2AJ2A

X-ray crystal structure of protein vc0467 from vibrio cholerae. northeast structural genomics consortium target vcr8.
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
187
structure length
187
Chain Sequence
b'SDIEVGHSMNLTNHFLVAMPSMKDPYFKRSVIYICEHNQDGAMGLMINAPIDITVGGMLKQVDIEPAYPQSHQENLKKPVFNGGPVSEDRGFILHRPRDHYESSMKMTDDIAVTTSKDILTVLGTEAEPEGYIVALGYSGWSAGQLEVELTENSWLTIEADPELIFNTPVHEKWQKAIQKLGISPAQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical UPF0301 protein VC0467
molecule tags Unknown function
source organism Vibrio cholerae
publication title X-Ray structure of hypothetical protein VC0467 from Vibrio cholerae: new fold. Northeast Structural Genomics Consortium target VcR8.
rcsb
total genus 38
structure length 187
sequence length 187
ec nomenclature
pdb deposition date 2005-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02622 DUF179 Uncharacterized ACR, COG1678
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1300 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits VC0467-like domains 2aj2A02
3.40.1740.10 Alpha Beta 3-Layer(aba) Sandwich VC0467-like VC0467-like 2aj2A01
2HRXA 2HAFA 2GS5A 2DO8A 2AJ2A 2MUIA 2EW0A 2GZOA
chains in the Genus database with same CATH superfamily
5A0YA 2FJDB 1GEHA 1SVDA 2B9WA 4NZ7A 2DIVA 4O3RA 3NNCA 4YEAA 4AXIA 2V34A 1CS4A 1N34J 2CJQA 4JI7J 5HBMB 2V6AA 1X4BA 2ATCB 1HPZB 2X51A 1DQAA 4IOCQ 2E7XA 4ITSA 1H7XA 2F5GA 3C66A 1WORA 3GFYA 4YS2A 1RWNB 4LRAA 3D1QA 2L3MA 5KT4A 2EW0A 2NXCA 3PO4A 2UUBJ 2RRNA 3HVAA 1ITPA 2BANA 3UD5A 1GXLA 4LIWA 5CD4H 3G6ES 1NJZA 2XMTA 2HHSA 3RAMA 3N28A 3W9JA 3IMQJ 1D0EA 2XS2A 2ZM6F 5IQQA 1MLAA 3PXGa 2DNNA 1SC1B 1NJYA 1WF2A 1YJRA 2DR5A 1N6QB 1NUEA 2W9BB 1FERA 3Q86A 4DSJA 1GAOA 1HI8A 3B8HA 2MTLA 1OIAA 1FRHA 1LWCA 1PG5B 1MU2A 3KG0A 2OP5A 2FUG9 2DEIA 2YH1A 1Q8IA 4Q44A 2R8IA 4KGZB 1IM4A 4KGVB 1Y5IB 1G4CA 1S59A 3KK3A 4Y2CA 3PY8A 1Y9OA 3IR7B 2XEXA 4DUZJ 2MZRA 3S01A 5KT2A 2KM8C 2RDJA 2HAIA 4RR5A 2MYFA 5DDPC 1BHNA 3OFGA 1LV5A 2M5YA 4UOFA 1HNZJ 1R31A 3SV4A 4A8FA 4KHRA 1ZPVA 4P2XA 3OLAA 4W90B 3H42A 1XMOF 5CYMB 3C14B 4UT4A 5JVGQ 1L5UA 1HR0F 2H65B 1KFSA 1VJQA 2GAGC 2WRMA 2LQ9A 4NOHA 1DLOB 3E3XA 3DRRB 3H40A 5KFVA 4LSNB 4OHXA 2NR0A 4EI2A 4ECZA 1IN0A 4MKAA 1RWKB 3E01B 4JYAJ 4BBYA 4DPTA 4OHZA 3PW4A 1HYSB 2AJQA 1JLAB 2Z2LA 3VAIA 3KLIB 5FD1A 3OFEA 3P4UB 3RW7A 4BC9A 4ZKAA 1N5YA 2AYEA 4DPUA 2WONB 3PJ9A 2DXFA 3FFIB 4XPEA 4F25A 4MIBA 3QZ7A 4UOHA 2WK4A 2CNOB 1LXNA 1XR5A 1YJVA 1CULA 2DISA 3C6UB 4LREA 1XC9A 2HVZA 1IWGA 3T5KA 4KHMA 3H4DA 2VL1A 3BDPA 5JXSA 4GKJF 1IBKF 1E6YA 4RO0A 2QYCA 1V6HA 1Q7YT 4FS1A 2Q6CA 2KHCA 1JLBA 1T9XA 1FDBA 3GJSB 2Q3PA 4IFVB 3TA1A 3MTKA 1VQ8S 4B3TJ 4NLWA 2Z58B 4CLYA 4ECQA 3VR1A 2V2QA 3CJ8A 3HHEA 5H9FK 2OMLA 4F26A 1HQ2A 1K44A 2ZHAA 5DDRC 2JEGA 2HMIA 3BSNA 2LXFA 1C1BA 3F0NA 5BR8F 2U1AA 1IJEB 1NK8A 4ETZA 1UETA 3AOCA 1YRXA 2BVZA 1X60A 2GVZB 2DNOA 3I31A 1F5AA 3R5GA 4I2PA 4KT0C 4ZVSB 3KK2B 1HBNB 2H4YB 2CQ0A 3M8PB 1RT1A 2J9DA 3HVTB 3R6LB 5F8HA 1G1XA 1OWXA 3MM7A 2C2OB 3GZ7A 4G65A 1Q81T 4R0JA 1QJHA 4IG0A 4YB7A 4YN3B 1UTAA 2HWHA 3EDRB 2OKQA 4LSLA 4JI6F 3P6YC 3HFKA 3MEDB 3SDEA 2L41A 2OSRA 5KFUA 2HKEA 2ZH3A 4IDKA 3C6TB 2QO3A 2C2RA 4F8RA 1JJ4A 1R8BA 3UR0A 4AT1B 4C6AA 5HJYA 1M5PC 3ZXWA 3GPAA 3QLHB 1FJEB 2V8DA 5HANA 3TQEA 1FTRA 3WX4A 4A4JA 4DV6F 2XCAA 2DO0A 4I1TA 5HSPA 2B7BB 2E5GA 2ZKUA 1RTDA 1KN6A 4NLUA 1NRKA 1NSPA 1YI2S 3LAKA 2EFPA 2YKMA 1UPMB 2HEKA 5DS7A 3KLGB 1SIZA 3CIMA 1LNQA 3BQ1A 5LM7E 4DL0C 1JXEA 1FKOB 2RNEA 4CO3A 2DNQA 1RWOB 2J5AA 2XZTB 3PW7A 2VICA 3MECA 4JI5J 1TL1A 2RKIB 3GR0A 3BSCA 4P75A 4AL5A 2FB0A 3ISND 3UD3P 1HARA 1TL1B 2RKIA 3IBCB 1SKWA 4I69A 3KG1A 2XGQA 3MHYA 3LOUA 4BC7A 3GFZA 2JVOA 3MAHA 3MR5A 1U1QA 3NBPB 1B99A 3RR8A 1OY9A 1NSQA 3OXLA 1C0TA 1OPIA 3MMBB 1RTZA 3CJKA 4JI1J 5A2QU 4J9QA 1GXTA 1RP5A 4CO2A 3NS6A 3NGKA 4CO4A 1RT1B 4Z37A 4LVOP 4EFAC 4A8SA 2YNIB 2YKPA 2D3O1 1Q5VA 5F41A 3T6BA 2HS3A 3DGVA 4NCGB 4W98A 2HQIA 3D0IE 4OX7A 4JI2F 4JUZA 2IM1A 2EKNA 1KQFB 1S99A 2P6SA 3D2WA 4C9DA 2NXUA 2KT5A 2CIMA 3C6TA 3HFVA 4P7VA 5ETNA 5KG1A 2Q66A 2DGQA 1ULRA 3M1VA 4IR9A 5F0UA 5IT0A 1YJTA 2PA3A 3D5MA 3DOMB 4RWXA 5SZTA 4USTA 4X4PA 2BQ3A 2BEFA 2P9GA 4CM0A 4FF4A 3SV3A 3NGTA 5E2QA 4J9MA 4JI4F 2IJRA 2IRXA 2ADCA 4OQJA 4JYAF 2R7XA 2YKNA 3UNGC 2FDNA 1FCAA 4ZP9A 4TXSA 3ZTSA 1X9MA 3K59A 2FYXA 1R7IA 3AD9C 2JZ5A 1R3NA 2DR8A 4HHJA 1RISA 1ZA2B 5IT4A 1HMVB 3LANA 3AODA 5BYSA 2DNMA 1CJTA 3DOLB 3IR6B 4WYLA 2MY8A 4X4RA 2VODA 1U1LA 2VBXA 3V6KA 4F02A 2RDIA 3CC7S 3CD7A 3M8YA 5KG6A 4X62F 1P9QC 1HNWJ 1PCAA 4OZLA 3TX8A 1VISA 4YY3J 4OLPA 2QIFA 3TJ9A 2E7VA 2QMWA 3KHRA 1Q78A 3UFCX 3AXMA 3M8RA 2QLXA 1WDTA 4DCOB 5IFMA 2O3DA 2AYMA 4A46A 2DCUB 2DD8S 4RW7A 1WSVA 1P8GA 2D69A 3A8EA 2FHJA 2E29A 3K5MA 1UCNA 2BBEA 2GIQA 5KG3A 4DL5A 1YVFA 2GJIA 2CQ3A 3BM7A 1EZZB 2VBZA 2Y0SD 2MQNA 2MSTA 1IKYB 1CJUB 1LOUA 2B43A 4JI5F 5CCLA 3KNAA 3R7SB 2ALYB 3LO3A 4PWUA 4KRWA 1SC3B 4KIAA 1N52B 3QATA 3KOAA 2FJXA 5D8HB 1NSKL 2XG8A 4OZNA 4ZPAA 2BM1A 4DR5J 4MT1A 3IBWA 3M4XA 4I0WA 3GIRA 3PIOQ 4JV2A 4I68A 1H6KX 4YDXA 1UA0A 2NZ4A 1PAUB 4B3RF 3JSRA 5A6PA 4UUXA 1Q16B 3ITHB 3ZTRA 1LW2B 2W4CA 1WHWA 1FRJA 3W9IA 1D9DA 4F2SA 4MIWA 3ISNC 2AWZA 1SQFA 3NGUA 2HVEA 2CQCA 3FK4A 4CIOA 2YKMB 2V9WA 3PW0A 3EYZA 4Z7CA 3POTA 1CULB 1CG2A 4JV1A 2QLFB 5IWAJ 3N5BA 3QO9A 2L08A 3Q8SB 4K5SA 2HQDA 3LP0B 4OYBA 3WBZA 4WE1B 4CH1A 4A8KA 4NLOA 1BE4A 4DR1J 3EZOA 3FCHA 3DKDA 3GYXB 4YHHJ 3BGFA 4WU3A 1JLEB 2W2OP 5MLCV 5E5NA 2JC1A 1DHMA 3QIDA 2MKHA 1C2PA 3M9NB 4P2SA 5K8NA 2VFUA 1EQMA 1ZAWA 2O5DA 5GAHI 2G1HA 4LF5F 3R5AA 5A8RA 5C5JA 1TFYA 5CZVA 2QFJA 1S1WA 1URRA 1WF1A 2M52A 3EGVA 1YTYA 1R8CA 1YGYA 4NASA 4KTQA 2F4VJ 1JXVA 5L1LA 4RLEA 3FNNA 4JV5J 5GADU 3QSIA 1HFEL 1T02A 4Y0FA 2MKSA 2VG6A 3TYTA 4EUVA 1WELA 5DQHA 5EN1A 3UQSA 5IV4A 4YB1P 2CG8A 4C97A 1NM2A 1XEZA 2YX4A 3AJ1A 1HPZA 3ICLA 1O5JA 1KS2A 3S7RA 3M9OB 3BSOA 2FQQB 2X1AA 2OPRA 4OI1A 3GU0A 4ZPTR 2I1RA 5C42A 5LJ3Y 3SSQA 2DGUA 3US5A 3HMJG 1MWZA 1ZETA 4MKBA 1LWFB 1YZ6A 4C48A 2M0GB 1XQIA 1BGXT 1N6QA 4FYXB 4WJBA 5HN0A 3KLEA 4NWBA 2H5IB 1HL6A 1S1TB 3MD3A 2CA9A 2V50A 1J5EF 3IWLA 2FHJD 5KFWA 3LP0A 4C3KA 3SSRA 4DBQA 1QTNB 3OJSA 4UOCA 1Z4UA 2QEXS 2HNYA 2B0GA 2RD5C 3ONQA 2DVIA 3K89A 1GK8A 3NWGA 3AJ2A 3OFFA 4FDFA 4F36A 3PYEA 4WFXA 2B9XA 1VI7A 3QT6A 4Y2MA 1HNZF 2CNNB 3OL6A 3IRXB 1M0SA 1F2HA 3M6WA 2BW2A 2D1CA 3MGJA 2LEPA 1RT5B 4IG3A 5EX0A 1DZ5A 3C14A 2VQEF 4Q8EA 3QWPA 1UJ4A 5DG9A 1Q95G 1MSWD 1S57A 3M2UB 1PC4A 1UW9A 2W8KA 2C28A 1FHTA 1IR1A 1IKWB 4UOGA 2J0WA 5I3PA 1NNDA 2OJ3A 1RBOB 4RZRA 2FTRA 3P96A 4FKXA 3HVRA 2AEJA 1CJVA 3A4TA 3KK3B 2ZC3A 1SH3A 2VUGA 5I42B 3RB0A 2P2CB 2HLTA 3B78A 2BE7D 3A8IA 5AXKA 3OW2R 3KUGA 3VGTA 1JNRB 4MJKA 4K4YA 1NU4A 4KB7A 4NI2B 1KEKA 3GIIA 4ES3A 4PXCA 2DEJA 5E3CA 5C42B 4ED3A 3KMQA 3TZYA 2VH7A 1RT7A 2PO4A 1JLGA 3QFWA 3OTEA 3CPWR 2WBMA 1B0VA 5E3QA 3CF5Q 4DQQA 3DOKA 2XNQA 4X2BA 3IO1A 3R27A 4HEA9 2MZTA 1R89A 2FHOB 5D0GA 1EP4A 2VV5A 1AT1B 1NDKA 5CQGA 5A8WB 2W9CB 2LYVA 2YWEA 1RAGB 2BJ8A 3H0PA 3D54A 2UVWA 1PBAA 4LFCF 2AJFE 1T9UA 2I8EA 5H9EJ 2HRXA 2W2NP 4FBTA 2OUGA 1N5TA 2VG5A 3THTA 4USIA 5HMYA 4OYIA 2J9EA 3KNGA 4OHWA 4EMDA 3K5OA 3NGSA 2CWKA 4CTAB 2PEBA 4B3OA 2B3TB 3LH2S 4LT6A 3EVOA 2EFNA 2MQMA 1U2RA 1S0NA 2XLIA 1L3SA 3DLLQ 3M2RA 3JAMY 2QMUB 5KFOA 3J7YI 1PIEA 2OO4A 2MKJA 3HHDA 3LP2A 4NLQA 4DI6A 4E0DA 1I1GA 3MEDA 3SDEB 4OFZA 3JAMU 4IH5A 4H4MB 2E5JA 3MPYA 5DLFA 4I6WA 2ZJQQ 1REGX 4DV7F 1BQNA 4RUHA 3HXMA 4ED2A 3T3FA 3ENVA 2IM2A 2MSSA 3MM7B 2GAHC 4QWAA 2AW0A 2PGCA 2UUAF 2MKYA 4GKJJ 3M2VA 3FCVA 1X8DA 1X31C 3FMWA 3GJRB 5C25B 3MR7A 1SH0A 4FP9A 2P8IA 2E5IA 2LU2A 3ISZA 4X84A 4ETXA 2ZJPQ 2IDLA 3GJTB 2GA7A 3ENQA 3OPKA 2R7RA 3MMAA 2ZZMA 5J2PA 3SCLE 5HJXA 2YNGA 1ROFA 1K73T 4OJGA 2R7SA 3QZ8A 5F8LA 9ATCB 3NCQA 1H74A 4C8MA 1YJ9S 4KC5A 4NRUA 3VTIA 3R1LA 5F8IA 4NXNJ 2V69A 3BGOP 2KYXA 4Y34A 3H5YA 1EARA 1R0CB 1V3ZA 2RS8A 3GJQB 5A8KB 3CDWA 2NPFA 3PR4A 5HLFB 4A8QA 4P6QA 3T5LA 3PACA 1YITS 3ZTPA 1FA0A 4GVBB 4U9RA 2MKCA 1H0HB 2VU5A 2H1YA 3UDEA 2N7CA 1AXQA 2RE1A 5HI7A 5CD4A 1CJTB 3JSMB 1DY3A 3HO1A 2DXEA 2WB4A 1VQ9S 2UV8A 2K7KA 4MMOA 3W5ZA 3DHWC 4RUAA 2LDYA 4MYTA 2FPHX 2WB1D 4GMKA 4KKOB 2HS4A 2R9LA 5B0AA 2YNIA 2AT1B 2CG4A 1AZSB 2CQDA 2K8GA 2KJWA 2V68A 2CQ4A 2RHSB 3CCES 3FZBA 5HP1B 5AXLA 3T19A 2EEYA 4YR3A 4ECUA 1FNMA 4OHYA 4DV3J 2UXDJ 1B70B 2YXLA 4KGXB 3CJKB 3TZXA 3QJLA 3TNVA 5KG2A 3CCWA 3QRRA 5HQ8A 2R2TA 1BMQB 2HQ3A 4XDCA 1HNVB 1HQEB 3HFZB 4KJIA 1NDLA 2ZFHA 2K2PA 1QVFR 5ETQA 1IKWA 4QU6A 2LECA 4LUBA 1K0VA 1GTEA 5DZ6A 2AX0A 3M8QB 3ZZYA 2HFZA 4Y3CA 3SQGB 2IBKA 4C8KA 4ER8A 3J7AN 4J91A 5M2PA 1GMUA 3MCSA 4MFBB 3VZHA 3NCRA 3ZNJ1 1YIJS 3L4BC 2HHVA 4HH0A 1N5QA 2DBBA 1U1PA 5EHHA 1TK0A 4KV8A 3VAJA 2LQJA 4ENOA 2OPRB 3M1VB 2CXEA 3RUBL 1RHKB 1VR6A 2OD6A 2VJVA 1ZH5A 1VGYA 4QPTA 1GMVA 3VAHA 1RTJB 2BRLA 2OHDA 3OXGA 5DQGA 1S97A 4YB6A 2GGPB 3MEEB 3ET6B 2BANB 5F0WA 3VGVA 4ZIWA 4DV4F 2WW4A 1DFDA 4F4XA 4ECSA 3VAMA 2D3UA 1XMBA 2XMVA 1D3WA 2DNYA 3DM2B 4U67Q 1MWYA 3QGPA 2V4JB 1RAAB 1FJGF 1JLCA 3CDAA 4M5KA 4B08A 1VC6A 2KT3A 2WVCA 2F7VA 2X1GA 4A47A 3Q8PB 2IJFA 1C4CA 4DQSA 1NO8A 4P74A 1F60B 3DLJA 1JLQA 2VG7A 2W9AA 4ED7A 1UVLA 1HNIB 3MF5A 4U8YA 1OYEA 3GQCA 1TKZB 4TLQA 2W7OA 1IBLJ 1IR2A 2FVSA 2XCPA 1NSAA 1NXIA 5AE2A 2ZD1B 3PJWA 1Q79A 3ZFVA 3J81U 3G4SS 2OTJS 4GKKJ 2E7WA 3VWSA 3MM8A 3SCJE 3IWXA 4NYOA 2XMMA 3MZIA 1LQ9A 3BYPA 2HPUA 3T9ZA 1XERA 1PO6A 1RU2A 3DU5A 3CCZA 4B3RJ 2CUYA 1RJJA 2QFIA 2AHOB 3MMCA 4P52A 4C0BA 4X64J 2DIUA 2CNKB 1XNRJ 2MZSA 1QAYA 4OMFG 1WI8A 2DNKA 4HH1A 4IH6A 2JVRA 2MXYA 4HR2A 4OYXA 4H4KC 3PEHA 3GE9A 3HZEA 1T9VA 1UJ5A 4N8OA 3VGSA 3VGUA 3DLHA 1XMOJ 2Y8WA 5C24B 5F8JA 1F3VA 1OS5A 2DJWA 2XYHB 3PG9A 4K7QA 1S9GB 4YMEA 1WHYA 3CCTA 1N48A 3EXYA 5J1PA 2MPUA 2NCKL 4F3OA 4LF7F 1FJ7A 2DO8A 2VKRA 5D15A 3OHBA 1M5SA 4DUZF 2KRBA 1FRIA 3H2LA 1R8PA 2CDQA 4KFBA 3NCPA 1NK5A 4PYDA 1D1UA 4CLPA 4ECVA 1GH8A 3PX4A 1UKUA 4ZJLA 4M63A 1JLCB 1X7VA 5KFAA 3E2EA 1ELOA 1GNKA 1KKHA 1SUQB 4HT7A 1Q86T 5HATA 2W9BA 4NXNF 2A3JA 2HNYB 1D9AA 1BUXA 1SQEA 1U26A 2EXUA 1Y3KA 2HAFA 2OPPA 2VD3A 3BBFA 4L75A 5L8RC 3RRGA 2F8HA 1M5HA 4IFYB 4UF4A 2LU1A 1REVA 5LSOA 2DB1A 2WSCC 1MW7A 1U1KA 1RAIB 1WSRA 2OPSA 3KYLA 4FYWB 1X9SA 4LRBA 3I5AA 4QOTA 5C2GA 3ZZPA 4C0HA 4AQYJ 3MPWA 4M95A 4DFKA 4LF8J 2XNRA 5KFHA 2BE9B 2RMLA 4P71A 3VQTA 3D6FB 3SSSA 4DV4J 3EGZA 1VQPS 1IBMJ 1T94A 2OGUA 1MWQA 2KKHA 3KJFB 3MM9B 2GO9A 1RGVA 2CDRB 3D1HA 1S49A 3LQVA 3W62A 1CQNA 2JFDA 2W7AA 4ED4A 1O51A 1EETA 1RLCL 1RHMB 1FD2A 1HW8A 2AZ1A 5B0FA 2KRRA 3UN2A 4DPWA 1NB7A 3B54A 4Q45A 1IKYA 1CJUA 3ULHA 1RK8A 1Y0HA 1Y5NB 5L39A 2C2MB 3CD6S 1WD6A 3KMSA 4PG6A 1WHXA 2AJ2A 1VLOA 5CABA 1OYDA 1OQ6A 2ABYA 3V6HA 1FRKA 3J80Y 4V19J 3TVYA 4TY8B 4EZ9A 1ZZNA 4UZBA 1T9WA 1TAQA 2UP1A 1YZ7A 5KT3A 5U47A 1FRXA 5DG8A 2QL5B 3BBBA 4DV6J 4Y2IA 2ZVIA 4MH8A 1VHFA 4DQIA 2K7JA 5FDLA 4DR6F 1VMBA 2E1AA 3FRZA 3GTYX 2F3JA 4EWTA 3WC2A 1N56A 5AXMA 1KLMA 3HK2A 4E98A 2HHUA 5E33A 1FX2A 4LQ3A 3POTB 4RW4A 3GCWP 1UPPA 5KFKA 2VPXB 2ZVSA 4NLDA 1Q8KA 3M8SA 4RW4B 3E8OA 3SEOA 1NDCA 4OI4A 1KQSR 2MQLA 3CO9A 3NOCA 3L09A 5J2MA 4KO0A 5GAHU 5B0BA 3I6PA 3KJNB 3L9ZA 4DN0A 2N82B 4B9TA 2XZWA 2C22A 1FDNA 1FRLA 4RW6B 5IS2A 1R43A 3MAAB 4L76A 2QX0A 4M5IA 2PFFB 3H59A 3BGLA 1NPKA 2G4BA 4RL1A 5K9FA 4DR2J 2E9ZA 4ECYA 1S6PA 4FVMA 3H5XA 4C4WA 2RF2B 2MKIA 3IG1B 1SB6A 3PRVA 5LL6d 3NNHA 1SJRA 1TL4A 1RHJB 1X4DA 3HHNB 2DRDA 2LFVA 1VHIA 4X65F 2BOPA 3NGRA 2CPFA 4HI1A 3AQOA 7FD1A 2BQRA 2CYYA 2EI5A 4ZCIA 3CC4S 2MLYA 1CBKA 3MMJA 3FQLA 1WOPA 5DDQC 3CCMS 3GONA 4JOUA 2PC6A 1IKXB 2PT0A 2C2EA 5F8NA 3UDLA 1V3SA 4CT8A 2LEBA 4I64A 1YSJA 4RW9B 4B9VA 3OTOJ 2R2RA 1DAXA 4DZDA 4IFVA 1DTTA 1FWPA 1SH2A 1HHQA 2FZKB 2ZNZA 3B4DA 1FXRA 4G1IA 2PFDA 3GYNA 3W2WA 4DPOA 2RU3A 1YRTA 3NNAA 5I4MA 4J9LA 1IQTA 4WCEQ 4UTGA 2NS1B 3DMJA 2DXDA 4BCAA 1NKCA 1U2CA 4KH1B 4D3HA 3H2VE 2WOMB 3LW5C 1FESA 2KU7A 4IFYA 2ROPA 2NZCA 3KDOA 1S1VA 2HZAA 4TQRA 2HNZB 2CJBA 2DGXA 5KFCA 4B9SA 4M94A 2Y1IA 2DNRA 4KO0B 5KG4A 4RUCA 6FD1A 4UZCA 4OZ3A 5CAAA 3OVSA 1UWBA 2AJ1A 1CVJA 1SV5B 2EFVA 4E2FB 2KZZA 3NLCA 3DLEA 4QBUA 2E9TA 3AB2B 2XYGB 4DL7A 2XMUA 4K0KJ 3CJ0A 2ZWPA 1TELA 2JLEA 5LSRA 2HRTA 4PCQA 1VBKA 1VRUA 2IVYA 4HACA 4NMLA 1B4SA 1RAFB 1Y4ZB 2WVBA 4GRSA 1SBRA 1VQ4S 1KLNA 1V9OA 2RVJA 3K17A 2Q79A 4L73A 2O01C 5DO2A 5C24A 3GIJA 3TANA 2BKPA 4GVBA 1M1GA 2KH9A 1Y7PA 1Z2ZA 3I4HX 4FPRA 1TKDA 1QAIA 4ELTA 2ZUAA 4LSLB 3JSBA 3CMAS 1TP7A 3IGVA 1RAEB 1RT7B 3HLUA 4XAKA 4ZVPB 1UVMA 3OL9A 2AV5A 4LSNA 5B0EA 1VK3A 2MDAA 3DU6A 4PG7A 1NKBA 5J2QB 1W2IA 5ETLA 2PI5A 1DARA 4I7FB 4JV5F 3GMGA 3MM6A 4QIFA 3T6JA 2CJYB 4DR7J 1TUGB 1Y00A 4QPXA 4RU9A 4X4NA 3HKZD 2OFHX 3PKMA 1P1TA 2AKWB 1C0UB 3CDUA 2KI2A 2AMCB 3HF5A 4NLSA 2Y1RI 3DXSX 1TQLA 1FD8A 1UJ6A 1NH8A 2V8HA 1DBDA 3FJ2A 3QRPA 1RT5A 2W24A 2XBPA 3K5NA 4HYKA 3W65A 1MU2B 4LF8F 3AOBA 4ZN3A 5GAEU 2PMHA 5LJ5Y 3A3OB 3FSYA 1ZM2A 3QYYA 2OPSB 1NK7A 3M6VA 1ZM3A 1JIHA 2I2YA 1NJIT 1CC7A 2LQ8A 1IBKJ 4WFYA 2MKKA 4K4WA 1SJQA 1WOSA 4DU8A 2GVZA 2C3OA 3BGRA 4I2PB 5M2UA 3KHGA 1CJVB 3QSYB 4HTIA 4IO1A 1KBRA 1S6QB 2J6SA 2M8DB 3DRPB 5B08A 5IWAF 2ZD1A 1SC6A 3PYGA 2BA9A 1C1BB 3QMQA 1R6YA 3QGGA 1TZ0A 4LR8A 1X4EA 5E41A 2FVPA 4IUFA 4N47A 4PRFA 2IC3A 5A8RB 2DGSA 4FS2A 2FJAB 1X5PA 1HD0A 2H5EA 2J9DE 5GAGU 3W8PA 5AXNA 1OY8A 3I0SB 5BR8J 3O6QA 3EJMA 2XGPA 1HWLA 2B51A 2XMKA 1Q4RA 2HQCA 3M8WA 3I0SA 4ZCKA 4FXVA 3AQPA 4PR6A 5F8GA 3RAQA 3UNYA 1GX5A 1LXJA 3FBEA 2A2DA 2DKOB 4O44A 5M2RA 2D7SA 2HQGA 1EP4B 1T11A 2J8AA 4USJC 4YB5A 3PX0A 3MDFA 1RCOB 3KTQA 1ZBTA 4WTOB 5J2NA 3ZTQA 5LMNJ 3RAXA 3JTPA 5D4PA 5B0CA 4LF7J 2AX1A 3HVWA 4ED1A 2IRYA 3KLHA 2E66A 3DI6A 4HDGA 4I7FA 5HBMA 4Q0BA 2RQCA 2L9WA 2KFYA 1RT6A 2G0CA 4P2MA 2C3PA 5SUHA 4M5DB 3U02A 3K5LA 4I2QB 1R6VA 4WFBQ 1RT6B 1RTIA 3O2IA 2AU0A 1WI6A 1CQMA 3D6HB 4A8YA 4FXWA 1NMEB 1YLXA 2HGLA 4DV5F 1REVB 2K1RB 1FO1A 2B56A 4HDHA 4K4XA 1EKRA 3HSGA 4UQGA 4LR7A 2O66A 3QJPA 4ZJQA 1TTHB 5K8OA 2JEIA 4N76A 1TV6B 4NZ0A 2VG7B 1S6QA 3QWUA 1TKZA 2LQ5A 1S6OA 3QT7A 4P2FA 4ZCLA 3R5BA 1U2FA 1OY6A 2GC8A 1U0HB 4LMZA 1SV5A 3IM9A 1KNZA 2VPWB 2VB6A 3I5CA 3QNWB 3QT5A 2GJFA 3FGVA 4B3MJ 1KR4A 7AT1B 1T9TA 4K4ZA 2DK2A 1NLKL 1YWXA 2YKOA 4OI2A 2C2ZB 4CO0A 4EO8A 4WKYA 3V81B 2XLKA 2RRAA 1FFWB 4CLUA 4RNFA 4PYAA 4DXLA 3T5JA 2D9PA 4C8OA 4MKYA 4WBFA 1K1QA 4LF1A 4USMA 4PPZA 4ZA1A 2VA3A 2YNHB 1S9GA 3EGWB 3QQCD 5D0HA 4AYBD 5A76A 1T7PA 1QE1B 3MCNA 4CLTA 1TUWA 2X3DA 4WK1A 2JEJA 4CI0B 2GS5A 1TU0B 3AA9A 1EAYC 2W2MP 3ETMA 2HRYA 2F63A 2JNJA 3K8VA 1FDAA 1PSDA 2YQ1A 3VAFA 1Q8BA 3BZQA 4WU2A 5AJ3J 3EX7B 2QA4S 1CLFA 1RE1B 1RUSA 3LPYA 2FHMA 2YBVA 4J90A 5B0GA 1VQ7S 1J2VA 1EB0A 3EICA 2OIHA 3M6UA 2Z0GA 3A3PB 1M5KC 1WKLA 2DGTA 1N8RT 4P73A 4ZOSA 3QBCA 4J9KA 2JOQA 2R8KA 4X66F 2IJNA 2EBEA 1KSPA 4DOZA 4B17A 3L3CA 1SXLA 2B8PA 2POKA 1H2VZ 2YY3A 2G2OA 2PN6A 2RUGA 3I96A 4KYZA 4MAKA 3THVA 1VQNS 3Q8UA 4N41A 1BQXA 4FPIA 3CJ2A 4TU9A 3JSMA 3SCIE 3VHQA 1VQ6S 1WEYA 1KVIA 3BN4A 3AJDA 3MPVA 3TR5A 4F3MA 4TYAA 3WZ0A 4DX8H 2QZ8A 4DQRA 4JI1F 3TA0A 4LSZB 1AUSL 2RH3A 4ZLJA 2I9SA 1RU1A 4EO6A 2CPXA 1MNEA 3AFGA 5GMKa 3Q2TC 3BS9A 4A8OA 1AZSA 1GMWD 1WKKA 3CVKA 3JSYA 1F3FA 4KPCA 3K7RA 3QAEA 1TR0A 3OUYA 1HNWF 1AUDA 1FVQA 4G6VB 2A6MA 3ENWA 3TW0A 1VS3A 1JLEA 2HWTA 2V94A 3BKFA 4ZPBA 4ZHRB 2FC8A 3DRPA 3MCOA 4ID5A 1VIOA 3UPFA 4V19X 5IOLA 4DS5A 3H98A 4ZHRA 2Z4PA 4WYWA 4ZVTB 4WK3A 2D3OR 2XS5A 1LFWA 2XSJA 1S79A 5DRKA 4P7TA 3U27A 1S0VA 3M2VB 4PWWA 3RU0A 1YBUA 4ZVFA 2Z2MA 4ECTA 1NKEA 1NDPA 4JI0F 2QRRA 1QAJA 2ZE2A 2GFFA 2L9DA 3D1OA 5HQLA 4QWDA 1Y3JA 1M5OC 4EBDA 5HLFA 2QSFA 5EWFA 3ELHA 5KG7A 4RJVA 1FXLA 2VQFF 4C8YA 2O67A 4U8VA 3LAMA 4AQYF 5JMNA 4K4TA 1OQ3A 2ZH5A 4CCHA 1PJ5A 2RQ4A 1KQKA 2LA4A 2AEMA 4K8RA 4QZVB 4CLWA 2BE2B 2PMZD 3GR1A 1PBUA 3P5BP 2HK3A 4O3QA 4F0KA 1TMMA 4X4OA 3LALA 3CXCR 1WC6A 1UA1A 4KPYA 2XWYA 4LBHA 4LF6J 5C2CA 2Z8QA 1G7CB 1RXOB 3IRWP 1V5IB 3GIMA 2CQBA 4DUYJ 3H5SA 1VBYA 4OIXA 3A8JA 4DL2A 3DRYA 1IKVA 2GHWA 3LP2B 1J5OB 2J6TA 3BPDA 2AYGA 4C8ZA 1FFSB 4H4MA 5KFTA 3LWMA 2ZH9A 1UFWA 4KHPJ 3GV8B 2KT2A 4I67A 4ZK7M 4TNOA 2ZBIA 4K2JA 3ILLA 1RSCA 4RW6A 2CAJA 3IA0A 1OSCA 4Q2LA 3OL7A 1KFDA 3N01A 4URGA 4ED5A 5D0RA 2DNHA 1K0TA 3DLEB 1UP1A 3BN7A 4NLVA 1S77D 2JRSA 5ADZA 5D6GA 1KHVA 3HVTA 4OZ0A 3DYAA 5CZXA 1R8HA 1D8YA 3IAM9 2XMJA 1S6PB 1NPPA 2BRKA 1F0XA 3W7BA 2X1BA 4GC6A 1E6VB 1N0UA 3S6EA 2AP6A 3AAWB 1U4BA 5A8WA 2QYGA 3DLKA 2WONA 2XY7A 1TK8A 1F5CA 2RSQA 2CZVC 4H4OA 2VBWA 3O44A 2XM3A 4DR1F 3KLIA 3IR5B 3TARA 3KUEA 3MFHA 4AUKA 4FYDA 1SUQA 4ES2A 4O4RA 5G0RB 3BO2A 2QLBB 1SPBP 1RT3A 4F0HA 3TUZC 3Q24A 2J9CA 4FVCA 2XI3A 1QUVA 3BDEA 5T14A 4LRCA 1UZDA 2KYZA 3K8WA 3ZZUA 4OLOA 4Q0BB 2EPIA 4LFAJ 1S9EB 4ZCMA 3OJUA 3R2CJ 5EUHA 2XSFA 4M1KA 2DHGA 2FVCA 1OSDA 5BJRA 1PGZA 1L3TA 2W9CA 3TUPA 3OTBA 1HD1A 2KO1A 4RU2A 4AXJA 1S1TA 1QM9A 3FUYA 1RT4A 3C16A 1MN7A 4KHPF 1WEZA 2HHPA 5IXUA 4NRTA 2KG0A 4DUYF 1WC5A 2ZOMA 5LT5A 4AE5A 5KTQA 4WZMA 1TKXB 1XK8A 2IA6A 5ETSA 4WFAQ 2VHGA 1VQKS 1XBWA 1XWLA 2UVRA 4CP5A 1FEHA 2KFNA 1JK9B 2XHCA 3CCQS 1CEZA 3SFUA 4C8LA 3AXKA 4I4BA 2JHEA 3PM9A 2F40A 1NZAA 5HROB 4Q5VA 1VQLS 1FE4A 2BJ1A 4LRFA 1HBMB 2ZH1A 1RA7A 1VQOS 1JKHB 3DLBA 4O3SA 3M2RB 2ACYA 3TAPA 2FVQA 4F04B 2DNGA 2ILYA 2W25A 3N79A 2KHDA 3Q2SC 5ETTA 5LXYA 4RNMA 2RJZA 2RUSA 2HHHF 4PUOB 4G3IA 3T5HA 1DTQB 1T3NA 4OV1A 4QIVA 1RABB 2UXBJ 4J7CA 1B3TA 3EVMA 1JLGB 4QW9A 2IAJB 1LWXA 3PDNA 2ZNYA 1U25A 3IC1A 1AA1B 1BQMA 4ZVQB 1X0PA 3FVYA 4GO7X 4ERDA 3EE3A 2V8PA 3VAKA 2VPZB 3KDNA 4PAAA 3G82A 3CJ4A 1SL1A 4MFBA 2CWXA 3RBZA 3MTJA 2ALZA 2HURA 1WOOA 2HBRB 4ZLLA 1RLDA 2DT9A 3M05A 2YTCA 2GO8A 3NAHA 1B0TA 4PEOA 4Q2MA 3WDOA 3RTVA 3RB4A 5D4NA 3QT8A 3PKYA 2HNDA 3CD0A 5LMNF 2FZCB 1F6TA 2DH9A 3G87A 4QWBA 1HNIA 4U96A 2P9CA 3W61A 3OLBA 4OZ1A 2GS8A 2UV8G 5E0OA 3H8YA 1L3KA 2ZH7A 3O5TB 1JLBB 1T3OA 5HMXA 3ZZZA 4FKYA 2GZOA 4DV0F 2HHXA 4M5DA 1U1NA 3G96A 3GV7B 3EXCX 3HT0A 1SJ4P 3F41A 4DR6J 1ZTWA 1S72S 1F5BA 1NHUA 4J5OA 2L48A 1HQUB 3MAQA 1X5SA 1RI7A 1N0VC 3IS9B 3LP1B 4OI3A 2LXUA 3DC2A 2XZDB 3AH6A 2E5LF 3H90A 3FC9A 1R0BG 3CD5A 3LP1A 4YY3F 4ANDA 5D4LA 1BC6A 5D0EA 2UUBF 3J81j 2A6OA 1YHQS 3G2XA 5HROA 1A7GE 2YH0A 3OT9A 3CCRS 1N34F 4O44B 2MJUA 2JEFA 4KV8B 2VONA 1DURA 2HRUA 3FSXA 3ZZRA 3CJQA 2GQCA 2NYIA 2IYIA 1U0HA 2ZBRA 4PPDA 4DG1A 4YUDA 2HVDA 2WVFA 1ZM4A 2XHWA 2ACMA 3DRRA 3PIPQ 3Q23A 8ATCB 2VDHA 1HBOA 1RWUA 2YNFB 3DOMA 3DI6B 1GT8A 3TAMA 3TEHB 3MEEA 4N77A 2VC1A 5FIIA 3G8QA 2VFTA 4DQPA 2AGPA 5I3UB 4QYZJ 1TK5A 3M32A 2FZGB 1VFJA 2DHHA 4NYZA 3LTOA 1S12A 5J2NB 2WTFA 2E1CA 3CJSA 2MHNA 4FNHA 4KBIA 1KHWA 3MEKA 2ZHBA 2DGWA 3OTCA 3EPIA 4ILMA 1WC3A 2B4OA 2ZH4A 3BQ0A 1TVRB 3H5UA 4YDDB 5KFZA 1RT3B 2XI2A 1S1UB 4O0IA 3PEJA 1SQGA 2YWHA 3EDQB 4RNHA 3V2UC 4ZPCA 5G4DA 4DV1F 1D9FA 4ZVHA 4RNNA 4KFBB 3TRGA 3VAGA 4DFMA 4ZP6A 4KKOA 1SJFA 3MEGA 1UVIA 1YRUA 2VC0A 1S1VB 4LF5J 3DN9A 3ITHA 4FF1A 1VCTA 2IBOA 2DH7A 3BSAA 2Z2YB 3MM5B 3U1NA 3KJVA 1WWHA 1NEEA 1TL3A 3O3LA 1BLUA 3T41A 4LQ9A 5D77A 4CLKA 2DPJA 4F4WA 3VCDA 5FLXY 1U1RA 3MOJB 3OR1B 1SC4B 4USUA 3PW2A 1WKJA 1RYSA 4WWSA 3VVUA 5AE1A 1HNVA 1HQEA 2YWFA 4R8UA 2CFXA 1N5SA 3CJTA 1UEUA 4DWIA 4CWBA 2JLGA 4PG4A 2MJNA 2LDIA 4IOBA 4F0MA 1UWBB 4RBUA 3P49B 1M1KT 4HHHA 4HI2A 4CM2A 4EEYA 4U7UK 2BACA 3D67A 5LSLA 1C1CA 2HLUA 2ZUGA 3HSZA 4K50A 3V5RA 4XK8C 2D3ZA 2N3OA 3LWLA 4QCLA 3WHIA 3O8WA 4ID5B 2ZWOA 3RRHA 2V2KA 3HD1A 4HACB 2YPYA 4CO1A 1E6VA 2NQPA 2P9EA 1KQGB 2QN6B 3TEGA 3CDEA 3DLGB 3ZZ0A 5J2QA 2PEHA 1TFWA 4YOEA 1Y10A 3D0GE 3PHEA 4MYUA 3NXZA 2F1FA 4WP8A 1FK9A 3W2VB 4IRDA 3R2DJ 2XS7A 3NGDA 1S1UA 2EC0A 4DR4J 4Y65A 4YP3A 1KLMB 2VOPA 4BDPA 1RWXB 3V4MA 5RUBA 1VRTA 4BLGA 2WBRA 5FLXU 4B9MA 5C7PA 4J37A 2BX6A 2I5JB 4DSKA 2UXCF 1UEKA 1FT8A 1Q8LA 1T03B 1RTJA 4DSEA 3V4IB 3NY0A 1NK6A 2OFGX 3MECB 4OJHA 2BE2A 1G2EA 2HFVA 2LEAA 5J2MB 2J0XA 1BY9A 3ZZOA 2E5LJ 2G2YA 2FJWA 3DRSA 1A0OB 4JI8F 5HVGA 1U1MA 2BKNA 4BWMA 4A8WA 4QIGA 3GG0A 2WAQD 2BQUA 1O8BA 1FXDA 1W25A 2XWXA 9RUBA 5FJ4A 5D3GA 4TQSA 3Q8RB 4F2RA 3ADAC 4B02A 4FNIA 3OL8A 1I6JA 3IP0A 3MMBA 4M5GA 2XO7A 3AB4B 2AYBA 2HNZA 2GQQA 2ROEA 3C2PA 2H5JB 1EHWA 1U8WA 1YKWA 2YKAA 4N5SA 2IPOB 1TV6A 2R7WA 2MEWA 3FEZA 3VF0B 4GC7A 4PXEA 4B3SJ 4K59A 4R0EA 3OVAA 4WF9Q 2JJ4D 3B82A 4YR0A 8RUCA 4NMXA 4QIWD 4RBTA 3CTRA 1R27B 4IQXA 1GFWB 3BKUA 5DG7A 2ZC4A 3G8TA 3G71S 2BW7A 3MR3A 3CUNA 2HHTA 2AJ0A 1XR7A 3RBEA 5K5MA 5KFQA 4UY8T 2JWNA 1N32F 1RT2A 3GILA 2CNLB 4QQBA 2RB7A 4KGKA 5CCMA 3QLHA 3A13A 3FBFA 1U1OA 2UUWA 1EETB 1XMQJ 2N4DA 2Q6BA 3KLHB 1X4AA 4CH0S 1WG5A 2VA2A 3R1HA 1KOHA 1WC0A 4CNYA 2LCWA 2ZJRQ 1D09B 1ZA1B 3NKYA 4FBUA 3I5BA 2E5HA 1XNQF 4ED0A 5F8MA 1I51B 2BJDA 1NK9A 3NMRA 3KJQB 2HZVA 2XB2D 2B6AB 3I0RA 5HO4A 3FQKA 1E6YB 3PVXA 1WTFA 3BREA 2F9JA 1EJ7L 1FI4A 3HJVA 3NS5A 2WSEC 4JI2J 4IQMA 4DCJB 1EKSA 4RW9A 1U6BA 3KKFA 1YX2A 2KN4A 2M2BA 1JJ2R 2OMOA 2QA1A 1X4CA 4WIIA 4DEZA 3G9CA 5DLGA 5DQIA 2WVDA 2XTJP 3OQ2A 1LW0B 1VQMS 1KDNA 3AY0A 1NHKL 1FJCA 1ZAVA 3P3DA 2E44A 3DXBA 4U95A 4ZPDA 2RS2A 4NE9C 4RW8A 2K1RA 2E9RX 4IG3B 1VC0A 4ZVRB 3HM9A 2HMIB 2Y8YA 3K0JA 2GIFA 3I55S 3FSIA 2GMHA 2LQBA 3FBBA 3E51A 1SJ1A 2CJAA 3PFEA 2XC9A 4FF2A 3B4MA 1CC8A 4JBCA 1BQNB 2B4UA 4LF6F 4M5JA 2RF2A 4W4MA 4QWEA 2KTQA 2DITA 3CMES 2LA6A 3D6TB 1HBNA 2MQOA 2Y1JA 3CCLS 2RT3A 1SL0A 1VBXA 3SFGA 4F4ZA 2VG6B 2CVIA 3SIPB 2IVMA 2RRBA 4F3QA 1RCXB 3F56A 5KG0A 4ZMMA 3H25A 3TI0A 3DOKB 3HULA 4NX9A 2WCXA 1ZZFA 2ERRA 1J27A 3NEKA 1U45A 2K06A 1K1SA 4OYOA 1N5YB 4DFJA 2YVSA 4TY8A 1HNXF 1VLYA 4ELUA 4EU0A 2H4WB 1FEEA 1JLAA 1RADB 5F3TA 3TZZA 1RKJA 1AW0A 2CPHA 3LGHA 5KT6A 1UL3A 2YWKA 2FLLA 1ZPWX 1R8AA 1TVRA 4DR7F 2ZKTA 5IM0A 4OJ1A 1W2BR 2UUCJ 1U02A 2FIUA 1TL7A 1ZM9A 5HAOA 2XYPB 1QD1A 2JFKA 5CYQA 3ILOA 3KK1B 3G86A 3R8YA 3ILIA 4WE1A 4NEYA 3M30A 4X4VA 4NEZA 1FNXH 4F4AA 4OX9J 4FXDA 3Q0AA 4CYUB 1KVJA 4PWDB 5CA5A 4Q43A 5ETRA 5DETA 2IFXA 5ETVA 3RB6A 2BR0A 1OPZA 3VQSA 1AROP 2PA8D 3C15A 3DRXA 4H54A 4USVA 3TVZA 4BWJA 1KOOA 4Y2AA 1K47A 5HMZA 5H9EK 2HIYA 2X3GA 3RBDA 3MFIA 1YBTA 5L1JA 3DGPB 3GCXP 4P9SA 1UZHA 4Z7YA 1PAEX 3X3UA 1IJFB 2EFQA 2XMAA 4JI4J 3JQJA 1PILA 1PJ7A 2BYCA 5LXRA 2W7PA 4J9RA 3TUIC 3SYZA 3OTDA 1SKSA 2XY5A 4PUOA 4O4GA 3M8ZA 4K4UA 2ASLA 4DV3F 1HHSA 2W4PA 2KL8A 1W7WA 3MI7X 2IY5B 2M7SA 1OO0B 3ZC4A 1S0OA 4DL4A 3DYAB 4X65J 4TY9A 2KM8B 2J6UA 3EWGA 3WX8A 3D4JA 3KLFB 1J5OA 3R7NB 4NLRA 4UY85 1IR0A 5K14B 3Q8YA 4LF9F 4F67A 5A6WA 4OZ2A 1XMQF 2IAJA 3D3CJ 5JUMA 5IT9Y 1VOMA 3KXDA 2V63A 2M3DA 4TLRA 1VDHA 2KVIA 1Q82T 1U8SA 1YJWS 3NRBA 5B0DA 1JMTA 3ET6A 3BJYA 3PR5B 1RWPB 3CE8A 4AL7A 1HWJA 1PYSB 2CPDA 4QU7A 1JWWA 5IM0B 3QO9B 4BHQA 4N56A 2ASDA 2YKQA 4B3MF 1WJ9A 1EQ0A 1VIXA 2UUTA 2ZDPA 4RPFA 3RBXA 3R6GB 3ZTOA 2A0FB 3HDSA 2JDJA 2BZ2A 3NS7B 3KUHA 4DJBA 5KFIA 5KOWA 1OJ4A 4L3NA 4PQUB 3M7VA 1XJWB 4CYUA 6AT1B 1VYAA 1DQ8A 2NUHA 2HGMA 1GTHA 1QAXA 4TVAB 5K8PA 3MM8B 5EWEA 3OVBA 4RW7B 1KP6A 1V3RA 3PO5A 5L9XA 4RW8B 1Q5YA 2VOOA 4NXMJ 3TJAA 3BB5A 3UDCA 3CIZA 1S9FA 2ILZA 4B9NA 4R5PA 1RHUB 4YHHF 3U1LA 5DGBA 4DV0J 1JLQB 2MMYA 4RBVA 2G1DA 4NA3A 3JS9A 4OI6A 1FF2A 1U6ZA 2NUUG 3SI8A 4AFFA 4X66J 5JVHQ 2DR6A 6FDRA 1VRQC 3GIKA 1GMWA 2W01A 4KAIA 4OX9F 4DPYA 4C7QA 2B5JB 4PG5A 2UUCF 3T1AA 4C11B 2QLJB 4IKAA 3V6JA 3V6DA 3NP5A 4YQWA 2UU9J 2QA2A 1RA6A 3N5FA 5LOQA 1K8AT 2CJXB 3J7ZT 2UVVA 3UI3A 1XNRF 1P27B 1KTVA 4CZCA 2C3YA 5H9FJ 3MEGB 5GADI 1ICEB 3JQMA 1CS4B 2OEKA 3IBFB 2YPZA 3S1TA 4EZ6A 1RAJA 2LLZA 3C19A 3LGMA 5KT7A 4IRKA 2RILA 4JP8A 5KFLA 2AGQA 2R7VA 3BF4A 3HHLC 4I56A 1RZMA 3OR1A 2Y9HA 2BJEA 4LFBF 4ZITA 4WKRA 2GVDA 3OD2A 4CH7A 2DYAA 4RX6A 2B4VA 1C4AA 3BBCA 4R25A 3LA0A 2JSXA 2N3LA 3TUJC 1HI0P 1TL3B 2IM3A 1VQ5S 4B3OB 3V4IA 3PW5A 1UMJA 4ECRA 4K4VA 1U7LA 2DHAA 3DDKA 1R0AB 2D41A 3KHHA 1N88A 4URQU 3B6BA 1APSA 4DV7J 1H98A 1VJWA 3PYFA 1IBCB 2WZ1A 3U7JA 5B09A 3OR2A 2RAQA 4XTTA 4HKQA 2VFVA 4RKUC 2VQFJ 4R8UB 3GSIA 1KRPA 2PD1A 2QL9B 2C3MA 3D6MB 4O3OA 2XO6A 3IG1A 3MPUB 1M5VC 3CCJS 2LP4A 2C2NA 4KE5A 3M8QA 2R8JA 1BXNA 1N5VA 2CQPA 3GLJA 5F3ZA 3JTNA 4XPCA 1C1CB 3AA8A 2UZAA 4DR3J 3C46A 2R8GA 1RAOA 2EC2A 3CO0P 1G6BA 1PC5A 3H20A 3HZGA 5E3RA 1T8EA 3AD7C 2IMWP 4NLYA 5GMDA 1WDDA 3BR9A 1SCJB 5CYJA 2EW9A 1FKAF 4HTJA 4NI2A 3MUVP 2W2QP 3KLFA 3UCUP 1SKUB 1QTMA 3BYRA 3W63A 2CKWA 5E7OB 1QDUB 2JLFA 5E3PA 5KAKA 1WNEA 2C2KB 3I82A 4CLLA 3HHKA 1QE1A 4NLGA 4LJMA 3G6XA 2UXBF 3DCAA 3L7OA 2YWGA 5T7LA 1WF0A 1A9NB 3BR8A 3K5PA 5FDLB 2R3VA 4ZP7A 1NJXA 2HHHJ 2MZ1A 3NG8A 3WIVA 5KFSA 3OV7A 4A8XA 3MXHP 3VVTA 1HWKA 5LMUJ 2F65A 2XLJA 3HCXA 3RYLA 5KFBA 2VJUA 1RWWB 1GXUA 2VG5B 1U6FA 4DSLA 1RBLA 3GV5B 5ITHA 1UWAA 3SZ2A 1LK5A 4X4SA 1Y5LB 2V2VA 1AYEA 2NSCA 2W2PP 3DRSB 2BOAA 4B3SF 4JI7F 2LMIA 1YJNS 4ZPVR 3IM8A 2GIRA 1UW4A 2J7WA 1S6UA 2HZCA 3UN5A 2M88A 1Y11A 4C0OC 1X0FA 1V5VA 4PABA 3NAIA 1FNOA 1X5TA 5T41A 2RQMA 3BO4A 1HQUA 1H73A 1YJUA 2EFOA 2ZOFA 1TMJA 3EGNA 4OYMA 2N7YA 2AQ4A 4IDKB 4LF4J 2G0JA 3ZZTA 2ASYA 3W64A 2FJEB 3E01A 1UVJA 1HBMA 2VZ9A 4FN5A 4DV2J 1BWEA 1HBOB 2YNFA 4NXMF 2R2UA 2VFRA 5D78A 4FYVB 4U7CA 2M9KA 2HG4A 5ETKA 1HW9A 4CRJA 4TU7A 3OTOF 1G3OA 1N33J 1VQYA 3L95X 4Q7AA 2KXHA 2HQFA 2HIQA 2DNZA 5I3QA 5A0YB 3THPA 3JXOA 1UVNA 3HJFA 2AEFA 3PV8A 3I32A 1WEXA 3M6XA 4Z2XA 3SCKE 4DDFA 2RDDA 4S0MA 5BYQA 3IFEA 1Q7LB 1TL5A 2NXJA 4OYZA 3G6VA 3Q22A 4NL5A 4U7UD 3LUYA 3FZ2A 3HSDA 1LWFA 3A8KA 1B7YB 1P6TA 1RDRA 3ENAA 3HX9A 4OYPA 3TVKA 4DPXA 3ZO7A 4EK2A 3R7BB 1RTDB 2COLA 1QLNA 4ED8A 4J9SA 3P8BB 4F4KA 3TX0A 1KTQA 3M30B 4NCBA 2DR7A 4X4UA 3JB9k 1EIYB 4KR0B 5AE3A 4O23A 5THWA 4C3MA 2H54B 2MZQA 2K3KA 2MGZB 1I5OB 4TU8A 1KC8T 4WFZA 4LFAF 4F4YA 4PG8A 4YFUA 1LKZA 1YG0A 2H3EB 5EWGA 3BGRB 1Q0NA 2GQ2A 2YQ3A 3IXQA 3PJXA 1ZOTA 1H3DA 1FKPB 1OMSA 4ICLA 3J7Z5 1B64A 2NREA 3HHLA 2EK6A 4QYZK 1XNQJ 2OAUA 1RBAA 5L1IA 5EDWA 4GO5X 2WW8A 2PMWA 3SXLA 2ASJA 4LF4F 2CJ9A 5GAGI 3UCGA 1FWLA 1TKXA 2VIHA 1X4HA 3MMCB 1JQGA 4Q8FA 4ATNA 1W26A 3CDBA 2D9OA 2DY9A 1HWUA 1XTZA 3N6MA 3UWTA 4DMZA 3A12A 2OPQB 5I3UA 2DH8A 2G13A 2RQKA 4M5HA 4OYAA 2ZM6J 1UAWA 4TYBA 5EGYA 3UD4P 1JKHA 1U49A 3W3SA 2KDOA 5DDOC 1H38A 2EFGA 1M1HA 1UVKA 4OZ5A 3CCVS 1RQ0A 1RTHA 1FE0A 3LGNA 3R5DA 1YDLA 4M5LA 5H1SV 3JYTB 2UUAJ 4IYQA 2Q43A 1HA1A 1LFPA 5G0RA 3MR6A 1O6XA 4N8NA 4JI0J 2A2CA 2Y1LB 3C6UA 2KG1A 2DHXA 2QV6A 3BEGB 1ZAXA 2H48B 2NXEA 3DM2A 4K0KF 4HVZA 4QR2A 3FFIA 3Q83A 3N6LA 2KZMA 2XY6A 3FDSA 3BH7B 5CYQB 4ALZA 3CJ5A 3D0HE 3PTWA 4KY3A 5JJBA 3KK1A 2I5JA 3GP9A 4L3KA 1F9EB 2GW8A 3RJMB 2GVDB 4CLFA 3DMJB 4RNOA 1S0MA 2EBGA 1H7WA 3MPDA 1RTIB 3SBMA 3ZNUA 4DN9A 5DM6Q 3MM6B 4NPOA 3HHLD 1N54B 1S9EA 1WC1A 3UO0A 4PXBA 4HL9A 5DZ7A 2VBYA 3Q8VA 2OELA 1IBLF 3T1YJ 2QL7B 4DF4A 2UXCJ 3R5JB 1LWEB 1VC5A 1J5EJ 1IWAA 5HVFA 2FLOA 4QR1A 5IV3A 3OBIA 3H2UB 3G8SA 1JLFB 2UVUA 2OLWA 1U09A 2CQ2A 2IDEA 4ZVUB 1F1BB 2FD2A 3N4WA 4RUBA 3HPOA 3OSPA 1JX4A 4C11A 1DRZA 2CPJA 2OI2A 4JB8B 1FJGJ 1AFIA 2CPEA 4RWWA 2MQ8A 3P5TL 5IQ6A 4GKKF 4AL6A 1ZS6A 4A8MP 3W9HA 1B7FA 2MLXA 2JC0A 1HBUB 4NLTA 2ATLA 2B4PA 4ANEA 1HLWA 4MK8A 4EBCA 5BXIA 2YQ0A 4FF3A 2M70A 5CH7B 1LEOA 3GYGA 5AT1B 1LK7A 2R2SA 1U0SA 2KB2A 4C2MA 3W66A 1S76D 1AB8A 4DX5A 3TZWA 3TP2A 5KOXA 5KFPA 4EBEA 4O0NA 2YNGB 1DTQA 1QUPA 2BKOA 2NPIA 3I56S 1IKXA 3CW2C 3W1YC 2JH3A 2ZH2A 2HHQA 4C8NA 2DPIA 4USKA 2RHQB 2FGCA 1MMNA 2EG2A 3QFHA 3V6DB 3BO3A 1L3VA 2HFSA 1IUJA 4ZLPA 4OYWA 4JI3F 3R9LA 3WIUA 3EZ5A 3LPEA 2BABA 2I0XA 4ZJOA 3RGIA 4DLGA 4ED6A 2QTWA 5DM7Q 1B0PA 3W2WB 2DY1A 2C2DA 3QIPB 1SJ3P 4ANCA 4DFPA 2HFOA 3FEXB 3QAUA 4J9PA 3IGNA 3QIPA 4USWA 3GWCA 2HK2A 2K3IA 2P6TA 1T0TV 1S7IA 3N9UC 2VASA 1WTBA 5A2QY 5ETOA 2R8HA 3MOZA 2F9DA 3R3TA 2FC9A 3PRBA 3BKTA 1RAHB 2DGVA 3T1HF 1JLFA 4CQ1A 2VDIA 2M8HA 4CLSA 4K5RA 4DX7A 3KLVA 4K2XA 3I4PA 4BS2A 2ZITA 1LWEA 3C8YA 4NCGA 3OUYB 1MMLA 3AHPA 4H4KA 3O1LA 2QSWA 4ZDNA 2AIRB 2OTLS 5DJBA 3CEDA 1C0TB 2BJ9A 3EM1A 1CJKA 2FVRA 5J1EB 2IMOA 2X7IA 4F7VA 1HBUA 2Z57B 2ROGA 1CJKB 2AJ4A 2IA0A 2PE8A 3H7HB 4Y6IA 4ES1A 1S4EA 2I38A 5I42A 1QSYA 1N32J 3DLGA 3SQGA 2FLNA 3J7A1 1RB0A 1S4FA 4MKVA 3NOGA 5HVHA 1S7HA 2Q1LA 1I3OB 4O4GB 1FX4A 4ZLNA 2FJVA 2RIJA 4IH7A 5KFJA 2E1MC 3JQKA 4DR5F 4NA2A 2XMWA 2HVHA 3KLEB 3GSDA 3HSJA 4KH0B 3HD2A 2R7TA 4G1QA 2B5JA 1FDDA 3W8GA 3KLGA 4FZVA 4HHUA 4X4TA 3G6YA 2J7KA 3PRDA 4NLXA 2AGOA 2EG1A 1URNA 2NXNA 3EVWA 2CJKA 4L72B 1U24A 4QYRA 5KFFA 2ZEJA 2CRLA 5K20B 4LFCJ 4WZQA 4V1Ak 5GMEA 2C3UA 2DNLA 1HWIA 3FCWA 2HGNA 5L1KA 3PNIA 4N7TA 1IBMF 2MY7A 4OX8A 4YR2A 1PKUA 2KXFA 1YJ7A 3KFWX 5ETMA 2D74B 1QSLA 1HMVA 3QPIA 1HNXJ 2HWIA 3W5XA 1SL2A 4PQAA 4JI8J 1QSSA 1D8ZA 1HKAA 1YBAA 4PZVA 3L7PA 1H2TZ 1MMDA 1VRTB 2V67A 2J8SA 2VF3A 1JNZB 2GMLA 3MUTP 1XR6A 3A3NB 4LBIA 1VK8A 1IKVB 3F44A 3DGPA 3IRXA 3FKBA 2DRAA 3T1YF 3KK2A 4DUTA 1QY7A 2HFUA 2FJBB 2KVQE 3QRQA 4LFBJ 3W60A 2J0SD 1R0AA 2V2ZA 4USHA 3GFXA 5CYMA 5K8MA 3GFHA 2ADBA 2EKYA 2EK1A 7FDRA 1F9FA 2G0IA 2CPYA 3QGIA 1HIYA 1CSJA 4KGMA 4O3NA 3UCZP 4ELVA 3IS9A 2J0QD 5KFMA 2BM0A 2OSQA 2GJ2A 2EVZA 3PYDA 2YNHA 5BYRA 4ZPWR 4WTYA 3V81A 4G1PA 3RZAA 1ACMB 1WACA 3MM9A 4ZVGA 4LIRA 1HYSA 4LR9A 1NAQA 1Z1ZA 3W5YA 3PZPA 3TAMB 4QWCA 1UFLA 2NSBA 1FK9B 4GVLA 4URSA 2R42A 3CJ3A 3W2VA 4DF8A 4B3TF 3FBCA 2I6WA 3RG6A 2AD9A 2ZE2B 2V4RA 2MUIA 2ZBQA 3AD8C 4OV6A 1RTHB 4DG1B 1RYRA 2P5VA 1NZ8A 4LVNP 3U1MA 3RR7A 4LBPA 4OL8A 2XSJB 4J9UE 4QW8A 5D4OA 4F50A 3DDNA 3WQPA 4WXWA 2JL9A 4DX6A 4DHVA 1TKTB 2HNDB 2ZBPA 3IAS9 2B8QA 2LVWA 3CB4A 3K2YA 4UUWA 4Y00A 3UR3C 2CZ4A 2QT7A 3UE2A 3M32B 1TKTA 2N4CA 2PIIA 2R7OA 2YWWA 2IIHA 4CTAA 2E1RA 3D66A 1F9HA 4C3LA 3QJJA 4X4QA 1P1LA 2F8MA 2HW3A 3Q8QB 4PQUA 2GX8A 3DHXA 3HKWA 2V8VA 2QA4G 3K57A 2G2ZA 2Y0BB 3JTOA 4EGLA 3FRYA 5L38A 1NH7A 2A1BA 3HHLB 4L74A 3SMZA 3OHAA 4DS4A 4PKDB 1UFKA 2MZJA 2FHKA 4WFNQ 4U6PA 3MUMP 4J9NA 4DR2F 4OZJA 3CWJA 2B6AA 1UEVA 2W1BA 4TKTA 1X4FA 5IC4B 2M4MA 5B7WA 4R5PB 3QGHA 2UXDF 2BV3A 2R7QA 4NA1A 3DDIA 3ETOA 4ILRA 2VFSA 2A18A 2FY8A 3TAQA 2DR9A 2DHSA 4IRCA 4DSIA 5ETPA 1H2UX 1MN9A 3OXFA 3D9BA 2OPQA 1TAUA 5IT9U 2F4VF 3OFHA 4CO5A 4OI0A 2CVEA 4EYHB 2ZH8A 1LWCB 1RKIA 3PX6A 2GHVC 2OH2A 2R7UA 1RT2B 1N4LA 3C3LA 3BH6B 4IO9Q 5KFYA 2W4DA 4ECWA 1SKRA 5HMWA 1DLOA 4ZN1A 1RACB 1BQMB 4X64F 2BDPA 2DNPA 3CC2S 4H4OB 1XIQA 1YQHA 4ZIVA 1H72C 4E8UA 1SIWB 2GGPA 2LXIA 2YX7A 3RW6A 2IYGA 4Y28C 2V8GA 1L3UA 2B9YA 1M90T 5CHCB 3AOAA 1TL7B 4XO0A 4WXOA 3NWRA 3PCOB 4JV0A 4J9OA 4ZS6A 2O1PA 3LF0A 2DTJA 2B7CB 1IQZA 3VV2B 3DNCA 5KT5A 3JYTA 3I9ZA 1T05A 3I0RB 4KSEB 5KG5A 4DV2F 1LW2A 3BPSP 2ZHOA 2HVIA 2BMBA 5KFNA 1JB0C 4CT9A 1WHVA 2V9KA 1C0UA 1FFGB 1JJCB 4OHVA 1FKPA 2V4JA 2WSFC 2G9OA 3BGUA 2FLPA 4P10A 4AD6A 4DCPB 1KONA 1ZYQA 2WVEA 1NK4A 4LF9J 2IRUA 1RT4B 1DJ0A 3C16B 3EMTA 1KWMA 4QR0A 4ZP8A 5KFGA 2V4QA 3K58A 2VQEJ 4ILLA 3Q89A 1WG1A 5L9NA 2HHWA 4DU7A 4WP9A 2KFZA 3TOQA 1X4GA 4M5MA 4MK7A 1VBZA 2QLWA 1N36J 5CXTA 1PJ6A 3HP6A 5HP1A 4NCAA 3BV8A 3TWZA 4IOAQ 1T9YA 4XIUA 2AZ3A 4ICLB 5D3GB 2X1FA 1S10A 3NBPA 4FYYB 5GAEI 2IC3B 1JXLA 4J9VA 1I94F 2HBZB 1IXKA 2VKZG 2QMXA 4HT5A 1QVGR 1S5ZA 4XDDA 3I9V9 3IN5A 3J7YU 2EWHA 2RU9A 2F8EX 2MQQA 2QG9B 3RRKA 4QJVA 4DV5J 3DLKB 4MIAA 3CNQP 2OD4A 1MROB 3FEYB 3L7UA 1VRUB 2DRBA 3PFOA 2HYIB 3G82B 2CQIA 1A6LA 1S1XA 2B9EA 2ZZNA 5HL7Q 1DQ9A 3D7SB 1MG7A 1S48A 5F9LA 4G1QB 1S1XB 3MD1A 2C1EB 3UVJB 2ZBCA 3EZUA 3TO8A 2MHEA 2UU9F 3DOLA 2NLWA 3GG1A 1GX6A 1NHVA 2CZ9A 1NPRA 4WP3A 2QJ3A 2PI4A 2FY1A 2HBYB 2QE5A 3CCUS 1T03A 1IVZA 2KJVA 2Y3YA 2BJ7A 2CPIA 2HS0A 2H51B 3M9MB 1X5OA 3MWBA 1IM6A 2FGOA 3UN3A 3D3BJ 1HR0J 3MURP 1FWKA 2AF6A 3CGIA 2E1PA 3MM5A 4A48A 3J81Y 2J76E 1FTCA 1Q1KA 2WOMA 4UQTA 4W92B 3X1LB 1Z2LA 3CSKA 3EPGA 1BD6A 3NL0A 3H4BA 3MR2A 2L9NA 3DFEA 2HFNA 1SI9A 1P9YA 2F4FA 2QGFB 3OR2B 4I6AA 1RHQB 4O3PA 3GB0A 2IVFB 2W8LA 1U48A 2H9ZA 2OEMA 3CULA 4K4SA 2DCLA 3AT1B 5J1EA 4ZVEA 2PSZA 1WUUA 4CLZA 1NBEB 3ILJA 1CPZA 4CDIA 2BJ3A 1ZTTA 3S8SA 2CADA 4MK9A 2GMJA 2MQPA 2V5HG 2J7UA 3TJ8A 5F9NA 1LW0A 2CQGA 2NYHA 4OX6A 3CJRA 2GCFA 4UW2A 4X62J 2XULA 5LMUF 1XN9A 5C25A 4DZ6A 1N36F 3D68A 3KG4A 3T9NA 2ZH6A 3CT9A 3SQOP 5IC6B 1AFJA 4IG0B 4TN2A 4LF2A 5HQMA 3A1YG 5GVQA 3CMQA 3I87A 4NYPA 3IWNC 4D3GA 5E3AA 4WPAA 2Z2ZA 2ZOGA 1MROA 2GHPA 4EYIB 1GQEA 3HT3A 4JI3J 2DGOA 4P72A 3VALA 2CPZA 5T7LB 2IM0A 2YX1A 3MMAB 4ECXA 4NZ6A 2QC3A 3TQ1A 1X9WA 1NCLA 4CNZA 5KFDA 3NMAA 1RWMB 4QIEA 2CQHA 2OPPB 3R97A 2Z30B 4M5NA 3UVJA 2ZZTA 1PYTA 4ID8A 4Y2KA 4M8LA 3TA2A 3T1HJ 2IHR1 1FKOA 2YKNB 1T05B 5A8KA 5HK4A 4I2QA 3BQ2A 1DTTB 2VPYB 1KVKA 2ZDOA 1RHRB 4HLBA 4OJ3A 2CQ1A 4ZVOB 2GV1A 1JJHA 3N0VA 3N6NA 4L6V3 5KFEA 2OEJA 5MAOA 4MTPA 4WIQA 4PWDA 4KQZA 2V0NA 1BWVA 2BUNA 3KJVB 1F2GA 2Z56B 3MAAA 1I94J 1HI1A 3P45B 5KFRA 4C98A 3M2UA 2GNKA 3R5CA 3F73A 4DL6A 1T95A 4PXDA 2U2FA 2MGZA 3RB3A 1NK0A 4B9LA 4DSFA 2HSEB 3WC0A 5IZHA 2BXJA 1VQSA 1PYOB 1S1WB 2APOA 5J1NA 2MB0B 4B9UA 3HI9A 4JI6J 4DLEA 2JX2A 1TUVA 5EX3A 2KXNB 3KWMA 3M8PA 5DGAA 1YK9A 1HHTP 3D28A 2WHOA 3C15B 3KHLA 1FRMA 1FVSA 2A10A 2DO4A 1RWVB 2HBQB 3MCMA 5KFXA 4I6YA 3OSNA 4DV1J 1KD1T 4IR1A 1EX8A 1K9MT 3UW1A 1NB2A 4DL3A 5AJ3F 2PDAA 1N33F 2C42A 1WC4A 4DR4F 3CCSS 5J2PB 4DR3F 2LKZA 1Q53A 3EUNA 3J80U 2SXLA 1O0PA 2MLZA 3UDVA 3FMBA 1NJWA 8AT1B 3VZIA 1WG4A 2XQCA 3PHTA 5L46A 5K14A 1U47A 4LRDA 2R4FA 4NLPA
chains in the Genus database with same CATH topology
2HRXA 2HAFA 2GS5A 2DO8A 2AJ2A 2MUIA 2EW0A 2GZOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HRX A;  2HAF A;  2GS5 A;  2DO8 A;  2AJ2 A;  2MUI A;  2EW0 A;  2GZO A; 
#chains in the Genus database with same CATH topology
 5A0Y A;  2FJD B;  1GEH A;  1SVD A;  2B9W A;  4NZ7 A;  2DIV A;  4O3R A;  3NNC A;  4YEA A;  4AXI A;  2V34 A;  1CS4 A;  1N34 J;  2CJQ A;  4JI7 J;  5HBM B;  2V6A A;  1X4B A;  2ATC B;  1HPZ B;  2X51 A;  1DQA A;  4IOC Q;  2E7X A;  4ITS A;  1H7X A;  2F5G A;  3C66 A;  1WOR A;  3GFY A;  4YS2 A;  1RWN B;  4LRA A;  3D1Q A;  2L3M A;  5KT4 A;  2EW0 A;  2NXC A;  3PO4 A;  2UUB J;  2RRN A;  3HVA A;  1ITP A;  2BAN A;  3UD5 A;  1GXL A;  4LIW A;  5CD4 H;  3G6E S;  1NJZ A;  2XMT A;  2HHS A;  3RAM A;  3N28 A;  3W9J A;  3IMQ J;  1D0E A;  2XS2 A;  2ZM6 F;  5IQQ A;  1MLA A;  3PXG a;  2DNN A;  1SC1 B;  1NJY A;  1WF2 A;  1YJR A;  2DR5 A;  1N6Q B;  1NUE A;  2W9B B;  1FER A;  3Q86 A;  4DSJ A;  1GAO A;  1HI8 A;  3B8H A;  2MTL A;  1OIA A;  1FRH A;  1LWC A;  1PG5 B;  1MU2 A;  3KG0 A;  2OP5 A;  2FUG 9;  2DEI A;  2YH1 A;  1Q8I A;  4Q44 A;  2R8I A;  4KGZ B;  1IM4 A;  4KGV B;  1Y5I B;  1G4C A;  1S59 A;  3KK3 A;  4Y2C A;  3PY8 A;  1Y9O A;  3IR7 B;  2XEX A;  4DUZ J;  2MZR A;  3S01 A;  5KT2 A;  2KM8 C;  2RDJ A;  2HAI A;  4RR5 A;  2MYF A;  5DDP C;  1BHN A;  3OFG A;  1LV5 A;  2M5Y A;  4UOF A;  1HNZ J;  1R31 A;  3SV4 A;  4A8F A;  4KHR A;  1ZPV A;  4P2X A;  3OLA A;  4W90 B;  3H42 A;  1XMO F;  5CYM B;  3C14 B;  4UT4 A;  5JVG Q;  1L5U A;  1HR0 F;  2H65 B;  1KFS A;  1VJQ A;  2GAG C;  2WRM A;  2LQ9 A;  4NOH A;  1DLO B;  3E3X A;  3DRR B;  3H40 A;  5KFV A;  4LSN B;  4OHX A;  2NR0 A;  4EI2 A;  4ECZ A;  1IN0 A;  4MKA A;  1RWK B;  3E01 B;  4JYA J;  4BBY A;  4DPT A;  4OHZ A;  3PW4 A;  1HYS B;  2AJQ A;  1JLA B;  2Z2L A;  3VAI A;  3KLI B;  5FD1 A;  3OFE A;  3P4U B;  3RW7 A;  4BC9 A;  4ZKA A;  1N5Y A;  2AYE A;  4DPU A;  2WON B;  3PJ9 A;  2DXF A;  3FFI B;  4XPE A;  4F25 A;  4MIB A;  3QZ7 A;  4UOH A;  2WK4 A;  2CNO B;  1LXN A;  1XR5 A;  1YJV A;  1CUL A;  2DIS A;  3C6U B;  4LRE A;  1XC9 A;  2HVZ A;  1IWG A;  3T5K A;  4KHM A;  3H4D A;  2VL1 A;  3BDP A;  5JXS A;  4GKJ F;  1IBK F;  1E6Y A;  4RO0 A;  2QYC A;  1V6H A;  1Q7Y T;  4FS1 A;  2Q6C A;  2KHC A;  1JLB A;  1T9X A;  1FDB A;  3GJS B;  2Q3P A;  4IFV B;  3TA1 A;  3MTK A;  1VQ8 S;  4B3T J;  4NLW A;  2Z58 B;  4CLY A;  4ECQ A;  3VR1 A;  2V2Q A;  3CJ8 A;  3HHE A;  5H9F K;  2OML A;  4F26 A;  1HQ2 A;  1K44 A;  2ZHA A;  5DDR C;  2JEG A;  2HMI A;  3BSN A;  2LXF A;  1C1B A;  3F0N A;  5BR8 F;  2U1A A;  1IJE B;  1NK8 A;  4ETZ A;  1UET A;  3AOC A;  1YRX A;  2BVZ A;  1X60 A;  2GVZ B;  2DNO A;  3I31 A;  1F5A A;  3R5G A;  4I2P A;  4KT0 C;  4ZVS B;  3KK2 B;  1HBN B;  2H4Y B;  2CQ0 A;  3M8P B;  1RT1 A;  2J9D A;  3HVT B;  3R6L B;  5F8H A;  1G1X A;  1OWX A;  3MM7 A;  2C2O B;  3GZ7 A;  4G65 A;  1Q81 T;  4R0J A;  1QJH A;  4IG0 A;  4YB7 A;  4YN3 B;  1UTA A;  2HWH A;  3EDR B;  2OKQ A;  4LSL A;  4JI6 F;  3P6Y C;  3HFK A;  3MED B;  3SDE A;  2L41 A;  2OSR A;  5KFU A;  2HKE A;  2ZH3 A;  4IDK A;  3C6T B;  2QO3 A;  2C2R A;  4F8R A;  1JJ4 A;  1R8B A;  3UR0 A;  4AT1 B;  4C6A A;  5HJY A;  1M5P C;  3ZXW A;  3GPA A;  3QLH B;  1FJE B;  2V8D A;  5HAN A;  3TQE A;  1FTR A;  3WX4 A;  4A4J A;  4DV6 F;  2XCA A;  2DO0 A;  4I1T A;  5HSP A;  2B7B B;  2E5G A;  2ZKU A;  1RTD A;  1KN6 A;  4NLU A;  1NRK A;  1NSP A;  1YI2 S;  3LAK A;  2EFP A;  2YKM A;  1UPM B;  2HEK A;  5DS7 A;  3KLG B;  1SIZ A;  3CIM A;  1LNQ A;  3BQ1 A;  5LM7 E;  4DL0 C;  1JXE A;  1FKO B;  2RNE A;  4CO3 A;  2DNQ A;  1RWO B;  2J5A A;  2XZT B;  3PW7 A;  2VIC A;  3MEC A;  4JI5 J;  1TL1 A;  2RKI B;  3GR0 A;  3BSC A;  4P75 A;  4AL5 A;  2FB0 A;  3ISN D;  3UD3 P;  1HAR A;  1TL1 B;  2RKI A;  3IBC B;  1SKW A;  4I69 A;  3KG1 A;  2XGQ A;  3MHY A;  3LOU A;  4BC7 A;  3GFZ A;  2JVO A;  3MAH A;  3MR5 A;  1U1Q A;  3NBP B;  1B99 A;  3RR8 A;  1OY9 A;  1NSQ A;  3OXL A;  1C0T A;  1OPI A;  3MMB B;  1RTZ A;  3CJK A;  4JI1 J;  5A2Q U;  4J9Q A;  1GXT A;  1RP5 A;  4CO2 A;  3NS6 A;  3NGK A;  4CO4 A;  1RT1 B;  4Z37 A;  4LVO P;  4EFA C;  4A8S A;  2YNI B;  2YKP A;  2D3O 1;  1Q5V A;  5F41 A;  3T6B A;  2HS3 A;  3DGV A;  4NCG B;  4W98 A;  2HQI A;  3D0I E;  4OX7 A;  4JI2 F;  4JUZ A;  2IM1 A;  2EKN A;  1KQF B;  1S99 A;  2P6S A;  3D2W A;  4C9D A;  2NXU A;  2KT5 A;  2CIM A;  3C6T A;  3HFV A;  4P7V A;  5ETN A;  5KG1 A;  2Q66 A;  2DGQ A;  1ULR A;  3M1V A;  4IR9 A;  5F0U A;  5IT0 A;  1YJT A;  2PA3 A;  3D5M A;  3DOM B;  4RWX A;  5SZT A;  4UST A;  4X4P A;  2BQ3 A;  2BEF A;  2P9G A;  4CM0 A;  4FF4 A;  3SV3 A;  3NGT A;  5E2Q A;  4J9M A;  4JI4 F;  2IJR A;  2IRX A;  2ADC A;  4OQJ A;  4JYA F;  2R7X A;  2YKN A;  3UNG C;  2FDN A;  1FCA A;  4ZP9 A;  4TXS A;  3ZTS A;  1X9M A;  3K59 A;  2FYX A;  1R7I A;  3AD9 C;  2JZ5 A;  1R3N A;  2DR8 A;  4HHJ A;  1RIS A;  1ZA2 B;  5IT4 A;  1HMV B;  3LAN A;  3AOD A;  5BYS A;  2DNM A;  1CJT A;  3DOL B;  3IR6 B;  4WYL A;  2MY8 A;  4X4R A;  2VOD A;  1U1L A;  2VBX A;  3V6K A;  4F02 A;  2RDI A;  3CC7 S;  3CD7 A;  3M8Y A;  5KG6 A;  4X62 F;  1P9Q C;  1HNW J;  1PCA A;  4OZL A;  3TX8 A;  1VIS A;  4YY3 J;  4OLP A;  2QIF A;  3TJ9 A;  2E7V A;  2QMW A;  3KHR A;  1Q78 A;  3UFC X;  3AXM A;  3M8R A;  2QLX A;  1WDT A;  4DCO B;  5IFM A;  2O3D A;  2AYM A;  4A46 A;  2DCU B;  2DD8 S;  4RW7 A;  1WSV A;  1P8G A;  2D69 A;  3A8E A;  2FHJ A;  2E29 A;  3K5M A;  1UCN A;  2BBE A;  2GIQ A;  5KG3 A;  4DL5 A;  1YVF A;  2GJI A;  2CQ3 A;  3BM7 A;  1EZZ B;  2VBZ A;  2Y0S D;  2MQN A;  2MST A;  1IKY B;  1CJU B;  1LOU A;  2B43 A;  4JI5 F;  5CCL A;  3KNA A;  3R7S B;  2ALY B;  3LO3 A;  4PWU A;  4KRW A;  1SC3 B;  4KIA A;  1N52 B;  3QAT A;  3KOA A;  2FJX A;  5D8H B;  1NSK L;  2XG8 A;  4OZN A;  4ZPA A;  2BM1 A;  4DR5 J;  4MT1 A;  3IBW A;  3M4X A;  4I0W A;  3GIR A;  3PIO Q;  4JV2 A;  4I68 A;  1H6K X;  4YDX A;  1UA0 A;  2NZ4 A;  1PAU B;  4B3R F;  3JSR A;  5A6P A;  4UUX A;  1Q16 B;  3ITH B;  3ZTR A;  1LW2 B;  2W4C A;  1WHW A;  1FRJ A;  3W9I A;  1D9D A;  4F2S A;  4MIW A;  3ISN C;  2AWZ A;  1SQF A;  3NGU A;  2HVE A;  2CQC A;  3FK4 A;  4CIO A;  2YKM B;  2V9W A;  3PW0 A;  3EYZ A;  4Z7C A;  3POT A;  1CUL B;  1CG2 A;  4JV1 A;  2QLF B;  5IWA J;  3N5B A;  3QO9 A;  2L08 A;  3Q8S B;  4K5S A;  2HQD A;  3LP0 B;  4OYB A;  3WBZ A;  4WE1 B;  4CH1 A;  4A8K A;  4NLO A;  1BE4 A;  4DR1 J;  3EZO A;  3FCH A;  3DKD A;  3GYX B;  4YHH J;  3BGF A;  4WU3 A;  1JLE B;  2W2O P;  5MLC V;  5E5N A;  2JC1 A;  1DHM A;  3QID A;  2MKH A;  1C2P A;  3M9N B;  4P2S A;  5K8N A;  2VFU A;  1EQM A;  1ZAW A;  2O5D A;  5GAH I;  2G1H A;  4LF5 F;  3R5A A;  5A8R A;  5C5J A;  1TFY A;  5CZV A;  2QFJ A;  1S1W A;  1URR A;  1WF1 A;  2M52 A;  3EGV A;  1YTY A;  1R8C A;  1YGY A;  4NAS A;  4KTQ A;  2F4V J;  1JXV A;  5L1L A;  4RLE A;  3FNN A;  4JV5 J;  5GAD U;  3QSI A;  1HFE L;  1T02 A;  4Y0F A;  2MKS A;  2VG6 A;  3TYT A;  4EUV A;  1WEL A;  5DQH A;  5EN1 A;  3UQS A;  5IV4 A;  4YB1 P;  2CG8 A;  4C97 A;  1NM2 A;  1XEZ A;  2YX4 A;  3AJ1 A;  1HPZ A;  3ICL A;  1O5J A;  1KS2 A;  3S7R A;  3M9O B;  3BSO A;  2FQQ B;  2X1A A;  2OPR A;  4OI1 A;  3GU0 A;  4ZPT R;  2I1R A;  5C42 A;  5LJ3 Y;  3SSQ A;  2DGU A;  3US5 A;  3HMJ G;  1MWZ A;  1ZET A;  4MKB A;  1LWF B;  1YZ6 A;  4C48 A;  2M0G B;  1XQI A;  1BGX T;  1N6Q A;  4FYX B;  4WJB A;  5HN0 A;  3KLE A;  4NWB A;  2H5I B;  1HL6 A;  1S1T B;  3MD3 A;  2CA9 A;  2V50 A;  1J5E F;  3IWL A;  2FHJ D;  5KFW A;  3LP0 A;  4C3K A;  3SSR A;  4DBQ A;  1QTN B;  3OJS A;  4UOC A;  1Z4U A;  2QEX S;  2HNY A;  2B0G A;  2RD5 C;  3ONQ A;  2DVI A;  3K89 A;  1GK8 A;  3NWG A;  3AJ2 A;  3OFF A;  4FDF A;  4F36 A;  3PYE A;  4WFX A;  2B9X A;  1VI7 A;  3QT6 A;  4Y2M A;  1HNZ F;  2CNN B;  3OL6 A;  3IRX B;  1M0S A;  1F2H A;  3M6W A;  2BW2 A;  2D1C A;  3MGJ A;  2LEP A;  1RT5 B;  4IG3 A;  5EX0 A;  1DZ5 A;  3C14 A;  2VQE F;  4Q8E A;  3QWP A;  1UJ4 A;  5DG9 A;  1Q95 G;  1MSW D;  1S57 A;  3M2U B;  1PC4 A;  1UW9 A;  2W8K A;  2C28 A;  1FHT A;  1IR1 A;  1IKW B;  4UOG A;  2J0W A;  5I3P A;  1NND A;  2OJ3 A;  1RBO B;  4RZR A;  2FTR A;  3P96 A;  4FKX A;  3HVR A;  2AEJ A;  1CJV A;  3A4T A;  3KK3 B;  2ZC3 A;  1SH3 A;  2VUG A;  5I42 B;  3RB0 A;  2P2C B;  2HLT A;  3B78 A;  2BE7 D;  3A8I A;  5AXK A;  3OW2 R;  3KUG A;  3VGT A;  1JNR B;  4MJK A;  4K4Y A;  1NU4 A;  4KB7 A;  4NI2 B;  1KEK A;  3GII A;  4ES3 A;  4PXC A;  2DEJ A;  5E3C A;  5C42 B;  4ED3 A;  3KMQ A;  3TZY A;  2VH7 A;  1RT7 A;  2PO4 A;  1JLG A;  3QFW A;  3OTE A;  3CPW R;  2WBM A;  1B0V A;  5E3Q A;  3CF5 Q;  4DQQ A;  3DOK A;  2XNQ A;  4X2B A;  3IO1 A;  3R27 A;  4HEA 9;  2MZT A;  1R89 A;  2FHO B;  5D0G A;  1EP4 A;  2VV5 A;  1AT1 B;  1NDK A;  5CQG A;  5A8W B;  2W9C B;  2LYV A;  2YWE A;  1RAG B;  2BJ8 A;  3H0P A;  3D54 A;  2UVW A;  1PBA A;  4LFC F;  2AJF E;  1T9U A;  2I8E A;  5H9E J;  2HRX A;  2W2N P;  4FBT A;  2OUG A;  1N5T A;  2VG5 A;  3THT A;  4USI A;  5HMY A;  4OYI A;  2J9E A;  3KNG A;  4OHW A;  4EMD A;  3K5O A;  3NGS A;  2CWK A;  4CTA B;  2PEB A;  4B3O A;  2B3T B;  3LH2 S;  4LT6 A;  3EVO A;  2EFN A;  2MQM A;  1U2R A;  1S0N A;  2XLI A;  1L3S A;  3DLL Q;  3M2R A;  3JAM Y;  2QMU B;  5KFO A;  3J7Y I;  1PIE A;  2OO4 A;  2MKJ A;  3HHD A;  3LP2 A;  4NLQ A;  4DI6 A;  4E0D A;  1I1G A;  3MED A;  3SDE B;  4OFZ A;  3JAM U;  4IH5 A;  4H4M B;  2E5J A;  3MPY A;  5DLF A;  4I6W A;  2ZJQ Q;  1REG X;  4DV7 F;  1BQN A;  4RUH A;  3HXM A;  4ED2 A;  3T3F A;  3ENV A;  2IM2 A;  2MSS A;  3MM7 B;  2GAH C;  4QWA A;  2AW0 A;  2PGC A;  2UUA F;  2MKY A;  4GKJ J;  3M2V A;  3FCV A;  1X8D A;  1X31 C;  3FMW A;  3GJR B;  5C25 B;  3MR7 A;  1SH0 A;  4FP9 A;  2P8I A;  2E5I A;  2LU2 A;  3ISZ A;  4X84 A;  4ETX A;  2ZJP Q;  2IDL A;  3GJT B;  2GA7 A;  3ENQ A;  3OPK A;  2R7R A;  3MMA A;  2ZZM A;  5J2P A;  3SCL E;  5HJX A;  2YNG A;  1ROF A;  1K73 T;  4OJG A;  2R7S A;  3QZ8 A;  5F8L A;  9ATC B;  3NCQ A;  1H74 A;  4C8M A;  1YJ9 S;  4KC5 A;  4NRU A;  3VTI A;  3R1L A;  5F8I A;  4NXN J;  2V69 A;  3BGO P;  2KYX A;  4Y34 A;  3H5Y A;  1EAR A;  1R0C B;  1V3Z A;  2RS8 A;  3GJQ B;  5A8K B;  3CDW A;  2NPF A;  3PR4 A;  5HLF B;  4A8Q A;  4P6Q A;  3T5L A;  3PAC A;  1YIT S;  3ZTP A;  1FA0 A;  4GVB B;  4U9R A;  2MKC A;  1H0H B;  2VU5 A;  2H1Y A;  3UDE A;  2N7C A;  1AXQ A;  2RE1 A;  5HI7 A;  5CD4 A;  1CJT B;  3JSM B;  1DY3 A;  3HO1 A;  2DXE A;  2WB4 A;  1VQ9 S;  2UV8 A;  2K7K A;  4MMO A;  3W5Z A;  3DHW C;  4RUA A;  2LDY A;  4MYT A;  2FPH X;  2WB1 D;  4GMK A;  4KKO B;  2HS4 A;  2R9L A;  5B0A A;  2YNI A;  2AT1 B;  2CG4 A;  1AZS B;  2CQD A;  2K8G A;  2KJW A;  2V68 A;  2CQ4 A;  2RHS B;  3CCE S;  3FZB A;  5HP1 B;  5AXL A;  3T19 A;  2EEY A;  4YR3 A;  4ECU A;  1FNM A;  4OHY A;  4DV3 J;  2UXD J;  1B70 B;  2YXL A;  4KGX B;  3CJK B;  3TZX A;  3QJL A;  3TNV A;  5KG2 A;  3CCW A;  3QRR A;  5HQ8 A;  2R2T A;  1BMQ B;  2HQ3 A;  4XDC A;  1HNV B;  1HQE B;  3HFZ B;  4KJI A;  1NDL A;  2ZFH A;  2K2P A;  1QVF R;  5ETQ A;  1IKW A;  4QU6 A;  2LEC A;  4LUB A;  1K0V A;  1GTE A;  5DZ6 A;  2AX0 A;  3M8Q B;  3ZZY A;  2HFZ A;  4Y3C A;  3SQG B;  2IBK A;  4C8K A;  4ER8 A;  3J7A N;  4J91 A;  5M2P A;  1GMU A;  3MCS A;  4MFB B;  3VZH A;  3NCR A;  3ZNJ 1;  1YIJ S;  3L4B C;  2HHV A;  4HH0 A;  1N5Q A;  2DBB A;  1U1P A;  5EHH A;  1TK0 A;  4KV8 A;  3VAJ A;  2LQJ A;  4ENO A;  2OPR B;  3M1V B;  2CXE A;  3RUB L;  1RHK B;  1VR6 A;  2OD6 A;  2VJV A;  1ZH5 A;  1VGY A;  4QPT A;  1GMV A;  3VAH A;  1RTJ B;  2BRL A;  2OHD A;  3OXG A;  5DQG A;  1S97 A;  4YB6 A;  2GGP B;  3MEE B;  3ET6 B;  2BAN B;  5F0W A;  3VGV A;  4ZIW A;  4DV4 F;  2WW4 A;  1DFD A;  4F4X A;  4ECS A;  3VAM A;  2D3U A;  1XMB A;  2XMV A;  1D3W A;  2DNY A;  3DM2 B;  4U67 Q;  1MWY A;  3QGP A;  2V4J B;  1RAA B;  1FJG F;  1JLC A;  3CDA A;  4M5K A;  4B08 A;  1VC6 A;  2KT3 A;  2WVC A;  2F7V A;  2X1G A;  4A47 A;  3Q8P B;  2IJF A;  1C4C A;  4DQS A;  1NO8 A;  4P74 A;  1F60 B;  3DLJ A;  1JLQ A;  2VG7 A;  2W9A A;  4ED7 A;  1UVL A;  1HNI B;  3MF5 A;  4U8Y A;  1OYE A;  3GQC A;  1TKZ B;  4TLQ A;  2W7O A;  1IBL J;  1IR2 A;  2FVS A;  2XCP A;  1NSA A;  1NXI A;  5AE2 A;  2ZD1 B;  3PJW A;  1Q79 A;  3ZFV A;  3J81 U;  3G4S S;  2OTJ S;  4GKK J;  2E7W A;  3VWS A;  3MM8 A;  3SCJ E;  3IWX A;  4NYO A;  2XMM A;  3MZI A;  1LQ9 A;  3BYP A;  2HPU A;  3T9Z A;  1XER A;  1PO6 A;  1RU2 A;  3DU5 A;  3CCZ A;  4B3R J;  2CUY A;  1RJJ A;  2QFI A;  2AHO B;  3MMC A;  4P52 A;  4C0B A;  4X64 J;  2DIU A;  2CNK B;  1XNR J;  2MZS A;  1QAY A;  4OMF G;  1WI8 A;  2DNK A;  4HH1 A;  4IH6 A;  2JVR A;  2MXY A;  4HR2 A;  4OYX A;  4H4K C;  3PEH A;  3GE9 A;  3HZE A;  1T9V A;  1UJ5 A;  4N8O A;  3VGS A;  3VGU A;  3DLH A;  1XMO J;  2Y8W A;  5C24 B;  5F8J A;  1F3V A;  1OS5 A;  2DJW A;  2XYH B;  3PG9 A;  4K7Q A;  1S9G B;  4YME A;  1WHY A;  3CCT A;  1N48 A;  3EXY A;  5J1P A;  2MPU A;  2NCK L;  4F3O A;  4LF7 F;  1FJ7 A;  2DO8 A;  2VKR A;  5D15 A;  3OHB A;  1M5S A;  4DUZ F;  2KRB A;  1FRI A;  3H2L A;  1R8P A;  2CDQ A;  4KFB A;  3NCP A;  1NK5 A;  4PYD A;  1D1U A;  4CLP A;  4ECV A;  1GH8 A;  3PX4 A;  1UKU A;  4ZJL A;  4M63 A;  1JLC B;  1X7V A;  5KFA A;  3E2E A;  1ELO A;  1GNK A;  1KKH A;  1SUQ B;  4HT7 A;  1Q86 T;  5HAT A;  2W9B A;  4NXN F;  2A3J A;  2HNY B;  1D9A A;  1BUX A;  1SQE A;  1U26 A;  2EXU A;  1Y3K A;  2HAF A;  2OPP A;  2VD3 A;  3BBF A;  4L75 A;  5L8R C;  3RRG A;  2F8H A;  1M5H A;  4IFY B;  4UF4 A;  2LU1 A;  1REV A;  5LSO A;  2DB1 A;  2WSC C;  1MW7 A;  1U1K A;  1RAI B;  1WSR A;  2OPS A;  3KYL A;  4FYW B;  1X9S A;  4LRB A;  3I5A A;  4QOT A;  5C2G A;  3ZZP A;  4C0H A;  4AQY J;  3MPW A;  4M95 A;  4DFK A;  4LF8 J;  2XNR A;  5KFH A;  2BE9 B;  2RML A;  4P71 A;  3VQT A;  3D6F B;  3SSS A;  4DV4 J;  3EGZ A;  1VQP S;  1IBM J;  1T94 A;  2OGU A;  1MWQ A;  2KKH A;  3KJF B;  3MM9 B;  2GO9 A;  1RGV A;  2CDR B;  3D1H A;  1S49 A;  3LQV A;  3W62 A;  1CQN A;  2JFD A;  2W7A A;  4ED4 A;  1O51 A;  1EET A;  1RLC L;  1RHM B;  1FD2 A;  1HW8 A;  2AZ1 A;  5B0F A;  2KRR A;  3UN2 A;  4DPW A;  1NB7 A;  3B54 A;  4Q45 A;  1IKY A;  1CJU A;  3ULH A;  1RK8 A;  1Y0H A;  1Y5N B;  5L39 A;  2C2M B;  3CD6 S;  1WD6 A;  3KMS A;  4PG6 A;  1WHX A;  2AJ2 A;  1VLO A;  5CAB A;  1OYD A;  1OQ6 A;  2ABY A;  3V6H A;  1FRK A;  3J80 Y;  4V19 J;  3TVY A;  4TY8 B;  4EZ9 A;  1ZZN A;  4UZB A;  1T9W A;  1TAQ A;  2UP1 A;  1YZ7 A;  5KT3 A;  5U47 A;  1FRX A;  5DG8 A;  2QL5 B;  3BBB A;  4DV6 J;  4Y2I A;  2ZVI A;  4MH8 A;  1VHF A;  4DQI A;  2K7J A;  5FDL A;  4DR6 F;  1VMB A;  2E1A A;  3FRZ A;  3GTY X;  2F3J A;  4EWT A;  3WC2 A;  1N56 A;  5AXM A;  1KLM A;  3HK2 A;  4E98 A;  2HHU A;  5E33 A;  1FX2 A;  4LQ3 A;  3POT B;  4RW4 A;  3GCW P;  1UPP A;  5KFK A;  2VPX B;  2ZVS A;  4NLD A;  1Q8K A;  3M8S A;  4RW4 B;  3E8O A;  3SEO A;  1NDC A;  4OI4 A;  1KQS R;  2MQL A;  3CO9 A;  3NOC A;  3L09 A;  5J2M A;  4KO0 A;  5GAH U;  5B0B A;  3I6P A;  3KJN B;  3L9Z A;  4DN0 A;  2N82 B;  4B9T A;  2XZW A;  2C22 A;  1FDN A;  1FRL A;  4RW6 B;  5IS2 A;  1R43 A;  3MAA B;  4L76 A;  2QX0 A;  4M5I A;  2PFF B;  3H59 A;  3BGL A;  1NPK A;  2G4B A;  4RL1 A;  5K9F A;  4DR2 J;  2E9Z A;  4ECY A;  1S6P A;  4FVM A;  3H5X A;  4C4W A;  2RF2 B;  2MKI A;  3IG1 B;  1SB6 A;  3PRV A;  5LL6 d;  3NNH A;  1SJR A;  1TL4 A;  1RHJ B;  1X4D A;  3HHN B;  2DRD A;  2LFV A;  1VHI A;  4X65 F;  2BOP A;  3NGR A;  2CPF A;  4HI1 A;  3AQO A;  7FD1 A;  2BQR A;  2CYY A;  2EI5 A;  4ZCI A;  3CC4 S;  2MLY A;  1CBK A;  3MMJ A;  3FQL A;  1WOP A;  5DDQ C;  3CCM S;  3GON A;  4JOU A;  2PC6 A;  1IKX B;  2PT0 A;  2C2E A;  5F8N A;  3UDL A;  1V3S A;  4CT8 A;  2LEB A;  4I64 A;  1YSJ A;  4RW9 B;  4B9V A;  3OTO J;  2R2R A;  1DAX A;  4DZD A;  4IFV A;  1DTT A;  1FWP A;  1SH2 A;  1HHQ A;  2FZK B;  2ZNZ A;  3B4D A;  1FXR A;  4G1I A;  2PFD A;  3GYN A;  3W2W A;  4DPO A;  2RU3 A;  1YRT A;  3NNA A;  5I4M A;  4J9L A;  1IQT A;  4WCE Q;  4UTG A;  2NS1 B;  3DMJ A;  2DXD A;  4BCA A;  1NKC A;  1U2C A;  4KH1 B;  4D3H A;  3H2V E;  2WOM B;  3LW5 C;  1FES A;  2KU7 A;  4IFY A;  2ROP A;  2NZC A;  3KDO A;  1S1V A;  2HZA A;  4TQR A;  2HNZ B;  2CJB A;  2DGX A;  5KFC A;  4B9S A;  4M94 A;  2Y1I A;  2DNR A;  4KO0 B;  5KG4 A;  4RUC A;  6FD1 A;  4UZC A;  4OZ3 A;  5CAA A;  3OVS A;  1UWB A;  2AJ1 A;  1CVJ A;  1SV5 B;  2EFV A;  4E2F B;  2KZZ A;  3NLC A;  3DLE A;  4QBU A;  2E9T A;  3AB2 B;  2XYG B;  4DL7 A;  2XMU A;  4K0K J;  3CJ0 A;  2ZWP A;  1TEL A;  2JLE A;  5LSR A;  2HRT A;  4PCQ A;  1VBK A;  1VRU A;  2IVY A;  4HAC A;  4NML A;  1B4S A;  1RAF B;  1Y4Z B;  2WVB A;  4GRS A;  1SBR A;  1VQ4 S;  1KLN A;  1V9O A;  2RVJ A;  3K17 A;  2Q79 A;  4L73 A;  2O01 C;  5DO2 A;  5C24 A;  3GIJ A;  3TAN A;  2BKP A;  4GVB A;  1M1G A;  2KH9 A;  1Y7P A;  1Z2Z A;  3I4H X;  4FPR A;  1TKD A;  1QAI A;  4ELT A;  2ZUA A;  4LSL B;  3JSB A;  3CMA S;  1TP7 A;  3IGV A;  1RAE B;  1RT7 B;  3HLU A;  4XAK A;  4ZVP B;  1UVM A;  3OL9 A;  2AV5 A;  4LSN A;  5B0E A;  1VK3 A;  2MDA A;  3DU6 A;  4PG7 A;  1NKB A;  5J2Q B;  1W2I A;  5ETL A;  2PI5 A;  1DAR A;  4I7F B;  4JV5 F;  3GMG A;  3MM6 A;  4QIF A;  3T6J A;  2CJY B;  4DR7 J;  1TUG B;  1Y00 A;  4QPX A;  4RU9 A;  4X4N A;  3HKZ D;  2OFH X;  3PKM A;  1P1T A;  2AKW B;  1C0U B;  3CDU A;  2KI2 A;  2AMC B;  3HF5 A;  4NLS A;  2Y1R I;  3DXS X;  1TQL A;  1FD8 A;  1UJ6 A;  1NH8 A;  2V8H A;  1DBD A;  3FJ2 A;  3QRP A;  1RT5 A;  2W24 A;  2XBP A;  3K5N A;  4HYK A;  3W65 A;  1MU2 B;  4LF8 F;  3AOB A;  4ZN3 A;  5GAE U;  2PMH A;  5LJ5 Y;  3A3O B;  3FSY A;  1ZM2 A;  3QYY A;  2OPS B;  1NK7 A;  3M6V A;  1ZM3 A;  1JIH A;  2I2Y A;  1NJI T;  1CC7 A;  2LQ8 A;  1IBK J;  4WFY A;  2MKK A;  4K4W A;  1SJQ A;  1WOS A;  4DU8 A;  2GVZ A;  2C3O A;  3BGR A;  4I2P B;  5M2U A;  3KHG A;  1CJV B;  3QSY B;  4HTI A;  4IO1 A;  1KBR A;  1S6Q B;  2J6S A;  2M8D B;  3DRP B;  5B08 A;  5IWA F;  2ZD1 A;  1SC6 A;  3PYG A;  2BA9 A;  1C1B B;  3QMQ A;  1R6Y A;  3QGG A;  1TZ0 A;  4LR8 A;  1X4E A;  5E41 A;  2FVP A;  4IUF A;  4N47 A;  4PRF A;  2IC3 A;  5A8R B;  2DGS A;  4FS2 A;  2FJA B;  1X5P A;  1HD0 A;  2H5E A;  2J9D E;  5GAG U;  3W8P A;  5AXN A;  1OY8 A;  3I0S B;  5BR8 J;  3O6Q A;  3EJM A;  2XGP A;  1HWL A;  2B51 A;  2XMK A;  1Q4R A;  2HQC A;  3M8W A;  3I0S A;  4ZCK A;  4FXV A;  3AQP A;  4PR6 A;  5F8G A;  3RAQ A;  3UNY A;  1GX5 A;  1LXJ A;  3FBE A;  2A2D A;  2DKO B;  4O44 A;  5M2R A;  2D7S A;  2HQG A;  1EP4 B;  1T11 A;  2J8A A;  4USJ C;  4YB5 A;  3PX0 A;  3MDF A;  1RCO B;  3KTQ A;  1ZBT A;  4WTO B;  5J2N A;  3ZTQ A;  5LMN J;  3RAX A;  3JTP A;  5D4P A;  5B0C A;  4LF7 J;  2AX1 A;  3HVW A;  4ED1 A;  2IRY A;  3KLH A;  2E66 A;  3DI6 A;  4HDG A;  4I7F A;  5HBM A;  4Q0B A;  2RQC A;  2L9W A;  2KFY A;  1RT6 A;  2G0C A;  4P2M A;  2C3P A;  5SUH A;  4M5D B;  3U02 A;  3K5L A;  4I2Q B;  1R6V A;  4WFB Q;  1RT6 B;  1RTI A;  3O2I A;  2AU0 A;  1WI6 A;  1CQM A;  3D6H B;  4A8Y A;  4FXW A;  1NME B;  1YLX A;  2HGL A;  4DV5 F;  1REV B;  2K1R B;  1FO1 A;  2B56 A;  4HDH A;  4K4X A;  1EKR A;  3HSG A;  4UQG A;  4LR7 A;  2O66 A;  3QJP A;  4ZJQ A;  1TTH B;  5K8O A;  2JEI A;  4N76 A;  1TV6 B;  4NZ0 A;  2VG7 B;  1S6Q A;  3QWU A;  1TKZ A;  2LQ5 A;  1S6O A;  3QT7 A;  4P2F A;  4ZCL A;  3R5B A;  1U2F A;  1OY6 A;  2GC8 A;  1U0H B;  4LMZ A;  1SV5 A;  3IM9 A;  1KNZ A;  2VPW B;  2VB6 A;  3I5C A;  3QNW B;  3QT5 A;  2GJF A;  3FGV A;  4B3M J;  1KR4 A;  7AT1 B;  1T9T A;  4K4Z A;  2DK2 A;  1NLK L;  1YWX A;  2YKO A;  4OI2 A;  2C2Z B;  4CO0 A;  4EO8 A;  4WKY A;  3V81 B;  2XLK A;  2RRA A;  1FFW B;  4CLU A;  4RNF A;  4PYA A;  4DXL A;  3T5J A;  2D9P A;  4C8O A;  4MKY A;  4WBF A;  1K1Q A;  4LF1 A;  4USM A;  4PPZ A;  4ZA1 A;  2VA3 A;  2YNH B;  1S9G A;  3EGW B;  3QQC D;  5D0H A;  4AYB D;  5A76 A;  1T7P A;  1QE1 B;  3MCN A;  4CLT A;  1TUW A;  2X3D A;  4WK1 A;  2JEJ A;  4CI0 B;  2GS5 A;  1TU0 B;  3AA9 A;  1EAY C;  2W2M P;  3ETM A;  2HRY A;  2F63 A;  2JNJ A;  3K8V A;  1FDA A;  1PSD A;  2YQ1 A;  3VAF A;  1Q8B A;  3BZQ A;  4WU2 A;  5AJ3 J;  3EX7 B;  2QA4 S;  1CLF A;  1RE1 B;  1RUS A;  3LPY A;  2FHM A;  2YBV A;  4J90 A;  5B0G A;  1VQ7 S;  1J2V A;  1EB0 A;  3EIC A;  2OIH A;  3M6U A;  2Z0G A;  3A3P B;  1M5K C;  1WKL A;  2DGT A;  1N8R T;  4P73 A;  4ZOS A;  3QBC A;  4J9K A;  2JOQ A;  2R8K A;  4X66 F;  2IJN A;  2EBE A;  1KSP A;  4DOZ A;  4B17 A;  3L3C A;  1SXL A;  2B8P A;  2POK A;  1H2V Z;  2YY3 A;  2G2O A;  2PN6 A;  2RUG A;  3I96 A;  4KYZ A;  4MAK A;  3THV A;  1VQN S;  3Q8U A;  4N41 A;  1BQX A;  4FPI A;  3CJ2 A;  4TU9 A;  3JSM A;  3SCI E;  3VHQ A;  1VQ6 S;  1WEY A;  1KVI A;  3BN4 A;  3AJD A;  3MPV A;  3TR5 A;  4F3M A;  4TYA A;  3WZ0 A;  4DX8 H;  2QZ8 A;  4DQR A;  4JI1 F;  3TA0 A;  4LSZ B;  1AUS L;  2RH3 A;  4ZLJ A;  2I9S A;  1RU1 A;  4EO6 A;  2CPX A;  1MNE A;  3AFG A;  5GMK a;  3Q2T C;  3BS9 A;  4A8O A;  1AZS A;  1GMW D;  1WKK A;  3CVK A;  3JSY A;  1F3F A;  4KPC A;  3K7R A;  3QAE A;  1TR0 A;  3OUY A;  1HNW F;  1AUD A;  1FVQ A;  4G6V B;  2A6M A;  3ENW A;  3TW0 A;  1VS3 A;  1JLE A;  2HWT A;  2V94 A;  3BKF A;  4ZPB A;  4ZHR B;  2FC8 A;  3DRP A;  3MCO A;  4ID5 A;  1VIO A;  3UPF A;  4V19 X;  5IOL A;  4DS5 A;  3H98 A;  4ZHR A;  2Z4P A;  4WYW A;  4ZVT B;  4WK3 A;  2D3O R;  2XS5 A;  1LFW A;  2XSJ A;  1S79 A;  5DRK A;  4P7T A;  3U27 A;  1S0V A;  3M2V B;  4PWW A;  3RU0 A;  1YBU A;  4ZVF A;  2Z2M A;  4ECT A;  1NKE A;  1NDP A;  4JI0 F;  2QRR A;  1QAJ A;  2ZE2 A;  2GFF A;  2L9D A;  3D1O A;  5HQL A;  4QWD A;  1Y3J A;  1M5O C;  4EBD A;  5HLF A;  2QSF A;  5EWF A;  3ELH A;  5KG7 A;  4RJV A;  1FXL A;  2VQF F;  4C8Y A;  2O67 A;  4U8V A;  3LAM A;  4AQY F;  5JMN A;  4K4T A;  1OQ3 A;  2ZH5 A;  4CCH A;  1PJ5 A;  2RQ4 A;  1KQK A;  2LA4 A;  2AEM A;  4K8R A;  4QZV B;  4CLW A;  2BE2 B;  2PMZ D;  3GR1 A;  1PBU A;  3P5B P;  2HK3 A;  4O3Q A;  4F0K A;  1TMM A;  4X4O A;  3LAL A;  3CXC R;  1WC6 A;  1UA1 A;  4KPY A;  2XWY A;  4LBH A;  4LF6 J;  5C2C A;  2Z8Q A;  1G7C B;  1RXO B;  3IRW P;  1V5I B;  3GIM A;  2CQB A;  4DUY J;  3H5S A;  1VBY A;  4OIX A;  3A8J A;  4DL2 A;  3DRY A;  1IKV A;  2GHW A;  3LP2 B;  1J5O B;  2J6T A;  3BPD A;  2AYG A;  4C8Z A;  1FFS B;  4H4M A;  5KFT A;  3LWM A;  2ZH9 A;  1UFW A;  4KHP J;  3GV8 B;  2KT2 A;  4I67 A;  4ZK7 M;  4TNO A;  2ZBI A;  4K2J A;  3ILL A;  1RSC A;  4RW6 A;  2CAJ A;  3IA0 A;  1OSC A;  4Q2L A;  3OL7 A;  1KFD A;  3N01 A;  4URG A;  4ED5 A;  5D0R A;  2DNH A;  1K0T A;  3DLE B;  1UP1 A;  3BN7 A;  4NLV A;  1S77 D;  2JRS A;  5ADZ A;  5D6G A;  1KHV A;  3HVT A;  4OZ0 A;  3DYA A;  5CZX A;  1R8H A;  1D8Y A;  3IAM 9;  2XMJ A;  1S6P B;  1NPP A;  2BRK A;  1F0X A;  3W7B A;  2X1B A;  4GC6 A;  1E6V B;  1N0U A;  3S6E A;  2AP6 A;  3AAW B;  1U4B A;  5A8W A;  2QYG A;  3DLK A;  2WON A;  2XY7 A;  1TK8 A;  1F5C A;  2RSQ A;  2CZV C;  4H4O A;  2VBW A;  3O44 A;  2XM3 A;  4DR1 F;  3KLI A;  3IR5 B;  3TAR A;  3KUE A;  3MFH A;  4AUK A;  4FYD A;  1SUQ A;  4ES2 A;  4O4R A;  5G0R B;  3BO2 A;  2QLB B;  1SPB P;  1RT3 A;  4F0H A;  3TUZ C;  3Q24 A;  2J9C A;  4FVC A;  2XI3 A;  1QUV A;  3BDE A;  5T14 A;  4LRC A;  1UZD A;  2KYZ A;  3K8W A;  3ZZU A;  4OLO A;  4Q0B B;  2EPI A;  4LFA J;  1S9E B;  4ZCM A;  3OJU A;  3R2C J;  5EUH A;  2XSF A;  4M1K A;  2DHG A;  2FVC A;  1OSD A;  5BJR A;  1PGZ A;  1L3T A;  2W9C A;  3TUP A;  3OTB A;  1HD1 A;  2KO1 A;  4RU2 A;  4AXJ A;  1S1T A;  1QM9 A;  3FUY A;  1RT4 A;  3C16 A;  1MN7 A;  4KHP F;  1WEZ A;  2HHP A;  5IXU A;  4NRT A;  2KG0 A;  4DUY F;  1WC5 A;  2ZOM A;  5LT5 A;  4AE5 A;  5KTQ A;  4WZM A;  1TKX B;  1XK8 A;  2IA6 A;  5ETS A;  4WFA Q;  2VHG A;  1VQK S;  1XBW A;  1XWL A;  2UVR A;  4CP5 A;  1FEH A;  2KFN A;  1JK9 B;  2XHC A;  3CCQ S;  1CEZ A;  3SFU A;  4C8L A;  3AXK A;  4I4B A;  2JHE A;  3PM9 A;  2F40 A;  1NZA A;  5HRO B;  4Q5V A;  1VQL S;  1FE4 A;  2BJ1 A;  4LRF A;  1HBM B;  2ZH1 A;  1RA7 A;  1VQO S;  1JKH B;  3DLB A;  4O3S A;  3M2R B;  2ACY A;  3TAP A;  2FVQ A;  4F04 B;  2DNG A;  2ILY A;  2W25 A;  3N79 A;  2KHD A;  3Q2S C;  5ETT A;  5LXY A;  4RNM A;  2RJZ A;  2RUS A;  2HHH F;  4PUO B;  4G3I A;  3T5H A;  1DTQ B;  1T3N A;  4OV1 A;  4QIV A;  1RAB B;  2UXB J;  4J7C A;  1B3T A;  3EVM A;  1JLG B;  4QW9 A;  2IAJ B;  1LWX A;  3PDN A;  2ZNY A;  1U25 A;  3IC1 A;  1AA1 B;  1BQM A;  4ZVQ B;  1X0P A;  3FVY A;  4GO7 X;  4ERD A;  3EE3 A;  2V8P A;  3VAK A;  2VPZ B;  3KDN A;  4PAA A;  3G82 A;  3CJ4 A;  1SL1 A;  4MFB A;  2CWX A;  3RBZ A;  3MTJ A;  2ALZ A;  2HUR A;  1WOO A;  2HBR B;  4ZLL A;  1RLD A;  2DT9 A;  3M05 A;  2YTC A;  2GO8 A;  3NAH A;  1B0T A;  4PEO A;  4Q2M A;  3WDO A;  3RTV A;  3RB4 A;  5D4N A;  3QT8 A;  3PKY A;  2HND A;  3CD0 A;  5LMN F;  2FZC B;  1F6T A;  2DH9 A;  3G87 A;  4QWB A;  1HNI A;  4U96 A;  2P9C A;  3W61 A;  3OLB A;  4OZ1 A;  2GS8 A;  2UV8 G;  5E0O A;  3H8Y A;  1L3K A;  2ZH7 A;  3O5T B;  1JLB B;  1T3O A;  5HMX A;  3ZZZ A;  4FKY A;  2GZO A;  4DV0 F;  2HHX A;  4M5D A;  1U1N A;  3G96 A;  3GV7 B;  3EXC X;  3HT0 A;  1SJ4 P;  3F41 A;  4DR6 J;  1ZTW A;  1S72 S;  1F5B A;  1NHU A;  4J5O A;  2L48 A;  1HQU B;  3MAQ A;  1X5S A;  1RI7 A;  1N0V C;  3IS9 B;  3LP1 B;  4OI3 A;  2LXU A;  3DC2 A;  2XZD B;  3AH6 A;  2E5L F;  3H90 A;  3FC9 A;  1R0B G;  3CD5 A;  3LP1 A;  4YY3 F;  4AND A;  5D4L A;  1BC6 A;  5D0E A;  2UUB F;  3J81 j;  2A6O A;  1YHQ S;  3G2X A;  5HRO A;  1A7G E;  2YH0 A;  3OT9 A;  3CCR S;  1N34 F;  4O44 B;  2MJU A;  2JEF A;  4KV8 B;  2VON A;  1DUR A;  2HRU A;  3FSX A;  3ZZR A;  3CJQ A;  2GQC A;  2NYI A;  2IYI A;  1U0H A;  2ZBR A;  4PPD A;  4DG1 A;  4YUD A;  2HVD A;  2WVF A;  1ZM4 A;  2XHW A;  2ACM A;  3DRR A;  3PIP Q;  3Q23 A;  8ATC B;  2VDH A;  1HBO A;  1RWU A;  2YNF B;  3DOM A;  3DI6 B;  1GT8 A;  3TAM A;  3TEH B;  3MEE A;  4N77 A;  2VC1 A;  5FII A;  3G8Q A;  2VFT A;  4DQP A;  2AGP A;  5I3U B;  4QYZ J;  1TK5 A;  3M32 A;  2FZG B;  1VFJ A;  2DHH A;  4NYZ A;  3LTO A;  1S12 A;  5J2N B;  2WTF A;  2E1C A;  3CJS A;  2MHN A;  4FNH A;  4KBI A;  1KHW A;  3MEK A;  2ZHB A;  2DGW A;  3OTC A;  3EPI A;  4ILM A;  1WC3 A;  2B4O A;  2ZH4 A;  3BQ0 A;  1TVR B;  3H5U A;  4YDD B;  5KFZ A;  1RT3 B;  2XI2 A;  1S1U B;  4O0I A;  3PEJ A;  1SQG A;  2YWH A;  3EDQ B;  4RNH A;  3V2U C;  4ZPC A;  5G4D A;  4DV1 F;  1D9F A;  4ZVH A;  4RNN A;  4KFB B;  3TRG A;  3VAG A;  4DFM A;  4ZP6 A;  4KKO A;  1SJF A;  3MEG A;  1UVI A;  1YRU A;  2VC0 A;  1S1V B;  4LF5 J;  3DN9 A;  3ITH A;  4FF1 A;  1VCT A;  2IBO A;  2DH7 A;  3BSA A;  2Z2Y B;  3MM5 B;  3U1N A;  3KJV A;  1WWH A;  1NEE A;  1TL3 A;  3O3L A;  1BLU A;  3T41 A;  4LQ9 A;  5D77 A;  4CLK A;  2DPJ A;  4F4W A;  3VCD A;  5FLX Y;  1U1R A;  3MOJ B;  3OR1 B;  1SC4 B;  4USU A;  3PW2 A;  1WKJ A;  1RYS A;  4WWS A;  3VVU A;  5AE1 A;  1HNV A;  1HQE A;  2YWF A;  4R8U A;  2CFX A;  1N5S A;  3CJT A;  1UEU A;  4DWI A;  4CWB A;  2JLG A;  4PG4 A;  2MJN A;  2LDI A;  4IOB A;  4F0M A;  1UWB B;  4RBU A;  3P49 B;  1M1K T;  4HHH A;  4HI2 A;  4CM2 A;  4EEY A;  4U7U K;  2BAC A;  3D67 A;  5LSL A;  1C1C A;  2HLU A;  2ZUG A;  3HSZ A;  4K50 A;  3V5R A;  4XK8 C;  2D3Z A;  2N3O A;  3LWL A;  4QCL A;  3WHI A;  3O8W A;  4ID5 B;  2ZWO A;  3RRH A;  2V2K A;  3HD1 A;  4HAC B;  2YPY A;  4CO1 A;  1E6V A;  2NQP A;  2P9E A;  1KQG B;  2QN6 B;  3TEG A;  3CDE A;  3DLG B;  3ZZ0 A;  5J2Q A;  2PEH A;  1TFW A;  4YOE A;  1Y10 A;  3D0G E;  3PHE A;  4MYU A;  3NXZ A;  2F1F A;  4WP8 A;  1FK9 A;  3W2V B;  4IRD A;  3R2D J;  2XS7 A;  3NGD A;  1S1U A;  2EC0 A;  4DR4 J;  4Y65 A;  4YP3 A;  1KLM B;  2VOP A;  4BDP A;  1RWX B;  3V4M A;  5RUB A;  1VRT A;  4BLG A;  2WBR A;  5FLX U;  4B9M A;  5C7P A;  4J37 A;  2BX6 A;  2I5J B;  4DSK A;  2UXC F;  1UEK A;  1FT8 A;  1Q8L A;  1T03 B;  1RTJ A;  4DSE A;  3V4I B;  3NY0 A;  1NK6 A;  2OFG X;  3MEC B;  4OJH A;  2BE2 A;  1G2E A;  2HFV A;  2LEA A;  5J2M B;  2J0X A;  1BY9 A;  3ZZO A;  2E5L J;  2G2Y A;  2FJW A;  3DRS A;  1A0O B;  4JI8 F;  5HVG A;  1U1M A;  2BKN A;  4BWM A;  4A8W A;  4QIG A;  3GG0 A;  2WAQ D;  2BQU A;  1O8B A;  1FXD A;  1W25 A;  2XWX A;  9RUB A;  5FJ4 A;  5D3G A;  4TQS A;  3Q8R B;  4F2R A;  3ADA C;  4B02 A;  4FNI A;  3OL8 A;  1I6J A;  3IP0 A;  3MMB A;  4M5G A;  2XO7 A;  3AB4 B;  2AYB A;  2HNZ A;  2GQQ A;  2ROE A;  3C2P A;  2H5J B;  1EHW A;  1U8W A;  1YKW A;  2YKA A;  4N5S A;  2IPO B;  1TV6 A;  2R7W A;  2MEW A;  3FEZ A;  3VF0 B;  4GC7 A;  4PXE A;  4B3S J;  4K59 A;  4R0E A;  3OVA A;  4WF9 Q;  2JJ4 D;  3B82 A;  4YR0 A;  8RUC A;  4NMX A;  4QIW D;  4RBT A;  3CTR A;  1R27 B;  4IQX A;  1GFW B;  3BKU A;  5DG7 A;  2ZC4 A;  3G8T A;  3G71 S;  2BW7 A;  3MR3 A;  3CUN A;  2HHT A;  2AJ0 A;  1XR7 A;  3RBE A;  5K5M A;  5KFQ A;  4UY8 T;  2JWN A;  1N32 F;  1RT2 A;  3GIL A;  2CNL B;  4QQB A;  2RB7 A;  4KGK A;  5CCM A;  3QLH A;  3A13 A;  3FBF A;  1U1O A;  2UUW A;  1EET B;  1XMQ J;  2N4D A;  2Q6B A;  3KLH B;  1X4A A;  4CH0 S;  1WG5 A;  2VA2 A;  3R1H A;  1KOH A;  1WC0 A;  4CNY A;  2LCW A;  2ZJR Q;  1D09 B;  1ZA1 B;  3NKY A;  4FBU A;  3I5B A;  2E5H A;  1XNQ F;  4ED0 A;  5F8M A;  1I51 B;  2BJD A;  1NK9 A;  3NMR A;  3KJQ B;  2HZV A;  2XB2 D;  2B6A B;  3I0R A;  5HO4 A;  3FQK A;  1E6Y B;  3PVX A;  1WTF A;  3BRE A;  2F9J A;  1EJ7 L;  1FI4 A;  3HJV A;  3NS5 A;  2WSE C;  4JI2 J;  4IQM A;  4DCJ B;  1EKS A;  4RW9 A;  1U6B A;  3KKF A;  1YX2 A;  2KN4 A;  2M2B A;  1JJ2 R;  2OMO A;  2QA1 A;  1X4C A;  4WII A;  4DEZ A;  3G9C A;  5DLG A;  5DQI A;  2WVD A;  2XTJ P;  3OQ2 A;  1LW0 B;  1VQM S;  1KDN A;  3AY0 A;  1NHK L;  1FJC A;  1ZAV A;  3P3D A;  2E44 A;  3DXB A;  4U95 A;  4ZPD A;  2RS2 A;  4NE9 C;  4RW8 A;  2K1R A;  2E9R X;  4IG3 B;  1VC0 A;  4ZVR B;  3HM9 A;  2HMI B;  2Y8Y A;  3K0J A;  2GIF A;  3I55 S;  3FSI A;  2GMH A;  2LQB A;  3FBB A;  3E51 A;  1SJ1 A;  2CJA A;  3PFE A;  2XC9 A;  4FF2 A;  3B4M A;  1CC8 A;  4JBC A;  1BQN B;  2B4U A;  4LF6 F;  4M5J A;  2RF2 A;  4W4M A;  4QWE A;  2KTQ A;  2DIT A;  3CME S;  2LA6 A;  3D6T B;  1HBN A;  2MQO A;  2Y1J A;  3CCL S;  2RT3 A;  1SL0 A;  1VBX A;  3SFG A;  4F4Z A;  2VG6 B;  2CVI A;  3SIP B;  2IVM A;  2RRB A;  4F3Q A;  1RCX B;  3F56 A;  5KG0 A;  4ZMM A;  3H25 A;  3TI0 A;  3DOK B;  3HUL A;  4NX9 A;  2WCX A;  1ZZF A;  2ERR A;  1J27 A;  3NEK A;  1U45 A;  2K06 A;  1K1S A;  4OYO A;  1N5Y B;  4DFJ A;  2YVS A;  4TY8 A;  1HNX F;  1VLY A;  4ELU A;  4EU0 A;  2H4W B;  1FEE A;  1JLA A;  1RAD B;  5F3T A;  3TZZ A;  1RKJ A;  1AW0 A;  2CPH A;  3LGH A;  5KT6 A;  1UL3 A;  2YWK A;  2FLL A;  1ZPW X;  1R8A A;  1TVR A;  4DR7 F;  2ZKT A;  5IM0 A;  4OJ1 A;  1W2B R;  2UUC J;  1U02 A;  2FIU A;  1TL7 A;  1ZM9 A;  5HAO A;  2XYP B;  1QD1 A;  2JFK A;  5CYQ A;  3ILO A;  3KK1 B;  3G86 A;  3R8Y A;  3ILI A;  4WE1 A;  4NEY A;  3M30 A;  4X4V A;  4NEZ A;  1FNX H;  4F4A A;  4OX9 J;  4FXD A;  3Q0A A;  4CYU B;  1KVJ A;  4PWD B;  5CA5 A;  4Q43 A;  5ETR A;  5DET A;  2IFX A;  5ETV A;  3RB6 A;  2BR0 A;  1OPZ A;  3VQS A;  1ARO P;  2PA8 D;  3C15 A;  3DRX A;  4H54 A;  4USV A;  3TVZ A;  4BWJ A;  1KOO A;  4Y2A A;  1K47 A;  5HMZ A;  5H9E K;  2HIY A;  2X3G A;  3RBD A;  3MFI A;  1YBT A;  5L1J A;  3DGP B;  3GCX P;  4P9S A;  1UZH A;  4Z7Y A;  1PAE X;  3X3U A;  1IJF B;  2EFQ A;  2XMA A;  4JI4 J;  3JQJ A;  1PIL A;  1PJ7 A;  2BYC A;  5LXR A;  2W7P A;  4J9R A;  3TUI C;  3SYZ A;  3OTD A;  1SKS A;  2XY5 A;  4PUO A;  4O4G A;  3M8Z A;  4K4U A;  2ASL A;  4DV3 F;  1HHS A;  2W4P A;  2KL8 A;  1W7W A;  3MI7 X;  2IY5 B;  2M7S A;  1OO0 B;  3ZC4 A;  1S0O A;  4DL4 A;  3DYA B;  4X65 J;  4TY9 A;  2KM8 B;  2J6U A;  3EWG A;  3WX8 A;  3D4J A;  3KLF B;  1J5O A;  3R7N B;  4NLR A;  4UY8 5;  1IR0 A;  5K14 B;  3Q8Y A;  4LF9 F;  4F67 A;  5A6W A;  4OZ2 A;  1XMQ F;  2IAJ A;  3D3C J;  5JUM A;  5IT9 Y;  1VOM A;  3KXD A;  2V63 A;  2M3D A;  4TLR A;  1VDH A;  2KVI A;  1Q82 T;  1U8S A;  1YJW S;  3NRB A;  5B0D A;  1JMT A;  3ET6 A;  3BJY A;  3PR5 B;  1RWP B;  3CE8 A;  4AL7 A;  1HWJ A;  1PYS B;  2CPD A;  4QU7 A;  1JWW A;  5IM0 B;  3QO9 B;  4BHQ A;  4N56 A;  2ASD A;  2YKQ A;  4B3M F;  1WJ9 A;  1EQ0 A;  1VIX A;  2UUT A;  2ZDP A;  4RPF A;  3RBX A;  3R6G B;  3ZTO A;  2A0F B;  3HDS A;  2JDJ A;  2BZ2 A;  3NS7 B;  3KUH A;  4DJB A;  5KFI A;  5KOW A;  1OJ4 A;  4L3N A;  4PQU B;  3M7V A;  1XJW B;  4CYU A;  6AT1 B;  1VYA A;  1DQ8 A;  2NUH A;  2HGM A;  1GTH A;  1QAX A;  4TVA B;  5K8P A;  3MM8 B;  5EWE A;  3OVB A;  4RW7 B;  1KP6 A;  1V3R A;  3PO5 A;  5L9X A;  4RW8 B;  1Q5Y A;  2VOO A;  4NXM J;  3TJA A;  3BB5 A;  3UDC A;  3CIZ A;  1S9F A;  2ILZ A;  4B9N A;  4R5P A;  1RHU B;  4YHH F;  3U1L A;  5DGB A;  4DV0 J;  1JLQ B;  2MMY A;  4RBV A;  2G1D A;  4NA3 A;  3JS9 A;  4OI6 A;  1FF2 A;  1U6Z A;  2NUU G;  3SI8 A;  4AFF A;  4X66 J;  5JVH Q;  2DR6 A;  6FDR A;  1VRQ C;  3GIK A;  1GMW A;  2W01 A;  4KAI A;  4OX9 F;  4DPY A;  4C7Q A;  2B5J B;  4PG5 A;  2UUC F;  3T1A A;  4C11 B;  2QLJ B;  4IKA A;  3V6J A;  3V6D A;  3NP5 A;  4YQW A;  2UU9 J;  2QA2 A;  1RA6 A;  3N5F A;  5LOQ A;  1K8A T;  2CJX B;  3J7Z T;  2UVV A;  3UI3 A;  1XNR F;  1P27 B;  1KTV A;  4CZC A;  2C3Y A;  5H9F J;  3MEG B;  5GAD I;  1ICE B;  3JQM A;  1CS4 B;  2OEK A;  3IBF B;  2YPZ A;  3S1T A;  4EZ6 A;  1RAJ A;  2LLZ A;  3C19 A;  3LGM A;  5KT7 A;  4IRK A;  2RIL A;  4JP8 A;  5KFL A;  2AGQ A;  2R7V A;  3BF4 A;  3HHL C;  4I56 A;  1RZM A;  3OR1 A;  2Y9H A;  2BJE A;  4LFB F;  4ZIT A;  4WKR A;  2GVD A;  3OD2 A;  4CH7 A;  2DYA A;  4RX6 A;  2B4V A;  1C4A A;  3BBC A;  4R25 A;  3LA0 A;  2JSX A;  2N3L A;  3TUJ C;  1HI0 P;  1TL3 B;  2IM3 A;  1VQ5 S;  4B3O B;  3V4I A;  3PW5 A;  1UMJ A;  4ECR A;  4K4V A;  1U7L A;  2DHA A;  3DDK A;  1R0A B;  2D41 A;  3KHH A;  1N88 A;  4URQ U;  3B6B A;  1APS A;  4DV7 J;  1H98 A;  1VJW A;  3PYF A;  1IBC B;  2WZ1 A;  3U7J A;  5B09 A;  3OR2 A;  2RAQ A;  4XTT A;  4HKQ A;  2VFV A;  4RKU C;  2VQF J;  4R8U B;  3GSI A;  1KRP A;  2PD1 A;  2QL9 B;  2C3M A;  3D6M B;  4O3O A;  2XO6 A;  3IG1 A;  3MPU B;  1M5V C;  3CCJ S;  2LP4 A;  2C2N A;  4KE5 A;  3M8Q A;  2R8J A;  1BXN A;  1N5V A;  2CQP A;  3GLJ A;  5F3Z A;  3JTN A;  4XPC A;  1C1C B;  3AA8 A;  2UZA A;  4DR3 J;  3C46 A;  2R8G A;  1RAO A;  2EC2 A;  3CO0 P;  1G6B A;  1PC5 A;  3H20 A;  3HZG A;  5E3R A;  1T8E A;  3AD7 C;  2IMW P;  4NLY A;  5GMD A;  1WDD A;  3BR9 A;  1SCJ B;  5CYJ A;  2EW9 A;  1FKA F;  4HTJ A;  4NI2 A;  3MUV P;  2W2Q P;  3KLF A;  3UCU P;  1SKU B;  1QTM A;  3BYR A;  3W63 A;  2CKW A;  5E7O B;  1QDU B;  2JLF A;  5E3P A;  5KAK A;  1WNE A;  2C2K B;  3I82 A;  4CLL A;  3HHK A;  1QE1 A;  4NLG A;  4LJM A;  3G6X A;  2UXB F;  3DCA A;  3L7O A;  2YWG A;  5T7L A;  1WF0 A;  1A9N B;  3BR8 A;  3K5P A;  5FDL B;  2R3V A;  4ZP7 A;  1NJX A;  2HHH J;  2MZ1 A;  3NG8 A;  3WIV A;  5KFS A;  3OV7 A;  4A8X A;  3MXH P;  3VVT A;  1HWK A;  5LMU J;  2F65 A;  2XLJ A;  3HCX A;  3RYL A;  5KFB A;  2VJU A;  1RWW B;  1GXU A;  2VG5 B;  1U6F A;  4DSL A;  1RBL A;  3GV5 B;  5ITH A;  1UWA A;  3SZ2 A;  1LK5 A;  4X4S A;  1Y5L B;  2V2V A;  1AYE A;  2NSC A;  2W2P P;  3DRS B;  2BOA A;  4B3S F;  4JI7 F;  2LMI A;  1YJN S;  4ZPV R;  3IM8 A;  2GIR A;  1UW4 A;  2J7W A;  1S6U A;  2HZC A;  3UN5 A;  2M88 A;  1Y11 A;  4C0O C;  1X0F A;  1V5V A;  4PAB A;  3NAI A;  1FNO A;  1X5T A;  5T41 A;  2RQM A;  3BO4 A;  1HQU A;  1H73 A;  1YJU A;  2EFO A;  2ZOF A;  1TMJ A;  3EGN A;  4OYM A;  2N7Y A;  2AQ4 A;  4IDK B;  4LF4 J;  2G0J A;  3ZZT A;  2ASY A;  3W64 A;  2FJE B;  3E01 A;  1UVJ A;  1HBM A;  2VZ9 A;  4FN5 A;  4DV2 J;  1BWE A;  1HBO B;  2YNF A;  4NXM F;  2R2U A;  2VFR A;  5D78 A;  4FYV B;  4U7C A;  2M9K A;  2HG4 A;  5ETK A;  1HW9 A;  4CRJ A;  4TU7 A;  3OTO F;  1G3O A;  1N33 J;  1VQY A;  3L95 X;  4Q7A A;  2KXH A;  2HQF A;  2HIQ A;  2DNZ A;  5I3Q A;  5A0Y B;  3THP A;  3JXO A;  1UVN A;  3HJF A;  2AEF A;  3PV8 A;  3I32 A;  1WEX A;  3M6X A;  4Z2X A;  3SCK E;  4DDF A;  2RDD A;  4S0M A;  5BYQ A;  3IFE A;  1Q7L B;  1TL5 A;  2NXJ A;  4OYZ A;  3G6V A;  3Q22 A;  4NL5 A;  4U7U D;  3LUY A;  3FZ2 A;  3HSD A;  1LWF A;  3A8K A;  1B7Y B;  1P6T A;  1RDR A;  3ENA A;  3HX9 A;  4OYP A;  3TVK A;  4DPX A;  3ZO7 A;  4EK2 A;  3R7B B;  1RTD B;  2COL A;  1QLN A;  4ED8 A;  4J9S A;  3P8B B;  4F4K A;  3TX0 A;  1KTQ A;  3M30 B;  4NCB A;  2DR7 A;  4X4U A;  3JB9 k;  1EIY B;  4KR0 B;  5AE3 A;  4O23 A;  5THW A;  4C3M A;  2H54 B;  2MZQ A;  2K3K A;  2MGZ B;  1I5O B;  4TU8 A;  1KC8 T;  4WFZ A;  4LFA F;  4F4Y A;  4PG8 A;  4YFU A;  1LKZ A;  1YG0 A;  2H3E B;  5EWG A;  3BGR B;  1Q0N A;  2GQ2 A;  2YQ3 A;  3IXQ A;  3PJX A;  1ZOT A;  1H3D A;  1FKP B;  1OMS A;  4ICL A;  3J7Z 5;  1B64 A;  2NRE A;  3HHL A;  2EK6 A;  4QYZ K;  1XNQ J;  2OAU A;  1RBA A;  5L1I A;  5EDW A;  4GO5 X;  2WW8 A;  2PMW A;  3SXL A;  2ASJ A;  4LF4 F;  2CJ9 A;  5GAG I;  3UCG A;  1FWL A;  1TKX A;  2VIH A;  1X4H A;  3MMC B;  1JQG A;  4Q8F A;  4ATN A;  1W26 A;  3CDB A;  2D9O A;  2DY9 A;  1HWU A;  1XTZ A;  3N6M A;  3UWT A;  4DMZ A;  3A12 A;  2OPQ B;  5I3U A;  2DH8 A;  2G13 A;  2RQK A;  4M5H A;  4OYA A;  2ZM6 J;  1UAW A;  4TYB A;  5EGY A;  3UD4 P;  1JKH A;  1U49 A;  3W3S A;  2KDO A;  5DDO C;  1H38 A;  2EFG A;  1M1H A;  1UVK A;  4OZ5 A;  3CCV S;  1RQ0 A;  1RTH A;  1FE0 A;  3LGN A;  3R5D A;  1YDL A;  4M5L A;  5H1S V;  3JYT B;  2UUA J;  4IYQ A;  2Q43 A;  1HA1 A;  1LFP A;  5G0R A;  3MR6 A;  1O6X A;  4N8N A;  4JI0 J;  2A2C A;  2Y1L B;  3C6U A;  2KG1 A;  2DHX A;  2QV6 A;  3BEG B;  1ZAX A;  2H48 B;  2NXE A;  3DM2 A;  4K0K F;  4HVZ A;  4QR2 A;  3FFI A;  3Q83 A;  3N6L A;  2KZM A;  2XY6 A;  3FDS A;  3BH7 B;  5CYQ B;  4ALZ A;  3CJ5 A;  3D0H E;  3PTW A;  4KY3 A;  5JJB A;  3KK1 A;  2I5J A;  3GP9 A;  4L3K A;  1F9E B;  2GW8 A;  3RJM B;  2GVD B;  4CLF A;  3DMJ B;  4RNO A;  1S0M A;  2EBG A;  1H7W A;  3MPD A;  1RTI B;  3SBM A;  3ZNU A;  4DN9 A;  5DM6 Q;  3MM6 B;  4NPO A;  3HHL D;  1N54 B;  1S9E A;  1WC1 A;  3UO0 A;  4PXB A;  4HL9 A;  5DZ7 A;  2VBY A;  3Q8V A;  2OEL A;  1IBL F;  3T1Y J;  2QL7 B;  4DF4 A;  2UXC J;  3R5J B;  1LWE B;  1VC5 A;  1J5E J;  1IWA A;  5HVF A;  2FLO A;  4QR1 A;  5IV3 A;  3OBI A;  3H2U B;  3G8S A;  1JLF B;  2UVU A;  2OLW A;  1U09 A;  2CQ2 A;  2IDE A;  4ZVU B;  1F1B B;  2FD2 A;  3N4W A;  4RUB A;  3HPO A;  3OSP A;  1JX4 A;  4C11 A;  1DRZ A;  2CPJ A;  2OI2 A;  4JB8 B;  1FJG J;  1AFI A;  2CPE A;  4RWW A;  2MQ8 A;  3P5T L;  5IQ6 A;  4GKK F;  4AL6 A;  1ZS6 A;  4A8M P;  3W9H A;  1B7F A;  2MLX A;  2JC0 A;  1HBU B;  4NLT A;  2ATL A;  2B4P A;  4ANE A;  1HLW A;  4MK8 A;  4EBC A;  5BXI A;  2YQ0 A;  4FF3 A;  2M70 A;  5CH7 B;  1LEO A;  3GYG A;  5AT1 B;  1LK7 A;  2R2S A;  1U0S A;  2KB2 A;  4C2M A;  3W66 A;  1S76 D;  1AB8 A;  4DX5 A;  3TZW A;  3TP2 A;  5KOX A;  5KFP A;  4EBE A;  4O0N A;  2YNG B;  1DTQ A;  1QUP A;  2BKO A;  2NPI A;  3I56 S;  1IKX A;  3CW2 C;  3W1Y C;  2JH3 A;  2ZH2 A;  2HHQ A;  4C8N A;  2DPI A;  4USK A;  2RHQ B;  2FGC A;  1MMN A;  2EG2 A;  3QFH A;  3V6D B;  3BO3 A;  1L3V A;  2HFS A;  1IUJ A;  4ZLP A;  4OYW A;  4JI3 F;  3R9L A;  3WIU A;  3EZ5 A;  3LPE A;  2BAB A;  2I0X A;  4ZJO A;  3RGI A;  4DLG A;  4ED6 A;  2QTW A;  5DM7 Q;  1B0P A;  3W2W B;  2DY1 A;  2C2D A;  3QIP B;  1SJ3 P;  4ANC A;  4DFP A;  2HFO A;  3FEX B;  3QAU A;  4J9P A;  3IGN A;  3QIP A;  4USW A;  3GWC A;  2HK2 A;  2K3I A;  2P6T A;  1T0T V;  1S7I A;  3N9U C;  2VAS A;  1WTB A;  5A2Q Y;  5ETO A;  2R8H A;  3MOZ A;  2F9D A;  3R3T A;  2FC9 A;  3PRB A;  3BKT A;  1RAH B;  2DGV A;  3T1H F;  1JLF A;  4CQ1 A;  2VDI A;  2M8H A;  4CLS A;  4K5R A;  4DX7 A;  3KLV A;  4K2X A;  3I4P A;  4BS2 A;  2ZIT A;  1LWE A;  3C8Y A;  4NCG A;  3OUY B;  1MML A;  3AHP A;  4H4K A;  3O1L A;  2QSW A;  4ZDN A;  2AIR B;  2OTL S;  5DJB A;  3CED A;  1C0T B;  2BJ9 A;  3EM1 A;  1CJK A;  2FVR A;  5J1E B;  2IMO A;  2X7I A;  4F7V A;  1HBU A;  2Z57 B;  2ROG A;  1CJK B;  2AJ4 A;  2IA0 A;  2PE8 A;  3H7H B;  4Y6I A;  4ES1 A;  1S4E A;  2I38 A;  5I42 A;  1QSY A;  1N32 J;  3DLG A;  3SQG A;  2FLN A;  3J7A 1;  1RB0 A;  1S4F A;  4MKV A;  3NOG A;  5HVH A;  1S7H A;  2Q1L A;  1I3O B;  4O4G B;  1FX4 A;  4ZLN A;  2FJV A;  2RIJ A;  4IH7 A;  5KFJ A;  2E1M C;  3JQK A;  4DR5 F;  4NA2 A;  2XMW A;  2HVH A;  3KLE B;  3GSD A;  3HSJ A;  4KH0 B;  3HD2 A;  2R7T A;  4G1Q A;  2B5J A;  1FDD A;  3W8G A;  3KLG A;  4FZV A;  4HHU A;  4X4T A;  3G6Y A;  2J7K A;  3PRD A;  4NLX A;  2AGO A;  2EG1 A;  1URN A;  2NXN A;  3EVW A;  2CJK A;  4L72 B;  1U24 A;  4QYR A;  5KFF A;  2ZEJ A;  2CRL A;  5K20 B;  4LFC J;  4WZQ A;  4V1A k;  5GME A;  2C3U A;  2DNL A;  1HWI A;  3FCW A;  2HGN A;  5L1K A;  3PNI A;  4N7T A;  1IBM F;  2MY7 A;  4OX8 A;  4YR2 A;  1PKU A;  2KXF A;  1YJ7 A;  3KFW X;  5ETM A;  2D74 B;  1QSL A;  1HMV A;  3QPI A;  1HNX J;  2HWI A;  3W5X A;  1SL2 A;  4PQA A;  4JI8 J;  1QSS A;  1D8Z A;  1HKA A;  1YBA A;  4PZV A;  3L7P A;  1H2T Z;  1MMD A;  1VRT B;  2V67 A;  2J8S A;  2VF3 A;  1JNZ B;  2GML A;  3MUT P;  1XR6 A;  3A3N B;  4LBI A;  1VK8 A;  1IKV B;  3F44 A;  3DGP A;  3IRX A;  3FKB A;  2DRA A;  3T1Y F;  3KK2 A;  4DUT A;  1QY7 A;  2HFU A;  2FJB B;  2KVQ E;  3QRQ A;  4LFB J;  3W60 A;  2J0S D;  1R0A A;  2V2Z A;  4USH A;  3GFX A;  5CYM A;  5K8M A;  3GFH A;  2ADB A;  2EKY A;  2EK1 A;  7FDR A;  1F9F A;  2G0I A;  2CPY A;  3QGI A;  1HIY A;  1CSJ A;  4KGM A;  4O3N A;  3UCZ P;  4ELV A;  3IS9 A;  2J0Q D;  5KFM A;  2BM0 A;  2OSQ A;  2GJ2 A;  2EVZ A;  3PYD A;  2YNH A;  5BYR A;  4ZPW R;  4WTY A;  3V81 A;  4G1P A;  3RZA A;  1ACM B;  1WAC A;  3MM9 A;  4ZVG A;  4LIR A;  1HYS A;  4LR9 A;  1NAQ A;  1Z1Z A;  3W5Y A;  3PZP A;  3TAM B;  4QWC A;  1UFL A;  2NSB A;  1FK9 B;  4GVL A;  4URS A;  2R42 A;  3CJ3 A;  3W2V A;  4DF8 A;  4B3T F;  3FBC A;  2I6W A;  3RG6 A;  2AD9 A;  2ZE2 B;  2V4R A;  2MUI A;  2ZBQ A;  3AD8 C;  4OV6 A;  1RTH B;  4DG1 B;  1RYR A;  2P5V A;  1NZ8 A;  4LVN P;  3U1M A;  3RR7 A;  4LBP A;  4OL8 A;  2XSJ B;  4J9U E;  4QW8 A;  5D4O A;  4F50 A;  3DDN A;  3WQP A;  4WXW A;  2JL9 A;  4DX6 A;  4DHV A;  1TKT B;  2HND B;  2ZBP A;  3IAS 9;  2B8Q A;  2LVW A;  3CB4 A;  3K2Y A;  4UUW A;  4Y00 A;  3UR3 C;  2CZ4 A;  2QT7 A;  3UE2 A;  3M32 B;  1TKT A;  2N4C A;  2PII A;  2R7O A;  2YWW A;  2IIH A;  4CTA A;  2E1R A;  3D66 A;  1F9H A;  4C3L A;  3QJJ A;  4X4Q A;  1P1L A;  2F8M A;  2HW3 A;  3Q8Q B;  4PQU A;  2GX8 A;  3DHX A;  3HKW A;  2V8V A;  2QA4 G;  3K57 A;  2G2Z A;  2Y0B B;  3JTO A;  4EGL A;  3FRY A;  5L38 A;  1NH7 A;  2A1B A;  3HHL B;  4L74 A;  3SMZ A;  3OHA A;  4DS4 A;  4PKD B;  1UFK A;  2MZJ A;  2FHK A;  4WFN Q;  4U6P A;  3MUM P;  4J9N A;  4DR2 F;  4OZJ A;  3CWJ A;  2B6A A;  1UEV A;  2W1B A;  4TKT A;  1X4F A;  5IC4 B;  2M4M A;  5B7W A;  4R5P B;  3QGH A;  2UXD F;  2BV3 A;  2R7Q A;  4NA1 A;  3DDI A;  3ETO A;  4ILR A;  2VFS A;  2A18 A;  2FY8 A;  3TAQ A;  2DR9 A;  2DHS A;  4IRC A;  4DSI A;  5ETP A;  1H2U X;  1MN9 A;  3OXF A;  3D9B A;  2OPQ A;  1TAU A;  5IT9 U;  2F4V F;  3OFH A;  4CO5 A;  4OI0 A;  2CVE A;  4EYH B;  2ZH8 A;  1LWC B;  1RKI A;  3PX6 A;  2GHV C;  2OH2 A;  2R7U A;  1RT2 B;  1N4L A;  3C3L A;  3BH6 B;  4IO9 Q;  5KFY A;  2W4D A;  4ECW A;  1SKR A;  5HMW A;  1DLO A;  4ZN1 A;  1RAC B;  1BQM B;  4X64 F;  2BDP A;  2DNP A;  3CC2 S;  4H4O B;  1XIQ A;  1YQH A;  4ZIV A;  1H72 C;  4E8U A;  1SIW B;  2GGP A;  2LXI A;  2YX7 A;  3RW6 A;  2IYG A;  4Y28 C;  2V8G A;  1L3U A;  2B9Y A;  1M90 T;  5CHC B;  3AOA A;  1TL7 B;  4XO0 A;  4WXO A;  3NWR A;  3PCO B;  4JV0 A;  4J9O A;  4ZS6 A;  2O1P A;  3LF0 A;  2DTJ A;  2B7C B;  1IQZ A;  3VV2 B;  3DNC A;  5KT5 A;  3JYT A;  3I9Z A;  1T05 A;  3I0R B;  4KSE B;  5KG5 A;  4DV2 F;  1LW2 A;  3BPS P;  2ZHO A;  2HVI A;  2BMB A;  5KFN A;  1JB0 C;  4CT9 A;  1WHV A;  2V9K A;  1C0U A;  1FFG B;  1JJC B;  4OHV A;  1FKP A;  2V4J A;  2WSF C;  2G9O A;  3BGU A;  2FLP A;  4P10 A;  4AD6 A;  4DCP B;  1KON A;  1ZYQ A;  2WVE A;  1NK4 A;  4LF9 J;  2IRU A;  1RT4 B;  1DJ0 A;  3C16 B;  3EMT A;  1KWM A;  4QR0 A;  4ZP8 A;  5KFG A;  2V4Q A;  3K58 A;  2VQE J;  4ILL A;  3Q89 A;  1WG1 A;  5L9N A;  2HHW A;  4DU7 A;  4WP9 A;  2KFZ A;  3TOQ A;  1X4G A;  4M5M A;  4MK7 A;  1VBZ A;  2QLW A;  1N36 J;  5CXT A;  1PJ6 A;  3HP6 A;  5HP1 A;  4NCA A;  3BV8 A;  3TWZ A;  4IOA Q;  1T9Y A;  4XIU A;  2AZ3 A;  4ICL B;  5D3G B;  2X1F A;  1S10 A;  3NBP A;  4FYY B;  5GAE I;  2IC3 B;  1JXL A;  4J9V A;  1I94 F;  2HBZ B;  1IXK A;  2VKZ G;  2QMX A;  4HT5 A;  1QVG R;  1S5Z A;  4XDD A;  3I9V 9;  3IN5 A;  3J7Y U;  2EWH A;  2RU9 A;  2F8E X;  2MQQ A;  2QG9 B;  3RRK A;  4QJV A;  4DV5 J;  3DLK B;  4MIA A;  3CNQ P;  2OD4 A;  1MRO B;  3FEY B;  3L7U A;  1VRU B;  2DRB A;  3PFO A;  2HYI B;  3G82 B;  2CQI A;  1A6L A;  1S1X A;  2B9E A;  2ZZN A;  5HL7 Q;  1DQ9 A;  3D7S B;  1MG7 A;  1S48 A;  5F9L A;  4G1Q B;  1S1X B;  3MD1 A;  2C1E B;  3UVJ B;  2ZBC A;  3EZU A;  3TO8 A;  2MHE A;  2UU9 F;  3DOL A;  2NLW A;  3GG1 A;  1GX6 A;  1NHV A;  2CZ9 A;  1NPR A;  4WP3 A;  2QJ3 A;  2PI4 A;  2FY1 A;  2HBY B;  2QE5 A;  3CCU S;  1T03 A;  1IVZ A;  2KJV A;  2Y3Y A;  2BJ7 A;  2CPI A;  2HS0 A;  2H51 B;  3M9M B;  1X5O A;  3MWB A;  1IM6 A;  2FGO A;  3UN3 A;  3D3B J;  1HR0 J;  3MUR P;  1FWK A;  2AF6 A;  3CGI A;  2E1P A;  3MM5 A;  4A48 A;  3J81 Y;  2J76 E;  1FTC A;  1Q1K A;  2WOM A;  4UQT A;  4W92 B;  3X1L B;  1Z2L A;  3CSK A;  3EPG A;  1BD6 A;  3NL0 A;  3H4B A;  3MR2 A;  2L9N A;  3DFE A;  2HFN A;  1SI9 A;  1P9Y A;  2F4F A;  2QGF B;  3OR2 B;  4I6A A;  1RHQ B;  4O3P A;  3GB0 A;  2IVF B;  2W8L A;  1U48 A;  2H9Z A;  2OEM A;  3CUL A;  4K4S A;  2DCL A;  3AT1 B;  5J1E A;  4ZVE A;  2PSZ A;  1WUU A;  4CLZ A;  1NBE B;  3ILJ A;  1CPZ A;  4CDI A;  2BJ3 A;  1ZTT A;  3S8S A;  2CAD A;  4MK9 A;  2GMJ A;  2MQP A;  2V5H G;  2J7U A;  3TJ8 A;  5F9N A;  1LW0 A;  2CQG A;  2NYH A;  4OX6 A;  3CJR A;  2GCF A;  4UW2 A;  4X62 J;  2XUL A;  5LMU F;  1XN9 A;  5C25 A;  4DZ6 A;  1N36 F;  3D68 A;  3KG4 A;  3T9N A;  2ZH6 A;  3CT9 A;  3SQO P;  5IC6 B;  1AFJ A;  4IG0 B;  4TN2 A;  4LF2 A;  5HQM A;  3A1Y G;  5GVQ A;  3CMQ A;  3I87 A;  4NYP A;  3IWN C;  4D3G A;  5E3A A;  4WPA A;  2Z2Z A;  2ZOG A;  1MRO A;  2GHP A;  4EYI B;  1GQE A;  3HT3 A;  4JI3 J;  2DGO A;  4P72 A;  3VAL A;  2CPZ A;  5T7L B;  2IM0 A;  2YX1 A;  3MMA B;  4ECX A;  4NZ6 A;  2QC3 A;  3TQ1 A;  1X9W A;  1NCL A;  4CNZ A;  5KFD A;  3NMA A;  1RWM B;  4QIE A;  2CQH A;  2OPP B;  3R97 A;  2Z30 B;  4M5N A;  3UVJ A;  2ZZT A;  1PYT A;  4ID8 A;  4Y2K A;  4M8L A;  3TA2 A;  3T1H J;  2IHR 1;  1FKO A;  2YKN B;  1T05 B;  5A8K A;  5HK4 A;  4I2Q A;  3BQ2 A;  1DTT B;  2VPY B;  1KVK A;  2ZDO A;  1RHR B;  4HLB A;  4OJ3 A;  2CQ1 A;  4ZVO B;  2GV1 A;  1JJH A;  3N0V A;  3N6N A;  4L6V 3;  5KFE A;  2OEJ A;  5MAO A;  4MTP A;  4WIQ A;  4PWD A;  4KQZ A;  2V0N A;  1BWV A;  2BUN A;  3KJV B;  1F2G A;  2Z56 B;  3MAA A;  1I94 J;  1HI1 A;  3P45 B;  5KFR A;  4C98 A;  3M2U A;  2GNK A;  3R5C A;  3F73 A;  4DL6 A;  1T95 A;  4PXD A;  2U2F A;  2MGZ A;  3RB3 A;  1NK0 A;  4B9L A;  4DSF A;  2HSE B;  3WC0 A;  5IZH A;  2BXJ A;  1VQS A;  1PYO B;  1S1W B;  2APO A;  5J1N A;  2MB0 B;  4B9U A;  3HI9 A;  4JI6 J;  4DLE A;  2JX2 A;  1TUV A;  5EX3 A;  2KXN B;  3KWM A;  3M8P A;  5DGA A;  1YK9 A;  1HHT P;  3D28 A;  2WHO A;  3C15 B;  3KHL A;  1FRM A;  1FVS A;  2A10 A;  2DO4 A;  1RWV B;  2HBQ B;  3MCM A;  5KFX A;  4I6Y A;  3OSN A;  4DV1 J;  1KD1 T;  4IR1 A;  1EX8 A;  1K9M T;  3UW1 A;  1NB2 A;  4DL3 A;  5AJ3 F;  2PDA A;  1N33 F;  2C42 A;  1WC4 A;  4DR4 F;  3CCS S;  5J2P B;  4DR3 F;  2LKZ A;  1Q53 A;  3EUN A;  3J80 U;  2SXL A;  1O0P A;  2MLZ A;  3UDV A;  3FMB A;  1NJW A;  8AT1 B;  3VZI A;  1WG4 A;  2XQC A;  3PHT A;  5L46 A;  5K14 A;  1U47 A;  4LRD A;  2R4F A;  4NLP A; 
#chains in the Genus database with same CATH homology
 2HRX A;  2HAF A;  2GS5 A;  2DO8 A;  2AJ2 A;  2MUI A;  2EW0 A;  2GZO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...