1RT1B

Crystal structure of hiv-1 reverse transcriptase complexed with mkc-442
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
435
structure length
415
Chain Sequence
ETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Nucleotidyltransferase
molecule keywords HIV-1 REVERSE TRANSCRIPTASE
publication title Complexes of HIV-1 reverse transcriptase with inhibitors of the HEPT series reveal conformational changes relevant to the design of potent non-nucleoside inhibitors.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 116
structure length 415
sequence length 435
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1996-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1rt1B01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rt1B04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rt1B02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rt1B03
3Q8PB 3KJVB 2IAJB 1KHWA 4ED6A 4H4OA 2BANB 3MECB 5KG2A 1S97A 4WFXA 3NMAA 3M9OB 2ZKUA 2WRMA 2BR0A 5HROA 2IM1A 4Q0BB 3KJVA 2D3ZA 4O3QA 3TVKA 3Q8QB 5DG8A 2BANA 3MECA 5CYMB 5KG3A 5KFUA 5EWFA 2C2RA 4DL7A 4Q8FA 2D7SA 1RT4B 4NLSA 3BREA 3VQSA 1CSJA 2GC8A 3UPFA 2AU0A 3HVWA 4ECVA 4R8UB 4RW7B 4Q0BA 1JLQA 3JYTB 5KT5A 4O3RA 3KLGB 5CYMA 3V6KA 4HYKA 4Q45A 3CIZA 1ZTWA 4NYZA 1RT4A 1LW0A 3OLAA 2JEJA 1S1UA 3BGRB 5JUMA 4QWDA 3NKYA 4RW7A 2XC9A 3JYTA 3C6UA 4R0EA 5KFIA 4DEZA 3KLGA 2UUTA 3NL0A 3TQ1A 2B5JB 3MEGB 1N5YB 3LAMA 2FJWA 2O5DA 5L1JA 4NLDA 1C1BB 3MEEB 4ED0A 2JEGA 4DL2A 1RDRA 4NLVA 4RU9A 3G6VA 5L1KA 4ZHRB 5D3GA 2CJQA 4J9QA 3KLHA 4Y34A 4ECTA 2V4QA 4R5PB 2B5JA 3MEGA 1N5YA 4ED3A 3MEEA 4WYLA 4IG3A 5C42B 3KK3B 5DGBA 3IRXA 1SV5B 5KG4A 4J9NA 4IH6A 1HMVB 5KFLA 5KFEA 3M9NB 3CJ5A 5KFFA 3GV7B 5KFTA 3DOLB 4M94A 5L9XA 1S9FA 5HP1A 2YNGA 2ASLA 5C42A 4ZP6A 1SV5A 1S0NA 1JX4A 2IBKA 1HMVA 1UWBB 3QZ7A 3DM2B 3QGHA 2IA6A 1VRUA 3KMSA 1GX6A 3PJWA 3CDWA 4IQXA 1N48A 4JV0A 2FVSA 4H4MB 3KLIB 3DM2A 1KLMB 1TL1B 4ZPDA 3GV5B 4X2BA 4B3OB 1SUQB 2WK4A 2WTFA 3MR2A 5EWEA 1S1XA 2R2SA 1HNVB 3H59A 1HARA 4MK8A 2UUWA 5F9LA 4H4MA 4O4GB 3OHAA 1KLMA 1TL1A 4LQ9A 4B3OA 4KSEB 1SUQA 4RW9A 2FVCA 4NLRA 2VG5B 3RAQA 2IMWP 3OL7A 1S9EB 1HNVA 5KFCA 4EYHB 4EEYA 4O4GA 3IS9B 5KG7A 3RBEA 1S1WA 3GYNA 4ZPCA 2R2RA 2VG5A 3PHEA 4TXSA 2J6TA 3H5SA 1S9EA 4Y2AA 4ECYA 1S1TB 3C6TB 3ITHA 3FFIB 4RW8B 3H98A 4O44B 2HWIA 3IS9A 4KB7A 4WFYA 3CDUA 2HNDA 1ZETA 4Y3CA 5C24B 4JV1A 1S1TA 3C6TA 1J5OB 3FFIA 4RW8A 5KFKA 4O44A 4TQSA 3H4DA 1QUVA 4YQWA 4NLGA 2JEIA 4PWDB 1RYSA 4MK7A 3M8PB 5C24A 2AX1A 1J5OA 3CO9A 4MIAA 4TYAA 5I42A 2AX0A 1TKTB 3T5JA 5KFJA 1I6JA 1JLAA 1YVFA 5F8IA 3LP1B 2HNZB 4PWDA 5KFZA 4EO6A 4NLWA 2OPSB 4DL6A 4RUCA 2UVVA 5KG6A 3N6MA 4YR0A 4K4TA 4K4ZA 2B6AA 2R2UA 4DG1B 5HLFB 1S0MA 3LP1A 2HNZA 3SFGA 2R8JA 1S9GB 2OPSA 4IOBA 3V6JA 2UVUA 1HYSB 1VRTB 2CKWA 4YR3A 4LSLB 2HWHA 5HLFA 4ICLB 2FJVA 3GQCA 2DPJA 4I7FB 1S9GA 1DTQB 3RBDA 1RT1B 3PW2A 2UVWA 5J2NB 1VRTA 1HYSA 5L1LA 2R8HA 1IKYA 4H4OB 4LSLA 4ID5B 1R0AB 3EZUA 4I2PB 4ICLA 4O4RA 5K14B 1K1QA 1BQMB 4I7FA 3UQSA 4U6PA 1RT1A 4DL5A 1RT3B 5HROB 5J2NA 3PR4A 4XO0A 4ZP9A 1QE1B 4ID5A 1R0AA 3GIMA 4I2PA 3LP2B 5K14A 4NRUA 3E01B 1BQMA 4TQRA 2FLLA 1RT3A 4URQU 4RNMA 4ECUA 1JLQB 2XGQA 5EWGA 1QE1A 5I3UA 4MIBA 2OH2A 1TV6B 3LP2A 4O3NA 3E01A 4WXOA 4ZVGA 1LW0B 1S1UB 1SH3A 5J2PA 3CDEA 2OPRA 2YNFB 3FQLA 3C6UB 1FK9B 1TV6A 3V6DB 4KHMA 4EBCA 3I5AA 2W9BB 5L1IA 3KNAA 4J9SA 3CVKA 4QW8A 1JLFB 5HBMB 4ZVFA 2YNFA 5D3GB 3G6XA 4K4XA 4J9KA 3KLHB 3T5KA 1FK9A 3V6DA 4NLUA 2WONB 2W9BA 3IG1B 3MEDB 3OSPA 1JLFA 4QWCA 5HBMA 3GIKA 4IG3B 4I2QB 4EBDA 3IRXB 4TLRA 1HPZB 4M95A 4K4SA 3GILA 1S4FA 2FJXA 3ICLA 2WONA 3QGIA 4NLOA 4DL4A 2VG7B 3IG1A 1JLGA 3MEDA 2ILYA 3I5BA 3DLKB 4YR2A 2AGOA 5HP1B 2YNGB 3DOKB 5T14A 3T5HA 4O3OA 4I2QA 4KV8A 4TY8B 4YP3A 1HPZA 5KFDA 5KFRA 1JKHB 4J9PA 2VG7A 4J9RA 1VRUB 3DLKA 5KT4A 2ATLA 2FVRA 3DOKA 3BSCA 4TY8A 2ALZA 3Q8SB 3FQKA 4Q43A 1JKHA 1T05B 5F8GA 5DLFA 2R8GA 3QZ8A 3UDLA 4IR1A 3CWJA 3QIPA 2W8KA 3V6HA 3PZPA 1S1XB 4ED2A 2VA3A 1T05A 4TYBA 3PVXA 4QWEA 1WNEA 2QE5A 2I5JA 5KT6A 1N56A 1S6QB 4RW9B 4IFVB 3GIJA 4KBIA 3QO9B 3DLEA 2AGPA 2ZE2A 3DYAB 1REVB 3QYYA 3V4IB 1TQLA 5F9NA 1IKWB 1S48A 5KFYA 1LWCB 4O3PA 1S6QA 1S1WB 5KFXA 2XI3A 2JEFA 4IFVA 4NLYA 5KFWA 1TKZB 3QO9A 4NLPA 2XGPA 3JSMA 3DYAA 1MMLA 1REVA 2BRKA 2JC0A 3PR5B 3ITHB 3V4IA 5KFSA 1IKWA 1OS5A 1NHVA 1LWCA 3KK1B 2D3UA 2W7PA 2RKIB 2HNDB 5C5JA 4ECWA 2YNIB 2E9TA 4NRTA 1TKZA 1ZTTA 2V0NA 3PW5A 3DI6B 3FRZA 2IJFA 2W9AA 1SH2A 3KK1A 1NNDA 1S0OA 1IKVB 1C0UB 2RKIA 5CYQA 3LALA 4XPCA 2YNIA 1D0EA 1RAJA 1C2PA 1Z4UA 2IM0A 5DQHA 4F4ZA 3DI6A 4K50A 2J6UA 1QAJA 2D41A 3TAMB 4U7CA 3MFHA 1N4LA 3OLBA 3ISND 5I42B 3HKWA 1IKVA 1C0UA 5DGAA 3FDSA 4ZPBA 3D5MA 1LWEA 5F8JA 1T94A 1JLAB 4F50A 4G1QB 2IM3A 2XCPA 3TAMA 4WE1B 3QLHA 3M9MB 4PUOB 2JLEA 3M8QB 2IM2A 1RTIB 2B6AB 3MR6A 5C25A 4LQ3A 4G1QA 2C22A 4PQUB 3ISNC 1HQEA 3KHGA 3RB0A 4FBUA 1RT2A 4IRKA 1DTTB 3PW4A 4WE1A 3KOAA 2HNYB 4PUOA 1JLCB 1HQUB 3M8QA 1RTIA 4IRDA 4PQUA 2R8IA 1DTTA 2AGQA 5KFVA 3H2LA 2HNYA 2ILZA 3RB4A 4IR9A 1JLCA 1S1VB 3OL9A 1HQUA 3HVAA 1S10A 1IKYB 2WHOA 3NAIA 4NCGB 4F4YA 3BQ1A 2FVPA 4KO0B 4QWBA 2UVRA 1XR6A 2VG6A 2BRLA 3DMJB 3V81A 1S1VA 5EDWA 4IDKB 4IH5A 1TL3B 4JV2A 4NCGA 5KFOA 4KHRA 1FKPB 3DRSA 2XI2A 4KO0A 4NLQA 1JLEB 3DMJA 2YKNB 4IDKA 5I3UB 4RW4B 4ECRA 1TL3A 4TN2A 4K4YA 3RB3A 4ZPAA 3BSOA 4ZVEA 1FKPA 3LANA 2V9WA 1JLEA 5J2PB 2OPRB 3D28A 3CJ4A 3EPGA 2YKNA 4IH7A 1RA6A 4RW4A 4WYWA 4HKQA 3H5UA 2R8KA 1RT7B 3KHRA 3DRPA 4TY9A 1BQNB 4KFBA 4OL8A 2IJNA 5DQIA 5KFAA 2JC1A 5F8LA 4KE5A 3PW7A 4URSA 1RT7A 3DLGB 1NHUA 1BQNA 4IG0B 4RNOA 1DLOB 1U09A 2BE2A 2ZD1B 4ECXA 4QPXA 2RF2A 2ASJA 3BR9A 1S6PB 1JLGB 3DLGA 4IG0A 4RZRA 2IAJA 3BJYA 1DLOA 3KHHA 2ZD1A 3KMQA 3QGGA 1XR5A 1C0TB 1RA7A 4KV8B 4EO8A 1IM4A 5EUHA 5KFNA 3I0SB 1TVRB 3HHKA 1S6PA 4RUAA 1C0TA 5KT7A 3T1AA 2QV6A 3I0SA 5KT2A 1TVRA 1C1CB 4ZP7A 3KLFB 5KFQA 3KLVA 3BSAA 2OPPB 4R8UA 3QIPB 3Q8RB 2RDIA 1JLBB 4IRCA 2OPQB 4K4VA 4WXWA 1C1CA 4JUZA 3KLFA 3BGRA 3KK2B 2RDJA 4ECSA 2B43A 2BQUA 2OPPA 2WB4A 4NZ0A 2I5JB 4Y2CA 2ASDA 5F8MA 3T5LA 3DLEB 3HVTB 3OSNA 1JLBA 1LWFB 2OPQA 2ZE2B 3G6YA 4Q8EA 5JXSA 1C1BA 2C2EA 1MU2B 3KK2A 5KG1A 4J9LA 4RNNA 4ZHRA 3GIIA 5FDLB 2HAIA 3DRRB 3SI8A 4QWAA 3CJ3A 3HVTA 5F8HA 1LWFA 4R5PA 2FLPA 3JSMB 3MTKA 4FS2A 3EPIA 3OL8A 1MU2A 5KG5A 3H40A 1EETB 5DG9A 3KK3A 2J6SA 5FDLA 3DRRA 5KT3A 4QW9A 2AWZA 2WCXA 4GC6A 5J1EB 3KHLA 3DOLA 1EETA 3H4BA 1XR7A 4F4WA 2C2DA 4WFZA 5CYQB 2XCAA 5J2MB 3BQ2A 3RB6A 2DPIA 2E9ZA 5KFBA 1RTHB 3IGNA 4ZVHA 1UWBA 4ED7A 4IFYB 5J1EA 1N6QB 2IC3B 5J2QB 1JXLA 5F8NA 5J2MA 1D1UA 1LWEB 4RW6B 3MFIA 2GIRA 1IKXB 1RTHA 3NBPB 2I1RA 3NGDA 3NAHA 3KLIA 4IFYA 1LW2B 1N6QA 2IC3A 3LP0B 3QLHB 5DLGA 5J2QA 3UR0A 2BQ3A 1T3NA 1RTDB 3N6NA 3H5XA 1S49A 3E51A 4RW6A 4ED8A 4O3SA 1IKXA 5C25B 3NBPA 4ZP8A 5KFHA 1HQEB 4LSNB 4ZMMA 1RT2B 1LW2A 3DDKA 4MKBA 3H5YA 3LP0A 2VA2A 3IN5A 2AQ4A 1RTDA 3PJXA 1TKXB 3FSIA 1T03B 4EBEA 3I0RB 1RTJB 4LSNA 4XPEA 3PW0A 2W7OA 5KG0A 1W25A 3T19A 1KHVA 4KAIA 1TKXA 2W8LA 1FKOB 1T03A 3LAKA 3I5CA 2EC0A 3BSNA 2XWYA 1GX5A 3I0RA 1RTJA 3IGVA 4MKAA 3MF5A 3OHBA 4ECQA 4MK9A 4EYIB 2VG6B 4GC7A 1SH0A 4FBTA 4K4WA 2W9CB 3V81B 4Q44A 1FKOA 3OL6A 1EP4B 1HNIB 4KKOB 1QAIA 3N6LA 2FVQA 3GV8B 4FS1A 4ECZA 4J9OA 4RNHA 3DRSB 3MR3A 4URGA 1RT6B 5KFPA 3MR5A 2W9CA 1RT5B 3RAXA 4DL3A 1EP4A 4WZQA 1HNIA 3M8PA 4KKOA 2R2TA 4ED1A 4MFBB 4WZMA 1TKTA 1RT6A 2F8EX 4H54A 2GIQA 4K4UA 2YKMB 1RT5A 4MH8A 2YNHB 5KFGA 5KFMA 3G86A 4IKAA 3DRPB 4KFBB 4MFBA 3CJ2A 1K1SA 4RNFA 3CJ0A 2C28A 2HMIB 3QIDA 2YKMA 4NLXA 3BQ0A 4DG1A 3KLEB 2BQRA 2V4RA 4YMEA 2YNHA 1RYRA 4G3IA 5DG7A 2WOMB 3SFUA 5DQGA 2E9RX 2BE2B 2HMIA 4F4XA 1TP7A 2FLNA 3KLEA 4J9MA 2RF2B 1DTQA 1JIHA 2WOMA 4NLTA
chains in the Genus database with same CATH superfamily
4PABA 2PMHA 2HYIB 3A8IA 1I1GA 4ZN1A 3ENVA 2BANA 2MHEA 5CABA 4K8RA 5B0FA 2X1GA 1YLXA 4O3RA 3TUJC 3SYZA 2ADCA 2AEJA 2G0CA 1N5QA 4NXMJ 3R5CA 2V34A 3J80U 3C6UA 4P7TA 5L1JA 4RBVA 4DFPA 4AD6A 2XMVA 4Y2IA 5E3PA 4RL1A 3RBZA 3KUGA 3LA0A 3CCMS 3M2RB 3W1YC 2CQ2A 1CULA 1YJ7A 2G2ZA 2LEPA 3D4JA 1RISA 3HX9A 2JL9A 3MR2A 2UUWA 4K0KF 4B3OA 4ZLPA 2QIFA 4LF5J 1XMQJ 2LP4A 1RUSA 3DNCA 3CNQP 3C6TB 4WFYA 5ITHA 1NK6A 3D1QA 1J5OB 2ZJRQ 5KFKA 2XZDB 1E6YA 1PJ6A 1KOHA 2B3TB 2AX0A 1YTYA 3OFEA 3LP1B 4PG4A 1VQ4S 4RBTA 2P6TA 3GE9A 3V6JA 3TOQA 5ETNA 3EXCX 2DXEA 4LSLB 3SXLA 3D9BA 3GQCA 4I7FB 3EICA 2CAJA 3A8JA 2DNHA 3BO2A 4ZP9A 4W98A 4DUYF 2F1FA 2LQ8A 2AYMA 2WZ1A 4DCJB 3OBIA 2XGQA 1V3ZA 4L3KA 4ANCA 3J7ZT 3JQKA 4NPOA 4WFAQ 3V6DB 2QFIA 3I5AA 2W9BB 2YNFA 4M5IA 3ELHA 2C3YA 1CBKA 3OSPA 1H98A 3LW5C 1G6BA 1K47A 3MM7A 4K4SA 5BR8F 2FJXA 2QLXA 5HQLA 3MEDA 1UPMB 5KFDA 2QA1A 2CQGA 2LXIA 2VG7A 3DLKA 2C42A 3BSCA 2R7TA 2JX2A 2EFOA 3CWJA 3SBMA 2V4JB 5I3QA 2MZQA 3OUYA 3HI9A 1S1WB 2XI3A 2HRYA 3MMAA 3TO8A 1NHVA 2HQIA 4NRTA 3K5PA 3PW5A 2KKHA 1HI0P 1NUEA 9ATCB 2YWGA 1Z4UA 2RKIA 2HZCA 1KQSR 4F4ZA 3RG6A 5F8JA 1JK9B 2Z56B 5AT1B 4ED4A 2XCPA 3MM5A 1NH8A 4WE1B 1S59A 4OHZA 4C0BA 2QL9B 4LFAJ 2M5YA 5HJXA 2KT3A 3DU6A 2B7BB 5ADZA 1OQ3A 2WHOA 2HQCA 3NAIA 4WP3A 5HQ8A 3PG9A 2C1EB 2VG6A 1NSKL 2BRLA 1GEHA 1MMNA 1TL3B 2R3VA 4NLQA 4JI5J 2ROGA 4OZ0A 1RAHB 3CJ4A 2X7IA 2KTQA 4JI6J 3M8RA 1RWWB 3PYFA 1M5SA 4WU2A 2YVSA 1NHUA 3R5AA 1D8YA 4YOEA 4JI0F 3BR9A 4ED5A 1FDNA 4RZRA 1OY9A 3IBCB 2GGPB 1Y3JA 2VOPA 1EHWA 2OPQB 1IXKA 4Z7YA 4Y2CA 2DGVA 2DXDA 3MDFA 1JB0C 3SI8A 3DRRB 4FPIA 2CPYA 1NZ8A 4QPTA 4C3LA 5KG5A 5F3ZA 3M2RA 4JBCA 1TMMA 3JSYA 3H4BA 4Y65A 2UXCJ 5A8KB 1PYOB 2KT2A 3HSJA 3G8TA 2QTWA 3GJSB 3LP0B 1VCTA 1RWNB 1RT2B 2QYGA 2HS4A 2HW3A 1S72S 3JSBA 3GWCA 1TKXA 3LGNA 1VIOA 3CJSA 3GSDA 2XULA 4MK9A 4NXMF 4KKOB 3GV8B 4J9OA 5E3CA 1T9VA 1J2VA 4B3TJ 1K44A 2C2MB 1FXLA 1R7IA 2QN6B 3SQGA 3H42A 2YNHB 5KFMA 1UJ5A 1HIYA 4QCLA 5HMYA 2N82B 3BQ0A 4KQZA 1H3DA 2PI4A 4NA1A 3TQEA 3NEKA 2LYVA 3OFGA 3Q8PB 1YITS 2GZOA 3HULA 2DITA 2IVFB 3KJVA 2OSRA 3Q8QB 2AZ3A 3NMRA 1YK9A 3D7SB 4NLSA 4LF5F 1XMQF 1H74A 2W25A 3ZZYA 2W01A 3I6PA 2P6SA 1OPZA 1ZTWA 3VV2B 3CPWR 1CQNA 1SQEA 3KLGA 2B8QA 3TQ1A 4CLKA 3QNWB 4DLGA 5DRKA 4AXJA 2JEGA 1TTHB 4DL2A 4WIIA 1XMOF 1N5YA 1BMQB 1GMUA 4J9NA 1HMVB 2Y8WA 4ELVA 3VGSA 3PX0A 1H7WA 3HHNB 3J7Z5 4JV0A 3KLIB 3CCZA 2Y1RI 2WVEA 1WHWA 1DY3A 1TL1A 4LQ9A 4NLRA 1RAGB 1HNVA 4EYHB 1Y5LB 1S1WA 4DSKA 4KB7A 2VDIA 4DFKA 5C24B 2DGTA 2B9EA 2OI2A 2QLWA 5K8MA 3JS9A 3W63A 4MIAA 1Q7YT 2HNZB 5KFZA 2LQBA 1U4BA 2MPUA 5HLFB 3CD6S 2Q6BA 4CIOA 3W2WB 4FXVA 2CKWA 1NDLA 3FBFA 4NXNF 1IWGA 2F3JA 3MM9B 2R8HA 2A6MA 3ETOA 1AZSA 3TUZC 2YWEA 1FCAA 2FZKB 2ATCB 4WXOA 3L95X 2IMOA 1W7WA 1TV6A 3WC2A 3HSDA 3SQOP 1FNMA 1P8GA 4FKXA 3GIKA 2XO7A 4ID8A 3RYLA 2NXJA 3GILA 3DLBA 2GAHC 5HP1B 4CM0A 3HD2A 4J9PA 4LFAF 2GGPA 4DFMA 2QYCA 2B9WA 3AY0A 2MLZA 4ZLJA 2I0XA 3CGIA 1GFWB 2DNRA 3OD2A 4I56A 3NNAA 1S6QB 1REVB 2CG4A 1WG4A 1VGYA 1BQXA 3R3TA 3DYAA 5IT0A 2X3GA 1FFSB 1BE4A 2W7PA 2HNDB 2SXLA 4ECWA 1PSDA 5HMWA 2W2OP 3P4UB 5F9LA 4JI6F 4CO3A 3MFHA 1FE4A 4NE9C 2IM3A 1ZA1B 3BO3A 2GMLA 3ISNC 2MGZB 1RT2A 4LR7A 2HNYB 1FKAF 3KUHA 3ADAC 1X4CA 5DM7Q 2XB2D 4OYAA 1S10A 2DVIA 1PC5A 2L9WA 3I9ZA 2HVDA 3TJ9A 2OEJA 5JVGQ 4DR3F 4KO0A 4EWTA 2FHKA 2OEKA 1GNKA 1WC0A 4RBUA 2E7XA 1FWKA 5K20B 3KHRA 2HFUA 4URSA 4DR4J 2D69A 3AA8A 1HBUB 3EXYA 4DN9A 5C7PA 3VVUA 2ZM6J 3F0NA 3HHKA 4N8OA 2OGUA 3DC2A 2QMWA 1AYEA 1C1CB 4UOHA 3KLVA 2KVIA 3CULA 1NLKL 2BJ7A 6AT1B 3MOZA 1KC8T 2KM8C 3TA0A 1LOUA 3OSNA 2PC6A 4RNNA 4NA2A 2HAIA 3HVTA 5B0GA 3PV8A 3MTKA 3ZZ0A 4L3NA 2H4WB 5ETRA 2HFSA 4KTQA 1LKZA 1S4EA 4F25A 1WDTA 2J8SA 3TZWA 3G82B 4WP8A 1BWVA 4YHHJ 3W2VB 1QSYA 3MFIA 1NSQA 2DRBA 3KLIA 4LBPA 2IC3A 3CC4S 4W4MA 4O3SA 2DNYA 4AQYJ 5I4MA 1LW2A 4MKBA 2ZH1A 2DXFA 4EBEA 4ZN3A 2BOAA 4RKUC 3LAKA 3D3BJ 2XWYA 3I0RA 5A8WA 2LFVA 3MAHA 3CMAS 1WC6A 3N4WA 2M7SA 4QR2A 2YH1A 2K7JA 1RWPB 4L6V3 3SV3A 2AYEA 4DL3A 2MY7A 4HVZA 1DQ8A 3M2UA 4FF1A 3GTYX 2F8EX 4K4UA 3J81Y 2DIUA 2CPZA 5H9FJ 2A6OA 2U2FA 1UFLA 2RF2B 1Q8LA 3AXKA 4X4OA 3MM9A 2J76E 4KT0C 1S97A 2O67A 4O0NA 2V68A 2BR0A 2DH8A 5DG8A 5EWFA 5KG3A 1DZ5A 4DL7A 4ATNA 3CCUS 3CJ8A 3KNGA 3PFEA 3V6KA 2WBRA 1JJ2R 1X9SA 1RTZA 1ITPA 3RU0A 1XBWA 3WDOA 4W92B 3BEGB 2WW8A 2V9KA 1GMWA 4IH6A 3QT6A 5T7LB 2G2OA 1S7IA 1TU0B 5HP1A 3H8YA 3KG4A 3UI3A 4C0OC 1JX4A 5AXKA 3GJTB 3SCJE 3L7OA 8AT1B 4K5RA 3VGVA 3GG1A 2QEXS 1UVJA 4OLPA 5EWEA 1WC5A 1S5ZA 2WVCA 3IAS9 1HNXJ 4DV4J 3PIOQ 2CIMA 4RW8B 1E6VB 4JI2J 1NPKA 2HNDA 4CLLA 4Z37A 1N52B 3B82A 4USMA 1YGYA 4C3KA 1WKKA 2DNPA 1UETA 5H9EK 4NL5A 3CO9A 4NMLA 3T5JA 2J0SD 2FZCB 3FC9A 1FO1A 4ZVQB 3N6MA 3U1MA 4CLZA 1PGZA 2EEYA 3AFGA 1U1OA 4PQAA 2JWNA 2I8EA 3M30A 3MWBA 4JI3J 2KVQE 3B8HA 4UY8T 4A8MP 4U95A 2QLBB 2ZBRA 1V9OA 3P3DA 1HYSA 1VRTA 3EGZA 1H2VZ 4KPYA 3EJMA 1R0AA 4QYZK 1DAXA 1P27B 2BKNA 2NZCA 3QJJA 4MIBA 1GAOA 2QA4S 4DV6J 3E01A 3I32A 1NJYA 2RQMA 2MB0B 1EAYC 1FK9B 1U2CA 3MCOA 4QW8A 5HBMB 1F60B 3T9NA 2VKZG 3EGWB 4QWCA 4X4SA 4TLRA 2CQ1A 4CT9A 3VAHA 1EZZB 4WF9Q 4J9RA 5CCLA 4TY8A 1RCXB 4Q43A 4I6WA 2JH3A 2JDJA 1KBRA 3R7SB 1J27A 2JLGA 5DDQC 2HVEA 2HHSA 1IKWB 1VI7A 1U1MA 2MQ8A 4B9VA 3AA9A 3PR5B 4OMFG 2IDEA 2HK2A 2NUUG 2VPWB 2J6UA 4OFZA 4IUFA 3SSRA 2DNGA 1RU2A 2K7KA 4DR4F 2ZWOA 4RLEA 4WK1A 1RTIB 4LIWA 1D8ZA 4IRKA 4ES1A 2QLJB 2VFUA 1JLCB 5AXNA 1FRJA 3HCXA 4PQUA 4BDPA 2ILZA 4HACB 1U1LA 4NCGB 3HZGA 4P9SA 5IM0B 2R7VA 3EDRB 1NO8A 3BBBA 2HQGA 4IDKA 3KTQA 1AT1B 4I68A 3LANA 2KZMA 2OPRB 2YKNA 4DV0J 4YDDB 2MQMA 4C7QA 4Y6IA 2MZJA 3PW7A 2BJEA 4YHHF 1U09A 3PRVA 2RF2A 3IRWP 1TK8A 5EUHA 1ULRA 4AQYF 3UDCA 1LWXA 2HVZA 4L72B 5JJBA 1R89A 2CJAA 2QL7B 3JAMY 1MROA 3MPVA 1F9HA 3AXMA 6FDRA 5D8HB 2VODA 1D9DA 1JLBA 5DJBA 4LF6J 2Q66A 2J6SA 2K1RB 3WC0A 2RQKA 3TZZA 5J2QB 4EFAC 3QRPA 2I1RA 4KJIA 2DISA 5DLGA 1HW8A 3HSZA 4LFBJ 2P9GA 3GYXB 3DDKA 3H5YA 1T03B 3THPA 1KSPA 2W7OA 2MKJA 2ROEA 4RX6A 4KAIA 2OUGA 1R8AA 3MZIA 4KR0B 3HPOA 4QOTA 3K59A 4URGA 3QT8A 2P8IA 1RT6B 3MR5A 3KKFA 1AROP 3VCDA 4GVBA 4X62J 1ICEB 4WZMA 4M1KA 4JV5J 5HSPA 2G0IA 2I2YA 1B99A 3G86A 3T3FA 4O23A 3UDVA 3HZEA 1K1SA 2IFXA 4YMEA 1KD1T 1NDCA 4QIEA 2HMIA 3QRQA 2PD1A 1JIHA 2IAJB 5ETMA 5AE2A 4WFXA 3M9OB 4TVAB 3OR1B 3UE2A 4LRAA 1HNXF 3CIZA 3GG0A 4USWA 3NKYA 2HHTA 2XC9A 5LMNJ 3LPYA 4JI2F 3MEGB 4UY85 1C1BB 1L3KA 2WW4A 4J9QA 1HFEL 3EZ5A 2KH9A 1CG2A 4KGXB 5DGBA 1FF2A 4KH0B 5KFLA 1S9FA 1YJWS 1KP6A 3D66A 4B02A 4ANEA 1NK9A 2V8GA 3KMSA 3N28A 1PIEA 3G96A 1SUQA 1RWXB 3GYNA 4ECYA 5F0WA 4USUA 1UW9A 2A10A 2DGSA 3C19A 3IS9A 2BV3A 1Q8IA 1RB0A 4HH0A 1TAUA 7FDRA 4C8KA 4DQQA 4PWDB 3NOGA 1YJRA 1H7XA 4WWSA 4LMZA 1YVFA 4EO6A 4YR0A 3IC1A 4YR3A 3L7PA 1DJ0A 1DTQB 2VC0A 5J2NB 3VALA 5L39A 1RT1A 2CPDA 2ACMA 2VPXB 1QE1B 3GB0A 3TAPA 1N0VC 5K8PA 2OPRA 2AYBA 2EKNA 4KGVB 1Q8BA 3NGKA 2CQ4A 3UWTA 2XTJP 3QPIA 3RRGA 1JLFA 3UO0A 4UZCA 4P74A 2NS1B 1RK8A 5DO2A 3T5HA 4LF9F 2L9NA 1X5PA 1RLDA 4JI8F 1H73A 2ATLA 5ETOA 1T05B 1Y4ZB 3CEDA 2OJ3A 3BPSP 4LVNP 2RUSA 3MPDA 3TWZA 4N8NA 2Q79A 5IT9U 4KBIA 4DUTA 3ENWA 1TKZB 4O0IA 2BRKA 1MLAA 1LWCA 2R7RA 2DNKA 3DI6B 5ETLA 2M9KA 4DV0F 3ZO7A 4PPZA 1B7FA 2GHVC 3NNHA 1N4LA 2CPFA 4ZPBA 2PEHA 4CO4A 5JVHQ 4LQ3A 1WF0A 1NSAA 3HHLD 1S1VB 3MMJA 3D67A 4UOCA 2GJIA 5A0YB 2XI2A 4P2MA 3CCES 4HR2A 1F2HA 4K4YA 3NCQA 4LF6F 4P6QA 2KO1A 3EPGA 4TY9A 1NK8A 5DQIA 4IG0B 2L41A 2M8HA 2ZC3A 2IAJA 3BJYA 4KY3A 3GP9A 4CH1A 4DOZA 4RUAA 4TU8A 4LFBF 5FLXU 3KLFB 5GAHU 1HWJA 4IRCA 3IP0A 4PYDA 3KFWX 4XTTA 3QSIA 1Y3KA 4Q8EA 1C1BA 3KK2A 2M4MA 4C8ZA 3JSMB 4CO2A 3J80Y 4AYBD 1V3RA 4X62F 4GC6A 5L46A 4JV5F 2RRBA 1BUXA 3Q24A 1R31A 5DDOC 5CYQB 1OSDA 1N6QB 3R1LA 2ZWPA 2KB2A 1U0HB 2HLUA 2GIRA 2MZTA 3NGDA 1KTVA 4IFYA 5E3AA 1S49A 3HHEA 4ZP8A 1FJGJ 4CQ1A 3ZZTA 3G9CA 4P75A 2QC3A 4ZA1A 2BEFA 1S6UA 5LMNF 1HHQA 4DQSA 2XHWA 3J7YI 3ZTOA 1GH8A 4MFBB 2IPOB 4PG6A 4IKAA 2JOQA 4G3IA 4WPAA 3SCIE 1LNQA 4F0MA 4PG5A 2BE2B 1KONA 2UZAA 5DDRC 1DTQA 2ASLA 2J9DE 4WK3A 2PFDA 1K0TA 2CZ9A 2DR6A 4QIFA 4CLUA 2CVIA 3PYDA 1M5VC 1JXVA 4YEAA 4R8UB 5CYMA 1ACMB 3I9V9 4A8OA 1CJTA 4XDCA 1T9YA 2BXJA 2FJWA 2O5DA 2JSXA 1TR0A 4Y34A 1C4CA 2B5JA 2D1CA 3W9HA 4WYLA 1S99A 1L3VA 2HZVA 1FESA 3LWLA 3X3UA 5L9XA 4DSJA 3HVRA 2Z30B 4N7TA 4EMDA 3CDWA 2FVSA 1G2EA 4GO5X 4CDIA 3N0VA 4UUWA 2BA9A 2FVCA 2VG5B 4HTIA 3EVOA 2J6TA 2RDDA 3H98A 4DV3F 1S1TA 2RE1A 2E5GA 3I55S 1QUVA 3MAAB 2KL8A 2W24A 3FKBA 3I56S 3HP6A 2Y1LB 2UVVA 2MKSA 1WOOA 3L7UA 1JJHA 2YWFA 4MAKA 3R1HA 3FMBA 2D74B 3UN2A 3TUPA 2UVWA 2VH7A 2OKQA 1URRA 2DY9A 5LJ5Y 4ICLA 5K14B 3W61A 1UJ6A 1LK5A 2AT1B 3D6HB 5A0YA 1IBLF 4DI6A 5EWGA 2DH7A 3K57A 1A0OB 4ZJOA 1VBZA 4FNHA 4OIXA 3OVSA 1YJ9S 3PYEA 3T41A 3MCNA 3IRXB 2X3DA 4DL4A 3TAQA 2ABYA 2FYXA 2ZNYA 3I5BA 2ZJQQ 5DS7A 4CLYA 4YP3A 2QX0A 1FX2A 2ALZA 1JKHA 2R8GA 5F8GA 4HDHA 1NSPA 4LF1A 2J7UA 4P2FA 3V6HA 2DHSA 3GYGA 2HQ3A 1RAFB 1WNEA 2YQ1A 1U49A 4AL5A 3OTCA 4WFNQ 5E0OA 5D0GA 3JSMA 4NEZA 5CXTA 3AJ2A 4H4KA 4PXDA 2YNIB 2E9TA 2M88A 2QSWA 3VAMA 1YI2S 3KK1A 5CYQA 3W5ZA 2DGOA 4K50A 3TAMB 2DH9A 4USKA 4I6AA 4M5KA 1U0HA 3D5MA 1UCNA 1T94A 1YQHA 2LXFA 3DDIA 1YZ6A 1SIWB 4B9UA 2HQFA 3O6QA 4FBUA 1QTNB 3EVWA 2GO8A 4IRDA 1QAYA 4CLTA 3UDEA 4MYUA 1HL6A 5E41A 3PRBA 1IR0A 2ASYA 1Q8KA 2H5IB 2OMLA 4JV2A 4LF8F 1FKPB 4X64J 2F8MA 5LSRA 1HBMB 4TN2A 2AW0A 5J2PB 4IH7A 3FUYA 2ZH2A 4YDXA 2EKYA 3NXZA 2OP5A 4RR5A 5KFAA 1NKEA 1NKBA 3DLGB 1X5SA 2BE2A 2HGNA 3UCUP 1B3TA 2VQFJ 4X84A 1WI8A 4YB6A 3G4SS 1AFIA 2CNLB 2F4FA 4G65A 2OPPB 4R8UA 3LTOA 4Y2MA 4FYDA 2GJ2A 4OJ3A 2PA3A 1W2BR 2OHDA 4Y2KA 1WTBA 2GO9A 2N3LA 3NWGA 3D1OA 1NDKA 3PDNA 5H9FK 2XCAA 2GVDB 2E9ZA 1HNZJ 2DR5A 5J1EA 4HT5A 3KYLA 1RTDB 4UT4A 1IKXA 5C25B 2VFSA 5I3PA 3CF5Q 4USJC 1VIXA 2XBPA 3EM1A 2DNOA 4DSLA 3B6BA 2MZ1A 4FBTA 3N6LA 5HQMA 4RJVA 4W90B 2R2TA 3MPYA 4OYIA 3TARA 2GIQA 1VR6A 3DRPB 2C28A 2YKMA 5F41A 3MR7A 1U6ZA 1HLWA 2HFOA 2HKEA 2HIQA 2YPYA 2JRSA 1VQSA 1K73T 2ZKUA 4Q0BB 3TVKA 1UEKA 1OMSA 2DT9A 5SZTA 2D7SA 3VZHA 4RW7B 5KT5A 4PAAA 1RT4A 2ZH5A 3JYTA 4FF4A 2V69A 3MEEB 4DPUA 4RU9A 3G6VA 2C3UA 5L1KA 4GKJJ 2MZSA 1PYTA 3IRXA 5GMKa 2M0GB 3CJ5A 5KFFA 2E5JA 5G4DA 2DBBA 3QGHA 1XMBA 5E3RA 1TK5A 2CPIA 3EGVA 2RHSB 1KLMB 4OZJA 2MJNA 2R2SA 4MK8A 4QIGA 3NCRA 3DCAA 3RBEA 4K2JA 4OZ1A 4LREA 3ONQA 2ZZMA 3FFIB 4FYWB 2H48B 1ZETA 4TLQA 3IO1A 2L3MA 1Y11A 2ALYB 3BF4A 2O3DA 1X0PA 4LRBA 2HBQB 1WEYA 2AV5A 2QL5B 4F3MA 1N36J 4Q2LA 4ID5B 4O4RA 3Q2SC 4OX8A 7FD1A 4XO0A 4I2PA 1FDAA 3OTOJ 1TFYA 4C2MA 1RT3A 2NYHA 3DKDA 3MPWA 1HBMA 4O3NA 2EFPA 2HHPA 5J2PA 2UUCJ 2XS2A 4L74A 3DHWC 3H20A 3CVKA 3VAGA 1Y5NB 5D3GB 5CHCB 5IZHA 3IG1B 1XWLA 1G7CB 3DOKB 1K0VA 3M8SA 2RMLA 5KT4A 3M1VA 4DDFA 4I69A 3GIJA 2CVEA 4JI7J 4E0DA 2ZH9A 4OX7A 3TR5A 2JEFA 4X64F 3QO9A 1KQFB 3V4IA 3PX6A 2IYGA 2XNRA 3OV7A 1HWKA 2WVFA 3OXLA 2DCLA 3CCWA 2GVDA 3L4BC 2RB7A 2RS8A 4CH7A 2KU7A 1Z2LA 1WF1A 1Y9OA 2HHUA 3FBCA 4WKRA 4BWJA 5C25A 4P2SA 4QR0A 1DTTB 2ZH3A 2W7AA 1O8BA 4GMKA 1X4DA 4DX7A 2FJDB 1X31C 1TKDA 1A9NB 1SJ3P 3H7HB 4KGZB 2G0JA 4E8UA 5I3UB 4ITSA 2OD4A 1QSSA 4QU6A 4OYWA 3H5UA 3DRPA 2OLWA 2WSCC 2UUAJ 3SV4A 3ZZRA 1RT7A 1HNZF 1SC4B 2HHHJ 3LUYA 4ZCMA 4CZCA 5KFNA 3DRXA 4UQGA 1C0TA 2EPIA 2GQ2A 1FNXH 4AUKA 4K4VA 2B43A 3FSXA 5EGYA 4U7UK 4QIVA 1XN9A 2YTCA 3CJ3A 1N8RT 1CJKB 3I87A 1U8WA 3KHLA 4X4VA 3CJQA 2QMUB 5KFBA 3GMGA 2HK3A 4J5OA 5IFMA 1JXLA 5C2CA 3TA2A 1UWAA 3UR0A 3E3XA 3N6NA 4X4NA 3FNNA 3GFHA 2Y0SD 4K59A 3UD3P 1CJUA 1FNOA 1PKUA 4DV1F 4OI2A 3VAJA 2RAQA 3QBCA 4MKAA 3RGIA 2W9CB 1HNIB 4B9MA 2XY7A 2FVQA 5E3QA 1IQZA 2PA8D 3OJUA 2HIYA 4GKJF 3SIPB 1IBCB 5AXMA 3CJ2A 4PXCA 3POTA 3W9IA 3SMZA 4C98A 5DQGA 4DZ6A 1FE0A 1R8HA 3AJDA 3C2PA 4FYYB 2BANB 3AODA 1R3NA 2Q6CA 1NBEB 2D3ZA 1FXRA 5M2RA 3RRHA 2YWKA 4ECVA 2PE8A 4A8KA 3ZTQA 2PI5A 3C16A 3OLAA 2JEJA 3BGFA 2KRRA 4ZPWR 2C2NA 3GLJA 4N76A 4R0EA 4DEZA 3LAMA 4ZCLA 5FIIA 4B3SJ 5D3GA 3DOMA 3HHLA 4OI0A 1RWVB 3CD0A 4FXDA 3KK3B 1CULB 1N54B 4JI4J 2BKOA 3G6ES 4ZP6A 5IV3A 3AOCA 4F67A 5HL7Q 3DM2A 3B54A 1N36F 4B3OB 4QYZJ 1T3OA 1HARA 4RU2A 3OHAA 5GAHI 3ZC4A 2ACYA 3RAQA 2IMWP 5A76A 2BE7D 3OTOF 2Y3YA 2HHVA 2FPHX 1SKRA 1E6YB 3HO1A 4O44A 1U1KA 2UUCF 3RW6A 2F8HA 2DIVA 1GXUA 3IR6B 1N5VA 5B0EA 1FI4A 2BJ1A 1TMJA 1CJVA 2R2UA 3ET6B 2OPSA 3BN4A 2LCWA 3ENQA 1FRXA 2XS7A 4S0MA 5EN1A 1RAIB 5L1LA 4C0HA 1EX8A 1RWUA 1YWXA 2HSEB 4TQRA 1FEEA 1UJ4A 4JI7F 3ZZZA 5I3UA 2EK6A 2HZAA 2KXNB 2YNFB 3HD1A 3HXMA 2L48A 3HMJG 2Z58B 4KHMA 5L1IA 2CQDA 2HPUA 2RNEA 3MOJB 3G6XA 1CEZA 3MM7B 2YKQA 4CT8A 3MEDB 3KJQB 1GT8A 3BH6B 4IG3B 2WONA 2VG7B 3HF5A 1R6VA 3DLKB 2CUYA 4V19X 2CA9A 4BCAA 2FVRA 3H25A 2ZVIA 3FVYA 3UDLA 2W8KA 2IRXA 1S1XB 4HLBA 1EIYB 4PWUA 4TYBA 3PVXA 2G4BA 4WBFA 2VV5A 1CPZA 1RBAA 3MMAB 4OV6A 4HDGA 4UOGA 1S48A 4OZLA 4IFVA 4NLYA 2UXBF 2D3UA 2RKIB 5K8NA 1Q4RA 4ZVSB 4JI0J 3W62A 1UVMA 3MM5B 1QAJA 2D41A 2UUAF 4NOHA 2R7WA 4B9TA 3LH2S 2HHHF 2KXHA 3QWUA 3R6GB 3M05A 1N88A 3MR6A 2C22A 2CPJA 3OR2B 4PUOA 2J9CA 3P96A 3NY0A 2ZHOA 2DHHA 4UQTA 1HHTP 1S0VA 5AXLA 2ZH6A 4DFJA 4LJMA 2ZUGA 3L09A 1JLEA 3D28A 4RW4A 1HQ2A 2XMMA 2R8KA 1TUWA 4M5NA 2JC1A 1X5TA 4RNOA 1LK7A 3ZXWA 3I96A 3S6EA 5LXRA 1DLOA 2ZD1A 1HKAA 3BYPA 1QDUB 1BD6A 3EVMA 3QT5A 3OTEA 1S6PA 3D0IE 4PZVA 5GMEA 2HQDA 2QV6A 2ZITA 4NCBA 4F02A 3OVAA 1VQPS 2RILA 4OI1A 2RDIA 3PCOB 4NWBA 4ECSA 2OFHX 3FEXB 3AOAA 2C3MA 1SBRA 4DQRA 5A8RB 3NCPA 3QFHA 2VL1A 3KK3A 3M6XA 5DDPC 3JTNA 2B7CB 5DZ6A 4ZDNA 3IGNA 3QJLA 2RQCA 5J2MA 1RTHA 4A48A 2BQ3A 2VBXA 3H5XA 4RW6A 1VOMA 1KQKA 1X5OA 2VA2A 2VD3A 4BHQA 5MAOA 1TKXB 3FSIA 2IHR1 5B0DA 4LSNA 2Y1JA 4CI0B 1KHVA 5D4OA 2EC0A 4F0HA 1RTJA 1O5JA 1XMOJ 1M5KC 2KG1A 1F6TA 1WSVA 1SKWA 2LU1A 3SQGB 4B3SF 3S7RA 3MURP 2H51B 3MPUB 1D09B 1KLNA 5ETQA 1ZZFA 4KFBB 1RXOB 2AJ2A 4NLXA 4JI4F 3ET6A 3ISZA 1TP7A 4MT1A 2KYXA 3PO4A 3KJVB 4A4JA 4ED6A 2FUG9 3CT9A 2A3JA 4O3QA 1VQ6S 3TNVA 3P6YC 1UKUA 1CSJA 1RHJB 1TZ0A 2IVMA 3HVWA 3O5TB 2AU0A 2YWWA 4F3QA 3KLGB 1XNQF 1XTZA 1EQMA 4P10A 2FQQB 4ZCKA 1N5YB 5CA5A 3PJ9A 4LF4J 4ZHRB 3AB2B 5GAEU 2DNZA 1VMBA 3O44A 4HI1A 4IG3A 4N5SA 1KRPA 2R42A 1MN9A 3M9NB 3DU5A 5C42A 4NXNJ 2EVZA 4X4QA 2XSJB 2BJ3A 1Q0NA 1N48A 3GV5B 1TL1B 4AE5A 2WTFA 4X4TA 4MKYA 1S1XA 1HNVB 4OX9J 2DRAA 1UEUA 1WUUA 4X66J 1VQ9S 3QT7A 3AT1B 1OJ4A 4TXSA 1S9EA 4A8YA 5IT9Y 1T9TA 2C2ZB 1Q53A 1V5VA 4I6YA 3EUNA 4NLGA 2UP1A 1B4SA 1U6BA 1WJ9A 4OZ3A 1B0VA 4FXWA 2UUBJ 2N7YA 2V8VA 2R8JA 3OR2A 4M5MA 2UVUA 3FRYA 2RSQA 5BYQA 1AZSB 2OMOA 3C15A 3LF0A 3EZUA 2QA2A 1K1QA 2NR0A 4EZ9A 3B78A 3NGSA 2G13A 5D0HA 4FPRA 2R4FA 1BQMA 2MQOA 3UFCX 1TV6B 3LP2A 3V4MA 4C8YA 3O3LA 1OY6A 2XS5A 3RW7A 1V6HA 4C8LA 3D6MB 1NXIA 2HHQA 1QVGR 1IM6A 4C97A 1LV5A 4PYAA 2MKYA 2XMKA 3FZ2A 1KOOA 1OPIA 1ZAWA 1SL0A 2PFFB 1A6LA 5LJ3Y 1VLOA 1D9FA 3P45B 2JJ4D 4NZ7A 2CQ3A 4DR3J 3BV8A 3C8YA 2VA3A 3QSYB 3PNIA 5DM6Q 3DYAB 5KFYA 5KTQA 1NRKA 5L9NA 4HI2A 2J7KA 4L75A 5A8RA 3ITHB 1EARA 3SSSA 4WTOB 1S0OA 3HKZD 1VC6A 4XPCA 4DCOB 1B64A 4ZJQA 1T02A 3KG1A 1BLUA 1WOPA 4F3OA 1IWAA 2JLEA 3MUTP 5IV4A 4G1QA 3M8YA 1UEVA 3OT9A 5ETPA 5HVGA 3EDQB 3G8SA 1HWLA 4TU9A 2COLA 3RB4A 2B0GA 4DR2F 2HFVA 5IQ6A 2MQQA 2UVRA 4KO0B 4QWBA 3CDBA 1ROFA 3US5A 1SL1A 1JNRB 1VBKA 2XHCA 1L5UA 3CDAA 2KZZA 2LXUA 4WP9A 2EFQA 3QRRA 4OHXA 4KFBA 4OL8A 4OZNA 3A8KA 2ZH8A 1T9UA 3CJKA 1BQNA 4ECXA 2MJUA 2DHGA 3BH7B 4EO8A 4OI3A 2GFFA 1J5EJ 2FHMA 1RHKB 1TVRA 2MQLA 1AB8A 1KEKA 3Q8RB 4M5DA 4LBIA 2I5JB 3T5LA 3HVTB 4ANDA 2W2QP 5J1PA 2M70A 4ZHRA 4OHWA 4A47A 1LWFA 3THVA 4FS2A 1D3WA 1Y5IB 1U25A 1KR4A 2P5VA 1FFGB 1CLFA 1Q79A 2IC3B 3KDNA 2XSJA 4G1IA 2CPEA 4MJKA 1AXQA 3PO5A 1LW2B 2ZFHA 1JQGA 1T9XA 2APOA 1VQ7S 3NBPA 5T41A 4MMOA 3ZZOA 1JMTA 2AQ4A 2XSFA 3NNCA 4WIQA 1ZM9A 4CRJA 3I0RB 1VQLS 5A8WB 2N4DA 1WC1A 4DV2J 4EYIB 5EHHA 3F44A 3M2UB 4ECZA 1T7PA 2F63A 3VAFA 4LF4F 2DGXA 2DJWA 3VGTA 2F7VA 4MH8A 3C46A 1AA1B 3MM6A 5B0CA 4J91A 2R7QA 1UZDA 3QIDA 1KVJA 2HG4A 4F8RA 3BKTA 4A8XA 2JVOA 3IR7B 4FZVA 1QUPA 4QZVB 4DX5A 5KT7A 2GHWA 3PFOA 2W4DA 3W64A 4GKKF 4OX9F 4A8SA 8RUCA 1RKJA 3MECA 1UTAA 3BREA 3VQSA 4X66F 2B8PA 2EI5A 2R9LA 1GK8A 2DB1A 2J9DA 3RTVA 2H3EB 2VBZA 1RADB 4USVA 1H6KX 4HH1A 4B3RJ 2Z2YB 2B51A 3WIVA 1RDRA 2BM0A 2MKCA 1NPRA 4ED3A 3LO3A 1M1HA 1NJZA 3IWLA 3PM9A 4WJBA 3DOLB 4QQBA 1U1QA 3IXQA 2UUBF 1UWBB 3PJWA 5A6PA 2VDHA 5GMDA 4OQJA 3VVTA 1NM2A 3L9ZA 4WFBQ 4KHPF 1NEEA 1VFJA 3EGNA 3J7YU 3H5SA 3ITHA 1DURA 1RWOB 3CDUA 3GCWP 1FJEB 3M32B 1U1RA 4TYAA 5AJ3J 1YBUA 4D3HA 3M30B 4FN5A 4XK8C 4DQIA 1S0MA 1IBKJ 1TL7A 2MKKA 2MSSA 1HYSB 1VRTB 1UA1A 2E29A 2DPJA 2W4PA 2DR7A 3ZTSA 3GFZA 1VLYA 1R0AB 2XY5A 1X8DA 2B9YA 5HROB 2I9SA 3NS6A 3E01B 3JAMU 1VHIA 1NB7A 3ZFVA 2GVZA 2AF6A 3TX0A 3W5YA 5HANA 3KNAA 3VWSA 4ZKAA 1SKSA 5D4LA 1VQNS 3BKUA 1YRTA 4I2QA 4TY8B 1R8PA 4Z7CA 1TUGB 4ELTA 4B9LA 5D0EA 2ZHBA 4F4AA 1LEOA 3B4DA 4Q5VA 2G1HA 2IYIA 5ETTA 4ED2A 2DO4A 2QE5A 2I5JA 4EK2A 1N56A 2AD9A 1EJ7L 2GV1A 5KFXA 3W65A 1PBAA 2HURA 2FGOA 8ATCB 1P1LA 1U45A 3M8ZA 1U1NA 4ZLNA 4F2SA 1D0EA 2VPYB 2DY1A 2IM0A 2O01C 1C0UA 3SCLE 4OJHA 2H1YA 3M9MB 4C11A 2E1MC 3FCHA 1UZHA 2IM2A 2K2PA 4PQUB 1GXTA 3RB0A 2QG9B 1D9AA 2B4OA 1J5EF 2POKA 1Z2ZA 1HQUA 3ZZPA 2FHJD 1ZOTA 4L73A 3AJ1A 3MUVP 2FVPA 2MKHA 4NZ6A 4IDKB 1L3TA 3VHQA 4Y28C 1B7YB 3DMJA 2YKNB 1VS3A 3RAMA 3RB3A 2IJRA 2LA4A 1U47A 1V3SA 4LVOP 2HVIA 1JJ4A 3W8GA 1QM9A 5BYRA 2UXDJ 3BBCA 5IQQA 2YQ0A 2ZBPA 2PIIA 2OTJS 4E98A 3QGGA 1RA7A 2Z4PA 3WX4A 2HGLA 2KFZA 1MROB 2XZTB 4DBQA 3I0SA 3PHTA 5B08A 2XEXA 2XY6A 1JLBB 4DV2F 3DLLQ 2H9ZA 2IY5B 1EB0A 2ASDA 3PX4A 2HBZB 3T6BA 1BC6A 3OL8A 2CRLA 4MYTA 4CCHA 2XM3A 5FDLA 4DPWA 5KT3A 4UUXA 3Q2TC 1RHRB 3R6LB 1QAXA 3DOLA 1EETA 4ILRA 2FC9A 4ZVHA 1UWBA 4ED7A 1IQTA 3K2YA 1RABB 2VQEF 1D1UA 2V2ZA 3QQCD 3QLHB 1FRIA 4XIUA 1GTEA 5U47A 2H65B 1YRUA 3GR0A 4YUDA 4PR6A 2XYGB 1SC1B 4WTYA 5KG0A 4DMZA 2RT3A 3MF5A 4I4BA 1WOSA 1ZPWX 1FKOA 4GVBB 3M2VA 3TZYA 3MR3A 4B3RF 3UN3A 3M32A 1KN6A 2GAGC 3R5BA 2BM1A 5KFGA 2HMIB 1SCJB 1RYRA 2VOOA 1PBUA 2MXYA 1I94J 4F4XA 3KLEA 1IJFB 1RGVA 2YKPA 2A2DA 1HD0A 5KG2A 3BB5A 4OHVA 5HROA 2XMAA 3V2UC 3OFFA 4BWMA 4H4KC 1WKJA 3Q0AA 1VQ8S 1MW7A 4NYZA 2UUTA 3NL0A 3P8BB 2AKWB 4F4KA 4OX6A 1X4BA 2VU5A 4HHHA 1Q5YA 1FRHA 1QSLA 5AJ3F 3A12A 1HBOA 4IQMA 2FB0A 3NS7B 1RLCL 4IYQA 1SV5A 2DHAA 1Q7LB 1RAEB 1IBKF 3THTA 4ZPVR 2NUHA 2V2QA 1F1BB 4KYZA 1X4AA 4YB7A 3CCLS 1SUQB 1F5BA 2LDYA 2LVWA 4H4MA 3RRKA 1HWUA 3M4XA 2J0QD 3TYTA 2VJUA 1JNZB 4EEYA 4O4GA 1NB2A 3IS9B 1LFPA 5LMUJ 3OXFA 1VQ5S 1Q1KA 2X1AA 2V8PA 5E5NA 1Q82T 4Y3CA 4B3MF 4MTPA 3HSGA 3QWPA 3HFVA 3H4DA 4YQWA 2KYZA 4MK7A 3VR1A 4LF9J 5IOLA 3CCSS 4JI8J 3Q22A 5FD1A 1HI8A 1CVJA 3O2IA 1U0SA 4PXEA 4USTA 2MYFA 1ZAXA 5E7OB 5EX3A 1S9GA 1RT1B 1PJ7A 5J1NA 1CC8A 1XJWB 4AFFA 2RD5C 3UQSA 1XK8A 2CQPA 1O0PA 2N7CA 2Z2ZA 2ZZTA 3GIMA 1YJUA 1DHMA 2V67A 4ZVTB 1HNWJ 7AT1B 2PN6A 2V2VA 4PWWA 2YX4A 5BXIA 2GNKA 1WHXA 1JLFB 4YB5A 4OYZA 4DUZF 3T5KA 3UNGC 4DHVA 5K9FA 2W2NP 3UVJA 2WVDA 4YN3B 1VHFA 2DGUA 3SDEA 1HPZA 5KFRA 1VC0A 1ZZNA 4J7CA 4CO0A 3BZQA 3A4TA 3PZPA 1LFWA 2U1AA 3IBWA 5KT6A 3QAEA 1DBDA 4PG7A 3FMWA 1LWCB 3VF0B 1IR2A 3TRGA 4NLPA 4DR6J 3NLCA 2XGPA 3TANA 4DSEA 2CDRB 3ZNUA 1ZTTA 3D0HE 5GAEI 2ZDPA 2W9AA 1VRQC 4K5SA 2UXDF 1IKVA 5ETVA 4QBUA 3QLHA 2BX6A 4K2XA 4EUVA 3PW4A 4P52A 3HFKA 2ZOMA 3M8QA 2K8GA 3EYZA 2ZOFA 5KOWA 3UR3C 3K17A 3DLHA 1N5SA 2A1BA 4ZPAA 2HHWA 1X9MA 2AMCB 4ILMA 2WVBA 4HKQA 5ETKA 3TZXA 5F8LA 3AB4B 2ASJA 2J5AA 1JLGB 1B70B 2YX1A 1PAEX 1SPBP 4ZJLA 1Q81T 3PACA 1U1PA 2XYPB 4LR9A 2YX7A 3K0JA 2LLZA 4WXWA 1BWEA 4JUZA 2RDJA 3KK2B 2BQUA 2DO0A 4DF4A 2FJAB 2FIUA 3G6YA 5HI7A 1WDDA 3N01A 4DV7J 3X1LB 2Z0GA 4F04B 1MU2A 2RHQB 3CC2S 4ZK7M 1HBNB 3RB6A 4IFYB 1SXLA 2F9DA 3BS9A 3AQOA 2ZJPQ 1I94F 1FX4A 2PMZD 2NCKL 3Q8VA 2ZHAA 4BC7A 1HQEB 3T6JA 3DXBA 1WEXA 5A2QU 2D9OA 5F0UA 4CLSA 1KWMA 1GQEA 1QVFR 3RJMB 1EP4A 2QJ3A 4I67A 2JLFA 4ED1A 3HFZB 4FKYA 4KRWA 1RT5A 1NK4A 1FERA 2AEFA 1FRKA 2V63A 2MLYA 4Q7AA 2FLNA 3G87A 2KXFA 1R8CA 2WOMA 2ZVSA 4DLEA 2JHEA 1TL4A 3NMAA 1G3OA 2HAFA 2WRMA 4D3GA 4CNZA 5CYMB 2VPZB 1AUDA 4DV3J 1CJTB 2DEJA 2D9PA 4QWDA 5LMUF 3AH6A 5KFIA 3VTIA 1FRMA 2B5JB 2RU9A 1SB6A 5D78A 1PG5B 2P9EA 4DPTA 1WKLA 2L9DA 4A8FA 2M2BA 4ER8A 1Q95G 2F4VJ 3OPKA 2P2CB 1SIZA 2XMUA 4DQPA 3SZ2A 4RUBA 2E1AA 2KN4A 1IBLJ 2CQCA 2WSEC 2BE9B 1PCAA 3CC7S 4DR1J 2R2RA 3F73A 1HNWF 4Y2AA 1S1TB 2XZWA 2J7WA 3C6TA 2NSBA 4DXLA 2VHGA 3M8PB 1J5OA 9RUBA 3IBFB 3UCGA 4RUHA 4EZ6A 5KFJA 3GPAA 3HK2A 1P1TA 4K4TA 3LP1A 2BBEA 1T8EA 3WQPA 4ZIVA 3IM8A 4ICLB 2FDNA 3R5GA 2CXEA 4LSLA 3GONA 4I7FA 5B0AA 5BJRA 3PR4A 3BR8A 2FY1A 2FLLA 3Q8UA 4RNMA 5AE1A 1JLQB 2VFRA 2V2KA 1FRLA 5HVFA 4DR6F 3MD3A 2EG1A 2AIRB 3V6DA 4NLUA 3JTOA 2W9BA 1REGX 4C8MA 1X4EA 3U1NA 1S4FA 2VF3A 1OYDA 2EW9A 3QGIA 1RQ0A 1JLGA 2B4PA 1JKHB 1BY9A 2FGCA 4J90A 1WACA 2DR9A 3JTPA 3R9LA 4LF8J 2I6WA 3Q83A 2RIJA 3TUIC 4RW9B 1F9FA 3CD7A 1S79A 2V4JA 2YKOA 1N33J 2F65A 5KFWA 2RQ4A 2FJBB 2J0WA 1NPPA 4DPXA 2QA4G 3KK1B 4USIA 3FRZA 5D4NA 1LQ9A 3NGTA 1ZH5A 1HBNA 2BW2A 1RAJA 4RWXA 4C48A 4NEYA 1RHMB 3ISND 3GJRB 1SQFA 2NXNA 2GHPA 1WHVA 1HQEA 3KOAA 4WE1A 2DNMA 3VAKA 4JOUA 3MMBB 5CCMA 5DETA 4J9UE 2JFDA 3R27A 3D1HA 2H54B 3UD4P 4LFCJ 1W26A 1RKIA 2UV8G 3GU0A 3BQ1A 3GFXA 3G2XA 4AL7A 1OWXA 4DS5A 3HHLC 3PXGa 2GQCA 5KFOA 4KIAA 3D2WA 1TL3A 4DV7F 4ZVEA 2ROPA 2ZH4A 4WYWA 4N47A 4G1PA 2VFVA 3OQ2A 3GCXP 4C4WA 4PKDB 1AFJA 2RRNA 1IM4A 2VONA 2A18A 4CLFA 5B7WA 5KT2A 2ZDOA 3P5TL 3G8QA 2QSFA 3FGVA 3ILIA 3M6VA 1Q86T 2WB4A 2BJ9A 1ZM3A 2OPQA 5BYSA 1H2TZ 1UW4A 3GIIA 4TNOA 3GR1A 3DRRA 1N5TA 2CJYB 5J1EB 4F4WA 4JI5F 1EKRA 1QLNA 4OYXA 4B08A 5A8KA 1IKXB 3NAHA 3M6UA 4M63A 5CZXA 5KFHA 3M6WA 1CS4B 3FCWA 1VQYA 3FK4A 3LP0A 4J37A 3LWMA 3PW0A 2HRUA 2W8LA 3I31A 2ERRA 2JVRA 3IGVA 2AJQA 1QAIA 3DGVA 1FVQA 3K5OA 4MIWA 4KKOA 3M8PA 1DQAA 3J7A1 3S01A 2YKMB 1X7VA 1WELA 2JNJA 5GVQA 2F4VF 2DKOB 2YNHA 5CD4H 1NDPA 4OV1A 2QMXA 4GRSA 4Z2XA 2XNQA 1FWLA 2UXCF 5HJYA 2X51A 1NCLA 4GVLA 5HK4A 1S7HA 2QGFB 4WU3A 4DF8A 1RT4B 5E2QA 2C2KB 2GC8A 3UPFA 3HT0A 1K9MT 1JLQA 3JYTB 4RPFA 2DYAA 2HEKA 4DR1F 2V8HA 4ZVRB 1F9EB 3D3CJ 2PO4A 3UNYA 2CPXA 1R8BA 3QMQA 2BVZA 1FJ7A 4R5PB 2FHJA 1FDBA 1SJQA 4B3TF 2IBKA 1HMVA 3RR7A 4KPCA 2ZBCA 2KHCA 1WC4A 2E1PA 1YG0A 4G6VB 4USHA 2Z57B 3O8WA 3PKYA 3GFYA 4DX8H 4RW9A 3D6TB 1TELA 2C3PA 3VZIA 5FJ4A 1M0SA 2D3O1 3MHYA 2L08A 4JI1J 2PMWA 2WSFC 1VJQA 4DL0C 5C24A 2AX1A 4P72A 4ENOA 3PY8A 2IRUA 4DL6A 2FC8A 3DDNA 4RUCA 5B0BA 5KG6A 3U02A 3FZBA 1AUSL 3ZTRA 2HNZA 2CJXB 2HHXA 3R5JB 2HWHA 3MMBA 5HLFA 4WKYA 3D0GE 3RBDA 3WHIA 3W2WA 1NJWA 2ZZNA 2MEWA 4H4OB 4M5JA 4I2PB 3ETMA 2HVHA 1RT3B 1WD6A 4RWWA 1FHTA 4URQU 4ECUA 3DHXA 3U1LA 1TK0A 1N33F 1ZYQA 1LW0B 1S1UB 3CDEA 1NJIT 4EBCA 1RJJA 2KJWA 1XQIA 1RU1A 3KLHB 2HWTA 2LDIA 5A6WA 3CUNA 3A3OB 4EBDA 4OJ1A 2DNQA 4YR2A 3M1VB 5IWAJ 3FQKA 4IR1A 3W8PA 1SJRA 4LFCF 5H1SV 2HLTA 3QO9B 1ZM2A 3N5BA 3V4IB 1RHUB 1S6QA 2GMHA 4NA3A 1REVA 5KFSA 3CMQA 1HHSA 2V0NA 3MXHP 4YB1P 1KFSA 2FTRA 4E2FB 3LALA 1C2PA 3Q89A 1A7GE 1R6YA 5I42B 3ILOA 3FDSA 1F2GA 5ETSA 4N41A 4OLOA 2B6AB 4NCAA 1KTQA 1CS4A 4DR5J 2NREA 2XQCA 1M5PC 1SC6A 2R8IA 2MGZA 2HNYA 2HBYB 3ILLA 1TL5A 2IBOA 3DLJA 4LRDA 4KGKA 4F26A 4P7VA 4RO0A 4NASA 1RAOA 4KHRA 2MQPA 1BHNA 1SC3B 4V1Ak 1RT7B 2IJNA 2W4CA 2OSQA 4PXBA 5HN0A 3KG0A 1HBUA 1U6FA 1C0TB 4KV8B 4DV1J 3GZ7A 1OY8A 2NZ4A 5KFQA 1Y00A 1Y7PA 3TI0A 3QIPB 4HEA9 1C1CA 2CPHA 2XYHB 4LRCA 3L3CA 4NZ0A 1PAUB 5CQGA 1ZA2B 1ZAVA 2VC1A 4R0JA 1PILA 3NWRA 2X1BA 3BBFA 1SJ1A 1VK3A 1MG7A 3KDOA 5F8HA 3K5LA 2FLPA 4R5PA 4ILLA 1S6OA 1KNZA 2VB6A 3BQ2A 3KUEA 2XLIA 5F8NA 2KHDA 3G82A 3QJPA 2YY3A 3W2VA 1UMJA 4JYAJ 1CJUB 2DNLA 2M52A 2PSZA 2RVJA 3T19A 2ZM6F 3CJTA 3LQVA 3RR8A 3BSNA 5AE3A 1I51B 4Q44A 2GW8A 2CJ9A 4OYOA 3RAXA 4M5HA 4I1TA 3POTB 4HHJA 1HWIA 4AXIA 3BDPA 1S76D 2Y8YA 3CJ0A 5CH7B 1UVIA 3SFUA 2E9RX 3CO0P 5LSLA 3A8EA 2FHOB 4QIWD 4J9MA 3W9JA 4K7QA 5F3TA 4HTJA 4H4OA 3DFEA 4EI2A 4FF2A 2RUGA 1SQGA 4BC9A 4DPYA 3C16B 2CNOB 3W5XA 1X60A 2CZ4A 1OSCA 1LW0A 1S1UA 3BGRB 1UP1A 3DOMB 3HHLB 2XLJA 4LUBA 1F5AA 4NLDA 4DU7A 3RBXA 4CO1A 3JXOA 4JI1F 2MHNA 3KLHA 1LXNA 4OI4A 4ECTA 4NMXA 3PEJA 2RS2A 1DARA 3MGJA 3OTDA 3VAIA 1O51A 1S0NA 3DM2B 1TAQA 3GJQB 5T7LA 1VQKS 2W2MP 2UU9J 5E33A 2CDQA 2YKAA 4C8OA 2VBWA 2Y0BB 2JFKA 4ZPCA 2V8DA 4O44B 2NYIA 2HWIA 5JMNA 2EC2A 4IO1A 4EGLA 4JV1A 4RW8A 1E6VA 2X1FA 1RCOB 3RZAA 4TQSA 1RAAB 2JEIA 2E5HA 2H5EA 3T1HJ 5I42A 1CJVB 1MNEA 1VDHA 2OPSB 2CYYA 2B6AA 1RE1B 3CCRS 4IOBA 3OJSA 4F2RA 5IWAF 4ERDA 5HVHA 3MUMP 2CNKB 3KJNB 1WSRA 4CYUB 1EKSA 3FBEA 2UXBJ 4F36A 4ALZA 3R2DJ 3W66A 2K3IA 2MDAA 2MMYA 1F3FA 1OYEA 3NG8A 4DV4F 5EX0A 4J9SA 1WG1A 5LL6d 1FK9A 2WONB 2C3OA 3B4MA 3K8WA 3WZ0A 5HBMA 4JB8B 2E1CA 1MWYA 4O3OA 4KV8A 1VQMS 2CQBA 2CNNB 1VRUB 1M1GA 4A8QA 4DR5F 1IVZA 1YSJA 3QZ8A 4X65J 3QIPA 1XC9A 2DR8A 2LQ9A 2V5HG 4JI3F 4HL9A 4IFVB 3EX7B 3S1TA 4O3PA 1T11A 1SKUB 2JC0A 4PCQA 4QJVA 1IKWA 2DD8S 2DGWA 4LF2A 2KM8B 1SH2A 3VGUA 4DV6F 1P9QC 4N77A 4DN0A 3HKWA 1JLAB 4F50A 2HFNA 4DCPB 2B4VA 4PUOB 2R7OA 2AJFE 3GIRA 1RTIA 3MCMA 3HHDA 1JLCA 4ZIWA 1IKYB 3OXGA 1RP5A 4HACA 2AHOB 4IH5A 4NCGA 2Z2MA 5IM0A 1JLEB 3UW1A 4RW4B 1MMDA 3HLUA 3BSOA 2DCUB 3QFWA 3OTBA 4J9VA 1Y10A 1FVSA 3SSQA 3PKMA 4HT7A 1X4FA 4KE5A 2F5GA 1YIJS 2EK1A 2YQ3A 1DLOB 2ZD1B 2GIFA 2BYCA 2EFGA 1S6PB 2KDOA 3D6FB 2VICA 3KHHA 4JYAF 4X4UA 3N79A 1UFKA 3AHPA 1K8AT 5LM7E 1KFDA 2RH3A 3A3PB 5CZVA 3BGRA 3MI7X 1FFWB 1VISA 3DLEB 3MAQA 2WBMA 5JXSA 2C2EA 5L38A 5KG1A 4J9LA 5GAGU 4QWAA 4AL6A 3EPIA 1S57A 2AWZA 4BS2A 1KVIA 1IUJA 3CCJS 2DPIA 3TX8A 1T0TV 5J2MB 3I82A 2MSTA 1ZM4A 2K1RA 1RTHB 4OZ5A 2J9EA 3AD7C 1WTFA 2FJEB 1LWEB 4RW6B 5HATA 1WG5A 2LA6A 2DRDA 5J2QA 1QY7A 2NQPA 4LSNB 4ZMMA 2W2PP 3K5MA 1XNQJ 4C8NA 3PJXA 3R2CJ 1RTJB 2AZ1A 3A13A 4XPEA 4CTAB 2CQIA 4C6AA 1T03A 3I5CA 2VUGA 3OHBA 4ECQA 3OW2R 4GC7A 4K4WA 4FS1A 1P9YA 3KWMA 1R0CB 4FYXB 2NXEA 1RT6A 1FD8A 2IVYA 3FEYB 3BYRA 2A0FB 4RNFA 2Z8QA 2OIHA 3HJVA 2BQRA 3NGRA 2N4CA 3ENAA 5GADU 2UU9F 2QLFB 1RI7A 1I5OB 4CYUA 5KFUA 4Q8FA 2KFYA 1DFDA 4A8WA 3OR1A 3H2UB 2IRYA 5G0RB 1RBLA 3NOCA 4NLVA 4L76A 2V4QA 2HFZA 3MEGA 2E7WA 5C42B 1M5OC 2BW7A 2GQQA 3T1HF 4CO5A 5KFEA 3GV7B 5KFTA 4V19J 4U7UD 1F3VA 3QZ7A 5LT5A 1VRUA 2H5JB 3HJFA 4IQXA 4X2BA 2QFJA 2E44A 2QRRA 3QATA 5L8RC 2QO3A 3R7BB 5CYJA 3K8VA 1S9EB 1QD1A 3H2VE 3BGOP 1UPPA 5KG7A 2E7VA 4UW2A 1NKCA 3PHEA 1P6TA 3LPEA 2F40A 4DS4A 3JQJA 3NRBA 2YWHA 1Z1ZA 2E1RA 2LU2A 2K3KA 1R27B 3N5FA 1TKTB 4FF3A 1JLAA 1RWMB 4PWDA 1XNRJ 1HI1A 4EU0A 4K4ZA 2J0XA 3C15B 1QJHA 2LMIA 2KRBA 3TJAA 3CD5A 4U8YA 2ZC4A 2FJVA 4UOFA 3P49B 4X4PA 1IKYA 4X65F 3CB4A 1BQMB 4U6PA 1HD1A 5J2NA 4U96A 3LP2B 4NRUA 2KJVA 3LGHA 1WI6A 3CJRA 1QE1A 2OH2A 5K8OA 3FQLA 4DR7J 4DJBA 5CAAA 4ZVFA 2EXUA 1OO0B 3P5BP 2HS0A 4LT6A 3TVZA 5LSOA 2H4YB 3TP2A 5IT4A 2YNGB 3CCTA 5T14A 4A46A 4DR2J 5KOXA 2OELA 5DLFA 4ZLLA 1T05A 3TW0A 2ZKTA 5KAKA 4C3MA 2AGPA 3DLEA 1KDNA 3QYYA 1MSWD 2CWKA 3DN9A 1NZAA 4DPOA 1FT8A 1TKZA 1H72C 2Z2LA 1YDLA 3DI6A 3E2EA 4U7CA 3OLBA 3AQPA 1LWEA 1FDDA 4G1QB 1SI9A 1HR0J 4ETZA 1HA1A 4P73A 3IA0A 2AGQA 4CTAA 1X4GA 4IR9A 3OL9A 3HVAA 2VKRA 1Y0HA 1NAQA 2C2OB 4ZVPB 5A2QY 1S1VA 3CCVS 2VIHA 5THWA 4ECRA 3Q86A 2V9WA 2KFNA 1UFWA 1U48A 3CJKB 1BQNB 2OFGX 1BXNA 1IJEB 3PRDA 4IG0A 1YBTA 1NK0A 1TVRB 2ZNZA 3CE8A 3W3SA 4M5DB 4ZP7A 1M1KT 2DNNA 4ZCIA 3BSAA 1MWZA 3EMTA 1WC3A 3KLFA 2GJFA 5G0RA 4ELUA 5F8MA 1LWFB 2ZE2B 2R7UA 4F0KA 3IAM9 4Y00A 3I4HX 4KC5A 4PRFA 2HGMA 1Q78A 2FD2A 2FZGB 2DK2A 5B09A 3NGUA 2C2DA 2HBRB 4P71A 2CQ0A 1UL3A 1DQ9A 4GKKJ 3NBPB 1N6QA 3BDEA 2NXCA 3E51A 2IDLA 3E8OA 1AW0A 2MKIA 2AJ4A 4QR1A 4M5LA 2DHXA 3BPDA 1GX5A 3V81B 3BKFA 3UCZP 2VBYA 2EG2A 4WZQA 3MM6B 5K5MA 1TKTA 3FCVA 4UZBA 3TJ8A 4MFBA 4LF7J 1YKWA 3ZZUA 2HS3A 2O66A 2V4RA 5HMXA 4KHPJ 1U26A 4BBYA 3M8WA 2RRAA 2AJ1A 1KHWA 3MECB 3KXDA 4LR8A 4GO7X 2C2RA 2R7SA 1YHQS 2HRTA 4HYKA 4Q45A 1M5HA 2VFTA 1FJGF 3U27A 5JUMA 3R5DA 4LRFA 4LBHA 5HO4A 2G2YA 1N32J 4IOAQ 1WEZA 4PEOA 1QTMA 1U7LA 2PDAA 2AP6A 4DWIA 5SUHA 1X9WA 5DZ7A 4M94A 1XNRF 1IN0A 2YNGA 2DTJA 3UD5A 4DU8A 3DGPB 4KH1B 5MLCV 2B56A 3DXSX 5FLXY 4ZPDA 4DZDA 3D54A 2ZOGA 1WHYA 3H59A 2BMBA 3CCQS 4YS2A 1V5IB 1G4CA 2V50A 2MY8A 2VG5A 3ILJA 3J7AN 3HT3A 3HM9A 3J81U 3AAWB 4DR7F 4IOCQ 4U8VA 1TUVA 3MCSA 1RYSA 2NSCA 1I6JA 1TL7B 3MAAA 2XMWA 3SFGA 2CQHA 2V94A 3ZNJ1 1FTCA 2Y9HA 1ELOA 1H0HB 1WF2A 1RHQB 3PW2A 1L3SA 3G71S 1B0PA 1KS2A 2XWXA 4DL5A 3MD1A 5IS2A 1LXJA 2GVZB 5D77A 5K14A 3U7JA 2V6AA 2BDPA 1PYSB 1DRZA 4R25A 3K7RA 1TFWA 1EQ0A 4J9KA 4B9SA 4MKVA 2MTLA 1PO6A 2QT7A 1U02A 2WAQD 4I2QB 3QAUA 4NLOA 2CJBA 2E5IA 2VASA 1NH7A 1HR0F 3ULHA 3N9UC 1NU4A 1ZBTA 1VBXA 2N3OA 3T1YJ 1IBMJ 1FA0A 4QWEA 1FXDA 2ZE2A 1TQLA 2D3OR 5F9NA 1U2RA 3PTWA 3IWNC 3BGUA 3FBBA 3IR5B 3IFEA 2IJFA 1YZ7A 4OYBA 1C0UB 1UVKA 2YNIA 2XO6A 2YBVA 2W1BA 4C11B 2YH0A 5DGAA 4C9DA 3R97A 1SL2A 3TAMA 4YY3J 1MN7A 3KHGA 2LKZA 3MM8B 1HQUB 3PIPQ 5IXUA 1NMEB 1N34J 5KFVA 3NS5A 4ES2A 2I38A 1XR6A 3DMJB 3V81A 5D4PA 3R8YA 2DEIA 2MLXA 4M8LA 3J81j 3LGMA 2M8DB 3BGLA 1FKPA 2GS8A 2P9CA 4OYMA 5C2GA 1FTRA 4OZ2A 1SJFA 1RA6A 2A2CA 1JWWA 2CADA 2VQEJ 4FP9A 2RJZA 1IR1A 4BLGA 2XLKA 3W60A 1XIQA 1OQ6A 4CM2A 4UTGA 3UN5A 3DLGA 1YJTA 1XR5A 3MMCB 4U67Q 1H38A 3I0SB 3TA1A 4ZVOB 3T1AA 4TU7A 1T95A 2ADBA 1YX2A 2OPPA 1XEZA 2IA0A 1YJVA 4UF4A 2EFVA 2UV8A 3ZTPA 5FDLB 4CP5A 4NI2B 1EETB 5DG9A 3WIUA 4QW9A 2WCXA 4QU7A 3VQTA 1N0UA 3A1YG 4LF7F 3DGPA 2YXLA 4DV5J 3OVBA 1KKHA 1CC7A 3IN5A 4IO9Q 1RTDA 1UVNA 3K89A 2NPFA 1GXLA 2DGQA 1W25A 2VQFF 1G1XA 5D0RA 1FKOB 3M2VB 2NLWA 2BKPA 3OL6A 2PEBA 2CWXA 4RNHA 3DRSB 3SEOA 1N32F 3CIMA 1SVDA 2E5LJ 4CH0S 2XMTA 4FYVB 2M3DA 2K06A 2LECA 3KLEB 1PJ5A 2ZH7A 3IWXA 2ZEJA 1GTHA 2FLOA 2QZ8A 1Q16B 2OO4A 2RU3A 1APSA 2G9OA 2IM1A 3TEGA 3D68A 2AJ0A 4FVMA 4B3MJ 4Q0BA 3C14B 2OAUA 3SCKE 3LOUA 4RW7A 2EBEA 3JSRA 3DRYA 4X4RA 4OHYA 2VZ9A 2GCFA 4ED0A 2CJQA 4CWBA 3QGPA 4ZS6A 1HBOB 3MEEA 1SV5B 3PEHA 5KG4A 2KG0A 4Q2MA 1W2IA 1GMVA 4OI6A 2IA6A 1R0BG 3IM9A 4I64A 1GX6A 3AOBA 1SJ4P 4XAKA 4H4MB 4LIRA 2WK4A 1RACB 3C3LA 4O4GB 1KLMA 4KSEB 1JJCB 3OL7A 1VJWA 5KFCA 2KI2A 3JQMA 3AD9C 3CXCR 1NHKL 4DUZJ 1C4AA 4FNIA 3BM7A 4CLWA 5GAGI 1S77D 3AD8C 4FVCA 3FFIA 4ZOSA 4WCEQ 2LQ5A 3V5RA 5IC4B 3EE3A 4LSZB 5HMZA 1U8SA 5F8IA 2G1DA 4NLWA 3FSYA 2YPZA 1U24A 4XDDA 1X4HA 3WBZA 4DG1B 1S9GB 3A3NB 3MM8A 1YRXA 1FJCA 1CQMA 3H90A 2OTLS 4OJGA 5HAOA 4CLPA 4K0KJ 3T1YF 4ZITA 3F41A 1IBMF 1UVLA 1NK7A 1I3OB 3W7BA 5LOQA 2MQNA 4ID5A 1L3UA 3FJ2A 3CTRA 1Q5VA 4DSFA 3C66A 3TVYA 4ZVGA 5M2PA 1SH3A 1U2FA 3BO4A 1X0FA 3C6UB 5M2UA 2GMJA 3UVJB 5H9EJ 4K4XA 1UAWA 3K58A 2FY8A 4U9RA 4CNYA 2ZBIA 3SDEB 1HPZB 4M95A 3ICLA 2ZBQA 2AGOA 3IG1A 2ILYA 3JB9k 3MMCA 2ZUAA 4DSIA 4YY3F 5GADI 1WWHA 3DOKA 4KGMA 3Q8SB 2EFNA 2Q1LA 2CZVC 4M5GA 3KJFB 4PG8A 3CW2C 1N34F 1NJXA 5D15A 1ZS6A 1VBYA 2EBGA 4DUYJ 3IMQJ 3CSKA 1VYAA 1MMLA 4NI2A 1OS5A 2NXUA 5C5JA 2BACA 1JXEA 3GSIA 1NNDA 1IKVB 5DQHA 3WX8A 2OEMA 3MEKA 2LQJA 1MWQA 1RWKB 5BR8J 1HW9A 1VQOS 2OD6A 3PYGA 2GX8A 3M8QB 1M90T 2EWHA 3BN7A 2E66A 4PPDA 1F5CA 6FD1A 2MZRA 4DX6A 1PC4A 1DTTA 2BZ2A 3H2LA 5D6GA 2LEBA 2Y1IA 4F4YA 1GMWD 2B4UA 5EDWA 2IIHA 3M7VA 2Q43A 4F7VA 3DRSA 3H0PA 3MTJA 3CMES 1F0XA 4B9NA 1YJNS 4JP8A 4NX9A 4B17A 3EZOA 3FEZA 3K5NA 2VJVA 1RZMA 2CFXA 2F9JA 4NYOA 2XG8A 1XERA 4AT1B 1O6XA 1YBAA 4QPXA 4DV5F 3KMQA 1WORA 1RSCA 2CJKA 2BJ8A 2PT0A 2CG8A 1NK5A 2JZ5A 3RUBL 5RUBA 1H2UX 3T9ZA 2WB1D 4ZPTR 4P2XA 2AEMA 4YFUA 3TEHB 3C14A 4I0WA 4QYRA 2J8AA 3OUYB 4NYPA 1MU2B 2LEAA 4HHUA 3R7NB 1KQGB 3H40A 1FWPA 1FEHA 1B0TA 3EWGA 2E5LF 2KT5A 4ZVUB 3O1LA 1CJKA 1XR7A 4WFZA 1VC5A 3I4PA 1R43A 1UA0A 2Q3PA 2PGCA 4FDFA 1VK8A 3OFHA 4Y0FA 1T3NA 2O1PA 3NP5A 4ED8A 4OYPA 2XMJA 2BUNA 3Q23A 2AYGA 1OIAA 1ZPVA 3Q8YA 2GA7A 4TKTA 4ES3A 1T9WA 1URNA 2VG6B 1SH0A 1S12A 1EP4B 3S8SA 2BABA 2BOPA 5KFPA 5CD4A 2W9CA 1RT5B 1BGXT 1HNIA 5LXYA 4ETXA 4H54A 4N56A 3HDSA 3F56A 1RBOB 2BJDA 2R7XA 4DG1A 2NPIA 2B9XA 5DG7A 2WOMB 1KVKA 1FD2A 5IC6B 4NLTA
chains in the Genus database with same CATH topology
2J9DE 4WK3A 3PFOA 5F3TA 2W4DA 1K0TA 4HTJA 4H4OA 2PMHA 3DFEA 2HYIB 4FF2A 2RUGA 4QIFA 4GKKF 2CVIA 1I1GA 4OX9F 4BC9A 4A8SA 3ENVA 1RKJA 2BANA 3MECA 2MHEA 1M5VC 3BREA 3VQSA 4X66F 5B0FA 4YEAA 2EI5A 2X1GA 4R8UB 2R9LA 2CZ4A 4O3RA 1OSCA 3TUJC 5CYMA 3SYZA 2ADCA 2DB1A 2J9DA 2G0CA 1N5QA 1LW0A 3I9V9 3RTVA 1S1UA 3BGRB 4A8OA 4XDCA 3R5CA 1UP1A 2VBZA 3C6UA 3HHLB 2XLJA 1H6KX 4HH1A 2BXJA 4P7TA 4LUBA 2FJWA 2O5DA 2JSXA 1F5AA 2B51A 2XMVA 4NLDA 4RBVA 4DFPA 1RDRA 4CO1A 1TR0A 2MHNA 2BM0A 3KLHA 4Y2IA 4Y34A 1LXNA 1C4CA 2MKCA 4OI4A 5E3PA 4ECTA 2B5JA 2D1CA 3PEJA 4ED3A 2RS2A 3LO3A 4WYLA 1S99A 1L3VA 3CCMS 1NJZA 1DARA 1FESA 3IWLA 3M2RB 3LWLA 3PM9A 3X3UA 3MGJA 4WJBA 3DOLB 4QQBA 5L9XA 3OTDA 4DSJA 2CQ2A 3HVRA 3VAIA 1O51A 1U1QA 3IXQA 1S0NA 2UUBF 2LEPA 1UWBB 3DM2B 1TAQA 5T7LA 1RISA 3PJWA 5A6PA 3HX9A 3CDWA 2JL9A 2FVSA 1VQKS 4OQJA 1G2EA 5E33A 4GO5X 3MR2A 4WFBQ 2UUWA 3N0VA 4K0KF 4KHPF 4UUWA 2BA9A 1NEEA 2CDQA 2YKAA 4B3OA 2FVCA 4ZLPA 1VFJA 2QIFA 2VG5B 4C8OA 2VBWA 4HTIA 3DNCA 3EGNA 2JFKA 4ZPCA 2V8DA 3J7YU 2J6TA 3H5SA 3C6TB 3ITHA 1DURA 3H98A 4O44B 2NYIA 2HWIA 4WFYA 3CDUA 5ITHA 4DV3F 1NK6A 3D1QA 4IO1A 4EGLA 4JV1A 1S1TA 1J5OB 2RE1A 4RW8A 5KFKA 2ZJRQ 1E6VA 2E5GA 2X1FA 3RZAA 1FJEB 3M32B 4TQSA 1QUVA 2E5HA 1E6YA 3I55S 2JEIA 1U1RA 1KOHA 2H5EA 2W24A 4TYAA 2B3TB 5I42A 3I56S 2AX0A 1MNEA 3HP6A 1YTYA 3OFEA 3LP1B 4D3HA 2OPSB 4PG4A 2UVVA 2MKSA 1VQ4S 4RBTA 3M30B 4FN5A 2CYYA 4XK8C 4DQIA 2B6AA 1S0MA 2P6TA 3GE9A 2MKKA 3CCRS 1JJHA 2YWFA 4IOBA 4MAKA 2MSSA 3OJSA 3TOQA 3V6JA 4F2RA 3R1HA 1HYSB 1VRTB 3EXCX 3FMBA 2D74B 5IWAF 4LSLB 1UA1A 4ERDA 2E29A 3SXLA 3GQCA 2DPJA 4I7FB 2W4PA 2DR7A 2UVWA 3MUMP 2VH7A 3GFZA 2OKQA 1URRA 1VLYA 5LJ5Y 1R0AB 4ICLA 5K14B 2XY5A 1X8DA 2B9YA 5HROB 1UJ6A 2DNHA 3BO2A 4ZP9A 1LK5A 4DUYF 2F1FA 2I9SA 3NS6A 3E01B 4ALZA 5A0YA 2AYMA 1IBLF 3OBIA 2XGQA 1NB7A 5EWGA 2K3IA 3ZFVA 2MDAA 1V3ZA 2DH7A 3K57A