1V5IB

Crystal structure of serine protease inhibitor poia1 in complex with subtilisin bpn'
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
76
structure length
76
Chain Sequence
b'SAGKFIVIFKNDVSEDKIRETKDEVIAEGGTITNEYNMPGMKGFAGELTPQSLTKFQGLQGDLIDSIEEDHVAHAY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Subtilisin BPN'
publication title Crystal structure of serine protease inhibitor POIA1 in complex with subtilisin BPN'
rcsb
source organism Bacillus amyloliquefaciens
molecule tags Hydrolase/protein binding
total genus 22
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2003-11-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.80 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Peptidase S8 propeptide/proteinase inhibitor I9 1v5iB00
2ZWPA 4K8RA 3QFHA 4NMXA 3GCXP 3CNQP 2ZWOA 3T41A 3P5BP 3WHIA 2Z58B 2W2OP 3A3OB 3WIUA 2QTWA 3BPSP 2Z56B 2W2PP 3AFGA 4YN3B 1SPBP 3BGOP 2E1PA 2Z57B 3A3PB 1ITPA 2PMWA 3VV2B 2Z2YB 2W2MP 1V5IB 3WIVA 4JP8A 1R6VA 3SQOP 2Z30B 2W2QP 4OV6A 2Z2ZA 3VHQA 3H42A 2W2NP 3GCWP 3CO0P 4NE9C 2XTJP 1SCJB 3A3NB
chains in the Genus database with same CATH superfamily
4AD6A 4DV5J 5DETA 4BWJA 2CZ4A 3ZTSA 4ZVRB 2UUCJ 1SC3B 4X2BA 1Y9OA 4DSEA 2CPXA 2V9WA 3T41A 3EMTA 4ZS6A 3MEEB 3GQCA 4B9SA 1D8ZA 4HT7A 4DPXA 1RKJA 1CJUA 1RBOB 3ET6B 1N6QB 3QIDA 1FVSA 2L48A 5E41A 1WF2A 2ZH5A 3KUGA 4O44B 2CNNB 4LFCF 1HHQA 4GRSA 2DNQA 4I6AA 2HBQB 4UW2A 3JB9k 2H5IB 2V5HG 3VVTA 1VQ9S 3PTWA 5D6GA 3C6TB 3CCTA 1RWPB 1OPIA 2D9PA 2ZBPA 3DLGB 4LVOP 2RJZA 4C7QA 3G6XA 4F4ZA 2YWGA 4K5SA 1DBDA 1GTHA 3JTOA 3ILIA 4HI2A 2M9KA 2E9RX 4P72A 2A3JA 2DGWA 5AXMA 1WTFA 1RB0A 4KFBB 1DHMA 2EFQA 4MAKA 2UXDJ 4OI4A 2IA0A 3CVKA 3TQ1A 2V0NA 3ZNJ1 3SCJE 1X4BA 2J0SD 1UJ6A 5L46A 1C1BB 4RBVA 1JJCB 2PMZD 5AXLA 1HNZJ 1KR4A 4F4KA 2Q6BA 1SKSA 3MAAB 3HLUA 4L74A 4RW9B 4ITSA 3PR5B 2EK6A 4WFNQ 4MYUA 5E3PA 1Z4UA 3NGSA 2CYYA 3VVUA 4ED1A 2X7IA 4ZCMA 2OGUA 1S99A 4P73A 2MMYA 2BQ3A 2W24A 2DR8A 2WONB 1QY7A 3D2WA 1S6QB 3MMAB 4AUKA 1XMQJ 2W2QP 4ZP8A 3A8EA 2R7QA 5HQLA 5LXRA 2UV8G 4M5DA 2R2UA 1X4EA 4B3OB 1GXUA 1SVDA 4MFBB 4DUZF 2JL9A 1NB2A 3I87A 5DDPC 2B4PA 1NJYA 3BYRA 4ES2A 2UU9F 4PXEA 4JV5F 2JLEA 4TU8A 5KG3A 1EP4A 1S9EB 4QBUA 1YJRA 4PABA 1GAOA 3UR0A 4J9OA 1RAAB 4X62F 1RYSA 1FERA 3IO1A 1S0NA 3LF0A 1HNWJ 4CLFA 4BS2A 2MHEA 4DL6A 3H4BA 1FD2A 2XB2D 2CQHA 2RAQA 4GO7X 1Y11A 1IBCB 3NGDA 3HSZA 3JS9A 3MM5A 1WC1A 1EKSA 5BXIA 4M8LA 3EICA 4K59A 3K17A 2HNZA 1LFPA 5ETSA 3HSGA 2VOPA 4K4VA 2W7PA 3EPIA 5B0EA 2FJBB 3UD3P 2AYMA 4WU3A 2L08A 4I7FA 1VJWA 2BRKA 3GIJA 4GC6A 1RISA 3GMGA 1EX8A 2V67A 2JHEA 5KFPA 2DRDA 4ELUA 4U7UD 4OLOA 5L39A 4PWDB 4ANDA 3MM7B 5D0HA 2CJQA 3KYLA 2XYHB 4WPAA 4R25A 5J2NB 4DSKA 2HHHF 2HFSA 1FRIA 1HBMB 2V63A 1UW4A 4ZCKA 1EZZB 1RT7B 4YFUA 4DCPB 4OQJA 4B9NA 1HKAA 4J9UE 2W1BA 1S49A 2F8HA 2VIHA 1JLCA 2JVRA 5KFSA 2RRBA 2ZWOA 2BRLA 4EBDA 2HNYB 4E8UA 4TQSA 4WTOB 2ZH7A 1GFWB 2CPEA 5J1NA 2ZUGA 1I94F 4N41A 2HFUA 1HBNA 5KG7A 1M5HA 1UMJA 2OP5A 3KMSA 3MR3A 2BJ7A 3ICLA 1S1WB 2AT1B 1LNQA 1GNKA 1YKWA 2R7WA 1XMOJ 4N7TA 5RUBA 4MKBA 3OTOJ 4MTPA 1MROA 2CJXB 4DPWA 1NK8A 4YN3B 1IQTA 4FXDA 5DDRC 1TV6A 2XS5A 2AEFA 3W65A 1MWQA 3H90A 1NXIA 4AL7A 3T5HA 1FT8A 2VC1A 3L4BC 3HHEA 4LR9A 4F67A 3HVAA 4N8NA 3PIOQ 5KG6A 1JWWA 3DXBA 3DGVA 3CXCR 1CVJA 5A2QU 2GJFA 1Z2ZA 5AXKA 2O67A 2AGPA 1QTNB 5F8GA 3E01B 4IDKB 2OEJA 1UWBB 2BE7D 2OUGA 1F5AA 2E7WA 1L3SA 3TQEA 3BZQA 4QWAA 4NYPA 1NDLA 2B0GA 5AE1A 7AT1B 3CJ8A 2MKSA 2GMLA 2LFVA 2IVMA 2X1AA 1YSJA 2ZZMA 2AWZA 1WC3A 4NE9C 3HSJA 2NZCA 4ZN3A 4RL1A 2J5AA 2YH0A 3D0HE 1WOSA 2LEPA 3M6XA 2VICA 5KFVA 4CO2A 2VONA 1DURA 1F5CA 2C1EB 3HHDA 4G1PA 3AB4B 2M2BA 1NHUA 3NNHA 3CCZA 1N5YB 4F02A 3TYTA 4K4SA 5LL6d 4FBTA 5ETMA 1R0CB 4K0KJ 4NASA 1H0HB 1TQLA 4XPCA 4DX5A 3G4SS 1YLXA 5DZ6A 2M7SA 2DBBA 2JLGA 1XC9A 2H5JB 3QWPA 2CJKA 4AYBD 1N32J 1C0TA 3M2VA 2OPPA 4CO4A 3NNCA 4WFZA 4TVAB 2J0XA 3D6MB 1F3VA 2DKOB 4Z7CA 4NZ7A 2PO4A 5A8KB 3FCVA 3OR1A 2OO4A 3WIVA 2R7VA 3PIPQ 2UUAJ 1LWEA 2ZHAA 4J5OA 4JI2F 2HMIA 1C4AA 3QT7A 3LQVA 2P5VA 1YIJS 2NSCA 3MMBA 8RUCA 4DQQA 5HO4A 1YJWS 2CFXA 3B6BA 1RHRB 2FGCA 2RDDA 2F7VA 1HYSB 2EWHA 4Q0BB 4JV2A 5CH7B 3M2RA 3H7HB 1VQLS 3GJTB 1WG5A 3IS9A 2DNKA 5D0RA 4O3OA 2G2ZA 2PFDA 1JB0C 2AJ4A 4F2RA 3KNGA 3EX7B 5F3TA 4HEA9 4LFBJ 2J7WA 3AH6A 2ZJPQ 4CO1A 3A8IA 5LT5A 4M5GA 4CRJA 2WVEA 1GK8A 2K3IA 5K8PA 3OVBA 1N88A 3CJRA 5KTQA 1BGXT 3UDEA 4RU2A 2ZE2B 4N77A 1L3VA 4DR6F 1X60A 2EFGA 3R5DA 5LJ5Y 3IN5A 1SB6A 2MJNA 3R7BB 2IIHA 3ZZUA 3MR2A 3C8YA 1U02A 2OPRA 2ZOFA 1URNA 3H5YA 3TJAA 3D4JA 2JRSA 4ES1A 2W8LA 1PCAA 4EUVA 4I68A 1UW9A 4PPZA 2MEWA 2PMHA 4KBIA 3SFGA 3CCJS 2J8SA 4P52A 2ZUAA 4H4KA 1NPKA 2RHSB 2JDJA 2G2OA 3LGMA 3NKYA 1MW7A 3OL8A 4C8MA 2ZBRA 1B4SA 4EGLA 4DDFA 4ZHRB 3PHEA 1SJFA 2CQDA 3M8SA 1DY3A 1FEHA 1NKEA 5HP1A 3C66A 3N9UC 2U1AA 3DRSA 2QMXA 2RUGA 4XTTA 4V19J 1RSCA 3Q8PB 1WHXA 2UVVA 2HQIA 4PPDA 1XN9A 4EK2A 2H3EB 2AX1A 1T03B 1Y10A 2XYGB 1VRUA 3CO0P 3MCNA 2MY8A 1WORA 1PIEA 2GVDB 1N34J 3W9JA 2QYCA 4FDFA 4DU7A 3GLJA 3POTB 5GAEI 1ZM2A 6AT1B 5IM0A 4CTAA 4CI0B 4JOUA 2QZ8A 1H73A 1R0BG 1JLAA 5MLCV 3MGJA 3V6HA 4KHRA 2VFVA 1JLGA 2UVWA 1FFGB 4G1QB 2HHUA 2IRYA 1IBLJ 3L3CA 1ZOTA 5F8JA 2DNMA 1PAUB 4LIWA 1N4LA 3Q2TC 1KOHA 5KG0A 3KK2A 2KH9A 1YTYA 5DG8A 1RHKB 2B9EA 1CJKB 2IM1A 3IMQJ 2AJ0A 4P2SA 1EETB 2BQRA 4IH7A 1DTTA 1R31A 4U67Q 2WW8A 3KHRA 4WCEQ 2HZVA 3EUNA 1HL6A 3DM2B 1IN0A 3G82A 2VPWB 2C42A 2Z57B 2EI5A 4NLQA 3MCMA 2YNGB 3VCDA 5IC6B 3KHLA 1TR0A 1HBOA 4TLRA 2FVSA 4RR5A 4WZMA 3QJLA 3ITHB 2HSEB 1LW0A 4CNZA 1FVQA 3GG1A 2H65B 3CUNA 1U2CA 2V8PA 1JNZB 2E5HA 3PYDA 3W66A 2YWFA 2LKZA 2CDRB 3DLLQ 3D54A 4AFFA 3CD0A 2X51A 1YITS 4ELTA 3NXZA 4R0EA 3AOCA 4LQ3A 3P96A 1B0PA 2VG6B 1CS4A 1XERA 1NLKL 3M2VB 4M95A 2D9OA 2C3PA 1MU2A 4YY3J 3MMCA 4FNHA 3GE9A 3OL6A 2HW3A 2X3DA 2SXLA 3M30B 2YWHA 1FJ7A 3GJSB 1FWLA 2AGQA 4Q44A 7FDRA 1T9YA 5H1SV 3BDPA 2DY1A 1X9MA 4DCOB 1VR6A 1ITPA 2HHPA 5H9EJ 2XMVA 3HHLB 3HVWA 2MKKA 4ZVUB 1V3SA 3T1YJ 2RQCA 4DQPA 4DFKA 3Q8SB 1RUSA 1FTCA 2K7KA 2QA4S 2H1YA 2CADA 4Q2LA 3DRRA 2P6TA 4DUZJ 4JI3F 4FF2A 1HQEA 2KJVA 1LOUA 5C42B 3OLAA 4P74A 2UU9J 2J0QD 4JV5J 4RW6B 5HI7A 1TKZB 3ISNC 1VQPS 2C3OA 4DUYF 2Y1LB 4X62J 3EGVA 1L5UA 3QFWA 3EZUA 1I51B 3SBMA 5KT5A 4DF8A 1KQGB 3KLFA 5HMXA 1CC8A 2V9KA 2NXNA 1JK9B 5E3AA 5KFBA 1TL3B 4OYAA 2V4QA 3NG8A 2OELA 4LSNA 2AYGA 4MK9A 1NK5A 5IWAJ 3T1HJ 1R8BA 4CO3A 1CULA 1UVLA 3HVTA 2A2CA 5I3UA 1VC6A 2HRUA 2HQCA 5T7LA 1Q81T 1ZH5A 2IA6A 2GX8A 2ASDA 5AE3A 5DRKA 5KFQA 3FBCA 4PRFA 4URQU 4YEAA 1APSA 1YJVA 2WSFC 5CA5A 5BR8F 3L7PA 3PKYA 2CPJA 4F8RA 2DNYA 3BBBA 2WCXA 4PXCA 2DR6A 3UO0A 2NXUA 3DLEA 1JXVA 1PJ6A 2ZFHA 2B8QA 3FFIB 3NGKA 1N56A 5GMEA 2DNHA 3ZTOA 2P9GA 2GVZA 3RB6A 4B3TF 2W9CA 1QE1A 1CC7A 3PYGA 4H4OA 4C3MA 5HLFA 4LF7J 1N0VC 1NU4A 1HNXJ 3QMQA 2XY6A 2YH1A 1KLMA 2PN6A 3BREA 1ZM4A 4FF1A 2R7TA 3PJWA 1FESA 4YOEA 1U1NA 3FUYA 1HQ2A 1HPZB 1FHTA 1WHWA 3G8TA 1F9EB 3WX4A 3FQKA 2DK2A 4FNIA 1I94J 2YQ1A 4A8XA 5IT4A 2Y9HA 1DFDA 2B8PA 3RAXA 4QIWD 3TUIC 1SJ3P 1FCAA 1S6PB 3HFKA 2FHJA 3M9OB 2F63A 2BANA 3IP0A 1EARA 4HVZA 5KT3A 3QWUA 3MM8A 3BKFA 4V1Ak 3UD5A 1KN6A 1ZS6A 1QAIA 1TTHB 2R3VA 3UDVA 2HWIA 3MZIA 2JLFA 1HD1A 2ATLA 3OLBA 3TAPA 3VAKA 3FVYA 3ISND 1CSJA 4QJVA 1DARA 1VK8A 1C1CA 3RJMB 3DGPB 3W2VA 3LANA 3MR5A 4PCQA 1IKWA 2OSRA 1O5JA 5HATA 1NJIT 4DV0F 4OYIA 2EW9A 1KWMA 4N5SA 3J81Y 2V2VA 5GADU 3V6JA 2RS2A 1TMJA 2VG5A 4R8UA 2LEBA 2VUGA 1R8CA 3QGGA 1HBOB 4M5NA 1IM4A 3QSYB 4UY85 3HULA 3GPAA 1IR0A 1CQNA 1IKYA 1OO0B 4MMOA 1RHMB 3ZZYA 1FKPB 4L72B 3UCGA 4PYAA 1T9TA 4GKJF 2PEHA 1XNQF 1O6XA 1CJVA 2E5JA 2GGPB 3F41A 3WC2A 3BGUA 1S0MA 2ZD1A 1LWXA 3HX9A 4YB6A 3LA0A 2VFUA 2ZBQA 4LSLB 3ADAC 3IAM9 2J76E 3IC1A 1X4FA 4USUA 4U9RA 3QJJA 3MEDA 3ETOA 4K4YA 1JLEB 5KFLA 2VF3A 3EVWA 3NCRA 2D69A 3K89A 2IHR1 2WVBA 3PHTA 2ILYA 4QIVA 1RTZA 3SYZA 4ZLLA 3DNCA 2JEIA 2CQ1A 1MWZA 2IM0A 1YRUA 2EG2A 4ZPBA 2EFOA 3AJ2A 4KGXB 1S48A 2NUHA 3TZWA 3K5NA 2RRNA 1HR0F 2LMIA 3W1YC 5DZ7A 2IC3A 3V2UC 4ZJOA 4PQUB 3VQTA 4C8LA 2DNRA 4PUOB 3GIMA 4QWBA 3ZTQA 1R43A 3KK3B 4LBHA 2VODA 2RUSA 3H2VE 4WFAQ 1OJ4A 1Q86T 3G2XA 5DQGA 2DNZA 2KZMA 4WK1A 5HL7Q 3LPYA 3LP2A 4MH8A 2E1CA 4QYZK 2PD1A 2E7XA 5EWEA 4NLGA 3MUMP 3FCHA 3QZ7A 2V68A 4AL5A 2E1PA 1AT1B 3G86A 3ENAA 3MXHP 5IQ6A 4ED6A 3NNAA 2J6SA 2Z4PA 3ZZOA 5AXNA 3OUYA 4HH1A 2A6OA 2A1BA 3BH7B 1IR2A 2VBXA 3TJ9A 4DR6J 1XK8A 1FRXA 1DTQB 4Y2AA 4ED5A 4G65A 3KLIB 4LRFA 1IKXA 3AD8C 2R4FA 4MKYA 5LMUF 5I3UB 5IT9U 4KH1B 2DVIA 5FJ4A 4RUAA 4DV2F 2RF2B 4DV3F 4X4VA 1J5OB 1S1UA 1SUQA 1X5TA 4O4GB 3R5AA 4ED3A 5HQMA 3KUHA 5IXUA 1LV5A 1ZTWA 1Q95G 1S6OA 3PEHA 4WIQA 4WTYA 3C6UB 2CPZA 1KONA 3MD1A 1XR5A 1G4CA 2H9ZA 1K8AT 5HBMB 3SFUA 4ED0A 3PRDA 2EBEA 2N7YA 3OVAA 2QN6B 3KLHA 4YDDB 3HKZD 4KH0B 3BBFA 1Q78A 2HS3A 4NZ0A 3RZAA 1VJQA 3ELHA 5EX0A 2BXJA 1JJHA 2NYHA 2PE8A 2NPIA 4L3NA 3NL0A 2ZHOA 3NWGA 5LSRA 4FYYB 2IDLA 4WJBA 3Q24A 1QVFR 3D5MA 4X4SA 2QLFB 1S1TA 3NS5A 3JYTB 1N5TA 2YTCA 4F25A 1RBLA 2LQ5A 3K8WA 4OHXA 2ILZA 4OZJA 2HHQA 4E2FB 1RT1B 4DR4F 4ILMA 3ILJA 5JMNA 3GILA 5GVQA 2RQKA 4WWSA 1Q5YA 1Y4ZB 2DT9A 1RWNB 3W2WA 3TA0A 2DPIA 1R0AB 3E2EA 1VQ7S 3UNGC 4ZJQA 1UA0A 3LUYA 3IR7B 3QT5A 1YJUA 1F5BA 4OYPA 1VS3A 2CPFA 4B9MA 4Q8FA 3GFZA 2RU3A 1VQ6S 3V4IA 4R5PB 2F4VF 4ECWA 3MUTP 4OI2A 2O01C 4TYBA 4CLWA 4TQRA 3N5BA 4P6QA 1H72C 3AFGA 1H98A 1WNEA 5D78A 4ZP9A 3M9MB 1V3ZA 2YWKA 4AXIA 1HBUA 2F40A 2IYGA 2IYIA 2DH7A 5J2PA 1PYOB 2IM2A 3MPWA 2I2YA 3IR5B 2RQ4A 4KPYA 2G0CA 3WZ0A 3SI8A 3QRPA 2HEKA 3T9ZA 4HI1A 4NI2A 1EQMA 5DLGA 1KNZA 4HYKA 5C2CA 1RKIA 1SV5B 5KG4A 2Y1JA 4FS2A 1N5SA 1PSDA 3L95X 2MSTA 1YI2S 2DIUA 3TA1A 4NRUA 4R0JA 1HI1A 3ENWA 1P9YA 2BOAA 1YRTA 3RBDA 2HIYA 4GVBA 2HNDA 1U2FA 3RAMA 1R8AA 1VGYA 2AZ3A 2V6AA 3P5TL 5C2GA 2IBKA 3JSYA 1RT6B 4A46A 2WSCC 3UCUP 1HMVB 2BMBA 3EPGA 4KGKA 3ZTPA 1S1VA 3TVZA 3PO4A 2CJYB 1CBKA 2RSQA 2Y8WA 3PO5A 4C8NA 5C25A 1NK0A 4OJ3A 1REGX 3UN5A 3IA0A 1H74A 2GQCA 1Y00A 1N33F 3KJQB 5THWA 2R2TA 1BE4A 2K2PA 3OV7A 3HVRA 3QGPA 3SQOP 2Z30B 1WF0A 3QLHB 4ECSA 4WP3A 2VG7A 4AQYF 1XNRF 3HHLC 3VAGA 2AMCB 3MM6A 4KV8B 3T5KA 3QRQA 4PXBA 2R8IA 2WOMA 4LRAA 4RW8A 4OI3A 5CYMB 4EYIB 3OXGA 2LLZA 1DJ0A 3PW4A 1F60B 1YBUA 2CQ3A 2HQFA 1OIAA 3IAS9 2VPXB 4OX6A 3M32A 3W8GA 3VTIA 5EWGA 3HFVA 1JLQA 2ADCA 4DUYJ 3FNNA 4ED4A 4TY8B 4F26A 2HLTA 4U7UK 4DSIA 3HFZB 3RUBL 3AJDA 1NDKA 2HQ3A 2QGFB 2LCWA 5K9FA 4ID5B 1HWLA 1SJ4P 1VOMA 2DIVA 2JNJA 3BGLA 5LJ3Y 2ZC3A 1ZZFA 4I2PA 3R3TA 4L3KA 1FJGJ 3TZYA 4KTQA 4OI0A 2XQCA 3IWLA 3D1HA 4AT1B 4OLPA 1TL1A 1H6KX 5ETRA 1A7GE 2GNKA 2I0XA 4H4KC 4MT1A 1QSSA 2Q43A 5BR8J 4Z7YA 2W2NP 1I1GA 1Y3KA 2NYIA 3OSNA 4NX9A 3K8VA 4ZIWA 3SV3A 1E6VB 4XDCA 1RYRA 4DXLA 2FC8A 2M5YA 3K5MA 3CDUA 3OTEA 4UY8T 2Y0SD 1RTDB 2K1RA 1MMDA 2D3OR 3HD2A 2KL8A 3W3SA 2YNFA 4EBEA 2NSBA 3IRXB 4DHVA 4CLLA 5K8NA 3CDAA 1UWAA 2Z58B 3RB0A 4S0MA 4A8KA 4XPEA 5F8NA 3RTVA 3FGVA 3OFEA 1MMLA 5CYQB 1U2RA 2XMAA 3RBEA 2FPHX 3HHLD 1RAGB 1RT3B 1RT5A 1VFJA 2HS0A 2CQCA 3QGIA 2IAJB 3DDKA 4QIEA 2N4DA 3DCAA 3QO9A 2R2RA 2R2SA 2PA8D 5E3RA 3KKFA 4ZVQB 1BQNA 5DJBA 4ID8A 2BKNA 1JMTA 2DJWA 2KYXA 2VKRA 3MTJA 3PW2A 3I4HX 4HKQA 3NAHA 1AB8A 2AJFE 3JSMA 2DHXA 2AD9A 1Q16B 4JI4F 2V2QA 2Q3PA 3FZ2A 1EAYC 2FYXA 3V4IB 4QCLA 2XSFA 2OAUA 3DU6A 3Q8QB 4HLBA 1PAEX 3VF0B 4EWTA 4GC7A 1Y5LB 4QWDA 2NQPA 4K4UA 4PEOA 5A8WA 4MJKA 2X1FA 2CVIA 3W5YA 3SSQA 3D6HB 1TKDA 2JC0A 3S1TA 2VQFJ 3GR1A 3MPDA 4CLKA 1OMSA 1JLBA 4IR1A 1VQSA 3MURP 4RUBA 4KGZB 3PFEA 3O5TB 1RXOB 2AEJA 1G2EA 1FJEB 1TFYA 1XNQJ 3M8ZA 4EYHB 2HGMA 3W8PA 4NLPA 1BQMA 1C0UA 4F4WA 3ONQA 5B0FA 4RNFA 4ZPTR 2CKWA 5A2QY 4K4ZA 2QLBB 1T05B 1NHKL 2HNDB 2GIRA 4OZ3A 1U09A 2FZCB 1RP5A 3BO2A 1WDDA 1BUXA 2QA4G 2DGQA 2DR9A 4PWWA 4IQMA 3BSNA 5ETKA 1ROFA 3A1YG 2AIRB 3QJPA 4ZVPB 2WRMA 3TARA 5F41A 3KJVA 3CCLS 1WELA 4KIAA 4DV4F 2MKYA 4JI8J 3PACA 3MOJB 2OSQA 1NZ8A 2J7KA 1YG0A 3KLEA 2HBZB 2P9CA 1QM9A 2Y0BB 2AYBA 1K44A 1R8HA 4CT8A 4H4MB 4EEYA 3C15B 1R7IA 4KKOA 4NEZA 3OL9A 2YNIB 1HW9A 5BYSA 2BJDA 5SZTA 4NRTA 4DPUA 2D41A 3CSKA 2B6AB 3S7RA 1TL7A 3V6KA 1WI6A 3B4MA 1OPZA 4XO0A 4A8MP 4DQIA 3DYAB 1LWFB 1U45A 4FZVA 3EVOA 4U95A 3CO9A 3IG1A 3PG9A 1N36J 3Q86A 3OSPA 4CZCA 3DHWC 3QNWB 4DN9A 4HH0A 2MSSA 3DOMB 4HHJA 2OPQB 2PEBA 3OPKA 3T3FA 3LTOA 4NXNF 1WEYA 5CABA 1VQ8S 3K5OA 2I5JB 4JI1J 2MDAA 2DB1A 1RAJA 2RB7A 4NA3A 3R5BA 2FC9A 4DL4A 3PX0A 3FKBA 2DCLA 1K1SA 4UUWA 1TL4A 3H20A 5LMUJ 1XBWA 4B9UA 4CNYA 2BEFA 2ZITA 2PA3A 1NCLA 3WC0A 1UEVA 1RA6A 3MEEA 5ETTA 4HDHA 4DV2J 1G7CB 3OW2R 1N6QA 4IFVB 1VHFA 4DV3J 3LOUA 2B5JB 4B9LA 1NH8A 3B8HA 1ZAVA 1SIWB 6FD1A 2WK4A 4DPYA 4O44A 4IR9A 4A47A 2VZ9A 3RAQA 3B4DA 4V19X 4OYXA 2GW8A 5CZXA 4F7VA 4ZMMA 2QTWA 3O1LA 2YY3A 2QIFA 1SC1B 4C0BA 4KHMA 4OYOA 3AXKA 2JEJA 3C6TA 3ZFVA 1NB7A 3U1MA 4I64A 5K8MA 4KR0B 5DGAA 4CH7A 3DLGA 5HAOA 2QA1A 3H8YA 1IBMF 1ZA2B 2V2ZA 1LWCB 2R8KA 1X5PA 2ZZTA 3IRWP 3HJVA 4ZCLA 1DQ9A 2LA6A 5J1EB 3RYLA 1SBRA 2E66A 1RTIB 4KFBA 1YDLA 4CLZA 1TP7A 4RZRA 3IGVA 2ZHBA 2J9CA 1S4EA 2D7SA 4OYBA 4ZP6A 2W8KA 2RT3A 2CQPA 3M05A 3OQ2A 3DI6B 1SKUB 5KOXA 4ZPAA 2D3ZA 4B02A 2UVRA 1C1BA 2IJRA 4Y00A 4DR4J 2C2EA 3MAAA 2R7UA 1PILA 2XGPA 4RW9A 2H5EA 5FLXU 1FTRA 1RHJB 2DH8A 4LF6F 1WUUA 1RACB 4IRCA 2X1BA 4NXMF 1ZPWX 2QJ3A 2WONA 3DOKB 1M0SA 3MMAA 5L8RC 2EKNA 1HQUB 4EO6A 2VBZA 1Q8KA 2ZH1A 4L73A 3ETMA 3J7AN 3D6FB 2FY8A 2E9ZA 3IXQA 4B3OA 2DO4A 4MFBA 2RH3A 2IM3A 2J9EA 2W7AA 4Y2KA 3KHGA 4QWEA 1PO6A 3LP0B 4ZITA 3R2CJ 4QIFA 3G9CA 1NDCA 2ASJA 4OV6A 5I3PA 2R7SA 3CDBA 3HMJG 3N5FA 1A6LA 4M5HA 1NHVA 2W4PA 1H38A 3JQJA 2HHSA 4GKKF 1U4BA 2W2MP 1UTAA 3Q89A 2GIFA 1VHIA 5GAGU 2MYFA 2GA7A 3V6DB 4CP5A 2FD2A 3BO4A 3A3NB 3CCSS 3V5RA 4DL7A 4B9TA 4DN0A 4ICLB 4IRDA 3Q8YA 2BOPA 1K0VA 3UI3A 4U6PA 3DLKB 4MKAA 4IG3B 2X3GA 3D6TB 4RNMA 3L7UA 2OMLA 1W7WA 4EMDA 2PFFB 3EM1A 2B56A 4FYVB 4DS5A 4IH6A 2B9YA 5KFCA 3CJTA 5LSLA 4PWDA 3MM7A 3AT1B 1N8RT 3FSIA 1K0TA 1UAWA 3BGFA 4DSLA 1KSPA 2DYAA 5J2NA 5B0BA 2NR0A 1N33J 1HBMA 1BWVA 4NPOA 1RT7A 1TK8A 4I1TA 2FHJD 1NK9A 4AQYJ 1XNRJ 2KXNB 4RBTA 2UXBF 2UXCF 1BXNA 2VU5A 4D3HA 3MDFA 3GYGA 5H9FK 3T9NA 4DPTA 3TW0A 4NLWA 3TOQA 3JSBA 4USTA 2HNYA 2GFFA 1LXNA 4ATNA 1JKHB 2JZ5A 3MR7A 4OX7A 3Q8RB 4KQZA 3LP1B 1D9FA 2AJQA 1K9MT 1S1WA 1Y3JA 3KHHA 2I38A 4RW4B 5EHHA 3FMBA 1IKVB 4I2QA 2DNPA 1KS2A 4X4RA 2M3DA 1HIYA 4DR5F 1U1RA 2KKHA 4IG0B 1S6UA 3M8WA 4MIBA 1H7WA 3AODA 5DM6Q 2VHGA 4ZIVA 1GH8A 1OSDA 2OH2A 1AXQA 1VBZA 2OFGX 4RWWA 5LSOA 1ZTTA 1S4FA 3SZ2A 2XWXA 3J80U 1QAJA 2J8AA 3ILOA 4WK3A 4M5MA 2UUTA 1NSKL 2GAHC 3R7SB 3CGIA 2I9SA 2YKNA 3FSYA 2VJUA 2W01A 1RTHB 3TO8A 1U1KA 5HMWA 4OI6A 4ZPWR 4ZLJA 3E01A 2RVJA 4IDKA 1KLNA 3M8QB 2CXEA 1UWBA 4C4WA 3CCMS 9RUBA 4DEZA 5CD4A 2BJEA 4O3NA 4DR2J 4QW9A 2WVCA 3SQGB 4LT6A 5IOLA 4QW8A 4NYOA 4DBQA 3ENQA 5U47A 2OTLS 3FMWA 3O8WA 1VQMS 2C3YA 2PMWA 5EN1A 4J90A 2ABYA 2BZ2A 1FDBA 1BLUA 3S6EA 3FQLA 2ZWPA 3BB5A 2HKEA 1GEHA 4LVNP 3AQOA 1REVB 1QVGR 2BR0A 4C48A 4X66J 1N5YA 3C16B 2HFVA 2ZH2A 3D3CJ 2D74B 2BBEA 3QFHA 3UWTA 3BSCA 4HACB 2R42A 2B43A 2EFNA 2VDHA 5KFDA 2JC1A 2OLWA 2DEIA 1U1PA 2BJ3A 3I82A 4AXJA 2MGZB 1D1UA 5K8OA 2PSZA 3GV7B 1V5VA 1OY6A 1X4DA 2AZ1A 3SCIE 5FDLB 4YR0A 1F2HA 3BBCA 3JXOA 1VK3A 5A8KA 3NBPB 2UUWA 2BACA 3DRPA 2WB4A 3MMJA 1FRHA 3G87A 3D68A 4M63A 2PI4A 5KFGA 3CJ0A 3P5BP 2PI5A 5F0WA 4ENOA 2XLKA 2J9DE 2CQ2A 1HI8A 1YJNS 5JVGQ 4DX6A 1HYSA 4Q0BA 1WSVA 2OTJS 1FXDA 2MQMA 3I0RB 2YWEA 2N7CA 1U8SA 3SCLE 2AQ4A 4DR1J 4W4MA 2KU7A 2OFHX 2KO1A 2F9JA 2XNQA 3BEGB 2GHPA 1RWUA 1NSPA 1U0HB 4I0WA 2H4WB 5A8RB 3DHXA 3F44A 1N48A 1RU2A 1CPZA 4UT4A 4F3OA 2EK1A 3CPWR 4Y2CA 1I3OB 4DV5F 2ZE2A 3MAHA 2COLA 4FVMA 4K7QA 3TX0A 3KLGB 1X8DA 1ZAWA 4PXDA 5HJYA 1NK6A 2G13A 3SDEB 4UOGA 3OFFA 3JAMY 2RKIA 1NKCA 4FPIA 3CC2S 1GMVA 3HKWA 4BC9A 2R8GA 3R5GA 2IVFB 3SV4A 3KDNA 2BM0A 1ZYQA 4UF4A 4ZKAA 1RU1A 1E6YB 1FFWB 2MQLA 2VH7A 5JJBA 3N0VA 3GWCA 2IJNA 3M9NB 3VAIA 3M8PB 1T11A 4ZHRA 1X0PA 1KD1T 3FEYB 2DISA 4NLSA 1T9WA 4NCBA 1PJ5A 3BKTA 1FJCA 2ASLA 3R5JB 4UUXA 1XR6A 5HVGA 4FYDA 4ED2A 4WFXA 1IJFB 3H2UB 2FVRA 1BD6A 3N6MA 3CMAS 2FLPA 1T02A 1T03A 3W62A 2RDIA 2V8DA 3LH2S 2UXDF 1UCNA 5E33A 2Y8YA 2XWYA 1S5ZA 2GVDA 2E1MC 3POTA 5BYQA 1UZHA 4JYAF 1AROP 5HN0A 2CIMA 3TANA 2DGXA 5L38A 1HNZF 5KFFA 3Q2SC 3KNAA 4I2QB 1XIQA 4OYWA 1J27A 4C98A 3W9HA 4G1QA 5JVHQ 4NXNJ 4NLDA 4QZVB 1UKUA 5IFMA 2WZ1A 3QBCA 1FRMA 1NNDA 4X4QA 3TA2A 2DRBA 3U1NA 4WZQA 4HTIA 3A12A 4ZPDA 5KFMA 1CJKA 4KRWA 4UZCA 1X4AA 1EETA 5DQHA 2Y1IA 2XCAA 3FEZA 3NWRA 3ZZZA 1X7VA 5E7OB 3J7A1 1CQMA 2RE1A 2G2YA 5KT6A 4DR3F 1RTJB 2EVZA 3ISZA 2CRLA 2YKNB 3DM2A 4I6YA 2N82B 3R27A 5D4PA 3N6NA 4DG1B 2JFDA 1HD0A 1DZ5A 2YNGA 1Y5NB 3RG6A 2UP1A 2M8HA 2P9EA 3VGTA 3WBZA 1TKTB 3ITHA 5D77A 2XNRA 1X4GA 2X1GA 8AT1B 4OV1A 1TUWA 4BC7A 4JI7F 2M8DB 2FJEB 4CLYA 5IQQA 2YKAA 3CJQA 1FK9B 4F4AA 3KG1A 1RT4B 1IBMJ 1TZ0A 2MJUA 2QL9B 5E0OA 4UQTA 2NXEA 3LALA 2OEMA 3T6BA 2Q66A 3PVXA 2JH3A 3ZZPA 3ULHA 3A3OB 3CJ5A 4YB1P 3HP6A 3E51A 1QTMA 2VG6A 2GQ2A 3MPVA 3MWBA 2AGOA 3QQCD 3EDRB 2E9TA 1FKOB 5HVFA 3DU5A 1JQGA 1TAQA 4J9NA 2F4FA 3UVJA 2FJAB 2YQ3A 1Q8BA 4LF6J 3M30A 5C24B 2L9WA 3NS6A 3DRPB 1VI7A 4USVA 4C11B 1KHVA 2KHCA 4NXMJ 4UOFA 2WW4A 1F3FA 3ZC4A 3HHLA 2WAQD 4Y2MA 3J7YU 5I4MA 1NPPA 5BYRA 4NLRA 2ZBIA 4Z37A 1VC0A 2ERRA 4DV1F 4GVLA 1Q7LB 2EBGA 5T41A 2E5LF 1CJTB 4Q5VA 3AY0A 5CYJA 1SH0A 3E3XA 3OTBA 2CZVC 4F0HA 5C42A 1S0OA 3OBIA 2XS7A 4RW6A 4LQ9A 2HG4A 2QL5B 1TKZA 3MI7X 1CG2A 3MD3A 4RKUC 1FKAF 2AU0A 3PFOA 4XAKA 2POKA 1HWIA 1XMOF 1H3DA 5K5MA 2B7CB 1YK9A 2U2FA 2KFYA 3UQSA 4ELVA 1TL3A 2JSXA 4DSFA 2GCFA 4X65J 5KFHA 3CDWA 2RILA 4LF9F 4FVCA 2RIJA 1YJTA 4MK8A 4DSJA 3GYNA 4XIUA 2CWXA 1AZSB 2RKIB 3I4PA 1RE1B 2O3DA 2MQOA 2C2NA 3PXGa 3NCQA 4MK7A 3KJFB 2VFSA 3M4XA 3JTPA 1RCXB 3W61A 3M1VA 4RNHA 4LF5F 4WKRA 1EKRA 4DV7J 2QLXA 2HPUA 1WF1A 1UEUA 2OPSA 1SH2A 5JXSA 1FXLA 5DG9A 1FRJA 1RLDA 3FFIA 2B4OA 1LQ9A 4YMEA 4DMZA 4X4OA 1BHNA 2ADBA 4C9DA 3PYEA 5D0GA 1BQXA 2ZOMA 5D0EA 3MECB 2FVQA 5F9NA 3OVSA 1WEZA 2N3LA 5EX3A 4P10A 3HT3A 3IBFB 4ZVOB 1MWYA 1HNVB 1HPZA 4Q2MA 4FN5A 4KO0A 5HROB 4J9MA 1NMEB 4K0KF 1W25A 3T5JA 3VZHA 5EWFA 2XSJB 4QYRA 3KG0A 1S6PA 4MIAA 2Z2YB 1VQKS 4PAAA 2N3OA 3OXLA 1B99A 3D67A 4DI6A 2FQQB 3G6VA 3OHAA 3CB4A 3BYPA 1XTZA 2K3KA 3PM9A 3FDSA 1T8EA 3KXDA 2BJ1A 2Z56B 2K8GA 1F0XA 4M5LA 2UUAF 4YB5A 1JIHA 1VIXA 3GG0A 3SIPB 3VGUA 4RW7B 1FNXH 3TR5A 1IVZA 4LSZB 3DGPA 3GU0A 3R5CA 1X9SA 4LRBA 4Y6IA 1WD6A 3A4TA 1S97A 2VPZB 4JUZA 1WHYA 4XK8C 1IR1A 3CJKB 3CE8A 4QOTA 5B7WA 1U49A 2DGUA 2P8IA 1YHQS 1RZMA 2HIQA 2V34A 4LF8F 4A4JA 4LFCJ 2R7OA 2HHWA 3MAQA 1Q0NA 1PBAA 2HGLA 5KFXA 1QUPA 4YR3A 4KGVB 4IFYB 5IV3A 4JI6F 4NMLA 3S01A 4ETXA 2FVCA 3CMQA 2M4MA 4YDXA 5GAEU 3DDNA 3EZOA 2LXFA 1NJXA 4K2JA 1TKXB 2CG8A 2ROEA 2WBRA 3GSIA 1FKPA 2C2MB 1YGYA 4OHVA 2W9BB 4KPCA 5F3ZA 2IRUA 3RRHA 1CLFA 1RQ0A 5A76A 3PJ9A 4OMFG 3T6JA 2GGPA 3TEGA 1HNIB 3QIPB 5A6PA 2UZAA 1VIOA 2V2KA 3DC2A 1WHVA 4YQWA 2I1RA 1NAQA 2EC2A 4LSLA 2RHQB 1PC4A 1T7PA 2MKCA 4P2XA 4USMA 2VQEF 2XMJA 3VGVA 2AX0A 1U6BA 3W5XA 4CWBA 3IBCB 1KTVA 1JLEA 4NMXA 1L3KA 4Y34A 3UVJB 4DV6F 4DCJB 1X0FA 4HTJA 2V8GA 2BV3A 3UDLA 4H54A 5KFRA 4DL0C 1HHTP 2MZQA 2KHDA 3BJYA 2H54B 1RHQB 3VHQA 4X4NA 4FXVA 1DLOB 4PQUA 1ZPVA 2Q79A 2AJ2A 2GIQA 4ECUA 4PUOA 5M2RA 2XMKA 1I5OB 2C2RA 1KRPA 3KK3A 3RW7A 1X5SA 1LW2B 2ALYB 5DO2A 4L6V3 1R89A 2DR7A 2CJBA 2BE2B 2GO9A 4QYZJ 1S76D 2JVOA 4PG7A 3EZ5A 1J2VA 3PDNA 3WX8A 3W63A 3H5SA 2M0GB 1I6JA 5CD4H 2YNHB 3EGZA 3CD7A 4LRCA 1IBLF 4ECZA 2CNOB 5F8MA 3GB0A 4ZPCA 4DUTA 4DOZA 1VLOA 1DTQA 2FLOA 1UJ4A 5D3GB 5IV4A 3KLIA 1M5PC 4X4TA 1S9GB 4C3LA 3J81j 4K8RA 5J2QB 4OZ2A 4A8SA 5JUMA 4JBCA 1OYDA 2WB1D 4ANEA 1S10A 3OTCA 3MM9B 3CCVS 5SUHA 4RU9A 2HVEA 1ACMB 4LF1A 2RF2A 4CIOA 3NGUA 2KG0A 5D4OA 1J5OA 2AJ1A 2RQMA 3QSIA 4JV1A 3M1VB 2BABA 2E5IA 4O4GA 2HQGA 3BGRA 2OPSB 5F8IA 4J9PA 3PJXA 3TJ8A 1TVRA 3RBXA 2XO7A 2DRAA 4WFBQ 2J0WA 4URSA 2MQPA 1JLFB 2HHHJ 1PYTA 3C6UA 1S0VA 4U96A 1MG7A 4KJIA 1SPBP 5HBMA 3DFEA 5AE2A 3TVKA 3I0SB 5DM7Q 9ATCB 4ZOSA 2B3TB 4FP9A 1U26A 4KYZA 1M1HA 5IZHA 1BC6A 3TAMA 1NM2A 4B9VA 2MZTA 2F8MA 4WU2A 2KM8B 3IWXA 4KO0B 1Q53A 3T19A 1LXJA 3C14A 1ZM9A 4J91A 2XCPA 4ES3A 3K58A 3DN9A 2C2KB 3PEJA 4FPRA 1AFIA 4C8OA 1KOOA 4WE1B 2MLYA 4K2XA 4Q7AA 2XHCA 5ETNA 3JYTA 1FE4A 2N4CA 4JYAJ 4RPFA 1FRKA 3TRGA 4A48A 2M70A 2YVSA 2YX7A 3FBBA 4YY3F 1RT1A 4ZA1A 4IKAA 3ZXWA 4OJ1A 2DHHA 4RLEA 3F0NA 4KGMA 1R0AA 1TL5A 3OFHA 1MN7A 2GHVC 2F65A 1AW0A 4LMZA 2WSEC 5B09A 2KI2A 1B0TA 2VC0A 1D8YA 3T1YF 3HM9A 1F1BB 2BJ9A 2DGOA 2QE5A 4KHPF 4R5PA 1SJ1A 3FC9A 2ZJRQ 2VFTA 1S79A 3O6QA 2HBYB 3AJ1A 3EVMA 5KFZA 4DR3J 3DMJB 2EC0A 4IO9Q 4F0KA 3HHNB 4NZ6A 4CT9A 1S1XB 5KG2A 3H59A 4K4TA 3FJ2A 5LOQA 3R6GB 1EHWA 5KFKA 3TP2A 2CA9A 5J2MB 1SL0A 1VBYA 3WDOA 2E29A 2Q6CA 1B70B 3BPDA 1JNRB 4JI7J 4A8WA 4C2MA 1MSWD 4DX7A 1SV5A 2ZH8A 3HO1A 1WOOA 1K47A 1UZDA 4N76A 3FK4A 3BN4A 1GX5A 1M1GA 4K50A 1X9WA 2CPDA 5IWAF 3T1HF 4FF3A 5LM7E 5L9NA 5A6WA 1HLWA 3WHIA 2YKMB 4KB7A 1X5OA 4O0IA 2ZH4A 3QT6A 2XMWA 5K14B 1RT6A 1T3OA 5HSPA 1V6HA 3G8QA 1HMVA 1W2BR 3QZ8A 3BQ0A 1NJWA 2FJDB 1YX2A 2BKOA 3FBFA 4NA2A 2EEYA 3ENVA 4CH0S 3I96A 2QLJB 5HMYA 3FEXB 3PW0A 2ZH9A 1QLNA 4IYQA 2QFIA 2HHVA 2XULA 1D3WA 2XHWA 1FWPA 3NEKA 3N28A 4MIWA 1U6ZA 5F0UA 1PJ7A 4C8YA 1B3TA 3MEGB 4NOHA 1SKRA 2E1RA 3ILLA 2XZDB 1PGZA 5EUHA 5K20B 4JI2J 4LF7F 4NLTA 1GXTA 1HNXF 1VRTB 3QLHA 4KE5A 3L09A 2D1CA 3PV8A 3VGSA 3BO3A 4WYLA 4NA1A 4KV8A 3M2UB 1Q8IA 5T14A 3LW5C 2UUBF 4DV1J 2QG9B 2ZOGA 2CJ9A 2V50A 5CYMA 4X4PA 2FJVA 2E5LJ 1PYSB 2LQ8A 2CZ9A 2Z2MA 5CZVA 1WEXA 2LDYA 3D9BA 1FEEA 4IOBA 5FLXY 4MKVA 1SQFA 1NDPA 4TY8A 1UVMA 1IUJA 2IVYA 4B3MF 1S72S 4BBYA 4IOAQ 2DITA 1H2VZ 1UFLA 1UL3A 3R1HA 2CQGA 1FX2A 4OZNA 1FWKA 2CPYA 2V8HA 3OJSA 2DGVA 2CVEA 5HVHA 4ID5A 2HVHA 1YBAA 2XYPB 4L76A 2WHOA 2KFZA 4LF9J 2JJ4D 1M5VC 1S59A 1N5VA 4TLQA 3KMQA 2LA4A 2LU1A 3P6YC 1DRZA 1B7FA 4U8YA 4JI0F 1RWOB 1CJUB 4UQGA 3CT9A 3R2DJ 1X4HA 2Z8QA 5ETPA 1N0UA 2W9AA 2FB0A 4LF5J 3FSXA 3BGRB 3W7BA 3M8RA 2P6SA 3UCZP 5F9LA 3P45B 3MFIA 2M52A 1KC8T 4OYZA 3GIIA 3HK2A 4EU0A 3HPOA 1TVRB 4CDIA 5HMZA 4OZ0A 1E6VA 2YKOA 2GHWA 4ECVA 4OX8A 1M5OC 4HHUA 4KY3A 1DQAA 3J7YI 4P7TA 2BUNA 4ZDNA 5KFEA 2DNNA 2K06A 1O8BA 3HZEA 3U7JA 1RTDA 2XLJA 2VB6A 1T9VA 5D15A 2BW7A 4NLOA 4Q43A 3VZIA 3TAMB 4OJHA 1FDNA 3IRXA 2QMWA 3C14B 1F2GA 1WACA 3NOCA 2C3MA 4RO0A 2L41A 1A9NB 5CYQA 3GFHA 3EE3A 3PR4A 1Q79A 5IT0A 1VQ4S 4TYAA 5L1IA 4PG4A 1RT3A 1D9DA 2FHKA 2KVIA 2IAJA 2CDQA 1S57A 3QYYA 1KQKA 2IMWP 4ZPVR 4ECXA 4FKYA 4FF4A 3EGNA 1Y5IB 3IFEA 1KQSR 3K2YA 1UP1A 1BY9A 4TNOA 4WP8A 3MR6A 1X31C 1KDNA 7FD1A 1SQGA 2Z0GA 3NRBA 5KFYA 2F8EX 3HDSA 1NSAA 4ZLNA 4M1KA 4M5DB 2J9DA 1SL1A 5C7PA 5KG5A 2OEKA 4OYMA 4LF8J 2YXLA 1PG5B 1KQFB 4F0MA 4OX9F 4KSEB 3OFGA 3SCKE 1EP4B 3BM7A 1XJWB 4JI6J 3JTNA 3RR8A 1EB0A 2R7XA 4A8QA 2BDPA 2EG1A 1K1QA 3FRYA 3GIKA 2W4DA 1NSQA 2HVZA 1XR7A 5KFTA 3MM5B 2UVUA 2W2PP 4BLGA 3DLJA 2L9NA 4DF4A 1QD1A 3J80Y 3V4MA 4J37A 4DZ6A 3BN7A 4FYXB 4C0HA 5KFAA 1HWJA 4E98A 2HNZB 1ULRA 4DFMA 1K73T 2JEFA 4WP9A 1T05A 1WKKA 5GMDA 4I7FB 1KHWA 4I69A 1C2PA 2HZCA 5KFJA 3QRRA 3RBZA 4K5RA 4C3KA 2VQEJ 1RAFB 3Q22A 3I32A 2F3JA 5ADZA 3UN2A 3G6ES 2J7UA 4P7VA 2RMLA 1RCOB 4Y0FA 3R7NB 4DV6J 4LBPA 3Q8UA 4OI1A 3DLHA 3US5A 1Q1KA 3HT0A 3JSRA 3VAJA 2HRTA 3CC4S 3TAQA 1O51A 1C4CA 2QT7A 4PWUA 4ZK7M 1RAIB 4H4MA 5DDOC 3C15A 1JLCB 1AA1B 1QAYA 2HYIB 3NOGA 1OY8A 2YNIA 1NPRA 2BVZA 4DQRA 1KKHA 2LU2A 2BM1A 2FGOA 3Q8VA 3VV2B 3O2IA 4LBIA 1YVFA 2NXJA 2KDOA 4ANCA 4BCAA 4P2FA 4JI3J 2B6AA 1FE0A 2XTJP 4LF2A 2LP4A 3HSDA 2YPZA 3E8OA 4RUCA 2DCUB 3DYAA 1LWFA 1HBNB 3OL7A 3CW2C 1RWWB 4F04B 2HLUA 1J5EF 1YRXA 2DXEA 1F9HA 3Q23A 1YJ9S 2QMUB 3EWGA 2EKYA 3F73A 4LRDA 4W92B 1RJJA 3DOMA 2OPQA 4G1IA 2HWHA 2MXYA 3MCOA 1MROB 1KP6A 4YUDA 1TV6B 2IFXA 2EXUA 3K57A 4W90B 2I5JA 1YJ7A 1EIYB 1IM6A 1YWXA 3THPA 4DFPA 4J9LA 2ALZA 1F9FA 2AKWB 2XZTB 2I8EA 1FDDA 4ERDA 3H40A 1RI7A 1SIZA 2XMMA 5ETQA 2VA3A 1LFWA 1Z2LA 1MN9A 4IFVA 2VFRA 2W4CA 2NZ4A 4Y3CA 2B5JA 3SSSA 4CLPA 4YB7A 1QJHA 3NS7B 1NZAA 3BSOA 4ZN1A 2G9OA 4KT0C 1WC0A 3CC7S 2ZVSA 5CHCB 2MKHA 3FCWA 4EO8A 2W2OP 4D3GA 2ZM6F 4USHA 1GX6A 4M5JA 4B3TJ 3X1LB 1NUEA 1T94A 1OQ3A 5GAHU 5E5NA 2XBPA 2J6TA 4CLTA 2DR5A 4ZVEA 4HL9A 1LWCA 1NEEA 5AT1B 4DS4A 2KM8C 4J7CA 2FUG9 3IWNC 4ED7A 5J1EA 1GMWD 1R6YA 2V4JA 3GR0A 1G3OA 1RTIA 5B0AA 1RWMB 3HXMA 2O1PA 4DLGA 2R7RA 2XM3A 3G96A 1SQEA 4ZVGA 4QU7A 4DZDA 3ZO7A 1YZ6A 4N47A 3DI6A 1C0TB 2OPPB 1VQ5S 5DS7A 4DU8A 1WOPA 2FZGB 4LIRA 1AYEA 3I9ZA 4PYDA 1L3UA 4QQBA 3C46A 3OR1B 2BKPA 2A10A 1ZAXA 3PNIA 5KFOA 1LWEB 1RWXB 2CNKB 2APOA 2DXFA 3GCXP 2QC3A 4IH5A 2KB2A 2HMIB 1IXKA 2HFNA 4Y2IA 1IBKF 3T1AA 1L3TA 2EFVA 3MMBB 2R8JA 3DOKA 4KHPJ 3ZTRA 3DRYA 2LXIA 4F4YA 1NK4A 1HQUA 1D0EA 4DV0J 2ACMA 2G4BA 2BE9B 2VOOA 2PGCA 1HWUA 2HRYA 4QPTA 3M2RB 3THTA 3NMAA 2K7JA 4NYZA 4DLEA 3IS9B 3PW5A 1KFSA 2QA2A 1PC5A 2Q1LA 3LP0A 2OD6A 3IBWA 5ITHA 2LQ9A 2NPFA 4OHZA 4RNNA 3D1OA 5A0YA 3H25A 2BJ8A 2CQBA 1UEKA 5J1PA 2AP6A 5KT2A 2XY5A 4DQSA 2A18A 4GKJJ 2OIHA 3V6DA 1SI9A 5LMNF 3WQPA 1MLAA 3RRGA 4M5KA 3RB3A 1FJGF 4TN2A 4ZVHA 5KAKA 4EBCA 4ICLA 2OPRB 3QGHA 1SC4B 1FI4A 2Y1RI 4DR7F 3DLKA 5ETVA 3P49B 1H2TZ 1LK5A 4EI2A 1WC4A 4IG3A 4LREA 5B0DA 4NCAA 3H5XA 3H2LA 2DXDA 1U1QA 3IGNA 1FA0A 3GP9A 3AXMA 2KJWA 2QLWA 2VDIA 4GMKA 2LQBA 5L9XA 4WXOA 2ACYA 1LEOA 3CJ2A 2FVPA 1RABB 2JX2A 2GV1A 2WBMA 3THVA 2VPYB 1KVIA 1V5IB 3LWLA 4F3QA 4RNOA 5HP1B 1HR0J 2C2OB 3PX6A 4ETZA 2MZRA 1PBUA 3NGTA 3DRSB 4IO1A 4UZBA 3AA8A 5H9FJ 2CG4A 4O3PA 2KXHA 1O0PA 2UUBJ 5GADI 4USWA 5B0GA 4P71A 3EXCX 1UVIA 4CM0A 3GONA 2HVDA 2MB0B 1VRUB 4ECYA 4K4WA 2VD3A 2NCKL 4WF9Q 1JKHA 3MPUB 3C3LA 1WKJA 2DNGA 4YS2A 4ZJLA 4ILLA 3QT8A 5IM0B 1KFDA 3LP1A 4CTAB 4WBFA 1WWHA 3RR7A 2V94A 5EDWA 3GTYX 2VJVA 3KWMA 4B3MJ 3KLVA 4RW4A 1JLAB 2GO8A 1IKVA 1P27B 4ZLPA 2D3UA 1JLGB 5LXYA 4X64F 3QAUA 1U24A 1FF2A 2RU9A 2JOQA 4IG0A 4C8KA 3GFXA 3KK2B 2G0JA 3BV8A 3BQ1A 2MQ8A 1UFKA 1WDTA 4NLUA 1DTTB 5KT4A 1U1OA 1Y7PA 4Z2XA 4JI0J 4WKYA 3RGIA 3FRZA 1S12A 4CO5A 1FD8A 3IM9A 1TMMA 3G82B 3VALA 4YHHF 1FDAA 4B3RF 5G0RA 1QUVA 3JAMU 3CCQS 2R9LA 5HQ8A 1RTHA 4CYUA 2CPIA 4QR2A 4ECQA 3BH6B 3M8QA 2VQFF 3PW7A 4NLYA 4DL5A 5CXTA 1LW0B 2CJAA 3UDCA 3SQGA 4EZ9A 3BS9A 2PT0A 2YWWA 1DAXA 2I6WA 5B08A 4O0NA 4ZP7A 2MQQA 2QL7B 3SEOA 5E3QA 3TI0A 1FO1A 2RRAA 1U48A 2W25A 3TUJC 1IJEB 3CJSA 1WTBA 5L1LA 2V4JB 1REVA 4FKXA 3EYZA 5CCMA 3R1LA 3DOLA 2WVDA 5DDQC 1P6TA 3C16A 1OQ6A 1KVKA 1SJQA 2KT3A 1UPPA 3D3BJ 1OS5A 4MYTA 1JXEA 1CS4B 2BW2A 2YKPA 4HACA 1P9QC 1T9XA 3PKMA 2MGZA 1MU2B 2Z2LA 3FBEA 3MMCB 1DQ8A 2YX4A 1QSLA 1U1MA 5FDLA 1OWXA 5ETOA 4JI8F 3NBPA 4W98A 2PC6A 3TZXA 2LDIA 2F5GA 5E2QA 3RW6A 2KRBA 4FYWB 3M8YA 5H9EK 1RA7A 2HBRB 4J9QA 1RLCL 3U27A 5DGBA 2F4VJ 3BKUA 1NKBA 4DJBA 1UFWA 3HJFA 3BSAA 5F8HA 2ZNYA 1U47A 2A0FB 3DRRB 1JJ4A 1RT2A 1OY9A 4PG8A 1HQEB 4B3SF 1SKWA 3I0RA 2EFPA 4OX9J 2IDEA 3R6LB 4OFZA 4NCGA 2MHNA 2OMOA 1HI0P 1N36F 1ICEB 1U0HA 2J6UA 3IM8A 3UR3C 5A8RA 3MPYA 1U8WA 2LYVA 3RU0A 5I42A 4JI5F 1T9UA 3B78A 5BJRA 4NEYA 5A0YB 4TKTA 4PQAA 1AUSL 3KLFB 3OXFA 2QV6A 4JI1F 2JEGA 1FNOA 3KLGA 4LSNB 4JV0A 2XC9A 4FXWA 4OL8A 1Q8LA 3D0GE 1ZETA 2XI3A 4O23A 3SDEA 4ZCIA 3H5UA 5AJ3F 5KT7A 4NL5A 4J9RA 1CULB 3HVTB 3LAKA 2PIIA 3V81A 5T7LB 3KUEA 1WJ9A 2QYGA 1SCJB 5CCLA 3A13A 3TEHB 2LXUA 4CCHA 3VAMA 1LK7A 3A3PB 4QIGA 1E6YA 3DLEB 4AL6A 4IQXA 3MFHA 3LAMA 2CQ4A 3K7RA 3M8PA 1XEZA 2OJ3A 2GVZB 2W9CB 1QE1B 4U8VA 4H4OB 4C6AA 5HLFB 1BMQB 4O3SA 5B0CA 3O3LA 4USJC 1VRQC 5C5JA 4ED8A 1VBKA 2DTJA 4LF4F 4F4XA 4ECRA 1VDHA 1KLMB 2XEXA 3CDEA 4LFAF 3GIRA 1OSCA 2HAFA 3PRBA 4RJVA 3M6UA 1RADB 3AD7C 1RGVA 4OZ1A 2G1DA 3JQMA 4LR7A 3L7OA 1UPMB 1J5EJ 5M2UA 4LR8A 1P1TA 2E7VA 2BANB 2VBYA 4J9KA 1Z1ZA 1SL2A 4URGA 5IC4B 3MM8B 1VBXA 3LGHA 3I31A 2YX1A 5I3QA 3BR9A 3MHYA 4GO5X 3M7VA 4Q45A 2DGTA 3EXYA 3G8SA 2VA2A 3N4WA 1MNEA 2HFZA 2GC8A 2FLLA 1C1CB 2XY7A 3OT9A 3W2VB 2AW0A 3DXSX 1P1LA 3DLBA 1WC6A 1IKWB 3AOBA 3CD6S 2IJFA 4XDDA 4L75A 3NAIA 4TY9A 1U6FA 4CLSA 3T5LA 1B0VA 1RTJA 4Y28C 2MY7A 4B08A 1VISA 2VG5B 5G0RB 4R8UB 4CYUB 4B17A 4JB8B 1UVNA 4DG1A 2IMOA 1Q5VA 3D66A 1IWAA 3P3DA 3L9ZA 2ZM6J 1NRKA 1IKYB 1TKTA 5D8HB 4QPXA 2LECA 3CMES 3JQKA 2B9XA 1R27B 3TZZA 4WXWA 1WI8A 3I9V9 1FK9A 2RD5C 1RT4A 3KDOA 1CJVB 2DNOA 3U1LA 3GV8B 5ETLA 3W5ZA 3PYFA 2GQQA 4G6VB 5DQIA 2XI2A 2ZD1B 5CAAA 4EFAC 2FY1A 5IS2A 3DOLB 4USKA 5F8LA 4OIXA 2V69A 5HANA 2IY5B 2C28A 1QAXA 1FX4A 2NS1B 3MEDB 4PR6A 1TELA 3TUZC 1WC5A 2C22A 1FKOA 4KAIA 2VKZG 1YZ7A 1G6BA 1T95A 1UETA 3B54A 4YP3A 2RNEA 4RX6A 2DEJA 2CPHA 5L1JA 3O44A 5DLFA 3K5PA 3TUPA 4OHYA 5C24A 1KBRA 1GQEA 4HHHA 4C11A 3D1QA 1IBKJ 4PG5A 4KC5A 4JI4J 5D4LA 2IC3B 3NY0A 2CNLB 1RHUB 3UW1A 2AF6A 3AD9C 5HJXA 3I55S 3D0IE 1Q82T 3GV5B 1QSYA 3I5AA 3J7Z5 1HW8A 1RT2B 3D7SB 2F1FA 1SXLA 4PZVA 2HQDA 2ZH3A 5L1KA 4X4UA 1VC5A 3SSRA 4N8OA 1CJTA 3LP2B 2ROGA 3OR2A 4BHQA 2XGQA 3U02A 2MZSA 4BWMA 4NCGB 1SJRA 3UPFA 2DNLA 2HZAA 2KVQE 2L3MA 4FS1A 2NXCA 3CCRS 3W64A 3GJRB 5I42B 5GAHI 3OUYB 3MCSA 1KVJA 2QRRA 3BQ2A 4J9SA 4K4XA 4HT5A 1N54B 3N01A 3HCXA 3BR8A 2UUCF 5LMNJ 2GMHA 3BPSP 2FLNA 1IKXB 1FFSB 5D4NA 3AOAA 4DR7J 3V81B 3MOZA 3BDEA 3VR1A 1M5KC 1AZSA 1N52B 3P4UB 3GFYA 1WKLA 2MTLA 1S1UB 1SUQB 4TXSA 4ER8A 3DDIA 3PY8A 2GMJA 2XLIA 2HK3A 3CIZA 2ROPA 3EDQB 2IPOB 1OYEA 3CJ3A 4DR2F 4DV4J 1IQZA 2KN4A 1KEKA 1HARA 1H2UX 4I6WA 1EJ7L 1RBAA 1Q7YT 2KZZA 2ZKTA 3CTRA 1VQNS 6FDRA 4O3RA 2YBVA 2G1HA 4ZVSB 3KLHB 3MECA 2UV8A 1UA1A 2C3UA 5GMKa 4Y65A 4CM2A 2P2CB 4OZLA 5G4DA 1IWGA 2FHOB 1HNVA 2KFNA 1V9OA 1WSRA 4X66F 2F9DA 5HROA 5KOWA 2HAIA 2Z2ZA 2XMUA 1N5QA 1D09B 4C97A 2IBOA 1S1TB 2EPIA 3CCWA 2XSJA 2C2ZB 2BYCA 1YBTA 4ECTA 1RDRA 4YR2A 1U0SA 2DGSA 4RBUA 3I5CA 2QFJA 4X64J 3VQSA 3TWZA 3W2WB 3B82A 4A8YA 4M94A 2YKQA 2FJXA 4QU6A 2DPJA 5KFWA 3EJMA 1G1XA 1S77D 3FZBA 2XMTA 4J9VA 2ZDPA 4RW7A 3UNYA 1NO8A 2O5DA 1X4CA 2FTRA 3CF5Q 2IRXA 2BX6A 5HK4A 4CO0A 2HURA 2KG1A 1XMQF 4FBUA 3QATA 3CJKA 3CIMA 2GJ2A 2HHXA 2ZVIA 1M5SA 3KK1A 1PKUA 1RK8A 3OD2A 2PDAA 4WIIA 4YHHJ 2HFOA 2HK2A 4B3RJ 1HBUB 3PZPA 4DR1F 1RWKB 3KG4A 3S8SA 5J2PB 4IRKA 1BWEA 4IFYA 3NP5A 4DX8H 1FNMA 3HI9A 3PX4A 2KRRA 2AHOB 1B64A 1GXLA 3MEKA 1ELOA 4NI2B 1HNWF 1R8PA 2ZH6A 1TKXA 2ZJQQ 3BGOP 2QO3A 1RWVB 1T3NA 5KFIA 4E0DA 1VQYA 3HD1A 3CJ4A 2W9BA 2KYZA 4I67A 2OD4A 1SC6A 1WG4A 1F6TA 5EGYA 4QWCA 5FD1A 4P2MA 3F56A 5IT9Y 1TUVA 4F36A 2B4UA 3N6LA 1VQOS 4A8FA 1TK0A 1HNIA 3NGRA 1M1KT 3QIPA 3RRKA 4GVBB 2CQ0A 3H42A 2HVIA 2CAJA 2OKQA 2MQNA 3NLCA 2XS2A 4A8OA 4G3IA 2ZZNA 4Q8EA 1U25A 2MPUA 2GAGC 1Q4RA 4DPOA 3H0PA 1S1VB 3MUVP 3AQPA 4DFJA 5C25B 3H98A 4F3MA 3PCOB 1LKZA 3G71S 1U1LA 2JWNA 2HS4A 2VV5A 1GMWA 5KG1A 1XWLA 2HWTA 1XQIA 2QSWA 2VG7B 3W9IA 3MM6B 2WOMB 4USIA 3LPEA 3AA9A 4UTGA 1DLOA 4RW8B 1NK7A 2HGNA 3H4DA 3UFCX 3KOAA 4OHWA 2G0IA 2LQJA 3OTDA 3CNQP 2VL1A 4B3SJ 2FDNA 1LW2A 3WIUA 2XO6A 2D3O1 1W26A 3OR2B 3M32B 1S9FA 2BE2A 1JLQB 3M6WA 3A8JA 3J81U 2E44A 3I56S 1RAOA 4UOCA 4O3QA 2H4YB 1AUDA 4JI5J 2H48B 4F50A 2O66A 1NBEB 4LJMA 1RAEB 4I4BA 4GKKJ 2YNHA 4QR0A 3GCWP 3OTOF 3MTKA 4HR2A 2DD8S 1AFJA 3OHBA 4ZVTB 4I2PB 2A6MA 5D3GA 3AB2B 2AEMA 5AJ3J 1S9GA 2V4RA 5J2QA 3CEDA 2ZNZA 1XMBA 2FIUA 1UJ5A 1TL1B 3PRVA 2WTFA 3GZ7A 2FZKB 3MM9A 1URRA 3P8BB 1HFEL 3ET6A 2AV5A 4DL2A 2E1AA 3RB4A 3TX8A 4N56A 1D9AA 3ZZRA 3NCPA 4CLUA 4DL3A 3UN3A 2L9DA 4QR1A 1ZZNA 1B7YB 2LEAA 2KT5A 3G6YA 2ZBCA 4EZ6A 4M5IA 3SMZA 3X3UA 1JLFA 3KTQA 3GJQB 3CULA 2KTQA 3CCUS 8ATCB 1TK5A 1A0OB 4LF4J 2RS8A 3I0SA 4CH1A 2K1RB 3OJUA 2UXBJ 2UXCJ 1T0TV 2CWKA 2MLZA 2VASA 3CCES 2YNFB 3ZZTA 4LFAJ 2Y3YA 2ZEJA 5MAOA 5KFUA 4IOCQ 2DY9A 3UE2A 2YPYA 4ZVFA 3K0JA 3NMRA 4HDGA 1R6VA 2C2DA 1YQHA 3AHPA 4I56A 1GTEA 4P75A 2B9WA 4UOHA 1RT5B 2NUUG 4NLXA 4WE1A 1CEZA 3ZNUA 3QO9B 2B7BB 1N32F 2LVWA 2DHGA 2ZKUA 2MKJA 3CD5A 2MKIA 1BQNB 4BDPA 5GAGI 3CWJA 3BF4A 1UVKA 2MLXA 1P8GA 4NWBA 1U7LA 4DR5J 1RAHB 1TUGB 4U7CA 3I6PA 4F2SA 3EGWB 4C8ZA 3JSMB 3LGNA 2NLWA 1HA1A 2QEXS 1EQ0A 1Y0HA 1ZA1B 2CQIA 4ALZA 2MZJA 4TU7A 1SH3A 4NLVA 4OZ5A 4WFYA 2KT2A 2H51B 1S6QA 5DG7A 3GYXB 2CUYA 3GSDA 3KK1B 1NJZA 5A8WB 3VAFA 1GMUA 3DMJA 1KTQA 4JP8A 1S7HA 2YQ0A 2HHTA 3R97A 1HWKA 3IR6B 3C19A 2FHMA 2ATCB 1S1XA 3DRXA 2QSFA 2WVFA 3AAWB 3J7ZT 2RDJA 4ILRA 4LUBA 1S9EA 1GT8A 1TAUA 4RUHA 1JXLA 3N79A 4LFBF 5J2MA 1JLBB 4WYWA 3HHKA 1WG1A 2VBWA 2MZ1A 4X84A 2KXFA 4PKDB 2XZWA 1BQMB 4X65F 1C0UB 5CQGA 3D28A 2A2DA 4RWXA 3HF5A 1VCTA 1VLYA 2ASYA 2E5GA 2ZDOA 3Q83A 1FRLA 2GJIA 2FJWA 3K59A 3R9LA 4DWIA 2DHSA 2YKMA 1TFWA 1W2IA 3UD4P 1VYAA 1VMBA 5KFNA 5K14A 3M6VA 4CQ1A 1R3NA 2DHAA 2R8HA 4DV7F 1S7IA 5FIIA 3KJVB 1UVJA 2DH9A 1JJ2R 3W60A 3C2PA 4TU9A 3Q0AA 3R8YA 1FXRA 1HHSA 2GS8A 3MEGA 3TVYA 3KLEB 5E3CA 1V3RA 1H7XA 2M88A 3QAEA 1TU0B 3LWMA 4OJGA 1VRTA 2DO0A 2B4VA 2W7OA 4KKOB 1QDUB 3KJNB 3M2UA 3MF5A 3VAHA 4PG6A 4IUFA 1ZM3A 2JFKA 4P9SA 2OI2A 2GZOA 5M2PA 4C0OC 3DKDA 3K5LA 3VWSA 1NH7A 3I5BA 2BA9A 1ZBTA 1TL7B 4AE5A 2OHDA 2BQUA 2QX0A 1MMNA 2XG8A 3A8KA 3ZZ0A 1JX4A 2V8VA 1N34F 2B51A 3QPIA 3IG1B 3LO3A 3HZGA 2ZC4A 2NREA 3SXLA 2AYEA 3KFWX 3TNVA 1M90T 4O4RA
chains in the Genus database with same CATH topology
2ZWPA 4K8RA 3QFHA 4NMXA 3GCXP 3CNQP 2ZWOA 3T41A 3P5BP 3WHIA 2Z58B 2W2OP 3A3OB 3WIUA 2QTWA 3BPSP 2Z56B 2W2PP 3AFGA 4YN3B 1SPBP 3BGOP 2E1PA 2Z57B 3A3PB 1ITPA 2PMWA 3VV2B 2Z2YB 2W2MP 1V5IB 3WIVA 4JP8A 1R6VA 3SQOP 2Z30B 2W2QP 4OV6A 2Z2ZA 3VHQA 3H42A 2W2NP 3GCWP 3CO0P 4NE9C 2XTJP 1SCJB 3A3NB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZWP A;  4K8R A;  3QFH A;  4NMX A;  3GCX P;  3CNQ P;  2ZWO A;  3T41 A;  3P5B P;  3WHI A;  2Z58 B;  2W2O P;  3A3O B;  3WIU A;  2QTW A;  3BPS P;  2Z56 B;  2W2P P;  3AFG A;  4YN3 B;  1SPB P;  3BGO P;  2E1P A;  2Z57 B;  3A3P B;  1ITP A;  2PMW A;  3VV2 B;  2Z2Y B;  2W2M P;  1V5I B;  3WIV A;  4JP8 A;  1R6V A;  3SQO P;  2Z30 B;  2W2Q P;  4OV6 A;  2Z2Z A;  3VHQ A;  3H42 A;  2W2N P;  3GCW P;  3CO0 P;  4NE9 C;  2XTJ P;  1SCJ B;  3A3N B; 
#chains in the Genus database with same CATH topology
 4AD6 A;  4DV5 J;  5DET A;  4BWJ A;  2CZ4 A;  3ZTS A;  4ZVR B;  2UUC J;  1SC3 B;  4X2B A;  1Y9O A;  4DSE A;  2CPX A;  2V9W A;  3T41 A;  3EMT A;  4ZS6 A;  3MEE B;  3GQC A;  4B9S A;  1D8Z A;  4HT7 A;  4DPX A;  1RKJ A;  1CJU A;  1RBO B;  3ET6 B;  1N6Q B;  3QID A;  1FVS A;  2L48 A;  5E41 A;  1WF2 A;  2ZH5 A;  3KUG A;  4O44 B;  2CNN B;  4LFC F;  1HHQ A;  4GRS A;  2DNQ A;  4I6A A;  2HBQ B;  4UW2 A;  3JB9 k;  2H5I B;  2V5H G;  3VVT A;  1VQ9 S;  3PTW A;  5D6G A;  3C6T B;  3CCT A;  1RWP B;  1OPI A;  2D9P A;  2ZBP A;  3DLG B;  4LVO P;  2RJZ A;  4C7Q A;  3G6X A;  4F4Z A;  2YWG A;  4K5S A;  1DBD A;  1GTH A;  3JTO A;  3ILI A;  4HI2 A;  2M9K A;  2E9R X;  4P72 A;  2A3J A;  2DGW A;  5AXM A;  1WTF A;  1RB0 A;  4KFB B;  1DHM A;  2EFQ A;  4MAK A;  2UXD J;  4OI4 A;  2IA0 A;  3CVK A;  3TQ1 A;  2V0N A;  3ZNJ 1;  3SCJ E;  1X4B A;  2J0S D;  1UJ6 A;  5L46 A;  1C1B B;  4RBV A;  1JJC B;  2PMZ D;  5AXL A;  1HNZ J;  1KR4 A;  4F4K A;  2Q6B A;  1SKS A;  3MAA B;  3HLU A;  4L74 A;  4RW9 B;  4ITS A;  3PR5 B;  2EK6 A;  4WFN Q;  4MYU A;  5E3P A;  1Z4U A;  3NGS A;  2CYY A;  3VVU A;  4ED1 A;  2X7I A;  4ZCM A;  2OGU A;  1S99 A;  4P73 A;  2MMY A;  2BQ3 A;  2W24 A;  2DR8 A;  2WON B;  1QY7 A;  3D2W A;  1S6Q B;  3MMA B;  4AUK A;  1XMQ J;  2W2Q P;  4ZP8 A;  3A8E A;  2R7Q A;  5HQL A;  5LXR A;  2UV8 G;  4M5D A;  2R2U A;  1X4E A;  4B3O B;  1GXU A;  1SVD A;  4MFB B;  4DUZ F;  2JL9 A;  1NB2 A;  3I87 A;  5DDP C;  2B4P A;  1NJY A;  3BYR A;  4ES2 A;  2UU9 F;  4PXE A;  4JV5 F;  2JLE A;  4TU8 A;  5KG3 A;  1EP4 A;  1S9E B;  4QBU A;  1YJR A;  4PAB A;  1GAO A;  3UR0 A;  4J9O A;  1RAA B;  4X62 F;  1RYS A;  1FER A;  3IO1 A;  1S0N A;  3LF0 A;  1HNW J;  4CLF A;  4BS2 A;  2MHE A;  4DL6 A;  3H4B A;  1FD2 A;  2XB2 D;  2CQH A;  2RAQ A;  4GO7 X;  1Y11 A;  1IBC B;  3NGD A;  3HSZ A;  3JS9 A;  3MM5 A;  1WC1 A;  1EKS A;  5BXI A;  4M8L A;  3EIC A;  4K59 A;  3K17 A;  2HNZ A;  1LFP A;  5ETS A;  3HSG A;  2VOP A;  4K4V A;  2W7P A;  3EPI A;  5B0E A;  2FJB B;  3UD3 P;  2AYM A;  4WU3 A;  2L08 A;  4I7F A;  1VJW A;  2BRK A;  3GIJ A;  4GC6 A;  1RIS A;  3GMG A;  1EX8 A;  2V67 A;  2JHE A;  5KFP A;  2DRD A;  4ELU A;  4U7U D;  4OLO A;  5L39 A;  4PWD B;  4AND A;  3MM7 B;  5D0H A;  2CJQ A;  3KYL A;  2XYH B;  4WPA A;  4R25 A;  5J2N B;  4DSK A;  2HHH F;  2HFS A;  1FRI A;  1HBM B;  2V63 A;  1UW4 A;  4ZCK A;  1EZZ B;  1RT7 B;  4YFU A;  4DCP B;  4OQJ A;  4B9N A;  1HKA A;  4J9U E;  2W1B A;  1S49 A;  2F8H A;  2VIH A;  1JLC A;  2JVR A;  5KFS A;  2RRB A;  2ZWO A;  2BRL A;  4EBD A;  2HNY B;  4E8U A;  4TQS A;  4WTO B;  2ZH7 A;  1GFW B;  2CPE A;  5J1N A;  2ZUG A;  1I94 F;  4N41 A;  2HFU A;  1HBN A;  5KG7 A;  1M5H A;  1UMJ A;  2OP5 A;  3KMS A;  3MR3 A;  2BJ7 A;  3ICL A;  1S1W B;  2AT1 B;  1LNQ A;  1GNK A;  1YKW A;  2R7W A;  1XMO J;  4N7T A;  5RUB A;  4MKB A;  3OTO J;  4MTP A;  1MRO A;  2CJX B;  4DPW A;  1NK8 A;  4YN3 B;  1IQT A;  4FXD A;  5DDR C;  1TV6 A;  2XS5 A;  2AEF A;  3W65 A;  1MWQ A;  3H90 A;  1NXI A;  4AL7 A;  3T5H A;  1FT8 A;  2VC1 A;  3L4B C;  3HHE A;  4LR9 A;  4F67 A;  3HVA A;  4N8N A;  3PIO Q;  5KG6 A;  1JWW A;  3DXB A;  3DGV A;  3CXC R;  1CVJ A;  5A2Q U;  2GJF A;  1Z2Z A;  5AXK A;  2O67 A;  2AGP A;  1QTN B;  5F8G A;  3E01 B;  4IDK B;  2OEJ A;  1UWB B;  2BE7 D;  2OUG A;  1F5A A;  2E7W A;  1L3S A;  3TQE A;  3BZQ A;  4QWA A;  4NYP A;  1NDL A;  2B0G A;  5AE1 A;  7AT1 B;  3CJ8 A;  2MKS A;  2GML A;  2LFV A;  2IVM A;  2X1A A;  1YSJ A;  2ZZM A;  2AWZ A;  1WC3 A;  4NE9 C;  3HSJ A;  2NZC A;  4ZN3 A;  4RL1 A;  2J5A A;  2YH0 A;  3D0H E;  1WOS A;  2LEP A;  3M6X A;  2VIC A;  5KFV A;  4CO2 A;  2VON A;  1DUR A;  1F5C A;  2C1E B;  3HHD A;  4G1P A;  3AB4 B;  2M2B A;  1NHU A;  3NNH A;  3CCZ A;  1N5Y B;  4F02 A;  3TYT A;  4K4S A;  5LL6 d;  4FBT A;  5ETM A;  1R0C B;  4K0K J;  4NAS A;  1H0H B;  1TQL A;  4XPC A;  4DX5 A;  3G4S S;  1YLX A;  5DZ6 A;  2M7S A;  2DBB A;  2JLG A;  1XC9 A;  2H5J B;  3QWP A;  2CJK A;  4AYB D;  1N32 J;  1C0T A;  3M2V A;  2OPP A;  4CO4 A;  3NNC A;  4WFZ A;  4TVA B;  2J0X A;  3D6M B;  1F3V A;  2DKO B;  4Z7C A;  4NZ7 A;  2PO4 A;  5A8K B;  3FCV A;  3OR1 A;  2OO4 A;  3WIV A;  2R7V A;  3PIP Q;  2UUA J;  1LWE A;  2ZHA A;  4J5O A;  4JI2 F;  2HMI A;  1C4A A;  3QT7 A;  3LQV A;  2P5V A;  1YIJ S;  2NSC A;  3MMB A;  8RUC A;  4DQQ A;  5HO4 A;  1YJW S;  2CFX A;  3B6B A;  1RHR B;  2FGC A;  2RDD A;  2F7V A;  1HYS B;  2EWH A;  4Q0B B;  4JV2 A;  5CH7 B;  3M2R A;  3H7H B;  1VQL S;  3GJT B;  1WG5 A;  3IS9 A;  2DNK A;  5D0R A;  4O3O A;  2G2Z A;  2PFD A;  1JB0 C;  2AJ4 A;  4F2R A;  3KNG A;  3EX7 B;  5F3T A;  4HEA 9;  4LFB J;  2J7W A;  3AH6 A;  2ZJP Q;  4CO1 A;  3A8I A;  5LT5 A;  4M5G A;  4CRJ A;  2WVE A;  1GK8 A;  2K3I A;  5K8P A;  3OVB A;  1N88 A;  3CJR A;  5KTQ A;  1BGX T;  3UDE A;  4RU2 A;  2ZE2 B;  4N77 A;  1L3V A;  4DR6 F;  1X60 A;  2EFG A;  3R5D A;  5LJ5 Y;  3IN5 A;  1SB6 A;  2MJN A;  3R7B B;  2IIH A;  3ZZU A;  3MR2 A;  3C8Y A;  1U02 A;  2OPR A;  2ZOF A;  1URN A;  3H5Y A;  3TJA A;  3D4J A;  2JRS A;  4ES1 A;  2W8L A;  1PCA A;  4EUV A;  4I68 A;  1UW9 A;  4PPZ A;  2MEW A;  2PMH A;  4KBI A;  3SFG A;  3CCJ S;  2J8S A;  4P52 A;  2ZUA A;  4H4K A;  1NPK A;  2RHS B;  2JDJ A;  2G2O A;  3LGM A;  3NKY A;  1MW7 A;  3OL8 A;  4C8M A;  2ZBR A;  1B4S A;  4EGL A;  4DDF A;  4ZHR B;  3PHE A;  1SJF A;  2CQD A;  3M8S A;  1DY3 A;  1FEH A;  1NKE A;  5HP1 A;  3C66 A;  3N9U C;  2U1A A;  3DRS A;  2QMX A;  2RUG A;  4XTT A;  4V19 J;  1RSC A;  3Q8P B;  1WHX A;  2UVV A;  2HQI A;  4PPD A;  1XN9 A;  4EK2 A;  2H3E B;  2AX1 A;  1T03 B;  1Y10 A;  2XYG B;  1VRU A;  3CO0 P;  3MCN A;  2MY8 A;  1WOR A;  1PIE A;  2GVD B;  1N34 J;  3W9J A;  2QYC A;  4FDF A;  4DU7 A;  3GLJ A;  3POT B;  5GAE I;  1ZM2 A;  6AT1 B;  5IM0 A;  4CTA A;  4CI0 B;  4JOU A;  2QZ8 A;  1H73 A;  1R0B G;  1JLA A;  5MLC V;  3MGJ A;  3V6H A;  4KHR A;  2VFV A;  1JLG A;  2UVW A;  1FFG B;  4G1Q B;  2HHU A;  2IRY A;  1IBL J;  3L3C A;  1ZOT A;  5F8J A;  2DNM A;  1PAU B;  4LIW A;  1N4L A;  3Q2T C;  1KOH A;  5KG0 A;  3KK2 A;  2KH9 A;  1YTY A;  5DG8 A;  1RHK B;  2B9E A;  1CJK B;  2IM1 A;  3IMQ J;  2AJ0 A;  4P2S A;  1EET B;  2BQR A;  4IH7 A;  1DTT A;  1R31 A;  4U67 Q;  2WW8 A;  3KHR A;  4WCE Q;  2HZV A;  3EUN A;  1HL6 A;  3DM2 B;  1IN0 A;  3G82 A;  2VPW B;  2C42 A;  2Z57 B;  2EI5 A;  4NLQ A;  3MCM A;  2YNG B;  3VCD A;  5IC6 B;  3KHL A;  1TR0 A;  1HBO A;  4TLR A;  2FVS A;  4RR5 A;  4WZM A;  3QJL A;  3ITH B;  2HSE B;  1LW0 A;  4CNZ A;  1FVQ A;  3GG1 A;  2H65 B;  3CUN A;  1U2C A;  2V8P A;  1JNZ B;  2E5H A;  3PYD A;  3W66 A;  2YWF A;  2LKZ A;  2CDR B;  3DLL Q;  3D54 A;  4AFF A;  3CD0 A;  2X51 A;  1YIT S;  4ELT A;  3NXZ A;  4R0E A;  3AOC A;  4LQ3 A;  3P96 A;  1B0P A;  2VG6 B;  1CS4 A;  1XER A;  1NLK L;  3M2V B;  4M95 A;  2D9O A;  2C3P A;  1MU2 A;  4YY3 J;  3MMC A;  4FNH A;  3GE9 A;  3OL6 A;  2HW3 A;  2X3D A;  2SXL A;  3M30 B;  2YWH A;  1FJ7 A;  3GJS B;  1FWL A;  2AGQ A;  4Q44 A;  7FDR A;  1T9Y A;  5H1S V;  3BDP A;  2DY1 A;  1X9M A;  4DCO B;  1VR6 A;  1ITP A;  2HHP A;  5H9E J;  2XMV A;  3HHL B;  3HVW A;  2MKK A;  4ZVU B;  1V3S A;  3T1Y J;  2RQC A;  4DQP A;  4DFK A;  3Q8S B;  1RUS A;  1FTC A;  2K7K A;  2QA4 S;  2H1Y A;  2CAD A;  4Q2L A;  3DRR A;  2P6T A;  4DUZ J;  4JI3 F;  4FF2 A;  1HQE A;  2KJV A;  1LOU A;  5C42 B;  3OLA A;  4P74 A;  2UU9 J;  2J0Q D;  4JV5 J;  4RW6 B;  5HI7 A;  1TKZ B;  3ISN C;  1VQP S;  2C3O A;  4DUY F;  2Y1L B;  4X62 J;  3EGV A;  1L5U A;  3QFW A;  3EZU A;  1I51 B;  3SBM A;  5KT5 A;  4DF8 A;  1KQG B;  3KLF A;  5HMX A;  1CC8 A;  2V9K A;  2NXN A;  1JK9 B;  5E3A A;  5KFB A;  1TL3 B;  4OYA A;  2V4Q A;  3NG8 A;  2OEL A;  4LSN A;  2AYG A;  4MK9 A;  1NK5 A;  5IWA J;  3T1H J;  1R8B A;  4CO3 A;  1CUL A;  1UVL A;  3HVT A;  2A2C A;  5I3U A;  1VC6 A;  2HRU A;  2HQC A;  5T7L A;  1Q81 T;  1ZH5 A;  2IA6 A;  2GX8 A;  2ASD A;  5AE3 A;  5DRK A;  5KFQ A;  3FBC A;  4PRF A;  4URQ U;  4YEA A;  1APS A;  1YJV A;  2WSF C;  5CA5 A;  5BR8 F;  3L7P A;  3PKY A;  2CPJ A;  4F8R A;  2DNY A;  3BBB A;  2WCX A;  4PXC A;  2DR6 A;  3UO0 A;  2NXU A;  3DLE A;  1JXV A;  1PJ6 A;  2ZFH A;  2B8Q A;  3FFI B;  3NGK A;  1N56 A;  5GME A;  2DNH A;  3ZTO A;  2P9G A;  2GVZ A;  3RB6 A;  4B3T F;  2W9C A;  1QE1 A;  1CC7 A;  3PYG A;  4H4O A;  4C3M A;  5HLF A;  4LF7 J;  1N0V C;  1NU4 A;  1HNX J;  3QMQ A;  2XY6 A;  2YH1 A;  1KLM A;  2PN6 A;  3BRE A;  1ZM4 A;  4FF1 A;  2R7T A;  3PJW A;  1FES A;  4YOE A;  1U1N A;  3FUY A;  1HQ2 A;  1HPZ B;  1FHT A;  1WHW A;  3G8T A;  1F9E B;  3WX4 A;  3FQK A;  2DK2 A;  4FNI A;  1I94 J;  2YQ1 A;  4A8X A;  5IT4 A;  2Y9H A;  1DFD A;  2B8P A;  3RAX A;  4QIW D;  3TUI C;  1SJ3 P;  1FCA A;  1S6P B;  3HFK A;  2FHJ A;  3M9O B;  2F63 A;  2BAN A;  3IP0 A;  1EAR A;  4HVZ A;  5KT3 A;  3QWU A;  3MM8 A;  3BKF A;  4V1A k;  3UD5 A;  1KN6 A;  1ZS6 A;  1QAI A;  1TTH B;  2R3V A;  3UDV A;  2HWI A;  3MZI A;  2JLF A;  1HD1 A;  2ATL A;  3OLB A;  3TAP A;  3VAK A;  3FVY A;  3ISN D;  1CSJ A;  4QJV A;  1DAR A;  1VK8 A;  1C1C A;  3RJM B;  3DGP B;  3W2V A;  3LAN A;  3MR5 A;  4PCQ A;  1IKW A;  2OSR A;  1O5J A;  5HAT A;  1NJI T;  4DV0 F;  4OYI A;  2EW9 A;  1KWM A;  4N5S A;  3J81 Y;  2V2V A;  5GAD U;  3V6J A;  2RS2 A;  1TMJ A;  2VG5 A;  4R8U A;  2LEB A;  2VUG A;  1R8C A;  3QGG A;  1HBO B;  4M5N A;  1IM4 A;  3QSY B;  4UY8 5;  3HUL A;  3GPA A;  1IR0 A;  1CQN A;  1IKY A;  1OO0 B;  4MMO A;  1RHM B;  3ZZY A;  1FKP B;  4L72 B;  3UCG A;  4PYA A;  1T9T A;  4GKJ F;  2PEH A;  1XNQ F;  1O6X A;  1CJV A;  2E5J A;  2GGP B;  3F41 A;  3WC2 A;  3BGU A;  1S0M A;  2ZD1 A;  1LWX A;  3HX9 A;  4YB6 A;  3LA0 A;  2VFU A;  2ZBQ A;  4LSL B;  3ADA C;  3IAM 9;  2J76 E;  3IC1 A;  1X4F A;  4USU A;  4U9R A;  3QJJ A;  3MED A;  3ETO A;  4K4Y A;  1JLE B;  5KFL A;  2VF3 A;  3EVW A;  3NCR A;  2D69 A;  3K89 A;  2IHR 1;  2WVB A;  3PHT A;  2ILY A;  4QIV A;  1RTZ A;  3SYZ A;  4ZLL A;  3DNC A;  2JEI A;  2CQ1 A;  1MWZ A;  2IM0 A;  1YRU A;  2EG2 A;  4ZPB A;  2EFO A;  3AJ2 A;  4KGX B;  1S48 A;  2NUH A;  3TZW A;  3K5N A;  2RRN A;  1HR0 F;  2LMI A;  3W1Y C;  5DZ7 A;  2IC3 A;  3V2U C;  4ZJO A;  4PQU B;  3VQT A;  4C8L A;  2DNR A;  4PUO B;  3GIM A;  4QWB A;  3ZTQ A;  1R43 A;  3KK3 B;  4LBH A;  2VOD A;  2RUS A;  3H2V E;  4WFA Q;  1OJ4 A;  1Q86 T;  3G2X A;  5DQG A;  2DNZ A;  2KZM A;  4WK1 A;  5HL7 Q;  3LPY A;  3LP2 A;  4MH8 A;  2E1C A;  4QYZ K;  2PD1 A;  2E7X A;  5EWE A;  4NLG A;  3MUM P;  3FCH A;  3QZ7 A;  2V68 A;  4AL5 A;  2E1P A;  1AT1 B;  3G86 A;  3ENA A;  3MXH P;  5IQ6 A;  4ED6 A;  3NNA A;  2J6S A;  2Z4P A;  3ZZO A;  5AXN A;  3OUY A;  4HH1 A;  2A6O A;  2A1B A;  3BH7 B;  1IR2 A;  2VBX A;  3TJ9 A;  4DR6 J;  1XK8 A;  1FRX A;  1DTQ B;  4Y2A A;  4ED5 A;  4G65 A;  3KLI B;  4LRF A;  1IKX A;  3AD8 C;  2R4F A;  4MKY A;  5LMU F;  5I3U B;  5IT9 U;  4KH1 B;  2DVI A;  5FJ4 A;  4RUA A;  4DV2 F;  2RF2 B;  4DV3 F;  4X4V A;  1J5O B;  1S1U A;  1SUQ A;  1X5T A;  4O4G B;  3R5A A;  4ED3 A;  5HQM A;  3KUH A;  5IXU A;  1LV5 A;  1ZTW A;  1Q95 G;  1S6O A;  3PEH A;  4WIQ A;  4WTY A;  3C6U B;  2CPZ A;  1KON A;  3MD1 A;  1XR5 A;  1G4C A;  2H9Z A;  1K8A T;  5HBM B;  3SFU A;  4ED0 A;  3PRD A;  2EBE A;  2N7Y A;  3OVA A;  2QN6 B;  3KLH A;  4YDD B;  3HKZ D;  4KH0 B;  3BBF A;  1Q78 A;  2HS3 A;  4NZ0 A;  3RZA A;  1VJQ A;  3ELH A;  5EX0 A;  2BXJ A;  1JJH A;  2NYH A;  2PE8 A;  2NPI A;  4L3N A;  3NL0 A;  2ZHO A;  3NWG A;  5LSR A;  4FYY B;  2IDL A;  4WJB A;  3Q24 A;  1QVF R;  3D5M A;  4X4S A;  2QLF B;  1S1T A;  3NS5 A;  3JYT B;  1N5T A;  2YTC A;  4F25 A;  1RBL A;  2LQ5 A;  3K8W A;  4OHX A;  2ILZ A;  4OZJ A;  2HHQ A;  4E2F B;  1RT1 B;  4DR4 F;  4ILM A;  3ILJ A;  5JMN A;  3GIL A;  5GVQ A;  2RQK A;  4WWS A;  1Q5Y A;  1Y4Z B;  2DT9 A;  1RWN B;  3W2W A;  3TA0 A;  2DPI A;  1R0A B;  3E2E A;  1VQ7 S;  3UNG C;  4ZJQ A;  1UA0 A;  3LUY A;  3IR7 B;  3QT5 A;  1YJU A;  1F5B A;  4OYP A;  1VS3 A;  2CPF A;  4B9M A;  4Q8F A;  3GFZ A;  2RU3 A;  1VQ6 S;  3V4I A;  4R5P B;  2F4V F;  4ECW A;  3MUT P;  4OI2 A;  2O01 C;  4TYB A;  4CLW A;  4TQR A;  3N5B A;  4P6Q A;  1H72 C;  3AFG A;  1H98 A;  1WNE A;  5D78 A;  4ZP9 A;  3M9M B;  1V3Z A;  2YWK A;  4AXI A;  1HBU A;  2F40 A;  2IYG A;  2IYI A;  2DH7 A;  5J2P A;  1PYO B;  2IM2 A;  3MPW A;  2I2Y A;  3IR5 B;  2RQ4 A;  4KPY A;  2G0C A;  3WZ0 A;  3SI8 A;  3QRP A;  2HEK A;  3T9Z A;  4HI1 A;  4NI2 A;  1EQM A;  5DLG A;  1KNZ A;  4HYK A;  5C2C A;  1RKI A;  1SV5 B;  5KG4 A;  2Y1J A;  4FS2 A;  1N5S A;  1PSD A;  3L95 X;  2MST A;  1YI2 S;  2DIU A;  3TA1 A;  4NRU A;  4R0J A;  1HI1 A;  3ENW A;  1P9Y A;  2BOA A;  1YRT A;  3RBD A;  2HIY A;  4GVB A;  2HND A;  1U2F A;  3RAM A;  1R8A A;  1VGY A;  2AZ3 A;  2V6A A;  3P5T L;  5C2G A;  2IBK A;  3JSY A;  1RT6 B;  4A46 A;  2WSC C;  3UCU P;  1HMV B;  2BMB A;  3EPG A;  4KGK A;  3ZTP A;  1S1V A;  3TVZ A;  3PO4 A;  2CJY B;  1CBK A;  2RSQ A;  2Y8W A;  3PO5 A;  4C8N A;  5C25 A;  1NK0 A;  4OJ3 A;  1REG X;  3UN5 A;  3IA0 A;  1H74 A;  2GQC A;  1Y00 A;  1N33 F;  3KJQ B;  5THW A;  2R2T A;  1BE4 A;  2K2P A;  3OV7 A;  3HVR A;  3QGP A;  3SQO P;  2Z30 B;  1WF0 A;  3QLH B;  4ECS A;  4WP3 A;  2VG7 A;  4AQY F;  1XNR F;  3HHL C;  3VAG A;  2AMC B;  3MM6 A;  4KV8 B;  3T5K A;  3QRQ A;  4PXB A;  2R8I A;  2WOM A;  4LRA A;  4RW8 A;  4OI3 A;  5CYM B;  4EYI B;  3OXG A;  2LLZ A;  1DJ0 A;  3PW4 A;  1F60 B;  1YBU A;  2CQ3 A;  2HQF A;  1OIA A;  3IAS 9;  2VPX B;  4OX6 A;  3M32 A;  3W8G A;  3VTI A;  5EWG A;  3HFV A;  1JLQ A;  2ADC A;  4DUY J;  3FNN A;  4ED4 A;  4TY8 B;  4F26 A;  2HLT A;  4U7U K;  4DSI A;  3HFZ B;  3RUB L;  3AJD A;  1NDK A;  2HQ3 A;  2QGF B;  2LCW A;  5K9F A;  4ID5 B;  1HWL A;  1SJ4 P;  1VOM A;  2DIV A;  2JNJ A;  3BGL A;  5LJ3 Y;  2ZC3 A;  1ZZF A;  4I2P A;  3R3T A;  4L3K A;  1FJG J;  3TZY A;  4KTQ A;  4OI0 A;  2XQC A;  3IWL A;  3D1H A;  4AT1 B;  4OLP A;  1TL1 A;  1H6K X;  5ETR A;  1A7G E;  2GNK A;  2I0X A;  4H4K C;  4MT1 A;  1QSS A;  2Q43 A;  5BR8 J;  4Z7Y A;  2W2N P;  1I1G A;  1Y3K A;  2NYI A;  3OSN A;  4NX9 A;  3K8V A;  4ZIW A;  3SV3 A;  1E6V B;  4XDC A;  1RYR A;  4DXL A;  2FC8 A;  2M5Y A;  3K5M A;  3CDU A;  3OTE A;  4UY8 T;  2Y0S D;  1RTD B;  2K1R A;  1MMD A;  2D3O R;  3HD2 A;  2KL8 A;  3W3S A;  2YNF A;  4EBE A;  2NSB A;  3IRX B;  4DHV A;  4CLL A;  5K8N A;  3CDA A;  1UWA A;  2Z58 B;  3RB0 A;  4S0M A;  4A8K A;  4XPE A;  5F8N A;  3RTV A;  3FGV A;  3OFE A;  1MML A;  5CYQ B;  1U2R A;  2XMA A;  3RBE A;  2FPH X;  3HHL D;  1RAG B;  1RT3 B;  1RT5 A;  1VFJ A;  2HS0 A;  2CQC A;  3QGI A;  2IAJ B;  3DDK A;  4QIE A;  2N4D A;  3DCA A;  3QO9 A;  2R2R A;  2R2S A;  2PA8 D;  5E3R A;  3KKF A;  4ZVQ B;  1BQN A;  5DJB A;  4ID8 A;  2BKN A;  1JMT A;  2DJW A;  2KYX A;  2VKR A;  3MTJ A;  3PW2 A;  3I4H X;  4HKQ A;  3NAH A;  1AB8 A;  2AJF E;  3JSM A;  2DHX A;  2AD9 A;  1Q16 B;  4JI4 F;  2V2Q A;  2Q3P A;  3FZ2 A;  1EAY C;  2FYX A;  3V4I B;  4QCL A;  2XSF A;  2OAU A;  3DU6 A;  3Q8Q B;  4HLB A;  1PAE X;  3VF0 B;  4EWT A;  4GC7 A;  1Y5L B;  4QWD A;  2NQP A;  4K4U A;  4PEO A;  5A8W A;  4MJK A;  2X1F A;  2CVI A;  3W5Y A;  3SSQ A;  3D6H B;  1TKD A;  2JC0 A;  3S1T A;  2VQF J;  3GR1 A;  3MPD A;  4CLK A;  1OMS A;  1JLB A;  4IR1 A;  1VQS A;  3MUR P;  4RUB A;  4KGZ B;  3PFE A;  3O5T B;  1RXO B;  2AEJ A;  1G2E A;  1FJE B;  1TFY A;  1XNQ J;  3M8Z A;  4EYH B;  2HGM A;  3W8P A;  4NLP A;  1BQM A;  1C0U A;  4F4W A;  3ONQ A;  5B0F A;  4RNF A;  4ZPT R;  2CKW A;  5A2Q Y;  4K4Z A;  2QLB B;  1T05 B;  1NHK L;  2HND B;  2GIR A;  4OZ3 A;  1U09 A;  2FZC B;  1RP5 A;  3BO2 A;  1WDD A;  1BUX A;  2QA4 G;  2DGQ A;  2DR9 A;  4PWW A;  4IQM A;  3BSN A;  5ETK A;  1ROF A;  3A1Y G;  2AIR B;  3QJP A;  4ZVP B;  2WRM A;  3TAR A;  5F41 A;  3KJV A;  3CCL S;  1WEL A;  4KIA A;  4DV4 F;  2MKY A;  4JI8 J;  3PAC A;  3MOJ B;  2OSQ A;  1NZ8 A;  2J7K A;  1YG0 A;  3KLE A;  2HBZ B;  2P9C A;  1QM9 A;  2Y0B B;  2AYB A;  1K44 A;  1R8H A;  4CT8 A;  4H4M B;  4EEY A;  3C15 B;  1R7I A;  4KKO A;  4NEZ A;  3OL9 A;  2YNI B;  1HW9 A;  5BYS A;  2BJD A;  5SZT A;  4NRT A;  4DPU A;  2D41 A;  3CSK A;  2B6A B;  3S7R A;  1TL7 A;  3V6K A;  1WI6 A;  3B4M A;  1OPZ A;  4XO0 A;  4A8M P;  4DQI A;  3DYA B;  1LWF B;  1U45 A;  4FZV A;  3EVO A;  4U95 A;  3CO9 A;  3IG1 A;  3PG9 A;  1N36 J;  3Q86 A;  3OSP A;  4CZC A;  3DHW C;  3QNW B;  4DN9 A;  4HH0 A;  2MSS A;  3DOM B;  4HHJ A;  2OPQ B;  2PEB A;  3OPK A;  3T3F A;  3LTO A;  4NXN F;  1WEY A;  5CAB A;  1VQ8 S;  3K5O A;  2I5J B;  4JI1 J;  2MDA A;  2DB1 A;  1RAJ A;  2RB7 A;  4NA3 A;  3R5B A;  2FC9 A;  4DL4 A;  3PX0 A;  3FKB A;  2DCL A;  1K1S A;  4UUW A;  1TL4 A;  3H20 A;  5LMU J;  1XBW A;  4B9U A;  4CNY A;  2BEF A;  2ZIT A;  2PA3 A;  1NCL A;  3WC0 A;  1UEV A;  1RA6 A;  3MEE A;  5ETT A;  4HDH A;  4DV2 J;  1G7C B;  3OW2 R;  1N6Q A;  4IFV B;  1VHF A;  4DV3 J;  3LOU A;  2B5J B;  4B9L A;  1NH8 A;  3B8H A;  1ZAV A;  1SIW B;  6FD1 A;  2WK4 A;  4DPY A;  4O44 A;  4IR9 A;  4A47 A;  2VZ9 A;  3RAQ A;  3B4D A;  4V19 X;  4OYX A;  2GW8 A;  5CZX A;  4F7V A;  4ZMM A;  2QTW A;  3O1L A;  2YY3 A;  2QIF A;  1SC1 B;  4C0B A;  4KHM A;  4OYO A;  3AXK A;  2JEJ A;  3C6T A;  3ZFV A;  1NB7 A;  3U1M A;  4I64 A;  5K8M A;  4KR0 B;  5DGA A;  4CH7 A;  3DLG A;  5HAO A;  2QA1 A;  3H8Y A;  1IBM F;  1ZA2 B;  2V2Z A;  1LWC B;  2R8K A;  1X5P A;  2ZZT A;  3IRW P;  3HJV A;  4ZCL A;  1DQ9 A;  2LA6 A;  5J1E B;  3RYL A;  1SBR A;  2E66 A;  1RTI B;  4KFB A;  1YDL A;  4CLZ A;  1TP7 A;  4RZR A;  3IGV A;  2ZHB A;  2J9C A;  1S4E A;  2D7S A;  4OYB A;  4ZP6 A;  2W8K A;  2RT3 A;  2CQP A;  3M05 A;  3OQ2 A;  3DI6 B;  1SKU B;  5KOX A;  4ZPA A;  2D3Z A;  4B02 A;  2UVR A;  1C1B A;  2IJR A;  4Y00 A;  4DR4 J;  2C2E A;  3MAA A;  2R7U A;  1PIL A;  2XGP A;  4RW9 A;  2H5E A;  5FLX U;  1FTR A;  1RHJ B;  2DH8 A;  4LF6 F;  1WUU A;  1RAC B;  4IRC A;  2X1B A;  4NXM F;  1ZPW X;  2QJ3 A;  2WON A;  3DOK B;  1M0S A;  3MMA A;  5L8R C;  2EKN A;  1HQU B;  4EO6 A;  2VBZ A;  1Q8K A;  2ZH1 A;  4L73 A;  3ETM A;  3J7A N;  3D6F B;  2FY8 A;  2E9Z A;  3IXQ A;  4B3O A;  2DO4 A;  4MFB A;  2RH3 A;  2IM3 A;  2J9E A;  2W7A A;  4Y2K A;  3KHG A;  4QWE A;  1PO6 A;  3LP0 B;  4ZIT A;  3R2C J;  4QIF A;  3G9C A;  1NDC A;  2ASJ A;  4OV6 A;  5I3P A;  2R7S A;  3CDB A;  3HMJ G;  3N5F A;  1A6L A;  4M5H A;  1NHV A;  2W4P A;  1H38 A;  3JQJ A;  2HHS A;  4GKK F;  1U4B A;  2W2M P;  1UTA A;  3Q89 A;  2GIF A;  1VHI A;  5GAG U;  2MYF A;  2GA7 A;  3V6D B;  4CP5 A;  2FD2 A;  3BO4 A;  3A3N B;  3CCS S;  3V5R A;  4DL7 A;  4B9T A;  4DN0 A;  4ICL B;  4IRD A;  3Q8Y A;  2BOP A;  1K0V A;  3UI3 A;  4U6P A;  3DLK B;  4MKA A;  4IG3 B;  2X3G A;  3D6T B;  4RNM A;  3L7U A;  2OML A;  1W7W A;  4EMD A;  2PFF B;  3EM1 A;  2B56 A;  4FYV B;  4DS5 A;  4IH6 A;  2B9Y A;  5KFC A;  3CJT A;  5LSL A;  4PWD A;  3MM7 A;  3AT1 B;  1N8R T;  3FSI A;  1K0T A;  1UAW A;  3BGF A;  4DSL A;  1KSP A;  2DYA A;  5J2N A;  5B0B A;  2NR0 A;  1N33 J;  1HBM A;  1BWV A;  4NPO A;  1RT7 A;  1TK8 A;  4I1T A;  2FHJ D;  1NK9 A;  4AQY J;  1XNR J;  2KXN B;  4RBT A;  2UXB F;  2UXC F;  1BXN A;  2VU5 A;  4D3H A;  3MDF A;  3GYG A;  5H9F K;  3T9N A;  4DPT A;  3TW0 A;  4NLW A;  3TOQ A;  3JSB A;  4UST A;  2HNY A;  2GFF A;  1LXN A;  4ATN A;  1JKH B;  2JZ5 A;  3MR7 A;  4OX7 A;  3Q8R B;  4KQZ A;  3LP1 B;  1D9F A;  2AJQ A;  1K9M T;  1S1W A;  1Y3J A;  3KHH A;  2I38 A;  4RW4 B;  5EHH A;  3FMB A;  1IKV B;  4I2Q A;  2DNP A;  1KS2 A;  4X4R A;  2M3D A;  1HIY A;  4DR5 F;  1U1R A;  2KKH A;  4IG0 B;  1S6U A;  3M8W A;  4MIB A;  1H7W A;  3AOD A;  5DM6 Q;  2VHG A;  4ZIV A;  1GH8 A;  1OSD A;  2OH2 A;  1AXQ A;  1VBZ A;  2OFG X;  4RWW A;  5LSO A;  1ZTT A;  1S4F A;  3SZ2 A;  2XWX A;  3J80 U;  1QAJ A;  2J8A A;  3ILO A;  4WK3 A;  4M5M A;  2UUT A;  1NSK L;  2GAH C;  3R7S B;  3CGI A;  2I9S A;  2YKN A;  3FSY A;  2VJU A;  2W01 A;  1RTH B;  3TO8 A;  1U1K A;  5HMW A;  4OI6 A;  4ZPW R;  4ZLJ A;  3E01 A;  2RVJ A;  4IDK A;  1KLN A;  3M8Q B;  2CXE A;  1UWB A;  4C4W A;  3CCM S;  9RUB A;  4DEZ A;  5CD4 A;  2BJE A;  4O3N A;  4DR2 J;  4QW9 A;  2WVC A;  3SQG B;  4LT6 A;  5IOL A;  4QW8 A;  4NYO A;  4DBQ A;  3ENQ A;  5U47 A;  2OTL S;  3FMW A;  3O8W A;  1VQM S;  2C3Y A;  2PMW A;  5EN1 A;  4J90 A;  2ABY A;  2BZ2 A;  1FDB A;  1BLU A;  3S6E A;  3FQL A;  2ZWP A;  3BB5 A;  2HKE A;  1GEH A;  4LVN P;  3AQO A;  1REV B;  1QVG R;  2BR0 A;  4C48 A;  4X66 J;  1N5Y A;  3C16 B;  2HFV A;  2ZH2 A;  3D3C J;  2D74 B;  2BBE A;  3QFH A;  3UWT A;  3BSC A;  4HAC B;  2R42 A;  2B43 A;  2EFN A;  2VDH A;  5KFD A;  2JC1 A;  2OLW A;  2DEI A;  1U1P A;  2BJ3 A;  3I82 A;  4AXJ A;  2MGZ B;  1D1U A;  5K8O A;  2PSZ A;  3GV7 B;  1V5V A;  1OY6 A;  1X4D A;  2AZ1 A;  3SCI E;  5FDL B;  4YR0 A;  1F2H A;  3BBC A;  3JXO A;  1VK3 A;  5A8K A;  3NBP B;  2UUW A;  2BAC A;  3DRP A;  2WB4 A;  3MMJ A;  1FRH A;  3G87 A;  3D68 A;  4M63 A;  2PI4 A;  5KFG A;  3CJ0 A;  3P5B P;  2PI5 A;  5F0W A;  4ENO A;  2XLK A;  2J9D E;  2CQ2 A;  1HI8 A;  1YJN S;  5JVG Q;  4DX6 A;  1HYS A;  4Q0B A;  1WSV A;  2OTJ S;  1FXD A;  2MQM A;  3I0R B;  2YWE A;  2N7C A;  1U8S A;  3SCL E;  2AQ4 A;  4DR1 J;  4W4M A;  2KU7 A;  2OFH X;  2KO1 A;  2F9J A;  2XNQ A;  3BEG B;  2GHP A;  1RWU A;  1NSP A;  1U0H B;  4I0W A;  2H4W B;  5A8R B;  3DHX A;  3F44 A;  1N48 A;  1RU2 A;  1CPZ A;  4UT4 A;  4F3O A;  2EK1 A;  3CPW R;  4Y2C A;  1I3O B;  4DV5 F;  2ZE2 A;  3MAH A;  2COL A;  4FVM A;  4K7Q A;  3TX0 A;  3KLG B;  1X8D A;  1ZAW A;  4PXD A;  5HJY A;  1NK6 A;  2G13 A;  3SDE B;  4UOG A;  3OFF A;  3JAM Y;  2RKI A;  1NKC A;  4FPI A;  3CC2 S;  1GMV A;  3HKW A;  4BC9 A;  2R8G A;  3R5G A;  2IVF B;  3SV4 A;  3KDN A;  2BM0 A;  1ZYQ A;  4UF4 A;  4ZKA A;  1RU1 A;  1E6Y B;  1FFW B;  2MQL A;  2VH7 A;  5JJB A;  3N0V A;  3GWC A;  2IJN A;  3M9N B;  3VAI A;  3M8P B;  1T11 A;  4ZHR A;  1X0P A;  1KD1 T;  3FEY B;  2DIS A;  4NLS A;  1T9W A;  4NCB A;  1PJ5 A;  3BKT A;  1FJC A;  2ASL A;  3R5J B;  4UUX A;  1XR6 A;  5HVG A;  4FYD A;  4ED2 A;  4WFX A;  1IJF B;  3H2U B;  2FVR A;  1BD6 A;  3N6M A;  3CMA S;  2FLP A;  1T02 A;  1T03 A;  3W62 A;  2RDI A;  2V8D A;  3LH2 S;  2UXD F;  1UCN A;  5E33 A;  2Y8Y A;  2XWY A;  1S5Z A;  2GVD A;  2E1M C;  3POT A;  5BYQ A;  1UZH A;  4JYA F;  1ARO P;  5HN0 A;  2CIM A;  3TAN A;  2DGX A;  5L38 A;  1HNZ F;  5KFF A;  3Q2S C;  3KNA A;  4I2Q B;  1XIQ A;  4OYW A;  1J27 A;  4C98 A;  3W9H A;  4G1Q A;  5JVH Q;  4NXN J;  4NLD A;  4QZV B;  1UKU A;  5IFM A;  2WZ1 A;  3QBC A;  1FRM A;  1NND A;  4X4Q A;  3TA2 A;  2DRB A;  3U1N A;  4WZQ A;  4HTI A;  3A12 A;  4ZPD A;  5KFM A;  1CJK A;  4KRW A;  4UZC A;  1X4A A;  1EET A;  5DQH A;  2Y1I A;  2XCA A;  3FEZ A;  3NWR A;  3ZZZ A;  1X7V A;  5E7O B;  3J7A 1;  1CQM A;  2RE1 A;  2G2Y A;  5KT6 A;  4DR3 F;  1RTJ B;  2EVZ A;  3ISZ A;  2CRL A;  2YKN B;  3DM2 A;  4I6Y A;  2N82 B;  3R27 A;  5D4P A;  3N6N A;  4DG1 B;  2JFD A;  1HD0 A;  1DZ5 A;  2YNG A;  1Y5N B;  3RG6 A;  2UP1 A;  2M8H A;  2P9E A;  3VGT A;  3WBZ A;  1TKT B;  3ITH A;  5D77 A;  2XNR A;  1X4G A;  2X1G A;  8AT1 B;  4OV1 A;  1TUW A;  4BC7 A;  4JI7 F;  2M8D B;  2FJE B;  4CLY A;  5IQQ A;  2YKA A;  3CJQ A;  1FK9 B;  4F4A A;  3KG1 A;  1RT4 B;  1IBM J;  1TZ0 A;  2MJU A;  2QL9 B;  5E0O A;  4UQT A;  2NXE A;  3LAL A;  2OEM A;  3T6B A;  2Q66 A;  3PVX A;  2JH3 A;  3ZZP A;  3ULH A;  3A3O B;  3CJ5 A;  4YB1 P;  3HP6 A;  3E51 A;  1QTM A;  2VG6 A;  2GQ2 A;  3MPV A;  3MWB A;  2AGO A;  3QQC D;  3EDR B;  2E9T A;  1FKO B;  5HVF A;  3DU5 A;  1JQG A;  1TAQ A;  4J9N A;  2F4F A;  3UVJ A;  2FJA B;  2YQ3 A;  1Q8B A;  4LF6 J;  3M30 A;  5C24 B;  2L9W A;  3NS6 A;  3DRP B;  1VI7 A;  4USV A;  4C11 B;  1KHV A;  2KHC A;  4NXM J;  4UOF A;  2WW4 A;  1F3F A;  3ZC4 A;  3HHL A;  2WAQ D;  4Y2M A;  3J7Y U;  5I4M A;  1NPP A;  5BYR A;  4NLR A;  2ZBI A;  4Z37 A;  1VC0 A;  2ERR A;  4DV1 F;  4GVL A;  1Q7L B;  2EBG A;  5T41 A;  2E5L F;  1CJT B;  4Q5V A;  3AY0 A;  5CYJ A;  1SH0 A;  3E3X A;  3OTB A;  2CZV C;  4F0H A;  5C42 A;  1S0O A;  3OBI A;  2XS7 A;  4RW6 A;  4LQ9 A;  2HG4 A;  2QL5 B;  1TKZ A;  3MI7 X;  1CG2 A;  3MD3 A;  4RKU C;  1FKA F;  2AU0 A;  3PFO A;  4XAK A;  2POK A;  1HWI A;  1XMO F;  1H3D A;  5K5M A;  2B7C B;  1YK9 A;  2U2F A;  2KFY A;  3UQS A;  4ELV A;  1TL3 A;  2JSX A;  4DSF A;  2GCF A;  4X65 J;  5KFH A;  3CDW A;  2RIL A;  4LF9 F;  4FVC A;  2RIJ A;  1YJT A;  4MK8 A;  4DSJ A;  3GYN A;  4XIU A;  2CWX A;  1AZS B;  2RKI B;  3I4P A;  1RE1 B;  2O3D A;  2MQO A;  2C2N A;  3PXG a;  3NCQ A;  4MK7 A;  3KJF B;  2VFS A;  3M4X A;  3JTP A;  1RCX B;  3W61 A;  3M1V A;  4RNH A;  4LF5 F;  4WKR A;  1EKR A;  4DV7 J;  2QLX A;  2HPU A;  1WF1 A;  1UEU A;  2OPS A;  1SH2 A;  5JXS A;  1FXL A;  5DG9 A;  1FRJ A;  1RLD A;  3FFI A;  2B4O A;  1LQ9 A;  4YME A;  4DMZ A;  4X4O A;  1BHN A;  2ADB A;  4C9D A;  3PYE A;  5D0G A;  1BQX A;  2ZOM A;  5D0E A;  3MEC B;  2FVQ A;  5F9N A;  3OVS A;  1WEZ A;  2N3L A;  5EX3 A;  4P10 A;  3HT3 A;  3IBF B;  4ZVO B;  1MWY A;  1HNV B;  1HPZ A;  4Q2M A;  4FN5 A;  4KO0 A;  5HRO B;  4J9M A;  1NME B;  4K0K F;  1W25 A;  3T5J A;  3VZH A;  5EWF A;  2XSJ B;  4QYR A;  3KG0 A;  1S6P A;  4MIA A;  2Z2Y B;  1VQK S;  4PAA A;  2N3O A;  3OXL A;  1B99 A;  3D67 A;  4DI6 A;  2FQQ B;  3G6V A;  3OHA A;  3CB4 A;  3BYP A;  1XTZ A;  2K3K A;  3PM9 A;  3FDS A;  1T8E A;  3KXD A;  2BJ1 A;  2Z56 B;  2K8G A;  1F0X A;  4M5L A;  2UUA F;  4YB5 A;  1JIH A;  1VIX A;  3GG0 A;  3SIP B;  3VGU A;  4RW7 B;  1FNX H;  3TR5 A;  1IVZ A;  4LSZ B;  3DGP A;  3GU0 A;  3R5C A;  1X9S A;  4LRB A;  4Y6I A;  1WD6 A;  3A4T A;  1S97 A;  2VPZ B;  4JUZ A;  1WHY A;  4XK8 C;  1IR1 A;  3CJK B;  3CE8 A;  4QOT A;  5B7W A;  1U49 A;  2DGU A;  2P8I A;  1YHQ S;  1RZM A;  2HIQ A;  2V34 A;  4LF8 F;  4A4J A;  4LFC J;  2R7O A;  2HHW A;  3MAQ A;  1Q0N A;  1PBA A;  2HGL A;  5KFX A;  1QUP A;  4YR3 A;  4KGV B;  4IFY B;  5IV3 A;  4JI6 F;  4NML A;  3S01 A;  4ETX A;  2FVC A;  3CMQ A;  2M4M A;  4YDX A;  5GAE U;  3DDN A;  3EZO A;  2LXF A;  1NJX A;  4K2J A;  1TKX B;  2CG8 A;  2ROE A;  2WBR A;  3GSI A;  1FKP A;  2C2M B;  1YGY A;  4OHV A;  2W9B B;  4KPC A;  5F3Z A;  2IRU A;  3RRH A;  1CLF A;  1RQ0 A;  5A76 A;  3PJ9 A;  4OMF G;  3T6J A;  2GGP A;  3TEG A;  1HNI B;  3QIP B;  5A6P A;  2UZA A;  1VIO A;  2V2K A;  3DC2 A;  1WHV A;  4YQW A;  2I1R A;  1NAQ A;  2EC2 A;  4LSL A;  2RHQ B;  1PC4 A;  1T7P A;  2MKC A;  4P2X A;  4USM A;  2VQE F;  2XMJ A;  3VGV A;  2AX0 A;  1U6B A;  3W5X A;  4CWB A;  3IBC B;  1KTV A;  1JLE A;  4NMX A;  1L3K A;  4Y34 A;  3UVJ B;  4DV6 F;  4DCJ B;  1X0F A;  4HTJ A;  2V8G A;  2BV3 A;  3UDL A;  4H54 A;  5KFR A;  4DL0 C;  1HHT P;  2MZQ A;  2KHD A;  3BJY A;  2H54 B;  1RHQ B;  3VHQ A;  4X4N A;  4FXV A;  1DLO B;  4PQU A;  1ZPV A;  2Q79 A;  2AJ2 A;  2GIQ A;  4ECU A;  4PUO A;  5M2R A;  2XMK A;  1I5O B;  2C2R A;  1KRP A;  3KK3 A;  3RW7 A;  1X5S A;  1LW2 B;  2ALY B;  5DO2 A;  4L6V 3;  1R89 A;  2DR7 A;  2CJB A;  2BE2 B;  2GO9 A;  4QYZ J;  1S76 D;  2JVO A;  4PG7 A;  3EZ5 A;  1J2V A;  3PDN A;  3WX8 A;  3W63 A;  3H5S A;  2M0G B;  1I6J A;  5CD4 H;  2YNH B;  3EGZ A;  3CD7 A;  4LRC A;  1IBL F;  4ECZ A;  2CNO B;  5F8M A;  3GB0 A;  4ZPC A;  4DUT A;  4DOZ A;  1VLO A;  1DTQ A;  2FLO A;  1UJ4 A;  5D3G B;  5IV4 A;  3KLI A;  1M5P C;  4X4T A;  1S9G B;  4C3L A;  3J81 j;  4K8R A;  5J2Q B;  4OZ2 A;  4A8S A;  5JUM A;  4JBC A;  1OYD A;  2WB1 D;  4ANE A;  1S10 A;  3OTC A;  3MM9 B;  3CCV S;  5SUH A;  4RU9 A;  2HVE A;  1ACM B;  4LF1 A;  2RF2 A;  4CIO A;  3NGU A;  2KG0 A;  5D4O A;  1J5O A;  2AJ1 A;  2RQM A;  3QSI A;  4JV1 A;  3M1V B;  2BAB A;  2E5I A;  4O4G A;  2HQG A;  3BGR A;  2OPS B;  5F8I A;  4J9P A;  3PJX A;  3TJ8 A;  1TVR A;  3RBX A;  2XO7 A;  2DRA A;  4WFB Q;  2J0W A;  4URS A;  2MQP A;  1JLF B;  2HHH J;  1PYT A;  3C6U A;  1S0V A;  4U96 A;  1MG7 A;  4KJI A;  1SPB P;  5HBM A;  3DFE A;  5AE2 A;  3TVK A;  3I0S B;  5DM7 Q;  9ATC B;  4ZOS A;  2B3T B;  4FP9 A;  1U26 A;  4KYZ A;  1M1H A;  5IZH A;  1BC6 A;  3TAM A;  1NM2 A;  4B9V A;  2MZT A;  2F8M A;  4WU2 A;  2KM8 B;  3IWX A;  4KO0 B;  1Q53 A;  3T19 A;  1LXJ A;  3C14 A;  1ZM9 A;  4J91 A;  2XCP A;  4ES3 A;  3K58 A;  3DN9 A;  2C2K B;  3PEJ A;  4FPR A;  1AFI A;  4C8O A;  1KOO A;  4WE1 B;  2MLY A;  4K2X A;  4Q7A A;  2XHC A;  5ETN A;  3JYT A;  1FE4 A;  2N4C A;  4JYA J;  4RPF A;  1FRK A;  3TRG A;  4A48 A;  2M70 A;  2YVS A;  2YX7 A;  3FBB A;  4YY3 F;  1RT1 A;  4ZA1 A;  4IKA A;  3ZXW A;  4OJ1 A;  2DHH A;  4RLE A;  3F0N A;  4KGM A;  1R0A A;  1TL5 A;  3OFH A;  1MN7 A;  2GHV C;  2F65 A;  1AW0 A;  4LMZ A;  2WSE C;  5B09 A;  2KI2 A;  1B0T A;  2VC0 A;  1D8Y A;  3T1Y F;  3HM9 A;  1F1B B;  2BJ9 A;  2DGO A;  2QE5 A;  4KHP F;  4R5P A;  1SJ1 A;  3FC9 A;  2ZJR Q;  2VFT A;  1S79 A;  3O6Q A;  2HBY B;  3AJ1 A;  3EVM A;  5KFZ A;  4DR3 J;  3DMJ B;  2EC0 A;  4IO9 Q;  4F0K A;  3HHN B;  4NZ6 A;  4CT9 A;  1S1X B;  5KG2 A;  3H59 A;  4K4T A;  3FJ2 A;  5LOQ A;  3R6G B;  1EHW A;  5KFK A;  3TP2 A;  2CA9 A;  5J2M B;  1SL0 A;  1VBY A;  3WDO A;  2E29 A;  2Q6C A;  1B70 B;  3BPD A;  1JNR B;  4JI7 J;  4A8W A;  4C2M A;  1MSW D;  4DX7 A;  1SV5 A;  2ZH8 A;  3HO1 A;  1WOO A;  1K47 A;  1UZD A;  4N76 A;  3FK4 A;  3BN4 A;  1GX5 A;  1M1G A;  4K50 A;  1X9W A;  2CPD A;  5IWA F;  3T1H F;  4FF3 A;  5LM7 E;  5L9N A;  5A6W A;  1HLW A;  3WHI A;  2YKM B;  4KB7 A;  1X5O A;  4O0I A;  2ZH4 A;  3QT6 A;  2XMW A;  5K14 B;  1RT6 A;  1T3O A;  5HSP A;  1V6H A;  3G8Q A;  1HMV A;  1W2B R;  3QZ8 A;  3BQ0 A;  1NJW A;  2FJD B;  1YX2 A;  2BKO A;  3FBF A;  4NA2 A;  2EEY A;  3ENV A;  4CH0 S;  3I96 A;  2QLJ B;  5HMY A;  3FEX B;  3PW0 A;  2ZH9 A;  1QLN A;  4IYQ A;  2QFI A;  2HHV A;  2XUL A;  1D3W A;  2XHW A;  1FWP A;  3NEK A;  3N28 A;  4MIW A;  1U6Z A;  5F0U A;  1PJ7 A;  4C8Y A;  1B3T A;  3MEG B;  4NOH A;  1SKR A;  2E1R A;  3ILL A;  2XZD B;  1PGZ A;  5EUH A;  5K20 B;  4JI2 J;  4LF7 F;  4NLT A;  1GXT A;  1HNX F;  1VRT B;  3QLH A;  4KE5 A;  3L09 A;  2D1C A;  3PV8 A;  3VGS A;  3BO3 A;  4WYL A;  4NA1 A;  4KV8 A;  3M2U B;  1Q8I A;  5T14 A;  3LW5 C;  2UUB F;  4DV1 J;  2QG9 B;  2ZOG A;  2CJ9 A;  2V50 A;  5CYM A;  4X4P A;  2FJV A;  2E5L J;  1PYS B;  2LQ8 A;  2CZ9 A;  2Z2M A;  5CZV A;  1WEX A;  2LDY A;  3D9B A;  1FEE A;  4IOB A;  5FLX Y;  4MKV A;  1SQF A;  1NDP A;  4TY8 A;  1UVM A;  1IUJ A;  2IVY A;  4B3M F;  1S72 S;  4BBY A;  4IOA Q;  2DIT A;  1H2V Z;  1UFL A;  1UL3 A;  3R1H A;  2CQG A;  1FX2 A;  4OZN A;  1FWK A;  2CPY A;  2V8H A;  3OJS A;  2DGV A;  2CVE A;  5HVH A;  4ID5 A;  2HVH A;  1YBA A;  2XYP B;  4L76 A;  2WHO A;  2KFZ A;  4LF9 J;  2JJ4 D;  1M5V C;  1S59 A;  1N5V A;  4TLQ A;  3KMQ A;  2LA4 A;  2LU1 A;  3P6Y C;  1DRZ A;  1B7F A;  4U8Y A;  4JI0 F;  1RWO B;  1CJU B;  4UQG A;  3CT9 A;  3R2D J;  1X4H A;  2Z8Q A;  5ETP A;  1N0U A;  2W9A A;  2FB0 A;  4LF5 J;  3FSX A;  3BGR B;  3W7B A;  3M8R A;  2P6S A;  3UCZ P;  5F9L A;  3P45 B;  3MFI A;  2M52 A;  1KC8 T;  4OYZ A;  3GII A;  3HK2 A;  4EU0 A;  3HPO A;  1TVR B;  4CDI A;  5HMZ A;  4OZ0 A;  1E6V A;  2YKO A;  2GHW A;  4ECV A;  4OX8 A;  1M5O C;  4HHU A;  4KY3 A;  1DQA A;  3J7Y I;  4P7T A;  2BUN A;  4ZDN A;  5KFE A;  2DNN A;  2K06 A;  1O8B A;  3HZE A;  3U7J A;  1RTD A;  2XLJ A;  2VB6 A;  1T9V A;  5D15 A;  2BW7 A;  4NLO A;  4Q43 A;  3VZI A;  3TAM B;  4OJH A;  1FDN A;  3IRX A;  2QMW A;  3C14 B;  1F2G A;  1WAC A;  3NOC A;  2C3M A;  4RO0 A;  2L41 A;  1A9N B;  5CYQ A;  3GFH A;  3EE3 A;  3PR4 A;  1Q79 A;  5IT0 A;  1VQ4 S;  4TYA A;  5L1I A;  4PG4 A;  1RT3 A;  1D9D A;  2FHK A;  2KVI A;  2IAJ A;  2CDQ A;  1S57 A;  3QYY A;  1KQK A;  2IMW P;  4ZPV R;  4ECX A;  4FKY A;  4FF4 A;  3EGN A;  1Y5I B;  3IFE A;  1KQS R;  3K2Y A;  1UP1 A;  1BY9 A;  4TNO A;  4WP8 A;  3MR6 A;  1X31 C;  1KDN A;  7FD1 A;  1SQG A;  2Z0G A;  3NRB A;  5KFY A;  2F8E X;  3HDS A;  1NSA A;  4ZLN A;  4M1K A;  4M5D B;  2J9D A;  1SL1 A;  5C7P A;  5KG5 A;  2OEK A;  4OYM A;  4LF8 J;  2YXL A;  1PG5 B;  1KQF B;  4F0M A;  4OX9 F;  4KSE B;  3OFG A;  3SCK E;  1EP4 B;  3BM7 A;  1XJW B;  4JI6 J;  3JTN A;  3RR8 A;  1EB0 A;  2R7X A;  4A8Q A;  2BDP A;  2EG1 A;  1K1Q A;  3FRY A;  3GIK A;  2W4D A;  1NSQ A;  2HVZ A;  1XR7 A;  5KFT A;  3MM5 B;  2UVU A;  2W2P P;  4BLG A;  3DLJ A;  2L9N A;  4DF4 A;  1QD1 A;  3J80 Y;  3V4M A;  4J37 A;  4DZ6 A;  3BN7 A;  4FYX B;  4C0H A;  5KFA A;  1HWJ A;  4E98 A;  2HNZ B;  1ULR A;  4DFM A;  1K73 T;  2JEF A;  4WP9 A;  1T05 A;  1WKK A;  5GMD A;  4I7F B;  1KHW A;  4I69 A;  1C2P A;  2HZC A;  5KFJ A;  3QRR A;  3RBZ A;  4K5R A;  4C3K A;  2VQE J;  1RAF B;  3Q22 A;  3I32 A;  2F3J A;  5ADZ A;  3UN2 A;  3G6E S;  2J7U A;  4P7V A;  2RML A;  1RCO B;  4Y0F A;  3R7N B;  4DV6 J;  4LBP A;  3Q8U A;  4OI1 A;  3DLH A;  3US5 A;  1Q1K A;  3HT0 A;  3JSR A;  3VAJ A;  2HRT A;  3CC4 S;  3TAQ A;  1O51 A;  1C4C A;  2QT7 A;  4PWU A;  4ZK7 M;  1RAI B;  4H4M A;  5DDO C;  3C15 A;  1JLC B;  1AA1 B;  1QAY A;  2HYI B;  3NOG A;  1OY8 A;  2YNI A;  1NPR A;  2BVZ A;  4DQR A;  1KKH A;  2LU2 A;  2BM1 A;  2FGO A;  3Q8V A;  3VV2 B;  3O2I A;  4LBI A;  1YVF A;  2NXJ A;  2KDO A;  4ANC A;  4BCA A;  4P2F A;  4JI3 J;  2B6A A;  1FE0 A;  2XTJ P;  4LF2 A;  2LP4 A;  3HSD A;  2YPZ A;  3E8O A;  4RUC A;  2DCU B;  3DYA A;  1LWF A;  1HBN B;  3OL7 A;  3CW2 C;  1RWW B;  4F04 B;  2HLU A;  1J5E F;  1YRX A;  2DXE A;  1F9H A;  3Q23 A;  1YJ9 S;  2QMU B;  3EWG A;  2EKY A;  3F73 A;  4LRD A;  4W92 B;  1RJJ A;  3DOM A;  2OPQ A;  4G1I A;  2HWH A;  2MXY A;  3MCO A;  1MRO B;  1KP6 A;  4YUD A;  1TV6 B;  2IFX A;  2EXU A;  3K57 A;  4W90 B;  2I5J A;  1YJ7 A;  1EIY B;  1IM6 A;  1YWX A;  3THP A;  4DFP A;  4J9L A;  2ALZ A;  1F9F A;  2AKW B;  2XZT B;  2I8E A;  1FDD A;  4ERD A;  3H40 A;  1RI7 A;  1SIZ A;  2XMM A;  5ETQ A;  2VA3 A;  1LFW A;  1Z2L A;  1MN9 A;  4IFV A;  2VFR A;  2W4C A;  2NZ4 A;  4Y3C A;  2B5J A;  3SSS A;  4CLP A;  4YB7 A;  1QJH A;  3NS7 B;  1NZA A;  3BSO A;  4ZN1 A;  2G9O A;  4KT0 C;  1WC0 A;  3CC7 S;  2ZVS A;  5CHC B;  2MKH A;  3FCW A;  4EO8 A;  2W2O P;  4D3G A;  2ZM6 F;  4USH A;  1GX6 A;  4M5J A;  4B3T J;  3X1L B;  1NUE A;  1T94 A;  1OQ3 A;  5GAH U;  5E5N A;  2XBP A;  2J6T A;  4CLT A;  2DR5 A;  4ZVE A;  4HL9 A;  1LWC A;  1NEE A;  5AT1 B;  4DS4 A;  2KM8 C;  4J7C A;  2FUG 9;  3IWN C;  4ED7 A;  5J1E A;  1GMW D;  1R6Y A;  2V4J A;  3GR0 A;  1G3O A;  1RTI A;  5B0A A;  1RWM B;  3HXM A;  2O1P A;  4DLG A;  2R7R A;  2XM3 A;  3G96 A;  1SQE A;  4ZVG A;  4QU7 A;  4DZD A;  3ZO7 A;  1YZ6 A;  4N47 A;  3DI6 A;  1C0T B;  2OPP B;  1VQ5 S;  5DS7 A;  4DU8 A;  1WOP A;  2FZG B;  4LIR A;  1AYE A;  3I9Z A;  4PYD A;  1L3U A;  4QQB A;  3C46 A;  3OR1 B;  2BKP A;  2A10 A;  1ZAX A;  3PNI A;  5KFO A;  1LWE B;  1RWX B;  2CNK B;  2APO A;  2DXF A;  3GCX P;  2QC3 A;  4IH5 A;  2KB2 A;  2HMI B;  1IXK A;  2HFN A;  4Y2I A;  1IBK F;  3T1A A;  1L3T A;  2EFV A;  3MMB B;  2R8J A;  3DOK A;  4KHP J;  3ZTR A;  3DRY A;  2LXI A;  4F4Y A;  1NK4 A;  1HQU A;  1D0E A;  4DV0 J;  2ACM A;  2G4B A;  2BE9 B;  2VOO A;  2PGC A;  1HWU A;  2HRY A;  4QPT A;  3M2R B;  3THT A;  3NMA A;  2K7J A;  4NYZ A;  4DLE A;  3IS9 B;  3PW5 A;  1KFS A;  2QA2 A;  1PC5 A;  2Q1L A;  3LP0 A;  2OD6 A;  3IBW A;  5ITH A;  2LQ9 A;  2NPF A;  4OHZ A;  4RNN A;  3D1O A;  5A0Y A;  3H25 A;  2BJ8 A;  2CQB A;  1UEK A;  5J1P A;  2AP6 A;  5KT2 A;  2XY5 A;  4DQS A;  2A18 A;  4GKJ J;  2OIH A;  3V6D A;  1SI9 A;  5LMN F;  3WQP A;  1MLA A;  3RRG A;  4M5K A;  3RB3 A;  1FJG F;  4TN2 A;  4ZVH A;  5KAK A;  4EBC A;  4ICL A;  2OPR B;  3QGH A;  1SC4 B;  1FI4 A;  2Y1R I;  4DR7 F;  3DLK A;  5ETV A;  3P49 B;  1H2T Z;  1LK5 A;  4EI2 A;  1WC4 A;  4IG3 A;  4LRE A;  5B0D A;  4NCA A;  3H5X A;  3H2L A;  2DXD A;  1U1Q A;  3IGN A;  1FA0 A;  3GP9 A;  3AXM A;  2KJW A;  2QLW A;  2VDI A;  4GMK A;  2LQB A;  5L9X A;  4WXO A;  2ACY A;  1LEO A;  3CJ2 A;  2FVP A;  1RAB B;  2JX2 A;  2GV1 A;  2WBM A;  3THV A;  2VPY B;  1KVI A;  1V5I B;  3LWL A;  4F3Q A;  4RNO A;  5HP1 B;  1HR0 J;  2C2O B;  3PX6 A;  4ETZ A;  2MZR A;  1PBU A;  3NGT A;  3DRS B;  4IO1 A;  4UZB A;  3AA8 A;  5H9F J;  2CG4 A;  4O3P A;  2KXH A;  1O0P A;  2UUB J;  5GAD I;  4USW A;  5B0G A;  4P71 A;  3EXC X;  1UVI A;  4CM0 A;  3GON A;  2HVD A;  2MB0 B;  1VRU B;  4ECY A;  4K4W A;  2VD3 A;  2NCK L;  4WF9 Q;  1JKH A;  3MPU B;  3C3L A;  1WKJ A;  2DNG A;  4YS2 A;  4ZJL A;  4ILL A;  3QT8 A;  5IM0 B;  1KFD A;  3LP1 A;  4CTA B;  4WBF A;  1WWH A;  3RR7 A;  2V94 A;  5EDW A;  3GTY X;  2VJV A;  3KWM A;  4B3M J;  3KLV A;  4RW4 A;  1JLA B;  2GO8 A;  1IKV A;  1P27 B;  4ZLP A;  2D3U A;  1JLG B;  5LXY A;  4X64 F;  3QAU A;  1U24 A;  1FF2 A;  2RU9 A;  2JOQ A;  4IG0 A;  4C8K A;  3GFX A;  3KK2 B;  2G0J A;  3BV8 A;  3BQ1 A;  2MQ8 A;  1UFK A;  1WDT A;  4NLU A;  1DTT B;  5KT4 A;  1U1O A;  1Y7P A;  4Z2X A;  4JI0 J;  4WKY A;  3RGI A;  3FRZ A;  1S12 A;  4CO5 A;  1FD8 A;  3IM9 A;  1TMM A;  3G82 B;  3VAL A;  4YHH F;  1FDA A;  4B3R F;  5G0R A;  1QUV A;  3JAM U;  3CCQ S;  2R9L A;  5HQ8 A;  1RTH A;  4CYU A;  2CPI A;  4QR2 A;  4ECQ A;  3BH6 B;  3M8Q A;  2VQF F;  3PW7 A;  4NLY A;  4DL5 A;  5CXT A;  1LW0 B;  2CJA A;  3UDC A;  3SQG A;  4EZ9 A;  3BS9 A;  2PT0 A;  2YWW A;  1DAX A;  2I6W A;  5B08 A;  4O0N A;  4ZP7 A;  2MQQ A;  2QL7 B;  3SEO A;  5E3Q A;  3TI0 A;  1FO1 A;  2RRA A;  1U48 A;  2W25 A;  3TUJ C;  1IJE B;  3CJS A;  1WTB A;  5L1L A;  2V4J B;  1REV A;  4FKX A;  3EYZ A;  5CCM A;  3R1L A;  3DOL A;  2WVD A;  5DDQ C;  1P6T A;  3C16 A;  1OQ6 A;  1KVK A;  1SJQ A;  2KT3 A;  1UPP A;  3D3B J;  1OS5 A;  4MYT A;  1JXE A;  1CS4 B;  2BW2 A;  2YKP A;  4HAC A;  1P9Q C;  1T9X A;  3PKM A;  2MGZ A;  1MU2 B;  2Z2L A;  3FBE A;  3MMC B;  1DQ8 A;  2YX4 A;  1QSL A;  1U1M A;  5FDL A;  1OWX A;  5ETO A;  4JI8 F;  3NBP A;  4W98 A;  2PC6 A;  3TZX A;  2LDI A;  2F5G A;  5E2Q A;  3RW6 A;  2KRB A;  4FYW B;  3M8Y A;  5H9E K;  1RA7 A;  2HBR B;  4J9Q A;  1RLC L;  3U27 A;  5DGB A;  2F4V J;  3BKU A;  1NKB A;  4DJB A;  1UFW A;  3HJF A;  3BSA A;  5F8H A;  2ZNY A;  1U47 A;  2A0F B;  3DRR B;  1JJ4 A;  1RT2 A;  1OY9 A;  4PG8 A;  1HQE B;  4B3S F;  1SKW A;  3I0R A;  2EFP A;  4OX9 J;  2IDE A;  3R6L B;  4OFZ A;  4NCG A;  2MHN A;  2OMO A;  1HI0 P;  1N36 F;  1ICE B;  1U0H A;  2J6U A;  3IM8 A;  3UR3 C;  5A8R A;  3MPY A;  1U8W A;  2LYV A;  3RU0 A;  5I42 A;  4JI5 F;  1T9U A;  3B78 A;  5BJR A;  4NEY A;  5A0Y B;  4TKT A;  4PQA A;  1AUS L;  3KLF B;  3OXF A;  2QV6 A;  4JI1 F;  2JEG A;  1FNO A;  3KLG A;  4LSN B;  4JV0 A;  2XC9 A;  4FXW A;  4OL8 A;  1Q8L A;  3D0G E;  1ZET A;  2XI3 A;  4O23 A;  3SDE A;  4ZCI A;  3H5U A;  5AJ3 F;  5KT7 A;  4NL5 A;  4J9R A;  1CUL B;  3HVT B;  3LAK A;  2PII A;  3V81 A;  5T7L B;  3KUE A;  1WJ9 A;  2QYG A;  1SCJ B;  5CCL A;  3A13 A;  3TEH B;  2LXU A;  4CCH A;  3VAM A;  1LK7 A;  3A3P B;  4QIG A;  1E6Y A;  3DLE B;  4AL6 A;  4IQX A;  3MFH A;  3LAM A;  2CQ4 A;  3K7R A;  3M8P A;  1XEZ A;  2OJ3 A;  2GVZ B;  2W9C B;  1QE1 B;  4U8V A;  4H4O B;  4C6A A;  5HLF B;  1BMQ B;  4O3S A;  5B0C A;  3O3L A;  4USJ C;  1VRQ C;  5C5J A;  4ED8 A;  1VBK A;  2DTJ A;  4LF4 F;  4F4X A;  4ECR A;  1VDH A;  1KLM B;  2XEX A;  3CDE A;  4LFA F;  3GIR A;  1OSC A;  2HAF A;  3PRB A;  4RJV A;  3M6U A;  1RAD B;  3AD7 C;  1RGV A;  4OZ1 A;  2G1D A;  3JQM A;  4LR7 A;  3L7O A;  1UPM B;  1J5E J;  5M2U A;  4LR8 A;  1P1T A;  2E7V A;  2BAN B;  2VBY A;  4J9K A;  1Z1Z A;  1SL2 A;  4URG A;  5IC4 B;  3MM8 B;  1VBX A;  3LGH A;  3I31 A;  2YX1 A;  5I3Q A;  3BR9 A;  3MHY A;  4GO5 X;  3M7V A;  4Q45 A;  2DGT A;  3EXY A;  3G8S A;  2VA2 A;  3N4W A;  1MNE A;  2HFZ A;  2GC8 A;  2FLL A;  1C1C B;  2XY7 A;  3OT9 A;  3W2V B;  2AW0 A;  3DXS X;  1P1L A;  3DLB A;  1WC6 A;  1IKW B;  3AOB A;  3CD6 S;  2IJF A;  4XDD A;  4L75 A;  3NAI A;  4TY9 A;  1U6F A;  4CLS A;  3T5L A;  1B0V A;  1RTJ A;  4Y28 C;  2MY7 A;  4B08 A;  1VIS A;  2VG5 B;  5G0R B;  4R8U B;  4CYU B;  4B17 A;  4JB8 B;  1UVN A;  4DG1 A;  2IMO A;  1Q5V A;  3D66 A;  1IWA A;  3P3D A;  3L9Z A;  2ZM6 J;  1NRK A;  1IKY B;  1TKT A;  5D8H B;  4QPX A;  2LEC A;  3CME S;  3JQK A;  2B9X A;  1R27 B;  3TZZ A;  4WXW A;  1WI8 A;  3I9V 9;  1FK9 A;  2RD5 C;  1RT4 A;  3KDO A;  1CJV B;  2DNO A;  3U1L A;  3GV8 B;  5ETL A;  3W5Z A;  3PYF A;  2GQQ A;  4G6V B;  5DQI A;  2XI2 A;  2ZD1 B;  5CAA A;  4EFA C;  2FY1 A;  5IS2 A;  3DOL B;  4USK A;  5F8L A;  4OIX A;  2V69 A;  5HAN A;  2IY5 B;  2C28 A;  1QAX A;  1FX4 A;  2NS1 B;  3MED B;  4PR6 A;  1TEL A;  3TUZ C;  1WC5 A;  2C22 A;  1FKO A;  4KAI A;  2VKZ G;  1YZ7 A;  1G6B A;  1T95 A;  1UET A;  3B54 A;  4YP3 A;  2RNE A;  4RX6 A;  2DEJ A;  2CPH A;  5L1J A;  3O44 A;  5DLF A;  3K5P A;  3TUP A;  4OHY A;  5C24 A;  1KBR A;  1GQE A;  4HHH A;  4C11 A;  3D1Q A;  1IBK J;  4PG5 A;  4KC5 A;  4JI4 J;  5D4L A;  2IC3 B;  3NY0 A;  2CNL B;  1RHU B;  3UW1 A;  2AF6 A;  3AD9 C;  5HJX A;  3I55 S;  3D0I E;  1Q82 T;  3GV5 B;  1QSY A;  3I5A A;  3J7Z 5;  1HW8 A;  1RT2 B;  3D7S B;  2F1F A;  1SXL A;  4PZV A;  2HQD A;  2ZH3 A;  5L1K A;  4X4U A;  1VC5 A;  3SSR A;  4N8O A;  1CJT A;  3LP2 B;  2ROG A;  3OR2 A;  4BHQ A;  2XGQ A;  3U02 A;  2MZS A;  4BWM A;  4NCG B;  1SJR A;  3UPF A;  2DNL A;  2HZA A;  2KVQ E;  2L3M A;  4FS1 A;  2NXC A;  3CCR S;  3W64 A;  3GJR B;  5I42 B;  5GAH I;  3OUY B;  3MCS A;  1KVJ A;  2QRR A;  3BQ2 A;  4J9S A;  4K4X A;  4HT5 A;  1N54 B;  3N01 A;  3HCX A;  3BR8 A;  2UUC F;  5LMN J;  2GMH A;  3BPS P;  2FLN A;  1IKX B;  1FFS B;  5D4N A;  3AOA A;  4DR7 J;  3V81 B;  3MOZ A;  3BDE A;  3VR1 A;  1M5K C;  1AZS A;  1N52 B;  3P4U B;  3GFY A;  1WKL A;  2MTL A;  1S1U B;  1SUQ B;  4TXS A;  4ER8 A;  3DDI A;  3PY8 A;  2GMJ A;  2XLI A;  2HK3 A;  3CIZ A;  2ROP A;  3EDQ B;  2IPO B;  1OYE A;  3CJ3 A;  4DR2 F;  4DV4 J;  1IQZ A;  2KN4 A;  1KEK A;  1HAR A;  1H2U X;  4I6W A;  1EJ7 L;  1RBA A;  1Q7Y T;  2KZZ A;  2ZKT A;  3CTR A;  1VQN S;  6FDR A;  4O3R A;  2YBV A;  2G1H A;  4ZVS B;  3KLH B;  3MEC A;  2UV8 A;  1UA1 A;  2C3U A;  5GMK a;  4Y65 A;  4CM2 A;  2P2C B;  4OZL A;  5G4D A;  1IWG A;  2FHO B;  1HNV A;  2KFN A;  1V9O A;  1WSR A;  4X66 F;  2F9D A;  5HRO A;  5KOW A;  2HAI A;  2Z2Z A;  2XMU A;  1N5Q A;  1D09 B;  4C97 A;  2IBO A;  1S1T B;  2EPI A;  3CCW A;  2XSJ A;  2C2Z B;  2BYC A;  1YBT A;  4ECT A;  1RDR A;  4YR2 A;  1U0S A;  2DGS A;  4RBU A;  3I5C A;  2QFJ A;  4X64 J;  3VQS A;  3TWZ A;  3W2W B;  3B82 A;  4A8Y A;  4M94 A;  2YKQ A;  2FJX A;  4QU6 A;  2DPJ A;  5KFW A;  3EJM A;  1G1X A;  1S77 D;  3FZB A;  2XMT A;  4J9V A;  2ZDP A;  4RW7 A;  3UNY A;  1NO8 A;  2O5D A;  1X4C A;  2FTR A;  3CF5 Q;  2IRX A;  2BX6 A;  5HK4 A;  4CO0 A;  2HUR A;  2KG1 A;  1XMQ F;  4FBU A;  3QAT A;  3CJK A;  3CIM A;  2GJ2 A;  2HHX A;  2ZVI A;  1M5S A;  3KK1 A;  1PKU A;  1RK8 A;  3OD2 A;  2PDA A;  4WII A;  4YHH J;  2HFO A;  2HK2 A;  4B3R J;  1HBU B;  3PZP A;  4DR1 F;  1RWK B;  3KG4 A;  3S8S A;  5J2P B;  4IRK A;  1BWE A;  4IFY A;  3NP5 A;  4DX8 H;  1FNM A;  3HI9 A;  3PX4 A;  2KRR A;  2AHO B;  1B64 A;  1GXL A;  3MEK A;  1ELO A;  4NI2 B;  1HNW F;  1R8P A;  2ZH6 A;  1TKX A;  2ZJQ Q;  3BGO P;  2QO3 A;  1RWV B;  1T3N A;  5KFI A;  4E0D A;  1VQY A;  3HD1 A;  3CJ4 A;  2W9B A;  2KYZ A;  4I67 A;  2OD4 A;  1SC6 A;  1WG4 A;  1F6T A;  5EGY A;  4QWC A;  5FD1 A;  4P2M A;  3F56 A;  5IT9 Y;  1TUV A;  4F36 A;  2B4U A;  3N6L A;  1VQO S;  4A8F A;  1TK0 A;  1HNI A;  3NGR A;  1M1K T;  3QIP A;  3RRK A;  4GVB B;  2CQ0 A;  3H42 A;  2HVI A;  2CAJ A;  2OKQ A;  2MQN A;  3NLC A;  2XS2 A;  4A8O A;  4G3I A;  2ZZN A;  4Q8E A;  1U25 A;  2MPU A;  2GAG C;  1Q4R A;  4DPO A;  3H0P A;  1S1V B;  3MUV P;  3AQP A;  4DFJ A;  5C25 B;  3H98 A;  4F3M A;  3PCO B;  1LKZ A;  3G71 S;  1U1L A;  2JWN A;  2HS4 A;  2VV5 A;  1GMW A;  5KG1 A;  1XWL A;  2HWT A;  1XQI A;  2QSW A;  2VG7 B;  3W9I A;  3MM6 B;  2WOM B;  4USI A;  3LPE A;  3AA9 A;  4UTG A;  1DLO A;  4RW8 B;  1NK7 A;  2HGN A;  3H4D A;  3UFC X;  3KOA A;  4OHW A;  2G0I A;  2LQJ A;  3OTD A;  3CNQ P;  2VL1 A;  4B3S J;  2FDN A;  1LW2 A;  3WIU A;  2XO6 A;  2D3O 1;  1W26 A;  3OR2 B;  3M32 B;  1S9F A;  2BE2 A;  1JLQ B;  3M6W A;  3A8J A;  3J81 U;  2E44 A;  3I56 S;  1RAO A;  4UOC A;  4O3Q A;  2H4Y B;  1AUD A;  4JI5 J;  2H48 B;  4F50 A;  2O66 A;  1NBE B;  4LJM A;  1RAE B;  4I4B A;  4GKK J;  2YNH A;  4QR0 A;  3GCW P;  3OTO F;  3MTK A;  4HR2 A;  2DD8 S;  1AFJ A;  3OHB A;  4ZVT B;  4I2P B;  2A6M A;  5D3G A;  3AB2 B;  2AEM A;  5AJ3 J;  1S9G A;  2V4R A;  5J2Q A;  3CED A;  2ZNZ A;  1XMB A;  2FIU A;  1UJ5 A;  1TL1 B;  3PRV A;  2WTF A;  3GZ7 A;  2FZK B;  3MM9 A;  1URR A;  3P8B B;  1HFE L;  3ET6 A;  2AV5 A;  4DL2 A;  2E1A A;  3RB4 A;  3TX8 A;  4N56 A;  1D9A A;  3ZZR A;  3NCP A;  4CLU A;  4DL3 A;  3UN3 A;  2L9D A;  4QR1 A;  1ZZN A;  1B7Y B;  2LEA A;  2KT5 A;  3G6Y A;  2ZBC A;  4EZ6 A;  4M5I A;  3SMZ A;  3X3U A;  1JLF A;  3KTQ A;  3GJQ B;  3CUL A;  2KTQ A;  3CCU S;  8ATC B;  1TK5 A;  1A0O B;  4LF4 J;  2RS8 A;  3I0S A;  4CH1 A;  2K1R B;  3OJU A;  2UXB J;  2UXC J;  1T0T V;  2CWK A;  2MLZ A;  2VAS A;  3CCE S;  2YNF B;  3ZZT A;  4LFA J;  2Y3Y A;  2ZEJ A;  5MAO A;  5KFU A;  4IOC Q;  2DY9 A;  3UE2 A;  2YPY A;  4ZVF A;  3K0J A;  3NMR A;  4HDG A;  1R6V A;  2C2D A;  1YQH A;  3AHP A;  4I56 A;  1GTE A;  4P75 A;  2B9W A;  4UOH A;  1RT5 B;  2NUU G;  4NLX A;  4WE1 A;  1CEZ A;  3ZNU A;  3QO9 B;  2B7B B;  1N32 F;  2LVW A;  2DHG A;  2ZKU A;  2MKJ A;  3CD5 A;  2MKI A;  1BQN B;  4BDP A;  5GAG I;  3CWJ A;  3BF4 A;  1UVK A;  2MLX A;  1P8G A;  4NWB A;  1U7L A;  4DR5 J;  1RAH B;  1TUG B;  4U7C A;  3I6P A;  4F2S A;  3EGW B;  4C8Z A;  3JSM B;  3LGN A;  2NLW A;  1HA1 A;  2QEX S;  1EQ0 A;  1Y0H A;  1ZA1 B;  2CQI A;  4ALZ A;  2MZJ A;  4TU7 A;  1SH3 A;  4NLV A;  4OZ5 A;  4WFY A;  2KT2 A;  2H51 B;  1S6Q A;  5DG7 A;  3GYX B;  2CUY A;  3GSD A;  3KK1 B;  1NJZ A;  5A8W B;  3VAF A;  1GMU A;  3DMJ A;  1KTQ A;  4JP8 A;  1S7H A;  2YQ0 A;  2HHT A;  3R97 A;  1HWK A;  3IR6 B;  3C19 A;  2FHM A;  2ATC B;  1S1X A;  3DRX A;  2QSF A;  2WVF A;  3AAW B;  3J7Z T;  2RDJ A;  4ILR A;  4LUB A;  1S9E A;  1GT8 A;  1TAU A;  4RUH A;  1JXL A;  3N79 A;  4LFB F;  5J2M A;  1JLB B;  4WYW A;  3HHK A;  1WG1 A;  2VBW A;  2MZ1 A;  4X84 A;  2KXF A;  4PKD B;  2XZW A;  1BQM B;  4X65 F;  1C0U B;  5CQG A;  3D28 A;  2A2D A;  4RWX A;  3HF5 A;  1VCT A;  1VLY A;  2ASY A;  2E5G A;  2ZDO A;  3Q83 A;  1FRL A;  2GJI A;  2FJW A;  3K59 A;  3R9L A;  4DWI A;  2DHS A;  2YKM A;  1TFW A;  1W2I A;  3UD4 P;  1VYA A;  1VMB A;  5KFN A;  5K14 A;  3M6V A;  4CQ1 A;  1R3N A;  2DHA A;  2R8H A;  4DV7 F;  1S7I A;  5FII A;  3KJV B;  1UVJ A;  2DH9 A;  1JJ2 R;  3W60 A;  3C2P A;  4TU9 A;  3Q0A A;  3R8Y A;  1FXR A;  1HHS A;  2GS8 A;  3MEG A;  3TVY A;  3KLE B;  5E3C A;  1V3R A;  1H7X A;  2M88 A;  3QAE A;  1TU0 B;  3LWM A;  4OJG A;  1VRT A;  2DO0 A;  2B4V A;  2W7O A;  4KKO B;  1QDU B;  3KJN B;  3M2U A;  3MF5 A;  3VAH A;  4PG6 A;  4IUF A;  1ZM3 A;  2JFK A;  4P9S A;  2OI2 A;  2GZO A;  5M2P A;  4C0O C;  3DKD A;  3K5L A;  3VWS A;  1NH7 A;  3I5B A;  2BA9 A;  1ZBT A;  1TL7 B;  4AE5 A;  2OHD A;  2BQU A;  2QX0 A;  1MMN A;  2XG8 A;  3A8K A;  3ZZ0 A;  1JX4 A;  2V8V A;  1N34 F;  2B51 A;  3QPI A;  3IG1 B;  3LO3 A;  3HZG A;  2ZC4 A;  2NRE A;  3SXL A;  2AYE A;  3KFW X;  3TNV A;  1M90 T;  4O4R A; 
#chains in the Genus database with same CATH homology
 2ZWP A;  4K8R A;  3QFH A;  4NMX A;  3GCX P;  3CNQ P;  2ZWO A;  3T41 A;  3P5B P;  3WHI A;  2Z58 B;  2W2O P;  3A3O B;  3WIU A;  2QTW A;  3BPS P;  2Z56 B;  2W2P P;  3AFG A;  4YN3 B;  1SPB P;  3BGO P;  2E1P A;  2Z57 B;  3A3P B;  1ITP A;  2PMW A;  3VV2 B;  2Z2Y B;  2W2M P;  1V5I B;  3WIV A;  4JP8 A;  1R6V A;  3SQO P;  2Z30 B;  2W2Q P;  4OV6 A;  2Z2Z A;  3VHQ A;  3H42 A;  2W2N P;  3GCW P;  3CO0 P;  4NE9 C;  2XTJ P;  1SCJ B;  3A3N B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...