1V5IB

Crystal structure of serine protease inhibitor poia1 in complex with subtilisin bpn'
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
76
structure length
76
Chain Sequence
SAGKFIVIFKNDVSEDKIRETKDEVIAEGGTITNEYNMPGMKGFAGELTPQSLTKFQGLQGDLIDSIEEDHVAHAY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Subtilisin BPN'
publication title Crystal structure of serine protease inhibitor POIA1 in complex with subtilisin BPN'
rcsb
source organism Bacillus amyloliquefaciens
molecule tags Hydrolase/protein binding
total genus 22
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2003-11-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.80 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Peptidase S8 propeptide/proteinase inhibitor I9 1v5iB00
3BPSP 2W2PP 2ZWOA 3A3OB 3H42A 3P5BP 3WHIA 2W2OP 1SCJB 3CO0P 2ZWPA 2XTJP 3QFHA 3GCWP 2Z30B 1SPBP 1ITPA 2Z57B 2W2NP 4NE9C 4OV6A 2W2QP 3CNQP 2Z2YB 3WIVA 2PMWA 2W2MP 3VV2B 3A3PB 3VHQA 4NMXA 3T41A 3GCXP 4K8RA 2QTWA 3BGOP 2E1PA 2Z58B 2Z2ZA 4YN3B 1V5IB 4JP8A 1R6VA 3SQOP 3A3NB 3WIUA 2Z56B 3AFGA
chains in the Genus database with same CATH superfamily
2LXFA 4PG8A 4J5OA 5LMUF 5BYSA 4KFBB 2X1BA 3K57A 3CSKA 3VAMA 1HARA 4DR6J 1IKWA 1U1OA 3R2DJ 3DRRB 3BGUA 2VG5A 5CD4H 3X3UA 1F60B 2EC2A 2GJ2A 1GAOA 4H54A 1FDAA 3DRXA 2RVJA 3R9LA 4LSNB 3HHKA 1RCXB 2R2SA 4LSZB 2GZOA 1NH8A 3NNAA 2DNNA 1TU0B 1SUQB 4UZBA 4DV5J 3M32A 4LRDA 3JTOA 3DRPA 3RW6A 3NXZA 2D1CA 3PYGA 3RR7A 3EMTA 3FBFA 5HK4A 2UU9J 3FBBA 4ZK7M 1AZSB 5A6WA 2AJ0A 3KJVA 4M94A 2JC1A 4NXMJ 4CM2A 2VG6B 2DCLA 2LQJA 3MUVP 3S01A 2GMJA 5AJ3J 1X8DA 1G7CB 2VQEF 4URSA 4CNYA 1LWEB 2MB0B 3QRQA 1CEZA 1MN9A 1TAUA 4CO2A 3LP0A 1RLCL 4USIA 1D9DA 4ZHRA 4N76A 3M1VA 4DX7A 1S79A 3FEZA 3MR5A 5EHHA 4Q7AA 4RBUA 1HBOA 2B3TB 5B0GA 3L7UA 3PRVA 4ZVOB 3AJ1A 2D41A 3ILIA 1WUUA 2N3LA 1YK9A 2DGUA 2E29A 3GB0A 2XMJA 2C3OA 3PW0A 4CLUA 2IRXA 1HKAA 4QCLA 7FD1A 4K4XA 4RKUC 2HHWA 5D0RA 1YJ7A 3CC7S 1S5ZA 4LR8A 2HZAA 2LCWA 4HYKA 1BUXA 2LYVA 4N77A 2BJ1A 2A6MA 3GG1A 2IMWP 2M5YA 4DR7F 5GAEU 2E5HA 2R7TA 1DY3A 3MM9B 4UUXA 4F8RA 2IDLA 2YNHA 1J2VA 2HS4A 4TQSA 2BX6A 1Y0HA 4ZJQA 2AJ1A 2KT2A 2XG8A 2CWXA 5D77A 4H4MB 1R3NA 3KYLA 3BGRB 1U1NA 4F04B 2ATCB 1DQAA 4LT6A 3EJMA 2X1GA 2W2MP 3L7OA 1RAAB 4P73A 4HH1A 1OYEA 2QSWA 1PYOB 4A48A 4JI4J 1DQ9A 1NRKA 1VISA 5BJRA 1XC9A 3AQOA 3BJYA 3GSIA 2KFNA 5BXIA 5A0YA 2HFNA 4J9KA 1ZM4A 1WOPA 4WZQA 3A8EA 3ONQA 1NK9A 2ACYA 4RW4A 1VBXA 1HI1A 2NSCA 2I8EA 1Q7YT 2BJ7A 2QFJA 2D3OR 3R5DA 3HXMA 2BE9B 3D68A 1TQLA 3M8YA 3A8JA 2CXEA 2A18A 3QRRA 2CQCA 2GC8A 4F3MA 3AOAA 3M2RA 4M95A 2G2YA 4JI3J 4C3KA 1X4FA 2QLJB 1ZYQA 3CJ3A 1AT1B 4HTIA 2PN6A 4NZ0A 4YHHF 1QD1A 3IWNC 4F2SA 3CIZA 1S1XB 1VHIA 4BWMA 5HVGA 2FLPA 4K8RA 2CIMA 3FQLA 1FRKA 3CCLS 4Q43A 4BHQA 1WF0A 3N9UC 1UPMB 2ABYA 4ECXA 2R8GA 3QFHA 2ZEJA 4DQSA 2AWZA 4O44A 3QAUA 5L1LA 3GFYA 4WP8A 3CMAS 3MEEA 4DPOA 4DZDA 3SI8A 2HNYA 3JYTA 5IWAF 4ZKAA 3OFEA 1FRXA 5B0BA 1RT2B 4PXCA 4OX8A 3D28A 3TVZA 4QWCA 1WWHA 1UVMA 4LBHA 3IGVA 2JOQA 3H42A 5LJ3Y 4F4AA 4BS2A 5KFJA 2BEFA 5A8RB 2HHTA 1NJZA 5I3QA 3GWCA 2OH2A 2K8GA 1MROA 3GSDA 4R8UA 2UXBJ 2HBRB 2OKQA 2ZWOA 4IG3A 2CPIA 1FWLA 4ZVPB 1RWVB 1HPZA 1HNZF 1S72S 5EDWA 4ZVSB 1R7IA 4NLXA 2WOMA 1RISA 2EVZA 1T3OA 1Q82T 1P9QC 2CQ3A 1JNZB 2OPQA 2M7SA 4Y2IA 3NGUA 2E9RX 3PDNA 3MUTP 4F67A 4PWUA 4JI1J 2OHDA 1NK5A 4P2FA 3R8YA 1MWZA 3O5TB 3BZQA 4M5HA 3ZZUA 4HACB 3H4BA 2KFYA 3QGHA 3NEKA 2D9OA 4HI1A 4B17A 3GIJA 4PEOA 1S6PB 4O4GA 3EGWB 2KYZA 1RHJB 3DFEA 4CH0S 2UUTA 1JLCB 1MG7A 2GCFA 1CJKB 4A8OA 3T9NA 5EX3A 4KY3A 4J37A 2VOOA 4QR2A 3CPWR 2UUCF 6AT1B 4FDFA 3KXDA 3Q8SB 1E6YB 1BHNA 5IV3A 2XBPA 2V8DA 2C3MA 4GO7X 4DR6F 2KHDA 2XHWA 4K5RA 1PYTA 1K1SA 1UEUA 4Y2CA 2Q66A 1NZAA 4AT1B 1UA0A 4OX9J 1FEHA 1HNXF 2NUUG 3BPSP 5KFOA 2NXJA 5GADI 2WCXA 3R5GA 5KFMA 4R0JA 2J9DA 3I9ZA 4NEZA 2MKSA 3M8SA 4UOGA 1D9AA 2KG1A 1UAWA 3T5KA 1UL3A 3IBCB 1RAFB 1VRUB 1GEHA 1Y5LB 5HMXA 4JV5J 1CS4A 1X4HA 4P9SA 3KG1A 1PSDA 4U7CA 2H51B 5HSPA 3F56A 3RB6A 2Y9HA 2GS8A 3PXGa 3HT3A 2R7VA 3FDSA 1M90T 5KFZA 1S1TA 3D4JA 1NO8A 3CIMA 3OHAA 1UEVA 3DRSA 4LF9F 3TO8A 2KVIA 1JX4A 2E7XA 5IM0A 1BGXT 1Q16B 4USVA 3TAMB 5CZVA 3KTQA 1SKUB 3ISND 3W61A 2RDIA 3FCWA 1S7IA 2E9ZA 3MD3A 3D54A 2CJKA 1FNXH 2JNJA 5ITHA 4P10A 2C2ZB 2FLNA 3W9HA 1NDLA 3NNHA 1F0XA 2ZOMA 4C97A 1GXUA 2QO3A 2DIVA 3V6JA 4I56A 1FKPB 2E1RA 5IC4B 2AMCB 1B7FA 3K5OA 3OTOJ 4WK3A 3HZEA 3K58A 3C15B 1WF1A 4MFBA 3IR5B 4F0HA 1Q78A 2FHOB 2O01C 1S77D 1DTQA 2M0GB 2AYBA 2XCPA 2AZ3A 1FKOA 3CJKB 3SCLE 5CH7B 3UW1A 3RW7A 3W5XA 3I5AA 3UI3A 3VZHA 3KHGA 5KFTA 3J7A1 2CJAA 1RTZA 2FHKA 4M5DA 4NYZA 3CCUS 2W2PP 3AODA 3S1TA 4ZVFA 3BH7B 1TVRB 2C3PA 1N36J 4QW9A 1BQMA 4O23A 2ADBA 4XPCA 1SH2A 3N4WA 3HD2A 4ILRA 1X5OA 3PYDA 1NSAA 1WORA 2NUHA 1S9EB 4K2XA 2CNNB 3B4MA 2W01A 1QLNA 3QNWB 3GIKA 2ZH6A 4FVMA 4MIBA 3G9CA 1AW0A 1RGVA 3T41A 1T05A 2V8GA 3BEGB 1H3DA 1IR0A 3LF0A 4P71A 3LGNA 2KYXA 4LQ3A 1P1TA 2MKIA 4P7VA 4LFBJ 2VC1A 3CB4A 1L3VA 4IH5A 1A6LA 1X4BA 2MKYA 2VH7A 4OHXA 3OR2A 4DFMA 2F9DA 4KGZB 5KG4A 3OFFA 3AQPA 3T6BA 3BPDA 3R27A 3E01A 1C1CB 1OQ6A 4CH7A 3NL0A 3LQVA 1YVFA 1WEXA 1N88A 4RUHA 3R3TA 4O3PA 3MZIA 2DNKA 2BW2A 3TUIC 2LKZA 1MWYA 4FXVA 3FC9A 3HSGA 3VAHA 1YJRA 3NGTA 2LDIA 4TQRA 1IBLF 1FRHA 4PG4A 2M4MA 3J80U 2V0NA 4N5SA 3QYYA 3VGTA 1DRZA 2QC3A 2HKEA 4CYUB 1ZPVA 4NLQA 4TU9A 2A2DA 4J9LA 3D6HB 1RB0A 1TUVA 3L9ZA 5CA5A 2VASA 4IQMA 1DQ8A 1FDNA 1X9SA 2N3OA 2VFRA 2VIHA 1U26A 4YDDB 4KIAA 5IQ6A 1HHQA 2PMWA 4NXNJ 3KLFA 2KN4A 3ZTOA 1WC6A 1XJWB 1R27B 5HLFB 2XMWA 2BYCA 3RTVA 2WVFA 1GNKA 2UUBF 3QZ7A 1TFYA 1VHFA 4OI3A 3W9IA 1XWLA 4ZDNA 5HQLA 2PT0A 3Q83A 1S9GB 4P75A 1YBUA 3NOCA 3P3DA 5KFVA 1X4EA 4PRFA 2V9WA 4B9TA 1BC6A 4X4SA 1XTZA 4CO1A 3MMAB 2OPPA 4OL8A 2GIRA 2F4VJ 4KGMA 3DN9A 4DUTA 5DLFA 3OUYB 1R0AB 2UZAA 3AHPA 2ZVIA 3PKYA 3TI0A 3JSRA 1YKWA 2FUG9 3M30B 5D4OA 3B6BA 2W9AA 2F5GA 2ZOFA 4C4WA 3TEHB 1XR6A 5KFXA 4Q5VA 2EKNA 4G1QA 2NXNA 5CYQB 3HVRA 4HDGA 1R89A 3G6ES 1Y3JA 3KUEA 4HEA9 1EX8A 3V4IB 2Q6BA 5H9EK 1VC0A 2XS7A 4ECYA 1V3ZA 2XI2A 2KJWA 3TW0A 1IQZA 1S6QA 4DX8H 3M8QA 2XHCA 4KC5A 4J9SA 3P96A 2M8HA 2D9PA 4C0HA 5AE2A 2OJ3A 4I7FA 2V63A 3ZZPA 1NNDA 2XYHB 3I5CA 6FDRA 2FHJA 5I42A 4BDPA 4WIIA 2W8LA 1FF2A 2LQ5A 2Z58B 3TP2A 4OJ3A 2RE1A 1TR0A 4Q8EA 3CGIA 2GHPA 2FC9A 4WBFA 2HMIA 3K8VA 2WVDA 2VB6A 1Y3KA 3MM8B 4GMKA 1HNVA 2VODA 2HFOA 1T7PA 4MKAA 3QSIA 1WKLA 4K2JA 4ANCA 4NE9C 3OL7A 1RWUA 3M9MB 1GMWD 5KFLA 1IKXA 3IA0A 4X4UA 1GMUA 5E3QA 4B3RJ 2PC6A 3ZZRA 2W9CB 2HW3A 2NPFA 3BR9A 3OTBA 3ZTSA 1F9EB 4QZVB 1RLDA 3MAAA 3DCAA 1TK8A 4PYDA 1HBMA 5D4PA 3OXFA 2YKOA 1XIQA 3MMCA 5A8KB 1UWBB 4WIQA 4DX5A 2B51A 3BB5A 4KV8A 4G1IA 2C28A 4RUAA 3DYAA 1X5SA 4WFXA 1Z1ZA 1IXKA 1CBKA 1LK7A 4MJKA 3DDNA 2QV6A 1R6YA 2V4JB 1PKUA 2DR5A 1X4DA 2BRLA 2FVCA 1EETA 4ER8A 2N7CA 2OUGA 2ZJRQ 3ENQA 3NS5A 2LEAA 2RU3A 4DV3F 1C0TA 5EX0A 2K3IA 1N0VC 3PV8A 2YH0A 4KYZA 1NM2A 3ILOA 3ENVA 4WFNQ 4KKOB 3DM2B 1T94A 3BO4A 1RCOB 4LR9A 1HI0P 4OJ1A 2ADCA 2YWWA 2JVRA 3PHEA 1GX6A 4UZCA 4CLPA 3SSSA 2K1RA 3P45B 2AGPA 3DNCA 4HH0A 3W9JA 1JJ4A 3QGIA 2C2DA 4DUYJ 4CO4A 3C16A 4A47A 3MMBA 1GXTA 2DXEA 3ZZTA 3UD4P 1F3VA 2E5GA 1H72C 1ZBTA 2XMAA 3E51A 1YZ7A 1VQPS 4OX7A 1IVZA 2ILYA 3J7Z5 3UCZP 2CPFA 5DDRC 4CTAB 1FNMA 1F2HA 4Y2MA 4P72A 4FYVB 1NSQA 3C6TA 5L9XA 2RS8A 2YNGB 3US5A 3VAKA 3QQCD 4DR5F 2OPRA 5MLCV 5C25B 4MKYA 5JUMA 4FPRA 3VR1A 4BBYA 1NJYA 2MZJA 2VFSA 3GR1A 3OPKA 5KT3A 4KB7A 2UVVA 2V5HG 2E7VA 4NLVA 1TFWA 1VGYA 4OV6A 4DV4J 2GGPB 2AEJA 3T1AA 1CULB 4RX6A 5DM7Q 4DG1B 2O5DA 2MMYA 4ID5B 5KOXA 4PPDA 3PHTA 2VF3A 2I1RA 5F8HA 2MY7A 1VQLS 1LWFA 2MPUA 2NZCA 3SSQA 2VG7A 2Y8WA 2B6AB 3ET6B 4DU7A 3WHIA 1N33F 3KJNB 2FVQA 5L1KA 4O0NA 2HNDB 1NHKL 2MHEA 3D5MA 3C19A 2YVSA 1HNWF 1SH3A 2ASLA 5K14A 2PFFB 1VFJA 2J0WA 1W2IA 4I2QB 4C0BA 4F0KA 1PAEX 4XO0A 4I68A 1VBZA 3KK3B 3ZZ0A 3A8KA 2E1PA 2N82B 2YKMA 1S99A 6FD1A 4B3OA 1B3TA 2MSTA 3PM9A 3EGVA 3KNGA 4EYHB 3JTPA 2RKIB 3AD8C 3KWMA 2CDRB 2AEMA 4IDKB 2ZKUA 4AYBD 3HP6A 5BYRA 4CLLA 2GVZA 2AJFE 1FJEB 3GONA 2DGXA 1FEEA 4LF7J 4KAIA 1N34F 5KFKA 2I5JB 3MHYA 4OZJA 1RT7B 3EDRB 4RW9B 4RPFA 3HKWA 3UDVA 2L41A 2QJ3A 3M9NB 4AL5A 5KFHA 4U95A 3IBFB 4YN3B 2H5EA 4A8WA 4BLGA 4KFBA 3NAIA 4DSIA 5L38A 4Q0BA 2HVHA 5AE3A 2R7RA 3DRRA 3O8WA 3ICLA 2PSZA 2OO4A 3QGPA 4WE1B 3RG6A 4LFAF 5JJBA 4OJHA 1RHKB 5JVHQ 2YKNB 1H2TZ 1KLMB 3SQGA 4E98A 4LSNA 4PCQA 4RW8A 2B8QA 3TEGA 2RH3A 1N5TA 1SUQA 3C14B 3CDAA 5D8HB 2V67A 4DCJB 2BRKA 1VQNS 4NRUA 3QIDA 3KUGA 3Q8VA 3GCWP 3PW2A 1TV6A 4DSLA 4WXOA 3EGZA 4OI4A 1RQ0A 2ILZA 1AZSA 2SXLA 4DV0J 4NPOA 2BDPA 4NLPA 2VFTA 2C2EA 4DSFA 4QBUA 3K5MA 2X51A 4IR9A 5L46A 3IAM9 2VG6A 2JVOA 3BSCA 3QFWA 1JIHA 2LXIA 4ECSA 4LMZA 1LWEA 2QL5B 4R0EA 3KLIB 4B9UA 1VQ9S 1L3UA 2HFZA 3EM1A 2V2QA 2W7OA 5T41A 4K0KJ 5IS2A 3PYEA 2H1YA 1CVJA 1WTBA 3HT0A 1KKHA 1CJUB 1YWXA 2OEJA 1SJRA 3T3FA 1JKHB 4WJBA 4LJMA 1RTDB 9ATCB 1WI6A 3CMES 4NMLA 4IH6A 3U27A 3O6QA 5KT2A 2P6SA 3H90A 1FJCA 3CCES 2YNIB 3A3PB 3PO4A 1FK9B 3M05A 2DBBA 2CWKA 2Z2MA 4KE5A 1FTRA 2C2KB 3MM9A 1TL3B 1ZPWX 5LMNJ 2AP6A 2EK6A 1YBTA 1TELA 3RBZA 1WJ9A 2XWYA 1FX4A 1V5VA 2YKQA 3GMGA 1D8YA 5L8RC 1RT1B 1YJNS 3FEXB 2IAJB 4FYXB 3FKBA 1S6UA 2BJDA 3DLKB 4NLRA 4H4MA 1SC3B 3HPOA 3BGRA 2E1CA 1MMLA 4NLWA 2KU7A 3W1YC 1N0UA 2QEXS 5J2NB 4OLPA 2NXEA 2XS2A 1NXIA 4ECWA 3T6JA 1GTEA 5KFGA 4USWA 3HJVA 1NBEB 4L72B 2IJNA 5E7OB 4K4UA 1WTFA 4NL5A 3MPWA 2EBEA 4DSJA 2HVIA 1GFWB 4OHWA 2KO1A 2BJ3A 2YWEA 2R8IA 1DTTB 5D4NA 2B43A 4B3TF 5KG7A 3N79A 2PA8D 2CRLA 4C7QA 3HM9A 3DXSX 3G6XA 4EUVA 5LXYA 2E1AA 3NG8A 4LF6F 2KM8C 3JQJA 3PFEA 3ZZOA 1X5PA 1XQIA 4LF2A 1HWKA 1NJWA 2BW7A 1QSSA 4F36A 1XMOJ 1CJVB 3L3CA 3H5UA 1RYSA 1ITPA 3RB0A 4IOAQ 3RJMB 3KK1A 2ZJPQ 1VQMS 4ECZA 3D6FB 2AJQA 4F50A 5A76A 4A46A 4RBTA 3I87A 4QWEA 2GJIA 1QE1A 2MLZA 5GMDA 5ETMA 2RRNA 1X5TA 1UMJA 1TKTA 5DS7A 1T9TA 2MXYA 4UW2A 1I3OB 5HQMA 3KLVA 4NA2A 4PYAA 5DETA 3RU0A 4FNHA 3NS6A 3NBPB 1SKSA 5G0RB 2BOPA 5ETNA 4LRAA 1LV5A 1C0UB 4YDXA 5F8GA 2MQNA 2VICA 1PGZA 4DV2J 1FXDA 1VIXA 1R8AA 1T9YA 2UUAF 3H59A 2PIIA 1RJJA 1FVSA 5A8RA 2LXUA 1JJHA 3TUZC 4ED6A 1H7XA 4JI5F 4N56A 4LF4F 1R0BG 5EUHA 3G87A 2ZBPA 3HSDA 3VVUA 3AH6A 1QUPA 3JSMB 5HP1B 1LXNA 4F26A 4ED2A 3GLJA 1KNZA 1UFWA 2J6TA 2J8AA 4C8NA 5J2QB 4DDFA 2QN6B 2WZ1A 1N56A 1TL1A 3ZO7A 2ZC3A 2OD6A 1AROP 4OYIA 1KDNA 3CD6S 1QAXA 4EYIB 5BR8F 3CJ2A 4WF9Q 2NLWA 2N4DA 4NZ6A 4OFZA 1JQGA 1TZ0A 1UFLA 2OI2A 3Q8UA 4PPZA 1RUSA 2OFHX 2IDEA 3OT9A 4DR3J 4HACA 4NA1A 4WFBQ 1Q86T 3OL9A 4DX6A 4B3SF 3O44A 2WBMA 3Q23A 3GYGA 1S6PA 2H4WB 1OJ4A 3JB9k 2C2MB 3K5NA 4F25A 2J7WA 1JLCA 1ZOTA 5E2QA 4QU7A 1CJKA 1D0EA 3AT1B 4OJGA 3J80Y 2DPIA 2VL1A 2HZCA 4RUBA 1CC8A 2BE2B 1KWMA 2R7QA 4MTPA 2RAQA 1WG5A 1XR7A 2YX4A 1S9FA 4V19X 2CPYA 4DUZF 2HGMA 2HZVA 2RD5C 1UETA 4ZIWA 1S49A 4NYPA 1A7GE 1RT5A 3W2WB 1NK0A 2C3UA 4OI6A 4DPTA 3D1HA 1JLEB 1JLFB 1Q5VA 3CCMS 3K7RA 1M5HA 5ETPA 1VRUA 4LQ9A 3V5RA 1N6QB 1N32J 4ZVUB 1Q79A 2ZD1B 2CPJA 4DF8A 3KJQB 4RR5A 2YWHA 2AV5A 2BVZA 2DXFA 3OVAA 1KQGB 1QM9A 2W1BA 3T1HJ 2GO9A 3GZ7A 2IVYA 1SJQA 2E66A 4QIEA 2D74B 2RQKA 2HRTA 4CI0B 2CVEA 1I51B 4OX6A 3HVWA 1ZM9A 2C3YA 2GJFA 1TMJA 4EWTA 1S97A 1IBKJ 4UF4A 3J81U 3NGDA 2VPYB 3TAMA 1MSWD 2R3VA 1J27A 4LBPA 3HFKA 2CQBA 2FPHX 1K1QA 2ZITA 3GFHA 1F9FA 4AQYJ 2FY1A 4KRWA 2GO8A 2MLYA 1DAXA 1NK6A 2Z2YB 4IOBA 4X62F 4P6QA 2DHAA 1TTHB 2XSJB 3CO9A 4X64J 3BKTA 4NCGB 3V6DB 2QSFA 3K59A 1VJWA 1REVB 4P2XA 4V1Ak 4NA3A 2DT9A 1UEKA 1WOSA 1FKPA 3RB3A 3GPAA 3Q2TC 4B9SA 5DDPC 1BQNB 3C15A 3TRGA 1S76D 2CDQA 1AFIA 4OYAA 4O4RA 4ZLJA 3CJKA 3FJ2A 2U2FA 2FIUA 4I6YA 5C24A 2M70A 3DLLQ 1TKXB 4FXWA 1CG2A 3THPA 4L3KA 2VV5A 4O3NA 1YJVA 1FTCA 1J5EJ 3I4PA 1VRTB 3BR8A 3QGGA 2WBRA 1Q8BA 1PILA 1VOMA 3MFIA 4HKQA 2VC0A 3H5SA 4M5JA 1U24A 2KXFA 2HVEA 5DG7A 2I38A 3KNAA 2CPDA 4LF8J 4ZA1A 5A8WA 3FVYA 2FZGB 5KG6A 5SUHA 2ZZMA 4RU9A 3POTB 4PXDA 3SCIE 5BYQA 3Q8QB 4C6AA 1S9EA 2AIRB 1EHWA 4Y34A 3TUJC 1RK8A 3JS9A 2QA2A 1URNA 5ETTA 3Q89A 1WHVA 4JV2A 4IH7A 1U2RA 1GMVA 2F8HA 3O1LA 3PJWA 3TJ8A 3R5BA 4QR0A 1NSKL 2P2CB 4NLTA 2VJUA 3OFGA 3HMJG 5GMKa 2HFVA 4A8QA 2DH8A 2P9CA 4ZCMA 3LAKA 4DCOB 1ZAXA 1C1CA 1Y00A 4ECVA 4AL7A 3E3XA 4PWWA 4OV1A 4OYWA 4CIOA 5HROA 1WKKA 4USKA 1ICEB 3CCZA 2EXUA 4JI2F 4OYZA 1OYDA 3DKDA 2GIFA 2XGPA 2RDJA 3QPIA 2HQCA 1LW2B 1WC4A 4OZ2A 2VU5A 3R7SB 4CZCA 4U67Q 3QATA 2M2BA 2BJ9A 2VG5B 2R2UA 5ETOA 4EMDA 3I9V9 3D0HE 1SL1A 1NJIT 1T95A 4DXLA 3S6EA 3VWSA 2YQ3A 3V6HA 2RDDA 4DLEA 2ZDOA 1YJ9S 4JI7J 4W92B 3ZZZA 1V6HA 1DLOB 3CCSS 4F4YA 1TL7B 4G6VB 1WHXA 1WC3A 5HLFA 1KFDA 4UTGA 2QA4S 3R5AA 4ERDA 1YJTA 3OL6A 1S4EA 2MZ1A 1WOOA 3EZUA 1HR0F 8ATCB 3DI6B 3KJVB 3MEDB 1NMEB 3FK4A 2E5LF 4E8UA 3I56S 2LEPA 3I0SB 1Q0NA 1KVIA 2KB2A 1S9GA 1S1VB 3RRHA 2X7IA 1PJ5A 3NS7B 2CVIA 3VF0B 1KQKA 1T11A 5I3UB 1RE1B 1SVDA 2DNRA 2WW8A 1T9VA 4ZCKA 3AA8A 5HMZA 4X65F 3MMAA 4HT5A 5HI7A 4LR7A 4G65A 3SZ2A 2QA4G 1FD2A 2BMBA 1ULRA 4Y0FA 3IGNA 2RMLA 2RRBA 4LVOP 2XB2D 5HMWA 3OUYA 3C6UA 1R0AA 3U02A 4M5IA 4DR1J 5THWA 1VQ8S 3PR4A 3M30A 2HQIA 2HHVA 4ZPTR 4J9OA 3MOJB 4ZVTB 3HULA 3CJ8A 5GAHI 2XTJP 2V8PA 3HHLB 1A9NB 1XNQJ 4E2FB 5CYQA 2AGOA 3TANA 4NMXA 2WHOA 3AY0A 2UXDF 2VA2A 3CCVS 3V4IA 4MH8A 5K8NA 5H9EJ 4QR1A 3H5XA 2DNOA 1VLYA 1UFKA 1RWXB 2Y1RI 3TZXA 4ED8A 3B78A 2PGCA 3CMQA 5LSOA 1VQYA 3W62A 2C2RA 3BSAA 4ZP9A 2RHQB 2XSFA 2UVWA 2FDNA 3CNQP 2RIJA 4M1KA 3G4SS 3D9BA 3KHLA 2G4BA 3CC2S 4X4PA 2GFFA 4HHJA 4M8LA 4JI8J 3LWMA 2UVUA 3EVMA 3N01A 3MM8A 3OSPA 3PW4A 2YX7A 4MYTA 2LA6A 3L4BC 1VRQC 1SQFA 5IT0A 5DG8A 5KFFA 5CZXA 2RS2A 1ZETA 1AYEA 1K44A 1Q8KA 2VONA 2P9GA 2W9CA 2V50A 1VBKA 3RYLA 1SV5B 5K8PA 2E5IA 2YNFB 2Q1LA 2CZ4A 2EFPA 3AA9A 2LU2A 2DNPA 1LWXA 4CO5A 5KT5A 2ERRA 1PJ6A 4ZN3A 3G8TA 3HCXA 5KFSA 2A3JA 2EBGA 2BJEA 2IVMA 2H65B 1TL5A 4WP3A 1Q4RA 2DGOA 5D15A 2B4UA 3MTJA 1Q95G 2ZKTA 2V4JA 4I6AA 4PG7A 4RW6B 3SMZA 2VOPA 3KHHA 4KO0B 5H9FK 1QDUB 1VBYA 2ZVSA 5A6PA 4XPEA 3S8SA 4TNOA 2HGLA 5KG3A 3I96A 3H7HB 4KKOA 1XNRJ 3DM2A 4X66J 2H5JB 3AAWB 3MECB 3G8QA 3MR2A 2LMIA 4DR2J 3CUNA 5CCLA 3MCOA 3VAJA 1RHMB 1BLUA 1S6OA 4O44B 4M5NA 4EBDA 1RHRB 1S0OA 2D69A 3FZ2A 5IOLA 4M63A 3RRGA 2G1HA 3QT6A 5CYMB 2VBYA 2IYGA 1UWAA 4W90B 1RHQB 4P2MA 2HWHA 1D3WA 4CTAA 2PMHA 2F8EX 4CLYA 3FNNA 1ZA2B 4DHVA 4I1TA 5HAOA 2YH1A 2YNGA 1W25A 2VQFJ 1JJCB 4TLRA 4DL7A 2MQMA 4DF4A 3SDEB 1S1UA 4Y3CA 3OBIA 1SC6A 1UKUA 4YP3A 5C25A 4DV7F 2XS5A 3T1YF 1RKJA 3PFOA 3A3OB 1QAYA 4DR4F 3CT9A 4LBIA 1OWXA 3N28A 3SYZA 5CQGA 4DV6J 4K4ZA 3TJ9A 1T03B 1H2VZ 3EDQB 4AFFA 2FVPA 3TVKA 1U1QA 3OHBA 1NDCA 3HDSA 1K8AT 1RU1A 2HFSA 2HHSA 1OSDA 1NPRA 4KSEB 3UE2A 2V34A 4KHPJ 2FZKB 4OHYA 2HHHJ 2ZBRA 2GGPA 1SKRA 2OPQB 2W7PA 4LFCF 1CULA 4DG1A 4J9VA 1AA1B 4ID5A 1YIJS 2ZH8A 4DV1J 4F0MA 3QT7A 4MIAA 1RWPB 3LWLA 1UPPA 3D0GE 4DL0C 4WPAA 3ILLA 2KXNB 1S48A 2B6AA 3MCNA 1RDRA 1HMVB 4YFUA 2B7CB 1D1UA 1JLQB 4OZ1A 1NPPA 4O4GB 4ZPWR 2HNDA 2NCKL 3U1NA 2G2OA 3VAFA 4BC9A 1LK5A 3UD3P 2FHMA 2LQ8A 4RWXA 3FMWA 4JI0F 3MWBA 1X9WA 4I2QA 1K0VA 1UJ4A 4E0DA 2B9YA 2HNZB 4Y2AA 3ZNJ1 1S7HA 1U09A 5C42B 3KK3A 2GNKA 3OTCA 4B3MF 2XMMA 3OR1A 3HJFA 3FSYA 2QTWA 4XAKA 2VFVA 4ZPCA 3K5LA 2VBZA 1M1KT 2RKIA 2HYIB 4IDKA 3QIPB 1L5UA 2J7UA 4PZVA 1HNIB 3PJXA 1HBNA 2L48A 2DY9A 2ZHAA 2ZDPA 2APOA 2ASDA 2K3KA 2O3DA 3PX6A 1SB6A 1FE0A 2XY6A 3F44A 2EFGA 2VPXB 4NZ7A 1RT7A 2XYGB 1R6VA 2DNQA 2KXHA 1RBAA 3MR3A 4MIWA 4PUOB 1NKEA 4F7VA 1ROFA 2CKWA 2IBOA 4CO0A 1FE4A 4U6PA 1UVKA 3BGLA 5GMEA 4EK2A 1VLOA 2HPUA 4ES3A 4I6WA 4RNHA 3DLEA 2XY7A 1NU4A 4NX9A 4USUA 1NEEA 1QAJA 1EJ7L 4ICLB 2RB7A 1WG4A 4YY3J 4WE1A 1I94F 2YQ0A 2YKNA 5CYJA 1KLMA 5KFIA 4ZVHA 3CE8A 4ZMMA 1N8RT 3IRXB 3MURP 3M6XA 3C14A 2WVCA 1Y9OA 2KT5A 1Q1KA 4QYRA 1FFSB 4HR2A 4CLFA 2HSEB 2UXCJ 1M0SA 2KVQE 1ELOA 1Q5YA 4YR3A 1DTQB 2I2YA 5L1JA 4HHUA 2YWFA 2Z0GA 2DR6A 3DLJA 4WZMA 1G3OA 4ZLLA 5B0AA 1EARA 3RBEA 3I82A 5GAGI 4L3NA 4J7CA 3KLIA 5DO2A 2H48B 4YB5A 4UY8T 4DEZA 3M8WA 2HS3A 1LQ9A 3Q2SC 1UW4A 4X4VA 3HF5A 1S1WB 2PI4A 4K4VA 1UVNA 1BQMB 4LF5F 3CJ0A 3WZ0A 3NLCA 3JSYA 1F2GA 5HL7Q 3MEKA 1JKHA 4ZPVR 3TZZA 1RTDA 2HK3A 4UQGA 3AJDA 5HBMA 3QLHB 3H20A 1Y11A 1R0CB 4W98A 3EZ5A 1IBMJ 2GV1A 1N5YB 2MJUA 3QO9A 2AU0A 2DRBA 3I4HX 2YNIA 4RNOA 3QAEA 3H40A 1XMQF 9RUBA 3V81B 1FK9A 4GKKF 3HFVA 3GE9A 4RNMA 5ETSA 1P27B 3OR2B 5D3GB 1VJQA 5AT1B 4DPXA 1IWGA 2LEBA 3BDEA 4ED7A 4H4OB 1QVFR 3E01B 1UTAA 2MKCA 1VQ5S 3RAXA 1RT1A 4AD6A 2IAJA 2QGFB 3DGPB 5D6GA 3DLKA 1VC5A 2POKA 4OHVA 3FCVA 2MQPA 4PXEA 2QYCA 1LW0B 3GYXB 2DGVA 4UOCA 3PTWA 2VFUA 1X7VA 5K5MA 3HSJA 4KGVB 3KLHB 5DDOC 1KRPA 5F9LA 3CULA 3DXBA 2JZ5A 2KKHA 2MQQA 2JWNA 3G2XA 3OVBA 1YJWS 4WTOB 4WFYA 3DLBA 3HO1A 1O8BA 3J81Y 1B64A 4FYWB 2FYXA 1RTJA 5C5JA 1PG5B 2B56A 2ZM6F 2CYYA 1R8CA 4B08A 5AXMA 2XNQA 3L95X 5E3CA 1U45A 3M6WA 2DNYA 1KHWA 1LWCB 2YKPA 2HAIA 3KLEB 1CJVA 2IRUA 2MZSA 3JSBA 4JP8A 3MR7A 1WNEA 2IFXA 2YPZA 1PAUB 5L39A 4ZJLA 3W65A 2IMOA 4A4JA 5LMUJ 2E5JA 1F1BB 3MM7B 2HIYA 3TWZA 3MEGB 2MKJA 4UT4A 4LREA 1U6BA 4HHHA 2DGSA 3AB2B 4AXIA 2LQ9A 2G2ZA 1X0FA 1MWQA 1Z2ZA 3MM6B 4G1PA 4TY9A 3VHQA 1YSJA 3M2UB 4DV5F 5HVHA 1NDKA 3PNIA 4ZVQB 4C8ZA 4AXJA 1J5OB 2OTLS 3DLGB 4J9MA 1P8GA 3WDOA 1QTMA 2AGQA 3BQ2A 4DQPA 2WSEC 2NQPA 2UU9F 2FC8A 1ZA1B 7FDRA 5KTQA 1EKRA 3PKMA 1U25A 3NBPA 3LAMA 3E8OA 5B7WA 1ZTWA 4Q44A 3CD7A 2GAHC 4NXMF 3MPDA 2P6TA 3W5YA 1FX2A 5AJ3F 1RBLA 4ZP7A 2F8MA 1S6QB 3M8QB 2EG2A 3MD1A 3IG1A 3SFGA 3LP2B 2VQEJ 5GVQA 4KPYA 2W4DA 4PWDA 4I7FB 2AZ1A 4PG5A 2DH7A 4WP9A 4IR1A 4I64A 3UR3C 3JSMA 1S12A 5HP1A 5LL6d 2JX2A 1YQHA 5B09A 3DDKA 2AEFA 1FRMA 5I3PA 2CUYA 5U47A 4EO6A 3MPVA 5J2QA 1CC7A 1F3FA 5DZ6A 1LFWA 3IN5A 3IM8A 3QT5A 1KBRA 3ILJA 4B9LA 1SH0A 4DCPB 1S10A 3J7YU 1M5SA 3IMQJ 1UW9A 4EBEA 2EPIA 3R7NB 3PCOB 2NZ4A 4ECRA 2XEXA 1U8SA 2XLIA 3Q8PB 1WI8A 1U8WA 2PEBA 2KJVA 5AXNA 4KBIA 1RWKB 3I55S 4DR7J 4JV0A 2KZZA 2BE2A 2G9OA 5EN1A 1YX2A 1DURA 1NK7A 4CT8A 4K50A 3LTOA 1OPZA 2EFVA 2P9EA 1G4CA 1W26A 4USHA 3NWRA 1DZ5A 2B9WA 4U8YA 4KGKA 2OGUA 3CDUA 3W2WA 2GQ2A 2VJVA 3GG0A 1QVGR 3M2VB 4K59A 1EETB 1JNRB 2AX0A 1JLEA 1VR6A 4B9VA 3H25A 3M8PA 2BQUA 3DC2A 3PW7A 2QFIA 2JH3A 2IBKA 4NLGA 4JI4F 5AE1A 3KMQA 2QLBB 3D67A 4AE5A 2V9KA 4U7UD 1N6QA 1TP7A 4JV1A 3GV8B 2PFDA 1RT4B 5A2QU 1B70B 2F40A 2ZD1A 2DNLA 2CG4A 1TUWA 3KUHA 3EVOA 5LT5A 4WFAQ 1YDLA 5IFMA 1AXQA 2QLFB 4NLUA 2DHGA 2OAUA 3C16B 4LRFA 2MGZB 2XC9A 3VTIA 2VBXA 2NPIA 2DO0A 4DFKA 1F5BA 4JI3F 4TVAB 2VPZB 2JEFA 4ZITA 1RXOB 4Y65A 1RT6B 2DNGA 1FDBA 2WSFC 4RW7B 2AW0A 4PAAA 2X3GA 3TAPA 1YHQS 3K2YA 1W2BR 3SV3A 1JLBA 2WONB 4NEYA 1EQMA 2WVBA 1WACA 2MEWA 4CWBA 4G3IA 3IS9B 5FD1A 2KRBA 4PQAA 4K5SA 2JJ4D 4YHHJ 2QT7A 3DOLB 2CQPA 4CM0A 1JB0C 1YJUA 2CPZA 1FXRA 2QLXA 2XSJA 1JLGB 2B4VA 3TJAA 7AT1B 3V6DA 4TXSA 5FLXU 4Z7YA 4IG0B 2BUNA 3AXMA 1EP4B 3P8BB 2FHJD 1BD6A 1JWWA 1ZM3A 5M2RA 2VZ9A 4CCHA 4QIVA 2IJRA 2J6UA 4JI6J 4ECUA 1BQNA 1KVKA 3HVAA 2XM3A 1SBRA 4DL2A 2ZH3A 2RNEA 3AOBA 5IWAJ 2J0SD 2BABA 2R8JA 3HHLC 2BM1A 1KS2A 2Q6CA 3LANA 3ENAA 5GAEI 1N5QA 2RF2A 4KHMA 1GTHA 3CWJA 1LWFB 3KG0A 5DQHA 2VG7B 1VRTA 1REGX 2R7XA 5L1IA 2EK1A 1YITS 2KH9A 2UXBF 3MAHA 2OPSA 2YPYA 4IRDA 3FSXA 4I69A 4R5PB 3G71S 4HTJA 5F41A 4K4YA 1ZTTA 1G1XA 2BKNA 1DJ0A 4URGA 1HNZJ 2FJDB 1K9MT 3KOAA 1RAGB 1K47A 4KH0B 2B5JB 2QMXA 2MZTA 3UCGA 2UUWA 3DMJA 4DQIA 1N54B 4JI1F 1Y10A 5ETQA 1RADB 3J7AN 3IFEA 3GJQB 1SL0A 3ETOA 2R7WA 4EEYA 1HQUB 2FGOA 4MK7A 3UR0A 3QSYB 3DDIA 4IFVB 3EXYA 2DR9A 1FJGJ 1AB8A 3EE3A 4GO5X 1C2PA 5EGYA 1PBAA 2ZH1A 2AF6A 3CJ5A 2MDAA 1BWEA 3HLUA 3JQKA 2OEKA 5LOQA 2W9BB 3G8SA 2L3MA 4DQQA 2GQQA 3HFZB 4C0OC 2OFGX 4IKAA 2R42A 3L09A 2UUCJ 1F5AA 2HQ3A 2ALZA 3KFWX 2IM0A 2XMTA 3UNGC 1VK3A 2IYIA 1NHUA 1C4AA 2ATLA 1I6JA 1WHYA 2DR7A 4Q0BB 1LW2A 4OX9F 5JMNA 4FKYA 1EAYC 1QUVA 2ZUGA 2RQ4A 3HD1A 1UJ5A 3OV7A 4ZS6A 1HNXJ 3FFIB 4XIUA 5G4DA 3SQGB 1RTIA 4U7UK 3BDPA 4JV5F 4RW8B 2F9JA 3SSRA 3C66A 1OY8A 2CPEA 5FDLB 4CLTA 3RAQA 3P6YC 4NOHA 4JUZA 1DLOA 4MKVA 1TL7A 4X4QA 1TV6B 1M5OC 4Q8FA 2AKWB 1NSPA 3GV7B 1BWVA 4OZ3A 3DI6A 1VQKS 1WD6A 3MEDA 2HURA 5I4MA 1T0TV 3GR0A 3I0SA 4DZ6A 3W63A 5J1EB 1X0PA 4LF9J 2J76E 2DITA 1S1VA 3DHWC 5DZ7A 1RT3A 1IQTA 2JRSA 2HLTA 5I3UA 4OZLA 3HI9A 4NRTA 3ZTQA 1OMSA 3ADAC 4C3LA 4J9NA 1VQOS 3LO3A 2BANA 3CD0A 1RYRA 3SCJE 3NKYA 3H5YA 2WB1D 4TY8B 1HWUA 2ZUAA 3ZZYA 3OTOF 3HHLA 2IM3A 4F3OA 3R7BB 4DJBA 3R1HA 3RBDA 3G86A 1VQ7S 4IRKA 2H4YB 3GILA 2HQFA 1HQEA 1FDDA 3CCQS 3LGMA 1NJXA 2CQDA 3ZNUA 1E6VB 1RA7A 2W2OP 1S57A 3QJJA 1R8BA 2DGTA 1TKZB 1QTNB 1FRJA 2QIFA 3KDNA 2MKKA 3EXCX 1RKIA 2IM2A 4GKJJ 1Y4ZB 3SQOP 3WIUA 4WCEQ 1ZM2A 2DHXA 3M7VA 2XULA 2A0FB 1HW9A 2YWGA 1N36F 1KQSR 2DNZA 4M5MA 1RP5A 4PXBA 1FI4A 3VVTA 4CO3A 3GP9A 3UDLA 4CLWA 3PX4A 3D3CJ 3DOKB 3JAMU 4ED4A 1SQGA 4QWDA 1S0VA 5H1SV 1VIOA 2VD3A 1X60A 2MQ8A 4TLQA 1VK8A 2XGQA 4M5GA 5F0WA 5B0FA 5J1NA 5KFCA 1TKDA 4KR0B 4ILMA 4LIWA 3TA2A 3H98A 3IWXA 2FZCB 1HBUB 2B9EA 2FQQB 3D2WA 2BXJA 4LFBF 2KDOA 1FWPA 3RB4A 1VQ6S 4RUCA 4A8SA 3UN3A 1D9FA 1SV5A 4DL5A 2YNFA 4RO0A 3QMQA 2Y8YA 3SFUA 1WEZA 2CQ0A 5KAKA 2NYHA 4FS1A 5ADZA 5EWFA 5LJ5Y 1SXLA 5D4LA 2FB0A 3PEJA 4WKRA 2HQDA 2DNMA 5D0HA 1CSJA 1WSRA 2XMKA 2C1EB 2Y0SD 4WYLA 5B08A 3THTA 4YS2A 4GRSA 2G13A 4RW6A 2WSCC 2OELA 4KO0A 1YRUA 5H9FJ 5EWEA 3VCDA 4CRJA 2YBVA 3JXOA 2AJ4A 5ETKA 3SXLA 3KK1B 4F3QA 1IM6A 1URRA 2ROEA 1T9XA 1IBLJ 2RT3A 1PJ7A 1IR2A 1N4LA 5HQ8A 1VQ4S 1ZAVA 4ZP8A 5T14A 3MOZA 2HG4A 3MECA 1QE1B 1S59A 4ZCIA 1VQSA 1V3RA 2FLOA 3RRKA 3FRYA 4C2MA 2ZFHA 2CADA 2M8DB 4NXNF 2YKAA 1FNOA 1TKTB 2KZMA 1T9WA 2JEIA 4JI6F 2DB1A 3J7YI 2JL9A 1KHVA 5SZTA 3ZXWA 3EWGA 2JFKA 3L7PA 1NDPA 2OLWA 2DH9A 2MY8A 5CYMA 3BSOA 3VZIA 3NP5A 2AJ2A 1U4BA 2DVIA 3D7SB 1VC6A 2UUBJ 1HLWA 4LUBA 3CTRA 4L6V3 4LRCA 1RTHB 3SDEA 1KSPA 1U6FA 2HFUA 1ZZFA 3EUNA 4B9NA 1MMDA 3HX9A 5M2PA 2AD9A 1X4CA 3R1LA 4PABA 2NR0A 2F4VF 1T03A 2QMUB 3J81j 1XMBA 2JEJA 2R7UA 5ETVA 3WX4A 1IKYB 1LEOA 5D0GA 4IFYB 1FRLA 2M88A 4J90A 4M5LA 1K0TA 1YRTA 5HANA 4N8OA 2EW9A 1FA0A 1DHMA 5J2MB 1TL1B 2QX0A 2RRAA 4F4ZA 1IUJA 3T5LA 1CQNA 2Y1JA 3UN2A 1FJGF 1X4GA 3UN5A 1HWLA 1TMMA 3ENWA 3UQSA 1V3SA 4X4TA 3A12A 4ED0A 2O66A 5HJYA 1HMVA 3MGJA 3BQ0A 3CJRA 1JLQA 1VS3A 4NI2B 3F41A 3OLBA 2IM1A 2MYFA 5K9FA 1NPKA 2BV3A 2K7KA 3EYZA 3ISNC 2OSRA 1QJHA 2YWKA 2VPWB 1FHTA 4FF3A 1UJ6A 3OVSA 3W2VB 1BY9A 2HNZA 2V2VA 1S4FA 4WTYA 2KI2A 5C42A 1XN9A 1KN6A 1RT5B 2VUGA 1Q81T 3DGVA 1GX5A 4Y6IA 3WQPA 2L9DA 1AFJA 2JLEA 3A13A 2DGQA 3BV8A 1OQ3A 1ZH5A 1MU2B 2FVSA 1F5CA 3OJSA 3QIPA 5F3TA 4FYDA 2W2NP 1SIZA 4B3RF 4CNZA 1HNIA 4Z37A 5AXKA 2OMOA 2Z2ZA 5E0OA 4KH1B 4WWSA 3BH6B 3IBWA 4ED3A 1KEKA 2KM8B 3HK2A 4ES2A 2R7OA 2C22A 2DHHA 4DPWA 3WIVA 4LRBA 4IO9Q 2H3EB 1JLAB 2DEJA 3VAIA 4PUOA 1WDDA 2OIHA 1HD1A 2JLFA 1OSCA 2IHR1 2R8KA 3KLGB 2RU9A 2ZBQA 3C2PA 2ZJQQ 3DU5A 1WC5A 2Y1IA 3GIRA 1RWWB 3Q8RB 2ZE2B 2C2OB 1HA1A 4C9DA 2EWHA 2B0GA 5FJ4A 2KG0A 4ICLA 1FFWB 3X1LB 4PQUB 4CH1A 1B0VA 4Q2LA 4DV3J 3Q0AA 1RU2A 2Q43A 3G82B 4CLKA 3UO0A 3NWGA 3GQCA 3KHRA 3JTNA 3IRXA 1YI2S 2I9SA 3PVXA 2XQCA 2FD2A 2GVDB 5KFEA 3VGSA 1Y5NB 3BO3A 1U49A 3N6NA 2CFXA 2RQMA 4DUYF 1SJ4P 1V5IB 3AXKA 2IIHA 4YMEA 2CA9A 4RNFA 4GVBB 2BACA 2D3UA 2ZNYA 3T5JA 3K5PA 3N5FA 2C2NA 1WDTA 2E44A 3DU6A 1Z4UA 4C8MA 1UCNA 5C24B 3W3SA 4OYPA 5LSLA 4KQZA 1WELA 2ASYA 5F0UA 3M6UA 3IWLA 4L73A 1YRXA 4GKJF 4NLYA 4OZ5A 1NB7A 3DRYA 4IYQA 4GC7A 1AUDA 3TX8A 1RWNB 1S1XA 2DXDA 2GX8A 2Z8QA 4DR5J 1QSLA 2MLXA 1S1WA 2VKRA 2EKYA 5A8WB 2IC3B 2EI5A 3RUBL 3NMRA 1EKSA 1O5JA 4MK9A 1C1BB 5IT9U 3BKUA 1VMBA 4DV4F 2CG8A 3WC2A 4ELVA 2GA7A 3QLHA 1P6TA 2NYIA 2YTCA 1N5YA 1RT2A 1UA1A 2V2ZA 5T7LB 2HGNA 3RBXA 3V81A 1RAIB 2EG1A 3U1LA 3F0NA 3Q22A 4J9RA 2GAGC 5D3GA 4C11B 1JJ2R 4ELTA 1HYSB 2PDAA 1N33J 3R2CJ 2PE8A 2IJFA 3AD7C 5KFDA 2OD4A 4YB6A 2B9XA 4H4OA 3D6TB 2W4CA 1U7LA 2FJEB 2QLWA 1HNWJ 4WK1A 2XYPB 3DGPA 5HROB 5A2QY 2Z30B 5F8IA 1U0HB 5CXTA 4OI1A 1OO0B 1UZHA 2LVWA 1LW0A 3CXCR 4RL1A 4BCAA 1X9MA 2EFOA 3KLHA 3UD5A 3V4MA 1M1GA 3G96A 1WKJA 1GQEA 1U47A 2XWXA 3O3LA 1U2CA 4DSEA 1T3NA 1RZMA 3S7RA 1APSA 1T02A 2ZZTA 1SL2A 5HN0A 1DARA 1Q7LB 1U02A 2LECA 2R2TA 4KT0C 4XDDA 3FBCA 2AHOB 3HSZA 1N5SA 2WB4A 3CO0P 4LF7F 3FSIA 1R8HA 1WC1A 2QL7B 2CJXB 4HVZA 3W8GA 2YY3A 4KJIA 2J7KA 5HO4A 3TQ1A 2NREA 1WC0A 3DOMB 3U1MA 2CZ9A 1N34J 3CJTA 2OP5A 2N4CA 1LWCA 3NCPA 4OYBA 5FLXY 4DQRA 3KLEA 4ZCLA 3CD5A 1E6YA 2P5VA 1WF2A 2J9DE 2QA1A 3MMJA 2V4RA 2O67A 4NCBA 1JXEA 4IUFA 1K73T 3MM7A 3MEGA 1EB0A 3OJUA 3OXGA 3I5BA 3MM5B 2UVRA 1H0HB 4FBTA 2MHNA 4DMZA 2DRDA 2GMHA 2Z56B 4YOEA 3GJSB 3MM6A 4Y28C 3B4DA 4LFAJ 2HBYB 4QW8A 1D8ZA 3W8PA 3M2UA 3ITHB 4IOCQ 2ZH9A 3C6UB 4H4KC 3KK2B 5LXRA 3LP1B 1J5OA 1XR5A 3DLGA 3SCKE 1LKZA 3D1QA 4I2PB 3HVTB 1IKVB 1MNEA 4DV0F 5C2CA 5E3AA 5IC6B 1B0PA 3ULHA 2J9EA 1FT8A 4P52A 1O6XA 4ZIVA 3RR8A 4JYAJ 3KKFA 3T19A 1FXLA 3D6MB 1NHVA 2RILA 3PRBA 3GCXP 3LP2A 3I32A 1RBOB 5KFQA 2ZH4A 2M3DA 3GIIA 2NS1B 4FZVA 5KOWA 2AYEA 4K0KF 1KP6A 4X4OA 3A1YG 1U1KA 2KHCA 1GXLA 3NGKA 4EI2A 2F63A 2G1DA 3VAGA 2PMZD 2HWTA 5KG2A 3OQ2A 2UP1A 1D09B 1SI9A 1RAHB 5JVGQ 1G2EA 3GV5B 2HBQB 5KT7A 5DQGA 2CQHA 2KFZA 2I0XA 4ETZA 3MUMP 3K8WA 3BO2A 2CPHA 2K7JA 4FBUA 4HL9A 3VALA 3HHEA 3A8IA 4WKYA 3D3BJ 1MW7A 4TU8A 2LA4A 2HLUA 3BREA 1HD0A 4MT1A 3OL8A 4D3GA 5B0DA 1BXNA 5DG9A 4USTA 2L08A 4RBVA 3UWTA 5LMNF 2A10A 4QYZK 3TYTA 1H7WA 1TVRA 4YQWA 2HIQA 2DNHA 3DHXA 2QRRA 1VYAA 2F7VA 3UDCA 2MQOA 4HT7A 2DRAA 2DJWA 1PYSB 1P1LA 3M2VA 5F8MA 3P49B 4X4NA 4F02A 2GHWA 3W64A 3UVJB 2J5AA 3K89A 2RSQA 5J2PB 1N48A 2H54B 4A8KA 2BR0A 2PD1A 2QYGA 4OMFG 5FIIA 2R2RA 1GK8A 2VHGA 1RT4A 3D1OA 3NNCA 4USMA 2CNLB 5CD4A 3B54A 3ZTPA 4TN2A 2BZ2A 3OTDA 4PR6A 2FTRA 3Q8YA 4LF1A 4IQXA 2WK4A 4B3TJ 2MGZA 3I0RB 4EO8A 3D0IE 4LSLB 2HHUA 5C2GA 2W24A 2DKOB 2W2QP 3UNYA 3SEOA 4LF6J 2CNKB 3MF5A 1UVLA 1H74A 2V69A 1XMOF 5DJBA 4CLSA 2AYGA 2QG9B 1FVQA 2CJBA 1CJTB 3HHDA 1RT6A 2NXCA 4RW7A 4FP9A 2XMVA 2VDIA 5KFBA 4OQJA 1U1MA 2CQ2A 3NAHA 4UQTA 5F9NA 2HHPA 2WONA 3O2IA 5B0CA 3IS9A 1S1UB 2CJYB 2COLA 1IKWB 1GMWA 3GFXA 3LALA 3DOLA 3EPIA 4H4KA 4CYUA 2AT1B 4EU0A 1YLXA 1JLGA 1SC4B 3CCJS 2W8KA 1L3SA 4ILLA 5DGAA 4IG0A 4RZRA 2ALYB 1EP4A 4NYOA 5ETRA 5IXUA 3P5BP 2ROGA 1NB2A 4UY85 3M32B 3I6PA 3PY8A 3RGIA 2V8VA 5KT6A 3DRPB 1R31A 2DO4A 2OEMA 3M4XA 4DN9A 4FS2A 3PO5A 2B4PA 5E3RA 4ECTA 4C8LA 4J9PA 1KFSA 3FQKA 5HVFA 2QE5A 2FVRA 2XNRA 2V68A 1MLAA 2XZDB 2YX1A 3JAMY 4DV2F 1IJEB 1BMQB 3D66A 4EGLA 3T9ZA 3BSNA 1PO6A 2BA9A 3CDEA 2BQ3A 1RWMB 2MZQA 3R6GB 1SQEA 1O51A 4L75A 1TUGB 2MSSA 2UUAJ 4NLDA 3LP0B 3PZPA 4ZHRB 4DSKA 3CF5Q 3M1VB 8AT1B 4WU3A 3Q86A 4R5PA 4Q2MA 4URQU 4ZVGA 4JI5J 4LF4J 1LFPA 5CABA 5C7PA 1B4SA 1HI8A 3OSNA 1HBOB 2D3O1 1F9HA 1B7YB 4OIXA 4Z7CA 1IR1A 3NRBA 4R25A 2B5JA 3OR1B 2GIQA 1KOOA 1SPBP 2M9KA 2JHEA 3FBEA 3ZFVA 3THVA 4C98A 3LUYA 2HHXA 1HQUA 4DR3F 5BR8J 4IFVA 3MCMA 1OIAA 4N8NA 1HBNB 3PYFA 3QJLA 2RUSA 1T9UA 2DISA 4B3SJ 3M8RA 3WC0A 3TQEA 3CCTA 3T5HA 3ZTRA 1HFEL 1T8EA 3A3NB 2DCUB 2W9BA 3BN4A 2YNHB 4RLEA 1H73A 3P4UB 1YBAA 3BYPA 3MPUB 2WW4A 3EICA 4FF1A 3FUYA 2OTJS 3EGNA 4KGXB 2X3DA 4A8MP 1RAJA 4DUZJ 4CLZA 4C8KA 2RUGA 4O3OA 2E9TA 4TYBA 3DLEB 2FJVA 3PIOQ 4ID8A 5HMYA 3EPGA 1YGYA 2X1AA 3DLHA 5CHCB 3FFIA 3C3LA 1UVJA 1NH7A 3GTYX 4FXDA 4DI6A 1N32F 1QAIA 1H98A 2HBZB 2BOAA 1IBCB 5A0YB 2PI5A 5FDLA 3R97A 1RABB 3AJ2A 4MYUA 2ASJA 1XBWA 2XO7A 2MJNA 3MAQA 2HVZA 3T1HF 4RW4B 4HLBA 5A8KA 3FCHA 1UWBA 2B4OA 3KJFB 2KTQA 3UCUP 5B0EA 3ELHA 3QBCA 2HHQA 4JYAF 4QOTA 1HL6A 3M2RB 3CCRS 3A4TA 1CLFA 5LM7E 1X4AA 1OY9A 3HZGA 1IBKF 5J1EA 2CQ4A 2JSXA 1TK0A 1FERA 2MTLA 3ETMA 4AQYF 1FWKA 3WBZA 1CPZA 3NCQA 3GJTB 5DGBA 3PIPQ 5KG0A 2AX1A 5F3ZA 4PG6A 4X64F 3MI7X 4X62J 4I4BA 1WSVA 5KFUA 4O3QA 2GHVC 3N6LA 4HDHA 2XO6A 2Z2LA 2ZWPA 4QIFA 2CZVC 5M2UA 2F4FA 1KC8T 4TY8A 1YG0A 4N47A 4DN0A 2L9NA 3WX8A 3BBFA 2JC0A 2CQGA 3MEEB 5HBMB 4YR2A 1HWIA 2HNYB 2XZWA 3JYTB 4Y00A 2BM0A 3CEDA 3QO9B 2BJ8A 2J0XA 1GH8A 1E6VA 1P9YA 3LW5C 3VGUA 1I5OB 2LLZA 2N7YA 1FCAA 1J5EF 1Z2LA 1TKZA 1NLKL 2U1AA 2ZH5A 4F4XA 4L74A 3FGVA 3B82A 3TUPA 4DPYA 4LF8F 5DM6Q 1MROB 4R8UB 3NMAA 4DLGA 3V2UC 1HQ2A 4O3RA 4IG3B 5KFRA 4WXWA 2AYMA 3VV2B 3DOKA 3QRPA 3QT8A 1HPZB 2DPJA 4NLOA 3LGHA 3SBMA 2WOMB 1QY7A 3NY0A 3R5CA 4ZLPA 2DR8A 2IVFB 1HBUA 3CJ4A 4DFPA 2FJXA 5GAHU 1HHSA 3I31A 4PKDB 1FRIA 4O0IA 2CJQA 1FESA 1I1GA 4U9RA 4J9UE 4YUDA 2CJ9A 3ET6A 4C48A 5KFNA 1RTJB 2IY5B 2OSQA 3BN7A 2G0JA 3N5BA 5D0EA 2V94A 1OY6A 2CQIA 4K4SA 4ZOSA 4KPCA 3LH2S 3NGRA 3MFHA 3EZOA 4JI2J 5ETLA 4OI0A 4P2SA 1ACMB 1FO1A 4XK8C 3BKFA 3RAMA 1Q8IA 2FJBB 2P8IA 2E7WA 3PJ9A 1F6TA 2FLLA 3LOUA 2Q79A 2UV8G 3QWUA 3KG4A 1NUEA 3MCSA 1NKBA 2EFNA 2BQRA 2W7AA 3QWPA 2HEKA 2ZBCA 1LXJA 4N41A 2HRYA 3E2EA 3W5ZA 1CS4B 4JI7F 1W7WA 2EEYA 4ENOA 3HHNB 2Y0BB 2IA6A 4ZP6A 4TU7A 4ATNA 2Z4PA 2I5JA 4DBQA 3FEYB 2IPOB 4RW9A 1WHWA 4ES1A 1U1RA 1KVJA 3TNVA 3LA0A 3TZYA 4K7QA 4GC6A 1S1TB 4Z2XA 1Y5IB 4C8YA 3R6LB 2Y1LB 1SC1B 1H2UX 1KOHA 2JEGA 5IT9Y 1HR0J 4JBCA 1WEYA 3DRSB 1VI7A 1RTHA 1B99A 1IJFB 2JFDA 2MQLA 2E5LJ 3TZWA 4RJVA 5IM0B 3V6KA 1M1HA 3IG1B 2ZOGA 4TKTA 5DDQC 2F1FA 1S0MA 1HW8A 2E1MC 1UVIA 3IXQA 5DQIA 4CP5A 2DK2A 3OTEA 4PWDB 3W66A 2HRUA 4X65J 5KFPA 1IKYA 4P74A 3N0VA 4IFYA 2FGCA 4U96A 4DR1F 3AOCA 4HI2A 3TR5A 2B8PA 3J7ZT 2VDHA 1L3TA 2CPXA 3K0JA 5J2MA 1A0OB 1XNQF 1RACB 5JXSA 4B02A 2Y3YA 3BM7A 1IN0A 4ZN1A 1U1PA 1UZDA 4TYAA 3CCWA 4MFBB 1DFDA 1OS5A 4QIGA 3H2UB 2F3JA 2LQBA 4ZVRB 1FKOB 4Y2KA 3H0PA 2UXDJ 4DL3A 3PACA 1R8PA 1UP1A 4CDIA 5KFWA 2PO4A 4NI2A 2QZ8A 3IP0A 3C46A 5F8LA 2WRMA 5D78A 2JDJA 3QJPA 1HHTP 1KR4A 2XMUA 1RHUB 4M5DB 5KFAA 2UV8A 3SIPB 3CJQA 4RU2A 3ZC4A 3W2VA 2BKPA 4USJC 1DBDA 3IC1A 4JI8F 3PRDA 3BBCA 4QPXA 2G0IA 1CJUA 4OI2A 2A2CA 1GT8A 4ALZA 1PCAA 2XLKA 1PC4A 4F2RA 3PR5B 3M8PB 3IR6B 5E41A 4DOZA 3FMBA 3TARA 1MU2A 3VQTA 2HWIA 1X31C 1T05B 1RI7A 3TOQA 2HS0A 3H2VE 3F73A 3JQMA 3IO1A 4F4WA 4IO1A 1HIYA 4ZPBA 4U8VA 3CC4S 1PC5A 4OYXA 2ZZNA 5L9NA 5K8OA 2HVDA 4EZ9A 3W7BA 4X4RA 1Q53A 1RSCA 5KFYA 1SKWA 4QU6A 1IM4A 2VKZG 5CCMA 5J1PA 1TL3A 1LOUA 1JLAA 5MAOA 2ACMA 3BF4A 3TVYA 2DD8S 4OZ0A 3CW2C 2BKOA 3BBBA 4YR0A 1R43A 4ED5A 3KLGA 1N52B 2DTJA 1VDHA 1KQFB 1H38A 4DL4A 4N7TA 5J2NA 2ZE2A 3PX0A 4FN5A 2YQ1A 1JLBB 2QL9B 4PQUA 4JOUA 1XNRF 4X66F 3G82A 4P7TA 2LFVA 4WFZA 3BGOP 4YB1P 2W25A 3CDWA 4DR2F 2A1BA 2A6OA 2MKHA 1NAQA 5IQQA 2GVDA 3CVKA 2H5IB 2WTFA 1DTTA 4J9QA 3GU0A 4DFJA 4FNIA 4J91A 4GVBA 4UOHA 1M5VC 1FKAF 2W4PA 3KLFB 2JLGA 2L9WA 4C8OA 2DY1A 3G6YA 1KLNA 2X1FA 1KTVA 1U48A 2XI3A 5KT4A 4RWWA 3UDEA 4DWIA 2DGWA 2R8HA 2HQGA 4ANEA 4YB7A 5HATA 3MR6A 1PBUA 4IRCA 2J8SA 1EZZB 2ZH7A 2R9LA 4WYWA 4EBCA 3CDBA 2I6WA 3VQSA 1L3KA 2RF2B 2LDYA 3U7JA 2VQFF 4W4MA 2Z57B 4UUWA 4OYOA 3FZBA 4FPIA 2J9CA 3PEHA 4EFAC 4DS5A 2OPSB 3VGVA 2FY8A 4DV7J 3GYNA 3AD9C 3T1YJ 4DV6F 4DR4J 2OPPB 2QMWA 2IC3A 3TA1A 1TK5A 2M52A 1C1BA 3IRWP 1XERA 3K17A 5IZHA 2R7SA 3M9OB 4KHPF 1RAEB 2HHHF 1V9OA 1RA6A 4XTTA 4WU2A 4BC7A 4NWBA 3H8YA 1SJ1A 3UFCX 4GVLA 3DMJB 4DV1F 4D3HA 4G1QB 5CAAA 2GQCA 4LFCJ 3SV4A 2BBEA 3MXHP 5G0RA 5T7LA 2RJZA 3M8ZA 4NASA 1C0UA 1U2FA 1Q8LA 3TA0A 4C3MA 1ZZNA 1Y7PA 4DS4A 1U0SA 4FF2A 3LPEA 3MPYA 4ECQA 4I0WA 4C11A 1H6KX 5K8MA 1HYSA 2O1PA 1YZ6A 1XEZA 5GAGU 2YXLA 1U6ZA 3B8HA 3EVWA 1WG1A 3OFHA 4JI0J 5I42B 5E5NA 4QPTA 1U0HA 3BGFA 2V4QA 3LPYA 2LP4A 2VBWA 1QSYA 2HMIB 4FVCA 4S0MA 2IA0A 2RQCA 4B3MJ 4CT9A 2AQ4A 1HNVB 4OHZA 4MMOA 3C8YA 4CQ1A 3GJRB 1NZ8A 2XLJA 5LSRA 2VA3A 3ISZA 3IM9A 3RZAA 1RTIB 1IKXB 1HWJA 2B7BB 5DRKA 2KL8A 1JMTA 4ETXA 1BQXA 2ROPA 1KONA 3MAAB 4ZLNA 1N5VA 2G0CA 1HBMB 2C42A 1NK8A 3P5TL 3MMCB 3DOMA 4MK8A 3MDFA 4FF4A 3IAS9 2D3ZA 2GW8A 2ZH2A 4OYMA 4FYYB 1MN7A 4KV8B 2ZBIA 2V2KA 4X2BA 4V19J 3DYAB 5IV4A 3QZ8A 5DLGA 3HKZD 4OLOA 2LU1A 4A8XA 1EIYB 3H4DA 4L76A 3PG9A 4DPUA 4JB8B 1JLFA 1RT3B 3MM5A 1G6BA 3GFZA 3CJSA 4YY3F 1C0TB 1ZAWA 2F65A 4DU8A 3OLAA 1VCTA 1I94J 1BE4A 2FJWA 3TAQA 3ITHA 2R4FA 1C4CA 2BANB 3Q24A 2BE7D 3KK2A 5KG5A 1SIWB 3FRZA 3LP1A 2ZHOA 3OXLA 2EFQA 2K1RB 2RHSB 4ITSA 2NXUA 1O0PA 4M5KA 3G6VA 4UOFA 4I2PA 3HVTA 1IKVA 4X84A 3MMBB 2UXCF 5IT4A 4A8FA 4EZ6A 3UPFA 4QIWD 4ELUA 1HQEB 3NGSA 1CQMA 1ZS6A 4NLSA 2ZHBA 4KTQA 1SJ3P 1TAQA 2EC0A 1RWOB 4OZNA 3C6TB 3EX7B 3W60A 8RUCA 2CNOB 2DIUA 2OPRB 1AUSL 4K4WA 4QWBA 2IRYA 4A8YA 2XY5A 2NSBA 4NCGA 2OMLA 4AUKA 1KTQA 1REVA 5GADU 4XDCA 1NK4A 3BQ1A 4LF5J 1S0NA 2HK2A 4YEAA 4QQBA 3KMSA 4QWAA 2WVEA 5KG1A 3GIMA 2PEHA 1PIEA 5E33A 1IBMF 3IR7B 2PA3A 4K4TA 1KD1T 4MAKA 1LNQA 4ZPDA 5E3PA 4AL6A 3OD2A 4NCAA 3PW5A 5EWGA 1TKXA 1TL4A 1JXLA 1M5PC 3TX0A 1XMQJ 4ZVEA 4GKKJ 3M6VA 1XK8A 4Q45A 2FJAB 3MTKA 2K06A 1U1LA 2J0QD 1FD8A 2DEIA 3OW2R 1FFGB 1JXVA 2V6AA 4FKXA 2Q3PA 1EQ0A 4QYZJ 1SJFA 2D7SA 2CAJA 5K14B 4ZJOA 4BWJA 1B0TA 4DL6A 1NKCA 1M5KC 1MMNA 4QJVA 3NOGA 3POTA 1NCLA 2WAQD 4LIRA 1IWAA 5K20B 2J6SA 3UVJA 2XCAA 2YKMB 5J2PA 4B3OB 2GMLA 5F8NA 2KT3A 4LVNP 1FJ7A 2ZC4A 3AB4B 2K2PA 2V8HA 2DHSA 4O3SA 4F4KA 1SCJB 3N6MA 3NCRA 2GVZB 2XZTB 1JK9B 1OPIA 3BYRA 3R5JB 2H9ZA 5F8JA 3H2LA 2KRRA 2CQ1A 2DYAA 3BS9A 3I0RA 4ANDA 2ZM6J 4B9MA 3AFGA 4LSLA 4RNNA 5AXLA 4ZPAA 2ZNZA 1RAOA 3HHLD 5RUBA 2HAFA 1YTYA 4I67A 2MZRA 4KHRA 3KDOA 4ED1A 4MKBA 1CJTA 5HJXA
chains in the Genus database with same CATH topology
3BPSP 2W2PP 2ZWOA 3A3OB 3H42A 3P5BP 3WHIA 2W2OP 1SCJB 3CO0P 2ZWPA 2XTJP 3QFHA 3GCWP 2Z30B 1SPBP 1ITPA 2Z57B 2W2NP 4NE9C 4OV6A 2W2QP 3CNQP 2Z2YB 3WIVA 2PMWA 2W2MP 3VV2B 3A3PB 3VHQA 4NMXA 3T41A 3GCXP 4K8RA 2QTWA 3BGOP 2E1PA 2Z58B 2Z2ZA 4YN3B 1V5IB 4JP8A 1R6VA 3SQOP 3A3NB 3WIUA 2Z56B 3AFGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BPS P;  2W2P P;  2ZWO A;  3A3O B;  3H42 A;  3P5B P;  3WHI A;  2W2O P;  1SCJ B;  3CO0 P;  2ZWP A;  2XTJ P;  3QFH A;  3GCW P;  2Z30 B;  1SPB P;  1ITP A;  2Z57 B;  2W2N P;  4NE9 C;  4OV6 A;  2W2Q P;  3CNQ P;  2Z2Y B;  3WIV A;  2PMW A;  2W2M P;  3VV2 B;  3A3P B;  3VHQ A;  4NMX A;  3T41 A;  3GCX P;  4K8R A;  2QTW A;  3BGO P;  2E1P A;  2Z58 B;  2Z2Z A;  4YN3 B;  1V5I B;  4JP8 A;  1R6V A;  3SQO P;  3A3N B;  3WIU A;  2Z56 B;  3AFG A; 
#chains in the Genus database with same CATH topology
 2LXF A;  4PG8 A;  4J5O A;  5LMU F;  5BYS A;  4KFB B;  2X1B A;  3K57 A;  3CSK A;  3VAM A;  1HAR A;  4DR6 J;  1IKW A;  1U1O A;  3R2D J;  3DRR B;  3BGU A;  2VG5 A;  5CD4 H;  3X3U A;  1F60 B;  2EC2 A;  2GJ2 A;  1GAO A;  4H54 A;  1FDA A;  3DRX A;  2RVJ A;  3R9L A;  4LSN B;  3HHK A;  1RCX B;  2R2S A;  4LSZ B;  2GZO A;  1NH8 A;  3NNA A;  2DNN A;  1TU0 B;  1SUQ B;  4UZB A;  4DV5 J;  3M32 A;  4LRD A;  3JTO A;  3DRP A;  3RW6 A;  3NXZ A;  2D1C A;  3PYG A;  3RR7 A;  3EMT A;  3FBF A;  5HK4 A;  2UU9 J;  3FBB A;  4ZK7 M;  1AZS B;  5A6W A;  2AJ0 A;  3KJV A;  4M94 A;  2JC1 A;  4NXM J;  4CM2 A;  2VG6 B;  2DCL A;  2LQJ A;  3MUV P;  3S01 A;  2GMJ A;  5AJ3 J;  1X8D A;  1G7C B;  2VQE F;  4URS A;  4CNY A;  1LWE B;  2MB0 B;  3QRQ A;  1CEZ A;  1MN9 A;  1TAU A;  4CO2 A;  3LP0 A;  1RLC L;  4USI A;  1D9D A;  4ZHR A;  4N76 A;  3M1V A;  4DX7 A;  1S79 A;  3FEZ A;  3MR5 A;  5EHH A;  4Q7A A;  4RBU A;  1HBO A;  2B3T B;  5B0G A;  3L7U A;  3PRV A;  4ZVO B;  3AJ1 A;  2D41 A;  3ILI A;  1WUU A;  2N3L A;  1YK9 A;  2DGU A;  2E29 A;  3GB0 A;  2XMJ A;  2C3O A;  3PW0 A;  4CLU A;  2IRX A;  1HKA A;  4QCL A;  7FD1 A;  4K4X A;  4RKU C;  2HHW A;  5D0R A;  1YJ7 A;  3CC7 S;  1S5Z A;  4LR8 A;  2HZA A;  2LCW A;  4HYK A;  1BUX A;  2LYV A;  4N77 A;  2BJ1 A;  2A6M A;  3GG1 A;  2IMW P;  2M5Y A;  4DR7 F;  5GAE U;  2E5H A;  2R7T A;  1DY3 A;  3MM9 B;  4UUX A;  4F8R A;  2IDL A;  2YNH A;  1J2V A;  2HS4 A;  4TQS A;  2BX6 A;  1Y0H A;  4ZJQ A;  2AJ1 A;  2KT2 A;  2XG8 A;  2CWX A;  5D77 A;  4H4M B;  1R3N A;  3KYL A;  3BGR B;  1U1N A;  4F04 B;  2ATC B;  1DQA A;  4LT6 A;  3EJM A;  2X1G A;  2W2M P;  3L7O A;  1RAA B;  4P73 A;  4HH1 A;  1OYE A;  2QSW A;  1PYO B;  4A48 A;  4JI4 J;  1DQ9 A;  1NRK A;  1VIS A;  5BJR A;  1XC9 A;  3AQO A;  3BJY A;  3GSI A;  2KFN A;  5BXI A;  5A0Y A;  2HFN A;  4J9K A;  1ZM4 A;  1WOP A;  4WZQ A;  3A8E A;  3ONQ A;  1NK9 A;  2ACY A;  4RW4 A;  1VBX A;  1HI1 A;  2NSC A;  2I8E A;  1Q7Y T;  2BJ7 A;  2QFJ A;  2D3O R;  3R5D A;  3HXM A;  2BE9 B;  3D68 A;  1TQL A;  3M8Y A;  3A8J A;  2CXE A;  2A18 A;  3QRR A;  2CQC A;  2GC8 A;  4F3M A;  3AOA A;  3M2R A;  4M95 A;  2G2Y A;  4JI3 J;  4C3K A;  1X4F A;  2QLJ B;  1ZYQ A;  3CJ3 A;  1AT1 B;  4HTI A;  2PN6 A;  4NZ0 A;  4YHH F;  1QD1 A;  3IWN C;  4F2S A;  3CIZ A;  1S1X B;  1VHI A;  4BWM A;  5HVG A;  2FLP A;  4K8R A;  2CIM A;  3FQL A;  1FRK A;  3CCL S;  4Q43 A;  4BHQ A;  1WF0 A;  3N9U C;  1UPM B;  2ABY A;  4ECX A;  2R8G A;  3QFH A;  2ZEJ A;  4DQS A;  2AWZ A;  4O44 A;  3QAU A;  5L1L A;  3GFY A;  4WP8 A;  3CMA S;  3MEE A;  4DPO A;  4DZD A;  3SI8 A;  2HNY A;  3JYT A;  5IWA F;  4ZKA A;  3OFE A;  1FRX A;  5B0B A;  1RT2 B;  4PXC A;  4OX8 A;  3D28 A;  3TVZ A;  4QWC A;  1WWH A;  1UVM A;  4LBH A;  3IGV A;  2JOQ A;  3H42 A;  5LJ3 Y;  4F4A A;  4BS2 A;  5KFJ A;  2BEF A;  5A8R B;  2HHT A;  1NJZ A;  5I3Q A;  3GWC A;  2OH2 A;  2K8G A;  1MRO A;  3GSD A;  4R8U A;  2UXB J;  2HBR B;  2OKQ A;  2ZWO A;  4IG3 A;  2CPI A;  1FWL A;  4ZVP B;  1RWV B;  1HPZ A;  1HNZ F;  1S72 S;  5EDW A;  4ZVS B;  1R7I A;  4NLX A;  2WOM A;  1RIS A;  2EVZ A;  1T3O A;  1Q82 T;  1P9Q C;  2CQ3 A;  1JNZ B;  2OPQ A;  2M7S A;  4Y2I A;  3NGU A;  2E9R X;  3PDN A;  3MUT P;  4F67 A;  4PWU A;  4JI1 J;  2OHD A;  1NK5 A;  4P2F A;  3R8Y A;  1MWZ A;  3O5T B;  3BZQ A;  4M5H A;  3ZZU A;  4HAC B;  3H4B A;  2KFY A;  3QGH A;  3NEK A;  2D9O A;  4HI1 A;  4B17 A;  3GIJ A;  4PEO A;  1S6P B;  4O4G A;  3EGW B;  2KYZ A;  1RHJ B;  3DFE A;  4CH0 S;  2UUT A;  1JLC B;  1MG7 A;  2GCF A;  1CJK B;  4A8O A;  3T9N A;  5EX3 A;  4KY3 A;  4J37 A;  2VOO A;  4QR2 A;  3CPW R;  2UUC F;  6AT1 B;  4FDF A;  3KXD A;  3Q8S B;  1E6Y B;  1BHN A;  5IV3 A;  2XBP A;  2V8D A;  2C3M A;  4GO7 X;  4DR6 F;  2KHD A;  2XHW A;  4K5R A;  1PYT A;  1K1S A;  1UEU A;  4Y2C A;  2Q66 A;  1NZA A;  4AT1 B;  1UA0 A;  4OX9 J;  1FEH A;  1HNX F;  2NUU G;  3BPS P;  5KFO A;  2NXJ A;  5GAD I;  2WCX A;  3R5G A;  5KFM A;  4R0J A;  2J9D A;  3I9Z A;  4NEZ A;  2MKS A;  3M8S A;  4UOG A;  1D9A A;  2KG1 A;  1UAW A;  3T5K A;  1UL3 A;  3IBC B;  1RAF B;  1VRU B;  1GEH A;  1Y5L B;  5HMX A;  4JV5 J;  1CS4 A;  1X4H A;  4P9S A;  3KG1 A;  1PSD A;  4U7C A;  2H51 B;  5HSP A;  3F56 A;  3RB6 A;  2Y9H A;  2GS8 A;  3PXG a;  3HT3 A;  2R7V A;  3FDS A;  1M90 T;  5KFZ A;  1S1T A;  3D4J A;  1NO8 A;  3CIM A;  3OHA A;  1UEV A;  3DRS A;  4LF9 F;  3TO8 A;  2KVI A;  1JX4 A;  2E7X A;  5IM0 A;  1BGX T;  1Q16 B;  4USV A;  3TAM B;  5CZV A;  3KTQ A;  1SKU B;  3ISN D;  3W61 A;  2RDI A;  3FCW A;  1S7I A;  2E9Z A;  3MD3 A;  3D54 A;  2CJK A;  1FNX H;  2JNJ A;  5ITH A;  4P10 A;  2C2Z B;  2FLN A;  3W9H A;  1NDL A;  3NNH A;  1F0X A;  2ZOM A;  4C97 A;  1GXU A;  2QO3 A;  2DIV A;  3V6J A;  4I56 A;  1FKP B;  2E1R A;  5IC4 B;  2AMC B;  1B7F A;  3K5O A;  3OTO J;  4WK3 A;  3HZE A;  3K58 A;  3C15 B;  1WF1 A;  4MFB A;  3IR5 B;  4F0H A;  1Q78 A;  2FHO B;  2O01 C;  1S77 D;  1DTQ A;  2M0G B;  2AYB A;  2XCP A;  2AZ3 A;  1FKO A;  3CJK B;  3SCL E;  5CH7 B;  3UW1 A;  3RW7 A;  3W5X A;  3I5A A;  3UI3 A;  3VZH A;  3KHG A;  5KFT A;  3J7A 1;  2CJA A;  1RTZ A;  2FHK A;  4M5D A;  4NYZ A;  3CCU S;  2W2P P;  3AOD A;  3S1T A;  4ZVF A;  3BH7 B;  1TVR B;  2C3P A;  1N36 J;  4QW9 A;  1BQM A;  4O23 A;  2ADB A;  4XPC A;  1SH2 A;  3N4W A;  3HD2 A;  4ILR A;  1X5O A;  3PYD A;  1NSA A;  1WOR A;  2NUH A;  1S9E B;  4K2X A;  2CNN B;  3B4M A;  2W01 A;  1QLN A;  3QNW B;  3GIK A;  2ZH6 A;  4FVM A;  4MIB A;  3G9C A;  1AW0 A;  1RGV A;  3T41 A;  1T05 A;  2V8G A;  3BEG B;  1H3D A;  1IR0 A;  3LF0 A;  4P71 A;  3LGN A;  2KYX A;  4LQ3 A;  1P1T A;  2MKI A;  4P7V A;  4LFB J;  2VC1 A;  3CB4 A;  1L3V A;  4IH5 A;  1A6L A;  1X4B A;  2MKY A;  2VH7 A;  4OHX A;  3OR2 A;  4DFM A;  2F9D A;  4KGZ B;  5KG4 A;  3OFF A;  3AQP A;  3T6B A;  3BPD A;  3R27 A;  3E01 A;  1C1C B;  1OQ6 A;  4CH7 A;  3NL0 A;  3LQV A;  1YVF A;  1WEX A;  1N88 A;  4RUH A;  3R3T A;  4O3P A;  3MZI A;  2DNK A;  2BW2 A;  3TUI C;  2LKZ A;  1MWY A;  4FXV A;  3FC9 A;  3HSG A;  3VAH A;  1YJR A;  3NGT A;  2LDI A;  4TQR A;  1IBL F;  1FRH A;  4PG4 A;  2M4M A;  3J80 U;  2V0N A;  4N5S A;  3QYY A;  3VGT A;  1DRZ A;  2QC3 A;  2HKE A;  4CYU B;  1ZPV A;  4NLQ A;  4TU9 A;  2A2D A;  4J9L A;  3D6H B;  1RB0 A;  1TUV A;  3L9Z A;  5CA5 A;  2VAS A;  4IQM A;  1DQ8 A;  1FDN A;  1X9S A;  2N3O A;  2VFR A;  2VIH A;  1U26 A;  4YDD B;  4KIA A;  5IQ6 A;  1HHQ A;  2PMW A;  4NXN J;  3KLF A;  2KN4 A;  3ZTO A;  1WC6 A;  1XJW B;  1R27 B;  5HLF B;  2XMW A;  2BYC A;  3RTV A;  2WVF A;  1GNK A;  2UUB F;  3QZ7 A;  1TFY A;  1VHF A;  4OI3 A;  3W9I A;  1XWL A;  4ZDN A;  5HQL A;  2PT0 A;  3Q83 A;  1S9G B;  4P75 A;  1YBU A;  3NOC A;  3P3D A;  5KFV A;  1X4E A;  4PRF A;  2V9W A;  4B9T A;  1BC6 A;  4X4S A;  1XTZ A;  4CO1 A;  3MMA B;  2OPP A;  4OL8 A;  2GIR A;  2F4V J;  4KGM A;  3DN9 A;  4DUT A;  5DLF A;  3OUY B;  1R0A B;  2UZA A;  3AHP A;  2ZVI A;  3PKY A;  3TI0 A;  3JSR A;  1YKW A;  2FUG 9;  3M30 B;  5D4O A;  3B6B A;  2W9A A;  2F5G A;  2ZOF A;  4C4W A;  3TEH B;  1XR6 A;  5KFX A;  4Q5V A;  2EKN A;  4G1Q A;  2NXN A;  5CYQ B;  3HVR A;  4HDG A;  1R89 A;  3G6E S;  1Y3J A;  3KUE A;  4HEA 9;  1EX8 A;  3V4I B;  2Q6B A;  5H9E K;  1VC0 A;  2XS7 A;  4ECY A;  1V3Z A;  2XI2 A;  2KJW A;  3TW0 A;  1IQZ A;  1S6Q A;  4DX8 H;  3M8Q A;  2XHC A;  4KC5 A;  4J9S A;  3P96 A;  2M8H A;  2D9P A;  4C0H A;  5AE2 A;  2OJ3 A;  4I7F A;  2V63 A;  3ZZP A;  1NND A;  2XYH B;  3I5C A;  6FDR A;  2FHJ A;  5I42 A;  4BDP A;  4WII A;  2W8L A;  1FF2 A;  2LQ5 A;  2Z58 B;  3TP2 A;  4OJ3 A;  2RE1 A;  1TR0 A;  4Q8E A;  3CGI A;  2GHP A;  2FC9 A;  4WBF A;  2HMI A;  3K8V A;  2WVD A;  2VB6 A;  1Y3K A;  3MM8 B;  4GMK A;  1HNV A;  2VOD A;  2HFO A;  1T7P A;  4MKA A;  3QSI A;  1WKL A;  4K2J A;  4ANC A;  4NE9 C;  3OL7 A;  1RWU A;  3M9M B;  1GMW D;  5KFL A;  1IKX A;  3IA0 A;  4X4U A;  1GMU A;  5E3Q A;  4B3R J;  2PC6 A;  3ZZR A;  2W9C B;  2HW3 A;  2NPF A;  3BR9 A;  3OTB A;  3ZTS A;  1F9E B;  4QZV B;  1RLD A;  3MAA A;  3DCA A;  1TK8 A;  4PYD A;  1HBM A;  5D4P A;  3OXF A;  2YKO A;  1XIQ A;  3MMC A;  5A8K B;  1UWB B;  4WIQ A;  4DX5 A;  2B51 A;  3BB5 A;  4KV8 A;  4G1I A;  2C28 A;  4RUA A;  3DYA A;  1X5S A;  4WFX A;  1Z1Z A;  1IXK A;  1CBK A;  1LK7 A;  4MJK A;  3DDN A;  2QV6 A;  1R6Y A;  2V4J B;  1PKU A;  2DR5 A;  1X4D A;  2BRL A;  2FVC A;  1EET A;  4ER8 A;  2N7C A;  2OUG A;  2ZJR Q;  3ENQ A;  3NS5 A;  2LEA A;  2RU3 A;  4DV3 F;  1C0T A;  5EX0 A;  2K3I A;  1N0V C;  3PV8 A;  2YH0 A;  4KYZ A;  1NM2 A;  3ILO A;  3ENV A;  4WFN Q;  4KKO B;  3DM2 B;  1T94 A;  3BO4 A;  1RCO B;  4LR9 A;  1HI0 P;  4OJ1 A;  2ADC A;  2YWW A;  2JVR A;  3PHE A;  1GX6 A;  4UZC A;  4CLP A;  3SSS A;  2K1R A;  3P45 B;  2AGP A;  3DNC A;  4HH0 A;  3W9J A;  1JJ4 A;  3QGI A;  2C2D A;  4DUY J;  4CO4 A;  3C16 A;  4A47 A;  3MMB A;  1GXT A;  2DXE A;  3ZZT A;  3UD4 P;  1F3V A;  2E5G A;  1H72 C;  1ZBT A;  2XMA A;  3E51 A;  1YZ7 A;  1VQP S;  4OX7 A;  1IVZ A;  2ILY A;  3J7Z 5;  3UCZ P;  2CPF A;  5DDR C;  4CTA B;  1FNM A;  1F2H A;  4Y2M A;  4P72 A;  4FYV B;  1NSQ A;  3C6T A;  5L9X A;  2RS8 A;  2YNG B;  3US5 A;  3VAK A;  3QQC D;  4DR5 F;  2OPR A;  5MLC V;  5C25 B;  4MKY A;  5JUM A;  4FPR A;  3VR1 A;  4BBY A;  1NJY A;  2MZJ A;  2VFS A;  3GR1 A;  3OPK A;  5KT3 A;  4KB7 A;  2UVV A;  2V5H G;  2E7V A;  4NLV A;  1TFW A;  1VGY A;  4OV6 A;  4DV4 J;  2GGP B;  2AEJ A;  3T1A A;  1CUL B;  4RX6 A;  5DM7 Q;  4DG1 B;  2O5D A;  2MMY A;  4ID5 B;  5KOX A;  4PPD A;  3PHT A;  2VF3 A;  2I1R A;  5F8H A;  2MY7 A;  1VQL S;  1LWF A;  2MPU A;  2NZC A;  3SSQ A;  2VG7 A;  2Y8W A;  2B6A B;  3ET6 B;  4DU7 A;  3WHI A;  1N33 F;  3KJN B;  2FVQ A;  5L1K A;  4O0N A;  2HND B;  1NHK L;  2MHE A;  3D5M A;  3C19 A;  2YVS A;  1HNW F;  1SH3 A;  2ASL A;  5K14 A;  2PFF B;  1VFJ A;  2J0W A;  1W2I A;  4I2Q B;  4C0B A;  4F0K A;  1PAE X;  4XO0 A;  4I68 A;  1VBZ A;  3KK3 B;  3ZZ0 A;  3A8K A;  2E1P A;  2N82 B;  2YKM A;  1S99 A;  6FD1 A;  4B3O A;  1B3T A;  2MST A;  3PM9 A;  3EGV A;  3KNG A;  4EYH B;  3JTP A;  2RKI B;  3AD8 C;  3KWM A;  2CDR B;  2AEM A;  4IDK B;  2ZKU A;  4AYB D;  3HP6 A;  5BYR A;  4CLL A;  2GVZ A;  2AJF E;  1FJE B;  3GON A;  2DGX A;  1FEE A;  4LF7 J;  4KAI A;  1N34 F;  5KFK A;  2I5J B;  3MHY A;  4OZJ A;  1RT7 B;  3EDR B;  4RW9 B;  4RPF A;  3HKW A;  3UDV A;  2L41 A;  2QJ3 A;  3M9N B;  4AL5 A;  5KFH A;  4U95 A;  3IBF B;  4YN3 B;  2H5E A;  4A8W A;  4BLG A;  4KFB A;  3NAI A;  4DSI A;  5L38 A;  4Q0B A;  2HVH A;  5AE3 A;  2R7R A;  3DRR A;  3O8W A;  3ICL A;  2PSZ A;  2OO4 A;  3QGP A;  4WE1 B;  3RG6 A;  4LFA F;  5JJB A;  4OJH A;  1RHK B;  5JVH Q;  2YKN B;  1H2T Z;  1KLM B;  3SQG A;  4E98 A;  4LSN A;  4PCQ A;  4RW8 A;  2B8Q A;  3TEG A;  2RH3 A;  1N5T A;  1SUQ A;  3C14 B;  3CDA A;  5D8H B;  2V67 A;  4DCJ B;  2BRK A;  1VQN S;  4NRU A;  3QID A;  3KUG A;  3Q8V A;  3GCW P;  3PW2 A;  1TV6 A;  4DSL A;  4WXO A;  3EGZ A;  4OI4 A;  1RQ0 A;  2ILZ A;  1AZS A;  2SXL A;  4DV0 J;  4NPO A;  2BDP A;  4NLP A;  2VFT A;  2C2E A;  4DSF A;  4QBU A;  3K5M A;  2X51 A;  4IR9 A;  5L46 A;  3IAM 9;  2VG6 A;  2JVO A;  3BSC A;  3QFW A;  1JIH A;  2LXI A;  4ECS A;  4LMZ A;  1LWE A;  2QL5 B;  4R0E A;  3KLI B;  4B9U A;  1VQ9 S;  1L3U A;  2HFZ A;  3EM1 A;  2V2Q A;  2W7O A;  5T41 A;  4K0K J;  5IS2 A;  3PYE A;  2H1Y A;  1CVJ A;  1WTB A;  3HT0 A;  1KKH A;  1CJU B;  1YWX A;  2OEJ A;  1SJR A;  3T3F A;  1JKH B;  4WJB A;  4LJM A;  1RTD B;  9ATC B;  1WI6 A;  3CME S;  4NML A;  4IH6 A;  3U27 A;  3O6Q A;  5KT2 A;  2P6S A;  3H90 A;  1FJC A;  3CCE S;  2YNI B;  3A3P B;  3PO4 A;  1FK9 B;  3M05 A;  2DBB A;  2CWK A;  2Z2M A;  4KE5 A;  1FTR A;  2C2K B;  3MM9 A;  1TL3 B;  1ZPW X;  5LMN J;  2AP6 A;  2EK6 A;  1YBT A;  1TEL A;  3RBZ A;  1WJ9 A;  2XWY A;  1FX4 A;  1V5V A;  2YKQ A;  3GMG A;  1D8Y A;  5L8R C;  1RT1 B;  1YJN S;  3FEX B;  2IAJ B;  4FYX B;  3FKB A;  1S6U A;  2BJD A;  3DLK B;  4NLR A;  4H4M A;  1SC3 B;  3HPO A;  3BGR A;  2E1C A;  1MML A;  4NLW A;  2KU7 A;  3W1Y C;  1N0U A;  2QEX S;  5J2N B;  4OLP A;  2NXE A;  2XS2 A;  1NXI A;  4ECW A;  3T6J A;  1GTE A;  5KFG A;  4USW A;  3HJV A;  1NBE B;  4L72 B;  2IJN A;  5E7O B;  4K4U A;  1WTF A;  4NL5 A;  3MPW A;  2EBE A;  4DSJ A;  2HVI A;  1GFW B;  4OHW A;  2KO1 A;  2BJ3 A;  2YWE A;  2R8I A;  1DTT B;  5D4N A;  2B43 A;  4B3T F;  5KG7 A;  3N79 A;  2PA8 D;  2CRL A;  4C7Q A;  3HM9 A;  3DXS X;  3G6X A;  4EUV A;  5LXY A;  2E1A A;  3NG8 A;  4LF6 F;  2KM8 C;  3JQJ A;  3PFE A;  3ZZO A;  1X5P A;  1XQI A;  4LF2 A;  1HWK A;  1NJW A;  2BW7 A;  1QSS A;  4F36 A;  1XMO J;  1CJV B;  3L3C A;  3H5U A;  1RYS A;  1ITP A;  3RB0 A;  4IOA Q;  3RJM B;  3KK1 A;  2ZJP Q;  1VQM S;  4ECZ A;  3D6F B;  2AJQ A;  4F50 A;  5A76 A;  4A46 A;  4RBT A;  3I87 A;  4QWE A;  2GJI A;  1QE1 A;  2MLZ A;  5GMD A;  5ETM A;  2RRN A;  1X5T A;  1UMJ A;  1TKT A;  5DS7 A;  1T9T A;  2MXY A;  4UW2 A;  1I3O B;  5HQM A;  3KLV A;  4NA2 A;  4PYA A;  5DET A;  3RU0 A;  4FNH A;  3NS6 A;  3NBP B;  1SKS A;  5G0R B;  2BOP A;  5ETN A;  4LRA A;  1LV5 A;  1C0U B;  4YDX A;  5F8G A;  2MQN A;  2VIC A;  1PGZ A;  4DV2 J;  1FXD A;  1VIX A;  1R8A A;  1T9Y A;  2UUA F;  3H59 A;  2PII A;  1RJJ A;  1FVS A;  5A8R A;  2LXU A;  1JJH A;  3TUZ C;  4ED6 A;  1H7X A;  4JI5 F;  4N56 A;  4LF4 F;  1R0B G;  5EUH A;  3G87 A;  2ZBP A;  3HSD A;  3VVU A;  3AH6 A;  1QUP A;  3JSM B;  5HP1 B;  1LXN A;  4F26 A;  4ED2 A;  3GLJ A;  1KNZ A;  1UFW A;  2J6T A;  2J8A A;  4C8N A;  5J2Q B;  4DDF A;  2QN6 B;  2WZ1 A;  1N56 A;  1TL1 A;  3ZO7 A;  2ZC3 A;  2OD6 A;  1ARO P;  4OYI A;  1KDN A;  3CD6 S;  1QAX A;  4EYI B;  5BR8 F;  3CJ2 A;  4WF9 Q;  2NLW A;  2N4D A;  4NZ6 A;  4OFZ A;  1JQG A;  1TZ0 A;  1UFL A;  2OI2 A;  3Q8U A;  4PPZ A;  1RUS A;  2OFH X;  2IDE A;  3OT9 A;  4DR3 J;  4HAC A;  4NA1 A;  4WFB Q;  1Q86 T;  3OL9 A;  4DX6 A;  4B3S F;  3O44 A;  2WBM A;  3Q23 A;  3GYG A;  1S6P A;  2H4W B;  1OJ4 A;  3JB9 k;  2C2M B;  3K5N A;  4F25 A;  2J7W A;  1JLC A;  1ZOT A;  5E2Q A;  4QU7 A;  1CJK A;  1D0E A;  3AT1 B;  4OJG A;  3J80 Y;  2DPI A;  2VL1 A;  2HZC A;  4RUB A;  1CC8 A;  2BE2 B;  1KWM A;  2R7Q A;  4MTP A;  2RAQ A;  1WG5 A;  1XR7 A;  2YX4 A;  1S9F A;  4V19 X;  2CPY A;  4DUZ F;  2HGM A;  2HZV A;  2RD5 C;  1UET A;  4ZIW A;  1S49 A;  4NYP A;  1A7G E;  1RT5 A;  3W2W B;  1NK0 A;  2C3U A;  4OI6 A;  4DPT A;  3D1H A;  1JLE B;  1JLF B;  1Q5V A;  3CCM S;  3K7R A;  1M5H A;  5ETP A;  1VRU A;  4LQ9 A;  3V5R A;  1N6Q B;  1N32 J;  4ZVU B;  1Q79 A;  2ZD1 B;  2CPJ A;  4DF8 A;  3KJQ B;  4RR5 A;  2YWH A;  2AV5 A;  2BVZ A;  2DXF A;  3OVA A;  1KQG B;  1QM9 A;  2W1B A;  3T1H J;  2GO9 A;  3GZ7 A;  2IVY A;  1SJQ A;  2E66 A;  4QIE A;  2D74 B;  2RQK A;  2HRT A;  4CI0 B;  2CVE A;  1I51 B;  4OX6 A;  3HVW A;  1ZM9 A;  2C3Y A;  2GJF A;  1TMJ A;  4EWT A;  1S97 A;  1IBK J;  4UF4 A;  3J81 U;  3NGD A;  2VPY B;  3TAM A;  1MSW D;  2R3V A;  1J27 A;  4LBP A;  3HFK A;  2CQB A;  2FPH X;  1K1Q A;  2ZIT A;  3GFH A;  1F9F A;  4AQY J;  2FY1 A;  4KRW A;  2GO8 A;  2MLY A;  1DAX A;  1NK6 A;  2Z2Y B;  4IOB A;  4X62 F;  4P6Q A;  2DHA A;  1TTH B;  2XSJ B;  3CO9 A;  4X64 J;  3BKT A;  4NCG B;  3V6D B;  2QSF A;  3K59 A;  1VJW A;  1REV B;  4P2X A;  4V1A k;  4NA3 A;  2DT9 A;  1UEK A;  1WOS A;  1FKP A;  3RB3 A;  3GPA A;  3Q2T C;  4B9S A;  5DDP C;  1BQN B;  3C15 A;  3TRG A;  1S76 D;  2CDQ A;  1AFI A;  4OYA A;  4O4R A;  4ZLJ A;  3CJK A;  3FJ2 A;  2U2F A;  2FIU A;  4I6Y A;  5C24 A;  2M70 A;  3DLL Q;  1TKX B;  4FXW A;  1CG2 A;  3THP A;  4L3K A;  2VV5 A;  4O3N A;  1YJV A;  1FTC A;  1J5E J;  3I4P A;  1VRT B;  3BR8 A;  3QGG A;  2WBR A;  1Q8B A;  1PIL A;  1VOM A;  3MFI A;  4HKQ A;  2VC0 A;  3H5S A;  4M5J A;  1U24 A;  2KXF A;  2HVE A;  5DG7 A;  2I38 A;  3KNA A;  2CPD A;  4LF8 J;  4ZA1 A;  5A8W A;  3FVY A;  2FZG B;  5KG6 A;  5SUH A;  2ZZM A;  4RU9 A;  3POT B;  4PXD A;  3SCI E;  5BYQ A;  3Q8Q B;  4C6A A;  1S9E A;  2AIR B;  1EHW A;  4Y34 A;  3TUJ C;  1RK8 A;  3JS9 A;  2QA2 A;  1URN A;  5ETT A;  3Q89 A;  1WHV A;  4JV2 A;  4IH7 A;  1U2R A;  1GMV A;  2F8H A;  3O1L A;  3PJW A;  3TJ8 A;  3R5B A;  4QR0 A;  1NSK L;  2P2C B;  4NLT A;  2VJU A;  3OFG A;  3HMJ G;  5GMK a;  2HFV A;  4A8Q A;  2DH8 A;  2P9C A;  4ZCM A;  3LAK A;  4DCO B;  1ZAX A;  1C1C A;  1Y00 A;  4ECV A;  4AL7 A;  3E3X A;  4PWW A;  4OV1 A;  4OYW A;  4CIO A;  5HRO A;  1WKK A;  4USK A;  1ICE B;  3CCZ A;  2EXU A;  4JI2 F;  4OYZ A;  1OYD A;  3DKD A;  2GIF A;  2XGP A;  2RDJ A;  3QPI A;  2HQC A;  1LW2 B;  1WC4 A;  4OZ2 A;  2VU5 A;  3R7S B;  4CZC A;  4U67 Q;  3QAT A;  2M2B A;  2BJ9 A;  2VG5 B;  2R2U A;  5ETO A;  4EMD A;  3I9V 9;  3D0H E;  1SL1 A;  1NJI T;  1T95 A;  4DXL A;  3S6E A;  3VWS A;  2YQ3 A;  3V6H A;  2RDD A;  4DLE A;  2ZDO A;  1YJ9 S;  4JI7 J;  4W92 B;  3ZZZ A;  1V6H A;  1DLO B;  3CCS S;  4F4Y A;  1TL7 B;  4G6V B;  1WHX A;  1WC3 A;  5HLF A;  1KFD A;  4UTG A;  2QA4 S;  3R5A A;  4ERD A;  1YJT A;  3OL6 A;  1S4E A;  2MZ1 A;  1WOO A;  3EZU A;  1HR0 F;  8ATC B;  3DI6 B;  3KJV B;  3MED B;  1NME B;  3FK4 A;  2E5L F;  4E8U A;  3I56 S;  2LEP A;  3I0S B;  1Q0N A;  1KVI A;  2KB2 A;  1S9G A;  1S1V B;  3RRH A;  2X7I A;  1PJ5 A;  3NS7 B;  2CVI A;  3VF0 B;  1KQK A;  1T11 A;  5I3U B;  1RE1 B;  1SVD A;  2DNR A;  2WW8 A;  1T9V A;  4ZCK A;  3AA8 A;  5HMZ A;  4X65 F;  3MMA A;  4HT5 A;  5HI7 A;  4LR7 A;  4G65 A;  3SZ2 A;  2QA4 G;  1FD2 A;  2BMB A;  1ULR A;  4Y0F A;  3IGN A;  2RML A;  2RRB A;  4LVO P;  2XB2 D;  5HMW A;  3OUY A;  3C6U A;  1R0A A;  3U02 A;  4M5I A;  4DR1 J;  5THW A;  1VQ8 S;  3PR4 A;  3M30 A;  2HQI A;  2HHV A;  4ZPT R;  4J9O A;  3MOJ B;  4ZVT B;  3HUL A;  3CJ8 A;  5GAH I;  2XTJ P;  2V8P A;  3HHL B;  1A9N B;  1XNQ J;  4E2F B;  5CYQ A;  2AGO A;  3TAN A;  4NMX A;  2WHO A;  3AY0 A;  2UXD F;  2VA2 A;  3CCV S;  3V4I A;  4MH8 A;  5K8N A;  5H9E J;  4QR1 A;  3H5X A;  2DNO A;  1VLY A;  1UFK A;  1RWX B;  2Y1R I;  3TZX A;  4ED8 A;  3B78 A;  2PGC A;  3CMQ A;  5LSO A;  1VQY A;  3W62 A;  2C2R A;  3BSA A;  4ZP9 A;  2RHQ B;  2XSF A;  2UVW A;  2FDN A;  3CNQ P;  2RIJ A;  4M1K A;  3G4S S;  3D9B A;  3KHL A;  2G4B A;  3CC2 S;  4X4P A;  2GFF A;  4HHJ A;  4M8L A;  4JI8 J;  3LWM A;  2UVU A;  3EVM A;  3N01 A;  3MM8 A;  3OSP A;  3PW4 A;  2YX7 A;  4MYT A;  2LA6 A;  3L4B C;  1VRQ C;  1SQF A;  5IT0 A;  5DG8 A;  5KFF A;  5CZX A;  2RS2 A;  1ZET A;  1AYE A;  1K44 A;  1Q8K A;  2VON A;  2P9G A;  2W9C A;  2V50 A;  1VBK A;  3RYL A;  1SV5 B;  5K8P A;  2E5I A;  2YNF B;  2Q1L A;  2CZ4 A;  2EFP A;  3AA9 A;  2LU2 A;  2DNP A;  1LWX A;  4CO5 A;  5KT5 A;  2ERR A;  1PJ6 A;  4ZN3 A;  3G8T A;  3HCX A;  5KFS A;  2A3J A;  2EBG A;  2BJE A;  2IVM A;  2H65 B;  1TL5 A;  4WP3 A;  1Q4R A;  2DGO A;  5D15 A;  2B4U A;  3MTJ A;  1Q95 G;  2ZKT A;  2V4J A;  4I6A A;  4PG7 A;  4RW6 B;  3SMZ A;  2VOP A;  3KHH A;  4KO0 B;  5H9F K;  1QDU B;  1VBY A;  2ZVS A;  5A6P A;  4XPE A;  3S8S A;  4TNO A;  2HGL A;  5KG3 A;  3I96 A;  3H7H B;  4KKO A;  1XNR J;  3DM2 A;  4X66 J;  2H5J B;  3AAW B;  3MEC B;  3G8Q A;  3MR2 A;  2LMI A;  4DR2 J;  3CUN A;  5CCL A;  3MCO A;  3VAJ A;  1RHM B;  1BLU A;  1S6O A;  4O44 B;  4M5N A;  4EBD A;  1RHR B;  1S0O A;  2D69 A;  3FZ2 A;  5IOL A;  4M63 A;  3RRG A;  2G1H A;  3QT6 A;  5CYM B;  2VBY A;  2IYG A;  1UWA A;  4W90 B;  1RHQ B;  4P2M A;  2HWH A;  1D3W A;  4CTA A;  2PMH A;  2F8E X;  4CLY A;  3FNN A;  1ZA2 B;  4DHV A;  4I1T A;  5HAO A;  2YH1 A;  2YNG A;  1W25 A;  2VQF J;  1JJC B;  4TLR A;  4DL7 A;  2MQM A;  4DF4 A;  3SDE B;  1S1U A;  4Y3C A;  3OBI A;  1SC6 A;  1UKU A;  4YP3 A;  5C25 A;  4DV7 F;  2XS5 A;  3T1Y F;  1RKJ A;  3PFO A;  3A3O B;  1QAY A;  4DR4 F;  3CT9 A;  4LBI A;  1OWX A;  3N28 A;  3SYZ A;  5CQG A;  4DV6 J;  4K4Z A;  3TJ9 A;  1T03 B;  1H2V Z;  3EDQ B;  4AFF A;  2FVP A;  3TVK A;  1U1Q A;  3OHB A;  1NDC A;  3HDS A;  1K8A T;  1RU1 A;  2HFS A;  2HHS A;  1OSD A;  1NPR A;  4KSE B;  3UE2 A;  2V34 A;  4KHP J;  2FZK B;  4OHY A;  2HHH J;  2ZBR A;  2GGP A;  1SKR A;  2OPQ B;  2W7P A;  4LFC F;  1CUL A;  4DG1 A;  4J9V A;  1AA1 B;  4ID5 A;  1YIJ S;  2ZH8 A;  4DV1 J;  4F0M A;  3QT7 A;  4MIA A;  1RWP B;  3LWL A;  1UPP A;  3D0G E;  4DL0 C;  4WPA A;  3ILL A;  2KXN B;  1S48 A;  2B6A A;  3MCN A;  1RDR A;  1HMV B;  4YFU A;  2B7C B;  1D1U A;  1JLQ B;  4OZ1 A;  1NPP A;  4O4G B;  4ZPW R;  2HND A;  2NCK L;  3U1N A;  2G2O A;  3VAF A;  4BC9 A;  1LK5 A;  3UD3 P;  2FHM A;  2LQ8 A;  4RWX A;  3FMW A;  4JI0 F;  3MWB A;  1X9W A;  4I2Q A;  1K0V A;  1UJ4 A;  4E0D A;  2B9Y A;  2HNZ B;  4Y2A A;  3ZNJ 1;  1S7H A;  1U09 A;  5C42 B;  3KK3 A;  2GNK A;  3OTC A;  4B3M F;  2XMM A;  3OR1 A;  3HJF A;  3FSY A;  2QTW A;  4XAK A;  2VFV A;  4ZPC A;  3K5L A;  2VBZ A;  1M1K T;  2RKI A;  2HYI B;  4IDK A;  3QIP B;  1L5U A;  2J7U A;  4PZV A;  1HNI B;  3PJX A;  1HBN A;  2L48 A;  2DY9 A;  2ZHA A;  2ZDP A;  2APO A;  2ASD A;  2K3K A;  2O3D A;  3PX6 A;  1SB6 A;  1FE0 A;  2XY6 A;  3F44 A;  2EFG A;  2VPX B;  4NZ7 A;  1RT7 A;  2XYG B;  1R6V A;  2DNQ A;  2KXH A;  1RBA A;  3MR3 A;  4MIW A;  4PUO B;  1NKE A;  4F7V A;  1ROF A;  2CKW A;  2IBO A;  4CO0 A;  1FE4 A;  4U6P A;  1UVK A;  3BGL A;  5GME A;  4EK2 A;  1VLO A;  2HPU A;  4ES3 A;  4I6W A;  4RNH A;  3DLE A;  2XY7 A;  1NU4 A;  4NX9 A;  4USU A;  1NEE A;  1QAJ A;  1EJ7 L;  4ICL B;  2RB7 A;  1WG4 A;  4YY3 J;  4WE1 A;  1I94 F;  2YQ0 A;  2YKN A;  5CYJ A;  1KLM A;  5KFI A;  4ZVH A;  3CE8 A;  4ZMM A;  1N8R T;  3IRX B;  3MUR P;  3M6X A;  3C14 A;  2WVC A;  1Y9O A;  2KT5 A;  1Q1K A;  4QYR A;  1FFS B;  4HR2 A;  4CLF A;  2HSE B;  2UXC J;  1M0S A;  2KVQ E;  1ELO A;  1Q5Y A;  4YR3 A;  1DTQ B;  2I2Y A;  5L1J A;  4HHU A;  2YWF A;  2Z0G A;  2DR6 A;  3DLJ A;  4WZM A;  1G3O A;  4ZLL A;  5B0A A;  1EAR A;  3RBE A;  3I82 A;  5GAG I;  4L3N A;  4J7C A;  3KLI A;  5DO2 A;  2H48 B;  4YB5 A;  4UY8 T;  4DEZ A;  3M8W A;  2HS3 A;  1LQ9 A;  3Q2S C;  1UW4 A;  4X4V A;  3HF5 A;  1S1W B;  2PI4 A;  4K4V A;  1UVN A;  1BQM B;  4LF5 F;  3CJ0 A;  3WZ0 A;  3NLC A;  3JSY A;  1F2G A;  5HL7 Q;  3MEK A;  1JKH A;  4ZPV R;  3TZZ A;  1RTD A;  2HK3 A;  4UQG A;  3AJD A;  5HBM A;  3QLH B;  3H20 A;  1Y11 A;  1R0C B;  4W98 A;  3EZ5 A;  1IBM J;  2GV1 A;  1N5Y B;  2MJU A;  3QO9 A;  2AU0 A;  2DRB A;  3I4H X;  2YNI A;  4RNO A;  3QAE A;  3H40 A;  1XMQ F;  9RUB A;  3V81 B;  1FK9 A;  4GKK F;  3HFV A;  3GE9 A;  4RNM A;  5ETS A;  1P27 B;  3OR2 B;  5D3G B;  1VJQ A;  5AT1 B;  4DPX A;  1IWG A;  2LEB A;  3BDE A;  4ED7 A;  4H4O B;  1QVF R;  3E01 B;  1UTA A;  2MKC A;  1VQ5 S;  3RAX A;  1RT1 A;  4AD6 A;  2IAJ A;  2QGF B;  3DGP B;  5D6G A;  3DLK A;  1VC5 A;  2POK A;  4OHV A;  3FCV A;  2MQP A;  4PXE A;  2QYC A;  1LW0 B;  3GYX B;  2DGV A;  4UOC A;  3PTW A;  2VFU A;  1X7V A;  5K5M A;  3HSJ A;  4KGV B;  3KLH B;  5DDO C;  1KRP A;  5F9L A;  3CUL A;  3DXB A;  2JZ5 A;  2KKH A;  2MQQ A;  2JWN A;  3G2X A;  3OVB A;  1YJW S;  4WTO B;  4WFY A;  3DLB A;  3HO1 A;  1O8B A;  3J81 Y;  1B64 A;  4FYW B;  2FYX A;  1RTJ A;  5C5J A;  1PG5 B;  2B56 A;  2ZM6 F;  2CYY A;  1R8C A;  4B08 A;  5AXM A;  2XNQ A;  3L95 X;  5E3C A;  1U45 A;  3M6W A;  2DNY A;  1KHW A;  1LWC B;  2YKP A;  2HAI A;  3KLE B;  1CJV A;  2IRU A;  2MZS A;  3JSB A;  4JP8 A;  3MR7 A;  1WNE A;  2IFX A;  2YPZ A;  1PAU B;  5L39 A;  4ZJL A;  3W65 A;  2IMO A;  4A4J A;  5LMU J;  2E5J A;  1F1B B;  3MM7 B;  2HIY A;  3TWZ A;  3MEG B;  2MKJ A;  4UT4 A;  4LRE A;  1U6B A;  4HHH A;  2DGS A;  3AB2 B;  4AXI A;  2LQ9 A;  2G2Z A;  1X0F A;  1MWQ A;  1Z2Z A;  3MM6 B;  4G1P A;  4TY9 A;  3VHQ A;  1YSJ A;  3M2U B;  4DV5 F;  5HVH A;  1NDK A;  3PNI A;  4ZVQ B;  4C8Z A;  4AXJ A;  1J5O B;  2OTL S;  3DLG B;  4J9M A;  1P8G A;  3WDO A;  1QTM A;  2AGQ A;  3BQ2 A;  4DQP A;  2WSE C;  2NQP A;  2UU9 F;  2FC8 A;  1ZA1 B;  7FDR A;  5KTQ A;  1EKR A;  3PKM A;  1U25 A;  3NBP A;  3LAM A;  3E8O A;  5B7W A;  1ZTW A;  4Q44 A;  3CD7 A;  2GAH C;  4NXM F;  3MPD A;  2P6T A;  3W5Y A;  1FX2 A;  5AJ3 F;  1RBL A;  4ZP7 A;  2F8M A;  1S6Q B;  3M8Q B;  2EG2 A;  3MD1 A;  3IG1 A;  3SFG A;  3LP2 B;  2VQE J;  5GVQ A;  4KPY A;  2W4D A;  4PWD A;  4I7F B;  2AZ1 A;  4PG5 A;  2DH7 A;  4WP9 A;  4IR1 A;  4I64 A;  3UR3 C;  3JSM A;  1S12 A;  5HP1 A;  5LL6 d;  2JX2 A;  1YQH A;  5B09 A;  3DDK A;  2AEF A;  1FRM A;  5I3P A;  2CUY A;  5U47 A;  4EO6 A;  3MPV A;  5J2Q A;  1CC7 A;  1F3F A;  5DZ6 A;  1LFW A;  3IN5 A;  3IM8 A;  3QT5 A;  1KBR A;  3ILJ A;  4B9L A;  1SH0 A;  4DCP B;  1S10 A;  3J7Y U;  1M5S A;  3IMQ J;  1UW9 A;  4EBE A;  2EPI A;  3R7N B;  3PCO B;  2NZ4 A;  4ECR A;  2XEX A;  1U8S A;  2XLI A;  3Q8P B;  1WI8 A;  1U8W A;  2PEB A;  2KJV A;  5AXN A;  4KBI A;  1RWK B;  3I55 S;  4DR7 J;  4JV0 A;  2KZZ A;  2BE2 A;  2G9O A;  5EN1 A;  1YX2 A;  1DUR A;  1NK7 A;  4CT8 A;  4K50 A;  3LTO A;  1OPZ A;  2EFV A;  2P9E A;  1G4C A;  1W26 A;  4USH A;  3NWR A;  1DZ5 A;  2B9W A;  4U8Y A;  4KGK A;  2OGU A;  3CDU A;  3W2W A;  2GQ2 A;  2VJV A;  3GG0 A;  1QVG R;  3M2V B;  4K59 A;  1EET B;  1JNR B;  2AX0 A;  1JLE A;  1VR6 A;  4B9V A;  3H25 A;  3M8P A;  2BQU A;  3DC2 A;  3PW7 A;  2QFI A;  2JH3 A;  2IBK A;  4NLG A;  4JI4 F;  5AE1 A;  3KMQ A;  2QLB B;  3D67 A;  4AE5 A;  2V9K A;  4U7U D;  1N6Q A;  1TP7 A;  4JV1 A;  3GV8 B;  2PFD A;  1RT4 B;  5A2Q U;  1B70 B;  2F40 A;  2ZD1 A;  2DNL A;  2CG4 A;  1TUW A;  3KUH A;  3EVO A;  5LT5 A;  4WFA Q;  1YDL A;  5IFM A;  1AXQ A;  2QLF B;  4NLU A;  2DHG A;  2OAU A;  3C16 B;  4LRF A;  2MGZ B;  2XC9 A;  3VTI A;  2VBX A;  2NPI A;  2DO0 A;  4DFK A;  1F5B A;  4JI3 F;  4TVA B;  2VPZ B;  2JEF A;  4ZIT A;  1RXO B;  4Y65 A;  1RT6 B;  2DNG A;  1FDB A;  2WSF C;  4RW7 B;  2AW0 A;  4PAA A;  2X3G A;  3TAP A;  1YHQ S;  3K2Y A;  1W2B R;  3SV3 A;  1JLB A;  2WON B;  4NEY A;  1EQM A;  2WVB A;  1WAC A;  2MEW A;  4CWB A;  4G3I A;  3IS9 B;  5FD1 A;  2KRB A;  4PQA A;  4K5S A;  2JJ4 D;  4YHH J;  2QT7 A;  3DOL B;  2CQP A;  4CM0 A;  1JB0 C;  1YJU A;  2CPZ A;  1FXR A;  2QLX A;  2XSJ A;  1JLG B;  2B4V A;  3TJA A;  7AT1 B;  3V6D A;  4TXS A;  5FLX U;  4Z7Y A;  4IG0 B;  2BUN A;  3AXM A;  1EP4 B;  3P8B B;  2FHJ D;  1BD6 A;  1JWW A;  1ZM3 A;  5M2R A;  2VZ9 A;  4CCH A;  4QIV A;  2IJR A;  2J6U A;  4JI6 J;  4ECU A;  1BQN A;  1KVK A;  3HVA A;  2XM3 A;  1SBR A;  4DL2 A;  2ZH3 A;  2RNE A;  3AOB A;  5IWA J;  2J0S D;  2BAB A;  2R8J A;  3HHL C;  2BM1 A;  1KS2 A;  2Q6C A;  3LAN A;  3ENA A;  5GAE I;  1N5Q A;  2RF2 A;  4KHM A;  1GTH A;  3CWJ A;  1LWF B;  3KG0 A;  5DQH A;  2VG7 B;  1VRT A;  1REG X;  2R7X A;  5L1I A;  2EK1 A;  1YIT S;  2KH9 A;  2UXB F;  3MAH A;  2OPS A;  2YPY A;  4IRD A;  3FSX A;  4I69 A;  4R5P B;  3G71 S;  4HTJ A;  5F41 A;  4K4Y A;  1ZTT A;  1G1X A;  2BKN A;  1DJ0 A;  4URG A;  1HNZ J;  2FJD B;  1K9M T;  3KOA A;  1RAG B;  1K47 A;  4KH0 B;  2B5J B;  2QMX A;  2MZT A;  3UCG A;  2UUW A;  3DMJ A;  4DQI A;  1N54 B;  4JI1 F;  1Y10 A;  5ETQ A;  1RAD B;  3J7A N;  3IFE A;  3GJQ B;  1SL0 A;  3ETO A;  2R7W A;  4EEY A;  1HQU B;  2FGO A;  4MK7 A;  3UR0 A;  3QSY B;  3DDI A;  4IFV B;  3EXY A;  2DR9 A;  1FJG J;  1AB8 A;  3EE3 A;  4GO5 X;  1C2P A;  5EGY A;  1PBA A;  2ZH1 A;  2AF6 A;  3CJ5 A;  2MDA A;  1BWE A;  3HLU A;  3JQK A;  2OEK A;  5LOQ A;  2W9B B;  3G8S A;  2L3M A;  4DQQ A;  2GQQ A;  3HFZ B;  4C0O C;  2OFG X;  4IKA A;  2R42 A;  3L09 A;  2UUC J;  1F5A A;  2HQ3 A;  2ALZ A;  3KFW X;  2IM0 A;  2XMT A;  3UNG C;  1VK3 A;  2IYI A;  1NHU A;  1C4A A;  2ATL A;  1I6J A;  1WHY A;  2DR7 A;  4Q0B B;  1LW2 A;  4OX9 F;  5JMN A;  4FKY A;  1EAY C;  1QUV A;  2ZUG A;  2RQ4 A;  3HD1 A;  1UJ5 A;  3OV7 A;  4ZS6 A;  1HNX J;  3FFI B;  4XIU A;  5G4D A;  3SQG B;  1RTI A;  4U7U K;  3BDP A;  4JV5 F;  4RW8 B;  2F9J A;  3SSR A;  3C66 A;  1OY8 A;  2CPE A;  5FDL B;  4CLT A;  3RAQ A;  3P6Y C;  4NOH A;  4JUZ A;  1DLO A;  4MKV A;  1TL7 A;  4X4Q A;  1TV6 B;  1M5O C;  4Q8F A;  2AKW B;  1NSP A;  3GV7 B;  1BWV A;  4OZ3 A;  3DI6 A;  1VQK S;  1WD6 A;  3MED A;  2HUR A;  5I4M A;  1T0T V;  3GR0 A;  3I0S A;  4DZ6 A;  3W63 A;  5J1E B;  1X0P A;  4LF9 J;  2J76 E;  2DIT A;  1S1V A;  3DHW C;  5DZ7 A;  1RT3 A;  1IQT A;  2JRS A;  2HLT A;  5I3U A;  4OZL A;  3HI9 A;  4NRT A;  3ZTQ A;  1OMS A;  3ADA C;  4C3L A;  4J9N A;  1VQO S;  3LO3 A;  2BAN A;  3CD0 A;  1RYR A;  3SCJ E;  3NKY A;  3H5Y A;  2WB1 D;  4TY8 B;  1HWU A;  2ZUA A;  3ZZY A;  3OTO F;  3HHL A;  2IM3 A;  4F3O A;  3R7B B;  4DJB A;  3R1H A;  3RBD A;  3G86 A;  1VQ7 S;  4IRK A;  2H4Y B;  3GIL A;  2HQF A;  1HQE A;  1FDD A;  3CCQ S;  3LGM A;  1NJX A;  2CQD A;  3ZNU A;  1E6V B;  1RA7 A;  2W2O P;  1S57 A;  3QJJ A;  1R8B A;  2DGT A;  1TKZ B;  1QTN B;  1FRJ A;  2QIF A;  3KDN A;  2MKK A;  3EXC X;  1RKI A;  2IM2 A;  4GKJ J;  1Y4Z B;  3SQO P;  3WIU A;  4WCE Q;  1ZM2 A;  2DHX A;  3M7V A;  2XUL A;  2A0F B;  1HW9 A;  2YWG A;  1N36 F;  1KQS R;  2DNZ A;  4M5M A;  1RP5 A;  4PXB A;  1FI4 A;  3VVT A;  4CO3 A;  3GP9 A;  3UDL A;  4CLW A;  3PX4 A;  3D3C J;  3DOK B;  3JAM U;  4ED4 A;  1SQG A;  4QWD A;  1S0V A;  5H1S V;  1VIO A;  2VD3 A;  1X60 A;  2MQ8 A;  4TLQ A;  1VK8 A;  2XGQ A;  4M5G A;  5F0W A;  5B0F A;  5J1N A;  5KFC A;  1TKD A;  4KR0 B;  4ILM A;  4LIW A;  3TA2 A;  3H98 A;  3IWX A;  2FZC B;  1HBU B;  2B9E A;  2FQQ B;  3D2W A;  2BXJ A;  4LFB F;  2KDO A;  1FWP A;  3RB4 A;  1VQ6 S;  4RUC A;  4A8S A;  3UN3 A;  1D9F A;  1SV5 A;  4DL5 A;  2YNF A;  4RO0 A;  3QMQ A;  2Y8Y A;  3SFU A;  1WEZ A;  2CQ0 A;  5KAK A;  2NYH A;  4FS1 A;  5ADZ A;  5EWF A;  5LJ5 Y;  1SXL A;  5D4L A;  2FB0 A;  3PEJ A;  4WKR A;  2HQD A;  2DNM A;  5D0H A;  1CSJ A;  1WSR A;  2XMK A;  2C1E B;  2Y0S D;  4WYL A;  5B08 A;  3THT A;  4YS2 A;  4GRS A;  2G13 A;  4RW6 A;  2WSC C;  2OEL A;  4KO0 A;  1YRU A;  5H9F J;  5EWE A;  3VCD A;  4CRJ A;  2YBV A;  3JXO A;  2AJ4 A;  5ETK A;  3SXL A;  3KK1 B;  4F3Q A;  1IM6 A;  1URR A;  2ROE A;  1T9X A;  1IBL J;  2RT3 A;  1PJ7 A;  1IR2 A;  1N4L A;  5HQ8 A;  1VQ4 S;  1ZAV A;  4ZP8 A;  5T14 A;  3MOZ A;  2HG4 A;  3MEC A;  1QE1 B;  1S59 A;  4ZCI A;  1VQS A;  1V3R A;  2FLO A;  3RRK A;  3FRY A;  4C2M A;  2ZFH A;  2CAD A;  2M8D B;  4NXN F;  2YKA A;  1FNO A;  1TKT B;  2KZM A;  1T9W A;  2JEI A;  4JI6 F;  2DB1 A;  3J7Y I;  2JL9 A;  1KHV A;  5SZT A;  3ZXW A;  3EWG A;  2JFK A;  3L7P A;  1NDP A;  2OLW A;  2DH9 A;  2MY8 A;  5CYM A;  3BSO A;  3VZI A;  3NP5 A;  2AJ2 A;  1U4B A;  2DVI A;  3D7S B;  1VC6 A;  2UUB J;  1HLW A;  4LUB A;  3CTR A;  4L6V 3;  4LRC A;  1RTH B;  3SDE A;  1KSP A;  1U6F A;  2HFU A;  1ZZF A;  3EUN A;  4B9N A;  1MMD A;  3HX9 A;  5M2P A;  2AD9 A;  1X4C A;  3R1L A;  4PAB A;  2NR0 A;  2F4V F;  1T03 A;  2QMU B;  3J81 j;  1XMB A;  2JEJ A;  2R7U A;  5ETV A;  3WX4 A;  1IKY B;  1LEO A;  5D0G A;  4IFY B;  1FRL A;  2M88 A;  4J90 A;  4M5L A;  1K0T A;  1YRT A;  5HAN A;  4N8O A;  2EW9 A;  1FA0 A;  1DHM A;  5J2M B;  1TL1 B;  2QX0 A;  2RRA A;  4F4Z A;  1IUJ A;  3T5L A;  1CQN A;  2Y1J A;  3UN2 A;  1FJG F;  1X4G A;  3UN5 A;  1HWL A;  1TMM A;  3ENW A;  3UQS A;  1V3S A;  4X4T A;  3A12 A;  4ED0 A;  2O66 A;  5HJY A;  1HMV A;  3MGJ A;  3BQ0 A;  3CJR A;  1JLQ A;  1VS3 A;  4NI2 B;  3F41 A;  3OLB A;  2IM1 A;  2MYF A;  5K9F A;  1NPK A;  2BV3 A;  2K7K A;  3EYZ A;  3ISN C;  2OSR A;  1QJH A;  2YWK A;  2VPW B;  1FHT A;  4FF3 A;  1UJ6 A;  3OVS A;  3W2V B;  1BY9 A;  2HNZ A;  2V2V A;  1S4F A;  4WTY A;  2KI2 A;  5C42 A;  1XN9 A;  1KN6 A;  1RT5 B;  2VUG A;  1Q81 T;  3DGV A;  1GX5 A;  4Y6I A;  3WQP A;  2L9D A;  1AFJ A;  2JLE A;  3A13 A;  2DGQ A;  3BV8 A;  1OQ3 A;  1ZH5 A;  1MU2 B;  2FVS A;  1F5C A;  3OJS A;  3QIP A;  5F3T A;  4FYD A;  2W2N P;  1SIZ A;  4B3R F;  4CNZ A;  1HNI A;  4Z37 A;  5AXK A;  2OMO A;  2Z2Z A;  5E0O A;  4KH1 B;  4WWS A;  3BH6 B;  3IBW A;  4ED3 A;  1KEK A;  2KM8 B;  3HK2 A;  4ES2 A;  2R7O A;  2C22 A;  2DHH A;  4DPW A;  3WIV A;  4LRB A;  4IO9 Q;  2H3E B;  1JLA B;  2DEJ A;  3VAI A;  4PUO A;  1WDD A;  2OIH A;  1HD1 A;  2JLF A;  1OSC A;  2IHR 1;  2R8K A;  3KLG B;  2RU9 A;  2ZBQ A;  3C2P A;  2ZJQ Q;  3DU5 A;  1WC5 A;  2Y1I A;  3GIR A;  1RWW B;  3Q8R B;  2ZE2 B;  2C2O B;  1HA1 A;  4C9D A;  2EWH A;  2B0G A;  5FJ4 A;  2KG0 A;  4ICL A;  1FFW B;  3X1L B;  4PQU B;  4CH1 A;  1B0V A;  4Q2L A;  4DV3 J;  3Q0A A;  1RU2 A;  2Q43 A;  3G82 B;  4CLK A;  3UO0 A;  3NWG A;  3GQC A;  3KHR A;  3JTN A;  3IRX A;  1YI2 S;  2I9S A;  3PVX A;  2XQC A;  2FD2 A;  2GVD B;  5KFE A;  3VGS A;  1Y5N B;  3BO3 A;  1U49 A;  3N6N A;  2CFX A;  2RQM A;  4DUY F;  1SJ4 P;  1V5I B;  3AXK A;  2IIH A;  4YME A;  2CA9 A;  4RNF A;  4GVB B;  2BAC A;  2D3U A;  2ZNY A;  3T5J A;  3K5P A;  3N5F A;  2C2N A;  1WDT A;  2E44 A;  3DU6 A;  1Z4U A;  4C8M A;  1UCN A;  5C24 B;  3W3S A;  4OYP A;  5LSL A;  4KQZ A;  1WEL A;  2ASY A;  5F0U A;  3M6U A;  3IWL A;  4L73 A;  1YRX A;  4GKJ F;  4NLY A;  4OZ5 A;  1NB7 A;  3DRY A;  4IYQ A;  4GC7 A;  1AUD A;  3TX8 A;  1RWN B;  1S1X A;  2DXD A;  2GX8 A;  2Z8Q A;  4DR5 J;  1QSL A;  2MLX A;  1S1W A;  2VKR A;  2EKY A;  5A8W B;  2IC3 B;  2EI5 A;  3RUB L;  3NMR A;  1EKS A;  1O5J A;  4MK9 A;  1C1B B;  5IT9 U;  3BKU A;  1VMB A;  4DV4 F;  2CG8 A;  3WC2 A;  4ELV A;  2GA7 A;  3QLH A;  1P6T A;  2NYI A;  2YTC A;  1N5Y A;  1RT2 A;  1UA1 A;  2V2Z A;  5T7L B;  2HGN A;  3RBX A;  3V81 A;  1RAI B;  2EG1 A;  3U1L A;  3F0N A;  3Q22 A;  4J9R A;  2GAG C;  5D3G A;  4C11 B;  1JJ2 R;  4ELT A;  1HYS B;  2PDA A;  1N33 J;  3R2C J;  2PE8 A;  2IJF A;  3AD7 C;  5KFD A;  2OD4 A;  4YB6 A;  2B9X A;  4H4O A;  3D6T B;  2W4C A;  1U7L A;  2FJE B;  2QLW A;  1HNW J;  4WK1 A;  2XYP B;  3DGP A;  5HRO B;  5A2Q Y;  2Z30 B;  5F8I A;  1U0H B;  5CXT A;  4OI1 A;  1OO0 B;  1UZH A;  2LVW A;  1LW0 A;  3CXC R;  4RL1 A;  4BCA A;  1X9M A;  2EFO A;  3KLH A;  3UD5 A;  3V4M A;  1M1G A;  3G96 A;  1WKJ A;  1GQE A;  1U47 A;  2XWX A;  3O3L A;  1U2C A;  4DSE A;  1T3N A;  1RZM A;  3S7R A;  1APS A;  1T02 A;  2ZZT A;  1SL2 A;  5HN0 A;  1DAR A;  1Q7L B;  1U02 A;  2LEC A;  2R2T A;  4KT0 C;  4XDD A;  3FBC A;  2AHO B;  3HSZ A;  1N5S A;  2WB4 A;  3CO0 P;  4LF7 F;  3FSI A;  1R8H A;  1WC1 A;  2QL7 B;  2CJX B;  4HVZ A;  3W8G A;  2YY3 A;  4KJI A;  2J7K A;  5HO4 A;  3TQ1 A;  2NRE A;  1WC0 A;  3DOM B;  3U1M A;  2CZ9 A;  1N34 J;  3CJT A;  2OP5 A;  2N4C A;  1LWC A;  3NCP A;  4OYB A;  5FLX Y;  4DQR A;  3KLE A;  4ZCL A;  3CD5 A;  1E6Y A;  2P5V A;  1WF2 A;  2J9D E;  2QA1 A;  3MMJ A;  2V4R A;  2O67 A;  4NCB A;  1JXE A;  4IUF A;  1K73 T;  3MM7 A;  3MEG A;  1EB0 A;  3OJU A;  3OXG A;  3I5B A;  3MM5 B;  2UVR A;  1H0H B;  4FBT A;  2MHN A;  4DMZ A;  2DRD A;  2GMH A;  2Z56 B;  4YOE A;  3GJS B;  3MM6 A;  4Y28 C;  3B4D A;  4LFA J;  2HBY B;  4QW8 A;  1D8Z A;  3W8P A;  3M2U A;  3ITH B;  4IOC Q;  2ZH9 A;  3C6U B;  4H4K C;  3KK2 B;  5LXR A;  3LP1 B;  1J5O A;  1XR5 A;  3DLG A;  3SCK E;  1LKZ A;  3D1Q A;  4I2P B;  3HVT B;  1IKV B;  1MNE A;  4DV0 F;  5C2C A;  5E3A A;  5IC6 B;  1B0P A;  3ULH A;  2J9E A;  1FT8 A;  4P52 A;  1O6X A;  4ZIV A;  3RR8 A;  4JYA J;  3KKF A;  3T19 A;  1FXL A;  3D6M B;  1NHV A;  2RIL A;  3PRB A;  3GCX P;  3LP2 A;  3I32 A;  1RBO B;  5KFQ A;  2ZH4 A;  2M3D A;  3GII A;  2NS1 B;  4FZV A;  5KOW A;  2AYE A;  4K0K F;  1KP6 A;  4X4O A;  3A1Y G;  1U1K A;  2KHC A;  1GXL A;  3NGK A;  4EI2 A;  2F63 A;  2G1D A;  3VAG A;  2PMZ D;  2HWT A;  5KG2 A;  3OQ2 A;  2UP1 A;  1D09 B;  1SI9 A;  1RAH B;  5JVG Q;  1G2E A;  3GV5 B;  2HBQ B;  5KT7 A;  5DQG A;  2CQH A;  2KFZ A;  2I0X A;  4ETZ A;  3MUM P;  3K8W A;  3BO2 A;  2CPH A;  2K7J A;  4FBU A;  4HL9 A;  3VAL A;  3HHE A;  3A8I A;  4WKY A;  3D3B J;  1MW7 A;  4TU8 A;  2LA4 A;  2HLU A;  3BRE A;  1HD0 A;  4MT1 A;  3OL8 A;  4D3G A;  5B0D A;  1BXN A;  5DG9 A;  4UST A;  2L08 A;  4RBV A;  3UWT A;  5LMN F;  2A10 A;  4QYZ K;  3TYT A;  1H7W A;  1TVR A;  4YQW A;  2HIQ A;  2DNH A;  3DHX A;  2QRR A;  1VYA A;  2F7V A;  3UDC A;  2MQO A;  4HT7 A;  2DRA A;  2DJW A;  1PYS B;  1P1L A;  3M2V A;  5F8M A;  3P49 B;  4X4N A;  4F02 A;  2GHW A;  3W64 A;  3UVJ B;  2J5A A;  3K89 A;  2RSQ A;  5J2P B;  1N48 A;  2H54 B;  4A8K A;  2BR0 A;  2PD1 A;  2QYG A;  4OMF G;  5FII A;  2R2R A;  1GK8 A;  2VHG A;  1RT4 A;  3D1O A;  3NNC A;  4USM A;  2CNL B;  5CD4 A;  3B54 A;  3ZTP A;  4TN2 A;  2BZ2 A;  3OTD A;  4PR6 A;  2FTR A;  3Q8Y A;  4LF1 A;  4IQX A;  2WK4 A;  4B3T J;  2MGZ A;  3I0R B;  4EO8 A;  3D0I E;  4LSL B;  2HHU A;  5C2G A;  2W24 A;  2DKO B;  2W2Q P;  3UNY A;  3SEO A;  4LF6 J;  2CNK B;  3MF5 A;  1UVL A;  1H74 A;  2V69 A;  1XMO F;  5DJB A;  4CLS A;  2AYG A;  2QG9 B;  1FVQ A;  2CJB A;  1CJT B;  3HHD A;  1RT6 A;  2NXC A;  4RW7 A;  4FP9 A;  2XMV A;  2VDI A;  5KFB A;  4OQJ A;  1U1M A;  2CQ2 A;  3NAH A;  4UQT A;  5F9N A;  2HHP A;  2WON A;  3O2I A;  5B0C A;  3IS9 A;  1S1U B;  2CJY B;  2COL A;  1IKW B;  1GMW A;  3GFX A;  3LAL A;  3DOL A;  3EPI A;  4H4K A;  4CYU A;  2AT1 B;  4EU0 A;  1YLX A;  1JLG A;  1SC4 B;  3CCJ S;  2W8K A;  1L3S A;  4ILL A;  5DGA A;  4IG0 A;  4RZR A;  2ALY B;  1EP4 A;  4NYO A;  5ETR A;  5IXU A;  3P5B P;  2ROG A;  1NB2 A;  4UY8 5;  3M32 B;  3I6P A;  3PY8 A;  3RGI A;  2V8V A;  5KT6 A;  3DRP B;  1R31 A;  2DO4 A;  2OEM A;  3M4X A;  4DN9 A;  4FS2 A;  3PO5 A;  2B4P A;  5E3R A;  4ECT A;  4C8L A;  4J9P A;  1KFS A;  3FQK A;  5HVF A;  2QE5 A;  2FVR A;  2XNR A;  2V68 A;  1MLA A;  2XZD B;  2YX1 A;  3JAM Y;  4DV2 F;  1IJE B;  1BMQ B;  3D66 A;  4EGL A;  3T9Z A;  3BSN A;  1PO6 A;  2BA9 A;  3CDE A;  2BQ3 A;  1RWM B;  2MZQ A;  3R6G B;  1SQE A;  1O51 A;  4L75 A;  1TUG B;  2MSS A;  2UUA J;  4NLD A;  3LP0 B;  3PZP A;  4ZHR B;  4DSK A;  3CF5 Q;  3M1V B;  8AT1 B;  4WU3 A;  3Q86 A;  4R5P A;  4Q2M A;  4URQ U;  4ZVG A;  4JI5 J;  4LF4 J;  1LFP A;  5CAB A;  5C7P A;  1B4S A;  1HI8 A;  3OSN A;  1HBO B;  2D3O 1;  1F9H A;  1B7Y B;  4OIX A;  4Z7C A;  1IR1 A;  3NRB A;  4R25 A;  2B5J A;  3OR1 B;  2GIQ A;  1KOO A;  1SPB P;  2M9K A;  2JHE A;  3FBE A;  3ZFV A;  3THV A;  4C98 A;  3LUY A;  2HHX A;  1HQU A;  4DR3 F;  5BR8 J;  4IFV A;  3MCM A;  1OIA A;  4N8N A;  1HBN B;  3PYF A;  3QJL A;  2RUS A;  1T9U A;  2DIS A;  4B3S J;  3M8R A;  3WC0 A;  3TQE A;  3CCT A;  3T5H A;  3ZTR A;  1HFE L;  1T8E A;  3A3N B;  2DCU B;  2W9B A;  3BN4 A;  2YNH B;  4RLE A;  1H73 A;  3P4U B;  1YBA A;  3BYP A;  3MPU B;  2WW4 A;  3EIC A;  4FF1 A;  3FUY A;  2OTJ S;  3EGN A;  4KGX B;  2X3D A;  4A8M P;  1RAJ A;  4DUZ J;  4CLZ A;  4C8K A;  2RUG A;  4O3O A;  2E9T A;  4TYB A;  3DLE B;  2FJV A;  3PIO Q;  4ID8 A;  5HMY A;  3EPG A;  1YGY A;  2X1A A;  3DLH A;  5CHC B;  3FFI A;  3C3L A;  1UVJ A;  1NH7 A;  3GTY X;  4FXD A;  4DI6 A;  1N32 F;  1QAI A;  1H98 A;  2HBZ B;  2BOA A;  1IBC B;  5A0Y B;  2PI5 A;  5FDL A;  3R97 A;  1RAB B;  3AJ2 A;  4MYU A;  2ASJ A;  1XBW A;  2XO7 A;  2MJN A;  3MAQ A;  2HVZ A;  3T1H F;  4RW4 B;  4HLB A;  5A8K A;  3FCH A;  1UWB A;  2B4O A;  3KJF B;  2KTQ A;  3UCU P;  5B0E A;  3ELH A;  3QBC A;  2HHQ A;  4JYA F;  4QOT A;  1HL6 A;  3M2R B;  3CCR S;  3A4T A;  1CLF A;  5LM7 E;  1X4A A;  1OY9 A;  3HZG A;  1IBK F;  5J1E A;  2CQ4 A;  2JSX A;  1TK0 A;  1FER A;  2MTL A;  3ETM A;  4AQY F;  1FWK A;  3WBZ A;  1CPZ A;  3NCQ A;  3GJT B;  5DGB A;  3PIP Q;  5KG0 A;  2AX1 A;  5F3Z A;  4PG6 A;  4X64 F;  3MI7 X;  4X62 J;  4I4B A;  1WSV A;  5KFU A;  4O3Q A;  2GHV C;  3N6L A;  4HDH A;  2XO6 A;  2Z2L A;  2ZWP A;  4QIF A;  2CZV C;  5M2U A;  2F4F A;  1KC8 T;  4TY8 A;  1YG0 A;  4N47 A;  4DN0 A;  2L9N A;  3WX8 A;  3BBF A;  2JC0 A;  2CQG A;  3MEE B;  5HBM B;  4YR2 A;  1HWI A;  2HNY B;  2XZW A;  3JYT B;  4Y00 A;  2BM0 A;  3CED A;  3QO9 B;  2BJ8 A;  2J0X A;  1GH8 A;  1E6V A;  1P9Y A;  3LW5 C;  3VGU A;  1I5O B;  2LLZ A;  2N7Y A;  1FCA A;  1J5E F;  1Z2L A;  1TKZ A;  1NLK L;  2U1A A;  2ZH5 A;  4F4X A;  4L74 A;  3FGV A;  3B82 A;  3TUP A;  4DPY A;  4LF8 F;  5DM6 Q;  1MRO B;  4R8U B;  3NMA A;  4DLG A;  3V2U C;  1HQ2 A;  4O3R A;  4IG3 B;  5KFR A;  4WXW A;  2AYM A;  3VV2 B;  3DOK A;  3QRP A;  3QT8 A;  1HPZ B;  2DPJ A;  4NLO A;  3LGH A;  3SBM A;  2WOM B;  1QY7 A;  3NY0 A;  3R5C A;  4ZLP A;  2DR8 A;  2IVF B;  1HBU A;  3CJ4 A;  4DFP A;  2FJX A;  5GAH U;  1HHS A;  3I31 A;  4PKD B;  1FRI A;  4O0I A;  2CJQ A;  1FES A;  1I1G A;  4U9R A;  4J9U E;  4YUD A;  2CJ9 A;  3ET6 A;  4C48 A;  5KFN A;  1RTJ B;  2IY5 B;  2OSQ A;  3BN7 A;  2G0J A;  3N5B A;  5D0E A;  2V94 A;  1OY6 A;  2CQI A;  4K4S A;  4ZOS A;  4KPC A;  3LH2 S;  3NGR A;  3MFH A;  3EZO A;  4JI2 J;  5ETL A;  4OI0 A;  4P2S A;  1ACM B;  1FO1 A;  4XK8 C;  3BKF A;  3RAM A;  1Q8I A;  2FJB B;  2P8I A;  2E7W A;  3PJ9 A;  1F6T A;  2FLL A;  3LOU A;  2Q79 A;  2UV8 G;  3QWU A;  3KG4 A;  1NUE A;  3MCS A;  1NKB A;  2EFN A;  2BQR A;  2W7A A;  3QWP A;  2HEK A;  2ZBC A;  1LXJ A;  4N41 A;  2HRY A;  3E2E A;  3W5Z A;  1CS4 B;  4JI7 F;  1W7W A;  2EEY A;  4ENO A;  3HHN B;  2Y0B B;  2IA6 A;  4ZP6 A;  4TU7 A;  4ATN A;  2Z4P A;  2I5J A;  4DBQ A;  3FEY B;  2IPO B;  4RW9 A;  1WHW A;  4ES1 A;  1U1R A;  1KVJ A;  3TNV A;  3LA0 A;  3TZY A;  4K7Q A;  4GC6 A;  1S1T B;  4Z2X A;  1Y5I B;  4C8Y A;  3R6L B;  2Y1L B;  1SC1 B;  1H2U X;  1KOH A;  2JEG A;  5IT9 Y;  1HR0 J;  4JBC A;  1WEY A;  3DRS B;  1VI7 A;  1RTH A;  1B99 A;  1IJF B;  2JFD A;  2MQL A;  2E5L J;  3TZW A;  4RJV A;  5IM0 B;  3V6K A;  1M1H A;  3IG1 B;  2ZOG A;  4TKT A;  5DDQ C;  2F1F A;  1S0M A;  1HW8 A;  2E1M C;  1UVI A;  3IXQ A;  5DQI A;  4CP5 A;  2DK2 A;  3OTE A;  4PWD B;  3W66 A;  2HRU A;  4X65 J;  5KFP A;  1IKY A;  4P74 A;  3N0V A;  4IFY A;  2FGC A;  4U96 A;  4DR1 F;  3AOC A;  4HI2 A;  3TR5 A;  2B8P A;  3J7Z T;  2VDH A;  1L3T A;  2CPX A;  3K0J A;  5J2M A;  1A0O B;  1XNQ F;  1RAC B;  5JXS A;  4B02 A;  2Y3Y A;  3BM7 A;  1IN0 A;  4ZN1 A;  1U1P A;  1UZD A;  4TYA A;  3CCW A;  4MFB B;  1DFD A;  1OS5 A;  4QIG A;  3H2U B;  2F3J A;  2LQB A;  4ZVR B;  1FKO B;  4Y2K A;  3H0P A;  2UXD J;  4DL3 A;  3PAC A;  1R8P A;  1UP1 A;  4CDI A;  5KFW A;  2PO4 A;  4NI2 A;  2QZ8 A;  3IP0 A;  3C46 A;  5F8L A;  2WRM A;  5D78 A;  2JDJ A;  3QJP A;  1HHT P;  1KR4 A;  2XMU A;  1RHU B;  4M5D B;  5KFA A;  2UV8 A;  3SIP B;  3CJQ A;  4RU2 A;  3ZC4 A;  3W2V A;  2BKP A;  4USJ C;  1DBD A;  3IC1 A;  4JI8 F;  3PRD A;  3BBC A;  4QPX A;  2G0I A;  1CJU A;  4OI2 A;  2A2C A;  1GT8 A;  4ALZ A;  1PCA A;  2XLK A;  1PC4 A;  4F2R A;  3PR5 B;  3M8P B;  3IR6 B;  5E41 A;  4DOZ A;  3FMB A;  3TAR A;  1MU2 A;  3VQT A;  2HWI A;  1X31 C;  1T05 B;  1RI7 A;  3TOQ A;  2HS0 A;  3H2V E;  3F73 A;  3JQM A;  3IO1 A;  4F4W A;  4IO1 A;  1HIY A;  4ZPB A;  4U8V A;  3CC4 S;  1PC5 A;  4OYX A;  2ZZN A;  5L9N A;  5K8O A;  2HVD A;  4EZ9 A;  3W7B A;  4X4R A;  1Q53 A;  1RSC A;  5KFY A;  1SKW A;  4QU6 A;  1IM4 A;  2VKZ G;  5CCM A;  5J1P A;  1TL3 A;  1LOU A;  1JLA A;  5MAO A;  2ACM A;  3BF4 A;  3TVY A;  2DD8 S;  4OZ0 A;  3CW2 C;  2BKO A;  3BBB A;  4YR0 A;  1R43 A;  4ED5 A;  3KLG A;  1N52 B;  2DTJ A;  1VDH A;  1KQF B;  1H38 A;  4DL4 A;  4N7T A;  5J2N A;  2ZE2 A;  3PX0 A;  4FN5 A;  2YQ1 A;  1JLB B;  2QL9 B;  4PQU A;  4JOU A;  1XNR F;  4X66 F;  3G82 A;  4P7T A;  2LFV A;  4WFZ A;  3BGO P;  4YB1 P;  2W25 A;  3CDW A;  4DR2 F;  2A1B A;  2A6O A;  2MKH A;  1NAQ A;  5IQQ A;  2GVD A;  3CVK A;  2H5I B;  2WTF A;  1DTT A;  4J9Q A;  3GU0 A;  4DFJ A;  4FNI A;  4J91 A;  4GVB A;  4UOH A;  1M5V C;  1FKA F;  2W4P A;  3KLF B;  2JLG A;  2L9W A;  4C8O A;  2DY1 A;  3G6Y A;  1KLN A;  2X1F A;  1KTV A;  1U48 A;  2XI3 A;  5KT4 A;  4RWW A;  3UDE A;  4DWI A;  2DGW A;  2R8H A;  2HQG A;  4ANE A;  4YB7 A;  5HAT A;  3MR6 A;  1PBU A;  4IRC A;  2J8S A;  1EZZ B;  2ZH7 A;  2R9L A;  4WYW A;  4EBC A;  3CDB A;  2I6W A;  3VQS A;  1L3K A;  2RF2 B;  2LDY A;  3U7J A;  2VQF F;  4W4M A;  2Z57 B;  4UUW A;  4OYO A;  3FZB A;  4FPI A;  2J9C A;  3PEH A;  4EFA C;  4DS5 A;  2OPS B;  3VGV A;  2FY8 A;  4DV7 J;  3GYN A;  3AD9 C;  3T1Y J;  4DV6 F;  4DR4 J;  2OPP B;  2QMW A;  2IC3 A;  3TA1 A;  1TK5 A;  2M52 A;  1C1B A;  3IRW P;  1XER A;  3K17 A;  5IZH A;  2R7S A;  3M9O B;  4KHP F;  1RAE B;  2HHH F;  1V9O A;  1RA6 A;  4XTT A;  4WU2 A;  4BC7 A;  4NWB A;  3H8Y A;  1SJ1 A;  3UFC X;  4GVL A;  3DMJ B;  4DV1 F;  4D3H A;  4G1Q B;  5CAA A;  2GQC A;  4LFC J;  3SV4 A;  2BBE A;  3MXH P;  5G0R A;  5T7L A;  2RJZ A;  3M8Z A;  4NAS A;  1C0U A;  1U2F A;  1Q8L A;  3TA0 A;  4C3M A;  1ZZN A;  1Y7P A;  4DS4 A;  1U0S A;  4FF2 A;  3LPE A;  3MPY A;  4ECQ A;  4I0W A;  4C11 A;  1H6K X;  5K8M A;  1HYS A;  2O1P A;  1YZ6 A;  1XEZ A;  5GAG U;  2YXL A;  1U6Z A;  3B8H A;  3EVW A;  1WG1 A;  3OFH A;  4JI0 J;  5I42 B;  5E5N A;  4QPT A;  1U0H A;  3BGF A;  2V4Q A;  3LPY A;  2LP4 A;  2VBW A;  1QSY A;  2HMI B;  4FVC A;  4S0M A;  2IA0 A;  2RQC A;  4B3M J;  4CT9 A;  2AQ4 A;  1HNV B;  4OHZ A;  4MMO A;  3C8Y A;  4CQ1 A;  3GJR B;  1NZ8 A;  2XLJ A;  5LSR A;  2VA3 A;  3ISZ A;  3IM9 A;  3RZA A;  1RTI B;  1IKX B;  1HWJ A;  2B7B B;  5DRK A;  2KL8 A;  1JMT A;  4ETX A;  1BQX A;  2ROP A;  1KON A;  3MAA B;  4ZLN A;  1N5V A;  2G0C A;  1HBM B;  2C42 A;  1NK8 A;  3P5T L;  3MMC B;  3DOM A;  4MK8 A;  3MDF A;  4FF4 A;  3IAS 9;  2D3Z A;  2GW8 A;  2ZH2 A;  4OYM A;  4FYY B;  1MN7 A;  4KV8 B;  2ZBI A;  2V2K A;  4X2B A;  4V19 J;  3DYA B;  5IV4 A;  3QZ8 A;  5DLG A;  3HKZ D;  4OLO A;  2LU1 A;  4A8X A;  1EIY B;  3H4D A;  4L76 A;  3PG9 A;  4DPU A;  4JB8 B;  1JLF A;  1RT3 B;  3MM5 A;  1G6B A;  3GFZ A;  3CJS A;  4YY3 F;  1C0T B;  1ZAW A;  2F65 A;  4DU8 A;  3OLA A;  1VCT A;  1I94 J;  1BE4 A;  2FJW A;  3TAQ A;  3ITH A;  2R4F A;  1C4C A;  2BAN B;  3Q24 A;  2BE7 D;  3KK2 A;  5KG5 A;  1SIW B;  3FRZ A;  3LP1 A;  2ZHO A;  3OXL A;  2EFQ A;  2K1R B;  2RHS B;  4ITS A;  2NXU A;  1O0P A;  4M5K A;  3G6V A;  4UOF A;  4I2P A;  3HVT A;  1IKV A;  4X84 A;  3MMB B;  2UXC F;  5IT4 A;  4A8F A;  4EZ6 A;  3UPF A;  4QIW D;  4ELU A;  1HQE B;  3NGS A;  1CQM A;  1ZS6 A;  4NLS A;  2ZHB A;  4KTQ A;  1SJ3 P;  1TAQ A;  2EC0 A;  1RWO B;  4OZN A;  3C6T B;  3EX7 B;  3W60 A;  8RUC A;  2CNO B;  2DIU A;  2OPR B;  1AUS L;  4K4W A;  4QWB A;  2IRY A;  4A8Y A;  2XY5 A;  2NSB A;  4NCG A;  2OML A;  4AUK A;  1KTQ A;  1REV A;  5GAD U;  4XDC A;  1NK4 A;  3BQ1 A;  4LF5 J;  1S0N A;  2HK2 A;  4YEA A;  4QQB A;  3KMS A;  4QWA A;  2WVE A;  5KG1 A;  3GIM A;  2PEH A;  1PIE A;  5E33 A;  1IBM F;  3IR7 B;  2PA3 A;  4K4T A;  1KD1 T;  4MAK A;  1LNQ A;  4ZPD A;  5E3P A;  4AL6 A;  3OD2 A;  4NCA A;  3PW5 A;  5EWG A;  1TKX A;  1TL4 A;  1JXL A;  1M5P C;  3TX0 A;  1XMQ J;  4ZVE A;  4GKK J;  3M6V A;  1XK8 A;  4Q45 A;  2FJA B;  3MTK A;  2K06 A;  1U1L A;  2J0Q D;  1FD8 A;  2DEI A;  3OW2 R;  1FFG B;  1JXV A;  2V6A A;  4FKX A;  2Q3P A;  1EQ0 A;  4QYZ J;  1SJF A;  2D7S A;  2CAJ A;  5K14 B;  4ZJO A;  4BWJ A;  1B0T A;  4DL6 A;  1NKC A;  1M5K C;  1MMN A;  4QJV A;  3NOG A;  3POT A;  1NCL A;  2WAQ D;  4LIR A;  1IWA A;  5K20 B;  2J6S A;  3UVJ A;  2XCA A;  2YKM B;  5J2P A;  4B3O B;  2GML A;  5F8N A;  2KT3 A;  4LVN P;  1FJ7 A;  2ZC4 A;  3AB4 B;  2K2P A;  2V8H A;  2DHS A;  4O3S A;  4F4K A;  1SCJ B;  3N6M A;  3NCR A;  2GVZ B;  2XZT B;  1JK9 B;  1OPI A;  3BYR A;  3R5J B;  2H9Z A;  5F8J A;  3H2L A;  2KRR A;  2CQ1 A;  2DYA A;  3BS9 A;  3I0R A;  4AND A;  2ZM6 J;  4B9M A;  3AFG A;  4LSL A;  4RNN A;  5AXL A;  4ZPA A;  2ZNZ A;  1RAO A;  3HHL D;  5RUB A;  2HAF A;  1YTY A;  4I67 A;  2MZR A;  4KHR A;  3KDO A;  4ED1 A;  4MKB A;  1CJT A;  5HJX A; 
#chains in the Genus database with same CATH homology
 3BPS P;  2W2P P;  2ZWO A;  3A3O B;  3H42 A;  3P5B P;  3WHI A;  2W2O P;  1SCJ B;  3CO0 P;  2ZWP A;  2XTJ P;  3QFH A;  3GCW P;  2Z30 B;  1SPB P;  1ITP A;  2Z57 B;  2W2N P;  4NE9 C;  4OV6 A;  2W2Q P;  3CNQ P;  2Z2Y B;  3WIV A;  2PMW A;  2W2M P;  3VV2 B;  3A3P B;  3VHQ A;  4NMX A;  3T41 A;  3GCX P;  4K8R A;  2QTW A;  3BGO P;  2E1P A;  2Z58 B;  2Z2Z A;  4YN3 B;  1V5I B;  4JP8 A;  1R6V A;  3SQO P;  3A3N B;  3WIU A;  2Z56 B;  3AFG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...