1FTCA

Y13c mutant of azotobacter vinelandii fdi
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
106
structure length
105
Chain Sequence
AFVVTDNCIKCKTDCVEVCPVDCFYEGPNFLVIHPDECIDCALCEPECPAQAIFSEDEVPEDMQEFIQLNAELAEVWPNITEKKDPLPDAEDWDGVKGKLQHLER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords FERREDOXIN
publication title Y13C Azotobacter vinelandii ferredoxin I. A designed [Fe-S] ligand motif contains a cysteine persulfide.
pubmed doi rcsb
source organism Azotobacter vinelandii
total genus 31
structure length 105
sequence length 106
chains with identical sequence B
ec nomenclature
pdb deposition date 1997-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00037 Fer4 4Fe-4S binding domain
A PF11953 DUF3470 Domain of unknown function (DUF3470)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1ftcA00
4YDDB 2FGOA 1KEKA 3MM7A 3PNIA 1G3OA 5BYRA 2UZAA 1SJ1A 1GTEA 3MM9B 1H0HB 1JB0C 1FRIA 1A6LA 1XERA 2VPWB 1B0PA 1FDBA 4CI0B 1DURA 3IR7B 3OR2B 5E7OB 1F5BA 2C3UA 2FJAB 5BYSA 1FRKA 2XSJA 3MMBB 1PC4A 1BC6A 2O01C 3MMCA 3EUNA 1BWEA 5L8RC 1FD2A 1F5CA 3MMCB 1R27B 1VJWA 1H7XA 2WSCC 2V4JA 1BD6A 1DAXA 5CHCB 1Q16B 2V4JB 3MM7B 2VPZB 1FRHA 5FD1A 1C4CA 3GYXB 4DHVA 3OR1A 1SIWB 4Y28C 1Y5LB 2WSFC 2GMJA 1IQZA 1G6BA 7FD1A 1K0TA 1FXRA 2VPXB 2WSEC 4RKUC 6FDRA 1FF2A 1GAOA 3HKZD 2C3YA 1Y5NB 3MM6A 2FJBB 1JNRB 2V2KA 1FEHA 2FDNA 1FDAA 2C3OA 4L6V3 1FRXA 2XSJB 1FERA 1DFDA 1F2GA 1Y4ZB 2VKRA 3C8YA 1C4AA 3EXYA 1IR0A 1JNZB 3MM5A 1RGVA 2FD2A 1AXQA 5BYQA 1BLUA 2ZVSA 1FXDA 4AYBD 2PMZD 2WAQD 3OR1B 1WTFA 1BQXA 2Y0SD 6FD1A 2PA8D 1Y5IB 5CH7B 1KQGB 1GT8A 1H98A 4XDCA 1SIZA 1CLFA 4ID8A 3MM6B 4OMFG 2FJEB 2FJDB 3MM9A 1FCAA 3MMAA 4XK8C 1GTHA 3MMAB 1KQFB 2GMHA 4XDDA 2IVFB 3IR5B 1H7WA 2VPYB 3LW5C 1FRMA 2C42A 3MM5B 3OR2A 4KT0C 2C3MA 1FRJA 1HFEL 1D3WA 3IR6B 1FDNA 2C3PA 2PDAA 3MM8A 3MMBA 1B0VA 2Z8QA 1PC5A 1B0TA 7FDRA 2WB1D 3MM8B 3EGWB 4OV1A 1FRLA 1ROFA 1FTCA 1FDDA
chains in the Genus database with same CATH superfamily
2YBVA 2HHHF 4NCBA 4CLZA 1FJCA 2KL8A 1RU1A 4DV2F 4MT1A 3WC2A 4LF4J 2MSSA 2J0QD 1Q7YT 1NK6A 3R27A 3QGIA 2DHGA 2YKQA 3HMJG 4OYAA 3KJQB 2KYZA 1U6BA 1HBNA 2UU9J 3BV8A 3W5YA 5L46A 4I2QA 3PKYA 2HMIA 5J1EA 2N4CA 2ROEA 2BJDA 2AP6A 1KBRA 4RLEA 3DFEA 2AJ4A 3I0RB 3CO0P 3I82A 3KLIA 1RACB 2LA6A 1FRXA 1NZAA 5KFNA 4DR3J 3NS6A 3RAQA 3K57A 5C25B 3HFVA 5LMUJ 2J6UA 2GQCA 2GW8A 2ZZTA 3SYZA 2XGQA 2DRAA 1R0AB 4ECSA 3MM6B 3G71S 3IO1A 4Q44A 3MM9A 1RKIA 3CMAS 3BDPA 4IYQA 5L9XA 3TW0A 5IT4A 4K0KF 5KFOA 3O2IA 5I4MA 3ZC4A 2AW0A 2VDHA 4CLLA 2NYIA 1FTCA 1HBOA 3NEKA 2B4UA 4ZVEA 4ZCKA 1U1KA 2D69A 2JHEA 4HTIA 3QZ7A 1FESA 5D77A 3ZTRA 3RB6A 4NXNF 1FD2A 2R7VA 3HJVA 2VFSA 3SCIE 1KR4A 1UZDA 4QR1A 1GMVA 1PGZA 2H5EA 3NMAA 2XMJA 3JS9A 2NR0A 3M4XA 2E9TA 1VQKS 1WG5A 2XB2D 2GA7A 1JKHB 3CCQS 5HAOA 2QA4S 1VQPS 3GU0A 4ZJLA 3PYFA 2FY8A 2CPDA 2H4YB 3HZGA 2Y1IA 1R89A 3D6FB 4QIWD 3PIOQ 1TKDA 4OLOA 1Y5IB 2H54B 2GNKA 1VC6A 2BANA 3H59A 4DL0C 3J81U 4O23A 2E9RX 1YJNS 2QGFB 1MWZA 2OPSA 2NPIA 2A3JA 3K5MA 1IBMJ 2GO8A 1FWPA 3KLGA 4F02A 4ES2A 1WHVA 2ILZA 3TANA 4P72A 4ZCLA 1H6KX 4UF4A 5E3PA 1FK9A 2PE8A 2IJNA 2VBWA 2V9KA 3NOCA 2HBRB 4B3RF 5LSLA 3WBZA 4LR8A 1HQUB 3KJVA 5LMNF 4DF4A 1NK8A 4C48A 1AYEA 2ZH2A 2FVQA 3RRGA 4OL8A 3M8WA 5DQHA 3SCKE 3KG0A 4OZ1A 1VFJA 3RG6A 1JXLA 1N32J 1WC6A 3BN4A 4F4ZA 3LQVA 2MQQA 3DLGA 4WU2A 2AJ2A 5KG5A 2QJ3A 4CLTA 4QWEA 4ZS6A 1IWAA 3C16A 2U2FA 1YJ9S 3Q8PB 4F4AA 1VQ6S 5HATA 1DZ5A 5HQLA 3MOZA 1VQ4S 4CYUB 4OMFG 2OPQA 1Y11A 5GMEA 2VBXA 1W2BR 1N5TA 4WPAA 5T7LA 2VA3A 2YPYA 3AOCA 1XMQF 4DV1F 4KT0C 1S97A 2KU7A 4U67Q 4HT5A 4LSLB 3MM8B 4WXOA 3I5AA 3SFGA 4OV1A 4ILRA 2HVEA 4W98A 1F9FA 2CPEA 1J5EF 2LECA 4OZLA 4LF8F 4ZPCA 1S77D 1NO8A 3KOAA 4Z7YA 1GEHA 2W9BB 2E5IA 1NZ8A 2VG6A 1FRKA 4EO6A 2Z2YB 3VQTA 4P10A 1YIJS 3QRRA 5KFWA 2BVZA 3CO9A 2VPZB 3CC2S 1JXEA 2C2DA 3K59A 2YKMB 2YNFB 4RKUC 4OHYA 4LR7A 1TR0A 5I42A 1MG7A 2LDIA 1UEVA 2YWEA 1Y4ZB 2APOA 1F6TA 3EVOA 1JNZB 5C42B 4OX9J 5EUHA 5JVHQ 3N28A 2W8KA 4URSA 4ZIVA 1HWJA 4ANEA 2IM0A 1NJXA 3VAJA 2KO1A 3LUYA 2XQCA 2DR7A 3PX0A 3AAWB 2FJEB 2CJXB 4C3MA 3T3FA 1QAIA 1SKSA 2W2QP 3JQKA 4OX7A 5F0WA 2P8IA 4HVZA 4ZCMA 1RT5B 1YJUA 2WB1D 3KUEA 4KSEB 4NZ6A 4UZBA 1R8BA 3GJQB 3QLHB 4CO3A 3D1QA 3DGPB 3DRRB 4WTYA 1OY8A 1X0PA 2LU1A 3KLVA 2BACA 2JLGA 2VL1A 1V3ZA 1U26A 2W7OA 5LM7E 4QW8A 1U6ZA 4IO9Q 3UI3A 2B8PA 4U7UD 4N77A 1RT6A 4DFPA 4CDIA 3DLKB 2CJ9A 1OJ4A 2XTJP 3VAIA 1JNRB 2MQMA 3QPIA 2ZH7A 1IWGA 4B3SJ 1I94F 3V2UC 2RU3A 4KV8B 3EVMA 1EHWA 2D41A 1UEUA 2QG9B 4QJVA 2ZVSA 3CCWA 4WFBQ 2MLZA 2HVDA 3ILIA 5HLFB 4QOTA 4ZPAA 2IVYA 3E2EA 2M52A 1AUSL 4TXSA 3MMAA 4QYZJ 2HFNA 1ZZFA 3PJ9A 1O8BA 3P5TL 1IKXB 2VZ9A 1HMVB 2ILYA 3CMQA 4ZA1A 4UOFA 2M8DB 3AOAA 3J80U 3EMTA 1X4FA 1PG5B 5CXTA 4TNOA 1KD1T 4L3NA 2BE7D 5C24A 2HGNA 1DY3A 3B6BA 2FVPA 3N5BA 5DG9A 1LWEB 3CJ8A 4P7VA 2BYCA 5KFAA 3KK1B 2RT3A 1GX5A 3DU5A 1S1WB 4L73A 1HI1A 2KB2A 2J0WA 3D5MA 3HHLA 3TEHB 2V9WA 5L8RC 4J9MA 1TVRA 4F67A 1RU2A 2VA2A 4A8YA 3X1LB 5FD1A 4TYAA 2EKYA 3GIJA 2I38A 2WSFC 5CZVA 3QJJA 2MY8A 4ID5A 4LFBJ 4ECQA 5K14A 4F0MA 1Q0NA 1P8GA 4NOHA 5M2UA 4MK8A 1S57A 1U1PA 4JI7J 4MKYA 5GAGU 5K8OA 4OJHA 3GTYX 4Q8FA 1Z2LA 4WCEQ 1LW2B 1Y3KA 2KM8C 3NCPA 1BUXA 5IQQA 2Z8QA 3IAS9 2KDOA 4C11B 1WWHA 2FQQB 1RHUB 2XMUA 2VQEF 3MAHA 2PEBA 4J91A 2QV6A 2PA3A 5IM0A 1XNQJ 4QYZK 3HHEA 2V8HA 2D9PA 2UV8G 1UCNA 3TARA 4IUFA 1URNA 2IYIA 3N0VA 1F5CA 5LXYA 1RXOB 2OSRA 3LH2S 1IQZA 2KT2A 3N01A 3W66A 3T1HJ 2W9CA 1GAOA 3P45B 4H4OB 1VQOS 2UU9F 1X5OA 3HF5A 2ZD1B 2XC9A 1KVJA 1S72S 4ZPTR 3MPDA 1PBUA 5M2PA 2DO0A 1FFSB 3T6BA 4U9RA 3Q8QB 2IDEA 2MZ1A 2C22A 1VRUA 3R5GA 1PJ6A 4DR3F 1TUGB 3M9NB 3OD2A 1TKXB 2YKOA 2DRDA 3O5TB 1KONA 4X66J 5LMUF 1RT4A 1BMQB 4N8NA 1OPIA 5AXLA 3UE2A 1VQNS 1GQEA 3W2WB 1Q8BA 2ZZNA 3EICA 1Y0HA 4X84A 4B08A 4I2PA 2WB4A 2HNZB 4QQBA 3S8SA 1FJGJ 2VONA 2CDRB 2O66A 5ADZA 1Q1KA 4TY9A 3QZ8A 1YTYA 2B9XA 4Y2MA 1Z4UA 4IQMA 3A4TA 3CIMA 3W61A 1BGXT 3CJ4A 4DSFA 4B9SA 3BBBA 3LPYA 1N5QA 3C14B 2OGUA 4FP9A 1UVLA 3RTVA 5DQGA 1JLBA 5DDQC 3BYPA 4OIXA 1N5SA 2JFDA 1SH3A 1NH7A 3EDRB 2H1YA 3QJPA 2DR5A 1HBMA 2ZHBA 3DOKA 5D0RA 2R7RA 1B7YB 1N54B 1FKOB 1WHWA 1L3SA 4NWBA 3ITHB 4LFCJ 2FLLA 2FVRA 1G3OA 4ECXA 1TL3A 4LBIA 1QE1B 2BX6A 4ZHRB 5F8LA 1IBMF 2GVZA 4CQ1A 1OSDA 1QD1A 2ZUAA 4F3MA 5J1EB 1S7HA 4HI2A 4ECVA 1B99A 1VS3A 3QRPA 2AT1B 4KH0B 3KJNB 5KT5A 3EX7B 4DV7F 3PHEA 1CQMA 3NBPA 1FERA 2EG2A 2DGOA 3BO2A 1WG1A 1NNDA 1APSA 2ZITA 2FVSA 1N32F 4PXCA 2H5IB 3H98A 3SCLE 4WKYA 3RAMA 1N4LA 4IKAA 2R3VA 2BRLA 3FJ2A 2K1RA 4QR0A 3ZZTA 2B51A 3SEOA 4UUXA 5GAEU 2E66A 4ZN3A 1X9MA 3R2DJ 4DR7J 1QTNB 1QY7A 2Z2ZA 3PEJA 2DEIA 4KR0B 2O67A 5D8HB 1FWKA 2H5JB 3SSQA 5IV3A 2C2EA 2VG7B 3CCLS 4DCPB 1RWWB 4EK2A 2KM8B 5B0GA 1WG4A 1TKTB 3MURP 3RJMB 4ECRA 1GTEA 2RF2B 4C7QA 4FXDA 3FBBA 2VV5A 3HHLD 2YVSA 2XSJA 2FHJA 3BB5A 3OBIA 2CPJA 2V4JA 3MECA 3US5A 2W2OP 4ED4A 2R2RA 3OR1A 3T5LA 3QJLA 3NGTA 1RT1A 1RWPB 3KDOA 1KKHA 1OMSA 2JC1A 1U49A 1U45A 3LAKA 2G9OA 5K20B 5BJRA 3UCGA 1YZ7A 6FD1A 1S12A 1H38A 2CA9A 1R0CB 1TQLA 3WHIA 3W63A 1U09A 3W8GA 4KGXB 4ES3A 2BANB 2XHCA 2YQ1A 3MUMP 4OX9F 3V4IB 5F8JA 2OPSB 2VJVA 1YJTA 2JH3A 4IOBA 4B9LA 2PO4A 1FNOA 3H42A 2RE1A 4Q7AA 3QGHA 1JJCB 5EWEA 5C7PA 2DR6A 4JBCA 4FBTA 3FFIA 1FK9B 2E7WA 3EZOA 3U1NA 5B0FA 3DOLA 4F4KA 3MUTP 3G86A 3KJVB 4DV3J 2AWZA 3R1HA 1EKSA 4P2FA 2NQPA 4CO4A 2DVIA 2ZVIA 5LJ5Y 1TZ0A 4DV5J 3DC2A 4KFBA 3OXLA 1A9NB 4J5OA 3KWMA 3VVUA 1SJ4P 3K17A 3BN7A 2BABA 2HK2A 2L9NA 4UQGA 3IG1A 5KG2A 1GXLA 1HPZA 1IVZA 3C16B 1VK3A 2DNRA 2XBPA 4ED2A 1X5TA 2DY9A 1ZTTA 4B3SF 2MXYA 3M32B 3FK4A 5T7LB 2J6TA 4OX6A 2C42A 3R6GB 5AJ3F 2XLJA 1TK0A 1NDCA 5D4PA 1RHKB 4I7FA 2GCFA 2DCUB 3TRGA 2J7UA 5E3AA 4USIA 2RU9A 2EPIA 3U1LA 3PW5A 1L3TA 4JYAJ 1FRIA 1TK5A 1SKRA 2MKHA 3Q89A 2ZBIA 3QRQA 2VG6B 3L7PA 2KFYA 3G9CA 4JI1J 3OT9A 4WKRA 5DDPC 4B02A 3DU6A 2P2CB 4X62J 4C6AA 3TNVA 3PX6A 2UVUA 1S59A 1YLXA 2VPXB 1U7LA 4NLGA 3TYTA 2C3YA 3DKDA 1KRPA 4DR6F 2KZZA 4ES1A 4O4GA 1XR7A 1ZA1B 2DNZA 3CJQA 4C8MA 1B70B 3DDNA 2HHWA 3TAQA 2ZHAA 2LCWA 2HRTA 4ZVGA 2PMZD 3M8QA 2UV8A 1AB8A 1O5JA 1WOSA 3SQOP 3KK3A 3E01A 3NCRA 1WSRA 1HQEB 2HQ3A 2WW8A 3UO0A 2DISA 2QFIA 2DXFA 4IRDA 3JQMA 2L9DA 1RWNB 3CD5A 2MQNA 4HR2A 1WKKA 1VQ8S 2CNLB 3DLLQ 3ZXWA 4JI7F 2EKNA 2ASDA 2FGOA 3ET6A 4DQIA 3F0NA 1YJ7A 3B78A 1N5VA 2HVIA 1RLCL 2DNOA 1VGYA 3W60A 3OFHA 2DO4A 4IG3A 4A8QA 1S1XA 1LOUA 4RR5A 2JEJA 1YG0A 1H7XA 2VBZA 2BA9A 3E8OA 2D3OR 4JUZA 3UN3A 1SKUB 1TMMA 1RT6B 4WK1A 3QATA 2Q66A 2MHEA 4F2RA 1XNQF 3LP2A 4JV0A 5KT7A 4L6V3 4L75A 2OKQA 4NLDA 2KFNA 5HO4A 4N56A 3HD1A 1Y9OA 2AYEA 4WIIA 3T1HF 3UD5A 1L3KA 3MMAB 2AF6A 5E41A 5J2QB 4F4WA 2XZTB 5AXMA 3R6LB 3GJTB 1B0VA 1U0HA 5ETKA 1SH0A 2DGTA 2DNKA 2NSBA 4X65J 4ZLNA 1HNXJ 5DLGA 5CZXA 4K59A 1Z1ZA 4AXIA 3AJ1A 4JI6F 4X66F 4XPCA 5D4NA 4USTA 4NLQA 3D1OA 1MU2B 1X4CA 1NXIA 1ULRA 4NLRA 2YX1A 3HSDA 3NP5A 2ZH3A 1HWIA 2RRNA 4DL2A 3QYYA 3M30A 4PABA 2CQ1A 4ID5B 5ETNA 1RAFB 5E3QA 2AZ3A 1WACA 5E0OA 4N76A 2CXEA 4DWIA 4TU8A 1NK0A 1U2CA 3G82A 2DCLA 2R42A 4C98A 4O44A 1P9QC 1XNRJ 4F04B 5F9LA 4KIAA 2J5AA 1VLOA 5C2CA 2ZH6A 1IKYA 2V5HG 1N52B 4MIBA 3OFGA 1IKVB 4FYYB 4WFYA 4Z2XA 2HGLA 4Y2CA 2G2ZA 3SV3A 2IC3B 2J7KA 1HHTP 3CJKA 2XNRA 2Y3YA 2XI2A 1W26A 4J7CA 4LFCF 3A3PB 4YS2A 3GCXP 4QWBA 5KFZA 4A48A 2NSCA 3K5OA 3FNNA 2YTCA 3JTPA 3SCJE 2CWXA 4X64J 4B9NA 1RCOB 5D0EA 2AJ1A 1IR0A 5L1LA 3M6VA 3IM8A 3CCSS 1I6JA 5HQ8A 1X60A 2EVZA 3D0IE 2G1DA 3ULHA 5T14A 1P6TA 2HKEA 2VFUA 2MQ8A 4OX8A 3IS9A 1TL1B 4E2FB 3OL7A 4KAIA 1FO1A 2XMWA 1R31A 2PFDA 3CCUS 5HVFA 4A4JA 2MZRA 2HNYA 2XI3A 1RT4B 2XMVA 3PFEA 4QPXA 2IA0A 1HYSA 5FIIA 4WJBA 1PJ5A 4M5MA 3V6JA 3I5CA 4DR7F 4NLPA 2U1AA 1DRZA 1FWLA 4R0EA 1AUDA 1F5BA 1WDDA 2G0JA 1JLEA 3VZHA 3BREA 4HDHA 1V9OA 3T5HA 1D09B 1OYEA 2XO6A 2CG4A 1NLKL 1FFWB 2IJFA 5DZ6A 2DD8S 4ECWA 2HHUA 1RT3A 3UDCA 1AFIA 1N8RT 3OVAA 2NZ4A 4AYBD 2IFXA 3QT8A 1RTJB 4NXMJ 1HWLA 3NNCA 4EWTA 2AKWB 2BMBA 1VJQA 4HYKA 4ZJOA 3D9BA 4CCHA 1Q81T 4RW9A 3DRXA 4DBQA 3OR2A 2KT5A 3LGHA 3IR6B 2K3IA 4JI5J 3MWBA 4MJKA 3MEDB 3MEGA 2GS8A 1LWXA 1T03A 4PWDA 4H4KC 4UOCA 2XMAA 1TL7A 3UR3C 1MMDA 4NASA 1FVSA 1TL3B 4DV4J 3J80Y 2Y8WA 2C28A 3GE9A 2GVZB 1S6QB 4AUKA 2AV5A 2WBRA 3NRBA 1VQ7S 9RUBA 2Z4PA 2CPZA 4LF9J 4NA1A 1N48A 4RPFA 1WJ9A 3KLHB 3PEHA 4NCGB 5T41A 5EX0A 1YJRA 4O0NA 2FDNA 4GC6A 1R0BG 1C0UA 4DV3F 3NBPB 1F2GA 2V2ZA 4JI2J 4LBPA 3IWNC 7AT1B 1U48A 1JLCA 4ZPDA 3PYDA 3CC7S 2W1BA 5LOQA 3PIPQ 4DV5F 5DG7A 5DM6Q 2R7SA 1U2FA 1SUQB 1SIZA 4RW8B 2OD4A 1CQNA 2YXLA 3EVWA 1KQSR 3MR5A 1TUVA 4PZVA 1DTQA 4JV2A 2FLOA 4UT4A 4DN9A 3NGSA 2RB7A 3VAMA 2OIHA 1IKWA 4XTTA 1FDDA 5D0HA 4YB1P 2J0SD 3FZBA 3TAMA 5G0RA 4DEZA 2V34A 4M1KA 4DSIA 1SJ3P 4DQSA 4F2SA 2A2DA 5IWAJ 3CCZA 2WRMA 1PC4A 2C2OB 4ZP9A 3HK2A 3ILLA 1FD8A 2KJVA 3QIPA 1VJWA 2J8AA 3VHQA 4DX5A 1Q16B 2V4JB 4UY85 1KQKA 1SL0A 2HWHA 4JYAF 3WIUA 1SI9A 4KC5A 4QWCA 4A8FA 2Z0GA 2HHTA 2PMWA 4HT7A 3KNGA 2ZC4A 4JI1F 1XIQA 3KDNA 2MTLA 4DDFA 2KVIA 4X62F 5EHHA 2QC3A 4IH5A 4CIOA 3UN2A 1BQXA 2CJKA 1NKCA 1UP1A 2OTLS 4RX6A 4KO0A 1HI8A 1LKZA 1RT7A 2RVJA 4QBUA 2G0IA 2WVDA 4FPRA 2V94A 3KMSA 1S6OA 1SV5B 3ETOA 3G8QA 4DJBA 3FBCA 4KGVB 3TJAA 4JI8J 4U6PA 1HNVA 3EYZA 1NPRA 4MK9A 3VV2B 4F50A 1FRLA 3M2VB 5U47A 1QTMA 5FJ4A 5DGAA 2VPWB 3MAQA 1PCAA 2KRBA 4YR2A 4DQRA 1KWMA 3O3LA 1CSJA 4QIEA 4ANCA 2R8JA 2B5JA 2FZCB 2LXFA 1R6VA 3IRXA 3OFFA 4NYOA 1DAXA 2BJ7A 3CD7A 3O8WA 3HX9A 4HL9A 4IOCQ 1SH2A 3CVKA 3ISZA 3EGNA 4AL5A 2CPFA 2RRAA 2RQ4A 3W9IA 1RDRA 4P71A 2V2VA 5CABA 3KHHA 4RNHA 5K5MA 1UTAA 2OPRB 2FLNA 2VQFF 1D0EA 5KFIA 4WWSA 3BGLA 5B0AA 3H90A 3IG1B 4M8LA 1HPZB 1M5SA 4ITSA 3PXGa 2UVWA 3PX4A 4ECUA 4USKA 1KQGB 1B3TA 1BY9A 1TU0B 2IYGA 3MR6A 1YK9A 1VBZA 2IM2A 4DS4A 1FFGB 4FKXA 4EZ9A 3CSKA 3TJ9A 1QJHA 2DPJA 1IM6A 1FDNA 2KXFA 4EU0A 1GH8A 4FDFA 1RBAA 4LBHA 1E6YA 2MKSA 3IRWP 3GG0A 2IMWP 4OHXA 2F8HA 2FLPA 2AEFA 4A8XA 2FJXA 2LKZA 1IJFB 3I0RA 3PDNA 1WF1A 3C6UB 1RWXB 5LXRA 1HNXF 1DJ0A 5C25A 3QBCA 4NI2A 1SIWB 3TUPA 3IXQA 5ETLA 3ZTPA 3MM6A 2DHAA 3G4SS 2AJ0A 5EX3A 5E3CA 4UY8T 2KI2A 3B82A 2VBYA 3I32A 5KTQA 3MR3A 4Q2MA 4FBUA 2MZQA 3KK3B 3E01B 2DIVA 1FCAA 4O4RA 2VFRA 4DX7A 2HQDA 4ED6A 5HBMA 4DXLA 1T8EA 1EKRA 2B6AA 3MTKA 4KPYA 3RU0A 3WC0A 3T41A 3NY0A 4K4WA 1XNRF 4X2BA 2HFVA 2ROGA 3IR7B 1JKHA 3GR0A 2ADBA 3ZZUA 1H2UX 3ILJA 2Q6BA 4CM0A 2GIRA 2HHVA 1S1XB 3FCHA 1UJ5A 3UCZP 4Y34A 3CCJS 3CDUA 5K8PA 3ZNUA 2F7VA 5KFFA 4IG0B 3AD8C 3PKMA 3G6ES 5HMWA 5J1PA 4D3GA 4X4VA 3ELHA 1YWXA 4NPOA 2B4VA 5MLCV 2QLWA 3HSGA 5E5NA 4X4OA 4YR3A 4JV5J 1IN0A 2F1FA 2B56A 4EI2A 4N41A 1S76D 1CLFA 5D4OA 2KVQE 2CQCA 2QLXA 1Y10A 1F3VA 4LF6J 4HI1A 3LW5C 2XO7A 1HQUA 3OUYB 2BQ3A 1UKUA 4ZP6A 2X1GA 3AHPA 2VH7A 3BR8A 2NXEA 4OYMA 2UXCJ 2RAQA 2UZAA 2XS2A 3NGDA 1EQ0A 4P2XA 2I2YA 5E3RA 4LRBA 3KHLA 2C3UA 3SQGA 1S6PA 3TO8A 3DMJB 2LQ9A 2DYAA 1N0UA 1CJVB 2M9KA 3KLFA 4J9QA 4AL7A 2JL9A 1AZSA 1YRXA 3EJMA 1NBEB 2FB0A 4TLRA 2KH9A 1NHKL 2KFZA 3P3DA 3HKZD 3SDEB 4QCLA 2ZDPA 1QSYA 2OO4A 3UWTA 3M30B 4Z37A 2CG8A 1LW0B 3KFWX 4EO8A 1RGVA 1EETA 3LAMA 1X7VA 4MAKA 4MK7A 1PILA 3TZWA 2HQIA 1RHMB 1JMTA 3G82B 5ITHA 4XDCA 1VLYA 4PG6A 4O44B 4BWJA 4RW7A 4U8VA 5L1KA 2W9AA 4OYXA 1S1VB 2YWHA 4M95A 2W9BA 1UEKA 1YVFA 2CQBA 4NXMF 4ZVUB 1X9WA 3D28A 2JZ5A 1ACMB 3R5BA 4NL5A 4RUAA 3IGVA 2ROPA 3OTDA 3NGUA 4DL7A 2V2QA 1LNQA 1CJKA 2YKMA 4LQ3A 8RUCA 2X51A 1B0PA 4CI0B 4WE1A 2FPHX 4AQYJ 4JI5F 5IT9Y 3K89A 3MOJB 4DV4F 1UVMA 3M8YA 4G1PA 2ASYA 4C0HA 2R8HA 5FDLA 2VUGA 1WF2A 5GVQA 1RBOB 5KT3A 5D78A 3HHNB 4F8RA 5K8MA 2LXUA 1PYSB 1RT5A 4NZ7A 2AU0A 5LMNJ 1KTQA 2GHWA 1JJ4A 2KYXA 1X5PA 1LV5A 2CIMA 3F44A 3QLHA 1TL5A 4D3HA 5KOWA 3DGPA 4JI2F 3DRRA 3K2YA 1KQFB 2HLUA 3GSDA 4F4YA 1NKBA 3D66A 4NLVA 4R25A 3EXCX 3FCWA 2HRUA 3H5XA 2R8GA 4UUWA 2UUAJ 3HD2A 2GAGC 2A2CA 3DRPA 5H1SV 3HP6A 4HH0A 3CF5Q 3PW2A 4F3OA 4RBVA 3HO1A 3VAFA 3PM9A 2EFPA 3PJXA 1BWEA 4KV8A 2ZDOA 2IY5B 4C9DA 1YBAA 1A7GE 4GVLA 2X3GA 3GLJA 5J2PB 4DV1J 1F0XA 5I3UB 3D3BJ 1JIHA 5HLFA 2LEAA 1HLWA 5IWAF 3N6LA 2IBKA 4DU8A 1J5EJ 3CT9A 1EP4A 2J9EA 3H4BA 2LQ8A 3PVXA 2AD9A 3MCMA 2X7IA 4ZPWR 1RWMB 1Q95G 3PZPA 2QL9B 3CXCR 3EPIA 3BBFA 5D6GA 4PPZA 2NXUA 3SBMA 4WU3A 2DNMA 2L3MA 5KG1A 3FDSA 4KQZA 1VHIA 2RS2A 1LWEA 4RW9B 1UJ6A 1U24A 2WW4A 1U8WA 1QAYA 2UUBF 3UW1A 4PPDA 1XMOJ 2EEYA 2E1MC 3MEGB 4NMLA 4BWMA 3CULA 2QO3A 1CJUB 2Z58B 2QL7B 1SCJB 3GFHA 1T9XA 3A1YG 4JI8F 3NKYA 2Q3PA 1R7IA 1Q82T 3HZEA 1NU4A 4P7TA 3TA0A 1QUPA 2XEXA 3KLEA 2RSQA 2C2NA 4WP3A 2LDYA 3RZAA 1YKWA 3D0HE 4DLGA 5CA5A 1U1RA 3W8PA 4EBDA 2V0NA 5C5JA 1W25A 1P27B 3BGRB 2D3UA 3VR1A 2ZBPA 3MTJA 1HBUA 1GXUA 1EAYC 4OI1A 3R9LA 1H98A 3TVZA 5J2MB 3TAPA 1JX4A 3DOMB 5L1JA 4IRCA 3TX0A 2G2YA 1TMJA 4KGMA 3GP9A 4IR1A 2CJYB 1ZAVA 1HNIA 4CRJA 2OHDA 2W8LA 2WVCA 2RH3A 2X1BA 4TY8B 1BHNA 1SJFA 4P52A 2GJ2A 2NXJA 4I68A 3CW2C 3TAMB 3HCXA 3NGRA 3GFYA 2AYMA 3K0JA 3OSPA 4H4OA 1H73A 2L9WA 3CEDA 5KG4A 2CJQA 5DM7Q 4K5SA 1BD6A 2F9JA 3QIPB 5HJXA 5A8RA 4UTGA 3OVBA 4I56A 3THPA 1WC1A 1RTIB 4LF5J 3H2UB 4KE5A 3V5RA 4RNFA 3IBWA 2K06A 2BOAA 4EBEA 3E3XA 2H48B 3PO5A 4ED0A 5ETRA 3HXMA 1WOPA 3K58A 1SC1B 3F56A 4BC9A 1TKXA 4EUVA 3TVKA 5CH7B 4A8OA 2OEJA 4CO1A 3MDFA 1YZ6A 3G6XA 4KO0B 4TQRA 3W2WA 2CJBA 3UVJA 2HNDA 1RT7B 2VHGA 3CCES 4MYUA 1WELA 1NDKA 1UVIA 3VAGA 2HNZA 1S4FA 1HNVB 1CPZA 4QW9A 2B7CB 3FSXA 4W90B 4J9NA 1U8SA 5KFQA 4PR6A 4MKAA 2DB1A 1RBLA 2H9ZA 1A6LA 2Y0BB 1XR6A 3QGPA 4LMZA 2H65B 1A0OB 5E7OB 1UPPA 3C14A 2UP1A 2B5JB 1VQMS 3IRXB 3QO9B 3CJ0A 4OYBA 4DV0F 4X4UA 2OSQA 3BGOP 3GSIA 3MGJA 3N6MA 5A8KA 4WP8A 1P1TA 2FJBB 5I3QA 4NMXA 2OI2A 5GAHI 1XWLA 3DXBA 4RWWA 2V8VA 1ZAWA 3ZZ0A 5IV4A 4EZ6A 2Y0SD 3ITHA 1SB6A 3TZYA 1UFLA 2KRRA 1QE1A 5KFLA 4ZHRA 2NLWA 5ETOA 1WD6A 3TR5A 2WZ1A 4JV5F 1BE4A 1BQNA 3PHTA 2PDAA 1REGX 3SMZA 2YNIB 1E6YB 1BWVA 1WDTA 4USWA 4LF6F 5B7WA 3KUHA 2EW9A 2RDIA 5A8WB 3POTB 3BQ2A 4K4VA 2UXCF 3MM7B 3KHRA 4Z7CA 2YY3A 4NI2B 4ELTA 4ZKAA 1ZOTA 4DR2J 3QWUA 3NS7B 3SV4A 1RYSA 2P6SA 3WDOA 2QYGA 4ZVRB 1N33F 1AW0A 1T3NA 2HFZA 4ECZA 2V68A 1XTZA 4DSLA 4LSZB 1SQEA 2VG7A 1PKUA 4N5SA 2AMCB 2POKA 1TKTA 2V8GA 4PRFA 2FHMA 2DT9A 3Q23A 4JI4J 2YQ0A 3T9ZA 2RF2A 2HHXA 4DPUA 4QR2A 4CLUA 2PFFB 2RD5C 3EWGA 5HBMB 1NK7A 4OJ1A 2B6AB 1V3SA 3CDBA 4CT8A 1L3UA 1F60B 3ISNC 2R2SA 5D0GA 5KG0A 3MR7A 3CNQP 2PEHA 5EWFA 2RMLA 4DPTA 2MYFA 3NOGA 1NEEA 2GX8A 1WTBA 2HK3A 5HMZA 3DNCA 3MAAA 1X4BA 4NA3A 4OYPA 1RLDA 2MGZB 3MHYA 4X4PA 2EWHA 4K8RA 2EFVA 2VODA 4AQYF 4IH7A 4DUYJ 1C4AA 3V4IA 3VGUA 3FQKA 3NXZA 3LWLA 1I1GA 3CJSA 3CWJA 1URRA 3QNWB 2DKOB 4HACB 4MYTA 3JSRA 2D74B 3DHWC 1GTHA 4FS1A 2VPYB 2HYIB 1MN7A 4K4UA 5C2GA 1TAUA 4DV7J 2D7SA 2E7VA 4LRFA 3J7Z5 1WEXA 3EDQB 2JC0A 3CJ3A 4CT9A 2YWFA 4HKQA 3MUVP 2DXDA 3NNAA 3SQGB 3MMBB 2UUAF 1S6PB 3D4JA 1RHRB 2CKWA 3OVSA 1C0TB 1XQIA 4G1IA 1CULA 3KLFB 5DG8A 4A8MP 1AZSB 1WHYA 3OTBA 4MTPA 2A0FB 1GX6A 1RCXB 2KHCA 3BQ1A 3M32A 1VISA 4I6WA 1RAIB 4OZ5A 3SFUA 3GIMA 2DNLA 1XJWB 2ASJA 1RTZA 1EETB 2OUGA 1P9YA 1Q79A 2BJ9A 4KPCA 2CADA 3AXMA 2ZNZA 4ID8A 2BUNA 3LP0B 4OYZA 4RWXA 3M8SA 1M5VC 4RW7B 3TQEA 3V6HA 1UAWA 4CO5A 1UWBB 2HSEB 1WKJA 3FKBA 2DGVA 1CJKB 3ZNJ1 3TA2A 4WE1B 1UFKA 3G2XA 2ASLA 1DQ8A 1FVQA 3OTOF 1XMOF 3GYGA 2VASA 1FKPA 3D0GE 1WI6A 4JI0F 2EFGA 1RHQB 3I9V9 1M1KT 2MKYA 2WSEC 1NSKL 3BSOA 1GNKA 3PYEA 1HQEA 3D3CJ 1HNWJ 2CVEA 5FDLB 2RKIA 3CDEA 5F8IA 2RUSA 1C1CB 4GC7A 4PUOA 4NEZA 3MF5A 2I9SA 2MQPA 4XPEA 4B3TJ 1ZM9A 4KHPJ 4Q45A 1X4AA 5LJ3Y 1QAXA 1KOOA 3TA1A 1J2VA 2WHOA 4XK8C 5A6PA 1HW8A 2QSWA 3HLUA 2KG0A 3JYTB 3W7BA 4DL5A 1J5OB 3DRPB 4ED3A 4TYBA 4TN2A 3DGVA 4FXWA 4EMDA 4C8OA 4PAAA 3FC9A 1ZPWX 4N8OA 1TV6A 2XULA 1YSJA 4PG5A 4S0MA 3J7ZT 1NH8A 2G1HA 2ZH1A 2ZC3A 2EC0A 4ZVPB 2QMUB 4OZ2A 3AD7C 3DI6A 1B7FA 1K0VA 3EE3A 3GYXB 5L1IA 1EARA 2G4BA 5AJ3J 3DLBA 1UWAA 2JFKA 4IR9A 4ZIWA 4URQU 1VRTB 2V63A 2VJUA 2CPHA 5G4DA 3QAUA 1M5PC 1WC4A 4TLQA 3G6VA 4I67A 2K2PA 1UJ4A 1G4CA 1EP4B 5J2QA 1PAUB 4LF5F 3CCTA 2QMWA 4J9KA 3FMBA 2H4WB 2DNGA 3TZZA 5KFRA 3RAXA 2HVZA 4DR1J 1R3NA 2HHQA 1TELA 4LVOP 1ZH5A 3HFZB 1SC6A 2ZKTA 4DR6J 3N9UC 4AFFA 2AX0A 2CQHA 2A18A 1MU2A 2PGCA 2GO9A 3F73A 4F0HA 1RAGB 2R2TA 3FSYA 2BZ2A 2IA6A 5HMYA 2WVBA 2ATCB 3U02A 4K4XA 1BXNA 4O3SA 2XMMA 3G96A 4ELUA 1BC6A 1L5UA 2HQGA 3R2CJ 1K44A 4RO0A 4EYHB 4N47A 3NAHA 4KJIA 3GFXA 1F5AA 4PCQA 2VICA 4C97A 4GRSA 3KLEB 3VWSA 2ZWPA 4BLGA 4GKJJ 3HI9A 4MH8A 4P73A 2NXCA 5CCLA 1UVKA 2VF3A 3AQPA 3QT5A 2J0XA 1VI7A 1P1LA 2IDLA 4ELVA 1FJ7A 3I4HX 1PJ7A 1HBUB 4MKVA 4AL6A 2DXEA 4EFAC 5ETMA 4CLPA 5BXIA 2F3JA 3FGVA 1IKVA 4DR4J 2P6TA 1WF0A 1DQAA 3H40A 4Y2KA 2V69A 4ZPVR 1S9GA 3R5CA 4NEYA 4KB7A 2IPOB 2QFJA 1HNIB 2IC3A 3DDKA 1RQ0A 2HPUA 1F2HA 1M0SA 1Y00A 4DFJA 4YQWA 2M5YA 3SI8A 3M2UB 2ZOFA 1RTDB 3KMQA 4Y2AA 2FIUA 1CG2A 5AXKA 1I5OB 4PKDB 1HIYA 2E7XA 1W7WA 1YI2S 3MFHA 4ED7A 4J9SA 5KFKA 4B3MJ 3EUNA 2GJFA 1TP7A 4I0WA 5KFUA 5A8RB 2UUCJ 1NSPA 3RBZA 1XR5A 4A8SA 1IXKA 2HGMA 3I31A 2BRKA 1TL1A 2W7PA 4CZCA 5HL7Q 4JI6J 5L39A 1RTHA 4NLUA 5H9FK 2WONA 4DF8A 5HANA 2NXNA 2N3OA 2ZBQA 2HURA 2N3LA 4DR2F 1MN9A 5AT1B 2PN6A 2J76E 4B9MA 4UW2A 4LSNB 1U6FA 4AXJA 2Y1LB 5DO2A 4P9SA 4LREA 2QLJB 5A0YA 2ERRA 3UVJB 1DTTA 2HNDB 5H9EK 2BJ1A 1D3WA 1YRUA 4X4TA 3B8HA 7FDRA 3LTOA 2HFSA 4X4NA 4JI4F 2P9GA 1XBWA 3M6XA 4LRCA 2YNGA 5JJBA 4ZP7A 2XWYA 2Z2MA 4M5HA 3UDEA 2CQ4A 4K5RA 3DRYA 1T9VA 1YDLA 4NYPA 1U1OA 1R8HA 1EX8A 5KOXA 3QAEA 1OS5A 3BS9A 2B9YA 1RTJA 2LQBA 4N7TA 2ZKUA 2OMLA 4J9VA 1LEOA 4DG1A 3GMGA 1Q4RA 5A8KB 2DR8A 3S1TA 2H51B 3NAIA 1H3DA 1SKWA 4KKOA 4M63A 2MZSA 3NWGA 4ICLB 3JXOA 3KJFB 1K1SA 2KTQA 3MEDA 1UVJA 3THVA 3DN9A 4M5GA 1GMUA 5CCMA 1MWQA 1PO6A 3PO4A 2EBEA 5GADI 3I9ZA 2BR0A 4DUYF 2JEGA 2QLBB 3TOQA 5HN0A 2OPPA 5IT0A 4JV1A 2ZH9A 4OZ0A 4PXBA 1LXJA 4KTQA 3M8ZA 3KG4A 1BQNB 1S6QA 1HL6A 3CIZA 1RAJA 2HBQB 3C66A 2GVDB 3KLHA 4KH1B 4FF2A 4YP3A 4NCGA 2JVRA 4XIUA 4G3IA 4USJC 5D3GA 2B9EA 3ZZOA 2AGQA 1K1QA 2R7XA 4ILMA 4OFZA 1IBLJ 1ZTWA 2ZFHA 1KNZA 2RS8A 1KLNA 3IWLA 2W2PP 1NJIT 4OI3A 1SUQA 2NCKL 4GVBB 4RW8A 1I3OB 2HS4A 2F4FA 2CUYA 4HLBA 3GZ7A 1WTFA 2M0GB 2PIIA 3RW7A 2XWXA 3H5UA 1PBAA 2HFOA 4H4MB 4DCJB 3RW6A 2GFFA 2LP4A 5KFVA 2ZHOA 3VAKA 2RQMA 1WKLA 5F9NA 3C6TA 2CVIA 1QVGR 3L7UA 4K4SA 1JK9B 2DGUA 2BXJA 2E44A 3GILA 3GV8B 2VG5B 3IMQJ 4ZLPA 1L3VA 3UFCX 4DL4A 4KBIA 1S1UA 2R8KA 5BR8J 5GAHU 1S0MA 1NUEA 3MAAB 3PW0A 1N36J 3W65A 2AJFE 2Y1RI 4R5PA 1O6XA 3M6UA 5A76A 4F4XA 4OI2A 3CB4A 2G13A 2M7SA 1T94A 3QSIA 3AA8A 4I6AA 3OTEA 1SV5A 4IDKB 4RW4B 4WP9A 3JSYA 4DV6J 3RYLA 2BOPA 2JLFA 3C15B 2B4OA 1OSCA 3MPUB 3M2VA 1LK7A 5AE2A 1HNWF 2FTRA 2IRXA 4NLYA 4IOAQ 4J9RA 3R7SB 5GMDA 2E1AA 4YN3B 1EB0A 2AZ1A 2Q79A 4WTOB 3FCVA 2HHSA 5KG3A 4B3TF 4KHPF 4Y65A 4ETZA 2Z57B 2MLXA 2GAHC 1T9WA 1LK5A 1QVFR 4Y00A 5LSRA 4NRUA 3K5PA 3FEXB 2OPRA 4YEAA 3OLAA 3BH7B 4NYZA 5CQGA 4C0OC 1YBUA 2MZTA 1S7IA 3KG1A 1KC8T 3M2RB 1CULB 4CO0A 3CMES 2ZH8A 3RB4A 3HVWA 2JRSA 1Y5LB 3O44A 4DN0A 2LVWA 3R5AA 4RNNA 1X4DA 2RHSB 4V1Ak 4IH6A 1Q78A 5B09A 2KN4A 1LWCA 1AFJA 3ZTSA 3DYAB 2XS5A 3R97A 4TQSA 1RKJA 3H5SA 4QIGA 3D6HB 5AE1A 3PR4A 4X4RA 2YQ3A 3T6JA 1JQGA 4HHUA 1FKAF 1Q8LA 4H4KA 5IT9U 3SSRA 2JLEA 1UPMB 4USUA 2KT3A 3C6UA 1N0VC 1FEEA 1JLQA 1YHQS 2ALYB 2OFGX 1S79A 2QX0A 3UD3P 1U25A 3JSMB 2V50A 3FRZA 3VALA 1V6HA 1NHVA 2XZWA 4E8UA 4DR1F 3AJDA 4BBYA 1DURA 3GR1A 2J9CA 1Z2ZA 3MMCA 4J9UE 3Q8UA 1IR2A 1SC3B 1MMNA 5IFMA 5IC4B 4LUBA 4LIRA 1FKPB 3KTQA 3Q2SC 4JP8A 2DGSA 4DL6A 4ZVHA 3NCQA 4RW6B 3ONQA 3W2VB 1DHMA 4CNYA 4BCAA 2RKIB 4PWUA 3IAM9 4PUOB 2UXBJ 5HVHA 3NG8A 3AJ2A 4GKJF 5DGBA 4PG8A 3AY0A 4ZP8A 4ZMMA 4CM2A 1HI0P 4I6YA 5CYQB 1N5YA 2VQFJ 4DR4F 1T9TA 4LFAJ 2E29A 2EK1A 3I4PA 4IG0A 4KHMA 2ZZMA 2RIJA 2FZGB 2FVCA 4RL1A 1OPZA 3NS5A 4J9OA 4L74A 1TV6B 2D3ZA 4ZPBA 2CQ3A 1VQYA 2BJ3A 2X3DA 4DZDA 3H20A 1FXLA 5E2QA 3CTRA 2EG1A 2CZVC 3DI6B 2J7WA 2YH0A 2BBEA 1RABB 3LOUA 1RWVB 4B3MF 4C3KA 1BQMB 1G1XA 2BKNA 3GIKA 5DDRC 2K7KA 3OUYA 2UUCF 3C46A 3A3NB 5EGYA 2AQ4A 4IQXA 3OSNA 2IVFB 2FC9A 3MM5B 2HW3A 4USMA 3DMJA 2KHDA 3A8JA 3D67A 2ZUGA 4GO5X 3GJRB 1CJVA 4R8UA 5HK4A 5JVGQ 4M5DB 4QPTA 1CVJA 4K2XA 3OHAA 4DR5J 1XERA 3AXKA 3SDEA 4J9PA 2IM3A 4FF3A 4NRTA 3S7RA 3WIVA 2F5GA 1LW0A 3KHGA 2ZM6J 5KFBA 2L08A 2B0GA 2FYXA 2GIFA 1RADB 2XCPA 3UDLA 3RB3A 3O1LA 3H8YA 5DZ7A 2ZE2A 3HT3A 1T9UA 1Q86T 3TUIC 1RJJA 1VCTA 2B43A 1VDHA 3PY8A 1S1VA 4O3OA 3FVYA 4I69A 3GIIA 2WAQD 1H74A 1NM2A 2G0CA 2W24A 2OAUA 4HTJA 3H2LA 3AA9A 1KP6A 5CD4A 2FJVA 3AD9C 1RB0A 3ENVA 1B4SA 3MCOA 2QSFA 2F9DA 1EJ7L 1S9GB 4X4SA 1QLNA 4LF1A 4RJVA 1S1TB 1M1HA 2GQQA 3OW2R 1ZA2B 3UR0A 4DPXA 1X4GA 3OTCA 3E51A 4LRDA 3U1MA 3I6PA 2KKHA 4YY3J 1TKZB 4XO0A 4IFVB 3DCAA 2MKKA 2CQGA 2W25A 5B0CA 1JLAA 4Q0BB 4BS2A 4DLEA 2HZCA 4OQJA 2NUHA 4U7UK 4L76A 4CO2A 1HQ2A 2CJAA 2YX7A 4M5JA 1WHXA 2BJ8A 2CPIA 1AT1B 4EYIB 4B3OA 1IBLF 3AOBA 2ACYA 2F4VF 3BO3A 3MFIA 1RTHB 5I3PA 2WONB 3QSYB 1M90T 2C2RA 1UW4A 2NYHA 5KFXA 5F8NA 5A0YB 3ZZPA 1DTTB 5HMXA 4FNIA 2DGQA 1ZZNA 2LLZA 3RUBL 1ITPA 4DUZJ 3Q8SB 1G7CB 4LVNP 2QLFB 5J2PA 1SJ1A 3HVTA 1TL4A 5I3UA 4WFZA 4OYWA 3JAMU 2XM3A 2B8QA 2YNGB 1NPKA 4ZOSA 4WFNQ 3VAHA 2HBZB 4YHHJ 2HFUA 1JLFA 3R1LA 2R4FA 4EGLA 1O51A 1HW9A 1HD0A 2DNPA 1EIYB 1KHVA 3KXDA 1ZPVA 4DG1B 1VYAA 1QSSA 1Y3JA 5DRKA 4HH1A 4B17A 2BW7A 1QDUB 1S99A 3K5NA 2BV3A 1HHSA 4KKOB 5BR8F 1E6VB 5CYMA 4Y3CA 1N36F 3CCMS 4OI4A 1PYOB 2GMLA 4DPWA 1CJUA 4PYAA 2QRRA 1FRMA 2OPPB 2P9EA 2CQDA 3IWXA 1VQ9S 1Q8KA 1WEZA 4DV6F 2HQFA 2JX2A 2ZOGA 1ELOA 1G2EA 2F63A 2GV1A 4DSKA 4KGKA 2M2BA 4C3LA 4DUTA 1CJTA 1O0PA 2DR9A 1YRTA 4OZ3A 5D3GB 4KY3A 3BGRA 2ATLA 2ZH4A 3BH6B 3U7JA 1LFPA 2CWKA 4PEOA 3NLCA 5J2MA 2HS0A 2N7YA 3DOMA 1XK8A 4ZVOB 2KG1A 4OHVA 4RU2A 4E98A 3UPFA 3I0SA 3CUNA 4C2MA 1RP5A 3IP0A 3X3UA 4RZRA 5BYQA 4HEA9 4CLSA 1DLOA 4LF4F 4TY8A 3J7YI 2VDIA 2PD1A 4WXWA 4ZK7M 4YMEA 5ETPA 4RUBA 4BHQA 2DH8A 3RB0A 1U2RA 3JTNA 2LEBA 2ZJRQ 4L3KA 3FRYA 3RBEA 2LYVA 4C0BA 1B0TA 2IM1A 4O3RA 1VBYA 5BYRA 3C6TB 5K9FA 2IIHA 1RTIA 2XYGB 1H2VZ 2A6OA 3LP1A 4WK3A 3FQLA 5HQMA 1T9YA 2QE5A 4BC7A 4W92B 3A3OB 3GV7B 2I5JB 2CNNB 1S1UB 2UUBJ 1VRQC 1W2IA 2V6AA 3WX8A 1F3FA 4R5PB 5GADU 4M5KA 2CDQA 3M8RA 3CD0A 5IQ6A 2AGOA 4V19X 2BE2A 2MSTA 3DDIA 1MROA 5KFHA 3B4MA 1NKEA 3GIRA 5IZHA 2ACMA 3TI0A 3EGZA 4KRWA 3WQPA 2QTWA 2BEFA 4LIWA 3OLBA 2J6SA 1HWUA 5KFTA 1U1LA 2JWNA 1ZBTA 1VQLS 4RNOA 1H2TZ 3PYGA 5JXSA 1X5SA 4J90A 1HFEL 2UXBF 2DEJA 2ZEJA 5B0EA 1T05B 1NB7A 2CAJA 2PMHA 1NJYA 3W62A 3GONA 3QO9A 3IGNA 2YWKA 2Q43A 2B3TB 1KLMA 2W7AA 2MDAA 3QFWA 5THWA 3LALA 4P74A 3FEZA 4DOZA 2AYBA 2E9ZA 1NMEB 4YOEA 4F36A 3C2PA 2Z56B 4LFAF 2EFQA 5L9NA 3I87A 1SPBP 3D2WA 3H7HB 3D6TB 1OQ3A 2V67A 1MMLA 2K8GA 2MJNA 2XY6A 1UZHA 1DFDA 1HBNB 4R0JA 2WVEA 3W64A 4IO1A 1LWCB 2FD2A 4I2QB 1TUWA 2HMIB 1HKAA 2A6MA 3Q24A 4DQQA 1DARA 4WYLA 2YNIA 2OLWA 3W5XA 3DLEA 2OD6A 3KLIB 2WBMA 1RAEB 3UCUP 3ENWA 4OI6A 3W3SA 4PYDA 1FRJA 5A8WA 4IRKA 3H4DA 1RYRA 1JLQB 1FNMA 4ZN1A 3POTA 3Q2TC 3BKUA 3LO3A 4MIAA 3MM7A 4O3PA 3MM9B 1IBKJ 2N7CA 3CJTA 5A2QY 1QAJA 2QIFA 1HD1A 2GGPA 1VBKA 5BYSA 3MPYA 3MMCB 3HDSA 2DHXA 3B4DA 1HBOB 1GMWA 2OH2A 1RI7A 4Y28C 4DR5F 4X4QA 4O3QA 3MPVA 2BM0A 3OJSA 4P2SA 5KG7A 1FEHA 4NLTA 3H5YA 3D1HA 3FEYB 3ZO7A 5RUBA 2WOMA 4CTAA 5HJYA 1RA6A 2ZM6F 2VKRA 4RU9A 3U27A 1S4EA 2EFOA 2MB0B 2OJ3A 4RUCA 4DV0J 3MXHP 2COLA 5IC6B 2ZBRA 3D7SB 3WX4A 2M88A 3P4UB 1D9AA 1N5YB 4OHZA 1FE4A 1GFWB 1WEYA 2XLKA 2DNQA 2JJ4D 3H25A 3PCOB 2OMOA 4CLFA 2Y9HA 3EZ5A 2YPZA 2MGZA 2IBOA 5KAKA 3IC1A 1SQFA 3DLHA 2ABYA 2NZCA 2AYGA 3DHXA 3Q22A 2XLIA 4MFBA 3KLGB 2CNOB 2RNEA 2CQPA 2XHWA 3GWCA 3UD4P 2DNHA 2N82B 3NWRA 3LPEA 2IMOA 1S9EA 5CYJA 1FRHA 2E5LJ 1ZAXA 1SXLA 2GMJA 4G65A 3HHLC 7FD1A 1CEZA 3LGMA 4YY3F 4HACA 3OQ2A 1WC5A 6AT1B 4ZLLA 3EXYA 1UL3A 4OYIA 3AB4B 2RQCA 1ZM2A 2UUWA 5KT4A 1FX4A 2O5DA 3GB0A 3HM9A 3DLGB 3QT6A 3CDWA 1M5HA 2J9DA 2AHOB 2RDDA 3N4WA 5D15A 3R8YA 5B0BA 1H7WA 3QT7A 3SXLA 5F41A 3MMBA 1V5VA 3T9NA 1VC5A 5SUHA 1S5ZA 2OEKA 3IFEA 2W4CA 2H3EB 2DNYA 3VTIA 1AA1B 1N33J 1C0TA 2OPQB 2JDJA 4U8YA 4ZLJA 4R8UB 1HWKA 4PQUA 2MEWA 4P75A 2M70A 1V5IB 4DI6A 3Q8YA 4DX6A 2IAJA 2V4QA 5FLXY 1S6UA 4DUZF 1D8ZA 1R27B 2WK4A 2RUGA 1I51B 9ATCB 5HP1A 2FUG9 3S01A 1TTHB 1YITS 1HA1A 3JSBA 4CLWA 4F3QA 3LA0A 3PG9A 2E1CA 1SL1A 2MQOA 2ZE2B 3LP0A 1VMBA 4YHHF 1YJVA 2I1RA 2IRUA 1IR1A 1NSQA 2GHPA 3KKFA 4LF2A 2R7UA 2QYCA 1UWBA 5F3ZA 3T19A 4BDPA 5I42B 3W9HA 3P5BP 2P5VA 1HNZJ 3A12A 4LR9A 8AT1B 2HRYA 3TZXA 1FHTA 3BKTA 1MW7A 1PC5A 3GJSB 3MMJA 3G6YA 3MR2A 5F8GA 3GFZA 2HG4A 4JI3J 4OV6A 4LFBF 5EN1A 2W01A 3T1AA 2YKNA 2NUUG 5B08A 3BBCA 4ECYA 3MEEA 5HROA 1Q5VA 4H54A 4ZDNA 2MLYA 1VIOA 3BYRA 2R9LA 4YB6A 3DRSA 4DCOB 2KXNB 1N6QA 1C1CA 1KTVA 1UFWA 4PXDA 2J8SA 4OJGA 2E5GA 1JLAB 2NPFA 3A8EA 1R6YA 2Y1JA 4ED8A 3TWZA 1S0NA 2VC0A 2HS3A 2KJWA 2CRLA 2R7QA 1U47A 2YNHA 1OY6A 2OP5A 1WC0A 2DGWA 3HULA 4B3OB 4USVA 2DIUA 3KYLA 1BLUA 2ZJPQ 3DM2A 5AXNA 3K8WA 2XZDB 2L41A 2Q6CA 3M05A 3JYTA 1KVKA 2DITA 2GQ2A 1J5OA 4FF1A 3A8KA 4M5LA 3I5BA 3IR5B 5KFPA 2DNNA 1ZYQA 2J9DE 5EDWA 2VFTA 1D9DA 2VD3A 1RZMA 1CC7A 3AQOA 4Q8EA 3J7AN 3VGVA 2BKPA 3FUYA 3HVTB 1S0VA 2MQLA 2RHQB 2WVFA 2HWIA 3M8PA 1VRTA 1KFDA 4ALZA 3VGTA 2LQJA 1NK4A 3J81Y 4TKTA 1NHUA 4MIWA 1GMWD 3QFHA 2HQCA 1JLFB 2ZOMA 2HIQA 3QGGA 5C24B 2VB6A 1C4CA 3ZTQA 4CWBA 4HHJA 1RAOA 3UNYA 3W9JA 4K50A 1FF2A 4GMKA 2FHJD 4G1QA 3RR8A 4F25A 5CD4H 3HHLB 4ZJQA 1WORA 4ZVTB 3W5ZA 1TVRB 4PWWA 1MLAA 4FYXB 2C2ZB 3OJUA 3CJ2A 3ZZYA 1OYDA 5CYMB 2F40A 1VQ5S 3OTOJ 3QIDA 3BM7A 4WFXA 3PJWA 4C8ZA 4JI0J 1FJGF 2DBBA 3NMRA 2FJWA 2FHKA 5K14B 5KFEA 1OO0B 3PTWA 5ETQA 5AE3A 2V4RA 1TFWA 3P49B 4UOHA 3M1VA 2ALZA 2BDPA 1CS4A 2O3DA 3VF0B 2OFHX 3THTA 3FBEA 5ETVA 1R8PA 3BQ0A 2P9CA 3AB2B 2QT7A 4CNZA 4KYZA 4QZVB 1CJTB 2UUTA 1FX2A 3VVTA 5E33A 2WSCC 4FVMA 2CZ4A 1WC3A 2W2MP 2HEKA 3JTOA 5IM0B 5KFSA 2QA4G 2ZWOA 5IOLA 4OI0A 1N56A 4AT1B 3VQSA 3C8YA 4HHHA 2M4MA 3BPSP 3HKWA 3CC4S 3I0SB 3TP2A 3IA0A 4EBCA 4WZQA 4YB5A 3SIPB 1DLOB 3MEKA 3BR9A 2W9CB 3M2UA 3BSNA 1RTDA 5JUMA 1YJWS 3DLJA 2XS7A 4C8KA 4XDDA 3EGVA 1RSCA 1U1QA 3LANA 3R7BB 1UA1A 1YGYA 5HVGA 4FNHA 3V6DA 3Q0AA 3FMWA 2OTJS 3PACA 3BEGB 3FBFA 1ZETA 5J2NA 3T5JA 3PNIA 4YFUA 1VRUB 8ATCB 4FN5A 4F7VA 1RAAB 4XAKA 3ETMA 1DBDA 3I55S 3LP1B 2MPUA 2XSFA 2HBYB 2FJAB 5EWGA 4UOGA 2LEPA 4WYWA 4NE9C 2ZBCA 3NNHA 3K7RA 1IBKF 1QM9A 3RR7A 4LJMA 1K8AT 3NGKA 4IFYA 1G6BA 2BM1A 2IHR1 2X1FA 4LSNA 5KFYA 1UVNA 1QUVA 2C3OA 4I2PB 1NCLA 3A8IA 4CLKA 2BE9B 2DPIA 2DH9A 1CC8A 2BE2B 1MROB 3UDVA 1LXNA 2RJZA 4QWDA 2IRYA 4CLYA 3R7NB 2B7BB 4QU7A 1NJWA 3CJRA 3TVYA 3BGUA 1C1BA 4DZ6A 1LQ9A 1N88A 1JLBB 4HDGA 2AEMA 2C3PA 1TK8A 4LF7J 2QZ8A 2JOQA 1Q5YA 4YDDB 2VOOA 1HBMB 3DOKB 1KLMB 2O1PA 4FXVA 2VC1A 3I96A 3L3CA 1D9FA 4PG7A 1PYTA 2MKCA 4NCAA 3T1YJ 5CHCB 2YH1A 1M5KC 3JAMY 4ICLA 3QWPA 4Y6IA 4Q5VA 1SC4B 3J81j 4DHVA 1VQSA 3Q86A 4OZNA 3J7A1 2PC6A 3J7YU 1RWOB 1NDLA 2LMIA 4V19J 1KDNA 1ZM3A 2E5LF 5LSOA 2WCXA 3HVRA 4NX9A 2Q1LA 3M6WA 1X8DA 2GVDA 2QA2A 3DLEB 3N6NA 4U7CA 4YR0A 1U0SA 3V81A 3ISND 4ERDA 4YDXA 3EGWB 1PSDA 2UVRA 1ZS6A 3D6MB 2DH7A 2K1RB 1HARA 3BSAA 1JJHA 1H0HB 2FZKB 2F65A 5F0UA 4DPOA 2QMXA 4GVBA 1JLGA 3MD3A 2GGPB 3RGIA 3BF4A 1GXTA 3JB9k 2XY5A 5ETSA 3IN5A 4QU6A 6FDRA 4JOUA 2XNQA 2JNJA 4Q2LA 1Y5NB 3L7OA 1WI8A 1RT2A 2XSJB 2VKZG 2WOMB 4H4MA 4CTAB 1M5OC 1OQ6A 2UXDJ 1AXQA 3MECB 3CGIA 3OFEA 5GMKa 3OR1B 2LA4A 2UVVA 1RT1B 1GT8A 2GC8A 3F41A 1RA7A 4OZJA 2Z2LA 4ETXA 5KFDA 1PIEA 2QA1A 4ENOA 2VG5A 2DRBA 3B54A 1LWFA 2HLTA 3R5JB 1SBRA 1UA0A 2XG8A 4YB7A 4DS5A 4AE5A 2E5JA 3D68A 2ZNYA 2G2OA 4DSEA 1AROP 1HNZF 2AJQA 1T95A 2LQ5A 1FA0A 3WZ0A 3V4MA 1UMJA 3P6YC 1K73T 1NRKA 4MFBB 1KFSA 3HJFA 2GJIA 1XN9A 1F9HA 1YQHA 4JI3F 2NREA 4IDKA 4RW4A 1S9EB 1S48A 3FFIB 3CJ5A 3C15A 3DOLB 5KFMA 1IJEB 3H0PA 4Y2IA 1FT8A 3H2VE 4QIVA 1REVA 4DPYA 2PT0A 2AX1A 2I8EA 4GKKJ 1IUJA 4UZCA 4ZVFA 1EQMA 3M9MB 2I0XA 4KFBB 3KK2A 1N34J 1U1MA 1Q8IA 5L38A 3AFGA 1SL2A 5DLFA 3BDEA 2AIRB 2X1AA 3AH6A 2ADCA 2A10A 4URGA 4OYOA 3EM1A 2AGPA 3HPOA 4B9TA 5F3TA 1RISA 1ROFA 2RQKA 2A1BA 3M2RA 5HSPA 1JB0C 2XMTA 3MI7X 4PQUB 1NAQA 2EXUA 4FVCA 2FGCA 2OEMA 4FS2A 1T0TV 3G87A 4ATNA 2DHSA 2KXHA 2IAJB 4I7FB 1R8CA 3LGNA 3OHBA 4K4YA 3DYAA 3QQCD 1NPPA 2BKOA 3OPKA 4M5NA 5HP1B 2GZOA 1FXRA 5A6WA 3C3LA 5KT2A 4K2JA 1YX2A 1MNEA 1XC9A 4X65F 1S10A 3UQSA 4A47A 3GCWP 2R7TA 4Y0FA 3Q8RB 3BJYA 3CE8A 3JSMA 2CQ2A 1R0AA 2FC8A 2CYYA 4O4GB 4I4BA 4L72B 4ED5A 4FPIA 1M1GA 2FY1A 2BW2A 4PG4A 3M8QB 2Y8YA 3UN5A 2CQ0A 1X4HA 3R3TA 4CH0S 3GQCA 5KG6A 3ZZRA 3ADAC 4RW6A 2YKNB 3OL6A 1FDBA 3PR5B 3MEEB 3W2VA 5HROB 2MZJA 5KFJA 4USHA 1X9SA 4YUDA 2IJRA 2W4DA 1HR0J 3DRSB 1N6QB 3Q83A 2N4DA 3ET6B 2YX4A 2HWTA 2QL5B 4ECTA 2FHOB 2YWGA 1ZM4A 4IG3B 1R43A 3VZIA 4DMZA 3A13A 4I64A 1UW9A 2XGPA 4Q43A 2YNHB 2HAIA 5CYQA 2R8IA 3DM2B 2VIHA 1RUSA 3P96A 2BQUA 4UQTA 2HVHA 3LP2B 2FJDB 2HHHJ 3M7VA 4NA2A 2JVOA 4DV2J 1ICEB 3GG1A 3HSJA 1H72C 1U1NA 4NLWA 2MMYA 1RWUA 1FE0A 4ZVSB 4DX8H 1V3RA 2R7WA 2B9WA 3OL8A 4X64F 1VHFA 3N5FA 3BKFA 1K47A 5DJBA 3M8PB 2D1CA 3RRKA 2I6WA 1U0HB 1BQMA 2D3O1 5ETTA 1JJ2R 3KUGA 5F8HA 2DGXA 5DQIA 3EPGA 1PAEX 2VOPA 1OY9A 2DK2A 3I56S 4I1TA 4OHWA 2M3DA 1NSAA 1D1UA 2HZAA 2BQRA 5HI7A 4RBUA 4G1QB 1X4EA 5D4LA 2DHHA 3BO4A 4RBTA 5K8NA 1IQTA 2C2MB 2CZ9A 3MM5A 4FKYA 1HHQA 2ZH5A 3HHDA 4K0KJ 4M94A 4F26A 4A46A 3N79A 4OJ3A 4CYUA 2IVMA 4A8KA 1NJZA 4PXEA 5LL6d 3ILOA 3Q8VA 4M5DA 4E0DA 1RWKB 2Z30B 2D9OA 3TUZC 5M2RA 1KS2A 1FNXH 5LT5A 4LSLA 3MM8A 2CPXA 4NXNJ 4ZCIA 3CCRS 3M1VB 5H9FJ 3AT1B 4O0IA 1YBTA 2CFXA 1CS4B 3VGSA 5DS7A 4KHRA 3R5DA 2R7OA 1RE1B 3TX8A 5H9EJ 1MSWD 1C2PA 4LF7F 1IKYB 2CPYA 2PSZA 1NK9A 1WNEA 1D8YA 2GIQA 3NL0A 2RRBA 3CD6S 3VCDA 1GK8A 2YNFA 1Y7PA 4MKBA 4JB8B 4K4TA 3MCNA 4NLSA 4B9VA 2V2KA 5CAAA 3CJKB 3PRVA 5C42A 3T1YF 2DTJA 1U02A 1T7PA 1Q53A 2SXLA 1FXDA 1IM4A 3AODA 5J1NA 4ANDA 5MAOA 3PV8A 1S1TA 3M9OB 3T5KA 3EZUA 2F8EX 1FI4A 2JSXA 3BGFA 1VBXA 3GV5B 5B0DA 2ZJQQ 4LF9F 4M5IA 4B3RJ 3JQJA 2XCAA 1TKZA 3OXGA 1OIAA 1J27A 3V6DB 4IFVA 4NLOA 1B64A 3PRBA 1F9EB 3W1YC 3IS9B 5GAGI 4QWAA 2EC2A 3QMQA 4Q0BA 5J2NB 4OLPA 1X31C 4DQPA 4U96A 3BZQA 4DFMA 2HNYB 4CH1A 5KFGA 3ZFVA 1T11A 2RDJA 2HHPA 3L9ZA 3G8SA 1HYSB 3DLKA 4IFYB 1S49A 4TVAB 1KSPA 1FDAA 1NDPA 2YKAA 1JLEB 1XMQJ 2CQIA 3O6QA 4AD6A 3PRDA 3HHKA 3LWMA 3OV7A 1CBKA 1RHJB 2PA8D 4WZMA 2YKPA 4LF8J 4WF9Q 2W2NP 1IKXA 4WBFA 4WIQA 1C1BB 2UXDF 1HMVA 1JWWA 1RT3B 2C3MA 1S0OA 3ENAA 2HIYA 2LU2A 4FF4A 4MMOA 1LFWA 3KNAA 1IBCB 3CCVS 1KEKA 1R8AA 4TU7A 2QEXS 1FTRA 3PW7A 2NS1B 4NLXA 2B4PA 3KK1A 3MZIA 2XYPB 3OR2B 1KVIA 1S1WA 3G8TA 2MKIA 2O01C 3OL9A 3L4BC 2HZVA 1VOMA 1T03B 3S6EA 3SSSA 3TJ8A 4PWDB 1E6VA 2XY7A 1TL7B 1F1BB 3TQ1A 2M8HA 3RBXA 2L48A 1K0TA 2DJWA 1X0FA 3FSIA 3IBFB 2XMKA 2LXIA 5F8MA 4DFKA 3UNGC 2E5HA 1U4BA 2MHNA 5A2QU 4K7QA 2E1PA 3HSZA 3PW4A 4P2MA 1KHWA 3GPAA 1C0UB 5DDOC 4LRAA 4ED1A 4GKKF 1LW2A 1KN6A 1VR6A 4CP5A 2EI5A 1RAHB 3V81B 1T3OA 1JLCB 1RK8A 2PI5A 4P6QA 1KOHA 4K4ZA 4RNMA 3D54A 3ICLA 3RRHA 2F8MA 4C11A 1N34F 1SQGA 2F4VJ 5IS2A 3TUJC 5KFCA 4O3NA 3ENQA 1VIXA 2EK6A 3IM9A 2CNKB 3MD1A 1DTQB 4PQAA 4QIFA 2V8DA 1WUUA 1XMBA 4RUHA 4KGZB 1JLGB 2OELA 2AEJA 1I94J 4U95A 2VFVA 4W4MA 1IKWB 2RILA 1FJEB 3DXSX 3HT0A 4A8WA 2EFNA 2MY7A 5G0RB 4C8LA 3C19A 4CH7A 2YWWA 1TFYA 4FYWB 1S9FA 1RT2B 2ZD1A 1JXVA 2XYHB 1NB2A 4J9LA 2JEIA 3BPDA 4ZITA 3CDAA 3BSCA 4F0KA 4FZVA 3LF0A 2W4PA 4NZ0A 3L09A 5JMNA 2PI4A 3GYNA 1DQ9A 4C8NA 4G6VB 3OXFA 1LWFB 1VC0A 5DETA 1EZZB 2R2UA 2I5JA 2WTFA 4ER8A 1WOOA 3P8BB 4LQ9A 5GAEI 3ZTOA 1SJRA 3IBCB 2DY1A 1SVDA 2LFVA 2QN6B 2VU5A 2V8PA 4TU9A 4FYDA 1K9MT 3CPWR 2MKJA 4C4WA 2JEFA 1XEZA 5IXUA 1UETA 1QSLA 3MPWA 2GHVC 4B9UA 4QYRA 4EEYA 2MJUA 4GO7X 3FZ2A 3V6KA 1SJQA 1T02A 2KZMA 5KT6A 4DL3A 4LT6A 3HFKA 2C1EB 3MCSA 1HR0F 1NK5A 2K3KA 2C2KB 1REVB 3SZ2A 1TAQA 1T05A 3ZZZA 3PFOA 4C8YA 4J37A 4WFAQ 3K8VA 1VK8A 1OWXA 5SZTA 3KK2B 1MWYA 2E1RA 1WSVA 2VQEJ 5FLXU 2GMHA 4FYVB 2EBGA 3TEGA 2HAFA 1FKOA 4DSJA 3RBDA 2K7JA 4ILLA 3L95X 3HVAA 4ZVQB 2BJEA 3K5LA 4DU7A 1Q7LB
chains in the Genus database with same CATH topology
2HHHF 3UR3C 4NCBA 2OPQB 1MMDA 1FJCA 2JDJA 4R8UB 1FVSA 1HWKA 2R2TA 3FSYA 2BZ2A 1TL3B 4DV2F 4PQUA 2IA6A 5HMYA 3WC2A 3U02A 2MSSA 2J0QD 4K4XA 1Q7YT 1NK6A 2M70A 3R27A 3J80Y 4O3SA 3QGIA 2DHGA 2XMMA 2YKQA 3G96A 3HMJG 4ELUA 2C28A 2IAJA 3GE9A 2KYZA 2V4QA 1U6BA 1HBNA 1BC6A 1L5UA 5FLXY 1S6UA 4DUZF 1D8ZA 1S6QB 4AUKA 2AV5A 1R27B 2WK4A 2RUGA 2WBRA 3NRBA 1VQ7S 2Z4PA 4I2QA 4N47A 4EYHB 2CPZA 3NAHA 4NA1A 3PKYA 2HMIA 3GFXA 4KJIA 5J1EA 2N4CA 1N48A 5HP1A 3KLHB 2ROEA 2FUG9 2BJDA 2AP6A 3S01A 1F5AA 4PCQA 3PEHA 1YITS 4C97A 4NCGB 1HA1A 3JSBA 4F3QA 5T41A 4RLEA 3DFEA 3KLEB 3VWSA 5EX0A 2E1CA 1SL1A 2AJ4A 3I0RB 2MQOA 2ZE2B 1YJRA 3I82A 3HI9A 3KLIA 3LP0A 4MH8A 2FDNA 4GC6A 2LA6A 5CCLA 1UVKA 1C0UA 1VMBA 4YHHF 1FRXA 3AQPA 4DV3F 3NBPB 1F2GA 1YJVA 1NZAA 5KFNA 2I1RA 2J0XA 3NS6A 3RAQA 3IWNC 2IRUA 1VI7A 1P1LA 3K57A 1U48A 5C25B 2GHPA 1JLCA 3KKFA 4ZPDA 4ELVA 2R7UA 1FJ7A 3I4HX 3CC7S 3PIPQ 1HBUB 2QYCA 4DV5F 5DG7A 4AL6A 5DM6Q 4EFAC 2R7SA 1U2FA 2F3JA 1UWBA 2J6UA 2GQCA 2GW8A 5F3ZA 3FGVA 1SUQB 3T19A 1SIZA 4BDPA 1IKVA 3SYZA 5I42B 2XGQA 2DRAA 1R0AB 4RW8B 3MM6B 4ECSA 3G71S 3IO1A 4Q44A 2OD4A 1CQNA 3MM9A 2P6TA 1WF0A 1RKIA 2P5VA 1DQAA 1KQSR 3H40A 4Y2KA 3MR5A 3CMAS 1TUVA 1DTQA 4JV2A 4ZPVR 2HRYA 3BDPA 4IYQA 5L9XA 1S9GA 3R5CA 3TW0A 5IT4A 2FLOA 4KB7A 4K0KF 2QFJA 1FHTA 4DN9A 5KFOA 1HNIB 2IC3A 3O2IA 5I4MA 1MW7A 1PC5A 3DDKA 1RQ0A 2RB7A 3VAMA 3ZC4A 2AW0A 2HPUA 1M0SA 2OIHA 2NYIA 1Y00A 4DFJA 1IKWA 4YQWA 1FTCA 1FDDA 2M5YA 2ZOFA 3M2UB 3MMJA 1HBOA 4ZVEA 2B4UA 4ZCKA 4YB1P 3G6YA 3MR2A 5F8GA 3GFZA 1U1KA 4Y2AA 2HG4A 2J0SD 3FZBA 2FIUA 2JHEA 4HTIA 4LFBF 5EN1A 3TAMA 5G0RA 3T1AA 4DEZA 1CG2A 2YKNA 2NUUG 4M1KA 5AXKA 5B08A 3QZ7A 4DSIA 1SJ3P 4PKDB 4ECYA 1FESA 3MEEA 4DQSA 2E7XA 4F2SA 5D77A 5HROA 2A2DA 4H54A 4ZDNA 1YI2S 3MFHA 4ED7A 1VIOA 3RB6A 3CCZA 2WRMA 4NXNF 4J9SA 5KFKA 4YB6A 1PC4A 2R9LA 3DRSA 3EUNA 4ZP9A 2KXNB 3HK2A 1N6QA 1FD2A 1FD8A 2KJVA 1TP7A 1VJWA 3QIPA 2R7VA 2J8AA 1C1CA 1KTVA 2VFSA 1Q16B 1UFWA 2V4JB 4PXDA 4UY85 4I0WA 1KQKA 1SL0A 3SCIE 2HWHA 4OJGA 1KR4A 2E5GA 5KFUA 5A8RB 4QR1A 1JLAB 4JYAF 2NPFA 1PGZA 2H5EA 3A8EA 3NMAA 2XMJA 1R6YA 1SI9A 1XR5A 2Y1JA 3M4XA 2NR0A 4KC5A 2E9TA 1VQKS 1WG5A 4A8SA 4QWCA 2XB2D 4A8FA 1IXKA 2HGMA 3I31A 4ED8A 2GA7A 2BRKA 1S0NA 1TL1A 1JKHB 2Z0GA 3CCQS 2W7PA 4CZCA 2QA4S 1VQPS 2VC0A 2HS3A 2HHTA 2KJWA 2CRLA 2R7QA 4HT7A 5HL7Q 3KNGA 1U47A 2ZC4A 4JI1F 2YNHA 2OP5A 2DGWA 4DDFA 5L39A 2KVIA 4B3OB 4X62F 5EHHA 2CPDA 2DIUA 3KYLA 1BLUA 1RTHA 2ZJPQ 3DM2A 3HZGA 4NLUA 2Y1IA 4IH5A 5AXNA 1R89A 4CIOA 2WONA 3K8WA 2L41A 4DF8A 2Q6CA 2N3OA 1BQXA 4QIWD 3PIOQ 2N3LA 1NKCA 3M05A 1TKDA 2CJKA 4OLOA 1UP1A 1Y5IB 3JYTA 4DR2F 2DITA 2GQ2A 1J5OA 2GNKA 2PN6A 2J76E 4B9MA 2OTLS 4RX6A 4UW2A 4FF1A 4KO0A 4LSNB 1VC6A 2BANA 1U6FA 3H59A 4DL0C 1HI8A 4AXJA 1LKZA 1RT7A 2RVJA 5DO2A 3I5BA 4O23A 4QBUA 2E9RX 5A0YA 2ERRA 1YJNS 1DTTA 2HNDB 1MWZA 2OPSA 2NPIA 3IR5B 4FPRA 2V94A 2A3JA 3KMSA 3K5MA 1S6OA 5KFPA 1SV5B 3ETOA 3G8QA 2DNNA 1D3WA 4DJBA 1ZYQA 1YRUA 2GO8A 2J9DE 5EDWA 4X4TA 3B8HA 2VFTA 3KLGA 1D9DA 7FDRA 1HNVA 2VD3A 4U6PA 3EYZA 4MK9A 4F02A 4ES2A 1CC7A 3AQOA 1WHVA 2ILZA 3TANA 4Q8EA 4F50A 3SI8A 1FRLA 4X4NA 4ZCLA 1H6KX 3M2VB 5U47A 5E3PA 4JI4F 2P9GA 1XBWA 1QTMA 1FK9A 2PE8A 2IJNA 3HVTB 3M6XA 1S0VA 5FJ4A 2VBWA 2YNGA 2V9KA 5JJBA 5DGAA 2VPWB 4ZP7A 2XWYA 2Z2MA 4B3RF 2MQLA 5LSLA 3MAQA 2HWIA 2KRBA 3M8PA 3WBZA 1VRTA 4YR2A 2CQ4A 4DQRA 4K5RA 1HQUB 1KFDA 4ALZA 3KJVA 5LMNF 4DF4A 2LQJA 3O3LA 1NK4A 1CSJA 3DRYA 1NK8A 4NYPA 4QIEA 3J81Y 1U1OA 4TKTA 2R8JA 1R8HA 2B5JA 1NHUA 2LXFA 4MIWA 4NYOA 3IRXA 3OFFA 2ZH2A 5KOXA 2FVQA 1DAXA 3QAEA 1JLFB 1OS5A 2HIQA 2ZOMA 3RRGA 3CD7A 3O8WA 3HX9A 4OL8A 4HL9A 3QGGA 4IOCQ 5C24B 5DQHA 2VB6A 1C4CA 3SCKE 3BS9A 3KG0A 4OZ1A 1VFJA 4HHJA 2B9YA 1RTJA 1SH2A 3CVKA 3ISZA 1JXLA 3EGNA 4AL5A 2CPFA 2LQBA 3BN4A 2ZKUA 2RRAA 4K50A 2RQ4A 2OMLA 1FF2A 4F4ZA 3LQVA 2MQQA 4DG1A 3DLGA 4WU2A 4GMKA 2FHJD 3GMGA 1RDRA 1Q4RA 4G1QA 5A8KB 2DR8A 3RR8A 4F25A 3S1TA 3KHHA 4RNHA 3NAIA 5K5MA 5KG5A 5CD4H 3HHLB 4QWEA 2OPRB 2FLNA 4ZS6A 2VQFF 1H3DA 1TVRB 1SKWA 1D0EA 5KFIA 4KKOA 4M63A 3BGLA 5B0AA 2MZSA 3NWGA 3IG1B 3OJUA 4ICLB 3CJ2A 2U2FA 1YJ9S 3ZZYA 4M8LA 1K1SA 5CYMB 3Q8PB 1HPZB 1M5SA 2F40A 4ITSA 3PXGa 1VQ6S 2KTQA 3MEDA 1DZ5A 2UVWA 3PX4A 3MOZA 1VQ5S 1UVJA 4ECUA 3QIDA 1KQGB 3BM7A 1VQ4S 4WFXA 1BY9A 3THVA 3DN9A 2IYGA 3PJWA 5CCMA 1PO6A 4OMFG 3MR6A 3PO4A 2OPQA 2EBEA 5GADI 3I9ZA 2VBXA 1W2BR 4C8ZA 1N5TA 2DBBA 1FJGF 5T7LA 2BR0A 4DUYF 1VBZA 2JEGA 2VA3A 3NMRA 2IM2A 2FJWA 4DS4A 4EZ9A 2FHKA 3TOQA 5HN0A 2OPPA 1XMQF 4DV1F 5K14B 3CSKA 5IT0A 4JV1A 5KFEA 2ZH9A 4OZ0A 4KT0C 1QJHA 4PXBA 2DPJA 1LXJA 1OO0B 4KTQA 5AE3A 1FDNA 1S97A 3KG4A 2KU7A 1BQNB 2KXFA 4U67Q 2V4RA 1TFWA 4HT5A 4LSLB 3MM8B 4EU0A 3P49B 4WXOA 1S6QA 1HL6A 3CIZA 3I5AA 3M1VA 3SFGA 2ALZA 2BDPA 4OV1A 1GH8A 1RAJA 4ILRA 2O3DA 1E6YA 2MKSA 3VF0B 1F9FA 3IRWP 2CPEA 3GG0A 2IMWP 4OHXA 2F8HA 2OFHX 3THTA 3C66A 1J5EF 2LECA 3KLHA 4OZLA 4FF2A 2FLPA 1R8PA 4LF8F 4YP3A 4NCGA 2JVRA 4A8XA 3BQ0A 4ZPCA 2P9CA 4XIUA 1S77D 3AB2B 2FJXA 1NO8A 2QT7A 2LKZA 1IJFB 4CNZA 4G3IA 4QZVB 2UUTA 3I0RA 3KOAA 3PDNA 4USJC 1WF1A 2W9BB 2E5IA 5D3GA 3C6UB 3ZZOA 2AGQA 2VG6A 1K1QA 2R7XA 1FRKA 4EO6A 4ILMA 3VQTA 5LXRA 1YIJS 5E33A 4OFZA 5KFWA 2WSCC 4FVMA 1DJ0A 1HNXF 2BVZA 5C25A 2CZ4A 3CO9A 1ZTWA 2VPZB 3CC2S 2ZFHA 1JXEA 1KNZA 2RS8A 2C2DA 1KLNA 3K59A 1SIWB 3IWLA 2YKMB 2YNFB 1NJIT 4OI3A 3JTOA 4RKUC 1SUQA 4OHYA 1TR0A 5IM0B 3IXQA 5KFSA 5I42A 4RW8A 3MM6A 2DHAA 3G4SS 2QA4G 2AJ0A 4OI0A 2LDIA 1UEVA 1N56A 5EX3A 5E3CA 2YWEA 3VQSA 1Y4ZB 3C8YA 4UY8T 2APOA 2KI2A 2M4MA 1JNZB 3B82A 2HS4A 5C42B 3HKWA 5EUHA 2VBYA 5JVHQ 3CC4S 3N28A 3I0SB 3I32A 3TP2A 2W8KA 5KTQA 4URSA 3IA0A 1HWJA 4HLBA 3MR3A 4EBCA 4WZQA 4YB5A 3GZ7A 2IM0A 1DLOB 1NJXA 1WTFA 3MEKA 4Q2MA 3VAJA 3BR9A 4FBUA 2KO1A 2MZQA 2W9CB 3LUYA 3M2UA 2M0GB 3BSNA 5JUMA 1RTDA 2DR7A 3PX0A 1YJWS 3AAWB 2PIIA 3DLJA 3KK3B 3RW7A 2FJEB 3E01B 2XWXA 2DIVA 1FCAA 3H5UA 2XS7A 4C8KA 4C3MA 3T3FA 4O4RA 1QAIA 1SKSA 2HFOA 4OX7A 2VFRA 4XDDA 4H4MB 5F0WA 3RW6A 4HVZA 4ZCMA 2GFFA 1RT5B 4ED6A 1U1QA 3LANA 1UA1A 5KFVA 1YGYA 1YJUA 5HBMA 4FNHA 3V6DA 1T8EA 2B6AA 3MTKA 3Q0AA 4KPYA 3RU0A 2WB1D 3WC0A 2ZHOA 3FMWA 2OTJS 3PACA 3VAKA 4K4WA 3BEGB 4KSEB 4NZ6A 2RQMA 5F9NA 1ZETA 5J2NA 3T5JA 1R8BA 3C6TA 3PNIA 2CVIA 4YFUA 3QLHB 4CO3A 1XNRF 1QVGR 4X2BA 1VRUB 3D1QA 4K4SA 4FN5A 1JK9B 2DGUA 3DRRB 4XAKA 2BXJA 4WTYA 2E44A 3GILA 1DBDA 3GV8B 2ROGA 3IR7B 3I55S 3LP1B 2MPUA 1JKHA 2VG5B 1X0PA 2LU1A 2XSFA 3GR0A 3KLVA 2FJAB 5EWGA 2ADBA 2BACA 3ZZUA 1H2UX 2JLGA 2VL1A 2LEPA 2Q6BA 4ZLPA 2GIRA 1V3ZA 2HHVA 1L3VA 3UFCX 4WYWA 4DL4A 1U26A 1S1XB 4KBIA 3FCHA 1UJ5A 3UCZP 2ZBCA 2W7OA 4Y34A 3CCJS 1S1UA 3CDUA 2R8KA 3NNHA 5K8PA 2V9WA 3K7RA 5GAHU 1S0MA 3PW0A 2F7VA 1QM9A 1U6ZA 4QW8A 5KFFA 4LJMA 3UI3A 4IO9Q 1K8AT 3RR7A 3NGKA 4N77A 4IG0B 1RT6A 4IFYA 3PKMA 3G6ES 4DFPA 1G6BA 5HMWA 3DLKB 2CJ9A 5J1PA 2AJFE 4D3GA 2BM1A 4X4VA 2Y1RI 4R5PA 2IHR1 1YWXA 2X1FA 4LSNA 3VAIA 1JNRB 3M6UA 2MQMA 5KFYA 4NPOA 3QPIA 2ZH7A 4F4XA 2B4VA 4OI2A 1UVNA 3CB4A 5MLCV 1QUVA 2C3OA 2QLWA 4I2PB 2G13A 2M7SA 1I94F 3V2UC 1T94A 2RU3A 3AA8A 4KV8B 4I6AA 3OTEA 5E5NA 4X4OA 2D41A 1SV5A 1UEUA 4YR3A 2DPIA 2DH9A 1CC8A 4QJVA 2BE2B 2ZVSA 3CCWA 1MROB 4IDKB 4RW4B 1IN0A 4WFBQ 2F1FA 3JSYA 1LXNA 2RJZA 2B56A 4N41A 4QWDA 3RYLA 2BOPA 5HLFB 2JLFA 2IRYA 2B4OA 1S76D 1OSCA 4QOTA 4ZPAA 2IVYA 3E2EA 1CLFA 2M52A 2B7BB 5D4OA 3M2VA 1LK7A 2CQCA 4QU7A 4TXSA 1NJWA 5AE2A 1HNWF 2FTRA 2QLXA 2IRXA 3MMAA 4NLYA 3TVYA 4J9RA 4IOAQ 4QYZJ 2HFNA 3BGUA 1C1BA 1ZZFA 1O8BA 3P5TL 4HI1A 2E1AA 1IKXB 3LW5C 1LQ9A 1N88A 2Q79A 2VZ9A 1HMVB 1JLBB 4HDGA 1HQUA 2XO7A 2HHSA 3OUYB 2ILYA 4ZA1A 2M8DB 2BQ3A 1UKUA 2C3PA 4ZP6A 5KG3A 4B3TF 4KHPF 1TK8A 2X1GA 3AHPA