1V5IB

Crystal structure of serine protease inhibitor poia1 in complex with subtilisin bpn'
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
76
structure length
76
Chain Sequence
SAGKFIVIFKNDVSEDKIRETKDEVIAEGGTITNEYNMPGMKGFAGELTPQSLTKFQGLQGDLIDSIEEDHVAHAY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of serine protease inhibitor POIA1 in complex with subtilisin BPN'
rcsb
source organism Bacillus amyloliquefaciens
molecule tags Hydrolase/protein binding
molecule keywords Subtilisin BPN'
total genus 22
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2003-11-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.80 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Peptidase S8 propeptide/proteinase inhibitor I9 1v5iB00
2W2QP 1SCJB 2Z58B 3A3OB 2PMWA 4OV6A 2W2NP 3CNQP 3SQOP 1V5IB 2W2PP 2E1PA 2W2MP 2Z2ZA 1ITPA 3GCXP 3WIVA 2W2OP 3WIUA 3GCWP 3H42A 3QFHA 4K8RA 4JP8A 3VHQA 2Z56B 4YN3B 3CO0P 1R6VA 2Z2YB 2ZWPA 2ZWOA 4NE9C 3A3NB 3BGOP 2Z57B 3WHIA 3BPSP 3P5BP 2Z30B 3T41A 4NMXA 3AFGA 1SPBP 2XTJP 2QTWA 3VV2B 3A3PB
chains in the Genus database with same CATH superfamily
4IG3B 2HHQA 1J5EJ 5CA5A 5D0EA 2MXYA 3GZ7A 3JYTB 1KLMA 4ZPDA 2XWYA 1CLFA 3KLVA 1RWXB 1E6VA 1ITPA 1SVDA 1S79A 4FYWB 4IFYA 1FXRA 4MK9A 4NLOA 3F0NA 4HTIA 1NH7A 4Q43A 3I82A 3R6LB 2FLLA 4ZPBA 3T5HA 3P6YC 2BACA 5KT4A 3JSBA 3MEEB 2XM3A 2AGOA 4PWDB 1S6QB 1BQMB 3RBDA 1HQUA 1U0HA 3UE2A 4CH0S 3M8YA 3MUMP 1HI0P 3CC4S 1U1RA 1NPRA 2NUHA 2YWKA 2ZH2A 1JLEA 1SBRA 3SQGA 3WBZA 3CJKA 1R27B 3CJ4A 3T6BA 5GAHI 1TK8A 2HSEB 3CCWA 2QGFB 3AB4B 3M8QA 3CCTA 4LUBA 5KOXA 4H4KC 4B3OA 3CDWA 3ZTQA 4MIWA 3A1YG 4DI6A 2CJAA 1RKIA 1WF2A 3ISNC 4NZ6A 1GTHA 5LM7E 3C14A 4FXVA 2RHSB 2OTLS 1KQSR 1N36J 3M2VA 3FC9A 1PKUA 3B78A 4B3MF 4UUWA 4JP8A 2NREA 2EFQA 1XBWA 4ED4A 3FZ2A 5L9XA 2B9XA 2VBWA 3OTEA 2V4RA 1NJZA 2HRYA 1HNZJ 3SMZA 2BOAA 1N8RT 2QMWA 3S7RA 3R27A 5B0DA 1DARA 5LSRA 3EGVA 1UFWA 4EFAC 1O0PA 3N6LA 3OJUA 4ED5A 1NHKL 1RADB 1OPIA 1YLXA 3HF5A 3M1VB 4IDKB 2EC0A 2VD3A 3HMJG 1W25A 3CJQA 4TN2A 4U9RA 2VOOA 3AOCA 4WCEQ 1NJYA 4IUFA 5GVQA 3TUPA 3F56A 1VISA 2BX6A 1H7WA 3MMAA 4MKBA 2QA2A 2QL9B 4CI0B 5DETA 2PT0A 2VFUA 2MMYA 2D3UA 2YQ1A 3EDQB 3MM7B 4RW7A 4KO0A 3NWRA 3OPKA 1CJKA 4TYAA 1Y5NB 2DXFA 2YKNB 2B6AA 2ZOGA 1G7CB 3TX8A 4LJMA 2W4PA 2XMVA 1S48A 1R6YA 4X4VA 5HK4A 3MR3A 1ZAVA 1U24A 1RAFB 1VQYA 2V2ZA 4LR9A 4WKYA 1PJ5A 2VBZA 2GO8A 2RRNA 3D6HB 2J9CA 4IOBA 4URQU 1FKPA 5A76A 2RF2A 1AUSL 3ENQA 1N33F 1M5VC 4DWIA 2AJ0A 1N36F 1LW2A 1OSCA 2B7CB 4OYXA 3OR1B 3LUYA 4J9KA 2L3MA 2JSXA 3SBMA 4B3SF 2X1FA 2M3DA 3C6TB 5IC4B 5DG9A 4DQPA 3MR5A 2ZOMA 3CULA 4C4WA 1RAJA 3NGKA 2DCLA 3C6UB 4MFBB 1WEYA 3KK2B 2FVPA 1NU4A 4AFFA 2LEBA 1CVJA 1YK9A 4I6AA 5A0YB 1HHTP 1S10A 4GKJF 4OX6A 2B8PA 4O4RA 1RWNB 4LFCJ 4NXMJ 3NOGA 3THVA 5E33A 3NAHA 4NCAA 3MFHA 4IRKA 2OD6A 2V67A 1FNMA 1YHQS 4U8VA 2GFFA 1S57A 2OLWA 5FLXY 3ZNJ1 1T9TA 4AD6A 1MROB 1DQ8A 3C15B 3CB4A 3DYAB 4QWEA 1BXNA 4ZKAA 4JI0J 3TOQA 5MAOA 4DUYF 3UFCX 4UY8T 3EMTA 2DJWA 1MWZA 2IC3A 3BGLA 1JLGB 2DNYA 1UJ5A 1RT7B 3PEHA 4W98A 1QAXA 1LW2B 3OFEA 2XO6A 4AQYF 1IN0A 1E6VB 1HKAA 3AT1B 1XQIA 4DS5A 2FHJA 5KFGA 1TZ0A 5KT5A 3FBBA 4RUCA 2W9BB 3PY8A 1FDAA 1YX2A 2BJDA 5I3PA 1UWBB 2GC8A 2KH9A 1U02A 1VOMA 4LR8A 3R7NB 2FHKA 3PFEA 1FWKA 2AKWB 5AXMA 4NE9C 5DQGA 3VGUA 3DLEA 1GAOA 2HHSA 4CT9A 3IRXB 4OX9J 5A6WA 3PJXA 3R97A 2KO1A 4IYQA 5HROA 3CC7S 1AFIA 2QL5B 3W62A 2HAIA 1XK8A 1JLQB 2DEIA 3KLEA 1YZ7A 4TYBA 5KG6A 2OMOA 3DGPB 5HVHA 2P8IA 3BSNA 1S9EB 2ROEA 1T05B 1X60A 5KFJA 4EGLA 2DNGA 2C1EB 4EWTA 4X62F 1RA7A 2A2DA 4C48A 3IP0A 3M2VB 5I42B 1UAWA 4IFYB 1S1VB 2VBYA 2W2MP 3WX8A 4KJIA 4RUBA 2POKA 3HD2A 4LF8F 1VQOS 4USUA 4BC9A 1S77D 1KN6A 1IUJA 3HSDA 3M6WA 5F3ZA 1QAIA 4HT7A 1QTMA 5E2QA 3SSQA 3QO9A 3SCKE 4FN5A 1JJ4A 2FHMA 3FBCA 1X5SA 2CADA 1G4CA 1KS2A 4CO2A 5K8OA 4G3IA 1R89A 3IS9B 4LF6J 4MJKA 3P96A 2CQ4A 2YPYA 2ASLA 5F8JA 4C97A 1FTCA 4G1QB 1Z2LA 4WP3A 1EZZB 1YJWS 4F36A 1TQLA 2VHGA 1F2GA 3JTNA 5IT4A 4EO6A 1VQMS 4NXNF 2MHNA 4CP5A 3JSRA 3G82B 4NPOA 1B0VA 3WDOA 5KFQA 3IG1B 2W9CB 2B43A 2ZH6A 3UDVA 5LXRA 3Q23A 2RQMA 3Q8UA 1D9FA 4M8LA 4PUOB 4FNIA 5GMDA 1HBNB 3EICA 4USVA 3L9ZA 3JTOA 2W7OA 1KLMB 2VL1A 3BGRA 2XZTB 4DV2F 1IQTA 4YB5A 4U95A 2Y1LB 4B9TA 4RW6B 2WVCA 1SC3B 1SV5A 4RNNA 3PX4A 2AGPA 3QZ8A 2R7UA 2DHXA 2CG8A 4DSLA 3H8YA 3IM8A 4O0IA 3FQLA 3DLKA 1NSPA 1ZM2A 3KLIB 4LIRA 4CO5A 1XMOJ 4K4YA 4WU3A 4W4MA 1WTFA 3OBIA 3CCUS 2VONA 1IM6A 1RB0A 3QYYA 2ZH7A 4DR5J 3LP1B 1RUSA 4NZ0A 3AB2B 2MKJA 1IR1A 3G8QA 5EX0A 1T0TV 3ITHB 4JV0A 4DL6A 3W61A 4ELTA 4JI7J 4CZCA 4M5HA 2KHCA 3IWXA 4OV6A 2ZD1A 4ECZA 1RT2B 1QDUB 1ZPVA 1V9OA 1VIXA 2CVIA 2OELA 2ZBIA 3D4JA 3BGRB 4WXOA 1FTRA 3F44A 3NXZA 4MK7A 1KDNA 2WK4A 4URSA 4DR4F 1SV5B 2XYHB 3OW2R 2IDEA 2LMIA 3ILIA 1SQEA 2PC6A 3G86A 4AXIA 4MKVA 1U45A 3X1LB 3D1OA 1YJTA 2Q1LA 2UXDJ 1NBEB 3OXLA 4HR2A 3IA0A 2XTJP 2CJXB 2G1DA 5DGAA 5GAEI 3P8BB 1SC4B 3KG1A 5E7OB 4A46A 4ELVA 4ED8A 1FDNA 5IOLA 3R7BB 4Y6IA 5DJBA 1NPKA 2MZTA 2VKZG 3P4UB 1RAOA 5C24B 5BYRA 3HVAA 3CJ0A 3EGNA 3H5XA 2DRDA 4CQ1A 4RBVA 2KXNB 3SDEB 2PN6A 2CPIA 2F8MA 5CYMA 3C8YA 4NCBA 1I1GA 2GHWA 5F8GA 3GYNA 4MKAA 1DTTB 7AT1B 2FVQA 2EG2A 3W9JA 4QYZJ 1OO0B 3A8IA 2KFNA 1NK0A 1BMQB 4LBIA 4X65F 2HFUA 2JLEA 1S9EA 2R7RA 2HMIA 1S49A 3D67A 3MTKA 2I0XA 3B54A 3GIRA 2EPIA 4P52A 2FY8A 5JJBA 2KKHA 5A6PA 3PKYA 5IZHA 1OY9A 3I56S 2R7WA 1IR0A 5HQMA 5HANA 2B0GA 2I5JA 1AFJA 4KAIA 4K7QA 5KFEA 2CYYA 3W65A 1BHNA 1R8AA 1Q53A 4AUKA 2DR8A 2ASJA 3C6TA 3I5AA 4CO1A 3DDNA 3DOKA 1YI2S 3MM9B 2B4UA 4O3SA 4C98A 5F3TA 3IR5B 2CPEA 2K06A 4I6YA 3K57A 2RUGA 2HWHA 4ILLA 1CULB 1CSJA 2B8QA 1K0TA 1TL3B 3KJQB 1S7HA 4GC6A 4P2XA 5ETMA 2VQFJ 1KFSA 2XMTA 4RZRA 5E3QA 2UUAF 4M5MA 3R1HA 1NK7A 2DR9A 1C4CA 3OUYB 1PAUB 2IHR1 1AUDA 2CNOB 2AYGA 2G4BA 2IJRA 3DRSB 1FRMA 2KI2A 2X3DA 3AQOA 1TKZB 1KQFB 3CXCR 3G4SS 5ETVA 5KT2A 3Q24A 3A3PB 2RJZA 2DEJA 2JLFA 3I4HX 3JQKA 2BKPA 4G6VB 1WDDA 2B9EA 2N4CA 4ANCA 1RT7A 4R5PA 2E7XA 2QX0A 5F9LA 2WW8A 1HYSA 3E8OA 3BPDA 3UW1A 3PVXA 1JNZB 2MEWA 2MY7A 3H20A 3HZGA 2XC9A 5H9EJ 1N5YB 4WKRA 2C2NA 2F40A 3DOKB 3LTOA 3LF0A 4I7FA 5BYQA 5C25B 1QSYA 2EFOA 3CD7A 1SI9A 2ZH1A 2R2UA 4J7CA 2MKKA 4Q8EA 1C1CA 4ZN1A 4Y00A 4LVNP 2VJUA 1M5KC 4QCLA 3IS9A 3CIMA 4RW4A 4N47A 2GS8A 4RNMA 4DL4A 1XMQF 4JI1J 1WI8A 5KFRA 4L75A 4OFZA 4N56A 5KG4A 2WONA 2AT1B 4DQSA 1XWLA 3JQMA 1VQLS 5IFMA 1VQSA 3HDSA 2JEJA 1S1UA 2DO0A 1NEEA 2FGCA 5LMUF 4B9UA 4YEAA 3C2PA 1X4EA 4P72A 1CJVB 1S4EA 4YR0A 2Q43A 5DM7Q 3C16B 3JQJA 1PJ7A 5CQGA 3W1YC 3MEDB 4F02A 1RHQB 2E7WA 2VDIA 3NY0A 4I7FB 7FDRA 2CNNB 3LAMA 3PYDA 1N6QA 4OI2A 2LDIA 2YNFA 3PTWA 4LF6F 1WDTA 4C3MA 1UZDA 3TI0A 4DV3J 1O8BA 1U09A 3UPFA 5L1KA 5KFWA 2VIHA 2XNQA 1TL7A 2K1RA 2DH8A 3UI3A 3KLHA 1QVGR 1M1KT 2CG4A 3HSJA 4N8OA 3IFEA 3EZOA 1QM9A 4KR0B 1WSRA 3UD4P 3U02A 2YWGA 4XIUA 2H5JB 1AZSA 3RAMA 2BKNA 1FJGF 4WE1B 2YX4A 4NRUA 3HHNB 3MM7A 4R25A 1NHUA 1AT1B 1S6UA 4BCAA 4OIXA 4V1Ak 2CZ9A 2CQ1A 1MMNA 1TKDA 1X4BA 2QO3A 5CYMB 3GCWP 3WX4A 2J7WA 3MR6A 2PI5A 4MMOA 1NHVA 1TP7A 3GFYA 3OV7A 2KG0A 1FI4A 1DTTA 1RE1B 2Z4PA 5KFLA 1Q79A 3ETMA 4FF3A 3B4DA 2O5DA 2QT7A 3DCAA 1EP4B 3ONQA 1KNZA 3IGVA 4H4MB 4TY9A 1FK9A 2NR0A 1HQEA 4P10A 4KGZB 1M5OC 3G6XA 4F4XA 3IMQJ 5FLXU 1UVIA 4N5SA 3MHYA 1WNEA 3KFWX 1RCXB 5SZTA 1JNRB 2A18A 3CJKB 1SKRA 3O3LA 3N4WA 4DL7A 5KT7A 3GIKA 4LSLB 3N28A 4DZ6A 5I3UA 2E5JA 5KFCA 4NEZA 4ES1A 3A12A 1ZZNA 1WHVA 5B0AA 1SUQA 4FBTA 2KHDA 4OYAA 2NS1B 1OIAA 2NPIA 4QR2A 1LFPA 2YKMA 3CVKA 4HTJA 4O3NA 3KUHA 4TU8A 3MUTP 4K0KJ 2QEXS 2KYZA 2GJFA 2AF6A 2EI5A 1TR0A 3CJ5A 2CJYB 2MQMA 2B4OA 2IM3A 3DRSA 2IAJA 4WJBA 3W63A 3AJDA 2HQGA 5C5JA 3PV8A 2AJFE 4H4MA 1XNRJ 1WC0A 3QT5A 2FJWA 5C7PA 2BBEA 4GKJJ 1SPBP 4OYMA 2CQBA 2UUCJ 1REGX 2I5JB 1TUGB 4IRDA 2P9CA 2LEPA 2OPSB 2QIFA 5DLFA 1S7IA 3M8PA 1NDPA 3M8WA 1RKJA 4QIEA 2W9AA 5EUHA 4FF1A 1U2CA 3DFEA 2WVBA 4B02A 5C2GA 5B0EA 4M5GA 3D7SB 4CLWA 1TVRA 3ENWA 3TO8A 2RU9A 5J1EA 2OKQA 2CA9A 4ZJQA 4ZPWR 4C8LA 3A8EA 4NLDA 3A8KA 4ID8A 5ETRA 4OZ3A 1PSDA 3ZZ0A 3BR8A 4CLTA 4A8KA 4NLSA 1X0FA 4CTAA 3SV4A 2GGPA 2XYPB 3I6PA 3FSIA 2QLJB 3UO0A 2B5JB 4F4WA 1GMUA 4C2MA 2RRAA 3ZZZA 5EX3A 4F67A 3O2IA 3PJ9A 5H1SV 1F5BA 4AXJA 2W24A 2GVDA 3DYAA 4OJ1A 3CJ3A 1BQXA 3GE9A 2G0IA 4DV1F 2PE8A 5HI7A 2ZBRA 4C11A 2N82B 2DH9A 2OPRB 1Q8KA 4J37A 2ADBA 4P9SA 2OFGX 2RB7A 1FVSA 2E1AA 2GZOA 3DHXA 2QFIA 4P7TA 2M9KA 5DDRC 1DRZA 5AXKA 4EU0A 1JLCB 3UD3P 2P5VA 1FNOA 1CS4A 6FDRA 1EB0A 2BRKA 2KM8C 4K4ZA 4IH5A 3GJSB 4O44B 1DZ5A 2CWKA 4LSNA 4K4UA 4LT6A 2AEFA 3WIVA 2VODA 3PW0A 3VAMA 1FX4A 1VI7A 5D8HB 2VQEJ 1XNRF 3DLGA 2MZQA 2D74B 2V0NA 5D4LA 4I0WA 5KFNA 5L1IA 1F0XA 3CJTA 4H54A 5GAGU 3G8TA 2BZ2A 2XNRA 2APOA 3MZIA 2XMJA 1TL1A 2YWHA 2HQIA 1KR4A 1S1WA 2HLTA 3DKDA 3G82A 4OYOA 2KDOA 1HLWA 4ZCMA 1S1UB 3L7PA 2JH3A 1U8SA 3GYGA 1N0VC 4QZVB 5K14A 4LF9J 4F3MA 4YB6A 2XMAA 2LP4A 4DEZA 2QG9B 3QZ7A 1T05A 4UY85 2J9EA 4A8XA 4DV0J 1XTZA 5D0GA 4JI7F 3G6VA 5T14A 1DTQA 1HL6A 5LMUJ 1AYEA 3VAHA 1L3UA 1S6PB 3B6BA 4DQRA 2I38A 3QMQA 3QT8A 3MM5B 3Q86A 4ZVUB 2WCXA 3H5UA 1HYSB 2WAQD 2G0JA 4DUYJ 2IM1A 4NWBA 4DF8A 2GIFA 4ZCIA 3ZTOA 2HK3A 3JB9k 2ZWOA 4XPCA 1SXLA 5C25A 2NYHA 1D8YA 1U0SA 1X0PA 2XB2D 3CMQA 3ENVA 3I32A 2Z57B 1NCLA 4USMA 5DLGA 3KK1B 4KH1B 2UU9F 3VQSA 1JIHA 1NK9A 1QE1B 2HWIA 3AHPA 3KHHA 3IRXA 3MTJA 4OYBA 3MPUB 3JSMA 2NXUA 3R1LA 1UVNA 3H25A 4ID5B 2RQKA 4TLRA 4DUTA 4U7UK 1R0CB 1PG5B 2H1YA 2I1RA 4ZP8A 3ILLA 3CPWR 4JI4J 2YQ0A 2ZE2A 2J6SA 3HI9A 2F1FA 4IG3A 6FD1A 2GO9A 4O3QA 4RUAA 1FT8A 4H4KA 1FE0A 1FO1A 3FUYA 3DRXA 4RW7B 2ZJQQ 1RT3B 3HKWA 5CD4A 2N3LA 3IM9A 3C16A 1WC3A 2VG7B 2D9PA 4IKAA 1N5QA 4ECSA 1X9WA 1HR0F 4J9QA 1UW4A 4ED7A 3VVTA 1K0VA 3JTPA 4WFXA 1SIZA 3DOMB 1ZETA 2HIQA 2XHWA 1LNQA 2V9KA 4EUVA 2QSFA 3MUVP 2UUTA 1RJJA 2L9WA 1U2FA 1ELOA 1X4FA 3UN2A 1F6TA 1T9YA 4ICLB 5HJYA 1UVMA 2KT3A 3OR1A 2VDHA 3LANA 4WXWA 5FD1A 2C2EA 1Q95G 2ALZA 2JZ5A 1NK5A 4M63A 2ZDOA 2W2QP 4NA3A 5K8MA 1Q7LB 4ZVPB 2Z8QA 2HZVA 1KP6A 3SQOP 1ZA2B 2PMHA 4MFBA 3C19A 2C2KB 2FVRA 4NCGB 2JJ4D 2E1MC 4DR2J 2HFVA 4CTAB 4XDCA 1F3FA 3RBEA 3CD6S 2HBQB 3TJ9A 1KSPA 1T7PA 2V6AA 1RYRA 1T3OA 2H5EA 4GMKA 2D41A 3HPOA 2H54B 1XMQJ 1EJ7L 1V3RA 3TA0A 3J7ZT 1VJQA 4NLGA 5MLCV 2UXBJ 4HHJA 1DHMA 1PBAA 2OGUA 3MF5A 2DGUA 1GT8A 3LWMA 1MW7A 3MAAB 2DIVA 1RHMB 5IXUA 3GP9A 4LFAJ 4U67Q 1OJ4A 2MLXA 5D3GA 4LREA 3Q8YA 1CS4B 3W7BA 3M6UA 1IBCB 4Q7AA 5KFYA 1OY6A 3C46A 1EARA 4PCQA 2LU2A 2AMCB 2Q6BA 3DLJA 4OZ0A 3B4MA 4ZOSA 3HP6A 1UWBA 3EE3A 4MIBA 2BJ8A 1QSSA 2BYCA 4F2SA 3GV8B 1I5OB 4BLGA 1X4DA 3PHEA 2V4JB 5HMZA 4JI0F 3VTIA 1WC6A 2R2SA 4DR3F 1CQMA 2BA9A 2PFDA 5HQ8A 5HROB 3K8WA 4P73A 2GHVC 3TQ1A 3RB6A 1CPZA 2CZVC 4YY3J 1VR6A 2DNQA 2V9WA 1EETA 5E0OA 2DNRA 4NX9A 1KEKA 3V6JA 2WBRA 3G6ES 3M9OB 2X3GA 1UCNA 3FEXB 3D28A 4ZPCA 4ZK7M 1P6TA 3NCRA 3VGSA 1LWXA 2P6TA 3CCSS 1UA0A 4N76A 2WB1D 4JYAF 2IA6A 2OPQB 3THTA 2E1PA 1FD8A 2K3KA 4LR7A 3SFGA 3THPA 2E1CA 4F50A 3QIDA 1BWVA 3BSAA 5HVGA 4TU9A 1JLAB 1RK8A 3GIJA 1FRKA 3O1LA 4GO5X 4I56A 2HBZB 2FUG9 4K8RA 3FDSA 4RJVA 5ETLA 4JI3F 2UXCJ 1B64A 4EMDA 5HLFB 1XIQA 4Y2KA 3RBZA 5DDQC 3BF4A 3GR0A 2L9DA 5DO2A 4EZ9A 3QRPA 2VPXB 8RUCA 4ED3A 1E6YA 3PJWA 1A9NB 4CLPA 4DX5A 1LEOA 4CCHA 5LJ3Y 1HPZA 4OLOA 1S12A 3LOUA 2M88A 4C0OC 4Q8FA 2RQ4A 1LOUA 3MECA 4ILRA 4K59A 1N52B 1DJ0A 2HFSA 4ZLLA 4ZIWA 4EBCA 1C1BB 2H48B 2NYIA 3T9NA 5LXYA 2HVDA 2VKRA 4IFVB 4UUXA 1N32J 2NUUG 3NKYA 2OPQA 1M0SA 3AH6A 4TY8A 1RHKB 4OZ5A 3J81U 1RTDB 2OD4A 4NA1A 2AV5A 5J2PB 2DRAA 2OPPB 2QYCA 5IT9Y 3BV8A 4QU6A 2R8IA 1FWLA 2R2TA 1Y4ZB 1ZM4A 4AL5A 3CCMS 3PIOQ 2XG8A 3RBXA 4DQIA 1ZA1B 3MMCA 1JMTA 2HFOA 4F7VA 1VRUA 1MLAA 2HNDA 4ZLJA 2LECA 3ZXWA 2OIHA 3G87A 3BO2A 1CJTB 2H4WB 2EKNA 5AXNA 4NYZA 2YNIA 4J9MA 3V81A 4WFYA 1FVQA 2GCFA 2DB1A 4PXDA 1XNQJ 1LKZA 4UT4A 1FRJA 2CNLB 3HFVA 3MMAB 4NL5A 3T19A 5KT6A 5GAHU 3PR4A 1NDCA 3QSYB 4F2RA 2IJFA 3QT6A 1A0OB 1B7FA 1R31A 3PW2A 1P8GA 2XMWA 3FBFA 3KJVB 2W2OP 4B9LA 1PC4A 2FZKB 4GVBB 5CH7B 3MMBA 5DG7A 2LFVA 1X7VA 2NXNA 3OXFA 4QIWD 3J7AN 1Z4UA 3LWLA 2O3DA 5KG2A 3MFIA 1N5YA 2K3IA 1S0MA 4CRJA 2YNHB 1M1GA 3MEEA 2YPZA 2AYMA 4CNZA 3HVRA 1U1KA 2RVJA 2DTJA 4DR1J 2HS0A 4E8UA 1Q1KA 1BD6A 3TZWA 3H40A 3PYGA 1MWQA 4DLEA 4OQJA 1LWEB 1N5VA 1TV6A 3TQEA 5F8IA 2MQLA 4FYXB 1WEXA 2DNLA 3MM6A 2HNYB 2HW3A 2G9OA 3SCLE 4YDDB 1CJTA 3HT3A 1NLKL 3I96A 3V81B 4M5LA 1U1MA 1ZYQA 3R6GB 3W3SA 3KLGA 2H3EB 3A3OB 2EFVA 2D3ZA 2XCAA 5JVHQ 1Y5LB 3PEJA 4NCGA 3TA1A 5KOWA 4NXNJ 1HBNA 1WJ9A 1KC8T 5DG8A 4ZCKA 1HBOB 1K47A 4I2PA 1Z1ZA 2KFZA 4OJHA 4JI8J 1C0UA 1FRIA 1XMOF 5DRKA 2YKQA 2W4CA 2OJ3A 3DDIA 3TNVA 5A8KB 2E7VA 4CIOA 3CCLS 1WF0A 3HULA 2KVQE 3OXGA 1FKPB 3Q0AA 2HHPA 2LCWA 9ATCB 4FVCA 4WWSA 4DXLA 2CPXA 3LP1A 1QSLA 2HQDA 2PD1A 4P2MA 3S6EA 1N0UA 2OUGA 1N32F 2XSJB 3OTOF 3US5A 2KJWA 4DZDA 1UFLA 4NLQA 1RT6B 1T9UA 3P49B 4U7UD 3M1VA 1U48A 4KB7A 1RABB 4F3QA 2ALYB 1Q16B 3CUNA 4LF7F 4LF9F 2Y8WA 1KVKA 1AZSB 2JEIA 4IG0A 4KSEB 1JJ2R 1FF2A 3CT9A 1CBKA 1UJ6A 4IQXA 2B9WA 2M52A 2RQCA 1BQNA 3FCHA 2BW7A 3U27A 4YN3B 4OHXA 2XGPA 2ZBQA 3HHDA 1T9XA 2C2RA 4YB1P 2N3OA 1VQ8S 2LA4A 4KO0B 2YKMB 4ZPTR 3OVAA 1E6YB 4QQBA 2YXLA 4OL8A 1HMVA 2IA0A 2MLYA 4ZHRB 2DT9A 1RGVA 3NEKA 1N34J 5CYQA 5HN0A 1WUUA 2VPYB 1B0PA 4WYWA 1LWCB 1RCOB 3UNYA 4K4TA 3FGVA 2QTWA 1FNXH 1CJUB 4DX7A 2ZHOA 4O44A 4HT5A 4RX6A 1VQKS 2RMLA 2HEKA 3RUBL 3SCIE 2MSSA 4F4AA 2J0XA 3AODA 4Y2CA 1RWWB 2ROPA 4WTOB 1I94F 1LK7A 4AQYJ 3CMES 3NNHA 2VFRA 5C24A 4OHYA 3IWLA 4IOCQ 3N01A 1IBMJ 2LU1A 3TVKA 3QO9B 3WIUA 5F0UA 2HHHJ 2MHEA 4ZDNA 2YQ3A 3KWMA 2NSCA 2IJNA 2XY7A 1SJQA 2M8DB 3NS5A 4KTQA 4PYDA 2A1BA 2Y1IA 1S1WB 3VZIA 5LT5A 1I6JA 3A4TA 3EM1A 1G2EA 3M8RA 4J9UE 2DITA 1MMDA 2F3JA 2Y9HA 3HSGA 3HHLA 1S97A 2NXJA 1WEZA 1PBUA 2ADCA 1NDKA 1YG0A 2VASA 4I68A 2JHEA 4DPUA 2V69A 2WVDA 3J81j 3JYTA 1HNXJ 3RZAA 4RKUC 2BRLA 3QNWB 1EQ0A 2RKIA 4KE5A 1H38A 2GQ2A 5J2NB 3VVUA 1N48A 5EWGA 4JI6J 1VCTA 2NPFA 2AD9A 3VWSA 3I0RA 1SL1A 1VQ5S 2UP1A 3POTB 4I2QA 5BJRA 1DQAA 1KLNA 3BREA 4KFBB 1RAHB 3QJLA 1U0HB 2O1PA 2Y0SD 4DR5F 3EPIA 2J6UA 2CDQA 4X2BA 2DBBA 4XK8C 3VGTA 3SV3A 4X4SA 4UW2A 4DL5A 4MYTA 5DGBA 4DUZF 2KN4A 4ZLPA 4UOGA 2OSRA 2AWZA 3BYRA 4FP9A 1JQGA 4CLYA 4C8ZA 3H90A 5JXSA 1WC4A 4I4BA 3FK4A 4QW8A 3KK3B 2ZE2B 4C8NA 4ZVFA 4PR6A 4Y65A 4M1KA 2KTQA 3I31A 1L3KA 2GQCA 3GONA 2XZWA 3MPWA 1S4FA 5DDPC 3WQPA 3OHBA 1VDHA 1ZOTA 3RW7A 1QLNA 4DV0F 1YGYA 1XJWB 2XEXA 3ZTPA 1A6LA 3GR1A 2ASDA 2EC2A 3ISND 3H4DA 3NMAA 2BKOA 4OJ3A 4Z7CA 2F4FA 2PA3A 5ETKA 3D9BA 4O0NA 3DHWC 2O67A 3N79A 2KYXA 5J2QA 1MSWD 4DU8A 2KM8B 3A3NB 1VQ9S 5AT1B 2EXUA 3W64A 3EUNA 4NASA 1FK9B 3NG8A 4WYLA 3FKBA 2MGZA 2ZUAA 2Q66A 2B3TB 3Q8PB 1UVJA 2IY5B 2Y1JA 3UDCA 1ROFA 1JLEB 1YJVA 3OVSA 4QYZK 2ASYA 5IS2A 5EDWA 1JX4A 5AJ3F 1OQ6A 3JSMB 3ZZTA 5D4OA 1D0EA 3R5CA 3GSIA 1JB0C 3ZNUA 3GV5B 4DV7F 2FJBB 2CJKA 3OR2A 3SSRA 1PYTA 1S6OA 3LO3A 1RXOB 3C14B 2AJ1A 1O51A 3RRGA 2LA6A 3ZZYA 1RAEB 2OSQA 5HMXA 2ZM6F 1APSA 1D09B 4K4WA 4PWWA 2NXCA 2D3O1 4A8FA 5CXTA 2E9RX 1R6VA 3BQ0A 3HX9A 4D3GA 3D1HA 3TWZA 2CJBA 2ZZNA 1H7XA 2MYFA 3OL7A 4OV1A 2YNHA 4OLPA 4C6AA 2U1AA 1HHQA 2K1RB 4DG1B 4BBYA 1LV5A 1MU2A 2VZ9A 3PO5A 3RAQA 2XMMA 3ZFVA 1RWKB 3GIMA 2HWTA 5A8RB 4KHMA 2HBYB 2GHPA 2Q79A 4FKYA 3C66A 3UD5A 1ZM3A 4CYUA 4XAKA 4LF4J 1PAEX 3P45B 3J80Y 4DSFA 2ZZTA 5D4PA 4ES2A 6AT1B 4U7CA 5JMNA 1BQNB 2O01C 2XWXA 3CO9A 3UWTA 2KZMA 1YRXA 1OMSA 3N5BA 2GGPB 1QTNB 3MPYA 3EVMA 4QIGA 2XBPA 9RUBA 3PO4A 4FXWA 3W9IA 3DOLA 1N5SA 2HKEA 3SSSA 3OUYA 4ATNA 1FESA 2ILYA 4DFJA 1V3ZA 1VQ4S 3GWCA 2NSBA 2YY3A 5D6GA 5CYQB 3BPSP 4WK3A 3K5NA 1VC6A 3D66A 1NB7A 1K8AT 4CLZA 3T41A 1RU1A 3K59A 3DU5A 3T5LA 2XY5A 1HQEB 1NJIT 1W26A 2JVOA 3R5AA 2VFSA 2AHOB 2ZM6J 3H2UB 3N6MA 4NOHA 1XMBA 1B4SA 3E01A 4LF1A 1LWFA 1GX6A 2M7SA 2YVSA 1VHIA 2Y3YA 3HXMA 1JJHA 1OWXA 4USTA 1M5HA 2H65B 4RNHA 2DVIA 3TJAA 4HL9A 1UWAA 1Y9OA 3CJRA 5KFKA 2QA4S 3TAQA 1XNQF 4UOCA 4DR6F 1PIEA 1RBAA 2M8HA 2A6OA 4TQSA 3FMBA 4CLKA 5DQIA 1ACMB 2QA4G 3KHLA 2BMBA 4FNHA 2MSTA 3NOCA 4P2SA 5AE2A 1HIYA 4KRWA 2G2OA 3U1MA 1QVFR 4LMZA 2V50A 5D4NA 4QIVA 4Y2AA 5T41A 3D2WA 2F5GA 2A6MA 4PABA 4HH1A 1HD1A 4PG8A 3KDNA 4Z7YA 1P9QC 4YHHF 4C9DA 5E3CA 5IQQA 3R5DA 3NRBA 4DR2F 4OI3A 1C1BA 1JLFA 4V19J 2W01A 3DXBA 1NJXA 3RJMB 1CC8A 4IH7A 4P75A 5J2NA 3TJ8A 1I94J 1WORA 3HD1A 3K2YA 1LQ9A 4O3PA 4KC5A 4ECQA 5D3GB 5KFDA 1SKSA 4MAKA 4KHRA 3TUZC 3DLLQ 1UTAA 5HO4A 4QWAA 1LFWA 4DV1J 2CQIA 1KQGB 3CCVS 1YKWA 2K2PA 3NLCA 1BY9A 2F9DA 1IKWB 2ZWPA 3NGRA 2MY8A 4Y2IA 4CLLA 3IWNC 4MTPA 3G9CA 4LQ9A 5BR8J 3LPEA 4WZQA 4EO8A 1RI7A 3PIPQ 3QRQA 3O6QA 2RDJA 1YJ9S 2FLOA 2YX7A 3AA8A 1J27A 4YQWA 2LKZA 2MQPA 1NSKL 3DI6A 5DZ7A 2QLBB 4RNFA 2HG4A 4PPDA 4QU7A 2AZ3A 2RHQB 2KT2A 4RLEA 4EBDA 2IMWP 3MOJB 3QPIA 1Q7YT 4B17A 4W92B 2JC1A 2JL9A 1D3WA 4E0DA 1U6ZA 2BJ7A 3GG0A 1JLCA 3EXCX 2ERRA 2OTJS 1R8CA 1T9VA 2LXFA 4IFVA 1FRLA 1RA6A 4DBQA 4Q2LA 1RBOB 1NZAA 3D6FB 2RRBA 3FRZA 4GO7X 5GAGI 4H4OA 4CH1A 5J2QB 2YNFB 1UP1A 2AJ4A 1EP4A 1FJ7A 5J2MB 2HBRB 5RUBA 4DR7J 2VA3A 1VK3A 5JVGQ 1ZZFA 2DGVA 5KTQA 4WFBQ 1GX5A 5F8LA 4ER8A 3PX0A 1B7YB 1U47A 1GTEA 3I0SA 2E5LF 1IJEB 1NMEB 3N9UC 3M32B 3FVYA 1TKTA 4RBUA 2Q3PA 4ZVGA 5CD4H 2CAJA 1G1XA 2WSFC 2DNHA 3GJQB 2ABYA 2ZH9A 2N7YA 1RYSA 1AA1B 3TUIC 4ZP6A 1KVJA 3PNIA 1Q8LA 3KK3A 1NSAA 2I2YA 1RACB 4KQZA 4LF4F 2RE1A 1GXUA 2RD5C 1S59A 2JVRA 2ZC4A 4ZS6A 1SC1B 3S01A 3R5BA 4PUOA 1B99A 4C3KA 1TUWA 3OFHA 5KFAA 1HD0A 7FD1A 5LSOA 2D69A 4K50A 4ECUA 3L4BC 4LRBA 2YKNA 1N33J 2MLZA 1TELA 1U1PA 1R0BG 1U7LA 1F60B 3OTBA 3BN7A 1WHWA 4USKA 4I6WA 3MAQA 4HYKA 2E9TA 1KHVA 3M05A 1HQUB 3IN5A 3D1QA 2QYGA 2YWEA 1NKCA 2VUGA 4DPXA 2IM0A 2XI3A 3DMJA 5KG3A 2E5GA 4P74A 3IAM9 2CKWA 1WI6A 2RNEA 4X64F 1EKRA 3NMRA 2CPYA 3J7YI 1FKOA 1VBKA 1V5VA 2X7IA 3M8QB 1D9AA 3MI7X 4BS2A 2NXEA 2WHOA 3HZEA 4WIQA 2HHTA 1WC1A 4DN0A 3TW0A 8ATCB 3OJSA 3CIZA 3NGSA 4DDFA 1RAIB 1HNIB 2X1AA 4OYZA 1OYEA 1R43A 1WKLA 1RT1A 4M5DB 1H0HB 2V4JA 4KT0C 2WW4A 1S1XB 2P9EA 3FSXA 1GMWD 2OEJA 2HNZB 2CZ4A 2R8GA 4NI2A 1BWEA 4WP9A 4FVMA 2JDJA 3P3DA 1RHRB 2DNOA 5SUHA 1NAQA 4PQUB 2WVEA 2B9YA 2YBVA 3BM7A 4OI6A 4LBHA 5D0HA 3M2UB 3ILJA 4ZIVA 2E9ZA 1IWGA 4C0BA 4KGMA 1KOOA 2PEBA 4B3MJ 1HNWF 3S1TA 3CWJA 2X1BA 3MEKA 2DGWA 1CJUA 2DISA 3CDAA 5E5NA 5KFXA 3LP0A 3M4XA 4DCJB 5IWAF 4IR9A 1URNA 2BE7D 1X9MA 4DR6J 2OFHX 4CO3A 4MK8A 3M8PB 4USIA 5IT9U 3M30A 3X3UA 2FLPA 3JAMY 1HI8A 5EWFA 5L1LA 3OSPA 2W9BA 3OVBA 2UV8A 3BQ1A 1RTIA 1VMBA 3M8ZA 2VBXA 4QBUA 3D0IE 2LLZA 3CCQS 2ATLA 3I87A 3W66A 1TAQA 1IBKJ 1VQ6S 2BEFA 3MEGB 1ZM9A 4KGVB 2F9JA 2VA2A 4IG0B 2GVZA 3FNNA 3PW4A 3IR7B 2GMHA 3N6NA 4B9MA 2JFDA 1K1QA 4RWWA 1YJ7A 1TMMA 2B5JA 2BV3A 2M2BA 3PDNA 4WP8A 1OPZA 1TL1B 2WOMB 1QAYA 3MM8A 2B6AB 2ZHAA 3K17A 1KHWA 2QL7B 2DXEA 1FX2A 2E5HA 2ZC3A 3TVZA 3U7JA 4P7VA 5F8MA 4ZVSB 1Q81T 4Y0FA 4URGA 4NMXA 4RUHA 4RU2A 3MAAA 2JEFA 5BYSA 4OZJA 4A4JA 1HWLA 2HHWA 4UOFA 3ZZOA 3IAS9 1S0VA 4QPXA 4KGKA 4PXCA 2GIQA 3KYLA 1FD2A 1VRQC 4CNYA 3NS6A 3QLHB 2VOPA 4ERDA 3BKFA 3GJRB 2LQBA 4QR0A 4C7QA 3BSOA 2W2PP 1T94A 4EYHB 5HBMB 1HNXF 4F8RA 2ZKUA 3GIIA 5FDLB 4F4KA 2BANB 3LQVA 4CT8A 2E66A 4ZVOB 3D3BJ 1OQ3A 4X4TA 3SEOA 3MWBA 2L08A 3ETOA 2G13A 1HNWJ 1IKWA 1IWAA 4WIIA 4DL3A 1RT4B 3I5BA 4W90B 1GMWA 2XS7A 5HMWA 2DPJA 2DXDA 4O4GB 3R9LA 1TKTB 3CSKA 2AYEA 5I4MA 2HVIA 5F41A 3C15A 4LRCA 1UJ4A 5DQHA 3EXYA 1FDBA 4L74A 3PACA 4Y28C 3ZC4A 1M1HA 2MKSA 3AOBA 3R3TA 4HACA 2BABA 3P5TL 1R0AB 3MD1A 4O3OA 1RZMA 1FE4A 2L9NA 3HFKA 4ECXA 3TA2A 4OHWA 1QD1A 4PZVA 4B3SJ 3RYLA 3T1AA 5I3QA 1UMJA 2IRXA 4NMLA 1FDDA 2VG7A 2N7CA 3EDRB 4ECYA 3K5OA 1M5PC 1Y0HA 2F4VJ 3DRRA 5AJ3J 2H4YB 2MKIA 4Y3CA 4M95A 1SQFA 2LVWA 2HGMA 2GA7A 4DPYA 4PQAA 4CLSA 2Z56B 1YBAA 4ZCLA 1OSDA 1X5PA 4E98A 3LP2B 2CUYA 4F25A 2VG5A 3OSNA 4NLTA 4OX9F 2IRYA 1T8EA 2XY6A 3J81Y 1J5OB 1NXIA 1RWVB 3FEZA 4DV4J 4X4NA 1HNZF 3M32A 2ACYA 5CCMA 1TL3A 2RAQA 2CQGA 4ID5A 3BSCA 1U1LA 2ZH3A 2RT3A 3RRHA 1FJEB 4LVOP 2V63A 2Z58B 1AXQA 2HQ3A 3AY0A 2ZHBA 1U1QA 2AQ4A 3HLUA 2DNZA 3J7Z5 2AEMA 2R7QA 1J2VA 4OZ2A 3RR8A 4D3HA 5LMNF 2WSEC 3QGPA 4YMEA 4YUDA 3VAGA 3T5JA 2XSFA 5HP1B 3T1YF 1S72S 3H98A 1DTQB 3VAKA 1C0UB 2A3JA 3HJFA 4ZMMA 2HHUA 3W8GA 3QSIA 2X51A 3AXKA 2AIRB 3HKZD 5KFTA 4JI1F 4DR4J 2UZAA 3G8SA 2RF2B 4PG5A 1JXLA 4DOZA 4HHUA 4RW8B 1HWJA 4B3TF 2HVZA 4QR1A 2AX1A 1UPMB 2LQ9A 1SC6A 1IKXB 1HA1A 2XYGB 1XEZA 4CYUB 3K89A 2HHXA 3U1NA 3W5YA 4N77A 5HSPA 4JYAJ 1TU0B 3KDOA 1RHJB 3F41A 3RB4A 2JX2A 1T02A 4LFAF 2OEKA 3VCDA 2UVRA 2BJ3A 2FTRA 2CPHA 2KZZA 3PKMA 2EBEA 3EVOA 4YY3F 2E44A 1RTHB 3DC2A 3JAMU 4FS1A 2BE2A 4O3RA 1Q5YA 1U6BA 3W2VB 2IYIA 4PEOA 1X4GA 4DR1F 2UUAJ 4PQUA 4DV4F 5EWEA 2IM2A 4LF2A 1F9FA 3DU6A 1KWMA 3TAPA 2MQQA 3J80U 1V3SA 4MH8A 1NZ8A 2GAGC 4DFPA 4AYBD 1D1UA 3W9HA 2DR7A 1H6KX 1G3OA 2HS3A 1UVKA 3QLHA 2YKAA 1IBKF 2CQHA 2V68A 4PG6A 1MMLA 3ULHA 4PRFA 3RB0A 5KFSA 4DN9A 1FCAA 1WF1A 2WZ1A 1HI1A 3H59A 4FZVA 4G1IA 2J76E 4QOTA 5K8NA 3QWUA 4AL6A 4BHQA 2J0QD 4YS2A 5DM6Q 3O5TB 3CEDA 4X4QA 2AGQA 4B9SA 3DM2A 2FJEB 1RDRA 2WB4A 4U8YA 4WE1A 4JBCA 3ELHA 3PW7A 5ETPA 3PW5A 1SJRA 1H2VZ 1ZAXA 3BYPA 3IGNA 3LH2S 1RTHA 1WOOA 5K5MA 1P1TA 1URRA 5KFOA 5THWA 4JV5F 2GQQA 2QLXA 4LSZB 1JLQA 2EKYA 3FSYA 1Y7PA 2WBMA 4TKTA 2CPDA 4E2FB 1WKJA 4YR2A 3EPGA 5HQLA 4ILMA 4NLWA 1EIYB 2EWHA 1YBTA 4DFMA 3IXQA 3T9ZA 3BBBA 3MECB 4Y2MA 3I4PA 3M2UA 4DSKA 3PX6A 1TKXA 3RU0A 2CJQA 1NKEA 4DS4A 4TNOA 1VBYA 2CQCA 1FA0A 4LF7J 2C28A 2XS2A 4TY8B 2HPUA 3NNAA 4GVLA 2P9GA 1P1LA 3EGZA 2Y8YA 4NRTA 1RLCL 1TUVA 1R7IA 3D3CJ 3D0HE 3R7SB 2J5AA 3DLHA 2ILZA 3QT7A 1X5TA 2B51A 3G71S 4TVAB 2VG5B 4DX8H 1HBMA 1NDLA 1MG7A 1C1CB 1R8PA 1SUQB 4WPAA 2J8SA 2WTFA 5ADZA 2AU0A 5AE1A 2V8DA 1YJNS 3MCMA 3TP2A 4DUZJ 1KRPA 3KKFA 4HDGA 1GK8A 3QRRA 2DGTA 3W2WA 1P9YA 3RW6A 2E1RA 2UXCF 3BZQA 1UVLA 3AA9A 3DDKA 4ZHRA 3Q8QB 1VQ7S 1S5ZA 3IG1A 4LF5F 5HL7Q 1QAJA 2RIJA 1VGYA 2DY1A 2YWWA 1WTBA 3KLFA 1DAXA 1HBUB 5JUMA 2MKHA 1UW9A 2V8GA 3N0VA 2QJ3A 3L09A 5T7LA 2VV5A 1XERA 2A0FB 2VG6A 3ET6B 5IM0B 4IO9Q 4R0EA 5H9EK 2C22A 4K2XA 1S6QA 2H51B 1VLOA 3GJTB 5B0CA 1NSQA 3R5GA 5GMEA 1EKSA 1RWOB 3AAWB 4L3KA 1LW0A 3UDEA 2BOPA 2FGOA 3VHQA 3DLKB 3KLIA 4RPFA 1PYSB 2CPFA 4QYRA 4L6V3 4FYDA 3K7RA 3BBFA 2UU9J 2VQFF 5A2QY 5BR8F 1Q8IA 1TV6B 3GG1A 1S9GB 3BKTA 3KUEA 2IRUA 3TANA 1VLYA 2XS5A 1MWYA 1ZAWA 4PG4A 1HNVB 3NCQA 3S8SA 1YQHA 3SXLA 1KOHA 3OTCA 5ETNA 3KNGA 4CO0A 1KTQA 1VIOA 3Q8SB 4DV2J 3MPDA 4MYUA 1F5CA 1S1TA 2RSQA 2M4MA 2PDAA 1FRXA 3TAMA 3DN9A 2YKPA 2W25A 3DGPA 4GKKJ 2KG1A 3KLFB 2ZNYA 2BM0A 5CZXA 3DLBA 3H5SA 5L38A 2WVFA 4USWA 4ITSA 4Y34A 3GFXA 4I2PB 5T7LB 4F4ZA 3NP5A 3I0RB 1X8DA 3GQCA 2BE2B 5F0WA 1QUVA 4EYIB 2OEMA 1FWPA 2J9DA 1PGZA 2DGQA 2DRBA 1SJ3P 1K9MT 3KG4A 5ETTA 4YFUA 1NH8A 1F9HA 3H2VE 1D8ZA 2H9ZA 1FXDA 3MGJA 2ZKTA 3LW5C 2PMZD 1NRKA 3V2UC 4PYAA 5ETOA 3L7OA 2VB6A 2ZVIA 2UVUA 1RQ0A 2XLIA 4ICLA 4NLPA 1RT5B 4ED6A 2L48A 4LIWA 4OI0A 3MR2A 4HEA9 1Y00A 3ZTSA 4I1TA 2C42A 2GMJA 1RBLA 3I9V9 2WONB 3HHLD 1EAYC 2DKOB 3MR7A 4UF4A 4ANDA 4DCPB 3RR7A 4JI5F 4B3OB 4KPCA 4ECVA 1RT2A 5D78A 2XQCA 3PR5B 1TL5A 4QJVA 2W4DA 3DRYA 4X4PA 3GCXP 5D77A 3KUGA 3LGNA 4KKOB 2BE9B 3R5JB 3QWPA 1YBUA 4G65A 4DSIA 3VZHA 4K4SA 5CZVA 4ED2A 2MJUA 5HP1A 3G6YA 3U1LA 1L3SA 2GX8A 4DL2A 3J7A1 2F8EX 2E5IA 1ZTTA 3PG9A 1N54B 3H0PA 4RW9A 1D9DA 1YWXA 2U2FA 2I8EA 3DOMA 4X66F 4JI3J 2YH0A 3DMJB 4N41A 1T03A 4ECWA 1HW9A 2BXJA 4C8OA 3LPYA 4RW8A 2C3PA 2VH7A 4IR1A 4Q0BB 2PI4A 2CPJA 1SCJB 2R7OA 4IDKA 3MM6B 1U6FA 3VAFA 1HFEL 1QJHA 3BH6B 1VYAA 1V5IB 4WFNQ 1X4CA 1J5EF 3IR6B 3CF5Q 3KLGB 4K4VA 3OR2B 1C0TA 4OHVA 3GILA 4JOUA 4ALZA 2DD8S 2XZDB 4USJC 3W5ZA 2QA1A 1TL4A 4WFZA 5GAEU 2HS4A 3CTRA 4V19X 3AD7C 4PKDB 2MTLA 4B3TJ 3BQ2A 3L95X 2HNZA 1R8BA 4A47A 1YJUA 2F8HA 4GRSA 3SFUA 5B0FA 1IXKA 1EETB 1O6XA 1JLBB 3Q83A 2W8LA 1WG4A 3Q2SC 3RB3A 4P2FA 4RW9B 2HHHF 4YP3A 3HO1A 1U4BA 3IC1A 4F0HA 3NCPA 5C2CA 1XR6A 2C3MA 2QC3A 2SXLA 3CD0A 3LAKA 4J9NA 2VJVA 3EJMA 3DRPA 3M30B 1FEEA 4Q45A 4C8KA 1DQ9A 2BANA 3HVTA 3NWGA 1KKHA 5H9FK 3FFIA 1YVFA 2VC1A 2IVYA 2B56A 3OTDA 4NLYA 2R8JA 1IR2A 1RT4A 5IWAJ 5F8HA 5AXLA 5CABA 2KXHA 3KK2A 1IBLF 3QAUA 3CJSA 4YDXA 4UQTA 3HSZA 3QFHA 5IC6B 1JXEA 2FJVA 3G96A 4A8WA 3ZTRA 2DGOA 2HURA 2GMLA 3BH7B 3CW2C 3TZYA 4ZA1A 1FKAF 1Q5VA 1RISA 1CJKB 3QJJA 3ZZPA 1HWIA 4OZLA 4C3LA 3ENAA 4HACB 4EK2A 1Q0NA 2AYBA 3E2EA 2PGCA 1ULRA 4U6PA 3H7HB 5B0GA 1B0TA 1T3NA 4DV5F 5G0RB 3CDEA 1RTJB 3R2CJ 1FJCA 2GJIA 3ISZA 4LF8J 3TYTA 2EFPA 3MCSA 4UOHA 1SH3A 3LALA 2RKIB 1IJFB 1RAGB 5LJ5Y 4ZPAA 1HARA 1W7WA 1P27B 4X62J 2CNKB 3K0JA 1VS3A 4I67A 5L39A 2LYVA 3POTA 5CCLA 1M90T 3QGGA 3CD5A 2C2MB 4R8UA 3MM5A 2R3VA 3FFIB 3QGHA 4CDIA 1RTIB 1SKUB 4ELUA 4YHHJ 1X9SA 2DHSA 1BQMA 2KFYA 2CPZA 1NM2A 5J2MA 2IMOA 3MEGA 3Q89A 1RSCA 1FFGB 2Z2LA 1JK9B 2A10A 2CQPA 2GVZB 4AT1B 3IBCB 2AP6A 5HMYA 1TL7B 3M9MB 1UEUA 1H2UX 3SIPB 4AE5A 2LQ8A 3QGIA 4JV2A 1HNVA 3V6KA 1NK8A 4DV6J 4RL1A 1A7GE 3NGUA 2DIUA 2FQQB 2W9CA 1WHYA 2VFVA 4EI2A 2Y0BB 3W2WB 5A8WA 3AJ2A 5DDOC 2JLGA 5ETQA 5G0RA 2XLKA 4BC7A 3BN4A 2HQCA 3HHLB 2PA8D 3KHRA 2G2YA 5KFHA 4NA2A 4JI6F 2KB2A 2HGNA 4Z2XA 3TRGA 1Y10A 2K7JA 4YOEA 5CHCB 4FDFA 1NK6A 3F73A 1S1VA 2DHGA 5B08A 2DGXA 2HLUA 2UUBF 4LSNB 3GU0A 1Q4RA 2AW0A 2F7VA 2OHDA 3T1HJ 2VFTA 1YZ6A 1VQPS 2V94A 1N6QB 3V6DA 3OQ2A 3KMSA 3GPAA 2MKYA 4ZPVR 1HW8A 1KFDA 3BO3A 4J9SA 2FVSA 3MPVA 3HHKA 1T03B 4LRFA 4PAAA 4DR7F 2I6WA 1DBDA 2Z2MA 1IKXA 4ENOA 4ED1A 2HNYA 2J7KA 3QJPA 1HHSA 4O4GA 2MPUA 5D15A 4A8MP 4DX6A 1YIJS 2IBKA 4M94A 1ZBTA 1KVIA 1FRHA 2P2CB 4N8NA 1U25A 3KLEB 2DYAA 1WELA 2YNIB 2WRMA 4FS2A 3WZ0A 2ZITA 2HFZA 3NNCA 4KKOA 1WWHA 4JI2F 4ZVEA 2UV8G 3TEHB 4DHVA 3TZZA 4LF5J 4ETZA 2QMUB 2XI2A 1NK4A 3GTYX 5CYJA 2FZCB 4X66J 1UZHA 4QWDA 4YB7A 2FC9A 2ZNZA 5KT3A 2P6SA 4RW6A 1RTDA 2ZBPA 3UVJB 1VRTA 4WK1A 1BUXA 1SJ1A 2YNGB 3CMAS 2X1GA 2JRSA 3EWGA 1NPPA 2K8GA 4C0HA 1RWPB 1XR7A 2HIYA 3TVYA 2DY9A 1L3VA 2FJAB 2YH1A 3MMCB 4Q0BA 2IVMA 2KJVA 5IQ6A 3BDEA 4FKXA 2CRLA 8AT1B 4DSEA 4CM0A 2ACMA 2BQUA 4DV7J 2ZVSA 2JC0A 3FRYA 1RWUA 5LOQA 2LXUA 2YTCA 3AD8C 4FYVB 4OX8A 5E41A 2UVWA 3C3LA 4JI5J 2RDDA 2LDYA 1L5UA 1UPPA 1NNDA 1RTZA 2PSZA 4ZVHA 2R8HA 3H42A 3OLBA 5AE3A 4DV5J 1FHTA 3DOLB 1IKVB 1Y5IB 2OO4A 3K58A 2UXDF 1F3VA 4NLUA 1H3DA 3JXOA 2DPIA 1RWMB 2XULA 2PEHA 2B7BB 3D0GE 3UCGA 3W2VA 4OJGA 4F26A 2I9SA 4LRDA 4ZP7A 1LK5A 2J7UA 4ED0A 1U49A 2CXEA 1S0OA 5H9FJ 3NGTA 1VQNS 1IVZA 4LRAA 1PO6A 3IO1A 2R7SA 3OL6A 2VU5A 2J0SD 4DQQA 1NJWA 2UXBF 2FHOB 3VF0B 1CEZA 3JSYA 4X84A 4QW9A 1QUPA 2BJ9A 2IIHA 2ZEJA 1K1SA 5K20B 2BR0A 3HK2A 5BXIA 2D3OR 4X4OA 3OL8A 4L73A 1FERA 1X31C 4PPZA 3H5YA 3QAEA 4FBUA 2MDAA 1TVRB 1RAAB 3HJVA 2R7TA 3CE8A 2DK2A 2ZD1B 2FZGB 3GB0A 4DL0C 3UDLA 5J1PA 5I3UB 3M8SA 4FF2A 4IRCA 2D7SA 2IPOB 3VR1A 2BDPA 2IBOA 3UR0A 1TFYA 4CO4A 4NLVA 1WSVA 2N4DA 5KFVA 3TEGA 1YRTA 4J91A 4MKYA 5GADU 2HGLA 3O44A 4J9PA 1GQEA 1EQMA 3BKUA 3PRVA 3PYFA 4QWBA 4AL7A 4J9OA 2LEAA 1HMVB 1WG5A 2HAFA 1X5OA 4C11B 4LFCF 4NXMF 3L7UA 1JLFB 1GNKA 2UUWA 3AFGA 1WOSA 1SH2A 3T1HF 3RAXA 1KONA 1REVA 1HWUA 4L76A 3V6HA 4OZNA 5FJ4A 2KL8A 2BJ1A 1V6HA 2FDNA 2RH3A 2HYIB 3R8YA 4K4XA 3OFFA 3DRRB 3QQCD 1LW0B 4KV8B 1M5SA 4CWBA 4RU9A 3GV7B 3EX7B 1Q8BA 3VALA 3CCJS 4PWUA 3B8HA 5J2PA 3K5LA 2OH2A 2JFKA 1KD1T 2VICA 2LQJA 4RBTA 4CLFA 3KK1A 1SH0A 3MOZA 4DV6F 3CO0P 3BO4A 1J5OA 3AOAA 3EVWA 1ZTWA 1GXTA 2V8VA 3M2RA 4JB8B 2OMLA 2AEJA 3GYXB 4OZ1A 4DU7A 4ZN3A 4DCOB 5LSLA 3BR9A 3P5BP 1UEVA 2FVCA 3BJYA 1IBMF 3DI6B 4X4UA 3CDUA 1X4AA 2F4VF 3V4MA 5HATA 2CJ9A 1RTJA 2OPRA 1IQZA 1LXNA 5CAAA 2ZUGA 2CQ0A 2E29A 1RT3A 3K5PA 4WTYA 5M2UA 1S6PA 3PYEA 2QMXA 1S0NA 2Z2ZA 3Q2TC 2XLJA 5KG7A 2DCUB 4GVBA 1DY3A 1OS5A 2IDLA 5HBMA 3UQSA 3KTQA 1FFSB 4J9RA 2BVZA 2V4QA 2C3UA 1H74A 3A8JA 3O8WA 5FIIA 5KAKA 5KFMA 1N4LA 1L3TA 4TLQA 2WSCC 3OL9A 2V2QA 3IBWA 2DNKA 5HLFA 2ZBCA 3BGOP 5KFBA 4KYZA 3UCZP 4DSJA 1NO8A 4A8OA 4XTTA 2D1CA 4DLGA 4IOAQ 2V5HG 3M9NB 2NQPA 4QPTA 4JI4F 4DJBA 2XCPA 4TU7A 2MB0B 4JI2J 1B70B 1YJRA 1R0AA 3GLJA 3HHLC 5F9NA 4DPWA 1HNIA 1ZH5A 1TKZA 5B0BA 4OI1A 3NBPB 3J7YU 2FJXA 1T11A 3MCNA 4B3RJ 3WC0A 2JEGA 1Y11A 1GMVA 4A8QA 1UEKA 5KG1A 5E3AA 2FJDB 2ZJRQ 3CDBA 3CJ8A 4R5PB 1DFDA 2CIMA 2PFFB 5M2PA 3UCUP 4DPOA 3KJNB 3ZZRA 3EYZA 1WKKA 1S76D 4WU2A 5K8PA 1N88A 1NB2A 2MKCA 4PWDA 4H4OB 4M5DA 3RGIA 1VC0A 4QIFA 1QY7A 4DPTA 1XN9A 1CC7A 2DR6A 4OYPA 5IV4A 1W2BR 1NKBA 1MU2B 3WC2A 1H2TZ 3DNCA 4LBPA 4RW4B 3KLHB 1VC5A 4FYYB 3I0SB 2QLWA 3FEYB 4NZ7A 3HT0A 2XSJA 2C2DA 2QRRA 3VQTA 2DO4A 4HLBA 4J9VA 1C0TB 1YRUA 2DHHA 2QN6B 1PILA 4IQMA 2HK2A 5ETSA 5A0YA 3NGDA 2RUSA 3EZ5A 3SZ2A 5F8NA 2LQ5A 3M6VA 3TUJC 3SDEA 2UVVA 2EVZA 3CGIA 3VAIA 2ZH8A 2WOMA 3BBCA 3MM8B 5EN1A 1T95A 3FCWA 3AJ1A 2ZFHA 3L3CA 3E3XA 4NYPA 4OYWA 3MEDA 2FYXA 4BWJA 4F0KA 3IRWP 3NL0A 5G4DA 1NUEA 4WFAQ 3QBCA 2CQ2A 2ZH4A 4C8YA 2V8PA 3EZUA 2IC3B 3AXMA 4R0JA 4HKQA 4X4RA 2FHJD 2MZRA 2YNGA 1LWFB 3I9ZA 2FD2A 3N5FA 2VQEF 2QFJA 1TKXB 3KNAA 5A2QU 2HZCA 2MGZB 3H4BA 1ICEB 2MZJA 3MAHA 4DG1A 5LMNJ 4OI4A 1HQ2A 3KMQA 1FJGJ 1XR5A 5A8RA 5KFUA 4B3RF 3FJ2A 1YDLA 1FKOB 5J1EB 4P71A 1BGXT 5DZ6A 1N5TA 3TARA 2DR5A 3PZPA 4WBFA 4LQ3A 4FF4A 3QIPB 1WACA 2DH7A 5L8RC 4X64J 2AZ1A 1S99A 3B82A 3OT9A 1YITS 2JOQA 4LFBJ 4YR3A 4Q5VA 2D9OA 2BUNA 5B09A 4XDDA 2Z2YB 1LXJA 1N56A 2GV1A 2V8HA 5M2RA 2GIRA 3PCOB 4PG7A 4FXDA 2XMKA 5A8KA 4WZMA 3A13A 4BWMA 1JLBA 2EK1A 2KVIA 2XHCA 2Z30B 3M7VA 4GC7A 1SKWA 1Q78A 4EZ6A 4JV1A 1VK8A 5EGYA 1IBLJ 1OYDA 2QSWA 1U1NA 3DGVA 1I3OB 3VV2B 3OHAA 1HBUA 1GXLA 2O66A 4L72B 1WD6A 3D6TB 3LA0A 3M6XA 4PXBA 1PYOB 3E01B 2VF3A 1T9WA 1VBZA 1UETA 1SL2A 1U2RA 3EGWB 3DRPB 4I64A 4KV8A 4J9LA 3KOAA 3VGVA 3KHGA 2EW9A 3BGUA 4KFBA 2MZSA 5L9NA 2FC8A 2B4PA 1JKHB 1YTYA 3LP2A 1FXLA 2HVEA 2ZJPQ 3QATA 2HQFA 2FIUA 4M5IA 2G0CA 4XPEA 2AJQA 3M2RB 3KJFB 2MZ1A 4ECRA 3UNGC 1RU2A 2RILA 1R3NA 4NLXA 3VAJA 3D68A 1EX8A 1MN9A 2VC0A 3NS7B 5A8WB 1TK5A 3ZZUA 2DNPA 2BQRA 2KXFA 3W60A 2R7XA 5KFIA 1R8HA 1Z2ZA 2BW2A 2RU3A 3Q8VA 1GEHA 1MROA 4NYOA 5K14B 5KFZA 5KG5A 1XC9A 2ZH5A 2AJ2A 2ATCB 2FB0A 1LWCA 3ZO7A 4K5SA 3PFOA 3G2XA 1ZPWX 2IYGA 3GFZA 4B9NA 4NEYA 1SQGA 2OP5A 2Q6CA 4ECTA 4TQRA 1AB8A 1RHUB 5DS7A 4O23A 5HVFA 4WF9Q 2NLWA 4UZCA 2CQDA 1WG1A 3T6JA 5IT0A 2W8KA 2IVFB 2R4FA 5ITHA 2AX0A 1F2HA 3KG0A 2ZDPA 3D6MB 4HI1A 2R2RA 3AQPA 1BLUA 2G2ZA 1G6BA 2HRUA 3HHEA 3RG6A 2OI2A 3CC2S 4G1PA 5FDLA 1HBMB 4MIAA 4KIAA 5LL6d 2L41A 2JWNA 1QE1A 1JLAA 2CFXA 4ES3A 4J5OA 4KBIA 4HHHA 1LWEA 4HI2A 2A2CA 3BB5A 3JS9A 4DR3J 4DMZA 3FBEA 3LGMA 3I55S 4EEYA 2Z0GA 1SB6A 1O5JA 1IKYA 1MNEA 4N7TA 4F3OA 2DNMA 3FZBA 5C42B 3V4IA 2JNJA 5KFFA 1UKUA 1ZS6A 3MDFA 5IV3A 4M5JA 4MT1A 2XO7A 3KJVA 2QV6A 3IBFB 2ZOFA 3D54A 3OFGA 5B7WA 5I42A 2BQ3A 1WHXA 3UVJA 2V34A 4R8UB 4BDPA 4X65J 4ZJOA 3HCXA 4KPYA 1BC6A 1GFWB 3V6DB 1VJWA 2ZZMA 3UN5A 4DV3F 4NLRA 3TX0A 3T3FA 3DLGB 1SIWB 2RDIA 2BJEA 2OPPA 1KQKA 4Q44A 3WHIA 4UZBA 1S9GA 4RO0A 3HFZB 2YWFA 3UR3C 1MN7A 4ETXA 4UQGA 3GMGA 4OX7A 1JWWA 2XGQA 3ITHA 1RP5A 1U26A 3ICLA 4G1QA 1IKYB 3W5XA 1DLOA 1RLDA 2DNNA 2B4VA 3DM2B 2PMWA 4KY3A 2ROGA 3PRBA 2NZCA 2W2NP 1VFJA 1W2IA 3K8VA 1YSJA 2PIIA 2GW8A 2DHAA 2QE5A 2V2KA 4IO1A 1WOPA 2GJ2A 3TZXA 3OTOJ 2EBGA 3OLAA 4A8SA 4IH6A 2M70A 3NBPA 4NI2B 2KT5A 1TK0A 2J9DE 4M5KA 1AROP 3I5CA 1SL0A 4U96A 1UFKA 2NCKL 3Q22A 4ANEA 3CCZA 2G1HA 5K9FA 4GKKF 3QFWA 1DURA 3MMBB 2HHVA 2GAHC 4C8MA 1S9FA 2J8AA 4F04B 4ZLNA 1TAUA 1CG2A 2YX1A 3T5KA 2HMIB 2IAJB 4K0KF 4ZJLA 2Y1RI 3SYZA 2GNKA 1HR0J 3LP0B 1RT5A 4JI8F 2EEYA 2MQ8A 1CQNA 2M5YA 3DXSX 2KRRA 3PXGa 5KG0A 3W8PA 2FLNA 1B3TA 2UUBJ 2OPSA 1F9EB 1RT6A 2HZAA 4KHPJ 4ZITA 2VPWB 1K44A 2H5IB 2HRTA 4K2JA 2M0GB 1FFWB 2QZ8A 4PXEA 4RR5A 1F1BB 3MM9A 4S0MA 1JKHA 4KGXB 5U47A 3QIPA 4JUZA 4DFKA 1VBXA 1K73T 2V2VA 2K7KA 3TR5A 2EFNA 2FY1A 3BDPA 2R9LA 1AW0A 2C3YA 1X4HA 3ILOA 1CULA 2CDRB 2HFNA 2W1BA 3LGHA 4Q2MA 4ZVQB 4ZVRB 1KTVA 5HJXA 3BGFA 3E51A 4EBEA 3GSDA 1HBOA 2RS2A 1H72C 1TTHB 2CWXA 3ADAC 3OD2A 4Z37A 1H73A 5EHHA 2C2OB 2XMUA 1BE4A 2GVDB 1Y3KA 3R2DJ 3GFHA 4RWXA 2VPZB 1VRTB 2OAUA 2EK6A 3SCJE 2J6TA 1REVB 2EFGA 1OY8A 1U8WA 2EG1A 5J1NA 1C4AA 1I51B 1WC5A 3T1YJ 2NZ4A 1SJ4P 1GH8A 4I69A 3HVWA 2RS8A 3PHTA 4L3NA 3K5MA 1KBRA 2MJNA 2VG6B 3ET6A 4UTGA 4I2QB 2J0WA 3BS9A 3MD3A 5IM0A 1SJFA 3CNQP 3MURP 3FMWA 4HH0A 4LSLA 2KRBA 1H98A 4KHPF 2CVEA 1PJ6A 4CH7A 3CCES 5E3PA 3MXHP 1TFWA 5D0RA 2QLFB 2LXIA 3DLEB 1N34F 3CJ2A 3H2LA 1Q82T 2F65A 1RT1B 2BM1A 1F5AA 4F0MA 2E5LJ 1S1XA 1UA1A 2R42A 4K5RA 3D5MA 1IKVA 4FPIA 3FCVA 1Q86T 4CLUA 1TMJA 1EHWA 1HPZB 4A48A 4QWCA 3MCOA 3AD9C 4USHA 1C2PA 2FPHX 3V5RA 4XO0A 1JJCB 4ZP9A 4P6QA 5L1JA 5GMKa 2MQOA 4F4YA 1CJVA 1HWKA 2C3OA 1JLGA 3BEGB 4RNOA 3RRKA 2YKOA 2IFXA 1Y3JA 2UUCF 2COLA 5HAOA 1FEHA 2R7VA 1IM4A 2F63A 2DGSA 3HVTB 5E3RA 2W7PA 1PC5A 3NAIA 4B9VA 4FPRA 4KH0B 3HM9A 4DF4A 2HVHA 3UN3A 3C6UA 4J90A 2CQ3A 2MQNA 5L46A 3Q8RB 1JXVA 5KFPA 5GADI 4A8YA 3PM9A 2C2ZB 4M5NA 2W7AA 3FQKA 4B08A 1VRUB 2HNDB 3MMJA 3SI8A 4JV5J 3SQGB 4HDHA 4OYIA 2PO4A 4OMFG 2R8KA 3PRDA 4TXSA 1VHFA 4LFBF 3CCRS 1S1TB 2KU7A 1DLOB 3KXDA 1PCAA 3TAMB 3RTVA 1U1OA 4OHZA 5C42A 3V4IB 4ZVTB 4HVZA 1UL3A 4CM2A
chains in the Genus database with same CATH topology
2W2QP 1SCJB 2Z58B 3A3OB 2PMWA 4OV6A 2W2NP 3CNQP 3SQOP 1V5IB 2W2PP 2E1PA 2W2MP 2Z2ZA 1ITPA 3GCXP 3WIVA 2W2OP 3WIUA 3GCWP 3H42A 3QFHA 4K8RA 4JP8A 3VHQA 2Z56B 4YN3B 3CO0P 1R6VA 2Z2YB 2ZWPA 2ZWOA 4NE9C 3A3NB 3BGOP 2Z57B 3WHIA 3BPSP 3P5BP 2Z30B 3T41A 4NMXA 3AFGA 1SPBP 2XTJP 2QTWA 3VV2B 3A3PB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W2Q P;  1SCJ B;  2Z58 B;  3A3O B;  2PMW A;  4OV6 A;  2W2N P;  3CNQ P;  3SQO P;  1V5I B;  2W2P P;  2E1P A;  2W2M P;  2Z2Z A;  1ITP A;  3GCX P;  3WIV A;  2W2O P;  3WIU A;  3GCW P;  3H42 A;  3QFH A;  4K8R A;  4JP8 A;  3VHQ A;  2Z56 B;  4YN3 B;  3CO0 P;  1R6V A;  2Z2Y B;  2ZWP A;  2ZWO A;  4NE9 C;  3A3N B;  3BGO P;  2Z57 B;  3WHI A;  3BPS P;  3P5B P;  2Z30 B;  3T41 A;  4NMX A;  3AFG A;  1SPB P;  2XTJ P;  2QTW A;  3VV2 B;  3A3P B; 
#chains in the Genus database with same CATH topology
 4IG3 B;  2HHQ A;  1J5E J;  5CA5 A;  5D0E A;  2MXY A;  3GZ7 A;  3JYT B;  1KLM A;  4ZPD A;  2XWY A;  1CLF A;  3KLV A;  1RWX B;  1E6V A;  1ITP A;  1SVD A;  1S79 A;  4FYW B;  4IFY A;  1FXR A;  4MK9 A;  4NLO A;  3F0N A;  4HTI A;  1NH7 A;  4Q43 A;  3I82 A;  3R6L B;  2FLL A;  4ZPB A;  3T5H A;  3P6Y C;  2BAC A;  5KT4 A;  3JSB A;  3MEE B;  2XM3 A;  2AGO A;  4PWD B;  1S6Q B;  1BQM B;  3RBD A;  1HQU A;  1U0H A;  3UE2 A;  4CH0 S;  3M8Y A;  3MUM P;  1HI0 P;  3CC4 S;  1U1R A;  1NPR A;  2NUH A;  2YWK A;  2ZH2 A;  1JLE A;  1SBR A;  3SQG A;  3WBZ A;  3CJK A;  1R27 B;  3CJ4 A;  3T6B A;  5GAH I;  1TK8 A;  2HSE B;  3CCW A;  2QGF B;  3AB4 B;  3M8Q A;  3CCT A;  4LUB A;  5KOX A;  4H4K C;  4B3O A;  3CDW A;  3ZTQ A;  4MIW A;  3A1Y G;  4DI6 A;  2CJA A;  1RKI A;  1WF2 A;  3ISN C;  4NZ6 A;  1GTH A;  5LM7 E;  3C14 A;  4FXV A;  2RHS B;  2OTL S;  1KQS R;  1N36 J;  3M2V A;  3FC9 A;  1PKU A;  3B78 A;  4B3M F;  4UUW A;  4JP8 A;  2NRE A;  2EFQ A;  1XBW A;  4ED4 A;  3FZ2 A;  5L9X A;  2B9X A;  2VBW A;  3OTE A;  2V4R A;  1NJZ A;  2HRY A;  1HNZ J;  3SMZ A;  2BOA A;  1N8R T;  2QMW A;  3S7R A;  3R27 A;  5B0D A;  1DAR A;  5LSR A;  3EGV A;  1UFW A;  4EFA C;  1O0P A;  3N6L A;  3OJU A;  4ED5 A;  1NHK L;  1RAD B;  1OPI A;  1YLX A;  3HF5 A;  3M1V B;  4IDK B;  2EC0 A;  2VD3 A;  3HMJ G;  1W25 A;  3CJQ A;  4TN2 A;  4U9R A;  2VOO A;  3AOC A;  4WCE Q;  1NJY A;  4IUF A;  5GVQ A;  3TUP A;  3F56 A;  1VIS A;  2BX6 A;  1H7W A;  3MMA A;  4MKB A;  2QA2 A;  2QL9 B;  4CI0 B;  5DET A;  2PT0 A;  2VFU A;  2MMY A;  2D3U A;  2YQ1 A;  3EDQ B;  3MM7 B;  4RW7 A;  4KO0 A;  3NWR A;  3OPK A;  1CJK A;  4TYA A;  1Y5N B;  2DXF A;  2YKN B;  2B6A A;  2ZOG A;  1G7C B;  3TX8 A;  4LJM A;  2W4P A;  2XMV A;  1S48 A;  1R6Y A;  4X4V A;  5HK4 A;  3MR3 A;  1ZAV A;  1U24 A;  1RAF B;  1VQY A;  2V2Z A;  4LR9 A;  4WKY A;  1PJ5 A;  2VBZ A;  2GO8 A;  2RRN A;  3D6H B;  2J9C A;  4IOB A;  4URQ U;  1FKP A;  5A76 A;  2RF2 A;  1AUS L;  3ENQ A;  1N33 F;  1M5V C;  4DWI A;  2AJ0 A;  1N36 F;  1LW2 A;  1OSC A;  2B7C B;  4OYX A;  3OR1 B;  3LUY A;  4J9K A;  2L3M A;  2JSX A;  3SBM A;  4B3S F;  2X1F A;  2M3D A;  3C6T B;  5IC4 B;  5DG9 A;  4DQP A;  3MR5 A;  2ZOM A;  3CUL A;  4C4W A;  1RAJ A;  3NGK A;  2DCL A;  3C6U B;  4MFB B;  1WEY A;  3KK2 B;  2FVP A;  1NU4 A;  4AFF A;  2LEB A;  1CVJ A;  1YK9 A;  4I6A A;  5A0Y B;  1HHT P;  1S10 A;  4GKJ F;  4OX6 A;  2B8P A;  4O4R A;  1RWN B;  4LFC J;  4NXM J;  3NOG A;  3THV A;  5E33 A;  3NAH A;  4NCA A;  3MFH A;  4IRK A;  2OD6 A;  2V67 A;  1FNM A;  1YHQ S;  4U8V A;  2GFF A;  1S57 A;  2OLW A;  5FLX Y;  3ZNJ 1;  1T9T A;  4AD6 A;  1MRO B;  1DQ8 A;  3C15 B;  3CB4 A;  3DYA B;  4QWE A;  1BXN A;  4ZKA A;  4JI0 J;  3TOQ A;  5MAO A;  4DUY F;  3UFC X;  4UY8 T;  3EMT A;  2DJW A;  1MWZ A;  2IC3 A;  3BGL A;  1JLG B;  2DNY A;  1UJ5 A;  1RT7 B;  3PEH A;  4W98 A;  1QAX A;  1LW2 B;  3OFE A;  2XO6 A;  4AQY F;  1IN0 A;  1E6V B;  1HKA A;  3AT1 B;  1XQI A;  4DS5 A;  2FHJ A;  5KFG A;  1TZ0 A;  5KT5 A;  3FBB A;  4RUC A;  2W9B B;  3PY8 A;  1FDA A;  1YX2 A;  2BJD A;  5I3P A;  1UWB B;  2GC8 A;  2KH9 A;  1U02 A;  1VOM A;  4LR8 A;  3R7N B;  2FHK A;  3PFE A;  1FWK A;  2AKW B;  5AXM A;  4NE9 C;  5DQG A;  3VGU A;  3DLE A;  1GAO A;  2HHS A;  4CT9 A;  3IRX B;  4OX9 J;  5A6W A;  3PJX A;  3R97 A;  2KO1 A;  4IYQ A;  5HRO A;  3CC7 S;  1AFI A;  2QL5 B;  3W62 A;  2HAI A;  1XK8 A;  1JLQ B;  2DEI A;  3KLE A;  1YZ7 A;  4TYB A;  5KG6 A;  2OMO A;  3DGP B;  5HVH A;  2P8I A;  3BSN A;  1S9E B;  2ROE A;  1T05 B;  1X60 A;  5KFJ A;  4EGL A;  2DNG A;  2C1E B;  4EWT A;  4X62 F;  1RA7 A;  2A2D A;  4C48 A;  3IP0 A;  3M2V B;  5I42 B;  1UAW A;  4IFY B;  1S1V B;  2VBY A;  2W2M P;  3WX8 A;  4KJI A;  4RUB A;  2POK A;  3HD2 A;  4LF8 F;  1VQO S;  4USU A;  4BC9 A;  1S77 D;  1KN6 A;  1IUJ A;  3HSD A;  3M6W A;  5F3Z A;  1QAI A;  4HT7 A;  1QTM A;  5E2Q A;  3SSQ A;  3QO9 A;  3SCK E;  4FN5 A;  1JJ4 A;  2FHM A;  3FBC A;  1X5S A;  2CAD A;  1G4C A;  1KS2 A;  4CO2 A;  5K8O A;  4G3I A;  1R89 A;  3IS9 B;  4LF6 J;  4MJK A;  3P96 A;  2CQ4 A;  2YPY A;  2ASL A;  5F8J A;  4C97 A;  1FTC A;  4G1Q B;  1Z2L A;  4WP3 A;  1EZZ B;  1YJW S;  4F36 A;  1TQL A;  2VHG A;  1F2G A;  3JTN A;  5IT4 A;  4EO6 A;  1VQM S;  4NXN F;  2MHN A;  4CP5 A;  3JSR A;  3G82 B;  4NPO A;  1B0V A;  3WDO A;  5KFQ A;  3IG1 B;  2W9C B;  2B43 A;  2ZH6 A;  3UDV A;  5LXR A;  3Q23 A;  2RQM A;  3Q8U A;  1D9F A;  4M8L A;  4PUO B;  4FNI A;  5GMD A;  1HBN B;  3EIC A;  4USV A;  3L9Z A;  3JTO A;  2W7O A;  1KLM B;  2VL1 A;  3BGR A;  2XZT B;  4DV2 F;  1IQT A;  4YB5 A;  4U95 A;  2Y1L B;  4B9T A;  4RW6 B;  2WVC A;  1SC3 B;  1SV5 A;  4RNN A;  3PX4 A;  2AGP A;  3QZ8 A;  2R7U A;  2DHX A;  2CG8 A;  4DSL A;  3H8Y A;  3IM8 A;  4O0I A;  3FQL A;  3DLK A;  1NSP A;  1ZM2 A;  3KLI B;  4LIR A;  4CO5 A;  1XMO J;  4K4Y A;  4WU3 A;  4W4M A;  1WTF A;  3OBI A;  3CCU S;  2VON A;  1IM6 A;  1RB0 A;  3QYY A;  2ZH7 A;  4DR5 J;  3LP1 B;  1RUS A;  4NZ0 A;  3AB2 B;  2MKJ A;  1IR1 A;  3G8Q A;  5EX0 A;  1T0T V;  3ITH B;  4JV0 A;  4DL6 A;  3W61 A;  4ELT A;  4JI7 J;  4CZC A;  4M5H A;  2KHC A;  3IWX A;  4OV6 A;  2ZD1 A;  4ECZ A;  1RT2 B;  1QDU B;  1ZPV A;  1V9O A;  1VIX A;  2CVI A;  2OEL A;  2ZBI A;  3D4J A;  3BGR B;  4WXO A;  1FTR A;  3F44 A;  3NXZ A;  4MK7 A;  1KDN A;  2WK4 A;  4URS A;  4DR4 F;  1SV5 B;  2XYH B;  3OW2 R;  2IDE A;  2LMI A;  3ILI A;  1SQE A;  2PC6 A;  3G86 A;  4AXI A;  4MKV A;  1U45 A;  3X1L B;  3D1O A;  1YJT A;  2Q1L A;  2UXD J;  1NBE B;  3OXL A;  4HR2 A;  3IA0 A;  2XTJ P;  2CJX B;  2G1D A;  5DGA A;  5GAE I;  3P8B B;  1SC4 B;  3KG1 A;  5E7O B;  4A46 A;  4ELV A;  4ED8 A;  1FDN A;  5IOL A;  3R7B B;  4Y6I A;  5DJB A;  1NPK A;  2MZT A;  2VKZ G;  3P4U B;  1RAO A;  5C24 B;  5BYR A;  3HVA A;  3CJ0 A;  3EGN A;  3H5X A;  2DRD A;  4CQ1 A;  4RBV A;  2KXN B;  3SDE B;  2PN6 A;  2CPI A;  2F8M A;  5CYM A;  3C8Y A;  4NCB A;  1I1G A;  2GHW A;  5F8G A;  3GYN A;  4MKA A;  1DTT B;  7AT1 B;  2FVQ A;  2EG2 A;  3W9J A;  4QYZ J;  1OO0 B;  3A8I A;  2KFN A;  1NK0 A;  1BMQ B;  4LBI A;  4X65 F;  2HFU A;  2JLE A;  1S9E A;  2R7R A;  2HMI A;  1S49 A;  3D67 A;  3MTK A;  2I0X A;  3B54 A;  3GIR A;  2EPI A;  4P52 A;  2FY8 A;  5JJB A;  2KKH A;  5A6P A;  3PKY A;  5IZH A;  1OY9 A;  3I56 S;  2R7W A;  1IR0 A;  5HQM A;  5HAN A;  2B0G A;  2I5J A;  1AFJ A;  4KAI A;  4K7Q A;  5KFE A;  2CYY A;  3W65 A;  1BHN A;  1R8A A;  1Q53 A;  4AUK A;  2DR8 A;  2ASJ A;  3C6T A;  3I5A A;  4CO1 A;  3DDN A;  3DOK A;  1YI2 S;  3MM9 B;  2B4U A;  4O3S A;  4C98 A;  5F3T A;  3IR5 B;  2CPE A;  2K06 A;  4I6Y A;  3K57 A;  2RUG A;  2HWH A;  4ILL A;  1CUL B;  1CSJ A;  2B8Q A;  1K0T A;  1TL3 B;  3KJQ B;  1S7H A;  4GC6 A;  4P2X A;  5ETM A;  2VQF J;  1KFS A;  2XMT A;  4RZR A;  5E3Q A;  2UUA F;  4M5M A;  3R1H A;  1NK7 A;  2DR9 A;  1C4C A;  3OUY B;  1PAU B;  2IHR 1;  1AUD A;  2CNO B;  2AYG A;  2G4B A;  2IJR A;  3DRS B;  1FRM A;  2KI2 A;  2X3D A;  3AQO A;  1TKZ B;  1KQF B;  3CXC R;  3G4S S;  5ETV A;  5KT2 A;  3Q24 A;  3A3P B;  2RJZ A;  2DEJ A;  2JLF A;  3I4H X;  3JQK A;  2BKP A;  4G6V B;  1WDD A;  2B9E A;  2N4C A;  4ANC A;  1RT7 A;  4R5P A;  2E7X A;  2QX0 A;  5F9L A;  2WW8 A;  1HYS A;  3E8O A;  3BPD A;  3UW1 A;  3PVX A;  1JNZ B;  2MEW A;  2MY7 A;  3H20 A;  3HZG A;  2XC9 A;  5H9E J;  1N5Y B;  4WKR A;  2C2N A;  2F40 A;  3DOK B;  3LTO A;  3LF0 A;  4I7F A;  5BYQ A;  5C25 B;  1QSY A;  2EFO A;  3CD7 A;  1SI9 A;  2ZH1 A;  2R2U A;  4J7C A;  2MKK A;  4Q8E A;  1C1C A;  4ZN1 A;  4Y00 A;  4LVN P;  2VJU A;  1M5K C;  4QCL A;  3IS9 A;  3CIM A;  4RW4 A;  4N47 A;  2GS8 A;  4RNM A;  4DL4 A;  1XMQ F;  4JI1 J;  1WI8 A;  5KFR A;  4L75 A;  4OFZ A;  4N56 A;  5KG4 A;  2WON A;  2AT1 B;  4DQS A;  1XWL A;  3JQM A;  1VQL S;  5IFM A;  1VQS A;  3HDS A;  2JEJ A;  1S1U A;  2DO0 A;  1NEE A;  2FGC A;  5LMU F;  4B9U A;  4YEA A;  3C2P A;  1X4E A;  4P72 A;  1CJV B;  1S4E A;  4YR0 A;  2Q43 A;  5DM7 Q;  3C16 B;  3JQJ A;  1PJ7 A;  5CQG A;  3W1Y C;  3MED B;  4F02 A;  1RHQ B;  2E7W A;  2VDI A;  3NY0 A;  4I7F B;  7FDR A;  2CNN B;  3LAM A;  3PYD A;  1N6Q A;  4OI2 A;  2LDI A;  2YNF A;  3PTW A;  4LF6 F;  1WDT A;  4C3M A;  1UZD A;  3TI0 A;  4DV3 J;  1O8B A;  1U09 A;  3UPF A;  5L1K A;  5KFW A;  2VIH A;  2XNQ A;  1TL7 A;  2K1R A;  2DH8 A;  3UI3 A;  3KLH A;  1QVG R;  1M1K T;  2CG4 A;  3HSJ A;  4N8O A;  3IFE A;  3EZO A;  1QM9 A;  4KR0 B;  1WSR A;  3UD4 P;  3U02 A;  2YWG A;  4XIU A;  2H5J B;  1AZS A;  3RAM A;  2BKN A;  1FJG F;  4WE1 B;  2YX4 A;  4NRU A;  3HHN B;  3MM7 A;  4R25 A;  1NHU A;  1AT1 B;  1S6U A;  4BCA A;  4OIX A;  4V1A k;  2CZ9 A;  2CQ1 A;  1MMN A;  1TKD A;  1X4B A;  2QO3 A;  5CYM B;  3GCW P;  3WX4 A;  2J7W A;  3MR6 A;  2PI5 A;  4MMO A;  1NHV A;  1TP7 A;  3GFY A;  3OV7 A;  2KG0 A;  1FI4 A;  1DTT A;  1RE1 B;  2Z4P A;  5KFL A;  1Q79 A;  3ETM A;  4FF3 A;  3B4D A;  2O5D A;  2QT7 A;  3DCA A;  1EP4 B;  3ONQ A;  1KNZ A;  3IGV A;  4H4M B;  4TY9 A;  1FK9 A;  2NR0 A;  1HQE A;  4P10 A;  4KGZ B;  1M5O C;  3G6X A;  4F4X A;  3IMQ J;  5FLX U;  1UVI A;  4N5S A;  3MHY A;  1WNE A;  3KFW X;  1RCX B;  5SZT A;  1JNR B;  2A18 A;  3CJK B;  1SKR A;  3O3L A;  3N4W A;  4DL7 A;  5KT7 A;  3GIK A;  4LSL B;  3N28 A;  4DZ6 A;  5I3U A;  2E5J A;  5KFC A;  4NEZ A;  4ES1 A;  3A12 A;  1ZZN A;  1WHV A;  5B0A A;  1SUQ A;  4FBT A;  2KHD A;  4OYA A;  2NS1 B;  1OIA A;  2NPI A;  4QR2 A;  1LFP A;  2YKM A;  3CVK A;  4HTJ A;  4O3N A;  3KUH A;  4TU8 A;  3MUT P;  4K0K J;  2QEX S;  2KYZ A;  2GJF A;  2AF6 A;  2EI5 A;  1TR0 A;  3CJ5 A;  2CJY B;  2MQM A;  2B4O A;  2IM3 A;  3DRS A;  2IAJ A;  4WJB A;  3W63 A;  3AJD A;  2HQG A;  5C5J A;  3PV8 A;  2AJF E;  4H4M A;  1XNR J;  1WC0 A;  3QT5 A;  2FJW A;  5C7P A;  2BBE A;  4GKJ J;  1SPB P;  4OYM A;  2CQB A;  2UUC J;  1REG X;  2I5J B;  1TUG B;  4IRD A;  2P9C A;  2LEP A;  2OPS B;  2QIF A;  5DLF A;  1S7I A;  3M8P A;  1NDP A;  3M8W A;  1RKJ A;  4QIE A;  2W9A A;  5EUH A;  4FF1 A;  1U2C A;  3DFE A;  2WVB A;  4B02 A;  5C2G A;  5B0E A;  4M5G A;  3D7S B;  4CLW A;  1TVR A;  3ENW A;  3TO8 A;  2RU9 A;  5J1E A;  2OKQ A;  2CA9 A;  4ZJQ A;  4ZPW R;  4C8L A;  3A8E A;  4NLD A;  3A8K A;  4ID8 A;  5ETR A;  4OZ3 A;  1PSD A;  3ZZ0 A;  3BR8 A;  4CLT A;  4A8K A;  4NLS A;  1X0F A;  4CTA A;  3SV4 A;  2GGP A;  2XYP B;  3I6P A;  3FSI A;  2QLJ B;  3UO0 A;  2B5J B;  4F4W A;  1GMU A;  4C2M A;  2RRA A;  3ZZZ A;  5EX3 A;  4F67 A;  3O2I A;  3PJ9 A;  5H1S V;  1F5B A;  4AXJ A;  2W24 A;  2GVD A;  3DYA A;  4OJ1 A;  3CJ3 A;  1BQX A;  3GE9 A;  2G0I A;  4DV1 F;  2PE8 A;  5HI7 A;  2ZBR A;  4C11 A;  2N82 B;  2DH9 A;  2OPR B;  1Q8K A;  4J37 A;  2ADB A;  4P9S A;  2OFG X;  2RB7 A;  1FVS A;  2E1A A;  2GZO A;  3DHX A;  2QFI A;  4P7T A;  2M9K A;  5DDR C;  1DRZ A;  5AXK A;  4EU0 A;  1JLC B;  3UD3 P;  2P5V A;  1FNO A;  1CS4 A;  6FDR A;  1EB0 A;  2BRK A;  2KM8 C;  4K4Z A;  4IH5 A;  3GJS B;  4O44 B;  1DZ5 A;  2CWK A;  4LSN A;  4K4U A;  4LT6 A;  2AEF A;  3WIV A;  2VOD A;  3PW0 A;  3VAM A;  1FX4 A;  1VI7 A;  5D8H B;  2VQE J;  1XNR F;  3DLG A;  2MZQ A;  2D74 B;  2V0N A;  5D4L A;  4I0W A;  5KFN A;  5L1I A;  1F0X A;  3CJT A;  4H54 A;  5GAG U;  3G8T A;  2BZ2 A;  2XNR A;  2APO A;  3MZI A;  2XMJ A;  1TL1 A;  2YWH A;  2HQI A;  1KR4 A;  1S1W A;  2HLT A;  3DKD A;  3G82 A;  4OYO A;  2KDO A;  1HLW A;  4ZCM A;  1S1U B;  3L7P A;  2JH3 A;  1U8S A;  3GYG A;  1N0V C;  4QZV B;  5K14 A;  4LF9 J;  4F3M A;  4YB6 A;  2XMA A;  2LP4 A;  4DEZ A;  2QG9 B;  3QZ7 A;  1T05 A;  4UY8 5;  2J9E A;  4A8X A;  4DV0 J;  1XTZ A;  5D0G A;  4JI7 F;  3G6V A;  5T14 A;  1DTQ A;  1HL6 A;  5LMU J;  1AYE A;  3VAH A;  1L3U A;  1S6P B;  3B6B A;  4DQR A;  2I38 A;  3QMQ A;  3QT8 A;  3MM5 B;  3Q86 A;  4ZVU B;  2WCX A;  3H5U A;  1HYS B;  2WAQ D;  2G0J A;  4DUY J;  2IM1 A;  4NWB A;  4DF8 A;  2GIF A;  4ZCI A;  3ZTO A;  2HK3 A;  3JB9 k;  2ZWO A;  4XPC A;  1SXL A;  5C25 A;  2NYH A;  1D8Y A;  1U0S A;  1X0P A;  2XB2 D;  3CMQ A;  3ENV A;  3I32 A;  2Z57 B;  1NCL A;  4USM A;  5DLG A;  3KK1 B;  4KH1 B;  2UU9 F;  3VQS A;  1JIH A;  1NK9 A;  1QE1 B;  2HWI A;  3AHP A;  3KHH A;  3IRX A;  3MTJ A;  4OYB A;  3MPU B;  3JSM A;  2NXU A;  3R1L A;  1UVN A;  3H25 A;  4ID5 B;  2RQK A;  4TLR A;  4DUT A;  4U7U K;  1R0C B;  1PG5 B;  2H1Y A;  2I1R A;  4ZP8 A;  3ILL A;  3CPW R;  4JI4 J;  2YQ0 A;  2ZE2 A;  2J6S A;  3HI9 A;  2F1F A;  4IG3 A;  6FD1 A;  2GO9 A;  4O3Q A;  4RUA A;  1FT8 A;  4H4K A;  1FE0 A;  1FO1 A;  3FUY A;  3DRX A;  4RW7 B;  2ZJQ Q;  1RT3 B;  3HKW A;  5CD4 A;  2N3L A;  3IM9 A;  3C16 A;  1WC3 A;  2VG7 B;  2D9P A;  4IKA A;  1N5Q A;  4ECS A;  1X9W A;  1HR0 F;  4J9Q A;  1UW4 A;  4ED7 A;  3VVT A;  1K0V A;  3JTP A;  4WFX A;  1SIZ A;  3DOM B;  1ZET A;  2HIQ A;  2XHW A;  1LNQ A;  2V9K A;  4EUV A;  2QSF A;  3MUV P;  2UUT A;  1RJJ A;  2L9W A;  1U2F A;  1ELO A;  1X4F A;  3UN2 A;  1F6T A;  1T9Y A;  4ICL B;  5HJY A;  1UVM A;  2KT3 A;  3OR1 A;  2VDH A;  3LAN A;  4WXW A;  5FD1 A;  2C2E A;  1Q95 G;  2ALZ A;  2JZ5 A;  1NK5 A;  4M63 A;  2ZDO A;  2W2Q P;  4NA3 A;  5K8M A;  1Q7L B;  4ZVP B;  2Z8Q A;  2HZV A;  1KP6 A;  3SQO P;  1ZA2 B;  2PMH A;  4MFB A;  3C19 A;  2C2K B;  2FVR A;  4NCG B;  2JJ4 D;  2E1M C;  4DR2 J;  2HFV A;  4CTA B;  4XDC A;  1F3F A;  3RBE A;  3CD6 S;  2HBQ B;  3TJ9 A;  1KSP A;  1T7P A;  2V6A A;  1RYR A;  1T3O A;  2H5E A;  4GMK A;  2D41 A;  3HPO A;  2H54 B;  1XMQ J;  1EJ7 L;  1V3R A;  3TA0 A;  3J7Z T;  1VJQ A;  4NLG A;  5MLC V;  2UXB J;  4HHJ A;  1DHM A;  1PBA A;  2OGU A;  3MF5 A;  2DGU A;  1GT8 A;  3LWM A;  1MW7 A;  3MAA B;  2DIV A;  1RHM B;  5IXU A;  3GP9 A;  4LFA J;  4U67 Q;  1OJ4 A;  2MLX A;  5D3G A;  4LRE A;  3Q8Y A;  1CS4 B;  3W7B A;  3M6U A;  1IBC B;  4Q7A A;  5KFY A;  1OY6 A;  3C46 A;  1EAR A;  4PCQ A;  2LU2 A;  2AMC B;  2Q6B A;  3DLJ A;  4OZ0 A;  3B4M A;  4ZOS A;  3HP6 A;  1UWB A;  3EE3 A;  4MIB A;  2BJ8 A;  1QSS A;  2BYC A;  4F2S A;  3GV8 B;  1I5O B;  4BLG A;  1X4D A;  3PHE A;  2V4J B;  5HMZ A;  4JI0 F;  3VTI A;  1WC6 A;  2R2S A;  4DR3 F;  1CQM A;  2BA9 A;  2PFD A;  5HQ8 A;  5HRO B;  3K8W A;  4P73 A;  2GHV C;  3TQ1 A;  3RB6 A;  1CPZ A;  2CZV C;  4YY3 J;  1VR6 A;  2DNQ A;  2V9W A;  1EET A;  5E0O A;  2DNR A;  4NX9 A;  1KEK A;  3V6J A;  2WBR A;  3G6E S;  3M9O B;  2X3G A;  1UCN A;  3FEX B;  3D28 A;  4ZPC A;  4ZK7 M;  1P6T A;  3NCR A;  3VGS A;  1LWX A;  2P6T A;  3CCS S;  1UA0 A;  4N76 A;  2WB1 D;  4JYA F;  2IA6 A;  2OPQ B;  3THT A;  2E1P A;  1FD8 A;  2K3K A;  4LR7 A;  3SFG A;  3THP A;  2E1C A;  4F50 A;  3QID A;  1BWV A;  3BSA A;  5HVG A;  4TU9 A;  1JLA B;  1RK8 A;  3GIJ A;  1FRK A;  3O1L A;  4GO5 X;  4I56 A;  2HBZ B;  2FUG 9;  4K8R A;  3FDS A;  4RJV A;  5ETL A;  4JI3 F;  2UXC J;  1B64 A;  4EMD A;  5HLF B;  1XIQ A;  4Y2K A;  3RBZ A;  5DDQ C;  3BF4 A;  3GR0 A;  2L9D A;  5DO2 A;  4EZ9 A;  3QRP A;  2VPX B;  8RUC A;  4ED3 A;  1E6Y A;  3PJW A;  1A9N B;  4CLP A;  4DX5 A;  1LEO A;  4CCH A;  5LJ3 Y;  1HPZ A;  4OLO A;  1S12 A;  3LOU A;  2M88 A;  4C0O C;  4Q8F A;  2RQ4 A;  1LOU A;  3MEC A;  4ILR A;  4K59 A;  1N52 B;  1DJ0 A;  2HFS A;  4ZLL A;  4ZIW A;  4EBC A;  1C1B B;  2H48 B;  2NYI A;  3T9N A;  5LXY A;  2HVD A;  2VKR A;  4IFV B;  4UUX A;  1N32 J;  2NUU G;  3NKY A;  2OPQ A;  1M0S A;  3AH6 A;  4TY8 A;  1RHK B;  4OZ5 A;  3J81 U;  1RTD B;  2OD4 A;  4NA1 A;  2AV5 A;  5J2P B;  2DRA A;  2OPP B;  2QYC A;  5IT9 Y;  3BV8 A;  4QU6 A;  2R8I A;  1FWL A;  2R2T A;  1Y4Z B;  1ZM4 A;  4AL5 A;  3CCM S;  3PIO Q;  2XG8 A;  3RBX A;  4DQI A;  1ZA1 B;  3MMC A;  1JMT A;  2HFO A;  4F7V A;  1VRU A;  1MLA A;  2HND A;  4ZLJ A;  2LEC A;  3ZXW A;  2OIH A;  3G87 A;  3BO2 A;  1CJT B;  2H4W B;  2EKN A;  5AXN A;  4NYZ A;  2YNI A;  4J9M A;  3V81 A;  4WFY A;  1FVQ A;  2GCF A;  2DB1 A;  4PXD A;  1XNQ J;  1LKZ A;  4UT4 A;  1FRJ A;  2CNL B;  3HFV A;  3MMA B;  4NL5 A;  3T19 A;  5KT6 A;  5GAH U;  3PR4 A;  1NDC A;  3QSY B;  4F2R A;  2IJF A;  3QT6 A;  1A0O B;  1B7F A;  1R31 A;  3PW2 A;  1P8G A;  2XMW A;  3FBF A;  3KJV B;  2W2O P;  4B9L A;  1PC4 A;  2FZK B;  4GVB B;  5CH7 B;  3MMB A;  5DG7 A;  2LFV A;  1X7V A;  2NXN A;  3OXF A;  4QIW D;  3J7A N;  1Z4U A;  3LWL A;  2O3D A;  5KG2 A;  3MFI A;  1N5Y A;  2K3I A;  1S0M A;  4CRJ A;  2YNH B;  1M1G A;  3MEE A;  2YPZ A;  2AYM A;  4CNZ A;  3HVR A;  1U1K A;  2RVJ A;  2DTJ A;  4DR1 J;  2HS0 A;  4E8U A;  1Q1K A;  1BD6 A;  3TZW A;  3H40 A;  3PYG A;  1MWQ A;  4DLE A;  4OQJ A;  1LWE B;  1N5V A;  1TV6 A;  3TQE A;  5F8I A;  2MQL A;  4FYX B;  1WEX A;  2DNL A;  3MM6 A;  2HNY B;  2HW3 A;  2G9O A;  3SCL E;  4YDD B;  1CJT A;  3HT3 A;  1NLK L;  3I96 A;  3V81 B;  4M5L A;  1U1M A;  1ZYQ A;  3R6G B;  3W3S A;  3KLG A;  2H3E B;  3A3O B;  2EFV A;  2D3Z A;  2XCA A;  5JVH Q;  1Y5L B;  3PEJ A;  4NCG A;  3TA1 A;  5KOW A;  4NXN J;  1HBN A;  1WJ9 A;  1KC8 T;  5DG8 A;  4ZCK A;  1HBO B;  1K47 A;  4I2P A;  1Z1Z A;  2KFZ A;  4OJH A;  4JI8 J;  1C0U A;  1FRI A;  1XMO F;  5DRK A;  2YKQ A;  2W4C A;  2OJ3 A;  3DDI A;  3TNV A;  5A8K B;  2E7V A;  4CIO A;  3CCL S;  1WF0 A;  3HUL A;  2KVQ E;  3OXG A;  1FKP B;  3Q0A A;  2HHP A;  2LCW A;  9ATC B;  4FVC A;  4WWS A;  4DXL A;  2CPX A;  3LP1 A;  1QSL A;  2HQD A;  2PD1 A;  4P2M A;  3S6E A;  1N0U A;  2OUG A;  1N32 F;  2XSJ B;  3OTO F;  3US5 A;  2KJW A;  4DZD A;  1UFL A;  4NLQ A;  1RT6 B;  1T9U A;  3P49 B;  4U7U D;  3M1V A;  1U48 A;  4KB7 A;  1RAB B;  4F3Q A;  2ALY B;  1Q16 B;  3CUN A;  4LF7 F;  4LF9 F;  2Y8W A;  1KVK A;  1AZS B;  2JEI A;  4IG0 A;  4KSE B;  1JJ2 R;  1FF2 A;  3CT9 A;  1CBK A;  1UJ6 A;  4IQX A;  2B9W A;  2M52 A;  2RQC A;  1BQN A;  3FCH A;  2BW7 A;  3U27 A;  4YN3 B;  4OHX A;  2XGP A;  2ZBQ A;  3HHD A;  1T9X A;  2C2R A;  4YB1 P;  2N3O A;  1VQ8 S;  2LA4 A;  4KO0 B;  2YKM B;  4ZPT R;  3OVA A;  1E6Y B;  4QQB A;  2YXL A;  4OL8 A;  1HMV A;  2IA0 A;  2MLY A;  4ZHR B;  2DT9 A;  1RGV A;  3NEK A;  1N34 J;  5CYQ A;  5HN0 A;  1WUU A;  2VPY B;  1B0P A;  4WYW A;  1LWC B;  1RCO B;  3UNY A;  4K4T A;  3FGV A;  2QTW A;  1FNX H;  1CJU B;  4DX7 A;  2ZHO A;  4O44 A;  4HT5 A;  4RX6 A;  1VQK S;  2RML A;  2HEK A;  3RUB L;  3SCI E;  2MSS A;  4F4A A;  2J0X A;  3AOD A;  4Y2C A;  1RWW B;  2ROP A;  4WTO B;  1I94 F;  1LK7 A;  4AQY J;  3CME S;  3NNH A;  2VFR A;  5C24 A;  4OHY A;  3IWL A;  4IOC Q;  3N01 A;  1IBM J;  2LU1 A;  3TVK A;  3QO9 B;  3WIU A;  5F0U A;  2HHH J;  2MHE A;  4ZDN A;  2YQ3 A;  3KWM A;  2NSC A;  2IJN A;  2XY7 A;  1SJQ A;  2M8D B;  3NS5 A;  4KTQ A;  4PYD A;  2A1B A;  2Y1I A;  1S1W B;  3VZI A;  5LT5 A;  1I6J A;  3A4T A;  3EM1 A;  1G2E A;  3M8R A;  4J9U E;  2DIT A;  1MMD A;  2F3J A;  2Y9H A;  3HSG A;  3HHL A;  1S97 A;  2NXJ A;  1WEZ A;  1PBU A;  2ADC A;  1NDK A;  1YG0 A;  2VAS A;  4I68 A;  2JHE A;  4DPU A;  2V69 A;  2WVD A;  3J81 j;  3JYT A;  1HNX J;  3RZA A;  4RKU C;  2BRL A;  3QNW B;  1EQ0 A;  2RKI A;  4KE5 A;  1H38 A;  2GQ2 A;  5J2N B;  3VVU A;  1N48 A;  5EWG A;  4JI6 J;  1VCT A;  2NPF A;  2AD9 A;  3VWS A;  3I0R A;  1SL1 A;  1VQ5 S;  2UP1 A;  3POT B;  4I2Q A;  5BJR A;  1DQA A;  1KLN A;  3BRE A;  4KFB B;  1RAH B;  3QJL A;  1U0H B;  2O1P A;  2Y0S D;  4DR5 F;  3EPI A;  2J6U A;  2CDQ A;  4X2B A;  2DBB A;  4XK8 C;  3VGT A;  3SV3 A;  4X4S A;  4UW2 A;  4DL5 A;  4MYT A;  5DGB A;  4DUZ F;  2KN4 A;  4ZLP A;  4UOG A;  2OSR A;  2AWZ A;  3BYR A;  4FP9 A;  1JQG A;  4CLY A;  4C8Z A;  3H90 A;  5JXS A;  1WC4 A;  4I4B A;  3FK4 A;  4QW8 A;  3KK3 B;  2ZE2 B;  4C8N A;  4ZVF A;  4PR6 A;  4Y65 A;  4M1K A;  2KTQ A;  3I31 A;  1L3K A;  2GQC A;  3GON A;  2XZW A;  3MPW A;  1S4F A;  5DDP C;  3WQP A;  3OHB A;  1VDH A;  1ZOT A;  3RW7 A;  1QLN A;  4DV0 F;  1YGY A;  1XJW B;  2XEX A;  3ZTP A;  1A6L A;  3GR1 A;  2ASD A;  2EC2 A;  3ISN D;  3H4D A;  3NMA A;  2BKO A;  4OJ3 A;  4Z7C A;  2F4F A;  2PA3 A;  5ETK A;  3D9B A;  4O0N A;  3DHW C;  2O67 A;  3N79 A;  2KYX A;  5J2Q A;  1MSW D;  4DU8 A;  2KM8 B;  3A3N B;  1VQ9 S;  5AT1 B;  2EXU A;  3W64 A;  3EUN A;  4NAS A;  1FK9 B;  3NG8 A;  4WYL A;  3FKB A;  2MGZ A;  2ZUA A;  2Q66 A;  2B3T B;  3Q8P B;  1UVJ A;  2IY5 B;  2Y1J A;  3UDC A;  1ROF A;  1JLE B;  1YJV A;  3OVS A;  4QYZ K;  2ASY A;  5IS2 A;  5EDW A;  1JX4 A;  5AJ3 F;  1OQ6 A;  3JSM B;  3ZZT A;  5D4O A;  1D0E A;  3R5C A;  3GSI A;  1JB0 C;  3ZNU A;  3GV5 B;  4DV7 F;  2FJB B;  2CJK A;  3OR2 A;  3SSR A;  1PYT A;  1S6O A;  3LO3 A;  1RXO B;  3C14 B;  2AJ1 A;  1O51 A;  3RRG A;  2LA6 A;  3ZZY A;  1RAE B;  2OSQ A;  5HMX A;  2ZM6 F;  1APS A;  1D09 B;  4K4W A;  4PWW A;  2NXC A;  2D3O 1;  4A8F A;  5CXT A;  2E9R X;  1R6V A;  3BQ0 A;  3HX9 A;  4D3G A;  3D1H A;  3TWZ A;  2CJB A;  2ZZN A;  1H7X A;  2MYF A;  3OL7 A;  4OV1 A;  2YNH A;  4OLP A;  4C6A A;  2U1A A;  1HHQ A;  2K1R B;  4DG1 B;  4BBY A;  1LV5 A;  1MU2 A;  2VZ9 A;  3PO5 A;  3RAQ A;  2XMM A;  3ZFV A;  1RWK B;  3GIM A;  2HWT A;  5A8R B;  4KHM A;  2HBY B;  2GHP A;  2Q79 A;  4FKY A;  3C66 A;  3UD5 A;  1ZM3 A;  4CYU A;  4XAK A;  4LF4 J;  1PAE X;  3P45 B;  3J80 Y;  4DSF A;  2ZZT A;  5D4P A;  4ES2 A;  6AT1 B;  4U7C A;  5JMN A;  1BQN B;  2O01 C;  2XWX A;  3CO9 A;  3UWT A;  2KZM A;  1YRX A;  1OMS A;  3N5B A;  2GGP B;  1QTN B;  3MPY A;  3EVM A;  4QIG A;  2XBP A;  9RUB A;  3PO4 A;  4FXW A;  3W9I A;  3DOL A;  1N5S A;  2HKE A;  3SSS A;  3OUY A;  4ATN A;  1FES A;  2ILY A;  4DFJ A;  1V3Z A;  1VQ4 S;  3GWC A;  2NSB A;  2YY3 A;  5D6G A;  5CYQ B;  3BPS P;  4WK3 A;  3K5N A;  1VC6 A;  3D66 A;  1NB7 A;  1K8A T;  4CLZ A;  3T41 A;  1RU1 A;  3K59 A;  3DU5 A;  3T5L A;  2XY5 A;  1HQE B;  1NJI T;  1W26 A;  2JVO A;  3R5A A;  2VFS A;  2AHO B;  2ZM6 J;  3H2U B;  3N6M A;  4NOH A;  1XMB A;  1B4S A;  3E01 A;  4LF1 A;  1LWF A;  1GX6 A;  2M7S A;  2YVS A;  1VHI A;  2Y3Y A;  3HXM A;  1JJH A;  1OWX A;  4UST A;  1M5H A;  2H65 B;  4RNH A;  2DVI A;  3TJA A;  4HL9 A;  1UWA A;  1Y9O A;  3CJR A;  5KFK A;  2QA4 S;  3TAQ A;  1XNQ F;  4UOC A;  4DR6 F;  1PIE A;  1RBA A;  2M8H A;  2A6O A;  4TQS A;  3FMB A;  4CLK A;  5DQI A;  1ACM B;  2QA4 G;  3KHL A;  2BMB A;  4FNH A;  2MST A;  3NOC A;  4P2S A;  5AE2 A;  1HIY A;  4KRW A;  2G2O A;  3U1M A;  1QVF R;  4LMZ A;  2V50 A;  5D4N A;  4QIV A;  4Y2A A;  5T41 A;  3D2W A;  2F5G A;  2A6M A;  4PAB A;  4HH1 A;  1HD1 A;  4PG8 A;  3KDN A;  4Z7Y A;  1P9Q C;  4YHH F;  4C9D A;  5E3C A;  5IQQ A;  3R5D A;  3NRB A;  4DR2 F;  4OI3 A;  1C1B A;  1JLF A;  4V19 J;  2W01 A;  3DXB A;  1NJX A;  3RJM B;  1CC8 A;  4IH7 A;  4P75 A;  5J2N A;  3TJ8 A;  1I94 J;  1WOR A;  3HD1 A;  3K2Y A;  1LQ9 A;  4O3P A;  4KC5 A;  4ECQ A;  5D3G B;  5KFD A;  1SKS A;  4MAK A;  4KHR A;  3TUZ C;  3DLL Q;  1UTA A;  5HO4 A;  4QWA A;  1LFW A;  4DV1 J;  2CQI A;  1KQG B;  3CCV S;  1YKW A;  2K2P A;  3NLC A;  1BY9 A;  2F9D A;  1IKW B;  2ZWP A;  3NGR A;  2MY8 A;  4Y2I A;  4CLL A;  3IWN C;  4MTP A;  3G9C A;  4LQ9 A;  5BR8 J;  3LPE A;  4WZQ A;  4EO8 A;  1RI7 A;  3PIP Q;  3QRQ A;  3O6Q A;  2RDJ A;  1YJ9 S;  2FLO A;  2YX7 A;  3AA8 A;  1J27 A;  4YQW A;  2LKZ A;  2MQP A;  1NSK L;  3DI6 A;  5DZ7 A;  2QLB B;  4RNF A;  2HG4 A;  4PPD A;  4QU7 A;  2AZ3 A;  2RHQ B;  2KT2 A;  4RLE A;  4EBD A;  2IMW P;  3MOJ B;  3QPI A;  1Q7Y T;  4B17 A;  4W92 B;  2JC1 A;  2JL9 A;  1D3W A;  4E0D A;  1U6Z A;  2BJ7 A;  3GG0 A;  1JLC A;  3EXC X;  2ERR A;  2OTJ S;  1R8C A;  1T9V A;  2LXF A;  4IFV A;  1FRL A;  1RA6 A;  4DBQ A;  4Q2L A;  1RBO B;  1NZA A;  3D6F B;  2RRB A;  3FRZ A;  4GO7 X;  5GAG I;  4H4O A;  4CH1 A;  5J2Q B;  2YNF B;  1UP1 A;  2AJ4 A;  1EP4 A;  1FJ7 A;  5J2M B;  2HBR B;  5RUB A;  4DR7 J;  2VA3 A;  1VK3 A;  5JVG Q;  1ZZF A;  2DGV A;  5KTQ A;  4WFB Q;  1GX5 A;  5F8L A;  4ER8 A;  3PX0 A;  1B7Y B;  1U47 A;  1GTE A;  3I0S A;  2E5L F;  1IJE B;  1NME B;  3N9U C;  3M32 B;  3FVY A;  1TKT A;  4RBU A;  2Q3P A;  4ZVG A;  5CD4 H;  2CAJ A;  1G1X A;  2WSF C;  2DNH A;  3GJQ B;  2ABY A;  2ZH9 A;  2N7Y A;  1RYS A;  1AA1 B;  3TUI C;  4ZP6 A;  1KVJ A;  3PNI A;  1Q8L A;  3KK3 A;  1NSA A;  2I2Y A;  1RAC B;  4KQZ A;  4LF4 F;  2RE1 A;  1GXU A;  2RD5 C;  1S59 A;  2JVR A;  2ZC4 A;  4ZS6 A;  1SC1 B;  3S01 A;  3R5B A;  4PUO A;  1B99 A;  4C3K A;  1TUW A;  3OFH A;  5KFA A;  1HD0 A;  7FD1 A;  5LSO A;  2D69 A;  4K50 A;  4ECU A;  3L4B C;  4LRB A;  2YKN A;  1N33 J;  2MLZ A;  1TEL A;  1U1P A;  1R0B G;  1U7L A;  1F60 B;  3OTB A;  3BN7 A;  1WHW A;  4USK A;  4I6W A;  3MAQ A;  4HYK A;  2E9T A;  1KHV A;  3M05 A;  1HQU B;  3IN5 A;  3D1Q A;  2QYG A;  2YWE A;  1NKC A;  2VUG A;  4DPX A;  2IM0 A;  2XI3 A;  3DMJ A;  5KG3 A;  2E5G A;  4P74 A;  3IAM 9;  2CKW A;  1WI6 A;  2RNE A;  4X64 F;  1EKR A;  3NMR A;  2CPY A;  3J7Y I;  1FKO A;  1VBK A;  1V5V A;  2X7I A;  3M8Q B;  1D9A A;  3MI7 X;  4BS2 A;  2NXE A;  2WHO A;  3HZE A;  4WIQ A;  2HHT A;  1WC1 A;  4DN0 A;  3TW0 A;  8ATC B;  3OJS A;  3CIZ A;  3NGS A;  4DDF A;  1RAI B;  1HNI B;  2X1A A;  4OYZ A;  1OYE A;  1R43 A;  1WKL A;  1RT1 A;  4M5D B;  1H0H B;  2V4J A;  4KT0 C;  2WW4 A;  1S1X B;  2P9E A;  3FSX A;  1GMW D;  2OEJ A;  2HNZ B;  2CZ4 A;  2R8G A;  4NI2 A;  1BWE A;  4WP9 A;  4FVM A;  2JDJ A;  3P3D A;  1RHR B;  2DNO A;  5SUH A;  1NAQ A;  4PQU B;  2WVE A;  2B9Y A;  2YBV A;  3BM7 A;  4OI6 A;  4LBH A;  5D0H A;  3M2U B;  3ILJ A;  4ZIV A;  2E9Z A;  1IWG A;  4C0B A;  4KGM A;  1KOO A;  2PEB A;  4B3M J;  1HNW F;  3S1T A;  3CWJ A;  2X1B A;  3MEK A;  2DGW A;  1CJU A;  2DIS A;  3CDA A;  5E5N A;  5KFX A;  3LP0 A;  3M4X A;  4DCJ B;  5IWA F;  4IR9 A;  1URN A;  2BE7 D;  1X9M A;  4DR6 J;  2OFH X;  4CO3 A;  4MK8 A;  3M8P B;  4USI A;  5IT9 U;  3M30 A;  3X3U A;  2FLP A;  3JAM Y;  1HI8 A;  5EWF A;  5L1L A;  3OSP A;  2W9B A;  3OVB A;  2UV8 A;  3BQ1 A;  1RTI A;  1VMB A;  3M8Z A;  2VBX A;  4QBU A;  3D0I E;  2LLZ A;  3CCQ S;  2ATL A;  3I87 A;  3W66 A;  1TAQ A;  1IBK J;  1VQ6 S;  2BEF A;  3MEG B;  1ZM9 A;  4KGV B;  2F9J A;  2VA2 A;  4IG0 B;  2GVZ A;  3FNN A;  3PW4 A;  3IR7 B;  2GMH A;  3N6N A;  4B9M A;  2JFD A;  1K1Q A;  4RWW A;  1YJ7 A;  1TMM A;  2B5J A;  2BV3 A;  2M2B A;  3PDN A;  4WP8 A;  1OPZ A;  1TL1 B;  2WOM B;  1QAY A;  3MM8 A;  2B6A B;  2ZHA A;  3K17 A;  1KHW A;  2QL7 B;  2DXE A;  1FX2 A;  2E5H A;  2ZC3 A;  3TVZ A;  3U7J A;  4P7V A;  5F8M A;  4ZVS B;  1Q81 T;  4Y0F A;  4URG A;  4NMX A;  4RUH A;  4RU2 A;  3MAA A;  2JEF A;  5BYS A;  4OZJ A;  4A4J A;  1HWL A;  2HHW A;  4UOF A;  3ZZO A;  3IAS 9;  1S0V A;  4QPX A;  4KGK A;  4PXC A;  2GIQ A;  3KYL A;  1FD2 A;  1VRQ C;  4CNY A;  3NS6 A;  3QLH B;  2VOP A;  4ERD A;  3BKF A;  3GJR B;  2LQB A;  4QR0 A;  4C7Q A;  3BSO A;  2W2P P;  1T94 A;  4EYH B;  5HBM B;  1HNX F;  4F8R A;  2ZKU A;  3GII A;  5FDL B;  4F4K A;  2BAN B;  3LQV A;  4CT8 A;  2E66 A;  4ZVO B;  3D3B J;  1OQ3 A;  4X4T A;  3SEO A;  3MWB A;  2L08 A;  3ETO A;  2G13 A;  1HNW J;  1IKW A;  1IWA A;  4WII A;  4DL3 A;  1RT4 B;  3I5B A;  4W90 B;  1GMW A;  2XS7 A;  5HMW A;  2DPJ A;  2DXD A;  4O4G B;  3R9L A;  1TKT B;  3CSK A;  2AYE A;  5I4M A;  2HVI A;  5F41 A;  3C15 A;  4LRC A;  1UJ4 A;  5DQH A;  3EXY A;  1FDB A;  4L74 A;  3PAC A;  4Y28 C;  3ZC4 A;  1M1H A;  2MKS A;  3AOB A;  3R3T A;  4HAC A;  2BAB A;  3P5T L;  1R0A B;  3MD1 A;  4O3O A;  1RZM A;  1FE4 A;  2L9N A;  3HFK A;  4ECX A;  3TA2 A;  4OHW A;  1QD1 A;  4PZV A;  4B3S J;  3RYL A;  3T1A A;  5I3Q A;  1UMJ A;  2IRX A;  4NML A;  1FDD A;  2VG7 A;  2N7C A;  3EDR B;  4ECY A;  3K5O A;  1M5P C;  1Y0H A;  2F4V J;  3DRR A;  5AJ3 J;  2H4Y B;  2MKI A;  4Y3C A;  4M95 A;  1SQF A;  2LVW A;  2HGM A;  2GA7 A;  4DPY A;  4PQA A;  4CLS A;  2Z56 B;  1YBA A;  4ZCL A;  1OSD A;  1X5P A;  4E98 A;  3LP2 B;  2CUY A;  4F25 A;  2VG5 A;  3OSN A;  4NLT A;  4OX9 F;  2IRY A;  1T8E A;  2XY6 A;  3J81 Y;  1J5O B;  1NXI A;  1RWV B;  3FEZ A;  4DV4 J;  4X4N A;  1HNZ F;  3M32 A;  2ACY A;  5CCM A;  1TL3 A;  2RAQ A;  2CQG A;  4ID5 A;  3BSC A;  1U1L A;  2ZH3 A;  2RT3 A;  3RRH A;  1FJE B;  4LVO P;  2V63 A;  2Z58 B;  1AXQ A;  2HQ3 A;  3AY0 A;  2ZHB A;  1U1Q A;  2AQ4 A;  3HLU A;  2DNZ A;  3J7Z 5;  2AEM A;  2R7Q A;  1J2V A;  4OZ2 A;  3RR8 A;  4D3H A;  5LMN F;  2WSE C;  3QGP A;  4YME A;  4YUD A;  3VAG A;  3T5J A;  2XSF A;  5HP1 B;  3T1Y F;  1S72 S;  3H98 A;  1DTQ B;  3VAK A;  1C0U B;  2A3J A;  3HJF A;  4ZMM A;  2HHU A;  3W8G A;  3QSI A;  2X51 A;  3AXK A;  2AIR B;  3HKZ D;  5KFT A;  4JI1 F;  4DR4 J;  2UZA A;  3G8S A;  2RF2 B;  4PG5 A;  1JXL A;  4DOZ A;  4HHU A;  4RW8 B;  1HWJ A;  4B3T F;  2HVZ A;  4QR1 A;  2AX1 A;  1UPM B;  2LQ9 A;  1SC6 A;  1IKX B;  1HA1 A;  2XYG B;  1XEZ A;  4CYU B;  3K89 A;  2HHX A;  3U1N A;  3W5Y A;  4N77 A;  5HSP A;  4JYA J;  1TU0 B;  3KDO A;  1RHJ B;  3F41 A;  3RB4 A;  2JX2 A;  1T02 A;  4LFA F;  2OEK A;  3VCD A;  2UVR A;  2BJ3 A;  2FTR A;  2CPH A;  2KZZ A;  3PKM A;  2EBE A;  3EVO A;  4YY3 F;  2E44 A;  1RTH B;  3DC2 A;  3JAM U;  4FS1 A;  2BE2 A;  4O3R A;  1Q5Y A;  1U6B A;  3W2V B;  2IYI A;  4PEO A;  1X4G A;  4DR1 F;  2UUA J;  4PQU A;  4DV4 F;  5EWE A;  2IM2 A;  4LF2 A;  1F9F A;  3DU6 A;  1KWM A;  3TAP A;  2MQQ A;  3J80 U;  1V3S A;  4MH8 A;  1NZ8 A;  2GAG C;  4DFP A;  4AYB D;  1D1U A;  3W9H A;  2DR7 A;  1H6K X;  1G3O A;  2HS3 A;  1UVK A;  3QLH A;  2YKA A;  1IBK F;  2CQH A;  2V68 A;  4PG6 A;  1MML A;  3ULH A;  4PRF A;  3RB0 A;  5KFS A;  4DN9 A;  1FCA A;  1WF1 A;  2WZ1 A;  1HI1 A;  3H59 A;  4FZV A;  4G1I A;  2J76 E;  4QOT A;  5K8N A;  3QWU A;  4AL6 A;  4BHQ A;  2J0Q D;  4YS2 A;  5DM6 Q;  3O5T B;  3CED A;  4X4Q A;  2AGQ A;  4B9S A;  3DM2 A;  2FJE B;  1RDR A;  2WB4 A;  4U8Y A;  4WE1 A;  4JBC A;  3ELH A;  3PW7 A;  5ETP A;  3PW5 A;  1SJR A;  1H2V Z;  1ZAX A;  3BYP A;  3IGN A;  3LH2 S;  1RTH A;  1WOO A;  5K5M A;  1P1T A;  1URR A;  5KFO A;  5THW A;  4JV5 F;  2GQQ A;  2QLX A;  4LSZ B;  1JLQ A;  2EKY A;  3FSY A;  1Y7P A;  2WBM A;  4TKT A;  2CPD A;  4E2F B;  1WKJ A;  4YR2 A;  3EPG A;  5HQL A;  4ILM A;  4NLW A;  1EIY B;  2EWH A;  1YBT A;  4DFM A;  3IXQ A;  3T9Z A;  3BBB A;  3MEC B;  4Y2M A;  3I4P A;  3M2U A;  4DSK A;  3PX6 A;  1TKX A;  3RU0 A;  2CJQ A;  1NKE A;  4DS4 A;  4TNO A;  1VBY A;  2CQC A;  1FA0 A;  4LF7 J;  2C28 A;  2XS2 A;  4TY8 B;  2HPU A;  3NNA A;  4GVL A;  2P9G A;  1P1L A;  3EGZ A;  2Y8Y A;  4NRT A;  1RLC L;  1TUV A;  1R7I A;  3D3C J;  3D0H E;  3R7S B;  2J5A A;  3DLH A;  2ILZ A;  3QT7 A;  1X5T A;  2B51 A;  3G71 S;  4TVA B;  2VG5 B;  4DX8 H;  1HBM A;  1NDL A;  1MG7 A;  1C1C B;  1R8P A;  1SUQ B;  4WPA A;  2J8S A;  2WTF A;  5ADZ A;  2AU0 A;  5AE1 A;  2V8D A;  1YJN S;  3MCM A;  3TP2 A;  4DUZ J;  1KRP A;  3KKF A;  4HDG A;  1GK8 A;  3QRR A;  2DGT A;  3W2W A;  1P9Y A;  3RW6 A;  2E1R A;  2UXC F;  3BZQ A;  1UVL A;  3AA9 A;  3DDK A;  4ZHR A;  3Q8Q B;  1VQ7 S;  1S5Z A;  3IG1 A;  4LF5 F;  5HL7 Q;  1QAJ A;  2RIJ A;  1VGY A;  2DY1 A;  2YWW A;  1WTB A;  3KLF A;  1DAX A;  1HBU B;  5JUM A;  2MKH A;  1UW9 A;  2V8G A;  3N0V A;  2QJ3 A;  3L09 A;  5T7L A;  2VV5 A;  1XER A;  2A0F B;  2VG6 A;  3ET6 B;  5IM0 B;  4IO9 Q;  4R0E A;  5H9E K;  2C22 A;  4K2X A;  1S6Q A;  2H51 B;  1VLO A;  3GJT B;  5B0C A;  1NSQ A;  3R5G A;  5GME A;  1EKS A;  1RWO B;  3AAW B;  4L3K A;  1LW0 A;  3UDE A;  2BOP A;  2FGO A;  3VHQ A;  3DLK B;  3KLI A;  4RPF A;  1PYS B;  2CPF A;  4QYR A;  4L6V 3;  4FYD A;  3K7R A;  3BBF A;  2UU9 J;  2VQF F;  5A2Q Y;  5BR8 F;  1Q8I A;  1TV6 B;  3GG1 A;  1S9G B;  3BKT A;  3KUE A;  2IRU A;  3TAN A;  1VLY A;  2XS5 A;  1MWY A;  1ZAW A;  4PG4 A;  1HNV B;  3NCQ A;  3S8S A;  1YQH A;  3SXL A;  1KOH A;  3OTC A;  5ETN A;  3KNG A;  4CO0 A;  1KTQ A;  1VIO A;  3Q8S B;  4DV2 J;  3MPD A;  4MYU A;  1F5C A;  1S1T A;  2RSQ A;  2M4M A;  2PDA A;  1FRX A;  3TAM A;  3DN9 A;  2YKP A;  2W25 A;  3DGP A;  4GKK J;  2KG1 A;  3KLF B;  2ZNY A;  2BM0 A;  5CZX A;  3DLB A;  3H5S A;  5L38 A;  2WVF A;  4USW A;  4ITS A;  4Y34 A;  3GFX A;  4I2P B;  5T7L B;  4F4Z A;  3NP5 A;  3I0R B;  1X8D A;  3GQC A;  2BE2 B;  5F0W A;  1QUV A;  4EYI B;  2OEM A;  1FWP A;  2J9D A;  1PGZ A;  2DGQ A;  2DRB A;  1SJ3 P;  1K9M T;  3KG4 A;  5ETT A;  4YFU A;  1NH8 A;  1F9H A;  3H2V E;  1D8Z A;  2H9Z A;  1FXD A;  3MGJ A;  2ZKT A;  3LW5 C;  2PMZ D;  1NRK A;  3V2U C;  4PYA A;  5ETO A;  3L7O A;  2VB6 A;  2ZVI A;  2UVU A;  1RQ0 A;  2XLI A;  4ICL A;  4NLP A;  1RT5 B;  4ED6 A;  2L48 A;  4LIW A;  4OI0 A;  3MR2 A;  4HEA 9;  1Y00 A;  3ZTS A;  4I1T A;  2C42 A;  2GMJ A;  1RBL A;  3I9V 9;  2WON B;  3HHL D;  1EAY C;  2DKO B;  3MR7 A;  4UF4 A;  4AND A;  4DCP B;  3RR7 A;  4JI5 F;  4B3O B;  4KPC A;  4ECV A;  1RT2 A;  5D78 A;  2XQC A;  3PR5 B;  1TL5 A;  4QJV A;  2W4D A;  3DRY A;  4X4P A;  3GCX P;  5D77 A;  3KUG A;  3LGN A;  4KKO B;  2BE9 B;  3R5J B;  3QWP A;  1YBU A;  4G65 A;  4DSI A;  3VZH A;  4K4S A;  5CZV A;  4ED2 A;  2MJU A;  5HP1 A;  3G6Y A;  3U1L A;  1L3S A;  2GX8 A;  4DL2 A;  3J7A 1;  2F8E X;  2E5I A;  1ZTT A;  3PG9 A;  1N54 B;  3H0P A;  4RW9 A;  1D9D A;  1YWX A;  2U2F A;  2I8E A;  3DOM A;  4X66 F;  4JI3 J;  2YH0 A;  3DMJ B;  4N41 A;  1T03 A;  4ECW A;  1HW9 A;  2BXJ A;  4C8O A;  3LPY A;  4RW8 A;  2C3P A;  2VH7 A;  4IR1 A;  4Q0B B;  2PI4 A;  2CPJ A;  1SCJ B;  2R7O A;  4IDK A;  3MM6 B;  1U6F A;  3VAF A;  1HFE L;  1QJH A;  3BH6 B;  1VYA A;  1V5I B;  4WFN Q;  1X4C A;  1J5E F;  3IR6 B;  3CF5 Q;  3KLG B;  4K4V A;  3OR2 B;  1C0T A;  4OHV A;  3GIL A;  4JOU A;  4ALZ A;  2DD8 S;  2XZD B;  4USJ C;  3W5Z A;  2QA1 A;  1TL4 A;  4WFZ A;  5GAE U;  2HS4 A;  3CTR A;  4V19 X;  3AD7 C;  4PKD B;  2MTL A;  4B3T J;  3BQ2 A;  3L95 X;  2HNZ A;  1R8B A;  4A47 A;  1YJU A;  2F8H A;  4GRS A;  3SFU A;  5B0F A;  1IXK A;  1EET B;  1O6X A;  1JLB B;  3Q83 A;  2W8L A;  1WG4 A;  3Q2S C;  3RB3 A;  4P2F A;  4RW9 B;  2HHH F;  4YP3 A;  3HO1 A;  1U4B A;  3IC1 A;  4F0H A;  3NCP A;  5C2C A;  1XR6 A;  2C3M A;  2QC3 A;  2SXL A;  3CD0 A;  3LAK A;  4J9N A;  2VJV A;  3EJM A;  3DRP A;  3M30 B;  1FEE A;  4Q45 A;  4C8K A;  1DQ9 A;  2BAN A;  3HVT A;  3NWG A;  1KKH A;  5H9F K;  3FFI A;  1YVF A;  2VC1 A;  2IVY A;  2B56 A;  3OTD A;  4NLY A;  2R8J A;  1IR2 A;  1RT4 A;  5IWA J;  5F8H A;  5AXL A;  5CAB A;  2KXH A;  3KK2 A;  1IBL F;  3QAU A;  3CJS A;  4YDX A;  4UQT A;  3HSZ A;  3QFH A;  5IC6 B;  1JXE A;  2FJV A;  3G96 A;  4A8W A;  3ZTR A;  2DGO A;  2HUR A;  2GML A;  3BH7 B;  3CW2 C;  3TZY A;  4ZA1 A;  1FKA F;  1Q5V A;  1RIS A;  1CJK B;  3QJJ A;  3ZZP A;  1HWI A;  4OZL A;  4C3L A;  3ENA A;  4HAC B;  4EK2 A;  1Q0N A;  2AYB A;  3E2E A;  2PGC A;  1ULR A;  4U6P A;  3H7H B;  5B0G A;  1B0T A;  1T3N A;  4DV5 F;  5G0R B;  3CDE A;  1RTJ B;  3R2C J;  1FJC A;  2GJI A;  3ISZ A;  4LF8 J;  3TYT A;  2EFP A;  3MCS A;  4UOH A;  1SH3 A;  3LAL A;  2RKI B;  1IJF B;  1RAG B;  5LJ5 Y;  4ZPA A;  1HAR A;  1W7W A;  1P27 B;  4X62 J;  2CNK B;  3K0J A;  1VS3 A;  4I67 A;  5L39 A;  2LYV A;  3POT A;  5CCL A;  1M90 T;  3QGG A;  3CD5 A;  2C2M B;  4R8U A;  3MM5 A;  2R3V A;  3FFI B;  3QGH A;  4CDI A;  1RTI B;  1SKU B;  4ELU A;  4YHH J;  1X9S A;  2DHS A;  1BQM A;  2KFY A;  2CPZ A;  1NM2 A;  5J2M A;  2IMO A;  3MEG A;  3Q89 A;  1RSC A;  1FFG B;  2Z2L A;  1JK9 B;  2A10 A;  2CQP A;  2GVZ B;  4AT1 B;  3IBC B;  2AP6 A;  5HMY A;  1TL7 B;  3M9M B;  1UEU A;  1H2U X;  3SIP B;  4AE5 A;  2LQ8 A;  3QGI A;  4JV2 A;  1HNV A;  3V6K A;  1NK8 A;  4DV6 J;  4RL1 A;  1A7G E;  3NGU A;  2DIU A;  2FQQ B;  2W9C A;  1WHY A;  2VFV A;  4EI2 A;  2Y0B B;  3W2W B;  5A8W A;  3AJ2 A;  5DDO C;  2JLG A;  5ETQ A;  5G0R A;  2XLK A;  4BC7 A;  3BN4 A;  2HQC A;  3HHL B;  2PA8 D;  3KHR A;  2G2Y A;  5KFH A;  4NA2 A;  4JI6 F;  2KB2 A;  2HGN A;  4Z2X A;  3TRG A;  1Y10 A;  2K7J A;  4YOE A;  5CHC B;  4FDF A;  1NK6 A;  3F73 A;  1S1V A;  2DHG A;  5B08 A;  2DGX A;  2HLU A;  2UUB F;  4LSN B;  3GU0 A;  1Q4R A;  2AW0 A;  2F7V A;  2OHD A;  3T1H J;  2VFT A;  1YZ6 A;  1VQP S;  2V94 A;  1N6Q B;  3V6D A;  3OQ2 A;  3KMS A;  3GPA A;  2MKY A;  4ZPV R;  1HW8 A;  1KFD A;  3BO3 A;  4J9S A;  2FVS A;  3MPV A;  3HHK A;  1T03 B;  4LRF A;  4PAA A;  4DR7 F;  2I6W A;  1DBD A;  2Z2M A;  1IKX A;  4ENO A;  4ED1 A;  2HNY A;  2J7K A;  3QJP A;  1HHS A;  4O4G A;  2MPU A;  5D15 A;  4A8M P;  4DX6 A;  1YIJ S;  2IBK A;  4M94 A;  1ZBT A;  1KVI A;  1FRH A;  2P2C B;  4N8N A;  1U25 A;  3KLE B;  2DYA A;  1WEL A;  2YNI B;  2WRM A;  4FS2 A;  3WZ0 A;  2ZIT A;  2HFZ A;  3NNC A;  4KKO A;  1WWH A;  4JI2 F;  4ZVE A;  2UV8 G;  3TEH B;  4DHV A;  3TZZ A;  4LF5 J;  4ETZ A;  2QMU B;  2XI2 A;  1NK4 A;  3GTY X;  5CYJ A;  2FZC B;  4X66 J;  1UZH A;  4QWD A;  4YB7 A;  2FC9 A;  2ZNZ A;  5KT3 A;  2P6S A;  4RW6 A;  1RTD A;  2ZBP A;  3UVJ B;  1VRT A;  4WK1 A;  1BUX A;  1SJ1 A;  2YNG B;  3CMA S;  2X1G A;  2JRS A;  3EWG A;  1NPP A;  2K8G A;  4C0H A;  1RWP B;  1XR7 A;  2HIY A;  3TVY A;  2DY9 A;  1L3V A;  2FJA B;  2YH1 A;  3MMC B;  4Q0B A;  2IVM A;  2KJV A;  5IQ6 A;  3BDE A;  4FKX A;  2CRL A;  8AT1 B;  4DSE A;  4CM0 A;  2ACM A;  2BQU A;  4DV7 J;  2ZVS A;  2JC0 A;  3FRY A;  1RWU A;  5LOQ A;  2LXU A;  2YTC A;  3AD8 C;  4FYV B;  4OX8 A;  5E41 A;  2UVW A;  3C3L A;  4JI5 J;  2RDD A;  2LDY A;  1L5U A;  1UPP A;  1NND A;  1RTZ A;  2PSZ A;  4ZVH A;  2R8H A;  3H42 A;  3OLB A;  5AE3 A;  4DV5 J;  1FHT A;  3DOL B;  1IKV B;  1Y5I B;  2OO4 A;  3K58 A;  2UXD F;  1F3V A;  4NLU A;  1H3D A;  3JXO A;  2DPI A;  1RWM B;  2XUL A;  2PEH A;  2B7B B;  3D0G E;  3UCG A;  3W2V A;  4OJG A;  4F26 A;  2I9S A;  4LRD A;  4ZP7 A;  1LK5 A;  2J7U A;  4ED0 A;  1U49 A;  2CXE A;  1S0O A;  5H9F J;  3NGT A;  1VQN S;  1IVZ A;  4LRA A;  1PO6 A;  3IO1 A;  2R7S A;  3OL6 A;  2VU5 A;  2J0S D;  4DQQ A;  1NJW A;  2UXB F;  2FHO B;  3VF0 B;  1CEZ A;  3JSY A;  4X84 A;  4QW9 A;  1QUP A;  2BJ9 A;  2IIH A;  2ZEJ A;  1K1S A;  5K20 B;  2BR0 A;  3HK2 A;  5BXI A;  2D3O R;  4X4O A;  3OL8 A;  4L73 A;  1FER A;  1X31 C;  4PPZ A;  3H5Y A;  3QAE A;  4FBU A;  2MDA A;  1TVR B;  1RAA B;  3HJV A;  2R7T A;  3CE8 A;  2DK2 A;  2ZD1 B;  2FZG B;  3GB0 A;  4DL0 C;  3UDL A;  5J1P A;  5I3U B;  3M8S A;  4FF2 A;  4IRC A;  2D7S A;  2IPO B;  3VR1 A;  2BDP A;  2IBO A;  3UR0 A;  1TFY A;  4CO4 A;  4NLV A;  1WSV A;  2N4D A;  5KFV A;  3TEG A;  1YRT A;  4J91 A;  4MKY A;  5GAD U;  2HGL A;  3O44 A;  4J9P A;  1GQE A;  1EQM A;  3BKU A;  3PRV A;  3PYF A;  4QWB A;  4AL7 A;  4J9O A;  2LEA A;  1HMV B;  1WG5 A;  2HAF A;  1X5O A;  4C11 B;  4LFC F;  4NXM F;  3L7U A;  1JLF B;  1GNK A;  2UUW A;  3AFG A;  1WOS A;  1SH2 A;  3T1H F;  3RAX A;  1KON A;  1REV A;  1HWU A;  4L76 A;  3V6H A;  4OZN A;  5FJ4 A;  2KL8 A;  2BJ1 A;  1V6H A;  2FDN A;  2RH3 A;  2HYI B;  3R8Y A;  4K4X A;  3OFF A;  3DRR B;  3QQC D;  1LW0 B;  4KV8 B;  1M5S A;  4CWB A;  4RU9 A;  3GV7 B;  3EX7 B;  1Q8B A;  3VAL A;  3CCJ S;  4PWU A;  3B8H A;  5J2P A;  3K5L A;  2OH2 A;  2JFK A;  1KD1 T;  2VIC A;  2LQJ A;  4RBT A;  4CLF A;  3KK1 A;  1SH0 A;  3MOZ A;  4DV6 F;  3CO0 P;  3BO4 A;  1J5O A;  3AOA A;  3EVW A;  1ZTW A;  1GXT A;  2V8V A;  3M2R A;  4JB8 B;  2OML A;  2AEJ A;  3GYX B;  4OZ1 A;  4DU7 A;  4ZN3 A;  4DCO B;  5LSL A;  3BR9 A;  3P5B P;  1UEV A;  2FVC A;  3BJY A;  1IBM F;  3DI6 B;  4X4U A;  3CDU A;  1X4A A;  2F4V F;  3V4M A;  5HAT A;  2CJ9 A;  1RTJ A;  2OPR A;  1IQZ A;  1LXN A;  5CAA A;  2ZUG A;  2CQ0 A;  2E29 A;  1RT3 A;  3K5P A;  4WTY A;  5M2U A;  1S6P A;  3PYE A;  2QMX A;  1S0N A;  2Z2Z A;  3Q2T C;  2XLJ A;  5KG7 A;  2DCU B;  4GVB A;  1DY3 A;  1OS5 A;  2IDL A;  5HBM A;  3UQS A;  3KTQ A;  1FFS B;  4J9R A;  2BVZ A;  2V4Q A;  2C3U A;  1H74 A;  3A8J A;  3O8W A;  5FII A;  5KAK A;  5KFM A;  1N4L A;  1L3T A;  4TLQ A;  2WSC C;  3OL9 A;  2V2Q A;  3IBW A;  2DNK A;  5HLF A;  2ZBC A;  3BGO P;  5KFB A;  4KYZ A;  3UCZ P;  4DSJ A;  1NO8 A;  4A8O A;  4XTT A;  2D1C A;  4DLG A;  4IOA Q;  2V5H G;  3M9N B;  2NQP A;  4QPT A;  4JI4 F;  4DJB A;  2XCP A;  4TU7 A;  2MB0 B;  4JI2 J;  1B70 B;  1YJR A;  1R0A A;  3GLJ A;  3HHL C;  5F9N A;  4DPW A;  1HNI A;  1ZH5 A;  1TKZ A;  5B0B A;  4OI1 A;  3NBP B;  3J7Y U;  2FJX A;  1T11 A;  3MCN A;  4B3R J;  3WC0 A;  2JEG A;  1Y11 A;  1GMV A;  4A8Q A;  1UEK A;  5KG1 A;  5E3A A;  2FJD B;  2ZJR Q;  3CDB A;  3CJ8 A;  4R5P B;  1DFD A;  2CIM A;  2PFF B;  5M2P A;  3UCU P;  4DPO A;  3KJN B;  3ZZR A;  3EYZ A;  1WKK A;  1S76 D;  4WU2 A;  5K8P A;  1N88 A;  1NB2 A;  2MKC A;  4PWD A;  4H4O B;  4M5D A;  3RGI A;  1VC0 A;  4QIF A;  1QY7 A;  4DPT A;  1XN9 A;  1CC7 A;  2DR6 A;  4OYP A;  5IV4 A;  1W2B R;  1NKB A;  1MU2 B;  3WC2 A;  1H2T Z;  3DNC A;  4LBP A;  4RW4 B;  3KLH B;  1VC5 A;  4FYY B;  3I0S B;  2QLW A;  3FEY B;  4NZ7 A;  3HT0 A;  2XSJ A;  2C2D A;  2QRR A;  3VQT A;  2DO4 A;  4HLB A;  4J9V A;  1C0T B;  1YRU A;  2DHH A;  2QN6 B;  1PIL A;  4IQM A;  2HK2 A;  5ETS A;  5A0Y A;  3NGD A;  2RUS A;  3EZ5 A;  3SZ2 A;  5F8N A;  2LQ5 A;  3M6V A;  3TUJ C;  3SDE A;  2UVV A;  2EVZ A;  3CGI A;  3VAI A;  2ZH8 A;  2WOM A;  3BBC A;  3MM8 B;  5EN1 A;  1T95 A;  3FCW A;  3AJ1 A;  2ZFH A;  3L3C A;  3E3X A;  4NYP A;  4OYW A;  3MED A;  2FYX A;  4BWJ A;  4F0K A;  3IRW P;  3NL0 A;  5G4D A;  1NUE A;  4WFA Q;  3QBC A;  2CQ2 A;  2ZH4 A;  4C8Y A;  2V8P A;  3EZU A;  2IC3 B;  3AXM A;  4R0J A;  4HKQ A;  4X4R A;  2FHJ D;  2MZR A;  2YNG A;  1LWF B;  3I9Z A;  2FD2 A;  3N5F A;  2VQE F;  2QFJ A;  1TKX B;  3KNA A;  5A2Q U;  2HZC A;  2MGZ B;  3H4B A;  1ICE B;  2MZJ A;  3MAH A;  4DG1 A;  5LMN J;  4OI4 A;  1HQ2 A;  3KMQ A;  1FJG J;  1XR5 A;  5A8R A;  5KFU A;  4B3R F;  3FJ2 A;  1YDL A;  1FKO B;  5J1E B;  4P71 A;  1BGX T;  5DZ6 A;  1N5T A;  3TAR A;  2DR5 A;  3PZP A;  4WBF A;  4LQ3 A;  4FF4 A;  3QIP B;  1WAC A;  2DH7 A;  5L8R C;  4X64 J;  2AZ1 A;  1S99 A;  3B82 A;  3OT9 A;  1YIT S;  2JOQ A;  4LFB J;  4YR3 A;  4Q5V A;  2D9O A;  2BUN A;  5B09 A;  4XDD A;  2Z2Y B;  1LXJ A;  1N56 A;  2GV1 A;  2V8H A;  5M2R A;  2GIR A;  3PCO B;  4PG7 A;  4FXD A;  2XMK A;  5A8K A;  4WZM A;  3A13 A;  4BWM A;  1JLB A;  2EK1 A;  2KVI A;  2XHC A;  2Z30 B;  3M7V A;  4GC7 A;  1SKW A;  1Q78 A;  4EZ6 A;  4JV1 A;  1VK8 A;  5EGY A;  1IBL J;  1OYD A;  2QSW A;  1U1N A;  3DGV A;  1I3O B;  3VV2 B;  3OHA A;  1HBU A;  1GXL A;  2O66 A;  4L72 B;  1WD6 A;  3D6T B;  3LA0 A;  3M6X A;  4PXB A;  1PYO B;  3E01 B;  2VF3 A;  1T9W A;  1VBZ A;  1UET A;  1SL2 A;  1U2R A;  3EGW B;  3DRP B;  4I64 A;  4KV8 A;  4J9L A;  3KOA A;  3VGV A;  3KHG A;  2EW9 A;  3BGU A;  4KFB A;  2MZS A;  5L9N A;  2FC8 A;  2B4P A;  1JKH B;  1YTY A;  3LP2 A;  1FXL A;  2HVE A;  2ZJP Q;  3QAT A;  2HQF A;  2FIU A;  4M5I A;  2G0C A;  4XPE A;  2AJQ A;  3M2R B;  3KJF B;  2MZ1 A;  4ECR A;  3UNG C;  1RU2 A;  2RIL A;  1R3N A;  4NLX A;  3VAJ A;  3D68 A;  1EX8 A;  1MN9 A;  2VC0 A;  3NS7 B;  5A8W B;  1TK5 A;  3ZZU A;  2DNP A;  2BQR A;  2KXF A;  3W60 A;  2R7X A;  5KFI A;  1R8H A;  1Z2Z A;  2BW2 A;  2RU3 A;  3Q8V A;  1GEH A;  1MRO A;  4NYO A;  5K14 B;  5KFZ A;  5KG5 A;  1XC9 A;  2ZH5 A;  2AJ2 A;  2ATC B;  2FB0 A;  1LWC A;  3ZO7 A;  4K5S A;  3PFO A;  3G2X A;  1ZPW X;  2IYG A;  3GFZ A;  4B9N A;  4NEY A;  1SQG A;  2OP5 A;  2Q6C A;  4ECT A;  4TQR A;  1AB8 A;  1RHU B;  5DS7 A;  4O23 A;  5HVF A;  4WF9 Q;  2NLW A;  4UZC A;  2CQD A;  1WG1 A;  3T6J A;  5IT0 A;  2W8K A;  2IVF B;  2R4F A;  5ITH A;  2AX0 A;  1F2H A;  3KG0 A;  2ZDP A;  3D6M B;  4HI1 A;  2R2R A;  3AQP A;  1BLU A;  2G2Z A;  1G6B A;  2HRU A;  3HHE A;  3RG6 A;  2OI2 A;  3CC2 S;  4G1P A;  5FDL A;  1HBM B;  4MIA A;  4KIA A;  5LL6 d;  2L41 A;  2JWN A;  1QE1 A;  1JLA A;  2CFX A;  4ES3 A;  4J5O A;  4KBI A;  4HHH A;  1LWE A;  4HI2 A;  2A2C A;  3BB5 A;  3JS9 A;  4DR3 J;  4DMZ A;  3FBE A;  3LGM A;  3I55 S;  4EEY A;  2Z0G A;  1SB6 A;  1O5J A;  1IKY A;  1MNE A;  4N7T A;  4F3O A;  2DNM A;  3FZB A;  5C42 B;  3V4I A;  2JNJ A;  5KFF A;  1UKU A;  1ZS6 A;  3MDF A;  5IV3 A;  4M5J A;  4MT1 A;  2XO7 A;  3KJV A;  2QV6 A;  3IBF B;  2ZOF A;  3D54 A;  3OFG A;  5B7W A;  5I42 A;  2BQ3 A;  1WHX A;  3UVJ A;  2V34 A;  4R8U B;  4BDP A;  4X65 J;  4ZJO A;  3HCX A;  4KPY A;  1BC6 A;  1GFW B;  3V6D B;  1VJW A;  2ZZM A;  3UN5 A;  4DV3 F;  4NLR A;  3TX0 A;  3T3F A;  3DLG B;  1SIW B;  2RDI A;  2BJE A;  2OPP A;  1KQK A;  4Q44 A;  3WHI A;  4UZB A;  1S9G A;  4RO0 A;  3HFZ B;  2YWF A;  3UR3 C;  1MN7 A;  4ETX A;  4UQG A;  3GMG A;  4OX7 A;  1JWW A;  2XGQ A;  3ITH A;  1RP5 A;  1U26 A;  3ICL A;  4G1Q A;  1IKY B;  3W5X A;  1DLO A;  1RLD A;  2DNN A;  2B4V A;  3DM2 B;  2PMW A;  4KY3 A;  2ROG A;  3PRB A;  2NZC A;  2W2N P;  1VFJ A;  1W2I A;  3K8V A;  1YSJ A;  2PII A;  2GW8 A;  2DHA A;  2QE5 A;  2V2K A;  4IO1 A;  1WOP A;  2GJ2 A;  3TZX A;  3OTO J;  2EBG A;  3OLA A;  4A8S A;  4IH6 A;  2M70 A;  3NBP A;  4NI2 B;  2KT5 A;  1TK0 A;  2J9D E;  4M5K A;  1ARO P;  3I5C A;  1SL0 A;  4U96 A;  1UFK A;  2NCK L;  3Q22 A;  4ANE A;  3CCZ A;  2G1H A;  5K9F A;  4GKK F;  3QFW A;  1DUR A;  3MMB B;  2HHV A;  2GAH C;  4C8M A;  1S9F A;  2J8A A;  4F04 B;  4ZLN A;  1TAU A;  1CG2 A;  2YX1 A;  3T5K A;  2HMI B;  2IAJ B;  4K0K F;  4ZJL A;  2Y1R I;  3SYZ A;  2GNK A;  1HR0 J;  3LP0 B;  1RT5 A;  4JI8 F;  2EEY A;  2MQ8 A;  1CQN A;  2M5Y A;  3DXS X;  2KRR A;  3PXG a;  5KG0 A;  3W8P A;  2FLN A;  1B3T A;  2UUB J;  2OPS A;  1F9E B;  1RT6 A;  2HZA A;  4KHP J;  4ZIT A;  2VPW B;  1K44 A;  2H5I B;  2HRT A;  4K2J A;  2M0G B;  1FFW B;  2QZ8 A;  4PXE A;  4RR5 A;  1F1B B;  3MM9 A;  4S0M A;  1JKH A;  4KGX B;  5U47 A;  3QIP A;  4JUZ A;  4DFK A;  1VBX A;  1K73 T;  2V2V A;  2K7K A;  3TR5 A;  2EFN A;  2FY1 A;  3BDP A;  2R9L A;  1AW0 A;  2C3Y A;  1X4H A;  3ILO A;  1CUL A;  2CDR B;  2HFN A;  2W1B A;  3LGH A;  4Q2M A;  4ZVQ B;  4ZVR B;  1KTV A;  5HJX A;  3BGF A;  3E51 A;  4EBE A;  3GSD A;  1HBO A;  2RS2 A;  1H72 C;  1TTH B;  2CWX A;  3ADA C;  3OD2 A;  4Z37 A;  1H73 A;  5EHH A;  2C2O B;  2XMU A;  1BE4 A;  2GVD B;  1Y3K A;  3R2D J;  3GFH A;  4RWX A;  2VPZ B;  1VRT B;  2OAU A;  2EK6 A;  3SCJ E;  2J6T A;  1REV B;  2EFG A;  1OY8 A;  1U8W A;  2EG1 A;  5J1N A;  1C4A A;  1I51 B;  1WC5 A;  3T1Y J;  2NZ4 A;  1SJ4 P;  1GH8 A;  4I69 A;  3HVW A;  2RS8 A;  3PHT A;  4L3N A;  3K5M A;  1KBR A;  2MJN A;  2VG6 B;  3ET6 A;  4UTG A;  4I2Q B;  2J0W A;  3BS9 A;  3MD3 A;  5IM0 A;  1SJF A;  3CNQ P;  3MUR P;  3FMW A;  4HH0 A;  4LSL A;  2KRB A;  1H98 A;  4KHP F;  2CVE A;  1PJ6 A;  4CH7 A;  3CCE S;  5E3P A;  3MXH P;  1TFW A;  5D0R A;  2QLF B;  2LXI A;  3DLE B;  1N34 F;  3CJ2 A;  3H2L A;  1Q82 T;  2F65 A;  1RT1 B;  2BM1 A;  1F5A A;  4F0M A;  2E5L J;  1S1X A;  1UA1 A;  2R42 A;  4K5R A;  3D5M A;  1IKV A;  4FPI A;  3FCV A;  1Q86 T;  4CLU A;  1TMJ A;  1EHW A;  1HPZ B;  4A48 A;  4QWC A;  3MCO A;  3AD9 C;  4USH A;  1C2P A;  2FPH X;  3V5R A;  4XO0 A;  1JJC B;  4ZP9 A;  4P6Q A;  5L1J A;  5GMK a;  2MQO A;  4F4Y A;  1CJV A;  1HWK A;  2C3O A;  1JLG A;  3BEG B;  4RNO A;  3RRK A;  2YKO A;  2IFX A;  1Y3J A;  2UUC F;  2COL A;  5HAO A;  1FEH A;  2R7V A;  1IM4 A;  2F63 A;  2DGS A;  3HVT B;  5E3R A;  2W7P A;  1PC5 A;  3NAI A;  4B9V A;  4FPR A;  4KH0 B;  3HM9 A;  4DF4 A;  2HVH A;  3UN3 A;  3C6U A;  4J90 A;  2CQ3 A;  2MQN A;  5L46 A;  3Q8R B;  1JXV A;  5KFP A;  5GAD I;  4A8Y A;  3PM9 A;  2C2Z B;  4M5N A;  2W7A A;  3FQK A;  4B08 A;  1VRU B;  2HND B;  3MMJ A;  3SI8 A;  4JV5 J;  3SQG B;  4HDH A;  4OYI A;  2PO4 A;  4OMF G;  2R8K A;  3PRD A;  4TXS A;  1VHF A;  4LFB F;  3CCR S;  1S1T B;  2KU7 A;  1DLO B;  3KXD A;  1PCA A;  3TAM B;  3RTV A;  1U1O A;  4OHZ A;  5C42 A;  3V4I B;  4ZVT B;  4HVZ A;  1UL3 A;  4CM2 A; 
#chains in the Genus database with same CATH homology
 2W2Q P;  1SCJ B;  2Z58 B;  3A3O B;  2PMW A;  4OV6 A;  2W2N P;  3CNQ P;  3SQO P;  1V5I B;  2W2P P;  2E1P A;  2W2M P;  2Z2Z A;  1ITP A;  3GCX P;  3WIV A;  2W2O P;  3WIU A;  3GCW P;  3H42 A;  3QFH A;  4K8R A;  4JP8 A;  3VHQ A;  2Z56 B;  4YN3 B;  3CO0 P;  1R6V A;  2Z2Y B;  2ZWP A;  2ZWO A;  4NE9 C;  3A3N B;  3BGO P;  2Z57 B;  3WHI A;  3BPS P;  3P5B P;  2Z30 B;  3T41 A;  4NMX A;  3AFG A;  1SPB P;  2XTJ P;  2QTW A;  3VV2 B;  3A3P B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...