1TKXB

Crystal structure of hiv-1 reverse transcriptase in complex with gw490745
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
430
structure length
404
Chain Sequence
b'ETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKDSTKWRKLVDFRELNKRTQDFWGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pol polyprotein, Reverse transcriptase, Chain A
publication title Design of non-nucleoside inhibitors of HIV-1 reverse transcriptase with improved drug resistance properties. 2.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 112
structure length 404
sequence length 430
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2004-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1tkxB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1tkxB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1tkxB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1tkxB03
3QGHA 3M8QA 1KHWA 1UWBA 4O3QA 1LWEA 2IM3A 1DTQB 5HP1A 4KV8A 3C6UA 3RB4A 5KT6A 2FJVA 3N6LA 2XWYA 3CDWA 3CWJA 1TL3B 5EWGA 5DG7A 3KJVB 5J2NA 2OH2A 1SV5B 3NKYA 2IA6A 4KFBB 4DG1A 4MFBA 4RW7B 4Q0BA 4RUCA 2FLLA 1EP4A 4KKOA 4HKQA 3D28A 2IAJB 4ZHRB 1C1CA 4O3NA 1K1QA 3DRPA 1OS5A 2XCPA 4ZP9A 2AGPA 1RTHA 4I2PA 4R5PA 1HMVB 3KHGA 1S6PB 4IG3B 4NLUA 3CO9A 3DRRB 5KFJA 5KT4A 5J2QA 5C24B 5HROA 4MIBA 4NLRA 4WFYA 3BGRA 3T5JA 4ICLB 5KFEA 5DG8A 2W9BA 4G3IA 2ILZA 4RNMA 2AU0A 5D3GA 4K4SA 2YKMA 1QE1B 1IKYB 3V81B 3OSNA 3GV8B 2C2DA 4ECSA 4NLXA 5C42A 1SH0A 1LWCA 3BQ1A 2W9CB 3D5MA 4WYWA 2R8KA 5KFAA 1HNIB 5KG3A 1R0AB 3KLIB 4MFBB 1S6QA 3CJ4A 4TY8A 4O44B 3PVXA 2JEGA 2AX1A 1UWBB 4QWEA 4QPXA 4JV0A 4RNHA 3PR5B 1IKVA 4WE1A 5J2PA 1QUVA 3SFUA 5I42B 2R2UA 1TKXA 4URSA 3PW4A 1S1WB 1TKTB 3KK2B 3KK1A 4TYAA 3TAMB 5KFUA 4EO8A 4ED8A 3NAIA 4Q0BB 4DG1B 3CDUA 3DLEA 1EP4B 3BSCA 1S9GA 4WFXA 4RZRA 2BRLA 2OPQA 5KFKA 1RYSA 4I2QA 2WK4A 3FSIA 2YKNB 4KBIA 1HPZB 1RTHB 1LW0B 4NLYA 4EO6A 2UVUA 4TY9A 1I6JA 3I5AA 4IDKA 4ZVEA 3DOLB 5HROB 3OLBA 2E9TA 2BANA 5KFMA 2W9BB 4NLSA 1RT7A 2FVPA 1EETB 5D3GB 3JSMB 4M95A 3ITHB 4LSNA 2EC0A 1S9EA 3BQ2A 3CIZA 4Q44A 3FQLA 3H59A 2R2TA 3PHEA 4IRCA 2ZD1A 3H4BA 2OPPA 4TY8B 1VRUB 1S6QB 3HVTA 3EPGA 4RW6B 4K4TA 2WCXA 3H2LA 2JEJA 4YR2A 3OHBA 2W7OA 3G6YA 5K14A 3H5SA 5J2MA 4ZP7A 1C1BA 3MEGA 1TKXB 1W25A 3EZUA 4Y34A 2AGQA 5KFDA 4F4XA 4PUOA 4NLOA 4ZP8A 1LWFA 2IC3A 4QWDA 4URQU 4HYKA 4ZVGA 3GIMA 4K4XA 1DTQA 5F8HA 4YP3A 2XC9A 5F9LA 1S9GB 3HHKA 3ISND 4J9PA 3KJVA 3JYTB 2HNZB 3IGNA 2CKWA 2FVQA 3NAHA 5KFYA 4RNFA 4IDKB 2IAJA 4ZHRA 3LP0B 5F8JA 4LSLB 2WOMB 2BANB 1CSJA 4R8UA 1RT7B 1TV6A 5DG9A 4ECZA 2FVSA 4IG3A 2FVCA 5KT5A 3TQ1A 1WNEA 3DRRA 4G1QB 1MMLA 5C25A 3OL8A 1NNDA 1FK9B 4IR9A 2UVVA 3KHHA 4YQWA 4TYBA 2ZD1B 1RDRA 4ID5B 1QE1A 1IKYA 3V81A 2HAIA 1RA6A 1ZTTA 4NLVA 3OSPA 3IRXB 4RNNA 4EYIB 4KAIA 5F9NA 3IN5A 1DLOB 4H4OB 1TL1A 3OHAA 2QE5A 4ZVFA 3V6KA 2CJQA 5KT3A 1T94A 5KG6A 3MEGB 4IFVA 1HNIA 4PUOB 1R0AA 3DLKB 1LWFB 2IC3B 4O44A 2ALZA 1RTIB 3OL6A 3QIDA 2IMWP 2JEIA 1JLGB 2WRMA 5I42A 3BQ0A 1JLBA 1KHVA 3SFGA 2WTFA 3KNAA 4RW4A 5J1EB 1S1WA 1TKTA 3KK2A 3BSAA 3TAMA 4NCGB 3V4IB 4WFZA 4Q8FA 2F8EX 3GV5B 3IS9B 4F4YA 2ZKUA 1N5YA 3G86A 2FJXA 5L1JA 5L1IA 4JV1A 2YKNA 4MKAA 4R8UB 1HPZA 1TV6B 1LW0A 5L9XA 5KG1A 4FBTA 2UVWA 5C25B 3DOLA 4PWDA 1RTDA 4DL6A 3QGGA 2JC0A 1EETA 5F8MA 5KFQA 3JSMA 3KOAA 1JLAA 2E9RX 2VG6A 3I0SA 2YNGA 2ASLA 3ITHA 4Q8EA 2XGQA 3V6HA 3G6XA 3CJ5A 1TL1B 3I5CA 3LAMA 5HLFA 4RUAA 4ECTA 4RU9A 4IFVB 1XR6A 1VRUA 2ILYA 4RW6A 4ED7A 4ED1A 4K4WA 4YR0A 2VG7B 5HBMA 4ZPCA 2RF2B 5FDLB 5KFLA 1JLBB 4H4MB 4RW4B 4TLRA 3T19A 3FRZA 2UUWA 5DQGA 1MU2B 5CYMB 2IJFA 3PW7A 4TXSA 3CJ2A 4ZP6A 3MR3A 2BE2B 3KLVA 1TKZB 1XR7A 4KSEB 5DQIA 4KHMA 2D3UA 4EEYA 2B5JB 2C22A 2RKIB 1N5YB 1BQNA 5KFOA 2B6AA 3JYTA 2HNZA 3PW0A 2J6TA 2R8JA 4ZPAA 3QIPB 1REVB 3DDKA 4K50A 2AQ4A 4ZVHA 3T5LA 3QZ7A 2JEFA 2GIRA 4IH6A 4J9SA 2JC1A 1HQUB 2AX0A 3E01A 1RTDB 3LP0A 3KLGA 4LSLA 4PWDB 2WOMA 3GIKA 3SI8A 2QV6A 3H4DA 3MR6A 1JLAB 4MK8A 1IKWA 4JV2A 4Q43A 2VG6B 2ATLA 2YNGB 3I0SB 1IM4A 3PJXA 4G1QA 2FLPA 4RW8B 1FK9A 2D41A 3GQCA 4QWBA 5HLFB 2D3ZA 2IBKA 3M9NB 4EBCA 3FFIA 1DTTB 4EBEA 1JXLA 3MECB 1RTJA 1HNVA 1HQEB 2O5DA 4ID5A 1RT6B 4O3OA 4QWCA 3EPIA 3KHLA 2V4RA 3IRXA 3C6TA 1FKPB 3TVKA 2BQRA 1DLOA 1S1VA 4H4OA 2IM0A 1RT3B 1S1TB 3PZPA 4XPCA 2HNDB 2FVRA 5HBMB 4NLPA 4XO0A 1RA7A 1RT1B 3LALA 3NMAA 3E51A 3MFIA 4F4ZA 3GILA 4PQUA 3KLFB 2V4QA 3DLKA 4ECWA 1D0EA 4ZPBA 3PW5A 4M94A 5DLFA 4IG0B 4OL8A 2OPRB 3DM2B 3LP2B 1N6QA 2ZE2B 1RTIA 3IG1B 4RW9B 3Q8PB 2J6SA 1NHVA 1JLGA 3MFHA 3RBEA 4J9MA 2C2RA 1QAJA 2HMIB 2HWIA 5J1EA 3QO9B 4DL7A 1BQNB 2B6AB 5KFVA 1S1UB 4NCGA 4ECUA 1S4FA 4IH7A 3V4IA 4J9NA 1T3NA 4JUZA 2V0NA 3FDSA 1D1UA 3IS9A 4K4VA 2I5JB 3E01B 3KLGB 3RB6A 4MIAA 3KLEB 3RB3A 4Y2CA 1JLEB 1SUQB 1C0TB 1JKHB 3ISNC 2D7SA 4TQRA 2R8HA 1IKWB 4O3RA 2XI2A 4WXWA 4Y2AA 2AGOA 4IFYA 4U6PA 3MR5A 2YNFA 1U09A 4IKAA 3OL7A 3FFIB 4TN2A 3V6DB 1RTJB 1HNVB 2W7PA 3NBPB 1HYSA 2V9WA 4DL2A 1LW2B 1BQMA 1RT5B 3C6TB 5KT7A 4DL4A 1S49A 1S1VB 2YNHB 4I7FA 4NZ0A 4ECXA 4DEZA 3ICLA 2VA3A 4EBDA 3GIIA 4O3SA 3MEEA 5KFIA 5KFNA 1SH3A 2BQ3A 4PQUB 4FBUA 3T5HA 2UVRA 1T05A 3I5BA 1N6QB 3MTKA 4O4GB 1RT4B 2VG7A 4WXOA 2RF2A 5FDLA 2RDJA 2IM2A 4H4MA 5KFWA 1ZTWA 2YNIA 3H40A 4ED6A 4J9OA 4DL3A 4K4UA 3DOKA 1MU2A 5CYMA 1JLQB 1JLCB 2BE2A 1TQLA 3OLAA 4K4ZA 4WZQA 1TKZA 1KLMA 4NLDA 3BSNA 4GC6A 1ZETA 2VA2A 3KK3A 2B5JA 5I3UA 2RKIA 3N6MA 4IOBA 3HVAA 4QWAA 4YMEA 2J6UA 3QIPA 1REVA 3QLHB 3I0RB 1TP7A 4NRUA 1N4LA 3H5UA 4TQSA 2I1RA 2FLNA 5KFCA 5L1KA 1N56A 2WHOA 4IFYB 4XPEA 1QAIA 4ED0A 1RYRA 2YNFB 1HQUA 3MF5A 4X2BA 2XCAA 2W8KA 1S1XB 5CYQA 1Z4UA 3CVKA 1C0UB 1HYSB 2GC8A 3LP1A 3H5YA 1BQMB 1JLFA 1TVRB 3DI6B 4NLTA 3DRSB 4F4WA 4O3PA 4RW8A 3LAKA 2HNYB 4I7FB 3KHRA 4NLWA 5KFBA 3V6JA 1DTTA 5C5JA 3MECA 1HQEA 2DPIA 1RT6A 3MEEB 1T03B 3CJ3A 3MEDB 3GYNA 3PR4A 3KMSA 4J9RA 1FKPA 4NLQA 1T05B 3DLGB 4B3OB 1YVFA 1RT3A 1S1TA 3M8PB 2HNDA 4KO0B 3RBDA 2DPJA 4ECQA 4GC7A 1RT1A 3KLHA 2YNIB 1VRTB 3KLFA 3DOKB 4IRDA 2WONA 4IG0A 1SH2A 2OPRA 3DM2A 3LP2A 2HWHA 2ZE2A 3IG1A 3HVWA 2JLEA 4RW9A 3QZ8A 2B43A 3RAQA 1S9FA 1KLMB 4F50A 1RT2A 2HMIA 2C28A 3BREA 3KK3B 5I3UB 1FKOB 3QO9A 4J9KA 3RB0A 3Q8QB 2BRKA 3UQSA 3Q8SB 1S1UA 5KFZA 4R0EA 3CJ0A 5KG7A 2C2EA 2XGPA 4ECRA 5JUMA 3M8QB 5DQHA 3N6NA 2R8IA 1LWEB 1C2PA 2I5JA 5F8LA 3BR9A 5HP1B 3HKWA 3KLEA 4KV8B 2UUTA 2VG5A 1JLEA 1SUQA 3C6UB 5CYQB 2R2RA 4MK7A 1C0TA 3DYAA 2XI3A 1JKHA 3PW2A 5J2NB 2OPSA 3H98A 3KMQA 4ECVA 3LP1B 1JX4A 1JLFB 5F8IA 5KFTA 1HARA 4IH5A 1GX6A 4IRKA 4Q45A 4KKOB 4ED2A 3V6DA 3NBPA 1C1CB 1IKXA 3DRPB 2AWZA 3IGVA 1JIHA 2W9AA 1LW2A 1RT5A 4I2PB 4R5PB 3DMJA 3Q8RB 2W8LA 2YNHA 2R2SA 2FJWA 5KFSA 5T14A 5EWEA 5KG4A 5J2QB 3BJYA 3BGRB 3KLHB 2GIQA 1RAJA 4LQ3A 4WZMA 5DGAA 2YKMB 2WONB 5KFXA 2BQUA 4O4GA 1RT4A 4KHRA 1J5OA 1RT2B 5C42B 4NRTA 3M9OB 1LWCB 4IR1A 4ED3A 2R8GA 3T1AA 5KFRA 1JLQA 4LQ9A 3GIJA 1JLCA 4O4RA 3GV7B 1S10A 4Y3CA 3QGIA 4ZMMA 3M9MB 2WB4A 3UPFA 3MR2A 5KG5A 1IKVB 2VG5B 4WE1B 5J2PB 4QW9A 3DYAB 3QLHA 3I0RA 2OPSB 3OL9A 3KK1B 5DLGA 4YR3A 4MKBA 1K1SA 4J9LA 4ECYA 1XR5A 3DLEB 2IM1A 1S97A 4KB7A 1S1XA 3BSOA 3QYYA 3VQSA 4KE5A 1TL3A 3T5KA 1C0UA 2OPQB 1IKXB 4I2QB 3UDLA 5KFPA 4WYLA 1TVRA 3DI6A 5JXSA 1SV5A 1N48A 3DRSA 4J9QA 3DMJB 4KFBA 1S0NA 4NLGA 2HNYA 4RW7A 3NGDA 4FS1A 5KFGA 5F8GA 1S0MA 4RNOA 3H5XA 3CDEA 2BR0A 3LANA 1S48A 1T03A 5KG2A 5DGBA 3MEDA 2ASJA 4MH8A 3RAXA 4URGA 3PJWA 1HMVA 5KG0A 1S6PA 4IQXA 3DLGA 4B3OA 1NHUA 4U7CA 5EDWA 3M8PA 5EWFA 4EYHB 4KO0A 4LSNB 1J5OB 1S9EB 1GX5A 5C24A 4DL5A 2ASDA 3NL0A 2IJNA 3FQKA 5KFHA 1VRTA 4ICLA 4K4YA 4MK9A 2E9ZA 3G6VA 3UR0A 2RDIA 4FS2A 2OPPB 3HVTB 1S0OA 4H54A 4ZPDA 5K14B 5KFFA 1FKOA 5F8NA 2W9CA 5J2MB 1C1BB 4QW8A 4NYZA 5KT2A 5EUHA 5L1LA 3KLIA
chains in the Genus database with same CATH superfamily
1F9HA 3L4BC 2NSCA 4E2FB 3UW1A 2KRRA 4USIA 4OZ0A 3DN9A 3C14A 2NYIA 2VONA 3HM9A 2VD3A 1URRA 4WFYA 1MNEA 2BUNA 3TVYA 5LSRA 1APSA 2W01A 1T9UA 3MR7A 4JP8A 1N33J 4X4PA 5ADZA 4NASA 4A8WA 4CLLA 4TY8A 1N33F 2B9YA 1MWZA 3LPYA 2HZAA 3M8SA 3PW4A 4C0OC 3DLEA 3L95X 2DGSA 4FXDA 3FSIA 3KG1A 4EO6A 2EFOA 1I6JA 4ZVEA 4V1Ak 4USWA 1TUWA 2J0WA 4B3MJ 4MTPA 2EC2A 3H59A 4RW6B 2SXLA 4B3MF 3CCMS 2XYGB 4DCOB 4F36A 2IC3A 2VIHA 2X3GA 3W5YA 4OYIA 5ETVA 1DZ5A 4R0JA 3OFEA 5KFYA 4RNFA 4OHVA 4ZHRA 1U47A 3W64A 1SC1B 1RT7B 2HK2A 4RX6A 3JSRA 1HKAA 4NOHA 4DBQA 1EJ7L 4DMZA 1IKYA 4QBUA 3HHEA 3GJSB 2LLZA 2LXIA 3NGUA 1JLGB 5I42A 2I38A 2XS5A 2YKNA 1FRIA 3M32A 2AMCB 2VOPA 2DGXA 3U1LA 1EQ0A 4I6WA 1ZYQA 1EB0A 3CB4A 2OHDA 2HVDA 2R3VA 5M2PA 4WKYA 4K4WA 3CDAA 3POTA 2R7OA 2FB0A 1MU2B 4F3MA 3R5GA 2Q66A 2QSWA 3UVJA 4USUA 2Z8QA 1BQNA 2NQPA 4CYUB 1UA1A 1RKIA 2GV1A 3AA8A 1FXRA 3BBFA 4FPIA 4OI6A 1Q82T 1MLAA 4M63A 4DQQA 2D3ZA 2V8GA 3HFZB 1HNVA 3A8IA 2DGWA 1GK8A 3VGUA 3IRXA 3RRHA 2W2PP 4L73A 3CJSA 1VMBA 2FVRA 5HBMB 1WHXA 2NXEA 2I6WA 5T41A 5FLXU 2LDIA 2AGQA 2ZE2B 4RW9B 3HX9A 2DB1A 3MFHA 1UEVA 2XEXA 3DXSX 3ONQA 2EG2A 1S4FA 4J9NA 1XNRJ 3W2WB 1YJTA 1U1PA 4RJVA 3HULA 3CCZA 4TN2A 2CVEA 2W7PA 2QJ3A 1YJWS 2L08A 3D4JA 3W60A 1G1XA 3I6PA 2BQ3A 1NEEA 4F2RA 1T05A 3SEOA 1RT4B 2YNIA 4K4UA 2V4JA 2FGCA 3OLAA 1T0TV 2VA2A 4OX9J 2ZJQQ 4OI1A 3MF5A 4OX9F 4JI0J 3MMJA 3DDIA 2QLXA 1U1QA 3TJAA 1H2VZ 3QSIA 4JI0F 3D1HA 4M5DB 1VC6A 4J5OA 3NCPA 3KLHA 4ZN3A 1U6ZA 4TVAB 1ICEB 3AOCA 4USJC 1B64A 3LP2A 4WP8A 2H1YA 1S9FA 4CWBA 3BREA 1WF2A 2C2EA 2NXUA 1EQMA 1MSWD 4ZLNA 4PZVA 1G6BA 2LQBA 1CC8A 2YPYA 4P6QA 2L41A 2UXDF 4USHA 2UUAJ 3OJSA 2FPHX 3MM6B 2DNPA 3PNIA 1T8EA 2WONB 1M5PC 1CJVA 2PMZD 5C42B 3VTIA 2GAHC 4IR1A 2KVQE 3VAJA 3R5CA 2NS1B 2OP5A 3IBCB 4DXLA 4AE5A 4F3OA 2EVZA 5DS7A 3L9ZA 2OPSB 1Q8KA 1VIXA 1DRZA 2YQ3A 3VQSA 1WELA 4IUFA 4WK3A 2A6OA 2RQ4A 1M1HA 4CCHA 4B9VA 1Q53A 4JI7J 3H5XA 1F1BB 5B7WA 4U7UD 4U7CA 4B3RF 2HHVA 4JI6J 1V9OA 2MPUA 2W9CA 1ZAXA 4MFBA 3UI3A 2QG9B 4O3QA 1QDUB 3MM5A 3G4SS 1AFIA 3AA9A 1FCAA 3MWBA 3JQJA 2OH2A 4RUCA 4B17A 1NKEA 1K1QA 4ZCMA 4PABA 5KFJA 2G1DA 1Y5LB 1Q16B 2DNLA 4DSLA 4LFCJ 1H2UX 2HFUA 2I2YA 1RBAA 1HNIB 1TELA 1R0AB 1ZOTA 2DTJA 2M88A 3CJ4A 4A8XA 3CMQA 3M4XA 4C8OA 3MD1A 1TTHB 5HVHA 3W9JA 3CDUA 1I5OB 4RZRA 2OPQA 5KFKA 4I2QA 1GNKA 2CNNB 3QT8A 1HWUA 4CO5A 1VQSA 1PYOB 1UKUA 4UTGA 4DCJB 4PG8A 4DR6J 4TKTA 5LOQA 1BXNA 2KYXA 3BBBA 3H4BA 4TY8B 1YJ7A 3PYDA 4ZP7A 1U8WA 4G65A 4ZP8A 2E7WA 3JYTB 3IGNA 2CPZA 3TJ9A 2J8SA 3CXCR 4R8UA 5KT5A 4YY3J 3K5PA 3QFHA 4FF3A 3SCKE 5BYSA 2CNLB 8ATCB 3NLCA 1JJ4A 4ZVFA 4A8OA 3ENAA 2IC3B 4O44A 1R43A 3ZXWA 3G8SA 1ZA1B 4IO9Q 4EZ9A 3KNAA 5L9NA 1PGZA 2PEHA 4F4YA 2DITA 1Y11A 3O3LA 2G2OA 1U0HB 1GFWB 3BYRA 4DL6A 1D3WA 5F8MA 3QWPA 5KFQA 1VDHA 4RUAA 3BYPA 5SZTA 1VRUA 2ILYA 4KIAA 1E6VB 2VG7B 3DGPA 4M1KA 4TLRA 1Q79A 3CJ2A 2ALYB 1HA1A 4YB7A 4MKVA 2B6AA 5B0GA 4FYYB 2BZ2A 2RHQB 3I31A 5LT5A 4HDGA 3BR8A 3Q89A 1O8BA 2YPZA 3MAQA 3AD7C 2R7QA 2FGOA 4Q2MA 1OIAA 4ZJLA 2BQRA 1S1VA 2HNDB 1S76D 3RTVA 1NPRA 1B4SA 1RT1B 3POTB 3MFIA 1SL2A 4OMFG 3IXQA 5GAEU 4M94A 4PPZA 3UVJB 2DEIA 1N0VC 3DOMA 2P5VA 1BQNB 1ZZNA 1R3NA 3V4IA 2MQPA 2HAFA 2LXUA 1BC6A 2YTCA 4WF9Q 2ROGA 1YRTA 4YB6A 1VHFA 4CLZA 5CZVA 1HNVB 1FE4A 3J81j 3T6JA 4C8MA 4ECXA 3GIIA 1SJ3P 3KKFA 2RF2A 1ZTWA 1J2VA 3PX0A 3KJQB 4WZQA 4X4UA 4NLDA 3W66A 5D8HB 3MPWA 4OZJA 1FX4A 4YMEA 3BPSP 4TQSA 1KBRA 1N56A 1HBMB 2XY6A 5HVFA 1HQUA 2CDQA 5ETKA 3OR1A 1RWKB 2ZDOA 1FE0A 5SUHA 2DPIA 3MEDB 1FKPA 5LMNJ 2GMHA 1T05B 4C9DA 2J7KA 4CDIA 4RR5A 2YNIB 2ZWPA 1YJ9S 3DRXA 1NU4A 4DV1J 3QO9A 3BKUA 1KD1T 2FQQB 4YDDB 1C2PA 1F3VA 1YDLA 3AOAA 3J7AN 1NLKL 3QPIA 3PIPQ 5BXIA 5A8WA 2W8LA 2VHGA 3AHPA 3KLHB 2GIQA 2XSFA 1SIWB 2CPYA 3SDEB 4P7TA 2LECA 2JHEA 1M5HA 2HBRB 2R8GA 3LGMA 4DPUA 3D9BA 1S10A 4WPAA 4QW9A 4K8RA 2F4FA 2VDHA 4I6YA 3S7RA 2DNZA 1S7HA 5F0UA 2EW9A 2BJEA 1HNZJ 2Z57B 1N0UA 1FXDA 1IR2A 1HNZF 5K5MA 5KG2A 4URGA 2M8HA 3NL0A 3VAKA 5KOWA 3VGSA 4BLGA 1TKDA 3U7JA 3FCWA 3V5RA 2W2OP 3PFEA 3PIOQ 3PY8A 3WIVA 3W63A 5L1LA 4A47A 5ETLA 2ZEJA 3RB4A 3KJVB 1SJFA 3HVRA 2XHCA 1OPIA 2ZNYA 3ENVA 4QIGA 2AGPA 1RTHA 4I2PA 3K8VA 4LRFA 5C7PA 4C4WA 1NO8A 2XYHB 4LIWA 2DHXA 3BO3A 1YI2S 1TL5A 2W9CB 2R8KA 2DHAA 2OIHA 4MFBB 3FEYB 2AJ4A 2COLA 3CC4S 4V19J 1S1WB 2FZCB 3JAMU 3THTA 1QVFR 1YRXA 1WG5A 1V5VA 2YQ0A 4DR7J 4P72A 3RBZA 3FVYA 3R6LB 1DARA 2FVPA 5ETPA 4M95A 3R9LA 3Q8YA 1N5SA 4WKRA 1VR6A 4DF8A 3PHEA 3JTOA 3V2UC 3KDOA 1NKCA 2V2KA 3MEGA 3GFXA 2MQ8A 1LWFA 3W7BA 2JNJA 2XC9A 1KOHA 3HHKA 2C3OA 1RE1B 4LSLB 2G0IA 2PGCA 3VF0B 2B4OA 1HWJA 3TQ1A 2DY9A 1L3KA 2LEBA 4P10A 2ACMA 1T9WA 3BO2A 1X7VA 2DNGA 2V9KA 3GCWP 2B8PA 1G3OA 2XQCA 3A8EA 1B99A 5CA5A 1PYTA 3GONA 2OUGA 4PG4A 3R7SB 1HD1A 3PYEA 4UW2A 1H3DA 4P9SA 1N5YA 4R8UB 1HPZA 2IYGA 1S0VA 4NWBA 3D0IE 2XHWA 3JSMA 1PJ7A 3KOAA 4C6AA 2HK3A 2E7XA 4ECTA 2JX2A 1GMWD 3HHLD 4ED1A 1FT8A 1FTCA 3P45B 2R7WA 3HF5A 1BUXA 1DQAA 3VGVA 2B4UA 3JS9A 4MK8A 1H38A 4QR1A 2RRNA 1FK9A 1P8GA 2ZBPA 4H4OA 2IM0A 1KDNA 2N7CA 1RU2A 3US5A 4JYAJ 4OHYA 2B6AB 5GVQA 2E5LJ 3R27A 1WHWA 1RZMA 2V68A 3W2VA 2CJ9A 3KLEB 4MAKA 5CH7B 2E5LF 2ZFHA 2IYIA 1VQKS 3MR5A 3H2VE 2YNFA 1V3SA 1F9EB 2DK2A 1GTEA 2V2VA 1X5OA 2B8QA 1RT5B 1S1VB 2N3LA 1CQNA 3HHDA 2IFXA 3DOMB 3J7YI 3P96A 4ER8A 3H40A 4NXNF 1JLQB 1H98A 2LXFA 3QMQA 1ZETA 3N6MA 1VQYA 1PSDA 4YDXA 5HJYA 1S1XB 4K5RA 2W7AA 1X31C 3TEGA 4KT0C 2VPZB 1R89A 5C5JA 4C8LA 1T03B 3LWMA 5DJBA 2J7UA 5IFMA 1RT3A 2PSZA 1KWMA 2DPJA 4XK8C 1RHMB 4K0KF 3I96A 1U2CA 3M9OB 2B3TB 3RAQA 2KT3A 2O1PA 4XIUA 2ZVSA 3J7ZT 2XGPA 3FZ2A 1PJ5A 1R6YA 3OR1B 3GIRA 4B9MA 3OV7A 5ETTA 2KN4A 2MGZA 4CLPA 5KG4A 2XS2A 2HG4A 2QA4G 1Y5NB 1HHSA 1UMJA 4MJKA 3KNGA 1LWCB 2YKOA 1RXOB 2U1AA 2AJQA 1Z2ZA 4ZMMA 5A2QU 3M9MB 2G0CA 1I3OB 4KY3A 4MKBA 2YWGA 2MQMA 1ULRA 3DI6A 5A8WB 1FJCA 3ZTOA 4DS5A 1HMVA 4IQXA 2UV8G 5DETA 2KDOA 1VRTA 2XSJA 4OI0A 4J9UE 4QYZK 4BWJA 3UR0A 1UJ4A 2KXNB 2QN6B 2PI5A 5DDQC 2E5IA 3HT0A 4NYOA 2CFXA 3OBIA 3BH6B 2DH9A 3KLIA 2MZSA 1UA0A 4PG6A 1F0XA 3J7Z5 1NHKL 3FEXB 3DRRB 3MM8A 5HROA 3CCWA 3T5JA 3TA0A 1SJRA 1QE1B 1UEKA 3V81B 2BJ8A 1MROB 2Y9HA 1N5QA 1QSSA 1SH0A 4X4RA 3LWLA 2E5JA 2CG4A 4CO4A 1M0SA 2ZOGA 2EPIA 2JEGA 1VBZA 2N4DA 4K2XA 1O51A 5L46A 5HQLA 3ZNJ1 1D09B 3ULHA 4FDFA 1FWPA 5AT1B 4EO8A 1RAAB 3TA2A 4DR2J 5JJBA 4RL1A 1RTHB 2UVUA 2M5YA 1YLXA 1VCTA 1YITS 4L72B 1J5EJ 3I5AA 3TR5A 1YSJA 4CP5A 3UWTA 3P5BP 1U8SA 1R8CA 1J5EF 3BQ2A 1FVQA 4IRCA 1NSAA 3EGWB 4YR2A 3BBCA 3CF5Q 3OTDA 4NLOA 2C3MA 3IM8A 2QLFB 3D67A 4O0NA 2I8EA 4ZPWR 2GMJA 4P75A 1DY3A 3G82A 5B0BA 5LXYA 1HBOA 4F02A 4ZVTB 5L38A 1EKSA 1Y4ZB 4WBFA 2VKRA 1L3SA 3MEGB 1H0HB 4FYWB 3DLKB 1LWFB 2KG0A 2J9DE 3K7RA 2DEJA 4RW4A 2G1HA 2P2CB 1XBWA 3VVUA 4WFZA 2QRRA 1AUDA 1PBAA 3IS9B 2MJUA 2P9EA 1QSYA 3MCOA 3D1QA 2CQCA 1RTDA 3HFKA 4ZLPA 3ELHA 2NSBA 3M05A 3N9UC 5CCLA 1XR6A 4BDPA 4ED7A 5K8OA 4H4MB 3PTWA 3TO8A 3UNYA 2O3DA 4OLOA 5DQIA 4MYUA 4QIVA 1N5YB 1KLNA 2GVZB 2F1FA 2IVFB 4DSKA 2UP1A 2DRAA 2CQ2A 1WC4A 2KO1A 2MY8A 2MKSA 4G1QA 1H2TZ 4ID5A 4F0HA 4PYAA 3EPIA 2ZHOA 3OQ2A 3AOBA 1OYEA 4IO1A 3PW5A 3AB4B 3DM2B 3OFHA 1YZ7A 5E41A 1J27A 4LSZB 1NMEB 4ECUA 2XS7A 1JXVA 1WC5A 1EX8A 4OX8A 2BV3A 2D7SA 4O3RA 4XAKA 1RAHB 3H20A 3D0HE 2LQ8A 4BCAA 1HYSA 4NZ0A 6FD1A 4DEZA 1F5CA 5KFNA 3TUZC 3QRQA 1KKHA 4ETZA 3MCNA 4K4ZA 1OWXA 1Y00A 3W2VB 2RKIA 3IWLA 3R5AA 3HCXA 3GJQB 1REVA 4I68A 2YNFB 5L8RC 2RU3A 1X4CA 1TVRB 1NDKA 1NSKL 4RW8A 4ELTA 4X62F 4Z37A 4QYRA 1VBXA 4PR6A 4WFBQ 1S1TA 4ECQA 2AEJA 1OY9A 2G4BA 4IRDA 4OYBA 1SH2A 4M5KA 5L39A 1F60B 3ZZUA 3C6UB 1HNXJ 5J2NB 3LGNA 2WVEA 4DX8H 2QL5B 4Q45A 5HANA 1C1CB 1B0VA 1BD6A 3DRPB 4ZVUB 1N34J 2MY7A 2CYYA 3JTPA 5G0RA 1LK5A 1LXJA 5FJ4A 1RU1A 2YH1A 4TNOA 4JI3J 1IXKA 4Y6IA 3T1AA 1R27B 4JI3F 1IBKJ 2VOOA 3D7SB 3OL9A 2X1AA 2IRUA 2VFVA 2WAQD 2PI4A 3LO3A 3QYYA 4KE5A 4DHVA 4B3SJ 1R8BA 1RHKB 3W5ZA 2MMYA 1GXUA 4M5MA 2VFSA 1S0MA 3VCDA 3W65A 2BR0A 2XY5A 3RAXA 4L6V3 3O5TB 4KO0A 1YJNS 3LPEA 3CMES 1JJHA 3HVTB 3EX7B 1ZPWX 2VF3A 2EBEA 4ZPDA 8RUCA 4I6AA 4AXJA 4OZ3A 5EUHA 2B51A 4JV5J 2ZJPQ 1RWNB 2IA6A 3OVSA 2ABYA 2FLLA 4O3NA 2K3IA 4DPOA 1TK8A 2WW4A 5B0FA 1HMVB 4ILRA 1NDLA 4GKKF 5IWAJ 1KRPA 1MG7A 4ES1A 5J2QA 1FRHA 1ZPVA 1N36J 5E3CA 5E5NA 2KZMA 2CQHA 5ITHA 2HZCA 3KLIB 4IOAQ 1IKVA 3JSBA 4URSA 2IPOB 1G7CB 2WK4A 5EHHA 2DIUA 2GGPA 4ELUA 1RWXB 5GAHU 2F3JA 3MM8B 3M6UA 5HROB 3A13A 1EETB 2FTRA 1VQ8S 4BBYA 3ITHB 2HRYA 6AT1B 1WDDA 3MDFA 1S9EA 1C4AA 1KTVA 1RSCA 1WC1A 1CJTA 2CQ0A 1NJXA 2WCXA 1VRQC 1TL7A 2C2KB 1W25A 4B9LA 4HYKA 4K7QA 5F8HA 1WORA 1N5TA 4LF4J 4XDCA 2VASA 3TVZA 2FVQA 4RBVA 2VBYA 4LF4F 4OHZA 2A18A 4ANDA 2XO7A 1TK0A 2DGVA 2QA4S 2VB6A 4QZVB 3PO5A 3OL6A 5A6WA 3TZXA 2JH3A 4C3LA 3EE3A 3BSAA 2RMLA 4GRSA 1VFJA 2F8EX 1EKRA 1RWOB 1D8ZA 5M2RA 1WEYA 5L9XA 4FBTA 1AUSL 4OZNA 4DV7J 3LTOA 2KRBA 2C2NA 4FPRA 4DV7F 4AXIA 3KTQA 2Z2YB 2HGLA 3PKMA 3NEKA 2LP4A 1L3TA 5AE2A 3T1YF 4RW4B 3CC2S 5CYMB 4TXSA 4DQRA 4KSEB 4KHMA 2B5JB 2KG1A 4P2FA 2EXUA 2IMOA 4IH6A 1RTDB 3LP0A 5LXRA 4YFUA 1K47A 2H48B 4PXCA 3G96A 4XDDA 1R6VA 3UE2A 2FLPA 3MMAB 2UXBF 1JXLA 1RTJA 3PHTA 3PZPA 1BY9A 4HTJA 4NLPA 1YWXA 3LALA 2DNYA 3KLFB 5DLFA 2WBMA 2OPRB 1HNWF 2HWIA 5THWA 4CO2A 3NWGA 1JLEB 1VBKA 2XI2A 1U45A 2WB1D 1U09A 3C66A 1AYEA 3BH7B 5DDOC 3MXHP 2FC8A 2F9DA 4EBDA 5KFIA 4GO7X 3GP9A 3UD4P 2UVRA 4QU7A 1MWYA 2AKWB 4IQMA 5FDLA 1AT1B 4NA1A 1NDCA 3C15B 3MMCB 5I3QA 1WKKA 1ZBTA 4DV5J 3QLHB 3S01A 1RYRA 4OZ1A 5AXKA 2XCAA 2M7SA 2OAUA 2ZM6F 1HYSB 4NLTA 1KVIA 3MECA 3DU6A 4PXEA 4TU7A 5D4NA 3TWZA 1CJKA 2P8IA 2HIYA 3RGIA 4IG0A 4KH1B 4NI2A 4GO5X 4X84A 2WVCA 5GAGI 4DPYA 1JQGA 3A3NB 2BOAA 2EK1A 5BJRA 5F8LA 3NP5A 1B7YB 3AQOA 2YWHA 3I9V9 5D0EA 3OTCA 4QIFA 4FF2A 3DCAA 3NBPA 1U4BA 2AWZA 5D4PA 3VZHA 5EWEA 2RNEA 2D9PA 3QNWB 4WZMA 1PIEA 4LF7J 3NS6A 1RBLA 4LQ9A 2QTWA 4LBIA 1XC9A 2WB4A 5IXUA 3N79A 2WSEC 2YX1A 3D66A 3M8RA 1R8HA 2QSFA 2E7VA 2FIUA 3HK2A 3P5TL 3T5KA 1C0UA 1NPPA 1PJ6A 2DH7A 4JBCA 1SV5A 3CTRA 4KFBA 3KWMA 2ATCB 4FS1A 2LQJA 4N56A 5G0RB 5K8MA 3CDEA 2V5HG 3VHQA 1NZAA 4LSNB 4DL5A 4QIEA 2Z56B 3OPKA 4ICLA 2G9OA 4M5HA 2EG1A 3GWCA 1K8AT 4FS2A 4UY85 3NCQA 3VAMA 2YBVA 3O6QA 4XTTA 2HFZA 2RDJA 2QYGA 3M8QA 2Q1LA 4OYOA 2BM0A 2EFVA 4DG1A 1RB0A 2DKOB 2P9CA 4R5PA 4NLUA 2CG8A 2KHCA 4MIBA 2J9EA 2MQOA 2VFRA 3A3OB 3SSSA 3OJUA 2IY5B 4HHHA 1GQEA 3CGIA 4WE1A 2RSQA 1PILA 5E3QA 1VYAA 1X0FA 4OLPA 1O0PA 4DFJA 3KG0A 1TU0B 4O0IA 3DOLB 2QC3A 2E9TA 2FHKA 3BKFA 3B8HA 1FKAF 4LT6A 2GQQA 2WW8A 1TK5A 4CTAA 2OPPA 4LF8J 2CQPA 3HPOA 1T11A 3G6YA 2HVZA 1IQZA 1IQTA 2Z0GA 4KGMA 4ZIVA 1JNZB 1T9TA 4F7VA 5F9LA 2C3UA 3ISND 1RCOB 5B0AA 5JVHQ 3SYZA 4KQZA 4N8NA 5CD4H 2DNKA 2VPWB 2HBYB 5DG9A 4A46A 1T7PA 3FBCA 3MURP 2DR7A 4A4JA 2FD2A 2I0XA 3ZTSA 4RNNA 2LFVA 2K3KA 5CAAA 4DR1J 3OW2R 5DZ7A 4DR1F 3TAMA 2FYXA 1RWMB 2W25A 3BGLA 4U7UK 1WF1A 4PWDA 3G6ES 2RE1A 1XMQJ 1NUEA 4Q8EA 2E29A 1Q1KA 2VV5A 4F4KA 4CRJA 3NOCA 4Z7YA 3T19A 3FRZA 4DOZA 3KLVA 1TKZB 4N8OA 3WC0A 3CCSS 1GMWA 3HHLA 2W4PA 2J6SA 3SI8A 1IKWA 2ATLA 4C7QA 2YWWA 2O5DA 3N4WA 4ZVQB 3KDNA 2KJVA 1DLOA 1RAGB 1TZ0A 2V4QA 3PEHA 4X4NA 3LUYA 1UWAA 4JI4J 2BJDA 3MMBB 2HMIB 4J9VA 1NK9A 3SQGA 2VBWA 5ETRA 4DUTA 3M6XA 3B6BA 1W2IA 1C0TB 1F2GA 3RRGA 2NUHA 4U9RA 4WIQA 1L3VA 1RTJB 2XMJA 1LW2B 4B3TF 3MM7B 4LVOP 3MTKA 1B0TA 2YWKA 3BSNA 1RISA 3LF0A 4LR7A 4C98A 2LDYA 2VFTA 1NK5A 1HFEL 3B4MA 5D77A 3SQOP 1JLFA 5AE3A 5CD4A 3KHRA 3FBFA 1HQEA 4B3OB 1YVFA 3ZO7A 3M8PB 3HLUA 1MMDA 7FDRA 3PXGa 4X64J 5BYRA 2Y1RI 3Q8QB 2BRKA 4X64F 1S1UA 3FCVA 4ECRA 5JUMA 4C8YA 2W24A 2I5JA 1UW9A 5HP1B 2VG5A 1X9SA 3HT3A 3TAPA 4DV6J 1EZZB 3H90A 4CO0A 2OD4A 2AD9A 4IH5A 2XBPA 1KP6A 4DV2J 1LV5A 4DV6F 1BMQB 4LQ3A 1WC0A 4BWMA 2YKMB 3OTBA 4NI2B 1AA1B 1Q8BA 4ED3A 1AW0A 3M8ZA 1JLCA 2AJ0A 2Q43A 3GU0A 4F0KA 1HBUA 5KG5A 5J2PB 3KK1B 4B9NA 4KB7A 2DNMA 4EMDA 1RQ0A 4DSJA 3TNVA 4RNOA 3NGKA 3TZZA 2OEKA 1U48A 4DV4J 1VK3A 3F73A 1R0BG 2AT1B 3CNQP 4RBTA 3ZC4A 5KT2A 5LMUJ 3D1OA 2JLGA 4KR0B 2ZZMA 1DTQB 1FERA 5HN0A 1SV5B 3UN5A 4KFBB 1EP4A 4KKOA 3PACA 2RDDA 2IAJB 1QJHA 3X1LB 3F44A 2MHEA 4ICLB 3NCRA 3OR2B 4G3IA 2R7VA 1SL1A 2FUG9 2XLJA 2IA0A 5GAEI 4HHJA 3M6VA 3FBEA 5KG3A 1QUVA 2C42A 1KSPA 1TKTB 4TYAA 4A8MP 4DG1B 1S9GA 1SKRA 3BN7A 1RYSA 4GMKA 2BM1A 1LW0B 4LUBA 1W2BR 5IC4B 2XULA 4X4SA 3CIZA 2VJVA 1HI1A 3C19A 2R2TA 2XMKA 1N88A 5B08A 4L76A 5K14A 3TYTA 3IFEA 5J2MA 1U2RA 4ZVGA 4Q5VA 2XMAA 2DT9A 4ZOSA 5IQQA 4ZLLA 4KHPJ 1CULA 4PRFA 4P2SA 3MUMP 2K1RA 2W1BA 4KHPF 2CZVC 1CSJA 1T9VA 4JI8F 4IG3A 2HBZB 1X4GA 2MKYA 1AZSA 4UOGA 4CTAB 1TMMA 2LCWA 4KAIA 2C2OB 5KT3A 3WZ0A 2BE9B 5D0HA 1GEHA 2JEIA 1NSPA 1LEOA 5A8RA 4G1PA 2P6SA 1DQ9A 4HT7A 3G87A 3IAS9 2FJXA 4JV1A 1QAXA 2DXFA 2LA4A 1UP1A 1FWLA 2F8MA 2JC0A 4C0BA 2VG6A 4YEAA 4DR5J 2DGUA 1SC4B 3WDOA 4DR5F 2IRYA 1H7WA 2H54B 4HACA 5M2UA 3CPWR 1FRMA 2UUWA 2ZH4A 2JEFA 1X9MA 2XWXA 4MKYA 1K0TA 2JC1A 4PWDB 2WOMA 2CPFA 1IM4A 2HKEA 2MSTA 2QT7A 3M9NB 4EBEA 3Q83A 2L3MA 2QA1A 3TVKA 4PEOA 4F4ZA 3E51A 1TMJA 2NUUG 1G2EA 1X4AA 1FXLA 4OL8A 3CCUS 1RTIA 3IG1B 1KFSA 1NHVA 1QAJA 5J1EA 3TUJC 3J7A1 4NCGA 3RB3A 2XZDB 2HQCA 3DHWC 4PWUA 4TQRA 1IKWB 4DR3J 3ZTPA 4P74A 3G2XA 3FRYA 3V6DB 1Q7YT 4DR4F 1S49A 2ZVIA 3NGRA 2RU9A 5D4LA 2QX0A 4OYMA 2DHSA 2I9SA 2EKNA 4KGZB 4EZ6A 4DL3A 3SQGB 1VGYA 2BE2A 1NPKA 1I1GA 4CT8A 4QWAA 3I0RB 1CJUA 5H9FJ 1IJEB 2BJ7A 5CHCB 1HHTP 5EGYA 2D69A 2A0FB 1DTTA 1T3OA 4C48A 2JJ4D 1FWKA 3R1LA 4LRCA 4GC7A 1WOSA 2ZWOA 2VBZA 1OY6A 4J9KA 1NJWA 5KFZA 1JXEA 3CJ0A 1KQGB 2BKNA 3GJTB 4KV8B 3WX8A 3DYAA 1JKHA 4ECVA 1JLFB 2XZTB 2QA2A 4A48A 2HQGA 3IR6B 2QFJA 2YNHA 2FJWA 2J0QD 3ZZZA 3BGRB 2KJWA 1UW4A 2YH0A 1IM6A 4O4GA 1FDBA 3RJMB 1G4CA 1VQ7S 4M5IA 4YHHJ 4O4RA 3QT6A 2N4CA 4GVBA 3WC2A 4YHHF 2VG5B 3PG9A 3RW7A 4ID8A 3ZTRA 4ECYA 3K17A 1IBLF 1TL3A 1SIZA 5KFPA 3T9NA 3ZZPA 3DRSA 4LFBJ 1QTNB 3NGDA 3EJMA 1LXNA 2HVEA 4ZITA 2PD1A 4LFBF 4DWIA 3HD1A 1KS2A 1S5ZA 1VQNS 5EWFA 1WDTA 4K4YA 2VQEJ 2UUBF 4FXWA 4EGLA 1S0OA 1QAYA 4AL6A 2VQEF 3D6HB 3RAMA 1KHWA 1WTBA 1LWEA 2ZC4A 4FF4A 4CNYA 1N32J 1B7FA 5DG7A 1EAYC 3CDWA 4WP3A 4U96A 2PN6A 5ETMA 4Q0BA 1HR0F 5FIIA 1N32F 1XJWB 3CCRS 4M5LA 4UT4A 3ETOA 5KT4A 3FEZA 2V63A 3FUYA 4Q2LA 2DISA 4CLYA 3M8YA 2CVIA 4DX7A 3ET6A 1S6QA 2LKZA 2ASYA 4QWEA 4JV0A 3PR5B 3EYZA 3SFUA 3PCOB 2R2UA 4CH7A 4DUZF 1U1OA 4P52A 3EICA 4B08A 1EP4B 2AEMA 1R31A 3L3CA 2V8DA 2R9LA 2GW8A 3UCZP 4NEZA 3DU5A 1T9YA 2NR0A 5KFMA 5C2GA 4NLSA 1VQLS 4DQIA 3LGHA 1DJ0A 4K4TA 1UVKA 4GKJF 3H8YA 4AFFA 4DQPA 2WSCC 5H9EJ 1SI9A 1S9GB 4FVMA 3K57A 2XB2D 4F04B 5A0YA 5F8JA 2RD5C 5HQ8A 2HQIA 4ECZA 2ZJRQ 2MZTA 1WNEA 2BBEA 1RP5A 2E5GA 3PX6A 5E3PA 3I4HX 1FDAA 3G8TA 4LF6J 2F9JA 2R42A 2BVZA 1E6YB 3V6KA 1T94A 3J80Y 4LF6F 3TARA 2OSRA 3QIDA 3SFGA 2WTFA 4C0HA 3KK2A 1NRKA 5T7LA 9ATCB 2K1RB 1RAEB 4ZDNA 2MKHA 2HLUA 4UUWA 4P2XA 1D9FA 2PFFB 3MHYA 4WTOB 1NM2A 2KB2A 3QGGA 2AIRB 3HDSA 1FI4A 1X60A 1VISA 4RU9A 3NNHA 4U8YA 1D8YA 4LR8A 2QMXA 1VJQA 3IR7B 2IIHA 3NS7B 2XMUA 4MMOA 4N7TA 2R8JA 3PW0A 2HNZA 4ZPAA 3DDKA 2FHOB 4OYAA 3W61A 3MR6A 1NK0A 1ACMB 1YGYA 3JQKA 2VG6B 2VICA 4LF9F 2UXDJ 1NBEB 4NL5A 3BV8A 4XPCA 4HACB 3NMAA 2HURA 4PQUA 3D3BJ 4ZPBA 2J9CA 2VBXA 1N6QA 1HD0A 2HSEB 1N54B 3I4PA 4PAAA 2J0XA 2HQDA 2V0NA 2C2MB 4K4VA 3RB6A 1NSQA 1RAIB 1VHIA 2CJYB 3BGUA 3B78A 1XEZA 3RRKA 3ADAC 2U2FA 3OL7A 1SQFA 4DFPA 1FJGF 3VAGA 3CD5A 1VQ5S 2AZ1A 2BJ9A 4OX7A 4DL0C 4B3RJ 3UDVA 3OUYA 2HIQA 1PAUB 2BACA 2XMTA 4WXOA 5D4OA 2CNOB 4CT9A 1NH8A 3M1VA 3QIPA 1IN0A 1O6XA 3FNNA 4NRUA 1N4LA 2HRUA 3AJ2A 1YBAA 3PJ9A 1S72S 1GXTA 3GMGA 3CVKA 4F25A 3H5YA 4QPTA 1V5IB 1UPPA 1RT6A 3HP6A 3KMSA 2Q6BA 1U25A 1LWXA 1W26A 5F3ZA 4MIWA 4A8KA 2PA3A 3Q8UA 2HRTA 4PG7A 4EFAC 4CI0B 4F50A 2C28A 1U1NA 2DRDA 1CJUB 4K2JA 5DQHA 5FD1A 1X5TA 1TR0A 1SUQA 1UVNA 1Y0HA 3DGVA 4LFAF 5K8NA 3Q23A 5F8IA 1RWUA 2K2PA 3C14B 1F3FA 1JIHA 2XNQA 2R2SA 5T14A 5IQ6A 3TANA 5DGAA 2PMWA 1UL3A 2LMIA 1A6LA 4Y2KA 5KOXA 2PT0A 3IBWA 2GIFA 3QGIA 2ZH1A 3DYAB 2BW2A 1K1SA 2UZAA 4WTYA 3DLEB 3BO4A 2QEXS 3AODA 3ISZA 1JMTA 2MLYA 2BW7A 3PEJA 2HNYA 4RW7A 2BABA 2BKPA 2ASJA 3DLGA 1NHUA 1WKLA 3K2YA 3QRPA 3FQKA 4P73A 3K58A 2E9ZA 4ZVRB 3Q0AA 2OSQA 5E3AA 1FKOA 2CQGA 1WJ9A 1IBMF 9RUBA 4QW8A 3VWSA 4ZJOA 2N3OA 2FJVA 2XWYA 1TL3B 3NKYA 3MCSA 4I0WA 1TUGB 4ZHRB 2Y8WA 2PFDA 3CO9A 4NLRA 3CJKA 2F5GA 3TAQA 3ILOA 1IKYB 3OSNA 4CLSA 1FDNA 2YKPA 5KFAA 4HDHA 3PVXA 3W9IA 2AX1A 1K73T 4QPXA 2D3OR 3W9HA 5I42B 2HHHF 1F9FA 1Q8LA 4Q0BB 4OYWA 3A8KA 3I82A 5IT4A 1XWLA 3T1HF 2BRLA 3BS9A 2YKNB 5A8KA 4TY9A 1RHQB 3M32B 4AYBD 4IDKA 4RWWA 1B0PA 3N5BA 2MZRA 4RUHA 4Y28C 1VQ9S 3C2PA 3ET6B 1S6QB 3CSKA 3R97A 4UOCA 3O8WA 1HIYA 1C1BA 5C2CA 5AJ3F 2VPYB 3DLJA 2BJ3A 2DR9A 4C97A 3TA1A 3W8PA 2E5HA 2ZH9A 4J9PA 2GNKA 3CEDA 5I3PA 2J9DA 2BX6A 5C25A 4Y2MA 3A1YG 4IR9A 1FRKA 1D9AA 2XO6A 1QLNA 3OSPA 3IRXB 4BC9A 1W7WA 4RLEA 5AXNA 3PM9A 3SSRA 4FN5A 3SIPB 3GV5B 1FVSA 3K89A 2KFNA 3NNCA 3GLJA 1X9WA 3GYXB 2NXJA 2RQMA 3CCJS 2JLFA 4K59A 2E9RX 1OQ6A 3WHIA 3V6HA 4YOEA 1RHUB 3CD0A 4RW6A 2KXFA 2JDJA 3QAEA 2GJIA 1ZM9A 5T7LB 2V4JB 1XR7A 4DV3J 1H7XA 3CCTA 2J6TA 3ILLA 1S4EA 2FY1A 3Q24A 4DV3F 2NXNA 4L3NA 3AAWB 4ZIWA 4USKA 3CC7S 2V4RA 3C6TA 2XM3A 2L9DA 2H9ZA 5HAOA 3C46A 3LP2B 3OVBA 2HFOA 1JLGA 3AFGA 2AV5A 4DL7A 4X4QA 4LBPA 4DZ6A 3DFEA 2CWKA 2IDEA 1NCLA 4Y2CA 2HGNA 3AXMA 4OIXA 2R8HA 3Q86A 2YXLA 4ED4A 3SV4A 1Q78A 3R7BB 2CQDA 3QJJA 1Q8IA 3HZEA 1TAQA 4PQUB 1RAOA 3I5BA 1N6QB 2DO0A 5GMDA 1CJVB 5IC6B 4C8KA 3OTOF 4J9OA 1N8RT 3GFHA 1MU2A 4OI4A 3M2RA 1Q5YA 1GT8A 3TX0A 4L75A 3MPDA 2J6UA 4CYUA 3R2CJ 2FLNA 1PYSB 5KFCA 4Y00A 2WHOA 2Z30B 3IP0A 2F4VJ 1Z4UA 5GAHI 3RW6A 2ZH7A 2GFFA 1SC3B 2F4VF 1PAEX 3OUYB 1YJVA 3BM7A 3EM1A 3M7VA 1R8AA 1AB8A 1HWLA 2RS8A 3HHLC 2ZE2A 3AH6A 2JLEA 4RW9A 1RT2A 4NPOA 2DIVA 3RU0A 3ILJA 1VK8A 5LSLA 2HHUA 3BR9A 2UUTA 3HHNB 3MM5B 3PW2A 3H98A 4DF4A 5KFTA 3K5OA 3TJ8A 3IMQJ 3DLBA 3K59A 4KC5A 3DMJA 3Q8RB 2VODA 3IM9A 2G2YA 1R0CB 4S0MA 1YJUA 4UZCA 2BQUA 1RT4A 1MN9A 3CMAS 3TRGA 3KJNB 2KFZA 3IO1A 4ES2A 3NRBA 2POKA 2CQ3A 2RUSA 3GPAA 3KG4A 2CJKA 1RLCL 2AYMA 2OPQB 2NZCA 4I2QB 1FA0A 4WYLA 2MDAA 3FC9A 3TUIC 3JB9k 3H25A 5IV3A 5KG0A 4N76A 3UNGC 1CQMA 4FF1A 2B9XA 2GHPA 5KFFA 2R7RA 3LA0A 2ZBRA 2ZHAA 3RG6A 2IM3A 2NREA 2LQ5A 3H2UB 3K5NA 3VAFA 1OPZA 3UD3P 4RW7B 3Q22A 5E7OB 2C1EB 5IS2A 2BKOA 3D28A 4X65F 2OTLS 1EHWA 1S57A 5E3RA 3GJRB 2DGOA 5IZHA 2W2MP 5GADU 1VOMA 4ECSA 4EK2A 5C42A 1N52B 4KH0B 3D5MA 4RWXA 2BOPA 2MKKA 2V8VA 4O44B 1Q81T 4C2MA 2V34A 1WHVA 2V69A 4EWTA 2Y0SD 4NLYA 2G0JA 1F6TA 3OLBA 2BANA 1S99A 1GH8A 3HZGA 4HTIA 3JSYA 2V2QA 3MGJA 3I55S 1P1LA 3RZAA 1RBOB 3PYFA 1VRUB 3EPGA 4LMZA 1UFLA 4E8UA 3DGPB 4OFZA 4Y34A 5KFDA 3CDBA 2XNRA 3TW0A 2K7KA 4V19X 3GYGA 2NYHA 5A8KB 3TQEA 4DSEA 4IDKB 2GQ2A 2XY7A 4DN9A 4YQWA 4ZPTR 2MTLA 2JFDA 4P7VA 1NAQA 1DAXA 1HNIA 2V94A 1R0AA 2W4DA 4NXNJ 2ALZA 2Q3PA 1KHVA 3V4IB 3BN4A 1ZA2B 4DU8A 5C25B 3MAAA 3AQPA 3JQMA 2KL8A 3HSDA 4AL5A 4OJGA 3LAMA 5HLFA 1M5OC 1KFDA 5CXTA 3EDQB 4K0KJ 2GO9A 2HEKA 8AT1B 4A8FA 4AL7A 2RF2B 5IOLA 4ZA1A 2WZ1A 2VPXB 4ZVSB 2OI2A 4Y2IA 5AXLA 2M4MA 1SBRA 5EX3A 4C8NA 5DRKA 3JYTA 4B9UA 3B82A 4ZVHA 3AT1B 1HQUB 3E01A 1FFGB 1UFKA 4RBUA 1FFWB 2B7BB 4ES3A 2FHJD 4EBCA 1NJZA 1XN9A 4O3OA 2GMLA 1FKPB 3PRBA 1ITPA 2E44A 4UOHA 1RA7A 1S12A 4ECWA 1D0EA 5GAGU 4DPXA 2QGFB 5LJ5Y 1RWVB 1I51B 3MPVA 1PC5A 3QO9B 1SC6A 4CO3A 1T3NA 1CVJA 1D1UA 4DFMA 1U0HA 5A6PA 1NK8A 1FNMA 2EI5A 1UZHA 3GZ7A 2OTJS 3C6TB 2EWHA 1SXLA 2CDRB 2VKZG 1GMUA 1RABB 1AXQA 3MEEA 2AP6A 1DBDA 2D3O1 2JL9A 1E6VA 2VG7A 3NXZA 3QGPA 3OTEA 1R8PA 1KOOA 2L48A 4IOBA 3VAHA 2A3JA 4CZCA 1B3TA 1UCNA 4XPEA 4J37A 2D1CA 2GC8A 3W5XA 3EGNA 2DGTA 1ZAVA 3CJ3A 3GYNA 2EFNA 2HNDA 1RT1A 5GMKa 1ZZFA 4E0DA 3M2RB 4FYVB 3GCXP 1H74A 5B0CA 1HW8A 2ZUGA 2QIFA 2KM8B 4MK7A 2VUGA 4OYXA 2DRBA 4F26A 4FNIA 3KMQA 4ETXA 4JOUA 3IGVA 2ZNZA 4I2PB 3OVAA 4D3GA 4J91A 2QYCA 4CH0S 4UQTA 1J5OA 1RT2B 4NRTA 1SQGA 3OT9A 5KFRA 3CD6S 2H3EB 3O1LA 2Q6CA 1XNRF 5DLGA 4YR3A 1YKWA 7AT1B 1HBMA 4J9LA 1R7IA 4KPCA 4G6VB 2DR5A 2CAJA 3P49B 2K06A 3P8BB 2E1AA 1RADB 2OLWA 1N48A 4J9QA 3DMJB 1FRLA 3CULA 4I1TA 1FDDA 5A76A 1S48A 3MEDA 4DDFA 4HR2A 5K9FA 1REGX 4EYHB 3SCLE 5KFHA 2JRSA 1FF2A 3R2DJ 3GSIA 2OKQA 2AZ3A 2DNHA 4U95A 5EWGA 1WSRA 2HVIA 2XCPA 1XNQJ 2FJBB 1HW9A 2M3DA 2GJ2A 2AW0A 4NA2A 1XNQF 3W3SA 5DG8A 1DQ8A 3S6EA 2QMUB 1FEEA 3SDEA 3RR7A 3AY0A 4NLXA 2GA7A 4NMLA 3KUGA 4RNHA 3ZNUA 2CPIA 3NY0A 1FJEB 3U02A 2MKJA 3VZIA 2OFGX 5F3TA 2IVMA 2H65B 4ZCLA 1M1KT 1HPZB 2ZZNA 2X3DA 4MYTA 2XMWA 3QAUA 1YJRA 3JSMB 2UUAF 1NK7A 1I94J 2KVIA 2KKHA 2WVDA 5G4DA 1I94F 3OHBA 2CRLA 2ZHBA 1WSVA 3V4MA 4ZN1A 1ROFA 4F4XA 5ETOA 3IWXA 4URQU 2BA9A 3KJVA 1UFWA 3ENQA 4C3KA 4OZLA 3GR0A 4X4TA 2BANB 4LRAA 2OFHX 3TZWA 4JI7F 2DJWA 1VC0A 1FK9B 2A1BA 2UVVA 3QATA 3KHHA 2HS4A 4ZPVR 4JI6F 4KJIA 4H4OB 4DI6A 3DXBA 4IFVA 2YX7A 1TFWA 2FLOA 3F0NA 1JLBA 2GS8A 1S1WA 1A0OB 1QUPA 1WKJA 1VQOS 2KU7A 5DM6Q 2PE8A 1GXLA 2J76E 1JLAA 4X62J 2H4WB 2HS0A 3I5CA 2D9OA 1WG4A 5ETSA 4LFCF 2ZBQA 2CZ9A 4ZPCA 3J81Y 4ZP6A 3H7HB 1HI0P 2CZ4A 3SV3A 1RI7A 3TX8A 5CCMA 1FHTA 2VQFJ 2AYEA 3MAAB 1U1KA 4LSLA 2A10A 3EMTA 4HLBA 2CJAA 2VQFF 2NLWA 4LR9A 2DH8A 5HLFB 1P9QC 3FFIA 2F8HA 4DR6F 4JI2J 3Q8VA 2HVHA 1RT3B 2RRAA 1F5AA 3VQTA 4JI2F 2CQIA 1ELOA 3ZZTA 2PIIA 1RTZA 4RPFA 5J1PA 1YQHA 2LU1A 3DDNA 3SCJE 2PMHA 3HXMA 3E01B 3C8YA 1VIOA 3MUTP 3CUNA 4YB1P 3HSJA 2V2ZA 4YY3F 2MGZB 4I7FA 5IT9Y 2VA3A 3T5HA 4DLEA 2X1FA 3SXLA 2HQFA 3UD5A 2Z58B 3K0JA 4ED6A 3NOGA 4EI2A 2QMWA 3DOKA 1SKWA 2FJEB 3KK3A 3J80U 4Y0FA 2V67A 1QAIA 1SKUB 4ED0A 3BGFA 4OI2A 4ZK7M 4LREA 3DI6B 4F0MA 2H5IB 3LAKA 1RAFB 4GKKJ 5HL7Q 3WIUA 3MEEB 2DVIA 4FVCA 1VRTB 1MW7A 2J5AA 2XSJB 3M2UA 1SJQA 4ITSA 4LJMA 4I67A 4CLWA 2ZZTA 2HHPA 3UQSA 4N5SA 4ILMA 1CS4A 3KLEA 4ALZA 3VVTA 5ETNA 1RT5A 3AD9C 5KFSA 2B7CB 5KFXA 4KHRA 2KYZA 2NXCA 2MLXA 4CNZA 1JLQA 2PO4A 3GV7B 4OZ2A 1URNA 3A3PB 4QU6A 2KFYA 1Z2LA 2E1RA 1RGVA 2HPUA 2MXYA 1XR5A 1S97A 4ED5A 1S1XA 1VQ4S 1U6FA 2V8PA 4C11A 4CLFA 2RILA 4DCPB 4TU9A 5DGBA 1T03A 5HVGA 1J5OB 3H42A 3SBMA 2HGMA 4G1IA 4NXMJ 3C16A 3BJYA 3QGHA 1S7IA 1UWBA 5KT6A 4NXMF 4CM0A 3CCES 5HQMA 5HATA 2MKIA 1U2FA 1NK6A 3G82B 1HBOB 4Y65A 5LMNF 2FJDB 2GCFA 2O67A 1LWCA 3FMWA 1FO1A 1RUSA 3T1YJ 2ERRA 1XTZA 4DV1F 4HT5A 1YTYA 4C8ZA 1JB0C 2XLKA 3N28A 3LW5C 3M2VA 3OXFA 2RB7A 2J7WA 3EDRB 2L9NA 1YK9A 1VQPS 2UXBJ 4OV6A 4WU3A 1OJ4A 3MI7X 4Q44A 3FQLA 1UJ5A 4DS4A 2ZD1A 1WEXA 2B9EA 1HWKA 1HNWJ 4NEYA 1NB7A 1HQ2A 5KTQA 5D78A 4ELVA 3SMZA 2Z4PA 2QL9B 4ZCIA 4MT1A 3PFOA 5H9FK 5D0RA 3CJRA 3DRRA 4G1QB 1NNDA 5LSOA 4HI1A 2OMLA 3RUBL 4ID5B 1QE1A 3V81A 1YX2A 1MROA 2DR8A 2QE5A 1HHQA 2HWTA 3L7UA 2QO3A 4OV1A 2E1PA 2WRMA 3BQ0A 2KT2A 1YIJS 3U1MA 1P27B 1RJJA 2X7IA 2YWEA 4WP9A 3QT5A 1H72C 1S59A 2ZC3A 5B09A 4DQSA 2ZKUA 2ZM6J 2V8HA 1C4CA 2UVWA 3KFWX 3DRYA 1MWQA 1TUVA 2XYPB 1GAOA 4A8YA 2HHXA 3I0SA 2YNGA 2ASLA 2XGQA 4X66J 2W2NP 4IFVB 1MN7A 4ERDA 4UY8T 1WD6A 4ATNA 1EIYB 4X66F 4YR0A 1JLBB 2IJFA 3MR3A 2G2ZA 4HVZA 2C22A 2RKIB 3S1TA 1REVB 3CJQA 3T5LA 3QZ7A 2CPHA 3T6BA 2QV6A 3H4DA 1JLAB 5D0GA 3QT7A 4Q43A 4RW8B 4DR7F 1UEUA 1XERA 2R7UA 1S1TB 1FD8A 4XO0A 3S8SA 1CPZA 2A2DA 3DLKA 4F4AA 1FRXA 1KVKA 4M5JA 4PCQA 4JUZA 1WOPA 4YB5A 3IS9A 3ISNC 2B4PA 2Z2LA 2AGOA 4QOTA 4IFYA 3WQPA 3CO0P 3FFIB 3EVMA 4QCLA 5KAKA 2V9WA 1UVJA 1BHNA 4M8LA 1JWWA 5HJXA 4LIRA 1ZM4A 5JMNA 4H4MA 4AQYJ 1X5SA 3D0GE 5EN1A 2DHGA 5I3UA 4AQYF 2GVZA 1K0VA 4TLQA 1X5PA 2UU9J 3LP1A 4OYPA 1Y3KA 2LEPA 4I7FB 4X4OA 2UU9F 3PR4A 4NLQA 1KR4A 2LYVA 1WWHA 4KO0B 3FBBA 1LFWA 2P9GA 2GX8A 3QQCD 3DOKB 3DM2A 3KK3B 4DFKA 4ZKAA 4W98A 2GHVC 2ROPA 3Q8SB 5KG7A 4M5GA 3UN3A 2YKAA 3KJFB 3T41A 4DJBA 4TU8A 4ZLJA 3VR1A 5H9EK 1WEZA 1OQ3A 4BC7A 2PEBA 3MZIA 4FNHA 1NJIT 4NMXA 4KGKA 3TZYA 2E1CA 3EGVA 5J2QB 5GMEA 1RAJA 3M2UB 2DO4A 2MQQA 1X4DA 4DUYJ 2RAQA 2CJBA 4W90B 2RVJA 4JYAF 4DUYF 3MM9A 1VLYA 2ZBCA 1CS4B 3CIMA 5DM7Q 3QJLA 1IKVB 3M6WA 2N82B 2VJUA 2KXHA 2K7JA 2GGPB 3IAM9 1TVRA 1S0NA 3HKZD 5IV4A 1FNXH 3UCUP 4ZCKA 4WWSA 5E0OA 2ZH6A 4MH8A 1KEKA 2FHMA 1GX5A 1VQ6S 1S9EB 4WIIA 3JTNA 1T9XA 1CJTB 3HO1A 1TL7B 5I4MA 4NYZA 2CNKB 1XMBA 1KC8T 3PO4A 3C6UA 3N6LA 3CWJA 3MTJA 5J2NA 4QR2A 4C11B 3GTYX 3D6TB 3EWGA 3H0PA 3QSYB 2RQKA 3THVA 4HKQA 4X4VA 1BWEA 1C1CA 3DRPA 4UOFA 2Z2MA 5F41A 4LBHA 2AYBA 5IT0A 1GTHA 2W9BA 4I56A 4RNMA 5D3GA 4F67A 1CLFA 2VC1A 3I9ZA 1SPBP 4E98A 3BQ1A 4WYWA 3I87A 4OJ1A 4ANCA 3C16B 1UWBB 1CBKA 4AUKA 1TKXA 1U0SA 1X8DA 1WHYA 3PV8A 4WFXA 1S77D 2DNRA 2B0GA 2ZOFA 2DNNA 1PKUA 3NGTA 2MZQA 1WC6A 3SSQA 1YBTA 5BYQA 3RR8A 2EC0A 3GSDA 4QIWD 3AB2B 2NPFA 1RK8A 2GAGC 3HVTA 1M5KC 3N5FA 2W7OA 4NCAA 2V50A 3EZUA 4PUOA 2YKQA 3GIMA 2LVWA 4N77A 3M2VB 3JXOA 3OFGA 3LP0B 2C3YA 4WJBA 2CQ1A 1HBNA 1MMLA 3OL8A 4B3TJ 1BWVA 4H4KC 2ZD1B 4DPTA 1YRUA 4NLVA 4EYIB 4PKDB 1CEZA 2CQ4A 2CJQA 3BKTA 2WSFC 4L74A 2HHQA 2IMWP 2R7TA 4LF1A 4WK1A 2OJ3A 1X4HA 5L1JA 3L7PA 3HD2A 4OJ3A 2IVYA 5KG1A 5EX0A 2A2CA 1EETA 3FGVA 3ITHA 4DN0A 3PYGA 2QLBB 5AE1A 3FJ2A 3UR3C 1T95A 2B56A 3NG8A 2JFKA 4NCBA 4P2MA 5FDLB 1EARA 4D3HA 2M9KA 1M5VC 1OY8A 5KFOA 4ENOA 1Q0NA 2RT3A 3BDPA 2GIRA 4J9SA 4DR2F 2BMBA 2YNGB 3I0SB 1YBUA 2IBKA 2MSSA 3MECB 3NS5A 2OGUA 1CJKB 4IG0B 4AT1B 4JB8B 4KYZA 2C2RA 3VALA 3SCIE 2UXCJ 2FHJA 1HI8A 3CE8A 2EBGA 2Q79A 4IH7A 3L09A 4U8VA 2DNOA 2UXCF 4MIAA 1KN6A 3MCMA 3PKYA 2B4VA 4U6PA 2DGQA 2IDLA 3NBPB 3SZ2A 2ZUAA 5B0EA 2C3PA 5KT7A 1Q95G 3ICLA 2H4YB 3A12A 3M30A 2GJFA 2PDAA 2KTQA 5CYMA 5ETQA 2BXJA 2QLWA 1KLMA 2HS3A 2B5JA 2IBOA 5E2QA 3HSGA 4IFYB 2X1BA 4UZBA 4WU2A 2CPJA 2ZKTA 4LF5J 3TEHB 1C0UB 5E33A 1U1RA 1Y7PA 3W1YC 2XMVA 5F0WA 5B0DA 2LQ9A 3MMAA 4NLWA 5KFBA 2AJFE 2O66A 5AXMA 4LF5F 2IRXA 5HI7A 3AD8C 1SVDA 3PX4A 3HMJG 3KLFA 2ADBA 5CQGA 3G9CA 2OPRA 5I3UB 3RB0A 1WUUA 1PO6A 3M8QB 3ETMA 1JLEA 1M5SA 2R2RA 2XI3A 2P6TA 2RHSB 3LP1B 2VL1A 2CPEA 4R5PB 1IBCB 1SQEA 1NDPA 4WFNQ 1VC5A 3NMRA 3OXGA 4I69A 3C15A 3MMCA 1X4FA 2MQNA 5LL6d 4WE1B 4AD6A 1UZDA 4KGXB 3QLHA 1YG0A 4EU0A 1ZH5A 2KZZA 4JI8J 1U1LA 4KRWA 1PG5B 2DYAA 3R7NB 1YHQS 1S6PA 2LU2A 3R5BA 2RQCA 1XMOJ 5C24A 2KHDA 2A6MA 1WI6A 2XG8A 5HSPA 2RDIA 1XMOF 2OPPB 3MM9B 1UVMA 1TFYA 1QM9A 4A8SA 3HJVA 1ZM3A 3RYLA 4PG5A 5HMYA 1V3RA 3TOQA 3MUVP 3KYLA 3KHGA 1ZM2A 2CXEA 1PC4A 3R5DA 1FRJA 3U1NA 2ILZA 4IOCQ 3T3FA 2C2DA 1RHJB 4I4BA 3P6YC 2CA9A 4OHWA 3TAMB 1L5UA 2C2ZB 3LH2S 1HNXF 3BSCA 3PDNA 1Y5IB 4KBIA 2D74B 1Q86T 4NZ6A 4N47A 4QJVA 2XMMA 1N34F 5FLXY 2W9BB 5D3GB 4LSNA 1UPMB 1U24A 1B70B 2CQBA 4N41A 3Q2SC 4LVNP 3H5SA 1U1MA 4RU2A 1TKXB 1WC3A 4JI5J 3WX4A 4QWDA 1IBKF 4YP3A 2R4FA 4JI5F 4F2SA 2PC6A 3HHLB 1K44A 3BDEA 4B3SF 1TV6A 1N5VA 3E3XA 4DR4J 2FZGB 2R7SA 3F41A 3EVWA 2HAIA 2X51A 1ZTTA 3ZZRA 1M90T 1DLOB 3OHAA 2DCUB 2DR6A 5KG6A 2DY1A 4PUOB 3BF4A 1S6OA 4ILLA 2HFNA 2O01C 3BEGB 3K5LA 4HH1A 4Q7AA 1U02A 2M52A 3HSZA 4JV5F 3G86A 4ZVOB 4PXDA 1HBNB 3DOLA 4B9SA 5IWAF 2Y8YA 1H6KX 3G6XA 1N36F 1MMNA 2B9WA 4W4MA 1UTAA 4FYDA 3EUNA 3WBZA 2JOQA 2RH3A 5HMZA 1WOOA 1U26A 2AJ1A 2DNQA 2ZH8A 3O2IA 2FDNA 2GVDA 3OD2A 2FC9A 3DNCA 1BQXA 1IJFB 2EEYA 3MAHA 1Q5VA 2R8IA 2MZJA 3KLGA 4JI1J 3PJXA 2D41A 4JI1F 3GQCA 1BLUA 1RLDA 1HQEB 2H5EA 4QWCA 4U67Q 3KHLA 1KQKA 2CPXA 2ZH2A 4DSFA 1SJ4P 1SJ1A 3HI9A 4UUXA 3EGZA 3FSXA 4FYXB 5KFVA 1S1UB 3CD7A 1WG1A 4WFAQ 4J7CA 3FDSA 2I5JB 1IBLJ 4CM2A 2KI2A 4WXWA 4UQGA 2QLJB 2QZ8A 3D3CJ 4DL4A 2YVSA 5GADI 4GVLA 5BR8J 4O3SA 4FBUA 3ZFVA 4ZJQA 1SB6A 1U7LA 3BB5A 1KQFB 2UUBJ 3QRRA 2MLZA 5BR8F 3E8OA 3I56S 1FFSB 1IWAA 4ZVPB 1JLCB 1TQLA 1TKZA 4GC6A 1LKZA 3C3LA 1HBUB 4HI2A 4BS2A 2I1RA 4X2BA 1HR0J 3TUPA 5CYQA 3MD3A 4O3PA 4F4WA 3GB0A 2ZITA 4P71A 1NB2A 3A4TA 3M30B 4PWWA 2Z2ZA 1LK7A 3TI0A 3CCQS 1JJCB 2BE7D 2HWHA 2B43A 3FMBA 4RO0A 3MMBA 1KLMB 2HMIA 3HJFA 1AROP 4DUZJ 4R0EA 4RKUC 3N6NA 1CG2A 3D6MB 1C0TA 2M8DB 3J81U 1JX4A 1NKBA 4YS2A 1KNZA 2WVBA 1HARA 1GX6A 1IVZA 4KKOB 3HFVA 2RUGA 1LW2A 2IHR1 3MM7A 4DV0J 1FESA 4KTQA 4DV0F 3D6FB 4GKJJ 3Q2TC 3O44A 4BHQA 4Y3CA 1TL4A 4ANEA 3UPFA 1DFDA 1NH7A 1QVGR 4CLKA 3VAIA 2L9WA 5JXSA 4NLGA 5J1NA 3NGSA 3MPYA 3R6GB 3PJWA 4B3OA 3M8PA 1UJ6A 1SCJB 3G6VA 2YY3A 5RUBA 5K20B 1RWPB 5K14B 5F8NA 5J2MB 3N01A 5IT9U 4K5SA 3ZZYA 5HP1A 3UO0A 4DV5F 2ZH3A 2RS2A 1CULB 2W2QP 3PRDA 4WCEQ 4ZP9A 3W8GA 1S6PB 4IG3B 4OYZA 5C24B 4DU7A 5KFEA 4K4SA 2AU0A 2YKMA 2HW3A 1AZSB 4NX9A 3FSYA 4Z7CA 3IBFB 1HWIA 1IR0A 2NPIA 3J7YU 5J2PA 2FY8A 5A8RB 3KK1A 1WF0A 2YQ1A 4ED8A 3GFYA 1QD1A 1KTQA 4DX5A 2GQCA 2MZ1A 1HLWA 3K8WA 1CC7A 4LF9J 2DXEA 1RHRB 1ZAWA 1Q7LB 1FD2A 3GE9A 4FKXA 2JVOA 2LEAA 4LF7F 3H2LA 1T02A 1YZ6A 3KXDA 4NYPA 4LRBA 1DTQA 3RBXA 2WBRA 3QBCA 2HQ3A 2RJZA 2HLTA 2GO8A 2EFQA 2ZH5A 2IAJA 2WOMB 1O5JA 2FVSA 1Q4RA 2JWNA 3G8QA 1FJGJ 2FVCA 3MOJB 3IWNC 3OR2A 4TYBA 1RDRA 1RA6A 1IUJA 3IN5A 1TL1A 1XK8A 3T9ZA 4CH1A 1FNOA 2OEMA 1RTIB 1RCXB 1UAWA 4DSIA 5J1EB 4OHXA 4ZS6A 1U6BA 1TKTA 4USTA 1NXIA 5IM0A 4NCGB 2KH9A 5L1IA 4MKAA 1Y3JA 1TV6B 1LW0A 4L3KA 2AJ2A 2E1MC 5DDRC 3MPUB 1P1TA 4NZ7A 4QYZJ 2H5JB 4FKYA 2XLIA 4OX6A 3EZOA 4QR0A 1X0PA 2R7XA 4R25A 5KFLA 2NZ4A 1SL0A 3CJTA 1VJWA 4USVA 3PW7A 2BE2B 4EEYA 4CLTA 1AFJA 3BZQA 4LFAJ 2CUYA 3L7OA 2AX0A 1VS3A 4RUBA 3K5MA 5DZ6A 1L3UA 2M70A 3CJ8A 4QWBA 3GFZA 1DTTB 1V3ZA 3THPA 3M8WA 4DZDA 3GILA 4LF8F 3DLLQ 2ACYA 3Q8PB 1VI7A 4J9MA 2BJ1A 2GVDB 1F2HA 4B02A 3LQVA 4C3MA 3NNAA 3UDCA 3ILIA 2Y3YA 1GMVA 4A8QA 3KLGB 4LF2A 1JKHB 2MQLA 4Y2AA 3DKDA 4IKAA 4CIOA 2V6AA 1KVJA 1BQMA 2YNHB 2KM8C 4F8RA 2LA6A 4NE9C 5H1SV 2JVRA 1IR1A 2YX4A 3QWUA 4CQ1A 4O4GB 5KFWA 1OO0B 4DLGA 1NZ8A 4YUDA 1IBMJ 4PYDA 3I32A 4GVBB 3H5UA 5L1KA 3GG0A 2MHNA 3AJ1A 2CWXA 1UETA 3DRSB 3FKBA 1XMQF 4HHUA 4W92B 3DLHA 4J9RA 3X3UA 3U27A 2F65A 2EKYA 2RRBA 2MEWA 3N0VA 3JAMY 3HVWA 2KT5A 3IG1A 1H73A 1X4EA 2HHHJ 3R8YA 1LWEB 3HKWA 1A9NB 5CYQB 3T1HJ 2ROEA 4I64A 1M1GA 3CCLS 3BGOP 4ED2A 3V6DA 1IKXA 4USMA 2W9AA 2HYIB 3EXYA 1OSDA 3GR1A 1QY7A 2RIJA 4JI4F 5AJ3J 3LOUA 2J8AA 3I0RA 4PXBA 2VDIA 1OMSA 3BSOA 1QTMA 2N7YA 3DC2A 1FTRA 2HFSA 3ZTQA 5KFGA 3LANA 3UDEA 3UFCX 2ASDA 3GG1A 2F7VA 4MK9A 2BEFA 1TAUA 5JVGQ 3ENWA 1P9YA 1FJ7A 4OJHA 4M5NA 3UCGA 4HEA9 2QFIA 1KONA 4KV8A 1PCAA 3KUHA 3NWRA 5A0YB 1LOUA 1JJ2R 1OS5A 3D68A 3EZ5A 2JZ5A 4KPYA 1VQMS 3BGRA 3DHXA 2OD6A 3GV8B 3R1HA 1UVLA 2AYGA 3AXKA 1BE4A 5CZXA 2HHSA 2DD8S 3CW2C 3D54A 2DBBA 4NA3A 1SKSA 4OZ5A 3KK2B 2APOA 5KFUA 3NAIA 3IC1A 4FXVA 4B9TA 4DPWA 3QFWA 2HFVA 3B54A 2AHOB 1OYDA 4DV2F 1BGXT 1JNRB 3MOZA 1S79A 3CT9A 2W4CA 1RT7A 3B4DA 2HBQB 3R5JB 2VZ9A 2JEJA 3OXLA 1JK9B 2OELA 2CPDA 3ZZOA 2BDPA 2CADA 4K4XA 2F40A 1NJYA 3TP2A 4HH0A 2JSXA 1Y9OA 2HNZB 2CKWA 2Y1JA 3NAHA 4YN3B 1WACA 2IJRA 3FK4A 2DXDA 1OSCA 2VU5A 2UV8A 1NK4A 2J0SD 4DV4F 5F9NA 1RACB 2DCLA 2YWFA 3OTOJ 4O23A 1XQIA 1QSLA 3VV2B 5LMUF 1PBUA 4CLUA 4OI3A 4Q8FA 3G71S 5MAOA 3IA0A 1IWGA 4FZVA 4LRDA 2HHTA 2GZOA 2NCKL 3CJ5A 1TL1B 2EK6A 3ZZ0A 2OEJA 1U49A 2EFPA 2G13A 1RKJA 2ZBIA 3W62A 1FX2A 3E2EA 5HBMA 1ZS6A 2PA8D 3KUEA 5DQGA 5IM0B 3F56A 2D3UA 3M1VB 4K50A 3QIPB 2AQ4A 4EUVA 3W2WA 3GIKA 5U47A 4FP9A 4JV2A 3A8JA 5D15A 1WTFA 2Y1LB 3PRVA 5HMWA 3IR5B 1WI8A 5HMXA 1RT6B 2CJXB 5A2QY 3FZBA 1E6YA 3MEKA 3VGTA 3AJDA 5HO4A 2MYFA 1P6TA 3RBEA 2GHWA 4J90A 3UN2A 3IRWP 2ADCA 1F5BA 2E66A 5LJ3Y 1LQ9A 2HZVA 1SUQB 2VC0A 1UVIA 1KQSR 1K9MT 4DL2A 1VBYA 1LFPA 2M0GB 1FEHA 3QJPA 2XZWA 4UF4A 1VLOA 1SH3A 3EXCX 4M5DA 3P3DA 2IM2A 5LM7E 2OMOA 3CCVS 5CYJA 4PPDA 7FD1A 2ZOMA 3HVAA 4H4KA 1TP7A 1D9DA 1DURA 2DHHA 2XTJP 2W8KA 2QL7B 4CO1A 2HHWA 4Z2XA 4X65J 1BQMB 2AF6A 2HNYB 2H51B 3V6JA 3BPDA 1RWWB 1S6UA 2ZDPA 4KGVB 3DLGB 3RBDA 4IYQA 3MM6A 6FDRA 2Y0BB 3EVOA 2WONA 3QZ8A 2F63A 2BYCA 1FKOB 1A7GE 2UUCJ 4QQBA 1HL6A 2UUCF 4OQJA 5CABA 2OPSA 2EFGA 5D6GA 1V6HA 3D2WA 4IRKA 2OO4A 1LNQA 1Y10A 3OFFA 4DX6A 4F3QA 3CJKB 3GIJA 1DHMA 2MJNA 3MR2A 2WVFA 5MLCV 2Y1IA 2X1GA 2IM1A 5DO2A 2AEFA 2FZKB 4PQAA 4DR3F 1IKXB 2CIMA 2M2BA 3UDLA 1Z1ZA 2MB0B 5F8GA 5HK4A 3FCHA 3P4UB 5EDWA 2MKCA 2IJNA 2K8GA 1XIQA 1X4BA 5DDPC 4HL9A 2VFUA 2VH7A 3R3TA 2FJAB 4H54A 5K8PA 1C1BB
chains in the Genus database with same CATH topology
1XMBA 1KC8T 3PO4A 2B51A 3C6UA 2N3OA 2FJVA 3N6LA 2XWYA 3CWJA 1TL3B 2NSCA 3MTJA 5J2NA 2ZJPQ 4QR2A 4C11B 3UW1A 3NKYA 2IA6A 3OVSA 2ABYA 2FLLA 2KRRA 4USIA 4OZ0A 3MCSA 3DN9A 3THVA 4X4VA 2RQKA 4HKQA 4I0WA 4ZHRB 1BWEA 1C1CA 4O3NA 3DRPA 2K3IA 4DPOA 1TK8A 2NYIA 2VONA 3HM9A 2VD3A 5B0FA 1HMVB 2Z2MA 4ILRA 4GKKF 1URRA 3CO9A 5F41A 1KRPA 4ES1A 2AYBA 5J2QA 1FRHA 5IT0A 4NLRA 1ZPVA 4WFYA 1GTHA 3CJKA 5E3CA 2W9BA 5E5NA 1MNEA 4I56A 4RNMA 2BUNA 5D3GA 4F67A 1CLFA 3TVYA 5LSRA 3TAQA 1IKYB 1APSA 3OSNA 2KZMA 2VC1A 1FDNA 2CQHA 3I9ZA 5ITHA 4E98A 4X4PA 5ADZA 3BQ1A 4A8WA 4WYWA 3I87A 4OJ1A 2HZCA 2YKPA 5KFAA 4HDHA 4TY8A 3KLIB 3PVXA 1N33F 2B9YA 2AX1A 1UWBB 1K73T 4QPXA 1MWZA 2D3OR 4IOAQ 1IKVA 5I42B 3JSBA 3LPYA 4AUKA 1TKXA 2HHHF 4URSA 3M8SA 1F9FA 3PW4A 4C0OC 1Q8LA 4Q0BB 3DLEA 3L95X 1X8DA 1WHYA 2DGSA 3I82A 1XWLA 5IT4A 4WFXA 3T1HF 3PV8A 1S77D 1G7CB 2BRLA 3BS9A 4FXDA 3W3SA 2DNRA 2WK4A 3FSIA 3KG1A 2YKNB 2DIUA 2GGPA 5EHHA 4EO6A 5A8KA 4ELUA 2EFOA 4TY9A 2B0GA 2ZOFA 1I6JA 3M32B 2DNNA 4AYBD 4IDKA 2F3JA 3MM8B 5GAHU 3M6UA 4ZVEA 5HROB 4RWWA 1B0PA 3N5BA 2MZQA 1EETB 2FTRA 2MZRA 2J0WA 3SSQA 4RUHA 1VQ8S 4BBYA 5BYQA 3RR8A 3ITHB 2HRYA 2EC0A 3MDFA 1S9EA 1C4AA 3GSDA 4MTPA 4QIWD 4Y28C 1VQ9S 3H59A 3C2PA 1KTVA 3AB2B 2NPFA 1RK8A 2CQ0A 1NJXA 3HVTA 1S6QB 3CSKA 1M5KC 4RW6B 2SXLA 2WCXA 4UOCA 4B3MF 3N5FA 2W7OA 4NCAA 3O8WA 3CCMS 1C1BA 3EZUA 1W25A 5AJ3F 4PUOA 2VPYB 3DLJA 2IC3A 2DR9A 4B9LA 2YKQA 4HYKA 3GIMA 4C97A 5F8HA 3TA1A 2X3GA 2E5HA 2ZH9A 2LVWA 4N77A 1DZ5A 4J9PA 1N5TA 3M2VB 2GNKA 4XDCA 2VASA 4R0JA 3TVZA 2FVQA 4RBVA 3OFEA 3OFGA 5KFYA 4RNFA 4OHVA 4ZHRA 3CEDA 3LP0B 2VBYA 4LF4F 4OHZA 1U47A 2C3YA 5I3PA 2J9DA 1RT7B 4WJBA 2CQ1A 2A18A 4RX6A 3JSRA 1HBNA 1MMLA 5C25A 4Y2MA 3OL8A 3A1YG 4IR9A 1FRKA 1D9AA 4NOHA 4H4KC 4DBQA 2ZD1B 4DMZA 1IKYA 1YRUA 4QBUA 1QLNA 4NLVA 3OSPA 3IRXB 4EYIB 4BC9A 4PKDB 1CEZA 2CQ4A 2XO7A 2CJQA 3HHEA