3IM8A

Crystal structure of mcat from streptococcus pneumoniae
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
305
structure length
305
Chain Sequence
b'KTAFLFAGQGAQYLGMGRDFYDQYPIVKETIDRASQVLGYDLRYLIDTEEDKLNQTRYTQPAILATSVAIYRLLQEKGYQPDMVAGLSLGEYSALVASGALDFEDAVALVAKRGAYMEEAAPADSGKMVAVLNTPVEVIEEACQKASELGVVTPANYNTPAQIVIAGEVVAVDRAVELLQEAGAKRLIPLKVSGPFHTSLLEPASQKLAETLAQVSFSDFTCPLVGNTEAAVMQKEDIAQLLTRQVKEPVRFYESIGVMQEAGISNFIEIGPGKVLSGFVKKIDQTAHLAHVEDQASLVALLEKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Malonyl acyl carrier protein transacylase
molecule tags Transferase
source organism Streptococcus pneumoniae
publication title New design platform for malonyl-CoA-acyl carrier protein transacylase
pubmed doi rcsb
total genus 109
structure length 305
sequence length 305
ec nomenclature ec 2.3.1.39: [Acyl-carrier-protein] S-malonyltransferase.
pdb deposition date 2009-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00698 Acyl_transf_1 Acyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.250 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Malonyl-CoA ACP transacylase, ACP-binding 3im8A02
3.40.366.10 Alpha Beta 3-Layer(aba) Sandwich Malonyl-Coenzyme A Acyl Carrier Protein; domain 2 Malonyl-Coenzyme A Acyl Carrier Protein, domain 2 3im8A01
3SBMA 3IM9A 2JFDA 3QATA 3TZWA 1NM2A 2G2YA 2VKZG 3BV8A 4RR5A 2C2NA 3CJ8A 5DZ7A 2CUYA 2VZ9A 2G1HA 4RL1A 3G87A 3HJVA 3EZOA 2JFKA 3PTWA 3IM8A 3R8YA 2QC3A 2UV8G 5CZCA 3HMJG 2VZ8A 5DZ6A 3K89A 2G2ZA 2H1YA 1MLAA 3TZXA 3TZZA 3TQEA 2PFFB 2G2OA 5CZDA 2QO3A 2QJ3A 3TZYA 3H0PA 3R97A 4QBUA 3RGIA 2HG4A 3HHDA
chains in the Genus database with same CATH superfamily
1S1TA 1TMJA 5GADU 4NCGB 1RT4B 3SIPB 3GSDA 4A8WA 4DG1A 3FQLA 2Y1LB 2YWHA 4YMEA 3HXMA 4MKYA 2QZ8A 3KLIA 3PZPA 4F26A 5IQ6A 4I2PB 1ZYQA 5KG4A 2BM1A 3BQ0A 1IBMF 3G6XA 1F0XA 3FCVA 2QFJA 1BXNA 2K3IA 5HP1B 1CC7A 1RAIB 4CO1A 4R5PB 3KLHB 1G4CA 2EFGA 1JKHA 2F8EX 5C24B 4YY3J 4FBUA 1YVFA 4W98A 2E1AA 1NKEA 3ZO7A 4WP3A 1SJQA 6FDRA 1KLMA 4TYBA 3GCXP 4JI7F 2H5EA 4C3LA 4DPYA 5KFVA 1YJ9S 2BRKA 1RT6B 2LXFA 5B0DA 2HIQA 2I9SA 3ZZUA 2X1GA 1J5OB 4DU8A 3M7VA 2J0QD 4J9OA 3V6DA 1NDCA 1RU2A 1AYEA 1FRJA 4LF7F 1JB0C 2IVFB 1NJXA 2VDHA 5CA5A 1VC0A 5LSRA 5C2GA 2RDDA 1FJGJ 3LAMA 4XAKA 2VG6A 2LKZA 5KT7A 2RDIA 1RBAA 3AA9A 3LPYA 4HI2A 5CQGA 1ULRA 2X7IA 3DRPB 3GPAA 1N5QA 4V1Ak 5I4MA 4DI6A 5EX3A 2YKMA 5LSOA 4FS1A 1S49A 3BPSP 2DNKA 2EKNA 1TKTB 1U2CA 2P9GA 4YS2A 2PI5A 4CYUA 4WKYA 4XTTA 1R89A 1W2IA 2B4PA 1IBMJ 3MEDB 3NGUA 3BR9A 4ZVQB 1WC1A 2B5JB 3T1HJ 4R0EA 4CLPA 2VICA 1YJUA 1GX5A 3G4SS 1VHFA 2CQ1A 3H2LA 4WFXA 5KG6A 1DFDA 2MHNA 1KEKA 2RMLA 2MLXA 3LW5C 4IG0B 4TXSA 3V4MA 2W9BB 2VJVA 4X64J 1KSPA 4BDPA 1HQUA 2YVSA 1Q8KA 4RUHA 5DZ7A 2G1HA 4RW6B 3HHLD 3Q0AA 1RWPB 3R6LB 2ERRA 1N33J 3HZEA 2GMHA 1IN0A 4USUA 1LKZA 4E98A 2RF2B 4DX6A 6FD1A 4AFFA 1OQ3A 5A0YA 2Z2LA 3D4JA 2QSWA 3AJ1A 2HYIB 4DWIA 2DHGA 2ZE2B 4DR6F 2QMXA 2WAQD 2MQQA 2XMVA 2GMLA 1P9QC 2GJFA 1RTHB 1YJWS 1MWYA 2C3OA 3M05A 3MUTP 5HBMA 2KVQE 3ZTRA 5LJ5Y 4DV6F 1SJ1A 2HQIA 2YY3A 2FC8A 1DJ0A 3RAMA 3TX8A 1BC6A 2I38A 4HDHA 5IQQA 2ASDA 2W7OA 1IWAA 2CG4A 1WG4A 3AD8C 5RUBA 4OYBA 2FJVA 1HL6A 4I69A 4UT4A 1NHKL 2QSFA 3H90A 1KQKA 1TK8A 5B08A 4ECZA 2GJIA 3CO0P 4PG6A 1TUWA 4F0MA 3ISNC 1IQTA 2BUNA 2V8PA 4NLVA 2ZE2A 3OLBA 3MR2A 4LVOP 3UD3P 3TA0A 1KHVA 1HBNB 3JYTB 5F8GA 1I94J 1NK7A 4FNIA 3IG1B 4ZK7M 1V3ZA 2FLOA 2YKNA 4IQMA 3PW5A 3K5NA 5H9EK 1JXLA 2UUCJ 7AT1B 3PY8A 1HBUB 2XTJP 4JUZA 3TQEA 1N32F 5GAHU 1JLAB 2HWIA 2EVZA 3DM2A 3D1OA 2BX6A 3DRRB 4KE5A 5J1PA 2B8QA 3CJ0A 1OY9A 2ZWPA 2ZOMA 1B0VA 3HVTA 3IS9B 3NOCA 2KM8C 1NKCA 2LP4A 4NLDA 1VJQA 4PYAA 1E6VB 2CJYB 2VQEJ 1K44A 4RBUA 2FIUA 4ZP9A 1UMJA 2VPXB 2JNJA 2OPPA 2BVZA 2EBEA 2V69A 1HPZB 1WKJA 2WB4A 1VK8A 1Y5LB 3D67A 3ILJA 3SCJE 4PWDA 3Q8QB 4OX9J 3M6UA 1EKRA 3NG8A 1HYSA 1RT2A 2YNHA 3MECB 2YX1A 2OTJS 4D3HA 4C6AA 3EZOA 2O5DA 1SJRA 3MCMA 5JVHQ 2KTQA 2HHSA 3CCWA 1TTHB 2UV8G 4ZLNA 2R2TA 1VQ4S 1RE1B 1RT5A 3E01A 4G1PA 4WPAA 2NSCA 2NYHA 4FYYB 4P75A 2FVSA 2UUBF 2GVDA 4FVMA 4OI0A 3A8KA 3D7SB 2YWKA 3HVTB 3R5CA 1LWCB 2F4VJ 5IXUA 2H51B 1WG5A 1RHMB 4WP8A 5IFMA 1JX4A 2ZH3A 4OYAA 3QQCD 3BDPA 5KFQA 3PW4A 3DHWC 4B08A 3KUEA 1QLNA 3VCDA 4IOAQ 3HD2A 1GMWD 2HK3A 3OV7A 4I56A 4K4TA 1GMUA 3NS5A 4OQJA 4RPFA 4ANEA 1PBUA 2DT9A 1ZAWA 1CG2A 3VF0B 5JVGQ 1T9VA 2F7VA 3W9JA 5LT5A 4DV2F 1AW0A 1ZPWX 3EVMA 1EKSA 4ZVHA 3BH6B 3TJ8A 5JJBA 2B9XA 1WC5A 3KK3B 1G7CB 3W2VA 3BGLA 3K8WA 2W2MP 2OFGX 3TANA 1NK0A 3T6JA 3CJ2A 3E8OA 5KFWA 2NZ4A 3AD7C 2GQ2A 3KG4A 4IYQA 1Z2ZA 2KB2A 4B3RF 3AOBA 2IRXA 2G2OA 3M9NB 4OLOA 3H42A 4URQU 3LAKA 5DDQC 1UAWA 4KQZA 4ZLJA 5SZTA 1ZETA 3K57A 4LUBA 3BO2A 1PC5A 2HBYB 2QN6B 1Q95G 2G2YA 2YWGA 1UKUA 3GV5B 2EFVA 1OSDA 4KKOB 1GX6A 1OYEA 2RQKA 1L3SA 2WVCA 4MIWA 4RO0A 4AT1B 4A8QA 1T3NA 2DH7A 1RKIA 2EFPA 3M8ZA 1FKPB 3ETOA 3HT0A 3GG1A 3SFUA 3QPIA 1S7IA 1SC6A 2YNFB 1N34F 4X62F 2G0JA 3B4MA 2XHWA 4U8YA 4IR9A 1RHQB 2XYPB 1C0UB 3FCHA 1Y11A 1YLXA 2WSFC 1D0EA 1CC8A 2LXIA 1FNMA 4Y0FA 3KUGA 1O8BA 3WX4A 2K8GA 3W5ZA 1M1GA 1RAJA 4ZLLA 1NZAA 4Q45A 1ZBTA 3CDUA 2ZDOA 2R2SA 2XSJB 2HRTA 3EM1A 1M5VC 2K2PA 3DOLB 2C2DA 4OL8A 4DHVA 5L8RC 2AQ4A 3BPDA 2A0FB 1LW2B 3BM7A 3OR2B 4X4PA 2XZDB 2J9EA 1N5YA 4L73A 3DKDA 2YPYA 3WQPA 1HI0P 4HKQA 3Q8PB 2V4RA 2KXNB 4NI2B 2MGZB 3CCLS 4WFNQ 1OWXA 5SUHA 4K5RA 4DV4F 2FYXA 5ETPA 5DG7A 5DETA 4LR7A 1XMQF 4ZN3A 2IMWP 4ZP7A 1JJHA 1XNQJ 2I5JA 2AEMA 2CIMA 4I64A 1SVDA 4YB6A 1DQ9A 4B17A 5DGBA 2A6OA 1LWXA 3IRXB 3I4HX 3LGNA 4FKXA 4N8OA 5CYQB 5KFRA 2AX0A 1NRKA 4C0OC 1NJZA 3IR7B 3H5UA 3HULA 4RW7B 3DOMB 3X3UA 4I1TA 3BJYA 4LREA 4GKJJ 4TU9A 1WDDA 1RAHB 4ZPCA 3CCQS 3RR7A 3TUJC 4FP9A 2R9LA 4I6WA 4KTQA 1HNWF 3GJSB 1R0AB 2CG8A 5HLFA 1NDLA 3H4DA 4C48A 2HW3A 2YKQA 1HNZJ 2DR5A 1EQ0A 2OPRB 1ACMB 4NOHA 3D28A 2PE8A 4NCGA 3W3SA 3DRRA 3TZXA 1S1VA 1YK9A 2AJ0A 2M8HA 1HBUA 4B3TJ 4ED5A 1VBZA 1KS2A 3F56A 1U0HA 1SIWB 1X4AA 2W9CB 4P72A 1PC4A 2C2OB 2LLZA 4OJ1A 4AYBD 4KFBB 2E44A 1PKUA 1J5EF 1HBNA 4PYDA 4TY8A 2W2PP 2EC2A 2FZKB 2AD9A 3R1HA 1B7YB 1JXEA 1JLBA 2LEPA 2YNIA 3M4XA 4M94A 4DR1F 2EG1A 5EHHA 2MDAA 1UEKA 4KR0B 5EWEA 2FUG9 1RTIB 2FHJA 2J7UA 1S48A 3H59A 3N9UC 3SSSA 4O4RA 2XGQA 1VFJA 3PJXA 1UVNA 3R5BA 4O44B 1UW4A 3JSMB 2IY5B 2FVCA 1H72C 1H6KX 3MXHP 5G4DA 1XMOJ 1A0OB 4OHZA 2V4JA 2R7UA 4WXOA 2CAJA 1LFWA 5K5MA 4H4MA 4OZ1A 4S0MA 3GIRA 2K1RB 1S4FA 3J7Z5 4WE1A 4ED3A 1S10A 5BYQA 2YPZA 3MEGA 4PUOA 1N56A 2DNQA 2DPIA 1G3OA 2GNKA 1B99A 3KLEB 2EPIA 1C1BB 4BBYA 5A0YB 5LMUJ 4K4XA 4HLBA 4PWUA 3JAMU 3OL7A 2H54B 3KTQA 1U1PA 1ZZFA 2A2CA 1RADB 3IAS9 4XK8C 5GMDA 3W9HA 1EIYB 3FEXB 2LDYA 2C2MB 1HNXJ 2ZEJA 2H4WB 3LOUA 1LWCA 2I1RA 3CMQA 4I2QA 4DR3J 4DFPA 2VDIA 2PN6A 4DPXA 3UN2A 4DZ6A 1NDKA 2YNGB 3BR8A 1L3KA 2KG0A 4QCLA 4X4OA 3L09A 3GIIA 1HNWJ 2OMLA 3VWSA 2ZM6J 1JWWA 2HK2A 4X66J 3MEKA 2H5IB 1I51B 5GAEI 3GR1A 2L08A 4LF6F 1Q53A 3ILLA 3IS9A 3W64A 4GKJF 3FSYA 1U47A 3TR5A 3I55S 4ECTA 2ACYA 1V5VA 2HS0A 3FBBA 1W25A 2HLUA 1VHIA 3BKTA 3EX7B 3T5KA 3HJFA 2UU9F 2CA9A 1HWJA 3M8PA 4Z7YA 3THVA 3FFIA 2O66A 3L7OA 1KQGB 3V5RA 1E6YA 1KOHA 1NNDA 1R31A 1TV6A 2E29A 1H38A 4K4SA 2J9DE 2DEJA 4NA3A 3Q22A 4RBVA 4F7VA 3G82B 4I4BA 4ETXA 5D15A 4O0IA 2W9CA 2IC3B 1SQGA 3MM7B 3U02A 1A7GE 4NL5A 3NEKA 5A8WA 1NMEB 3PW7A 2YKPA 3UVJA 1VC5A 4Q0BB 4PXDA 2ALYB 3MAHA 4RUCA 1V3SA 2C3UA 2ROEA 1YRUA 4U95A 1Q0NA 2VG7A 4ID8A 5D4NA 5HATA 4Q8EA 3K89A 5K8NA 4QIVA 1F9FA 4M5DA 2E1MC 5MAOA 4DN9A 4Y00A 3OUYB 1RHKB 3PG9A 3IFEA 3M8SA 1U1OA 4WZQA 2KRRA 1ICEB 2QO3A 3FKBA 1GAOA 4WU2A 5IWAJ 5F8NA 4LQ3A 5IM0B 1S1VB 4OI6A 2Z2ZA 2IM1A 4RW8B 1RK8A 1AROP 5DRKA 4YP3A 4P73A 1QSSA 2JZ5A 1LWEA 3JTOA 1T9TA 1VC6A 3CD6S 1SH0A 1KTVA 4CZCA 5IV4A 1CJTB 3KJVA 4QOTA 2ZH6A 1B4SA 1KNZA 4DF8A 1UZHA 2DGTA 3H2UB 4ZP8A 3TARA 2E9RX 4IKAA 1JLQA 2BM0A 2VFVA 4Y65A 3UCUP 1NK4A 4M8LA 1QUPA 1OO0B 3F41A 3OHAA 3U1NA 1N5SA 1K0TA 4UY8T 1VCTA 2UXDF 2MKKA 3S01A 2VA2A 2QLFB 4ZCLA 3CIZA 2OPSB 1HW8A 1HQUB 4P2SA 5BXIA 1FE0A 2QJ3A 2Q1LA 2RVJA 2QL9B 4C0BA 4CYUB 2BBEA 3IR5B 5AE2A 4ES1A 4FBTA 3NL0A 2IYGA 4UF4A 4ILRA 1FCAA 4OI4A 5GMKa 2KG1A 3IRXA 3KK3A 4DR2F 3P6YC 3MM6A 3MM6B 2ZKUA 3ICLA 4EBCA 4DLEA 3I4PA 1GQEA 5L46A 5CD4A 4LRCA 4MK9A 2XMTA 2LA6A 3KJNB 3VVUA 3SDEA 3HHEA 5ITHA 3IRWP 1NPPA 1S76D 3BGFA 4CH7A 4C0HA 4G65A 1XR6A 2IYIA 1QAXA 1X31C 2B8PA 2L9NA 4DV2J 4AQYJ 3HHLB 3NAIA 3WDOA 1KBRA 1Q8IA 2XNQA 3UD4P 1OQ6A 3E2EA 4B3OB 1WC6A 4ELVA 2FTRA 4P7VA 4OHVA 3TZZA 1N0VC 3GMGA 3KNGA 4EZ9A 5B0CA 1NK6A 5C5JA 4YUDA 1RDRA 4C8ZA 2M3DA 3IM9A 1YITS 1FJEB 1QAYA 2R2RA 2IM0A 1WTFA 4NLQA 2PIIA 2CNNB 4IH6A 1YRTA 1NK5A 1X0FA 4F3QA 1CJKB 1FTRA 2QYCA 2HHHJ 2UUBJ 4PKDB 1UFWA 1KWMA 1T9UA 3EDRB 4OYPA 3OTOF 1UFKA 3M6VA 2CVIA 2GVZA 2E9TA 1HD1A 3OVSA 1IUJA 3KLIB 2R8IA 2CPIA 1MROB 2QT7A 2JHEA 5HANA 2HFSA 2QC3A 1M1KT 1BWEA 2OSRA 2L3MA 5J1EA 4ZMMA 4QYZK 2OEMA 1XIQA 2G2ZA 2HQGA 5KFDA 4ECQA 2BJ1A 2J6UA 3LWLA 4DSIA 3OJUA 2HHWA 2FJAB 3MTKA 4Y2CA 1JK9B 5G0RA 4TYAA 3ZZYA 1YRXA 1FWPA 3UPFA 4B3MJ 1S6QB 3TAQA 1HWLA 2FQQB 5KAKA 2UZAA 3D54A 3RAXA 1VQNS 3PHTA 4KHRA 3KK2A 1N5TA 1X4EA 2FC9A 3OFHA 4Q2MA 1N32J 1RBOB 2VC0A 3R2CJ 3MZIA 2D7SA 2QMWA 3MAAA 1FRHA 4OYMA 3ZNUA 3M8PB 5HMWA 2I0XA 2XQCA 4DUZF 1IQZA 1UJ4A 2CJ9A 2MKHA 2PSZA 2XM3A 2Y0SD 3OTDA 3K5MA 1FWKA 2XBPA 3QNWB 4OYIA 1I3OB 3NGTA 2MZ1A 3DLHA 2EXUA 3ZZOA 2MYFA 2E5LJ 3C16B 3UI3A 2DNMA 1REVB 3RJMB 3C3LA 2XYHB 2QGFB 2BANB 1RT5B 3MMBB 3R3TA 4YB5A 3PRVA 2Y1JA 1HWUA 4DCPB 4J90A 2R7TA 1I6JA 2IJNA 4I2QB 5GADI 2ZC3A 4DV6J 2NQPA 2QFIA 3SQGB 4EEYA 5KFTA 4YB1P 1ZA1B 4NE9C 2A18A 2EW9A 4O3SA 2ZH5A 4DR6J 4NLWA 5HQ8A 1PYTA 1YJNS 2CJQA 2BKPA 2QMUB 4ZJLA 4ELUA 5IT9U 2W4PA 2HRUA 3CD5A 1OIAA 4QR1A 5LXRA 3T1YF 1GTEA 2GQCA 2MZJA 1TUGB 2BXJA 3NCRA 3TX0A 1P9YA 3BREA 3HSGA 4KGVB 3CCRS 3VALA 4DQPA 1N33F 3DRSA 1YWXA 3PJWA 3TOQA 3P45B 1T3OA 4IDKA 2ZFHA 3KWMA 5KG0A 4U7CA 3HVRA 5I3UA 3G6YA 4FVCA 4FXWA 3AOCA 2OPQB 2ILZA 1EHWA 1U1QA 5KFNA 2NXEA 5LMNF 5F3TA 5D3GB 3C46A 2FJWA 2CQCA 1DTTB 1GMWA 1Y9OA 2PMWA 3PFOA 4WK1A 1FKOA 4FYDA 3IG1A 1VQMS 5L1KA 4CLKA 3OJSA 4RUAA 4RR5A 2E1PA 2HGNA 2P6TA 2YKAA 4WK3A 3MTJA 2IPOB 2C2ZB 3M8WA 2MQOA 5J2PA 4USIA 2VL1A 3DGPB 3EDQB 3PYGA 2CFXA 5D4OA 3SMZA 4Y2MA 2NUUG 4LJMA 3CJKA 2C28A 3D0GE 3BKUA 2NPFA 1YBTA 2ZHAA 4KPYA 1TUVA 1T05A 4HH1A 1OY6A 3KLGA 3LF0A 4L6V3 1B0PA 2W2QP 4MK7A 5J1EB 1S5ZA 2DGXA 2FHKA 2OMOA 3CJQA 2Y8WA 4C4WA 2GHWA 1VS3A 3OFEA 2X1BA 2QA1A 5DLFA 4JI7J 4GKKJ 3L9ZA 3RB0A 2CADA 3P5TL 3ZC4A 4I68A 1RKJA 2U1AA 5KFHA 2BE7D 3HP6A 1U49A 3I0RB 1WF2A 4ID5B 1WHVA 4OMFG 4TLRA 3TVYA 1Y0HA 5LOQA 2JRSA 2MJNA 2J7KA 3RB6A 3G9CA 4DFKA 4AMMA 2KVIA 4CIOA 3KXDA 4RU2A 3ILOA 4U9RA 5B0FA 3KJQB 3VAKA 2MZSA 1FRKA 2OUGA 1NB2A 3PTWA 4ZPDA 2CJAA 1SL2A 4OV1A 4NLYA 1HI1A 1VBXA 3DXBA 2UUAJ 4KPCA 4A8MP 1VQSA 4G1QA 4Z37A 3M6XA 2VFUA 2XULA 2VG6B 1D09B 2Z2YB 1DZ5A 2UUAF 3ZZZA 3ADAC 3S1TA 3TEGA 1SV5A 5HAOA 3SDEB 1HHSA 1Z2LA 2JSXA 5M2UA 1Q5VA 2G9OA 3DDIA 2CZ4A 2G0CA 3AFGA 3FBFA 4FYWB 4USWA 1NHUA 2HMIB 1NUEA 2IRYA 4CH0S 4B3SJ 3NS6A 3A4TA 3TUIC 2AW0A 3ILIA 1U0SA 3HD1A 3CGIA 3I0SA 3BSAA 4IH7A 3GCWP 2MZTA 4P71A 4EFAC 4ZS6A 2HS4A 4AL7A 1XQIA 4DQQA 1X4DA 3OR1A 2M2BA 1S1WB 2VH7A 4CO0A 4FF1A 4GKKF 1U1MA 3PR5B 2ZBRA 3N0VA 3J80Y 1KDNA 3FMWA 2XMUA 4P74A 1CULB 2HKEA 4ECRA 2VZ8A 2GA7A 4DSLA 3VGUA 3NP5A 3H8YA 1UWBB 4B9SA 1WKKA 1MN9A 2FZCB 2GGPB 2IDEA 1JLQB 3RBZA 5K8MA 1FX2A 2HZVA 1S6UA 1ZOTA 2RIJA 1WC0A 2JC0A 4KGKA 1FNXH 1T03A 2M4MA 4M5IA 5KT5A 4KKOA 3CCVS 2D3OR 2HPUA 3TWZA 4NEYA 4CWBA 4J7CA 1IVZA 2GZOA 1AUDA 4JV5F 1DQ8A 1UP1A 1KLMB 1OSCA 3IO1A 4KBIA 5HVFA 4TQSA 2OKQA 1EJ7L 1JLCB 4DR5F 1SXLA 4RKUC 4EU0A 5GAHI 3K0JA 2WONA 1GEHA 3O1LA 1KKHA 4RL1A 3RZAA 3UR3C 3TI0A 1HMVB 2CQ3A 1QE1A 2PD1A 2V94A 2XMJA 4Q7AA 3I5CA 2DPJA 5KFYA 5LM7E 5E3PA 1IXKA 2W2OP 2BQUA 2VONA 1LK7A 3OXFA 4FXVA 5KFKA 4WIQA 1N48A 3DLBA 2AF6A 3PJ9A 1UA0A 2DNRA 1DTQA 3O3LA 4J9LA 1Z4UA 2VOPA 2Q6BA 4KSEB 2H4YB 2HS3A 2WBMA 6AT1B 4JI3J 2R7VA 5D0HA 3FDSA 5KFAA 3SCIE 3D6FB 3OBIA 4XIUA 2DNGA 4PQUA 3T1YJ 1RTDA 5KT6A 4L75A 4ICLA 4CLTA 3UO0A 3J7YU 3C14B 2CWXA 2HQFA 2WSCC 3ETMA 3MM7A 1FWLA 1QJHA 1P8GA 1WHXA 3CJ8A 3HFVA 2C2EA 1F2HA 1S79A 3AB4B 1HQEA 3DI6B 4LSNB 1AFJA 2DJWA 1P6TA 2BJEA 2KXHA 2RUGA 3TP2A 4AXJA 5H9FJ 1Q82T 5E7OB 1RLDA 3Q89A 3L4BC 3QT7A 3W60A 5I3UB 2GHVC 1HBMA 5AXNA 2M8DB 3LA0A 3U27A 1Q8LA 2AJQA 4J5OA 3V2UC 5FIIA 5JUMA 2QIFA 4FDFA 2UXBF 2VPZB 2HHVA 3CULA 3R6GB 5C25A 3OSNA 3G8QA 3T41A 2DR8A 1VQ7S 2MQLA 5T14A 3PHEA 4F2SA 3CDAA 5DG9A 3FFIB 4ANCA 3WIVA 1NJWA 3CD7A 4IFYB 2CQHA 4DUZJ 2I2YA 2POKA 5ETNA 3GLJA 1FERA 4FPIA 3VGSA 4DDFA 3H5YA 2AP6A 1XNRF 1BMQB 2CDRB 3A8JA 3FBEA 3PRDA 2X1AA 1C0TB 1ZTWA 5KFEA 4DOZA 3RRKA 2FGCA 2BEFA 3DCAA 1FDNA 3FQKA 2D9PA 3CDEA 3W5XA 1LNQA 3HMJG 4B3MF 1LWFA 2DXFA 3AHPA 2KO1A 4FYXB 3M32A 2CQ0A 2V4JB 3OXGA 2E7VA 4LF9F 3GILA 4C9DA 5ADZA 2PDAA 3QFHA 2MSTA 2Y1IA 4E0DA 2BOAA 4G1IA 4AMPA 1WJ9A 4WKRA 1RAFB 2K7JA 3VZHA 2YX4A 4U7UK 2DY9A 1F9HA 4GMKA 1S0NA 1HBMB 5IC4B 3THPA 2QLXA 5T41A 1RAOA 2P6SA 5HI7A 4BHQA 4QW8A 3EYZA 4DPUA 2R8JA 2XMWA 4X4TA 2BE2B 3MEEB 5IS2A 3UCZP 4DCJB 3VTIA 4LF4F 1X0PA 2LYVA 4NXNJ 2D3ZA 5F9NA 4HH0A 2DNYA 2CNKB 2VF3A 1RAAB 4H4MB 5K8PA 2BV3A 1TKDA 5A6WA 5C42A 2XY5A 3W1YC 4ICLB 1CJVB 2DNZA 3KHRA 5DQHA 2DNNA 1WD6A 2B6AA 2B6AB 4KJIA 1K8AT 2QA4S 4DR7J 1WOPA 3A3NB 2MHEA 3TA2A 1RT7A 4YR0A 2GIRA 1DTTA 3C19A 2J0SD 3ENQA 4XPEA 4N7TA 4DFJA 1RWMB 1F5BA 4AQYF 3MGJA 3OL9A 4OZ3A 5LJ3Y 1WELA 2YQ1A 1FX4A 1T11A 2OPRA 2ZC4A 2F8HA 3CWJA 3EGWB 4HTIA 4A8YA 5F8HA 2FVPA 1BD6A 2R7XA 1SC1B 2FLLA 5CYQA 5D0EA 5U47A 2GW8A 3M30A 2XYGB 2BR0A 4FF2A 3RAQA 3GZ7A 2XO6A 2BDPA 1AB8A 2Z56B 4O4GB 4ZN1A 4LR9A 5KG3A 2P5VA 3ZZ0A 4G3IA 3O8WA 1UW9A 3VAHA 5JXSA 3LWMA 3A3PB 4HTJA 2D41A 3BZQA 2HBRB 1R7IA 3LQVA 3NAHA 4I6YA 3DDNA 3W8PA 1N5YB 4JI2J 5EN1A 3V4IB 2RNEA 4NLGA 2B7CB 3BO4A 2DIVA 3HVAA 4IG0A 4PXCA 4RWXA 4JV0A 3UDCA 5F9LA 2FJXA 3L7PA 3QJLA 3PR4A 4P2MA 2UVVA 2X1FA 2J5AA 1AZSA 1TFWA 3NLCA 1RYRA 1J5OA 4FXDA 4AUKA 3O2IA 2VG5B 5B09A 4LRAA 4EGLA 3T5JA 2DYAA 3LGHA 3DOKA 1QTNB 4L74A 2DD8S 3JSBA 4KYZA 4LRBA 4TQRA 1PAUB 1RTIA 3IC1A 4USTA 3FEZA 5IWAF 4OI2A 3R8YA 4RNMA 4EBEA 1TL3B 2MKYA 4QYRA 2FJDB 4JI5J 3KOAA 3QJJA 4WFBQ 1NK9A 4ILMA 5A8RA 3SCLE 3CC2S 3HKWA 3BBBA 3QGPA 3C15B 1VQLS 3AH6A 1WEZA 4O23A 4ECVA 4CRJA 3CVKA 1G2EA 4A47A 4CLLA 2OPSA 2ASYA 4EYIB 1PJ5A 1UA1A 1R43A 2N4DA 2RAQA 3V6HA 3FJ2A 3WC0A 1VI7A 1YHQS 2MLYA 3KLFA 3FMBA 1KVJA 1VRUA 4CNZA 4URGA 2KHCA 2HAFA 2OELA 3EGNA 3HF5A 2MQ8A 4J9MA 2B56A 4RW9B 5HJXA 1KC8T 1MROA 4C3MA 1MMNA 1MU2B 3T5LA 4HHUA 1DTQB 1XERA 1FT8A 1S12A 2OEKA 2MPUA 4Z7CA 1KFSA 2QG9B 3JTNA 3HHLC 5HMXA 4Y2KA 1EETA 3S8SA 1T9WA 4QIEA 4J37A 5CABA 4Y2AA 1F9EB 3H25A 4LF6J 2M7SA 4ED0A 4RNNA 3MAQA 1QTMA 1U8WA 4H54A 3K5LA 1LEOA 3SQOP 3I32A 2AX1A 2XMKA 3H5SA 3K17A 3RBDA 3KHLA 2CRLA 4LF2A 1TL7A 3GFHA 3P8BB 4P10A 2V68A 5DGAA 3R7NB 2V9WA 3NNHA 4NLPA 4USJC 2HNDA 2Y1RI 3CJTA 5CAAA 4ZITA 4ZVOB 4Q8FA 1CULA 2ASLA 1TV6B 1V6HA 3DRYA 1SKSA 1U6BA 1UJ6A 3I31A 5KTQA 2VBZA 1HNXF 3BSCA 1O5JA 4CI0B 4IO9Q 3RB4A 2IRUA 5HQLA 1XN9A 1Y3KA 4M5KA 4DSJA 3MCSA 2GX8A 2FGOA 2BKOA 1RCXB 1RWUA 3MD3A 3GV8B 3C2PA 2D9OA 2LEBA 4FN5A 1VQKS 1P1TA 2EFQA 2VG5A 5B0BA 1ITPA 3AB2B 3P3DA 1PIEA 1FJ7A 3NWRA 2B9YA 2RB7A 3PM9A 2F3JA 3DC2A 3NBPB 1FD2A 4H4OB 4J9SA 1RWWB 1UVIA 1GTHA 1WUUA 1FKAF 1ZH5A 1RT2B 2XS7A 5A8KA 4OZJA 5D3GA 2GVDB 1S9EB 1TELA 1NU4A 2M0GB 5I3QA 3BF4A 2XCPA 2E9ZA 1FVQA 3E01B 2FZGB 1IR0A 3G6VA 5GAGI 2YNGA 3M9OB 1N52B 2FVQA 3MMCA 4XDDA 3M8RA 1HYSB 3MEGB 4I0WA 4LIWA 4WFZA 4Y3CA 3G6ES 2V2QA 4F8RA 4F3MA 4PUOB 1AUSL 2E7WA 3QO9A 4X4QA 3MFIA 3KJVB 2BJ8A 3NXZA 2YX7A 5CCMA 1MN7A 3A12A 2CPJA 3K7RA 3N4WA 2XG8A 4DV1J 2VD3A 1IJEB 2V67A 3RB3A 2F5GA 3HFZB 2ZBIA 4O4GA 1F60B 3EZUA 3MR7A 4MKAA 3AQOA 3WBZA 4ZCMA 3T5HA 4AMOA 4PG4A 1S9FA 4M63A 3FSIA 2VOOA 2DHHA 4NZ6A 2CKWA 3T1AA 1HLWA 4LQ9A 3RRHA 1IBKJ 3NMRA 3CT9A 2J8SA 4OX8A 1OS5A 1D9FA 5EDWA 1T02A 4PG7A 1DAXA 5F8MA 3M8YA 3PW2A 4LFCF 2XWYA 5B0GA 2RU9A 3DLGB 2EBGA 1BUXA 2ROGA 4WFAQ 3R2DJ 3VAMA 3WX8A 1JLEB 2LQ8A 3A1YG 1SQFA 2GO8A 4QU6A 1Z1ZA 4DL5A 4B9UA 2QYGA 1UJ5A 5A6PA 4F4YA 5F0WA 3TUZC 2VQFF 5C7PA 4ZPAA 1C2PA 4DV4J 3U1LA 4OV6A 1WOOA 1FHTA 4ECYA 1IJFB 1VQYA 2RHSB 2Y8YA 1HNIB 2B4OA 4F67A 2V2ZA 1F3VA 1X5OA 2R4FA 1C0TA 3DU5A 3KFWX 3KHGA 1NXIA 2C3YA 4EYHB 2DRDA 5JMNA 2H5JB 2XEXA 4IRKA 3QFWA 3QMQA 2ZH2A 4LFBJ 2W25A 2RRNA 2VBYA 5J1NA 4K7QA 4CT9A 1DARA 4IFYA 5DDPC 4AL6A 2HVZA 1RT3B 3OT9A 5T7LB 5KFCA 1HBOA 2WONB 1UZDA 2I5JB 2C2NA 3MUMP 1U48A 3I87A 4DL7A 1VBKA 2CUYA 2VBXA 2E5IA 1U1KA 2QA4G 4DV7F 3LH2S 2B51A 4PR6A 5L9NA 3RU0A 1FFGB 1SJ3P 2PA8D 5ETOA 3K5OA 2RJZA 3TJAA 5IT0A 1IKVA 1C1CA 2DNHA 1XJWB 3ZFVA 3BQ1A 1RTJA 3OFFA 5CZCA 3W2WA 2UUCF 3DRPA 3RW7A 4DXLA 1V5IB 4P6QA 3QLHA 2B9EA 4ED6A 1REGX 4AMNA 4OJGA 3HM9A 1Y4ZB 2FY8A 2IDLA 1IKWA 2YWEA 1SJFA 2IBKA 2UVRA 4DR4F 3UDEA 2GGPA 3JAMY 2V6AA 2XLJA 2JEGA 3A13A 4DQRA 5J2QB 1PCAA 5KT3A 3EJMA 4PG5A 5D4PA 2L9WA 3CJSA 4YHHJ 2OP5A 2LVWA 5GAGU 2W7AA 4ZVEA 2GQQA 2DR6A 3S6EA 1S9EA 2DKOB 2RH3A 2NYIA 2WRMA 4DPOA 3J7A1 4JV5J 5HO4A 2DHXA 2PFFB 4F04B 1WC4A 3MFHA 1Y7PA 3U1MA 3WZ0A 2KXFA 1TKTA 3VQSA 2ATCB 2A1BA 4MFBA 1WWHA 3CCSS 3T19A 1ZAVA 1H2UX 4IG3B 5MLCV 2ZJQQ 3V6DB 4RLEA 2VPWB 3AAWB 4LFAF 2N4CA 2RILA 4USVA 2SXLA 1T9YA 2ZZTA 1G6BA 3D3BJ 1RCOB 5LL6d 5HJYA 1NSAA 1NLKL 3I5AA 1EP4A 2AEJA 4CM0A 2AKWB 4ZIVA 1XR5A 5KFJA 1EQMA 2HHPA 2BJ3A 1HKAA 1RA6A 4DV0F 5ETLA 2J8AA 3HSZA 4JI6F 1WORA 4OX6A 5HK4A 4ELTA 3GYGA 5DJBA 2FDNA 2VFTA 5HP1A 2QV6A 3QZ7A 3R7SB 1CJUA 1U1NA 3GG0A 1IKYB 4Q5VA 3D2WA 2CQGA 4R0JA 4FPRA 4DX7A 4JI4F 2BACA 1H74A 4KHPJ 2E5LF 3ELHA 1EP4B 3IBFB 3I9ZA 2GIFA 2DNPA 2PA3A 2F4VF 3LP0B 1N8RT 3QIPB 4OJHA 3Q8VA 1RWNB 1NB7A 5CD4H 2RSQA 4KB7A 3ZTSA 3ZZPA 8ATCB 3QAUA 1H0HB 4OFZA 1FXDA 4RNFA 1HARA 1X5SA 4RW9A 1IKYA 1Q78A 3FVYA 3KKFA 3UFCX 1YBUA 5DDOC 1VYAA 4ZHRB 4I67A 3SBMA 2R8KA 2YKMB 4OX9F 2FY1A 4KH0B 1M5HA 4DLGA 1EB0A 3F44A 3P4UB 4KGMA 1U4BA 2MQPA 3QBCA 2W24A 1S0OA 2OEJA 4Q0BA 3NGSA 3PDNA 2EG2A 1EARA 3L7UA 2BOPA 4NLUA 2VQEF 1SKWA 2G4BA 5LXYA 5J2QA 3W8GA 1RABB 9ATCB 3CPWR 5HVGA 2IJFA 4DL2A 1N5VA 1MG7A 2KYXA 3BGRA 3ENAA 5H9FK 4EUVA 2ZNYA 2O67A 2E7XA 1RJJA 3LPEA 3SSRA 2VC1A 4M95A 3OTOJ 3A8IA 2APOA 4WTYA 3SEOA 1RTJB 3UN5A 5DQGA 4X4NA 1IKVB 2GAHC 3AT1B 5KFMA 4EBDA 1LV5A 3AXKA 2QX0A 5FDLB 5LSLA 1I94F 1YZ7A 2YNHB 3MECA 2V8VA 2N82B 1RB0A 2CQPA 5J2NB 4J9NA 3QLHB 2F9JA 4HHJA 1F3FA 2HEKA 3EVWA 1A6LA 3RYLA 2ZZNA 4JI4J 3QIPA 5KG2A 4C8YA 4KHPF 1TAQA 1RT1B 3VGTA 5HROB 4K4WA 3I0RA 1Q7LB 3GJQB 3LANA 4YFUA 2B7BB 1Q86T 1WI6A 2HWTA 3MM8A 5E3AA 1SBRA 1S1XA 5HVHA 5H1SV 5BR8F 2XWXA 4QWBA 1IKXB 1B70B 2ADBA 3QGHA 3GQCA 4DV5J 2AYBA 2HNZA 4FYVB 3R1LA 3OW2R 1N4LA 4JI6J 5DM6Q 1L3TA 2DRAA 1TP7A 4G6VB 1NDPA 3D0HE 1CJUB 2DCUB 4OZNA 1AT1B 2BZ2A 3QWPA 3W9IA 4DV0J 4C11B 2J6SA 2CJXB 3PYFA 1RP5A 4O3QA 3JSYA 4F0HA 3G8SA 2HWHA 3Q8UA 1GT8A 3CCZA 3GE9A 4IO1A 5DDRC 4DX8H 2ADCA 4TKTA 3HDSA 4BWMA 4IFVA 5KFFA 4GO5X 3CC4S 4LFAJ 4BS2A 1S7HA 3H5XA 4OHYA 3JYTA 2IMOA 3CDWA 2R8GA 1WHYA 4F4XA 2E5GA 2LU1A 2V34A 3W2VB 2R2UA 3GJRB 1WDTA 4PXEA 3MWBA 4O3NA 4WYWA 4LBHA 5M2PA 1FDAA 2UXDJ 2HHQA 2P9CA 4X2BA 5B0AA 1HNIA 2CYYA 3T9ZA 4ZPWR 4DMZA 2IC3A 4YHHF 3T1HF 4U8VA 1S9GA 3N6MA 1RYSA 2OD6A 3PYEA 3VZIA 3HSDA 4MYUA 4XDCA 2BQ3A 4BWJA 1S99A 3Q86A 2JEJA 2XS2A 2CPXA 3LUYA 4C98A 1VQ6S 2ZUGA 1RWOB 3M32B 1JLFA 3KK1B 4HYKA 3DLKB 4AD6A 5DLGA 1JJ4A 1P1LA 2JEFA 3BYPA 3GYXB 2ZKTA 4MIBA 4NASA 4WCEQ 5BYRA 1BQNB 3VAJA 2WW4A 4QWCA 3DLGA 2G13A 5GVQA 1X4BA 3L95X 3RGIA 4C11A 4DN0A 1FJGF 1KP6A 1LW0A 1W7WA 2W9BA 4DV7J 1B3TA 1FFWB 3MD1A 1ZAXA 2DY1A 4KO0B 3W2WB 2XLKA 2Y9HA 4X4SA 4ED4A 1ZA2B 1JNZB 4L3NA 1WTBA 2XLIA 3QSYB 1D8YA 2OFHX 4H4KA 4KV8A 1FXLA 3B82A 5E5NA 2XO7A 4ER8A 5J2NA 2YH1A 4LFBF 2OPQA 3PKYA 3HJVA 4NZ0A 3NGDA 4ECWA 4DL4A 4ETZA 1U25A 2E1RA 2DO4A 2GJ2A 5K9FA 2R7WA 1KQFB 5HROA 4OX7A 3AY0A 2BKNA 4K2XA 4M5GA 4QWEA 3MHYA 2HFNA 3BDEA 3C6UB 1VQ9S 5FLXY 3MM9A 2KI2A 2YQ3A 4Y6IA 3V6KA 4ZJQA 1CVJA 5B0EA 2N7YA 4GC6A 2UU9J 2UXCF 2XMMA 3HHLA 1KRPA 3FNNA 4AE5A 4NPOA 3SV3A 3KLEA 1FDBA 1TKZB 2ZVSA 4NA2A 3UDLA 4ZLPA 4ZHRA 3JQKA 4LFCJ 1KVKA 4UOHA 1AFIA 4WIIA 1PYSB 4X66F 2Y3YA 5KFOA 1EAYC 3QRQA 3MOJB 4UQGA 2J7WA 1HNVA 3D1QA 4TVAB 4C3KA 1SC4B 3V6JA 4RW4A 2AJ2A 4R5PA 3WC2A 3NNAA 2WK4A 4DR3F 1HHQA 2MMYA 3J7ZT 1FK9A 7FDRA 2ZHBA 1HWKA 1EZZB 1XR7A 5AJ3J 4Q43A 3N01A 5KFPA 1HMVA 3RW6A 3OFGA 4TNOA 2A6MA 2KYZA 3MPYA 2JC1A 4Y34A 5ETVA 3TVKA 1ZPVA 1YTYA 1SH3A 2OGUA 5L1IA 2DR7A 3H0PA 3MAAB 5LMUF 4B9LA 4F2RA 2ROPA 5K14A 3CMES 1UL3A 2AYEA 3OTEA 3KLVA 3DMJB 4MTPA 4TY8B 1J27A 2CXEA 3GJTB 2KZMA 3CW2C 3LTOA 3Q8SB 4ECUA 1S6QA 1JJCB 2BRLA 2K06A 2EFNA 2ZBPA 4K4UA 1NO8A 2DGSA 2EEYA 2U2FA 4M5LA 3PXGa 2LXUA 2YKOA 1XMOF 1T03B 4UOCA 2HVIA 1UVJA 2Z4PA 2KZZA 1VGYA 1PAEX 2NSBA 3MM8B 3UNYA 4OYZA 5CXTA 4A8SA 5EGYA 1SCJB 1L5UA 1PJ6A 3HKZD 4DSKA 1HA1A 1SKRA 5HLFB 2QTWA 1S6PA 1XMBA 4DU7A 1LQ9A 2FHJD 2E5HA 3JQMA 3M8QA 1L3VA 2QEXS 1D1UA 4MFBB 1FI4A 3VV2B 2MKSA 2YWFA 1UWAA 2HG4A 4OZ5A 4EO8A 2RS2A 2X51A 1VRUB 4PRFA 3HHKA 5E33A 3C6TB 2XCAA 3HT3A 2VJUA 1NM2A 2VKZG 2KRBA 1K1SA 2E66A 2RRBA 3HLUA 3MMAA 2COLA 4AXIA 2L9DA 4LF8J 5A2QY 3KMQA 1IKWB 1N6QA 1WOSA 1V3RA 3DXSX 4TN2A 3D9BA 3BSNA 4ED8A 3CJ5A 4LRFA 4PABA 1GXLA 1JLGA 2O01C 2YQ0A 3EGVA 3IBCB 5AE1A 4X4RA 4QW9A 1PG5B 2CQ4A 1R27B 1PO6A 3IWNC 1TQLA 4YDXA 4ZIWA 3CF5Q 1NPKA 4RNOA 1TL7B 4CLUA 2AT1B 1AA1B 1CBKA 2BMBA 3HX9A 2PMZD 1KOOA 1QY7A 3FEYB 1WSRA 4CM2A 2NXJA 5E41A 3OVAA 2Q6CA 2OI2A 3F73A 5CYMA 4BLGA 1XNQF 5ETTA 4CLYA 1VQOS 1X9MA 4K4VA 4NXMF 3H4BA 4JI0F 3KUHA 1XMQJ 2BW2A 1HQ2A 2GIQA 3VAGA 3GB0A 1Q5YA 2DO0A 2KHDA 2R7OA 4NYPA 3VHQA 1FKPA 3BKFA 4FNHA 3J81Y 2MQMA 4OZ0A 2HGLA 4F4KA 1NSKL 2DHSA 2Z30B 2XSFA 4WYLA 3PKMA 4LF1A 3FZ2A 1Q81T 2YNFA 1MU2A 4MAKA 4C8MA 3UDVA 2IM2A 2LMIA 4IRCA 3EWGA 2RS8A 5DZ6A 3I56S 1UVMA 4CP5A 4NMLA 2ZITA 4RX6A 1SPBP 4WFYA 2FB0A 4ZDNA 1JLAA 2HLTA 1WHWA 3QT5A 1HR0F 3FRZA 4JYAJ 3CJKB 3IA0A 4HHHA 4JI5F 2XGPA 5E2QA 2J0WA 4H4KC 3PO4A 3W7BA 4MH8A 3C15A 1K73T 3LALA 3S7RA 1T9XA 3CXCR 5AXLA 5L9XA 4NRTA 3TVZA 5K14B 1WNEA 1RGVA 1G1XA 3ZZTA 4X62J 4QYZJ 3ONQA 3DRXA 2ZD1A 2ZD1B 3OSPA 5KG5A 3C66A 2A10A 3LP1A 5DM7Q 1JIHA 1RT7B 2FJEB 1GNKA 3DOKB 4D3GA 3JTPA 3OTBA 1R8CA 4I7FA 2ZVIA 3TYTA 1XEZA 2CQDA 1DLOA 2GAGC 2KT2A 2AZ3A 1GXUA 3JSRA 2CPEA 3R7BB 1X8DA 4JI2F 2JWNA 3SFGA 4EI2A 5A8WB 4NLOA 2CPDA 3BN4A 2HFOA 2IJRA 3CB4A 2FHMA 2Y0BB 3MM9B 3OXLA 1LOUA 2Q66A 3TUPA 4QPTA 4K8RA 1M5KC 2RDJA 2R3VA 2RHQB 3AQPA 4K0KF 2GCFA 3NOGA 2VB6A 4Z2XA 1B64A 1F6TA 2JFDA 4B9NA 4JYAF 2C22A 2YH0A 4B3RJ 1HWIA 1UEVA 1HR0J 1R0AA 2P2CB 1SB6A 3AA8A 2VPYB 2XHCA 3NY0A 4YR3A 3AD9C 4HR2A 2MKJA 2OSQA 3C6UA 3KJFB 4GVLA 2DTJA 4PAAA 2J9DA 2K7KA 2UUTA 3MMCB 4WE1B 2HVDA 3RRGA 1QVFR 2EC0A 2CVEA 1HPZA 4ZPVR 5A76A 4B9VA 4WU3A 5E3QA 4FF3A 2ZOFA 1WEXA 3OD2A 2MZRA 2R7SA 1C4CA 3CCMS 4IQXA 2GFFA 2BABA 1T0TV 4J91A 4U7UD 3SXLA 1LW0B 1FA0A 4DR7F 3K8VA 1VMBA 2XY7A 2LQ5A 3CCES 3ET6A 5IZHA 2VV5A 1HQEB 3DI6A 1RA7A 4Y28C 5F0UA 4V19X 2J76E 1RTZA 2C1EB 2XB2D 1M5OC 2ZH9A 4JB8B 1N36F 4KY3A 1JLFB 3DN9A 2HRYA 4NXNF 2RUSA 4DEZA 5KFBA 2D3UA 1CLFA 1U26A 3BGRB 1YI2S 2J6TA 1CJVA 2F8MA 1YJRA 2W01A 4O44A 4EO6A 1BQNA 1Y10A 3I9V9 3US5A 3B6BA 4CDIA 4USHA 3FC9A 8RUCA 3G87A 2AIRB 4HACB 4PWWA 5EWGA 2ALZA 3MPWA 4N5SA 1RT6A 3AJDA 1VQ5S 2HBZB 1LXNA 1JLBB 2HNDB 2WB1D 3ZTQA 3QT6A 1N88A 4ZPBA 1NK8A 3LP1B 2DR9A 1QE1B 4A8XA 1ZM2A 1OPIA 1BWVA 1RHJB 4L72B 4CLWA 1RLCL 1OMSA 3GSIA 1U0HB 2F1FA 4OZLA 3GU0A 1NH7A 3Q8YA 1UFLA 3C14A 3W66A 1SUQA 4MT1A 4F36A 1A9NB 3OQ2A 5D0RA 3ZTOA 4F4AA 3KDOA 3SSQA 4ALZA 1RISA 3CCJS 3PX4A 1TVRA 4WJBA 3TRGA 2Z58B 1EETB 1M1HA 2AHOB 1SL1A 1RTHA 2CWKA 3OL8A 1U6FA 3FGVA 5CYMB 1T7PA 2HGMA 2LCWA 1GMVA 1VR6A 1KONA 4OYOA 4YQWA 3BO3A 1TFYA 3HZGA 4X4UA 1TKXA 3TNVA 3DLLQ 1X4CA 3N5BA 2ATLA 1RI7A 3THTA 2DGVA 1WF0A 2GVZB 2EI5A 4OHWA 1NSPA 4ZPTR 4URSA 1B0TA 2V8GA 1CQMA 2B43A 3TA1A 2K3KA 2I8EA 1ELOA 1BHNA 3LGMA 1HW9A 4ERDA 3NBPA 4H4OA 4EK2A 5ETKA 2KFZA 4ENOA 2VBWA 5M2RA 2NXUA 1Y00A 1YG0A 2EK6A 3EICA 1JLGB 3MEDA 4QR2A 3K59A 4K5SA 4QWDA 2YWWA 2Z8QA 4UOGA 4L3KA 4PPZA 2HQCA 2M70A 4BCAA 4X4VA 1OPZA 3G86A 5F8JA 2DISA 1F2GA 1R6YA 4J9KA 2BYCA 1S1UA 2DK2A 4U96A 3M2RB 3NGKA 5IC6B 2NREA 2XMAA 3QSIA 1D3WA 2BE9B 5EWFA 2FLPA 4TY9A 3LP2A 2OIHA 4JI3F 5KG1A 4K59A 3OR2A 2MY7A 4IR1A 4X64F 3AXMA 1TKXB 3I96A 5D0GA 4E2FB 1URNA 4ZCKA 1OY8A 2HZCA 3TJ9A 1YZ6A 3Q24A 5GMEA 2ZJRQ 3BB5A 1T94A 1IBLF 2UXCJ 2KU7A 1FXRA 1PSDA 2VFRA 3IWXA 3HCXA 3RG6A 2N7CA 3RBEA 2MQNA 4DR5J 4NXMJ 3R5DA 3BV8A 1UTAA 2EFOA 2MB0B 4USKA 1GFWB 2KFYA 5J2MA 2HHHF 3KNAA 1ROFA 1JKHB 2WTFA 4C7QA 1XWLA 2WZ1A 3MR6A 2HNYA 2MZQA 3EE3A 4R25A 4KGXB 2XI2A 1E6VA 4UW2A 3M2VA 5KFXA 2HQDA 2D69A 5A2QU 4LF5J 2B4VA 1WC3A 2VG7B 3KLGB 3KG0A 3DMJA 4LF7J 2H1YA 1YGYA 2L41A 2MKIA 1QUVA 2I6WA 2UVUA 1ZS6A 2JOQA 3V81A 4QJVA 4MYTA 2XC9A 2AZ1A 1FJCA 4Q2LA 3G82A 4RUBA 3UD5A 1M5PC 3HFKA 2CDQA 2P9EA 2Z57B 3IGVA 3P96A 3MEEA 2BE2A 2KJWA 3TAMB 1BLUA 1SUQB 4P52A 5CCLA 4YY3F 3BSOA 1TL3A 4RBTA 2R42A 2HSEB 2HQ3A 3DYAA 5HL7Q 3D6TB 2VZ9A 4KHMA 4YEAA 2IAJA 1RAGB 4O3OA 3KYLA 1HI8A 1PBAA 4L76A 1GK8A 3C8YA 4LRDA 1FK9B 5AXKA 4DQSA 3POTB 1BE4A 1O0PA 3QGIA 1VIXA 2MSSA 1URRA 3W62A 3NGRA 4ANDA 3SYZA 4KRWA 2MXYA 1R8HA 2P8IA 3MURP 5I42B 3NNCA 2B9WA 3CMAS 4C2MA 2MLZA 4A8FA 3DU6A 3ZNJ1 4C8LA 1E6YB 4UZBA 3KMSA 2RF2A 3ZTPA 4YDDB 1UVKA 3TEHB 5HN0A 4FS2A 3JS9A 1SKUB 4DPTA 2DB1A 3QO9B 2RQCA 1RACB 2GS8A 2NPIA 4F50A 1R0BG 3SV4A 2X3GA 3RUBL 3HHNB 2XZTB 5CH7B 4LVNP 2OD4A 4NLRA 3HPOA 3PIPQ 1CSJA 1NAQA 2G0IA 1JXVA 4ZVTB 2B0GA 3ITHA 1IR2A 2MEWA 3UW1A 4J9UE 2LQJA 4DZDA 5DG8A 3A3OB 3MM5B 2QL5B 3DLKA 3GONA 3DHXA 3MM5A 4OYWA 3DRSB 5T7LA 5AXMA 4DV5F 1VLYA 4NWBA 5BR8J 3NWGA 3UE2A 2W7PA 2ZH7A 3UR0A 5ETMA 3JSMA 2VODA 1F1BB 3W5YA 4MMOA 2V8DA 1DRZA 4IRDA 3OLAA 3OHBA 4B9MA 2VHGA 4GO7X 2PGCA 5H9EJ 3BGUA 2VKRA 1H2VZ 4X65F 1QVGR 1MSWD 3PACA 3PYDA 3GFYA 4KO0A 1BY9A 1JNRB 4LSLB 4UQTA 3PIOQ 2FD2A 2PO4A 3GR0A 4P9SA 1LFPA 3KK1A 4DV3J 4KGZB 1Q16B 3G2XA 3PX6A 2OJ3A 1TL1B 1R8AA 3D5MA 2JJ4D 4P2XA 2OH2A 4NZ7A 2NXCA 2V8HA 1K9MT 5G0RB 3DGPA 2BJ7A 2HZAA 2ASJA 1PGZA 1FRLA 2BANA 4HT5A 1VK3A 3TAMA 1U1RA 3M6WA 2WHOA 1D9DA 4WTOB 3FZBA 2H65B 3PFEA 2PFDA 5LMNJ 3IN5A 3GTYX 1CQNA 1FD8A 4YN3B 1VBYA 4OYXA 3VAFA 3CO9A 4LT6A 1XBWA 4QU7A 2AWZA 1WF1A 2KT5A 4LSZB 3T3FA 2FHOB 2H9ZA 2Q43A 5IOLA 4DL6A 2FLNA 1XTZA 1DY3A 2VASA 4C8NA 1IBCB 1TMMA 2OLWA 2ZBQA 4M5MA 4QQBA 4P2FA 4J9PA 4ECSA 4JI8J 2ZDPA 2VUGA 2UV8A 3QGGA 1YJTA 1OJ4A 4DUTA 4MK8A 4OIXA 4DUYJ 1RT1A 2OO4A 1X5TA 3O44A 2BA9A 4IFVB 4R8UA 1FFSB 3BQ2A 3I82A 4J9RA 2PI4A 3B8HA 2GV1A 2RE1A 1BQMA 3CJRA 3IMQJ 4RW6A 5KFLA 4O3PA 3ENWA 2Q3PA 3GYNA 2WCXA 4DG1B 1C4AA 2CJBA 4B3OA 4YB7A 4QIWD 2KDOA 4OI3A 2LDIA 4WBFA 1QM9A 2B5JA 1VJWA 5AE3A 1MLAA 1MNEA 5E0OA 1S97A 4CO5A 3RBXA 4CLFA 1S1XB 1S1UB 1S1WA 3CUNA 4YOEA 5C25B 5CZDA 4ED7A 3QT8A 4KH1B 3CCUS 3SZ2A 3DLEA 3CJ3A 1PILA 3MPDA 2F40A 3MMAB 2AMCB 4IH5A 4YR2A 3D3CJ 3LP2B 4UZCA 2PC6A 1FRXA 3BBCA 3MCOA 3QATA 4OI1A 4ITSA 4TU8A 3L3CA 4F4ZA 5HSPA 4DS4A 4JBCA 3VAIA 3ZXWA 2CPYA 1Q79A 1H2TZ 4IG3A 4NYOA 2DNOA 1M5SA 3QWUA 5K8OA 1RQ0A 3HO1A 1NZ8A 1H98A 3Q23A 2HIYA 1D8ZA 1RAEB 5DS7A 2DGUA 2DBBA 2DGOA 2M88A 1KTQA 4JI8F 9RUBA 1S6OA 3PV8A 3DYAB 1KVIA 2D3O1 5L38A 4LR8A 4DSFA 4PG8A 4B02A 4IUFA 1SIZA 3BBFA 3UN3A 3IAM9 1RWVB 5BYSA 4I6AA 4F02A 4DPWA 2A2DA 1VISA 2J0XA 2QA2A 4MKVA 3V81B 2HHXA 2KN4A 1MMDA 3EVOA 4ZJOA 4NCBA 4IOCQ 1IM4A 3D6MB 5D4LA 4E8UA 1Q4RA 3G96A 2WVFA 5FJ4A 3O6QA 1C1CB 1VQPS 1H7XA 1FTCA 4WWSA 5KFIA 2ZBCA 1BQXA 2DXDA 4F25A 2M52A 2RU3A 3JB9k 2AGQA 3CC7S 4DR4J 2M9KA 1S1TB 3R9LA 1FEHA 3QRRA 1CJTA 2NZCA 1X9SA 4DV3F 2YBVA 3BN7A 4CO2A 3H20A 1X7VA 3IWLA 4UOFA 2LEAA 4JP8A 1HBOB 3DGVA 1CJKA 8AT1B 4X65J 2RT3A 3OUYA 1K1QA 1O6XA 1VRTB 4RW8A 4OZ2A 2O3DA 3J7AN 1SL0A 4LIRA 1PJ7A 2BJDA 2MY8A 1H7WA 1U2FA 1Q8BA 3J81U 3DDKA 2EKYA 2LU2A 1HNVB 3UVJB 2CZ9A 2AYGA 1U7LA 5ETRA 2ABYA 3O5TB 4NX9A 4DX5A 4F4WA 1MMLA 1YQHA 4IOBA 1GH8A 1U6ZA 1LWEB 3A8EA 4ZVRB 7FD1A 3HHDA 2ILYA 3UWTA 3SCKE 4EMDA 5L1LA 1KR4A 1RT4A 3M2UB 5L1JA 2RKIA 3FK4A 4KIAA 4EZ6A 2CNOB 2AJ4A 1NBEB 3NCPA 4O0NA 5AT1B 4N47A 1VRQC 1Y5IB 2PT0A 4BC9A 4C8KA 2DCLA 2F63A 4QIFA 4DR2J 3B4DA 2VQFJ 3ET6B 3MOZA 2MKCA 4M5DB 3T6BA 2VA3A 4FF4A 2KFNA 1QSYA 2D1CA 4RW4B 4BC7A 4N76A 2WVEA 1H3DA 1RHUB 3B78A 4ZVPB 3Q2SC 1CEZA 3OVBA 2AGPA 1UPPA 1X4GA 2C42A 2IFXA 1U09A 2QLJB 2W1BA 3CEDA 3ZZRA 4QWAA 3H7HB 1RZMA 5EX0A 3FBCA 2DH9A 5KFZA 1SV5B 4DL3A 1WSVA 1FNOA 1YJ7A 2XI3A 3BYRA 3CCTA 3H40A 3I6PA 1ZTTA 1UPMB 4RWWA 2F65A 2DVIA 1B7FA 4JOUA 3N28A 2R7RA 1IBKF 2CJKA 1WACA 1YX2A 2BJ9A 4O3RA 1RT3A 2QE5A 2IHR1 2J9CA 4C8OA 1YDLA 2HAIA 4W92B 4WP9A 3D0IE 3EGZA 3Q2TC 1I5OB 3BS9A 4PPDA 3V4IA 3LO3A 3QJPA 4CTAA 4ATNA 4DV1F 1M90T 3TW0A 4DL0C 4DF4A 3VQTA 1T95A 3VGVA 5B7WA 2IBOA 4R8UB 3M30B 2OTLS 1VQ8S 5F8IA 1NHVA 3EXYA 2BW7A 2XNRA 2DIUA 4HL9A 1PYOB 4OHXA 4RJVA 1X60A 1HFEL 3HVWA 4LBIA 2ZH4A 1TK5A 4ED2A 3D1HA 3D68A 1APSA 1NPRA 2LFVA 4KV8B 4CQ1A 2R8HA 2GO9A 1FEEA 1SJ4P 1FE4A 2ZWOA 5CZVA 4LF5F 2C3PA 3MMBA 2ZUAA 1IWGA 3N6LA 4NLXA 1TK0A 1S72S 5DQIA 4B9TA 1DLOB 2JL9A 1DQAA 2QRRA 4NLTA 1VIOA 2AU0A 2QLWA 4TLQA 1T05B 1N0UA 3GFZA 1J2VA 1RSCA 2IAJB 2LQ9A 4KFBA 5CHCB 1U8SA 2ZHOA 2IVMA 4A48A 5HBMB 2K1RA 3G71S 1WG1A 4DJBA 5C2CA 2CQBA 3MMJA 2ZH1A 2V0NA 4JI1J 2W8KA 5E3RA 1IBLJ 2YNIB 5J2PB 1YKWA 1TL1A 3MF5A 3M2UA 2KH9A 1TAUA 2N3LA 3Q83A 3K5PA 5K20B 1X4HA 5THWA 3UQSA 1NCLA 2JLGA 3X1LB 2ZNZA 1ZZNA 2JEIA 3MUVP 3B54A 3KDNA 2E1CA 1OYDA 2D74B 2V2VA 2ZM6F 2H48B 5F3ZA 2V9KA 5HMYA 2HBQB 1IKXA 2R7QA 3T9NA 4RZRA 4N56A 4RU9A 3GIJA 2NS1B 4DSEA 1KD1T 1RU1A 1MWZA 3QIDA 1RUSA 3MI7X 1Y5NB 4HT7A 1S77D 3PEHA 4RW7A 2KT3A 4ECXA 3WHIA 2HNYB 2IM3A 4ZVUB 5F8LA 1X4FA 1JQGA 2NUHA 1M0SA 4N8NA 4ZVSB 5F41A 3D66A 1TL5A 3ITHB 3NS7B 1SH2A 2AEFA 1IR1A 1S59A 2KM8B 5EUHA 2AJ1A 2HMIA 4DQIA 3VR1A 2X3DA 3M9MB 5FDLA 2AGOA 4NI2A 3F0NA 2MGZA 4AL5A 4ZOSA 4DS5A 1TZ0A 4CH1A 3EZ5A 2C2RA 2C3MA 1JJ2R 2UUWA 4N77A 4JI1F 3DLJA 4HDGA 4ZVFA 4V19J 2HFUA 4A8KA 3H2VE 1KHWA 2WW8A 3GP9A 3OPKA 3SQGA 4CTAB 2N3OA 1N6QB 3J80U 5A8KB 4OLPA 3TZYA 3U7JA 1WKLA 1S57A 2WOMA 3RTVA 4FZVA 5A8RB 4XO0A 3DOLA 4M5JA 1LXJA 2RQMA 1F5AA 2RRAA 4X84A 4A46A 1P27B 1BGXT 4MIAA 2ZZMA 1FDDA 1FO1A 3FUYA 3M2RA 4DR1J 4K50A 1R8PA 1VDHA 3J7YI 3UCGA 4K2JA 3MDFA 3N79A 3P5BP 1J5EJ 1C0UA 1KLNA 1R0CB 2HVEA 5C24A 3GIMA 5CYJA 4GC7A 2XSJA 4DFMA 5ETSA 2F9DA 3IBWA 3IM8A 3C6TA 1UVLA 1AZSB 3E3XA 4B3TF 3NCQA 5KFGA 5FLXU 3NKYA 3DLEB 5D8HB 2WOMB 3PW0A 4CO4A 3EPGA 3PCOB 1K0VA 5D6GA 2B4UA 5KT4A 1TR0A 1HNZF 3NMAA 3DFEA 1S0VA 4CLZA 3EMTA 2HURA 4QBUA 4G1QB 1R6VA 1FRMA 3TQ1A 2DGQA 1RTDB 1QAJA 1UETA 4EWTA 1JMTA 4NEZA 2GMJA 4GVBA 4RNHA 4UUXA 2KKHA 3KLFB 1AXQA 1UCNA 2EK1A 1BQMB 2RQ4A 2JLFA 3M2VB 5KT2A 1Q7YT 1TL4A 2CPZA 3GWCA 1N36J 2HHTA 4NRUA 3KLHA 1S6PB 2VIHA 5D77A 3LP0A 1JLCA 2A3JA 2VU5A 3DOMA 3RR8A 5KOXA 2DRBA 1CS4B 2JH3A 3IXQA 3KHHA 5IM0A 3EPIA 2CZVC 2DEIA 2JVRA 3M1VB 2FVRA 4ES3A 1U2RA 1Y3JA 4I2PA 4HACA 3R27A 2W8LA 4M1KA 1O51A 4HI1A 4NA1A 2ZH8A 4GVBB 2OHDA 2M5YA 1UWBA 2DITA 2H3EB 2RD5C 2ZOGA 4P7TA 5IT4A 1R3NA 4K4ZA 2KL8A 4A8OA 1ZM4A 2PEBA 4Q44A 4UY85 1HIYA 1HD0A 2ACMA 4W90B 4QIGA 4M5HA 1MWQA 3OR1B 1I1GA 1WEYA 3ISND 4WF9Q 2G1DA 3QRPA 1TKZA 4K0KJ 3K2YA 1V9OA 2DH8A 2Z2MA 1FKOB 1RHRB 3PO5A 4LSLA 1RWKB 4ZCIA 2UXBJ 1X5PA 4NYZA 1YBAA 1NJIT 3PEJA 5E3CA 3DNCA 4WZMA 4J9VA 2Q79A 1N34J 4ES2A 4LF4J 1YSJA 3CNQP 4LF8F 2PMHA 3R5JB 4XPCA 2WVBA 2EWHA 4KAIA 1QDUB 2KJVA 1R8BA 4JV2A 1FESA 3I0SB 4ZA1A 4F0KA 3GV7B 1DBDA 2GHPA 2HFVA 2O1PA 3N6NA 1U45A 3KG1A 2AYMA 1H73A 4ZP6A 5HMZA 1YIJS 3ISZA 2V4QA 2IVYA 3GIKA 2UVWA 2FPHX 2LECA 2V50A 3D6HB 3E51A 1F5CA 3R5GA 5KG7A 1LK5A 2HFZA 3MPUB 4LF9J 3FCWA 4CLSA 3BGOP 4PZVA 5GAEU 2NLWA 1Q1KA 1ZM9A 4CT8A 4NCAA 2JVOA 3VVTA 2E5JA 2MTLA 3Q8RB 1U24A 1C1BA 3JXOA 4ID5A 1RXOB 4DCOB 4CCHA 1TVRB 5I3PA 1XNRJ 4PXBA 4ILLA 1UEUA 4HEA9 1ZM3A 4ZVGA 4U67Q 2WSEC 3AJ2A 1DHMA 3QAEA 3FRYA 1K47A 4KC5A 5I42A 1JLEA 2UP1A 3H98A 4PWDB 2OPPB 5L39A 3CIMA 3OL6A 3G8TA 2DHAA 2YKNB 3J81j 1QSLA 4GRSA 4JV1A 2JDJA 2BQRA 2LQBA 5KFUA 2WBRA 3C16A 4LMZA 3IR6B 2V63A 3POTA 4CNYA 5IV3A 4UUWA 1NKBA 3AODA 3IP0A 3QYYA 1S9GB 2DXEA 3W65A 4LBPA 1FF2A 1IM6A 3CE8A 4QR0A 4JI0J 1TU0B 3BEGB 3JQJA 2CNLB 2QLBB 2XY6A 1CPZA 5HQMA 3SI8A 2HVHA 1QAIA 2JFKA 3MR5A 2PEHA 3CD0A 3I5BA 4PQAA 1KQSR 2NR0A 4U6PA 4PQUB 3CDBA 3HSJA 4KT0C 1NSQA 3PNIA 3TAPA 2V2KA 3CTRA 5C42B 2IA6A 3N5FA 5CZXA 4ED1A 3ENVA 4PEOA 1YJVA 2L48A 4K4YA 3P49B 4DUYF 3BH7B 1NJYA 4PCQA 5KFSA 4A4JA 3UNGC 4MJKA 1GXTA 3W63A 2IA0A 4W4MA 4WXWA 4F3OA 2WVDA 3PX0A 5FD1A 1MW7A 2CQ2A 1VLOA 3OTCA 2Z0GA 4Y2IA 1X9WA 1KN6A 1XK8A 3MCNA 3EUNA 4IDKB 3R5AA 2DNLA 4TU7A 4DBQA 3EXCX 1SI9A 4C97A 5KOWA 4NMXA 1T8EA 1L3UA 4HVZA 2CPHA 5ETQA 5J2MB 1RBLA 2MJUA 1VOMA 4USMA 1FRIA 1N54B 2W9AA 3CJ4A 1SQEA 1LWFB 1NH8A 3PRBA 3W61A 3MR3A 3CSKA 4J9QA 2W4DA 3TO8A 1DURA 2HNZB 3MPVA 2HHUA 4NLSA 3WIUA 3GFXA 2JLEA 2F4FA 3QZ8A 2IIHA 1LW2A 2VFSA 1S4EA 1KFDA 2AV5A 3DM2B 4QZVB 1HHTP 3IGNA 3R97A 4FKYA 1XC9A 3HI9A 2YXLA 2NCKL 1RWXB 2GC8A 3K58A 3FSXA 3TZWA 5IT9Y 1SC3B 4M5NA 1D9AA 2LA4A 2V5HG 2W4CA 2XZWA 3AOAA 1FVSA 4I7FB 1W26A 4ZKAA 2XS5A 2CPFA 1EX8A 3NRBA 5DO2A 4CO3A 2YTCA 2C2KB 2CQIA 4UTGA 1NEEA 5BJRA 4OJ3A 2QL7B 3M8QB 1REVA 3M1VA 2W2NP 2JX2A 4MKBA 1U1LA 2NXNA 3PVXA 2AJFE 1QD1A 1CS4A 2RKIB 1VRTA 2DGWA 3KK2B 3HK2A 5AJ3F 1U02A 2FJBB 4LSNA 4N41A 3ULHA 2OAUA 5D78A 4QPXA 2B3TB 2ZJPQ 1S0MA 4B3SF 1WI8A 1W2BR
chains in the Genus database with same CATH topology
3SBMA 3IM9A 2JFDA 3QATA 3TZWA 1NM2A 2G2YA 2VKZG 3BV8A 4RR5A 2C2NA 3CJ8A 5DZ7A 2CUYA 2VZ9A 2G1HA 4RL1A 3G87A 3HJVA 3EZOA 2JFKA 3PTWA 3IM8A 3R8YA 2QC3A 2UV8G 5CZCA 3HMJG 2VZ8A 5DZ6A 3K89A 2G2ZA 2H1YA 1MLAA 3TZXA 3TZZA 3TQEA 2PFFB 2G2OA 5CZDA 2QO3A 2QJ3A 3TZYA 3H0PA 3R97A 4QBUA 3RGIA 2HG4A 3HHDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SBM A;  3IM9 A;  2JFD A;  3QAT A;  3TZW A;  1NM2 A;  2G2Y A;  2VKZ G;  3BV8 A;  4RR5 A;  2C2N A;  3CJ8 A;  5DZ7 A;  2CUY A;  2VZ9 A;  2G1H A;  4RL1 A;  3G87 A;  3HJV A;  3EZO A;  2JFK A;  3PTW A;  3IM8 A;  3R8Y A;  2QC3 A;  2UV8 G;  5CZC A;  3HMJ G;  2VZ8 A;  5DZ6 A;  3K89 A;  2G2Z A;  2H1Y A;  1MLA A;  3TZX A;  3TZZ A;  3TQE A;  2PFF B;  2G2O A;  5CZD A;  2QO3 A;  2QJ3 A;  3TZY A;  3H0P A;  3R97 A;  4QBU A;  3RGI A;  2HG4 A;  3HHD A; 
#chains in the Genus database with same CATH topology
 1S1T A;  1TMJ A;  5GAD U;  4NCG B;  1RT4 B;  3SIP B;  3GSD A;  4A8W A;  4DG1 A;  3FQL A;  2Y1L B;  2YWH A;  4YME A;  3HXM A;  4MKY A;  2QZ8 A;  3KLI A;  3PZP A;  4F26 A;  5IQ6 A;  4I2P B;  1ZYQ A;  5KG4 A;  2BM1 A;  3BQ0 A;  1IBM F;  3G6X A;  1F0X A;  3FCV A;  2QFJ A;  1BXN A;  2K3I A;  5HP1 B;  1CC7 A;  1RAI B;  4CO1 A;  4R5P B;  3KLH B;  1G4C A;  2EFG A;  1JKH A;  2F8E X;  5C24 B;  4YY3 J;  4FBU A;  1YVF A;  4W98 A;  2E1A A;  1NKE A;  3ZO7 A;  4WP3 A;  1SJQ A;  6FDR A;  1KLM A;  4TYB A;  3GCX P;  4JI7 F;  2H5E A;  4C3L A;  4DPY A;  5KFV A;  1YJ9 S;  2BRK A;  1RT6 B;  2LXF A;  5B0D A;  2HIQ A;  2I9S A;  3ZZU A;  2X1G A;  1J5O B;  4DU8 A;  3M7V A;  2J0Q D;  4J9O A;  3V6D A;  1NDC A;  1RU2 A;  1AYE A;  1FRJ A;  4LF7 F;  1JB0 C;  2IVF B;  1NJX A;  2VDH A;  5CA5 A;  1VC0 A;  5LSR A;  5C2G A;  2RDD A;  1FJG J;  3LAM A;  4XAK A;  2VG6 A;  2LKZ A;  5KT7 A;  2RDI A;  1RBA A;  3AA9 A;  3LPY A;  4HI2 A;  5CQG A;  1ULR A;  2X7I A;  3DRP B;  3GPA A;  1N5Q A;  4V1A k;  5I4M A;  4DI6 A;  5EX3 A;  2YKM A;  5LSO A;  4FS1 A;  1S49 A;  3BPS P;  2DNK A;  2EKN A;  1TKT B;  1U2C A;  2P9G A;  4YS2 A;  2PI5 A;  4CYU A;  4WKY A;  4XTT A;  1R89 A;  1W2I A;  2B4P A;  1IBM J;  3MED B;  3NGU A;  3BR9 A;  4ZVQ B;  1WC1 A;  2B5J B;  3T1H J;  4R0E A;  4CLP A;  2VIC A;  1YJU A;  1GX5 A;  3G4S S;  1VHF A;  2CQ1 A;  3H2L A;  4WFX A;  5KG6 A;  1DFD A;  2MHN A;  1KEK A;  2RML A;  2MLX A;  3LW5 C;  4IG0 B;  4TXS A;  3V4M A;  2W9B B;  2VJV A;  4X64 J;  1KSP A;  4BDP A;  1HQU A;  2YVS A;  1Q8K A;  4RUH A;  5DZ7 A;  2G1H A;  4RW6 B;  3HHL D;  3Q0A A;  1RWP B;  3R6L B;  2ERR A;  1N33 J;  3HZE A;  2GMH A;  1IN0 A;  4USU A;  1LKZ A;  4E98 A;  2RF2 B;  4DX6 A;  6FD1 A;  4AFF A;  1OQ3 A;  5A0Y A;  2Z2L A;  3D4J A;  2QSW A;  3AJ1 A;  2HYI B;  4DWI A;  2DHG A;  2ZE2 B;  4DR6 F;  2QMX A;  2WAQ D;  2MQQ A;  2XMV A;  2GML A;  1P9Q C;  2GJF A;  1RTH B;  1YJW S;  1MWY A;  2C3O A;  3M05 A;  3MUT P;  5HBM A;  2KVQ E;  3ZTR A;  5LJ5 Y;  4DV6 F;  1SJ1 A;  2HQI A;  2YY3 A;  2FC8 A;  1DJ0 A;  3RAM A;  3TX8 A;  1BC6 A;  2I38 A;  4HDH A;  5IQQ A;  2ASD A;  2W7O A;  1IWA A;  2CG4 A;  1WG4 A;  3AD8 C;  5RUB A;  4OYB A;  2FJV A;  1HL6 A;  4I69 A;  4UT4 A;  1NHK L;  2QSF A;  3H90 A;  1KQK A;  1TK8 A;  5B08 A;  4ECZ A;  2GJI A;  3CO0 P;  4PG6 A;  1TUW A;  4F0M A;  3ISN C;  1IQT A;  2BUN A;  2V8P A;  4NLV A;  2ZE2 A;  3OLB A;  3MR2 A;  4LVO P;  3UD3 P;  3TA0 A;  1KHV A;  1HBN B;  3JYT B;  5F8G A;  1I94 J;  1NK7 A;  4FNI A;  3IG1 B;  4ZK7 M;  1V3Z A;  2FLO A;  2YKN A;  4IQM A;  3PW5 A;  3K5N A;  5H9E K;  1JXL A;  2UUC J;  7AT1 B;  3PY8 A;  1HBU B;  2XTJ P;  4JUZ A;  3TQE A;  1N32 F;  5GAH U;  1JLA B;  2HWI A;  2EVZ A;  3DM2 A;  3D1O A;  2BX6 A;  3DRR B;  4KE5 A;  5J1P A;  2B8Q A;  3CJ0 A;  1OY9 A;  2ZWP A;  2ZOM A;  1B0V A;  3HVT A;  3IS9 B;  3NOC A;  2KM8 C;  1NKC A;  2LP4 A;  4NLD A;  1VJQ A;  4PYA A;  1E6V B;  2CJY B;  2VQE J;  1K44 A;  4RBU A;  2FIU A;  4ZP9 A;  1UMJ A;  2VPX B;  2JNJ A;  2OPP A;  2BVZ A;  2EBE A;  2V69 A;  1HPZ B;  1WKJ A;  2WB4 A;  1VK8 A;  1Y5L B;  3D67 A;  3ILJ A;  3SCJ E;  4PWD A;  3Q8Q B;  4OX9 J;  3M6U A;  1EKR A;  3NG8 A;  1HYS A;  1RT2 A;  2YNH A;  3MEC B;  2YX1 A;  2OTJ S;  4D3H A;  4C6A A;  3EZO A;  2O5D A;  1SJR A;  3MCM A;  5JVH Q;  2KTQ A;  2HHS A;  3CCW A;  1TTH B;  2UV8 G;  4ZLN A;  2R2T A;  1VQ4 S;  1RE1 B;  1RT5 A;  3E01 A;  4G1P A;  4WPA A;  2NSC A;  2NYH A;  4FYY B;  4P75 A;  2FVS A;  2UUB F;  2GVD A;  4FVM A;  4OI0 A;  3A8K A;  3D7S B;  2YWK A;  3HVT B;  3R5C A;  1LWC B;  2F4V J;  5IXU A;  2H51 B;  1WG5 A;  1RHM B;  4WP8 A;  5IFM A;  1JX4 A;  2ZH3 A;  4OYA A;  3QQC D;  3BDP A;  5KFQ A;  3PW4 A;  3DHW C;  4B08 A;  3KUE A;  1QLN A;  3VCD A;  4IOA Q;  3HD2 A;  1GMW D;  2HK3 A;  3OV7 A;  4I56 A;  4K4T A;  1GMU A;  3NS5 A;  4OQJ A;  4RPF A;  4ANE A;  1PBU A;  2DT9 A;  1ZAW A;  1CG2 A;  3VF0 B;  5JVG Q;  1T9V A;  2F7V A;  3W9J A;  5LT5 A;  4DV2 F;  1AW0 A;  1ZPW X;  3EVM A;  1EKS A;  4ZVH A;  3BH6 B;  3TJ8 A;  5JJB A;  2B9X A;  1WC5 A;  3KK3 B;  1G7C B;  3W2V A;  3BGL A;  3K8W A;  2W2M P;  2OFG X;  3TAN A;  1NK0 A;  3T6J A;  3CJ2 A;  3E8O A;  5KFW A;  2NZ4 A;  3AD7 C;  2GQ2 A;  3KG4 A;  4IYQ A;  1Z2Z A;  2KB2 A;  4B3R F;  3AOB A;  2IRX A;  2G2O A;  3M9N B;  4OLO A;  3H42 A;  4URQ U;  3LAK A;  5DDQ C;  1UAW A;  4KQZ A;  4ZLJ A;  5SZT A;  1ZET A;  3K57 A;  4LUB A;  3BO2 A;  1PC5 A;  2HBY B;  2QN6 B;  1Q95 G;  2G2Y A;  2YWG A;  1UKU A;  3GV5 B;  2EFV A;  1OSD A;  4KKO B;  1GX6 A;  1OYE A;  2RQK A;  1L3S A;  2WVC A;  4MIW A;  4RO0 A;  4AT1 B;  4A8Q A;  1T3N A;  2DH7 A;  1RKI A;  2EFP A;  3M8Z A;  1FKP B;  3ETO A;  3HT0 A;  3GG1 A;  3SFU A;  3QPI A;  1S7I A;  1SC6 A;  2YNF B;  1N34 F;  4X62 F;  2G0J A;  3B4M A;  2XHW A;  4U8Y A;  4IR9 A;  1RHQ B;  2XYP B;  1C0U B;  3FCH A;  1Y11 A;  1YLX A;  2WSF C;  1D0E A;  1CC8 A;  2LXI A;  1FNM A;  4Y0F A;  3KUG A;  1O8B A;  3WX4 A;  2K8G A;  3W5Z A;  1M1G A;  1RAJ A;  4ZLL A;  1NZA A;  4Q45 A;  1ZBT A;  3CDU A;  2ZDO A;  2R2S A;  2XSJ B;  2HRT A;  3EM1 A;  1M5V C;  2K2P A;  3DOL B;  2C2D A;  4OL8 A;  4DHV A;  5L8R C;  2AQ4 A;  3BPD A;  2A0F B;  1LW2 B;  3BM7 A;  3OR2 B;  4X4P A;  2XZD B;  2J9E A;  1N5Y A;  4L73 A;  3DKD A;  2YPY A;  3WQP A;  1HI0 P;  4HKQ A;  3Q8P B;  2V4R A;  2KXN B;  4NI2 B;  2MGZ B;  3CCL S;  4WFN Q;  1OWX A;  5SUH A;  4K5R A;  4DV4 F;  2FYX A;  5ETP A;  5DG7 A;  5DET A;  4LR7 A;  1XMQ F;  4ZN3 A;  2IMW P;  4ZP7 A;  1JJH A;  1XNQ J;  2I5J A;  2AEM A;  2CIM A;  4I64 A;  1SVD A;  4YB6 A;  1DQ9 A;  4B17 A;  5DGB A;  2A6O A;  1LWX A;  3IRX B;  3I4H X;  3LGN A;  4FKX A;  4N8O A;  5CYQ B;  5KFR A;  2AX0 A;  1NRK A;  4C0O C;  1NJZ A;  3IR7 B;  3H5U A;  3HUL A;  4RW7 B;  3DOM B;  3X3U A;  4I1T A;  3BJY A;  4LRE A;  4GKJ J;  4TU9 A;  1WDD A;  1RAH B;  4ZPC A;  3CCQ S;  3RR7 A;  3TUJ C;  4FP9 A;  2R9L A;  4I6W A;  4KTQ A;  1HNW F;  3GJS B;  1R0A B;  2CG8 A;  5HLF A;  1NDL A;  3H4D A;  4C48 A;  2HW3 A;  2YKQ A;  1HNZ J;  2DR5 A;  1EQ0 A;  2OPR B;  1ACM B;  4NOH A;  3D28 A;  2PE8 A;  4NCG A;  3W3S A;  3DRR A;  3TZX A;  1S1V A;  1YK9 A;  2AJ0 A;  2M8H A;  1HBU A;  4B3T J;  4ED5 A;  1VBZ A;  1KS2 A;  3F56 A;  1U0H A;  1SIW B;  1X4A A;  2W9C B;  4P72 A;  1PC4 A;  2C2O B;  2LLZ A;  4OJ1 A;  4AYB D;  4KFB B;  2E44 A;  1PKU A;  1J5E F;  1HBN A;  4PYD A;  4TY8 A;  2W2P P;  2EC2 A;  2FZK B;  2AD9 A;  3R1H A;  1B7Y B;  1JXE A;  1JLB A;  2LEP A;  2YNI A;  3M4X A;  4M94 A;  4DR1 F;  2EG1 A;  5EHH A;  2MDA A;  1UEK A;  4KR0 B;  5EWE A;  2FUG 9;  1RTI B;  2FHJ A;  2J7U A;  1S48 A;  3H59 A;  3N9U C;  3SSS A;  4O4R A;  2XGQ A;  1VFJ A;  3PJX A;  1UVN A;  3R5B A;  4O44 B;  1UW4 A;  3JSM B;  2IY5 B;  2FVC A;  1H72 C;  1H6K X;  3MXH P;  5G4D A;  1XMO J;  1A0O B;  4OHZ A;  2V4J A;  2R7U A;  4WXO A;  2CAJ A;  1LFW A;  5K5M A;  4H4M A;  4OZ1 A;  4S0M A;  3GIR A;  2K1R B;  1S4F A;  3J7Z 5;  4WE1 A;  4ED3 A;  1S10 A;  5BYQ A;  2YPZ A;  3MEG A;  4PUO A;  1N56 A;  2DNQ A;  2DPI A;  1G3O A;  2GNK A;  1B99 A;  3KLE B;  2EPI A;  1C1B B;  4BBY A;  5A0Y B;  5LMU J;  4K4X A;  4HLB A;  4PWU A;  3JAM U;  3OL7 A;  2H54 B;  3KTQ A;  1U1P A;  1ZZF A;  2A2C A;  1RAD B;  3IAS 9;  4XK8 C;  5GMD A;  3W9H A;  1EIY B;  3FEX B;  2LDY A;  2C2M B;  1HNX J;  2ZEJ A;  2H4W B;  3LOU A;  1LWC A;  2I1R A;  3CMQ A;  4I2Q A;  4DR3 J;  4DFP A;  2VDI A;  2PN6 A;  4DPX A;  3UN2 A;  4DZ6 A;  1NDK A;  2YNG B;  3BR8 A;  1L3K A;  2KG0 A;  4QCL A;  4X4O A;  3L09 A;  3GII A;  1HNW J;  2OML A;  3VWS A;  2ZM6 J;  1JWW A;  2HK2 A;  4X66 J;  3MEK A;  2H5I B;  1I51 B;  5GAE I;  3GR1 A;  2L08 A;  4LF6 F;  1Q53 A;  3ILL A;  3IS9 A;  3W64 A;  4GKJ F;  3FSY A;  1U47 A;  3TR5 A;  3I55 S;  4ECT A;  2ACY A;  1V5V A;  2HS0 A;  3FBB A;  1W25 A;  2HLU A;  1VHI A;  3BKT A;  3EX7 B;  3T5K A;  3HJF A;  2UU9 F;  2CA9 A;  1HWJ A;  3M8P A;  4Z7Y A;  3THV A;  3FFI A;  2O66 A;  3L7O A;  1KQG B;  3V5R A;  1E6Y A;  1KOH A;  1NND A;  1R31 A;  1TV6 A;  2E29 A;  1H38 A;  4K4S A;  2J9D E;  2DEJ A;  4NA3 A;  3Q22 A;  4RBV A;  4F7V A;  3G82 B;  4I4B A;  4ETX A;  5D15 A;  4O0I A;  2W9C A;  2IC3 B;  1SQG A;  3MM7 B;  3U02 A;  1A7G E;  4NL5 A;  3NEK A;  5A8W A;  1NME B;  3PW7 A;  2YKP A;  3UVJ A;  1VC5 A;  4Q0B B;  4PXD A;  2ALY B;  3MAH A;  4RUC A;  1V3S A;  2C3U A;  2ROE A;  1YRU A;  4U95 A;  1Q0N A;  2VG7 A;  4ID8 A;  5D4N A;  5HAT A;  4Q8E A;  3K89 A;  5K8N A;  4QIV A;  1F9F A;  4M5D A;  2E1M C;  5MAO A;  4DN9 A;  4Y00 A;  3OUY B;  1RHK B;  3PG9 A;  3IFE A;  3M8S A;  1U1O A;  4WZQ A;  2KRR A;  1ICE B;  2QO3 A;  3FKB A;  1GAO A;  4WU2 A;  5IWA J;  5F8N A;  4LQ3 A;  5IM0 B;  1S1V B;  4OI6 A;  2Z2Z A;  2IM1 A;  4RW8 B;  1RK8 A;  1ARO P;  5DRK A;  4YP3 A;  4P73 A;  1QSS A;  2JZ5 A;  1LWE A;  3JTO A;  1T9T A;  1VC6 A;  3CD6 S;  1SH0 A;  1KTV A;  4CZC A;  5IV4 A;  1CJT B;  3KJV A;  4QOT A;  2ZH6 A;  1B4S A;  1KNZ A;  4DF8 A;  1UZH A;  2DGT A;  3H2U B;  4ZP8 A;  3TAR A;  2E9R X;  4IKA A;  1JLQ A;  2BM0 A;  2VFV A;  4Y65 A;  3UCU P;  1NK4 A;  4M8L A;  1QUP A;  1OO0 B;  3F41 A;  3OHA A;  3U1N A;  1N5S A;  1K0T A;  4UY8 T;  1VCT A;  2UXD F;  2MKK A;  3S01 A;  2VA2 A;  2QLF B;  4ZCL A;  3CIZ A;  2OPS B;  1HW8 A;  1HQU B;  4P2S A;  5BXI A;  1FE0 A;  2QJ3 A;  2Q1L A;  2RVJ A;  2QL9 B;  4C0B A;  4CYU B;  2BBE A;  3IR5 B;  5AE2 A;  4ES1 A;  4FBT A;  3NL0 A;  2IYG A;  4UF4 A;  4ILR A;  1FCA A;  4OI4 A;  5GMK a;  2KG1 A;  3IRX A;  3KK3 A;  4DR2 F;  3P6Y C;  3MM6 A;  3MM6 B;  2ZKU A;  3ICL A;  4EBC A;  4DLE A;  3I4P A;  1GQE A;  5L46 A;  5CD4 A;  4LRC A;  4MK9 A;  2XMT A;  2LA6 A;  3KJN B;  3VVU A;  3SDE A;  3HHE A;  5ITH A;  3IRW P;  1NPP A;  1S76 D;  3BGF A;  4CH7 A;  4C0H A;  4G65 A;  1XR6 A;  2IYI A;  1QAX A;  1X31 C;  2B8P A;  2L9N A;  4DV2 J;  4AQY J;  3HHL B;  3NAI A;  3WDO A;  1KBR A;  1Q8I A;  2XNQ A;  3UD4 P;  1OQ6 A;  3E2E A;  4B3O B;  1WC6 A;  4ELV A;  2FTR A;  4P7V A;  4OHV A;  3TZZ A;  1N0V C;  3GMG A;  3KNG A;  4EZ9 A;  5B0C A;  1NK6 A;  5C5J A;  4YUD A;  1RDR A;  4C8Z A;  2M3D A;  3IM9 A;  1YIT S;  1FJE B;  1QAY A;  2R2R A;  2IM0 A;  1WTF A;  4NLQ A;  2PII A;  2CNN B;  4IH6 A;  1YRT A;  1NK5 A;  1X0F A;  4F3Q A;  1CJK B;  1FTR A;  2QYC A;  2HHH J;  2UUB J;  4PKD B;  1UFW A;  1KWM A;  1T9U A;  3EDR B;  4OYP A;  3OTO F;  1UFK A;  3M6V A;  2CVI A;  2GVZ A;  2E9T A;  1HD1 A;  3OVS A;  1IUJ A;  3KLI B;  2R8I A;  2CPI A;  1MRO B;  2QT7 A;  2JHE A;  5HAN A;  2HFS A;  2QC3 A;  1M1K T;  1BWE A;  2OSR A;  2L3M A;  5J1E A;  4ZMM A;  4QYZ K;  2OEM A;  1XIQ A;  2G2Z A;  2HQG A;  5KFD A;  4ECQ A;  2BJ1 A;  2J6U A;  3LWL A;  4DSI A;  3OJU A;  2HHW A;  2FJA B;  3MTK A;  4Y2C A;  1JK9 B;  5G0R A;  4TYA A;  3ZZY A;  1YRX A;  1FWP A;  3UPF A;  4B3M J;  1S6Q B;  3TAQ A;  1HWL A;  2FQQ B;  5KAK A;  2UZA A;  3D54 A;  3RAX A;  1VQN S;  3PHT A;  4KHR A;  3KK2 A;  1N5T A;  1X4E A;  2FC9 A;  3OFH A;  4Q2M A;  1N32 J;  1RBO B;  2VC0 A;  3R2C J;  3MZI A;  2D7S A;  2QMW A;  3MAA A;  1FRH A;  4OYM A;  3ZNU A;  3M8P B;  5HMW A;  2I0X A;  2XQC A;  4DUZ F;  1IQZ A;  1UJ4 A;  2CJ9 A;  2MKH A;  2PSZ A;  2XM3 A;  2Y0S D;  3OTD A;  3K5M A;  1FWK A;  2XBP A;  3QNW B;  4OYI A;  1I3O B;  3NGT A;  2MZ1 A;  3DLH A;  2EXU A;  3ZZO A;  2MYF A;  2E5L J;  3C16 B;  3UI3 A;  2DNM A;  1REV B;  3RJM B;  3C3L A;  2XYH B;  2QGF B;  2BAN B;  1RT5 B;  3MMB B;  3R3T A;  4YB5 A;  3PRV A;  2Y1J A;  1HWU A;  4DCP B;  4J90 A;  2R7T A;  1I6J A;  2IJN A;  4I2Q B;  5GAD I;  2ZC3 A;  4DV6 J;  2NQP A;  2QFI A;  3SQG B;  4EEY A;  5KFT A;  4YB1 P;  1ZA1 B;  4NE9 C;  2A18 A;  2EW9 A;  4O3S A;  2ZH5 A;  4DR6 J;  4NLW A;  5HQ8 A;  1PYT A;  1YJN S;  2CJQ A;  2BKP A;  2QMU B;  4ZJL A;  4ELU A;  5IT9 U;  2W4P A;  2HRU A;  3CD5 A;  1OIA A;  4QR1 A;  5LXR A;  3T1Y F;  1GTE A;  2GQC A;  2MZJ A;  1TUG B;  2BXJ A;  3NCR A;  3TX0 A;  1P9Y A;  3BRE A;  3HSG A;  4KGV B;  3CCR S;  3VAL A;  4DQP A;  1N33 F;  3DRS A;  1YWX A;  3PJW A;  3TOQ A;  3P45 B;  1T3O A;  4IDK A;  2ZFH A;  3KWM A;  5KG0 A;  4U7C A;  3HVR A;  5I3U A;  3G6Y A;  4FVC A;  4FXW A;  3AOC A;  2OPQ B;  2ILZ A;  1EHW A;  1U1Q A;  5KFN A;  2NXE A;  5LMN F;  5F3T A;  5D3G B;  3C46 A;  2FJW A;  2CQC A;  1DTT B;  1GMW A;  1Y9O A;  2PMW A;  3PFO A;  4WK1 A;  1FKO A;  4FYD A;  3IG1 A;  1VQM S;  5L1K A;  4CLK A;  3OJS A;  4RUA A;  4RR5 A;  2E1P A;  2HGN A;  2P6T A;  2YKA A;  4WK3 A;  3MTJ A;  2IPO B;  2C2Z B;  3M8W A;  2MQO A;  5J2P A;  4USI A;  2VL1 A;  3DGP B;  3EDQ B;  3PYG A;  2CFX A;  5D4O A;  3SMZ A;  4Y2M A;  2NUU G;  4LJM A;  3CJK A;  2C28 A;  3D0G E;  3BKU A;  2NPF A;  1YBT A;  2ZHA A;  4KPY A;  1TUV A;  1T05 A;  4HH1 A;  1OY6 A;  3KLG A;  3LF0 A;  4L6V 3;  1B0P A;  2W2Q P;  4MK7 A;  5J1E B;  1S5Z A;  2DGX A;  2FHK A;  2OMO A;  3CJQ A;  2Y8W A;  4C4W A;  2GHW A;  1VS3 A;  3OFE A;  2X1B A;  2QA1 A;  5DLF A;  4JI7 J;  4GKK J;  3L9Z A;  3RB0 A;  2CAD A;  3P5T L;  3ZC4 A;  4I68 A;  1RKJ A;  2U1A A;  5KFH A;  2BE7 D;  3HP6 A;  1U49 A;  3I0R B;  1WF2 A;  4ID5 B;  1WHV A;  4OMF G;  4TLR A;  3TVY A;  1Y0H A;  5LOQ A;  2JRS A;  2MJN A;  2J7K A;  3RB6 A;  3G9C A;  4DFK A;  4AMM A;  2KVI A;  4CIO A;  3KXD A;  4RU2 A;  3ILO A;  4U9R A;  5B0F A;  3KJQ B;  3VAK A;  2MZS A;  1FRK A;  2OUG A;  1NB2 A;  3PTW A;  4ZPD A;  2CJA A;  1SL2 A;  4OV1 A;  4NLY A;  1HI1 A;  1VBX A;  3DXB A;  2UUA J;  4KPC A;  4A8M P;  1VQS A;  4G1Q A;  4Z37 A;  3M6X A;  2VFU A;  2XUL A;  2VG6 B;  1D09 B;  2Z2Y B;  1DZ5 A;  2UUA F;  3ZZZ A;  3ADA C;  3S1T A;  3TEG A;  1SV5 A;  5HAO A;  3SDE B;  1HHS A;  1Z2L A;  2JSX A;  5M2U A;  1Q5V A;  2G9O A;  3DDI A;  2CZ4 A;  2G0C A;  3AFG A;  3FBF A;  4FYW B;  4USW A;  1NHU A;  2HMI B;  1NUE A;  2IRY A;  4CH0 S;  4B3S J;  3NS6 A;  3A4T A;  3TUI C;  2AW0 A;  3ILI A;  1U0S A;  3HD1 A;  3CGI A;  3I0S A;  3BSA A;  4IH7 A;  3GCW P;  2MZT A;  4P71 A;  4EFA C;  4ZS6 A;  2HS4 A;  4AL7 A;  1XQI A;  4DQQ A;  1X4D A;  3OR1 A;  2M2B A;  1S1W B;  2VH7 A;  4CO0 A;  4FF1 A;  4GKK F;  1U1M A;  3PR5 B;  2ZBR A;  3N0V A;  3J80 Y;  1KDN A;  3FMW A;  2XMU A;  4P74 A;  1CUL B;  2HKE A;  4ECR A;  2VZ8 A;  2GA7 A;  4DSL A;  3VGU A;  3NP5 A;  3H8Y A;  1UWB B;  4B9S A;  1WKK A;  1MN9 A;  2FZC B;  2GGP B;  2IDE A;  1JLQ B;  3RBZ A;  5K8M A;  1FX2 A;  2HZV A;  1S6U A;  1ZOT A;  2RIJ A;  1WC0 A;  2JC0 A;  4KGK A;  1FNX H;  1T03 A;  2M4M A;  4M5I A;  5KT5 A;  4KKO A;  3CCV S;  2D3O R;  2HPU A;  3TWZ A;  4NEY A;  4CWB A;  4J7C A;  1IVZ A;  2GZO A;  1AUD A;  4JV5 F;  1DQ8 A;  1UP1 A;  1KLM B;  1OSC A;  3IO1 A;  4KBI A;  5HVF A;  4TQS A;  2OKQ A;  1EJ7 L;  1JLC B;  4DR5 F;  1SXL A;  4RKU C;  4EU0 A;  5GAH I;  3K0J A;  2WON A;  1GEH A;  3O1L A;  1KKH A;  4RL1 A;  3RZA A;  3UR3 C;  3TI0 A;  1HMV B;  2CQ3 A;  1QE1 A;  2PD1 A;  2V94 A;  2XMJ A;  4Q7A A;  3I5C A;  2DPJ A;  5KFY A;  5LM7 E;  5E3P A;  1IXK A;  2W2O P;  2BQU A;  2VON A;  1LK7 A;  3OXF A;  4FXV A;  5KFK A;  4WIQ A;  1N48 A;  3DLB A;  2AF6 A;  3PJ9 A;  1UA0 A;  2DNR A;  1DTQ A;  3O3L A;  4J9L A;  1Z4U A;  2VOP A;  2Q6B A;  4KSE B;  2H4Y B;  2HS3 A;  2WBM A;  6AT1 B;  4JI3 J;  2R7V A;  5D0H A;  3FDS A;  5KFA A;  3SCI E;  3D6F B;  3OBI A;  4XIU A;  2DNG A;  4PQU A;  3T1Y J;  1RTD A;  5KT6 A;  4L75 A;  4ICL A;  4CLT A;  3UO0 A;  3J7Y U;  3C14 B;  2CWX A;  2HQF A;  2WSC C;  3ETM A;  3MM7 A;  1FWL A;  1QJH A;  1P8G A;  1WHX A;  3CJ8 A;  3HFV A;  2C2E A;  1F2H A;  1S79 A;  3AB4 B;  1HQE A;  3DI6 B;  4LSN B;  1AFJ A;  2DJW A;  1P6T A;  2BJE A;  2KXH A;  2RUG A;  3TP2 A;  4AXJ A;  5H9F J;  1Q82 T;  5E7O B;  1RLD A;  3Q89 A;  3L4B C;  3QT7 A;  3W60 A;  5I3U B;  2GHV C;  1HBM A;  5AXN A;  2M8D B;  3LA0 A;  3U27 A;  1Q8L A;  2AJQ A;  4J5O A;  3V2U C;  5FII A;  5JUM A;  2QIF A;  4FDF A;  2UXB F;  2VPZ B;  2HHV A;  3CUL A;  3R6G B;  5C25 A;  3OSN A;  3G8Q A;  3T41 A;  2DR8 A;  1VQ7 S;  2MQL A;  5T14 A;  3PHE A;  4F2S A;  3CDA A;  5DG9 A;  3FFI B;  4ANC A;  3WIV A;  1NJW A;  3CD7 A;  4IFY B;  2CQH A;  4DUZ J;  2I2Y A;  2POK A;  5ETN A;  3GLJ A;  1FER A;  4FPI A;  3VGS A;  4DDF A;  3H5Y A;  2AP6 A;  1XNR F;  1BMQ B;  2CDR B;  3A8J A;  3FBE A;  3PRD A;  2X1A A;  1C0T B;  1ZTW A;  5KFE A;  4DOZ A;  3RRK A;  2FGC A;  2BEF A;  3DCA A;  1FDN A;  3FQK A;  2D9P A;  3CDE A;  3W5X A;  1LNQ A;  3HMJ G;  4B3M F;  1LWF A;  2DXF A;  3AHP A;  2KO1 A;  4FYX B;  3M32 A;  2CQ0 A;  2V4J B;  3OXG A;  2E7V A;  4LF9 F;  3GIL A;  4C9D A;  5ADZ A;  2PDA A;  3QFH A;  2MST A;  2Y1I A;  4E0D A;  2BOA A;  4G1I A;  4AMP A;  1WJ9 A;  4WKR A;  1RAF B;  2K7J A;  3VZH A;  2YX4 A;  4U7U K;  2DY9 A;  1F9H A;  4GMK A;  1S0N A;  1HBM B;  5IC4 B;  3THP A;  2QLX A;  5T41 A;  1RAO A;  2P6S A;  5HI7 A;  4BHQ A;  4QW8 A;  3EYZ A;  4DPU A;  2R8J A;  2XMW A;  4X4T A;  2BE2 B;  3MEE B;  5IS2 A;  3UCZ P;  4DCJ B;  3VTI A;  4LF4 F;  1X0P A;  2LYV A;  4NXN J;  2D3Z A;  5F9N A;  4HH0 A;  2DNY A;  2CNK B;  2VF3 A;  1RAA B;  4H4M B;  5K8P A;  2BV3 A;  1TKD A;  5A6W A;  5C42 A;  2XY5 A;  3W1Y C;  4ICL B;  1CJV B;  2DNZ A;  3KHR A;  5DQH A;  2DNN A;  1WD6 A;  2B6A A;  2B6A B;  4KJI A;  1K8A T;  2QA4 S;  4DR7 J;  1WOP A;  3A3N B;  2MHE A;  3TA2 A;  1RT7 A;  4YR0 A;  2GIR A;  1DTT A;  3C19 A;  2J0S D;  3ENQ A;  4XPE A;  4N7T A;  4DFJ A;  1RWM B;  1F5B A;  4AQY F;  3MGJ A;  3OL9 A;  4OZ3 A;  5LJ3 Y;  1WEL A;  2YQ1 A;  1FX4 A;  1T11 A;  2OPR A;  2ZC4 A;  2F8H A;  3CWJ A;  3EGW B;  4HTI A;  4A8Y A;  5F8H A;  2FVP A;  1BD6 A;  2R7X A;  1SC1 B;  2FLL A;  5CYQ A;  5D0E A;  5U47 A;  2GW8 A;  3M30 A;  2XYG B;  2BR0 A;  4FF2 A;  3RAQ A;  3GZ7 A;  2XO6 A;  2BDP A;  1AB8 A;  2Z56 B;  4O4G B;  4ZN1 A;  4LR9 A;  5KG3 A;  2P5V A;  3ZZ0 A;  4G3I A;  3O8W A;  1UW9 A;  3VAH A;  5JXS A;  3LWM A;  3A3P B;  4HTJ A;  2D41 A;  3BZQ A;  2HBR B;  1R7I A;  3LQV A;  3NAH A;  4I6Y A;  3DDN A;  3W8P A;  1N5Y B;  4JI2 J;  5EN1 A;  3V4I B;  2RNE A;  4NLG A;  2B7C B;  3BO4 A;  2DIV A;  3HVA A;  4IG0 A;  4PXC A;  4RWX A;  4JV0 A;  3UDC A;  5F9L A;  2FJX A;  3L7P A;  3QJL A;  3PR4 A;  4P2M A;  2UVV A;  2X1F A;  2J5A A;  1AZS A;  1TFW A;  3NLC A;  1RYR A;  1J5O A;  4FXD A;  4AUK A;  3O2I A;  2VG5 B;  5B09 A;  4LRA A;  4EGL A;  3T5J A;  2DYA A;  3LGH A;  3DOK A;  1QTN B;  4L74 A;  2DD8 S;  3JSB A;  4KYZ A;  4LRB A;  4TQR A;  1PAU B;  1RTI A;  3IC1 A;  4UST A;  3FEZ A;  5IWA F;  4OI2 A;  3R8Y A;  4RNM A;  4EBE A;  1TL3 B;  2MKY A;  4QYR A;  2FJD B;  4JI5 J;  3KOA A;  3QJJ A;  4WFB Q;  1NK9 A;  4ILM A;  5A8R A;  3SCL E;  3CC2 S;  3HKW A;  3BBB A;  3QGP A;  3C15 B;  1VQL S;  3AH6 A;  1WEZ A;  4O23 A;  4ECV A;  4CRJ A;  3CVK A;  1G2E A;  4A47 A;  4CLL A;  2OPS A;  2ASY A;  4EYI B;  1PJ5 A;  1UA1 A;  1R43 A;  2N4D A;  2RAQ A;  3V6H A;  3FJ2 A;  3WC0 A;  1VI7 A;  1YHQ S;  2MLY A;  3KLF A;  3FMB A;  1KVJ A;  1VRU A;  4CNZ A;  4URG A;  2KHC A;  2HAF A;  2OEL A;  3EGN A;  3HF5 A;  2MQ8 A;  4J9M A;  2B56 A;  4RW9 B;  5HJX A;  1KC8 T;  1MRO A;  4C3M A;  1MMN A;  1MU2 B;  3T5L A;  4HHU A;  1DTQ B;  1XER A;  1FT8 A;  1S12 A;  2OEK A;  2MPU A;  4Z7C A;  1KFS A;  2QG9 B;  3JTN A;  3HHL C;  5HMX A;  4Y2K A;  1EET A;  3S8S A;  1T9W A;  4QIE A;  4J37 A;  5CAB A;  4Y2A A;  1F9E B;  3H25 A;  4LF6 J;  2M7S A;  4ED0 A;  4RNN A;  3MAQ A;  1QTM A;  1U8W A;  4H54 A;  3K5L A;  1LEO A;  3SQO P;  3I32 A;  2AX1 A;  2XMK A;  3H5S A;  3K17 A;  3RBD A;  3KHL A;  2CRL A;  4LF2 A;  1TL7 A;  3GFH A;  3P8B B;  4P10 A;  2V68 A;  5DGA A;  3R7N B;  2V9W A;  3NNH A;  4NLP A;  4USJ C;  2HND A;  2Y1R I;  3CJT A;  5CAA A;  4ZIT A;  4ZVO B;  4Q8F A;  1CUL A;  2ASL A;  1TV6 B;  1V6H A;  3DRY A;  1SKS A;  1U6B A;  1UJ6 A;  3I31 A;  5KTQ A;  2VBZ A;  1HNX F;  3BSC A;  1O5J A;  4CI0 B;  4IO9 Q;  3RB4 A;  2IRU A;  5HQL A;  1XN9 A;  1Y3K A;  4M5K A;  4DSJ A;  3MCS A;  2GX8 A;  2FGO A;  2BKO A;  1RCX B;  1RWU A;  3MD3 A;  3GV8 B;  3C2P A;  2D9O A;  2LEB A;  4FN5 A;  1VQK S;  1P1T A;  2EFQ A;  2VG5 A;  5B0B A;  1ITP A;  3AB2 B;  3P3D A;  1PIE A;  1FJ7 A;  3NWR A;  2B9Y A;  2RB7 A;  3PM9 A;  2F3J A;  3DC2 A;  3NBP B;  1FD2 A;  4H4O B;  4J9S A;  1RWW B;  1UVI A;  1GTH A;  1WUU A;  1FKA F;  1ZH5 A;  1RT2 B;  2XS7 A;  5A8K A;  4OZJ A;  5D3G A;  2GVD B;  1S9E B;  1TEL A;  1NU4 A;  2M0G B;  5I3Q A;  3BF4 A;  2XCP A;  2E9Z A;  1FVQ A;  3E01 B;  2FZG B;  1IR0 A;  3G6V A;  5GAG I;  2YNG A;  3M9O B;  1N52 B;  2FVQ A;  3MMC A;  4XDD A;  3M8R A;  1HYS B;  3MEG B;  4I0W A;  4LIW A;  4WFZ A;  4Y3C A;  3G6E S;  2V2Q A;  4F8R A;  4F3M A;  4PUO B;  1AUS L;  2E7W A;  3QO9 A;  4X4Q A;  3MFI A;  3KJV B;  2BJ8 A;  3NXZ A;  2YX7 A;  5CCM A;  1MN7 A;  3A12 A;  2CPJ A;  3K7R A;  3N4W A;  2XG8 A;  4DV1 J;  2VD3 A;  1IJE B;  2V67 A;  3RB3 A;  2F5G A;  3HFZ B;  2ZBI A;  4O4G A;  1F60 B;  3EZU A;  3MR7 A;  4MKA A;  3AQO A;  3WBZ A;  4ZCM A;  3T5H A;  4AMO A;  4PG4 A;  1S9F A;  4M63 A;  3FSI A;  2VOO A;  2DHH A;  4NZ6 A;  2CKW A;  3T1A A;  1HLW A;  4LQ9 A;  3RRH A;  1IBK J;  3NMR A;  3CT9 A;  2J8S A;  4OX8 A;  1OS5 A;  1D9F A;  5EDW A;  1T02 A;  4PG7 A;  1DAX A;  5F8M A;  3M8Y A;  3PW2 A;  4LFC F;  2XWY A;  5B0G A;  2RU9 A;  3DLG B;  2EBG A;  1BUX A;  2ROG A;  4WFA Q;  3R2D J;  3VAM A;  3WX8 A;  1JLE B;  2LQ8 A;  3A1Y G;  1SQF A;  2GO8 A;  4QU6 A;  1Z1Z A;  4DL5 A;  4B9U A;  2QYG A;  1UJ5 A;  5A6P A;  4F4Y A;  5F0W A;  3TUZ C;  2VQF F;  5C7P A;  4ZPA A;  1C2P A;  4DV4 J;  3U1L A;  4OV6 A;  1WOO A;  1FHT A;  4ECY A;  1IJF B;  1VQY A;  2RHS B;  2Y8Y A;  1HNI B;  2B4O A;  4F67 A;  2V2Z A;  1F3V A;  1X5O A;  2R4F A;  1C0T A;  3DU5 A;  3KFW X;  3KHG A;  1NXI A;  2C3Y A;  4EYH B;  2DRD A;  5JMN A;  2H5J B;  2XEX A;  4IRK A;  3QFW A;  3QMQ A;  2ZH2 A;  4LFB J;  2W25 A;  2RRN A;  2VBY A;  5J1N A;  4K7Q A;  4CT9 A;  1DAR A;  4IFY A;  5DDP C;  4AL6 A;  2HVZ A;  1RT3 B;  3OT9 A;  5T7L B;  5KFC A;  1HBO A;  2WON B;  1UZD A;  2I5J B;  2C2N A;  3MUM P;  1U48 A;  3I87 A;  4DL7 A;  1VBK A;  2CUY A;  2VBX A;  2E5I A;  1U1K A;  2QA4 G;  4DV7 F;  3LH2 S;  2B51 A;  4PR6 A;  5L9N A;  3RU0 A;  1FFG B;  1SJ3 P;  2PA8 D;  5ETO A;  3K5O A;  2RJZ A;  3TJA A;  5IT0 A;  1IKV A;  1C1C A;  2DNH A;  1XJW B;  3ZFV A;  3BQ1 A;  1RTJ A;  3OFF A;  5CZC A;  3W2W A;  2UUC F;  3DRP A;  3RW7 A;  4DXL A;  1V5I B;  4P6Q A;  3QLH A;  2B9E A;  4ED6 A;  1REG X;  4AMN A;  4OJG A;  3HM9 A;  1Y4Z B;  2FY8 A;  2IDL A;  1IKW A;  2YWE A;  1SJF A;  2IBK A;  2UVR A;  4DR4 F;  3UDE A;  2GGP A;  3JAM Y;  2V6A A;  2XLJ A;  2JEG A;  3A13 A;  4DQR A;  5J2Q B;  1PCA A;  5KT3 A;  3EJM A;  4PG5 A;  5D4P A;  2L9W A;  3CJS A;  4YHH J;  2OP5 A;  2LVW A;  5GAG U;  2W7A A;  4ZVE A;  2GQQ A;  2DR6 A;  3S6E A;  1S9E A;  2DKO B;  2RH3 A;  2NYI A;  2WRM A;  4DPO A;  3J7A 1;  4JV5 J;  5HO4 A;  2DHX A;  2PFF B;  4F04 B;  1WC4 A;  3MFH A;  1Y7P A;  3U1M A;  3WZ0 A;  2KXF A;  1TKT A;  3VQS A;  2ATC B;  2A1B A;  4MFB A;  1WWH A;  3CCS S;  3T19 A;  1ZAV A;  1H2U X;  4IG3 B;  5MLC V;  2ZJQ Q;  3V6D B;  4RLE A;  2VPW B;  3AAW B;  4LFA F;  2N4C A;  2RIL A;  4USV A;  2SXL A;  1T9Y A;  2ZZT A;  1G6B A;  3D3B J;  1RCO B;  5LL6 d;  5HJY A;  1NSA A;  1NLK L;  3I5A A;  1EP4 A;  2AEJ A;  4CM0 A;  2AKW B;  4ZIV A;  1XR5 A;  5KFJ A;  1EQM A;  2HHP A;  2BJ3 A;  1HKA A;  1RA6 A;  4DV0 F;  5ETL A;  2J8A A;  3HSZ A;  4JI6 F;  1WOR A;  4OX6 A;  5HK4 A;  4ELT A;  3GYG A;  5DJB A;  2FDN A;  2VFT A;  5HP1 A;  2QV6 A;  3QZ7 A;  3R7S B;  1CJU A;  1U1N A;  3GG0 A;  1IKY B;  4Q5V A;  3D2W A;  2CQG A;  4R0J A;  4FPR A;  4DX7 A;  4JI4 F;  2BAC A;  1H74 A;  4KHP J;  2E5L F;  3ELH A;  1EP4 B;  3IBF B;  3I9Z A;  2GIF A;  2DNP A;  2PA3 A;  2F4V F;  3LP0 B;  1N8R T;  3QIP B;  4OJH A;  3Q8V A;  1RWN B;  1NB7 A;  5CD4 H;  2RSQ A;  4KB7 A;  3ZTS A;  3ZZP A;  8ATC B;  3QAU A;  1H0H B;  4OFZ A;  1FXD A;  4RNF A;  1HAR A;  1X5S A;  4RW9 A;  1IKY A;  1Q78 A;  3FVY A;  3KKF A;  3UFC X;  1YBU A;  5DDO C;  1VYA A;  4ZHR B;  4I67 A;  3SBM A;  2R8K A;  2YKM B;  4OX9 F;  2FY1 A;  4KH0 B;  1M5H A;  4DLG A;  1EB0 A;  3F44 A;  3P4U B;  4KGM A;  1U4B A;  2MQP A;  3QBC A;  2W24 A;  1S0O A;  2OEJ A;  4Q0B A;  3NGS A;  3PDN A;  2EG2 A;  1EAR A;  3L7U A;  2BOP A;  4NLU A;  2VQE F;  1SKW A;  2G4B A;  5LXY A;  5J2Q A;  3W8G A;  1RAB B;  9ATC B;  3CPW R;  5HVG A;  2IJF A;  4DL2 A;  1N5V A;  1MG7 A;  2KYX A;  3BGR A;  3ENA A;  5H9F K;  4EUV A;  2ZNY A;  2O67 A;  2E7X A;  1RJJ A;  3LPE A;  3SSR A;  2VC1 A;  4M95 A;  3OTO J;  3A8I A;  2APO A;  4WTY A;  3SEO A;  1RTJ B;  3UN5 A;  5DQG A;  4X4N A;  1IKV B;  2GAH C;  3AT1 B;  5KFM A;  4EBD A;  1LV5 A;  3AXK A;  2QX0 A;  5FDL B;  5LSL A;  1I94 F;  1YZ7 A;  2YNH B;  3MEC A;  2V8V A;  2N82 B;  1RB0 A;  2CQP A;  5J2N B;  4J9N A;  3QLH B;  2F9J A;  4HHJ A;  1F3F A;  2HEK A;  3EVW A;  1A6L A;  3RYL A;  2ZZN A;  4JI4 J;  3QIP A;  5KG2 A;  4C8Y A;  4KHP F;  1TAQ A;  1RT1 B;  3VGT A;  5HRO B;  4K4W A;  3I0R A;  1Q7L B;  3GJQ B;  3LAN A;  4YFU A;  2B7B B;  1Q86 T;  1WI6 A;  2HWT A;  3MM8 A;  5E3A A;  1SBR A;  1S1X A;  5HVH A;  5H1S V;  5BR8 F;  2XWX A;  4QWB A;  1IKX B;  1B70 B;  2ADB A;  3QGH A;  3GQC A;  4DV5 J;  2AYB A;  2HNZ A;  4FYV B;  3R1L A;  3OW2 R;  1N4L A;  4JI6 J;  5DM6 Q;  1L3T A;  2DRA A;  1TP7 A;  4G6V B;  1NDP A;  3D0H E;  1CJU B;  2DCU B;  4OZN A;  1AT1 B;  2BZ2 A;  3QWP A;  3W9I A;  4DV0 J;  4C11 B;  2J6S A;  2CJX B;  3PYF A;  1RP5 A;  4O3Q A;  3JSY A;  4F0H A;  3G8S A;  2HWH A;  3Q8U A;  1GT8 A;  3CCZ A;  3GE9 A;  4IO1 A;  5DDR C;  4DX8 H;  2ADC A;  4TKT A;  3HDS A;  4BWM A;  4IFV A;  5KFF A;  4GO5 X;  3CC4 S;  4LFA J;  4BS2 A;  1S7H A;  3H5X A;  4OHY A;  3JYT A;  2IMO A;  3CDW A;  2R8G A;  1WHY A;  4F4X A;  2E5G A;  2LU1 A;  2V34 A;  3W2V B;  2R2U A;  3GJR B;  1WDT A;  4PXE A;  3MWB A;  4O3N A;  4WYW A;  4LBH A;  5M2P A;  1FDA A;  2UXD J;  2HHQ A;  2P9C A;  4X2B A;  5B0A A;  1HNI A;  2CYY A;  3T9Z A;  4ZPW R;  4DMZ A;  2IC3 A;  4YHH F;  3T1H F;  4U8V A;  1S9G A;  3N6M A;  1RYS A;  2OD6 A;  3PYE A;  3VZI A;  3HSD A;  4MYU A;  4XDC A;  2BQ3 A;  4BWJ A;  1S99 A;  3Q86 A;  2JEJ A;  2XS2 A;  2CPX A;  3LUY A;  4C98 A;  1VQ6 S;  2ZUG A;  1RWO B;  3M32 B;  1JLF A;  3KK1 B;  4HYK A;  3DLK B;  4AD6 A;  5DLG A;  1JJ4 A;  1P1L A;  2JEF A;  3BYP A;  3GYX B;  2ZKT A;  4MIB A;  4NAS A;  4WCE Q;  5BYR A;  1BQN B;  3VAJ A;  2WW4 A;  4QWC A;  3DLG A;  2G13 A;  5GVQ A;  1X4B A;  3L95 X;  3RGI A;  4C11 A;  4DN0 A;  1FJG F;  1KP6 A;  1LW0 A;  1W7W A;  2W9B A;  4DV7 J;  1B3T A;  1FFW B;  3MD1 A;  1ZAX A;  2DY1 A;  4KO0 B;  3W2W B;  2XLK A;  2Y9H A;  4X4S A;  4ED4 A;  1ZA2 B;  1JNZ B;  4L3N A;  1WTB A;  2XLI A;  3QSY B;  1D8Y A;  2OFH X;  4H4K A;  4KV8 A;  1FXL A;  3B82 A;  5E5N A;  2XO7 A;  4ER8 A;  5J2N A;  2YH1 A;  4LFB F;  2OPQ A;  3PKY A;  3HJV A;  4NZ0 A;  3NGD A;  4ECW A;  4DL4 A;  4ETZ A;  1U25 A;  2E1R A;  2DO4 A;  2GJ2 A;  5K9F A;  2R7W A;  1KQF B;  5HRO A;  4OX7 A;  3AY0 A;  2BKN A;  4K2X A;  4M5G A;  4QWE A;  3MHY A;  2HFN A;  3BDE A;  3C6U B;  1VQ9 S;  5FLX Y;  3MM9 A;  2KI2 A;  2YQ3 A;  4Y6I A;  3V6K A;  4ZJQ A;  1CVJ A;  5B0E A;  2N7Y A;  4GC6 A;  2UU9 J;  2UXC F;  2XMM A;  3HHL A;  1KRP A;  3FNN A;  4AE5 A;  4NPO A;  3SV3 A;  3KLE A;  1FDB A;  1TKZ B;  2ZVS A;  4NA2 A;  3UDL A;  4ZLP A;  4ZHR A;  3JQK A;  4LFC J;  1KVK A;  4UOH A;  1AFI A;  4WII A;  1PYS B;  4X66 F;  2Y3Y A;  5KFO A;  1EAY C;  3QRQ A;  3MOJ B;  4UQG A;  2J7W A;  1HNV A;  3D1Q A;  4TVA B;  4C3K A;  1SC4 B;  3V6J A;  4RW4 A;  2AJ2 A;  4R5P A;  3WC2 A;  3NNA A;  2WK4 A;  4DR3 F;  1HHQ A;  2MMY A;  3J7Z T;  1FK9 A;  7FDR A;  2ZHB A;  1HWK A;  1EZZ B;  1XR7 A;  5AJ3 J;  4Q43 A;  3N01 A;  5KFP A;  1HMV A;  3RW6 A;  3OFG A;  4TNO A;  2A6M A;  2KYZ A;  3MPY A;  2JC1 A;  4Y34 A;  5ETV A;  3TVK A;  1ZPV A;  1YTY A;  1SH3 A;  2OGU A;  5L1I A;  2DR7 A;  3H0P A;  3MAA B;  5LMU F;  4B9L A;  4F2R A;  2ROP A;  5K14 A;  3CME S;  1UL3 A;  2AYE A;  3OTE A;  3KLV A;  3DMJ B;  4MTP A;  4TY8 B;  1J27 A;  2CXE A;  3GJT B;  2KZM A;  3CW2 C;  3LTO A;  3Q8S B;  4ECU A;  1S6Q A;  1JJC B;  2BRL A;  2K06 A;  2EFN A;  2ZBP A;  4K4U A;  1NO8 A;  2DGS A;  2EEY A;  2U2F A;  4M5L A;  3PXG a;  2LXU A;  2YKO A;  1XMO F;  1T03 B;  4UOC A;  2HVI A;  1UVJ A;  2Z4P A;  2KZZ A;  1VGY A;  1PAE X;  2NSB A;  3MM8 B;  3UNY A;  4OYZ A;  5CXT A;  4A8S A;  5EGY A;  1SCJ B;  1L5U A;  1PJ6 A;  3HKZ D;  4DSK A;  1HA1 A;  1SKR A;  5HLF B;  2QTW A;  1S6P A;  1XMB A;  4DU7 A;  1LQ9 A;  2FHJ D;  2E5H A;  3JQM A;  3M8Q A;  1L3V A;  2QEX S;  1D1U A;  4MFB B;  1FI4 A;  3VV2 B;  2MKS A;  2YWF A;  1UWA A;  2HG4 A;  4OZ5 A;  4EO8 A;  2RS2 A;  2X51 A;  1VRU B;  4PRF A;  3HHK A;  5E33 A;  3C6T B;  2XCA A;  3HT3 A;  2VJU A;  1NM2 A;  2VKZ G;  2KRB A;  1K1S A;  2E66 A;  2RRB A;  3HLU A;  3MMA A;  2COL A;  4AXI A;  2L9D A;  4LF8 J;  5A2Q Y;  3KMQ A;  1IKW B;  1N6Q A;  1WOS A;  1V3R A;  3DXS X;  4TN2 A;  3D9B A;  3BSN A;  4ED8 A;  3CJ5 A;  4LRF A;  4PAB A;  1GXL A;  1JLG A;  2O01 C;  2YQ0 A;  3EGV A;  3IBC B;  5AE1 A;  4X4R A;  4QW9 A;  1PG5 B;  2CQ4 A;  1R27 B;  1PO6 A;  3IWN C;  1TQL A;  4YDX A;  4ZIW A;  3CF5 Q;  1NPK A;  4RNO A;  1TL7 B;  4CLU A;  2AT1 B;  1AA1 B;  1CBK A;  2BMB A;  3HX9 A;  2PMZ D;  1KOO A;  1QY7 A;  3FEY B;  1WSR A;  4CM2 A;  2NXJ A;  5E41 A;  3OVA A;  2Q6C A;  2OI2 A;  3F73 A;  5CYM A;  4BLG A;  1XNQ F;  5ETT A;  4CLY A;  1VQO S;  1X9M A;  4K4V A;  4NXM F;  3H4B A;  4JI0 F;  3KUH A;  1XMQ J;  2BW2 A;  1HQ2 A;  2GIQ A;  3VAG A;  3GB0 A;  1Q5Y A;  2DO0 A;  2KHD A;  2R7O A;  4NYP A;  3VHQ A;  1FKP A;  3BKF A;  4FNH A;  3J81 Y;  2MQM A;  4OZ0 A;  2HGL A;  4F4K A;  1NSK L;  2DHS A;  2Z30 B;  2XSF A;  4WYL A;  3PKM A;  4LF1 A;  3FZ2 A;  1Q81 T;  2YNF A;  1MU2 A;  4MAK A;  4C8M A;  3UDV A;  2IM2 A;  2LMI A;  4IRC A;  3EWG A;  2RS8 A;  5DZ6 A;  3I56 S;  1UVM A;  4CP5 A;  4NML A;  2ZIT A;  4RX6 A;  1SPB P;  4WFY A;  2FB0 A;  4ZDN A;  1JLA A;  2HLT A;  1WHW A;  3QT5 A;  1HR0 F;  3FRZ A;  4JYA J;  3CJK B;  3IA0 A;  4HHH A;  4JI5 F;  2XGP A;  5E2Q A;  2J0W A;  4H4K C;  3PO4 A;  3W7B A;  4MH8 A;  3C15 A;  1K73 T;  3LAL A;  3S7R A;  1T9X A;  3CXC R;  5AXL A;  5L9X A;  4NRT A;  3TVZ A;  5K14 B;  1WNE A;  1RGV A;  1G1X A;  3ZZT A;  4X62 J;  4QYZ J;  3ONQ A;  3DRX A;  2ZD1 A;  2ZD1 B;  3OSP A;  5KG5 A;  3C66 A;  2A10 A;  3LP1 A;  5DM7 Q;  1JIH A;  1RT7 B;  2FJE B;  1GNK A;  3DOK B;  4D3G A;  3JTP A;  3OTB A;  1R8C A;  4I7F A;  2ZVI A;  3TYT A;  1XEZ A;  2CQD A;  1DLO A;  2GAG C;  2KT2 A;  2AZ3 A;  1GXU A;  3JSR A;  2CPE A;  3R7B B;  1X8D A;  4JI2 F;  2JWN A;  3SFG A;  4EI2 A;  5A8W B;  4NLO A;  2CPD A;  3BN4 A;  2HFO A;  2IJR A;  3CB4 A;  2FHM A;  2Y0B B;  3MM9 B;  3OXL A;  1LOU A;  2Q66 A;  3TUP A;  4QPT A;  4K8R A;  1M5K C;  2RDJ A;  2R3V A;  2RHQ B;  3AQP A;  4K0K F;  2GCF A;  3NOG A;  2VB6 A;  4Z2X A;  1B64 A;  1F6T A;  2JFD A;  4B9N A;  4JYA F;  2C22 A;  2YH0 A;  4B3R J;  1HWI A;  1UEV A;  1HR0 J;  1R0A A;  2P2C B;  1SB6 A;  3AA8 A;  2VPY B;  2XHC A;  3NY0 A;  4YR3 A;  3AD9 C;  4HR2 A;  2MKJ A;  2OSQ A;  3C6U A;  3KJF B;  4GVL A;  2DTJ A;  4PAA A;  2J9D A;  2K7K A;  2UUT A;  3MMC B;  4WE1 B;  2HVD A;  3RRG A;  1QVF R;  2EC0 A;  2CVE A;  1HPZ A;  4ZPV R;  5A76 A;  4B9V A;  4WU3 A;  5E3Q A;  4FF3 A;  2ZOF A;  1WEX A;  3OD2 A;  2MZR A;  2R7S A;  1C4C A;  3CCM S;  4IQX A;  2GFF A;  2BAB A;  1T0T V;  4J91 A;  4U7U D;  3SXL A;  1LW0 B;  1FA0 A;  4DR7 F;  3K8V A;  1VMB A;  2XY7 A;  2LQ5 A;  3CCE S;  3ET6 A;  5IZH A;  2VV5 A;  1HQE B;  3DI6 A;  1RA7 A;  4Y28 C;  5F0U A;  4V19 X;  2J76 E;  1RTZ A;  2C1E B;  2XB2 D;  1M5O C;  2ZH9 A;  4JB8 B;  1N36 F;  4KY3 A;  1JLF B;  3DN9 A;  2HRY A;  4NXN F;  2RUS A;  4DEZ A;  5KFB A;  2D3U A;  1CLF A;  1U26 A;  3BGR B;  1YI2 S;  2J6T A;  1CJV A;  2F8M A;  1YJR A;  2W01 A;  4O44 A;  4EO6 A;  1BQN A;  1Y10 A;  3I9V 9;  3US5 A;  3B6B A;  4CDI A;  4USH A;  3FC9 A;  8RUC A;  3G87 A;  2AIR B;  4HAC B;  4PWW A;  5EWG A;  2ALZ A;  3MPW A;  4N5S A;  1RT6 A;  3AJD A;  1VQ5 S;  2HBZ B;  1LXN A;  1JLB B;  2HND B;  2WB1 D;  3ZTQ A;  3QT6 A;  1N88 A;  4ZPB A;  1NK8 A;  3LP1 B;  2DR9 A;  1QE1 B;  4A8X A;  1ZM2 A;  1OPI A;  1BWV A;  1RHJ B;  4L72 B;  4CLW A;  1RLC L;  1OMS A;  3GSI A;  1U0H B;  2F1F A;  4OZL A;  3GU0 A;  1NH7 A;  3Q8Y A;  1UFL A;  3C14 A;  3W66 A;  1SUQ A;  4MT1 A;  4F36 A;  1A9N B;  3OQ2 A;  5D0R A;  3ZTO A;  4F4A A;  3KDO A;  3SSQ A;  4ALZ A;  1RIS A;  3CCJ S;  3PX4 A;  1TVR A;  4WJB A;  3TRG A;  2Z58 B;  1EET B;  1M1H A;  2AHO B;  1SL1 A;  1RTH A;  2CWK A;  3OL8 A;  1U6F A;  3FGV A;  5CYM B;  1T7P A;  2HGM A;  2LCW A;  1GMV A;  1VR6 A;  1KON A;  4OYO A;  4YQW A;  3BO3 A;  1TFY A;  3HZG A;  4X4U A;  1TKX A;  3TNV A;  3DLL Q;  1X4C A;  3N5B A;  2ATL A;  1RI7 A;  3THT A;  2DGV A;  1WF0 A;  2GVZ B;  2EI5 A;  4OHW A;  1NSP A;  4ZPT R;  4URS A;  1B0T A;  2V8G A;  1CQM A;  2B43 A;  3TA1 A;  2K3K A;  2I8E A;  1ELO A;  1BHN A;  3LGM A;  1HW9 A;  4ERD A;  3NBP A;  4H4O A;  4EK2 A;  5ETK A;  2KFZ A;  4ENO A;  2VBW A;  5M2R A;  2NXU A;  1Y00 A;  1YG0 A;  2EK6 A;  3EIC A;  1JLG B;  3MED A;  4QR2 A;  3K59 A;  4K5S A;  4QWD A;  2YWW A;  2Z8Q A;  4UOG A;  4L3K A;  4PPZ A;  2HQC A;  2M70 A;  4BCA A;  4X4V A;  1OPZ A;  3G86 A;  5F8J A;  2DIS A;  1F2G A;  1R6Y A;  4J9K A;  2BYC A;  1S1U A;  2DK2 A;  4U96 A;  3M2R B;  3NGK A;  5IC6 B;  2NRE A;  2XMA A;  3QSI A;  1D3W A;  2BE9 B;  5EWF A;  2FLP A;  4TY9 A;  3LP2 A;  2OIH A;  4JI3 F;  5KG1 A;  4K59 A;  3OR2 A;  2MY7 A;  4IR1 A;  4X64 F;  3AXM A;  1TKX B;  3I96 A;  5D0G A;  4E2F B;  1URN A;  4ZCK A;  1OY8 A;  2HZC A;  3TJ9 A;  1YZ6 A;  3Q24 A;  5GME A;  2ZJR Q;  3BB5 A;  1T94 A;  1IBL F;  2UXC J;  2KU7 A;  1FXR A;  1PSD A;  2VFR A;  3IWX A;  3HCX A;  3RG6 A;  2N7C A;  3RBE A;  2MQN A;  4DR5 J;  4NXM J;  3R5D A;  3BV8 A;  1UTA A;  2EFO A;  2MB0 B;  4USK A;  1GFW B;  2KFY A;  5J2M A;  2HHH F;  3KNA A;  1ROF A;  1JKH B;  2WTF A;  4C7Q A;  1XWL A;  2WZ1 A;  3MR6 A;  2HNY A;  2MZQ A;  3EE3 A;  4R25 A;  4KGX B;  2XI2 A;  1E6V A;  4UW2 A;  3M2V A;  5KFX A;  2HQD A;  2D69 A;  5A2Q U;  4LF5 J;  2B4V A;  1WC3 A;  2VG7 B;  3KLG B;  3KG0 A;  3DMJ A;  4LF7 J;  2H1Y A;  1YGY A;  2L41 A;  2MKI A;  1QUV A;  2I6W A;  2UVU A;  1ZS6 A;  2JOQ A;  3V81 A;  4QJV A;  4MYT A;  2XC9 A;  2AZ1 A;  1FJC A;  4Q2L A;  3G82 A;  4RUB A;  3UD5 A;  1M5P C;  3HFK A;  2CDQ A;  2P9E A;  2Z57 B;  3IGV A;  3P96 A;  3MEE A;  2BE2 A;  2KJW A;  3TAM B;  1BLU A;  1SUQ B;  4P52 A;  5CCL A;  4YY3 F;  3BSO A;  1TL3 A;  4RBT A;  2R42 A;  2HSE B;  2HQ3 A;  3DYA A;  5HL7 Q;  3D6T B;  2VZ9 A;  4KHM A;  4YEA A;  2IAJ A;  1RAG B;  4O3O A;  3KYL A;  1HI8 A;  1PBA A;  4L76 A;  1GK8 A;  3C8Y A;  4LRD A;  1FK9 B;  5AXK A;  4DQS A;  3POT B;  1BE4 A;  1O0P A;  3QGI A;  1VIX A;  2MSS A;  1URR A;  3W62 A;  3NGR A;  4AND A;  3SYZ A;  4KRW A;  2MXY A;  1R8H A;  2P8I A;  3MUR P;  5I42 B;  3NNC A;  2B9W A;  3CMA S;  4C2M A;  2MLZ A;  4A8F A;  3DU6 A;  3ZNJ 1;  4C8L A;  1E6Y B;  4UZB A;  3KMS A;  2RF2 A;  3ZTP A;  4YDD B;  1UVK A;  3TEH B;  5HN0 A;  4FS2 A;  3JS9 A;  1SKU B;  4DPT A;  2DB1 A;  3QO9 B;  2RQC A;  1RAC B;  2GS8 A;  2NPI A;  4F50 A;  1R0B G;  3SV4 A;  2X3G A;  3RUB L;  3HHN B;  2XZT B;  5CH7 B;  4LVN P;  2OD4 A;  4NLR A;  3HPO A;  3PIP Q;  1CSJ A;  1NAQ A;  2G0I A;  1JXV A;  4ZVT B;  2B0G A;  3ITH A;  1IR2 A;  2MEW A;  3UW1 A;  4J9U E;  2LQJ A;  4DZD A;  5DG8 A;  3A3O B;  3MM5 B;  2QL5 B;  3DLK A;  3GON A;  3DHX A;  3MM5 A;  4OYW A;  3DRS B;  5T7L A;  5AXM A;  4DV5 F;  1VLY A;  4NWB A;  5BR8 J;  3NWG A;  3UE2 A;  2W7P A;  2ZH7 A;  3UR0 A;  5ETM A;  3JSM A;  2VOD A;  1F1B B;  3W5Y A;  4MMO A;  2V8D A;  1DRZ A;  4IRD A;  3OLA A;  3OHB A;  4B9M A;  2VHG A;  4GO7 X;  2PGC A;  5H9E J;  3BGU A;  2VKR A;  1H2V Z;  4X65 F;  1QVG R;  1MSW D;  3PAC A;  3PYD A;  3GFY A;  4KO0 A;  1BY9 A;  1JNR B;  4LSL B;  4UQT A;  3PIO Q;  2FD2 A;  2PO4 A;  3GR0 A;  4P9S A;  1LFP A;  3KK1 A;  4DV3 J;  4KGZ B;  1Q16 B;  3G2X A;  3PX6 A;  2OJ3 A;  1TL1 B;  1R8A A;  3D5M A;  2JJ4 D;  4P2X A;  2OH2 A;  4NZ7 A;  2NXC A;  2V8H A;  1K9M T;  5G0R B;  3DGP A;  2BJ7 A;  2HZA A;  2ASJ A;  1PGZ A;  1FRL A;  2BAN A;  4HT5 A;  1VK3 A;  3TAM A;  1U1R A;  3M6W A;  2WHO A;  1D9D A;  4WTO B;  3FZB A;  2H65 B;  3PFE A;  2PFD A;  5LMN J;  3IN5 A;  3GTY X;  1CQN A;  1FD8 A;  4YN3 B;  1VBY A;  4OYX A;  3VAF A;  3CO9 A;  4LT6 A;  1XBW A;  4QU7 A;  2AWZ A;  1WF1 A;  2KT5 A;  4LSZ B;  3T3F A;  2FHO B;  2H9Z A;  2Q43 A;  5IOL A;  4DL6 A;  2FLN A;  1XTZ A;  1DY3 A;  2VAS A;  4C8N A;  1IBC B;  1TMM A;  2OLW A;  2ZBQ A;  4M5M A;  4QQB A;  4P2F A;  4J9P A;  4ECS A;  4JI8 J;  2ZDP A;  2VUG A;  2UV8 A;  3QGG A;  1YJT A;  1OJ4 A;  4DUT A;  4MK8 A;  4OIX A;  4DUY J;  1RT1 A;  2OO4 A;  1X5T A;  3O44 A;  2BA9 A;  4IFV B;  4R8U A;  1FFS B;  3BQ2 A;  3I82 A;  4J9R A;  2PI4 A;  3B8H A;  2GV1 A;  2RE1 A;  1BQM A;  3CJR A;  3IMQ J;  4RW6 A;  5KFL A;  4O3P A;  3ENW A;  2Q3P A;  3GYN A;  2WCX A;  4DG1 B;  1C4A A;  2CJB A;  4B3O A;  4YB7 A;  4QIW D;  2KDO A;  4OI3 A;  2LDI A;  4WBF A;  1QM9 A;  2B5J A;  1VJW A;  5AE3 A;  1MLA A;  1MNE A;  5E0O A;  1S97 A;  4CO5 A;  3RBX A;  4CLF A;  1S1X B;  1S1U B;  1S1W A;  3CUN A;  4YOE A;  5C25 B;  5CZD A;  4ED7 A;  3QT8 A;  4KH1 B;  3CCU S;  3SZ2 A;  3DLE A;  3CJ3 A;  1PIL A;  3MPD A;  2F40 A;  3MMA B;  2AMC B;  4IH5 A;  4YR2 A;  3D3C J;  3LP2 B;  4UZC A;  2PC6 A;  1FRX A;  3BBC A;  3MCO A;  3QAT A;  4OI1 A;  4ITS A;  4TU8 A;  3L3C A;  4F4Z A;  5HSP A;  4DS4 A;  4JBC A;  3VAI A;  3ZXW A;  2CPY A;  1Q79 A;  1H2T Z;  4IG3 A;  4NYO A;  2DNO A;  1M5S A;  3QWU A;  5K8O A;  1RQ0 A;  3HO1 A;  1NZ8 A;  1H98 A;  3Q23 A;  2HIY A;  1D8Z A;  1RAE B;  5DS7 A;  2DGU A;  2DBB A;  2DGO A;  2M88 A;  1KTQ A;  4JI8 F;  9RUB A;  1S6O A;  3PV8 A;  3DYA B;  1KVI A;  2D3O 1;  5L38 A;  4LR8 A;  4DSF A;  4PG8 A;  4B02 A;  4IUF A;  1SIZ A;  3BBF A;  3UN3 A;  3IAM 9;  1RWV B;  5BYS A;  4I6A A;  4F02 A;  4DPW A;  2A2D A;  1VIS A;  2J0X A;  2QA2 A;  4MKV A;  3V81 B;  2HHX A;  2KN4 A;  1MMD A;  3EVO A;  4ZJO A;  4NCB A;  4IOC Q;  1IM4 A;  3D6M B;  5D4L A;  4E8U A;  1Q4R A;  3G96 A;  2WVF A;  5FJ4 A;  3O6Q A;  1C1C B;  1VQP S;  1H7X A;  1FTC A;  4WWS A;  5KFI A;  2ZBC A;  1BQX A;  2DXD A;  4F25 A;  2M52 A;  2RU3 A;  3JB9 k;  2AGQ A;  3CC7 S;  4DR4 J;  2M9K A;  1S1T B;  3R9L A;  1FEH A;  3QRR A;  1CJT A;  2NZC A;  1X9S A;  4DV3 F;  2YBV A;  3BN7 A;  4CO2 A;  3H20 A;  1X7V A;  3IWL A;  4UOF A;  2LEA A;  4JP8 A;  1HBO B;  3DGV A;  1CJK A;  8AT1 B;  4X65 J;  2RT3 A;  3OUY A;  1K1Q A;  1O6X A;  1VRT B;  4RW8 A;  4OZ2 A;  2O3D A;  3J7A N;  1SL0 A;  4LIR A;  1PJ7 A;  2BJD A;  2MY8 A;  1H7W A;  1U2F A;  1Q8B A;  3J81 U;  3DDK A;  2EKY A;  2LU2 A;  1HNV B;  3UVJ B;  2CZ9 A;  2AYG A;  1U7L A;  5ETR A;  2ABY A;  3O5T B;  4NX9 A;  4DX5 A;  4F4W A;  1MML A;  1YQH A;  4IOB A;  1GH8 A;  1U6Z A;  1LWE B;  3A8E A;  4ZVR B;  7FD1 A;  3HHD A;  2ILY A;  3UWT A;  3SCK E;  4EMD A;  5L1L A;  1KR4 A;  1RT4 A;  3M2U B;  5L1J A;  2RKI A;  3FK4 A;  4KIA A;  4EZ6 A;  2CNO B;  2AJ4 A;  1NBE B;  3NCP A;  4O0N A;  5AT1 B;  4N47 A;  1VRQ C;  1Y5I B;  2PT0 A;  4BC9 A;  4C8K A;  2DCL A;  2F63 A;  4QIF A;  4DR2 J;  3B4D A;  2VQF J;  3ET6 B;  3MOZ A;  2MKC A;  4M5D B;  3T6B A;  2VA3 A;  4FF4 A;  2KFN A;  1QSY A;  2D1C A;  4RW4 B;  4BC7 A;  4N76 A;  2WVE A;  1H3D A;  1RHU B;  3B78 A;  4ZVP B;  3Q2S C;  1CEZ A;  3OVB A;  2AGP A;  1UPP A;  1X4G A;  2C42 A;  2IFX A;  1U09 A;  2QLJ B;  2W1B A;  3CED A;  3ZZR A;  4QWA A;  3H7H B;  1RZM A;  5EX0 A;  3FBC A;  2DH9 A;  5KFZ A;  1SV5 B;  4DL3 A;  1WSV A;  1FNO A;  1YJ7 A;  2XI3 A;  3BYR A;  3CCT A;  3H40 A;  3I6P A;  1ZTT A;  1UPM B;  4RWW A;  2F65 A;  2DVI A;  1B7F A;  4JOU A;  3N28 A;  2R7R A;  1IBK F;  2CJK A;  1WAC A;  1YX2 A;  2BJ9 A;  4O3R A;  1RT3 A;  2QE5 A;  2IHR 1;  2J9C A;  4C8O A;  1YDL A;  2HAI A;  4W92 B;  4WP9 A;  3D0I E;  3EGZ A;  3Q2T C;  1I5O B;  3BS9 A;  4PPD A;  3V4I A;  3LO3 A;  3QJP A;  4CTA A;  4ATN A;  4DV1 F;  1M90 T;  3TW0 A;  4DL0 C;  4DF4 A;  3VQT A;  1T95 A;  3VGV A;  5B7W A;  2IBO A;  4R8U B;  3M30 B;  2OTL S;  1VQ8 S;  5F8I A;  1NHV A;  3EXY A;  2BW7 A;  2XNR A;  2DIU A;  4HL9 A;  1PYO B;  4OHX A;  4RJV A;  1X60 A;  1HFE L;  3HVW A;  4LBI A;  2ZH4 A;  1TK5 A;  4ED2 A;  3D1H A;  3D68 A;  1APS A;  1NPR A;  2LFV A;  4KV8 B;  4CQ1 A;  2R8H A;  2GO9 A;  1FEE A;  1SJ4 P;  1FE4 A;  2ZWO A;  5CZV A;  4LF5 F;  2C3P A;  3MMB A;  2ZUA A;  1IWG A;  3N6L A;  4NLX A;  1TK0 A;  1S72 S;  5DQI A;  4B9T A;  1DLO B;  2JL9 A;  1DQA A;  2QRR A;  4NLT A;  1VIO A;  2AU0 A;  2QLW A;  4TLQ A;  1T05 B;  1N0U A;  3GFZ A;  1J2V A;  1RSC A;  2IAJ B;  2LQ9 A;  4KFB A;  5CHC B;  1U8S A;  2ZHO A;  2IVM A;  4A48 A;  5HBM B;  2K1R A;  3G71 S;  1WG1 A;  4DJB A;  5C2C A;  2CQB A;  3MMJ A;  2ZH1 A;  2V0N A;  4JI1 J;  2W8K A;  5E3R A;  1IBL J;  2YNI B;  5J2P B;  1YKW A;  1TL1 A;  3MF5 A;  3M2U A;  2KH9 A;  1TAU A;  2N3L A;  3Q83 A;  3K5P A;  5K20 B;  1X4H A;  5THW A;  3UQS A;  1NCL A;  2JLG A;  3X1L B;  2ZNZ A;  1ZZN A;  2JEI A;  3MUV P;  3B54 A;  3KDN A;  2E1C A;  1OYD A;  2D74 B;  2V2V A;  2ZM6 F;  2H48 B;  5F3Z A;  2V9K A;  5HMY A;  2HBQ B;  1IKX A;  2R7Q A;  3T9N A;  4RZR A;  4N56 A;  4RU9 A;  3GIJ A;  2NS1 B;  4DSE A;  1KD1 T;  1RU1 A;  1MWZ A;  3QID A;  1RUS A;  3MI7 X;  1Y5N B;  4HT7 A;  1S77 D;  3PEH A;  4RW7 A;  2KT3 A;  4ECX A;  3WHI A;  2HNY B;  2IM3 A;  4ZVU B;  5F8L A;  1X4F A;  1JQG A;  2NUH A;  1M0S A;  4N8N A;  4ZVS B;  5F41 A;  3D66 A;  1TL5 A;  3ITH B;  3NS7 B;  1SH2 A;  2AEF A;  1IR1 A;  1S59 A;  2KM8 B;  5EUH A;  2AJ1 A;  2HMI A;  4DQI A;  3VR1 A;  2X3D A;  3M9M B;  5FDL A;  2AGO A;  4NI2 A;  3F0N A;  2MGZ A;  4AL5 A;  4ZOS A;  4DS5 A;  1TZ0 A;  4CH1 A;  3EZ5 A;  2C2R A;  2C3M A;  1JJ2 R;  2UUW A;  4N77 A;  4JI1 F;  3DLJ A;  4HDG A;  4ZVF A;  4V19 J;  2HFU A;  4A8K A;  3H2V E;  1KHW A;  2WW8 A;  3GP9 A;  3OPK A;  3SQG A;  4CTA B;  2N3O A;  1N6Q B;  3J80 U;  5A8K B;  4OLP A;  3TZY A;  3U7J A;  1WKL A;  1S57 A;  2WOM A;  3RTV A;  4FZV A;  5A8R B;  4XO0 A;  3DOL A;  4M5J A;  1LXJ A;  2RQM A;  1F5A A;  2RRA A;  4X84 A;  4A46 A;  1P27 B;  1BGX T;  4MIA A;  2ZZM A;  1FDD A;  1FO1 A;  3FUY A;  3M2R A;  4DR1 J;  4K50 A;  1R8P A;  1VDH A;  3J7Y I;  3UCG A;  4K2J A;  3MDF A;  3N79 A;  3P5B P;  1J5E J;  1C0U A;  1KLN A;  1R0C B;  2HVE A;  5C24 A;  3GIM A;  5CYJ A;  4GC7 A;  2XSJ A;  4DFM A;  5ETS A;  2F9D A;  3IBW A;  3IM8 A;  3C6T A;  1UVL A;  1AZS B;  3E3X A;  4B3T F;  3NCQ A;  5KFG A;  5FLX U;  3NKY A;  3DLE B;  5D8H B;  2WOM B;  3PW0 A;  4CO4 A;  3EPG A;  3PCO B;  1K0V A;  5D6G A;  2B4U A;  5KT4 A;  1TR0 A;  1HNZ F;  3NMA A;  3DFE A;  1S0V A;  4CLZ A;  3EMT A;  2HUR A;  4QBU A;  4G1Q B;  1R6V A;  1FRM A;  3TQ1 A;  2DGQ A;  1RTD B;  1QAJ A;  1UET A;  4EWT A;  1JMT A;  4NEZ A;  2GMJ A;  4GVB A;  4RNH A;  4UUX A;  2KKH A;  3KLF B;  1AXQ A;  1UCN A;  2EK1 A;  1BQM B;  2RQ4 A;  2JLF A;  3M2V B;  5KT2 A;  1Q7Y T;  1TL4 A;  2CPZ A;  3GWC A;  1N36 J;  2HHT A;  4NRU A;  3KLH A;  1S6P B;  2VIH A;  5D77 A;  3LP0 A;  1JLC A;  2A3J A;  2VU5 A;  3DOM A;  3RR8 A;  5KOX A;  2DRB A;  1CS4 B;  2JH3 A;  3IXQ A;  3KHH A;  5IM0 A;  3EPI A;  2CZV C;  2DEI A;  2JVR A;  3M1V B;  2FVR A;  4ES3 A;  1U2R A;  1Y3J A;  4I2P A;  4HAC A;  3R27 A;  2W8L A;  4M1K A;  1O51 A;  4HI1 A;  4NA1 A;  2ZH8 A;  4GVB B;  2OHD A;  2M5Y A;  1UWB A;  2DIT A;  2H3E B;  2RD5 C;  2ZOG A;  4P7T A;  5IT4 A;  1R3N A;  4K4Z A;  2KL8 A;  4A8O A;  1ZM4 A;  2PEB A;  4Q44 A;  4UY8 5;  1HIY A;  1HD0 A;  2ACM A;  4W90 B;  4QIG A;  4M5H A;  1MWQ A;  3OR1 B;  1I1G A;  1WEY A;  3ISN D;  4WF9 Q;  2G1D A;  3QRP A;  1TKZ A;  4K0K J;  3K2Y A;  1V9O A;  2DH8 A;  2Z2M A;  1FKO B;  1RHR B;  3PO5 A;  4LSL A;  1RWK B;  4ZCI A;  2UXB J;  1X5P A;  4NYZ A;  1YBA A;  1NJI T;  3PEJ A;  5E3C A;  3DNC A;  4WZM A;  4J9V A;  2Q79 A;  1N34 J;  4ES2 A;  4LF4 J;  1YSJ A;  3CNQ P;  4LF8 F;  2PMH A;  3R5J B;  4XPC A;  2WVB A;  2EWH A;  4KAI A;  1QDU B;  2KJV A;  1R8B A;  4JV2 A;  1FES A;  3I0S B;  4ZA1 A;  4F0K A;  3GV7 B;  1DBD A;  2GHP A;  2HFV A;  2O1P A;  3N6N A;  1U45 A;  3KG1 A;  2AYM A;  1H73 A;  4ZP6 A;  5HMZ A;  1YIJ S;  3ISZ A;  2V4Q A;  2IVY A;  3GIK A;  2UVW A;  2FPH X;  2LEC A;  2V50 A;  3D6H B;  3E51 A;  1F5C A;  3R5G A;  5KG7 A;  1LK5 A;  2HFZ A;  3MPU B;  4LF9 J;  3FCW A;  4CLS A;  3BGO P;  4PZV A;  5GAE U;  2NLW A;  1Q1K A;  1ZM9 A;  4CT8 A;  4NCA A;  2JVO A;  3VVT A;  2E5J A;  2MTL A;  3Q8R B;  1U24 A;  1C1B A;  3JXO A;  4ID5 A;  1RXO B;  4DCO B;  4CCH A;  1TVR B;  5I3P A;  1XNR J;  4PXB A;  4ILL A;  1UEU A;  4HEA 9;  1ZM3 A;  4ZVG A;  4U67 Q;  2WSE C;  3AJ2 A;  1DHM A;  3QAE A;  3FRY A;  1K47 A;  4KC5 A;  5I42 A;  1JLE A;  2UP1 A;  3H98 A;  4PWD B;  2OPP B;  5L39 A;  3CIM A;  3OL6 A;  3G8T A;  2DHA A;  2YKN B;  3J81 j;  1QSL A;  4GRS A;  4JV1 A;  2JDJ A;  2BQR A;  2LQB A;  5KFU A;  2WBR A;  3C16 A;  4LMZ A;  3IR6 B;  2V63 A;  3POT A;  4CNY A;  5IV3 A;  4UUW A;  1NKB A;  3AOD A;  3IP0 A;  3QYY A;  1S9G B;  2DXE A;  3W65 A;  4LBP A;  1FF2 A;  1IM6 A;  3CE8 A;  4QR0 A;  4JI0 J;  1TU0 B;  3BEG B;  3JQJ A;  2CNL B;  2QLB B;  2XY6 A;  1CPZ A;  5HQM A;  3SI8 A;  2HVH A;  1QAI A;  2JFK A;  3MR5 A;  2PEH A;  3CD0 A;  3I5B A;  4PQA A;  1KQS R;  2NR0 A;  4U6P A;  4PQU B;  3CDB A;  3HSJ A;  4KT0 C;  1NSQ A;  3PNI A;  3TAP A;  2V2K A;  3CTR A;  5C42 B;  2IA6 A;  3N5F A;  5CZX A;  4ED1 A;  3ENV A;  4PEO A;  1YJV A;  2L48 A;  4K4Y A;  3P49 B;  4DUY F;  3BH7 B;  1NJY A;  4PCQ A;  5KFS A;  4A4J A;  3UNG C;  4MJK A;  1GXT A;  3W63 A;  2IA0 A;  4W4M A;  4WXW A;  4F3O A;  2WVD A;  3PX0 A;  5FD1 A;  1MW7 A;  2CQ2 A;  1VLO A;  3OTC A;  2Z0G A;  4Y2I A;  1X9W A;  1KN6 A;  1XK8 A;  3MCN A;  3EUN A;  4IDK B;  3R5A A;  2DNL A;  4TU7 A;  4DBQ A;  3EXC X;  1SI9 A;  4C97 A;  5KOW A;  4NMX A;  1T8E A;  1L3U A;  4HVZ A;  2CPH A;  5ETQ A;  5J2M B;  1RBL A;  2MJU A;  1VOM A;  4USM A;  1FRI A;  1N54 B;  2W9A A;  3CJ4 A;  1SQE A;  1LWF B;  1NH8 A;  3PRB A;  3W61 A;  3MR3 A;  3CSK A;  4J9Q A;  2W4D A;  3TO8 A;  1DUR A;  2HNZ B;  3MPV A;  2HHU A;  4NLS A;  3WIU A;  3GFX A;  2JLE A;  2F4F A;  3QZ8 A;  2IIH A;  1LW2 A;  2VFS A;  1S4E A;  1KFD A;  2AV5 A;  3DM2 B;  4QZV B;  1HHT P;  3IGN A;  3R97 A;  4FKY A;  1XC9 A;  3HI9 A;  2YXL A;  2NCK L;  1RWX B;  2GC8 A;  3K58 A;  3FSX A;  3TZW A;  5IT9 Y;  1SC3 B;  4M5N A;  1D9A A;  2LA4 A;  2V5H G;  2W4C A;  2XZW A;  3AOA A;  1FVS A;  4I7F B;  1W26 A;  4ZKA A;  2XS5 A;  2CPF A;  1EX8 A;  3NRB A;  5DO2 A;  4CO3 A;  2YTC A;  2C2K B;  2CQI A;  4UTG A;  1NEE A;  5BJR A;  4OJ3 A;  2QL7 B;  3M8Q B;  1REV A;  3M1V A;  2W2N P;  2JX2 A;  4MKB A;  1U1L A;  2NXN A;  3PVX A;  2AJF E;  1QD1 A;  1CS4 A;  2RKI B;  1VRT A;  2DGW A;  3KK2 B;  3HK2 A;  5AJ3 F;  1U02 A;  2FJB B;  4LSN A;  4N41 A;  3ULH A;  2OAU A;  5D78 A;  4QPX A;  2B3T B;  2ZJP Q;  1S0M A;  4B3S F;  1WI8 A;  1W2B R; 
#chains in the Genus database with same CATH homology
 3SBM A;  3IM9 A;  2JFD A;  3QAT A;  3TZW A;  1NM2 A;  2G2Y A;  2VKZ G;  3BV8 A;  4RR5 A;  2C2N A;  3CJ8 A;  5DZ7 A;  2CUY A;  2VZ9 A;  2G1H A;  4RL1 A;  3G87 A;  3HJV A;  3EZO A;  2JFK A;  3PTW A;  3IM8 A;  3R8Y A;  2QC3 A;  2UV8 G;  5CZC A;  3HMJ G;  2VZ8 A;  5DZ6 A;  3K89 A;  2G2Z A;  2H1Y A;  1MLA A;  3TZX A;  3TZZ A;  3TQE A;  2PFF B;  2G2O A;  5CZD A;  2QO3 A;  2QJ3 A;  3TZY A;  3H0P A;  3R97 A;  4QBU A;  3RGI A;  2HG4 A;  3HHD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...