4QR2A

Crystal structure of streptococcus pyogenes cas2 at ph 7.5
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
83
structure length
83
Chain Sequence
MMVLVTYDVNTETPAGRKRLRHVAKLCVDYGQRVQNSVFECSVTPAEFVDIKHRLTQIIDEKTDSIRFYLLGKNWQRRVETLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CRISPR-associated endoribonuclease Cas2
publication title Structural and functional characterization of Streptococcus pyogenes Cas2 protein under different pH conditions
pubmed doi rcsb
source organism Streptococcus pyogenes serotype m1
molecule tags Hydrolase
total genus 24
structure length 83
sequence length 83
chains with identical sequence B
ec nomenclature ec 3.1.-.-:
pdb deposition date 2014-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09827 CRISPR_Cas2 CRISPR associated protein Cas2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.240 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4qr2A00
1T95A 4FN5A 3EXCX 2NPFA 2XEXA 2CVEA 3LH2S 4TNOA 2I0XA 2ZITA 3UI3A 4MAKA 1ZPWX 1ZM4A 3B82A 4ZCIA 2J7KA 4ZCLA 1DARA 4MYUA 4ZCKA 1N0VC 1ZM2A 5G4DA 2WBMA 2L9NA 4ES2A 4MYTA 4QR1A 3ZZ0A 4M1KA 1ZM3A 2EFGA 3B8HA 4ZCMA 2BM1A 2KDOA 1KTVA 2IVYA 3ZZTA 3ZZUA 4ES1A 2BV3A 2BM0A 4QR2A 1ELOA 2E1RA 3B78A 4ES3A 1FNMA 1P9QC 2I8EA 3OQ2A 4QR0A 3E3XA 1ZM9A 1N0UA 1VI7A 1U2RA
chains in the Genus database with same CATH superfamily
2HEKA 2AYBA 4QWDA 4PAAA 4RW7A 3CCJS 1NCLA 3NCPA 4MJKA 3SIPB 3D1OA 4JV5F 4N8OA 4YQWA 1UPMB 4G1IA 5IZHA 3NNHA 2MJNA 4USJC 3AXKA 4Y2AA 3LP0A 4IRCA 2V69A 1TU0B 4PWDB 1RT6B 1TUGB 4WFNQ 2FHJD 1IBLJ 4L3KA 2W4CA 3BSCA 2FZKB 1TL3B 2EC0A 2QZ8A 2NQPA 5AJ3J 3I9ZA 3PR5B 4PRFA 3H5UA 3CJ0A 3QZ7A 4DF8A 2C3UA 5FD1A 1SUQA 3L09A 2B3TB 5DQHA 1KLMA 3A3PB 2NSBA 5ETOA 4DFKA 1RAOA 3CJ4A 3M8SA 2R7SA 5IWAF 3UO0A 3DLKB 1K47A 2E5HA 4KRWA 1TMJA 2R2SA 1NSAA 3MMAB 4DR4J 4ECTA 2H65B 2GHPA 2MKJA 1TTHB 4EFAC 4P10A 4RNFA 3VTIA 3C2PA 1HI1A 4LREA 4DPOA 3DLGA 5ETQA 1N52B 4JI7F 3EZOA 1KDNA 1S79A 1Y0HA 1HNWJ 1YWXA 1HNZF 5E3PA 2K2PA 3CCRS 3TA0A 1S6QB 2VQEJ 2Q6CA 2W9CB 2XNRA 1XERA 1VDHA 2MHNA 2J6UA 1YLXA 1HWKA 4DR1J 1K0VA 2GQCA 1EHWA 4CTAB 1R0AB 4YB6A 4WFAQ 4I6AA 4F0MA 1UEKA 2C2EA 3HULA 1G7CB 4J9NA 3FRYA 3KJNB 3M32B 3ETOA 1JJ4A 4R8UB 3IXQA 3KLGA 1IKVB 5DQGA 4WKRA 4DUYJ 2JHEA 4PG4A 4JI8J 2VFTA 4K4SA 4MIBA 4IRDA 1GTHA 1JKHB 4FYYB 2OGUA 3PX6A 2MLYA 4DPYA 2FDNA 4QIWD 1LKZA 2CJBA 2FZCB 1UVMA 3CDWA 2YY3A 1W7WA 3MM8A 4OYMA 3HVTB 4Q44A 4JV0A 5HBMB 2MZJA 3PX4A 2DNGA 3JAMY 4OJ3A 2MZ1A 3OL9A 2GIQA 2UXBJ 4DR7J 4DSFA 3IBCB 2K8GA 1O6XA 4RBVA 2XI3A 2XBPA 1JQGA 3ET6A 2B8PA 3RUBL 4CH7A 1S1WB 1VBYA 1SQGA 2QA1A 1UEUA 1DTQB 3Q8QB 3TR5A 4J37A 2QJ3A 4UTGA 2GCFA 4F4WA 4DQRA 3VAGA 1H2TZ 2J76E 1U09A 1JLAB 4B9MA 4JYAJ 3I56S 1R43A 4KHPF 4PZVA 4DV6J 2ZOGA 4CLYA 2AKWB 4I7FA 1EQ0A 3P4UB 3EM1A 2W7OA 5AE2A 2AW0A 3ZTRA 1SC6A 2PA3A 2Y1LB 3BKUA 2DR7A 4HKQA 2X7IA 4AT1B 3RYLA 3QT6A 1N48A 2W25A 3FGVA 4N76A 1VRTB 1S72S 4J9MA 2R7QA 1FJGJ 4KHMA 3OJUA 4OMFG 1BMQB 2M5YA 3CMAS 1N56A 3MD1A 3CSKA 3ZTOA 3KXDA 1F9FA 3CPWR 5LM7E 2BE2A 1IBLF 3GSDA 1IKYB 1X5SA 4K7QA 5T7LA 2OUGA 4RUHA 1VIOA 2CNNB 5KG3A 5AJ3F 2VU5A 1Q53A 3C14B 2QMXA 2OD6A 3W9HA 3DLHA 2RH3A 4ZVOB 2HNDA 1WC3A 4HI2A 1SJRA 3FZBA 3QAEA 4DR4F 2HBRB 4O3QA 4HH0A 4OHWA 1T03A 3CJSA 1I1GA 2MZTA 4OLOA 3DM2A 4CO4A 2XGQA 2C3PA 4K2XA 3VWSA 2LXIA 4FXDA 4LIRA 1WACA 3M8RA 4FYWB 2DNMA 3J7AN 1HNWF 3MFIA 3KLHB 1QUVA 2PFFB 2HHPA 3DRYA 3ILLA 2DEIA 2VQEF 5L1IA 4YHHJ 3TYTA 4DR1F 1U24A 3ADAC 3SDEB 1UFLA 3D54A 2BE9B 1FRHA 2ASYA 1M90T 4BWMA 2CQGA 3K5NA 2BQRA 1LFWA 5JUMA 4RLEA 4LRFA 2UVWA 3VHQA 2JWNA 2LDYA 1N5SA 2XULA 4C7QA 1SH2A 1QDUB 4JOUA 1V9OA 4NLYA 3BSOA 4DQSA 2AEMA 1AB8A 3FJ2A 2R8KA 1MN9A 3HX9A 4DUYF 4JI8F 5ETSA 1UETA 1JB0C 5E3CA 4HACB 4X4UA 1TFWA 1RT5A 4NXNJ 5ADZA 4ELVA 4UOHA 3HDSA 3M1VB 3EUNA 4JUZA 3PTWA 4U96A 3U1MA 3RU0A 1IM6A 3JYTB 1QTNB 2Q79A 1RHJB 3OSPA 4V19J 2AF6A 3GFXA 3W2VA 2FY1A 1WORA 2LDIA 4E2FB 3UN5A 2G1HA 1ZTWA 5K8NA 3KK3B 4LRBA 4WP9A 3DGPA 4X4PA 3M8QB 4MAKA 4P74A 1WOPA 2UXBF 1RT2A 1U25A 4DR7F 1B99A 3K59A 1MWZA 5A2QY 2CQHA 2N4CA 2OJ3A 4I68A 2HGMA 1E6YA 3UFCX 1DZ5A 5I42A 2HAIA 4O44A 4LF2A 4MK7A 2OO4A 3NBPA 5KT3A 4DCPB 3SCJE 1HL6A 4NLDA 1BD6A 2HPUA 3HFZB 3AA9A 3UCUP 4JYAF 2IAJA 3TP2A 4DV6F 4FDFA 2FYXA 2VJVA 3T1HJ 3U02A 1OWXA 2NCKL 1Q8IA 2XG8A 1YJRA 3FZ2A 3KG1A 1GH8A 3PIPQ 3CD6S 1N54B 4ZA1A 1Z1ZA 2GVDA 4A46A 5DZ6A 2QO3A 1FRIA 2HQGA 3IP0A 1N88A 3C46A 3B8HA 3QLHB 2XZWA 5BXIA 3GILA 1U1RA 1VRUA 5A8RB 2N3OA 4JV1A 1FJGF 2PE8A 1EZZB 3QRQA 5GAHI 2DITA 1LFPA 5MLCV 3J81U 1HYSB 3KUEA 4NLXA 4NEZA 3N6LA 1WEYA 3D2WA 2G4BA 2HGLA 1KKHA 1AFIA 3MMBA 3D66A 1NSPA 3IRWP 2L9WA 4FF1A 2HLTA 4X64J 3J7A1 2H54B 1GAOA 4CH1A 2J5AA 2ZD1B 2KJWA 2YWGA 3TAPA 2OH2A 5KFCA 1RU1A 2IM3A 2W4PA 4IG3B 1NK9A 4CYUA 2C2NA 3HD2A 4KGZB 5JJBA 4UQTA 2P9CA 5CCMA 1GFWB 3AD9C 3V4MA 5HVHA 2FB0A 2NR0A 2E1PA 4ATNA 2BJ1A 1C0TA 3G8QA 2XMUA 2OKQA 2FVRA 4PYAA 1PSDA 4DL3A 3H7HB 2MHEA 2GMJA 4B3OA 4FBUA 1KP6A 5G0RB 2VBZA 3R2DJ 3VZHA 4YR3A 2KXNB 4ED1A 1IN0A 3M2VB 2OPRB 2IC3B 5IT9U 3WIUA 3TUJC 2YKOA 4USIA 3QIPA 4Y34A 3JTOA 4YHHF 2KTQA 5IXUA 1HHQA 2NXJA 4IG0B 4C2MA 1F3FA 3EVWA 3TOQA 3GLJA 5J1EA 4LMZA 1HHTP 2QMWA 4EEYA 1IR1A 1JIHA 4E8UA 1TL7A 4IQMA 1WI6A 3PACA 1XN9A 3HVWA 2OEJA 1HMVB 4DQPA 2ZOFA 2QMUB 3DRPA 2MQMA 4HL9A 1RCOB 4NXNF 5C24A 3QAUA 1UA0A 1IBMJ 4WXOA 2I6WA 5L1KA 2FPHX 4DV0F 4I2QB 3K5LA 1U7LA 2C2DA 4P73A 3FC9A 4QWAA 1UP1A 3O5TB 4PXBA 2QGFB 2XSJA 2PC6A 4M5NA 1CQNA 2AQ4A 4PABA 3RB4A 3H90A 3SCIE 2WBRA 3N0VA 2CJKA 1REGX 2YH1A 5C25B 3K2YA 4FNIA 4P2MA 3HVAA 2XMTA 3DOLB 3GQCA 3MM5B 4L72B 1TMMA 1RT1B 4DLEA 1S7HA 2KRRA 2Z2YB 1U1LA 4LQ3A 1F5AA 2XO6A 4KIAA 3BBFA 4C0BA 2MSTA 4EK2A 3THTA 3GTYX 3FMBA 3IN5A 2ZZMA 4R25A 4NLRA 4ZP9A 1XQIA 3T1HF 1TELA 5CHCB 1C1CB 3VAKA 2V4QA 2QC3A 1T9WA 3CD0A 4OZ3A 4M95A 3KLIA 1LW0B 3PHTA 1GXLA 2EBEA 4I6WA 4CLUA 2E1AA 1PJ6A 5CCLA 1Q8LA 1BWEA 4F4AA 2J6TA 3ILOA 1TKZA 3V4IA 2ZFHA 3OVSA 3UN2A 2KM8B 4PG5A 2L9DA 3GR1A 1HBOA 3R7SB 3KNGA 3Q8UA 2E1CA 3K5PA 3Q8RB 4ZPTR 1HWIA 4O0NA 3DOKB 3DHWC 2VC1A 1Q81T 5BYQA 4V19X 1FRJA 2MSSA 4DFPA 4X64F 1NUEA 3DLEB 2J0XA 1KHVA 3M2UA 3G8TA 1VQLS 2W2OP 1HBMA 2FZGB 4PUOB 2GZOA 2BKPA 3UVJA 3NRBA 1LWXA 1F9HA 2F63A 1XTZA 4OJGA 1RTHB 4F8RA 1SQFA 2I38A 1RSCA 1BQNA 2RS2A 4FN5A 3Q2SC 2WTFA 4IR9A 3WBZA 3QO9B 4A8OA 5JXSA 1LWFB 4DPXA 5SZTA 5L9NA 4M5GA 3J7YI 1NK8A 1IKXB 4KHRA 1I5OB 3EVOA 2GVZA 2HFNA 2F5GA 3A13A 3ENQA 1SI9A 2VASA 1QSLA 4DSLA 1RK8A 3DRSA 3O6QA 1RHKB 2FJEB 4C11B 1B0PA 1H73A 3KK2B 1P9QC 1XC9A 2DY9A 2HZAA 4KKOA 4GVLA 2LQ8A 3CD5A 2R7RA 3K8WA 2ZJRQ 4ED2A 3SSRA 3MM7A 1X4AA 1JX4A 3HF5A 3IR7B 2JDJA 1LWEB 4TU8A 3C3LA 1SQEA 2IVMA 4NLQA 3E2EA 2YWKA 3LP1A 2J9CA 1R6YA 1PCAA 2XZTB 4G1PA 1PBUA 4TVAB 1FJ7A 3KWMA 5K8OA 3DLLQ 1FWKA 1X4EA 4B17A 3G82B 2LQ5A 1Q7YT 5LSRA 1WG4A 2UUWA 3BSAA 2AHOB 1CC8A 1IBMF 3O8WA 3M05A 4ZVEA 4DHVA 1RUSA 3C15A 2ZH1A 3NS5A 2R8HA 2XS2A 1KHWA 5DGBA 1KQSR 1T05B 1CEZA 1GMUA 4NLVA 3Q83A 3MDFA 1DLOB 4ECRA 4F04B 3F73A 4G1QA 3BKTA 4JI6J 1U2CA 3VVTA 2HQCA 2K7JA 2VFVA 2E7VA 4BDPA 2YNHA 2OSQA 3WHIA 3MM9A 1FWLA 4KB7A 1RWKB 1NK7A 1Y4ZB 5L38A 4X4TA 1HQEB 4A8MP 3FQLA 4XPEA 4ECVA 3D3CJ 1LW2B 4WCEQ 5AXLA 1HBNA 2MPUA 4PXEA 1U1QA 4W4MA 1TKXA 4O3NA 5B09A 4J91A 5L1LA 3VGVA 2YKNA 2WSCC 3H42A 5HP1B 2W7AA 6FDRA 4C8YA 4ID8A 5GAEI 2VA3A 2VBYA 1M1KT 1JNRB 2N82B 4XTTA 3DYAB 2XZDB 2HFVA 1RTIA 2X1BA 2N4DA 1HKAA 3HHEA 2VDIA 2K1RA 4RUAA 3JSMA 1PJ5A 2KT3A 3K8VA 4C3KA 4UZBA 3IA0A 4H54A 4DJBA 1RTJA 4F4YA 3MFHA 3CT9A 2A0FB 5JVHQ 1XIQA 4RW8A 2H5IB 4OZ0A 1YK9A 1G3OA 2MTLA 1MN7A 3KUGA 2EG2A 2J0SD 3CVKA 2CIMA 4DL5A 2KZZA 3FBEA 4N47A 2R4FA 3POTA 1Y3JA 4N5SA 3AJ1A 5IQ6A 3MR6A 2F8MA 4ECZA 4CH0S 5KT4A 3NWRA 1H72C 1GT8A 4AL6A 1JLQA 2FUG9 4UUWA 1S57A 1PO6A 1NKBA 4IDKA 3EX7B 2KU7A 2ZBQA 2XHWA 4QR1A 1JJHA 1RAEB 4NPOA 5D0HA 4OZ5A 3C6TB 1N5YA 2HVHA 1FJCA 4DLGA 4DL4A 2W9BB 4DS5A 3PO4A 4DUTA 1K73T 3CUNA 2I1RA 1TV6B 4YMEA 2B9YA 1KFSA 4J9OA 2XS5A 4TQRA 5J1PA 1HNVB 4NCAA 2KRBA 3V81B 5K8MA 3RAMA 1D9DA 4OYOA 3CJ2A 2W7PA 4RW6B 4C8ZA 1GXTA 3H59A 4GVBB 2ZNYA 1HPZB 1Z2ZA 3E01A 4DSJA 2CUYA 4HT7A 2FGCA 2W2QP 2PDAA 3R6LB 1REVB 1NSQA 1G2EA 1E6VB 3VR1A 4DL6A 1URRA 1VOMA 5A8WA 1S1VA 2IJRA 2E9RX 3H5SA 2RDDA 4OJHA 2A10A 3QGPA 3CC2S 3S1TA 4B3MJ 3EMTA 3KLFB 1CULB 3D67A 4PQUB 2HZCA 2M0GB 4C4WA 4U6PA 1MROA 2R3VA 1W2IA 4IH7A 2CJ9A 4F4ZA 4JI6F 2B5JB 3M8WA 1CJVB 4ECYA 4YB5A 3S7RA 3EXCX 3EXYA 1FCAA 4ZN3A 2JL9A 2DNYA 4LSZB 1KNZA 3Q8PB 2CPYA 3NGSA 2MZSA 3HZEA 3J7ZT 4RW4A 1QTMA 5D4NA 3BN7A 3M8YA 4MH8A 3QWUA 4K4YA 2DD8S 2VHGA 3G96A 2EFVA 5RUBA 1V5IB 2MQPA 4CI0B 5J2PB 2QTWA 2CJXB 1ROFA 4NLGA 1TK0A 1S1UA 2FIUA 3KJVB 3RJMB 3HHLC 4I6YA 2ZOMA 5EDWA 3L4BC 2OMLA 1VQ5S 3HHLA 3TNVA 2EK6A 4FF3A 3GIIA 3ZZZA 3AOBA 2V4JB 1FKAF 3AOAA 2CPFA 3VALA 4KY3A 2Y8WA 1S4EA 3JXOA 1VQNS 1KFDA 2MQNA 3OL6A 2DGSA 3W64A 4DCJB 4ELTA 2V8GA 2YNFA 4PPDA 3IG1B 1HARA 3C8YA 2D9OA 3EDRB 4DFMA 4AFFA 1UAWA 2NPFA 1RWUA 4W90B 1L3TA 2AJ0A 3I0RB 2BJ3A 4ILMA 1Y5NB 3L95X 3BS9A 5I3UB 5KFWA 1HWUA 1FX2A 3TW0A 2HNZA 1DURA 2HK3A 3OR1A 3FBBA 5L46A 1U8SA 1FD8A 2RDJA 1FJEB 5A8KB 2RF2A 2R7VA 1S1XA 4QR2A 1R7IA 3BEGB 1UVJA 5KG1A 4KFBB 1VS3A 3CCTA 3K5OA 5ETRA 4I64A 1VJQA 2QE5A 3UW1A 4M8LA 2CQCA 2IRXA 3QQCD 2QL5B 2VD3A 3AJ2A 4J9VA 3G87A 4XPCA 2F4VF 4U8YA 2MEWA 2D7SA 1WF1A 5FLXU 1JJCB 4FYVB 1U0HA 1H0HB 4TNOA 4AD6A 2XWXA 2GAHC 5C42A 3GYXB 3DRRA 2MLZA 2JJ4D 1H38A 3MAAA 2KN4A 2V8HA 1S0NA 2V2VA 4RW7B 2ZEJA 4LBHA 2G2OA 4DDFA 3CCLS 2DNZA 3CO0P 2WAQD 1WHWA 4OYBA 1NJXA 5HANA 5F8NA 3GFZA 2ZKUA 3LP0B 4X4OA 3KHHA 2F7VA 5ETVA 4DEZA 2F8HA 3MUVP 4YDDB 3WZ0A 1ZPVA 2V2ZA 2CA9A 3OFFA 4CLPA 4LFBF 4MKVA 1JLGA 2D69A 2HNYB 2LA6A 4ED7A 1SUQB 4QYZJ 2JLGA 4M5DA 3RW6A 4WYWA 4MKAA 2F4FA 3GJQB 4B3MF 5BR8J 4EZ6A 3LWLA 1OSCA 1MMNA 1C2PA 2AJFE 5F3TA 2DH8A 3UCGA 2IY5B 3PYDA 1H98A 3F56A 3FFIA 3ULHA 5HMZA 1TK8A 4B9UA 4AL7A 4GO7X 3D7SB 2WONA 4F36A 3GG0A 3NCQA 2EEYA 5F9NA 4RL1A 2QLFB 3MTJA 1U1PA 1YG0A 1ZZNA 3LP2B 1MMLA 2WCXA 3BDEA 2EKNA 2VG5A 4K4XA 3SCKE 3OVBA 4LVNP 4ZVSB 2BRKA 2A2DA 3EYZA 1H6KX 4C8LA 2Z0GA 3J80Y 4A48A 5KFVA 3GIRA 3HSJA 2A18A 4I2PA 3PKMA 2DRDA 1FXRA 1U2RA 4G65A 4OYWA 3T6JA 5D4PA 5IM0A 2JSXA 4RX6A 2EVZA 1QE1A 3IRXA 2DNQA 4OZ2A 1N6QA 1RWOB 5CYJA 5HMYA 4CLZA 2OEKA 3DXBA 1U6ZA 2L9NA 5D8HB 2YNIA 2RNEA 4O4RA 1HNIB 2ZH8A 1FNMA 1BLUA 4QR0A 2LXFA 3NLCA 4OIXA 4U9RA 5KFGA 1C1BB 3IM8A 4CLKA 2E29A 1IXKA 2AEJA 4KGXB 2JFKA 2LP4A 3G6ES 2BM0A 3CJ5A 3PW5A 4OX8A 1MU2B 2M8HA 3NWGA 4L74A 1WC5A 4JV2A 2DRAA 3MTKA 4P2FA 3AD7C 4CNZA 4CM0A 2PFDA 2EI5A 2PO4A 1TP7A 5IV3A 2A1BA 1S5ZA 4OL8A 3S01A 3QWPA 3TVYA 1VHIA 3KNAA 2OMOA 1LWCA 4ANCA 2QRRA 4WTYA 1QAJA 3V6DA 2RB7A 4DQQA 2N3LA 3TUZC 1IBKJ 5J2NB 1R31A 3FEZA 3NP5A 3MF5A 2YX4A 3P8BB 4JI3J 5H9EJ 3BR9A 2DK2A 4EI2A 1FXLA 1HQ2A 3OTOJ 5GADU 4WFZA 3FCWA 3LA0A 2HFUA 3J7Z5 1TR0A 2QN6B 1UVIA 5A2QU 2IMOA 2ZE2A 1RE1B 4I7FB 2DNKA 2QFIA 3C16B 2FTRA 2YKMB 2UVRA 3EGZA 2ZKTA 1RT7A 2LQJA 4O4GA 2RUSA 1W25A 1R8HA 2IRUA 3D9BA 3I0SA 4ZJLA 1A6LA 4J7CA 2UUCJ 2BEFA 1TAUA 2XMVA 4EYIB 2OHDA 3EE3A 2HFZA 5U47A 4XDDA 3VAJA 3FEXB 5LSOA 2B51A 1VFJA 2WVDA 2XCAA 3I5CA 2BE2B 5FJ4A 2LEPA 2AMCB 4HYKA 5T7LB 2XWYA 3ZTQA 4G6VB 4ES1A 2XYGB 2RSQA 3OSNA 3BJYA 4RUBA 4QU7A 2JLEA 2DHHA 2G0CA 1D9FA 2VBWA 1RCXB 2DGQA 2ZH2A 1FK9A 5BR8F 2HNDB 1SPBP 2C42A 2YVSA 2GMLA 3JSRA 2KHDA 5E3QA 5KG7A 1CS4B 1UTAA 1KONA 2J8AA 2MKKA 1YJ9S 4UOFA 2B9WA 3DM2B 3L9ZA 3GZ7A 1LK5A 4M1KA 2ZZTA 4K4ZA 2AIRB 2GMHA 5LL6d 3QSYB 3I96A 5M2PA 4C98A 2E9TA 2BM1A 2RU3A 5HQMA 1Q8BA 5DG7A 2HHXA 4EYHB 3NGTA 1UPPA 1VQYA 2QEXS 4DU8A 1TL3A 4WE1B 3RRHA 1T9VA 4ZCMA 2V2KA 4ZHRA 2VV5A 4MMOA 1Q0NA 2HRYA 4LF7J 2VG7A 3A12A 3N9UC 3DXSX 5HI7A 4K5SA 4DPTA 3HK2A 4OHZA 4U7CA 4USWA 1S0VA 2V2QA 1SJQA 2UUTA 1S99A 4B3RF 3ZNUA 2A3JA 3OFEA 2K06A 2J7KA 1RT5B 1RGVA 3MI7X 1GMWA 3TZXA 3RBXA 2QA4G 4OI3A 1JLCA 3D68A 5T14A 3ITHA 1K44A 3W2VB 2E66A 5JVGQ 1S10A 2H4YB 3CCZA 4TYAA 2ZBCA 2NXCA 4OI1A 1R3NA 2DPIA 1HIYA 4P52A 3BREA 4NYOA 4DX8H 4A8WA 2KXHA 5DM6Q 2OPQA 4U8VA 2X1GA 1RT2B 3L7UA 5C5JA 4IOAQ 4LFCJ 3AY0A 2ATLA 1NU4A 4IRKA 1TL4A 3FSIA 1E6YB 3N6MA 1IBKF 2BJEA 1U1OA 2GQ2A 5I42B 2WSEC 4JI3F 1VQPS 3NBPB 3M30A 2G9OA 3I31A 2DNPA 3OTOF 3ENVA 4O0IA 3M8PA 4A8YA 1IR0A 2AZ1A 3CCMS 4CLFA 2IAJB 1FKPA 5ITHA 1O0PA 3UNGC 1T95A 2DBBA 3NL0A 2I5JA 3PW4A 4PG6A 4RW9A 3EGVA 1AA1B 4BHQA 2M88A 2YPYA 4X65J 3DI6A 1SVDA 3GFHA 2J8SA 4K59A 2GVDB 4OX7A 5HBMA 4Z7YA 5D4OA 1VQ9S 2O1PA 5D77A 2W2NP 4WXWA 1JXLA 1JLEB 5J1NA 1JJ2R 1ACMB 1BWVA 1RBAA 3NOGA 1VRUB 2GNKA 3MZIA 2VL1A 4K4TA 3RZAA 4AXIA 2U1AA 3I5AA 2UUCF 5HO4A 4P75A 3TAMB 3BH7B 2IM2A 2CWXA 1P6TA 1N36J 4HHUA 3QPIA 4O23A 4FBTA 3MMBB 4B9LA 2M8DB 2WVBA 3RB0A 5DDQC 2V8VA 4DR2J 3UDVA 2C2ZB 1C0UB 4B9TA 4NZ6A 4DF4A 3DOMA 2E5LJ 4K5RA 4JI4J 2P9EA 4QIFA 1NHKL 1CJTA 3TVZA 1HD1A 4CYUB 2WSFC 2HHHJ 3D6HB 1SH0A 4TYBA 4HI1A 3MEKA 1OO0B 1V6HA 4OYIA 4DV7J 2JRSA 5B0EA 2M52A 3OXGA 1C0TB 2HQIA 1D3WA 4ZCKA 3PV8A 1X9SA 2CJQA 2AJ4A 5CYQA 3AB4B 3T5LA 4DXLA 3HXMA 4B3OB 4DV2J 3OHAA 5KT2A 4YOEA 3GYGA 2ROPA 3MECB 5IOLA 3UI3A 1VRTA 2IBKA 2ZUGA 3QGHA 3UD5A 1Q5VA 4U67Q 2CZVC 5J2QB 1KLNA 1YRUA 4U95A 3IWXA 1N34J 3PRBA 3TJ8A 1ZPWX 4L75A 4FYDA 5DGAA 3CJ8A 5J1EB 4A8KA 2FGOA 3NEKA 1MW7A 2BACA 2EW9A 1TL7B 3C14A 3NAHA 4LF7F 1RHRB 2W24A 1MWQA 3T5JA 1S9FA 4C9DA 1TUVA 2W9AA 2C2KB 1EJ7L 4LR9A 4EU0A 1PGZA 1BY9A 4ZVRB 1UJ5A 2RMLA 1C4AA 2XNQA 3DRPB 3IWLA 4DPUA 3VZIA 2QYCA 2W8KA 5C24B 3PZPA 2BUNA 2V68A 1QVFR 3AT1B 4NRUA 8RUCA 3W9JA 1X9WA 4ZLNA 3ZZOA 2B4VA 2VPWB 4GKKJ 2RQ4A 1YJVA 4IH5A 1RWWB 1FD2A 1VQ7S 3CCVS 5B08A 3KLHA 1NKEA 4OI2A 2G0IA 3RG6A 4BCAA 5KFPA 1FFGB 2XSJB 1T9XA 2B4OA 1WDDA 1YJWS 1PC4A 2OFHX 5HAOA 4QBUA 3T9ZA 2GS8A 4P72A 4GO5X 4LFCF 3MHYA 3D6TB 1OY9A 3LGHA 1K0TA 1F6TA 2OP5A 3W65A 5H9FK 1EKSA 3A1YG 2Q3PA 4ECQA 1YGYA 4KC5A 4PPZA 3RR7A 3HCXA 1U0SA 4DZ6A 3IFEA 1S6PA 2ALZA 4WWSA 5HL7Q 2QV6A 2BQUA 4Q8FA 4DR5J 4A8QA 4TU7A 3D6MB 2IIHA 4HDGA 3M1VA 4URQU 2R9LA 1YDLA 4NEYA 2HURA 5CXTA 4NLPA 4YR0A 3BZQA 5DJBA 1WHVA 3ZFVA 3KLIB 1Y7PA 3MEDA 4C3LA 2B6AB 2C28A 2GHWA 4X65F 2AD9A 4ICLA 4OZNA 3B6BA 3CJTA 4ZMMA 5EUHA 2BX6A 1Z4UA 1TKZB 4IKAA 5F8JA 2NUHA 1KQKA 4J5OA 3D0IE 3M8QA 5MAOA 1IM4A 1SC1B 1ZM9A 1B3TA 4Y28C 4OX6A 2KT5A 1N36F 2FLNA 4DX6A 3G2XA 1U49A 4B08A 2QFJA 1FXDA 4ELUA 4DR2F 2KH9A 1IQZA 4QWCA 4JI0J 3R7BB 6FD1A 1RWNB 3M2UB 3N28A 1O8BA 2E5LF 4JI4F 1HBMB 4ES2A 2DXFA 1RXOB 3D0HE 2RU9A 3AH6A 4ZP7A 3JB9k 2HHHF 3UVJB 4CQ1A 4F0KA 1VC5A 3I4HX 3W8GA 4DV7F 3ISND 4AQYF 1BQNB 2B9EA 3OTBA 2GGPA 2LQ9A 3N01A 4PYDA 2C1EB 2HKEA 2J9EA 1X5TA 3MWBA 5KFNA 3LPEA 2RIJA 2Y0SD 2XMAA 1NPKA 2PGCA 4DV2F 4HEA9 2AEFA 1GMWD 3TX8A 1ZAXA 2PI4A 1SKWA 4BLGA 5CD4A 5J2MB 2K3KA 5A8RA 2A2CA 3CMQA 1YKWA 5F8IA 3DRSB 1Q7LB 2DR5A 3MD3A 4DL7A 1UWBA 1VCTA 1N34F 2V4RA 1IWAA 2ILYA 4W92B 1EQMA 3AA8A 2HWHA 3PXGa 1IR2A 4KKOB 2D9PA 2MKSA 1S97A 3UDEA 4YN3B 2E9ZA 3MM7B 2BABA 3MEEA 2DNLA 1OS5A 3F44A 4QCLA 1AFJA 4WTOB 1S1TB 2WW8A 2UP1A 4BBYA 2I9SA 1EB0A 2JFDA 3LP1B 3TAQA 3GPAA 1S7IA 3GP9A 3MCMA 4QPXA 3K58A 1Y11A 3AQPA 3PEJA 4WFBQ 4NI2A 4TY8A 2WOMB 1QJHA 3TA1A 1FEHA 3THVA 5E2QA 3JTPA 3M6VA 3H98A 4DX7A 1K1SA 2WB1D 5G0RA 4GKKF 1OIAA 3BBBA 4ZPBA 5K14A 1JK9B 3VQSA 3C15B 2J9DA 3Q22A 4I4BA 1CJKA 4ZVFA 3M2VA 1UJ6A 2OPRA 2PD1A 1KRPA 3D3BJ 3RB6A 3E3XA 2HMIA 4OQJA 2VPYB 4G1QB 2XB2D 4C48A 1FESA 1WEXA 5IQQA 2CPEA 1OPIA 2BJ9A 1SJ4P 1WHXA 5I3PA 2O66A 2YNHB 4F7VA 4DR6J 1HI0P 4Q0BA 3MM9B 1NDKA 2GIFA 1FKOB 4E98A 1D8YA 2M2BA 4R5PA 3EICA 1B7YB 3QIDA 3J81j 3VF0B 4M5MA 2DY1A 1NHUA 2B7CB 4B3TJ 2V9WA 1RTDA 1HBNB 5D3GA 3NGRA 5KFSA 2BE7D 3Q89A 2RQMA 3AXMA 1EAYC 2UU9J 3UDLA 1TKXB 2DHSA 4DR5F 4FNHA 2C22A 2YKNB 1LEOA 1WDTA 3OUYA 5AE1A 2P2CB 3LOUA 2VZ9A 3HPOA 4N56A 4X4VA 4I2QA 1KSPA 3I82A 4RU9A 1YZ7A 3CJ3A 1RTIB 5BJRA 2DVIA 2CZ9A 3G9CA 2K1RB 5EN1A 4NLSA 3JSMB 4HLBA 1RTJB 3SYZA 4BC7A 1JXEA 4ZK7M 3E8OA 4RW8B 2FLOA 3CTRA 3MM6A 3GSIA 5C25A 3SZ2A 4A8SA 1S49A 1DAXA 2COLA 1X4FA 1Q79A 2APOA 1I3OB 4P7VA 2DGXA 1PYOB 1RT1A 4QW9A 5EWEA 2NXEA 4JI0F 4HHJA 1Q86T 2OD4A 2VF3A 3Q8SB 1YBTA 2JX2A 5AXKA 1RAAB 2V94A 4LJMA 4UOCA 2L48A 4NYPA 1NLKL 2KI2A 1JLQB 3MR7A 5F41A 1L3SA 3QFWA 3J81Y 1M1HA 4Y0FA 5HK4A 1NMEB 2JEIA 4IDKB 4EWTA 1NPRA 1XR6A 1TKTA 4EGLA 1S6UA 1YHQS 4WPAA 2OPSA 3QFHA 3O44A 5E41A 2CVIA 2PA8D 1PIEA 2EFOA 2LQBA 5CYMA 5GVQA 1AT1B 1AROP 2EFQA 2BKOA 1S76D 2FVPA 1OQ3A 4K0KJ 4O3RA 1J5EJ 4XDCA 2MDAA 3MAHA 2ROEA 3PEHA 2NLWA 5CAAA 4M63A 1R8AA 1NK0A 4ITSA 4CO1A 1UVKA 3SMZA 1LOUA 4NWBA 4ECWA 3E01B 5HATA 4GC7A 4WK3A 3PHEA 2YKPA 1RP5A 4XIUA 2IRYA 3HJFA 5D4LA 4QYRA 3G4SS 3VAHA 4USVA 4Q2LA 4X84A 2BOAA 1NB2A 5A8WB 2V63A 2E7XA 3M9NB 1S1VB 3BO2A 3CXCR 1HQUA 3A8KA 1SXLA 2MQLA 2O01C 3KDNA 3MPWA 2J6SA 2V8DA 3NGDA 2VFRA 5GAGU 3K0JA 3R5BA 2ZNZA 2HWTA 1MROB 3GONA 2HHUA 2HBQB 5HVGA 2XMMA 1NZAA 2Y1RI 5KFUA 5EWFA 1QAIA 2RJZA 1LV5A 4MIAA 1F2HA 2IVYA 2VUGA 2VB6A 1QD1A 3ZZRA 4K4WA 4DR6F 4DG1A 2BJDA 1H7XA 3RRKA 4RW4B 2JVOA 3HSZA 1B64A 2H3EB 2BOPA 1SCJB 1JLBA 4LBIA 4B3TF 2XCPA 2F9DA 1Y9OA 3OT9A 2BA9A 2P5VA 3ISZA 2UU9F 2RVJA 3LH2S 4H4MA 2WZ1A 2GO8A 4LF1A 2WRMA 1S1UB 4J90A 1NK4A 1SV5A 1SC4B 3OBIA 3TANA 5B0GA 4KYZA 2CDQA 2BDPA 3HHLB 2PMHA 1NH7A 3GB0A 4DV0J 3O3LA 3MAQA 2EK1A 4Z2XA 3G6VA 1DLOA 2B0GA 3MMCA 3TQ1A 2KG0A 2PN6A 2DTJA 1VQSA 2YNFB 1B0VA 1AYEA 4QOTA 4DV1J 2CPDA 2D3OR 2O5DA 2AJQA 5CA5A 1NKCA 1FHTA 4ZPAA 2AYMA 3PM9A 2XI2A 3FCVA 1U02A 3NMAA 3CO9A 2ZH6A 3U1NA 2ZHAA 2IHR1 4FXVA 4JP8A 5KG2A 4QPTA 2LFVA 3FRZA 1RWMB 3CCWA 4WIIA 2UUAJ 5HP1A 2X3GA 3ZC4A 3OR1B 2YXLA 2KKHA 1FDAA 5E7OB 4GC6A 3MR5A 1NXIA 4RKUC 3CJQA 3D4JA 2RF2B 1S1XB 3EJMA 2ZITA 3A3NB 2YKQA 3DYAA 2HQ3A 3W60A 4KJIA 2ZDPA 3LTOA 2IYGA 1IJEB 1DTTB 5KOWA 2CWKA 1MMDA 1IKWA 3R5AA 4M5KA 3LUYA 2M9KA 2YNGB 3PCOB 3OTEA 1CPZA 2VOOA 4K0KF 1J5EF 3CIZA 2Y1IA 1FE0A 2DH7A 1U0HB 3PJXA 3PW0A 4LFAJ 2C2OB 1IUJA 5IC4B 3GJSB 3US5A 1XBWA 4WK1A 3DRRB 2CQBA 5KFTA 2WHOA 2ZJQQ 2HBZB 1NZ8A 1D09B 3MAAB 4R0JA 4ED8A 1TKDA 1DBDA 3G71S 1S77D 2CKWA 3H2LA 1G4CA 2C3OA 1BQXA 3R1LA 3O2IA 3R27A 2Q66A 5HMWA 3GIKA 3OR2A 3VAMA 1T7PA 3VVUA 4RU2A 2E44A 2HAFA 4Z37A 4K50A 4HTJA 2MKYA 1YTYA 2V9KA 4WZMA 3I5BA 3NG8A 3CULA 2CQPA 4N7TA 1RWPB 4X4QA 4QU6A 2RQCA 4WU2A 4M5DB 4ZVGA 1M5VC 4JBCA 1JMTA 1RACB 2R2RA 3TWZA 1YRTA 4KQZA 4H4KA 1Z2LA 4ZP8A 4KGVB 1PYTA 1TV6A 4OYPA 3FFIB 5B0BA 4NX9A 4EBEA 2WONB 4OYAA 5DRKA 3V81A 5DO2A 2C2RA 1KEKA 4OI4A 2CPHA 1XK8A 1QSYA 2P6SA 2VG5B 4MK9A 4Y00A 1VGYA 2EXUA 4ZP6A 2QSFA 4ZPVR 2PIIA 3U27A 2PEHA 5C2GA 2CXEA 4I2PB 3EZ5A 3TRGA 1E6VA 4Q7AA 5IM0B 3QRRA 2XSFA 1QE1B 3IRXB 3W5YA 4CRJA 1N6QB 3CJKA 3IAS9 2ERRA 2DKOB 4LUBA 2YNIB 4OX9J 4FVMA 5KFJA 5KT5A 2R2TA 2LLZA 1D9AA 1GX5A 4PQUA 1KVJA 4BC9A 1WC1A 1RWXB 3W5XA 2UV8G 3ZXWA 2DCUB 1MG7A 1D0EA 3TZWA 3W66A 4IFVA 1SL1A 2R7XA 4DV1F 5DDPC 2D41A 3WDOA 3ONQA 1N5VA 1ZH5A 2ACMA 5F0UA 3D0GE 2H51B 3HJVA 1X4BA 1KVIA 4NLOA 2G13A 3TO8A 2BBEA 1LWCB 5C2CA 1RT3A 1U1MA 4NLTA 3HT3A 3UR3C 4IO9Q 1KR4A 2RKIA 5F8MA 2UUAF 3KJVA 2B4UA 3DN9A 2KFNA 1K8AT 4LSLA 4ZVUB 3DRXA 2WB4A 2P9GA 4NCBA 3LW5C 2F8EX 3LO3A 2QLXA 4F02A 4H4OA 1J27A 3AB2B 1UA1A 4I56A 5LT5A 4NA2A 5LOQA 4B02A 1DQAA 3R1HA 2V5HG 1WSVA 2ROGA 2Z58B 1T9TA 1U6BA 1UEVA 3M2RB 2FJXA 3TZYA 2AX0A 2ZE2B 4N41A 4YDXA 4ANEA 3P5BP 1U6FA 2HRUA 3R8YA 2HIYA 1N32J 3LWMA 4Y65A 2EG1A 4LFAF 2VH7A 3I9V9 2YWHA 1XR7A 4O4GB 4Y2MA 2AGPA 4LRCA 2E1MC 4C0OC 4C0HA 3I0SB 3AQOA 5AE3A 3GV7B 4FF2A 3SQGA 3F41A 2QX0A 3E51A 4BS2A 3W61A 3MXHP 1L3VA 1BGXT 4KV8A 5HMXA 1T94A 1MWYA 1X7VA 2CVEA 1FVSA 3VCDA 4XK8C 2ZBRA 4ZCIA 3QRPA 4ZJOA 1DHMA 4Q2MA 5G4DA 2FHKA 1DFDA 2E5GA 2H4WB 5A8KA 1L3KA 1RYSA 2HG4A 1O51A 2ZH9A 1KOOA 2QYGA 5KFKA 4C6AA 3OW2R 2HWIA 2V50A 1VMBA 1UL3A 1DQ8A 2KVIA 2L08A 2U2FA 5B0DA 1FNOA 1VQMS 4NXMF 3W2WA 3BPSP 3EPIA 1APSA 4F2SA 4L3NA 1B4SA 1FK9B 3Q86A 3IS9A 1QM9A 4JB8B 1VYAA 4P2XA 4CLSA 4FP9A 1VR6A 2VODA 3MMJA 2QT7A 1M5SA 1EETA 3I4PA 1BE4A 4NMLA 2YPZA 1NK5A 4KO0B 4FS2A 3CDAA 2CADA 2EPIA 3N6NA 3JQJA 1CVJA 3AHPA 2FHMA 3SV3A 2F1FA 1VQ6S 4F2RA 2DNNA 4KPYA 2H9ZA 5ETPA 7FDRA 3B82A 1RHMB 5HJXA 4MFBA 5KG0A 3R5GA 1HI8A 3HVRA 3DGVA 4ED3A 1EARA 2KL8A 1WC4A 3CDEA 3LGMA 3NS7B 3IO1A 2YWFA 2RHQB 4ZHRB 2HNYA 2F40A 4OX9F 2VG7B 2IA6A 1YJNS 1WSRA 4AYBD 4LRAA 1AUSL 1V3RA 2ZHBA 3KK1A 1RT4A 3V6KA 4OZ1A 2HW3A 3WX8A 2G0JA 4FPIA 4F25A 1LNQA 4NOHA 3W8PA 3UN3A 1Y00A 2JEJA 1JLCB 4Y2CA 3QMQA 3VQTA 1PKUA 1RB0A 4YR2A 5KFIA 3OLAA 3ITHB 3LP2A 2LU2A 2BW2A 2UZAA 4PKDB 2IM1A 1X9MA 5CH7B 5KT7A 1GMVA 4B9VA 1U8WA 1T3NA 1S12A 2ZH3A 4TXSA 2I0XA 1ZTTA 5DLGA 3H2VE 2OPQB 3SEOA 3TEGA 3UR0A 1PAUB 5GADI 5THWA 5GMEA 2BKNA 3OQ2A 2ZH7A 5F0WA 1N0UA 1YBAA 3A8IA 1Y3KA 3QT7A 1SL2A 1HNIA 2CAJA 3N5BA 1P1LA 4FXWA 1MSWD 1C1BA 1RBOB 3M30B 3IMQJ 4I1TA 1X8DA 3PJ9A 1NK6A 4FF4A 3M8PB 5M2RA 3NOCA 1H3DA 2CYYA 2UVUA 4AUKA 4WFYA 3V2UC 2PMWA 3SXLA 1FKPB 3I87A 2UUBJ 1MU2A 3BO3A 1RAIB 2I5JB 4RW9B 3CWJA 5LJ3Y 2QIFA 2QLBB 1N32F 5GMKa 2MKHA 4FS1A 2Z2MA 2FVCA 3DI6B 1M5HA 2VDHA 1RABB 2MB0B 4NCGA 4B9NA 3CB4A 5DETA 1HNXJ 3QT5A 1XNRJ 4NZ7A 3GIMA 4F26A 3D1QA 2BR0A 3EPGA 4ECXA 2GQQA 1RDRA 3MUTP 3HHNB 1BQMB 5KFLA 4DU7A 1YJTA 3NXZA 2R8GA 1A9NB 4DS4A 1K1QA 2XY6A 3MR3A 2FC9A 1X4CA 4WP3A 4F3QA 5J2NA 3BV8A 1RU2A 5FLXY 2FLLA 3KHGA 3HM9A 1ZYQA 3DFEA 3H0PA 4UY8T 4OI0A 5CABA 3DOMB 1T9UA 3OLBA 1PAEX 2CPZA 3S6EA 1CJTB 4QWBA 1X4HA 2EBGA 3OFGA 1OYDA 3I6PA 2F4VJ 4OZJA 3C16A 3C6UA 2M3DA 3JTNA 1YI2S 1T3OA 3HHDA 3PRDA 2MYFA 2YKMA 3Q8VA 4MTPA 4TKTA 1H2VZ 4ED0A 4ETZA 1ZA1B 3BDPA 4CIOA 3P96A 5CYQB 2CG8A 3H20A 5JMNA 5KFYA 4AXJA 1VQOS 3CMES 2JC1A 5DS7A 2F9JA 3ZZTA 4RNMA 2CPIA 4CLTA 1PC5A 1TL1A 1KQGB 1VLYA 2BV3A 4ZVHA 4CT8A 4TY9A 3ILIA 5FDLB 4F0HA 3KHRA 2HSEB 3KHLA 2VG6A 3OL8A 2XC9A 1H7WA 2G2ZA 4LFBJ 3N79A 3CF5Q 3PJWA 5CZVA 2HHSA 4Y3CA 1SBRA 1CQMA 2HHVA 4CWBA 4NLUA 3AAWB 5D0RA 2KJVA 1RLCL 1D1UA 2IBOA 4A4JA 4L73A 2BQ3A 4Q43A 2VQFJ 4FZVA 1XR5A 1CS4A 2J9DE 3QGGA 2FHOB 4C3MA 3H2UB 4CO3A 4C8KA 2KFYA 2M70A 4XAKA 1QAXA 2VPZB 3SQOP 1ZA2B 4WE1A 2X1AA 1WKJA 3GFYA 3ILJA 3MOZA 2MGZA 3BYPA 1WG1A 1NJZA 2B9XA 2QLJB 4BWJA 2R42A 4MKYA 4A47A 5HLFA 2CQIA 1N33J 1S6PB 3G6YA 5DDOC 3M8ZA 1WF0A 2QLWA 3BGRA 3MPUB 2BXJA 2IVFB 2FVSA 2B7BB 2DXEA 2UUBF 4HTIA 1X0PA 1S0MA 3VGSA 1YSJA 3ETMA 4B3SJ 4QQBA 1QUPA 3Q8YA 4TQSA 2RRNA 3RTVA 3MEDB 5DQIA 3TI0A 3RW7A 2BANA 2DNOA 4IH6A 4ICLB 3CDUA 1ZM3A 2XS7A 1X4DA 1HNXF 1XNRF 1Q4RA 4EMDA 1X5PA 5KT6A 2Q43A 5KFZA 4M5IA 1FA0A 4PXCA 1TZ0A 2N7YA 5A0YB 3CCUS 2AZ3A 5A6PA 3W3SA 3RBDA 3ZZPA 4O3OA 1Q82T 1CJUA 3TX0A 4PR6A 1A7GE 2DHAA 4NYZA 4OJ1A 4J9RA 4CLLA 5I4MA 2CNOB 1BHNA 4DI6A 1VC0A 1VIXA 5KFBA 3JAMU 3GYNA 3KYLA 1GK8A 1SJ3P 2CJAA 2CQ1A 2LXUA 2IDEA 3UE2A 2L3MA 3SSQA 2O3DA 1WHYA 3F0NA 1T11A 4Y2IA 2HVZA 4UQGA 1UZDA 2QA2A 3KMSA 2ZJPQ 4YB7A 4NRTA 1YRXA 1BC6A 1QAYA 2OPPA 2GGPB 4EBDA 2AX1A 2RRBA 3W1YC 3PW7A 1VHFA 2RUGA 1JLEA 1HBUA 5C7PA 1EX8A 3KLEA 4Q8EA 3EDQB 5LMNJ 4QIGA 4HH1A 3TAMA 1VISA 1GXUA 1UWBB 3H40A 3HKWA 1UZHA 1NPPA 4Y2KA 2RILA 1KQFB 4F3OA 1K9MT 3ENAA 2YWEA 5HROA 3RAXA 2HFOA 2YTCA 1FDNA 3DMJA 3MEEB 1C0UA 3KUHA 1U26A 1A0OB 4TN2A 1NH8A 1DRZA 3K7RA 5IT4A 4ZIWA 3PYGA 1DQ9A 1FO1A 1KLMB 3UPFA 1FRKA 4NLWA 1GNKA 3UDCA 2KYXA 5BYSA 2A6MA 3IBFB 2DR9A 1RAJA 2Z30B 4RBUA 2VQFF 2EKYA 2IM0A 1WI8A 3B4MA 5D0GA 2K3IA 5IC6B 4NI2B 4TY8B 1TFYA 2W01A 1OQ6A 4UW2A 5CQGA 2OFGX 3DLGB 3T41A 4ZCLA 3BPDA 3X1LB 1VRQC 2FJDB 4URGA 3MECA 5K14B 2DHGA 2VJUA 3KG4A 1CJKB 5J2QA 4G3IA 2VFUA 2NXNA 2D3ZA 1NJYA 4UY85 5KAKA 4HR2A 1N8RT 3FK4A 2EFNA 2HMIB 5KFMA 2ZH4A 2HK2A 2B43A 2DYAA 3PFOA 2QA4S 3IAM9 3M7VA 3CC4S 4OHXA 3EVMA 3IBWA 1N5QA 4LF5J 4ZIVA 1NSKL 1XMQJ 4Q0BB 4LRDA 1S9GA 1X31C 1ZBTA 4R5PB 4OHVA 4ALZA 2PT0A 1S0OA 3P49B 1IQTA 3M4XA 4D3GA 3KLGB 2ZWOA 1N33F 1RTDB 5D3GB 4B3RJ 1NBEB 2PMZD 2KDOA 3MR2A 1LK7A 2DHXA 3OUYB 1YIJS 1JLFA 1X5OA 3QZ8A 4DCOB 1TVRA 4B3SF 2Y1JA 4J9SA 4AE5A 4RR5A 3GR0A 2D74B 4ID5A 4O3SA 4WU3A 3UD4P 3MM8B 2ACYA 2B4PA 4X2BA 1TQLA 5A76A 1HW9A 1J5OA 3OVAA 3PFEA 1N0VC 1IWGA 4ZLPA 1NB7A 1SKUB 4P9SA 1R8CA 3MM6B 1HA1A 3JSYA 4IOBA 3FCHA 5BYRA 2XMJA 4K8RA 5K9FA 1UCNA 4P2SA 1WC6A 3R3TA 3MEGA 3PYFA 4LVOP 2FJVA 3D6FB 1KC8T 3ET6B 2KXFA 4N8NA 5D15A 3BGLA 4UUXA 2LU1A 3R5CA 1XEZA 2DR8A 1R0CB 3HT0A 1L5UA 5E5NA 2OEMA 3I32A 4Q45A 1AUDA 4U7UK 4LSNA 4DV5J 1R89A 3JQKA 4K2JA 3PY8A 1S9EA 2B6AA 3QBCA 2V34A 1RHUB 2KFZA 1TKTB 3RRGA 4ZJQA 2DNRA 2P8IA 1NAQA 2H1YA 2UV8A 2OPSB 3M9OB 2MZRA 2AU0A 1HWJA 3LQVA 5L1JA 3LAMA 5CYMB 1NO8A 5KFXA 4WF9Q 2CRLA 3BKFA 2C2MB 3DKDA 5LMNF 2HBYB 1XNQJ 3C19A 4K4VA 1RBLA 4IFYA 4DZDA 3EZUA 1AZSA 2KYZA 3P6YC 3GJTB 3DC2A 4UF4A 7AT1B 1RAGB 4MYUA 2SXLA 2KB2A 1EP4A 5AXMA 2EFPA 4DN9A 4OHYA 5EHHA 4N77A 2ZBPA 1B7FA 3KG0A 3H5YA 2B8QA 3EGWB 2DB1A 1QLNA 3MCSA 1F2GA 2CQ0A 1OSDA 4WP8A 4DV3J 2ZC3A 2HS3A 1T03B 3T5HA 3T1YJ 2JNJA 1P1TA 4DQIA 2YH0A 2W4DA 1U4BA 1U47A 2NXUA 1HQUB 3Q24A 1KD1T 5J2MA 1TUWA 1XMBA 2ZZNA 4L6V3 1KS2A 1CC7A 1NDCA 2RQKA 1GTEA 2I2YA 3HP6A 4PWDA 1RT6A 3X3UA 1T0TV 3GCXP 2HVIA 1G1XA 2VOPA 3FQKA 2HQFA 2P6TA 2J7UA 4LF5F 3T19A 1XMQF 4DG1B 3ISNC 2CDRB 3HI9A 1S1TA 2VONA 5IFMA 2W8LA 1FERA 1JLBB 2OIHA 4B9SA 3LAKA 5D0EA 4CLWA 1EIYB 3DLKA 5A6WA 3MMAA 2LECA 3WQPA 2IJNA 4H4MB 2WOMA 4OYXA 2DNHA 2Z4PA 4LF8J 1SV5B 3U1LA 1V3ZA 1Y5IB 2JEGA 2XGPA 2WBMA 2KHCA 1PYSB 1W26A 1RLDA 2WVEA 2IJFA 1QVGR 1M0SA 2E5JA 3CGIA 4EZ9A 2NS1B 1S6QA 3T3FA 2W9CA 4RWWA 1VC6A 3GE9A 3MMCB 4M5JA 3TUPA 3DGPB 4CTAA 4GMKA 2ADCA 1R0AA 3BYRA 3PG9A 4AL5A 4KE5A 2RS8A 4EBCA 1RHQB 5I3QA 2GJIA 4NZ0A 4LF4J 1VQ8S 3FBCA 3JQMA 5EGYA 2DR6A 3L3CA 3FMWA 4KH0B 1FKOA 2ZH5A 5K5MA 3M32A 2HRTA 4R8UA 1P27B 4P7TA 1HW8A 1RISA 4O44B 2MKIA 9ATCB 3RR8A 1IKVA 3HSDA 3H4BA 3BGFA 1F0XA 3OFHA 2O67A 3MPYA 3R97A 4F4XA 4DSIA 5KG6A 3BF4A 1ITPA 5FIIA 4USHA 2FY8A 4ED5A 1JKHA 4C8NA 5B0CA 2XMWA 4A8FA 1IJFB 4DV5F 5SUHA 3SFGA 3MURP 3CC7S 2XMKA 3ZZYA 1FNXH 4KH1B 1OYEA 1MLAA 1FI4A 3HVTA 5KFDA 2VKZG 3W7BA 3DU5A 3KMQA 2BRLA 1RAFB 3SBMA 2Y8YA 2WK4A 2NPIA 3GV8B 1P9YA 2VBXA 1IKWB 3HSGA 2A6OA 5D78A 3DLJA 3DDIA 4LF9J 1XNQF 2VPXB 2Y3YA 2HIQA 4ILRA 3P3DA 5LMUJ 2XLJA 3CEDA 1SIZA 1UW9A 4ZDNA 2KO1A 3VGUA 3FUYA 3IGNA 4MYTA 1S1WA 1DTQA 2Q6BA 3V6HA 3PR4A 4PCQA 1JLAA 2CQ3A 5IT0A 2C3YA 3OR2B 2IDLA 2H5EA 2ZUAA 1F3VA 4ZPDA 1UKUA 5ETLA 3A3OB 3FNNA 1OJ4A 4AQYJ 2GC8A 1ZS6A 1M1GA 1S59A 4DV3F 5GAGI 3KJQB 2NYIA 4DL2A 3T1YF 2VICA 4HVZA 1TK5A 3BN4A 1NDLA 1WD6A 4KR0B 5HSPA 6AT1B 5K20B 1RADB 3W63A 2V0NA 3OTCA 3OJSA 2HS4A 3GV5B 3R5JB 1YBUA 2QL7B 3K89A 2B56A 3QIPB 3SFUA 2POKA 3VAFA 4PXDA 3NAIA 1U1NA 2ASLA 1IKYA 1DY3A 2ABYA 4Z7CA 1T9YA 1I51B 2ZM6J 1FT8A 5AT1B 1WOOA 5GAHU 1YJ7A 2DIVA 4P71A 3T1AA 3VV2B 2JOQA 2WVCA 3BSNA 2YX1A 4DN0A 2OTLS 2BJ7A 2EC2A 3NNAA 4URSA 1ELOA 1GQEA 1FE4A 4CZCA 4Q5VA 4ANDA 3NMRA 4OFZA 3AOCA 2LVWA 3CJKB 2WVFA 4LF8F 4U7UD 1I94J 1OMSA 1ZM2A 2D1CA 4RWXA 2G1DA 2PI5A 4ZS6A 2ILZA 2DPJA 3CNQP 5CZXA 4J9KA 7FD1A 3GIJA 2YQ1A 3SDEA 1PILA 1FRXA 3BQ0A 2MMYA 3KKFA 3FSXA 2MY7A 4IFVB 1LQ9A 1F9EB 4CO5A 4LF4F 1RAHB 2YKAA 3RBEA 1VI7A 3TUIC 4MIWA 2ATCB 1F1BB 4GKJJ 1R8PA 2ZVIA 2HGNA 4KBIA 1NDPA 3UWTA 5DM7Q 1X4GA 5KFEA 3A4TA 1VK8A 4HACA 1RT3B 3SI8A 1RA6A 4CM2A 2RKIB 4YY3J 4ZN1A 4LSLB 1U2FA 1WEZA 1SJFA 3N5FA 2FJAB 3JYTA 2R2UA 2DXDA 2YX7A 2YBVA 1WNEA 4H4OB 4DV4J 4PEOA 2DH9A 3PO5A 1SIWB 5L39A 2XLKA 3BGUA 4ZVPB 5H9FJ 3OXFA 3GWCA 1HWLA 1RYRA 3LGNA 2XLIA 1F5CA 3V4IB 3KK3A 4FPRA 1FDBA 4IOCQ 3NY0A 1JWWA 1FFWB 1HBOB 3RB3A 1DARA 4LF9F 4DMZA 1VJWA 2LEBA 3FDSA 2N7CA 5LJ5Y 2R7UA 4OV6A 5LMUF 1DJ0A 2CFXA 4CO2A 4NA3A 2M4MA 4KSEB 1F60B 1FDDA 2DEJA 2RAQA 1S48A 2CPJA 3LANA 3SSSA 4X62J 4A8XA 3SQGB 2HHQA 1QY7A 4X66J 2DT9A 1KBRA 4ECUA 2XY5A 4X4RA 3PKYA 4KV8B 5B7WA 1WF2A 2LYVA 3ZO7A 1M5PC 3CD7A 3MOJB 2VA2A 3A8JA 3SV4A 2AYGA 1XWLA 4KTQA 4OI6A 1UWAA 3FKBA 2X3DA 4CNYA 3FSYA 3HFVA 2GW8A 4UT4A 3WC0A 4WZQA 1OY8A 2ZWPA 2MLXA 1U45A 2GO9A 1RZMA 1YZ6A 3QLHA 1DTTA 1UFKA 1NJIT 3W2WB 1NEEA 2H5JB 4YEAA 2LMIA 1UVLA 4LIWA 2GVZB 3QNWB 1KWMA 2YNGA 1EKRA 3IS9B 2GFFA 1HYSA 1G6BA 4YS2A 1IVZA 2LKZA 5KFRA 1EETB 2OLWA 1SKSA 1HHSA 2MKCA 4QYZK 2FVQA 4J9QA 1ZAVA 4RJVA 4RNOA 2JEFA 3NKYA 2ZD1A 2F3JA 2GHVC 2ZM6F 5DLFA 2X1FA 2HZVA 2FC8A 1SL0A 3OL7A 2MQOA 1N4LA 3I55S 4IG3A 4ZVQB 3H5XA 2HQDA 3BGOP 1S6OA 5EWGA 4RNNA 2NZ4A 2ASJA 3BBCA 3NS6A 2HHTA 1NHVA 2CZ4A 4MFBB 1WUUA 2BW7A 4M5LA 3DHXA 1VBKA 1I94F 3CW2C 1RJJA 2GV1A 4ILLA 4TU9A 1ZZFA 3W5ZA 2CG4A 4ZOSA 2IA0A 3IM9A 2IC3A 1IBCB 2VKRA 4F4KA 3FBFA 1JXVA 3U7JA 3KK1B 1P8GA 2IFXA 1RT4B 3OTDA 4LF6J 3CE8A 3SCLE 2ZDOA 3P5TL 4UOGA 1I6JA 4IG0A 3GG1A 4DX5A 2G2YA 5KFFA 4USTA 3J7YU 3LF0A 2MZQA 2GA7A 3K57A 4E0DA 3PRVA 3KJFB 1WOSA 2FD2A 4QW8A 4GKJF 1HMVA 2FQQB 1Y5LB 1CSJA 2DGWA 1CLFA 1PJ7A 1ICEB 4EO6A 1H2UX 2K7KA 2YQ0A 1SH3A 5DZ7A 5EX0A 4YY3F 2W2MP 2DGVA 4K4UA 2EFGA 1L3UA 1M5KC 2UVVA 3B4DA 3WC2A 1NM2A 3HMJG 4RBTA 3BB5A 4W98A 4DV4F 4IUFA 3VAIA 3GCWP 1X0FA 2DGUA 5DG8A 1WJ9A 2AJ2A 2Z56B 3DNCA 1SKRA 4KAIA 2IYIA 2XYPB 2QSWA 2VFSA 1TAQA 3RAQA 1AXQA 2ADBA 2MXYA 3ZNJ1 2AYEA 5H9EK 1ZM4A 2DISA 4M94A 3ZTSA 3UCZP 2XQCA 2AGQA 3R5DA 2I8EA 3DOLA 4NCGB 3MM5A 2R7WA 2YQ3A 4X62F 1VK3A 1OY6A 4RPFA 3RBZA 4KGKA 1KVKA 4X66F 1W2BR 5HQ8A 3POTB 3DLBA 3NNCA 4ETXA 2IPOB 2ASDA 1Q1KA 2BZ2A 2UXCJ 2RE1A 4IR1A 3TQEA 2CJYB 2XY7A 2BYCA 1FFSB 4WJBA 1C1CA 1C4CA 3BR8A 2L41A 4JI5J 1LW0A 4DR3J 4QZVB 2HLUA 4MKBA 5ETNA 4PG8A 4F50A 3ZTPA 4OV1A 4RZRA 2KM8C 2J0QD 1Q5YA 2C3MA 5B0AA 4NASA 4JI1J 2OTJS 1N5YB 3M2RA 1H74A 1UJ4A 1KTVA 5GAEU 3K17A 4FKXA 1YVFA 5KOXA 2HYIB 2XHCA 3C6UB 4YP3A 4TLQA 2NZCA 1HR0J 4Y6IA 2ZBIA 3DOKA 2J7WA 3HZGA 4NMXA 1RA7A 5DG9A 2DGTA 1N5TA 2Z8QA 3DLEA 5D6GA 4CP5A 5E3RA 2AJ1A 3BQ1A 2AP6A 3TJAA 4YB1P 3THPA 2J0WA 4ZPCA 4PUOA 1M5OC 4ES3A 3OV7A 3G86A 5IT9Y 1FTCA 1TL1B 3M9MB 1RTHA 3KDOA 4LR7A 3O1LA 2RRAA 3R9LA 2VG6B 3HHKA 3QO9A 4ZPWR 4ZLLA 1D8ZA 3UD3P 3CIMA 1HFEL 5ETTA 1LWFA 5KG4A 1RTZA 2AWZA 3KTQA 1IKXA 3T6BA 3IR6B 1RKIA 1VQ4S 2Y9HA 3HHLD 3Q2TC 4D3HA 2LCWA 2D3UA 5H1SV 2PSZA 4LF6F 1Q78A 3JSBA 3TVKA 4C11A 3KK2A 4DUZJ 2GX8A 3VGTA 2CQ4A 2GJ2A 2LA4A 4ENOA 4IYQA 3PX0A 4ECSA 2W2PP 1RWVB 4ED6A 4KO0A 4C8OA 2BVZA 2RHSB 1LWEA 1SC3B 3MPDA 2YWWA 1O5JA 1TL5A 3TEHB 3GJRB 3G8SA 4RUCA 3PNIA 4R0EA 1Q8KA 3DU6A 3L7OA 4I69A 3R7NB 5HVFA 5L9XA 2Y0BB 3HKZD 2R8JA 3G82A 4FKYA 3OD2A 1AW0A 1Q95G 3P45B 1RI7A 1YX2A 5B0FA 5T41A 3N4WA 3IR5B 2MJUA 3UNYA 3IGVA 5L8RC 4DPWA 2MGZB 1QSSA 1UW4A 2QL9B 3Q0AA 2JVRA 5HLFB 4PWWA 1T05A 3J80U 3TJ9A 4J9LA 2V67A 1NNDA 3DDKA 3BGRB 3QGIA 4V1Ak 4LBPA 1S4FA 5K8PA 3MUMP 2UXDJ 2Z2ZA 3R2CJ 3QJPA 5F8GA 2XO7A 4DFJA 4DL0C 4WYLA 4C97A 4ERDA 2BANB 2W1BA 3V5RA 4USMA 3TARA 4F3MA 1HQEA 3WIVA 3Q23A 3GU0A 3QJLA 2AT1B 4WIQA 1LW2A 2FHJA 1V5VA 3TZZA 4XO0A 2HNZB 4NL5A 2M7SA 5E3AA 3QJJA 4RNHA 9RUBA 4HT5A 2UXCF 1ZETA 2KT2A 4I67A 2E7WA 1LXNA 3HLUA 2RDIA 3JS9A 1SB6A 2OSRA 5DDRC 1CJUB 4IO1A 4FVCA 3M6UA 4JI5F 4DR3F 1KN6A 4WKYA 4J9UE 3V6JA 2GAGC 2XM3A 4OYZA 2XEXA 4YUDA 1R8BA 2R7OA 2JZ5A 4X4NA 1R27B 2PEBA 4JI1F 4M5HA 1Q16B 3CJRA 3HD1A 4WFXA 4ED4A 1U1KA 3LALA 1T02A 4L76A 5F8HA 4DSKA 4DWIA 2X51A 1HR0F 1YITS 1RKJA 1XMOJ 2OPPB 2NREA 1NRKA 3B54A 5C42B 3BM7A 3QATA 1VQKS 2BMBA 3H8YA 4C8MA 4QWEA 4KT0C 4CT9A 3PDNA 3PYEA 1HBUB 5F3ZA 1KOHA 4S0MA 3PW2A 3KLEB 3ENWA 3HO1A 5AXNA 1BQMA 2NYHA 2QG9B 3M6WA 4CDIA 1UMJA 5E0OA 2AV5A 2KZMA 2FJBB 3QSIA 2VC0A 1BUXA 2OI2A 3G6XA 2MQQA 4MT1A 4QJVA 4NA1A 4JI2J 1GX6A 1ULRA 5KFOA 2WW4A 5HROB 5F8LA 2CNKB 3DMJB 5HN0A 1JLGB 3FVYA 5EX3A 1FVQA 2F65A 2DO0A 3DDNA 2CQ2A 3C6TA 4NXMJ 2FJWA 4H4KC 4EUVA 3L7PA 2W9BA 1WWHA 3OXLA 3KFWX 5CD4H 3ICLA 2JH3A 2MQ8A 3D28A 5LXRA 4OZLA 1NJWA 1LXJA 4DUZF 3AFGA 2RT3A 1FF2A 1HNVA 4F67A 4ZITA 2ZC4A 1GEHA 3IWNC 4RW6A 2NUUG 5ETMA 4GVBA 1HPZA 2V8PA 1VBZA 1URNA 4JV5J 3BQ2A 1WTBA 3H4DA 3W9IA 3D5MA 4LR8A 3CCQS 3MCNA 4P6QA 2D3O1 4PWUA 2OAUA 2DCLA 3GMGA 1REVA 2XYHB 2HVDA 5FDLA 2LEAA 4KGMA 1FWPA 1BXNA 3HFKA 3ZZUA 2BJ8A 2ZVSA 1ZOTA 3B78A 3AJDA 4PG7A 3FEYB 1HD0A 2CNLB 5F9LA 1S9GB 2XTJP 4KPCA 4CO0A 1X60A 2CPXA 1T8EA 3C66A 3OHBA 4UZCA 5IWAJ 3KLFA 1CULA 4DBQA 3EWGA 3S8SA 3PVXA 2Q1LA 2Z2LA 3A8EA 2UXDF 2B5JA 1CJVA 1JLFB 1B0TA 1FEEA 2Z57B 1TVRB 2V6AA 4TLRA 4X4SA 4JI7J 4ID5B 1WC0A 2ZHOA 5KG5A 2E5IA 1HLWA 1WTFA 2H48B 1HNZJ 3CDBA 4NE9C 3EGNA 4EO8A 5E33A 3KLVA 1SJ1A 4YFUA 2MY8A 1FRLA 4MK8A 5M2UA 2DIUA 4HDHA 4IQXA 5KFQA 1J5OB 5J2PA 2IMWP 3WX4A 5LXYA 2NSCA 4QIEA 3KOAA 3TA2A 1JNZB 2GJFA 4WBFA 4HHHA 2JLFA 4J9PA 3V6DB 2HVEA 1UFWA 3OPKA 1RQ0A 3MEGB 5KFAA 4DOZA 4CCHA 4ZLJA 3AODA 4DSEA 5ETKA 2CQDA 3K5MA 1XJWB 2V4JA 3IC1A 1F5BA 3ZZ0A 2KVQE 5IS2A 3T9NA 2E1RA 1FRMA 4PQAA 1WG5A 2RD5C 4OLPA 2HHWA 2DO4A 2DGOA 1PG5B 1U48A 1V3SA 5LSLA 3IG1A 3CCSS 4LSNB 1WKLA 1VLOA 3NGKA 3H25A 1FTRA 2FLPA 3I0RA 4RO0A 1S9EB 1ZAWA 3BO4A 1XMOF 1RT7B 3NCRA 1B70B 8AT1B 5I3UA 4ZVTB 1OPZA 2GIRA 5KFHA 2DRBA 5HJYA 1J2VA 1Y10A 3M6XA 5A0YA 3ELHA 4ER8A 3CCES 1PBAA 1R6VA 2EWHA 4I0WA 3MCOA 4USUA 1R0BG 4IFYB 1WKKA 8ATCB 2OELA 1AZSB 3LPYA 1YJUA 3PIOQ 4JI2F 1CBKA 1KTQA 2KG1A 2VIHA 2DJWA 2R8IA 2HS0A 3NGUA 3QYYA 1EP4B 5HQLA 4O3PA 2HFSA 3D1HA 4FYXB 4KFBA 3W62A 5IV4A 3T5KA 1WELA 2R7TA 4LT6A 3UQSA 3MPVA 2AGOA 3AD8C 4USKA 2ALYB 5KTQA 1UVNA 4KHPJ 4ZKAA 5GMDA 1MNEA 4LQ9A 1FX4A 3DCAA 1CG2A 3BH6B 4QIVA 2JC0A 3MGJA 1VBXA 3QT8A 1YQHA 3RGIA 4GRSA 3R6GB
chains in the Genus database with same CATH topology
2W8LA 1FERA 2DTJA 1JLBB 2OIHA 4B9SA 3LAKA 1U8SA 1VQSA 2YNFB 1FD8A 2AYBA 1B0VA 2RDJA 1FJEB 4QWDA 3DLKA 5A8KB 2RF2A 4QOTA 2R7VA 4RW7A 5A6WA 1S1XA 3CCJS 3NCPA 4MJKA 2CPDA 3D1OA 3MMAA 4QR2A 2D3OR 2LECA 1R7IA 4JV5F 2IJNA 2O5DA 3BEGB 4H4MB 5KG1A 1UVJA 4KFBB 1VS3A 2AJQA 4N8OA 2WOMA 3CCTA 5CA5A 4YQWA 1NKCA 4G1IA 5IZHA 3NNHA 2MJNA 3K5OA 4USJC 2DNHA 1FHTA 4I64A 2QE5A 3UW1A 4M8LA 2CQCA 4ZPAA 2Z4PA 1SV5B 4Y2AA 3U1LA 2IRXA 3LP0A 4IRCA 2AYMA 1V3ZA 4PWDB 1RT6B 1Y5IB 2VD3A 3AJ2A 2JEGA 2XGPA 3PM9A 2XI2A 2WBMA 4XPCA 2KHCA 4WFNQ 2FHJD 2F4VF 3NMAA 3CO9A 2ZH6A 2D7SA 2IJFA 3U1NA 2ZHAA 1WF1A 2IHR1 2W4CA 4FXVA 1QVGR 3BSCA 5KG2A 1M0SA 1TL3B 2E5JA 4QPTA 3FRZA 2EC0A 3CGIA 4EZ9A 2QZ8A 2NQPA 2NS1B 3CCWA 1S6QA 1H0HB 3I9ZA 3PR5B 3T3FA 4PRFA 2W9CA 4RWWA 3H5UA 4TNOA 4WIIA 3CJ0A 3QZ7A 2XWXA 4DF8A 5HP1A 2X3GA 2C3UA 3GE9A 5FD1A 1SUQA 3MMCB 3OR1B 3ZC4A 5C42A 1VC6A 2KKHA 3L09A 1FDAA 2B3TB 3GYXB 5E7OB 4CTAA 4GMKA 3DRRA 5DQHA 4GC6A 1KLMA 3MR5A 2ADCA 1R0AA 2JJ4D 2NSBA 4AL5A 4DFKA 4RKUC 1H38A 3CJ4A 3M8SA 2R7SA 4KE5A 2KN4A 2RS8A 5IWAF 2V8HA 4EBCA 1S0NA 3DLKB 2E5HA 2RF2B 4KRWA 4RW7B 1S1XB 2ZITA 5I3QA 2R2SA 3MMAB 2YKQA 4DDFA 2GJIA 3CCLS 4NZ0A 1VQ8S 3DYAA 4ECTA 2HQ3A 2DNZA 5EGYA 4KJIA 2GHPA 2MKJA 2ZDPA 4EFAC 3L3CA 3FMWA 2IYGA 1FKOA 2ZH5A 2WAQD 1WHWA 1IJEB 5K5MA 4RNFA 3M32A 3VTIA 1DTTB 5KOWA 1NJXA 4R8UA 1P27B 4P7TA 3C2PA 5F8NA 1HW8A 1RISA 4O44B 1HI1A 3GFZA 2MKIA 3RR8A 2ZKUA 3DLGA 3LP0B 4DPOA 1MMDA 4X4OA 3KHHA 1IKVA 1N52B 2F7VA 4DEZA 3H4BA 1IKWA 2F8HA 3BGFA 3R5AA 3MUVP 4JI7F 1F0XA 3OFHA 4YDDB 2O67A 1S79A 3LUYA 3MPYA 3WZ0A 1ZPVA 2M9KA 2YNGB 4F4XA 1Y0HA 3OTEA 1CPZA 4DSIA 2VOOA 3OFFA 1YWXA 5KG6A 1HNZF 4K0KF 4LFBF 1J5EF 5E3PA 2K2PA 3CIZA 2Y1IA 3BF4A 1FE0A 3CCRS 2DH7A 1JLGA 5FIIA 3TA0A 1S6QB 3PJXA 4USHA 3PW0A 4ED5A 1JKHA 2Q6CA 2W9CB 2XNRA 1XERA 2MHNA 2J6UA 1IUJA 4C8NA 1HWKA 2HNYB 3US5A 2LA6A 5B0CA 4ED7A 1K0VA 2XMWA 1SUQB 2GQCA 4A8FA 4QYZJ 1XBWA 1IJFB 4WK1A 2JLGA 4M5DA 4DV5F 3RW6A 4CTAB 3DRRB 4WYWA 2CQBA 4YB6A 4MKAA 2WHOA 5KFTA 2ZJQQ 5SUHA 1R0AB 3SFGA 3MURP 4WFAQ 4I6AA 4B3MF 4EZ6A 4R0JA 3CC7S 4ED8A 1TKDA 1DBDA 3G71S 1S77D 2C2EA 2CKWA 3H2LA 2XMKA 3LWLA 3ZZYA 1FNXH 1OSCA 1G7CB 1MMNA 1BQXA 1C2PA 2AJFE 2C3OA 5F3TA 4J9NA 3R1LA 5KFDA 3FRYA 3HVTA 3O2IA 3R27A 2VKZG 2Q66A 2DH8A 5HMWA 3UCGA 1H98A 3F56A 3FFIA 3ULHA 5HMZA 3GIKA 1TK8A 3OR2A 3W7BA 3VAMA 1T7PA 4B9UA 3DU5A 3KMQA 2BRLA 3M32B 4GO7X 4AL7A 3ETOA 1JJ4A 2WONA 4R8UB 3GG0A 2WK4A 2NPIA 3NCQA 4RU2A 5F9NA 3IXQA 3GV8B 2E44A 3MTJA 1IKVB 3KLGA 1U1PA 2VBXA 5DQGA 1IKWB 1YG0A 5D78A 4Z37A 1ZZNA 4K50A 4HTJA 1YTYA 2V9KA 3LP2B 4WKRA 3DLJA 1MMLA 2JHEA 4PG4A 2WCXA 4WZMA 2VFTA 1XNQF 3I5BA 4K4SA 2VPXB 3NG8A 4MIBA 2HIQA 3BDEA 2VG5A 4K4XA 3SCKE 4ILRA 3CULA 2CQPA 3OVBA 4LVNP 3P3DA 2XLJA 3CEDA 4IRDA 1SIZA 1GTHA 4X4QA 4QU6A 4ZDNA 1JKHB 2BRKA 2A2DA 2KO1A 2RQCA 3EYZA 1H6KX 4C8LA 2Z0GA 4WU2A 3IGNA 3J80Y 4MYTA 3PX6A 4A48A 1S1WA 4M5DB 5KFVA 4ZVGA 1M5VC 2A18A 2FDNA 4I2PA 4JBCA 3PKMA 1DTQA 1JMTA 2Q6BA 2R2RA 3V6HA 1FXRA 4QIWD 1U2RA 1LKZA 3PR4A 2CJBA 3T6JA 5D4PA 5IM0A 2JSXA 4PCQA 1YRTA 1UVMA 4RX6A 2EVZA 4KQZA 1JLAA 1QE1A 2CQ3A 2DNQA 1Z2LA 3CDWA 3IRXA 4H4KA 4ZP8A 2YY3A 3MM8A 1N6QA 1TV6A 3HVTB 4Q44A 5CYJA 4JV0A 5HBMB 5HMYA 2MZJA 5IT0A 2C3YA 3FFIB 3PX4A 3DXBA 1U6ZA 2L9NA 5D8HB 3OR2B 2YNIA 2RNEA 4O4RA 2H5EA 5B0BA 4NX9A 1HNIB 2DNGA 3JAMY 2WONB 4OJ3A 5DRKA 2ZH8A 4EBEA 4ZPDA 1FNMA 1BLUA 1UKUA 4QR0A 3V81A 2MZ1A 5DO2A 2LXFA 2C2RA 3FNNA 3NLCA 1KEKA 3OL9A 4OIXA 4U9RA 5KFGA 4OI4A 1C1BB 2CPHA 2GC8A 2GIQA 1XK8A 1QSYA 4DSFA 2E29A 2P6SA 1IXKA 4DV3F 2K8GA 5GAGI 2NYIA 4DL2A 2VG5B 4MK9A 4RBVA 3T1YF 4HVZA 4Y00A 2JFKA 1TK5A 3G6ES 2BM0A 1VGYA 3BN4A 2XI3A 3CJ5A 3PW5A 1WD6A 4ZP6A 4KR0B 2XBPA 4OX8A 1MU2B 2M8HA 2QSFA 3NWGA 4ZPVR 2PIIA 4CH7A 1S1WB 3U27A 2PEHA 1VBYA 2QA1A 2V0NA 1UEUA 4I2PB 1DTQB 3EZ5A 3OTCA 3Q8QB 2HS4A 3OJSA 3TRGA 3GV5B 4JV2A 2DRAA 3MTKA 3TR5A 1E6VA 4J37A 4CNZA 2GCFA 4F4WA 4DQRA 2B56A 4Q7AA 3VAGA 5IM0B 3QIPB 2XSFA 2EI5A 1H2TZ 2J76E 1U09A 1JLAB 1QE1B 3IRXB 3SFUA 2PO4A 4B9MA 1N6QB 3CJKA 1TP7A 2POKA 3IAS9 3VAFA 4PXDA 2A1BA 3I56S 4OL8A 1R43A 4KHPF 3NAIA 3S01A 2ERRA 4LUBA 2YNIB 3QWPA 3TVYA 1U1NA 2ZOGA 2ASLA 4FVMA 5KFJA 5KT5A 1IKYA 4I7FA 3KNAA 2R2TA 2OMOA 1LWCA 2ABYA 2LLZA 1D9AA 2QRRA 4WTYA 1GX5A 4PQUA 1FT8A 5GAHU 2W7OA 1QAJA 1KVJA 4BC9A 5AE2A 2AW0A 3V6DA 2RB7A 1SC6A 4DQQA 2DIVA 2N3LA 2PA3A 3TUZC 3T1AA 2DR7A 2UV8G 4HKQA 2JOQA 3BSNA 5J2NB 2DCUB 2YX1A 4DN0A 1R31A 3FEZA 3NP5A 3RYLA 2OTLS 1N48A 1D0EA 2W25A 3FGVA 3MF5A 2YX4A 3NNAA 4N76A 1VRTB 4URSA 4IFVA 1S72S 1ELOA 1SL1A 4J9MA 1GQEA 4DV1F 2R7XA 2R7QA 5H9EJ 3BR9A 1FE4A 2DK2A 1FXLA 4CZCA 5DDPC 2D41A 3WDOA 4Q5VA 5GADU 4KHMA 3OJUA 4WFZA 3NMRA 4OFZA 2LVWA 3ONQA 4OMFG 1N5VA 2M5YA 3CJKB 4LF8F 1ZH5A 3CMAS 1ZM2A 1N56A 3MD1A 3J7Z5 2D1CA 4RWXA 5F0UA 1TR0A 3CSKA 1UVIA 2G1DA 3D0GE 1F9FA 3CPWR 2PI5A 2IMOA 2ZE2A 4ZS6A 1X4BA 1KVIA 4NLOA 2BE2A 1IBLF 2ILZA 3GSDA 2DPJA 1IKYB 4I7FB 2DNKA 1X5SA 2G13A 5CZXA 5T7LA 3TO8A 4RUHA 2BBEA 2FTRA 1LWCB 4J9KA 1VIOA 2YKMB 5KG3A 1RT3A 1U1MA 5AJ3F 4NLTA 3HT3A 2UVRA 7FD1A 3UR3C 4IO9Q 1KR4A 2RKIA 3EGZA 1Q53A 2ZKTA 5F8MA 1RT7A 3GIJA 2UUAF 3KJVA 2B4UA 3DN9A 2LQJA 4O4GA 2KFNA 1W25A 1K8AT 3SDEA 2QMXA 4LSLA 1PILA 1R8HA 2IRUA 1FRXA 3DRXA 3BQ0A 2OD6A 2WB4A 3DLHA 3I0SA 2RH3A 1A6LA 2MMYA 2HNDA 2P9GA 4NCBA 3LW5C 2F8EX 3LO3A 2QLXA 4F02A 3KKFA 3FSXA 4HI2A 2MY7A 4IFVB 1SJRA 1LQ9A 3FZBA 4H4OA 3AB2B 1UA1A 4I56A 5LT5A 3QAEA 4CO5A 4LF4F 4NA2A 4DR4F 4O3QA 1TAUA 4B02A 1DQAA 4HH0A 3R1HA 2V5HG 2XMVA 2ROGA 4OHWA 1T03A 1I1GA 2MZTA 4OLOA 4EYIB 3DM2A 4CO4A 2YKAA 3RBEA 1U6BA 1UEVA 1VI7A 3TUIC 2XGQA 2C3PA 2HFZA 3M2RB 4K2XA 4MIWA 2FJXA 5U47A 4XDDA 3VAJA 3VWSA 3FEXB 5LSOA 1R8PA 2AX0A 2ZE2B 2LXIA 2B51A 1VFJA 2XCAA 4N41A 3I5CA 4FXDA 2HGNA 4KBIA 4LIRA 4YDXA 2BE2B 1WACA 5FJ4A 2LEPA 3M8RA 2DNMA 3UWTA 4HYKA 1U6FA 5DM7Q 5T7LB 1HNWF 3MFIA 2XWYA 1X4GA 2HRUA 1QUVA 5KFEA 3KLHB 4G6VB 4ES1A 2PFFB 1VK8A 2HHPA 3DRYA 3LWMA 1RT3B 2RSQA 3SI8A 3OSNA 1RA6A 4Y65A 2EG1A 3BJYA 2VQEF 4LFAF 2VH7A 2RKIB 4QU7A 2JLEA 3I9V9 5L1IA 2G0CA 2YWHA 1D9FA 1XR7A 3TYTA 4DR1F 4O4GB 1U24A 4Y2MA 2VBWA 2AGPA 3SDEB 4LSLB 1U2FA 1WEZA 2DGQA 2E1MC 3N5FA 1SJFA 1UFLA 4C0OC 4C0HA 2ZH2A 3D54A 1FK9A 3I0SB 2FJAB 3JYTA 3AQOA 5BR8F 2R2UA 5AE3A 3GV7B 4FF2A 3SQGA 2HNDB 2YX7A 3F41A 1FRHA 2ASYA 2C42A 1M90T 4BWMA 3E51A 4BS2A 1WNEA 2CQGA 3K5NA 3MXHP 2BQRA 4H4OB 2YVSA 1L3VA 1LFWA 2DH9A 5JUMA 3PO5A 1BGXT 4KV8A 2GMLA 3JSRA 1T94A 4RLEA 1SIWB 5HMXA 2KHDA 2UVWA 2JWNA 5L39A 5E3QA 2LDYA 5KG7A 1MWYA 3BGUA 5H9FJ 1X7VA 3OXFA 1N5SA 2CVEA 3GWCA 2XLKA 1HWLA 1FVSA 1KONA 1RYRA 2J8AA 2XULA 2MKKA 1YJ9S 3LGNA 4C7QA 3VCDA 4XK8C 2B9WA 1SH2A 3DM2B 4ZCIA 1F5CA 2XLIA 3V4IB 3KK3A 4JOUA 1V9OA 3GZ7A 1FDBA 4FPRA 1DHMA 4Q2MA 5G4DA 4IOCQ 1LK5A 4M1KA 4NLYA 2FHKA 1DFDA 1JWWA 3BSOA 3RB3A 1HBOB 4K4ZA 4DQSA 2E5GA 3FJ2A 2R8KA 1DARA 2GMHA 5LL6d 3HX9A 4DUYF 4JI8F 4LF9F 4DMZA 5A8KA 1VJWA 1L3KA 2LEBA 1RYSA 2HG4A 1O51A 3FDSA 3I96A 2ZH9A 1KOOA 5M2PA 2N7CA 1UETA 4C98A 1JB0C 5LJ5Y 2R7UA 5E3CA 4X4UA 5LMUF 5KFKA 1TFWA 1RT5A 3OW2R 2HWIA 1DJ0A 2CFXA 1VMBA 5ADZA 1UL3A 1DQ8A 4NA3A 4CO2A 4ELVA 2KVIA 2M4MA 4KSEB 2L08A 2U2FA 3HDSA 2E9TA 2BM1A 5B0DA 1F60B 2RU3A 1FNOA 1FDDA 3EUNA 3M1VB 1VQMS 4NXMF 1Q8BA 3W2WA 1S48A 2CPJA 4JUZA 3LANA 3SSSA 5DG7A 3EPIA 1APSA 3U1MA 4F2SA 2HHXA 3RU0A 4L3NA 4A8XA 1FK9B 3JYTB 2Q79A 3OSPA 3SQGB 4EYHB 4V19J 2HHQA 2AF6A 3GFXA 1QY7A 1VQYA 2QEXS 3W2VA 2DT9A 2FY1A 4ECUA 2XY5A 3IS9A 4X4RA 1TL3A 4WE1B 3RRHA 3PKYA 1QM9A 4KV8B 5B7WA 2LDIA 1WF2A 2LYVA 4FP9A 1M5PC 3CD7A 4ZCMA 2VODA 3MMJA 3MOJB 2QT7A 1M5SA 2V2KA 2VA2A 1EETA 2AYGA 3SV4A 3I4PA 4ZHRA 2VV5A 1XWLA 4MMOA 1ZTWA 2HRYA 5K8NA 3KK3B 2VG7A 3N9UC 3DGPA 3DXSX 5HI7A 4K5SA 4NMLA 4X4PA 4KTQA 4OI6A 3M8QB 3HK2A 4MAKA 4OHZA 4U7CA 1NK5A 1S0VA 2UXBF 4KO0B 1RT2A 1U25A 4CNYA 4DR7F 1SJQA 3FSYA 4FS2A 3CDAA 2GW8A 3K59A 1MWZA 2UUTA 1S99A 4B3RF 2EPIA 3N6NA 1CVJA 3AHPA 5A2QY 2A3JA 3WC0A 2CQHA 2N4CA 2FHMA 3SV3A 2OJ3A 4I68A 4WZQA 2HGMA 1E6YA 3UFCX 2F1FA 3OFEA 1DZ5A 2J7KA 1RT5B 1U45A 1VQ6S 4F2RA 2GO9A 2DNNA 4KPYA 1RGVA 3MI7X 2H9ZA 7FDRA 3QLHA 1DTTA 5I42A 1NJIT 2HAIA 3W2WB 4O44A 1NEEA 2QA4G 3B82A 1JLCA 4OI3A 4YEAA 4MK7A 2OO4A 5T14A 2LMIA 3NBPA 1UVLA 5KT3A 3SCJE 1HL6A 4LIWA 4MFBA 4NLDA 5KG0A 3ITHA 1BD6A 2HPUA 3W2VB 2YNGA 2E66A 1HI8A 5JVGQ 3IS9B 3HVRA 2GFFA 1S10A 1HYSA 3CCZA 3AA9A 4TYAA 4ED3A 1G6BA 3UCUP 3CDEA 4JYAF 3LGMA