4QR2A

Crystal structure of streptococcus pyogenes cas2 at ph 7.5
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
83
structure length
83
Chain Sequence
b'MMVLVTYDVNTETPAGRKRLRHVAKLCVDYGQRVQNSVFECSVTPAEFVDIKHRLTQIIDEKTDSIRFYLLGKNWQRRVETLG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CRISPR-associated endoribonuclease Cas2
publication title Structural and functional characterization of Streptococcus pyogenes Cas2 protein under different pH conditions
pubmed doi rcsb
source organism Streptococcus pyogenes serotype m1
molecule tags Hydrolase
total genus 24
structure length 83
sequence length 83
chains with identical sequence B
ec nomenclature ec 3.1.-.-:
pdb deposition date 2014-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09827 CRISPR_Cas2 CRISPR associated protein Cas2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.240 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4qr2A00
3E3XA 4ES1A 4QR0A 1KTVA 2I0XA 2E1RA 2BM0A 3ZZUA 1ZM4A 1ZM3A 4FN5A 4TNOA 2L9NA 4MYTA 1N0VC 4ZCMA 3B8HA 2BV3A 2WBMA 1N0UA 3UI3A 3ZZTA 1ZM9A 2ZITA 2EFGA 4MAKA 3EXCX 4QR1A 2I8EA 2CVEA 4MYUA 2KDOA 4ES3A 1T95A 1P9QC 3B78A 3LH2S 2IVYA 1DARA 1VI7A 4QR2A 1ZM2A 1U2RA 4ZCKA 3OQ2A 1ZPWX 2XEXA 1ELOA 2BM1A 4M1KA 4ZCLA 2NPFA 4ES2A 3B82A 1FNMA 4ZCIA 5G4DA 3ZZ0A 2J7KA
chains in the Genus database with same CATH superfamily
4PG5A 1CLFA 5M2RA 5KFQA 3GYXB 1JMTA 2DITA 4IDKA 2RD5C 3MUMP 3J7YU 1UA0A 1XK8A 4HH1A 3OTDA 1K0VA 5K8NA 5HMZA 2QMUB 4WFZA 3VAKA 5DQGA 5IC6B 4AFFA 4FVCA 1TUVA 3HSZA 3TWZA 3N9UC 3ZNJ1 1VJQA 4WE1A 2UVUA 1FKOA 2E66A 1LEOA 4J9MA 2PA8D 5F8IA 2AJ0A 2KL8A 2HBYB 4C0BA 4EO6A 4HHJA 4DG1B 1GMWA 2QC3A 3OTEA 2J9EA 2B51A 4IG0A 2KM8B 3IWXA 3MTKA 1EARA 2JWNA 3NAHA 3MEDB 3H98A 1JLAB 1MWQA 1UFLA 4DUZF 1U02A 5CD4A 1SIZA 5AE2A 3M2UB 3ITHA 1PKUA 3PEHA 2P8IA 3J80Y 2JEJA 3B6BA 4NXNF 1X60A 2HLUA 4IO1A 4K4TA 2W4PA 4DV0F 4A4JA 1YJTA 3AA9A 2ACYA 3MF5A 5GMKa 1RT2B 4YEAA 4CM2A 4ZPVR 1U25A 2QL9B 3KJVB 1PILA 2F7VA 2VICA 2HK2A 3LPYA 1RBAA 1HNZJ 2LQ5A 5KG5A 1NPKA 2F63A 2CJXB 2DR5A 4KE5A 4WYLA 3PX0A 3KYLA 4B3SJ 5ETRA 4OL8A 2K3IA 4KR0B 4DV2J 1Q82T 5ADZA 3KLIB 4DQPA 1V3RA 4A46A 1TUGB 1SV5B 1VISA 1S1XB 5DZ7A 5H9EJ 1U8WA 4G3IA 1SKWA 2VODA 1T3NA 3TNVA 2CPJA 1L3KA 2HZVA 5T7LB 3C6UB 3MM8A 4GKJJ 1FK9A 2NZCA 3LP2B 4OX8A 2VH7A 4K4WA 2YXLA 1T7PA 1EX8A 4KFBA 1JXLA 2Q79A 2L08A 5LSLA 1JXEA 2LU2A 5A8WB 2MJUA 3SQOP 3VVTA 2HIQA 2YPYA 4USTA 5J2NA 4CT9A 3PRVA 2X1AA 4NLYA 3HD1A 1HNIA 1U7LA 3AXKA 1R27B 4CNZA 2HFSA 2OIHA 4DSLA 5L1IA 1CSJA 1JX4A 1NAQA 1QY7A 3HVRA 3MM5A 3PKMA 5H9EK 4FF1A 2IVYA 3TUZC 4M5DB 2CADA 1AFIA 5A0YB 2K1RA 3GV7B 2DGTA 2XWYA 3IS9B 2QGFB 1QTMA 1RHJB 2WRMA 3MI7X 4IO9Q 2Z8QA 3TANA 2V9WA 3DRPA 4IR1A 1DLOB 3OR1A 4ALZA 2YNFB 3FKBA 4LF9F 3LA0A 2RF2A 1IUJA 4ZPDA 2MY7A 7FDRA 2GIQA 1RAEB 3UCUP 1MW7A 3L09A 1M0SA 4RW7B 1R8PA 1S1TB 2P9GA 3KLEB 5E5NA 3MEGA 3GE9A 3AQPA 1VRQC 5D4OA 3IWLA 3MCOA 2QE5A 2HZCA 4URQU 1B99A 2IYGA 4H4MA 3Q24A 4RJVA 5GMEA 4XAKA 2YWFA 4IH5A 3M9MB 1TFWA 1NMEB 1W2IA 1MROB 3Q86A 3NOCA 4IRKA 4M5HA 2BOAA 2WK4A 2MKKA 3HP6A 1N36F 2E5GA 2AX0A 2RJZA 3DOKA 4ILMA 4PCQA 3JAMU 3ENAA 4J37A 1WTFA 5KG3A 3CPWR 2C1EB 1Q81T 3FK4A 2GMHA 1WC1A 1T03B 2O5DA 3VTIA 3NBPA 2W8LA 3CNQP 3T5HA 1B7FA 5B0BA 2JDJA 5HL7Q 3BN4A 5LXYA 2R9LA 1VBZA 4X4SA 2ZC4A 2UUTA 4R5PB 2W2PP 3NGDA 5E41A 4I2QB 3PJXA 4NLXA 5KFFA 4F0HA 1RAGB 2V4RA 1HI0P 1R7IA 2QO3A 4CI0B 1T3OA 1RZMA 2OPRB 2IA6A 2Y1JA 1M5VC 1RT4B 1VC5A 2C3PA 2RQCA 2DYAA 1M1GA 1PYTA 2CPEA 3ETOA 4DR5F 2DEJA 2B4OA 1CS4A 2BJDA 4KYZA 4UUWA 2MKYA 4JI7J 1I5OB 4DLEA 2E5IA 4WZMA 1W26A 4KHPF 4DX5A 3OJUA 2HGMA 4AL5A 4G1QA 8RUCA 4KPYA 4IOAQ 3UD4P 1IWGA 5KFBA 2V5HG 3TARA 3VAMA 1HW9A 2FC9A 1APSA 4IRCA 2MQOA 4QBUA 3SZ2A 4DI6A 3PFEA 3N6MA 4N8NA 5A8RB 3Q8PB 2XY5A 2X1BA 2BQRA 4EO8A 5F3TA 3P6YC 4DSIA 2CVIA 4RW9B 1KOOA 4DL0C 3WQPA 3C14A 1N5TA 3JAMY 4IOCQ 1ULRA 4O3QA 4YDDB 1SUQA 1VQ6S 4ILRA 2HNZA 3GFZA 2WBRA 3OL8A 3X3UA 4USHA 5IC4B 5B0EA 1LW2A 3C16B 4H4OB 4K0KF 1FJ7A 2E1CA 2KTQA 4KH0B 2IAJA 4ED1A 3RAMA 1BMQB 2UXCF 1TTHB 3NNCA 5IQQA 2E7VA 3H5YA 2CZ4A 5HJXA 4EFAC 1UW4A 2BJ9A 1X31C 1RWVB 3LAKA 3PRDA 1HR0F 1WHWA 3MMBA 4KO0A 4ZLNA 3HULA 4ID5A 1JJHA 4DQIA 3QJJA 1ZM9A 1RAFB 4HR2A 5KFNA 3IXQA 1WNEA 4XIUA 3M30B 4Y28C 3HHKA 1LWEB 4KGVB 1U0HB 3GIIA 4YB7A 2XNQA 5IS2A 4IDKB 1VBXA 4RNFA 5LL6d 1Q0NA 5IM0A 2OD4A 4X66J 1XWLA 1T02A 2XULA 1AUSL 1IQZA 1SKSA 4B9MA 2DRBA 1P9YA 4O4RA 4WE1B 5CQGA 4B9LA 1FKOB 4RWWA 2UU9F 4Q5VA 2RKIB 2I1RA 2VB6A 3KNAA 1HWIA 1UTAA 1U48A 2HK3A 4BHQA 4JI6F 3ZNUA 4QU6A 4X4QA 5LMUF 3DKDA 2BACA 2AJ2A 1RT5A 5HVHA 2DT9A 1S9GA 3LGMA 3ITHB 3HVWA 3C15A 1FKAF 2BZ2A 4M8LA 4ZVPB 4Q8EA 3ENQA 2IDEA 1J5EF 1VBKA 2WOMA 5CZXA 2ZH8A 4WFAQ 5D77A 5AE3A 3JQJA 3N28A 2FJDB 1P6TA 5LOQA 1O5JA 1QSLA 4NI2A 2W7PA 5L39A 1VQ9S 2CPYA 5B0AA 1DRZA 1K73T 2ZJPQ 4O3SA 2HRTA 2RE1A 4DUYF 4LT6A 4NMXA 4PPZA 1GXTA 3FEZA 2KRRA 2HVDA 1HWUA 3DHXA 1TU0B 3T9NA 3TX8A 2EG2A 1JKHB 1SJRA 2Q6CA 1FEHA 1FA0A 2JC0A 3NWGA 1QAIA 3SV4A 4DR6J 5L8RC 2ZH2A 1NJXA 2OMOA 3DNCA 4OIXA 3TZZA 3DU5A 4DBQA 1D8YA 1WWHA 4OX7A 2ZBQA 1U1MA 4WFYA 1RT3A 4GKKJ 2EG1A 1RWUA 2W24A 4JI1J 2A18A 2VZ9A 1CJVA 4ZKAA 1EIYB 2ADCA 2GX8A 1GTHA 5KFEA 1A6LA 3MM8B 4M5LA 1FK9B 2VUGA 1UMJA 5AE1A 3EYZA 3W66A 1BQMB 1FXLA 3EXYA 1N0VC 3HHDA 4KFBB 4AL7A 2JVRA 2XGPA 4N41A 2HMIA 5ETKA 1H3DA 5E33A 3H8YA 3B4DA 5LXRA 5GAEI 4OJ1A 3AB2B 2C42A 2OKQA 3JYTA 2V6AA 4HI1A 4DN9A 2BQUA 3N0VA 4DV1F 3F56A 3OHBA 5B09A 3BQ1A 1HNIB 1Z2LA 2VBWA 1M5PC 2KHCA 1RWOB 3BEGB 4M94A 3MR6A 5M2PA 4LBHA 2ZHBA 2JEGA 2AJ4A 4EBCA 1HBUA 1SJQA 2G1DA 5D0GA 2CQHA 1IR1A 2K1RB 2RMLA 2FLOA 2ZM6J 3LWMA 4ANEA 3KLHA 3DDNA 4DSEA 4FXDA 5EX3A 3UDEA 3Q8SB 2W9CB 1FXRA 2Z2YB 2RF2B 2YH0A 3VAGA 2XYPB 1OWXA 5BYSA 3E01A 4C2MA 4ED2A 5E3PA 3NL0A 4GVLA 1D8ZA 2OPPB 3GG1A 2A2DA 3M2RA 2DIUA 1X4HA 1Q86T 2DNKA 1Z4UA 2MKJA 1I94J 2SXLA 4MKVA 2HNDB 2FTRA 2B0GA 1NJWA 3AHPA 4B17A 4MYUA 3N4WA 2BE2A 4YB5A 1VOMA 3CEDA 4PQAA 4BC9A 1JLEB 4LF4J 3NS6A 2OD6A 3DOKB 2BBEA 1DHMA 2V2KA 2J0QD 1FI4A 2H5EA 3VGTA 1SQGA 1VQ7S 3LP0A 3ILIA 4C8OA 3K7RA 5KFSA 3MMCA 3NBPB 2IM0A 3ZZRA 2DNZA 2XBPA 1FVSA 4C0OC 2VFTA 2DCUB 1LFPA 4UOCA 1UVMA 2PFDA 3OLBA 2RRAA 3DRYA 1U49A 4UY85 1H73A 2KT5A 4EWTA 2HHPA 1PBAA 3IC1A 1JXVA 2FHOB 4C8ZA 1EQMA 3CCTA 3G8QA 3JS9A 1DTQB 3KOAA 4FPIA 2HHQA 1URRA 4CT8A 1F2HA 2YKMA 3I0RA 2QG9B 1SJ1A 3W9JA 1CG2A 4PXEA 1QDUB 2MHNA 2FB0A 4RX6A 1Q4RA 1BWEA 3G2XA 4X84A 3LW5C 5HI7A 4ZJLA 1U2RA 3MAQA 2DNMA 4C6AA 1C1BA 2J9CA 2HHHJ 1XMOJ 1CS4B 4DFKA 1NK8A 3JSMA 2ZITA 3CIMA 1ZAWA 1LQ9A 5T41A 2RB7A 4N56A 4OI4A 3KXDA 5F8MA 3QBCA 4G1QB 4P2SA 3W3SA 4W4MA 2KJVA 1WOOA 5D4NA 2WSFC 3QWUA 3T1YF 1Y4ZB 4ED6A 2R8IA 2MKIA 3UCZP 3W1YC 1C0UA 4ZCIA 4KIAA 2OO4A 4RR5A 1HNVA 2Y8YA 3NKYA 3HF5A 1KQFB 5DLGA 1JNZB 2D3UA 2M5YA 3PZPA 5IV3A 3IRWP 2PD1A 1KNZA 2ZBPA 3GR1A 2R7UA 1ITPA 4QOTA 3R27A 4FP9A 3SYZA 5A6WA 1K47A 1XQIA 4PQUA 3NXZA 3EVOA 3O6QA 1SUQB 1RHKB 4F36A 2HNZB 1VRTA 4H54A 1YJ7A 4Y34A 3FCWA 2M7SA 4Z7CA 1UVLA 3W7BA 1LW2B 4TNOA 3O2IA 4CLZA 5KTQA 3HXMA 4IG3A 2IAJB 2NXUA 1EHWA 2V8GA 3CO9A 3HFVA 5MAOA 2DNPA 3CJQA 1AT1B 2BXJA 3H5UA 3CB4A 4EYIB 2COLA 4ELUA 4QYZK 1VQ5S 2M4MA 1SKUB 2DCLA 3MMBB 4KO0B 7AT1B 2DGWA 3BJYA 4ID5B 4J9VA 4DV6J 1RHUB 3G87A 4AD6A 2DO4A 2VA3A 2VFSA 4KQZA 1RAOA 2WAQD 1PJ6A 1WF1A 3L95X 2XM3A 3QIPB 4OLOA 2EK6A 3THVA 4KC5A 3BBBA 3D66A 4J9QA 2BMBA 3UDLA 3UWTA 1LWCA 4IUFA 3CDUA 4QIEA 5IM0B 2Q6BA 2YWEA 2VBYA 4I64A 1ZBTA 4JI0J 1NJZA 5CYMA 4JI3F 2NLWA 4OJGA 4C7QA 3K59A 2DNQA 2Q66A 1HQEA 4ICLA 1WSVA 5DM6Q 1VJWA 4LRAA 3HSJA 3RJMB 3EGWB 1S6OA 3CC2S 1RWKB 1S76D 1S0NA 2KXHA 3KK2A 3G96A 2J7UA 4LF8F 1WHVA 1V6HA 3HKZD 3QJLA 1TKZA 4X4OA 1RT5B 1TKDA 5HLFA 2BA9A 2QMWA 5KFAA 5KFDA 2CZ9A 1HBOA 2EVZA 3M8WA 3ISND 2ZHAA 2GNKA 4TLQA 2NSBA 4QIWD 5DDRC 1JLCA 4C3MA 4EK2A 1CJUA 1SQFA 5KG1A 1GX6A 2P9EA 4NYZA 5KFXA 2C2OB 2CQGA 2WOMB 3NOGA 2Z2MA 2OAUA 3Q89A 3X1LB 3DRSA 4NI2B 1HA1A 5GAEU 2CZVC 2FVCA 2W7OA 1C0TA 4NLDA 2C2NA 1L3UA 3RRGA 1REVA 4DZDA 1FJGF 1CC8A 4N5SA 4TLRA 4DR1J 1FE0A 3ULHA 3S1TA 1U2CA 1Z1ZA 2R8JA 2LFVA 4ECVA 1QLNA 4Y6IA 2E9ZA 1KR4A 1U0HA 2GAHC 4Y65A 2ZE2B 5FJ4A 2WTFA 1RAJA 4CNYA 4U7UD 3SI8A 5KFTA 2JSXA 1NH7A 1RADB 1UKUA 1RT3B 2HHWA 1TV6B 2BEFA 4FYXB 3QT7A 3G6ES 4JI8F 1CJVB 4OX9J 4A8FA 3ILLA 2JLGA 3G82A 3DU6A 3OT9A 2R2TA 3HVTA 4K2XA 1KFSA 2QX0A 3S6EA 3MMJA 1FRHA 3MR2A 3HHEA 4WYWA 3PYEA 3A3PB 3UQSA 2HMIB 5HANA 3VALA 1F6TA 2G1HA 5H1SV 4O4GA 3UFCX 2YKOA 1Z2ZA 4YFUA 4M5GA 1N56A 2BKNA 4DV4J 1YJUA 4WKRA 3JYTB 2Z58B 1UW9A 2WBMA 3KLFB 2YKAA 1TR0A 2EXUA 2XMJA 1UVIA 1O6XA 3T19A 3QRQA 2ZBIA 2HBQB 2DNHA 4LREA 3QGPA 3M8PA 1RSCA 4ELTA 4PXCA 2UXDJ 3D1QA 5EWEA 1XNRJ 2AGOA 3TVZA 4DX7A 1FD8A 4DV5J 2HWIA 3DFEA 1FESA 1HBUB 2M70A 1EETA 3EPGA 3IBCB 5E7OB 2YQ0A 2KRBA 4YMEA 4MFBA 4YY3J 3M9OB 5G4DA 1U6ZA 3CDAA 2KFZA 3EX7B 2MPUA 2M3DA 1SBRA 3M6XA 4QU7A 1IBCB 2ROPA 2Y1RI 3D6TB 3HK2A 1KFDA 2FZKB 1F1BB 4K5SA 4C9DA 1TL7A 2NUHA 3PJWA 3BO2A 1E6YA 3HJVA 1S57A 2IMOA 1HNWJ 1S72S 4NZ0A 2CPFA 5J1EA 1NCLA 2X1GA 2ZNYA 2HGLA 4ITSA 2RQ4A 5C42A 2XYGB 2W4CA 2B9YA 2WVDA 1WORA 3R1LA 5HJYA 1YGYA 3EMTA 2EFPA 3IN5A 3KUGA 2F4VF 2H54B 3TVKA 3RW6A 2HSEB 3M2RB 3CVKA 2AYBA 4QR2A 2ROGA 3GPAA 1NK0A 2V8DA 1L3TA 1JQGA 3ZXWA 4I0WA 2B7CB 5M2UA 1WEZA 4J9UE 1AZSA 2QEXS 2BE2B 2CPDA 1RISA 2WB4A 4XPCA 4ER8A 5L1LA 1X8DA 1MNEA 4K50A 1WKLA 1ZOTA 4LUBA 3MXHP 2MLZA 1RHMB 3AA8A 3UI3A 4DHVA 2OPSA 1NZ8A 1REGX 4NLUA 1CBKA 3A12A 2UV8A 4I67A 2YNHB 1Y5NB 2AMCB 2R7SA 1I1GA 2LEPA 1FDAA 1X5TA 4B9SA 3PM9A 4ZPAA 4Y2AA 3VGUA 4DDFA 1NJYA 4I2PA 2Y1IA 3UO0A 2FY8A 1MMDA 4QR0A 3QT6A 4DPWA 2Y3YA 2DH9A 4UY8T 2I2YA 4PWDA 3BSNA 2ZFHA 5KG4A 2J6SA 2YKMB 3WC2A 2HQIA 3I0RB 1VK3A 5GADI 1YWXA 4ZVOB 1ZH5A 1RU1A 2XS7A 4UTGA 2F3JA 2Y9HA 4OYOA 2IHR1 4X4PA 3BKUA 3JTNA 1HNZF 2G4BA 3FMBA 3IAS9 5BR8J 3MM9A 2ZUGA 2XLIA 1K44A 3ENVA 4B3SF 2B9XA 2AF6A 2G0IA 4TQSA 3B8HA 4DV2F 3JSMB 2RVJA 1CEZA 3QIDA 1DQ9A 3MUVP 1RT6A 3HM9A 1Y10A 1QM9A 4JI2F 1GAOA 4ZVUB 3HLUA 2CKWA 4B3OA 2VG7B 1FDNA 4GVBA 2VIHA 3MGJA 2UVWA 4HDGA 3K57A 4DL2A 2X7IA 3A13A 1HYSA 2R8HA 2KG1A 4LIRA 1C0UB 2FJWA 4GKJF 4TU7A 4JB8B 3D6MB 2POKA 1B4SA 4E8UA 4Q43A 4EMDA 3MMAB 3HFZB 4YDXA 1NZAA 2DGXA 3IGVA 2JLEA 2QA2A 4J9SA 2V8PA 4HYKA 4DOZA 2QA4G 3IBWA 4F3OA 4PQUB 3IWNC 2CNOB 3DHWC 1T95A 1R43A 5C2CA 3JQKA 1VRTB 1F0XA 2CNKB 4CH7A 3HX9A 1OYEA 2ZD1A 1RHRB 3GSIA 3BN7A 1YJ9S 3EE3A 2BR0A 3VVUA 2N3OA 1Q1KA 3KMSA 4ZVHA 1D9DA 3OL7A 5J1PA 3D0IE 3H4DA 4OI3A 1T94A 2YKNA 5KT2A 3BB5A 1U2FA 3NS7B 5BYQA 1KQGB 3HI9A 2Y1LB 2QSWA 1NUEA 4HL9A 4GMKA 5U47A 1RBLA 1TMJA 3M8YA 1X4EA 1KHVA 2XB2D 2IC3B 4J90A 2ADBA 5ETQA 4KHRA 4FF2A 2PIIA 1LWCB 2B5JA 5IT9U 3LUYA 1MMLA 2E9TA 5CYMB 5DZ6A 4RU2A 4U95A 2YNIA 4UT4A 4FXWA 2N3LA 3KJQB 3PYGA 3T3FA 1HQEB 4H4KA 2MZRA 1BWVA 4CYUA 4UZBA 1NBEB 1R8CA 1F9FA 3N6NA 4NLSA 2NXCA 4I69A 2H48B 1WSRA 1PBUA 1RI7A 4TY9A 2FVSA 4WFNQ 1KBRA 1TKZB 3CC4S 5HQ8A 1XJWB 2WVBA 2R3VA 1YQHA 3R7SB 1HBOB 3MM7A 2XSFA 1N5VA 5G0RB 1JLCB 2RDDA 4QPXA 1LK5A 4LF2A 3AODA 1G1XA 3JTOA 4NMLA 3GZ7A 1PCAA 1NM2A 2D41A 5LMNJ 1WF0A 4PWUA 2H5JB 3G71S 2PSZA 2Z0GA 3DRSB 3H0PA 1M5KC 1KQSR 1ZTWA 3BBCA 2HFNA 4TU8A 1C0TB 1QUPA 1PO6A 1SCJB 3KDNA 3CMQA 4URGA 4DR4F 2VJUA 3RTVA 1REVB 3SEOA 3KHLA 2O3DA 5CCMA 1BUXA 2EI5A 3H7HB 3OXLA 3HSDA 2VL1A 2JFDA 6AT1B 2ROEA 1NLKL 4QQBA 5D6GA 4TYBA 2GQ2A 3U1MA 1OY8A 5IT0A 3UR3C 3BDPA 1NSQA 4F4ZA 4OZJA 1WF2A 4MT1A 1MN9A 4WBFA 3SXLA 2N7CA 1FRXA 5KFOA 4EEYA 2BUNA 1KTVA 2Z2ZA 4HT5A 4ZMMA 4GC7A 1R0AA 1S4FA 2CQCA 3HHLA 2R2RA 3G82B 3HZGA 4ZIVA 2I38A 3LH2S 5IT9Y 3CCSS 3HVTB 2AZ3A 4JI7F 4O0IA 3MHYA 3J81U 1FHTA 1ZZNA 4L3NA 3R5BA 3D0GE 3P8BB 2C2MB 3U1LA 5KFRA 5JMNA 4L6V3 5EX0A 5D0HA 4ZS6A 4CO5A 3IMQJ 3NNHA 2DNRA 3PJ9A 3W8GA 4RNNA 2O67A 3KTQA 1F3VA 3PIOQ 2CNNB 2ALYB 4DCPB 4X64J 3BR9A 2GIRA 2R8GA 2R7TA 1NKEA 3K2YA 2WZ1A 2QLXA 4B3MJ 1GH8A 3M8PB 3WBZA 2ZH3A 3M6VA 1YI2S 3V5RA 4ZCMA 2KT3A 4NLQA 2OP5A 1S1UA 1KWMA 1EETB 3FBFA 3KNGA 5HATA 4RNOA 3CCRS 2F4FA 4MFBB 4C97A 1NH8A 5K9FA 2XZWA 4DX6A 2MQMA 3UE2A 3TUIC 2RS8A 4X62J 4DV7J 4F26A 3VCDA 2HHVA 1VQNS 5L46A 1E6YB 2DIVA 3JTPA 3AJ2A 2Z57B 5J1EB 2JNJA 2B56A 4RPFA 5C42B 2E5LJ 1Y9OA 3FRYA 4MK7A 2AP6A 3BYPA 3C19A 3DLKA 4AE5A 3CE8A 1HNXF 4C8LA 2ZKTA 1WOSA 1YTYA 3MWBA 1PYSB 1EKSA 5GADU 1UPMB 5CYQA 3S8SA 4NLTA 2CG8A 2LP4A 2AYEA 4X65J 1Q7LB 2XMAA 2HBRB 3D5MA 3NCRA 4NASA 5FIIA 1BLUA 2JEFA 2RNEA 3CJTA 2DPJA 1WDDA 4KKOA 3SFGA 3DLBA 1IBLF 2HG4A 2W8KA 2YWGA 1KLMA 3JSBA 3N79A 3RUBL 4DV0J 3IR6B 4DX8H 4ED8A 3J81Y 4YP3A 1X0FA 2CRLA 1UVJA 2OPSB 2V0NA 1UP1A 3LWLA 3PO4A 1N5QA 3S7RA 1G2EA 1M5SA 2XY7A 2VPXB 3IFEA 1O8BA 4LRBA 2L9WA 3EPIA 5F0UA 4CP5A 2O66A 1IKWA 1LXNA 3I5BA 4OZ2A 1UAWA 2IFXA 1WHXA 2F40A 2PMZD 3Q2TC 2MEWA 4A8MP 1FFGB 4I2PB 1SJ4P 1F5AA 4NWBA 3VZIA 3GQCA 4F2SA 4N8OA 3KG0A 1LFWA 5JUMA 1M1KT 4NLPA 4RUHA 4ZA1A 2DHGA 5L38A 4V19J 2DRDA 4DJBA 4Y2MA 2YWKA 3UNYA 4KGKA 1WC4A 3R7NB 2UXBJ 2XTJP 5HROB 2DPIA 2MY8A 4P2XA 2GW8A 3C3LA 3FZBA 2WB1D 3GR0A 2AIRB 2VPYB 3QFWA 3CCWA 3CJRA 3MM9B 1Q5YA 3FBBA 3OSPA 3BZQA 1X4DA 3PHEA 2PE8A 1W25A 1HWJA 2AYMA 2CJKA 4LBIA 2GIFA 3CT9A 1RT6B 1RTHB 5F0WA 5JVGQ 2Z56B 1YVFA 2DNOA 2RRBA 4B3RJ 2WVCA 1T9XA 4B3OB 3PX4A 2OTJS 2CYYA 2FHJA 2HS4A 3D1HA 4OYPA 4GKKF 5KFGA 1VC6A 1Y00A 3O5TB 1HYSB 4B08A 4P73A 3CD7A 4OYWA 3Q8VA 4USJC 1IKXA 4LFBJ 4HEA9 3QRRA 3TZYA 4ENOA 2UUCF 5IZHA 3GSDA 2WHOA 3TZXA 4X4RA 3ENWA 4IRDA 4RKUC 2CQ0A 2WSCC 2QSFA 2YX1A 4YB6A 3BKFA 5EN1A 4OX6A 3EJMA 2B9WA 1N5YA 1MMNA 5IWAJ 3M8SA 4C0HA 2NCKL 2CJAA 1ZPWX 1MWYA 3B82A 3R6LB 2LDIA 2ZD1B 4LF9J 2F8MA 4QW8A 2QL5B 3LOUA 2H51B 2OH2A 1C4CA 1X9SA 2V8VA 1TUWA 3GJQB 4KHMA 4DS4A 5DDPC 3I5AA 2YPZA 4DR2J 4LVNP 2QA1A 5SZTA 3R6GB 4PYAA 2QYCA 1VQLS 3OJSA 1CJKA 2ZM6F 1U6FA 4QWCA 1VC0A 2KM8C 2PEHA 2KYZA 4HKQA 1WC3A 3TAMA 2VHGA 2OELA 1WKKA 2HVZA 3D67A 2HWHA 2V4JA 1PSDA 1NHKL 3LTOA 3AOCA 1RCOB 3UNGC 4C8YA 2MGZA 3SCLE 2R7RA 5F8LA 2CNLB 3W2VB 1FX2A 4ZVFA 4WIQA 2VQFF 2V67A 2J9DE 2GHVC 4CYUB 4CO3A 3ZTPA 1F5CA 5JJBA 2E5JA 2ZZTA 5E3QA 3UN5A 4DFMA 5BYRA 5L9NA 2DR9A 5KFYA 5C25B 4KRWA 3ADAC 1I94F 2IPOB 3WZ0A 4WP8A 2ACMA 1ZZFA 4IH7A 1NSAA 1EZZB 3K58A 1NB7A 3FSIA 3MM7B 4DCOB 3CMAS 5KFMA 3GCXP 4LF4F 4ZVGA 3HPOA 4EYHB 2V2QA 2GJIA 3I0SA 2FY1A 1SPBP 2G2OA 1NK6A 2NSCA 1KVIA 2NYIA 1A9NB 3G6YA 5AJ3J 1ZAVA 2BJ7A 3CXCR 1PIEA 1RT1A 3FSYA 3D3CJ 2KDOA 2HFVA 3Q8QB 4OI0A 4DR5J 1EB0A 3BV8A 2KJWA 4FS1A 2G0JA 1FEEA 3Q23A 1AUDA 2DNLA 3TP2A 2PA3A 8AT1B 1S10A 1YRXA 1HPZB 4C3LA 4JYAJ 4X4VA 1BY9A 4KGMA 3SFUA 2OMLA 3PX6A 1SH3A 2EFNA 4ZOSA 5KFZA 3TOQA 5E3CA 2YX7A 1K0TA 2DY9A 1RYSA 2FHMA 3LP1A 1U26A 3PKYA 3MFIA 2ASJA 3W5XA 3ZZZA 4JUZA 1DFDA 3RBDA 1RAIB 1R0AB 4DV3J 3UN3A 3HHLB 1T0TV 1TZ0A 1XMOF 3MAHA 1S7HA 3HMJG 3EICA 5DQHA 4ED3A 3MM6B 4P2MA 3DDKA 1XERA 2GC8A 4DF8A 4J7CA 1SVDA 3ISZA 4GO5X 3V81A 4HHUA 4R0EA 5CD4H 3DLJA 3I4PA 2C2KB 3GCWP 1VQKS 2F1FA 4K0KJ 2IVMA 3QT8A 1X4AA 2UXCJ 2BE7D 2ZH5A 1KD1T 1EJ7L 4BCAA 4XPEA 1IM6A 2V2ZA 3FUYA 2HFUA 2JRSA 3OD2A 1HR0J 2VG6A 2W9BA 1N88A 1O51A 1RACB 5IV4A 3TJAA 2A6OA 1S1UB 3Q8RB 2JX2A 2FC8A 5KFIA 1WEXA 4U67Q 2ZOMA 1TFYA 4U7UK 2AQ4A 1U6BA 4JV0A 2J0SD 4ZLLA 5CCLA 1RTZA 1YK9A 1RTJA 2AU0A 4BDPA 1S97A 2D3O1 3AD7C 1N34J 3L7PA 4OZNA 3DLKB 4JV1A 3R9LA 2UVRA 4F0MA 1RUSA 2UU9J 2OEMA 2ZZMA 1VQ8S 4DPXA 1BXNA 5F8HA 2F8HA 2XEXA 4DV6F 4NLGA 1U1PA 1TK5A 1T8EA 4V1Ak 4LFCJ 2DNGA 1GX5A 3C8YA 2GAGC 4J91A 2LDYA 1TL1A 1FDDA 2GVDA 4RBUA 3AXMA 4ED5A 1WC0A 4CLPA 2OI2A 4ECZA 5H9FJ 4JI0F 2YQ1A 2WVFA 3TX0A 3RBZA 1J2VA 2R4FA 4B9TA 1N0UA 4PKDB 3O3LA 4QW9A 4FDFA 4KKOB 2I8EA 4WK1A 4QWAA 4RO0A 1FJEB 1KLMB 3UD3P 4QWEA 4RU9A 2VD3A 2CPZA 1S1WA 5DG7A 4OZLA 4UOFA 2F9JA 2MQNA 4RUAA 1I6JA 4CLWA 2V4QA 3BPSP 4XTTA 2YNGA 2I5JA 3BH6B 5IXUA 1XR5A 1RA6A 2KHDA 4WFBQ 1RU2A 2FHKA 1H6KX 2QFIA 1C1CA 4U7CA 2IM3A 2WW4A 4DUYJ 4OI6A 2MQPA 1IKWB 4RW4A 3K17A 1RE1B 2ZDPA 1FRJA 3W61A 1ACMB 3M32A 2C3MA 4G1IA 2E7WA 1JLFB 2XCPA 1FTCA 4DU7A 2MZSA 4HH0A 1ZM4A 3Q8UA 5FDLA 1NSPA 2X51A 2I9SA 3K5PA 2FQQB 2XG8A 2RT3A 4A8QA 1XIQA 1SQEA 3QAEA 3OV7A 2UUBJ 2G9OA 3M2VA 3RR8A 2ASYA 1CJTB 4C48A 3D7SB 5H9FK 3BGOP 2GGPA 3J7AN 2K3KA 4DR1F 3KDOA 3D3BJ 4G6VB 5HAOA 4X2BA 1U0SA 2L9DA 3I96A 2CUYA 1X5OA 4HHHA 4AQYJ 2WCXA 1S6QA 5KFKA 1VGYA 1Q78A 5I3QA 4DL6A 4TVAB 3DGVA 3CJSA 5T14A 2JEIA 1B70B 1N8RT 2IRYA 3P49B 3CJ3A 3OVBA 3QLHA 4M5IA 1NEEA 2PO4A 4DV1J 1H2VZ 2KFNA 3OXFA 1LV5A 3CUNA 1RK8A 3T5JA 2EBGA 2VF3A 1TP7A 4PRFA 4LSNA 1TELA 3C66A 2VOPA 1Y7PA 2VKRA 4NA3A 2K7KA 3NNAA 2M0GB 4YR0A 4ZJOA 2M8HA 2PMWA 1IKXB 4RW6A 1DTTA 2PT0A 2HW3A 4WXWA 3E8OA 3F73A 2YKQA 1GXLA 4P72A 3CDWA 2Q3PA 1CC7A 2OSRA 4ANDA 5CZVA 2DR8A 1RB0A 1RTDB 2KO1A 3Q2SC 1VQPS 3PW5A 2XGQA 2L9NA 3TUPA 3RB0A 1N5YB 1G4CA 1N33F 1LK7A 4DV4F 3HFKA 3RGIA 1RLDA 4FXVA 3RRKA 4BC7A 4XO0A 1NSKL 3LAMA 2EW9A 3POTA 1S5ZA 5CABA 4XDCA 4F4XA 1K1SA 2EFOA 1XNRF 3ZC4A 2NUUG 4CLFA 1H2TZ 4DV5F 4KTQA 3PEJA 3QPIA 2AX1A 5ETNA 1G3OA 2H4WB 5LSOA 4YY3F 3R2CJ 1R8AA 5F8GA 1XR7A 2B4PA 1GTEA 2ZEJA 3IM9A 3DYAB 1QSSA 2AEMA 3QAUA 2DISA 4UOHA 4ID8A 1T9UA 1WI6A 3TAMB 4ELVA 1MG7A 1V5IB 3UDCA 4KT0C 4DR3F 3OFEA 3CD0A 2MGZB 1KEKA 2DY1A 3TQ1A 2W1BA 1FRMA 1CPZA 3F41A 2E1RA 4WF9Q 4NXMJ 5J2PB 4FYDA 3LPEA 2HVEA 4DG1A 4O3PA 1VRUA 3ZTSA 4ES3A 1FE4A 1OY6A 4A48A 3GONA 2MSTA 1GFWB 1SJ3P 5J2QB 3K0JA 1JLAA 1UWBB 2VFVA 5EGYA 5FLXU 3M2UA 4QCLA 1S12A 4CLLA 1S4EA 5L9XA 2W2MP 4L73A 4G1PA 2BOPA 3C46A 1PC5A 1SH2A 2MZTA 3TA0A 3BDEA 5A2QU 3IG1A 2HFOA 3I0SB 4W98A 2DR7A 2D9OA 1IM4A 4YN3B 3KJVA 1YBAA 3Q8YA 1TQLA 5C24A 1RT1B 2HQDA 2NQPA 4U96A 2BRKA 4J9PA 5KFLA 3NLCA 4OZ1A 2RUSA 3GB0A 1VMBA 4S0MA 3ET6B 1U45A 4I7FA 5HP1A 3FQLA 3R3TA 3W2WA 4USWA 4CCHA 2Z30B 5HQMA 1SV5A 1S1XA 2HS3A 3EUNA 3PW2A 3NCPA 3KKFA 2KH9A 3FSXA 2CJYB 3SCIE 5LJ3Y 5KT5A 4NRUA 3FCHA 3CJKA 1X4GA 1QUVA 3T1YJ 2VDIA 3SQGA 4TXSA 3K5NA 2EFGA 1HD0A 4CO2A 5HVGA 2E29A 2QZ8A 2AYGA 1WD6A 2KXFA 3LP2A 4MK8A 2LXFA 4ANCA 5BR8F 3RBXA 4FYYB 5HK4A 3P5TL 1CULA 1T11A 3SSQA 2XMWA 3TEGA 1FWPA 1Q5VA 3TW0A 2KG0A 1L3VA 3CCJS 3DLGA 3SDEA 1JLQA 4NZ7A 3EVMA 5A8WA 3V81B 4M5KA 3BGUA 2W7AA 3G8TA 2LKZA 2MMYA 2W2OP 4ZPWR 2LVWA 3AAWB 1G6BA 2J7KA 2M2BA 1FTRA 4FVMA 4GO7X 3NP5A 1XN9A 3DGPA 2YH1A 3C6TA 5FLXY 1N32F 4IG0B 2CQBA 2VQEJ 1SXLA 3HD2A 4L75A 1S6UA 1M5HA 1UA1A 2VG6B 3CJ0A 3FBEA 1NDCA 4USIA 2UUAJ 3I9ZA 3V2UC 3CIZA 3IS9A 4OYAA 5A2QY 4ZHRA 3F44A 2P5VA 1UZDA 3HT0A 5CA5A 1AFJA 2HHSA 2YNFA 1KC8T 4JI3J 1XMBA 2FLLA 4R25A 5DQIA 1RTJB 3E3XA 2LYVA 4NE9C 1S9EA 3EGNA 2FGOA 5ETTA 1HIYA 3CMES 2DRAA 3PRBA 4LR7A 2PN6A 3L7OA 3MR5A 2ZJRQ 1UFWA 3TJ9A 2XC9A 2MKCA 1L3SA 4QWBA 4LF8J 2CWXA 3RG6A 3K5LA 6FDRA 1YKWA 3BGRA 1TL1B 2GVDB 2RH3A 1F5BA 2J8AA 2DR6A 2CWKA 2F9DA 1URNA 2JL9A 4OZ5A 3FZ2A 5KG0A 2BJ3A 2CDRB 1D09B 3EZOA 3QO9A 4USMA 2L41A 1OO0B 4OLPA 1U47A 4NLVA 1IXKA 2NS1B 1TL5A 1S1WB 3Q0AA 1JWWA 3ZO7A 1ZA2B 4I6AA 1X4BA 2KZZA 2H1YA 1XNQJ 4B9UA 1KTQA 2FJBB 3OFFA 2HPUA 1C1CB 1IVZA 4ES1A 3VF0B 1NK4A 2IVFB 5J2NB 4CLUA 3KLGA 3CSKA 3AY0A 3M32B 3CC7S 1K1QA 3IO1A 3TA1A 3OXGA 1UVNA 2RS2A 4RNMA 2XI3A 3QZ7A 2Z2LA 4AT1B 3MM5B 5LMNF 4EUVA 2B8PA 3EDQB 3B78A 2K8GA 2OPRA 1LXJA 4P6QA 1B0VA 3M2VB 2C22A 2DHHA 3QYYA 4KGXB 3HHNB 1VQSA 2PGCA 2BW7A 2HGNA 5I42A 1VDHA 4OHZA 3PDNA 3CGIA 3H90A 2EWHA 1EKRA 3R8YA 4DXLA 2ZH4A 5K5MA 3DRPB 3U7JA 1S6QB 3W5ZA 5ETMA 3OR1B 3UD5A 1DURA 3DXBA 1NDLA 5D15A 2HQGA 2OEJA 3QLHB 1WOPA 3MEGB 4TKTA 3AH6A 1R8BA 2RILA 1CQNA 3PYDA 4H4MB 5A8RA 4FYVB 1RKJA 1WACA 4KAIA 4LSNB 1TMMA 1EAYC 5KFVA 4ED4A 4LF5J 2BANA 2XO7A 4RW9A 3TUJC 1XC9A 5IQ6A 1X5SA 5B0DA 4KB7A 1FERA 2CVEA 3G86A 3D6HB 3W9IA 3UW1A 4DSFA 2X3DA 4RBTA 1YZ6A 5KG7A 2R2SA 2P2CB 3EZUA 3GIRA 1IN0A 2HKEA 1UL3A 2IRUA 1TVRA 4RL1A 4PZVA 2XNRA 3POTB 4PUOA 2HBZB 2B9EA 4ZVQB 4B3MF 2ASLA 5GMDA 2MQ8A 5KFJA 1WG4A 4K7QA 1F9HA 3M05A 4PXBA 2E1MC 1BD6A 1D9AA 2AV5A 4FS2A 4OYZA 2ZDOA 3RW7A 2RQMA 3M30A 4LF7F 1M5OC 3A8KA 2J9DA 2ZVSA 4F3QA 2RDJA 1UJ4A 3MOJB 3TRGA 4X62F 4DV7F 3KHGA 2BRLA 4KBIA 1YJVA 4MJKA 5ETVA 1WI8A 2B7BB 3AFGA 4KH1B 3N5BA 4WTYA 1N5SA 1NDPA 3NGRA 1FRLA 1YX2A 2E5LF 2OHDA 3AQOA 2A3JA 1C4AA 1SC3B 3I9V9 2H3EB 2RKIA 2BKOA 3QGHA 3SSRA 4Y2KA 5IOLA 3WHIA 1VRUB 5LM7E 3GJSB 2V8HA 1TK0A 3I87A 4WK3A 1T05A 4QYZJ 3L7UA 5DGAA 4Z37A 2XY6A 4X65F 3OFHA 2OSQA 2PMHA 1ZYQA 1RYRA 2EC2A 2V9KA 1P1TA 3PW7A 5B08A 3D0HE 3EWGA 3RZAA 1IJFB 1R6YA 4F0KA 1HQ2A 3ZZ0A 2IBKA 4OYBA 2FZGB 4DQSA 2JFKA 1Q7YT 1R31A 3KHRA 3ZTRA 3GIKA 3BREA 3IG1B 4U6PA 1KLNA 2DK2A 3FQKA 4PWWA 1V9OA 3RR7A 1IBMJ 4ECTA 3C14B 3F0NA 2AD9A 5C24B 3RB3A 1Q8LA 4U8VA 1VQMS 1RWXB 4OHYA 4OV1A 2ALZA 2DO0A 2ASDA 3JQMA 4IR9A 3WIUA 2GQCA 1JKHA 1X4FA 1U4BA 4E0DA 4I7FB 2XWXA 5HP1B 3W2WB 4MMOA 2XMUA 5K14A 2HYIB 4JI2J 2NZ4A 1S48A 2Y0BB 4YR3A 2GMLA 2CPXA 2R7OA 1IKVA 5KT7A 1VQYA 4ZP8A 4DFPA 3CJKB 2W2QP 4RNHA 3M8QA 3SQGB 2UXBF 3NAIA 2CQPA 4MAKA 3TYTA 1NNDA 2ERRA 1MWZA 3GV5B 1DAXA 3WX4A 3I82A 1HQUA 2VFUA 5K20B 1CULB 4WFXA 1BQMA 2C3OA 4A8SA 2AJQA 2LQBA 1VCTA 1DARA 5RUBA 2CA9A 1S6PA 1OSDA 2JHEA 4OV6A 2C3UA 4PG7A 3DLGB 3VR1A 3SDEB 5ITHA 1JLQB 3GG0A 1J27A 4B3RF 1ZA1B 4Y3CA 4K4ZA 2IJFA 1HI8A 3ZZTA 4B3TJ 1VHIA 2MZ1A 2J6UA 3OLAA 3K5MA 5EDWA 4M63A 2RAQA 2RHSB 2HRYA 4F67A 2XLJA 3DGPB 1PJ5A 4IQMA 3C6TB 3NG8A 5EUHA 4LFBF 1YBTA 3BO4A 4CZCA 2CJ9A 4ZPCA 3QRPA 2H9ZA 5KFUA 1S9GB 1S79A 4QWDA 3WIVA 3C15B 2BV3A 4I56A 1S49A 4P75A 4IH6A 1U1RA 4WIIA 4ZHRB 3NGKA 5IWAF 2XS2A 3CJ8A 1X9MA 3U27A 4JV2A 3BPDA 2VASA 1HKAA 1JIHA 2R7VA 3ZTQA 1VLYA 2HEKA 1Q16B 2NR0A 3QMQA 5MLCV 1WC6A 3W63A 3H4BA 1Q53A 1HBNA 1B64A 4PXDA 2W9CA 4ED7A 2E1PA 3RYLA 4D3HA 1YITS 1SB6A 2VPWB 4LRFA 1UZHA 5EWFA 3CWJA 1S9EB 1WG1A 4CLTA 1XMQJ 1OJ4A 4F02A 3GFXA 2OPPA 3MURP 3KG1A 3IR5B 4DR2F 4PG8A 1FF2A 4LRCA 1U1QA 2WW8A 1NKCA 4LF6J 3BSOA 4BLGA 1ZS6A 4YHHJ 5KG2A 2HNDA 4OZ0A 3ZZPA 3BGRB 3CJ5A 3RAXA 4YQWA 2AZ1A 2YWHA 3OUYA 2CPHA 3PHTA 2ZOFA 1JLEA 2CJQA 1YSJA 3R97A 3QO9B 5D78A 3PO5A 3I55S 3I5CA 2CJBA 5B7WA 1P8GA 3IR7B 1A0OB 4A47A 4LFAJ 4ZN1A 5A8KA 2B8QA 1H7WA 3KK3A 3M7VA 3A3OB 3Q83A 2L3MA 3NMRA 2FLNA 1YBUA 1WELA 1X5PA 4U9RA 4DR4J 1EQ0A 1FFSB 3MPWA 3R1HA 1UETA 4EZ9A 2B4VA 2FZCB 2G2YA 4FPRA 5C7PA 4UUXA 4AXJA 3H2VE 3IP0A 3MD1A 2QFJA 4LF1A 3KLGB 2DHAA 1FFWB 1RWPB 1DTQA 4DF4A 3H42A 3OW2R 3CCUS 4OYXA 3HHLD 4JV5F 4TYAA 1CVJA 1DBDA 1UFKA 2LLZA 2GMJA 3EVWA 2XSJA 2C2EA 2MB0B 3RRHA 2P6TA 1M1HA 4QJVA 1T9VA 4J9LA 4MKYA 5AJ3F 4CH1A 3UVJA 1FCAA 2LCWA 2L48A 1X9WA 3BH7B 4JI4J 5I42B 3KHHA 2VDHA 1NHVA 5F41A 3LALA 3QATA 1GT8A 4JYAF 2DXEA 1H0HB 4GRSA 3KLHB 2M9KA 2M52A 2XHCA 2V68A 2JH3A 5HQLA 5DGBA 2W25A 1K9MT 3E51A 1QTNB 4A8XA 2XLKA 5CYJA 1NPRA 2PI4A 2MYFA 2D74B 2MQLA 1YZ7A 3E01B 1IBKF 1Y5LB 4WWSA 2BM0A 4DPTA 5THWA 2W4DA 1JNRB 2AGQA 4DV3F 2M88A 1KSPA 2MLYA 2CQDA 5F8NA 3FC9A 4ZCLA 2BANB 4W92B 4ZITA 3EGVA 4BS2A 2XZDB 2BYCA 2FLPA 5JXSA 5FD1A 4USVA 2LQJA 4CTAA 3T5KA 1HI1A 1X4CA 4O44A 2JLFA 3R5DA 1QD1A 1HHQA 5HMXA 2JJ4D 2HVHA 3LP0B 3VWSA 3T9ZA 2BJ8A 4FF4A 1TVRB 3MMCB 1Q79A 4PUOB 3DCAA 1JLGA 1FNMA 2FJEB 2AEFA 2ZVIA 1VFJA 2VONA 4QPTA 2JC1A 2F65A 4LBPA 1Y3KA 4OHVA 1HNXJ 1OY9A 3M8RA 1HHSA 1N52B 2G13A 1UEUA 3THPA 4USUA 4Q2MA 3P45B 3QIPA 2ZNZA 3GILA 3M9NB 4Y00A 4DU8A 2H65B 1WEYA 2FD2A 5KT6A 3IGNA 5E2QA 4C4WA 1HBMA 2NXJA 4KY3A 2OJ3A 4DPYA 2V50A 3W8PA 3H5XA 4OI1A 4CRJA 1IBLJ 1RLCL 2FJXA 2AKWB 4HDHA 1BQXA 2DBBA 7FD1A 1N34F 5KFHA 4DQQA 2W2NP 1S59A 2D69A 1C1BB 4LRDA 3CCLS 4DL7A 2GVZA 2A10A 4AL6A 4YB1P 2ZH1A 3W9HA 2NXNA 2CG4A 4HTIA 2A6MA 3KLVA 2EFQA 4LFCF 3MFHA 4NRTA 3FDSA 3EGZA 3CCMS 1QE1A 1ELOA 1T05B 2XMMA 3A4TA 2FJVA 4UQGA 5GAHI 1SH0A 4EGLA 3GTYX 3M4XA 2XMVA 3KUEA 4EBEA 1B0PA 4JOUA 1HNVB 4OFZA 2ZWOA 4M5JA 1S0OA 5KT4A 4ECRA 5LSRA 2ATLA 4CLSA 3CCQS 5BXIA 3EDRB 2CPIA 3GWCA 1NB2A 2MHEA 2DGSA 1V3ZA 2VA2A 4F7VA 4F8RA 4QIFA 4EBDA 3HSGA 4J9KA 3TEHB 4J9RA 2LU1A 1PJ7A 2FHJD 2ZBCA 1ZAXA 4MIWA 2QTWA 1U8SA 1AB8A 1RAAB 2BKPA 5AXNA 2ZE2A 3CJ2A 3ZZUA 3WDOA 4IG3B 5K14B 2DNYA 4ZVSB 3ZZOA 1IKVB 1N54B 2VBXA 5D4LA 5KAKA 2LXIA 3NWRA 5KFWA 3M8QB 1TV6A 2UUBF 2OEKA 1T9YA 4HACA 6FD1A 1KN6A 1YLXA 4Y2CA 4LSZB 2A2CA 2R7WA 5CXTA 4WZQA 2CQ3A 2APOA 1HQUB 3QGIA 4DR7J 4HT7A 1F9EB 2PC6A 2UUCJ 2FJAB 3DOMA 3QQCD 4AQYF 4DLGA 2C28A 2OFHX 4R8UA 1S6PB 2FIUA 4Q0BA 2A1BA 4F4YA 3MAAA 1SI9A 3US5A 1HHTP 4WKYA 4ICLB 2XMTA 2FVRA 1RCXB 1P1LA 2AT1B 3KLFA 1FX4A 3H2LA 3CDEA 3CJ4A 2LQ8A 4UZCA 3CTRA 3BQ0A 2IY5B 4FF3A 1HLWA 2CQ4A 3KK2B 2GZOA 4ZN3A 3MR3A 4NCAA 2RIJA 5EWGA 1VIOA 1F60B 2MKSA 3OFGA 5HLFB 2KT2A 1MN7A 3FFIA 1CJUB 3HZEA 4ZP6A 1SL1A 2VU5A 1BGXT 4CLKA 1FVQA 2QIFA 2QJ3A 3THTA 2OFGX 4MK9A 3R5GA 2HAFA 4RUCA 3T1HJ 2GO9A 2WVEA 4FN5A 4ZJQA 4ZVEA 1HBNB 2QV6A 3H25A 2C2ZB 3H59A 5KFPA 4Q2LA 4WP9A 1H72C 2VQFJ 4CO1A 3FEXB 5ETSA 3ICLA 1X7VA 2EBEA 4F25A 2PDAA 3DDIA 1WHYA 3P96A 3MECA 4QYRA 3KFWX 2MKHA 1NDKA 1Y11A 4M5MA 4LR8A 1G7CB 3W5YA 3DMJA 4PG4A 4RZRA 1Q8IA 4CO4A 3TVYA 3T5LA 4C98A 1BHNA 2LXUA 3OUYB 2W9AA 4JP8A 4ECWA 1RQ0A 2BW2A 3MEKA 4KPCA 5F9NA 2UZAA 2AGPA 1ZTTA 3T6BA 4DPUA 5E0OA 4NXMF 5A8KB 4K5RA 4MTPA 5DJBA 3QSIA 3KK3B 3NGSA 1HFEL 2YNHA 4DSKA 2F5GA 1Y0HA 5DS7A 4W90B 3T6JA 3OTOJ 4O4GB 2HNYA 3LF0A 4NLOA 5ETPA 4Y0FA 3Q22A 1FRKA 3PYFA 3A8EA 3L9ZA 1XTZA 2ATCB 1LOUA 1AROP 2GJFA 2ZJQQ 2YTCA 3V6KA 4F50A 4JI5J 2DH7A 4ZCKA 4ZIWA 1UJ5A 2AHOB 1ZM2A 4UW2A 2ZC3A 2ABYA 4USKA 2XSJB 3DLEA 1W7WA 3W60A 1QVFR 2OUGA 3UVJB 4DEZA 2GHPA 3BF4A 2DGUA 3N5FA 1FWLA 3ZTOA 2QLFB 2X1FA 2LEAA 3V6JA 3W64A 1NK7A 4L3KA 5ETOA 5KT3A 3ELHA 2AJFE 4ZVRB 2KI2A 3CCZA 2EFVA 1TL7B 5E3RA 5GAGI 4I6WA 4DFJA 4RW8A 2CXEA 2I0XA 2ZZNA 2VG7A 2UP1A 2FPHX 4WU2A 3BYRA 2D7SA 4HVZA 2IA0A 1KDNA 1RXOB 2QLJB 1JB0C 1QAXA 3IBFB 4K4XA 2HFZA 3JB9k 1UEKA 4UOGA 2HQ3A 4C11A 4ZP7A 2BJ1A 1XBWA 4DUZJ 2VPZB 3MMAA 3PXGa 1V3SA 4J5OA 4X66F 3CO0P 3TO8A 4DSJA 1AZSB 4FYWB 4P9SA 2NPIA 4NXNJ 4FKXA 3DOLA 4AXIA 2VG5A 4CTAB 1T9TA 2AJ1A 4ECQA 1EP4A 3MTJA 2DH8A 3OQ2A 1R0BG 4O44B 3PNIA 3P4UB 4WXOA 4L72B 2C2RA 1UJ6A 4K4SA 1MU2A 3W62A 3PFOA 1DY3A 2KZMA 4NZ6A 4MKAA 3WC0A 2EC0A 1VBYA 5GAHU 2B4UA 1JLGB 3ISNC 3GIMA 2VQEF 3BSAA 2RU3A 3N6LA 2V2VA 5F3ZA 2MDAA 2UUAF 3MPYA 2PFFB 4NA1A 2CQ1A 4H4KC 4CQ1A 1FNOA 2Q43A 2IC3A 4IYQA 4P7VA 4LQ3A 1TKXA 3FEYB 1TK8A 3A3NB 3DC2A 2DKOB 5DLFA 3T1AA 4PWDB 3IA0A 4DZ6A 2J7WA 5HBMA 2RUGA 4ILLA 4IOBA 2YWWA 2AEJA 1HBMB 3BGFA 1NPPA 3MPVA 1BC6A 3MD3A 4B9NA 1TL3A 1VK8A 2J76E 3QWPA 4P2FA 1Q8BA 4URSA 1LWFA 1RT7A 2HZAA 3GFHA 2GVZB 2FUG9 4KV8A 3RAQA 4OQJA 3FVYA 3OVAA 1NU4A 4DR6F 2D3OR 2QLBB 4WPAA 5KG6A 1QE1B 2EKNA 1VYAA 3RBEA 4NYPA 4FKYA 4GVBB 1OPZA 2CDQA 3D28A 5G0RA 3DRRA 2XO6A 4JI1F 3MZIA 1VQ4S 1U09A 2RHQB 4PAAA 2DVIA 4TY8A 1YRUA 5IFMA 4NCGA 2IM1A 3VV2B 2RU9A 5DETA 1R0CB 2JVOA 4PPDA 1OQ3A 3ZFVA 5LJ5Y 3PW0A 3G6VA 1N6QA 1ROFA 1XNQF 3R5JB 2IRXA 3MR7A 3OSNA 4CH0S 3MUTP 4O3OA 5CAAA 4DMZA 1I3OB 2MLXA 4FBUA 1IKYA 2D1CA 4RLEA 3HHLC 1U1OA 1HL6A 1FO1A 2HS0A 2N7YA 4OYMA 1FD2A 1TKTA 4F4WA 3I56S 2DGQA 3U1NA 4OMFG 1HD1A 2YKNB 2ILZA 4AUKA 1RKIA 1IR2A 3M6UA 5JVHQ 3MEEA 4HACB 4FBTA 1VQOS 4OJHA 4IFYA 4C8MA 1SJFA 2YY3A 3S01A 2B6AA 1OMSA 4TN2A 2KVIA 3VZHA 3J7Z5 3DOMB 2B5JB 3GV8B 4PG6A 1KKHA 2RQKA 2ZHOA 1N36J 1RTIA 4R8UB 2HAIA 4ATNA 3HT3A 4AYBD 2EEYA 1VHFA 1IR0A 3PIPQ 2NPFA 2YNIB 4Q0BB 4P71A 1Q95G 2GHWA 1N33J 4LSLA 3MAAB 1JJ2R 4MYTA 4C3KA 3K89A 1MLAA 3MDFA 2OLWA 4JBCA 1M90T 1D0EA 1PAUB 3TAQA 1LW0A 2HHUA 5F9LA 4EU0A 3V4IA 4CO0A 1ZM3A 1DQ8A 3I32A 4LF5F 5AT1B 1RWNB 4PABA 2K7JA 3PY8A 3O1LA 4DPOA 3ILOA 2K2PA 3FFIB 4Y2IA 4WJBA 3E2EA 3BM7A 4Z7YA 2HQCA 2MSSA 4ECYA 1E6VA 3SV3A 4Q7AA 1PGZA 3P3DA 1HMVA 2M8DB 1J5OA 3V6DA 4ZPBA 3KMQA 1VI7A 2KU7A 1ICEB 4J9NA 2UV8G 1QVGR 3DM2A 1F3FA 5EHHA 4K2JA 1IQTA 2GV1A 1R6VA 1IWAA 4FZVA 4DR3J 3VQTA 1A7GE 1DJ0A 2R42A 4EZ6A 3PTWA 4NYOA 3BS9A 3J81j 3M1VA 3UN2A 3QFHA 2E44A 3G4SS 4KHPJ 5A6PA 3SBMA 3MECB 2D9PA 1NHUA 4O3NA 2FYXA 3PR5B 3OR2A 2VV5A 4ETXA 3P5BP 4F4AA 3DMJB 3SCKE 4RWXA 1FXDA 1JK9B 4P10A 1RBOB 4IFVA 4PEOA 3DLHA 1PC4A 4CDIA 1XR6A 5L1KA 1YG0A 4WCEQ 3D2WA 4OI2A 2ZH7A 4TU9A 2V34A 3AOAA 1YDLA 2X3GA 5GAGU 4ZDNA 4NPOA 2LMIA 4DL5A 2IIHA 2HHHF 3ETMA 3ONQA 1U1KA 2U1AA 1VIXA 3FJ2A 4NL5A 3D54A 3GIJA 3NRBA 4KGZB 4UF4A 1HWLA 1LNQA 2XQCA 4CIOA 4HI2A 2KVQE 3MCNA 3V4MA 3SSSA 2HNYB 3O8WA 1FKPA 2QN6B 5B0GA 2V69A 3DI6A 2HHXA 5B0FA 1D9FA 4RUBA 4EI2A 3EXCX 3OBIA 1PAEX 5D3GA 3J7A1 2BM1A 2DGOA 1OS5A 3DLEB 2NXEA 5HROA 3UCGA 1IBMF 1GQEA 2G0CA 1V5VA 4L76A 3GYNA 5HMYA 1UEVA 1FRIA 1MSWD 4OYIA 3FCVA 3QSYB 1Q8KA 1N4LA 2KYXA 3BGLA 2PEBA 3OTBA 3VGVA 1RTHA 3HDSA 2Q1LA 4RW8B 3UPFA 4MIBA 5J2MA 3NGTA 4F4KA 1SIWB 3NY0A 4DQRA 3QJPA 2V94A 5DDQC 5HN0A 1SKRA 5DRKA 2IYIA 4K4UA 3H5SA 4OZ3A 2H4YB 1BQNA 1QAYA 3M8ZA 4ERDA 2CIMA 3V6HA 4JI6J 1YHQS 1N32J 5LMUJ 4PR6A 5CYQB 2ZUAA 3HCXA 4C11B 2VC0A 4N76A 4V19X 1W2BR 2G2ZA 1SL0A 1T9WA 3PCOB 4LQ9A 3CCVS 5I3UA 3FRZA 1UPPA 4KSEB 4F2RA 5HVFA 3MCMA 4J9OA 2LA6A 3LQVA 2MZJA 3DOLB 1J5EJ 2VG5B 1P9QC 3KJFB 1EP4B 4B3TF 1RWWB 1N48A 1KP6A 1U1NA 2NYHA 4IQXA 3BSCA 1MU2B 3GLJA 1KOHA 3IRXA 1TAUA 3U02A 9ATCB 1WTBA 1O0PA 4N47A 3NS5A 2EK1A 3G9CA 1OSCA 3HVAA 4N7TA 4NOHA 1OYDA 4C8NA 3LGNA 3VGSA 1RWMB 1HWKA 2FVQA 4ZVTB 1H38A 1LKZA 4GC6A 4ECUA 1TKXB 5KOXA 2K06A 1WKJA 4C8KA 2VBZA 1KHWA 5HBMB 4P7TA 2VFRA 2LA4A 5HSPA 5AXLA 1FT8A 1AXQA 2WONA 2XCAA 2OPQA 3W2VA 2OGUA 1TL3B 1GMUA 2B43A 1BE4A 1XMQF 1C2PA 1YJNS 1LWFB 1RT7B 3MPUB 1S7IA 1UWAA 3OPKA 3RB4A 4Q44A 5DG8A 3CD6S 1NKBA 4KV8B 2ZH6A 3PVXA 5C25A 4LF6F 1GMVA 4U8YA 5K8PA 2A0FB 2RRNA 3ZZYA 1GEHA 4YHHF 1KQKA 1JLBA 2WSEC 2IJNA 3R5AA 5C2GA 5C5JA 4YOEA 2W01A 2ZWPA 3D4JA 2J0XA 4K59A 3DRRB 1S1VA 2BQ3A 1WG5A 5CHCB 2EKYA 4I68A 1FDBA 5I3PA 4MH8A 3B54A 2VKZG 1P27B 4OX9F 4TY8B 4NA2A 4ES2A 4NCGB 2HWTA 4LFAF 2O01C 2YQ3A 4DUTA 4P52A 1N6QB 2E7XA 4G65A 2GFFA 2ZOGA 5D4PA 2V63A 2VOOA 4K4VA 4YUDA 1WUUA 2RSQA 2U2FA 5HMWA 3FGVA 3H20A 1HPZA 2CFXA 1IKYB 2GJ2A 2DHSA 4HTJA 3SMZA 5DM7Q 4KJIA 4ZP9A 1TKTB 3H40A 1QAJA 1AW0A 2UXDF 2E9RX 3UDVA 3R2DJ 2BE9B 3KK1A 2HQFA 3D1OA 1KS2A 1H74A 1RP5A 2R7QA 3CD5A 5DO2A 1FJCA 1YJRA 1UVKA 3MEEB 4K4YA 3CULA 2HURA 1D3WA 2QA4S 2N82B 4JI4F 4QR1A 1CJKB 4IFYB 3PR4A 2GS8A 2B6AB 1S0MA 3MM6A 3NGUA 3UR0A 2HHTA 2MQQA 3DXSX 1SC4B 5KFCA 4A8KA 1HNWF 1RTIB 4ZPTR 5AXKA 2V4JB 2MTLA 3BQ2A 3SIPB 2YBVA 3H2UB 3AT1B 4FNHA 3J7ZT 4NLWA 3CCES 1VS3A 4LSLB 4N77A 3TAPA 4IKAA 4A8OA 3D6FB 2QLWA 3I6PA 3L3CA 1KONA 3L4BC 1SC6A 2C3YA 1KVKA 1LW0B 4M5NA 4BWJA 3A8JA 1XEZA 3RU0A 4UQTA 3MEDA 2GQQA 2O1PA 3V4IB 4YR2A 3K5OA 3CW2C 1VLOA 1F2GA 1RAHB 4ZLPA 1CQMA 2FGCA 2DGVA 1NK9A 5D8HB 1GXUA 4O3RA 4LF7J 2QT7A 3IAM9 3JXOA 3VHQA 2P9CA 2KFYA 4I6YA 1B0TA 2D3ZA 3VAIA 3QZ8A 1GNKA 1E6VB 4FNIA 1HMVB 5DG9A 1J5OB 3V6DB 1RT2A 4LJMA 3MOZA 5IT4A 4NX9A 3A8IA 3DM2B 2DD8S 3D68A 5A76A 3G8SA 1GMWD 2JOQA 3J7YI 2AWZA 3O44A 4ECXA 4WU3A 5SUHA 1FWKA 4I1TA 4XK8C 4TQRA 1LWXA 1RABB 3HKWA 1B3TA 3M6WA 5F8JA 1Y5IB 2FDNA 4NCBA 1NXIA 3VQSA 3ILJA 2CAJA 4X4NA 2IBOA 3T41A 3M1VB 1DQAA 1TL4A 3KLIA 4YS2A 1NJIT 5HO4A 2J0WA 4QIGA 3AJ1A 2HVIA 1R8HA 5AXMA 4DL4A 5D0EA 2PI5A 1KRPA 1GK8A 3TA2A 3AJDA 3R5CA 1H7XA 2KXNB 3OR2B 2YKPA 3D9BA 3PW4A 4CLYA 3LP1B 1AYEA 3VAJA 4RBVA 3DN9A 3KG4A 2J5AA 4IFVB 3DRXA 5T7LA 1PG5B 3C6UA 5BJRA 2GA7A 3GP9A 5GVQA 2FVPA 2OTLS 4OHWA 4OJ3A 1RGVA 2N4CA 1B7YB 3I4HX 1ZETA 4WTOB 3VAHA 4I4BA 3JSYA 1KVJA 3PV8A 2BJEA 4DN0A 3NMAA 1AA1B 3RB6A 5D0RA 1SL2A 2R8KA 2HIYA 3AD8C 2HLTA 2EPIA 1H98A 1JLFA 1FKPB 4M1KA 2YVSA 2RDIA 4E98A 4OHXA 1FNXH 3DI6B 2J8SA 3R7BB 1YIJS 3AD9C 5E3AA 2JZ5A 5D3GB 3N01A 2KB2A 3B4MA 4ZLJA 2W9BB 4M5DA 3GFYA 1CJTA 1JJCB 2VJVA 1H2UX 4A8YA 1R3NA 5A0YA 1YRTA 2DJWA 1NK5A 2ILYA 2F8EX 4LR9A 2J6TA 2ZH9A 1K8AT 1U24A 2Y0SD 3BO3A 4Q8FA 1DLOA 2DEIA 3OVSA 2LQ9A 3NCQA 4DWIA 4NLRA 1S9FA 3TR5A 4LVOP 4RW7A 1S1TA 5J2MB 8ATCB 3LGHA 3KLEA 2B3TB 2DB1A 3KWMA 3TZWA 4X4TA 4LMZA 3I31A 2GCFA 3GMGA 1HW8A 3WX8A 3LANA 1BQNB 1IJEB 5J1NA 4BBYA 1D1UA 5CH7B 1RDRA 1MROA 4DR7F 2R2UA 4NEYA 4B02A 3OHAA 2MXYA 5I3UB 2MZQA 1L5UA 2P6SA 5I4MA 4MIAA 1RTDA 1QSYA 4R0JA 1WDTA 5L1JA 2IM2A 1OQ6A 3OL9A 1HARA 4B9VA 1T03A 3TI0A 9RUBA 4ECSA 4X4UA 2QL7B 4Q45A 2KN4A 2I5JB 2YNGB 3BR8A 3IRXB 3EM1A 3GYGA 3HJFA 2XHWA 2BX6A 3AOBA 3MPDA 4CWBA 3CDBA 1FJGJ 2XS5A 1ZPVA 3FNNA 1JJ4A 3PACA 2XZTB 2CQIA 4RW4B 2XMKA 2IDLA 2YX4A 4R5PA 2N4DA 4HLBA 2BDPA 4I2QA 4ED0A 5DDOC 4WP3A 5K8OA 3DLLQ 2ZKUA 1S77D 3EZ5A 3DYAA 3GU0A 5FDLB 3GJRB 4BWMA 5LT5A 3IM8A 3T1HF 1WC5A 2DHXA 2E5HA 3BKTA 3CF5Q 1RT4A 1U1LA 4M95A 1RA7A 2WONB 4JI8J 2LECA 2OPQB 2E1AA 3LO3A 1I51B 2Y8WA 2GGPB 3MCSA 1NRKA 5KOWA 1WJ9A 3VAFA 5J2PA 3PG9A 1NO8A 2IJRA 4DL3A 3HO1A 1SC1B 1YJWS 4DCJB 4L74A 3K8WA 3SCJE 5J2QA 3KUHA 4K8RA 1UWBA 1VR6A 3K8VA 4QZVB 2XI2A 4DS5A 4P74A 2NREA 1OIAA 1OPIA 4CM0A 3FBCA 1JLBB 3AB4B 2QMXA 1S0VA 2CQ2A 4PYDA 3J80U 2XYHB 1RHQB 1S1VB 2QYGA 2MJNA 4Z2XA 2BVZA 4JV5J 4D3GA 3OTCA 2QRRA 5ETLA 3KJNB 3QGGA 4O23A 3OL6A 2H5IB 1RJJA 2UUWA 4RW6B 1DTTB 3TQEA 5B0CA 1PYOB 2UVVA 3G6XA 2C2DA 4LIWA 2ZBRA 1X0PA 2GO8A 4F04B 4O0NA 2VC1A 1S99A 3OTOF 1DZ5A 4XDDA 3TJ8A 2BABA 3C2PA 1TAQA 3ET6A 3C16A 4H4OA 2LEBA 3W65A 4ETZA 4QIVA 4X64F 2DXDA 2KKHA 4F3MA 5K8MA 4JI5F 4A8WA 2AW0A 2DNNA 1UCNA 3QT5A 2R7XA 3A1YG 4ZK7M 4E2FB 3KK1B 3GJTB 1QJHA 4NEZA 3FMWA 2DXFA 3QNWB 1IBKJ 2IMWP 2HRUA 3JSRA 1Y3JA 3BBFA 2F4VJ 2DTJA 2Z4PA 1LWEA 4MKBA 1R89A 2I6WA 3NEKA
chains in the Genus database with same CATH topology
2ZC3A 2ABYA 2XSJB 4PG5A 1NK0A 4G1PA 2V8DA 2BOPA 1CLFA 3DLEA 1L3TA 3C46A 1PC5A 5M2RA 4I0WA 5KFQA 3GYXB 2B7CB 1JMTA 1SH2A 1WEZA 5M2UA 2DITA 2MZTA 4IDKA 2QEXS 1QVFR 3TA0A 2RD5C 2BE2B 3BDEA 3IG1A 2HFOA 3MUMP 3I0SB 3J7YU 1UA0A 2CPDA 4DEZA 2GHPA 1RISA 2WB4A 4XPCA 5L1LA 3BF4A 2DR7A 1X8DA 1XK8A 1MNEA 2DGUA 3OTDA 4HH1A 4K50A 2D9OA 1K0VA 1IM4A 5K8NA 3N5FA 1ZOTA 4LUBA 3MXHP 5HMZA 3KJVA 1YBAA 2X1FA 2LEAA 4WFZA 3V6JA 1TQLA 5C24A 3VAKA 1NK7A 1RT1B 5DQGA 3AA8A 3UI3A 4AFFA 5KT3A 4DHVA 2AJFE 2OPSA 4FVCA 2NQPA 2KI2A 1TUVA 4NLUA 3CCZA 2BRKA 4J9PA 2UV8A 3N9UC 2EFVA 5KFLA 4I67A 4WE1A 3NLCA 4OZ1A 5E3RA 2UVUA 5GAGI 1FKOA 2YNHB 3GB0A 2E66A 1Y5NB 4I6WA 4DFJA 1VMBA 4J9MA 4RW8A 2PA8D 1U45A 5F8IA 2R7SA 2AJ0A 2I0XA 2ZZNA 4I7FA 4C0BA 2VG7A 4EO6A 1I1GA 2LEPA 5HP1A 3FQLA 3R3TA 3W2WA 1FDAA 2UP1A 4HHJA 4DG1B 2FPHX 4CCHA 4WU2A 2D7SA 1SV5A 1X5TA 4HVZA 1S1XA 4B9SA 2HS3A 2IA0A 2J9EA 2B51A 3OTEA 3EUNA 3PM9A 3PW2A 3NCPA 4ZPAA 4IG0A 4Y2AA 2KM8B 3KKFA 3IWXA 4DDFA 3MTKA 2KH9A 1NJYA 3FSXA 2JWNA 3NAHA 4I2PA 2Y1IA 3MEDB 3SCIE 1JB0C 5LJ3Y 3H98A 1MMDA 5KT5A 1JLAB 4NRUA 1UFLA 4DUZF 3FCHA 4QR0A 3CJKA 1QAXA 1SIZA 1QUVA 1X4GA 5AE2A 3M2UB 2DH9A 4K4XA 3SQGA 4TXSA 3K5NA 2HFZA 3JB9k 3ITHA 2KFZA 4UY8T 3PEHA 2I2YA 2HQ3A 2EFGA 3J80Y 4PWDA 2JEJA 3BSNA 4C11A 2ZFHA 5KG4A 1HD0A 4CO2A 2J6SA 4ZP7A 2YKMB 3WC2A 1XBWA 2E29A 2VPZB 2HQIA 3I0RB 2QZ8A 1VK3A 3MMAA 4NXNF 2AYGA 5GADI 1YWXA 1WD6A 2KXFA 3LP2A 1V3SA 2HLUA 4MK8A 4IO1A 3PXGa 1ZH5A 2LXFA 4J5OA 4X66F 5BR8F 4K4TA 2W4PA 3TO8A 2XS7A 4DV0F 4A4JA 4DSJA 1YJTA 2F3JA 3AA9A 3P5TL 2IHR1 4X4PA 2NPIA 2ACYA 3MF5A 3JTNA 3SSQA 3DOLA 1RT2B 5GMKa 4AXIA 1HNZF 2G4BA 2VG5A 4CTAB 3FMBA 4YEAA 2AJ1A 3IAS9 4ECQA 1EP4A 3MTJA 2DH8A 3MM9A 3OQ2A 2XMWA 2ZUGA 2XLIA 4O44B 3PNIA 1U25A 4ZPVR 4WXOA 3TW0A 2KG0A 1L3VA 3ENVA 3KJVB 3CCJS 4B3SF 2B9XA 3DLGA 1PILA 2AF6A 2F7VA 4L72B 4TQSA 3SDEA 2C2RA 1JLQA 3LPYA 4NZ7A 1UJ6A 2LQ5A 5A8WA 5KG5A 3B8HA 1MU2A 3JSMB 3PFOA 4DV2F 4K4SA 3V81B 2KZMA 4NZ6A 2RVJA 4KE5A 4WYLA 2DR5A 3BGUA 3PX0A 2W7AA 1CEZA 3KYLA 3QIDA 3G8TA 2LKZA 4MKAA 1DQ9A 3WC0A 3MUVP 1RT6A 2MMYA 3HM9A 2EC0A 1VBYA 5GAHU 4ZPWR 1QM9A 2B4UA 4JI2F 2LVWA 3AAWB 1GAOA 4OL8A 1JLGB 3HLUA 2K3IA 4KR0B 1G6BA 3ISNC 3GIMA 2J7KA 5ADZA 2VQEF 1Q82T 3BSAA 2CKWA 4B3OA 2RU3A 3KLIB 2VG7B 2M2BA 1FTRA 4FVMA 3N6LA 4GO7X 1FDNA 4DQPA 3NP5A 1V3RA 4A46A 1XN9A 3DGPA 2YH1A 1SV5B 5F3ZA 1S1XB 3C6TA 3MGJA 2UVWA 5H9EJ 2MDAA 2UUAF 3MPYA 4HDGA 4NA1A 5FLXY 1N32F 3K57A 4IG0B 2PFFB 2CQBA 4DL2A 2CQ1A 4H4KC 4CQ1A 1HYSA 1SXLA 2R8HA 4G3IA 1FNOA 2KG1A 2Q43A 1S6UA 2IC3A 4LIRA 1M5HA 4IYQA 2VG6B 1UA1A 1C0UB 3CJ0A 1SKWA 2FJWA 4P7VA 4LQ3A 1TKXA 4GKJF 4TU7A 4USIA 3FEYB 2VODA 1TK8A 1T3NA 3DC2A 5DLFA 2POKA 3T1AA 3TNVA 3I9ZA 4PWDB 3IA0A 2J7WA 3V2UC 3CIZA 5HBMA 2CPJA 4E8UA 4Q43A 1L3KA 5T7LB 2RUGA 4ILLA 3C6UB 3MM8A 3IS9A 4IOBA 3MMAB 4MKBA 5A2QY 4ZHRA 4YDXA 1NZAA 1FK9A 4OX8A 3F44A 3LP2B 2P5VA 2VH7A 2DGXA 3IGVA 4K4WA 2JLEA 2QA2A 1HBMB 4J9SA 3BGFA 3MPVA 1BC6A 1T7PA 4HYKA 4DOZA 5CA5A 1AFJA 3MD3A 2QA4G 2HHSA 3IBWA 1TL3A 4KFBA 4B9NA 4F3OA 2YNFA 1KC8T 4PQUB 1VK8A 1JXLA 3IWNC 2J76E 3DHWC 1T95A 2Q79A 3QWPA 1Q8BA 4URSA 1R43A 2L08A 1VRTB 1XMBA 2FLLA 1LWFA 4R25A 5DQIA 1RT7A 1F0XA 4CH7A 1RTJB 3HX9A 5LSLA 3GFHA 2FUG9 3E3XA 1JXEA 2ZD1A 2LU2A 2LYVA 1S9EA 3BN7A 1YJ9S 5A8WB 2MJUA 3EGNA 2BR0A 2FGOA 4KV8A 3RAQA 4OQJA 2HIQA 2N3OA 3FVYA 1Q1KA 3OVAA 3KMSA 3CMES 1NU4A 4ZVHA 1D9DA 2DRAA 5J2NA 4DR6F 2D3OR 3PRBA 4CT9A 3OL7A 5J1PA 3D0IE 2X1AA 4NLYA 3H4DA 4OI3A 1T94A 2PN6A 2YKNA 5KG6A 1QE1B 5KT2A 3L7OA 3MR5A 2ZJRQ 3BB5A 1HNIA 1U2FA 1U7LA 1UFWA 2XC9A 1R27B 4CNZA 3RBEA 2MKCA 4NYPA 5BYQA 4QWBA 1L3SA 2OIHA 1KQGB 3HI9A 4DSLA 5L1IA 1CSJA 3K5LA 2QSWA 1OPZA 2CDQA 1JX4A 4HL9A 4GMKA 6FDRA 3D28A 5G0RA 1NAQA 3DRRA 5U47A 1QY7A 3HVRA 3MM5A 3PKMA 4JI1F 1X4EA 1KHVA 3MZIA 3BGRA 1TL1B 2RH3A 1VQ4S 1F5BA 2IVYA 3TUZC 1U09A 4FF1A 2J8AA 2XB2D 2IC3B 2DVIA 4TY8A 1YRUA 2F9DA 5IFMA 1URNA 2JL9A 4M5DB 4NCGA 2ADBA 2IM1A 4OZ5A 2RU9A 5DETA 3FZ2A 5KG0A 3QO9A 2JVOA 4KHRA 4FF2A 4PPDA 1AFIA 1OQ3A 2L41A 2PIIA 5A0YB 2K1RA 3ZFVA 3GV7B 5LJ5Y 1LWCB 2DGTA 2B5JA 3G6VA 3PW0A 1OO0B 2XWYA 3IS9B 1N6QA 4OLPA 3LUYA 1U47A 4NLVA 1IXKA 1MMLA 1QTMA 2NS1B 2E9TA 1ROFA 1XNQF 1TL5A 2WRMA 5CYMB 3MI7X 4RU2A 1S1WB 3Q0AA 2IRXA 4IO9Q 2Z8QA 1JWWA 3TANA 2V9WA 3DRPA 2YNIA 3OSNA 4CH0S 4IR1A 1DLOB 3OR1A 4FXWA 2N3LA 3MUTP 4ALZA 4O3OA 3T3FA 2YNFB 4I6AA 1X4BA 2KZZA 1HQEB 4H4KA 4LF9F 4DMZA 2MZRA 4B9UA 2RF2A 4FBUA 1KTQA 1IKYA 2D1CA 2FJBB 4RLEA 3HHLC 1IUJA 1U1OA 4ZPDA 2MY7A 1HL6A 1FO1A 3OFFA 7FDRA 2HPUA 1C1CB 2GIQA 1R8CA 2HS0A 3UCUP 1MW7A 1F9FA 2N7YA 3L09A 1M0SA 4RW7B 1R8PA 3N6NA 1S1TB 1FD2A 1TKTA 4ES1A 4F4WA 3I56S 2P9GA 3KLEB 4NLSA 5E5NA 3MEGA 3GE9A 3AQPA 3VF0B 2DGQA 4I69A 5D4OA 1NK4A 2IVFB 3IWLA 5J2NB 3U1NA 3KLGA 1RI7A 2QE5A 2HZCA 3CSKA 4TY9A 3AY0A 4URQU 4OMFG 3M32B 2FVSA 2IYGA 3CC7S 1HD1A 4H4MA 4WFNQ 1K1QA 2YKNB 2ILZA 3Q24A 3IO1A 3TA1A 3OXGA 1TKZB 1UVNA 2RS2A 5HQ8A 4XAKA 3CC4S 4AUKA 2YWFA 1RKIA 4RNMA 2XI3A 1YQHA 3M6UA 4IH5A 3QZ7A 3M9MB 5JVHQ 1HBOB 3MM7A 2XSFA 1TFWA 3MEEA 1N5VA 2Z2LA 5G0RB 1W2IA 1JLCB 3MM5B 1LK5A 1MROB 4QPXA 5LMNF 4EUVA 4IRKA 4FBTA 1VQOS 3B78A 4OJHA 2K8GA 4IFYA 2OPRA 4C8MA 2YY3A 3S01A 1SJFA 2WK4A 1G1XA 1LXJA 2B6AA 3JTOA 4NMLA 3GZ7A 2MKKA 4P6QA 3HP6A 1N36F 2E5GA 1B0VA 3M2VB 4TN2A 2C22A 2D41A 3QYYA 3HHNB 2AX0A 1WF0A 2RJZA 3DOKA 4ILMA 1VQSA 2PGCA 4PWUA 2KVIA 3VZHA 2HGNA 4PCQA 5I42A 4OHZA 3J7Z5 3PDNA 2B5JB 4J37A 3G71S 2PSZA 2Z0GA 3DRSB 3GV8B 4PG6A 1WTFA 1M5KC 5KG3A 3CGIA 2RQKA 2ZHOA 3CPWR 1RTIA 1ZTWA 2EWHA 1KQSR 2HFNA 4R8UB 2HAIA 1C0TB 4TU8A 1Q81T 1QUPA 4ATNA 3HT3A 1PO6A 2GMHA 4AYBD 2ZH4A 4URGA 1VHFA 4DR4F 1T03B 2O5DA 1IR0A 3RTVA 3VTIA 3PIPQ 3NBPA 2NPFA 5K5MA 3DRPB 1REVB 2YNIB 3SEOA 3U7JA 3KHLA 2W8LA 4Q0BB 2O3DA 1S6QB 5CCMA 2GHWA 3OR1B 4LSLA 3T5HA 1JJ2R 4MYTA 1DURA 2EI5A 3OXLA 4C3KA 1B7FA 2VL1A 3MDFA 2OLWA 4JBCA 5B0BA 2JDJA 2JFDA 3DXBA 1M90T 1D0EA 2ROEA 3TAQA 5HL7Q 3BN4A 5LXYA 4QQBA 2R9LA 1LW0A 5D6GA 1VBZA 4TYBA 2HHUA 3QLHB 2GQ2A 5F9LA 3U1MA 4EU0A 3V4IA 4X4SA 2ZC4A 3MEGB 4CO0A 4TKTA 5IT0A 3UR3C 3AH6A 1ZM3A 1DQ8A 2UUTA 3I32A 4R5PB 3BDPA 4LF5F 4F4ZA 1R8BA 2RILA 1CQNA 3NGDA 4OZJA 5E41A 1WF2A 4I2QB 2K7JA 4H4MB 3PJXA 4NLXA 5A8RA 3PY8A 1RKJA 1WACA 4KAIA 4LSNB 3O1LA 3SXLA 5KFFA 2N7CA 4DPOA 1FRXA 5KFOA 4EEYA 5KFVA 2V4RA 1HI0P 1R7IA 2BANA 2K2PA 2XO7A 2BUNA 3FFIB 4RW9A 2QO3A 1KTVA 3TUJC 4Y2IA 4CI0B 4HT5A 4WJBA 3BM7A 1T3OA 4ZMMA 4GC7A 1R0AA 1XC9A 3E2EA 1S4FA 5IQ6A 2MSSA 2CQCA 3HHLA 1X5SA 5B0DA 2R2RA 4ECYA 4KB7A 1E6VA 3SV3A 1FERA 3HZGA 2CVEA 2OPRB 3G86A 4Q7AA 3P3DA 2Y1JA 1PGZA 2I38A 2IA6A 1M5VC 1HMVA 1RT4B 1VC5A 3V6DA 3LH2S 1J5OA 2M8DB 4ZPBA 5IT9Y 3KMQA 3CCSS 1VI7A 3HVTB 2C3PA 3UW1A 2KU7A 2RQCA 4DSFA 4JI7F 4J9NA 4O0IA 2UV8G 3MHYA 1QVGR 3DM2A 1FHTA 1ZZNA 5EHHA 4RBTA 3ETOA 2CPEA 4DR5F 4L3NA 5KG7A 2B4OA 1IQTA 2GV1A 3R5BA 2R2SA 2BJDA 4FZVA 4UUWA 3EZUA 3D0GE 3U1LA 1IN0A 3VQTA 4DLEA 5KFRA 2E5IA 4WZMA 1A7GE 1UL3A 4L6V3 1DJ0A 2IRUA 5EX0A 1TVRA 4KHPF 4EZ6A 4ZS6A 4CO5A 3OJUA 2XNRA 3NNHA 3POTB 2HGMA 4PUOA 4AL5A 2DNRA 4NYOA 4G1QA 2O67A 3BS9A 4RNNA 3KTQA 3M1VA 4B3MF 2ASLA 2E44A 3PIOQ 5KFJA 1WG4A 4KPYA 3G4SS 3BR9A 2GIRA 3M05A 4PXBA 2E1MC 5A6PA 2R8GA 4IOAQ 3UD4P 5KFBA 2V5HG 3TARA 2R7TA 1BD6A 1NKEA 3VAMA 1D9AA 2AV5A 4FS2A 1HW9A 3K2YA 2FC9A 3MECB 1APSA 4IRCA 2QLXA 2ZDOA 2D9PA 3RW7A 1NHUA 1GH8A 3M8PB 4O3NA 3WBZA 2MQOA 2RQMA 3M6VA 4QBUA 3PR5B 2ZH3A 3M30A 3OR2A 1YI2S 4LF7F 3SZ2A 2VV5A 4ETXA 1M5OC 3V5RA 3PFEA 3DMJB 3SCKE 4ZCMA 4RWXA 1FXDA 2KT3A 3N6MA 2J9DA 4NLQA 2OP5A 2ZVSA 4N8NA 4F3QA 1S1UA 1JK9B 5A8RB 3Q8PB 4IFVA 2XY5A 2RDJA 1EETB 1UJ4A 3MOJB 2X1BA 3DLHA 1PC4A 2BQRA 3TRGA 4X62F 4EO8A 3KHGA 4DV7F 3KNGA 5F3TA 4RNOA 1XR6A 5L1KA 1YG0A 4WCEQ 2BRLA 3CCRS 4MFBB 4C97A 3P6YC 4DSIA 2CVIA 4RW9B 3D2WA 1KOOA 4KBIA 1YJVA 4MJKA 4OI2A 1NH8A 4DL0C 2ZH7A 5K9FA 4TU9A 1WI8A 2B7BB 2XZWA 2MQMA 2X3GA 3UE2A 4ZDNA 4NPOA 5GAGU 2LMIA 4DL5A 2HHHF 3TUIC 1N5TA 2RS8A 3JAMY 4IOCQ 3N5BA 4WTYA 1ULRA 4O3QA 4F26A 1N5SA 3VCDA 1FRLA 4YDDB 2E5LF 3ONQA 2HHVA 1VQNS 1SUQA 1U1KA 1VQ6S 2U1AA 3AQOA 4ILRA 1VIXA 2A3JA 3FJ2A 4NL5A 1E6YB 2HNZA 1C4AA 2WBRA 3GFZA 2DIVA 3OL8A 3I9V9 3D54A 3AJ2A 3JTPA 3GIJA 3X3UA 3NRBA 4USHA 5J1EB 2RKIA 2B56A 5B0EA 1LW2A 3QGHA 1HWLA 4H4OB 4K0KF 5C42B 1Y9OA 1FJ7A 3SSRA 3FRYA 4Y2KA 4MK7A 2AP6A 4CIOA 2E1CA 2KTQA 3DLKA 2IAJA 4AE5A 4ED1A 3RAMA 4HI2A 1VRUB 2UXCF 3NNCA 5IQQ