2AJ2A

X-ray crystal structure of protein vc0467 from vibrio cholerae. northeast structural genomics consortium target vcr8.
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
187
structure length
187
Chain Sequence
SDIEVGHSMNLTNHFLVAMPSMKDPYFKRSVIYICEHNQDGAMGLMINAPIDITVGGMLKQVDIEPAYPQSHQENLKKPVFNGGPVSEDRGFILHRPRDHYESSMKMTDDIAVTTSKDILTVLGTEAEPEGYIVALGYSGWSAGQLEVELTENSWLTIEADPELIFNTPVHEKWQKAIQKLGISPAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical UPF0301 protein VC0467
publication title X-Ray structure of hypothetical protein VC0467 from Vibrio cholerae: new fold. Northeast Structural Genomics Consortium target VcR8.
rcsb
source organism Vibrio cholerae
molecule tags Unknown function
total genus 38
structure length 187
sequence length 187
ec nomenclature
pdb deposition date 2005-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02622 DUF179 Uncharacterized ACR, COG1678
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1300 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits VC0467-like domains 2aj2A02
3.40.1740.10 Alpha Beta 3-Layer(aba) Sandwich VC0467-like VC0467-like 2aj2A01
2EW0A 2HRXA 2MUIA 2HAFA 2GS5A 2AJ2A 2GZOA 2DO8A
chains in the Genus database with same CATH superfamily
4DQIA 1IKXA 1EKSA 4F67A 3LALA 2G2ZA 5F9NA 2MQPA 5KFFA 3LP0A 2UVVA 3Q23A 2HQIA 4NL5A 1S9EB 5B08A 2W2OP 4WXOA 5ETLA 2U1AA 2W9AA 1ZM2A 2GHVC 4FNHA 2V67A 1JLQA 4G1IA 3RR7A 3DXBA 4IRCA 3E3XA 1KHVA 4DSEA 2VC0A 1VBZA 2VJVA 1O8BA 4ECZA 4I69A 2BVZA 5DLFA 1VQLS 4WFBQ 3PW0A 2DTJA 1NPRA 3SXLA 1HI1A 1NH7A 2XM3A 4P75A 5D0HA 2PMZD 3HXMA 2E5HA 2OIHA 4HEA9 1CJTB 2IRYA 1S7IA 3S6EA 3VGSA 2HBQB 2FLOA 3GIIA 3PJWA 4Z2XA 3RAXA 2J5AA 4ZLNA 2GAGC 3BYPA 3W61A 4O0IA 4WU3A 2V8HA 2AGQA 1UP1A 5D8HB 1IKVA 2V69A 5FJ4A 4NE9C 4PXEA 1LNQA 2KHDA 3TEHB 2UVRA 4YN3B 4IFVB 1RWNB 4ES3A 4DV1F 2MQ8A 1FTCA 2CRLA 4B9TA 3D1OA 2AEMA 4NLUA 1FRIA 2QJ3A 4IRKA 2P8IA 1FDNA 3M2VA 2BJ7A 1YJTA 4WPAA 1KVIA 3D67A 4ZDNA 1LKZA 2M2BA 3H25A 2FC8A 2LA4A 2I5JB 1Z2LA 3G6YA 2V8PA 2NSCA 4CQ1A 5L8RC 5HSPA 3E51A 3BKFA 2K3KA 1FEEA 1Y10A 2HNDA 2V68A 1TAUA 5A8WA 5KFPA 5J2QA 4TVAB 2BYCA 2E7XA 2HK2A 2YH1A 4M5DA 2PMHA 3B4MA 1TKZB 2M3DA 2NUUG 2RDDA 3CCQS 5F0WA 3W60A 3C3LA 4NEYA 2XSJB 2MLZA 2CQPA 1KQKA 5HMYA 1KOHA 4ECUA 4NLTA 3SQOP 2SXLA 2AZ1A 2CDQA 3TP2A 2C3PA 2Q3PA 3O2IA 2LEAA 1CC7A 2J9DE 2KH9A 4UOGA 1D1UA 3SCLE 1U1OA 2VUGA 1BXNA 1WD6A 5E41A 1KDNA 1QSYA 2HEKA 1R89A 2PA8D 4IYQA 1R43A 4K2JA 1VIOA 5D78A 1S0OA 3LW5C 3R5GA 4YP3A 5J2MA 1JJHA 1B7FA 4O4GB 1IWAA 5FD1A 5L1KA 4F4KA 1WC0A 3NCRA 3AQPA 3PG9A 2EKNA 4JUZA 1FJ7A 4GVLA 4WFNQ 3GJQB 4X66F 5LSOA 1VQPS 1TL7A 3QO9B 1RDRA 4RUAA 4JI5F 1RZMA 1UETA 1S72S 2G9OA 1HWKA 1EAYC 4HYKA 5A8KB 4QYRA 2F63A 2G0IA 3I6PA 3Q8QB 1GK8A 4DV0J 4I4BA 5C24B 4UY8T 1SJFA 4N41A 1RT1A 3C66A 4LF5F 2A2CA 1YDLA 4EWTA 2FLPA 2GO9A 5I4MA 3OUYB 2GVZA 3FEXB 2EFVA 4CT9A 4N8OA 2QRRA 1UEKA 3EDRB 3G86A 4TY8A 1APSA 3N79A 5IS2A 3JQJA 5ETOA 3ZZYA 2GCFA 4ED7A 4WYLA 3D5MA 1NZ8A 3P3DA 1F9FA 5LSRA 4C48A 2G2YA 3L7PA 2CPJA 4PKDB 4XPEA 4NEZA 1LWFB 4HKQA 1RLDA 1HI0P 1IBMF 2HIYA 4A4JA 3OHBA 1BE4A 2CJQA 4TY9A 3CJ5A 4P2MA 2CJ9A 3ZTOA 4LVOP 3FEYB 1J5OB 3QNWB 1R6VA 3TOQA 3M9NB 4ICLB 2VBWA 3DOLA 1FNXH 3VWSA 2LDIA 4RNNA 4NRTA 2YX7A 1VFJA 1D9AA 5BR8J 4ZA1A 4BCAA 1V3SA 4I2QA 5KFVA 2R7VA 4J9KA 1N33J 3MM7B 4GMKA 2K1RB 4EBDA 5L38A 2H9ZA 2XS7A 4LF9J 2HIQA 4ED4A 4RUCA 1U1QA 3PRDA 4FYXB 1PYTA 4P52A 4PEOA 1M5HA 4X65F 5EGYA 3Q8UA 1HPZB 3ZTRA 4MK7A 4OX9F 3MCMA 2GJFA 4BS2A 1K73T 4ZVHA 3TAMB 2KG1A 3CJ4A 4URQU 3EJMA 1EP4B 5IT9Y 3ETMA 1N34F 4NYPA 4DPYA 4AYBD 1NJZA 3V4MA 3FBEA 1U0SA 5LXYA 2QT7A 3HVTA 4LF8F 1N36J 3ISZA 3B82A 4DS5A 3GFXA 3BGOP 2DY1A 1WKKA 3JS9A 2F3JA 3KKFA 3R7SB 2Y8WA 3VAFA 2WVEA 2XYHB 5CXTA 2DHXA 2YWHA 5G0RA 1HQEB 5T41A 1U7LA 3MECA 3EVWA 3PEJA 2MY8A 2KZZA 3GONA 4FZVA 2OJ3A 1K47A 4JI4J 4ECWA 1NSKL 1RHJB 4EI2A 3OFGA 1CJTA 2V94A 4KGMA 2KFZA 4QCLA 1SIWB 4HL9A 3M8SA 3OXLA 2CNOB 5L1LA 3TA1A 1YJNS 3BDEA 1I5OB 1WSVA 2Z2LA 3T41A 2R2UA 2K7KA 4J9SA 1TELA 4BWJA 3OR1B 1TZ0A 2QFIA 3T1YF 4USKA 4AE5A 4I56A 3M7VA 3EPIA 3MM9A 4J90A 4BC9A 3MM8B 3I0SB 2QGFB 3UWTA 2GGPB 2IBOA 4IH6A 2DEJA 4DMZA 4XTTA 3RRHA 1IR2A 1FFWB 5GAHI 3IA0A 2I5JA 4E98A 1Q86T 5HVFA 3MZIA 2XS2A 3H59A 3OVSA 1X0FA 5GMKa 1RTDA 2EK1A 2VPZB 1HNVB 3KJVA 3DI6A 1FJGF 4DR3J 5B7WA 2UXDF 4K59A 3FVYA 3EZ5A 3KNAA 3KG0A 2MYFA 3J81U 2OLWA 3CCSS 1GQEA 2W9BA 3LO3A 4DV5F 3KJFB 3O5TB 1WOOA 2RHQB 3HSJA 1OY6A 1IQZA 3GFHA 4CLKA 3GU0A 3C16B 2CVIA 2H54B 1RT7B 2HSEB 4FF1A 5CH7B 2BRKA 3U27A 3HO1A 2VICA 1RHUB 3KJQB 4XDCA 3W3SA 2VONA 3MR6A 3PJ9A 1X60A 2JLEA 3QFWA 2V2KA 2ADCA 2R8GA 1WJ9A 4ZHRB 5HK4A 3F56A 2BEFA 2GIRA 2ZBIA 1U1LA 3FKBA 4X2BA 4X4VA 4PCQA 1WEXA 1JLFB 4IOCQ 3C6TB 3QLHA 3N6LA 4B17A 1RAFB 3P8BB 3KMQA 1RT5B 4DR5J 4QWDA 1M90T 2YNHB 4PQUB 2BX6A 3JQMA 2B9EA 5AT1B 2HNYB 4I67A 5CYMB 1RBOB 2ZWPA 1S9GB 5D4LA 1LK7A 4QWBA 3O8WA 5E0OA 3VF0B 3FK4A 1UVNA 3SSSA 3OLBA 3VGTA 4QW8A 1UVMA 1HNZF 2CQHA 4EYIB 3QFHA 2VASA 2F40A 4LSLB 5LMNJ 1MMDA 2V34A 2OHDA 2CWKA 4TNOA 1OSDA 3DLKA 2IDEA 5HN0A 1MN7A 2VBYA 1KN6A 2UXBJ 2DISA 2B4PA 1KKHA 5DDRC 3L9ZA 3G71S 3OUYA 2VDHA 1IVZA 2XCPA 1RSCA 3FQKA 4K8RA 3S8SA 2DGQA 4C98A 3RG6A 2EKYA 3M6WA 3PFEA 2V2QA 3TUJC 3ZTPA 3KMSA 2GAHC 3G8QA 3VQSA 2DGSA 1URNA 5HJXA 4U7CA 3CDEA 2EVZA 2H3EB 1RTHB 4CLPA 1LWEA 2XG8A 1P1LA 2MQMA 4DF4A 2W8LA 2Y1LB 5DDQC 4UF4A 4ALZA 4LSZB 3DLJA 3LH2S 3JAMY 1YRTA 1T11A 2LEPA 3TZZA 3CJRA 3I4HX 2ZVSA 3TUZC 4IQXA 1SIZA 4WYWA 4E2FB 2UUCF 3HMJG 1UVIA 1PIEA 3NGUA 3CCVS 2HHXA 2QX0A 3NRBA 2A6MA 1X4HA 4DV4J 2AQ4A 4FXWA 1H2TZ 5CA5A 4OHVA 4FKXA 2L9WA 3N4WA 1TVRB 3WX8A 4OYXA 3MEGB 2MEWA 1VC5A 3ITHB 1B0VA 1VQYA 3C46A 1IR1A 4HVZA 4F36A 1V9OA 3QGIA 1AFJA 3OXFA 4F0MA 3DC2A 1HFEL 1JNRB 5ETPA 2AJQA 2F8EX 2HGMA 5D0EA 2BW2A 4XO0A 4U7UD 2Q6BA 3J80U 1BQNB 2HQCA 2QLJB 3CVKA 3MMAB 4R25A 2ZH6A 3GP9A 1HPZA 2ZBRA 2ZM6F 2VD3A 3FNNA 2FHOB 1WHWA 2NZ4A 1OY8A 3QGGA 2KT2A 2BQRA 1S1VB 3ZZOA 2CPFA 4C6AA 2IVMA 4GC6A 4LMZA 4CLTA 4ZMMA 3VTIA 3EGZA 3EYZA 5F41A 3SV3A 3QPIA 1UA0A 2GFFA 3EDQB 3ET6B 1D0EA 5KTQA 2OPQA 2YVSA 3NGDA 5HMWA 3MAAB 1JQGA 3IO1A 1MWYA 5HVGA 1B0TA 1N48A 4NXNJ 4R0JA 3A3PB 4WIIA 1S0NA 3LGNA 5IC4B 2EK6A 4RW4B 3GLJA 3FUYA 1LW0B 1ZPVA 3CGIA 2CZVC 4OI6A 1O51A 2B9YA 3EGWB 2BACA 3W66A 3FGVA 1JXVA 3N0VA 2CQGA 5J2NB 4DR2J 1RAAB 2DIVA 4XDDA 3MPDA 4LFBJ 4C9DA 4H4OB 4DS4A 7FD1A 4RKUC 1J5EF 4FF4A 2WVBA 3ISNC 1VQ5S 3OR1A 2AHOB 1T94A 1FRHA 4Y2MA 3D0GE 2Z8QA 2OH2A 1SJRA 1C0TA 1KHWA 4CZCA 1KVKA 2NYHA 2VZ9A 2UUBF 3PEHA 2KXHA 3GJRB 3I0SA 1VC0A 1RWVB 5T14A 3PR5B 4KHMA 2NXEA 4ID8A 4B3SJ 1DFDA 1NSAA 3UNGC 3VALA 1RAIB 4DL6A 4RW7B 3WIUA 4DV2F 3R97A 2G0CA 1XNQJ 2EBGA 1KFDA 3EGVA 1AROP 1JKHB 2DGUA 4M94A 2W7OA 2ZDPA 2V2VA 3D6FB 1RGVA 2ZZNA 1HNVA 2AWZA 2W24A 3SSRA 1UVJA 5D4OA 3UQSA 5ETQA 1SJ4P 4OZ3A 1SJ1A 4F3OA 2IHR1 3HZEA 4I1TA 2YWEA 1RCOB 4ENOA 3CMES 2M7SA 2YNGB 2AU0A 4ZOSA 3R1HA 5ETVA 3R5JB 2GX8A 1T0TV 3GIJA 3MM5A 2BOPA 3LAKA 4OZNA 2ZKUA 3HDSA 4ES2A 5AXNA 2R3VA 2GS8A 5JVGQ 4ZHRA 1JLCB 3BPDA 4C8MA 2OKQA 3TQ1A 3GIMA 1XMOF 2HVIA 3IXQA 2CIMA 2AYEA 2ZH7A 3KLGA 5JUMA 3V6HA 3G82B 4PQUA 2LECA 5KFZA 4DXLA 1RISA 4K0KF 3OTEA 4JI3J 4IRDA 2J9CA 1S6UA 2PDAA 1W2BR 3ONQA 1S9GA 1WUUA 4YHHF 2Q66A 2HLTA 3EZUA 3KLHA 3BB5A 1S12A 3G6XA 4NZ7A 2KFNA 2ZBPA 3AH6A 3CJKB 5C5JA 1CJUA 1PCAA 2CJAA 4AL6A 4OZJA 3QBCA 1FRKA 1YJ9S 1RHKB 3UVJB 3J7YU 3AD9C 3M8YA 3LGMA 1OQ6A 2RB7A 3P5BP 1JJ2R 5J1EB 2F8HA 1H0HB 1DAXA 1QUPA 2LQ5A 4DV1J 2Y1JA 5F8LA 1PAUB 1YZ6A 1WDDA 3HHNB 1Y3KA 3EE3A 4KO0B 3M9OB 2RE1A 2KT3A 2QA2A 3QATA 5EDWA 2JDJA 4HT7A 4A8MP 2XSFA 3DN9A 4DV7F 3IBCB 1RTHA 1Y00A 2R8KA 3M2RA 4X4SA 1FFSB 2XNQA 1AUSL 3LPYA 3FQLA 4TLRA 2W2NP 5KT3A 1RBAA 1PJ6A 4M5NA 3BQ2A 3FRZA 5DM6Q 4O0NA 1RK8A 2HZCA 2QYGA 2DK2A 3OT9A 1NJWA 5B0CA 2RH3A 1X31C 2V6AA 4Q0BB 4PXDA 1VHIA 3UFCX 4P74A 2MZJA 4MMOA 4PG7A 3CEDA 2ILZA 3MEGA 1XMBA 3ITHA 5MLCV 4PR6A 1BD6A 2I9SA 2DEIA 3U1MA 3BGLA 3NCQA 3L95X 3QYYA 3A13A 1YQHA 2RUSA 2RD5C 1DLOA 4V1Ak 3BN7A 4HLBA 4CTAA 4WFAQ 2L08A 4J9QA 1KS2A 2FJDB 2GO8A 5C42B 4X66J 1X4CA 4X4OA 2WW4A 3CCUS 2XI3A 4RNFA 3H5UA 4JI5J 4B9UA 1LK5A 2DKOB 4GO5X 2RS8A 3OJSA 5L9XA 3FDSA 2DR8A 2HMIA 1IKWA 1JIHA 2MXYA 5EWEA 1T9VA 3ET6A 4LF5J 3NAHA 3I55S 1KQFB 2VBXA 3BM7A 1P6TA 2CQ0A 2X3DA 1E6VB 3I5BA 3M8QB 1RT6B 4FS1A 3PRBA 4LF6F 3AXKA 1UVKA 4DUTA 1QE1B 4FYDA 1WC4A 4C4WA 2M9KA 4KHPF 2QA1A 1YJ7A 5CD4A 3IRXB 2FQQB 2GJIA 2DHAA 2E7VA 4B9LA 3HVAA 4H4OA 2J7UA 3BBBA 1EX8A 1XQIA 1FX4A 4TU7A 1IBMJ 1XK8A 3IFEA 4A46A 5HJYA 4DEZA 1UFWA 3PYDA 4ITSA 4PWWA 1X8DA 2EFGA 3HVRA 3M4XA 2HZAA 4W90B 1ZZFA 3ZNJ1 1VQKS 1BGXT 3CCES 1K1QA 2E5LF 1U1RA 1L3TA 1SKSA 3D66A 4NLDA 1XWLA 1Q5VA 1H73A 2ZZMA 2XMAA 3KK2B 2HRYA 1YHQS 4YB5A 3A8IA 4USHA 4KFBB 2E1RA 4DCOB 2D7SA 2LXIA 3C14B 3KFWX 1REGX 2CG8A 1C2PA 2NREA 4PQAA 1X9MA 2UV8A 4I6WA 3GG0A 3TX0A 2GHPA 4DSIA 2JNJA 4FNIA 3BH7B 1K0VA 3HHDA 4X65J 4KC5A 2AW0A 2Z2MA 1CJKB 3GCWP 2QLFB 4OX9J 3D1HA 1FFGB 3BV8A 3TJ8A 1RT4A 1Q78A 2XMMA 3C15B 4QR0A 1FRLA 1U1NA 1RAJA 3MPUB 1N34J 4ZJLA 3DYAB 2QEXS 2MGZB 3Q8VA 4DSKA 4NYOA 3VAJA 2KO1A 3UI3A 2FC9A 4LRAA 4DU7A 4P9SA 1VLOA 2IRUA 4LF8J 1HW8A 4DSFA 1JLCA 1URRA 3IBFB 4I6AA 4OZ1A 4GKKF 4CI0B 4ZPTR 3DLLQ 4R5PA 1JJ4A 2DH7A 3SMZA 1QSSA 3UD4P 4Q8FA 3UD5A 2O66A 4RNOA 3OV7A 2COLA 1TUWA 1RUSA 1CS4B 2KJVA 1NM2A 2CQ2A 4PZVA 3DHXA 1OQ3A 1U8WA 1S0VA 3KG4A 1GMVA 2W2PP 2WW8A 4K5SA 3KLIB 1T03B 3W2WB 3KXDA 1CVJA 2HS4A 2DCUB 3L09A 3AA8A 4OYPA 4DCJB 2AMCB 2CJYB 4EBEA 2K7JA 1GTHA 3EWGA 1SH3A 1FWLA 1U0HB 4NZ6A 5EX0A 4AUKA 2XZTB 3T1YJ 3HHKA 5KFEA 2E9RX 2R8HA 2OGUA 2E29A 1F5BA 1Y7PA 2AKWB 3FFIB 3RB0A 2B56A 5JXSA 1E6YB 3VZHA 1CULA 4H4KC 2UZAA 3UR3C 1AZSA 4KO0A 4TU8A 2B4VA 1RYRA 1NDLA 1GXTA 4DUZF 5BXIA 5BYSA 1P9YA 2QC3A 3AOAA 5F3ZA 3ZXWA 1RAHB 3MMBA 1HD0A 1RWPB 1CC8A 1WOPA 3LOUA 3B78A 4ZP7A 3JB9k 2DPIA 1X5PA 2IC3B 1FJGJ 2UXDJ 1SC1B 2YKOA 3MPYA 4DV5J 4H54A 4C97A 2QLBB 2ZEJA 3I31A 1LWXA 3A3NB 5K5MA 1HYSB 3QJLA 1UEVA 2YPZA 5I3QA 1NJYA 1MWQA 3G96A 3BGRA 3RB3A 2ZH5A 4NCGB 5HBMB 3VVTA 8ATCB 1RBLA 2MHNA 2DHHA 5KFOA 4OYOA 1Z1ZA 2FJAB 1HBMB 4H4KA 2YKNB 1UWBB 4X4QA 3JSMA 4WZMA 2IJRA 4LBIA 4HDHA 4X4PA 4Q43A 1U6ZA 2Z30B 2G4BA 3TA0A 1OY9A 2JLFA 1TV6B 3ZO7A 4HI1A 3MTKA 3RZAA 2GV1A 1FNMA 2WRMA 1H98A 3LANA 2HQDA 3TRGA 3T19A 1U02A 3ZZUA 2A6OA 1HR0F 2XWXA 4ECTA 1OYDA 3BBCA 4YB6A 3NXZA 3BF4A 2QL5B 4CYUB 3NS7B 2BE7D 2HS0A 4UZBA 5HAOA 2D74B 1HNZJ 2GMJA 1WHVA 4E8UA 4RX6A 3N5BA 4NLOA 2XB2D 3CC2S 1T02A 2RILA 5GAEU 1UL3A 4C0BA 4CLWA 1FI4A 1HWIA 3MMCB 2XY6A 4O3SA 1HBUB 3ETOA 3OTOF 2CZ9A 3H4DA 3GJTB 4JV2A 3AFGA 5E7OB 4IG0A 5FDLB 2L48A 2L41A 4FP9A 1E6VA 2RQMA 3M8QA 4P10A 2Z0GA 3MEEB 5E3PA 4DL7A 3NNHA 3WQPA 1QE1A 2CQBA 1ZPWX 3CW2C 3GYGA 3IRXA 4YB7A 2B5JA 1HLWA 1MWZA 4RLEA 5DETA 5IV3A 2Q79A 2HW3A 5IFMA 5HMXA 5ETSA 1JJCB 2Y0BB 4YFUA 2KVQE 3W2VB 2UUCJ 2EW0A 1LWCB 2EI5A 5HROB 5FLXU 1HBOB 3K57A 4JI6F 4QIVA 5I3PA 3LP2A 4F7VA 3AOBA 4NXMF 1AA1B 1HQUB 1R8BA 4MIBA 2OSQA 4ECXA 3OR2B 1XERA 4L6V3 1NDPA 2XQCA 1R8PA 3VZIA 5CQGA 2YWWA 2H65B 1O0PA 2IDLA 1EHWA 3KK1A 1I94F 2ATCB 4K2XA 2CPYA 3V6DB 3K89A 3TANA 2CDRB 2N7YA 1ZOTA 4OHZA 2PSZA 3R1LA 4JI0F 1JX4A 2XZDB 4DR1F 1NK7A 2AGPA 7FDRA 2E66A 4FVCA 2ZM6J 3IR7B 1RU2A 1CJKA 3F73A 5KOWA 5A0YA 3CB4A 4DU8A 1EZZB 2FY8A 3C15A 3DLGA 1PYSB 1LOUA 3O1LA 5LOQA 4NCBA 3DYAA 3ZZTA 3QJJA 3POTB 1P1TA 4MKYA 4FF2A 6AT1B 1JLAB 2MB0B 4DPTA 3I5AA 4LVNP 1NSPA 1L3VA 1R3NA 1S6PA 2ALYB 2IMOA 4B9NA 5H9FJ 3LQVA 2KDOA 1RU1A 4X4RA 1WG1A 4WE1A 4X62F 1V6HA 2XWYA 2BJ1A 2MTLA 2HGNA 4GO7X 2PI4A 4UOFA 2EG2A 4AXIA 1WC3A 4DHVA 1IQTA 3L7OA 1UVLA 1W7WA 2MJNA 3QIPB 2PEHA 3HT0A 1C0UA 5L46A 4LQ9A 1VQ4S 3IG1B 3V4IB 2QV6A 2ZH9A 5KFDA 2ZUAA 2EFOA 1OPIA 2H1YA 2ZVIA 3CCJS 3QWPA 1VK3A 1J5EJ 4OI0A 1JLGB 2CPXA 2IM1A 2DNQA 4JI7F 4PXBA 5FIIA 2XLJA 4FVMA 1U0HA 3G2XA 3CIMA 1P27B 4QWEA 3D6HB 2B8QA 2HWIA 2UUBJ 5IM0B 1E6YA 5HI7A 3MCNA 4RU2A 3WX4A 3GFYA 1WHXA 5KFBA 2W9CA 4DV2J 3T1HF 3DM2B 1IBKF 4LFCF 4CH1A 4G1QA 1N6QA 3WC0A 2B6AB 2D3ZA 2GMLA 3CJTA 4WF9Q 2ROGA 2WSEC 4MFBB 5B09A 2CNNB 2E44A 3HZGA 1FEHA 4K4WA 4LSNA 2ZC4A 3TYTA 2CPHA 3BSOA 1Y11A 1EB0A 4YDDB 4ZVQB 4BBYA 1WOSA 4HACA 4ERDA 4OQJA 5DRKA 1ICEB 3HSDA 1X9WA 3D28A 1XJWB 3RRGA 4EUVA 1WG5A 3KUHA 5T7LA 4LF4F 2FLNA 1A7GE 2YX1A 4ANEA 4CWBA 1NEEA 3DGPB 1PG5B 4O3QA 3C19A 3OD2A 1X5TA 1YG0A 1HBMA 3PX0A 2E1PA 1BMQB 2YKNA 4ECSA 2RDJA 5D15A 4RUBA 1PAEX 4QIFA 2Y1RI 1CBKA 4R8UB 1XMOJ 3CT9A 4AQYF 5BJRA 5I42B 3SCIE 5AE2A 1S1TA 1GX5A 2Y0SD 2ZNZA 2OPRB 3IMQJ 2HFVA 5KFXA 1XNRF 5G4DA 4K0KJ 3MUMP 3BSNA 4C3MA 2WCXA 2MKCA 3RBDA 2AV5A 4XPCA 4C8OA 1VBKA 1NDKA 3D6MB 4YHHJ 3EVOA 2DH8A 1ACMB 4EBCA 1SC4B 3ZZZA 1G3OA 4DZ6A 1WEYA 3SDEB 4FS2A 4MT1A 1C4AA 2K3IA 1MLAA 2DBBA 2OEKA 4Y28C 4MK9A 2V0NA 1SL2A 1S79A 4AL5A 1Q16B 3CE8A 2PIIA 4QIGA 1WC1A 4KYZA 2LQBA 3CDAA 2J0QD 3R3TA 5IWAF 1HBUA 4CLFA 2P6SA 4IFYB 2VPWB 5HLFA 3MI7X 2HHHF 4JOUA 3HFVA 4F4AA 3IC1A 5K8MA 1ITPA 2IYGA 1BWEA 2AX0A 1SUQA 3DLEB 3BDPA 5K8OA 4UT4A 4CIOA 3CD6S 3VAMA 3GQCA 3CJQA 1UEUA 4DV7J 1WDTA 3N6NA 3PY8A 2ZJQQ 4AFFA 2JC1A 1DURA 1VMBA 3TUIC 4K4YA 3R5BA 2PN6A 2I6WA 2YH0A 5C2CA 2FUG9 4Q2MA 4O23A 3B6BA 1ZTTA 3KYLA 3T3FA 4TYBA 3JTNA 1LWCA 3RRKA 1TQLA 2B9XA 4H4MB 1FDAA 2ROPA 4FN5A 3IAM9 3A8JA 5LSLA 4G65A 2VKRA 2J7WA 2Y3YA 4EGLA 3NL0A 5KAKA 2P9CA 3VAGA 1X7VA 1HQUA 2CNKB 4YQWA 2FJXA 4W92B 5KG4A 4YY3F 3TZXA 2HLUA 1Q81T 1SKUB 3R5CA 5KFJA 2VFSA 4LUBA 3MOJB 1ZA2B 1VDHA 4Q8EA 2DH9A 5AXMA 3GV7B 3HJVA 2LXUA 4KPYA 5KFTA 2CAJA 3V6DA 9ATCB 3GILA 4KGKA 4ZVGA 4OJHA 4J7CA 5IZHA 3CJSA 1U2FA 3MOZA 5J2PB 3GIKA 4X4TA 1ZM9A 5DG9A 1IJEB 3PDNA 1RTJB 4OV6A 1TL5A 4ZVSB 3BR9A 2XS5A 3JYTA 1HNWF 1JLAA 1NHVA 3PO5A 4MJKA 1LW2B 3QT6A 2E9ZA 2J0SD 4TQRA 2C3UA 5F8JA 4L3NA 3D0HE 3CCRS 2P9EA 5KT7A 4UUWA 1KLNA 1QM9A 2JWNA 2FVRA 5LXRA 2J7KA 1B70B 3MR2A 4LF6J 5A76A 1UFLA 1JNZB 3QIPA 4KHPJ 2Z2YB 5GADI 2RVJA 4WWSA 3OL9A 2Q1LA 1UPPA 3NEKA 4GKJF 4BLGA 2FJWA 1SXLA 4NASA 4YUDA 1HMVA 3GE9A 1R0AB 1JLGA 2K06A 4RW9B 1U6BA 4PAAA 2NZCA 1W2IA 4NPOA 3DOMA 4KHRA 3H5SA 4B3MF 1N32F 2BE2B 1TKTB 2KKHA 3BGUA 2DGTA 3M05A 1WSRA 2IMWP 1OMSA 2VFTA 4FDFA 2E5LJ 3NBPA 4IOBA 2RUGA 4MTPA 1TFWA 3TZYA 3DM2A 5ADZA 2BQ3A 2R9LA 2AYBA 2B6AA 2Z56B 3CO9A 1G6BA 4MFBA 1S49A 1VQ6S 1OYEA 3JTOA 1VRTB 3BSAA 2E1MC 2ZDOA 2AZ3A 2O67A 4IH7A 2ZH3A 4X64F 1NKCA 4NA1A 3BEGB 1F5AA 2UUWA 3VGUA 2GIQA 4NLXA 1Q5YA 3MEDA 4RUHA 2KM8C 4KQZA 1H2VZ 1I1GA 4URSA 3P45B 2POKA 5AJ3F 5J1PA 1YWXA 3B54A 2HZVA 4K4UA 3PYFA 5DZ7A 2MKJA 1NU4A 1UZHA 1JLEB 2LQ9A 4UOHA 1WI8A 2B9WA 2CZ4A 2CNLB 1PYOB 4IO9Q 3DU6A 4DPXA 3DGPA 2HVEA 3EZOA 4KGVB 4QQBA 3K5PA 5D0RA 3ICLA 2R2TA 4PG5A 3OL8A 1K8AT 4GKKJ 2OMOA 2JHEA 1N0VC 1FXRA 4OI1A 1LEOA 4N5SA 2V4JB 5I42A 3CJ8A 1FERA 2C22A 1C4CA 1VC6A 4UZCA 1GX6A 4JI3F 3CWJA 1M1GA 4DDFA 1RTIB 2OELA 1EIYB 4CLYA 2GJ2A 5C25A 3KUGA 3CCWA 4XIUA 3TX8A 4HI2A 3A8KA 2QSFA 2RQ4A 5DG8A 3L3CA 2HYIB 3SDEA 3J81Y 5I3UB 2N4CA 3H4BA 3DRSA 1GT8A 3KK3B 3FJ2A 4Y6IA 3H2LA 4GRSA 1FRXA 4LIRA 4CDIA 2CJBA 2K2PA 4M5LA 3D3CJ 4R0EA 5A8RB 4Z7CA 1OWXA 2ZKTA 4DUZJ 4PG4A 2KXFA 2MQNA 2EC2A 1VRQC 4OLPA 2LMIA 3IS9B 4LR9A 1REVB 4YR3A 1TMJA 2OFGX 2GHWA 2QYCA 2CJXB 1SV5B 3HSGA 4QW9A 9RUBA 2HNZA 4LIWA 1KQGB 3JSBA 2DR9A 4N47A 4V19J 3TO8A 1TFYA 4DWIA 2RF2B 5J1NA 2KG0A 3F44A 2JLGA 2DNHA 4DQQA 2A18A 1U1KA 1TMMA 4TXSA 3VHQA 4QYZJ 1SQFA 3HD2A 2XMWA 2HRXA 2M5YA 4OYIA 3LF0A 3EMTA 1YIJS 1Z4UA 3M1VB 4CLZA 3KNGA 1IWGA 2EG1A 1FF2A 1R31A 2RSQA 4ZS6A 4WP3A 4KGZB 1UCNA 2JH3A 1T05B 1RWWB 3KHLA 2RKIA 1N52B 1D9FA 3PKYA 2NPIA 3M8PB 4UOCA 2ZD1B 8RUCA 1M1HA 1D8ZA 1T95A 1YX2A 2E5IA 4F04B 1RT2B 4NI2A 2VFVA 3QWUA 2UVUA 4IG3B 3BO2A 2E5JA 5H9EK 1BQXA 4D3HA 3TZWA 5A2QU 3I4PA 1GTEA 4PWDB 1HR0J 1VR6A 4ECYA 3M8WA 3HHLB 5CAAA 2W25A 2KRRA 2FHMA 5A6PA 4F0HA 1DTQB 2PMWA 3ZTSA 3OQ2A 2G2OA 2BBEA 1RTJA 2VG7B 4JI1F 1G4CA 3A1YG 1OSCA 3LUYA 4LR7A 2PO4A 4F25A 2YNIA 4ILMA 2R7UA 1LW2A 1N5YB 1DTTB 1ZA1B 3ZFVA 4LQ3A 4F4WA 1H7WA 3OTOJ 1YLXA 3J7ZT 1ELOA 4USMA 2ZHOA 2JC0A 4C8LA 4NLYA 4I68A 2LFVA 4NCAA 3PW7A 3MCOA 4B9VA 4QOTA 2ZH2A 4ELTA 2C2RA 3W5ZA 4DJBA 3U1NA 4F8RA 4DV3F 3V81A 2V50A 4O4RA 5K20B 2I8EA 4U67Q 4YR0A 2OUGA 3PCOB 3PO4A 2GVDA 4D3GA 2LKZA 1S6QA 3J80Y 4KAIA 5E3RA 2P6TA 5GAHU 4F4XA 3ENQA 3K5MA 3NMAA 4RW9A 4WKYA 2DXEA 4LFAF 4ES1A 2AJ2A 4O44A 3KLVA 3WIVA 3I96A 4RZRA 4ECRA 2BE2A 1TKTA 1QUVA 3SCKE 1B64A 4JI6J 4HHHA 3OHAA 5LJ5Y 3EXCX 3DRRA 4NXMJ 1U1PA 2YQ1A 2DR6A 1QY7A 3V5RA 3ILOA 3MGJA 1MMNA 2VG5B 1FRJA 5AE1A 5JMNA 3KLFB 5IV4A 3CCLS 4Q2LA 4PUOA 3E01B 3NWRA 5KFMA 1VQSA 3N6MA 5F8MA 2ZFHA 3CMAS 1T7PA 1VRTA 1I94J 2GIFA 2UXCF 2IRXA 4KV8B 3UE2A 3D9BA 2KVIA 3NMRA 2BANA 2ILYA 3DDKA 2JEFA 1XR5A 1YKWA 1RAGB 2J6SA 2D41A 2CJKA 4JI0J 2QL7B 1NK6A 4DR1J 1UAWA 2DNKA 2V4RA 1BY9A 4M5IA 4F3MA 1TK5A 4Y2AA 3RBZA 1ZAXA 2FZGB 1Q8LA 1S9EA 4HH1A 2DCLA 2V2ZA 3UCGA 1JLEA 3DFEA 5GMEA 2CFXA 4URGA 2FY1A 2FVPA 2BR0A 3MEKA 4IH5A 2MKHA 3HM9A 4N76A 3SZ2A 4IDKB 2VQFF 2D9PA 1X4GA 3AY0A 4X62J 1WKLA 2DHGA 2E1AA 2IYIA 1WI6A 1TL1B 1I6JA 1EETB 3CCMS 2AGOA 1S1WB 4G3IA 3ZNUA 2L9DA 3CD5A 1RTIA 1VLYA 1WF1A 1Q7YT 1YGYA 2CPDA 3F0NA 2QTWA 1ZH5A 4ANDA 2QE5A 2Y9HA 4M5GA 3CC7S 4ZJQA 1TR0A 1UKUA 5L1JA 3TW0A 1R8HA 1S0MA 3Q8YA 2N3LA 2P9GA 3Q8PB 4USIA 2VA2A 1J2VA 4JV1A 2IM2A 4JI7J 4OI2A 2PA3A 3KK3A 1HHQA 4F50A 3NCPA 1N54B 5L1IA 2WBMA 5HQMA 4IFVA 5KFNA 4CO1A 2WAQD 1S57A 4C8YA 1IKXB 3LWLA 2ASYA 5AE3A 2MJUA 1SC3B 2CQIA 4UUXA 3H90A 4FYVB 2VIHA 5A8RA 3G9CA 3AJ1A 4CO5A 1Y3JA 1VQMS 1MSWD 2V63A 3EM1A 3T1HJ 1IBKJ 1QDUB 5DQHA 4LFCJ 2AYMA 2ZOMA 1N5TA 3IS9A 1RCXB 1QAIA 4CM2A 3M6XA 2D3UA 1REVA 3BR8A 2CPZA 4KSEB 2ABYA 1SV5A 4F4YA 4KIAA 4CO3A 2RHSB 4DLEA 2B8PA 3QMQA 5F9LA 3ULHA 3BH6B 3DOKB 2XY7A 1RAEB 1TKZA 3MMJA 4LF2A 3PVXA 4EK2A 1A0OB 2R4FA 2HHQA 2NUHA 2MMYA 3PNIA 3V2UC 2EEYA 3I32A 3IGVA 5K9FA 2XSJA 4ED2A 3K5NA 4DFKA 4LF4J 4TYAA 4EZ6A 1GEHA 1R6YA 1EQMA 4DPUA 1Q8KA 3SSQA 3T6BA 4QU6A 1PKUA 3N9UC 1KONA 2F9DA 4ZKAA 2KM8B 3HVWA 4B3OB 2V4QA 1TKXB 3IWXA 2QFJA 1T05A 4B08A 1IKVB 3EICA 1NRKA 3M8PA 4O4GA 3M8RA 2C3OA 4OLOA 4MH8A 4AQYJ 3GSIA 1RT2A 2FZKB 2KYZA 2QN6B 2QA4S 2OPPB 1XTZA 4MKAA 4L73A 4WIQA 1XNRJ 1M5OC 4ZP9A 4A8QA 1U45A 4HHUA 3QO9A 4EO8A 2UUAF 1A9NB 4YS2A 1M5PC 1B3TA 3VGVA 2DYAA 3PM9A 1RAOA 2AYGA 3ZTQA 3N01A 3HKWA 4K4SA 3RB6A 2CQ3A 4M8LA 1FE0A 5A8KA 1S1UB 1S6OA 2VG7A 1V5IB 3RAMA 5B0DA 2HNDB 5C24A 1NAQA 4L74A 4ZIWA 1BWVA 1U49A 5J2QB 2C42A 4ILLA 1FJEB 5JJBA 3TVKA 2VHGA 2BM0A 5IWAJ 5HO4A 3JSYA 3NG8A 1DBDA 4QR1A 1ZTWA 3SV4A 5SUHA 1RWMB 2ERRA 1JK9B 2I1RA 3GR1A 2HHHJ 1HL6A 3PACA 3RTVA 2HFNA 2ZJPQ 3KDOA 1VOMA 2CYYA 2FJBB 3R8YA 5GVQA 3OL6A 1SL0A 3ADAC 1N5VA 1D3WA 1KQSR 3DHWC 2FGCA 2F5GA 4LRCA 1T9XA 4OI4A 1FDBA 2JEIA 1K1SA 1FRMA 3R6GB 3D2WA 1TUVA 1T3OA 1TK0A 3CC4S 3UNYA 2JOQA 2ATLA 1EJ7L 1LWFA 2ASDA 5DM7Q 2HAIA 3AHPA 1FXDA 1XMQF 3WZ0A 4QWAA 2YKPA 3K5OA 1CSJA 3QT7A 4ED0A 5KG2A 1J5OA 3RW6A 1F0XA 1HA1A 3EX7B 4ICLA 6FDRA 5F8GA 2C1EB 2VFRA 4WFXA 2DR5A 1KVJA 4QPXA 3B8HA 5L9NA 2DHSA 1B99A 4USUA 2X1AA 1H7XA 4OYMA 3OXGA 3LTOA 4YY3J 1SB6A 3E01A 1P8GA 3MPWA 2HFUA 1IBCB 3MM7A 2DD8S 2K1RA 2VDIA 2DRDA 2FHKA 3J7A1 1GXLA 2OEMA 4WTYA 3PYEA 4NLWA 1L3UA 2R7XA 2VOPA 2QLXA 4ZN3A 3PW2A 4DL3A 4DR4F 2F65A 3PHEA 1VQ7S 4TY8B 3TAMA 3NGKA 2DNMA 1EP4A 3OVBA 2UP1A 3AD7C 3OTBA 2BJ9A 3HI9A 4ZVOB 3IN5A 4OHYA 2JVRA 1HNWJ 2R2RA 5KG1A 1Y4ZB 1KWMA 3VAHA 4JI2F 5CZXA 2G1HA 1HARA 4F3QA 3BO4A 1X4AA 4CLUA 3GPAA 4NA3A 1YVFA 1QD1A 1HQEA 1X4EA 5KFCA 2F1FA 3T5HA 3M30B 1TL1A 2FJEB 2YKMB 3C6UB 1S10A 3QQCD 4ATNA 5E2QA 5LJ3Y 3DOLB 5E5NA 3S01A 3MR3A 1VYAA 3JTPA 4FKYA 5F8NA 5LL6d 4I2QB 3FCVA 4GKJJ 4ZVTB 1JLBB 2PFFB 1VJWA 4KPCA 3BN4A 4Y3CA 1M5VC 2BRLA 3PIOQ 5HVHA 2LU1A 2EFNA 2WONB 2J6TA 5D0GA 2MQOA 4B3MJ 1N32J 2BKNA 4N8NA 3MM8A 4NLRA 3VAKA 4USJC 2HFOA 3EGNA 2AF6A 3QT8A 1T9YA 2YQ3A 4DLGA 2GGPA 3CCZA 3GMGA 3QT5A 2AP6A 3T5KA 1FT8A 2E9TA 1YITS 2YKQA 2BW7A 1WELA 4CO2A 2F4FA 3UPFA 2FIUA 5HATA 1XEZA 3L7UA 3VCDA 1S4EA 3HVTB 2XTJP 4X64J 1VBXA 1Q53A 3DOKA 1F5CA 1UPMB 4KRWA 5G0RB 5HP1B 3C16A 1RT7A 1U6FA 1VRUB 3MECB 2ZHBA 1IR0A 4DR6F 1FVQA 3VQTA 2LQJA 2IIHA 2D9OA 2LA6A 5AJ3J 1HD1A 4M63A 1FCAA 1NUEA 3CO0P 3CJ0A 1SL1A 2GC8A 4C3KA 2E1CA 2DITA 3H7HB 3KDNA 1FVSA 1HQ2A 3AB4B 4N56A 3PW5A 4PABA 3IGNA 1SQEA 4A8OA 3Q8RB 4B3OA 2DNLA 1WC6A 3MM6B 2YWKA 1TKXA 3OBIA 1DJ0A 4OL8A 3Q89A 4NMXA 1JLFA 4U8YA 3C6TA 1GH8A 2WHOA 1OS5A 4DR7F 3AJ2A 3ZC4A 1RT5A 4ZCLA 2EW9A 3MM9B 2BMBA 1SPBP 3P6YC 1UFKA 3WHIA 2YNHA 2OPPA 2LXFA 3C8YA 2OSRA 3H98A 3QGPA 2CPEA 2HNYA 5CYMA 3OFFA 5KFUA 2ZE2B 1NB7A 3E8OA 4CLLA 2KN4A 4F2RA 1P9QC 3HPOA 1Y5NB 1S1UA 2LU2A 2EFPA 3DXSX 5KFIA 5KFGA 4LSLA 3DKDA 5KG0A 3QRQA 2JFDA 1RTDB 3W7BA 2OEJA 3KJVB 3AODA 3GG1A 4ZLPA 4B9SA 3DI6B 1AXQA 3NP5A 3D54A 2O01C 2C3MA 1FWKA 5KT6A 2W9BB 2MKKA 2G0JA 3GSDA 3FBFA 4DL5A 1MU2B 5DLGA 2VG6B 2NSBA 2HHWA 5ETMA 1RP5A 2HQGA 1NK9A 3TEGA 4WK3A 5THWA 4UQTA 2XYGB 2FHJD 3AAWB 2XHCA 4XAKA 1NHKL 2LP4A 2EXUA 1KC8T 4I2PB 4LRFA 4ED5A 1R7IA 1Y5IB 4RNMA 2IA6A 4ID5B 4OJGA 1RA6A 4CT8A 1RHQB 2W4DA 4F4ZA 4LRBA 1RB0A 4UTGA 1KOOA 1PJ5A 3QLHB 3IBWA 2UV8G 4K4XA 2AEFA 3NOGA 1DARA 1UW9A 1FKPB 2AX1A 4C0OC 4LF1A 1JMTA 1NB2A 4FPIA 2FTRA 1IM6A 4LRDA 4FBUA 2KYXA 2X7IA 5D77A 1TVRA 2JEJA 4DCPB 4EO6A 4ZITA 4FF3A 2IM0A 3RB4A 4AL7A 4OJ1A 2WSFC 2PI5A 4OI3A 4WU2A 1FKAF 1N8RT 2RU3A 1KTQA 4DFPA 3DLKB 5GAGU 2HS3A 1Q8IA 1BQNA 4DPWA 1TUGB 1FJCA 3MMAA 2WB4A 3RW7A 1CEZA 5HMZA 2DNNA 3UR0A 1H6KX 2V9KA 3HD1A 1WWHA 4TN2A 3JQKA 1GXUA 1S1VA 4J9UE 2XGQA 2FJVA 4QJVA 1LV5A 1LWEB 2IAJB 1SQGA 4JI1J 4RBVA 4JBCA 1UW4A 4YOEA 1JXLA 5DGAA 2B3TB 5B0FA 3HHLD 3NOCA 2EBEA 3MAAA 5FLXY 1VBYA 2MKSA 3MURP 1VISA 4Q7AA 4PYDA 2RS2A 3PR4A 1DY3A 4A8WA 3H5XA 1NO8A 1QSLA 1NSQA 4RW4A 3M30A 1U25A 4YB1P 4OZ2A 2YKMA 1LW0A 3C6UA 4DV3J 1C1CB 2C2MB 4Y34A 2XMVA 5DQGA 1VHFA 3MWBA 2HK3A 4NWBA 3MR5A 2WK4A 1GMWA 4IR1A 3G6ES 5J2NA 1V3RA 3QIDA 1RLCL 1QTMA 3N5FA 3ENAA 4GVBB 3TVZA 4Y0FA 2HGLA 1JLBA 4RU9A 2VB6A 3Q2TC 1Z2ZA 4CRJA 5HANA 3G8SA 2W4PA 5F3TA 3J81j 4C7QA 2WONA 3NGSA 5DDPC 2JJ4D 1F6TA 1IBLF 4LFAJ 1XC9A 1BQMB 4ZPDA 3C2PA 5K14B 4QZVB 2ZH4A 3SIPB 5LT5A 2GQCA 5KFAA 3M32B 4DSJA 3LGHA 4RW7A 1RXOB 1XBWA 4OHXA 2YWGA 4KH1B 1JKHA 3U7JA 4IOAQ 1NKEA 5DG7A 1KP6A 1KBRA 4K7QA 1VCTA 2J9EA 2F9JA 2ZZTA 3BKTA 1TKDA 2NS1B 2UXCJ 3HLUA 1U47A 1VGYA 2KHCA 2OPQB 3PRVA 4JV0A 3BJYA 2RQCA 3NNCA 1JXEA 3PYGA 4J91A 4ZLJA 1NMEB 2CADA 1DZ5A 2YTCA 3QAUA 5HP1A 1VRUA 2DPJA 3OTDA 5M2PA 2J0XA 4OJ3A 4A8SA 2YNGA 2R8IA 4HHJA 4CNYA 2JL9A 4ZP6A 3GCXP 5KT2A 5L39A 4IUFA 2D3O1 5CYQB 4CLSA 2YY3A 2VJUA 4CCHA 3M8ZA 3UCUP 3MM6A 4PXCA 1SJ3P 4K4ZA 2VQFJ 3P96A 2HHVA 4BC7A 5CCLA 2OPSB 5KFQA 4ELUA 3ILJA 3DDIA 3A3OB 1RABB 2NXUA 4V19X 4RPFA 1C0TB 3G82A 1BC6A 1Y9OA 4ECQA 2A2DA 2R7SA 1XN9A 1B4SA 3DLBA 2LDYA 4QBUA 2C2ZB 3EVMA 2ZE2A 1Q4RA 3MDFA 1N88A 4RJVA 4E0DA 4PWUA 2CWXA 1H38A 2HFSA 3H5YA 1LXJA 1FTRA 1UJ5A 3V6KA 2VPYB 1WF2A 3CJKA 2L9NA 3QSYB 1MG7A 4DG1B 1LXNA 4DSLA 4J9PA 2BKOA 3UVJA 4K4VA 4GC7A 2UUTA 1A6LA 5J1EA 1G1XA 3DRYA 1TL4A 3TNVA 2P5VA 3GV8B 1KD1T 3KHGA 2RAQA 4OX6A 5DS7A 4ELVA 2X1FA 1MU2A 4ZCMA 2VG6A 1ZZNA 3GYXB 2CQ1A 2MY7A 5CCMA 5MAOA 1T8EA 3MPVA 3IAS9 2BKPA 1IM4A 5BYRA 1NK0A 3SI8A 2FPHX 4AXJA 4FXVA 3MM5B 3K58A 4I2PA 3D3BJ 3CDWA 4ID5A 2OMLA 3U02A 2JZ5A 1X4FA 3O44A 4HDGA 3HT3A 4YEAA 3V6JA 4RR5A 4C8KA 2F4VF 3K5LA 2UU9F 4OFZA 1SBRA 2IVYA 2PT0A 2R2SA 3FMWA 1F9EB 1NK8A 3KLGB 2NYIA 1TL3B 2ASLA 2JSXA 4LF7F 2EC0A 3DRXA 1W26A 3P4UB 4CM0A 1FKPA 1Q0NA 2VKZG 4Q0BA 2IPOB 3QAEA 2GS5A 3G6VA 4DUYF 3Q22A 3BZQA 3WC2A 4TU9A 1M0SA 4U95A 2LEBA 3CPWR 2R7RA 1NCLA 4DFMA 1IXKA 3G8TA 1YJRA 1DQ9A 3T5LA 3KLHB 1SCJB 2LVWA 3O6QA 2N82B 3E2EA 3DRPB 2Z57B 2BV3A 2DXDA 1CJUB 2XNRA 1NBEB 2RMLA 4JV5F 4ILRA 5EN1A 2DO8A 3R2DJ 2AJ0A 4ZPVR 3ILLA 2XYPB 5E33A 4OZ5A 3PTWA 7AT1B 5KG3A 3NY0A 3H40A 1VQ8S 4ED1A 4BHQA 3UO0A 2DGXA 3TAQA 5C42A 4ZCKA 4Q45A 3NWGA 3CXCR 2E7WA 5K8PA 2XO7A 5GMDA 2UUAJ 1FXLA 4M5HA 1S4FA 4MAKA 3W5YA 4KH0B 4L72B 4KGXB 3M2RB 2IAJA 2R7OA 3M9MB 1WORA 4QPTA 4WFZA 1V3ZA 1TK8A 3QRRA 1WG4A 1HWLA 2APOA 4P7VA 4MYTA 2BJEA 1AT1B 4W4MA 3DLHA 3R5DA 3EUNA 4NOHA 3T9NA 2K8GA 1KTVA 3CDUA 2O5DA 2VU5A 2XZWA 3VAIA 3OFHA 4M5MA 2C2OB 3BS9A 1RT6A 3D68A 4LJMA 3T1AA 1C1CA 3KWMA 3PX6A 3TR5A 1WHYA 1GFWB 3CIZA 3NKYA 3BQ1A 1R27B 2V8DA 2WZ1A 4ZP8A 3OW2R 4GVBA 4B3RF 1OO0B 1ULRA 1RHMB 2VC1A 3M6UA 4Z7YA 4PG6A 3TJAA 2Y1IA 1DLOB 1Q8BA 5D4NA 3AQOA 2HWHA 2X1GA 1UWAA 1XMQJ 2FVQA 2MQQA 2OD6A 1BQMA 4CTAB 2C2EA 4NLPA 5K14A 4JB8B 3I0RB 1RWOB 2IVFB 2MDAA 1OPZA 3DGVA 2DGOA 3O3LA 4P2FA 3M32A 1O5JA 3HCXA 3KK2A 4WK1A 1SVDA 1FE4A 4KFBA 2YPYA 1YJWS 3D0IE 2DY9A 3C14A 3R2CJ 1U24A 3P49B 2XI2A 2WVDA 1HKAA 1R8AA 2HMIB 1IKWB 2Z58B 2M4MA 3UDLA 1WACA 3GIRA 4TKTA 3FZ2A 2KXNB 3GWCA 2CQDA 1UZDA 3TA2A 3THPA 1PBUA 2MUIA 3QGHA 1K9MT 4DR4J 4QIEA 4O3NA 1BLUA 4A47A 4O3PA 3TI0A 2VODA 4WTOB 2FVCA 2H51B 4WXWA 4NLQA 1R0CB 5ETTA 2ZWOA 3GZ7A 2Z4PA 4O3OA 2MGZA 2A1BA 4C8ZA 4O3RA 3W1YC 4X84A 2HHPA 5IT9U 1VIXA 2ROEA 5CYQA 3NLCA 1XR7A 1VQ9S 2WSCC 2VV5A 2AEJA 4JI2J 3SFUA 3SQGB 4DBQA 1YJUA 3IWNC 3K7RA 1Q7LB 2OPSA 4ZPWR 2WVFA 4CO0A 4PPDA 1M1KT 2E5GA 2XHWA 5IT4A 3A8EA 3DDNA 1FHTA 3WBZA 1FKOB 4G6VB 3BREA 4JYAF 1CS4A 3H0PA 5KFRA 2VQEF 4NMLA 1NXIA 4C11B 2DVIA 4DN0A 3KLIA 1T03A 3W2WA 4NA2A 2PC6A 2CXEA 5K8NA 3OVAA 1KNZA 2C2NA 4DG1A 5LMUF 3GTYX 1PSDA 1GMWD 5C7PA 3MD3A 1YBAA 3FFIA 3FMBA 3AJDA 5IQQA 3T5JA 2HVZA 1KEKA 1QAYA 2ZUGA 1RT4B 1AW0A 1HNIB 3I87A 3GYNA 2H4YB 1RHRB 4DV6F 4PYAA 2IFXA 3H2VE 2L3MA 2KRBA 5KG6A 3OL7A 4TLQA 4HH0A 2HRTA 3FBBA 1NLKL 5DO2A 1FNOA 2IC3A 2J9DA 3TUPA 1T9WA 4DX8H 2QMUB 4DL2A 2C3YA 5M2RA 3CMQA 4R5PB 2XEXA 1TL3A 1CQNA 2B0GA 1HYSA 4ZVPB 3KG1A 2GZOA 4DR6J 3KOAA 2OFHX 3CD0A 3KUEA 1U2CA 3RBEA 2BOAA 2VL1A 2DRBA 1ZM4A 4CP5A 2WB1D 1NNDA 4MKBA 4NCGA 5HBMA 4ED6A 3LAMA 2BJ3A 1TAQA 4USWA 1XIQA 4MKVA 4PG8A 5ETKA 4ZK7M 1UWBA 4A48A 3DRPA 3HSZA 2RT3A 1YI2S 1UJ6A 1ZYQA 3H8YA 5IXUA 3OTCA 1CG2A 2HG4A 3D6TB 3OSPA 4KJIA 3IR5B 3CF5Q 1TV6A 2B7BB 4OZ0A 2CPIA 4DR7J 4UW2A 3K59A 1K0TA 1LFPA 2FB0A 1I3OB 2V8GA 4N7TA 4DX5A 1CULB 1SI9A 1SJQA 5E3CA 5KG5A 1AZSB 5SZTA 2QIFA 3ZZ0A 3MFHA 4QWCA 3Q24A 4CYUA 3Q0AA 4OYAA 2J8AA 2HURA 4K5RA 2QLWA 2WTFA 5IC6B 2O1PA 4J9LA 3MMBB 2XC9A 4AD6A 4UQGA 1T3NA 3IR6B 2ZOFA 5GADU 4DZDA 4B3TF 1ZAVA 1HNXF 5F8IA 3MMCA 2XY5A 1RWUA 3K8VA 3K2YA 4MIWA 2H4WB 3LP1B 3I82A 1YBUA 3Q8SB 5FDLA 1SKWA 3T9ZA 3QSIA 4HTIA 3GJSB 1Q95G 2N7CA 3MEEA 2DR7A 2VH7A 4C3LA 4KR0B 5KOXA 2DO4A 1WTBA 3TAPA 2AT1B 2W01A 3BGRB 5ITHA 1RWXB 1FX2A 3PIPQ 4ZVUB 2DNZA 3FCWA 2B43A 5C2GA 2KZMA 3JSMB 4U8VA 2R7QA 1YSJA 4ZVEA 5HQ8A 4P7TA 3H42A 5B0BA 3CD7A 3FSYA 5M2UA 3W2VA 3JAMU 5A2QY 2KJWA 4FYYB 4I64A 2J0WA 2W2MP 5HROA 1AYEA 3CJ2A 1HBOA 3I5CA 1QVFR 2XMTA 3I0RA 3S1TA 1X5SA 2DRAA 2XMKA 4OMFG 3SEOA 4DX6A 3M6VA 1F3VA 2DNPA 3HF5A 3OR2A 1YRUA 1ZM3A 2MQLA 3UN5A 3NAIA 5CD4H 1S9FA 1SKRA 4QIWD 5D6GA 3BKUA 1HIYA 3AA9A 2J6UA 1RKIA 2YQ0A 1UA1A 2MLXA 5KFSA 4P6QA 1PBAA 2HBZB 4IG0B 3CTRA 3Q83A 2JVOA 2CA9A 4OX7A 3RR8A 2HKEA 3MXHP 2EFQA 1WTFA 2CUYA 1M5SA 3UN3A 4NZ0A 3A12A 3FRYA 4L76A 3HP6A 1IJFB 2DNRA 3G87A 1D09B 1YRXA 3NS6A 2WVCA 4M95A 4I6YA 2HBYB 3POTA 3J7YI 4B02A 2B5JB 3HHEA 2B7CB 1WC5A 4JI8F 2JEGA 1N5SA 2QZ8A 5JVHQ 2ZOGA 4RO0A 3SQGA 1IKYB 3DCAA 1FK9B 3HX9A 2MZTA 4XK8C 4DN9A 1F2HA 3LWMA 1FKOA 2R7TA 5EHHA 1D8YA 3LP2B 1YTYA 2NR0A 2G13A 2C28A 1IN0A 1EKRA 3S7RA 1KR4A 3KJNB 1SC6A 4C11A 3IG1A 3V4IA 1HW9A 2DJWA 2AJ4A 1D9DA 3L4BC 2XGPA 1QTNB 1WNEA 1V5VA 3KK1B 3NNAA 2N4DA 5F0UA 3B4DA 2PD1A 2ZITA 2KT5A 3KHRA 2V5HG 1CLFA 2W7AA 1IBLJ 1PO6A 3HULA 1TTHB 4ZLLA 5IM0A 2ZH1A 1CJVB 3K8WA 1DQ8A 4RW6B 5IT0A 5A0YB 3QRPA 3ZZPA 1HNIA 1NZAA 3DLGB 4YDXA 1MW7A 4ZPBA 1F2GA 5GAGI 3RJMB 4C2MA 2CG4A 2MKIA 4NYZA 3ELHA 2VOOA 4U6PA 2XLIA 4ZPCA 1ROFA 4EYHB 4DQSA 2X1BA 1S6PB 1VJQA 4BWMA 4EFAC 2KL8A 1EQ0A 4WE1B 2FLLA 2CKWA 1OIAA 2YBVA 2BXJA 2DIUA 3THVA 3MF5A 1J27A 2YWFA 2OAUA 4CO4A 4C8NA 4Q44A 2M8HA 4Q5VA 3CJ3A 5AXKA 3M2UB 3G4SS 3MAHA 3RYLA 1NJXA 2C2KB 4Y65A 1C0UB 2HVDA 2BQUA 4OHWA 2DGVA 1U8SA 1RA7A 5F8HA 3ENVA 2ADBA 5DDOC 4F2SA 5B0GA 2NPFA 4ZIVA 2RU9A 4QU7A 1ZBTA 5EWGA 4HT5A 4R8UA 2RRNA 5H9FK 3EXYA 6FD1A 1X4BA 4WJBA 2OPRA 1NK4A 3X3UA 3AB2B 5KFLA 2DO0A 4K50A 1VQNS 2A10A 2AIRB 4L75A 2W9CB 1NPPA 4RL1A 3CULA 4G1QB 1N6QB 3BGFA 1RQ0A 1DQAA 3K17A 1NDCA 2CVEA 1PC5A 2QSWA 3W8PA 2IJNA 1HHSA 4LSNB 2QA4G 4WZQA 3D4JA 1S1XB 1QAXA 2ZC3A 3RU0A 3VR1A 4X4UA 1U09A 1HWJA 1Q1KA 2QMWA 4F02A 1X0PA 2H5IB 4IFYA 1PJ7A 1GMUA 4HACB 1KFSA 3LP1A 3CSKA 3H20A 1S7HA 3GR0A 5HQLA 2M8DB 5T7LB 4ZVFA 4ED8A 1AFIA 4AT1B 3BQ0A 3HFZB 1AUDA 3CCTA 3DLEA 4LBPA 2N3OA 2M70A 3R27A 2HHTA 3KLEB 4ETXA 2EPIA 2O3DA 1L5UA 3W64A 3R7BB 4Y2KA 2W2QP 2HVHA 4CNZA 2KTQA 1X4DA 2ASJA 1F1BB 5HL7Q 3OFEA 3J7AN 3ISND 1QJHA 1Q82T 4I0WA 1KLMB 4F0KA 1W25A 2F4VJ 2KFYA 4EMDA 2UU9J 2BJDA 4MYUA 5KFWA 1NK5A 3R7NB 4DL4A 4DOZA 1S1TB 3FCHA 4OYZA 1HHTP 4LF7J 2XMUA 3P5TL 3GB0A 4H4MA 2EWHA 5B0EA 2MSSA 4NLVA 3HFKA 2V8VA 3CDBA 2GQQA 4DUYJ 4USVA 2B51A 4DF8A 2Q43A 2IJFA 3MUTP 2VBZA 1FD2A 5D4PA 4FYWB 4KY3A 3ENWA 1U26A 2OTLS 4NRUA 2B4UA 2X51A 1F3FA 4DV0F 2MKYA 3CUNA 2IBKA 3QZ7A 2MSTA 3D7SB 2HQ3A 4JV5J 2OI2A 3MHYA 3PXGa 1UTAA 1HBNB 4WBFA 1BUXA 3PW4A 1L3SA 4RWWA 2HBRB 2ZH8A 4DPOA 4PRFA 1B7YB 5HLFB 4N77A 5E3QA 4I7FB 4LREA 2J8SA 1NKBA 3FZBA 5J2PA 2NQPA 3FC9A 1SUQB 4ZN1A 4KE5A 4DFJA 4Y00A 1NH8A 1T9UA 3SBMA 4FBTA 3Q2SC 3RGIA 1RYSA 3NS5A 2ZHAA 1CQMA 5E3AA 4WCEQ 5EWFA 3PFOA 1GAOA 3BO3A 3FBCA 4ECVA 2PGCA 4OYWA 4BDPA 1IKYA 1NPKA 1FK9A 3TWZA 2BUNA 1YK9A 4M5KA 2OO4A 3AT1B 1RT3B 3MR7A 2CQCA 1VQOS 3W9JA 4TQSA 2GMHA 1QLNA 2JRSA 3OLAA 1BHNA 3K0JA 3FSIA 1RTZA 5BR8F 4ED3A 2BABA 1F9HA 4RBTA 1M5KC 4S0MA 2BDPA 1N33F 4IR9A 4FXDA 1MROB 1U48A 4ZCIA 1FWPA 4B3RJ 4RWXA 2I0XA 3U1LA 4LF9F 1RI7A 2XCAA 3PKMA 1R0AA 2W7PA 3CNQP 2LYVA 1QAJA 1YJVA 1VS3A 2VPXB 4WFYA 4KKOB 3SYZA 3US5A 1RACB 4ZJOA 2Y8YA 3HK2A 2M52A 2P2CB 4LBHA 1N5QA 4DQRA 2AD9A 5DGBA 2DNYA 2FD2A 2YNFB 4WKRA 3NGRA 1CJVA 4RW6A 1S76D 5EUHA 3WDOA 2H5JB 3PX4A 2IA0A 3DNCA 2U2FA 1PC4A 2OP5A 1T9TA 3UCZP 2CQ4A 4DQPA 2JFKA 3JYTB 4KBIA 3DMJB 4J9VA 3MAQA 5KFYA 3N28A 1N36F 4MK8A 4J37A 3W9HA 1PILA 3MCSA 3MD1A 3IM8A 4U96A 2RJZA 3W62A 1C1BB 1GNKA 2GQ2A 2ACYA 2WOMB 2ZJRQ 2MZRA 1ZETA 2NXCA 1RJJA 3MFIA 3KHHA 1WEZA 4JI4F 3M2UA 3SFGA 1SH0A 3UN2A 4HTJA 4KTQA 3R9LA 5GAEI 5D3GB 4ETZA 3I9ZA 4P2SA 3AOCA 4IQMA 1F60B 3W63A 3PZPA 1RWKB 1H2UX 4OX8A 4Y2CA 3BBFA 1HMVB 1RADB 4B9MA 2I38A 4A8XA 3QZ8A 2FVSA 1ZAWA 1FD8A 2DNGA 5EX3A 3DOMB 3IM9A 5DQIA 2V4JA 3JSRA 2NXJA 2MLYA 2J76E 3H2UB 4DX7A 2RRAA 2MZ1A 4JYAJ 3HKZD 4ANCA 4NLSA 5KFKA 4M1KA 2HFZA 4P72A 2VQEJ 3NBPB 3T6JA 3RUBL 4J5OA 5KT5A 3EPGA 2V9WA 2BJ8A 4KT0C 2D3OR 2D69A 1TU0B 5IQ6A 3VVUA 2R7WA 5I3UA 1DHMA 1HI8A 2R8JA 5LMUJ 4DR3F 1FDDA 1S1XA 2FDNA 5DZ6A 4ZVRB 2LLZA 4HR2A 3TJ9A 1S99A 2A3JA 2FHJA 2OD4A 3MEDB 4RW8B 5DJBA 4U7UK 1Q79A 2NLWA 3IWLA 3LP0B 3RAQA 2I2YA 2DXFA 3UDEA 2XBPA 5H1SV 3SCJE 4DV6J 3KLEA 3TVYA 1JLQB 1H72C 2HPUA 1HWUA 2YX4A 1L3KA 2RNEA 4RBUA 2W1BA 3PHTA 3NGTA 3D1QA 2ALZA 4RNHA 4YMEA 4IKAA 1YZ7A 3HHLC 1KLMA 4A8FA 1N56A 2W4CA 2RF2A 5H9EJ 1KRPA 4DR5F 4OYBA 2KB2A 3LA0A 4A8KA 2HQFA 4EU0A 2Q6CA 2VF3A 2H48B 2HHUA 3F41A 2LQ8A 3OJUA 2UVWA 5RUBA 5C25B 3M1VA 1RKJA 4DI6A 1VK8A 1X9SA 1KSPA 2HHSA 5LMNF 2F8MA 4L3KA 3ILIA 5ETNA 3W5XA 1G2EA 2GW8A 1RE1B 1MMLA 2FZCB 1AB8A 4NLGA 3DRSB 3HJFA 2PE8A 1B0PA 2ZD1A 1S5ZA 3OPKA 2UXBF 4USTA 1HBNA 2ZNYA 5B0AA 3W8GA 2XULA 3Q86A 4KB7A 1MN9A 2YXLA 4IG3A 4MIAA 2MZSA 1JB0C 4I7FA 4PWDA 3M2VB 1K44A 3HHLA 1R8CA 3I9V9 3IRWP 1DTQA 4P73A 3KTQA 3BYRA 2D1CA 1JWWA 1NHUA 1NJIT 2GNKA 1H74A 1U1MA 5A8WB 2IM3A 2A0FB 2HNZB 2BE9B 2QG9B 4M5DB 4B3TJ 1N5YA 2LCWA 1HNXJ 1DTTA 4P71A 2RRBA 3W65A 2KI2A 1IUJA 3R6LB 2X3GA 1FESA 1H3DA 1S77D 2XO6A 2RDIA 1OJ4A 1RT3A 4LT6A 3W9IA 4DV4F 4P2XA 3TARA 1R0BG 4F26A 2H5EA 4W98A 2FYXA 4Z37A 1I51B 3I56S 2W8KA 5A6WA 3UDVA 4J9NA 2R42A 2DT9A 2M0GB 3QJPA 3MUVP 1MROA 2XMJA 4CH0S 2BZ2A 3GFZA 3PV8A 4OZLA 1PGZA 2RKIB 5J2MB 2Z2ZA 5KFHA 3UDCA 1CPZA 1S59A 2MPUA 4DL0C 4JP8A 4M5JA 2QMXA 4KKOA 2G1DA 4ZPAA 3AXMA 4NI2B 4EZ9A 4WP8A 2XLKA 4IO1A 1LFWA 2AJFE 3FSXA 1FA0A 2HAFA 4C0HA 4A8YA 4CH7A 1TL7B 2YNFA 3THTA 2VG5A 4QYZK 1UMJA 3R5AA 3KLFA 4J9OA 1Y0HA 2MZQA 2PFDA 5CYJA 3RBXA 4UY85 3MTJA 2RIJA 5KT4A 1YBTA 2M88A 1DRZA 4X4NA 3DMJA 3PJXA 2HWTA 1U4BA 1RT1B 4KV8A 2FGOA 5AXLA 3ZZRA 4PPZA 2YNIB 3J7Z5 1LQ9A 1TP7A 1C1BA 2GVZB 2VFUA 4NXNF 1VI7A 1QVGR 2WOMA 4U9RA 5KG7A 2ACMA 1WKJA 3BPSP 3V81B 4J9RA 2B4OA 1ZS6A 1S97A 4YR2A 4QR2A 5D3GA 3UD3P 4LR8A 1UJ4A 3TQEA 2NCKL 5CABA 4DR2F 1X5OA 2GVDB 3A4TA 1S6QB 4LFBF 4Y2IA 4IDKA 4JI8J 1N4LA 3JXOA 3OSNA 4OV1A 2IY5B 1FO1A 2ZBQA 5CZVA 2HRUA 5U47A 2MHEA 1MNEA 2JX2A 4K4TA 4EEYA 4O44B 2DNOA 1Y5LB 2OTJS 1SH2A 2GA7A 1EETA 1O6XA 4ER8A 1S1WA 2QO3A 3BSCA 8AT1B 1N0UA 2ZBCA 3DRRB 4B3SF 4G1PA 2QL9B 2WBRA 2DGWA 4WP9A 1WF0A 1XR6A 2RQKA 2F7VA 3X1LB 2BA9A 5LM7E 1XNQF 2VA3A 1U2RA 4PUOB 2KU7A 2DB1A 3FEZA 3DU5A 3GV5B 2C2DA 2BM1A 1S48A 4OIXA 3AD8C 4J9MA 2PEBA 5CHCB 5IOLA 1EARA 3IP0A 4FPRA 5BYQA 2AJ1A 3VV2B 4NX9A 2BANB 3UW1A 2NXNA 1G7CB 2YKAA 3LPEA 5ETRA 4RW8A
chains in the Genus database with same CATH topology
2EW0A 2HRXA 2MUIA 2HAFA 2GS5A 2AJ2A 2GZOA 2DO8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EW0 A;  2HRX A;  2MUI A;  2HAF A;  2GS5 A;  2AJ2 A;  2GZO A;  2DO8 A; 
#chains in the Genus database with same CATH topology
 4DQI A;  1IKX A;  1EKS A;  4F67 A;  3LAL A;  2G2Z A;  5F9N A;  2MQP A;  5KFF A;  3LP0 A;  2UVV A;  3Q23 A;  2HQI A;  4NL5 A;  1S9E B;  5B08 A;  2W2O P;  4WXO A;  5ETL A;  2U1A A;  2W9A A;  1ZM2 A;  2GHV C;  4FNH A;  2V67 A;  1JLQ A;  4G1I A;  3RR7 A;  3DXB A;  4IRC A;  3E3X A;  1KHV A;  4DSE A;  2VC0 A;  1VBZ A;  2VJV A;  1O8B A;  4ECZ A;  4I69 A;  2BVZ A;  5DLF A;  1VQL S;  4WFB Q;  3PW0 A;  2DTJ A;  1NPR A;  3SXL A;  1HI1 A;  1NH7 A;  2XM3 A;  4P75 A;  5D0H A;  2PMZ D;  3HXM A;  2E5H A;  2OIH A;  4HEA 9;  1CJT B;  2IRY A;  1S7I A;  3S6E A;  3VGS A;  2HBQ B;  2FLO A;  3GII A;  3PJW A;  4Z2X A;  3RAX A;  2J5A A;  4ZLN A;  2GAG C;  3BYP A;  3W61 A;  4O0I A;  4WU3 A;  2V8H A;  2AGQ A;  1UP1 A;  5D8H B;  1IKV A;  2V69 A;  5FJ4 A;  4NE9 C;  4PXE A;  1LNQ A;  2KHD A;  3TEH B;  2UVR A;  4YN3 B;  4IFV B;  1RWN B;  4ES3 A;  4DV1 F;  2MQ8 A;  1FTC A;  2CRL A;  4B9T A;  3D1O A;  2AEM A;  4NLU A;  1FRI A;  2QJ3 A;  4IRK A;  2P8I A;  1FDN A;  3M2V A;  2BJ7 A;  1YJT A;  4WPA A;  1KVI A;  3D67 A;  4ZDN A;  1LKZ A;  2M2B A;  3H25 A;  2FC8 A;  2LA4 A;  2I5J B;  1Z2L A;  3G6Y A;  2V8P A;  2NSC A;  4CQ1 A;  5L8R C;  5HSP A;  3E51 A;  3BKF A;  2K3K A;  1FEE A;  1Y10 A;  2HND A;  2V68 A;  1TAU A;  5A8W A;  5KFP A;  5J2Q A;  4TVA B;  2BYC A;  2E7X A;  2HK2 A;  2YH1 A;  4M5D A;  2PMH A;  3B4M A;  1TKZ B;  2M3D A;  2NUU G;  2RDD A;  3CCQ S;  5F0W A;  3W60 A;  3C3L A;  4NEY A;  2XSJ B;  2MLZ A;  2CQP A;  1KQK A;  5HMY A;  1KOH A;  4ECU A;  4NLT A;  3SQO P;  2SXL A;  2AZ1 A;  2CDQ A;  3TP2 A;  2C3P A;  2Q3P A;  3O2I A;  2LEA A;  1CC7 A;  2J9D E;  2KH9 A;  4UOG A;  1D1U A;  3SCL E;  1U1O A;  2VUG A;  1BXN A;  1WD6 A;  5E41 A;  1KDN A;  1QSY A;  2HEK A;  1R89 A;  2PA8 D;  4IYQ A;  1R43 A;  4K2J A;  1VIO A;  5D78 A;  1S0O A;  3LW5 C;  3R5G A;  4YP3 A;  5J2M A;  1JJH A;  1B7F A;  4O4G B;  1IWA A;  5FD1 A;  5L1K A;  4F4K A;  1WC0 A;  3NCR A;  3AQP A;  3PG9 A;  2EKN A;  4JUZ A;  1FJ7 A;  4GVL A;  4WFN Q;  3GJQ B;  4X66 F;  5LSO A;  1VQP S;  1TL7 A;  3QO9 B;  1RDR A;  4RUA A;  4JI5 F;  1RZM A;  1UET A;  1S72 S;  2G9O A;  1HWK A;  1EAY C;  4HYK A;  5A8K B;  4QYR A;  2F63 A;  2G0I A;  3I6P A;  3Q8Q B;  1GK8 A;  4DV0 J;  4I4B A;  5C24 B;  4UY8 T;  1SJF A;  4N41 A;  1RT1 A;  3C66 A;  4LF5 F;  2A2C A;  1YDL A;  4EWT A;  2FLP A;  2GO9 A;  5I4M A;  3OUY B;  2GVZ A;  3FEX B;  2EFV A;  4CT9 A;  4N8O A;  2QRR A;  1UEK A;  3EDR B;  3G86 A;  4TY8 A;  1APS A;  3N79 A;  5IS2 A;  3JQJ A;  5ETO A;  3ZZY A;  2GCF A;  4ED7 A;  4WYL A;  3D5M A;  1NZ8 A;  3P3D A;  1F9F A;  5LSR A;  4C48 A;  2G2Y A;  3L7P A;  2CPJ A;  4PKD B;  4XPE A;  4NEZ A;  1LWF B;  4HKQ A;  1RLD A;  1HI0 P;  1IBM F;  2HIY A;  4A4J A;  3OHB A;  1BE4 A;  2CJQ A;  4TY9 A;  3CJ5 A;  4P2M A;  2CJ9 A;  3ZTO A;  4LVO P;  3FEY B;  1J5O B;  3QNW B;  1R6V A;  3TOQ A;  3M9N B;  4ICL B;  2VBW A;  3DOL A;  1FNX H;  3VWS A;  2LDI A;  4RNN A;  4NRT A;  2YX7 A;  1VFJ A;  1D9A A;  5BR8 J;  4ZA1 A;  4BCA A;  1V3S A;  4I2Q A;  5KFV A;  2R7V A;  4J9K A;  1N33 J;  3MM7 B;  4GMK A;  2K1R B;  4EBD A;  5L38 A;  2H9Z A;  2XS7 A;  4LF9 J;  2HIQ A;  4ED4 A;  4RUC A;  1U1Q A;  3PRD A;  4FYX B;  1PYT A;  4P52 A;  4PEO A;  1M5H A;  4X65 F;  5EGY A;  3Q8U A;  1HPZ B;  3ZTR A;  4MK7 A;  4OX9 F;  3MCM A;  2GJF A;  4BS2 A;  1K73 T;  4ZVH A;  3TAM B;  2KG1 A;  3CJ4 A;  4URQ U;  3EJM A;  1EP4 B;  5IT9 Y;  3ETM A;  1N34 F;  4NYP A;  4DPY A;  4AYB D;  1NJZ A;  3V4M A;  3FBE A;  1U0S A;  5LXY A;  2QT7 A;  3HVT A;  4LF8 F;  1N36 J;  3ISZ A;  3B82 A;  4DS5 A;  3GFX A;  3BGO P;  2DY1 A;  1WKK A;  3JS9 A;  2F3J A;  3KKF A;  3R7S B;  2Y8W A;  3VAF A;  2WVE A;  2XYH B;  5CXT A;  2DHX A;  2YWH A;  5G0R A;  1HQE B;  5T41 A;  1U7L A;  3MEC A;  3EVW A;  3PEJ A;  2MY8 A;  2KZZ A;  3GON A;  4FZV A;  2OJ3 A;  1K47 A;  4JI4 J;  4ECW A;  1NSK L;  1RHJ B;  4EI2 A;  3OFG A;  1CJT A;  2V94 A;  4KGM A;  2KFZ A;  4QCL A;  1SIW B;  4HL9 A;  3M8S A;  3OXL A;  2CNO B;  5L1L A;  3TA1 A;  1YJN S;  3BDE A;  1I5O B;  1WSV A;  2Z2L A;  3T41 A;  2R2U A;  2K7K A;  4J9S A;  1TEL A;  4BWJ A;  3OR1 B;  1TZ0 A;  2QFI A;  3T1Y F;  4USK A;  4AE5 A;  4I56 A;  3M7V A;  3EPI A;  3MM9 A;  4J90 A;  4BC9 A;  3MM8 B;  3I0S B;  2QGF B;  3UWT A;  2GGP B;  2IBO A;  4IH6 A;  2DEJ A;  4DMZ A;  4XTT A;  3RRH A;  1IR2 A;  1FFW B;  5GAH I;  3IA0 A;  2I5J A;  4E98 A;  1Q86 T;  5HVF A;  3MZI A;  2XS2 A;  3H59 A;  3OVS A;  1X0F A;  5GMK a;  1RTD A;  2EK1 A;  2VPZ B;  1HNV B;  3KJV A;  3DI6 A;  1FJG F;  4DR3 J;  5B7W A;  2UXD F;  4K59 A;  3FVY A;  3EZ5 A;  3KNA A;  3KG0 A;  2MYF A;  3J81 U;  2OLW A;  3CCS S;  1GQE A;  2W9B A;  3LO3 A;  4DV5 F;  3KJF B;  3O5T B;  1WOO A;  2RHQ B;  3HSJ A;  1OY6 A;  1IQZ A;  3GFH A;  4CLK A;  3GU0 A;  3C16 B;  2CVI A;  2H54 B;  1RT7 B;  2HSE B;  4FF1 A;  5CH7 B;  2BRK A;  3U27 A;  3HO1 A;  2VIC A;  1RHU B;  3KJQ B;  4XDC A;  3W3S A;  2VON A;  3MR6 A;  3PJ9 A;  1X60 A;  2JLE A;  3QFW A;  2V2K A;  2ADC A;  2R8G A;  1WJ9 A;  4ZHR B;  5HK4 A;  3F56 A;  2BEF A;  2GIR A;  2ZBI A;  1U1L A;  3FKB A;  4X2B A;  4X4V A;  4PCQ A;  1WEX A;  1JLF B;  4IOC Q;  3C6T B;  3QLH A;  3N6L A;  4B17 A;  1RAF B;  3P8B B;  3KMQ A;  1RT5 B;  4DR5 J;  4QWD A;  1M90 T;  2YNH B;  4PQU B;  2BX6 A;  3JQM A;  2B9E A;  5AT1 B;  2HNY B;  4I67 A;  5CYM B;  1RBO B;  2ZWP A;  1S9G B;  5D4L A;  1LK7 A;  4QWB A;  3O8W A;  5E0O A;  3VF0 B;  3FK4 A;  1UVN A;  3SSS A;  3OLB A;  3VGT A;  4QW8 A;  1UVM A;  1HNZ F;  2CQH A;  4EYI B;  3QFH A;  2VAS A;  2F40 A;  4LSL B;  5LMN J;  1MMD A;  2V34 A;  2OHD A;  2CWK A;  4TNO A;  1OSD A;  3DLK A;  2IDE A;  5HN0 A;  1MN7 A;  2VBY A;  1KN6 A;  2UXB J;  2DIS A;  2B4P A;  1KKH A;  5DDR C;  3L9Z A;  3G71 S;  3OUY A;  2VDH A;  1IVZ A;  2XCP A;  1RSC A;  3FQK A;  4K8R A;  3S8S A;  2DGQ A;  4C98 A;  3RG6 A;  2EKY A;  3M6W A;  3PFE A;  2V2Q A;  3TUJ C;  3ZTP A;  3KMS A;  2GAH C;  3G8Q A;  3VQS A;  2DGS A;  1URN A;  5HJX A;  4U7C A;  3CDE A;  2EVZ A;  2H3E B;  1RTH B;  4CLP A;  1LWE A;  2XG8 A;  1P1L A;  2MQM A;  4DF4 A;  2W8L A;  2Y1L B;  5DDQ C;  4UF4 A;  4ALZ A;  4LSZ B;  3DLJ A;  3LH2 S;  3JAM Y;  1YRT A;  1T11 A;  2LEP A;  3TZZ A;  3CJR A;  3I4H X;  2ZVS A;  3TUZ C;  4IQX A;  1SIZ A;  4WYW A;  4E2F B;  2UUC F;  3HMJ G;  1UVI A;  1PIE A;  3NGU A;  3CCV S;  2HHX A;  2QX0 A;  3NRB A;  2A6M A;  1X4H A;  4DV4 J;  2AQ4 A;  4FXW A;  1H2T Z;  5CA5 A;  4OHV A;  4FKX A;  2L9W A;  3N4W A;  1TVR B;  3WX8 A;  4OYX A;  3MEG B;  2MEW A;  1VC5 A;  3ITH B;  1B0V A;  1VQY A;  3C46 A;  1IR1 A;  4HVZ A;  4F36 A;  1V9O A;  3QGI A;  1AFJ A;  3OXF A;  4F0M A;  3DC2 A;  1HFE L;  1JNR B;  5ETP A;  2AJQ A;  2F8E X;  2HGM A;  5D0E A;  2BW2 A;  4XO0 A;  4U7U D;  2Q6B A;  3J80 U;  1BQN B;  2HQC A;  2QLJ B;  3CVK A;  3MMA B;  4R25 A;  2ZH6 A;  3GP9 A;  1HPZ A;  2ZBR A;  2ZM6 F;  2VD3 A;  3FNN A;  2FHO B;  1WHW A;  2NZ4 A;  1OY8 A;  3QGG A;  2KT2 A;  2BQR A;  1S1V B;  3ZZO A;  2CPF A;  4C6A A;  2IVM A;  4GC6 A;  4LMZ A;  4CLT A;  4ZMM A;  3VTI A;  3EGZ A;  3EYZ A;  5F41 A;  3SV3 A;  3QPI A;  1UA0 A;  2GFF A;  3EDQ B;  3ET6 B;  1D0E A;  5KTQ A;  2OPQ A;  2YVS A;  3NGD A;  5HMW A;  3MAA B;  1JQG A;  3IO1 A;  1MWY A;  5HVG A;  1B0T A;  1N48 A;  4NXN J;  4R0J A;  3A3P B;  4WII A;  1S0N A;  3LGN A;  5IC4 B;  2EK6 A;  4RW4 B;  3GLJ A;  3FUY A;  1LW0 B;  1ZPV A;  3CGI A;  2CZV C;  4OI6 A;  1O51 A;  2B9Y A;  3EGW B;  2BAC A;  3W66 A;  3FGV A;  1JXV A;  3N0V A;  2CQG A;  5J2N B;  4DR2 J;  1RAA B;  2DIV A;  4XDD A;  3MPD A;  4LFB J;  4C9D A;  4H4O B;  4DS4 A;  7FD1 A;  4RKU C;  1J5E F;  4FF4 A;  2WVB A;  3ISN C;  1VQ5 S;  3OR1 A;  2AHO B;  1T94 A;  1FRH A;  4Y2M A;  3D0G E;  2Z8Q A;  2OH2 A;  1SJR A;  1C0T A;  1KHW A;  4CZC A;  1KVK A;  2NYH A;  2VZ9 A;  2UUB F;  3PEH A;  2KXH A;  3GJR B;  3I0S A;  1VC0 A;  1RWV B;  5T14 A;  3PR5 B;  4KHM A;  2NXE A;  4ID8 A;  4B3S J;  1DFD A;  1NSA A;  3UNG C;  3VAL A;  1RAI B;  4DL6 A;  4RW7 B;  3WIU A;  4DV2 F;  3R97 A;  2G0C A;  1XNQ J;  2EBG A;  1KFD A;  3EGV A;  1ARO P;  1JKH B;  2DGU A;  4M94 A;  2W7O A;  2ZDP A;  2V2V A;  3D6F B;  1RGV A;  2ZZN A;  1HNV A;  2AWZ A;  2W24 A;  3SSR A;  1UVJ A;  5D4O A;  3UQS A;  5ETQ A;  1SJ4 P;  4OZ3 A;  1SJ1 A;  4F3O A;  2IHR 1;  3HZE A;  4I1T A;  2YWE A;  1RCO B;  4ENO A;  3CME S;  2M7S A;  2YNG B;  2AU0 A;  4ZOS A;  3R1H A;  5ETV A;  3R5J B;  2GX8 A;  1T0T V;  3GIJ A;  3MM5 A;  2BOP A;  3LAK A;  4OZN A;  2ZKU A;  3HDS A;  4ES2 A;  5AXN A;  2R3V A;  2GS8 A;  5JVG Q;  4ZHR A;  1JLC B;  3BPD A;  4C8M A;  2OKQ A;  3TQ1 A;  3GIM A;  1XMO F;  2HVI A;  3IXQ A;  2CIM A;  2AYE A;  2ZH7 A;  3KLG A;  5JUM A;  3V6H A;  3G82 B;  4PQU A;  2LEC A;  5KFZ A;  4DXL A;  1RIS A;  4K0K F;  3OTE A;  4JI3 J;  4IRD A;  2J9C A;  1S6U A;  2PDA A;  1W2B R;  3ONQ A;  1S9G A;  1WUU A;  4YHH F;  2Q66 A;  2HLT A;  3EZU A;  3KLH A;  3BB5 A;  1S12 A;  3G6X A;  4NZ7 A;  2KFN A;  2ZBP A;  3AH6 A;  3CJK B;  5C5J A;  1CJU A;  1PCA A;  2CJA A;  4AL6 A;  4OZJ A;  3QBC A;  1FRK A;  1YJ9 S;  1RHK B;  3UVJ B;  3J7Y U;  3AD9 C;  3M8Y A;  3LGM A;  1OQ6 A;  2RB7 A;  3P5B P;  1JJ2 R;  5J1E B;  2F8H A;  1H0H B;  1DAX A;  1QUP A;  2LQ5 A;  4DV1 J;  2Y1J A;  5F8L A;  1PAU B;  1YZ6 A;  1WDD A;  3HHN B;  1Y3K A;  3EE3 A;  4KO0 B;  3M9O B;  2RE1 A;  2KT3 A;  2QA2 A;  3QAT A;  5EDW A;  2JDJ A;  4HT7 A;  4A8M P;  2XSF A;  3DN9 A;  4DV7 F;  3IBC B;  1RTH A;  1Y00 A;  2R8K A;  3M2R A;  4X4S A;  1FFS B;  2XNQ A;  1AUS L;  3LPY A;  3FQL A;  4TLR A;  2W2N P;  5KT3 A;  1RBA A;  1PJ6 A;  4M5N A;  3BQ2 A;  3FRZ A;  5DM6 Q;  4O0N A;  1RK8 A;  2HZC A;  2QYG A;  2DK2 A;  3OT9 A;  1NJW A;  5B0C A;  2RH3 A;  1X31 C;  2V6A A;  4Q0B B;  4PXD A;  1VHI A;  3UFC X;  4P74 A;  2MZJ A;  4MMO A;  4PG7 A;  3CED A;  2ILZ A;  3MEG A;  1XMB A;  3ITH A;  5MLC V;  4PR6 A;  1BD6 A;  2I9S A;  2DEI A;  3U1M A;  3BGL A;  3NCQ A;  3L95 X;  3QYY A;  3A13 A;  1YQH A;  2RUS A;  2RD5 C;  1DLO A;  4V1A k;  3BN7 A;  4HLB A;  4CTA A;  4WFA Q;  2L08 A;  4J9Q A;  1KS2 A;  2FJD B;  2GO8 A;  5C42 B;  4X66 J;  1X4C A;  4X4O A;  2WW4 A;  3CCU S;  2XI3 A;  4RNF A;  3H5U A;  4JI5 J;  4B9U A;  1LK5 A;  2DKO B;  4GO5 X;  2RS8 A;  3OJS A;  5L9X A;  3FDS A;  2DR8 A;  2HMI A;  1IKW A;  1JIH A;  2MXY A;  5EWE A;  1T9V A;  3ET6 A;  4LF5 J;  3NAH A;  3I55 S;  1KQF B;  2VBX A;  3BM7 A;  1P6T A;  2CQ0 A;  2X3D A;  1E6V B;  3I5B A;  3M8Q B;  1RT6 B;  4FS1 A;  3PRB A;  4LF6 F;  3AXK A;  1UVK A;  4DUT A;  1QE1 B;  4FYD A;  1WC4 A;  4C4W A;  2M9K A;  4KHP F;  2QA1 A;  1YJ7 A;  5CD4 A;  3IRX B;  2FQQ B;  2GJI A;  2DHA A;  2E7V A;  4B9L A;  3HVA A;  4H4O A;  2J7U A;  3BBB A;  1EX8 A;  1XQI A;  1FX4 A;  4TU7 A;  1IBM J;  1XK8 A;  3IFE A;  4A46 A;  5HJY A;  4DEZ A;  1UFW A;  3PYD A;  4ITS A;  4PWW A;  1X8D A;  2EFG A;  3HVR A;  3M4X A;  2HZA A;  4W90 B;  1ZZF A;  3ZNJ 1;  1VQK S;  1BGX T;  3CCE S;  1K1Q A;  2E5L F;  1U1R A;  1L3T A;  1SKS A;  3D66 A;  4NLD A;  1XWL A;  1Q5V A;  1H73 A;  2ZZM A;  2XMA A;  3KK2 B;  2HRY A;  1YHQ S;  4YB5 A;  3A8I A;  4USH A;  4KFB B;  2E1R A;  4DCO B;  2D7S A;  2LXI A;  3C14 B;  3KFW X;  1REG X;  2CG8 A;  1C2P A;  2NRE A;  4PQA A;  1X9M A;  2UV8 A;  4I6W A;  3GG0 A;  3TX0 A;  2GHP A;  4DSI A;  2JNJ A;  4FNI A;  3BH7 B;  1K0V A;  3HHD A;  4X65 J;  4KC5 A;  2AW0 A;  2Z2M A;  1CJK B;  3GCW P;  2QLF B;  4OX9 J;  3D1H A;  1FFG B;  3BV8 A;  3TJ8 A;  1RT4 A;  1Q78 A;  2XMM A;  3C15 B;  4QR0 A;  1FRL A;  1U1N A;  1RAJ A;  3MPU B;  1N34 J;  4ZJL A;  3DYA B;  2QEX S;  2MGZ B;  3Q8V A;  4DSK A;  4NYO A;  3VAJ A;  2KO1 A;  3UI3 A;  2FC9 A;  4LRA A;  4DU7 A;  4P9S A;  1VLO A;  2IRU A;  4LF8 J;  1HW8 A;  4DSF A;  1JLC A;  1URR A;  3IBF B;  4I6A A;  4OZ1 A;  4GKK F;  4CI0 B;  4ZPT R;  3DLL Q;  4R5P A;  1JJ4 A;  2DH7 A;  3SMZ A;  1QSS A;  3UD4 P;  4Q8F A;  3UD5 A;  2O66 A;  4RNO A;  3OV7 A;  2COL A;  1TUW A;  1RUS A;  1CS4 B;  2KJV A;  1NM2 A;  2CQ2 A;  4PZV A;  3DHX A;  1OQ3 A;  1U8W A;  1S0V A;  3KG4 A;  1GMV A;  2W2P P;  2WW8 A;  4K5S A;  3KLI B;  1T03 B;  3W2W B;  3KXD A;  1CVJ A;  2HS4 A;  2DCU B;  3L09 A;  3AA8 A;  4OYP A;  4DCJ B;  2AMC B;  2CJY B;  4EBE A;  2K7J A;  1GTH A;  3EWG A;  1SH3 A;  1FWL A;  1U0H B;  4NZ6 A;  5EX0 A;  4AUK A;  2XZT B;  3T1Y J;  3HHK A;  5KFE A;  2E9R X;  2R8H A;  2OGU A;  2E29 A;  1F5B A;  1Y7P A;  2AKW B;  3FFI B;  3RB0 A;  2B56 A;  5JXS A;  1E6Y B;  3VZH A;  1CUL A;  4H4K C;  2UZA A;  3UR3 C;  1AZS A;  4KO0 A;  4TU8 A;  2B4V A;  1RYR A;  1NDL A;  1GXT A;  4DUZ F;  5BXI A;  5BYS A;  1P9Y A;  2QC3 A;  3AOA A;  5F3Z A;  3ZXW A;  1RAH B;  3MMB A;  1HD0 A;  1RWP B;  1CC8 A;  1WOP A;  3LOU A;  3B78 A;  4ZP7 A;  3JB9 k;  2DPI A;  1X5P A;  2IC3 B;  1FJG J;  2UXD J;  1SC1 B;  2YKO A;  3MPY A;  4DV5 J;  4H54 A;  4C97 A;  2QLB B;  2ZEJ A;  3I31 A;  1LWX A;  3A3N B;  5K5M A;  1HYS B;  3QJL A;  1UEV A;  2YPZ A;  5I3Q A;  1NJY A;  1MWQ A;  3G96 A;  3BGR A;  3RB3 A;  2ZH5 A;  4NCG B;  5HBM B;  3VVT A;  8ATC B;  1RBL A;  2MHN A;  2DHH A;  5KFO A;  4OYO A;  1Z1Z A;  2FJA B;  1HBM B;  4H4K A;  2YKN B;  1UWB B;  4X4Q A;  3JSM A;  4WZM A;  2IJR A;  4LBI A;  4HDH A;  4X4P A;  4Q43 A;  1U6Z A;  2Z30 B;  2G4B A;  3TA0 A;  1OY9 A;  2JLF A;  1TV6 B;  3ZO7 A;  4HI1 A;  3MTK A;  3RZA A;  2GV1 A;  1FNM A;  2WRM A;  1H98 A;  3LAN A;  2HQD A;  3TRG A;  3T19 A;  1U02 A;  3ZZU A;  2A6O A;  1HR0 F;  2XWX A;  4ECT A;  1OYD A;  3BBC A;  4YB6 A;  3NXZ A;  3BF4 A;  2QL5 B;  4CYU B;  3NS7 B;  2BE7 D;  2HS0 A;  4UZB A;  5HAO A;  2D74 B;  1HNZ J;  2GMJ A;  1WHV A;  4E8U A;  4RX6 A;  3N5B A;  4NLO A;  2XB2 D;  3CC2 S;  1T02 A;  2RIL A;  5GAE U;  1UL3 A;  4C0B A;  4CLW A;  1FI4 A;  1HWI A;  3MMC B;  2XY6 A;  4O3S A;  1HBU B;  3ETO A;  3OTO F;  2CZ9 A;  3H4D A;  3GJT B;  4JV2 A;  3AFG A;  5E7O B;  4IG0 A;  5FDL B;  2L48 A;  2L41 A;  4FP9 A;  1E6V A;  2RQM A;  3M8Q A;  4P10 A;  2Z0G A;  3MEE B;  5E3P A;  4DL7 A;  3NNH A;  3WQP A;  1QE1 A;  2CQB A;  1ZPW X;  3CW2 C;  3GYG A;  3IRX A;  4YB7 A;  2B5J A;  1HLW A;  1MWZ A;  4RLE A;  5DET A;  5IV3 A;  2Q79 A;  2HW3 A;  5IFM A;  5HMX A;  5ETS A;  1JJC B;  2Y0B B;  4YFU A;  2KVQ E;  3W2V B;  2UUC J;  2EW0 A;  1LWC B;  2EI5 A;  5HRO B;  5FLX U;  1HBO B;  3K57 A;  4JI6 F;  4QIV A;  5I3P A;  3LP2 A;  4F7V A;  3AOB A;  4NXM F;  1AA1 B;  1HQU B;  1R8B A;  4MIB A;  2OSQ A;  4ECX A;  3OR2 B;  1XER A;  4L6V 3;  1NDP A;  2XQC A;  1R8P A;  3VZI A;  5CQG A;  2YWW A;  2H65 B;  1O0P A;  2IDL A;  1EHW A;  3KK1 A;  1I94 F;  2ATC B;  4K2X A;  2CPY A;  3V6D B;  3K89 A;  3TAN A;  2CDR B;  2N7Y A;  1ZOT A;  4OHZ A;  2PSZ A;  3R1L A;  4JI0 F;  1JX4 A;  2XZD B;  4DR1 F;  1NK7 A;  2AGP A;  7FDR A;  2E66 A;  4FVC A;  2ZM6 J;  3IR7 B;  1RU2 A;  1CJK A;  3F73 A;  5KOW A;  5A0Y A;  3CB4 A;  4DU8 A;  1EZZ B;  2FY8 A;  3C15 A;  3DLG A;  1PYS B;  1LOU A;  3O1L A;  5LOQ A;  4NCB A;  3DYA A;  3ZZT A;  3QJJ A;  3POT B;  1P1T A;  4MKY A;  4FF2 A;  6AT1 B;  1JLA B;  2MB0 B;  4DPT A;  3I5A A;  4LVN P;  1NSP A;  1L3V A;  1R3N A;  1S6P A;  2ALY B;  2IMO A;  4B9N A;  5H9F J;  3LQV A;  2KDO A;  1RU1 A;  4X4R A;  1WG1 A;  4WE1 A;  4X62 F;  1V6H A;  2XWY A;  2BJ1 A;  2MTL A;  2HGN A;  4GO7 X;  2PI4 A;  4UOF A;  2EG2 A;  4AXI A;  1WC3 A;  4DHV A;  1IQT A;  3L7O A;  1UVL A;  1W7W A;  2MJN A;  3QIP B;  2PEH A;  3HT0 A;  1C0U A;  5L46 A;  4LQ9 A;  1VQ4 S;  3IG1 B;  3V4I B;  2QV6 A;  2ZH9 A;  5KFD A;  2ZUA A;  2EFO A;  1OPI A;  2H1Y A;  2ZVI A;  3CCJ S;  3QWP A;  1VK3 A;  1J5E J;  4OI0 A;  1JLG B;  2CPX A;  2IM1 A;  2DNQ A;  4JI7 F;  4PXB A;  5FII A;  2XLJ A;  4FVM A;  1U0H A;  3G2X A;  3CIM A;  1P27 B;  4QWE A;  3D6H B;  2B8Q A;  2HWI A;  2UUB J;  5IM0 B;  1E6Y A;  5HI7 A;  3MCN A;  4RU2 A;  3WX4 A;  3GFY A;  1WHX A;  5KFB A;  2W9C A;  4DV2 J;  3T1H F;  3DM2 B;  1IBK F;  4LFC F;  4CH1 A;  4G1Q A;  1N6Q A;  3WC0 A;  2B6A B;  2D3Z A;  2GML A;  3CJT A;  4WF9 Q;  2ROG A;  2WSE C;  4MFB B;  5B09 A;  2CNN B;  2E44 A;  3HZG A;  1FEH A;  4K4W A;  4LSN A;  2ZC4 A;  3TYT A;  2CPH A;  3BSO A;  1Y11 A;  1EB0 A;  4YDD B;  4ZVQ B;  4BBY A;  1WOS A;  4HAC A;  4ERD A;  4OQJ A;  5DRK A;  1ICE B;  3HSD A;  1X9W A;  3D28 A;  1XJW B;  3RRG A;  4EUV A;  1WG5 A;  3KUH A;  5T7L A;  4LF4 F;  2FLN A;  1A7G E;  2YX1 A;  4ANE A;  4CWB A;  1NEE A;  3DGP B;  1PG5 B;  4O3Q A;  3C19 A;  3OD2 A;  1X5T A;  1YG0 A;  1HBM A;  3PX0 A;  2E1P A;  1BMQ B;  2YKN A;  4ECS A;  2RDJ A;  5D15 A;  4RUB A;  1PAE X;  4QIF A;  2Y1R I;  1CBK A;  4R8U B;  1XMO J;  3CT9 A;  4AQY F;  5BJR A;  5I42 B;  3SCI E;  5AE2 A;  1S1T A;  1GX5 A;  2Y0S D;  2ZNZ A;  2OPR B;  3IMQ J;  2HFV A;  5KFX A;  1XNR F;  5G4D A;  4K0K J;  3MUM P;  3BSN A;  4C3M A;  2WCX A;  2MKC A;  3RBD A;  2AV5 A;  4XPC A;  4C8O A;  1VBK A;  1NDK A;  3D6M B;  4YHH J;  3EVO A;  2DH8 A;  1ACM B;  4EBC A;  1SC4 B;  3ZZZ A;  1G3O A;  4DZ6 A;  1WEY A;  3SDE B;  4FS2 A;  4MT1 A;  1C4A A;  2K3I A;  1MLA A;  2DBB A;  2OEK A;  4Y28 C;  4MK9 A;  2V0N A;  1SL2 A;  1S79 A;  4AL5 A;  1Q16 B;  3CE8 A;  2PII A;  4QIG A;  1WC1 A;  4KYZ A;  2LQB A;  3CDA A;  2J0Q D;  3R3T A;  5IWA F;  1HBU A;  4CLF A;  2P6S A;  4IFY B;  2VPW B;  5HLF A;  3MI7 X;  2HHH F;  4JOU A;  3HFV A;  4F4A A;  3IC1 A;  5K8M A;  1ITP A;  2IYG A;  1BWE A;  2AX0 A;  1SUQ A;  3DLE B;  3BDP A;  5K8O A;  4UT4 A;  4CIO A;  3CD6 S;  3VAM A;  3GQC A;  3CJQ A;  1UEU A;  4DV7 J;  1WDT A;  3N6N A;  3PY8 A;  2ZJQ Q;  4AFF A;  2JC1 A;  1DUR A;  1VMB A;  3TUI C;  4K4Y A;  3R5B A;  2PN6 A;  2I6W A;  2YH0 A;  5C2C A;  2FUG 9;  4Q2M A;  4O23 A;  3B6B A;  1ZTT A;  3KYL A;  3T3F A;  4TYB A;  3JTN A;  1LWC A;  3RRK A;  1TQL A;  2B9X A;  4H4M B;  1FDA A;  2ROP A;  4FN5 A;  3IAM 9;  3A8J A;  5LSL A;  4G65 A;  2VKR A;  2J7W A;  2Y3Y A;  4EGL A;  3NL0 A;  5KAK A;  2P9C A;  3VAG A;  1X7V A;  1HQU A;  2CNK B;  4YQW A;  2FJX A;  4W92 B;  5KG4 A;  4YY3 F;  3TZX A;  2HLU A;  1Q81 T;  1SKU B;  3R5C A;  5KFJ A;  2VFS A;  4LUB A;  3MOJ B;  1ZA2 B;  1VDH A;  4Q8E A;  2DH9 A;  5AXM A;  3GV7 B;  3HJV A;  2LXU A;  4KPY A;  5KFT A;  2CAJ A;  3V6D A;  9ATC B;  3GIL A;  4KGK A;  4ZVG A;  4OJH A;  4J7C A;  5IZH A;  3CJS A;  1U2F A;  3MOZ A;  5J2P B;  3GIK A;  4X4T A;  1ZM9 A;  5DG9 A;  1IJE B;  3PDN A;  1RTJ B;  4OV6 A;  1TL5 A;  4ZVS B;  3BR9 A;  2XS5 A;  3JYT A;  1HNW F;  1JLA A;  1NHV A;  3PO5 A;  4MJK A;  1LW2 B;  3QT6 A;  2E9Z A;  2J0S D;  4TQR A;  2C3U A;  5F8J A;  4L3N A;  3D0H E;  3CCR S;  2P9E A;  5KT7 A;  4UUW A;  1KLN A;  1QM9 A;  2JWN A;  2FVR A;  5LXR A;  2J7K A;  1B70 B;  3MR2 A;  4LF6 J;  5A76 A;  1UFL A;  1JNZ B;  3QIP A;  4KHP J;  2Z2Y B;  5GAD I;  2RVJ A;  4WWS A;  3OL9 A;  2Q1L A;  1UPP A;  3NEK A;  4GKJ F;  4BLG A;  2FJW A;  1SXL A;  4NAS A;  4YUD A;  1HMV A;  3GE9 A;  1R0A B;  1JLG A;  2K06 A;  4RW9 B;  1U6B A;  4PAA A;  2NZC A;  1W2I A;  4NPO A;  3DOM A;  4KHR A;  3H5S A;  4B3M F;  1N32 F;  2BE2 B;  1TKT B;  2KKH A;  3BGU A;  2DGT A;  3M05 A;  1WSR A;  2IMW P;  1OMS A;  2VFT A;  4FDF A;  2E5L J;  3NBP A;  4IOB A;  2RUG A;  4MTP A;  1TFW A;  3TZY A;  3DM2 A;  5ADZ A;  2BQ3 A;  2R9L A;  2AYB A;  2B6A A;  2Z56 B;  3CO9 A;  1G6B A;  4MFB A;  1S49 A;  1VQ6 S;  1OYE A;  3JTO A;  1VRT B;  3BSA A;  2E1M C;  2ZDO A;  2AZ3 A;  2O67 A;  4IH7 A;  2ZH3 A;  4X64 F;  1NKC A;  4NA1 A;  3BEG B;  1F5A A;  2UUW A;  3VGU A;  2GIQ A;  4NLX A;  1Q5Y A;  3MED A;  4RUH A;  2KM8 C;  4KQZ A;  1H2V Z;  1I1G A;  4URS A;  3P45 B;  2POK A;  5AJ3 F;  5J1P A;  1YWX A;  3B54 A;  2HZV A;  4K4U A;  3PYF A;  5DZ7 A;  2MKJ A;  1NU4 A;  1UZH A;  1JLE B;  2LQ9 A;  4UOH A;  1WI8 A;  2B9W A;  2CZ4 A;  2CNL B;  1PYO B;  4IO9 Q;  3DU6 A;  4DPX A;  3DGP A;  2HVE A;  3EZO A;  4KGV B;  4QQB A;  3K5P A;  5D0R A;  3ICL A;  2R2T A;  4PG5 A;  3OL8 A;  1K8A T;  4GKK J;  2OMO A;  2JHE A;  1N0V C;  1FXR A;  4OI1 A;  1LEO A;  4N5S A;  2V4J B;  5I42 A;  3CJ8 A;  1FER A;  2C22 A;  1C4C A;  1VC6 A;  4UZC A;  1GX6 A;  4JI3 F;  3CWJ A;  1M1G A;  4DDF A;  1RTI B;  2OEL A;  1EIY B;  4CLY A;  2GJ2 A;  5C25 A;  3KUG A;  3CCW A;  4XIU A;  3TX8 A;  4HI2 A;  3A8K A;  2QSF A;  2RQ4 A;  5DG8 A;  3L3C A;  2HYI B;  3SDE A;  3J81 Y;  5I3U B;  2N4C A;  3H4B A;  3DRS A;  1GT8 A;  3KK3 B;  3FJ2 A;  4Y6I A;  3H2L A;  4GRS A;  1FRX A;  4LIR A;  4CDI A;  2CJB A;  2K2P A;  4M5L A;  3D3C J;  4R0E A;  5A8R B;  4Z7C A;  1OWX A;  2ZKT A;  4DUZ J;  4PG4 A;  2KXF A;  2MQN A;  2EC2 A;  1VRQ C;  4OLP A;  2LMI A;  3IS9 B;  4LR9 A;  1REV B;  4YR3 A;  1TMJ A;  2OFG X;  2GHW A;  2QYC A;  2CJX B;  1SV5 B;  3HSG A;  4QW9 A;  9RUB A;  2HNZ A;  4LIW A;  1KQG B;  3JSB A;  2DR9 A;  4N47 A;  4V19 J;  3TO8 A;  1TFY A;  4DWI A;  2RF2 B;  5J1N A;  2KG0 A;  3F44 A;  2JLG A;  2DNH A;  4DQQ A;  2A18 A;  1U1K A;  1TMM A;  4TXS A;  3VHQ A;  4QYZ J;  1SQF A;  3HD2 A;  2XMW A;  2HRX A;  2M5Y A;  4OYI A;  3LF0 A;  3EMT A;  1YIJ S;  1Z4U A;  3M1V B;  4CLZ A;  3KNG A;  1IWG A;  2EG1 A;  1FF2 A;  1R31 A;  2RSQ A;  4ZS6 A;  4WP3 A;  4KGZ B;  1UCN A;  2JH3 A;  1T05 B;  1RWW B;  3KHL A;  2RKI A;  1N52 B;  1D9F A;  3PKY A;  2NPI A;  3M8P B;  4UOC A;  2ZD1 B;  8RUC A;  1M1H A;  1D8Z A;  1T95 A;  1YX2 A;  2E5I A;  4F04 B;  1RT2 B;  4NI2 A;  2VFV A;  3QWU A;  2UVU A;  4IG3 B;  3BO2 A;  2E5J A;  5H9E K;  1BQX A;  4D3H A;  3TZW A;  5A2Q U;  3I4P A;  1GTE A;  4PWD B;  1HR0 J;  1VR6 A;  4ECY A;  3M8W A;  3HHL B;  5CAA A;  2W25 A;  2KRR A;  2FHM A;  5A6P A;  4F0H A;  1DTQ B;  2PMW A;  3ZTS A;  3OQ2 A;  2G2O A;  2BBE A;  1RTJ A;  2VG7 B;  4JI1 F;  1G4C A;  3A1Y G;  1OSC A;  3LUY A;  4LR7 A;  2PO4 A;  4F25 A;  2YNI A;  4ILM A;  2R7U A;  1LW2 A;  1N5Y B;  1DTT B;  1ZA1 B;  3ZFV A;  4LQ3 A;  4F4W A;  1H7W A;  3OTO J;  1YLX A;  3J7Z T;  1ELO A;  4USM A;  2ZHO A;  2JC0 A;  4C8L A;  4NLY A;  4I68 A;  2LFV A;  4NCA A;  3PW7 A;  3MCO A;  4B9V A;  4QOT A;  2ZH2 A;  4ELT A;  2C2R A;  3W5Z A;  4DJB A;  3U1N A;  4F8R A;  4DV3 F;  3V81 A;  2V50 A;  4O4R A;  5K20 B;  2I8E A;  4U67 Q;  4YR0 A;  2OUG A;  3PCO B;  3PO4 A;  2GVD A;  4D3G A;  2LKZ A;  1S6Q A;  3J80 Y;  4KAI A;  5E3R A;  2P6T A;  5GAH U;  4F4X A;  3ENQ A;  3K5M A;  3NMA A;  4RW9 A;  4WKY A;  2DXE A;  4LFA F;  4ES1 A;  2AJ2 A;  4O44 A;  3KLV A;  3WIV A;  3I96 A;  4RZR A;  4ECR A;  2BE2 A;  1TKT A;  1QUV A;  3SCK E;  1B64 A;  4JI6 J;  4HHH A;  3OHA A;  5LJ5 Y;  3EXC X;  3DRR A;  4NXM J;  1U1P A;  2YQ1 A;  2DR6 A;  1QY7 A;  3V5R A;  3ILO A;  3MGJ A;  1MMN A;  2VG5 B;  1FRJ A;  5AE1 A;  5JMN A;  3KLF B;  5IV4 A;  3CCL S;  4Q2L A;  4PUO A;  3E01 B;  3NWR A;  5KFM A;  1VQS A;  3N6M A;  5F8M A;  2ZFH A;  3CMA S;  1T7P A;  1VRT A;  1I94 J;  2GIF A;  2UXC F;  2IRX A;  4KV8 B;  3UE2 A;  3D9B A;  2KVI A;  3NMR A;  2BAN A;  2ILY A;  3DDK A;  2JEF A;  1XR5 A;  1YKW A;  1RAG B;  2J6S A;  2D41 A;  2CJK A;  4JI0 J;  2QL7 B;  1NK6 A;  4DR1 J;  1UAW A;  2DNK A;  2V4R A;  1BY9 A;  4M5I A;  4F3M A;  1TK5 A;  4Y2A A;  3RBZ A;  1ZAX A;  2FZG B;  1Q8L A;  1S9E A;  4HH1 A;  2DCL A;  2V2Z A;  3UCG A;  1JLE A;  3DFE A;  5GME A;  2CFX A;  4URG A;  2FY1 A;  2FVP A;  2BR0 A;  3MEK A;  4IH5 A;  2MKH A;  3HM9 A;  4N76 A;  3SZ2 A;  4IDK B;  2VQF F;  2D9P A;  1X4G A;  3AY0 A;  4X62 J;  1WKL A;  2DHG A;  2E1A A;  2IYI A;  1WI6 A;  1TL1 B;  1I6J A;  1EET B;  3CCM S;  2AGO A;  1S1W B;  4G3I A;  3ZNU A;  2L9D A;  3CD5 A;  1RTI A;  1VLY A;  1WF1 A;  1Q7Y T;  1YGY A;  2CPD A;  3F0N A;  2QTW A;  1ZH5 A;  4AND A;  2QE5 A;  2Y9H A;  4M5G A;  3CC7 S;  4ZJQ A;  1TR0 A;  1UKU A;  5L1J A;  3TW0 A;  1R8H A;  1S0M A;  3Q8Y A;  2N3L A;  2P9G A;  3Q8P B;  4USI A;  2VA2 A;  1J2V A;  4JV1 A;  2IM2 A;  4JI7 J;  4OI2 A;  2PA3 A;  3KK3 A;  1HHQ A;  4F50 A;  3NCP A;  1N54 B;  5L1I A;  2WBM A;  5HQM A;  4IFV A;  5KFN A;  4CO1 A;  2WAQ D;  1S57 A;  4C8Y A;  1IKX B;  3LWL A;  2ASY A;  5AE3 A;  2MJU A;  1SC3 B;  2CQI A;  4UUX A;  3H90 A;  4FYV B;  2VIH A;  5A8R A;  3G9C A;  3AJ1 A;  4CO5 A;  1Y3J A;  1VQM S;  1MSW D;  2V63 A;  3EM1 A;  3T1H J;  1IBK J;  1QDU B;  5DQH A;  4LFC J;  2AYM A;  2ZOM A;  1N5T A;  3IS9 A;  1RCX B;  1QAI A;  4CM2 A;  3M6X A;  2D3U A;  1REV A;  3BR8 A;  2CPZ A;  4KSE B;  2ABY A;  1SV5 A;  4F4Y A;  4KIA A;  4CO3 A;  2RHS B;  4DLE A;  2B8P A;  3QMQ A;  5F9L A;  3ULH A;  3BH6 B;  3DOK B;  2XY7 A;  1RAE B;  1TKZ A;  3MMJ A;  4LF2 A;  3PVX A;  4EK2 A;  1A0O B;  2R4F A;  2HHQ A;  2NUH A;  2MMY A;  3PNI A;  3V2U C;  2EEY A;  3I32 A;  3IGV A;  5K9F A;  2XSJ A;  4ED2 A;  3K5N A;  4DFK A;  4LF4 J;  4TYA A;  4EZ6 A;  1GEH A;  1R6Y A;  1EQM A;  4DPU A;  1Q8K A;  3SSQ A;  3T6B A;  4QU6 A;  1PKU A;  3N9U C;  1KON A;  2F9D A;  4ZKA A;  2KM8 B;  3HVW A;  4B3O B;  2V4Q A;  1TKX B;  3IWX A;  2QFJ A;  1T05 A;  4B08 A;  1IKV B;  3EIC A;  1NRK A;  3M8P A;  4O4G A;  3M8R A;  2C3O A;  4OLO A;  4MH8 A;  4AQY J;  3GSI A;  1RT2 A;  2FZK B;  2KYZ A;  2QN6 B;  2QA4 S;  2OPP B;  1XTZ A;  4MKA A;  4L73 A;  4WIQ A;  1XNR J;  1M5O C;  4ZP9 A;  4A8Q A;  1U45 A;  4HHU A;  3QO9 A;  4EO8 A;  2UUA F;  1A9N B;  4YS2 A;  1M5P C;  1B3T A;  3VGV A;  2DYA A;  3PM9 A;  1RAO A;  2AYG A;  3ZTQ A;  3N01 A;  3HKW A;  4K4S A;  3RB6 A;  2CQ3 A;  4M8L A;  1FE0 A;  5A8K A;  1S1U B;  1S6O A;  2VG7 A;  1V5I B;  3RAM A;  5B0D A;  2HND B;  5C24 A;  1NAQ A;  4L74 A;  4ZIW A;  1BWV A;  1U49 A;  5J2Q B;  2C42 A;  4ILL A;  1FJE B;  5JJB A;  3TVK A;  2VHG A;  2BM0 A;  5IWA J;  5HO4 A;  3JSY A;  3NG8 A;  1DBD A;  4QR1 A;  1ZTW A;  3SV4 A;  5SUH A;  1RWM B;  2ERR A;  1JK9 B;  2I1R A;  3GR1 A;  2HHH J;  1HL6 A;  3PAC A;  3RTV A;  2HFN A;  2ZJP Q;  3KDO A;  1VOM A;  2CYY A;  2FJB B;  3R8Y A;  5GVQ A;  3OL6 A;  1SL0 A;  3ADA C;  1N5V A;  1D3W A;  1KQS R;  3DHW C;  2FGC A;  2F5G A;  4LRC A;  1T9X A;  4OI4 A;  1FDB A;  2JEI A;  1K1S A;  1FRM A;  3R6G B;  3D2W A;  1TUV A;  1T3O A;  1TK0 A;  3CC4 S;  3UNY A;  2JOQ A;  2ATL A;  1EJ7 L;  1LWF A;  2ASD A;  5DM7 Q;  2HAI A;  3AHP A;  1FXD A;  1XMQ F;  3WZ0 A;  4QWA A;  2YKP A;  3K5O A;  1CSJ A;  3QT7 A;  4ED0 A;  5KG2 A;  1J5O A;  3RW6 A;  1F0X A;  1HA1 A;  3EX7 B;  4ICL A;  6FDR A;  5F8G A;  2C1E B;  2VFR A;  4WFX A;  2DR5 A;  1KVJ A;  4QPX A;  3B8H A;  5L9N A;  2DHS A;  1B99 A;  4USU A;  2X1A A;  1H7X A;  4OYM A;  3OXG A;  3LTO A;  4YY3 J;  1SB6 A;  3E01 A;  1P8G A;  3MPW A;  2HFU A;  1IBC B;  3MM7 A;  2DD8 S;  2K1R A;  2VDI A;  2DRD A;  2FHK A;  3J7A 1;  1GXL A;  2OEM A;  4WTY A;  3PYE A;  4NLW A;  1L3U A;  2R7X A;  2VOP A;  2QLX A;  4ZN3 A;  3PW2 A;  4DL3 A;  4DR4 F;  2F65 A;  3PHE A;  1VQ7 S;  4TY8 B;  3TAM A;  3NGK A;  2DNM A;  1EP4 A;  3OVB A;  2UP1 A;  3AD7 C;  3OTB A;  2BJ9 A;  3HI9 A;  4ZVO B;  3IN5 A;  4OHY A;  2JVR A;  1HNW J;  2R2R A;  5KG1 A;  1Y4Z B;  1KWM A;  3VAH A;  4JI2 F;  5CZX A;  2G1H A;  1HAR A;  4F3Q A;  3BO4 A;  1X4A A;  4CLU A;  3GPA A;  4NA3 A;  1YVF A;  1QD1 A;  1HQE A;  1X4E A;  5KFC A;  2F1F A;  3T5H A;  3M30 B;  1TL1 A;  2FJE B;  2YKM B;  3C6U B;  1S10 A;  3QQC D;  4ATN A;  5E2Q A;  5LJ3 Y;  3DOL B;  5E5N A;  3S01 A;  3MR3 A;  1VYA A;  3JTP A;  4FKY A;  5F8N A;  5LL6 d;  4I2Q B;  3FCV A;  4GKJ J;  4ZVT B;  1JLB B;  2PFF B;  1VJW A;  4KPC A;  3BN4 A;  4Y3C A;  1M5V C;  2BRL A;  3PIO Q;  5HVH A;  2LU1 A;  2EFN A;  2WON B;  2J6T A;  5D0G A;  2MQO A;  4B3M J;  1N32 J;  2BKN A;  4N8N A;  3MM8 A;  4NLR A;  3VAK A;  4USJ C;  2HFO A;  3EGN A;  2AF6 A;  3QT8 A;  1T9Y A;  2YQ3 A;  4DLG A;  2GGP A;  3CCZ A;  3GMG A;  3QT5 A;  2AP6 A;  3T5K A;  1FT8 A;  2E9T A;  1YIT S;  2YKQ A;  2BW7 A;  1WEL A;  4CO2 A;  2F4F A;  3UPF A;  2FIU A;  5HAT A;  1XEZ A;  3L7U A;  3VCD A;  1S4E A;  3HVT B;  2XTJ P;  4X64 J;  1VBX A;  1Q53 A;  3DOK A;  1F5C A;  1UPM B;  4KRW A;  5G0R B;  5HP1 B;  3C16 A;  1RT7 A;  1U6F A;  1VRU B;  3MEC B;  2ZHB A;  1IR0 A;  4DR6 F;  1FVQ A;  3VQT A;  2LQJ A;  2IIH A;  2D9O A;  2LA6 A;  5AJ3 J;  1HD1 A;  4M63 A;  1FCA A;  1NUE A;  3CO0 P;  3CJ0 A;  1SL1 A;  2GC8 A;  4C3K A;  2E1C A;  2DIT A;  3H7H B;  3KDN A;  1FVS A;  1HQ2 A;  3AB4 B;  4N56 A;  3PW5 A;  4PAB A;  3IGN A;  1SQE A;  4A8O A;  3Q8R B;  4B3O A;  2DNL A;  1WC6 A;  3MM6 B;  2YWK A;  1TKX A;  3OBI A;  1DJ0 A;  4OL8 A;  3Q89 A;  4NMX A;  1JLF A;  4U8Y A;  3C6T A;  1GH8 A;  2WHO A;  1OS5 A;  4DR7 F;  3AJ2 A;  3ZC4 A;  1RT5 A;  4ZCL A;  2EW9 A;  3MM9 B;  2BMB A;  1SPB P;  3P6Y C;  1UFK A;  3WHI A;  2YNH A;  2OPP A;  2LXF A;  3C8Y A;  2OSR A;  3H98 A;  3QGP A;  2CPE A;  2HNY A;  5CYM A;  3OFF A;  5KFU A;  2ZE2 B;  1NB7 A;  3E8O A;  4CLL A;  2KN4 A;  4F2R A;  1P9Q C;  3HPO A;  1Y5N B;  1S1U A;  2LU2 A;  2EFP A;  3DXS X;  5KFI A;  5KFG A;  4LSL A;  3DKD A;  5KG0 A;  3QRQ A;  2JFD A;  1RTD B;  3W7B A;  2OEJ A;  3KJV B;  3AOD A;  3GG1 A;  4ZLP A;  4B9S A;  3DI6 B;  1AXQ A;  3NP5 A;  3D54 A;  2O01 C;  2C3M A;  1FWK A;  5KT6 A;  2W9B B;  2MKK A;  2G0J A;  3GSD A;  3FBF A;  4DL5 A;  1MU2 B;  5DLG A;  2VG6 B;  2NSB A;  2HHW A;  5ETM A;  1RP5 A;  2HQG A;  1NK9 A;  3TEG A;  4WK3 A;  5THW A;  4UQT A;  2XYG B;  2FHJ D;  3AAW B;  2XHC A;  4XAK A;  1NHK L;  2LP4 A;  2EXU A;  1KC8 T;  4I2P B;  4LRF A;  4ED5 A;  1R7I A;  1Y5I B;  4RNM A;  2IA6 A;  4ID5 B;  4OJG A;  1RA6 A;  4CT8 A;  1RHQ B;  2W4D A;  4F4Z A;  4LRB A;  1RB0 A;  4UTG A;  1KOO A;  1PJ5 A;  3QLH B;  3IBW A;  2UV8 G;  4K4X A;  2AEF A;  3NOG A;  1DAR A;  1UW9 A;  1FKP B;  2AX1 A;  4C0O C;  4LF1 A;  1JMT A;  1NB2 A;  4FPI A;  2FTR A;  1IM6 A;  4LRD A;  4FBU A;  2KYX A;  2X7I A;  5D77 A;  1TVR A;  2JEJ A;  4DCP B;  4EO6 A;  4ZIT A;  4FF3 A;  2IM0 A;  3RB4 A;  4AL7 A;  4OJ1 A;  2WSF C;  2PI5 A;  4OI3 A;  4WU2 A;  1FKA F;  1N8R T;  2RU3 A;  1KTQ A;  4DFP A;  3DLK B;  5GAG U;  2HS3 A;  1Q8I A;  1BQN A;  4DPW A;  1TUG B;  1FJC A;  3MMA A;  2WB4 A;  3RW7 A;  1CEZ A;  5HMZ A;  2DNN A;  3UR0 A;  1H6K X;  2V9K A;  3HD1 A;  1WWH A;  4TN2 A;  3JQK A;  1GXU A;  1S1V A;  4J9U E;  2XGQ A;  2FJV A;  4QJV A;  1LV5 A;  1LWE B;  2IAJ B;  1SQG A;  4JI1 J;  4RBV A;  4JBC A;  1UW4 A;  4YOE A;  1JXL A;  5DGA A;  2B3T B;  5B0F A;  3HHL D;  3NOC A;  2EBE A;  3MAA A;  5FLX Y;  1VBY A;  2MKS A;  3MUR P;  1VIS A;  4Q7A A;  4PYD A;  2RS2 A;  3PR4 A;  1DY3 A;  4A8W A;  3H5X A;  1NO8 A;  1QSL A;  1NSQ A;  4RW4 A;  3M30 A;  1U25 A;  4YB1 P;  4OZ2 A;  2YKM A;  1LW0 A;  3C6U A;  4DV3 J;  1C1C B;  2C2M B;  4Y34 A;  2XMV A;  5DQG A;  1VHF A;  3MWB A;  2HK3 A;  4NWB A;  3MR5 A;  2WK4 A;  1GMW A;  4IR1 A;  3G6E S;  5J2N A;  1V3R A;  3QID A;  1RLC L;  1QTM A;  3N5F A;  3ENA A;  4GVB B;  3TVZ A;  4Y0F A;  2HGL A;  1JLB A;  4RU9 A;  2VB6 A;  3Q2T C;  1Z2Z A;  4CRJ A;  5HAN A;  3G8S A;  2W4P A;  5F3T A;  3J81 j;  4C7Q A;  2WON A;  3NGS A;  5DDP C;  2JJ4 D;  1F6T A;  1IBL F;  4LFA J;  1XC9 A;  1BQM B;  4ZPD A;  3C2P A;  5K14 B;  4QZV B;  2ZH4 A;  3SIP B;  5LT5 A;  2GQC A;  5KFA A;  3M32 B;  4DSJ A;  3LGH A;  4RW7 A;  1RXO B;  1XBW A;  4OHX A;  2YWG A;  4KH1 B;  1JKH A;  3U7J A;  4IOA Q;  1NKE A;  5DG7 A;  1KP6 A;  1KBR A;  4K7Q A;  1VCT A;  2J9E A;  2F9J A;  2ZZT A;  3BKT A;  1TKD A;  2NS1 B;  2UXC J;  3HLU A;  1U47 A;  1VGY A;  2KHC A;  2OPQ B;  3PRV A;  4JV0 A;  3BJY A;  2RQC A;  3NNC A;  1JXE A;  3PYG A;  4J91 A;  4ZLJ A;  1NME B;  2CAD A;  1DZ5 A;  2YTC A;  3QAU A;  5HP1 A;  1VRU A;  2DPJ A;  3OTD A;  5M2P A;  2J0X A;  4OJ3 A;  4A8S A;  2YNG A;  2R8I A;  4HHJ A;  4CNY A;  2JL9 A;  4ZP6 A;  3GCX P;  5KT2 A;  5L39 A;  4IUF A;  2D3O 1;  5CYQ B;  4CLS A;  2YY3 A;  2VJU A;  4CCH A;  3M8Z A;  3UCU P;  3MM6 A;  4PXC A;  1SJ3 P;  4K4Z A;  2VQF J;  3P96 A;  2HHV A;  4BC7 A;  5CCL A;  2OPS B;  5KFQ A;  4ELU A;  3ILJ A;  3DDI A;  3A3O B;  1RAB B;  2NXU A;  4V19 X;  4RPF A;  1C0T B;  3G82 A;  1BC6 A;  1Y9O A;  4ECQ A;  2A2D A;  2R7S A;  1XN9 A;  1B4S A;  3DLB A;  2LDY A;  4QBU A;  2C2Z B;  3EVM A;  2ZE2 A;  1Q4R A;  3MDF A;  1N88 A;  4RJV A;  4E0D A;  4PWU A;  2CWX A;  1H38 A;  2HFS A;  3H5Y A;  1LXJ A;  1FTR A;  1UJ5 A;  3V6K A;  2VPY B;  1WF2 A;  3CJK A;  2L9N A;  3QSY B;  1MG7 A;  4DG1 B;  1LXN A;  4DSL A;  4J9P A;  2BKO A;  3UVJ A;  4K4V A;  4GC7 A;  2UUT A;  1A6L A;  5J1E A;  1G1X A;  3DRY A;  1TL4 A;  3TNV A;  2P5V A;  3GV8 B;  1KD1 T;  3KHG A;  2RAQ A;  4OX6 A;  5DS7 A;  4ELV A;  2X1F A;  1MU2 A;  4ZCM A;  2VG6 A;  1ZZN A;  3GYX B;  2CQ1 A;  2MY7 A;  5CCM A;  5MAO A;  1T8E A;  3MPV A;  3IAS 9;  2BKP A;  1IM4 A;  5BYR A;  1NK0 A;  3SI8 A;  2FPH X;  4AXJ A;  4FXV A;  3MM5 B;  3K58 A;  4I2P A;  3D3B J;  3CDW A;  4ID5 A;  2OML A;  3U02 A;  2JZ5 A;  1X4F A;  3O44 A;  4HDG A;  3HT3 A;  4YEA A;  3V6J A;  4RR5 A;  4C8K A;  2F4V F;  3K5L A;  2UU9 F;  4OFZ A;  1SBR A;  2IVY A;  2PT0 A;  2R2S A;  3FMW A;  1F9E B;  1NK8 A;  3KLG B;  2NYI A;  1TL3 B;  2ASL A;  2JSX A;  4LF7 F;  2EC0 A;  3DRX A;  1W26 A;  3P4U B;  4CM0 A;  1FKP A;  1Q0N A;  2VKZ G;  4Q0B A;  2IPO B;  3QAE A;  2GS5 A;  3G6V A;  4DUY F;  3Q22 A;  3BZQ A;  3WC2 A;  4TU9 A;  1M0S A;  4U95 A;  2LEB A;  3CPW R;  2R7R A;  1NCL A;  4DFM A;  1IXK A;  3G8T A;  1YJR A;  1DQ9 A;  3T5L A;  3KLH B;  1SCJ B;  2LVW A;  3O6Q A;  2N82 B;  3E2E A;  3DRP B;  2Z57 B;  2BV3 A;  2DXD A;  1CJU B;  2XNR A;  1NBE B;  2RML A;  4JV5 F;  4ILR A;  5EN1 A;  2DO8 A;  3R2D J;  2AJ0 A;  4ZPV R;  3ILL A;  2XYP B;  5E33 A;  4OZ5 A;  3PTW A;  7AT1 B;  5KG3 A;  3NY0 A;  3H40 A;  1VQ8 S;  4ED1 A;  4BHQ A;  3UO0 A;  2DGX A;  3TAQ A;  5C42 A;  4ZCK A;  4Q45 A;  3NWG A;  3CXC R;  2E7W A;  5K8P A;  2XO7 A;  5GMD A;  2UUA J;  1FXL A;  4M5H A;  1S4F A;  4MAK A;  3W5Y A;  4KH0 B;  4L72 B;  4KGX B;  3M2R B;  2IAJ A;  2R7O A;  3M9M B;  1WOR A;  4QPT A;  4WFZ A;  1V3Z A;  1TK8 A;  3QRR A;  1WG4 A;  1HWL A;  2APO A;  4P7V A;  4MYT A;  2BJE A;  1AT1 B;  4W4M A;  3DLH A;  3R5D A;  3EUN A;  4NOH A;  3T9N A;  2K8G A;  1KTV A;  3CDU A;  2O5D A;  2VU5 A;  2XZW A;  3VAI A;  3OFH A;  4M5M A;  2C2O B;  3BS9 A;  1RT6 A;  3D68 A;  4LJM A;  3T1A A;  1C1C A;  3KWM A;  3PX6 A;  3TR5 A;  1WHY A;  1GFW B;  3CIZ A;  3NKY A;  3BQ1 A;  1R27 B;  2V8D A;  2WZ1 A;  4ZP8 A;  3OW2 R;  4GVB A;  4B3R F;  1OO0 B;  1ULR A;  1RHM B;  2VC1 A;  3M6U A;  4Z7Y A;  4PG6 A;  3TJA A;  2Y1I A;  1DLO B;  1Q8B A;  5D4N A;  3AQO A;  2HWH A;  2X1G A;  1UWA A;  1XMQ J;  2FVQ A;  2MQQ A;  2OD6 A;  1BQM A;  4CTA B;  2C2E A;  4NLP A;  5K14 A;  4JB8 B;  3I0R B;  1RWO B;  2IVF B;  2MDA A;  1OPZ A;  3DGV A;  2DGO A;  3O3L A;  4P2F A;  3M32 A;  1O5J A;  3HCX A;  3KK2 A;  4WK1 A;  1SVD A;  1FE4 A;  4KFB A;  2YPY A;  1YJW S;  3D0I E;  2DY9 A;  3C14 A;  3R2C J;  1U24 A;  3P49 B;  2XI2 A;  2WVD A;  1HKA A;  1R8A A;  2HMI B;  1IKW B;  2Z58 B;  2M4M A;  3UDL A;  1WAC A;  3GIR A;  4TKT A;  3FZ2 A;  2KXN B;  3GWC A;  2CQD A;  1UZD A;  3TA2 A;  3THP A;  1PBU A;  2MUI A;  3QGH A;  1K9M T;  4DR4 J;  4QIE A;  4O3N A;  1BLU A;  4A47 A;  4O3P A;  3TI0 A;  2VOD A;  4WTO B;  2FVC A;  2H51 B;  4WXW A;  4NLQ A;  1R0C B;  5ETT A;  2ZWO A;  3GZ7 A;  2Z4P A;  4O3O A;  2MGZ A;  2A1B A;  4C8Z A;  4O3R A;  3W1Y C;  4X84 A;  2HHP A;  5IT9 U;  1VIX A;  2ROE A;  5CYQ A;  3NLC A;  1XR7 A;  1VQ9 S;  2WSC C;  2VV5 A;  2AEJ A;  4JI2 J;  3SFU A;  3SQG B;  4DBQ A;  1YJU A;  3IWN C;  3K7R A;  1Q7L B;  2OPS A;  4ZPW R;  2WVF A;  4CO0 A;  4PPD A;  1M1K T;  2E5G A;  2XHW A;  5IT4 A;  3A8E A;  3DDN A;  1FHT A;  3WBZ A;  1FKO B;  4G6V B;  3BRE A;  4JYA F;  1CS4 A;  3H0P A;  5KFR A;  2VQE F;  4NML A;  1NXI A;  4C11 B;  2DVI A;  4DN0 A;  3KLI A;  1T03 A;  3W2W A;  4NA2 A;  2PC6 A;  2CXE A;  5K8N A;  3OVA A;  1KNZ A;  2C2N A;  4DG1 A;  5LMU F;  3GTY X;  1PSD A;  1GMW D;  5C7P A;  3MD3 A;  1YBA A;  3FFI A;  3FMB A;  3AJD A;  5IQQ A;  3T5J A;  2HVZ A;  1KEK A;  1QAY A;  2ZUG A;  1RT4 B;  1AW0 A;  1HNI B;  3I87 A;  3GYN A;  2H4Y B;  1RHR B;  4DV6 F;  4PYA A;  2IFX A;  3H2V E;  2L3M A;  2KRB A;  5KG6 A;  3OL7 A;  4TLQ A;  4HH0 A;  2HRT A;  3FBB A;  1NLK L;  5DO2 A;  1FNO A;  2IC3 A;  2J9D A;  3TUP A;  1T9W A;  4DX8 H;  2QMU B;  4DL2 A;  2C3Y A;  5M2R A;  3CMQ A;  4R5P B;  2XEX A;  1TL3 A;  1CQN A;  2B0G A;  1HYS A;  4ZVP B;  3KG1 A;  2GZO A;  4DR6 J;  3KOA A;  2OFH X;  3CD0 A;  3KUE A;  1U2C A;  3RBE A;  2BOA A;  2VL1 A;  2DRB A;  1ZM4 A;  4CP5 A;  2WB1 D;  1NND A;  4MKB A;  4NCG A;  5HBM A;  4ED6 A;  3LAM A;  2BJ3 A;  1TAQ A;  4USW A;  1XIQ A;  4MKV A;  4PG8 A;  5ETK A;  4ZK7 M;  1UWB A;  4A48 A;  3DRP A;  3HSZ A;  2RT3 A;  1YI2 S;  1UJ6 A;  1ZYQ A;  3H8Y A;  5IXU A;  3OTC A;  1CG2 A;  2HG4 A;  3D6T B;  3OSP A;  4KJI A;  3IR5 B;  3CF5 Q;  1TV6 A;  2B7B B;  4OZ0 A;  2CPI A;  4DR7 J;  4UW2 A;  3K59 A;  1K0T A;  1LFP A;  2FB0 A;  1I3O B;  2V8G A;  4N7T A;  4DX5 A;  1CUL B;  1SI9 A;  1SJQ A;  5E3C A;  5KG5 A;  1AZS B;  5SZT A;  2QIF A;  3ZZ0 A;  3MFH A;  4QWC A;  3Q24 A;  4CYU A;  3Q0A A;  4OYA A;  2J8A A;  2HUR A;  4K5R A;  2QLW A;  2WTF A;  5IC6 B;  2O1P A;  4J9L A;  3MMB B;  2XC9 A;  4AD6 A;  4UQG A;  1T3N A;  3IR6 B;  2ZOF A;  5GAD U;  4DZD A;  4B3T F;  1ZAV A;  1HNX F;  5F8I A;  3MMC A;  2XY5 A;  1RWU A;  3K8V A;  3K2Y A;  4MIW A;  2H4W B;  3LP1 B;  3I82 A;  1YBU A;  3Q8S B;  5FDL A;  1SKW A;  3T9Z A;  3QSI A;  4HTI A;  3GJS B;  1Q95 G;  2N7C A;  3MEE A;  2DR7 A;  2VH7 A;  4C3L A;  4KR0 B;  5KOX A;  2DO4 A;  1WTB A;  3TAP A;  2AT1 B;  2W01 A;  3BGR B;  5ITH A;  1RWX B;  1FX2 A;  3PIP Q;  4ZVU B;  2DNZ A;  3FCW A;  2B43 A;  5C2G A;  2KZM A;  3JSM B;  4U8V A;  2R7Q A;  1YSJ A;  4ZVE A;  5HQ8 A;  4P7T A;  3H42 A;  5B0B A;  3CD7 A;  3FSY A;  5M2U A;  3W2V A;  3JAM U;  5A2Q Y;  2KJW A;  4FYY B;  4I64 A;  2J0W A;  2W2M P;  5HRO A;  1AYE A;  3CJ2 A;  1HBO A;  3I5C A;  1QVF R;  2XMT A;  3I0R A;  3S1T A;  1X5S A;  2DRA A;  2XMK A;  4OMF G;  3SEO A;  4DX6 A;  3M6V A;  1F3V A;  2DNP A;  3HF5 A;  3OR2 A;  1YRU A;  1ZM3 A;  2MQL A;  3UN5 A;  3NAI A;  5CD4 H;  1S9F A;  1SKR A;  4QIW D;  5D6G A;  3BKU A;  1HIY A;  3AA9 A;  2J6U A;  1RKI A;  2YQ0 A;  1UA1 A;  2MLX A;  5KFS A;  4P6Q A;  1PBA A;  2HBZ B;  4IG0 B;  3CTR A;  3Q83 A;  2JVO A;  2CA9 A;  4OX7 A;  3RR8 A;  2HKE A;  3MXH P;  2EFQ A;  1WTF A;  2CUY A;  1M5S A;  3UN3 A;  4NZ0 A;  3A12 A;  3FRY A;  4L76 A;  3HP6 A;  1IJF B;  2DNR A;  3G87 A;  1D09 B;  1YRX A;  3NS6 A;  2WVC A;  4M95 A;  4I6Y A;  2HBY B;  3POT A;  3J7Y I;  4B02 A;  2B5J B;  3HHE A;  2B7C B;  1WC5 A;  4JI8 F;  2JEG A;  1N5S A;  2QZ8 A;  5JVH Q;  2ZOG A;  4RO0 A;  3SQG A;  1IKY B;  3DCA A;  1FK9 B;  3HX9 A;  2MZT A;  4XK8 C;  4DN9 A;  1F2H A;  3LWM A;  1FKO A;  2R7T A;  5EHH A;  1D8Y A;  3LP2 B;  1YTY A;  2NR0 A;  2G13 A;  2C28 A;  1IN0 A;  1EKR A;  3S7R A;  1KR4 A;  3KJN B;  1SC6 A;  4C11 A;  3IG1 A;  3V4I A;  1HW9 A;  2DJW A;  2AJ4 A;  1D9D A;  3L4B C;  2XGP A;  1QTN B;  1WNE A;  1V5V A;  3KK1 B;  3NNA A;  2N4D A;  5F0U A;  3B4D A;  2PD1 A;  2ZIT A;  2KT5 A;  3KHR A;  2V5H G;  1CLF A;  2W7A A;  1IBL J;  1PO6 A;  3HUL A;  1TTH B;  4ZLL A;  5IM0 A;  2ZH1 A;  1CJV B;  3K8W A;  1DQ8 A;  4RW6 B;  5IT0 A;  5A0Y B;  3QRP A;  3ZZP A;  1HNI A;  1NZA A;  3DLG B;  4YDX A;  1MW7 A;  4ZPB A;  1F2G A;  5GAG I;  3RJM B;  4C2M A;  2CG4 A;  2MKI A;  4NYZ A;  3ELH A;  2VOO A;  4U6P A;  2XLI A;  4ZPC A;  1ROF A;  4EYH B;  4DQS A;  2X1B A;  1S6P B;  1VJQ A;  4BWM A;  4EFA C;  2KL8 A;  1EQ0 A;  4WE1 B;  2FLL A;  2CKW A;  1OIA A;  2YBV A;  2BXJ A;  2DIU A;  3THV A;  3MF5 A;  1J27 A;  2YWF A;  2OAU A;  4CO4 A;  4C8N A;  4Q44 A;  2M8H A;  4Q5V A;  3CJ3 A;  5AXK A;  3M2U B;  3G4S S;  3MAH A;  3RYL A;  1NJX A;  2C2K B;  4Y65 A;  1C0U B;  2HVD A;  2BQU A;  4OHW A;  2DGV A;  1U8S A;  1RA7 A;  5F8H A;  3ENV A;  2ADB A;  5DDO C;  4F2S A;  5B0G A;  2NPF A;  4ZIV A;  2RU9 A;  4QU7 A;  1ZBT A;  5EWG A;  4HT5 A;  4R8U A;  2RRN A;  5H9F K;  3EXY A;  6FD1 A;  1X4B A;  4WJB A;  2OPR A;  1NK4 A;  3X3U A;  3AB2 B;  5KFL A;  2DO0 A;  4K50 A;  1VQN S;  2A10 A;  2AIR B;  4L75 A;  2W9C B;  1NPP A;  4RL1 A;  3CUL A;  4G1Q B;  1N6Q B;  3BGF A;  1RQ0 A;  1DQA A;  3K17 A;  1NDC A;  2CVE A;  1PC5 A;  2QSW A;  3W8P A;  2IJN A;  1HHS A;  4LSN B;  2QA4 G;  4WZQ A;  3D4J A;  1S1X B;  1QAX A;  2ZC3 A;  3RU0 A;  3VR1 A;  4X4U A;  1U09 A;  1HWJ A;  1Q1K A;  2QMW A;  4F02 A;  1X0P A;  2H5I B;  4IFY A;  1PJ7 A;  1GMU A;  4HAC B;  1KFS A;  3LP1 A;  3CSK A;  3H20 A;  1S7H A;  3GR0 A;  5HQL A;  2M8D B;  5T7L B;  4ZVF A;  4ED8 A;  1AFI A;  4AT1 B;  3BQ0 A;  3HFZ B;  1AUD A;  3CCT A;  3DLE A;  4LBP A;  2N3O A;  2M70 A;  3R27 A;  2HHT A;  3KLE B;  4ETX A;  2EPI A;  2O3D A;  1L5U A;  3W64 A;  3R7B B;  4Y2K A;  2W2Q P;  2HVH A;  4CNZ A;  2KTQ A;  1X4D A;  2ASJ A;  1F1B B;  5HL7 Q;  3OFE A;  3J7A N;  3ISN D;  1QJH A;  1Q82 T;  4I0W A;  1KLM B;  4F0K A;  1W25 A;  2F4V J;  2KFY A;  4EMD A;  2UU9 J;  2BJD A;  4MYU A;  5KFW A;  1NK5 A;  3R7N B;  4DL4 A;  4DOZ A;  1S1T B;  3FCH A;  4OYZ A;  1HHT P;  4LF7 J;  2XMU A;  3P5T L;  3GB0 A;  4H4M A;  2EWH A;  5B0E A;  2MSS A;  4NLV A;  3HFK A;  2V8V A;  3CDB A;  2GQQ A;  4DUY J;  4USV A;  2B51 A;  4DF8 A;  2Q43 A;  2IJF A;  3MUT P;  2VBZ A;  1FD2 A;  5D4P A;  4FYW B;  4KY3 A;  3ENW A;  1U26 A;  2OTL S;  4NRU A;  2B4U A;  2X51 A;  1F3F A;  4DV0 F;  2MKY A;  3CUN A;  2IBK A;  3QZ7 A;  2MST A;  3D7S B;  2HQ3 A;  4JV5 J;  2OI2 A;  3MHY A;  3PXG a;  1UTA A;  1HBN B;  4WBF A;  1BUX A;  3PW4 A;  1L3S A;  4RWW A;  2HBR B;  2ZH8 A;  4DPO A;  4PRF A;  1B7Y B;  5HLF B;  4N77 A;  5E3Q A;  4I7F B;  4LRE A;  2J8S A;  1NKB A;  3FZB A;  5J2P A;  2NQP A;  3FC9 A;  1SUQ B;  4ZN1 A;  4KE5 A;  4DFJ A;  4Y00 A;  1NH8 A;  1T9U A;  3SBM A;  4FBT A;  3Q2S C;  3RGI A;  1RYS A;  3NS5 A;  2ZHA A;  1CQM A;  5E3A A;  4WCE Q;  5EWF A;  3PFO A;  1GAO A;  3BO3 A;  3FBC A;  4ECV A;  2PGC A;  4OYW A;  4BDP A;  1IKY A;  1NPK A;  1FK9 A;  3TWZ A;  2BUN A;  1YK9 A;  4M5K A;  2OO4 A;  3AT1 B;  1RT3 B;  3MR7 A;  2CQC A;  1VQO S;  3W9J A;  4TQS A;  2GMH A;  1QLN A;  2JRS A;  3OLA A;  1BHN A;  3K0J A;  3FSI A;  1RTZ A;  5BR8 F;  4ED3 A;  2BAB A;  1F9H A;  4RBT A;  1M5K C;  4S0M A;  2BDP A;  1N33 F;  4IR9 A;  4FXD A;  1MRO B;  1U48 A;  4ZCI A;  1FWP A;  4B3R J;  4RWX A;  2I0X A;  3U1L A;  4LF9 F;  1RI7 A;  2XCA A;  3PKM A;  1R0A A;  2W7P A;  3CNQ P;  2LYV A;  1QAJ A;  1YJV A;  1VS3 A;  2VPX B;  4WFY A;  4KKO B;  3SYZ A;  3US5 A;  1RAC B;  4ZJO A;  2Y8Y A;  3HK2 A;  2M52 A;  2P2C B;  4LBH A;  1N5Q A;  4DQR A;  2AD9 A;  5DGB A;  2DNY A;  2FD2 A;  2YNF B;  4WKR A;  3NGR A;  1CJV A;  4RW6 A;  1S76 D;  5EUH A;  3WDO A;  2H5J B;  3PX4 A;  2IA0 A;  3DNC A;  2U2F A;  1PC4 A;  2OP5 A;  1T9T A;  3UCZ P;  2CQ4 A;  4DQP A;  2JFK A;  3JYT B;  4KBI A;  3DMJ B;  4J9V A;  3MAQ A;  5KFY A;  3N28 A;  1N36 F;  4MK8 A;  4J37 A;  3W9H A;  1PIL A;  3MCS A;  3MD1 A;  3IM8 A;  4U96 A;  2RJZ A;  3W62 A;  1C1B B;  1GNK A;  2GQ2 A;  2ACY A;  2WOM B;  2ZJR Q;  2MZR A;  1ZET A;  2NXC A;  1RJJ A;  3MFI A;  3KHH A;  1WEZ A;  4JI4 F;  3M2U A;  3SFG A;  1SH0 A;  3UN2 A;  4HTJ A;  4KTQ A;  3R9L A;  5GAE I;  5D3G B;  4ETZ A;  3I9Z A;  4P2S A;  3AOC A;  4IQM A;  1F60 B;  3W63 A;  3PZP A;  1RWK B;  1H2U X;  4OX8 A;  4Y2C A;  3BBF A;  1HMV B;  1RAD B;  4B9M A;  2I38 A;  4A8X A;  3QZ8 A;  2FVS A;  1ZAW A;  1FD8 A;  2DNG A;  5EX3 A;  3DOM B;  3IM9 A;  5DQI A;  2V4J A;  3JSR A;  2NXJ A;  2MLY A;  2J76 E;  3H2U B;  4DX7 A;  2RRA A;  2MZ1 A;  4JYA J;  3HKZ D;  4ANC A;  4NLS A;  5KFK A;  4M1K A;  2HFZ A;  4P72 A;  2VQE J;  3NBP B;  3T6J A;  3RUB L;  4J5O A;  5KT5 A;  3EPG A;  2V9W A;  2BJ8 A;  4KT0 C;  2D3O R;  2D69 A;  1TU0 B;  5IQ6 A;  3VVU A;  2R7W A;  5I3U A;  1DHM A;  1HI8 A;  2R8J A;  5LMU J;  4DR3 F;  1FDD A;  1S1X A;  2FDN A;  5DZ6 A;  4ZVR B;  2LLZ A;  4HR2 A;  3TJ9 A;  1S99 A;  2A3J A;  2FHJ A;  2OD4 A;  3MED B;  4RW8 B;  5DJB A;  4U7U K;  1Q79 A;  2NLW A;  3IWL A;  3LP0 B;  3RAQ A;  2I2Y A;  2DXF A;  3UDE A;  2XBP A;  5H1S V;  3SCJ E;  4DV6 J;  3KLE A;  3TVY A;  1JLQ B;  1H72 C;  2HPU A;  1HWU A;  2YX4 A;  1L3K A;  2RNE A;  4RBU A;  2W1B A;  3PHT A;  3NGT A;  3D1Q A;  2ALZ A;  4RNH A;  4YME A;  4IKA A;  1YZ7 A;  3HHL C;  1KLM A;  4A8F A;  1N56 A;  2W4C A;  2RF2 A;  5H9E J;  1KRP A;  4DR5 F;  4OYB A;  2KB2 A;  3LA0 A;  4A8K A;  2HQF A;  4EU0 A;  2Q6C A;  2VF3 A;  2H48 B;  2HHU A;  3F41 A;  2LQ8 A;  3OJU A;  2UVW A;  5RUB A;  5C25 B;  3M1V A;  1RKJ A;  4DI6 A;  1VK8 A;  1X9S A;  1KSP A;  2HHS A;  5LMN F;  2F8M A;  4L3K A;  3ILI A;  5ETN A;  3W5X A;  1G2E A;  2GW8 A;  1RE1 B;  1MML A;  2FZC B;  1AB8 A;  4NLG A;  3DRS B;  3HJF A;  2PE8 A;  1B0P A;  2ZD1 A;  1S5Z A;  3OPK A;  2UXB F;  4UST A;  1HBN A;  2ZNY A;  5B0A A;  3W8G A;  2XUL A;  3Q86 A;  4KB7 A;  1MN9 A;  2YXL A;  4IG3 A;  4MIA A;  2MZS A;  1JB0 C;  4I7F A;  4PWD A;  3M2V B;  1K44 A;  3HHL A;  1R8C A;  3I9V 9;  3IRW P;  1DTQ A;  4P73 A;  3KTQ A;  3BYR A;  2D1C A;  1JWW A;  1NHU A;  1NJI T;  2GNK A;  1H74 A;  1U1M A;  5A8W B;  2IM3 A;  2A0F B;  2HNZ B;  2BE9 B;  2QG9 B;  4M5D B;  4B3T J;  1N5Y A;  2LCW A;  1HNX J;  1DTT A;  4P71 A;  2RRB A;  3W65 A;  2KI2 A;  1IUJ A;  3R6L B;  2X3G A;  1FES A;  1H3D A;  1S77 D;  2XO6 A;  2RDI A;  1OJ4 A;  1RT3 A;  4LT6 A;  3W9I A;  4DV4 F;  4P2X A;  3TAR A;  1R0B G;  4F26 A;  2H5E A;  4W98 A;  2FYX A;  4Z37 A;  1I51 B;  3I56 S;  2W8K A;  5A6W A;  3UDV A;  4J9N A;  2R42 A;  2DT9 A;  2M0G B;  3QJP A;  3MUV P;  1MRO A;  2XMJ A;  4CH0 S;  2BZ2 A;  3GFZ A;  3PV8 A;  4OZL A;  1PGZ A;  2RKI B;  5J2M B;  2Z2Z A;  5KFH A;  3UDC A;  1CPZ A;  1S59 A;  2MPU A;  4DL0 C;  4JP8 A;  4M5J A;  2QMX A;  4KKO A;  2G1D A;  4ZPA A;  3AXM A;  4NI2 B;  4EZ9 A;  4WP8 A;  2XLK A;  4IO1 A;  1LFW A;  2AJF E;  3FSX A;  1FA0 A;  2HAF A;  4C0H A;  4A8Y A;  4CH7 A;  1TL7 B;  2YNF A;  3THT A;  2VG5 A;  4QYZ K;  1UMJ A;  3R5A A;  3KLF A;  4J9O A;  1Y0H A;  2MZQ A;  2PFD A;  5CYJ A;  3RBX A;  4UY8 5;  3MTJ A;  2RIJ A;  5KT4 A;  1YBT A;  2M88 A;  1DRZ A;  4X4N A;  3DMJ A;  3PJX A;  2HWT A;  1U4B A;  1RT1 B;  4KV8 A;  2FGO A;  5AXL A;  3ZZR A;  4PPZ A;  2YNI B;  3J7Z 5;  1LQ9 A;  1TP7 A;  1C1B A;  2GVZ B;  2VFU A;  4NXN F;  1VI7 A;  1QVG R;  2WOM A;  4U9R A;  5KG7 A;  2ACM A;  1WKJ A;  3BPS P;  3V81 B;  4J9R A;  2B4O A;  1ZS6 A;  1S97 A;  4YR2 A;  4QR2 A;  5D3G A;  3UD3 P;  4LR8 A;  1UJ4 A;  3TQE A;  2NCK L;  5CAB A;  4DR2 F;  1X5O A;  2GVD B;  3A4T A;  1S6Q B;  4LFB F;  4Y2I A;  4IDK A;  4JI8 J;  1N4L A;  3JXO A;  3OSN A;  4OV1 A;  2IY5 B;  1FO1 A;  2ZBQ A;  5CZV A;  2HRU A;  5U47 A;  2MHE A;  1MNE A;  2JX2 A;  4K4T A;  4EEY A;  4O44 B;  2DNO A;  1Y5L B;  2OTJ S;  1SH2 A;  2GA7 A;  1EET A;  1O6X A;  4ER8 A;  1S1W A;  2QO3 A;  3BSC A;  8AT1 B;  1N0U A;  2ZBC A;  3DRR B;  4B3S F;  4G1P A;  2QL9 B;  2WBR A;  2DGW A;  4WP9 A;  1WF0 A;  1XR6 A;  2RQK A;  2F7V A;  3X1L B;  2BA9 A;  5LM7 E;  1XNQ F;  2VA3 A;  1U2R A;  4PUO B;  2KU7 A;  2DB1 A;  3FEZ A;  3DU5 A;  3GV5 B;  2C2D A;  2BM1 A;  1S48 A;  4OIX A;  3AD8 C;  4J9M A;  2PEB A;  5CHC B;  5IOL A;  1EAR A;  3IP0 A;  4FPR A;  5BYQ A;  2AJ1 A;  3VV2 B;  4NX9 A;  2BAN B;  3UW1 A;  2NXN A;  1G7C B;  2YKA A;  3LPE A;  5ETR A;  4RW8 A; 
#chains in the Genus database with same CATH homology
 2EW0 A;  2HRX A;  2MUI A;  2HAF A;  2GS5 A;  2AJ2 A;  2GZO A;  2DO8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...