1TKXB

Crystal structure of hiv-1 reverse transcriptase in complex with gw490745
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
430
structure length
404
Chain Sequence
ETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKDSTKWRKLVDFRELNKRTQDFWGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Design of non-nucleoside inhibitors of HIV-1 reverse transcriptase with improved drug resistance properties. 2.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords Pol polyprotein, Reverse transcriptase, Chain A
total genus 112
structure length 404
sequence length 430
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2004-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1tkxB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1tkxB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1tkxB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1tkxB03
4RW4B 4NCGB 2AX0A 4Q44A 1JLCA 3MEDA 4PUOB 3UQSA 3NBPA 2JEFA 1GX5A 5EUHA 1HARA 3DLKB 3KLGB 4TY9A 3GILA 5KFXA 2C28A 2UUWA 4TLRA 1TKXB 2RKIB 3V4IB 3BGRB 1XR6A 3M8PA 3ITHA 3C6UB 3GV7B 3ISNC 1LW2A 3HVTA 3KMQA 4ZP6A 5KFBA 1JLFB 3QGIA 1VRUA 4ECVA 1DLOA 1SV5A 4TYBA 5HBMB 2FVPA 4Y2AA 3DRRB 3BSOA 2IBKA 3MR6A 1IKWB 4TQSA 4RW6A 5C24A 1C0TB 3LAMA 4NLYA 1J5OA 3IS9A 4FBUA 1C1BA 3HHKA 2ASJA 4GC7A 5KG5A 5F8NA 1RA7A 4IG3A 4Q43A 1HNVB 4J9KA 1JLAB 1S1TA 5CYMB 3T5KA 1C2PA 2VG6A 4K4UA 5DQHA 1ZTWA 3I5BA 3FFIB 3OSNA 2OPSB 4IH5A 3IS9B 4EBDA 4NLRA 5KFIA 2DPIA 5DGBA 4RW6B 1IKYA 1MU2B 4DL3A 1IKWA 5D3GB 4NLTA 3BQ1A 4EYIB 1JLBA 2OPRB 2XCPA 4F4ZA 5HLFA 3FDSA 4MIBA 1S1UB 2IC3A 2ZE2A 5KFZA 2YKNA 5HROB 3V6DB 2W9BB 5F8MA 1RT5A 3E01B 3KLEA 3FSIA 1LWCA 3QYYA 2JC1A 5EWGA 1RYSA 2GIQA 4F4YA 4LSLB 2UVRA 4IG0A 3MTKA 2OPSA 4IFYB 2FVRA 4Q8FA 4KHRA 3HVWA 4HYKA 4KFBA 4ED3A 3BSAA 3BQ0A 2IAJA 1JLAA 3C6TB 2HAIA 3UPFA 3MEDB 2WONB 4NLDA 4RZRA 4DL5A 3G6VA 4IR1A 4NCGA 4LQ3A 3V6HA 2WB4A 1EETA 1SUQB 3DRSB 4MIAA 4K4VA 1RTDB 1REVA 4NYZA 5KG2A 4DL4A 4NRUA 4WZQA 4I7FA 1C0TA 4TYAA 4ZPDA 3GIMA 5L1KA 2BQUA 1S10A 4EO8A 4J9SA 2O5DA 4QWDA 2UVWA 5HBMA 4IH7A 5KG3A 5KFQA 1S6PB 1S49A 3QGHA 3M8QA 2FVSA 4EO6A 4JV1A 1EP4B 2GIRA 4J9LA 2B5JB 2XI3A 5T14A 2FJWA 4F4WA 4U6PA 5F8IA 5DLFA 2C2RA 4RNMA 3KLGA 4I2QA 2QV6A 5KFAA 1N5YB 3C6TA 3NBPB 1UWBA 2YNIA 3DM2B 1JLCB 3KLHA 4PUOA 1CSJA 2HWIA 4IFVB 1HMVB 3CJ2A 2C2DA 1IKVB 2J6TA 3LP1B 4EEYA 2B6AA 4IG0B 2HWHA 1JKHB 4URSA 3TQ1A 1NHUA 5CYQB 5FDLB 3RAXA 3E01A 3KLEB 3OHAA 3NL0A 2YKNB 5HROA 3RBEA 3PW7A 2IM0A 1KLMA 1RT3A 3PJWA 5DG7A 3D28A 2ZD1A 4H4OB 2OPQB 5C25B 4XPCA 3I0SA 4ID5B 1OS5A 2UVUA 5C42B 4B3OA 4H4MA 3LP2A 4LSNB 5KT5A 4RU9A 1TL3B 1TVRA 2RF2B 1C1CB 1RT2B 2WK4A 5C5JA 1C0UA 1JX4A 3DI6B 4NLSA 4IQXA 3MR3A 2WHOA 1JLEA 3KHHA 1TL1B 4KV8B 5JXSA 5J2PA 2R2UA 1JLQA 4IRDA 1S1WA 5CYMA 2ALZA 3T5JA 1VRTB 3MEEB 4IG3B 2BANA 3JYTB 3NKYA 3Q8QB 2W9AA 1ZTTA 2RDJA 2EC0A 2WTFA 1TV6B 1RT7B 1JLEB 3DOLB 5KFVA 4ECQA 3DI6A 1LWEA 1D1UA 3SFUA 2RF2A 1JLGA 4RW8B 1TL3A 1JIHA 4ED7A 4ECZA 4WZMA 3LP2B 2HNZA 3LALA 2J6UA 4R8UB 3T5LA 2ZD1B 3CJ3A 1RDRA 4K4WA 3DRPA 4YR0A 3GIKA 1JLFA 1U09A 2W8KA 4WE1A 3N6NA 1LW2B 3HVTB 2AWZA 1JKHA 3H5YA 5HP1B 3BGRA 3KK1B 2IJNA 4MFBA 4O3QA 3CJ0A 3LP1A 3BREA 4O4GA 3GYNA 4WXOA 4ECXA 4ECYA 1HMVA 3V81A 3QGGA 4PQUB 4WYWA 3KMSA 1IKXA 1FK9B 4KBIA 5KG0A 1T03B 5F9NA 5KFKA 4RW4A 1I6JA 3DLEB 3PW2A 1XR5A 4O4GB 2BRLA 3GV8B 3PW4A 3MEGB 1IM4A 4NZ0A 5HP1A 3IG1A 4ZPAA 3LANA 4WE1B 4IOBA 4MH8A 4RUAA 4O3PA 1RTHA 2HNYA 1N6QB 5EWFA 4RW7A 3QZ7A 5KFWA 3KLVA 2VG5B 2YNHB 2FJVA 4Q8EA 1LWFB 5L9XA 5DQIA 4JV2A 4I7FB 3TAMA 4NLPA 2J6SA 1TV6A 3PJXA 2IA6A 5EWEA 4J9NA 3DLEA 3NAHA 5L1LA 4F50A 2CKWA 4ECWA 1HQEA 2R8JA 3BR9A 1S1WB 3Q8RB 4YQWA 1JLQB 3RBDA 4X2BA 4U7CA 4K4YA 1DTQA 4ZPBA 1Z4UA 4QWCA 4Q0BA 4QPXA 1TKZA 4FS2A 1S9GA 1K1QA 4ZP9A 4DG1A 5DGAA 3BSCA 4RNFA 4O44B 4IRCA 4M95A 2HNDA 4RNNA 5C42A 3N6MA 3M9NB 3EPIA 5K14A 2OPQA 5C25A 1HQUB 5KFRA 5KFUA 4JUZA 5J2MA 1JLBB 5DG9A 5KFYA 2I5JB 3CIZA 4ZP7A 4ZHRA 2YNGA 2I1RA 4DG1B 2ASDA 3D5MA 3KHLA 2RDIA 3H4DA 1FKPB 4IH6A 2FLNA 1TKZB 1T05B 4XO0A 3T1AA 4ICLA 5F8LA 2OPPA 2VG6B 2WOMA 3MEEA 1VRTA 3JYTA 3H98A 1N5YA 1RT4A 2AU0A 3H40A 4MK9A 4I2QB 3FQKA 2BE2B 4H54A 4EBEA 1R0AA 1TL1A 5KFDA 3TAMB 4KO0B 5I3UB 2AX1A 3MFHA 1S4FA 5KFTA 3DRRA 3TVKA 2AGQA 3I0SB 4ID5A 4HKQA 1SV5B 3H5SA 4YR3A 4IDKA 3V6JA 5F8JA 2BRKA 1VRUB 2BQ3A 3NGDA 2XGQA 1KLMB 1RT3B 4QW8A 1W25A 4IRKA 2JC0A 1N56A 3KJVA 3PR5B 4OL8A 5CYQA 3G6XA 5F8HA 4DEZA 1LW0A 3KK2A 1REVB 4ECSA 2XI2A 1S6QB 5KFJA 3DLGB 2R2SA 3MECA 3HVAA 1T03A 4TQRA 2W7OA 4KKOB 2DPJA 3H5XA 4PQUA 2FLPA 4QWAA 3CVKA 2VA2A 3KOAA 4I2PB 3OLBA 5F8GA 3ISND 4IFYA 3QO9B 3V6KA 2B5JA 2D3ZA 4MFBB 5F9LA 1RTIB 4O3RA 5L1JA 4LQ9A 1NNDA 1RT5B 1RTJA 2W9BA 3DRPB 1RT6A 4IDKB 3JSMA 5J2NA 4YP3A 2IM2A 2OPRA 2UVVA 4NLWA 4J9MA 2XGPA 4Y34A 1RT1A 3KLIA 1S0NA 3IRXB 1S1XA 2FVQA 1RTDA 4ED6A 1RT7A 3DOLA 4RW9A 1R0AB 1SUQA 5DQGA 3I5AA 3N6LA 1BQNA 2GC8A 2IJFA 1S1TB 4O3OA 1HNVA 3PR4A 1HYSB 3KLFB 4K4ZA 3E51A 4KFBB 5KG7A 1RYRA 1FKOA 3KK3B 5KFCA 1TVRB 2AGOA 1RT1B 3KLIB 3MR2A 5I42A 3QZ8A 2I5JA 2FLLA 3OL9A 4H4MB 1S1UA 2IC3B 1HNIA 3JSMB 1HQUA 4Q45A 2UUTA 3G6YA 2HNDB 4O44A 3MF5A 4DL6A 5I42B 3RB4A 1BQMA 1HPZB 2R2RA 3ITHB 3CO9A 1S9GB 1RTIA 4O3SA 5EDWA 3KK3A 5JUMA 3CJ5A 1ZETA 3GIIA 2JEJA 5J2QA 2XWYA 4JV0A 4J9OA 1WNEA 4IFVA 3KLFA 2YNIB 3DM2A 2IM1A 1NHVA 3Q8PB 2BQRA 4ECTA 3QLHA 4O3NA 1TQLA 4GC6A 5KG1A 3DMJA 4ED0A 1J5OB 4G1QB 1QE1A 2D3UA 3QIPA 3FRZA 1LWFA 5C24B 3MR5A 2YNFB 2HMIB 2W8LA 2YNHA 4R0EA 2ASLA 3VQSA 2WRMA 2D7SA 4KSEB 4TN2A 3H4BA 2YKMA 1XR7A 4TXSA 3C6UA 1QAJA 3PHEA 4KO0A 5I3UA 4NLUA 1KHVA 2RKIA 3V4IA 3MEGA 5KT2A 4IR9A 5J1EA 4WFXA 3DYAB 2V0NA 3H5UA 1MMLA 2WONA 4MKBA 3GV5B 2E9RX 3H59A 4KKOA 3NAIA 4ZVEA 4QWBA 3MECB 3DLGA 2OPPB 4ICLB 1S6QA 1S97A 1T05A 4RNOA 3KK2B 3KK1A 2VG7B 1FKPA 4LSLA 3HKWA 4MK7A 5KFGA 1GX6A 1LWCB 1BQMB 3IGVA 3RAQA 3CDWA 4Y3CA 4J9RA 4PWDA 4NLQA 3SI8A 1HNIB 5HLFB 4QWEA 3OLAA 1QUVA 3OSPA 4ZMMA 2JLEA 1MU2A 1IKYB 4ZP8A 5KFSA 1JXLA 3KHRA 5KFPA 3H2LA 1DTTA 5KFFA 2IM3A 5KFLA 4TY8B 3FFIA 5KFHA 3BQ2A 2BANB 1S9EB 3I0RB 1TKTB 1BQNB 3PZPA 1S1VB 2C2EA 5J2PB 3CJ4A 2ILYA 1QAIA 1DTTB 3KNAA 2V4RA 4K4XA 2YNGB 3CDEA 1RA6A 3LAKA 5KFOA 2BR0A 1RAJA 5J2MB 3RB6A 4K50A 2HNYB 1DLOB 5KG4A 3RB3A 4ED8A 4KB7A 5KT7A 3UDLA 4ED1A 2W7PA 1S0MA 1RTJB 2XC9A 3OHBA 4J9QA 3M9MB 4R5PA 3MFIA 1TKXA 4Q0BB 3QO9A 2B6AB 3IGNA 2R8IA 2D41A 1DTQB 3UR0A 3BJYA 3RB0A 3DLKA 4URGA 3CDUA 2AGPA 4NLGA 1IKXB 1FK9A 2OH2A 5J1EB 4ED2A 3DOKB 4ZPCA 4ZVFA 4WFZA 3GQCA 4EYHB 2WCXA 1N48A 3ICLA 2R8GA 4FBTA 3M9OB 1LW0B 4NLVA 4QW9A 4R5PB 2C22A 4KE5A 3NMAA 1K1SA 1S0OA 4XPEA 1T3NA 3KJVB 3LP0A 3IN5A 3PW5A 2VG5A 3SFGA 5KT6A 2R8KA 5L1IA 4RW7B 1RTHB 1N6QA 4R8UA 2R2TA 1KHWA 3QIDA 2W9CB 4IKAA 4Y2CA 4ZVGA 3LP0B 2YNFA 2HMIA 2FVCA 1TP7A 1QE1B 4G3IA 4K4TA 3DRSA 4FS1A 1EETB 3CWJA 3DOKA 2BE2A 4M94A 1S1VA 4K4SA 1T94A 4URQU 3GIJA 1RT4B 3EZUA 4ZVHA 4YR2A 4KAIA 3BSNA 3I0RA 2WOMB 2IAJB 4ECUA 3V81B 5J2QB 5KT4A 1S48A 3FQLA 5DLGA 3KHGA 4MKAA 1C0UB 1RT2A 1HPZA 2B43A 4ZHRB 2JEGA 5KG6A 3V6DA 1S9FA 4B3OB 2ZE2B 4MK8A 2E9ZA 4O4RA 2E9TA 4PWDB 4WYLA 3OL6A 5KFNA 5K14B 2QE5A 4EBCA 2HNZB 2JEIA 5D3GA 1YVFA 4KHMA 1N4LA 4RNHA 4YMEA 1JLGB 4RW8A 5FDLA 2VA3A 1LWEB 3EPGA 1FKOB 4DL2A 2ATLA 3T19A 3I5CA 3OL7A 1HYSA 1TKTA 1UWBB 3KLHB 4NLXA 5DG8A 1HQEB 2F8EX 1S9EA 3DYAA 2AQ4A 1SH3A 2FJXA 3PW0A 2XCAA 4TY8A 4KV8A 2IMWP 4RW9B 1D0EA 4J9PA 1C1BB 4NRTA 1S1XB 5KT3A 4WFYA 3IRXA 1C1CA 4DL7A 1EP4A 4F4XA 2YKMB 4ECRA 4LSNA 4WXWA 1SH2A 5KFMA 3M8QB 2ILZA 2W9CA 3OL8A 5J2NB 4H4OA 2CJQA 1S6PA 2ZKUA 1RT6B 4NLOA 2V4QA 2V9WA 5KFEA 3T5HA 4RUCA 3Q8SB 3G86A 3IG1B 1SH0A 3QIPB 3M8PB 4G1QA 2VG7A 3DMJB 2R8HA 3QLHB 3DDKA 3PVXA 4I2PA 1IKVA
chains in the Genus database with same CATH superfamily
4NMLA 2AX0A 4PUOB 2DGVA 3K8VA 2MDAA 3NGSA 1A9NB 1GX5A 1NB2A 3DLKB 2EKYA 4J9VA 4ID8A 1F1BB 2MGZB 4TY9A 1VQKS 2HBRB 4DV6J 3O5TB 4OHVA 3VAJA 3BGRB 3NRBA 1FJEB 3C6UB 2BABA 4N77A 1LW2A 3HVTA 3PKYA 3Q23A 3R6GB 1TFWA 1JLFB 3QGIA 2QIFA 2B3TB 2AHOB 4TYBA 2P5VA 2DNKA 3UN5A 3TAQA 5CYJA 3DRRB 1S77D 1IJFB 1U48A 1C0TB 3LAMA 2HVEA 3ONQA 3HHKA 1J27A 2QX0A 3MCNA 4GC7A 1SKWA 3GJSB 1VQMS 5B08A 2KZMA 5GAEU 2QLWA 3D1QA 2CAJA 2LQ5A 4YY3F 1CBKA 4CM2A 2GNKA 2XZTB 3I56S 1JNZB 5JMNA 2W2QP 1A0OB 5D6GA 1V6HA 3W9IA 3TQEA 2ZHAA 5KFIA 2I8EA 1S6OA 4Z7YA 1IKYA 1R3NA 3R2DJ 3M6WA 2CPDA 4NA3A 4OZ2A 3M2UB 2W2MP 3FDSA 4NYPA 4WP3A 2MQ8A 1UVJA 5FLXY 4U95A 3NY0A 1ZBTA 1S1UB 4JI6F 3SCIE 2ZE2A 5D0EA 2YKNA 1FRJA 4DV4F 3D1HA 5F8MA 3E01B 3KLEA 3UNGC 1Y5NB 5EWGA 4F04B 4FF3A 4LSLB 1RLDA 1S76D 4IG0A 3MTKA 2GGPB 3CC4S 4IFYB 1CPZA 4Q8FA 2AYGA 4KFBA 1FF2A 1RISA 2BMBA 2GX8A 2G9OA 2MKHA 4KH1B 3UCZP 3NS5A 4B08A 3UPFA 4AQYF 1NKBA 3MEDB 4IR1A 3PRDA 3EUNA 3VAIA 4EGLA 1RE1B 2EVZA 1SUQB 2JOQA 2QLXA 3M30A 3ENVA 3U1LA 4RKUC 3SIPB 3J7AN 1UVIA 4WZQA 4I7FA 4TYAA 4ZPDA 2HG4A 2LFVA 5ETSA 3TVZA 4ZIVA 3Q22A 3K7RA 5L1KA 4DSLA 2EC2A 3QFWA 2J5AA 4LRCA 4IH7A 4C0HA 5KOWA 1S6PB 1MMDA 3US5A 3R3TA 4USUA 3M8QA 1LQ9A 2X3DA 4WF9Q 1JNRB 5DDQC 4LFCF 3T9ZA 3EGVA 2IVYA 2FHOB 4CO1A 2C2RA 4DSKA 2W4PA 3VR1A 2VL1A 2IHR1 4DQPA 1I1GA 1N5YB 1CSJA 1KQSR 3KLHA 2YNIA 3DM2B 1DZ5A 2M88A 1KNZA 2IJRA 3EJMA 1HMVB 3PXGa 1YG0A 3K59A 3O44A 2CJBA 2CG4A 1NPRA 1PILA 2J6TA 3LP1B 2HHQA 1KDNA 1QSYA 1L5UA 4M63A 2HWHA 1JKHB 1Q79A 3ISZA 4DR4J 3PIOQ 1VLYA 1FVSA 3E01A 3KLEB 1VS3A 3GWCA 3I4HX 4ZVUB 3UR3C 4ZKAA 1CQNA 3OHAA 3RBEA 2IM0A 2UU9F 3O3LA 4BS2A 2K3IA 4I68A 3BR8A 4USVA 2ZD1A 2OPQB 2UVUA 2DK2A 5C42B 2GAHC 4F3QA 1MWZA 5AE1A 2MZ1A 3H7HB 4WTYA 3C15B 4C8YA 2RF2B 5C5JA 1RT2B 1T95A 4IQXA 2H1YA 2WHOA 1JLEA 3KHHA 4NEYA 2D69A 4USTA 5A0YA 7FD1A 4KV8B 3LWLA 1JMTA 2R2UA 3LGHA 2HBQB 1JLQA 3CULA 2O3DA 3TJ9A 5B09A 3THVA 1WEXA 1CEZA 2HEKA 3JYTB 4IG3B 3Q8QB 5LMUJ 3NKYA 4CDIA 1FJGJ 4QU7A 2WW8A 1ZTTA 1EIYB 1WOOA 5I3QA 4K7QA 4ZPTR 3HT0A 5LL6d 5AE2A 5LSOA 1U6BA 1WWHA 1GH8A 1VJWA 5L46A 3GG1A 1AW0A 4ED7A 1D3WA 1T8EA 3LP2B 2HNZA 3FZ2A 3F44A 5M2PA 4CNZA 3HZEA 3IAM9 1A7GE 1TR0A 2OD6A 2EK6A 2RAQA 3T9NA 4YR0A 2ALYB 2W8KA 2GHWA 4WE1A 2ZH1A 2R7QA 1E6YB 4O3QA 3TANA 2V8HA 4MFBA 3LPEA 2FJDB 2VDHA 4KGMA 3CJ0A 1KC8T 3LP1A 4O4GA 4N8OA 1ZM2A 2DO4A 4WFNQ 4X66F 4ECXA 1HMVA 3BPDA 4WYWA 2E5IA 4P10A 1FK9B 3VVUA 2CQBA 1CC7A 4KBIA 4B3TF 1XWLA 1PCAA 2OFHX 3GV8B 4NMXA 5IWAJ 2CYYA 2XHWA 1VDHA 3PYEA 3PW4A 2ERRA 2BYCA 1SI9A 1V5VA 4KIAA 2DHHA 4AFFA 4K0KJ 4EWTA 2XZWA 4ES1A 1D09B 2O1PA 5LM7E 1HQ2A 3MMAA 4OI6A 3WC0A 3DHWC 2PC6A 3GTYX 4IOBA 1U4BA 4MH8A 3AQOA 4DR5F 1L3KA 2L9DA 3PFOA 4U67Q 1VLOA 3QZ7A 5KFWA 2ZVIA 4OHZA 2RHQB 3IC1A 4PG7A 3BF4A 4P73A 2DHGA 1F5BA 4I7FB 1YZ7A 4PXDA 2UV8A 2GO8A 1GMWA 2XMWA 1U6FA 4NLPA 4N5SA 1H73A 1WEZA 4HH1A 5EWEA 2ZFHA 4OI3A 2JNJA 3ZTSA 4X4QA 4NASA 2AMCB 4J9NA 1OQ3A 3POTA 4ECWA 2R8JA 1WF1A 3BR9A 4JI2F 5C2GA 3P5TL 3Q8RB 3OV7A 4ZLNA 1RBAA 5ETVA 1P8GA 3MPDA 3PG9A 1TKZA 1KSPA 4GKJF 1RAHB 1Y3KA 3L3CA 3EZOA 4B9UA 4X66J 3CCWA 3X3UA 2M0GB 5LSRA 5C42A 2DRBA 4CO2A 1X4EA 2RILA 1U8WA 5C25A 3K58A 4ZOSA 2VJVA 4ELVA 4HLBA 4OV1A 4CLPA 2Y0SD 4AE5A 2EFQA 4DR1J 2I5JB 3JAMU 3Q0AA 5F0WA 4DG1B 2N3LA 4P71A 1LKZA 2AEJA 3W5ZA 3C16A 3T1AA 2V8DA 4NX9A 2B0GA 2KJWA 4HI1A 4F67A 2XMMA 4USMA 3BH6B 2R7WA 3K17A 3MEEA 2AU0A 3H98A 2F1FA 1N5YA 2A6OA 3H40A 4MK9A 4KGXB 1NDPA 5AJ3F 2BE2B 3OTOJ 2ZH2A 2QA4G 5IT9Y 3GZ7A 4EBEA 4OZJA 2OGUA 4MKVA 1NMEB 1NB7A 5HMYA 1Q5VA 2AX1A 5ETRA 1HHTP 4YN3B 1HBMB 1Y0HA 2ZJPQ 5KFTA 4CZCA 3DRRA 1Z2ZA 3GLJA 3I0SB 1U1OA 2HHHF 1KLMB 1HBOA 3FJ2A 4MT1A 4X84A 1UA1A 1W25A 1QSSA 3HDSA 4OL8A 2XYPB 4KHPJ 1XMBA 3NNCA 3KK2A 1REVB 2ZWPA 3HO1A 3AFGA 3NS6A 3U1MA 3J81Y 3VTIA 2CVEA 2BJ7A 2YVSA 4A47A 1XNRF 5JVGQ 3CCVS 1VBXA 4A8FA 2LLZA 4PXEA 4QJVA 3H5XA 4EUVA 4X4SA 4KPYA 4FF2A 3KOAA 2VA2A 2VONA 3EXCX 4B9SA 3IR5B 4NWBA 4IFYA 3QO9B 4ZVOB 4MFBB 1Y10A 1L3VA 2G1HA 1LXJA 3MHYA 3TWZA 2KFNA 2Z57B 1NNDA 2OUGA 2QT7A 1MLAA 1RWVB 5AXKA 3OFFA 2Y3YA 5K20B 4P9SA 2HVIA 4IDKB 2OMLA 4DZ6A 3PX6A 2KI2A 1OY9A 2HQCA 2V63A 4HACB 3CT9A 3HJFA 2FUG9 3JS9A 2MQLA 4OYWA 3KLIA 2MLZA 1MN7A 1VCTA 2WVEA 4RJVA 1ACMB 1CJUA 2W01A 3N5FA 4I1TA 1RTDA 3QAEA 3CCMS 5CAAA 2HHTA 3G82B 3KUHA 1TAQA 5DRKA 2U1AA 1N88A 2FYXA 2JVOA 3BB5A 5DQGA 3F0NA 3GE9A 1BQNA 2GC8A 2HHWA 3IM9A 2GVZA 5D0HA 2QMXA 1TAUA 3KLFB 3E51A 1XBWA 5KG7A 1X4BA 2FJEB 4CLKA 1RYRA 3X1LB 4LF7J 4ILLA 5FD1A 2O66A 3M2RA 4DR3F 4CQ1A 4WIIA 3KLIB 2Z8QA 1HLWA 1N5SA 2BUNA 2EG2A 3MM6B 2Z58B 4J9UE 4LR7A 2LECA 1Q86T 2LQ9A 5LMUF 2LU1A 1REGX 2RNEA 4OX6A 2HNDB 3A3PB 5BYQA 4O44A 2J9EA 2VZ9A 1OYDA 9ATCB 4FYVB 4DV4J 4IOCQ 4DL6A 1YJWS 5EDWA 4WK3A 1YJRA 3MM5A 1C4CA 3WBZA 3MR7A 3TARA 1BWVA 2VF3A 4F25A 2G0JA 1SB6A 2YNIB 3DM2A 2IM1A 3HSZA 5B0AA 1HA1A 1NHVA 4HI2A 3ZZRA 5SZTA 4PYDA 2KVQE 3Q8PB 5I4MA 2RRAA 1VQPS 2BQRA 2KU7A 5E3QA 1FJCA 2ZBRA 1AYEA 4J37A 3UDCA 3DMJA 4ECUA 4G1QB 1RHMB 2D3UA 1UVNA 4X4TA 2Z30B 2W8LA 1NK6A 2VQEJ 4X2BA 3TZXA 2SXLA 2LQBA 2WW4A 4USKA 4PXBA 2LEPA 1IBMF 4PEOA 3UD3P 2WRMA 2D7SA 4KSEB 5ITHA 3QRPA 1UFLA 5B0FA 5DDPC 1VQ5S 4I67A 1ICEB 1AFJA 3VAKA 1F60B 2YKMA 3PY8A 1O8BA 4ENOA 4NXMJ 2GMJA 4OYAA 5KT2A 1NH8A 3KXDA 4C8MA 4RBVA 2EK1A 4A4JA 4DQQA 4DCPB 2G2OA 2CZVC 2JFKA 2V0NA 4MKBA 5IT4A 4AT1B 2DR9A 5BJRA 1YBUA 1Y7PA 2GIFA 2HFVA 1VC0A 2AZ3A 1T9YA 2JRSA 5ADZA 3BEGB 4ICLB 3D68A 3FMWA 1S6QA 1S97A 1T05A 3DRYA 3N5BA 3KK2B 4RNOA 1FKPA 3DC2A 1RHUB 2Y8YA 1URRA 5CH7B 1ZZFA 4F4KA 4DU8A 3B78A 5I3PA 4EZ6A 3BO2A 2AT1B 2B8PA 2QA1A 3R7BB 4Y3CA 1FDDA 1R8BA 1ROFA 3EYZA 5HLFB 4QWEA 4B3MF 5HMWA 1QUVA 1FWKA 3OSPA 2PI5A 2JLEA 1IKYB 1JXLA 3KHRA 1LFWA 1YGYA 2QL7B 2OO4A 4FKXA 4A8WA 3SSRA 2HFOA 1RWPB 2QLBB 3CCTA 4DV3F 3PYGA 1S9EB 3MM8A 2GVZB 1T9VA 2HGLA 3QSIA 1SCJB 4LRDA 4ES3A 5HMXA 4DR1F 2C2EA 1PSDA 2J9DA 2MY8A 2YWWA 2AJ1A 2Q43A 3JSYA 3OR2A 4YHHJ 2FY8A 3W9HA 1RZMA 4K4XA 1FX4A 1H98A 1IBCB 5KFOA 2OSQA 4OZNA 3HD1A 4ZJOA 1UCNA 1NKEA 4RBUA 4G6VB 2IFXA 3T1YF 5ETMA 5D15A 2P9GA 2WVCA 1LV5A 2XC9A 2IDEA 2NSBA 1MROA 5E7OB 1NJXA 4GO5X 4DUYJ 2CNKB 2H65B 3BZQA 2VKZG 4C7QA 2X1BA 2F40A 3QO9A 2B6AB 1WHXA 3IGNA 3NGTA 3L7UA 3PX4A 3R8YA 1R43A 2NR0A 4F0KA 1RWXB 3HF5A 2IYIA 4ETZA 3QT8A 1S4EA 1TU0B 1X5TA 3A8KA 3CDUA 3GJTB 1YJTA 3CJKB 2KXFA 1N34J 4LR8A 3TRGA 2KTQA 2P8IA 1U2FA 2DNHA 2WCXA 3V4MA 4F3MA 3AA9A 2MQOA 3DNCA 1LW0B 4FNIA 2DR7A 2P9CA 1K1SA 4DDFA 1WKJA 3FCWA 1OY8A 5BYRA 3HT3A 3IN5A 1VI7A 5IM0B 4EI2A 3VGTA 5HQ8A 4RW7B 4ZJLA 4GVBA 4OI1A 2UUBF 1BHNA 4R8UA 3VGSA 2VFVA 4QBUA 3QJLA 4IKAA 4Y2CA 3IO1A 5IC6B 3TJAA 4H4KC 2GZOA 2EW9A 2IPOB 1NK8A 4DCJB 5BYSA 3MPUB 1FDAA 3CSKA 3TEHB 4BWMA 3MAHA 5HATA 1ZH5A 2J9CA 2UU9J 3DOKA 3ENWA 2BE2A 4LF5F 3FZBA 1QAXA 2HRTA 4ANEA 4URQU 5GMEA 3V2UC 1P27B 3EGNA 4ZVHA 3HVRA 3BSNA 1U1NA 3SQOP 2WOMB 3Q86A 1M1GA 3AA8A 5J2QB 2NUHA 1NJWA 1S48A 1VQNS 4I6WA 3HI9A 1E6VA 2V8GA 2EKNA 4LRFA 4XTTA 3KHGA 3S7RA 2DHXA 1UA0A 2EBEA 2W24A 3V6DA 4B3OB 2ZE2B 4X4OA 3B8HA 2E9ZA 2E9TA 1EKSA 4DR7F 3OL6A 3V5RA 5K14B 2HIYA 5GADI 5CD4H 4ZITA 1KN6A 2KDOA 2JEIA 2LDYA 4KHMA 4WFBQ 1N4LA 1GFWB 4M5HA 1JLGB 5FDLA 2VIHA 4JYAF 4DPOA 1M5KC 2FPHX 1PJ6A 3UFCX 1W2IA 1HNXJ 4DL2A 3RR8A 7AT1B 1U1QA 3PX0A 3D6TB 1CS4A 3OTDA 4KT0C 5H9EK 1UWBB 4PRFA 3MM8B 4OV6A 2F8EX 3GFHA 4JI2J 2Y1LB 3DYAA 3ZZUA 2JSXA 2FJXA 1SQEA 2XCAA 3PW0A 3WC2A 1YJVA 3GSIA 2IMWP 2NZ4A 1MW7A 2A18A 1LXNA 4N47A 1C1CA 3C15A 3RRHA 2DH9A 4ECRA 2LP4A 4WXWA 1SH2A 5KFMA 3M8QB 2NZCA 4F7VA 1Q8IA 1RT6B 2AKWB 2YWFA 2BE7D 3M4XA 4KH0B 4P72A 1HWJA 2V4QA 4OZ3A 3MMJA 4GMKA 4ED4A 1KQFB 3R7SB 3IG1B 2J76E 5HO4A 1X8DA 5GAGI 4LF6F 4KHPF 4N41A 4HDHA 1FWLA 2J0XA 4FF1A 1RAGB 2MZSA 1AB8A 3R9LA 3NCPA 2D9PA 4I2PA 1JLCA 3UQSA 3E8OA 3K2YA 3NBPA 1WORA 2B9XA 1QTNB 4BC9A 1UMJA 2V2VA 1SL2A 3KLGB 1EZZB 3ZZTA 5KFXA 4JYAJ 2UUWA 3CD0A 3MM5B 5D78A 4PKDB 2RKIB 3V4IB 3MUMP 2ZOMA 2VOOA 3ITHA 4LFBF 4K5RA 3A1YG 3ISNC 2DNNA 2KRBA 2I38A 4PPZA 2VBZA 3HULA 5HAOA 3UDEA 5DETA 4XAKA 1PKUA 2J7UA 1VRUA 2NXNA 2PI4A 1TK0A 5HBMB 2FVPA 2V9KA 4Y2AA 1R6YA 2MKYA 3MR6A 1TK5A 3T6BA 2IYGA 2NXCA 4NLYA 3SCLE 1J5OA 1Z2LA 4RL1A 4QU6A 4JI3J 2MHEA 1WACA 4MMOA 4OHXA 2ZBPA 3IR6B 4Y00A 5KG5A 2J8AA 1KD1T 1P1LA 5A8WA 1SIWB 4Q43A 2RSQA 1XNQJ 2MTLA 1FJGF 3VVTA 2VG6A 4K4UA 1PYSB 3I5BA 5DG9A 3NNHA 4F2RA 4KQZA 3OSNA 1NK5A 4NYOA 2FIUA 1V3ZA 2OPSB 2XWXA 1QAYA 4NLRA 2DPIA 3NEKA 3R5DA 4F2SA 4DR6J 1JK9B 2H5IB 1IKWA 3TX8A 3BQ1A 4A8SA 2CJXB 3DOMA 4F4ZA 1ZAWA 1W26A 2P9EA 3P5BP 5CCLA 5HROB 3P3DA 2W9BB 1V3SA 1HL6A 1IBLF 3QYYA 4QYRA 4DQRA 3MI7X 5HJXA 2UVRA 1MNEA 2KT5A 2YKAA 1FRIA 4UOCA 2WVBA 3M2VA 4LVOP 4XIUA 1AUDA 2IDLA 3H2UB 1U26A 1VQYA 2ZUAA 3RBZA 3VZIA 4HYKA 1XMOF 1M1KT 2IRUA 5AXLA 1JLAA 1X0FA 1F9FA 2WONB 2HAFA 1RHKB 2HFSA 2VBXA 3POTB 4NCGA 3TZYA 1YRTA 2NSCA 3G6VA 2KJVA 3V6HA 3G82A 4YDDB 3DRSB 2XEXA 2DT9A 4NYZA 3ENQA 4RWXA 3SCKE 5KG2A 3K5PA 4NRUA 4DFKA 5IS2A 7FDRA 5L8RC 3TW0A 5L38A 2E5HA 4J9SA 2O5DA 1NPPA 2OLWA 5EX0A 1S49A 3TZWA 4TLQA 1WG1A 3FBFA 2GQ2A 4UOHA 4UY8T 1XQIA 2DHAA 4JV5J 2PD1A 2CPJA 4UY85 1LOUA 1P1TA 4RPFA 3EGZA 2B5JB 5DS7A 3W5XA 1KRPA 5DLFA 2RRNA 3KLGA 2F4FA 3WX4A 1RI7A 3IMQJ 4Y28C 2ACMA 3C6TA 3NBPB 1UWBA 4CH7A 4WTOB 2CPIA 2HWIA 2CVIA 5HJYA 4AXJA 3W61A 2MHNA 4X4PA 3CJ8A 4FYWB 2MKCA 3TA2A 2B6AA 3MOJB 4DFMA 4HT7A 3CE8A 3RAXA 1J2VA 1NHUA 1TELA 5FDLB 3ETMA 3OW2R 4DQIA 2YKNB 1FRXA 2Z2YB 4K2XA 5DG7A 3PW7A 3ZZ0A 1FERA 1CG2A 4NEZA 3I0SA 2V67A 4DL0C 4NPOA 4B3OA 1SJ4P 4LSNB 2DD8S 3FMBA 3KNGA 2P2CB 4RBTA 1TVRA 3JXOA 2WK4A 3SSSA 2I2YA 3DI6B 2MKSA 4NLSA 3UVJB 2CZ9A 2M70A 2ZH6A 5B0DA 4Y6IA 5JXSA 2LXFA 5J2PA 4HR2A 2XYHB 2NXEA 2DXDA 2ZWOA 2BJ1A 1VRTB 2W9AA 4GKKF 1H2VZ 4DV0F 3AT1B 3CB4A 3JSRA 3BO4A 1CJUB 3DI6A 3EICA 5EX3A 3UVJA 2ROPA 2PSZA 2RF2A 1JLGA 2YQ3A 1JIHA 3AODA 4XDCA 1N36F 4WZMA 2J6UA 3LALA 3T41A 2GJIA 4F4AA 1XMOJ 1SKRA 1R8CA 4R8UB 3T5LA 5A2QU 3IM8A 1RDRA 3R6LB 1HFEL 3GIKA 1JLFA 2BDPA 4U7UD 2J0SD 3AB2B 3N6NA 2HLUA 1LW2B 3HVTB 2VBWA 5EN1A 3I9ZA 3MMCA 3H5YA 1VQ6S 2ZH4A 3ET6A 2CRLA 5K8NA 2QTWA 2JEFA 3GYNA 4WXOA 5A6WA 3RJMB 3TUIC 1XIQA 4ECYA 3V81A 2HFNA 3NGRA 1YI2S 4L3NA 2RS2A 1YJ7A 5E3CA 3PJ9A 5KG0A 1T03B 4LSZB 3FCHA 1I6JA 4OZ1A 5F9NA 3PW2A 2CQHA 3QBCA 2D3OR 1YIJS 1H0HB 2E1MC 2DY1A 5E2QA 4LF6J 3FBBA 1FE4A 4NZ0A 3DGPB 4GO7X 3CF5Q 2H3EB 2QZ8A 4YOEA 3IG1A 1Y11A 2E7XA 4NI2A 4ZPAA 2MQPA 4DCOB 3LANA 4WE1B 3KYLA 1W7WA 4B02A 4RUAA 4O3PA 1RTHA 1KKHA 2KG1A 1OJ4A 2EG1A 1K8AT 1OPZA 1ZA1B 4KY3A 3QRQA 3KLVA 2OTJS 2VG5B 2V69A 3U02A 4PXCA 3D6MB 2FJVA 4M5LA 2VODA 5HVFA 2VKRA 2HRUA 4OIXA 3QGPA 4KGVB 4QOTA 5ETTA 1O51A 1XJWB 1CJKB 3MM9B 2YX7A 3OUYB 4OI4A 1RAIB 3CCZA 3JQJA 4CYUB 3T1YJ 1S1WB 4YQWA 1BY9A 1TL5A 1FDNA 1UP1A 3MPWA 1M1HA 3HHLC 5C2CA 3TYTA 1Z4UA 3ZNJ1 4Q0BA 1VFJA 4UW2A 2BM0A 4Y65A 3VGUA 4CO3A 5F3ZA 5AXNA 1K1QA 1GQEA 2V2KA 4DG1A 2XMJA 5FLXU 4WKRA 2C3PA 4RNFA 5LJ3Y 4M95A 2HNDA 4ER8A 2UP1A 3G87A 1EQMA 2OPQA 3KDOA 3EWGA 5J2MA 4NXNF 1OMSA 3CIZA 4QIFA 3SQGB 4ZHRA 1VQ9S 4OI2A 3Q83A 5EHHA 1FKPB 2N4CA 4IH6A 3ZTQA 2Q66A 3F73A 4XO0A 4WJBA 5F8LA 4FYDA 2OPPA 5A8RB 1X9MA 2MY7A 1N32F 1VK3A 1ZM4A 3UCGA 3JYTA 2FC8A 3BDEA 2K8GA 1JXEA 4KJIA 2DXEA 2H5JB 2KHCA 1PJ5A 1YJNS 2HQGA 4AD6A 3D2WA 1TL1A 3H4DA 1U0HB 1JB0C 4QIWD 3TAMB 5ETQA 1DBDA 2ZVSA 5KFDA 2KG0A 5I3UB 4DS5A 4IYQA 2AJQA 3DLJA 3AOAA 5ETPA 4PG8A 3R5CA 1WJ9A 4NZ6A 3RRGA 2VFRA 4YR3A 1SJFA 5F8JA 4IDKA 2DISA 2RT3A 2YWGA 3R5AA 4M5NA 2HQ3A 2BQ3A 1HR0F 2AYMA 2ZOFA 3EGWB 3PEJA 2M52A 5U47A 1S59A 1WDTA 1ZPVA 2FGCA 2JC0A 1WC4A 3IBCB 1N56A 2HS4A 4IRKA 5CYQA 3C2PA 5F8HA 4DEZA 1WSVA 1F9EB 3I32A 3NOCA 4ECSA 2XI2A 1S6QB 1KOOA 4A8YA 2DITA 4JI3F 5KFJA 4X4UA 2R2SA 1PC5A 2VD3A 1T03A 2NYHA 4TQRA 1NK9A 5D4OA 4KKOB 2FZCB 3MUTP 3R97A 1VMBA 2HGMA 4OYOA 3CVKA 3TA0A 3Q89A 1FD2A 3OLBA 3MAAB 3W60A 2V4JA 3H8YA 4FVMA 2C2OB 3RBXA 2XY5A 4LFCJ 3D0GE 1RT5B 1RTJA 1OPIA 1L3SA 4W90B 1YITS 3A8EA 1U1RA 4W4MA 5J2NA 3TEGA 3VV2B 4X4VA 4PG4A 1YJUA 2OPRA 1H6KX 2AW0A 2VBYA 4NLWA 3FGVA 2Y1RI 2IBOA 3NLCA 1EHWA 2HZAA 1EAYC 1S1XA 5K8OA 1U0SA 3D67A 3SSQA 2KM8C 3SBMA 1SC3B 4J90A 3I55S 3I5AA 3I4PA 3N6LA 3M8YA 4B3RJ 4MYUA 1Y9OA 4GKJJ 3OXGA 1HNVA 1URNA 1GXTA 5GAEI 1Q7YT 2LA4A 1UTAA 3M1VB 4PG5A 1I51B 3ZXWA 1TL7B 4WWSA 1S72S 1FNMA 4PCQA 2HHPA 2QLFB 1TVRB 1NXIA 2YBVA 3W63A 3MR2A 5I42A 2RMLA 4NE9C 1L3UA 4JI1F 1HWLA 4FXWA 2OMOA 3CGIA 5H1SV 1DJ0A 3ULHA 4NZ7A 4DV1F 2FHKA 3UN2A 3DOMB 3G6YA 3ZZYA 4DV5J 1ZM3A 1BQMA 3FBCA 1RTIA 3CTRA 2EWHA 2P6TA 1WKLA 2BE9B 2GV1A 4OYPA 3CJ5A 1TL7A 1FESA 1ZETA 3GIIA 1S10A 4EU0A 1WNEA 2XZDB 3W2WB 1OWXA 1R89A 2BV3A 1VQOS 1NBEB 4UQTA 4CYUA 4L75A 1DAXA 1FRKA 3CCQS 4DSFA 2CWXA 4A8QA 5CQGA 2MLYA 4LF8J 5DM6Q 2OFGX 4ECTA 3QLHA 4OQJA 1B7YB 1TQLA 5KG1A 4DPWA 4ED0A 3MR5A 3FRZA 1FD8A 3QIPA 2VUGA 3GJQB 5C24B 3D3BJ 5B0GA 1VQ7S 3RR7A 3MXHP 1FJ7A 2MJNA 2ASLA 3VQSA 4DV3J 3Q8YA 1S99A 1S7IA 2GO9A 4J91A 1HI8A 1S5ZA 1WOPA 2EFOA 2WSCC 3CNQP 4UUWA 2DVIA 2X1FA 3OVSA 3FRYA 2X7IA 3BBCA 2XULA 5G0RA 4GKKJ 4ZVSB 3H4BA 1XR7A 1PGZA 1FDBA 3S8SA 2BBEA 5I3UA 4NLUA 4ITSA 1KFSA 3FEZA 2I6WA 2E66A 1PC4A 4WFXA 3H5UA 2B4OA 1MMLA 2AJ0A 3GV5B 1CC8A 4KKOA 5D0GA 5F0UA 4QWBA 1H38A 1CS4B 2CJAA 2RQ4A 3QATA 8ATCB 4CM0A 1GNKA 3DLGA 1I94F 4DL5A 2D1CA 2OP5A 5J1PA 2GGPA 5KFGA 3HKWA 4MJKA 5RUBA 4XDDA 2ZZNA 3S01A 1LWCB 3BKFA 1BQMB 1VJQA 2KZZA 3BYPA 3CDWA 1QD1A 2LVWA 1KQGB 4NLQA 1HNIB 2ZNYA 1HNWJ 1M5SA 4UF4A 1AZSB 3OLAA 1FI4A 1PJ7A 4A8KA 3NOGA 4AL5A 2ZITA 4C3MA 2ZH3A 1VHIA 2ROEA 5KFSA 4LF7F 4NXMF 1KWMA 5E5NA 1PYTA 3O6QA 5KFPA 2NUUG 3H2LA 3OR2B 4D3HA 2YY3A 2JWNA 1EX8A 3GP9A 4Y2KA 3SDEA 5KFLA 4TY8B 4I4BA 4FXVA 3O1LA 2BANB 3BQ2A 3GJRB 1TKTB 2YXLA 1FTCA 1QJHA 1DFDA 4JV5F 4DU7A 1HR0J 4F0MA 4ZJQA 3NG8A 4K5SA 2UUCJ 3MD1A 2CJKA 2HHVA 5C7PA 1U25A 3KNAA 1WSRA 4M5JA 1RA6A 3R27A 2XS5A 1RB0A 1Q53A 2CA9A 2LKZA 2XLJA 2X1GA 3BM7A 1UKUA 2CQ1A 4KB7A 1RU2A 2BW7A 3M8WA 4ED1A 2W7PA 4DV7F 1S0MA 1FNXH 2N7YA 2H54B 2Q6BA 5G4DA 3TI0A 4ZCMA 2OTLS 4CH0S 4I0WA 2IVFB 3PO4A 3MFIA 1TKXA 4C8ZA 2V4JB 3CD7A 4N7TA 3BS9A 3VF0B 2R8IA 1UETA 1SC1B 1WHWA 2CXEA 1FWPA 4USWA 1XNRJ 4CNYA 3FEYB 2M7SA 1IKXB 3RUBL 2MQMA 4NLGA 4O23A 3PV8A 5J1EB 3GQCA 1B70B 2MB0B 3PO5A 3G9CA 2QGFB 3ICLA 3MCMA 1Q7LB 4FBTA 2B4PA 4WU2A 4LT6A 3CJRA 4QW9A 3M9OB 4KTQA 3GB0A 3NMAA 4DR2J 1MROB 1R27B 2L9WA 3AD8C 3KJVB 1RGVA 3LP0A 4K59A 3PW5A 1T3NA 4LF9J 5KT6A 2R8KA 4OHYA 1RTHB 4M1KA 3N28A 1U1LA 5IT9U 2R2TA 1M0SA 5IFMA 1R0CB 3CEDA 5CHCB 2CUYA 1X7VA 2RIJA 2YNFA 5CZVA 3HP6A 3IRWP 2R7VA 5HVHA 5KTQA 3BO3A 3GSDA 2UUAJ 4G3IA 2GJ2A 2CPXA 3DRSA 4K4TA 4B9VA 3MEKA 1EETB 1FX2A 4C11A 4M94A 1T94A 2F9DA 3EZUA 1HI1A 3FNNA 4YR2A 3I0RA 4BCAA 4M8LA 3W2VA 3V81B 1K0TA 3N9UC 1DURA 1RSCA 3ZZOA 1PYOB 5K8PA 1MWQA 1FCAA 3CIMA 3FQLA 1VQ4S 4ELUA 1O0PA 3GYGA 5D0RA 1FRMA 4MKAA 1C0UB 1YHQS 4DUZJ 1RT2A 4F02A 2N4DA 2B43A 1R8PA 2JEGA 3KDNA 3OTCA 4C2MA 4A8MP 1VR6A 1Q0NA 1S9FA 1AZSA 1NJYA 2EFPA 2LXIA 1XN9A 3W64A 1BC6A 3M8ZA 5KFNA 3LTOA 4OX9J 2PMZD 1KONA 2GFFA 1HWKA 3LOUA 4QQBA 2F7VA 1D9DA 4RNHA 2C2NA 1SJ1A 4RW8A 2A6MA 3P96A 4LREA 1Q81T 4ZLLA 4IO1A 2Z56B 4DR6F 2L3MA 1NSPA 4DN0A 2D9OA 1H74A 3MWBA 5LSLA 3OL7A 1GXLA 2H4YB 1RADB 5KAKA 3OUYA 1EJ7L 3EM1A 3VGVA 1FFGB 3CJSA 4C0OC 4JI8F 1X4AA 2XHCA 2NQPA 3OBIA 1KVKA 3IRXA 3HHDA 2HGNA 4USHA 1BUXA 4E98A 4ZLJA 2YKMB 1RWKB 3KKFA 4DLEA 2W9CA 3OL8A 5J2NB 4H4OA 2CJQA 4GVLA 4CI0B 3Q8SB 2L08A 2CNOB 1FRHA 4USIA 3RTVA 3R7NB 5IWAF 3I82A 4G1QA 3DGPA 4A8XA 2VG7A 2UV8G 5AT1B 5GMDA 3AQPA 2R8HA 3QLHB 2A3JA 1DARA 3DDKA 3T6JA 3R5JB 1N0UA 3G6ES 3PVXA 1S0VA 4RW4B 4NCGB 1KOHA 3G8TA 3MEDA 1M5VC 4C8LA 1Z1ZA 2FDNA 4FYYB 3C3LA 4I6YA 3VZHA 3ZZZA 1H7XA 2Z2LA 4Y2MA 3GILA 1K44A 2J9DE 3AB4B 3AY0A 1TKXB 2V8VA 3PNIA 1XR6A 4TLRA 3M8PA 1H2UX 1OYEA 2G2ZA 2QYGA 4DR2F 3DDIA 4X4NA 1DY3A 4LRBA 3BYRA 4P75A 4F36A 5KFBA 1LFPA 1VISA 4ECVA 1YDLA 3MM7B 3ZO7A 1SV5A 3HXMA 2CDRB 2P6SA 4AQYJ 3M2UA 3R5BA 4YUDA 3NGKA 1RAFB 4OFZA 4E2FB 3BSOA 2MJUA 4JBCA 4TQSA 5C24A 1SC4B 3CCUS 1X5OA 1C1BA 2B9EA 2CG8A 2MYFA 3C19A 2ASJA 2CWKA 3A4TA 1IBKF 2DNQA 2RD5C 1S7HA 4K2JA 3WQPA 3ZTPA 2XB2D 2DNZA 1VGYA 1T9XA 4IG3A 1WD6A 1XTZA 1HNVB 2YWHA 1JLAB 3PTWA 5CYMB 1R0BG 4LJMA 1C2PA 3OQ2A 4QIEA 3AOBA 5DZ7A 1ZTWA 3T3FA 2UXBJ 5FJ4A 2ZM6F 2CQ2A 4IH5A 2ZBCA 2PE8A 4EBDA 3W7BA 2FY1A 1SPBP 4DL3A 3DRXA 4LUBA 5D3GB 1P9QC 1PAUB 4EYIB 1U2RA 4FKYA 3A8JA 3W65A 5HLFA 3TP2A 4DQSA 3OTEA 1KR4A 3KJQB 1AUSL 1NO8A 2YKOA 4MIBA 2ZOGA 2I0XA 4JI0J 1UZHA 3AHPA 3BGLA 5AJ3J 4L3KA 4P6QA 1RT5A 3FSIA 1LWCA 2JC1A 3ILJA 4F4YA 4PG6A 2W7AA 4PYAA 2OPSA 2FVRA 1TK8A 2C2KB 4PPDA 1CVJA 4KHRA 3HVWA 3WZ0A 2B51A 2XNQA 3BSAA 1TMJA 3C6TB 1QDUB 2DH7A 2HAIA 2R7OA 3H2VE 3K8WA 3M32B 3KTQA 1HNWF 1TL4A 2PMHA 3PYDA 2HZCA 4MIAA 1RABB 3QSYB 2UZAA 1RTDB 1REVA 2J0WA 3JQKA 4OYXA 2JFDA 2F8MA 3GIMA 2BQUA 3B54A 2ZH8A 1U2CA 4EO8A 3A8IA 2GMHA 2EFNA 1IQTA 2DY9A 1FFSB 1GT8A 3AJ2A 3MURP 5KFQA 2HK2A 5M2UA 2XLKA 2ZH5A 2FVSA 3FCVA 5LXYA 4EO6A 3JAMY 2KKHA 3J7YI 2UXDJ 2MZTA 5SUHA 2O67A 4QR1A 2DGWA 3RGIA 4OX8A 1IR0A 2RVJA 4X64F 2GVDB 1SVDA 2G0IA 4KYZA 1EARA 1Q8LA 4ES2A 2FJWA 4F4WA 1WTBA 2AJ4A 4U6PA 2FLOA 5F8IA 4I64A 1F5CA 1OSDA 4I2QA 3DGVA 5KFAA 1H2TZ 3AH6A 4QWDA 1RWOB 3KWMA 4PUOA 3UN3A 1GTHA 1IKVB 1RHRB 4YB1P 1UW4A 2RU3A 4DFJA 4IG0B 2XTJP 1E6YA 4URSA 3WIUA 4WCEQ 1AROP 3TQ1A 5IQQA 2VH7A 5HROA 2XS7A 1NJZA 3ETOA 1RT3A 1R6VA 1TUWA 3PJWA 5L9NA 2AV5A 3D28A 4XPCA 4H4OB 1OS5A 3QFHA 4LRAA 1C4AA 3T1HF 6FDRA 4MAKA 3CCES 3QWUA 1ZA2B 1W2BR 2NREA 1KVIA 3CMAS 3C14B 2VU5A 4IO9Q 1TL1B 1KP6A 3PCOB 4ZVQB 3J81U 3QT7A 1UAWA 4IRDA 2FTRA 3MAQA 2OJ3A 4DR7J 2KH9A 2H5EA 3THTA 4KGKA 1B0PA 2WSEC 1VIOA 3M7VA 4V19J 4DPXA 2RDJA 4V19X 3D9BA 2DGXA 4Q5VA 1RT7B 3DOLB 4WP9A 1BE4A 5KFVA 5F3TA 1D1UA 4CLSA 2CZ4A 4NOHA 4RW8B 2XQCA 4ECZA 2CQCA 2VC1A 3DKDA 2HIQA 3IA0A 2GQQA 1D8YA 1KQKA 1PIEA 2ZDPA 4K4WA 1X5SA 2XMKA 4CO0A 1U09A 3TUZC 1ZAVA 1UVMA 4TKTA 2DH8A 5B0CA 2XSJB 2AWZA 3QQCD 4DLGA 2LCWA 1JKHA 4AL6A 5HP1B 1QY7A 3KK1B 3DXSX 4N56A 3M6UA 1F3VA 3EVOA 1LWXA 3PRVA 3BREA 3R1HA 2E1RA 1T9UA 5IC4B 1APSA 1RWWB 3CDBA 4PQUB 2HZVA 3KMSA 1IKXA 3LGMA 4B9NA 3MD3A 1AA1B 3EMTA 5KFKA 4QYZJ 4RW4A 4M5IA 3DLEB 3BGFA 4O4GB 1YBTA 3IWLA 3MEGB 4RUBA 3BKTA 1IM4A 2DCLA 4ZVTB 4MTPA 4DX7A 1U49A 5HP1A 3ENAA 4ZVRB 1ZS6A 8RUCA 4O0NA 2XSFA 3ADAC 1GMVA 2DGOA 2DNLA 1F2GA 1OIAA 2JX2A 2HNYA 3W8PA 4IUFA 4RW7A 3JSBA 3AXMA 4X62J 3P4UB 2V50A 2AYBA 1GEHA 2KHDA 2YNHB 5IM0A 4QYZK 4OZ0A 4Q8EA 3HLUA 5DQIA 4ZVPB 5L9XA 2DTJA 4F8RA 5ETLA 2NXUA 3J81j 5DDRC 1JJ4A 2IA6A 4OJGA 3HHEA 3B4MA 4FPIA 1YX2A 4UZBA 2BVZA 1M90T 2KN4A 2VFUA 1S79A 2AP6A 2WBRA 3P49B 3T1HJ 3SDEB 4QWCA 4KPCA 4QPXA 5D8HB 1U8SA 1VQLS 1YJ9S 4FS2A 4OJHA 1S9GA 3F56A 5DGAA 4PABA 3BSCA 3GMGA 2ZEJA 1OY6A 4O44B 1B0TA 1U6ZA 2E29A 3EPIA 5KFUA 1YRXA 4J7CA 4X4RA 2ZC4A 4FF4A 2YH0A 1P6TA 4ZP7A 5IT0A 3CCRS 1RCXB 2I1RA 3D5MA 4L6V3 2RDIA 4P2FA 5A76A 3TNVA 1HBNA 4EMDA 3HMJG 3D1OA 3KHLA 1T05B 2BJ3A 4RO0A 2FHMA 3CCJS 1IN0A 4LF4F 2VPYB 2VG6B 3K5MA 1VRTA 2B4UA 2CQGA 3FK4A 3FQKA 1OSCA 4JI6J 3TR5A 3CC7S 1R31A 1R0AA 3PDNA 5FIIA 2X1AA 3SV3A 3LH2S 2UXCJ 4USJC 4E8UA 1QLNA 1K9MT 3KJNB 1DQ9A 1WG4A 3MFHA 2GHVC 1Q1KA 3GCXP 1TUVA 1N5VA 3LF0A 1VRQC 4P2MA 1RKJA 4ID5A 1FNOA 3V6JA 1SV5B 1Q8BA 1M5HA 2QYCA 3H5SA 1XNQF 2BRKA 1VRUB 2B4VA 2XG8A 1X4FA 2JHEA 3EE3A 3KJVA 5HQLA 4CRJA 3G6XA 1OQ6A 3K5LA 1LEOA 4QIVA 5GAGU 3L4BC 4RLEA 4DPTA 4OYIA 2RQCA 2RQMA 3HVAA 2V68A 3SCJE 1KEKA 4K8RA 4X62F 4FP9A 2DPJA 3HX9A 3LA0A 5K8MA 1ZYQA 4I2PB 5E0OA 4DV0J 3V6KA 3IBFB 5F9LA 1S12A 2KXNB 3J7Z5 4I6AA 1FXLA 3D0IE 4LQ9A 4WU3A 3W5YA 1HBUB 5THWA 1NDKA 2K1RA 3M8SA 1Q16B 3QT6A 3K57A 5BXIA 5G0RB 3N01A 1SJ3P 4JI4F 3DRPB 2ZC3A 3OFGA 2YH1A 4TNOA 1Q8KA 4YP3A 4G1PA 3RU0A 2B56A 2IM2A 1Q82T 2UVVA 4C98A 2HS3A 2APOA 3KG1A 4Y34A 4ZCKA 3RAMA 2FD2A 4GRSA 2XGPA 1TKDA 1S0NA 1HNZF 1UEVA 2C3OA 1KVJA 2ZHBA 2X3GA 4ED6A 4F3OA 1RT7A 3DOLA 4RW9A 2OHDA 1R0AB 1HHSA 3FSXA 3GIRA 4DX8H 1IBKJ 2V6AA 4JP8A 1UFKA 2HQFA 1WI8A 2IJFA 4O3OA 4NCBA 2HVDA 2JL9A 3PR4A 1HYSB 4K4ZA 1N34F 4KFBB 1SL0A 1NPKA 2B9YA 2E1AA 2FJAB 3ZTOA 1TTHB 2C3MA 3KK3B 1RJJA 3R2CJ 1B99A 3W1YC 2Q1LA 3HM9A 2BOAA 2AGOA 2CQIA 3RW7A 1P9YA 2FLLA 3QZ8A 1EB0A 3ZTRA 3EDRB 2IC3B 4CLUA 1N33F 2HSEB 1AT1B 3JSMB 2G13A 2DKOB 1T02A 3FBEA 1QSLA 2FZKB 1RUSA 2IRXA 2R4FA 3OR1A 3MM6A 3WIVA 3CD5A 1HPZB 2UUAF 3ITHB 4OI0A 1S9GB 1X0PA 3AJDA 1TUGB 3TVYA 2K7KA 1VC5A 1QUPA 2XYGB 4CIOA 2D3O1 2ROGA 2JVRA 3NCRA 5J2QA 3M1VA 4JV0A 4J9OA 4IFVA 4QIGA 3KLFA 2V5HG 3W66A 1QVFR 1UZDA 2MZJA 3G71S 5GAHU 1HKAA 1YK9A 3HD2A 2ZM6J 2OELA 2DRAA 5EGYA 2OEKA 2K2PA 2WVFA 4JI7J 2J7KA 3BGOP 1QE1A 2YNFB 3NXZA 2MLXA 3QAUA 3G8SA 3TUJC 2V2QA 5LMNJ 1GK8A 1V9OA 2WSFC 1VHFA 3G8QA 3IR7B 4DPYA 4Z37A 1U1PA 2F4VJ 3GFZA 3D0HE 4TN2A 4B3MJ 4I56A 1VQSA 5CZXA 1IBLJ 1NJIT 4QZVB 1QAJA 3OPKA 1KLNA 2XS2A 4PAAA 1KHVA 2NS1B 1F9HA 1Q78A 1RWUA 3DFEA 3MEGA 2DR8A 3CMES 4B9TA 4OZLA 1CQMA 5J1EA 1SQFA 4ERDA 3G96A 1SC6A 4ZVEA 2QA2A 2MZQA 2F9JA 2JDJA 2DGTA 4CT9A 3MECB 2PT0A 1N8RT 2HVHA 1I3OB 4ZK7M 2IRYA 3C16B 1FA0A 2KM8B 2UUCF 4MK7A 2VG7B 4FNHA 4LSLA 2G2YA 3FUYA 3GU0A 3I31A 2EXUA 4P52A 4BDPA 2HFZA 4ELTA 1RQ0A 1ZAXA 3SQGA 4C48A 2VFSA 2G1DA 4PWDA 3KJFB 2ATCB 4ZMMA 2KRRA 5LXRA 1QTMA 2ZZMA 1FHTA 1CLFA 5CABA 2CQDA 1H3DA 1UVKA 2IMOA 2MMYA 1BGXT 2Z0GA 3P8BB 4Q7AA 4U9RA 2A2CA 4ATNA 2DGUA 5HQMA 5KFFA 3HPOA 5AXMA 2VQEF 3E3XA 3FFIA 3HHLD 4OX7A 1JQGA 1I5OB 2DYAA 2E1PA 2RS8A 4WBFA 2RB7A 4UQGA 3CUNA 1BQNB 4JI5F 3PKMA 3PZPA 3MGJA 2OI2A 5J2PB 5IQ6A 2HPUA 3CJ4A 2ILYA 1QAIA 1UW9A 1DTTB 3LWMA 2V4RA 2LU2A 2HQIA 3CDEA 3JTNA 4AUKA 2ZKTA 2QEXS 2NCKL 1K47A 2BR0A 4LF9F 2E7VA 2VASA 5J2MB 1WG5A 2BX6A 3RB6A 2HNYB 1DLOB 4K50A 1IVZA 4ED8A 1D9FA 3W3SA 2CQPA 2DO0A 2QLJB 4R0JA 1RTJB 3THPA 2XMAA 4J9QA 2ZH9A 3D7SB 1YTYA 3CO0P 1DQAA 4R5PA 3HHNB 1DQ8A 2WAQD 4L73A 2ASYA 1DTQB 3UR0A 2VPXB 1X5PA 1NU4A 3DLKA 2B9WA 3KG4A 2MGZA 3HFKA 2OH2A 2CADA 4WK1A 5JJBA 4DSEA 1FE0A 2R8GA 4WFZA 1WC6A 4EYHB 1NKCA 3IBWA 5J1NA 3DU6A 2C22A 4NLVA 2GVDA 3BDPA 4R5PB 4K0KF 2R3VA 3NGUA 4XPEA 2VFTA 3SFGA 5D4NA 4ETXA 3VCDA 1R8AA 1RP5A 2QC3A 1KHWA 3DCAA 3MPYA 3QIDA 1Y4ZB 3TA1A 6FD1A 1SIZA 1U1KA 1Y00A 2VC0A 4ZVGA 3S1TA 1T3OA 4ZLPA 2HMIA 4O0IA 4P2SA 4U8VA 1QE1B 1F0XA 5MLCV 4YHHF 2AF6A 1O5JA 3L9ZA 5A8KA 1UEKA 5L39A 2A2DA 5DJBA 1EKRA 4FS1A 3CWJA 3M30B 4CLLA 1ITPA 1Q5YA 4B9LA 4K4SA 4U96A 1JJHA 3GIJA 1RYSA 1RHJB 4E0DA 3PYFA 3BPSP 3H42A 4FVCA 3EX7B 5KT4A 3H25A 5DLGA 2QFJA 3CCLS 3ET6B 3NS7B 5GVQA 4U8YA 2HW3A 4ANDA 3SV4A 1HPZA 2BEFA 4ZHRB 4CLZA 2GS8A 2H48B 3TZZA 5KG6A 3SEOA 3KG0A 1RAOA 2DCUB 3AD9C 3BH7B 4MK8A 1HW8A 2I9SA 1VIXA 4PWDB 5HSPA 2YX1A 2YTCA 4W98A 2QE5A 2AYEA 2HHHJ 4EBCA 2HYIB 1CULA 2UXDF 5D3GA 1YVFA 4UT4A 2BXJA 3DXBA 4UUXA 3A12A 4LFAJ 4YMEA 1SL1A 2VA3A 2QL9B 2M9KA 4ZN3A 3L95X 3EPGA 2CDQA 4F0HA 3T19A 4PZVA 2ATLA 3I5CA 2XO6A 2DB1A 1WELA 3DLHA 4W92B 1TKTA 4NLXA 1Y5LB 4D3GA 5DG8A 1HQEB 1S9EA 2VDIA 3Q2SC 4KC5A 5A8WB 3OTOF 1SH3A 2PEHA 3MM9A 4KV8A 2FGOA 1N0VC 2VICA 1SKSA 3A3NB 4RW9B 3VWSA 1VBKA 1C1BB 1NK4A 1S1XB 1HW9A 2FC9A 2IVMA 2ZDOA 4WFYA 5KT3A 3K0JA 4DL7A 1BXNA 1WTFA 4F4XA 1RTZA 1B64A 4LSNA 2Q6CA 3D66A 4FYXB 5IV3A 5GAHI 4CH1A 2ILZA 2XMTA 4UOFA 2OEMA 3MM7A 3BGUA 1S6PA 4GVBB 2OKQA 3D6FB 2V9WA 1VOMA 5KFEA 1CJTB 2CQ3A 1QM9A 3PM9A 3G86A 4C9DA 2Y0BB 2BJDA 1SH0A 1G1XA 3M8PB 2AD9A 1RACB 5E41A 2RU9A 2FB0A 5MAOA 1F5AA 2GA7A 4L74A 4CT8A 1UPMB 6AT1B 3UW1A 1S0OA 2BOPA 1YQHA 3MUVP 4Q44A 3N0VA 1YRUA 2GJFA 3K5OA 1G2EA 3HZGA 5EUHA 1HARA 2QSWA 1N5TA 4YDXA 2DJWA 2C28A 2VPWB 3UO0A 3BN4A 5JVHQ 2RRBA 3EXYA 3MMCB 2GHPA 1S6UA 1GAOA 1YLXA 3GV7B 3KMQA 4ZP6A 4RUHA 2Y1JA 5GADU 4H4KA 4LF4J 4OJ1A 4C3LA 5HVGA 2C42A 4DS4A 1DLOA 1WC0A 2QN6B 2A1BA 2JLGA 4HDGA 2DEJA 4CWBA 3NP5A 2IBKA 1IKWB 3VALA 4RW6A 1NZAA 4CO4A 5HMZA 5IXUA 2DHSA 4FBUA 3IS9A 1IR1A 3KUGA 2LXUA 3GYXB 4YEAA 2HWTA 1CJVB 1KBRA 2HK3A 3KUEA 1RA7A 1RCOB 3UI3A 3J7YU 5F8NA 2XO7A 1NSAA 4J9KA 3M32A 1S1TA 3W2WA 4JB8B 2DRDA 3ZFVA 2OEJA 2POKA 3IAS9 5DQHA 3FFIB 3T5KA 4DSJA 1NLKL 3H0PA 5K9FA 4DF8A 3L7OA 2CPFA 1JWWA 3C46A 2NYIA 3K5NA 1HBNB 2AJFE 3IS9B 2DNRA 2RHSB 2QJ3A 1TFYA 1YSJA 2R7XA 5DGBA 4RW6B 1MU2B 1MWYA 4NLTA 3Q24A 1JLBA 2OPRB 4M5DA 1FFWB 4ZN1A 2XCPA 1EQ0A 1FT8A 2MSSA 3MZIA 3UNYA 3MDFA 2IC3A 3RZAA 3QRRA 5M2RA 3V6DB 1NH7A 4HVZA 4ZA1A 4DV5F 1B7FA 5CD4A 2QA4S 2GIQA 3HCXA 4LF1A 2W1BA 1UJ6A 2MQQA 2ZBIA 1VYAA 4DPUA 4HT5A 3WHIA 2RJZA 2H9ZA 4ED3A 3BQ0A 2IAJA 3JQMA 2Y8WA 4DXLA 2QMUB 2YQ1A 5HI7A 4NLDA 4WIQA 4RZRA 1PO6A 4LQ3A 1LK7A 2G0CA 2WB4A 3FEXB 3MCOA 1EETA 4V1Ak 4K4VA 5D4LA 5F41A 4DL4A 4QR2A 4JI7F 1C0TA 3QNWB 2BACA 4BWJA 3M9NB 2M5YA 5E3AA 4FXDA 2UVWA 2EBGA 5HBMA 5KG3A 4RX6A 2OD4A 3WDOA 1HIYA 2E5JA 2DGQA 1R7IA 1Q95G 3QGHA 4B3TJ 1PAEX 4P74A 1XEZA 1HBMA 4HHHA 3CMQA 1HBUA 1EP4B 4JV1A 2GIRA 1B4SA 4J9LA 2YX4A 5BR8F 4OMFG 3QMQA 2XI3A 5T14A 4DUTA 4DV2J 2V94A 4DX5A 2EFVA 1N32J 2YQ0A 4RNMA 3L09A 4OZ5A 1M5PC 2QV6A 3R1LA 4AL7A 3QJPA 2BZ2A 3G2XA 3MCSA 2DNPA 1JLCB 3CJ2A 3CD6S 4IFVB 1ZM9A 5A6PA 5DDOC 3OJUA 2C2DA 3P45B 2RH3A 4EEYA 4LMZA 4DUYF 3DLLQ 3ILLA 5CYQB 4YB6A 1S57A 1HI0P 2H51B 5IV4A 3NL0A 4M5KA 2PGCA 1RXOB 4MKYA 4EZ9A 1KLMA 1GMUA 1HBOB 5C25B 2HURA 4ID5B 3AOCA 2LQ8A 4H4MA 3LP2A 2DIVA 5KT5A 1K0VA 1JXVA 4RU9A 1FRLA 1TL3B 4TU8A 1GMWD 1C1CB 1JX4A 1T9WA 1C0UA 3G4SS 2PIIA 2AEFA 5K5MA 4TU9A 3MR3A 3Q8VA 4L72B 2B7BB 3BN7A 2UUBJ 1N33J 1S1WA 5CYMA 2ALZA 3T5JA 3CPWR 3MEEB 1IJEB 1WC5A 2BANA 1FEHA 4UZCA 2QG9B 5B7WA 4Y0FA 4DV1J 1NEEA 2C2ZB 4C8OA 1UJ5A 2EC0A 1NRKA 5IZHA 2WTFA 1TV6B 1JLEB 4LF2A 5DO2A 4ECQA 1T7PA 1LWEA 4BHQA 5LJ5Y 3SFUA 3QPIA 4DR3J 1TL3A 3TOQA 3Q2TC 4Y2IA 1G7CB 1N54B 1V5IB 3M8RA 1CULB 5ETOA 2MKKA 4MIWA 4LF5J 3HK2A 2ZD1B 2Z2ZA 3CJ3A 4QPTA 3RRKA 2L41A 3DRPA 1XC9A 3MMAB 4UOGA 5CXTA 2ABYA 3HSDA 2CQ4A 2BJ8A 2DR6A 2IY5B 2MEWA 2OSRA 3BGRA 2HBYB 2IJNA 3LPYA 4J5OA 5T7LA 3TJ8A 4BLGA 2KFYA 2GMLA 1VC6A 2CQ0A 1QVGR 3J7A1 2ZBQA 2PFDA 3AJ1A 4OJ3A 1U7LA 4XK8C 3QGGA 2BJEA 4P7VA 2ZJQQ 3UCUP 1FKAF 3CCSS 4WP8A 1X4CA 4KGZB 4OX9F 4YY3J 1ULRA 3A3OB 5LT5A 1XR5A 2LQJA 2BRLA 3LQVA 3VHQA 4DV6F 4CCHA 4NA1A 3DLBA 1WHYA 2CNNB 3HFZB 4ALZA 5T7LB 2XSJA 4P7TA 4OYZA 3VAMA 5E33A 4UTGA 3W9JA 4QCLA 4CLTA 2J7WA 3UD5A 3VAGA 1RK8A 1N6QB 1WDDA 3NCQA 3PACA 1ZOTA 2BKPA 5EWFA 2XM3A 3I87A 4C97A 2JLFA 3FKBA 4DHVA 1LWFB 1X9WA 4JV2A 2GW8A 4ED5A 1BD6A 3C66A 4OYMA 3TAMA 2Y1IA 1IWAA 1T11A 2QFIA 2J6SA 1TV6A 4DV2F 3PJXA 5GMKa 3DLEA 2H4WB 3NAHA 5L1LA 3O2IA 3IWNC 4WFAQ 1IM6A 2CKWA 4OLPA 1HQEA 4Q2MA 3CJKA 4AYBD 4F50A 3CJQA 8AT1B 2F4VF 3P6YC 5H9FK 4LIRA 1JLQB 2NPFA 4DV7J 3D4JA 4U7CA 4K4YA 3RBDA 3TX0A 1DTQA 1HNZJ 4ZPBA 3M2VB 2VJUA 1U45A 4ZP9A 3PEHA 5T41A 4IRCA 4B9MA 4RNNA 1R8HA 2KYZA 3N6MA 2N7CA 5K14A 2CJYB 1G4CA 1G6BA 1VK8A 1HQUB 1NUEA 2EI5A 2M3DA 5ETKA 5KFRA 4JUZA 4B3SJ 2W2NP 4JI5J 2C1EB 1HHQA 2CJ9A 1JLBB 1RU1A 1UJ4A 2K7JA 3H90A 3OD2A 4M5DB 2AZ1A 1B0VA 1X4DA 5KFYA 2YNGA 4L76A 2ASDA 4YB7A 2FLNA 1SXLA 1U47A 3D3CJ 1TKZB 3ILIA 2KT2A 4KRWA 4ICLA 3R5GA 4ZDNA 1N36J 4LIWA 2Y9HA 3RG6A 2WOMA 3CDAA 4R25A 2KO1A 2HHUA 1RT4A 3NMRA 4I2QB 4A48A 1X4HA 4LF8F 4H54A 2PO4A 4C11B 2YPYA 3KFWX 1WC3A 4DBQA 3CC2S 1NK0A 3TAPA 1A6LA 2AJ2A 2IIHA 4KO0B 3PRBA 3AD7C 4CO5A 3RW6A 1S4FA 1UPPA 4CLWA 3ILOA 1RKIA 2ZUGA 3TVKA 4FDFA 2AGQA 2ADCA 2XBPA 4HKQA 3BV8A 4N8NA 2Z2MA 4QR0A 2VPZB 1RT3B 3J80U 3NGDA 2XGQA 4QW8A 2UXBF 1U1MA 4LFAF 3PR5B 2YKPA 1KTVA 2NXJA 2ZH7A 2VHGA 3VAFA 4DSIA 4PWWA 3OFEA 1LW0A 1LK5A 2LA6A 4DOZA 4EFAC 4DR4F 4ZPWR 3N4WA 2V8PA 3MAAA 4JI1J 3DLGB 5DZ6A 3MECA 2V34A 1ZPWX 1FO1A 1D9AA 2LDIA 5H9FJ 2B7CB 2V2ZA 2GQCA 3RYLA 4YS2A 2W7OA 2CIMA 2M8HA 2R7SA 3ELHA 4PQUA 3D6HB 4QWAA 2FLPA 3MOZA 3H20A 4IQMA 2DNYA 5F8GA 2LEBA 3ISND 4FPRA 2B5JA 2D3ZA 3BBFA 3LGNA 4JOUA 1RTIB 1WHVA 2QO3A 4O3RA 1FXDA 5L1JA 2KFZA 1NZ8A 5KOXA 5B0EA 2W9BA 4B3RF 3M6VA 1IXKA 3GPAA 2HVZA 3EVWA 1RT6A 4C3KA 3HHLB 3JSMA 2PDAA 2F5GA 4LVNP 4Z2XA 4J9MA 5H9EJ 1RT1A 1WKKA 1MMNA 4WPAA 2HHSA 3IRXB 1IUJA 2DXFA 2RUGA 2XMUA 3OTBA 4OLOA 1Y3JA 3CXCR 1NK7A 2FVQA 4AXIA 2YPZA 1SUQA 2XMVA 2VV5A 3QWPA 2NLWA 4DFPA 3DU5A 4RU2A 1IR2A 1S1TB 1NSKL 3M6XA 2CPHA 4HTJA 3WX8A 3JB9k 4C4WA 4HEA9 9RUBA 4BC7A 2VQFJ 3QT5A 1U02A 2F63A 1FKOA 5KFCA 1MN9A 2MZRA 3C14A 2QRRA 1YKWA 4U7UK 2LEAA 2RDDA 2W4DA 3GCWP 3L7PA 3U1NA 4C6AA 5AE3A 5CCMA 1RT1B 2ZZTA 3A13A 2R7RA 3CW2C 2I5JA 2KT3A 4CP5A 4H4MB 3OL9A 2N82B 1S1UA 2FZGB 1AFIA 1F2HA 1HNIA 4RWWA 4Q45A 1HQUA 4JI0F 1DRZA 1TMMA 3HFVA 2UUTA 2L48A 4LBIA 1AXQA 2WBMA 3N79A 2DBBA 2W4CA 4OYBA 2VB6A 3MF5A 3VAHA 5I42B 1HD0A 3W62A 3RB4A 2R2RA 1IQZA 2K06A 1T0TV 3CO9A 5A2QY 4O3SA 1B3TA 1F6TA 2JH3A 3AAWB 3FVYA 1DHMA 3KK3A 1KS2A 5JUMA 3SMZA 4X64J 2HS0A 3K89A 2JEJA 1HD1A 1WOSA 2XWYA 4PQAA 1SJRA 2KVIA 4Q2LA 2R7TA 2FHJD 4S0MA 4N76A 3OVBA 3PHTA 2MSTA 2ZHOA 4OHWA 2BKNA 2LMIA 1PG5B 1CJKA 3NWGA 1CJVA 5HL7Q 2DNOA 2W25A 2R7UA 2COLA 1D8ZA 4O3NA 2E7WA 4GC6A 1J5EF 2FQQB 1J5OB 1BWEA 5D4PA 1LWFA 3OVAA 1H72C 2HMIB 2WZ1A 3GONA 1RAEB 2YNHA 1UFWA 3D54A 1BQXA 3DDNA 4HHJA 4R0EA 5LMNF 4DWIA 1K73T 1UVLA 2OAUA 3NNAA 4ZPVR 3U7JA 2K3KA 2C3YA 2FHJA 1ZZNA 2DNGA 3DN9A 3C8YA 3OT9A 2C3UA 1XMQF 4ILMA 3ZZPA 2HKEA 1UWAA 2JZ5A 4TXSA 4C8NA 3C6UA 5DM7Q 3PHEA 1OO0B 4KO0A 3B6BA 5ETNA 5HANA 1NSQA 2RKIA 3V4IA 1JJ2R 4IR9A 4YFUA 3B4DA 2Q79A 1RAAB 3BKUA 2M4MA 4NL5A 4RR5A 3DYAB 3JTOA 2WONA 4X65J 2O01C 2E9RX 3H59A 2PN6A 3NAIA 3OJSA 2E5LF 1G3OA 4DZDA 2HRYA 2ADBA 3LO3A 2OPPB 5A8RA 2D74B 2XY7A 4FN5A 3HSJA 1N52B 3KK1A 1LNQA 2QL5B 1UEUA 3UD4P 4IOAQ 1GX6A 2MKJA 1V3RA 1Y5IB 2RE1A 5HK4A 2VOPA 3IGVA 1O6XA 4ZS6A 1HWUA 3RAQA 1N5QA 2MKIA 3M05A 4J9RA 3S6EA 3SI8A 3MTJA 3J80Y 2PA3A 1XMQJ 3DHXA 2R9LA 1X4GA 4ZP8A 1MU2A 3GFYA 1RLCL 3FSYA 3ZNUA 3E2EA 3OXLA 1NHKL 1L3TA 1DTTA 2AEMA 3W8GA 3EVMA 4ANCA 1NDLA 2IM3A 4YB5A 2JJ4D 2F65A 1NCLA 4HL9A 2LYVA 5KFHA 4DR5J 2XLIA 3I0RB 4M5GA 3EZ5A 1WC1A 4CTAA 4B3SF 3NWRA 1S1VB 2Z4PA 4G1IA 3FC9A 1PBAA 1X31C 2DNMA 2ZNZA 4ILRA 5A8KB 3IFEA 5LOQA 2DR5A 1ELOA 1XERA 4DI6A 2YNGB 3SZ2A 3LAKA 2EFGA 1YZ6A 2XNRA 1BMQB 2CPYA 1RAJA 4HTIA 2GCFA 4HACA 4TVAB 3BBBA 5KG4A 3RB3A 3HHLA 1WUUA 1NAQA 4F26A 1Q4RA 3UDLA 3TO8A 3B82A 2W2PP 2YKQA 4DN9A 5KT7A 2E5LJ 5CA5A 2K1RB 4C0BA 2BJ9A 3OHBA 3M9MB 3OXFA 4HH0A 2A0FB 4DUZF 1VQ8S 2Q3PA 1FVQA 4Q0BB 3SXLA 3QJJA 2R42A 1VBZA 2D41A 3AXKA 1JJCB 3BJYA 3RB0A 3J7ZT 2QSFA 1SKUB 4URGA 1WEYA 3LUYA 4A46A 1FK9A 4DF4A 1X60A 1SJQA 2AGPA 4NXNJ 2W2OP 3JTPA 2VQFF 4PWUA 3VQTA 3DOKB 1WF2A 4ZPCA 4ZVFA 2CNLB 3PIPQ 4ED2A 1N48A 2BKOA 5D77A 2HLTA 2F8HA 2RQKA 3HSGA 4KE5A 4LFBJ 1GXUA 4BBYA 4DMZA 1RWMB 2VG5A 3UDVA 1FXRA 2AIRB 1CJTA 4ZCIA 5L1IA 4CLFA 2J0QD 1N6QA 2GAGC 1GTEA 2HHXA 2W9CB 4Z7CA 1PBUA 2MQNA 1VBYA 1I94J 3LP0B 1RHQB 3MMBA 2MPUA 2FVCA 3PFEA 4NI2B 1TP7A 2CPZA 4DX6A 2WVDA 3IP0A 4I69A 4PR6A 1U0HA 1SQGA 2CFXA 2DGSA 2L9NA 2J8SA 3IWXA 2WB1D 2HBZB 3OFHA 2C2MB 1TZ0A 1S1VA 2KYXA 1X9SA 4JI4J 1RT4B 2ACYA 4ZCLA 4KAIA 1FEEA 3IXQA 2IAJB 2PFFB 1M5OC 2OIHA 3TUPA 2MXYA 1KFDA 2M8DB 3LW5C 3HJVA 5A0YB 2BM1A 5E3RA 1MG7A 3U27A 2ZJRQ 4JI8J 1HWIA 4KR0B 1J5EJ 2QMWA 3UWTA 1SBRA 2EEYA 2KL8A 3OR1B 2M2BA 4A8OA 2A10A 2E44A 4G65A 4TU7A 2HQDA 2KXHA 1U24A 4O4RA 3GFXA 3SYZA 1BLUA 3MPVA 4WYLA 1KTQA 5HN0A 1H7WA 5B0BA 2HNZB 1WF0A 2DEIA 4LR9A 3EDQB 1LWEB 1FTRA 1NDCA 2KB2A 2PEBA 1E6VB 3M2RB 2X51A 1HNXF 4LBPA 1FKOB 4ZIWA 3I96A 2YWKA 3F41A 1NM2A 3I9V9 4P2XA 5E3PA 3W2VB 1HYSA 4CLYA 3KLHB 4X65F 4CTAB 1MSWD 2CPEA 4DJBA 2AQ4A 3O8WA 2RUSA 3Q8UA 4TY8A 2NPIA 3UE2A 3ZC4A 2PMWA 2XY6A 1RBLA 4LBHA 4C8KA 4NA2A 1D0EA 4B17A 4J9PA 2UXCF 4NRTA 4MYTA 2B8QA 1EP4A 3MMBB 4FZVA 4WKYA 2BA9A 1IBMJ 4NCAA 2G4BA 2IA0A 2PA8D 2E1CA 1UL3A 2F3JA 3I6PA 1F3FA 1YBAA 1RBOB 2BW2A 2HFUA 2ZKUA 3GG0A 2EPIA 2FJBB 4M5MA 4NLOA 4RUCA 3HKZD 3T5HA 2YWEA 4HHUA 1YWXA 2DIUA 1RWNB 4EK2A 2N3OA 3QIPB 1WI6A 1T9TA 2U2FA 1IWGA 3CJTA 3DMJB 3GR1A 5IOLA 5BR8J 3GR0A 5KFZA 1XK8A 2E5GA 1IKVA
chains in the Genus database with same CATH topology
4NMLA 2AX0A 4PUOB 2DGVA 3K8VA 2MDAA 1A9NB 1GX5A 3DLKB 2EKYA 2MGZB 4ID8A 1VQKS 4TY9A 3O5TB 4OHVA 3VAJA 3BGRB 3NRBA 1FJEB 3C6UB 2BABA 4N77A 1LW2A 3HVTA 3PKYA 3Q23A 1TFWA 1JLFB 3QGIA 2QIFA 2B3TB 4TYBA 2P5VA 2DNKA 3TAQA 1S77D 5CYJA 3DRRB 1IJFB 1U48A 1C0TB 3LAMA 3ONQA 3HHKA 4GC7A 1SKWA 1VQMS 5B08A 2KZMA 5GAEU 2QLWA 3D1QA 2LQ5A 4YY3F 2GNKA 3I56S 1JNZB 5D6GA 1V6HA 2ZHAA 5KFIA 2I8EA 1S6OA 1IKYA 1R3NA 3M6WA 2CPDA 4NA3A 3M2UB 3FDSA 4NYPA 1UVJA 5FLXY 1ZBTA 1S1UB 4JI6F 3SCIE 2ZE2A 2YKNA 1FRJA 4DV4F 3D1HA 5F8MA 3E01B 3KLEA 3UNGC 1Y5NB 5EWGA 4FF3A 4LSLB 1S76D 4IG0A 3MTKA 2GGPB 3CC4S 4IFYB 1CPZA 4Q8FA 2AYGA 4KFBA 1FF2A 1RISA 2GX8A 2G9OA 2MKHA 3UCZP 3NS5A 4B08A 3UPFA 4AQYF 1NKBA 3MEDB 4IR1A 3PRDA 3EUNA 3VAIA 4EGLA 2EVZA 1SUQB 2JOQA 2QLXA 3M30A 3ENVA 3U1LA 4RKUC 1UVIA 4WZQA 4I7FA 4TYAA 4ZPDA 2HG4A 3TVZA 3Q22A 5L1KA 1S10A 4DSLA 3K7RA 2J5AA 4IH7A 4C0HA 5KOWA 1S6PB 1MMDA 3US5A 3R3TA 3M8QA 1LQ9A 1JNRB 5DDQC 4LFCF 3T9ZA 2IVYA 2FHOB 4CO1A 2C2RA 4DSKA 2W4PA 3VR1A 2VL1A 2IHR1 4DQPA 1I1GA 1N5YB 1CSJA 1KQSR 3KLHA 2YNIA 3DM2B 1DZ5A 2M88A 1KNZA 3PXGa 1HMVB 3K59A 1YG0A 3O44A 2CJBA 2CG4A 2J6TA 1PILA 2HHQA 3LP1B 1QSYA 1L5UA 4M63A 2HWHA 1JKHB 1Q79A 3ISZA 3PIOQ 1VLYA 1FVSA 3E01A 3KLEB 1VS3A 3GWCA 3I4HX 3UR3C 4ZKAA 3OHAA 1CQNA 3RBEA 2UU9F 2IM0A 3O3LA 4BS2A 2K3IA 4I68A 3BR8A 2ZD1A 2OPQB 2UVUA 2DK2A 5C42B 4F3QA 1MWZA 5AE1A 2MZ1A 4WTYA 4C8YA 2RF2B 5C5JA 1RT2B 1T95A 4IQXA 2WHOA 1JLEA 3KHHA 5A0YA 7FD1A 4KV8B 3LWLA 1JMTA 2R2UA 1JLQA 3CULA 2O3DA 5B09A 3THVA 1WEXA 1CEZA 3JYTB 4IG3B 3Q8QB 4QU7A 3NKYA 2WW8A 1ZTTA 5I3QA 5LL6d 4ZPTR 5AE2A 5LSOA 1GH8A 1U6BA 1WWHA 1VJWA 3GG1A 1AW0A 4ED7A 1D3WA 1T8EA 3LP2B 2HNZA 3FZ2A 3F44A 5M2PA 4CNZA 3HZEA 3IAM9 1A7GE 1TR0A 2OD6A 2EK6A 4YR0A 3T9NA 2W8KA 2GHWA 4WE1A 2ZH1A 2R7QA 1E6YB 4O3QA 3TANA 2V8HA 4MFBA 2FJDB 4KGMA 3CJ0A 1KC8T 3LP1A 4O4GA 4N8OA 1ZM2A 2DO4A