1V5IB

Crystal structure of serine protease inhibitor poia1 in complex with subtilisin bpn'
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
76
structure length
76
Chain Sequence
SAGKFIVIFKNDVSEDKIRETKDEVIAEGGTITNEYNMPGMKGFAGELTPQSLTKFQGLQGDLIDSIEEDHVAHAY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/protein binding
molecule keywords Subtilisin BPN'
publication title Crystal structure of serine protease inhibitor POIA1 in complex with subtilisin BPN'
rcsb
source organism Bacillus amyloliquefaciens
total genus 22
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2003-11-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.80 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Peptidase S8 propeptide/proteinase inhibitor I9 1v5iB00
4JP8A 4K8RA 3GCXP 2ZWPA 3SQOP 3WHIA 4NE9C 3WIUA 1SCJB 2W2MP 3BGOP 2Z2YB 3CNQP 3VHQA 2W2NP 2W2OP 2Z58B 3T41A 2ZWOA 3A3NB 3P5BP 2W2QP 3VV2B 2PMWA 3H42A 3GCWP 2Z56B 4YN3B 3AFGA 2QTWA 4OV6A 3WIVA 2Z30B 3A3PB 2XTJP 3CO0P 1ITPA 1V5IB 3BPSP 2Z57B 1R6VA 2E1PA 3A3OB 3QFHA 2W2PP 1SPBP 4NMXA 2Z2ZA
chains in the Genus database with same CATH superfamily
4I68A 4R0JA 3EYZA 4ZN3A 2EFQA 3EZUA 1WHWA 3MECA 3W3SA 4UOFA 2YH0A 5GMDA 3HVWA 4C8YA 3D1QA 4PG6A 4DUYJ 4PG5A 4CLLA 5J2MA 1U26A 2UXDF 3D0HE 1U8WA 5I3QA 2R7UA 2UUBF 1URNA 4U9RA 2CVIA 1WKLA 4R8UB 2DJWA 4WFAQ 3FMWA 1H6KX 4I69A 4JI2F 1VQKS 2C2DA 3HT0A 4IOBA 2OEJA 4C3LA 1N36J 3NBPB 1S1TB 1Y3JA 2ZH4A 5AXLA 4FXVA 3DOLB 3F56A 2VQFJ 2AGPA 2IVFB 1IBMF 5A8WA 1PYTA 6FD1A 4X4PA 3C6TB 3QGIA 3CCES 4RX6A 2V8VA 2BXJA 1SCJB 3SMZA 2E1AA 4C8OA 4FP9A 2X7IA 3VAJA 1R7IA 4MMOA 4J9VA 1YJRA 2ZM6J 2XMWA 3MMJA 4R25A 2POKA 3SSRA 3BBBA 3C6UB 4FF4A 5I42B 5KFSA 4ECTA 4PZVA 1A0OB 2MZTA 1W25A 2UXBF 1QSYA 4WK1A 1S6QB 1R0CB 1ZZFA 2JRSA 4IQMA 4NLYA 1H2UX 2M4MA 1WKKA 3CJ3A 1AT1B 4CO2A 5B0EA 4CO1A 2DNLA 3R8YA 4MTPA 4RW9B 2MPUA 2QLFB 4TY8B 2DBBA 4DLGA 4ZP7A 1M1KT 4J9MA 1IKWB 1V3RA 3D6FB 5HROB 1SPBP 1S6PB 2AV5A 3WQPA 3KG4A 1HD0A 1OQ6A 3K5NA 1YI2S 2J6SA 2PEHA 5B0CA 5M2RA 4N7TA 4C97A 1K1QA 2BOPA 3DHWC 3TQEA 5AT1B 4A8FA 3NL0A 1K47A 3CTRA 4R8UA 4KIAA 1OIAA 2UVRA 2GCFA 3PNIA 3TJAA 2X1GA 4DSLA 2GAHC 3P45B 4PKDB 4W4MA 1U0SA 3UD3P 3R7NB 3NBPA 1S1TA 1U45A 3DOLA 2LFVA 4V19J 1TKZB 4GO7X 1YJVA 1NDKA 2OELA 4N47A 2RH3A 1QLNA 3C6TA 4YB7A 4AQYJ 1T3OA 1YBUA 5EN1A 2MQMA 3T1HF 4WFXA 1IM6A 2C42A 3Q8QB 1S9EB 2HGMA 4ED5A 3T6BA 2HPUA 5F8LA 4J9NA 3G6ES 3C6UA 4LR8A 4ENOA 1UVIA 3PG9A 5I42A 1UZDA 1HNXF 4WP8A 3OLBA 2RE1A 4IR1A 5KFJA 3OJSA 1S6QA 2XZDB 2HK3A 1T95A 2VL1A 1VK3A 4RW9A 2R2UA 3G8QA 4TY8A 1HWLA 4DV1J 3ONQA 1T9XA 3FQKA 4BWMA 5E33A 1IKWA 4DUZF 5HROA 1S6PA 1IUJA 3IR7B 2E66A 2NUHA 3CD0A 1CSJA 4RLEA 4ZJOA 1HI0P 3KKFA 4DR4J 1HYSB 2C2EA 1UPPA 3FFIB 3LPEA 3HVAA 1SJ4P 3PHEA 3H5XA 4LFAJ 1VFJA 3FC9A 4FYDA 3RBXA 3AOAA 2YKMB 4CLUA 4LIRA 5MAOA 2QSFA 5F0UA 4OYIA 1RUSA 4MKAA 2CWKA 4IRDA 1UFWA 1TKZA 1NB7A 1Z4UA 3WC2A 3BJYA 4E8UA 2HQGA 4QZVB 4NLXA 1DHMA 2VU5A 5IC6B 1B64A 1UEKA 2VF3A 3HHLD 1FXLA 2IHR1 1S9EA 4QU6A 2PI5A 1C1BB 5DM6Q 1ZM2A 3KLHB 4K4XA 2RILA 4JI6F 3R6LB 4Q2MA 2VKZG 2YNGB 2XMMA 1F6TA 5L9XA 2AX1A 4RKUC 4DZDA 2DRAA 1T94A 2W8LA 1FI4A 1RDRA 3RB4A 4RW4B 2DEJA 1U1RA 3HJFA 4H4KC 2I38A 1JKHB 4ZITA 2E1MC 2W7OA 2E7XA 3I9ZA 3SV3A 2C3PA 3OL9A 2CPDA 1RWWB 2C1EB 1BGXT 1EJ7L 3DLBA 3AY0A 1PILA 2F7VA 3O2IA 3OJUA 5CA5A 1RABB 4UZCA 2HLUA 2KTQA 1WG1A 1HYSA 5M2PA 2DK2A 3H25A 3FFIA 3PEHA 4B3SF 2M0GB 3CC7S 1RI7A 2KYZA 1Q8KA 5EHHA 3HD1A 3PW0A 4QYRA 3W62A 2YH1A 2KU7A 2R7TA 2YKMA 4Y65A 4JI3J 3HDSA 3KDNA 5B0AA 1RHUB 1S57A 4J9OA 2CPHA 4EYHB 2C2ZB 2W7PA 3L7PA 3BO3A 1CULA 2XLJA 2VPXB 4UOGA 2ZDOA 5GADI 4RU2A 4IRCA 3KLGA 5AXNA 1C0UB 3K2YA 1FFSB 2ASJA 5KG4A 1WELA 3CUNA 1C1BA 1Q16B 4HR2A 4DCPB 1KDNA 1VRTB 5HJXA 4U7UK 4LJMA 5K9FA 3VVTA 4QWAA 4WFBQ 4DN9A 2YNGA 1FE0A 4F4WA 2F1FA 2PFDA 2LA6A 4OI2A 4RW4A 3FQLA 2KO1A 4LVNP 3EZOA 4LF9F 1JKHA 1LXJA 1PC5A 2E5GA 2VV5A 4DF8A 1S1XB 4M63A 2OFHX 3OPKA 1R8HA 4LSZB 3GJQB 3B4MA 3AJ2A 2AJQA 2ADBA 4AUKA 7FD1A 2FYXA 2AP6A 4USMA 2GVDB 2HHHJ 3P96A 2GO8A 1HBMB 3L7OA 4NRUA 2ZBCA 4DR6F 2CZ4A 1RU1A 1HMVB 3IXQA 1V5VA 2ZITA 2VQFF 3K7RA 3LO3A 2RF2A 2HZCA 3T9NA 5DDPC 1SC1B 3TUZC 2ZC3A 1K1SA 1JX4A 1GQEA 4DS5A 1FEEA 1F3VA 1LEOA 5H9EK 3PZPA 5LSRA 1UCNA 4OZLA 2LLZA 4KGKA 4PRFA 3RW7A 4EUVA 2IAJB 2W9CB 1UJ4A 1S12A 4IH5A 1VMBA 3MM6B 1JXEA 3HX9A 1C0UA 5ETOA 4ZPVR 3NNAA 3KYLA 2KT5A 4NOHA 4LRFA 4KQZA 4N5SA 2IRUA 2FJXA 5LJ3Y 1VRTA 1KVKA 1RA6A 1FD2A 5B7WA 4B3TJ 4TY9A 2DGWA 1H2TZ 4QQBA 4HYKA 3GR1A 4FYVB 4UY8T 1VQNS 4OZ3A 4Q8EA 4F36A 1U2CA 4FYYB 3TARA 1Y4ZB 4MIWA 4JI4J 4MK7A 2IBOA 2A2DA 3SEOA 1VQMS 4XK8C 2IM3A 3D1OA 5KG7A 1BUXA 3GJTB 3HF5A 1JJHA 1S1XA 4WXWA 3W9HA 5L1LA 4BC9A 2Z58B 2ZH3A 4M5NA 4EZ6A 4XTTA 5IS2A 4RBUA 2IJNA 5D3GA 2GVDA 4DSJA 5K20B 1HW9A 3BS9A 3UDVA 1HBMA 4EZ9A 1YG0A 3UN3A 2RVJA 3S8SA 1FF2A 3DC2A 1HMVA 3K0JA 2WVDA 2ALYB 1FFGB 4AQYF 2Y3YA 2EFNA 3FBBA 3K5OA 1CEZA 3EUNA 1PBAA 3NKYA 4C8KA 1KWMA 2KXNB 3VGSA 1RHMB 4UOHA 1JXLA 1KQFB 1RB0A 2YQ1A 5K8OA 2HFZA 2BJ3A 4DZ6A 2IAJA 3CIMA 2W4PA 3EVMA 3PYDA 3C16B 2BM0A 3MM6A 3DYAB 4CRJA 2R7XA 2W9BA 1R8CA 1H3DA 3QLHA 3SDEB 1FKPB 2M70A 3MD1A 3BKFA 3T5JA 5GAGI 1RBOB 3PIOQ 4ED7A 5ETKA 1EETB 1I5OB 2W01A 1AFIA 1NJZA 2OPPB 5B0DA 2GHVC 5KFRA 1YZ6A 3W1YC 2PA8D 1WF2A 1YGYA 2QJ3A 1FJGF 2L9NA 4LRCA 2XNRA 2CQ2A 2EVZA 2BRLA 4KE5A 1IR1A 4Q8FA 5U47A 1IWGA 2QLXA 4ZIVA 4LFAF 3PO4A 4JI5F 1HBNB 1TTHB 3ZZOA 3UN5A 2BVZA 4X4NA 5HMYA 5EWGA 5KAKA 3HSJA 2UVVA 2OMOA 3D2WA 1T02A 1V3SA 1GH8A 4I6WA 2Q1LA 2HRYA 2XZTB 4F3QA 4ZVGA 2JC0A 2VKRA 3QO9A 3THTA 1VOMA 5KT4A 3HCXA 4I2PB 5DJBA 4LRBA 4RNNA 2DTJA 2EW9A 4BDPA 4FS2A 1SKSA 4I67A 1B0PA 1AW0A 3GIMA 3AODA 5E0OA 2ZWOA 4RW7B 3C16A 4YDDB 4BWJA 1Q1KA 4V1Ak 1HNIA 3DYAA 3G96A 3JTPA 4G3IA 2IVMA 3OTEA 1YWXA 3N6NA 3SDEA 2HKEA 2CNLB 2FTRA 2HVHA 3GSDA 2LKZA 3U7JA 1FKPA 4EBEA 3NCPA 2F8MA 1BD6A 1EETA 2OPPA 4J9KA 2OSQA 1SJQA 3H4DA 2LXIA 1MMDA 2FLPA 2N82B 4OI0A 4K0KJ 3O8WA 1Q8BA 3M6VA 4MAKA 2UU9F 1RT4B 3R5CA 1XEZA 3THVA 4KPCA 2Z30B 1WEYA 3HHEA 4DV6J 2EC0A 1HHTP 2RDJA 2OO4A 2YY3A 3N9UC 1U47A 4KGVB 4DQIA 1VK8A 4LF8F 1SC4B 5DZ7A 2XMAA 3PKYA 4OZ2A 1XN9A 2W2MP 3GIIA 2UXCJ 4L6V3 2V6AA 2A2CA 3IBWA 3LP2B 1HBNA 1IBKF 3ADAC 1SI9A 2C3YA 1JLEB 3W8GA 1S6UA 1MG7A 2HFOA 3R2CJ 1OYDA 1XWLA 2HQFA 1JLFB 2I6WA 3GTYX 5F9NA 3QT5A 4WP9A 4LRDA 3CJSA 2ZWPA 3E51A 5DLFA 2ZUAA 4I2PA 3QIDA 3PO5A 1IWAA 2ZUGA 1P8GA 4LF6F 1C0TB 2D41A 5IWAJ 1W26A 1S7IA 3NCRA 3AOBA 3GLJA 2P6SA 4USJC 2HG4A 1KHWA 2M9KA 4JYAF 3HPOA 4RW7A 4DPYA 2ZKUA 1RK8A 3Q2SC 4DQRA 1WHYA 4B9UA 2AT1B 2YWWA 2WOMB 3HHDA 3O5TB 4F26A 5LSLA 5D0RA 4NXNF 3MEKA 2V4RA 2OTJS 3GILA 2AJ1A 1QAIA 2B43A 4M1KA 1P1TA 1YJUA 1T9WA 4LF5J 1RTHB 1X4EA 2RUGA 2AGQA 3W2WB 4BHQA 3QPIA 1R89A 3RUBL 2VB6A 1OMSA 3R3TA 4DV2J 2EWHA 1OY6A 1DRZA 1RT4A 1VRUB 5EGYA 2B9WA 4F4AA 2W7AA 3OFHA 3IM9A 2P2CB 2ZVIA 2VDIA 2AU0A 2RRBA 1ZA2B 3MCMA 3ZZUA 2DO0A 1G3OA 2W25A 1AB8A 4YP3A 2E5LJ 3LP2A 2G9OA 4HT7A 1JLEA 2LXFA 4GC7A 3HHNB 2J7UA 4JV0A 1SJ3P 3MCSA 1JLFA 4K8RA 1WTBA 1DLOB 4BC7A 3TUIC 5C24B 1O51A 4F4YA 4G65A 1BWVA 3DU5A 1GNKA 2AW0A 5J1NA 1YX2A 3VZIA 2DNNA 3VCDA 1C0TA 2MKJA 1FRXA 2L08A 3CCZA 4ZVOB 2LEPA 4RWWA 3GE9A 1EARA 4CDIA 1TELA 3KJQB 4PG7A 2ZH1A 2VG5B 1VLYA 2WOMA 3CCVS 3H59A 2XLIA 2AEMA 1BQMB 2FZCB 4GKKF 4ED8A 1F3FA 2ZKTA 3K8WA 3Q86A 1IJFB 2RS8A 2XMUA 2X3DA 1RTHA 3B4DA 3H40A 2D3O1 3DLGB 1UAWA 2G1DA 4K5RA 3W2WA 4OV1A 1ZTWA 1RZMA 1O5JA 3NGSA 3VQTA 1VRUA 1JNRB 5C2GA 4USIA 3BEGB 5KFAA 2PSZA 2WW8A 1O0PA 2FY8A 2JFDA 4CLKA 3IAM9 4C4WA 2C3OA 1FHTA 1CJVB 4X4OA 3JXOA 3ZNUA 5ETSA 4NCAA 1KLMB 4O23A 4IFYB 2D7SA 2ATLA 3MPWA 3OTOF 3NOGA 5D15A 2G0IA 1CC8A 1VQ4S 1MLAA 1NNDA 3JSBA 4FPIA 1U49A 4A8WA 2OD6A 1DLOA 3CEDA 1RJJA 3EZ5A 5C24A 1CQNA 2VDHA 2YWGA 5KG1A 3MOZA 1GMVA 1AYEA 3DRSB 1Q7YT 3A8IA 2YKAA 3PCOB 3JSYA 2RRAA 3UCUP 5K8PA 1JIHA 3UI3A 1NLKL 5A2QY 2XWXA 3R1HA 4B17A 3CJ2A 1OJ4A 2V0NA 3GJRB 2VG5A 3HZGA 3N5BA 1UVNA 2XWYA 2OI2A 4MH8A 4FS1A 4RBVA 1BQMA 1U2FA 4RW6B 3B6BA 4CWBA 2JDJA 2F5GA 3BDEA 3P49B 2IBKA 5B0BA 3PYGA 4DR3F 3MTJA 3LANA 3B78A 2OH2A 5J2QB 3DLGA 3TP2A 1YTYA 1MWQA 3B82A 4KH1B 2UV8A 4ES2A 3T5LA 2P9GA 4G1PA 1Q53A 2NZ4A 5F41A 4WZQA 2QGFB 1QDUB 4YHHJ 2R3VA 4LF4F 3L7UA 4XDDA 2BA9A 1WC6A 2K3KA 4G1IA 1T03B 1BQNB 1KLMA 4IFYA 4CLSA 3I32A 1PJ6A 3FCVA 2KVIA 3PX6A 5IQQA 4DLEA 1HNVB 4TQSA 1KLNA 3U27A 2CAJA 4OI6A 2XBPA 4AFFA 4Q5VA 2R4FA 3IP0A 3PR4A 5GMKa 3P3DA 3F44A 3SSQA 1OY8A 1XERA 4QWEA 3SXLA 2DNOA 3PKMA 1LWXA 3DRSA 4NZ0A 4F0HA 2GVZB 3NP5A 3ISZA 1S6OA 2WB4A 2PI4A 3ZFVA 4WBFA 1FK9B 1NM2A 3JTOA 3UW1A 3OTCA 2HQCA 3MEDB 1C4CA 1YDLA 4ID5B 3KK2B 3SQOP 4CM0A 3EXCX 2W4CA 4NYZA 1U1NA 3QAEA 4DL0C 3T41A 1NZAA 3AOCA 1C1CB 3HJVA 1RISA 3K58A 5DETA 2RRNA 1KFDA 2WVFA 2BKNA 4RW6A 3RB3A 1NJIT 4ZLPA 3V6KA 2GC8A 4Y2AA 4M5IA 3GJSB 1RAJA 2WW4A 5J2QA 3MM9B 2NXNA 2QV6A 4OJ3A 1QSLA 3AHPA 2M52A 2XZWA 2DIVA 2XEXA 3QGGA 4USHA 2FHJD 5K8MA 2HWIA 4F7VA 3NS7B 1IKXB 1UVJA 1X7VA 4KO0B 3MR5A 1ZS6A 5D78A 1T03A 1BQNA 2BANB 3G71S 4CYUB 4FVMA 2KFNA 3N0VA 1IBLJ 2OUGA 1X0FA 2NXUA 2WCXA 1HNVA 1GTHA 2MY8A 4ZHRB 1TAUA 2IDLA 2CWXA 2QL9B 1XIQA 3IWXA 1HQ2A 3W64A 1F1BB 5DDQC 1FFWB 1FKOB 1TL5A 1CG2A 3OFFA 4C0OC 3VHQA 4EFAC 4IOCQ 4LT6A 2NQPA 4JI7J 5MLCV 2GVZA 3M6UA 4U7CA 5C25B 4OQJA 2IJRA 5DGBA 4YR0A 3T1AA 1FK9A 3I6PA 3SBMA 2XY7A 2J0QD 4DR7J 1FTRA 2PC6A 1IQTA 3T9ZA 3QT6A 4ID5A 3KK2A 4P74A 3K17A 4DU7A 5IV3A 3CD6S 1C1CA 2AKWB 4TVAB 3NY0A 3C8YA 5ETVA 2V8HA 2KJVA 1J5EF 2MQOA 1WC0A 3Q23A 2CQBA 3MM9A 1SQFA 3ELHA 5B09A 3IR6B 3KK1B 2BJEA 3DLLQ 2FD2A 1FVQA 2BKPA 4DV5J 3WC0A 1IKVB 1J5OB 2OMLA 2WVEA 2F40A 1J2VA 1IKXA 2X3GA 4WU3A 2IMOA 3M7VA 3EJMA 4KO0A 3D6MB 2BANA 4CYUA 3OXFA 1XNQF 2Z57B 3JAMY 2VBWA 4RL1A 2MKSA 2P9CA 4ZHRA 4QPXA 1Q82T 4Q45A 1YBAA 3CDEA 2XB2D 3H7HB 4WF9Q 2CG4A 3RR8A 1M5PC 4B3RJ 3BN7A 1KSPA 4B3MJ 3BBFA 2HK2A 5C25A 3ZTQA 5FLXU 5E41A 2D69A 4DPUA 4KV8B 3TQ1A 1JJCB 4DL2A 5D6GA 3MOJB 3KUGA 1S0VA 2LP4A 2MKIA 1R3NA 2CPIA 1JWWA 3G86A 3KLIB 3NGTA 5BR8J 3J81j 2DCLA 2HRUA 1VDHA 3D3CJ 1FVSA 3HXMA 2E5IA 3W5XA 2NSBA 2IC3B 4R0EA 2HNDB 1QTMA 1WWHA 3A1YG 2Y1JA 4LF7J 1K73T 2MZJA 5KFVA 5DGAA 2HAFA 4DN0A 1S49A 2G2ZA 4X4VA 2ABYA 3GG0A 3SZ2A 3KK1A 2XM3A 3MEEB 4RNHA 3G8SA 2C2OB 3PRBA 4ATNA 5DDRC 2DH7A 2XYPB 3RYLA 1IKVA 3TVZA 5E3RA 1J5OA 3E01B 3EDQB 3IC1A 1VIOA 2OAUA 4DCOB 2XO7A 2XULA 1OWXA 1DZ5A 4NMLA 4EWTA 4QCLA 1RAIB 2RMLA 3KNGA 2H54B 4OHZA 4LMZA 4EGLA 2CQIA 3I5CA 5GAHU 3VWSA 1X5PA 3W5YA 2HHPA 3PEJA 4KPYA 3TAMB 3D1HA 1VJWA 1Y11A 2YTCA 4J5OA 4MJKA 2EPIA 1QAJA 1D1UA 4XPEA 3J7Z5 1URRA 2ZHBA 3KWMA 4PYDA 3NGDA 3C19A 2KB2A 1EAYC 3PXGa 1WHXA 5C7PA 5CHCB 3I82A 1FKAF 1WC3A 2C2RA 4KV8A 3RB6A 5A6PA 4IDKB 4HDGA 4IYQA 4N41A 2EI5A 4ZPDA 4OZNA 3CCMS 3KLIA 4NA2A 1YK9A 2AF6A 4B9VA 4OX9J 3LW5C 1R8AA 2VPYB 4X65F 1NZ8A 2P9EA 5T14A 1WEZA 2IC3A 1UFKA 2HNDA 2PT0A 1OPZA 7AT1B 4YHHF 1CBKA 3GV7B 1RBLA 1F5AA 5KFXA 3CCLS 5HL7Q 5E3AA 1X0PA 2PD1A 3NNHA 3G87A 2KKHA 3UDEA 2XMKA 2FJEB 4ZPCA 4OHYA 3MEEA 5B0GA 1OPIA 3K5MA 4BLGA 3MAQA 3Q8SB 1CJKB 1JK9B 3E01A 2BR0A 2GIQA 1ICEB 3KHHA 4A4JA 2M7SA 3EVWA 1RCXB 1KTQA 3M1VA 1VS3A 2Y0BB 4M5LA 2N4DA 3TAMA 4C3KA 4CLZA 2WSCC 3NMAA 1HQUB 4GKJJ 3MCNA 3M6WA 3KUEA 2K8GA 3HKZD 3VVUA 1WUUA 4KYZA 1TKXB 1XC9A 4XAKA 1K0VA 3HKWA 1U8SA 1TL4A 3BPDA 4C0HA 4IDKA 3NAIA 2EC2A 4ELVA 4FZVA 5IXUA 3G8TA 1ZH5A 4W92B 3SV4A 2F8HA 1JLGB 3NGUA 4LBHA 1KFSA 1R6VA 3CJKB 1XMBA 1GX6A 1DJ0A 1X4CA 3OD2A 2R8HA 2NLWA 4IKAA 4DL5A 4TU7A 3RW6A 3ISNC 1X4HA 2V9KA 1KOOA 1D9DA 1Y5IB 1IBLF 1TKTB 2M2BA 4Q2LA 2BW7A 3AQPA 4X4SA 3J81U 5DLGA 3THPA 1NPPA 4JI0J 2CYYA 4KBIA 1I94J 2LEBA 2KG0A 1A6LA 1YZ7A 4O0NA 9ATCB 1HBUB 1CJKA 5KFMA 5I3PA 2XHCA 3EPIA 2BOAA 1PJ5A 2NPIA 2HHVA 3D68A 3LF0A 1I51B 2W2QP 1S7HA 2VQEF 1WOPA 3FCHA 2VONA 2HWTA 2B8QA 1TL1B 2W4DA 3GPAA 1VQPS 5LM7E 3ET6B 2RB7A 3GFXA 1FJEB 4QWBA 3QT7A 4WFNQ 3MWBA 2OHDA 1FDDA 4DR7F 1ZAXA 1U02A 1HQUA 4J7CA 4Z37A 2JOQA 2RHSB 1N32J 1APSA 1UPMB 1SJ1A 2CJYB 4CH1A 3BGUA 3GV8B 4ZVUB 4QIWD 4ECSA 2DCUB 1TKXA 4K7QA 2R8GA 1UP1A 5IFMA 3CGIA 4L72B 2BX6A 2CADA 2AJ2A 3M9MB 3UPFA 4TN2A 1SBRA 4DI6A 2KZMA 2DNZA 4HL9A 1JLGA 4DV4J 2BW2A 2DT9A 2NYHA 2DH9A 5KFEA 3CJKA 5IT9U 1NHVA 2YNIB 4C3MA 2V9WA 2VFVA 2UUBJ 2HHUA 5FDLB 1UFLA 2W2PP 3EICA 3N79A 3K8VA 1DFDA 3KFWX 4DQSA 2H48B 3RU0A 4JI2J 5D4NA 2CQPA 5HAOA 3RAMA 3MM7B 1RAEB 1RWUA 4KT0C 3CF5Q 5DQIA 2HNZB 1TKTA 2EG2A 4MYTA 4NXMF 2DO4A 1QUPA 1IBMJ 1NK7A 5D4LA 1H74A 1EZZB 1KRPA 1AUDA 1HBUA 2XMTA 2W9AA 1QVFR 2J9EA 4Q7AA 2QA1A 4UUXA 1TUVA 4NLUA 4MYUA 4RO0A 2DHAA 1LFPA 3MXHP 1TL1A 3DU6A 4A8MP 3ET6A 4O3SA 4GO5X 1HI1A 2UXBJ 2CRLA 4YFUA 5L1KA 4Y00A 1Q8LA 5BR8F 1EB0A 2RDDA 2X1AA 4QR0A 2XS2A 2BE2B 2KVQE 2GIRA 3Q8PB 2ZDPA 1Q81T 2GGPB 1H73A 1X8DA 2YPZA 2DYAA 1S4EA 4LF7F 1UWBB 1NDPA 2J9DA 3KG0A 1GAOA 2OPRB 2V2KA 1PCAA 4ZPTR 2E7WA 2YX4A 1RXOB 1VQ9S 2HZVA 1RKIA 5LMNF 1FXRA 3DDIA 5L39A 3R1LA 3BREA 2YNIA 2QA4S 1I6JA 5KFFA 2FJDB 5FDLA 1WJ9A 1VQ8S 3V2UC 2I9SA 1TFWA 5D0EA 3I56S 4ED4A 3QYYA 2F9DA 1VC6A 3R7SB 4ETXA 2VZ9A 2YKQA 1VQ7S 5F8IA 2MSTA 4HLBA 3MM7A 4I4BA 1FWLA 2HNZA 3BQ1A 1RA7A 1YJTA 4JI8F 3PDNA 4FBTA 4WWSA 5KG2A 1WDTA 5KT3A 1BY9A 3FZBA 3T1HJ 1D8YA 4NWBA 1N4LA 4NLSA 3RGIA 1WG4A 4J9LA 2QT7A 3RTVA 2JNJA 3TVKA 2XQCA 2H4WB 2QN6B 1FRHA 3T19A 5C42A 1FD8A 2NSCA 4Y3CA 4ZKAA 1GX5A 1HNXJ 4UZBA 2CPEA 2RJZA 1RADB 3I0SB 3QZ8A 3HD2A 2DHXA 3RG6A 2J0WA 2DISA 2KHDA 1XMQF 2BE2A 2G0CA 5C2CA 1YJ9S 2EFPA 1RP5A 1DY3A 3NXZA 1YJWS 2V63A 2GGPA 3BGLA 1NKEA 2DRBA 2F4VF 4LREA 4F04B 1UWBA 4DUZJ 4J9RA 5KOWA 3HM9A 1UW4A 2OPRA 2ZJPQ 4URSA 2E5JA 1S0NA 3TAPA 3MEGB 1G4CA 4H54A 4QBUA 2M8DB 2HHWA 3Q24A 5CQGA 5ITHA 3RBDA 1N8RT 1RT7B 1NK0A 3G9CA 3J7YI 2NUUG 4Y0FA 4YY3F 1FCAA 3DDKA 5LXYA 2RUSA 3R7BB 5KG5A 2AEJA 1S9GB 2DXEA 2IJFA 3CIZA 1LV5A 2GQ2A 4UQTA 4YOEA 2V4QA 5HLFB 4RUAA 2N3OA 5DO2A 2OSRA 4X4QA 1RWMB 2C28A 4NLVA 2F8EX 3HHLC 4O44B 5DZ6A 1KONA 4PEOA 1F2GA 4F3MA 2MKCA 1SL0A 4KHPF 3IO1A 3PY8A 2CJKA 4JI6J 2DGOA 2CQHA 2BKOA 1HI8A 1XR5A 3ZTOA 3I0SA 1UVLA 4DL6A 4N8OA 1Z1ZA 1SIZA 4I0WA 2VFTA 3D3BJ 1SKRA 3QBCA 2ZD1B 1WOOA 2MY7A 3J7ZT 3OHAA 1WD6A 5BYQA 2LMIA 3PRDA 5KT5A 3A13A 4NLOA 4KHMA 2GO9A 2R7SA 3MEGA 1SH0A 3GIKA 2UUTA 3EMTA 2FIUA 3MUVP 4C11B 4PXBA 2K2PA 4B3SJ 4DR5F 1L5UA 1NEEA 2CJ9A 1RT7A 2MLYA 4X4UA 4A47A 4F0MA 2B9YA 3VGTA 4PXEA 3PACA 1QM9A 3M8YA 2FJAB 1VQYA 1TAQA 1S9GA 2QMUB 2HAIA 4ZVSB 2E1RA 4DG1B 4F02A 4JV5J 3H5SA 4UY85 5HLFA 3L9ZA 3OW2R 1H0HB 3S01A 1M1GA 3MAHA 6FDRA 3IBCB 3UD5A 3VZHA 5IC4B 5ETTA 3G82B 1RTZA 3VGUA 3Q8UA 3FRZA 4O44A 2YKNB 2C3UA 3LPYA 1HQEB 2DRDA 4DX7A 2HBYB 4QR2A 4ECVA 2CJAA 5H9FJ 2DNPA 3DXBA 3N01A 4PUOB 1I1GA 3BSOA 3R5JB 3QATA 3AD7C 1DTQB 4I2QB 1TP7A 1N34F 4J9UE 2HVDA 3I9V9 3GP9A 2FB0A 1B0TA 1N6QB 2AEFA 1CQMA 4DV4F 1PBUA 1U1QA 1NK6A 1PJ7A 2ZD1A 4LF9J 4R5PB 1S1WB 1FXDA 2OTLS 2DR7A 4ZJQA 1B3TA 1MSWD 4MKVA 4OJHA 2OIHA 3HFVA 2MB0B 2D9OA 4DR1F 4MIBA 3OSPA 3QNWB 1TK5A 2XMJA 2AYGA 4M5HA 2BABA 3RAQA 2ACYA 3LAMA 4C11A 4DR6J 5FD1A 1GMWA 2UUWA 2DY9A 2JHEA 2PDAA 4ZVQB 1IR0A 2MQ8A 2FZGB 4AL6A 3K89A 4ED6A 4FYXB 4N56A 2XYHB 4OFZA 4EYIB 4CTAA 1FRKA 4QYZK 5CZVA 2UUCF 2E1CA 4PCQA 3BN4A 4QPTA 4DG1A 3LALA 3WX8A 3GFYA 2RD5C 1RU2A 5GAHI 2JVRA 2FHJA 2AYMA 2CNNB 1K8AT 1NSQA 4ERDA 1PG5B 2MJNA 3G82A 2B4VA 3N6LA 3DXSX 2PMZD 2YKNA 1HQEA 1S0MA 4PUOA 3ILOA 3K5PA 2C3MA 1NPRA 1QSSA 1DTQA 1T7PA 2YWKA 2N7YA 2QFJA 1UVMA 1N6QA 2D1CA 3MR3A 2VC0A 1E6YB 2DH8A 4TQRA 4EI2A 4ES1A 2DHHA 4R5PA 5A6WA 1S1WA 4QOTA 4F2RA 1F5BA 2QSWA 1REGX 2AJFE 3OBIA 1YVFA 1SL2A 1FTCA 3U1MA 4JI1F 2QYGA 3EGNA 1HNWJ 2WVBA 3C46A 3VGVA 4LQ9A 2QTWA 4FPRA 3DNCA 1B0VA 3R9LA 3VAFA 2DNMA 3BF4A 3JB9k 4ZLNA 4Q0BB 5CXTA 4WCEQ 3MD3A 4PG8A 4DV3F 5CAAA 3PW5A 3ILJA 1VIXA 2VHGA 3UNGC 4ILMA 2XNQA 1VC0A 2YNFB 1R6YA 4KKOB 1IN0A 5K8NA 2V94A 3IBFB 1RT1B 3TX8A 2VICA 2RQ4A 5A8KB 3FEYB 4DR2F 5SZTA 4OYMA 4AXIA 2UUAF 2R2RA 2IM2A 4K2JA 1F0XA 5ETRA 2JZ5A 5CYMB 3TEHB 1MNEA 2GMHA 3CC4S 4FKXA 3DKDA 1X4DA 4LFBF 2B6AB 3EWGA 1HW8A 2J76E 2BEFA 3TI0A 5I4MA 1FJGJ 4DPOA 1WF1A 4D3HA 4KHRA 3OL8A 2DGTA 1FWPA 2IRXA 3Q8RB 2D3UA 1E6YA 4K5SA 2GV1A 1VQSA 2H4YB 4OMFG 4P6QA 1SC3B 4JI5J 2Q3PA 5HQMA 2AZ1A 1PAUB 5JVHQ 4ANCA 4O4GB 5E5NA 5HVGA 3M2RB 4CLFA 3CB4A 4DFKA 1DTTB 2KN4A 2J9DE 1NU4A 1AA1B 2L48A 5FJ4A 1HIYA 4K59A 2Z2LA 4Q0BA 3UDCA 1VQ6S 4NLTA 1Q8IA 1KBRA 1X4FA 3OSNA 2CVEA 2RNEA 2XCAA 2QC3A 4TYAA 1P27B 4O3NA 2YNFA 2LCWA 4FYWB 4KKOA 3D9BA 5D0HA 4CNYA 2D9PA 1FX2A 3GCWP 2QMXA 4YUDA 1RT1A 5A8KA 1RE1B 2A0FB 3DGVA 2BRKA 1RHKB 2KT3A 2CPJA 1F9FA 3TOQA 3MMAB 4FXDA 3KNAA 1GTEA 1T3NA 2IRYA 4DU8A 3L4BC 3PJXA 4KY3A 2GMJA 5K14B 2AIRB 1KQSR 1B99A 5CYMA 4DL7A 2APOA 5EDWA 4U95A 4MKBA 3ITHB 3G2XA 3DRYA 2ILYA 3W2VB 2I0XA 4Y2IA 2B6AA 1VJQA 4C6AA 4QIFA 3PX4A 5EUHA 2UU9J 5LMUF 2AYEA 2FJWA 4QIVA 1G2EA 3FZ2A 2ZH5A 1RWKB 2A6MA 4OYWA 4LF8J 3D5MA 5DRKA 1HWIA 1KOHA 4ZVEA 5HJYA 4ZPAA 1ZM9A 4ED1A 1EKRA 3NEKA 4LR7A 3VAIA 4KFBB 4Y2MA 5DDOC 3FGVA 1IBKJ 2EG1A 1B7FA 1LW0B 4LUBA 1KR4A 3IRXB 4O4GA 3S1TA 2QO3A 3M2RA 4B9LA 2DIUA 3LAKA 3PW2A 3MDFA 3EPGA 3BGFA 4NPOA 1QAYA 1Y7PA 1DTTA 1S77D 2DHGA 2FVSA 1X31C 4JV5F 3Q22A 2GW8A 3F41A 4DSFA 4OHXA 2HBQB 3OXGA 5KT6A 4NCBA 2B8PA 1NSAA 4LF6J 3NCQA 4Y2KA 3D4JA 3AFGA 1A9NB 3GR0A 3L3CA 3K59A 4WFYA 4JYAJ 3BM7A 1M0SA 3KLHA 4J90A 4X62F 4WU2A 4EU0A 4U7UD 3CWJA 2COLA 3MM8B 3I31A 1RT3B 2L3MA 2R9LA 3KHRA 1KP6A 3M4XA 3MMAA 4TKTA 4NXNJ 4OI4A 1KVIA 2GS8A 4FBUA 1U0HB 5HQLA 2DNGA 1RT5B 5K14A 4GRSA 1D8ZA 3QGHA 1Y9OA 4Z7YA 3ITHA 3I5AA 3W2VA 1V9OA 1YRUA 3PX0A 1FX4A 3O6QA 2R2TA 2O01C 5KFOA 3VAHA 2FJVA 3PW4A 1H7XA 2VFUA 3CT9A 3D66A 3ZZYA 1V5IB 3GIRA 5GADU 2IA0A 2QX0A 3EE3A 1H98A 5IM0B 2BJ7A 4KFBA 2DNYA 1U6FA 2BJDA 3UD4P 2MQNA 1Y10A 1KEKA 1VYAA 1AUSL 3DLEB 1LW0A 1TQLA 4KGXB 3N4WA 3IRXA 1EX8A 4RUHA 2E1PA 3SCJE 4ZJLA 1REVB 4UUWA 2Y1LB 3LGNA 1P6TA 4HTIA 4TLQA 2VPWB 1AXQA 4Y2CA 2MKYA 4A8QA 2UVUA 2ZZMA 4K2XA 2DEIA 1QY7A 2EFOA 5IT4A 4WYLA 4CH7A 2CNOB 3GV5B 1JLAB 3OLAA 4G1QB 2HHTA 3C66A 5AE3A 3ENAA 3MM8A 2CQCA 1RT3A 4C9DA 1LWFB 2G1HA 2LDIA 4JBCA 1U0HA 4GKKJ 3CVKA 1N5YB 1NB2A 4RPFA 2U2FA 2HIQA 2CJXB 1JLQB 1RT5A 3CMAS 3PIPQ 1VLOA 4KSEB 4CM2A 2KXHA 2BYCA 1WI8A 2GJ2A 3HSZA 2OPSB 4WFZA 3A3PB 1AZSB 3DOMB 2HVZA 1HNWF 3V6DB 4ILRA 4U96A 2G2OA 1NH8A 1JMTA 1U24A 3MF5A 2LXUA 4USWA 1Q78A 1ZBTA 1WC5A 4QWCA 5L8RC 4AXJA 2ZEJA 5IM0A 3OUYB 1A7GE 2ZHOA 3PRVA 4YEAA 1L3TA 3BSCA 3OTOJ 4Z7CA 3DLEA 2HSEB 2CPXA 2CFXA 2OFGX 2G13A 4P2SA 3M8SA 4HVZA 1PIEA 1REVA 3V4MA 4PAAA 1LQ9A 5RUBA 2W9CA 1U48A 4F0KA 1SVDA 1YITS 1LXNA 2R8IA 3CDWA 4DQPA 4NYOA 4C0BA 2EK1A 2CZ9A 4I64A 1XNRF 2QMWA 2QIFA 2WSEC 4LBPA 1W7WA 2HWHA 2HFUA 1JLAA 1R8BA 4K4ZA 1G7CB 2CPZA 4G1QA 2AJ4A 4NLRA 2CQGA 3NLCA 3OVAA 1VISA 1NDLA 1R8PA 3RRKA 1MN9A 1LWFA 3GQCA 4PWDB 4HDHA 3OFGA 2ZOGA 1NJXA 1N5YA 3BB5A 1JLQA 2ASYA 4FF3A 2Z8QA 4CO0A 4DR3J 4RUBA 1Q7LB 4BBYA 2V69A 3DHXA 1YRXA 4M5DB 4HI2A 4X64F 2MZSA 4WPAA 2OPSA 1NO8A 1AZSA 4ZCMA 3DOMA 4NLDA 3V6DA 4LQ3A 4PQAA 2HZAA 3QJPA 4OJGA 4LF4J 1XMOF 2UZAA 3QWPA 4JUZA 2OEMA 2BJ8A 2AX0A 2IPOB 1B7YB 2VD3A 5F3TA 1TVRB 5F8GA 3OUYA 2VODA 4NX9A 4TLRA 2MLXA 4L3KA 1TU0B 5GMEA 2RQKA 2CA9A 2RHQB 5DM7Q 1S99A 1QUVA 5GAGU 2ADCA 4J91A 1O6XA 1RWXB 2XYGB 2Q79A 5D0GA 3MTKA 2FC8A 3P5TL 4P71A 3I4HX 3NAHA 3FVYA 4QW8A 4K4SA 2MSSA 4ZK7M 4UOCA 5C5JA 1QAXA 3TNVA 2Q6CA 2D3OR 2M88A 5GAEI 4KC5A 2KT2A 4TU8A 2HS3A 4PPZA 1UW9A 3RZAA 2HNYB 2XS5A 4ITSA 4KJIA 1EIYB 2SXLA 2Q43A 5D4PA 2ROPA 1NSKL 4AYBD 2HQ3A 3CD5A 1R43A 2R8JA 4DV0F 2YKOA 1T9VA 3PW7A 3BYPA 2O66A 4M5DA 2LQ8A 3JQKA 2ZH2A 3SIPB 2HURA 2Z0GA 4P73A 3RBEA 3KK3B 4Y6IA 2F9JA 1HNZF 1SUQB 4ES3A 4NLPA 4LSLB 5HMWA 4U8YA 2MGZB 4YB1P 4ED3A 2AQ4A 2V68A 4LFCF 1DBDA 2WTFA 1TVRA 2KRRA 1LWEB 2PIIA 3KG1A 4A46A 4B9MA 3CULA 1S1VB 5AJ3F 3W9JA 4RBTA 3H20A 4IO9Q 2DPIA 2IM1A 2J8SA 5A0YB 1SQGA 3UE2A 3RR7A 1SKWA 4ED2A 2JWNA 1FJCA 2OGUA 1W2BR 3PR5B 5JMNA 5HMXA 3TAQA 2O67A 2CG8A 3QGPA 4YS2A 4L75A 3V6HA 3GMGA 2Y1IA 1WDDA 4CLTA 2HQDA 5EX0A 3TW0A 4JV2A 2DNKA 2LDYA 3SI8A 2JEJA 4OHWA 2HNYA 4ZN1A 4BS2A 1PAEX 2VFSA 5GVQA 5FLXY 1J5EJ 4LIWA 2J8AA 3M30B 4A8OA 5SUHA 3OR2B 4RNOA 2DB1A 4C7QA 4LVOP 3GSIA 4DUTA 2KM8B 3ENWA 4DX8H 4CNZA 2VA3A 5JJBA 3H8YA 3ULHA 1RQ0A 2BJ1A 3GWCA 3KK3A 4B02A 1T8EA 1SUQA 2ZBQA 1R0BG 1PC4A 4O4RA 2MXYA 2B5JB 3BGOP 4LSLA 4CLPA 2MGZA 3DN9A 3GB0A 8RUCA 3FRYA 4DV7F 3QIPB 4B08A 1XNQJ 4DXLA 1LWEA 2MQQA 4NZ7A 1YIJS 3OT9A 4FKYA 1S1VA 4ZIWA 1NAQA 3LWLA 2BE9B 3DRXA 1L3SA 4ZOSA 2RAQA 5A0YA 5LSOA 4ZP9A 2BQ3A 3TRGA 5DG7A 2QA2A 1N5SA 1PSDA 3MMCB 2F65A 1T9YA 1U6BA 3D67A 3UR0A 1VGYA 1OSCA 2BMBA 3AD8C 4KTQA 1UL3A 3LUYA 1RHQB 2KRBA 3NS6A 1YJNS 1BC6A 1N33F 2ZOMA 3HFZB 2CPYA 2GFFA 4DFPA 4NEZA 4F3OA 3W63A 3BH6B 3M9NB 3CJQA 2DXFA 4IO1A 1XJWB 1GMUA 3OTBA 1ZAVA 3M30A 1FO1A 1U25A 3OR2A 2DGQA 3JYTB 5KFYA 1KQGB 4Q43A 4WKRA 1ZOTA 3UNYA 5KFUA 2RSQA 2CJBA 5CH7B 2CQ4A 2G2YA 3Q8YA 2GNKA 2B56A 3MFHA 5H1SV 3E3XA 2AD9A 2B5JA 3FJ2A 2RT3A 1XK8A 3QIPA 1F60B 3NWRA 2LA4A 4CCHA 3TEGA 5H9EJ 2N4CA 3FMBA 4ALZA 3EXYA 3KHLA 1XR7A 3MGJA 5BJRA 2IYIA 1N5TA 3LWMA 1S5ZA 4OZ0A 4OX7A 1U1LA 3VAKA 1EQ0A 3HSGA 2R2SA 5IT0A 1AFJA 2ZVSA 3QMQA 3MMCA 1B4SA 3QRPA 4ILLA 2PEBA 1V3ZA 3NWGA 5IZHA 4HH1A 3N6MA 1BWEA 3CJ4A 3D54A 4AT1B 2GJFA 2NPFA 5E3PA 4C98A 1F5CA 1VQLS 4GVLA 1PKUA 4X65J 3OTDA 5KFZA 4X84A 2M8HA 3S7RA 2QL5B 4A48A 1WOSA 4NCGB 3TJ8A 3IGVA 2N7CA 2GA7A 3DM2B 3FEZA 4XDCA 1HR0J 3ZZZA 3T5KA 2JLFA 2VOOA 4F2SA 1CULB 1CJVA 4DMZA 3M2VB 2ZNZA 4EBCA 1WORA 3JYTA 1HWUA 3M9OB 1WI6A 4J37A 3EDRB 4M8LA 2IMWP 2OPQB 3KLGB 1Q95G 3LGMA 1GXUA 2XY5A 3ENVA 3RAXA 1U1KA 4QR1A 1VBZA 2VBXA 5L38A 2H3EB 3HVRA 4JOUA 4KH0B 2ZBIA 4F4XA 2FHOB 2JEIA 2L9WA 3BQ2A 2HLTA 4LRAA 2RQCA 1WNEA 3UN2A 4XO0A 4A8SA 2P5VA 3OVSA 2JC1A 1FA0A 2ZH7A 1TUWA 5BYRA 3J81Y 3KJNB 2DNHA 3H0PA 1XQIA 4NASA 1T9TA 3MR7A 1NCLA 2I1RA 1LNQA 4PWUA 5KFGA 4LF2A 4NLWA 1KTVA 4OL8A 3HHLB 2XTJP 5ADZA 1FWKA 3FBCA 3I55S 2ZFHA 2U1AA 4HACB 4WZMA 1BXNA 1HWKA 5KFWA 4CLYA 2RF2B 1RTIB 4DPTA 1IQZA 3A3NB 3CCWA 2HIYA 1RLCL 2JEGA 4O3PA 2DGXA 1IJEB 4NCGA 3HT3A 1MROB 1NPKA 3DM2A 1UMJA 1SIWB 2LEAA 3MURP 3MPYA 5HO4A 3M2VA 2HFSA 3V6JA 4U67Q 1IVZA 3M8WA 3ZTSA 4AD6A 2OPQA 4W90B 5ETLA 2VG6B 2BUNA 3W8PA 2DHSA 4UF4A 2B4PA 4ETZA 1JXVA 1LK5A 3AH6A 2F4FA 5HVHA 3RRGA 2VFRA 4M5GA 5LL6d 5IT9Y 4A8KA 1ZYQA 1MWYA 3D6HB 4B3OB 2LYVA 1HWJA 2VPZB 2BE7D 2MJUA 2VJUA 2MMYA 3TX0A 2BV3A 4A8YA 2VQEJ 3WX4A 1CLFA 3MHYA 2IA6A 4TU9A 5B08A 2NXCA 4DUYF 1HD1A 2ZE2B 1FDBA 1OSDA 2L9DA 3MEDA 1X5TA 1KN6A 2C22A 5KFTA 3AQOA 1TR0A 4DJBA 1HBOB 4MKYA 2VIHA 1RHRB 2BZ2A 2WBRA 4JP8A 4WP3A 1TK0A 2LECA 4OX8A 3HHLA 5D3GB 3GFHA 1R0AB 2H1YA 4O0IA 1N36F 3R5GA 2D3ZA 4RWXA 4HH0A 2MQPA 2VC1A 4HACA 3J80U 1RTIA 4F25A 3CDUA 8ATCB 4ZMMA 3T6JA 1KHVA 3T3FA 2KFYA 1TMJA 5F8MA 2G0JA 4F67A 2UP1A 1WC1A 3DLJA 2KG1A 4KR0B 2ZM6F 2GX8A 3DDNA 1MROA 1UA1A 3TYTA 1N54B 5HQ8A 3MR6A 1ZPVA 4PXDA 4EK2A 3WBZA 1SKUB 1T11A 4RUCA 2EEYA 1UJ6A 1Q86T 2W9BB 2VG6A 3TUPA 3QLHB 1NH7A 3G6VA 4NXMJ 4PABA 2K1RB 3M32B 1TFYA 1RWVB 1NK8A 1LW2B 2HS4A 4OX6A 1NK4A 4AL7A 4B3OA 1FKOA 2VA2A 2YNHB 2Q66A 3LP0B 3MAAB 5IV4A 2JSXA 4RR5A 1YLXA 4WXOA 5CZXA 2VBZA 1M5VC 1MMNA 1JB0C 2AGOA 3WDOA 3P5BP 1N88A 4OYOA 1WF0A 1L3UA 2ZE2A 2EBEA 3VQSA 1CS4B 3Q8VA 2DKOB 2B7CB 1M5KC 2H5IB 3IWNC 4ECRA 5CD4A 2XC9A 1HBOA 3ZZ0A 1S9FA 4YDXA 3PHTA 4J9SA 1N0UA 2JH3A 2YX1A 2Y8WA 2DNRA 3H2LA 3ZC4A 5JVGQ 3V81B 4URGA 2R7VA 1R0AA 4C48A 4I1TA 2D74B 3ZXWA 2BM1A 2ACMA 1X4GA 3FSXA 3FBFA 1PGZA 3H42A 4OZJA 2YWFA 1SC6A 3NNCA 3QO9B 2A18A 2NS1B 3W5ZA 4ZDNA 8AT1B 1E6VB 3A3OB 3F73A 5LMNJ 5EWEA 4Q44A 3U1LA 2HFVA 2ZNYA 4EBDA 2GIFA 3VALA 1L3KA 3LOUA 1I3OB 3L09A 4PPDA 2DGSA 2VOPA 2DXDA 4NYPA 1Q5VA 4HHJA 3BR8A 3GYXB 2FGCA 1HNIB 2EK6A 3KLFB 3Q0AA 2P6TA 4AL5A 4DEZA 4JI8J 1P9QC 2DPJA 3A8JA 1JQGA 2K1RA 3M32A 2HHSA 3E8OA 1LW2A 2R7OA 4TYBA 3CMQA 3G6YA 4MFBB 1QD1A 1KD1T 4DV1F 2YNHA 3LP0A 3MAAA 4ZCLA 3QQCD 2ASLA 3JTNA 1M90T 3DLHA 4B9SA 1UTAA 4RNMA 4DR4F 1T0TV 1CS4A 3QFWA 2OP5A 1NSPA 3H5YA 1RCOB 4X66J 4QU7A 3V4IB 1U09A 3N5FA 1GEHA 4KRWA 3HULA 1XMQJ 4ELTA 1RGVA 2NYIA 1ULRA 1DQAA 2A6OA 3AA8A 3HI9A 1QJHA 4WYWA 3M05A 2H51B 2FGOA 2F4VJ 3V81A 3QWUA 3GZ7A 1HR0F 2AWZA 2CQ0A 5F8JA 2H65B 2OEKA 1M1HA 4NZ6A 3KJFB 2EFVA 3DCAA 1E6VA 1WSVA 3B54A 4LSNB 2IFXA 4P7TA 4OYAA 2HVIA 2J0XA 4DOZA 1Y3KA 4USTA 4F4ZA 1TKDA 1JJ4A 3FCWA 5F8NA 4YY3J 2V8GA 4ECXA 2K06A 4OYBA 1GFWB 4DS4A 3KLFA 3TA2A 3RRHA 4NMXA 2R7QA 3WIUA 2J5AA 4EO8A 4IR9A 3J7AN 3N28A 2GHWA 5KFPA 1XTZA 4WJBA 3W66A 1GXLA 4MFBA 1RWOB 3T1YJ 2HRTA 4IH7A 5A76A 2VJVA 1U1MA 4KHPJ 1SJRA 1WHVA 1NDCA 1BHNA 4ZP8A 2BQRA 2H5JB 2PA3A 4Y28C 4C8ZA 4W98A 3FDSA 1ZZNA 3AB2B 1Y5LB 1OYEA 3PVXA 3E2EA 4CO5A 3V4IA 2B4OA 2E5HA 3HK2A 4ZVFA 4PG4A 3VR1A 4U8VA 1ROFA 4ELUA 4K50A 2E9ZA 1RACB 2XI2A 3DI6B 1ZTTA 4JI3F 3R5AA 2CQDA 1WACA 2ZOFA 4URQU 4OZ5A 4DQQA 3CO9A 3FSYA 2MDAA 1X4AA 1QTNB 1HFEL 1SV5B 4P2MA 1VC5A 2ZZTA 2LU2A 2LQBA 4DX5A 4RZRA 1NJYA 4LSNA 1TK8A 4DR5J 2E44A 3TR5A 1FDNA 2A1BA 4N77A 1WEXA 3BH7B 1YBTA 2IY5B 3PJWA 5HANA 4X4RA 2H5EA 1RAFB 5CABA 3ZZRA 2PFFB 3BO4A 4E98A 4ZLLA 2E29A 3W9IA 4N8NA 2HFNA 1S4FA 3BQ0A 2MHNA 2MTLA 3UWTA 2I8EA 1DURA 3X3UA 4ECYA 4USKA 2IVYA 3ILIA 2VH7A 5D77A 4ECQA 5F8HA 1U4BA 2V2VA 3KMSA 2Y8YA 1UEVA 3NS5A 4C8MA 1HA1A 4IRKA 3BYRA 4XPCA 3QT8A 2ZZNA 1NBEB 2HHHF 4UQGA 4Z2XA 3DRRB 2FZKB 4ZA1A 2JX2A 1N34J 1VR6A 3OL7A 5KG0A 2KM8C 2E9TA 5T41A 2IIHA 2R7RA 1FRIA 5JXSA 3IRWP 1U2RA 3TWZA 5KFBA 3OL6A 3AT1B 5EWFA 3DI6A 2DR8A 1NHKL 4E0DA 2X1BA 4DR1J 4CIOA 3PJ9A 4FDFA 1SV5A 1UEUA 3I0RB 1EQMA 2HGLA 3VV2B 4DWIA 2JLEA 4ZVPB 4UT4A 4C2MA 2G4BA 4F50A 4NRTA 1RYSA 2DNQA 4LBIA 2M5YA 1G1XA 4FF1A 4M5JA 5KFKA 1ELOA 1H2VZ 4K4UA 1G6BA 4EEYA 5BYSA 1YKWA 4B3TF 4KGZB 3NRBA 2UUCJ 2V50A 3MMBB 4O3RA 3EM1A 3LA0A 4JI4F 4IFVB 2QRRA 2ZBRA 6AT1B 3Q89A 4IG3B 2KL8A 2HS0A 2EBGA 4QW9A 1KKHA 3CPWR 3SFUA 3TJ9A 1UA0A 2HVEA 2LQJA 4EO6A 2RS2A 3DRRA 2BACA 1H7WA 1UWAA 2BQUA 4KAIA 1S97A 5CYJA 1LFWA 1DAXA 3IMQJ 1SXLA 1TL3B 4ZPWR 4DDFA 2J7WA 3OV7A 3HO1A 3ETMA 5JUMA 2JVOA 4HHUA 3OVBA 3BV8A 3P8BB 3IR5B 5E7OB 3ETOA 3TUJC 3KLVA 2XMVA 3LH2S 2WAQD 1FRJA 2XHWA 5FIIA 1HARA 2AMCB 2BBEA 3GYNA 3O3LA 4JI1J 4QWDA 1YJ7A 3P6YC 3GG1A 3MM5B 3TA0A 3I0RA 2B9XA 3ZTPA 3B8HA 2YWHA 2YPYA 2QLJB 2CQ3A 2IDEA 2CXEA 4FNHA 4AE5A 4DV3J 3MZIA 3S6EA 2GHPA 5F0WA 3HHKA 1N5QA 3JSRA 3POTB 3MMBA 1S72S 2KDOA 2Y0SD 3AB4B 2V5HG 5CD4H 4I6YA 2Z2ZA 4ANDA 3M8RA 4DFMA 2YXLA 3SCLE 2DVIA 4DR2J 4IFVA 5G0RB 4CQ1A 4DSIA 4X66F 2Z4PA 7FDRA 2OLWA 2O5DA 2UUAJ 4IG3A 1RKJA 2ROGA 1M5SA 4O3OA 4TNOA 3G6XA 4K4TA 3I4PA 4WTYA 2MEWA 1JNZB 5HATA 5DS7A 3NMRA 1NHUA 1N56A 1RAAB 2IYGA 1VBXA 3D7SB 4LR9A 2RDIA 1GXTA 1HL6A 3PM9A 2NREA 3BKTA 4LFBJ 2V8DA 1MN7A 3W61A 3K57A 5AE2A 2GQCA 4OI3A 2PMHA 2RU3A 1TL3A 2PE8A 2NZCA 4USVA 5EX3A 5E2QA 3FEXB 1U6ZA 3BR9A 4HKQA 2QLBB 2C2KB 2K7KA 1F9EB 4CO3A 3Q83A 1D9AA 4O3QA 1RBAA 1N5VA 1SB6A 2QLWA 3M2UB 1CJUB 4WTOB 2JL9A 3MM5A 1N52B 3CO0P 1MW7A 2FJBB 1VHFA 3TZWA 5KT2A 3X1LB 3UR3C 2ZBPA 4DHVA 3FK4A 4Y34A 4KGMA 2JFKA 3T1YF 4RW8B 2KJWA 3QRRA 3WHIA 1GMWD 1RWPB 3DRPB 4K0KF 3POTA 1CJTB 1D3WA 3R2DJ 2W2OP 3W7BA 1RLDA 1SH3A 1D0EA 1FT8A 4DV6F 5HSPA 3AXMA 4ZVRB 1FNMA 5LOQA 3TO8A 1VQOS 5G0RA 3UCZP 3HSDA 4PXCA 3TANA 2UXCF 4IQXA 4ZS6A 3H4BA 2OJ3A 1ITPA 1U1OA 2CPFA 1AROP 1ZA1B 3OQ2A 3EVOA 4ANEA 2WZ1A 1JJ2R 3CW2C 3J7YU 1Z2LA 4FXWA 1MWZA 3KHGA 2KH9A 2V8PA 1KNZA 4M94A 5LMUJ 4S0MA 3BPSP 1X9SA 3O44A 1B70B 3QFHA 4GMKA 3IG1B 4K4VA 5THWA 1TL7B 4DFJA 3NGKA 4ECUA 3EGZA 3BSAA 2QFIA 5IWAF 4QIGA 4F4KA 4HTJA 3CD7A 2J7KA 2C2MB 3LP1B 2HEKA 3M2UA 1CJUA 2RIJA 3SSSA 4J9QA 2QYCA 2H9ZA 2ASDA 3MPUB 2MQLA 5KTQA 1VCTA 4NLQA 2KFZA 4P52A 5LXRA 3CJTA 2FVQA 1S79A 1UZHA 2WK4A 2GZOA 1K9MT 5L1JA 2FUG9 4B9NA 4WK3A 4LF5F 4L3NA 2RU9A 4RW8A 2HBRB 2CUYA 1T05B 5IQ6A 3DOKB 3DRPA 1CJTA 4DV2F 2VUGA 1LKZA 1WTFA 4FNIA 4X62J 3BSNA 3VAGA 5LT5A 4L73A 1C2PA 2MZ1A 2XS7A 1K0TA 1FJ7A 3EGVA 2XLKA 4I6AA 1X4BA 1VHIA 5G4DA 2V4JB 2NXEA 4MK8A 1KQKA 5AXMA 4ID8A 2E5LF 3P4UB 2NXJA 1OO0B 2AZ3A 3PFEA 4QIEA 4DL3A 3QSIA 2ERRA 1RT6B 2PMWA 3IM8A 5I3UB 2YQ0A 5F9LA 1NJWA 2CQ1A 3ZZPA 2FC9A 1DQ9A 4PQUB 2CDQA 3IG1A 4ZLJA 1TL7A 2MHEA 4E2FB 4FVCA 1MMLA 1P1LA 2ALZA 1V6HA 4LF1A 2GMLA 2M3DA 5HP1B 2WONB 3ZTRA 4YQWA 2GQQA 4IG0B 3LP1A 3IAS9 5E3QA 4HHHA 1HKAA 1NKCA 2CJQA 3ICLA 2GJIA 3QJJA 3G4SS 3NGRA 3GONA 1J27A 1K44A 3LQVA 3R97A 1X9MA 3F0NA 1TZ0A 1Q0NA 3AJDA 3CJRA 3A8KA 2DY1A 1X5OA 2Y9HA 1RAHB 4D3GA 3H98A 2I5JB 2DD8S 1T05A 2MZQA 3DOKA 3D28A 3GIJA 4NEYA 4CI0B 3MFIA 1JLBB 5CCMA 4NLGA 4P9SA 1NMEB 4I2QA 2FQQB 2FHMA 4U6PA 3CCRS 2W2NP 3H2VE 2LU1A 3TVYA 1SH2A 3CMES 5HMZA 2RKIB 2V4JA 1FDAA 3SCKE 1EP4B 3A12A 1MU2B 1VBKA 3D6TB 1PYOB 5KOXA 1IKYB 3LGHA 1GT8A 1N48A 3MPDA 3CC2S 3CE8A 3IFEA 4ZCKA 1RT6A 4KB7A 3M8QB 5I3UA 2MKHA 3HFKA 1RAGB 3RBZA 2CIMA 1ZETA 3DMJB 4WE1B 1HHSA 1NRKA 1JLCB 4DX6A 3CJ8A 3MPVA 2HMIB 4G6VB 1YHQS 4PQUA 1VRQC 4P7VA 5B0FA 4DF4A 3D0IE 3M1VB 3FUYA 3MUTP 2HHXA 2GAGC 5KFHA 4ECZA 5HP1A 2WONA 1Y5NB 4IG0A 5AE1A 2O1PA 5DQGA 5KFCA 3K5LA 4WKYA 3UQSA 4YB5A 3JQMA 3I96A 1FRLA 2A10A 5KG3A 3JQJA 1KS2A 2ZH9A 3MCOA 3U1NA 2YQ3A 5HBMB 1NK9A 4P75A 1VBYA 1NKBA 1XNRJ 2LQ5A 1RT2B 1S0OA 1VI7A 2I5JA 3C3LA 4OLPA 2EFGA 5HI7A 1Q4RA 2HGNA 4ZCIA 2XI3A 3CDAA 2E9RX 1N0VC 1JLBA 1CC7A 4CH0S 2NR0A 1TV6B 2A3JA 2F63A 4QJVA 1IM4A 3FBEA 3BO2A 1ZPWX 3HZEA 2RKIA 3KXDA 4YR2A 2XGQA 3I87A 1EP4A 1MU2A 3US5A 4ZP6A 4CO4A 2ZJQQ 5KFLA 1IKYA 2HQIA 3CCUS 4X64J 4I7FB 1QE1B 5A2QU 3M8QA 2J6UA 4RJVA 4ED0A 2ZHAA 3DMJA 4WE1A 5J1EB 1JLCA 3RJMB 2JLGA 2HMIA 3WZ0A 3OFEA 4CT8A 3KUHA 2Q6BA 1XMOJ 1EKSA 4H4OB 5H9FK 3MI7X 2ZC4A 3GYGA 2Z2YB 3HMJG 4GC6A 1UETA 5J2NB 4OV6A 4IUFA 1F9HA 2B0GA 1L3VA 1NUEA 1FRMA 2B7BB 3IS9B 3MUMP 4MK9A 3PFOA 1T9UA 4OIXA 3VTIA 3CSKA 2WB1D 3LTOA 3BBCA 2WVCA 4JV1A 2PN6A 2XGPA 3TZZA 1RAOA 5ETNA 5HBMA 4C8LA 5CCLA 1OQ3A 2XCPA 1YSJA 4MT1A 1RT2A 2LQ9A 3KJVB 3J7A1 4X4TA 4NA1A 4NI2B 1SL1A 4UW2A 5KG6A 4N76A 1TV6A 3PYFA 1BMQB 2CNKB 4P10A 2XG8A 3DFEA 2K3IA 5J2PB 2DITA 3ZZTA 5HVFA 4DV0J 3KDOA 4OI1A 3VF0B 2I2YA 4ZPBA 2AYBA 1R27B 4I7FA 1QE1A 2ZH6A 4XIUA 3IWLA 2RQMA 5DG8A 5J1EA 1RYRA 3QSYB 2DR6A 1HNZJ 3SQGB 3BKUA 4JI7F 1IR2A 5F3ZA 4H4OA 4X2BA 2JJ4D 2FDNA 3R27A 4HI1A 3QAUA 4LFCJ 2V2ZA 5J2NA 5M2UA 1WG5A 2V2QA 2V67A 1PO6A 1RTJB 3IS9A 5AJ3J 1LWCB 1ZM3A 3C2PA 1VQ5S 1ZM4A 3PV8A 3CXCR 3PYEA 3CCSS 5K5MA 1WKJA 5AXKA 2C2NA 4C8NA 5KFIA 4JB8B 2W8KA 2WHOA 4F8RA 1Y0HA 4DPXA 5L46A 2FLOA 4PWWA 4OLOA 5CYQB 5IOLA 2X1FA 3KJVA 1PYSB 3NG8A 2JEFA 1Q79A 4NI2A 2UXDJ 2Z56B 3UVJB 4DV5F 1YQHA 3MR2A 2ZJRQ 5A8RB 2KI2A 4H4KA 4YMEA 4CLWA 2ZH8A 5ETPA 3HP6A 5E3CA 4K4WA 2QL7B 5L1IA 2XY6A 3KMQA 2B9EA 2FLLA 4OYZA 5J2PA 1GK8A 4CP5A 3I5BA 3CCTA 2FHKA 5T7LB 2FVRA 3H90A 2KYXA 5KFDA 3M8PB 1XBWA 1U1PA 1FERA 4B3RF 2VBYA 3SQGA 4B3MF 4L76A 4OJ1A 3EGWB 3UCGA 1R31A 1NK5A 1D9FA 5C42B 5LJ5Y 4P2FA 2R7WA 4DV7J 3GFZA 2ILZA 3DGPB 2F3JA 3M8ZA 3OXLA 2P8IA 1XR6A 2VG7B 1RTJA 1FNOA 2OD4A 1LWCA 2BDPA 4UTGA 3C14B 1M5OC 3A8EA 2J0SD 3AA9A 2PGCA 3FNNA 2CKWA 2L41A 1OY9A 1WC4A 4OYXA 3NOCA 4ICLB 1ZAWA 2FPHX 2XSFA 1TUGB 1DQ8A 3M6XA 5CYQA 3KTQA 1D09B 5ETMA 4HEA9 3SYZA 1BE4A 1CPZA 3JAMU 1RSCA 3R6GB 5J1PA 3CNQP 4OYPA 4H4MB 2YBVA 4YB6A 2EKNA 3UVJA 1Z2ZA 4K4YA 1KC8T 2MLZA 1RTDB 2HW3A 4DCJB 5A8RA 1IXKA 1FEHA 3Q2TC 1N33J 5KFNA 3T5HA 3UDLA 1YRTA 4WIIA 1HPZB 3HLUA 4PYAA 2DGVA 4FF2A 4DL4A 1H72C 4RNFA 5L9NA 3VAMA 2W1BA 2FVCA 3BDPA 3UFCX 5T7LA 2YWEA 1X60A 1QVGR 3KLEB 1F2HA 2YVSA 1S1UB 2CDRB 5DG9A 3M8PA 3TZYA 4ZVTB 5BXIA 3ILLA 5KFQA 3R5BA 1O8BA 3HVTB 4ZVHA 2EKYA 1BQXA 4IH6A 3CJ0A 2B3TB 3CCJS 2EXUA 2KHCA 3AD9C 4ECWA 4RU9A 4NE9C 3IA0A 1RWNB 4P2XA 3DGPA 3RB0A 1ACMB 3IN5A 2VG7A 1SJFA 2DR9A 4QYZJ 2B51A 4OX9F 3BGRB 3OR1B 2X51A 4A8XA 1S76D 5HK4A 1UVKA 2XSJB 1W2IA 3U02A 3C14A 3DLKB 3ENQA 3JS9A 3UO0A 2ROEA 1HHQA 2IM0A 3QJLA 3C15B 3ZO7A 4ICLA 1C4AA 3GCXP 3D0GE 4M5MA 2MKKA 2YKPA 3GU0A 4OHVA 4NA3A 4H4MA 2K7JA 3AAWB 2R42A 4CZCA 4I56A 2OKQA 2HHQA 1RTDA 3QRQA 4ER8A 4CT9A 3H5UA 3L95X 4J9PA 3W60A 4WIQA 3V5RA 1HPZA 2N3LA 3JSMB 3CDBA 1WSRA 2LVWA 2QA4G 1SQEA 2J6TA 4M95A 9RUBA 3CCQS 3W65A 3KLEA 4YN3B 3WIVA 1S1UA 4EMDA 1X5SA 1U7LA 4L74A 2XO6A 4GKJF 2ATCB 5KT7A 3QZ7A 3TZXA 1S48A 3HVTA 1M5HA 1S10A 2NCKL 4P72A 4GVBB 4FN5A 2WRMA 3H2UB 2CZVC 5ETQA 1UKUA 1FESA 1IBCB 3MECB 4OZ1A 1EHWA 2QE5A 4USUA 4DBQA 3OHBA 4DSKA 4HT5A 3R5DA 1FNXH 3BGRA 3OR1A 5DQHA 2UVWA 4B9TA 2FLNA 2DR5A 3AXKA 2E7VA 2QZ8A 2XSJA 2R8KA 2B4UA 5D4OA 5J2MB 2AHOB 2MZRA 3DLKA 2KZZA 2UV8G 3IGNA 4YR3A 1H38A 4BCAA 3SCIE 3BZQA 2PO4A 1BLUA 3A4TA 3ISND 3C15A 1S59A 1Q5YA 5D8HB 2Y1RI 2FY1A 3AJ1A 4MIAA 3EX7B 4PWDA 1TMMA 1FE4A 2BJ9A 3SFGA 3ZNJ1 4NL5A 2AJ0A 2WSFC 1LK7A 3PTWA 1UJ5A 4TXSA 3FSIA 5HN0A 5A8WB 2MYFA 1HLWA 4JI0F 1I94F 1NXIA 1KVJA 2VASA 2QEXS 4IOAQ 1X9WA 4CTAB 2FVPA 4DPWA 1RHJB 1Y00A 3JSMA 4DSEA 1DARA 2HYIB 1CVJA 3CJ5A 1OS5A 2YX7A 2WBMA 1P9YA 3J80Y 4PR6A 3TA1A 2O3DA 2Z2MA 4V19X 3FKBA 1LOUA 2V34A 2QG9B 2W24A 3O1LA 1N32F 2J9CA 3KOAA 2DGUA 4GVBA 4M5KA 2HBZB 2KXFA 5GAEU
chains in the Genus database with same CATH topology
4JP8A 4K8RA 3GCXP 2ZWPA 3SQOP 3WHIA 4NE9C 3WIUA 1SCJB 2W2MP 3BGOP 2Z2YB 3CNQP 3VHQA 2W2NP 2W2OP 2Z58B 3T41A 2ZWOA 3A3NB 3P5BP 2W2QP 3VV2B 2PMWA 3H42A 3GCWP 2Z56B 4YN3B 3AFGA 2QTWA 4OV6A 3WIVA 2Z30B 3A3PB 2XTJP 3CO0P 1ITPA 1V5IB 3BPSP 2Z57B 1R6VA 2E1PA 3A3OB 3QFHA 2W2PP 1SPBP 4NMXA 2Z2ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JP8 A;  4K8R A;  3GCX P;  2ZWP A;  3SQO P;  3WHI A;  4NE9 C;  3WIU A;  1SCJ B;  2W2M P;  3BGO P;  2Z2Y B;  3CNQ P;  3VHQ A;  2W2N P;  2W2O P;  2Z58 B;  3T41 A;  2ZWO A;  3A3N B;  3P5B P;  2W2Q P;  3VV2 B;  2PMW A;  3H42 A;  3GCW P;  2Z56 B;  4YN3 B;  3AFG A;  2QTW A;  4OV6 A;  3WIV A;  2Z30 B;  3A3P B;  2XTJ P;  3CO0 P;  1ITP A;  1V5I B;  3BPS P;  2Z57 B;  1R6V A;  2E1P A;  3A3O B;  3QFH A;  2W2P P;  1SPB P;  4NMX A;  2Z2Z A; 
#chains in the Genus database with same CATH topology
 4I68 A;  4R0J A;  3EYZ A;  4ZN3 A;  2EFQ A;  3EZU A;  1WHW A;  3MEC A;  3W3S A;  4UOF A;  2YH0 A;  5GMD A;  3HVW A;  4C8Y A;  3D1Q A;  4PG6 A;  4DUY J;  4PG5 A;  4CLL A;  5J2M A;  1U26 A;  2UXD F;  3D0H E;  1U8W A;  5I3Q A;  2R7U A;  2UUB F;  1URN A;  4U9R A;  2CVI A;  1WKL A;  4R8U B;  2DJW A;  4WFA Q;  3FMW A;  1H6K X;  4I69 A;  4JI2 F;  1VQK S;  2C2D A;  3HT0 A;  4IOB A;  2OEJ A;  4C3L A;  1N36 J;  3NBP B;  1S1T B;  1Y3J A;  2ZH4 A;  5AXL A;  4FXV A;  3DOL B;  3F56 A;  2VQF J;  2AGP A;  2IVF B;  1IBM F;  5A8W A;  1PYT A;  6FD1 A;  4X4P A;  3C6T B;  3QGI A;  3CCE S;  4RX6 A;  2V8V A;  2BXJ A;  1SCJ B;  3SMZ A;  2E1A A;  4C8O A;  4FP9 A;  2X7I A;  3VAJ A;  1R7I A;  4MMO A;  4J9V A;  1YJR A;  2ZM6 J;  2XMW A;  3MMJ A;  4R25 A;  2POK A;  3SSR A;  3BBB A;  3C6U B;  4FF4 A;  5I42 B;  5KFS A;  4ECT A;  4PZV A;  1A0O B;  2MZT A;  1W25 A;  2UXB F;  1QSY A;  4WK1 A;  1S6Q B;  1R0C B;  1ZZF A;  2JRS A;  4IQM A;  4NLY A;  1H2U X;  2M4M A;  1WKK A;  3CJ3 A;  1AT1 B;  4CO2 A;  5B0E A;  4CO1 A;  2DNL A;  3R8Y A;  4MTP A;  4RW9 B;  2MPU A;  2QLF B;  4TY8 B;  2DBB A;  4DLG A;  4ZP7 A;  1M1K T;  4J9M A;  1IKW B;  1V3R A;  3D6F B;  5HRO B;  1SPB P;  1S6P B;  2AV5 A;  3WQP A;  3KG4 A;  1HD0 A;  1OQ6 A;  3K5N A;  1YI2 S;  2J6S A;  2PEH A;  5B0C A;  5M2R A;  4N7T A;  4C97 A;  1K1Q A;  2BOP A;  3DHW C;  3TQE A;  5AT1 B;  4A8F A;  3NL0 A;  1K47 A;  3CTR A;  4R8U A;  4KIA A;  1OIA A;  2UVR A;  2GCF A;  3PNI A;  3TJA A;  2X1G A;  4DSL A;  2GAH C;  3P45 B;  4PKD B;  4W4M A;  1U0S A;  3UD3 P;  3R7N B;  3NBP A;  1S1T A;  1U45 A;  3DOL A;  2LFV A;  4V19 J;  1TKZ B;  4GO7 X;  1YJV A;  1NDK A;  2OEL A;  4N47 A;  2RH3 A;  1QLN A;  3C6T A;  4YB7 A;  4AQY J;  1T3O A;  1YBU A;  5EN1 A;  2MQM A;  3T1H F;  4WFX A;  1IM6 A;  2C42 A;  3Q8Q B;  1S9E B;  2HGM A;  4ED5 A;  3T6B A;  2HPU A;  5F8L A;  4J9N A;  3G6E S;  3C6U A;  4LR8 A;  4ENO A;  1UVI A;  3PG9 A;  5I42 A;  1UZD A;  1HNX F;  4WP8 A;  3OLB A;  2RE1 A;  4IR1 A;  5KFJ A;  3OJS A;  1S6Q A;  2XZD B;  2HK3 A;  1T95 A;  2VL1 A;  1VK3 A;  4RW9 A;  2R2U A;  3G8Q A;  4TY8 A;  1HWL A;  4DV1 J;  3ONQ A;  1T9X A;  3FQK A;  4BWM A;  5E33 A;  1IKW A;  4DUZ F;  5HRO A;  1S6P A;  1IUJ A;  3IR7 B;  2E66 A;  2NUH A;  3CD0 A;  1CSJ A;  4RLE A;  4ZJO A;  1HI0 P;  3KKF A;  4DR4 J;  1HYS B;  2C2E A;  1UPP A;  3FFI B;  3LPE A;  3HVA A;  1SJ4 P;  3PHE A;  3H5X A;  4LFA J;  1VFJ A;  3FC9 A;  4FYD A;  3RBX A;  3AOA A;  2YKM B;  4CLU A;  4LIR A;  5MAO A;  2QSF A;  5F0U A;  4OYI A;  1RUS A;  4MKA A;  2CWK A;  4IRD A;  1UFW A;  1TKZ A;  1NB7 A;  1Z4U A;  3WC2 A;  3BJY A;  4E8U A;  2HQG A;  4QZV B;  4NLX A;  1DHM A;  2VU5 A;  5IC6 B;  1B64 A;  1UEK A;  2VF3 A;  3HHL D;  1FXL A;  2IHR 1;  1S9E A;  4QU6 A;  2PI5 A;  1C1B B;  5DM6 Q;  1ZM2 A;  3KLH B;  4K4X A;  2RIL A;  4JI6 F;  3R6L B;  4Q2M A;  2VKZ G;  2YNG B;  2XMM A;  1F6T A;  5L9X A;  2AX1 A;  4RKU C;  4DZD A;  2DRA A;  1T94 A;  2W8L A;  1FI4 A;  1RDR A;  3RB4 A;  4RW4 B;  2DEJ A;  1U1R A;  3HJF A;  4H4K C;  2I38 A;  1JKH B;  4ZIT A;  2E1M C;  2W7O A;  2E7X A;  3I9Z A;  3SV3 A;  2C3P A;  3OL9 A;  2CPD A;  1RWW B;  2C1E B;  1BGX T;  1EJ7 L;  3DLB A;  3AY0 A;  1PIL A;  2F7V A;  3O2I A;  3OJU A;  5CA5 A;  1RAB B;  4UZC A;  2HLU A;  2KTQ A;  1WG1 A;  1HYS A;  5M2P A;  2DK2 A;  3H25 A;  3FFI A;  3PEH A;  4B3S F;  2M0G B;  3CC7 S;  1RI7 A;  2KYZ A;  1Q8K A;  5EHH A;  3HD1 A;  3PW0 A;  4QYR A;  3W62 A;  2YH1 A;  2KU7 A;  2R7T A;  2YKM A;  4Y65 A;  4JI3 J;  3HDS A;  3KDN A;  5B0A A;  1RHU B;  1S57 A;  4J9O A;  2CPH A;  4EYH B;  2C2Z B;  2W7P A;  3L7P A;  3BO3 A;  1CUL A;  2XLJ A;  2VPX B;  4UOG A;  2ZDO A;  5GAD I;  4RU2 A;  4IRC A;  3KLG A;  5AXN A;  1C0U B;  3K2Y A;  1FFS B;  2ASJ A;  5KG4 A;  1WEL A;  3CUN A;  1C1B A;  1Q16 B;  4HR2 A;  4DCP B;  1KDN A;  1VRT B;  5HJX A;  4U7U K;  4LJM A;  5K9F A;  3VVT A;  4QWA A;  4WFB Q;  4DN9 A;  2YNG A;  1FE0 A;  4F4W A;  2F1F A;  2PFD A;  2LA6 A;  4OI2 A;  4RW4 A;  3FQL A;  2KO1 A;  4LVN P;  3EZO A;  4LF9 F;  1JKH A;  1LXJ A;  1PC5 A;  2E5G A;  2VV5 A;  4DF8 A;  1S1X B;  4M63 A;  2OFH X;  3OPK A;  1R8H A;  4LSZ B;  3GJQ B;  3B4M A;  3AJ2 A;  2AJQ A;  2ADB A;  4AUK A;  7FD1 A;  2FYX A;  2AP6 A;  4USM A;  2GVD B;  2HHH J;  3P96 A;  2GO8 A;  1HBM B;  3L7O A;  4NRU A;  2ZBC A;  4DR6 F;  2CZ4 A;  1RU1 A;  1HMV B;  3IXQ A;  1V5V A;  2ZIT A;  2VQF F;  3K7R A;  3LO3 A;  2RF2 A;  2HZC A;  3T9N A;  5DDP C;  1SC1 B;  3TUZ C;  2ZC3 A;  1K1S A;  1JX4 A;  1GQE A;  4DS5 A;  1FEE A;  1F3V A;  1LEO A;  5H9E K;  3PZP A;  5LSR A;  1UCN A;  4OZL A;  2LLZ A;  4KGK A;  4PRF A;  3RW7 A;  4EUV A;  2IAJ B;  2W9C B;  1UJ4 A;  1S12 A;  4IH5 A;  1VMB A;  3MM6 B;  1JXE A;  3HX9 A;  1C0U A;  5ETO A;  4ZPV R;  3NNA A;  3KYL A;  2KT5 A;  4NOH A;  4LRF A;  4KQZ A;  4N5S A;  2IRU A;  2FJX A;  5LJ3 Y;  1VRT A;  1KVK A;  1RA6 A;  1FD2 A;  5B7W A;  4B3T J;  4TY9 A;  2DGW A;  1H2T Z;  4QQB A;  4HYK A;  3GR1 A;  4FYV B;  4UY8 T;  1VQN S;  4OZ3 A;  4Q8E A;  4F36 A;  1U2C A;  4FYY B;  3TAR A;  1Y4Z B;  4MIW A;  4JI4 J;  4MK7 A;  2IBO A;  2A2D A;  3SEO A;  1VQM S;  4XK8 C;  2IM3 A;  3D1O A;  5KG7 A;  1BUX A;  3GJT B;  3HF5 A;  1JJH A;  1S1X A;  4WXW A;  3W9H A;  5L1L A;  4BC9 A;  2Z58 B;  2ZH3 A;  4M5N A;  4EZ6 A;  4XTT A;  5IS2 A;  4RBU A;  2IJN A;  5D3G A;  2GVD A;  4DSJ A;  5K20 B;  1HW9 A;  3BS9 A;  3UDV A;  1HBM A;  4EZ9 A;  1YG0 A;  3UN3 A;  2RVJ A;  3S8S A;  1FF2 A;  3DC2 A;  1HMV A;  3K0J A;  2WVD A;  2ALY B;  1FFG B;  4AQY F;  2Y3Y A;  2EFN A;  3FBB A;  3K5O A;  1CEZ A;  3EUN A;  1PBA A;  3NKY A;  4C8K A;  1KWM A;  2KXN B;  3VGS A;  1RHM B;  4UOH A;  1JXL A;  1KQF B;  1RB0 A;  2YQ1 A;  5K8O A;  2HFZ A;  2BJ3 A;  4DZ6 A;  2IAJ A;  3CIM A;  2W4P A;  3EVM A;  3PYD A;  3C16 B;  2BM0 A;  3MM6 A;  3DYA B;  4CRJ A;  2R7X A;  2W9B A;  1R8C A;  1H3D A;  3QLH A;  3SDE B;  1FKP B;  2M70 A;  3MD1 A;  3BKF A;  3T5J A;  5GAG I;  1RBO B;  3PIO Q;  4ED7 A;  5ETK A;  1EET B;  1I5O B;  2W01 A;  1AFI A;  1NJZ A;  2OPP B;  5B0D A;  2GHV C;  5KFR A;  1YZ6 A;  3W1Y C;  2PA8 D;  1WF2 A;  1YGY A;  2QJ3 A;  1FJG F;  2L9N A;  4LRC A;  2XNR A;  2CQ2 A;  2EVZ A;  2BRL A;  4KE5 A;  1IR1 A;  4Q8F A;  5U47 A;  1IWG A;  2QLX A;  4ZIV A;  4LFA F;  3PO4 A;  4JI5 F;  1HBN B;  1TTH B;  3ZZO A;  3UN5 A;  2BVZ A;  4X4N A;  5HMY A;  5EWG A;  5KAK A;  3HSJ A;  2UVV A;  2OMO A;  3D2W A;  1T02 A;  1V3S A;  1GH8 A;  4I6W A;  2Q1L A;  2HRY A;  2XZT B;  4F3Q A;  4ZVG A;  2JC0 A;  2VKR A;  3QO9 A;  3THT A;  1VOM A;  5KT4 A;  3HCX A;  4I2P B;  5DJB A;  4LRB A;  4RNN A;  2DTJ A;  2EW9 A;  4BDP A;  4FS2 A;  1SKS A;  4I67 A;  1B0P A;  1AW0 A;  3GIM A;  3AOD A;  5E0O A;  2ZWO A;  4RW7 B;  3C16 A;  4YDD B;  4BWJ A;  1Q1K A;  4V1A k;  1HNI A;  3DYA A;  3G96 A;  3JTP A;  4G3I A;  2IVM A;  3OTE A;  1YWX A;  3N6N A;  3SDE A;  2HKE A;  2CNL B;  2FTR A;  2HVH A;  3GSD A;  2LKZ A;  3U7J A;  1FKP A;  4EBE A;  3NCP A;  2F8M A;  1BD6 A;  1EET A;  2OPP A;  4J9K A;  2OSQ A;  1SJQ A;  3H4D A;  2LXI A;  1MMD A;  2FLP A;  2N82 B;  4OI0 A;  4K0K J;  3O8W A;  1Q8B A;  3M6V A;  4MAK A;  2UU9 F;  1RT4 B;  3R5C A;  1XEZ A;  3THV A;  4KPC A;  2Z30 B;  1WEY A;  3HHE A;  4DV6 J;  2EC0 A;  1HHT P;  2RDJ A;  2OO4 A;  2YY3 A;  3N9U C;  1U47 A;  4KGV B;  4DQI A;  1VK8 A;  4LF8 F;  1SC4 B;  5DZ7 A;  2XMA A;  3PKY A;  4OZ2 A;  1XN9 A;  2W2M P;  3GII A;  2UXC J;  4L6V 3;  2V6A A;  2A2C A;  3IBW A;  3LP2 B;  1HBN A;  1IBK F;  3ADA C;  1SI9 A;  2C3Y A;  1JLE B;  3W8G A;  1S6U A;  1MG7 A;  2HFO A;  3R2C J;  1OYD A;  1XWL A;  2HQF A;  1JLF B;  2I6W A;  3GTY X;  5F9N A;  3QT5 A;  4WP9 A;  4LRD A;  3CJS A;  2ZWP A;  3E51 A;  5DLF A;  2ZUA A;  4I2P A;  3QID A;  3PO5 A;  1IWA A;  2ZUG A;  1P8G A;  4LF6 F;  1C0T B;  2D41 A;  5IWA J;  1W26 A;  1S7I A;  3NCR A;  3AOB A;  3GLJ A;  2P6S A;  4USJ C;  2HG4 A;  1KHW A;  2M9K A;  4JYA F;  3HPO A;  4RW7 A;  4DPY A;  2ZKU A;  1RK8 A;  3Q2S C;  4DQR A;  1WHY A;  4B9U A;  2AT1 B;  2YWW A;  2WOM B;  3HHD A;  3O5T B;  4F26 A;  5LSL A;  5D0R A;  4NXN F;  3MEK A;  2V4R A;  2OTJ S;  3GIL A;  2AJ1 A;  1QAI A;  2B43 A;  4M1K A;  1P1T A;  1YJU A;  1T9W A;  4LF5 J;  1RTH B;  1X4E A;  2RUG A;  2AGQ A;  3W2W B;  4BHQ A;  3QPI A;  1R89 A;  3RUB L;  2VB6 A;  1OMS A;  3R3T A;  4DV2 J;  2EWH A;  1OY6 A;  1DRZ A;  1RT4 A;  1VRU B;  5EGY A;  2B9W A;  4F4A A;  2W7A A;  3OFH A;  3IM9 A;  2P2C B;  2ZVI A;  2VDI A;  2AU0 A;  2RRB A;  1ZA2 B;  3MCM A;  3ZZU A;  2DO0 A;  1G3O A;  2W25 A;  1AB8 A;  4YP3 A;  2E5L J;  3LP2 A;  2G9O A;  4HT7 A;  1JLE A;  2LXF A;  4GC7 A;  3HHN B;  2J7U A;  4JV0 A;  1SJ3 P;  3MCS A;  1JLF A;  4K8R A;  1WTB A;  1DLO B;  4BC7 A;  3TUI C;  5C24 B;  1O51 A;  4F4Y A;  4G65 A;  1BWV A;  3DU5 A;  1GNK A;  2AW0 A;  5J1N A;  1YX2 A;  3VZI A;  2DNN A;  3VCD A;  1C0T A;  2MKJ A;  1FRX A;  2L08 A;  3CCZ A;  4ZVO B;  2LEP A;  4RWW A;  3GE9 A;  1EAR A;  4CDI A;  1TEL A;  3KJQ B;  4PG7 A;  2ZH1 A;  2VG5 B;  1VLY A;  2WOM A;  3CCV S;  3H59 A;  2XLI A;  2AEM A;  1BQM B;  2FZC B;  4GKK F;  4ED8 A;  1F3F A;  2ZKT A;  3K8W A;  3Q86 A;  1IJF B;  2RS8 A;  2XMU A;  2X3D A;  1RTH A;  3B4D A;  3H40 A;  2D3O 1;  3DLG B;  1UAW A;  2G1D A;  4K5R A;  3W2W A;  4OV1 A;  1ZTW A;  1RZM A;  1O5J A;  3NGS A;  3VQT A;  1VRU A;  1JNR B;  5C2G A;  4USI A;  3BEG B;  5KFA A;  2PSZ A;  2WW8 A;  1O0P A;  2FY8 A;  2JFD A;  4CLK A;  3IAM 9;  4C4W A;  2C3O A;  1FHT A;  1CJV B;  4X4O A;  3JXO A;  3ZNU A;  5ETS A;  4NCA A;  1KLM B;  4O23 A;  4IFY B;  2D7S A;  2ATL A;  3MPW A;  3OTO F;  3NOG A;  5D15 A;  2G0I A;  1CC8 A;  1VQ4 S;  1MLA A;  1NND A;  3JSB A;  4FPI A;  1U49 A;  4A8W A;  2OD6 A;  1DLO A;  3CED A;  1RJJ A;  3EZ5 A;  5C24 A;  1CQN A;  2VDH A;  2YWG A;  5KG1 A;  3MOZ A;  1GMV A;  1AYE A;  3DRS B;  1Q7Y T;  3A8I A;  2YKA A;  3PCO B;  3JSY A;  2RRA A;  3UCU P;  5K8P A;  1JIH A;  3UI3 A;  1NLK L;  5A2Q Y;  2XWX A;  3R1H A;  4B17 A;  3CJ2 A;  1OJ4 A;  2V0N A;  3GJR B;  2VG5 A;  3HZG A;  3N5B A;  1UVN A;  2XWY A;  2OI2 A;  4MH8 A;  4FS1 A;  4RBV A;  1BQM A;  1U2F A;  4RW6 B;  3B6B A;  4CWB A;  2JDJ A;  2F5G A;  3BDE A;  3P49 B;  2IBK A;  5B0B A;  3PYG A;  4DR3 F;  3MTJ A;  3LAN A;  3B78 A;  2OH2 A;  5J2Q B;  3DLG A;  3TP2 A;  1YTY A;  1MWQ A;  3B82 A;  4KH1 B;  2UV8 A;  4ES2 A;  3T5L A;  2P9G A;  4G1P A;  1Q53 A;  2NZ4 A;  5F41 A;  4WZQ A;  2QGF B;  1QDU B;  4YHH J;  2R3V A;  4LF4 F;  3L7U A;  4XDD A;  2BA9 A;  1WC6 A;  2K3K A;  4G1I A;  1T03 B;  1BQN B;  1KLM A;  4IFY A;  4CLS A;  3I32 A;  1PJ6 A;  3FCV A;  2KVI A;  3PX6 A;  5IQQ A;  4DLE A;  1HNV B;  4TQS A;  1KLN A;  3U27 A;  2CAJ A;  4OI6 A;  2XBP A;  4AFF A;  4Q5V A;  2R4F A;  3IP0 A;  3PR4 A;  5GMK a;  3P3D A;  3F44 A;  3SSQ A;  1OY8 A;  1XER A;  4QWE A;  3SXL A;  2DNO A;  3PKM A;  1LWX A;  3DRS A;  4NZ0 A;  4F0H A;  2GVZ B;  3NP5 A;  3ISZ A;  1S6O A;  2WB4 A;  2PI4 A;  3ZFV A;  4WBF A;  1FK9 B;  1NM2 A;  3JTO A;  3UW1 A;  3OTC A;  2HQC A;  3MED B;  1C4C A;  1YDL A;  4ID5 B;  3KK2 B;  3SQO P;  4CM0 A;  3EXC X;  2W4C A;  4NYZ A;  1U1N A;  3QAE A;  4DL0 C;  3T41 A;  1NZA A;  3AOC A;  1C1C B;  3HJV A;  1RIS A;  3K58 A;  5DET A;  2RRN A;  1KFD A;  2WVF A;  2BKN A;  4RW6 A;  3RB3 A;  1NJI T;  4ZLP A;  3V6K A;  2GC8 A;  4Y2A A;  4M5I A;  3GJS B;  1RAJ A;  2WW4 A;  5J2Q A;  3MM9 B;  2NXN A;  2QV6 A;  4OJ3 A;  1QSL A;  3AHP A;  2M52 A;  2XZW A;  2DIV A;  2XEX A;  3QGG A;  4USH A;  2FHJ D;  5K8M A;  2HWI A;  4F7V A;  3NS7 B;  1IKX B;  1UVJ A;  1X7V A;  4KO0 B;  3MR5 A;  1ZS6 A;  5D78 A;  1T03 A;  1BQN A;  2BAN B;  3G71 S;  4CYU B;  4FVM A;  2KFN A;  3N0V A;  1IBL J;  2OUG A;  1X0F A;  2NXU A;  2WCX A;  1HNV A;  1GTH A;  2MY8 A;  4ZHR B;  1TAU A;  2IDL A;  2CWX A;  2QL9 B;  1XIQ A;  3IWX A;  1HQ2 A;  3W64 A;  1F1B B;  5DDQ C;  1FFW B;  1FKO B;  1TL5 A;  1CG2 A;  3OFF A;  4C0O C;  3VHQ A;  4EFA C;  4IOC Q;  4LT6 A;  2NQP A;  4JI7 J;  5MLC V;  2GVZ A;  3M6U A;  4U7C A;  5C25 B;  4OQJ A;  2IJR A;  5DGB A;  4YR0 A;  3T1A A;  1FK9 A;  3I6P A;  3SBM A;  2XY7 A;  2J0Q D;  4DR7 J;  1FTR A;  2PC6 A;  1IQT A;  3T9Z A;  3QT6 A;  4ID5 A;  3KK2 A;  4P74 A;  3K17 A;  4DU7 A;  5IV3 A;  3CD6 S;  1C1C A;  2AKW B;  4TVA B;  3NY0 A;  3C8Y A;  5ETV A;  2V8H A;  2KJV A;  1J5E F;  2MQO A;  1WC0 A;  3Q23 A;  2CQB A;  3MM9 A;  1SQF A;  3ELH A;  5B09 A;  3IR6 B;  3KK1 B;  2BJE A;  3DLL Q;  2FD2 A;  1FVQ A;  2BKP A;  4DV5 J;  3WC0 A;  1IKV B;  1J5O B;  2OML A;  2WVE A;  2F40 A;  1J2V A;  1IKX A;  2X3G A;  4WU3 A;  2IMO A;  3M7V A;  3EJM A;  4KO0 A;  3D6M B;  2BAN A;  4CYU A;  3OXF A;  1XNQ F;  2Z57 B;  3JAM Y;  2VBW A;  4RL1 A;  2MKS A;  2P9C A;  4ZHR A;  4QPX A;  1Q82 T;  4Q45 A;  1YBA A;  3CDE A;  2XB2 D;  3H7H B;  4WF9 Q;  2CG4 A;  3RR8 A;  1M5P C;  4B3R J;  3BN7 A;  1KSP A;  4B3M J;  3BBF A;  2HK2 A;  5C25 A;  3ZTQ A;  5FLX U;  5E41 A;  2D69 A;  4DPU A;  4KV8 B;  3TQ1 A;  1JJC B;  4DL2 A;  5D6G A;  3MOJ B;  3KUG A;  1S0V A;  2LP4 A;  2MKI A;  1R3N A;  2CPI A;  1JWW A;  3G86 A;  3KLI B;  3NGT A;  5BR8 J;  3J81 j;  2DCL A;  2HRU A;  1VDH A;  3D3C J;  1FVS A;  3HXM A;  2E5I A;  3W5X A;  2NSB A;  2IC3 B;  4R0E A;  2HND B;  1QTM A;  1WWH A;  3A1Y G;  2Y1J A;  4LF7 J;  1K73 T;  2MZJ A;  5KFV A;  5DGA A;  2HAF A;  4DN0 A;  1S49 A;  2G2Z A;  4X4V A;  2ABY A;  3GG0 A;  3SZ2 A;  3KK1 A;  2XM3 A;  3MEE B;  4RNH A;  3G8S A;  2C2O B;  3PRB A;  4ATN A;  5DDR C;  2DH7 A;  2XYP B;  3RYL A;  1IKV A;  3TVZ A;  5E3R A;  1J5O A;  3E01 B;  3EDQ B;  3IC1 A;  1VIO A;  2OAU A;  4DCO B;  2XO7 A;  2XUL A;  1OWX A;  1DZ5 A;  4NML A;  4EWT A;  4QCL A;  1RAI B;  2RML A;  3KNG A;  2H54 B;  4OHZ A;  4LMZ A;  4EGL A;  2CQI A;  3I5C A;  5GAH U;  3VWS A;  1X5P A;  3W5Y A;  2HHP A;  3PEJ A;  4KPY A;  3TAM B;  3D1H A;  1VJW A;  1Y11 A;  2YTC A;  4J5O A;  4MJK A;  2EPI A;  1QAJ A;  1D1U A;  4XPE A;  3J7Z 5;  1URR A;  2ZHB A;  3KWM A;  4PYD A;  3NGD A;  3C19 A;  2KB2 A;  1EAY C;  3PXG a;  1WHX A;  5C7P A;  5CHC B;  3I82 A;  1FKA F;  1WC3 A;  2C2R A;  4KV8 A;  3RB6 A;  5A6P A;  4IDK B;  4HDG A;  4IYQ A;  4N41 A;  2EI5 A;  4ZPD A;  4OZN A;  3CCM S;  3KLI A;  4NA2 A;  1YK9 A;  2AF6 A;  4B9V A;  4OX9 J;  3LW5 C;  1R8A A;  2VPY B;  4X65 F;  1NZ8 A;  2P9E A;  5T14 A;  1WEZ A;  2IC3 A;  1UFK A;  2HND A;  2PT0 A;  1OPZ A;  7AT1 B;  4YHH F;  1CBK A;  3GV7 B;  1RBL A;  1F5A A;  5KFX A;  3CCL S;  5HL7 Q;  5E3A A;  1X0P A;  2PD1 A;  3NNH A;  3G87 A;  2KKH A;  3UDE A;  2XMK A;  2FJE B;  4ZPC A;  4OHY A;  3MEE A;  5B0G A;  1OPI A;  3K5M A;  4BLG A;  3MAQ A;  3Q8S B;  1CJK B;  1JK9 B;  3E01 A;  2BR0 A;  2GIQ A;  1ICE B;  3KHH A;  4A4J A;  2M7S A;  3EVW A;  1RCX B;  1KTQ A;  3M1V A;  1VS3 A;  2Y0B B;  4M5L A;  2N4D A;  3TAM A;  4C3K A;  4CLZ A;  2WSC C;  3NMA A;  1HQU B;  4GKJ J;  3MCN A;  3M6W A;  3KUE A;  2K8G A;  3HKZ D;  3VVU A;  1WUU A;  4KYZ A;  1TKX B;  1XC9 A;  4XAK A;  1K0V A;  3HKW A;  1U8S A;  1TL4 A;  3BPD A;  4C0H A;  4IDK A;  3NAI A;  2EC2 A;  4ELV A;  4FZV A;  5IXU A;  3G8T A;  1ZH5 A;  4W92 B;  3SV4 A;  2F8H A;  1JLG B;  3NGU A;  4LBH A;  1KFS A;  1R6V A;  3CJK B;  1XMB A;  1GX6 A;  1DJ0 A;  1X4C A;  3OD2 A;  2R8H A;  2NLW A;  4IKA A;  4DL5 A;  4TU7 A;  3RW6 A;  3ISN C;  1X4H A;  2V9K A;  1KOO A;  1D9D A;  1Y5I B;  1IBL F;  1TKT B;  2M2B A;  4Q2L A;  2BW7 A;  3AQP A;  4X4S A;  3J81 U;  5DLG A;  3THP A;  1NPP A;  4JI0 J;  2CYY A;  4KBI A;  1I94 J;  2LEB A;  2KG0 A;  1A6L A;  1YZ7 A;  4O0N A;  9ATC B;  1HBU B;  1CJK A;  5KFM A;  5I3P A;  2XHC A;  3EPI A;  2BOA A;  1PJ5 A;  2NPI A;  2HHV A;  3D68 A;  3LF0 A;  1I51 B;  2W2Q P;  1S7H A;  2VQE F;  1WOP A;  3FCH A;  2VON A;  2HWT A;  2B8Q A;  1TL1 B;  2W4D A;  3GPA A;  1VQP S;  5LM7 E;  3ET6 B;  2RB7 A;  3GFX A;  1FJE B;  4QWB A;  3QT7 A;  4WFN Q;  3MWB A;  2OHD A;  1FDD A;  4DR7 F;  1ZAX A;  1U02 A;  1HQU A;  4J7C A;  4Z37 A;  2JOQ A;  2RHS B;  1N32 J;  1APS A;  1UPM B;  1SJ1 A;  2CJY B;  4CH1 A;  3BGU A;  3GV8 B;  4ZVU B;  4QIW D;  4ECS A;  2DCU B;  1TKX A;  4K7Q A;  2R8G A;  1UP1 A;  5IFM A;  3CGI A;  4L72 B;  2BX6 A;  2CAD A;  2AJ2 A;  3M9M B;  3UPF A;  4TN2 A;  1SBR A;  4DI6 A;  2KZM A;  2DNZ A;  4HL9 A;  1JLG A;  4DV4 J;  2BW2 A;  2DT9 A;  2NYH A;  2DH9 A;  5KFE A;  3CJK A;  5IT9 U;  1NHV A;  2YNI B;  4C3M A;  2V9W A;  2VFV A;  2UUB J;  2HHU A;  5FDL B;  1UFL A;  2W2P P;  3EIC A;  3N79 A;  3K8V A;  1DFD A;  3KFW X;  4DQS A;  2H48 B;  3RU0 A;  4JI2 J;  5D4N A;  2CQP A;  5HAO A;  3RAM A;  3MM7 B;  1RAE B;  1RWU A;  4KT0 C;  3CF5 Q;  5DQI A;  2HNZ B;  1TKT A;  2EG2 A;  4MYT A;  4NXM F;  2DO4 A;  1QUP A;  1IBM J;  1NK7 A;  5D4L A;  1H74 A;  1EZZ B;  1KRP A;  1AUD A;  1HBU A;  2XMT A;  2W9A A;  1QVF R;  2J9E A;  4Q7A A;  2QA1 A;  4UUX A;  1TUV A;  4NLU A;  4MYU A;  4RO0 A;  2DHA A;  1LFP A;  3MXH P;  1TL1 A;  3DU6 A;  4A8M P;  3ET6 A;  4O3S A;  4GO5 X;  1HI1 A;  2UXB J;  2CRL A;  4YFU A;  5L1K A;  4Y00 A;  1Q8L A;  5BR8 F;  1EB0 A;  2RDD A;  2X1A A;  4QR0 A;  2XS2 A;  2BE2 B;  2KVQ E;  2GIR A;  3Q8P B;  2ZDP A;  1Q81 T;  2GGP B;  1H73 A;  1X8D A;  2YPZ A;  2DYA A;  1S4E A;  4LF7 F;  1UWB B;  1NDP A;  2J9D A;  3KG0 A;  1GAO A;  2OPR B;  2V2K A;  1PCA A;  4ZPT R;  2E7W A;  2YX4 A;  1RXO B;  1VQ9 S;  2HZV A;  1RKI A;  5LMN F;  1FXR A;  3DDI A;  5L39 A;  3R1L A;  3BRE A;  2YNI A;  2QA4 S;  1I6J A;  5KFF A;  2FJD B;  5FDL A;  1WJ9 A;  1VQ8 S;  3V2U C;  2I9S A;  1TFW A;  5D0E A;  3I56 S;  4ED4 A;  3QYY A;  2F9D A;  1VC6 A;  3R7S B;  4ETX A;  2VZ9 A;  2YKQ A;  1VQ7 S;  5F8I A;  2MST A;  4HLB A;  3MM7 A;  4I4B A;  1FWL A;  2HNZ A;  3BQ1 A;  1RA7 A;  1YJT A;  4JI8 F;  3PDN A;  4FBT A;  4WWS A;  5KG2 A;  1WDT A;  5KT3 A;  1BY9 A;  3FZB A;  3T1H J;  1D8Y A;  4NWB A;  1N4L A;  4NLS A;  3RGI A;  1WG4 A;  4J9L A;  2QT7 A;  3RTV A;  2JNJ A;  3TVK A;  2XQC A;  2H4W B;  2QN6 B;  1FRH A;  3T19 A;  5C42 A;  1FD8 A;  2NSC A;  4Y3C A;  4ZKA A;  1GX5 A;  1HNX J;  4UZB A;  2CPE A;  2RJZ A;  1RAD B;  3I0S B;  3QZ8 A;  3HD2 A;  2DHX A;  3RG6 A;  2J0W A;  2DIS A;  2KHD A;  1XMQ F;  2BE2 A;  2G0C A;  5C2C A;  1YJ9 S;  2EFP A;  1RP5 A;  1DY3 A;  3NXZ A;  1YJW S;  2V63 A;  2GGP A;  3BGL A;  1NKE A;  2DRB A;  2F4V F;  4LRE A;  4F04 B;  1UWB A;  4DUZ J;  4J9R A;  5KOW A;  3HM9 A;  1UW4 A;  2OPR A;  2ZJP Q;  4URS A;  2E5J A;  1S0N A;  3TAP A;  3MEG B;  1G4C A;  4H54 A;  4QBU A;  2M8D B;  2HHW A;  3Q24 A;  5CQG A;  5ITH A;  3RBD A;  1N8R T;  1RT7 B;  1NK0 A;  3G9C A;  3J7Y I;  2NUU G;  4Y0F A;  4YY3 F;  1FCA A;  3DDK A;  5LXY A;  2RUS A;  3R7B B;  5KG5 A;  2AEJ A;  1S9G B;  2DXE A;  2IJF A;  3CIZ A;  1LV5 A;  2GQ2 A;  4UQT A;  4YOE A;  2V4Q A;  5HLF B;  4RUA A;  2N3O A;  5DO2 A;  2OSR A;  4X4Q A;  1RWM B;  2C28 A;  4NLV A;  2F8E X;  3HHL C;  4O44 B;  5DZ6 A;  1KON A;  4PEO A;  1F2G A;  4F3M A;  2MKC A;  1SL0 A;  4KHP F;  3IO1 A;  3PY8 A;  2CJK A;  4JI6 J;  2DGO A;  2CQH A;  2BKO A;  1HI8 A;  1XR5 A;  3ZTO A;  3I0S A;  1UVL A;  4DL6 A;  4N8O A;  1Z1Z A;  1SIZ A;  4I0W A;  2VFT A;  3D3B J;  1SKR A;  3QBC A;  2ZD1 B;  1WOO A;  2MY7 A;  3J7Z T;  3OHA A;  1WD6 A;  5BYQ A;  2LMI A;  3PRD A;  5KT5 A;  3A13 A;  4NLO A;  4KHM A;  2GO9 A;  2R7S A;  3MEG A;  1SH0 A;  3GIK A;  2UUT A;  3EMT A;  2FIU A;  3MUV P;  4C11 B;  4PXB A;  2K2P A;  4B3S J;  4DR5 F;  1L5U A;  1NEE A;  2CJ9 A;  1RT7 A;  2MLY A;  4X4U A;  4A47 A;  4F0M A;  2B9Y A;  3VGT A;  4PXE A;  3PAC A;  1QM9 A;  3M8Y A;  2FJA B;  1VQY A;  1TAQ A;  1S9G A;  2QMU B;  2HAI A;  4ZVS B;  2E1R A;  4DG1 B;  4F02 A;  4JV5 J;  3H5S A;  4UY8 5;  5HLF A;  3L9Z A;  3OW2 R;  1H0H B;  3S01 A;  1M1G A;  3MAH A;  6FDR A;  3IBC B;  3UD5 A;  3VZH A;  5IC4 B;  5ETT A;  3G82 B;  1RTZ A;  3VGU A;  3Q8U A;  3FRZ A;  4O44 A;  2YKN B;  2C3U A;  3LPY A;  1HQE B;  2DRD A;  4DX7 A;  2HBY B;  4QR2 A;  4ECV A;  2CJA A;  5H9F J;  2DNP A;  3DXB A;  3N01 A;  4PUO B;  1I1G A;  3BSO A;  3R5J B;  3QAT A;  3AD7 C;  1DTQ B;  4I2Q B;  1TP7 A;  1N34 F;  4J9U E;  2HVD A;  3I9V 9;  3GP9 A;  2FB0 A;  1B0T A;  1N6Q B;  2AEF A;  1CQM A;  4DV4 F;  1PBU A;  1U1Q A;  1NK6 A;  1PJ7 A;  2ZD1 A;  4LF9 J;  4R5P B;  1S1W B;  1FXD A;  2OTL S;  2DR7 A;  4ZJQ A;  1B3T A;  1MSW D;  4MKV A;  4OJH A;  2OIH A;  3HFV A;  2MB0 B;  2D9O A;  4DR1 F;  4MIB A;  3OSP A;  3QNW B;  1TK5 A;  2XMJ A;  2AYG A;  4M5H A;  2BAB A;  3RAQ A;  2ACY A;  3LAM A;  4C11 A;  4DR6 J;  5FD1 A;  1GMW A;  2UUW A;  2DY9 A;  2JHE A;  2PDA A;  4ZVQ B;  1IR0 A;  2MQ8 A;  2FZG B;  4AL6 A;  3K89 A;  4ED6 A;  4FYX B;  4N56 A;  2XYH B;  4OFZ A;  4EYI B;  4CTA A;  1FRK A;  4QYZ K;  5CZV A;  2UUC F;  2E1C A;  4PCQ A;  3BN4 A;  4QPT A;  4DG1 A;  3LAL A;  3WX8 A;  3GFY A;  2RD5 C;  1RU2 A;  5GAH I;  2JVR A;  2FHJ A;  2AYM A;  2CNN B;  1K8A T;  1NSQ A;  4ERD A;  1PG5 B;  2MJN A;  3G82 A;  2B4V A;  3N6L A;  3DXS X;  2PMZ D;  2YKN A;  1HQE A;  1S0M A;  4PUO A;  3ILO A;  3K5P A;  2C3M A;  1NPR A;  1QSS A;  1DTQ A;  1T7P A;  2YWK A;  2N7Y A;  2QFJ A;  1UVM A;  1N6Q A;  2D1C A;  3MR3 A;  2VC0 A;  1E6Y B;  2DH8 A;  4TQR A;  4EI2 A;  4ES1 A;  2DHH A;  4R5P A;  5A6W A;  1S1W A;  4QOT A;  4F2R A;  1F5B A;  2QSW A;  1REG X;  2AJF E;  3OBI A;  1YVF A;  1SL2 A;  1FTC A;  3U1M A;  4JI1 F;  2QYG A;  3EGN A;  1HNW J;  2WVB A;  3C46 A;  3VGV A;  4LQ9 A;  2QTW A;  4FPR A;  3DNC A;  1B0V A;  3R9L A;  3VAF A;  2DNM A;  3BF4 A;  3JB9 k;  4ZLN A;  4Q0B B;  5CXT A;  4WCE Q;  3MD3 A;  4PG8 A;  4DV3 F;  5CAA A;  3PW5 A;  3ILJ A;  1VIX A;  2VHG A;  3UNG C;  4ILM A;  2XNQ A;  1VC0 A;  2YNF B;  1R6Y A;  4KKO B;  1IN0 A;  5K8N A;  2V94 A;  3IBF B;  1RT1 B;  3TX8 A;  2VIC A;  2RQ4 A;  5A8K B;  3FEY B;  4DR2 F;  5SZT A;  4OYM A;  4AXI A;  2UUA F;  2R2R A;  2IM2 A;  4K2J A;  1F0X A;  5ETR A;  2JZ5 A;  5CYM B;  3TEH B;  1MNE A;  2GMH A;  3CC4 S;  4FKX A;  3DKD A;  1X4D A;  4LFB F;  2B6A B;  3EWG A;  1HW8 A;  2J76 E;  2BEF A;  3TI0 A;  5I4M A;  1FJG J;  4DPO A;  1WF1 A;  4D3H A;  4KHR A;  3OL8 A;  2DGT A;  1FWP A;  2IRX A;  3Q8R B;  2D3U A;  1E6Y A;  4K5S A;  2GV1 A;  1VQS A;  2H4Y B;  4OMF G;  4P6Q A;  1SC3 B;  4JI5 J;  2Q3P A;  5HQM A;  2AZ1 A;  1PAU B;  5JVH Q;  4ANC A;  4O4G B;  5E5N A;  5HVG A;  3M2R B;  4CLF A;  3CB4 A;  4DFK A;  1DTT B;  2KN4 A;  2J9D E;  1NU4 A;  1AA1 B;  2L48 A;  5FJ4 A;  1HIY A;  4K59 A;  2Z2L A;  4Q0B A;  3UDC A;  1VQ6 S;  4NLT A;  1Q8I A;  1KBR A;  1X4F A;  3OSN A;  2CVE A;  2RNE A;  2XCA A;  2QC3 A;  4TYA A;  1P27 B;  4O3N A;  2YNF A;  2LCW A;  4FYW B;  4KKO A;  3D9B A;  5D0H A;  4CNY A;  2D9P A;  1FX2 A;  3GCW P;  2QMX A;  4YUD A;  1RT1 A;  5A8K A;  1RE1 B;  2A0F B;  3DGV A;  2BRK A;  1RHK B;  2KT3 A;  2CPJ A;  1F9F A;  3TOQ A;  3MMA B;  4FXD A;  3KNA A;  1GTE A;  1T3N A;  2IRY A;  4DU8 A;  3L4B C;  3PJX A;  4KY3 A;  2GMJ A;  5K14 B;  2AIR B;  1KQS R;  1B99 A;  5CYM A;  4DL7 A;  2APO A;  5EDW A;  4U95 A;  4MKB A;  3ITH B;  3G2X A;  3DRY A;  2ILY A;  3W2V B;  2I0X A;  4Y2I A;  2B6A A;  1VJQ A;  4C6A A;  4QIF A;  3PX4 A;  5EUH A;  2UU9 J;  5LMU F;  2AYE A;  2FJW A;  4QIV A;  1G2E A;  3FZ2 A;  2ZH5 A;  1RWK B;  2A6M A;  4OYW A;  4LF8 J;  3D5M A;  5DRK A;  1HWI A;  1KOH A;  4ZVE A;  5HJY A;  4ZPA A;  1ZM9 A;  4ED1 A;  1EKR A;  3NEK A;  4LR7 A;  3VAI A;  4KFB B;  4Y2M A;  5DDO C;  3FGV A;  1IBK J;  2EG1 A;  1B7F A;  1LW0 B;  4LUB A;  1KR4 A;  3IRX B;  4O4G A;  3S1T A;  2QO3 A;  3M2R A;  4B9L A;  2DIU A;  3LAK A;  3PW2 A;  3MDF A;  3EPG A;  3BGF A;  4NPO A;  1QAY A;  1Y7P A;  1DTT A;  1S77 D;  2DHG A;  2FVS A;  1X31 C;  4JV5 F;  3Q22 A;  2GW8 A;  3F41 A;  4DSF A;  4OHX A;  2HBQ B;  3OXG A;  5KT6 A;  4NCB A;  2B8P A;  1NSA A;  4LF6 J;  3NCQ A;  4Y2K A;  3D4J A;  3AFG A;  1A9N B;  3GR0 A;  3L3C A;  3K59 A;  4WFY A;  4JYA J;  3BM7 A;  1M0S A;  3KLH A;  4J90 A;  4X62 F;  4WU2 A;  4EU0 A;  4U7U D;  3CWJ A;  2COL A;  3MM8 B;  3I31 A;  1RT3 B;  2L3M A;  2R9L A;  3KHR A;  1KP6 A;  3M4X A;  3MMA A;  4TKT A;  4NXN J;  4OI4 A;  1KVI A;  2GS8 A;  4FBU A;  1U0H B;  5HQL A;  2DNG A;  1RT5 B;  5K14 A;  4GRS A;  1D8Z A;  3QGH A;  1Y9O A;  4Z7Y A;  3ITH A;  3I5A A;  3W2V A;  1V9O A;  1YRU A;  3PX0 A;  1FX4 A;  3O6Q A;  2R2T A;  2O01 C;  5KFO A;  3VAH A;  2FJV A;  3PW4 A;  1H7X A;  2VFU A;  3CT9 A;  3D66 A;  3ZZY A;  1V5I B;  3GIR A;  5GAD U;  2IA0 A;  2QX0 A;  3EE3 A;  1H98 A;  5IM0 B;  2BJ7 A;  4KFB A;  2DNY A;  1U6F A;  2BJD A;  3UD4 P;  2MQN A;  1Y10 A;  1KEK A;  1VYA A;  1AUS L;  3DLE B;  1LW0 A;  1TQL A;  4KGX B;  3N4W A;  3IRX A;  1EX8 A;  4RUH A;  2E1P A;  3SCJ E;  4ZJL A;  1REV B;  4UUW A;  2Y1L B;  3LGN A;  1P6T A;  4HTI A;  4TLQ A;  2VPW B;  1AXQ A;  4Y2C A;  2MKY A;  4A8Q A;  2UVU A;  2ZZM A;  4K2X A;  2DEI A;  1QY7 A;  2EFO A;  5IT4 A;  4WYL A;  4CH7 A;  2CNO B;  3GV5 B;  1JLA B;  3OLA A;  4G1Q B;  2HHT A;  3C66 A;  5AE3 A;  3ENA A;  3MM8 A;  2CQC A;  1RT3 A;  4C9D A;  1LWF B;  2G1H A;  2LDI A;  4JBC A;  1U0H A;  4GKK J;  3CVK A;  1N5Y B;  1NB2 A;  4RPF A;  2U2F A;  2HIQ A;  2CJX B;  1JLQ B;  1RT5 A;  3CMA S;  3PIP Q;  1VLO A;  4KSE B;  4CM2 A;  2KXH A;  2BYC A;  1WI8 A;  2GJ2 A;  3HSZ A;  2OPS B;  4WFZ A;  3A3P B;  1AZS B;  3DOM B;  2HVZ A;  1HNW F;  3V6D B;  4ILR A;  4U96 A;  2G2O A;  1NH8 A;  1JMT A;  1U24 A;  3MF5 A;  2LXU A;  4USW A;  1Q78 A;  1ZBT A;  1WC5 A;  4QWC A;  5L8R C;  4AXJ A;  2ZEJ A;  5IM0 A;  3OUY B;  1A7G E;  2ZHO A;  3PRV A;  4YEA A;  1L3T A;  3BSC A;  3OTO J;  4Z7C A;  3DLE A;  2HSE B;  2CPX A;  2CFX A;  2OFG X;  2G13 A;  4P2S A;  3M8S A;  4HVZ A;  1PIE A;  1REV A;  3V4M A;  4PAA A;  1LQ9 A;  5RUB A;  2W9C A;  1U48 A;  4F0K A;  1SVD A;  1YIT S;  1LXN A;  2R8I A;  3CDW A;  4DQP A;  4NYO A;  4C0B A;  2EK1 A;  2CZ9 A;  4I64 A;  1XNR F;  2QMW A;  2QIF A;  2WSE C;  4LBP A;  1W7W A;  2HWH A;  2HFU A;  1JLA A;  1R8B A;  4K4Z A;  1G7C B;  2CPZ A;  4G1Q A;  2AJ4 A;  4NLR A;  2CQG A;  3NLC A;  3OVA A;  1VIS A;  1NDL A;  1R8P A;  3RRK A;  1MN9 A;  1LWF A;  3GQC A;  4PWD B;  4HDH A;  3OFG A;  2ZOG A;  1NJX A;  1N5Y A;  3BB5 A;  1JLQ A;  2ASY A;  4FF3 A;  2Z8Q A;  4CO0 A;  4DR3 J;  4RUB A;  1Q7L B;  4BBY A;  2V69 A;  3DHX A;  1YRX A;  4M5D B;  4HI2 A;  4X64 F;  2MZS A;  4WPA A;  2OPS A;  1NO8 A;  1AZS A;  4ZCM A;  3DOM A;  4NLD A;  3V6D A;  4LQ3 A;  4PQA A;  2HZA A;  3QJP A;  4OJG A;  4LF4 J;  1XMO F;  2UZA A;  3QWP A;  4JUZ A;  2OEM A;  2BJ8 A;  2AX0 A;  2IPO B;  1B7Y B;  2VD3 A;  5F3T A;  1TVR B;  5F8G A;  3OUY A;  2VOD A;  4NX9 A;  4TLR A;  2MLX A;  4L3K A;  1TU0 B;  5GME A;  2RQK A;  2CA9 A;  2RHQ B;  5DM7 Q;  1S99 A;  1QUV A;  5GAG U;  2ADC A;  4J91 A;  1O6X A;  1RWX B;  2XYG B;  2Q79 A;  5D0G A;  3MTK A;  2FC8 A;  3P5T L;  4P71 A;  3I4H X;  3NAH A;  3FVY A;  4QW8 A;  4K4S A;  2MSS A;  4ZK7 M;  4UOC A;  5C5J A;  1QAX A;  3TNV A;  2Q6C A;  2D3O R;  2M88 A;  5GAE I;  4KC5 A;  2KT2 A;  4TU8 A;  2HS3 A;  4PPZ A;  1UW9 A;  3RZA A;  2HNY B;  2XS5 A;  4ITS A;  4KJI A;  1EIY B;  2SXL A;  2Q43 A;  5D4P A;  2ROP A;  1NSK L;  4AYB D;  2HQ3 A;  3CD5 A;  1R43 A;  2R8J A;  4DV0 F;  2YKO A;  1T9V A;  3PW7 A;  3BYP A;  2O66 A;  4M5D A;  2LQ8 A;  3JQK A;  2ZH2 A;  3SIP B;  2HUR A;  2Z0G A;  4P73 A;  3RBE A;  3KK3 B;  4Y6I A;  2F9J A;  1HNZ F;  1SUQ B;  4ES3 A;  4NLP A;  4LSL B;  5HMW A;  4U8Y A;  2MGZ B;  4YB1 P;  4ED3 A;  2AQ4 A;  2V68 A;  4LFC F;  1DBD A;  2WTF A;  1TVR A;  2KRR A;  1LWE B;  2PII A;  3KG1 A;  4A46 A;  4B9M A;  3CUL A;  1S1V B;  5AJ3 F;  3W9J A;  4RBT A;  3H20 A;  4IO9 Q;  2DPI A;  2IM1 A;  2J8S A;  5A0Y B;  1SQG A;  3UE2 A;  3RR7 A;  1SKW A;  4ED2 A;  2JWN A;  1FJC A;  2OGU A;  1W2B R;  3PR5 B;  5JMN A;  5HMX A;  3TAQ A;  2O67 A;  2CG8 A;  3QGP A;  4YS2 A;  4L75 A;  3V6H A;  3GMG A;  2Y1I A;  1WDD A;  4CLT A;  2HQD A;  5EX0 A;  3TW0 A;  4JV2 A;  2DNK A;  2LDY A;  3SI8 A;  2JEJ A;  4OHW A;  2HNY A;  4ZN1 A;  4BS2 A;  1PAE X;  2VFS A;  5GVQ A;  5FLX Y;  1J5E J;  4LIW A;  2J8A A;  3M30 B;  4A8O A;  5SUH A;  3OR2 B;  4RNO A;  2DB1 A;  4C7Q A;  4LVO P;  3GSI A;  4DUT A;  2KM8 B;  3ENW A;  4DX8 H;  4CNZ A;  2VA3 A;  5JJB A;  3H8Y A;  3ULH A;  1RQ0 A;  2BJ1 A;  3GWC A;  3KK3 A;  4B02 A;  1T8E A;  1SUQ A;  2ZBQ A;  1R0B G;  1PC4 A;  4O4R A;  2MXY A;  2B5J B;  3BGO P;  4LSL A;  4CLP A;  2MGZ A;  3DN9 A;  3GB0 A;  8RUC A;  3FRY A;  4DV7 F;  3QIP B;  4B08 A;  1XNQ J;  4DXL A;  1LWE A;  2MQQ A;  4NZ7 A;  1YIJ S;  3OT9 A;  4FKY A;  1S1V A;  4ZIW A;  1NAQ A;  3LWL A;  2BE9 B;  3DRX A;  1L3S A;  4ZOS A;  2RAQ A;  5A0Y A;  5LSO A;  4ZP9 A;  2BQ3 A;  3TRG A;  5DG7 A;  2QA2 A;  1N5S A;  1PSD A;  3MMC B;  2F65 A;  1T9Y A;  1U6B A;  3D67 A;  3UR0 A;  1VGY A;  1OSC A;  2BMB A;  3AD8 C;  4KTQ A;  1UL3 A;  3LUY A;  1RHQ B;  2KRB A;  3NS6 A;  1YJN S;  1BC6 A;  1N33 F;  2ZOM A;  3HFZ B;  2CPY A;  2GFF A;  4DFP A;  4NEZ A;  4F3O A;  3W63 A;  3BH6 B;  3M9N B;  3CJQ A;  2DXF A;  4IO1 A;  1XJW B;  1GMU A;  3OTB A;  1ZAV A;  3M30 A;  1FO1 A;  1U25 A;  3OR2 A;  2DGQ A;  3JYT B;  5KFY A;  1KQG B;  4Q43 A;  4WKR A;  1ZOT A;  3UNY A;  5KFU A;  2RSQ A;  2CJB A;  5CH7 B;  2CQ4 A;  2G2Y A;  3Q8Y A;  2GNK A;  2B56 A;  3MFH A;  5H1S V;  3E3X A;  2AD9 A;  2B5J A;  3FJ2 A;  2RT3 A;  1XK8 A;  3QIP A;  1F60 B;  3NWR A;  2LA4 A;  4CCH A;  3TEG A;  5H9E J;  2N4C A;  3FMB A;  4ALZ A;  3EXY A;  3KHL A;  1XR7 A;  3MGJ A;  5BJR A;  2IYI A;  1N5T A;  3LWM A;  1S5Z A;  4OZ0 A;  4OX7 A;  1U1L A;  3VAK A;  1EQ0 A;  3HSG A;  2R2S A;  5IT0 A;  1AFJ A;  2ZVS A;  3QMQ A;  3MMC A;  1B4S A;  3QRP A;  4ILL A;  2PEB A;  1V3Z A;  3NWG A;  5IZH A;  4HH1 A;  3N6M A;  1BWE A;  3CJ4 A;  3D54 A;  4AT1 B;  2GJF A;  2NPF A;  5E3P A;  4C98 A;  1F5C A;  1VQL S;  4GVL A;  1PKU A;  4X65 J;  3OTD A;  5KFZ A;  4X84 A;  2M8H A;  3S7R A;  2QL5 B;  4A48 A;  1WOS A;  4NCG B;  3TJ8 A;  3IGV A;  2N7C A;  2GA7 A;  3DM2 B;  3FEZ A;  4XDC A;  1HR0 J;  3ZZZ A;  3T5K A;  2JLF A;  2VOO A;  4F2S A;  1CUL B;  1CJV A;  4DMZ A;  3M2V B;  2ZNZ A;  4EBC A;  1WOR A;  3JYT A;  1HWU A;  3M9O B;  1WI6 A;  4J37 A;  3EDR B;  4M8L A;  2IMW P;  2OPQ B;  3KLG B;  1Q95 G;  3LGM A;  1GXU A;  2XY5 A;  3ENV A;  3RAX A;  1U1K A;  4QR1 A;  1VBZ A;  2VBX A;  5L38 A;  2H3E B;  3HVR A;  4JOU A;  4KH0 B;  2ZBI A;  4F4X A;  2FHO B;  2JEI A;  2L9W A;  3BQ2 A;  2HLT A;  4LRA A;  2RQC A;  1WNE A;  3UN2 A;  4XO0 A;  4A8S A;  2P5V A;  3OVS A;  2JC1 A;  1FA0 A;  2ZH7 A;  1TUW A;  5BYR A;  3J81 Y;  3KJN B;  2DNH A;  3H0P A;  1XQI A;  4NAS A;  1T9T A;  3MR7 A;  1NCL A;  2I1R A;  1LNQ A;  4PWU A;  5KFG A;  4LF2 A;  4NLW A;  1KTV A;  4OL8 A;  3HHL B;  2XTJ P;  5ADZ A;  1FWK A;  3FBC A;  3I55 S;  2ZFH A;  2U1A A;  4HAC B;  4WZM A;  1BXN A;  1HWK A;  5KFW A;  4CLY A;  2RF2 B;  1RTI B;  4DPT A;  1IQZ A;  3A3N B;  3CCW A;  2HIY A;  1RLC L;  2JEG A;  4O3P A;  2DGX A;  1IJE B;  4NCG A;  3HT3 A;  1MRO B;  1NPK A;  3DM2 A;  1UMJ A;  1SIW B;  2LEA A;  3MUR P;  3MPY A;  5HO4 A;  3M2V A;  2HFS A;  3V6J A;  4U67 Q;  1IVZ A;  3M8W A;  3ZTS A;  4AD6 A;  2OPQ A;  4W90 B;  5ETL A;  2VG6 B;  2BUN A;  3W8P A;  2DHS A;  4UF4 A;  2B4P A;  4ETZ A;  1JXV A;  1LK5 A;  3AH6 A;  2F4F A;  5HVH A;  3RRG A;  2VFR A;  4M5G A;  5LL6 d;  5IT9 Y;  4A8K A;  1ZYQ A;  1MWY A;  3D6H B;  4B3O B;  2LYV A;  1HWJ A;  2VPZ B;  2BE7 D;  2MJU A;  2VJU A;  2MMY A;  3TX0 A;  2BV3 A;  4A8Y A;  2VQE J;  3WX4 A;  1CLF A;  3MHY A;  2IA6 A;  4TU9 A;  5B08 A;  2NXC A;  4DUY F;  1HD1 A;  2ZE2 B;  1FDB A;  1OSD A;  2L9D A;  3MED A;  1X5T A;  1KN6 A;  2C22 A;  5KFT A;  3AQO A;  1TR0 A;  4DJB A;  1HBO B;  4MKY A;  2VIH A;  1RHR B;  2BZ2 A;  2WBR A;  4JP8 A;  4WP3 A;  1TK0 A;  2LEC A;  4OX8 A;  3HHL A;  5D3G B;  3GFH A;  1R0A B;  2H1Y A;  4O0I A;  1N36 F;  3R5G A;  2D3Z A;  4RWX A;  4HH0 A;  2MQP A;  2VC1 A;  4HAC A;  3J80 U;  1RTI A;  4F25 A;  3CDU A;  8ATC B;  4ZMM A;  3T6J A;  1KHV A;  3T3F A;  2KFY A;  1TMJ A;  5F8M A;  2G0J A;  4F67 A;  2UP1 A;  1WC1 A;  3DLJ A;  2KG1 A;  4KR0 B;  2ZM6 F;  2GX8 A;  3DDN A;  1MRO A;  1UA1 A;  3TYT A;  1N54 B;  5HQ8 A;  3MR6 A;  1ZPV A;  4PXD A;  4EK2 A;  3WBZ A;  1SKU B;  1T11 A;  4RUC A;  2EEY A;  1UJ6 A;  1Q86 T;  2W9B B;  2VG6 A;  3TUP A;  3QLH B;  1NH7 A;  3G6V A;  4NXM J;  4PAB A;  2K1R B;  3M32 B;  1TFY A;  1RWV B;  1NK8 A;  1LW2 B;  2HS4 A;  4OX6 A;  1NK4 A;  4AL7 A;  4B3O A;  1FKO A;  2VA2 A;  2YNH B;  2Q66 A;  3LP0 B;  3MAA B;  5IV4 A;  2JSX A;  4RR5 A;  1YLX A;  4WXO A;  5CZX A;  2VBZ A;  1M5V C;  1MMN A;  1JB0 C;  2AGO A;  3WDO A;  3P5B P;  1N88 A;  4OYO A;  1WF0 A;  1L3U A;  2ZE2 A;  2EBE A;  3VQS A;  1CS4 B;  3Q8V A;  2DKO B;  2B7C B;  1M5K C;  2H5I B;  3IWN C;  4ECR A;  5CD4 A;  2XC9 A;  1HBO A;  3ZZ0 A;  1S9F A;  4YDX A;  3PHT A;  4J9S A;  1N0U A;  2JH3 A;  2YX1 A;  2Y8W A;  2DNR A;  3H2L A;  3ZC4 A;  5JVG Q;  3V81 B;  4URG A;  2R7V A;  1R0A A;  4C48 A;  4I1T A;  2D74 B;  3ZXW A;  2BM1 A;  2ACM A;  1X4G A;  3FSX A;  3FBF A;  1PGZ A;  3H42 A;  4OZJ A;  2YWF A;  1SC6 A;  3NNC A;  3QO9 B;  2A18 A;  2NS1 B;  3W5Z A;  4ZDN A;  8AT1 B;  1E6V B;  3A3O B;  3F73 A;  5LMN J;  5EWE A;  4Q44 A;  3U1L A;  2HFV A;  2ZNY A;  4EBD A;  2GIF A;  3VAL A;  1L3K A;  3LOU A;  1I3O B;  3L09 A;  4PPD A;  2DGS A;  2VOP A;  2DXD A;  4NYP A;  1Q5V A;  4HHJ A;  3BR8 A;  3GYX B;  2FGC A;  1HNI B;  2EK6 A;  3KLF B;  3Q0A A;  2P6T A;  4AL5 A;  4DEZ A;  4JI8 J;  1P9Q C;  2DPJ A;  3A8J A;  1JQG A;  2K1R A;  3M32 A;  2HHS A;  3E8O A;  1LW2 A;  2R7O A;  4TYB A;  3CMQ A;  3G6Y A;  4MFB B;  1QD1 A;  1KD1 T;  4DV1 F;  2YNH A;  3LP0 A;  3MAA A;  4ZCL A;  3QQC D;  2ASL A;  3JTN A;  1M90 T;  3DLH A;  4B9S A;  1UTA A;  4RNM A;  4DR4 F;  1T0T V;  1CS4 A;  3QFW A;  2OP5 A;  1NSP A;  3H5Y A;  1RCO B;  4X66 J;  4QU7 A;  3V4I B;  1U09 A;  3N5F A;  1GEH A;  4KRW A;  3HUL A;  1XMQ J;  4ELT A;  1RGV A;  2NYI A;  1ULR A;  1DQA A;  2A6O A;  3AA8 A;  3HI9 A;  1QJH A;  4WYW A;  3M05 A;  2H51 B;  2FGO A;  2F4V J;  3V81 A;  3QWU A;  3GZ7 A;  1HR0 F;  2AWZ A;  2CQ0 A;  5F8J A;  2H65 B;  2OEK A;  1M1H A;  4NZ6 A;  3KJF B;  2EFV A;  3DCA A;  1E6V A;  1WSV A;  3B54 A;  4LSN B;  2IFX A;  4P7T A;  4OYA A;  2HVI A;  2J0X A;  4DOZ A;  1Y3K A;  4UST A;  4F4Z A;  1TKD A;  1JJ4 A;  3FCW A;  5F8N A;  4YY3 J;  2V8G A;  4ECX A;  2K06 A;  4OYB A;  1GFW B;  4DS4 A;  3KLF A;  3TA2 A;  3RRH A;  4NMX A;  2R7Q A;  3WIU A;  2J5A A;  4EO8 A;  4IR9 A;  3J7A N;  3N28 A;  2GHW A;  5KFP A;  1XTZ A;  4WJB A;  3W66 A;  1GXL A;  4MFB A;  1RWO B;  3T1Y J;  2HRT A;  4IH7 A;  5A76 A;  2VJV A;  1U1M A;  4KHP J;  1SJR A;  1WHV A;  1NDC A;  1BHN A;  4ZP8 A;  2BQR A;  2H5J B;  2PA3 A;  4Y28 C;  4C8Z A;  4W98 A;  3FDS A;  1ZZN A;  3AB2 B;  1Y5L B;  1OYE A;  3PVX A;  3E2E A;  4CO5 A;  3V4I A;  2B4O A;  2E5H A;  3HK2 A;  4ZVF A;  4PG4 A;  3VR1 A;  4U8V A;  1ROF A;  4ELU A;  4K50 A;  2E9Z A;  1RAC B;  2XI2 A;  3DI6 B;  1ZTT A;  4JI3 F;  3R5A A;  2CQD A;  1WAC A;  2ZOF A;  4URQ U;  4OZ5 A;  4DQQ A;  3CO9 A;  3FSY A;  2MDA A;  1X4A A;  1QTN B;  1HFE L;  1SV5 B;  4P2M A;  1VC5 A;  2ZZT A;  2LU2 A;  2LQB A;  4DX5 A;  4RZR A;  1NJY A;  4LSN A;  1TK8 A;  4DR5 J;  2E44 A;  3TR5 A;  1FDN A;  2A1B A;  4N77 A;  1WEX A;  3BH7 B;  1YBT A;  2IY5 B;  3PJW A;  5HAN A;  4X4R A;  2H5E A;  1RAF B;  5CAB A;  3ZZR A;  2PFF B;  3BO4 A;  4E98 A;  4ZLL A;  2E29 A;  3W9I A;  4N8N A;  2HFN A;  1S4F A;  3BQ0 A;  2MHN A;  2MTL A;  3UWT A;  2I8E A;  1DUR A;  3X3U A;  4ECY A;  4USK A;  2IVY A;  3ILI A;  2VH7 A;  5D77 A;  4ECQ A;  5F8H A;  1U4B A;  2V2V A;  3KMS A;  2Y8Y A;  1UEV A;  3NS5 A;  4C8M A;  1HA1 A;  4IRK A;  3BYR A;  4XPC A;  3QT8 A;  2ZZN A;  1NBE B;  2HHH F;  4UQG A;  4Z2X A;  3DRR B;  2FZK B;  4ZA1 A;  2JX2 A;  1N34 J;  1VR6 A;  3OL7 A;  5KG0 A;  2KM8 C;  2E9T A;  5T41 A;  2IIH A;  2R7R A;  1FRI A;  5JXS A;  3IRW P;  1U2R A;  3TWZ A;  5KFB A;  3OL6 A;  3AT1 B;  5EWF A;  3DI6 A;  2DR8 A;  1NHK L;  4E0D A;  2X1B A;  4DR1 J;  4CIO A;  3PJ9 A;  4FDF A;  1SV5 A;  1UEU A;  3I0R B;  1EQM A;  2HGL A;  3VV2 B;  4DWI A;  2JLE A;  4ZVP B;  4UT4 A;  4C2M A;  2G4B A;  4F50 A;  4NRT A;  1RYS A;  2DNQ A;  4LBI A;  2M5Y A;  1G1X A;  4FF1 A;  4M5J A;  5KFK A;  1ELO A;  1H2V Z;  4K4U A;  1G6B A;  4EEY A;  5BYS A;  1YKW A;  4B3T F;  4KGZ B;  3NRB A;  2UUC J;  2V50 A;  3MMB B;  4O3R A;  3EM1 A;  3LA0 A;  4JI4 F;  4IFV B;  2QRR A;  2ZBR A;  6AT1 B;  3Q89 A;  4IG3 B;  2KL8 A;  2HS0 A;  2EBG A;  4QW9 A;  1KKH A;  3CPW R;  3SFU A;  3TJ9 A;  1UA0 A;  2HVE A;  2LQJ A;  4EO6 A;  2RS2 A;  3DRR A;  2BAC A;  1H7W A;  1UWA A;  2BQU A;  4KAI A;  1S97 A;  5CYJ A;  1LFW A;  1DAX A;  3IMQ J;  1SXL A;  1TL3 B;  4ZPW R;  4DDF A;  2J7W A;  3OV7 A;  3HO1 A;  3ETM A;  5JUM A;  2JVO A;  4HHU A;  3OVB A;  3BV8 A;  3P8B B;  3IR5 B;  5E7O B;  3ETO A;  3TUJ C;  3KLV A;  2XMV A;  3LH2 S;  2WAQ D;  1FRJ A;  2XHW A;  5FII A;  1HAR A;  2AMC B;  2BBE A;  3GYN A;  3O3L A;  4JI1 J;  4QWD A;  1YJ7 A;  3P6Y C;  3GG1 A;  3MM5 B;  3TA0 A;  3I0R A;  2B9X A;  3ZTP A;  3B8H A;  2YWH A;  2YPY A;  2QLJ B;  2CQ3 A;  2IDE A;  2CXE A;  4FNH A;  4AE5 A;  4DV3 J;  3MZI A;  3S6E A;  2GHP A;  5F0W A;  3HHK A;  1N5Q A;  3JSR A;  3POT B;  3MMB A;  1S72 S;  2KDO A;  2Y0S D;  3AB4 B;  2V5H G;  5CD4 H;  4I6Y A;  2Z2Z A;  4AND A;  3M8R A;  4DFM A;  2YXL A;  3SCL E;  2DVI A;  4DR2 J;  4IFV A;  5G0R B;  4CQ1 A;  4DSI A;  4X66 F;  2Z4P A;  7FDR A;  2OLW A;  2O5D A;  2UUA J;  4IG3 A;  1RKJ A;  2ROG A;  1M5S A;  4O3O A;  4TNO A;  3G6X A;  4K4T A;  3I4P A;  4WTY A;  2MEW A;  1JNZ B;  5HAT A;  5DS7 A;  3NMR A;  1NHU A;  1N56 A;  1RAA B;  2IYG A;  1VBX A;  3D7S B;  4LR9 A;  2RDI A;  1GXT A;  1HL6 A;  3PM9 A;  2NRE A;  3BKT A;  4LFB J;  2V8D A;  1MN7 A;  3W61 A;  3K57 A;  5AE2 A;  2GQC A;  4OI3 A;  2PMH A;  2RU3 A;  1TL3 A;  2PE8 A;  2NZC A;  4USV A;  5EX3 A;  5E2Q A;  3FEX B;  1U6Z A;  3BR9 A;  4HKQ A;  2QLB B;  2C2K B;  2K7K A;  1F9E B;  4CO3 A;  3Q83 A;  1D9A A;  4O3Q A;  1RBA A;  1N5V A;  1SB6 A;  2QLW A;  3M2U B;  1CJU B;  4WTO B;  2JL9 A;  3MM5 A;  1N52 B;  3CO0 P;  1MW7 A;  2FJB B;  1VHF A;  3TZW A;  5KT2 A;  3X1L B;  3UR3 C;  2ZBP A;  4DHV A;  3FK4 A;  4Y34 A;  4KGM A;  2JFK A;  3T1Y F;  4RW8 B;  2KJW A;  3QRR A;  3WHI A;  1GMW D;  1RWP B;  3DRP B;  4K0K F;  3POT A;  1CJT B;  1D3W A;  3R2D J;  2W2O P;  3W7B A;  1RLD A;  1SH3 A;  1D0E A;  1FT8 A;  4DV6 F;  5HSP A;  3AXM A;  4ZVR B;  1FNM A;  5LOQ A;  3TO8 A;  1VQO S;  5G0R A;  3UCZ P;  3HSD A;  4PXC A;  3TAN A;  2UXC F;  4IQX A;  4ZS6 A;  3H4B A;  2OJ3 A;  1ITP A;  1U1O A;  2CPF A;  1ARO P;  1ZA1 B;  3OQ2 A;  3EVO A;  4ANE A;  2WZ1 A;  1JJ2 R;  3CW2 C;  3J7Y U;  1Z2L A;  4FXW A;  1MWZ A;  3KHG A;  2KH9 A;  2V8P A;  1KNZ A;  4M94 A;  5LMU J;  4S0M A;  3BPS P;  1X9S A;  3O44 A;  1B70 B;  3QFH A;  4GMK A;  3IG1 B;  4K4V A;  5THW A;  1TL7 B;  4DFJ A;  3NGK A;  4ECU A;  3EGZ A;  3BSA A;  2QFI A;  5IWA F;  4QIG A;  4F4K A;  4HTJ A;  3CD7 A;  2J7K A;  2C2M B;  3LP1 B;  2HEK A;  3M2U A;  1CJU A;  2RIJ A;  3SSS A;  4J9Q A;  2QYC A;  2H9Z A;  2ASD A;  3MPU B;  2MQL A;  5KTQ A;  1VCT A;  4NLQ A;  2KFZ A;  4P52 A;  5LXR A;  3CJT A;  2FVQ A;  1S79 A;  1UZH A;  2WK4 A;  2GZO A;  1K9M T;  5L1J A;  2FUG 9;  4B9N A;  4WK3 A;  4LF5 F;  4L3N A;  2RU9 A;  4RW8 A;  2HBR B;  2CUY A;  1T05 B;  5IQ6 A;  3DOK B;  3DRP A;  1CJT A;  4DV2 F;  2VUG A;  1LKZ A;  1WTF A;  4FNI A;  4X62 J;  3BSN A;  3VAG A;  5LT5 A;  4L73 A;  1C2P A;  2MZ1 A;  2XS7 A;  1K0T A;  1FJ7 A;  3EGV A;  2XLK A;  4I6A A;  1X4B A;  1VHI A;  5G4D A;  2V4J B;  2NXE A;  4MK8 A;  1KQK A;  5AXM A;  4ID8 A;  2E5L F;  3P4U B;  2NXJ A;  1OO0 B;  2AZ3 A;  3PFE A;  4QIE A;  4DL3 A;  3QSI A;  2ERR A;  1RT6 B;  2PMW A;  3IM8 A;  5I3U B;  2YQ0 A;  5F9L A;  1NJW A;  2CQ1 A;  3ZZP A;  2FC9 A;  1DQ9 A;  4PQU B;  2CDQ A;  3IG1 A;  4ZLJ A;  1TL7 A;  2MHE A;  4E2F B;  4FVC A;  1MML A;  1P1L A;  2ALZ A;  1V6H A;  4LF1 A;  2GML A;  2M3D A;  5HP1 B;  2WON B;  3ZTR A;  4YQW A;  2GQQ A;  4IG0 B;  3LP1 A;  3IAS 9;  5E3Q A;  4HHH A;  1HKA A;  1NKC A;  2CJQ A;  3ICL A;  2GJI A;  3QJJ A;  3G4S S;  3NGR A;  3GON A;  1J27 A;  1K44 A;  3LQV A;  3R97 A;  1X9M A;  3F0N A;  1TZ0 A;  1Q0N A;  3AJD A;  3CJR A;  3A8K A;  2DY1 A;  1X5O A;  2Y9H A;  1RAH B;  4D3G A;  3H98 A;  2I5J B;  2DD8 S;  1T05 A;  2MZQ A;  3DOK A;  3D28 A;  3GIJ A;  4NEY A;  4CI0 B;  3MFI A;  1JLB B;  5CCM A;  4NLG A;  4P9S A;  1NME B;  4I2Q A;  2FQQ B;  2FHM A;  4U6P A;  3CCR S;  2W2N P;  3H2V E;  2LU1 A;  3TVY A;  1SH2 A;  3CME S;  5HMZ A;  2RKI B;  2V4J A;  1FDA A;  3SCK E;  1EP4 B;  3A12 A;  1MU2 B;  1VBK A;  3D6T B;  1PYO B;  5KOX A;  1IKY B;  3LGH A;  1GT8 A;  1N48 A;  3MPD A;  3CC2 S;  3CE8 A;  3IFE A;  4ZCK A;  1RT6 A;  4KB7 A;  3M8Q B;  5I3U A;  2MKH A;  3HFK A;  1RAG B;  3RBZ A;  2CIM A;  1ZET A;  3DMJ B;  4WE1 B;  1HHS A;  1NRK A;  1JLC B;  4DX6 A;  3CJ8 A;  3MPV A;  2HMI B;  4G6V B;  1YHQ S;  4PQU A;  1VRQ C;  4P7V A;  5B0F A;  4DF4 A;  3D0I E;  3M1V B;  3FUY A;  3MUT P;  2HHX A;  2GAG C;  5KFH A;  4ECZ A;  5HP1 A;  2WON A;  1Y5N B;  4IG0 A;  5AE1 A;  2O1P A;  5DQG A;  5KFC A;  3K5L A;  4WKY A;  3UQS A;  4YB5 A;  3JQM A;  3I96 A;  1FRL A;  2A10 A;  5KG3 A;  3JQJ A;  1KS2 A;  2ZH9 A;  3MCO A;  3U1N A;  2YQ3 A;  5HBM B;  1NK9 A;  4P75 A;  1VBY A;  1NKB A;  1XNR J;  2LQ5 A;  1RT2 B;  1S0O A;  1VI7 A;  2I5J A;  3C3L A;  4OLP A;  2EFG A;  5HI7 A;  1Q4R A;  2HGN A;  4ZCI A;  2XI3 A;  3CDA A;  2E9R X;  1N0V C;  1JLB A;  1CC7 A;  4CH0 S;  2NR0 A;  1TV6 B;  2A3J A;  2F63 A;  4QJV A;  1IM4 A;  3FBE A;  3BO2 A;  1ZPW X;  3HZE A;  2RKI A;  3KXD A;  4YR2 A;  2XGQ A;  3I87 A;  1EP4 A;  1MU2 A;  3US5 A;  4ZP6 A;  4CO4 A;  2ZJQ Q;  5KFL A;  1IKY A;  2HQI A;  3CCU S;  4X64 J;  4I7F B;  1QE1 B;  5A2Q U;  3M8Q A;  2J6U A;  4RJV A;  4ED0 A;  2ZHA A;  3DMJ A;  4WE1 A;  5J1E B;  1JLC A;  3RJM B;  2JLG A;  2HMI A;  3WZ0 A;  3OFE A;  4CT8 A;  3KUH A;  2Q6B A;  1XMO J;  1EKS A;  4H4O B;  5H9F K;  3MI7 X;  2ZC4 A;  3GYG A;  2Z2Y B;  3HMJ G;  4GC6 A;  1UET A;  5J2N B;  4OV6 A;  4IUF A;  1F9H A;  2B0G A;  1L3V A;  1NUE A;  1FRM A;  2B7B B;  3IS9 B;  3MUM P;  4MK9 A;  3PFO A;  1T9U A;  4OIX A;  3VTI A;  3CSK A;  2WB1 D;  3LTO A;  3BBC A;  2WVC A;  4JV1 A;  2PN6 A;  2XGP A;  3TZZ A;  1RAO A;  5ETN A;  5HBM A;  4C8L A;  5CCL A;  1OQ3 A;  2XCP A;  1YSJ A;  4MT1 A;  1RT2 A;  2LQ9 A;  3KJV B;  3J7A 1;  4X4T A;  4NA1 A;  4NI2 B;  1SL1 A;  4UW2 A;  5KG6 A;  4N76 A;  1TV6 A;  3PYF A;  1BMQ B;  2CNK B;  4P10 A;  2XG8 A;  3DFE A;  2K3I A;  5J2P B;  2DIT A;  3ZZT A;  5HVF A;  4DV0 J;  3KDO A;  4OI1 A;  3VF0 B;  2I2Y A;  4ZPB A;  2AYB A;  1R27 B;  4I7F A;  1QE1 A;  2ZH6 A;  4XIU A;  3IWL A;  2RQM A;  5DG8 A;  5J1E A;  1RYR A;  3QSY B;  2DR6 A;  1HNZ J;  3SQG B;  3BKU A;  4JI7 F;  1IR2 A;  5F3Z A;  4H4O A;  4X2B A;  2JJ4 D;  2FDN A;  3R27 A;  4HI1 A;  3QAU A;  4LFC J;  2V2Z A;  5J2N A;  5M2U A;  1WG5 A;  2V2Q A;  2V67 A;  1PO6 A;  1RTJ B;  3IS9 A;  5AJ3 J;  1LWC B;  1ZM3 A;  3C2P A;  1VQ5 S;  1ZM4 A;  3PV8 A;  3CXC R;  3PYE A;  3CCS S;  5K5M A;  1WKJ A;  5AXK A;  2C2N A;  4C8N A;  5KFI A;  4JB8 B;  2W8K A;  2WHO A;  4F8R A;  1Y0H A;  4DPX A;  5L46 A;  2FLO A;  4PWW A;  4OLO A;  5CYQ B;  5IOL A;  2X1F A;  3KJV A;  1PYS B;  3NG8 A;  2JEF A;  1Q79 A;  4NI2 A;  2UXD J;  2Z56 B;  3UVJ B;  4DV5 F;  1YQH A;  3MR2 A;  2ZJR Q;  5A8R B;  2KI2 A;  4H4K A;  4YME A;  4CLW A;  2ZH8 A;  5ETP A;  3HP6 A;  5E3C A;  4K4W A;  2QL7 B;  5L1I A;  2XY6 A;  3KMQ A;  2B9E A;  2FLL A;  4OYZ A;  5J2P A;  1GK8 A;  4CP5 A;  3I5B A;  3CCT A;  2FHK A;  5T7L B;  2FVR A;  3H90 A;  2KYX A;  5KFD A;  3M8P B;  1XBW A;  1U1P A;  1FER A;  4B3R F;  2VBY A;  3SQG A;  4B3M F;  4L76 A;  4OJ1 A;  3EGW B;  3UCG A;  1R31 A;  1NK5 A;  1D9F A;  5C42 B;  5LJ5 Y;  4P2F A;  2R7W A;  4DV7 J;  3GFZ A;  2ILZ A;  3DGP B;  2F3J A;  3M8Z A;  3OXL A;  2P8I A;  1XR6 A;  2VG7 B;  1RTJ A;  1FNO A;  2OD4 A;  1LWC A;  2BDP A;  4UTG A;  3C14 B;  1M5O C;  3A8E A;  2J0S D;  3AA9 A;  2PGC A;  3FNN A;  2CKW A;  2L41 A;  1OY9 A;  1WC4 A;  4OYX A;  3NOC A;  4ICL B;  1ZAW A;  2FPH X;  2XSF A;  1TUG B;  1DQ8 A;  3M6X A;  5CYQ A;  3KTQ A;  1D09 B;  5ETM A;  4HEA 9;  3SYZ A;  1BE4 A;  1CPZ A;  3JAM U;  1RSC A;  3R6G B;  5J1P A;  3CNQ P;  4OYP A;  4H4M B;  2YBV A;  4YB6 A;  2EKN A;  3UVJ A;  1Z2Z A;  4K4Y A;  1KC8 T;  2MLZ A;  1RTD B;  2HW3 A;  4DCJ B;  5A8R A;  1IXK A;  1FEH A;  3Q2T C;  1N33 J;  5KFN A;  3T5H A;  3UDL A;  1YRT A;  4WII A;  1HPZ B;  3HLU A;  4PYA A;  2DGV A;  4FF2 A;  4DL4 A;  1H72 C;  4RNF A;  5L9N A;  3VAM A;  2W1B A;  2FVC A;  3BDP A;  3UFC X;  5T7L A;  2YWE A;  1X60 A;  1QVG R;  3KLE B;  1F2H A;  2YVS A;  1S1U B;  2CDR B;  5DG9 A;  3M8P A;  3TZY A;  4ZVT B;  5BXI A;  3ILL A;  5KFQ A;  3R5B A;  1O8B A;  3HVT B;  4ZVH A;  2EKY A;  1BQX A;  4IH6 A;  3CJ0 A;  2B3T B;  3CCJ S;  2EXU A;  2KHC A;  3AD9 C;  4ECW A;  4RU9 A;  4NE9 C;  3IA0 A;  1RWN B;  4P2X A;  3DGP A;  3RB0 A;  1ACM B;  3IN5 A;  2VG7 A;  1SJF A;  2DR9 A;  4QYZ J;  2B51 A;  4OX9 F;  3BGR B;  3OR1 B;  2X51 A;  4A8X A;  1S76 D;  5HK4 A;  1UVK A;  2XSJ B;  1W2I A;  3U02 A;  3C14 A;  3DLK B;  3ENQ A;  3JS9 A;  3UO0 A;  2ROE A;  1HHQ A;  2IM0 A;  3QJL A;  3C15 B;  3ZO7 A;  4ICL A;  1C4A A;  3GCX P;  3D0G E;  4M5M A;  2MKK A;  2YKP A;  3GU0 A;  4OHV A;  4NA3 A;  4H4M A;  2K7J A;  3AAW B;  2R42 A;  4CZC A;  4I56 A;  2OKQ A;  2HHQ A;  1RTD A;  3QRQ A;  4ER8 A;  4CT9 A;  3H5U A;  3L95 X;  4J9P A;  3W60 A;  4WIQ A;  3V5R A;  1HPZ A;  2N3L A;  3JSM B;  3CDB A;  1WSR A;  2LVW A;  2QA4 G;  1SQE A;  2J6T A;  4M95 A;  9RUB A;  3CCQ S;  3W65 A;  3KLE A;  4YN3 B;  3WIV A;  1S1U A;  4EMD A;  1X5S A;  1U7L A;  4L74 A;  2XO6 A;  4GKJ F;  2ATC B;  5KT7 A;  3QZ7 A;  3TZX A;  1S48 A;  3HVT A;  1M5H A;  1S10 A;  2NCK L;  4P72 A;  4GVB B;  4FN5 A;  2WRM A;  3H2U B;  2CZV C;  5ETQ A;  1UKU A;  1FES A;  1IBC B;  3MEC B;  4OZ1 A;  1EHW A;  2QE5 A;  4USU A;  4DBQ A;  3OHB A;  4DSK A;  4HT5 A;  3R5D A;  1FNX H;  3BGR A;  3OR1 A;  5DQH A;  2UVW A;  4B9T A;  2FLN A;  2DR5 A;  3AXK A;  2E7V A;  2QZ8 A;  2XSJ A;  2R8K A;  2B4U A;  5D4O A;  5J2M B;  2AHO B;  2MZR A;  3DLK A;  2KZZ A;  2UV8 G;  3IGN A;  4YR3 A;  1H38 A;  4BCA A;  3SCI E;  3BZQ A;  2PO4 A;  1BLU A;  3A4T A;  3ISN D;  3C15 A;  1S59 A;  1Q5Y A;  5D8H B;  2Y1R I;  2FY1 A;  3AJ1 A;  4MIA A;  3EX7 B;  4PWD A;  1TMM A;  1FE4 A;  2BJ9 A;  3SFG A;  3ZNJ 1;  4NL5 A;  2AJ0 A;  2WSF C;  1LK7 A;  3PTW A;  1UJ5 A;  4TXS A;  3FSI A;  5HN0 A;  5A8W B;  2MYF A;  1HLW A;  4JI0 F;  1I94 F;  1NXI A;  1KVJ A;  2VAS A;  2QEX S;  4IOA Q;  1X9W A;  4CTA B;  2FVP A;  4DPW A;  1RHJ B;  1Y00 A;  3JSM A;  4DSE A;  1DAR A;  2HYI B;  1CVJ A;  3CJ5 A;  1OS5 A;  2YX7 A;  2WBM A;  1P9Y A;  3J80 Y;  4PR6 A;  3TA1 A;  2O3D A;  2Z2M A;  4V19 X;  3FKB A;  1LOU A;  2V34 A;  2QG9 B;  2W24 A;  3O1L A;  1N32 F;  2J9C A;  3KOA A;  2DGU A;  4GVB A;  4M5K A;  2HBZ B;  2KXF A;  5GAE U; 
#chains in the Genus database with same CATH homology
 4JP8 A;  4K8R A;  3GCX P;  2ZWP A;  3SQO P;  3WHI A;  4NE9 C;  3WIU A;  1SCJ B;  2W2M P;  3BGO P;  2Z2Y B;  3CNQ P;  3VHQ A;  2W2N P;  2W2O P;  2Z58 B;  3T41 A;  2ZWO A;  3A3N B;  3P5B P;  2W2Q P;  3VV2 B;  2PMW A;  3H42 A;  3GCW P;  2Z56 B;  4YN3 B;  3AFG A;  2QTW A;  4OV6 A;  3WIV A;  2Z30 B;  3A3P B;  2XTJ P;  3CO0 P;  1ITP A;  1V5I B;  3BPS P;  2Z57 B;  1R6V A;  2E1P A;  3A3O B;  3QFH A;  2W2P P;  1SPB P;  4NMX A;  2Z2Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...