1WJ9A

Crystal structure of a crispr-associated protein from thermus thermophilus
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
211
structure length
188
Chain Sequence
MWLTKLVLNPASRAARRDLANPYEMHRTLSKAVSRALEEGRERLLWRLEPARGLEPPVVLVQTLTEPDWSVLDEGYAQVFPPKPFHPALKPGQRLRFRLRANPAKRLKTPAEKVAWLERRLEEGGFRLLEGERGPWVQILQDTFLEQVQAVLFEGRLEVVDPERALATLRRGVGPGKALGLGLLSVAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords CRISPR-associated protein
publication title Crystal structure of hypothetical protein TTHB192 from Thermus thermophilus HB8 reveals a new protein family with an RNA recognition motif-like domain
pubmed doi rcsb
source organism Thermus thermophilus
total genus 49
structure length 188
sequence length 211
ec nomenclature
pdb deposition date 2004-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08798 CRISPR_assoc CRISPR associated protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1200 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Crispr-associated protein; domain 1 1wj9A01
3.30.70.1210 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Crispr-associated protein; domain 2 1wj9A02
2Y9HA 1WJ9A 3QRRA 5H9EK 4U7UD 4DZDA 3QRQA 5CD4A 2Y8WA 5H9FK 4QYZK 3QRPA 2Y8YA
chains in the Genus database with same CATH superfamily
4TQRA 2ZUGA 2UUWA 1VHFA 3CMAS 3SV3A 3LGHA 3UCZP 4H4MA 4WTYA 4KPCA 4RNOA 4BLGA 4I2PA 4KC5A 1J27A 1X4CA 5KG2A 1RA7A 3RUBL 4OYXA 2FJWA 4S0MA 4QWAA 1X8DA 3I9V9 1QSSA 3M9OB 3A3OB 1P9YA 4LSNB 3LWLA 4HTIA 2Z0GA 5KFLA 2GW8A 1N34J 4M8LA 1Y3KA 2G4BA 2XS2A 1AXQA 2AGOA 4F3QA 2B9XA 1KQSR 2AMCB 1M0SA 4IYQA 3S01A 4ANCA 3LP2A 2VG5B 4B9NA 4ZITA 3W8GA 2ZEJA 1BY9A 1Y3JA 2GVZB 2C3PA 1S12A 3MCNA 1RISA 2HFSA 4QWCA 3GP9A 3OW2R 1XMQF 3R6GB 4Z7YA 1DQAA 1S76D 4LREA 3KK1A 1S6QA 5DJBA 4URQU 5KFAA 1TFWA 3TA0A 3C14A 2HNYB 1SKSA 2KRBA 4Z37A 4E2FB 2HVIA 4DFMA 2E1RA 4ZVEA 3JB9k 1PSDA 3VV2B 3H2VE 4WFXA 2DRBA 3C6TA 4ECZA 9RUBA 2H51B 3DOMB 1KONA 2C3MA 1NDCA 4UZBA 4DQIA 4ELUA 3H5SA 1NUEA 1T9VA 3QATA 5GMDA 2JDJA 3W60A 2Z4PA 5E2QA 5FDLA 2FLPA 2V8GA 2H5IB 5D4OA 3GU0A 3MM5B 4X66J 1GTEA 2JZ5A 1C0UA 4MMOA 2E5LF 4ZMMA 4LBPA 2ZH9A 2LVWA 2YKNA 1NMEB 4IRCA 3FUYA 2C3UA 1WEZA 2BRKA 2ADCA 2KZZA 3AA8A 4CWBA 4QPTA 2XY5A 5ETKA 1LXJA 4AE5A 3AB4B 2VQEF 2KZMA 4ZVSB 1KNZA 4OHXA 2XZTB 3FJ2A 4DQQA 4LF7F 1LOUA 4P71A 2BBEA 3TVZA 3DDKA 4NLQA 3DLJA 4U7UD 2DGXA 4A48A 4PQUA 4K4TA 4LBHA 4O0IA 1F9HA 3HFKA 1HYSB 1PILA 1S1UA 2JFKA 4F50A 2KU7A 1T0TV 3B8HA 2V6AA 3PYFA 4RWXA 1GK8A 4NYZA 1V5VA 4UOHA 5HQLA 4A8SA 3J81Y 2FZCB 3TUPA 2A2CA 2DB1A 5RUBA 4V19X 4IUFA 2CQPA 4LF1A 5ETRA 2OPRA 1DTQB 1VRUA 4XDCA 2BKPA 1SJFA 3ENVA 3G82A 4JP8A 8AT1B 2V4JB 1U2FA 3GSDA 2F1FA 1X4GA 3AXKA 4JI3J 1I3OB 1QVGR 1NSKL 2BM0A 2BJ3A 4F04B 2H3EB 4EZ9A 1WC4A 3BN4A 2OPSA 4P74A 1C4CA 1FRXA 1N33J 1ZS6A 4KY3A 4OYWA 3UPFA 4WTOB 4ECVA 2L3MA 3MPDA 4YR3A 2R7RA 3RG6A 5LM7E 5C42B 4J9SA 3MCSA 3OJUA 4LSZB 7AT1B 3OUYB 1NK6A 3H5UA 2HQ3A 2JWNA 4DR5J 4WFBQ 5A8WA 3T1YF 4YHHF 1N0VC 3MPWA 1JLAA 1FWPA 3BGRB 4P7VA 2X1AA 1VQOS 1K1QA 3I5AA 3D6FB 1KHWA 2CPHA 2XO7A 1KP6A 2XULA 2W7AA 3GYNA 3K8WA 2C2EA 3H0PA 1HI8A 1FCAA 2Z57B 3VQTA 5IM0A 1K44A 4DR4F 1TL7A 4WFAQ 1UPPA 1SI9A 2MB0B 1HI0P 2COLA 3GCWP 3Q86A 2BEFA 4LRAA 2O3DA 2LECA 1ZTWA 2IYIA 3IM9A 4RNMA 5HVHA 2IIHA 2W7OA 5J2QA 4YDDB 1W2IA 1WHWA 1GTHA 1NHKL 3A12A 2ZFHA 3T1AA 4QYRA 1NPPA 2L48A 3NXZA 3KK3A 1RAIB 4IFYA 1TP7A 3J80Y 2I5JA 5I42A 1FTRA 3LP1A 1GEHA 4NE9C 4F3OA 1RKJA 3CGIA 4KHRA 2V9KA 2YQ1A 4DV1F 3MUMP 1REVA 1KQGB 2GCFA 3DDNA 1U6BA 4ETZA 3CJ3A 2NPFA 2OD6A 2NYIA 2RS8A 2W2OP 2HLUA 2GQ2A 3NNCA 1OSCA 2ASDA 1OPIA 1YQHA 1RWWB 3QT7A 1S77D 3ZZYA 1Z2LA 4K4XA 2YNHB 2YH0A 3BN7A 1JLEB 2JX2A 1L3VA 1H0HB 2DIUA 1AA1B 6FD1A 1XQIA 3DLKA 3T9NA 3I0SB 2BA9A 2OLWA 3BBBA 3RRGA 4NLYA 4P2MA 2LQBA 2Y9HA 2BMBA 4FNIA 3N5BA 4QOTA 1T05A 4MKYA 2BRLA 3PTWA 2EFPA 3RTVA 3DC2A 5ITHA 1RTJA 1SH3A 2NZ4A 5LJ3Y 1HBMA 3GFYA 3TQ1A 3BQ0A 2MQOA 4JYAJ 2CPZA 1YJTA 1BQXA 4KHMA 4TN2A 4O3NA 3BPSP 3J7YI 1XMOJ 1Q8LA 2FD2A 2P5VA 1K8AT 3FGVA 4K50A 3KKFA 3DGPA 1XC9A 1O0PA 4HI2A 4U8YA 1PJ7A 2ZDPA 3KHRA 5FD1A 1BC6A 2LP4A 4RUAA 2PA3A 3MR6A 1KHVA 2YKQA 1L5UA 5CAAA 2E29A 1YBAA 1LKZA 1MG7A 2DYAA 4LVOP 1XWLA 1IM6A 3L7UA 2WBRA 2E9ZA 1RAOA 1WC5A 2BKOA 1X4AA 2Q3PA 5K9FA 2JEIA 2QRRA 3JAMY 2DISA 4A8FA 1LWFB 3CJRA 1DHMA 2NXUA 2CQ1A 4L76A 2J9CA 2XM3A 3FBBA 3FBEA 2EWHA 4ZIWA 4KKOB 1KD1T 1MMLA 2HNZB 1NAQA 1GMUA 4WXWA 2RU3A 5E3AA 3VGVA 1G1XA 4BBYA 4LF8F 4PCQA 4ELTA 1NH7A 1RHUB 2OTJS 1RKIA 2JFDA 3EJMA 4U96A 2PFDA 2YWWA 1YWXA 2NS1B 2F5GA 4RW7A 3RRHA 1NM2A 4LMZA 4YB1P 3MM7A 5F3TA 3BO3A 3BDPA 3MMCB 4RX6A 3TEGA 1TKDA 3IWXA 3CC4S 2W01A 1FD2A 4QJVA 4KGZB 3R2CJ 2R7XA 1PYTA 2J0SD 5DM6Q 4N47A 3ET6B 3KXDA 4CH7A 3KLHA 4A46A 3MZIA 3PJWA 5DGBA 3LP0A 3GLJA 2BJ9A 4DPWA 5HN0A 1EP4B 1JNZB 4N41A 2OPQA 1XR5A 4B9SA 2HHVA 4PWDA 2HBYB 5IFMA 2F65A 4ILMA 4B9UA 4TYBA 3A8JA 1GT8A 5E41A 1M1KT 1F6TA 3CCUS 4ERDA 1WSVA 2MJNA 5IT4A 2BZ2A 4Q5VA 5DZ7A 3GZ7A 1NLKL 2IC3A 3IXQA 4DSIA 3VQSA 2ZOMA 3AJ1A 2XSFA 3WIUA 3K5PA 2VDIA 4ED6A 3W65A 2F4VJ 1TU0B 2GVDB 3IWNC 4M5IA 3POTA 2KM8B 2RRBA 3M8PB 1N54B 2O67A 1FKAF 2XMWA 2G1HA 2ZWPA 2LYVA 2ZH1A 2EVZA 3Q8UA 4J9QA 3KG0A 3HZGA 2MQ8A 2GGPA 3RU0A 1S0NA 1T9UA 2B4UA 2KM8C 3FMBA 2YWHA 3K57A 3OVSA 1U1LA 4PZVA 3H90A 5DZ6A 4RW4B 2OJ3A 2NUHA 3D4JA 3AD9C 2DHXA 2ZOFA 5BJRA 4Z2XA 1SPBP 3OL7A 1RTDB 5A2QY 4NX9A 2FYXA 3MEDA 2KH9A 1DFDA 4NA1A 3D9BA 3KLEB 3EVMA 1BWEA 2VB6A 3B4MA 4ZVOB 3WBZA 3AH6A 2Z30B 2CZ9A 4PG8A 4DX6A 1S6OA 2HFVA 3FKBA 3UD3P 5BYRA 4IH7A 1HNZF 3EX7B 2I1RA 3CE8A 2F63A 4ECUA 1YGYA 3GV8B 5B0BA 1VQKS 3GQCA 1AFJA 2JJ4D 3K0JA 2VU5A 1J5OB 2GMLA 1Q86T 3PYGA 2MKJA 3JSBA 3L3CA 3TA1A 4DL4A 2V5HG 1S7HA 3HVAA 3IGNA 4N7TA 1FX2A 5K8OA 5IOLA 3MM8B 2BUNA 2OEMA 5D4LA 1M1GA 3NCPA 2CPEA 1HNXF 1J2VA 4C0OC 4K4ZA 1MWQA 4DBQA 1RT1A 5J2MB 5EN1A 4GKJJ 3O5TB 3MPVA 4AXJA 4LFAF 3THTA 2DGVA 2BOPA 5HATA 1U09A 3R6LB 3M30A 4USIA 3KDOA 3UW1A 3ZZTA 2DR7A 5ADZA 3T1HF 4DDFA 2AYBA 2PI4A 2MGZA 3ITHB 1T03A 1RU1A 3C46A 3HSGA 4NEZA 1RA6A 1PAEX 5B0FA 5MAOA 5AXKA 4EMDA 4DXLA 1SQEA 2QC3A 2B56A 2AF6A 1DTTB 3OR2B 1TR0A 4FXDA 3I4PA 3M32B 4DFKA 3G8QA 4BC9A 3ADAC 3DU5A 1JXEA 4CTAA 3FEYB 2H1YA 1OYDA 1MMNA 2CXEA 5HVGA 5HP1A 4DSKA 2Z2LA 2VPZB 5F8NA 3E3XA 2XY6A 5K8NA 2M70A 3D6TB 2Z2ZA 4A47A 5KG7A 4OI6A 3Q23A 4QZVB 1UZHA 2ZZTA 3KLFA 1AB8A 4AXIA 2RRNA 4H4KC 3LA0A 2MLZA 1TTHB 2R9LA 2HAFA 2P6SA 4J9OA 1YRXA 4X65J 1KOHA 1JLGA 1Z4UA 4C3LA 4BDPA 1UVMA 3FCHA 2ZBIA 2KL8A 1X4FA 2QIFA 1DRZA 3DXBA 4NPOA 1JLBB 2VFUA 1G3OA 4MYUA 2CQBA 2XYGB 3MF5A 3HT3A 1B99A 3KJVA 2ZJRQ 1X60A 3UN2A 3QBCA 2CJ9A 2CWKA 4KRWA 3NKYA 7FDRA 5IV4A 1RHMB 1EZZB 4B3RJ 2GZOA 3RW7A 2RVJA 4F2SA 2LCWA 3FCWA 3VAKA 3US5A 1NJIT 4PKDB 2XGPA 1CJUB 1IWAA 4RW8B 4OX9F 2L9WA 4I2QA 1UETA 2JSXA 3NNAA 1EETB 2ALYB 3MM6B 3SCLE 3DRRA 2R7TA 2C42A 1PBAA 4X4QA 1RCOB 4E8UA 1IVZA 1BHNA 1HL6A 2VQFJ 2AW0A 2W4PA 2R2TA 4Q8EA 4DF4A 4OYZA 1VLOA 4NA2A 1M5HA 4ID8A 7FD1A 5EUHA 5ETSA 2KG0A 3PW4A 1ZAWA 4CO3A 1SJ1A 3OVBA 3BSNA 2FJAB 3NWRA 4DR7J 4J9PA 5CYMA 4IRDA 2A1BA 2YNFB 1HD0A 4RUBA 1T8EA 5T7LA 3QIPB 2CJQA 4QCLA 1S5ZA 3RBXA 4HHJA 1B3TA 4OZ2A 3TZWA 3S7RA 2LKZA 2FVSA 2IVFB 4B3TF 3LOUA 2GQCA 4O4GB 4EEYA 3AQOA 2XYPB 6AT1B 1CJVB 5J1EA 2C2KB 2DNHA 3D28A 5BR8J 2HHHJ 2OFHX 5GAHU 1J5EF 4NXMF 3ZTOA 3KDNA 1VQ6S 2NREA 2R7SA 2D3OR 1JNRB 5CD4A 4LR8A 5D6GA 3HHLA 5AJ3F 4F4KA 3FC9A 4FYDA 1H72C 2GJIA 4CLLA 4Q7AA 2KYZA 2PEBA 5SZTA 1RTZA 2FHJA 2WVDA 4N5SA 3E51A 3NAIA 2BJ1A 1XBWA 3OBIA 5A76A 3HCXA 1N5TA 1ZAVA 3IG1B 4QR2A 5DQGA 1XMBA 4H4MB 5CH7B 5CQGA 1KDNA 3QZ8A 4B3MJ 3V2UC 1N48A 3F44A 2KJVA 1N52B 4CLWA 5GAGI 3OJSA 1FDNA 4ED3A 4L6V3 5KFRA 5K14A 4ZPDA 3M2RB 4WYWA 1OS5A 5DS7A 2PMZD 2W7PA 4DR3F 1GH8A 4QR1A 3BR8A 4CNYA 4W4MA 3TWZA 4K0KJ 1VQ8S 5IZHA 4WWSA 1S0VA 1YX2A 1TK0A 4MH8A 5EWEA 4UOGA 2C3OA 2DGSA 1DARA 4UF4A 1RT3A 1U2RA 1FDBA 4RU2A 1ACMB 4JI6J 2DR5A 3B54A 4P9SA 3U7JA 4YR0A 4LIRA 3CCMS 1UCNA 1FNXH 4GMKA 3IM8A 4Y2AA 2U1AA 1U25A 3S6EA 4C97A 3Q8SB 1WHVA 5KFUA 3KK1B 1S6QB 2JVOA 1UTAA 2VG7B 1IBLJ 2ZHAA 3IBWA 3VAMA 2EC0A 1W25A 1D9DA 3IGVA 2XZDB 2ACYA 1KKHA 2OGUA 4MK8A 4M5KA 2JLGA 4ECXA 3K5MA 4NLTA 1FESA 3PEHA 2WONA 4NWBA 2ZVIA 1G4CA 4WIIA 4RW9A 1UJ4A 2CVEA 4KIAA 2QMUB 1YRUA 2IVMA 3H5XA 2R4FA 2P6TA 4B08A 3D66A 1MN7A 4EYIB 4KGXB 1HQEA 5HLFA 2SXLA 1TKTB 2UXBF 3MI7X 2H5JB 5CD4H 2KT2A 2YKNB 1KFSA 2LEPA 2E5GA 4DZDA 2VFTA 3IAM9 1Z1ZA 5IT9Y 2XNQA 4NOHA 3OTOF 2ZM6F 4K4VA 2N4CA 1CJKB 2BANA 4QWDA 4DF8A 2J9EA 1S1WA 3ZZOA 4DG1B 3FSIA 1IJFB 2OPPA 2CAJA 4H54A 2DEIA 3T5LA 3GPAA 3C16B 3EPIA 3TUJC 1CJTB 2ZITA 2AGQA 2D3UA 4UTGA 1QAJA 3O44A 1IQTA 1OIAA 1S1UB 4AL6A 4DQRA 4ZS6A 3U02A 1WG5A 3D6MB 5K20B 5KG1A 3C15A 1DZ5A 5IC4B 3H4BA 5DM7Q 1HNWF 3W3SA 4W90B 2F40A 1YTYA 4DOZA 5L46A 4J90A 3ISNC 4X4PA 1NK8A 3PW2A 5L39A 4ZHRB 4KT0C 2X1FA 5E3RA 2BJEA 1VISA 3MTKA 2OPSB 2E5LJ 1SXLA 4GRSA 1V3RA 5EWGA 1TQLA 1YDLA 2CQHA 1X9WA 4XAKA 3KTQA 3ICLA 2A3JA 2FLLA 2E7VA 4NCAA 2HVZA 1JLQB 2XBPA 2QL5B 2BX6A 3P49B 3GB0A 3TVYA 3DHXA 4RNHA 4USTA 5FIIA 2XWYA 2VQEJ 4M5LA 1U0HA 1BGXT 2QFIA 4LF7J 4OV6A 4M5MA 5A8WB 2DKOB 3GWCA 3WX8A 3J7AN 2BW2A 4QYZK 1NEEA 3M8YA 1MROA 3SEOA 2AJ0A 3QZ7A 1BQNA 4IO9Q 4RZRA 3JQMA 2UXCJ 2IRXA 4KH0B 3ENQA 4J9KA 3OXLA 3PFEA 4YQWA 1WC0A 2K1RB 4I7FB 2IM3A 1TL7B 1WC6A 2IMWP 2IA6A 3G6ES 3G87A 1UZDA 5DG7A 2NSCA 4K7QA 3F0NA 3S1TA 1CVJA 1S0OA 4NLXA 3JQKA 3HFZB 5C7PA 3CJ4A 2DNMA 1LWEB 3GR0A 2DNZA 4TY8A 4CYUA 1W7WA 1JLCA 2BE9B 1K0VA 3GJTB 3LP1B 4LQ9A 3LW5C 4OYBA 3GG1A 1R6YA 5A8KB 2HNDA 1S1VA 3AD7C 2KT3A 2YKPA 1FJGF 3OVAA 3HHEA 1TKZA 4YHHJ 4CIOA 1UA0A 3CD6S 3QSIA 1YJ9S 1GAOA 4IKAA 3PACA 2PMWA 2E9RX 4DEZA 2C2NA 3B4DA 1FRMA 4LFBF 4KE5A 4YR2A 1WF2A 3CJQA 4K2XA 1IR1A 3CDEA 4DR4J 2DHSA 3C66A 2ZKTA 3E01A 2W9BA 2AHOB 5DDRC 1SV5B 1RHKB 3N01A 2MYFA 2FVQA 4HT7A 4P73A 1HBOA 3M2VB 3DYAA 4CH0S 4I56A 1PGZA 3DKDA 2XLJA 2YTCA 4PQAA 1IN0A 4Z7CA 1M5OC 4NA3A 3OXFA 3VGSA 4DV0J 1R89A 1L3SA 5IWAJ 3GONA 1WG4A 2VOOA 4B3OA 2VKZG 2AYGA 3F73A 4A8QA 4DV1J 3DRXA 3GYGA 2NXNA 4HH1A 1S1TB 1C4AA 2CQ0A 1FA0A 2RILA 4ZVUB 3RR8A 4DV6J 2JLFA 1F2HA 4CP5A 1TL1A 3W1YC 1RWNB 4QR0A 4ILRA 4LVNP 5KFFA 4URGA 1HARA 3CTRA 3ZTQA 4F4XA 5HROA 1N6QB 1IKYA 2G13A 2MSTA 4DL6A 4F0HA 1A7GE 1V6HA 2C2MB 4OZ1A 1VBZA 2ACMA 1EKRA 2VKRA 1FWLA 2J7KA 2Y3YA 1JIHA 1N5QA 2A2DA 5LJ5Y 3W5XA 4GO7X 1WTBA 2CWXA 3N6NA 5B0CA 4IRKA 8RUCA 2ZH8A 3PYEA 1Y10A 3R3TA 1I5OB 2AU0A 2XNRA 4PXCA 1H98A 4KBIA 1CG2A 4ES2A 5KT2A 3MFHA 4Y2MA 1HMVA 4J9LA 1VJWA 3W2VA 5CA5A 1ZM2A 2ZBQA 3DCAA 3WIVA 5LSLA 3NMRA 5D0RA 4RW7B 1ZH5A 1YRTA 4W92B 3DOKA 4WP3A 3HKWA 3G9CA 4X4UA 1NU4A 3D6HB 5D3GB 4OZ3A 3MM7B 5M2UA 4FF4A 3T5KA 5L1JA 2QSWA 2B0GA 2YVSA 1AZSA 1SB6A 3TZYA 1PBUA 4X4NA 2HGMA 3IR7B 4NEYA 1YJ7A 4LRFA 1NJYA 2A18A 2FHMA 4LBIA 2DY9A 1KVKA 2XEXA 2IFXA 4ZCLA 2EK6A 1CEZA 4X4TA 2ZZNA 2LXUA 3HHNB 1RT4A 1SQFA 3N5FA 2Q79A 1ZBTA 1X9MA 2CQ3A 5AT1B 3HD2A 3ZO7A 2CQGA 3DLBA 3CT9A 4PWDB 3LPYA 1S49A 3OXGA 3BR9A 3MCMA 1PJ6A 1OY6A 2FJEB 4JV2A 1D9AA 4R5PA 3KHLA 3OL9A 3MM9B 2M52A 3BKUA 4LF8J 1U24A 5EGYA 4P10A 2I9SA 1VYAA 2D7SA 5KFKA 3JTPA 3VF0B 3H20A 1VQ4S 1UVJA 4KSEB 3N4WA 3BJYA 2BVZA 3MD3A 1NRKA 1FJCA 1UW9A 4ZP7A 4UW2A 4NRTA 3LUYA 3EGVA 3RB0A 5ETTA 3PJXA 2CJAA 4FBUA 3AB2B 3R97A 5IC6B 3JQJA 1H2TZ 4URSA 2HGLA 3HP6A 4LRCA 3HJFA 2BDPA 2E9TA 5T41A 3EDQB 4L75A 4TQSA 3D1HA 1HNIA 1RAEB 1XNQJ 2HS0A 2ZH6A 3GFXA 5HI7A 3K5OA 5KFQA 3OLBA 3BSAA 4Q2MA 2VBWA 2F4VF 3CIZA 1FDAA 1HPZA 3Q24A 3R7BB 3GIKA 1WG1A 4OJ3A 2MQQA 2HYIB 3M8WA 3HI9A 2NXCA 1JX4A 4PUOA 3T3FA 5E7OB 2YNIB 2HVDA 3MEDB 4FKYA 3NG8A 4EFAC 2JC0A 1QJHA 2GAGC 2W9CB 2I8EA 2MZQA 1O51A 1RWMB 3N6LA 1ZA2B 4ZPBA 3KJQB 5F8IA 4U9RA 4HEA9 4P75A 4OI2A 2Y1IA 3NEKA 3I82A 4ZN1A 1FO1A 4Y3CA 3CPWR 3CJ0A 2HG4A 3UE2A 1S59A 1HWIA 2J7UA 4YB7A 2N4DA 4FZVA 4DS4A 2X1BA 5BYQA 2GJ2A 2J0QD 4M5HA 3IRWP 3RAQA 1ZPWX 2HMIA 2BV3A 3MECB 1RWPB 3CDBA 5HQ8A 4O3OA 5E0OA 3SFUA 3I0RB 1Y11A 3ZNJ1 4DPOA 1HWLA 2C2ZB 2FB0A 1RHQB 1UA1A 2JEGA 3OSPA 3W2WA 3VHQA 2YNGA 4HLBA 1U47A 1LW2A 3TUIC 3A13A 1NK9A 3AXMA 3M2UA 4Y00A 3LQVA 3PVXA 2HBRB 5KT7A 3RZAA 4DSEA 5F0WA 1DY3A 3V81B 1HBUA 3W9JA 2IBKA 4OLPA 2R42A 1RBLA 2V69A 1XK8A 1T03B 1FKPB 1M5VC 2NSBA 3F41A 4MIBA 2V9WA 4FF2A 2PDAA 3ZXWA 3AOAA 1QSLA 2A6OA 4F67A 4JI5F 1HNZJ 4M95A 1FXRA 4QWBA 1HR0F 1YJWS 5HVFA 1UJ6A 4C7QA 4YS2A 3FQLA 3GFZA 4MFBA 1RP5A 2N7CA 3PHTA 4EK2A 4CLKA 4USVA 1RTIB 3OFHA 1YI2S 2DT9A 5J2PA 3THVA 4IG3A 2DNRA 2ZNYA 1HNXJ 4ZVRB 1TUGB 1S6UA 1JWWA 5HJYA 3R5GA 5KOWA 4YN3B 1VGYA 2DY1A 4PPZA 5ETQA 4LFAJ 4WK1A 1MNEA 3TJAA 1FNOA 3G96A 1QLNA 2XMTA 2P8IA 2GC8A 1JMTA 5L1LA 3AHPA 1OMSA 3U1LA 2EBGA 3KLGA 4A8OA 1KEKA 2KHDA 3L7PA 4IH6A 3GMGA 4QWEA 4P2SA 3SCKE 3G86A 3L4BC 2RUGA 2GMJA 4F0MA 4PYDA 1KR4A 4I64A 4F3MA 1TV6A 3C3LA 1IXKA 3KJVB 2ILYA 3MEGB 2HRTA 3QT8A 2XLIA 1KLMA 2IAJA 1WI8A 2ERRA 4IH5A 1HI1A 5H1SV 1SJQA 3R7SB 1EQ0A 5C25A 2CPJA 2ZJPQ 1C1BA 3SI8A 4TLRA 3AA9A 2POKA 3DI6B 3V4IA 1BQMA 2AV5A 4OHYA 4NLSA 1WWHA 4LFCF 3CO0P 2HVHA 1TVRB 3FFIA 1HQUA 3PRDA 1FXDA 4G1QA 5F3ZA 2GA7A 4DUZJ 1RT2B 2VJUA 5B0GA 5KFCA 1Q8BA 4NRUA 2XCAA 1FE0A 2CJXB 1SIWB 2PE8A 3AY0A 3P5BP 4EYHB 3C6UA 1VIXA 2CADA 3PX6A 4FBTA 4P7TA 5I3UB 2B7BB 1U26A 1TL3B 2HHTA 2LU1A 3GTYX 3K17A 1IKVB 3DM2A 4J9NA 2QTWA 1IKWB 2YWGA 5T7LB 1U1OA 2VQFF 4O44A 3VVTA 4J91A 2YH1A 2IM2A 3D3CJ 1ELOA 4D3HA 2G1DA 4DX8H 1CLFA 1HW9A 2EW9A 2FUG9 4AT1B 5LXRA 3P5TL 3FSYA 3FRYA 1U1MA 5LT5A 1RE1B 3PX4A 1U0SA 4OX9J 3N9UC 3TJ9A 1UAWA 1OY9A 1RTHB 4ZLPA 4C4WA 2KJWA 4MK9A 4TU8A 3QGIA 1X4DA 3FEZA 2LA6A 2B5JA 4M1KA 1ZTTA 1RB0A 2A0FB 3AJ2A 4Y2CA 3BYPA 4PPDA 5H9EJ 5DLFA 3TZZA 1SH2A 4MIWA 5KT3A 5GMEA 3CF5Q 3LANA 1I6JA 5KAKA 4Y6IA 1PKUA 2FVPA 4NZ6A 4K4UA 2AD9A 2AJ4A 4EGLA 1SC1B 2W2MP 4F36A 4LSNA 2G2ZA 1RHJB 2G0JA 3QRRA 2OMOA 1VMBA 1N8RT 1NK7A 2ATLA 1QTNB 1CS4B 2E1AA 3LGMA 1IQZA 1R7IA 8ATCB 3PEJA 3DHWC 3MOZA 2QJ3A 2H5EA 1U4BA 2FJBB 3CCJS 3B6BA 4ZP6A 2P9EA 4K59A 2GVZA 1X5TA 2FVRA 4PXDA 2D69A 1X0PA 1N36F 1T9TA 5SUHA 3M6WA 4OI1A 2YX7A 1MWZA 4X2BA 3PX0A 1EIYB 3VAGA 1U1QA 2FGCA 2IJRA 3EE3A 3EYZA 1J5EJ 3JSMB 3UWTA 2HNYA 3UDCA 2L9NA 2OSRA 2OI2A 4QU7A 1RT3B 2IJNA 2HBQB 4U7UK 2J8SA 3DOMA 3CWJA 1UWAA 4I67A 3ILLA 5DO2A 4YOEA 2N3LA 5GADI 1H7WA 1N88A 1WHYA 4FF1A 2RIJA 3M1VB 5AE1A 3CO9A 3A8KA 1NPRA 3ZTRA 3EZOA 2VC1A 1D8YA 2KDOA 1WSRA 3D0HE 2JOQA 4ZLJA 1GFWB 1T94A 4XDDA 1JJ4A 4RW9B 1N5YB 2FZGB 4FP9A 4FVCA 2HQFA 1UKUA 3CMES 4DR3J 1I94F 3UQSA 1FRKA 2R3VA 2V2ZA 3MR7A 4ZPTR 2C2DA 3TUZC 3PHEA 1HYSA 3IS9A 1PC5A 5LOQA 1N5SA 5MLCV 1KVJA 3IWLA 3BV8A 1XIQA 5KG5A 3A1YG 4ZPAA 3A8IA 4USUA 2V4RA 2AYEA 2E5JA 5JJBA 3OSNA 1DTQA 2B3TB 1PG5B 3BS9A 4CCHA 1M5PC 2V4JA 1Q81T 3GFHA 1B0TA 2Y0BB 4CLYA 3HZEA 3H7HB 2FY8A 2Y0SD 1R0CB 1NSAA 5CYJA 2R2UA 1N32F 2CQCA 1UL3A 4DU7A 3HSJA 4NL5A 4C98A 2OO4A 3MMBA 1UEVA 3ZC4A 2CQDA 2QO3A 1P27B 3BPDA 2B9EA 4ZVGA 2EBEA 2DH9A 4ZJOA 1WC1A 3IR5B 5C42A 4C11B 1UVIA 3AODA 3OUYA 3G6YA 4RBVA 4UUXA 4X4RA 2DNQA 4XIUA 3O3LA 4P2XA 4OJGA 4PEOA 5HMYA 3TX0A 4DL3A 1H6KX 2UXBJ 3BGRA 4CO2A 5JMNA 1VR6A 4ECYA 2MZ1A 1U02A 1VIOA 4KGVB 4E0DA 3N0VA 2RHSB 3V6DA 3HVTB 3IFEA 4DPUA 2XG8A 1FX4A 1MLAA 3OTOJ 2J6TA 2ZM6J 4I4BA 3IRXB 4OI0A 1REGX 5A8RB 4BCAA 4HT5A 3QSYB 1U0HB 2VASA 4Y65A 2XC9A 2HS4A 2IJFA 5HO4A 4TU7A 4LRDA 2QX0A 3HK2A 1M1HA 3DLGB 3W5YA 3QJLA 3HJVA 4WPAA 3P96A 2RKIB 3BSCA 4DCOB 1RAJA 4N8NA 2AT1B 3M7VA 3W5ZA 3PW0A 1YHQS 1HIYA 3TI0A 4KR0B 5D78A 2Z2MA 1RT7B 2XMUA 2WBMA 4ZPWR 3RB3A 1TK5A 3BEGB 3GJQB 1UFWA 3FSXA 1IM4A 1HNWJ 1C0TA 3PR5B 2GNKA 1Q8IA 3A3PB 1YJRA 2CKWA 4ALZA 1UFLA 1AUDA 5KG0A 2I0XA 4OZ5A 2RF2B 5IV3A 2OFGX 2WVEA 4R25A 4TY8B 4AQYF 2UXCF 3D3BJ 2G2YA 2ZHOA 4CO4A 4R8UB 1V9OA 1IBKF 4IFVB 2BR0A 2QLJB 3HHKA 2B9WA 3K89A 2Z2YB 2YNHA 2IM0A 1QAYA 3NMAA 1JLEA 1QM9A 2KFZA 3QGGA 1FRHA 4CO5A 3BREA 3I0SA 4MJKA 1ZETA 1NB2A 4OV1A 4GC6A 1JLFB 4G65A 1IKXB 3I5BA 2F4FA 2UV8G 2V4QA 1O6XA 1LK7A 2GIQA 4RWWA 3H4DA 3RBZA 1YJVA 5BXIA 3CJ5A 1NK0A 2HHUA 1T9XA 4ECSA 3E01B 2W9BB 1U45A 1A9NB 5B0EA 4PRFA 4Q0BB 2KFYA 3FMWA 2C1EB 3M05A 2ATCB 2C28A 1NDKA 3CIMA 3HHDA 1RWOB 2QMWA 1D3WA 2HK2A 1YBTA 3V5RA 4ED1A 3NRBA 3R9LA 5K8PA 2DXEA 3VZHA 1FK9A 4DHVA 2W25A 1SUQB 3GG0A 1IR2A 3UDLA 2M2BA 3MXHP 4CLUA 1URNA 4CM0A 4FYYB 3P3DA 3NCQA 5AXLA 1QE1B 2R7WA 3BH6B 4JUZA 2WOMB 3DMJA 2XTJP 2L41A 2ZKUA 3TJ8A 2MY7A 3VVUA 2CJKA 1HBNB 1FJGJ 2NR0A 4F2RA 1TL1B 1VQYA 2E44A 5KFEA 5CCLA 3VWSA 1H7XA 4JI8F 4OIXA 2M8HA 1G6BA 2PFFB 3CJSA 1CQNA 1LWFA 3QGPA 3BGOP 4OZJA 1VBKA 4FN5A 1APSA 4MYTA 5HROB 4DV0F 4LFBJ 1IKYB 5IWAF 2H48B 1F9EB 1Q78A 3SQGB 2YPZA 2HNZA 4DL2A 3UN5A 4QU6A 2HPUA 2GIFA 1E6VA 4XK8C 4WE1B 4UY85 4DV6F 4AL5A 2OMLA 2WB1D 2YKMA 2F9JA 2WAQD 5K5MA 4ICLA 2KVIA 3CVKA 4ECWA 1S57A 1K1SA 4LF4F 1RADB 3CDWA 4DL7A 1VQ9S 1CULB 3L9ZA 1M90T 1DQ9A 1RT5A 2J8AA 1Q5YA 2VPXB 4HTJA 3J7Z5 2YPYA 2LU2A 1Y4ZB 2ZUAA 1TFYA 3WC2A 2ZVSA 1RLDA 1RYSA 1KWMA 2QA1A 3W2VB 2G0IA 4RUHA 4QIFA 3EM1A 1WI6A 1I1GA 3HVWA 1U1NA 1VQNS 3MAAB 2HKEA 1EP4A 3PKYA 1TAUA 3RB4A 1HFEL 2AJFE 3JS9A 2BM1A 5KFBA 4C8ZA 4DS5A 2MHNA 2EG1A 3L09A 2Y1JA 1AUSL 1JJ2R 2HIYA 2DH8A 4UOFA 5KFVA 1X5PA 2HQGA 2HGNA 2R8IA 2CQ4A 2GO9A 3T19A 4XPEA 3MAHA 4ATNA 2R8KA 4QIWD 4DI6A 3EVOA 5K8MA 1Q4RA 3Q8RB 2Q66A 2RDIA 1T3NA 2GVDA 3H2UB 3KK2A 3FVYA 2OIHA 3Q22A 1C1CB 2BJ7A 5HBMA 3L95X 2QV6A 4R5PB 3QWPA 2J9DA 3N28A 2O01C 3THPA 3D68A 3OL8A 4ES3A 4DV2F 1S72S 3NBPB 2B8QA 2ZC4A 4ZCIA 4NLPA 4WF9Q 1S99A 1LWXA 3D7SB 3ILIA 5H9FK 1LWCA 5AXMA 3MTJA 4RW4A 3RJMB 1WEXA 1RAAB 5D8HB 1UEKA 4PAAA 1WOSA 2KT5A 1RSCA 4DV4F 3RRKA 4IO1A 4LSLA 2UUCF 2FZKB 5KFDA 2AKWB 2ZWOA 4YP3A 4NLDA 2MKCA 1HNIB 3EXYA 2YWEA 1Y5NB 2ZE2B 4ZK7M 1U6ZA 3MMAB 4QIEA 3BYRA 4PG6A 5DETA 1RLCL 4USKA 5ETLA 2AJQA 4TNOA 5EWFA 5FJ4A 3K5LA 1NH8A 3DRSB 2ZHBA 1YZ6A 2YQ3A 4J9UE 1OJ4A 1YKWA 3WC0A 5E5NA 3PIOQ 2KKHA 2KTQA 2HW3A 4G6VB 4PUOB 1QAXA 5KFXA 1J5OA 3QO9A 1EB0A 1XNQF 1HQ2A 3SCJE 3UFCX 1LEOA 2E7XA 3MM8A 3DLEA 1ROFA 4FPIA 5KTQA 2HS3A 1VQ7S 2RHQB 2DNKA 1S9FA 1SKRA 1F9FA 5KFYA 5F8GA 5J2MA 1QUVA 3H59A 2ZJQQ 4MTPA 1R0AB 3MFIA 2U2FA 3CULA 3BSOA 2MZJA 2R7VA 4JV5F 1B4SA 2BE7D 3EGNA 5CZVA 2M0GB 1D0EA 2XSJB 3GIRA 1RXOB 2DJWA 3RGIA 5DQIA 2LDYA 3ITHA 3CJ8A 2FQQB 2XHWA 1VI7A 3ISZA 2K2PA 1PIEA 4WYLA 2YNGB 4ECRA 5HAOA 1YJUA 3QFHA 5KFJA 3I96A 1UVLA 1JQGA 2HQCA 1HNVB 3M4XA 3M8QB 3M32A 2ALZA 1UMJA 2J9DE 3UVJB 4PXEA 4UQGA 2ABYA 5M2RA 3SV4A 2QYGA 2CNKB 2W8KA 1ITPA 2DCUB 1FRIA 1GX6A 3ULHA 3OTBA 1LFWA 3AOBA 1RU2A 3AQPA 4N77A 2WSEC 2D41A 2F8EX 4B3SJ 4H4KA 1SKWA 1TKXB 1VBXA 1FTCA 1Q53A 2YWFA 4DPXA 3R1LA 3C19A 3GIIA 2AWZA 2LQ5A 5DDPC 4RLEA 5KG3A 4IR9A 1DLOB 3R5JB 3GE9A 3FRZA 4BC7A 1QD1A 1VCTA 4YUDA 1T02A 1NSQA 3PW5A 2PGCA 5LMNF 1HD1A 3W66A 3BGLA 1FRLA 2QL7B 3SSRA 4NXNF 5KFWA 2UVWA 2DPJA 1IR0A 1KBRA 4ZPCA 4KV8B 1WDDA 4YDXA 4C8LA 3BB5A 2XMMA 2XI2A 1URRA 1TUWA 3MD1A 4CZCA 4O3SA 4LRBA 1F5BA 4I6WA 2VL1A 4I0WA 1NK4A 1WF0A 4M5GA 1RWXB 2IRUA 2AZ3A 4A8MP 4L74A 3KNAA 4RW6B 3MMJA 3IR6B 3BBFA 2Q6BA 2FHKA 1SH0A 3ZZUA 2CZVC 2RAQA 3G8TA 3BO2A 2AGPA 2WHOA 3SFGA 2P2CB 1XJWB 2DBBA 1CJUA 4RW8A 3VGTA 5GMKa 1TV6B 1QUPA 4YY3F 1EETA 3D2WA 3MM6A 4JI5J 2CQ2A 1HR0J 1U1PA 5D4NA 3ZNUA 1MU2A 4K5SA 3HMJG 4I1TA 3Q2SC 1NHVA 2MMYA 3MEKA 1NKBA 4K4SA 1C1BB 2AZ1A 4KHPJ 1GX5A 2E66A 1VQ5S 3PFOA 3OHBA 1ZZNA 3GV7B 1X4BA 1K9MT 1NNDA 3QPIA 2KB2A 4ZVTB 3EXCX 2FC9A 1SC4B 2MKYA 4USHA 1KSPA 2R8JA 3FFIB 4CO0A 1HQUB 4ETXA 1BD6A 1HHSA 4WFZA 1P1TA 4G1QB 2PN6A 3MEEA 5B7WA 3M6VA 4HHUA 2DGWA 2MKKA 2BKNA 4OHZA 2BE2A 2CJBA 4P72A 4ID5B 3KUEA 4NASA 3C6UB 2HFUA 1Q1KA 4X64F 5CCMA 2LQJA 2WW8A 4O4GA 1KVIA 3T6BA 2CVIA 5F0UA 2E7WA 2JNJA 2UVRA 1CJVA 3GV5B 1MW7A 3DM2B 3K58A 2OEKA 3JSRA 2C2RA 4Q45A 3OLAA 1S10A 3RAXA 2YX1A 3Q0AA 4GKKF 1QTMA 4DUZF 2AX0A 5CHCB 2Z58B 4EBDA 4LUBA 3CW2C 3GSIA 3PRVA 2E1MC 5B08A 1WACA 2QLBB 1WNEA 2NYHA 1N56A 2OH2A 2CZ4A 5KFZA 2IYGA 1FD8A 2ZBRA 1WOOA 4F02A 2PI5A 4NLRA 4C8MA 9ATCB 4WKRA 3HX9A 5KFMA 2NPIA 2ADBA 3AFGA 4C8OA 4EU0A 5A6PA 1Q95G 4LFCJ 3NY0A 1N0UA 4B9VA 4CLTA 5FLXY 3IG1A 2QLFB 4KFBB 4FPRA 2B5JB 3BKTA 1XR6A 2UZAA 3QWUA 1SVDA 1WOPA 3NGTA 2RSQA 4KQZA 3ZTSA 3TAMB 3MCOA 1F60B 4LQ3A 1CQMA 4B9LA 1HHQA 3TO8A 3IBCB 2HRUA 3RB6A 4HHHA 4RR5A 2B9YA 3M2RA 1TL4A 2GMHA 2WVBA 1AFIA 4PR6A 3RR7A 3IAS9 5F9LA 1Y00A 4DUYF 3FZ2A 2DNOA 3TRGA 3W8PA 3A4TA 2BXJA 1ZM9A 4RO0A 2V94A 3X3UA 4OJHA 1NDLA 4EZ6A 1RUSA 2IY5B 3BQ2A 2VG6B 2DR6A 2RT3A 2GFFA 2VUGA 3E2EA 2ZDOA 5EX3A 4FXVA 1X4EA 1E6YA 5KFPA 2VG7A 3ENAA 3NNHA 1FEEA 1ULRA 4ECTA 2EK1A 5IQ6A 4LJMA 3OT9A 3MPYA 3CCSS 1H73A 2MHEA 2MZTA 1FDDA 4A8YA 3TAQA 5J2NB 1VRTB 2HK3A 1WORA 1RGVA 2H65B 2KVQE 1AW0A 1S9EB 1VK3A 2YQ0A 4M5JA 4CLZA 3UD5A 4MK7A 2V8PA 3TR5A 2IDEA 1TKTA 1TELA 5AXNA 4OZNA 2V8DA 4JI7F 1KC8T 3MOJB 1RZMA 1RAGB 5DG8A 3OL6A 2CNOB 4HACA 4Y34A 2B8PA 1S79A 2HLTA 2DNNA 1CJKA 3CJTA 4NCGB 4NYOA 4GC7A 4HKQA 4DG1A 1N36J 4MKAA 4J7CA 1XTZA 2O1PA 3R8YA 4L3KA 3C16A 5LL6d 2Q1LA 3SZ2A 1CJTA 3ZZPA 3G71S 2UV8A 4O3RA 3K59A 2DITA 3KLIA 4WKYA 3H40A 3VALA 2AEJA 4Q44A 2UP1A 1F5AA 1D9FA 2M5YA 1FWKA 3IS9B 2P9GA 4V19J 3IN5A 1R43A 1L3KA 4I2PB 2NUUG 4TVAB 2E5IA 1SJRA 2LQ9A 5JVHQ 1LXNA 3NLCA 5HQMA 5D0GA 2V34A 2UVVA 3DFEA 3HSDA 5GAHI 4OHVA 3SYZA 5KFHA 2DGTA 3SDEA 2CYYA 1S97A 5CZXA 3TEHB 4ZHRA 3MUTP 1F3VA 1VQPS 4OFZA 1S4EA 4P52A 3DOLA 2KO1A 3MMBB 1G7CB 5CXTA 3LP2B 4R0EA 1JLQA 3BF4A 3NS7B 2OP5A 1YLXA 2IHR1 1JXVA 3I87A 5KG4A 1UPMB 3TOQA 4I6YA 3S8SA 1YBUA 2LMIA 1X31C 1T11A 1C2PA 5KFOA 4DL0C 1I94J 3QJJA 3VR1A 3C14B 1LV5A 4WXOA 1RCXB 2B6AA 2VH7A 2H54B 4YFUA 2XS7A 3V6DB 1B64A 5D15A 2DD8S 1FEHA 3C6TB 1JKHA 3NGDA 5G0RA 2CFXA 2DO0A 2K1RA 3FZBA 4I7FA 2VBXA 2HZVA 5LMUF 3KWMA 1VFJA 5B09A 5FDLB 3PM9A 2CNLB 4OI3A 2CPDA 4RNFA 1YVFA 1SL0A 1FVSA 2M88A 1C0UB 4O23A 1NDPA 1LWEA 3DLHA 1N32J 4PYAA 1WKJA 1VBYA 3BQ1A 4OL8A 2OELA 1PAUB 4NLGA 1RK8A 2V8VA 5A8KA 4MAKA 1UWBA 2BQRA 1C0TB 3D54A 1NKEA 4NMXA 4CH1A 4TLQA 4TYAA 4ELVA 1NXIA 5CABA 4PQUB 3W64A 2CG8A 3CCRS 2EFGA 3VAJA 3J7YU 4F26A 3TYTA 3V6HA 3OPKA 2WK4A 5A6WA 3BGUA 3H8YA 1XNRF 4DX5A 1FFSB 3TX8A 1U49A 3QAEA 1YITS 3TW0A 4RNNA 3IBFB 1OPZA 3GJRB 4I69A 2HIQA 1Y0HA 1GXUA 2AYMA 2OPRB 1VRUB 2PD1A 5KFNA 1SV5A 3G82B 1KRPA 1D1UA 3PCOB 1RWUA 1CSJA 1KQKA 3MDFA 2ZNZA 3M2VA 2UUTA 1UVKA 3KHHA 1X9SA 4TKTA 2YX4A 2RQKA 2KN4A 4YMEA 3CJ2A 2QZ8A 4EWTA 2XMAA 4UY8T 3U27A 3BZQA 5KT5A 3TP2A 1SL1A 2JHEA 3VAIA 1S48A 2JLEA 4CQ1A 3G8SA 2FY1A 1S1TA 3VGUA 2WSCC 3WX4A 2WW4A 1NPKA 4O0NA 4KTQA 3J7ZT 4GVBA 1JLAB 1SCJB 4IOAQ 2I6WA 3ZFVA 2D3ZA 4IQXA 3FBFA 1PYOB 3R7NB 2DH7A 1FK9B 4DR6J 4DZ6A 4AQYJ 3HSZA 3R27A 3NCRA 1GMWD 2K7KA 4ED5A 2VPYB 4V1Ak 1V3SA 1IBKJ 1PCAA 4Y2KA 3CDUA 5IM0B 1N6QA 1SJ4P 4OLOA 1IBMF 3H98A 3DMJB 3LPEA 3EVWA 1R6VA 1QSYA 4KO0A 5EHHA 2V63A 5J2QB 3D0IE 1N4LA 3H2LA 1R8CA 3PW7A 1U7LA 5HSPA 4UZCA 4LF9F 3KK3B 4IFYB 4DN0A 2I5JB 5I42B 3KMQA 3D0GE 1RT6A 1VOMA 4P6QA 2J6UA 2FJXA 3V6KA 1BMQB 4DSFA 2JRSA 2DEJA 4TXSA 3FEXB 1REVB 4CNZA 3U1NA 1E6VB 2ZH7A 1ZYQA 3M6XA 2VA3A 2XO6A 1VK8A 2YKMB 5HK4A 4ICLB 3R5AA 2K7JA 2EG2A 2G2OA 3SXLA 4NLVA 5D3GA 4FYWB 1Q7YT 1RT5B 1SIZA 2R8HA 2RDDA 4DV5J 5DRKA 3G4SS 3KJFB 3GJSB 3H25A 4PG4A 3DLKB 2HBZB 5DGAA 4RKUC 2MXYA 2QG9B 3KG1A 2RS2A 3PNIA 4JI2F 1CPZA 1HA1A 3X1LB 3O2IA 1TZ0A 1T05B 1ICEB 4JI4F 4AYBD 2JH3A 1FT8A 4NI2A 4CRJA 2A10A 4JI8J 1VLYA 3KMSA 2XYHB 1RWKB 1OWXA 4ZVHA 1SQGA 4PXBA 3W9IA 1ZAXA 2P9CA 1A0OB 1RTJB 2H9ZA 4A8KA 3TVKA 1R31A 2QGFB 1HBMB 1RBOB 1YG0A 3MM9A 2N3OA 4I68A 5DG9A 2AQ4A 4NZ7A 2EPIA 3E8OA 2CDRB 4KGMA 4WCEQ 4ENOA 4M5NA 3IO1A 4CLFA 3MR2A 4C0HA 2J7WA 3QQCD 2HRYA 1FKOA 3DGPB 4IOCQ 1X5OA 3MURP 4FVMA 3KK2B 4LF4J 4DR1F 3AD8C 2KYXA 1LW0A 2EEYA 4CI0B 5HBMB 3UDEA 3SQOP 3KHGA 4OX6A 2J0WA 3CNQP 2DR8A 1EHWA 1MWYA 2KXFA 4WU2A 4BWMA 4IDKA 4FDFA 1P1LA 1TMMA 3IA0A 1LWCB 2RH3A 2BJ8A 4ILLA 2DCLA 4ZPVR 4WP9A 4C8YA 1Q0NA 1M5KC 2CPIA 2W2NP 1WF1A 1Q82T 3KNGA 3B82A 3R5CA 4G1IA 1DAXA 4LSLB 1HWKA 3BGFA 5C24A 2YNIA 4DLGA 3GCXP 1WJ9A 2A6MA 4HVZA 2VIHA 2W9CA 4C8KA 1VC5A 1QAIA 1FERA 2R7OA 2D9OA 2QA4G 1O8BA 3O8WA 4G3IA 1UVNA 3W7BA 4ED7A 4RBTA 3ETMA 4CM2A 3ONQA 3W62A 4EI2A 5F8HA 4K4YA 3JSYA 5CYQA 2WB4A 4MIAA 4CT8A 1ZOTA 2K06A 5L1KA 4RU9A 6FDRA 2CA9A 4X62J 1ZPVA 1SJ3P 3QO9B 4W98A 1IBCB 2DHAA 3MECA 2MKIA 4EBEA 3P8BB 3KUGA 4DQPA 2RB7A 2M8DB 1IUJA 1BUXA 4DV2J 3UO0A 4HR2A 3DLEB 3KLHB 3I0RA 2DHGA 2XCPA 3LP0B 2LEAA 4OZLA 3UDVA 4Y28C 2ASJA 4JI1F 4DPYA 2OPQB 4MT1A 2ZZMA 4DSLA 2UXDF 2FHOB 4DV4J 2RQMA 2W4CA 1G2EA 2DNGA 5JVGQ 2VA2A 2VJVA 1N5VA 4DV3J 2UUCJ 2CPYA 3V81A 3HPOA 3AAWB 2IC3B 2J76E 1UW4A 3CC7S 1FKPA 5L38A 4WIQA 3LO3A 1BWVA 4U8VA 3CSKA 3HXMA 3MPUB 2F9DA 2VBZA 3PXGa 4OQJA 4ES1A 1S9GA 2AEFA 3DRPA 3CD5A 3Q8QB 4F8RA 3POTB 1WC3A 4QYZJ 1D09B 3CC2S 2KFNA 2HQIA 2FGOA 2MLXA 4C9DA 2IBOA 2GGPB 1IWGA 1FJ7A 5KT6A 5KG6A 4WU3A 3V6JA 1RTIA 3EGZA 2GX8A 3VAHA 5FLXU 4ER8A 2DGUA 2YWKA 3RBDA 2JEFA 3H5YA 2UUBF 2GAHC 2AJ2A 4JV5J 4GVLA 4O3QA 5KFIA 4IQMA 4NYPA 2RU9A 4DMZA 4B3SF 5JXSA 4YB5A 2H4YB 3P45B 2VFVA 4WP8A 3HULA 4DLEA 1PJ5A 1KN6A 4USJC 5HMWA 4M94A 2ZD1A 3QNWB 5DDQC 4RUCA 3G6XA 1K47A 2HHXA 4PG7A 1B0VA 4ZVPB 3ZZRA 2V68A 1F0XA 4A8XA 3MEGA 3QFWA 4DV7J 4WFYA 5E3QA 4DSJA 2EFVA 3M8SA 4C6AA 2XB2D 5F8LA 1OY8A 4D3GA 1XR7A 3EPGA 4X4SA 2M7SA 4U67Q 1S1XA 4NLOA 4RL1A 2JEJA 1HWJA 2M4MA 3DI6A 4IG0A 3PR4A 3SSSA 1RT1B 2OEJA 2UU9F 1F1BB 1TVRA 3M30B 4NLWA 1MU2B 3EICA 4DFJA 1RT2A 4C48A 2QL9B 2K3KA 1L3TA 3TZXA 3M8ZA 5EX0A 3QT6A 5LMNJ 2MGZB 5I3UA 3PKMA 4NXNJ 1MSWD 1TL3A 1SKUB 3CJKA 2DIVA 1RWVB 1UP1A 2FIUA 1IKVA 2CQIA 1Z2ZA 3EGWB 3TAPA 3MEEB 1IKWA 4EBCA 1EARA 1OSDA 2BW7A 3OQ2A 4JI0F 1EKSA 4DUTA 3HFVA 4CTAB 2RQ4A 5L9XA 3I31A 2BE2B 1HLWA 4LF5J 3CCQS 1UJ5A 4F0KA 1JXLA 3PYDA 4FS1A 3HO1A 1W2BR 5C2GA 1NJZA 2I38A 4ANEA 5HP1B 3QMQA 4KHPF 3UCUP 4LF6F 1VRQC 3DLLQ 3FK4A 5GAGU 2QLWA 3LH2S 1U48A 2V2QA 2BQUA 5I4MA 3KLFB 5A0YA 2DNLA 2IM1A 3LAKA 2ZH4A 4YY3J 5KFSA 4KB7A 2KXHA 2YY3A 3J81j 3PIPQ 1RTHA 5F9NA 2WZ1A 2MZRA 4QW9A 3J81U 1JLGB 3UNGC 4OI4A 2I2YA 2ZBCA 4ZVQB 1XEZA 5THWA 2GHVC 2VPWB 4PG5A 2HWTA 1H2VZ 3BM7A 5G4DA 5LSRA 3WHIA 5ETNA 3A3NB 2FPHX 2RJZA 4K8RA 3DDIA 4G1PA 5KFGA 2V2KA 3HT0A 2EXUA 4ZLNA 1S6PA 4X4OA 1YZ7A 3KLVA 2QLXA 1GMVA 5LXYA 2D1CA 3DGVA 4FNHA 4U6PA 5D0HA 3JYTA 3VAFA 4NZ0A 3VCDA 4DR2J 3A8EA 1CS4A 2ZBPA 5I3QA 4JBCA 2XGQA 4LT6A 4PWUA 4F7VA 4ANDA 1U1RA 3QRPA 2AEMA 2LEBA 2MQLA 1VC6A 2ZH3A 4X64J 4ZN3A 3OR1A 4H4OA 4UUWA 1U1KA 4KJIA 2E1PA 5HMZA 4UT4A 4BS2A 1PYSB 3EZUA 4I2QB 1NB7A 4FYXB 3QLHA 4XO0A 3DRRB 1FXLA 5IS2A 4HDGA 3JSMA 2ASLA 3T5JA 3GIJA 4GKKJ 1F5CA 1NJWA 1DURA 2B43A 2E1CA 3AT1B 4J5OA 1NCLA 1NZAA 2NQPA 5U47A 4ZOSA 5JUMA 3T6JA 2R2RA 2UUAJ 1FHTA 1T9YA 2HHWA 2ASYA 3MAQA 1EAYC 4X84A 2OUGA 3GYXB 2MY8A 2L9DA 2NCKL 1U2CA 2ZC3A 2VOPA 2CUYA 5L8RC 1PC4A 4AFFA 3K5NA 2GJFA 4LF2A 1TMJA 4BWJA 3ILOA 1E6YB 2DO4A 5CYMB 3M1VA 2J6SA 3DRYA 4OYPA 2LXIA 3J80U 2FDNA 3UR0A 1W26A 1N34F 2HHPA 1R27B 2X1GA 1Q79A 2D74B 4A4JA 3PV8A 4RBUA 4R0JA 2HHQA 1RYRA 2QA4S 3NAHA 5GAEU 4PWWA 1N5YA 2VHGA 5J1EB 5IXUA 4HL9A 4ZA1A 3VTIA 4L73A 3R5BA 2HVEA 5HMXA 4KYZA 4M5DA 4U7CA 2OSQA 4DUYJ 2LQ8A 1B0PA 4B17A 4OYIA 4ZJLA 1WD6A 3HHLB 2CNNB 5KOXA 4HACB 5ETOA 2MDAA 2FJDB 4OMFG 1BE4A 5DQHA 2XI3A 1FRJA 3K8VA 4ZKAA 2Y8YA 3T9ZA 4EO6A 2QA2A 1PO6A 1L3UA 2ZH5A 2L08A 4WZQA 3HHLC 3OTDA 1XMQJ 1KOOA 1P9QC 1WDTA 2DVIA 4X66F 3NOCA 3DXSX 2LFVA 2OTLS 4N56A 3KLIB 4C3KA 2FJVA 2HZAA 2X3DA 3BKFA 1B7FA 4JOUA 3QRQA 1NO8A 3TQEA 1P6TA 3ZZZA 4DQSA 4MKVA 2VG5A 5GAEI 3ETOA 5K14B 2ILZA 3G2XA 4C11A 2NXJA 5DLGA 2B7CB 1VQLS 4O4RA 3SDEB 3P6YC 1EJ7L 4A8WA 2WTFA 2OHDA 3Q83A 4QIVA 2VFSA 1K0TA 2HQDA 1AROP 4JI7J 2PC6A 1CC7A 3DOLB 4L3NA 2W8LA 4ITSA 4AD6A 1SC6A 4KAIA 3HVTA 2RNEA 3Q89A 2PT0A 1KLNA 3UD4P 2PIIA 2HFNA 4HH0A 2G9OA 2BOAA 3NGRA 2DXDA 1RAFB 3IRXA 5A8RA 1OQ6A 3RBEA 2W1BA 4CLPA 1XN9A 3JAMU 3LTOA 1R3NA 4B9MA 2CPXA 3R5DA 4JI3F 5B0AA 3MM5A 3SCIE 5EDWA 2B6AB 3DLGA 4DPTA 1D8ZA 2DTJA 4LIWA 4N8OA 3OFGA 2XWXA 2RKIA 1RAHB 1N33F 3AJDA 4DU8A 4AL7A 2BACA 1B70B 1JKHB 4UQTA 3JTOA 5G0RB 2WONB 3OV7A 3HVRA 1RT7A 3NP5A 1LQ9A 3HLUA 3I6PA 3FDSA 3O1LA 2AIRB 2FLOA 4DR5F 4XPCA 1HQEB 5HLFB 3LAMA 3O6QA 5IQQA 2DHHA 2X7IA 3D1QA 2IDLA 1GQEA 3W9HA 3QAUA 2RF2A 3MHYA 3KOAA 4ZVFA 1H38A 2OAUA 3G6VA 4R8UA 2RMLA 5D77A 2XLKA 5F8JA 2M9KA 3UNYA 4IFVA 3NL0A 2NLWA 3OFEA 4C3MA 2HHSA 2Q6CA 3WDOA 2BANB 3L7OA 1ZM4A 1S1WB 3TNVA 2PO4A 1U8WA 3NS5A 1I51B 1UWBB 2OPPB 4ZCKA 4ZIVA 1FE4A 1V3ZA 3HKZD 1HWUA 4CO1A 1KTVA 3T1YJ 4DFPA 2V2VA 5DDOC 4TU9A 3EWGA 3RYLA 4TY9A 2XMJA 3RAMA 2WCXA 1JLFA 3JXOA 4Q2LA 2EC2A 1RACB 5F8MA 1S7IA 1IKXA 1DJ0A 1WKKA 4DCJB 3K7RA 4K5RA 2FC8A 3C15B 5LMUJ 3CMQA 4Q0BA 2AP6A 2HEKA 1X0FA 1JB0C 3C8YA 5AE3A 1VC0A 1HKAA 2XZWA 1CBKA 4ED4A 1T7PA 4O3PA 3TA2A 2BYCA 2MPUA 3I4HX 2Y1RI 1MN9A 1SUQA 2LA4A 1Q5VA 2M3DA 2NZCA 2VBYA 2EFOA 3CCTA 1S0MA 2YXLA 3QJPA 3V4MA 1QE1A 2ZH2A 2WOMA 5KFTA 3PJ9A 4GVBB 2MLYA 1HBNA 3JTNA 3PO4A 1MROB 1A6LA 2BQ3A 1BQNB 4B02A 5A2QU 3B78A 4IOBA 1XNRJ 1OQ3A 3FQKA 3NS6A 2DRDA 4USMA 3H42A 1DQ8A 3SQGA 3P4UB 4JYAF 2HSEB 4KO0B 2RUSA 3PDNA 2D3O1 4WE1A 1XMOF 4WBFA 3NOGA 2R2SA 4ZDNA 2HFZA 1EX8A 4DR6F 4J9RA 1TK8A 4CYUB 4FXWA 1JLCB 2VD3A 1RT6B 3TARA 1CULA 2FTRA 3T5HA 1MMDA 4ECQA 4FS2A 2HNDB 1V5IB 1S1VB 2HAIA 1ZA1B 3CD7A 1GNKA 1WEYA 1GXTA 2R8GA 3GIMA 1TKZB 2MQNA 4DX7A 3EZ5A 1KQFB 3MAAA 1OO0B 5T14A 4ZP8A 4OYMA 1QVFR 2B51A 3OD2A 2W24A 3K2YA 3AOCA 2RDJA 1IBMJ 2O5DA 2K8GA 3CCZA 2RRAA 1YK9A 1JK9B 4ED2A 2EFNA 3BDEA 1HBOB 3DYAB 2VONA 2MTLA 1HHTP 1CC8A 1FFGB 3HF5A 4NI2B 2VZ9A 2GO8A 4LF9J 4F4ZA 5D0EA 2JL9A 1Q7LB 1C1CA 3KG4A 4WZMA 1B7YB 1GMWA 2PA8D 1FNMA 4B3OB 4DV5F 1LFPA 2HZCA 5ETPA 1Q8KA 4J37A 4YB6A 2GS8A 2RD5C 3W63A 1T9WA 2PSZA 2F8HA 2J5AA 3NBPA 1K73T 1WTFA 4J9VA 1FKOB 2GHWA 4LR7A 2KHCA 2JVRA 2HURA 1NJXA 1IJEB 1LW0B 1M5SA 3SBMA 2FLNA 5ETMA 4JB8B 2NXEA 4NLUA 2HWHA 4KKOA 1UEUA 2F3JA 3IC1A 3CD0A 1R8PA 4IDKB 3Q8PB 2V0NA 1FVQA 3J7A1 4JV0A 4J9MA 2C2OB 2ZE2A 4JI2J 3QIDA 4EUVA 4X4VA 3MMAA 5F41A 4JI4J 2KI2A 2LDIA 1NKCA 3NGKA 3DRSA 2DXFA 3M9MB 4KPYA 4F4AA 2XS5A 2ROEA 3Q8VA 5H9EK 3NGUA 4DCPB 5E33A 4ZLLA 1FJEB 2DNPA 5C24B 3I55S 1AT1B 1NK5A 3KJNB 3MMCA 4ZJQA 3WZ0A 2VFRA 3HD1A 1UFKA 4EO8A 2KG1A 4ED0A 2XY7A 2V8HA 1HMVB 3M8RA 4OX8A 1WKLA 2PEHA 2K3IA 3I32A 3LGNA 3ET6A 3MGJA 3CEDA 1LK5A 3PRBA 2X3GA 3SMZA 3DOKB 3GILA 5CYQB 1WHXA 3N6MA 1RI7A 4DR1J 4L72B 5I3PA 2GV1A 1AZSB 1R0AA 3DN9A 1QY7A 3F56A 4K2JA 3PG9A 2MQPA 5IT0A 3MR5A 2XSJA 1P8GA 1Y5IB 4WFNQ 3KYLA 4CLSA 3DNCA 4RPFA 3T41A 2RQCA 1TUVA 3OHAA 3HDSA 1RT4B 5LSOA 1X4HA 5C2CA 2Y8WA 1F3FA 2IPOB 2DGOA 2R7UA 5HL7Q 4QIGA 2QT7A 2G0CA 1H74A 3QT5A 5ETVA 4YEAA 2C3YA 3TANA 2DNYA 2H4WB 3M8PA 1HNVA 4JV1A 3M8QA 2F8MA 2QSFA 2WRMA 2ZOGA 3UVJA 4X62F 2V67A 2J0XA 1R8HA 1RJJA 5BYSA 4NMLA 2CDQA 3IMQJ 4DJBA 2QMXA 4OZ0A 3I56S 1TL5A 2IMOA 2CJYB 4CDIA 4DN9A 1TKXA 4GO5X 3D5MA 4GKJF 4HI1A 1S9GB 2MKSA 1BXNA 2O66A 3DRPB 4AUKA 4K4WA 1DLOA 5B0DA 3CXCR 2E5HA 4QQBA 3CCVS 3WQPA 4PABA 3LF0A 1YIJS 1O5JA 4WK3A 4DV3F 3KUHA 1RABB 1RTDA 2MJUA 4P2FA 2VICA 1LNQA 2HFOA 1VS3A 3KLEA 3C2PA 2IRYA 2BJDA 3M6UA 5C5JA 2GHPA 1KFDA 3MR3A 1OYEA 2W4DA 4KV8A 2B4OA 2Z8QA 1H3DA 4M63A 4JI1J 4HDHA 2XHCA 1HPZB 1X5SA 4WJBA 2YKAA 2WVFA 2FVCA 2UXDJ 2YKOA 1Y7PA 1HW8A 1SBRA 2KXNB 2N7YA 4OYAA 1QDUB 2MKHA 5AE2A 2PMHA 4Y2IA 3T1HJ 1S4FA 5D4PA 4RW6A 3CCES 4C0BA 2VDHA 2QEXS 3MWBA 4B9TA 1FI4A 2CG4A 3OTCA 1Y5LB 2ZD1B 3CDAA 2WSFC 2D9PA 5L1IA 2DR9A 3ZZ0A 3Q2TC 4C2MA 3EUNA 3EMTA 4E98A 3SSQA 2JC1A 2EI5A 4X65F 2R7QA 2HMIB 3U1MA 4NCBA 4CT9A 3Q8YA 1AYEA 3LWMA 2KRRA 4ZCMA 4C8NA 1S1XB 5E3CA 2QE5A 1R8BA 3EDRB 1R0BG 1XERA 2YBVA 4IG0B 3UR3C 2GQQA 3QGHA 1EQMA 3W2WB 2V50A 1Q16B 2OKQA 3ILJA 1WUUA 3OTEA 1LW2B 2CIMA 3VZIA 1DTTA 3OR2A 3M2UB 4DV7F 2UUBJ 2WVCA 2DK2A 2XMKA 4ZP9A 1F2GA 4QBUA 3CB4A 4B3RF 1HBUB 2DRAA 1T95A 4QW8A 1BLUA 4ID5A 4XTTA 2W2PP 1NHUA 1JJCB 2BABA 1VJQA 3CJKB 4IR1A 1Y9OA 5HJXA 3UI3A 2APOA 1GXLA 1T3OA 4OYOA 5J1PA 3UCGA 2N82B 3D1OA 3HM9A 4Y0FA 1JJHA 2Y1LB 1RQ0A 3CCLS 2XMVA 5IT9U 2VODA 1FFWB 1VQMS 2LLZA 4MFBB 3NWGA 4LR9A 4BHQA 3CUNA 2HWIA 1WELA 3RW6A 2MQMA 5J2PB 4IG3B 3ELHA 4N76A 1JLBA 4OX7A 4DR7F 5A0YB 4RJVA 1NBEB 2MEWA 2W2QP 3I5CA 2ROPA 2UU9J 4F4YA 3FCVA 1RBAA 3FNNA 1X7VA 1NSPA 2IA0A 3HHLD 2LXFA 2W9AA 4KFBA 2DPIA 4QPXA 4LF5F 2CRLA 3SIPB 4ED8A 1ZZFA 2FHJD 5KT4A 3KLGB 1U8SA 3W61A 4KGKA 3TAMA 1YSJA 3BH7B 5M2PA 2DGQA 1RDRA 2VC0A 5BR8F 2QFJA 1NZ8A 5GADU 2HHHF 1S6PB 2UVUA 2QN6B 1TAQA 3ENWA 2C22A 3JYTB 4F4WA 4UOCA 3M9NB 3ZTPA 5E3PA 1KLMB 2EFQA 2IAJB 2GIRA 3UN3A 2XQCA 4JI0J 3OFFA 2AJ1A 2Q43A 1RHRB 3ISND 4FKXA 2VV5A 5L9NA 3N79A 5C25B 4F25A 1VDHA 4USWA 1KS2A 5J1NA 2VF3A 3OR1B 4H4OB 4B3TJ 3NGSA 2VG6A 2B4VA 4LF6J 1H2UX 1BQMB 3V4IB 1KTQA 3QLHB 3PO5A 2EKNA 5HANA 2ROGA 2F7VA 4Q43A 4NXMJ 4U95A 2YNFA 1VHIA 4DR2F 3D67A 2CPFA 1DBDA 3QIPA 3R1HA 1R8AA 4B3MF 4FYVB 3GR1A 2B4PA 3BO4A 3LALA 5AJ3J 1VQSA 1ZM3A 4OJ1A 5J2NA 1U6FA 1VRTA 3PZPA 1YJNS 1SC3B 3BBCA 4DWIA 1S9EA 2QYCA 3IP0A 4K0KF 4KH1B 2AX1A 5H9FJ 2MZSA 2EKYA 4O44B 3PY8A 5GVQA 3KFWX 1SL2A 4MKBA 2RE1A 2UUAF 1FF2A 4OHWA 4JI6F 3CCWA 2OD4A 3QYYA 2Z56B 3R2DJ 2MSSA 4Q8FA 3MUVP 4NCGA 3I9ZA 2IVYA 3FBCA 4HYKA 2X51A 4FF3A 4M5DB 4I6AA 3DU6A 4DL5A 1IBLF
chains in the Genus database with same CATH topology
2Y9HA 1WJ9A 3QRRA 5H9EK 4U7UD 4DZDA 3QRQA 5CD4A 2Y8WA 5H9FK 4QYZK 3QRPA 2Y8YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y9H A;  1WJ9 A;  3QRR A;  5H9E K;  4U7U D;  4DZD A;  3QRQ A;  5CD4 A;  2Y8W A;  5H9F K;  4QYZ K;  3QRP A;  2Y8Y A; 
#chains in the Genus database with same CATH topology
 4TQR A;  2ZUG A;  2UUW A;  1VHF A;  3CMA S;  3SV3 A;  3LGH A;  3UCZ P;  4H4M A;  4WTY A;  4KPC A;  4RNO A;  4BLG A;  4I2P A;  4KC5 A;  1J27 A;  1X4C A;  5KG2 A;  1RA7 A;  3RUB L;  4OYX A;  2FJW A;  4S0M A;  4QWA A;  1X8D A;  3I9V 9;  1QSS A;  3M9O B;  3A3O B;  1P9Y A;  4LSN B;  3LWL A;  4HTI A;  2Z0G A;  5KFL A;  2GW8 A;  1N34 J;  4M8L A;  1Y3K A;  2G4B A;  2XS2 A;  1AXQ A;  2AGO A;  4F3Q A;  2B9X A;  1KQS R;  2AMC B;  1M0S A;  4IYQ A;  3S01 A;  4ANC A;  3LP2 A;  2VG5 B;  4B9N A;  4ZIT A;  3W8G A;  2ZEJ A;  1BY9 A;  1Y3J A;  2GVZ B;  2C3P A;  1S12 A;  3MCN A;  1RIS A;  2HFS A;  4QWC A;  3GP9 A;  3OW2 R;  1XMQ F;  3R6G B;  4Z7Y A;  1DQA A;  1S76 D;  4LRE A;  3KK1 A;  1S6Q A;  5DJB A;  4URQ U;  5KFA A;  1TFW A;  3TA0 A;  3C14 A;  2HNY B;  1SKS A;  2KRB A;  4Z37 A;  4E2F B;  2HVI A;  4DFM A;  2E1R A;  4ZVE A;  3JB9 k;  1PSD A;  3VV2 B;  3H2V E;  4WFX A;  2DRB A;  3C6T A;  4ECZ A;  9RUB A;  2H51 B;  3DOM B;  1KON A;  2C3M A;  1NDC A;  4UZB A;  4DQI A;  4ELU A;  3H5S A;  1NUE A;  1T9V A;  3QAT A;  5GMD A;  2JDJ A;  3W60 A;  2Z4P A;  5E2Q A;  5FDL A;  2FLP A;  2V8G A;  2H5I B;  5D4O A;  3GU0 A;  3MM5 B;  4X66 J;  1GTE A;  2JZ5 A;  1C0U A;  4MMO A;  2E5L F;  4ZMM A;  4LBP A;  2ZH9 A;  2LVW A;  2YKN A;  1NME B;  4IRC A;  3FUY A;  2C3U A;  1WEZ A;  2BRK A;  2ADC A;  2KZZ A;  3AA8 A;  4CWB A;  4QPT A;  2XY5 A;  5ETK A;  1LXJ A;  4AE5 A;  3AB4 B;  2VQE F;  2KZM A;  4ZVS B;  1KNZ A;  4OHX A;  2XZT B;  3FJ2 A;  4DQQ A;  4LF7 F;  1LOU A;  4P71 A;  2BBE A;  3TVZ A;  3DDK A;  4NLQ A;  3DLJ A;  4U7U D;  2DGX A;  4A48 A;  4PQU A;  4K4T A;  4LBH A;  4O0I A;  1F9H A;  3HFK A;  1HYS B;  1PIL A;  1S1U A;  2JFK A;  4F50 A;  2KU7 A;  1T0T V;  3B8H A;  2V6A A;  3PYF A;  4RWX A;  1GK8 A;  4NYZ A;  1V5V A;  4UOH A;  5HQL A;  4A8S A;  3J81 Y;  2FZC B;  3TUP A;  2A2C A;  2DB1 A;  5RUB A;  4V19 X;  4IUF A;  2CQP A;  4LF1 A;  5ETR A;  2OPR A;  1DTQ B;  1VRU A;  4XDC A;  2BKP A;  1SJF A;  3ENV A;  3G82 A;  4JP8 A;  8AT1 B;  2V4J B;  1U2F A;  3GSD A;  2F1F A;  1X4G A;  3AXK A;  4JI3 J;  1I3O B;  1QVG R;  1NSK L;  2BM0 A;  2BJ3 A;  4F04 B;  2H3E B;  4EZ9 A;  1WC4 A;  3BN4 A;  2OPS A;  4P74 A;  1C4C A;  1FRX A;  1N33 J;  1ZS6 A;  4KY3 A;  4OYW A;  3UPF A;  4WTO B;  4ECV A;  2L3M A;  3MPD A;  4YR3 A;  2R7R A;  3RG6 A;  5LM7 E;  5C42 B;  4J9S A;  3MCS A;  3OJU A;  4LSZ B;  7AT1 B;  3OUY B;  1NK6 A;  3H5U A;  2HQ3 A;  2JWN A;  4DR5 J;  4WFB Q;  5A8W A;  3T1Y F;  4YHH F;  1N0V C;  3MPW A;  1JLA A;  1FWP A;  3BGR B;  4P7V A;  2X1A A;  1VQO S;  1K1Q A;  3I5A A;  3D6F B;  1KHW A;  2CPH A;  2XO7 A;  1KP6 A;  2XUL A;  2W7A A;  3GYN A;  3K8W A;  2C2E A;  3H0P A;  1HI8 A;  1FCA A;  2Z57 B;  3VQT A;  5IM0 A;  1K44 A;  4DR4 F;  1TL7 A;  4WFA Q;  1UPP A;  1SI9 A;  2MB0 B;  1HI0 P;  2COL A;  3GCW P;  3Q86 A;  2BEF A;  4LRA A;  2O3D A;  2LEC A;  1ZTW A;  2IYI A;  3IM9 A;  4RNM A;  5HVH A;  2IIH A;  2W7O A;  5J2Q A;  4YDD B;  1W2I A;  1WHW A;  1GTH A;  1NHK L;  3A12 A;  2ZFH A;  3T1A A;  4QYR A;  1NPP A;  2L48 A;  3NXZ A;  3KK3 A;  1RAI B;  4IFY A;  1TP7 A;  3J80 Y;  2I5J A;  5I42 A;  1FTR A;  3LP1 A;  1GEH A;  4NE9 C;  4F3O A;  1RKJ A;  3CGI A;  4KHR A;  2V9K A;  2YQ1 A;  4DV1 F;  3MUM P;  1REV A;  1KQG B;  2GCF A;  3DDN A;  1U6B A;  4ETZ A;  3CJ3 A;  2NPF A;  2OD6 A;  2NYI A;  2RS8 A;  2W2O P;  2HLU A;  2GQ2 A;  3NNC A;  1OSC A;  2ASD A;  1OPI A;  1YQH A;  1RWW B;  3QT7 A;  1S77 D;  3ZZY A;  1Z2L A;  4K4X A;  2YNH B;  2YH0 A;  3BN7 A;  1JLE B;  2JX2 A;  1L3V A;  1H0H B;  2DIU A;  1AA1 B;  6FD1 A;  1XQI A;  3DLK A;  3T9N A;  3I0S B;  2BA9 A;  2OLW A;  3BBB A;  3RRG A;  4NLY A;  4P2M A;  2LQB A;  2Y9H A;  2BMB A;  4FNI A;  3N5B A;  4QOT A;  1T05 A;  4MKY A;  2BRL A;  3PTW A;  2EFP A;  3RTV A;  3DC2 A;  5ITH A;  1RTJ A;  1SH3 A;  2NZ4 A;  5LJ3 Y;  1HBM A;  3GFY A;  3TQ1 A;  3BQ0 A;  2MQO A;  4JYA J;  2CPZ A;  1YJT A;  1BQX A;  4KHM A;  4TN2 A;  4O3N A;  3BPS P;  3J7Y I;  1XMO J;  1Q8L A;  2FD2 A;  2P5V A;  1K8A T;  3FGV A;  4K50 A;  3KKF A;  3DGP A;  1XC9 A;  1O0P A;  4HI2 A;  4U8Y A;  1PJ7 A;  2ZDP A;  3KHR A;  5FD1 A;  1BC6 A;  2LP4 A;  4RUA A;  2PA3 A;  3MR6 A;  1KHV A;  2YKQ A;  1L5U A;  5CAA A;  2E29 A;  1YBA A;  1LKZ A;  1MG7 A;  2DYA A;  4LVO P;  1XWL A;  1IM6 A;  3L7U A;  2WBR A;  2E9Z A;  1RAO A;  1WC5 A;  2BKO A;  1X4A A;  2Q3P A;  5K9F A;  2JEI A;  2QRR A;  3JAM Y;  2DIS A;  4A8F A;  1LWF B;  3CJR A;  1DHM A;  2NXU A;  2CQ1 A;  4L76 A;  2J9C A;  2XM3 A;  3FBB A;  3FBE A;  2EWH A;  4ZIW A;  4KKO B;  1KD1 T;  1MML A;  2HNZ B;  1NAQ A;  1GMU A;  4WXW A;  2RU3 A;  5E3A A;  3VGV A;  1G1X A;  4BBY A;  4LF8 F;  4PCQ A;  4ELT A;  1NH7 A;  1RHU B;  2OTJ S;  1RKI A;  2JFD A;  3EJM A;  4U96 A;  2PFD A;  2YWW A;  1YWX A;  2NS1 B;  2F5G A;  4RW7 A;  3RRH A;  1NM2 A;  4LMZ A;  4YB1 P;  3MM7 A;  5F3T A;  3BO3 A;  3BDP A;  3MMC B;  4RX6 A;  3TEG A;  1TKD A;  3IWX A;  3CC4 S;  2W01 A;  1FD2 A;  4QJV A;  4KGZ B;  3R2C J;  2R7X A;  1PYT A;  2J0S D;  5DM6 Q;  4N47 A;  3ET6 B;  3KXD A;  4CH7 A;  3KLH A;  4A46 A;  3MZI A;  3PJW A;  5DGB A;  3LP0 A;  3GLJ A;  2BJ9 A;  4DPW A;  5HN0 A;  1EP4 B;  1JNZ B;  4N41 A;  2OPQ A;  1XR5 A;  4B9S A;  2HHV A;  4PWD A;  2HBY B;  5IFM A;  2F65 A;  4ILM A;  4B9U A;  4TYB A;  3A8J A;  1GT8 A;  5E41 A;  1M1K T;  1F6T A;  3CCU S;  4ERD A;  1WSV A;  2MJN A;  5IT4 A;  2BZ2 A;  4Q5V A;  5DZ7 A;  3GZ7 A;  1NLK L;  2IC3 A;  3IXQ A;  4DSI A;  3VQS A;  2ZOM A;  3AJ1 A;  2XSF A;  3WIU A;  3K5P A;  2VDI A;  4ED6 A;  3W65 A;  2F4V J;  1TU0 B;  2GVD B;  3IWN C;  4M5I A;  3POT A;  2KM8 B;  2RRB A;  3M8P B;  1N54 B;  2O67 A;  1FKA F;  2XMW A;  2G1H A;  2ZWP A;  2LYV A;  2ZH1 A;  2EVZ A;  3Q8U A;  4J9Q A;  3KG0 A;  3HZG A;  2MQ8 A;  2GGP A;  3RU0 A;  1S0N A;  1T9U A;  2B4U A;  2KM8 C;  3FMB A;  2YWH A;  3K57 A;  3OVS A;  1U1L A;  4PZV A;  3H90 A;  5DZ6 A;  4RW4 B;  2OJ3 A;  2NUH A;  3D4J A;  3AD9 C;  2DHX A;  2ZOF A;  5BJR A;  4Z2X A;  1SPB P;  3OL7 A;  1RTD B;  5A2Q Y;  4NX9 A;  2FYX A;  3MED A;  2KH9 A;  1DFD A;  4NA1 A;  3D9B A;  3KLE B;  3EVM A;  1BWE A;  2VB6 A;  3B4M A;  4ZVO B;  3WBZ A;  3AH6 A;  2Z30 B;  2CZ9 A;  4PG8 A;  4DX6 A;  1S6O A;  2HFV A;  3FKB A;  3UD3 P;  5BYR A;  4IH7 A;  1HNZ F;  3EX7 B;  2I1R A;  3CE8 A;  2F63 A;  4ECU A;  1YGY A;  3GV8 B;  5B0B A;  1VQK S;  3GQC A;  1AFJ A;  2JJ4 D;  3K0J A;  2VU5 A;  1J5O B;  2GML A;  1Q86 T;  3PYG A;  2MKJ A;  3JSB A;  3L3C A;  3TA1 A;  4DL4 A;  2V5H G;  1S7H A;  3HVA A;  3IGN A;  4N7T A;  1FX2 A;  5K8O A;  5IOL A;  3MM8 B;  2BUN A;  2OEM A;  5D4L A;  1M1G A;  3NCP A;  2CPE A;  1HNX F;  1J2V A;  4C0O C;  4K4Z A;  1MWQ A;  4DBQ A;  1RT1 A;  5J2M B;  5EN1 A;  4GKJ J;  3O5T B;  3MPV A;  4AXJ A;  4LFA F;  3THT A;  2DGV A;  2BOP A;  5HAT A;  1U09 A;  3R6L B;  3M30 A;  4USI A;  3KDO A;  3UW1 A;  3ZZT A;  2DR7 A;  5ADZ A;  3T1H F;  4DDF A;  2AYB A;  2PI4 A;  2MGZ A;  3ITH B;  1T03 A;  1RU1 A;  3C46 A;  3HSG A;  4NEZ A;  1RA6 A;  1PAE X;  5B0F A;  5MAO A;  5AXK A;  4EMD A;  4DXL A;  1SQE A;  2QC3 A;  2B56 A;  2AF6 A;  1DTT B;  3OR2 B;  1TR0 A;  4FXD A;  3I4P A;  3M32 B;  4DFK A;  3G8Q A;  4BC9 A;  3ADA C;  3DU5 A;  1JXE A;  4CTA A;  3FEY B;  2H1Y A;  1OYD A;  1MMN A;  2CXE A;  5HVG A;  5HP1 A;  4DSK A;  2Z2L A;  2VPZ B;  5F8N A;  3E3X A;  2XY6 A;  5K8N A;  2M70 A;  3D6T B;  2Z2Z A;  4A47 A;  5KG7 A;  4OI6 A;  3Q23 A;  4QZV B;  1UZH A;  2ZZT A;  3KLF A;  1AB8 A;  4AXI A;  2RRN A;  4H4K C;  3LA0 A;  2MLZ A;  1TTH B;  2R9L A;  2HAF A;  2P6S A;  4J9O A;  1YRX A;  4X65 J;  1KOH A;  1JLG A;  1Z4U A;  4C3L A;  4BDP A;  1UVM A;  3FCH A;  2ZBI A;  2KL8 A;  1X4F A;  2QIF A;  1DRZ A;  3DXB A;  4NPO A;  1JLB B;  2VFU A;  1G3O A;  4MYU A;  2CQB A;  2XYG B;  3MF5 A;  3HT3 A;  1B99 A;  3KJV A;  2ZJR Q;  1X60 A;  3UN2 A;  3QBC A;  2CJ9 A;  2CWK A;  4KRW A;  3NKY A;  7FDR A;  5IV4 A;  1RHM B;  1EZZ B;  4B3R J;  2GZO A;  3RW7 A;  2RVJ A;  4F2S A;  2LCW A;  3FCW A;  3VAK A;  3US5 A;  1NJI T;  4PKD B;  2XGP A;  1CJU B;  1IWA A;  4RW8 B;  4OX9 F;  2L9W A;  4I2Q A;  1UET A;  2JSX A;  3NNA A;  1EET B;  2ALY B;  3MM6 B;  3SCL E;  3DRR A;  2R7T A;  2C42 A;  1PBA A;  4X4Q A;  1RCO B;  4E8U A;  1IVZ A;  1BHN A;  1HL6 A;  2VQF J;  2AW0 A;  2W4P A;  2R2T A;  4Q8E A;  4DF4 A;  4OYZ A;  1VLO A;  4NA2 A;  1M5H A;  4ID8 A;  7FD1 A;  5EUH A;  5ETS A;  2KG0 A;  3PW4 A;  1ZAW A;  4CO3 A;  1SJ1 A;  3OVB A;  3BSN A;  2FJA B;  3NWR A;  4DR7 J;  4J9P A;  5CYM A;  4IRD A;  2A1B A;  2YNF B;  1HD0 A;  4RUB A;  1T8E A;  5T7L A;  3QIP B;  2CJQ A;  4QCL A;  1S5Z A;  3RBX A;  4HHJ A;  1B3T A;  4OZ2 A;  3TZW A;  3S7R A;  2LKZ A;  2FVS A;  2IVF B;  4B3T F;  3LOU A;  2GQC A;  4O4G B;  4EEY A;  3AQO A;  2XYP B;  6AT1 B;  1CJV B;  5J1E A;  2C2K B;  2DNH A;  3D28 A;  5BR8 J;  2HHH J;  2OFH X;  5GAH U;  1J5E F;  4NXM F;  3ZTO A;  3KDN A;  1VQ6 S;  2NRE A;  2R7S A;  2D3O R;  1JNR B;  5CD4 A;  4LR8 A;  5D6G A;  3HHL A;  5AJ3 F;  4F4K A;  3FC9 A;  4FYD A;  1H72 C;  2GJI A;  4CLL A;  4Q7A A;  2KYZ A;  2PEB A;  5SZT A;  1RTZ A;  2FHJ A;  2WVD A;  4N5S A;  3E51 A;  3NAI A;  2BJ1 A;  1XBW A;  3OBI A;  5A76 A;  3HCX A;  1N5T A;  1ZAV A;  3IG1 B;  4QR2 A;  5DQG A;  1XMB A;  4H4M B;  5CH7 B;  5CQG A;  1KDN A;  3QZ8 A;  4B3M J;  3V2U C;  1N48 A;  3F44 A;  2KJV A;  1N52 B;  4CLW A;  5GAG I;  3OJS A;  1FDN A;  4ED3 A;  4L6V 3;  5KFR A;  5K14 A;  4ZPD A;  3M2R B;  4WYW A;  1OS5 A;  5DS7 A;  2PMZ D;  2W7P A;  4DR3 F;  1GH8 A;  4QR1 A;  3BR8 A;  4CNY A;  4W4M A;  3TWZ A;  4K0K J;  1VQ8 S;  5IZH A;  4WWS A;  1S0V A;  1YX2 A;  1TK0 A;  4MH8 A;  5EWE A;  4UOG A;  2C3O A;  2DGS A;  1DAR A;  4UF4 A;  1RT3 A;  1U2R A;  1FDB A;  4RU2 A;  1ACM B;  4JI6 J;  2DR5 A;  3B54 A;  4P9S A;  3U7J A;  4YR0 A;  4LIR A;  3CCM S;  1UCN A;  1FNX H;  4GMK A;  3IM8 A;  4Y2A A;  2U1A A;  1U25 A;  3S6E A;  4C97 A;  3Q8S B;  1WHV A;  5KFU A;  3KK1 B;  1S6Q B;  2JVO A;  1UTA A;  2VG7 B;  1IBL J;  2ZHA A;  3IBW A;  3VAM A;  2EC0 A;  1W25 A;  1D9D A;  3IGV A;  2XZD B;  2ACY A;  1KKH A;  2OGU A;  4MK8 A;  4M5K A;  2JLG A;  4ECX A;  3K5M A;  4NLT A;  1FES A;  3PEH A;  2WON A;  4NWB A;  2ZVI A;  1G4C A;  4WII A;  4RW9 A;  1UJ4 A;  2CVE A;  4KIA A;  2QMU B;  1YRU A;  2IVM A;  3H5X A;  2R4F A;  2P6T A;  4B08 A;  3D66 A;  1MN7 A;  4EYI B;  4KGX B;  1HQE A;  5HLF A;  2SXL A;  1TKT B;  2UXB F;  3MI7 X;  2H5J B;  5CD4 H;  2KT2 A;  2YKN B;  1KFS A;  2LEP A;  2E5G A;  4DZD A;  2VFT A;  3IAM 9;  1Z1Z A;  5IT9 Y;  2XNQ A;  4NOH A;  3OTO F;  2ZM6 F;  4K4V A;  2N4C A;  1CJK B;  2BAN A;  4QWD A;  4DF8 A;  2J9E A;  1S1W A;  3ZZO A;  4DG1 B;  3FSI A;  1IJF B;  2OPP A;  2CAJ A;  4H54 A;  2DEI A;  3T5L A;  3GPA A;  3C16 B;  3EPI A;  3TUJ C;  1CJT B;  2ZIT A;  2AGQ A;  2D3U A;  4UTG A;  1QAJ A;  3O44 A;  1IQT A;  1OIA A;  1S1U B;  4AL6 A;  4DQR A;  4ZS6 A;  3U02 A;  1WG5 A;  3D6M B;  5K20 B;  5KG1 A;  3C15 A;  1DZ5 A;  5IC4 B;  3H4B A;  5DM7 Q;  1HNW F;  3W3S A;  4W90 B;  2F40 A;  1YTY A;  4DOZ A;  5L46 A;  4J90 A;  3ISN C;  4X4P A;  1NK8 A;  3PW2 A;  5L39 A;  4ZHR B;  4KT0 C;  2X1F A;  5E3R A;  2BJE A;  1VIS A;  3MTK A;  2OPS B;  2E5L J;  1SXL A;  4GRS A;  1V3R A;  5EWG A;  1TQL A;  1YDL A;  2CQH A;  1X9W A;  4XAK A;  3KTQ A;  3ICL A;  2A3J A;  2FLL A;  2E7V A;  4NCA A;  2HVZ A;  1JLQ B;  2XBP A;  2QL5 B;  2BX6 A;  3P49 B;  3GB0 A;  3TVY A;  3DHX A;  4RNH A;  4UST A;  5FII A;  2XWY A;  2VQE J;  4M5L A;  1U0H A;  1BGX T;  2QFI A;  4LF7 J;  4OV6 A;  4M5M A;  5A8W B;  2DKO B;  3GWC A;  3WX8 A;  3J7A N;  2BW2 A;  4QYZ K;  1NEE A;  3M8Y A;  1MRO A;  3SEO A;  2AJ0 A;  3QZ7 A;  1BQN A;  4IO9 Q;  4RZR A;  3JQM A;  2UXC J;  2IRX A;  4KH0 B;  3ENQ A;  4J9K A;  3OXL A;  3PFE A;  4YQW A;  1WC0 A;  2K1R B;  4I7F B;  2IM3 A;  1TL7 B;  1WC6 A;  2IMW P;  2IA6 A;  3G6E S;  3G87 A;  1UZD A;  5DG7 A;  2NSC A;  4K7Q A;  3F0N A;  3S1T A;  1CVJ A;  1S0O A;  4NLX A;  3JQK A;  3HFZ B;  5C7P A;  3CJ4 A;  2DNM A;  1LWE B;  3GR0 A;  2DNZ A;  4TY8 A;  4CYU A;  1W7W A;  1JLC A;  2BE9 B;  1K0V A;  3GJT B;  3LP1 B;  4LQ9 A;  3LW5 C;  4OYB A;  3GG1 A;  1R6Y A;  5A8K B;  2HND A;  1S1V A;  3AD7 C;  2KT3 A;  2YKP A;  1FJG F;  3OVA A;  3HHE A;  1TKZ A;  4YHH J;  4CIO A;  1UA0 A;  3CD6 S;  3QSI A;  1YJ9 S;  1GAO A;  4IKA A;  3PAC A;  2PMW A;  2E9R X;  4DEZ A;  2C2N A;  3B4D A;  1FRM A;  4LFB F;  4KE5 A;  4YR2 A;  1WF2 A;  3CJQ A;  4K2X A;  1IR1 A;  3CDE A;  4DR4 J;  2DHS A;  3C66 A;  2ZKT A;  3E01 A;  2W9B A;  2AHO B;  5DDR C;  1SV5 B;  1RHK B;  3N01 A;  2MYF A;  2FVQ A;  4HT7 A;  4P73 A;  1HBO A;  3M2V B;  3DYA A;  4CH0 S;  4I56 A;  1PGZ A;  3DKD A;  2XLJ A;  2YTC A;  4PQA A;  1IN0 A;  4Z7C A;  1M5O C;  4NA3 A;  3OXF A;  3VGS A;  4DV0 J;  1R89 A;  1L3S A;  5IWA J;  3GON A;  1WG4 A;  2VOO A;  4B3O A;  2VKZ G;  2AYG A;  3F73 A;  4A8Q A;  4DV1 J;  3DRX A;  3GYG A;  2NXN A;  4HH1 A;  1S1T B;  1C4A A;  2CQ0 A;  1FA0 A;  2RIL A;  4ZVU B;  3RR8 A;  4DV6 J;  2JLF A;  1F2H A;  4CP5 A;  1TL1 A;  3W1Y C;  1RWN B;  4QR0 A;  4ILR A;  4LVN P;  5KFF A;  4URG A;  1HAR A;  3CTR A;  3ZTQ A;  4F4X A;  5HRO A;  1N6Q B;  1IKY A;  2G13 A;  2MST A;  4DL6 A;  4F0H A;  1A7G E;  1V6H A;  2C2M B;  4OZ1 A;  1VBZ A;  2ACM A;  1EKR A;  2VKR A;  1FWL A;  2J7K A;  2Y3Y A;  1JIH A;  1N5Q A;  2A2D A;  5LJ5 Y;  3W5X A;  4GO7 X;  1WTB A;  2CWX A;  3N6N A;  5B0C A;  4IRK A;  8RUC A;  2ZH8 A;  3PYE A;  1Y10 A;  3R3T A;  1I5O B;  2AU0 A;  2XNR A;  4PXC A;  1H98 A;  4KBI A;  1CG2 A;  4ES2 A;  5KT2 A;  3MFH A;  4Y2M A;  1HMV A;  4J9L A;  1VJW A;  3W2V A;  5CA5 A;  1ZM2 A;  2ZBQ A;  3DCA A;  3WIV A;  5LSL A;  3NMR A;  5D0R A;  4RW7 B;  1ZH5 A;  1YRT A;  4W92 B;  3DOK A;  4WP3 A;  3HKW A;  3G9C A;  4X4U A;  1NU4 A;  3D6H B;  5D3G B;  4OZ3 A;  3MM7 B;  5M2U A;  4FF4 A;  3T5K A;  5L1J A;  2QSW A;  2B0G A;  2YVS A;  1AZS A;  1SB6 A;  3TZY A;  1PBU A;  4X4N A;  2HGM A;  3IR7 B;  4NEY A;  1YJ7 A;  4LRF A;  1NJY A;  2A18 A;  2FHM A;  4LBI A;  2DY9 A;  1KVK A;  2XEX A;  2IFX A;  4ZCL A;  2EK6 A;  1CEZ A;  4X4T A;  2ZZN A;  2LXU A;  3HHN B;  1RT4 A;  1SQF A;  3N5F A;  2Q79 A;  1ZBT A;  1X9M A;  2CQ3 A;  5AT1 B;  3HD2 A;  3ZO7 A;  2CQG A;  3DLB A;  3CT9 A;  4PWD B;  3LPY A;  1S49 A;  3OXG A;  3BR9 A;  3MCM A;  1PJ6 A;  1OY6 A;  2FJE B;  4JV2 A;  1D9A A;  4R5P A;  3KHL A;  3OL9 A;  3MM9 B;  2M52 A;  3BKU A;  4LF8 J;  1U24 A;  5EGY A;  4P10 A;  2I9S A;  1VYA A;  2D7S A;  5KFK A;  3JTP A;  3VF0 B;  3H20 A;  1VQ4 S;  1UVJ A;  4KSE B;  3N4W A;  3BJY A;  2BVZ A;  3MD3 A;  1NRK A;  1FJC A;  1UW9 A;  4ZP7 A;  4UW2 A;  4NRT A;  3LUY A;  3EGV A;  3RB0 A;  5ETT A;  3PJX A;  2CJA A;  4FBU A;  3AB2 B;  3R97 A;  5IC6 B;  3JQJ A;  1H2T Z;  4URS A;  2HGL A;  3HP6 A;  4LRC A;  3HJF A;  2BDP A;  2E9T A;  5T41 A;  3EDQ B;  4L75 A;  4TQS A;  3D1H A;  1HNI A;  1RAE B;  1XNQ J;  2HS0 A;  2ZH6 A;  3GFX A;  5HI7 A;  3K5O A;  5KFQ A;  3OLB A;  3BSA A;  4Q2M A;  2VBW A;  2F4V F;  3CIZ A;  1FDA A;  1HPZ A;  3Q24 A;  3R7B B;  3GIK A;  1WG1 A;  4OJ3 A;  2MQQ A;  2HYI B;  3M8W A;  3HI9 A;  2NXC A;  1JX4 A;  4PUO A;  3T3F A;  5E7O B;  2YNI B;  2HVD A;  3MED B;  4FKY A;  3NG8 A;  4EFA C;  2JC0 A;  1QJH A;  2GAG C;  2W9C B;  2I8E A;  2MZQ A;  1O51 A;  1RWM B;  3N6L A;  1ZA2 B;  4ZPB A;  3KJQ B;  5F8I A;  4U9R A;  4HEA 9;  4P75 A;  4OI2 A;  2Y1I A;  3NEK A;  3I82 A;  4ZN1 A;  1FO1 A;  4Y3C A;  3CPW R;  3CJ0 A;  2HG4 A;  3UE2 A;  1S59 A;  1HWI A;  2J7U A;  4YB7 A;  2N4D A;  4FZV A;  4DS4 A;  2X1B A;  5BYQ A;  2GJ2 A;  2J0Q D;  4M5H A;  3IRW P;  3RAQ A;  1ZPW X;  2HMI A;  2BV3 A;  3MEC B;  1RWP B;  3CDB A;  5HQ8 A;  4O3O A;  5E0O A;  3SFU A;  3I0R B;  1Y11 A;  3ZNJ 1;  4DPO A;  1HWL A;  2C2Z B;  2FB0 A;  1RHQ B;  1UA1 A;  2JEG A;  3OSP A;  3W2W A;  3VHQ A;  2YNG A;  4HLB A;  1U47 A;  1LW2 A;  3TUI C;  3A13 A;  1NK9 A;  3AXM A;  3M2U A;  4Y00 A;  3LQV A;  3PVX A;  2HBR B;  5KT7 A;  3RZA A;  4DSE A;  5F0W A;  1DY3 A;  3V81 B;  1HBU A;  3W9J A;  2IBK A;  4OLP A;  2R42 A;  1RBL A;  2V69 A;  1XK8 A;  1T03 B;  1FKP B;  1M5V C;  2NSB A;  3F41 A;  4MIB A;  2V9W A;  4FF2 A;  2PDA A;  3ZXW A;  3AOA A;  1QSL A;  2A6O A;  4F67 A;  4JI5 F;  1HNZ J;  4M95 A;  1FXR A;  4QWB A;  1HR0 F;  1YJW S;  5HVF A;  1UJ6 A;  4C7Q A;  4YS2 A;  3FQL A;  3GFZ A;  4MFB A;  1RP5 A;  2N7C A;  3PHT A;  4EK2 A;  4CLK A;  4USV A;  1RTI B;  3OFH A;  1YI2 S;  2DT9 A;  5J2P A;  3THV A;  4IG3 A;  2DNR A;  2ZNY A;  1HNX J;  4ZVR B;  1TUG B;  1S6U A;  1JWW A;  5HJY A;  3R5G A;  5KOW A;  4YN3 B;  1VGY A;  2DY1 A;  4PPZ A;  5ETQ A;  4LFA J;  4WK1 A;  1MNE A;  3TJA A;  1FNO A;  3G96 A;  1QLN A;  2XMT A;  2P8I A;  2GC8 A;  1JMT A;  5L1L A;  3AHP A;  1OMS A;  3U1L A;  2EBG A;  3KLG A;  4A8O A;  1KEK A;  2KHD A;  3L7P A;  4IH6 A;  3GMG A;  4QWE A;  4P2S A;  3SCK E;  3G86 A;  3L4B C;  2RUG A;  2GMJ A;  4F0M A;  4PYD A;  1KR4 A;  4I64 A;  4F3M A;  1TV6 A;  3C3L A;  1IXK A;  3KJV B;  2ILY A;  3MEG B;  2HRT A;  3QT8 A;  2XLI A;  1KLM A;  2IAJ A;  1WI8 A;  2ERR A;  4IH5 A;  1HI1 A;  5H1S V;  1SJQ A;  3R7S B;  1EQ0 A;  5C25 A;  2CPJ A;  2ZJP Q;  1C1B A;  3SI8 A;  4TLR A;  3AA9 A;  2POK A;  3DI6 B;  3V4I A;  1BQM A;  2AV5 A;  4OHY A;  4NLS A;  1WWH A;  4LFC F;  3CO0 P;  2HVH A;  1TVR B;  3FFI A;  1HQU A;  3PRD A;  1FXD A;  4G1Q A;  5F3Z A;  2GA7 A;  4DUZ J;  1RT2 B;  2VJU A;  5B0G A;  5KFC A;  1Q8B A;  4NRU A;  2XCA A;  1FE0 A;  2CJX B;  1SIW B;  2PE8 A;  3AY0 A;  3P5B P;  4EYH B;  3C6U A;  1VIX A;  2CAD A;  3PX6 A;  4FBT A;  4P7T A;  5I3U B;  2B7B B;  1U26 A;  1TL3 B;  2HHT A;  2LU1 A;  3GTY X;  3K17 A;  1IKV B;  3DM2 A;  4J9N A;  2QTW A;  1IKW B;  2YWG A;  5T7L B;  1U1O A;  2VQF F;  4O44 A;  3VVT A;  4J91 A;  2YH1 A;  2IM2 A;  3D3C J;  1ELO A;  4D3H A;  2G1D A;  4DX8 H;  1CLF A;  1HW9 A;  2EW9 A;  2FUG 9;  4AT1 B;  5LXR A;  3P5T L;  3FSY A;  3FRY A;  1U1M A;  5LT5 A;  1RE1 B;  3PX4 A;  1U0S A;  4OX9 J;  3N9U C;  3TJ9 A;  1UAW A;  1OY9 A;  1RTH B;  4ZLP A;  4C4W A;  2KJW A;  4MK9 A;  4TU8 A;  3QGI A;  1X4D A;  3FEZ A;  2LA6 A;  2B5J A;  4M1K A;  1ZTT A;  1RB0 A;  2A0F B;  3AJ2 A;  4Y2C A;  3BYP A;  4PPD A;  5H9E J;  5DLF A;  3TZZ A;  1SH2 A;  4MIW A;  5KT3 A;  5GME A;  3CF5 Q;  3LAN A;  1I6J A;  5KAK A;  4Y6I A;  1PKU A;  2FVP A;  4NZ6 A;  4K4U A;  2AD9 A;  2AJ4 A;  4EGL A;  1SC1 B;  2W2M P;  4F36 A;  4LSN A;  2G2Z A;  1RHJ B;  2G0J A;  3QRR A;  2OMO A;  1VMB A;  1N8R T;  1NK7 A;  2ATL A;  1QTN B;  1CS4 B;  2E1A A;  3LGM A;  1IQZ A;  1R7I A;  8ATC B;  3PEJ A;  3DHW C;  3MOZ A;  2QJ3 A;  2H5E A;  1U4B A;  2FJB B;  3CCJ S;  3B6B A;  4ZP6 A;  2P9E A;  4K59 A;  2GVZ A;  1X5T A;  2FVR A;  4PXD A;  2D69 A;  1X0P A;  1N36 F;  1T9T A;  5SUH A;  3M6W A;  4OI1 A;  2YX7 A;  1MWZ A;  4X2B A;  3PX0 A;  1EIY B;  3VAG A;  1U1Q A;  2FGC A;  2IJR A;  3EE3 A;  3EYZ A;  1J5E J;  3JSM B;  3UWT A;  2HNY A;  3UDC A;  2L9N A;  2OSR A;  2OI2 A;  4QU7 A;  1RT3 B;  2IJN A;  2HBQ B;  4U7U K;  2J8S A;  3DOM A;  3CWJ A;  1UWA A;  4I67 A;  3ILL A;  5DO2 A;  4YOE A;  2N3L A;  5GAD I;  1H7W A;  1N88 A;  1WHY A;  4FF1 A;  2RIJ A;  3M1V B;  5AE1 A;  3CO9 A;  3A8K A;  1NPR A;  3ZTR A;  3EZO A;  2VC1 A;  1D8Y A;  2KDO A;  1WSR A;  3D0H E;  2JOQ A;  4ZLJ A;  1GFW B;  1T94 A;  4XDD A;  1JJ4 A;  4RW9 B;  1N5Y B;  2FZG B;  4FP9 A;  4FVC A;  2HQF A;  1UKU A;  3CME S;  4DR3 J;  1I94 F;  3UQS A;  1FRK A;  2R3V A;  2V2Z A;  3MR7 A;  4ZPT R;  2C2D A;  3TUZ C;  3PHE A;  1HYS A;  3IS9 A;  1PC5 A;  5LOQ A;  1N5S A;  5MLC V;  1KVJ A;  3IWL A;  3BV8 A;  1XIQ A;  5KG5 A;  3A1Y G;  4ZPA A;  3A8I A;  4USU A;  2V4R A;  2AYE A;  2E5J A;  5JJB A;  3OSN A;  1DTQ A;  2B3T B;  1PG5 B;  3BS9 A;  4CCH A;  1M5P C;  2V4J A;  1Q81 T;  3GFH A;  1B0T A;  2Y0B B;  4CLY A;  3HZE A;  3H7H B;  2FY8 A;  2Y0S D;  1R0C B;  1NSA A;  5CYJ A;  2R2U A;  1N32 F;  2CQC A;  1UL3 A;  4DU7 A;  3HSJ A;  4NL5 A;  4C98 A;  2OO4 A;  3MMB A;  1UEV A;  3ZC4 A;  2CQD A;  2QO3 A;  1P27 B;  3BPD A;  2B9E A;  4ZVG A;  2EBE A;  2DH9 A;  4ZJO A;  1WC1 A;  3IR5 B;  5C42 A;  4C11 B;  1UVI A;  3AOD A;  3OUY A;  3G6Y A;  4RBV A;  4UUX A;  4X4R A;  2DNQ A;  4XIU A;  3O3L A;  4P2X A;  4OJG A;  4PEO A;  5HMY A;  3TX0 A;  4DL3 A;  1H6K X;  2UXB J;  3BGR A;  4CO2 A;  5JMN A;  1VR6 A;  4ECY A;  2MZ1 A;  1U02 A;  1VIO A;  4KGV B;  4E0D A;  3N0V A;  2RHS B;  3V6D A;  3HVT B;  3IFE A;  4DPU A;  2XG8 A;  1FX4 A;  1MLA A;  3OTO J;  2J6T A;  2ZM6 J;  4I4B A;  3IRX B;  4OI0 A;  1REG X;  5A8R B;  4BCA A;  4HT5 A;  3QSY B;  1U0H B;  2VAS A;  4Y65 A;  2XC9 A;  2HS4 A;  2IJF A;  5HO4 A;  4TU7 A;  4LRD A;  2QX0 A;  3HK2 A;  1M1H A;  3DLG B;  3W5Y A;  3QJL A;  3HJV A;  4WPA A;  3P96 A;  2RKI B;  3BSC A;  4DCO B;  1RAJ A;  4N8N A;  2AT1 B;  3M7V A;  3W5Z A;  3PW0 A;  1YHQ S;  1HIY A;  3TI0 A;  4KR0 B;  5D78 A;  2Z2M A;  1RT7 B;  2XMU A;  2WBM A;  4ZPW R;  3RB3 A;  1TK5 A;  3BEG B;  3GJQ B;  1UFW A;  3FSX A;  1IM4 A;  1HNW J;  1C0T A;  3PR5 B;  2GNK A;  1Q8I A;  3A3P B;  1YJR A;  2CKW A;  4ALZ A;  1UFL A;  1AUD A;  5KG0 A;  2I0X A;  4OZ5 A;  2RF2 B;  5IV3 A;  2OFG X;  2WVE A;  4R25 A;  4TY8 B;  4AQY F;  2UXC F;  3D3B J;  2G2Y A;  2ZHO A;  4CO4 A;  4R8U B;  1V9O A;  1IBK F;  4IFV B;  2BR0 A;  2QLJ B;  3HHK A;  2B9W A;  3K89 A;  2Z2Y B;  2YNH A;  2IM0 A;  1QAY A;  3NMA A;  1JLE A;  1QM9 A;  2KFZ A;  3QGG A;  1FRH A;  4CO5 A;  3BRE A;  3I0S A;  4MJK A;  1ZET A;  1NB2 A;  4OV1 A;  4GC6 A;  1JLF B;  4G65 A;  1IKX B;  3I5B A;  2F4F A;  2UV8 G;  2V4Q A;  1O6X A;  1LK7 A;  2GIQ A;  4RWW A;  3H4D A;  3RBZ A;  1YJV A;  5BXI A;  3CJ5 A;  1NK0 A;  2HHU A;  1T9X A;  4ECS A;  3E01 B;  2W9B B;  1U45 A;  1A9N B;  5B0E A;  4PRF A;  4Q0B B;  2KFY A;  3FMW A;  2C1E B;  3M05 A;  2ATC B;  2C28 A;  1NDK A;  3CIM A;  3HHD A;  1RWO B;  2QMW A;  1D3W A;  2HK2 A;  1YBT A;  3V5R A;  4ED1 A;  3NRB A;  3R9L A;  5K8P A;  2DXE A;  3VZH A;  1FK9 A;  4DHV A;  2W25 A;  1SUQ B;  3GG0 A;  1IR2 A;  3UDL A;  2M2B A;  3MXH P;  4CLU A;  1URN A;  4CM0 A;  4FYY B;  3P3D A;  3NCQ A;  5AXL A;  1QE1 B;  2R7W A;  3BH6 B;  4JUZ A;  2WOM B;  3DMJ A;  2XTJ P;  2L41 A;  2ZKU A;  3TJ8 A;  2MY7 A;  3VVU A;  2CJK A;  1HBN B;  1FJG J;  2NR0 A;  4F2R A;  1TL1 B;  1VQY A;  2E44 A;  5KFE A;  5CCL A;  3VWS A;  1H7X A;  4JI8 F;  4OIX A;  2M8H A;  1G6B A;  2PFF B;  3CJS A;  1CQN A;  1LWF A;  3QGP A;  3BGO P;  4OZJ A;  1VBK A;  4FN5 A;  1APS A;  4MYT A;  5HRO B;  4DV0 F;  4LFB J;  1IKY B;  5IWA F;  2H48 B;  1F9E B;  1Q78 A;  3SQG B;  2YPZ A;  2HNZ A;  4DL2 A;  3UN5 A;  4QU6 A;  2HPU A;  2GIF A;  1E6V A;  4XK8 C;  4WE1 B;  4UY8 5;  4DV6 F;  4AL5 A;  2OML A;  2WB1 D;  2YKM A;  2F9J A;  2WAQ D;  5K5M A;  4ICL A;  2KVI A;  3CVK A;  4ECW A;  1S57 A;  1K1S A;  4LF4 F;  1RAD B;  3CDW A;  4DL7 A;  1VQ9 S;  1CUL B;  3L9Z A;  1M90 T;  1DQ9 A;  1RT5 A;  2J8A A;  1Q5Y A;  2VPX B;  4HTJ A;  3J7Z 5;  2YPY A;  2LU2 A;  1Y4Z B;  2ZUA A;  1TFY A;  3WC2 A;  2ZVS A;  1RLD A;  1RYS A;  1KWM A;  2QA1 A;  3W2V B;  2G0I A;  4RUH A;  4QIF A;  3EM1 A;  1WI6 A;  1I1G A;  3HVW A;  1U1N A;  1VQN S;  3MAA B;  2HKE A;  1EP4 A;  3PKY A;  1TAU A;  3RB4 A;  1HFE L;  2AJF E;  3JS9 A;  2BM1 A;  5KFB A;  4C8Z A;  4DS5 A;  2MHN A;  2EG1 A;  3L09 A;  2Y1J A;  1AUS L;  1JJ2 R;  2HIY A;  2DH8 A;  4UOF A;  5KFV A;  1X5P A;  2HQG A;  2HGN A;  2R8I A;  2CQ4 A;  2GO9 A;  3T19 A;  4XPE A;  3MAH A;  4ATN A;  2R8K A;  4QIW D;  4DI6 A;  3EVO A;  5K8M A;  1Q4R A;  3Q8R B;  2Q66 A;  2RDI A;  1T3N A;  2GVD A;  3H2U B;  3KK2 A;  3FVY A;  2OIH A;  3Q22 A;  1C1C B;  2BJ7 A;  5HBM A;  3L95 X;  2QV6 A;  4R5P B;  3QWP A;  2J9D A;  3N28 A;  2O01 C;  3THP A;  3D68 A;  3OL8 A;  4ES3 A;  4DV2 F;  1S72 S;  3NBP B;  2B8Q A;  2ZC4 A;  4ZCI A;  4NLP A;  4WF9 Q;  1S99 A;  1LWX A;  3D7S B;  3ILI A;  5H9F K;  1LWC A;  5AXM A;  3MTJ A;  4RW4 A;  3RJM B;  1WEX A;  1RAA B;  5D8H B;  1UEK A;  4PAA A;  1WOS A;  2KT5 A;  1RSC A;  4DV4 F;  3RRK A;  4IO1 A;  4LSL A;  2UUC F;  2FZK B;  5KFD A;  2AKW B;  2ZWO A;  4YP3 A;  4NLD A;  2MKC A;  1HNI B;  3EXY A;  2YWE A;  1Y5N B;  2ZE2 B;  4ZK7 M;  1U6Z A;  3MMA B;  4QIE A;  3BYR A;  4PG6 A;  5DET A;  1RLC L;  4USK A;  5ETL A;  2AJQ A;  4TNO A;  5EWF A;  5FJ4 A;  3K5L A;  1NH8 A;  3DRS B;  2ZHB A;  1YZ6 A;  2YQ3 A;  4J9U E;  1OJ4 A;  1YKW A;  3WC0 A;  5E5N A;  3PIO Q;  2KKH A;  2KTQ A;  2HW3 A;  4G6V B;  4PUO B;  1QAX A;  5KFX A;  1J5O A;  3QO9 A;  1EB0 A;  1XNQ F;  1HQ2 A;  3SCJ E;  3UFC X;  1LEO A;  2E7X A;  3MM8 A;  3DLE A;  1ROF A;  4FPI A;  5KTQ A;  2HS3 A;  1VQ7 S;  2RHQ B;  2DNK A;  1S9F A;  1SKR A;  1F9F A;  5KFY A;  5F8G A;  5J2M A;  1QUV A;  3H59 A;  2ZJQ Q;  4MTP A;  1R0A B;  3MFI A;  2U2F A;  3CUL A;  3BSO A;  2MZJ A;  2R7V A;  4JV5 F;  1B4S A;  2BE7 D;  3EGN A;  5CZV A;  2M0G B;  1D0E A;  2XSJ B;  3GIR A;  1RXO B;  2DJW A;  3RGI A;  5DQI A;  2LDY A;  3ITH A;  3CJ8 A;  2FQQ B;  2XHW A;  1VI7 A;  3ISZ A;  2K2P A;  1PIE A;  4WYL A;  2YNG B;  4ECR A;  5HAO A;  1YJU A;  3QFH A;  5KFJ A;  3I96 A;  1UVL A;  1JQG A;  2HQC A;  1HNV B;  3M4X A;  3M8Q B;  3M32 A;  2ALZ A;  1UMJ A;  2J9D E;  3UVJ B;  4PXE A;  4UQG A;  2ABY A;  5M2R A;  3SV4 A;  2QYG A;  2CNK B;  2W8K A;  1ITP A;  2DCU B;  1FRI A;  1GX6 A;  3ULH A;  3OTB A;  1LFW A;  3AOB A;  1RU2 A;  3AQP A;  4N77 A;  2WSE C;  2D41 A;  2F8E X;  4B3S J;  4H4K A;  1SKW A;  1TKX B;  1VBX A;  1FTC A;  1Q53 A;  2YWF A;  4DPX A;  3R1L A;  3C19 A;  3GII A;  2AWZ A;  2LQ5 A;  5DDP C;  4RLE A;  5KG3 A;  4IR9 A;  1DLO B;  3R5J B;  3GE9 A;  3FRZ A;  4BC7 A;  1QD1 A;  1VCT A;  4YUD A;  1T02 A;  1NSQ A;  3PW5 A;  2PGC A;  5LMN F;  1HD1 A;  3W66 A;  3BGL A;  1FRL A;  2QL7 B;  3SSR A;  4NXN F;  5KFW A;  2UVW A;  2DPJ A;  1IR0 A;  1KBR A;  4ZPC A;  4KV8 B;  1WDD A;  4YDX A;  4C8L A;  3BB5 A;  2XMM A;  2XI2 A;  1URR A;  1TUW A;  3MD1 A;  4CZC A;  4O3S A;  4LRB A;  1F5B A;  4I6W A;  2VL1 A;  4I0W A;  1NK4 A;  1WF0 A;  4M5G A;  1RWX B;  2IRU A;  2AZ3 A;  4A8M P;  4L74 A;  3KNA A;  4RW6 B;  3MMJ A;  3IR6 B;  3BBF A;  2Q6B A;  2FHK A;  1SH0 A;  3ZZU A;  2CZV C;  2RAQ A;  3G8T A;  3BO2 A;  2AGP A;  2WHO A;  3SFG A;  2P2C B;  1XJW B;  2DBB A;  1CJU A;  4RW8 A;  3VGT A;  5GMK a;  1TV6 B;  1QUP A;  4YY3 F;  1EET A;  3D2W A;  3MM6 A;  4JI5 J;  2CQ2 A;  1HR0 J;  1U1P A;  5D4N A;  3ZNU A;  1MU2 A;  4K5S A;  3HMJ G;  4I1T A;  3Q2S C;  1NHV A;  2MMY A;  3MEK A;  1NKB A;  4K4S A;  1C1B B;  2AZ1 A;  4KHP J;  1GX5 A;  2E66 A;  1VQ5 S;  3PFO A;  3OHB A;  1ZZN A;  3GV7 B;  1X4B A;  1K9M T;  1NND A;  3QPI A;  2KB2 A;  4ZVT B;  3EXC X;  2FC9 A;  1SC4 B;  2MKY A;  4USH A;  1KSP A;  2R8J A;  3FFI B;  4CO0 A;  1HQU B;  4ETX A;  1BD6 A;  1HHS A;  4WFZ A;  1P1T A;  4G1Q B;  2PN6 A;  3MEE A;  5B7W A;  3M6V A;  4HHU A;  2DGW A;  2MKK A;  2BKN A;  4OHZ A;  2BE2 A;  2CJB A;  4P72 A;  4ID5 B;  3KUE A;  4NAS A;  3C6U B;  2HFU A;  1Q1K A;  4X64 F;  5CCM A;  2LQJ A;  2WW8 A;  4O4G A;  1KVI A;  3T6B A;  2CVI A;  5F0U A;  2E7W A;  2JNJ A;  2UVR A;  1CJV A;  3GV5 B;  1MW7 A;  3DM2 B;  3K58 A;  2OEK A;  3JSR A;  2C2R A;  4Q45 A;  3OLA A;  1S10 A;  3RAX A;  2YX1 A;  3Q0A A;  4GKK F;  1QTM A;  4DUZ F;  2AX0 A;  5CHC B;  2Z58 B;  4EBD A;  4LUB A;  3CW2 C;  3GSI A;  3PRV A;  2E1M C;  5B08 A;  1WAC A;  2QLB B;  1WNE A;  2NYH A;  1N56 A;  2OH2 A;  2CZ4 A;  5KFZ A;  2IYG A;  1FD8 A;  2ZBR A;  1WOO A;  4F02 A;  2PI5 A;  4NLR A;  4C8M A;  9ATC B;  4WKR A;  3HX9 A;  5KFM A;  2NPI A;  2ADB A;  3AFG A;  4C8O A;  4EU0 A;  5A6P A;  1Q95 G;  4LFC J;  3NY0 A;  1N0U A;  4B9V A;  4CLT A;  5FLX Y;  3IG1 A;  2QLF B;  4KFB B;  4FPR A;  2B5J B;  3BKT A;  1XR6 A;  2UZA A;  3QWU A;  1SVD A;  1WOP A;  3NGT A;  2RSQ A;  4KQZ A;  3ZTS A;  3TAM B;  3MCO A;  1F60 B;  4LQ3 A;  1CQM A;  4B9L A;  1HHQ A;  3TO8 A;  3IBC B;  2HRU A;  3RB6 A;  4HHH A;  4RR5 A;  2B9Y A;  3M2R A;  1TL4 A;  2GMH A;  2WVB A;  1AFI A;  4PR6 A;  3RR7 A;  3IAS 9;  5F9L A;  1Y00 A;  4DUY F;  3FZ2 A;  2DNO A;  3TRG A;  3W8P A;  3A4T A;  2BXJ A;  1ZM9 A;  4RO0 A;  2V94 A;  3X3U A;  4OJH A;  1NDL A;  4EZ6 A;  1RUS A;  2IY5 B;  3BQ2 A;  2VG6 B;  2DR6 A;  2RT3 A;  2GFF A;  2VUG A;  3E2E A;  2ZDO A;  5EX3 A;  4FXV A;  1X4E A;  1E6Y A;  5KFP A;  2VG7 A;  3ENA A;  3NNH A;  1FEE A;  1ULR A;  4ECT A;  2EK1 A;  5IQ6 A;  4LJM A;  3OT9 A;  3MPY A;  3CCS S;  1H73 A;  2MHE A;  2MZT A;  1FDD A;  4A8Y A;  3TAQ A;  5J2N B;  1VRT B;  2HK3 A;  1WOR A;  1RGV A;  2H65 B;  2KVQ E;  1AW0 A;  1S9E B;  1VK3 A;  2YQ0 A;  4M5J A;  4CLZ A;  3UD5 A;  4MK7 A;  2V8P A;  3TR5 A;  2IDE A;  1TKT A;  1TEL A;  5AXN A;  4OZN A;  2V8D A;  4JI7 F;  1KC8 T;  3MOJ B;  1RZM A;  1RAG B;  5DG8 A;  3OL6 A;  2CNO B;  4HAC A;  4Y34 A;  2B8P A;  1S79 A;  2HLT A;  2DNN A;  1CJK A;  3CJT A;  4NCG B;  4NYO A;  4GC7 A;  4HKQ A;  4DG1 A;  1N36 J;  4MKA A;  4J7C A;  1XTZ A;  2O1P A;  3R8Y A;  4L3K A;  3C16 A;  5LL6 d;  2Q1L A;  3SZ2 A;  1CJT A;  3ZZP A;  3G71 S;  2UV8 A;  4O3R A;  3K59 A;  2DIT A;  3KLI A;  4WKY A;  3H40 A;  3VAL A;  2AEJ A;  4Q44 A;  2UP1 A;  1F5A A;  1D9F A;  2M5Y A;  1FWK A;  3IS9 B;  2P9G A;  4V19 J;  3IN5 A;  1R43 A;  1L3K A;  4I2P B;  2NUU G;  4TVA B;  2E5I A;  1SJR A;  2LQ9 A;  5JVH Q;  1LXN A;  3NLC A;  5HQM A;  5D0G A;  2V34 A;  2UVV A;  3DFE A;  3HSD A;  5GAH I;  4OHV A;  3SYZ A;  5KFH A;  2DGT A;  3SDE A;  2CYY A;  1S97 A;  5CZX A;  3TEH B;  4ZHR A;  3MUT P;  1F3V A;  1VQP S;  4OFZ A;  1S4E A;  4P52 A;  3DOL A;  2KO1 A;  3MMB B;  1G7C B;  5CXT A;  3LP2 B;  4R0E A;  1JLQ A;  3BF4 A;  3NS7 B;  2OP5 A;  1YLX A;  2IHR 1;  1JXV A;  3I87 A;  5KG4 A;  1UPM B;  3TOQ A;  4I6Y A;  3S8S A;  1YBU A;  2LMI A;  1X31 C;  1T11 A;  1C2P A;  5KFO A;  4DL0 C;  1I94 J;  3QJJ A;  3VR1 A;  3C14 B;  1LV5 A;  4WXO A;  1RCX B;  2B6A A;  2VH7 A;  2H54 B;  4YFU A;  2XS7 A;  3V6D B;  1B64 A;  5D15 A;  2DD8 S;  1FEH A;  3C6T B;  1JKH A;  3NGD A;  5G0R A;  2CFX A;  2DO0 A;  2K1R A;  3FZB A;  4I7F A;  2VBX A;  2HZV A;  5LMU F;  3KWM A;  1VFJ A;  5B09 A;  5FDL B;  3PM9 A;  2CNL B;  4OI3 A;  2CPD A;  4RNF A;  1YVF A;  1SL0 A;  1FVS A;  2M88 A;  1C0U B;  4O23 A;  1NDP A;  1LWE A;  3DLH A;  1N32 J;  4PYA A;  1WKJ A;  1VBY A;  3BQ1 A;  4OL8 A;  2OEL A;  1PAU B;  4NLG A;  1RK8 A;  2V8V A;  5A8K A;  4MAK A;  1UWB A;  2BQR A;  1C0T B;  3D54 A;  1NKE A;  4NMX A;  4CH1 A;  4TLQ A;  4TYA A;  4ELV A;  1NXI A;  5CAB A;  4PQU B;  3W64 A;  2CG8 A;  3CCR S;  2EFG A;  3VAJ A;  3J7Y U;  4F26 A;  3TYT A;  3V6H A;  3OPK A;  2WK4 A;  5A6W A;  3BGU A;  3H8Y A;  1XNR F;  4DX5 A;  1FFS B;  3TX8 A;  1U49 A;  3QAE A;  1YIT S;  3TW0 A;  4RNN A;  3IBF B;  1OPZ A;  3GJR B;  4I69 A;  2HIQ A;  1Y0H A;  1GXU A;  2AYM A;  2OPR B;  1VRU B;  2PD1 A;  5KFN A;  1SV5 A;  3G82 B;  1KRP A;  1D1U A;  3PCO B;  1RWU A;  1CSJ A;  1KQK A;  3MDF A;  2ZNZ A;  3M2V A;  2UUT A;  1UVK A;  3KHH A;  1X9S A;  4TKT A;  2YX4 A;  2RQK A;  2KN4 A;  4YME A;  3CJ2 A;  2QZ8 A;  4EWT A;  2XMA A;  4UY8 T;  3U27 A;  3BZQ A;  5KT5 A;  3TP2 A;  1SL1 A;  2JHE A;  3VAI A;  1S48 A;  2JLE A;  4CQ1 A;  3G8S A;  2FY1 A;  1S1T A;  3VGU A;  2WSC C;  3WX4 A;  2WW4 A;  1NPK A;  4O0N A;  4KTQ A;  3J7Z T;  4GVB A;  1JLA B;  1SCJ B;  4IOA Q;  2I6W A;  3ZFV A;  2D3Z A;  4IQX A;  3FBF A;  1PYO B;  3R7N B;  2DH7 A;  1FK9 B;  4DR6 J;  4DZ6 A;  4AQY J;  3HSZ A;  3R27 A;  3NCR A;  1GMW D;  2K7K A;  4ED5 A;  2VPY B;  4V1A k;  1V3S A;  1IBK J;  1PCA A;  4Y2K A;  3CDU A;  5IM0 B;  1N6Q A;  1SJ4 P;  4OLO A;  1IBM F;  3H98 A;  3DMJ B;  3LPE A;  3EVW A;  1R6V A;  1QSY A;  4KO0 A;  5EHH A;  2V63 A;  5J2Q B;  3D0I E;  1N4L A;  3H2L A;  1R8C A;  3PW7 A;  1U7L A;  5HSP A;  4UZC A;  4LF9 F;  3KK3 B;  4IFY B;  4DN0 A;  2I5J B;  5I42 B;  3KMQ A;  3D0G E;  1RT6 A;  1VOM A;  4P6Q A;  2J6U A;  2FJX A;  3V6K A;  1BMQ B;  4DSF A;  2JRS A;  2DEJ A;  4TXS A;  3FEX B;  1REV B;  4CNZ A;  3U1N A;  1E6V B;  2ZH7 A;  1ZYQ A;  3M6X A;  2VA3 A;  2XO6 A;  1VK8 A;  2YKM B;  5HK4 A;  4ICL B;  3R5A A;  2K7J A;  2EG2 A;  2G2O A;  3SXL A;  4NLV A;  5D3G A;  4FYW B;  1Q7Y T;  1RT5 B;  1SIZ A;  2R8H A;  2RDD A;  4DV5 J;  5DRK A;  3G4S S;  3KJF B;  3GJS B;  3H25 A;  4PG4 A;  3DLK B;  2HBZ B;  5DGA A;  4RKU C;  2MXY A;  2QG9 B;  3KG1 A;  2RS2 A;  3PNI A;  4JI2 F;  1CPZ A;  1HA1 A;  3X1L B;  3O2I A;  1TZ0 A;  1T05 B;  1ICE B;  4JI4 F;  4AYB D;  2JH3 A;  1FT8 A;  4NI2 A;  4CRJ A;  2A10 A;  4JI8 J;  1VLY A;  3KMS A;  2XYH B;  1RWK B;  1OWX A;  4ZVH A;  1SQG A;  4PXB A;  3W9I A;  1ZAX A;  2P9C A;  1A0O B;  1RTJ B;  2H9Z A;  4A8K A;  3TVK A;  1R31 A;  2QGF B;  1HBM B;  1RBO B;  1YG0 A;  3MM9 A;  2N3O A;  4I68 A;  5DG9 A;  2AQ4 A;  4NZ7 A;  2EPI A;  3E8O A;  2CDR B;  4KGM A;  4WCE Q;  4ENO A;  4M5N A;  3IO1 A;  4CLF A;  3MR2 A;  4C0H A;  2J7W A;  3QQC D;  2HRY A;  1FKO A;  3DGP B;  4IOC Q;  1X5O A;  3MUR P;  4FVM A;  3KK2 B;  4LF4 J;  4DR1 F;  3AD8 C;  2KYX A;  1LW0 A;  2EEY A;  4CI0 B;  5HBM B;  3UDE A;  3SQO P;  3KHG A;  4OX6 A;  2J0W A;  3CNQ P;  2DR8 A;  1EHW A;  1MWY A;  2KXF A;  4WU2 A;  4BWM A;  4IDK A;  4FDF A;  1P1L A;  1TMM A;  3IA0 A;  1LWC B;  2RH3 A;  2BJ8 A;  4ILL A;  2DCL A;  4ZPV R;  4WP9 A;  4C8Y A;  1Q0N A;  1M5K C;  2CPI A;  2W2N P;  1WF1 A;  1Q82 T;  3KNG A;  3B82 A;  3R5C A;  4G1I A;  1DAX A;  4LSL B;  1HWK A;  3BGF A;  5C24 A;  2YNI A;  4DLG A;  3GCX P;  1WJ9 A;  2A6M A;  4HVZ A;  2VIH A;  2W9C A;  4C8K A;  1VC5 A;  1QAI A;  1FER A;  2R7O A;  2D9O A;  2QA4 G;  1O8B A;  3O8W A;  4G3I A;  1UVN A;  3W7B A;  4ED7 A;  4RBT A;  3ETM A;  4CM2 A;  3ONQ A;  3W62 A;  4EI2 A;  5F8H A;  4K4Y A;  3JSY A;  5CYQ A;  2WB4 A;  4MIA A;  4CT8 A;  1ZOT A;  2K06 A;  5L1K A;  4RU9 A;  6FDR A;  2CA9 A;  4X62 J;  1ZPV A;  1SJ3 P;  3QO9 B;  4W98 A;  1IBC B;  2DHA A;  3MEC A;  2MKI A;  4EBE A;  3P8B B;  3KUG A;  4DQP A;  2RB7 A;  2M8D B;  1IUJ A;  1BUX A;  4DV2 J;  3UO0 A;  4HR2 A;  3DLE B;  3KLH B;  3I0R A;  2DHG A;  2XCP A;  3LP0 B;  2LEA A;  4OZL A;  3UDV A;  4Y28 C;  2ASJ A;  4JI1 F;  4DPY A;  2OPQ B;  4MT1 A;  2ZZM A;  4DSL A;  2UXD F;  2FHO B;  4DV4 J;  2RQM A;  2W4C A;  1G2E A;  2DNG A;  5JVG Q;  2VA2 A;  2VJV A;  1N5V A;  4DV3 J;  2UUC J;  2CPY A;  3V81 A;  3HPO A;  3AAW B;  2IC3 B;  2J76 E;  1UW4 A;  3CC7 S;  1FKP A;  5L38 A;  4WIQ A;  3LO3 A;  1BWV A;  4U8V A;  3CSK A;  3HXM A;  3MPU B;  2F9D A;  2VBZ A;  3PXG a;  4OQJ A;  4ES1 A;  1S9G A;  2AEF A;  3DRP A;  3CD5 A;  3Q8Q B;  4F8R A;  3POT B;  1WC3 A;  4QYZ J;  1D09 B;  3CC2 S;  2KFN A;  2HQI A;  2FGO A;  2MLX A;  4C9D A;  2IBO A;  2GGP B;  1IWG A;  1FJ7 A;  5KT6 A;  5KG6 A;  4WU3 A;  3V6J A;  1RTI A;  3EGZ A;  2GX8 A;  3VAH A;  5FLX U;  4ER8 A;  2DGU A;  2YWK A;  3RBD A;  2JEF A;  3H5Y A;  2UUB F;  2GAH C;  2AJ2 A;  4JV5 J;  4GVL A;  4O3Q A;  5KFI A;  4IQM A;  4NYP A;  2RU9 A;  4DMZ A;  4B3S F;  5JXS A;  4YB5 A;  2H4Y B;  3P45 B;  2VFV A;  4WP8 A;  3HUL A;  4DLE A;  1PJ5 A;  1KN6 A;  4USJ C;  5HMW A;  4M94 A;  2ZD1 A;  3QNW B;  5DDQ C;  4RUC A;  3G6X A;  1K47 A;  2HHX A;  4PG7 A;  1B0V A;  4ZVP B;  3ZZR A;  2V68 A;  1F0X A;  4A8X A;  3MEG A;  3QFW A;  4DV7 J;  4WFY A;  5E3Q A;  4DSJ A;  2EFV A;  3M8S A;  4C6A A;  2XB2 D;  5F8L A;  1OY8 A;  4D3G A;  1XR7 A;  3EPG A;  4X4S A;  2M7S A;  4U67 Q;  1S1X A;  4NLO A;  4RL1 A;  2JEJ A;  1HWJ A;  2M4M A;  3DI6 A;  4IG0 A;  3PR4 A;  3SSS A;  1RT1 B;  2OEJ A;  2UU9 F;  1F1B B;  1TVR A;  3M30 B;  4NLW A;  1MU2 B;  3EIC A;  4DFJ A;  1RT2 A;  4C48 A;  2QL9 B;  2K3K A;  1L3T A;  3TZX A;  3M8Z A;  5EX0 A;  3QT6 A;  5LMN J;  2MGZ B;  5I3U A;  3PKM A;  4NXN J;  1MSW D;  1TL3 A;  1SKU B;  3CJK A;  2DIV A;  1RWV B;  1UP1 A;  2FIU A;  1IKV A;  2CQI A;  1Z2Z A;  3EGW B;  3TAP A;  3MEE B;  1IKW A;  4EBC A;  1EAR A;  1OSD A;  2BW7 A;  3OQ2 A;  4JI0 F;  1EKS A;  4DUT A;  3HFV A;  4CTA B;  2RQ4 A;  5L9X A;  3I31 A;  2BE2 B;  1HLW A;  4LF5 J;  3CCQ S;  1UJ5 A;  4F0K A;  1JXL A;  3PYD A;  4FS1 A;  3HO1 A;  1W2B R;  5C2G A;  1NJZ A;  2I38 A;  4ANE A;  5HP1 B;  3QMQ A;  4KHP F;  3UCU P;  4LF6 F;  1VRQ C;  3DLL Q;  3FK4 A;  5GAG U;  2QLW A;  3LH2 S;  1U48 A;  2V2Q A;  2BQU A;  5I4M A;  3KLF B;  5A0Y A;  2DNL A;  2IM1 A;  3LAK A;  2ZH4 A;  4YY3 J;  5KFS A;  4KB7 A;  2KXH A;  2YY3 A;  3J81 j;  3PIP Q;  1RTH A;  5F9N A;  2WZ1 A;  2MZR A;  4QW9 A;  3J81 U;  1JLG B;  3UNG C;  4OI4 A;  2I2Y A;  2ZBC A;  4ZVQ B;  1XEZ A;  5THW A;  2GHV C;  2VPW B;  4PG5 A;  2HWT A;  1H2V Z;  3BM7 A;  5G4D A;  5LSR A;  3WHI A;  5ETN A;  3A3N B;  2FPH X;  2RJZ A;  4K8R A;  3DDI A;  4G1P A;  5KFG A;  2V2K A;  3HT0 A;  2EXU A;  4ZLN A;  1S6P A;  4X4O A;  1YZ7 A;  3KLV A;  2QLX A;  1GMV A;  5LXY A;  2D1C A;  3DGV A;  4FNH A;  4U6P A;  5D0H A;  3JYT A;  3VAF A;  4NZ0 A;  3VCD A;  4DR2 J;  3A8E A;  1CS4 A;  2ZBP A;  5I3Q A;  4JBC A;  2XGQ A;  4LT6 A;  4PWU A;  4F7V A;  4AND A;  1U1R A;  3QRP A;  2AEM A;  2LEB A;  2MQL A;  1VC6 A;  2ZH3 A;  4X64 J;  4ZN3 A;  3OR1 A;  4H4O A;  4UUW A;  1U1K A;  4KJI A;  2E1P A;  5HMZ A;  4UT4 A;  4BS2 A;  1PYS B;  3EZU A;  4I2Q B;  1NB7 A;  4FYX B;  3QLH A;  4XO0 A;  3DRR B;  1FXL A;  5IS2 A;  4HDG A;  3JSM A;  2ASL A;  3T5J A;  3GIJ A;  4GKK J;  1F5C A;  1NJW A;  1DUR A;  2B43 A;  2E1C A;  3AT1 B;  4J5O A;  1NCL A;  1NZA A;  2NQP A;  5U47 A;  4ZOS A;  5JUM A;  3T6J A;  2R2R A;  2UUA J;  1FHT A;  1T9Y A;  2HHW A;  2ASY A;  3MAQ A;  1EAY C;  4X84 A;  2OUG A;  3GYX B;  2MY8 A;  2L9D A;  2NCK L;  1U2C A;  2ZC3 A;  2VOP A;  2CUY A;  5L8R C;  1PC4 A;  4AFF A;  3K5N A;  2GJF A;  4LF2 A;  1TMJ A;  4BWJ A;  3ILO A;  1E6Y B;  2DO4 A;  5CYM B;  3M1V A;  2J6S A;  3DRY A;  4OYP A;  2LXI A;  3J80 U;  2FDN A;  3UR0 A;  1W26 A;  1N34 F;  2HHP A;  1R27 B;  2X1G A;  1Q79 A;  2D74 B;  4A4J A;  3PV8 A;  4RBU A;  4R0J A;  2HHQ A;  1RYR A;  2QA4 S;  3NAH A;  5GAE U;  4PWW A;  1N5Y A;  2VHG A;  5J1E B;  5IXU A;  4HL9 A;  4ZA1 A;  3VTI A;  4L73 A;  3R5B A;  2HVE A;  5HMX A;  4KYZ A;  4M5D A;  4U7C A;  2OSQ A;  4DUY J;  2LQ8 A;  1B0P A;  4B17 A;  4OYI A;  4ZJL A;  1WD6 A;  3HHL B;  2CNN B;  5KOX A;  4HAC B;  5ETO A;  2MDA A;  2FJD B;  4OMF G;  1BE4 A;  5DQH A;  2XI3 A;  1FRJ A;  3K8V A;  4ZKA A;  2Y8Y A;  3T9Z A;  4EO6 A;  2QA2 A;  1PO6 A;  1L3U A;  2ZH5 A;  2L08 A;  4WZQ A;  3HHL C;  3OTD A;  1XMQ J;  1KOO A;  1P9Q C;  1WDT A;  2DVI A;  4X66 F;  3NOC A;  3DXS X;  2LFV A;  2OTL S;  4N56 A;  3KLI B;  4C3K A;  2FJV A;  2HZA A;  2X3D A;  3BKF A;  1B7F A;  4JOU A;  3QRQ A;  1NO8 A;  3TQE A;  1P6T A;  3ZZZ A;  4DQS A;  4MKV A;  2VG5 A;  5GAE I;  3ETO A;  5K14 B;  2ILZ A;  3G2X A;  4C11 A;  2NXJ A;  5DLG A;  2B7C B;  1VQL S;  4O4R A;  3SDE B;  3P6Y C;  1EJ7 L;  4A8W A;  2WTF A;  2OHD A;  3Q83 A;  4QIV A;  2VFS A;  1K0T A;  2HQD A;  1ARO P;  4JI7 J;  2PC6 A;  1CC7 A;  3DOL B;  4L3N A;  2W8L A;  4ITS A;  4AD6 A;  1SC6 A;  4KAI A;  3HVT A;  2RNE A;  3Q89 A;  2PT0 A;  1KLN A;  3UD4 P;  2PII A;  2HFN A;  4HH0 A;  2G9O A;  2BOA A;  3NGR A;  2DXD A;  1RAF B;  3IRX A;  5A8R A;  1OQ6 A;  3RBE A;  2W1B A;  4CLP A;  1XN9 A;  3JAM U;  3LTO A;  1R3N A;  4B9M A;  2CPX A;  3R5D A;  4JI3 F;  5B0A A;  3MM5 A;  3SCI E;  5EDW A;  2B6A B;  3DLG A;  4DPT A;  1D8Z A;  2DTJ A;  4LIW A;  4N8O A;  3OFG A;  2XWX A;  2RKI A;  1RAH B;  1N33 F;  3AJD A;  4DU8 A;  4AL7 A;  2BAC A;  1B70 B;  1JKH B;  4UQT A;  3JTO A;  5G0R B;  2WON B;  3OV7 A;  3HVR A;  1RT7 A;  3NP5 A;  1LQ9 A;  3HLU A;  3I6P A;  3FDS A;  3O1L A;  2AIR B;  2FLO A;  4DR5 F;  4XPC A;  1HQE B;  5HLF B;  3LAM A;  3O6Q A;  5IQQ A;  2DHH A;  2X7I A;  3D1Q A;  2IDL A;  1GQE A;  3W9H A;  3QAU A;  2RF2 A;  3MHY A;  3KOA A;  4ZVF A;  1H38 A;  2OAU A;  3G6V A;  4R8U A;  2RML A;  5D77 A;  2XLK A;  5F8J A;  2M9K A;  3UNY A;  4IFV A;  3NL0 A;  2NLW A;  3OFE A;  4C3M A;  2HHS A;  2Q6C A;  3WDO A;  2BAN B;  3L7O A;  1ZM4 A;  1S1W B;  3TNV A;  2PO4 A;  1U8W A;  3NS5 A;  1I51 B;  1UWB B;  2OPP B;  4ZCK A;  4ZIV A;  1FE4 A;  1V3Z A;  3HKZ D;  1HWU A;  4CO1 A;  1KTV A;  3T1Y J;  4DFP A;  2V2V A;  5DDO C;  4TU9 A;  3EWG A;  3RYL A;  4TY9 A;  2XMJ A;  3RAM A;  2WCX A;  1JLF A;  3JXO A;  4Q2L A;  2EC2 A;  1RAC B;  5F8M A;  1S7I A;  1IKX A;  1DJ0 A;  1WKK A;  4DCJ B;  3K7R A;  4K5R A;  2FC8 A;  3C15 B;  5LMU J;  3CMQ A;  4Q0B A;  2AP6 A;  2HEK A;  1X0F A;  1JB0 C;  3C8Y A;  5AE3 A;  1VC0 A;  1HKA A;  2XZW A;  1CBK A;  4ED4 A;  1T7P A;  4O3P A;  3TA2 A;  2BYC A;  2MPU A;  3I4H X;  2Y1R I;  1MN9 A;  1SUQ A;  2LA4 A;  1Q5V A;  2M3D A;  2NZC A;  2VBY A;  2EFO A;  3CCT A;  1S0M A;  2YXL A;  3QJP A;  3V4M A;  1QE1 A;  2ZH2 A;  2WOM A;  5KFT A;  3PJ9 A;  4GVB B;  2MLY A;  1HBN A;  3JTN A;  3PO4 A;  1MRO B;  1A6L A;  2BQ3 A;  1BQN B;  4B02 A;  5A2Q U;  3B78 A;  4IOB A;  1XNR J;  1OQ3 A;  3FQK A;  3NS6 A;  2DRD A;  4USM A;  3H42 A;  1DQ8 A;  3SQG A;  3P4U B;  4JYA F;  2HSE B;  4KO0 B;  2RUS A;  3PDN A;  2D3O 1;  4WE1 A;  1XMO F;  4WBF A;  3NOG A;  2R2S A;  4ZDN A;  2HFZ A;  1EX8 A;  4DR6 F;  4J9R A;  1TK8 A;  4CYU B;  4FXW A;  1JLC B;  2VD3 A;  1RT6 B;  3TAR A;  1CUL A;  2FTR A;  3T5H A;  1MMD A;  4ECQ A;  4FS2 A;  2HND B;  1V5I B;  1S1V B;  2HAI A;  1ZA1 B;  3CD7 A;  1GNK A;  1WEY A;  1GXT A;  2R8G A;  3GIM A;  1TKZ B;  2MQN A;  4DX7 A;  3EZ5 A;  1KQF B;  3MAA A;  1OO0 B;  5T14 A;  4ZP8 A;  4OYM A;  1QVF R;  2B51 A;  3OD2 A;  2W24 A;  3K2Y A;  3AOC A;  2RDJ A;  1IBM J;  2O5D A;  2K8G A;  3CCZ A;  2RRA A;  1YK9 A;  1JK9 B;  4ED2 A;  2EFN A;  3BDE A;  1HBO B;  3DYA B;  2VON A;  2MTL A;  1HHT P;  1CC8 A;  1FFG B;  3HF5 A;  4NI2 B;  2VZ9 A;  2GO8 A;  4LF9 J;  4F4Z A;  5D0E A;  2JL9 A;  1Q7L B;  1C1C A;  3KG4 A;  4WZM A;  1B7Y B;  1GMW A;  2PA8 D;  1FNM A;  4B3O B;  4DV5 F;  1LFP A;  2HZC A;  5ETP A;  1Q8K A;  4J37 A;  4YB6 A;  2GS8 A;  2RD5 C;  3W63 A;  1T9W A;  2PSZ A;  2F8H A;  2J5A A;  3NBP A;  1K73 T;  1WTF A;  4J9V A;  1FKO B;  2GHW A;  4LR7 A;  2KHC A;  2JVR A;  2HUR A;  1NJX A;  1IJE B;  1LW0 B;  1M5S A;  3SBM A;  2FLN A;  5ETM A;  4JB8 B;  2NXE A;  4NLU A;  2HWH A;  4KKO A;  1UEU A;  2F3J A;  3IC1 A;  3CD0 A;  1R8P A;  4IDK B;  3Q8P B;  2V0N A;  1FVQ A;  3J7A 1;  4JV0 A;  4J9M A;  2C2O B;  2ZE2 A;  4JI2 J;  3QID A;  4EUV A;  4X4V A;  3MMA A;  5F41 A;  4JI4 J;  2KI2 A;  2LDI A;  1NKC A;  3NGK A;  3DRS A;  2DXF A;  3M9M B;  4KPY A;  4F4A A;  2XS5 A;  2ROE A;  3Q8V A;  5H9E K;  3NGU A;  4DCP B;  5E33 A;  4ZLL A;  1FJE B;  2DNP A;  5C24 B;  3I55 S;  1AT1 B;  1NK5 A;  3KJN B;  3MMC A;  4ZJQ A;  3WZ0 A;  2VFR A;  3HD1 A;  1UFK A;  4EO8 A;  2KG1 A;  4ED0 A;  2XY7 A;  2V8H A;  1HMV B;  3M8R A;  4OX8 A;  1WKL A;  2PEH A;  2K3I A;  3I32 A;  3LGN A;  3ET6 A;  3MGJ A;  3CED A;  1LK5 A;  3PRB A;  2X3G A;  3SMZ A;  3DOK B;  3GIL A;  5CYQ B;  1WHX A;  3N6M A;  1RI7 A;  4DR1 J;  4L72 B;  5I3P A;  2GV1 A;  1AZS B;  1R0A A;  3DN9 A;  1QY7 A;  3F56 A;  4K2J A;  3PG9 A;  2MQP A;  5IT0 A;  3MR5 A;  2XSJ A;  1P8G A;  1Y5I B;  4WFN Q;  3KYL A;  4CLS A;  3DNC A;  4RPF A;  3T41 A;  2RQC A;  1TUV A;  3OHA A;  3HDS A;  1RT4 B;  5LSO A;  1X4H A;  5C2C A;  2Y8W A;  1F3F A;  2IPO B;  2DGO A;  2R7U A;  5HL7 Q;  4QIG A;  2QT7 A;  2G0C A;  1H74 A;  3QT5 A;  5ETV A;  4YEA A;  2C3Y A;  3TAN A;  2DNY A;  2H4W B;  3M8P A;  1HNV A;  4JV1 A;  3M8Q A;  2F8M A;  2QSF A;  2WRM A;  2ZOG A;  3UVJ A;  4X62 F;  2V67 A;  2J0X A;  1R8H A;  1RJJ A;  5BYS A;  4NML A;  2CDQ A;  3IMQ J;  4DJB A;  2QMX A;  4OZ0 A;  3I56 S;  1TL5 A;  2IMO A;  2CJY B;  4CDI A;  4DN9 A;  1TKX A;  4GO5 X;  3D5M A;  4GKJ F;  4HI1 A;  1S9G B;  2MKS A;  1BXN A;  2O66 A;  3DRP B;  4AUK A;  4K4W A;  1DLO A;  5B0D A;  3CXC R;  2E5H A;  4QQB A;  3CCV S;  3WQP A;  4PAB A;  3LF0 A;  1YIJ S;  1O5J A;  4WK3 A;  4DV3 F;  3KUH A;  1RAB B;  1RTD A;  2MJU A;  4P2F A;  2VIC A;  1LNQ A;  2HFO A;  1VS3 A;  3KLE A;  3C2P A;  2IRY A;  2BJD A;  3M6U A;  5C5J A;  2GHP A;  1KFD A;  3MR3 A;  1OYE A;  2W4D A;  4KV8 A;  2B4O A;  2Z8Q A;  1H3D A;  4M63 A;  4JI1 J;  4HDH A;  2XHC A;  1HPZ B;  1X5S A;  4WJB A;  2YKA A;  2WVF A;  2FVC A;  2UXD J;  2YKO A;  1Y7P A;  1HW8 A;  1SBR A;  2KXN B;  2N7Y A;  4OYA A;  1QDU B;  2MKH A;  5AE2 A;  2PMH A;  4Y2I A;  3T1H J;  1S4F A;  5D4P A;  4RW6 A;  3CCE S;  4C0B A;  2VDH A;  2QEX S;  3MWB A;  4B9T A;  1FI4 A;  2CG4 A;  3OTC A;  1Y5L B;  2ZD1 B;  3CDA A;  2WSF C;  2D9P A;  5L1I A;  2DR9 A;  3ZZ0 A;  3Q2T C;  4C2M A;  3EUN A;  3EMT A;  4E98 A;  3SSQ A;  2JC1 A;  2EI5 A;  4X65 F;  2R7Q A;  2HMI B;  3U1M A;  4NCB A;  4CT9 A;  3Q8Y A;  1AYE A;  3LWM A;  2KRR A;  4ZCM A;  4C8N A;  1S1X B;  5E3C A;  2QE5 A;  1R8B A;  3EDR B;  1R0B G;  1XER A;  2YBV A;  4IG0 B;  3UR3 C;  2GQQ A;  3QGH A;  1EQM A;  3W2W B;  2V50 A;  1Q16 B;  2OKQ A;  3ILJ A;  1WUU A;  3OTE A;  1LW2 B;  2CIM A;  3VZI A;  1DTT A;  3OR2 A;  3M2U B;  4DV7 F;  2UUB J;  2WVC A;  2DK2 A;  2XMK A;  4ZP9 A;  1F2G A;  4QBU A;  3CB4 A;  4B3R F;  1HBU B;  2DRA A;  1T95 A;  4QW8 A;  1BLU A;  4ID5 A;  4XTT A;  2W2P P;  1NHU A;  1JJC B;  2BAB A;  1VJQ A;  3CJK B;  4IR1 A;  1Y9O A;  5HJX A;  3UI3 A;  2APO A;  1GXL A;  1T3O A;  4OYO A;  5J1P A;  3UCG A;  2N82 B;  3D1O A;  3HM9 A;  4Y0F A;  1JJH A;  2Y1L B;  1RQ0 A;  3CCL S;  2XMV A;  5IT9 U;  2VOD A;  1FFW B;  1VQM S;  2LLZ A;  4MFB B;  3NWG A;  4LR9 A;  4BHQ A;  3CUN A;  2HWI A;  1WEL A;  3RW6 A;  2MQM A;  5J2P B;  4IG3 B;  3ELH A;  4N76 A;  1JLB A;  4OX7 A;  4DR7 F;  5A0Y B;  4RJV A;  1NBE B;  2MEW A;  2W2Q P;  3I5C A;  2ROP A;  2UU9 J;  4F4Y A;  3FCV A;  1RBA A;  3FNN A;  1X7V A;  1NSP A;  2IA0 A;  3HHL D;  2LXF A;  2W9A A;  4KFB A;  2DPI A;  4QPX A;  4LF5 F;  2CRL A;  3SIP B;  4ED8 A;  1ZZF A;  2FHJ D;  5KT4 A;  3KLG B;  1U8S A;  3W61 A;  4KGK A;  3TAM A;  1YSJ A;  3BH7 B;  5M2P A;  2DGQ A;  1RDR A;  2VC0 A;  5BR8 F;  2QFJ A;  1NZ8 A;  5GAD U;  2HHH F;  1S6P B;  2UVU A;  2QN6 B;  1TAQ A;  3ENW A;  2C22 A;  3JYT B;  4F4W A;  4UOC A;  3M9N B;  3ZTP A;  5E3P A;  1KLM B;  2EFQ A;  2IAJ B;  2GIR A;  3UN3 A;  2XQC A;  4JI0 J;  3OFF A;  2AJ1 A;  2Q43 A;  1RHR B;  3ISN D;  4FKX A;  2VV5 A;  5L9N A;  3N79 A;  5C25 B;  4F25 A;  1VDH A;  4USW A;  1KS2 A;  5J1N A;  2VF3 A;  3OR1 B;  4H4O B;  4B3T J;  3NGS A;  2VG6 A;  2B4V A;  4LF6 J;  1H2U X;  1BQM B;  3V4I B;  1KTQ A;  3QLH B;  3PO5 A;  2EKN A;  5HAN A;  2ROG A;  2F7V A;  4Q43 A;  4NXM J;  4U95 A;  2YNF A;  1VHI A;  4DR2 F;  3D67 A;  2CPF A;  1DBD A;  3QIP A;  3R1H A;  1R8A A;  4B3M F;  4FYV B;  3GR1 A;  2B4P A;  3BO4 A;  3LAL A;  5AJ3 J;  1VQS A;  1ZM3 A;  4OJ1 A;  5J2N A;  1U6F A;  1VRT A;  3PZP A;  1YJN S;  1SC3 B;  3BBC A;  4DWI A;  1S9E A;  2QYC A;  3IP0 A;  4K0K F;  4KH1 B;  2AX1 A;  5H9F J;  2MZS A;  2EKY A;  4O44 B;  3PY8 A;  5GVQ A;  3KFW X;  1SL2 A;  4MKB A;  2RE1 A;  2UUA F;  1FF2 A;  4OHW A;  4JI6 F;  3CCW A;  2OD4 A;  3QYY A;  2Z56 B;  3R2D J;  2MSS A;  4Q8F A;  3MUV P;  4NCG A;  3I9Z A;  2IVY A;  3FBC A;  4HYK A;  2X51 A;  4FF3 A;  4M5D B;  4I6A A;  3DU6 A;  4DL5 A;  1IBL F; 
#chains in the Genus database with same CATH homology
 2Y9H A;  1WJ9 A;  3QRR A;  5H9E K;  4U7U D;  4DZD A;  3QRQ A;  5CD4 A;  2Y8W A;  5H9F K;  4QYZ K;  3QRP A;  2Y8Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...