4QR2A

Crystal structure of streptococcus pyogenes cas2 at ph 7.5
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
83
structure length
83
Chain Sequence
MMVLVTYDVNTETPAGRKRLRHVAKLCVDYGQRVQNSVFECSVTPAEFVDIKHRLTQIIDEKTDSIRFYLLGKNWQRRVETLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords CRISPR-associated endoribonuclease Cas2
publication title Structural and functional characterization of Streptococcus pyogenes Cas2 protein under different pH conditions
pubmed doi rcsb
source organism Streptococcus pyogenes serotype m1
total genus 24
structure length 83
sequence length 83
chains with identical sequence B
ec nomenclature ec 3.1.-.-:
pdb deposition date 2014-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09827 CRISPR_Cas2 CRISPR associated protein Cas2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.240 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4qr2A00
1ZPWX 4ZCLA 1FNMA 2KDOA 1ZM9A 3B82A 1KTVA 4QR1A 4ES3A 3OQ2A 4QR2A 1T95A 5G4DA 3ZZTA 3E3XA 4ES1A 2XEXA 2WBMA 4MYTA 3ZZ0A 1P9QC 4MAKA 2E1RA 3ZZUA 4TNOA 2IVYA 4M1KA 3UI3A 4MYUA 1U2RA 2I8EA 4ZCMA 1N0VC 3LH2S 3B8HA 4ZCIA 2BV3A 2L9NA 4ES2A 4ZCKA 4QR0A 1VI7A 2J7KA 3B78A 2BM1A 1ZM2A 2NPFA 2EFGA 2ZITA 1N0UA 1ZM4A 2BM0A 1DARA 1ELOA 3EXCX 2I0XA 1ZM3A 4FN5A 2CVEA
chains in the Genus database with same CATH superfamily
5KFUA 3KLIB 1ITPA 2CAJA 2RKIA 1RI7A 1UFKA 4AFFA 3AQOA 3DU5A 4LBHA 4UT4A 1QTMA 1NRKA 2KT2A 4F2RA 4DCJB 3R3TA 1TL7B 2ZVIA 4WXWA 3Q23A 3UVJB 1OY8A 2PE8A 3R6LB 2V4QA 2IMOA 1UJ6A 1IBKJ 1T95A 2AKWB 5KFNA 4NLXA 2B8QA 3MEGA 2H5JB 3VVUA 3CCZA 3FBEA 4ID5B 4I4BA 1WC5A 3BR8A 3BH6B 2WTFA 1SL2A 1XBWA 3MOZA 3OL8A 1X9SA 2XY7A 2UUWA 2HRUA 2LEPA 3O6QA 4ES2A 2C1EB 4LF4F 1YGYA 1R8HA 5C42B 2VA2A 4WWSA 3FEXB 2ZBIA 1WC4A 2DNPA 1HBNA 3CXCR 4BLGA 8RUCA 1RT3A 3ZNUA 2Q1LA 4X64J 4BS2A 1HNZF 4LQ9A 2WOMA 2D9PA 2PN6A 3C14A 4AE5A 4I68A 2VB6A 3FSYA 2VFTA 3RRKA 4Q0BB 2FJEB 1J27A 1HQUA 1UPPA 3SFGA 3G9CA 4X4NA 1HBOA 4BCAA 4CH0S 4O44A 3ZC4A 1KOHA 1JLBA 4ZJQA 2R7TA 4KR0B 5ETNA 2R4FA 3MMCB 5LL6d 3O2IA 1S7HA 4DQSA 2QMUB 1WEZA 5F9NA 1OO0B 4KC5A 2KI2A 2EG1A 2M88A 5KT6A 1SC3B 4ILMA 3D66A 3WX8A 4CO2A 1UVJA 2BE9B 2DHGA 1JJCB 3MUTP 1MU2B 3KKFA 5KFPA 3ENAA 3JTNA 1GMUA 1M5SA 2V50A 1YSJA 2V5HG 2XB2D 1S9EB 2DR6A 2HZVA 3DRPB 4KT0C 4K5RA 3MF5A 4DFMA 4WU2A 3F41A 2V4RA 3DLBA 4ES3A 7FDRA 3VGUA 2J8SA 1Q86T 4NLDA 3QAUA 3MGJA 3MUVP 4KO0B 4CRJA 5BR8J 4EGLA 3UPFA 1OQ3A 1SH3A 5EWEA 1FXRA 5BYQA 3NS6A 1FESA 1UEUA 2V2KA 1UEKA 2BW7A 5CYQB 4F04B 1N5TA 1HNXJ 2QYCA 2CADA 3F44A 4PEOA 1P6TA 4HDHA 2KHDA 3EPIA 4DUYF 3GIJA 1NSQA 3MD1A 3PYEA 3ETOA 3UCGA 3AJ1A 1YJWS 1Y3KA 5EUHA 3NRBA 1B7YB 5DGAA 4OIXA 2X1BA 2G0JA 3CD7A 4ZPDA 3IS9B 1SKSA 2DNMA 1MW7A 3EMTA 3PJ9A 2GJIA 5HAOA 4LF7J 4TVAB 3U27A 1WI6A 3I32A 3C46A 1S1VA 3CC4S 3VR1A 5RUBA 1Z2LA 3D0IE 4E98A 4ER8A 3C19A 1T9TA 3TJAA 2HWTA 2ZD1B 2MKSA 4X66J 4EI2A 1FNMA 3PTWA 3UCZP 3OFFA 2PEHA 4I2QA 4OYMA 5DZ7A 2OUGA 2YKQA 3UN3A 2ZH7A 4MKYA 4WTOB 4Y2KA 3CCVS 4DX6A 5D0HA 3H0PA 2HVHA 4TXSA 4DL6A 1IUJA 1QAJA 3KLEA 2CQGA 1WHYA 4JP8A 3EGNA 5T14A 1O51A 2EBEA 2VJVA 1WG4A 5HLFB 5IOLA 4OYOA 2HFOA 1FEHA 1DZ5A 4DR3J 4X4PA 3OD2A 4QW9A 5LXYA 1TKZB 2ABYA 4KKOA 3CDEA 3AD9C 1FRMA 4PXEA 4UUWA 1HR0F 1SQFA 2I9SA 4HH1A 2DBBA 5KG3A 3C6UB 4ZIVA 4HACA 1QVFR 2M5YA 4I69A 1U1PA 1LFPA 2AU0A 1TUVA 1ZM3A 5GVQA 1IKWB 2F40A 2BBEA 2OELA 1KKHA 2DIVA 3LGNA 3UI3A 2MKJA 1BQNA 2UP1A 4B9NA 4IFYA 2V63A 3LP1B 3WBZA 3SYZA 2AP6A 1SV5A 4WP9A 3D6TB 4QR1A 1DTQA 3AJDA 2KZMA 2E1AA 3PW0A 1RTJA 3CTRA 4B3MF 2KFZA 1HL6A 3EYZA 2ZKUA 1MNEA 3OSNA 2HBZB 3HSDA 3UDEA 1VI7A 2GA7A 1RE1B 2WVBA 1HD1A 1C0TA 2NYIA 1G7CB 3O3LA 4WE1A 4JI8J 1IBMJ 2WVDA 2K1RB 2YKOA 2V68A 3IM8A 2QSFA 4PWDA 3BF4A 4OHYA 4RW4B 3NNAA 4LF6J 4C8MA 1BMQB 2A6MA 4KPYA 3DLEA 3AB2B 4X62F 4QW8A 2MLXA 5JVGQ 3RTVA 2CPJA 2BJEA 1HW8A 3BREA 2L41A 2W2OP 1RAOA 3CJQA 5LSLA 4YHHF 1RWPB 3VGSA 4MIWA 4LF9J 5J2QB 2KB2A 2PIIA 4LR7A 2W4DA 1CVJA 1DTTB 3BDPA 2WONB 3LH2S 4DR5F 1T94A 2JJ4D 2CFXA 1UVMA 1KLMA 3VGTA 2AV5A 4KFBB 4NLGA 1SKUB 4FYXB 3JQMA 1UA0A 2AF6A 2ZBRA 1JLQA 3UW1A 2O1PA 4J91A 2JVRA 3MEDA 1OS5A 3ZTRA 4ZMMA 2YNGA 3M2RA 1L3VA 1JJ4A 4JI4J 1I5OB 4OV6A 2MQ8A 3GCXP 3GB0A 2HNZB 2E9ZA 2M4MA 1OPZA 4QWBA 3MM8B 1NH8A 1NCLA 1KTQA 2XMMA 3H90A 1XJWB 5HMWA 1PGZA 3V81B 3SQGA 4DV7J 3Q0AA 1XQIA 1DQ8A 4O3PA 4PR6A 1MN7A 4MH8A 2HMIB 5J1PA 1WEYA 1OYDA 3GMGA 1D09B 2EBGA 1QE1B 1RAHB 3A3NB 1PJ7A 4IOAQ 1R0CB 4ECWA 2VFRA 4OI3A 1Y9OA 2R2SA 4TU8A 2BABA 5F9LA 4CP5A 3AJ2A 1Q0NA 5B0FA 2J7WA 3CWJA 1PJ6A 2VC1A 2IPOB 1O0PA 3DDKA 4CDIA 4IOCQ 4FPIA 1R0AA 2KN4A 1H7XA 3CCJS 4GKJF 4QYZK 1PAEX 4QQBA 3FEZA 2EK6A 3US5A 2DTJA 2FHMA 2N82B 1HPZA 2AEMA 1HHQA 4KSEB 5E0OA 2UZAA 5FJ4A 3NKYA 1SL1A 1Q5YA 4F4AA 2ZE2B 1HNIA 2J0XA 1BQXA 3SZ2A 2KG0A 1RTZA 3W61A 1QJHA 4WKRA 4NE9C 1XEZA 3BJYA 3RW7A 4B3TJ 1Q1KA 1JXVA 1VQ8S 2GIRA 2BE2B 5I4MA 3MFIA 4PXBA 4C97A 4DL4A 2VG6A 2XY5A 1S7IA 1FJGJ 1Q7YT 3EGVA 2GJFA 1SJFA 4DHVA 2KG1A 4S0MA 1S48A 1SVDA 2MLZA 3RJMB 1RTHB 4X4VA 1JKHB 4EK2A 1YITS 5E3RA 3QNWB 2VDIA 2YY3A 3HJFA 3BSNA 2EI5A 3R9LA 1T05A 1QAYA 1IBCB 1RT6A 2HNYB 4DV6J 2CRLA 1T02A 2QSWA 5KFEA 3HHLA 1RWWB 3JXOA 3HFKA 5HROA 2MSTA 2E5LF 1YQHA 3DLKA 3FBFA 1SQEA 2I5JA 3K0JA 2NUUG 2FLOA 4O4GB 2YPZA 2XGQA 3HT3A 2YKNA 4DN0A 2E1MC 4C2MA 4V19X 1OSCA 4TYAA 1WTBA 1MU2A 1SC1B 3PW5A 2EFGA 5EGYA 2IVMA 1HKAA 3G8SA 4CLZA 1T0TV 2GC8A 3LP0B 4IFVA 2YKMA 3A8EA 3HVTA 4OFZA 2D3O1 4RR5A 1Q16B 3FUYA 3UCUP 2F9DA 4RX6A 3PR5B 3QWPA 3HVAA 1PG5B 3O44A 2LU2A 3ITHB 4GVBB 2LA6A 4O3SA 2CZ4A 1SIZA 3QBCA 4C8KA 3AXKA 3UDVA 1UJ4A 4DPTA 1KVJA 3QQCD 3KNAA 1LWFB 5HVFA 1RHJB 3CD6S 5F8GA 4WTYA 5E3PA 2MMYA 5E5NA 3TQ1A 1RAFB 4RBVA 4WJBA 4OYXA 3KUGA 4G1QB 2BKNA 4ZPCA 3GSIA 1TTHB 3C3LA 3MAQA 4B3OA 3KK1A 1YJNS 4AT1B 2IAJB 2GVZA 2IRUA 5IT4A 5HMZA 3KFWX 3KLFA 4H4MB 2AJ4A 5L1KA 3BGOP 1IVZA 5E3QA 2ZWOA 5T7LA 1TL4A 4UTGA 4EEYA 1UETA 2OO4A 4CO1A 3TEGA 3DOMB 1S57A 4JBCA 3QLHA 3WHIA 3OR1B 2E9RX 1CJVB 1FJEB 2VBWA 4P7TA 2GJ2A 3BGRB 2VJUA 4OYIA 3IAS9 3EM1A 3SV3A 2MY7A 2J9DA 3GILA 4OJ3A 4A8QA 1WC3A 2BJ9A 2XWXA 4MYTA 3CNQP 5BR8F 2APOA 2B6AA 4U7UK 5CH7B 2FZGB 5B0EA 3NNHA 4RUBA 7FD1A 8AT1B 2ATLA 4DL3A 2DXDA 3EZUA 4KPCA 1RWOB 4GO5X 1AZSB 4C3MA 1S6QB 3EDRB 2E66A 2Z57B 3ZTPA 2J9EA 2VA3A 2IBKA 4KTQA 3SDEB 3VVTA 4USHA 5JVHQ 2XCPA 2W9CA 3JQJA 1X4DA 3BYPA 1SL0A 4PQAA 2W9BB 4KV8A 5ETQA 1V5IB 1C0UB 4OHXA 2MB0B 3CW2C 4N77A 3UQSA 3NLCA 4UW2A 2PI4A 1N5YA 2CQ2A 4RW8A 2OPPB 1VGYA 4FYVB 2K7JA 3HHLC 3BKUA 4OZJA 3DC2A 1CS4A 4LF7F 1D9AA 1S9GB 4M94A 1S76D 2KFYA 2MZTA 3AOCA 4KY3A 3TZZA 1HNWF 1VK3A 2DH7A 1G6BA 1H38A 4L3NA 3W8GA 1BUXA 3SFUA 4CIOA 3T1AA 3PKYA 4UOHA 3T1HJ 3KMSA 2JZ5A 1UAWA 4ECZA 1LXJA 3MMJA 1I1GA 3HT0A 4C4WA 3KWMA 4U67Q 2ZNYA 2MGZB 4NYPA 1QAXA 2POKA 5KT4A 4ANEA 2IHR1 1NKCA 2ADCA 1FKAF 2SXLA 3CJKB 2HFZA 1TAUA 3EGWB 4NX9A 3EWGA 3W5YA 3CCWA 3OLAA 1DJ0A 2DEJA 4WFAQ 4LBIA 2CQBA 2Y0BB 4ZDNA 3CMQA 5EDWA 3ILLA 2ILZA 3MMBB 5LJ3Y 3X3UA 3FJ2A 2V2VA 3IGNA 2ILYA 1JLFA 2WSCC 5DLFA 2HHUA 1Y5LB 3HI9A 3OJSA 5FDLB 1JJHA 2DGTA 2IJFA 2VQEF 3RB4A 1S1XA 1M1KT 4ZCIA 1HMVB 1KD1T 2NXJA 5KFDA 1NKEA 3I4PA 2MEWA 2BYCA 1QTNB 3AT1B 1OSDA 1JLEB 1J5EF 1U2RA 1LOUA 1NPPA 1X4CA 2FDNA 3TOQA 3SBMA 4C0BA 4ECVA 2GIFA 3DMJA 4DCOB 2UU9J 1OWXA 1U8WA 2MHNA 3VQTA 3OW2R 2KYZA 4PABA 3LALA 2XNQA 1N5SA 3DRRB 1KP6A 3EXCX 4PUOB 4EBCA 1SKWA 2B9EA 3BEGB 3TA1A 1F2HA 1ZTTA 1RT1A 2RRNA 2R8IA 2YX1A 3QT7A 1VIOA 2W1BA 3CJTA 2JEGA 4JI8F 3D2WA 3DRXA 3IP0A 5IFMA 3CCMS 1JLGB 1TKTB 2D3UA 4PAAA 4A8WA 4C8OA 3VAJA 2JHEA 5EWGA 2P9CA 4FPRA 3DDIA 3CEDA 1FWPA 4A8FA 3M6XA 1WHXA 3SI8A 2RIJA 4RBUA 3EUNA 4K4SA 3NGRA 5C24A 2FVPA 4X65J 4J9PA 4CO3A 4OHVA 3W7BA 4XPEA 3DOLB 3MECB 2XMWA 2BE7D 4R8UA 1S0NA 2ZC4A 1CPZA 1L3SA 1Q95G 1WI8A 2MQMA 2KT5A 5HMYA 1CJKA 4ZLPA 4P7VA 2KL8A 2I8EA 4YFUA 2X7IA 1CBKA 2MZRA 4YEAA 1XMOF 4USUA 1VOMA 1UZDA 2QTWA 3VTIA 4DR4J 1S1WA 2C3PA 4NL5A 2ZVSA 2ZH9A 4EYIB 5IT0A 3QT6A 2QE5A 3CCSS 4DL7A 4JI4F 3QATA 1NEEA 3HCXA 4FF3A 2Y9HA 3UNGC 2DHHA 2RB7A 5J2PB 4DR6F 1U1NA 3I9ZA 3K5MA 4C8ZA 4M5HA 2XI3A 2E1RA 4H4OA 1UWBB 1MWQA 2VPWB 2IVYA 2FGOA 4CLYA 2WSEC 2KVIA 2IYGA 5D0EA 5K14B 1N48A 3MEKA 4DBQA 4EO6A 3KNGA 1S99A 3R5DA 1TZ0A 3V6HA 3LQVA 4YY3J 2HQDA 2FZCB 1XK8A 2J6TA 2ALYB 1WACA 3SIPB 3L7UA 1BWEA 2NXCA 4DU7A 4RW7A 1HLWA 1JMTA 4B08A 4RZRA 4NLOA 4FF1A 2Y1JA 2R7WA 2QN6B 2KJWA 1X4AA 3G71S 3ZO7A 2AHOB 1VQ6S 1JLAB 2GV1A 3PRDA 2Z30B 2DKOB 1ZZFA 1B70B 3M8QA 4C7QA 1VR6A 4NLPA 2LQBA 1KBRA 4RO0A 4OYWA 2VQFF 5IM0A 4QPXA 4OJHA 1WG1A 1RTDA 2PMHA 1CEZA 3BKTA 4MYUA 1X4BA 2AT1B 3NL0A 4LFCF 4GKKF 2VPYB 1RA6A 1VQ9S 1MWZA 3PO4A 3B6BA 3PYGA 3K7RA 1LWXA 1Y5NB 1K8AT 3W60A 5DM6Q 4WIQA 2JSXA 4W98A 5GADI 2LCWA 2AWZA 4ZCKA 3OFEA 1UFWA 2CJQA 5KG2A 4R5PA 2OFHX 1RLDA 1NLKL 5C7PA 1NK7A 2CDRB 1S59A 2PC6A 3TVYA 1ZM9A 4CO0A 4FXWA 5IWAF 4AQYJ 4PG6A 2FC8A 2G0CA 2PD1A 2CKWA 1UZHA 3FFIA 4FBTA 4YB1P 2J5AA 3GYGA 2I38A 5CA5A 3MR5A 1FDBA 2F4FA 1FJGF 3K8VA 3OXLA 2JH3A 3T41A 5KFAA 1X8DA 4WFZA 2HRTA 1IKXA 1NBEB 3L3CA 1D1UA 1WELA 2KU7A 1T03B 3KTQA 4M5MA 2MXYA 2FHOB 2RQ4A 3NBPA 5DZ6A 2FVRA 3VAKA 3PX4A 2AJFE 3VF0B 4DS4A 3RU0A 2XHWA 4UOCA 2CWKA 1NPKA 3W5ZA 3GG0A 1NJWA 2CPIA 5EX3A 4DV3F 4HYKA 1VISA 3HHKA 3K59A 1CQNA 5B0CA 5FLXU 4WZQA 3Q89A 4O3QA 2DCUB 2AIRB 2GHPA 4LF5J 1F6TA 2D3OR 4HH0A 1U0HB 2UXCF 3ENVA 1N32J 2YNHB 1RTIA 4ZCMA 1HD0A 2IM0A 1QUPA 5B09A 4TY9A 5LSRA 3N5BA 2HLUA 2QGFB 6AT1B 3IAM9 4UY8T 4NLRA 2EG2A 3RUBL 4EO8A 4J9OA 1B4SA 1CULB 3BBBA 1AB8A 3DNCA 2A2DA 3POTA 3AQPA 5D0GA 4H4KA 1AFIA 1DLOB 4QWEA 2DHSA 2NZCA 3M32B 2HKEA 3BSAA 3LPEA 4DPWA 2GHVC 4EZ9A 4DZ6A 3EE3A 3DXBA 5HBMB 4HHUA 2DISA 2XS5A 4Y2CA 1DRZA 2Y1RI 1TVRA 2XMTA 1QM9A 4TQSA 2IRXA 3EX7B 3HULA 3E01A 3N5FA 2OPRA 4DSLA 3C16B 3R5JB 4RL1A 2HHPA 2ADBA 3GV5B 1VRTA 2KM8C 4V19J 4DPYA 2VKRA 2YX4A 1VDHA 2R7RA 2W24A 2BVZA 2NZ4A 5D4NA 3TVZA 4OJ1A 2M8HA 1NSKL 3N0VA 3I5BA 4FN5A 4ED1A 3MM6B 5IT9Y 3CCTA 4Z2XA 2VZ9A 4Q7AA 2G2YA 4YOEA 4ILRA 3R7NB 2XLIA 1CJTA 2XCAA 3NMRA 3B4DA 1O5JA 1FVSA 1REVB 4NZ0A 3LAMA 4QCLA 2RF2A 1ZS6A 3PJWA 1F9HA 4LF2A 3VAHA 2RRAA 4LUBA 5FIIA 2GIQA 3LUYA 2FJDB 3QRPA 3BQ1A 2CPEA 2R3VA 3RRGA 2HWIA 3GWCA 3M6WA 3TZXA 5A6PA 3CJ5A 2XULA 4RW9A 5FDLA 5J2MA 3IM9A 2RDJA 3J7ZT 4K0KJ 1IKVA 4KBIA 3V4MA 3ZZYA 2XSFA 3D7SB 3H40A 4KIAA 5AE3A 2UXBJ 4F4ZA 3ILJA 1EB0A 2GGPB 2MKIA 2B4PA 4JI7F 2C2MB 1VRUB 2VU5A 5KFOA 2HW3A 2DITA 2FHKA 1KN6A 2YWKA 1X31C 5DG7A 3R2DJ 1M0SA 2ZOMA 1RADB 2NR0A 4LQ3A 4WZMA 4ZP9A 1N34J 1FE4A 5BYRA 5F3ZA 1MN9A 3HX9A 4L76A 4MKVA 4C8YA 3OR2B 2CNNB 2HSEB 3DGVA 4Y6IA 2KXHA 4C11B 2HRYA 3M1VB 2OIHA 5GAGU 4IR1A 2AZ1A 1FXLA 5DO2A 2MZSA 4NI2A 3JSMB 3QIPA 3N79A 2MHEA 1WSRA 3RBEA 5ETLA 1R6VA 1FWKA 5L9NA 5HSPA 5DQHA 2QMWA 2R7UA 1GQEA 3MM9B 4CLWA 1S97A 3VAFA 3QGIA 3J81Y 1RT5B 3NMAA 2OGUA 1CJUA 4DR2J 3IXQA 1P27B 5B0BA 3A4TA 3D6HB 4QWAA 4ECTA 1UEVA 2XYPB 4XAKA 5F3TA 4H4KC 2RVJA 4DX8H 3SV4A 4LVNP 1WDDA 3QT5A 3W2VA 3CDUA 2E5IA 1X5SA 1TAQA 4DWIA 5M2UA 3PIPQ 3WC2A 2Y3YA 3T9ZA 3AB4B 4YN3B 5HATA 2DGVA 4DQIA 4URSA 4FYYB 2R7VA 4B3RJ 3W9IA 3K5LA 5HQ8A 3BPSP 2PMWA 1QLNA 4IR9A 1PC4A 1REGX 1FD2A 2DPJA 2LU1A 3MHYA 5J1NA 2FJWA 2Q3PA 2G1HA 2ZJPQ 5J1EB 2RNEA 1UKUA 3C2PA 4D3GA 2ZH8A 3HSZA 4G65A 2VDHA 2YQ0A 1SC6A 4IDKA 1RWKB 1HWJA 4PQUB 4F36A 4WFXA 3P4UB 2R2TA 2ZH5A 1PO6A 4R0EA 2W2MP 1LV5A 2ZOFA 3OT9A 3W9JA 4ED0A 4BHQA 2BUNA 4LSNB 4M1KA 1BWVA 1YIJS 3M2UA 3JAMU 5AXNA 3Q86A 4ELUA 3D6FB 4JI6J 5HP1B 1LQ9A 4E2FB 2YVSA 2Y0SD 1GTEA 2DY9A 4K5SA 4DPUA 2OPSA 2VHGA 3JTPA 3BQ0A 2XS7A 5EWFA 1XNRJ 4LMZA 2VV5A 2YNFB 3U7JA 1TL1B 2AJ0A 3JQKA 3DLGA 3DM2A 4O0IA 4JI2J 5KFFA 3J80U 2HK3A 5AE1A 2CUYA 3MM5B 1S72S 2R2UA 4RBTA 2AJ2A 2XLKA 4JI3F 1RHRB 1N5VA 4JV5F 4NMXA 3M30A 5A8KA 3DKDA 1QY7A 3I87A 2C22A 5BJRA 4LREA 1VC6A 2MTLA 1NK5A 2OEMA 1YKWA 3OXGA 2QL7B 2RKIB 4ZPAA 1U1QA 5KFMA 2XI2A 3NAHA 2QJ3A 3RAQA 4CCHA 3M8ZA 3KK3A 2C28A 1KFDA 4M5KA 4YY3F 1FFGB 3A8JA 4CH1A 1IQTA 3ENWA 5D8HB 5G0RB 3MAAA 3ICLA 1FKPA 3MEGB 3BBFA 4ILLA 2RHQB 3PW7A 5IC6B 3GV8B 1PILA 1JXEA 2DXFA 4DLGA 2K3IA 2O67A 2LQ9A 4XDDA 3PDNA 2RE1A 1LWEA 4AL7A 3TAMA 3GPAA 4RKUC 1E6VA 2MZ1A 4XIUA 3BGFA 3SXLA 3VAIA 1UW4A 4F2SA 1IKYA 3J7YI 2DNHA 1RWNB 5KG6A 5F8HA 1HBNB 3TUZC 2HPUA 4WXOA 1FE0A 3ZNJ1 1RT3B 4J9UE 4TNOA 4ZVUB 4G1PA 5KG4A 2VFUA 1AW0A 3OL9A 3JTOA 2XMJA 2A18A 4OZ3A 1DQ9A 2WOMB 3C14B 3IWLA 3LWLA 3P3DA 5CZXA 4U7CA 2Y8YA 4ZK7M 3UWTA 4DR1F 3V6KA 2KRBA 1F5BA 5HN0A 2N3OA 5C2GA 3W62A 5A2QY 1HQUB 5LMNF 2MQNA 2YWWA 5B0DA 3VHQA 2IFXA 3Q8RB 4CM0A 5KFJA 1HBOB 1WJ9A 1NSPA 2DVIA 4O44B 3LANA 4Y28C 4DV0F 1VQ7S 5KFQA 2F5GA 3ISND 1JLBB 1JNZB 4NRUA 2DGOA 5D4OA 2W7PA 3MPUB 5K8NA 4Z7CA 1VCTA 4Z37A 1KLNA 1N0UA 1DARA 4QIVA 2DGWA 1ZBTA 3T19A 1SPBP 4ICLA 4I67A 2YKAA 1XMQF 4I2PA 3IMQJ 1PYSB 3H2UB 4ZVQB 3M32A 1K1QA 3H42A 3HSGA 3KJVB 3BKFA 1HQEA 1H74A 4PPZA 3CD5A 3JSRA 4WFNQ 1WNEA 3FSXA 3KDNA 1SH0A 2ZWPA 3HK2A 3T9NA 4HT7A 2UUBJ 3CMES 3DI6A 2HQ3A 2I0XA 4C3KA 2KXFA 2BKPA 3IRXA 1NB2A 4JI1F 3BR9A 2CPDA 4HEA9 3A8IA 3MPDA 4LF5F 2DNGA 2DNKA 4FVMA 3QPIA 2XNRA 3H98A 3FKBA 2GMLA 5E3AA 1PYOB 1U1OA 2OHDA 3MUMP 3ETMA 4K7QA 3NOCA 2OLWA 4OYZA 1Y3JA 1N36J 1HA1A 5IXUA 1SJQA 1PBAA 2OD4A 4FYWB 3QMQA 2H9ZA 4PYDA 3OVAA 2RT3A 2O66A 3P45B 1UCNA 2V34A 1ZAVA 4U8YA 3BN7A 3SSRA 4KGKA 3PX0A 1Q81T 4P2XA 4ZP7A 3KUHA 3I31A 5FD1A 3PV8A 1NJIT 1S1VB 2JC0A 2B9WA 4ZVSB 3V6DA 3ET6A 3DOKA 2A0FB 2WK4A 2D69A 3FK4A 2VH7A 1RWVB 5HJXA 4I2QB 3DU6A 3S1TA 5F0WA 2MPUA 1Q82T 2Z2YB 1GAOA 3EVWA 1V5VA 3KLEB 5AE2A 2BOAA 3JS9A 2B56A 2E1PA 1BHNA 2HQFA 3K5PA 3BGLA 8ATCB 4OYBA 2V9WA 4OZLA 2I1RA 4KKOB 2YPYA 3KDOA 5GMDA 1OY6A 4UF4A 2RSQA 3L7OA 4TQRA 2VPXB 4DQRA 1YK9A 1RT4A 4BWJA 3ZZZA 3Q8UA 2OSQA 4HACB 4JI0F 1U2CA 4U9RA 4ZJLA 4Q44A 3VWSA 5E33A 3H2LA 2Q6CA 4U95A 1WKJA 2M52A 5THWA 3GP9A 1VHIA 3TWZA 1BQNB 2YBVA 5C2CA 5DM7Q 2JX2A 5CQGA 4IFYB 1EQMA 1RISA 4DEZA 2R8JA 1SV5B 1FNOA 3OTCA 4USMA 1DTQB 2ZM6J 3I0SA 5ETPA 1RTJB 1RWMB 4K0KF 4Y34A 3WQPA 4B9TA 3VGVA 2N4DA 2CPFA 3G82A 1C0TB 5F8MA 3UFCX 3OJUA 3E8OA 4QZVB 1XERA 3WDOA 3M8RA 3CCQS 2FLNA 3I5AA 1F9FA 4HDGA 1OMSA 4PWDB 1N34F 1NAQA 1T3OA 2VONA 3D0GE 4JB8B 3RR7A 3D9BA 1HI1A 5E2QA 2UUCF 1KQFB 3DLEB 1FF2A 1KQSR 4C98A 2AMCB 1BE4A 3F0NA 1FRIA 2MJUA 2XZWA 2EPIA 1X0FA 3A3OB 1FKOA 4OI2A 1JJ2R 2HBRB 3PW4A 1YJRA 4ZPWR 2DNNA 3GV7B 4AYBD 4LFBJ 1FJCA 4NXMF 1KLMB 2EEYA 4DR2F 1JLQB 1TP7A 4HLBA 4A47A 2DR7A 1JB0C 3QFHA 3MEDB 3KMQA 2YNGB 2YX7A 1RAJA 3M2RB 2YWGA 5HI7A 3NWRA 4MJKA 4KGXB 5ITHA 1A0OB 5L1LA 1LK7A 3HF5A 4QJVA 3OUYA 3C15A 4Q8EA 1LW0A 2RS8A 2B5JA 2NXNA 1Y10A 4PG8A 2IY5B 4YP3A 5KG7A 2JFDA 2ZZMA 3A13A 3SQGB 4AD6A 3TNVA 4WFBQ 1RBAA 1HBMA 4ZLLA 4OMFG 2CJKA 5KFXA 3J81j 2L9DA 1Q53A 4OYPA 3ILIA 3TUIC 4LF8F 4G3IA 1VS3A 1NDPA 1NZ8A 4I6AA 2DHXA 2N3LA 3TEHB 2BJ1A 2EVZA 2VG7A 5SUHA 3AA9A 2EFOA 4RJVA 1R0AB 3IO1A 1RYRA 2VOPA 2DRAA 2GFFA 3ILOA 3D3BJ 3OVSA 1HPZB 1NHKL 1TL5A 5G0RA 4JI5J 4DV2J 1SUQA 5E7OB 1HNIB 2WVFA 4FP9A 4K4WA 1AUDA 1EETA 5I42A 1GMVA 5DG8A 3A8KA 2ALZA 5KG1A 5K8OA 2Z2LA 2H51B 2VF3A 4DSFA 3DGPA 1XNRF 4GC7A 3DDNA 3CGIA 2UV8A 3DYAA 4LRFA 4PG7A 4N7TA 1D9FA 1GK8A 5AJ3F 2QRRA 3TI0A 3SCIE 2VG6B 2DR5A 2OTLS 1DHMA 5B0AA 4Y3CA 1UJ5A 5M2PA 2EFPA 2CPYA 3HDSA 3PIOQ 5AXMA 1B99A 1FNXH 1X0PA 4YB6A 3KLVA 1X4EA 2V9KA 1TKDA 1XR5A 4BC9A 3OPKA 4OV1A 2FLLA 3IG1A 4M5GA 2WAQD 2BJ7A 1T05B 2PFDA 3M9NB 1RT6B 2NXEA 2IJRA 5HVGA 3X1LB 3GIMA 3HHLB 4WU3A 3SCKE 3UR0A 4QIFA 4UOFA 5HROB 3CO0P 4NPOA 5JMNA 3DLKB 2I5JB 5IQ6A 3HHEA 3NCQA 5MLCV 1WF0A 1UA1A 2FLPA 2NXUA 2YKNB 2UUAF 2UVVA 2B4UA 4LIWA 1J5OA 1S0MA 1XR7A 4A8OA 3PYDA 3RBZA 3T1YJ 3PM9A 4ZVFA 5DRKA 1ZAXA 2WBMA 1N33J 3KJVA 1S4FA 1Q4RA 4CYUA 3RB6A 4IFVB 1W2BR 2YKMB 3N01A 1YRUA 3NCRA 1U48A 2NPIA 3HVTB 1NHVA 3OTOF 2VFVA 2G0IA 1RHKB 1RSCA 3I82A 2CNLB 2YNIA 3TW0A 2C3OA 2CXEA 2WW8A 4Q2LA 3KJNB 3MXHP 1FTRA 5KAKA 3OHAA 2OTJS 1NU4A 4QIEA 3CJ2A 4IG3A 1ICEB 3OL6A 9ATCB 4I6YA 1A9NB 4X4UA 2OD6A 5CHCB 4YB7A 2BOPA 4ID8A 4DL2A 1G2EA 2AYGA 1CLFA 1PBUA 3M4XA 3MM7A 1ZM4A 2HHVA 1TK0A 2QEXS 2BEFA 3B54A 4B3OB 3KK1B 1S1TA 3IA0A 2DK2A 4WFYA 2BANA 3P8BB 5J2NA 3FRZA 2GVZB 2FY1A 1TUWA 4M5IA 3AOBA 2KXNB 1BY9A 3KLFB 4DV5J 4K50A 3GFZA 2HFNA 2MYFA 3KOAA 2KO1A 5T7LB 1HBUA 1HWUA 2HHHJ 4ZOSA 4DV1J 2V4JA 4QIGA 3KLHA 2XTJP 3GTYX 3H59A 4EUVA 3PZPA 3LP2A 3QLHB 4DUZF 1GMWD 2H4WB 2KKHA 4DG1A 2A6OA 2V8HA 3AHPA 3F56A 2W2NP 5HANA 3S8SA 5LMUJ 3RYLA 3QZ8A 2UUBF 1B7FA 2DGUA 4P75A 1NJZA 1NO8A 2ZHOA 3K2YA 5AT1B 4NCAA 2XHCA 5CYMA 4NLVA 4A46A 2B6AB 2B4OA 4F3MA 2IMWP 3OTDA 3W65A 2IIHA 5C25A 2RILA 1U6BA 1R6YA 4IUFA 2UXDF 1URNA 4M5DA 4FYDA 2W9CB 1WF1A 1RU2A 4CH7A 1EP4A 4ELTA 2XZDB 4ECQA 5L8RC 2BQUA 3W2WA 1EKRA 5KFYA 4IH5A 3EICA 4KV8B 4LF4J 4CO5A 1KS2A 4ZPBA 1KHWA 2F4VF 4ZLNA 2GAGC 1N5YB 3P6YC 4RW8B 2H1YA 4N5SA 4C8LA 4HTJA 2LXFA 1VC0A 3Q8VA 1R8BA 1G1XA 3Q8YA 3CULA 4LFAJ 1CS4B 3HD1A 2N4CA 2P9EA 2GS8A 1SB6A 1HNZJ 2R8HA 4HKQA 2FJBB 4F02A 1FFWB 2K7KA 2XLJA 4P10A 1F1BB 3R8YA 3KLGA 4USJC 1TMJA 3N28A 2HAIA 2KYXA 2Z58B 2AJ1A 4DDFA 5I3UA 1V3RA 1WSVA 3UN5A 2QX0A 4BBYA 3RG6A 1HW9A 1T9XA 3UDLA 2G1DA 3Q8PB 2ROGA 1H7WA 4IRKA 2KZZA 3KYLA 1LK5A 2KHCA 5K8PA 3IFEA 4KHRA 3W9HA 1ULRA 1FTCA 2JC1A 1JLFB 2KT3A 1S12A 3PCOB 1RJJA 2NSBA 5KFTA 1EZZB 2PO4A 2JWNA 1Z4UA 4O23A 1VK8A 1GH8A 1S1XB 4IQXA 2DNZA 2HHWA 1LXNA 2IA0A 1RLCL 4ZP6A 4X4TA 5IC4B 1FI4A 1XWLA 3GYNA 1IJEB 2J6UA 3DMJB 2GVDA 1Q78A 3SMZA 2CG4A 1X4HA 3KG0A 2EFNA 3IWNC 4PWWA 3GYXB 1ZPWX 2XS2A 5K9FA 2B9XA 5CZVA 1ZOTA 2XY6A 1T11A 3JSBA 3CMAS 1HI0P 4OL8A 1VQOS 1EAYC 1S1UA 2YH1A 4QPTA 2ACYA 1RT1B 5EHHA 4ALZA 1MMLA 5KFBA 4FF4A 4RNOA 3EJMA 3I5CA 1PKUA 2VBYA 4A8SA 4ZA1A 4U6PA 4OX9F 4CO4A 2HNDA 1CQMA 1DY3A 3IBWA 4L73A 3G86A 4KJIA 2B9YA 4Y00A 4GVLA 1TV6A 1ZA1B 1NK9A 4CLKA 3JB9k 1EQ0A 4IG0A 3CCUS 4USKA 5AXLA 1QUVA 5G4DA 1DFDA 5C24B 1Y5IB 3QFWA 1KQKA 1HHTP 1TMMA 2Y1LB 5JUMA 1EARA 5KT2A 4ZVPB 4R8UB 2GX8A 1ZPVA 4G1IA 1LEOA 2AD9A 4D3HA 1HYSA 4G6VB 5GADU 1CJKB 1TR0A 2DPIA 4LFBF 3RBXA 3R97A 2XGPA 4JYAF 3N4WA 3Q2TC 2XWYA 3JYTA 2QYGA 5CCMA 1K0TA 3CT9A 2DH9A 2NUHA 3MR3A 4OZNA 3PHEA 3T6JA 3LOUA 1S1WB 3T5HA 4DV4F 4B9MA 2H3EB 3VZIA 2W8LA 2LQ5A 4ED7A 1S0OA 1WEXA 3MAHA 1OJ4A 2YWHA 4KH1B 1SCJB 4B9VA 4OHZA 2J8AA 4F50A 4TLRA 4CTAA 1E6YA 4H4OB 1SJ4P 2H48B 1RB0A 2CQ3A 1CC8A 2J0WA 3TJ8A 4AXIA 4YB5A 1NKBA 4F4WA 3K17A 4ED8A 3U1MA 1BLUA 3BS9A 4JV1A 2RU9A 3GJTB 1X9WA 4RW7B 1FEEA 3MPWA 1FA0A 2RHSB 2ZJQQ 3R7SB 1ZETA 2QL9B 2CVEA 2KTQA 3BO4A 1M5VC 1JLCA 1NZAA 1VBXA 4DQPA 1C1CA 3M8QB 3H20A 3G6ES 2G4BA 5HQMA 1TKXA 1S9FA 2KJVA 1RHUB 2J9CA 4B3MJ 2LDYA 2ATCB 3KHHA 2CIMA 4CLTA 2DO0A 4KYZA 4DSKA 2FGCA 3CJ4A 5IM0B 2KM8B 3I0RA 1RTDB 4Q45A 4K4UA 2P8IA 4KH0B 2OPQA 1YWXA 1ZM2A 1IBKF 1AXQA 2CJ9A 4X4RA 3G6VA 2VFSA 3TP2A 2F3JA 3MMAA 1SC4B 4DV2F 1IBLJ 1HWLA 4F0MA 2X1AA 2DNQA 4H54A 2RU3A 2FD2A 1M5HA 2RDDA 3TA2A 3PEHA 3W63A 1BXNA 4ETXA 4F3QA 4R5PB 2D1CA 1F5CA 4X62J 1UTAA 3M9OB 2V6AA 3TVKA 3LF0A 2CJBA 2HBQB 3V5RA 5CYJA 4GC6A 3BPDA 5M2RA 2C2KB 1VYAA 1WKLA 3FFIB 1S6OA 3D0HE 4UQGA 1L3TA 2QV6A 2GNKA 2EK1A 4DR5J 3IRWP 4WYWA 2E5HA 3PX6A 3NWGA 3IBCB 4RW6A 3HHDA 4QR2A 1FXDA 1V3ZA 4TYBA 4X64F 3AD8C 4RNHA 2ZH4A 2QLJB 1IKXB 4OI1A 2CDQA 4MTPA 3BDEA 2QA1A 4IH7A 1RT2A 1U0SA 3NBPB 4ZN1A 3R5BA 4HL9A 4C8NA 1WC6A 2L3MA 3D4JA 2IM2A 4ETZA 4I0WA 1KVIA 2C42A 3MEEA 1L5UA 2LQJA 5DQGA 4EU0A 2JVOA 3M6UA 1H3DA 1T7PA 4QYRA 4N56A 2DR9A 3E51A 2EFVA 2GQCA 1M90T 2J7UA 3RRHA 5IV4A 4F4KA 3HVRA 2MQPA 4U96A 3CJRA 1RTIB 4EYHB 2OAUA 3PG9A 2EC0A 2GCFA 3UD5A 4YS2A 4MIAA 2HGNA 1AFJA 5IZHA 3G2XA 1C1BA 3KHLA 4URQU 2FY8A 1PAUB 2WSFC 2P6TA 2PMZD 5D6GA 4GKJJ 2BR0A 3POTB 3IR6B 2DYAA 1FRXA 4AL6A 1HIYA 3B82A 4EBDA 3QAEA 4IYQA 1N6QA 1P9QC 1ZA2B 3MR6A 4J9LA 2FJAB 3SEOA 3FC9A 2Z4PA 1UWAA 2DY1A 2CQPA 5E41A 2X3GA 1KSPA 2PDAA 2OP5A 3I4HX 1C2PA 3Q24A 3QSYB 1HNXF 4GO7X 2AYBA 3QGGA 2HGLA 2I6WA 2X51A 1TVRB 3SQOP 3QZ7A 4OJGA 3MCOA 3CB4A 3AXMA 3E01B 4M8LA 3NGTA 4UY85 3OL7A 2QFIA 1R0BG 2OI2A 1XNQJ 1LW2A 1P8GA 2OPRB 3QO9A 1VRTB 1RABB 1WTFA 4X4SA 1PJ5A 5KFIA 4B3SJ 1PIEA 2HFVA 2HYIB 3PHTA 2HHHF 4DV1F 1L3UA 3M8SA 1UW9A 4X66F 3B8HA 1RCXB 4EBEA 3MI7X 1Y00A 1Z1ZA 1B0VA 3KHRA 2CQIA 1JQGA 1X4FA 3AD7C 2R42A 1BQMA 4NA3A 5LMUF 2L08A 2JL9A 4Y65A 2C3MA 1ROFA 5KG5A 3I56S 3M05A 1Q7LB 3S7RA 1CJTB 2JLGA 2E5LJ 1VQKS 4O4RA 2WZ1A 4ZVRB 5ETRA 3TZWA 5A8RA 3TARA 2JNJA 4NXNJ 2RF2B 3TAQA 2GQ2A 1U45A 2R7QA 2HS0A 1NMEB 4DR3F 4TY8A 1ZH5A 1H2VZ 4J5OA 3GLJA 1F9EB 1VLYA 1H2UX 3M8WA 4RW9B 1NK4A 5J2MB 4ZJOA 1FX2A 5A8WA 1FRLA 1IKVB 2VPZB 3S6EA 2HIYA 1WOPA 2L48A 1R27B 2FVSA 2G2ZA 2R8GA 1M5OC 4RU2A 1IQZA 3ZZ0A 5DDPC 5DS7A 1B64A 4DU8A 4KGMA 1MWYA 5KFLA 1JK9B 5LJ5Y 5D4PA 4LFAF 1NPRA 2E5GA 3RR8A 4P9SA 4ZLJA 1UVIA 2WVEA 1ZAWA 4OX7A 3MCNA 5SZTA 4Z7YA 1S6PA 1FRKA 2QA2A 3CUNA 5D3GA 2B7CB 3RAMA 5L39A 1RT7A 1SJ3P 3NNCA 4OX6A 4KHPJ 3GR0A 4NI2B 2BZ2A 3QIPB 3T6BA 4NZ7A 3THVA 3LW5C 4WCEQ 3R6GB 4ECYA 1IBMF 3DHXA 4YMEA 3J7Z5 2BM0A 4RWWA 2ZZNA 1GT8A 1QAIA 4L3KA 2P5VA 2K2PA 2QIFA 4ZVTB 1CJUB 3MCSA 1U4BA 3KHGA 4M95A 2UVWA 2FTRA 4LF6F 1YRXA 5C5JA 4J9QA 3LWMA 4P2MA 2GMJA 1IR2A 2V8PA 4NLQA 3W2VB 2D41A 1HHSA 1FO1A 2J6SA 4LT6A 1D3WA 2HWHA 1U8SA 3H5XA 5CABA 2NQPA 2OKQA 1F5AA 2MKYA 4LF9F 1GXTA 3VQSA 2KDOA 1DBDA 2BXJA 3RW6A 1Q5VA 3LGMA 2Z2MA 5HVHA 1X60A 2E9TA 2BJDA 5CD4H 1ZTWA 4OI4A 3R7BB 3SCLE 3BQ2A 3GJRB 4WKYA 3IBFB 2JRSA 3THTA 4ED6A 4N8OA 2FB0A 1JNRB 4LBPA 4FDFA 1EHWA 4L6V3 1WUUA 4YUDA 3N6MA 4XK8C 2CPXA 3WIVA 2DCLA 3BB5A 2IJNA 2GAHC 2LEBA 2VL1A 1M5PC 4IDKB 2CNKB 2IC3A 3NS5A 4B9LA 4YR3A 3VZHA 2M9KA 1OPIA 4WBFA 2R7SA 4DV7F 1SH2A 3TAPA 1J2VA 4ZHRA 4U8VA 4C9DA 1Y11A 3M2UB 3ISNC 3J7YU 1HNWJ 1F0XA 3WC0A 1GNKA 4UQTA 4CLPA 2XMVA 3BO3A 3VV2B 2AQ4A 3QJPA 2AZ3A 2HVIA 1XMBA 2OPSB 3PW2A 2BACA 3VAMA 3PY8A 4EMDA 4YDXA 4R25A 2FUG9 4LSLA 3DLGB 3DM2B 2WCXA 1W25A 4OI6A 1TL3A 2RUSA 1RYSA 4M63A 2LVWA 4PCQA 1NM2A 2DGQA 4I7FA 3A12A 4LRCA 4OZ2A 3OHBA 1R3NA 3ISZA 5DDOC 5EN1A 5A0YA 2C3YA 3M2VA 3M30B 3ZFVA 3UD3P 4B3TF 5A8KB 2VQEJ 2XO7A 3HZEA 3KK2A 3H5SA 3M8PA 4ECUA 1YZ7A 5KFRA 3FCVA 1M5KC 4LR9A 1RBOB 3AODA 4U7UD 4ELVA 3KG1A 2CYYA 1KQGB 3MR2A 3KK3B 1R8CA 1J5EJ 4ZVEA 2H54B 3OTBA 2NLWA 4HR2A 5GAEI 3MAAB 3IN5A 1OQ6A 3MZIA 1FKPB 3PRBA 4NCGA 4DL0C 2FHJD 2BQRA 1LWCA 1WD6A 2BX6A 2ZITA 2ZHBA 2BJ3A 3PKMA 2Q66A 2CQCA 1LWEB 3TAMB 2D3ZA 1E6VB 4YDDB 3QIDA 4DLEA 4DCPB 1HARA 4CQ1A 4DXLA 4FNHA 4N47A 4V1Ak 4JV0A 1CC7A 1KVKA 1IKYB 4DV6F 5F8IA 2ASJA 4B9UA 4EZ6A 2F8EX 2WRMA 1IM4A 4J9NA 3D54A 1SI9A 5KFCA 3SCJE 2MLYA 1IBLF 3OXFA 3DLHA 2YQ3A 3D3CJ 2AYMA 1U1KA 3DRSA 1QSLA 2EKYA 4HVZA 4USTA 3QT8A 3BH7B 1R7IA 1HNVA 3OFHA 2MKKA 1ELOA 1U09A 3N9UC 3DFEA 1FK9A 5DDQC 2E29A 3F73A 2MQLA 1GX6A 2VG5A 5GAHU 3V4IA 3MWBA 2DGXA 3OFGA 5DETA 4J9KA 1MROA 3G96A 1RK8A 4ICLB 1GXLA 3M7VA 4I2PB 1XMOJ 2RD5C 2GHWA 1SJ1A 3QWUA 5H9EK 2BRKA 3NGKA 2DB1A 2MKCA 3FGVA 2QLBB 2V2QA 1HQEB 2K8GA 4LSZB 4DFKA 1TQLA 2E5JA 4OHWA 1RGVA 4CLSA 4ATNA 1F3VA 4IO9Q 2XSJA 4L72B 2HVEA 4QIWD 4DR6J 2A3JA 2UVRA 2AGQA 4PYAA 2FJVA 3DI6B 1F3FA 3IRXB 2RMLA 2XZTB 3U1LA 5DGBA 2UUTA 2ZH3A 4OZ1A 1U25A 5T41A 1OY9A 1TU0B 1N4LA 1N52B 1K44A 4NYOA 3CC2S 2P6SA 1FRJA 2VODA 2MSSA 2VC0A 3MURP 4PG4A 2V0NA 3ONQA 3C6TB 3Q22A 1GTHA 3E2EA 4B02A 2QLWA 3HFVA 3WZ0A 3PYFA 4ECXA 1VC5A 3KLIA 2XEXA 3EVOA 2VQFJ 2F7VA 5I3PA 2ZKTA 4DOZA 3DXSX 4MT1A 1TL7A 4P6QA 3UVJA 2MJNA 3EVMA 4LFCJ 2GO9A 4GKKJ 2NS1B 4NMLA 1Y0HA 2RQKA 3ZXWA 3CD0A 4NZ6A 4F3OA 4ID5A 2BV3A 1S79A 4W90B 3GSDA 3V6DB 3CO9A 3ET6B 3GFYA 3DOKB 4M5NA 1QSYA 4O3NA 1NB7A 4B17A 2HQIA 4WK3A 2M70A 4FKYA 3BGUA 3PO5A 4L75A 4PZVA 1FDAA 3QGHA 5IWAJ 1YRTA 1NXIA 2J7KA 3I55S 5KG0A 4K2XA 3U02A 5C42A 2V94A 2FQQB 2OFGX 1JX4A 1XNQF 3VALA 1WHVA 2NPFA 4B3SF 3G4SS 5FLXY 1KTVA 3D28A 4DFJA 5CD4A 1S49A 1YJVA 5BXIA 3K8WA 1C4AA 4WP8A 4Q0BA 1KWMA 5IS2A 4A8KA 4J7CA 4CLFA 4WP3A 3CF5Q 3T1HF 1T9YA 2HFUA 5JXSA 1RHQB 4Y0FA 4CNYA 5D77A 2W25A 3HD2A 2P2CB 4LJMA 1RT4B 1AROP 3QRQA 3BO2A 1U24A 4DPOA 4CLUA 1RAGB 3AOAA 2D7SA 2RUGA 4K4XA 2Y1IA 1TK8A 3MMCA 4C6AA 4DV3J 5ETSA 3CVKA 2DXEA 4Y2AA 3T5JA 4NXNF 4UZBA 1NDCA 3CJ8A 2XMAA 2XYHB 2UXCJ 1WOOA 4ENOA 3DLJA 4XO0A 1S0VA 3I0SB 2BA9A 3MFHA 2HHSA 2B51A 3T5KA 4YR0A 2QZ8A 1V3SA 4WYLA 4PKDB 4DF4A 4M5JA 4QWCA 4J9VA 3G82B 1S9EA 1XR6A 2VIHA 3DRPA 2CQDA 2K06A 1GMWA 4NCBA 2JFKA 4XDCA 4RPFA 2W2PP 1ZZNA 2R2RA 2LFVA 4CLLA 5KFVA 4DF8A 1IR0A 2UU9F 4KO0A 2CQ1A 3B4MA 3HLUA 4IOBA 4CT9A 1FVQA 1T9WA 2LXIA 2DEIA 3FBCA 1S4EA 1RWUA 2GZOA 3FEYB 3LA0A 2OMOA 2PEBA 3BBCA 2W4CA 4KHPF 3A1YG 4OYAA 5CYQA 4OQJA 2VASA 1PSDA 4WPAA 1U6FA 1W2IA 1V9OA 2U1AA 2QFJA 1FKOB 3IR5B 4DUTA 3NG8A 3W1YC 2ROEA 4ERDA 2BRLA 2XG8A 4NEYA 4FBUA 2A1BA 2HG4A 3UDCA 5U47A 5K5MA 3UNYA 2RQCA 3IS9A 4MMOA 1BC6A 2GW8A 2ZHAA 1HWKA 3PVXA 1S5ZA 2YWEA 5HO4A 4YR2A 1R8PA 3GZ7A 4KQZA 2ZD1A 3MD3A 4X84A 1JWWA 2FVCA 4X65F 1X4GA 1KOOA 4P71A 3OUYB 3NXZA 2YH0A 3C15B 5F0UA 3GCWP 3PJXA 1LW0B 4NA2A 2B5JB 3CJ0A 1H98A 1QD1A 2LKZA 1FCAA 1UVLA 2CJXB 4USWA 1IR1A 3FCWA 1HBMB 2ZH1A 4M5LA 4DJBA 2M7SA 1D9DA 2BQ3A 2HBYB 4DR4F 5HLFA 5D78A 2RDIA 2ZUGA 1K1SA 2HLTA 2WW4A 1RA7A 2OEKA 1TKZA 3TQEA 3W5XA 4TKTA 4UOGA 4NWBA 2VG7B 4K4ZA 3ADAC 5MAOA 1T9UA 4KGVB 5LOQA 2ZDPA 2ZJRQ 3C6UA 2B0GA 4JOUA 4JI7J 1WG5A 1OYEA 5DQIA 2HVDA 4K4VA 4Q2MA 4NLTA 2KVQE 2C2NA 5KFSA 1IKWA 2XM3A 2M3DA 5JJBA 1SUQB 1F60B 2AEFA 3G8TA 2ZH2A 4Q43A 1YJ9S 2MKHA 3H5UA 2B7BB 1EETB 5I42B 3CPWR 3I9V9 3Q8SB 3R27A 2EXUA 5ETMA 3LP1A 3U1NA 5CCLA 2CJYB 4X4QA 3DGPB 3UR3C 2IDEA 1UMJA 1KONA 4F67A 5I3QA 3DYAB 1I3OB 2H5EA 1N5QA 1TFWA 1FDDA 1I94J 2IYIA 1B3TA 4I64A 4PXCA 4GRSA 2AYEA 1HQ2A 2K1RA 5K8MA 2CPZA 1U1LA 3OTEA 4HI2A 4BWMA 2CZVC 3HKWA 4HHJA 4MFBB 1RWXB 4C0OC 4RW4A 5DDRC 5E3CA 3CDBA 2AJQA 3E3XA 2O3DA 2H5IB 2I2YA 3IG1B 2H65B 3L7PA 5LXRA 2NSCA 3PFEA 3PNIA 4AQYF 3LTOA 2X1FA 5J2QA 3OVBA 5KFZA 1DTTA 2WONA 1RACB 3W66A 3GU0A 4KFBA 1VMBA 2HK2A 3KG4A 1Q8BA 3BM7A 3OLBA 2YXLA 1J5OB 2CWXA 1WC1A 4ZP8A 3ENQA 3RAXA 1IWAA 2JLEA 3TRGA 3JAMY 3QJLA 1NK6A 4N76A 1VJWA 4LRAA 4CYUB 3UN2A 5KTQA 3GIKA 3N6NA 1NSAA 1G3OA 2IBOA 2HNZA 2YNIB 2V8DA 4ED4A 3MM8A 2RQMA 3K89A 3EZOA 3BSCA 3OBIA 1RUSA 2J0SD 4X2BA 3QRRA 3V81A 2Q6BA 1U1MA 1JIHA 1VQYA 1DURA 2WB1D 5HMXA 4LVOP 3GE9A 4IG3B 2HMIA 1A6LA 3J80Y 9RUBA 2G9OA 3A3PB 1N32F 1QE1A 2KH9A 1YJTA 4K4TA 4X4OA 3RZAA 1DAXA 2XO6A 4O3RA 1FT8A 2W7OA 3C6TA 1Q79A 3MM7B 3UE2A 4BDPA 2HS4A 3J7AN 3HVWA 1VQNS 1T9VA 2JOQA 1VBYA 4N8NA 3GIRA 1S1TB 2V8GA 2BANB 1FRHA 5J2NB 2HIQA 4FVCA 3QSIA 3HMJG 1SBRA 2N7CA 4QBUA 2HZAA 2X3DA 3OQ2A 5H9FK 1HBUB 1CSJA 2ZE2A 2R7XA 2V4JB 4F8RA 2W7AA 3KLHB 6FDRA 4JI3J 2QG9B 2WVCA 3LP2B 4JV5J 4R0JA 2B43A 2WHOA 4DG1B 3MTKA 2CQ0A 1Q8IA 2BE2A 2DNOA 5KFHA 2XQCA 2W8KA 4HTIA 3BN4A 1NHUA 2GQQA 1GEHA 3R5AA 3T3FA 3FDSA 3AY0A 4FXVA 2ZBPA 4DSEA 5KOXA 2W4PA 4EWTA 1K0VA 5CYMB 1PCAA 1FDNA 3TJ9A 4DSIA 4J9MA 1LNQA 2BDPA 4I6WA 1WC0A 2O01C 3HO1A 5GMKa 4P74A 2E44A 5C25B 2DH8A 5D15A 3H7HB 4A8MP 1RTHA 4MKAA 2HAFA 4M5DB 1KHVA 1JKHA 4RU9A 3H5YA 1N88A 3CIMA 1EP4B 3W2WB 3V6JA 1H2TZ 2HNYA 4RNMA 2HVZA 2RRBA 2E7VA 5ADZA 1VBZA 3RGIA 1B0PA 1YLXA 1WOSA 4A8XA 2E7WA 3FCHA 1VFJA 2ZNZA 1RDRA 2CVIA 4CI0B 4O4GA 3NGUA 4DS5A 1U1RA 5H9EJ 3KLGB 1KC8T 2M8DB 3CJ3A 4FF2A 4DR1J 5LSOA 3NOGA 5LMNJ 2LP4A 4ZIWA 3OSPA 5IT9U 1VQ4S 3FMWA 1VIXA 1MMNA 5I3UB 2FPHX 3CIZA 3LP0A 4F25A 4DV0J 2IA6A 2DRBA 2UXBF 2QLFB 3M9MB 1WF2A 1YX2A 1T3NA 6FD1A 3C66A 4TLQA 2CA9A 4XPCA 2E1CA 2CG8A 4P2FA 3DCAA 2LDIA 2E7XA 3LPYA 1XMQJ 1M1GA 5ETKA 3ITHA 2QC3A 4GVBA 5KT7A 1MLAA 2MQQA 4RLEA 3CC7S 3D1OA 2JEIA 2ZFHA 1RAEB 1XN9A 4ZVGA 4KB7A 4NLUA 2ZEJA 2AX1A 2RAQA 1LWFA 2R9LA 2L9NA 2EKNA 2NYHA 3D67A 1YTYA 4TU9A 2DR8A 2HZCA 1NJXA 3NCPA 1SJRA 1NK0A 3LAKA 4G1QA 2C2DA 4QYZJ 1ZYQA 1U02A 2PT0A 1MSWD 1S6UA 2V67A 4JI1J 3TZYA 1D8ZA 5ETVA 2GVDB 2IAJA 2HHXA 3FQKA 3J7A1 4QWDA 4MIBA 1AT1B 4H4MA 5DG9A 2YWFA 3R1LA 1W7WA 1C4CA 2IM3A 1H73A 1S1UB 4HHHA 5AXKA 3WIUA 3DOMA 2ASLA 3KXDA 4YQWA 2DO4A 3H25A 2W01A 1HI8A 3OR1A 3EPGA 1CJVA 3V2UC 2PA8D 1N56A 3SSQA 3BGRA 1P1TA 2G2OA 4MK7A 2HNDB 1X5OA 3J81U 1JXLA 1X5TA 3CE8A 4J90A 1U47A 4B3RF 3MCMA 5IV3A 2KFNA 1TV6B 3MPYA 1IWGA 1UVNA 1YJ7A 4IG0B 2COLA 2B3TB 2B8PA 1RAIB 2EWHA 2ACMA 1DQAA 1AZSA 4ZPTR 1S6QA 1VJQA 4KAIA 3N6LA 2HHQA 3SDEA 2ZC3A 4UUXA 1X5PA 1GX5A 3DRYA 1KEKA 1HYSB 2W9BA 4DX7A 2VBZA 1C0UA 3MTJA 2ZZTA 3D1HA 3D6MB 1W26A 1T8EA 1YI2S 2JEJA 3S01A 3JYTB 2QA4S 2OMLA 2OPPA 1VLOA 4PG5A 1NK8A 4CM2A 4IKAA 1S9GA 1H72C 2LECA 2WBRA 1Y7PA 4DPXA 2ROPA 4JI6F 3M6VA 3P5TL 2AW0A 1UL3A 1IJFB 2X1GA 2A2CA 3FZBA 4CTAB 3O8WA 4ZCLA 1FFSB 3ZTOA 2OJ3A 1E6YB 5KT5A 2MGZA 4DL5A 5F8JA 3HKZD 2UV8G 3L9ZA 4JI0J 3K5OA 1TUGB 2Z0GA 3CJKA 3NP5A 1TELA 1TK5A 2Z2ZA 4JI2F 3T5LA 2FZKB 3EXYA 4C0HA 2QL5B 1QDUB 1TFYA 3AH6A 2B4VA 2JEFA 3MMBA 1KRPA 5F8LA 4P73A 1Y4ZB 4QU7A 5CAAA 4MFBA 1XTZA 4F4XA 2DIUA 3K58A 3GQCA 1RCOB 1JLCB 2ZDOA 4UZCA 1C1CB 2BW2A 1LFWA 3AFGA 1TKXB 5L1JA 1I6JA 4HI1A 1HMVA 1D0EA 1RKIA 1KNZA 5KFKA 4DZDA 3HM9A 3Q2SC 1KFSA 3I0RB 4P72A 4A48A 2VOOA 3Q8QB 1JLEA 2IVFB 2OPQB 3MR7A 2Y8WA 3NGDA 4DR7J 1WDTA 4PPDA 3MMAB 2BKOA 3CCLS 2HURA 1GXUA 1HWIA 3KJQB 2DNRA 2P9GA 1BGXT 4P52A 2EFQA 3ZZPA 2UUCJ 3CCES 2QMXA 2RH3A 3H2VE 3SSSA 4CZCA 2A10A 5KT3A 1WORA 2MQOA 3DRRA 1AYEA 2CQHA 2FVQA 1EIYB 4PUOA 2JLFA 4OZ5A 3HP6A 4Y2IA 2R8KA 1I94F 1L3KA 1U2FA 2CNOB 4B9SA 5K20B 4RW6B 4NXMJ 2W9AA 1RBLA 4OX8A 1APSA 1JLGA 1R89A 1TKTA 3GJQB 1P9YA 1U6ZA 3TYTA 1GFWB 4J37A 1P1LA 2PGCA 2C3UA 5DLGA 4OZ0A 5F8NA 4ZN3A 3CJSA 1RT2B 4K8RA 3VCDA 4ZVOB 4C48A 2D74B 3DHWC 3HHLD 3ULHA 4LF1A 4RNFA 5D4LA 1EX8A 1YG0A 3DOLA 3MECA 2V69A 1IN0A 3IGVA 3MEEB 2G13A 2HEKA 2R7OA 2OSRA 2C2EA 4QOTA 4ED5A 2Z56B 2VUGA 1KDNA 1Q8KA 5BYSA 1SIWB 3RB0A 3QYYA 2LEAA 2XMUA 1N54B 1O6XA 4J9RA 4DFPA 5A2QU 4LF8J 2ZBQA 2OEJA 4K59A 3LGHA 2Q79A 4ZVHA 3EDQB 2BMBA 5J2PA 1C1BB 3PEJA 4ECSA 4LR8A 1UWBA 1NDKA 2F8HA 3L4BC 1G4CA 4FKXA 5K14A 3IWXA 1UPMB 5LM7E 2ASYA 3GJSB 5ETOA 4Q5VA 1N6QB 1S77D 4PWUA 4IQMA 2FJXA 2DGSA 2MZQA 3R1HA 4AUKA 3G87A 3B78A 4O0NA 4ZITA 3HFZB 4E0DA 3NAIA 4FXDA 1FD8A 4DMZA 1FWLA 2DT9A 1JLAA 3R5CA 2FHJA 1RHMB 1VHFA 4MAKA 4GMKA 1N36F 2WB4A 4J9SA 2LXUA 4FS1A 3NGSA 5B0GA 4OLOA 3ZTQA 2LMIA 2XC9A 4DSJA 2FYXA 3ZZRA 5AJ3J 4E8UA 1YBTA 1LW2B 4RUAA 3P5BP 3QO9B 1WKKA 4CNZA 1WWHA 3W8PA 3CDWA 1AA1B 1X9MA 3PRVA 2RJZA 3KUEA 1SKRA 4JV2A 1AUSL 4ANCA 4ZPVR 2PA3A 4LIRA 3D5MA 5HL7Q 1PYTA 2BJ8A 3BYRA 2C2RA 2LYVA 3TUJC 1PC5A 1BQMB 1U26A 2IDLA 4F7VA 4FS2A 5LT5A 3GIIA 2XYGB 1MG7A 5B08A 2VBXA 1N0VC 3ZTSA 3G6YA 3I96A 1O8BA 4ED3A 2F8MA 3WX4A 5A8RB 3TA0A 2UUAJ 2CZ9A 4KE5A 4P2SA 4TY8B 4RUCA 1RQ0A 1T03A 1QSSA 2NCKL 4CT8A 5A8WB 5F41A 1VQ5S 4F0HA 2DRDA 2HQGA 2LQ8A 3M8YA 3OTOJ 1Q8LA 2Q43A 5L1IA 5HJYA 3NEKA 4NLSA 1S10A 4MKBA 4CWBA 5KFWA 2ZUAA 2PSZA 3LO3A 4I56A 3FZ2A 1KR4A 4ED2A 2BM1A 3OV7A 4NASA 3ZZTA 2J0QD 2VICA 5H9FJ 3VAGA 2QO3A 4LRDA 1U0HA 2DNLA 4KHMA 1S6PB 2HQCA 2KRRA 2AX0A 5D3GB 4PXDA 2YNHA 2FIUA 4NRTA 3CCRS 4I1TA 2C2ZB 4QR0A 1N8RT 2EC2A 3P49B 1RT7B 2ZM6F 2D9OA 5EX0A 2XMKA 2W2QP 2F9JA 1RP5A 2JDJA 4TU7A 1U49A 1UFLA 4L74A 4A4JA 3RB3A 4DUYJ 4TN2A 1CULA 3H4BA 3AA8A 1EJ7L 1V6HA 5A6WA 4IH6A 1FJ7A 1DLOA 1WHWA 1YVFA 3PFOA 1VQMS 3FMBA 4O3OA 3TX8A 1M1HA 1YDLA 1K73T 5HQLA 2J76E 4Q8FA 3L95X 3R2CJ 3HZGA 4QU6A 4DUZJ 3DN9A 5HBMA 2H4YB 4MK9A 2OH2A 4MK8A 4IO1A 3RBDA 3HHNB 1XIQA 5CXTA 3IC1A 2MZJA 4JUZA 3QJJA 2L9WA 3CSKA 3MOJB 1URRA 3R5GA 2V8VA 4ZS6A 3BV8A 4DX5A 1YJUA 4OI0A 3THPA 3C16A 3GFHA 3JSYA 3GONA 2GMHA 4FNIA 1Z2ZA 1XC9A 1VQSA 2GO8A 2ASDA 2DHAA 3G6XA 3H8YA 1R8AA 2UXDJ 1RAAB 4LRBA 2RS2A 5GAEU 4NOHA 1NJYA 1HR0J 2C2OB 1OIAA 1RU1A 3MM6A 4W4MA 3ZZOA 4F26A 1X7VA 2IC3B 2F4VJ 4XTTA 2YQ1A 2VKZG 2HFSA 3L09A 2M0GB 4URGA 2YTCA 2FC9A 4K4YA 2K3KA 1NH7A 1REVA 4ZHRB 4NLYA 4USIA 1FERA 3GFXA 5B7WA 2QT7A 5L9XA 1SQGA 1R43A 5GAHI 3PR4A 4EFAC 2F63A 4PRFA 4ANDA 5IQQA 2YKPA 3TX0A 2XBPA 3FNNA 4F4YA 4OLPA 2M2BA 1RZMA 2HS3A 3GR1A 3K57A 4NLWA 4LSLB 2GGPA 1VRUA 1TL3B 1VQPS 1QVGR 2DNYA 4N41A 3MPVA 1YZ6A 1H0HB 1FHTA 1VRQC 4DQQA 2PFFB 3PXGa 4USVA 4I7FB 4JI5F 1MMDA 5HK4A 5A0YB 4C3LA 3OR2A 3M2VB 2VD3A 1VQLS 5KFGA 3KK2B 2MY8A 4C11A 3M1VA 3M8PB 3Q83A 2DJWA 2F1FA 4AXJA 2MDAA 4YHHJ 3JSMA 4A8YA 2PI5A 2EW9A 3BSOA 1UP1A 4F0KA 4WK1A 1H6KX 5L38A 4WF9Q 4Y2MA 1BD6A 1K9MT 3D68A 1IM6A 3MM9A 2UVUA 1B0TA 4NCGB 1RT5A 3HJVA 3D1QA 1LWCB 3TUPA 1NUEA 2AGOA 3UD4P 2AEJA 1IXKA 2DD8S 2V2ZA 4ITSA 4BC7A 5A76A 3EZ5A 1CG2A 1K47A 3I6PA 1ACMB 2HGMA 4KRWA 2LLZA 3FVYA 4WE1B 4IRCA 4IRDA 4ES1A 4OX9J 7AT1B 3ELHA 2QA4G 4DR7F 4HT5A 5ETTA 1UVKA 1R31A 3DLLQ 5D0RA 3DRSB 2ZOGA 2N7YA 1LKZA 3T1YF 3KJFB 3BZQA 1HNVB 1N33F 2F65A 3NY0A 5KOWA 2QLXA 1FK9B 4NA1A 2U2FA 5J1EA 2ZBCA 2VG5B 1VBKA 3V4IB 5GMEA 2HHTA 1RXOB 3H4DA 1F2GA 3FBBA 4PQUA 4JYAJ 1MROB 3CDAA 5GAGI 3FQLA 3GG1A 4NYZA 4ECRA 1I51B 1FX4A 3TO8A 4ZKAA 1SXLA 3C8YA 2CJAA 3O5TB 4LSNA 4RNNA 4DV4J 3P96A 5L46A 3IR7B 1A7GE 2Z8QA 3HSJA 3G8QA 5HP1A 2XSJB 1HFEL 1YBUA 2AGPA 4RWXA 2O5DA 4DI6A 2IM1A 3UO0A 2ERRA 3K5NA 1YHQS 2IRYA 3QGPA 2YNFA 3W64A 3TANA 4NEZA 1TL1A 1YBAA 1NDLA 4K2JA 4RUHA 3NS7B 3O1LA 1EKSA 3FRYA 5DJBA 4DV5F 2LA4A 3HPOA 3FSIA 4FZVA 2ZH6A 4DN9A 4AL5A 1D8YA 5H1SV 1RKJA 4WIIA 3MM5A 1NNDA 4KGZB 4W92B 3ZZUA 3EGZA 2NREA 3AAWB 3HXMA 2CQ4A 3W3SA 2J9DE 3PACA 2CPHA 3MDFA 3TR5A 1U7LA
chains in the Genus database with same CATH topology
1ZPWX 2XS2A 5K9FA 2B9XA 5CZVA 1ZOTA 5KFUA 3KLIB 2XY6A 3JSBA 2AYEA 3DXBA 3CMAS 2RKIA 2K1RA 5HBMB 5K8MA 1HI0P 1RI7A 2CPZA 4AFFA 1U1LA 3AQOA 3DU5A 4OL8A 1VQOS 1QTMA 3OTEA 1NRKA 2DISA 2KT2A 4F2RA 4HI2A 4BWMA 2CZVC 3R3TA 2XS5A 3HKWA 4WXWA 4Y2CA 4HHJA 3Q23A 1DRZA 2PE8A 2Y1RI 1TVRA 1S1UA 4MFBB 4C0OC 2XMTA 2YH1A 1QM9A 4RW4A 4QPTA 4TQSA 5DDRC 2IRXA 2V4QA 2IMOA 1UJ6A 2ACYA 5E3CA 3CDBA 1RT1B 1T95A 3EX7B 2AJQA 5EHHA 3E3XA 4ALZA 2O3DA 5KFNA 3E01A 1MMLA 4NLXA 5KFBA 3MEGA 4FF4A 3CCZA 4RNOA 4ID5B 2I2YA 4I4BA 3IG1B 3I5CA 3N5FA 3L7PA 2VBYA 5LXRA 4A8SA 2NSCA 3BR8A 2OPRA 4ZA1A 4DSLA 4U6PA 3PFEA 2ADBA 2HHPA 3GV5B 2WTFA 1SL2A 1VRTA 2KM8C 4V19J 4OX9F 4CO4A 3PNIA 2HNDA 4AQYF 1CQMA 3IBWA 3G86A 4KJIA 1XBWA 2X1FA 2B9YA 4Y00A 2VKRA 3MOZA 3OL8A 1TV6A 2YX4A 5J2QA 1X9SA 2XY7A 3OVBA 2R7RA 5KFZA 2W24A 2UUWA 2BVZA 1NK9A 2NZ4A 2HRUA 5D4NA 1DTTA 3JB9k 2WONA 2LEPA 3O6QA 3TVZA 4ES2A 4LF4F 1YGYA 4IG0A 4OJ1A 3CCUS 1R8HA 2M8HA 5C42B 2VA2A 3N0VA 3FEXB 2ZBIA 5AXLA 3I5BA 4FN5A 1QUVA 2DNPA 4KFBA 4ED1A 1HBNA 1VMBA 3MM6B 3KG4A 5G4DA 5IT9Y 3CXCR 3CCTA 4Z2XA 1DFDA 1Q8BA 3BM7A 5C24B 1Y5IB 1KQKA 2VZ9A 3OLBA 1J5OB 4Q7AA 1RT3A 1HHTP 4ZP8A 3ENQA 3RAXA 2Q1LA 4YOEA 5JUMA 5KT2A 4BS2A 4ILRA 1HNZF 4LQ9A 4R8UB 2XLIA 2JLEA 2XCAA 2WOMA 2D9PA 3TRGA 2GX8A 3JAMY 2PN6A 1NK6A 3QJLA 3NMRA 3B4DA 4AE5A 1ZPVA 4G1IA 4I68A 1O5JA 2VB6A 4N76A 1VJWA 1FVSA 1REVB 2AD9A 4D3HA 1HYSA 3FSYA 4NZ0A 2VFTA 4G6VB 3RRKA 4Q0BB 5GADU 2FJEB 1TR0A 2DPIA 3LAMA 5KTQA 4LFBF 3GIKA 3N6NA 2RF2A 4QCLA 3PJWA 2XGPA 3VAHA 2RRAA 4JYAF 4LUBA 5FIIA 1G3OA 2GIQA 3N4WA 3LUYA 3Q2TC 2FJDB 1HQUA 2XWYA 2IBOA 3SFGA 2HNZA 3JYTA 3G9CA 4X4NA 3BQ1A 2CPEA 1HBOA 2V8DA 2YNIB 3CT9A 5CCMA 1K0TA 3RRGA 2DH9A 2HWIA 3MM8A 4BCAA 3GWCA 2NUHA 2RQMA 3MR3A 3M6WA 4CH0S 4O44A 3ZC4A 3BSCA 5A6PA 3OBIA 2J0SD 4X2BA 4OZNA 3PHEA 3T6JA 3LOUA 1S1WB 3CJ5A 2XULA 3V81A 1KOHA 2Q6BA 1JLBA 2R7TA 4RW9A 1IBKF 5FDLA 1U1MA 3T5HA 4KR0B 1JIHA 5J2MA 1VQYA 4DV4F 4B9MA 2R4FA 3VZIA 1DURA 2W8LA 2RDJA 3MMCB 2WB1D 5HMXA 2LQ5A 4LVOP 4ED7A 3GE9A 3J7ZT 1S0OA 1IKVA 1WEXA 3MAHA 4IG3B 4KBIA 3V4MA 2YWHA 2XSFA 3ZZYA 3H40A 1A6LA 5LL6d 2HMIA 4KIAA 3O2IA 5AE3A 4B9VA 1S7HA 4DQSA 4OHZA 1WEZA 5F9NA 1OO0B 3J80Y 4F4ZA 2G9OA 2GGPB 2J8AA 2MKIA 4KC5A 4TLRA 4F50A 4CTAA 1N32F 2KI2A 1QE1A 2B4PA 2EG1A 2KH9A 4JI7F 1VRUB 1E6YA 1YJTA 5KFOA 2M88A 4H4OB 4K4TA 2HW3A 5KT6A 2DITA 4ILMA 2FHKA 4X4OA 1KN6A 2YWKA 5DG7A 1SJ4P 3RZAA 1DAXA 4CO2A 1UVJA 2CQ3A 4O3RA 1M0SA 1FT8A 2W7OA 2DHGA 2ZOMA 3C6TA 1Q79A 3MUTP 1CC8A 2J0WA 3MM7B 1MU2B 3UE2A 3KKFA 5KFPA 4BDPA 2HS4A 2NR0A 4AXIA 3HVWA 4LQ3A 4WZMA 4ZP9A 3JTNA 4YB5A 1VQNS 1NKBA 1FE4A 2JOQA 5BYRA 5F3ZA 4F4WA 4ED8A 1M5SA 1VBYA 3HX9A 3U1MA 1YSJA 2V5HG 4N8NA 1BLUA 3BS9A 4C8YA 1S1TB 3OR2B 4JV1A 2V8GA 2BANB 1FRHA 2RU9A 1X9WA 5J2NB 2HIQA 4RW7B 1FEEA 2XB2D 3MPWA 1FA0A 4FVCA 1S9EB 4Y6IA 2KXHA 3HMJG 4C11B 3DRPB 4KT0C 2HRYA 3M1VB 1SBRA 2OIHA 5GAGU 2N7CA 4IR1A 4K5RA 2ZJQQ 1ZETA 3MF5A 4DFMA 5DO2A 1FXLA 2CVEA 4QBUA 2KTQA 4WU2A 2MZSA 3BO4A 3F41A 1JLCA 2V4RA 1M5VC 1NZAA 4ES3A 3DLBA 3OQ2A 7FDRA 1VBXA 4DQPA 1C1CA 3JSMB 1Q86T 4NLDA 3M8QB 1HBUB 3H20A 3QIPA 3G6ES 3N79A 2G4BA 1CSJA 1TKXA 2ZE2A 3MGJA 3QAUA 3MUVP 1S9FA 4KO0B 2KJVA 2R7XA 2V4JB 4F8RA 2MHEA 2W7AA 3KLHB 3RBEA 2J9CA 4EGLA 5L9NA 2LDYA 3UPFA 6FDRA 3KHHA 1OQ3A 2CIMA 5DQHA 1SH3A 5EWEA 2QMWA 3LP2B 2DO0A 2R7UA 4DSKA 1FXRA 1GQEA 2FGCA 4R0JA 3CJ4A 3MM9B 2B43A 5IM0B 1S97A 5BYQA 2WHOA 3VAFA 4DG1B 3MTKA 2KM8B 3QGIA 3J81Y 2CQ0A 3NS6A 3I0RA 1RT5B 1FESA 1RTDB 4Q45A 1UEUA 4K4UA 3NMAA 1Q8IA 2BE2A 2DNOA 2V2KA 5KFHA 3IXQA 1P27B 2W8KA 4HTIA 5B0BA 3BN4A 2OPQA 1NHUA 2GQQA 1UEVA 1YWXA 4QWAA 4ECTA 4XAKA 5F3TA 5CYQB 3R5AA 3T3FA 1ZM2A 4H4KC 1AXQA 2CJ9A 2RVJA 1N5TA 4DX8H 4X4RA 3FDSA 3AY0A 3G6VA 3SV4A 2QYCA 2VFSA 4FXVA 3TP2A 4LVNP 2F3JA 3MMAA 3F44A 4DV2F 1P6TA 4HDHA 1HWLA 4DSEA 2KHDA 3EPIA 5KOXA 2W4PA 4EWTA 2X1AA 1K0VA 5CYMB 3W2VA 3GIJA 4DUYF 2DNQA 4H54A 3CDUA 2RU3A 1FDNA 2E5IA 2FD2A 1X5SA 4DSIA 4J9MA 1M5HA 1TAQA 3TA2A 4DWIA 3PEHA 5M2UA 3PIPQ 4ETXA 3WC2A 3MD1A 4F3QA 3ETOA 2BDPA 4I6WA 3T9ZA 3UCGA 2O01C 3AJ1A 3HO1A 5GMKa 1YJWS 3AB4B 4R5PB 2D1CA 1F5CA 1Y3KA 5EUHA 3NRBA 3M9OB 5DGAA 2E44A 4OIXA 5C25B 2DH8A 2X1BA 3TVKA 2DGVA 3CD7A 4ZPDA 4A8MP 3IS9B 1SKSA 3LF0A 1RTHA 2CJBA 4DQIA 2DNMA 1MW7A 3V5RA 4MKAA 2GJIA 5CYJA 4M5DB 4GC6A 4URSA 1KHVA 1JKHA 1WI6A 3U27A 2R7VA 4RU9A 5M2RA 3I32A 3K5LA 3FFIB 3C46A 3H5YA 1N88A 5HQ8A 1S1VA 3CIMA 1S6OA 3CC4S 3VR1A 1EP4B 1Z2LA 3D0HE 3D0IE 4E98A 3W2WB 4UQGA 3V6JA 1L3TA 1H2TZ 2HWTA 2QV6A 2ZD1B 2GNKA 2MKSA 2EK1A 1QLNA 3IRWP 4IR9A 4WYWA 2E5HA 3PX6A 3NWGA 1PC4A 1FNMA 2HNYA 4RNMA 2HVZA 4RW6A 2RRBA 3HHDA 1FXDA 1V3ZA 4QR2A 3UCZP 4TYBA 5ADZA 1FD2A 1VBZA 3OFFA 2PEHA 4X64F 4I2QA 4RNHA 1B0PA 2DPJA 2ZH4A 1IKXB 2YKQA 4OI1A 2LU1A 2ZH7A 2CDQA 3MHYA 4MTPA 5J1NA 3BDEA 4A8XA 4MKYA 4Y2KA 3CCVS 2FJWA 2QA1A 4IH7A 2E7WA 2Q3PA 3FCHA 1VFJA 2ZNZA 2HVHA 2ZJPQ 5J1EB 1RDRA 2CVIA 1RT2A 1UKUA 2RNEA 4TXSA 4CI0B 4D3GA 3C2PA 4O4GA 3NBPB 1IUJA 4DL6A 4DS5A 3R5BA 1U1RA 1QAJA 2ZH8A 3KLEA 5H9EJ 4HL9A 3KLGB 1KC8T 2M8DB 2CQGA 3CJ3A 4C8NA 1WHYA 4FF2A 5T14A 3EGNA 1O51A 2EBEA 2L3MA 1SC6A 4IDKA 1WG4A 1HWJA 5LSOA 4PQUB 5HLFB 2IM2A 2HFOA 4WFXA 4ETZA 3OSPA 1FEHA 2R2TA 1DZ5A 2ZH5A 1PO6A 4I0WA 1VQ4S 3FMWA 1KVIA 2C42A 3MEEA 4X4PA 4R0EA 1L5UA 2LQJA 1VIXA 1LV5A 1MMNA 2ZOFA 4QW9A 5I3UB 5LXYA 5DQGA 4ED0A 4EU0A 2FPHX 3CIZA 1TKZB 4BHQA 2JVOA 2ABYA 3LP0A 2BUNA 3M6UA 3CDEA 4KKOA 4F25A 1H3DA 2IA6A 4LSNB 4M1KA 1T7PA 4QYRA 4N56A 2DRBA 1YIJS 2DR9A 2UXBF 1FRMA 3E51A 2EFVA 2GQCA 3M2UA 1M90T 4PXEA 5AXNA 4UUWA 1HR0F 2J7UA 3M9MB 4ELUA 1WF2A 1T3NA 1U48A 2I9SA 6FD1A 5HP1B 3RRHA 4HH1A 1LQ9A 3C66A 4TLQA 2DBBA 4F4KA 3HVRA 4XPCA 5KG3A 3C6UB 2YVSA 2MQPA 2Y0SD 2E1CA 1QVFR 1RTIB 3DCAA 4EYHB 1GTEA 4K5SA 2LDIA 2E7XA 3LPYA 2M5YA 2OPSA 4I69A 2OAUA 3JTPA 1U1PA 3BQ0A 2XS7A 3ITHA 5EWFA 1LFPA 2AU0A 1TUVA 4LMZA 5KT7A 2EC0A 2GCFA 2MQQA 4RLEA 2VV5A 3CC7S 3D1OA 2JEIA 2YNFB 1ZM3A 5GVQA 1IKWB 2ZFHA 3U7JA 4MIAA 2F40A 2BBEA 1TL1B 2HGNA 1XN9A 1AFJA 2AJ0A 5IZHA 2DIVA 3DLGA 4ZVGA 3DM2A 4KB7A 4NLUA 1C1BA 4O0IA 3LGNA 3KHLA 2AX1A 3UI3A 4URQU 1LWFA 2MKJA 2R9LA 2WSFC 1BQNA 2L9NA 2UP1A 2P6TA 2PMZD 5D6GA 5KFFA 4B9NA 4IFYA 2BR0A 3POTB 3LP1B 3IR6B 3WBZA 3SYZA 4TU9A 1FRXA 4AL6A 1YTYA 2DR8A 2HZCA 1NJXA 3NCPA 2AP6A 5AE1A 1SJRA 1SV5A 3B82A 1NK0A 3LAKA 4G1QA 4QR1A 2C2DA 1DTQA 4EBDA 3MM5B 3QAEA 4QYZJ 4IYQA 1S72S 1ZYQA 2KZMA 2R2UA 1N6QA 2E1AA 1P9QC 3MR6A 4J9LA 3PW0A 1RTJA 2FJAB 3CTRA 4RBTA 2PT0A 4B3MF 2XLKA 2KFZA 4JI3F 1HL6A 1MSWD 1S6UA 3EYZA 2ZKUA 1MNEA 3SEOA 1D8ZA 1N5VA 4JV5F 3OSNA 1VI7A 2IAJA 2Z4PA 3M30A 2GA7A 5A8KA 2HHXA 3FQKA 1QY7A 1C0TA 2NYIA 3I87A 1HD1A 2C22A 1G7CB 4EZ9A 3J7A1 3O3LA 5BJRA 4QWDA 2CQPA 4WE1A 2X3GA 4MIBA 5E41A 1NK5A 1VC6A 1KSPA 4H4MA 2PDAA 3OXGA 5DG9A 2OP5A 2YWFA 3I4HX 2RKIB 2K1RB 4ZPAA 3R1LA 1U1QA 5KFMA 1C2PA 2XI2A 1C4CA 3Q24A 3NAHA 3RAQA 2YKOA 1HNXF 4GO7X 2AYBA 4CCHA 3QGGA 2HGLA 3KK3A 2C28A 1KFDA 2X51A 2IM3A 2QSFA 4PWDA 4YY3F 3BF4A 4OHYA 1TVRB 1S1UB 5AXKA 3QZ7A 4CH1A 4RW4B 3NNAA 3DOMA 4OJGA 1IQTA 2ASLA 3CB4A 4YQWA 4C8MA 2DO4A 3ENWA 5D8HB 5G0RB 4KPYA 3DLEA 3E01B 3H25A 1HI8A 3ICLA 1FKPA 4M8LA 3MEGB 3OR1A 3EPGA 4UY85 3OL7A 3V2UC 4ILLA 2PA8D 3PW7A 3AB2B 4X62F 4QW8A 5JVGQ 3GV8B 3RTVA 1LW2A 1P8GA 1N56A 2CPJA 2BJEA 2OPRB 3SSQA 3BGRA 1PILA 1JXEA 3QO9A 1HW8A 3BREA 1P1TA 2L41A 4MK7A 1VRTB 4DLGA 2HNDB 2K3IA 2O67A 2LQ9A 1X5OA 4XDDA 1JXLA 1X5TA 3CE8A 1WTFA 1U47A 3PDNA 5LSLA 4X4SA 2RE1A 4YHHF 4B3RF 5KFIA 1LWEA 2KFNA 4MIWA 4AL7A 1TV6B 3TAMA 5J2QB 2KB2A 2PIIA 2HYIB 4RKUC 2HHHF 1E6VA 4DV1F 1L3UA 3MPYA 2W4DA 2MZ1A 4XIUA 1UVNA 1CVJA 3BGFA 1DTTB 3BDPA 2WONB 3M8SA 3SXLA 3LH2S 4X66F 3B8HA 4DR5F 3VAIA 1T94A 1UW4A 4IG0B 4F2SA 2COLA 4EBEA 1IKYA 3MI7X 1Y00A 1Z1ZA 3J7YI 2JJ4D 2DNHA 2CFXA 1B0VA 1UVMA 2B3TB 1KLMA 5KG6A 3KHRA 2CQIA 2EWHA 2AV5A 4KFBB 1DQAA 1HBNB 5F8HA 1X4FA 3TUZC 2HPUA 4WXOA 4NLGA 1BQMA 4NA3A 5LMUF 2L08A 2AF6A 1UA0A 1FE0A 4ZPTR 1S6QA 1JLQA 2JL9A 3UW1A 2O1PA 1RT3B 2JVRA 4TNOA 4KAIA 4Y65A 3N6LA 2C3MA 4G1PA 1ROFA 5KG4A 2VFUA 5KG5A 2HHQA 3MEDA 3JTOA 1OS5A 3OL9A 3I56S 1AW0A 3M05A 4ZMMA 1Q7LB 2XMJA 3SDEA 2YNGA 2ZC3A 3S7RA 2A18A 3M2RA 4UUXA 1DQ9A 1L3VA 2WOMB 4I64A 1X5PA 3IWLA 2JLGA 1GX5A 1JJ4A 3LWLA 3P3DA 3DRYA 1KEKA 5CZXA 1VQKS 1HYSB 4O4RA 4U7CA 4ZK7M 2W9BA 3UWTA 4DR1F 3V6KA 2KRBA 1F5BA 2VBZA 5A8RA 1C0UA 3TARA 2RF2B 3MTJA 3TAQA 3D1HA 5HN0A 2GQ2A