1WJ9A

Crystal structure of a crispr-associated protein from thermus thermophilus
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
211
structure length
188
Chain Sequence
MWLTKLVLNPASRAARRDLANPYEMHRTLSKAVSRALEEGRERLLWRLEPARGLEPPVVLVQTLTEPDWSVLDEGYAQVFPPKPFHPALKPGQRLRFRLRANPAKRLKTPAEKVAWLERRLEEGGFRLLEGERGPWVQILQDTFLEQVQAVLFEGRLEVVDPERALATLRRGVGPGKALGLGLLSVAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of hypothetical protein TTHB192 from Thermus thermophilus HB8 reveals a new protein family with an RNA recognition motif-like domain
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Structural genomics, unknown function
molecule keywords CRISPR-associated protein
total genus 49
structure length 188
sequence length 211
ec nomenclature
pdb deposition date 2004-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08798 CRISPR_assoc CRISPR associated protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1200 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Crispr-associated protein; domain 1 1wj9A01
3.30.70.1210 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Crispr-associated protein; domain 2 1wj9A02
5H9EK 2Y9HA 4U7UD 3QRQA 4QYZK 1WJ9A 4DZDA 2Y8YA 5CD4A 3QRPA 2Y8WA 5H9FK 3QRRA
chains in the Genus database with same CATH superfamily
2DIUA 4NZ7A 3J7YI 2YNFA 2YX4A 5I4MA 2FDNA 5D0GA 1RTHB 2ACYA 1HQ2A 5LL6d 5KFVA 2PI4A 3B4DA 4B9LA 1IQTA 2XMJA 4ILMA 2BACA 1U1RA 1N6QB 4C11B 1HI1A 3K5OA 4RUBA 4JV0A 4ED3A 2RRAA 4F2SA 4OYIA 2C1EB 1S9GA 2E5HA 2CZ4A 2NXUA 2X51A 5SZTA 1YRXA 2DHSA 3I0RA 4UUWA 2Z57B 1RACB 1WG1A 4WYLA 2G0JA 4USWA 4MKYA 3DOMA 2G13A 2MKSA 4ZPBA 2WVFA 2N4DA 4CP5A 5LMNF 4IFVB 3SMZA 3JSRA 4DLGA 4LFCJ 1EHWA 4RWXA 3W5XA 2VDIA 4OJGA 4TY8A 1XQIA 3R5AA 2GHWA 2XCAA 1I6JA 3P49B 1HBOA 4OZ2A 1X7VA 2UUTA 3M2UB 4M5MA 3CCVS 2XY6A 2HGNA 2GO9A 2IIHA 1NK5A 2B8PA 3DDIA 2ADBA 3U1MA 5EHHA 4JI8J 1IKYA 1RT4B 4UW2A 1S57A 3TX8A 1FRXA 2P9GA 4F0HA 1SJFA 1NK0A 2XMWA 2M7SA 3FJ2A 1FJEB 4QW8A 5T7LB 3DU5A 2AHOB 1CBKA 3Q83A 3M8WA 3MD1A 5LMUF 2XG8A 4A8YA 1FFWB 2IM0A 3L7PA 4MMOA 4TQSA 4YB6A 4A8XA 3KMSA 2MYFA 3AQPA 2GQQA 2IA6A 1TZ0A 5BJRA 4IOAQ 2YVSA 2F3JA 3TVYA 3Q0AA 1TFYA 3BGRB 1TL7A 3EX7B 2CNKB 1HI8A 3NGKA 2A10A 4O44B 1RT1B 3KK3B 5D77A 3ZNUA 3I5AA 3MI7X 5HANA 4ZMMA 3RB4A 4XK8C 5H9FJ 5CXTA 3OVBA 3ENVA 3W2WB 1S6PB 1UW9A 1XJWB 5LSOA 4I6YA 4WFBQ 4YHHJ 1WACA 4PXDA 4CYUA 2ZHBA 5DDOC 1NLKL 5HQMA 3CJQA 1RZMA 8ATCB 3MEDB 5DDPC 3EJMA 2MGZA 2XLJA 1TL3B 2JWNA 2XZDB 1R0AA 2E5JA 1CPZA 4ZVPB 1RYRA 5CYMB 1TKTB 1YJRA 1TMJA 4PWDB 3H42A 1RTDA 1T3NA 3CCJS 2DGXA 4EZ9A 3AHPA 2EFQA 2OFGX 3CCRS 3LWLA 4DR7J 5J2PA 1J2VA 1WC1A 3DRPB 4ZK7M 2LECA 2B9XA 3QJJA 1U1PA 2HS4A 2PDAA 4ZJQA 1D8YA 2JVRA 1FXRA 2AZ3A 2VL1A 4MTPA 3IGNA 1S7IA 3KKFA 3CMQA 2CQ2A 2V8PA 1U6FA 4DPWA 2KDOA 1S1WB 5FDLA 4X66J 3VGUA 5B0CA 3MUVP 4AL5A 1V6HA 1W7WA 5IZHA 3WX4A 1BE4A 2FVQA 3HD2A 1BWVA 1QDUB 3GJSB 4KHPJ 4OLPA 4GMKA 3NNCA 2IVFB 3W9IA 2AEFA 2MJNA 3MEDA 5HVGA 2MGZB 2YKNA 4OJ3A 2QLWA 1ZM3A 1CS4B 5CH7B 4DU8A 1UEUA 5A0YA 1U1KA 1N8RT 2XTJP 1OS5A 2H5EA 3FCWA 3H7HB 4QPTA 4XDCA 1TVRB 2N7YA 1HBUA 2KTQA 2DNNA 2U1AA 3GIJA 3Q89A 3P3DA 4NI2B 3LP0B 3S7RA 3D68A 1WEZA 2RVJA 2RKIA 1URNA 2J9DA 3BYPA 1TL7B 4Z7CA 3CULA 2BJ1A 3PHEA 3QSIA 3LAKA 3C16A 2PN6A 2IFXA 3BR9A 4ID5B 5F9LA 4EBCA 1W2BR 4IRDA 3GV8B 3Q22A 2Z2YB 4LF7J 2Z2MA 2FQQB 1U09A 4PG4A 5DQIA 1QE1A 4J9QA 2M88A 4DOZA 2DH9A 3HI9A 1HNWF 4UZBA 3CJ8A 2HQGA 2VZ9A 5DRKA 1E6VA 4FP9A 3UWTA 4GKKF 1AFIA 1NM2A 4QZVB 4CO3A 3NAIA 3UO0A 1IKYB 1RT4A 3C8YA 3GCWP 4OYPA 4X4UA 2O1PA 3NGRA 4EU0A 2AU0A 1RSCA 2VB6A 2J6TA 4L6V3 5J1EB 2ZEJA 3BSAA 4HDGA 2KT5A 5KFYA 2EVZA 1WKKA 4OLOA 4GKJF 2V4QA 1CJKB 1WG4A 2QYGA 2ATCB 3DOKB 4ERDA 1UMJA 2XMTA 5HJXA 2WOMB 1FE0A 1UJ6A 2ZOMA 4YMEA 2YWWA 2EWHA 4YQWA 1LWXA 2LXIA 1R31A 2JNJA 1RP5A 2DR5A 3HJVA 5C25A 2HMIB 5KFEA 3I31A 3CVKA 5KG4A 3I4HX 1NK4A 2F4VF 1MROB 4TYAA 2IY5B 5AT1B 1NKBA 2BJ8A 3QT6A 1BC6A 5EX3A 2IJFA 1N6QA 4ZPTR 2XULA 3FMWA 1BMQB 3CSKA 4WFZA 2G4BA 4CLFA 5L9XA 3IRXB 4R0JA 4DUZF 4AYBD 2MQNA 2NXNA 4F4ZA 4FS1A 2B4UA 1S10A 1JQGA 5D4OA 2QEXS 5ETVA 1KD1T 2POKA 3MMBB 1FVQA 3PYFA 1WOOA 3LGMA 3SDEB 4A46A 3SCKE 2O67A 4I64A 4P9SA 1V3ZA 3IC1A 2O5DA 1JLQA 2IPOB 2CPZA 4OI6A 4ZHRA 1KNZA 5SUHA 4PWWA 3J81j 2ZBCA 1AB8A 3HZGA 1C1CA 3DGPB 4B9NA 1DQAA 3H20A 2EFOA 3TAMA 3MFHA 2UUAF 2DD8S 3QPIA 4LQ9A 3DHWC 2JJ4D 3IXQA 4JI2J 3LGNA 4J9KA 1GMUA 1B99A 3ZZPA 5GADU 3L9ZA 2YBVA 1EP4B 4X66F 4NLUA 2ZNZA 2DXDA 3GTYX 4K5SA 3SCJE 5H9EJ 3AOAA 1S1TB 1Q53A 3KG4A 2ZJQQ 3A1YG 4NZ6A 2PSZA 4NLVA 2VPZB 3QWPA 3UN2A 3V6KA 2ZH5A 2KYXA 3HSGA 4PKDB 3HVRA 4UF4A 1X9SA 1DHMA 1BHNA 2KKHA 2ZITA 3DRSB 3UN5A 2Z2LA 5D3GB 4IFYA 1SKRA 1LKZA 3TVKA 3VGSA 4M5KA 4F2RA 2HLTA 4LBIA 3NKYA 1NHVA 4O4GB 2HNZB 1UA0A 2PMWA 3E2EA 2XSJB 1H2VZ 3SCLE 3M8PA 3TVZA 2DGSA 3LP1A 1XMQJ 2MKHA 2M8HA 4TN2A 1RAAB 3EDRB 3UD4P 1HARA 1HPZA 2YH1A 4Q45A 2DRAA 4KFBA 2JL9A 1T3OA 2CNNB 2DK2A 2BDPA 1H38A 3MOJB 3CJ5A 1YSJA 5GAEU 5LMNJ 1S97A 4WZMA 4MFBB 1IKXA 2DCLA 2V9KA 4XTTA 4CLKA 2XBPA 2HRTA 5LSLA 4WFNQ 1HNWJ 1WUUA 1FDAA 2XZTB 3TZWA 3KJVA 2EC0A 1HIYA 1LXJA 2AJ0A 3G6YA 1VRUA 2I8EA 2PA8D 4YS2A 4QU6A 3Q86A 2FJEB 4NCGA 2K8GA 2L9WA 1L3KA 1MN7A 5J2NB 2WVCA 3SFUA 2FLLA 2C2KB 3J7AN 2UXBJ 1WTBA 1N48A 3HT0A 4JI6F 4ZLPA 1U8WA 2WONA 2W4DA 3D3CJ 5THWA 4KGXB 2PE8A 4KBIA 3MEEA 4X4PA 5D0RA 1X4HA 4M5DA 3ETMA 1H7WA 4B17A 1F5AA 1PYTA 2XWXA 2PIIA 4YR0A 2HFNA 1AUDA 3MM6B 3IWXA 2EK1A 1IUJA 2VU5A 5IT9Y 3NBPA 2CFXA 3BGFA 2AYMA 5BYSA 4WE1A 4WE1B 5EGYA 3TEHB 4GVBB 2AD9A 3RAXA 4LF1A 4JYAJ 5HVFA 1LWCB 4X4QA 2HWIA 1K0TA 1QD1A 3NEKA 2N7CA 3PRDA 3I0SB 5C2GA 2DRDA 4DS4A 3TW0A 3CCUS 4ZDNA 5CD4H 3MCSA 2VOPA 1FHTA 2YX7A 3JTOA 4WIQA 1X4FA 2DY1A 2A2CA 2LLZA 3OFEA 2DR9A 4BBYA 4M5DB 5JUMA 1MN9A 1NK9A 1RAJA 3QT8A 4L3KA 5J1NA 4U95A 2M5YA 4OHZA 5KFWA 2J9EA 3HULA 1JJ4A 2XYGB 5HAOA 1FK9B 3BPDA 3EZOA 4J5OA 3UW1A 4DZ6A 2XM3A 2Y8YA 3D6TB 2MSTA 1S0MA 5J2QA 2KRRA 2AJ1A 2AV5A 3CCQS 2DH8A 3TI0A 3MMCB 1Y7PA 4F26A 4DSIA 2BZ2A 4A8FA 1XNRJ 1AZSA 2OSRA 4MK7A 4RU2A 1LW2A 2LCWA 2V67A 1YJ9S 1EETB 1HWKA 3VZHA 4ZKAA 2DXEA 1F3VA 4QWDA 3VAKA 1Q5VA 2I38A 2XHWA 6FD1A 2BW7A 2OGUA 4FZVA 4F4XA 1T05B 2I2YA 1ROFA 3CDBA 1SKSA 1L3UA 4CI0B 3H25A 3CCMS 1YKWA 3RBDA 2E5GA 4IG0B 3M8PB 5BYRA 3HVTA 5AXMA 2FHMA 3ZTPA 3KK1B 2RILA 1K0VA 4FXDA 2HQCA 5BXIA 1FRLA 2W9BB 2UUCJ 3CGIA 2JOQA 2XMMA 2PFDA 2ZKTA 3JYTA 4G3IA 2R7QA 4TYBA 2KYZA 5I42A 2YQ0A 3HXMA 3MM5B 4ZP7A 2Y1JA 2V4JA 1U02A 4KRWA 3CJ4A 1A9NB 1CLFA 4OYOA 1RISA 2CA9A 3DLJA 3FNNA 4LF6J 3Q2TC 1AXQA 1TKZB 2IYGA 3GV5B 5FIIA 1VIOA 1NJIT 1JLGB 1YG0A 2X1GA 1NK8A 3MM9B 2XMAA 4N47A 1U1NA 3BF4A 1SV5B 4IR1A 2HBYB 4AXIA 2CUYA 3JS9A 3TAMB 3GU0A 2OO4A 1R7IA 3DGPA 2AYBA 1C1CB 1JLAB 2QYCA 3MPVA 1UA1A 2KVIA 3IG1B 3U7JA 4EBEA 1HNZJ 2OFHX 1C4AA 1OIAA 3QJPA 3LGHA 2PD1A 3KJFB 1OYDA 2EBEA 1BWEA 3W7BA 2O01C 3CC7S 1N33J 4Y34A 4F4KA 3ENQA 4ZA1A 1WTFA 2GNKA 4OX8A 3HD1A 1UKUA 4NYPA 4K4ZA 4JB8B 4PPDA 3H4DA 1U2RA 1OYEA 1IKWA 1ULRA 4ZCMA 2CQGA 3RBEA 1SH2A 3I9V9 5LJ3Y 4QBUA 2R2TA 3OXFA 4JI1J 2BE2B 3EGNA 1IJFB 2J9DE 1PGZA 4C8KA 1OPZA 2UXCJ 1HWIA 4O3RA 5KFAA 2Y3YA 2YKAA 2YQ3A 3G86A 3L4BC 5KT6A 1MROA 1T9XA 2YNIB 3CJTA 3QYYA 4G1QB 4TQRA 2FHJA 4NZ0A 3HKWA 2PMZD 4RW9A 4CH1A 5AE2A 2HHHJ 1UVJA 3M8YA 2MLXA 5C25B 5IC4B 2HMIA 1TR0A 3DMJA 1TFWA 2AX0A 3Q8SB 3B6BA 4KYZA 3IR7B 1Q95G 2B43A 2O66A 2HK3A 4OQJA 2VASA 4U67Q 4NLGA 2UXDF 1CJKA 2CQDA 2IVMA 2R7TA 2VICA 4PQUA 1YZ7A 3GJQB 1Y00A 5J1EA 2CG4A 2FLNA 1S9FA 2LMIA 4ECSA 1TKXA 1U2CA 3AH6A 4B9SA 1G7CB 1O5JA 2Y1RI 2X1BA 5I3UB 1C1BA 1JLBA 4HL9A 3DLEB 3PFOA 4MKAA 4WFXA 1T7PA 4WBFA 2E1PA 2VKRA 2E7WA 3P5TL 4ZVGA 3M32A 4X4RA 4C0HA 3R8YA 4OI0A 4UQTA 5B08A 3FGVA 3KDNA 3M6WA 1OSDA 3DLGA 3KLEB 3GWCA 3M6VA 4DPUA 2CVEA 1UAWA 1V5VA 2NCKL 4LT6A 5I3QA 1FX2A 5KAKA 3FKBA 3TZYA 3J80Y 1M1KT 3KXDA 5GADI 3MR5A 3O2IA 1KRPA 2YKQA 3UR0A 1VDHA 4CLUA 4USJC 1B7FA 1ZETA 3O3LA 2Z30B 2RDJA 2GMLA 3UNYA 4K4UA 3ETOA 1RQ0A 3KJNB 5DDQC 5KG5A 1FXLA 3D5MA 5IWAF 4BS2A 3T9ZA 3TA0A 4NE9C 2B5JB 1K8AT 3OTDA 1J5OB 1PYOB 1S9EB 1RA7A 4QOTA 2RUGA 1BGXT 4MIWA 1Q7YT 1REGX 2VOOA 3T5HA 2RUSA 5J2MA 2YKMB 3PYEA 3RGIA 2BJ3A 1QSYA 4CLYA 1JLFB 1X8DA 5BYQA 2GHVC 1FKPB 5FDLB 2BYCA 2OKQA 3FDSA 3VV2B 1UVNA 4LF8F 4WCEQ 3OBIA 5JJBA 4IOCQ 3PW7A 2ZOFA 2B9YA 1X4EA 3WDOA 5AE3A 5T14A 3LA0A 2R2RA 5U47A 4K7QA 4LFBF 1YVFA 3EGVA 1RKIA 2E7VA 1ZZNA 3V4IA 2DNKA 3RRGA 4KAIA 2VFSA 4PWDA 1KHVA 3D1OA 2QL5B 3NWRA 2YNHB 1JKHB 4FYVB 3OTOJ 3MUTP 4EGLA 4JI8F 3UCUP 4DR1J 2HQIA 2F1FA 2FVCA 4J9PA 2W9AA 3V4IB 4O3QA 4KPYA 4ZP8A 1ZM2A 2DNMA 2CXEA 5CZXA 1S6PA 1GMWD 1I5OB 1Y0HA 3IS9B 1Q82T 2FZCB 5ETSA 1RHUB 3QNWB 1JMTA 4HH0A 3PR4A 4LIRA 3IBWA 4ES3A 4K0KJ 4AFFA 3KK3A 3RB0A 1HNVA 1KQFB 4CM0A 5E3AA 1VBKA 3ADAC 4OL8A 2GFFA 2ZD1B 4WXOA 2CPYA 4Y6IA 1RK8A 2MKCA 1LK5A 2V50A 3RBXA 1RT2A 4DL7A 5GVQA 2ZBIA 4J7CA 1AYEA 3CCSS 1FNMA 2OMOA 1RTJB 4RW8B 3RTVA 4N76A 2KI2A 4DWIA 1NSAA 4KIAA 4ZPDA 4OHWA 4TU7A 2JDJA 2B5JA 3OPKA 4O0IA 2W7PA 1UPMB 2ZZTA 4ED2A 2NS1B 1HWJA 3P8BB 4OX7A 3QRQA 1KHWA 1RCXB 4DR3J 2UVRA 4RU9A 2P6TA 4ANCA 3RAQA 5HN0A 1IM4A 2RQKA 3WIVA 2HWTA 1UEKA 1PILA 4DV2F 1VC6A 1N32J 1FJGJ 3BH6B 2FIUA 3HCXA 3CNQP 4ZCLA 3TJAA 3GSIA 4F04B 3M8SA 1F9FA 1HQUA 2CQPA 3EDQB 3AXMA 3BGUA 3JXOA 3N4WA 4CTAA 1RI7A 1WEYA 2KHDA 3A3PB 3PG9A 3JQJA 5ETLA 2VODA 2MQOA 2W2MP 1FERA 1I94F 1HR0J 2BRLA 2X1AA 4NL5A 3K8WA 3LTOA 3FFIA 3ISND 4FS2A 4ED1A 5ETPA 2QGFB 2HFZA 2K1RA 4ECUA 3I5CA 1TKXB 3ICLA 2OHDA 1X4CA 1JLEB 4IH5A 3S6EA 1HNXF 4M5LA 2ZDPA 4RPFA 4P2XA 4HKQA 3SV4A 4X2BA 4PQUB 1XK8A 3GFHA 1DAXA 1F1BB 3QATA 3OUYB 1ZTTA 2YNFB 3NCQA 3VAJA 1YI2S 5ETNA 4NRUA 3FFIB 2Y9HA 3PYGA 3SSRA 4UQGA 4H4KA 4NA3A 5DETA 3ZNJ1 4RUCA 2QL7B 4P6QA 1XNQJ 2DPJA 4JI5F 1QLNA 1WJ9A 2WW8A 4RW9B 1LV5A 2CQBA 4NEZA 2I1RA 1GH8A 1DZ5A 4AT1B 5MLCV 5GMKa 3RB3A 1VMBA 2FLPA 5F0UA 1GNKA 1TTHB 1FX4A 2AP6A 2H5IB 2GMJA 1KSPA 3OJSA 5B7WA 4ZVEA 3UVJA 4EWTA 3GR1A 3JSMA 5T41A 1HBNA 3RAMA 1U48A 1R6YA 3C15B 2DNQA 1N52B 2XNQA 3HSDA 3HSJA 4P73A 5HI7A 1HNIA 1HD0A 4Y2MA 4ES1A 4J9LA 2MHEA 2VDHA 1O6XA 2M8DB 2V2ZA 5F8NA 5AXKA 2KFYA 2CJ9A 2H65B 3BBCA 4QR0A 4DSJA 2BKNA 3TQEA 4C48A 3MMJA 1WC3A 2NXEA 4K2XA 2XS7A 1U25A 1UWBA 1S5ZA 1YJUA 2CZ9A 2PEBA 4OZ5A 1XMOF 4DQPA 4DFJA 3K5MA 2AJ4A 2V5HG 2I5JA 1UTAA 2EW9A 2JH3A 3C46A 2EBGA 4DJBA 1TUWA 1RHRB 1FVSA 1NAQA 1S79A 3HHLB 1U24A 4ZLNA 3H90A 1TKZA 2QJ3A 1VQ8S 1NJYA 1OMSA 4JV5F 4RNHA 4WU2A 2MY8A 3GE9A 2H4WB 1G4CA 2XNRA 1NBEB 2RE1A 3N0VA 4KT0C 2GJFA 4C8MA 1KQGB 2R7OA 5CYQB 1M5PC 2MSSA 2K06A 4PG7A 4UOGA 4DQSA 2J7WA 3MMAA 3BPSP 2MKIA 4ES2A 1B0VA 4J90A 1HYSA 4LR7A 1VQSA 3OVAA 2ASYA 3A3OB 3ILIA 3SI8A 3THPA 4NXNJ 1O51A 4USVA 2D74B 2MLZA 3BSNA 2Q6CA 1P9QC 1ZAVA 3K0JA 3MEGB 5M2RA 4DN9A 3EPGA 1FKPA 2FHOB 2V2KA 1RBLA 3NGTA 5LXRA 4UY85 1HA1A 1Y10A 4HLBA 3ZZUA 2RQ4A 4EFAC 3AD9C 1FE4A 4C7QA 5M2UA 5H9FK 2D41A 1WF1A 2IDEA 3GG0A 3LH2S 3PYDA 4KO0A 1J5OA 4F25A 3MF5A 2EK6A 1D1UA 3DLLQ 3FRZA 3CD0A 1QAYA 2YKOA 3MAAA 2BUNA 3M8QA 3AD7C 4QIVA 3ZC4A 2CYYA 5D0EA 1AUSL 1SJ1A 2DNRA 2CWXA 2YWFA 5KG3A 5A8RB 1V3RA 4UUXA 4ANEA 3PIOQ 5J2QB 1RT7A 2E44A 1H0HB 2DNYA 1ZTWA 2AW0A 3EGZA 2QLXA 2EKNA 3GR0A 4O3PA 2UXBF 3CW2C 1KFDA 4NLWA 9ATCB 2JC0A 3BDEA 1IN0A 2DYAA 5A8WA 3DRYA 2CG8A 5KFNA 5IWAJ 1MSWD 4HACA 2BKOA 1DY3A 1G2EA 4NWBA 2IAJB 5DG7A 4ELTA 4ZPVR 3D6HB 2DKOB 2QL9B 1A7GE 1S1UB 2I0XA 2IRYA 3NS6A 4O3NA 4AXJA 1LEOA 4LREA 3C14A 3MDFA 1VQ4S 2CQ0A 4JI5J 2BM1A 4C0BA 4H4MA 3W9JA 2CQ1A 3GIKA 4PAAA 3H59A 4LF8J 1B0PA 3QO9A 2BE9B 1NUEA 2YKPA 3WC2A 1DTQA 2QLJB 3M6UA 2RMLA 2AWZA 4OYAA 1Y3KA 4CRJA 1UVKA 1X5TA 2DR6A 1HWLA 2QMUB 3QT7A 4TLQA 3WX8A 4CIOA 2H48B 2HFVA 1E6YA 3D1HA 3O5TB 4TU8A 2VF3A 1KVIA 1RGVA 2CPXA 3FRYA 2VHGA 3AD8C 1X5PA 1E6YB 4PPZA 4HT7A 4RBUA 1YK9A 3VAHA 1JK9B 3K8VA 4ZLLA 4XAKA 1SQEA 1MMNA 2DY9A 3FQKA 3FEZA 4HI1A 2OEKA 4WTYA 4NCGB 5IXUA 1DQ9A 3J81Y 1SBRA 3B54A 1JXLA 3MCMA 1VRUB 4HEA9 4TKTA 4A8QA 2WBMA 4E0DA 3W5ZA 2YWEA 5F41A 2P9CA 5LT5A 4OZLA 1IR1A 2GVZB 3O1LA 5LJ5Y 2E5LF 2IHR1 4W90B 5CYJA 1HMVB 1KQKA 4ECXA 4CLTA 4ZVUB 4WKRA 3JAMU 1VGYA 2QTWA 3TX0A 1Q8IA 1HPZB 2DBBA 2P9EA 5A8WB 5KFKA 2IA0A 3ZXWA 4V19J 1D09B 3HFZB 3LP1B 5B09A 5B0AA 1WF0A 4U8YA 4IQMA 3W2VA 4DN0A 4NYZA 4OYWA 1DARA 1RT7B 2BQ3A 2VG7A 2ZNYA 2HSEB 1PC5A 1GXUA 3M05A 4FYXB 4CLLA 2R2UA 4NLOA 1NEEA 3GIRA 1Z2ZA 3MHYA 4IFYB 1WDTA 2KL8A 1PJ6A 1CJVB 1QAXA 2MY7A 3HHEA 3C66A 1RA6A 4D3HA 3MAAB 4ZOSA 4A48A 2C3MA 2CJQA 5C24B 1JLGA 1YBUA 3I32A 1YBTA 3SSQA 3RRHA 2F8HA 3FBCA 2RS2A 2DNHA 1FRMA 4WPAA 2BR0A 4YB7A 4CLWA 3D0GE 1SUQA 4YB5A 4JOUA 3HSZA 3BR8A 1VRQC 2EFPA 3NY0A 3LANA 3NL0A 2AIRB 3KLGB 4JI0J 4Y2CA 1N54B 5DZ6A 3JYTB 4FF3A 2JEIA 4C9DA 4URSA 4DV1J 1OWXA 3AODA 2X3DA 5I3PA 3E51A 5HL7Q 2A0FB 5D4NA 2ACMA 3V6JA 1DRZA 3BN7A 1WI6A 2FHJD 4DX7A 4HR2A 4EEYA 2ZZMA 3M7VA 4M5GA 2BOPA 4RBVA 1SPBP 2CDRB 2CQ4A 1JLQB 3C19A 3DRXA 3IP0A 5KFDA 2ZH2A 4RL1A 1M5OC 1M5SA 4JV2A 3HPOA 4V19X 1CJUA 2FTRA 1EETA 1SI9A 1YJVA 2G2YA 3BJYA 3JQKA 5KFJA 5GAHI 4DV3F 1AZSB 4Q2MA 1BQMB 3W5YA 2VBWA 5KOWA 2L9NA 2PC6A 4CO2A 2Y8WA 4YOEA 2X3GA 2IYIA 3P45B 4ED8A 4MKBA 1C0TB 3CF5Q 3PX0A 2GV1A 2F63A 5HMYA 4Y0FA 4NLSA 2LDYA 1Q5YA 3UI3A 3GILA 4B3TF 4BHQA 2ZH6A 4NLTA 4A8WA 4QR1A 2YTCA 5AXLA 4ZS6A 3MR7A 1M90T 3AQOA 5ETRA 4ZVRB 5L1JA 4DS5A 1GK8A 1QUPA 1D3WA 1RAHB 1WOPA 4HTIA 1HNIB 4UT4A 4RZRA 3G96A 3V6DB 5HJYA 1XIQA 1PJ7A 1QAIA 2NXCA 2DEJA 3NWGA 4RLEA 3T1AA 1HBNB 1LWCA 4JUZA 4K4TA 1UFLA 2HKEA 1MU2B 3WHIA 2DHGA 2MPUA 1RWMB 3ZZRA 4RUHA 5CD4A 4DR7F 2DIVA 5A2QY 2ASLA 3AA9A 4KGZB 4DG1A 3BBBA 1N5SA 3QLHB 3EUNA 1IKVA 3F0NA 4H4MB 4CLZA 4KJIA 4ETZA 4G1IA 4FF1A 4B9UA 2DNZA 3GG1A 4V1Ak 3NS7B 1RHJB 2EG2A 4GO5X 4HHHA 4OX9F 2VPYB 4YFUA 3VGTA 4B02A 1RAOA 1RHKB 2FPHX 3M8RA 3W60A 2NYHA 1DLOA 4FDFA 5L8RC 3PO4A 2LYVA 4DFMA 4CO4A 2NLWA 4MYTA 4WWSA 2HHHF 3I96A 4GVLA 1HWUA 2WHOA 4OZ3A 4CWBA 2R8GA 2K1RB 5CCMA 2HZAA 1HBUB 1T0TV 3GFZA 4N8OA 4K50A 3UFCX 5E2QA 3JAMY 2YQ1A 2KXFA 5A0YB 5HP1A 2BOAA 4NCBA 2HHTA 4KO0B 4P75A 3CJ0A 1RLCL 3OHAA 3Q23A 3R1LA 3B8HA 2OAUA 3IO1A 2AGQA 4MT1A 4F02A 1C4CA 3MECA 4NLXA 1HQUB 1T94A 4CTAB 4U7CA 4KHPF 3AFGA 3MR3A 1GMWA 4PXBA 3F41A 2B3TB 2ZHOA 2DEIA 3UD5A 1S1XB 2W9CA 1S1WA 3T3FA 2JEFA 3MEGA 5K8MA 4G6VB 1U1MA 3V6HA 3UCZP 3RG6A 4DPXA 5D3GA 4DBQA 1RWWB 4X64J 2Z4PA 2MZ1A 1HYSB 1HQEB 3MMAB 4DL2A 4DPTA 4DL5A 2QV6A 1Q8BA 2OP5A 2V94A 1PBAA 2XGQA 2VBZA 3CCLS 5HLFA 5KFCA 2GJ2A 3ILOA 1S6QA 5KOXA 1N0UA 4LR8A 5DM7Q 4LVNP 1FJCA 4WP9A 2YY3A 1R0AB 5FJ4A 4QWAA 2XC9A 4CYUB 4B9TA 3OLAA 1HNVB 2GZOA 1LOUA 1P6TA 5A2QU 2DHAA 3CDUA 2H4YB 1NK7A 3W2WA 2ZFHA 4CO1A 3GB0A 1FRIA 1WC5A 2L48A 4IYQA 3OTCA 2MKKA 2IM1A 1RTZA 2B4PA 2VD3A 5F8IA 1B7YB 3QGHA 1WHYA 4ZVHA 1KEKA 4Q44A 1QTNB 1BY9A 4GKJJ 2HGLA 3HHDA 3MTKA 2W8LA 1NZ8A 4ER8A 4YDXA 2UUBJ 3MAHA 1L3TA 4NOHA 3NG8A 4B3MF 4ZVOB 4A8SA 4NXMF 3SDEA 3VAMA 1SJ3P 2DCUB 3CIMA 1X0PA 2QA1A 1NDPA 4XIUA 3R5BA 3TANA 1YHQS 5HVHA 2RHSB 1X9MA 4PXEA 3VZIA 4CLPA 1UETA 2HK2A 3BH7B 3IRXA 2MB0B 2CJBA 2LQJA 2F7VA 4A8MP 1SXLA 3M2RB 3N28A 3R1HA 4IH7A 4DV2J 4YEAA 1N32F 3MM7A 3FK4A 3GYGA 2JLGA 1B3TA 4NYOA 1MNEA 4IFVA 5GMDA 1GX5A 1KQSR 2JLFA 4G1PA 4J9UE 3W65A 1W26A 3W8GA 1QTMA 2RRNA 2J6UA 2PA3A 4J9NA 4NLYA 1GEHA 1YTYA 2UV8A 4P10A 5HP1B 3FSIA 3ZZZA 3SFGA 5AE1A 1YZ6A 1S76D 3M2VA 5KTQA 2YWHA 1Q7LB 3E3XA 1VK8A 3K7RA 4F4AA 1SJ4P 1IVZA 2OEMA 4DV7F 3BM7A 1RWOB 5A8KA 4A8KA 1WKJA 1MLAA 2XI3A 4I2QB 2MLYA 4C3MA 4C3KA 4YDDB 5KG2A 3X1LB 1TUVA 4QIWD 5HMWA 1U6ZA 3NCRA 5KG1A 4BCAA 1NPRA 2LEAA 3KUHA 1C0UA 2DTJA 4PG6A 4JI2F 3MAQA 4DSFA 2V8DA 2XS5A 3MPDA 3TR5A 4ELUA 1CSJA 3KUEA 2HFUA 4J9VA 2XO6A 1OY6A 4W98A 2HYIB 3DLEA 1SL0A 3R9LA 3D7SB 2MHNA 4ID5A 3V5RA 3TJ8A 1OY8A 1VQPS 4YR2A 3RZAA 2JSXA 3BQ1A 1N88A 2RKIB 5EWEA 2R7RA 5DS7A 4M95A 1KVJA 3PACA 4ECVA 2YWKA 2Y0BB 4ECYA 2XQCA 2HVHA 4CDIA 3VCDA 3M2VB 3DLBA 2J0XA 1UZHA 1HR0F 3HHLD 2BW2A 1JJCB 3EGWB 3VHQA 5LXYA 1I3OB 4H54A 4Y00A 1CS4A 4ED0A 4GC6A 4KGKA 1IBLJ 2BBEA 4F3OA 1FD2A 1LQ9A 1AFJA 2RQCA 4FXVA 5FD1A 4UOHA 3SCIE 3HK2A 2ERRA 5KFOA 3L95X 2DNPA 3DXSX 2WVEA 2UU9F 3N79A 2D3O1 3W3SA 2DGTA 2N4CA 5F8MA 2R7VA 2J8SA 2R8HA 2VG5B 3GONA 2ZD1A 3I9ZA 4KHMA 2O3DA 5KFIA 4X62J 2NUUG 1OPIA 3G8SA 5IQQA 1NDCA 1SB6A 3CDAA 1GAOA 1R8PA 1JJ2R 1VQ5S 3D6MB 3P4UB 1H2TZ 1X5SA 1YIJS 2DPIA 3IM8A 4DSLA 4QCLA 2C3PA 3PX4A 1U0SA 1DTTA 3M9NB 3GSDA 2ZJPQ 3PY8A 2MQMA 4USTA 1CJUB 5CYMA 5IT0A 3EXCX 1U8SA 3QJLA 1NMEB 5BR8F 1TL3A 4LRAA 4Z7YA 3UE2A 4N56A 1M1HA 1PC4A 1S6OA 4HHJA 4C3LA 1RE1B 3IG1A 3PW2A 2KRBA 3H2VE 2MMYA 4FVCA 2KG1A 4U8VA 1X4DA 5JVHQ 2J5AA 5D6GA 5K14A 1TK5A 1S48A 4KB7A 1RADB 3ZZOA 3HFVA 3NS5A 3PM9A 3MM9A 4LFAJ 2V8HA 1S72S 2QO3A 3GP9A 4L74A 2XMVA 3FSXA 1LWEA 1B4SA 3ZTSA 2MZRA 5KT2A 4ZVQB 3GJRB 4U7UD 1IWGA 1K9MT 2ZDOA 1S6QB 2L08A 2H54B 4UZCA 5HK4A 3OL7A 5HLFB 4C8NA 3VQSA 4L76A 5T7LA 4B3RF 9RUBA 1RDRA 4CQ1A 2BABA 1HQEA 1U1QA 1IBMJ 2R3VA 1Y5LB 2ZC3A 4C98A 3PW4A 4JI4F 5KFTA 1IQZA 3CD6S 2J8AA 4ATNA 4DUYJ 4C4WA 5F3ZA 2VG7B 5DGBA 1RBOB 1VLYA 3EWGA 4J91A 1KS2A 1VR6A 2F40A 5E5NA 3QAEA 3W2VB 1X4GA 2FC8A 4TY8B 1S1XA 2IBOA 3PEHA 3J7YU 2W9CB 4KHRA 3FVYA 2GX8A 1HHTP 1D8ZA 2DNGA 3K57A 2QMXA 3R3TA 4OZ0A 3DOMB 5IT4A 3CB4A 2XB2D 2OMLA 3M32B 3I0RB 2C2OB 2IRXA 1NXIA 5CZVA 2IM3A 4FBUA 5I3UA 2B51A 2XLIA 2D9PA 5L46A 5G0RA 5DM6Q 3EVMA 1K47A 5GAEI 4DR2F 2J0SD 4X64F 5F8HA 1N34J 4WP3A 4E98A 2LQ8A 2IC3B 4B08A 1FWKA 3OT9A 3DMJB 4ICLA 4R0EA 4RW4A 4W92B 4ID8A 4WKYA 4X4OA 1H73A 3DM2A 5HO4A 4MK9A 4JBCA 1IM6A 1O8BA 3I0SA 4Y2AA 1SL1A 3MM8A 2B9EA 1REVB 3HKZD 3QLHA 2UP1A 3TUJC 3OFFA 2F8EX 3HF5A 4I0WA 4Q7AA 3N5BA 3QO9B 2BE2A 4X62F 5ETKA 3CWJA 2F65A 1G6BA 3BGOP 4LF4F 1YDLA 1R89A 3QAUA 1F5BA 2C28A 2C2ZB 1K44A 5CQGA 3MM6A 3TA2A 3EVOA 4YP3A 3PIPQ 1FTRA 3GJTB 4TVAB 2Q43A 1UFKA 1RAEB 2NPIA 1J5EF 1NPPA 2VPXB 4EMDA 3RW6A 2R2SA 2R8JA 4NCAA 2R8IA 1YJNS 4B3SJ 4I2PA 4HVZA 1WC4A 2AKWB 3A8IA 4LSZB 1EQMA 2HNDA 2WK4A 5F8LA 2W24A 3ZZTA 2IJNA 3DFEA 2Y1LB 4HHUA 4WU3A 1TQLA 4XDDA 4QIEA 1SV5A 4ZLJA 4UOFA 1CVJA 4ITSA 1BQMA 1PBUA 3PW5A 2ILYA 1RWNB 1MW7A 1RT6B 1LWFA 2V8VA 2E9RX 3L3CA 2FZKB 2PEHA 3BKTA 4KFBB 1T8EA 1HL6A 3JSYA 4ECWA 2A6OA 3NLCA 2VBXA 1VLOA 4WZQA 1RBAA 2BVZA 4RNMA 1A6LA 2H51B 4YHHF 1UEVA 2V4JB 2CVIA 4MJKA 1PCAA 1VCTA 4DV6F 2AEMA 3QZ7A 2VC0A 1B0TA 3KYLA 1X4BA 1X9WA 3DCAA 1TELA 2FD2A 4LMZA 3W66A 1N5QA 2Z56B 1WSRA 3N6MA 1YJ7A 3OR1B 4EK2A 2QLBB 8AT1B 4JI4J 2VV5A 4G65A 4TY9A 4OYZA 1FDNA 3KK1A 4ECQA 3HX9A 4M1KA 3OXLA 1TV6B 4IR9A 3VTIA 2AYEA 4LVOP 4OFZA 3T9NA 1JIHA 1EP4A 3DN9A 3OR2B 4J9MA 3VAGA 1Q86T 4DX6A 2HZVA 4F0KA 2W4CA 3EZUA 2E1RA 2ZC4A 7AT1B 2N3LA 3U1LA 2D3OR 4DFKA 5KFQA 2CADA 2I5JB 3R6GB 3JTNA 4QYZJ 1GX6A 2EKYA 2E29A 1YITS 1ZYQA 1ZM4A 4K4YA 1H6KX 2NZCA 2CNLB 3CCZA 2OUGA 2ZBPA 1NRKA 3DC2A 2ABYA 4TU9A 2PFFB 1VRTB 1UWBB 1TL5A 3QRRA 3CIZA 3PJ9A 3W64A 3FBEA 4I2PB 2EXUA 2QFIA 4GRSA 5KFLA 4QWEA 5IS2A 2FVPA 2DISA 3GZ7A 3HVWA 2ASDA 3OTEA 5GMEA 5KFPA 1WHXA 4N77A 5J1PA 1HMVA 1TU0B 4QWCA 4X4VA 1GFWB 5HMZA 3C15A 1TAQA 3GYNA 4M8LA 3QT5A 3OTOF 3BO4A 5DGAA 1UVIA 3UVJB 4LF7F 3BO2A 1Q0NA 2LKZA 1M1GA 4OI3A 3G8TA 5F0WA 3ENWA 3IN5A 2JEGA 2J7KA 3AXKA 4PG5A 2WAQD 3IR5B 3LPYA 4J37A 3PRVA 4QYRA 3PNIA 5C2CA 3MR6A 3T5LA 3DM2B 2H3EB 3PKYA 3SXLA 2ROGA 4CO5A 5C42B 1FA0A 4OX9J 2FGCA 4ICLB 2HHPA 2GA7A 5IV3A 1X4AA 4RNNA 2IMWP 2OD6A 3R5JB 5F9NA 3H8YA 2WONB 3CDEA 5A6WA 1CQNA 4URGA 5ETOA 2GC8A 1S12A 3OXGA 3SIPB 2LDIA 4NLDA 3CEDA 5HATA 2LP4A 2W2QP 3E8OA 4LFBJ 1NNDA 1OQ3A 4HYKA 1VBZA 1IBKJ 1RXOB 3DYAA 3KJVB 4O3SA 1RT5B 3RJMB 1SQFA 1RU1A 1HLWA 2DGWA 1R8HA 1APSA 2G1DA 1P9YA 1IKXB 4NLRA 4C8LA 2MKYA 1F9HA 4ZN3A 4LF2A 1S1UA 1T9YA 2Z0GA 4LBPA 4TLRA 2ALZA 1T9UA 1Q8LA 3TOQA 3TP2A 2UVWA 4B3RJ 3KLIA 1KDNA 3CMES 4HACB 4NLPA 1XR6A 1PKUA 3CT9A 3U1NA 1MMDA 3C16B 2HIQA 2EEYA 1LFWA 2KJVA 1MWQA 1VQNS 5L1KA 2CPHA 2Q1LA 2XSJA 3Q8RB 3KTQA 3NOGA 2J0QD 4OZNA 3RW7A 2RS8A 1YBAA 5LOQA 2NQPA 1KOOA 2CPIA 4OZ1A 3VALA 2JLEA 3KUGA 4EZ6A 3DRSA 4PABA 1FKAF 1TKDA 3G71S 2VQEF 2APOA 2ZBQA 4RBTA 2YPYA 3CJKA 2YKNB 3H5YA 4Q8FA 1RJJA 4LRBA 1MWYA 2FY1A 3R27A 4RW8A 2BX6A 3OTBA 4PYDA 2A6MA 3BSOA 5KFUA 1JLCA 2V6AA 2K2PA 3F73A 4KH0B 4USHA 1ZS6A 3LALA 3FMBA 3ISZA 2A2DA 1JXEA 3D54A 3H4BA 1I94J 1TL1B 1NJZA 1VHFA 5H9EK 4ZP6A 1UWAA 2ZVIA 3O44A 1RKJA 2GAHC 5F3TA 4LF9J 2KZMA 1UZDA 2HS0A 3KK2A 2OLWA 1RUSA 2E1MC 3ITHB 4F36A 3QWUA 3R6LB 4LBHA 3C2PA 4OJ1A 2UUBF 2LA4A 2V9WA 1VJQA 1RHQB 3T6JA 3GLJA 2ZH9A 3MMBA 5KT7A 1OY9A 1NB7A 3OW2R 1JJHA 1S4FA 1YRTA 3T1HF 1K1QA 2DB1A 3G4SS 1P8GA 4M94A 4EYHB 3I87A 4AD6A 4E2FB 3OHBA 1NO8A 1KLMA 3IAS9 1ACMB 1U6BA 3GCXP 2RAQA 2XZWA 4O44A 3H40A 4JI7J 3QRPA 5DO2A 3KHLA 2KM8B 3NAHA 4MYUA 2BEFA 2BA9A 3B4MA 3PJWA 4IOBA 1G1XA 1RTIA 2WCXA 1Q81T 3E01B 1JLFA 3GIMA 3PR5B 1OSCA 5KFMA 1J5EJ 3K5PA 5J2MB 4LF5J 5CHCB 1CEZA 2V2VA 3VQTA 2W2NP 1GTHA 6AT1B 1S9EA 3OJUA 2RU3A 1R6VA 2LEPA 4QYZK 1NH7A 2AX1A 5AXNA 2UZAA 2DJWA 3BV8A 4H4KC 2OEJA 3AT1B 2FZGB 2UVUA 1S7HA 2B9WA 3DOKA 5EWGA 2CPJA 5KT3A 1KTVA 2V2QA 1EJ7L 3JSMB 4WIIA 2BQUA 2HPUA 2R7XA 1DJ0A 3T41A 1HBOB 1VC5A 3L7UA 2F4FA 4H4OB 4URQU 3KHGA 2HBZB 2CQCA 4PR6A 3PTWA 2V34A 4TXSA 1S0OA 4DF4A 3N01A 1IBKF 3BYRA 2LVWA 3KLEA 4PXCA 3M6XA 2F8MA 1E6VB 2MEWA 1TAUA 4C0OC 2A18A 3D4JA 3LF0A 3CTRA 3D3BJ 1RT3B 4F3QA 1F3FA 1C2PA 1EARA 4JYAF 1H3DA 1WHWA 1RAGB 1ZOTA 1QSSA 1JXVA 2AMCB 2E7XA 2FJDB 2DNLA 4I2QA 2C2NA 3A4TA 3H98A 5CAAA 5K8NA 3V2UC 4YY3J 3OUYA 2W1BA 5F8GA 2DHHA 3TA1A 1NSQA 1GT8A 1PYSB 2ALYB 3LP0A 4BWJA 4DUTA 1RTHA 1JLEA 1FKOA 4Z37A 3KLFB 2VQFJ 3TRGA 5IV4A 1RWXB 3K58A 1TVRA 1R0CB 2H9ZA 3J81U 4O4RA 2ZWOA 2R4FA 3A8KA 4RW7A 2M4MA 4ZIVA 4DSKA 3N6LA 1UJ5A 1BQNA 4OZJA 3NGDA 1U0HB 1UJ4A 3S8SA 3CE8A 1PSDA 1U7LA 2QSWA 2HFSA 2YNIA 1LXNA 3B78A 3BB5A 3D28A 3MM7B 4FPRA 4DQQA 5GAGU 3QSYB 5DG8A 2B7BB 3OSPA 2J6SA 4WXWA 4DCOB 1FO1A 3M2RA 3OD2A 1NDLA 2IVYA 4N8NA 4LRFA 4X4NA 1BLUA 4DMZA 3HJFA 2OPQB 4A47A 5E33A 2DVIA 4OYMA 2OPSA 4I67A 1F5CA 4NASA 3PX6A 1Q78A 1U47A 1SKUB 3U27A 4LSNA 1RB0A 5J2PB 5FLXU 4AQYF 3A8JA 2WB4A 3LUYA 3HHLC 3R2DJ 4P2MA 1RTDB 1IR2A 1JLCB 1FEHA 4MKVA 1RTJA 4XO0A 3IBFB 3K2YA 2XEXA 3Q8VA 4P52A 2W2OP 3OVSA 2XYHB 1FESA 2ZH4A 2YXLA 3A13A 1P1TA 4CNYA 4FYYB 2OPRB 4BC9A 3QZ8A 1JLAA 2RDDA 4FPIA 3MURP 2C2MB 2J9CA 3Q8YA 4M5NA 5IOLA 1Z2LA 4ZCIA 1VQYA 1N5TA 4DV4F 3OL9A 1XMBA 3I82A 3IS9A 1FWLA 1FNOA 2FB0A 4LFAF 5ETQA 2W4PA 2CQ3A 2OD4A 1YJWS 2GAGC 4EUVA 5IT9U 2MZTA 3BGRA 2BQRA 1IJEB 4O3OA 4BWMA 2UUWA 2KN4A 2GMHA 5DQGA 4Q0BA 2HGMA 4LFCF 1TL4A 1MWZA 3SEOA 1VBYA 3OL6A 4DL4A 4JI3F 5EX0A 3VWSA 1LW0B 2QSFA 3I6PA 2VH7A 3LP2B 3MM5A 1UFWA 1V3SA 2HZCA 4Y3CA 1T9TA 3ZZYA 5ADZA 5I42B 3OQ2A 4O23A 4CT9A 1TK8A 5F8JA 4OV6A 1WELA 4KH1B 3KLHA 3HVAA 1XR5A 3H2UB 2P6SA 1PO6A 3ISNC 2V63A 2B6AB 2P5VA 4WK3A 3S1TA 5BR8J 4WYWA 4DLEA 1ICEB 1FI4A 4ELVA 1R8AA 4ILRA 3P6YC 2Q79A 4ILLA 4RKUC 1NJXA 1CQMA 1NKEA 1D9DA 3Q24A 1RAFB 2YKMA 4Q2LA 2CJXB 3MECB 3VVTA 3KG1A 4C8YA 2HHXA 3WC0A 1PIEA 2HEKA 2YNGA 1L5UA 3M30A 1SH0A 3P5BP 2UXCF 3FQLA 2AF6A 2FJBB 3ZTOA 3T5JA 3DGVA 3M4XA 2HHSA 1S9GB 3HHKA 3MMCA 1ITPA 1WORA 3T5KA 3FEYB 2CKWA 2LXUA 3WBZA 4C11A 1ZAWA 1KN6A 1S49A 2EG1A 1Z1ZA 1VQ9S 3FBBA 5LM7E 4CH0S 1F2HA 1EAYC 2ILZA 1NB2A 3OLBA 4AE5A 5IM0A 1SJRA 2V68A 2NXJA 2PI5A 2VQFF 2BJ9A 3MPYA 1DLOB 3J7Z5 3DRRB 2KFNA 4F4WA 1T02A 1SC3B 1XERA 2QA4S 1ZAXA 4BLGA 4LR9A 4OHVA 2C2DA 3A12A 4ZJLA 2Z2ZA 3RR8A 4KQZA 2MZSA 4CT8A 5H1SV 2V4RA 3T6BA 1JLBB 4FKXA 4PCQA 4U9RA 3QBCA 4ZVSB 5D8HB 4ANDA 3KMQA 3T1YF 2HAIA 2QN6B 1VISA 4J9RA 3TWZA 2LU2A 3X3UA 1FXDA 1XN9A 4L3NA 1RAIB 4X4SA 3H5XA 3POTA 1J27A 1CG2A 2R9LA 2FJVA 3B82A 2I9SA 2GQ2A 2Z8QA 3HT3A 2LXFA 2Q6BA 4KC5A 3V81B 2VPWB 5L39A 3V6DA 3TNVA 1QJHA 4F4YA 2DH7A 4OV1A 3EYZA 1AT1B 2AT1B 3PV8A 1GXLA 3ILJA 4FF2A 1I51B 4G1QA 4MH8A 4P72A 2B0GA 2G0CA 3LAMA 4DCJB 4B3OA 4IG3B 3BEGB 4B3SF 2HURA 2NSBA 3BN4A 2CJYB 4ZP9A 3K89A 4KE5A 1YWXA 4RUAA 4OHXA 2XMKA 2ATLA 2WSFC 3LW5C 3R5DA 3NXZA 4S0MA 3O8WA 5E3PA 3ZFVA 3KLVA 3G6ES 3C6TA 4WP8A 4IUFA 2Y0SD 3D6FB 1H2UX 2M3DA 4DV4J 2DGOA 3G87A 3IRWP 4ED6A 2P8IA 5KG7A 2HHWA 1QY7A 2BMBA 1EX8A 3AJ2A 2BE7D 4M63A 5CA5A 2KO1A 1OQ6A 4OMFG 1W25A 3W8PA 4K0KF 3R97A 4DR4J 4U96A 3Q8PB 1RT6A 3Q8QB 3IA0A 4ZPCA 2RD5C 4WJBA 2RH3A 1F6TA 2G2OA 2HNZA 3QIDA 4KV8B 4O4GA 4AL6A 2KZZA 3PDNA 3AY0A 2RRBA 4Y65A 3G6VA 4DUZJ 4MAKA 3N5FA 4ZJOA 3K17A 3DOLB 1RWPB 4DR1F 1X0FA 3VVUA 2MZQA 3NNAA 8RUCA 1VJWA 2LEBA 1UVLA 2ZUAA 3W62A 5B0DA 4LJMA 1SUQB 2Q66A 3KOAA 2B4OA 2F4VJ 3BDPA 2WW4A 1N0VC 4USMA 4DR3F 1IBCB 1LFPA 4NLQA 1D0EA 3HHNB 5C24A 4L73A 3ILLA 3K5LA 2AJ2A 3KDOA 1CJVA 2AJQA 1X31C 2LU1A 1WEXA 2J7UA 4ZN1A 2D9OA 5KFHA 4YR3A 2EPIA 4AL7A 3NMAA 1RCOB 2MDAA 2G0IA 1O0PA 1IWAA 2P2CB 2QMWA 4IG0A 4LSLA 2B7CB 4NA2A 4HTJA 4YN3B 1Q16B 1REVA 1ZM9A 3FCVA 3HDSA 3QGGA 1IXKA 3TYTA 2FVRA 3L09A 4EI2A 1T05A 4FYWB 3PJXA 2CJAA 2GIFA 4QJVA 1SQGA 1TK0A 4N7TA 2ZE2A 4F0MA 4RW4B 2DNOA 3ET6B 3AOBA 1VI7A 2CWKA 2MJUA 4ZVTB 5HMXA 5HBMA 1N5VA 1FJ7A 5ETTA 3DI6A 2GVZA 2XY7A 2Y1IA 4LRDA 4K2JA 4F50A 3W61A 1T03B 2BJ7A 1QUVA 1BUXA 4K5RA 1Y9OA 3MD3A 3KNAA 1XMQF 2RF2B 4FNIA 3T1YJ 2MQQA 4RJVA 1T03A 3F56A 4W4MA 5G0RB 3BREA 4QWBA 4QU7A 4QIFA 1RABB 1WG5A 2IJRA 2KVQE 1DFDA 3TUPA 5C7PA 2L41A 2XMUA 4AQYJ 2R7SA 4C6AA 2A1BA 3M30B 1SKWA 2KM8C 4JI6J 1XC9A 2V0NA 1KTQA 4ED7A 3PO5A 4C8ZA 2XLKA 2E1CA 1WC6A 5KFGA 5K9FA 5EDWA 2WOMA 4AUKA 2YH0A 2NREA 3IWNC 4UTGA 1XNRF 2ASJA 4NXMJ 2WVBA 2HVDA 2HG4A 4PUOB 3A8EA 4GVBA 1V9OA 1CC8A 1URRA 1Y11A 2B6AA 1SIWB 2K3KA 3EM1A 4WFYA 2XO7A 3UPFA 4EYIB 1VQLS 3NBPB 3BSCA 3VF0B 3ULHA 2C22A 4PQAA 4USKA 3C14B 3Q2SC 2ZJRQ 4CNZA 3MR2A 1PJ5A 3FZBA 1LW0A 2GW8A 2JFKA 2RHQB 3OFHA 3M8ZA 4I6WA 4MK8A 1QE1B 3US5A 1XMOJ 3EZ5A 4FXWA 4ZITA 3MEEB 2WBRA 3C3LA 1S59A 2QIFA 5KFZA 3D67A 2BJDA 4N41A 5IFMA 1B70B 2LQ5A 3AA8A 5J2NA 2F9JA 4B9VA 3C6UA 2BXJA 4A4JA 4ETXA 4NI2A 1VBXA 1NK6A 5L38A 3DOLA 4I69A 4ED5A 4RO0A 3DLHA 2QLFB 3LQVA 1ZH5A 4DR6J 2HAFA 3MCOA 1H98A 5RUBA 2HVZA 4KSEB 5E3RA 3MPWA 1ZA2B 2XSFA 4B3MJ 2C2RA 4UY8T 5E3QA 3TUZC 1SIZA 2JC1A 3BKUA 2RSQA 2XI2A 3HP6A 2OSQA 3N6NA 4P7VA 1ZPVA 3KLGA 1DQ8A 1YX2A 2R42A 2VFVA 4RW6A 3NRBA 2VBYA 2VONA 3UD3P 2FHKA 3JTPA 4NXNF 1HW9A 3CJSA 1DTTB 3HZEA 1L3SA 2KT2A 3DDKA 2WRMA 3EICA 1VHIA 2GVDB 2ZVSA 1N5YB 5C5JA 4LSNB 4DQRA 2C3YA 3QGPA 1KR4A 5E41A 2W8KA 2R7UA 1ZA1B 2KJWA 1S99A 4F8RA 2W01A 5HROA 1N56A 3G6XA 3GFXA 3DRPA 4DV7J 1T9VA 2HWHA 3SZ2A 2QX0A 1PG5B 1S1TA 1RU2A 2VG5A 2W25A 3AJDA 1TKTA 2QRRA 4NPOA 3SV3A 4OI4A 1KC8T 4ZPWR 7FDRA 2OIHA 1RLDA 4PRFA 2MTLA 4C2MA 1R0BG 1BQNB 1CC7A 3BQ0A 2VJVA 4I7FA 4RW7B 2FGOA 2JZ5A 2VQEJ 1F60B 1Q1KA 2CDQA 3MZIA 3RU0A 3V81A 4K59A 3T1HJ 1TMMA 1DURA 2OTJS 2NZ4A 2ZM6F 3SSSA 2JHEA 1NSKL 4R8UA 4XPCA 1RT1A 2BRKA 1KKHA 3KLFA 1YGYA 4JI7F 1F2GA 4I4BA 3ZTRA 2HW3A 5JVGQ 4ZIWA 2RNEA 1HW8A 2V8GA 3RUBL 1SH3A 4DCPB 4I1TA 2DO4A 3GMGA 1HNZF 2HRYA 1TP7A 2GCFA 4K8RA 1BXNA 1S1VA 1Q4RA 1VOMA 3MFIA 1U1OA 4LQ3A 3DNCA 1KP6A 1C0UB 3ELHA 4CH7A 1LNQA 4DV0J 4LF9F 4LIWA 4ZVFA 2ADCA 4DEZA 3F44A 4F3MA 2UUCF 1CJTA 1GQEA 4HI2A 4QPXA 4H4OA 5IM0B 3CD5A 2HQ3A 5A8KB 2RU9A 3G82B 4XPEA 3M2UA 1K1SA 2D3UA 4P2FA 1KLNA 1FDBA 1HBMB 1U1LA 2B56A 1JNZB 1TUGB 4FYDA 2YX1A 2MQLA 2MKJA 3G8QA 3NGSA 1R27B 3S01A 1B64A 2DXFA 3FCHA 4P74A 4ZCKA 2C3UA 2NYIA 4F7VA 1DBDA 2DGVA 2LFVA 2YNGB 3KG0A 2HBRB 1YRUA 4OHYA 1AA1B 3KWMA 2M0GB 1ZZFA 2NPFA 5FLXY 4WFAQ 4TNOA 4DF8A 4B9MA 3R7BB 3EMTA 3OV7A 1IBLF 2E66A 6FDRA 1RTIB 3MCNA 1S0VA 2WSCC 1R43A 5LSRA 4LF5F 2VA3A 2D1CA 1H74A 3CCTA 3G82A 3KHHA 3VAFA 1D9AA 3ZZ0A 1KLMB 4HH1A 5D15A 4QR2A 3V4MA 3KLHB 4P71A 3TZXA 2ZZNA 4K4WA 2UXDJ 2WZ1A 2RDIA 2L9DA 2VUGA 3D0HE 2Z58B 5KFXA 4DZDA 5L1LA 3BQ2A 3PZPA 2CIMA 3CC4S 1KVKA 4DR6F 3DHXA 2DGQA 3LP2A 4GC7A 4JV1A 1FWPA 5GAGI 1WNEA 1Y5IB 2IBKA 2E9TA 3KFWX 4DL6A 4FVMA 4OYXA 5KFFA 1QAJA 4Q0BB 5ITHA 2OJ3A 3J80U 4Q5VA 2M2BA 2ROPA 3ITHA 2ZKUA 4JI1F 1YLXA 2GGPA 3DLKB 4X65F 4C97A 2ZUGA 3LPEA 5JMNA 1WC0A 3TZZA 1WF2A 2OPPB 1IBMF 2E9ZA 2LQ9A 2F5GA 2RQMA 1TL1A 4NRTA 3D1QA 2XGPA 1QSLA 1FT8A 4O0NA 4L72B 1R8BA 1FEEA 1X5OA 3D0IE 2IRUA 1Y3JA 4YY3F 1RWUA 4FBTA 5EN1A 4UOCA 3CC2S 2BM0A 2QZ8A 1RWVB 1N34F 1T9WA 1UP1A 1OO0B 4Y2IA 1RT2B 2MXYA 2HNYA 4KY3A 1NJWA 4WTOB 1I1GA 1NKCA 3CJKB 3NGUA 3FZ2A 3D2WA 2H5JB 5K8OA 5HROB 2M9KA 1HHQA 2GS8A 3PCOB 2CZVC 2XYPB 3J7ZT 2CJKA 3UR3C 4OJHA 2RT3A 3IFEA 3FUYA 1VC0A 2KG0A 2WB1D 5B0BA 5G4DA 2W7AA 4RWWA 2U2FA 2IDLA 1UW4A 5HQLA 1QVFR 3FC9A 4NA1A 1JKHA 2YNHA 4OX6A 4RW6B 5KFRA 1U0HA 1FTCA 3UDEA 2KHCA 3WIUA 1G3OA 4DPYA 2GIQA 1U45A 5E3CA 5L1IA 2VKZG 4DL3A 4B3TJ 1EB0A 1M5HA 4Y28C 2MQ8A 3CXCR 3D66A 2WVDA 3NNHA 5ETMA 3AJ1A 1R3NA 3DYAB 2OTLS 3JSBA 1FKOB 3C6UB 3ENAA 2QC3A 4DV3J 2W2PP 4JI3J 2EFVA 5CABA 2VJUA 3PHTA 1L3VA 1HKAA 3R5CA 3RR7A 1T11A 4DX8H 1S77D 4CCHA 1UCNA 3FSYA 2UVVA 3CO9A 4YUDA 1SCJB 3AOCA 3LOUA 3SQOP 2FJXA 1RT3A 3MTJA 5M2PA 2JVOA 5C42A 4IO9Q 2GQCA 2KT3A 5DLFA 2HHVA 3IMQJ 2B4VA 1UPPA 2AJFE 4ALZA 1IKVB 1U26A 4LF4J 2G9OA 2ZH3A 1HD1A 1KBRA 4A8OA 4DG1B 4JP8A 1HBMA 4R25A 1KFSA 4U7UK 1T95A 3TAPA 4I68A 4DV6J 2MZJA 3SQGA 4DFPA 1MU2A 4DL0C 4K4XA 1VQ6S 4BDPA 3RYLA 4CM2A 1CJTB 3O6QA 2N3OA 3GYXB 2IM2A 2KU7A 2CRLA 1FD8A 3DLGB 2HFOA 3CUNA 3PVXA 3UDCA 4PG8A 3BO3A 3TEGA 2A3JA 3KHRA 3JQMA 1M5VC 1EIYB 4PZVA 3HO1A 1S1VB 2LQBA 1SJQA 3EXYA 2EFNA 4OI2A 1W2IA 1NZAA 4D3GA 5L9NA 5DDRC 2UUAJ 4K4SA 4KR0B 4P2SA 1C1BB 2GJIA 2KB2A 4ZPAA 2IMOA 3E01A 5KG0A 2ZBRA 1SVDA 3IR6B 3W1YC 4MIAA 2DR7A 2OH2A 4I56A 2RB7A 1S0NA 3TJ9A 1VRTA 1UVMA 2ZHAA 1FRKA 1JNRB 1GTEA 2RF2A 1VQ7S 2XHCA 3MXHP 3VAIA 1FJGF 4R8UB 2MQPA 1C0TA 3NCPA 2HQFA 1Y5NB 3ZO7A 1JWWA 2B8QA 5A6PA 3RB6A 2EFGA 4R5PB 2Q3PA 3EPIA 3SYZA 2DO0A 3DI6B 3QIPB 1HNXJ 2R8KA 3CMAS 1ZPWX 4I7FB 2KXNB 3ET6A 1A0OB 2JRSA 2COLA 1SC6A 5MAOA 4DPOA 3PKMA 5D4PA 3AAWB 5EWFA 3NOCA 2HHUA 3QQCD 3L7OA 3QFHA 1TV6A 5HSPA 3CD7A 3KK2B 4I6AA 1U4BA 4DR5J 3PXGa 2QT7A 1XTZA 4KKOB 2D69A 4BC7A 2QFJA 2JFDA 3MUMP 2ZM6J 1UL3A 1WHVA 1VQMS 5A76A 4MIBA 2RIJA 1IKWB 3CJ3A 4U6PA 2PMHA 2AYGA 1FFSB 1MG7A 1XWLA 3THTA 3UDVA 2GVDA 1Q8KA 1PAEX 3ZTQA 1N5YA 3FBFA 2D7SA 1QVGR 4IDKB 1LK7A 1EKRA 3I56S 1S6UA 2F9DA 4NX9A 2QA4G 2FYXA 3U02A 2XCPA 3PW0A 3R7SB 1NH8A 1NU4A 1LWFB 2CQHA 5D78A 5JXSA 2QG9B 3QFWA 4J9SA 3RBZA 3H5SA 2FVSA 2FC9A 4F67A 2CNOB 2HVEA 2NUHA 3BBFA 4IRCA 2VFTA 3IWLA 3PEJA 4IH6A 1NPKA 2C3OA 5EUHA 3R5GA 5KFSA 1SC4B 3OSNA 1XEZA 1X60A 4USIA 1XNQF 4ED4A 1HHSA 4NMXA 4PYAA 5E0OA 2W7OA 5LMUJ 3HM9A 2V69A 3M9OB 3CO0P 1EKSA 4YB1P 4C8OA 3UQSA 2X7IA 1OJ4A 3KLIB 4HT5A 3CDWA 2CPEA 3EE3A 1BD6A 5KFBA 4NEYA 2VG6B 3M1VB 1V5IB 3DU6A 1KOHA 4JV5J 2E1AA 1PAUB 1N36F 4EBDA 3C6TB 2KXHA 1RT5A 3CJRA 2W9BA 3LWMA 1VS3A 5K8PA 2XS2A 1ELOA 3D9BA 1WI8A 4FNHA 2K7JA 3GFYA 4KGMA 4P7TA 1H7XA 3HVTB 3UN3A 2ZH1A 4DR4F 4KPCA 4PUOA 4DV5F 3BS9A 3HFKA 4ENOA 4DHVA 3GV7B 5AJ3F 4RX6A 1WDDA 2QA2A 2ZWPA 4USUA 3MEKA 3MPUB 1YJTA 1FDDA 4LRCA 3G2XA 3BGLA 4FN5A 4DI6A 4Q43A 4J9OA 1S4EA 3KNGA 4RR5A 2HS3A 1LW2B 1FRHA 2QE5A 2ROEA 1IR0A 5E7OB 3T19A 2EC2A 1VYAA 4HDHA 5CCLA 3TQ1A 1M5KC 2IC3A 2K7KA 2BANB 5B0FA 2KFZA 3QIPA 5DJBA 2D3ZA 2SXLA 3W9HA 2HIYA 4EO8A 5K20B 4R5PA 4X65J 1GXTA 2DITA 2WTFA 1MMLA 1DTQB 1RWKB 3GPAA 3IBCB 4Y2KA 5IC6B 4OI1A 1FK9A 4IO1A 2KH9A 3I4PA 2HRUA 1CULB 1WKLA 3Q8UA 4M5IA 2VIHA 5KG6A 2M52A 5DG9A 2VA2A 1BQXA 1EZZB 2X1FA 3A3NB 4CLSA 1KONA 2GO8A 2K3IA 1HFEL 2DRBA 1F0XA 1JX4A 5DLGA 2JEJA 5HBMB 5K5MA 1NHUA 2ZOGA 5GAHU 1R8CA 2FLOA 3TAQA 1FF2A 1ZBTA 2IAJA 2ZE2B 1VQOS 2FJWA 4KTQA 1NSPA 4CO0A 4CZCA 3K5NA 3IAM9 1VQKS 2XY5A 1Q79A 3CCES 3IGVA 3WZ0A 1RYSA 1XBWA 5D4LA 7FD1A 2E5IA 4X4TA 2HBQB 2BJEA 4LSLB 1CULA 3QMQA 5KT5A 4M5HA 3SQGB 5B0EA 4DR5F 2VC1A 4ECTA 5A8RA 2L3MA 2UU9J 2VFUA 4LF6F 1Y4ZB 1K73T 3M8QB 3JB9k 3G9CA 3J7A1 2XWYA 1U2FA 2BANA 3TARA 2ZH7A 4L75A 2EI5A 2R7WA 3TUIC 4IKAA 2OI2A 3OR2A 3MOZA 4DXLA 2VFRA 3UDLA 3MWBA 4GKKJ 4K4VA 2HLUA 1FCAA 4KGVB 3NP5A 1SL2A 4IQXA 1LWEB 2G1HA 2PO4A 2AEJA 1F9EB 3DDNA 3SBMA 1XR7A 4RNOA 4Q8EA 4IRKA 4PEOA 3W63A 3M9MB 3MGJA 2C42A 5K14B 3OR1A 2ZH8A 3P96A 5DZ7A 3ONQA 1EQ0A 3TO8A 2PT0A 1AW0A 4KV8A 4MFBA 2DGUA 2VG6A 3M1VA 3CPWR 5HQ8A 3R2CJ 2CPFA 5CYQA 2C2EA 3IM9A 4OIXA 2DHXA 4WK1A 2LA6A 3VR1A 2H1YA 1WSVA 3I55S 2HQDA 2DT9A 3DKDA 3FEXB 2HVIA 2BKPA 3DXBA 3H5UA 1Z4UA 3HHLA 4QQBA 1NHKL 3WQPA 1N36J 1KWMA 4M5JA 1WWHA 2AQ4A 3PFEA 1VK3A 2WSEC 3I5BA 1AROP 4FF4A 3PRBA 4FKYA 4PWUA 4QIGA 1JB0C 2YPZA 1FRJA 4B3OB 3OFGA 3K59A 1D9FA 3AB4B 2E5LJ 4DSEA 3AB2B 4OYBA 1P27B 2OPRA 2HNDB 2FY8A 3UCGA 4DQIA 3NMRA 2OELA 2RJZA 2GIRA 1N33F 2FUG9 2G2ZA 2M70A 4IG3A 2HNYB 2AZ1A 2CPDA 4DV5J 1RHMB 1VFJA 1VIXA 1WD6A 4EO6A 5IQ6A 5AJ3J 1NCLA 2J0WA 3BZQA 4IDKA 4DUYF 4QW9A 1N4LA 2HHQA 4RNFA 2GHPA 2DR8A 1H72C 1NDKA 4DU7A 1SC1B 1P1LA 4ECRA 2PGCA 1FNXH 5D0HA 4DDFA 1U49A 3EVWA 4GO7X 4NMLA 2AGPA 5KT4A 3H0PA 2AGOA 3UNGC 3N9UC 2OPSB 3CCWA 3POTB 2OPPA 4LUBA 2OPQA 3VGVA 4ECZA 4JI0F 1HI0P 1QM9A 4KKOA 4E8UA 2NR0A 2I6WA 2N82B 3GIIA 2GGPB 3DLKA 3R7NB 2CQIA 2NSCA 1M0SA 3BKFA 4ZHRB 3MM8B 5DQHA 3H2LA 1WOSA 4Z2XA 3OL8A 3LO3A 2CAJA 3THVA 3RRKA 3HMJG 2BV3A 2UV8G 1YQHA 2J76E 2YWGA 2FJAB 1FFGB 4X84A 3KJQB 4DX5A 1GMVA 3HLUA 3QGIA 3GQCA 2JX2A 5B0GA 3CJ2A 3DRRA 4DV0F 4DR2J 4WF9Q 4DV1F 4N5SA
chains in the Genus database with same CATH topology
5H9EK 2Y9HA 4U7UD 3QRQA 4QYZK 1WJ9A 4DZDA 2Y8YA 5CD4A 3QRPA 2Y8WA 5H9FK 3QRRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5H9E K;  2Y9H A;  4U7U D;  3QRQ A;  4QYZ K;  1WJ9 A;  4DZD A;  2Y8Y A;  5CD4 A;  3QRP A;  2Y8W A;  5H9F K;  3QRR A; 
#chains in the Genus database with same CATH topology
 2DIU A;  4NZ7 A;  3J7Y I;  2YNF A;  2YX4 A;  5I4M A;  2FDN A;  5D0G A;  1RTH B;  2ACY A;  1HQ2 A;  5LL6 d;  5KFV A;  2PI4 A;  3B4D A;  4B9L A;  1IQT A;  2XMJ A;  4ILM A;  2BAC A;  1U1R A;  1N6Q B;  4C11 B;  1HI1 A;  3K5O A;  4RUB A;  4JV0 A;  4ED3 A;  2RRA A;  4F2S A;  4OYI A;  2C1E B;  1S9G A;  2E5H A;  2CZ4 A;  2NXU A;  2X51 A;  5SZT A;  1YRX A;  2DHS A;  3I0R A;  4UUW A;  2Z57 B;  1RAC B;  1WG1 A;  4WYL A;  2G0J A;  4USW A;  4MKY A;  3DOM A;  2G13 A;  2MKS A;  4ZPB A;  2WVF A;  2N4D A;  4CP5 A;  5LMN F;  4IFV B;  3SMZ A;  3JSR A;  4DLG A;  4LFC J;  1EHW A;  4RWX A;  3W5X A;  2VDI A;  4OJG A;  4TY8 A;  1XQI A;  3R5A A;  2GHW A;  2XCA A;  1I6J A;  3P49 B;  1HBO A;  4OZ2 A;  1X7V A;  2UUT A;  3M2U B;  4M5M A;  3CCV S;  2XY6 A;  2HGN A;  2GO9 A;  2IIH A;  1NK5 A;  2B8P A;  3DDI A;  2ADB A;  3U1M A;  5EHH A;  4JI8 J;  1IKY A;  1RT4 B;  4UW2 A;  1S57 A;  3TX8 A;  1FRX A;  2P9G A;  4F0H A;  1SJF A;  1NK0 A;  2XMW A;  2M7S A;  3FJ2 A;  1FJE B;  4QW8 A;  5T7L B;  3DU5 A;  2AHO B;  1CBK A;  3Q83 A;  3M8W A;  3MD1 A;  5LMU F;  2XG8 A;  4A8Y A;  1FFW B;  2IM0 A;  3L7P A;  4MMO A;  4TQS A;  4YB6 A;  4A8X A;  3KMS A;  2MYF A;  3AQP A;  2GQQ A;  2IA6 A;  1TZ0 A;  5BJR A;  4IOA Q;  2YVS A;  2F3J A;  3TVY A;  3Q0A A;  1TFY A;  3BGR B;  1TL7 A;  3EX7 B;  2CNK B;  1HI8 A;  3NGK A;  2A10 A;  4O44 B;  1RT1 B;  3KK3 B;  5D77 A;  3ZNU A;  3I5A A;  3MI7 X;  5HAN A;  4ZMM A;  3RB4 A;  4XK8 C;  5H9F J;  5CXT A;  3OVB A;  3ENV A;  3W2W B;  1S6P B;  1UW9 A;  1XJW B;  5LSO A;  4I6Y A;  4WFB Q;  4YHH J;  1WAC A;  4PXD A;  4CYU A;  2ZHB A;  5DDO C;  1NLK L;  5HQM A;  3CJQ A;  1RZM A;  8ATC B;  3MED B;  5DDP C;  3EJM A;  2MGZ A;  2XLJ A;  1TL3 B;  2JWN A;  2XZD B;  1R0A A;  2E5J A;  1CPZ A;  4ZVP B;  1RYR A;  5CYM B;  1TKT B;  1YJR A;  1TMJ A;  4PWD B;  3H42 A;  1RTD A;  1T3N A;  3CCJ S;  2DGX A;  4EZ9 A;  3AHP A;  2EFQ A;  2OFG X;  3CCR S;  3LWL A;  4DR7 J;  5J2P A;  1J2V A;  1WC1 A;  3DRP B;  4ZK7 M;  2LEC A;  2B9X A;  3QJJ A;  1U1P A;  2HS4 A;  2PDA A;  4ZJQ A;  1D8Y A;  2JVR A;  1FXR A;  2AZ3 A;  2VL1 A;  4MTP A;  3IGN A;  1S7I A;  3KKF A;  3CMQ A;  2CQ2 A;  2V8P A;  1U6F A;  4DPW A;  2KDO A;  1S1W B;  5FDL A;  4X66 J;  3VGU A;  5B0C A;  3MUV P;  4AL5 A;  1V6H A;  1W7W A;  5IZH A;  3WX4 A;  1BE4 A;  2FVQ A;  3HD2 A;  1BWV A;  1QDU B;  3GJS B;  4KHP J;  4OLP A;  4GMK A;  3NNC A;  2IVF B;  3W9I A;  2AEF A;  2MJN A;  3MED A;  5HVG A;  2MGZ B;  2YKN A;  4OJ3 A;  2QLW A;  1ZM3 A;  1CS4 B;  5CH7 B;  4DU8 A;  1UEU A;  5A0Y A;  1U1K A;  1N8R T;  2XTJ P;  1OS5 A;  2H5E A;  3FCW A;  3H7H B;  4QPT A;  4XDC A;  1TVR B;  2N7Y A;  1HBU A;  2KTQ A;  2DNN A;  2U1A A;  3GIJ A;  3Q89 A;  3P3D A;  4NI2 B;  3LP0 B;  3S7R A;  3D68 A;  1WEZ A;  2RVJ A;  2RKI A;  1URN A;  2J9D A;  3BYP A;  1TL7 B;  4Z7C A;  3CUL A;  2BJ1 A;  3PHE A;  3QSI A;  3LAK A;  3C16 A;  2PN6 A;  2IFX A;  3BR9 A;  4ID5 B;  5F9L A;  4EBC A;  1W2B R;  4IRD A;  3GV8 B;  3Q22 A;  2Z2Y B;  4LF7 J;  2Z2M A;  2FQQ B;  1U09 A;  4PG4 A;  5DQI A;  1QE1 A;  4J9Q A;  2M88 A;  4DOZ A;  2DH9 A;  3HI9 A;  1HNW F;  4UZB A;  3CJ8 A;  2HQG A;  2VZ9 A;  5DRK A;  1E6V A;  4FP9 A;  3UWT A;  4GKK F;  1AFI A;  1NM2 A;  4QZV B;  4CO3 A;  3NAI A;  3UO0 A;  1IKY B;  1RT4 A;  3C8Y A;  3GCW P;  4OYP A;  4X4U A;  2O1P A;  3NGR A;  4EU0 A;  2AU0 A;  1RSC A;  2VB6 A;  2J6T A;  4L6V 3;  5J1E B;  2ZEJ A;  3BSA A;  4HDG A;  2KT5 A;  5KFY A;  2EVZ A;  1WKK A;  4OLO A;  4GKJ F;  2V4Q A;  1CJK B;  1WG4 A;  2QYG A;  2ATC B;  3DOK B;  4ERD A;  1UMJ A;  2XMT A;  5HJX A;  2WOM B;  1FE0 A;  1UJ6 A;  2ZOM A;  4YME A;  2YWW A;  2EWH A;  4YQW A;  1LWX A;  2LXI A;  1R31 A;  2JNJ A;  1RP5 A;  2DR5 A;  3HJV A;  5C25 A;  2HMI B;  5KFE A;  3I31 A;  3CVK A;  5KG4 A;  3I4H X;  1NK4 A;  2F4V F;  1MRO B;  4TYA A;  2IY5 B;  5AT1 B;  1NKB A;  2BJ8 A;  3QT6 A;  1BC6 A;  5EX3 A;  2IJF A;  1N6Q A;  4ZPT R;  2XUL A;  3FMW A;  1BMQ B;  3CSK A;  4WFZ A;  2G4B A;  4CLF A;  5L9X A;  3IRX B;  4R0J A;  4DUZ F;  4AYB D;  2MQN A;  2NXN A;  4F4Z A;  4FS1 A;  2B4U A;  1S10 A;  1JQG A;  5D4O A;  2QEX S;  5ETV A;  1KD1 T;  2POK A;  3MMB B;  1FVQ A;  3PYF A;  1WOO A;  3LGM A;  3SDE B;  4A46 A;  3SCK E;  2O67 A;  4I64 A;  4P9S A;  1V3Z A;  3IC1 A;  2O5D A;  1JLQ A;  2IPO B;  2CPZ A;  4OI6 A;  4ZHR A;  1KNZ A;  5SUH A;  4PWW A;  3J81 j;  2ZBC A;  1AB8 A;  3HZG A;  1C1C A;  3DGP B;  4B9N A;  1DQA A;  3H20 A;  2EFO A;  3TAM A;  3MFH A;  2UUA F;  2DD8 S;  3QPI A;  4LQ9 A;  3DHW C;  2JJ4 D;  3IXQ A;  4JI2 J;  3LGN A;  4J9K A;  1GMU A;  1B99 A;  3ZZP A;  5GAD U;  3L9Z A;  2YBV A;  1EP4 B;  4X66 F;  4NLU A;  2ZNZ A;  2DXD A;  3GTY X;  4K5S A;  3SCJ E;  5H9E J;  3AOA A;  1S1T B;  1Q53 A;  3KG4 A;  2ZJQ Q;  3A1Y G;  4NZ6 A;  2PSZ A;  4NLV A;  2VPZ B;  3QWP A;  3UN2 A;  3V6K A;  2ZH5 A;  2KYX A;  3HSG A;  4PKD B;  3HVR A;  4UF4 A;  1X9S A;  1DHM A;  1BHN A;  2KKH A;  2ZIT A;  3DRS B;  3UN5 A;  2Z2L A;  5D3G B;  4IFY A;  1SKR A;  1LKZ A;  3TVK A;  3VGS A;  4M5K A;  4F2R A;  2HLT A;  4LBI A;  3NKY A;  1NHV A;  4O4G B;  2HNZ B;  1UA0 A;  2PMW A;  3E2E A;  2XSJ B;  1H2V Z;  3SCL E;  3M8P A;  3TVZ A;  2DGS A;  3LP1 A;  1XMQ J;  2MKH A;  2M8H A;  4TN2 A;  1RAA B;  3EDR B;  3UD4 P;  1HAR A;  1HPZ A;  2YH1 A;  4Q45 A;  2DRA A;  4KFB A;  2JL9 A;  1T3O A;  2CNN B;  2DK2 A;  2BDP A;  1H38 A;  3MOJ B;  3CJ5 A;  1YSJ A;  5GAE U;  5LMN J;  1S97 A;  4WZM A;  4MFB B;  1IKX A;  2DCL A;  2V9K A;  4XTT A;  4CLK A;  2XBP A;  2HRT A;  5LSL A;  4WFN Q;  1HNW J;  1WUU A;  1FDA A;  2XZT B;  3TZW A;  3KJV A;  2EC0 A;  1HIY A;  1LXJ A;  2AJ0 A;  3G6Y A;  1VRU A;  2I8E A;  2PA8 D;  4YS2 A;  4QU6 A;  3Q86 A;  2FJE B;  4NCG A;  2K8G A;  2L9W A;  1L3K A;  1MN7 A;  5J2N B;  2WVC A;  3SFU A;  2FLL A;  2C2K B;  3J7A N;  2UXB J;  1WTB A;  1N48 A;  3HT0 A;  4JI6 F;  4ZLP A;  1U8W A;  2WON A;  2W4D A;  3D3C J;  5THW A;  4KGX B;  2PE8 A;  4KBI A;  3MEE A;  4X4P A;  5D0R A;  1X4H A;  4M5D A;  3ETM A;  1H7W A;  4B17 A;  1F5A A;  1PYT A;  2XWX A;  2PII A;  4YR0 A;  2HFN A;  1AUD A;  3MM6 B;  3IWX A;  2EK1 A;  1IUJ A;  2VU5 A;  5IT9 Y;  3NBP A;  2CFX A;  3BGF A;  2AYM A;  5BYS A;  4WE1 A;  4WE1 B;  5EGY A;  3TEH B;  4GVB B;  2AD9 A;  3RAX A;  4LF1 A;  4JYA J;  5HVF A;  1LWC B;  4X4Q A;  2HWI A;  1K0T A;  1QD1 A;  3NEK A;  2N7C A;  3PRD A;  3I0S B;  5C2G A;  2DRD A;  4DS4 A;  3TW0 A;  3CCU S;  4ZDN A;  5CD4 H;  3MCS A;  2VOP A;  1FHT A;  2YX7 A;  3JTO A;  4WIQ A;  1X4F A;  2DY1 A;  2A2C A;  2LLZ A;  3OFE A;  2DR9 A;  4BBY A;  4M5D B;  5JUM A;  1MN9 A;  1NK9 A;  1RAJ A;  3QT8 A;  4L3K A;  5J1N A;  4U95 A;  2M5Y A;  4OHZ A;  5KFW A;  2J9E A;  3HUL A;  1JJ4 A;  2XYG B;  5HAO A;  1FK9 B;  3BPD A;  3EZO A;  4J5O A;  3UW1 A;  4DZ6 A;  2XM3 A;  2Y8Y A;  3D6T B;  2MST A;  1S0M A;  5J2Q A;  2KRR A;  2AJ1 A;  2AV5 A;  3CCQ S;  2DH8 A;  3TI0 A;  3MMC B;  1Y7P A;  4F26 A;  4DSI A;  2BZ2 A;  4A8F A;  1XNR J;  1AZS A;  2OSR A;  4MK7 A;  4RU2 A;  1LW2 A;  2LCW A;  2V67 A;  1YJ9 S;  1EET B;  1HWK A;  3VZH A;  4ZKA A;  2DXE A;  1F3V A;  4QWD A;  3VAK A;  1Q5V A;  2I38 A;  2XHW A;  6FD1 A;  2BW7 A;  2OGU A;  4FZV A;  4F4X A;  1T05 B;  2I2Y A;  1ROF A;  3CDB A;  1SKS A;  1L3U A;  4CI0 B;  3H25 A;  3CCM S;  1YKW A;  3RBD A;  2E5G A;  4IG0 B;  3M8P B;  5BYR A;  3HVT A;  5AXM A;  2FHM A;  3ZTP A;  3KK1 B;  2RIL A;  1K0V A;  4FXD A;  2HQC A;  5BXI A;  1FRL A;  2W9B B;  2UUC J;  3CGI A;  2JOQ A;  2XMM A;  2PFD A;  2ZKT A;  3JYT A;  4G3I A;  2R7Q A;  4TYB A;  2KYZ A;  5I42 A;  2YQ0 A;  3HXM A;  3MM5 B;  4ZP7 A;  2Y1J A;  2V4J A;  1U02 A;  4KRW A;  3CJ4 A;  1A9N B;  1CLF A;  4OYO A;  1RIS A;  2CA9 A;  3DLJ A;  3FNN A;  4LF6 J;  3Q2T C;  1AXQ A;  1TKZ B;  2IYG A;  3GV5 B;  5FII A;  1VIO A;  1NJI T;  1JLG B;  1YG0 A;  2X1G A;  1NK8 A;  3MM9 B;  2XMA A;  4N47 A;  1U1N A;  3BF4 A;  1SV5 B;  4IR1 A;  2HBY B;  4AXI A;  2CUY A;  3JS9 A;  3TAM B;  3GU0 A;  2OO4 A;  1R7I A;  3DGP A;  2AYB A;  1C1C B;  1JLA B;  2QYC A;  3MPV A;  1UA1 A;  2KVI A;  3IG1 B;  3U7J A;  4EBE A;  1HNZ J;  2OFH X;  1C4A A;  1OIA A;  3QJP A;  3LGH A;  2PD1 A;  3KJF B;  1OYD A;  2EBE A;  1BWE A;  3W7B A;  2O01 C;  3CC7 S;  1N33 J;  4Y34 A;  4F4K A;  3ENQ A;  4ZA1 A;  1WTF A;  2GNK A;  4OX8 A;  3HD1 A;  1UKU A;  4NYP A;  4K4Z A;  4JB8 B;  4PPD A;  3H4D A;  1U2R A;  1OYE A;  1IKW A;  1ULR A;  4ZCM A;  2CQG A;  3RBE A;  1SH2 A;  3I9V 9;  5LJ3 Y;  4QBU A;  2R2T A;  3OXF A;  4JI1 J;  2BE2 B;  3EGN A;  1IJF B;  2J9D E;  1PGZ A;  4C8K A;  1OPZ A;  2UXC J;  1HWI A;  4O3R A;  5KFA A;  2Y3Y A;  2YKA A;  2YQ3 A;  3G86 A;  3L4B C;  5KT6 A;  1MRO A;  1T9X A;  2YNI B;  3CJT A;  3QYY A;  4G1Q B;  4TQR A;  2FHJ A;  4NZ0 A;  3HKW A;  2PMZ D;  4RW9 A;  4CH1 A;  5AE2 A;  2HHH J;  1UVJ A;  3M8Y A;  2MLX A;  5C25 B;  5IC4 B;  2HMI A;  1TR0 A;  3DMJ A;  1TFW A;  2AX0 A;  3Q8S B;  3B6B A;  4KYZ A;  3IR7 B;  1Q95 G;  2B43 A;  2O66 A;  2HK3 A;  4OQJ A;  2VAS A;  4U67 Q;  4NLG A;  2UXD F;  1CJK A;  2CQD A;  2IVM A;  2R7T A;  2VIC A;  4PQU A;  1YZ7 A;  3GJQ B;  1Y00 A;  5J1E A;  2CG4 A;  2FLN A;  1S9F A;  2LMI A;  4ECS A;  1TKX A;  1U2C A;  3AH6 A;  4B9S A;  1G7C B;  1O5J A;  2Y1R I;  2X1B A;  5I3U B;  1C1B A;  1JLB A;  4HL9 A;  3DLE B;  3PFO A;  4MKA A;  4WFX A;  1T7P A;  4WBF A;  2E1P A;  2VKR A;  2E7W A;  3P5T L;  4ZVG A;  3M32 A;  4X4R A;  4C0H A;  3R8Y A;  4OI0 A;  4UQT A;  5B08 A;  3FGV A;  3KDN A;  3M6W A;  1OSD A;  3DLG A;  3KLE B;  3GWC A;  3M6V A;  4DPU A;  2CVE A;  1UAW A;  1V5V A;  2NCK L;  4LT6 A;  5I3Q A;  1FX2 A;  5KAK A;  3FKB A;  3TZY A;  3J80 Y;  1M1K T;  3KXD A;  5GAD I;  3MR5 A;  3O2I A;  1KRP A;  2YKQ A;  3UR0 A;  1VDH A;  4CLU A;  4USJ C;  1B7F A;  1ZET A;  3O3L A;  2Z30 B;  2RDJ A;  2GML A;  3UNY A;  4K4U A;  3ETO A;  1RQ0 A;  3KJN B;  5DDQ C;  5KG5 A;  1FXL A;  3D5M A;  5IWA F;  4BS2 A;  3T9Z A;  3TA0 A;  4NE9 C;  2B5J B;  1K8A T;  3OTD A;  1J5O B;  1PYO B;  1S9E B;  1RA7 A;  4QOT A;  2RUG A;  1BGX T;  4MIW A;  1Q7Y T;  1REG X;  2VOO A;  3T5H A;  2RUS A;  5J2M A;  2YKM B;  3PYE A;  3RGI A;  2BJ3 A;  1QSY A;  4CLY A;  1JLF B;  1X8D A;  5BYQ A;  2GHV C;  1FKP B;  5FDL B;  2BYC A;  2OKQ A;  3FDS A;  3VV2 B;  1UVN A;  4LF8 F;  4WCE Q;  3OBI A;  5JJB A;  4IOC Q;  3PW7 A;  2ZOF A;  2B9Y A;  1X4E A;  3WDO A;  5AE3 A;  5T14 A;  3LA0 A;  2R2R A;  5U47 A;  4K7Q A;  4LFB F;  1YVF A;  3EGV A;  1RKI A;  2E7V A;  1ZZN A;  3V4I A;  2DNK A;  3RRG A;  4KAI A;  2VFS A;  4PWD A;  1KHV A;  3D1O A;  2QL5 B;  3NWR A;  2YNH B;  1JKH B;  4FYV B;  3OTO J;  3MUT P;  4EGL A;  4JI8 F;  3UCU P;  4DR1 J;  2HQI A;  2F1F A;  2FVC A;  4J9P A;  2W9A A;  3V4I B;  4O3Q A;  4KPY A;  4ZP8 A;  1ZM2 A;  2DNM A;  2CXE A;  5CZX A;  1S6P A;  1GMW D;  1I5O B;  1Y0H A;  3IS9 B;  1Q82 T;  2FZC B;  5ETS A;  1RHU B;  3QNW B;  1JMT A;  4HH0 A;  3PR4 A;  4LIR A;  3IBW A;  4ES3 A;  4K0K J;  4AFF A;  3KK3 A;  3RB0 A;  1HNV A;  1KQF B;  4CM0 A;  5E3A A;  1VBK A;  3ADA C;  4OL8 A;  2GFF A;  2ZD1 B;  4WXO A;  2CPY A;  4Y6I A;  1RK8 A;  2MKC A;  1LK5 A;  2V50 A;  3RBX A;  1RT2 A;  4DL7 A;  5GVQ A;  2ZBI A;  4J7C A;  1AYE A;  3CCS S;  1FNM A;  2OMO A;  1RTJ B;  4RW8 B;  3RTV A;  4N76 A;  2KI2 A;  4DWI A;  1NSA A;  4KIA A;  4ZPD A;  4OHW A;  4TU7 A;  2JDJ A;  2B5J A;  3OPK A;  4O0I A;  2W7P A;  1UPM B;  2ZZT A;  4ED2 A;  2NS1 B;  1HWJ A;  3P8B B;  4OX7 A;  3QRQ A;  1KHW A;  1RCX B;  4DR3 J;  2UVR A;  4RU9 A;  2P6T A;  4ANC A;  3RAQ A;  5HN0 A;  1IM4 A;  2RQK A;  3WIV A;  2HWT A;  1UEK A;  1PIL A;  4DV2 F;  1VC6 A;  1N32 J;  1FJG J;  3BH6 B;  2FIU A;  3HCX A;  3CNQ P;  4ZCL A;  3TJA A;  3GSI A;  4F04 B;  3M8S A;  1F9F A;  1HQU A;  2CQP A;  3EDQ B;  3AXM A;  3BGU A;  3JXO A;  3N4W A;  4CTA A;  1RI7 A;  1WEY A;  2KHD A;  3A3P B;  3PG9 A;  3JQJ A;  5ETL A;  2VOD A;  2MQO A;  2W2M P;  1FER A;  1I94 F;  1HR0 J;  2BRL A;  2X1A A;  4NL5 A;  3K8W A;  3LTO A;  3FFI A;  3ISN D;  4FS2 A;  4ED1 A;  5ETP A;  2QGF B;  2HFZ A;  2K1R A;  4ECU A;  3I5C A;  1TKX B;  3ICL A;  2OHD A;  1X4C A;  1JLE B;  4IH5 A;  3S6E A;  1HNX F;  4M5L A;  2ZDP A;  4RPF A;  4P2X A;  4HKQ A;  3SV4 A;  4X2B A;  4PQU B;  1XK8 A;  3GFH A;  1DAX A;  1F1B B;  3QAT A;  3OUY B;  1ZTT A;  2YNF B;  3NCQ A;  3VAJ A;  1YI2 S;  5ETN A;  4NRU A;  3FFI B;  2Y9H A;  3PYG A;  3SSR A;  4UQG A;  4H4K A;  4NA3 A;  5DET A;  3ZNJ 1;  4RUC A;  2QL7 B;  4P6Q A;  1XNQ J;  2DPJ A;  4JI5 F;  1QLN A;  1WJ9 A;  2WW8 A;  4RW9 B;  1LV5 A;  2CQB A;  4NEZ A;  2I1R A;  1GH8 A;  1DZ5 A;  4AT1 B;  5MLC V;  5GMK a;  3RB3 A;  1VMB A;  2FLP A;  5F0U A;  1GNK A;  1TTH B;  1FX4 A;  2AP6 A;  2H5I B;  2GMJ A;  1KSP A;  3OJS A;  5B7W A;  4ZVE A;  3UVJ A;  4EWT A;  3GR1 A;  3JSM A;  5T41 A;  1HBN A;  3RAM A;  1U48 A;  1R6Y A;  3C15 B;  2DNQ A;  1N52 B;  2XNQ A;  3HSD A;  3HSJ A;  4P73 A;  5HI7 A;  1HNI A;  1HD0 A;  4Y2M A;  4ES1 A;  4J9L A;  2MHE A;  2VDH A;  1O6X A;  2M8D B;  2V2Z A;  5F8N A;  5AXK A;  2KFY A;  2CJ9 A;  2H65 B;  3BBC A;  4QR0 A;  4DSJ A;  2BKN A;  3TQE A;  4C48 A;  3MMJ A;  1WC3 A;  2NXE A;  4K2X A;  2XS7 A;  1U25 A;  1UWB A;  1S5Z A;  1YJU A;  2CZ9 A;  2PEB A;  4OZ5 A;  1XMO F;  4DQP A;  4DFJ A;  3K5M A;  2AJ4 A;  2V5H G;  2I5J A;  1UTA A;  2EW9 A;  2JH3 A;  3C46 A;  2EBG A;  4DJB A;  1TUW A;  1RHR B;  1FVS A;  1NAQ A;  1S79 A;  3HHL B;  1U24 A;  4ZLN A;  3H90 A;  1TKZ A;  2QJ3 A;  1VQ8 S;  1NJY A;  1OMS A;  4JV5 F;  4RNH A;  4WU2 A;  2MY8 A;  3GE9 A;  2H4W B;  1G4C A;  2XNR A;  1NBE B;  2RE1 A;  3N0V A;  4KT0 C;  2GJF A;  4C8M A;  1KQG B;  2R7O A;  5CYQ B;  1M5P C;  2MSS A;  2K06 A;  4PG7 A;  4UOG A;  4DQS A;  2J7W A;  3MMA A;  3BPS P;  2MKI A;  4ES2 A;  1B0V A;  4J90 A;  1HYS A;  4LR7 A;  1VQS A;  3OVA A;  2ASY A;  3A3O B;  3ILI A;  3SI8 A;  3THP A;  4NXN J;  1O51 A;  4USV A;  2D74 B;  2MLZ A;  3BSN A;  2Q6C A;  1P9Q C;  1ZAV A;  3K0J A;  3MEG B;  5M2R A;  4DN9 A;  3EPG A;  1FKP A;  2FHO B;  2V2K A;  1RBL A;  3NGT A;  5LXR A;  4UY8 5;  1HA1 A;  1Y10 A;  4HLB A;  3ZZU A;  2RQ4 A;  4EFA C;  3AD9 C;  1FE4 A;  4C7Q A;  5M2U A;  5H9F K;  2D41 A;  1WF1 A;  2IDE A;  3GG0 A;  3LH2 S;  3PYD A;  4KO0 A;  1J5O A;  4F25 A;  3MF5 A;  2EK6 A;  1D1U A;  3DLL Q;  3FRZ A;  3CD0 A;  1QAY A;  2YKO A;  3MAA A;  2BUN A;  3M8Q A;  3AD7 C;  4QIV A;  3ZC4 A;  2CYY A;  5D0E A;  1AUS L;  1SJ1 A;  2DNR A;  2CWX A;  2YWF A;  5KG3 A;  5A8R B;  1V3R A;  4UUX A;  4ANE A;  3PIO Q;  5J2Q B;  1RT7 A;  2E44 A;  1H0H B;  2DNY A;  1ZTW A;  2AW0 A;  3EGZ A;  2QLX A;  2EKN A;  3GR0 A;  4O3P A;  2UXB F;  3CW2 C;  1KFD A;  4NLW A;  9ATC B;  2JC0 A;  3BDE A;  1IN0 A;  2DYA A;  5A8W A;  3DRY A;  2CG8 A;  5KFN A;  5IWA J;  1MSW D;  4HAC A;  2BKO A;  1DY3 A;  1G2E A;  4NWB A;  2IAJ B;  5DG7 A;  4ELT A;  4ZPV R;  3D6H B;  2DKO B;  2QL9 B;  1A7G E;  1S1U B;  2I0X A;  2IRY A;  3NS6 A;  4O3N A;  4AXJ A;  1LEO A;  4LRE A;  3C14 A;  3MDF A;  1VQ4 S;  2CQ0 A;  4JI5 J;  2BM1 A;  4C0B A;  4H4M A;  3W9J A;  2CQ1 A;  3GIK A;  4PAA A;  3H59 A;  4LF8 J;  1B0P A;  3QO9 A;  2BE9 B;  1NUE A;  2YKP A;  3WC2 A;  1DTQ A;  2QLJ B;  3M6U A;  2RML A;  2AWZ A;  4OYA A;  1Y3K A;  4CRJ A;  1UVK A;  1X5T A;  2DR6 A;  1HWL A;  2QMU B;  3QT7 A;  4TLQ A;  3WX8 A;  4CIO A;  2H48 B;  2HFV A;  1E6Y A;  3D1H A;  3O5T B;  4TU8 A;  2VF3 A;  1KVI A;  1RGV A;  2CPX A;  3FRY A;  2VHG A;  3AD8 C;  1X5P A;  1E6Y B;  4PPZ A;  4HT7 A;  4RBU A;  1YK9 A;  3VAH A;  1JK9 B;  3K8V A;  4ZLL A;  4XAK A;  1SQE A;  1MMN A;  2DY9 A;  3FQK A;  3FEZ A;  4HI1 A;  2OEK A;  4WTY A;  4NCG B;  5IXU A;  1DQ9 A;  3J81 Y;  1SBR A;  3B54 A;  1JXL A;  3MCM A;  1VRU B;  4HEA 9;  4TKT A;  4A8Q A;  2WBM A;  4E0D A;  3W5Z A;  2YWE A;  5F41 A;  2P9C A;  5LT5 A;  4OZL A;  1IR1 A;  2GVZ B;  3O1L A;  5LJ5 Y;  2E5L F;  2IHR 1;  4W90 B;  5CYJ A;  1HMV B;  1KQK A;  4ECX A;  4CLT A;  4ZVU B;  4WKR A;  3JAM U;  1VGY A;  2QTW A;  3TX0 A;  1Q8I A;  1HPZ B;  2DBB A;  2P9E A;  5A8W B;  5KFK A;  2IA0 A;  3ZXW A;  4V19 J;  1D09 B;  3HFZ B;  3LP1 B;  5B09 A;  5B0A A;  1WF0 A;  4U8Y A;  4IQM A;  3W2V A;  4DN0 A;  4NYZ A;  4OYW A;  1DAR A;  1RT7 B;  2BQ3 A;  2VG7 A;  2ZNY A;  2HSE B;  1PC5 A;  1GXU A;  3M05 A;  4FYX B;  4CLL A;  2R2U A;  4NLO A;  1NEE A;  3GIR A;  1Z2Z A;  3MHY A;  4IFY B;  1WDT A;  2KL8 A;  1PJ6 A;  1CJV B;  1QAX A;  2MY7 A;  3HHE A;  3C66 A;  1RA6 A;  4D3H A;  3MAA B;  4ZOS A;  4A48 A;  2C3M A;  2CJQ A;  5C24 B;  1JLG A;  1YBU A;  3I32 A;  1YBT A;  3SSQ A;  3RRH A;  2F8H A;  3FBC A;  2RS2 A;  2DNH A;  1FRM A;  4WPA A;  2BR0 A;  4YB7 A;  4CLW A;  3D0G E;  1SUQ A;  4YB5 A;  4JOU A;  3HSZ A;  3BR8 A;  1VRQ C;  2EFP A;  3NY0 A;  3LAN A;  3NL0 A;  2AIR B;  3KLG B;  4JI0 J;  4Y2C A;  1N54 B;  5DZ6 A;  3JYT B;  4FF3 A;  2JEI A;  4C9D A;  4URS A;  4DV1 J;  1OWX A;  3AOD A;  2X3D A;  5I3P A;  3E51 A;  5HL7 Q;  2A0F B;  5D4N A;  2ACM A;  3V6J A;  1DRZ A;  3BN7 A;  1WI6 A;  2FHJ D;  4DX7 A;  4HR2 A;  4EEY A;  2ZZM A;  3M7V A;  4M5G A;  2BOP A;  4RBV A;  1SPB P;  2CDR B;  2CQ4 A;  1JLQ B;  3C19 A;  3DRX A;  3IP0 A;  5KFD A;  2ZH2 A;  4RL1 A;  1M5O C;  1M5S A;  4JV2 A;  3HPO A;  4V19 X;  1CJU A;  2FTR A;  1EET A;  1SI9 A;  1YJV A;  2G2Y A;  3BJY A;  3JQK A;  5KFJ A;  5GAH I;  4DV3 F;  1AZS B;  4Q2M A;  1BQM B;  3W5Y A;  2VBW A;  5KOW A;  2L9N A;  2PC6 A;  4CO2 A;  2Y8W A;  4YOE A;  2X3G A;  2IYI A;  3P45 B;  4ED8 A;  4MKB A;  1C0T B;  3CF5 Q;  3PX0 A;  2GV1 A;  2F63 A;  5HMY A;  4Y0F A;  4NLS A;  2LDY A;  1Q5Y A;  3UI3 A;  3GIL A;  4B3T F;  4BHQ A;  2ZH6 A;  4NLT A;  4A8W A;  4QR1 A;  2YTC A;  5AXL A;  4ZS6 A;  3MR7 A;  1M90 T;  3AQO A;  5ETR A;  4ZVR B;  5L1J A;  4DS5 A;  1GK8 A;  1QUP A;  1D3W A;  1RAH B;  1WOP A;  4HTI A;  1HNI B;  4UT4 A;  4RZR A;  3G96 A;  3V6D B;  5HJY A;  1XIQ A;  1PJ7 A;  1QAI A;  2NXC A;  2DEJ A;  3NWG A;  4RLE A;  3T1A A;  1HBN B;  1LWC A;  4JUZ A;  4K4T A;  1UFL A;  2HKE A;  1MU2 B;  3WHI A;  2DHG A;  2MPU A;  1RWM B;  3ZZR A;  4RUH A;  5CD4 A;  4DR7 F;  2DIV A;  5A2Q Y;  2ASL A;  3AA9 A;  4KGZ B;  4DG1 A;  3BBB A;  1N5S A;  3QLH B;  3EUN A;  1IKV A;  3F0N A;  4H4M B;  4CLZ A;  4KJI A;  4ETZ A;  4G1I A;  4FF1 A;  4B9U A;  2DNZ A;  3GG1 A;  4V1A k;  3NS7 B;  1RHJ B;  2EG2 A;  4GO5 X;  4HHH A;  4OX9 F;  2VPY B;  4YFU A;  3VGT A;  4B02 A;  1RAO A;  1RHK B;  2FPH X;  3M8R A;  3W60 A;  2NYH A;  1DLO A;  4FDF A;  5L8R C;  3PO4 A;  2LYV A;  4DFM A;  4CO4 A;  2NLW A;  4MYT A;  4WWS A;  2HHH F;  3I96 A;  4GVL A;  1HWU A;  2WHO A;  4OZ3 A;  4CWB A;  2R8G A;  2K1R B;  5CCM A;  2HZA A;  1HBU B;  1T0T V;  3GFZ A;  4N8O A;  4K50 A;  3UFC X;  5E2Q A;  3JAM Y;  2YQ1 A;  2KXF A;  5A0Y B;  5HP1 A;  2BOA A;  4NCB A;  2HHT A;  4KO0 B;  4P75 A;  3CJ0 A;  1RLC L;  3OHA A;  3Q23 A;  3R1L A;  3B8H A;  2OAU A;  3IO1 A;  2AGQ A;  4MT1 A;  4F02 A;  1C4C A;  3MEC A;  4NLX A;  1HQU B;  1T94 A;  4CTA B;  4U7C A;  4KHP F;  3AFG A;  3MR3 A;  1GMW A;  4PXB A;  3F41 A;  2B3T B;  2ZHO A;  2DEI A;  3UD5 A;  1S1X B;  2W9C A;  1S1W A;  3T3F A;  2JEF A;  3MEG A;  5K8M A;  4G6V B;  1U1M A;  3V6H A;  3UCZ P;  3RG6 A;  4DPX A;  5D3G A;  4DBQ A;  1RWW B;  4X64 J;  2Z4P A;  2MZ1 A;  1HYS B;  1HQE B;  3MMA B;  4DL2 A;  4DPT A;  4DL5 A;  2QV6 A;  1Q8B A;  2OP5 A;  2V94 A;  1PBA A;  2XGQ A;  2VBZ A;  3CCL S;  5HLF A;  5KFC A;  2GJ2 A;  3ILO A;  1S6Q A;  5KOX A;  1N0U A;  4LR8 A;  5DM7 Q;  4LVN P;  1FJC A;  4WP9 A;  2YY3 A;  1R0A B;  5FJ4 A;  4QWA A;  2XC9 A;  4CYU B;  4B9T A;  3OLA A;  1HNV B;  2GZO A;  1LOU A;  1P6T A;  5A2Q U;  2DHA A;  3CDU A;  2H4Y B;  1NK7 A;  3W2W A;  2ZFH A;  4CO1 A;  3GB0 A;  1FRI A;  1WC5 A;  2L48 A;  4IYQ A;  3OTC A;  2MKK A;  2IM1 A;  1RTZ A;  2B4P A;  2VD3 A;  5F8I A;  1B7Y B;  3QGH A;  1WHY A;  4ZVH A;  1KEK A;  4Q44 A;  1QTN B;  1BY9 A;  4GKJ J;  2HGL A;  3HHD A;  3MTK A;  2W8L A;  1NZ8 A;  4ER8 A;  4YDX A;  2UUB J;  3MAH A;  1L3T A;  4NOH A;  3NG8 A;  4B3M F;  4ZVO B;  4A8S A;  4NXM F;  3SDE A;  3VAM A;  1SJ3 P;  2DCU B;  3CIM A;  1X0P A;  2QA1 A;  1NDP A;  4XIU A;  3R5B A;  3TAN A;  1YHQ S;  5HVH A;  2RHS B;  1X9M A;  4PXE A;  3VZI A;  4CLP A;  1UET A;  2HK2 A;  3BH7 B;  3IRX A;  2MB0 B;  2CJB A;  2LQJ A;  2F7V A;  4A8M P;  1SXL A;  3M2R B;  3N28 A;  3R1H A;  4IH7 A;  4DV2 J;  4YEA A;  1N32 F;  3MM7 A;  3FK4 A;  3GYG A;  2JLG A;  1B3T A;  4NYO A;  1MNE A;  4IFV A;  5GMD A;  1GX5 A;  1KQS R;  2JLF A;  4G1P A;  4J9U E;  3W65 A;  1W26 A;  3W8G A;  1QTM A;  2RRN A;  2J6U A;  2PA3 A;  4J9N A;  4NLY A;  1GEH A;  1YTY A;  2UV8 A;  4P10 A;  5HP1 B;  3FSI A;  3ZZZ A;  3SFG A;  5AE1 A;  1YZ6 A;  1S76 D;  3M2V A;  5KTQ A;  2YWH A;  1Q7L B;  3E3X A;  1VK8 A;  3K7R A;  4F4A A;  1SJ4 P;  1IVZ A;  2OEM A;  4DV7 F;  3BM7 A;  1RWO B;  5A8K A;  4A8K A;  1WKJ A;  1MLA A;  2XI3 A;  4I2Q B;  2MLY A;  4C3M A;  4C3K A;  4YDD B;  5KG2 A;  3X1L B;  1TUV A;  4QIW D;  5HMW A;  1U6Z A;  3NCR A;  5KG1 A;  4BCA A;  1NPR A;  2LEA A;  3KUH A;  1C0U A;  2DTJ A;  4PG6 A;  4JI2 F;  3MAQ A;  4DSF A;  2V8D A;  2XS5 A;  3MPD A;  3TR5 A;  4ELU A;  1CSJ A;  3KUE A;  2HFU A;  4J9V A;  2XO6 A;  1OY6 A;  4W98 A;  2HYI B;  3DLE A;  1SL0 A;  3R9L A;  3D7S B;  2MHN A;  4ID5 A;  3V5R A;  3TJ8 A;  1OY8 A;  1VQP S;  4YR2 A;  3RZA A;  2JSX A;  3BQ1 A;  1N88 A;  2RKI B;  5EWE A;  2R7R A;  5DS7 A;  4M95 A;  1KVJ A;  3PAC A;  4ECV A;  2YWK A;  2Y0B B;  4ECY A;  2XQC A;  2HVH A;  4CDI A;  3VCD A;  3M2V B;  3DLB A;  2J0X A;  1UZH A;  1HR0 F;  3HHL D;  2BW2 A;  1JJC B;  3EGW B;  3VHQ A;  5LXY A;  1I3O B;  4H54 A;  4Y00 A;  1CS4 A;  4ED0 A;  4GC6 A;  4KGK A;  1IBL J;  2BBE A;  4F3O A;  1FD2 A;  1LQ9 A;  1AFJ A;  2RQC A;  4FXV A;  5FD1 A;  4UOH A;  3SCI E;  3HK2 A;  2ERR A;  5KFO A;  3L95 X;  2DNP A;  3DXS X;  2WVE A;  2UU9 F;  3N79 A;  2D3O 1;  3W3S A;  2DGT A;  2N4C A;  5F8M A;  2R7V A;  2J8S A;  2R8H A;  2VG5 B;  3GON A;  2ZD1 A;  3I9Z A;  4KHM A;  2O3D A;  5KFI A;  4X62 J;  2NUU G;  1OPI A;  3G8S A;  5IQQ A;  1NDC A;  1SB6 A;  3CDA A;  1GAO A;  1R8P A;  1JJ2 R;  1VQ5 S;  3D6M B;  3P4U B;  1H2T Z;  1X5S A;  1YIJ S;  2DPI A;  3IM8 A;  4DSL A;  4QCL A;  2C3P A;  3PX4 A;  1U0S A;  1DTT A;  3M9N B;  3GSD A;  2ZJP Q;  3PY8 A;  2MQM A;  4UST A;  1CJU B;  5CYM A;  5IT0 A;  3EXC X;  1U8S A;  3QJL A;  1NME B;  5BR8 F;  1TL3 A;  4LRA A;  4Z7Y A;  3UE2 A;  4N56 A;  1M1H A;  1PC4 A;  1S6O A;  4HHJ A;  4C3L A;  1RE1 B;  3IG1 A;  3PW2 A;  2KRB A;  3H2V E;  2MMY A;  4FVC A;  2KG1 A;  4U8V A;  1X4D A;  5JVH Q;  2J5A A;  5D6G A;  5K14 A;  1TK5 A;  1S48 A;  4KB7 A;  1RAD B;  3ZZO A;  3HFV A;  3NS5 A;  3PM9 A;  3MM9 A;  4LFA J;  2V8H A;  1S72 S;  2QO3 A;  3GP9 A;  4L74 A;  2XMV A;  3FSX A;  1LWE A;  1B4S A;  3ZTS A;  2MZR A;  5KT2 A;  4ZVQ B;  3GJR B;  4U7U D;  1IWG A;  1K9M T;  2ZDO A;  1S6Q B;  2L08 A;  2H54 B;  4UZC A;  5HK4 A;  3OL7 A;  5HLF B;  4C8N A;  3VQS A;  4L76 A;  5T7L A;  4B3R F;  9RUB A;  1RDR A;  4CQ1 A;  2BAB A;  1HQE A;  1U1Q A;  1IBM J;  2R3V A;  1Y5L B;  2ZC3 A;  4C98 A;  3PW4 A;  4JI4 F;  5KFT A;  1IQZ A;  3CD6 S;  2J8A A;  4ATN A;  4DUY J;  4C4W A;  5F3Z A;  2VG7 B;  5DGB A;  1RBO B;  1VLY A;  3EWG A;  4J91 A;  1KS2 A;  1VR6 A;  2F40 A;  5E5N A;  3QAE A;  3W2V B;  1X4G A;  2FC8 A;  4TY8 B;  1S1X A;  2IBO A;  3PEH A;  3J7Y U;  2W9C B;  4KHR A;  3FVY A;  2GX8 A;  1HHT P;  1D8Z A;  2DNG A;  3K57 A;  2QMX A;  3R3T A;  4OZ0 A;  3DOM B;  5IT4 A;  3CB4 A;  2XB2 D;  2OML A;  3M32 B;  3I0R B;  2C2O B;  2IRX A;  1NXI A;  5CZV A;  2IM3 A;  4FBU A;  5I3U A;  2B51 A;  2XLI A;  2D9P A;  5L46 A;  5G0R A;  5DM6 Q;  3EVM A;  1K47 A;  5GAE I;  4DR2 F;  2J0S D;  4X64 F;  5F8H A;  1N34 J;  4WP3 A;  4E98 A;  2LQ8 A;  2IC3 B;  4B08 A;  1FWK A;  3OT9 A;  3DMJ B;  4ICL A;  4R0E A;  4RW4 A;  4W92 B;  4ID8 A;  4WKY A;  4X4O A;  1H73 A;  3DM2 A;  5HO4 A;  4MK9 A;  4JBC A;  1IM6 A;  1O8B A;  3I0S A;  4Y2A A;  1SL1 A;  3MM8 A;  2B9E A;  1REV B;  3HKZ D;  3QLH A;  2UP1 A;  3TUJ C;  3OFF A;  2F8E X;  3HF5 A;  4I0W A;  4Q7A A;  3N5B A;  3QO9 B;  2BE2 A;  4X62 F;  5ETK A;  3CWJ A;  2F65 A;  1G6B A;  3BGO P;  4LF4 F;  1YDL A;  1R89 A;  3QAU A;  1F5B A;  2C28 A;  2C2Z B;  1K44 A;  5CQG A;  3MM6 A;  3TA2 A;  3EVO A;  4YP3 A;  3PIP Q;  1FTR A;  3GJT B;  4TVA B;  2Q43 A;  1UFK A;  1RAE B;  2NPI A;  1J5E F;  1NPP A;  2VPX B;  4EMD A;  3RW6 A;  2R2S A;  2R8J A;  4NCA A;  2R8I A;  1YJN S;  4B3S J;  4I2P A;  4HVZ A;  1WC4 A;  2AKW B;  3A8I A;  4LSZ B;  1EQM A;  2HND A;  2WK4 A;  5F8L A;  2W24 A;  3ZZT A;  2IJN A;  3DFE A;  2Y1L B;  4HHU A;  4WU3 A;  1TQL A;  4XDD A;  4QIE A;  1SV5 A;  4ZLJ A;  4UOF A;  1CVJ A;  4ITS A;  1BQM A;  1PBU A;  3PW5 A;  2ILY A;  1RWN B;  1MW7 A;  1RT6 B;  1LWF A;  2V8V A;  2E9R X;  3L3C A;  2FZK B;  2PEH A;  3BKT A;  4KFB B;  1T8E A;  1HL6 A;  3JSY A;  4ECW A;  2A6O A;  3NLC A;  2VBX A;  1VLO A;  4WZQ A;  1RBA A;  2BVZ A;  4RNM A;  1A6L A;  2H51 B;  4YHH F;  1UEV A;  2V4J B;  2CVI A;  4MJK A;  1PCA A;  1VCT A;  4DV6 F;  2AEM A;  3QZ7 A;  2VC0 A;  1B0T A;  3KYL A;  1X4B A;  1X9W A;  3DCA A;  1TEL A;  2FD2 A;  4LMZ A;  3W66 A;  1N5Q A;  2Z56 B;  1WSR A;  3N6M A;  1YJ7 A;  3OR1 B;  4EK2 A;  2QLB B;  8AT1 B;  4JI4 J;  2VV5 A;  4G65 A;  4TY9 A;  4OYZ A;  1FDN A;  3KK1 A;  4ECQ A;  3HX9 A;  4M1K A;  3OXL A;  1TV6 B;  4IR9 A;  3VTI A;  2AYE A;  4LVO P;  4OFZ A;  3T9N A;  1JIH A;  1EP4 A;  3DN9 A;  3OR2 B;  4J9M A;  3VAG A;  1Q86 T;  4DX6 A;  2HZV A;  4F0K A;  2W4C A;  3EZU A;  2E1R A;  2ZC4 A;  7AT1 B;  2N3L A;  3U1L A;  2D3O R;  4DFK A;  5KFQ A;  2CAD A;  2I5J B;  3R6G B;  3JTN A;  4QYZ J;  1GX6 A;  2EKY A;  2E29 A;  1YIT S;  1ZYQ A;  1ZM4 A;  4K4Y A;  1H6K X;  2NZC A;  2CNL B;  3CCZ A;  2OUG A;  2ZBP A;  1NRK A;  3DC2 A;  2ABY A;  4TU9 A;  2PFF B;  1VRT B;  1UWB B;  1TL5 A;  3QRR A;  3CIZ A;  3PJ9 A;  3W64 A;  3FBE A;  4I2P B;  2EXU A;  2QFI A;  4GRS A;  5KFL A;  4QWE A;  5IS2 A;  2FVP A;  2DIS A;  3GZ7 A;  3HVW A;  2ASD A;  3OTE A;  5GME A;  5KFP A;  1WHX A;  4N77 A;  5J1P A;  1HMV A;  1TU0 B;  4QWC A;  4X4V A;  1GFW B;  5HMZ A;  3C15 A;  1TAQ A;  3GYN A;  4M8L A;  3QT5 A;  3OTO F;  3BO4 A;  5DGA A;  1UVI A;  3UVJ B;  4LF7 F;  3BO2 A;  1Q0N A;  2LKZ A;  1M1G A;  4OI3 A;  3G8T A;  5F0W A;  3ENW A;  3IN5 A;  2JEG A;  2J7K A;  3AXK A;  4PG5 A;  2WAQ D;  3IR5 B;  3LPY A;  4J37 A;  3PRV A;  4QYR A;  3PNI A;  5C2C A;  3MR6 A;  3T5L A;  3DM2 B;  2H3E B;  3PKY A;  3SXL A;  2ROG A;  4CO5 A;  5C42 B;  1FA0 A;  4OX9 J;  2FGC A;  4ICL B;  2HHP A;  2GA7 A;  5IV3 A;  1X4A A;  4RNN A;  2IMW P;  2OD6 A;  3R5J B;  5F9N A;  3H8Y A;  2WON B;  3CDE A;  5A6W A;  1CQN A;  4URG A;  5ETO A;  2GC8 A;  1S12 A;  3OXG A;  3SIP B;  2LDI A;  4NLD A;  3CED A;  5HAT A;  2LP4 A;  2W2Q P;  3E8O A;  4LFB J;  1NND A;  1OQ3 A;  4HYK A;  1VBZ A;  1IBK J;  1RXO B;  3DYA A;  3KJV B;  4O3S A;  1RT5 B;  3RJM B;  1SQF A;  1RU1 A;  1HLW A;  2DGW A;  1R8H A;  1APS A;  2G1D A;  1P9Y A;  1IKX B;  4NLR A;  4C8L A;  2MKY A;  1F9H A;  4ZN3 A;  4LF2 A;  1S1U A;  1T9Y A;  2Z0G A;  4LBP A;  4TLR A;  2ALZ A;  1T9U A;  1Q8L A;  3TOQ A;  3TP2 A;  2UVW A;  4B3R J;  3KLI A;  1KDN A;  3CME S;  4HAC B;  4NLP A;  1XR6 A;  1PKU A;  3CT9 A;  3U1N A;  1MMD A;  3C16 B;  2HIQ A;  2EEY A;  1LFW A;  2KJV A;  1MWQ A;  1VQN S;  5L1K A;  2CPH A;  2Q1L A;  2XSJ A;  3Q8R B;  3KTQ A;  3NOG A;  2J0Q D;  4OZN A;  3RW7 A;  2RS8 A;  1YBA A;  5LOQ A;  2NQP A;  1KOO A;  2CPI A;  4OZ1 A;  3VAL A;  2JLE A;  3KUG A;  4EZ6 A;  3DRS A;  4PAB A;  1FKA F;  1TKD A;  3G71 S;  2VQE F;  2APO A;  2ZBQ A;  4RBT A;  2YPY A;  3CJK A;  2YKN B;  3H5Y A;  4Q8F A;  1RJJ A;  4LRB A;  1MWY A;  2FY1 A;  3R27 A;  4RW8 A;  2BX6 A;  3OTB A;  4PYD A;  2A6M A;  3BSO A;  5KFU A;  1JLC A;  2V6A A;  2K2P A;  3F73 A;  4KH0 B;  4USH A;  1ZS6 A;  3LAL A;  3FMB A;  3ISZ A;  2A2D A;  1JXE A;  3D54 A;  3H4B A;  1I94 J;  1TL1 B;  1NJZ A;  1VHF A;  5H9E K;  4ZP6 A;  1UWA A;  2ZVI A;  3O44 A;  1RKJ A;  2GAH C;  5F3T A;  4LF9 J;  2KZM A;  1UZD A;  2HS0 A;  3KK2 A;  2OLW A;  1RUS A;  2E1M C;  3ITH B;  4F36 A;  3QWU A;  3R6L B;  4LBH A;  3C2P A;  4OJ1 A;  2UUB F;  2LA4 A;  2V9W A;  1VJQ A;  1RHQ B;  3T6J A;  3GLJ A;  2ZH9 A;  3MMB A;  5KT7 A;  1OY9 A;  1NB7 A;  3OW2 R;  1JJH A;  1S4F A;  1YRT A;  3T1H F;  1K1Q A;  2DB1 A;  3G4S S;  1P8G A;  4M94 A;  4EYH B;  3I87 A;  4AD6 A;  4E2F B;  3OHB A;  1NO8 A;  1KLM A;  3IAS 9;  1ACM B;  1U6B A;  3GCX P;  2RAQ A;  2XZW A;  4O44 A;  3H40 A;  4JI7 J;  3QRP A;  5DO2 A;  3KHL A;  2KM8 B;  3NAH A;  4MYU A;  2BEF A;  2BA9 A;  3B4M A;  3PJW A;  4IOB A;  1G1X A;  1RTI A;  2WCX A;  1Q81 T;  3E01 B;  1JLF A;  3GIM A;  3PR5 B;  1OSC A;  5KFM A;  1J5E J;  3K5P A;  5J2M B;  4LF5 J;  5CHC B;  1CEZ A;  2V2V A;  3VQT A;  2W2N P;  1GTH A;  6AT1 B;  1S9E A;  3OJU A;  2RU3 A;  1R6V A;  2LEP A;  4QYZ K;  1NH7 A;  2AX1 A;  5AXN A;  2UZA A;  2DJW A;  3BV8 A;  4H4K C;  2OEJ A;  3AT1 B;  2FZG B;  2UVU A;  1S7H A;  2B9W A;  3DOK A;  5EWG A;  2CPJ A;  5KT3 A;  1KTV A;  2V2Q A;  1EJ7 L;  3JSM B;  4WII A;  2BQU A;  2HPU A;  2R7X A;  1DJ0 A;  3T41 A;  1HBO B;  1VC5 A;  3L7U A;  2F4F A;  4H4O B;  4URQ U;  3KHG A;  2HBZ B;  2CQC A;  4PR6 A;  3PTW A;  2V34 A;  4TXS A;  1S0O A;  4DF4 A;  3N01 A;  1IBK F;  3BYR A;  2LVW A;  3KLE A;  4PXC A;  3M6X A;  2F8M A;  1E6V B;  2MEW A;  1TAU A;  4C0O C;  2A18 A;  3D4J A;  3LF0 A;  3CTR A;  3D3B J;  1RT3 B;  4F3Q A;  1F3F A;  1C2P A;  1EAR A;  4JYA F;  1H3D A;  1WHW A;  1RAG B;  1ZOT A;  1QSS A;  1JXV A;  2AMC B;  2E7X A;  2FJD B;  2DNL A;  4I2Q A;  2C2N A;  3A4T A;  3H98 A;  5CAA A;  5K8N A;  3V2U C;  4YY3 J;  3OUY A;  2W1B A;  5F8G A;  2DHH A;  3TA1 A;  1NSQ A;  1GT8 A;  1PYS B;  2ALY B;  3LP0 A;  4BWJ A;  4DUT A;  1RTH A;  1JLE A;  1FKO A;  4Z37 A;  3KLF B;  2VQF J;  3TRG A;  5IV4 A;  1RWX B;  3K58 A;  1TVR A;  1R0C B;  2H9Z A;  3J81 U;  4O4R A;  2ZWO A;  2R4F A;  3A8K A;  4RW7 A;  2M4M A;  4ZIV A;  4DSK A;  3N6L A;  1UJ5 A;  1BQN A;  4OZJ A;  3NGD A;  1U0H B;  1UJ4 A;  3S8S A;  3CE8 A;  1PSD A;  1U7L A;  2QSW A;  2HFS A;  2YNI A;  1LXN A;  3B78 A;  3BB5 A;  3D28 A;  3MM7 B;  4FPR A;  4DQQ A;  5GAG U;  3QSY B;  5DG8 A;  2B7B B;  3OSP A;  2J6S A;  4WXW A;  4DCO B;  1FO1 A;  3M2R A;  3OD2 A;  1NDL A;  2IVY A;  4N8N A;  4LRF A;  4X4N A;  1BLU A;  4DMZ A;  3HJF A;  2OPQ B;  4A47 A;  5E33 A;  2DVI A;  4OYM A;  2OPS A;  4I67 A;  1F5C A;  4NAS A;  3PX6 A;  1Q78 A;  1U47 A;  1SKU B;  3U27 A;  4LSN A;  1RB0 A;  5J2P B;  5FLX U;  4AQY F;  3A8J A;  2WB4 A;  3LUY A;  3HHL C;  3R2D J;  4P2M A;  1RTD B;  1IR2 A;  1JLC B;  1FEH A;  4MKV A;  1RTJ A;  4XO0 A;  3IBF B;  3K2Y A;  2XEX A;  3Q8V A;  4P52 A;  2W2O P;  3OVS A;  2XYH B;  1FES A;  2ZH4 A;  2YXL A;  3A13 A;  1P1T A;  4CNY A;  4FYY B;  2OPR B;  4BC9 A;  3QZ8 A;  1JLA A;  2RDD A;  4FPI A;  3MUR P;  2C2M B;  2J9C A;  3Q8Y A;  4M5N A;  5IOL A;  1Z2L A;  4ZCI A;  1VQY A;  1N5T A;  4DV4 F;  3OL9 A;  1XMB A;  3I82 A;  3IS9 A;  1FWL A;  1FNO A;  2FB0 A;  4LFA F;  5ETQ A;  2W4P A;  2CQ3 A;  2OD4 A;  1YJW S;  2GAG C;  4EUV A;  5IT9 U;  2MZT A;  3BGR A;  2BQR A;  1IJE B;  4O3O A;  4BWM A;  2UUW A;  2KN4 A;  2GMH A;  5DQG A;  4Q0B A;  2HGM A;  4LFC F;  1TL4 A;  1MWZ A;  3SEO A;  1VBY A;  3OL6 A;  4DL4 A;  4JI3 F;  5EX0 A;  3VWS A;  1LW0 B;  2QSF A;  3I6P A;  2VH7 A;  3LP2 B;  3MM5 A;  1UFW A;  1V3S A;  2HZC A;  4Y3C A;  1T9T A;  3ZZY A;  5ADZ A;  5I42 B;  3OQ2 A;  4O23 A;  4CT9 A;  1TK8 A;  5F8J A;  4OV6 A;  1WEL A;  4KH1 B;  3KLH A;  3HVA A;  1XR5 A;  3H2U B;  2P6S A;  1PO6 A;  3ISN C;  2V63 A;  2B6A B;  2P5V A;  4WK3 A;  3S1T A;  5BR8 J;  4WYW A;  4DLE A;  1ICE B;  1FI4 A;  4ELV A;  1R8A A;  4ILR A;  3P6Y C;  2Q79 A;  4ILL A;  4RKU C;  1NJX A;  1CQM A;  1NKE A;  1D9D A;  3Q24 A;  1RAF B;  2YKM A;  4Q2L A;  2CJX B;  3MEC B;  3VVT A;  3KG1 A;  4C8Y A;  2HHX A;  3WC0 A;  1PIE A;  2HEK A;  2YNG A;  1L5U A;  3M30 A;  1SH0 A;  3P5B P;  2UXC F;  3FQL A;  2AF6 A;  2FJB B;  3ZTO A;  3T5J A;  3DGV A;  3M4X A;  2HHS A;  1S9G B;  3HHK A;  3MMC A;  1ITP A;  1WOR A;  3T5K A;  3FEY B;  2CKW A;  2LXU A;  3WBZ A;  4C11 A;  1ZAW A;  1KN6 A;  1S49 A;  2EG1 A;  1Z1Z A;  1VQ9 S;  3FBB A;  5LM7 E;  4CH0 S;  1F2H A;  1EAY C;  2ILZ A;  1NB2 A;  3OLB A;  4AE5 A;  5IM0 A;  1SJR A;  2V68 A;  2NXJ A;  2PI5 A;  2VQF F;  2BJ9 A;  3MPY A;  1DLO B;  3J7Z 5;  3DRR B;  2KFN A;  4F4W A;  1T02 A;  1SC3 B;  1XER A;  2QA4 S;  1ZAX A;  4BLG A;  4LR9 A;  4OHV A;  2C2D A;  3A12 A;  4ZJL A;  2Z2Z A;  3RR8 A;  4KQZ A;  2MZS A;  4CT8 A;  5H1S V;  2V4R A;  3T6B A;  1JLB B;  4FKX A;  4PCQ A;  4U9R A;  3QBC A;  4ZVS B;  5D8H B;  4AND A;  3KMQ A;  3T1Y F;  2HAI A;  2QN6 B;  1VIS A;  4J9R A;  3TWZ A;  2LU2 A;  3X3U A;  1FXD A;  1XN9 A;  4L3N A;  1RAI B;  4X4S A;  3H5X A;  3POT A;  1J27 A;  1CG2 A;  2R9L A;  2FJV A;  3B82 A;  2I9S A;  2GQ2 A;  2Z8Q A;  3HT3 A;  2LXF A;  2Q6B A;  4KC5 A;  3V81 B;  2VPW B;  5L39 A;  3V6D A;  3TNV A;  1QJH A;  4F4Y A;  2DH7 A;  4OV1 A;  3EYZ A;  1AT1 B;  2AT1 B;  3PV8 A;  1GXL A;  3ILJ A;  4FF2 A;  1I51 B;  4G1Q A;  4MH8 A;  4P72 A;  2B0G A;  2G0C A;  3LAM A;  4DCJ B;  4B3O A;  4IG3 B;  3BEG B;  4B3S F;  2HUR A;  2NSB A;  3BN4 A;  2CJY B;  4ZP9 A;  3K89 A;  4KE5 A;  1YWX A;  4RUA A;  4OHX A;  2XMK A;  2ATL A;  2WSF C;  3LW5 C;  3R5D A;  3NXZ A;  4S0M A;  3O8W A;  5E3P A;  3ZFV A;  3KLV A;  3G6E S;  3C6T A;  4WP8 A;  4IUF A;  2Y0S D;  3D6F B;  1H2U X;  2M3D A;  4DV4 J;  2DGO A;  3G87 A;  3IRW P;  4ED6 A;  2P8I A;  5KG7 A;  2HHW A;  1QY7 A;  2BMB A;  1EX8 A;  3AJ2 A;  2BE7 D;  4M63 A;  5CA5 A;  2KO1 A;  1OQ6 A;  4OMF G;  1W25 A;  3W8P A;  4K0K F;  3R97 A;  4DR4 J;  4U96 A;  3Q8P B;  1RT6 A;  3Q8Q B;  3IA0 A;  4ZPC A;  2RD5 C;  4WJB A;  2RH3 A;  1F6T A;  2G2O A;  2HNZ A;  3QID A;  4KV8 B;  4O4G A;  4AL6 A;  2KZZ A;  3PDN A;  3AY0 A;  2RRB A;  4Y65 A;  3G6V A;  4DUZ J;  4MAK A;  3N5F A;  4ZJO A;  3K17 A;  3DOL B;  1RWP B;  4DR1 F;  1X0F A;  3VVU A;  2MZQ A;  3NNA A;  8RUC A;  1VJW A;  2LEB A;  1UVL A;  2ZUA A;  3W62 A;  5B0D A;  4LJM A;  1SUQ B;  2Q66 A;  3KOA A;  2B4O A;  2F4V J;  3BDP A;  2WW4 A;  1N0V C;  4USM A;  4DR3 F;  1IBC B;  1LFP A;  4NLQ A;  1D0E A;  3HHN B;  5C24 A;  4L73 A;  3ILL A;  3K5L A;  2AJ2 A;  3KDO A;  1CJV A;  2AJQ A;  1X31 C;  2LU1 A;  1WEX A;  2J7U A;  4ZN1 A;  2D9O A;  5KFH A;  4YR3 A;  2EPI A;  4AL7 A;  3NMA A;  1RCO B;  2MDA A;  2G0I A;  1O0P A;  1IWA A;  2P2C B;  2QMW A;  4IG0 A;  4LSL A;  2B7C B;  4NA2 A;  4HTJ A;  4YN3 B;  1Q16 B;  1REV A;  1ZM9 A;  3FCV A;  3HDS A;  3QGG A;  1IXK A;  3TYT A;  2FVR A;  3L09 A;  4EI2 A;  1T05 A;  4FYW B;  3PJX A;  2CJA A;  2GIF A;  4QJV A;  1SQG A;  1TK0 A;  4N7T A;  2ZE2 A;  4F0M A;  4RW4 B;  2DNO A;  3ET6 B;  3AOB A;  1VI7 A;  2CWK A;  2MJU A;  4ZVT B;  5HMX A;  5HBM A;  1N5V A;  1FJ7 A;  5ETT A;  3DI6 A;  2GVZ A;  2XY7 A;  2Y1I A;  4LRD A;  4K2J A;  4F50 A;  3W61 A;  1T03 B;  2BJ7 A;  1QUV A;  1BUX A;  4K5R A;  1Y9O A;  3MD3 A;  3KNA A;  1XMQ F;  2RF2 B;  4FNI A;  3T1Y J;  2MQQ A;  4RJV A;  1T03 A;  3F56 A;  4W4M A;  5G0R B;  3BRE A;  4QWB A;  4QU7 A;  4QIF A;  1RAB B;  1WG5 A;  2IJR A;  2KVQ E;  1DFD A;  3TUP A;  5C7P A;  2L41 A;  2XMU A;  4AQY J;  2R7S A;  4C6A A;  2A1B A;  3M30 B;  1SKW A;  2KM8 C;  4JI6 J;  1XC9 A;  2V0N A;  1KTQ A;  4ED7 A;  3PO5 A;  4C8Z A;  2XLK A;  2E1C A;  1WC6 A;  5KFG A;  5K9F A;  5EDW A;  2WOM A;  4AUK A;  2YH0 A;  2NRE A;  3IWN C;  4UTG A;  1XNR F;  2ASJ A;  4NXM J;  2WVB A;  2HVD A;  2HG4 A;  4PUO B;  3A8E A;  4GVB A;  1V9O A;  1CC8 A;  1URR A;  1Y11 A;  2B6A A;  1SIW B;  2K3K A;  3EM1 A;  4WFY A;  2XO7 A;  3UPF A;  4EYI B;  1VQL S;  3NBP B;  3BSC A;  3VF0 B;  3ULH A;  2C22 A;  4PQA A;  4USK A;  3C14 B;  3Q2S C;  2ZJR Q;  4CNZ A;  3MR2 A;  1PJ5 A;  3FZB A;  1LW0 A;  2GW8 A;  2JFK A;  2RHQ B;  3OFH A;  3M8Z A;  4I6W A;  4MK8 A;  1QE1 B;  3US5 A;  1XMO J;  3EZ5 A;  4FXW A;  4ZIT A;  3MEE B;  2WBR A;  3C3L A;  1S59 A;  2QIF A;  5KFZ A;  3D67 A;  2BJD A;  4N41 A;  5IFM A;  1B70 B;  2LQ5 A;  3AA8 A;  5J2N A;  2F9J A;  4B9V A;  3C6U A;  2BXJ A;  4A4J A;  4ETX A;  4NI2 A;  1VBX A;  1NK6 A;  5L38 A;  3DOL A;  4I69 A;  4ED5 A;  4RO0 A;  3DLH A;  2QLF B;  3LQV A;  1ZH5 A;  4DR6 J;  2HAF A;  3MCO A;  1H98 A;  5RUB A;  2HVZ A;  4KSE B;  5E3R A;  3MPW A;  1ZA2 B;  2XSF A;  4B3M J;  2C2R A;  4UY8 T;  5E3Q A;  3TUZ C;  1SIZ A;  2JC1 A;  3BKU A;  2RSQ A;  2XI2 A;  3HP6 A;  2OSQ A;  3N6N A;  4P7V A;  1ZPV A;  3KLG A;  1DQ8 A;  1YX2 A;  2R42 A;  2VFV A;  4RW6 A;  3NRB A;  2VBY A;  2VON A;  3UD3 P;  2FHK A;  3JTP A;  4NXN F;  1HW9 A;  3CJS A;  1DTT B;  3HZE A;  1L3S A;  2KT2 A;  3DDK A;  2WRM A;  3EIC A;  1VHI A;  2GVD B;  2ZVS A;  1N5Y B;  5C5J A;  4LSN B;  4DQR A;  2C3Y A;  3QGP A;  1KR4 A;  5E41 A;  2W8K A;  2R7U A;  1ZA1 B;  2KJW A;  1S99 A;  4F8R A;  2W01 A;  5HRO A;  1N56 A;  3G6X A;  3GFX A;  3DRP A;  4DV7 J;  1T9V A;  2HWH A;  3SZ2 A;  2QX0 A;  1PG5 B;  1S1T A;  1RU2 A;  2VG5 A;  2W25 A;  3AJD A;  1TKT A;  2QRR A;  4NPO A;  3SV3 A;  4OI4 A;  1KC8 T;  4ZPW R;  7FDR A;  2OIH A;  1RLD A;  4PRF A;  2MTL A;  4C2M A;  1R0B G;  1BQN B;  1CC7 A;  3BQ0 A;  2VJV A;  4I7F A;  4RW7 B;  2FGO A;  2JZ5 A;  2VQE J;  1F60 B;  1Q1K A;  2CDQ A;  3MZI A;  3RU0 A;  3V81 A;  4K59 A;  3T1H J;  1TMM A;  1DUR A;  2OTJ S;  2NZ4 A;  2ZM6 F;  3SSS A;  2JHE A;  1NSK L;  4R8U A;  4XPC A;  1RT1 A;  2BRK A;  1KKH A;  3KLF A;  1YGY A;  4JI7 F;  1F2G A;  4I4B A;  3ZTR A;  2HW3 A;  5JVG Q;  4ZIW A;  2RNE A;  1HW8 A;  2V8G A;  3RUB L;  1SH3 A;  4DCP B;  4I1T A;  2DO4 A;  3GMG A;  1HNZ F;  2HRY A;  1TP7 A;  2GCF A;  4K8R A;  1BXN A;  1S1V A;  1Q4R A;  1VOM A;  3MFI A;  1U1O A;  4LQ3 A;  3DNC A;  1KP6 A;  1C0U B;  3ELH A;  4CH7 A;  1LNQ A;  4DV0 J;  4LF9 F;  4LIW A;  4ZVF A;  2ADC A;  4DEZ A;  3F44 A;  4F3M A;  2UUC F;  1CJT A;  1GQE A;  4HI2 A;  4QPX A;  4H4O A;  5IM0 B;  3CD5 A;  2HQ3 A;  5A8K B;  2RU9 A;  3G82 B;  4XPE A;  3M2U A;  1K1S A;  2D3U A;  4P2F A;  1KLN A;  1FDB A;  1HBM B;  1U1L A;  2B56 A;  1JNZ B;  1TUG B;  4FYD A;  2YX1 A;  2MQL A;  2MKJ A;  3G8Q A;  3NGS A;  1R27 B;  3S01 A;  1B64 A;  2DXF A;  3FCH A;  4P74 A;  4ZCK A;  2C3U A;  2NYI A;  4F7V A;  1DBD A;  2DGV A;  2LFV A;  2YNG B;  3KG0 A;  2HBR B;  1YRU A;  4OHY A;  1AA1 B;  3KWM A;  2M0G B;  1ZZF A;  2NPF A;  5FLX Y;  4WFA Q;  4TNO A;  4DF8 A;  4B9M A;  3R7B B;  3EMT A;  3OV7 A;  1IBL F;  2E66 A;  6FDR A;  1RTI B;  3MCN A;  1S0V A;  2WSC C;  1R43 A;  5LSR A;  4LF5 F;  2VA3 A;  2D1C A;  1H74 A;  3CCT A;  3G82 A;  3KHH A;  3VAF A;  1D9A A;  3ZZ0 A;  1KLM B;  4HH1 A;  5D15 A;  4QR2 A;  3V4M A;  3KLH B;  4P71 A;  3TZX A;  2ZZN A;  4K4W A;  2UXD J;  2WZ1 A;  2RDI A;  2L9D A;  2VUG A;  3D0H E;  2Z58 B;  5KFX A;  4DZD A;  5L1L A;  3BQ2 A;  3PZP A;  2CIM A;  3CC4 S;  1KVK A;  4DR6 F;  3DHX A;  2DGQ A;  3LP2 A;  4GC7 A;  4JV1 A;  1FWP A;  5GAG I;  1WNE A;  1Y5I B;  2IBK A;  2E9T A;  3KFW X;  4DL6 A;  4FVM A;  4OYX A;  5KFF A;  1QAJ A;  4Q0B B;  5ITH A;  2OJ3 A;  3J80 U;  4Q5V A;  2M2B A;  2ROP A;  3ITH A;  2ZKU A;  4JI1 F;  1YLX A;  2GGP A;  3DLK B;  4X65 F;  4C97 A;  2ZUG A;  3LPE A;  5JMN A;  1WC0 A;  3TZZ A;  1WF2 A;  2OPP B;  1IBM F;  2E9Z A;  2LQ9 A;  2F5G A;  2RQM A;  1TL1 A;  4NRT A;  3D1Q A;  2XGP A;  1QSL A;  1FT8 A;  4O0N A;  4L72 B;  1R8B A;  1FEE A;  1X5O A;  3D0I E;  2IRU A;  1Y3J A;  4YY3 F;  1RWU A;  4FBT A;  5EN1 A;  4UOC A;  3CC2 S;  2BM0 A;  2QZ8 A;  1RWV B;  1N34 F;  1T9W A;  1UP1 A;  1OO0 B;  4Y2I A;  1RT2 B;  2MXY A;  2HNY A;  4KY3 A;  1NJW A;  4WTO B;  1I1G A;  1NKC A;  3CJK B;  3NGU A;  3FZ2 A;  3D2W A;  2H5J B;  5K8O A;  5HRO B;  2M9K A;  1HHQ A;  2GS8 A;  3PCO B;  2CZV C;  2XYP B;  3J7Z T;  2CJK A;  3UR3 C;  4OJH A;  2RT3 A;  3IFE A;  3FUY A;  1VC0 A;  2KG0 A;  2WB1 D;  5B0B A;  5G4D A;  2W7A A;  4RWW A;  2U2F A;  2IDL A;  1UW4 A;  5HQL A;  1QVF R;  3FC9 A;  4NA1 A;  1JKH A;  2YNH A;  4OX6 A;  4RW6 B;  5KFR A;  1U0H A;  1FTC A;  3UDE A;  2KHC A;  3WIU A;  1G3O A;  4DPY A;  2GIQ A;  1U45 A;  5E3C A;  5L1I A;  2VKZ G;  4DL3 A;  4B3T J;  1EB0 A;  1M5H A;  4Y28 C;  2MQ8 A;  3CXC R;  3D66 A;  2WVD A;  3NNH A;  5ETM A;  3AJ1 A;  1R3N A;  3DYA B;  2OTL S;  3JSB A;  1FKO B;  3C6U B;  3ENA A;  2QC3 A;  4DV3 J;  2W2P P;  4JI3 J;  2EFV A;  5CAB A;  2VJU A;  3PHT A;  1L3V A;  1HKA A;  3R5C A;  3RR7 A;  1T11 A;  4DX8 H;  1S77 D;  4CCH A;  1UCN A;  3FSY A;  2UVV A;  3CO9 A;  4YUD A;  1SCJ B;  3AOC A;  3LOU A;  3SQO P;  2FJX A;  1RT3 A;  3MTJ A;  5M2P A;  2JVO A;  5C42 A;  4IO9 Q;  2GQC A;  2KT3 A;  5DLF A;  2HHV A;  3IMQ J;  2B4V A;  1UPP A;  2AJF E;  4ALZ A;  1IKV B;  1U26 A;  4LF4 J;  2G9O A;  2ZH3 A;  1HD1 A;  1KBR A;  4A8O A;  4DG1 B;  4JP8 A;  1HBM A;  4R25 A;  1KFS A;  4U7U K;  1T95 A;  3TAP A;  4I68 A;  4DV6 J;  2MZJ A;  3SQG A;  4DFP A;  1MU2 A;  4DL0 C;  4K4X A;  1VQ6 S;  4BDP A;  3RYL A;  4CM2 A;  1CJT B;  3O6Q A;  2N3O A;  3GYX B;  2IM2 A;  2KU7 A;  2CRL A;  1FD8 A;  3DLG B;  2HFO A;  3CUN A;  3PVX A;  3UDC A;  4PG8 A;  3BO3 A;  3TEG A;  2A3J A;  3KHR A;  3JQM A;  1M5V C;  1EIY B;  4PZV A;  3HO1 A;  1S1V B;  2LQB A;  1SJQ A;  3EXY A;  2EFN A;  4OI2 A;  1W2I A;  1NZA A;  4D3G A;  5L9N A;  5DDR C;  2UUA J;  4K4S A;  4KR0 B;  4P2S A;  1C1B B;  2GJI A;  2KB2 A;  4ZPA A;  2IMO A;  3E01 A;  5KG0 A;  2ZBR A;  1SVD A;  3IR6 B;  3W1Y C;  4MIA A;  2DR7 A;  2OH2 A;  4I56 A;  2RB7 A;  1S0N A;  3TJ9 A;  1VRT A;  1UVM A;  2ZHA A;  1FRK A;  1JNR B;  1GTE A;  2RF2 A;  1VQ7 S;  2XHC A;  3MXH P;  3VAI A;  1FJG F;  4R8U B;  2MQP A;  1C0T A;  3NCP A;  2HQF A;  1Y5N B;  3ZO7 A;  1JWW A;  2B8Q A;  5A6P A;  3RB6 A;  2EFG A;  4R5P B;  2Q3P A;  3EPI A;  3SYZ A;  2DO0 A;  3DI6 B;  3QIP B;  1HNX J;  2R8K A;  3CMA S;  1ZPW X;  4I7F B;  2KXN B;  3ET6 A;  1A0O B;  2JRS A;  2COL A;  1SC6 A;  5MAO A;  4DPO A;  3PKM A;  5D4P A;  3AAW B;  5EWF A;  3NOC A;  2HHU A;  3QQC D;  3L7O A;  3QFH A;  1TV6 A;  5HSP A;  3CD7 A;  3KK2 B;  4I6A A;  1U4B A;  4DR5 J;  3PXG a;  2QT7 A;  1XTZ A;  4KKO B;  2D69 A;  4BC7 A;  2QFJ A;  2JFD A;  3MUM P;  2ZM6 J;  1UL3 A;  1WHV A;  1VQM S;  5A76 A;  4MIB A;  2RIJ A;  1IKW B;  3CJ3 A;  4U6P A;  2PMH A;  2AYG A;  1FFS B;  1MG7 A;  1XWL A;  3THT A;  3UDV A;  2GVD A;  1Q8K A;  1PAE X;  3ZTQ A;  1N5Y A;  3FBF A;  2D7S A;  1QVG R;  4IDK B;  1LK7 A;  1EKR A;  3I56 S;  1S6U A;  2F9D A;  4NX9 A;  2QA4 G;  2FYX A;  3U02 A;  2XCP A;  3PW0 A;  3R7S B;  1NH8 A;  1NU4 A;  1LWF B;  2CQH A;  5D78 A;  5JXS A;  2QG9 B;  3QFW A;  4J9S A;  3RBZ A;  3H5S A;  2FVS A;  2FC9 A;  4F67 A;  2CNO B;  2HVE A;  2NUH A;  3BBF A;  4IRC A;  2VFT A;  3IWL A;  3PEJ A;  4IH6 A;  1NPK A;  2C3O A;  5EUH A;  3R5G A;  5KFS A;  1SC4 B;  3OSN A;  1XEZ A;  1X60 A;  4USI A;  1XNQ F;  4ED4 A;  1HHS A;  4NMX A;  4PYA A;  5E0O A;  2W7O A;  5LMU J;  3HM9 A;  2V69 A;  3M9O B;  3CO0 P;  1EKS A;  4YB1 P;  4C8O A;  3UQS A;  2X7I A;  1OJ4 A;  3KLI B;  4HT5 A;  3CDW A;  2CPE A;  3EE3 A;  1BD6 A;  5KFB A;  4NEY A;  2VG6 B;  3M1V B;  1V5I B;  3DU6 A;  1KOH A;  4JV5 J;  2E1A A;  1PAU B;  1N36 F;  4EBD A;  3C6T B;  2KXH A;  1RT5 A;  3CJR A;  2W9B A;  3LWM A;  1VS3 A;  5K8P A;  2XS2 A;  1ELO A;  3D9B A;  1WI8 A;  4FNH A;  2K7J A;  3GFY A;  4KGM A;  4P7T A;  1H7X A;  3HVT B;  3UN3 A;  2ZH1 A;  4DR4 F;  4KPC A;  4PUO A;  4DV5 F;  3BS9 A;  3HFK A;  4ENO A;  4DHV A;  3GV7 B;  5AJ3 F;  4RX6 A;  1WDD A;  2QA2 A;  2ZWP A;  4USU A;  3MEK A;  3MPU B;  1YJT A;  1FDD A;  4LRC A;  3G2X A;  3BGL A;  4FN5 A;  4DI6 A;  4Q43 A;  4J9O A;  1S4E A;  3KNG A;  4RR5 A;  2HS3 A;  1LW2 B;  1FRH A;  2QE5 A;  2ROE A;  1IR0 A;  5E7O B;  3T19 A;  2EC2 A;  1VYA A;  4HDH A;  5CCL A;  3TQ1 A;  1M5K C;  2IC3 A;  2K7K A;  2BAN B;  5B0F A;  2KFZ A;  3QIP A;  5DJB A;  2D3Z A;  2SXL A;  3W9H A;  2HIY A;  4EO8 A;  5K20 B;  4R5P A;  4X65 J;  1GXT A;  2DIT A;  2WTF A;  1MML A;  1DTQ B;  1RWK B;  3GPA A;  3IBC B;  4Y2K A;  5IC6 B;  4OI1 A;  1FK9 A;  4IO1 A;  2KH9 A;  3I4P A;  2HRU A;  1CUL B;  1WKL A;  3Q8U A;  4M5I A;  2VIH A;  5KG6 A;  2M52 A;  5DG9 A;  2VA2 A;  1BQX A;  1EZZ B;  2X1F A;  3A3N B;  4CLS A;  1KON A;  2GO8 A;  2K3I A;  1HFE L;  2DRB A;  1F0X A;  1JX4 A;  5DLG A;  2JEJ A;  5HBM B;  5K5M A;  1NHU A;  2ZOG A;  5GAH U;  1R8C A;  2FLO A;  3TAQ A;  1FF2 A;  1ZBT A;  2IAJ A;  2ZE2 B;  1VQO S;  2FJW A;  4KTQ A;  1NSP A;  4CO0 A;  4CZC A;  3K5N A;  3IAM 9;  1VQK S;  2XY5 A;  1Q79 A;  3CCE S;  3IGV A;  3WZ0 A;  1RYS A;  1XBW A;  5D4L A;  7FD1 A;  2E5I A;  4X4T A;  2HBQ B;  2BJE A;  4LSL B;  1CUL A;  3QMQ A;  5KT5 A;  4M5H A;  3SQG B;  5B0E A;  4DR5 F;  2VC1 A;  4ECT A;  5A8R A;  2L3M A;  2UU9 J;  2VFU A;  4LF6 F;  1Y4Z B;  1K73 T;  3M8Q B;  3JB9 k;  3G9C A;  3J7A 1;  2XWY A;  1U2F A;  2BAN A;  3TAR A;  2ZH7 A;  4L75 A;  2EI5 A;  2R7W A;  3TUI C;  4IKA A;  2OI2 A;  3OR2 A;  3MOZ A;  4DXL A;  2VFR A;  3UDL A;  3MWB A;  4GKK J;  4K4V A;  2HLU A;  1FCA A;  4KGV B;  3NP5 A;  1SL2 A;  4IQX A;  1LWE B;  2G1H A;  2PO4 A;  2AEJ A;  1F9E B;  3DDN A;  3SBM A;  1XR7 A;  4RNO A;  4Q8E A;  4IRK A;  4PEO A;  3W63 A;  3M9M B;  3MGJ A;  2C42 A;  5K14 B;  3OR1 A;  2ZH8 A;  3P96 A;  5DZ7 A;  3ONQ A;  1EQ0 A;  3TO8 A;  2PT0 A;  1AW0 A;  4KV8 A;  4MFB A;  2DGU A;  2VG6 A;  3M1V A;  3CPW R;  5HQ8 A;  3R2C J;  2CPF A;  5CYQ A;  2C2E A;  3IM9 A;  4OIX A;  2DHX A;  4WK1 A;  2LA6 A;  3VR1 A;  2H1Y A;  1WSV A;  3I55 S;  2HQD A;  2DT9 A;  3DKD A;  3FEX B;  2HVI A;  2BKP A;  3DXB A;  3H5U A;  1Z4U A;  3HHL A;  4QQB A;  1NHK L;  3WQP A;  1N36 J;  1KWM A;  4M5J A;  1WWH A;  2AQ4 A;  3PFE A;  1VK3 A;  2WSE C;  3I5B A;  1ARO P;  4FF4 A;  3PRB A;  4FKY A;  4PWU A;  4QIG A;  1JB0 C;  2YPZ A;  1FRJ A;  4B3O B;  3OFG A;  3K59 A;  1D9F A;  3AB4 B;  2E5L J;  4DSE A;  3AB2 B;  4OYB A;  1P27 B;  2OPR A;  2HND B;  2FY8 A;  3UCG A;  4DQI A;  3NMR A;  2OEL A;  2RJZ A;  2GIR A;  1N33 F;  2FUG 9;  2G2Z A;  2M70 A;  4IG3 A;  2HNY B;  2AZ1 A;  2CPD A;  4DV5 J;  1RHM B;  1VFJ A;  1VIX A;  1WD6 A;  4EO6 A;  5IQ6 A;  5AJ3 J;  1NCL A;  2J0W A;  3BZQ A;  4IDK A;  4DUY F;  4QW9 A;  1N4L A;  2HHQ A;  4RNF A;  2GHP A;  2DR8 A;  1H72 C;  1NDK A;  4DU7 A;  1SC1 B;  1P1L A;  4ECR A;  2PGC A;  1FNX H;  5D0H A;  4DDF A;  1U49 A;  3EVW A;  4GO7 X;  4NML A;  2AGP A;  5KT4 A;  3H0P A;  2AGO A;  3UNG C;  3N9U C;  2OPS B;  3CCW A;  3POT B;  2OPP A;  4LUB A;  2OPQ A;  3VGV A;  4ECZ A;  4JI0 F;  1HI0 P;  1QM9 A;  4KKO A;  4E8U A;  2NR0 A;  2I6W A;  2N82 B;  3GII A;  2GGP B;  3DLK A;  3R7N B;  2CQI A;  2NSC A;  1M0S A;  3BKF A;  4ZHR B;  3MM8 B;  5DQH A;  3H2L A;  1WOS A;  4Z2X A;  3OL8 A;  3LO3 A;  2CAJ A;  3THV A;  3RRK A;  3HMJ G;  2BV3 A;  2UV8 G;  1YQH A;  2J76 E;  2YWG A;  2FJA B;  1FFG B;  4X84 A;  3KJQ B;  4DX5 A;  1GMV A;  3HLU A;  3QGI A;  3GQC A;  2JX2 A;  5B0G A;  3CJ2 A;  3DRR A;  4DV0 F;  4DR2 J;  4WF9 Q;  4DV1 F;  4N5S A; 
#chains in the Genus database with same CATH homology
 5H9E K;  2Y9H A;  4U7U D;  3QRQ A;  4QYZ K;  1WJ9 A;  4DZD A;  2Y8Y A;  5CD4 A;  3QRP A;  2Y8W A;  5H9F K;  3QRR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...