1TKXB

Crystal structure of hiv-1 reverse transcriptase in complex with gw490745
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
430
structure length
404
Chain Sequence
ETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKDSTKWRKLVDFRELNKRTQDFWGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Design of non-nucleoside inhibitors of HIV-1 reverse transcriptase with improved drug resistance properties. 2.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords Pol polyprotein, Reverse transcriptase, Chain A
total genus 112
structure length 404
sequence length 430
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2004-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1tkxB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1tkxB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1tkxB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1tkxB03
5DGAA 5HLFA 1IKXB 2BRLA 4NLRA 1LWFB 5EWFA 3KK2A 5HBMB 5KFJA 2E9RX 1NHUA 4JV0A 5CYMA 2IC3A 1S0MA 4MH8A 3KLIB 4FBUA 4DEZA 5KFGA 1S1XB 1JLGB 3I0SA 3KLHB 5HBMA 4IFYB 4RW8B 3FSIA 5J2NA 1R0AB 2HMIB 3KNAA 3KLEA 5KFRA 5F8GA 4O4GB 4ECTA 2B43A 2JEIA 5KT2A 3RB3A 1CSJA 2ILYA 5KFXA 1RT6B 4O44B 5J1EB 1SV5A 1T05B 1S9EB 3DOKA 2ZE2A 3DI6B 1JLQA 2BR0A 3M8PA 4PQUA 4G1QB 4H4OA 5C25B 3NBPB 3BSCA 2CKWA 1RT2B 1TKZA 3JYTB 3RBDA 2YKNB 2AQ4A 4PWDB 1S0NA 1SV5B 5F8HA 4WZMA 2IM3A 4WZQA 5HP1B 3T1AA 3QGHA 3OLBA 1JLQB 2W9CB 1JIHA 1N4LA 1TKTA 4KKOA 2UUTA 2D3ZA 1TVRB 2F8EX 3G6YA 4DL5A 4J9LA 2V0NA 4KBIA 3T5JA 1UWBB 3HVAA 2QV6A 5KFOA 3T19A 4PUOB 4MIBA 4TQSA 2JEJA 1TV6B 1S1UB 2IJFA 2C2DA 1S6PA 1I6JA 3MECA 3V6KA 4WFXA 5C42B 5T14A 4J9NA 1IKWB 4RW7B 4O3RA 4PUOA 4NCGA 2OPPB 5DQIA 5KFVA 5KFFA 3TAMB 3HVWA 5EDWA 5FDLB 4F4YA 4EO8A 1N56A 2DPIA 3H98A 4ED7A 1HARA 2VG7B 2W7OA 1T05A 4ZPDA 1NHVA 4RW9A 3VQSA 4K4VA 1HQUA 2FJXA 4XPCA 1RDRA 5KFUA 3HHKA 1SH0A 1S1WA 2IMWP 3V6DA 4IRCA 3SI8A 2CJQA 4ZP8A 5D3GB 1FK9B 2AX1A 3M9OB 1RT3A 4NRUA 4IQXA 3CDUA 3IN5A 1FKPA 5JUMA 2W9BB 2EC0A 4EEYA 2HWHA 4RUAA 3QZ7A 3FDSA 4Q45A 5I3UB 2W9BA 2IM2A 2YNGB 4RW6B 4ECRA 1XR5A 4O3QA 1LWFA 4ID5B 4G3IA 2AU0A 1QE1A 3QZ8A 1ZTWA 4RU9A 2VG5A 4TXSA 3HVTA 1T03A 2O5DA 2BANB 2W9AA 4QWDA 1QAJA 4ID5A 2UVVA 4JV1A 3Q8PB 5L1KA 2OPSA 2E9ZA 3CWJA 1MU2B 2ATLA 2B5JB 3PW2A 4KFBA 2WOMA 4WE1B 1QAIA 5KFWA 3T5HA 4GC6A 4I2QB 4RW4B 1SUQB 1KHWA 4QWAA 1S9GB 3M9NB 3DLGB 1HYSA 4DL4A 3RBEA 1S10A 1QUVA 4TYBA 1C1BB 4MFBB 4ZMMA 1VRTB 5DG9A 1JLFA 1JLAA 1JLBA 3IS9B 1YVFA 4X2BA 1S48A 4MK9A 4ED1A 1N6QA 3UPFA 4K4SA 2XWYA 4K4TA 3RB0A 4KKOB 3LANA 3I0RB 1C0TA 4TN2A 4WXOA 3KJVB 1HMVA 5J2QB 1C0UB 4Y2CA 1RT4B 3KLGA 3M8QB 5KFMA 1C1CB 4NLYA 3QO9A 4ZPBA 2UVUA 3E51A 5KFQA 3H5SA 4NYZA 5KT4A 5DG8A 2W8LA 5DLFA 2IAJB 3GV7B 3DM2B 5C42A 4ZP7A 4O44A 5J1EA 1C0UA 5L1IA 3PZPA 1N48A 3LP1A 3JSMA 1TP7A 1C1CA 4QWEA 1S97A 3M8PB 2FLNA 1MU2A 1RTHA 5C25A 4TY8B 5KFIA 2DPJA 5KFHA 2HNDB 3DYAB 2YNFA 1ZTTA 5EWEA 4J9RA 1U09A 2ASDA 3GIMA 4RZRA 2ASJA 3N6MA 3PW4A 3MR3A 4NLWA 4Y34A 2HNDA 3DYAA 5KFSA 2YKMB 5EUHA 2FVRA 3FQLA 2UVWA 1T3NA 1TKZB 3BJYA 4DL7A 3MEEA 4NLDA 3MR6A 2V4QA 1JX4A 3OL9A 1LWEA 3MEDA 5F8LA 4WYLA 2W9CA 3DOLB 4QW9A 3GILA 4ED3A 2JC0A 5L1JA 5L9XA 5KFPA 2XC9A 1TL3B 1JLGA 3CVKA 1JKHA 4K50A 4I2PA 1HPZB 4ZHRA 5EWGA 3BQ2A 5KG4A 4O4GA 1RT1A 4NLQA 1RTHB 4K4XA 2RF2A 2E9TA 1S6PB 3DRPB 3UR0A 5F8MA 3C6UB 3CIZA 3PHEA 4IH5A 3V6DB 4ZVEA 3KOAA 3RAXA 1DTTB 1S0OA 4LSNA 4K4ZA 2IJNA 4J9SA 5DQHA 3PVXA 1FKPB 1IKVA 1LW0A 1EETA 2VG7A 1Z4UA 4J9MA 4NLUA 1T94A 4LSNB 5C24A 2XGQA 1BQMA 2B6AA 4MKBA 5C5JA 4Q0BA 5F9NA 3MEEB 1S1WB 5K14A 2W7PA 3E01B 1HNIA 5C24B 4ED2A 3D28A 3MR2A 4YR0A 4NLVA 3IGNA 3LP0B 1KLMA 2BANA 3E01A 3MEGB 4RW7A 5J2MA 2WONA 3FRZA 4NLSA 2I1RA 2OPPA 4KAIA 4IG3B 5KFNA 3EPIA 3TAMA 2HNZA 4TLRA 3UDLA 2RF2B 1RT7A 5J2PA 2WTFA 2FVQA 4WFYA 3PR5B 2HNYA 4R0EA 4M94A 1C2PA 2XCAA 1LW2B 2XI2A 2FVPA 3BGRA 3ICLA 5L1LA 4IOBA 3KMQA 3G6VA 1FKOA 3GQCA 4WXWA 3LAMA 2UVRA 4TQRA 4J9QA 1DTQB 4NRTA 3Q8QB 2D41A 1JLEA 1K1QA 2IM1A 4K4WA 1C0TB 2YNIA 1RT5B 1RT2A 3JYTA 3MF5A 4ED6A 4IH6A 4M95A 3KK2B 2ZD1B 2YKMA 1JLCA 4EYIB 1OS5A 5KG3A 2IC3B 2JC1A 1HYSB 1IKYA 3PR4A 1TKTB 4XO0A 3V6HA 1RTDB 3SFGA 1TVRA 1ZETA 3QIPA 2HAIA 5KG0A 2BE2B 4ED8A 4IFYA 4RW8A 2HMIA 4ECYA 3NAIA 3TQ1A 3KLEB 3GIIA 3HKWA 4F4XA 3DLKA 1XR6A 4RNFA 2WB4A 1VRUB 2XGPA 4J9OA 4RUCA 4ECZA 4ECSA 3BGRB 4EBDA 3CDEA 3C6TB 4ZPCA 3ISND 3DRRB 1FKOB 5I42B 4TYAA 3ISNC 2AGPA 1LWCB 4YMEA 2C22A 4H4MB 4WE1A 3I0SB 3KLHA 3CJ4A 1R0AA 4I2QA 3H59A 4H54A 1DTTA 1JLEB 3QGGA 2XI3A 4DL2A 2ZKUA 4LSLB 4U7CA 3UQSA 3KHRA 1VRTA 3KHLA 1GX5A 3DDKA 1JLAB 1JLBB 4IFVB 3PW5A 1S9EA 4KV8B 4KO0A 2OPQA 4R5PB 3T5KA 4YP3A 5KG6A 1HMVB 1REVA 5HROA 3PJXA 2I5JA 3KK1A 2GC8A 4IFVA 5KFTA 1RTJB 1JXLA 2C28A 3M8QA 1J5OB 4NLXA 1S4FA 5KG7A 3KLIA 3DLKB 2OPQB 2D3UA 3CO9A 1D0EA 2YNGA 4MK8A 1S1XA 1VRUA 3LP0A 3OL8A 4O3NA 4B3OA 2I5JB 3LAKA 3KK1B 4QWCA 4DL6A 1RTJA 3LP1B 3JSMB 1D1UA 2XCPA 3T5LA 2AGOA 3DOLA 1QE1B 1W25A 5I42A 3CJ2A 1LWCA 1IKVB 2VG5B 4QWBA 5KG2A 4ECVA 1NNDA 1TL3A 1EETB 4Q43A 3OSNA 2R8IA 1S9FA 5F8NA 2R8JA 2GIRA 3SFUA 3KK3B 5D3GA 4Y2AA 3OLAA 4NCGB 1BQMB 4ED0A 2BQ3A 1RT1B 1RT3B 3Q8SB 3Q8RB 3BSNA 3QLHA 2WK4A 2J6UA 4LQ9A 4EBCA 2WHOA 3OL7A 3RAQA 4IH7A 1SH3A 4U6PA 4JV2A 4RW9B 5KFKA 2R8GA 3DRSA 3QIDA 4Q8FA 4YR3A 5KFYA 1RTIB 5CYQB 3BSOA 4RNHA 3CDWA 4RNOA 2V4RA 3PJWA 4ZVFA 2ZD1A 2BQRA 1TKXA 5KG1A 3KLVA 1TV6A 1DLOA 1TQLA 4IDKB 1RT7B 1IKYB 3D5MA 3MECB 2YNHB 3I0RA 4IRKA 1S1VB 1IKWA 3QIPB 1HPZA 4ZHRB 3OHBA 2BE2A 4KHMA 3H5YA 4F4ZA 2FLPA 3ITHA 2V9WA 3MFIA 4R8UB 4LQ3A 4O4RA 2OPRA 4ZP9A 2OH2A 3BQ0A 4GC7A 4ECXA 2R2UA 5DQGA 5KFAA 4EO6A 1DTQA 3BQ1A 2WRMA 3NGDA 4DG1B 5J2NB 1HQUB 5KT7A 3DLGA 5J2PB 2QE5A 3CJ0A 2IM0A 4J9PA 2YNIB 4IG0A 4URQU 1RT6A 1JLFB 3I5BA 4DG1A 3V81B 4YQWA 1LW2A 3I5AA 2B6AB 2WCXA 3DI6A 5KT3A 3DRSB 4K4UA 4PQUB 2FLLA 1RTIA 2C2RA 2VG6A 1RTDA 5JXSA 3KJVA 4O3OA 4PWDA 3KLFB 3V81A 1S9GA 1S1TA 3QO9B 4OL8A 4NZ0A 5KT6A 4ECQA 5KFZA 1K1SA 4KO0B 3PW7A 4O3SA 3FFIB 1KLMB 1RT5A 1HQEB 2IAJA 1WNEA 5KFEA 1REVB 5HROB 2WONB 3IS9A 3KLFA 2R2RA 2FJWA 3OSPA 4IG3A 1J5OA 2R2SA 4FBTA 4YR2A 3DLEA 3NAHA 4MIAA 3GV5B 5DG7A 3HVTB 1T03B 4DL3A 3KHHA 2ASLA 2AX0A 1EP4B 2JEGA 1BQNB 4J9KA 4B3OB 4HYKA 4IRDA 1TL1B 4NLOA 3IG1A 2OPSB 4LSLA 3MTKA 3QGIA 4QW8A 3LALA 3DRPA 1EP4A 1S49A 1RA7A 3C6UA 3LP2A 3GYNA 1TL1A 2RKIA 3DMJA 1N5YB 2JEFA 2BQUA 3V4IA 3IG1B 4IR1A 4I7FB 2RDIA 3N6LA 5KFCA 4NLTA 3DRRA 2W8KA 3RB4A 3CJ5A 1LW0B 3IRXA 2FVSA 4H4MA 4TY9A 3LP2B 3BSAA 1RYSA 1LWEB 3MEDB 1N5YA 3H2LA 1JLCB 4FS1A 1S1TB 4I7FA 5KFBA 5KT5A 3H4BA 3H5XA 4JUZA 3H4DA 3FFIA 3N6NA 3NBPA 4ZP6A 5DGBA 1HNVA 2IBKA 1IKXA 4NLPA 4KHRA 2ALZA 5F8IA 4I2PB 2R2TA 3KHGA 1KHVA 2GIQA 5DLGA 1GX6A 4URSA 3GV8B 3NMAA 1TKXB 5FDLA 4RNNA 1MMLA 3OHAA 1S6QA 3DM2A 4RW6A 1UWBA 3GIJA 2HWIA 3GIKA 2J6TA 4Q8EA 3ITHB 3TVKA 3OL6A 1S1UA 4K4YA 4HKQA 4TY8A 1JKHB 1RA6A 2YNFB 3QYYA 5KG5A 4FS2A 3DOKB 4ECWA 4ZVGA 4ICLB 3V6JA 1FK9A 2R8HA 4G1QA 4NLGA 2IA6A 3IRXB 1IM4A 2FJVA 3H40A 2YKNA 4KFBB 2AWZA 5HP1A 4ICLA 4KB7A 4ZVHA 4KE5A 1SUQA 1DLOB 3QLHB 1HNVB 2UUWA 4QPXA 5KFLA 3BREA 5F8JA 3EZUA 1RYRA 5J2MB 4WYWA 1N6QB 2HNZB 2FVCA 4ZPAA 2VA2A 4R8UA 4XPEA 1S6QB 2OPRB 2AGQA 4Y3CA 3MFHA 4EYHB 5CYQA 2C2EA 2HNYB 3KMSA 5HLFB 1HNIB 5J2QA 4RNMA 3G86A 1RT4A 3KLGB 4IDKA 2YNHA 2J6SA 3EPGA 2B5JA 1S1VA 2BRKA 2ILZA 3MEGA 1BQNA 2WOMB 3KK3A 3FQKA 5KFDA 3RB6A 3G6XA 1RAJA 3M9MB 3H5UA 4RW4A 3BR9A 2RDJA 4WFZA 4ECUA 3I5CA 2VA3A 4F50A 2JLEA 3C6TA 3MR5A 4KSEB 1C1BA 2VG6B 4MK7A 3PW0A 3NKYA 4F4WA 3IGVA 4URGA 2RKIB 3DMJB 2ZE2B 3V4IB 1SH2A 5F9LA 4O3PA 2D7SA 4Q0BB 3CJ3A 4H4OB 5K14B 4EBEA 4IG0B 4IKAA 1HQEA 4Q44A 3NL0A 2R8KA 4IR9A 5I3UA 5CYMB 1XR7A 3DLEB 4KV8A 4MKAA 4R5PA 4MFBA
chains in the Genus database with same CATH superfamily
1YDLA 1OY9A 2YKOA 4CLFA 4KTQA 1IKXB 1QAXA 1UFWA 2BRLA 3B78A 3I4HX 5HBMB 2E9RX 3ULHA 4JV0A 5CYMA 1EJ7L 2KT2A 4WPAA 3VGVA 2QSFA 3KLIB 4DUTA 3TZXA 1NJWA 5KFGA 3CJQA 4BLGA 1OQ3A 1S1XB 2B4UA 4FF1A 2BJEA 1HFEL 2KVIA 2HMIB 1Y5LB 4DFJA 3KNAA 3UCUP 1HI1A 3GFYA 1YBAA 3VVUA 4UQTA 3CCUS 2A3JA 3RB3A 4DWIA 3EGZA 2ASYA 4DX6A 1RT6B 3BBCA 4O44B 1APSA 1OJ4A 1Y7PA 3TAQA 3DOKA 4RKUC 1GK8A 2XHWA 3GU0A 5L8RC 2MSSA 4G1QB 4H4OA 5D15A 3NBPB 2J9CA 4FYVB 1YTYA 4CH0S 5IWAJ 1S0NA 4ZLLA 1BY9A 5G4DA 4R25A 3QAUA 3FSXA 2KG0A 3FZBA 2HFVA 2Q6CA 3LO3A 3FBBA 3D1HA 1N4LA 3OLBA 4FYYB 3ZO7A 2HHTA 2IVMA 2UUTA 1NK7A 4J9LA 3GE9A 1L3UA 2P6TA 3HVAA 3CIMA 1URNA 4JI1J 2QV6A 5KFOA 2AZ1A 2QL7B 3T19A 5E3QA 2CZVC 2OP5A 4TQSA 2QLJB 1I94F 2JEJA 2HSEB 2VFTA 2IRUA 3U1MA 3U1NA 1S6PA 5LOQA 3MECA 2C2DA 2B9WA 3ZNUA 4J9NA 1R27B 1D9AA 3ISZA 2DGXA 5DDPC 4P7TA 4O3RA 1HHSA 3CJ8A 1Z2LA 4KY3A 2R7TA 1M0SA 2YQ3A 5FDLB 3TUIC 1ZZNA 1CS4B 1HD0A 4EO8A 2EK6A 3UW1A 4ED7A 1ELOA 1HARA 2VG7B 4DPYA 2W7OA 1YG0A 1ZOTA 2VBWA 1VOMA 1UVMA 2ZUGA 3VQSA 5AXNA 4PR6A 1WSVA 1HQUA 2Y8WA 2KO1A 1R0BG 1RDRA 1H2TZ 5B0FA 3PV8A 3GJRB 5ETVA 4F7VA 3VR1A 1XMOF 1N0UA 4IRCA 5CYJA 2AKWB 1FRMA 4CQ1A 5D3GB 4P73A 4LF5F 4P2FA 3TQEA 2CRLA 1PJ6A 2K8GA 2NXEA 1RT3A 1YBTA 3BYPA 3MPYA 4LRCA 3IN5A 1GH8A 1N8RT 2IYIA 2W2MP 2EC0A 1NEEA 1WG4A 1Y00A 4C2MA 4C3MA 3CUNA 4NEZA 4EEYA 2MZQA 4RUAA 3HT3A 2ZBQA 3TRGA 4DFMA 4W90B 2JWNA 2KJVA 1KLNA 5I3UB 1WSRA 2W9BA 3JTNA 2BX6A 4OIXA 2MQOA 1ITPA 2QLBB 2JLFA 4USMA 1R31A 2QYGA 4F25A 1LEOA 2H54B 2GJIA 4PEOA 3SYZA 4J37A 2UUBJ 4G3IA 4OZ0A 1TELA 1ZTWA 1W26A 1ZM2A 4JOUA 2VG5A 3VCDA 4RU9A 1T03A 2O5DA 3IAM9 1QAJA 5LT5A 5ADZA 1NDLA 2MEWA 1WHVA 2OPSA 2HKEA 4EGLA 3R2DJ 1PYSB 3CWJA 4N8OA 2QC3A 5BXIA 3CC7S 1F60B 3TUPA 2PIIA 3T5HA 2APOA 4GC6A 4HTIA 1SUQB 4QWAA 2PFFB 1DARA 7FDRA 2HVEA 1C1BB 3AHPA 3W60A 3D6FB 5K5MA 1KEKA 4ZOSA 3GG1A 1JLAA 1JLBA 2PO4A 1FDDA 2R7OA 4ED1A 2H4WB 3DGPB 1N6QA 4DI6A 4DV5F 3UD4P 4K4SA 2Z30B 2CWXA 4KKOB 2D1CA 1T9YA 3TJAA 2RS2A 5AJ3J 4Y6IA 4DV0J 1PILA 3QPIA 3ONQA 2AT1B 3AJ1A 4ERDA 3KLGA 4USTA 5KFMA 1WHXA 2MJNA 4JI5F 1EX8A 5KFQA 2WB1D 5LMUF 1YIJS 1X0FA 3AT1B 2JVRA 4H4KC 1U6FA 3C14A 3M05A 5HQLA 3EGNA 5C42A 4O44A 1C0UA 2LXIA 4QWEA 3D68A 4C9DA 2MZTA 2DHAA 1MU2A 1RTHA 2FLOA 4JI6J 1X5TA 3CTRA 4LFAF 4GVBA 1WTFA 3ZZ0A 2JRSA 2NS1B 2HNDB 4J9RA 1HWUA 3D6HB 2LCWA 1KVKA 4QBUA 1U09A 1DURA 4RZRA 1UCNA 3CJSA 5HANA 3EM1A 2GJ2A 1AB8A 2E1PA 2XMTA 2LECA 5KFSA 4DMZA 4FXWA 2NPIA 1TR0A 5T7LA 4DF8A 2HVZA 3HFZB 2HWTA 4F3OA 2PC6A 1U1NA 1HBUA 2ROGA 2Z58B 2FHMA 3TO8A 5CAAA 3S8SA 4WFNQ 2ZH8A 2UVWA 4V19J 1B0TA 4PPDA 4DL7A 2MDAA 3MR6A 1YI2S 1JX4A 5HI7A 4ZIWA 3MEDA 3OTCA 3MUMP 3QRRA 1NH8A 2M52A 3MAAB 4GKJF 2YWKA 3AD8C 3DOLB 4ID8A 9ATCB 2Y0BB 2ZUAA 3CT9A 4QZVB 2AW0A 2JC0A 5AE3A 4K0KF 3GJTB 1J5EF 1G2EA 1K0VA 2NREA 4MYTA 1JLGA 4HDHA 1M90T 3H2VE 3BQ2A 5EWGA 3I31A 3VAGA 1N34F 1DQAA 3PTWA 5U47A 1RT1A 1RTHB 4K4XA 3K17A 2N82B 4A8MP 4P7VA 3QQCD 2UUAF 2HHUA 1BXNA 2J7UA 2HBZB 4OJHA 4DR4J 4WKYA 2RHQB 3RAXA 1AYEA 4DV5J 1ZS6A 4YN3B 2IJNA 2V6AA 3NOGA 2CPJA 4ILRA 2XZDB 1RWWB 4PCQA 2ZFHA 4KHPF 1FKPB 4O3NA 4B3MF 1SKSA 2GMJA 1N33J 2CPZA 2L9WA 5IXUA 1X9WA 1X4HA 2MKCA 2N3LA 2XGQA 3H25A 1N5VA 2B6AA 5HMWA 4OZ5A 1RADB 2ZC4A 1H73A 2DNPA 4Y2MA 2HK3A 5F9NA 3MEEB 5K14A 4L74A 4A4JA 2XMAA 4I56A 4F0HA 2VBZA 2CG8A 2ZH5A 3M32B 1KOHA 3HFVA 4WU2A 3D28A 3ETMA 2RIJA 2W25A 3MD3A 3MMCB 3KDNA 3MR2A 4CYUB 4NLVA 1KTQA 4CLUA 5IOLA 4IQMA 2DNLA 3N0VA 2RILA 4EI2A 5B0BA 4X4NA 3E01A 3MEGB 1FWKA 3HJFA 1S6UA 1JWWA 5J2MA 3FRZA 3CMAS 3EVOA 5T41A 2OPPA 1UKUA 4QCLA 4PG4A 2HNZA 3IBCB 3SCKE 2RF2B 2RQKA 3EICA 5D0HA 5J2PA 1UW9A 2ZH1A 2WTFA 1G3OA 2VPYB 2CQHA 1T9VA 4F0MA 1HR0F 4CO3A 1HWIA 4M94A 1KS2A 2XCAA 1TFWA 4CH7A 1CC8A 2KXNB 1CEZA 1E6YA 3C15B 2B9XA 3ICLA 2CPIA 4IOBA 3MURP 3O6QA 2DO4A 4LF9F 4N8NA 2ZBCA 3MPDA 4WXWA 1NK9A 2UVRA 3EVWA 4J9QA 3S01A 1FJGJ 2PA3A 4NRTA 4AQYF 2Z0GA 3A3PB 5GMKa 2XM3A 4E0DA 1IWAA 1JLEA 1K1QA 2MKYA 1UFKA 4LRAA 4DUZJ 2DT9A 2ZITA 2VONA 1RT2A 4J9UE 2WSFC 3AD9C 1Q86T 4JI3F 3I4PA 1C4CA 3Q22A 4M95A 3TR5A 2KRBA 3G96A 3D6TB 4OLOA 2LXFA 3FCWA 2IC3B 2JC1A 1ACMB 1FRJA 1TKTB 2WBRA 3DHXA 2QMWA 2AEFA 3V6HA 1S59A 3H2UB 4G1PA 1TVRA 3J7ZT 1HNWF 1ZAXA 2XZWA 1KVIA 1ULRA 3W2WB 4WF9Q 3DU6A 2R42A 3NAIA 1NK8A 2NXUA 1E6VA 3DLKA 1XR6A 3B8HA 2IRYA 3M8YA 3PNIA 4GO5X 4IUFA 2XB2D 3NS5A 3GFHA 6FD1A 3Q23A 1SJ1A 4G1IA 4FNIA 1MWQA 3CDEA 2C3MA 3C6TB 1KTVA 4HR2A 3DRRB 3D0IE 4TYAA 3A12A 3QAEA 5A8RB 2VH7A 1Q82T 1JXVA 2N7CA 1A7GE 3D9BA 3O3LA 3I0SB 3CJ4A 2OEJA 2KYZA 1JLEB 3ELHA 3QGGA 3HD1A 4LSLB 4FDFA 2HVDA 3VAKA 1VRTA 1AW0A 2GIFA 1RWUA 3RBZA 3VAFA 1SC1B 2BW7A 3QSYB 4C98A 3HK2A 2OPQA 4R5PB 3SMZA 2UXDF 2LEPA 4KIAA 3MPWA 3OR1B 1M5OC 3PJXA 2I5JA 1JXLA 4IFVA 1FX4A 3ZTPA 4USKA 1I51B 1S4FA 2LDIA 4DFKA 2H5IB 4OZ1A 2OELA 2BM1A 4OZJA 5CD4H 2U1AA 4M5NA 2KTQA 1D0EA 1SI9A 2YNGA 1S1XA 1VRUA 3LP0A 3PYDA 3EJMA 4B3OA 3KK1B 1U0HA 4KH1B 2EFQA 2O3DA 4QIGA 4ZVSB 3JSMB 2XCPA 3T5LA 4DR7J 1U25A 1SKWA 3DOLA 2BXJA 3R2CJ 1QE1B 5LSRA 3NG8A 1LWCA 1SQFA 1NB2A 4QWBA 1LKZA 5DG9A 1LQ9A 4CLPA 2V8DA 1NSAA 3R5CA 3KK3B 1TZ0A 1CJVB 3OLAA 1OYDA 1RT1B 3S7RA 4DV3F 4A8QA 1ZAWA 3THTA 5B0CA 2WK4A 3BDEA 2DNGA 4I6WA 1UVKA 2P5VA 2WHOA 2SXLA 3RAQA 4TVAB 3L3CA 3DXSX 2QYCA 4L6V3 2VBYA 3AH6A 4FKYA 4TU9A 2R7SA 2RJZA 2W4DA 4QYZK 2GHWA 2DCUB 4USVA 3FK4A 2RE1A 3OR1A 3K2YA 5KAKA 2L41A 5CH7B 4RNHA 5LXRA 1S4EA 2M9KA 4OZLA 4P72A 4W4MA 2KVQE 2V4RA 4ZVFA 2ZD1A 1X5OA 2I38A 3M2UA 3OTDA 2W7AA 1GXLA 3JQJA 5KG1A 1M5VC 4IDKB 1IKYB 3MECB 3I0RA 2HRUA 3M6UA 1RISA 3P4UB 5IC4B 3OFHA 4X62J 1U48A 1IKWA 1L3SA 3QIPB 2HGNA 1M5HA 3JXOA 2BE2A 2DGSA 4WP3A 3SQGB 1URRA 3ZTOA 2F40A 4OHWA 5E3CA 3G71S 2JH3A 2V8HA 3HLUA 5KOWA 3RBXA 5L46A 1LWXA 4ZP9A 2G0JA 2CNLB 2Z2LA 3OD2A 4KGMA 1UW4A 5DQGA 1DTQA 2DHHA 2WRMA 4DG1B 3JB9k 4RWWA 1V3RA 1IWGA 3CDBA 5L38A 3CJ0A 4N41A 3TW0A 2IM0A 4J9PA 2AJFE 4DLGA 3NNCA 4DF4A 1UMJA 2HIYA 3W3SA 3I5BA 1YJVA 2Q79A 1Q5VA 4AD6A 1B3TA 1VRQC 2DH9A 2LKZA 2RDDA 4FPRA 2UXBJ 4K2XA 1REGX 4DZDA 3A8EA 2Y3YA 4ZJLA 5C2GA 2LFVA 4KJIA 3GSDA 1V5IB 2F4VJ 3OQ2A 1XEZA 2XZTB 2KT5A 3LGNA 1D8ZA 4YY3J 1F0XA 1NLKL 1RHKB 4OL8A 2ZH3A 3QO9B 1ZBTA 4ANDA 4ECQA 1K1SA 4KO0B 2L08A 2J7WA 4NASA 1WNEA 4ZKAA 3RU0A 4NA2A 4PG6A 1REVB 3TA2A 5KFEA 2BJ3A 2FJWA 4RU2A 4DSKA 4IG3A 4ES3A 5IM0B 5DETA 2R2SA 2ALYB 5IQ6A 2UU9J 1ZAVA 1CPZA 2J0WA 5DG7A 1T03B 1XIQA 3KHHA 5A8RA 4YB7A 2ASLA 4J9KA 5BJRA 3TA0A 2XMVA 4LF9J 3AODA 3IG1A 2OPSB 1XERA 4LSLA 3MTKA 3QGIA 4P74A 2E44A 1LXNA 2V63A 3C6UA 2ZWOA 1U49A 2C1EB 3R6GB 3DMJA 1N5YB 1RAOA 2FHJD 3DHWC 4I7FB 3ZZPA 4NXNF 1Q8KA 2DK2A 1Q8LA 4DFPA 2W8KA 4NLGA 4NLTA 3DRRA 1MSWD 1RBOB 1J27A 3LP2B 2V2QA 1RKIA 3GMGA 3HT0A 5M2PA 3FJ2A 4IOAQ 1U6BA 3N6NA 4QR2A 2N4DA 4V1Ak 2IBKA 2DCLA 2HHPA 2ZWPA 3J7AN 4NLPA 3KYLA 2X1GA 3OTBA 3J81j 2KKHA 1X4AA 2CJAA 4F3MA 3PDNA 3KHGA 2PGCA 2X1FA 1GX6A 1X8DA 2FUG9 3OHAA 4ED4A 1NJYA 3DM2A 2BABA 2XYPB 3O5TB 1UWBA 1RTZA 1X4GA 2NR0A 1NZAA 3VAHA 2J0XA 1RAIB 5DDRC 5IQQA 4KPYA 4QQBA 5ETLA 1NDKA 4CTAB 3ETOA 4HKQA 4RX6A 2KU7A 2F7VA 1F3FA 3QYYA 3CW2C 2YBVA 4GMKA 3DOKB 4ECWA 1LK7A 2HS3A 4JB8B 3V6JA 3R1HA 1FK9A 1R8AA 4DX7A 4G1QA 2GS8A 1SIZA 2EBGA 5LM7E 1SBRA 4UZBA 4FYWB 3CCSS 5JVHQ 2IA6A 3IRXB 3H40A 3K5LA 1NJIT 2OGUA 2FJBB 2FQQB 1WDDA 2M3DA 2CQBA 4KB7A 4ZVHA 2V50A 3GR1A 3K89A 1MROA 4DL0C 1DLOB 4EFAC 4ZJQA 2YPYA 2YX4A 2Z2ZA 1OSDA 3WIVA 3ENWA 1B64A 1DJ0A 3DLJA 2QG9B 2AYMA 2QEXS 1N6QB 2DR8A 5K8NA 2OPRB 2HBYB 2RVJA 3MFHA 2D3OR 3CB4A 3B82A 2A6OA 1RU1A 2C2EA 5A8WB 5HLFB 1YGYA 3KMSA 2COLA 4LR9A 2F8MA 2NQPA 3QMQA 3TEGA 1VJWA 2CNNB 2Y1LB 2CJ9A 4IDKA 3NEKA 4AL7A 1HNXF 2VDHA 4L3KA 2J6SA 1MMDA 2B5JA 2OKQA 2Y1RI 3PYGA 4HT5A 2ILZA 5IV4A 5HO4A 3HJVA 5IT4A 1RAJA 3H5UA 4ECUA 1Q4RA 4N56A 2LQ9A 2RUSA 1KSPA 2JLEA 1VYAA 4MK7A 2OTLS 3CCWA 1IR2A 2GX8A 1YLXA 4URGA 2LXUA 4KT0C 3V4IB 1SH2A 1T9WA 2DGQA 2W2QP 3I9V9 4C0BA 5IZHA 5F9LA 4B3TJ 4DV4J 2BUNA 4TU8A 4MAKA 2ROEA 3QJPA 1HQEA 1ZZFA 2LU1A 5D6GA 1CG2A 1VQ5S 2MLYA 4LRFA 2CQ0A 5I3UA 1RE1B 3CSKA 5CYMB 2I0XA 3GP9A 2E29A 2AEJA 1F9HA 3R5GA 3CEDA 4CZCA 4LFCJ 4MFBA 4CIOA 2HAFA 1S79A 4K5SA 3KK2A 1RAHB 4X4UA 3EVMA 1GQEA 1NHUA 3ET6B 2IC3A 2BJ9A 2VPZB 5IFMA 1EIYB 3NLCA 4PRFA 4FBUA 2FHOB 2E1MC 2CAJA 4DEZA 5IV3A 2KDOA 2HS0A 4PABA 3KLHB 3FSIA 5HBMA 2WSCC 4LMZA 1R0AB 1VR6A 4C8KA 3IC1A 3OVAA 5JMNA 2P2CB 4QJVA 2ZH2A 3A3NB 3SSSA 4O4GB 5KFRA 4ECTA 2JEIA 1HBNA 3HM9A 5KT2A 5LL6d 1LFPA 2ILYA 1XQIA 3EDRB 5KFXA 5H9EJ 2XEXA 1SV5A 1T05B 2PN6A 3EZ5A 1S9EB 5HQ8A 1VQLS 2Y1IA 2OIHA 3LQVA 1TMJA 2MZJA 5IC6B 2A2CA 2BR0A 4PQUA 4B9TA 1GMVA 2DITA 3SV4A 2DYAA 3BSCA 3JYTB 1TKZA 3RR8A 4ZLPA 2JLGA 3HZGA 2HHQA 1VHIA 2IM3A 5HP1B 3DGPA 3QGHA 4NX9A 1JLQB 4M5DB 1JIHA 2PT0A 3W2VA 4X4TA 4DSEA 3M8ZA 3BB5A 2NZCA 2VPXB 2G1DA 1TVRB 2PE8A 3G6YA 3A8JA 5F3ZA 4DL5A 3W61A 3IO1A 4BC7A 2ZBIA 4DR5J 1PO6A 2CZ9A 3FEYB 4PUOB 1EKSA 4MIBA 1PAEX 1E6VB 1S57A 1KOOA 1TV6B 1NRKA 2IJFA 2MKJA 3V6KA 1O8BA 4WFXA 2G2OA 5E5NA 4A8WA 2UZAA 3EWGA 4HHJA 5SUHA 2DRBA 1G6BA 4B3TF 5KFVA 5KFFA 4QPTA 3GIRA 2JOQA 4DCOB 4WP8A 3SDEB 2DPIA 4C7QA 2XS2A 4L3NA 1Q81T 2CVEA 2BE7D 1VMBA 1T05A 5A2QY 4DUYJ 1VBYA 3P5TL 4C97A 4RW9A 3CCES 2ADCA 2DEIA 1UJ5A 3QRPA 2MXYA 5KFUA 2G0IA 1DFDA 3HHKA 3R7BB 4OHVA 1S1WA 3NY0A 1TUGB 2IMWP 3SI8A 4ZP8A 1VK8A 1KDNA 2QLFB 1GXUA 3LTOA 1FK9B 2B0GA 2WAQD 1PSDA 4N47A 4OZ2A 1YBUA 2LA4A 4HI1A 4NRUA 1M1KT 4NZ7A 2R4FA 3CCJS 3GTYX 2H5JB 3VGUA 2HWHA 3QZ7A 1Q95G 3IWXA 1Y5IB 2C2ZB 5ETPA 3W9JA 2QFJA 2AYBA 1SC3B 2NXJA 4RBUA 2VJUA 1FXLA 2V68A 2XQCA 3RRKA 4C8YA 3CNQP 4DR6F 1FFGB 1AT1B 1FTRA 1X4BA 1I94J 2DGTA 2AEMA 4I68A 4O3QA 1NPPA 1U1RA 2AU0A 3AXKA 3FCVA 4DV6F 3MM7A 4C3KA 4B9NA 3WHIA 3P3DA 2X51A 5K8OA 2FHKA 2BANB 3JQKA 3DU5A 2A10A 4QWDA 2MQPA 3IXQA 2W9AA 2M88A 3PFOA 3Q8PB 2E66A 2XYHB 3MM5A 1P1TA 2E9ZA 1FDAA 2MY8A 2ATLA 2MPUA 5ETQA 2CQIA 2A1BA 4KFBA 4D3GA 5KFWA 2L3MA 2QRRA 1GNKA 3A13A 1HNZF 2C2NA 4FVCA 3DLGB 1HYSA 1VGYA 4ZN1A 3LGMA 3RBEA 3B4MA 1BWEA 4MFBB 3M2RA 3NXZA 1P27B 1U24A 2HVHA 2OJ3A 3M30B 1TK0A 1RZMA 2VKRA 2W1BA 2X3DA 3CCZA 1WC3A 2HGMA 3I0RB 1C0TA 4I0WA 4P75A 3X1LB 1TTHB 4WXOA 3KJVB 3UN3A 1LOUA 2VFUA 4Q2LA 1C0UB 4FF3A 2HLTA 1RT4B 2HPUA 2YPZA 4Y2CA 5HSPA 4DV7F 2IJRA 1CC7A 3E51A 1NK6A 1X4CA 4OI1A 5KT4A 5DG8A 2G9OA 1R8PA 2WVCA 3HSDA 3GV7B 4GVBB 8ATCB 3JSMA 3PCOB 1C1CA 3TX0A 3NS6A 2V2ZA 3M8PB 3ZZZA 1NBEB 4MKYA 3Q8YA 4NCBA 2YTCA 1YRTA 4NXNJ 1WF2A 2QT7A 4TY8B 2J9DE 2DPJA 1UWAA 2AIRB 2EFNA 4KRWA 4F4AA 5EWEA 1IBKJ 2DIUA 2YWGA 2MY7A 2ASDA 4JI7J 4M63A 3CJKA 1NK0A 4DR6J 3CMES 1XN9A 5E3RA 3W9IA 3PW4A 4OX9J 4PAAA 3M2RB 3SQOP 4FXDA 4YFUA 4Y34A 2HNDA 1T7PA 5EUHA 1XTZA 3OW2R 2ZZNA 3JTPA 3BGUA 1K0TA 4NI2A 5D0GA 4QYRA 2V5HG 1AZSA 2C2KB 2EW9A 4G65A 1TKZB 3BJYA 3OL9A 2G13A 4WBFA 4Z7YA 7FD1A 1ZPVA 4PXBA 5ETKA 5HVHA 2W9CA 3QT6A 1X7VA 4A8OA 2HYIB 5L9XA 4UOFA 2MHNA 3LUYA 1TL3B 3AY0A 4FVMA 2V4JA 4USIA 4DV1J 4K50A 3HO1A 4ZHRA 4CLWA 1Y0HA 4USUA 2J76E 3OFEA 1R43A 1KONA 3HHNB 5CCMA 3FMBA 3EGWB 1HHTP 3DRPB 3TZWA 4CO1A 4RWXA 3HI9A 3C6UB 2VC1A 2WW8A 3A1YG 3PHEA 3KOAA 1TAUA 2BJ8A 2I2YA 2IY5B 1V3SA 5E3PA 4LSNA 4K4ZA 2V67A 3O8WA 3AOCA 3Q8UA 2MLZA 2FZGB 2J8AA 3DGVA 4C6AA 1D3WA 2NLWA 5DQHA 1IKVA 1IJEB 1JMTA 1JXEA 1UZHA 1VI7A 3PVXA 1EETA 3B6BA 3R5DA 3JQMA 4J9MA 2F1FA 1T94A 3OXGA 4JBCA 1HWKA 1O0PA 2GAHC 2PI4A 3VQTA 1T9XA 3D1QA 2XO7A 3P45B 3A8KA 5GADI 5B0GA 1ZPWX 1S1WB 3M7VA 1X9SA 4HHUA 2VQFF 4ETXA 5C24B 3RGIA 5A76A 3CCVS 1S5ZA 4RPFA 3MM7B 2UXDJ 1V3ZA 3G6ES 1U1QA 3IGNA 3LP0B 4NA1A 4J9VA 4YHHJ 2H4YB 1H3DA 4E2FB 2CA9A 4JI0J 4NLSA 2I1RA 3LGHA 3GCWP 4IG3B 3HHLC 3PRVA 3SCJE 1YITS 2C2MB 1RT7A 2W2PP 5F0UA 3QT8A 3BKUA 3PR5B 3UCGA 2ZZMA 2HHSA 2PD1A 3GPAA 4KGXB 3ZNJ1 1C2PA 2OFGX 1YQHA 2AP6A 1NH7A 2DXEA 2MQLA 2FVPA 3BGRA 3MHYA 5L1LA 1FKAF 3TZZA 5SZTA 4LFCF 1SJ4P 2KFZA 1ZM3A 4TNOA 8RUCA 3Q8QB 4PG8A 1KQKA 3SZ2A 4HLBA 1RLCL 1LXJA 1WEZA 2EG1A 3R5AA 3V4MA 5LMNF 3VAMA 3M1VA 1UVNA 4B9SA 4LR8A 3P5BP 2YKMA 1JLCA 3ILOA 5H9FK 1IKYA 4U9RA 3ZTSA 4OYIA 3V2UC 2KYXA 4DR3F 3SFGA 3CCRS 4OFZA 2WSEC 4LVOP 5LSOA 3HHLD 5KG0A 1XMOJ 2BE2B 3SQGA 3VV2B 2HMIA 4ED8A 2QTWA 1FEEA 1XJWB 3TQ1A 3GIIA 2ZOMA 4TLQA 3K8WA 3R9LA 2PMHA 1VIXA 2WB4A 3ILIA 3X3UA 2XGPA 2GZOA 4PG5A 3CF5Q 4WFAQ 3Q0AA 4EK2A 4EBDA 2DNHA 3UVJB 4ZPCA 3G8SA 3ISND 5I42B 4ZK7M 4NCAA 1DHMA 3ISNC 3ENAA 2VJVA 5AXKA 2VBXA 4WE1A 3KLHA 2CQGA 2P9CA 3OJUA 4I2QA 4X66J 2GNKA 1TL4A 3L09A 4L75A 2PMWA 4OYMA 4OZ3A 4U7CA 3K0JA 4ENOA 3KHRA 1WF0A 4NA3A 3W62A 1JLAB 1JLBB 4ED5A 4IFVB 5G0RB 3F73A 1SL1A 2KI2A 1IBCB 2CQPA 4BCAA 3LWLA 4DLEA 1CJKA 1HKAA 1FI4A 1ICEB 4AT1B 2HHHF 4YP3A 2HQIA 1HMVB 3HZEA 2GC8A 4L72B 3MUTP 1S77D 4CO5A 3W5YA 4XDDA 5KG7A 4P2SA 3PX4A 2JVOA 1Z2ZA 1H98A 2GQCA 2KHDA 2OPQB 3TEHB 4DOZA 2CDQA 1FDBA 3MUVP 4QWCA 2FYXA 3PFEA 3NCQA 3P8BB 1ZM9A 1MMNA 5I42A 1NZ8A 2GHVC 4ECVA 1A9NB 1IKVB 1RU2A 4HHHA 1U1OA 1NNDA 2NYIA 2R8IA 4AFFA 2GIRA 2BBEA 3LWMA 3BBFA 3GYXB 4Y2AA 4FF2A 4DBQA 4K7QA 4QIFA 3Q8SB 1R89A 3Q8RB 1WOOA 2GV1A 1SKRA 3GG0A 2RQ4A 1DZ5A 2X7IA 2LQ8A 2IVYA 2OD4A 1NJZA 4M5KA 4ETZA 1SL2A 4IH7A 1FA0A 1U8WA 3OVBA 5KFKA 2CQ3A 4CWBA 4MT1A 2CIMA 3DRXA 2WBMA 3NWRA 1H7WA 2R8GA 4LF6J 3D1OA 4Q8FA 3T3FA 1MN7A 4N5SA 1NU4A 4UT4A 3RZAA 1RTIB 4DSIA 2MZRA 4AL5A 1UL3A 2DD8S 2PI5A 2D9PA 1VC0A 2BQRA 4F2RA 1TV6A 4R0JA 4ZVOB 1VQOS 1RT7B 5A2QU 3HKZD 3NMRA 2GHPA 3KJNB 3M8SA 1HPZA 1WC6A 2CXEA 4FN5A 2YKQA 4C8LA 1WI6A 1YSJA 4M5JA 2RQCA 2VF3A 2ZBRA 1GTHA 3HULA 3MM8B 1HW8A 3MFIA 2VIHA 4O4RA 5E7OB 4LQ3A 4LRDA 1H2UX 1IXKA 1IJFB 1S12A 2KRRA 4W98A 3C14B 2R2UA 5DJBA 4EO6A 2P9GA 1P9YA 3TARA 1EHWA 1N5QA 4USHA 3HMJG 2ACYA 3EGVA 4ZCMA 2W2NP 2Z4PA 4HEA9 2N3OA 1QAYA 4LR7A 4URQU 4FYXB 2IPOB 5HJXA 7AT1B 4CT9A 4Y0FA 1QJHA 2B6AB 2OMOA 4ELVA 4K4UA 4AXIA 4PQUB 2UU9F 3T6BA 1RHQB 2HQFA 3ZZYA 2D9OA 1RTIA 5M2UA 2FLLA 1RTDA 4DPTA 3K57A 2QJ3A 3M32A 3D66A 3BF4A 2AMCB 2J9DA 3MMBA 4ER8A 4WU3A 1S1TA 3PW7A 5KT6A 3IR7B 4F0KA 4CYUA 5KFZA 5EHHA 3FFIB 1RT5A 3S1TA 5HROB 2R2RA 1U26A 3M30A 4P2XA 4F36A 1J5OA 2B4PA 1V5VA 2LA6A 4YR2A 3DLEA 2QLXA 3GV5B 2P8IA 3L4BC 3HVTB 1L3KA 2FIUA 4JI1F 5D0EA 4OX9F 2JEGA 3AXMA 1BQNB 3POTA 1NUEA 2OEKA 4UZCA 9RUBA 5AXLA 1TL1B 2KM8B 1NPKA 3FBEA 1UPPA 4M1KA 4NLOA 4ES1A 1IVZA 5AE2A 3NGSA 2IVFB 1VIOA 1F5BA 3LALA 1F5AA 1O51A 1S49A 3W65A 1FRLA 2FPHX 1B0PA 4DN9A 2A18A 3LP2A 2CVIA 1VQPS 2Y9HA 4IR1A 2XMWA 3V4IA 3IG1B 2FTRA 3ZZRA 2FJEB 4EUVA 4QR0A 4DS5A 1CJKB 1VQ4S 3U02A 4CDIA 5KFCA 2DNKA 2NUUG 4JI2F 1WC5A 1GT8A 2W01A 3KWMA 4CO0A 1G4CA 1ROFA 4LREA 4K5RA 4TY9A 3BSAA 4USWA 2ZJQQ 3MEDB 3H2LA 4MYUA 1RYSA 4DV6J 1R0CB 1B7FA 3H4BA 1VS3A 1IN0A 3CJKB 1MN9A 5KT5A 1YHQS 1ZH5A 3H5XA 4JUZA 2IFXA 3I82A 3NBPA 2EEYA 1UJ4A 4DXLA 5DGBA 1YJWS 2JHEA 2LEAA 1KD1T 2QSWA 2E5IA 5A0YB 2R2TA 3OXLA 3HXMA 3ET6A 3OFGA 3IBFB 3GV8B 1K8AT 4I4BA 3VWSA 5FDLA 5RUBA 2NPFA 1MMLA 3DLBA 2GGPA 4FPIA 3I32A 1U1MA 4RW6A 3QGPA 1QUPA 3HHLB 3MZIA 4DUZF 4QIWD 3GIJA 2J6TA 1NSKL 4Q8EA 3TVYA 4PPZA 3WZ0A 5KOXA 1KVJA 4NL5A 3RR7A 3OL6A 1UAWA 2PDAA 4TY8A 3NS7B 2KFYA 3KXDA 3W9HA 1FJEB 3OBIA 1HI0P 2FDNA 4KHPJ 2VOPA 4DR7F 2K3IA 2AYGA 2H48B 4ICLB 4Z2XA 4DV4F 2ERRA 2HQCA 2R8HA 3FEZA 3HSZA 4RO0A 3RG6A 3UDCA 1GMUA 2L9NA 5DZ6A 2W2OP 1IM4A 4C0OC 4YUDA 5GMEA 3CC4S 4KFBB 2AWZA 4B08A 4KE5A 2OD6A 3QRQA 4OV1A 4DCJB 1I3OB 5DO2A 1QDUB 2MB0B 5J2MB 3J80Y 2FVCA 4WK3A 4A8KA 3MM9B 2ZH6A 2GGPB 3MEKA 4Y3CA 4DQIA 3KG4A 5CYQA 2Q6BA 3T6JA 4EYHB 4OJ3A 3HSJA 1BWVA 2HNYB 2Z2MA 1UVLA 1HNIB 5J2QA 2KJWA 3MMAB 1KFDA 1RT4A 2G2YA 2K7KA 4DPOA 4YB5A 1EQMA 2LEBA 3EPGA 2P9EA 2BRKA 2LQBA 5KFDA 3HSGA 5CABA 3RB6A 3BR9A 5D77A 3I5CA 2XLKA 3DDIA 4F50A 3UNGC 1WWHA 4OI6A 3C6TA 3ZZOA 3MR5A 4KSEB 1C1BA 1RWMB 1G7CB 3P49B 1U47A 4RUBA 3UN5A 1AA1B 4F4WA 4JI6F 2LQ5A 2RRAA 1VBKA 4LF6F 2RKIB 4M5GA 4UOCA 2JL9A 3BN4A 3C3LA 2O67A 1YZ7A 3L7PA 4IKAA 3NL0A 2BMBA 1UA1A 4IR9A 3TA1A 2DHGA 3G87A 3A4TA 3DDNA 4U95A 5LMUJ 2DGUA 4DV7J 2HLUA 2CWKA 3GFZA 1XR7A 3K7RA 1RACB 3DLEB 4MKAA 3H90A 3VAJA 2N7YA 3Q86A 1JJ4A 5DGAA 4PWUA 3DC2A 3POTB 4NLRA 4OJ1A 5I3QA 4ZLJA 4AQYJ 1RAAB 2R7VA 2GVDA 4EMDA 4LF7J 2HFSA 1Q5YA 4MH8A 4DDFA 1TK8A 5FD1A 4F67A 2KB2A 1ZM4A 5CZVA 4WTOB 5E2QA 1LK5A 5L39A 4DSLA 2XS7A 3I0SA 1MG7A 1WC4A 2K1RA 5J2NA 2HIQA 2YQ0A 2YWEA 3D3CJ 1N88A 2QN6B 4M8LA 3JS9A 3AOBA 3QBCA 3KLEA 5B09A 3T1YF 5D4NA 5DS7A 3UNYA 3UD5A 6AT1B 4V19X 2RS8A 5J1EB 2PFDA 1A6LA 3MD1A 4G6VB 2B4VA 1JLQA 2EFPA 2HURA 3GJQB 2GAGC 1QTNB 2P6SA 3Q89A 1WC1A 4PG7A 2RRNA 4PXCA 3TJ9A 1SVDA 4C11A 3NNHA 2R9LA 3RBDA 4OYXA 2YKNB 3VVTA 2AQ4A 1QSYA 1SV5B 3WX8A 4WZMA 4WZQA 1T9TA 1F2HA 2YWHA 4OX8A 5DDQC 1N33F 2ZM6F 5AJ3F 5GAGI 1SPBP 3HX9A 3MDFA 4KBIA 4CI0B 4DX5A 3T5JA 5CHCB 1DQ9A 3DRYA 5IM0A 5J1PA 4RUHA 4HACB 1VHFA 1S1UB 2C42A 2W4CA 3I87A 2MLXA 4LJMA 3MPUB 2AJ4A 5C2CA 3FCHA 4HVZA 1X5SA 1IKWB 2AJ1A 1XK8A 3B54A 4NXMF 4RW7B 2BZ2A 2VFSA 4PUOA 1CJVA 5DQIA 1UTAA 2MQNA 5THWA 4F4YA 3TAMB 3HVWA 1N56A 3H98A 1JJHA 2MHEA 2MGZA 3W66A 3ILLA 1NHVA 1HBMB 3N5FA 4K4VA 2H3EB 3M6VA 1N32F 3VGSA 2OI2A 4XPCA 3R7NB 1N0VC 1SH0A 3LPEA 3I9ZA 3TYTA 1RWKB 4EWTA 1NPRA 3ZZTA 1NKCA 1PBAA 2DR7A 2UXBF 4KGKA 4IO9Q 1CULA 2YH1A 2HFUA 2YVSA 3PEHA 4DHVA 1WUUA 1FKPA 2O1PA 5JUMA 1PGZA 2VDIA 3W7BA 4DQRA 3CD5A 3IR5B 2CQ1A 2XSJB 4NMLA 1CJTB 3LW5C 4U8VA 4DR2F 3TI0A 2D74B 4C4WA 2CADA 4Q45A 4NE9C 1HNXJ 2UUBF 4DSJA 4FYDA 2IM2A 4B9UA 3KKFA 1FDNA 2J0QD 2OHDA 3G82B 4ECRA 4P52A 4JYAJ 4LT6A 4B9VA 3ZTQA 3HDSA 5GAHI 4FF4A 3LH2S 1LWFA 4ID5B 1NMEB 3F41A 5IT9Y 1KR4A 1MLAA 1GFWB 2QMUB 3QZ8A 3J7A1 3MM9A 1YJ9S 4OYAA 2UV8G 2KZMA 1JJ2R 1RBLA 4ZS6A 1VC6A 3DOMB 2H51B 5L1KA 4CO2A 3K8VA 2Q1LA 3PYEA 1MU2B 3NP5A 2XG8A 2B4OA 1F2GA 2GO9A 2EVZA 4YDXA 3PW2A 1D9FA 4WE1B 2NXCA 1VBXA 4I2QB 2Q3PA 3E8OA 3M9NB 1S9GB 5CXTA 4DL4A 2RMLA 4CLYA 1H6KX 4TYBA 2PSZA 3N5BA 5F3TA 3KG1A 2KXHA 4J7CA 4ZMMA 1JQGA 3AB2B 3N28A 3D0HE 1JLFA 1FFSB 3IS9B 1YVFA 2BJDA 2QX0A 3AA9A 1Y11A 3N01A 4MK9A 1TU0B 4RR5A 2F9JA 1VDHA 2FJAB 4PYAA 5J1NA 3VZIA 2VU5A 2XWYA 1HBUB 4K4TA 3RB0A 1D9DA 4TN2A 2ZEJA 3FC9A 1T9UA 5A8WA 3FSYA 1HMVA 3HCXA 2R7WA 1O6XA 4Y28C 1IBLJ 2RNEA 3MMBB 2ZJPQ 3M8QB 6FDRA 1C1CB 4NLYA 2ADBA 1YRUA 1NDPA 2V9KA 4BBYA 2W8LA 2DY9A 2V69A 1HR0J 1P9QC 2IAJB 2BACA 4RBTA 1RAFB 4UOHA 3DM2B 3W2WA 5HJYA 4ZP7A 5J1EA 2U2FA 3PZPA 4B17A 3LP1A 1R8HA 1TP7A 2AV5A 3Q2TC 3CD6S 3UFCX 1X4DA 4OLPA 1LNQA 1X5PA 4OQJA 3R7SB 2B8PA 4CTAA 2O66A 2LDYA 5KFIA 3PJ9A 2M7SA 3MM8A 3DYAB 1ZTTA 4S0MA 3BYRA 5A8KB 2FZCB 3GIMA 3K58A 4GKKF 2ASJA 3UD3P 1MW7A 4QR1A 4JYAF 4DQSA 1G1XA 3N6MA 4DR5F 3MR3A 2MQMA 3M1VB 3UN2A 1UP1A 4A48A 4ZIVA 4ILMA 2YKMB 3BPDA 2FY8A 4X66F 4DN0A 1BQXA 4LF5J 5IS2A 1MROB 3FQLA 1V9OA 1WC0A 1T3NA 3MEEA 2ZBPA 4NLDA 1CBKA 3BN7A 4GVLA 3WIUA 2V4QA 5F8LA 2MZSA 2WW4A 3MOZA 4A46A 4WYLA 1L3VA 3GB0A 4QW9A 4ZVPB 3WDOA 4ED3A 1O5JA 1S76D 1Q0NA 2V94A 4LSZB 4K2JA 4NMXA 4Y65A 1YJ7A 4B02A 5KFPA 1WD6A 2XC9A 3CVKA 4CCHA 2MKSA 1SJRA 2KM8C 4I2PA 2UUAJ 1PYOB 1HPZB 3FRYA 3EXYA 4ZVQB 3E2EA 3Q8VA 4IOCQ 4O4GA 4NLQA 3I6PA 4YDDB 1IM6A 2RF2A 2E9TA 2DHXA 1S6PB 3EE3A 1EAYC 3UR0A 5F8MA 1IBMJ 3PKMA 4I6YA 4IH5A 1BHNA 4U96A 4ZVEA 5IT0A 3OUYA 1Q8BA 4NZ6A 3PX0A 1KN6A 1DTTB 2RSQA 4J5OA 1S0OA 2DNMA 1RAGB 4M5IA 1FT8A 1IR0A 4U7UK 2F65A 1MNEA 1JNZB 1CS4A 1OPIA 1U2CA 3AA8A 3J81U 1LW0A 1HNZJ 2HHXA 2VG7A 2XSJA 1SJFA 1Z4UA 3PEJA 4LSNB 2OUGA 5C24A 2H9ZA 1BQMA 2XYGB 3IAS9 4MKBA 3L95X 4X62F 1RI7A 3QJJA 5C5JA 1NCLA 4HL9A 4Q0BA 1HWJA 2W7PA 3GCXP 3BO4A 1Y9OA 2FGCA 3BKFA 3AD7C 5DM7Q 1TL5A 2R7QA 3I96A 1N5TA 4X4QA 4Q2MA 4UY85 4HI2A 2G2ZA 2YQ1A 3THPA 1RUSA 4ZJOA 3ZTRA 4QU7A 1H38A 2QFIA 3E3XA 3CO0P 2FHJA 4KAIA 5KFNA 3EPIA 1FXRA 1PBUA 4TLRA 5GAGU 3TZYA 3EX7B 1KC8T 2XS5A 4NYPA 2FVQA 4M5MA 1RJJA 1Q1KA 3KUGA 4J90A 3K5OA 4WFYA 2HNYA 4DR1F 5B7WA 3OJSA 3OT9A 2XI2A 1FWLA 2VZ9A 1PAUB 4FZVA 3W63A 4JV5F 3KMQA 5ETTA 3TUZC 3K5PA 2CDRB 4CLKA 3FMWA 2YKAA 2CG4A 3LAMA 4ATNA 4TQRA 2JDJA 3IP0A 1DTQB 3WX4A 2ZDOA 1CVJA 2HBQB 2EC2A 2E7VA 1FRHA 2HGLA 2IM1A 1VCTA 1RABB 3JYTA 3P96A 2UP1A 2DR6A 1P8GA 3MF5A 2YKPA 4IH6A 3J81Y 2CJKA 3KK2B 3MCNA 4I69A 3MR7A 1MWZA 5KG3A 1DY3A 2ZDPA 1IBMF 1TFYA 1RSCA 1YZ6A 2R7UA 2OSRA 1WHYA 4KH0B 1U2FA 2G1HA 2C3YA 2CJYB 2HAIA 3PXGa 1NKBA 4EZ6A 1KRPA 4IFYA 4RW8A 3U1LA 2KH9A 2CQCA 2MQ8A 3O1LA 5E3AA 1RWVB 2BV3A 1VQMS 3PX6A 3HKWA 4CLTA 2GMHA 1X4FA 3T9NA 2ATCB 2FZKB 1VRUB 4J9OA 3Q2SC 1L3TA 3HHLA 4RUCA 4K0KJ 2HQ3A 3C66A 4ECZA 2PMZD 1EARA 2BOAA 3L7UA 3OXFA 8AT1B 2LP4A 2AGPA 2HHHJ 1LWCB 3DN9A 2BEFA 3SBMA 2IBOA 4H4MB 2BW2A 1N36F 2DH8A 3W2VB 3H59A 1QY7A 2XI3A 2DNZA 3D67A 3QATA 2EK1A 3DFEA 3UQSA 3PIOQ 3UCZP 1TAQA 4OHYA 2GO8A 2B7BB 1GX5A 3QFWA 4OI4A 4BWMA 4B3MJ 4I6AA 4B3RJ 1YJUA 4JI7F 2RB7A 3S6EA 3CCMS 4CT8A 4B3SJ 3H20A 5CA5A 5HROA 1H2VZ 5KFTA 2ZNYA 3R97A 2NZ4A 1J5OB 1FJCA 4CNZA 2X1BA 2JFKA 2DXDA 3KLIA 3DLKB 3K5MA 2VQFJ 3CO9A 2MZ1A 2V9WA 3AAWB 1R8CA 2GJFA 1RBAA 3T41A 2XLJA 4DL6A 1RTJA 3MM6A 2XY7A 1D1UA 2M8HA 2AGOA 1KNZA 2M70A 2XMJA 3JSBA 4KGVB 1HHQA 1W25A 3SXLA 2KZZA 4CLSA 5KG2A 2EKYA 4PZVA 2DRDA 3M8RA 2XNQA 4Q43A 3CCTA 3JTOA 5F8NA 2R8JA 1FEHA 1BQMB 2BQ3A 3RAMA 1RK8A 3UDEA 2DNOA 3MAQA 3BSNA 2PEHA 3QLHA 4XK8C 3SCIE 1WG5A 2VQEF 4LQ9A 3P6YC 1T02A 1VFJA 3VAIA 2XTJP 5HVFA 2D3O1 1BUXA 3OTOF 1T95A 4F26A 2CYYA 3PM9A 3RTVA 3GR0A 3QIDA 4DZ6A 4BS2A 4YR3A 3GFXA 3BSOA 3IM8A 2DXFA 4CLLA 1BD6A 1WG1A 3CDWA 1TL7B 5EX3A 3PJWA 4X4PA 2HQGA 4LBPA 1F6TA 1TKXA 3CULA 2KG1A 1DLOA 4QOTA 4XAKA 4QU6A 3BPSP 1T3OA 4IRKA 5LJ5Y 1S1VB 4O23A 2GA7A 1QSSA 4ZHRB 3OHBA 1DRZA 2FLPA 4F4ZA 3BM7A 4E8UA 4PYDA 2EBEA 4R8UB 4N76A 2OPRA 2RHSB 2FD2A 2M4MA 2OH2A 3BQ0A 3CD0A 2YWFA 5I4MA 5J2NB 2YY3A 1MWYA 1HQUB 2AJ2A 2DNNA 3D4JA 3DLGA 5B08A 5J2PB 2VFVA 3RRGA 4XDCA 1IBKF 5C7PA 1RCOB 1L5UA 1VQKS 4LUBA 1BE4A 1RT6A 2DHSA 3DOMA 3V81B 4AXJA 1U0SA 4LRBA 5D4LA 2VUGA 2EFVA 4FNHA 1SJQA 1UZDA 4UF4A 4ZDNA 3RYLA 1SC4B 4UUWA 4DR3J 5LSLA 5JXSA 2ZC3A 3KJVA 1WELA 1SB6A 3SCLE 3KLFB 3W64A 2E5HA 3W1YC 4OYOA 2R3VA 5G0RA 1XNQJ 1S9GA 1S7HA 1QSLA 4NZ0A 2F4VF 1RHUB 1W2IA 4N7TA 4OJGA 1KLMB 4O3SA 1HQEB 4NWBA 4YY3F 1Q79A 1RCXB 2WONB 3IS9A 5A6PA 1SJ3P 5BR8F 3CCLS 4DV3J 3NNAA 1J2VA 4DV0F 3MMJA 4MIAA 2OO4A 2BOPA 5IWAF 2FC8A 2AX0A 2YXLA 1VQ7S 3TNVA 3BGFA 4Q7AA 4C8ZA 5AXMA 4FKXA 4OV6A 3I56S 4JV5J 1P1LA 3PRDA 2CPEA 2GW8A 3CDAA 4QW8A 3T1HF 3DRPA 1EP4A 1RA7A 2VASA 1VISA 1RQ0A 1TL1A 2RKIA 2JEFA 2F5GA 2BQUA 4LFAJ 4JI0F 1NB7A 2OSQA 1F9EB 2RDIA 3D7SB 3JAMU 4OI0A 3N6LA 1UVIA 1RWXB 3RB4A 2FVSA 3IRXA 2J8SA 3JAMY 4H4MA 3CJRA 1WJ9A 1TK5A 5H9FJ 3QJLA 1LWEB 4ZPWR 2HFZA 2H65B 1JLCB 1NSPA 3BBBA 3EXCX 4HDGA 5ETRA 4FS1A 2VOOA 1HWLA 4ZPVR 4FXVA 4ZP6A 3J7Z5 3SEOA 2RH3A 3U27A 1HNVA 4CM2A 5D8HB 1CQMA 3C16B 3D2WA 1IKXA 2C3PA 2DR5A 5LJ3Y 4JI4F 3BEGB 1CJTA 1TUWA 4ZCIA 5DLGA 2AD9A 2B56A 2MYFA 2XHCA 3NMAA 2GQ2A 4RNNA 2CNKB 1VK3A 3FUYA 3ILJA 1TKDA 3G82A 3A3OB 1M1GA 4WKRA 2BJ1A 2AF6A 3M6WA 2HWIA 3AQOA 5EN1A 4F02A 3CGIA 3ITHB 5HMZA 5FJ4A 4X65F 1FNXH 1R6YA 2FJDB 1RKJA 4K4YA 3ENVA 4A8SA 5K8MA 4LBIA 5KG5A 5HQMA 2MQQA 3SV3A 4RLEA 1AROP 4ZVGA 2OMLA 3QWPA 1FTCA 4B9LA 4MMOA 1VJQA 1WTBA 3RW6A 2YKNA 3GJSB 5E33A 4ICLA 2CPYA 5H1SV 1HBOA 1SUQA 3MOJB 3PACA 5ETSA 3QLHB 1HNVB 2BA9A 2DGWA 2LU2A 2UUWA 5DM6Q 1B70B 3J7YI 5KFLA 4DV1F 3GWCA 1AFIA 4UY8T 1VQNS 1RYRA 5H9EK 3AOAA 2H1YA 2DEJA 1KQSR 3IBWA 4LFBJ 1UETA 2IDLA 4WYWA 5K9FA 3CE8A 2GCFA 1BMQB 4XPEA 4R8UA 1Y3KA 3ZXWA 1KBRA 2CFXA 3BR8A 3DNCA 2DO0A 4RNMA 1WORA 1YX2A 4DSFA 1KP6A 3KLGB 1I5OB 4UW2A 1HI8A 3C46A 3BKTA 2AHOB 2B51A 4XTTA 1WOPA 1S6OA 1RAEB 3G9CA 4I67A 3RW7A 1S1VA 2KHCA 2KXFA 4CP5A 1ZA2B 3MEGA 1AXQA 3RJMB 3ZC4A 1BQNA 2WOMB 4CLZA 5HMYA 3G6XA 4RW4A 3SIPB 2RDJA 3FNNA 4WFZA 3BO3A 4LF8F 4ILLA 3NWGA 1XMQF 1FVQA 2F4FA 2QZ8A 1FFWB 3F56A 3NKYA 4Z37A 2R7RA 2WVFA 4JI8F 2ZVSA 1NDCA 3IA0A 4P71A 4MTPA 3TOQA 2ZE2B 2F63A 4O3PA 4Q0BB 1UEVA 1W7WA 5K14B 2HZCA 1UJ6A 3MPVA 2R8KA 4X64F 3N4WA 2HHVA 3DCAA 3FBCA 4DUYF 3HF5A 3THVA 4OZNA 2GVDB 2M8DB 5DZ7A 3LF0A 4KV8A 3LOUA 3MWBA 4OYWA 2M2BA 3OV7A 4ES2A 2K06A 1X0PA 5HLFA 2BM0A 1Y10A 3EZOA 1LWFB 2VKZG 5EWFA 3UDVA 1OSCA 3QNWB 3W8GA 2J7KA 4I64A 5KFJA 5DDOC 4RBVA 1SQGA 1S0MA 1F9FA 3KUHA 4PQAA 4U67Q 4BC9A 1JLGB 2E1RA 4IFYB 4RW8B 2CPFA 5BYQA 4DR1J 1CLFA 1Q78A 1K73T 2L48A 2IRXA 5F8GA 2PEBA 3AQPA 2Y1JA 2B43A 2ZM6J 3UO0A 5HATA 1CSJA 4C8MA 4Y2IA 2BJ7A 3SDEA 3R1LA 1CJUA 1R6VA 1B4SA 2OAUA 2K7JA 4X4RA 2ZE2A 3DI6B 2CQDA 3US5A 4EU0A 1S99A 1S0VA 3M8PA 4NI2B 2W24A 1FCAA 5C25B 1H0HB 4M5HA 2CKWA 1RT2B 2Q43A 1RGVA 3NGUA 1A0OB 4PWDB 2HZAA 1XBWA 5F8HA 4QYZJ 3T1AA 1GTEA 2W9CB 1M5SA 1VLOA 1TKTA 4KKOA 1VQ6S 1SKUB 2LVWA 2D3ZA 2F8EX 2V0NA 3HFKA 1UWBB 1KQFB 2VFRA 4TU7A 2JFDA 3KNGA 4OYPA 1OQ6A 4ZVTB 1LV5A 1WKJA 2DIVA 1I6JA 4DJBA 4DPXA 4DR4F 1RWPB 2UXCJ 2E5JA 5T14A 5C42B 1X9MA 2KFNA 4DCPB 4LIWA 2EG2A 3WBZA 1GMWD 4LVNP 3R8YA 1RHRB 4NCGA 2OPPB 2V8PA 3FKBA 4HH0A 5GADU 1QD1A 2JSXA 2DY1A 5EDWA 4XIUA 2MKKA 4LF4F 3N79A 1IUJA 1SQEA 2YWWA 1VLYA 3OFFA 4X64J 1CJUB 4KC5A 4U8YA 5DRKA 1J5EJ 1EQ0A 3MAHA 4ZPDA 3SSQA 4E98A 4AUKA 1N52B 2XO6A 1AUSL 2E5LF 5GVQA 4D3HA 4LF4J 4F8RA 2GQQA 3IWLA 3AJ2A 4PXDA 2FJXA 5HVGA 4LF8J 1IR1A 1XNRF 1IQZA 3CXCR 2NSCA 2JZ5A 1SXLA 3V6DA 1WKKA 1EKRA 1WACA 2CJQA 2F8HA 3L7OA 3BZQA 2AX1A 1YK9A 3OR2A 2UV8A 3ENQA 3FBFA 3M9OB 4IQXA 2Z8QA 3CDUA 1PC5A 2W9BB 3TVZA 5HN0A 4GKJJ 2CQ4A 5A0YA 1P6TA 1T8EA 1D8YA 2QGFB 4P9SA 4WIQA 3FDSA 3K5NA 5MAOA 2MSTA 3WC2A 4YS2A 4NEYA 2HEKA 3IFEA 4CM0A 1RHJB 2YNGB 2C3UA 3Q83A 4RW6B 2Y8YA 1XR5A 2B3TB 2O01C 4H4KA 1FE0A 4USJC 3EUNA 2OFHX 1WEYA 2Y0SD 2VICA 1QE1A 2VPWB 2B9YA 4OI3A 4WP9A 4ANCA 3MCSA 1OPZA 2XSFA 4TXSA 3HVTA 3AB4B 3OUYB 4ITSA 1V6HA 2K2PA 4W92B 4ID5A 2UVVA 3PKYA 4JV1A 2J5AA 1NK5A 2K3KA 3IR6B 1FNOA 3PG9A 1RP5A 4X84A 3FVYA 2B9EA 2ZH4A 1PG5B 2LQJA 2B5JB 4MJKA 1LFWA 3VALA 1FXDA 1RHMB 2CNOB 4DPWA 3HD2A 2VQEJ 2WOMA 1QAIA 3DKDA 1FVSA 4OI2A 2ZH9A 4RW4B 1KHWA 1B0VA 3TANA 4WTYA 3GZ7A 2CZ4A 1Q8IA 1WEXA 2ZHAA 1PKUA 1QUVA 1S10A 1SL0A 1WDTA 2VL1A 4KQZA 1VRTB 1WF1A 2AYEA 1FJGF 4X2BA 2FGOA 3QT5A 2DNQA 1S48A 1W2BR 1JK9B 4ALZA 3UPFA 4F2SA 1Q16B 4N77A 2DRAA 3LANA 2Z2YB 1AZSB 3EDQB 1NM2A 2VC0A 1K9MT 3RUBL 2XNRA 5J2QB 3MMAA 3OVSA 2GVZA 2HRTA 3TP2A 2UVUA 4EZ9A 3QO9A 4ZPBA 2AZ3A 3H5SA 4NYZA 3M2VA 1RWNB 4YB1P 3FEXB 5DLFA 2V8GA 1OIAA 2YX7A 2XULA 1FD2A 1N34J 1HL6A 1FERA 5L1IA 1N48A 2JX2A 1XMQJ 2QA4S 2YX1A 2WVEA 4KPCA 1VQ8S 1S97A 2FLNA 3HVRA 4JI8J 4C8NA 5C25A 2HVIA 1YJTA 5HL7Q 4WFBQ 4RJVA 5CCLA 5KFHA 4ZVRB 2EXUA 1ZYQA 2YNFA 1KQGB 3AFGA 1RXOB 3WQPA 3HHEA 4B3SF 3T1YJ 2WVDA 2A6MA 5BYSA 1Q7LB 3R27A 3PHTA 1DQ8A 1FX2A 4NLWA 2FC9A 2HRYA 3DYAA 3QSIA 3W5XA 4DU8A 1FE4A 2DR9A 1N36J 5K20B 2ZJRQ 1VQ9S 2FVRA 3O2IA 5EX0A 2RQMA 4KR0B 2HFNA 1DAXA 1LWEA 3SSRA 4A8XA 4UUXA 3PIPQ 1QM9A 5F41A 4M5DA 4F04B 5FIIA 2QMXA 3M2UB 4A8FA 3M2VB 3M8WA 1SC6A 4KGZB 2QA4G 1JKHA 3NGTA 4NPOA 1VBZA 1NO8A 2XLIA 3PYFA 5KG4A 3K59A 1N32J 3H7HB 5M2RA 4K8RA 2RU9A 2VODA 3CIZA 2MJUA 3V6DB 3GSIA 2X3GA 3OTOJ 4F3QA 2M0GB 2ZH7A 1DBDA 3Q24A 2V2KA 2DKOB 2ABYA 2GFFA 4J9SA 4AL6A 1WI8A 3JSYA 3HPOA 1UEKA 1HD1A 4NLUA 4WK1A 2WZ1A 2IA0A 3FGVA 2EPIA 4GRSA 4MKVA 3MXHP 4FP9A 3V5RA 4ZCKA 3PO4A 3C16A 4U7UD 4UQGA 2MKIA 3B4DA 3O44A 3E01B 3D0GE 4NOHA 1NSQA 5L9NA 1HNIA 2CPDA 2VD3A 2ZOGA 2HBRB 4ED2A 3OR2B 4HACA 1QTMA 1KWMA 2F3JA 2KN4A 4YR0A 3OPKA 3UI3A 1VC5A 1OY8A 3R5JB 1KLMA 2BANA 1FRXA 1GAOA 2RU3A 2G0CA 4RW7A 1F3VA 2WONA 2MKHA 1M5PC 3TAPA 3TAMA 3UDLA 4YHHF 5GMDA 4JI5J 2HK2A 4B3RF 2CJXB 4OX7A 2XY6A 4R0EA 1UEUA 4MIWA 2NCKL 1LW2B 3KTQA 5MLCV 2J0SD 1F1BB 1N5SA 5E0OA 4CO4A 3MI7X 1TUVA 3UVJA 3G6VA 1FKOA 2UUCF 3VHQA 3GQCA 2HHWA 4FS2A 4Q5VA 2IHR1 4LF2A 2DGVA 2D41A 2DH7A 4CNYA 5A8KA 4DX8H 4HT7A 1M5KC 1BC6A 4AE5A 2J9EA 3BGLA 4K4WA 1C0TB 2YNIA 1RT5B 4LF1A 4ED6A 1OO0B 1Q7YT 5A6WA 5GAEU 2ZD1B 3L9ZA 4EYIB 1UVJA 1OS5A 4JP8A 1FD8A 4A47A 1HYSB 3PR4A 2VB6A 4XO0A 1Q53A 2ZVIA 5D0RA 1RTDB 1PYTA 2QA1A 1ZETA 3QIPA 2MMYA 5GAEI 4ZLNA 4ZITA 1U1KA 1UA0A 3IWNC 2ROPA 2K1RB 1PCAA 2A2DA 4ECYA 3A8IA 3W5ZA 3FZ2A 3KLEB 4WWSA 4F4XA 3WC0A 1X4EA 5F0WA 3DLLQ 4JI3J 3C2PA 2DTJA 4RNFA 1NKEA 4P2MA 2HQDA 4YB6A 4DQQA 2EI5A 2HS4A 2QIFA 3OTEA 3BGRB 2BKOA 1H7XA 1T11A 2NUHA 5ETNA 4DV2F 4ECSA 4JI2J 1K44A 2QL5B 2Q66A 1FKOB 3CD7A 1F5CA 2NXNA 1RWOB 3R3TA 3UR3C 4YMEA 5AE1A 1VQSA 1OWXA 4CH1A 2C22A 1R0AA 3NCPA 1FESA 1Y5NB 1DTTA 2BKNA 3GONA 4H54A 4DL2A 2ZKUA 4X4SA 2PA8D 3C8YA 2V2VA 1I1GA 1B7YB 1HW9A 1VQYA 3F44A 3M4XA 3M6XA 4Y00A 4QIVA 4ZCLA 3KHLA 1U02A 2BKPA 3BH7B 3DDKA 3QWUA 1AUDA 4F4KA 3PW5A 1S9EA 2DNYA 1U1PA 2FB0A 5HMXA 4KV8B 4KO0A 2DBBA 2IDEA 4Y2KA 3T5KA 5KG6A 3KG0A 2ZHBA 1REVA 1WOSA 3KK1A 1U0HB 2E5GA 2V4JB 1GMWA 1RTJB 3MM6B 2C28A 3M8QA 4NLXA 4OHXA 2KL8A 1R3NA 2XMMA 1YWXA 4KYZA 5ETOA 2L9DA 5HK4A 4C48A 3IRWP 2D3UA 1JNRB 3W8PA 3H8YA 4MK8A 1JB0C 3GILA 1UFLA 1FRIA 3OL8A 2I5JB 3LAKA 2WVBA 4WIIA 3ZZUA 3J80U 2AJ0A 3LP1B 2JNJA 3GLJA 1HBMA 3NGRA 5I3PA 3T1HJ 2UXCF 3J7YU 3BV8A 1HBNB 1S72S 4X4OA 3DLHA 3VF0B 3CJ2A 4PKDB 1U2RA 2VG5B 4P6QA 1S9FA 1TL3A 1U6ZA 1EETB 5CZXA 3OSNA 3G4SS 2W4PA 3UWTA 2BYCA 1D09B 3R6LB 3SFUA 5D3GA 1IBLF 2CQ2A 4NCGB 4ED0A 2ZZTA 5D78A 2I9SA 2A0FB 2DISA 1RT3B 1YRXA 1K47A 4ZA1A 4X65J 2NSBA 3BO2A 2J6UA 4EBCA 2BDPA 3C19A 3OL7A 2HFOA 3TWZA 1WHWA 2X1AA 4DS4A 2H5EA 1SH3A 4U6PA 3HP6A 5T7LB 4RW9B 4JV2A 1OY6A 3N9UC 5BYRA 2LLZA 5E41A 1KFSA 1C4AA 2Z56B 3DRSA 1PJ7A 1X60A 4AYBD 3PY8A 2DB1A 5KFYA 3D54A 5CYQB 3NGKA 3G8QA 3CJTA 4OX6A 2RT3A 2DJWA 4RNOA 3MAAA 4ELTA 4P10A 4DPUA 1S7IA 4Z7CA 3D5MA 3KLVA 1TQLA 4LIRA 1R7IA 2XY5A 1YJNS 1SIWB 2YNHB 1FJ7A 1RB0A 4ANEA 1ZA1B 2CPXA 5CD4A 2V8VA 3H0PA 5HAOA 1TL7A 4KHMA 3H5YA 1U45A 3ITHA 4PWWA 3D3BJ 2G4BA 4IYQA 4DQPA 2QLWA 3LA0A 5GAHU 4ELUA 4PXEA 4ZVUB 4GC7A 3NRBA 4ECXA 1HIYA 1AFJA 5KFAA 4DR2J 3BQ1A 3NGDA 3MCOA 1QVFR 1U1LA 4B9MA 5KT7A 1GEHA 2QE5A 2ACMA 4DV2J 2C2OB 1OYEA 2YNIB 4IG0A 2CJBA 1KKHA 3QFHA 4BWJA 5KTQA 4WCEQ 2HZVA 1YKWA 4OYBA 4GO7X 1JLFB 3BDPA 4DG1A 1XNRJ 4GKKJ 4YQWA 1LW2A 3I5AA 2WCXA 3F0NA 3DI6A 2XMKA 3DRSB 3NCRA 4TKTA 5KT3A 5FLXU 2ZOFA 1XC9A 1HNWJ 2JJ4D 1QVGR 2N4CA 2XWXA 2C2RA 2VG6A 4YEAA 5FLXY 2EKNA 3HHDA 2D69A 4O3OA 1T0TV 4PWDA 4L73A 3V81A 2HG4A 1H72C 4UOGA 2RRBA 4HH1A 3U7JA 2IAJA 1JJCB 5D4PA 2VHGA 2OLWA 1HQ2A 2HW3A 3KLFA 3OSPA 3RRHA 2QA2A 2E7XA 4UTGA 5JVGQ 4FBTA 3ADAC 3NAHA 3MGJA 4C3LA 1FHTA 2EFOA 4DL3A 1NK4A 1EP4B 4HYKA 4B3OB 3JSRA 4WJBA 4IRDA 2EFGA 4NXMJ 2DGOA 5B0EA 2UUCJ 3MM5B 4BDPA 3R5BA 2M5YA 1IQTA 2MTLA 1X31C 1UPMB 5L1JA 3PO5A 1XWLA 3GYNA 4CRJA 4JI4J 4HTJA 5D4OA 1YJRA 3VTIA 1NJXA 2Z57B 3CJ5A 1LW0B 4QIEA 1N5YA 1S1TB 4I7FA 5B0DA 5KFBA 5ITHA 3H4DA 2BVZA 3FFIA 3MCMA 4C11B 1PIEA 3H42A 3ZFVA 4A8YA 3IMQJ 2B7CB 4YOEA 3NOCA 4KHRA 1OMSA 2IIHA 2ALZA 5F8IA 4I2PB 1Y4ZB 2QL9B 1H74A 1KHVA 2GIQA 4J91A 4URSA 4LF7F 2RAQA 1TKXB 2CUYA 3BH6B 2I6WA 1FNMA 2V34A 1U7LA 3TX8A 1S6QA 2FY1A 3D6MB 3CPWR 2MGZB 4K59A 1BLUA 3CC2S 3GIKA 4C8OA 2F9DA 3TVKA 2AJQA 2DNRA 5LXYA 1HA1A 1S1UA 2E1CA 2QO3A 1XMBA 4NYOA 3CMQA 4L76A 3T9ZA 1Y3JA 5IT9U 1JKHB 1FWPA 2YNFB 1RA6A 2B8QA 2I8EA 1HLWA 3BS9A 2LMIA 4ZPTR 3I55S 1U8SA 4I1TA 4X4VA 1CULB 1HBOB 3VZHA 1E6YB 1NAQA 4DU7A 2FJVA 3KFWX 3KJFB 3KJQB 3EYZA 1PJ5A 5HP1A 2E5LJ 2GMLA 2DVIA 4OYZA 2ZNZA 1FF2A 2NYHA 3MMCA 3EMTA 1EB0A 4QPXA 1PC4A 3BREA 4M5LA 3DXBA 5ETMA 2IYGA 3EZUA 1GXTA 5F8JA 1NHKL 2E7WA 1M1HA 2R7XA 5JJBA 4IO1A 4ZPAA 2HNZB 2VA2A 5B0AA 1S6QB 2AGQA 2OEMA 1N54B 3VGTA 3LPYA 4OHZA 5EGYA 3MTJA 4BHQA 4O0IA 4ZN3A 2IMOA 3G86A 3QT7A 2ZHOA 2GVZB 2XMUA 2YH0A 3C15A 2OTJS 3KDOA 2E1AA 2YNHA 3AJDA 5K8PA 5BR8J 4O0NA 1B99A 3G2XA 4OMFG 2BE9B 2POKA 3KK3A 3FQKA 4LFBF 4C0HA 3M9MB 1WKLA 2KT3A 1CQNA 2XBPA 2ZKTA 3G8TA 3CCQS 3IM9A 2VA3A 3KUEA 3BGOP 3PRBA 1R8BA 4RL1A 5CQGA 1XNQF 2VG6B 1NXIA 3PW0A 3GYGA 5AT1B 3IGVA 2C3OA 1RLDA 3UE2A 3DMJB 1FRKA 1TMMA 3TUJC 1Z1ZA 1QLNA 2CPHA 1EZZB 2D7SA 4H4OB 2LYVA 3CJ3A 4EBEA 1U4BA 4IG0B 4Q44A 1FO1A 2EWHA 2RUGA 4LBHA 2VV5A 1BGXT 5LMNJ 2RD5C 1SCJB 4R5PA 3TJ8A
chains in the Genus database with same CATH topology
2YKOA 4KTQA 1IKXB 1QAXA 1UFWA 2BRLA 3B78A 3I4HX 5HBMB 2E9RX 3ULHA 4JV0A 5CYMA 2KT2A 2QSFA 3KLIB 5KFGA 1OQ3A 1S1XB 2B4UA 4FF1A 2BJEA 1HFEL 2KVIA 2HMIB 1Y5LB 4DFJA 3KNAA 3UCUP 1HI1A 3GFYA 1YBAA 4UQTA 3CCUS 2A3JA 3RB3A 4DWIA 3EGZA 2ASYA 1RT6B 4O44B 1APSA 1Y7PA 3TAQA 3DOKA 4RKUC 2XHWA 5L8RC 2MSSA 4G1QB 4H4OA 3NBPB 2J9CA 1YTYA 4CH0S 1S0NA 1BY9A 5G4DA 4R25A 3QAUA 3FSXA 2KG0A 3FZBA 3OLBA 2Q6CA 3LO3A 3D1HA 1N4LA 2HHTA 2IVMA 2UUTA 1NK7A 4J9LA 3GE9A 1L3UA 2P6TA 3HVAA 3CIMA 1URNA 2QV6A 5KFOA 3T19A 5E3QA 2CZVC 2OP5A 4TQSA 1I94F 2JEJA 2VFTA 2IRUA 3U1MA 3U1NA 1S6PA 2C2DA 3MECA 2B9WA 4J9NA 1R27B 1D9AA 3ISZA 2DGXA 5DDPC 4P7TA 4O3RA 1HHSA 2R7TA 1Z2LA 1M0SA 2YQ3A 5FDLB 3TUIC 1ZZNA 4EO8A 2EK6A 3UW1A 4ED7A 1ELOA 1HARA 2VG7B 2W7OA 1YG0A 1ZOTA 2VBWA 1VOMA 1UVMA 2ZUGA 3VQSA 5AXNA 4PR6A 1HQUA 2KO1A 1RDRA 1H2TZ 5B0FA 3PV8A 1XMOF 3VR1A 1N0UA 4IRCA 1FRMA 4CQ1A 5D3GB 4LF5F 2CRLA 2K8GA 1RT3A 3MPYA 1GH8A 3IN5A 1N8RT 2IYIA 2EC0A 1NEEA 1WG4A 1Y00A 4C2MA 4C3MA 3CUNA 4EEYA 2MZQA 4RUAA 3HT3A 3TRGA 4DFMA 4W90B 2JWNA 2KJVA 1KLNA 5I3UB 2W9BA 3JTNA 4OIXA 2MQOA 2JLFA 1R31A 4F25A 2GJIA 3SYZA 4G3IA 4J37A 4OZ0A 1ZTWA 1ZM2A 4JOUA 3VCDA 2VG5A 4RU9A 1T03A 2O5DA 3IAM9 1QAJA 5LT5A 5ADZA 1WHVA 2OPSA 4EGLA 4N8OA 3CWJA 3CC7S 1F60B 2PIIA 3T5HA 2APOA 4GC6A 4HTIA 1SUQB 4QWAA 1DARA 7FDRA 1C1BB 3AHPA 5K5MA 1KEKA 4ZOSA 3GG1A 1JLAA 1JLBA 2PO4A 1FDDA 2R7OA 4ED1A 1N6QA 3UD4P 4DV5F 4K4SA 4KKOB 2D1CA 2RS2A 4Y6IA 1PILA 3QPIA 3ONQA 3AJ1A 4ERDA 3KLGA 5KFMA 4JI5F 1WHXA 2MJNA 5KFQA 2WB1D 5LMUF 1YIJS 1X0FA 4H4KC 2JVRA 1U6FA 3M05A 3EGNA 5C42A 4O44A 1C0UA 2LXIA 4QWEA 4C9DA 2MZTA 2DHAA 1MU2A 1RTHA 2FLOA 1X5TA 3CTRA 4LFAF 3ZZ0A 1WTFA 2JRSA 2NS1B 2HNDB 4J9RA 1HWUA 2LCWA 4QBUA 1U09A 1DURA 4RZRA 2GJ2A 2XMTA 2LECA 5KFSA 4DMZA 4FXWA 2NPIA 1TR0A 5T7LA 4DF8A 2HVZA 4F3OA 2HWTA 2PC6A 1U1NA 1HBUA 2ROGA 2FHMA 3TO8A 3S8SA 4WFNQ