1TKXB

Crystal structure of hiv-1 reverse transcriptase in complex with gw490745
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
430
structure length
404
Chain Sequence
ETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKDSTKWRKLVDFRELNKRTQDFWGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Design of non-nucleoside inhibitors of HIV-1 reverse transcriptase with improved drug resistance properties. 2.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords Pol polyprotein, Reverse transcriptase, Chain A
total genus 112
structure length 404
sequence length 430
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2004-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1tkxB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1tkxB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1tkxB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1tkxB03
4RW4B 3V6DB 3H2LA 4KHMA 4NLDA 3HVTB 3DLKB 2JC0A 4IOBA 2IAJB 4ECUA 4RW9B 2ZD1A 3H4DA 2FVRA 2C2DA 5KFKA 2XCPA 3MR3A 1IKVB 4DG1A 1N6QA 1EETA 2IM3A 5KG5A 2W9BA 3NAIA 5J1EA 3KLGA 2IJFA 3MFIA 3D28A 5KFTA 2OPQB 1MU2A 4ZPDA 4TQSA 4ECXA 3G6XA 2D3ZA 3ISND 5DG7A 4PUOA 4DL3A 4MFBA 1RT3A 5FDLA 4ZHRB 1C1BB 1TVRA 4IR9A 2WRMA 2IA6A 1TKXA 5KG7A 4EBCA 1NHUA 1LWEA 2FJWA 4QWCA 5KFFA 1J5OB 3E01B 1SH3A 3Q8PB 1TL3A 5KG6A 2OPSB 5L1LA 4ED0A 1TV6A 4ED8A 1ZETA 1VRUB 3OL7A 2B6AB 2AQ4A 2YNGA 4RUCA 4ECQA 3QZ8A 4F4ZA 1EETB 3SI8A 4OL8A 3OSNA 3PZPA 4IG3B 4R5PA 4RW6B 1UWBA 4J9NA 1DLOA 2HNDB 4TN2A 4ECYA 4MKBA 3PW7A 3KK1A 4I7FA 4NCGA 4IH7A 5K14B 5KFNA 2HNYB 4I2PA 4RW8B 1S4FA 3RBDA 2RKIA 3QLHB 2V4QA 4TYAA 1N56A 3BREA 1C0TB 2BANB 3I0RA 2F8EX 4WYWA 4ZPBA 5J1EB 3KLGB 4QPXA 5C24B 3OL8A 3QLHA 3DI6B 3BSOA 1RT2A 2YKNB 2HMIA 2IBKA 5DGAA 4WXWA 2CKWA 2FVCA 1RTJB 4I2QA 4ZVGA 2VG5B 2V9WA 4K4VA 5C42A 1C1CB 1DTTB 1HNIA 3LAMA 4RW6A 2W9CB 4HYKA 1TVRB 1QUVA 1XR7A 3BSAA 3MR2A 2BE2B 2W9AA 1HMVB 2IM2A 4R8UB 4JUZA 3TVKA 1JLEA 4LSLB 3FFIB 2YKMA 4DG1B 4WFXA 1VRTA 1HARA 4ZP9A 5EWFA 5HROA 2YNHB 4NLGA 4K4ZA 1S6PA 4PWDB 4IQXA 4R0EA 2AX1A 3EPGA 1S0NA 3HVWA 4URQU 2ILZA 3M9MB 3KHLA 1REVA 5J2NA 2HNDA 3GIJA 3HVTA 4KHRA 5C24A 2YNHA 4KSEB 3PJWA 4NLPA 5KFYA 4ED3A 1RT4A 1K1SA 1JKHB 5D3GA 4Q0BA 4ZVHA 3HVAA 5CYQA 1S1TB 3T1AA 2WONA 5HLFB 3CO9A 4U7CA 2W9BB 3IN5A 4FS1A 4IRKA 1RT5B 3OL6A 3KK2B 1VRUA 5L1IA 1LWFB 1RT4B 3Q8RB 2I1RA 3JSMB 4EBEA 1BQNA 3KK3B 4ZP8A 2XGQA 4TY9A 3KLVA 4YR3A 3NL0A 3OHBA 4J9MA 1OS5A 2W7PA 1EP4A 4J9SA 1ZTWA 1WNEA 1T03A 3KNAA 1TL1A 1JLBB 4WYLA 3GQCA 1R0AB 3M8QB 1RTDB 4WFYA 3DRSA 1IKWA 2C2RA 1IKYA 1TV6B 5JXSA 1RTHA 1RT7B 2AWZA 4FBTA 3DM2A 4EYHB 3V81B 5KG0A 3GYNA 2VG7B 5CYQB 3T5HA 3RB0A 3VQSA 4O3RA 1I6JA 2R8HA 4IFYB 2JEFA 3H5YA 4LSNA 4QW8A 2FVPA 4Q43A 4TYBA 2JEGA 2C2EA 1JLFA 1K1QA 4NLTA 1S1VB 2WTFA 4NYZA 4Q45A 2FLPA 3NMAA 1C1BA 4IFVB 1LWFA 3QGHA 5L9XA 5KT4A 5L1JA 2E9TA 1RT6B 4RNFA 4DL4A 1N48A 2FLNA 3FQLA 5KFIA 1TKZA 2HAIA 5CYMA 1HPZB 3LP0B 4J9PA 4MK7A 3CDUA 4RNMA 3Q8QB 3GILA 2D7SA 4QWEA 3DRSB 1LW2A 1JLEB 2B5JB 4H4OA 2BRKA 3T19A 1R0AA 4URSA 3TQ1A 1QAJA 1S1WA 3QYYA 3KMSA 3KOAA 4NRTA 4G1QB 5J2PB 5F8NA 3FSIA 3OHAA 4O3QA 4RW9A 4ECZA 1C1CA 3HKWA 3V81A 4IKAA 3GIIA 2JC1A 3QIPB 1S1XB 3I0SB 4IDKB 1RYRA 2UVRA 2FJXA 2XC9A 5F8LA 3PW4A 3CDEA 5KT6A 1RA7A 3IRXA 3MEEA 4O3PA 4Y3CA 4QWDA 2AGOA 4IFVA 1IKXB 3DLEB 4ID5B 3KLFB 1NNDA 3KLEA 1RDRA 2YNIB 2HNZB 3PHEA 4NLVA 1DLOB 5KT7A 4QWAA 4KB7A 1S1UA 5J2QB 1T3NA 3RAXA 4GC6A 3KK1B 2WHOA 4WXOA 4IG0A 1C0UB 3BQ2A 4KE5A 3H59A 2YNFB 3CWJA 1JKHA 4Q0BB 3E51A 1S9GB 4B3OA 3TAMA 2WK4A 4RNNA 3OSPA 3DMJB 2FVSA 2WCXA 3LP2B 3H5XA 5DG9A 5KFWA 1S6QB 1S1XA 3I0SA 4DEZA 1XR5A 1HQEB 3PW2A 1HNIB 2IAJA 3E01A 3M9OB 4H4OB 2QE5A 3DLEA 3KLFA 4IFYA 5I42A 2IM0A 2UVWA 3BQ1A 3OL9A 4M94A 4YR0A 2E9RX 3UPFA 2OH2A 3DOLA 4KFBB 5KG4A 4F4YA 2BANA 2FVQA 4RNHA 5EUHA 5D3GB 3I5AA 4GC7A 4RU9A 3ITHB 1JXLA 1HPZA 4J9RA 3DLKA 1JLGB 1SUQB 1GX5A 3MF5A 3MEGA 3NGDA 5KFRA 3H40A 3EPIA 2HWIA 5K14A 3BR9A 5KFEA 4DL5A 4J9QA 1S49A 5KFLA 2R8JA 3DRPA 3V6JA 1XR6A 2W8KA 2ILYA 5KFDA 2YNIA 2IC3A 3LP1A 4NLYA 4K4TA 4WZQA 4IH5A 5KFUA 2OPPB 2FLLA 3I5CA 3IGVA 1RT2B 2YKNA 3M8QA 1RTDA 2HMIB 1C0UA 4K50A 1FK9B 1HQUB 3ISNC 3TAMB 2YNFA 4ICLA 4NLQA 2R8IA 1DTTA 4JV1A 3DOKA 4RW7B 1HYSA 4RZRA 3GIMA 1D0EA 3G6VA 4PQUB 4ECSA 1YVFA 4G1QA 4KKOA 5J2PA 4Q44A 2W7OA 3RB6A 4KO0A 3C6TA 2DPIA 2YNGB 1JLCA 2JEJA 1JLGA 3DOKB 1S9EB 4RW7A 5C5JA 4FS2A 3CJ3A 1S1TA 5HLFA 5KFVA 2VA2A 4IG3A 4IDKA 2V4RA 2R8GA 1KLMA 3T5KA 2OPRB 4TLRA 5CYMB 3V4IB 1JLCB 4KV8B 5F8MA 3IS9A 2GIRA 2IMWP 4H4MA 4ZP7A 3PR5B 1HQEA 4Q8EA 2UVVA 3IS9B 4KAIA 2R2UA 1SV5A 4Y2CA 4IR1A 1RT5A 5HBMA 3DI6A 4MK8A 1TKZB 4TXSA 1QE1A 2R2TA 1RA6A 4IH6A 3DDKA 1S9GA 3M8PA 4B3OB 1S48A 4EO6A 1TL3B 1QAIA 1S9FA 3LAKA 3V6KA 3FQKA 3KJVA 4NLRA 4NRUA 4ED6A 1MMLA 3DRRB 3DLGA 1T05B 4F4WA 1S1VA 3FDSA 4IRCA 3V4IA 4WFZA 4ZMMA 3PW5A 4X2BA 4O4RA 3RAQA 1RTHB 1SH2A 4J9KA 3UR0A 2ASDA 1RT1B 3NAHA 4YQWA 4ED2A 2W8LA 2ZKUA 3N6LA 3KLIB 4ZP6A 2J6SA 4JV2A 2HNYA 2D3UA 5EDWA 5KFPA 2W9CA 3HHKA 4TY8B 2C22A 1S1UB 1JLFB 4H54A 3MFHA 2XCAA 1TL1B 4ICLB 4XPEA 3G86A 1FKOA 4HKQA 5HP1B 2IM1A 4YMEA 3QO9A 4O44A 5HROB 5DQGA 1UWBB 2XGPA 1RT7A 5KFBA 2WOMA 5DGBA 2AU0A 4U6PA 2C28A 4DL2A 3DOLB 4KFBA 2IJNA 3OLBA 5HBMB 1REVB 5J2NB 4I2PB 2BE2A 4RW8A 1T03B 1KHVA 3T5JA 5T14A 5J2QA 3GIKA 5KT5A 1SUQA 5F8GA 4TQRA 4WE1A 2BR0A 4TY8A 4H4MB 4F4XA 4MH8A 1JLAA 2D41A 4MKAA 3KK2A 4QW9A 4PWDA 3MR5A 3LP0A 3QIDA 3KLHB 5F9LA 3GV7B 1RTIA 4ZVEA 3KMQA 5I3UA 3ITHA 2V0NA 1SV5B 4IRDA 1JLAB 1QE1B 5HP1A 4F50A 1S0OA 2QV6A 4ECTA 5KFOA 4K4WA 2AGQA 4MFBB 1SH0A 2E9ZA 3KJVB 4RW4A 3NKYA 3NBPB 1U09A 2O5DA 4MIBA 3IRXB 3LP2A 3QO9B 4O44B 1S9EA 4K4YA 2ATLA 2RKIB 4ECWA 1TKTB 1JLBA 3EZUA 4LQ3A 4EYIB 4PQUA 1N4LA 3MEDA 1HYSB 1BQMA 2ZE2A 4O4GB 3DRPB 2XWYA 3N6MA 5KFGA 3DRRA 2ASJA 4KKOB 4Q8FA 1JIHA 5DLFA 2VG7A 1S6PB 3MR6A 5KFHA 5KFSA 1LW2B 2B5JA 2VG6B 2OPPA 2OPRA 3JSMA 4QWBA 4O3NA 3UDLA 4ECRA 2RF2B 5L1KA 1JLQB 3T5LA 1HNVA 4NZ0A 1FK9A 3NBPA 4J9OA 2J6UA 3CIZA 3KLHA 2B6AA 1RAJA 4ZVFA 4M95A 1FKPB 5KFCA 1LW0B 3MECA 4K4SA 3H98A 3QZ7A 2IC3B 5DG8A 3LALA 4I2QB 3DYAB 1TKXB 3UQSA 4EO8A 1CSJA 3GV8B 5KG1A 1LW0A 2HWHA 4NLUA 3KHGA 2VA3A 3H5SA 3IG1A 2GC8A 4NLWA 4R8UA 1GX6A 2JLEA 3M9NB 1RT1A 3H5UA 3M8PB 4DL6A 2ASLA 1C0TA 2YKMB 2DPJA 2VG6A 3V6DA 4XO0A 3C6UA 2FJVA 4MIAA 1RT6A 4G3IA 5JUMA 5FDLB 4ZHRA 3BQ0A 3RBEA 4NLXA 3BSCA 3GV5B 4DL7A 2WB4A 2ZE2B 4NLOA 2GIQA 1W25A 3DMJA 4ID5A 1KLMB 2UUTA 1S6QA 2XI2A 4YP3A 2XI3A 3KHRA 5F8JA 3I0RB 3PR4A 1JLQA 1DTQA 1C2PA 1IKYB 5I42B 5KG2A 5EWGA 3BJYA 3ICLA 2AGPA 2UUWA 3JYTA 1RYSA 2J6TA 4O3SA 1RTJA 4I7FB 4NCGB 1DTQB 1FKPA 2CJQA 3MEEB 2AX0A 3BSNA 1S1WB 2UVUA 5KFQA 2I5JA 3BGRB 5EWEA 3H4BA 3KLEB 5KFJA 2ALZA 4ED7A 2WOMB 1Z4UA 5J2MB 5KFZA 3FFIA 4LSLA 3QGGA 4K4XA 2R8KA 3CVKA 5DLGA 4XPCA 4IG0B 4K4UA 3DLGB 1T05A 5C25B 5DQIA 1RT3B 3CJ0A 3SFUA 1NHVA 3LANA 4NLSA 1BQMB 5C42B 5DQHA 1T94A 1BQNB 3KK3A 5KFAA 3RB4A 1IKXA 3G6YA 2BRLA 1ZTTA 4O3OA 2OPQA 4Y34A 4RNOA 5I3UB 3V6HA 3KLIA 4EEYA 4ZPAA 1RTIB 1KHWA 4PUOB 1HMVA 4FBUA 2RF2A 1VRTB 3CDWA 2RDIA 3QIPA 2B43A 3IG1B 3FRZA 4ZPCA 1S10A 2VG5A 4EBDA 1LWCB 4ECVA 2RDJA 1FKOB 1IKVA 1N6QB 3QGIA 3CJ5A 5F9NA 3OLAA 5KFXA 2ZD1B 2BQRA 1S0MA 4WE1B 4KBIA 3C6UB 3JYTB 5KT3A 3PW0A 2HNZA 4LSNB 5KT2A 4YR2A 3D5MA 5C25A 1MU2B 4J9LA 1IKWB 1TKTA 2I5JB 1TP7A 3PJXA 1S97A 3MTKA 2WONB 3DM2B 4KO0B 3I5BA 1IM4A 4Y2AA 5J2MA 5KG3A 1N5YB 4JV0A 5F8IA 4LQ9A 4O4GA 1J5OA 4URGA 3MEDB 1LWEB 3CJ4A 3IGNA 3Q8SB 2BQ3A 3MECB 2R2RA 2R2SA 1N5YA 1D1UA 4WZMA 1HQUA 4KV8A 1LWCA 3MEGB 3CJ2A 2EC0A 5F8HA 2BQUA 4RUAA 3RB3A 1TQLA 3SFGA 1JX4A 1HNVB 2JEIA 4R5PB 3KHHA 3LP1B 3BGRA 5KFMA 3C6TB 3PVXA 1EP4B 2OPSA 3N6NA 4ED1A 3DYAA 4MK9A
chains in the Genus database with same CATH superfamily
4RW4B 3H2LA 4ZIVA 4NLDA 3RB4A 4IOBA 4ECUA 4RW9B 2UXDF 1WHWA 2FY8A 2GNKA 1FRKA 4DG1A 2IM3A 2B8QA 3P5BP 1HBOB 2W9BA 3KLGA 3X3UA 1VI7A 1MU2A 1MROA 3R5DA 4BHQA 1CJVB 2IYGA 4LR9A 1KQFB 4X4SA 2MZRA 2VB6A 4W98A 1HBUA 4AXJA 4DL3A 3W2VB 2Z56B 2M3DA 1CBKA 1NDKA 2CZ4A 2NPIA 2WAQD 3AXKA 5FLXY 1WG1A 1RWPB 2AYMA 3AOAA 2IA6A 1LWEA 2FJWA 1WELA 1S57A 1R3NA 2U2FA 3E01B 1SH3A 2V67A 2XTJP 3PACA 2KDOA 2NLWA 2P9CA 2YKAA 1MWYA 1FRIA 3VALA 3W5YA 1OJ4A 2MSTA 2U1AA 4OZ1A 1GQEA 5D4LA 1WOPA 1XERA 4CLLA 4EK2A 2YNGA 2EW9A 4RUCA 3QFWA 7AT1B 5GADI 3QZ8A 4ECQA 3SI8A 2AYBA 2AJ1A 4B3SF 4R5PA 3BV8A 3R2CJ 1WEXA 2DHXA 1U24A 4F4KA 1I51B 3QBCA 5D78A 3HX9A 2NXEA 3WX4A 2HNDB 3RW6A 5C2GA 1WSRA 2RRNA 1S0VA 2BUNA 2HZVA 3FC9A 3KK1A 4NCGA 3MM9B 2QMXA 4IH7A 4X66J 4CH0S 4MKYA 3FEXB 4RW8B 1S4FA 3U02A 3OJSA 1RISA 2RSQA 2HBZB 2V4QA 3CCRS 2BX6A 1YLXA 2EKYA 2W2PP 4JI8F 2AKWB 4M5DA 4I1TA 3I9ZA 2R7WA 1VHFA 2QGFB 3R6GB 1GXTA 4MTPA 4DCPB 4QPXA 4DFJA 3SDEA 5J1EB 3QLHA 3DI6B 1WOOA 1RT2A 2DIUA 2B4VA 3TANA 5DGAA 2CJKA 4DCJB 3QRRA 2FVCA 3DXSX 1VDHA 4LFAJ 1X4BA 1NAQA 3HHLA 4I2QA 3IBWA 4WU2A 2VG5B 2PMWA 3ZTOA 2RS2A 1C1CB 1BE4A 3HVRA 2V9WA 2EFNA 3NGKA 3PDNA 2NUHA 5AE3A 3MR2A 2BE2B 1F2HA 2A3JA 2B4UA 2MKSA 2W2NP 3OFEA 4TLQA 5GVQA 3NNCA 4TU9A 4KJIA 2CPJA 1FJCA 2IRUA 1IBLJ 2ABYA 4OI6A 3T3FA 3BN7A 1B7YB 2C3YA 3VZIA 2CJAA 5EWFA 4P10A 4N8NA 4WIIA 4AQYF 1PBUA 2H5IB 2VODA 2CNKB 3ETMA 4LF2A 1QY7A 3MMBA 2DY9A 2WSCC 3M9MB 3IWNC 3GIJA 3MTJA 2MEWA 5KFYA 5C24A 2Y1IA 4OQJA 1TZ0A 3AD8C 3C15B 4LF9F 1RT4A 2YQ3A 1S0NA 4G1IA 3V6JA 3QJJA 3HVAA 5CYQA 1S1TB 5JVGQ 2WONA 4F0HA 1X5SA 1XC9A 2W9BB 1F9EB 3IN5A 4L73A 3K5PA 1RT5B 3WBZA 4IRKA 4B3TJ 3OL6A 3PO4A 2DNGA 4EZ9A 4QU7A 3Q8RB 4OZNA 4EBEA 1BQNA 4ZP8A 2XGQA 1ZZNA 4CQ1A 2F1FA 2MYFA 3MCNA 4ZCMA 3OHBA 1Y10A 2FHJA 1OS5A 2BKPA 2W7PA 4J9SA 3ZTQA 3Q24A 4CLYA 4RWXA 3P49B 2V2KA 1U25A 1SJRA 4WFYA 3NS6A 8AT1B 4BLGA 3OD2A 4WK3A 5C2CA 2C2RA 2CNOB 5JXSA 2N3OA 1EHWA 1HLWA 4O0NA 4A8WA 1PGZA 3JQKA 1T7PA 4RBTA 4FBTA 2LXIA 1GEHA 1VLOA 2BJEA 3MEKA 5L8RC 4JI4F 2VG7B 1T9TA 4LF4J 3RB0A 3VQSA 4O3RA 1HNXJ 1FD2A 1EZZB 2HHVA 4L75A 1AFJA 2JEGA 1PYOB 2EG1A 3IR7B 4NYZA 1XNRF 2HQFA 2VZ9A 3ZZZA 4EZ6A 2B9WA 1NDPA 3AQOA 5DDQC 2PC6A 3GR1A 4DL4A 2FLNA 1VC5A 1TKZA 3GE9A 3M32A 5CYMA 5T41A 3W63A 4LRDA 4J9PA 4LF1A 3MPUB 3M4XA 4MK7A 5LJ5Y 1MLAA 3GILA 2DR5A 5F3TA 1KS2A 4BBYA 4FNIA 5HSPA 4F2SA 3T19A 3TQ1A 1S1WA 2CQ1A 1JJ4A 3KMSA 2IA0A 3AH6A 3HDSA 3KOAA 4WPAA 2HS3A 4O3QA 2HVEA 2AIRB 1DHMA 2VONA 3V81A 2UZAA 2QLJB 3RRHA 4FYXB 4MJKA 3QIPB 5CA5A 3I0SB 5CCLA 2M52A 1C4CA 3MUVP 4QOTA 4YDDB 2A6MA 3TWZA 3UDCA 3K57A 1WF2A 2NZCA 3MEEA 2Y8WA 4XDDA 3ZTRA 3HT3A 5E3PA 1KONA 1Q8IA 3DLEB 4PXEA 2Z2MA 3L7OA 1RDRA 2YNIB 3KJQB 4C2MA 5LXYA 3H90A 5J2QB 2R7XA 1RK8A 5L9NA 3LWMA 3RAXA 2E7XA 3OTCA 3QAEA 4ZLPA 2VC0A 4F3QA 3MMCB 3Q83A 3D68A 2WSFC 5BYQA 3K58A 1NBEB 3A8IA 5F0WA 1NB2A 4KE5A 1GH8A 3E51A 1T9WA 3ENVA 2GVZB 4B3OA 3HJVA 3KKFA 3POTB 5ETQA 6AT1B 1HWIA 2FVSA 2DY1A 2K1RA 2MXYA 3H20A 1SKWA 2EBEA 2PFDA 3BGFA 4ANDA 5DG9A 2AMCB 2DKOB 2F3JA 4C8KA 2MQOA 2H5EA 1S1XA 5CHCB 1XR5A 1F60B 1SKUB 1Q8KA 2JWNA 2Y1RI 1HNIB 2IAJA 5ETPA 1K0VA 3DOMB 3OPKA 3THTA 4OHYA 4HLBA 2KXNB 2SXLA 2UVWA 2P5VA 4V19J 3MD3A 4WJBA 2DGXA 3KG0A 2FC8A 4FXVA 4QR0A 3ZZRA 4YR0A 2DNPA 1KSPA 4B3TF 2FZKB 2MQNA 3AT1B 2EFQA 4B02A 4FYWB 4D3GA 1XWLA 3I5AA 1NK4A 1SL2A 3RYLA 4LF9J 3ITHB 1HPZA 4J9RA 3DLKA 2P6SA 1TL4A 4ZLLA 1OPIA 3MF5A 3NGTA 3H40A 3EPIA 2P9EA 2PI5A 2DJWA 1S59A 4DL5A 2B7CB 4J9QA 3HHDA 3FBCA 4USUA 4XK8C 5KFLA 1AT1B 3DRPA 3TVZA 2L41A 2R8JA 2Q6BA 3MAQA 2ILYA 3GMGA 1RTZA 2I0XA 1UJ6A 2IC3A 3LP1A 3EJMA 2G0IA 3SEOA 2OSQA 1RP5A 2YWFA 4IH5A 3I6PA 4USIA 3G9CA 5KFUA 2UXCF 2HSEB 2JRSA 2QA2A 1RT2B 1GTHA 1S99A 1UW9A 1Q0NA 3GLJA 1X4AA 1F5BA 1YX2A 5BXIA 2AV5A 3KNGA 3TAMB 2QEXS 2ZJQQ 4KYZA 4NLQA 3U7JA 1CULA 1U1PA 2R7TA 1HYSA 3QSIA 3UVJB 1E6YB 1OWXA 3GIMA 2XM3A 1YJNS 4ECSA 1YVFA 2OMLA 5J2PA 5LJ3Y 1VIXA 5L39A 4K5SA 4DDFA 1WC0A 3K5OA 2W7OA 2AHOB 3U1NA 2DPIA 5AT1B 5IM0A 1U26A 1JLGA 2DH9A 1S9EB 2PEHA 4NPOA 2E5IA 4N47A 3RU0A 1S1TA 3ZXWA 1NK6A 1L3SA 4IG3A 5CZXA 1OYDA 4UY85 4UQTA 1SC6A 2A2DA 1B3TA 4C3KA 1RXOB 3D0HE 1TTHB 2AEFA 2Z2ZA 4H4MA 1GAOA 2EPIA 2DNOA 3CJ8A 2VH7A 2V8VA 4CT9A 2FYXA 2FJDB 2UVVA 1M1HA 1NH7A 1RT5A 4DOZA 3K59A 4DV7F 2MLYA 1TKZB 3M32B 2HHQA 2BM1A 4Y6IA 1NDCA 1P27B 1RA6A 3MUMP 2HVIA 3DDKA 3RBZA 3WC0A 5L38A 3BO2A 2D9OA 3HULA 4HHUA 4LBPA 3HXMA 1PO6A 1YG0A 1TL3B 1QAIA 1MWZA 1WF1A 2MQMA 2VC1A 2XY7A 2PFFB 4U95A 1QDUB 4WTOB 4NLRA 4J9VA 3P5TL 4C7QA 4ED6A 5LSLA 1MMLA 3DRRB 3DLGA 4H4KA 3R7NB 4YS2A 5HQMA 2KJWA 5IWAJ 4IRCA 3V4IA 4WFZA 4ID8A 1UEKA 4ZMMA 3SDEB 3PW5A 4X2BA 1FI4A 2VJVA 1SH2A 1KN6A 2RDDA 5CZVA 2CJ9A 3NGSA 4EU0A 3TUPA 4OX9F 1HD0A 3HD1A 4YQWA 2XB2D 1IQZA 2R7OA 2ZKUA 2RQ4A 1R8HA 2XMWA 4ZP6A 2D3UA 2N3LA 3PNIA 1UW4A 3D6FB 2ZH5A 2XY5A 4ZVPB 3W9HA 5CD4A 3HPOA 4TY8B 1VC0A 1XK8A 1SI9A 5LMNF 2VFVA 3BBCA 5FIIA 2MKCA 3FMWA 3MFHA 2R3VA 3GYGA 1UVJA 4DR2F 4XPEA 3BH7B 1FKOA 2LEPA 3G86A 5EX0A 1N34J 3BDPA 4HKQA 1O8BA 2YQ1A 4C3MA 1UWBB 4A4JA 1RT7A 2W4DA 2X1AA 2K06A 2WOMA 4USJC 3VAKA 5E0OA 4OZLA 3SQGA 3HHNB 5FLXU 5HVHA 3R5CA 2AJ2A 2BACA 5T14A 5GAGI 1NJWA 2KHDA 4OX7A 3UVJA 4ES3A 1RJJA 5A6PA 1EIYB 4OHZA 4F4XA 2Z30B 2XS5A 5BYRA 3KK2A 3JS9A 3W61A 3IBCB 3BYPA 3QIDA 3KLHB 3GV7B 5AXKA 4ZVEA 4U96A 4DLEA 5I3UA 1VQPS 3ITHA 3W60A 4K2JA 5A8WB 1JLAB 3I9V9 4UW2A 4L3KA 2DNYA 3QT8A 4DV2F 4JI8J 1QE1B 4PPZA 4PQAA 1ZPWX 3LGMA 1TUWA 1IJEB 2LQBA 1E6VB 1KC8T 4PR6A 1YJRA 1HHQA 1FCAA 1E6YA 2OEKA 4I6AA 2L9WA 3M1VB 1UPPA 3FZBA 2K3IA 4X4NA 4OHWA 2ROPA 3BGLA 3ILIA 1VQYA 4NMXA 4ZVSB 1N5TA 1BY9A 1YRXA 2XZDB 1FDAA 4K4YA 1S9EA 3QWUA 4ECWA 2GHWA 3OXFA 3RUBL 4LQ3A 1TFYA 1HHTP 3K0JA 4DX5A 3BB5A 3MEDA 1HYSB 3U1LA 4DSLA 2ZE2A 3DRPB 3D7SB 4HR2A 4DMZA 2ZFHA 2GQCA 2ASJA 2DH7A 1JIHA 2RUGA 3P96A 1SQEA 2BOAA 2MHEA 2V94A 4A48A 2CZVC 3G8SA 4DV3F 4IR9A 2HQIA 1Z2LA 3PYGA 5KFHA 3C2PA 4UOGA 4M5HA 2DEJA 1N0VC 3AAWB 2ZH2A 4KC5A 1JLQB 3BO3A 1D3WA 1EKRA 3CIZA 3I96A 1U48A 1VQ9S 1MMNA 3KLHA 4F26A 4OX9J 2JOQA 3JQJA 3IWXA 3MECA 1S7HA 2H48B 4P74A 1H38A 2DNZA 2XZWA 3LALA 1VJQA 6FD1A 4RUHA 2N82B 1TKXB 2HFNA 5DRKA 4RWWA 3GV8B 2PA8D 1LW0A 2HWHA 1YRUA 2NS1B 3H5SA 1ZH5A 5LOQA 2JLFA 1CQNA 3MMJA 2F4FA 3D6HB 4Y2IA 4DR5F 1HBOA 3HFKA 4A8QA 3PX0A 4KTQA 4C8YA 1O6XA 2J76E 3W9JA 5J1NA 2XMJA 4UZCA 2ASLA 4NEYA 2YKMB 2KJVA 3K5LA 2E1RA 2VQEF 1TR0A 1WC1A 1SL1A 5FJ4A 3C6UA 1YGYA 1FESA 1RT6A 2PA3A 5E3AA 3UE2A 3VTIA 2RD5C 2V2VA 5FDLB 4ZHRA 2J9CA 2QA1A 2KT5A 2VUGA 3MM6A 3SSRA 3TA2A 2CPXA 2WB4A 3CJTA 1B7FA 4M63A 3SXLA 3TEHB 4YDXA 1UMJA 5B0CA 4ID5A 2FIUA 2GZOA 1KLMB 3BEGB 3N5FA 1Y00A 3AODA 1PBAA 2VKRA 3GG1A 4OYAA 2ADCA 4B3MF 1WG5A 5A8RA 2CQ2A 2AYGA 5ETLA 4DR3J 5F8JA 3D6MB 3MGJA 1DTQA 3K8WA 1HA1A 2NSBA 5EHHA 4FXDA 2IJRA 5K9FA 1JQGA 2OP5A 1RB0A 2WVCA 3TJ9A 1F0XA 3FBBA 3KUGA 4RBVA 3TUJC 3UNGC 1CJKA 3JAMY 4K0KJ 2ZWPA 1UEUA 1VIOA 2AX0A 4DR1F 5KFQA 4PXCA 2Y1LB 1CC7A 1YDLA 2MGZB 4OYMA 2I8EA 2K2PA 4JI3J 1IBKF 3HJFA 1HI8A 1N54B 2CQBA 2WOMB 1JNZB 2GA7A 2BE7D 3I87A 3IR6B 4LRCA 4OMFG 3KJFB 4C48A 4A46A 4WKRA 5IT9Y 2KYZA 2LEBA 4K4XA 5CAAA 2R8KA 4DZ6A 1CJUB 1Q95G 1WDDA 5DQIA 1RT3B 3CJ0A 3W3SA 1URRA 4CLWA 3LANA 4NLSA 5B0GA 3TQEA 3KK3A 1FXDA 4QU6A 2CA9A 2BJ8A 1M1GA 2RQKA 4O3OA 4A8XA 1U49A 5I3UB 3TZZA 4EEYA 4ZPAA 1R43A 2NR0A 2VQFF 1HMVA 4DR4J 1UAWA 2RS8A 3M2RA 2NXJA 1VQ4S 3GJRB 4JI0J 4FF3A 2ACMA 3IG1B 4DV0J 4U67Q 1H3DA 3OTOF 1PJ6A 1FKOB 4LFAF 3CJ5A 2FPHX 2HBYB 3DHWC 3UDEA 4F36A 4WE1B 4KBIA 1RWUA 3JYTB 1G6BA 2H5JB 4CO1A 3PW0A 1ELOA 2HNZA 1REGX 3J81Y 1KLNA 1CG2A 2ZBCA 1NU4A 2B9EA 2NXCA 4KHPF 3H0PA 2Z4PA 2KRBA 4KGKA 3LOUA 1CC8A 4LF4F 2I6WA 1BUXA 1PILA 2HBRB 3O6QA 4P75A 2GFFA 2WONB 4WTYA 3I5BA 2EVZA 5KG3A 3TZWA 4UF4A 5F8IA 4B3SJ 4JV5J 2I2YA 3NCQA 3S01A 5IV3A 2ZH9A 1AZSB 3RRGA 4DV4F 2D3O1 1LWEB 3J81j 3CC2S 5HL7Q 4N7TA 3Q8SB 1FEEA 3NOCA 4LIWA 1WJ9A 3UWTA 2BQ3A 2DD8S 4DV6J 2CADA 1NB7A 4KV8A 1LWCA 2QSFA 4WZMA 5F8HA 1HBUB 3ZZPA 2BQUA 4RUAA 2PE8A 2GAHC 3L7PA 2VQEJ 2LDYA 4R5PB 3FCVA 3QT5A 1KQKA 1QTMA 1OO0B 2NUUG 4LF8F 3KG1A 5KFMA 4FPIA 2KM8B 3TJAA 4DFKA 2NYIA 2X1FA 1OPZA 3PVXA 3TAQA 1LKZA 3C46A 3GJTB 3AD7C 2OPSA 2CJBA 1HARA 1TUVA 4KHMA 3EDRB 1JB0C 1W26A 4OV1A 4GKJJ 2NZ4A 3ZNJ1 2OAUA 1RWMB 2E1MC 1FX4A 1DQ9A 2HGNA 3MR3A 1EETA 5T7LB 2W2MP 2QO3A 1GMUA 5J1EA 1PIEA 4F25A 3T1HJ 2IJFA 2JSXA 2VFSA 2BJ9A 2OPQB 1O0PA 3D28A 3MFIA 4ECXA 3HFVA 1SJ3P 4DCOB 2M2BA 1J5EJ 2GVDA 4PUOA 4EGLA 3GSIA 5LMUF 1WEZA 4C8MA 1VK3A 4MFBA 1RT3A 5A2QU 5FDLA 4ZHRB 2KI2A 2NSCA 5CYJA 5DDOC 2HLTA 1TKXA 3BH6B 2VQFJ 2D69A 4DR4F 2IFXA 2XS7A 5SUHA 1J27A 1J5OB 4DPXA 5A0YA 5KG6A 3OXLA 4ED0A 2OIHA 1TV6A 3J7YU 1RU2A 2MDAA 2M88A 2ZVIA 1L3UA 4DQQA 2P8IA 5A8RB 4QIVA 1QAYA 2EWHA 4F4ZA 3MM8A 3MM9A 3OSNA 1SJ1A 2HZCA 2IHR1 3LPYA 4UY8T 1KVJA 1HBMA 1OY8A 1UFLA 3SIPB 2ZOFA 3D6TB 8RUCA 1PG5B 2FTRA 4P71A 3RAMA 4MKBA 5JJBA 4I7FA 4MIWA 1R0BG 4Y00A 4I2PA 1X4FA 4JB8B 1KNZA 1F9HA 4TYAA 3AHPA 1FDNA 4NI2B 3DC2A 3ENQA 4DV5F 1R6VA 2GQQA 3FCHA 3LTOA 1LFWA 4ZPTR 5CQGA 4ZPBA 3W2WB 3BSOA 2F40A 3OUYB 3FZ2A 2IBKA 4N41A 2YKNB 2HMIA 1GXUA 4QBUA 3RBEA 3A4TA 3MM6B 4WXWA 3I55S 1HBNA 1F5AA 1UCNA 4ZVGA 3HF5A 2XNRA 4ZKAA 4ANCA 4X65F 3ADAC 1DTTB 1HNIA 3LAMA 2MLXA 4RW6A 2KXFA 3ILJA 1TVRB 2V4JA 1ACMB 4NZ7A 4HYKA 2X3GA 3K17A 1HMVB 2IPOB 1T9UA 2JZ5A 4N5SA 2J0QD 4JUZA 2K1RB 3TVKA 4LSLB 3FFIB 4MAKA 2V5HG 4M5IA 1ZOTA 3SCJE 1T0TV 2G1DA 5HROA 1AUSL 5IC4B 4DQSA 4FNHA 3DOMA 3GJSB 4PWDB 1ZM9A 3ZTSA 5A8KA 2XLIA 4HACB 2PN6A 4OV6A 3T1YJ 1BD6A 2C3PA 2YNHA 4KSEB 4DHVA 1S79A 1N36F 1K1SA 2L9NA 4ZVHA 5CABA 3T1AA 2XBPA 4LRBA 1SJ4P 3UCUP 3EYZA 4OYXA 4FS1A 1VRUA 2HS0A 3VGVA 3J7A1 4F3MA 3HHEA 2I1RA 3JSMB 3BN4A 2E5JA 3R5JB 1ULRA 1M5OC 4TY9A 4YR3A 3OTEA 3EVMA 3QT6A 4TU7A 4J9MA 2C2MB 4LBIA 1WNEA 3GU0A 3ZZUA 1JLBB 1DJ0A 1X5TA 3G87A 4WYLA 4U8YA 5THWA 4ZVRB 3VV2B 3GQCA 2VOOA 2KTQA 2V2ZA 3SYZA 3DRSA 2MY7A 1IQTA 1VQNS 3T1YF 1IKYA 1TV6B 3FEZA 2QC3A 3GPAA 5GADU 2AWZA 2J9DE 2CWKA 3CCWA 3M8ZA 1IN0A 1GMWA 3EE3A 3V81B 2MZSA 3GYNA 2RB7A 5CYQB 3OT9A 3PKYA 4KGMA 3T5HA 4C8LA 5JVHQ 1I6JA 4IFYB 4FF4A 2DTJA 2FGOA 1K1QA 2WTFA 1UZDA 1FF2A 4CLZA 1C1BA 3U27A 1HIYA 4YEAA 5ETKA 3OR1B 5L9XA 5L1JA 2UP1A 4I6YA 4RNFA 5RUBA 2AYEA 3AQPA 5EGYA 3N79A 1RE1B 3PJ9A 5J1PA 3Q8QB 1WKJA 4V19X 3HLUA 2MQ8A 1UETA 3D3CJ 4UZBA 3K2YA 2BRKA 4N56A 1ZBTA 2M5YA 3D0GE 4N77A 4URSA 5K20B 2ZH4A 3QYYA 4IYQA 1RWKB 3D54A 3C8YA 3W64A 5J2PB 2ATCB 2ZWOA 3FSIA 5K8NA 3OHAA 1LXJA 1UEVA 1V3ZA 2MKJA 4ZVQB 3CJKB 3QT7A 3HKWA 2J7KA 2JNJA 2HHPA 4PKDB 3NGUA 1QD1A 2KU7A 4PYDA 3ZZOA 1SKRA 2FJXA 1RHRB 2XMMA 2YWKA 3CDEA 3HZGA 5HK4A 3JSYA 1RA7A 2IVMA 1YK9A 3Q8UA 4GVLA 4QWDA 1KVKA 4NCAA 4IFVA 1UVLA 3KLEA 1Z2ZA 3K7RA 4NLVA 5IT9U 4P7TA 3W7BA 4KB7A 1T3NA 2E5LJ 2E7VA 2Q43A 1S72S 2MZTA 1JNRB 3KK1B 1VQKS 1AROP 1JJHA 1M5VC 2AW0A 3B4DA 1C0UB 4DV4J 3BQ2A 3A8JA 4USKA 3AY0A 1K9MT 1KOOA 3C3LA 2ZHAA 3CJRA 2LKZA 1RHMB 4J90A 4DR2J 2P9GA 3TAMA 3MAHA 1U1KA 3F56A 4RNNA 3OSPA 1X9MA 2HHHJ 2RH3A 3BGUA 3LP2B 1SJQA 3TP2A 2PT0A 4OIXA 3SMZA 1S6QB 4USWA 2XWXA 2BW7A 2L3MA 1FKAF 3E01A 1EAYC 2BXJA 3P8BB 3KLFA 3FK4A 5A76A 3EVWA 1I3OB 4DV5J 4XDCA 4K5RA 4LVOP 1Y11A 3SV4A 2E9RX 4KIAA 2OH2A 4ENOA 2DXEA 1DBDA 5KG4A 1RUSA 2BANA 3D1QA 1SCJB 5EUHA 2RU3A 2OI2A 1V6HA 1WEYA 2QLXA 3BF4A 4GC7A 4LF7F 9ATCB 4B9NA 1FXLA 3HI9A 3MCMA 1FO1A 4OI0A 1JLGB 1NSQA 2YKQA 3J80U 2EK6A 3MEGA 3FSYA 5KFRA 3TA0A 3NGDA 1FWPA 2HWIA 3W8GA 5KFEA 4DPOA 4A8KA 1UVIA 2DHAA 1FTRA 4AYBD 1PAUB 4B08A 2JL9A 4Q5VA 2E5LF 3DLHA 4X62J 1Q16B 2A1BA 2R7UA 4NLYA 2DNMA 4ILRA 2UU9J 1MROB 4B9VA 1UVNA 2HFZA 2R9LA 2FLLA 1RWOB 3I5CA 2YKNA 1XMBA 2HMIB 3IGVA 3W65A 1C0UA 4K50A 2AQ4A 3ISNC 2L9DA 2OFHX 3J7YI 4JBCA 4ES2A 2YNFA 4Z37A 1HNZJ 3QMQA 3US5A 3CXCR 4JV1A 1CVJA 4RZRA 5E2QA 1M5HA 4KKOA 5AXNA 4ZOSA 3SV3A 1IXKA 4KO0A 3C6TA 3C14B 4U9RA 3AJ2A 5G4DA 2YNGB 2H3EB 3RB6A 1I94J 3DOKB 4RW7A 2ZOGA 5D4PA 1UWAA 1X4GA 3PFOA 4ITSA 5KFVA 4DV1J 1TAUA 2R8GA 3T5KA 2HQCA 2MQPA 4P2XA 4FXWA 5IOLA 3V4IB 1JLCB 1NEEA 3ULHA 3C16A 1NMEB 2OMOA 3E8OA 4EMDA 4B3RF 2QA4S 3IS9A 3CT9A 1DQ8A 3MM5B 2ZBPA 2MLZA 3OVAA 3IA0A 2Z57B 4HT7A 4LF6F 2LQ9A 5DO2A 1FFGB 1UTAA 2XSFA 2R2UA 2VASA 3MURP 2DITA 5K8OA 2E1CA 4DV7J 4GKKJ 1QE1A 3W5ZA 2X51A 4C8OA 4DBQA 3TI0A 2BMBA 4IH6A 4ALZA 4AUKA 3M8PA 2ZJPQ 2LQ5A 3ET6B 1S9FA 3VF0B 8ATCB 4HEA9 4DR5J 4PCQA 1QVFR 2LCWA 1JWWA 4AT1B 5M2UA 3QPIA 2CFXA 2OTJS 2XLKA 1S1VA 3H25A 3FDSA 5B0AA 1N88A 3B4MA 4HHJA 3RAQA 2E66A 1TL5A 4JI2F 4K0KF 4KHPJ 5A8WA 3R5AA 1H73A 3NAHA 3MCSA 2D74B 1FERA 1Q5VA 2H4YB 5D0RA 1R8CA 4X64F 2LQJA 4I69A 4KRWA 2HNYA 3J81U 3M30B 4JV2A 4NXMF 3UD3P 3EGNA 3GONA 3MZIA 2GCFA 3ELHA 3HHKA 5KFPA 2UXDJ 1S1UB 3N28A 5F3ZA 2N7YA 2VDIA 1RQ0A 2HURA 3W66A 2YH1A 4ICLB 1B0PA 4ELVA 1UKUA 1XNRJ 2GHPA 1FFWB 4Q7AA 2IM1A 3T6BA 4YMEA 1VBZA 1YIJS 5B08A 1SKSA 2CPDA 1GTEA 4RBUA 1F9FA 3R5GA 5HMWA 3S8SA 2MZJA 2XGPA 3OVBA 2W1BA 4WFAQ 2GGPB 1OSDA 4U6PA 2HAFA 2VICA 2G4BA 1LQ9A 3NWGA 2C2OB 3T9NA 3W1YC 2KM8C 2HHTA 1OY9A 3ILOA 1PCAA 4LF5F 1U2CA 2BE2A 4LFBF 4DU7A 2Y1JA 2F65A 3C15A 3GG0A 3G8TA 3GIKA 4FDFA 1SUQA 4NWBA 3D2WA 1KVIA 1VQMS 3ET6A 3THVA 2R7SA 4WE1A 4TY8A 3F41A 4MH8A 1JLAA 2D41A 5IT4A 4ELTA 5B09A 1RI7A 1VISA 2DHGA 4P2MA 2MMYA 4MKVA 3EMTA 4QW9A 4LF7J 1HNWF 3BKUA 4ZCKA 1RLCL 2EFVA 3W62A 4ECZA 4W90B 2UUBJ 2FHMA 1SV5B 3TUZC 4IRDA 2RNEA 1Y5LB 4I67A 3M1VA 5HP1A 2OEJA 4F50A 2BZ2A 2GIFA 3IAM9 4K4WA 2ERRA 2HVDA 1SH0A 1OIAA 1SXLA 2E9ZA 3KJVB 2J9DA 1A0OB 4PPDA 2J8AA 1U09A 2O5DA 3TZYA 2DXDA 4D3HA 2ZBRA 3CD0A 1BGXT 4C11A 5LSRA 2HK3A 2DISA 3LP2A 4O44B 3CCVS 1FRHA 2BJ3A 2RKIB 4PEOA 1RCOB 4FF2A 2FJAB 1MW7A 3HHLD 5I4MA 4U7UK 5HANA 1NKBA 1ZAWA 1RBAA 3KG4A 4C97A 1JK9B 1N4LA 1R8AA 4EYIB 1NKCA 2DR9A 1BQMA 1QSYA 1YBUA 3QJLA 4C6AA 1XJWB 2XWYA 3C19A 3CC4S 5KFGA 1RCXB 4Q8FA 2HLUA 2VG7A 1KEKA 1HWLA 3MR6A 3CEDA 5ETRA 4CWBA 2FQQB 4QWBA 4O3NA 2OPRA 4NA3A 3V4MA 5L1KA 3BBBA 1FK9A 3RG6A 1IBMJ 4DF8A 1KFSA 2B6AA 2YQ0A 3QFHA 3NLCA 4PG5A 3H98A 2IC3B 2RT3A 2RVJA 2DGVA 2YH0A 4DZDA 2V34A 1T3OA 1VOMA 2QL5B 2AGPA 4KGXB 4OJ3A 3KHGA 3M2RB 4DSIA 1D9AA 3CMQA 3O2IA 3IG1A 4B3MJ 4NLWA 4RX6A 4WU3A 4DSJA 1GX6A 2GQ2A 3M8PB 3O1LA 1FT8A 1KTVA 4QIGA 3RJMB 2VG6A 4X4PA 1XQIA 2DNQA 2W7AA 4JI4J 4XO0A 4MIAA 1GT8A 2P2CB 2F4VJ 1U4BA 2VBYA 1YJ9S 3BSCA 3GV5B 3MCOA 2OJ3A 4JOUA 4YUDA 2DHSA 5GAEU 1CLFA 2BYCA 3MM7A 5H1SV 2G9OA 3MMAA 2Z8QA 1N8RT 2OHDA 2M70A 2UUTA 1WDTA 2I38A 1KTQA 2F7VA 4ZN1A 3ZZ0A 1WD6A 2P6TA 4RPFA 1FTCA 1WACA 3W2WA 1Q1KA 4NE9C 4DJBA 2Z2LA 1EQ0A 3OBIA 3PRDA 2DVIA 5KG2A 2LQ8A 4PYAA 4BWJA 2HGMA 3K5MA 3IM9A 1ZZFA 5B0EA 1ZS6A 2ZUAA 5KOWA 2UUWA 3LH2S 3NCPA 1QAXA 1IUJA 2J6TA 4FF1A 3EGWB 3VGTA 1XTZA 2CJQA 1NSKL 2Y0SD 2UUBF 2UVUA 3EXCX 4GKJF 1HQ2A 3HT0A 4HH1A 3TOQA 1QUPA 2GGPA 2EBGA 2YTCA 4UOFA 4ED7A 1Z4UA 5J2MB 1S6UA 5KFZA 3FFIA 4LSLA 2CQIA 2LFVA 3AOCA 1VBKA 2GO9A 2LA6A 2A6OA 4JP8A 1PJ7A 2Z2YB 5DLGA 3MMCA 4K4UA 3DLGB 1XMQJ 5C25B 1PSDA 3SFUA 4F4AA 1R89A 2DT9A 1UPMB 4PG4A 3TEGA 2IDLA 3QAUA 1BQMB 5C42B 5AXLA 4CLPA 1YKWA 2E7WA 2ADBA 1Y5IB 1SBRA 2IRXA 1C4AA 2EC2A 1QSSA 4M5GA 1J2VA 4MYTA 1KHWA 3HP6A 4PUOB 3NCRA 1W2BR 2UXBJ 2KXHA 2RF2A 1VRTB 2NREA 2RDIA 3QIPA 2OEMA 2KT2A 3OJUA 4OLOA 1NK5A 2DB1A 5L46A 4DUYF 1H72C 4E2FB 4ZPCA 5AE1A 1X9SA 1G7CB 2PSZA 2WBRA 2UV8A 2XULA 3N01A 1NHKL 7FDRA 2WZ1A 4YY3F 2B56A 4OYBA 4ECVA 3QGIA 1Q7LB 5F9NA 2BQRA 2DEIA 2V4JB 1S0MA 1JJ2R 1ZA2B 3OXGA 5IQQA 1RU1A 5A8KB 3T1HF 2BOPA 2BW2A 2QRRA 2CDRB 3FKBA 3P45B 1LOUA 5B7WA 4LSNB 2CRLA 4L72B 5KT2A 2OUGA 3OTBA 2MQQA 1MU2B 1D8ZA 3MM8B 2XO7A 4J9LA 1TKTA 2HS4A 2LMIA 2HZAA 2RQMA 4ZJOA 1H74A 3DM2B 1X0PA 1HL6A 4Y2AA 3OV7A 4DQRA 3PYEA 5HI7A 2N4CA 2HIQA 4BDPA 1ZAXA 4LQ9A 1WG4A 4NOHA 1J5OA 2DR8A 2ZNYA 3MEDB 2EKNA 1K73T 2CQ4A 2FZCB 2V69A 3IGNA 4LF8J 5G0RA 2GJ2A 4G1PA 4F67A 1N5YA 1D1UA 1NLKL 3G2XA 4LUBA 4P6QA 2QL9B 3NOGA 4OJHA 3M8SA 2CNLB 2KVIA 2EC0A 1MSWD 1JX4A 5DM7Q 1FRXA 1TQLA 1RAOA 1HNVB 3R3TA 1XMOF 3Q2TC 1IR1A 1ICEB 2JEIA 3KHHA 2MKIA 3IFEA 5ETVA 1LNQA 4KH0B 1P1LA 3BGRA 2D3OR 2EFPA 1WKLA 2HRTA 4HACA 3K8VA 5ITHA 2HVHA 1VCTA 4MK9A 5E3CA 3OR2B 3V6DB 1XBWA 4ETZA 2JC0A 3DLKB 3FJ2A 4FKXA 1BHNA 3IC1A 4Y2MA 5DZ7A 3CJKA 3OVSA 3H4DA 5D0GA 2C2DA 2EI5A 1N5QA 5KFKA 1IKVB 1N6QA 3M30A 3PFEA 5KG5A 3TX8A 1M90T 5KFTA 1VLYA 1DZ5A 4ZPDA 3R8YA 3DRYA 4TQSA 4ANEA 3VAGA 3G6XA 1RHKB 2D3ZA 2V50A 3G82A 4OYZA 5IC6B 4DR3F 3NMRA 1HI0P 2FHKA 3CD6S 4NMLA 2DGSA 2GJFA 4O0IA 1C1BB 1IWAA 4J7CA 3R7SB 4CH1A 5KG7A 2E1PA 1RGVA 4M5LA 3OUYA 2AD9A 5KFFA 5L1LA 3Q8PB 3X1LB 2QFJA 2AEJA 3CCQS 2OPSB 5HO4A 2XHCA 3NXZA 4ED8A 2JLGA 2DO0A 1ZETA 4TKTA 3OL7A 2B6AB 4Z2XA 2YX7A 2VL1A 1RWNB 4DR6J 2ZH3A 4M8LA 1U02A 1EETB 3F0NA 3K89A 4X62F 4M5MA 4B9UA 2IYIA 4IG3B 2BV3A 3CCTA 3CNQP 2N7CA 2V2QA 1UWBA 5HVGA 4CYUA 1FEHA 2CQCA 5H9EJ 4OYPA 4OYWA 4QYZK 3QATA 3SZ2A 2RRBA 3VHQA 1CPZA 4I6WA 2FJEB 1Y5NB 4JV5F 3AD9C 5K14B 3HZEA 2JX2A 2PDAA 3KDNA 4HI2A 5E7OB 4CLFA 3CF5Q 3RBDA 3QLHB 1N56A 3HD2A 1YQHA 2ZBQA 3R1LA 1SC4B 2EXUA 1SJFA 2DO4A 2BANB 3I0RA 2F8EX 4WYWA 4XAKA 5A0YB 1YI2S 2J6UA 5C24B 4P73A 3ONQA 3S7RA 3ZFVA 4DFMA 2Q66A 3V5RA 2CKWA 2GMLA 4F8RA 4A8FA 3G4SS 1SIZA 2GMHA 1F2GA 4CH7A 1X5PA 3A13A 4I56A 4UT4A 4CIOA 4K4VA 2FHOB 4DUYJ 3UO0A 3KJNB 2W24A 4QR1A 3L4BC 2YPZA 4ZPVR 1R8PA 4DLGA 4WKYA 5AJ3F 4KY3A 3AJ1A 2W9AA 2IM2A 5MLCV 3ZO7A 1Y0HA 3AOBA 1H6KX 3PV8A 3LW5C 1Y9OA 1PC5A 2IRYA 2YKMA 4OX8A 4WFXA 2BJ7A 3TZXA 1F3FA 1H98A 4ZP9A 3VVUA 1M1KT 2IY5B 2AT1B 3TAPA 4ERDA 4NLGA 4K4ZA 1U1RA 4WK1A 4DQIA 1H7WA 2ZOMA 2AX1A 3LGHA 4R0EA 1WTBA 3DLBA 3GFHA 4AL5A 3HVWA 4URQU 5B0DA 4KGVB 2HNDA 1NKEA 3KUHA 4KHRA 3AA8A 4NLPA 4CYUB 1K44A 1RAEB 3V2UC 2CPEA 5D15A 4ED3A 3P3DA 2J7UA 2DHHA 3M6VA 1D9DA 4USMA 2QA4G 2J8SA 3H7HB 3CPWR 1RAFB 2HHSA 1V5VA 4YFUA 3KUEA 3Q86A 2FDNA 1W2IA 5L1IA 3IBFB 2YVSA 1VQ8S 1Q81T 3ILLA 4DS4A 2DNKA 1WWHA 3KK3B 2QSWA 4M1KA 4ZDNA 4DSEA 2HWTA 3NL0A 3CMES 1ZTWA 1T03A 4OI4A 1TL1A 3JTPA 2BVZA 3SQOP 2V6AA 3VGSA 2L48A 1X8DA 1RTDB 2ZC4A 2G13A 1IKWA 4PWWA 1U6BA 2QFIA 4C9DA 4USVA 4X4QA 3DM2A 2BABA 4Z7CA 3I82A 5KG0A 2H1YA 3IR5B 4P7VA 1KQGB 3M05A 2HQGA 2R8HA 1U6ZA 1SQGA 1HWKA 2B8PA 2HRUA 4LSNA 4QW8A 3D9BA 2FLPA 1JLFA 3DKDA 4NLTA 1S1VB 4P2SA 4Q45A 1YHQS 3T41A 4J91A 4IFVB 1LWFA 3QGHA 2IMOA 3MOJB 2E9TA 3KTQA 1RT6B 1N48A 3VCDA 3FQLA 5KFIA 2HAIA 1HPZB 3LP0B 1H2TZ 2AJ4A 1RAAB 3UI3A 4Q8EA 2D7SA 2ZZNA 3DRSB 2HBQB 1JLEB 1YJWS 3CMAS 1NJXA 2V68A 1R0AA 3CCES 1TL7A 5IQ6A 4LMZA 1KRPA 1ZM3A 4NRTA 1NRKA 3QRPA 1WI8A 3MI7X 4Y28C 3U1MA 4LRFA 1A6LA 3AXMA 2AEMA 5IWAF 1VQSA 4IKAA 2CVIA 4NEZA 1S1XB 2KL8A 5ETSA 3AJDA 4DL0C 3HHLC 1RYRA 5F8LA 1U8WA 3CO0P 3Q89A 5KT6A 4B9SA 2ZH6A 3CCLS 2FY1A 3UNYA 4F2RA 4ILMA 4O3PA 1ROFA 4Y2KA 1WKKA 1WC3A 2XNQA 3T6JA 1ZPVA 3EDQB 3HSDA 2J0XA 4ID5B 3Q8YA 1FJEB 4QWAA 4GKKF 4ZITA 4QIWD 1S1UA 2Z0GA 1RLDA 2X7IA 3D66A 3R5BA 2B51A 3DDIA 2WHOA 2JDJA 2XSJA 1D9FA 4IG0A 1RKJA 2A10A 4W92B 4RUBA 2Q1LA 3H59A 1G3OA 2YNFB 3BKFA 1JKHA 4Q0BB 1R27B 1FWLA 1NPPA 2B4PA 3CWJA 2AJFE 4H4KC 3TUIC 2KO1A 4TU8A 3DMJB 1KD1T 1TFWA 2NQPA 2CIMA 4JI1J 5IFMA 3H5XA 4NZ6A 2PMHA 3I0SA 5D4OA 4DEZA 1EARA 1Y4ZB 3PW2A 4X4VA 3NS7B 3SSQA 2FB0A 2H65B 4NXMJ 5GMDA 2QE5A 2HYIB 2YBVA 5LM7E 3DLEA 5I42A 2KZZA 4J9UE 2RHSB 3BPSP 2FHJD 3MPYA 2C1EB 3UPFA 4C8NA 1Q78A 3DOLA 4F4YA 2E29A 4CRJA 1FRLA 4USTA 2FVQA 4UUWA 4AXIA 5D3GB 4EI2A 1GMVA 2GS8A 5DDRC 2UUAF 1JXLA 2KFNA 3UN3A 1SUQB 3GYXB 4QYRA 2M8DB 3GCXP 1WHYA 2PIIA 1NCLA 9RUBA 4YHHJ 1S7IA 1U1NA 2BBEA 2VOPA 2W8KA 2OELA 2KG1A 2LU1A 2K7JA 1FNXH 4K4TA 4WZQA 3SSSA 1X7VA 2O01C 4AL6A 5ETNA 3DU5A 2OPPB 1RTDA 3NP5A 3NRBA 1FK9B 1HQUB 3D0IE 2AP6A 1M5PC 4ICLA 3W9IA 1VYAA 4HI1A 3PIPQ 1DTTA 7FD1A 2R8IA 2ZZMA 4GRSA 3R97A 5I3QA 3FRYA 2RRAA 4KPYA 1X60A 4G1QA 3EICA 4Q44A 2XMAA 2VF3A 2WVEA 2HFSA 4F3OA 2RE1A 1VGYA 1JLCA 2XMVA 2BKOA 1YJUA 2M8HA 4YB5A 1WTFA 2GVDB 2B7BB 4WFBQ 4FS2A 5EX3A 4LFCF 2V4RA 2LYVA 3PO5A 1YSJA 2OPRB 4DU8A 3R7BB 4TLRA 5B0BA 3OTOJ 3AB4B 4L76A 2CJYB 2Y0BB 1CS4B 4KV8B 1NZAA 3OQ2A 2J0SD 2V63A 2GIRA 2HFVA 3GWCA 4YN3B 1NXIA 2ROEA 4ED2A 4ZP7A 1TL7B 3PR5B 2KN4A 1UVKA 3UDVA 2AZ3A 3UCGA 3UN5A 3R2DJ 1O51A 1HQEA 2X1BA 3M8YA 4KAIA 4Y2CA 1X5OA 3P4UB 3W2VA 4EFAC 2QJ3A 5HBMA 3DI6A 3ZTPA 4Y0FA 2V8DA 3HSZA 4U7UD 4TXSA 2R2TA 1FDDA 3MHYA 4QZVB 1MG7A 1HWJA 1S9GA 1S48A 2AF6A 3M6WA 4EO6A 3OFFA 5D6GA 3FVYA 4BS2A 2YXLA 2QN6B 3LAKA 3V6KA 2CPHA 3KJVA 3RRKA 1ZM4A 3I4HX 2MPUA 3M6UA 1T05B 3TRGA 4PXDA 4F4WA 2G0CA 5IZHA 3KDOA 3JTNA 4HTJA 2CG8A 1O5JA 4DR1J 3LQVA 1YZ6A 2YKOA 4O4RA 3WHIA 2VKZG 2ASDA 1XNQF 3NY0A 1M5SA 4ETXA 2G1HA 2UUCF 3DGPB 2RMLA 2Y9HA 3KLIB 2J6SA 5SZTA 1RADB 1M0SA 5EDWA 1S12A 5GAHI 5C7PA 3H8YA 4CNZA 2C22A 3GCWP 4H54A 4WP3A 3IM8A 3WDOA 2XCAA 2MSSA 3J80Y 4B9MA 4C8ZA 2UXBF 3RBXA 5HP1B 2H54B 3EWGA 4O44A 3T9ZA 5HROB 4C0BA 5DM6Q 1SL0A 4DWIA 3VAHA 1B64A 3BDEA 2HQDA 2KFYA 3K5NA 4FYDA 5HJXA 4J37A 1T8EA 1SIWB 2C2NA 2C28A 3GJQB 3DOLB 2OFGX 3PKMA 5HBMB 2ZJRQ 4RW8A 2GW8A 2NYHA 2LLZA 2Q6CA 4S0MA 4QPTA 5E3RA 4YHHF 2XZTB 3LWLA 3T5JA 1HW8A 2QT7A 4GVBB 2DRBA 4TQRA 2BR0A 1L3TA 4H4MB 2PEBA 1YTYA 4PWDA 3MR5A 1MNEA 5F9LA 1RTIA 3ENWA 3GFZA 3NGRA 2FUG9 2GV1A 2V0NA 2CQGA 3BGOP 5GMKa 2XQCA 4MYUA 1L3VA 3EXYA 1A9NB 2QYCA 2D1CA 3CCZA 1S0OA 2QV6A 1P8GA 1DARA 1GMWD 3A3NB 1XEZA 1F1BB 4ECTA 4AFFA 3PX4A 3TARA 3MAAB 4Z7YA 3Q0AA 2H51B 2VFRA 1TUGB 3GR0A 2XMUA 3H2UB 5G0RB 3CULA 2ZH8A 2KFZA 4OYOA 2W2OP 4RW4A 3NBPB 1VQLS 2JFDA 5DJBA 3VAFA 2D9PA 2OTLS 2QL7B 4X4RA 2MZ1A 2ZKTA 5H9FJ 4MIBA 4C3LA 1U1LA 2BKNA 2C2KB 2DGUA 3QO9B 1FHTA 1S4EA 4M5JA 2VU5A 1F5CA 1TKTB 2CWXA 1JLBA 1Q5YA 1SVDA 1CJKB 2YX4A 4OZ3A 1NK8A 2UV8G 2ZVSA 1R7IA 2B4OA 5AXMA 1B99A 3TVYA 1P1TA 1Y7PA 2KVQE 2V8HA 2XSJB 3AB2B 4ZN3A 3DXBA 4DUZF 1QVGR 4KKOB 2ACYA 1DAXA 5DLFA 2PI4A 5KOXA 3RZAA 1S6PB 2BJ1A 2KH9A 3OFHA 1X0FA 1N32F 1R8BA 3MPDA 1WHXA 3LO3A 2OPPA 1FA0A 4YB7A 4ED4A 5EWGA 1DQAA 1X4CA 1U1MA 2RF2B 1DY3A 4A8MP 1TK0A 1HNVA 1KR4A 4NZ0A 4J9OA 3MWBA 4I0WA 4X64J 4F0MA 4F0KA 2DCLA 3I4PA 1U47A 3PY8A 2DCUB 4M95A 4IOCQ 1VR6A 1LW0B 4QIFA 1NPRA 2XY6A 5I3PA 3TR5A 3QZ7A 2CQ3A 2RU9A 2XEXA 3M2UB 4OI3A 3TNVA 4QQBA 4X66F 1YZ7A 3R6LB 5KG1A 4NLUA 2VA3A 1GFWB 2RUSA 1HI1A 4CP5A 5IXUA 2K3KA 5A2QY 3N4WA 2GC8A 4R8UA 4DV3J 3IO1A 3EGZA 1F6TA 3M9NB 1RT1A 4L3NA 3J7AN 4LSZB 4DL6A 4DF4A 2Y8YA 1C0TA 4ELUA 1VQ7S 3LPEA 5E3QA 4DR7F 4LF5J 1NK7A 3V6DA 1AYEA 2FJVA 1LV5A 1ZM2A 5ADZA 4CO3A 3KYLA 5JUMA 2MB0B 3BQ0A 2ZDPA 5H9FK 2F4VF 5F41A 2VPXB 3GTYX 2ZE2B 4NLOA 2GIQA 1W25A 4HDHA 3DMJA 3HMJG 4WIQA 2G2ZA 2ZM6J 1FNOA 3R27A 4LVNP 1S6QA 3UN2A 3CE8A 1CS4A 4YP3A 3FSXA 2XI3A 1UFKA 3DGPA 5D4NA 1NM2A 3I0RB 3IP0A 2MKHA 2DNHA 3VAJA 4LFCJ 4RL1A 3HK2A 1HWUA 3I32A 3CCUS 4BC7A 4DV1F 2QLBB 3CCMS 1Y3JA 3KHLA 1IR2A 3SCKE 3JYTA 1P9QC 5HN0A 1RTJA 3CDBA 1QM9A 3MAAA 4NCGB 4DPYA 2AJ0A 2CPYA 2VDHA 1Q82T 2VBWA 3MEEB 3EVOA 3HFZB 1S1WB 1AB8A 3PTWA 3TA1A 4YY3J 3R1HA 4OX6A 2CXEA 4K2XA 5EWEA 3KLEB 4JI0F 5KFJA 1HNWJ 2ALZA 4RO0A 4CTAA 2CYYA 1TK8A 1K47A 3JB9k 4XPCA 1U0HB 1VQ5S 5FD1A 3RR8A 2X1GA 2DGWA 2XYHB 3QSYB 1D8YA 1H7XA 1R0CB 1GXLA 2HEKA 1TMJA 5DQHA 1GK8A 1FRMA 1BQNB 2A18A 2XO6A 4QYZJ 1IKXA 2GX8A 3NNHA 2BRLA 1ZTTA 1LWXA 4X84A 2OPQA 1UJ5A 4Y34A 4CLTA 2C2ZB 3V6HA 3KLIA 3F44A 3M6XA 1RTIB 3H42A 3IWLA 5B0FA 4U8VA 3UFCX 5AJ3J 5HQ8A 2OD4A 3E2EA 2B43A 2MTLA 1RKIA 1QSLA 4JI3F 1YBAA 2BM0A 3FRZA 1S10A 2BJDA 4X65J 5IV4A 3CTRA 4EBDA 1LWCB 4YB1P 2RILA 4GVBA 2RDJA 3NNAA 1IKVA 1N6QB 1X31C 2W01A 2W2QP 4UOHA 3TJ8A 1EKSA 3N0VA 1VS3A 1PC4A 2F8HA 5A6WA 2MHNA 5DZ6A 2KKHA 4ZJQA 5KT3A 4CNYA 3QJPA 4PABA 2RQCA 4K59A 4ILLA 2LECA 5IT0A 4B9LA 2QLWA 3CB4A 3BKTA 4JI2J 1IKWB 3QGPA 3DHXA 2DGTA 3FEYB 2I5JB 3LF0A 1TP7A 4XTTA 3PJXA 4DSFA 1S97A 4KO0B 1IM4A 3EM1A 4JI6F 4JV0A 3UD5A 4O4GA 2XS2A 5D0EA 4NX9A 3CCJS 1VK8A 1BMQB 1F3VA 2O3DA 3CJ4A 1YJ7A 3D4JA 3DRXA 3KWMA 1S5ZA 2M7SA 3PEJA 4OLPA 5GAEI 5GAHU 2R2SA 3CJ2A 2WVFA 2F9JA 3JAMU 2R7RA 3SFGA 3RB3A 1NZ8A 3D67A 1LEOA 2MJNA 2OD6A 2V9KA 3PYDA 2FGCA 4HVZA 1MN7A 1PYSB 2JVRA 1EP4B 4NYPA 3N6NA 3IRWP 3M2UA 5LMUJ 4WP9A 1SB6A 2O66A 4ED1A 1UA0A 3HVTB 1FX2A 2IAJB 2H4WB 1RHQB 4OYIA 2ZD1A 3BM7A 2FVRA 5GAGU 4WFNQ 2XCPA 3UCZP 3PM9A 2XHWA 3PIOQ 4DXLA 2AJQA 4CT8A 4ZLJA 3I56S 3NAIA 4FYYB 1UJ4A 1PYTA 2ZH1A 2G2YA 1Z1ZA 2OKQA 4CO4A 4FVCA 1H2UX 2GJIA 3ISND 1RHUB 2Q3PA 5BYSA 2B0GA 5DG7A 1N5SA 1YWXA 1Q86T 2OGUA 1YRTA 5M2RA 3N5BA 1TVRA 2WRMA 2E5GA 2HHWA 4EBCA 1NHUA 2ZUGA 4A8OA 4E98A 4QWCA 5E33A 3W8PA 1TL3A 2NXNA 3DFEA 3RTVA 1B70B 1VRUB 3A3PB 3PRVA 1OSCA 2LVWA 1TK5A 4X4TA 4OL8A 3PZPA 2F63A 4RW6B 1IVZA 1G2EA 2C3MA 5U47A 4J9NA 1DLOA 3GB0A 5D8HB 1ZAVA 4FN5A 4TN2A 1CULB 1EQMA 2ZC3A 4ECYA 3PW7A 3UD4P 1NJYA 2XMKA 1QTNB 2R7QA 4JYAJ 5KFNA 4NCBA 2HNYB 2RKIA 1U45A 5EN1A 4HHHA 1MMDA 2F5GA 1C0TB 3BREA 4CTAB 2GVZA 1V9OA 2ZBIA 5K5MA 3DLLQ 3DCAA 3OL8A 1KOHA 3KLGB 5JMNA 1VBXA 1PJ5A 2CQPA 2EFGA 2O67A 4HTIA 1IBMF 4P9SA 2VFUA 1NH8A 3QRQA 5HATA 2FJBB 4E0DA 2R42A 1RTJB 1N36J 4IQMA 4PWUA 1IJFB 3CDAA 5C42A 3B6BA 4NASA 2XG8A 4DPUA 1DRZA 4JI1F 2QTWA 2NPFA 1HNZF 2OO4A 4LR7A 1XR7A 1QUVA 3BSAA 2W9CB 1D09B 1HBNB 3MPWA 5LL6d 3EUNA 2Y3YA 3NS5A 4DS5A 1FWKA 4M5KA 4R8UB 1KDNA 1FDBA 2WSEC 1JLEA 4OZ5A 1HD1A 3CGIA 3NWRA 4JI7F 4DG1B 5GMEA 1VRTA 4O23A 2L08A 4BC9A 2YNHB 1WC4A 3F73A 1S6PA 2JVOA 1FD8A 1KQSR 1X4DA 3EPGA 3LA0A 2ILZA 1FRJA 1FE0A 1REVA 5J2NA 1T11A 1CJTA 3HVTA 2LXUA 3NEKA 3PJWA 4OJGA 3C66A 3G71S 1BWVA 2VIHA 1CEZA 2VPWB 3ISZA 1JKHB 5D3GA 4Q0BA 2IVFB 4WCEQ 3CO9A 5HLFB 3O3LA 3O5TB 4ES1A 5AE2A 3QQCD 4U7CA 1IWGA 2UUCJ 2QMUB 1H2VZ 4JI5J 4TNOA 1YBTA 2M0GB 3KK2B 3GFXA 1LWFB 4RLEA 1RT4B 2WB1D 4M5DB 2WVBA 2PMZD 3KLVA 2F8MA 3THPA 2DYAA 3CUNA 4FYVB 1EP4A 4JYAF 4LT6A 2QLFB 3SCIE 3KNAA 2KZMA 2BA9A 1CQMA 1R0AB 4LRAA 2YWGA 3M8QB 3PEHA 1L3KA 1JMTA 1LFPA 5DS7A 2KYXA 1YITS 1APSA 1VRQC 2PO4A 2HHHF 4ZLNA 3VR1A 1RTHA 1RT7B 4I64A 4EYHB 4A47A 3TW0A 1YJVA 1N33J 4PG8A 4IO1A 4WBFA 1HNXF 4WP8A 2JEFA 3MMAB 3MXHP 3H5YA 2FVPA 4Q43A 1HHSA 1VJWA 4TYBA 2WW4A 2RJZA 2W25A 4P72A 2C2EA 1X9WA 1NJIT 3HO1A 3DN9A 3MMBB 2CQDA 1N34F 3NMAA 3LUYA 5KT4A 3JSRA 3PG9A 4OI2A 2LP4A 3NG8A 2E44A 1CJVA 4QR2A 3CDUA 3E3XA 3CJSA 3FBEA 3RW7A 3UR3C 4RNMA 1X4HA 4CZCA 4QWEA 3GZ7A 3AFGA 4DSKA 5BR8J 1LW2A 2B5JB 4H4OA 1HKAA 1RWXB 2K8GA 5CXTA 1JJCB 1UZHA 1QAJA 1WORA 4B17A 1AFIA 1BQXA 4DX8H 2R7VA 2DNNA 2QYGA 4KPCA 4IOAQ 1BWEA 4G1QB 3MOZA 2CAJA 4EUVA 2WVDA 1AUDA 5F8NA 4RW9A 3O8WA 1VFJA 4LIRA 1C1CA 2W4PA 2HW3A 2Z58B 3GIIA 2DR6A 2JC1A 2YWHA 3UW1A 4IDKB 2CPFA 2B9YA 2UVRA 2XC9A 1EB0A 3PW4A 4N76A 1OY6A 3IRXA 4ZCIA 2GAGC 1N32J 4Y3CA 6FDRA 2WW8A 4DN0A 4HL9A 4DX7A 2AGOA 3J7ZT 4LFBJ 1IKXB 3KLFB 3MM7B 5DETA 1NNDA 3PHEA 1XMOJ 4UTGA 2HNZB 1DLOB 4G6VB 5KT7A 2YY3A 4N8OA 4CDIA 4GC6A 2DBBA 4PRFA 4C0HA 1IBLF 2HFOA 4WXOA 3BPDA 2HKEA 4RU2A 2CVEA 3M8WA 3MDFA 1L5UA 1FXRA 2DGOA 4QJVA 2M9KA 2APOA 1WF0A 4L74A 2IBOA 1S9GB 2OLWA 2WK4A 3JXOA 4CO5A 3BBFA 2JHEA 4FP9A 1VHIA 4DN9A 2WCXA 3MD1A 5D0HA 5LMNJ 3B82A 5KFWA 1WUUA 1U6FA 1W7WA 2C3UA 4ZVTB 2LDIA 4XIUA 2GHVC 1KBRA 1HQEB 4OHVA 1V3RA 2PD1A 3G6ES 1S6OA 4K8RA 3SCLE 4KGZB 3M9OB 4H4OB 1S76D 1P6TA 1Q53A 2MKYA 4IFYA 2IM0A 3OL9A 2QIFA 3BQ1A 1NJZA 1RABB 2ZH7A 4M94A 4DV0F 4KFBB 1T9YA 1SC3B 3VGUA 4USHA 4RNHA 1RAHB 4RU9A 1TKDA 3RR7A 3WZ0A 4C98A 2A0FB 1N52B 1R6YA 1RAGB 1GX5A 4Q2MA 4IQXA 2HRYA 5MAOA 3BR9A 5K14A 2CQ0A 3EX7B 1S49A 3CW2C 4PG7A 4BCAA 1MWQA 2R4FA 1AA1B 1XR6A 2IIHA 5ETTA 1P9YA 2RHQB 5KFDA 4AQYJ 3WC2A 2YNIA 2YPYA 1BC6A 3A1YG 1T02A 1HR0J 1B4SA 2MQLA 5D77A 2CPIA 1B0VA 2HHXA 4K7QA 1X4EA 1WC6A 5ETOA 3M8QA 3QNWB 3S1TA 2BE9B 2DK2A 2EG2A 3WX8A 3KXDA 3DOKA 4RW7B 1RSCA 3G6VA 4NXNJ 1D0EA 4ED5A 1ITPA 4PQUB 1BXNA 3GFYA 3I31A 1RWVB 5KTQA 2FZGB 1RWWB 2JEJA 1FJGF 4OJ1A 1GNKA 4A8YA 5C5JA 2HVZA 2CNNB 3CJ3A 5HLFA 2ZHBA 1QLNA 2VA2A 4IDKA 4NA2A 2GO8A 3B54A 1KLMA 4MMOA 4R25A 1A7GE 4AL7A 4DPWA 5CYMB 4PG6A 1U7LA 3BR8A 5IM0B 5K8MA 2YWWA 1N5VA 3A12A 5HQLA 5IS2A 5F8MA 5H9EK 5KAKA 2IMWP 1VC6A 2V8GA 3GSDA 4ZVUB 1QJHA 4CM0A 2HGLA 1WSVA 4CLKA 5LT5A 4W4MA 2IDEA 2ROGA 5M2PA 1NK9A 3G82B 2UXCJ 1NSPA 2LEAA 3ENAA 1TU0B 2FC9A 3FUYA 3EZ5A 3IS9B 4GO5X 3L95X 1SV5A 2UU9F 4IR1A 4DPTA 5BJRA 1IM6A 2ZNZA 3L09A 1Q4RA 4MK8A 3L7UA 2ZITA 4HDGA 3IXQA 4LREA 2NCKL 3CIMA 4B3OB 2VBXA 3POTA 2A2CA 2FD2A 3BO4A 2CZ9A 4LBHA 4F7VA 1AW0A 3M2VB 1SPBP 2I9SA 2XMTA 1G1XA 1FE4A 3FQKA 4NRUA 5LXRA 4X4OA 5T7LA 1PKUA 3J7Z5 2UUAJ 4JI6J 2AZ1A 2E1AA 1KWMA 2CUYA 3G8QA 4UOCA 5E41A 3MUTP 4A8SA 2J0WA 2KT3A 3CD5A 1UA1A 4I4BA 4CCHA 1U1QA 1RTHB 4J9KA 1EJ7L 3EGVA 3UR0A 3ZZYA 3Q22A 1RT1B 1I1GA 3ZNUA 1XN9A 4X4UA 3PX6A 3BS9A 1FFSB 3N6LA 4J5OA 2W8LA 5BR8F 2VPYB 3VAMA 1VBYA 1RZMA 3CSKA 2XYGB 2W9CA 2WBMA 1RHJB 4NI2A 1JLFB 2PGCA 1OQ6A 4C0OC 4KQZA 1J5EF 1T9VA 3M7VA 1TL1B 4ZIWA 4HH0A 2YWEA 3ZC4A 3VQTA 1NDLA 3TO8A 2Q79A 3QO9A 3L3CA 5DQGA 3TX0A 3GP9A 1NO8A 4QIEA 4KR0B 5KFBA 2VFTA 5DGBA 2AU0A 1WHVA 2HG4A 1HR0F 4DL2A 4KFBA 5DDPC 1BLUA 2IJNA 3FGVA 2ZZTA 3Q8VA 5HAOA 1REVB 5J2NB 4I2PB 3OLBA 4DQPA 4DV6F 3KFWX 1T03B 4C11B 1KHVA 1XMQF 4DX6A 5J2QA 2VD3A 4FPRA 5KT5A 5F8GA 4RKUC 2QZ8A 2B3TB 3MM5A 4NL5A 4CO2A 4MKAA 2G0JA 4AD6A 4ZJLA 1IBKJ 1UL3A 3LP0A 2N4DA 2MJUA 3KMQA 2W4CA 3D3BJ 3PYFA 2EK1A 3L9ZA 4DV2J 1SQFA 5CD4H 4M5NA 4DFPA 4JI5F 3B78A 3B8HA 5KFOA 1JXVA 1SC1B 2H9ZA 3OR1A 4RJVA 2AGQA 1ZYQA 4MFBB 4GO7X 1UFWA 2NXUA 3VVTA 1DURA 4DUTA 1JXEA 3SQGB 4E8UA 3NKYA 4YB6A 2JFKA 1FVQA 4OFZA 2DIVA 4PXBA 1LK7A 4GMKA 4UQGA 4DR6F 1XIQA 4QCLA 4DUZJ 3RGIA 3P6YC 1T9XA 3IRXB 4ZVOB 1N0UA 1K8AT 3EZOA 3LGNA 5K8PA 2ATLA 3JSBA 3OTDA 4OZ2A 3EZUA 5CH7B 2LA4A 4JI7J 1K0TA 4PQUA 1N33F 1IBCB 2C3OA 2BEFA 3A8EA 1T95A 1HBMB 4O4GB 4DR7J 3VWSA 3N6MA 1RACB 3DRRA 1NPKA 4ER8A 2LU2A 4IO9Q 5ETMA 2HHUA 4NA1A 3WIUA 3DDNA 2C42A 3N9UC 1I5OB 1LW2B 2B5JA 2VG6B 3JSMA 1U2RA 1VMBA 2KB2A 4ZCLA 5KFSA 3UDLA 4ECRA 1OQ3A 2J9EA 3T5LA 3ZZTA 2KG0A 3NBPA 2DH8A 3JQMA 1YJTA 2F9DA 3FBFA 2QX0A 2FLOA 3H2VE 1RAJA 4ZVFA 1TAQA 1Y3KA 1FKPB 2RIJA 5KFCA 4K4SA 3CCSS 5DG8A 2XYPB 4R0JA 1U0SA 3QWPA 4I2QB 3DYAB 3UQSA 2DNRA 4MT1A 4EO8A 1CSJA 1B0TA 1EX8A 1NK0A 4ZA1A 2VJUA 3CJQA 2KHCA 4CLUA 3DU6A 2JLEA 3H5UA 2YKPA 1KKHA 2MY8A 3S6EA 2EFOA 3HCXA 2ZM6F 2DPJA 2VHGA 1LK5A 1OMSA 2DGQA 3SBMA 4CI0B 4WWSA 2DNLA 5E5NA 4G3IA 1MN9A 2MKKA 3WQPA 1RBLA 3IMQJ 4NLXA 4OI1A 4DL7A 3A3OB 1URNA 2KRRA 1VQOS 3IAS9 4AE5A 3FMBA 1CJUA 3MR7A 3OFGA 4FVMA 2XI2A 4P2FA 2CPZA 1V5IB 5HMXA 2CJXB 1U8SA 3KHRA 1Q8LA 2ALYB 5F0UA 2MZQA 4DI6A 1JLQA 3PR4A 4ZK7M 1H0HB 1Q7YT 1C2PA 1IKYB 4KT0C 3FNNA 5I42B 2LXFA 3BZQA 1NSAA 3BYRA 3ICLA 4CO0A 2OSRA 3BJYA 2ASYA 1UP1A 3A8KA 5HJYA 3DGVA 1RYSA 4O3SA 4NYOA 3HHLB 1FJGJ 2ZEJA 4WF9Q 1RAIB 1LXNA 1PAEX 4BWMA 4I7FB 2HFUA 1DTQB 1FKPA 1NUEA 1S77D 4C4WA 3CC7S 3BSNA 5HMZA 1FJ7A 2HIYA 4NXNF 3R9LA 3M8RA 2I5JA 3BGRB 2HPUA 3H4BA 3DLJA 4KH1B 1FVSA 5CCMA 1U1OA 4TVAB 4RR5A 1U2FA 3HSGA 3GIRA 3QGGA 2JJ4D 2MGZA 3CVKA 1Q8BA 1RBOB 4IG0B 2HK2A 3O44A 1T05A 2ZDOA 4P52A 1Q79A 1V3SA 1NHVA 1WOSA 2J5AA 2XLJA 1T94A 5KFAA 3HM9A 3DNCA 1E6VA 3G6YA 4CM2A 4F04B 4V1Ak 3HKZD 2CG4A 4RNOA 5HMYA 1HFEL 4L6V3 2J7WA 2GMJA 1KFDA 3HSJA 4FBUA 1HW9A 4LR8A 2VBZA 3MPVA 3CDWA 2VPZB 2B9XA 4IUFA 4B3RJ 3D1HA 4OZ0A 4UUXA 2VG5A 3OR2A 2E5HA 4I68A 4Y65A 4ATNA 1UVMA 3OLAA 5KFXA 2ZD1B 3VZHA 4ZPWR 1DFDA 1VQ6S 1OYEA 1U0HA 3TYTA 2CDQA 3C6UB 1ZA1B 2O1PA 4LJMA 2DR7A 2DRAA 1FNMA 2CQHA 1I94F 1M5KC 2V8PA 2HQ3A 4YR2A 2COLA 3D1OA 3D5MA 5C25A 1KP6A 3ETOA 3W5XA 1XNQJ 4OHXA 1AXQA 3G96A 4FZVA 3MTKA 2DRDA 2POKA 1TMMA 5J2MA 1WI6A 1N5YB 3PCOB 1G4CA 4B9TA 3CD7A 2QG9B 4HT5A 3PHTA 3WIVA 1CJTB 4CLSA 4URGA 3OW2R 1IR0A 2YX1A 3Q23A 2EEYA 3Q2SC 3MECB 4G65A 2R2RA 4PAAA 3VAIA 4ZS6A 1HQUA 2JH3A 3C16B 3MEGB 3FCWA 5HVFA 5LSOA 4F02A 4YOEA 2QMWA 1AZSA 4EWTA 2ZHOA 3M2VA 4Q2LA 2X3DA 2K7KA 2BDPA 3LP1B 2RAQA 3PRBA 3JTOA 2G2OA 2DXFA 4OZJA 4PZVA 4LF6J 3PXGa 3C6TB 1R31A 1TELA 2IVYA 2M4MA 3C14A 3AA9A 4FKYA 2VV5A 3DYAA 1WC5A
chains in the Genus database with same CATH topology
4RW4B 3H2LA 3RB4A 4NLDA 4IOBA 4ECUA 4RW9B 2UXDF 1WHWA 2GNKA 1FRKA 4DG1A 2IM3A 1HBOB 2W9BA 3KLGA 3X3UA 1VI7A 1MU2A 1MROA 3R5DA 4BHQA 2IYGA 1KQFB 4X4SA 2MZRA 2VB6A 1HBUA 4AXJA 4DL3A 3W2VB 2M3DA 2CZ4A 2NPIA 2WAQD 4IR9A 2KZMA 5FLXY 1WG1A 2IA6A 2AYMA 1LWEA 2FJWA 1WELA 2U2FA 1R3NA 3E01B 1SH3A 3PACA 2KDOA 2NLWA 2P9CA 2YKAA 1MWYA 1FRIA 3VALA 2U1AA 2MSTA 4OZ1A 5D4LA 1GQEA 2AQ4A 1XERA 2YNGA 2EW9A 4RUCA 5GADI 3QZ8A 4ECQA 3SI8A 2AYBA 2AJ1A 4R5PA 1WEXA 2DHXA 1U24A 4F4KA 5D78A 3HX9A 3WX4A 2HNDB 3RW6A 2RRNA 1S0VA 2BUNA 3KK1A 4NCGA 3MM9B 2QMXA 4IH7A 4MKYA 3FEXB 4RW8B 1S4FA 3U02A 3OJSA 1RISA 2RSQA 2V4QA 3CCRS 2EKYA 4JI8F 4M5DA 4I1TA 3I9ZA 2R7WA 1VHFA 1GXTA 4MTPA 4QPXA 4DFJA 3SDEA 5J1EB 3QLHA 3DI6B 1RT2A 2DIUA 2B4VA 3TANA 5DGAA 2CJKA 2FVCA 3DXSX 1X4BA 1NAQA 3HHLA 4I2QA 3IBWA 4WU2A 2VG5B 2RS2A 2V9WA 1C1CB 3HVRA 2EFNA 3NGKA 3PDNA 2NUHA 5AE3A 3MR2A 2BE2B 2A3JA 2B4UA 2MKSA 3OFEA 5GVQA 3NNCA 4TLQA 4KJIA 4TU9A 2CPJA 1FJCA 2IRUA 2ABYA 4OI6A 3T3FA 3BN7A 2C3YA 3VZIA 2CJAA 5EWFA 4N8NA 4WIIA 4AQYF 2VODA 1QY7A 3MMBA 2WSCC 3IWNC 3M9MB 3GIJA 3MTJA 5KFYA 5C24A 2Y1IA 4OQJA 1TZ0A 4LF9F 3QJJA 1RT4A 2YQ3A 1S0NA 4G1IA 3V6JA 3HVAA 5CYQA 1S1TB 5JVGQ 2WONA 1X5SA 1XC9A 2W9BB 3IN5A 3K5PA 1RT5B 3WBZA 4IRKA 3OL6A 3PO4A 2DNGA 4EZ9A 4QU7A 3Q8RB 4OZNA 4EBEA 1BQNA 4ZP8A 2XGQA 1ZZNA 4CQ1A 2F1FA 2MYFA 4ZCMA 3OHBA 2FHJA 1OS5A 2W7PA 4J9SA 3Q24A 4RWXA 3P49B 2V2KA 1U25A 1SJRA 4WFYA 3NS6A 2C2RA 4WK3A 1PGZA 5JXSA 2N3OA 1T7PA 4A8WA 4FBTA 4RBTA 2LXIA 3MEKA 2BJEA 5L8RC 2VG7B 3RB0A 3VQSA 4O3RA 1FD2A 2HHVA 2JEGA 2EG1A 3IR7B 4NYZA 1XNRF 3ZZZA 2VZ9A 4EZ6A 2B9WA 3AQOA 5DDQC 2PC6A 3GR1A 4DL4A 2FLNA 1TKZA 3GE9A 3M32A 5CYMA 5T41A 4J9PA 4MK7A 3M4XA 5LJ5Y 2DR5A 3GILA 5F3TA 1KS2A 4BBYA 4FNIA 4F2SA 3T19A 3TQ1A 1S1WA 2CQ1A 1JJ4A 3KMSA 2IA0A 3AH6A 3HDSA 3KOAA 2HS3A 4O3QA 1DHMA 2VONA 3V81A 2UZAA 3RRHA 4MJKA 5CA5A 3QIPB