1FESA

Solution structure of the apo form of the yeast metallochaperone, atx1
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
73
structure length
73
Chain Sequence
MAEIKHYQFNVVMTCSGCSGAVNKVLTKLEPDVSKIDISLEKQLVDVYTTLPYDFILEKIKKTGKEVRSGKQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the Cu(I) and apo forms of the yeast metallochaperone, Atx1.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Metal transport
molecule keywords ATX1 COPPER CHAPERONE
total genus 19
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2000-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1fesA00
1N5TA 1OQ6A 1MWYA 2HQIA 4HI1A 2RILA 2HIQA 1W2IA 3HDSA 5B08A 4F67A 3VTIA 1Q8BA 2VH7A 2FTRA 2OFHX 2BBEA 2GO8A 2XMKA 2ZDOA 4HH1A 2IYIA 1FD8A 1FESA 3HHLA 1P8GA 4EFAC 2OD6A 1TR0A 3HHLB 1XBWA 2KKHA 2XMTA 1FE4A 1N5SA 3FRYA 3LGNA 2XMJA 2LDIA 2AW0A 2BJDA 5T7LB 5T7LA 4A46A 1U7LA 1N5VA 2GCFA 3CJKA 1QUPA 2K7JA 1TL5A 4YEAA 1OPZA 3BDEA 3KKFA 1GXUA 5B0CA 2GFFA 1AFIA 1URRA 1OSDA 1Y3JA 3HHLD 2W4DA 2CRLA 4Y2IA 2GV1A 3WDOA 3DXSX 2HFOA 3IWLA 5F0WA 5B0DA 1Q8LA 2VV5A 2HFNA 1OQ3A 2W4CA 1S6OA 1VQYA 1YRXA 4YDXA 1MWZA 3BR8A 2IFXA 2KT2A 2QLXA 1FE0A 3HF5A 3QMQA 4HH0A 4FNIA 1GXTA 1SQEA 3DCAA 4FNHA 2JDJA 3HFKA 1TZ0A 4A47A 5B0AA 1CPZA 3KG1A 4ZA1A 3CJKB 2N7YA 5F0UA 1Y0HA 2KT3A 4OIXA 4OJ1A 2OD4A 3BM7A 3BGUA 3KNGA 1YG0A 4Q2LA 1CC7A 5KAKA 4HI2A 1YJRA 3HHLC 5B09A 2HLUA 4HL9A 2KYZA 1TL4A 1FVQA 2LQBA 3MCSA 1Y9OA 1YJTA 4DL0C 1SB6A 2GA7A 2OP5A 1Q53A 1FVSA 2AP6A 3IWXA 2ASYA 2OFGX 3F44A 4NPOA 4OJGA 3TNVA 1KVIA 4OJHA 2XMMA 1VQSA 2XMWA 2XMVA 2N4DA 1CC8A 1KQKA 3LGMA 1TUVA 3KG0A 3E8OA 2G9OA 3BF4A 2Q3PA 2LQ9A 4A48A 1KVJA 3K7RA 2RSQA 2OAUA 2GGPA 5IXUA 2FHMA 2GGPB 2RU9A 4ZOSA 1WD6A 2RMLA 2AJ1A 3FGVA 2L3MA 3GZ7A 1YJVA 3FMBA 1YJUA 1X7VA 4Y2MA 1Q4RA 1JK9B 1IUJA 2OMOA 1RJJA 3LO3A 5B0GA 2K7KA 2AJ0A 1R6YA 2PD1A 1AW0A 1V3ZA 5B0EA 4NL5A 2EW9A 4U9RA 1P6TA 2ROGA 2FB0A 4A4JA 5B0BA 5A6PA 2ACYA 2HLTA 1X0PA 2ROPA 1AFJA 1X8DA 2BJEA 2FIUA 5K9FA 5B0FA 2K1RB 2K2PA 2LXFA 2QYCA 4Y2KA 4QOTA 2K1RA 3TOQA 3BN7A 3T9NA 1N5QA 1LQ9A 5A6WA 1APSA 2ROEA 2ZDPA 4Q2MA 3TRGA 3MZIA 1Y3KA 3QGPA 1SI9A 3UDCA 2QLWA 3HX9A 1FEEA 3BB5A 2N4CA 2PGCA 1JWWA 2IYGA 2QIFA 4DN9A 4OJ3A 1ULRA 2BUNA 2XMUA 4DPOA 2W4PA 1S6UA 1K0VA 2BYCA 3I9ZA 2OKQA
chains in the Genus database with same CATH superfamily
2WBRA 4M5IA 1OQ6A 1MWYA 1VHFA 1S10A 2HQIA 3DGVA 3I5BA 3KG4A 1RQ0A 4IKAA 4P2FA 4ECTA 4RUCA 2CVIA 4L74A 4MYTA 3KNAA 1RTDA 2Y1JA 4F50A 2G1DA 3IRXB 3MR2A 2ZH7A 3HVTB 3IR6B 3I5CA 5ETRA 3UCGA 5HVGA 4JI5F 1RT2A 1WEZA 1ICEB 2GIFA 9RUBA 1AXQA 2GMLA 2XMTA 2LKZA 3DN9A 3FK4A 1KOHA 4O23A 3W60A 3M9OB 2AW0A 1S59A 1NCLA 1PG5B 4H4MA 4NYOA 2DNNA 5SZTA 2HHHJ 1HBMA 3M30B 2AF6A 2XSJB 3PFOA 2BA9A 3C16A 3DMJB 2AQ4A 4C9DA 3VGUA 3M6XA 2C3OA 2XYPB 5LMNJ 1F1BB 1ZETA 3TAQA 5IQ6A 2GJ2A 3R6LB 4YOEA 2E29A 3HLUA 3QLHA 4C8MA 1RCOB 4Y2IA 2KDOA 2YKMA 1V3RA 2Q79A 1JJCB 3KK1B 3MPYA 1RWVB 3I82A 3KLEB 4I67A 3ZNUA 3QWUA 3KJQB 2UXCJ 3SV3A 4KGKA 1S6QB 3HFKA 4HEA9 3MM5B 2RNEA 3N5FA 3EMTA 1VDHA 1X31C 3MWBA 1QDUB 2QG9B 5E3RA 4ECWA 4DV0F 3H5UA 3R27A 2KT3A 2PN6A 4CH0S 4OIXA 2ZNYA 1QSSA 3KNGA 4QYRA 4NXMJ 3BGFA 3Q2TC 3IG1A 1UWAA 1YJRA 3Q8SB 2MKYA 5LM7E 4Y0FA 3QZ8A 2B5JA 1B0TA 1VMBA 3H7HB 2DBBA 3MR7A 3TZWA 4X4SA 1R0AB 2UUCJ 5ITHA 1UW4A 3KK2B 3TUPA 5JUMA 2D41A 4DCOB 4OX8A 1CLFA 2EC0A 1EP4A 1NO8A 1MMLA 2AP6A 5ADZA 4WBFA 5LSLA 1UWBA 2XMMA 3MECB 2IRYA 3FQLA 2GO9A 4LF6F 2HAIA 3HSZA 4ED1A 4WXWA 4ES2A 2DPIA 5H9EK 4C4WA 2HVIA 5KFBA 4LF5J 2NSCA 2IJRA 3RRGA 1IR2A 2G2ZA 4MK8A 3TI0A 2XLJA 2J8SA 2E5HA 2MHNA 4ZVTB 3T6JA 3QZ7A 3BBFA 3D0HE 2X1AA 1NKEA 4O3RA 5EHHA 1Z4UA 5AXNA 4PUOA 4OHXA 1SIZA 1G6BA 2RU9A 2PDAA 3M1VB 3PM9A 4P2MA 3LTOA 5HI7A 2HZAA 1DQ8A 3BGOP 2KU7A 2VPYB 3CO9A 4NLOA 2VASA 4NASA 2OGUA 5AE2A 5EX0A 3IM9A 4IFVA 4PEOA 3ZTSA 5IM0B 3DC2A 3QPIA 4GRSA 4FS1A 1IUJA 3KLIB 5DDQC 1T02A 3J7Z5 1JQGA 1JLAB 1RJJA 3T1YJ 1X5OA 3PRVA 5HROB 1V3ZA 5DDPC 1HNWF 4QU7A 1C1CA 2ROGA 3UN5A 2R8KA 1MWQA 1B0VA 2VHGA 3FNNA 2F9JA 2F40A 5A8WB 2DEJA 2BJEA 1RADB 4P75A 4X4NA 1D1UA 4OLOA 2HPUA 2AJ4A 4WZQA 4K4TA 4RPFA 5E33A 4F3MA 4FXVA 3OR1B 1N5QA 3K58A 5A6WA 3W2WB 2NZ4A 1MROA 4NXNF 3HHDA 1UFKA 3LP1A 5ETMA 3M7VA 4NRTA 2XMAA 3RB6A 4IRDA 1U6ZA 1NEEA 2M4MA 3V4IA 5KFOA 4DN9A 2UUCF 2EBEA 3M8ZA 4DV1F 2XMUA 1S6UA 2AYBA 4NWBA 1UFWA 1PKUA 2OKQA 5LMUF 1FNOA 1LKZA 4IG3A 4IYQA 1U1RA 1VBXA 2YNHA 5KG4A 4A8KA 4DS4A 1I1GA 1TKDA 2GO8A 2DGOA 2ZOGA 5L1IA 1VRTB 3BKFA 4ED4A 1T94A 2HS0A 4ZIVA 5H1SV 3PR4A 3M9NB 1N5SA 1OYEA 5AE3A 1N36F 1RTIA 4JB8B 5KG0A 4I6AA 2LYVA 2HNDA 1NB2A 1REVA 2Q1LA 1H72C 2YX7A 4KGZB 1RHQB 4F4AA 1EIYB 4OZ3A 4E98A 1E6VA 4J7CA 3IBWA 2DB1A 4ZP7A 2FVSA 1FWPA 4PR6A 3MR3A 4I6YA 4LF6J 2YWGA 3CDBA 1P1TA 3EX7B 5E3PA 1R6VA 3JAMY 1GH8A 3EVMA 4PQUB 3NRBA 2KXHA 1Y3JA 2V2QA 4DUTA 1X5TA 2XNRA 2V50A 3NEKA 4ID8A 4N56A 1T3OA 3WDOA 4G1IA 3W61A 3HKZD 4LREA 1Q8LA 2RH3A 3FJ2A 2PIIA 4I64A 3PYDA 4YHHJ 4NI2B 4DU7A 3CSKA 1IBMJ 3KWMA 1FRLA 2IVYA 1YZ7A 4BHQA 4LSNB 4K4WA 2ABYA 4A8OA 2O3DA 4OYIA 3ZZYA 4C3MA 3M2UA 3TARA 2LP4A 4RKUC 2YKAA 3KYLA 3OJSA 2RQMA 2APOA 3HD2A 2IDEA 4F4XA 1T05A 4IOCQ 3TYTA 3TUJC 1SKRA 3N6MA 3BQ0A 1URNA 1I51B 4K0KJ 2LQ5A 3HM9A 2CNLB 1S4EA 4M5DA 2J6UA 2VOOA 1V5VA 1Z1ZA 1VC0A 4YS2A 3UR0A 1YJTA 2HHTA 4TY8B 4LJMA 3FBEA 2HIYA 2WCXA 3AQPA 1S57A 4RU2A 1RXOB 3KFWX 4JI6F 2MGZB 1AZSA 3R5BA 2OFGX 3F44A 1HA1A 4FYWB 4U7CA 4K4UA 1R3NA 2IMOA 4B3OB 4DG1A 1EKSA 1KQKA 3QGGA 2CWKA 2RHQB 4WFXA 2BV3A 2D9PA 5DETA 4NCBA 2ZBCA 3HK2A 3G71S 3QRPA 2OSQA 4K8RA 2LQ9A 4WFAQ 2IAJA 4DFJA 1WTBA 3J7YU 2IM1A 4K4XA 4RW6B 1GQEA 2G2OA 2GGPA 5LOQA 4ECQA 2F8HA 1XMOJ 3D9BA 4CM0A 3DKDA 2JLGA 4Y6IA 4FF2A 1YTYA 2AJ1A 1RUSA 5L1KA 2LXIA 2RF2B 4Q7AA 3D54A 3R7BB 4TXSA 4Y2MA 2M5YA 2A0FB 1WI8A 2RKIA 3FBBA 3MMCB 3VCDA 4WCEQ 4AYBD 3VAFA 3P3DA 3CCLS 3RG6A 4DV2F 4HHHA 1H73A 2FZKB 1R6YA 2L9DA 2V4JA 4C98A 4Q45A 4DR5J 1AW0A 2VG7A 1IQZA 4NL5A 4BDPA 2QSFA 2HMIA 1RTHB 2BKOA 1QJHA 4ED5A 1N54B 4MTPA 4CDIA 2W8KA 3F73A 2LLZA 1VRUA 1QE1B 3AA8A 1FEHA 3QATA 1VGYA 1VC5A 2QYCA 3DRPB 3LANA 3TZXA 5IQQA 1WUUA 1ZTWA 1M5PC 1S1WA 5D4LA 2YX4A 5GAGU 2YTCA 1Y3KA 3UDCA 5HLFB 1JIHA 3CMQA 4HT5A 4TLQA 2C2EA 2VF3A 2B56A 2VFRA 3DDNA 1ZA1B 3N6LA 1DURA 2Z0GA 2CVEA 4J37A 5C42A 4A8YA 1ULRA 4AQYJ 5IOLA 3U02A 4GVBA 4OHZA 3F0NA 4X4QA 3MDFA 5IC6B 4V19J 1B7FA 3JYTB 2EFQA 1U09A 4ZITA 5D3GA 3SQOP 3KLVA 2JLEA 2FTRA 3IWNC 1MG7A 4HH1A 3THPA 4IQXA 3E01B 3DOMA 2GW8A 4S0MA 1NJIT 1OY6A 1CBKA 3RGIA 1EX8A 3BSNA 1HR0J 2AT1B 2YNIA 2WTFA 1RI7A 2DNLA 4WIIA 2HHXA 1IM6A 1FERA 2RT3A 3DDKA 3PG9A 5AT1B 2MKKA 3FDSA 4A46A 2KM8C 4DSEA 3PKMA 2YNFB 2QC3A 5EWGA 3GONA 4LF9F 2WVDA 5KFFA 3C6TA 4FYYB 1U8SA 2XNQA 3I4HX 4NA1A 3C2PA 4MFBA 1SUQA 5G0RA 1TV6A 2NXCA 2UZAA 3FBFA 3PTWA 1ZM4A 3RBXA 2Y9HA 1TELA 2HHWA 1WHWA 4KKOB 2HHPA 3D6FB 4DV7J 4IO1A 5KFIA 3K0JA 2UV8A 3HHNB 4CIOA 4HH0A 3MFIA 4WYLA 4CYUA 1U24A 3QMQA 5A8RB 4TU7A 1QAIA 4DSJA 2W9CB 1NSAA 3POTB 2QFJA 4FN5A 4KR0B 2HVEA 3SFUA 3KG1A 5K8MA 4DV6J 1LW0B 4ZPVR 3PCOB 2VDHA 5KFGA 3MHYA 4PG4A 4EEYA 4J9RA 2CPJA 2MPUA 3QQCD 4YDDB 1IKXA 4OV6A 4WJBA 6FDRA 2FZGB 2NPIA 2UVRA 4OHYA 2CPHA 4DUYF 1TK0A 2XS2A 3D3BJ 2GZOA 1Q95G 3DHWC 4NLVA 3FBCA 5I3UB 4JV1A 2NPFA 2DRDA 4RBTA 1HNIB 4ZVSB 1NBEB 3V6KA 2D3O1 2M3DA 4QIWD 2P5VA 4ZP9A 4Z7CA 4YB1P 3G6XA 3SIPB 3IAS9 3IXQA 2ILYA 1D09B 4X65J 3PR5B 2W8LA 3RTVA 4C48A 1C0UA 3TNVA 1FCAA 2DK2A 3K5OA 2ZKUA 3GJSB 3MMBA 4I2QA 4DX7A 1RT7A 4USTA 1U2RA 4WFNQ 3MURP 4RUBA 4UOCA 1SKWA 3NWRA 3AAWB 4O4GA 1OYDA 1FX4A 3OUYA 1ZM9A 5KFHA 5A2QU 3HXMA 3L09A 4OYXA 4P7VA 4YMEA 4XIUA 5IC4B 3MAAA 4FF4A 4QPXA 4HKQA 1NSKL 3BR9A 2W2MP 1JXEA 2IBOA 3GSDA 4IQMA 2LEBA 1JNZB 1OY8A 2X1BA 2VG6B 4M63A 3BH7B 2DPJA 2CDQA 3IP0A 3MCOA 3BH6B 2M52A 2R7WA 2L3MA 3GP9A 3DFEA 3WC2A 3NGSA 1GXLA 3V6JA 4RW7A 2ALYB 2QO3A 3DOKB 4QU6A 3M6UA 3G6YA 4ECRA 1HW9A 2DNRA 2YKQA 4U96A 3RB0A 1REGX 2VFVA 3GMGA 3HSDA 2V4QA 1VQNS 3TW0A 5E2QA 2XY5A 4RX6A 2GAHC 4TQSA 4RW4A 1HPZB 2DO0A 1C1BB 4I0WA 1TQLA 2M2BA 5L8RC 3PX6A 1X8DA 5DZ7A 1R27B 3UDLA 5JVGQ 1TK5A 2HW3A 2RB7A 4QJVA 2NXUA 4MJKA 1ZZNA 5K8NA 3CCZA 5A0YB 5M2UA 2K1RB 1UAWA 2V94A 4I7FB 2B8QA 4IDKB 4NZ0A 2JL9A 4ZLPA 2VQEF 1R8AA 4ALZA 4CTAB 2LECA 2O67A 2I5JB 3J80Y 1LK5A 4OZNA 3C14B 2Z30B 1KONA 5JVHQ 4FS2A 2JSXA 4W4MA 3HJFA 4NLQA 2J9EA 2QZ8A 1IWGA 1VISA 3JTOA 4BLGA 4DSIA 3QJLA 1HNVA 3A8EA 2BUNA 1IKWB 3UN2A 3I9ZA 2V6AA 4M94A 2MQMA 4WTYA 4JI6J 1W2BR 1WG5A 1MU2A 1YJ7A 2RILA 3QFHA 3N79A 4F67A 1GNKA 5IT4A 3PYGA 5K8PA 5KFCA 1TFYA 4WE1B 1UZHA 1NNDA 2BANA 1NDLA 3AY0A 2GHPA 3DNCA 3DLKA 2DNMA 3OD2A 3Q8YA 4WU2A 3BREA 5CABA 4P73A 4RZRA 3JSMB 3B4DA 3BGRB 3E51A 1DAXA 3FRYA 4DL4A 4JI8J 4KHPF 1TKTA 3SCJE 1S6QA 1S1UB 1Q5VA 3AD8C 2HSEB 5T7LB 3SSSA 4XPEA 4O44A 1VFJA 1UVNA 3GV8B 4EU0A 1SIWB 1KDNA 2E1MC 3NS7B 1D0EA 2FY1A 1VCTA 4EZ6A 4K7QA 3QIDA 2GFFA 3CD0A 3DRYA 3UE2A 2XYGB 3TUIC 3CW2C 2HQFA 4TKTA 2Q66A 2XZTB 3BEGB 1N33F 5CCMA 1R0AA 1Y5NB 2IM0A 2AHOB 5E5NA 3AH6A 5KT2A 3K5NA 1ZAXA 1YBUA 1EAYC 1NHKL 2NXNA 2HGLA 3ETMA 3ISND 4OI2A 5AXMA 4EO8A 2ATLA 4YDXA 1YRXA 2QEXS 1KLMB 2HFUA 2EEYA 3M32B 2N3LA 3S6EA 3OL6A 1KR4A 4J9OA 4DPYA 2FJXA 3OLBA 2HWTA 2BOAA 1F9FA 4DQQA 3MUVP 1Q78A 1UP1A 3D67A 4H4MB 1RZMA 2H51B 2KRBA 1H7XA 4X64J 4ZA1A 4FXDA 2L48A 4LT6A 1IKYB 1LFWA 2RDIA 3CCUS 1WI6A 2XULA 1X0FA 1FNXH 5LMNF 4FF1A 3DXBA 1BLUA 2J5AA 4O3NA 3K57A 1T9UA 1A9NB 2QJ3A 1S12A 2ZM6F 3MMAA 4XDCA 1YQHA 5DLGA 1K1SA 5C24A 1R31A 1GMUA 1SJ3P 1TL4A 2ATCB 1FVQA 2ZOFA 2C2KB 4P71A 1ZPWX 1HHQA 4AFFA 2OJ3A 1SH3A 1JLAA 2LU1A 1S97A 1G4CA 3NBPA 1H6KX 2HBQB 5HROA 2HZVA 4JI5J 4DR1F 4Q8FA 2CKWA 1GK8A 4DF8A 4OQJA 4KIAA 4U7UK 4I4BA 4A8XA 3C3LA 2JHEA 2LFVA 5GAEI 1FXDA 2RS2A 1FK9A 1VI7A 2R3VA 4OZ1A 4ECUA 1FRHA 3K8VA 3IN5A 2J6SA 4P72A 1BQNA 2YVSA 1S0MA 4B9NA 1M5SA 3FQKA 1PYTA 2OAUA 1WEYA 3PXGa 4DPUA 2W9BA 2H1YA 1RBOB 4O4RA 4MKAA 3EZUA 4DOZA 3LP0B 5T14A 4TU8A 4DR2F 1HNZJ 5KT6A 3H42A 3MPVA 9ATCB 2MXYA 2WW8A 2ZBQA 1NK6A 3QBCA 3PO4A 2ZZNA 1TFWA 4LFBJ 2D1CA 2WB4A 2K3KA 3IR5B 4RNOA 4LUBA 4DZDA 3H5YA 2PD1A 1U2FA 3RYLA 3EUNA 1HARA 3KLGB 1CJUB 3SV4A 4PG6A 2HNZB 3GYGA 2PO4A 1FTRA 2YWFA 4O3OA 3K89A 4LF1A 1UL3A 4KT0C 1RTIB 2ZZMA 4QR0A 2DVIA 1T9YA 1XR5A 3CPWR 2CIMA 1REVB 2DITA 5EGYA 2H54B 5CYJA 1QVFR 1MW7A 2XS7A 3K5MA 1APSA 2A1BA 4G65A 1E6VB 1AUDA 5CYQA 3VAJA 3QT8A 2QLWA 5CYMB 4K2XA 3BB5A 1FRKA 3PRBA 2YH1A 1QAJA 4B9UA 2CJKA 3RBEA 1O51A 5KFSA 3Q22A 4I69A 5KG7A 1UVKA 5FDLB 3S01A 4USUA 5CH7B 4LFCJ 5L9NA 5KG6A 3R9LA 4R5PA 4LF4F 5B08A 1KSPA 1D3WA 2NZCA 4TNOA 4RO0A 2DNYA 2OTLS 2BQ3A 4KO0B 4KBIA 1XNRJ 1H2UX 3ZTPA 5F41A 1FA0A 2AIRB 3I56S 4QYZK 1JXLA 3LGNA 1C2PA 4USMA 2BJDA 3V6HA 2E9TA 4F0KA 2CJ9A 1S9EB 4N8NA 3OTCA 4CM2A 1F0XA 4DV0J 1CS4B 1PBAA 2G0CA 2DNHA 2KB2A 2JX2A 2RVJA 3CJTA 2ZC4A 3H20A 4LQ9A 4OZJA 4CWBA 3FSIA 2VBWA 4UF4A 4WP8A 4DN0A 2KFYA 3RAQA 1IJEB 1VRQC 3RRKA 4ZCMA 3QGIA 3Q8VA 2XHCA 1HQEB 3BBCA 3HHEA 2XI3A 1JKHA 4RLEA 1LWXA 1YJNS 2W4DA 4IG3B 1U47A 2OHDA 2KFNA 2YNHB 3ICLA 2LEPA 2O66A 1VQ8S 1TVRA 2BJ9A 2VKRA 1FNMA 3R5CA 2H4WB 1OQ3A 1UPMB 3Q0AA 2VONA 1S4FA 1MWZA 4DF4A 3G8SA 4DCPB 4FNIA 3KJNB 3OTOF 4B9LA 2O5DA 2YX1A 4B3OA 2HBZB 5B0AA 1TTHB 1T8EA 2WHOA 4NOHA 2Y8WA 4G1PA 1GTHA 2BX6A 3TAMB 3OV7A 5F0UA 2MQLA 4WK3A 2Q6BA 4NMXA 1CJVB 2B4PA 4PQAA 4DR1J 4IRKA 4RNHA 1P27B 4AL6A 5D0EA 4ZVFA 2W9AA 4PQUA 3IG1B 3CJ8A 2BE7D 3O1LA 3H40A 2RF2A 1RWOB 4X84A 4PG8A 2XB2D 2R2UA 1NK0A 1PGZA 3D28A 3R1LA 4NRUA 3T5KA 4AD6A 3TVKA 1UA1A 8RUCA 3CCJS 2IPOB 3OFHA 3US5A 3V2UC 4OJGA 2V67A 4NI2A 2FLLA 1RAHB 1HQUB 1ZBTA 2DGWA 1T0TV 2GQ2A 2JZ5A 5HK4A 3RJMB 3TANA 4LSNA 5DM6Q 3D0GE 4K0KF 1WC0A 2GAGC 2YPYA 3CJQA 2W24A 4U6PA 2PFFB 5KFNA 1CVJA 4ID5A 4ILRA 4NCAA 1RA7A 4PUOB 4MKBA 2M9KA 2MKSA 3LQVA 1XR6A 2CUYA 5KFRA 3EXCX 1VIOA 2EKYA 1N33J 4M5HA 2B3TB 2MLZA 2H9ZA 4EO6A 2ZD1B 1JNRB 3FRZA 4WU3A 4EYHB 2DR8A 4JI2F 2EWHA 1AZSB 2I6WA 1D9FA 1AB8A 1C1CB 1S1TB 1TKXB 2QL5B 3MGJA 3ZZOA 3MM8B 4QWCA 2B7CB 3FEZA 3CJRA 4HT7A 2XY6A 4H4OB 3HO1A 4P52A 2J9DE 1L3UA 2HQCA 3W5YA 4KHPJ 2G13A 5BR8F 1HMVA 1ZM2A 5ETPA 1SJFA 2FJEB 1DY3A 1RTJA 2OTJS 3T9NA 4X4OA 2QX0A 3TVZA 4C0BA 3CCMS 1UJ4A 2ZUAA 1BQMB 1RGVA 2JH3A 3R97A 5KT7A 1SI9A 2OPQB 1AUSL 4ZCKA 5KG5A 2RQCA 3HX9A 5DGBA 1QSLA 3C6TB 3GFHA 2AMCB 2L9NA 3BSOA 4DL2A 1KEKA 4P7TA 3MXHP 2W2OP 4MFBB 2UUBF 2RKIB 3CJ4A 2DIUA 3I0SB 3I31A 1TV6B 4LR9A 1RLCL 3UO0A 2R42A 3I32A 1CEZA 3KUGA 4M5MA 4QWAA 4ZJQA 1U1PA 3CD7A 3S7RA 3OVAA 1RTHA 1R7IA 4WXOA 4ER8A 1K0TA 4K2JA 2ZJPQ 1X5SA 2V8GA 1VRTA 3MR6A 1JJHA 1TR0A 1BY9A 2YQ0A 3PJ9A 4ECSA 3CD6S 4ANEA 4IH6A 1D9DA 2WBMA 4CNZA 4ZLNA 1F5CA 4HTJA 1X4HA 3DU5A 3UD5A 5F3ZA 2FY8A 3IBCB 2V8VA 4G3IA 2D74B 1U45A 4KSEB 1VLYA 3SCKE 4HYKA 2EXUA 1IM4A 2GNKA 3OQ2A 3PDNA 1IKXB 3GB0A 4YFUA 5H9FJ 2ZH5A 2F63A 2C28A 1WOSA 2CZVC 2AEMA 3PJXA 4WYWA 2AGOA 2OPRA 1OSDA 1RAAB 4Z37A 1TK8A 4KY3A 4RR5A 4UY8T 1HNWJ 1HNIA 1WOOA 3M2RA 4CLPA 5J2QB 1N32J 1UEVA 3HVAA 1NPKA 3DOMB 2NR0A 4NLGA 1HL6A 4B17A 1K9MT 3BR8A 4L72B 1X5PA 2CFXA 2FVCA 2QLXA 3L4BC 4Q44A 2D3OR 4K4YA 1GXTA 5L9XA 2HFSA 1QD1A 3MCMA 2ZHAA 4JI0F 1HI0P 2VD3A 2DNQA 1A6LA 4ZLJA 2YNFA 3MEGB 2N7YA 4DPWA 2ZJRQ 3MR5A 1LWFA 4MT1A 3PEHA 3W7BA 3TUZC 4RU9A 4MK9A 4DQPA 3NMRA 1IBCB 4CH1A 4ED7A 1VQ9S 5G0RB 3IR7B 4XDDA 3KK3A 4PG7A 5I3PA 2HGMA 4M5KA 4DUYJ 3IMQJ 3PW5A 2FZCB 2HLUA 1L3VA 4B3MF 2HK2A 4DV5F 3W2VA 1Y5LB 4FZVA 1WSRA 1L3KA 2BABA 3ISNC 1JLEA 3W8GA 3LP2B 2E7VA 1UZDA 4DV2J 2F8EX 1VHIA 3HULA 3IO1A 3H5SA 4NPOA 2RRAA 4O3SA 1CJTA 2BKNA 2P6TA 2OMLA 4RW4B 1KC8T 1JJ4A 3OJUA 1NPRA 2FLNA 1KVIA 3PHTA 2GIQA 4PXCA 4X4PA 1XC9A 3V6DB 2AJQA 2NUHA 2PMWA 1S72S 1SC6A 4MKVA 5J1EA 1LWEB 4XAKA 1RYRA 3ZXWA 5HO4A 5IXUA 2SXLA 1W25A 2GHVC 1V6HA 3SSQA 2QN6B 4ZVOB 5JMNA 1X4CA 3B82A 4MH8A 1NK9A 1ZAVA 2HK3A 4X2BA 2PE8A 2CQ1A 1Q4RA 1IKWA 2I9SA 2OMOA 2V9WA 4Q5VA 3MMCA 2DR5A 4XPCA 2CQHA 5DGAA 3QT7A 4R25A 1HQ2A 5B0EA 2EW9A 4NA3A 1GX5A 1WC6A 1NXIA 2I8EA 2BRLA 4UUWA 3VGVA 5A6PA 1DRZA 2HVHA 1BWVA 1HD1A 2A6MA 1RT7B 2QMXA 4UQGA 1IBKF 3THVA 3G82B 1MLAA 1CQNA 1J27A 2HEKA 3B54A 1AT1B 2Z58B 2Z8QA 3LGHA 3UWTA 4DV3J 5EUHA 3DLGA 3MM6B 3V5RA 1FJEB 2HVZA 2VFUA 3L7PA 2KJWA 3J7ZT 1Y00A 1GX6A 1WORA 3HZGA 3NP5A 4CLKA 4YUDA 2V5HG 3MEKA 4HTIA 5KT3A 1M1HA 1JWWA 1WHVA 1R0BG 2YWKA 3CDEA 5RUBA 2VPZB 3AQOA 3S1TA 1HWLA 2LVWA 3CWJA 4W92B 1S7HA 3QRQA 2C3YA 3EJMA 3NOGA 2ZM6J 3VZIA 5KTQA 4X62J 2BOPA 3CC4S 3WX8A 4U7UD 5C2CA 1T9TA 2MZQA 2UUAF 1U6BA 3UD3P 5D3GB 3GV5B 5D4PA 2HBYB 2XMKA 1FKAF 3CC7S 2JC0A 3CJ5A 1VQKS 1U0HA 1WWHA 1HFEL 2OD6A 3CVKA 3C19A 3HHLA 4EFAC 1NH8A 1B7YB 1XMBA 2KKHA 3AJ1A 5A0YA 4DX8H 2E1AA 5E41A 2ZWPA 5BXIA 2UVUA 1NRKA 4N47A 3V81B 3B6BA 2EC2A 3L3CA 4DFMA 2RS8A 1LWCA 1X4FA 2UV8G 2I5JA 1HBMB 3AB2B 3M30A 4NMLA 5HANA 1JLBB 1JLFB 3BKUA 4RNNA 2E5JA 3T1HJ 4K5RA 1KD1T 3ZZ0A 3HP6A 1QAYA 2AYGA 3RUBL 4J9VA 1UVJA 3DRSB 3ZZUA 1O6XA 1RHJB 4Z7YA 3ZTQA 1SXLA 2YXLA 1HNVB 4OV1A 1NJZA 2CDRB 1SKSA 3HKWA 2QV6A 3D6MB 3I4PA 3HHLD 3G9CA 1JMTA 2X3DA 5J2QA 1NSPA 1HW8A 2YKMB 3CCRS 2AU0A 3NKYA 2YKNB 3VHQA 1FHTA 3BO2A 3MF5A 5F8IA 4WE1A 1VQ7S 3GFXA 4HHUA 5IWAF 5U47A 1FWLA 4HR2A 1YVFA 4O3PA 1PAEX 4CYUB 5GAHU 5I4MA 3MEEB 3LWLA 2BDPA 4NEYA 5DO2A 2AKWB 5F9NA 1QSYA 3K5PA 1XNQJ 1RT4A 2FGOA 2R8HA 2CQBA 3KUHA 3NCQA 4DJBA 3KLFB 2EVZA 3VWSA 2HYIB 1E6YB 1N56A 3BGUA 4Q2LA 2BMBA 1FXLA 3D4JA 2C2OB 2V8PA 4DQSA 1RACB 1R8HA 4K59A 2XI2A 3CCVS 1KFSA 3G87A 2OPPA 2KM8B 5I3UA 3MCSA 3QJPA 2XG8A 3H8YA 4DL0C 1LXNA 2BJ8A 3QGHA 2CQIA 4C8ZA 4ZCLA 1FVSA 2HFZA 2FGCA 1BWEA 3M32A 4K50A 1SH2A 1HHSA 2IIHA 2GJIA 2C3PA 2CJQA 3B8HA 3EVWA 3MM7B 2CA9A 2A3JA 3QWPA 4TLRA 1DARA 1RWPB 2NS1B 1T9WA 5D78A 2DGSA 3RAMA 3VAMA 3PNIA 7FD1A 4DL7A 5DG7A 1S48A 1U6FA 4KRWA 1C4CA 2VDIA 4TN2A 4A48A 3ADAC 2FQQB 1RWNB 2YQ1A 4TQRA 3MAAB 3OHBA 1JLGA 4X4TA 1WJ9A 2CG4A 1P9QC 4ENOA 2J0QD 2Z4PA 5CYQB 2KL8A 3MMAB 2W2PP 4IFVB 4DHVA 3EYZA 2VOPA 1UCNA 2H5IB 2VB6A 2ADCA 2H5JB 5HSPA 4F4ZA 3QO9B 5HATA 4J9SA 4NLWA 4RNFA 3LWMA 1NHUA 4JI3J 2J9DA 4R5PB 4F3OA 1V5IB 4KHRA 2ZC3A 3J80U 1MN9A 2KI2A 3HHKA 5A8WA 1OPIA 7AT1B 2IHR1 4ELUA 4KO0A 3AD9C 3ULHA 5C25A 5I42B 4CLSA 2Q6CA 1RAGB 2LXFA 3KHGA 4UY85 1PJ5A 3OR1A 2VQEJ 2VG5A 1BQNB 2OELA 5KG3A 2BW7A 1RT6B 1RWWB 3M2VA 4WP9A 4CT9A 7FDRA 1K1QA 1S9EA 3MPUB 2KHCA 3QGPA 3TR5A 2W9BB 4FBUA 1KS2A 2YKPA 4KFBB 3LP0A 5C5JA 3JB9k 1ZA2B 2Y8YA 3C6UB 2UXCF 2HS3A 1PC5A 4DV1J 3A3NB 3DI6A 2NQPA 2E5IA 2OO4A 3Q83A 1HQEA 4IR1A 3PFEA 2YH0A 3QFWA 5BJRA 1XIQA 2FHJA 2MMYA 4JV0A 1Y4ZB 4GO5X 2NUUG 1SV5B 1DTQB 5B7WA 1BD6A 1CJUA 4ZP8A 3TX0A 3BJYA 5JXSA 2HNZA 3KHRA 2MTLA 4GC6A 5J2PA 1QVGR 4AXJA 2BANB 2EFVA 1N0VC 2LDYA 3GIJA 2ZITA 3R7NB 2XMJA 3BGRA 1QLNA 2W2NP 3CD5A 2VBXA 1TKTB 3O44A 1Q0NA 1S1UA 5T7LA 3DLBA 1N6QB 4CRJA 4O44B 1QUPA 2WRMA 1TL5A 1H38A 4PRFA 4ES1A 1SJRA 4QWBA 5AJ3F 1KWMA 5IS2A 3BDPA 3AA9A 4U67Q 3GV7B 2XWXA 3R2DJ 2DY1A 1URRA 1NDKA 5KFUA 4A8FA 1TKZA 3EVOA 4J9MA 3GCXP 4USIA 4WFBQ 4PXDA 2ZH4A 4LIRA 2FC8A 3DXSX 4ECYA 4DL6A 1KNZA 2YWHA 1WF2A 2YWWA 4F4KA 1VQYA 2BW2A 3P5TL 2BEFA 3GIRA 1H2TZ 1KLMA 2H4YB 1I94F 4OMFG 2G4BA 2WB1D 4WP3A 3I0RB 3FZ2A 5JJBA 2V63A 1CPZA 4FKYA 3HMJG 4USVA 1RYSA 4AUKA 1FO1A 4M5GA 5J2NB 4JV5F 4RWWA 5D0RA 4NXMF 2AZ1A 2J0SD 4ED2A 2DGTA 3D0IE 1HWKA 1T11A 3QIPB 3MEDB 2BJ1A 1RISA 2D3ZA 1J5EF 2ERRA 4B02A 4JYAJ 5HBMA 1UA0A 1LOUA 5ETQA 3RR7A 1Y9OA 4LFBF 2ZD1A 2MSTA 4DU8A 4NCGA 3MFHA 3RAXA 4OI6A 4DUZJ 3R5GA 2MGZA 2E5LJ 2IRUA 4K4VA 2ASYA 2QMUB 2GS8A 3FKBA 4TYAA 4KTQA 1TU0B 2CPXA 2V9KA 2CZ9A 1PYSB 2YKOA 4DG1B 1VQ5S 2HZCA 1IKVA 4IG0A 2Y0SD 5A8KA 3J81j 3FSYA 4W98A 1FJGF 3K8WA 2R7TA 1B64A 3R5AA 1BXNA 1OO0B 3TAMA 1R0CB 3ETOA 2FC9A 3IM8A 1WG4A 4JUZA 3QRRA 2KZZA 1JB0C 2RSQA 1T95A 5CD4A 3EZOA 4LF7J 4M95A 5ETKA 3D7SB 4PWDA 1Y5IB 4KYZA 5J2MB 2KZMA 4BC7A 1VQMS 1NHVA 2A10A 3BV8A 3OL9A 2Z2LA 4CLZA 2XGPA 2UP1A 2B4UA 2GVZA 4HDGA 3OSNA 4ZVEA 4OI4A 1U26A 1RU2A 3JSYA 3ONQA 2E5LF 2AWZA 4JI2J 2VG7B 2VKZG 2NCKL 2HNYB 3RB4A 2QE5A 4IR9A 2CJYB 3ENVA 2U1AA 3J7A1 1KQGB 1WF1A 4UUXA 4BS2A 4DR3J 1FKOA 2DNGA 3ITHB 3W63A 4B3TJ 4MYUA 3G86A 2LQ8A 4DXLA 4TYBA 3KMSA 1XWLA 3DRPA 2XZWA 2F5GA 2HFVA 3QT6A 1KOOA 3VVTA 4CLTA 4NXNJ 4B3SF 4Q2MA 4DS5A 1JJ2R 1FF2A 1FT8A 2D3UA 4OYOA 4PABA 2C2NA 2C42A 4KGVB 3C15A 2QTWA 3PW7A 2DRBA 5C42B 1HI1A 3SDEA 2V2VA 1K44A 2VQFF 2FJAB 3AOCA 2C22A 4DPOA 4ELVA 4USWA 3MM9A 3OT9A 4DV6F 2KTQA 4C11A 5FDLA 1DLOA 4DDFA 4L73A 4UT4A 4YR3A 5H9EJ 3UNYA 3M2RB 4OYMA 3WBZA 4NA2A 3D1OA 4OYWA 4OX9J 5FJ4A 3U1LA 4URSA 1EKRA 4IOBA 2F3JA 4O3QA 3W1YC 3KOAA 1LW2A 3SXLA 4PKDB 2IA0A 2R7QA 4LFCF 1HMVB 4IO9Q 1RHMB 4DZ6A 5IZHA 3HVWA 2CXEA 1J5OB 3D6TB 3I9V9 1IR1A 2MZ1A 1ZZFA 4F7VA 1BHNA 1KRPA 4DR7J 3FMWA 3CJKA 5IV4A 4GKJJ 2F9DA 2HG4A 1CS4A 1LWFB 2H65B 2J0XA 5D6GA 3ZTRA 4KQZA 4EZ9A 2RDJA 1B0PA 4ZVPB 1UPPA 3M8QB 2IC3A 1RKIA 3AJDA 3JQKA 3KK3B 1N8RT 1IBKJ 3H5XA 4R0JA 2XY7A 5KFAA 3KLHB 2B6AB 1NDPA 1VS3A 4LRBA 4ZPWR 2MQPA 2FJBB 3O5TB 1D8YA 1ZAWA 5KFWA 1HLWA 3OLAA 3PYFA 2MLXA 4EGLA 2GC8A 3R3TA 1M0SA 1U02A 3PHEA 5L46A 4K4SA 2W4CA 4IOAQ 1UKUA 3MPWA 3NGDA 1NLKL 2VBYA 3M6WA 4RW9A 1VYAA 3AHPA 1WKJA 4UW2A 4NLRA 4WPAA 5E3CA 3WX4A 1N88A 1P1LA 2VUGA 3OVSA 4DV4F 3DCAA 4C0HA 3VF0B 5BYQA 1B70B 4P2XA 3TJ9A 2XCAA 3QSYB 1K73T 4JI7F 4X62F 1ZTTA 1AYEA 1S77D 1T9VA 2MZJA 4LBIA 2EFPA 2ZBRA 3BM7A 1TL1B 2EG2A 4ZJOA 2V4RA 1QM9A 2FD2A 4J9PA 5E0OA 3W65A 1VK8A 2XO6A 3GILA 4GKKF 2IDLA 1XN9A 4X4RA 1RKJA 3W9JA 2PEBA 4F0MA 3HFVA 1U1OA 4O0IA 4KGXB 4C3KA 1HI8A 2GA7A 2R7OA 1Q53A 4ZPBA 1GFWB 2UVVA 1M5HA 2EK1A 2C1EB 3CC2S 1PCAA 4L3NA 1S49A 2JOQA 3OVBA 3MMBB 4I2QB 3N01A 4ZN1A 3LAMA 2MYFA 1HYSA 4Y00A 1ZYQA 1X60A 2N4DA 3DYAB 2KN4A 3M6VA 2DIVA 2P9EA 1Q7LB 3SSRA 3PRDA 4P74A 2V2ZA 4YY3J 3JTNA 2ADBA 4GKJF 1A7GE 4BC9A 2DNKA 5E3QA 1ZPVA 4ID5B 1KQSR 4IUFA 3QJJA 4AL5A 2MQQA 4A8QA 5IWAJ 5K14A 2UUTA 4X66J 2CQ3A 5CQGA 4ED8A 3M4XA 3LOUA 1LEOA 3LF0A 3ZZRA 2R7VA 1YJUA 3KDNA 2FLOA 3J7AN 3H2LA 1TMJA 4QW8A 1S79A 1M5VC 1ZH5A 3LP2A 1XJWB 1F9HA 3Q8UA 3R5DA 4FP9A 3AT1B 2QLFB 2JC1A 2R9LA 1Q86T 4CO4A 5FIIA 3EICA 3NY0A 3CF5Q 3E2EA 1LNQA 2ROPA 1S1TA 2DH8A 2H3EB 3LUYA 4XTTA 3MM8A 2IRXA 4C97A 2VQFJ 2COLA 2BKPA 2DGQA 4H4OA 1RBLA 3NAIA 3OXLA 2HBRB 1RHKB 1RDRA 4N8OA 4P2SA 4Y2KA 3CTRA 1LWEA 4OX6A 3WZ0A 1NB7A 2ASLA 1SBRA 5LJ3Y 3C14A 4ANDA 1JLQA 2P2CB 1UMJA 2B9EA 2ROEA 4HACB 2PMZD 5F8MA 1X9WA 2B4OA 1XNQF 1S1VA 3C46A 4ANCA 3A4TA 2MZSA 3DRSA 3JS9A 4XO0A 5GADI 3TO8A 4B3TF 1IJFB 1XMQJ 1S0NA 2QA1A 5F3TA 1FDNA 1RWMB 3X3UA 1PBUA 2J9CA 3BZQA 3I0SA 2FUG9 2IM2A 3KUEA 3SCLE 2YWEA 1BGXT 1FDAA 5HVHA 5GAEU 4Y2AA 2HVDA 2BQUA 2DYAA 3WHIA 3NMAA 3PY8A 1XK8A 1HIYA 2E7XA 2B7BB 2IYIA 3DLKB 1WC3A 4NE9C 4NEZA 5ETNA 3E3XA 3SCIE 4DMZA 4QWDA 4WFYA 1XBWA 1BQXA 2WW4A 3J7YI 1EETA 3UN3A 1RAJA 1NJWA 4DV4J 3N0VA 3HFZB 1M1GA 3R6GB 4LF5F 1VQ4S 3CNQP 3VAKA 4WF9Q 2XGQA 1TUGB 3GLJA 1EQMA 1HBNB 1NKCA 3J81U 3LA0A 2CG8A 3UVJB 1WG1A 2ASJA 4LF8F 1F6TA 1YKWA 3ENWA 2RDDA 2CPFA 3B4MA 4RJVA 1HWIA 1RT1A 5H9FK 1RT5B 1KKHA 3GTYX 4RWXA 2Y0BB 5DQGA 2GV1A 2G1HA 2P9CA 2FDNA 4QIVA 1F60B 3CJSA 3VALA 1YLXA 5DJBA 3QYYA 1F5AA 2C2MB 1ACMB 3CJ3A 2ZBPA 2FHJD 4LSLA 2HHHF 3RW6A 3X1LB 3L7OA 2C2DA 1PILA 4P6QA 2KH9A 2KT2A 4FYDA 4MIBA 4WTOB 2CQGA 3HT3A 4J9UE 4KAIA 4NYZA 2R2RA 3EXYA 4I6WA 4PAAA 3JXOA 4CLWA 1U25A 1UFLA 2OPSA 3FFIB 4GVLA 4RUHA 1IBLF 1NSQA 1JLBA 1JLFA 4RL1A 5DM7Q 3TP2A 2ZH3A 2PEHA 2XLKA 5DDOC 4LFAJ 2W7PA 2OD4A 3A8KA 1A0OB 4LF9J 4ZS6A 4OLPA 2I38A 1SVDA 2JWNA 4WWSA 4LMZA 5KAKA 3G4SS 3VQTA 3T5HA 5KFPA 4B3RF 1W7WA 2EFNA 3NS6A 2MKHA 2YKNA 3W2VB 3PW2A 3IFEA 4Z2XA 2Z2YB 3N28A 4F2SA 5EDWA 2F7VA 3ZNJ1 3R8YA 3H4DA 4OJHA 2AYEA 1CJTB 2MZRA 4UOGA 1XMOF 4EUVA 5CZVA 1PJ6A 2RJZA 2CNOB 3CUNA 4EMDA 2B8PA 2L08A 4F3QA 5D0HA 2QSWA 2QYGA 1MNEA 3UI3A 3V6DA 5A2QY 1HWUA 3DLHA 2VODA 1N32F 3CO0P 3MI7X 5K20B 1RABB 1E6YA 3V4MA 3M2VB 4CCHA 1FRJA 3VQSA 2CJXB 2X1FA 1WD6A 3ENAA 3EDQB 3CJ0A 1KQFB 3FGVA 2B9YA 3C6UA 3U1NA 3JAMU 1Q7YT 2ZFHA 2ZH6A 2DR7A 3DI6B 4J9QA 3NLCA 3KJVB 3BO3A 3FSXA 1B99A 2IBKA 2CPEA 5C2GA 1VBKA 3UPFA 1FFWB 2OSRA 3K59A 4J9KA 3W8PA 4DR4J 2RQ4A 3DRXA 4UOHA 3A1YG 4L3KA 2ACYA 1RAFB 3DOLA 3KDOA 4PPDA 2FIUA 2X7IA 3BBBA 4LR8A 4JI1F 4CO1A 5HP1A 2GHWA 4NLTA 1EHWA 2DH7A 4QOTA 4TY9A 3BN7A 3I6PA 3U1MA 6AT1B 2BJ7A 4DCJB 2VJVA 2HQDA 3ZO7A 3DLGB 2HURA 3MM6A 3NGUA 4ZVGA 1NAQA 4YN3B 3OL8A 2VIHA 4DUZF 3SQGA 1VQOS 5GAGI 1PSDA 2N3OA 5IT9U 4GMKA 1S5ZA 4QZVB 1HNXF 2K06A 4I2PB 4ELTA 2CQ4A 5IFMA 2NREA 3BS9A 3Q89A 2PC6A 5K5MA 3QO9A 3RB3A 2WAQD 3CCQS 4DV3F 1T03A 2B51A 2ASDA 4X65F 4ETZA 4HI1A 1FJ7A 3ILIA 1GMVA 4LF4J 2OI2A 3H59A 5I3QA 3AODA 1FD8A 5D4OA 2E5GA 4LF8J 2YBVA 3HVTA 3OHAA 4JV5J 1U0HB 1ELOA 3HHLB 1RT2B 3FC9A 5F8GA 2U2FA 2ZHBA 2ZUGA 1KFDA 4QR1A 2J7WA 2B9WA 5D0GA 3NOCA 3FUYA 2POKA 1FJGJ 1LWCB 3VVUA 4AT1B 2K7JA 2RHSB 4OZ5A 3EPIA 5J2NA 3BDEA 3VZHA 1AROP 2FHKA 3Q86A 1DTTA 4X4UA 2HWIA 4IFYB 4JBCA 5HQMA 1JLCB 3JSBA 4MK7A 2DCUB 2X51A 2DGUA 3QLHB 1GMWD 3FCHA 3MEDA 5BYRA 4E8UA 2XTJP 1S1XB 2W25A 2I2YA 1Q8KA 5KFTA 1YSJA 3D68A 5F8HA 1SV5A 2HFOA 3IWLA 1J5EJ 4DR6J 3C66A 4DR6F 1F5BA 3W3SA 4ZIWA 1RAIB 1R8BA 1RK8A 3KK1A 4K4ZA 3K17A 2O01C 4J5OA 4KB7A 4CI0B 4FF3A 2IFXA 1FE0A 1YJWS 3QT5A 2R2TA 3EGNA 3G6VA 1NKBA 5L1JA 4FNHA 2DNOA 1TZ0A 3MEEA 4A47A 1IKVB 1O0PA 3AXKA 2AJFE 4IG0B 5IV3A 2N82B 4JOUA 3A3OB 4G1QA 3T5JA 2LMIA 1CJVA 2JLFA 4LVOP 1RT4B 3VGSA 3W5ZA 2BQRA 1YGYA 2WSCC 3CCES 2E44A 2Q43A 4LF7F 4C6AA 4ES3A 1CC7A 3UR3C 2AYMA 2HRUA 2K3IA 2VFSA 2AZ3A 1TKZB 2YY3A 2Z2MA 3LW5C 4USJC 4R8UA 2LQBA 2OPPB 1T3NA 3IS9A 4LFAF 4LR7A 1PAUB 2CAJA 4PG5A 1S9GB 5KFZA 4OZ2A 3W9IA 1PJ7A 2FJVA 4ED6A 2QRRA 2WOMA 2WVFA 3GSIA 8AT1B 2WVCA 4ZLLA 1NJYA 5DZ6A 2MQOA 2XMVA 1SCJB 4NLSA 5M2RA 4XK8C 5CHCB 2DISA 5AXKA 3H2VE 2UXBJ 3WIVA 1GT8A 2G9OA 2DHSA 1KVJA 2DHAA 2QLBB 4NZ7A 5THWA 1HWJA 2CNKB 1JLGB 3OFEA 5L39A 4ZOSA 4DPXA 2VICA 2VBZA 2VC1A 3M1VA 3C15B 3TVYA 5LSRA 1M5KC 3I55S 4ZHRB 3BKTA 2V69A 1RTZA 3GZ7A 3QIPA 3ZZTA 1OWXA 2H5EA 4ZVHA 4KGMA 2IVFB 4ZK7M 4DQRA 1U49A 5HBMB 4OFZA 3GIKA 4FPRA 3LO3A 2L41A 1DFDA 2MB0B 3P49B 2FYXA 1RA6A 2ZOMA 3VGTA 2IA6A 3RW7A 3CEDA 2UUAJ 4Q0BB 4YB7A 1P6TA 3JQJA 2FB0A 5ETOA 1Q79A 3KJFB 1YRUA 2KRRA 1X0PA 2DD8S 2XQCA 3M05A 1FFSB 1NU4A 4RW8B 2R7XA 4DEZA 4GO7X 1XTZA 2E66A 1BUXA 3OW2R 1TL3B 3DM2B 4M5LA 4AXIA 2BJ3A 3BYRA 1SJ4P 4JI7J 3W2WA 2KJVA 1UJ6A 3MZIA 2OPQA 2QL7B 2ZE2A 4OYPA 4UZCA 1FRIA 4KC5A 4EBCA 1S6PA 3LH2S 2FHOB 4KFBA 3TEGA 5IT9Y 5HVFA 1X4BA 2DXEA 3NGKA 5ETTA 2QIFA 1N4LA 4JI8F 2R8JA 4B9VA 4EWTA 2HHQA 1IBMF 1LFPA 3M8QA 2KFZA 2GVZB 2M7SA 3TZZA 4AL7A 2MKCA 1YJ9S 4GC7A 3KLHA 5BR8J 1RT3B 4Y65A 4ZPAA 4ECZA 2W01A 2VH7A 4BWMA 1X9MA 1X4EA 1X4AA 4QIFA 5BYSA 2UU9F 5CCLA 1FKOB 3ITHA 4ZPCA 5J2PB 5E7OB 2RAQA 4C8LA 2IVMA 1FRXA 4OI1A 4CZCA 3GWCA 5FLXY 1CJKB 1KHWA 2MY8A 3M8YA 3DLEB 1X4DA 4LF2A 1N5VA 2GCFA 4IH5A 4NLYA 5LT5A 1Q82T 2HHSA 4YEAA 5HAOA 2L9WA 4P10A 3SDEB 1FKPB 1WC4A 2BRKA 1N5YA 4DV7F 4ECVA 4OYAA 1PO6A 2NLWA 5AXLA 2CJBA 1AFIA 2OPRB 3CB4A 3MM9B 3TJ8A 3UNGC 4X66F 8ATCB 4WKYA 1IXKA 3N9UC 3WC0A 1TL7B 5F0WA 3VV2B 5B0DA 3OSPA 2VFTA 2OH2A 4QWEA 3AXMA 3EGVA 3D1HA 3PW4A 1LV5A 2F4VJ 1RAEB 1HR0F 3GFYA 1RWXB 2RUGA 1SQEA 1WHYA 3NL0A 3NCPA 1OIAA 5HJXA 3O6QA 3PW0A 3N4WA 3SI8A 1C0TA 2MKIA 3CJKB 6FD1A 2CPDA 1VJWA 1Y0HA 5ETVA 4Q43A 3PIPQ 2KO1A 2EK6A 3CIMA 3NS5A 1U0SA 2PA3A 2MZTA 3PKYA 4KPYA 4OI3A 2IC3B 4CO0A 2CPZA 4L76A 5KT4A 2B6AA 4CP5A 3QAUA 1NJXA 3DLLQ 2LCWA 2MQNA 4LSZB 5L1LA 2GVDA 1FI4A 5G4DA 2AGPA 3BPDA 1NZ8A 1IWAA 3MD3A 1SB6A 3I96A 3L7UA 4LBPA 2EBGA 1FRMA 2IJFA 3JTPA 4WIQA 5KFJA 1U1QA 3H90A 2HQ3A 2O1PA 5HQ8A 3SBMA 5F9LA 1UEKA 2MJUA 3AD7C 1XQIA 2R8GA 3F56A 2PFDA 2VZ9A 3TX8A 2QT7A 4DR2J 1S0OA 5CXTA 2DGVA 2HAFA 3TAPA 1HNZF 1XERA 2A2CA 4X64F 1NMEB 1S99A 3CE8A 3E8OA 3TA1A 3VAGA 3DLJA 3EM1A 3HSGA 2V8DA 2CQ2A 3EGWB 3RU0A 2XM3A 1NZAA 4OZ0A 4USHA 3PX0A 1FDDA 4ED0A 2GGPB 1RAOA 5DG9A 5KFVA 5J2MA 4ERDA 3G6ES 2CPYA 3VAIA 3FMBA 2XSFA 4A8MP 2MY7A 2XCPA 1U4BA 1WC1A 3BSAA 4EBDA 3ET6B 2UXBF 3M8PB 3L9ZA 2JFDA 2K7KA 5EWFA 1PIEA 4DR7F 1S0VA 2M8HA 1TMMA 2J7UA 2DHXA 2P9GA 2V4JB 3HSJA 4A4JA 1L3TA 5SUHA 2EG1A 3AFGA 1OS5A 2UUBJ 2FVPA 3G82A 2AX1A 1DJ0A 5K9FA 2M70A 3RRHA 1DBDA 3T3FA 1DHMA 5E3AA 2NXJA 5M2PA 3OXGA 3M9MB 5DG8A 2JVOA 4QYZJ 3HD1A 4TU9A 2ZDPA 3HJVA 3F41A 2BM0A 2MJNA 4DBQA 4F36A 4E2FB 3M8RA 2FVRA 3PO5A 1FFGB 1FEEA 1YK9A 2DJWA 4PWUA 5KFDA 1K47A 2GIRA 5J1PA 1H0HB 2BE2B 1SC3B 3O2IA 1B4SA 1Q1KA 2AV5A 3UD4P 2EFGA 2JNJA 1RT5A 2Z57B 4EBEA 1UJ5A 2CQDA 1DLOB 1OSCA 1W2IA 3DRRA 3HDSA 4ZVRB 1TUWA 1RTDB 1FJCA 2OFHX 4NLDA 2KVIA 2W1BA 2Y1LB 3GJTB 1FESA 2P6SA 3EPGA 1P8GA 2OEJA 5GVQA 4M1KA 2E7WA 1NUEA 3THTA 1LW2B 3BYPA 3W62A 1T9XA 3V81A 3Q2SC 1U1KA 2VA2A 2YNIB 1N5YB 4U95A 1HBUB 1JLQB 1UVIA 1EJ7L 3MPDA 2XSJA 4BWJA 2VJUA 4OHVA 1S1VB 1WHXA 2ZKTA 4OHWA 3GG0A 5KFYA 5A76A 5KFEA 2KG0A 4YHHF 2QLJB 3LALA 4CT8A 2DNZA 3GQCA 1VBZA 1RP5A 1YX2A 3OTDA 3DGPA 2IY5B 4JI1J 1AA1B 4YB5A 3T19A 4ILMA 3BN4A 3T9ZA 2KT5A 2JEIA 2DNPA 1GTEA 4FDFA 5GAHI 5T41A 1Y11A 2HFNA 3ISZA 1RCXB 1VLOA 2FLPA 5HL7Q 1H98A 4B3MJ 1EQ0A 3KLEA 3CDAA 4Y34A 3SFGA 4QCLA 3OR2B 3OPKA 4RW9B 1N34J 1VQLS 1SL1A 3MM5A 2VPXB 4LRAA 4OZLA 3PJWA 5HN0A 5CAAA 1CSJA 3BQ1A 2H48B 2PA8D 3W66A 4YQWA 1VOMA 3KLFA 1G1XA 4ICLA 3Q8RB 2KVQE 3LAKA 3KTQA 4OJ1A 1VBYA 2EI5A 2V34A 3ZZPA 2MKJA 1DQAA 3UVJA 1F9EB 5MAOA 4ZDNA 2ZH1A 3SYZA 5GMEA 3HI9A 3UDVA 1RE1B 3HHLC 2B5JB 3AOAA 3HT0A 3OTOJ 5HMXA 4ZVUB 4HL9A 1UVMA 2ZZTA 2HRTA 2BXJA 3KJVA 3B78A 4MMOA 3GYNA 4OX9F 1VC6A 1G2EA 4K5SA 1Z2ZA 4JV2A 4Q8EA 4QPTA 3ENQA 2IMWP 2V8HA 2LA4A 2UXDF 3VAHA 3MM7A 4DWIA 5A8KB 1C0UB 4DR4F 2PT0A 3OBIA 4PWWA 4LIWA 4J9LA 4DV5J 4CO2A 4UZBA 4DL3A 2LXUA 5LXRA 4LRFA 2RUSA 1IR0A 5EX3A 2MDAA 2QA4G 2PSZA 3G8QA 4YB6A 4B3SJ 3T1YF 3S8SA 1HBOB 3NGTA 3UW1A 2KG1A 4J9NA 3R7SB 4ILLA 3SQGB 2XO7A 1Q81T 2HRYA 1XR7A 2C2RA 2F8MA 2RMLA 3R1HA 2YNGA 2ZWOA 1X4GA 2LU2A 3OFFA 1X7VA 4DR3F 3BQ2A 2XS5A 5F8JA 2CJAA 2QL9B 4KV8B 1CULA 2CZ4A 4KHMA 5B0GA 1T03B 3CCSS 1FDBA 1P9YA 4KJIA 2DTJA 4C2MA 1GEHA 1YDLA 1U1NA 2UU9J 2NYHA 1C1BA 5C25B 1Q16B 5I42A 3DDIA 2CWXA 1EZZB 1QY7A 1WELA 3CCWA 3NWGA 4NLUA 4KH1B 3IC1A 4V1Ak 1SC1B 2K2PA 5B0FA 4EI2A 2J76E 2VG5B 2K1RA 4NX9A 2NSBA 2P8IA 2F65A 4IDKA 2XWYA 4Y3CA 5DLFA 1G3OA 1RT6A 4UTGA 4CTAA 1F2GA 2B4VA 1KLNA 4HACA 3CT9A 4URQU 4DSLA 4DLEA 4N76A 1NPPA 1DTTB 3OL7A 4DPTA 1YBAA 3OFGA 3CMAS 2IYGA 3P96A 2EPIA 1JLCA 2FPHX 3D3CJ 5DS7A 5KG1A 2VU5A 4C8KA 1K0VA 3TEHB 2M88A 2Y1RI 3ZC4A 3HPOA 2ZVIA 2DGXA 2WONB 1DTQA 3FCWA 4ZMMA 3A13A 3VTIA 4P9SA 3GIMA 4IH7A 4DFKA 3RBDA 1WC5A 2ZDOA 4UOFA 2K8GA 3KMQA 4URGA 3PIOQ 3MD1A 3T6BA 1UEUA 3JSMA 1FE4A 1OY9A 4CQ1A 1EETB 2LDIA 2HNDB 2WSEC 3QNWB 2M0GB 5D4NA 5KOWA 5DQHA 1KTVA 4ZP6A 2G0IA 1RBAA 3IGVA 4BCAA 1N6QA 1RWUA 3CCTA 3GFZA 4B9SA 2AJ2A 4FBTA 3ILJA 2DH9A 1HBNA 1WKLA 3ZTOA 1GXUA 1WNEA 5B0CA 2W7AA 1YZ6A 3KXDA 1J2VA 2DY9A 4I2PA 1KVKA 3IRWP 2GX8A 2UVWA 5KFXA 1PC4A 4ATNA 3PVXA 1EARA 1I3OB 1I94J 4G6VB 3N6NA 2JVRA 1NK8A 3GPAA 3R2CJ 4WKRA 4R8UB 1TAQA 3IS9B 2HQGA 2WK4A 2LEAA 2ZHOA 2ZNZA 2VV5A 5CZXA 2CQPA 4WFZA 2ALZA 3UCUP 2QMWA 3IRXA 4LSLB 4F25A 1S6OA 1S9FA 5KFLA 3A8IA 3IGNA 1NK5A 1UWBB 3HF5A 3MECA 3I0RA 4DX5A 3D2WA 3Q8QB 1YIJS 2JDJA 2CYYA 3D5MA 1HKAA 1JX4A 1RWKB 2J0WA 5LJ5Y 4GKKJ 3MTJA 2UUWA 3TWZA 2ZBIA 4PYDA 4PXBA 3EGZA 3C16B 3DMJA 5GMDA 4D3HA 2OEMA 2RE1A 1N34F 2XLIA 5HMWA 4IFYA 3WQPA 3GCWP 2OIHA 1R43A 2XEXA 2IJNA 5KFKA 4YP3A 2I0XA 5C24B 3FVYA 1S1XA 5IM0A 4IRCA 1V9OA 1X9SA 3KLIA 5FLXU 4NCGB 1T7PA 3T41A 3TA2A 2BACA 1FXRA 3GG1A 4OL8A 3EE3A 1F2HA 4DR5F 4F8RA 1UW9A 1F3FA 1QUVA 2JFKA 3NBPB 4DQIA 4Q0BA 3MCNA 3W9HA 5LXYA 5DRKA 3PZPA 1VQSA 3AJ2A 2XMWA 1H2VZ 2R4FA 2V0NA 4RW8A 2E1PA 4YR2A 1CC8A 3EWGA 3NG8A 1M5OC 2GJFA 3LGMA 1N0UA 4N77A 4CLYA 3BO4A 4QW9A 3KG0A 1BE4A 4G1QB 2D9OA 3BF4A 3G8TA 1M90T 3SZ2A 4D3GA 2Q3PA 4FVMA 2J8AA 4ZVQB 2CQCA 3K7RA 1MROB 1N52B 4E0DA 3PACA 1RLDA 1EB0A 3HZEA 3LP1B 4PWDB 3OTBA 2HGNA 1JXVA 2BE9B 4LRDA 1S6PB 4DX6A 1KTQA 2E1RA 2I1RA 4L6V3 4NLPA 3K5LA 4B9TA 3NCRA 4YY3F 3D1QA 1JK9B 2C2ZB 3KK2A 1WDDA 3RZAA 4M8LA 1UTAA 1S9GA 2AJ0A 2HNYA 2Y1IA 1M1KT 2R7UA 2ZH2A 1K8AT 3MUTP 1EP4B 2C3MA 4L75A 2WOMB 1WTFA 3AB4B 4USKA 5B0BA 3KLGA 2GMHA 1AFJA 1VRUB 4DL5A 4I56A 4ZCIA 2GQCA 4DSFA 2PI4A 4WZMA 3DU6A 4ITSA 3PEJA 4NZ6A 5GMKa 5F8LA 2JEGA 3CGIA 4M5JA 1H3DA 4AQYF 2RU3A 4JI0J 2DT9A 2RRNA 3DLEA 1FTCA 3ZZZA 3TRGA 1WKKA 5HLFA 2VL1A 2GQQA 2B9XA 2Z2ZA 5CYMA 2N4CA 3OTEA 2PGCA 4ZHRA 2HWHA 4BBYA 2R7RA 3RR8A 4OJ3A 4B9MA 1HHTP 2W4PA 2JEJA 4C11B 3HCXA 4ZN3A 1WF0A 4CLLA 4LQ3A 1SQFA 4DFPA 2ZVSA 1TL7A 1Q8BA 1Q8IA 5D8HB 2KXFA 4QIEA 3E01A 4FYVB 1DZ5A 1NH7A 2E1CA 1CG2A 1R8PA 3CDUA 3TJAA 2DO4A 4YR0A 3H98A 5HMZA 4N7TA 1J5OA 1TL3A 2JRSA 2AEFA 3DM2A 4FYXB 1MN7A 3UDEA 1UVLA 4OX7A 3NNHA 1U7LA 1C0TB 3GR1A 3M2UB 4W90B 2ZEJA 1Z2LA 2ZE2B 3MOZA 4RBUA 1U1LA 4LBHA 4JI4F 3KKFA 4QBUA 4MIWA 1Y7PA 2XHWA 4ZJLA 3V4IB 2NXEA 1NK7A 2C3UA 3NNCA 1ZM3A 1T05B 3UFCX 3CIZA 3I87A 4EYIB 4DSKA 1KP6A 3MMJA 4ZPDA 4UQTA 2OLWA 3VR1A 1O8BA 1JKHB 4M5DB 4F04B 1RT3A 2HHUA 2DHHA 1WSVA 2RIJA 2RD5C 4FVCA 2AD9A 3FEYB 1TVRB 2CNNB 4EK2A 3LPYA 5AJ3J 5D15A 4LRCA 5A8RA 4B08A 2AX0A 1F3VA 4X4VA 3TZYA 2W9CA 4C8OA 2ZJQQ 3ELHA 3KHLA 2E9ZA 3FEXB 4TVAB 2A18A 1SC4B 1PYOB 3GJRB 5EN1A 4F4WA 1YITS 4CO5A 2BR0A 4JI4J 1OMSA 3K2YA 2FVQA 4OI0A 4B3RJ 1NM2A 3T1HF 2IAJB 3HVRA 1TL1A 2ACMA 4RW6A 1RHRB 1FKPA 3A8JA 4ZKAA 1YG0A 5ETLA 4RBVA 1SL2A 4RNMA 1L5UA 4I1TA 3NGRA 4HI2A 3BGLA 2HHVA 3EDRB 1BC6A 3I5AA 2J6TA 2HKEA 2KYZA 2DRAA 1V3SA 1IBLJ 1I5OB 3ET6A 2A2DA 2EFOA 3GYXB 3G96A 1C4AA 1RB0A 5DQIA 3M8SA 3CMES 3DHXA 3TQEA 1MMDA 3ILOA 1RHUB 1Y10A 3FCVA 1HYSB 2HMIB 1ZOTA 2MLYA 1HQUA 3MTKA 4JYAF 1IVZA 3DYAA 2WVEA 3NNAA 2G0JA 4O4GB 1H74A 4OYBA 3O3LA 2F4FA 5IT0A 4F26A 3OUYB 3R5JB 2LA6A 1U1MA 1KBRA 1G7CB 4JI3F 2W2QP 1ITPA 1FWKA 2J7KA 1KHVA 4U8VA 1L3SA 1TAUA 5K14B 2FHMA 2AEJA 3ILLA 5FD1A 1VQ6S 2UXDJ 2V68A 4N5SA 4Y28C 1NDCA 3MAQA 4O0NA 2CQ0A 2PI5A 2BVZA 1ROFA 1FD2A 5K8OA 4GVBB 4TY8A 2MEWA 4DI6A 1MSWD 2QGFB 3DRRB 1SJQA 3SEOA 2XZDB 1HPZA 2VC0A 3P5BP 4J90A 3GR0A 3A3PB 4U9RA 1FX2A 4OYZA 3MUMP 2HLTA 2G2YA 1VIXA 3U27A 1TKXA 3KHHA 2R8IA 2M8DB 1XEZA 1DQ9A 2KYXA 2EKNA 2PMHA 3P45B 4NYPA 4PYAA 5HJYA 3ZFVA 4I7FA 1HNXJ 4J91A 4H4KA 2MQ8A 4H4KC 2IM3A 1R89A 4PPZA 5LMUJ 1RTJB 3TQ1A 3T1AA 1YWXA 1HBUA 3AOBA 3N5BA 4RUAA 2CADA 5KOXA 3MOJB 3LPEA 1BQMA 1ZS6A 3GJQB 4HDHA 5LSOA 1IN0A 2QA2A 4A8WA 3H2UB 2JJ4D 3IAM9 2FJWA 1S7IA 2BYCA 2YQ3A 3M8PA 1LXJA 4PZVA 5DDRC 1N5TA 4V19X 2HIQA 4HLBA 4C8NA 1KN6A 1LK7A 3CDWA 5L38A 1SH0A 2BBEA 2F1FA 4KKOA 5CD4H 1IQTA 4LVNP 3PYEA 1QE1A 3Q24A 2ILZA 1VR6A 3CULA 2D7SA 3OR2A 4PXEA 4CH7A 5KG2A 1OJ4A 1RU1A 3Q23A 2BM1A 3W64A 1D8ZA 1YRTA 1CJKA 4F2RA 1S1WB 1LW0A 1WDTA 2WSFC 4JP8A 3IA0A 4PCQA 2BZ2A 1OPZA 4U8YA 3D6HB 4CNYA 1VK3A 2XC9A 3H4BA 3EZ5A 1QTMA 4Y2CA 4F02A 5CA5A 2BE2A 1XNRF 4CO3A 1UETA 2QFIA 1RT1B 3TA0A 4AE5A 1R8CA 2RQKA 4A8SA 1HD0A 2CRLA 5KT5A 3JYTA 2DXDA 3MAHA 4FXWA 3SMZA 2Z56B 3BSCA 2HS4A 1SQGA 2R2SA 2WZ1A 4NLXA 4ETXA 2QA4S 2DCLA 4C0OC 5EWEA 5F8NA 4KPCA 2DR6A 2R7SA 1SJ1A 2OPSB 3FFIA 3IBFB 4ECXA 3M8WA 2GMJA 2Y3YA 2ZH9A 4I68A 3U7JA 1IKYA 5C7PA 2RRBA 3T5LA 2FJDB 3MEGA 4KH0B 3BPSP 2DKOB 3WIUA 3P8BB 2N7CA 3J81Y 4M5NA 2X3GA 2VG6A 3DGPB 3GE9A 5KFMA 3GIIA 1SUQB 1YI2S 2YNGB 4DLGA 3W5XA 5B09A 2VPWB 4RW7B 2D69A 3DOKA 5AE1A 1SPBP 3CXCR 1NK4A 2GVDB 1CULB 1WACA 3P4UB 1N36J 2VA3A 4MKYA 1SKUB 1JLEB 2OP5A 3O8WA 2DHGA 4H54A 3UQSA 3IWXA 1B3TA 3FZBA 4FKXA 1SL0A 1GMWA 2OUGA 5MLCV 4ED3A 3JSRA 3POTA 1FK9B 2MHEA 2YPZA 2KXNB 1U2CA 1YBTA 3JQMA 4F4YA 5LL6d 1TUVA 2B43A 3PX4A 4C3LA 4N41A 2MSSA 3C8YA 3QSIA 1D9AA 4ICLB 5J1EB 5ETSA 3UCZP 1N48A 1I6JA 2LQJA 2DXFA 3OXFA 4KE5A 5D77A 2E9RX 4ZPTR 4HVZA 5HMYA 1BMQB 2DEIA 1YJVA 5KFQA 2XBPA 1W26A 4F0HA 2NYIA 4MAKA 3RBZA 1QAXA 5HQLA 1RSCA 2WONA 2V2KA 1U8WA 1MU2B 2XYHB 4FPIA 5J1NA 4CLFA 2CPIA 4CLUA 5GADU 3H25A 1QTNB 1U48A 2W7OA 3DOLB 2AGQA 3L95X 2B0GA 1H7WA 1GAOA 1VQPS 1XMQF 1MMNA 3D66A 3NAHA 5HP1B 2A6OA 4HHJA 2JEFA 4QQBA 3GU0A 1VJQA 3TOQA 3Q8PB 3A12A 2KHDA 1LQ9A 1Q5YA 3CJ2A 4QIGA 3QAEA 1YHQS 1WOPA 1HBOA 3PV8A 1O5JA 2ZH8A 4R0EA 1CQMA 1TP7A 4QR2A 4WK1A 2OEKA 4MIAA 2F4VF 4C7QA 4C8YA 1S76D 3P6YC 3G2XA 2WVBA 2DR9A 3NXZA 4KV8A 1WEXA 2X1GA 3H0PA
chains in the Genus database with same CATH topology
2WBRA 1OQ6A 1MWYA 1VHFA 1S10A 2HQIA 3I5BA 3KG4A 4IKAA 1RQ0A 4ECTA 4RUCA 2CVIA 4MYTA 3KNAA 1RTDA 2Y1JA 4F50A 2G1DA 3IRXB 3MR2A 2ZH7A 3HVTB 3IR6B 3I5CA 3UCGA 1NK8A 4JI5F 1RT2A 1WEZA 1AXQA 2GMLA 2XMTA 2LKZA 3DN9A 4O23A 1KOHA 3M9OB 2AW0A 4H4MA 4NYOA 2DNNA 5SZTA 1HBMA 3M30B 2AF6A 2XSJB 3PFOA 2BA9A 3DMJB 4C9DA 2AQ4A 3M6XA 2C3OA 1ZETA 3TAQA 5IQ6A 2GJ2A 4YOEA 2E29A 3HLUA 3QLHA 4C8MA 4Y2IA 2KDOA 2YKMA 1V3RA 2Q79A 3KK1B 3MPYA 3I82A 3KLEB 4I67A 3QWUA 3SV3A 4KGKA 1S6QB 3HFKA 4HEA9 3MM5B 2RNEA 3N5FA 3MWBA 4ECWA 5E3RA 4DV0F 3H5UA 3R27A 2KT3A 2PN6A 4CH0S 4OIXA 2ZNYA 1QSSA 3KNGA 3BGFA 3Q2TC 3IG1A 1YJRA 3Q8SB 4Y0FA 3QZ8A 2B5JA 1B0TA 1VMBA 1R0AB 2DBBA 4X4SA 3MOJB 5ITHA 1UW4A 3KK2B 5JUMA 2D41A 4OX8A 1CLFA 1EP4A 1NO8A 1MMLA 2AP6A 5ADZA 5LSLA 1UWBA 2XMMA 3MECB 2IRYA 3FQLA 2GO9A 4LF6F 2HAIA 4ED1A 2DPIA 4WXWA 4ES2A 2HVIA 5KFBA 2NSCA 3RRGA 4MK8A 3TI0A 2XLJA 2E5HA 2MHNA 3QZ7A 3T6JA 2X1AA 3D0HE 4O3RA 5EHHA 1Z4UA 5AXNA 4PUOA 4OHXA 1SIZA 1G6BA 2RU9A 2PDAA 3M1VB 3PM9A 5HI7A 1DQ8A 2KU7A 2VPYB 3CO9A 4NLOA 2VASA 5AE2A 5EX0A 4IFVA 4FS1A 5IM0B 3QJJA 3DC2A 3QPIA 1IUJA 3KLIB 5DDQC 1T02A 3J7Z5 1JLAB 1RJJA 1X5OA 5HROB 1V3ZA 5DDPC 1HNWF 4QU7A 1C1CA 2ROGA 2R8KA 1B0VA 3FNNA 2F9JA 2F40A 5A8WB 2BJEA 4X4NA 1D1UA 4OLOA 2HPUA 2AJ4A 4WZQA 4K4TA 5E33A 4F3MA 4FXVA 3OR1B 1N5QA 3K58A 5A6WA 3W2WB 2NZ4A 1MROA 4NXNF 3HHDA 3LP1A 3RB6A 4NRTA 1U6ZA 1NEEA 2M4MA 3V4IA 5KFOA 4DN9A 2UUCF 2EBEA 4DV1F 2XMUA 1S6UA 2AYBA 4NWBA 1UFWA 5LMUF 2OKQA 1VBXA 1FNOA 1LKZA 4IG3A 4IYQA 1U1RA 2YNHA 5KG4A 4A8KA 1I1GA 1TKDA 2GO8A 2DGOA 2ZOGA 5L1IA 1VRTB 3PR4A 1T94A 2HS0A 5H1SV 3M9NB 1N5SA 5AE3A 1RTIA 5KG0A 4I6AA 2LYVA 2HNDA 1REVA 2Q1LA 2YX7A 4E98A 1E6VA 3IBWA 2DB1A 4ZP7A 2FVSA 4PR6A 3MR3A 4I6YA 2YWGA 3CDBA 1P1TA 3EX7B 5E3PA 3JAMY 1GH8A 4PQUB 3NRBA 2KXHA 1Y3JA 1X5TA 2XNRA 4ID8A 4N56A 1T3OA 3WDOA 4G1IA 3HKZD 1Q8LA 2RH3A 3FJ2A 2PIIA 4I64A 3CSKA 3KWMA 1FRLA 2IVYA 4BHQA 4LSNB 4K4WA 2ABYA 4A8OA 2O3DA 3ZZYA 4C3MA 3M2UA 4RKUC 2YKAA 3KYLA 3OJSA 2RQMA 2APOA 4F4XA 1T05A 4IOCQ 3TYTA 3TUJC 1SKRA 3N6MA 3BQ0A 1URNA 2LQ5A 3HM9A 4M5DA 2J6UA 2VOOA 1Z1ZA 1VC0A 3UR0A 1YJTA 2HHTA 4TY8B 4LJMA 2WCXA 3AQPA 4RU2A 3KFWX 4JI6F 2MGZB 3R5BA 2OFGX 3F44A 1HA1A 4K4UA 4U7CA 1R3NA 2IMOA 4B3OB 4DG1A 1KQKA 3QGGA 4WFXA 2BV3A 2D9PA 5DETA 4NCBA 2ZBCA 3HK2A 3G71S 2OSQA 4WFAQ 2LQ9A 1WTBA 2IAJA 4DFJA 3J7YU 2IM1A 4K4XA 4RW6B 1GQEA 2GGPA 4ECQA 2F8HA 2JLGA 4Y6IA 4FF2A 1YTYA 2AJ1A 5L1KA 2LXIA 2RF2B 4Q7AA 3D54A 4TXSA 4Y2MA 2M5YA 3VCDA 1WI8A 2RKIA 4WCEQ 3MMCB 3VAFA 4AYBD 3P3DA 3CCLS 4DV2F 4C98A 2L9DA 1R6YA 2V4JA 4Q45A 1AW0A 2VG7A 1IQZA 4NL5A 4BDPA 2QSFA 2HMIA 1RTHB 1QJHA 4ED5A 1N54B 4MTPA 2W8KA 3F73A 2LLZA 1VRUA 1QE1B 3AA8A 1FEHA 1VGYA 1VC5A 2QYCA 3DRPB 3LANA 5IQQA 1ZTWA 1S1WA 5D4LA 2YX4A 5GAGU 2YTCA 1Y3KA 3UDCA 5HLFB 1JIHA 4HT5A 4TLQA 3DDNA 2B56A 2VFRA 3N6LA 4J37A 5C42A 1DURA 2Z0GA 2CVEA 4A8YA 1ULRA 3U02A 4OHZA 4X4QA 3MDFA 4V19J 1B7FA 3JYTB 2EFQA 1U09A 5D3GA 3KLVA 2JLEA 2FTRA 3IWNC 4HH1A 3THPA 4IQXA 3E01B 3DOMA 2GW8A 1NJIT 3BSNA 2WTFA 2YNIA 1RI7A 2DNLA 4WIIA 2HHXA 1FERA 2RT3A 3DDKA 2MKKA 2KM8C 3FDSA 4A46A 4DSEA 3PKMA 2YNFB 5EWGA 4LF9F 5KFFA 3C6TA 1U8SA 2XNQA 3I4HX 4NA1A 3C2PA 4MFBA 1SUQA 5G0RA 1TV6A 2UZAA 1ZM4A 2HHWA 1WHWA 4KKOB 2HHPA 4IO1A 5KFIA 3K0JA 2UV8A 3HHNB 4HH0A 3MFIA 4WYLA 5A8RB 1U24A 3QMQA 4TU7A 1QAIA 4DSJA 2W9CB 3POTB 2QFJA 4FN5A 4KR0B 3SFUA 3KG1A 5K8MA 1LW0B 4ZPVR 5KFGA 3MHYA 4PG4A 4J9RA 2CPJA 2MPUA 4YDDB 1IKXA 4WJBA 6FDRA 2NPIA 2UVRA 4OHYA 2CPHA 4DUYF 1TK0A 2XS2A 3DHWC 4NLVA 5I3UB 4JV1A 2NPFA 4RBTA 1HNIB 3V6KA 2M3DA 4QIWD 2P5VA 4ZP9A 4YB1P 3G6XA 3IAS9 3IXQA 2ILYA 3RTVA 3PR5B 2W8LA 1C0UA 3TNVA 1FCAA 2DK2A 3K5OA 2ZKUA 3MMBA 4I2QA 3MURP 1IBMF 1RT7A 1SKWA 1U2RA 4WFNQ 4UOCA 3AAWB 4O4GA 3OUYA 1ZM9A 5KFHA 3HXMA 3L09A 4YMEA 4P7VA 4XIUA 4QPXA 4HKQA 3BR9A 1JXEA 2IBOA 3GSDA 4IQMA 2LEBA 1JNZB 2X1BA 2VG6B 4M63A 2DPJA 2OJ3A 2CDQA 2R7WA 4B3MF 2M52A 2L3MA 3WC2A 3DFEA 3V6JA 1GXLA 4RW7A 2QO3A 3DOKB 4QU6A 3M6UA 3G6YA 4ECRA 1HW9A 2DNRA 2YKQA 3RB0A 2V4QA 2VFVA 3GMGA 1VQNS 3TW0A 5E2QA 2XY5A 4RX6A 4TQSA 4RW4A 1HPZB 2DO0A 1C1BB 4I0WA 1TQLA 2M2BA 5L8RC 1TK5A 1X8DA 5JVGQ 1R27B 3UDLA 2HW3A 2RB7A 4QJVA 2NXUA 4MJKA 1ZZNA 5K8NA 3CCZA 5A0YB 5M2UA 2K1RB 1UAWA 2V94A 4I7FB 4IDKB 4NZ0A 4ZLPA 2JL9A 2LECA 2VQEF 1R8AA 4ALZA 4CTAB 2C2EA 2O67A 2I5JB 3J80Y 1LK5A 4OZNA 1KONA 5JVHQ 4FS2A 2JSXA 3HJFA 4NLQA 2J9EA 2QZ8A 3QJLA 3JTOA 4DSIA 1HNVA 3A8EA 2BUNA 1IKWB 3I9ZA 4M94A 2MQMA 4WTYA 1W2BR 1WG5A 1MU2A 2RILA 3N79A 4F67A 1GNKA 5IT4A 5K8PA 5KFCA 1TFYA 4WE1B 1NNDA 2BANA 3AY0A 4EEYA 2GHPA 3DNCA 3DLKA 2DNMA 4WU2A 5C5JA 3J81Y 3BREA 4RZRA 4DL4A 3B4DA 3BGRB 3E51A 1DAXA 3FRYA 4KHPF 1TKTA 3SCJE 1S6QA 1S1UB 5T7LB 3SSSA 4XPEA 4O44A 1VFJA 1UVNA 3GV8B 4EU0A 1SIWB 2E1MC 1D0EA 2FY1A 4EZ6A 3QIDA 2GFFA 3CD0A 3DRYA 3UE2A 3TUIC 4TKTA 2Q66A 3BEGB 1N33F 5CCMA 1R0AA 1Y5NB 2IM0A 5E5NA 3AH6A 5KT2A 3K5NA 1ZAXA 4EO8A 4OI2A 2HGLA 3ISND 5AXMA 2ATLA 4C4WA 4YDXA 1YRXA 2QEXS 1KLMB 3OL6A 4J9OA 3M32B 2N3LA 3S6EA 1KR4A 2FJXA 3OLBA 2HWTA 1F9FA 4DQQA 3MUVP 1Q78A 1UP1A 4H4MB 2KRBA 1H7XA 4ZA1A 4FXDA 2L48A 4LT6A 1IKYB 1LFWA 2RDIA 3CCUS 1WI6A 2XULA 1X0FA 1FNXH 5LMNF 4FF1A 3DXBA 1BLUA 2J5AA 4O3NA 3K57A 1A9NB 2ZM6F 3MMAA 4XDCA 1YQHA 5DLGA 1K1SA 5C24A 1R31A 1SJ3P 1TL4A 2ZOFA 1FVQA 4AFFA 1ZPWX 1SH3A 1JLAA 2LU1A 1S97A 3NBPA 1H6KX 5HROA 4Q8FA 4DR1F 2CKWA 4DF8A 4OQJA 4KIAA 4U7UK 4I4BA 4A8XA 3C3LA 2JHEA 5GAEI 1FXDA 2RS2A 1FK9A 1VI7A 4OZ1A 4ECUA 1FRHA 3K8VA 3IN5A 2J6SA 1BQNA 2YVSA 1S0MA 4B9NA 1M5SA 3FQKA 2OAUA 1WEYA 3PXGa 2W9BA 4DOZA 4O4RA 4MKAA 3EZUA 4TU8A 3LP0B 5T14A 4DR2F 5KT6A 3MPVA 2MXYA 2WW8A 1NK6A 3PO4A 2ZZNA 1TFWA 2D1CA 2WB4A 2K3KA 3IR5B 4RNOA 4LUBA 3H5YA 2PD1A 1U2FA 3RYLA 3EUNA 1HARA 3KLGB 3SV4A 4PG6A 2HNZB 2PO4A 1FTRA 2YWFA 4O3OA 1UL3A 4KT0C 1RTIB 2ZZMA 4QR0A 2DVIA 1XR5A 3CPWR 2CIMA 1REVB 2DITA 5EGYA 5CYJA 1QVFR 2XS7A 1MW7A 1APSA 3K5MA 2A1BA 1E6VB 5CYQA 3VAJA 5CYMB 2QLWA 4K2XA 3BB5A 1FRKA 3PRBA 2YH1A 1QAJA 4B9UA 2CJKA 3RBEA 1O51A 5KFSA 3Q22A 4I69A 5KG7A 1UVKA 5FDLB 3S01A 5CH7B 5L9NA 5KG6A 4R5PA 4LF4F 5B08A 1KSPA 1D3WA 4TNOA 2DNYA 2OTLS 2BQ3A 4KO0B 4KBIA 1H2UX 5F41A 1FA0A 3I56S 3LGNA 1C2PA 2BJDA 3V6HA 2E9TA 2CJ9A 1S9EB 4N8NA 3OTCA 1F0XA 2G0CA 2KB2A 2RVJA 2DNHA 3H20A 2JX2A 4LQ9A 3CXCR 2ZC4A 3FSIA 4OZJA 3RAQA 2VBWA 4DN0A 2KFYA 1IJEB 3RRKA 4ZCMA 3QGIA 1HQEB 3HHEA 4RLEA 2XI3A 1JKHA 1YJNS 1U47A 2W4DA 4IG3B 2KFNA 2YNHB 3ICLA 2LEPA 2O66A 1VQ8S 1TVRA 2VKRA 1FNMA 3R5CA 1OQ3A 3Q0AA 2VONA 1S4FA 1MWZA 4DF4A 3G8SA 4FNIA 3OTOF 4B9LA 2O5DA 2YX1A 4B3OA 5B0AA 1T8EA 2WHOA 4NOHA 4G1PA 1GTHA 3TAMB 1N36F 3OV7A 5F0UA 2MQLA 4WK3A 2Q6BA 4IRKA 2B4PA 4PQAA 4RNHA 1P27B 4AL6A 4ZVFA 2W9AA 4PQUA 3IG1B 3H40A 3O1LA 2RF2A 4X84A 4PG8A 2XB2D 2R2UA 1NK0A 1PGZA 3D28A 4NRUA 3T5KA 3TVKA 1UA1A 3CCJS 3OFHA 3V2UC 3US5A 4OJGA 2FLLA 2DGWA 1HQUB 1ZBTA 2GQ2A 2JZ5A 3TANA 4LSNA 5DM6Q 3D0GE 4K0KF 2W24A 4U6PA 2PFFB 5KFNA 1CVJA 4ID5A 4ILRA 4NCAA 1RA7A 4PUOB 4MKBA 2M9KA 2MKSA 3LQVA 1XR6A 5KFRA 3EXCX 1VIOA 2EKYA 2B3TB 2H9ZA 4EO6A 2ZD1B 1JNRB 3FRZA 4WU3A 4EYHB 2DR8A 4JI2F 2EWHA 1D9FA 1C1CB 1S1TB 1TKXB 3MGJA 3ZZOA