1V5IB

Crystal structure of serine protease inhibitor poia1 in complex with subtilisin bpn'
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
76
structure length
76
Chain Sequence
SAGKFIVIFKNDVSEDKIRETKDEVIAEGGTITNEYNMPGMKGFAGELTPQSLTKFQGLQGDLIDSIEEDHVAHAY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Subtilisin BPN'
publication title Crystal structure of serine protease inhibitor POIA1 in complex with subtilisin BPN'
rcsb
source organism Bacillus amyloliquefaciens
molecule tags Hydrolase/protein binding
total genus 22
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2003-11-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.80 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Peptidase S8 propeptide/proteinase inhibitor I9 1v5iB00
3CO0P 2Z56B 3WHIA 2Z30B 3VHQA 4K8RA 3WIUA 3T41A 4NE9C 3BGOP 2Z2ZA 2E1PA 1SCJB 2W2PP 2ZWPA 4NMXA 3GCXP 4OV6A 3GCWP 3H42A 2W2MP 1R6VA 3A3PB 3VV2B 2QTWA 2Z57B 1SPBP 3WIVA 4JP8A 2Z2YB 3QFHA 2ZWOA 3BPSP 3AFGA 2Z58B 3CNQP 3SQOP 2XTJP 3P5BP 2W2OP 2W2NP 4YN3B 3A3NB 1ITPA 1V5IB 2W2QP 3A3OB 2PMWA
chains in the Genus database with same CATH superfamily
3PYEA 2B4UA 4P52A 5J2MA 3BKUA 1HWIA 1HBUB 3LALA 3A12A 2RILA 4RW7A 4R0EA 3IG1A 4DR3F 4DL2A 5LL6d 4DZDA 1U8WA 1TL7A 3MMCA 1T7PA 1H2UX 1Q4RA 1S76D 2W1BA 4LSZB 1QSSA 2ASYA 2XGPA 1HNXF 1X4HA 4ATNA 1X4GA 4D3HA 1QVFR 2JEGA 3US5A 3OTOJ 2FDNA 4HHUA 2C3YA 3N5BA 5K14A 3EVWA 4MYTA 1GMVA 2BDPA 4NCAA 3DOLB 3QZ8A 3BPSP 1XMOJ 3BDPA 1X5PA 2JLGA 2XI3A 1M5VC 2C3MA 4B9UA 2LA4A 4CNZA 4FNHA 1WC5A 1Q86T 4KJIA 2D3OR 4DF4A 4QR1A 5J1PA 2DKOB 2EG2A 3C6TA 1R27B 4KHPF 1TUWA 1HIYA 4R5PB 2NXEA 3G96A 4Q8FA 2JEJA 1UVNA 3KK3A 4QWBA 3AD9C 1DAXA 3OVSA 4B02A 1C0UA 5DDPC 3L4BC 4WTOB 3TR5A 5HLFA 2ZHBA 4B9NA 5D4NA 1SIZA 2HSEB 4YOEA 2HW3A 3KG0A 2CQ4A 4JB8B 4FYWB 2HRYA 2V2KA 4LF5J 2DR5A 4ES1A 1HMVB 2POKA 2CWXA 4NA3A 2KXNB 2HNZB 4FF4A 2OAUA 3VAMA 1QUVA 1EARA 3P3DA 2IDLA 1RWMB 3GR1A 3DLHA 1Q8IA 3JSRA 5KT5A 1SV5B 1S99A 1MMNA 2R8KA 1RHMB 2ASDA 2MZSA 2EEYA 1SC4B 1GXUA 2OMOA 1SJFA 4P2XA 3OR1A 2X1GA 1F0XA 5D3GA 3MCNA 1RWKB 1ZS6A 1KLNA 4ED3A 1KR4A 3ZZPA 4B3OA 3HVAA 2DGWA 4ES3A 3OR2A 3W7BA 3UD5A 1U2RA 1TKTA 3UNYA 4J37A 2B4OA 2MKJA 4M5KA 3NNAA 4ZKAA 2F8EX 3R5CA 1EAYC 2DD8S 5KFPA 3CJ3A 3CVKA 1VK8A 3I96A 3I5AA 1NNDA 2GO8A 3I82A 5LSLA 4X4VA 1MU2B 4UY8T 3AB4B 3G71S 2FQQB 3WX8A 3B6BA 1RTIA 1EP4A 2HWHA 4DUYJ 3H59A 4RZRA 1T03A 2HHUA 2ZKUA 4HEA9 4P9SA 3PG9A 3KJVA 3VGSA 1FERA 4ECZA 3CCZA 2UUAJ 4DPYA 2BXJA 5KG0A 2L08A 1MWYA 4IQXA 2AEFA 5SZTA 1JLBB 2KHCA 5T7LA 3WX4A 1C0TA 1CULA 2IMWP 2OLWA 4IOAQ 3BZQA 4TQRA 1KS2A 1RADB 3L7UA 3M8WA 1S6PA 2LEAA 2ZH2A 2V4JA 3I56S 3CDBA 2I2YA 1N88A 2HGLA 4HT5A 2OHDA 2G4BA 4IUFA 2V8HA 1NSQA 4OYZA 1ZA2B 4YUDA 3GYXB 2LXFA 3HVWA 4RNHA 3J81U 2R7TA 3DI6A 1UZDA 3OTEA 5F3TA 4XTTA 3OUYB 2EK1A 2FC9A 2FGOA 4H4KC 5KFZA 2KXHA 1RAAB 1LXNA 3G87A 5IT0A 2XI2A 1IJFB 4EUVA 4JI3F 4MYUA 4AFFA 1H73A 2AGOA 1IWGA 3TJ9A 2XCPA 2XWYA 1I94F 3LGHA 3ZTOA 3KLEB 1U2CA 3SSSA 2ZD1A 4FBTA 2QG9B 2IPOB 2N4CA 3JTNA 2HFVA 4NMLA 2JFKA 3U27A 1RSCA 3L9ZA 5AT1B 2XG8A 3HZEA 4K7QA 4E8UA 4C11B 4F0HA 2BQUA 5IZHA 2RB7A 3AJ2A 1H7WA 2Q43A 5T41A 3PV8A 3HM9A 3BGOP 2ZBCA 1FWKA 2QIFA 3EXYA 4CO3A 3KTQA 4DSJA 2M0GB 4WFBQ 1QAIA 3HJFA 4PG5A 1R3NA 1PYTA 2K3KA 1VCTA 4DBQA 3SZ2A 4A8WA 2XLKA 2X1FA 4BCAA 3T41A 2CJ9A 4K4VA 1FFWB 3I55S 1UVKA 2KRRA 2VG5A 1O51A 4ENOA 1HYSA 2E1CA 1PAUB 3HHDA 5J1EA 1DY3A 2XO7A 4EMDA 1GTEA 4L74A 4NXMF 3RAXA 5K8NA 2AZ3A 1MWZA 2KFNA 1SQFA 1LOUA 3OHAA 1L3VA 1VRTA 3E01B 4P73A 2F8MA 3Q23A 1KONA 5CYJA 4JYAF 1IBKF 5LJ3Y 3H42A 3QQCD 1WC1A 2RS2A 2MKCA 5LMUF 4KBIA 1N33F 4YB6A 1P8GA 1UWBB 2M3DA 2W9BB 4F67A 1M5KC 4PG7A 5DJBA 4OI2A 3UVJB 5E3AA 3UD4P 4BC7A 3EUNA 4N7TA 1KOHA 3GSDA 2HNDA 2BE7D 2BW7A 2F9JA 5ETOA 3JQMA 4C8KA 3HHLD 1BLUA 4DL6A 4ZOSA 4I2QA 1FFSB 4K5SA 2GFFA 3TQEA 4XAKA 2QYCA 1YRTA 1CJKA 5J2PA 2A0FB 3KNAA 3QGIA 4Q45A 2XY7A 2AJQA 3VZIA 4Q43A 4C7QA 1TU0B 3CJ5A 5CHCB 4DL4A 4M5NA 4OV6A 2RS8A 5KFBA 4LUBA 4RU9A 3C3LA 4S0MA 4LIRA 3M8PB 2AJ1A 2ADCA 4A8SA 2KT5A 4DZ6A 1L3TA 2OTJS 1RT6B 4WIIA 3ENQA 5M2UA 4H4MA 4JV0A 4WFXA 1Q53A 4CLYA 2VF3A 2JFDA 4GVBB 2MZTA 3H0PA 3G6VA 4M5GA 5A0YB 1CBKA 1LWEB 5AE1A 4U95A 2FY1A 2W2OP 4A8KA 5M2RA 1PJ5A 4USUA 2ATLA 2FVQA 3NNHA 4JV5J 3C2PA 3CCWA 3PFOA 1TK5A 2MEWA 3MMAB 1JJ2R 1N0UA 4A8FA 5I42A 3CCUS 1SH3A 3MWBA 1SKUB 3IRXB 3FBCA 3KK1B 2FVRA 2OEJA 3PW7A 3CJTA 4KTQA 4AQYJ 1GT8A 3RB0A 2D3ZA 3KJNB 4ZVUB 3H90A 4C48A 4YN3B 2DNYA 3E2EA 3AQOA 4LF4F 2L9WA 3KMQA 4QWCA 2OPPA 1WG1A 1FRJA 3TAQA 2DBBA 2DGSA 3DLKB 1WSRA 1RU2A 2BJ7A 4M5MA 2JLFA 2GX8A 4F4WA 3HHLA 2J0SD 1FDDA 3ZTQA 3H25A 1TKZB 4YY3J 1N36F 5K8MA 2G2OA 1NDPA 4ED4A 2MKHA 2GS8A 4URQU 3BGRB 2DNGA 3RW6A 5B08A 3EGZA 2BJ3A 2OPQB 1JLQB 2B9WA 4EGLA 1N6QA 4ZPAA 5DZ6A 3O6QA 3RRGA 3OSNA 2WVBA 2VOPA 2BQRA 2E5LJ 3ENWA 2B51A 3R5AA 3K17A 4HHJA 3G86A 4IR9A 1RA6A 1K1QA 2XULA 2UV8G 3QMQA 4IDKA 1Z1ZA 1ZM2A 3V81B 2DTJA 2IVFB 4YQWA 1SUQA 3DLBA 1UPPA 2RKIB 4OHZA 3J80U 3BR8A 1TL3B 3IO1A 4NZ6A 3TUIC 1GFWB 3UQSA 5EX3A 3VQTA 4F3QA 3I9ZA 1TK8A 4TN2A 4JBCA 3QJLA 1TVRB 4ZPVR 4NYOA 4NI2A 2M8HA 1X5SA 2OH2A 1RTHA 4KE5A 2BJ8A 4DQIA 1TKXB 5M2PA 3P8BB 4M5JA 1N56A 5DGAA 1Q16B 4F4AA 3D66A 4U8YA 3QRRA 1AFIA 3WZ0A 3KJFB 4QIVA 2YNGA 4IO9Q 4Y2CA 3I0RA 3DRSB 4KV8A 2B4VA 1N34F 2VASA 4L3NA 4CO4A 4D3GA 2YKMA 1RT4B 2EK6A 3LGMA 4MIWA 2Y1RI 4DR3J 3H5XA 1HD0A 2HMIB 1FESA 4ALZA 2HZCA 4HLBA 1PKUA 2XGQA 2M4MA 1G1XA 3GIIA 4ELTA 1S1WA 1FDNA 4U7UD 3JB9k 2W9CA 2JWNA 1RHKB 2BM1A 4GKKF 3TVZA 1Q78A 1IR0A 3CTRA 2VC0A 1VC5A 2RQ4A 3MI7X 2J76E 8AT1B 1R0CB 8RUCA 4ER8A 5IQQA 3ZC4A 1VBKA 4DG1B 3RUBL 2CIMA 1KFSA 2XS7A 2LQJA 1OMSA 3M05A 3THTA 1UZHA 3N0VA 1P9QC 4B9LA 1HBNB 4HI2A 1JWWA 3B82A 2LXUA 4XPCA 2VFRA 1SCJB 4DPOA 1HPZA 3MUVP 2VJUA 3OTCA 5KFCA 3DRYA 1FJEB 4MT1A 3LTOA 2CQCA 2CVIA 5LXRA 1IKYB 2W8KA 1X4AA 2E29A 1RAFB 1FJGF 2Y9HA 3LQVA 4PUOA 4QWDA 2DNMA 2BBEA 3ADAC 3DOKA 3AD8C 1ZOTA 3KLFA 4J9UE 1XWLA 3FBBA 3TA2A 4BLGA 2QLBB 5D4PA 5DS7A 3JTPA 5EGYA 5CD4A 3CJKA 1RT5A 4ECVA 3FSIA 2C2DA 2HHHF 1YJ7A 2VBXA 2GMJA 4MKAA 2Z2ZA 2VFTA 4OHWA 2ILYA 1UJ5A 2C2NA 2PT0A 3MR3A 1VC6A 4KAIA 4I2PA 3RB3A 1DQAA 2BX6A 5B0BA 4WFNQ 3DOMB 3HXMA 1T9WA 2HZVA 1WTFA 4JV1A 3LA0A 1NPPA 4ES2A 4HTIA 2XMTA 1VBXA 3W2WB 2E5JA 4OYXA 2YNFB 3N28A 2IRYA 4NA1A 1TL1A 2PO4A 2G13A 2CPYA 4BS2A 2BOPA 1KQGB 1C4AA 3N01A 3PEHA 2RUSA 4UUWA 2WVDA 3NBPA 3EMTA 2MSTA 4IH6A 4UY85 3RW7A 4QIFA 4ECWA 2ACYA 1S9EA 2J9DA 3BV8A 1Y00A 1PG5B 3V6DB 1DTQA 2JRSA 1Z2LA 1PJ7A 2KJWA 3PO5A 3TYTA 2F5GA 3ZZTA 2DNKA 1KEKA 1SQEA 1Q82T 4WF9Q 2JJ4D 4M95A 5RUBA 1PJ6A 2U1AA 4OI4A 1WNEA 4CLFA 4RU2A 4PXBA 2C28A 1N54B 3LWLA 3DYAB 2J5AA 2PFFB 4DV2F 4WZQA 2OPRA 4FS2A 3FBEA 1NK9A 5HSPA 1TUVA 3ICLA 2D69A 1B0VA 4ID5B 5HBMA 4TYBA 2XNRA 2UV8A 3BO4A 2EW9A 3FMWA 2CPDA 2YY3A 3TP2A 1RJJA 3HSJA 4UW2A 1OS5A 2DHSA 3KLIB 3QT7A 3MF5A 1RWPB 3DKDA 4USJC 2ABYA 4ZP8A 3IR7B 3K59A 3HHNB 2JL9A 3BREA 2DO0A 1D3WA 1S48A 1FNXH 3BR9A 3TOQA 1CPZA 2ZOFA 3FDSA 4FKXA 5LSOA 2PDAA 4FF1A 3LP0B 3GTYX 2ZITA 2G2YA 5AXLA 1RWUA 5BYRA 4TYAA 1YQHA 1V9OA 3T1YJ 2CZ4A 1RQ0A 3O3LA 3AODA 5ETPA 3QGGA 4URSA 3TQ1A 1RWVB 3DDIA 4ZLLA 3MEEA 4YB1P 2VU5A 5IOLA 5D8HB 3W9IA 2MQ8A 5CABA 3O2IA 2ZOMA 1I94J 3DN9A 2OPSB 3D54A 1HBMB 1H2VZ 2LECA 1HQ2A 1SC3B 3Q8RB 5CYQA 1K0VA 2ZH5A 2JNJA 3LPYA 3R5GA 2DXDA 1FK9B 1Q8LA 3U02A 1U1KA 3W2VB 2WTFA 1VGYA 2VONA 2B5JA 1U1PA 5HMXA 4DFJA 2R42A 4KGXB 3JAMY 1QUPA 4DDFA 3W65A 3UDCA 4OI6A 2QO3A 2ZFHA 1ZH5A 3PKYA 2H48B 2MQNA 1AFJA 1U6ZA 4OJ1A 2HPUA 3TA1A 4NLTA 1YSJA 4HHHA 3MPWA 4X62F 1K8AT 2OMLA 2IVYA 2JDJA 3CGIA 5L39A 4Q44A 3IGVA 3HPOA 1AYEA 4U7UK 5K8OA 1YJWS 3OJSA 4KO0A 2A2CA 2A18A 1UA0A 4I56A 3HX9A 1YVFA 1H0HB 3OT9A 1NKEA 3QAEA 4NXMJ 3WBZA 1FE0A 1IBLF 1QTNB 3NCPA 5KFLA 1E6VA 2LEBA 1R89A 3THPA 1PGZA 3KG4A 1RT2A 4JYAJ 5H9EJ 2ZJRQ 4CP5A 4DI6A 1IBKJ 1RZMA 3CCLS 2WZ1A 1XERA 1RHJB 3NWGA 5LMUJ 1N33J 3SV3A 3CMES 3M6VA 3R27A 3RBXA 3TJ8A 4F50A 1JLAB 4OFZA 4OX7A 1LWCA 3I5BA 2DH9A 5IM0A 5KFEA 5LXYA 5HROB 5CD4H 1TUGB 2G1HA 2BR0A 1GNKA 3ZZ0A 5F8NA 3LP2B 3TA0A 5HVGA 3GIMA 2ZE2B 3FC9A 2KYXA 2ZC3A 3P5BP 2WB1D 2UXDF 4PXCA 3CW2C 4ZMMA 1XNQJ 2DITA 1C2PA 1IKXA 1DURA 2H51B 1RAJA 2C2OB 2HEKA 2KVQE 4Q0BA 1H2TZ 5C25B 4IG3A 2LU1A 4B3RF 3JS9A 2WBMA 2KT2A 2ZEJA 2EC2A 2W4CA 5D6GA 2AYBA 1P1LA 5J2NB 2FVCA 3IAM9 4K5RA 3CJ2A 4DCOB 2IHR1 4ZLJA 1RHUB 5DDQC 4U96A 2RQKA 3MXHP 2YH0A 4ANEA 3T6BA 3ZTRA 1R7IA 3ZNJ1 3EPGA 1BQMB 5EN1A 4PEOA 3OPKA 2DY1A 2UXCF 3NL0A 1J5EF 2FJXA 1WF0A 3IC1A 3CC2S 2MQOA 4MKBA 1OY6A 1QSYA 2R8JA 2DHGA 2CQ2A 3DLLQ 2YNHA 2V9KA 3ZO7A 3OVAA 4J91A 3VZHA 4LF2A 4RR5A 4M5IA 1VC0A 1VHFA 5HJYA 1QE1B 3QT8A 3M7VA 3VAHA 1FEEA 2FYXA 3TANA 2UUCJ 5H9FJ 2HIQA 4QQBA 3DRPB 2OSRA 2B6AA 1P1TA 3I5CA 4M5LA 3X1LB 4DX8H 3GONA 1X9MA 2FUG9 4CDIA 3NS6A 4ED7A 1N4LA 4L6V3 1T11A 5GMDA 2HGMA 5LMNF 4WE1A 2KVIA 3NEKA 5E33A 2R2SA 1JQGA 4C0BA 4XK8C 2V2QA 2DNHA 3CIMA 2MYFA 1H74A 4LF4J 2H4YB 2W24A 1RTJA 2F4FA 4HI1A 1WOPA 4I6WA 2ZZMA 4X65F 1JLGB 3BM7A 3PYGA 1IKWB 3V6JA 4PYAA 2V69A 3TWZA 1KOOA 3H5YA 3MM9A 3K5LA 2AJ0A 4ZVHA 2WCXA 4ZJLA 1VYAA 2WVCA 3CC4S 1JLEA 4B3MF 3MOJB 4LFBJ 3QGHA 2HHWA 3RJMB 4F4XA 2IY5B 2CPJA 3UR0A 3NGKA 1RYRA 3D28A 3GE9A 4DPTA 4ZP7A 1O5JA 4N41A 3M2UB 2B9EA 2I6WA 3G8TA 2AJ4A 4CTAB 2Q66A 4HYKA 2AIRB 3AD7C 3W64A 5EWGA 1TV6A 2QMXA 3QNWB 3HF5A 1RT1A 4NLPA 5F0WA 1SH2A 4DS4A 2H5JB 2J0QD 3P96A 4L3KA 5B0FA 4RW4B 1F5BA 2QL9B 4PPZA 1WHXA 3HCXA 3J7A1 1LW0B 4M63A 4RW9B 2DCLA 2MLXA 1U1LA 1I5OB 4LSNB 1VRUA 1IBCB 2HYIB 2FIUA 2NCKL 3ETMA 1VQKS 2DVIA 2AKWB 1IR2A 5A8WA 5FLXY 3R2DJ 4J5OA 6FD1A 3N6NA 3H2UB 1FDAA 1LFPA 3MMBB 3T1HF 1S6QB 3CMAS 2X3GA 2E1MC 3IWXA 4G1PA 2HQIA 3CD5A 2MTLA 4OHYA 1ZPVA 1YX2A 1N34J 4YR0A 2AQ4A 3OXFA 2J0XA 1RT3A 3OL8A 1HNVA 1R43A 4H4OB 3C66A 1NJWA 2HHXA 2XZTB 4F25A 2NSCA 4LSLA 2J9CA 3BSNA 1RTHB 3A8EA 3GMGA 2DISA 2BE2B 3F73A 3CD0A 3GYGA 2XMVA 1U24A 2XS5A 4GKKJ 3N5FA 1PO6A 2IRUA 4CM2A 4NEZA 2I1RA 1FVSA 5G0RA 4PG4A 3IBWA 5LT5A 2O66A 4YMEA 3BGLA 1T9VA 3GSIA 3DXBA 4RBUA 1PC4A 3M4XA 3HD1A 3M9OB 4FXVA 3R5BA 2Z2MA 2LEPA 4JI5F 3NKYA 2DNQA 4CT8A 5D0EA 4IOCQ 2K7KA 3DGPB 4CI0B 5E3CA 4ZLPA 2MDAA 2W2NP 2ZHOA 3B8HA 4KH0B 3JXOA 4O3RA 2KI2A 4U67Q 2AX0A 1FI4A 2O01C 3TAMA 3Q8QB 5KG2A 2BANB 1MSWD 1RT7A 2GMLA 2MJNA 1KLMA 1FJGJ 2EKYA 2PA8D 1D09B 2I8EA 3GFHA 2M52A 5F0UA 3CT9A 1U1MA 2B9YA 3LWMA 3PR5B 1Z4UA 3MPDA 3GLJA 4NA2A 2HHHJ 2HFNA 4DU7A 1CJUA 2R7WA 4QR2A 3AXKA 1HR0J 1WOSA 2MZJA 4ILRA 4RLEA 1BMQB 3DM2A 2MY7A 3D3BJ 4H4KA 1OPZA 2IC3A 3DOKB 4ECRA 2JVRA 4L73A 1U7LA 3G82A 1URRA 5J1NA 4NLYA 5KFAA 1YG0A 2Y3YA 4UUXA 1YBUA 1MW7A 1X4DA 4OZ5A 1RHRB 3O8WA 3H7HB 2HVDA 2MHNA 1JMTA 3R5DA 3HT3A 3MAHA 4C97A 4WP9A 3D6MB 1ZTTA 3PHEA 2GHPA 3VALA 3MUMP 5C24B 2RHSB 1SJ3P 3G6ES 2YWEA 4ED0A 2FC8A 3D7SB 4RNMA 3CCJS 1WUUA 1FCAA 3UO0A 4CO5A 3BH7B 2R7VA 2BYCA 2EBGA 4ZPBA 2VPWB 3AHPA 1FXDA 1LEOA 2C2KB 4DR2F 4DV1J 3DLGB 2OI2A 1JLFB 4OX9F 5GADU 1FX4A 2PC6A 3RTVA 2VFUA 2GMHA 3QO9B 4C3KA 2E1RA 2HVZA 2BACA 1F3VA 3IAS9 4J9VA 3DLEA 4USHA 1SPBP 4CO2A 4LJMA 3IBFB 2L9DA 2CJAA 1M5PC 4ICLA 2XWXA 4BHQA 1XQIA 4ZK7M 2IBKA 4DV2J 4B08A 2GVDB 4MK9A 1EIYB 1Y9OA 2AJFE 3RBZA 1UA1A 1KP6A 4C0HA 3FFIB 4BBYA 2XMKA 1HQEB 3C6UB 1NJIT 4Q8EA 3IS9B 2GO9A 2R3VA 1DHMA 2CNLB 4PR6A 2M88A 4R0JA 3MM6A 5E2QA 9RUBA 1RYSA 3D0GE 4KGZB 3M1VB 2KHDA 4NE9C 3POTA 3M8RA 4X64J 4KYZA 4NL5A 3TZZA 5KFQA 3D9BA 4WYWA 1L3KA 2R2TA 3EVOA 3K5MA 2R2UA 4P74A 5AJ3J 3IFEA 2HK2A 5EWEA 1KRPA 3KHLA 1JJCB 3HVRA 1UFWA 1Q8KA 1RTZA 1E6YA 4IFVB 4DFMA 2IYGA 4RNNA 3MUTP 4ECQA 5B7WA 1DRZA 1UVIA 2HNYB 2CPIA 2YNIB 1RAHB 3MZIA 3BF4A 4NLOA 1K0TA 1VLOA 5HAOA 4X4SA 4ZVPB 4OYAA 2YWHA 1S1UB 1ZAWA 1KFDA 2RD5C 4LFAF 1JJ4A 3D67A 3Q86A 3R8YA 4Z37A 2ASJA 3LP1A 3EJMA 3EXCX 4USTA 4G6VB 2RIJA 2IJFA 2UVVA 1WJ9A 2ZH7A 1RABB 5KFHA 2KKHA 1FKOB 4DV4F 3BBBA 4Y2MA 1WDDA 1KKHA 3QATA 2M7SA 1XR5A 1IQTA 2EFOA 4N8OA 1TELA 3KWMA 4GKJF 3MM8A 1X9WA 2WSFC 1FTRA 2OEMA 3R6GB 3O44A 1W2BR 4C9DA 4IRDA 1X4EA 3RYLA 2OELA 3TZXA 3W3SA 5A8KA 1QAXA 3GB0A 4E0DA 4I7FB 1LWXA 4DR6F 4HACB 1Y3JA 2EFQA 9ATCB 3ET6B 5LM7E 3M6WA 2QA4G 2V6AA 1M5SA 1BHNA 1S1TB 2WOMB 4P71A 2AYGA 2EFGA 3C15B 3DGVA 1UCNA 5DM6Q 1Q5YA 1Q8BA 2QA2A 2RMLA 3JQKA 3RR7A 3N6LA 1IBLJ 4QU7A 3TAPA 4R8UB 2C22A 2BA9A 3PNIA 3H20A 1SQGA 4YFUA 1AUSL 5B0CA 3IA0A 1MMDA 1S49A 3QJJA 4YP3A 2EVZA 1VR6A 3DHWC 4UQTA 3QLHA 3J81j 3DMJA 2HG4A 3QT6A 2WONB 3LO3A 1GAOA 3B54A 1NK5A 3DDKA 3TX0A 2M5YA 1V5VA 3ITHA 1OPIA 4ITSA 4KR0B 1O6XA 1N5SA 3C8YA 4ZS6A 4DR4F 1KQFB 4JI7F 3QYYA 3E3XA 2LYVA 4B3SJ 1Q81T 1LXJA 2VA3A 2PSZA 3RBEA 1HNIB 2KXFA 2UXDJ 4C8NA 3I0SB 2CPHA 4USMA 1QAJA 2KFZA 2ZH3A 3BYPA 2YBVA 4KHRA 4OMFG 2YX7A 4ZHRB 4IRKA 5DDOC 4F2RA 2FLPA 2M9KA 3NGUA 4PKDB 2BV3A 4TXSA 3MURP 2MPUA 4B3RJ 1J5OB 3MTKA 2VG7B 1EKSA 3N4WA 3X3UA 4OYBA 5I3UA 1FKPB 1S6OA 3PRVA 3K89A 4ZP9A 3D5MA 1PSDA 5DETA 1RBAA 2GQQA 3V6KA 4KKOA 1T05A 2NXJA 1S79A 4ZDNA 1KWMA 2ZBIA 2YQ1A 4B3TF 2HS0A 2WW4A 4C3LA 2CPZA 4OQJA 2D41A 4HKQA 5AXMA 1C1BB 1WKKA 2UXCJ 3MAAB 2DRDA 1DBDA 1NSPA 4EZ6A 2F4VJ 3CF5Q 4Z7YA 1RK8A 4HH1A 3AAWB 1RBLA 3W5XA 2IFXA 5IT4A 2C42A 1HARA 2DRAA 3T19A 5CZVA 3FRZA 2XEXA 3TVYA 4DCPB 1NXIA 2M2BA 2IAJA 3PW2A 2HHQA 1WELA 1C4CA 4IH7A 3H98A 3NG8A 2XC9A 2GGPB 3AJ1A 2HHPA 2PMHA 3KUGA 3Q0AA 3JQJA 4ED1A 4QIWD 4P6QA 1AXQA 4DL5A 2HS4A 4QBUA 2H5EA 4V19X 2E66A 3FVYA 1H72C 1RTDB 1S97A 2F1FA 5LMNJ 4OV1A 4L72B 1REVA 2E9TA 1I1GA 3AOBA 2P6TA 2FHJD 2HQGA 1BY9A 3QIPA 4JI2J 3MEKA 4QJVA 4N5SA 4FF3A 4LF9F 4NXNJ 2PI4A 2K1RA 1NDCA 3BGFA 1U09A 2DIUA 3VVTA 5C42A 4X65J 1PCAA 2C3OA 1SI9A 5J2QA 1CS4B 3D0IE 3NGSA 2V0NA 2BUNA 4QWAA 1B64A 1FDBA 1FRHA 1WHVA 3BPDA 3HHEA 3ENVA 1T8EA 1S12A 1HNZF 1XIQA 2WVEA 2QA4S 1HL6A 1MROA 1NK0A 4B3MJ 1S9FA 1UMJA 3G6XA 3Q83A 1VQ4S 3MCOA 1FO1A 1MMLA 4MK7A 2B0GA 3W5YA 1UVJA 4EWTA 3SDEA 1NDLA 5GMEA 2RRBA 4J9LA 4TLRA 2ZC4A 3I31A 5I4MA 4PRFA 2JC0A 1SJRA 3CDWA 3HVTB 2UVUA 1SL1A 1IWAA 3PHTA 2HQFA 5IWAF 2B43A 3ZZYA 3C14A 3EGNA 4TY9A 1EJ7L 3D1QA 3M30A 3UDVA 5CCLA 3J7YI 3ZZZA 3T1AA 4YHHF 1R0AA 1BGXT 4PWDB 4RW8B 3SIPB 3G6YA 2Z4PA 5F3ZA 4K4UA 1XNRF 1IKVA 4TKTA 2FHMA 3GJTB 3IBCB 1HWKA 4RWWA 3H4DA 4RW6B 1OYDA 3PW4A 5E5NA 2AEJA 4G1QB 3VQSA 3TVKA 3T1HJ 2QTWA 1WHWA 4DFKA 3R6LB 4WFAQ 4AUKA 4MFBB 4OYOA 3TUJC 4PAAA 3CJ8A 2ZBRA 2QSWA 3DU6A 4LF7F 2R2RA 5A6WA 4O4GA 4OHVA 4QYZK 1HKAA 1YZ7A 2BJ1A 3G8SA 1Y5LB 1UJ6A 3PTWA 2JZ5A 4NLXA 2Z56B 3C16B 5L38A 1YDLA 1YITS 3D6HB 2Y1IA 3NP5A 4X2BA 1S1VB 3D0HE 3W66A 2PI5A 1IQZA 3F0NA 2FHJA 3OJUA 1MN9A 4X84A 1W25A 1WD6A 4NCGB 5KT4A 2Q6BA 1HA1A 4CLTA 1ITPA 3OFHA 2QZ8A 4Y2AA 2RF2A 2CNNB 2IM0A 1J27A 5IV4A 1M1KT 3KLGA 2CPEA 5A8RB 5CYMB 3SQGA 1NB2A 4JI5J 2YKNA 1U47A 2PA3A 2HKEA 5THWA 1U1RA 2W2PP 3Q8SB 1HI1A 4LQ3A 4K0KF 1AW0A 4PZVA 4JI4F 2E9RX 4HTJA 4LFCF 3T5LA 2RUGA 4ZLNA 3FMBA 5EX0A 1BUXA 2VV5A 1NKCA 2F65A 2UVRA 2ZZNA 2G1DA 2FD2A 3CJSA 3KDOA 4IFYB 4HDHA 1HBUA 2CJYB 3W9HA 1UWAA 5DM7Q 3OQ2A 2ZNYA 5GAHI 3ILIA 3HSDA 4X4OA 5KOWA 2D7SA 3M8ZA 4Y28C 1BQNB 3HLUA 2E5HA 5MAOA 2DIVA 1OJ4A 3HD2A 1VQ5S 5F8IA 5KFNA 2HFSA 2ACMA 4WPAA 3NLCA 3NAIA 1C1CB 2ALYB 1I6JA 4HH0A 1DZ5A 1EQ0A 1U1QA 4X4UA 1BE4A 3S6EA 1S1XB 3DOLA 2WK4A 5KFKA 1K9MT 3LAKA 4A4JA 3HP6A 5F9LA 1B3TA 1Y3KA 1QD1A 4I0WA 1QSLA 3MM7B 5FD1A 1GMWD 3PIOQ 4DPWA 2I0XA 5D0GA 2FJEB 1UEKA 5CA5A 1S7HA 3M2RB 4R5PA 4OLPA 2ROEA 2CPXA 4QIGA 1TR0A 2BJEA 2HQDA 3IM8A 4M94A 5L9NA 2AYMA 3SFUA 4DSLA 3KOAA 2B8PA 1TAQA 3NWRA 1XBWA 2C2MB 5KG5A 3MTJA 3GU0A 3RBDA 4EEYA 4IQMA 4N47A 4DQPA 3M2VB 2AT1B 4MKVA 1KTQA 4WU2A 4DR2J 1VIXA 4AL6A 1GTHA 2RRNA 4OX9J 4NMXA 4WU3A 1HMVA 2MJUA 2P8IA 2A2DA 3EX7B 3PX6A 5HP1B 1RWNB 1VI7A 4J9RA 3OLAA 2MGZB 2LMIA 1EX8A 1PC5A 3KHGA 4QPXA 1RAGB 1RKJA 5HO4A 4DEZA 2KO1A 4CQ1A 2NZCA 1SV5A 3H5UA 2VC1A 1RUSA 4NLDA 4PG8A 1OIAA 4DL3A 1TMMA 2R7OA 3CCSS 2W25A 4ECTA 4LF5F 3ZFVA 4GRSA 2N4DA 4NYZA 3KHRA 3BBCA 3RU0A 4DR5J 4UTGA 3W5ZA 5L1KA 3MPVA 2NPIA 4EO8A 4P10A 4QWEA 4OZJA 2DXEA 2UXBF 1HBOB 1HQUB 3V6HA 1R8AA 1CC7A 4DF8A 4UOGA 1AROP 1WTBA 1H6KX 4NX9A 4KH1B 3BYRA 3PR4A 4WBFA 1KQSR 4TU8A 3H2LA 2I5JB 4EBEA 3IR5B 2AZ1A 1NLKL 1NK8A 3BBFA 4WFZA 1T95A 1FVQA 3HMJG 4FNIA 2ZM6F 3NGTA 2MQLA 3TRGA 3ZTPA 4J7CA 1MU2A 4OYMA 5B0GA 7AT1B 1A0OB 3U1LA 2MLYA 4FPRA 2HRUA 4YB7A 5KG7A 1NSAA 4PQUB 3M8YA 1GMWA 3UNGC 2MSSA 2LKZA 4A46A 2PE8A 3MEDB 1MN7A 2P5VA 2OP5A 2NS1B 3MECB 2CADA 4DPUA 3QRPA 2B7CB 5ADZA 2DXFA 2CG8A 4OZ0A 1TL4A 2HAIA 3SYZA 5KFWA 4NRTA 1ZM4A 4IG0B 3QWUA 4LVOP 5KFRA 1N5YB 1CQMA 4ED5A 5K20B 1JLBA 1D9FA 3W61A 5MLCV 5LJ5Y 4E2FB 1ZA1B 3PXGa 1DLOB 4NEYA 4DUYF 5KG4A 4K4XA 4DV4J 1NMEB 4ELVA 1WC4A 3IM9A 1UPMB 4GKJJ 4CYUB 2XMJA 4TY8B 1FRKA 1FTCA 5SUHA 1CJVB 1S0OA 2KL8A 2VA2A 1S0NA 2UUAF 2G2ZA 1NK7A 4Y3CA 3ZZRA 1SJ4P 3JYTB 1T02A 2HQ3A 4DR6J 1F5AA 1UETA 4J9MA 1LFWA 2AGQA 4RNOA 1Y0HA 1YHQS 4N56A 3OUYA 1WKJA 3AOAA 1GEHA 1LK7A 4BWMA 4OYPA 4QZVB 4B17A 1UVLA 5BR8J 3VWSA 4CLZA 4LF6F 4O3OA 4KFBB 4FXDA 2XHWA 3OBIA 2RQMA 3KLEA 2MQMA 2K06A 2CDRB 1HW8A 3V5RA 2CRLA 4B9VA 1IBMJ 1SC1B 4O3QA 1DFDA 3JSMB 1Z2ZA 1YZ6A 2GCFA 2QL7B 4ANCA 2N3OA 1SBRA 3CDAA 2B7BB 2VQFF 4JI7J 3Q22A 4C11A 4X66F 1LKZA 3QZ7A 3K0JA 1RGVA 1NUEA 1VISA 1X7VA 3A3NB 2XCAA 4ZJQA 1KTVA 3KLHB 3GQCA 3AH6A 5IT9Y 2V2ZA 2GW8A 4DSIA 4DR7J 2VPXB 4KT0C 3PACA 1IVZA 4HT7A 2RJZA 1KVJA 4Y34A 2JOQA 2VZ9A 1VQYA 4Y00A 3HZGA 2LP4A 3ZNUA 2GVZB 3R7BB 3EWGA 2DGUA 4QOTA 3ILOA 1CC8A 1EB0A 2FJDB 2W2QP 2MZ1A 3E01A 1JLCB 4B3TJ 1R6YA 2RH3A 2ZDPA 1ZAXA 4IRCA 1F60B 4DV0J 3I9V9 2RDIA 1X0FA 1M1HA 1CJTB 2QX0A 3SSRA 1UWBA 3W9JA 2W9BA 4RPFA 1GMUA 2HVHA 2P6SA 3P45B 3UVJA 1CLFA 2RAQA 1M5HA 3VAKA 2ZOGA 5JVGQ 3H4BA 1U6FA 5CCMA 4IYQA 5BYQA 3OL9A 4Q5VA 4X4QA 4NASA 4LF8F 4DV6F 3MD3A 2RU9A 2IA6A 4LBIA 4FVCA 4NYPA 3JAMU 4K4WA 1X0PA 1RKIA 1EETB 5H1SV 4KGMA 1XTZA 2CNOB 1T9YA 3EDQB 5HQMA 3AY0A 3LUYA 3Q8YA 1OSDA 5K5MA 2V4QA 3LGNA 1QJHA 3AB2B 2YKOA 3ISND 5LOQA 3DRRB 2QV6A 2HVIA 2QYGA 1U45A 3MM5B 3D68A 3M8QA 2GIRA 3L09A 3UR3C 4LF9J 3BO3A 2E44A 3ZTSA 2CQ1A 4ZVEA 5B0EA 3M8PA 3BQ1A 1VQ7S 4UOCA 1LW2B 2EKNA 2H4WB 1JKHB 1RT6A 3QFWA 1NDKA 2HZAA 2HS3A 3GV7B 3A13A 2LDIA 1M5OC 2CZVC 1H3DA 2ATCB 1R6VA 2X3DA 4GVBA 1NO8A 3QJPA 2V94A 1AZSB 2UU9F 5A0YA 3PJ9A 2VQEF 4LR7A 2LQ8A 1LWEA 5KFGA 3IP0A 1KDNA 4IOBA 3NCRA 3V4IB 4AE5A 1OYEA 5CH7B 1ZTWA 4F4YA 2ZWPA 3OW2R 2O67A 5C42B 2GHVC 2W7AA 2DGQA 1U4BA 1YWXA 1KN6A 2R8GA 4JI6J 4P2FA 2YQ0A 3MMAA 4MAKA 1N52B 5EDWA 2VKRA 1FHTA 5BYSA 2KH9A 1X9SA 3IRXA 1HNWJ 3H5SA 1OSCA 4AL7A 4IKAA 1NB7A 4Q2MA 2MZQA 4ZVOB 1XK8A 1XNRJ 3GZ7A 3UN3A 4A47A 5I3QA 3NCQA 1RHQB 1T9XA 2YWGA 3BB5A 3KK2B 1LWFB 2KYZA 4JV5F 1BWVA 2CG4A 2ZBQA 2K8GA 2DNOA 2CQIA 1VFJA 4ZCKA 3VHQA 1LV5A 3DLKA 4DL7A 3WC2A 4ECXA 4PPDA 3SMZA 3KUEA 1SB6A 5ITHA 3PW0A 2JX2A 1FJCA 1TKZA 4TNOA 3FK4A 3CB4A 5FDLB 3M32B 3BGRA 3MEGB 4AQYF 4AXIA 3CO0P 4LF7J 2OPQA 4WCEQ 2KRBA 1JLQA 1DTTB 3CCRS 1GQEA 4NLWA 2XSJB 3NMAA 5L1IA 2C1EB 2J7WA 3FRYA 2FVPA 2CQGA 2DHXA 2V2VA 3D4JA 1HNXJ 5JVHQ 2CQ0A 2XBPA 4A8MP 5A2QY 1ZM3A 4Z2XA 3V81A 4NLVA 2GIQA 2UZAA 2RKIA 1BQXA 2DPIA 2YH1A 2UVWA 5J2MB 1TL3A 3SCJE 1H98A 2BKNA 4RW7B 3LW5C 5GAGI 3IG1B 4DV3F 3F56A 1FRMA 1B0TA 1QLNA 1TL7B 3MMCB 1TVRA 5DG8A 4ZPWR 2K3IA 3CC7S 3KMSA 4I69A 5DLFA 4K0KJ 5IV3A 1TKXA 2X1BA 2YXLA 2C2EA 4LFCJ 4KGKA 4KHPJ 3VGTA 2MKYA 3TUPA 5ETMA 4J9OA 2XY5A 4QYRA 2PEHA 5K14B 2XSFA 4PQAA 3DRSA 3K8VA 3IWNC 2DCUB 1RT4A 1A7GE 1NHUA 2PIIA 3MR6A 4RUBA 1UTAA 4CLLA 2HMIA 2QL5B 4WXWA 4K50A 4USKA 4DMZA 1R31A 3C6TB 4DFPA 1UW9A 2E7XA 2RSQA 3UCZP 2JEFA 2WAQD 1VQ9S 3IR6B 3RG6A 4W92B 3KK3B 4ECYA 1WF1A 2EFVA 2F7VA 4I4BA 1IM6A 2FB0A 1C0UB 2V68A 4OL8A 6FDRA 4TU9A 4J9KA 2ROGA 2HVEA 1NJYA 4J9QA 4DG1A 5HLFB 2GQCA 1WEYA 1W2IA 4PXDA 4CO0A 4QIEA 3WC0A 4EU0A 4ZCIA 3OSPA 3NGDA 2FJWA 1HBNA 1FT8A 4F8RA 2W4DA 2A10A 4OZLA 3SEOA 2DNPA 3FCWA 3HFVA 2KTQA 3E51A 1FF2A 5KAKA 4NLSA 4GMKA 5L9XA 4FYXB 3CD7A 1IKYA 1GXLA 2V8PA 5B0AA 4C98A 2PEBA 3AOCA 1FA0A 1D8ZA 5D4LA 1TFYA 1V3ZA 1NRKA 2V5HG 5FLXU 2AF6A 3OR1B 5JUMA 4GC7A 1EZZB 4LRDA 5D3GB 1U6BA 4AYBD 2H3EB 2Z58B 3AJDA 3GWCA 4USVA 4B3OB 3OR2B 4NZ7A 1TKTB 4DR1F 1BD6A 4RBVA 4ECUA 2R7SA 4J9NA 1FNMA 3FNNA 1FXLA 3NS5A 2NXCA 3RRKA 4TU7A 2LU2A 4W90B 1NHVA 4YS2A 2I38A 3KKFA 1Q95G 3DOMA 3TUZC 2YX1A 2HLTA 3R3TA 2J9DE 3AFGA 4A8XA 1W7WA 3W2WA 4FYYB 4N8NA 5GVQA 1S5ZA 4ZVSB 2YNFA 1RTIB 1EP4B 4G3IA 4RWXA 1UW4A 1Q1KA 1T03B 3DHXA 2QMUB 2UXBJ 4ID8A 3SXLA 4DV5F 1ICEB 2JLEA 1MG7A 3KJVB 2E5GA 1GX6A 2N7CA 2LXIA 2O1PA 2C3UA 5F8GA 1QY7A 3QSYB 3BKTA 2ZKTA 3BN4A 2XMMA 5T7LB 4DS5A 1HD1A 5EUHA 3V6DA 4FDFA 1PBUA 1C0TB 1VQNS 4OI1A 1CULB 1OWXA 2ZM6J 1NPRA 4IO1A 2DT9A 2OKQA 4FP9A 2ZH1A 2D9OA 4X4TA 3NAHA 3QRQA 2VG6A 1S6PB 3J7ZT 3HKWA 3EGWB 1T3OA 2V4JB 5A6PA 3MGJA 2FHKA 1BC6A 4JI3J 3U7JA 4OZ2A 2CA9A 3NGRA 2K7JA 4QCLA 3G8QA 1N8RT 3DYAA 3GG0A 1GK8A 2WHOA 2PD1A 3DI6B 4CLSA 2DK2A 1Y5IB 3ENAA 3EGVA 3T5JA 2CPFA 4MKYA 2R7RA 4ID5A 5B09A 1WI6A 3DFEA 1NK6A 4WIQA 4F4ZA 3SV4A 1TMJA 1U26A 4MIAA 4JI0F 4F3MA 4QW9A 1UFLA 1V6HA 4OZ3A 2HHVA 2R8IA 2VL1A 2JH3A 3KLIA 1BXNA 3HHKA 4RNFA 4CZCA 4CLUA 5L46A 1MLAA 2L9NA 1WKLA 5C2CA 5KFMA 2VIHA 2ZD1B 1YJUA 3G4SS 2MLZA 1WEZA 4TVAB 1B0PA 1XR6A 3LP0A 5B0DA 2XMWA 2J8SA 3BKFA 3K2YA 1CQNA 2NUHA 4C3MA 3OFFA 4X4RA 4LT6A 1WC6A 1NHKL 4GO5X 2W01A 2LLZA 1NAQA 2ADBA 3Q8VA 4M1KA 1WACA 4RX6A 2XQCA 2W7PA 2GJFA 5IQ6A 2AWZA 3GJRB 1S0VA 4LF6J 2OPSA 5L1LA 5C5JA 1HBMA 4DJBA 3B4MA 2B3TB 4V19J 2C3PA 1VBZA 2VG5B 2AD9A 4NPOA 1FNOA 1HYSB 3T1YF 4PYDA 1FK9A 2ZHAA 4WK1A 3RAMA 3W2VA 2ZZTA 2Y8YA 5J1EB 4RO0A 2V9WA 2IMOA 4ZJOA 4NLRA 2VQFJ 1XMBA 2BABA 1RE1B 4X66J 1X5OA 2KJVA 2EPIA 2PMWA 2VPYB 4O0NA 4IR1A 2GJ2A 1VRTB 6AT1B 1YI2S 1UEVA 3HSZA 4FF2A 3QSIA 2F3JA 1AB8A 3I32A 3CCVS 4EYIB 7FDRA 2HFOA 2ALZA 4ZN3A 2RVJA 4NLQA 2LVWA 3EZ5A 3TO8A 4WP3A 2KG0A 2MXYA 2JSXA 2CFXA 4L75A 3MPYA 2HNDB 2NLWA 1V3SA 3FUYA 2ZJQQ 2Y1JA 2B9XA 1UKUA 5KG6A 3RRHA 2M70A 4I2QB 4GVLA 3T6JA 4Q7AA 1URNA 1R8BA 4OI0A 1T94A 4DLEA 2WBRA 2DH7A 3AT1B 1CJKB 3H8YA 5J2PB 3PW5A 2QLJB 2NYHA 4K59A 1IUJA 5F8LA 4DHVA 1JLAA 1HWUA 3KJQB 4N77A 3R5JB 1UL3A 3GR0A 4ZCMA 2PN6A 5HROA 2BQ3A 4JI1F 4DV7F 3FQLA 1DQ8A 1KQKA 3PIPQ 3LP2A 3NMRA 2E1PA 2ZE2A 2HHTA 2HWIA 1L5UA 1NU4A 2J0WA 4E98A 1FWPA 4LF8J 4DV6J 4OIXA 1FRIA 2EBEA 2VHGA 3MCSA 4OLOA 1PYOB 2KZMA 4ETXA 4H4MB 5CQGA 2H5IB 5D0RA 2ZH9A 5C25A 1G7CB 1Q5VA 2Q1LA 2BM0A 3O1LA 2MB0B 1O0PA 1KD1T 2BE9B 5E41A 4FBUA 5J2NA 3BQ2A 3BSAA 1XNQF 4WWSA 2VKZG 3T9ZA 1VIOA 1WHYA 4WZMA 1BQMA 1PILA 4LRFA 3FCHA 5I42B 3EDRB 3BQ0A 3OFEA 4CLKA 5HK4A 1EKRA 4YR2A 1ACMB 1N36J 2OO4A 2NUUG 2J8AA 3KDNA 4O23A 1WEXA 2F63A 2RHQB 4HR2A 3FGVA 3M8QB 2V67A 2UU9J 2VQEJ 1N32F 2E7VA 4ILLA 1YJVA 5D4OA 2DRBA 3BH6B 1M0SA 1S7IA 2FLOA 5EWFA 2MY8A 2OPPB 3VGVA 2VUGA 1QE1A 2XS2A 4DLGA 1Q0NA 4FKYA 2CQBA 4K2XA 1TFWA 3HHLB 3L95X 4DQSA 2Y0BB 5I3PA 4WP8A 3DRPA 4O3SA 3N9UC 4K2JA 2Q6CA 1NH8A 3HFZB 4ZA1A 1PIEA 1NJXA 4A48A 1JNZB 3Q24A 1N6QB 2V34A 3T3FA 4URGA 3EPIA 1U02A 4F26A 3R9LA 2HBZB 2GNKA 2L41A 4IDKB 4ZVGA 4NLGA 1IN0A 3G9CA 2UUCF 4K4TA 1KVKA 1SUQB 2VFSA 1VJWA 4X4NA 3Q2SC 1QVGR 2GC8A 1JLGA 1UFKA 3K7RA 3CXCR 1IKWA 3AA8A 4WYLA 1KHVA 1N5QA 3D1HA 4NI2B 3FCVA 2LQ5A 4ZVQB 3P5TL 5A76A 3S01A 1RACB 4Y2IA 1F6TA 2DO4A 1VQPS 1S4FA 3PYDA 5KFJA 2YVSA 3T5KA 4P7VA 2W7OA 1VMBA 2BMBA 4F02A 3TEHB 5E3RA 3DXSX 1W26A 2MHEA 2YNGB 2GZOA 3TJAA 3I0RB 4KV8B 2J7UA 4NCBA 1SXLA 3M2UA 4P75A 2YKMB 3IWLA 2I9SA 1VLYA 4CTAA 3KYLA 2E9ZA 1VDHA 2BEFA 2W2MP 4PXEA 1VOMA 4DV3J 3M6UA 1U49A 2VODA 4ELUA 5KFTA 4J90A 4RW4A 5F8HA 4XDCA 2XZWA 5HQ8A 4YEAA 5U47A 1VS3A 1LW0A 4MIBA 4RW9A 4DCJB 4U8VA 2Q79A 4X4PA 1S1WB 4LFBF 4LR8A 2D3UA 2W9CB 3CULA 4LSNA 2DGOA 3NRBA 2NPFA 2FJAB 4TQSA 1I3OB 3HT0A 4KPYA 3MMBA 4I6YA 3DU5A 1S6QA 4FVMA 2EXUA 1NJZA 2XHCA 1SKRA 4O3PA 1R8HA 1WORA 3GIJA 4H4OA 1K44A 1Y7PA 2Z57B 5GAEU 4P2SA 3R97A 4RUCA 2BE2A 3GILA 2CWKA 3AXMA 1HPZB 2MZRA 4DUZF 1UP1A 5D0HA 3FBFA 3WHIA 1CEZA 3UN5A 2OFGX 1LK5A 2QJ3A 2NXNA 2JHEA 2CNKB 2ZUAA 2QSFA 2CJBA 2KZZA 3GJSB 2XLIA 4PUOB 4U6PA 1GX5A 3VR1A 2YPYA 1Y10A 3MDFA 3KLFB 1D0EA 4J9SA 1G4CA 1DARA 4LREA 3BJYA 5KFOA 1HWJA 2IA0A 3VGUA 1M90T 3DGPA 4DSEA 3CJKB 1RT5B 2HQCA 4UT4A 2AEMA 4BDPA 1FD8A 4ILMA 1WDTA 2FJBB 3PZPA 4LR9A 2ZJPQ 4F0MA 3EYZA 1EQMA 4XO0A 4KIAA 1S72S 1D1UA 4MH8A 2AGPA 2BANA 3PRBA 4PWWA 4I2PB 2RT3A 5DRKA 2H65B 2ZBPA 1OY8A 3EE3A 3MCMA 3GV8B 2D1CA 4ZIWA 2HGNA 3I4HX 1ZBTA 2V8GA 5KFDA 3U1NA 3W8PA 3WIUA 2DR8A 2GA7A 4CH7A 1YJTA 1D9AA 2VH7A 1QAYA 1TL1B 4YB5A 2JEIA 2VD3A 4EFAC 4DR1J 1WSVA 3L7PA 2EI5A 3J81Y 2UUBF 3NBPB 3CUNA 3OXGA 2J9EA 1L3SA 4O44A 3MPUB 2YX4A 1YBAA 3SCKE 5F8JA 1S9EB 2J6TA 3QT5A 2WSEC 1ZZNA 1DTQB 4RUHA 5KFYA 3P49B 4DSKA 2NXUA 3OTBA 2P9CA 3I4PA 4NRUA 2L3MA 3PKMA 5ETSA 2OUGA 1HR0F 4U7CA 3MR2A 2BZ2A 4DV5J 4UF4A 5HANA 5KT2A 2OFHX 3OXLA 5GAEI 2RRAA 4ANDA 5C24A 4K4YA 2ZDOA 3MFIA 1I51B 3HKZD 2OPRB 4PABA 2HBYB 4ZN1A 4I1TA 2V4RA 2RNEA 3J7Z5 2FLNA 4CH0S 1REGX 5DG7A 3SI8A 5HBMB 1JB0C 2BRKA 4FZVA 3DLGA 1JLFA 4USWA 2ZH8A 2PGCA 5KTQA 2HRTA 1JXEA 4ETZA 2Z0GA 1RDRA 1R8PA 3QO9A 5DO2A 2OIHA 1U1NA 1LQ9A 4DOZA 1ZETA 1V5IB 4AL5A 3Q8UA 3GFZA 5HL7Q 1NSKL 1X4BA 3MAQA 2XO6A 2SXLA 5F9NA 4ERDA 2GVDA 1Q79A 4AT1B 3KXDA 4DV1F 3QBCA 2W8LA 2CQPA 2VDIA 1YBTA 3T9NA 4Y65A 1U0SA 4ZITA 2VG6B 3FFIA 5HVFA 3TARA 3NOCA 4FYVB 4YDXA 1HQEA 1MNEA 3C6UA 2FLLA 3SCLE 4JI0J 3CDEA 2WB4A 2Y0SD 3IS9A 3MEEB 2UUWA 3CCTA 4Q2LA 3QIDA 4UZCA 2LDYA 3M1VA 4FYDA 2ZWOA 1K73T 5CYQB 5HQLA 1ULRA 3PVXA 4OJ3A 2Q3PA 4X62J 2WSCC 3ILLA 2XYPB 4F0KA 5FIIA 1RAEB 2B5JB 3HSGA 2HWTA 1N48A 3AQPA 1FRLA 2D3O1 3B78A 1KHWA 5H9EK 3CEDA 4FS1A 1APSA 2KDOA 1F3FA 2QT7A 4IFVA 1IM4A 2NYIA 2WW8A 3EZUA 1TKDA 2DNZA 3FEYB 4LVNP 1P6TA 2HNYA 2YNIA 3FKBA 4X64F 3D6FB 3GIRA 1S6UA 4CM0A 4DN0A 1NKBA 4MMOA 4C8OA 2QLFB 3VAJA 1S1UA 3GPAA 4KO0B 5AJ3F 4BC9A 3UW1A 5JJBA 2Z30B 5KOXA 1FKOA 5KG3A 2B8QA 4Z7CA 2J7KA 2VDHA 3EVMA 1WC3A 1E6VB 2LQBA 2UUTA 1RISA 2DR9A 8ATCB 4Y6IA 4KC5A 1RT2B 5CAAA 4C8LA 4JV2A 4ZVTB 5JXSA 5T14A 3BEGB 1VQLS 2XB2D 4I7FA 1B4SA 4HACA 1SH0A 3ET6A 4F3OA 2KM8B 4HVZA 2HAFA 2VBWA 1LWCB 4G65A 4NLUA 1S1TA 1TTHB 2WOMA 5CZXA 5IM0B 5EHHA 3FSXA 3DC2A 3C15A 5ETTA 1XMQF 2IRXA 3ZZUA 4ED6A 4WTYA 2XNQA 3RZAA 4R8UA 2U2FA 3DRXA 2P9EA 3K8WA 2BW2A 2VB6A 3VAIA 4ZCLA 1IKXB 3J7YU 3R1LA 4DUTA 4N76A 3RR8A 5D15A 3UCUP 4Q0BB 3RGIA 2WONA 4V1Ak 2ZH6A 2FZGB 1J5EJ 4OJGA 4LIWA 4IG3B 3BS9A 1FWLA 3WDOA 3RAQA 4OYWA 2CQDA 2L48A 2XMUA 4PCQA 2DPJA 3E8OA 3OLBA 1P27B 1RAOA 3A3PB 3LOUA 3O5TB 5H9FK 4JI1J 2BKOA 2AV5A 4DV7J 1L3UA 1FKAF 2GIFA 4OHXA 1X8DA 3ILJA 1S9GA 3GFXA 3ONQA 4DX6A 5HN0A 1VBYA 4OI3A 1HNIA 4I67A 3TW0A 3I0SA 1KSPA 1XR7A 2NSBA 2IIHA 1ROFA 4ZHRA 4L76A 1D9DA 2RQCA 3DNCA 2DR7A 4XDDA 2V8VA 1WG5A 1J5OA 1VK3A 2VG7A 1Y5NB 2CUYA 3J80Y 3BGUA 2YNHB 2DNRA 4B3SF 3I87A 1D8YA 1FKPA 2EFNA 2R7XA 3W62A 5KT7A 1N5TA 4ED2A 2Y8WA 4JOUA 2FZCB 2HBQB 4DQQA 5G4DA 1F9EB 3UDLA 2B6AB 3ETOA 1C1BA 3IMQJ 1RWXB 3MAAA 1OQ6A 3MOZA 1SC6A 3THVA 1HHTP 2HHSA 3TNVA 1NCLA 1XN9A 3M9MB 4PG6A 2AJ2A 3SCIE 2BJ9A 1A9NB 2VJVA 1YIJS 1VQMS 5DG9A 2OJ3A 4M8LA 2W4PA 2CAJA 2FVSA 4H54A 3OFGA 4WXOA 4WE1B 2YKPA 4PWUA 4M5DA 1TQLA 5KFUA 4OZ1A 2QA1A 2G0JA 1B7YB 1N32J 4ECSA 1NH7A 1YJRA 1YLXA 1B99A 1S10A 1U8SA 2RDDA 1RTJB 1VQ6S 3KLVA 5GAHU 2NQPA 2AW0A 2XYGB 2GGPA 4A8YA 4U9RA 5IC6B 1HI8A 2F4VF 4JI8F 3D3CJ 3FSYA 1QTMA 2AYEA 1T3NA 3MM9B 3U1MA 2B4PA 2QEXS 3IRWP 3V4MA 2R4FA 3A1YG 1M1GA 1S0MA 1RTDA 4LRCA 5IT9U 1JLEB 2VICA 1YRXA 3A8IA 3UFCX 1VRQC 5KFIA 1LNQA 1U0HA 4CIOA 1JXVA 2BRLA 2Z2YB 2DY9A 2XY6A 3D1OA 4ZVRB 1YJ9S 3V2UC 1R0BG 4HDGA 5KFFA 1H38A 2R7QA 2BJDA 4DX7A 1TV6B 2DGXA 1RT1B 2ERRA 4EZ9A 1RBOB 2NZ4A 3L7OA 4C8YA 2QRRA 4NOHA 1CS4A 1XJWB 1RB0A 4GO7X 3W8GA 5C2GA 2OD6A 2ASLA 3PY8A 1SKWA 4MTPA 4LBHA 4UOHA 4GC6A 3GG1A 1U1OA 3M8SA 5F8MA 4O3NA 1VRUB 1FEHA 3CJ0A 4C2MA 5K8PA 4EBDA 2QC3A 5HJXA 4JI2F 5KG1A 5A8WB 2CQHA 4MK8A 4NXNF 3NS7B 1YRUA 2VFVA 3QAUA 2AMCB 2KT3A 4CO1A 2N7YA 5HMWA 1N0VC 1T9TA 2J6SA 3TX8A 2BVZA 2IM2A 1RT3B 1V3RA 3F41A 2VBZA 3HVTA 4A8QA 2X1AA 1HNVB 2F8HA 3FQKA 1NM2A 4LRAA 4LSLB 2IYIA 1NK4A 3T5HA 1T9UA 1HLWA 1VQ8S 2H9ZA 2H1YA 5IC4B 2J6UA 5DGBA 4PWDA 4QPTA 3K57A 3S7RA 3K58A 3GYNA 4RW8A 3QPIA 1OO0B 2A6OA 2LA6A 1WF2A 3FJ2A 1CSJA 2QFIA 2CJXB 3S1TA 4RW6A 5ETKA 4P72A 5G0RB 1JXLA 3H2VE 5E7OB 4Y2KA 4G1QA 1OQ3A 3MMJA 2K2PA 2MQPA 1CG2A 2OEKA 3UD3P 2HIYA 2FTRA 2XZDB 2HBRB 4MFBA 5HATA 2P9GA 2O3DA 3UE2A 2BOAA 3UI3A 3WQPA 3SBMA 3CNQP 4TLQA 4NWBA 2PFDA 3K5OA 2HURA 1U25A 4WJBA 2KFYA 2CJQA 3OL7A 4DUZJ 3C16A 4LQ9A 4K4SA 1K47A 3PX0A 1S1VA 1HFEL 2AP6A 2DHHA 3TAMB 2QFJA 1X60A 4KGVB 4XIUA 1U2FA 3TZWA 4NCGA 5D78A 2DR6A 2ZVSA 3KNGA 1WC0A 3Q2TC 1RT7B 4YDDB 1VHIA 1RXOB 1KLMB 2R9LA 2DNLA 1VQOS 3BO2A 1NZAA 2VBYA 5A8RA 3NOGA 5CYMA 2N82B 2N3LA 2OD4A 4EBCA 4F4KA 5HI7A 3MD1A 3UN2A 3GP9A 5KT3A 4DN9A 1X4CA 2GQ2A 2YWKA 1S59A 3GFYA 2YKQA 1CJUB 3HFKA 4OYIA 4QYZJ 2G0CA 2G9OA 3OTOF 2C2RA 4USIA 5HMYA 2DGVA 1WWHA 3DM2B 5ETNA 2ZH4A 2IC3B 1HHSA 3G82B 4IFYA 2PMZD 2HLUA 1XMOF 2CZ9A 4WKRA 3CSKA 3NY0A 1Y11A 4FPIA 4LMZA 4DPXA 3HHLC 4CLWA 1BQNA 2Z2LA 3OV7A 3CWJA 4LBPA 2C2ZB 4JUZA 2UUBJ 2YTCA 1JIHA 4C6AA 1AT1B 2GHWA 4RJVA 1ZPWX 2DJWA 2HNZA 1AUDA 2X7IA 3A8JA 2KG1A 5JMNA 2IM3A 3R2CJ 3R7SB 4P2MA 3UDEA 3CE8A 1C1CA 2XMAA 3EZOA 4B9TA 3K5PA 1S1XA 1FX2A 4A8OA 4M5HA 5AXNA 3HJVA 1KNZA 1NEEA 2XTJP 3GIKA 5A2QU 4F36A 5F41A 2OTLS 5DQHA 3TI0A 3MM7A 4NZ0A 2G0IA 4KB7A 4RL1A 2BKPA 2V63A 4QU6A 5K9FA 2A3JA 2XM3A 4OX8A 4ED8A 3M2RA 3DLEB 2ZVIA 1TP7A 5DDRC 4O44B 2EFPA 3CJRA 2HK3A 2RDJA 4J9PA 1UVMA 4ICLB 1JNRB 1PAEX 1KC8T 1SL2A 1WI8A 3PJXA 1S4EA 3A3OB 1RI7A 2DYAA 3QGPA 3M2VA 3J7AN 2QGFB 2IBOA 3OVBA 3N6MA 3ISZA 3M6XA 3PYFA 1FFGB 4CT9A 5GMKa 5ETRA 2Z8QA 1JJHA 4I6AA 1K1SA 1RLCL 1HW9A 2MMYA 5HP1A 1S57A 1UJ4A 3CCES 3MM6B 2UP1A 2DNNA 3CPWR 3ELHA 2FPHX 3KHHA 2MGZA 3D6TB 2MQQA 4EI2A 1RA7A 2FY8A 1QM9A 3FEXB 4KQZA 3POTB 3ISNC 2CJKA 1RLDA 2OGUA 2EG1A 2IVMA 1ZYQA 1FD2A 3MFHA 2NREA 4DL0C 4RKUC 2MKKA 3IXQA 2V50A 3QWPA 5E3QA 4LFAJ 3QFHA 1YK9A 1G6BA 3LANA 4C8ZA 2VPZB 2AHOB 2LQ9A 2HFZA 2YQ3A 1E6YB 2IJNA 2DEIA 5IS2A 3NNCA 1HBOA 1HQUA 3C19A 3UPFA 5ETVA 3PFEA 4F04B 4CRJA 4DXLA 4K8RA 1SVDA 3ULHA 3I6PA 7FD1A 4F2SA 1WOOA 1SL0A 2I5JA 3CO9A 4R25A 1RP5A 3CMQA 3P6YC 1YKWA 3F44A 3OHBA 2APOA 3M9NB 5C7PA 1RCXB 3LP1B 1F9FA 4DR5F 1YTYA 3VV2B 1ZZFA 2ZUGA 4LF1A 5E0OA 2ROPA 3VAGA 3W1YC 4PQUA 1S77D 3MM8B 2IJRA 3R7NB 3MEDA 4ZPDA 1FXRA 3MECA 4LRBA 2FHOB 3PEJA 1GH8A 3W60A 2NR0A 4IG0A 5A8KB 2FJVA 1EHWA 2LFVA 3IGNA 1QDUB 2CYYA 3VF0B 1SJQA 3NXZA 3DCAA 1F5CA 1TAUA 4FXWA 1N5YA 3VCDA 3CJ4A 2ILZA 4WK3A 2KB2A 1DLOA 2DEJA 2MKSA 4DR4J 4W98A 4B9MA 1YJNS 1ZM9A 2H54B 2RE1A 4CCHA 2CXEA 3EM1A 2GV1A 3OL6A 4CYUA 4CWBA 4TY8A 4QW8A 1CJVA 4WKYA 2XLJA 1IJEB 3QLHB 1X5TA 3VAFA 1BWEA 3DMJB 5KT6A 5KFXA 3LAMA 3JYTA 4DQRA 1Y4ZB 4OZNA 5DQGA 3P4UB 3RB4A 4UQGA 3ITHB 1F2GA 3BDEA 3KFWX 2E5IA 4AD6A 1B70B 3JSYA 4ZP6A 2CKWA 3CDUA 3GCWP 3VTIA 1XMQJ 1G3OA 3Q8PB 3WIVA 5E3PA 4HL9A 5ETQA 5AE2A 4G1IA 4C4WA 2O5DA 5GADI 2GAGC 2EC0A 1J2VA 1Q7YT 1N5VA 4B9SA 4KFBA 1HI0P 2GAHC 2KN4A 1JK9B 3VVUA 1PBAA 3SSQA 3DDNA 3SQOP 4QR0A 4CLPA 1KVIA 1SJ1A 2W9AA 4MJKA 2LCWA 2ZNZA 1RWOB 1Q7LB 3JSMA 3CCMS 3GCXP 2JVOA 3CD6S 2RU3A 4KPCA 5I3UB 2IM1A 3TZYA 4EO6A 4C0OC 1AA1B 3PX4A 3IN5A 5BR8F 4KKOB 1T05B 2DHAA 3MR5A 1O8BA 4EK2A 1B7FA 3ZXWA 1UAWA 5ETLA 1NZ8A 3KLHA 5DLGA 4K4ZA 3FZ2A 3LF0A 4CH1A 1FE4A 2DH8A 4ZIVA 1IBMF 4DX5A 5DQIA 4BWJA 1H7XA 1PYSB 2EWHA 4O4RA 1TL5A 2FGCA 1RU1A 5KFVA 3BSOA 5FJ4A 3UWTA 1TK0A 1RAIB 1XEZA 4OJHA 2GVZA 1S9GB 2IAJB 4CNYA 4IH5A 5IFMA 2QN6B 1X4FA 1DQ9A 3FEZA 1TZ0A 3PCOB 4C8MA 2AX1A 3S8SA 5GAGU 5LSRA 2CDQA 1XC9A 1JLCA 1JX4A 1U48A 1RCOB 3MR7A 2DGTA 3HULA 2Y1LB 1VJQA 4DR7F 1FJ7A 2QLWA 3BN7A 3LPEA 4ZPTR 4FN5A 1CJTA 2YWWA 1T0TV 3HO1A 1REVB 1RWWB 1MWQA 4EYHB 1HNZJ 1G2EA 3PM9A 4AXJA 4OX6A 4W4MA 1CVJA 4Y0FA 3QIPB 1ZAVA 4P7TA 1IXKA 3DLJA 2FZKB 2K1RB 3JSBA 1KBRA 2YWFA 1DJ0A 4DV0F 5BJRA 5AXKA 2E1AA 5J2QB 4JI8J 4O0IA 2DB1A 1EETA 2AU0A 3PRDA 4KHMA 3GJQB 3A8KA 2F9DA 5IWAJ 3R1HA 4M5DB 3KK1A 1YGYA 2QE5A 3L3CA 3KUHA 1NPKA 4YHHJ 2QMWA 2COLA 4UOFA 1MROB 3DRRA 2F40A 2XYHB 3MM5A 4I68A 2M8DB 2P2CB 3LH2S 3OTDA 2WRMA 3PO4A 3HK2A 3SDEB 3UCGA 1X31C 1F1BB 5HVHA 3TEGA 4UZBA 1IR1A 3B4DA 1LW2A 1A6LA 2V8DA 2MKIA 4XPEA 2B56A 1JKHA 3C14B 2R8HA 3M30B 1VQSA 1UEUA 1SKSA 3A4TA 1R0AB 2CQ3A 3ZZOA 2YPZA 4DU8A 1U0HB 2YKAA 4RBTA 1IKVB 1AZSA 2WVFA 5AE3A 2JC1A 3D2WA 2A1BA 2D74B 3SFGA 4F7VA 2GJIA 4DSFA 2CVEA 1F2HA 3V4IA 4JP8A 3CIZA 2KM8C 3N79A 4DWIA 1F9HA 3PDNA 2A6MA 3C46A 2X51A 4ZVFA 2VOOA 3MHYA 4YY3F 1R8CA 4KSEB 2D9PA 3G2XA 1OY9A 2QLXA 2E7WA 1HHQA 4O4GB 5CXTA 5DZ7A 5HMZA 1SIWB 5BXIA 1ELOA 3W63A 4ZPCA 2KU7A 3HDSA 4RUAA 4YR3A 2E5LF 2HFUA 5L8RC 4WFYA 5L1JA 4JI4J 3KK2A 1LWFA 4JI6F 4KY3A 1HWLA 3Q89A 2RF2B 3H40A 3CJQA 3FZBA 1HNWF 5KFSA 2IDEA 3JTOA 3KLGB 3HI9A 1WG4A 3SQGB 5FDLA 3BSCA 1GXTA 3M32A 3MEGA 3KG1A 2YKNB 3GV5B 1NBEB 1DTTA 3AA9A 3K5NA 2R7UA 2XSJA 3PJWA 3OD2A 2OSQA 3EICA 3CCQS 4I64A 3RB6A 5IXUA 4KRWA 1FRXA 1P9YA 5D77A
chains in the Genus database with same CATH topology
3CO0P 2Z56B 3WHIA 2Z30B 3VHQA 4K8RA 3WIUA 3T41A 4NE9C 3BGOP 2Z2ZA 2E1PA 1SCJB 2W2PP 2ZWPA 4NMXA 3GCXP 4OV6A 3GCWP 3H42A 2W2MP 1R6VA 3A3PB 3VV2B 2QTWA 2Z57B 1SPBP 3WIVA 4JP8A 2Z2YB 3QFHA 2ZWOA 3BPSP 3AFGA 2Z58B 3CNQP 3SQOP 2XTJP 3P5BP 2W2OP 2W2NP 4YN3B 3A3NB 1ITPA 1V5IB 2W2QP 3A3OB 2PMWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CO0 P;  2Z56 B;  3WHI A;  2Z30 B;  3VHQ A;  4K8R A;  3WIU A;  3T41 A;  4NE9 C;  3BGO P;  2Z2Z A;  2E1P A;  1SCJ B;  2W2P P;  2ZWP A;  4NMX A;  3GCX P;  4OV6 A;  3GCW P;  3H42 A;  2W2M P;  1R6V A;  3A3P B;  3VV2 B;  2QTW A;  2Z57 B;  1SPB P;  3WIV A;  4JP8 A;  2Z2Y B;  3QFH A;  2ZWO A;  3BPS P;  3AFG A;  2Z58 B;  3CNQ P;  3SQO P;  2XTJ P;  3P5B P;  2W2O P;  2W2N P;  4YN3 B;  3A3N B;  1ITP A;  1V5I B;  2W2Q P;  3A3O B;  2PMW A; 
#chains in the Genus database with same CATH topology
 3PYE A;  2B4U A;  4P52 A;  5J2M A;  3BKU A;  1HWI A;  1HBU B;  3LAL A;  3A12 A;  2RIL A;  4RW7 A;  4R0E A;  3IG1 A;  4DR3 F;  4DL2 A;  5LL6 d;  4DZD A;  1U8W A;  1TL7 A;  3MMC A;  1T7P A;  1H2U X;  1Q4R A;  1S76 D;  2W1B A;  4LSZ B;  1QSS A;  2ASY A;  2XGP A;  1HNX F;  1X4H A;  4ATN A;  1X4G A;  4D3H A;  1QVF R;  2JEG A;  3US5 A;  3OTO J;  2FDN A;  4HHU A;  2C3Y A;  3N5B A;  5K14 A;  3EVW A;  4MYT A;  1GMV A;  2BDP A;  4NCA A;  3DOL B;  3QZ8 A;  3BPS P;  1XMO J;  3BDP A;  1X5P A;  2JLG A;  2XI3 A;  1M5V C;  2C3M A;  4B9U A;  2LA4 A;  4CNZ A;  4FNH A;  1WC5 A;  1Q86 T;  4KJI A;  2D3O R;  4DF4 A;  4QR1 A;  5J1P A;  2DKO B;  2EG2 A;  3C6T A;  1R27 B;  4KHP F;  1TUW A;  1HIY A;  4R5P B;  2NXE A;  3G96 A;  4Q8F A;  2JEJ A;  1UVN A;  3KK3 A;  4QWB A;  3AD9 C;  1DAX A;  3OVS A;  4B02 A;  1C0U A;  5DDP C;  3L4B C;  4WTO B;  3TR5 A;  5HLF A;  2ZHB A;  4B9N A;  5D4N A;  1SIZ A;  2HSE B;  4YOE A;  2HW3 A;  3KG0 A;  2CQ4 A;  4JB8 B;  4FYW B;  2HRY A;  2V2K A;  4LF5 J;  2DR5 A;  4ES1 A;  1HMV B;  2POK A;  2CWX A;  4NA3 A;  2KXN B;  2HNZ B;  4FF4 A;  2OAU A;  3VAM A;  1QUV A;  1EAR A;  3P3D A;  2IDL A;  1RWM B;  3GR1 A;  3DLH A;  1Q8I A;  3JSR A;  5KT5 A;  1SV5 B;  1S99 A;  1MMN A;  2R8K A;  1RHM B;  2ASD A;  2MZS A;  2EEY A;  1SC4 B;  1GXU A;  2OMO A;  1SJF A;  4P2X A;  3OR1 A;  2X1G A;  1F0X A;  5D3G A;  3MCN A;  1RWK B;  1ZS6 A;  1KLN A;  4ED3 A;  1KR4 A;  3ZZP A;  4B3O A;  3HVA A;  2DGW A;  4ES3 A;  3OR2 A;  3W7B A;  3UD5 A;  1U2R A;  1TKT A;  3UNY A;  4J37 A;  2B4O A;  2MKJ A;  4M5K A;  3NNA A;  4ZKA A;  2F8E X;  3R5C A;  1EAY C;  2DD8 S;  5KFP A;  3CJ3 A;  3CVK A;  1VK8 A;  3I96 A;  3I5A A;  1NND A;  2GO8 A;  3I82 A;  5LSL A;  4X4V A;  1MU2 B;  4UY8 T;  3AB4 B;  3G71 S;  2FQQ B;  3WX8 A;  3B6B A;  1RTI A;  1EP4 A;  2HWH A;  4DUY J;  3H59 A;  4RZR A;  1T03 A;  2HHU A;  2ZKU A;  4HEA 9;  4P9S A;  3PG9 A;  3KJV A;  3VGS A;  1FER A;  4ECZ A;  3CCZ A;  2UUA J;  4DPY A;  2BXJ A;  5KG0 A;  2L08 A;  1MWY A;  4IQX A;  2AEF A;  5SZT A;  1JLB B;  2KHC A;  5T7L A;  3WX4 A;  1C0T A;  1CUL A;  2IMW P;  2OLW A;  4IOA Q;  3BZQ A;  4TQR A;  1KS2 A;  1RAD B;  3L7U A;  3M8W A;  1S6P A;  2LEA A;  2ZH2 A;  2V4J A;  3I56 S;  3CDB A;  2I2Y A;  1N88 A;  2HGL A;  4HT5 A;  2OHD A;  2G4B A;  4IUF A;  2V8H A;  1NSQ A;  4OYZ A;  1ZA2 B;  4YUD A;  3GYX B;  2LXF A;  3HVW A;  4RNH A;  3J81 U;  2R7T A;  3DI6 A;  1UZD A;  3OTE A;  5F3T A;  4XTT A;  3OUY B;  2EK1 A;  2FC9 A;  2FGO A;  4H4K C;  5KFZ A;  2KXH A;  1RAA B;  1LXN A;  3G87 A;  5IT0 A;  2XI2 A;  1IJF B;  4EUV A;  4JI3 F;  4MYU A;  4AFF A;  1H73 A;  2AGO A;  1IWG A;  3TJ9 A;  2XCP A;  2XWY A;  1I94 F;  3LGH A;  3ZTO A;  3KLE B;  1U2C A;  3SSS A;  2ZD1 A;  4FBT A;  2QG9 B;  2IPO B;  2N4C A;  3JTN A;  2HFV A;  4NML A;  2JFK A;  3U27 A;  1RSC A;  3L9Z A;  5AT1 B;  2XG8 A;  3HZE A;  4K7Q A;  4E8U A;  4C11 B;  4F0H A;  2BQU A;  5IZH A;  2RB7 A;  3AJ2 A;  1H7W A;  2Q43 A;  5T41 A;  3PV8 A;  3HM9 A;  3BGO P;  2ZBC A;  1FWK A;  2QIF A;  3EXY A;  4CO3 A;  3KTQ A;  4DSJ A;  2M0G B;  4WFB Q;  1QAI A;  3HJF A;  4PG5 A;  1R3N A;  1PYT A;  2K3K A;  1VCT A;  4DBQ A;  3SZ2 A;  4A8W A;  2XLK A;  2X1F A;  4BCA A;  3T41 A;  2CJ9 A;  4K4V A;  1FFW B;  3I55 S;  1UVK A;  2KRR A;  2VG5 A;  1O51 A;  4ENO A;  1HYS A;  2E1C A;  1PAU B;  3HHD A;  5J1E A;  1DY3 A;  2XO7 A;  4EMD A;  1GTE A;  4L74 A;  4NXM F;  3RAX A;  5K8N A;  2AZ3 A;  1MWZ A;  2KFN A;  1SQF A;  1LOU A;  3OHA A;  1L3V A;  1VRT A;  3E01 B;  4P73 A;  2F8M A;  3Q23 A;  1KON A;  5CYJ A;  4JYA F;  1IBK F;  5LJ3 Y;  3H42 A;  3QQC D;  1WC1 A;  2RS2 A;  2MKC A;  5LMU F;  4KBI A;  1N33 F;  4YB6 A;  1P8G A;  1UWB B;  2M3D A;  2W9B B;  4F67 A;  1M5K C;  4PG7 A;  5DJB A;  4OI2 A;  3UVJ B;  5E3A A;  3UD4 P;  4BC7 A;  3EUN A;  4N7T A;  1KOH A;  3GSD A;  2HND A;  2BE7 D;  2BW7 A;  2F9J A;  5ETO A;  3JQM A;  4C8K A;  3HHL D;  1BLU A;  4DL6 A;  4ZOS A;  4I2Q A;  1FFS B;  4K5S A;  2GFF A;  3TQE A;  4XAK A;  2QYC A;  1YRT A;  1CJK A;  5J2P A;  2A0F B;  3KNA A;  3QGI A;  4Q45 A;  2XY7 A;  2AJQ A;  3VZI A;  4Q43 A;  4C7Q A;  1TU0 B;  3CJ5 A;  5CHC B;  4DL4 A;  4M5N A;  4OV6 A;  2RS8 A;  5KFB A;  4LUB A;  4RU9 A;  3C3L A;  4S0M A;  4LIR A;  3M8P B;  2AJ1 A;  2ADC A;  4A8S A;  2KT5 A;  4DZ6 A;  1L3T A;  2OTJ S;  1RT6 B;  4WII A;  3ENQ A;  5M2U A;  4H4M A;  4JV0 A;  4WFX A;  1Q53 A;  4CLY A;  2VF3 A;  2JFD A;  4GVB B;  2MZT A;  3H0P A;  3G6V A;  4M5G A;  5A0Y B;  1CBK A;  1LWE B;  5AE1 A;  4U95 A;  2FY1 A;  2W2O P;  4A8K A;  5M2R A;  1PJ5 A;  4USU A;  2ATL A;  2FVQ A;  3NNH A;  4JV5 J;  3C2P A;  3CCW A;  3PFO A;  1TK5 A;  2MEW A;  3MMA B;  1JJ2 R;  1N0U A;  4A8F A;  5I42 A;  3CCU S;  1SH3 A;  3MWB A;  1SKU B;  3IRX B;  3FBC A;  3KK1 B;  2FVR A;  2OEJ A;  3PW7 A;  3CJT A;  4KTQ A;  4AQY J;  1GT8 A;  3RB0 A;  2D3Z A;  3KJN B;  4ZVU B;  3H90 A;  4C48 A;  4YN3 B;  2DNY A;  3E2E A;  3AQO A;  4LF4 F;  2L9W A;  3KMQ A;  4QWC A;  2OPP A;  1WG1 A;  1FRJ A;  3TAQ A;  2DBB A;  2DGS A;  3DLK B;  1WSR A;  1RU2 A;  2BJ7 A;  4M5M A;  2JLF A;  2GX8 A;  4F4W A;  3HHL A;  2J0S D;  1FDD A;  3ZTQ A;  3H25 A;  1TKZ B;  4YY3 J;  1N36 F;  5K8M A;  2G2O A;  1NDP A;  4ED4 A;  2MKH A;  2GS8 A;  4URQ U;  3BGR B;  2DNG A;  3RW6 A;  5B08 A;  3EGZ A;  2BJ3 A;  2OPQ B;  1JLQ B;  2B9W A;  4EGL A;  1N6Q A;  4ZPA A;  5DZ6 A;  3O6Q A;  3RRG A;  3OSN A;  2WVB A;  2VOP A;  2BQR A;  2E5L J;  3ENW A;  2B51 A;  3R5A A;  3K17 A;  4HHJ A;  3G86 A;  4IR9 A;  1RA6 A;  1K1Q A;  2XUL A;  2UV8 G;  3QMQ A;  4IDK A;  1Z1Z A;  1ZM2 A;  3V81 B;  2DTJ A;  2IVF B;  4YQW A;  1SUQ A;  3DLB A;  1UPP A;  2RKI B;  4OHZ A;  3J80 U;  3BR8 A;  1TL3 B;  3IO1 A;  4NZ6 A;  3TUI C;  1GFW B;  3UQS A;  5EX3 A;  3VQT A;  4F3Q A;  3I9Z A;  1TK8 A;  4TN2 A;  4JBC A;  3QJL A;  1TVR B;  4ZPV R;  4NYO A;  4NI2 A;  2M8H A;  1X5S A;  2OH2 A;  1RTH A;  4KE5 A;  2BJ8 A;  4DQI A;  1TKX B;  5M2P A;  3P8B B;  4M5J A;  1N56 A;  5DGA A;  1Q16 B;  4F4A A;  3D66 A;  4U8Y A;  3QRR A;  1AFI A;  3WZ0 A;  3KJF B;  4QIV A;  2YNG A;  4IO9 Q;  4Y2C A;  3I0R A;  3DRS B;  4KV8 A;  2B4V A;  1N34 F;  2VAS A;  4L3N A;  4CO4 A;  4D3G A;  2YKM A;  1RT4 B;  2EK6 A;  3LGM A;  4MIW A;  2Y1R I;  4DR3 J;  3H5X A;  1HD0 A;  2HMI B;  1FES A;  4ALZ A;  2HZC A;  4HLB A;  1PKU A;  2XGQ A;  2M4M A;  1G1X A;  3GII A;  4ELT A;  1S1W A;  1FDN A;  4U7U D;  3JB9 k;  2W9C A;  2JWN A;  1RHK B;  2BM1 A;  4GKK F;  3TVZ A;  1Q78 A;  1IR0 A;  3CTR A;  2VC0 A;  1VC5 A;  2RQ4 A;  3MI7 X;  2J76 E;  8AT1 B;  1R0C B;  8RUC A;  4ER8 A;  5IQQ A;  3ZC4 A;  1VBK A;  4DG1 B;  3RUB L;  2CIM A;  1KFS A;  2XS7 A;  2LQJ A;  1OMS A;  3M05 A;  3THT A;  1UZH A;  3N0V A;  1P9Q C;  4B9L A;  1HBN B;  4HI2 A;  1JWW A;  3B82 A;  2LXU A;  4XPC A;  2VFR A;  1SCJ B;  4DPO A;  1HPZ A;  3MUV P;  2VJU A;  3OTC A;  5KFC A;  3DRY A;  1FJE B;  4MT1 A;  3LTO A;  2CQC A;  2CVI A;  5LXR A;  1IKY B;  2W8K A;  1X4A A;  2E29 A;  1RAF B;  1FJG F;  2Y9H A;  3LQV A;  4PUO A;  4QWD A;  2DNM A;  2BBE A;  3ADA C;  3DOK A;  3AD8 C;  1ZOT A;  3KLF A;  4J9U E;  1XWL A;  3FBB A;  3TA2 A;  4BLG A;  2QLB B;  5D4P A;  5DS7 A;  3JTP A;  5EGY A;  5CD4 A;  3CJK A;  1RT5 A;  4ECV A;  3FSI A;  2C2D A;  2HHH F;  1YJ7 A;  2VBX A;  2GMJ A;  4MKA A;  2Z2Z A;  2VFT A;  4OHW A;  2ILY A;  1UJ5 A;  2C2N A;  2PT0 A;  3MR3 A;  1VC6 A;  4KAI A;  4I2P A;  3RB3 A;  1DQA A;  2BX6 A;  5B0B A;  4WFN Q;  3DOM B;  3HXM A;  1T9W A;  2HZV A;  1WTF A;  4JV1 A;  3LA0 A;  1NPP A;  4ES2 A;  4HTI A;  2XMT A;  1VBX A;  3W2W B;  2E5J A;  4OYX A;  2YNF B;  3N28 A;  2IRY A;  4NA1 A;  1TL1 A;  2PO4 A;  2G13 A;  2CPY A;  4BS2 A;  2BOP A;  1KQG B;  1C4A A;  3N01 A;  3PEH A;  2RUS A;  4UUW A;  2WVD A;  3NBP A;  3EMT A;  2MST A;  4IH6 A;  4UY8 5;  3RW7 A;  4QIF A;  4ECW A;  2ACY A;  1S9E A;  2J9D A;  3BV8 A;  1Y00 A;  1PG5 B;  3V6D B;  1DTQ A;  2JRS A;  1Z2L A;  1PJ7 A;  2KJW A;  3PO5 A;  3TYT A;  2F5G A;  3ZZT A;  2DNK A;  1KEK A;  1SQE A;  1Q82 T;  4WF9 Q;  2JJ4 D;  4M95 A;  5RUB A;  1PJ6 A;  2U1A A;  4OI4 A;  1WNE A;  4CLF A;  4RU2 A;  4PXB A;  2C28 A;  1N54 B;  3LWL A;  3DYA B;  2J5A A;  2PFF B;  4DV2 F;  4WZQ A;  2OPR A;  4FS2 A;  3FBE A;  1NK9 A;  5HSP A;  1TUV A;  3ICL A;  2D69 A;  1B0V A;  4ID5 B;  5HBM A;  4TYB A;  2XNR A;  2UV8 A;  3BO4 A;  2EW9 A;  3FMW A;  2CPD A;  2YY3 A;  3TP2 A;  1RJJ A;  3HSJ A;  4UW2 A;  1OS5 A;  2DHS A;  3KLI B;  3QT7 A;  3MF5 A;  1RWP B;  3DKD A;  4USJ C;  2ABY A;  4ZP8 A;  3IR7 B;  3K59 A;  3HHN B;  2JL9 A;  3BRE A;  2DO0 A;  1D3W A;  1S48 A;  1FNX H;  3BR9 A;  3TOQ A;  1CPZ A;  2ZOF A;  3FDS A;  4FKX A;  5LSO A;  2PDA A;  4FF1 A;  3LP0 B;  3GTY X;  2ZIT A;  2G2Y A;  5AXL A;  1RWU A;  5BYR A;  4TYA A;  1YQH A;  1V9O A;  3T1Y J;  2CZ4 A;  1RQ0 A;  3O3L A;  3AOD A;  5ETP A;  3QGG A;  4URS A;  3TQ1 A;  1RWV B;  3DDI A;  4ZLL A;  3MEE A;  4YB1 P;  2VU5 A;  5IOL A;  5D8H B;  3W9I A;  2MQ8 A;  5CAB A;  3O2I A;  2ZOM A;  1I94 J;  3DN9 A;  2OPS B;  3D54 A;  1HBM B;  1H2V Z;  2LEC A;  1HQ2 A;  1SC3 B;  3Q8R B;  5CYQ A;  1K0V A;  2ZH5 A;  2JNJ A;  3LPY A;  3R5G A;  2DXD A;  1FK9 B;  1Q8L A;  3U02 A;  1U1K A;  3W2V B;  2WTF A;  1VGY A;  2VON A;  2B5J A;  1U1P A;  5HMX A;  4DFJ A;  2R42 A;  4KGX B;  3JAM Y;  1QUP A;  4DDF A;  3W65 A;  3UDC A;  4OI6 A;  2QO3 A;  2ZFH A;  1ZH5 A;  3PKY A;  2H48 B;  2MQN A;  1AFJ A;  1U6Z A;  4OJ1 A;  2HPU A;  3TA1 A;  4NLT A;  1YSJ A;  4HHH A;  3MPW A;  4X62 F;  1K8A T;  2OML A;  2IVY A;  2JDJ A;  3CGI A;  5L39 A;  4Q44 A;  3IGV A;  3HPO A;  1AYE A;  4U7U K;  5K8O A;  1YJW S;  3OJS A;  4KO0 A;  2A2C A;  2A18 A;  1UA0 A;  4I56 A;  3HX9 A;  1YVF A;  1H0H B;  3OT9 A;  1NKE A;  3QAE A;  4NXM J;  3WBZ A;  1FE0 A;  1IBL F;  1QTN B;  3NCP A;  5KFL A;  1E6V A;  2LEB A;  1R89 A;  3THP A;  1PGZ A;  3KG4 A;  1RT2 A;  4JYA J;  5H9E J;  2ZJR Q;  4CP5 A;  4DI6 A;  1IBK J;  1RZM A;  3CCL S;  2WZ1 A;  1XER A;  1RHJ B;  3NWG A;  5LMU J;  1N33 J;  3SV3 A;  3CME S;  3M6V A;  3R27 A;  3RBX A;  3TJ8 A;  4F50 A;  1JLA B;  4OFZ A;  4OX7 A;  1LWC A;  3I5B A;  2DH9 A;  5IM0 A;  5KFE A;  5LXY A;  5HRO B;  5CD4 H;  1TUG B;  2G1H A;  2BR0 A;  1GNK A;  3ZZ0 A;  5F8N A;  3LP2 B;  3TA0 A;  5HVG A;  3GIM A;  2ZE2 B;  3FC9 A;  2KYX A;  2ZC3 A;  3P5B P;  2WB1 D;  2UXD F;  4PXC A;  3CW2 C;  4ZMM A;  1XNQ J;  2DIT A;  1C2P A;  1IKX A;  1DUR A;  2H51 B;  1RAJ A;  2C2O B;  2HEK A;  2KVQ E;  4Q0B A;  1H2T Z;  5C25 B;  4IG3 A;  2LU1 A;  4B3R F;  3JS9 A;  2WBM A;  2KT2 A;  2ZEJ A;  2EC2 A;  2W4C A;  5D6G A;  2AYB A;  1P1L A;  5J2N B;  2FVC A;  3IAM 9;  4K5R A;  3CJ2 A;  4DCO B;  2IHR 1;  4ZLJ A;  1RHU B;  5DDQ C;  4U96 A;  2RQK A;  3MXH P;  2YH0 A;  4ANE A;  3T6B A;  3ZTR A;  1R7I A;  3ZNJ 1;  3EPG A;  1BQM B;  5EN1 A;  4PEO A;  3OPK A;  2DY1 A;  2UXC F;  3NL0 A;  1J5E F;  2FJX A;  1WF0 A;  3IC1 A;  3CC2 S;  2MQO A;  4MKB A;  1OY6 A;  1QSY A;  2R8J A;  2DHG A;  2CQ2 A;  3DLL Q;  2YNH A;  2V9K A;  3ZO7 A;  3OVA A;  4J91 A;  3VZH A;  4LF2 A;  4RR5 A;  4M5I A;  1VC0 A;  1VHF A;  5HJY A;  1QE1 B;  3QT8 A;  3M7V A;  3VAH A;  1FEE A;  2FYX A;  3TAN A;  2UUC J;  5H9F J;  2HIQ A;  4QQB A;  3DRP B;  2OSR A;  2B6A A;  1P1T A;  3I5C A;  4M5L A;  3X1L B;  4DX8 H;  3GON A;  1X9M A;  2FUG 9;  4CDI A;  3NS6 A;  4ED7 A;  1N4L A;  4L6V 3;  1T11 A;  5GMD A;  2HGM A;  5LMN F;  4WE1 A;  2KVI A;  3NEK A;  5E33 A;  2R2S A;  1JQG A;  4C0B A;  4XK8 C;  2V2Q A;  2DNH A;  3CIM A;  2MYF A;  1H74 A;  4LF4 J;  2H4Y B;  2W24 A;  1RTJ A;  2F4F A;  4HI1 A;  1WOP A;  4I6W A;  2ZZM A;  4X65 F;  1JLG B;  3BM7 A;  3PYG A;  1IKW B;  3V6J A;  4PYA A;  2V69 A;  3TWZ A;  1KOO A;  3H5Y A;  3MM9 A;  3K5L A;  2AJ0 A;  4ZVH A;  2WCX A;  4ZJL A;  1VYA A;  2WVC A;  3CC4 S;  1JLE A;  4B3M F;  3MOJ B;  4LFB J;  3QGH A;  2HHW A;  3RJM B;  4F4X A;  2IY5 B;  2CPJ A;  3UR0 A;  3NGK A;  1RYR A;  3D28 A;  3GE9 A;  4DPT A;  4ZP7 A;  1O5J A;  4N41 A;  3M2U B;  2B9E A;  2I6W A;  3G8T A;  2AJ4 A;  4CTA B;  2Q66 A;  4HYK A;  2AIR B;  3AD7 C;  3W64 A;  5EWG A;  1TV6 A;  2QMX A;  3QNW B;  3HF5 A;  1RT1 A;  4NLP A;  5F0W A;  1SH2 A;  4DS4 A;  2H5J B;  2J0Q D;  3P96 A;  4L3K A;  5B0F A;  4RW4 B;  1F5B A;  2QL9 B;  4PPZ A;  1WHX A;  3HCX A;  3J7A 1;  1LW0 B;  4M63 A;  4RW9 B;  2DCL A;  2MLX A;  1U1L A;  1I5O B;  4LSN B;  1VRU A;  1IBC B;  2HYI B;  2FIU A;  2NCK L;  3ETM A;  1VQK S;  2DVI A;  2AKW B;  1IR2 A;  5A8W A;  5FLX Y;  3R2D J;  4J5O A;  6FD1 A;  3N6N A;  3H2U B;  1FDA A;  1LFP A;  3MMB B;  3T1H F;  1S6Q B;  3CMA S;  2X3G A;  2E1M C;  3IWX A;  4G1P A;  2HQI A;  3CD5 A;  2MTL A;  4OHY A;  1ZPV A;  1YX2 A;  1N34 J;  4YR0 A;  2AQ4 A;  3OXF A;  2J0X A;  1RT3 A;  3OL8 A;  1HNV A;  1R43 A;  4H4O B;  3C66 A;  1NJW A;  2HHX A;  2XZT B;  4F25 A;  2NSC A;  4LSL A;  2J9C A;  3BSN A;  1RTH B;  3A8E A;  3GMG A;  2DIS A;  2BE2 B;  3F73 A;  3CD0 A;  3GYG A;  2XMV A;  1U24 A;  2XS5 A;  4GKK J;  3N5F A;  1PO6 A;  2IRU A;  4CM2 A;  4NEZ A;  2I1R A;  1FVS A;  5G0R A;  4PG4 A;  3IBW A;  5LT5 A;  2O66 A;  4YME A;  3BGL A;  1T9V A;  3GSI A;  3DXB A;  4RBU A;  1PC4 A;  3M4X A;  3HD1 A;  3M9O B;  4FXV A;  3R5B A;  2Z2M A;  2LEP A;  4JI5 F;  3NKY A;  2DNQ A;  4CT8 A;  5D0E A;  4IOC Q;  2K7K A;  3DGP B;  4CI0 B;  5E3C A;  4ZLP A;  2MDA A;  2W2N P;  2ZHO A;  3B8H A;  4KH0 B;  3JXO A;  4O3R A;  2KI2 A;  4U67 Q;  2AX0 A;  1FI4 A;  2O01 C;  3TAM A;  3Q8Q B;  5KG2 A;  2BAN B;  1MSW D;  1RT7 A;  2GML A;  2MJN A;  1KLM A;  1FJG J;  2EKY A;  2PA8 D;  1D09 B;  2I8E A;  3GFH A;  2M52 A;  5F0U A;  3CT9 A;  1U1M A;  2B9Y A;  3LWM A;  3PR5 B;  1Z4U A;  3MPD A;  3GLJ A;  4NA2 A;  2HHH J;  2HFN A;  4DU7 A;  1CJU A;  2R7W A;  4QR2 A;  3AXK A;  1HR0 J;  1WOS A;  2MZJ A;  4ILR A;  4RLE A;  1BMQ B;  3DM2 A;  2MY7 A;  3D3B J;  4H4K A;  1OPZ A;  2IC3 A;  3DOK B;  4ECR A;  2JVR A;  4L73 A;  1U7L A;  3G82 A;  1URR A;  5J1N A;  4NLY A;  5KFA A;  1YG0 A;  2Y3Y A;  4UUX A;  1YBU A;  1MW7 A;  1X4D A;  4OZ5 A;  1RHR B;  3O8W A;  3H7H B;  2HVD A;  2MHN A;  1JMT A;  3R5D A;  3HT3 A;  3MAH A;  4C97 A;  4WP9 A;  3D6M B;  1ZTT A;  3PHE A;  2GHP A;  3VAL A;  3MUM P;  5C24 B;  2RHS B;  1SJ3 P;  3G6E S;  2YWE A;  4ED0 A;  2FC8 A;  3D7S B;  4RNM A;  3CCJ S;  1WUU A;  1FCA A;  3UO0 A;  4CO5 A;  3BH7 B;  2R7V A;  2BYC A;  2EBG A;  4ZPB A;  2VPW B;  3AHP A;  1FXD A;  1LEO A;  2C2K B;  4DR2 F;  4DV1 J;  3DLG B;  2OI2 A;  1JLF B;  4OX9 F;  5GAD U;  1FX4 A;  2PC6 A;  3RTV A;  2VFU A;  2GMH A;  3QO9 B;  4C3K A;  2E1R A;  2HVZ A;  2BAC A;  1F3V A;  3IAS 9;  4J9V A;  3DLE A;  4USH A;  1SPB P;  4CO2 A;  4LJM A;  3IBF B;  2L9D A;  2CJA A;  1M5P C;  4ICL A;  2XWX A;  4BHQ A;  1XQI A;  4ZK7 M;  2IBK A;  4DV2 J;  4B08 A;  2GVD B;  4MK9 A;  1EIY B;  1Y9O A;  2AJF E;  3RBZ A;  1UA1 A;  1KP6 A;  4C0H A;  3FFI B;  4BBY A;  2XMK A;  1HQE B;  3C6U B;  1NJI T;  4Q8E A;  3IS9 B;  2GO9 A;  2R3V A;  1DHM A;  2CNL B;  4PR6 A;  2M88 A;  4R0J A;  3MM6 A;  5E2Q A;  9RUB A;  1RYS A;  3D0G E;  4KGZ B;  3M1V B;  2KHD A;  4NE9 C;  3POT A;  3M8R A;  4X64 J;  4KYZ A;  4NL5 A;  3TZZ A;  5KFQ A;  3D9B A;  4WYW A;  1L3K A;  2R2T A;  3EVO A;  3K5M A;  2R2U A;  4P74 A;  5AJ3 J;  3IFE A;  2HK2 A;  5EWE A;  1KRP A;  3KHL A;  1JJC B;  3HVR A;  1UFW A;  1Q8K A;  1RTZ A;  1E6Y A;  4IFV B;  4DFM A;  2IYG A;  4RNN A;  3MUT P;  4ECQ A;  5B7W A;  1DRZ A;  1UVI A;  2HNY B;  2CPI A;  2YNI B;  1RAH B;  3MZI A;  3BF4 A;  4NLO A;  1K0T A;  1VLO A;  5HAO A;  4X4S A;  4ZVP B;  4OYA A;  2YWH A;  1S1U B;  1ZAW A;  1KFD A;  2RD5 C;  4LFA F;  1JJ4 A;  3D67 A;  3Q86 A;  3R8Y A;  4Z37 A;  2ASJ A;  3LP1 A;  3EJM A;  3EXC X;  4UST A;  4G6V B;  2RIJ A;  2IJF A;  2UVV A;  1WJ9 A;  2ZH7 A;  1RAB B;  5KFH A;  2KKH A;  1FKO B;  4DV4 F;  3BBB A;  4Y2M A;  1WDD A;  1KKH A;  3QAT A;  2M7S A;  1XR5 A;  1IQT A;  2EFO A;  4N8O A;  1TEL A;  3KWM A;  4GKJ F;  3MM8 A;  1X9W A;  2WSF C;  1FTR A;  2OEM A;  3R6G B;  3O44 A;  1W2B R;  4C9D A;  4IRD A;  1X4E A;  3RYL A;  2OEL A;  3TZX A;  3W3S A;  5A8K A;  1QAX A;  3GB0 A;  4E0D A;  4I7F B;  1LWX A;  4DR6 F;  4HAC B;  1Y3J A;  2EFQ A;  9ATC B;  3ET6 B;  5LM7 E;  3M6W A;  2QA4 G;  2V6A A;  1M5S A;  1BHN A;  1S1T B;  2WOM B;  4P71 A;  2AYG A;  2EFG A;  3C15 B;  3DGV A;  1UCN A;  5DM6 Q;  1Q5Y A;  1Q8B A;  2QA2 A;  2RML A;  3JQK A;  3RR7 A;  3N6L A;  1IBL J;  4QU7 A;  3TAP A;  4R8U B;  2C22 A;  2BA9 A;  3PNI A;  3H20 A;  1SQG A;  4YFU A;  1AUS L;  5B0C A;  3IA0 A;  1MMD A;  1S49 A;  3QJJ A;  4YP3 A;  2EVZ A;  1VR6 A;  3DHW C;  4UQT A;  3QLH A;  3J81 j;  3DMJ A;  2HG4 A;  3QT6 A;  2WON B;  3LO3 A;  1GAO A;  3B54 A;  1NK5 A;  3DDK A;  3TX0 A;  2M5Y A;  1V5V A;  3ITH A;  1OPI A;  4ITS A;  4KR0 B;  1O6X A;  1N5S A;  3C8Y A;  4ZS6 A;  4DR4 F;  1KQF B;  4JI7 F;  3QYY A;  3E3X A;  2LYV A;  4B3S J;  1Q81 T;  1LXJ A;  2VA3 A;  2PSZ A;  3RBE A;  1HNI B;  2KXF A;  2UXD J;  4C8N A;  3I0S B;  2CPH A;  4USM A;  1QAJ A;  2KFZ A;  2ZH3 A;  3BYP A;  2YBV A;  4KHR A;  4OMF G;  2YX7 A;  4ZHR B;  4IRK A;  5DDO C;  4F2R A;  2FLP A;  2M9K A;  3NGU A;  4PKD B;  2BV3 A;  4TXS A;  3MUR P;  2MPU A;  4B3R J;  1J5O B;  3MTK A;  2VG7 B;  1EKS A;  3N4W A;  3X3U A;  4OYB A;  5I3U A;  1FKP B;  1S6O A;  3PRV A;  3K89 A;  4ZP9 A;  3D5M A;  1PSD A;  5DET A;  1RBA A;  2GQQ A;  3V6K A;  4KKO A;  1T05 A;  2NXJ A;  1S79 A;  4ZDN A;  1KWM A;  2ZBI A;  2YQ1 A;  4B3T F;  2HS0 A;  2WW4 A;  4C3L A;  2CPZ A;  4OQJ A;  2D41 A;  4HKQ A;  5AXM A;  1C1B B;  1WKK A;  2UXC J;  3MAA B;  2DRD A;  1DBD A;  1NSP A;  4EZ6 A;  2F4V J;  3CF5 Q;  4Z7Y A;  1RK8 A;  4HH1 A;  3AAW B;  1RBL A;  3W5X A;  2IFX A;  5IT4 A;  2C42 A;  1HAR A;  2DRA A;  3T19 A;  5CZV A;  3FRZ A;  2XEX A;  3TVY A;  4DCP B;  1NXI A;  2M2B A;  2IAJ A;  3PW2 A;  2HHQ A;  1WEL A;  1C4C A;  4IH7 A;  3H98 A;  3NG8 A;  2XC9 A;  2GGP B;  3AJ1 A;  2HHP A;  2PMH A;  3KUG A;  3Q0A A;  3JQJ A;  4ED1 A;  4QIW D;  4P6Q A;  1AXQ A;  4DL5 A;  2HS4 A;  4QBU A;  2H5E A;  4V19 X;  2E66 A;  3FVY A;  1H72 C;  1RTD B;  1S97 A;  2F1F A;  5LMN J;  4OV1 A;  4L72 B;  1REV A;  2E9T A;  1I1G A;  3AOB A;  2P6T A;  2FHJ D;  2HQG A;  1BY9 A;  3QIP A;  4JI2 J;  3MEK A;  4QJV A;  4N5S A;  4FF3 A;  4LF9 F;  4NXN J;  2PI4 A;  2K1R A;  1NDC A;  3BGF A;  1U09 A;  2DIU A;  3VVT A;  5C42 A;  4X65 J;  1PCA A;  2C3O A;  1SI9 A;  5J2Q A;  1CS4 B;  3D0I E;  3NGS A;  2V0N A;  2BUN A;  4QWA A;  1B64 A;  1FDB A;  1FRH A;  1WHV A;  3BPD A;  3HHE A;  3ENV A;  1T8E A;  1S12 A;  1HNZ F;  1XIQ A;  2WVE A;  2QA4 S;  1HL6 A;  1MRO A;  1NK0 A;  4B3M J;  1S9F A;  1UMJ A;  3G6X A;  3Q83 A;  1VQ4 S;  3MCO A;  1FO1 A;  1MML A;  4MK7 A;  2B0G A;  3W5Y A;  1UVJ A;  4EWT A;  3SDE A;  1NDL A;  5GME A;  2RRB A;  4J9L A;  4TLR A;  2ZC4 A;  3I31 A;  5I4M A;  4PRF A;  2JC0 A;  1SJR A;  3CDW A;  3HVT B;  2UVU A;  1SL1 A;  1IWA A;  3PHT A;  2HQF A;  5IWA F;  2B43 A;  3ZZY A;  3C14 A;  3EGN A;  4TY9 A;  1EJ7 L;  3D1Q A;  3M30 A;  3UDV A;  5CCL A;  3J7Y I;  3ZZZ A;  3T1A A;  4YHH F;  1R0A A;  1BGX T;  4PWD B;  4RW8 B;  3SIP B;  3G6Y A;  2Z4P A;  5F3Z A;  4K4U A;  1XNR F;  1IKV A;  4TKT A;  2FHM A;  3GJT B;  3IBC B;  1HWK A;  4RWW A;  3H4D A;  4RW6 B;  1OYD A;  3PW4 A;  5E5N A;  2AEJ A;  4G1Q B;  3VQS A;  3TVK A;  3T1H J;  2QTW A;  1WHW A;  4DFK A;  3R6L B;  4WFA Q;  4AUK A;  4MFB B;  4OYO A;  3TUJ C;  4PAA A;  3CJ8 A;  2ZBR A;  2QSW A;  3DU6 A;  4LF7 F;  2R2R A;  5A6W A;  4O4G A;  4OHV A;  4QYZ K;  1HKA A;  1YZ7 A;  2BJ1 A;  3G8S A;  1Y5L B;  1UJ6 A;  3PTW A;  2JZ5 A;  4NLX A;  2Z56 B;  3C16 B;  5L38 A;  1YDL A;  1YIT S;  3D6H B;  2Y1I A;  3NP5 A;  4X2B A;  1S1V B;  3D0H E;  3W66 A;  2PI5 A;  1IQZ A;  3F0N A;  2FHJ A;  3OJU A;  1MN9 A;  4X84 A;  1W25 A;  1WD6 A;  4NCG B;  5KT4 A;  2Q6B A;  1HA1 A;  4CLT A;  1ITP A;  3OFH A;  2QZ8 A;  4Y2A A;  2RF2 A;  2CNN B;  2IM0 A;  1J27 A;  5IV4 A;  1M1K T;  3KLG A;  2CPE A;  5A8R B;  5CYM B;  3SQG A;  1NB2 A;  4JI5 J;  2YKN A;  1U47 A;  2PA3 A;  2HKE A;  5THW A;  1U1R A;  2W2P P;  3Q8S B;  1HI1 A;  4LQ3 A;  4K0K F;  1AW0 A;  4PZV A;  4JI4 F;  2E9R X;  4HTJ A;  4LFC F;  3T5L A;  2RUG A;  4ZLN A;  3FMB A;  5EX0 A;  1BUX A;  2VV5 A;  1NKC A;  2F65 A;  2UVR A;  2ZZN A;  2G1D A;  2FD2 A;  3CJS A;  3KDO A;  4IFY B;  4HDH A;  1HBU A;  2CJY B;  3W9H A;  1UWA A;  5DM7 Q;  3OQ2 A;  2ZNY A;  5GAH I;  3ILI A;  3HSD A;  4X4O A;  5KOW A;  2D7S A;  3M8Z A;  4Y28 C;  1BQN B;  3HLU A;  2E5H A;  5MAO A;  2DIV A;  1OJ4 A;  3HD2 A;  1VQ5 S;  5F8I A;  5KFN A;  2HFS A;  2ACM A;  4WPA A;  3NLC A;  3NAI A;  1C1C B;  2ALY B;  1I6J A;  4HH0 A;  1DZ5 A;  1EQ0 A;  1U1Q A;  4X4U A;  1BE4 A;  3S6E A;  1S1X B;  3DOL A;  2WK4 A;  5KFK A;  1K9M T;  3LAK A;  4A4J A;  3HP6 A;  5F9L A;  1B3T A;  1Y3K A;  1QD1 A;  4I0W A;  1QSL A;  3MM7 B;  5FD1 A;  1GMW D;  3PIO Q;  4DPW A;  2I0X A;  5D0G A;  2FJE B;  1UEK A;  5CA5 A;  1S7H A;  3M2R B;  4R5P A;  4OLP A;  2ROE A;  2CPX A;  4QIG A;  1TR0 A;  2BJE A;  2HQD A;  3IM8 A;  4M94 A;  5L9N A;  2AYM A;  3SFU A;  4DSL A;  3KOA A;  2B8P A;  1TAQ A;  3NWR A;  1XBW A;  2C2M B;  5KG5 A;  3MTJ A;  3GU0 A;  3RBD A;  4EEY A;  4IQM A;  4N47 A;  4DQP A;  3M2V B;  2AT1 B;  4MKV A;  1KTQ A;  4WU2 A;  4DR2 J;  1VIX A;  4AL6 A;  1GTH A;  2RRN A;  4OX9 J;  4NMX A;  4WU3 A;  1HMV A;  2MJU A;  2P8I A;  2A2D A;  3EX7 B;  3PX6 A;  5HP1 B;  1RWN B;  1VI7 A;  4J9R A;  3OLA A;  2MGZ B;  2LMI A;  1EX8 A;  1PC5 A;  3KHG A;  4QPX A;  1RAG B;  1RKJ A;  5HO4 A;  4DEZ A;  2KO1 A;  4CQ1 A;  2NZC A;  1SV5 A;  3H5U A;  2VC1 A;  1RUS A;  4NLD A;  4PG8 A;  1OIA A;  4DL3 A;  1TMM A;  2R7O A;  3CCS S;  2W25 A;  4ECT A;  4LF5 F;  3ZFV A;  4GRS A;  2N4D A;  4NYZ A;  3KHR A;  3BBC A;  3RU0 A;  4DR5 J;  4UTG A;  3W5Z A;  5L1K A;  3MPV A;  2NPI A;  4EO8 A;  4P10 A;  4QWE A;  4OZJ A;  2DXE A;  2UXB F;  1HBO B;  1HQU B;  3V6H A;  1R8A A;  1CC7 A;  4DF8 A;  4UOG A;  1ARO P;  1WTB A;  1H6K X;  4NX9 A;  4KH1 B;  3BYR A;  3PR4 A;  4WBF A;  1KQS R;  4TU8 A;  3H2L A;  2I5J B;  4EBE A;  3IR5 B;  2AZ1 A;  1NLK L;  1NK8 A;  3BBF A;  4WFZ A;  1T95 A;  1FVQ A;  3HMJ G;  4FNI A;  2ZM6 F;  3NGT A;  2MQL A;  3TRG A;  3ZTP A;  4J7C A;  1MU2 A;  4OYM A;  5B0G A;  7AT1 B;  1A0O B;  3U1L A;  2MLY A;  4FPR A;  2HRU A;  4YB7 A;  5KG7 A;  1NSA A;  4PQU B;  3M8Y A;  1GMW A;  3UNG C;  2MSS A;  2LKZ A;  4A46 A;  2PE8 A;  3MED B;  1MN7 A;  2P5V A;  2OP5 A;  2NS1 B;  3MEC B;  2CAD A;  4DPU A;  3QRP A;  2B7C B;  5ADZ A;  2DXF A;  2CG8 A;  4OZ0 A;  1TL4 A;  2HAI A;  3SYZ A;  5KFW A;  4NRT A;  1ZM4 A;  4IG0 B;  3QWU A;  4LVO P;  5KFR A;  1N5Y B;  1CQM A;  4ED5 A;  5K20 B;  1JLB A;  1D9F A;  3W61 A;  5MLC V;  5LJ5 Y;  4E2F B;  1ZA1 B;  3PXG a;  1DLO B;  4NEY A;  4DUY F;  5KG4 A;  4K4X A;  4DV4 J;  1NME B;  4ELV A;  1WC4 A;  3IM9 A;  1UPM B;  4GKJ J;  4CYU B;  2XMJ A;  4TY8 B;  1FRK A;  1FTC A;  5SUH A;  1CJV B;  1S0O A;  2KL8 A;  2VA2 A;  1S0N A;  2UUA F;  2G2Z A;  1NK7 A;  4Y3C A;  3ZZR A;  1SJ4 P;  3JYT B;  1T02 A;  2HQ3 A;  4DR6 J;  1F5A A;  1UET A;  4J9M A;  1LFW A;  2AGQ A;  4RNO A;  1Y0H A;  1YHQ S;  4N56 A;  3OUY A;  1WKJ A;  3AOA A;  1GEH A;  1LK7 A;  4BWM A;  4OYP A;  4QZV B;  4B17 A;  1UVL A;  5BR8 J;  3VWS A;  4CLZ A;  4LF6 F;  4O3O A;  4KFB B;  4FXD A;  2XHW A;  3OBI A;  2RQM A;  3KLE A;  2MQM A;  2K06 A;  2CDR B;  1HW8 A;  3V5R A;  2CRL A;  4B9V A;  1IBM J;  1SC1 B;  4O3Q A;  1DFD A;  3JSM B;  1Z2Z A;  1YZ6 A;  2GCF A;  2QL7 B;  4ANC A;  2N3O A;  1SBR A;  3CDA A;  2B7B B;  2VQF F;  4JI7 J;  3Q22 A;  4C11 A;  4X66 F;  1LKZ A;  3QZ7 A;  3K0J A;  1RGV A;  1NUE A;  1VIS A;  1X7V A;  3A3N B;  2XCA A;  4ZJQ A;  1KTV A;  3KLH B;  3GQC A;  3AH6 A;  5IT9 Y;  2V2Z A;  2GW8 A;  4DSI A;  4DR7 J;  2VPX B;  4KT0 C;  3PAC A;  1IVZ A;  4HT7 A;  2RJZ A;  1KVJ A;  4Y34 A;  2JOQ A;  2VZ9 A;  1VQY A;  4Y00 A;  3HZG A;  2LP4 A;  3ZNU A;  2GVZ B;  3R7B B;  3EWG A;  2DGU A;  4QOT A;  3ILO A;  1CC8 A;  1EB0 A;  2FJD B;  2W2Q P;  2MZ1 A;  3E01 A;  1JLC B;  4B3T J;  1R6Y A;  2RH3 A;  2ZDP A;  1ZAX A;  4IRC A;  1F60 B;  4DV0 J;  3I9V 9;  2RDI A;  1X0F A;  1M1H A;  1CJT B;  2QX0 A;  3SSR A;  1UWB A;  3W9J A;  2W9B A;  4RPF A;  1GMU A;  2HVH A;  2P6S A;  3P45 B;  3UVJ A;  1CLF A;  2RAQ A;  1M5H A;  3VAK A;  2ZOG A;  5JVG Q;  3H4B A;  1U6F A;  5CCM A;  4IYQ A;  5BYQ A;  3OL9 A;  4Q5V A;  4X4Q A;  4NAS A;  4LF8 F;  4DV6 F;  3MD3 A;  2RU9 A;  2IA6 A;  4LBI A;  4FVC A;  4NYP A;  3JAM U;  4K4W A;  1X0P A;  1RKI A;  1EET B;  5H1S V;  4KGM A;  1XTZ A;  2CNO B;  1T9Y A;  3EDQ B;  5HQM A;  3AY0 A;  3LUY A;  3Q8Y A;  1OSD A;  5K5M A;  2V4Q A;  3LGN A;  1QJH A;  3AB2 B;  2YKO A;  3ISN D;  5LOQ A;  3DRR B;  2QV6 A;  2HVI A;  2QYG A;  1U45 A;  3MM5 B;  3D68 A;  3M8Q A;  2GIR A;  3L09 A;  3UR3 C;  4LF9 J;  3BO3 A;  2E44 A;  3ZTS A;  2CQ1 A;  4ZVE A;  5B0E A;  3M8P A;  3BQ1 A;  1VQ7 S;  4UOC A;  1LW2 B;  2EKN A;  2H4W B;  1JKH B;  1RT6 A;  3QFW A;  1NDK A;  2HZA A;  2HS3 A;  3GV7 B;  3A13 A;  2LDI A;  1M5O C;  2CZV C;  1H3D A;  2ATC B;  1R6V A;  2X3D A;  4GVB A;  1NO8 A;  3QJP A;  2V94 A;  1AZS B;  2UU9 F;  5A0Y A;  3PJ9 A;  2VQE F;  4LR7 A;  2LQ8 A;  1LWE A;  5KFG A;  3IP0 A;  1KDN A;  4IOB A;  3NCR A;  3V4I B;  4AE5 A;  1OYE A;  5CH7 B;  1ZTW A;  4F4Y A;  2ZWP A;  3OW2 R;  2O67 A;  5C42 B;  2GHV C;  2W7A A;  2DGQ A;  1U4B A;  1YWX A;  1KN6 A;  2R8G A;  4JI6 J;  4P2F A;  2YQ0 A;  3MMA A;  4MAK A;  1N52 B;  5EDW A;  2VKR A;  1FHT A;  5BYS A;  2KH9 A;  1X9S A;  3IRX A;  1HNW J;  3H5S A;  1OSC A;  4AL7 A;  4IKA A;  1NB7 A;  4Q2M A;  2MZQ A;  4ZVO B;  1XK8 A;  1XNR J;  3GZ7 A;  3UN3 A;  4A47 A;  5I3Q A;  3NCQ A;  1RHQ B;  1T9X A;  2YWG A;  3BB5 A;  3KK2 B;  1LWF B;  2KYZ A;  4JV5 F;  1BWV A;  2CG4 A;  2ZBQ A;  2K8G A;  2DNO A;  2CQI A;  1VFJ A;  4ZCK A;  3VHQ A;  1LV5 A;  3DLK A;  4DL7 A;  3WC2 A;  4ECX A;  4PPD A;  3SMZ A;  3KUE A;  1SB6 A;  5ITH A;  3PW0 A;  2JX2 A;  1FJC A;  1TKZ A;  4TNO A;  3FK4 A;  3CB4 A;  5FDL B;  3M32 B;  3BGR A;  3MEG B;  4AQY F;  4AXI A;  3CO0 P;  4LF7 J;  2OPQ A;  4WCE Q;  2KRB A;  1JLQ A;  1DTT B;  3CCR S;  1GQE A;  4NLW A;  2XSJ B;  3NMA A;  5L1I A;  2C1E B;  2J7W A;  3FRY A;  2FVP A;  2CQG A;  2DHX A;  2V2V A;  3D4J A;  1HNX J;  5JVH Q;  2CQ0 A;  2XBP A;  4A8M P;  5A2Q Y;  1ZM3 A;  4Z2X A;  3V81 A;  4NLV A;  2GIQ A;  2UZA A;  2RKI A;  1BQX A;  2DPI A;  2YH1 A;  2UVW A;  5J2M B;  1TL3 A;  3SCJ E;  1H98 A;  2BKN A;  4RW7 B;  3LW5 C;  5GAG I;  3IG1 B;  4DV3 F;  3F56 A;  1FRM A;  1B0T A;  1QLN A;  1TL7 B;  3MMC B;  1TVR A;  5DG8 A;  4ZPW R;  2K3I A;  3CC7 S;  3KMS A;  4I69 A;  5DLF A;  4K0K J;  5IV3 A;  1TKX A;  2X1B A;  2YXL A;  2C2E A;  4LFC J;  4KGK A;  4KHP J;  3VGT A;  2MKY A;  3TUP A;  5ETM A;  4J9O A;  2XY5 A;  4QYR A;  2PEH A;  5K14 B;  2XSF A;  4PQA A;  3DRS A;  3K8V A;  3IWN C;  2DCU B;  1RT4 A;  1A7G E;  1NHU A;  2PII A;  3MR6 A;  4RUB A;  1UTA A;  4CLL A;  2HMI A;  2QL5 B;  4WXW A;  4K50 A;  4USK A;  4DMZ A;  1R31 A;  3C6T B;  4DFP A;  1UW9 A;  2E7X A;  2RSQ A;  3UCZ P;  2JEF A;  2WAQ D;  1VQ9 S;  3IR6 B;  3RG6 A;  4W92 B;  3KK3 B;  4ECY A;  1WF1 A;  2EFV A;  2F7V A;  4I4B A;  1IM6 A;  2FB0 A;  1C0U B;  2V68 A;  4OL8 A;  6FDR A;  4TU9 A;  4J9K A;  2ROG A;  2HVE A;  1NJY A;  4J9Q A;  4DG1 A;  5HLF B;  2GQC A;  1WEY A;  1W2I A;  4PXD A;  4CO0 A;  4QIE A;  3WC0 A;  4EU0 A;  4ZCI A;  3OSP A;  3NGD A;  2FJW A;  1HBN A;  1FT8 A;  4F8R A;  2W4D A;  2A10 A;  4OZL A;  3SEO A;  2DNP A;  3FCW A;  3HFV A;  2KTQ A;  3E51 A;  1FF2 A;  5KAK A;  4NLS A;  4GMK A;  5L9X A;  4FYX B;  3CD7 A;  1IKY A;  1GXL A;  2V8P A;  5B0A A;  4C98 A;  2PEB A;  3AOC A;  1FA0 A;  1D8Z A;  5D4L A;  1TFY A;  1V3Z A;  1NRK A;  2V5H G;  5FLX U;  2AF6 A;  3OR1 B;  5JUM A;  4GC7 A;  1EZZ B;  4LRD A;  5D3G B;  1U6B A;  4AYB D;  2H3E B;  2Z58 B;  3AJD A;  3GWC A;  4USV A;  4B3O B;  3OR2 B;  4NZ7 A;  1TKT B;  4DR1 F;  1BD6 A;  4RBV A;  4ECU A;  2R7S A;  4J9N A;  1FNM A;  3FNN A;  1FXL A;  3NS5 A;  2NXC A;  3RRK A;  4TU7 A;  2LU2 A;  4W90 B;  1NHV A;  4YS2 A;  2I38 A;  3KKF A;  1Q95 G;  3DOM A;  3TUZ C;  2YX1 A;  2HLT A;  3R3T A;  2J9D E;  3AFG A;  4A8X A;  1W7W A;  3W2W A;  4FYY B;  4N8N A;  5GVQ A;  1S5Z A;  4ZVS B;  2YNF A;  1RTI B;  1EP4 B;  4G3I A;  4RWX A;  1UW4 A;  1Q1K A;  1T03 B;  3DHX A;  2QMU B;  2UXB J;  4ID8 A;  3SXL A;  4DV5 F;  1ICE B;  2JLE A;  1MG7 A;  3KJV B;  2E5G A;  1GX6 A;  2N7C A;  2LXI A;  2O1P A;  2C3U A;  5F8G A;  1QY7 A;  3QSY B;  3BKT A;  2ZKT A;  3BN4 A;  2XMM A;  5T7L B;  4DS5 A;  1HD1 A;  5EUH A;  3V6D A;  4FDF A;  1PBU A;  1C0T B;  1VQN S;  4OI1 A;  1CUL B;  1OWX A;  2ZM6 J;  1NPR A;  4IO1 A;  2DT9 A;  2OKQ A;  4FP9 A;  2ZH1 A;  2D9O A;  4X4T A;  3NAH A;  3QRQ A;  2VG6 A;  1S6P B;  3J7Z T;  3HKW A;  3EGW B;  1T3O A;  2V4J B;  5A6P A;  3MGJ A;  2FHK A;  1BC6 A;  4JI3 J;  3U7J A;  4OZ2 A;  2CA9 A;  3NGR A;  2K7J A;  4QCL A;  3G8Q A;  1N8R T;  3DYA A;  3GG0 A;  1GK8 A;  2WHO A;  2PD1 A;  3DI6 B;  4CLS A;  2DK2 A;  1Y5I B;  3ENA A;  3EGV A;  3T5J A;  2CPF A;  4MKY A;  2R7R A;  4ID5 A;  5B09 A;  1WI6 A;  3DFE A;  1NK6 A;  4WIQ A;  4F4Z A;  3SV4 A;  1TMJ A;  1U26 A;  4MIA A;  4JI0 F;  4F3M A;  4QW9 A;  1UFL A;  1V6H A;  4OZ3 A;  2HHV A;  2R8I A;  2VL1 A;  2JH3 A;  3KLI A;  1BXN A;  3HHK A;  4RNF A;  4CZC A;  4CLU A;  5L46 A;  1MLA A;  2L9N A;  1WKL A;  5C2C A;  5KFM A;  2VIH A;  2ZD1 B;  1YJU A;  3G4S S;  2MLZ A;  1WEZ A;  4TVA B;  1B0P A;  1XR6 A;  3LP0 A;  5B0D A;  2XMW A;  2J8S A;  3BKF A;  3K2Y A;  1CQN A;  2NUH A;  4C3M A;  3OFF A;  4X4R A;  4LT6 A;  1WC6 A;  1NHK L;  4GO5 X;  2W01 A;  2LLZ A;  1NAQ A;  2ADB A;  3Q8V A;  4M1K A;  1WAC A;  4RX6 A;  2XQC A;  2W7P A;  2GJF A;  5IQ6 A;  2AWZ A;  3GJR B;  1S0V A;  4LF6 J;  2OPS A;  5L1L A;  5C5J A;  1HBM A;  4DJB A;  3B4M A;  2B3T B;  4V19 J;  2C3P A;  1VBZ A;  2VG5 B;  2AD9 A;  4NPO A;  1FNO A;  1HYS B;  3T1Y F;  4PYD A;  1FK9 A;  2ZHA A;  4WK1 A;  3RAM A;  3W2V A;  2ZZT A;  2Y8Y A;  5J1E B;  4RO0 A;  2V9W A;  2IMO A;  4ZJO A;  4NLR A;  2VQF J;  1XMB A;  2BAB A;  1RE1 B;  4X66 J;  1X5O A;  2KJV A;  2EPI A;  2PMW A;  2VPY B;  4O0N A;  4IR1 A;  2GJ2 A;  1VRT B;  6AT1 B;  1YI2 S;  1UEV A;  3HSZ A;  4FF2 A;  3QSI A;  2F3J A;  1AB8 A;  3I32 A;  3CCV S;  4EYI B;  7FDR A;  2HFO A;  2ALZ A;  4ZN3 A;  2RVJ A;  4NLQ A;  2LVW A;  3EZ5 A;  3TO8 A;  4WP3 A;  2KG0 A;  2MXY A;  2JSX A;  2CFX A;  4L75 A;  3MPY A;  2HND B;  2NLW A;  1V3S A;  3FUY A;  2ZJQ Q;  2Y1J A;  2B9X A;  1UKU A;  5KG6 A;  3RRH A;  2M70 A;  4I2Q B;  4GVL A;  3T6J A;  4Q7A A;  1URN A;  1R8B A;  4OI0 A;  1T94 A;  4DLE A;  2WBR A;  2DH7 A;  3AT1 B;  1CJK B;  3H8Y A;  5J2P B;  3PW5 A;  2QLJ B;  2NYH A;  4K59 A;  1IUJ A;  5F8L A;  4DHV A;  1JLA A;  1HWU A;  3KJQ B;  4N77 A;  3R5J B;  1UL3 A;  3GR0 A;  4ZCM A;  2PN6 A;  5HRO A;  2BQ3 A;  4JI1 F;  4DV7 F;  3FQL A;  1DQ8 A;  1KQK A;  3PIP Q;  3LP2 A;  3NMR A;  2E1P A;  2ZE2 A;  2HHT A;  2HWI A;  1L5U A;  1NU4 A;  2J0W A;  4E98 A;  1FWP A;  4LF8 J;  4DV6 J;  4OIX A;  1FRI A;  2EBE A;  2VHG A;  3MCS A;  4OLO A;  1PYO B;  2KZM A;  4ETX A;  4H4M B;  5CQG A;  2H5I B;  5D0R A;  2ZH9 A;  5C25 A;  1G7C B;  1Q5V A;  2Q1L A;  2BM0 A;  3O1L A;  2MB0 B;  1O0P A;  1KD1 T;  2BE9 B;  5E41 A;  4FBU A;  5J2N A;  3BQ2 A;  3BSA A;  1XNQ F;  4WWS A;  2VKZ G;  3T9Z A;  1VIO A;  1WHY A;  4WZM A;  1BQM A;  1PIL A;  4LRF A;  3FCH A;  5I42 B;  3EDR B;  3BQ0 A;  3OFE A;  4CLK A;  5HK4 A;  1EKR A;  4YR2 A;  1ACM B;  1N36 J;  2OO4 A;  2NUU G;  2J8A A;  3KDN A;  4O23 A;  1WEX A;  2F63 A;  2RHQ B;  4HR2 A;  3FGV A;  3M8Q B;  2V67 A;  2UU9 J;  2VQE J;  1N32 F;  2E7V A;  4ILL A;  1YJV A;  5D4O A;  2DRB A;  3BH6 B;  1M0S A;  1S7I A;  2FLO A;  5EWF A;  2MY8 A;  2OPP B;  3VGV A;  2VUG A;  1QE1 A;  2XS2 A;  4DLG A;  1Q0N A;  4FKY A;  2CQB A;  4K2X A;  1TFW A;  3HHL B;  3L95 X;  4DQS A;  2Y0B B;  5I3P A;  4WP8 A;  3DRP A;  4O3S A;  3N9U C;  4K2J A;  2Q6C A;  1NH8 A;  3HFZ B;  4ZA1 A;  1PIE A;  1NJX A;  4A48 A;  1JNZ B;  3Q24 A;  1N6Q B;  2V34 A;  3T3F A;  4URG A;  3EPI A;  1U02 A;  4F26 A;  3R9L A;  2HBZ B;  2GNK A;  2L41 A;  4IDK B;  4ZVG A;  4NLG A;  1IN0 A;  3G9C A;  2UUC F;  4K4T A;  1KVK A;  1SUQ B;  2VFS A;  1VJW A;  4X4N A;  3Q2S C;  1QVG R;  2GC8 A;  1JLG A;  1UFK A;  3K7R A;  3CXC R;  1IKW A;  3AA8 A;  4WYL A;  1KHV A;  1N5Q A;  3D1H A;  4NI2 B;  3FCV A;  2LQ5 A;  4ZVQ B;  3P5T L;  5A76 A;  3S01 A;  1RAC B;  4Y2I A;  1F6T A;  2DO4 A;  1VQP S;  1S4F A;  3PYD A;  5KFJ A;  2YVS A;  3T5K A;  4P7V A;  2W7O A;  1VMB A;  2BMB A;  4F02 A;  3TEH B;  5E3R A;  3DXS X;  1W26 A;  2MHE A;  2YNG B;  2GZO A;  3TJA A;  3I0R B;  4KV8 B;  2J7U A;  4NCB A;  1SXL A;  3M2U A;  4P75 A;  2YKM B;  3IWL A;  2I9S A;  1VLY A;  4CTA A;  3KYL A;  2E9Z A;  1VDH A;  2BEF A;  2W2M P;  4PXE A;  1VOM A;  4DV3 J;  3M6U A;  1U49 A;  2VOD A;  4ELU A;  5KFT A;  4J90 A;  4RW4 A;  5F8H A;  4XDC A;  2XZW A;  5HQ8 A;  4YEA A;  5U47 A;  1VS3 A;  1LW0 A;  4MIB A;  4RW9 A;  4DCJ B;  4U8V A;  2Q79 A;  4X4P A;  1S1W B;  4LFB F;  4LR8 A;  2D3U A;  2W9C B;  3CUL A;  4LSN A;  2DGO A;  3NRB A;  2NPF A;  2FJA B;  4TQS A;  1I3O B;  3HT0 A;  4KPY A;  3MMB A;  4I6Y A;  3DU5 A;  1S6Q A;  4FVM A;  2EXU A;  1NJZ A;  2XHC A;  1SKR A;  4O3P A;  1R8H A;  1WOR A;  3GIJ A;  4H4O A;  1K44 A;  1Y7P A;  2Z57 B;  5GAE U;  4P2S A;  3R97 A;  4RUC A;  2BE2 A;  3GIL A;  2CWK A;  3AXM A;  1HPZ B;  2MZR A;  4DUZ F;  1UP1 A;  5D0H A;  3FBF A;  3WHI A;  1CEZ A;  3UN5 A;  2OFG X;  1LK5 A;  2QJ3 A;  2NXN A;  2JHE A;  2CNK B;  2ZUA A;  2QSF A;  2CJB A;  2KZZ A;  3GJS B;  2XLI A;  4PUO B;  4U6P A;  1GX5 A;  3VR1 A;  2YPY A;  1Y10 A;  3MDF A;  3KLF B;  1D0E A;  4J9S A;  1G4C A;  1DAR A;  4LRE A;  3BJY A;  5KFO A;  1HWJ A;  2IA0 A;  3VGU A;  1M90 T;  3DGP A;  4DSE A;  3CJK B;  1RT5 B;  2HQC A;  4UT4 A;  2AEM A;  4BDP A;  1FD8 A;  4ILM A;  1WDT A;  2FJB B;  3PZP A;  4LR9 A;  2ZJP Q;  4F0M A;  3EYZ A;  1EQM A;  4XO0 A;  4KIA A;  1S72 S;  1D1U A;  4MH8 A;  2AGP A;  2BAN A;  3PRB A;  4PWW A;  4I2P B;  2RT3 A;  5DRK A;  2H65 B;  2ZBP A;  1OY8 A;  3EE3 A;  3MCM A;  3GV8 B;  2D1C A;  4ZIW A;  2HGN A;  3I4H X;  1ZBT A;  2V8G A;  5KFD A;  3U1N A;  3W8P A;  3WIU A;  2DR8 A;  2GA7 A;  4CH7 A;  1YJT A;  1D9A A;  2VH7 A;  1QAY A;  1TL1 B;  4YB5 A;  2JEI A;  2VD3 A;  4EFA C;  4DR1 J;  1WSV A;  3L7P A;  2EI5 A;  3J81 Y;  2UUB F;  3NBP B;  3CUN A;  3OXG A;  2J9E A;  1L3S A;  4O44 A;  3MPU B;  2YX4 A;  1YBA A;  3SCK E;  5F8J A;  1S9E B;  2J6T A;  3QT5 A;  2WSE C;  1ZZN A;  1DTQ B;  4RUH A;  5KFY A;  3P49 B;  4DSK A;  2NXU A;  3OTB A;  2P9C A;  3I4P A;  4NRU A;  2L3M A;  3PKM A;  5ETS A;  2OUG A;  1HR0 F;  4U7C A;  3MR2 A;  2BZ2 A;  4DV5 J;  4UF4 A;  5HAN A;  5KT2 A;  2OFH X;  3OXL A;  5GAE I;  2RRA A;  4AND A;  5C24 A;  4K4Y A;  2ZDO A;  3MFI A;  1I51 B;  3HKZ D;  2OPR B;  4PAB A;  2HBY B;  4ZN1 A;  4I1T A;  2V4R A;  2RNE A;  3J7Z 5;  2FLN A;  4CH0 S;  1REG X;  5DG7 A;  3SI8 A;  5HBM B;  1JB0 C;  2BRK A;  4FZV A;  3DLG A;  1JLF A;  4USW A;  2ZH8 A;  2PGC A;  5KTQ A;  2HRT A;  1JXE A;  4ETZ A;  2Z0G A;  1RDR A;  1R8P A;  3QO9 A;  5DO2 A;  2OIH A;  1U1N A;  1LQ9 A;  4DOZ A;  1ZET A;  1V5I B;  4AL5 A;  3Q8U A;  3GFZ A;  5HL7 Q;  1NSK L;  1X4B A;  3MAQ A;  2XO6 A;  2SXL A;  5F9N A;  4ERD A;  2GVD A;  1Q79 A;  4AT1 B;  3KXD A;  4DV1 F;  3QBC A;  2W8L A;  2CQP A;  2VDI A;  1YBT A;  3T9N A;  4Y65 A;  1U0S A;  4ZIT A;  2VG6 B;  3FFI A;  5HVF A;  3TAR A;  3NOC A;  4FYV B;  4YDX A;  1HQE A;  1MNE A;  3C6U A;  2FLL A;  3SCL E;  4JI0 J;  3CDE A;  2WB4 A;  2Y0S D;  3IS9 A;  3MEE B;  2UUW A;  3CCT A;  4Q2L A;  3QID A;  4UZC A;  2LDY A;  3M1V A;  4FYD A;  2ZWO A;  1K73 T;  5CYQ B;  5HQL A;  1ULR A;  3PVX A;  4OJ3 A;  2Q3P A;  4X62 J;  2WSC C;  3ILL A;  2XYP B;  4F0K A;  5FII A;  1RAE B;  2B5J B;  3HSG A;  2HWT A;  1N48 A;  3AQP A;  1FRL A;  2D3O 1;  3B78 A;  1KHW A;  5H9E K;  3CED A;  4FS1 A;  1APS A;  2KDO A;  1F3F A;  2QT7 A;  4IFV A;  1IM4 A;  2NYI A;  2WW8 A;  3EZU A;  1TKD A;  2DNZ A;  3FEY B;  4LVN P;  1P6T A;  2HNY A;  2YNI A;  3FKB A;  4X64 F;  3D6F B;  3GIR A;  1S6U A;  4CM0 A;  4DN0 A;  1NKB A;  4MMO A;  4C8O A;  2QLF B;  3VAJ A;  1S1U A;  3GPA A;  4KO0 B;  5AJ3 F;  4BC9 A;  3UW1 A;  5JJB A;  2Z30 B;  5KOX A;  1FKO A;  5KG3 A;  2B8Q A;  4Z7C A;  2J7K A;  2VDH A;  3EVM A;  1WC3 A;  1E6V B;  2LQB A;  2UUT A;  1RIS A;  2DR9 A;  8ATC B;  4Y6I A;  4KC5 A;  1RT2 B;  5CAA A;  4C8L A;  4JV2 A;  4ZVT B;  5JXS A;  5T14 A;  3BEG B;  1VQL S;  2XB2 D;  4I7F A;  1B4S A;  4HAC A;  1SH0 A;  3ET6 A;  4F3O A;  2KM8 B;  4HVZ A;  2HAF A;  2VBW A;  1LWC B;  4G65 A;  4NLU A;  1S1T A;  1TTH B;  2WOM A;  5CZX A;  5IM0 B;  5EHH A;  3FSX A;  3DC2 A;  3C15 A;  5ETT A;  1XMQ F;  2IRX A;  3ZZU A;  4ED6 A;  4WTY A;  2XNQ A;  3RZA A;  4R8U A;  2U2F A;  3DRX A;  2P9E A;  3K8W A;  2BW2 A;  2VB6 A;  3VAI A;  4ZCL A;  1IKX B;  3J7Y U;  3R1L A;  4DUT A;  4N76 A;  3RR8 A;  5D15 A;  3UCU P;  4Q0B B;  3RGI A;  2WON A;  4V1A k;  2ZH6 A;  2FZG B;  1J5E J;  4OJG A;  4LIW A;  4IG3 B;  3BS9 A;  1FWL A;  3WDO A;  3RAQ A;  4OYW A;  2CQD A;  2L48 A;  2XMU A;  4PCQ A;  2DPJ A;  3E8O A;  3OLB A;  1P27 B;  1RAO A;  3A3P B;  3LOU A;  3O5T B;  5H9F K;  4JI1 J;  2BKO A;  2AV5 A;  4DV7 J;  1L3U A;  1FKA F;  2GIF A;  4OHX A;  1X8D A;  3ILJ A;  1S9G A;  3GFX A;  3ONQ A;  4DX6 A;  5HN0 A;  1VBY A;  4OI3 A;  1HNI A;  4I67 A;  3TW0 A;  3I0S A;  1KSP A;  1XR7 A;  2NSB A;  2IIH A;  1ROF A;  4ZHR A;  4L76 A;  1D9D A;  2RQC A;  3DNC A;  2DR7 A;  4XDD A;  2V8V A;  1WG5 A;  1J5O A;  1VK3 A;  2VG7 A;  1Y5N B;  2CUY A;  3J80 Y;  3BGU A;  2YNH B;  2DNR A;  4B3S F;  3I87 A;  1D8Y A;  1FKP A;  2EFN A;  2R7X A;  3W62 A;  5KT7 A;  1N5T A;  4ED2 A;  2Y8W A;  4JOU A;  2FZC B;  2HBQ B;  4DQQ A;  5G4D A;  1F9E B;  3UDL A;  2B6A B;  3ETO A;  1C1B A;  3IMQ J;  1RWX B;  3MAA A;  1OQ6 A;  3MOZ A;  1SC6 A;  3THV A;  1HHT P;  2HHS A;  3TNV A;  1NCL A;  1XN9 A;  3M9M B;  4PG6 A;  2AJ2 A;  3SCI E;  2BJ9 A;  1A9N B;  2VJV A;  1YIJ S;  1VQM S;  5DG9 A;  2OJ3 A;  4M8L A;  2W4P A;  2CAJ A;  2FVS A;  4H54 A;  3OFG A;  4WXO A;  4WE1 B;  2YKP A;  4PWU A;  4M5D A;  1TQL A;  5KFU A;  4OZ1 A;  2QA1 A;  2G0J A;  1B7Y B;  1N32 J;  4ECS A;  1NH7 A;  1YJR A;  1YLX A;  1B99 A;  1S10 A;  1U8S A;  2RDD A;  1RTJ B;  1VQ6 S;  3KLV A;  5GAH U;  2NQP A;  2AW0 A;  2XYG B;  2GGP A;  4A8Y A;  4U9R A;  5IC6 B;  1HI8 A;  2F4V F;  4JI8 F;  3D3C J;  3FSY A;  1QTM A;  2AYE A;  1T3N A;  3MM9 B;  3U1M A;  2B4P A;  2QEX S;  3IRW P;  3V4M A;  2R4F A;  3A1Y G;  1M1G A;  1S0M A;  1RTD A;  4LRC A;  5IT9 U;  1JLE B;  2VIC A;  1YRX A;  3A8I A;  3UFC X;  1VRQ C;  5KFI A;  1LNQ A;  1U0H A;  4CIO A;  1JXV A;  2BRL A;  2Z2Y B;  2DY9 A;  2XY6 A;  3D1O A;  4ZVR B;  1YJ9 S;  3V2U C;  1R0B G;  4HDG A;  5KFF A;  1H38 A;  2R7Q A;  2BJD A;  4DX7 A;  1TV6 B;  2DGX A;  1RT1 B;  2ERR A;  4EZ9 A;  1RBO B;  2NZ4 A;  3L7O A;  4C8Y A;  2QRR A;  4NOH A;  1CS4 A;  1XJW B;  1RB0 A;  4GO7 X;  3W8G A;  5C2G A;  2OD6 A;  2ASL A;  3PY8 A;  1SKW A;  4MTP A;  4LBH A;  4UOH A;  4GC6 A;  3GG1 A;  1U1O A;  3M8S A;  5F8M A;  4O3N A;  1VRU B;  1FEH A;  3CJ0 A;  4C2M A;  5K8P A;  4EBD A;  2QC3 A;  5HJX A;  4JI2 F;  5KG1 A;  5A8W B;  2CQH A;  4MK8 A;  4NXN F;  3NS7 B;  1YRU A;  2VFV A;  3QAU A;  2AMC B;  2KT3 A;  4CO1 A;  2N7Y A;  5HMW A;  1N0V C;  1T9T A;  2J6S A;  3TX8 A;  2BVZ A;  2IM2 A;  1RT3 B;  1V3R A;  3F41 A;  2VBZ A;  3HVT A;  4A8Q A;  2X1A A;  1HNV B;  2F8H A;  3FQK A;  1NM2 A;  4LRA A;  4LSL B;  2IYI A;  1NK4 A;  3T5H A;  1T9U A;  1HLW A;  1VQ8 S;  2H9Z A;  2H1Y A;  5IC4 B;  2J6U A;  5DGB A;  4PWD A;  4QPT A;  3K57 A;  3S7R A;  3K58 A;  3GYN A;  4RW8 A;  3QPI A;  1OO0 B;  2A6O A;  2LA6 A;  1WF2 A;  3FJ2 A;  1CSJ A;  2QFI A;  2CJX B;  3S1T A;  4RW6 A;  5ETK A;  4P72 A;  5G0R B;  1JXL A;  3H2V E;  5E7O B;  4Y2K A;  4G1Q A;  1OQ3 A;  3MMJ A;  2K2P A;  2MQP A;  1CG2 A;  2OEK A;  3UD3 P;  2HIY A;  2FTR A;  2XZD B;  2HBR B;  4MFB A;  5HAT A;  2P9G A;  2O3D A;  3UE2 A;  2BOA A;  3UI3 A;  3WQP A;  3SBM A;  3CNQ P;  4TLQ A;  4NWB A;  2PFD A;  3K5O A;  2HUR A;  1U25 A;  4WJB A;  2KFY A;  2CJQ A;  3OL7 A;  4DUZ J;  3C16 A;  4LQ9 A;  4K4S A;  1K47 A;  3PX0 A;  1S1V A;  1HFE L;  2AP6 A;  2DHH A;  3TAM B;  2QFJ A;  1X60 A;  4KGV B;  4XIU A;  1U2F A;  3TZW A;  4NCG A;  5D78 A;  2DR6 A;  2ZVS A;  3KNG A;  1WC0 A;  3Q2T C;  1RT7 B;  4YDD B;  1VHI A;  1RXO B;  1KLM B;  2R9L A;  2DNL A;  1VQO S;  3BO2 A;  1NZA A;  2VBY A;  5A8R A;  3NOG A;  5CYM A;  2N82 B;  2N3L A;  2OD4 A;  4EBC A;  4F4K A;  5HI7 A;  3MD1 A;  3UN2 A;  3GP9 A;  5KT3 A;  4DN9 A;  1X4C A;  2GQ2 A;  2YWK A;  1S59 A;  3GFY A;  2YKQ A;  1CJU B;  3HFK A;  4OYI A;  4QYZ J;  2G0C A;  2G9O A;  3OTO F;  2C2R A;  4USI A;  5HMY A;  2DGV A;  1WWH A;  3DM2 B;  5ETN A;  2ZH4 A;  2IC3 B;  1HHS A;  3G82 B;  4IFY A;  2PMZ D;  2HLU A;  1XMO F;  2CZ9 A;  4WKR A;  3CSK A;  3NY0 A;  1Y11 A;  4FPI A;  4LMZ A;  4DPX A;  3HHL C;  4CLW A;  1BQN A;  2Z2L A;  3OV7 A;  3CWJ A;  4LBP A;  2C2Z B;  4JUZ A;  2UUB J;  2YTC A;  1JIH A;  4C6A A;  1AT1 B;  2GHW A;  4RJV A;  1ZPW X;  2DJW A;  2HNZ A;  1AUD A;  2X7I A;  3A8J A;  2KG1 A;  5JMN A;  2IM3 A;  3R2C J;  3R7S B;  4P2M A;  3UDE A;  3CE8 A;  1C1C A;  2XMA A;  3EZO A;  4B9T A;  3K5P A;  1S1X A;  1FX2 A;  4A8O A;  4M5H A;  5AXN A;  3HJV A;  1KNZ A;  1NEE A;  2XTJ P;  3GIK A;  5A2Q U;  4F36 A;  5F41 A;  2OTL S;  5DQH A;  3TI0 A;  3MM7 A;  4NZ0 A;  2G0I A;  4KB7 A;  4RL1 A;  2BKP A;  2V63 A;  4QU6 A;  5K9F A;  2A3J A;  2XM3 A;  4OX8 A;  4ED8 A;  3M2R A;  3DLE B;  2ZVI A;  1TP7 A;  5DDR C;  4O44 B;  2EFP A;  3CJR A;  2HK3 A;  2RDJ A;  4J9P A;  1UVM A;  4ICL B;  1JNR B;  1PAE X;  1KC8 T;  1SL2 A;  1WI8 A;  3PJX A;  1S4E A;  3A3O B;  1RI7 A;  2DYA A;  3QGP A;  3M2V A;  3J7A N;  2QGF B;  2IBO A;  3OVB A;  3N6M A;  3ISZ A;  3M6X A;  3PYF A;  1FFG B;  4CT9 A;  5GMK a;  5ETR A;  2Z8Q A;  1JJH A;  4I6A A;  1K1S A;  1RLC L;  1HW9 A;  2MMY A;  5HP1 A;  1S57 A;  1UJ4 A;  3CCE S;  3MM6 B;  2UP1 A;  2DNN A;  3CPW R;  3ELH A;  2FPH X;  3KHH A;  2MGZ A;  3D6T B;  2MQQ A;  4EI2 A;  1RA7 A;  2FY8 A;  1QM9 A;  3FEX B;  4KQZ A;  3POT B;  3ISN C;  2CJK A;  1RLD A;  2OGU A;  2EG1 A;  2IVM A;  1ZYQ A;  1FD2 A;  3MFH A;  2NRE A;  4DL0 C;  4RKU C;  2MKK A;  3IXQ A;  2V50 A;  3QWP A;  5E3Q A;  4LFA J;  3QFH A;  1YK9 A;  1G6B A;  3LAN A;  4C8Z A;  2VPZ B;  2AHO B;  2LQ9 A;  2HFZ A;  2YQ3 A;  1E6Y B;  2IJN A;  2DEI A;  5IS2 A;  3NNC A;  1HBO A;  1HQU A;  3C19 A;  3UPF A;  5ETV A;  3PFE A;  4F04 B;  4CRJ A;  4DXL A;  4K8R A;  1SVD A;  3ULH A;  3I6P A;  7FD1 A;  4F2S A;  1WOO A;  1SL0 A;  2I5J A;  3CO9 A;  4R25 A;  1RP5 A;  3CMQ A;  3P6Y C;  1YKW A;  3F44 A;  3OHB A;  2APO A;  3M9N B;  5C7P A;  1RCX B;  3LP1 B;  1F9F A;  4DR5 F;  1YTY A;  3VV2 B;  1ZZF A;  2ZUG A;  4LF1 A;  5E0O A;  2ROP A;  3VAG A;  3W1Y C;  4PQU A;  1S77 D;  3MM8 B;  2IJR A;  3R7N B;  3MED A;  4ZPD A;  1FXR A;  3MEC A;  4LRB A;  2FHO B;  3PEJ A;  1GH8 A;  3W60 A;  2NR0 A;  4IG0 A;  5A8K B;  2FJV A;  1EHW A;  2LFV A;  3IGN A;  1QDU B;  2CYY A;  3VF0 B;  1SJQ A;  3NXZ A;  3DCA A;  1F5C A;  1TAU A;  4FXW A;  1N5Y A;  3VCD A;  3CJ4 A;  2ILZ A;  4WK3 A;  2KB2 A;  1DLO A;  2DEJ A;  2MKS A;  4DR4 J;  4W98 A;  4B9M A;  1YJN S;  1ZM9 A;  2H54 B;  2RE1 A;  4CCH A;  2CXE A;  3EM1 A;  2GV1 A;  3OL6 A;  4CYU A;  4CWB A;  4TY8 A;  4QW8 A;  1CJV A;  4WKY A;  2XLJ A;  1IJE B;  3QLH B;  1X5T A;  3VAF A;  1BWE A;  3DMJ B;  5KT6 A;  5KFX A;  3LAM A;  3JYT A;  4DQR A;  1Y4Z B;  4OZN A;  5DQG A;  3P4U B;  3RB4 A;  4UQG A;  3ITH B;  1F2G A;  3BDE A;  3KFW X;  2E5I A;  4AD6 A;  1B70 B;  3JSY A;  4ZP6 A;  2CKW A;  3CDU A;  3GCW P;  3VTI A;  1XMQ J;  1G3O A;  3Q8P B;  3WIV A;  5E3P A;  4HL9 A;  5ETQ A;  5AE2 A;  4G1I A;  4C4W A;  2O5D A;  5GAD I;  2GAG C;  2EC0 A;  1J2V A;  1Q7Y T;  1N5V A;  4B9S A;  4KFB A;  1HI0 P;  2GAH C;  2KN4 A;  1JK9 B;  3VVU A;  1PBA A;  3SSQ A;  3DDN A;  3SQO P;  4QR0 A;  4CLP A;  1KVI A;  1SJ1 A;  2W9A A;  4MJK A;  2LCW A;  2ZNZ A;  1RWO B;  1Q7L B;  3JSM A;  3CCM S;  3GCX P;  2JVO A;  3CD6 S;  2RU3 A;  4KPC A;  5I3U B;  2IM1 A;  3TZY A;  4EO6 A;  4C0O C;  1AA1 B;  3PX4 A;  3IN5 A;  5BR8 F;  4KKO B;  1T05 B;  2DHA A;  3MR5 A;  1O8B A;  4EK2 A;  1B7F A;  3ZXW A;  1UAW A;  5ETL A;  1NZ8 A;  3KLH A;  5DLG A;  4K4Z A;  3FZ2 A;  3LF0 A;  4CH1 A;  1FE4 A;  2DH8 A;  4ZIV A;  1IBM F;  4DX5 A;  5DQI A;  4BWJ A;  1H7X A;  1PYS B;  2EWH A;  4O4R A;  1TL5 A;  2FGC A;  1RU1 A;  5KFV A;  3BSO A;  5FJ4 A;  3UWT A;  1TK0 A;  1RAI B;  1XEZ A;  4OJH A;  2GVZ A;  1S9G B;  2IAJ B;  4CNY A;  4IH5 A;  5IFM A;  2QN6 B;  1X4F A;  1DQ9 A;  3FEZ A;  1TZ0 A;  3PCO B;  4C8M A;  2AX1 A;  3S8S A;  5GAG U;  5LSR A;  2CDQ A;  1XC9 A;  1JLC A;  1JX4 A;  1U48 A;  1RCO B;  3MR7 A;  2DGT A;  3HUL A;  2Y1L B;  1VJQ A;  4DR7 F;  1FJ7 A;  2QLW A;  3BN7 A;  3LPE A;  4ZPT R;  4FN5 A;  1CJT A;  2YWW A;  1T0T V;  3HO1 A;  1REV B;  1RWW B;  1MWQ A;  4EYH B;  1HNZ J;  1G2E A;  3PM9 A;  4AXJ A;  4OX6 A;  4W4M A;  1CVJ A;  4Y0F A;  3QIP B;  1ZAV A;  4P7T A;  1IXK A;  3DLJ A;  2FZK B;  2K1R B;  3JSB A;  1KBR A;  2YWF A;  1DJ0 A;  4DV0 F;  5BJR A;  5AXK A;  2E1A A;  5J2Q B;  4JI8 J;  4O0I A;  2DB1 A;  1EET A;  2AU0 A;  3PRD A;  4KHM A;  3GJQ B;  3A8K A;  2F9D A;  5IWA J;  3R1H A;  4M5D B;  3KK1 A;  1YGY A;  2QE5 A;  3L3C A;  3KUH A;  1NPK A;  4YHH J;  2QMW A;  2COL A;  4UOF A;  1MRO B;  3DRR A;  2F40 A;  2XYH B;  3MM5 A;  4I68 A;  2M8D B;  2P2C B;  3LH2 S;  3OTD A;  2WRM A;  3PO4 A;  3HK2 A;  3SDE B;  3UCG A;  1X31 C;  1F1B B;  5HVH A;  3TEG A;  4UZB A;  1IR1 A;  3B4D A;  1LW2 A;  1A6L A;  2V8D A;  2MKI A;  4XPE A;  2B56 A;  1JKH A;  3C14 B;  2R8H A;  3M30 B;  1VQS A;  1UEU A;  1SKS A;  3A4T A;  1R0A B;  2CQ3 A;  3ZZO A;  2YPZ A;  4DU8 A;  1U0H B;  2YKA A;  4RBT A;  1IKV B;  1AZS A;  2WVF A;  5AE3 A;  2JC1 A;  3D2W A;  2A1B A;  2D74 B;  3SFG A;  4F7V A;  2GJI A;  4DSF A;  2CVE A;  1F2H A;  3V4I A;  4JP8 A;  3CIZ A;  2KM8 C;  3N79 A;  4DWI A;  1F9H A;  3PDN A;  2A6M A;  3C46 A;  2X51 A;  4ZVF A;  2VOO A;  3MHY A;  4YY3 F;  1R8C A;  4KSE B;  2D9P A;  3G2X A;  1OY9 A;  2QLX A;  2E7W A;  1HHQ A;  4O4G B;  5CXT A;  5DZ7 A;  5HMZ A;  1SIW B;  5BXI A;  1ELO A;  3W63 A;  4ZPC A;  2KU7 A;  3HDS A;  4RUA A;  4YR3 A;  2E5L F;  2HFU A;  5L8R C;  4WFY A;  5L1J A;  4JI4 J;  3KK2 A;  1LWF A;  4JI6 F;  4KY3 A;  1HWL A;  3Q89 A;  2RF2 B;  3H40 A;  3CJQ A;  3FZB A;  1HNW F;  5KFS A;  2IDE A;  3JTO A;  3KLG B;  3HI9 A;  1WG4 A;  3SQG B;  5FDL A;  3BSC A;  1GXT A;  3M32 A;  3MEG A;  3KG1 A;  2YKN B;  3GV5 B;  1NBE B;  1DTT A;  3AA9 A;  3K5N A;  2R7U A;  2XSJ A;  3PJW A;  3OD2 A;  2OSQ A;  3EIC A;  3CCQ S;  4I64 A;  3RB6 A;  5IXU A;  4KRW A;  1FRX A;  1P9Y A;  5D77 A; 
#chains in the Genus database with same CATH homology
 3CO0 P;  2Z56 B;  3WHI A;  2Z30 B;  3VHQ A;  4K8R A;  3WIU A;  3T41 A;  4NE9 C;  3BGO P;  2Z2Z A;  2E1P A;  1SCJ B;  2W2P P;  2ZWP A;  4NMX A;  3GCX P;  4OV6 A;  3GCW P;  3H42 A;  2W2M P;  1R6V A;  3A3P B;  3VV2 B;  2QTW A;  2Z57 B;  1SPB P;  3WIV A;  4JP8 A;  2Z2Y B;  3QFH A;  2ZWO A;  3BPS P;  3AFG A;  2Z58 B;  3CNQ P;  3SQO P;  2XTJ P;  3P5B P;  2W2O P;  2W2N P;  4YN3 B;  3A3N B;  1ITP A;  1V5I B;  2W2Q P;  3A3O B;  2PMW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...