1TKXB

Crystal structure of hiv-1 reverse transcriptase in complex with gw490745
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
430
structure length
404
Chain Sequence
ETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKDSTKWRKLVDFRELNKRTQDFWGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Pol polyprotein, Reverse transcriptase, Chain A
publication title Design of non-nucleoside inhibitors of HIV-1 reverse transcriptase with improved drug resistance properties. 2.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 112
structure length 404
sequence length 430
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2004-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1tkxB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1tkxB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1tkxB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1tkxB03
1JLGB 1TVRB 1KHVA 3TQ1A 1JLEB 4KV8A 2V0NA 1HPZB 3FRZA 5F8GA 4IFYB 3OL9A 3NMAA 5KFSA 2ILZA 3N6LA 3V81B 3PJWA 4X2BA 4NRUA 2C2DA 3PW0A 2WHOA 3KLIA 1S10A 3DLKB 4H54A 4NLVA 4ZVFA 1S9GA 1JKHA 4LSLA 2C2RA 3M8QB 2W7OA 3FFIB 2VG6B 4RW7B 2YNGB 5KFZA 2W9AA 5DG8A 1VRTB 2OPSB 3DM2B 4R8UB 4K4ZA 1RT7B 5JXSA 3Q8QB 4Y3CA 3QGIA 3DMJB 2FLNA 4PWDA 1S49A 2FLLA 2UVUA 3RB3A 4MIBA 1T3NA 4YQWA 2AU0A 4O44A 3H98A 4FS1A 4IRKA 3DLGA 5FDLB 3M8PA 1EETB 3LAKA 3I5BA 4U7CA 2XCPA 5KG5A 4U6PA 2AQ4A 5CYQA 5F8MA 3SI8A 3DRRB 4RW8A 3KLEA 2R2SA 5L1LA 5KT3A 5KFIA 4RNOA 4EO6A 2IC3B 3H2LA 2JEGA 2QV6A 4WFYA 1Z4UA 4O3SA 1UWBA 4JV1A 4URQU 1JLQA 1K1SA 2HMIB 1RT2A 4I7FB 3QZ8A 4I2QA 3HHKA 4K4UA 3ISND 2RF2A 5EWFA 3JSMB 3KHRA 2V4QA 4QW8A 3LP1A 3KLIB 3KNAA 1S9GB 1JKHB 4LSLB 3KLVA 4ECTA 5JUMA 5DLFA 3T1AA 1RT4A 4RUCA 3OSNA 2AX0A 2W9CA 2GIRA 3KK3A 3IGVA 3DRPA 4PWDB 1CSJA 3DOLB 2YNIB 2XGQA 3G6YA 1RYSA 2W7PA 5DQIA 4G1QA 4O44B 4R5PA 5F9LA 4DL3A 4NCGA 2HWHA 1RAJA 1HNVA 2I1RA 4ZP9A 2HNDA 3H59A 4TY9A 1S97A 4O4RA 4NZ0A 3PR5B 1IKVA 1FKOB 1ZTWA 3V6JA 3BQ2A 3CJ5A 5EUHA 4EYIB 4ICLB 4NLRA 1HARA 5CYQB 1T03A 4ED2A 1QUVA 3H4DA 4KO0A 5C5JA 3I0SB 4RW8B 4ZVHA 4QWBA 3Q8PB 5L1JA 3BSCA 3IS9A 5KFLA 3CDEA 4IH5A 1S0NA 4NLQA 5I42A 1UWBB 2R2RA 1RT2B 1RDRA 1QAIA 3T19A 3MTKA 3C6UB 1RTDA 4RU9A 3RB6A 2VG7B 5KFKA 2JEIA 4H4OB 2VA2A 1LWCA 2FVCA 2W9BA 4IH6A 3IG1A 3LP1B 1BQMA 1HNIA 2DPIA 4YMEA 2F8EX 2ZKUA 4ECWA 2ASDA 4NLGA 5KFDA 1RT4B 4ECSA 3E01B 1HPZA 1DTTA 2W9CB 4QWAA 4F4WA 3KK3B 5KFEA 3DRPB 3GILA 3IN5A 2E9TA 1NNDA 5HLFA 2CJQA 5L1KA 4JV0A 4KE5A 2QE5A 2E9ZA 4JUZA 3M8QA 3HVTB 4R5PB 3GYNA 3HVAA 4IR9A 2VG6A 4RW7A 3FSIA 1ZTTA 3PHEA 5KFPA 5KT5A 1T05A 1HNVB 1OS5A 1VRTA 3IGNA 2HNDB 4ZP7A 1LW0A 3T5JA 1RT7A 1RTJA 4IKAA 1IKVB 3CVKA 2VG5A 3T5HA 3DMJA 4J9OA 4TXSA 5KFVA 3QLHB 1S0MA 1T94A 4KO0B 2OPQA 4WFZA 2W8LA 2BQUA 1S6QA 2WOMB 2RKIA 4ECVA 3IS9B 3NAIA 3CO9A 1REVA 5I42B 2GC8A 1RT5A 4XPEA 4O4GB 3EPGA 4WXOA 4J9QA 1RTDB 4QW9A 3MR2A 1BQNA 3KK2A 3DRRA 3JYTA 1LWCB 3KMSA 2W9BB 2ATLA 3IG1B 2XI3A 2BANA 2HWIA 4TQSA 4ID5B 4J9PA 3H5YA 1C0UB 4O3PA 3G86A 1S1TB 3KLFA 2HMIA 4I7FA 3MEEB 2V4RA 2WK4A 4LQ9A 3IRXA 1DTTB 4YR0A 3KJVB 3JSMA 1TKTA 5K14A 4KHMA 1I6JA 3OL8A 2JC0A 5HLFB 3N6MA 3DRSB 4B3OA 5J2PA 2J6UA 1C0TA 2R8KA 1T05B 1HYSA 2R8GA 2FVQA 3ICLA 1LW0B 1RTJB 4YP3A 2VG5B 1C2PA 2EC0A 3DOLA 2YNIA 4TYBA 1KLMA 3DOKB 4NYZA 3PJXA 5L9XA 4EBCA 5DGAA 3V6HA 3GIJA 2C2EA 3I5CA 2OPQB 4IG3A 5J2QA 5KT2A 4J9LA 1S6QB 5CYMA 2RKIB 1N6QA 5I3UA 3OLBA 1FKOA 1REVB 1HQEA 1RT5B 2HNZA 4I2PB 4ICLA 4KHRA 4Y34A 1JX4A 2FVPA 1S1UA 4ED1A 4IRDA 3LP0A 1BQNB 3LP2A 3KK2B 3JYTB 4FBTA 3I0SA 5F8LA 2BANB 4ECQA 2JC1A 1IKXA 2ZD1B 1QE1A 1QAJA 4O3OA 4MKAA 3KLFB 5L1IA 4HYKA 3BQ0A 3C6UA 4QWCA 2VG7A 4TQRA 3IRXB 5KFNA 4IFVB 4MK9A 4RW6A 5KG2A 4H4OA 4NLXA 1S6PB 4J9MA 1TKTB 5K14B 4TYAA 5KFCA 4K50A 4EBEA 5DGBA 4GC7A 4Y2AA 4ECRA 3KHHA 3BQ1A 3I0RA 4B3OB 4Q0BB 4LQ3A 3PW2A 2AX1A 4IH7A 5J2PB 1C0TB 2IM3A 3MR5A 3LAMA 1HYSB 4ECZA 3E01A 4NLOA 2AGOA 4K4SA 2IJFA 2IAJB 2YKNA 2JEFA 4DL5A 3NAHA 4EBDA 1RT6B 2FJVA 1IM4A 1KLMB 4MK8A 4DL2A 3D28A 3HVTA 3UDLA 4KBIA 2FVSA 3DI6B 4IG3B 5J2QB 2B43A 3TVKA 4R0EA 3MR6A 2J6SA 3QGHA 5CYMB 1XR5A 3Q8SB 1N6QB 2BQRA 4PQUA 4WE1B 5I3UB 4EYHB 2UUTA 1HQEB 4ECYA 1N48A 2HNZB 5KT7A 1S1UB 3PVXA 3QLHA 3LP0B 3TAMB 2ILYA 3LP2B 3QZ7A 2OPPA 4Q8FA 1TL3B 2B5JB 4Q43A 4FBUA 5J2MA 1SV5B 2WOMA 1TL1A 3GV7B 5J1EB 5F9NA 2GIQA 1IKXB 3GQCA 1QE1B 2IM1A 2R8IA 3BJYA 4WYLA 4ZP6A 4O4GA 3CJ0A 2YNHB 4RNNA 3E51A 2XCAA 1JLBB 3G6VA 3KHLA 3CJ3A 4G3IA 4RW6B 4ZVGA 2FLPA 4K4XA 4Y2CA 3RB4A 1S1XA 1SUQB 4RZRA 4ID5A 4MK7A 3I0RB 1C0UA 3FQKA 1S1TA 3MEGA 3MEEA 3CWJA 3GIKA 5KG4A 2XI2A 3CDUA 3CJ2A 4M95A 2R2TA 4JV2A 3T5KA 3KJVA 1IKWA 4ZP8A 2YKNB 3OLAA 1S9EA 1NHVA 3DRSA 3GV5B 4OL8A 4IDKB 1SH0A 2ALZA 4ZPAA 3RBEA 2I5JB 1FK9A 2R8JA 4KFBB 3UPFA 2AWZA 2YKMA 1GX5A 4F4YA 4PQUB 4J9KA 4RNFA 2WRMA 3CJ4A 1LWEB 4Q8EA 4PUOA 2BRLA 5KFGA 3DOKA 4IRCA 3V6DB 2OPPB 4O3QA 5HBMA 5J2MB 5C42A 3OL6A 1TL1B 3QIPA 3DYAA 5KG3A 1FKPB 3KK1A 5KFJA 5C25A 3M9OB 2E9RX 2D41A 3MFIA 4NLSA 4I2PA 3FQLA 1XR7A 4KAIA 5KFMA 1S0OA 4ED7A 3KOAA 4KSEB 3GV8B 3HKWA 1R0AA 2WTFA 4LSNA 2C22A 2ZE2B 1C1BA 1S1XB 1J5OB 1SH2A 3EZUA 2ZD1A 4HKQA 4QWDA 3I5AA 3OHAA 4MIAA 4NLWA 4WXWA 3RB0A 3MEGB 4IG0A 5KFHA 3C6TB 4XPCA 2FJXA 4YR2A 2XC9A 4WZMA 4IFVA 4RW4B 4Q45A 3LALA 1S6PA 1IKWB 5HP1A 2W8KA 1WNEA 1S9EB 3CDWA 3H40A 3NBPB 4O3NA 4DL7A 4Q0BA 5DQHA 1LWFA 2D3ZA 1LW2B 3UR0A 1FK9B 4DG1B 4ZPDA 1C1CB 2YKMB 4KKOA 1MU2A 2IAJA 2JLEA 2IA6A 1TQLA 4K4TA 5EWGA 1N56A 3QO9B 1RT6A 4PUOB 3RAQA 4QPXA 1S48A 3DI6A 5HBMB 2CKWA 4K4WA 2UVWA 5C42B 5KT6A 2HNYA 3DYAB 3QIPB 1ZETA 4MFBB 4WE1A 2V9WA 3KK1B 2JEJA 5C25B 1D1UA 3HVWA 3DLEA 5HROB 3MF5A 4YR3A 3Q8RB 5F8NA 1S1WB 5J2NA 4ZPBA 4DEZA 3TAMA 5T14A 2XWYA 1JLFA 1TL3A 2B5JA 1SV5A 1R0AB 1JXLA 4LSNB 2R8HA 2WONA 1RA7A 1C1BB 3KLGB 5J1EA 3N6NA 5KFBA 1N4LA 2D7SA 2AGQA 4TN2A 4URGA 3OL7A 2OPRA 4NLTA 4NLPA 4ZHRA 1RTHA 2YNHA 4IG0B 5KFQA 4WFXA 5EDWA 1JLBA 2BE2A 1TP7A 1TV6A 1K1QA 5HP1B 3BGRA 5DQGA 4ED3A 4ED6A 2UVRA 1SUQA 3QYYA 5DLGA 1EP4A 1LWFB 2YNFA 5KFWA 3BSOA 3MECA 4ECUA 3ITHA 4K4VA 4KKOB 1HQUA 1MU2B 4EO8A 1DTQA 5D3GA 3CIZA 3KLHA 1RT1A 5C24B 2IM2A 3BSNA 4MKBA 3V6KA 4IDKA 1TKZB 1VRUB 5DG9A 1N5YA 1DLOA 4RNMA 4WYWA 4QWEA 2I5JA 5KFYA 4WZQA 4KFBA 4KV8B 4J9RA 2HNYB 2BQ3A 4NLUA 1YVFA 4RNHA 3DLEB 5KFTA 1LWEA 3PW5A 1U09A 3PW7A 2UVVA 3T5LA 5J2NB 2J6TA 3MEDA 1KHWA 3V6DA 4RUAA 2WB4A 1JLFB 4URSA 2R2UA 3MFHA 4ED8A 3RAXA 2AGPA 1HMVA 2OH2A 4H4MA 4IOBA 5KG1A 2WONB 4IR1A 3QIDA 5KFOA 1FKPA 3V4IA 2IJNA 5KFRA 3KHGA 4F50A 1TKXA 4K4YA 2O5DA 3MR3A 2OPRB 3H4BA 4ZHRB 1RTHB 3OSPA 1RYRA 1XR6A 3BSAA 4XO0A 3BREA 4NLYA 2BE2B 3DDKA 3DLGB 3NL0A 1TV6B 2IMWP 3BGRB 3EPIA 5EWEA 2ZE2A 3M8PB 1J5OA 1GX6A 1S4FA 2WCXA 4F4ZA 4DL6A 1EP4B 5KG7A 3D5MA 1JLAA 2YNFB 3MECB 3RBDA 3NGDA 2RDIA 3C6TA 1RA6A 4TY8A 2FJWA 3ITHB 3SFUA 4RW4A 1HQUB 3KLEB 4TLRA 3OHBA 1DTQB 5D3GB 2ASLA 4RW9A 2FVRA 3PZPA 3KLHB 4EEYA 3NBPA 1RT1B 1RT3A 3LANA 1JLQB 2D3UA 2UUWA 1N5YB 1DLOB 1LW2A 4DG1A 2B6AA 4I2QB 1C1CA 1RTIA 2RF2B 2RDJA 3G6XA 5KFXA 1IKYA 4ZPCA 5KFAA 4O3RA 3QO9A 1JLCA 1S1VA 2BRKA 5KG0A 3MEDB 3ISNC 3PR4A 3UQSA 4J9NA 1JLGA 4FS2A 1TVRA 2DPJA 1HMVB 1JLEA 4H4MB 4ECXA 1MMLA 3SFGA 4IFYA 4MFBA 1NHUA 3BR9A 3V4IB 3V81A 4M94A 1TKXB 5HROA 3FDSA 3GIMA 3DLKA 1S1WA 5DG7A 2IBKA 4G1QB 5KT4A 4J9SA 3QGGA 1S9FA 3FFIA 2YNGA 4NCGB 3GIIA 2OPSA 4R8UA 3DM2A 4DL4A 2HAIA 2IM0A 3KLGA 4Q44A 4F4XA 4ED0A 1JLAB 3M9NB 2C28A 1T03B 4TY8B 3VQSA 4NRTA 4IQXA 1JIHA 4GC6A 5KFUA 5FDLA 4RW9B 4NLDA 5KFFA 5F8JA 1EETA 5KG6A 4KB7A 2BR0A 1RT3B 3KMQA 3H5XA 3H5UA 2ASJA 3H5SA 2B6AB 1SH3A 1W25A 1RTIB 5F8HA 5F8IA 1IKYB 3NKYA 2XGPA 4ZVEA 2IC3A 4MH8A 4ZMMA 1BQMB 1JLCB 1HNIB 1S1VB 5C24A 3M9MB 3PW4A 1D0EA 2VA3A 1TKZA 1VRUA
chains in the Genus database with same CATH superfamily
3CEDA 3OVAA 1NSPA 3PW0A 2PD1A 4NEYA 5ETPA 1UFKA 3Q86A 5CABA 1HIYA 2W9AA 3DM2B 2LDIA 4UF4A 2ZZMA 4RBVA 1CG2A 3DRYA 2AU0A 3PEJA 1NDCA 2NYHA 2AEJA 3CD6S 4OYAA 5DDRC 3HF5A 2DHSA 1RKJA 2KTQA 3ISND 5EWFA 2WW4A 4LFCF 4M5GA 2UUBJ 4QW8A 2HHHF 2VDHA 4HDHA 1S9GB 3RZAA 2AX0A 3W2WB 2VQFJ 4ZITA 4R5PA 2V4JB 5ADZA 3MM9B 1RAJA 2I1RA 4P10A 2V2KA 3K7RA 4DWIA 3GYXB 5J1PA 3Q8PB 5I42A 3FJ2A 1YJNS 1YJRA 1HW8A 5KFKA 2KZMA 4H4OB 4U7UD 2FVCA 2F8MA 5A8WB 1SCJB 2FTRA 2PMZD 2NZ4A 2B8PA 5L46A 1Y11A 1RU1A 4KE5A 2E9ZA 1HNVB 3OR2A 1KOOA 3CVKA 3DGPA 4OX7A 2JFDA 3GSDA 4C4WA 1CQMA 2OPQA 1G7CB 3C46A 4NXNJ 4WKRA 3DRRA 2XSJA 2ATLA 3TZZA 2VIHA 4LBHA 1FCAA 1FO1A 4PWUA 2J0WA 3BB5A 1TKTA 2AMCB 1LXNA 2ZEJA 2JC0A 4M63A 3OL8A 3LUYA 1T9XA 2ZH7A 3GSIA 2R8KA 1TAUA 2ZWOA 3NS7B 4IQMA 2Q6BA 3ZTRA 4HTJA 4CDIA 5J2QA 2JRSA 3CO0P 3W65A 2XQCA 4DZ6A 1S1UA 1M90T 2VPZB 1IWAA 3PYFA 4O3OA 2GNKA 1GEHA 2ABYA 4Y2AA 3P5TL 4LQ3A 3I6PA 5J2PB 2FC9A 3ISZA 3E01A 4IOCQ 4K4SA 5SZTA 2CXEA 1IM4A 4RUHA 3S01A 3HVTA 4A8SA 5DETA 2QA1A 1YI2S 2MLZA 2UUTA 1HQEB 1RWOB 1XNRF 2HNZB 3IWLA 2F3JA 4C8LA 1UVNA 1IKXB 1R43A 3BH6B 1KSPA 2BA9A 2C3PA 2OELA 4Y2CA 1BC6A 1URRA 4X4RA 2AYBA 3KJVA 4DSIA 4ZP8A 1SKSA 2ALZA 2MEWA 2PEHA 1TUGB 4RNFA 2N3LA 3NCPA 4DR6F 3CC2S 2VU5A 2CYYA 4L75A 3ILLA 5DO2A 1VOMA 3X3UA 4DI6A 3IXQA 3T6JA 3PHTA 4IFVA 2GA7A 3WC0A 1G3OA 1HI0P 1MU2A 2IAJA 2BEFA 3THTA 3W1YC 2PFFB 4H4KA 2B7BB 5B0DA 1EJ7L 5A2QU 1SVDA 4X65J 4DEZA 2PEBA 3CJRA 4BHQA 1VQOS 3N6NA 1N4LA 5DQGA 2BJ3A 3I56S 3IM9A 1AROP 2E5GA 4N56A 2O3DA 5KFWA 4PQAA 4ZLJA 2KJWA 2V34A 2J8AA 4QWEA 4PCQA 3RG6A 4WU3A 1VC6A 3HHDA 2DIUA 1MROB 2Y3YA 3T5LA 1JLFB 2R2UA 5KFRA 3KHGA 3C66A 3OSPA 3M2RA 1YJUA 4BCAA 1SL2A 3DLGB 3BGRB 1RI7A 5E3RA 2YWEA 1RT3A 4DV3J 4W98A 4DG1A 4I2QB 2XMVA 2RF2B 2O1PA 4ZPCA 5LXYA 1WOSA 5MAOA 3MEDB 4DLEA 1GT8A 2XEXA 2DPJA 3GJTB 1HNWF 3IA0A 4HI2A 2BM1A 4AXJA 3QGGA 1SJ4P 2CJKA 5CYJA 2CRLA 4DSKA 1NRKA 1T03B 1RSCA 4NRTA 1Y3KA 5KFUA 5FDLA 3GZ7A 4PYAA 2BR0A 4MKYA 4JI2J 2ZOFA 1M5OC 1SKRA 2KFNA 3NKYA 1MNEA 3AOCA 1VRUA 4DR1F 4WIIA 2VASA 4X66J 2YH1A 4P9SA 2DRBA 4ZVTB 5IT4A 2J9CA 4K4ZA 2FLNA 5M2RA 3UCGA 1WDTA 2J9DE 3DCAA 3ADAC 2BJ7A 3BV8A 4OQJA 5A8KA 2R2SA 2W4DA 3I55S 3TEHB 3OTCA 1F2GA 1NB2A 3D9BA 2OEMA 3W61A 3EVWA 3MM6B 1NK5A 2H9ZA 2DNKA 1JWWA 1UCNA 2DO4A 2XGQA 1RYSA 2LEBA 1QM9A 1DJ0A 3K17A 4ZVPB 3I0SB 4IH5A 3C6UB 2ACYA 1N8RT 3AFGA 4IH6A 4AQYJ 2BE9B 3U1NA 5A6WA 1IJFB 1HPZA 4YDXA 5KFEA 3CCES 3PYEA 1FFWB 4RNMA 3IGNA 3T5JA 3ZZOA 2J7UA 3C14A 3H2VE 4ANDA 2ZC4A 2ZH1A 2Q3PA 3KK2A 4DFMA 2F4VF 2M9KA 2VBZA 3FRYA 2EI5A 1C0UB 1IR1A 3TI0A 3D0GE 1FERA 3PYGA 1Y10A 3G82A 1HBMA 4U67Q 4OYXA 2LXUA 2ZNYA 2AF6A 3O5TB 1RXOB 1RTJB 1GMUA 2ZJPQ 5L9XA 2WBMA 2MKHA 1BQNB 4LFCJ 2HHHJ 2JC1A 2P9CA 3BN7A 1X4AA 2AJ0A 1JNRB 3NCQA 1U2CA 2EW9A 1AXQA 2OO4A 4J9MA 3L7OA 5DM7Q 2CPFA 4HDGA 2EG2A 1Y4ZB 2IDLA 2FLOA 2VBXA 4KBIA 2J6SA 5CYMB 4NA2A 2FC8A 2RILA 4EYHB 2DGXA 2DIVA 1LQ9A 2EK6A 3LQVA 4YDDB 2XM3A 3E51A 3DHWC 4G3IA 4RW6B 4ZVGA 3CMES 1S1XA 1HBUA 3V5RA 3J7Z5 3M8ZA 1IN0A 3CWJA 4EUVA 3FBFA 2RHQB 2YKNB 4Z2XA 3OLAA 1N34F 1F0XA 4ZPAA 1GX5A 2DHHA 1OY8A 3HJFA 2WRMA 4CLZA 2F40A 5D15A 4NOHA 2GW8A 4WWSA 4MMOA 2QO3A 3KK1A 1WHXA 3M9OB 2XNRA 5KFMA 3QAEA 5HSPA 3N01A 4K59A 1S9EB 2YH0A 2ZH3A 1LWFA 4D3HA 2VV5A 5D4NA 5DDPC 1K73T 3MPUB 2ZUAA 2SXLA 1B64A 1N0UA 1Q4RA 1ZETA 3QIPB 4C8YA 4MFBB 3OTEA 3BDPA 3EE3A 1WUUA 1KD1T 3TUPA 2YVSA 4LSNB 2VKZG 3KLGB 2QTWA 2AGQA 3HDSA 4FF1A 4IG0B 4B3MJ 3PV8A 1ZBTA 2OSRA 2Z2LA 4F67A 1HNXF 4FYVB 3MOJB 3R8YA 1XNRJ 4DCJB 4DV0J 1IM6A 3LA0A 3KLHA 2D9PA 5HN0A 4UY85 3LO3A 4NLUA 2CZ9A 4DX8H 2J6TA 3MI7X 2XZTB 3CCMS 1U4BA 1RHJB 3RTVA 5ETMA 1X4FA 1QAYA 1RAOA 6FD1A 4X4TA 2HKEA 1SJ3P 1DARA 1EP4B 5JJBA 3SFUA 2VFVA 4DR6J 4HHUA 2UUWA 3MOZA 4WBFA 3R5CA 3EDQB 1KQFB 3GCWP 3PM9A 4C0BA 1TVRA 1U1NA 2EBGA 3V4IB 3DLKA 1S1WA 3AD8C 1FDBA 1NDPA 3FFIA 3IBFB 2KO1A 3SIPB 2AD9A 4NA3A 2VC1A 2UXDF 2FHJA 2VKRA 4B3SF 4CO2A 4USWA 5GADI 2XMAA 2KZZA 2HPUA 2ZFHA 1IXKA 1IKYB 3R6LB 1OPZA 3M9MB 4J91A 2VA3A 2C42A 2C2NA 4NLVA 4ZVFA 2OFHX 3HP6A 3MMCB 4RW7B 3BKFA 3ZZTA 1FWKA 1GAOA 1SXLA 4C11A 1E6VB 2NYIA 2W2MP 3J80Y 2DXDA 3I5BA 2CJBA 5K5MA 3M6XA 2M88A 3ZFVA 3ZTQA 3SI8A 1XK8A 1NDLA 3W66A 2ZDPA 3AD7C 1JLQA 5D4PA 4HI1A 3IR5B 3MTJA 4ZN3A 3KLVA 3UCZP 3T1AA 2ALYB 3VQTA 2W2NP 3G2XA 4NLRA 1K0TA 1D9DA 3H4DA 3PFEA 4YOEA 1VK3A 3BSCA 1WTBA 1DY3A 3RB6A 3LPEA 3MTKA 2VG7B 1HNWJ 3C15A 2HIQA 4DMZA 3R3TA 3JTNA 2FD2A 1RKIA 1DAXA 2CPIA 3GILA 2ACMA 4ZA1A 2GCFA 5HLFA 1KBRA 1UVJA 4JUZA 4R5PB 4IR9A 4FF4A 3FSIA 1T05A 1PCAA 4ZLLA 2VG5A 3HSZA 3BEGB 1FX2A 2RKIA 3BN4A 2K8GA 5I42B 4DR1J 2C3YA 3TJAA 4B9UA 2QLFB 1JNZB 5LSOA 4Q2MA 2R7XA 2A3JA 2M7SA 3EGWB 3C16B 3ILOA 2QN6B 4DL0C 5H9FK 3OR2B 3DGPB 2YKOA 1HBNA 2OPQB 3QWPA 1WC1A 1N6QA 1KR4A 3W3SA 1FKOA 1L3KA 3HD2A 4QR1A 1LNQA 2XSJB 4OMFG 1H7XA 1HBOA 1QE1A 1VBKA 3SMZA 1TKTB 1H7WA 4K50A 3FBCA 4LT6A 3I0RA 3AJ1A 9RUBA 2HFNA 1NH8A 4DQIA 2E1MC 1RCOB 2GJIA 1ACMB 3D28A 5J2QB 3TVKA 2MTLA 4B17A 4ECYA 1S1UB 3DHXA 1QY7A 4OJ3A 1MWZA 1SKUB 2B5JB 1SV5B 1P1TA 1WHWA 4RNNA 4OFZA 3ZZ0A 1F9HA 4TU8A 4USHA 4YY3F 2KU7A 3W9JA 3CCWA 1Q16B 3CDUA 3A8JA 3GG1A 5ETVA 1FJGF 3MD3A 1EX8A 2QLBB 1U2RA 1L3UA 2P6SA 5IS2A 4Q8EA 2BRLA 2F4VJ 4HL9A 3D0HE 4BS2A 1A6LA 2VPWB 1XR7A 3HKWA 1R0AA 2W25A 2FGOA 4OI0A 3EZUA 1KTVA 3PKYA 1F9EB 4ILRA 1Z1ZA 5EN1A 2U1AA 3JQKA 1V5IB 5GVQA 1LW2B 2D3O1 2QYGA 1QSSA 4OJGA 4PXCA 2JEJA 5F8NA 1U8SA 1F60B 2WONA 5J1EA 3GJQB 4NLPA 1Y00A 2OLWA 4DQQA 2F9JA 3M1VB 4Y2KA 3KKFA 1SUQA 3QYYA 3QT6A 3HULA 2RH3A 4KGZB 2FIUA 2PC6A 5GMEA 1HQUA 3ENQA 1MU2B 4JBCA 2XS7A 4B3TF 1RT1A 3V6KA 1NZ8A 2U2FA 4K0KF 2QSFA 1IBMF 2CQGA 1U09A 2F7VA 3AA9A 4HACA 1YG0A 2KVQE 4ITSA 3HHLC 3O3LA 1N34J 1N0VC 2FHKA 4ELUA 3WQPA 4B02A 4EEYA 5T41A 3K5LA 1UVKA 1C1CA 2MXYA 1EKSA 3BKTA 1OY6A 1SC6A 1PJ5A 5H9FJ 5HROA 4X4OA 4HT5A 4QZVB 1S9FA 4NCGB 2B9WA 3TJ8A 2O66A 2LEPA 2KI2A 3M9NB 2C28A 2W2QP 5F8JA 1RT3B 4RX6A 2ASJA 1X31C 3L3CA 3ZNJ1 2XGPA 3D0IE 2IC3A 1U47A 3TR5A 2C3UA 1D0EA 4B3RF 4CQ1A 5E33A 5G0RB 2HGMA 1XBWA 1BWVA 7FDRA 5CD4H 2C2DA 2VICA 2KG1A 3OTBA 3M8SA 1Q82T 3B54A 3BYRA 3DMJB 1HNXJ 2QA4G 2X3GA 4YQWA 1AB8A 2UV8A 5FDLB 2BW7A 3LAKA 2YBVA 5F8MA 1FI4A 1M1KT 3WX8A 3LP1A 3N9UC 1N52B 2OAUA 5D0HA 1TK5A 2YNIB 1VRQC 3G6YA 5AXLA 4TY9A 1IKVA 2ZBIA 5EUHA 2Y9HA 4ZVSB 1HHTP 1MMDA 3NGKA 3PFOA 5A8KB 4X4UA 1F5AA 1MSWD 1OMSA 4NLQA 1GXLA 3D66A 2RRAA 3MEKA 3UNGC 4RU9A 3GB0A 3VCDA 2ZKUA 3ZNUA 2N3OA 2UXDJ 2Q66A 5KAKA 4WTOB 4B3SJ 1F2HA 2LFVA 3QJPA 4ZP7A 5E5NA 2IYIA 1T94A 4CLFA 4DOZA 3BS9A 5LMUF 3DXSX 4O4GB 4QYZK 4I6AA 2Q6CA 3W8GA 1VQPS 5HATA 3TQEA 1YDLA 1HI8A 2XI3A 1HHSA 1FJCA 2N82B 4I7FA 2BJDA 2WK4A 2ZOGA 3M8WA 1XQIA 2MZ1A 4Y2MA 1N5VA 2L9NA 1D9AA 3EXCX 3MM8A 2HHTA 3EGZA 3C14B 4S0MA 1RBLA 2B8QA 4IG3A 4I2PB 1O5JA 1CULA 3KK2B 5F8LA 4WFAQ 2DRAA 3N0VA 3CCQS 4CI0B 1HBMB 1W26A 2K06A 3CULA 2DHAA 4NLOA 4DR7F 1S12A 4DL5A 2DNRA 3FEXB 1ROFA 2DH7A 3DI6B 4UUXA 4TLQA 4O0IA 3HO1A 3M2UA 2AZ1A 4Q43A 2WOMA 3K0JA 2GIQA 4JI8F 1R8PA 3G6VA 1NH7A 4DZDA 2R7UA 3HFVA 4EZ9A 3QT8A 2ZC3A 3W62A 3CXCR 1QTMA 1NHVA 3GV5B 2NCKL 4G1IA 3CMAS 3GIRA 4RWWA 3IWNC 2W24A 4CLYA 4AL5A 2MQ8A 3CJ4A 1LWEB 3BBCA 2CA9A 2R4FA 5HBMA 3J7ZT 2VUGA 1VCTA 3TA0A 1X4HA 4LF1A 2CADA 1PAUB 1S1XB 5L1KA 2ZH2A 1HBUB 3GLJA 1X0FA 2MZRA 2D3ZA 4LR9A 4WP9A 1FA0A 1R0CB 2APOA 2IA6A 1QTNB 5EWGA 1KONA 1XMBA 2XULA 3Q2SC 1NJXA 3KK1B 4ZPBA 1NU4A 2FJAB 1T11A 4WTYA 4KYZA 6FDRA 2RDDA 2FHJD 1B70B 1TAQA 3RYLA 2HBYB 2EPIA 3BPDA 3FKBA 1LWFB 3MECA 2H54B 2NZCA 1H73A 1NK7A 3BSNA 2ZH4A 5D0EA 3K8VA 3A3OB 2HFSA 2GHVC 2K3KA 3EMTA 4URSA 3DC2A 1U6BA 4YY3J 1FKPA 4ZPTR 1FJGJ 3DDKA 2E1CA 4HH1A 4WK1A 3M8PB 4UY8T 2VZ9A 3D5MA 4CH7A 2V8VA 5D78A 2RDIA 1NSKL 4QYZJ 2B0GA 1X4GA 3OR1A 3THPA 3KLHB 3TX8A 3PTWA 2G0CA 3RBZA 4O3RA 2HK2A 1IWGA 2H5IB 2O01C 3UQSA 4DV2F 3EM1A 3R1LA 4M94A 4A8OA 2KJVA 4XDDA 3PX4A 5KOWA 4BDPA 1H2TZ 2QG9B 1YGYA 1JIHA 5E3PA 1EETA 2CZ4A 2MSSA 4CLUA 1SH3A 4DPTA 5F8IA 2UUAJ 2DR6A 3AOBA 1WD6A 4MH8A 2VPYB 5C24A 3M6VA 1F9FA 1TVRB 1KHVA 3D2WA 2XG8A 1M1GA 1ZM9A 1V9OA 2V0NA 3DLKB 3NWGA 2LU2A 3M8QB 4NMLA 3TW0A 3FFIB 5KFZA 1VQLS 3AT1B 1RT7B 2B51A 3NP5A 3H98A 3F41A 4B3TJ 4USMA 5AE3A 3CNQP 4K0KJ 1UJ5A 3HK2A 1IBMJ 3ET6B 1U24A 3UNYA 5JUMA 3JXOA 1TL5A 1NMEB 3KK3A 4JI3F 1HWJA 1Q7YT 1VQ4S 3ETMA 2OKQA 3FBEA 5C5JA 4B9LA 2DGQA 2KRRA 5E7OB 1S99A 2XHCA 4BWMA 5CA5A 4JI4F 5K20B 1XMQJ 2CPDA 3QT7A 1NB7A 3RBXA 2K2PA 2KT2A 3HHLA 2EFPA 4I1TA 2EFNA 5JVGQ 1ZTTA 3TEGA 4AT1B 3UD4P 1LW0A 4P72A 1A0OB 2UUCJ 3T41A 2CNKB 4FZVA 2MYFA 4B3RJ 1HD1A 2PFDA 2PGCA 4J9QA 1L3TA 1RE1B 3AJDA 1F5CA 3CCRS 3K2YA 2IA0A 3KLFA 2N7CA 2V2VA 5K14A 5HLFB 3B82A 3O6QA 4B3OA 2KYXA 4UOGA 1O8BA 1T05B 5IQQA 4DX5A 4U9RA 2VG5B 1MWQA 4TYBA 1ZAVA 2RQMA 3PJXA 5HMWA 1Q78A 3NOCA 2RKIB 1G4CA 2FB0A 3ILIA 1CC7A 3M8YA 4Y34A 3W9HA 4I6YA 3CW2C 2RS2A 1V6HA 5HQMA 4NCBA 2YTCA 2YKPA 2ZD1B 5L1IA 2JVOA 3BQ0A 3JS9A 3IM8A 2CPZA 1M1HA 4ECRA 4DSFA 1BMQB 2BZ2A 3TANA 3AD9C 1RZMA 2DNMA 2JEFA 3NAHA 5HVGA 4MJKA 1N6QB 2MKSA 2FHMA 1CJKA 4NL5A 2RMLA 3M2VA 3QLHA 1B7FA 4C3KA 3ZZUA 1YLXA 1HBOB 1QE1B 1FKAF 3ZO7A 3G6ES 2Y8WA 3SSSA 1APSA 1O0PA 4ILMA 3I0RB 2GJFA 3FQKA 4PXEA 1S1TA 1H2VZ 1RUSA 1ZAWA 4EI2A 2LQ8A 5BR8F 1FK9A 5LMUJ 1VFJA 3MURP 4CRJA 2YQ1A 3OL6A 3NG8A 1R8HA 4KSEB 1Q7LB 2IRYA 2GIFA 2LU1A 2WVBA 2C2ZB 2JFKA 4YR2A 2ROGA 3UWTA 1RAEB 3I96A 3R2CJ 2GQQA 3IMQJ 5L39A 4OV1A 1RT6A 2BYCA 1NUEA 3MCMA 2ASYA 2A10A 3MF5A 1UA1A 1UEUA 2WB1D 3IR7B 4DSJA 2HLUA 1L5UA 1R0AB 2R8HA 2D7SA 2K7KA 2OPRA 4DR7J 3ILJA 1NCLA 4ED6A 4K4VA 4ZCMA 3PX0A 4M5KA 3ZZZA 4KV8B 3CTRA 4JI8J 5KFTA 1WG5A 2CPYA 2WONB 1UEKA 2IJNA 3AXKA 4ENOA 2O5DA 5CCLA 3MR3A 3J7AN 3DDIA 1RAGB 4F4ZA 2M0GB 2IMOA 2QFJA 3VHQA 1HQUB 1TK8A 2QL9B 3E8OA 1RT1B 2P9EA 1FHTA 4ANCA 3LANA 4F4KA 3MM7A 2RHSB 1WG1A 1N5QA 4J37A 2ZBPA 4ECXA 2Y1IA 2HS0A 4RL1A 4J9SA 4UOCA 1NDKA 2XNQA 2HAIA 4CLWA 4ED0A 4C0HA 2LDYA 4DCOB 4QU6A 3VQSA 3T6BA 5IT0A 4OX8A 4YB5A 2VB6A 3H5UA 1Q5YA 1UAWA 2P5VA 1ZYQA 4OYIA 2HQGA 4ZVEA 1BQMB 1GNKA 2XC9A 4CIOA 2EEYA 3NEKA 3LWLA 1RHUB 3FRZA 4OJ1A 4M1KA 4LSLA 2W7OA 3MPYA 5FD1A 4GMKA 3MGJA 3HI9A 1CJUA 2H5EA 4N5SA 3PACA 1MN7A 2IC3B 2DISA 4DV4F 3RU0A 5HQLA 2W9CA 3PKMA 3KDNA 3LGNA 4F3MA 3VAJA 3EDRB 2RAQA 4PKDB 3CJ5A 4DV1F 1PYSB 4USTA 5KFLA 4DV2J 2JEIA 3MAAA 2VA2A 1J2VA 3LP1B 2MB0B 4FF2A 4P2FA 1WORA 2MZTA 1UVIA 4QWAA 2DK2A 4F0MA 1RISA 1OS5A 3ZZRA 4IKAA 1IKVB 3LF0A 3D1QA 2BX6A 2J9DA 4C3MA 1WF1A 3MD1A 3QBCA 3GTYX 1FNMA 2VQEF 1M5VC 2Y1RI 3W2VA 4WXOA 3SZ2A 4OLOA 1UPPA 3I9ZA 2RUGA 4MYTA 4J9PA 4AUKA 4OYWA 3LPYA 4FPIA 2DB1A 2KXHA 2VOOA 3MAQA 3DLLQ 3DRSB 2HHSA 3SQGA 2PI4A 5B09A 3CCJS 3A13A 4EBCA 5E0OA 5A8RA 5JVHQ 2MKYA 1ITPA 2KRBA 2B56A 3WDOA 1R27B 4TNOA 4JI3J 3DOMA 1S6PB 2HZVA 3D6TB 3MM8B 3TO8A 4DV7F 1WG4A 3C3LA 4L6V3 3HVRA 1I51B 3JQJA 2B9YA 2FVSA 4IG3B 3MR6A 1S7IA 3DGVA 3R6GB 2HG4A 1NPPA 5HMZA 3BGLA 2Z58B 1CULB 5FJ4A 2BOAA 4PYDA 4JI4J 1G6BA 2YNHB 1NAQA 1EQMA 2RB7A 1JLBB 3CJ3A 2DNYA 1IBKF 4E0DA 3M30A 4LIRA 2HSEB 4OZNA 4Q2LA 2HQCA 1D3WA 1RBOB 3O1LA 5KG4A 1B0TA 4KGMA 2AZ3A 1DQAA 5CHCB 1RADB 1RABB 4OL8A 2BVZA 2AIRB 1P6TA 1VBXA 2H3EB 1GMVA 4OZ5A 4AL6A 1T8EA 3MZIA 2VOPA 5KFJA 1SPBP 1HA1A 4WIQA 1S0OA 4KAIA 1WF0A 3CJ8A 1FFGB 1X8DA 4N41A 2FJXA 4Q45A 4PAAA 3CD5A 5LSLA 2JSXA 5AXMA 3OFGA 1WKLA 4F3OA 2ATCB 4OYZA 4PEOA 3FEZA 5HBMB 4ID8A 3PCOB 1BUXA 2V9WA 3DLEA 4DX7A 2BJ1A 4LRCA 3MMAA 2BE2A 1TV6A 4LF6F 2PIIA 1SQEA 3CIMA 2RIJA 2V8DA 1DTQA 5F3TA 4IDKA 4WYWA 5IOLA 4NYOA 3U1LA 4BLGA 2DO0A 1YVFA 2YQ0A 3V6DA 2DR9A 2XTJP 4IR1A 3FGVA 2XMWA 3QIDA 4F50A 1KOHA 3GU0A 3VAKA 3AHPA 3BGOP 1XR6A 3BREA 5HO4A 3VR1A 2LA4A 1Q0NA 1ZS6A 3MECB 3NGDA 4RW9A 1N5TA 3NBPA 2B6AA 4OZLA 4E2FB 3B8HA 2GGPB 3M32B 3O44A 2E1AA 2AT1B 2W4CA 4CT8A 2AJFE 2OJ3A 4OI2A 4X64F 4JP8A 2DNZA 4R8UA 2J0XA 2YPZA 4GKJF 3M05A 4L76A 1U1QA 5T7LB 5I4MA 5HJXA 1CQNA 2MKKA 4I0WA 4A48A 2D74B 4OHVA 1VQSA 1TKZA 4FN5A 1BLUA 4FDFA 4ZIVA 3MHYA 3J81U 2ILZA 3B78A 2X7IA 4LF7F 1VC0A 4J5OA 5LT5A 4FYWB 4CT9A 4HHJA 1DZ5A 3J81Y 2WVFA 3HHLD 1VRTB 1VBYA 3P49B 3W5XA 5B0BA 1RWMB 3NGRA 1JJCB 1SIWB 3GJSB 3L9ZA 4CO0A 1PSDA 1EETB 1PKUA 4QBUA 5E3QA 1BD6A 1FD8A 3P4UB 2IY5B 1L3VA 1TL7A 2LXFA 1JMTA 1Z4UA 4JV1A 1I1GA 3PX6A 5D4LA 4I6WA 1HLWA 1HWUA 3EVMA 3JSMB 2PT0A 1YJWS 2HHWA 3EZ5A 4P7TA 2I9SA 3GR1A 4ER8A 5HK4A 2I8EA 4BC9A 3I4HX 3DOLB 4G1QA 5DJBA 5K8PA 3H59A 4Z7YA 4CNZA 4DQRA 2V67A 1ZTWA 4YN3B 1WEYA 2HW3A 5ETLA 4CO1A 1TUVA 1QAIA 3T19A 1Q95G 4C8MA 4YMEA 1N33F 3FCWA 3JAMY 2L9WA 4ECSA 2HFVA 3KK3B 1B0VA 2DT9A 1BY9A 2VG6A 4OYPA 1H0HB 3T1HF 5D4OA 3J81j 1WC4A 1Y5LB 2CVIA 1IQTA 1KQGB 4QQBA 4ECVA 3NAIA 3US5A 4XPEA 2ZM6J 2EK1A 3IR6B 4FP9A 3GPAA 3KMSA 2E5HA 1CLFA 1PYOB 5ETNA 3CJTA 4HH0A 3N6MA 2DTJA 1CJVA 5IZHA 1NJYA 2FVQA 1KP6A 1LW0B 3G8TA 2M2BA 1NHKL 3PG9A 4I64A 5KT2A 2YWFA 4OYBA 3OLBA 3T9NA 2VONA 4DV4J 1U1LA 4AD6A 4M5NA 4FXDA 2ZHAA 4YHHF 2ZUGA 1H2UX 1QAJA 1AT1B 3AH6A 3KLFB 4HYKA 3EYZA 4QWCA 5KFNA 4AE5A 5K14B 1LWXA 4B3OB 3ZTOA 4LVOP 2IM3A 2CFXA 1RBAA 1ZM4A 4DV1J 2VFUA 2JNJA 2HK3A 4RPFA 2MGZB 1TL3B 4DS5A 4KTQA 5IT9Y 1TR0A 2B3TB 3BJYA 3NS5A 1L3SA 1T3OA 4UZCA 1TTHB 3ZTPA 2N4CA 2CAJA 4USVA 2XYGB 1X4DA 3ZZPA 1DHMA 3SV4A 3R9LA 2VQEJ 1DQ9A 3NS6A 2MDAA 2ADBA 1CJKB 2AV5A 2DNNA 3M2VB 3GE9A 2JL9A 1W2BR 1U7LA 3MFIA 1I3OB 4Z37A 3BF4A 1XN9A 3RB0A 4FKYA 5AXNA 3CDBA 2V8HA 2HURA 5E2QA 4Q0BA 3JSBA 3B4DA 1FK9B 1TQLA 3MCNA 4KHPF 3IO1A 1OY9A 2LA6A 2RUSA 1VMBA 1YBUA 2GX8A 1WI6A 3HVWA 5IQ6A 3Q83A 3W9IA 1WSVA 4YFUA 3CC4S 4ELVA 1G1XA 3MCOA 3KNGA 4DV7J 2GHWA 4ZS6A 4UQTA 3N79A 2UVRA 2PE8A 2XMMA 2BKNA 4K2JA 4DUZF 3MCSA 1LOUA 3H25A 4DN9A 2DEIA 3GYGA 4CLPA 2I5JA 4KFBA 5KOXA 2YQ3A 3PW7A 4OLPA 3DLJA 1IBKJ 5FIIA 2GVDB 2VBWA 5A0YA 5AE1A 2LYVA 2OPRB 2HEKA 4DQSA 3NL0A 3QSYB 5HI7A 1GX6A 5GMKa 4USUA 2YXLA 1IBCB 3KUHA 3KJQB 3K58A 2FVRA 2MKCA 3H42A 2VBYA 3HFKA 1RB0A 2JLFA 2LQBA 3QO9A 4WF9Q 2Y1LB 1JLEA 2CUYA 1J5EJ 3FNNA 3KG4A 3V81A 1AZSA 2N7YA 5KT4A 1KFSA 1V3SA 2W4PA 3QQCD 2WVEA 1FRHA 1O51A 4GC6A 4IOAQ 4ZKAA 2A18A 3UDCA 1UZDA 2VC0A 1QD1A 3ENAA 3UI3A 4ZMMA 2EWHA 1RCXB 3T1YF 2VD3A 4NRUA 2BV3A 3KLIA 1YHQS 1I5OB 2MSTA 5GAHI 4LF6J 2DGVA 4CP5A 3MM5A 1U1PA 3F44A 1GH8A 2ZH5A 1T3NA 3J7YI 2K1RB 3TOQA 3DNCA 2ZNZA 3P8BB 3RGIA 5CYQA 3TAQA 1Q79A 3KLEA 2QV6A 2HMIB 5GADU 2HIYA 3CJKA 3S8SA 3KNAA 4D3GA 4LSLB 3K8WA 3UD3P 4P2XA 3WIUA 4HR2A 3TZXA 2GIRA 4L73A 3GONA 1CJUB 1WEXA 4ICLB 3A8IA 3EVOA 1HARA 2AEMA 3VGUA 3OFFA 4GKKF 3CDEA 2HVZA 3GFHA 2B9EA 2QMWA 1LWCA 2E7XA 1PIEA 2ZHBA 4X64J 2DPIA 4R0JA 1F3VA 2MKJA 1EARA 4GKJJ 2W9CB 3MWBA 4JV0A 1KEKA 2CJYB 5HANA 2QZ8A 2B4VA 2GC8A 4RWXA 4C3LA 2CQDA 4ZK7M 3OXFA 3HMJG 4LF7J 4TQSA 5B0FA 3MMBA 4LBPA 2A1BA 4ZCLA 5EGYA 4KHMA 1I6JA 1FRKA 4WFBQ 1SJQA 3ICLA 1FXLA 3W2WA 4OZ2A 3T9ZA 3GIJA 2V4JA 4J9LA 4GO7X 5I3UA 4KJIA 2HVEA 3W2VB 1X0PA 2ZJRQ 4JI1F 5A2QY 1F1BB 2G2YA 4DPOA 1T9WA 4H4OA 5A8WA 4GC7A 2G13A 3SQGB 1Q5VA 3KWMA 5DZ7A 2RD5C 1RU2A 4HLBA 3TUJC 2M8HA 4K5RA 5E3AA 5FLXU 2GO8A 2W01A 2ZBQA 3ENWA 2OPPA 1JXVA 3GV7B 3QRPA 2BKPA 1N33J 3A1YG 2P6TA 2H65B 2QMXA 2MQOA 3DOMB 4K4XA 4OIXA 3MEGA 4OI3A 3T1HJ 1N36F 1PBUA 3EGNA 3Q8UA 1SH0A 3RBEA 2FY1A 2AWZA 2YKMA 1NSQA 3OUYB 6AT1B 2X1BA 4PG8A 3DYAA 3BGFA 2KXFA 4F2RA 4NLSA 1YJ9S 1KVKA 3KUGA 3S7RA 3M30B 2C22A 2ZE2B 3L4BC 3JQMA 4HKQA 1S77D 1W7WA 4PXBA 1MG7A 3C6TB 2GQ2A 4RW4B 2MHEA 3TNVA 2EFQA 3GR0A 4O3NA 4DPYA 1Z2ZA 1AFJA 3BBFA 3IC1A 3RAQA 4YHHJ 2CKWA 2GO9A 2NPFA 3N5FA 2LECA 3ENVA 3PO5A 3D6MB 1U2FA 4O23A 4U95A 2KT3A 4N76A 4LF9F 1TP7A 3IAM9 4ED3A 1SBRA 3W64A 3BSOA 4W92B 1FE4A 1ZA2B 3R5BA 2HHXA 3P3DA 1R8CA 2XYHB 3W5ZA 2F63A 3FCHA 3DLEB 2NLWA 3TX0A 2UVVA 3P96A 3RAXA 3IP0A 4IOBA 1B99A 3LOUA 3WHIA 3MMAB 2BE2B 1TV6B 3EPIA 4F0HA 1S4FA 4Y0FA 3RBDA 4DV6F 1DQ8A 4TKTA 1RA6A 2QC3A 1KVJA 4P2MA 1DTQB 1MMNA 4M5LA 2A0FB 2RDJA 3EZOA 3A8EA 2V69A 4FS2A 5B0CA 1D9FA 1CBKA 1MMLA 2QJ3A 3BR9A 2GAGC 4IUFA 3QT5A 1SQGA 3BO2A 2YNGA 4Q44A 4F4XA 2FZKB 2XSFA 4QIWD 3W7BA 3SCLE 1GK8A 1Q1KA 3P5BP 3HKZD 2B9XA 5CQGA 3R97A 4KHPJ 2MJNA 4RW9B 4NLDA 2HFUA 4KB7A 4CTAA 2IFXA 3KMQA 1UETA 3OW2R 2B6AB 4M5DA 4NMXA 1HNIB 5D6GA 1B3TA 4GVLA 3KFWX 3U7JA 1UW9A 4OHWA 5KFSA 1MROA 1R8AA 3M6UA 1NJWA 2HS4A 4LFBF 2CNLB 4R8UB 1WKJA 1S49A 2NSCA 4QOTA 1FJ7A 4DUZJ 3VZIA 1VDHA 3DLGA 4U7CA 1Q81T 4U8YA 3G87A 4QJVA 3H2LA 2JEGA 1N32F 4URQU 5B08A 3TARA 3HXMA 3SCKE 3FSXA 4I2QA 2RF2A 2XLJA 2GMLA 2M3DA 2JLGA 4ECTA 3NLCA 3DRPA 2W7PA 2E1PA 4LF2A 4YB6A 1K0VA 1K47A 1T03A 2QA4S 5K8MA 1GXUA 3D3BJ 1TL7B 1H6KX 4U7UK 3Q2TC 2VFSA 1X60A 4OYMA 4UT4A 3NNHA 2VJVA 1RWKB 1VQNS 4F4WA 3F73A 3FZBA 2Z8QA 1ZA1B 3I32A 3PHEA 4DR5F 4TXSA 2JJ4D 2W8LA 1RHRB 2YX1A 2MZJA 3CCTA 3L7UA 3CO9A 3I9V9 1REVA 2HRTA 4QPTA 3E2EA 2GV1A 3D6FB 3R5DA 3H8YA 4U96A 4ID5B 4HEA9 3G86A 3MEEB 2IHR1 2YWKA 2MZSA 2V4RA 2K3IA 1JB0C 1Y7PA 2GVZB 5F3ZA 2B7CB 3MM6A 2RE1A 2RS8A 3W8PA 3G8QA 3DOKB 3BBBA 2CQ3A 3VV2B 1LFWA 2AYEA 4ED1A 2R7OA 3I0SA 3SDEB 1KFDA 1RGVA 4HHHA 4UZBA 3C6UA 3C19A 4TQRA 1QAXA 5ETQA 1RAAB 1R3NA 1LK7A 3KHHA 1W2IA 1KQKA 1ZAXA 2IJFA 2KHCA 1VQMS 4MK8A 4OYOA 1Q8IA 2G1DA 3KTQA 4GKKJ 4R0EA 1XR5A 3GFXA 4WU2A 4WE1B 1VJQA 5KT7A 2G1HA 4WP8A 3TAMB 1FEEA 2UP1A 5D77A 5F9NA 4ZP6A 3SQOP 2DH9A 5IC6B 4PWWA 1PG5B 4MK7A 2W7AA 1C0UA 2VFTA 4M95A 2E44A 5C2GA 3T5KA 2J8SA 4KGVB 4OZ1A 3EUNA 2XWXA 3DDNA 5C25A 1GFWB 3KOAA 1TK0A 4P6QA 1VQKS 3GV8B 4ZVQB 3MUTP 1J5OB 1SH2A 2BBEA 3GMGA 4MIAA 4CYUA 2XS2A 1YBTA 2HAFA 3OPKA 1SJFA 1REGX 1UWAA 3UR0A 1PAEX 2JLEA 2DGOA 4PXDA 1M5SA 3NY0A 4JI1J 1VIXA 2IPOB 2VH7A 2X3DA 2B4OA 2OMOA 5GAEI 5J2NA 1FFSB 3RUBL 1YZ7A 3QRQA 4Y28C 2Y0BB 2F65A 4DSEA 1YJTA 1QVFR 5MLCV 1ZZFA 4P75A 4R25A 4ELTA 1N5YA 4J9RA 1FWLA 2ERRA 1FEHA 4A46A 1MLAA 3R5JB 3RR7A 1GXTA 1QSYA 4CO3A 3AA8A 3EXYA 3H4BA 1LV5A 3DLBA 2CQ1A 1N36J 1X9MA 2FJDB 3BM7A 1VQ7S 3AB2B 4Y65A 1T0TV 1XC9A 3A4TA 2ASLA 1RTIA 1FTRA 1JLCA 3VTIA 4WJBA 3I87A 2NR0A 5LOQA 2I0XA 5A0YB 4DV3F 2OTLS 4MFBA 1UJ6A 2HBQB 3Q89A 3GIMA 4RR5A 1YIJS 4EZ6A 3VVTA 2QRRA 2IM0A 3CCZA 3KLGA 3R7NB 1H74A 1U45A 4NZ6A 1KTQA 4NWBA 1T95A 1M5KC 2NXUA 1W25A 3SBMA 2HVDA 5DZ6A 4A8QA 3TJ9A 1JLEB 2IIHA 3V81B 3PJWA 4LF9J 4K8RA 2OFGX 4DHVA 2K7JA 4Y3CA 4PWDA 2GS8A 4DPXA 2Q79A 2WSEC 3C2PA 5LMNF 4WKYA 3DRRB 4RW8A 3CC7S 2ZDOA 3NNCA 1K1SA 3A3PB 2QL5B 1SI9A 3R2DJ 3KLIB 1AUDA 3GFYA 1Q8KA 3NXZA 2DBBA 3DFEA 3QSIA 4DV6J 3DU6A 2BACA 1NXIA 2YY3A 3RRGA 1NK6A 4ZP9A 5M2UA 3V6JA 3K89A 1HFEL 5CCMA 5CYQB 4KO0A 2DGTA 4J90A 4HTIA 1RTDA 2LCWA 4B9VA 3WZ0A 4L3NA 4QIEA 4WPAA 3V2UC 2ASDA 1RHQB 3E01B 2BXJA 2B4UA 3HVTB 1BE4A 4AQYF 4RW7A 2BW2A 3HPOA 4RBUA 4J9OA 8RUCA 4NCAA 2LLZA 2DNGA 3IFEA 1PGZA 1E6VA 2BQUA 1UMJA 5AJ3F 3CT9A 4CCHA 3MR2A 1LWCB 2EVZA 3P6YC 4KR0B 2Z2MA 1DFDA 3KJVB 1LEOA 3DKDA 2KFZA 2IRUA 1FESA 5I3QA 1HYSA 4OX6A 4DU7A 1DRZA 3OV7A 2YKAA 3SCJE 1NO8A 4QR2A 2V68A 4IO1A 3I5CA 1URNA 5DDQC 1N32J 2COLA 1C4CA 4KHRA 3EICA 3HJVA 5F41A 4LIWA 3MMBB 4F0KA 4MKAA 2DR7A 2I38A 2AJ1A 3HFZB 2VG7A 4IFVB 2XZDB 3TUIC 4NE9C 3BQ1A 2M8DB 1G2EA 1PILA 3MR5A 1HWIA 1PJ6A 2IAJB 1Y5NB 1SJ1A 1Q8LA 1UL3A 2QGFB 2LP4A 5I3UB 3SYZA 2XYPB 1YJVA 4A8WA 1RHMB 3CCVS 4QR0A 2IJRA 4DX6A 1R31A 1TL1A 2NQPA 2LQ9A 2MLYA 4QU7A 2R8IA 3PY8A 2FY8A 3O2IA 2W1BA 4Q5VA 4LVNP 4CM2A 3OT9A 4KC5A 1CC8A 5HJYA 4TU7A 3R5GA 2QIFA 2PI5A 4DR5J 1IKWA 3TWZA 3C16A 3P45B 2BJ9A 2BJEA 5LJ5Y 3MUVP 1F5BA 2BUNA 1JJ4A 4LUBA 4AYBD 4IRCA 2E7WA 2OPPB 3LTOA 4P73A 3RAMA 2NPIA 1RAIB 3M2RB 1U6ZA 4QWDA 1ZPVA 3MEGB 3EGVA 3TA1A 4B9NA 2CQHA 1WNEA 3H40A 5LM7E 2IVMA 4DG1B 2YKMB 2NS1B 3HHNB 1SC1B 2DNLA 3DYAB 1NK4A 4C6AA 3Q8RB 1BGXT 2B5JA 2CNOB 1SV5A 4JI6F 4L72B 1OJ4A 3OXGA 1SQFA 4TVAB 3JSYA 3PIPQ 1NBEB 2A6MA 3M7VA 4B3MF 5D3GA 2HYIB 1VRUB 1UA0A 4NASA 5ETTA 4DV0F 5LJ3Y 1HMVA 5CAAA 4QIGA 1R0BG 2BKOA 3G71S 5EWEA 2NXJA 5KG7A 3WC2A 1O6XA 2XHWA 4O0NA 2DCLA 3PO4A 2IYGA 1LW2A 2MQMA 5G4DA 4NPOA 1YQHA 2WVDA 1FVSA 2V8GA 2M70A 3HSGA 3VAGA 1JQGA 2OPSA 4W4MA 3TVZA 3HHEA 3M1VA 2XMJA 2KM8C 3CCSS 2EBEA 2HS3A 2XBPA 2G2OA 4HVZA 1HPZB 4OZ0A 4H54A 4CO5A 3AB4B 1XWLA 3EJMA 2YNGB 2F9DA 2CG4A 1ZH5A 5F0UA 5JXSA 4Z7CA 3NWRA 3Q8QB 3E3XA 2FZCB 1D8ZA 1NPRA 2V6AA 3OXLA 1EKRA 2DR8A 1OWXA 2XCPA 4CTAB 1FDAA 1UW4A 4RKUC 1R89A 4M5DB 4RNOA 1V5VA 4EO6A 1UWBA 3FEYB 3QATA 3QZ8A 2AKWB 2OD4A 3HHKA 4OI6A 3G82B 2DHXA 1XJWB 3CF5Q 3QAUA 1OYEA 2MQQA 5H1SV 2L08A 4ES2A 4NCGA 2HWHA 2D69A 4NZ0A 1EAYC 4C8ZA 4JYAF 1QUVA 5CD4A 1IVZA 3NGSA 4M5JA 1DBDA 2UZAA 2ZH8A 2G4BA 2CQ4A 2DKOB 5G0RA 4J9UE 4MTPA 3DRPB 1B0PA 3T3FA 3HVAA 3GYNA 5IXUA 3DMJA 2FGCA 2AHOB 2KHDA 3CUNA 5KFVA 1S0MA 3AQOA 1Y0HA 2V94A 4OI4A 2A2DA 1KS2A 2Y8YA 1RT5A 1VLOA 1EHWA 4QW9A 4A4JA 2BANA 2HWIA 2NREA 4NX9A 5DS7A 4ZDNA 2CG8A 1TZ0A 4YR0A 2DY1A 2E66A 4USIA 5LMNJ 1C2PA 4LREA 2YNIA 3CSKA 4RLEA 5A76A 1HQ2A 4PABA 3S6EA 1REVB 2OD6A 5M2PA 3LP0A 4C98A 4ECQA 3U02A 3CMQA 4GVBA 5DGBA 2JZ5A 3FCVA 2AYMA 2KL8A 4WP3A 2OUGA 2FJVA 1HD0A 5B0AA 4NYPA 3QGHA 4PQUA 5IC4B 1CEZA 4B9MA 1YJ7A 1RWVB 2DNPA 4ALZA 3H7HB 1GTHA 4O4GA 2LQ5A 4Y6IA 1NK8A 1V3RA 5HQ8A 4KH0B 1DURA 2BM0A 2YX7A 1VR6A 5CZXA 5B0GA 3TZWA 4KRWA 5AJ3J 4ZPWR 3HCXA 5KFGA 1T7PA 5IM0A 2ZJQQ 2E9RX 4I2PA 2RNEA 1FX4A 2AJ2A 2KFYA 3CJSA 2DGSA 1KRPA 3KDOA 3Q24A 3UE2A 2CPXA 5DQHA 5LSRA 3UN3A 1N56A 4FXWA 3BR8A 4KPCA 3DI6A 2ZBRA 4CLKA 5KT6A 5CH7B 4LF8F 5C25B 1XMOF 1S1WB 5E3CA 4DR2F 1RA7A 5KFBA 4CYUB 4DXLA 4N47A 1PO6A 2UXCF 2HBRB 3RW7A 4G6VB 2R7TA 1WHVA 2YNFA 4G1PA 1U0SA 4Y2IA 5K8OA 2XB2D 1MW7A 3CIZA 2KYZA 3CGIA 3GJRB 2PSZA 4MKBA 3TAPA 1OIAA 5KFYA 2C2OB 3MUMP 4KH1B 2BQ3A 3V4MA 1VI7A 4A8YA 2H48B 2RT3A 3D6HB 1LWEA 5J2NB 3MFHA 1HL6A 4WK3A 1YX2A 1LK5A 5KFOA 1AW0A 4FNHA 2MY7A 4DFKA 2BOPA 4C11B 1FDDA 5GAGI 1JLAA 1ZOTA 4X4VA 2FJWA 4B9SA 1VQ9S 1JLQB 1N5YB 3NMRA 3CCUS 2QMUB 4OZ3A 1RWUA 1S1VA 5I3PA 1QDUB 3PR4A 4F3QA 2P8IA 4IFYA 1S79A 4ZJQA 4ZOSA 4DL4A 5ITHA 2OGUA 1D09B 3H20A 5KFFA 1HWKA 5F8HA 1RTIB 3C15B 2QLXA 1JLCB 4PG6A 1FRMA 3PW4A 4C9DA 4ZCIA 2Y0SD 4JI6J 2FQQB 1S59A 2HZCA 5D0GA 2LQJA 3I4PA 3QGIA 3OD2A 3QFWA 1UZHA 3HZEA 2CWXA 3M8PA 4DV5F 2X51A 2MZQA 3OVSA 1RJJA 1R6YA 5KT3A 1FD2A 4WFYA 1IQZA 2WBRA 4K4UA 4LJMA 2V4QA 4I56A 5K8NA 4ZPVR 3R27A 5DLFA 4ETXA 1RT4A 1FT8A 3GG0A 4UTGA 3IGVA 4PWDB 1RLDA 1HBNB 5F9LA 1UKUA 1NKEA 2HNDA 4NA1A 1S97A 3PR5B 1FKOB 2HRUA 7FD1A 2ZH6A 4LRBA 4RW8B 4QWBA 3ZTSA 4B9TA 3QNWB 4C2MA 1WEZA 4GO5X 4KQZA 4KY3A 1YK9A 4ES1A 5IV3A 4NLGA 2VPXB 1DTTA 4L3KA 2QE5A 1NKCA 3M8QA 2KT5A 1RT7A 4ATNA 1D8YA 4KO0B 1E6YA 1S6QA 2F8HA 1U1OA 4A47A 4EK2A 3LGHA 1RTDB 4HT7A 5JMNA 2YKQA 2RU3A 1H72C 3ET6A 2HBZB 3UFCX 1GMWA 1ELOA 1CVJA 1PBAA 3QJLA 1H3DA 2J6UA 1C0TA 3KJNB 3J80U 4NYZA 3VGVA 3UDEA 3BO4A 3HSJA 3ULHA 3BGUA 2JX2A 1NPKA 2XO7A 1M5PC 1NJZA 2QT7A 4DF8A 4P71A 4TYAA 5KFCA 1WC6A 2ZZNA 3I31A 3LAMA 1HYSB 2PMHA 4F26A 2XY7A 3D7SB 4JYAJ 1VC5A 3EWGA 3QRRA 1WOPA 3BPSP 4C8KA 1VQ6S 2HFZA 3PVXA 3OFHA 3K5PA 5J2MA 2DCUB 3GP9A 2RSQA 3FZ2A 5J1EB 2MQNA 3GQCA 2V2QA 3PDNA 2M4MA 2DY9A 3KHLA 2XCAA 1TELA 1WACA 4DFJA 1AFIA 1SUQB 3U27A 3BO3A 4RZRA 2VODA 3DN9A 2X1FA 4OHYA 3CJ2A 1WI8A 3CD0A 2M5YA 4PZVA 2NXNA 1ICEB 1YBAA 4E98A 2CNNB 2Q1LA 2V9KA 4HACB 1TL1B 1ZM3A 4ED4A 2QX0A 1LXJA 1VJWA 1EIYB 1CS4A 4F36A 3SEOA 2WTFA 4KGXB 1C1BA 3UW1A 2H51B 2ZD1A 3HSDA 4NLWA 4WZMA 1IKWB 2VJUA 5HP1A 2W8KA 3G8SA 4ZPDA 1C1CB 2V63A 5CZVA 3IBCB 4DBQA 4QPXA 2OP5A 4CO4A 4CH0S 2HNYA 4YR3A 5HROB 5T14A 3NRBA 1F6TA 2EXUA 4QIVA 3OL7A 5EX0A 4C7QA 4NLTA 3AAWB 5EDWA 4WFXA 3KXDA 5DLGA 1XTZA 4F25A 5CXTA 2CPEA 3ITHA 2X1GA 2DITA 1WSRA 4OI1A 2L41A 1M5HA 2FPHX 3HT3A 3ELHA 4RUAA 4ED8A 1FWPA 1FNXH 1RTZA 2MJUA 2PMWA 1TKXA 3L7PA 1PC4A 3BSAA 4XO0A 1TU0B 3FVYA 1WC3A 2UXBF 1U0HA 3OHBA 5D3GB 4ETZA 1KQSR 2G0JA 3N28A 1CPZA 5KFXA 3DRXA 1HMVB 4A8FA 9ATCB 4DFPA 3CD7A 3VAMA 5HMYA 2QL7B 4G65A 3NCRA 3VGSA 1XEZA 3W5YA 2DVIA 3N5BA 1VYAA 4MYUA 3LH2S 4X62F 4J9VA 5DDOC 4E8UA 1FE0A 4PR6A 3OVBA 4LF8J 3F56A 1IR0A 1XMOJ 2W2OP 3UD5A 2MHNA 2KH9A 2PA3A 4DR2J 1VLYA 3TQ1A 4KV8A 5F8GA 1R7IA 2UUAF 4X2BA 4LFAF 4C97A 5IV4A 2UXCJ 1MWYA 2CJAA 5DG8A 2OPSB 2KN4A 3OTOF 2UVUA 3VAHA 3RB3A 2QLJB 4IRKA 3VGTA 5HMXA 2AQ4A 3PIOQ 2IRXA 4CH1A 5L1LA 4DS4A 4P74A 4O3SA 1RT2A 4I7FB 1YRTA 2R7QA 3NGTA 2ZZTA 3PRVA 4JV5F 3FSYA 5L8RC 2C3MA 5LL6d 3MAHA 4UOHA 4U8VA 4XK8C 5DQIA 4O4RA 4FVMA 5GAHU 2V2ZA 3M6WA 1Q8BA 2EKNA 3IWXA 3IS9A 3J7YU 1S0NA 1UWBB 2R2RA 3AJ2A 2NUHA 4OJHA 3IG1A 3TVYA 1BQMA 2F8EX 3H2UB 3UN5A 4AXIA 2CJQA 5KT5A 5KFPA 4DCPB 1XMQF 4ILLA 3T5HA 3M2UB 1X4CA 4TU9A 1YITS 2WOMB 2Q43A 4PG7A 3W60A 2VL1A 3OTDA 1P8GA 2UUCF 3PYDA 4ZIWA 3H5YA 4LQ9A 1KWMA 1H98A 3RRHA 2DEJA 3ETOA 1VGYA 4DV5J 1UFWA 1A9NB 5BYQA 3R7BB 2V8PA 1KLMA 2HFOA 1XIQA 2VFRA 4ZVOB 1WDDA 1RT5B 4IRDA 4ZJLA 3LP2A 2FZGB 3MDFA 1QUPA 3BDEA 2C2KB 2BANB 4M5HA 2F5GA 4MK9A 4NI2A 1LFPA 3OBIA 1HKAA 5HVFA 4NXMF 2CWKA 4FYDA 2DGWA 2BQRA 3Q8SB 4F4AA 2KKHA 3LP0B 2ILYA 2DJWA 2DNOA 1KN6A 2IM1A 4UUWA 4GVBB 4X84A 1M0SA 5BR8J 1WOOA 2P9GA 2XI2A 4JV2A 2XS5A 3DRSA 4ZLPA 4XTTA 4PQUB 2NXEA 1SJRA 2ZH9A 4DU8A 4PUOA 2DXFA 4OHZA 3SV3A 5C42A 5ETRA 5KG3A 1FKPB 4JI7F 4CZCA 4ED7A 3FMWA 4A8KA 2HHPA 1KDNA 4LR8A 1KLNA 4M5IA 1YSJA 2E1RA 1S6PA 2RJZA 4KPYA 3OR1B 4P7VA 4DL7A 4DR4F 4QCLA 2CDQA 3TZYA 3KUEA 5BYSA 4KKOA 5ETOA 4K4TA 3G96A 1NM2A 3ZZYA 2V50A 1RWXB 3HX9A 1RAFB 5IM0B 3L09A 3FK4A 1TL4A 1YWXA 3FBBA 2EC2A 4MKVA 1JXLA 1K44A 4PG5A 5KFQA 1RTHA 2YNHA 1FRJA 1JLBA 1WC5A 1QJHA 1U1MA 4CLTA 2AEFA 2CQBA 1FRXA 3B6BA 5C24B 3OQ2A 2F1FA 1DLOA 5DRKA 1HHQA 1C4AA 1HI1A 4XAKA 1B7YB 1TFYA 5E41A 4N8NA 5KG1A 4X4QA 4K4YA 2G2ZA 1RYRA 2ZITA 2IMWP 4DL6A 4DDFA 2YNFB 2J0QD 4LR7A 4TY8A 2FHOB 4TLRA 3UCUP 2C1EB 2L48A 3QMQA 4CLLA 4F7VA 1LKZA 2HVIA 3KG1A 3ISNC 1JLGA 2EFOA 1NHUA 1UEVA 2IBKA 4W90B 1JLAB 2QLWA 4FNIA 2C2MB 3D54A 2G0IA 5KG6A 1S5ZA 2BDPA 2HZAA 3H5SA 3UVJA 4KGKA 1S1VB 2L9DA 2HWTA 4GRSA 3H90A 4OHXA 1R8BA 4IFYB 1OSCA 2C2RA 1JKHA 3HHLB 4M8LA 4N7TA 4DUYF 2EFGA 1OQ6A 1VISA 3UDVA 3H0PA 1TUWA 3FC9A 4O44A 5C2CA 4DUTA 2V5HG 1HW9A 2BMBA 1X9SA 2HGNA 1X5PA 2DR5A 2C3OA 5KFIA 1FNOA 2GGPA 3D1HA 2XZWA 3K5NA 2HVHA 2ZBCA 1GMWD 2CIMA 1WJ9A 3M32A 3Q23A 2ZHOA 2KDOA 1VS3A 2UXBJ 2R9LA 1S7HA 3S1TA 1PC5A 4EYIB 5T7LA 4ZVHA 3AQPA 2XLIA 2E5IA 1RDRA 1U1RA 1X4BA 2W9BA 3PNIA 4ECWA 1RT4B 4ZVRB 2XLKA 2RQKA 2X1AA 1NNDA 3VALA 3VF0B 2DXEA 4DL3A 1UVLA 1VRTA 4X62J 2HNDB 2IVYA 3QLHB 1S6UA 1N54B 1U02A 4A8MP 2HHQA 3HLUA 4LBIA 3EPGA 1OQ3A 3JYTA 1OO0B 4LFAJ 3K5MA 4DR3F 4JI0F 1JJ2R 4O3PA 1S1TB 3OTOJ 5GMDA 3IRXA 1DTTB 3JSMA 1NZAA 2EKYA 1UVMA 3W63A 2E5LF 1HNZF 2BJ8A 2EC0A 3DOLA 3TUZC 4FKXA 2AJQA 3K5OA 3V6HA 2RQCA 1E6YB 1S6QB 2XMUA 3N4WA 1U1KA 3R5AA 2R42A 2FVPA 4ZLNA 1T9VA 2CVEA 4JV5J 4F8RA 3AXMA 5U47A 4NLXA 4EBEA 1VHFA 4IH7A 3GCXP 3PXGa 3CPWR 1C0TB 2GAHC 2VHGA 4CWBA 4ECZA 2UU9F 1RT6B 2YPYA 2ZVIA 1UFLA 1KVIA 2KM8B 5HAOA 4V1Ak 4FBUA 2OSQA 3OJUA 1A7GE 3I82A 1EZZB 1T9YA 1CJTA 1AA1B 2QFIA 1N88A 2R7VA 3RB4A 4CLSA 2QA2A 2NSBA 2RRBA 1K8AT 4DN0A 4M5MA 4UQGA 2MY8A 4DPWA 3UPFA 1WELA 4J9KA 3UO0A 2WW8A 2YWHA 5J2MB 1KKHA 1BWEA 4LMZA 3FQLA 2OMLA 2PA8D 4F2SA 3TA2A 4LF5F 3D1OA 3I5AA 3OHAA 2UV8G 4K7QA 2L3MA 3LALA 5DM6Q 1SL1A 1SC4B 5F0WA 1Q53A 3MM7B 3RR8A 2M52A 1RQ0A 1S48A 4OX9F 2YX4A 3VVUA 1XERA 2MGZA 2P2CB 1X5OA 1CS4B 5D0RA 4IYQA 1S4EA 4C48A 1TL3A 1C1BB 2Z56B 3SSRA 4WCEQ 5HVHA 1HR0F 4FVCA 4ZHRA 4EFAC 4NXMJ 1RP5A 5HP1B 1RWWB 4KIAA 1WTFA 4ECUA 4USJC 4BBYA 4EO8A 2XY6A 5DG9A 1PJ7A 2A6OA 2HNYB 3A8KA 5BYRA 2XMTA 3TYTA 2AGPA 2H1YA 4H4MA 2WAQD 2HQFA 3F0NA 1P9QC 2PDAA 5GAEU 2WCXA 2FDNA 4RUBA 3POTA 3ITHB 3QJJA 2FUG9 2D3UA 1RK8A 3M8RA 2HQ3A 4JI7J 3G6XA 1JJHA 5KFAA 4PG4A 3LW5C 4J9NA 2POKA 4Y00A 3SFGA 4UW2A 1Y9OA 1TKXB 4ED5A 5IWAF 3GIIA 2N4DA 3DM2A 4DR4J 2HLTA 3NGUA 1RACB 4P52A 1U0HB 2MQPA 4EWTA 1WWHA 1T9TA 1YTYA 3MAAB 1SL0A 2LXIA 3TRGA 1SB6A 1JXEA 1P27B 2XO6A 5AT1B 2QEXS 2WHOA 1S9GA 3NOGA 3IAS9 2GVDA 2AJ4A 1HWLA 3WX4A 1NJIT 5C7PA 2FLLA 4V19J 2PN6A 4MIBA 3CE8A 4YEAA 3Q8YA 3MM9A 4X4NA 4LF4F 2HGLA 5KG5A 2DH8A 3D4JA 2JOQA 3AOAA 1YZ6A 1XNQF 2LKZA 2PO4A 2CZVC 2GMJA 2JDJA 4RUCA 3OSNA 4USKA 1YRUA 1RWPB 5A8RB 1HNVA 3D68A 4WFNQ 5BJRA 3BQ2A 2GJ2A 1R6VA 2CJXB 1OPIA 4ZVUB 5FLXY 4LRDA 5RUBA 1FTCA 1RT2B 3FMBA 2WVCA 4JB8B 2B4PA 2FJBB 2OEJA 2CQ0A 2HHVA 1IJEB 2R7WA 5KFDA 2HRYA 3CB4A 4FF3A 4LSZB 4UOFA 2E9TA 1JK9B 2AP6A 3U1MA 4IO9Q 2K1RA 2GQCA 4MAKA 2LEAA 3IS9B 2NUUG 3TP2A 4ANEA 3IG1B 3BZQA 3DU5A 1IBLF 2WSCC 3R7SB 4ZN1A 4DUYJ 2HMIA 2VDIA 2G9OA 4FYXB 5ETSA 4YS2A 3WBZA 2ZM6F 1KC8T 4PPZA 1SKWA 1EQ0A 5J2PA 1VK8A 1NKBA 4XDCA 2W2PP 2C2EA 2OTJS 3MR7A 4ES3A 2O67A 1FF2A 3PRBA 1T9UA 2HQIA 1HQEA 2HNZA 4ICLA 1NK9A 3D67A 4FBTA 1FVQA 1IKXA 3MXHP 5HL7Q 1TKDA 2NXCA 2OI2A 1ULRA 2Z2ZA 1NEEA 2H5JB 3PW2A 2AX1A 4FPRA 2DRDA 4K5SA 1S76D 1Y5IB 4JI5F 3MPDA 4EBDA 2ZOMA 1KLMB 2EFVA 2B43A 3IBWA 1UPMB 1S6OA 1VQ5S 3PEHA 2I6WA 1N48A 3QZ7A 3LP2B 3KG0A 1FRLA 3WIVA 3HD1A 5EHHA 1S57A 2VF3A 3CJ0A 2FLPA 4NI2B 4BWJA 4EGLA 3GIKA 2R2TA 4JOUA 2LMIA 1OSDA 4IDKB 1X7VA 2KG0A 3J7A1 2DD8S 4F4YA 2KB2A 1YRXA 3AODA 3V6DB 4O3QA 2RU9A 4DR3J 4JI0J 1SIZA 5B0EA 1U48A 4YUDA 1K9MT 2D41A 5L9NA 2JVRA 2GMHA 2E7VA 3FUYA 2LVWA 1I94F 3G9CA 5B7WA 1IR2A 3L95X 1NSAA 2E5LJ 4XPCA 1HNZJ 5EX3A 1WKKA 4OV6A 1RLCL 3CDWA 3NBPB 2F4FA 4MIWA 2R3VA 2E5JA 5K9FA 4PUOB 2IDEA 4K4WA 5C42B 2YWWA 2D3OR 1X4EA 3QWUA 4YB1P 1JLFA 4URGA 1FDNA 4DJBA 2UU9J 4FXVA 1S72S 3BGRA 4CM0A 2KVIA 2XMKA 3BYPA 4KKOB 1BHNA 7AT1B 2Z0GA 1TKZB 2ZVSA 4L74A 3OUYA 2Y1JA 3CCLS 3PW5A 3GWCA 3MEDA 1KHWA 2ADCA 4Q8FA 2OH2A 2CPJA 5KTQA 2HQDA 4F04B 2UUBF 1WHYA 4J7CA 1RTHB 3DLHA 1N5SA 4NLYA 2ZE2A 2DGUA 2D9OA 2JWNA 2VQFF 2H4WB 3C6TA 3JTPA 5AXKA 3PJ9A 4RW4A 3PZPA 3NNAA 1DLOB 2MMYA 2WSFC 2BRKA 2ZWPA 5KG0A 3CJQA 4ERDA 1MN9A 4LF5J 3VAFA 3FDSA 4G1QB 4QIFA 1J5EF 2MQLA 4LRFA 4TY8B 4IQXA 4Q7AA 3T1YJ 1P9YA 1X5TA 4OX9J 1BXNA 2J9EA 2J76E 3BKUA 2A2CA 4RU2A 2GFFA 1JLGB 4NXNF 1GQEA 8ATCB 3NMAA 1HR0J 4QYRA 3OL9A 3N6LA 3G4SS 3JB9k 1S10A 1UP1A 3VAIA 4LRAA 2FJEB 2VG6B 2J7WA 1NK0A 1RHKB 2MKIA 2R7SA 1EB0A 4FS1A 4I4BA 2WZ1A 1VHIA 4RBTA 2MPUA 4U6PA 1UTAA 1X5SA 3UVJB 1QSLA 2HHUA 4B08A 3B4MA 3QGPA 5AE2A 2AW0A 4EU0A 3KHRA 1GTEA 1YKWA 2D1CA 1JKHB 1CJVB 4ZJOA 1Z2LA 4DSLA 2ZKTA 1VQ8S 4X4PA 1CSJA 1WC0A 4O44B 2QYCA 3R1HA 3UR3C 3RJMB 3RRKA 4ED2A 3LGMA 5D8HB 1B4SA 5L1JA 2CJ9A 3VZHA 2RQ4A 2DNHA 3MPVA 2ROPA 3GFZA 2Z4PA 1U49A 1FXRA 4C8NA 1HNIA 5IWAJ 1T02A 1RAHB 5A6PA 4C0OC 2IBOA 3IN5A 4P2SA 1J27A 4FYYB 4MT1A 3QPIA 5J1NA 2J5AA 1VQYA 4XIUA 2FYXA 1RTJA 3K59A 3D3CJ 4H4KC 4WFZA 4F02A 1SC3B 1AUSL 1FRIA 3HM9A 1BQNA 2BE7D 2W9BB 4AFFA 2Z30B 1X9WA 2BABA 3ONQA 4EMDA 1PYTA 2CQ2A 1ZPWX 2OIHA 1IUJA 4LF4J 2R8GA 3LWMA 2OEKA 2Z57B 4YP3A 5THWA 5DGAA 5CYMA 5L38A 5H9EK 4KT0C 1XNQJ 3SCIE 1JX4A 3BH7B 3KJFB 3JYTB 2J7KA 4I69A 1NLKL 3OFEA 4V19X 3IRXB 5KG2A 4RW6A 4X65F 2H4YB 3Q8VA 2DNQA 4Q0BB 4A8XA 2AGOA 3KYLA 3OJSA 2YKNA 3SXLA 1ZZNA 2IVFB 2JH3A 3PRDA 4DL2A 3UDLA 1TMMA 3AY0A 4ZCKA 1U6FA 4C8OA 2CQCA 3CDAA 2XY5A 2ROEA 2MLXA 4WYLA 4I67A 1U26A 1Y3JA 4PPDA 2RVJA 3UN2A 3JAMU 4ID5A 3MEEA 2R7RA 2GVZA 2AYGA 3HZGA 1S9EA 2I5JB 2R8JA 4KFBB 1U8WA 5ETKA 1Q86T 1FXDA 3DOKA 2J0SD 1FJEB 1IBLJ 3QIPA 4N77A 1CJTB 3SDEA 1ZM2A 2DYAA 4LSNA 4NZ7A 4WXWA 3IRWP 3ZXWA 4IG0A 5KFHA 1F3FA 1BQXA 4RJVA 2JHEA 1U25A 3JTOA 3RW6A 2CPHA 4NEZA 3X1LB 3VWSA 3QO9B 4K2XA 2UVWA 4CNYA 1VBZA 4JI2F 4WE1A 1AZSB 1D1UA 2I2YA 3TAMA 3C8YA 2XWYA 1TMJA 1S0VA 3A12A 4DPUA 4TN2A 8AT1B 4X66F 3SSQA 4JI5J 1K1QA 5BXIA 1UJ4A 3HT0A 1EP4A 3THVA 2DHGA 2CQIA 4BC7A 2IM2A 4OZJA 2KXNB 1OYDA 3EX7B 4WZQA 5IFMA 4RNHA 4YB7A 5IT9U 2WB4A 4RO0A 2RRNA 2E29A 3MM5B 5LXRA 4X4SA 1V3ZA 3V4IA 4AL7A 3JSRA 3QFHA 1QLNA 4ZHRB 1H38A 4DF4A 4DLGA 4PRFA 1J5OA 2CDRB 1RWNB 1AYEA 1WF2A 5SUHA 3KLEB 1KNZA 3O8WA 1VIOA 2Z2YB 4N8OA 4DQPA 1IKYA 2GHPA 2YWGA 3CJKB 3ZC4A 3K57A 1I94J 1QVGR 2EG1A 3Q22A 4H4MB 2GZOA 1P1LA 3M4XA 5DG7A 3DXBA 3MMCA 3MPWA 1TFWA 5H9EJ 3POTB 2QSWA 4I68A 2OHDA 3H5XA 3Q0AA 3A3NB 5GAGU 3MMJA 2CQPA 4LFBJ
chains in the Genus database with same CATH topology
3CEDA 3U7JA 1TVRB 1KHVA 1VLYA 2XG8A 1ZM9A 3D2WA 3TQ1A 4KV8A 1V9OA 2V0NA 4OHWA 3OVAA 5F8GA 5KFSA 1R7IA 2UUAF 4X2BA 1MROA 3PW0A 2PD1A 4LFAF 3DLKB 1R8AA 3M6UA 4C97A 3NWGA 2LU2A 1NJWA 3M8QB 4NMLA 3TW0A 3FFIB 2HS4A 5KFZA 1VQLS 4LFBF 1MWYA 2W9AA 2CJAA 5DG8A 2OPSB 4R8UB 3DM2B 2LDIA 1RT7B 2B51A 2KN4A 3OTOF 1S49A 2NSCA 4QOTA 2ZZMA 1FJ7A 4RBVA 3NP5A 1CG2A 3VZIA 3VAHA 3RB3A 2UVUA 3DRYA 2AU0A 3H98A 3F41A 4IRKA 3DLGA 3PEJA 5AE3A 4U7CA 3CD6S 1Q81T 1UJ5A 5HMXA 3HK2A 2AQ4A 3PIOQ 2IRXA 5DDRC 4CH1A 5L1LA 3HF5A 4DS4A 4QJVA 2DHSA 3H2LA 2JEGA 1RKJA 4O3SA 1N32F 4URQU 5B08A 2KTQA 3TARA 1RT2A 3HXMA 4I7FB 3FSXA 3SCKE 1YRTA 4I2QA 3ISND 2RF2A 2R7QA 5EWFA 2XLJA 4LFCF 2GMLA 4QW8A 2M3DA 1U24A 2HHHF 4HDHA 1S9GB 4JV5F 2JLGA 4ECTA 5JUMA 3NLCA 3FSYA 3RZAA 5L8RC 2C3MA 2AX0A 5LL6d 1TL5A 3MAHA 3KK3A 3DRPA 3W2WB 4JI3F 4XK8C 2W7PA 5DQIA 4R5PA 2V4JB 5ADZA 3MM9B 1RAJA 4YB6A 2I1RA 1HWJA 1Q7YT 4O4RA 4FVMA 1K0VA 5GAHU 2V2KA 3K7RA 3M6WA 1VQ4S 2OKQA 4DWIA 1T03A 1Q8BA 3GYXB 2QA4S 5K8MA 1GXUA 3IWXA 5C5JA 5J1PA 4B9LA 2DGQA 2KRRA 3Q8PB 1H6KX 4U7UK 3IS9A 3Q2TC 3J7YU 5E7OB 1S0NA 5I42A 1UWBB 3FJ2A 2R2RA 3AJ2A 1YJNS 1S99A 1YJRA 2NUHA 2VFSA 1HW8A 4BWMA 5KFKA 2KZMA 4OJHA 4H4OB 2FVCA 2F8MA 5CA5A 5A8WB 3IG1A 3TVYA 1BQMA 4JI4F 2FTRA 3NNHA 2PMZD 2NZ4A 2F8EX 3H2UB 1VQNS 4F4WA 2CPDA 4AXIA 2CJQA 3F73A 3FZBA 1NB7A 4KE5A 2K2PA 2Z8QA 2KT2A 2E9ZA 3HHLA 2EFPA 4I1TA 2EFNA 3I32A 5KT5A 1ZTTA 5JVGQ 3PHEA 5KFPA 3UD4P 1HNVB 1LW0A 1XMQF 3OR2A 1KOOA 3CVKA 4ILLA 3DGPA 4DR5F 3T5HA 4OX7A 4TXSA 3M2UB 2JJ4D 4FZVA 2JFDA 3GSDA 4C4WA 1CQMA 1X4CA 2OPQA 1G7CB 4TU9A 2W8LA 2YX1A 1YITS 2WOMB 2MZJA 2Q43A 3CCTA 4PG7A 2MYFA 3CO9A 1HD1A 3I9V9 2VL1A 1REVA 3C46A 3OTDA 1P8GA 4QPTA 3E2EA 2PGCA 2GV1A 4J9QA 2UUCF 1L3TA 4WKRA 3DRRA 3R5DA 2XSJA 3H8YA 2ATLA 1F5CA 3CCRS 3K2YA 4ID5B 2IA0A 4HEA9 3H5YA 1FCAA 3G86A 3KLFA 3MEEB 2IHR1 2YWKA 2MZSA 1FO1A