1RT1B

Crystal structure of hiv-1 reverse transcriptase complexed with mkc-442
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
435
structure length
415
Chain Sequence
b'ETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 REVERSE TRANSCRIPTASE
publication title Complexes of HIV-1 reverse transcriptase with inhibitors of the HEPT series reveal conformational changes relevant to the design of potent non-nucleoside inhibitors.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Nucleotidyltransferase
total genus 116
structure length 415
sequence length 435
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1996-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1rt1B01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rt1B04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rt1B02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rt1B03
4ZPDA 4MIAA 2BR0A 3IG1B 5KFYA 3KJVA 5CYMB 3C6UB 2OH2A 2FJWA 2W9BB 4RW6A 4O3NA 4PUOA 4K4YA 5KFEA 3BSOA 3PVXA 2UVRA 1T05B 2C28A 5F8IA 1QAJA 3FDSA 3H40A 2HNZA 2FVSA 1R0AA 2HNDB 4WFZA 4TYBA 3BJYA 5KFSA 4KBIA 3MECA 1LWFA 1VRUB 4EO6A 2AQ4A 1JX4A 2IM2A 1XR7A 2AWZA 4K4SA 2BRKA 4PQUB 4IQXA 1K1QA 4NLYA 2HMIB 4QWAA 4DEZA 3H98A 4WYLA 4NLTA 3FQKA 4JV2A 1JLAB 2XWYA 1S1UB 4RU9A 1JLBA 4NLVA 2YNIB 5EDWA 4KO0B 4J9OA 2IM0A 3NGDA 5F8NA 2B43A 4RW8B 2AU0A 5C42B 2IAJB 3M8QB 4RNMA 3G6VA 2AX1A 4WZMA 1HQUA 4H4OA 5L1IA 4ECYA 1JLFA 2B6AB 1WNEA 1XR5A 2WB4A 1N5YB 4R8UB 1REVA 4J9MA 1DLOB 2I5JA 5KG2A 5K14B 4DG1A 1N4LA 3NBPB 4WE1A 5L1LA 3DOKB 5KG5A 1SV5A 5KFCA 4HYKA 1C1BB 2RKIA 4Y3CA 3CJ3A 3QGHA 5FDLB 1BQMA 3G6YA 2ZD1B 3DRPA 5C25A 1S1VA 3H4DA 1S4FA 4ECQA 4IFYB 3DRSA 1C0UA 4IG0A 3BSAA 1S1WA 2OPRA 1S97A 4LQ3A 5HP1B 3DMJB 2HNYA 3ICLA 2XC9A 4RUAA 1MU2B 1IKVB 3BGRB 1S9GB 4MFBB 1TKZA 2OPSA 5HBMA 2RDIA 1RTJA 1D0EA 2E9RX 2IC3A 1RT2A 2R8GA 3OL6A 4RNFA 1JLEB 1RT6B 4RW9B 4ZHRB 3RB4A 3V6HA 4YQWA 4ZVGA 1JLCA 2OPPA 4I2QA 2WK4A 4WYWA 3V4IA 4RNNA 4K4XA 4KB7A 5J2PB 3RAQA 5J2NA 3KLIB 3IRXB 1MMLA 4O44A 5KFIA 3GV7B 5L9XA 1NHUA 3JSMA 2YKNA 3MFIA 4ECUA 3E01B 5J2MB 3Q8QB 2ZKUA 4NLXA 1S0NA 1BQNB 3N6NA 2D3UA 1TP7A 2RF2B 2GIQA 5KT7A 2R8JA 4F50A 1VRTB 3KK2B 3CDUA 3KK1A 2EC0A 3DLKA 3BQ0A 2AGPA 3KHHA 4IR9A 1TKXA 4DL7A 1S9EA 4TY9A 3GQCA 2IJFA 2J6TA 4KSEB 4ZP7A 3C6UA 2BRLA 2YNHB 1T94A 4QWCA 2W9BA 4EBCA 3LP1B 4NZ0A 4YR2A 1RAJA 3M9OB 4NLPA 3LP0B 2BQ3A 2ZE2B 4EYIB 3DRRB 2HNDA 3OL9A 2UUTA 4DL3A 2R8HA 4IFVA 3NAHA 5EWFA 4ED6A 3G86A 3PJWA 3ITHB 4PQUA 3GV5B 3MEEB 1HNIA 3G6XA 2UVWA 4ED2A 2HMIA 4ZVEA 3KLHB 3SFUA 3CJ4A 3OL7A 5DGAA 3JYTB 1JLAA 1FKPB 4NCGB 1IKYB 1DTTB 2YNIA 4KO0A 3KNAA 5KFWA 4LSLB 1DTQB 4RZRA 3H5UA 4NLQA 4RW8A 3LAKA 5C42A 3H5XA 2IAJA 5F8LA 3MR6A 2ASJA 2B6AA 4IH6A 4URGA 3I5CA 3QYYA 3LP2B 4GC6A 3DLGB 1JLGA 1N5YA 4R8UA 3RBDA 3C6TB 2W9CB 5K14A 3NBPA 4G3IA 3DOKA 4B3OB 1C1BA 4KFBB 3NMAA 4ZVHA 4O4RA 2ZD1A 2XCAA 2B5JB 2AGQA 3N6LA 2JEJA 3H59A 1RTIB 3QZ7A 3H2LA 4EYHB 4XO0A 5HLFB 1JXLA 4J9RA 2HWHA 4YMEA 3PW4A 4ID5B 1IKXA 1C0TB 3DMJA 4ICLA 5HP1A 2FJXA 4IH5A 1TL1B 1MU2A 1IKVA 3BGRA 1S9GA 1RT3B 4MFBA 4NLSA 4ECXA 3PR5B 3RB0A 5KFBA 3EZUA 4RW9A 1RT6A 4ZHRA 4H54A 2WCXA 3QGIA 4TLRA 2XI3A 5J1EB 2JC0A 3T5LA 4GC7A 2DPJA 5KT3A 3GYNA 5J2PA 5KG0A 1HYSB 3KLIA 3IRXA 1TL3A 1JKHB 1S6QB 1Z4UA 2HWIA 5J2MA 2XGPA 2CKWA 3RBEA 1LW2B 4Q45A 1BQNA 3I0SA 1YVFA 4JV0A 4TQRA 2RF2A 4TN2A 5KFMA 2V4RA 3I5BA 4MK9A 5KT2A 1VRTA 3KK2A 1K1SA 5DG8A 4Y34A 2J6SA 1TQLA 2D3ZA 5I42B 2IJNA 4H4MB 3N6MA 5KFQA 3MEDB 4QWDA 2E9TA 3DM2A 4IG3B 4LQ9A 5KFTA 2RDJA 3IGNA 3LP1A 3D28A 2C2EA 2R2TA 1C1CA 3OSNA 3D5MA 1RT4B 4IOBA 3Q8SB 1N56A 3LP0A 2C22A 2ASDA 2BQUA 3QO9B 2ZE2A 4KKOB 2BANA 3DRRA 3E51A 4FBUA 2FVPA 4XPEA 5C24B 5EWEA 2XGQA 1TVRA 1JIHA 4NLDA 4RNHA 1S1XB 2VA3A 3ITHA 4QW8A 3OL8A 3MEEA 3KLHA 4NLUA 2V4QA 1FKOB 3JYTA 1FKPA 4NCGA 3PW7A 5D3GB 1DTTA 5KFVA 4IRCA 4K4VA 5F9LA 1KLMB 5CYQB 4LSLA 1DTQA 3V81B 3MF5A 4RW4B 3DYAB 1C2PA 1TV6A 4J9LA 4OL8A 1S48A 3DDKA 4X2BA 5KFDA 2GIRA 2IM1A 1RTHA 3UDLA 5KFHA 2YNGB 3LP2A 3FRZA 2W7PA 3DLGA 3LAMA 1NHVA 1S0OA 4Q8FA 2YNFB 3C6TA 1ZTTA 2W9CA 1ZTWA 4K4ZA 1GX5A 3EPIA 4ED1A 1W25A 4HKQA 2FVQA 4B3OA 5KFNA 4IRKA 4KFBA 1LW0B 3MR3A 5F8MA 3BQ2A 1RT7A 1KHVA 2JEIA 1LWCB 3QIPB 2QE5A 4R5PB 1RTIA 4ZP8A 3IN5A 5HLFA 5EUHA 3MEGB 3BQ1A 3KLGB 3OHAA 3PR4A 3FFIB 1C0TA 1UWBB 3IG1A 3IS9B 5CYMA 3ISNC 3TAMB 3KHLA 4WFXA 5DLGA 1TL1A 1T3NA 2YKMB 1RT3A 3CIZA 4PWDB 1T05A 2BE2B 1SH0A 4O3QA 3GIJA 1IM4A 4ZP9A 3UPFA 4WXOA 5KG3A 1GX6A 4DL5A 5J1EA 1JLBB 1HQEB 2O5DA 1VRUA 1HYSA 3TVKA 3HHKA 5J2QB 5L1JA 3PZPA 3CWJA 1JKHA 1RT5B 2FLNA 4TXSA 4KHRA 3T5HA 2R2UA 3KLVA 1S1TB 1LW2A 5HROB 4QWEA 4JUZA 1S1UA 2WTFA 2UVVA 1IKWB 3CJ0A 5KFLA 4EBEA 4ECVA 4Q44A 4NLWA 3M8QA 1N6QB 4H4MA 1RYRA 2FJVA 3FQLA 4ED7A 3MEDA 4KV8B 3UQSA 3M9MB 4IG3A 3PW2A 1NNDA 3V6DB 4O4GB 4J9PA 3DRSB 1DLOA 2FLLA 3DOLB 3HVTB 5EWGA 3T19A 1T03B 1ZETA 1J5OB 4YR0A 1EETB 5I3UB 3CDEA 5KFAA 3QO9A 4KKOA 5FDLA 3UR0A 2W8KA 3BR9A 4DL4A 2JEFA 1EP4B 4O3SA 4TYAA 2UVUA 2JC1A 3NL0A 2XI2A 4IFYA 5C24A 2WONB 1TKTB 3IGVA 3T5KA 3PW0A 4K4WA 1S1XA 3I0RB 2FVCA 5KFKA 1KHWA 2VA2A 4I2PB 2ILYA 2IBKA 4XPCA 3H5YA 4Y2AA 1FKOA 2WRMA 4IRDA 4LSNB 5D3GA 4MK8A 4ECZA 1FK9B 4ZP6A 2FVRA 3MR2A 1KLMA 4WFYA 1HNVB 4YR3A 1LWEB 3V81A 4TY8B 3M8PB 1JLEA 2VG7B 4URSA 2VG6B 3KHRA 4RW4A 3DYAA 1RDRA 4J9NA 2IM3A 1HMVB 4G1QB 1I6JA 1S49A 3M9NB 3T5JA 5DQGA 4RW7B 2YNGA 2W8LA 1HPZB 4NLGA 4DL6A 3HVAA 3KLFB 3E01A 2R2SA 4EBDA 3KK3B 3EPGA 1S9EB 4ZPBA 1RTDB 1S9FA 5T14A 2DPIA 4I7FB 3DLEB 2R2RA 5KFPA 4J9QA 1JLQB 4NLOA 5F8JA 1LW0A 2WOMB 1SH2A 4KHMA 3PJXA 1LWCA 3QIPA 1QE1B 4U7CA 1S10A 4R5PA 4IR1A 3OSPA 2ASLA 2OPQB 4QW9A 3MEGA 1QUVA 3LALA 3KLGA 1XR6A 2C2RA 3MTKA 4EO8A 2VG5B 3FFIA 3TAMA 1UWBA 3IS9A 4M95A 5KFJA 4TQSA 2YNHA 4O3OA 4IFVB 1RYSA 3DI6B 1N48A 2YKMA 4F4WA 3KOAA 4PWDA 4KAIA 5KT6A 2ILZA 2BE2A 5KG1A 5C5JA 1HNIB 3BSCA 1S6PB 3Q8PB 4NRTA 1S0MA 2IA6A 4O3RA 3ISND 5KFZA 3CJ2A 4EEYA 2IMWP 1HQEA 4Q0BB 3PHEA 3CVKA 4K50A 5J2QA 3NKYA 1RT5A 4ZVFA 1SUQB 4NYZA 2E9ZA 3KLEB 1S1TA 5HROA 3QLHB 1IKYA 1QAIA 1IKWA 1JLGB 1D1UA 1RT1B 3H4BA 2ATLA 4MIBA 4IDKB 2CJQA 3SI8A 3GV8B 2XCPA 1N6QA 2D7SA 3Q8RB 5KFFA 4JV1A 2WHOA 2W7OA 4KV8A 4O3PA 2AX0A 2C2DA 5F8GA 4K4UA 3V6DA 4O4GA 1RA7A 4U6PA 3DOLA 3V6JA 3HVTA 3RB6A 2ALZA 1T03A 4ED3A 1J5OA 2JLEA 4MH8A 4M94A 1IKXB 1EETA 4ICLB 3KJVB 5I3UA 4QWBA 3MFHA 2FLPA 4RW6B 1EP4A 5DQIA 4FS1A 2B5JA 3OLAA 4J9KA 4PUOB 2WONA 3HVWA 1TKTA 3CO9A 5KG4A 4MKAA 3PW5A 3I0RA 2HNZB 5L1KA 1R0AB 4Y2CA 4I2PA 4ID5A 2QV6A 5KT5A 3RAXA 4ECSA 4RUCA 3T1AA 4MK7A 3MECB 1LWFB 4LSNA 4NLRA 5DG9A 1TL3B 2V0NA 1FK9A 2F8EX 3OLBA 4F4ZA 1HNVA 5KFXA 1LWEA 4KE5A 3M8PA 2VG7A 4TY8A 2VG6A 3SFGA 3I0SB 5JXSA 1HMVA 4G1QA 2R8KA 1U09A 4RW7A 1HPZA 3CJ5A 1S6QA 5DLFA 3KLFA 1HQUB 4H4OB 3KK3A 2D41A 3HKWA 1RTDA 4J9SA 1JLFB 4F4XA 4I7FA 3DLEA 2JEGA 1JLQA 5JUMA 3GILA 3DM2B 4Q8EA 2WOMA 1REVB 3LANA 2I5JB 3H5SA 4DG1B 3FSIA 2AGOA 4WE1B 1C1CB 1QE1A 2GC8A 5I42A 1SV5B 5DGBA 3KMSA 2OPQA 4RNOA 2RKIB 3OHBA 3BSNA 3NAIA 4ED8A 1BQMB 3I5AA 2BANB 2VG5A 5C25B 3DRPB 3QGGA 1S1VB 1RA6A 3RB3A 4IH7A 4YP3A 4K4TA 4FS2A 1SH3A 3DI6A 1C0UB 4IG0B 1S1WB 1TVRB 2OPRB 4IKAA 3GIIA 4ZPAA 1RT4A 5KFRA 1HARA 3KHGA 5KFOA 2HNYB 1S6PA 4ZMMA 2BQRA 2R8IA 5KT4A 3TQ1A 4FBTA 4ECWA 4WZQA 4Q43A 5HBMB 2UUWA 2W9AA 3QZ8A 1TKZB 2OPSB 1RTJB 4Q0BA 4QPXA 5KFUA 2IC3B 1RT2B 4ZPCA 1SUQA 3VQSA 4ED0A 4MKBA 1TV6B 4DL2A 3GIMA 3KLEA 1JLCB 2OPPB 4I2QB 3V6KA 3V4IB 5KG7A 3QLHA 3GIKA 2I1RA 1RTHB 5J2NB 4O44B 4NRUA 5KG6A 1RT1A 3JSMB 4R0EA 4F4YA 2V9WA 2YKNB 5CYQA 5DQHA 3MR5A 4IDKA 5KFGA 5DG7A 4ECRA 5F8HA 1RT7B 3CDWA 1CSJA 3KK1B 3DLKB 3BREA 2YNFA 4URQU 4ECTA 2J6UA 2HAIA 3QIDA 5F9NA 1TKXB 1OS5A 3KMQA 4WXWA
chains in the Genus database with same CATH superfamily
3ZZOA 3K5LA 3N9UC 2C28A 4UOCA 5K8OA 3U02A 5A8RB 5G0RB 1NDLA 3DXSX 2B9XA 5GAGU 2CPDA 1L5UA 3M2RA 5ETQA 4ZVRB 1VBXA 2KFZA 4J9MA 3IC1A 3IR6B 5KFCA 1VFJA 4OYXA 5HQLA 4IO9Q 2GX8A 2W25A 1NLKL 1NJXA 1FE0A 3OL6A 2KFYA 4DV2J 1RT6B 1YZ6A 2LDIA 2WK4A 4KB7A 4DSIA 3P8BB 1HD1A 3QSIA 3HZGA 2WVBA 3DLKA 3BQ0A 1W26A 1XIQA 1SKSA 2A3JA 4ZP7A 2RRNA 1QTNB 4EMDA 2UXCF 4PG5A 4B3MF 3GB0A 3ITHB 4G65A 1TK8A 3UW1A 4N77A 2ZHAA 1OYEA 3FSYA 1X4BA 2PDAA 5CYJA 1VQOS 4Y0FA 5FJ4A 2XCAA 1RTIB 3QZ7A 2D69A 4YMEA 2B9WA 2BJ7A 3HFZB 1CLFA 3EZUA 2XI3A 2W01A 2DPJA 1UWAA 5KT3A 2GAGC 3MMBA 1HFEL 4PABA 1BD6A 1Y00A 3G2XA 1HWKA 1T9VA 1VHIA 2YQ3A 3QQCD 4Y34A 2JX2A 2MZTA 2IJNA 3MURP 4LVNP 3EX7B 4I1TA 3LP1A 2P5VA 3H2UB 4CLTA 5IT9U 4OI2A 3MM6A 4JYAF 1LQ9A 4RR5A 2B4OA 3MOZA 2FJBB 4DQQA 2V4QA 3JYTA 2I0XA 3BF4A 4K0KJ 3QNWB 4OX8A 4EGLA 2HG4A 2ZEJA 3DYAB 3UDCA 2HQCA 3JTOA 2CADA 5BYQA 4UZBA 5HJXA 2BABA 1FNOA 4NZ7A 4YY3F 4ZP8A 1P27B 1WKLA 3BQ1A 1HBOA 4TU8A 1TL1A 3GWCA 4CLFA 2DHHA 2H4YB 2KXFA 1D3WA 2BX6A 1S6OA 1GX6A 1PJ7A 2O5DA 3VAHA 3MGJA 2C3PA 1B0VA 5HROB 2FY1A 2WTFA 1U4BA 4EBEA 2ZNZA 1UJ5A 3FEZA 1S7HA 2GCFA 4O4GB 1RLDA 1NK8A 1UVNA 3QO9A 4KKOA 3S01A 1OY6A 3BR9A 3GG0A 4DV5J 1HHQA 3T5KA 4P2MA 1FKOA 1KEKA 1GMWD 3ZZTA 2HK2A 1KLMA 4URSA 1I3OB 2MY8A 3R5AA 4F8RA 1S9FA 1RTDB 5F3TA 2MMYA 4IR1A 3HMJG 3HT0A 1NSKL 1SI9A 1RYSA 3DI6B 1E6VA 1KQSR 2FGCA 2XHWA 1H72C 2QX0A 2CQPA 1VQ5S 2V2VA 3PHEA 5J2QA 3OXGA 5JVGQ 1CG2A 2GJ2A 1YG0A 5KAKA 1U1KA 4UUWA 2LCWA 1YLXA 3IM8A 4USTA 4ETXA 2A18A 1M90T 1T03A 2MQMA 1EETA 3TQEA 1RAAB 3EYZA 3D66A 1BWVA 3CO9A 1SVDA 5LSRA 3J7YU 2IVFB 3TUZC 3OVSA 2KI2A 4EWTA 2UV8A 2MZRA 4BC9A 5CH7B 2BXJA 2J0WA 2HBRB 3POTB 2N7CA 2BM0A 5IV3A 4OJHA 3CC4S 1RI7A 2WOMA 2VQFJ 1WI6A 3I5AA 2VG5A 2KZZA 3ZNJ1 3CC7S 2MQOA 3IFEA 4DUZJ 4IG0B 5DZ7A 2YWGA 4ZPAA 1RT4A 1FX4A 3DU5A 3UCUP 3O5TB 2ADCA 4QPXA 2XMWA 3HF5A 2O1PA 2YH0A 4XK8C 4F4YA 2Q1LA 4RUBA 2H9ZA 2NZ4A 4HACB 2W7AA 3BREA 4URQU 1P8GA 4ZPDA 1RHKB 1S59A 2QYGA 5HVHA 4JOUA 2QC3A 1KNZA 4U8VA 3T3FA 3AQPA 4MKVA 3L7UA 3B4MA 1JLAB 2Z0GA 3SSSA 1LXJA 2D9PA 1XMQF 3G6VA 2C2OB 1UFLA 1Z2LA 1JLFA 4X4NA 5HJYA 4MTPA 4F0KA 1SJQA 1FKAF 1UVMA 4P7VA 2BV3A 3LA0A 1B7FA 5LSOA 1VIOA 4LFCF 1A0OB 1TKZA 1AROP 2BMBA 1FA0A 2CPIA 1RT2A 2G1HA 3QAEA 2VPWB 3TJ8A 2JDJA 1AT1B 2HIQA 1NSQA 3HCXA 3IXQA 3Q8QB 4NLXA 2JWNA 2IBOA 3KUEA 3KK1A 1KONA 4N8OA 1TAQA 2W9BA 2JH3A 4NZ0A 3AY0A 1IWAA 3DRRB 2HNDA 2UUTA 4IFVA 1RKJA 5EWFA 2MLZA 3Q22A 4LSLB 1DTQB 2RHQB 2IAJA 3GSIA 2ASJA 4URGA 2IPOB 5LJ3Y 3QYYA 3DLGB 1JLGA 3QATA 1S79A 3N6LA 2JEJA 4OV1A 3H2LA 2EG1A 2ZBQA 3VWSA 1BXNA 2HWHA 2B9YA 4QOTA 2MQLA 2H1YA 4X84A 1BQXA 3CCRS 5D15A 3I56S 2B8PA 3SEOA 4YDDB 3PFOA 2LXFA 1JKHB 3HSDA 2CNLB 2HWIA 3T9ZA 3W8GA 2JNJA 1D09B 5I42B 4BCAA 2WVEA 1JXEA 4WBFA 4HH1A 5AXMA 4DCJB 2A6OA 2IMOA 4JI6F 3ET6A 4NLDA 4FNIA 4RLEA 3MEEA 4ES1A 3WBZA 4DOZA 1D9DA 2DXFA 2XSFA 1QD1A 3EGNA 1FDNA 5B0CA 4IRCA 1F1BB 1QSLA 3ZO7A 4JI1J 1JWWA 2W7PA 2DJWA 2PMZD 1N0VC 1ZTTA 1ZTWA 3UNYA 3LO3A 4KFBA 3BQ2A 3BM7A 5A6PA 2Y8WA 1UWBB 2EFQA 4JI0J 2C3MA 3OXLA 4CLWA 4PWDB 5ETMA 3JS9A 3QFWA 1JLBB 1HYSA 2Z2LA 4LF9J 1T02A 4ZJOA 1HLWA 1R8AA 5EHHA 3HZEA 1RBLA 1ZM9A 1NNDA 3L09A 2YPYA 1ZETA 3NGRA 5FDLA 1H6KX 2JEFA 2UXDJ 1CULB 2OD4A 3BH7B 3IGVA 4K4WA 7FDRA 1HI8A 2FC9A 3AXMA 2DGOA 4LSNB 1WG5A 3M8PB 4JI4J 4FVMA 3SV4A 1PGZA 2GJFA 1I6JA 3KNGA 2F8HA 3T5JA 1EAYC 3IWNC 2HURA 5HMWA 3DLEB 5KFPA 1TL7B 2YXLA 4QYZK 3PJXA 1LWCA 3BKUA 3LALA 3R5DA 4M95A 1IBKF 1NJZA 3PYGA 2XMTA 5B0EA 2ILZA 2HRTA 3CF5Q 2LQ5A 1GQEA 4EEYA 1NHKL 2C2NA 1IKWA 3VTIA 3JXOA 2W2QP 1ULRA 2DGWA 3DLJA 2KG1A 5DZ6A 3KJNB 3MAQA 1EX8A 2GQCA 4MH8A 1FRXA 4DN9A 5FLXY 3D6HB 1SQEA 2HNZB 3VR1A 1Q8KA 3UWTA 5GMDA 4KE5A 4PQAA 1XMBA 4LR8A 1S6QA 5DLFA 3CULA 1NH8A 3CCUS 2V8HA 3FSIA 2GC8A 1XMOF 2UUBJ 5KFOA 4L74A 3MPWA 3I32A 3GJRB 2ZUAA 1SKRA 4LIRA 1VS3A 2R7VA 4MKBA 2OPPB 5J2NB 4NRUA 3TA0A 4OX6A 5GAEU 4U7UD 5A8WA 4KHPJ 2FZKB 3J7A1 2YNFA 3Q86A 5IM0B 4OZ0A 4DLEA 1IQTA 1TKXB 1FX2A 3K89A 4N5SA 4WFBQ 3CJKB 3BGUA 4O3NA 1FDDA 1Q0NA 4PG6A 2OLWA 1N52B 2BA9A 2VH7A 5F8IA 4X62F 3ZZUA 1IVZA 1T8EA 2Z2MA 1O8BA 2FHJD 3V5RA 2ZH8A 1RE1B 4V1Ak 5A0YB 1YZ7A 3NGDA 1FRMA 4RW8B 5C42B 2Q3PA 5L1IA 4ECYA 1UTAA 1XR5A 1KQFB 3WIVA 3TEHB 3IWLA 4IOAQ 5KG5A 2DRAA 2R4FA 2V4JB 3QRPA 4DR6F 4F67A 2QMUB 1UA1A 1GXUA 4K2JA 2PGCA 2VJVA 2MQ8A 1JLEB 3HHLD 4LF5F 4K4XA 2VDHA 2DTJA 1WELA 4C9DA 5HSPA 2D3UA 1TP7A 2GIQA 2DGXA 3KK2B 4GMKA 1MWYA 1DARA 1RGVA 2IJFA 1R3NA 2JLFA 2DRDA 3Q24A 4S0MA 5BJRA 4EYIB 1QAYA 2R9LA 4CNYA 1U02A 3PJWA 2LA6A 3M2UB 2EFVA 4R25A 4KO0A 1SC4B 3D0GE 4P72A 4A47A 4B3OB 4J5OA 5L39A 3TVZA 3FBBA 1LFWA 1DFDA 2RHSB 3GZ7A 3HXMA 5RUBA 1N5QA 1KR4A 3UI3A 1HBUB 4DPTA 2KDOA 5IWAJ 1PG5B 1LNQA 4F3OA 1VQ7S 1VBYA 3DM2A 4OIXA 1V9OA 4B3SF 2QJ3A 3CCJS 4F36A 2YKOA 4K4VA 3NCPA 2AD9A 4USKA 5AXLA 4QYZJ 3LAMA 1X5SA 2FVQA 2KFNA 3K0JA 2R7WA 1S57A 4NXNJ 3NNAA 2QT7A 3C16A 3QIPB 1O0PA 1T9XA 3MEGB 2Q6CA 1HW8A 4OZ2A 2FZCB 3VVUA 1G7CB 4NZ6A 4OHWA 2BE2B 1J2VA 5H9EK 5J1EA 3KG0A 2F65A 2P9GA 1URRA 2ASYA 1HWUA 1RT5B 3EXYA 4ZS6A 1AXQA 4C8YA 3J80Y 1RHUB 4ECVA 1BLUA 5L46A 4ZLJA 2B7BB 3DOLB 1N33F 3AAWB 3E3XA 3UR0A 4DL4A 3R2CJ 2DO4A 1HNXF 4PG7A 3I0RB 4LF1A 4NMXA 3H5YA 1UZHA 2ZH9A 4PG8A 1VQKS 2W8LA 4FYXB 4DL6A 3JSYA 2MDAA 4U67Q 4NLOA 1UW4A 3UN2A 5L38A 4C0OC 3FCVA 1RBOB 2LDYA 1FRIA 5M2RA 3KOAA 2OAUA 3AJ1A 4A8SA 2FQQB 4YS2A 3NS5A 4KGMA 3HHLB 2ATCB 3CJ2A 2VL1A 4NYZA 1DQAA 5HMZA 3WDOA 2AW0A 4OZ1A 3Q89A 1QAIA 2KXHA 1LK7A 1Q7YT 4FF2A 2QZ8A 3B8HA 3BGOP 4HT5A 4CLYA 4ICLB 3QRRA 3S6EA 4ZCLA 4ZITA 4E2FB 2RU9A 4Y2CA 2MLYA 2ROGA 3AFGA 2X1AA 5ETLA 1HNVA 1PC4A 1UMJA 4WWSA 4C97A 4RW7A 1FFWB 5C7PA 4J9SA 4I7FA 1REVB 1EB0A 4A46A 4ILRA 1Q5VA 4W98A 2MJNA 1SJRA 1ZBTA 2ABYA 3HLUA 5IT9Y 5A2QY 1UEVA 3MEKA 2R8IA 2Z30B 2HAFA 2EEYA 2OPSB 1U6FA 1UJ6A 2IC3B 1TV6B 3GIMA 4E8UA 3GIKA 3N01A 2VKRA 5KG6A 1RT1A 2J9DE 4X66J 4ECRA 3AODA 4X4SA 2W24A 2XMVA 1HBNA 2E44A 2LMIA 5KFYA 2NXNA 5KFEA 1LWXA 1T05B 1QDUB 1QY7A 2E1PA 4FYDA 2POKA 3FDSA 3PRBA 3QSYB 3JAMU 2OTLS 1N8RT 4NLVA 2YNIB 5F8NA 3L7PA 3HI9A 4WPAA 2DNKA 1U47A 2ZVSA 5T7LB 3LW5C 4MMOA 1NDKA 3HD2A 4NWBA 1U1OA 3CJ3A 3RU0A 2AV5A 5HP1B 3ICLA 1JJ4A 2ROPA 3PY8A 2Y9HA 2G0CA 3KLIB 3JSRA 4U7UK 1NO8A 4ECUA 2RQMA 5KOXA 1VHFA 2EC0A 2CJBA 4BWMA 5HQ8A 4FN5A 5CQGA 8ATCB 2BE7D 1Z2ZA 3W5YA 1NRKA 4FVCA 1R0CB 2AEMA 3N79A 2E1MC 3KLHB 1ZOTA 4RZRA 4DMZA 3GONA 1JNRB 2F9DA 2DYAA 5K14A 3SXLA 1JK9B 3A8KA 4O4RA 2ZD1A 2HQ3A 3H59A 2W4PA 3FZ2A 2NREA 1JXLA 5H9EJ 2DGUA 2DNHA 3RB0A 2J7WA 4GKJJ 1WUUA 5B0GA 4H54A 2DKOB 1B7YB 1Y0HA 5GAHU 3SMZA 2V67A 5J2MA 2XGPA 4KRWA 3I0SA 1NAQA 5KFMA 3I5BA 4ZJLA 2HS0A 2DNQA 2Y1LB 2VC0A 3IGNA 5SZTA 3D28A 3LOUA 2XG8A 3GTYX 2QLJB 4DR7F 4AL7A 4PXCA 1CJTB 1TVRA 3CB4A 4X4PA 1DTTA 1G3OA 3W61A 3MUMP 4J9LA 1NHVA 5E5NA 2W9CA 1XWLA 2B4VA 4DQIA 1Q86T 5E41A 1YDLA 2HHUA 2QSFA 1LW0B 4USWA 1FEHA 2WAQD 3FZBA 4OFZA 1IBLJ 2QE5A 2IRXA 2J9DA 5HLFA 2RQKA 3ISNC 1O5JA 1ZZFA 7AT1B 3G8SA 1QM9A 1KOOA 2HS4A 4OI6A 1UA0A 3MAAB 5M2UA 3EVWA 3NCRA 3UDEA 2GVDA 3HHKA 5L1JA 2BJ3A 3SCIE 2CPYA 4FP9A 3KLVA 1VBKA 2P2CB 4LFBJ 3PHTA 3OFEA 2VB6A 4CLPA 4DPWA 2HVZA 4AXJA 1UPMB 2CQ4A 3QT6A 2FLLA 3WC2A 1J5OB 4DR3F 2K3KA 2ZOGA 2F7VA 2ILYA 1IBMJ 3NGKA 3VF0B 3TZXA 5D3GA 1Y3KA 2XYPB 3GFYA 2FYXA 5AE1A 2O66A 1U7LA 3M9NB 1RQ0A 1G6BA 3K59A 4NE9C 3D6FB 2PMHA 1UVKA 3OR2A 2LFVA 4R5PA 4L3NA 4UW2A 4DF8A 2U1AA 4O3OA 2ZJPQ 1M5PC 3R1LA 3ZTSA 3A13A 4P73A 4HL9A 4DV4J 1I94J 1HQEA 1Q16B 1SUQB 3DDIA 4DI6A 4YOEA 4YHHF 4B9VA 3SI8A 2J0XA 2NSCA 1XNQF 2AX0A 2V68A 2KKHA 2J5AA 4HTIA 2JLEA 4M94A 3SBMA 1B0TA 2WONA 2BJ9A 3RAXA 2RDDA 2V0NA 2ZDPA 4OYIA 1TK0A 1Q81T 1LWEA 9RUBA 1BC6A 3CCQS 3VAIA 4C7QA 2JEGA 4Q8EA 1WF1A 3LANA 4ZK7M 3J7YI 1QE1A 1S6UA 4JI8J 4USHA 4LF4F 4ES2A 2XWXA 4UY85 1X8DA 2NSBA 1B64A 1CJVB 2XYHB 2F4VF 2HYIB 4A8XA 1CEZA 4C11B 1J5EJ 5KG7A 1AW0A 3QLHA 4DQSA 2YKNB 5DQHA 2V5HG 5KFGA 3TOQA 3AOAA 4PG4A 2B0GA 3BO2A 4ECTA 1M1HA 4YR0A 1OS5A 4OHXA 4UY8T 3DN9A 3WZ0A 3VAGA 3TRGA 5AJ3J 4CYUB 1RCXB 4OYAA 1U1QA 3MECA 4L76A 1UEKA 1QAXA 2XS5A 4DEZA 1KTVA 4X4TA 3GIRA 4J9OA 4GO7X 4H4OA 4HT7A 2KVQE 4DV7J 2VICA 2YH1A 1VJWA 2RKIA 3A1YG 4XDCA 1IM6A 3G87A 1C0UA 1L3UA 1TL5A 5ETPA 4A8WA 4F25A 1D0EA 5AE2A 2EC2A 3IBWA 4ENOA 3G82B 3BGLA 4C98A 2V6AA 5L9XA 1X5OA 3D4JA 3UN3A 4UTGA 2CNOB 4ILMA 5IZHA 3E2EA 2V69A 4FYWB 1NK9A 3MMAB 3D0HE 1IR2A 2WSEC 4GKKJ 3EICA 2DT9A 1NB7A 2CYYA 3W7BA 3DRYA 3L9ZA 4USJC 3MCSA 5KFWA 2QTWA 3ZFVA 3H5UA 2B3TB 3Q2TC 3HDSA 2C2ZB 1E6YA 1REGX 2VOOA 1Y4ZB 3RBDA 1FRJA 2C3YA 1C1BA 3ZTOA 2YY3A 3I55S 3CO0P 1P1LA 5C2CA 1R31A 5K8MA 4ID5B 4IH5A 2UUCF 2EXUA 4CM0A 4MFBA 2Q66A 3I4PA 2CDQA 5IFMA 5E7OB 2R3VA 4TLRA 2EKYA 3IRXA 4NYPA 1RWXB 3O2IA 4O23A 2M4MA 1LW2B 2APOA 1F3VA 4PPDA 2CQDA 3UD3P 2V8VA 2RDJA 2G2YA 2R2TA 1V5VA 3M2VA 5IC4B 1N56A 2ASDA 4FF3A 5EWEA 3DU6A 3H8YA 3VAFA 1OSCA 3OFFA 4AD6A 4C8KA 4X2BA 1WC1A 3LP2A 3C2PA 3L3CA 5LXYA 4DV1F 5F8MA 1KVJA 3FFIB 5LXRA 4WKYA 2KJWA 2HEKA 3K2YA 4ZP9A 4LF2A 3QT5A 3T5HA 4DFMA 1PILA 4NLWA 2VQEJ 3EVMA 2F5GA 2BYCA 3MEDA 1KVIA 4TU7A 2GZOA 3HVTB 3CDEA 5KFAA 2IDEA 4O3SA 4JI3F 4ANDA 2QA2A 5C24A 1RU1A 1TKTB 2BEFA 3M6XA 2VU5A 1HR0J 1BMQB 4A48A 1FK9B 3N4WA 3TX8A 3V81A 1WKJA 4TY8B 2KB2A 3QPIA 3JQKA 5C2GA 1S9EB 5T14A 2NS1B 1NJIT 2HRUA 1U1NA 4DQPA 4CCHA 4IYQA 3MTKA 4LMZA 3TAMA 3TZZA 1U2FA 2W4CA 4ZLLA 4C3KA 3AQOA 1FEEA 2CWXA 4K50A 3R6GB 2G0JA 1GMWA 1MSWD 3IM9A 3H4BA 3GV8B 2QLFB 2K06A 2MGZB 4LIWA 3M32B 2RD5C 3AD7C 1KFSA 1EP4A 2Z56B 3EGVA 3C46A 1RAEB 3UO0A 2HIYA 2KTQA 3BBCA 5BYRA 1LWFB 4NLRA 5DG9A 4DV2F 3BH6B 4N7TA 1VK8A 1F0XA 4KQZA 3MM7B 2MY7A 5I42A 2GS8A 5C25B 4ZMMA 4Q0BA 3CDAA 2DR9A 4DL2A 3C66A 3R5GA 3V4IB 1VISA 1RK8A 4O44B 3TARA 2Q43A 4IDKA 2B8QA 3IMQJ 2CG8A 3ULHA 2GGPB 2WW8A 3A4TA 3RJMB 2BVZA 3HKZD 2ZM6J 5GAEI 1KDNA 1XR7A 1JLBA 4YB5A 2RRAA 3R5BA 1HBMA 4RNMA 4W92B 2LQJA 1RHMB 5GMEA 4X4QA 3TAPA 2PEBA 3SCJE 5KG2A 3ILLA 3QGHA 4CTAB 3AD8C 1S4FA 3NMRA 3RG6A 1S97A 1MWZA 4DSJA 2H5IB 1RACB 1MU2B 1CULA 1U0HA 5EX0A 3V6HA 3CTRA 3GYXB 4RU2A 5AT1B 2XNRA 1YX2A 2HBQB 2AYBA 4DR4J 4K0KF 3E01B 3M8SA 5KT7A 2GVZA 1N0UA 2DHAA 3BYRA 1EHWA 2KM8C 2COLA 4YR2A 4QYRA 5CAAA 4WTYA 2X1BA 3ZZYA 1CS4B 3AT1B 2JZ5A 2ZUGA 1IR0A 2MKKA 2YBVA 2CQGA 5DGAA 1ZAVA 5DDQC 3AHPA 1A7GE 4PAAA 1U49A 4OX7A 2A6MA 4DF4A 4GC6A 1RWUA 3LTOA 3C6TB 4C0HA 1WI8A 1VC0A 1CPZA 1NB2A 1WSVA 3L95X 2WZ1A 1T7PA 1CVJA 2NQPA 2XNQA 3O1LA 3BGRA 4DV5F 4U8YA 2IRYA 2XMUA 5J2PA 3RR8A 2L9WA 1PYOB 3OW2R 4RO0A 2OGUA 3T41A 4P2XA 1Q5YA 1TTHB 2OSQA 3SDEB 3HJFA 1HA1A 3D5MA 3DXBA 2XSJA 2C22A 1RAGB 1CC8A 4OX9J 2BOAA 2DB1A 1S1XB 4QW8A 1CQMA 1SQGA 4X65J 4DCPB 3MF5A 3G96A 2L41A 4PYAA 2CDRB 1MG7A 1I1GA 1YTYA 4HEA9 4XAKA 4I68A 1UFKA 1VQPS 4DU7A 5KFNA 4DZ6A 3DHWC 3KLGB 2AIRB 4HI2A 3K8VA 3MMCA 1IM4A 3JAMY 2V2KA 4M5JA 3SZ2A 1NMEB 4F04B 3GR1A 4ZN1A 4NI2A 1LFPA 3CE8A 5IOLA 3EMTA 2AEJA 2VQFF 1VRQC 3K58A 2DNGA 4M5DB 2DBBA 3MUVP 3PW0A 4DUZF 1UAWA 1YHQS 4IRDA 2ALYB 3FBCA 1DAXA 1JLEA 2A10A 1GMUA 3CCZA 2YNGA 4IQMA 4FYVB 2IFXA 1IXKA 4AL5A 3OSPA 2OPQB 2XLJA 5CXTA 1M5SA 4KAIA 3CJ8A 2IA6A 2BUNA 1AFIA 2CPFA 4LF6J 3G4SS 2MXYA 3KLEB 2JHEA 2YTCA 3PRVA 3B4DA 3DGPB 3K8WA 1FWPA 1GT8A 3M1VA 2HBZB 4WFAQ 4KV8A 5F8GA 3M4XA 1FJGJ 2VFUA 3OLAA 4JI2J 1RXOB 4PPZA 3M6WA 1OMSA 4PR6A 4FYYB 3AJ2A 5HMXA 4NXMJ 2VG7A 2VG6A 2QLXA 1KWMA 2AMCB 1M1GA 3M2RB 2MQPA 3NNHA 4F4XA 3UN5A 3RW6A 2LXIA 1FNMA 3F41A 3H5SA 4TKTA 2DXDA 2BANB 1TUGB 1RHRB 2VFVA 3C14A 1FNXH 2HGNA 1SH3A 3HHLC 4H4KC 5KFRA 2G0IA 1FE4A 1C4CA 2BQRA 3UVJA 4JI5J 1WWHA 1KQGB 2I6WA 4AUKA 3QGPA 2MZQA 2KU7A 5DG7A 3R5CA 5FLXU 2RU3A 5F8HA 1Q8LA 3FEXB 3CDWA 3DLKB 4DV0J 4C4WA 2KRRA 5F0WA 5F0UA 4W4MA 2RS2A 3M8YA 1LK5A 3PVXA 3BSOA 3RGIA 1JXVA 4FPIA 2PEHA 3H40A 4WFZA 3T1YJ 2XB2D 4OI3A 3TUIC 3FQKA 1RP5A 2FHKA 4OZJA 1U1PA 1H74A 4Y28C 1DBDA 2BDPA 3HPOA 4ZJQA 1OIAA 4JP8A 1VLOA 4KPYA 4YEAA 3EGWB 4WU3A 1BQMA 3G6YA 2MTLA 2I8EA 1GTEA 1TUWA 2R42A 2MZ1A 5HBMA 2B4PA 3NXZA 3M8RA 2E9RX 3QAUA 3A8EA 4FKYA 4WIIA 1F2HA 2FHJA 2ROEA 1JLCA 4I2QA 3RAQA 3MMBB 2FUG9 4CLZA 4QR0A 4CNZA 4DV6J 4JI1F 2EBGA 2AGPA 1YJNS 1HNWJ 2BM1A 1T9TA 3KFWX 5U47A 2RRBA 4RWWA 4EBCA 4PXBA 3LP1B 1NJWA 3HVRA 4DSLA 3X3UA 2OHDA 5BR8J 5F41A 4DL3A 3MM6B 2G1DA 2H5EA 3NAHA 3GU0A 4JI0F 2KVIA 4PQUA 3MOJB 1S76D 1PBUA 2DNZA 3JYTB 4H4KA 3H5XA 3BZQA 1SPBP 4LF9F 1TFWA 3D7SB 5CABA 1VDHA 3MMJA 2PO4A 3RBXA 3FEYB 1H3DA 2HLTA 3NOGA 4PYDA 1YJUA 4EYHB 1HBOB 3TVYA 4K2XA 4XIUA 4ICLA 1TL1B 1WTBA 1NH7A 1UW9A 2UXDF 3IA0A 4IUFA 2MZJA 4C3LA 3KWMA 1WEYA 1Z4UA 5BYSA 2EBEA 1BQNA 1YVFA 4JI4F 3I4HX 3KDOA 2RF2A 2ERRA 1Y3JA 5ITHA 2J0SD 4QWDA 5KFTA 3ZC4A 3PX4A 1SL1A 4JB8B 3CD6S 5GAHI 2ZH3A 3H25A 4DR2J 3QO9B 4KKOB 3E51A 2NPFA 4RBVA 1FKOB 7FD1A 1FKPA 4NCGA 1KRPA 3GCXP 1KLMB 2NUUG 3AOCA 1U2RA 1TV6A 5ETTA 4FKXA 4LSZB 2GIRA 1S0OA 3UD4P 4QCLA 3MM8A 2FB0A 2JFKA 1KHVA 1Y5IB 1KN6A 1YBAA 3D3CJ 1BY9A 1LEOA 2DCUB 3G71S 2N4CA 1Z1ZA 4OJ1A 3KHLA 3TA2A 1E6VB 1T05A 3Q83A 4O3QA 2JSXA 4WXOA 2EI5A 3GYGA 1KP6A 3TVKA 5J2QB 2WVCA 2C42A 4OZLA 2E7XA 4ETZA 1EZZB 4H4MA 1T9UA 1RYRA 4OI1A 3UQSA 1K9MT 4IG3A 3NGTA 2E1AA 3VZHA 3KG1A 3T19A 1T03B 1G1XA 2H51B 1EETB 2VPXB 3T1HJ 2FVCA 1GMVA 4YFUA 2UUBF 4MK8A 2QL9B 4UOFA 4RW4A 1RDRA 4DR1J 2DR6A 2C3OA 2ZKTA 4LFAJ 2R2RA 2ZVIA 4KHPF 2WOMB 3CMAS 2IYGA 3FMBA 3B54A 2VG5B 3IS9A 2VBZA 4WTOB 3SSQA 4F4WA 5KG1A 3FBFA 3J80U 5KFZA 3NG8A 4ELTA 2N4DA 4A4JA 4LVOP 2M2BA 4P7TA 2ATLA 4MIBA 2DRBA 1WC5A 3DDNA 1NZAA 3GE9A 2W7OA 2C2DA 4UOGA 4CO1A 1RA7A 1XNRJ 4QWBA 1NDCA 1SC3B 2X51A 2CPHA 5DDRC 3OLBA 3Q23A 4EI2A 3RTVA 2AKWB 3BBBA 1VIXA 4HDHA 4G1QA 2XM3A 2Z57B 3O44A 1YSJA 2BKPA 3KK3A 5ETRA 1JLFB 2V50A 3D9BA 4Y2IA 3QGGA 3A3PB 1H2VZ 2GQQA 1KLNA 4B3TJ 5MAOA 1FDAA 4IKAA 4BWJA 1BUXA 3ENWA 1HARA 3K57A 1S6PA 5KT4A 4ECWA 4WZQA 1WHXA 3MR7A 1HI0P 2VFTA 1TKZB 1VI7A 1RT2B 5E33A 3VQSA 2IDLA 3V6KA 3TWZA 4F2SA 4DHVA 4RBTA 3TAQA 1VC5A 3N5FA 3MM5A 5D4LA 3KK1B 4YN3B 2OEMA 1Q53A 5F9NA 5KOWA 3OFHA 4F3MA 2YX7A 2OH2A 2W9BB 2QL7B 2Z8QA 2MHEA 2UVRA 3NGSA 2MZSA 1HL6A 2WVDA 2HNDB 2ZH1A 5FD1A 5IT4A 1Y11A 2AQ4A 2WSCC 1HNZJ 2LU1A 1K1QA 3PYDA 4KH1B 5IWAF 4A8QA 2IAJB 4MKYA 4F0MA 1OJ4A 3M8ZA 3JTNA 4QR1A 2EFPA 2UP1A 5A2QU 4Y3CA 3U27A 1VQSA 2FHOB 4QIGA 2K1RA 4J90A 1SB6A 3BSAA 3NEKA 3MZIA 3AB4B 2KL8A 2RDIA 4I4BA 3AOBA 2M3DA 5E3CA 3G6ES 4Q2MA 3M30A 8AT1B 1S99A 2CZ4A 1WOOA 5KFIA 5MLCV 3N6NA 4WK1A 4DS4A 1T9YA 3OV7A 3KG4A 2X3GA 2YNHB 3QJJA 4NXNF 2DNLA 3TYTA 2HFNA 3BO3A 2WW4A 4ED6A 1S77D 4OHYA 3ET6B 2EW9A 3BN7A 3GV5B 3MEEB 2HMIA 3FCHA 3OL7A 3FCWA 1SXLA 2Z4PA 3W2WA 4LJMA 3VCDA 2B6AA 2LQ8A 1N5YA 4R8UA 3O3LA 2DGVA 3DOKA 4KFBB 2H65B 1TK5A 1RAOA 4RWXA 1AFJA 3M8WA 1IKVA 4ECXA 1S9GA 5E3QA 4RW9A 4ZHRA 1CJKA 2QA4S 3GYNA 1HYSB 2ZH4A 1WC0A 3VGUA 1ZA2B 4N76A 4ZVUB 1NKBA 1NXIA 2V4RA 1ZM3A 5F3ZA 4B9UA 5ETKA 3PJ9A 2OTJS 2ZFHA 4DPOA 2YKAA 2ZE2A 4FBUA 4XTTA 1XJWB 4ZDNA 2HHWA 1S0VA 1JIHA 3OL8A 3P3DA 3MDFA 3LQVA 5GMKa 1C2PA 1SKUB 3CD5A 4ITSA 1W2IA 3CIMA 1FXDA 1VYAA 4XDDA 1F9EB 2UU9J 2GO8A 1GFWB 2G2OA 3GMGA 1LWCB 2LYVA 1HHTP 4Y2MA 4RKUC 4CYUA 4CLLA 4TXSA 4TU9A 1NBEB 4C6AA 1BE4A 4LR9A 2HVHA 1IKWB 2L08A 1PSDA 4QBUA 2RILA 2FJVA 4NA1A 2AJ2A 2G4BA 3GSDA 3NL0A 4M5IA 2CNKB 3R3TA 5KFKA 4X64J 3IAM9 4M5MA 1H0HB 1R89A 1DZ5A 5K9FA 3QJLA 2RUGA 3U1LA 2DPIA 3MD1A 3BBFA 4X66F 3VHQA 4U7CA 2KRBA 2C2RA 3DOMB 3VGSA 4C2MA 1F60B 2YKMA 4NYOA 1CJUA 3Q8PB 1S0MA 1HIYA 2IMWP 2DHXA 4LRDA 2IY5B 1IUJA 3PYFA 4QU6A 2HZAA 2CFXA 1H2TZ 4J7CA 5A8WB 4AXIA 1SJ3P 2OKQA 1WEXA 3MPYA 2DH8A 2XEXA 1TU0B 1M5HA 1FF2A 1X5TA 3Q0AA 4ID5A 6FD1A 3DFEA 3LF0A 4F4ZA 3FBEA 1X4DA 1RWVB 1HMVA 2ZJRQ 2LXUA 3CJ5A 4AFFA 3BKFA 3I82A 4PWWA 4WU2A 1JLQA 2P9CA 3J81j 4WF9Q 1WC3A 5DGBA 2NPIA 5CCMA 3B82A 1EARA 1IN0A 2ACYA 2QG9B 2UUWA 2W9AA 4CO0A 1UVIA 2RB7A 4WP9A 2VONA 2BBEA 3Q8UA 3R7NB 4ZPWR 2GHVC 3PM9A 3MR5A 5T41A 1T0TV 4FDFA 4OLOA 4C3MA 4ANEA 1D9FA 2QO3A 3PACA 3Q8YA 5LSLA 5C5JA 3CW2C 4HHJA 5CYMB 1O51A 3I31A 1YJ9S 4PCQA 5E0OA 3RRGA 1WF2A 2DGQA 4HTJA 2Y1JA 3MCMA 2YWKA 3IP0A 5KFSA 2IM2A 5H1SV 4IQXA 1VBZA 4GKJF 2D3O1 4NLTA 4IOCQ 4KO0B 2AU0A 2I2YA 2YWHA 3K5NA 4NA2A 2I5JA 3DRPA 3H4DA 1HKAA 1S1WA 5IQ6A 2EVZA 4LQ3A 4B9SA 1NSPA 4RNFA 3TUJC 2E5LJ 2J7UA 3WC0A 3A8JA 1NK0A 3ILIA 3CDUA 3QWPA 1K47A 1S12A 2UV8G 1S9EA 1ZAXA 3C6UA 1K8AT 2ZZMA 1IBLF 3OD2A 2R8HA 1MW7A 2LEPA 5GVQA 1N36J 2QA4G 1NU4A 2CJYB 4KJIA 4Y65A 5D8HB 4ANCA 5DJBA 2DISA 2VUGA 3TJ9A 1SC1B 2R7UA 3D67A 2GMHA 4LFBF 3NBPA 2GV1A 2OMLA 1M1KT 1U26A 2EFGA 3PW4A 2I38A 1I51B 3ZTQA 2KO1A 5DDPC 1N34J 5J1EB 2E5GA 4ZIWA 1IBMF 1LKZA 3PEJA 2CKWA 5B08A 4YHHJ 2ZH2A 3NS6A 2E5JA 2UZAA 3EDQB 4PXDA 1SKWA 1HI1A 2HLUA 5AXNA 5HL7Q 1N32J 4IOBA 3ZTPA 1V3ZA 3LP0A 4CO5A 4QIWD 4AQYJ 3S7RA 1F3FA 4E0DA 1FVQA 2VOPA 4DV4F 3H2VE 2PIIA 1I94F 5KFDA 4DV3J 3U1NA 2LA4A 2DCLA 1QTMA 1W25A 4M1KA 3MR3A 5LMUJ 4DX5A 2XY6A 2P9EA 1C0TA 1VR6A 2VFSA 1X4GA 3JQMA 4DL5A 2FLOA 3VV2B 2M9KA 3PNIA 2FLNA 2HWTA 4QIFA 2YWFA 2DR7A 2XS7A 5KFLA 4I6YA 3M6UA 3HHDA 3IAS9 4P9SA 2KG0A 1FWLA 2LEAA 3RW7A 2GJIA 3RR7A 2UVUA 2JC1A 4JI8F 1GAOA 5SUHA 1EIYB 3QWUA 1NK4A 1RABB 4ECZA 2Z58B 3ISZA 1HNVB 3A12A 1YIJS 1M5VC 5DQGA 4RW7B 1J5EF 2RQ4A 3W65A 3E01A 2YWEA 3EPGA 4I7FB 3LUYA 1U25A 2V8PA 4DPXA 4KHMA 1S10A 1QUVA 3CEDA 2FGOA 2HS3A 1FERA 5AJ3F 4HVZA 3PFEA 2ZHOA 2OELA 4HDGA 3CVKA 3BV8A 3VAMA 2NZCA 1AZSA 4DR5J 5AE3A 3G9CA 2VC1A 1RT1B 3TO8A 2CJQA 2OSRA 2OO4A 4E98A 3V6DA 3B6BA 2CVEA 3V6JA 1HBNB 2L9NA 4DV7F 3RRKA 5KG4A 4I56A 3JB9k 4MJKA 1Y10A 2P6TA 1RTZA 1HPZA 4Y6IA 1WDTA 4ZCIA 2MKIA 1QSYA 2RAQA 4OYWA 4J91A 3BSNA 3J81Y 3NAIA 3KXDA 3THPA 1IQZA 2HZCA 4J9UE 4GKKF 3AA9A 2UUAJ 3HSZA 1GEHA 1TKDA 1UPPA 4CLKA 3D6MB 2DXEA 4CWBA 1PBAA 2E66A 3FRYA 2FJDB 1Q8BA 3OBIA 3FJ2A 3KJVA 4RW6A 2KT3A 4PUOA 2ZWOA 3RZAA 1QSSA 2FVSA 1R0AA 4CZCA 4TYBA 2DR5A 2AWZA 4QWAA 3MM9A 4KC5A 1IBCB 1B99A 5B09A 2EG2A 1HQUA 5CZXA 1RCOB 5K14B 4DG1A 3IR7B 1SV5A 4HYKA 2H48B 4LREA 1MN7A 2ZD1B 3R7BB 1RHJB 4ILLA 4P71A 2OPRA 1WF0A 2F3JA 2HNYA 3P5BP 2YQ1A 1RTJA 2ZC3A 5EN1A 2M8DB 2Z2ZA 2V2QA 2L48A 4WZMA 1NHUA 3JSMA 3DRXA 5D4NA 3W60A 5J2MB 1TMJA 5AXKA 4LUBA 4NEYA 3W8PA 4F50A 2KH9A 3KHHA 1AA1B 1YJVA 4TY9A 2XY7A 2GIFA 2JFDA 1RAJA 2VV5A 2IIHA 5IT0A 2LLZA 5E3AA 3G86A 4DFKA 3TP2A 1IKYB 1DTTB 5A76A 3ILOA 4FF4A 3ZZZA 2F1FA 4CO3A 1RHQB 4IH6A 1RWNB 2YKPA 2CQ3A 2W9CB 3QFHA 4DJBA 3BGFA 3JQJA 2VQEF 4DCOB 4X4RA 1NM2A 5HLFB 1SJ4P 2OEKA 4YB7A 3DMJA 4I67A 3R9LA 3AJDA 1RWWB 4NLSA 2AZ1A 3ZNUA 3T5LA 2GVDB 1HR0F 4GRSA 2QLWA 5DM7Q 4Q45A 1URNA 4TN2A 1VRTA 1K1SA 3PTWA 4USIA 1TQLA 5D4OA 3FUYA 4OYBA 2E9TA 2DIUA 3G8QA 1WJ9A 4JV5J 4P75A 4WJBA 2BANA 4BHQA 2XGQA 3A3OB 3JTPA 1U0SA 5D3GB 2C1EB 3RYLA 1NK6A 1MLAA 4CLUA 1FRHA 1U1MA 1EQMA 2RNEA 3FRZA 2WSFC 5DRKA 1NCLA 5ETNA 4ED1A 3TR5A 3MPVA 3OR2B 2JEIA 5HI7A 4R5PB 4BLGA 3IN5A 1OPIA 3TANA 4KGVB 4G6VB 2PFFB 4WFXA 3F0NA 4OYOA 4UUXA 1RT3A 3WX8A 2DEIA 3UPFA 3W2VA 1HQEB 4A8MP 1L3KA 2BKNA 1FJEB 4Z37A 3K7RA 3SYZA 3HM9A 2MYFA 2UVVA 2DEJA 3FKBA 4ER8A 2PA8D 3LWMA 2CQ0A 4M5NA 3PW2A 1X9MA 3N28A 2XMKA 1XK8A 2XZTB 3WHIA 2XI2A 2WONB 3EVOA 4B9NA 4ELVA 1FDBA 4WFYA 1LWEB 3PIOQ 2H5JB 2B56A 4J9NA 1X4CA 1DURA 4X4OA 4J9QA 3QBCA 4OHVA 2UXBJ 1QE1B 2MLXA 2ASLA 1S4EA 1RWPB 2CQHA 1XQIA 1HD0A 1NPPA 4I0WA 3OR1B 2OIHA 3R1HA 1OQ6A 2ZM6F 2U2FA 2PMWA 2RUSA 3R5JB 8RUCA 1S1TA 3QLHB 5K8PA 4P6QA 1F5CA 4EK2A 2PT0A 1ROFA 1MNEA 1N6QA 4CLSA 5KFFA 2ZH7A 4K4UA 3HP6A 4K5RA 4ED3A 2Y0SD 5I3UA 5GAGI 5DQIA 1RAIB 4J9KA 2HVEA 4MKAA 3PW5A 2AP6A 3AXKA 4PZVA 1X4HA 4I2PA 4ECSA 3CMES 4YDXA 3MECB 3F44A 3BPDA 3SCLE 3D1OA 2ZBRA 5JJBA 5JXSA 4WP8A 3PIPQ 2HHPA 3KLFA 1MMNA 3HKWA 4H4OB 4DR4F 1S7IA 5HO4A 4CIOA 2XMMA 3KMSA 2RKIB 1DQ8A 3UD5A 1RWKB 1ZPVA 3MAHA 1Q95G 5IS2A 1C0UB 2CA9A 1NJYA 2HZVA 4F2RA 4QQBA 4M63A 2RJZA 3V4MA 2QN6B 1YRUA 2ACMA 4M5KA 1RB0A 3J7Z5 1R43A 1RUSA 2OP5A 4LF7J 2G13A 3AD9C 3LPEA 3OUYA 1YRTA 3BJYA 3H0PA 1VRUB 3LGHA 2PI4A 4KGZB 4DS5A 4JV2A 3W66A 2V8DA 3FC9A 3M8QB 4DUTA 3J7ZT 1E6YB 4ID8A 3CUNA 2MB0B 1YJRA 3D6TB 1VC6A 2DH9A 2AHOB 4WE1A 2D3OR 1C1BB 3EM1A 1RAHB 2K7KA 1S1VA 4ECQA 2XC9A 2PA3A 4MFBB 2R8GA 4OX9F 2O67A 3GV7B 3IRXB 1MMLA 2K8GA 4X65F 3MFIA 1Q78A 2R7OA 1T3OA 1X9WA 1G2EA 4AYBD 1MROB 1HHSA 1VJQA 2J6TA 4QWCA 3M7VA 4L75A 1JNZB 2GO9A 2J9EA 3M2VB 5DDOC 2EPIA 2V8GA 4C8ZA 4EFAC 3IBFB 5A8RA 5G0RA 4YB6A 4B08A 3SFUA 4ZVEA 2ZBCA 3HFVA 3LAKA 2QL5B 2ZDOA 2AYEA 2VBWA 3W64A 2V63A 3LP2B 1NEEA 3UFCX 2ZZTA 4M5HA 4ZVHA 2AGQA 2GNKA 3TZWA 1UKUA 3M6VA 1N5SA 5B0FA 3NP5A 1YRXA 1KVKA 2DIVA 2CJXB 3HO1A 4P2FA 1RT6A 3QGIA 2ZC4A 4P74A 3R8YA 2ZHBA 3KDNA 3QT7A 4QIEA 2XYGB 1F2GA 2J0QD 5D0RA 4ZPTR 1HQ2A 2D3ZA 1U8SA 4EUVA 3R97A 2VIHA 3MEDB 4DDFA 1CC7A 3Q8SB 1YK9A 1G4CA 4N41A 5C24B 3P96A 2VF3A 3C15B 2DITA 4B9TA 4RNHA 3ITHA 4Y2KA 2JOQA 4YB1P 3PW7A 4B17A 3V81B 4BDPA 2OUGA 4EZ9A 4LF6F 3DDKA 1VQLS 5CA5A 1ZA1B 4M8LA 5M2PA 4G1IA 4ZVTB 3CNQP 1RTIA 1KOHA 3TAMB 5KTQA 1FJGF 2XY5A 2V94A 4JI2F 3A3NB 5B0BA 4FF1A 3CWJA 1W7WA 4DX8H 1PAUB 1XN9A 4NXMF 2MKSA 4DX7A 2ZITA 3N0VA 3HFKA 3W62A 2HHHJ 2F4FA 2BOPA 3DRSB 2VBYA 3P5TL 2VD3A 1EP4B 2G2ZA 2Q79A 3CJTA 4JI7J 1RLCL 3GPAA 1KHWA 3W63A 5HATA 2MKYA 4XPCA 2JVRA 2WRMA 4JI5F 2CXEA 3DYAA 2IM3A 1TAUA 3ZXWA 1B0PA 4DV0F 5KFJA 2YNHA 3GFXA 3RAMA 3F56A 2KHCA 1U48A 4DQRA 1HNIB 3D1QA 4Q0BB 3T1YF 1I5OB 1RISA 3NKYA 3WQPA 4P10A 3HD1A 4HI1A 5HROA 2BACA 2EWHA 1D1UA 1DQ9A 4IDKB 4B3RJ 3RBZA 4O3PA 4O4GA 1YITS 2ZNYA 4I6AA 4A8KA 1YI2S 1IKXB 2FZGB 2FPHX 3OVBA 1FO1A 5L1KA 2OFHX 2QYCA 1TL3B 1WC4A 3D1HA 3W1YC 1U09A 3GLJA 1HBMB 2D41A 1OSDA 2KT5A 1RTDA 4F7VA 3GILA 3CXCR 4DV6F 1HNWF 2CUYA 4F02A 1RA6A 3OQ2A 2GFFA 3SQGB 3DI6A 4C0BA 3PKMA 3GIIA 5LMNJ 2HK3A 4LF8J 1MWQA 4FBTA 2M0GB 5BR8F 1U0HB 4LT6A 1IWGA 3C3LA 1Y9OA 1WKKA 3KTQA 4N8NA 1QUPA 2FC8A 2I1RA 1RTHB 1AUSL 2CWKA 2E5IA 1EKSA 4R0EA 4CO4A 2A2CA 1RT7B 4M5GA 2GVZB 3IG1B 2FJWA 2PSZA 3GJSB 2MKJA 4K4YA 2ZZNA 3W9JA 4FXWA 4K4SA 4C8NA 3ADAC 4NLYA 3OTOJ 1NPKA 2C2KB 4DFJA 4RU9A 3POTA 4KTQA 1VQYA 2AX1A 2DD8S 3TEGA 1WOPA 2XBPA 2PC6A 4C8OA 3SQOP 3NCQA 4RX6A 5HANA 2VBXA 2H54B 2HVIA 3H90A 1QLNA 4DUYJ 4IG0A 3MXHP 4DR2F 3BGRB 3W3SA 5DO2A 1OY8A 1L3TA 4ZVGA 4A8FA 5J2PB 5H9FK 2QEXS 3PKYA 4CDIA 3CMQA 4HACA 3HSJA 5LL6d 4UT4A 4KSEB 4B02A 2F40A 1H38A 2XSJB 3SCKE 3DOMA 3OL9A 1N5VA 2F63A 3HK2A 1RWOB 2UVWA 4ED2A 2AJ4A 3K5MA 1JLAA 2DR8A 3KNAA 3MPDA 3FGVA 1QJHA 2BKOA 3BEGB 1Q79A 2NUHA 3EGZA 3A8IA 3D0IE 2LEBA 3TI0A 3MMCB 3NOCA 5KFBA 2KM8B 1VQ9S 3H7HB 5THWA 3T1HF 2CZ9A 1UZDA 3CCVS 4GC7A 5KG0A 4UQGA 4Q5VA 1U45A 1XBWA 1DRZA 4MAKA 4Y00A 2LVWA 4ZN3A 1R6VA 4DR1F 1UFWA 2ZJQQ 4LFAF 2KJVA 4NI2B 4K59A 5B0DA 2BQUA 1F9FA 3DRRA 3P45B 1WG4A 4USMA 5I3QA 3MD3A 4NLUA 5A8KB 5F9LA 5CYQB 4LSLA 1DTQA 4P2SA 4OL8A 1S48A 1TZ0A 2XLIA 2YNGB 3FK4A 3DLGA 1HWLA 1OQ3A 1WTFA 1GX5A 5I3PA 2IJRA 3EUNA 1B4SA 1RJJA 3ZZPA 2UXCJ 3CCWA 1CQNA 4B3MJ 1XNRF 5CYMA 5DLGA 5HAOA 1F9HA 2V34A 4F4AA 3V2UC 4CI0B 1JKHA 4ATNA 4I6WA 1M5OC 3WIUA 4KHRA 2R2UA 3PXGa 4QWEA 2AJFE 3GR0A 1TELA 3M1VB 1Q4RA 1R8CA 1SCJB 4KV8B 1F6TA 1JJ2R 3OT9A 1HWIA 2P8IA 2EK1A 3OVAA 4GVBB 4ZLNA 4HHUA 3D3BJ 4B3TF 2IBKA 1WHWA 1FT8A 5I4MA 3MCOA 4YR3A 3MI7X 2VG7B 2R7XA 2VG6B 2OEJA 3DGVA 4NLGA 4HH0A 4QJVA 4RBUA 4D3HA 4ELUA 3IO1A 4NL5A 1K0VA 3AA8A 4NA3A 1XR6A 4JYAJ 1UWBA 3C14B 1JJCB 5ETVA 4PWDA 1WACA 3UNGC 3UVJB 4WCEQ 1X31C 2F9JA 1VQNS 4ZVFA 2IRUA 1HNZF 5K20B 2CIMA 1HWJA 2C2MB 5J1NA 2MPUA 2D7SA 4OYPA 4YY3J 3EJMA 2XMJA 3HULA 3MFHA 2VASA 2L9DA 1PKUA 2R7TA 2QV6A 2CRLA 4PKDB 1FFSB 4OYMA 3T1AA 4LSNA 1PCAA 3LGNA 3M8PA 3SV3A 3R7SB 3TX0A 2RT3A 3DLEA 4LBIA 3ZZ0A 2RE1A 4ED5A 1TL7A 4NCBA 1C1CB 3MCNA 3ETMA 3AH6A 3HX9A 1BQMB 4WP3A 1N5TA 1X0PA 3KHGA 2WB1D 2XO6A 5HBMB 5H9FJ 1VQ8S 1JLCB 4I2QB 1WHYA 1JQGA 3OTBA 3CCTA 4ZA1A 2V9WA 2AT1B 1RSCA 4MT1A 3ENAA 2YVSA 1V3RA 3U1MA 2J6UA 5D77A 2N3OA 4ZKAA 2CQ1A 1H2UX 3QRQA 2AJQA 2HFOA 1OPZA 2SXLA 1EQ0A 2HNZA 4LRBA 2HQDA 4EO6A 4PQUB 1X0FA 2HHSA 3H98A 1S1UB 2B43A 2IVMA 1NSAA 1ZM2A 3CGIA 3SSRA 2KYZA 2WB4A 2QA1A 1FVSA 1DLOB 2OFGX 1N4LA 4CH0S 1UEUA 4B9LA 4UQTA 4IFYB 3VGVA 3P4UB 1OO0B 1GK8A 2BZ2A 4AT1B 3Q2SC 2OPPA 4RNNA 5D78A 5J2NA 4MYTA 2MSSA 1JMTA 2ZKUA 1S0NA 3K17A 1BQNB 3DC2A 2RF2B 5CZVA 4ZCKA 5IM0A 1OYDA 1TKXA 3IBCB 5D0HA 1P1TA 4ALZA 3CJKA 1T94A 4LR7A 2UU9F 2VPYB 1XC9A 5E3RA 2BQ3A 4QPTA 2K2PA 4L73A 1YQHA 4C8LA 1LV5A 2GHPA 1YJ7A 3G6XA 1NK7A 2FHMA 1FKPB 4NCGB 5A0YA 5D0EA 4F0HA 4RW8A 5C42A 2HHXA 3MR6A 4U96A 2QGFB 4FXDA 3MM8B 2GA7A 2V4JA 2HFZA 2B5JB 2GMJA 5FIIA 3EDRB 2J8SA 2DGTA 2JC0A 4KT0C 4O0IA 4X64F 1XMQJ 5A6WA 1PC5A 1DY3A 2V9KA 4JV0A 5GADU 3KK2A 1K44A 2FD2A 3PEHA 1ZZNA 4H4MB 2ZWPA 4IG3B 4LQ9A 3BDPA 2KXNB 2AZ3A 4Q2LA 3WX4A 4LFCJ 1ZS6A 5B7WA 5ETOA 2HQFA 2JL9A 3M2UA 4TLQA 3NY0A 4A8YA 4RW4B 2BJ1A 5KFHA 3W9HA 5D0GA 1T11A 3NLCA 4B3OA 4LRAA 2Z2YB 5G4DA 5DM6Q 1KBRA 2XLKA 1VGYA 1PJ6A 4J37A 4B9MA 5EUHA 2DVIA 1ACMB 4U95A 3IS9B 2J7KA 3O6QA 1ZM4A 1WSRA 1HBUA 2MEWA 1U24A 1SH0A 3I96A 1FCAA 1Y7PA 3P49B 1KFDA 4R0JA 3OTDA 1GTHA 1TMMA 3GFHA 2QFJA 4NOHA 1N88A 4QU7A 3FQLA 3EWGA 1ZAWA 1ELOA 2QIFA 4ED4A 2VJUA 4ERDA 4I69A 4BS2A 1Q82T 4CH1A 3D68A 2VA2A 3GCWP 1U8WA 4OI4A 1SJFA 3MR2A 4F26A 2OD6A 3FVYA 2W2MP 4G1QB 4OZNA 4O0NA 1A6LA 1FHTA 2QFIA 4FXVA 2R2SA 1IJEB 3KK3B 4ZPVR 3DHXA 4ZPBA 4C8MA 1SH2A 5LOQA 4YUDA 3QIPA 3BO4A 2AJ0A 2B4UA 4QW9A 3MEGA 3LPYA 3PDNA 1X4EA 4JI6J 1AUDA 1WHVA 1FD8A 2DHSA 2BE2A 4L3KA 2H3EB 1RZMA 3BSCA 1S6PB 4O3RA 2GAHC 2MJUA 4USVA 1WC6A 3QMQA 3CCMS 1T95A 1RT5A 1WEZA 1IJFB 5EGYA 1IKYA 1SJ1A 4Z7CA 3IWXA 4KIAA 1FRKA 3MM5B 4JV1A 2GMLA 5IXUA 2M52A 3DOLA 3UR3C 4RL1A 3KUGA 1WG1A 3TA1A 3NWGA 2HPUA 3GP9A 3I0RA 4KPCA 3OXFA 2OI2A 1FESA 5KFXA 4HHHA 4AL6A 1UVLA 3N5BA 4Z2XA 1D8ZA 2E5LF 1FXLA 3FNNA 3KUHA 1FTRA 1NKCA 5JUMA 3MUTP 2AGOA 1RBAA 3BKTA 2HHTA 1R8HA 4HR2A 2CJAA 3TNVA 2K1RB 3RB3A 4IH7A 4YP3A 4K4TA 3UE2A 2F8MA 1D8YA 3VAJA 1B70B 3HHLA 5KFUA 2MQNA 3CSKA 1CBKA 3M30B 1N36F 3AB2B 3Q8VA 3IRWP 2Y0BB 5HN0A 4JBCA 2XTJP 3PO4A 2KN4A 1FI4A 3OJUA 2HBYB 1UP1A 4WXWA 1IBKJ 2CJKA 2Y8YA 3CD7A 5LJ5Y 1JX4A 3BR8A 2D9OA 3VALA 1QVFR 3MPUB 4M5LA 2HMIB 1XEZA 3CDBA 1N34F 2IM0A 3W2WB 3J81U 1YBTA 2CJ9A 3NNCA 2HSEB 2B6AB 2FJAB 1N5YB 4R8UB 1REVA 3DOKB 2CQBA 2IYIA 1ZH5A 1V5IB 2GW8A 2M8HA 1EKRA 3TJAA 1N32F 4RUAA 1H7WA 2HGLA 1P9YA 1IKVB 1S9GB 4AQYF 1RU2A 2OPSA 4X4UA 2HHVA 2IC3A 4RW9B 4ZHRB 3RB4A 4ZVPB 3RUBL 1FRLA 1CJKB 4YQWA 5B0AA 2DHGA 4CM2A 2XQCA 4DV3F 4DL7A 3GQCA 1VCTA 1XMOJ 2QMXA 5LMUF 2ZE2B 2W2PP 4FNHA 3OR1A 2NR0A 5DETA 3CJ4A 4J9VA 2CPJA 4KH0B 2YNIA 3LH2S 4PXEA 4NLQA 1RADB 1KSPA 2J8AA 3J7AN 1K0TA 1X4FA 4DN0A 5T7LA 4IO1A 4ZVOB 1PYSB 4ZVSB 4WK3A 1TUVA 2DK2A 3U7JA 1LXNA 4X62J 4CO2A 1VQ6S 2HW3A 5HP1A 1U6ZA 3B78A 5IV4A 3PR5B 2WCXA 5J1PA 1GXTA 3KLIA 1BWEA 3OTCA 3KJQB 3RBEA 4NEZA 4TQRA 2E29A 1Y5NB 4MK9A 5KT2A 1U1LA 3S8SA 1VQ4S 5CD4H 4DR6J 1SC6A 2DNPA 1RT4B 2FY8A 3PG9A 3PX0A 2CQIA 2XZWA 4XPEA 4Z7YA 3DNCA 4LF5J 1Q1KA 3KLHA 3GG1A 1VLYA 1R6YA 3EZOA 3H20A 2W1BA 4MYUA 2IM1A 4DR5F 3HHNB 2M88A 1WORA 2JRSA 2CAJA 1IR1A 2RIJA 1T3NA 4UOHA 3ZTRA 3ZZRA 2YKMB 1CJUB 3GIJA 1BHNA 2DNNA 1PYTA 1VRUA 3PZPA 1WOSA 4LRFA 4JUZA 2ZBPA 4X4VA 2VPZB 3M8QA 2HFVA 2DGSA 1Y5LB 2J9CA 2N7YA 4TYAA 1CJTA 2IVYA 2A1BA 1SL2A 4DBQA 2FDNA 4Y2AA 1R8BA 4OZ5A 1HMVB 4Q7AA 1PIEA 4DZDA 2UUAF 1P6TA 3HVAA 4EBDA 1JLQB 1LW0A 1APSA 5K5MA 3VQTA 1UETA 4ZLPA 1K73T 1MROA 1NDPA 4B3SJ 1KC8T 4IFVB 1ZYQA 1HW9A 3MHYA 5L9NA 4K8RA 3MAAA 3UCZP 1R0BG 3MTJA 2E9ZA 2CQ2A 4L72B 4WKRA 4USUA 1JLGB 2EFNA 3EXCX 1RKIA 2DH7A 3Q8RB 2WHOA 1SL0A 3RB6A 4FPRA 1J5OA 3CPWR 3NGUA 4FS1A 4OHZA 2D1CA 3VAKA 3C19A 1NK5A 4NCAA 2F8EX 4ES3A 1VOMA 3RRHA 3PCOB 2BE9B 1GXLA 1X4AA 1O6XA 4KR0B 1M0SA 1ITPA 1N33J 2I5JB 1JJHA 1VMBA 4RNOA 2LP4A 3DRPB 1HNXJ 1S1WB 3QJPA 3TQ1A 1FXRA 3ELHA 3C15A 4ZPCA 1SUQA 2HFUA 1YJWS 3THTA 3I9ZA 4DPYA 5JMNA 5K8NA 1R8PA 2CVIA 5L8RC 5D4PA 1S5ZA 4CQ1A 3OPKA 4D3GA 2VA3A 2BR0A 5D6GA 3C6UB 1H7XA 3GJQB 1UJ4A 4KYZA 3DLBA 2MKCA 2AYGA 2LECA 4KBIA 2LKZA 2BRKA 2BW2A 4PWUA 2HRYA 3NWRA 4TVAB 4RUHA 2XWYA 4DU8A 5EDWA 2NXJA 2EK6A 2LQBA 2DNYA 3NBPB 3US5A 3CT9A 4DX6A 5FDLB 1GNKA 3DRSA 4RJVA 2N82B 1CJVA 4JV5F 2DNMA 3QT8A 4C11A 4WYWA 2RSQA 2QRRA 4AE5A 3KJFB 2YKNA 1UVJA 5IQQA 2ZH6A 3BDEA 5HVGA 2J76E 2BRLA 1WDDA 4NLPA 3LP0B 4ZOSA 1F5AA 4TNOA 2RS8A 3W5ZA 2DY1A 2PN6A 2CZVC 1R7IA 1HNIA 5IC6B 2C3UA 1FTCA 5F8LA 2M7SA 3I9V9 1DHMA 3I5CA 2P6SA 3HSGA 3CD0A 2HGMA 1V6HA 1H98A 1DJ0A 2XMAA 2B51A 2DO0A 4NX9A 1IKXA 1C0TB 4RPFA 1RWMB 4OV6A 1TFYA 2O3DA 4EU0A 2VFRA 3G82A 1T9WA 1TL3A 1S6QB 3CCLS 1FWKA 3T9NA 5DG8A 2J6SA 3M05A 2XZDB 3N6MA 5KFQA 3G8TA 1R27B 1H73A 2C2EA 2NYHA 2UXBF 6FDRA 3EE3A 4NMLA 2HQIA 2QLBB 2FVPA 2Q6BA 3MMAA 2VDIA 3SQGA 1P9QC 4PRFA 1X60A 2HVDA 4W90B 1RTHA 4Q8FA 4DSEA 2YNFB 4K4ZA 2AYMA 3X1LB 4OQJA 4IRKA 2X7IA 1U2CA 1RT7A 3NRBA 2CPXA 4LBPA 3IG1A 2JVOA 2L3MA 2KHDA 4DSFA 1XTZA 1TL4A 1Q8IA 3FMWA 2FIUA 4V19X 3MWBA 5HQMA 2VODA 2XHCA 1AZSB 1LW2A 3KYLA 2GHWA 2DNOA 4DLGA 4DWIA 4QIVA 4ED7A 2G9OA 3V6DB 5EWGA 2NXEA 3S1TA 1LOUA 1X7VA 2V2ZA 3R2DJ 3LWLA 5ETSA 4OMFG 1S72S 2FVRA 3PRDA 3F73A 2WBMA 1VQMS 3CJRA 1HPZB 3H42A 1SQFA 4LRCA 5F8JA 2W2NP 2A0FB 2HKEA 2IHR1 4DR7J 3E8OA 3BYPA 4EO8A 3FFIA 3ONQA 4LF7F 2PE8A 1N48A 2Y3YA 2BJEA 1YWXA 1UCNA 4NRTA 2RVJA 4UF4A 2ZOMA 2FJEB 2AJ1A 2NYIA 3PV8A 5BXIA 4BC7A 3ENVA 2ADBA 5ADZA 3JSBA 1UL3A 4OZ3A 2NLWA 4U6PA 3HVTA 2ALZA 5CCLA 3PX6A 3KJVB 4RW6B 4PUOB 1ICEB 3HVWA 1TKTA 1KQKA 2B9EA 4KGKA 3BB5A 1NKEA 1R0AB 2DY9A 2YQ0A 5KT5A 1WD6A 1FK9A 3T6JA 4TY8A 3MM9B 2OMOA 2NCKL 1QVGR 3PYEA 1HQUB 1GH8A 1NZ8A 2DNRA 2LQ9A 1F5BA 3DM2B 3EZ5A 4DG1B 4DR3J 2D74B 1SV5B 2MQQA 4CT8A 4ED8A 1NPRA 1MN9A 3THVA 2ZOFA 3P6YC 2OPRB 3T6BA 4BBYA 2HNYB 9ATCB 2RH3A 4OYZA 3W5XA 3VGTA 3TUPA 3QZ8A 2NXUA 1RTJB 1D9AA 2PFDA 2E7VA 4ED0A 4CT9A 5A8KA 2MSTA 3JSMB 1U1RA 5CYQA 2YWWA 1XERA 4K5SA 1YGYA 2MGZA 3M32A 1CSJA 3C16B 4I64A 2M70A 4F3QA 2HAIA 3C8YA 1A9NB 2BJ8A 3KMQA 1FJ7A 3TZYA 4MIAA 2RQCA 3BS9A 1PO6A 1QAJA 2Y1RI 2Y1IA 2X3DA 3L7OA 1LWFA 4KY3A 3CJQA 4WYLA 4N47A 4KGXB 1NUEA 1C4AA 1XNQJ 2VKZG 2YKQA 1WNEA 3MM7A 4FS2A 5L1LA 3VZIA 1KTQA 5C25A 2NXCA 3CC2S 4OJGA 1FFGB 3DMJB 4GVBA 2R7RA 1Q7LB 5LT5A 2HHQA 1L3SA 1W2BR 1BGXT 5HVFA 4GVLA 1SBRA 2ZH5A 4U9RA 3V4IA 4O44A 2IA0A 3ILJA 3DLHA 2X1GA 4K7QA 2R8JA 1VRTB 2GGPA 4P52A 4CRJA 4CH7A 4IR9A 2MKHA 4LF4J 2HQGA 4OLPA 3M9OB 2O01C 3L4BC 2F4VJ 1X9SA 3D54A 1N54B 1EJ7L 4PEOA 2PI5A 1AB8A 4HLBA 3HHEA 3DKDA 5CD4A 2W2OP 4NPOA 4G3IA 3O8WA 2A2DA 2E1RA 2HHHF 3NMAA 4CTAA 1OWXA 2CPZA 3I6PA 3BN4A 1TR0A 5HMYA 4XO0A 1SIWB 4J9RA 1YJTA 2FJXA 1L3VA 1MU2A 3OFGA 3W9IA 1RT3B 5LM7E 3R6LB 4NASA 4JI7F 3W2VB 2AF6A 1FD2A 4QZVB 4C48A 3K5OA 6AT1B 2WVFA 4WFNQ 3FSXA 4G1PA 3CCES 3SIPB 3OSNA 1C1CA 1CS4A 2R7QA 4A8OA 3GJTB 5GADI 4L6V3 1SIZA 2BW7A 1ZPWX 1V3SA 2E5HA 5KFVA 2JLGA 3UDLA 2KYXA 3C6TA 2N3LA 5HK4A 2K7JA 1KS2A 3EPIA 2QMWA 1PAEX 4HKQA 2XULA 2E1CA 3UDVA 4B3RF 5JVHQ 2HFSA 1FJCA 3OHAA 3PR4A 2R7SA 4DPUA 2CQCA 3CIZA 5KG3A 3I87A 5E2QA 2KT2A 1YKWA 1U6BA 2B7CB 3ENQA 1S1TB 1X5PA 3HT3A 1S1UA 3CJ0A 2CNNB 4Q44A 2H4WB 5DS7A 1N6QB 4V19J 3M9MB 1PJ5A 3SDEA 4J9PA 1DLOA 2BJDA 3PO5A 5I3UB 2UUCJ 2W8KA 3CJSA 2XS2A 3ETOA 5CHCB 4IFYA 4DSKA 4LBHA 3UCGA 3D2WA 1S1XA 4I2PB 5LMNF 2X1FA 3OJSA 4OJ3A 4LF8F 4ZP6A 1OY9A 3KHRA 2FTRA 2EFOA 4DFPA 1S49A 4WIQA 3BPSP 5EX3A 3KLFB 2JJ4D 4OI0A 5E3PA 3K5PA 3KLGA 4ZIVA 4TQSA 2YX4A 3TW0A 2VZ9A 3VVTA 5KT6A 2M5YA 1B3TA 2K3IA 3ISND 2VHGA 2LU2A 2CG4A 4ZVQB 2AEFA 3OTOF 3OTEA 4DV1J 2XCPA 1KKHA 2YX1A 1KD1T 1RAFB 2WBRA 4N56A 4M5DA 2FLPA 4MIWA 2QSWA 2B5JA 3KKFA 4DUYF 2W4DA 4ZCMA 3OUYB 4EZ6A 4RUCA 4MK7A 3DCAA 3SFGA 3I0SB 2R8KA 1MMDA 2PD1A 2GQ2A 4DXLA 3GFZA 3LGMA 1AYEA 3NS7B 3R27A 4GO5X 4WE1B 2CPEA 2OPQA 4JI3J 3OHBA 1M5KC 1S1VB 2I9SA 4DL0C 4QR2A 1TVRB 2XO7A 2YPZA 4F4KA 2KZMA 3IR5B 4Q43A 3HJVA 4CP5A 2ZBIA 3KLEA 4FZVA 1VK3A 2MHNA 3DGPA 3CCSS 2OJ3A 1J27A 1YBUA 3DLLQ 1JB0C 2EKNA 2RMLA 2E7WA 3QIDA 4UZCA
chains in the Genus database with same CATH topology
4HHJA 4UY8T 1H2UX 3ZZOA 5CYMB 1O51A 3DN9A 3I31A 3WZ0A 3K5LA 1YJ9S 4PCQA 5E0OA 4B9VA 3N9UC 3VAGA 3TRGA 2HFOA 1OPZA 2SXLA 3RRGA 1WF2A 2C28A 2DGQA 4HTJA 2Y1JA 2HNZA 2YWKA 4UOCA 5K8OA 5KFSA 3U02A 1U1QA 4EO6A 3MECA 5A8RB 2IM2A 5G0RB 5H1SV 4PQUB 4IQXA 1QAXA 1X0FA 4DEZA 1KTVA 3DXSX 4X4TA 3H98A 1VBZA 2XS5A 4GKJF 4NLTA 2HHSA 1S1UB 4IOCQ 4J9OA 4GO7X 4KO0B 2B9XA 2B43A 2IVMA 5GAGU 2CPDA 2AU0A 1L5UA 2YWHA 1ZM2A 2I2YA 3K5NA 3CGIA 3M2RA 4H4OA 4HT7A 3SSRA 1VBXA 2KYZA 4NA2A 2WB4A 2QA1A 2KFZA 4J9MA 1FVSA 1DLOB 2I5JA 2OFGX 1N4LA 3IC1A 3IR6B 4CH0S 2YH1A 1UEUA 5KFCA 1VJWA 4B9LA 2RKIA 3A1YG 3DRPA 3H4DA 4XDCA 1VFJA 4UQTA 4IFYB 1C0UA 1S1WA 5IQ6A 2EVZA 4IO9Q 1L3UA 4LQ3A 1TL5A 1OO0B 4A8WA 2GX8A 2BZ2A 4B9SA 2W25A 4F25A 1D0EA 5AE2A 3Q2SC 1NJXA 1FE0A 3OL6A 4RNFA 2KFYA 1RT6B 3IBWA 3TUJC 2LDIA 2OPPA 2WK4A 3BGLA 4RNNA 5D78A 4KB7A 5J2NA 2J7UA 4C98A 4DSIA 4MYTA 5L9XA 1HD1A 1X5OA 2MSSA 3WC0A 1JMTA 2ZKUA 1S0NA 3HZGA 1NK0A 1BQNB 3DC2A 2RF2B 5CZVA 3CDUA 3QWPA 3DLKA 3BQ0A 4ZCKA 1SKSA 5IM0A 2UV8G 1TKXA 1S9EA 4ILMA 1P1TA 1ZAXA 4ALZA 5IZHA 2A3JA 4ZP7A 3CJKA 3C6UA 1K8AT 1T94A 3E2EA 2UU9F 2ZZMA 2VPYB 1XC9A 1IBLF 2RRNA 5E3RA 2BQ3A 1NK9A 4QPTA 2K2PA 3MMAB 2UXCF 2R8HA 1YQHA 4PG5A 3D0HE 4B3MF 2WSEC 4C8LA 1MW7A 2LEPA 3GB0A 1LV5A 5GVQA 2GHPA 3ITHB 3G6XA 2QA4G 1NK7A 1NU4A 2DT9A 1TK8A 1NB7A 2FHMA 2CYYA 3W7BA 4KJIA 1FKPB 4NCGB 3DRYA 4Y65A 5A0YA 5D8HB 5DJBA 3UW1A 2DISA 2VUGA 4N77A 3MCSA 4USJC 5KFWA 3ZFVA 3H5UA 4RW8A 2B3TB 5C42A 2HHXA 3Q2TC 2ZHAA 3HDSA 3MR6A 1E6YA 3FSYA 2R7UA 1X4BA 2PDAA 5CYJA 2VOOA 2GMHA 1Y4ZB 3RBDA 4FXDA 4LFBF 1FRJA 3NBPA 2GA7A 3MM8B 1VQOS 4Y0FA 2C3YA 1C1BA 3I55S 2V4JA 2YY3A 5FJ4A 2GV1A 2OMLA 2XCAA 2HFZA 2B5JB 2GMJA 1RTIB 3QZ7A 1P1LA 1U26A 1M1KT 1R31A 5FIIA 5K8MA 2EFGA 4YMEA 3PW4A 4ID5B 2I38A 2B9WA 4IH5A 2UUCF 4MFBA 2Q66A 3I4PA 2KO1A 1CLFA 2CDQA 2DGTA 5DDPC 3EZUA 5IFMA 5E7OB 4TLRA