4X84A 5LMUJ 1PJ5A 4LFCF 1SXLA 4W90B 3B54A 2AF6A 1VRTA 5J2NA 2M4MA 2QLWA 3NY0A 1FXRA 2IM1A 5DZ6A 3AA9A 1SBRA 3G4SS 4CP5A 4DR7F 4A8YA 4JOUA 1LW0B 3N6MA 5E41A 1RBOB 4DN0A 3CD7A 1S48A 3PZPA 2XQCA 2CJBA 3QFWA 2JWNA 2UXBF 1FDDA 3FEYB 3BKUA 2HQIA 5J2QA 1HMVB 1TL7A 2QSWA 2V4RA 1XR6A 1HA1A 5B7WA 1SUQB 2GQCA 1LK7A 1EP4B 1RHQB 2KDOA 4MKVA 2FLLA 2N3OA 1WHYA 1Q79A 2MQNA 4I7FB 3SBMA 4LSNB 3MWBA 3GJSB 2PA3A 3BPDA 2GVZB 4U8VA 3D0HE 1MG7A 3TR5A 5LT5A 5AXKA 2W1BA 1Z2LA 4MK8A 4UZCA 3GWCA 1GXUA 2KHDA 3B4DA 2EFVA 2C3PA 3OVAA 2BA9A 1YZ7A 5BR8J 1TAQA 4JI3J 3ICLA 4DQPA 3D68A 1YBUA 2LECA 2EFQA 2OPPB 1HBMA 5CABA 2FPHX 1JKHA 1RT7B 4UQGA 3VAJA 3CC4S 2FZCB 5IM0A 4C8LA 2ZHOA 4J37A 4HDHA 1ZS6A 5CYMB 2ZZTA 1NJWA 1JLBA 4DXLA 3VZIA 3SCLE 4PWDB 2YQ0A 1Q7LB 5CZCA 1RTJB 4WP3A 4ZVUB 2YWWA 4NLRA 3R9LA 2J0XA 3VVUA 2ZZNA 4K4XA 2HRYA 1DQ8A 4JV2A 4QR2A 2CA9A 2HFSA 2HHWA 2MHEA 2OP5A 2G4BA 2MKSA 1NHKL 3MD1A 3G2XA 5GADI 2LQ8A 3D1OA 2KRBA 3HSZA 2CJKA 4MT1A 2WONB 2BE2A 4IDKA 2E5HA 2R8HA 1ZYQA 2A0FB 1YI2S 3RYLA 1JLCB 1SKRA 4USJC 2NXCA 2GIQA 3I0RA 1RT6B 1LQ9A 4IOBA 2EC2A 2XZWA 3A4TA 3FSXA 4F4WA 1VDHA 3DRSA 1MWQA 4RNOA 5HQLA 2C2MB 1W7WA 5H1SV 1C0TA 3DU5A 3G8QA 3Q24A 2C3UA 2XO7A 3JSBA 1WNEA 2ILZA 3QZ7A 2HFNA 4IO1A 2DJWA 4ERDA 1JXEA 3WX4A 2FHKA 2HZAA 4K4WA 3C15B 2B8PA 1Q8LA 3T1AA 3KK2B 1YRXA 4H4MB 1ZAXA 2GFFA 2E5JA 5KT5A 3HX9A 4RW9A 2XMTA 1DJ0A 2FC9A 4PEOA 1YWXA 3C14A 1R0AB 2ZVIA 3BGLA 2DIVA 3FRYA 3MPUB 2DNRA 4W98A 4E8UA 3GJQB 5A8KB 3RB0A 2RUGA 4J9NA 2ZZMA 1D9FA 4AMPA 2I5JA 4KGMA 2MPUA 2PI4A 4CNYA 4IKAA 3DOLA 4NCGA 4Q44A 2KM8C 2ZFHA 1XNQJ 4EBDA 3ZC4A 2HZVA 3MEKA 3CJ4A 3GIJA 4MTPA 3R6GB 3ZNUA 1NZ8A 3POTA 3TWZA 4N5SA 2R42A 3RRGA 4KV8B 3K2YA 1Y3KA 4QWDA 1BQMB 2AJFE 1QE1B 3GSIA 4QWCA 2B9XA 4P2SA 1IKYA 5CD4H 1NJXA 3OR1A 2ZDOA 2E1PA 2K06A 1XIQA 4K4SA 3PHTA 3KTQA 1F3VA 3W8GA 4F3QA 1VRUB 4DL4A 2QMUB 2DO0A 5GVQA 2B5JB 1S9FA 2R2TA 4JV0A 3DLGB 2B9WA 4DWIA 5A8RB 4ZMMA 5JVHQ 3TO8A 2XC9A 1S1WB 4IR1A 4W4MA 5IC6B 3G96A 2GC8A 4LF5F 1SKWA 2CJYB 3HI9A 3OQ2A 5K8PA 2W2PP 3QMQA 4DV2J 3HHLA 2KN4A 4ANDA 2HFZA 2BX6A 3NGUA 2BM1A 2F4VJ 3FSIA 5DS7A 2RB7A 5B0GA 5IT9U 5D3GB 2CDRB 2R7WA 1TP7A 2Q6BA 2D3OR 2GA7A 3I0SA 3UN2A 2AJ0A 3UDLA 4AQYF 1ZTTA 2DRAA 3EJMA 3L4BC 2FJAB 2V9WA 5H9FJ 4ZJQA 3DM2B 1CVJA 5LSOA 1VRQC 4MIBA 1YJ9S 4DX6A 4OYIA 3D54A 1FFSB 2B4UA 4A8QA 1HNXJ 1WWHA 3PFEA 1TZ0A 2NZCA 1LWEA 1SH0A 2KM8B 5DDPC 4F26A 4Y2IA 2DIUA 4FXDA 2HIQA 2HVEA 3GQCA 5E2QA 3PVXA 3LP0B 1I3OB 5KFRA 4ZIWA 5K9FA 2OHDA 4HDGA 3UDEA 4R5PA 2KB2A 4CNZA 2UU9J 4ZVFA 5A0YA 3GFXA 2QA2A 1FVSA 2XMAA 3MMJA 2Z57B 4RW8B 2IMWP 2QLFB 2K3KA 3K58A 4I2PB 3FMBA 2CQHA 2QEXS 2CQ0A 4P7VA 4EMDA 2H9ZA 3RBDA 3KG1A 5GAGU 2VPZB 1R6VA 3TVYA 2BABA 4UY85 2MLXA 4XTTA 1LXNA 3FBBA 5HLFA 1XMBA 3CDWA 4RW7A 4AXJA 2DO4A 1R0BG 2Y3YA 3L7OA 1D3WA 3CJKA 1C4CA 2KRRA 4M5KA 4Q2LA 2G13A 2J0QD 4YDDB 1UKUA 3VV2B 3ENQA 2XMVA 1D1UA 3GJTB 5KT3A 1RHJB 4YMEA 1UVJA 2FDNA 2WVCA 1JWWA 3Q8VA 2CNLB 1KONA 4TQSA 1WC5A 3GSDA 2YNHA 1PKUA 1N52B 2DY1A 3S1TA 5GAHU 2JX2A 3KLFB 1X4BA 4M5GA 5CA5A 4B9SA 1RTIB 5K14A 2MQMA 1VQ6S 4J9LA 3W62A 2VBYA 1UWBB 3TAPA 2HHHJ 1FJEB 1ZA2B 1Q7YT 3GR0A 3QNWB 1VBKA 4RUCA 3EICA 1Q5VA 2QTWA 4DL3A 1TVRB 4LVNP 4ICLB 3DDNA 2DHSA 4DSFA 1RTHB 1R43A 2MKIA 2H51B 2EG2A 3T9NA 1DFDA 1XNQF 1FHTA 2VG7B 1C0UA 1S9GB 1OO0B 1FRHA 5HBMB 1Y5LB 1U1RA 5IQ6A 3FMWA 2NS1B 3M32A 4C97A 1TAUA 1MROA 4NYOA 2GS8A 1R0CB 3MR7A 3VQSA 8RUCA 2DHXA 4USUA 4KHRA 4DUYJ 1I94J 3HJVA 1ZAVA 5E33A 1WSVA 4CLKA 4DLGA 1WF1A 3T19A 2H5IB 1WF2A 2C3YA 5L38A 1LWFA 4PXCA 3P3DA 1BLUA 4JI4F 1IKVA 4NCAA 2LXUA 4Q8EA 4OZJA 3OPKA 3BZQA 3KFWX 5DG7A 3H2VE 3N01A 5J2MA 3C19A 4CH1A 4PWWA 1TL1B 3O8WA 4WU3A 3ZTOA 3W5ZA 4NPOA 2BE7D 2M5YA 4OQJA 4HL9A 1WC4A 4WPAA 2CJQA 3IN5A 4AMNA 4ECXA 3CCUS 3UFCX 2G2OA 4P75A 3M1VA 3W8PA 4HHUA 1BC6A 2EKNA 4DPXA 4DV2F 3IG1A 3PEJA 4QWAA 3KJQB 3CE8A 1TKXA 2NYHA 4RW4B 1YIJS 5BJRA 1JLEB 3W7BA 2WW4A 4URSA 1XJWB 2JRSA 1M5HA 2ZHBA 4DCPB 1A9NB 3CD6S 3LP2A 3O44A 2BJ3A 2VG5A 4LQ9A 4OJ3A 2ATLA 4RLEA 1XERA 3GYNA 2ZH6A 2ZJRQ 4FF4A 2FQQB 3NMAA 2CPFA 2N82B 3QZ8A 3DMJB 4RW6A 3AY0A 3MPDA 5IFMA 2HFVA 2M2BA 5C7PA 5ETVA 1HNXF 3SDEA 2MKJA 4N7TA 2CJ9A 2IM0A 3MFIA 3TJ8A 3GMGA 2UUBJ 3PYGA 4Z7YA 1VRTB 2HHXA 1SJRA 2DHHA 2GQQA 5KG1A 1YSJA 4DEZA 2ZEJA 4CM2A 2WHOA 1IKXA 1FD8A 2KJVA 2VF3A 2UU9F 1C1CA 2GQ2A 5LM7E 2RIJA 3BH6B 2PGCA 1X5SA 4HYKA 2ZH7A 3KMSA 4NASA 3KDNA 1XWLA 2VDHA 3CNQP 4QOTA 3QRRA 1UWAA 2HNDA 3SV4A 4M5DA 3RB6A 3G87A 2E7XA 1UJ6A 1B7YB 4Q0BA 4YEAA 3AXKA 2YWEA 3C16B 2HVZA 2YKMA 3I87A 1GH8A 2AZ3A 1U24A 1VBXA 1U0SA 3DDIA 3GG0A 4KY3A 3RTVA 2YWHA 2XCAA 3EM1A 1YBTA 4ENOA 1H2UX 5ADZA 3R7BB 4ED0A 3H4BA 2QYGA 3MM6B 1IR1A 2MHNA 3BPSP 4DV6F 1KEKA 3A8JA 1E6VB 5KAKA 2OLWA 3VTIA 4LF2A 4X66J 4WFXA 1RTDB 2LFVA 3M2VB 1I1GA 5D78A 5F0WA 2RRAA 1FDNA 1SL1A 4NA2A 2BR0A 2OTLS 3U7JA 1JLQB 3LALA 2BW2A 4WFAQ 4GKJF 4NLOA 1QUVA 4WK1A 3ZZOA 4WYWA 3KUEA 4KTQA 3JTPA 3P5TL 2GAHC 2I1RA 3LP1A 4XDCA 3VAFA 2FY1A 3JAMY 2BKPA 4XPCA 5CCLA 4YHHJ 1TL5A 3HSGA 1S0MA 2DEJA 4HACA 2E1MC 2ZHAA 3TA0A 2NUHA 4RNHA 2CWXA 2XO6A 3KJVA 2Y1JA 2H3EB 2EG1A 1L3UA 3IGVA 4K4UA 4Y2AA 3E01A 2FYXA 1XR5A 4CCHA 1UVMA 2ZBPA 2N7YA 1BWVA 2V4JA 2HVIA 2MY7A 3J7YU 1I5OB 2VKZG 5HROA 1DY3A 4L73A 3L95X 4EYHB 4OYWA 1FKOB 5AXLA 2KJWA 2R7OA 4ZVEA 5KFKA 1S6PB 2ZBQA 2HQDA 4KJIA 2X1GA 3R5BA 4J7CA 3CDEA 4LF1A 3DLEA 2CQ1A 3EGZA 3RBEA 3TJAA 4DUYF 3AT1B 5J1EA 3SMZA 2DNKA 1Z1ZA 2GAGC 2XZDB 5F3TA 3G8SA 2VA3A 2EI5A 4RNFA 1RU1A 2WZ1A 3FSYA 3HVAA 3K57A 2W2QP 4J9OA 1UFLA 4G1IA 1RAJA 5IZHA 3WQPA 3OXLA 4ZPTR 1FTRA 2BUNA 2QGFB 3DI6A 4PXBA 5H9EK 3TUIC 1RAOA 4DSKA 3BF4A 1RSCA 4CQ1A 4KB7A 4IFVB 2EWHA 3RRKA 4J9QA 4DV1F 1U2CA 2IMOA 1SJ1A 1N33J 1HQ2A 3EVOA 3C66A 4NLPA 2AQ4A 2WAQD 3UWTA 3UR0A 3EX7B 4NRTA 2AYGA 2O5DA 2XB2D 2QRRA 1BE4A 4ZPVR 1RJJA 4USKA 4CI0B 2UUAJ 2MKKA 1D09B 1FRLA 4P2FA 3RAMA 3KG0A 2YXLA 3BH7B 2HAFA 2P6SA 2P2CB 3H42A 2DCLA 4LR7A 1BQXA 4F2RA 2HQGA 3C6UB 4L3KA 3DRPB 4AFFA 2HLUA 4QIFA 4K4VA 3RAQA 2L48A 2UUBF 2DEIA 3CSKA 1RLDA 5H9EJ 3PRBA 3KG4A 5BYSA 1KFDA 4ZCLA 6AT1B 1O51A 3O3LA 2ZD1A 5L46A 1RWUA 2CQ4A 1ZOTA 3MAHA 3HVTA 1HR0J 4OL8A 5KFEA 4TYBA 4RZRA 1WOPA 2DXEA 4Q7AA 5KFLA 2J9CA 4KIAA 1OQ3A 2C3MA 3JSMA 1APSA 3W2VA 1RU2A 4M5HA 3AODA 2KVIA 1ICEB 3NBPA 1S1XB 5KT7A 2H4YB 1KWMA 1AB8A 3WC0A 2HMIA 1FKPB 3IAM9 3IBWA 4C4WA 4QW9A 1N8RT 2DNHA 3LW5C 4KSEB 4DX8H 4ZDNA 2IA0A 3D6TB 2OMOA 3ISND 2F9JA 2QZ8A 3V81B 3IGNA 5C42B 1HNZJ 4M1KA 1FESA 1HD1A 2GJ2A 4ILMA 3CCMS 3PM9A 2YNGA 3CO0P 1JJ2R 1NPKA 3QSIA 4DG1B 2YNIB 3MF5A 1Y10A 5F0UA 3MAAA 4LMZA 4ECTA 1YRTA 3HPOA 1U1LA 5HSPA 3BGRB 4NX9A 5ETMA 2BKNA 4YS2A 5E3PA 2AMCB 5MAOA 2VICA 2VZ9A 3M2UA 1LWEB 3ITHB 3HD2A 4N8NA 3IR7B 5HP1B 2DNPA 2VODA 2ERRA 2QFIA 1X5OA 2NCKL 4NEYA 4CWBA 1KBRA 5KFNA 2A18A 2V9KA 4WE1B 1FJGF 4CO0A 3N5BA 5L9XA 5D0EA 1KVIA 2CG8A 5I42A 4U96A 2W2NP 2RRNA 1OYEA 1KS2A 2IIHA 3PX0A 2X7IA 5KFXA 2IJFA 4D3HA 3NP5A 3VALA 2H5JB 3I96A 3F56A 1MN9A 2YH0A 4OI2A 3M30A 1TV6B 2MEWA 2NPIA 2DNYA 4NZ6A 5LSLA 3DOKB 4I0WA 1AA1B 1XEZA 5A2QU 3I55S 4QIEA 4UZBA 3ZZRA 1C2PA 2BANA 2AKWB 5IT0A 2F8MA 3CJ3A 2HWTA 1Q81T 4LRAA 1B0PA 4FF2A 3VR1A 5KFYA 5FJ4A 3RRHA 5T41A 4YB7A 2P9GA 1RT3B 1NM2A 2I6WA 1NB7A 3OR2A 2QMXA 4KT0C 3ETMA 4PUOA 5F8IA 1R8AA 4DBQA 1LK5A 1OPZA 1Y5NB 2IM2A 1S1VB 4ZVHA 2A2CA 3U1LA 4J91A 2Q79A 1IJEB 1RT4A 4CRJA 3E2EA 1WDTA 2KI2A 3RR7A 1GX5A 3K7RA 5IOLA 3KLIA 2CNNB 4DX7A 3BKTA 3BB5A 4I4BA 1RBLA 4PRFA 1N33F 3MECB 4K8RA 3PYFA 2G2YA 5B0CA 2ZBIA 3BYRA 3D67A 3W63A 3DGVA 3RU0A 1AFJA 3BYPA 4NMLA 3NNHA 3K5NA 2UUAF 4C8YA 1REGX 4C11A 1RACB 4DV4J 4I68A 3QJPA 1E6YA 3KK1A 5HN0A 2JEFA 3EZOA 5DDOC 3HO1A 5KFOA 2BW7A 1U1MA 3PR4A 3N28A 3OFHA 1XTZA 2M70A 2V94A 2V8PA 3UVJB 4I2QA 1M0SA 4B3TF 1C1BA 8AT1B 4F67A 3KLHA 2HNYA 2BBEA 4G1QA 1H0HB 3C46A 1RKIA 2HIYA 2WSCC 1CULA 2PDAA 4U9RA 1REVB 4ZCMA 3CCWA 2GIFA 2A1BA 2PMHA 3F0NA 4BWJA 5JVGQ 1JXLA 4P10A 4C8OA 2XS5A 4LR9A 4IRCA 1HR0F 3IS9A 2JNJA 2FJDB 4NCBA 3EDRB 1OMSA 4TN2A 4ED5A 1S6UA 1FCAA 3KHGA 3TARA 4C0BA 2NXNA 2COLA 4ID5B 4XK8C 1KC8T 2OPSA 1SH3A 1MMNA 2HZCA 4F2SA 4KHMA 1F3FA 1SB6A 1HPZA 3FKBA 4AL5A 4PZVA 2VFRA 5I3UB 3NLCA 3I9V9 1HNZF 2MMYA 1X9SA 1N5TA 2QO3A 3SSSA 1RWWB 2C2ZB 3J7YI 2V8HA 3W2WA 3NNAA 2G0JA 1XNRJ 5HMYA 1NNDA 1BUXA 1BWEA 2CG4A 3UD3P 3PX6A 1Y0HA 3MOZA 2P9CA 3D1HA 2DRDA 2FHMA 2AT1B 5KT2A 1CQNA 3A1YG 2G0CA 1K0VA 1PC4A 5G0RA 3H5XA 2OSRA 5CXTA 1YJVA 3QO9B 3SFGA 4FYDA 2ZH3A 1PBUA 1U0HB 2Y1IA 3R5GA 5A8WB 2RUSA 4IH7A 2V2ZA 1KQKA 2VHGA 3D6MB 3DLJA 5KFVA 1GMVA 2AV5A 2ZDPA 2UXDJ 3EWGA 3KMQA 2DGUA 1U09A 3EGNA 3PDNA 1J27A 1VFJA 5B08A 3EXYA 3MPVA 2J7UA 4RNMA 4ECWA 4DSIA 4C48A 2VPYB 3B82A 2OKQA 1TUVA 1RHRB 2F8EX 1OS5A 3CULA 3PO5A 2LEPA 1U47A 1H7WA 4B3RF 4ES3A 1DTTB 3FFIA 2VC0A 1CC7A 4WFZA 3UW1A 2B9EA 3ONQA 5C25A 3A8KA 3QATA 5U47A 3OJUA 1Q0NA 2BVZA 2XS2A 2W9BB 4OHXA 4TVAB 4NL5A 4Z37A 4FBTA 3Q8SB 2CQDA 4DR3J 4Q43A 1X4AA 4NLQA 2I38A 2ZWPA 4C2MA 3KLEA 3T41A 1I6JA 1X4GA 1Q16B 3MMCA 4CM0A 1F9HA 2HS4A 5T7LB 3UCGA 3CJ8A 2F8HA 1JJCB 1JNRB 3D6FB 5E7OB 1UVNA 5DZ7A 3SEOA 5DJBA 2PO4A 3VQTA 2CVIA 1HKAA 2GVDA 4O3OA 4ECRA 3GV8B 4YB6A 2BJ9A 4DUZJ 3M9OB 4DR5J 1IVZA 2RKIA 4GC6A 4RUBA 3FJ2A 2LKZA 3CMQA 1SJQA 3IXQA 3SQGB 2CAJA 4X62J 2CPIA 1NH8A 1CJTA 4PYAA 3IBFB 2K1RA 3CCSS 3NOCA 1KR4A 5B0BA 3JQJA 4RUAA 3UO0A 3KJNB 2F63A 4YR0A 4DS4A 3DRRB 4JI2J 2P5VA 4DV4F 1QUPA 1NK4A 2VFVA 3FCVA 1KVJA 4JYAF 2HK2A 2A6MA 3FC9A 2WVFA 3VGTA 4J9UE 3PW7A 4OZNA 1WKKA 1T9VA 1TR0A 3HLUA 1LW0A 3MAQA 1U1QA 1JB0C 1NHUA 4X65J 3U02A 2ASDA 2NSCA 2JOQA 1K1SA 4P6QA 2R7VA 4G1PA 3VCDA 4ECUA 1K44A 2DGTA 2WW8A 4LREA 4WWSA 4K5SA 5J1EB 2OJ3A 4C8NA 4FF1A 4U7UK 1HMVA 4J9MA 4HHHA 2XWYA 4Z2XA 1SUQA 2HGMA 1EP4A 2LQJA 3K5PA 4ID8A 2RDDA 3LGNA 4ANCA 2QSFA 3R7SB 2D41A 4I7FA 4LSNA 4DV0F 4NA3A 4ZPCA 2GVZA 3N5FA 3V2UC 5IV3A 4QW8A 2N4CA 1P27B 3DXSX 3FEZA 5CQGA 3DHWC 3SFUA 1H72C 1TKTB 2YTCA 4ED4A 2NSBA 2HHPA 1DARA 1AZSB 2DITA 3CMES 3R97A 5KOXA 2AEMA 3AH6A 2OPPA 1U26A 1N5VA 1W2BR 1NUEA 3ADAC 1RT7A 4A8OA 4IOAQ 1NRKA 4X4UA 1VYAA 5K8NA 2YWKA 1HNWF 4M5NA 2D7SA 3QGHA 2DPJA 3ELHA 1QD1A 1DTQA 5L1LA 1VR6A 5CYMA 4EYIB 4CLLA 2FHOB 3MEDA 4RBUA 1CEZA 1WOOA 4PWDA 1RTJA 1P1LA 1KQSR 3UNGC 3SIPB 4WCEQ 4DHVA 2JJ4D 1QDUB 2RQCA 3R5DA 2RD5C 4LQ3A 1FX4A 3GU0A 2BMBA 3L3CA 4MK9A 4B3SJ 5D4OA 4DCJB 4Q5VA 5F8NA 1BHNA 2E1AA 3OL6A 3CJ5A 2I0XA 4JI7J 4FBUA 2UZAA 3WHIA 3HHLD 3K5LA 2VDIA 4IUFA 1RCOB 5DQHA 2WONA 4OHYA 4ED6A 2AEFA 2EK1A 1JLCA 1NSQA 1EETB 4C6AA 3G6XA 3T1HJ 2XMWA 4CYUB 1RT6A 2BJEA 5HJXA 5D4PA 2DNQA 4LSZB 1IXKA 2QX0A 4GKKJ 3B4MA 1IBKJ 3I56S 2XCPA 4DR3F 1N4LA 3M8ZA 3CO9A 4P72A 3EVMA 3HFVA 1YJUA 3N79A 1FX2A 3QPIA 3A8IA 5EX0A 3C15A 4WYLA 3KK2A 2YNFB 3EDQB 2LQ9A 1M5VC 4NZ0A 1SKSA 5JXSA 3IWNC 1MWZA 1T9WA 3TA2A 2WB4A 1R0AA 3ZTSA 1WORA 4Q8FA 3MCSA 1S76D 3J7AN 3G6ES 1VIXA 2OO4A 5A8KA 1K47A 2IC3B 3KUHA 5AXMA 4X62F 2BZ2A 5I4MA 3FK4A 3FEXB 4ETZA 2VIHA 4WKRA 2BJ1A 3ULHA 5D0GA 4ZLNA 3VF0B 3MM9B 1RDRA 4DCOB 4AMOA 2NXEA 3OSPA 5CAAA 4YN3B 2JFKA 3AB2B 4WIQA 3PYEA 4ZLPA 4WXWA 1NDPA 2VJUA 2MXYA 4KO0B 2D74B 4JP8A 4KV8A 5KFBA 5DDQC 1BQMA 1RAHB 1QE1A 1H73A 3CJQA 4DPUA 1UW4A 1LFPA 2YH1A 1Q82T 5KFIA 4RO0A 3GE9A 3M30B 1WJ9A 5KG5A 2MZRA 2K2PA 1K73T 1UCNA 2E9ZA 3FBCA 3AOBA 3IM9A 1VRUA 5DGBA 1T3NA 1RT1B 2RQMA 2BJ7A 4RUHA 4DSLA 2B5JA 3LUYA 4WFYA 1EQMA 4F3MA 3S01A 2WBRA 3MM5B 3CUNA 2DGQA 5A8RA 5KFWA 1AROP 4ZN3A 2B8QA 1S1WA 5DG9A 3ZXWA 4OYPA 3LO3A 2XSJB 5E3RA 1SH2A 3CJTA 5EWGA 2YQ1A 1VK8A 2IJNA 1KN6A 4A8MP 2B3TB 3DKDA 1FRJA 5J1PA 5D3GA 5KFTA 1KQFB 2GIRA 1ZTWA 2SXLA 3THPA 3TJ9A 3BO4A 2XTJP 1LEOA 3PJWA 4LBPA 3T1YJ 3UR3C 3JB9k 3WC2A 2GNKA 2N4DA 3NOGA 4I6WA 3BN7A 3DM2A 3Q8QB 4F0MA 2ASJA 1OY8A 3BR8A 2MZ1A 3M8SA 3IRWP 2V0NA 4NXNJ 3MMBB 4ZP8A 1S7IA 4K50A 4OHWA 3QQCD 2Z2MA 1RK8A 5D0HA 2R4FA 2H54B 4JV1A 3DRXA 1R31A 3LP0A 4DMZA 1N5QA 4F36A 3PACA 2DR8A 5E3QA 2K3IA 1PILA 3QT6A 1RT2B 1SC3B 1TKDA 1X0FA 1R6YA 4RW8A 1X31C 2GO9A 2YKQA 4I2PA 1G2EA 5CH7B 4K2XA 3DN9A 1JK9B 4YOEA 3IS9B 2HHSA 4B3SF 2PMZD 1KHWA 1FFWB 1RUSA 2GGPB 1Q8BA 3WBZA 4HHJA 1VQ9S 2KTQA 4ER8A 1A6LA 1HBUB 4WBFA 2LA4A 5DDRC 1L3SA 2XMUA 3P6YC 4KH1B 3RB3A 4LIRA 3T1HF 1IWGA 3CD5A 2P8IA 4DU7A 4L6V3 2YKNB 3GYGA 1ZBTA 5C24B 4EO8A 4BC9A 5A76A 1FI4A 4GKKF 1U49A 3I4PA 3W5YA 1CG2A 2L9WA 3S7RA 2ADBA 1VC6A 1Q78A 1OY9A 1U6ZA 5DETA 3VAGA 2LVWA 2BJ8A 3AD9C 4Z7CA 5KFAA 4EBEA 3UDCA 3A3PB 3FUYA 3DLKB 3M7VA 3SQOP 1RAAB 4DR6F 2XMMA 3EPGA 3KLFA 1Q53A 3I5CA 1QJHA 3R5JB 4MK7A 1RTIA 4RR5A 4ED8A 1U02A 2PFFB 1UWBA 2LP4A 5L1JA
chains in the Genus database with same CATH topology
3SBMA 2QJ3A 2G2ZA 3TZXA 2CUYA 2QO3A 2G2OA 2QC3A 4RL1A 2UV8G 3RGIA 5DZ7A 3HJVA 2VZ8A 2G1HA 3PTWA 2VZ9A 2VKZG 3TZZA 3R97A 1NM2A 2G2YA 3H0PA 1MLAA 3G87A 4RR5A 2H1YA 5DZ6A 3R8YA 3HMJG 5CZCA 3HHDA 3TQEA 3BV8A 3TZWA 2JFKA 3EZOA 2PFFB 3K89A 4QBUA 3TZYA 3IM8A 2JFDA 5CZDA 3IM9A 2HG4A 3CJ8A 2C2NA 3QATA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SBM A;  2QJ3 A;  2G2Z A;  3TZX A;  2CUY A;  2QO3 A;  2G2O A;  2QC3 A;  4RL1 A;  2UV8 G;  3RGI A;  5DZ7 A;  3HJV A;  2VZ8 A;  2G1H A;  3PTW A;  2VZ9 A;  2VKZ G;  3TZZ A;  3R97 A;  1NM2 A;  2G2Y A;  3H0P A;  1MLA A;  3G87 A;  4RR5 A;  2H1Y A;  5DZ6 A;  3R8Y A;  3HMJ G;  5CZC A;  3HHD A;  3TQE A;  3BV8 A;  3TZW A;  2JFK A;  3EZO A;  2PFF B;  3K89 A;  4QBU A;  3TZY A;  3IM8 A;  2JFD A;  5CZD A;  3IM9 A;  2HG4 A;  3CJ8 A;  2C2N A;  3QAT A; 
#chains in the Genus database with same CATH topology
 3IWX A;  4LJM A;  2LCW A;  3ILI A;  4DV5 J;  4QPX A;  4NLW A;  4A8S A;  1TVR A;  3OBI A;  4BLG A;  3QIP B;  4ICL A;  2FJV A;  4EGL A;  1M5P C;  5KFD A;  1WHV A;  1RTH A;  3HJF A;  4OJ1 A;  1VBY A;  2RHS B;  5AT1 B;  2VG7 A;  1S9G A;  3H8Y A;  2DXD A;  4DPW A;  3GR1 A;  5HBM A;  2IHR 1;  1H2T Z;  1JLG B;  4V19 X;  2O3D A;  1S9E B;  1GK8 A;  2VBX A;  2XSF A;  4OYA A;  4LRC A;  2W2O P;  4OLP A;  5KOW A;  3DGP B;  2IRY A;  3HHK A;  2CJX B;  4O3Q A;  3VGS A;  1SL0 A;  4QWE A;  2RE1 A;  2CPY A;  2MSS A;  3M8Q B;  4Y3C A;  4QQB A;  1Y11 A;  3H2U B;  5CD4 A;  4OX7 A;  2MQL A;  4USM A;  3FRZ A;  3CDA A;  3ENW A;  4BS2 A;  1Y3J A;  3S6E A;  2EW9 A;  3UQS A;  2HQC A;  1JIH A;  5DQG A;  4YY3 F;  2CJA A;  1Q8K A;  1MSW D;  1HBO B;  1TL1 A;  4B9M A;  4LFA J;  1F1B B;  2OPR B;  2O1P A;  3W9H A;  5KT4 A;  3MMC B;  3O2I A;  1VQY A;  5D15 A;  4QPT A;  3NGR A;  1S72 S;  4F4X A;  2DCU B;  1JLA B;  1RZM A;  1IJF B;  4A46 A;  4RW4 A;  5FD1 A;  2YX4 A;  3QID A;  3TA1 A;  1JLE A;  2JEI A;  2F5G A;  3EGV A;  3LAK A;  2X3G A;  2XEX A;  3PTW A;  3I4H X;  2GW8 A;  3T1Y F;  4N56 A;  4RU9 A;  4N8O A;  3IAS 9;  1RAI B;  3DMJ A;  2IY5 B;  4CTA B;  2V8G A;  3CPW R;  1TMJ A;  2B9Y A;  2Y8Y A;  1QLN A;  3CWJ A;  4NLS A;  4NXN F;  3FBF A;  1M1H A;  4OI4 A;  3NMR A;  2JEG A;  3CJS A;  5HAT A;  2VG6 B;  3M6W A;  4MYT A;  5HMW A;  4J5O A;  3Q89 A;  2XMK A;  4QU6 A;  4PG4 A;  1N32 F;  4FPI A;  3L7U A;  4DI6 A;  3NKY A;  4OV1 A;  1NLK L;  5B0A A;  2E5L F;  3OSN A;  5K8M A;  1B4S A;  1RAG B;  2RSQ A;  3H7H B;  5CZX A;  1HWJ A;  3OVS A;  3CXC R;  1SPB P;  4JBC A;  2RU9 A;  4FPR A;  1HL6 A;  3RZA A;  1SI9 A;  3DLH A;  1AW0 A;  4F4Z A;  4LF5 J;  3C16 A;  5HJY A;  1D0E A;  2QA1 A;  1KLM B;  1H6K X;  1X5T A;  1YJR A;  2UP1 A;  5ETK A;  2R7S A;  2ZNZ A;  1RWP B;  2EEY A;  1G7C B;  4L75 A;  1CJK B;  2ROG A;  2UUW A;  4AXI A;  3MM6 A;  4NI2 B;  4R25 A;  2MQP A;  4C8Z A;  1TL4 A;  4EBC A;  4ZCK A;  2BQU A;  3SSQ A;  3SCI E;  4AQY J;  1E6V A;  2IVF B;  3LPE A;  3HDS A;  4Y2C A;  1RTD A;  3M2V A;  1WAC A;  1SJ3 P;  5KFF A;  4B17 A;  3HZG A;  2MZT A;  1JLQ A;  1I51 B;  1F9E B;  1CS4 B;  3TAM B;  1Y4Z B;  2OSQ A;  1P1T A;  1N36 J;  2OUG A;  3OVB A;  5KFG A;  2O01 C;  4I67 A;  3H5S A;  4OZ1 A;  3CD0 A;  3RAX A;  3ZTP A;  5IQQ A;  3B6B A;  5M2R A;  2EBG A;  1DTQ B;  4HT7 A;  2BEF A;  8ATC B;  3MED B;  4DV5 F;  2V2Q A;  2PT0 A;  2ILY A;  2FUG 9;  1SV5 A;  1XBW A;  1RT5 B;  2HHU A;  4M8L A;  3GFY A;  4MAK A;  3HUL A;  1NO8 A;  3DXB A;  3MCM A;  2GJI A;  3L7P A;  3PFO A;  1HWK A;  1UTA A;  4FYX B;  4C3M A;  3MM7 B;  3PW5 A;  3BEG B;  4EO6 A;  1FKO A;  4OZL A;  4KAI A;  1ULR A;  5HMZ A;  1PJ7 A;  1S6P A;  4CDI A;  3J7Z T;  5MLC V;  3CCT A;  2E44 A;  3LGH A;  5KFM A;  2EFG A;  4NOH A;  4WFB Q;  3Q2S C;  1GMW A;  1VQN S;  2V6A A;  4ZA1 A;  2D1C A;  3GLJ A;  4IR9 A;  1SKU B;  1H74 A;  2H65 B;  2F4F A;  5F9N A;  1NSA A;  2ZJP Q;  2DK2 A;  3ILL A;  1MWY A;  3N6N A;  4FVC A;  4OHZ A;  3PKM A;  2CKW A;  2DNG A;  4HT5 A;  5ETQ A;  1DHM A;  1NH7 A;  3MGJ A;  2OD4 A;  4LFA F;  3C8Y A;  1N0V C;  3CGI A;  5KFZ A;  2AYE A;  2HLT A;  4FYV B;  3BRE A;  2BV3 A;  4IFV A;  3Q8R B;  4ECS A;  3H4D A;  2PC6 A;  2LEA A;  1T05 B;  4B3M F;  4MKB A;  4Y65 A;  4TY8 B;  3TI0 A;  5B09 A;  3ISZ A;  4CLZ A;  5EDW A;  1ZPW X;  1VLO A;  3OHA A;  1L3K A;  3PW0 A;  3CVK A;  1MU2 A;  2KG0 A;  4ECY A;  2KFZ A;  1X4E A;  3LPY A;  4KYZ A;  2R2S A;  5GAE U;  1RHM B;  3GFZ A;  3F41 A;  1EAY C;  3DRY A;  3MHY A;  3VAH A;  1XN9 A;  1YBA A;  3AOC A;  4LRB A;  1EKR A;  2VB6 A;  1YZ6 A;  4OYM A;  2ZE2 B;  4OJG A;  2VPW B;  4NA1 A;  2K7K A;  1FK9 B;  1J2V A;  1M5K C;  3C6U A;  4CO1 A;  4IQX A;  3DRP A;  4IH5 A;  4IRD A;  3OD2 A;  2W24 A;  2AJ2 A;  2EXU A;  5HK4 A;  2MZQ A;  3OTC A;  4PG6 A;  1TK0 A;  3ZFV A;  1GMU A;  4ETX A;  1EHW A;  4NLU A;  1NME B;  1ZM4 A;  4LR8 A;  4OYZ A;  2YPY A;  2E1R A;  1QY7 A;  5BXI A;  4L72 B;  5H9F K;  3CB4 A;  2KYZ A;  1IQZ A;  4JI4 J;  1FJ7 A;  3NGK A;  1UFK A;  7FDR A;  4A48 A;  2OEM A;  3W1Y C;  2UXC J;  3CJR A;  4WZM A;  3BO3 A;  1S1X A;  4X4P A;  2XMJ A;  4C98 A;  3DHX A;  3K89 A;  1NKE A;  4X64 J;  4IG3 B;  2VOO A;  4P2M A;  3A3N B;  4AMM A;  1FKP A;  4WTY A;  1ZM3 A;  4B9N A;  4E98 A;  3CED A;  2ZKU A;  2OGU A;  2R7T A;  4TNO A;  2ZOG A;  1IR2 A;  3V81 A;  5C42 A;  3HHE A;  2QYC A;  3MR3 A;  3PEH A;  1KVK A;  1WI6 A;  3JYT B;  2Y1L B;  3PJ9 A;  1M5O C;  3KK3 B;  3QRP A;  4DG1 A;  2YNI A;  4WF9 Q;  3TQE A;  3TZW A;  4HTJ A;  2E1C A;  1NJI T;  4GO5 X;  1IR0 A;  4ZP6 A;  2E29 A;  1X60 A;  3G82 B;  3ZNJ 1;  2W7O A;  1VQP S;  3PO4 A;  3BGR A;  2E66 A;  3P96 A;  1YLX A;  2I8E A;  1TK8 A;  1N36 F;  2P6T A;  1GAO A;  4ECZ A;  4M63 A;  4XPE A;  3U1N A;  3ITH A;  3HCX A;  5HP1 A;  2J0S D;  3QYY A;  1HNI B;  1WEZ A;  2P9E A;  1HQU B;  3CCJ S;  2DH8 A;  3R2C J;  1FE0 A;  2HRT A;  1U1K A;  4WK3 A;  1PBA A;  2DHA A;  2PN6 A;  3HFZ B;  4B9U A;  2BQ3 A;  1T9T A;  3M8Y A;  2QC3 A;  3KNA A;  4WE1 A;  1BQN B;  1GTE A;  4NE9 C;  3GB0 A;  3JAM U;  2VAS A;  3T6J A;  4ZVP B;  4A8W A;  2CQ2 A;  1FKA F;  1ZAW A;  2UVW A;  2DD8 S;  1D9D A;  3EE3 A;  3MR6 A;  4UUW A;  4IFY B;  1HHS A;  2WRM A;  2Y9H A;  3G6Y A;  2LYV A;  3FCH A;  2XG8 A;  3Q0A A;  5L8R C;  2KHC A;  2XBP A;  1SQF A;  2E9R X;  5EGY A;  2XGP A;  1TV6 A;  4BDP A;  1X0P A;  1B70 B;  3DOK A;  1X9M A;  1LWX A;  5J2P A;  3CCQ S;  2J8S A;  1PYT A;  1VQ7 S;  4H4O B;  4JV5 J;  1FER A;  4UT4 A;  4C0H A;  2IRU A;  3GG1 A;  3OUY B;  2WVB A;  1RT3 A;  4DV6 J;  4F4A A;  1BD6 A;  3PIP Q;  3UD4 P;  1VHI A;  1T03 B;  1HBN B;  3BDE A;  2AGO A;  5JMN A;  3MPY A;  4GC7 A;  3HKZ D;  1S1V A;  4GKJ J;  3CJ0 A;  2V4Q A;  4R0E A;  2AYB A;  3MM8 B;  1URR A;  3J80 Y;  2HS0 A;  1F5A A;  2LXI A;  1DQA A;  2RF2 B;  2FZG B;  3MR5 A;  2WBM A;  1UET A;  3MEC A;  2F40 A;  5D4L A;  2LMI A;  2DXF A;  2A3J A;  2OPQ B;  3MEE B;  1AUS L;  3W9I A;  4KRW A;  3PY8 A;  2V34 A;  4FYW B;  3NGT A;  2DRB A;  2XLI A;  2RQK A;  5KFJ A;  3NXZ A;  3AJ2 A;  3VHQ A;  1UMJ A;  2H1Y A;  3FGV A;  1WG1 A;  3R8Y A;  2VQE J;  4GO7 X;  4HTI A;  3I82 A;  3UVJ A;  3BSC A;  4X4O A;  1GXL A;  2EFP A;  5BYQ A;  3PIO Q;  1FNX H;  3KHL A;  1L5U A;  4EK2 A;  3T9Z A;  3R5A A;  4TU7 A;  3EMT A;  4WP8 A;  5KFS A;  1REV A;  1RP5 A;  5KFC A;  1VS3 A;  4PG7 A;  3W3S A;  4NYP A;  2DR5 A;  3NCQ A;  2L3M A;  2DVI A;  3DYA B;  3BR9 A;  3GIM A;  1IM4 A;  3GCW P;  2F7V A;  1QSY A;  1M1K T;  3ENA A;  3OHB A;  4KFB B;  4IYQ A;  1Z4U A;  2UXC F;  4G6V B;  2ZOM A;  2NR0 A;  1S10 A;  4ID5 A;  2KH9 A;  3HT3 A;  3FQK A;  1T8E A;  3GIK A;  2VUG A;  1FDB A;  4X64 F;  4P2X A;  3BV8 A;  2DPI A;  2HVH A;  4ZPW R;  1N48 A;  1RTZ A;  2RQ4 A;  4EZ6 A;  1X4F A;  1FJC A;  4DV1 J;  1UVI A;  2RU3 A;  3FCW A;  1S1T B;  4PG5 A;  4Y00 A;  3W65 A;  1KP6 A;  5I3U A;  1XMO J;  3AHP A;  4Y28 C;  4CO3 A;  2DGS A;  3ET6 B;  1VGY A;  1BMQ B;  3OLB A;  5EN1 A;  5LL6 d;  3KUG A;  3BN4 A;  4DFM A;  5F8H A;  2R2R A;  2IM3 A;  1B3T A;  3EVW A;  3BKF A;  1FA0 A;  2ROE A;  1LW2 B;  5IV4 A;  2MKC A;  1R27 B;  4ZVT B;  2BRL A;  1LFW A;  1CLF A;  1B99 A;  4R8U B;  2PE8 A;  4OI1 A;  3IBC B;  2BDP A;  3ZZT A;  3QO9 A;  3IMQ J;  1ACM B;  1KOO A;  4TYA A;  1U0H A;  2YY3 A;  4LVO P;  5A8W A;  3X3U A;  3BQ0 A;  1RKJ A;  1SC6 A;  3US5 A;  4E0D A;  3V4I B;  2A6O A;  4KKO B;  2HHT A;  4MYU A;  2ZBR A;  4JI1 J;  5RUB A;  4MKY A;  5L1K A;  2LU2 A;  1CJV B;  3HHN B;  1GQE A;  4A8F A;  2V50 A;  2Q3P A;  3RJM B;  1XK8 A;  1FWP A;  2BE9 B;  3THT A;  2VFU A;  1S1U B;  3KWM A;  4JB8 B;  1SQE A;  2FD2 A;  3PJX A;  1D8Z A;  4QBU A;  2VA2 A;  3TAN A;  4LBI A;  1OIA A;  1SC1 B;  1DTT A;  2ZKT A;  1X4H A;  2JLG A;  2J9D E;  1NBE B;  4JI8 J;  1F6T A;  1V3Z A;  5I3Q A;  3BS9 A;  1N34 F;  5GAE I;  3ILJ A;  2XI2 A;  3AQP A;  2LLZ A;  1Q4R A;  3R5C A;  3TEH B;  2W9B A;  4DL2 A;  3A3O B;  4Y2M A;  1NHV A;  4JV5 F;  1DRZ A;  4ZIV A;  2RS8 A;  1VC0 A;  3K5O A;  1SJF A;  3I6P A;  2YKA A;  5L9N A;  5HVH A;  3J81 Y;  5LXY A;  1N6Q B;  3SCK E;  3TW0 A;  2JEJ A;  4FVM A;  4CH0 S;  4ELU A;  2MKY A;  1RHK B;  1Z2Z A;  3RG6 A;  2W9C A;  4XO0 A;  3DNC A;  1AYE A;  5T7L A;  2MQO A;  3V6K A;  2AHO B;  4D3G A;  1H38 A;  3MOJ B;  1NEE A;  2HAI A;  2KU7 A;  4RNN A;  4HH1 A;  2C28 A;  1VCT A;  4N41 A;  4I56 A;  1S6Q B;  3SQG A;  4F50 A;  3FNN A;  1F2H A;  2D3O 1;  4IOC Q;  5GMK a;  5M2U A;  3Q8P B;  4M94 A;  2N7C A;  4OYX A;  3BGO P;  3MUM P;  3RB4 A;  1FVQ A;  4WJB A;  1T02 A;  5IXU A;  3U27 A;  5HVF A;  2HFU A;  2X1F A;  2DNO A;  1FJG J;  3DRR A;  3JQK A;  3Q8U A;  1SV5 B;  3OLA A;  1RCX B;  1FT8 A;  3JSR A;  4F0K A;  1X9W A;  5KG7 A;  4DQQ A;  1FRX A;  3SYZ A;  1U1O A;  3G8T A;  1B7F A;  2VQE F;  4CLF A;  3M9M B;  2VJV A;  1WUU A;  4B9V A;  2FGC A;  1TKZ B;  1RBA A;  5F41 A;  2DH9 A;  5B0E A;  1HQE B;  3AJ1 A;  2DT9 A;  3VWS A;  2ZH8 A;  1LWC B;  1FDA A;  4M95 A;  2AU0 A;  2KXH A;  1Q8I A;  2CWK A;  1UVL A;  1B64 A;  1B0T A;  3GV5 B;  3UCZ P;  3SSR A;  4DL0 C;  1HWI A;  3DFE A;  2RIL A;  3D0G E;  1QAI A;  1GNK A;  4LBH A;  4O44 B;  4O4G A;  3N4W A;  3E51 A;  2KZM A;  2M88 A;  4PQU B;  2FVS A;  1HNV A;  4C8M A;  1NKB A;  1WI8 A;  4QIW D;  2FLN A;  5F8L A;  1HWU A;  1U8W A;  4P52 A;  1XMO F;  1JLF B;  4B3O A;  2J7W A;  2J76 E;  1EJ7 L;  3MXH P;  1TKT A;  2R7Q A;  1V9O A;  1MU2 B;  2UV8 A;  1AZS A;  2NZ4 A;  1YGY A;  2FJB B;  3BO2 A;  3Q22 A;  4TY9 A;  1RLC L;  3K0J A;  4EI2 A;  1URN A;  2WCX A;  3DLL Q;  3GP9 A;  1YDL A;  1R8B A;  2CQ3 A;  4N47 A;  1S77 D;  2EFN A;  3M2R B;  3W61 A;  4AT1 B;  3ZZ0 A;  2PEH A;  4KBI A;  2OEK A;  5FDL B;  3OTO F;  2W9A A;  2D3U A;  3F44 A;  2PI5 A;  1MML A;  3IRX B;  2WSF C;  4B3T J;  2GZO A;  2ZH5 A;  3LWM A;  1FXL A;  5DG8 A;  4JI1 F;  9RUB A;  4IG0 B;  2QLX A;  1GTH A;  4TLR A;  4DX5 A;  4ANE A;  3O6Q A;  1WEY A;  3WX8 A;  2ZUA A;  2QV6 A;  4LRD A;  1S97 A;  4P7T A;  2KT2 A;  2RML A;  2V8V A;  2ACY A;  2W8K A;  2GHW A;  2CPE A;  4CLW A;  4NZ7 A;  1SCJ B;  4BBY A;  2IDE A;  2BYC A;  4PQA A;  4DR4 J;  2BM0 A;  1TMM A;  1JJ4 A;  3ZZU A;  1EET A;  3J81 j;  4FKY A;  3AFG A;  4JI8 F;  3SI8 A;  4L76 A;  4CYU A;  4ZHR B;  4ELT A;  2HBZ B;  2UVU A;  4TXS A;  3UE2 A;  2B6A A;  2DH7 A;  2PEB A;  2MJN A;  2ZH2 A;  4HI1 A;  4J9S A;  5HQ8 A;  3IO1 A;  1X8D A;  2CQC A;  4DL5 A;  2BXJ A;  4LF7 J;  1P9Q C;  1NB2 A;  1RIS A;  5ETT A;  1RA7 A;  1F60 B;  2NXU A;  3WIU A;  5DM6 Q;  1HI8 A;  3Q8Y A;  1YJW S;  1YRU A;  3UN5 A;  4O3N A;  2YNF A;  4DV7 J;  1U25 A;  4J90 A;  1CQM A;  2OFH X;  4M5I A;  2XLJ A;  2DR9 A;  4DF8 A;  1A7G E;  3KOA A;  2BAC A;  2KFY A;  1IBM J;  2IC3 A;  3T5L A;  2UUT A;  3UI3 A;  1YTY A;  2QG9 B;  4CO5 A;  2GO8 A;  3OW2 R;  1HD0 A;  1FRM A;  3MM9 A;  4HR2 A;  5KG2 A;  2MGZ B;  5EUH A;  3BQ1 A;  3ISN C;  4TU9 A;  4KO0 A;  1IKW B;  2F1F A;  3C2P A;  1T9U A;  3KXD A;  2FB0 A;  4B3R J;  5CYQ B;  2EBE A;  3D6H B;  1NPR A;  3JS9 A;  5E3C A;  3LTO A;  3QBC A;  4OLO A;  2RHQ B;  1Y5I B;  2KT5 A;  2B56 A;  3TUP A;  3O5T B;  4QIG A;  5F8M A;  1S57 A;  4DOZ A;  1OQ6 A;  5J2P B;  1R3N A;  5LMU F;  1D9A A;  1GX6 A;  2FVP A;  3UDV A;  2YWG A;  1XQI A;  3Q23 A;  2FVQ A;  4CO2 A;  1OWX A;  3HT0 A;  1RT1 A;  2HHQ A;  5C5J A;  2WTF A;  2JL9 A;  1SC4 B;  3CC2 S;  1VIS A;  1RI7 A;  3MM5 A;  3D0I E;  3QT7 A;  3EZU A;  4MH8 A;  1WC1 A;  4CH7 A;  3QLH B;  2PSZ A;  2XSJ A;  4H4K C;  1KFS A;  3EUN A;  2Y8W A;  4QJV A;  2ZNY A;  3KLG A;  2JSX A;  2POK A;  1CC8 A;  1UEK A;  3UD5 A;  1N54 B;  1HLW A;  1QAY A;  4DJB A;  4X4V A;  1S5Z A;  3P45 B;  2XY7 A;  4UST A;  4YQW A;  3OTE A;  1EIY B;  5CZV A;  5F8J A;  3H40 A;  4FP9 A;  2LU1 A;  1HYS B;  2FJE B;  3H98 A;  2MST A;  2LQ5 A;  3D3C J;  4LF9 J;  2RDJ A;  1UPP A;  1FTC A;  3FQL A;  1AFI A;  3U1M A;  1KOH A;  1RWO B;  2IA6 A;  3MMB A;  1P9Y A;  2ASY A;  4GVB B;  1H3D A;  2B7B B;  2DHG A;  2IVM A;  1F5B A;  2ASL A;  2FJW A;  2IAJ B;  4JYA J;  2K7J A;  3ZZP A;  1RYR A;  1NJY A;  3TVK A;  1NK8 A;  4O0N A;  3RUB L;  2KT3 A;  1VMB A;  2VU5 A;  2ZWO A;  1T11 A;  5BR8 F;  2MTL A;  3QWU A;  5SUH A;  1HHT P;  4JI3 F;  4USH A;  5EWF A;  4I69 A;  3M8P B;  1RT2 A;  1ITP A;  4DL6 A;  4QIV A;  4A4J A;  3D7S B;  1N5Y B;  5LJ3 Y;  4CLY A;  1PG5 B;  4UQT A;  1TFY A;  5ETR A;  5ETO A;  2FVR A;  4GRS A;  4KPC A;  2GGP A;  3DU6 A;  5DGA A;  3HSJ A;  2QA4 S;  2M0G B;  4F0H A;  5A6P A;  3FBE A;  1HBU A;  1EAR A;  4EWT A;  2IBK A;  2FVC A;  2YVS A;  4DR4 F;  4DV0 J;  2AX0 A;  4F04 B;  1O0P A;  3H5U A;  1V5V A;  3C6T B;  3CCL S;  1PCA A;  3DOM B;  1DUR A;  2YKN A;  5K20 B;  3S8S A;  5C24 A;  1JNZ B;  4OYO A;  3CDB A;  3JSY A;  1NK0 A;  4XIU A;  2CAD A;  1JX4 A;  4LF7 F;  4F25 A;  3AAW B;  1X7V A;  4QU7 A;  1RAE B;  2R9L A;  1YK9 A;  3MEG B;  3DLK A;  2H5E A;  4X4N A;  4CIO A;  2ZJQ Q;  5LXR A;  4U8Y A;  2C2D A;  4EUV A;  1S49 A;  2LDY A;  1RA6 A;  3OTD A;  3J7Z 5;  4DV7 F;  2E7V A;  2H48 B;  1HNW J;  3NG8 A;  2Q43 A;  4QWB A;  2HK3 A;  4F4K A;  2Z2L A;  3H25 A;  3KYL A;  1ZZF A;  2E9T A;  1IBL J;  5KFP A;  2CYY A;  4O4R A;  4TU8 A;  1YKW A;  2OEJ A;  1IBM F;  3P49 B;  3NGS A;  1RYS A;  3QIP A;  3MTK A;  1ZPV A;  4X4Q A;  4MJK A;  2CZV C;  2FLP A;  4P73 A;  2HWH A;  2MJU A;  3H90 A;  1ZA1 B;  4GMK A;  2F9D A;  3HK2 A;  1JLG A;  1S9E A;  4OJH A;  1D8Y A;  2CNK B;  3DGP A;  3GCX P;  3AA8 A;  2XZT B;  1RXO B;  2HNZ B;  1S4E A;  3LH2 S;  2CUY A;  2F3J A;  1ZH5 A;  2J0W A;  1TL3 B;  3M8Q A;  4MKA A;  3MPW A;  1V3R A;  4ATN A;  3DDK A;  2QFJ A;  5L1I A;  2M8H A;  1CJU B;  1S0O A;  1S12 A;  3KDO A;  1VJW A;  3AB4 B;  3MMA B;  1G3O A;  4B9L A;  2R3V A;  1ZET A;  2QL7 B;  3BBF A;  4LSL B;  3TEG A;  1HBO A;  4NRU A;  2CVE A;  3AD8 C;  1RAB B;  2OPR A;  4LFB J;  4MFB A;  2KVQ E;  1YVF A;  2VON A;  1DLO B;  2W9C B;  3DC2 A;  4X4S A;  2XUL A;  1RWK B;  3D9B A;  2AX1 A;  2YWF A;  1ELO A;  4J9V A;  4ALZ A;  1JLA A;  3OFG A;  4ES1 A;  2OD6 A;  1S6O A;  4LIW A;  5SZT A;  5ETS A;  2LA6 A;  3ZTQ A;  1UA1 A;  3GFH A;  1T9X A;  1YJN S;  4DSJ A;  2DNL A;  2QLB B;  4BWM A;  1VI7 A;  4UUX A;  3AXM A;  4NXM J;  2ZH1 A;  4ZIT A;  4KGK A;  4LF9 F;  2L9D A;  2WOM B;  1VLY A;  2V63 A;  4CTA A;  4DL7 A;  2ZM6 J;  1L3T A;  1R7I A;  5KG3 A;  1WKJ A;  2F4V F;  4ZKA A;  1RQ0 A;  1RHU B;  2C2N A;  4PAA A;  3TAQ A;  1KNZ A;  3SV3 A;  3IP0 A;  1GMW D;  4AYB D;  2EK6 A;  2HUR A;  4CT9 A;  2VG6 A;  4JI0 J;  4J9K A;  3ZZZ A;  1NJZ A;  2D3Z A;  1WDD A;  1PSD A;  4YDX A;  5AE1 A;  4MMO A;  5IWA J;  4S0M A;  1OSD A;  2J9E A;  2AEJ A;  3T5J A;  2VH7 A;  5B0D A;  2DB1 A;  4M5L A;  4RWX A;  2JHE A;  1KTQ A;  2Q66 A;  4ED2 A;  5F8G A;  2CXE A;  3PCO B;  2W7A A;  4UOC A;  5J2N B;  3TX8 A;  1T95 A;  1M90 T;  4AL6 A;  4YR2 A;  3IM8 A;  2KO1 A;  3CCV S;  2YQ3 A;  1PIE A;  4RX6 A;  3BDP A;  1F0X A;  3L9Z A;  1DBD A;  1P6T A;  1FE4 A;  4NLG A;  4ECV A;  2R7X A;  2VKR A;  4O4G B;  1KLM A;  3MCN A;  1HNV B;  1CJK A;  4JUZ A;  1YJ7 A;  3H59 A;  2MQQ A;  2B4P A;  4K7Q A;  4NI2 A;  1NAQ A;  5J2Q B;  1FWL A;  2MZS A;  1TL7 B;  4R0J A;  3QT5 A;  4B3O B;  1T9Y A;  3NS5 A;  5IT9 Y;  3LGM A;  1PAE X;  5HAO A;  3R7N B;  3BM7 A;  4GVL A;  4Y2K A;  4ZK7 M;  3V6D A;  1CS4 A;  1FF2 A;  3TAM A;  5LSR A;  4DSE A;  2IJR A;  5THW A;  2X1A A;  1P8G A;  1TUG B;  4ECQ A;  2OFG X;  2Y1R I;  3HP6 A;  2KL8 A;  4ZJL A;  1OJ4 A;  4PAB A;  5D8H B;  3EXC X;  1T3O A;  1SIW B;  4OX9 J;  3GTY X;  3M4X A;  2QL9 B;  1EKS A;  2VFT A;  3PHE A;  2DR6 A;  1IBL F;  1J5O A;  2NPF A;  1VK3 A;  5IS2 A;  4U7C A;  4RBT A;  4AL7 A;  2RAQ A;  4K0K J;  1FD2 A;  1VQ8 S;  1HBM B;  1RT5 A;  4Y0F A;  4C7Q A;  1JKH B;  5B0F A;  4FS1 A;  4IH6 A;  3CMA S;  5IM0 B;  4ZPA A;  2HQ3 A;  2HHH F;  1UZH A;  4NLV A;  3MM7 A;  1NKC A;  2W8L A;  4RWW A;  1OY6 A;  2C2K B;  1WTF A;  1JLB B;  4Q2M A;  1QTN B;  5EX3 A;  4DPO A;  2HG4 A;  6FD1 A;  2L41 A;  2IVY A;  1YHQ S;  3QGI A;  5IT4 A;  3GJR B;  2G9O A;  1N0U A;  2HYI B;  3UPF A;  1U1P A;  1H7X A;  2FHJ A;  2B6A B;  1PAU B;  2VC1 A;  2JC1 A;  2FY8 A;  3V6J A;  3IA0 A;  2MLZ A;  2BJD A;  4FS2 A;  3T5H A;  3V5R A;  4HVZ A;  1NCL A;  2BE2 B;  4IDK B;  1PO6 A;  3BBB A;  3DLB A;  4LFB F;  1I94 F;  2DGX A;  1IBC B;  2AWZ A;  4DR6 J;  5FLX U;  4OX6 A;  1T05 A;  3I0R B;  4F4Y A;  2WSE C;  4TY8 A;  3OL8 A;  3DRS B;  1QVG R;  4BHQ A;  1Q86 T;  2OEL A;  2L08 A;  4P9S A;  2XY6 A;  3G9C A;  1C0T B;  4C3K A;  3N9U C;  3CIM A;  2PD1 A;  3MZI A;  1KTV A;  3HHL C;  4DQR A;  2X3D A;  1T0T V;  4NXM F;  4JI5 J;  3IWL A;  1NZA A;  2JLE A;  4NLT A;  3TP2 A;  2IBO A;  4K5R A;  3R1L A;  2IPO B;  2EFO A;  1Y00 A;  2ZM6 F;  4UOG A;  2B51 A;  2ZE2 A;  3PW2 A;  2E7W A;  4RW9 B;  1FK9 A;  1HIY A;  5F9L A;  3C14 B;  1F2G A;  4JI6 J;  3SCJ E;  4LF8 J;  4MIA A;  3QT8 A;  2MB0 B;  3BQ2 A;  1VQM S;  1RWX B;  4JI0 F;  4OZ3 A;  2ZH9 A;  5GAG I;  3GPA A;  2BQR A;  4M5M A;  1TK5 A;  4ELV A;  1GFW B;  4TLQ A;  5AJ3 J;  1Q5Y A;  2I5J B;  5D0R A;  4O3P A;  4PR6 A;  5IWA F;  3DOL B;  2J5A A;  1UEU A;  4NCG B;  1UAW A;  1AT1 B;  4ZOS A;  2ACM A;  3NGD A;  4EZ9 A;  2C1E B;  2Y0B B;  1O8B A;  4KE5 A;  3POT B;  3HHD A;  1S7H A;  1WSR A;  4YY3 J;  4E2F B;  2ZH4 A;  1UA0 A;  5M2P A;  3MUR P;  2CFX A;  2DNZ A;  2IDL A;  2AP6 A;  1IKY B;  4IG3 A;  4F02 A;  2V2V A;  2I2Y A;  4FKX A;  2MDA A;  2DBB A;  1IWA A;  3OR1 B;  2VL1 A;  4FXV A;  1G6B A;  4RKU C;  2G2Z A;  2PFD A;  3TUJ C;  2XHW A;  1R8H A;  3KLG B;  4USI A;  2RH3 A;  1N88 A;  3TQ1 A;  1NDC A;  1X5P A;  2V8D A;  3JYT A;  5GAH I;  5HQM A;  1S99 A;  2HFO A;  3TNV A;  4RL1 A;  3KK3 A;  4UTG A;  4ED1 A;  1PYS B;  4PYD A;  2NLW A;  1ZM2 A;  2PMW A;  4WII A;  2CDQ A;  3G82 A;  2W4C A;  2J7K A;  3HHL B;  3RW6 A;  2Z2Z A;  1HI0 P;  1T7P A;  3NS7 B;  1VBZ A;  3D5M A;  3W5X A;  4ZPD A;  4ZJO A;  2R2U A;  3PV8 A;  3EPI A;  4XDD A;  1HI1 A;  1FXD A;  1K8A T;  4ZCI A;  4P71 A;  2L9N A;  1HNI A;  3OXG A;  1HQU A;  4WKY A;  1DQ9 A;  3I0S B;  3W64 A;  4OX9 F;  1SIZ A;  4X66 F;  3NCR A;  4KC5 A;  1FEE A;  2NUU G;  1N32 J;  1BQN A;  3IFE A;  2AD9 A;  2ABY A;  4NLY A;  3OT9 A;  2E5L J;  4K0K F;  3SZ2 A;  2DKO B;  4IFY A;  2B43 A;  4OHV A;  4X2B A;  4YHH F;  2YBV A;  3CTR A;  1KRP A;  4K4Z A;  3OXF A;  2J6T A;  3HXM A;  2RVJ A;  4K4T A;  1NK6 A;  2AW0 A;  4R5P B;  5ETN A;  2F65 A;  3J7A 1;  4I6A A;  2KG1 A;  3SXL A;  3BBC A;  3OTB A;  2GJF A;  5A0Y B;  1TQL A;  2APO A;  3W66 A;  3M9N B;  2JH3 A;  4H4O A;  1HAR A;  3PRD A;  2OAU A;  5HO4 A;  3E8O A;  2CPJ A;  4CLU A;  4QYZ K;  2MLY A;  4DFP A;  5HAN A;  2QE5 A;  1NPP A;  4OZ2 A;  2GMJ A;  2JC0 A;  3OUY A;  4QZV B;  4FDF A;  3QWP A;  3PRV A;  3HF5 A;  4WFN Q;  3QFH A;  2HBY B;  2W4D A;  2Z56 B;  1KD1 T;  2W2M P;  1T03 A;  1X4D A;  3G86 A;  4I6Y A;  1HBN A;  1TTH B;  3QAE A;  3CC7 S;  1LNQ A;  5HLF B;  4RW7 B;  1M5S A;  3K59 A;  4FNI A;  5ETP A;  2Y0S D;  4CO4 A;  3KNG A;  1WC0 A;  3MM8 A;  3CJK B;  1FWK A;  1Q95 G;  4ED7 A;  4AE5 A;  2VV5 A;  2RF2 A;  4U7U D;  4OZ5 A;  2ZBC A;  1XR7 A;  3K5M A;  2HBQ B;  4KH0 B;  4DZ6 A;  2BRK A;  1JMT A;  4V1A k;  1Y7P A;  2OPQ A;  1NK9 A;  3MEE A;  1RWN B;  3UCU P;  2QL5 B;  3GIL A;  4OX8 A;  3HKW A;  1CSJ A;  3WDO A;  1BY9 A;  4H54 A;  1NDL A;  4JI5 F;  2YNH B;  4O23 A;  2O67 A;  4QYZ J;  2HKE A;  5K14 B;  4OFZ A;  3R1H A;  7FD1 A;  2XWX A;  1BGX T;  5JJB A;  3N6L A;  2Z8Q A;  2RDI A;  2R8I A;  4JI6 F;  1WG4 A;  5CZD A;  4LF8 F;  1U2F A;  3PW4 A;  2X1B A;  5JUM A;  2CPH A;  1RB0 A;  5EHH A;  3A8E A;  4M5J A;  1IUJ A;  2CZ4 A;  5BYR A;  3TZZ A;  5AJ3 F;  4FNH A;  2YX1 A;  2KXN B;  2PA8 D;  4PG8 A;  3D2W A;  4C3L A;  1UZD A;  4G65 A;  1C0U B;  3DYA A;  3QJL A;  1U4B A;  4OI3 A;  3D28 A;  1N56 A;  5HVG A;  2G0I A;  2X51 A;  4HI2 A;  4ZVQ B;  3A12 A;  2EVZ A;  4QYR A;  4KFB A;  2HRU A;  3M32 B;  4HH0 A;  1FEH A;  4ZP7 A;  2ZOF A;  3CIZ A;  2AGQ A;  1MRO B;  5E0O A;  3TUZ C;  4MFB B;  4NMX A;  1C4A A;  1V3S A;  3NL0 A;  4N76 A;  4DLE A;  2KKH A;  2ZIT A;  1G1X A;  4B3M J;  1LWF B;  1S1T A;  2RRB A;  3DCA A;  3A13 A;  3ET6 A;  1DZ5 A;  3I5A A;  1IKV B;  1MMD A;  2QN6 B;  1K1Q A;  4ZPB A;  5J2M B;  2ZVS A;  5D6G A;  4DV3 J;  3ETO A;  2IFX A;  4DFJ A;  2Z2Y B;  4B08 A;  3TZX A;  4AD6 A;  2CNO B;  2LDI A;  3L09 A;  1LW2 A;  3M1V B;  3M6U A;  2CQB A;  1VIO A;  1R8C A;  3AD7 C;  1N5S A;  4R8U A;  3F73 A;  3IG1 B;  3OJS A;  1TKX B;  1WC6 A;  2MKH A;  3MCO A;  1T94 A;  1OSC A;  1IM6 A;  2ZUG A;  3LP2 B;  2WB1 D;  2ZC3 A;  1QTM A;  3OV7 A;  1ZM9 A;  3V4I A;  4KKO A;  3TX0 A;  4ZN1 A;  2VG5 B;  1GEH A;  3N0V A;  4KGZ B;  4J9P A;  4NLD A;  1CJV A;  2XGQ A;  4RW6 B;  5LMN J;  4KR0 B;  1MW7 A;  1VHF A;  1TUW A;  1WOS A;  3K17 A;  3M6V A;  3HZE A;  1S1U A;  3MTJ A;  3SDE B;  3EYZ A;  3ZTR A;  4B9T A;  4W92 B;  1XMQ J;  1EZZ B;  2RT3 A;  3VAI A;  2RNE A;  2CPZ A;  4DFK A;  3KKF A;  1KQG B;  3HFK A;  1IKX B;  5DLF A;  1C1C B;  1QVF R;  3PNI A;  2O66 A;  5ITH A;  3GON A;  1RAF B;  1RGV A;  3JTN A;  3IR5 B;  5KTQ A;  5FII A;  3FZ2 A;  1SL2 A;  1JXV A;  3X1L B;  1OYD A;  5GMD A;  2D9P A;  2CPD A;  1N6Q A;  2Q1L A;  1WHW A;  3R27 A;  2HND B;  4DZD A;  3HMJ G;  5AXN A;  3TOQ A;  4M5D B;  3W9J A;  2J6S A;  1LV5 A;  1NU4 A;  4NLX A;  2JZ5 A;  2WK4 A;  3NWG A;  4Q0B B;  5KG0 A;  2HBR B;  3LWL A;  4DR1 J;  2YKM B;  3D4J A;  1WEL A;  3V6D B;  2AGP A;  1QAJ A;  3BSN A;  2QLJ B;  2HPU A;  3QJJ A;  1AUD A;  4PXD A;  5T14 A;  4Q45 A;  3VZH A;  2BKO A;  2HHV A;  2M8D B;  1S6Q A;  1KLN A;  5KG6 A;  4USV A;  2AIR B;  1TEL A;  2C2R A;  2VPX B;  2JDJ A;  2W7P A;  5F3Z A;  2GX8 A;  2HWI A;  2R8J A;  1O5J A;  2LQB A;  2EC0 A;  3W60 A;  4DDF A;  3J80 U;  4PKD B;  5GME A;  4NWB A;  1VQK S;  3P8B B;  1J5O B;  2VZ8 A;  4EU0 A;  4DN9 A;  4UY8 T;  4FYY B;  2XLK A;  5HMX A;  2E5I A;  3H20 A;  4ZVO B;  2DNM A;  3LP1 B;  1VQ5 S;  3MI7 X;  3VGV A;  3ILO A;  2VQF J;  2B7C B;  2W01 A;  4ILR A;  4HAC B;  3OL9 A;  1UEV A;  2J8A A;  2DNN A;  2C22 A;  3NAH A;  3KJV B;  3JXO A;  4DF4 A;  2AYM A;  3E01 B;  1TKZ A;  4OMF G;  3KHR A;  1KDN A;  1DAX A;  2V4J B;  1HQE A;  1NDK A;  4C8K A;  3MDF A;  5DM7 Q;  5E3A A;  1LWC A;  4L74 A;  3HVR A;  5A2Q Y;  3T6B A;  3KJF B;  5HRO B;  1SJ4 P;  1WD6 A;  2DGO A;  3K8W A;  2VFS A;  2R7U A;  4ES2 A;  3UN3 A;  4NEZ A;  4Y34 A;  4WU2 A;  3NRB A;  3D3B J;  2FZK B;  3LAN A;  4O44 A;  4UW2 A;  3DLE B;  3MUV P;  3M6X A;  3MUT P;  3IC1 A;  2EPI A;  2NQP A;  2W4P A;  1NSP A;  3WZ0 A;  4QR0 A;  4PQU A;  2V67 A;  1VQ4 S;  1KSP A;  3H2L A;  5LJ5 Y;  1WC3 A;  1FFG B;  2GML A;  4C0O C;  2CQG A;  2N3L A;  2MZJ A;  1UW9 A;  1JLF A;  1UFW A;  5KFQ A;  3HD1 A;  1WKL A;  2QT7 A;  2ZC4 A;  4RPF A;  3VAK A;  4J9R A;  1S59 A;  1U48 A;  4DV3 F;  2HS3 A;  1EQ0 A;  3DI6 B;  3TZY A;  2ALY B;  2XS7 A;  4WZQ A;  3NS6 A;  4YP3 A;  1IN0 A;  4WXO A;  3M2R A;  2YX7 A;  2OI2 A;  1R89 A;  2CPX A;  3LA0 A;  4BCA A;  4KHP J;  2M9K A;  5FDL A;  1UL3 A;  1VQS A;  1VQO S;  2HVD A;  4U6P A;  3IRX A;  2IYG A;  4XAK A;  1XNR F;  3NCP A;  1F9F A;  2E5G A;  4IRK A;  1W2I A;  1YJT A;  3PXG a;  3M8W A;  4FXW A;  4IG0 A;  1V6H A;  3JQM A;  1WHX A;  3G71 S;  4V19 J;  1YX2 A;  5IC4 B;  1Q1K A;  2CZ9 A;  2U1A A;  5DO2 A;  3GZ7 A;  3HM9 A;  3CT9 A;  2KZZ A;  5LMN F;  5HL7 Q;  3R3T A;  3IR6 B;  1PC5 A;  2MY8 A;  5EWE A;  2G1D A;  4L3N A;  1U6F A;  3GYX B;  4OIX A;  3RGI A;  4X4R A;  2MQ8 A;  4ED3 A;  1XMQ F;  1BXN A;  2VD3 A;  4O3R A;  2XYG B;  1UPM B;  2OML A;  1R8P A;  2UXD F;  4CLS A;  1W25 A;  2IYI A;  2ZD1 B;  4RJV A;  3QGG A;  5ETL A;  5E5N A;  1YG0 A;  4YR3 A;  5DRK A;  4ZHR A;  3HVT B;  2J9D A;  4YUD A;  5C2G A;  4N77 A;  1J5E J;  3G6V A;  4HEA 9;  3JSM B;  2AJ1 A;  3CF5 Q;  5K5M A;  4OZ0 A;  3W2V B;  5I3P A;  2GCF A;  4YFU A;  3NBP B;  3E3X A;  2R8G A;  2GV1 A;  3QRQ A;  1EX8 A;  1VC5 A;  2HMI B;  1CPZ A;  2DY9 A;  3B78 A;  2ALZ A;  1Y9O A;  4DR1 F;  3RW7 A;  1QM9 A;  3J81 U;  2UVR A;  1QSS A;  3THV A;  1UJ5 A;  4P74 A;  4U95 A;  2YNG B;  1XC9 A;  4ZP9 A;  3MAA B;  2B0G A;  4B02 A;  2NRE A;  2K8G A;  3P5B P;  4H4M A;  1WEX A;  2YKP A;  3QSY B;  1IQT A;  2MGZ A;  2LEB A;  2HSE B;  4PPD A;  3ZO7 A;  2CIM A;  2QA4 G;  2XHC A;  1IKW A;  3H5Y A;  4EEY A;  4PCQ A;  4DUZ F;  4DR5 F;  4CT8 A;  3M2U B;  2NYI A;  2JFD A;  2FJX A;  2VQF F;  2Q6C A;  3NEK A;  5CYQ A;  3TRG A;  2LXF A;  3OFE A;  2M3D A;  2GMH A;  1NK7 A;  1U7L A;  3FDS A;  2JVO A;  1MLA A;  2U2F A;  2UUC J;  2QIF A;  1TFW A;  2IRX A;  3PR5 B;  2XNR A;  3GII A;  4DR2 J;  4JI2 F;  1RWM B;  1N34 J;  1L3V A;  2C2O B;  4ITS A;  3KHH A;  1FRK A;  4URQ U;  5I42 B;  1K9M T;  1H98 A;  1MNE A;  3T3F A;  1SQG A;  4WP9 A;  4LF6 J;  2Z30 B;  2JLF A;  1O6X A;  3CDU A;  5L39 A;  1LKZ A;  1GT8 A;  3LQV A;  4ZS6 A;  2A10 A;  2DGW A;  3QLH A;  2XI3 A;  4I64 A;  3I31 A;  2ROP A;  1CBK A;  4C9D A;  4X65 F;  3MD3 A;  4DPT A;  4OYB A;  3PYD A;  3CJ2 A;  3B8H A;  5HI7 A;  1WG5 A;  2BAN B;  4LUB A;  4FF3 A;  5C2C A;  3BJY A;  4K4Y A;  4FN5 A;  1YQH A;  2YKO A;  2G1H A;  4RBV A;  4LT6 A;  1WTB A;  4ILL A;  1UP1 A;  2B4V A;  4PWU A;  3DLG A;  4I1T A;  4OI0 A;  9ATC B;  4X4T A;  3I32 A;  1HW8 A;  1NXI A;  5G4D A;  4FZV A;  2FC8 A;  3OR2 B;  2V68 A;  2M7S A;  1HYS A;  2XY5 A;  4PUO B;  3TVZ A;  4A8X A;  3FVY A;  3I5B A;  1HW9 A;  2D69 A;  3D66 A;  2AJQ A;  4DU8 A;  1ROF A;  1S0N A;  5GAD U;  3RBX A;  3NWR A;  1RT4 B;  2JVR A;  4TKT A;  2HGN A;  4LF4 J;  2OIH A;  4O0I A;  4IQM A;  2Z58 B;  3FZB A;  4UOH A;  3JTO A;  3ZZY A;  4G3I A;  4GVB A;  3KLI B;  2IAJ A;  2DGV A;  2XM3 A;  2R7R A;  4KHP F;  3TYT A;  1A0O B;  4PPZ A;  1PYO B;  4YB1 P;  3ENV A;  3BSA A;  1U2R A;  4A8K A;  2C2E A;  4QR1 A;  1FNO A;  4KPY A;  1YIT S;  1NK5 A;  2UV8 G;  2PII A;  2FLO A;  2C3O A;  3BGF A;  4C11 B;  3M8P A;  4TQR A;  1E6Y B;  3QAU A;  3KK1 B;  4LFC J;  1VQL S;  3CCE S;  2GHP A;  4A47 A;  5D77 A;  1N5Y A;  3MFH A;  4ZLJ A;  3V6H A;  1EB0 A;  2AZ1 A;  3CCR S;  1PJ6 A;  4F3O A;  2RS2 A;  1U45 A;  3BGU A;  3GIR A;  1W26 A;  4I2Q B;  1FRI A;  1C1B B;  5KT6 A;  4DR7 J;  3AJD A;  3PKY A;  3KLH B;  2HNY B;  3P4U B;  4G1Q B;  2VBZ A;  1G4C A;  1PGZ A;  1LXJ A;  2KYX A;  4UF4 A;  1CUL B;  4HKQ A;  3LF0 A;  2UXB J;  3Q83 A;  3RBZ A;  1K0T A;  3NNC A;  3C6T A;  4H4K A;  4K2J A;  2XYP B;  3DOM A;  5KFH A;  1RE1 B;  3UNY A;  3VAM A;  4JI7 F;  3NAI A;  4WTO B;  1J5E F;  3MR2 A;  2I9S A;  6FDR A;  7AT1 B;  4KGX B;  2EKY A;  1KKH A;  3T5K A;  2M52 A;  2OPS B;  3MEG A;  2Z4P A;  2B4O A;  4K59 A;  4ZVS B;  3R2D J;  2C42 A;  2HQF A;  1HPZ B;  3PX4 A;  5DLG A;  4QCL A;  2DR7 A;  3HVW A;  1LOU A;  2J6U A;  3OL7 A;  1IBK F;  3OTO J;  1VOM A;  2W25 A;  3QGP A;  2ADC A;  3PG9 A;  3W2W B;  2FIU A;  4Y6I A;  4F7V A;  1HWL A;  1S0V A;  4USW A;  2HEK A;  4O3S A;  1S4F A;  3LAM A;  3CW2 C;  1U1N A;  1HFE L;  4DQS A;  5D4N A;  3RR8 A;  1VJQ A;  3AQO A;  2R8K A;  1U8S A;  4IO9 Q;  2DTJ A;  4DQI A;  1ZZN A;  1JJH A;  2V5H G;  1MN7 A;  5G0R B;  3EGW B;  2VOP A;  2GHV C;  2HGL A;  2VBW A;  1WF0 A;  2UVV A;  3VGU A;  2RJZ A;  2HNZ A;  2CQI A;  2OTJ S;  2AJ4 A;  2MYF A;  4PXE A;  5CCM A;  1TL3 A;  1AXQ A;  2D9O A;  3Q86 A;  4CLT A;  5LOQ A;  2UUC F;  3LOU A;  4ZLL A;  3V4M A;  1CJU A;  5DQI A;  2DYA A;  4DR2 F;  3OFF A;  3HSD A;  3MMA A;  4NYZ A;  3EZ5 A;  4URG A;  1RAD B;  2XYH B;  3VVT A;  4KGV B;  1UJ4 A;  2Z0G A;  2FTR A;  4LSL A;  4LF6 F;  1UVK A;  3I9Z A;  2V2K A;  4LRF A;  1V5I B;  3FFI B;  5KG4 A;  1DLO A;  3AOA A;  1U6B A;  4CZC A;  2BOA A;  5C25 B;  2CRL A;  5AE3 A;  4EFA C;  2QMW A;  1X4C A;  1JQG A;  3BSO A;  2NXJ A;  5FLX Y;  3WIV A;  4YB5 A;  4DUT A;  3R6L B;  2HW3 A;  1QSL A;  1FNM A;  1QAX A;  2OH2 A;  4U67 Q;  2YPZ A;  1TU0 B;  1S79 A;  2KXF A;  1M1G A;  4RU2 A;  4BC7 A;  4DS5 A;  1H2V Z;  2BOP A;  4ZVG A;  3C3L A;  1NSK L;  1GXT A;  3KLE B;  4UOF A;  2XNQ A;  1SVD A;  3GV7 B;  2V69 A;  4ZVR B;  1B0V A;  2WOM A;  3D1Q A;  2WVE A;  2A2D A;  2WVD A;  4DPY A;  3M8R A;  1F5C A;  4LF4 F;  2GVD B;  1OPI A;  5K8O A;  5CHC B;  5A6W A;  4CLP A;  2ATC B;  2RKI B;  3KLV A;  2QJ3 A;  1FO1 A;  4AUK A;  3M05 A;  4OV6 A;  3H0P A;  5KFU A;  1CJT B;  2CQP A;  3O1L A;  1KHV A;  2KFN A;  3K8V A;  2K1R B;  4MIW A;  4HLB A;  2FGO A;  5AE2 A;  4OI6 A;  2FHJ D;  5CYJ A;  3Q2T C;  2DIS A;  4F8R A;  1RWV B;  3CCZ A;  4KQZ A;  1HHQ A;  2H4W B;  5J1N A;  4X84 A;  5LMU J;  1PJ5 A;  4LFC F;  1SXL A;  4W90 B;  3B54 A;  2AF6 A;  1VRT A;  5J2N A;  2M4M A;  2QLW A;  3NY0 A;  1FXR A;  2IM1 A;  5DZ6 A;  3AA9 A;  1SBR A;  3G4S S;  4CP5 A;  4DR7 F;  4A8Y A;  4JOU A;  1LW0 B;  3N6M A;  5E41 A;  1RBO B;  4DN0 A;  3CD7 A;  1S48 A;  3PZP A;  2XQC A;  2CJB A;  3QFW A;  2JWN A;  2UXB F;  1FDD A;  3FEY B;  3BKU A;  2HQI A;  5J2Q A;  1HMV B;  1TL7 A;  2QSW A;  2V4R A;  1XR6 A;  1HA1 A;  5B7W A;  1SUQ B;  2GQC A;  1LK7 A;  1EP4 B;  1RHQ B;  2KDO A;  4MKV A;  2FLL A;  2N3O A;  1WHY A;  1Q79 A;  2MQN A;  4I7F B;  3SBM A;  4LSN B;  3MWB A;  3GJS B;  2PA3 A;  3BPD A;  2GVZ B;  4U8V A;  3D0H E;  1MG7 A;  3TR5 A;  5LT5 A;  5AXK A;  2W1B A;  1Z2L A;  4MK8 A;  4UZC A;  3GWC A;  1GXU A;  2KHD A;  3B4D A;  2EFV A;  2C3P A;  3OVA A;  2BA9 A;  1YZ7 A;  5BR8 J;  1TAQ A;  4JI3 J;  3ICL A;  4DQP A;  3D68 A;  1YBU A;  2LEC A;  2EFQ A;  2OPP B;  1HBM A;  5CAB A;  2FPH X;  1JKH A;  1RT7 B;  4UQG A;  3VAJ A;  3CC4 S;  2FZC B;  5IM0 A;  4C8L A;  2ZHO A;  4J37 A;  4HDH A;  1ZS6 A;  5CYM B;  2ZZT A;  1NJW A;  1JLB A;  4DXL A;  3VZI A;  3SCL E;  4PWD B;  2YQ0 A;  1Q7L B;  5CZC A;  1RTJ B;  4WP3 A;  4ZVU B;  2YWW A;  4NLR A;  3R9L A;  2J0X A;  3VVU A;  2ZZN A;  4K4X A;  2HRY A;  1DQ8 A;  4JV2 A;  4QR2 A;  2CA9 A;  2HFS A;  2HHW A;  2MHE A;  2OP5 A;  2G4B A;  2MKS A;  1NHK L;  3MD1 A;  3G2X A;  5GAD I;  2LQ8 A;  3D1O A;  2KRB A;  3HSZ A;  2CJK A;  4MT1 A;  2WON B;  2BE2 A;  4IDK A;  2E5H A;  2R8H A;  1ZYQ A;  2A0F B;  1YI2 S;  3RYL A;  1JLC B;  1SKR A;  4USJ C;  2NXC A;  2GIQ A;  3I0R A;  1RT6 B;  1LQ9 A;  4IOB A;  2EC2 A;  2XZW A;  3A4T A;  3FSX A;  4F4W A;  1VDH A;  3DRS A;  1MWQ A;  4RNO A;  5HQL A;  2C2M B;  1W7W A;  5H1S V;  1C0T A;  3DU5 A;  3G8Q A;  3Q24 A;  2C3U A;  2XO7 A;  3JSB A;  1WNE A;  2ILZ A;  3QZ7 A;  2HFN A;  4IO1 A;  2DJW A;  4ERD A;  1JXE A;  3WX4 A;  2FHK A;  2HZA A;  4K4W A;  3C15 B;  2B8P A;  1Q8L A;  3T1A A;  3KK2 B;  1YRX A;  4H4M B;  1ZAX A;  2GFF A;  2E5J A;  5KT5 A;  3HX9 A;  4RW9 A;  2XMT A;  1DJ0 A;  2FC9 A;  4PEO A;  1YWX A;  3C14 A;  1R0A B;  2ZVI A;  3BGL A;  2DIV A;  3FRY A;  3MPU B;  2DNR A;  4W98 A;  4E8U A;  3GJQ B;  5A8K B;  3RB0 A;  2RUG A;  4J9N A;  2ZZM A;  1D9F A;  4AMP A;  2I5J A;  4KGM A;  2MPU A;  2PI4 A;  4CNY A;  4IKA A;  3DOL A;  4NCG A;  4Q44 A;  2KM8 C;  2ZFH A;  1XNQ J;  4EBD A;  3ZC4 A;  2HZV A;  3MEK A;  3CJ4 A;  3GIJ A;  4MTP A;  3R6G B;  3ZNU A;  1NZ8 A;  3POT A;  3TWZ A;  4N5S A;  2R42 A;  3RRG A;  4KV8 B;  3K2Y A;  1Y3K A;  4QWD A;  1BQM B;  2AJF E;  1QE1 B;  3GSI A;  4QWC A;  2B9X A;  4P2S A;  1IKY A;  5CD4 H;  1NJX A;  3OR1 A;  2ZDO A;  2E1P A;  2K06 A;  1XIQ A;  4K4S A;  3PHT A;  3KTQ A;  1F3V A;  3W8G A;  4F3Q A;  1VRU B;  4DL4 A;  2QMU B;  2DO0 A;  5GVQ A;  2B5J B;  1S9F A;  2R2T A;  4JV0 A;  3DLG B;  2B9W A;  4DWI A;  5A8R B;  4ZMM A;  5JVH Q;  3TO8 A;  2XC9 A;  1S1W B;  4IR1 A;  4W4M A;  5IC6 B;  3G96 A;  2GC8 A;  4LF5 F;  1SKW A;  2CJY B;  3HI9 A;  3OQ2 A;  5K8P A;  2W2P P;  3QMQ A;  4DV2 J;  3HHL A;  2KN4 A;  4AND A;  2HFZ A;  2BX6 A;  3NGU A;  2BM1 A;  2F4V J;  3FSI A;  5DS7 A;  2RB7 A;  5B0G A;  5IT9 U;  5D3G B;  2CDR B;  2R7W A;  1TP7 A;  2Q6B A;  2D3O R;  2GA7 A;  3I0S A;  3UN2 A;  2AJ0 A;  3UDL A;  4AQY F;  1ZTT A;  2DRA A;  3EJM A;  3L4B C;  2FJA B;  2V9W A;  5H9F J;  4ZJQ A;  3DM2 B;  1CVJ A;  5LSO A;  1VRQ C;  4MIB A;  1YJ9 S;  4DX6 A;  4OYI A;  3D54 A;  1FFS B;  2B4U A;  4A8Q A;  1HNX J;  1WWH A;  3PFE A;  1TZ0 A;  2NZC A;  1LWE A;  1SH0 A;  2KM8 B;  5DDP C;  4F26 A;  4Y2I A;  2DIU A;  4FXD A;  2HIQ A;  2HVE A;  3GQC A;  5E2Q A;  3PVX A;  3LP0 B;  1I3O B;  5KFR A;  4ZIW A;  5K9F A;  2OHD A;  4HDG A;  3UDE A;  4R5P A;  2KB2 A;  4CNZ A;  2UU9 J;  4ZVF A;  5A0Y A;  3GFX A;  2QA2 A;  1FVS A;  2XMA A;  3MMJ A;  2Z57 B;  4RW8 B;  2IMW P;  2QLF B;  2K3K A;  3K58 A;  4I2P B;  3FMB A;  2CQH A;  2QEX S;  2CQ0 A;  4P7V A;  4EMD A;  2H9Z A;  3RBD A;  3KG1 A;  5GAG U;  2VPZ B;  1R6V A;  3TVY A;  2BAB A;  4UY8 5;  2MLX A;  4XTT A;  1LXN A;  3FBB A;  5HLF A;  1XMB A;  3CDW A;  4RW7 A;  4AXJ A;  2DO4 A;  1R0B G;  2Y3Y A;  3L7O A;  1D3W A;  3CJK A;  1C4C A;  2KRR A;  4M5K A;  4Q2L A;  2G13 A;  2J0Q D;  4YDD B;  1UKU A;  3VV2 B;  3ENQ A;  2XMV A;  1D1U A;  3GJT B;  5KT3 A;  1RHJ B;  4YME A;  1UVJ A;  2FDN A;  2WVC A;  1JWW A;  3Q8V A;  2CNL B;  1KON A;  4TQS A;  1WC5 A;  3GSD A;  2YNH A;  1PKU A;  1N52 B;  2DY1 A;  3S1T A;  5GAH U;  2JX2 A;  3KLF B;  1X4B A;  4M5G A;  5CA5 A;  4B9S A;  1RTI B;  5K14 A;  2MQM A;  1VQ6 S;  4J9L A;  3W62 A;  2VBY A;  1UWB B;  3TAP A;  2HHH J;  1FJE B;  1ZA2 B;  1Q7Y T;  3GR0 A;  3QNW B;  1VBK A;  4RUC A;  3EIC A;  1Q5V A;  2QTW A;  4DL3 A;  1TVR B;  4LVN P;  4ICL B;  3DDN A;  2DHS A;  4DSF A;  1RTH B;  1R43 A;  2MKI A;  2H51 B;  2EG2 A;  3T9N A;  1DFD A;  1XNQ F;  1FHT A;  2VG7 B;  1C0U A;  1S9G B;  1OO0 B;  1FRH A;  5HBM B;  1Y5L B;  1U1R A;  5IQ6 A;  3FMW A;  2NS1 B;  3M32 A;  4C97 A;  1TAU A;  1MRO A;  4NYO A;  2GS8 A;  1R0C B;  3MR7 A;  3VQS A;  8RUC A;  2DHX A;  4USU A;  4KHR A;  4DUY J;  1I94 J;  3HJV A;  1ZAV A;  5E33 A;  1WSV A;  4CLK A;  4DLG A;  1WF1 A;  3T19 A;  2H5I B;  1WF2 A;  2C3Y A;  5L38 A;  1LWF A;  4PXC A;  3P3D A;  1BLU A;  4JI4 F;  1IKV A;  4NCA A;  2LXU A;  4Q8E A;  4OZJ A;  3OPK A;  3BZQ A;  3KFW X;  5DG7 A;  3H2V E;  3N01 A;  5J2M A;  3C19 A;  4CH1 A;  4PWW A;  1TL1 B;  3O8W A;  4WU3 A;  3ZTO A;  3W5Z A;  4NPO A;  2BE7 D;  2M5Y A;  4OQJ A;  4HL9 A;  1WC4 A;  4WPA A;  2CJQ A;  3IN5 A;  4AMN A;  4ECX A;  3CCU S;  3UFC X;  2G2O A;  4P75 A;  3M1V A;  3W8P A;  4HHU A;  1BC6 A;  2EKN A;  4DPX A;  4DV2 F;  3IG1 A;  3PEJ A;  4QWA A;  3KJQ B;  3CE8 A;  1TKX A;  2NYH A;  4RW4 B;  1YIJ S;  5BJR A;  1JLE B;  3W7B A;  2WW4 A;  4URS A;  1XJW B;  2JRS A;  1M5H A;  2ZHB A;  4DCP B;  1A9N B;  3CD6 S;  3LP2 A;  3O44 A;  2BJ3 A;  2VG5 A;  4LQ9 A;  4OJ3 A;  2ATL A;  4RLE A;  1XER A;  3GYN A;  2ZH6 A;  2ZJR Q;  4FF4 A;  2FQQ B;  3NMA A;  2CPF A;  2N82 B;  3QZ8 A;  3DMJ B;  4RW6 A;  3AY0 A;  3MPD A;  5IFM A;  2HFV A;  2M2B A;  5C7P A;  5ETV A;  1HNX F;  3SDE A;  2MKJ A;  4N7T A;  2CJ9 A;  2IM0 A;  3MFI A;  3TJ8 A;  3GMG A;  2UUB J;  3PYG A;  4Z7Y A;  1VRT B;  2HHX A;  1SJR A;  2DHH A;  2GQQ A;  5KG1 A;  1YSJ A;  4DEZ A;  2ZEJ A;  4CM2 A;  2WHO A;  1IKX A;  1FD8 A;  2KJV A;  2VF3 A;  2UU9 F;  1C1C A;  2GQ2 A;  5LM7 E;  2RIJ A;  3BH6 B;  2PGC A;  1X5S A;  4HYK A;  2ZH7 A;  3KMS A;  4NAS A;  3KDN A;  1XWL A;  2VDH A;  3CNQ P;  4QOT A;  3QRR A;  1UWA A;  2HND A;  3SV4 A;  4M5D A;  3RB6 A;  3G87 A;  2E7X A;  1UJ6 A;  1B7Y B;  4Q0B A;  4YEA A;  3AXK A;  2YWE A;  3C16 B;  2HVZ A;  2YKM A;  3I87 A;  1GH8 A;  2AZ3 A;  1U24 A;  1VBX A;  1U0S A;  3DDI A;  3GG0 A;  4KY3 A;  3RTV A;  2YWH A;  2XCA A;  3EM1 A;  1YBT A;  4ENO A;  1H2U X;  5ADZ A;  3R7B B;  4ED0 A;  3H4B A;  2QYG A;  3MM6 B;  1IR1 A;  2MHN A;  3BPS P;  4DV6 F;  1KEK A;  3A8J A;  1E6V B;  5KAK A;  2OLW A;  3VTI A;  4LF2 A;  4X66 J;  4WFX A;  1RTD B;  2LFV A;  3M2V B;  1I1G A;  5D78 A;  5F0W A;  2RRA A;  1FDN A;  1SL1 A;  4NA2 A;  2BR0 A;  2OTL S;  3U7J A;  1JLQ B;  3LAL A;  2BW2 A;  4WFA Q;  4GKJ F;  4NLO A;  1QUV A;  4WK1 A;  3ZZO A;  4WYW A;  3KUE A;  4KTQ A;  3JTP A;  3P5T L;  2GAH C;  2I1R A;  3LP1 A;  4XDC A;  3VAF A;  2FY1 A;  3JAM Y;  2BKP A;  4XPC A;  5CCL A;  4YHH J;  1TL5 A;  3HSG A;  1S0M A;  2DEJ A;  4HAC A;  2E1M C;  2ZHA A;  3TA0 A;  2NUH A;  4RNH A;  2CWX A;  2XO6 A;  3KJV A;  2Y1J A;  2H3E B;  2EG1 A;  1L3U A;  3IGV A;  4K4U A;  4Y2A A;  3E01 A;  2FYX A;  1XR5 A;  4CCH A;  1UVM A;  2ZBP A;  2N7Y A;  1BWV A;  2V4J A;  2HVI A;  2MY7 A;  3J7Y U;  1I5O B;  2VKZ G;  5HRO A;  1DY3 A;  4L73 A;  3L95 X;  4EYH B;  4OYW A;  1FKO B;  5AXL A;  2KJW A;  2R7O A;  4ZVE A;  5KFK A;  1S6P B;  2ZBQ A;  2HQD A;  4KJI A;  2X1G A;  3R5B A;  4J7C A;  3CDE A;  4LF1 A;  3DLE A;  2CQ1 A;  3EGZ A;  3RBE A;  3TJA A;  4DUY F;  3AT1 B;  5J1E A;  3SMZ A;  2DNK A;  1Z1Z A;  2GAG C;  2XZD B;  5F3T A;  3G8S A;  2VA3 A;  2EI5 A;  4RNF A;  1RU1 A;  2WZ1 A;  3FSY A;  3HVA A;  3K57 A;  2W2Q P;  4J9O A;  1UFL A;  4G1I A;  1RAJ A;  5IZH A;  3WQP A;  3OXL A;  4ZPT R;  1FTR A;  2BUN A;  2QGF B;  3DI6 A;  4PXB A;  5H9E K;  3TUI C;  1RAO A;  4DSK A;  3BF4 A;  1RSC A;  4CQ1 A;  4KB7 A;  4IFV B;  2EWH A;  3RRK A;  4J9Q A;  4DV1 F;  1U2C A;  2IMO A;  1SJ1 A;  1N33 J;  1HQ2 A;  3EVO A;  3C66 A;  4NLP A;  2AQ4 A;  2WAQ D;  3UWT A;  3UR0 A;  3EX7 B;  4NRT A;  2AYG A;  2O5D A;  2XB2 D;  2QRR A;  1BE4 A;  4ZPV R;  1RJJ A;  4USK A;  4CI0 B;  2UUA J;  2MKK A;  1D09 B;  1FRL A;  4P2F A;  3RAM A;  3KG0 A;  2YXL A;  3BH7 B;  2HAF A;  2P6S A;  2P2C B;  3H42 A;  2DCL A;  4LR7 A;  1BQX A;  4F2R A;  2HQG A;  3C6U B;  4L3K A;  3DRP B;  4AFF A;  2HLU A;  4QIF A;  4K4V A;  3RAQ A;  2L48 A;  2UUB F;  2DEI A;  3CSK A;  1RLD A;  5H9E J;  3PRB A;  3KG4 A;  5BYS A;  1KFD A;  4ZCL A;  6AT1 B;  1O51 A;  3O3L A;  2ZD1 A;  5L46 A;  1RWU A;  2CQ4 A;  1ZOT A;  3MAH A;  3HVT A;  1HR0 J;  4OL8 A;  5KFE A;  4TYB A;  4RZR A;  1WOP A;  2DXE A;  4Q7A A;  5KFL A;  2J9C A;  4KIA A;  1OQ3 A;  2C3M A;  3JSM A;  1APS A;  3W2V A;  1RU2 A;  4M5H A;  3AOD A;  2KVI A;  1ICE B;  3NBP A;  1S1X B;  5KT7 A;  2H4Y B;  1KWM A;  1AB8 A;  3WC0 A;  2HMI A;  1FKP B;  3IAM 9;  3IBW A;  4C4W A;  4QW9 A;  1N8R T;  2DNH A;  3LW5 C;  4KSE B;  4DX8 H;  4ZDN A;  2IA0 A;  3D6T B;  2OMO A;  3ISN D;  2F9J A;  2QZ8 A;  3V81 B;  3IGN A;  5C42 B;  1HNZ J;  4M1K A;  1FES A;  1HD1 A;  2GJ2 A;  4ILM A;  3CCM S;  3PM9 A;  2YNG A;  3CO0 P;  1JJ2 R;  1NPK A;  3QSI A;  4DG1 B;  2YNI B;  3MF5 A;  1Y10 A;  5F0U A;  3MAA A;  4LMZ A;  4ECT A;  1YRT A;  3HPO A;  1U1L A;  5HSP A;  3BGR B;  4NX9 A;  5ETM A;  2BKN A;  4YS2 A;  5E3P A;  2AMC B;  5MAO A;  2VIC A;  2VZ9 A;  3M2U A;  1LWE B;  3ITH B;  3HD2 A;  4N8N A;  3IR7 B;  5HP1 B;  2DNP A;  2VOD A;  2ERR A;  2QFI A;  1X5O A;  2NCK L;  4NEY A;  4CWB A;  1KBR A;  5KFN A;  2A18 A;  2V9K A;  4WE1 B;  1FJG F;  4CO0 A;  3N5B A;  5L9X A;  5D0E A;  1KVI A;  2CG8 A;  5I42 A;  4U96 A;  2W2N P;  2RRN A;  1OYE A;  1KS2 A;  2IIH A;  3PX0 A;  2X7I A;  5KFX A;  2IJF A;  4D3H A;  3NP5 A;  3VAL A;  2H5J B;  3I96 A;  3F56 A;  1MN9 A;  2YH0 A;  4OI2 A;  3M30 A;  1TV6 B;  2MEW A;  2NPI A;  2DNY A;  4NZ6 A;  5LSL A;  3DOK B;  4I0W A;  1AA1 B;  1XEZ A;  5A2Q U;  3I55 S;  4QIE A;  4UZB A;  3ZZR A;  1C2P A;  2BAN A;  2AKW B;  5IT0 A;  2F8M A;  3CJ3 A;  2HWT A;  1Q81 T;  4LRA A;  1B0P A;  4FF2 A;  3VR1 A;  5KFY A;  5FJ4 A;  3RRH A;  5T41 A;  4YB7 A;  2P9G A;  1RT3 B;  1NM2 A;  2I6W A;  1NB7 A;  3OR2 A;  2QMX A;  4KT0 C;  3ETM A;  4PUO A;  5F8I A;  1R8A A;  4DBQ A;  1LK5 A;  1OPZ A;  1Y5N B;  2IM2 A;  1S1V B;  4ZVH A;  2A2C A;  3U1L A;  4J91 A;  2Q79 A;  1IJE B;  1RT4 A;  4CRJ A;  3E2E A;  1WDT A;  2KI2 A;  3RR7 A;  1GX5 A;  3K7R A;  5IOL A;  3KLI A;  2CNN B;  4DX7 A;  3BKT A;  3BB5 A;  4I4B A;  1RBL A;  4PRF A;  1N33 F;  3MEC B;  4K8R A;  3PYF A;  2G2Y A;  5B0C A;  2ZBI A;  3BYR A;  3D67 A;  3W63 A;  3DGV A;  3RU0 A;  1AFJ A;  3BYP A;  4NML A;  3NNH A;  3K5N A;  2UUA F;  4C8Y A;  1REG X;  4C11 A;  1RAC B;  4DV4 J;  4I68 A;  3QJP A;  1E6Y A;  3KK1 A;  5HN0 A;  2JEF A;  3EZO A;  5DDO C;  3HO1 A;  5KFO A;  2BW7 A;  1U1M A;  3PR4 A;  3N28 A;  3OFH A;  1XTZ A;  2M70 A;  2V94 A;  2V8P A;  3UVJ B;  4I2Q A;  1M0S A;  4B3T F;  1C1B A;  8AT1 B;  4F67 A;  3KLH A;  2HNY A;  2BBE A;  4G1Q A;  1H0H B;  3C46 A;  1RKI A;  2HIY A;  2WSC C;  1CUL A;  2PDA A;  4U9R A;  1REV B;  4ZCM A;  3CCW A;  2GIF A;  2A1B A;  2PMH A;  3F0N A;  4BWJ A;  5JVG Q;  1JXL A;  4P10 A;  4C8O A;  2XS5 A;  4LR9 A;  4IRC A;  1HR0 F;  3IS9 A;  2JNJ A;  2FJD B;  4NCB A;  3EDR B;  1OMS A;  4TN2 A;  4ED5 A;  1S6U A;  1FCA A;  3KHG A;  3TAR A;  4C0B A;  2NXN A;  2COL A;  4ID5 B;  4XK8 C;  1KC8 T;  2OPS A;  1SH3 A;  1MMN A;  2HZC A;  4F2S A;  4KHM A;  1F3F A;  1SB6 A;  1HPZ A;  3FKB A;  4AL5 A;  4PZV A;  2VFR A;  5I3U B;  3NLC A;  3I9V 9;  1HNZ F;  2MMY A;  1X9S A;  1N5T A;  2QO3 A;  3SSS A;  1RWW B;  2C2Z B;  3J7Y I;  2V8H A;  3W2W A;  3NNA A;  2G0J A;  1XNR J;  5HMY A;  1NND A;  1BUX A;  1BWE A;  2CG4 A;  3UD3 P;  3PX6 A;  1Y0H A;  3MOZ A;  2P9C A;  3D1H A;  2DRD A;  2FHM A;  2AT1 B;  5KT2 A;  1CQN A;  3A1Y G;  2G0C A;  1K0V A;  1PC4 A;  5G0R A;  3H5X A;  2OSR A;  5CXT A;  1YJV A;  3QO9 B;  3SFG A;  4FYD A;  2ZH3 A;  1PBU A;  1U0H B;  2Y1I A;  3R5G A;  5A8W B;  2RUS A;  4IH7 A;  2V2Z A;  1KQK A;  2VHG A;  3D6M B;  3DLJ A;  5KFV A;  1GMV A;  2AV5 A;  2ZDP A;  2UXD J;  3EWG A;  3KMQ A;  2DGU A;  1U09 A;  3EGN A;  3PDN A;  1J27 A;  1VFJ A;  5B08 A;  3EXY A;  3MPV A;  2J7U A;  4RNM A;  4ECW A;  4DSI A;  4C48 A;  2VPY B;  3B82 A;  2OKQ A;  1TUV A;  1RHR B;  2F8E X;  1OS5 A;  3CUL A;  3PO5 A;  2LEP A;  1U47 A;  1H7W A;  4B3R F;  4ES3 A;  1DTT B;  3FFI A;  2VC0 A;  1CC7 A;  4WFZ A;  3UW1 A;  2B9E A;  3ONQ A;  5C25 A;  3A8K A;  3QAT A;  5U47 A;  3OJU A;  1Q0N A;  2BVZ A;  2XS2 A;  2W9B B;  4OHX A;  4TVA B;  4NL5 A;  4Z37 A;  4FBT A;  3Q8S B;  2CQD A;  4DR3 J;  4Q43 A;  1X4A A;  4NLQ A;  2I38 A;  2ZWP A;  4C2M A;  3KLE A;  3T41 A;  1I6J A;  1X4G A;  1Q16 B;  3MMC A;  4CM0 A;  1F9H A;  2HS4 A;  5T7L B;  3UCG A;  3CJ8 A;  2F8H A;  1JJC B;  1JNR B;  3D6F B;  5E7O B;  1UVN A;  5DZ7 A;  3SEO A;  5DJB A;  2PO4 A;  3VQT A;  2CVI A;  1HKA A;  2GVD A;  4O3O A;  4ECR A;  3GV8 B;  4YB6 A;  2BJ9 A;  4DUZ J;  3M9O B;  4DR5 J;  1IVZ A;  2RKI A;  4GC6 A;  4RUB A;  3FJ2 A;  2LKZ A;  3CMQ A;  1SJQ A;  3IXQ A;  3SQG B;  2CAJ A;  4X62 J;  2CPI A;  1NH8 A;  1CJT A;  4PYA A;  3IBF B;  2K1R A;  3CCS S;  3NOC A;  1KR4 A;  5B0B A;  3JQJ A;  4RUA A;  3UO0 A;  3KJN B;  2F63 A;  4YR0 A;  4DS4 A;  3DRR B;  4JI2 J;  2P5V A;  4DV4 F;  1QUP A;  1NK4 A;  2VFV A;  3FCV A;  1KVJ A;  4JYA F;  2HK2 A;  2A6M A;  3FC9 A;  2WVF A;  3VGT A;  4J9U E;  3PW7 A;  4OZN A;  1WKK A;  1T9V A;  1TR0 A;  3HLU A;  1LW0 A;  3MAQ A;  1U1Q A;  1JB0 C;  1NHU A;  4X65 J;  3U02 A;  2ASD A;  2NSC A;  2JOQ A;  1K1S A;  4P6Q A;  2R7V A;  4G1P A;  3VCD A;  4ECU A;  1K44 A;  2DGT A;  2WW8 A;  4LRE A;  4WWS A;  4K5S A;  5J1E B;  2OJ3 A;  4C8N A;  4FF1 A;  4U7U K;  1HMV A;  4J9M A;  4HHH A;  2XWY A;  4Z2X A;  1SUQ A;  2HGM A;  1EP4 A;  2LQJ A;  3K5P A;  4ID8 A;  2RDD A;  3LGN A;  4ANC A;  2QSF A;  3R7S B;  2D41 A;  4I7F A;  4LSN A;  4DV0 F;  4NA3 A;  4ZPC A;  2GVZ A;  3N5F A;  3V2U C;  5IV3 A;  4QW8 A;  2N4C A;  1P27 B;  3DXS X;  3FEZ A;  5CQG A;  3DHW C;  3SFU A;  1H72 C;  1TKT B;  2YTC A;  4ED4 A;  2NSB A;  2HHP A;  1DAR A;  1AZS B;  2DIT A;  3CME S;  3R97 A;  5KOX A;  2AEM A;  3AH6 A;  2OPP A;  1U26 A;  1N5V A;  1W2B R;  1NUE A;  3ADA C;  1RT7 A;  4A8O A;  4IOA Q;  1NRK A;  4X4U A;  1VYA A;  5K8N A;  2YWK A;  1HNW F;  4M5N A;  2D7S A;  3QGH A;  2DPJ A;  3ELH A;  1QD1 A;  1DTQ A;  5L1L A;  1VR6 A;  5CYM A;  4EYI B;  4CLL A;  2FHO B;  3MED A;  4RBU A;  1CEZ A;  1WOO A;  4PWD A;  1RTJ A;  1P1L A;  1KQS R;  3UNG C;  3SIP B;  4WCE Q;  4DHV A;  2JJ4 D;  1QDU B;  2RQC A;  3R5D A;  2RD5 C;  4LQ3 A;  1FX4 A;  3GU0 A;  2BMB A;  3L3C A;  4MK9 A;  4B3S J;  5D4O A;  4DCJ B;  4Q5V A;  5F8N A;  1BHN A;  2E1A A;  3OL6 A;  3CJ5 A;  2I0X A;  4JI7 J;  4FBU A;  2UZA A;  3WHI A;  3HHL D;  3K5L A;  2VDI A;  4IUF A;  1RCO B;  5DQH A;  2WON A;  4OHY A;  4ED6 A;  2AEF A;  2EK1 A;  1JLC A;  1NSQ A;  1EET B;  4C6A A;  3G6X A;  3T1H J;  2XMW A;  4CYU B;  1RT6 A;  2BJE A;  5HJX A;  5D4P A;  2DNQ A;  4LSZ B;  1IXK A;  2QX0 A;  4GKK J;  3B4M A;  1IBK J;  3I56 S;  2XCP A;  4DR3 F;  1N4L A;  3M8Z A;  3CO9 A;  4P72 A;  3EVM A;  3HFV A;  1YJU A;  3N79 A;  1FX2 A;  3QPI A;  3A8I A;  5EX0 A;  3C15 A;  4WYL A;  3KK2 A;  2YNF B;  3EDQ B;  2LQ9 A;  1M5V C;  4NZ0 A;  1SKS A;  5JXS A;  3IWN C;  1MWZ A;  1T9W A;  3TA2 A;  2WB4 A;  1R0A A;  3ZTS A;  1WOR A;  4Q8F A;  3MCS A;  1S76 D;  3J7A N;  3G6E S;  1VIX A;  2OO4 A;  5A8K A;  1K47 A;  2IC3 B;  3KUH A;  5AXM A;  4X62 F;  2BZ2 A;  5I4M A;  3FK4 A;  3FEX B;  4ETZ A;  2VIH A;  4WKR A;  2BJ1 A;  3ULH A;  5D0G A;  4ZLN A;  3VF0 B;  3MM9 B;  1RDR A;  4DCO B;  4AMO A;  2NXE A;  3OSP A;  5CAA A;  4YN3 B;  2JFK A;  3AB2 B;  4WIQ A;  3PYE A;  4ZLP A;  4WXW A;  1NDP A;  2VJU A;  2MXY A;  4KO0 B;  2D74 B;  4JP8 A;  4KV8 A;  5KFB A;  5DDQ C;  1BQM A;  1RAH B;  1QE1 A;  1H73 A;  3CJQ A;  4DPU A;  1UW4 A;  1LFP A;  2YH1 A;  1Q82 T;  5KFI A;  4RO0 A;  3GE9 A;  3M30 B;  1WJ9 A;  5KG5 A;  2MZR A;  2K2P A;  1K73 T;  1UCN A;  2E9Z A;  3FBC A;  3AOB A;  3IM9 A;  1VRU A;  5DGB A;  1T3N A;  1RT1 B;  2RQM A;  2BJ7 A;  4RUH A;  4DSL A;  2B5J A;  3LUY A;  4WFY A;  1EQM A;  4F3M A;  3S01 A;  2WBR A;  3MM5 B;  3CUN A;  2DGQ A;  5A8R A;  5KFW A;  1ARO P;  4ZN3 A;  2B8Q A;  1S1W A;  5DG9 A;  3ZXW A;  4OYP A;  3LO3 A;  2XSJ B;  5E3R A;  1SH2 A;  3CJT A;  5EWG A;  2YQ1 A;  1VK8 A;  2IJN A;  1KN6 A;  4A8M P;  2B3T B;  3DKD A;  1FRJ A;  5J1P A;  5D3G A;  5KFT A;  1KQF B;  2GIR A;  1ZTW A;  2SXL A;  3THP A;  3TJ9 A;  3BO4 A;  2XTJ P;  1LEO A;  3PJW A;  4LBP A;  3T1Y J;  3UR3 C;  3JB9 k;  3WC2 A;  2GNK A;  2N4D A;  3NOG A;  4I6W A;  3BN7 A;  3DM2 A;  3Q8Q B;  4F0M A;  2ASJ A;  1OY8 A;  3BR8 A;  2MZ1 A;  3M8S A;  3IRW P;  2V0N A;  4NXN J;  3MMB B;  4ZP8 A;  1S7I A;  4K50 A;  4OHW A;  3QQC D;  2Z2M A;  1RK8 A;  5D0H A;  2R4F A;  2H54 B;  4JV1 A;  3DRX A;  1R31 A;  3LP0 A;  4DMZ A;  1N5Q A;  4F36 A;  3PAC A;  2DR8 A;  5E3Q A;  2K3I A;  1PIL A;  3QT6 A;  1RT2 B;  1SC3 B;  1TKD A;  1X0F A;  1R6Y A;  4RW8 A;  1X31 C;  2GO9 A;  2YKQ A;  4I2P A;  1G2E A;  5CH7 B;  4K2X A;  3DN9 A;  1JK9 B;  4YOE A;  3IS9 B;  2HHS A;  4B3S F;  2PMZ D;  1KHW A;  1FFW B;  1RUS A;  2GGP B;  1Q8B A;  3WBZ A;  4HHJ A;  1VQ9 S;  2KTQ A;  4ER8 A;  1A6L A;  1HBU B;  4WBF A;  2LA4 A;  5DDR C;  1L3S A;  2XMU A;  3P6Y C;  4KH1 B;  3RB3 A;  4LIR A;  3T1H F;  1IWG A;  3CD5 A;  2P8I A;  4DU7 A;  4L6V 3;  2YKN B;  3GYG A;  1ZBT A;  5C24 B;  4EO8 A;  4BC9 A;  5A76 A;  1FI4 A;  4GKK F;  1U49 A;  3I4P A;  3W5Y A;  1CG2 A;  2L9W A;  3S7R A;  2ADB A;  1VC6 A;  1Q78 A;  1OY9 A;  1U6Z A;  5DET A;  3VAG A;  2LVW A;  2BJ8 A;  3AD9 C;  4Z7C A;  5KFA A;  4EBE A;  3UDC A;  3A3P B;  3FUY A;  3DLK B;  3M7V A;  3SQO P;  1RAA B;  4DR6 F;  2XMM A;  3EPG A;  3KLF A;  1Q53 A;  3I5C A;  1QJH A;  3R5J B;  4MK7 A;  1RTI A;  4RR5 A;  4ED8 A;  1U02 A;  2PFF B;  1UWB A;  2LP4 A;  5L1J A; 
#chains in the Genus database with same CATH homology
 3SBM A;  2QJ3 A;  2G2Z A;  3TZX A;  2CUY A;  2QO3 A;  2G2O A;  2QC3 A;  4RL1 A;  2UV8 G;  3RGI A;  5DZ7 A;  3HJV A;  2VZ8 A;  2G1H A;  3PTW A;  2VZ9 A;  2VKZ G;  3TZZ A;  3R97 A;  1NM2 A;  2G2Y A;  3H0P A;  1MLA A;  3G87 A;  4RR5 A;  2H1Y A;  5DZ6 A;  3R8Y A;  3HMJ G;  5CZC A;  3HHD A;  3TQE A;  3BV8 A;  3TZW A;  2JFK A;  3EZO A;  2PFF B;  3K89 A;  4QBU A;  3TZY A;  3IM8 A;  2JFD A;  5CZD A;  3IM9 A;  2HG4 A;  3CJ8 A;  2C2N A;  3QAT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...