2AJ2A

X-ray crystal structure of protein vc0467 from vibrio cholerae. northeast structural genomics consortium target vcr8.
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
187
structure length
187
Chain Sequence
SDIEVGHSMNLTNHFLVAMPSMKDPYFKRSVIYICEHNQDGAMGLMINAPIDITVGGMLKQVDIEPAYPQSHQENLKKPVFNGGPVSEDRGFILHRPRDHYESSMKMTDDIAVTTSKDILTVLGTEAEPEGYIVALGYSGWSAGQLEVELTENSWLTIEADPELIFNTPVHEKWQKAIQKLGISPAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical UPF0301 protein VC0467
publication title X-Ray structure of hypothetical protein VC0467 from Vibrio cholerae: new fold. Northeast Structural Genomics Consortium target VcR8.
rcsb
source organism Vibrio cholerae
molecule tags Unknown function
total genus 38
structure length 187
sequence length 187
ec nomenclature
pdb deposition date 2005-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02622 DUF179 Uncharacterized ACR, COG1678
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1300 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits VC0467-like domains 2aj2A02
3.40.1740.10 Alpha Beta 3-Layer(aba) Sandwich VC0467-like VC0467-like 2aj2A01
2MUIA 2HAFA 2GZOA 2GS5A 2EW0A 2DO8A 2HRXA 2AJ2A
chains in the Genus database with same CATH superfamily
2AJ0A 4OZ5A 3FBBA 4F0MA 3MPDA 4BWMA 2V0NA 3ZTOA 3GIRA 2A10A 1WEYA 1HARA 2VOPA 2NPIA 1RT1A 4LF5F 4ZLLA 4ENOA 3NCQA 3HJFA 1N36F 2CPDA 4DFJA 4IO1A 3GFZA 2NLWA 1L3KA 1DTTA 1GTHA 4DMZA 3MZIA 2BABA 4J7CA 4CQ1A 1CJVB 1LV5A 3TVKA 4PG5A 1WC0A 3QPIA 4QJVA 3UR0A 2QGFB 2IVMA 3C15B 4C0HA 1NK5A 2J6UA 3TA0A 3QJLA 4CIOA 3BGRA 1F5BA 2BOAA 1SUQA 2PMHA 1VQMS 1NK9A 4LREA 4FBUA 3MEEA 2VG7A 4YP3A 4DR4J 2ZJQQ 3EUNA 5DDRC 4DV1F 2UXDF 4FPRA 1WKLA 1DJ0A 1SL0A 4USTA 3H20A 2NUHA 3GIIA 2IJFA 3FCWA 3M2RA 4YB7A 1S49A 4DUTA 2LXUA 1RAFB 1H38A 3N01A 4I6YA 2YH1A 1HBOA 4Y2MA 1YZ7A 4HEA9 2AJFE 1XEZA 3VZHA 4P2SA 3KHGA 2MQLA 3H5UA 1S1WA 2EEYA 3GMGA 2BA9A 5M2RA 2BM0A 4F7VA 1UETA 2LP4A 2KFYA 3LOUA 1UWBB 5LSOA 2CQPA 4M95A 1LWEA 1N5TA 1JLFA 2MQQA 4ZIWA 2GA7A 2W2NP 4NXMJ 4BLGA 3KUEA 2UUCJ 3OFHA 1FHTA 3QAEA 1RHMB 3LWMA 3IBCB 3FRZA 3W66A 5F8MA 3OVSA 4AQYJ 1T05B 3PX4A 4LF7J 1DBDA 2VFVA 1JJHA 1VQ7S 4Q0BB 1RACB 4FKYA 2X7IA 3CCMS 2B9EA 4KPCA 2VG6B 4NE9C 4USKA 3GPAA 1U1PA 2MYFA 3VAIA 2AYGA 1HNVB 3TP2A 3CC4S 1U1KA 1FFGB 3PO4A 2V68A 3H5XA 4OJ1A 4PEOA 3RU0A 5CA5A 4IG3B 1S6QA 2ASDA 1B3TA 1QAIA 1MSWD 2J7KA 1IR0A 2ZJPQ 3KNAA 4CLLA 4ERDA 3NMAA 1TVRB 4K4SA 4ZVQB 3Q2SC 3HHKA 4NPOA 2J8SA 1KLMA 1OY6A 2B4OA 4G6VB 4NLDA 2WVDA 3GJTB 2WAQD 2QL7B 1RHKB 1FWKA 5IT0A 1J5EF 1S1XB 4K4UA 2Y1RI 3RTVA 2FIUA 1X4CA 2GVDB 2ZBPA 2OIHA 4KKOB 1H7WA 2YKNB 4N41A 4U7UD 1UW9A 3WQPA 2XNQA 3G82B 2F63A 3SSQA 2F4VF 3ILIA 3IRXA 1C4AA 3DLKA 4HI2A 4JUZA 4JI5J 2AJQA 3AOBA 2AEFA 2OFHX 2IC3B 2M70A 4R5PA 1C1CA 2BMBA 1KQSR 3UD4P 3AOAA 5ETNA 3OJSA 4M5HA 2DXFA 4WXOA 1G1XA 1UVJA 2ZHBA 1N6QB 1S6OA 4M5JA 5SUHA 1XR5A 3LUYA 2XI3A 1X4GA 4X4VA 3KDOA 5BYRA 4CO1A 4DR7F 2WW4A 4QR2A 1NUEA 1QY7A 4LF4J 2BACA 2HZCA 2BANB 3Q22A 2EK6A 1M5VC 3RW6A 2I5JB 3M6VA 3ETOA 4C8KA 3PW4A 1HBMB 3FBFA 2HIYA 4KPYA 2UVWA 3T5LA 3V81A 1YJUA 1M5OC 4CWBA 1G2EA 1GAOA 1V6HA 4UZBA 3EGWB 4OZNA 2QMUB 2W2OP 4ZITA 1AW0A 4RLEA 3ZZYA 2HQFA 1WWHA 1HQUB 3NRBA 3J7YU 4FP9A 3D0GE 3BKFA 4DV6J 1HD0A 3ZZOA 4HR2A 1U8WA 2HSEB 5H9FJ 4YMEA 2J76E 2UUBJ 2RSQA 2OO4A 2QLFB 4CH7A 4K4YA 4NRUA 3I55S 1RBOB 1VR6A 1Q78A 2OPRB 4L3NA 4NLXA 3NY0A 1W25A 2KRBA 2ZDPA 2QLJB 1E6VA 1OYEA 2UVRA 1RXOB 2V2KA 2B6AB 1SC6A 1FWLA 2MB0B 4K8RA 2QL5B 4LF1A 1S79A 4LFAJ 2R8GA 1VCTA 5AXMA 3KYLA 3DN9A 3B82A 1QLNA 1LW2B 5CYMB 1IKYA 3IM9A 3MEDB 2B9YA 4QWAA 5DM7Q 1UAWA 1SL2A 1RWPB 2RE1A 3K7RA 3AODA 2HRUA 5LSLA 2E5LF 1VLOA 1EAYC 4QCLA 1UWAA 3OHAA 1KC8T 3GR0A 3QIDA 1SJ4P 2RQ4A 5C25A 1NAQA 2A6OA 3GJSB 2MZ1A 5J2QB 4FF3A 4CZCA 3MR2A 1HBUB 4IR1A 3R7SB 4RWXA 2Z4PA 4YR0A 2P9EA 3DLGB 1NJZA 4CLUA 5K8PA 4RUCA 3R6LB 1S0NA 2JEFA 3P49B 3LH2S 3KK1B 3GFXA 4IKAA 5EGYA 4DV4F 1KDNA 1UWBA 2PA8D 2Q66A 1AYEA 1TUWA 3EPIA 2H51B 3SSSA 4ES2A 3IRWP 1IKXB 3KJQB 4LBIA 3OTOF 1F9HA 5KFMA 4DPTA 1IUJA 4NEYA 3D1OA 1S77D 4DR2F 3OLAA 3D6TB 2V9WA 3U1LA 3B4MA 3EE3A 4DS5A 4GVBA 4G1PA 1T05A 1ZTTA 2KJVA 2YWFA 4Q0BA 3MMAB 1V5IB 2VG6A 4PYAA 3M30B 4UOFA 3ZTPA 3MDFA 3TEGA 3KUHA 4H4KC 2ZH1A 1HNVA 3D67A 3V2UC 1PKUA 1SJ3P 1LW0A 4KHMA 5E2QA 1ZM3A 4DLGA 3QYYA 2DGXA 4PPZA 4B9MA 2RF2B 2BW7A 2JOQA 1TVRA 5T7LB 2JEIA 1KWMA 2HG4A 2QA1A 2G9OA 1AT1B 2W7OA 2OTJS 1MWQA 1T7PA 3IC1A 4RW9A 2CDRB 2K7KA 1VI7A 2DGSA 1APSA 2ZWPA 5K5MA 1JXEA 4CLTA 3HD1A 1U45A 4LF5J 3LGMA 2CPYA 4RBVA 1N36J 2IM0A 1RJJA 2VKZG 4KKOA 2MQMA 2CPFA 4JV2A 1KBRA 2L9WA 2WONB 1D8YA 4OX6A 2FZKB 2VBYA 1TK5A 1B99A 1BC6A 2E7VA 3RAQA 3PJ9A 2XULA 1R89A 1PYTA 3THTA 5CCMA 4J9QA 2IC3A 2H5JB 4IH7A 1YJTA 1WNEA 1AZSB 3ZZTA 1N33F 1YX2A 2IBOA 1NHVA 2MKHA 1F9FA 1XNQF 4A47A 4ILRA 4FDFA 4DV1J 3KMSA 4K0KF 6FD1A 2UXDJ 4AFFA 1QSYA 1JLAA 2EI5A 3EGNA 1HQEB 1RTZA 4KB7A 3LA0A 2Y9HA 2RHSB 4NASA 1TZ0A 2MSTA 3EJMA 1IVZA 3NP5A 4DEZA 1RKJA 2I5JA 3Q8QB 3CULA 4RO0A 1N52B 2QTWA 3TA1A 4WTOB 5J1PA 5GADU 4EBCA 1OJ4A 3EZ5A 2VC1A 4C11A 2YX7A 2CFXA 1R43A 3DHXA 3IG1A 4ZHRB 1GX5A 3W5ZA 4EBDA 2DRAA 1JB0C 4J9UE 2HQGA 3K5NA 4HTJA 2K1RB 3ICLA 3R2CJ 3A4TA 3UCGA 1RAJA 4URSA 1TL5A 5D8HB 3FQLA 1YBAA 3GYGA 3WC0A 3ZZPA 1UJ4A 1Q16B 1F2GA 3TAQA 1FVQA 4M8LA 1WG5A 4YR2A 3VWSA 1W26A 2ACMA 1NZ8A 2LDYA 3SCJE 4ZVFA 4O4GA 2ATLA 1TL3B 4LUBA 2L41A 1VFJA 2A2CA 1HNWF 2UV8A 1XERA 2JRSA 1LW2A 1JKHA 5D4LA 3D1QA 4PXBA 4NX9A 2WCXA 5DM6Q 2R2RA 4TLRA 4L76A 1FNMA 1J5EJ 2Q6BA 3BSCA 4RUBA 2IPOB 3T1YF 3QT6A 1NSKL 4JI3J 1S6PA 5J2QA 4A4JA 1AXQA 3A8IA 1IWAA 4AUKA 3HSZA 4ZMMA 1MROA 4F36A 3NL0A 1WI8A 5CYJA 1FDDA 3F44A 3DLGA 1MWYA 4M5KA 5F8GA 3MFHA 3MUTP 2IBKA 2CQDA 3ZZUA 3OTDA 2ROEA 2P5VA 2KT2A 2XEXA 4DXLA 1YTYA 3HHLD 4CNZA 2MQOA 3D6FB 4Y28C 3RUBL 3N6MA 6AT1B 1FVSA 4RW6B 1IKXA 4X66F 1FDAA 3FMBA 4L72B 2IM2A 5DO2A 3POTB 1FK9B 1H0HB 1Z1ZA 3NNHA 1VHFA 2FZGB 3V4IA 3LW5C 4JI1F 1Q7LB 4DR7J 4TQRA 4Y0FA 3H0PA 3HO1A 2R2SA 1B0TA 1VQPS 2OPQA 3BSOA 1IM6A 2XMWA 1GXUA 1X5SA 4U95A 4JI8F 3MTJA 1JLEB 1T9TA 2DNMA 3MM6A 3QFHA 4M5NA 2CXEA 5DQIA 9RUBA 1FJEB 4QQBA 2DRBA 5L9NA 4BDPA 4E0DA 1N5SA 4HKQA 4C4WA 5T7LA 4Q8FA 3H42A 1X5OA 4CTAA 2B9WA 3G87A 5KG7A 3SDEB 4EYIB 1X4BA 3QRQA 2DHXA 2YKMB 2HEKA 2EKYA 5HP1B 1L5UA 4ZN3A 3RB0A 3RG6A 4TY9A 2AKWB 1CEZA 5KFNA 1JQGA 5AJ3F 1K9MT 5E7OB 2CNNB 4C8OA 1RWMB 2WONA 3CIMA 3CC7S 4OLPA 2F8MA 2V67A 2VG5B 4EZ6A 2V8VA 3DOMA 1KRPA 4DR5F 4BS2A 2HAFA 4N7TA 1D8ZA 2VL1A 2B7CB 4MIAA 1ULRA 5E3QA 5ETPA 3KG4A 2IVFB 1WC6A 5KFDA 4ZCKA 1TL1B 1WI6A 1VDHA 3LGHA 3O5TB 1TL4A 2C2NA 1DURA 2WB1D 2PD1A 5DGAA 3CDUA 5J2PA 4PUOB 3ELHA 5GAEU 1UVMA 1RQ0A 2F5GA 1M5SA 1XQIA 2DR8A 1P9YA 1FJ7A 4ZJOA 2VASA 2H3EB 4HHUA 3DRPA 3A3NB 1IBCB 1ZM9A 2XYHB 3KLEB 4DV4J 4K4TA 1N8RT 3R5BA 5DDPC 3N9UC 2XB2D 4ALZA 2PIIA 1RSCA 1EARA 5LJ3Y 1FJCA 4LF6F 4NLPA 1BE4A 3W9IA 1LWFB 4ZHRA 4ECYA 2RD5C 4ECQA 3OTOJ 3CSKA 5H9EK 4G3IA 2K1RA 5HJYA 2CYYA 3CW2C 1RT6B 1RTJA 2GJIA 1MMDA 2GMJA 4P6QA 3IR6B 1XWLA 4DV7F 3NG8A 4L3KA 3W8PA 2HVHA 1AFIA 5ETRA 3ENAA 1WELA 5CQGA 3W2WB 2M52A 3K5LA 4TVAB 5CHCB 3FZBA 2P9GA 2WRMA 4NI2A 3PYFA 4Q5VA 5IS2A 4LRAA 4NCAA 1TL3A 4FVMA 5JXSA 2LQBA 3EXYA 3RYLA 3UDVA 1UKUA 5KFHA 2F3JA 3MMBB 5C7PA 1N88A 1RUSA 1TV6B 4BC9A 3GIMA 1YZ6A 1LK7A 1RT4A 4DLEA 2AZ1A 4C9DA 3HHNB 2N3OA 1UFLA 2UVUA 5JUMA 3HX9A 1TKZB 4M5IA 2LXIA 3CJRA 4Y2IA 1MMNA 3BGOP 1S1VA 4PABA 2ZH9A 3W61A 4PG7A 2GFFA 5FD1A 4DR1F 3FEZA 4YY3F 3I9V9 3F41A 2WVFA 4Y2AA 1N33J 4MYTA 4U96A 1FX2A 1B4SA 3RB3A 1XNQJ 2VFUA 2FJAB 3MXHP 3UI3A 3K57A 2G2OA 1CS4A 1XJWB 2ZD1B 4K0KJ 2XYGB 5A8KA 4QOTA 4LF2A 3B6BA 3MM5B 2FC9A 1Q8IA 1T9VA 4FXVA 3D5MA 2DJWA 1Y3KA 1IR1A 3H5SA 2XMUA 2ZH6A 4CT8A 4NYOA 2G4BA 2YNHB 2YKAA 4LR8A 2H65B 4ZVSB 4WXWA 2DCLA 5THWA 4KV8A 3PFEA 2YNFA 1PAEX 2DISA 3GU0A 4E98A 4OJHA 5CAAA 2MKJA 2ZOGA 4ZA1A 2IVYA 4YDXA 5C5JA 3NWGA 2VUGA 3R5JB 3OVAA 1FX4A 4Q43A 1RP5A 3SYZA 2HFSA 4L75A 1BGXT 3VQTA 1SPBP 4RW7A 1H73A 1D1UA 3TZZA 3VGUA 3MGJA 4WWSA 2LU2A 5FIIA 2W9AA 3O1LA 2MPUA 2CQ2A 2MUIA 1RU1A 4KGZB 4HL9A 3OHBA 1C0UA 3MUMP 2XLJA 3CD6S 4ATNA 2R7SA 3VV2B 4O0NA 4FN5A 4FYXB 4B9UA 3B78A 2EKNA 3BB5A 3TI0A 1VRQC 3KLGB 1WKKA 2ILZA 4DR6F 1JLQA 1R8HA 4DQRA 4P73A 3JSBA 4P10A 4DZ6A 1N54B 3SXLA 3LP1B 3PFOA 4QBUA 4RNMA 4M5MA 2VDHA 1KHWA 1Y5IB 2FY8A 4RW8B 1FE4A 1P6TA 2HWHA 1RT2B 4WFYA 3FEYB 3T1YJ 2FLPA 3QRRA 3HVWA 2CQ4A 1VQNS 4XDCA 1VQOS 1JNZB 2MGZB 2FZCB 2ZOMA 4OYAA 2KM8B 2GGPB 3PKYA 2XO6A 1PSDA 1TKTB 4URQU 4MK8A 1B7YB 4BWJA 2XO7A 1QJHA 2E9ZA 4TQSA 4ECUA 2FJWA 1PC5A 1RT7B 4ZPAA 2VF3A 4F25A 1ACMB 3C3LA 3ENVA 1S7IA 1VIXA 1PO6A 3D0HE 3BPSP 4X66J 2DGOA 1F3FA 3VVTA 1Y00A 4MAKA 2IYGA 5B09A 4JI1J 3Q8RB 1RK8A 2RQMA 2FQQB 2IAJA 4KGMA 3NGRA 2CQCA 1NO8A 3NGSA 3PYEA 2GVZB 2QL9B 1U0HB 3ZTSA 1KS2A 1RU2A 1S12A 4USMA 2V4JB 1RHQB 4USWA 4FF2A 4JI8J 4HACA 2KJWA 1X8DA 2ZBQA 2YBVA 5HQ8A 2LLZA 1T8EA 2EC2A 5K20B 3T6JA 1NK7A 4C3KA 4F4ZA 2JFDA 1RYSA 1S5ZA 3IBFB 2J9DA 4LBHA 3RRKA 2LA4A 2KL8A 2DNNA 2UU9F 4TYBA 1QAJA 1TV6A 1XMOF 4QU6A 4J9OA 1YITS 4OZ0A 2YWWA 4M5DA 2CG8A 3J7A1 3HKZD 4M5GA 2HVZA 4NRTA 4ZKAA 2LDIA 1UP1A 1ZZFA 4TXSA 4NLYA 2XS2A 2W25A 2CDQA 2XZTB 4ZLJA 1HW9A 1TKZA 1RTIA 2ZC4A 2ZC3A 4OYPA 3MEGB 2ZM6F 2ADCA 3ZXWA 3CD5A 3UDCA 4OYWA 5ADZA 2OPPB 1S1UB 1N4LA 1OSDA 1IBKF 3H2UB 4DR5J 5AXKA 2HMIA 5GAHI 4I56A 5BR8F 1DAXA 3FBCA 1S72S 4OV6A 5LL6d 5E3RA 4QW8A 2OMLA 3BF4A 1MG7A 1V5VA 3R5AA 1O51A 2BE7D 5HQMA 1KHVA 3CJKA 4IG0B 1ZOTA 5HO4A 4UOHA 2QG9B 3VALA 2W01A 3I4HX 1VRTA 3PHTA 4NCGB 1PGZA 5HVGA 3D68A 3VGVA 1RAOA 2YNIB 4ID8A 3MR6A 1UFWA 3EYZA 5EWGA 2MKCA 1VQLS 1NBEB 5C2GA 3PEHA 1DLOB 1PIEA 1VQ9S 1QSSA 3G6ES 1DY3A 3O3LA 2YH0A 3OSPA 3CWJA 4BC7A 1NSPA 2MKKA 1Y3JA 2CNOB 2R3VA 3FJ2A 4NA2A 2I2YA 4DDFA 4LF6J 2PC6A 2VPYB 2QFIA 3DGPA 3OXFA 2GHVC 3UR3C 1TFYA 2O66A 2NREA 3LP0B 1Z2LA 1RWNB 4HI1A 4OZJA 2XCAA 1UEUA 2DHAA 2HGMA 2V69A 4JI0J 2XGPA 2RUSA 3IN5A 4AL5A 3P5TL 4DV7J 4KRWA 4LRCA 4KHPF 4P2MA 1FNXH 1VOMA 2FC8A 1RBLA 3A13A 2JEJA 1KN6A 4OHVA 1RTDA 3C6UB 4CLPA 1XTZA 1QVGR 4U6PA 3GV5B 2DO8A 5MLCV 1U2FA 2MKSA 4OX7A 2CJ9A 3MM8B 1L3TA 1FNOA 2QJ3A 2HBYB 1MU2A 4P7VA 4U7CA 2CZ9A 3LP1A 3UQSA 2IA0A 2AGQA 4I1TA 3GQCA 3IP0A 4I2PB 3ZTRA 1VYAA 3KMQA 3PRDA 3JTPA 1UJ5A 1EB0A 3W8GA 8RUCA 3PYDA 2YWGA 1VC5A 2EBEA 2Q79A 1S7HA 3H7HB 1O5JA 2MGZA 1U6ZA 3MOJB 2FD2A 1T3NA 2XS7A 3A8JA 1H3DA 2WOMB 1RTHB 4ZPVR 4C8NA 3M1VB 1S76D 2LYVA 1NJYA 2OLWA 3HLUA 4LSNB 4YY3J 4DX6A 2QLWA 3GFHA 3OFGA 4OFZA 1ZM2A 1WF1A 4YR3A 4UQTA 1I5OB 2DO0A 2CA9A 2MZSA 5I42A 5GAGI 2MEWA 3AXMA 1XR7A 2ZE2B 1Q0NA 3G8TA 1CBKA 1WF0A 4ZVUB 1OQ6A 3OXLA 5HBMB 4F3QA 3C14B 3OQ2A 4DV2J 5G0RB 1KSPA 4NL5A 1JLGB 2DNLA 2JJ4D 4DSEA 4KAIA 1AA1B 3AD9C 3KLFB 1MNEA 1ITPA 4B3MF 2V4JA 2OJ3A 4WP9A 5A8RA 2D3OR 3TAMB 2A1BA 5F3ZA 1PBAA 2ZH2A 1HMVA 2MKIA 4WU2A 1UA1A 4OHXA 1RCOB 3GR1A 3D66A 4WYLA 3NEKA 1JIHA 3QWUA 1SIZA 4DSFA 3HHLA 3AD8C 1HQ2A 1GTEA 3M8RA 2CJQA 1VQ8S 1X4EA 5F8JA 5DZ7A 2E1CA 1VBYA 2MTLA 3HF5A 5B0BA 1LWXA 2HK2A 3FK4A 4WZQA 2BDPA 3JS9A 4L6V3 1SJFA 2XCPA 3LGNA 1KTVA 5K14B 2HRTA 1NH7A 4RX6A 4QIEA 1TR0A 4I7FA 5HVHA 2HNYB 3UVJA 1CLFA 4YS2A 2CQGA 4MKYA 3GV7B 3CCES 2DNOA 2UP1A 3OUYA 2U1AA 4E2FB 3KWMA 2MXYA 3M8WA 4DR6J 3MTKA 3TYTA 4DCOB 1S6UA 1SCJB 5E3AA 3W62A 4TU7A 3NMRA 2D3O1 3BH7B 4ILMA 2OELA 1RZMA 4HT7A 1S10A 2D74B 1UVLA 4RPFA 3O6QA 3EMTA 5IFMA 2MHEA 3AD7C 4I68A 3BR9A 1HFEL 2JNJA 4KY3A 4OQJA 1S9EA 3PRBA 4WE1B 1YIJS 4I0WA 4FNHA 3SQOP 3DLJA 2R9LA 2FHMA 2CQ1A 3IS9B 4QU7A 5IC4B 1DLOA 1GH8A 4IFVB 5E41A 3FSXA 2QO3A 4USUA 1Q5YA 2HYIB 3FMWA 3TRGA 2J9DE 2LQ9A 1TKXB 5IT9U 1V3SA 4K4XA 3MD3A 2KG0A 4Q44A 4P9SA 1UL3A 4DX5A 2Z8QA 1W2IA 2KH9A 5KFRA 4FKXA 1HHQA 5A6WA 4F3MA 3SMZA 1JJ4A 3O2IA 1U2RA 1M5KC 2ZH5A 1YQHA 3TX8A 3Q8PB 1LFPA 2KXHA 4N76A 5EN1A 1U1OA 4OJ3A 3MCOA 1N0UA 2WSCC 4A8OA 1PILA 3B8HA 1K0TA 2IRUA 3NNCA 2NXJA 2VU5A 4ZPTR 1RLDA 1JK9B 2G13A 2B5JB 4IRDA 2HHHF 3BKTA 1D0EA 2WHOA 4IQXA 3JAMU 2KN4A 4J9SA 2M4MA 3QIPB 3JTNA 3ZNUA 2BUNA 1VQ6S 3Q89A 4U67Q 5L46A 3TO8A 2W4PA 3FRYA 2DIUA 3Q8VA 1RWKB 1XMOJ 1KR4A 4DWIA 4I2PA 3MPWA 4WCEQ 2AJ2A 4PXCA 4DV3F 2DK2A 2HQ3A 2HFOA 3R6GB 4TLQA 4F3OA 4OLOA 4F0KA 4WIQA 3PJXA 1ZM4A 1C4CA 2DY9A 2DRDA 3BBBA 1VBXA 3D3BJ 4A8YA 1QTNB 4LT6A 2V2ZA 4O3SA 2ZM6J 1RTHA 4ZLNA 5KT2A 4EUVA 3DDIA 2YQ3A 2WK4A 2FHOB 1LKZA 2EFVA 4WP8A 3H4BA 2FPHX 2EC0A 2B51A 2QN6B 4H4MB 3EX7B 2GHWA 4A48A 2XHWA 3G96A 1VJWA 3GG1A 2QA4S 3G4SS 3HKWA 3O44A 3S8SA 3DOKA 3RRHA 4DU7A 2JL9A 2MHNA 2D69A 2DY1A 3EVWA 5HQLA 5HMZA 3CO0P 1JLGA 1VQKS 1S9GB 2DKOB 4NLVA 1NB2A 2GS5A 1U25A 4LF8F 5D4NA 3TAMA 2VV5A 3HHEA 2FVQA 4FYYB 3WX8A 4F4WA 5CZXA 4YB5A 1UW4A 5KFSA 1TTHB 1RT5A 3W1YC 3KJVB 4TKTA 2YQ0A 4XDDA 4USVA 4MYUA 4OYOA 1KVIA 2QIFA 3DGVA 1H2VZ 1N0VC 1X5PA 4DI6A 3PW2A 3M9NB 2AU0A 2AHOB 1T3OA 1Q8KA 1XIQA 2NZ4A 3C16B 1C0TA 2ZZNA 3UW1A 1F2HA 4DUZF 3V6DA 3GJRB 4OYBA 5KOWA 4WU3A 4KFBB 4ZCIA 3CJ8A 2IJRA 3MECA 4IFYA 2FB0A 3K5MA 2R7TA 4N5SA 2PFDA 3CDWA 2HRYA 1DTTB 5F9LA 3MAHA 3GSIA 3W9JA 2DVIA 4RL1A 2VOOA 1VK3A 2OAUA 1S1TA 3S1TA 4Q2LA 3T5KA 1OS5A 3FDSA 3JB9k 2B4VA 2F7VA 4F50A 4RUAA 2VBWA 2J8AA 2MQNA 3BGRB 4WE1A 5I3PA 2ASYA 2BJEA 1U1LA 3ZFVA 1SUQB 2NXNA 3CCUS 4AL7A 2XSJA 5DLFA 1LOUA 1U6BA 5DJBA 4ED0A 1S0MA 4OHYA 3IS9A 3MCSA 1TKDA 1Q82T 5D3GA 4I2QB 3EGVA 5J2MB 4IFVA 1M1HA 2YY3A 1VQ5S 1S9FA 1U09A 4OYZA 3DLLQ 3PY8A 2UXBF 2NR0A 3W5XA 1TKXA 1SV5B 5EDWA 2CPHA 1HBOB 2AGPA 4DX7A 1TK8A 4ELUA 4JYAJ 2BJ3A 1I3OB 1S1WB 1E6YA 4LF9J 1G7CB 3AHPA 2N82B 2BW2A 1ZAVA 1IQZA 2ALYB 1NEEA 2K7JA 1RI7A 2YX4A 4CM0A 1HPZB 3HFVA 4DQQA 2HHQA 2IDLA 3J7YI 2VHGA 4B3MJ 1HI1A 3VZIA 3J81j 3MUVP 4EYHB 1IKWB 3BGUA 1FD8A 4UOGA 3OPKA 3M6WA 4DSJA 3ZZRA 2FGOA 8ATCB 3D3CJ 5KFTA 1U7LA 3CMAS 3QT5A 3QIPA 5ETTA 4WFNQ 4AE5A 4JBCA 1WORA 1D9FA 3A3OB 5LM7E 1PG5B 1VGYA 1WACA 2JC0A 1S6QB 3Q83A 5CD4A 4HT5A 2FLOA 4I6WA 4ICLB 4NLQA 2CKWA 4K5SA 2IFXA 1Q86T 4N8OA 4ETZA 2Y8WA 3ZO7A 4TNOA 1QDUB 1LK5A 3CE8A 2BQUA 4MMOA 2E9TA 3N6NA 2Z58B 1FJGF 1FRHA 3RB6A 2VA2A 4A8QA 2EBGA 1N32F 2EG2A 2V63A 5F8HA 3H25A 2Q43A 2UUTA 4DF8A 3DLKB 3DI6A 1ELOA 1LQ9A 2DR5A 4ANEA 4B3RF 4G65A 4HDHA 1GMUA 2EFQA 3QQCD 4R5PB 2ZNZA 1C1CB 3CCJS 2DH8A 1FWPA 5B0EA 4LBPA 2MKYA 2KT3A 2ZUGA 3AAWB 2D3UA 3KHHA 2P2CB 1YWXA 1TQLA 2ZVSA 3L4BC 1Y11A 3VF0B 3X3UA 4CCHA 4OMFG 3W2VA 2C2RA 2CJKA 1RGVA 3V6JA 3A3PB 7FDRA 3NGUA 1VC0A 2BV3A 3HDSA 3E51A 1MN9A 2KVIA 3DNCA 3OFEA 2HBZB 3KJVA 5IT9Y 4MH8A 2XY5A 3M6XA 3HM9A 1KQGB 2V8HA 4J9KA 3NS7B 3N5FA 1YBUA 2GX8A 3W64A 3PM9A 1N5VA 3PACA 3C6TA 3CCSS 3OJUA 3OR2A 3V81B 3LAKA 3DKDA 3BO3A 4LSLB 1NK0A 4W4MA 2E1PA 1BQMA 2OHDA 1N34J 4E8UA 1QAXA 1D09B 1WEXA 3QZ8A 3QGPA 3QLHA 4MIBA 2AIRB 2H9ZA 5KAKA 1EETA 4KFBA 1O8BA 2UV8G 2Q3PA 5A2QU 4ED4A 3KXDA 3CEDA 4NZ7A 3QATA 2BE2B 1ZZNA 2IM3A 1MN7A 1E6VB 4W98A 2A18A 1IBMF 3BN7A 3JAMY 2EXUA 3QRPA 2LFVA 1YJ7A 5KFLA 1CC8A 3OR1B 1U49A 4DV3J 3CMES 3O8WA 1FRIA 4DBQA 1IKYB 1H2TZ 2BOPA 4JI2F 1HNIB 3CDBA 3UE2A 4OI2A 2ZZMA 2B0GA 2VQFF 1VBZA 2M9KA 2DT9A 5HJXA 4LRBA 5KG5A 2NYIA 3BREA 5C25B 3I96A 4I2QA 5J2MA 4EO6A 4B9SA 3FKBA 1ZYQA 2CJYB 2YQ1A 4Z37A 1U48A 4A8SA 3G6YA 1O6XA 2KM8C 4YUDA 1SV5A 2MMYA 2ADBA 4KIAA 1N48A 1SJQA 3IFEA 2AEMA 5GADI 2ZJRQ 4KH0B 2UUAF 1CJKA 3BGFA 4OX9J 3KK2B 2R7OA 2CNKB 2IJNA 2QZ8A 3QSIA 4I4BA 3A8KA 1WHXA 1R6YA 3DXBA 3GTYX 2HFNA 3DYAA 5B0GA 1MWZA 1T95A 4TY8A 1HPZA 4GKKF 3P4UB 1GNKA 3P6YC 4NZ6A 4LF8J 2VBZA 1WOOA 4L74A 4ZPCA 3CO9A 2QMXA 4GVBB 4Z7CA 1LXJA 1IKWA 4WJBA 2FJVA 2KG1A 2KT5A 1ZAWA 3ISNC 3C8YA 3M8ZA 3I82A 1U1MA 2B9XA 4C2MA 2HPUA 1S0OA 3H4DA 1A6LA 5L1IA 4Q7AA 1NM2A 1B7FA 2YPZA 1S0VA 4C97A 1LW0B 5KFUA 3TUJC 5AT1B 5C2CA 3C2PA 2AV5A 4KSEB 3D4JA 1HIYA 4PG6A 3EZOA 4ICLA 4LFCF 4EWTA 1TFWA 1R0BG 4C6AA 2XMTA 7AT1B 2JHEA 1U02A 1F9EB 2NCKL 4RW9B 5BYQA 4PXEA 3KK3A 1M90T 4IOBA 2JX2A 1KEKA 1S97A 1SJRA 2HHVA 2UZAA 2DR6A 3DU5A 3EXCX 2RHQB 1VRUA 5A0YA 1S57A 2BQRA 2BKOA 2Z2ZA 5FDLA 2QX0A 1NJWA 4P72A 3E2EA 1IKVB 4U8VA 2P8IA 3K58A 2HIQA 2HS4A 1HHTP 3N6LA 2OEJA 5I3UA 2H5EA 2VKRA 3W65A 2RQCA 5L38A 1H6KX 3AB2B 4CRJA 3GZ7A 4AT1B 4DFPA 1JLAB 4QWDA 3BO2A 1WSRA 1RT3A 2RT3A 4OYXA 4JV5F 4WFZA 2GV1A 2UXBJ 2AT1B 2I6WA 3CTRA 3ZC4A 2B4UA 3TQEA 1CSJA 3AQOA 4H4OB 1GX6A 2VD3A 1D3WA 2WVEA 3M8PB 1ZA2B 4MFBA 3SFUA 1IBLF 3TJ8A 3HFKA 3QWPA 2RUGA 4C11B 1T9YA 1EJ7L 2CZVC 1Q4RA 2RU3A 2FHJD 4C0BA 4DL4A 3IGNA 1X7VA 3IG1B 3BJYA 3TW0A 2N4CA 2PT0A 3DFEA 2WBMA 3IWLA 5DRKA 4LSLA 4D3GA 2M88A 4GO5X 5D0HA 4NWBA 1G3OA 2NZCA 2BYCA 5KT4A 1SIWB 2F1FA 5KG2A 3MMCB 3MR3A 2HW3A 4CLZA 4LRDA 1Y5NB 3NAIA 3DOLA 4DQSA 5K9FA 2QLBB 3CC2S 1QUPA 2BE2A 4NLWA 5IQQA 1FI4A 3PKMA 2DPJA 3GSDA 3SEOA 1FEHA 3NNAA 1OQ3A 3PV8A 4C8YA 4O4GB 2DNGA 3CCZA 1TMJA 4AXIA 3OR1A 2RDJA 1JKHB 1D9DA 5AE2A 1X9SA 3M32B 4XTTA 4DS4A 2R7XA 3HFZB 4P71A 1HNIA 3BKUA 3SBMA 2G1HA 2HVDA 1U0SA 2DYAA 4V1Ak 4GKJF 2U2FA 3T3FA 2CQ3A 3UN2A 3FSIA 5FLXU 3FZ2A 2V4RA 4U8YA 2QYCA 1FJGJ 2V2VA 2Z0GA 2EFOA 4ZVEA 5RUBA 5HL7Q 3DRRA 1S6PB 1N32J 3I87A 4IH6A 4NMLA 2GIRA 3R5CA 3M8QA 1HWLA 4B3OA 3GIKA 3RBZA 1MROB 5I3QA 3VAGA 5KFBA 1N56A 4RNHA 3TZYA 1UVIA 4WYWA 4ELTA 4M94A 3CPWR 1KOHA 4ZP8A 4B3RJ 1T02A 2RNEA 2D7SA 2QT7A 1NPKA 3QJJA 2KZMA 5L8RC 3VAKA 2N7YA 4ZLPA 1QTMA 1KNZA 2W8KA 3KK2A 4X4PA 3H8YA 4A8KA 1T9UA 4X2BA 2MZTA 4ZIVA 4AD6A 2WVCA 3DDNA 3KLHA 2DH9A 3CJ5A 1BMQB 3V4IB 4GO7X 3U7JA 3DCAA 2ATCB 3GP9A 3ETMA 1EKSA 5A8WA 3CB4A 1JXVA 1TU0B 2M0GB 3E3XA 2YKQA 2FVCA 4URGA 1Q95G 2OPQB 2MJNA 1BY9A 1M5HA 2CPJA 5HATA 4ED1A 2XS5A 2PMWA 2W2PP 4ES1A 4L73A 2XC9A 3TVYA 4XO0A 2B8PA 3SSRA 2JSXA 2LEPA 3MM6B 4B3TF 2VODA 7FD1A 1ZBTA 5ITHA 3T9NA 4DQPA 4WFBQ 1KOOA 1RE1B 4RR5A 1YSJA 3FVYA 3DLEB 4PR6A 2EFNA 4CTAB 3MAAB 5LSRA 4ECRA 1GXLA 5HVFA 3CCQS 5EWEA 4QWEA 4G1QA 4ECTA 3ZTQA 1GEHA 2O1PA 4ZJQA 1NB7A 3MURP 3P96A 2Y8YA 3LALA 3N4WA 2QE5A 1U24A 5A2QY 2AJ4A 3PEJA 2XHCA 5DLGA 2R8KA 4H4KA 4USIA 4WPAA 2HFVA 3L7OA 4O44A 2CPIA 1IKVA 1S4EA 1UZDA 2VC0A 3DOMB 5LMNF 4QYZK 4JI2J 1CQNA 2CQIA 3V4MA 2OEMA 3ZZ0A 3M9OB 3AA9A 2ZUAA 3T19A 4OJGA 2VQFJ 1H74A 4IRCA 4DPYA 2H4WB 4EGLA 4EU0A 5HMWA 2RKIA 2Z2YB 2VJVA 3UFCX 3D1HA 1VBKA 5L9XA 3KG1A 2VB6A 3I0SA 2Z2LA 5J2PB 2EW0A 1YJVA 1GMWD 1URRA 3M05A 3KJFB 3BPDA 2A6MA 4H4OA 1XNRF 5DDQC 4ED5A 3N0VA 4ANDA 2XZWA 2ILYA 3DLBA 5ETKA 3M8PA 3DRPB 4N8NA 2UUAJ 4EMDA 4BCAA 3J81U 3MPVA 1WG1A 4ZPDA 2B8QA 2W24A 2PMZD 3L7UA 2HHXA 4DL5A 2DXDA 2I1RA 5CZVA 2GMLA 2YXLA 2L08A 2GQQA 4GKKJ 4X64F 3TANA 3THPA 2H5IB 2J6SA 2RILA 3MMCA 4HHJA 1RTJB 3QJPA 2GIQA 3G86A 2ACYA 2VFSA 5IC6B 1R27B 2C3YA 2BZ2A 3UCZP 1TAUA 4NA3A 5KT6A 1OY9A 1YVFA 4DPOA 4NI2B 1K1SA 3QGGA 4I6AA 3HXMA 1JWWA 2JVRA 1T0TV 1AROP 3T41A 3UDLA 2DTJA 4ZVHA 3TJAA 3MPYA 4LFCJ 5CYQA 4Z7YA 3M32A 2FYXA 1B0VA 2X3DA 2FHKA 2E1RA 2MQ8A 4CH1A 4A8MP 3VGSA 1RT4B 5KFFA 5HROB 2OUGA 2C3UA 5KTQA 4LIWA 2W9CA 3LAMA 2XY7A 5IXUA 1LWCA 2ASLA 2OMOA 2XSFA 1EQMA 3BN4A 5L1KA 4EK2A 1YK9A 2X1GA 1P1LA 2DGTA 3ILJA 1WDTA 1CJTB 1IJFB 2F4VJ 1S1VB 3S6EA 5L39A 2XI2A 2DHGA 1FXRA 4QPTA 1IJEB 3E8OA 5IWAF 3UN3A 3UDEA 2PE8A 3CF5Q 4ECXA 3B54A 1S59A 1OSCA 2ZEJA 2QMWA 2BXJA 1WOPA 3I6PA 1XK8A 1VS3A 2KVQE 4S0MA 4IO9Q 4LFAF 3DU6A 5HLFB 2Q1LA 3BZQA 1RWWB 2VFTA 1CS4B 1XMBA 1HW8A 3ONQA 4F4XA 3BS9A 3JYTB 1EP4B 5A8KB 2FUG9 1HYSA 3PR4A 4DL3A 2HVEA 4JV5J 1N5QA 2GQ2A 2AF6A 2OSQA 1PJ5A 3R1HA 4ER8A 3NGKA 4J91A 2BJ7A 3K17A 5AXLA 3MPUB 1ZH5A 4DPUA 1Y9OA 1FKPA 1QE1A 3QSYB 5HN0A 3JSMA 4DFMA 3AH6A 4RBTA 1RA7A 4DR3F 1EZZB 1WDDA 2IHR1 3LANA 1JJ2R 1VC6A 3CCTA 1FTRA 4KV8B 3PNIA 4DSLA 4DOZA 4JV0A 1R0CB 2YNFB 5KFOA 4X4UA 1A0OB 2K8GA 3SV4A 3NAHA 1EX8A 1D9AA 4OYMA 2QYGA 3UPFA 1PYOB 1Q5VA 3ILLA 1DHMA 2CVIA 3S7RA 1T94A 3DLEA 5D15A 3MAAA 4ZCLA 4NYPA 4B9TA 4DF4A 1NZAA 4RW7B 5SZTA 3EVOA 2W9BA 4CI0B 2XMVA 3IO1A 3EM1A 3T5HA 1C0UB 2C3OA 1YRXA 2RB7A 3MR5A 3M9MB 2FVPA 2LCWA 2NYHA 1U26A 2BJDA 3WX4A 2E5IA 3FFIB 5KFYA 1JLQB 1QSLA 1I51B 4U7UK 1BUXA 1SQFA 2AYMA 3DLHA 3UD5A 4W90B 3G71S 5E0OA 4IRKA 3JQMA 5J1EA 2KTQA 2UXCF 1VQSA 2LA6A 3MM9B 1RAAB 3ILOA 2CPZA 3MHYA 3R3TA 4MKAA 1RHRB 3NS6A 2E5LJ 4GKJJ 3W63A 1S48A 3SCLE 3RBDA 4HHHA 3TAPA 1I1GA 4NLTA 4LIRA 5KOXA 3IA0A 2R7UA 1CJUA 3J80Y 1IXKA 3QZ7A 1WD6A 2QFJA 3BYRA 5FLXY 2DCUB 1REVA 1WEZA 3CJQA 1V9OA 2C28A 1R8PA 4ANCA 2P6TA 4AYBD 4X4RA 2KZZA 1Y5LB 4PWDB 2M8HA 5ETVA 3VCDA 1GK8A 1FFSB 1JXLA 2CQHA 1YRTA 2LECA 1EHWA 1U1NA 2YNGB 4MKBA 2ZNYA 3WC2A 3TEHB 2VPZB 2KHDA 4Y6IA 1K0VA 4EEYA 3FNNA 1FKOA 2Y0SD 2GAGC 4DR2J 2MSSA 2XMKA 3PX0A 2CAJA 2X1BA 4KJIA 2IAJB 4KQZA 1HBNA 3AJ1A 3ENWA 3HPOA 5JJBA 4O3QA 2LVWA 4O4RA 2GNKA 4NA1A 4MJKA 3HVTA 1YHQS 4J90A 1P1TA 4HACB 2KFNA 3L7PA 3WZ0A 3SQGA 2LEBA 4B3TJ 2Y1LB 4MK7A 2IM1A 2R8HA 4EO8A 4IOCQ 4F2SA 4C8ZA 3IM8A 4RNNA 1X9MA 1FXLA 2OSRA 3NS5A 2ZH8A 2ZBRA 4OYIA 1DFDA 2B43A 4KYZA 1CQMA 1TL7A 1L3UA 2Q6CA 5HROA 2E66A 1S99A 4DL0C 4X62F 3CD0A 4M5DB 1P9QC 2BJ8A 4CLKA 4USJC 4Y3CA 1HI8A 1YRUA 5M2PA 3RAMA 3W60A 1TAQA 3GIJA 4USHA 1RTIB 2HFZA 2PSZA 4UOCA 1CJTA 4CDIA 2R42A 1UPPA 3RBXA 2KYXA 5AE1A 2FJDB 3IAS9 2AWZA 3ET6A 4F2RA 4KO0B 1VIOA 2WSEC 1KQKA 1WHWA 4O3NA 5LMNJ 2I38A 2HMIB 2R7RA 2E44A 1ICEB 3CVKA 1SH0A 1A7GE 1X4FA 4QR0A 2VPWB 3BV8A 2OPSB 5HLFA 3PZPA 3CJKB 1OPIA 3JYTA 3BH6B 1G4CA 2FLNA 1EP4A 1ZAXA 3QNWB 3DRXA 1VRTB 2MZJA 3HULA 1G6BA 2JLGA 2K3KA 3AJ2A 1TUVA 4P7TA 4LQ3A 1BQNA 4EZ9A 4XK8C 2NSBA 1X31C 1XNRJ 2V5HG 3NBPA 2RQKA 5KT3A 4RKUC 4UT4A 5ETLA 4RW4B 3G8QA 2AQ4A 3DC2A 4JI3F 2BRLA 2PI4A 4F8RA 3JQJA 3PJWA 2JEGA 5C42A 3Q23A 2EWHA 1NSQA 1PAUB 2G1DA 3DGPB 3EVMA 3JTOA 3J81Y 4ED3A 3HSGA 4X64J 1HD1A 2J0WA 1FRMA 4XIUA 2DEJA 4FYWB 2D3ZA 3HI9A 1C2PA 3I5AA 4EFAC 5EX3A 2MJUA 2L48A 2P9CA 2M2BA 2MDAA 1RWVB 4Q45A 3NOGA 2XWXA 4IH5A 3ULHA 4WKRA 3GWCA 4ETXA 1XC9A 4DUYF 5C24B 2J5AA 4IUFA 5HMYA 2BM1A 4OI1A 3VAJA 1AFJA 2KHCA 3CCRS 4BHQA 1RTDB 3FFIA 3LP2A 3M4XA 1UEVA 2QSWA 2H54B 2FHJA 3TNVA 1R3NA 4QPXA 1HNWJ 1TELA 2H1YA 5CXTA 4Q8EA 1MU2B 3MM9A 4AL6A 2HURA 1CULA 3EPGA 1WTBA 3R7NB 2J7UA 4ZPWR 4CLSA 1SKSA 1M1KT 1UZHA 1IN0A 2R2UA 1X4AA 3QO9A 4OI0A 4Y00A 4Y2CA 4C3LA 1R0AB 1NK8A 1REGX 4DL2A 2W2QP 2V4QA 2IRXA 3BSNA 2KB2A 1K47A 4C7QA 5GMKa 5IWAJ 3J7Z5 2DBBA 3Q8YA 1F0XA 4PWDA 3PIPQ 4N56A 3QBCA 5I42B 1QD1A 1GMVA 1CJVA 2DNHA 2YNGA 2CWXA 4ED2A 1GQEA 3IWXA 3TVZA 3IBWA 2HQCA 4C0OC 3C15A 3J7AN 3F73A 1SC4B 3Q24A 2V2QA 1Q79A 2PO4A 3I56S 4DG1B 2GAHC 4ZOSA 1BWEA 1O0PA 4UTGA 3EWGA 5A8RB 4BBYA 4X84A 4DR3J 1HMVB 4OZ3A 1NDPA 3SZ2A 4ED7A 4IQMA 3PVXA 2AGOA 3HHLB 2CG4A 2F8HA 3BO4A 5M2UA 1JJCB 2WBRA 4FXDA 3MFIA 2PI5A 5LXYA 2WTFA 3PIOQ 1FA0A 3PG9A 1RHJB 3PW7A 2ABYA 3R5GA 1VK8A 1BHNA 2CZ4A 4LFBF 5JVGQ 3KLIB 1NSAA 3L95X 4YQWA 2Y1IA 2RS8A 4ZDNA 3SIPB 4I7FB 3UVJB 3G6VA 5B0AA 2P6SA 1VISA 5AJ3J 1DRZA 5B08A 5CCLA 1Y0HA 3MCMA 1Q8LA 3OUYB 2ZVIA 4R25A 1NKCA 2HZVA 2XLIA 5D4OA 1TP7A 2CVEA 2LQJA 3LPYA 1NHKL 2DH7A 3BQ1A 1DARA 4KO0A 2ZOFA 5B7WA 2HQDA 2E9RX 3SFGA 1K1QA 2IMOA 2UXCJ 2F8EX 4AXJA 4DN0A 2QRRA 1H98A 2DNQA 5HANA 8AT1B 2CIMA 4HLBA 2V8PA 2OPSA 4IG3A 1YI2S 5AXNA 1J27A 1SB6A 4FZVA 1BWVA 4DSIA 5E3PA 1S9EB 1B64A 1P27B 2FJBB 5F9NA 3GJQB 4OI3A 1H2UX 2KU7A 2N7CA 4WBFA 2FJXA 3HZEA 4OHZA 4DZDA 3IXQA 3FQKA 2MLZA 2XMAA 1S1XA 4RW4A 3CCWA 2OGUA 5DS7A 2GVDA 2ZHAA 2YKNA 3VTIA 2XMJA 4C98A 1OWXA 3G82A 5EWFA 4F67A 5H1SV 1Y7PA 3CCVS 2R2TA 3ENQA 1RAEB 1SJ1A 2RIJA 2RDDA 3RW7A 2M3DA 5BXIA 2QA2A 2C1EB 2DEIA 5DQGA 1I94F 2X51A 3HK2A 4A46A 1GMWA 4PAAA 5C24A 1N6QA 1TUGB 2VBXA 3GCWP 4QYZJ 4F0HA 2OP5A 1FCAA 2PEBA 4UY85 4NLRA 2BANA 2UUWA 5T14A 2NQPA 3FC9A 4JI4F 3G9CA 2E7XA 2K06A 4DSKA 1XR6A 2F4FA 3V5RA 2E1AA 1HBMA 2KYZA 3UWTA 2J0XA 3CCLS 1DTQB 2PDAA 5F0WA 3D7SB 4X62J 2Y3YA 4C8MA 3M8YA 2YTCA 2GO8A 2M8DB 1I6JA 4WFXA 4OZ2A 3RGIA 1R0AA 1SQEA 1UVKA 1HQUA 3D54A 4NEZA 4RUHA 3T6BA 4O0IA 1NJXA 2IIHA 3AA8A 1WHVA 2DPIA 1OO0B 4DR1J 2OPRA 1NPRA 3KLVA 2C2DA 3Q86A 1UFKA 2B6AA 5KFZA 2CNLB 4CLWA 1YJRA 2DR7A 1FRXA 4IOAQ 4KT0C 2V6AA 1U2CA 4Y34A 2HLUA 5GMDA 3RR7A 1QAYA 1PCAA 2V50A 3H5YA 3J7ZT 2NXUA 2AX0A 2AW0A 2OKQA 3I5CA 3DOKB 5CYMA 4MIWA 3MEDA 2W2MP 3GFYA 2HHPA 3K8VA 4F04B 5DDOC 3BR8A 1OIAA 4DG1A 2OEKA 4QIWD 1VQYA 1DZ5A 4CO2A 2WW8A 2J7WA 1Q81T 1RDRA 4O23A 3EDQB 2O5DA 2L9DA 4QR1A 4PYDA 1Q8BA 4ELVA 2YKOA 1HBUA 2JVOA 4JI6F 2IDEA 1RT5B 4R0EA 1CPZA 2HFUA 4U9RA 2XQCA 3ISND 1PYSB 4PG4A 3Q8SB 2AX1A 2Y0BB 3KK1A 3BBCA 3GLJA 1HL6A 4UUWA 2L9NA 1WJ9A 3PCOB 2KXFA 1C0TB 3CDEA 4YN3B 4FS2A 5U47A 3KLIA 4CO4A 3V6DB 3OL7A 4DUYJ 4PKDB 4PQUB 4LVNP 2DGUA 4RWWA 3DXSX 3M7VA 4G1IA 3UNYA 4KGKA 4X4NA 2EVZA 1FRJA 5IOLA 2CADA 2MLYA 3MECB 4ZS6A 2DHHA 4IFYB 4HTIA 1IM4A 1NPPA 3MMAA 1SKRA 2NXEA 3M30A 1SC1B 5KFAA 2LEAA 1S1TB 1JNRB 1X0FA 3VGTA 4YOEA 1KTQA 2IYIA 1H7XA 2RF2A 4A8FA 3VAMA 4EI2A 3I31A 1JX4A 1NDCA 4YDDB 2GHPA 2BJ1A 1SVDA 2XSJB 1A9NB 4CT9A 2COLA 2XYPB 3SCIE 5D3GB 2QV6A 3OL8A 3GILA 4F4AA 3K8WA 3QFWA 5HK4A 3D9BA 2XNRA 3C19A 3K89A 5DG9A 4NLUA 4KHRA 4ECWA 4JI7F 3W3SA 2FLLA 5EX0A 5J2NB 3CNQP 2N4DA 1R31A 3FCVA 2VQEF 2HK3A 4GRSA 1E6YB 2J0SD 4LJMA 2YWEA 4IYQA 5E5NA 3QGHA 1CVJA 1L3SA 1AZSA 1F3VA 4KE5A 1RCXB 3H98A 3OXGA 4J9NA 2HNDB 4ECZA 1WC4A 4A8XA 2ZBIA 1IQTA 3Q0AA 2C2KB 1EIYB 3S01A 2O01C 4I64A 2CJAA 2DNKA 4OI4A 4C8LA 3K5OA 1HQEA 1V3RA 3SCKE 3VR1A 1AB8A 5KFXA 2ZZTA 4ES3A 3C66A 4HDGA 2J6TA 3N5BA 2Z30B 3PX6A 2CWKA 3KG0A 3C46A 4TYAA 3IWNC 1HKAA 1LEOA 1X4HA 3R2DJ 1PBUA 4FPIA 2IMWP 2UU9J 1DTQA 3RRGA 3BDEA 3OTBA 1HR0F 3HHDA 2AP6A 3TOQA 2AEJA 4LFBJ 4UY8T 4DV0F 1Q1KA 4WTYA 3GG0A 3G6XA 4GC6A 2NS1B 1HLWA 2EFPA 5G4DA 2JFKA 4K4WA 2RS2A 3I9ZA 4A8WA 4RBUA 4JI0F 3WHIA 3VHQA 3NCRA 1Z4UA 2DNZA 1IBKJ 3DDKA 5KFEA 1KONA 2VONA 1WG4A 1NU4A 5CABA 1MW7A 4B08A 2DD8S 2HRXA 1IR2A 2X1FA 4OL8A 5BR8J 3E01B 3I4PA 3DI6B 2CQ0A 3LTOA 4ID5B 3LWLA 3OFFA 3SV3A 1FKAF 4JB8B 3TUIC 3KTQA 2AJ1A 3CD7A 5KG4A 4ECSA 3A8EA 1HWJA 3FSYA 3TUPA 5F3TA 3WIUA 1KD1T 4RU2A 1M1GA 3MI7X 2K3IA 4RZRA 4JV1A 2XLKA 3W2VB 2GMHA 3CIZA 4QYRA 1HNZF 1RBAA 1T11A 2ZKTA 4PWUA 1NK4A 3KOAA 3G8SA 4D3HA 4P74A 4WP3A 1R8CA 4KGVB 2XWYA 2QEXS 3DMJB 1SI9A 3MAQA 3MR7A 3C6TB 3OR2B 4CH0S 2E5HA 1I94J 3LPEA 5CD4H 3I0RB 2NXCA 2PN6A 1BQMB 3LQVA 3R8YA 4RNFA 4RW6A 4DPWA 4KHPJ 4CYUB 4PQUA 3RAXA 3OL6A 1YBTA 1FDNA 1GT8A 3POTA 3QLHB 2ZKUA 1FK9A 2HNZB 3HSJA 2CJXB 1NKBA 1YDLA 1EETB 2E7WA 5F8LA 3HMJG 4DV2F 3B4DA 1TK0A 4JI4J 4NZ0A 2ZH4A 3K59A 2KKHA 1UMJA 1JLEA 4CLFA 3KUGA 4UQGA 1S4FA 4RNOA 1YJ9S 4DFKA 5KG0A 4PRFA 4V19X 4V19J 1VLYA 1FTCA 4Y2KA 1T03B 2OH2A 2NUUG 1W2BR 2VA3A 4F26A 5A76A 3D2WA 1B70B 2FTRA 2BRKA 3SDEA 2YVSA 1RADB 2YKMA 4Q2MA 3H90A 2G2ZA 1OMSA 5HP1A 3VAHA 2HQIA 2MY8A 4MK9A 4DN9A 2OTLS 3UCUP 3M2UB 2FVRA 3HT3A 5EUHA 3CMQA 4ED6A 5J2NA 1ROFA 4DL7A 3MEKA 2B56A 2W4DA 1FRLA 5DZ6A 4HVZA 2VG5A 3M6UA 2HGNA 1CJKB 1WC3A 5KFGA 4ZPBA 6FDRA 5LOQA 2HNDA 3P3DA 1F60B 3Q2TC 3DYAB 3CJSA 4TY8B 1KP6A 4CLYA 4WK1A 1XMQF 3HCXA 1TL1A 5IM0B 2V8DA 4QWCA 3PO5A 1RLCL 3CJTA 2J9EA 4JI6J 1BD6A 4PUOA 1F1BB 3LO3A 3PYGA 4OZLA 2W8LA 3PDNA 1QM9A 3KLEA 2YPYA 5E3CA 1UJ6A 2EPIA 3RR8A 3ADAC 1Q7YT 2V8GA 1U4BA 2C2EA 4FXWA 2GW8A 4M1KA 1LWFA 1M0SA 2KRRA 3EZUA 5AE3A 2KFZA 4J37A 1NHUA 2D9OA 2O67A 2F65A 4OI6A 4LR9A 1SKWA 3CJ0A 3KK3B 3KFWX 1RT6A 5HI7A 1BLUA 4KTQA 2YWKA 4K2XA 5F8NA 2PA3A 3SI8A 5D6GA 3AFGA 1VRUB 4UZCA 5ETQA 3NGDA 3JQKA 5A0YB 2LQ5A 3W2WA 1FO1A 3ZNJ1 3OV7A 3E01A 5FDLB 3R5DA 2VDIA 2C42A 4ED8A 4RJVA 3X1LB 4DCPB 4ID5A 1U1QA 1RABB 5ETSA 1RA6A 3A12A 1N5YB 2FVSA 1MLAA 3MCNA 5B0DA 2MLXA 2I8EA 2ROGA 1ZA1B 3UNGC 2DGQA 2CRLA 1RHUB 2D9PA 2ZBCA 3MMBA 5I3UB 3ZZZA 3RB4A 2C22A 4P75A 4UUXA 1GXTA 2A3JA 3GYNA 4LRFA 3TJ9A 1OPZA 2FDNA 4M63A 1VMBA 2C3MA 1DQAA 3QAUA 4DQIA 2GO9A 1RT3B 5MAOA 4QWBA 5B0FA 4LSZB 5KT7A 4JI7J 1NDLA 2CJBA 2G0IA 4QIFA 3D28A 4NMXA 2O3DA 4MFBB 4KC5A 2VQEJ 4B17A 3HSDA 3N28A 4XPEA 2BE9B 3DMJA 5LJ5Y 4X4OA 5D0RA 1YG0A 4NXNF 1NK6A 4QIGA 3QT7A 4OV1A 1FE0A 3I0RA 1V3ZA 4R0JA 2HKEA 1C1BB 4QIVA 3OTCA 4CYUA 3BSAA 2ZD1A 4PQAA 2HNZA 4LMZA 2X3GA 2DO4A 2E1MC 4CNYA 4X4QA 1R8AA 3MM5A 2HHHJ 3DOLB 2G2YA 1EQ0A 3AQPA 2W4CA 3OSNA 2HBQB 2PEHA 1AUDA 5KFIA 3CT9A 4FF1A 1NMEB 4NCBA 2VFRA 3TWZA 3V6HA 2IA6A 4B9VA 2YNHA 4F02A 4CO5A 4J9MA 4LQ9A 4NLSA 4HYKA 1HWUA 1HR0J 1NKEA 3KNGA 3DHWC 1FRKA 1JLBB 1PJ7A 3Q8UA 3THVA 3TR5A 4DV0J 4NLGA 1WUUA 3KKFA 4K2JA 2OFGX 3WBZA 1T03A 2KXNB 2HLTA 2JLEA 2YKPA 5GMEA 3GB0A 1R7IA 1RWUA 1WC5A 3VVUA 2CPEA 1HNXF 1B0PA 4YFUA 4K50A 2X1AA 1ZPVA 3DRRB 1ZETA 3M8QB 4B3OB 4TN2A 2ALZA 3M2UA 2XMMA 5HSPA 1KKHA 3MM7B 4CO0A 2RDIA 3NOCA 2VJUA 2HS0A 3KLGA 1P8GA 3R1LA 4IDKB 3D6MB 3DRYA 1RKIA 2CPXA 2J9CA 2EK1A 2LU1A 4P52A 2B7BB 1SH2A 3UD3P 4P2FA 2R7WA 2GQCA 2DNYA 5HMXA 4K4VA 5BJRA 2WB4A 2XGQA 1XBWA 1URNA 4K7QA 3KLHB 4RW8A 1LXNA 2HVIA 3PRVA 5A8WB 5IM0A 1RT2A 4J9LA 1YLXA 5KFCA 4ZVOB 1HNZJ 2VIHA 5LXRA 2VH7A 4ZP7A 4DCJB 3MF5A 3PXGa 3H2VE 1LNQA 2ASJA 3R97A 3F0NA 5T41A 2GGPA 3ITHB 1TKTA 4ZVRB 1WHYA 2F9JA 2DNPA 3EICA 4ZVPB 3BDPA 2HHWA 3A1YG 4J9VA 3TARA 4F4YA 1RT7A 1L3VA 4YHHF 2VPXB 4KH1B 4WIIA 4ZP9A 3HHLC 4FNIA 2AZ3A 4WKYA 2YX1A 3RZAA 4JYAF 3BM7A 4ZN1A 4DUZJ 1HWIA 3EDRB 4UW2A 1YGYA 3HJVA 3K5PA 1X60A 4LF9F 3R7BB 1DQ9A 3TA2A 3HP6A 5A6PA 1FXDA 4TU9A 4J9PA 2ROPA 4G1QB 3JSRA 3GV8B 2GVZA 2I9SA 1U0HA 2HHUA 4ZVGA 1MMLA 2QA4G 4ILLA 3U1NA 4JP8A 2RRBA 3OD2A 2FGCA 2BJ9A 4O44B 3RJMB 2ZHOA 4B9NA 2BBEA 4X4TA 1U8SA 1UEKA 4IR9A 1N5YA 2E5JA 1F6TA 3IMQJ 5KFQA 2OD6A 5LMUF 2POKA 1HHSA 4J5OA 2RKIB 2MY7A 3T1HF 1VQ4S 3OW2R 3WDOA 3PW0A 2DGVA 4KR0B 3NGTA 2HGLA 1NH8A 3I0SB 2LQ8A 4WF9Q 4B3SF 3JXOA 3BBFA 3HD2A 3BEGB 3GE9A 4C48A 3BQ0A 2EFGA 3MEGA 3UO0A 3HZGA 1WOSA 2OPPA 4N47A 1RISA 1HWKA 5D0EA 1S1UA 3DRSB 2ERRA 5KFJA 5F8IA 2EW9A 1KFSA 3TQ1A 2AMCB 3P8BB 4RU9A 5H9FK 2RVJA 1XN9A 1JLCB 1R6VA 1PJ6A 5K8MA 3W5YA 3IGVA 1C1BA 2JLFA 4K4ZA 3P5BP 5D4PA 1XMQJ 4ECVA 2ZITA 2GC8A 1OYDA 4IG0A 2N3LA 1Z2ZA 1RAGB 4YEAA 3NKYA 4I67A 2JDJA 4NCGA 4DL6A 5D78A 4PG8A 2YNIA 5D77A 4ITSA 5DQHA 2R8IA 2DNRA 3TZXA 4ZK7M 3QMQA 4DV5F 2C2OB 2GIFA 1KQFB 4YB1P 4PPDA 3BQ2A 3AJDA 2F9DA 4M5LA 4FYVB 1JLBA 1NCLA 3DM2B 5CYQB 4X65F 4CP5A 3HVRA 4NYZA 1H72C 4CM2A 3NCPA 2JH3A 3LP0A 3J80U 3EGZA 1X5TA 2ZH7A 5HAOA 2F40A 4X4SA 2V9KA 3RBEA 2FY1A 4B02A 3CUNA 2W9CB 4O3OA 2V34A 3M8SA 3U27A 1LWCB 1SQGA 1U1RA 3BGLA 3L09A 3H2LA 2WSFC 3T9ZA 3T5JA 1N34F 5GAEI 3US5A 3AOCA 3KJNB 2Z56B 3H59A 3MM7A 3CJ2A 4I69A 1Y10A 3IR5B 3M2VB 3C6UA 5DETA 5KFVA 2OI2A 4IDKA 4DX8H 2IRYA 5B0CA 4HH1A 3KHRA 4GMKA 4MTPA 4P2XA 4WFAQ 3MM8A 1SC3B 1BXNA 2QSFA 1F5CA 5L1JA 1SBRA 4GC7A 2R7VA 3PW5A 3CJ3A 3FUYA 5JVHQ 3D0IE 1SKUB 2HHTA 5DGBA 4FYDA 4TU8A 5FJ4A 1HYSB 2W7AA 5ETMA 4ZP6A 2V94A 4DPXA 2GS8A 1NDKA 1GFWB 4WZMA 2C3PA 1ZS6A 2DITA 2RH3A 4R8UB 2OD4A 4LVOP 2NPFA 4CO3A 3U02A 1FKPB 1QE1B 4DR4F 2WOMA 3ITHA 3JSMB 2BKPA 3M1VA 3U1MA 2W7PA 5DG7A 3G2XA 5IV4A 4LSNA 3R9LA 5H9EJ 4NXNJ 3NXZA 3FBEA 5F0UA 3GYXB 3TUZC 1YJNS 3VAFA 4W92B 5GAHU 1FFWB 3JSYA 2D1CA 5ETOA 1J5OB 1RYRA 1TMMA 2JWNA 2CQBA 2ZFHA 2QLXA 2ZE2A 3LF0A 4OX9F 3PHEA 4HH0A 2W9BB 1YKWA 1Y4ZB 3OLBA 5HBMA 1K8AT 2HZAA 2H48B 2SXLA 3C14A 4PXDA 3K2YA 5G0RA 1UCNA 2AD9A 2RAQA 4PZVA 4WK3A 2RRAA 1HA1A 4NXMF 3V6KA 2UUCF 2MZQA 3KLFA 1IBMJ 3QGIA 1AUSL 4AQYF 2LKZA 4DU8A 1J2VA 1IWGA 4LF7F 4O3PA 2WZ1A 2APOA 2FJEB 1CG2A 1FF2A 1ZTWA 5J1EB 4UF4A 3K0JA 2R4FA 3D6HB 2C2ZB 1PC4A 3W9HA 2M7SA 1W7WA 1HNXJ 2M5YA 2NSCA 4ZVTB 1UVNA 1CJUB 2BQ3A 3TX0A 3OTEA 2D41A 5K14A 4QW9A 2K2PA 2BKNA 2PFFB 2HS3A 2XZDB 2HNYA 3CGIA 2Z2MA 1REVB 1F5AA 5IT4A 5GVQA 1R8BA 1U6FA 3TZWA 1OY8A 1RT1B 5CH7B 5IZHA 1SL1A 2GJFA 3VQSA 3PR5B 3DRSA 4Z2XA 3CDAA 2AYBA 2G0JA 1FT8A 1FD2A 1LFWA 5DG8A 5KT5A 4JI5F 4XPCA 2GCFA 1JLCA 1JMTA 1T9WA 5KG3A 1FKOB 4B9LA 4FF4A 2W1BA 4KBIA 4ZJLA 1VHIA 2BVZA 3FGVA 2LXFA 3KDNA 2XTJP 2HWTA 1FEEA 1WC1A 1HBNB 1CC7A 2CUYA 9ATCB 5KG1A 1U47A 3H40A 1DQ8A 3GCXP 1QVFR 2ZDOA 4NOHA 2RMLA 2QC3A 2LMIA 3MEEB 2VG7B 2HWIA 3HVTB 1NLKL 3M2RB 3SQGB 2KDOA 4YHHJ 4FBTA 5K8OA 1M5PC 5KFPA 4LF4F 3L3CA 4OZ1A 5IV3A 3DM2A 2J0QD 2ZWOA 1NNDA 1RAHB 5GAGU 3AXKA 1WSVA 5F41A 4XAKA 4FS1A 1TL7B 3QT8A 2DR9A 3GONA 2VZ9A 2B4PA 1LWEB 2BX6A 1JLFB 3MWBA 4PWWA 2R7QA 5J1NA 1KVKA 1RWXB 5JMNA 3CJ4A 3N79A 1RWOB 2A2DA 1NJIT 1T9XA 3PTWA 1K73T 2JZ5A 4DV6F 1FESA 4MKVA 2UUBF 3BYPA 3ET6B 3M2VA 2B5JA 2MQPA 2E29A 5E33A 3NWRA 2EG1A 2B3TB 2C2MB 1YJWS 3IR7B 2WVBA 1NRKA 2AYEA 2XBPA 4OX8A 2H4YB 5LMUJ 2E5GA 4N77A 2ZH3A 4QZVB 2HAIA 2DGWA 2R8JA 2XM3A 3T1HJ 2GJ2A 1X0PA 4DHVA 4F4KA 4NLOA 1SXLA 3CXCR 1KLMB 4J9RA 1Q53A 4B3SJ 5IQ6A 1BQNB 4R8UA 1ZPWX 2HHSA 3NBPB 3F56A 2PGCA 2KI2A 1IBLJ 3HT0A 1WF2A 1RAIB 3P45B 5D0GA 1EKRA 2VICA 1KVJA 5C42B 5KG6A 3IRXB 2Y1JA 1WTFA 3R27A 3I5BA 3OVBA 1J5OA 2I0XA 1K44A 4OIXA 2XY6A 1QUVA 4H4MA 2BR0A 2DIVA 2IY5B 2KO1A 2JC1A 2MZRA 3IAM9 1KLNA 2YWHA 2DB1A 1UTAA 3ISZA 2HBRB 5EHHA 2DXEA 4GVLA 4MT1A 3OBIA 4H54A 5L1LA 4Y65A 1RB0A 4ZCMA 5BYSA 1X4DA 3FEXB 1KFDA 4LR7A 3AT1B 5K8NA 2XG8A 3T1AA 1FERA 1UA0A 1S9GA 2DHSA 4O3RA 5KFKA 4FVCA 3HVAA 3AY0A 1UPMB 2BEFA 3MMJA 3MOZA 2RRNA 3MD1A 3OL9A 3FCHA 5KFWA 3LP2B 1SH3A 3WIVA 4DV5J 2RJZA 4C3MA 3UN5A 4DJBA 4PCQA 2L3MA 4OHWA 3I32A 1FDBA 5I4MA 1WKJA 4JOUA 4X65J 1NXIA 4EBEA 1X9WA 3NLCA 3OT9A 2UVVA 3KHLA 2A0FB 5LT5A 1CULB 2GZOA 3L9ZA 2Z57B 2RU9A 4K59A 4YB6A 3W7BA 1BQXA 3AB4B 4K5RA 3C16A 3QO9B 1HI0P 2G0CA 4KGXB 1VJQA
chains in the Genus database with same CATH topology
2MUIA 2HAFA 2GZOA 2GS5A 2EW0A 2DO8A 2HRXA 2AJ2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MUI A;  2HAF A;  2GZO A;  2GS5 A;  2EW0 A;  2DO8 A;  2HRX A;  2AJ2 A; 
#chains in the Genus database with same CATH topology
 2AJ0 A;  4OZ5 A;  3FBB A;  4F0M A;  3MPD A;  4BWM A;  2V0N A;  3ZTO A;  3GIR A;  2A10 A;  1WEY A;  1HAR A;  2VOP A;  2NPI A;  1RT1 A;  4LF5 F;  4ZLL A;  4ENO A;  3NCQ A;  3HJF A;  1N36 F;  2CPD A;  4DFJ A;  4IO1 A;  3GFZ A;  2NLW A;  1L3K A;  1DTT A;  1GTH A;  4DMZ A;  3MZI A;  2BAB A;  4J7C A;  4CQ1 A;  1CJV B;  1LV5 A;  3TVK A;  4PG5 A;  1WC0 A;  3QPI A;  4QJV A;  3UR0 A;  2QGF B;  2IVM A;  3C15 B;  4C0H A;  1NK5 A;  2J6U A;  3TA0 A;  3QJL A;  4CIO A;  3BGR A;  1F5B A;  2BOA A;  1SUQ A;  2PMH A;  1VQM S;  1NK9 A;  4LRE A;  4FBU A;  3MEE A;  2VG7 A;  4YP3 A;  4DR4 J;  2ZJQ Q;  3EUN A;  5DDR C;  4DV1 F;  2UXD F;  4FPR A;  1WKL A;  1DJ0 A;  1SL0 A;  4UST A;  3H20 A;  2NUH A;  3GII A;  2IJF A;  3FCW A;  3M2R A;  4YB7 A;  1S49 A;  4DUT A;  2LXU A;  1RAF B;  1H38 A;  3N01 A;  4I6Y A;  2YH1 A;  1HBO A;  4Y2M A;  1YZ7 A;  4HEA 9;  2AJF E;  1XEZ A;  3VZH A;  4P2S A;  3KHG A;  2MQL A;  3H5U A;  1S1W A;  2EEY A;  3GMG A;  2BA9 A;  5M2R A;  2BM0 A;  4F7V A;  1UET A;  2LP4 A;  2KFY A;  3LOU A;  1UWB B;  5LSO A;  2CQP A;  4M95 A;  1LWE A;  1N5T A;  1JLF A;  2MQQ A;  4ZIW A;  2GA7 A;  2W2N P;  4NXM J;  4BLG A;  3KUE A;  2UUC J;  3OFH A;  1FHT A;  3QAE A;  1RHM B;  3LWM A;  3IBC B;  3FRZ A;  3W66 A;  5F8M A;  3OVS A;  4AQY J;  1T05 B;  3PX4 A;  4LF7 J;  1DBD A;  2VFV A;  1JJH A;  1VQ7 S;  4Q0B B;  1RAC B;  4FKY A;  2X7I A;  3CCM S;  2B9E A;  4KPC A;  2VG6 B;  4NE9 C;  4USK A;  3GPA A;  1U1P A;  2MYF A;  3VAI A;  2AYG A;  1HNV B;  3TP2 A;  3CC4 S;  1U1K A;  1FFG B;  3PO4 A;  2V68 A;  3H5X A;  4OJ1 A;  4PEO A;  3RU0 A;  5CA5 A;  4IG3 B;  1S6Q A;  2ASD A;  1B3T A;  1QAI A;  1MSW D;  2J7K A;  1IR0 A;  2ZJP Q;  3KNA A;  4CLL A;  4ERD A;  3NMA A;  1TVR B;  4K4S A;  4ZVQ B;  3Q2S C;  3HHK A;  4NPO A;  2J8S A;  1KLM A;  1OY6 A;  2B4O A;  4G6V B;  4NLD A;  2WVD A;  3GJT B;  2WAQ D;  2QL7 B;  1RHK B;  1FWK A;  5IT0 A;  1J5E F;  1S1X B;  4K4U A;  2Y1R I;  3RTV A;  2FIU A;  1X4C A;  2GVD B;  2ZBP A;  2OIH A;  4KKO B;  1H7W A;  2YKN B;  4N41 A;  4U7U D;  1UW9 A;  3WQP A;  2XNQ A;  3G82 B;  2F63 A;  3SSQ A;  2F4V F;  3ILI A;  3IRX A;  1C4A A;  3DLK A;  4HI2 A;  4JUZ A;  4JI5 J;  2AJQ A;  3AOB A;  2AEF A;  2OFH X;  2IC3 B;  2M70 A;  4R5P A;  1C1C A;  2BMB A;  1KQS R;  3UD4 P;  3AOA A;  5ETN A;  3OJS A;  4M5H A;  2DXF A;  4WXO A;  1G1X A;  1UVJ A;  2ZHB A;  1N6Q B;  1S6O A;  4M5J A;  5SUH A;  1XR5 A;  3LUY A;  2XI3 A;  1X4G A;  4X4V A;  3KDO A;  5BYR A;  4CO1 A;  4DR7 F;  2WW4 A;  4QR2 A;  1NUE A;  1QY7 A;  4LF4 J;  2BAC A;  2HZC A;  2BAN B;  3Q22 A;  2EK6 A;  1M5V C;  3RW6 A;  2I5J B;  3M6V A;  3ETO A;  4C8K A;  3PW4 A;  1HBM B;  3FBF A;  2HIY A;  4KPY A;  2UVW A;  3T5L A;  3V81 A;  1YJU A;  1M5O C;  4CWB A;  1G2E A;  1GAO A;  1V6H A;  4UZB A;  3EGW B;  4OZN A;  2QMU B;  2W2O P;  4ZIT A;  1AW0 A;  4RLE A;  3ZZY A;  2HQF A;  1WWH A;  1HQU B;  3NRB A;  3J7Y U;  4FP9 A;  3D0G E;  3BKF A;  4DV6 J;  1HD0 A;  3ZZO A;  4HR2 A;  1U8W A;  2HSE B;  5H9F J;  4YME A;  2J76 E;  2UUB J;  2RSQ A;  2OO4 A;  2QLF B;  4CH7 A;  4K4Y A;  4NRU A;  3I55 S;  1RBO B;  1VR6 A;  1Q78 A;  2OPR B;  4L3N A;  4NLX A;  3NY0 A;  1W25 A;  2KRB A;  2ZDP A;  2QLJ B;  1E6V A;  1OYE A;  2UVR A;  1RXO B;  2V2K A;  2B6A B;  1SC6 A;  1FWL A;  2MB0 B;  4K8R A;  2QL5 B;  4LF1 A;  1S79 A;  4LFA J;  2R8G A;  1VCT A;  5AXM A;  3KYL A;  3DN9 A;  3B82 A;  1QLN A;  1LW2 B;  5CYM B;  1IKY A;  3IM9 A;  3MED B;  2B9Y A;  4QWA A;  5DM7 Q;  1UAW A;  1SL2 A;  1RWP B;  2RE1 A;  3K7R A;  3AOD A;  2HRU A;  5LSL A;  2E5L F;  1VLO A;  1EAY C;  4QCL A;  1UWA A;  3OHA A;  1KC8 T;  3GR0 A;  3QID A;  1SJ4 P;  2RQ4 A;  5C25 A;  1NAQ A;  2A6O A;  3GJS B;  2MZ1 A;  5J2Q B;  4FF3 A;  4CZC A;  3MR2 A;  1HBU B;  4IR1 A;  3R7S B;  4RWX A;  2Z4P A;  4YR0 A;  2P9E A;  3DLG B;  1NJZ A;  4CLU A;  5K8P A;  4RUC A;  3R6L B;  1S0N A;  2JEF A;  3P49 B;  3LH2 S;  3KK1 B;  3GFX A;  4IKA A;  5EGY A;  4DV4 F;  1KDN A;  1UWB A;  2PA8 D;  2Q66 A;  1AYE A;  1TUW A;  3EPI A;  2H51 B;  3SSS A;  4ES2 A;  3IRW P;  1IKX B;  3KJQ B;  4LBI A;  3OTO F;  1F9H A;  5KFM A;  4DPT A;  1IUJ A;  4NEY A;  3D1O A;  1S77 D;  4DR2 F;  3OLA A;  3D6T B;  2V9W A;  3U1L A;  3B4M A;  3EE3 A;  4DS5 A;  4GVB A;  4G1P A;  1T05 A;  1ZTT A;  2KJV A;  2YWF A;  4Q0B A;  3MMA B;  1V5I B;  2VG6 A;  4PYA A;  3M30 B;  4UOF A;  3ZTP A;  3MDF A;  3TEG A;  3KUH A;  4H4K C;  2ZH1 A;  1HNV A;  3D67 A;  3V2U C;  1PKU A;  1SJ3 P;  1LW0 A;  4KHM A;  5E2Q A;  1ZM3 A;  4DLG A;  3QYY A;  2DGX A;  4PPZ A;  4B9M A;  2RF2 B;  2BW7 A;  2JOQ A;  1TVR A;  5T7L B;  2JEI A;  1KWM A;  2HG4 A;  2QA1 A;  2G9O A;  1AT1 B;  2W7O A;  2OTJ S;  1MWQ A;  1T7P A;  3IC1 A;  4RW9 A;  2CDR B;  2K7K A;  1VI7 A;  2DGS A;  1APS A;  2ZWP A;  5K5M A;  1JXE A;  4CLT A;  3HD1 A;  1U45 A;  4LF5 J;  3LGM A;  2CPY A;  4RBV A;  1N36 J;  2IM0 A;  1RJJ A;  2VKZ G;  4KKO A;  2MQM A;  2CPF A;  4JV2 A;  1KBR A;  2L9W A;  2WON B;  1D8Y A;  4OX6 A;  2FZK B;  2VBY A;  1TK5 A;  1B99 A;  1BC6 A;  2E7V A;  3RAQ A;  3PJ9 A;  2XUL A;  1R89 A;  1PYT A;  3THT A;  5CCM A;  4J9Q A;  2IC3 A;  2H5J B;  4IH7 A;  1YJT A;  1WNE A;  1AZS B;  3ZZT A;  1N33 F;  1YX2 A;  2IBO A;  1NHV A;  2MKH A;  1F9F A;  1XNQ F;  4A47 A;  4ILR A;  4FDF A;  4DV1 J;  3KMS A;  4K0K F;  6FD1 A;  2UXD J;  4AFF A;  1QSY A;  1JLA A;  2EI5 A;  3EGN A;  1HQE B;  1RTZ A;  4KB7 A;  3LA0 A;  2Y9H A;  2RHS B;  4NAS A;  1TZ0 A;  2MST A;  3EJM A;  1IVZ A;  3NP5 A;  4DEZ A;  1RKJ A;  2I5J A;  3Q8Q B;  3CUL A;  4RO0 A;  1N52 B;  2QTW A;  3TA1 A;  4WTO B;  5J1P A;  5GAD U;  4EBC A;  1OJ4 A;  3EZ5 A;  2VC1 A;  4C11 A;  2YX7 A;  2CFX A;  1R43 A;  3DHX A;  3IG1 A;  4ZHR B;  1GX5 A;  3W5Z A;  4EBD A;  2DRA A;  1JB0 C;  4J9U E;  2HQG A;  3K5N A;  4HTJ A;  2K1R B;  3ICL A;  3R2C J;  3A4T A;  3UCG A;  1RAJ A;  4URS A;  1TL5 A;  5D8H B;  3FQL A;  1YBA A;  3GYG A;  3WC0 A;  3ZZP A;  1UJ4 A;  1Q16 B;  1F2G A;  3TAQ A;  1FVQ A;  4M8L A;  1WG5 A;  4YR2 A;  3VWS A;  1W26 A;  2ACM A;  1NZ8 A;  2LDY A;  3SCJ E;  4ZVF A;  4O4G A;  2ATL A;  1TL3 B;  4LUB A;  2L41 A;  1VFJ A;  2A2C A;  1HNW F;  2UV8 A;  1XER A;  2JRS A;  1LW2 A;  1JKH A;  5D4L A;  3D1Q A;  4PXB A;  4NX9 A;  2WCX A;  5DM6 Q;  2R2R A;  4TLR A;  4L76 A;  1FNM A;  1J5E J;  2Q6B A;  3BSC A;  4RUB A;  2IPO B;  3T1Y F;  3QT6 A;  1NSK L;  4JI3 J;  1S6P A;  5J2Q A;  4A4J A;  1AXQ A;  3A8I A;  1IWA A;  4AUK A;  3HSZ A;  4ZMM A;  1MRO A;  4F36 A;  3NL0 A;  1WI8 A;  5CYJ A;  1FDD A;  3F44 A;  3DLG A;  1MWY A;  4M5K A;  5F8G A;  3MFH A;  3MUT P;  2IBK A;  2CQD A;  3ZZU A;  3OTD A;  2ROE A;  2P5V A;  2KT2 A;  2XEX A;  4DXL A;  1YTY A;  3HHL D;  4CNZ A;  2MQO A;  3D6F B;  4Y28 C;  3RUB L;  3N6M A;  6AT1 B;  1FVS A;  4RW6 B;  1IKX A;  4X66 F;  1FDA A;  3FMB A;  4L72 B;  2IM2 A;  5DO2 A;  3POT B;  1FK9 B;  1H0H B;  1Z1Z A;  3NNH A;  1VHF A;  2FZG B;  3V4I A;  3LW5 C;  4JI1 F;  1Q7L B;  4DR7 J;  4TQR A;  4Y0F A;  3H0P A;  3HO1 A;  2R2S A;  1B0T A;  1VQP S;  2OPQ A;  3BSO A;  1IM6 A;  2XMW A;  1GXU A;  1X5S A;  4U95 A;  4JI8 F;  3MTJ A;  1JLE B;  1T9T A;  2DNM A;  3MM6 A;  3QFH A;  4M5N A;  2CXE A;  5DQI A;  9RUB A;  1FJE B;  4QQB A;  2DRB A;  5L9N A;  4BDP A;  4E0D A;  1N5S A;  4HKQ A;  4C4W A;  5T7L A;  4Q8F A;  3H42 A;  1X5O A;  4CTA A;  2B9W A;  3G87 A;  5KG7 A;  3SDE B;  4EYI B;  1X4B A;  3QRQ A;  2DHX A;  2YKM B;  2HEK A;  2EKY A;  5HP1 B;  1L5U A;  4ZN3 A;  3RB0 A;  3RG6 A;  4TY9 A;  2AKW B;  1CEZ A;  5KFN A;  1JQG A;  5AJ3 F;  1K9M T;  5E7O B;  2CNN B;  4C8O A;  1RWM B;  2WON A;  3CIM A;  3CC7 S;  4OLP A;  2F8M A;  2V67 A;  2VG5 B;  4EZ6 A;  2V8V A;  3DOM A;  1KRP A;  4DR5 F;  4BS2 A;  2HAF A;  4N7T A;  1D8Z A;  2VL1 A;  2B7C B;  4MIA A;  1ULR A;  5E3Q A;  5ETP A;  3KG4 A;  2IVF B;  1WC6 A;  5KFD A;  4ZCK A;  1TL1 B;  1WI6 A;  1VDH A;  3LGH A;  3O5T B;  1TL4 A;  2C2N A;  1DUR A;  2WB1 D;  2PD1 A;  5DGA A;  3CDU A;  5J2P A;  4PUO B;  3ELH A;  5GAE U;  1UVM A;  1RQ0 A;  2F5G A;  1M5S A;  1XQI A;  2DR8 A;  1P9Y A;  1FJ7 A;  4ZJO A;  2VAS A;  2H3E B;  4HHU A;  3DRP A;  3A3N B;  1IBC B;  1ZM9 A;  2XYH B;  3KLE B;  4DV4 J;  4K4T A;  1N8R T;  3R5B A;  5DDP C;  3N9U C;  2XB2 D;  4ALZ A;  2PII A;  1RSC A;  1EAR A;  5LJ3 Y;  1FJC A;  4LF6 F;  4NLP A;  1BE4 A;  3W9I A;  1LWF B;  4ZHR A;  4ECY A;  2RD5 C;  4ECQ A;  3OTO J;  3CSK A;  5H9E K;  4G3I A;  2K1R A;  5HJY A;  2CYY A;  3CW2 C;  1RT6 B;  1RTJ A;  2GJI A;  1MMD A;  2GMJ A;  4P6Q A;  3IR6 B;  1XWL A;  4DV7 F;  3NG8 A;  4L3K A;  3W8P A;  2HVH A;  1AFI A;  5ETR A;  3ENA A;  1WEL A;  5CQG A;  3W2W B;  2M52 A;  3K5L A;  4TVA B;  5CHC B;  3FZB A;  2P9G A;  2WRM A;  4NI2 A;  3PYF A;  4Q5V A;  5IS2 A;  4LRA A;  4NCA A;  1TL3 A;  4FVM A;  5JXS A;  2LQB A;  3EXY A;  3RYL A;  3UDV A;  1UKU A;  5KFH A;  2F3J A;  3MMB B;  5C7P A;  1N88 A;  1RUS A;  1TV6 B;  4BC9 A;  3GIM A;  1YZ6 A;  1LK7 A;  1RT4 A;  4DLE A;  2AZ1 A;  4C9D A;  3HHN B;  2N3O A;  1UFL A;  2UVU A;  5JUM A;  3HX9 A;  1TKZ B;  4M5I A;  2LXI A;  3CJR A;  4Y2I A;  1MMN A;  3BGO P;  1S1V A;  4PAB A;  2ZH9 A;  3W61 A;  4PG7 A;  2GFF A;  5FD1 A;  4DR1 F;  3FEZ A;  4YY3 F;  3I9V 9;  3F41 A;  2WVF A;  4Y2A A;  1N33 J;  4MYT A;  4U96 A;  1FX2 A;  1B4S A;  3RB3 A;  1XNQ J;  2VFU A;  2FJA B;  3MXH P;  3UI3 A;  3K57 A;  2G2O A;  1CS4 A;  1XJW B;  2ZD1 B;  4K0K J;  2XYG B;  5A8K A;  4QOT A;  4LF2 A;  3B6B A;  3MM5 B;  2FC9 A;  1Q8I A;  1T9V A;  4FXV A;  3D5M A;  2DJW A;  1Y3K A;  1IR1 A;  3H5S A;  2XMU A;  2ZH6 A;  4CT8 A;  4NYO A;  2G4B A;  2YNH B;  2YKA A;  4LR8 A;  2H65 B;  4ZVS B;  4WXW A;  2DCL A;  5THW A;  4KV8 A;  3PFE A;  2YNF A;  1PAE X;  2DIS A;  3GU0 A;  4E98 A;  4OJH A;  5CAA A;  2MKJ A;  2ZOG A;  4ZA1 A;  2IVY A;  4YDX A;  5C5J A;  3NWG A;  2VUG A;  3R5J B;  3OVA A;  1FX4 A;  4Q43 A;  1RP5 A;  3SYZ A;  2HFS A;  4L75 A;  1BGX T;  3VQT A;  1SPB P;  4RW7 A;  1H73 A;  1D1U A;  3TZZ A;  3VGU A;  3MGJ A;  4WWS A;  2LU2 A;  5FII A;  2W9A A;  3O1L A;  2MPU A;  2CQ2 A;  2MUI A;  1RU1 A;  4KGZ B;  4HL9 A;  3OHB A;  1C0U A;  3MUM P;  2XLJ A;  3CD6 S;  4ATN A;  2R7S A;  3VV2 B;  4O0N A;  4FN5 A;  4FYX B;  4B9U A;  3B78 A;  2EKN A;  3BB5 A;  3TI0 A;  1VRQ C;  3KLG B;  1WKK A;  2ILZ A;  4DR6 F;  1JLQ A;  1R8H A;  4DQR A;  4P73 A;  3JSB A;  4P10 A;  4DZ6 A;  1N54 B;  3SXL A;  3LP1 B;  3PFO A;  4QBU A;  4RNM A;  4M5M A;  2VDH A;  1KHW A;  1Y5I B;  2FY8 A;  4RW8 B;  1FE4 A;  1P6T A;  2HWH A;  1RT2 B;  4WFY A;  3FEY B;  3T1Y J;  2FLP A;  3QRR A;  3HVW A;  2CQ4 A;  1VQN S;  4XDC A;  1VQO S;  1JNZ B;  2MGZ B;  2FZC B;  2ZOM A;  4OYA A;  2KM8 B;  2GGP B;  3PKY A;  2XO6 A;  1PSD A;  1TKT B;  4URQ U;  4MK8 A;  1B7Y B;  4BWJ A;  2XO7 A;  1QJH A;  2E9Z A;  4TQS A;  4ECU A;  2FJW A;  1PC5 A;  1RT7 B;  4ZPA A;  2VF3 A;  4F25 A;  1ACM B;  3C3L A;  3ENV A;  1S7I A;  1VIX A;  1PO6 A;  3D0H E;  3BPS P;  4X66 J;  2DGO A;  1F3F A;  3VVT A;  1Y00 A;  4MAK A;  2IYG A;  5B09 A;  4JI1 J;  3Q8R B;  1RK8 A;  2RQM A;  2FQQ B;  2IAJ A;  4KGM A;  3NGR A;  2CQC A;  1NO8 A;  3NGS A;  3PYE A;  2GVZ B;  2QL9 B;  1U0H B;  3ZTS A;  1KS2 A;  1RU2 A;  1S12 A;  4USM A;  2V4J B;  1RHQ B;  4USW A;  4FF2 A;  4JI8 J;  4HAC A;  2KJW A;  1X8D A;  2ZBQ A;  2YBV A;  5HQ8 A;  2LLZ A;  1T8E A;  2EC2 A;  5K20 B;  3T6J A;  1NK7 A;  4C3K A;  4F4Z A;  2JFD A;  1RYS A;  1S5Z A;  3IBF B;  2J9D A;  4LBH A;  3RRK A;  2LA4 A;  2KL8 A;  2DNN A;  2UU9 F;  4TYB A;  1QAJ A;  1TV6 A;  1XMO F;  4QU6 A;  4J9O A;  1YIT S;  4OZ0 A;  2YWW A;  4M5D A;  2CG8 A;  3J7A 1;  3HKZ D;  4M5G A;  2HVZ A;  4NRT A;  4ZKA A;  2LDI A;  1UP1 A;  1ZZF A;  4TXS A;  4NLY A;  2XS2 A;  2W25 A;  2CDQ A;  2XZT B;  4ZLJ A;  1HW9 A;  1TKZ A;  1RTI A;  2ZC4 A;  2ZC3 A;  4OYP A;  3MEG B;  2ZM6 F;  2ADC A;  3ZXW A;  3CD5 A;  3UDC A;  4OYW A;  5ADZ A;  2OPP B;  1S1U B;  1N4L A;  1OSD A;  1IBK F;  3H2U B;  4DR5 J;  5AXK A;  2HMI A;  5GAH I;  4I56 A;  5BR8 F;  1DAX A;  3FBC A;  1S72 S;  4OV6 A;  5LL6 d;  5E3R A;  4QW8 A;  2OML A;  3BF4 A;  1MG7 A;  1V5V A;  3R5A A;  1O51 A;  2BE7 D;  5HQM A;  1KHV A;  3CJK A;  4IG0 B;  1ZOT A;  5HO4 A;  4UOH A;  2QG9 B;  3VAL A;  2W01 A;  3I4H X;  1VRT A;  3PHT A;  4NCG B;  1PGZ A;  5HVG A;  3D68 A;  3VGV A;  1RAO A;  2YNI B;  4ID8 A;  3MR6 A;  1UFW A;  3EYZ A;  5EWG A;  2MKC A;  1VQL S;  1NBE B;  5C2G A;  3PEH A;  1DLO B;  1PIE A;  1VQ9 S;  1QSS A;  3G6E S;  1DY3 A;  3O3L A;  2YH0 A;  3OSP A;  3CWJ A;  4BC7 A;  1NSP A;  2MKK A;  1Y3J A;  2CNO B;  2R3V A;  3FJ2 A;  4NA2 A;  2I2Y A;  4DDF A;  4LF6 J;  2PC6 A;  2VPY B;  2QFI A;  3DGP A;  3OXF A;  2GHV C;  3UR3 C;  1TFY A;  2O66 A;  2NRE A;  3LP0 B;  1Z2L A;  1RWN B;  4HI1 A;  4OZJ A;  2XCA A;  1UEU A;  2DHA A;  2HGM A;  2V69 A;  4JI0 J;  2XGP A;  2RUS A;  3IN5 A;  4AL5 A;  3P5T L;  4DV7 J;  4KRW A;  4LRC A;  4KHP F;  4P2M A;  1FNX H;  1VOM A;  2FC8 A;  1RBL A;  3A13 A;  2JEJ A;  1KN6 A;  4OHV A;  1RTD A;  3C6U B;  4CLP A;  1XTZ A;  1QVG R;  4U6P A;  3GV5 B;  2DO8 A;  5MLC V;  1U2F A;  2MKS A;  4OX7 A;  2CJ9 A;  3MM8 B;  1L3T A;  1FNO A;  2QJ3 A;  2HBY B;  1MU2 A;  4P7V A;  4U7C A;  2CZ9 A;  3LP1 A;  3UQS A;  2IA0 A;  2AGQ A;  4I1T A;  3GQC A;  3IP0 A;  4I2P B;  3ZTR A;  1VYA A;  3KMQ A;  3PRD A;  3JTP A;  1UJ5 A;  1EB0 A;  3W8G A;  8RUC A;  3PYD A;  2YWG A;  1VC5 A;  2EBE A;  2Q79 A;  1S7H A;  3H7H B;  1O5J A;  2MGZ A;  1U6Z A;  3MOJ B;  2FD2 A;  1T3N A;  2XS7 A;  3A8J A;  1H3D A;  2WOM B;  1RTH B;  4ZPV R;  4C8N A;  3M1V B;  1S76 D;  2LYV A;  1NJY A;  2OLW A;  3HLU A;  4LSN B;  4YY3 J;  4DX6 A;  2QLW A;  3GFH A;  3OFG A;  4OFZ A;  1ZM2 A;  1WF1 A;  4YR3 A;  4UQT A;  1I5O B;  2DO0 A;  2CA9 A;  2MZS A;  5I42 A;  5GAG I;  2MEW A;  3AXM A;  1XR7 A;  2ZE2 B;  1Q0N A;  3G8T A;  1CBK A;  1WF0 A;  4ZVU B;  1OQ6 A;  3OXL A;  5HBM B;  4F3Q A;  3C14 B;  3OQ2 A;  4DV2 J;  5G0R B;  1KSP A;  4NL5 A;  1JLG B;  2DNL A;  2JJ4 D;  4DSE A;  4KAI A;  1AA1 B;  3AD9 C;  3KLF B;  1MNE A;  1ITP A;  4B3M F;  2V4J A;  2OJ3 A;  4WP9 A;  5A8R A;  2D3O R;  3TAM B;  2A1B A;  5F3Z A;  1PBA A;  2ZH2 A;  1HMV A;  2MKI A;  4WU2 A;  1UA1 A;  4OHX A;  1RCO B;  3GR1 A;  3D66 A;  4WYL A;  3NEK A;  1JIH A;  3QWU A;  1SIZ A;  4DSF A;  3HHL A;  3AD8 C;  1HQ2 A;  1GTE A;  3M8R A;  2CJQ A;  1VQ8 S;  1X4E A;  5F8J A;  5DZ7 A;  2E1C A;  1VBY A;  2MTL A;  3HF5 A;  5B0B A;  1LWX A;  2HK2 A;  3FK4 A;  4WZQ A;  2BDP A;  3JS9 A;  4L6V 3;  1SJF A;  2XCP A;  3LGN A;  1KTV A;  5K14 B;  2HRT A;  1NH7 A;  4RX6 A;  4QIE A;  1TR0 A;  4I7F A;  5HVH A;  2HNY B;  3UVJ A;  1CLF A;  4YS2 A;  2CQG A;  4MKY A;  3GV7 B;  3CCE S;  2DNO A;  2UP1 A;  3OUY A;  2U1A A;  4E2F B;  3KWM A;  2MXY A;  3M8W A;  4DR6 J;  3MTK A;  3TYT A;  4DCO B;  1S6U A;  1SCJ B;  5E3A A;  3W62 A;  4TU7 A;  3NMR A;  2D3O 1;  3BH7 B;  4ILM A;  2OEL A;  1RZM A;  4HT7 A;  1S10 A;  2D74 B;  1UVL A;  4RPF A;  3O6Q A;  3EMT A;  5IFM A;  2MHE A;  3AD7 C;  4I68 A;  3BR9 A;  1HFE L;  2JNJ A;  4KY3 A;  4OQJ A;  1S9E A;  3PRB A;  4WE1 B;  1YIJ S;  4I0W A;  4FNH A;  3SQO P;  3DLJ A;  2R9L A;  2FHM A;  2CQ1 A;  3IS9 B;  4QU7 A;  5IC4 B;  1DLO A;  1GH8 A;  4IFV B;  5E41 A;  3FSX A;  2QO3 A;  4USU A;  1Q5Y A;  2HYI B;  3FMW A;  3TRG A;  2J9D E;  2LQ9 A;  1TKX B;  5IT9 U;  1V3S A;  4K4X A;  3MD3 A;  2KG0 A;  4Q44 A;  4P9S A;  1UL3 A;  4DX5 A;  2Z8Q A;  1W2I A;  2KH9 A;  5KFR A;  4FKX A;  1HHQ A;  5A6W A;  4F3M A;  3SMZ A;  1JJ4 A;  3O2I A;  1U2R A;  1M5K C;  2ZH5 A;  1YQH A;  3TX8 A;  3Q8P B;  1LFP A;  2KXH A;  4N76 A;  5EN1 A;  1U1O A;  4OJ3 A;  3MCO A;  1N0U A;  2WSC C;  4A8O A;  1PIL A;  3B8H A;  1K0T A;  2IRU A;  3NNC A;  2NXJ A;  2VU5 A;  4ZPT R;  1RLD A;  1JK9 B;  2G13 A;  2B5J B;  4IRD A;  2HHH F;  3BKT A;  1D0E A;  2WHO A;  4IQX A;  3JAM U;  2KN4 A;  4J9S A;  2M4M A;  3QIP B;  3JTN A;  3ZNU A;  2BUN A;  1VQ6 S;  3Q89 A;  4U67 Q;  5L46 A;  3TO8 A;  2W4P A;  3FRY A;  2DIU A;  3Q8V A;  1RWK B;  1XMO J;  1KR4 A;  4DWI A;  4I2P A;  3MPW A;  4WCE Q;  2AJ2 A;  4PXC A;  4DV3 F;  2DK2 A;  2HQ3 A;  2HFO A;  3R6G B;  4TLQ A;  4F3O A;  4OLO A;  4F0K A;  4WIQ A;  3PJX A;  1ZM4 A;  1C4C A;  2DY9 A;  2DRD A;  3BBB A;  1VBX A;  3D3B J;  4A8Y A;  1QTN B;  4LT6 A;  2V2Z A;  4O3S A;  2ZM6 J;  1RTH A;  4ZLN A;  5KT2 A;  4EUV A;  3DDI A;  2YQ3 A;  2WK4 A;  2FHO B;  1LKZ A;  2EFV A;  4WP8 A;  3H4B A;  2FPH X;  2EC0 A;  2B51 A;  2QN6 B;  4H4M B;  3EX7 B;  2GHW A;  4A48 A;  2XHW A;  3G96 A;  1VJW A;  3GG1 A;  2QA4 S;  3G4S S;  3HKW A;  3O44 A;  3S8S A;  3DOK A;  3RRH A;  4DU7 A;  2JL9 A;  2MHN A;  2D69 A;  2DY1 A;  3EVW A;  5HQL A;  5HMZ A;  3CO0 P;  1JLG A;  1VQK S;  1S9G B;  2DKO B;  4NLV A;  1NB2 A;  2GS5 A;  1U25 A;  4LF8 F;  5D4N A;  3TAM A;  2VV5 A;  3HHE A;  2FVQ A;  4FYY B;  3WX8 A;  4F4W A;  5CZX A;  4YB5 A;  1UW4 A;  5KFS A;  1TTH B;  1RT5 A;  3W1Y C;  3KJV B;  4TKT A;  2YQ0 A;  4XDD A;  4USV A;  4MYU A;  4OYO A;  1KVI A;  2QIF A;  3DGV A;  1H2V Z;  1N0V C;  1X5P A;  4DI6 A;  3PW2 A;  3M9N B;  2AU0 A;  2AHO B;  1T3O A;  1Q8K A;  1XIQ A;  2NZ4 A;  3C16 B;  1C0T A;  2ZZN A;  3UW1 A;  1F2H A;  4DUZ F;  3V6D A;  3GJR B;  4OYB A;  5KOW A;  4WU3 A;  4KFB B;  4ZCI A;  3CJ8 A;  2IJR A;  3MEC A;  4IFY A;  2FB0 A;  3K5M A;  2R7T A;  4N5S A;  2PFD A;  3CDW A;  2HRY A;  1DTT B;  5F9L A;  3MAH A;  3GSI A;  3W9J A;  2DVI A;  4RL1 A;  2VOO A;  1VK3 A;  2OAU A;  1S1T A;  3S1T A;  4Q2L A;  3T5K A;  1OS5 A;  3FDS A;  3JB9 k;  2B4V A;  2F7V A;  4F50 A;  4RUA A;  2VBW A;  2J8A A;  2MQN A;  3BGR B;  4WE1 A;  5I3P A;  2ASY A;  2BJE A;  1U1L A;  3ZFV A;  1SUQ B;  2NXN A;  3CCU S;  4AL7 A;  2XSJ A;  5DLF A;  1LOU A;  1U6B A;  5DJB A;  4ED0 A;  1S0M A;  4OHY A;  3IS9 A;  3MCS A;  1TKD A;  1Q82 T;  5D3G A;  4I2Q B;  3EGV A;  5J2M B;  4IFV A;  1M1H A;  2YY3 A;  1VQ5 S;  1S9F A;  1U09 A;  4OYZ A;  3DLL Q;  3PY8 A;  2UXB F;  2NR0 A;  3W5X A;  1TKX A;  1SV5 B;  5EDW A;  2CPH A;  1HBO B;  2AGP A;  4DX7 A;  1TK8 A;  4ELU A;  4JYA J;  2BJ3 A;  1I3O B;  1S1W B;  1E6Y A;  4LF9 J;  1G7C B;  3AHP A;  2N82 B;  2BW2 A;  1ZAV A;  1IQZ A;  2ALY B;  1NEE A;  2K7J A;  1RI7 A;  2YX4 A;  4CM0 A;  1HPZ B;  3HFV A;  4DQQ A;  2HHQ A;  2IDL A;  3J7Y I;  2VHG A;  4B3M J;  1HI1 A;  3VZI A;  3J81 j;  3MUV P;  4EYH B;  1IKW B;  3BGU A;  1FD8 A;  4UOG A;  3OPK A;  3M6W A;  4DSJ A;  3ZZR A;  2FGO A;  8ATC B;  3D3C J;  5KFT A;  1U7L A;  3CMA S;  3QT5 A;  3QIP A;  5ETT A;  4WFN Q;  4AE5 A;  4JBC A;  1WOR A;  1D9F A;  3A3O B;  5LM7 E;  1PG5 B;  1VGY A;  1WAC A;  2JC0 A;  1S6Q B;  3Q83 A;  5CD4 A;  4HT5 A;  2FLO A;  4I6W A;  4ICL B;  4NLQ A;  2CKW A;  4K5S A;  2IFX A;  1Q86 T;  4N8O A;  4ETZ A;  2Y8W A;  3ZO7 A;  4TNO A;  1QDU B;  1LK5 A;  3CE8 A;  2BQU A;  4MMO A;  2E9T A;  3N6N A;  2Z58 B;  1FJG F;  1FRH A;  3RB6 A;  2VA2 A;  4A8Q A;  2EBG A;  1N32 F;  2EG2 A;  2V63 A;  5F8H A;  3H25 A;  2Q43 A;  2UUT A;  4DF8 A;  3DLK B;  3DI6 A;  1ELO A;  1LQ9 A;  2DR5 A;  4ANE A;  4B3R F;  4G65 A;  4HDH A;  1GMU A;  2EFQ A;  3QQC D;  4R5P B;  2ZNZ A;  1C1C B;  3CCJ S;  2DH8 A;  1FWP A;  5B0E A;  4LBP A;  2MKY A;  2KT3 A;  2ZUG A;  3AAW B;  2D3U A;  3KHH A;  2P2C B;  1YWX A;  1TQL A;  2ZVS A;  3L4B C;  1Y11 A;  3VF0 B;  3X3U A;  4CCH A;  4OMF G;  3W2V A;  2C2R A;  2CJK A;  1RGV A;  3V6J A;  3A3P B;  7FDR A;  3NGU A;  1VC0 A;  2BV3 A;  3HDS A;  3E51 A;  1MN9 A;  2KVI A;  3DNC A;  3OFE A;  2HBZ B;  3KJV A;  5IT9 Y;  4MH8 A;  2XY5 A;  3M6X A;  3HM9 A;  1KQG B;  2V8H A;  4J9K A;  3NS7 B;  3N5F A;  1YBU A;  2GX8 A;  3W64 A;  3PM9 A;  1N5V A;  3PAC A;  3C6T A;  3CCS S;  3OJU A;  3OR2 A;  3V81 B;  3LAK A;  3DKD A;  3BO3 A;  4LSL B;  1NK0 A;  4W4M A;  2E1P A;  1BQM A;  2OHD A;  1N34 J;  4E8U A;  1QAX A;  1D09 B;  1WEX A;  3QZ8 A;  3QGP A;  3QLH A;  4MIB A;  2AIR B;  2H9Z A;  5KAK A;  1EET A;  4KFB A;  1O8B A;  2UV8 G;  2Q3P A;  5A2Q U;  4ED4 A;  3KXD A;  3CED A;  4NZ7 A;  3QAT A;  2BE2 B;  1ZZN A;  2IM3 A;  1MN7 A;  1E6V B;  4W98 A;  2A18 A;  1IBM F;  3BN7 A;  3JAM Y;  2EXU A;  3QRP A;  2LFV A;  1YJ7 A;  5KFL A;  1CC8 A;  3OR1 B;  1U49 A;  4DV3 J;  3CME S;  3O8W A;  1FRI A;  4DBQ A;  1IKY B;  1H2T Z;  2BOP A;  4JI2 F;  1HNI B;  3CDB A;  3UE2 A;  4OI2 A;  2ZZM A;  2B0G A;  2VQF F;  1VBZ A;  2M9K A;  2DT9 A;  5HJX A;  4LRB A;  5KG5 A;  2NYI A;  3BRE A;  5C25 B;  3I96 A;  4I2Q A;  5J2M A;  4EO6 A;  4B9S A;  3FKB A;  1ZYQ A;  2CJY B;  2YQ1 A;  4Z37 A;  1U48 A;  4A8S A;  3G6Y A;  1O6X A;  2KM8 C;  4YUD A;  1SV5 A;  2MMY A;  2ADB A;  4KIA A;  1N48 A;  1SJQ A;  3IFE A;  2AEM A;  5GAD I;  2ZJR Q;  4KH0 B;  2UUA F;  1CJK A;  3BGF A;  4OX9 J;  3KK2 B;  2R7O A;  2CNK B;  2IJN A;  2QZ8 A;  3QSI A;  4I4B A;  3A8K A;  1WHX A;  1R6Y A;  3DXB A;  3GTY X;  2HFN A;  3DYA A;  5B0G A;  1MWZ A;  1T95 A;  4TY8 A;  1HPZ A;  4GKK F;  3P4U B;  1GNK A;  3P6Y C;  4NZ6 A;  4LF8 J;  2VBZ A;  1WOO A;  4L74 A;  4ZPC A;  3CO9 A;  2QMX A;  4GVB B;  4Z7C A;  1LXJ A;  1IKW A;  4WJB A;  2FJV A;  2KG1 A;  2KT5 A;  1ZAW A;  3ISN C;  3C8Y A;  3M8Z A;  3I82 A;  1U1M A;  2B9X A;  4C2M A;  2HPU A;  1S0O A;  3H4D A;  1A6L A;  5L1I A;  4Q7A A;  1NM2 A;  1B7F A;  2YPZ A;  1S0V A;  4C97 A;  1LW0 B;  5KFU A;  3TUJ C;  5AT1 B;  5C2C A;  3C2P A;  2AV5 A;  4KSE B;  3D4J A;  1HIY A;  4PG6 A;  3EZO A;  4ICL A;  4LFC F;  4EWT A;  1TFW A;  1R0B G;  4C6A A;  2XMT A;  7AT1 B;  2JHE A;  1U02 A;  1F9E B;  2NCK L;  4RW9 B;  5BYQ A;  4PXE A;  3KK3 A;  1M90 T;  4IOB A;  2JX2 A;  1KEK A;  1S97 A;  1SJR A;  2HHV A;  2UZA A;  2DR6 A;  3DU5 A;  3EXC X;  2RHQ B;  1VRU A;  5A0Y A;  1S57 A;  2BQR A;  2BKO A;  2Z2Z A;  5FDL A;  2QX0 A;  1NJW A;  4P72 A;  3E2E A;  1IKV B;  4U8V A;  2P8I A;  3K58 A;  2HIQ A;  2HS4 A;  1HHT P;  3N6L A;  2OEJ A;  5I3U A;  2H5E A;  2VKR A;  3W65 A;  2RQC A;  5L38 A;  1H6K X;  3AB2 B;  4CRJ A;  3GZ7 A;  4AT1 B;  4DFP A;  1JLA B;  4QWD A;  3BO2 A;  1WSR A;  1RT3 A;  2RT3 A;  4OYX A;  4JV5 F;  4WFZ A;  2GV1 A;  2UXB J;  2AT1 B;  2I6W A;  3CTR A;  3ZC4 A;  2B4U A;  3TQE A;  1CSJ A;  3AQO A;  4H4O B;  1GX6 A;  2VD3 A;  1D3W A;  2WVE A;  3M8P B;  1ZA2 B;  4MFB A;  3SFU A;  1IBL F;  3TJ8 A;  3HFK A;  3QWP A;  2RUG A;  4C11 B;  1T9Y A;  1EJ7 L;  2CZV C;  1Q4R A;  2RU3 A;  2FHJ D;  4C0B A;  4DL4 A;  3IGN A;  1X7V A;  3IG1 B;  3BJY A;  3TW0 A;  2N4C A;  2PT0 A;  3DFE A;  2WBM A;  3IWL A;  5DRK A;  4LSL A;  4D3G A;  2M88 A;  4GO5 X;  5D0H A;  4NWB A;  1G3O A;  2NZC A;  2BYC A;  5KT4 A;  1SIW B;  2F1F A;  5KG2 A;  3MMC B;  3MR3 A;  2HW3 A;  4CLZ A;  4LRD A;  1Y5N B;  3NAI A;  3DOL A;  4DQS A;  5K9F A;  2QLB B;  3CC2 S;  1QUP A;  2BE2 A;  4NLW A;  5IQQ A;  1FI4 A;  3PKM A;  2DPJ A;  3GSD A;  3SEO A;  1FEH A;  3NNA A;  1OQ3 A;  3PV8 A;  4C8Y A;  4O4G B;  2DNG A;  3CCZ A;  1TMJ A;  4AXI A;  3OR1 A;  2RDJ A;  1JKH B;  1D9D A;  5AE2 A;  1X9S A;  3M32 B;  4XTT A;  4DS4 A;  2R7X A;  3HFZ B;  4P71 A;  1HNI A;  3BKU A;  3SBM A;  2G1H A;  2HVD A;  1U0S A;  2DYA A;  4V1A k;  4GKJ F;  2U2F A;  3T3F A;  2CQ3 A;  3UN2 A;  3FSI A;  5FLX U;  3FZ2 A;  2V4R A;  4U8Y A;  2QYC A;  1FJG J;  2V2V A;  2Z0G A;  2EFO A;  4ZVE A;  5RUB A;  5HL7 Q;  3DRR A;  1S6P B;  1N32 J;  3I87 A;  4IH6 A;  4NML A;  2GIR A;  3R5C A;  3M8Q A;  1HWL A;  4B3O A;  3GIK A;  3RBZ A;  1MRO B;  5I3Q A;  3VAG A;  5KFB A;  1N56 A;  4RNH A;  3TZY A;  1UVI A;  4WYW A;  4ELT A;  4M94 A;  3CPW R;  1KOH A;  4ZP8 A;  4B3R J;  1T02 A;  2RNE A;  2D7S A;  2QT7 A;  1NPK A;  3QJJ A;  2KZM A;  5L8R C;  3VAK A;  2N7Y A;  4ZLP A;  1QTM A;  1KNZ A;  2W8K A;  3KK2 A;  4X4P A;  3H8Y A;  4A8K A;  1T9U A;  4X2B A;  2MZT A;  4ZIV A;  4AD6 A;  2WVC A;  3DDN A;  3KLH A;  2DH9 A;  3CJ5 A;  1BMQ B;  3V4I B;  4GO7 X;  3U7J A;  3DCA A;  2ATC B;  3GP9 A;  3ETM A;  1EKS A;  5A8W A;  3CB4 A;  1JXV A;  1TU0 B;  2M0G B;  3E3X A;  2YKQ A;  2FVC A;  4URG A;  1Q95 G;  2OPQ B;  2MJN A;  1BY9 A;  1M5H A;  2CPJ A;  5HAT A;  4ED1 A;  2XS5 A;  2PMW A;  2W2P P;  4ES1 A;  4L73 A;  2XC9 A;  3TVY A;  4XO0 A;  2B8P A;  3SSR A;  2JSX A;  2LEP A;  3MM6 B;  4B3T F;  2VOD A;  7FD1 A;  1ZBT A;  5ITH A;  3T9N A;  4DQP A;  4WFB Q;  1KOO A;  1RE1 B;  4RR5 A;  1YSJ A;  3FVY A;  3DLE B;  4PR6 A;  2EFN A;  4CTA B;  3MAA B;  5LSR A;  4ECR A;  1GXL A;  5HVF A;  3CCQ S;  5EWE A;  4QWE A;  4G1Q A;  4ECT A;  3ZTQ A;  1GEH A;  2O1P A;  4ZJQ A;  1NB7 A;  3MUR P;  3P96 A;  2Y8Y A;  3LAL A;  3N4W A;  2QE5 A;  1U24 A;  5A2Q Y;  2AJ4 A;  3PEJ A;  2XHC A;  5DLG A;  2R8K A;  4H4K A;  4USI A;  4WPA A;  2HFV A;  3L7O A;  4O44 A;  2CPI A;  1IKV A;  1S4E A;  1UZD A;  2VC0 A;  3DOM B;  5LMN F;  4QYZ K;  4JI2 J;  1CQN A;  2CQI A;  3V4M A;  2OEM A;  3ZZ0 A;  3M9O B;  3AA9 A;  2ZUA A;  3T19 A;  4OJG A;  2VQF J;  1H74 A;  4IRC A;  4DPY A;  2H4W B;  4EGL A;  4EU0 A;  5HMW A;  2RKI A;  2Z2Y B;  2VJV A;  3UFC X;  3D1H A;  1VBK A;  5L9X A;  3KG1 A;  2VB6 A;  3I0S A;  2Z2L A;  5J2P B;  2EW0 A;  1YJV A;  1GMW D;  1URR A;  3M05 A;  3KJF B;  3BPD A;  2A6M A;  4H4O A;  1XNR F;  5DDQ C;  4ED5 A;  3N0V A;  4AND A;  2XZW A;  2ILY A;  3DLB A;  5ETK A;  3M8P A;  3DRP B;  4N8N A;  2UUA J;  4EMD A;  4BCA A;  3J81 U;  3MPV A;  1WG1 A;  4ZPD A;  2B8Q A;  2W24 A;  2PMZ D;  3L7U A;  2HHX A;  4DL5 A;  2DXD A;  2I1R A;  5CZV A;  2GML A;  2YXL A;  2L08 A;  2GQQ A;  4GKK J;  4X64 F;  3TAN A;  3THP A;  2H5I B;  2J6S A;  2RIL A;  3MMC A;  4HHJ A;  1RTJ B;  3QJP A;  2GIQ A;  3G86 A;  2ACY A;  2VFS A;  5IC6 B;  1R27 B;  2C3Y A;  2BZ2 A;  3UCZ P;  1TAU A;  4NA3 A;  5KT6 A;  1OY9 A;  1YVF A;  4DPO A;  4NI2 B;  1K1S A;  3QGG A;  4I6A A;  3HXM A;  1JWW A;  2JVR A;  1T0T V;  1ARO P;  3T41 A;  3UDL A;  2DTJ A;  4ZVH A;  3TJA A;  3MPY A;  4LFC J;  5CYQ A;  4Z7Y A;  3M32 A;  2FYX A;  1B0V A;  2X3D A;  2FHK A;  2E1R A;  2MQ8 A;  4CH1 A;  4A8M P;  3VGS A;  1RT4 B;  5KFF A;  5HRO B;  2OUG A;  2C3U A;  5KTQ A;  4LIW A;  2W9C A;  3LAM A;  2XY7 A;  5IXU A;  1LWC A;  2ASL A;  2OMO A;  2XSF A;  1EQM A;  3BN4 A;  5L1K A;  4EK2 A;  1YK9 A;  2X1G A;  1P1L A;  2DGT A;  3ILJ A;  1WDT A;  1CJT B;  1IJF B;  2F4V J;  1S1V B;  3S6E A;  5L39 A;  2XI2 A;  2DHG A;  1FXR A;  4QPT A;  1IJE B;  3E8O A;  5IWA F;  3UN3 A;  3UDE A;  2PE8 A;  3CF5 Q;  4ECX A;  3B54 A;  1S59 A;  1OSC A;  2ZEJ A;  2QMW A;  2BXJ A;  1WOP A;  3I6P A;  1XK8 A;  1VS3 A;  2KVQ E;  4S0M A;  4IO9 Q;  4LFA F;  3DU6 A;  5HLF B;  2Q1L A;  3BZQ A;  1RWW B;  2VFT A;  1CS4 B;  1XMB A;  1HW8 A;  3ONQ A;  4F4X A;  3BS9 A;  3JYT B;  1EP4 B;  5A8K B;  2FUG 9;  1HYS A;  3PR4 A;  4DL3 A;  2HVE A;  4JV5 J;  1N5Q A;  2GQ2 A;  2AF6 A;  2OSQ A;  1PJ5 A;  3R1H A;  4ER8 A;  3NGK A;  4J91 A;  2BJ7 A;  3K17 A;  5AXL A;  3MPU B;  1ZH5 A;  4DPU A;  1Y9O A;  1FKP A;  1QE1 A;  3QSY B;  5HN0 A;  3JSM A;  4DFM A;  3AH6 A;  4RBT A;  1RA7 A;  4DR3 F;  1EZZ B;  1WDD A;  2IHR 1;  3LAN A;  1JJ2 R;  1VC6 A;  3CCT A;  1FTR A;  4KV8 B;  3PNI A;  4DSL A;  4DOZ A;  4JV0 A;  1R0C B;  2YNF B;  5KFO A;  4X4U A;  1A0O B;  2K8G A;  3SV4 A;  3NAH A;  1EX8 A;  1D9A A;  4OYM A;  2QYG A;  3UPF A;  1PYO B;  1Q5V A;  3ILL A;  1DHM A;  2CVI A;  3S7R A;  1T94 A;  3DLE A;  5D15 A;  3MAA A;  4ZCL A;  4NYP A;  4B9T A;  4DF4 A;  1NZA A;  4RW7 B;  5SZT A;  3EVO A;  2W9B A;  4CI0 B;  2XMV A;  3IO1 A;  3EM1 A;  3T5H A;  1C0U B;  2C3O A;  1YRX A;  2RB7 A;  3MR5 A;  3M9M B;  2FVP A;  2LCW A;  2NYH A;  1U26 A;  2BJD A;  3WX4 A;  2E5I A;  3FFI B;  5KFY A;  1JLQ B;  1QSL A;  1I51 B;  4U7U K;  1BUX A;  1SQF A;  2AYM A;  3DLH A;  3UD5 A;  4W90 B;  3G71 S;  5E0O A;  4IRK A;  3JQM A;  5J1E A;  2KTQ A;  2UXC F;  1VQS A;  2LA6 A;  3MM9 B;  1RAA B;  3ILO A;  2CPZ A;  3MHY A;  3R3T A;  4MKA A;  1RHR B;  3NS6 A;  2E5L J;  4GKJ J;  3W63 A;  1S48 A;  3SCL E;  3RBD A;  4HHH A;  3TAP A;  1I1G A;  4NLT A;  4LIR A;  5KOX A;  3IA0 A;  2R7U A;  1CJU A;  3J80 Y;  1IXK A;  3QZ7 A;  1WD6 A;  2QFJ A;  3BYR A;  5FLX Y;  2DCU B;  1REV A;  1WEZ A;  3CJQ A;  1V9O A;  2C28 A;  1R8P A;  4ANC A;  2P6T A;  4AYB D;  4X4R A;  2KZZ A;  1Y5L B;  4PWD B;  2M8H A;  5ETV A;  3VCD A;  1GK8 A;  1FFS B;  1JXL A;  2CQH A;  1YRT A;  2LEC A;  1EHW A;  1U1N A;  2YNG B;  4MKB A;  2ZNY A;  3WC2 A;  3TEH B;  2VPZ B;  2KHD A;  4Y6I A;  1K0V A;  4EEY A;  3FNN A;  1FKO A;  2Y0S D;  2GAG C;  4DR2 J;  2MSS A;  2XMK A;  3PX0 A;  2CAJ A;  2X1B A;  4KJI A;  2IAJ B;  4KQZ A;  1HBN A;  3AJ1 A;  3ENW A;  3HPO A;  5JJB A;  4O3Q A;  2LVW A;  4O4R A;  2GNK A;  4NA1 A;  4MJK A;  3HVT A;  1YHQ S;  4J90 A;  1P1T A;  4HAC B;  2KFN A;  3L7P A;  3WZ0 A;  3SQG A;  2LEB A;  4B3T J;  2Y1L B;  4MK7 A;  2IM1 A;  2R8H A;  4EO8 A;  4IOC Q;  4F2S A;  4C8Z A;  3IM8 A;  4RNN A;  1X9M A;  1FXL A;  2OSR A;  3NS5 A;  2ZH8 A;  2ZBR A;  4OYI A;  1DFD A;  2B43 A;  4KYZ A;  1CQM A;  1TL7 A;  1L3U A;  2Q6C A;  5HRO A;  2E66 A;  1S99 A;  4DL0 C;  4X62 F;  3CD0 A;  4M5D B;  1P9Q C;  2BJ8 A;  4CLK A;  4USJ C;  4Y3C A;  1HI8 A;  1YRU A;  5M2P A;  3RAM A;  3W60 A;  1TAQ A;  3GIJ A;  4USH A;  1RTI B;  2HFZ A;  2PSZ A;  4UOC A;  1CJT A;  4CDI A;  2R42 A;  1UPP A;  3RBX A;  2KYX A;  5AE1 A;  2FJD B;  3IAS 9;  2AWZ A;  3ET6 A;  4F2R A;  4KO0 B;  1VIO A;  2WSE C;  1KQK A;  1WHW A;  4O3N A;  5LMN J;  2I38 A;  2HMI B;  2R7R A;  2E44 A;  1ICE B;  3CVK A;  1SH0 A;  1A7G E;  1X4F A;  4QR0 A;  2VPW B;  3BV8 A;  2OPS B;  5HLF A;  3PZP A;  3CJK B;  1OPI A;  3JYT A;  3BH6 B;  1G4C A;  2FLN A;  1EP4 A;  1ZAX A;  3QNW B;  3DRX A;  1VRT B;  2MZJ A;  3HUL A;  1G6B A;  2JLG A;  2K3K A;  3AJ2 A;  1TUV A;  4P7T A;  4LQ3 A;  1BQN A;  4EZ9 A;  4XK8 C;  2NSB A;  1X31 C;  1XNR J;  2V5H G;  3NBP A;  2RQK A;  5KT3 A;  4RKU C;  4UT4 A;  5ETL A;  4RW4 B;  3G8Q A;  2AQ4 A;  3DC2 A;  4JI3 F;  2BRL A;  2PI4 A;  4F8R A;  3JQJ A;  3PJW A;  2JEG A;  5C42 A;  3Q23 A;  2EWH A;  1NSQ A;  1PAU B;  2G1D A;  3DGP B;  3EVM A;  3JTO A;  3J81 Y;  4ED3 A;  3HSG A;  4X64 J;  1HD1 A;  2J0W A;  1FRM A;  4XIU A;  2DEJ A;  4FYW B;  2D3Z A;  3HI9 A;  1C2P A;  3I5A A;  4EFA C;  5EX3 A;  2MJU A;  2L48 A;  2P9C A;  2M2B A;  2MDA A;  1RWV B;  4Q45 A;  3NOG A;  2XWX A;  4IH5 A;  3ULH A;  4WKR A;  3GWC A;  4ETX A;  1XC9 A;  4DUY F;  5C24 B;  2J5A A;  4IUF A;  5HMY A;  2BM1 A;  4OI1 A;  3VAJ A;  1AFJ A;  2KHC A;  3CCR S;  4BHQ A;  1RTD B;  3FFI A;  3LP2 A;  3M4X A;  1UEV A;  2QSW A;  2H54 B;  2FHJ A;  3TNV A;  1R3N A;  4QPX A;  1HNW J;  1TEL A;  2H1Y A;  5CXT A;  4Q8E A;  1MU2 B;  3MM9 A;  4AL6 A;  2HUR A;  1CUL A;  3EPG A;  1WTB A;  3R7N B;  2J7U A;  4ZPW R;  4CLS A;  1SKS A;  1M1K T;  1UZH A;  1IN0 A;  2R2U A;  1X4A A;  3QO9 A;  4OI0 A;  4Y00 A;  4Y2C A;  4C3L A;  1R0A B;  1NK8 A;  1REG X;  4DL2 A;  2W2Q P;  2V4Q A;  2IRX A;  3BSN A;  2KB2 A;  1K47 A;  4C7Q A;  5GMK a;  5IWA J;  3J7Z 5;  2DBB A;  3Q8Y A;  1F0X A;  4PWD A;  3PIP Q;  4N56 A;  3QBC A;  5I42 B;  1QD1 A;  1GMV A;  1CJV A;  2DNH A;  2YNG A;  2CWX A;  4ED2 A;  1GQE A;  3IWX A;  3TVZ A;  3IBW A;  2HQC A;  4C0O C;  3C15 A;  3J7A N;  3F73 A;  1SC4 B;  3Q24 A;  2V2Q A;  1Q79 A;  2PO4 A;  3I56 S;  4DG1 B;  2GAH C;  4ZOS A;  1BWE A;  1O0P A;  4UTG A;  3EWG A;  5A8R B;  4BBY A;  4X84 A;  4DR3 J;  1HMV B;  4OZ3 A;  1NDP A;  3SZ2 A;  4ED7 A;  4IQM A;  3PVX A;  2AGO A;  3HHL B;  2CG4 A;  2F8H A;  3BO4 A;  5M2U A;  1JJC B;  2WBR A;  4FXD A;  3MFI A;  2PI5 A;  5LXY A;  2WTF A;  3PIO Q;  1FA0 A;  3PG9 A;  1RHJ B;  3PW7 A;  2ABY A;  3R5G A;  1VK8 A;  1BHN A;  2CZ4 A;  4LFB F;  5JVG Q;  3KLI B;  1NSA A;  3L95 X;  4YQW A;  2Y1I A;  2RS8 A;  4ZDN A;  3SIP B;  4I7F B;  3UVJ B;  3G6V A;  5B0A A;  2P6S A;  1VIS A;  5AJ3 J;  1DRZ A;  5B08 A;  5CCL A;  1Y0H A;  3MCM A;  1Q8L A;  3OUY B;  2ZVI A;  4R25 A;  1NKC A;  2HZV A;  2XLI A;  5D4O A;  1TP7 A;  2CVE A;  2LQJ A;  3LPY A;  1NHK L;  2DH7 A;  3BQ1 A;  1DAR A;  4KO0 A;  2ZOF A;  5B7W A;  2HQD A;  2E9R X;  3SFG A;  1K1Q A;  2IMO A;  2UXC J;  2F8E X;  4AXJ A;  4DN0 A;  2QRR A;  1H98 A;  2DNQ A;  5HAN A;  8AT1 B;  2CIM A;  4HLB A;  2V8P A;  2OPS A;  4IG3 A;  1YI2 S;  5AXN A;  1J27 A;  1SB6 A;  4FZV A;  1BWV A;  4DSI A;  5E3P A;  1S9E B;  1B64 A;  1P27 B;  2FJB B;  5F9N A;  3GJQ B;  4OI3 A;  1H2U X;  2KU7 A;  2N7C A;  4WBF A;  2FJX A;  3HZE A;  4OHZ A;  4DZD A;  3IXQ A;  3FQK A;  2MLZ A;  2XMA A;  1S1X A;  4RW4 A;  3CCW A;  2OGU A;  5DS7 A;  2GVD A;  2ZHA A;  2YKN A;  3VTI A;  2XMJ A;  4C98 A;  1OWX A;  3G82 A;  5EWF A;  4F67 A;  5H1S V;  1Y7P A;  3CCV S;  2R2T A;  3ENQ A;  1RAE B;  1SJ1 A;  2RIJ A;  2RDD A;  3RW7 A;  2M3D A;  5BXI A;  2QA2 A;  2C1E B;  2DEI A;  5DQG A;  1I94 F;  2X51 A;  3HK2 A;  4A46 A;  1GMW A;  4PAA A;  5C24 A;  1N6Q A;  1TUG B;  2VBX A;  3GCW P;  4QYZ J;  4F0H A;  2OP5 A;  1FCA A;  2PEB A;  4UY8 5;  4NLR A;  2BAN A;  2UUW A;  5T14 A;  2NQP A;  3FC9 A;  4JI4 F;  3G9C A;  2E7X A;  2K06 A;  4DSK A;  1XR6 A;  2F4F A;  3V5R A;  2E1A A;  1HBM A;  2KYZ A;  3UWT A;  2J0X A;  3CCL S;  1DTQ B;  2PDA A;  5F0W A;  3D7S B;  4X62 J;  2Y3Y A;  4C8M A;  3M8Y A;  2YTC A;  2GO8 A;  2M8D B;  1I6J A;  4WFX A;  4OZ2 A;  3RGI A;  1R0A A;  1SQE A;  1UVK A;  1HQU A;  3D54 A;  4NEZ A;  4RUH A;  3T6B A;  4O0I A;  1NJX A;  2IIH A;  3AA8 A;  1WHV A;  2DPI A;  1OO0 B;  4DR1 J;  2OPR A;  1NPR A;  3KLV A;  2C2D A;  3Q86 A;  1UFK A;  2B6A A;  5KFZ A;  2CNL B;  4CLW A;  1YJR A;  2DR7 A;  1FRX A;  4IOA Q;  4KT0 C;  2V6A A;  1U2C A;  4Y34 A;  2HLU A;  5GMD A;  3RR7 A;  1QAY A;  1PCA A;  2V50 A;  3H5Y A;  3J7Z T;  2NXU A;  2AX0 A;  2AW0 A;  2OKQ A;  3I5C A;  3DOK B;  5CYM A;  4MIW A;  3MED A;  2W2M P;  3GFY A;  2HHP A;  3K8V A;  4F04 B;  5DDO C;  3BR8 A;  1OIA A;  4DG1 A;  2OEK A;  4QIW D;  1VQY A;  1DZ5 A;  4CO2 A;  2WW8 A;  2J7W A;  1Q81 T;  1RDR A;  4O23 A;  3EDQ B;  2O5D A;  2L9D A;  4QR1 A;  4PYD A;  1Q8B A;  4ELV A;  2YKO A;  1HBU A;  2JVO A;  4JI6 F;  2IDE A;  1RT5 B;  4R0E A;  1CPZ A;  2HFU A;  4U9R A;  2XQC A;  3ISN D;  1PYS B;  4PG4 A;  3Q8S B;  2AX1 A;  2Y0B B;  3KK1 A;  3BBC A;  3GLJ A;  1HL6 A;  4UUW A;  2L9N A;  1WJ9 A;  3PCO B;  2KXF A;  1C0T B;  3CDE A;  4YN3 B;  4FS2 A;  5U47 A;  3KLI A;  4CO4 A;  3V6D B;  3OL7 A;  4DUY J;  4PKD B;  4PQU B;  4LVN P;  2DGU A;  4RWW A;  3DXS X;  3M7V A;  4G1I A;  3UNY A;  4KGK A;  4X4N A;  2EVZ A;  1FRJ A;  5IOL A;  2CAD A;  2MLY A;  3MEC B;  4ZS6 A;  2DHH A;  4IFY B;  4HTI A;  1IM4 A;  1NPP A;  3MMA A;  1SKR A;  2NXE A;  3M30 A;  1SC1 B;  5KFA A;  2LEA A;  1S1T B;  1JNR B;  1X0F A;  3VGT A;  4YOE A;  1KTQ A;  2IYI A;  1H7X A;  2RF2 A;  4A8F A;  3VAM A;  4EI2 A;  3I31 A;  1JX4 A;  1NDC A;  4YDD B;  2GHP A;  2BJ1 A;  1SVD A;  2XSJ B;  1A9N B;  4CT9 A;  2COL A;  2XYP B;  3SCI E;  5D3G B;  2QV6 A;  3OL8 A;  3GIL A;  4F4A A;  3K8W A;  3QFW A;  5HK4 A;  3D9B A;  2XNR A;  3C19 A;  3K89 A;  5DG9 A;  4NLU A;  4KHR A;  4ECW A;  4JI7 F;  3W3S A;  2FLL A;  5EX0 A;  5J2N B;  3CNQ P;  2N4D A;  1R31 A;  3FCV A;  2VQE F;  2HK3 A;  4GRS A;  1E6Y B;  2J0S D;  4LJM A;  2YWE A;  4IYQ A;  5E5N A;  3QGH A;  1CVJ A;  1L3S A;  1AZS A;  1F3V A;  4KE5 A;  1RCX B;  3H98 A;  3OXG A;  4J9N A;  2HND B;  4ECZ A;  1WC4 A;  4A8X A;  2ZBI A;  1IQT A;  3Q0A A;  2C2K B;  1EIY B;  3S01 A;  2O01 C;  4I64 A;  2CJA A;  2DNK A;  4OI4 A;  4C8L A;  3K5O A;  1HQE A;  1V3R A;  3SCK E;  3VR1 A;  1AB8 A;  5KFX A;  2ZZT A;  4ES3 A;  3C66 A;  4HDG A;  2J6T A;  3N5B A;  2Z30 B;  3PX6 A;  2CWK A;  3KG0 A;  3C46 A;  4TYA A;  3IWN C;  1HKA A;  1LEO A;  1X4H A;  3R2D J;  1PBU A;  4FPI A;  2IMW P;  2UU9 J;  1DTQ A;  3RRG A;  3BDE A;  3OTB A;  1HR0 F;  3HHD A;  2AP6 A;  3TOQ A;  2AEJ A;  4LFB J;  4UY8 T;  4DV0 F;  1Q1K A;  4WTY A;  3GG0 A;  3G6X A;  4GC6 A;  2NS1 B;  1HLW A;  2EFP A;  5G4D A;  2JFK A;  4K4W A;  2RS2 A;  3I9Z A;  4A8W A;  4RBU A;  4JI0 F;  3WHI A;  3VHQ A;  3NCR A;  1Z4U A;  2DNZ A;  1IBK J;  3DDK A;  5KFE A;  1KON A;  2VON A;  1WG4 A;  1NU4 A;  5CAB A;  1MW7 A;  4B08 A;  2DD8 S;  2HRX A;  1IR2 A;  2X1F A;  4OL8 A;  5BR8 J;  3E01 B;  3I4P A;  3DI6 B;  2CQ0 A;  3LTO A;  4ID5 B;  3LWL A;  3OFF A;  3SV3 A;  1FKA F;  4JB8 B;  3TUI C;  3KTQ A;  2AJ1 A;  3CD7 A;  5KG4 A;  4ECS A;  3A8E A;  1HWJ A;  3FSY A;  3TUP A;  5F3T A;  3WIU A;  1KD1 T;  4RU2 A;  1M1G A;  3MI7 X;  2K3I A;  4RZR A;  4JV1 A;  2XLK A;  3W2V B;  2GMH A;  3CIZ A;  4QYR A;  1HNZ F;  1RBA A;  1T11 A;  2ZKT A;  4PWU A;  1NK4 A;  3KOA A;  3G8S A;  4D3H A;  4P74 A;  4WP3 A;  1R8C A;  4KGV B;  2XWY A;  2QEX S;  3DMJ B;  1SI9 A;  3MAQ A;  3MR7 A;  3C6T B;  3OR2 B;  4CH0 S;  2E5H A;  1I94 J;  3LPE A;  5CD4 H;  3I0R B;  2NXC A;  2PN6 A;  1BQM B;  3LQV A;  3R8Y A;  4RNF A;  4RW6 A;  4DPW A;  4KHP J;  4CYU B;  4PQU A;  3RAX A;  3OL6 A;  1YBT A;  1FDN A;  1GT8 A;  3POT A;  3QLH B;  2ZKU A;  1FK9 A;  2HNZ B;  3HSJ A;  2CJX B;  1NKB A;  1YDL A;  1EET B;  2E7W A;  5F8L A;  3HMJ G;  4DV2 F;  3B4D A;  1TK0 A;  4JI4 J;  4NZ0 A;  2ZH4 A;  3K59 A;  2KKH A;  1UMJ A;  1JLE A;  4CLF A;  3KUG A;  4UQG A;  1S4F A;  4RNO A;  1YJ9 S;  4DFK A;  5KG0 A;  4PRF A;  4V19 X;  4V19 J;  1VLY A;  1FTC A;  4Y2K A;  1T03 B;  2OH2 A;  2NUU G;  1W2B R;  2VA3 A;  4F26 A;  5A76 A;  3D2W A;  1B70 B;  2FTR A;  2BRK A;  3SDE A;  2YVS A;  1RAD B;  2YKM A;  4Q2M A;  3H90 A;  2G2Z A;  1OMS A;  5HP1 A;  3VAH A;  2HQI A;  2MY8 A;  4MK9 A;  4DN9 A;  2OTL S;  3UCU P;  3M2U B;  2FVR A;  3HT3 A;  5EUH A;  3CMQ A;  4ED6 A;  5J2N A;  1ROF A;  4DL7 A;  3MEK A;  2B56 A;  2W4D A;  1FRL A;  5DZ6 A;  4HVZ A;  2VG5 A;  3M6U A;  2HGN A;  1CJK B;  1WC3 A;  5KFG A;  4ZPB A;  6FDR A;  5LOQ A;  2HND A;  3P3D A;  1F60 B;  3Q2T C;  3DYA B;  3CJS A;  4TY8 B;  1KP6 A;  4CLY A;  4WK1 A;  1XMQ F;  3HCX A;  1TL1 A;  5IM0 B;  2V8D A;  4QWC A;  3PO5 A;  1RLC L;  3CJT A;  2J9E A;  4JI6 J;  1BD6 A;  4PUO A;  1F1B B;  3LO3 A;  3PYG A;  4OZL A;  2W8L A;  3PDN A;  1QM9 A;  3KLE A;  2YPY A;  5E3C A;  1UJ6 A;  2EPI A;  3RR8 A;  3ADA C;  1Q7Y T;  2V8G A;  1U4B A;  2C2E A;  4FXW A;  2GW8 A;  4M1K A;  1LWF A;  1M0S A;  2KRR A;  3EZU A;  5AE3 A;  2KFZ A;  4J37 A;  1NHU A;  2D9O A;  2O67 A;  2F65 A;  4OI6 A;  4LR9 A;  1SKW A;  3CJ0 A;  3KK3 B;  3KFW X;  1RT6 A;  5HI7 A;  1BLU A;  4KTQ A;  2YWK A;  4K2X A;  5F8N A;  2PA3 A;  3SI8 A;  5D6G A;  3AFG A;  1VRU B;  4UZC A;  5ETQ A;  3NGD A;  3JQK A;  5A0Y B;  2LQ5 A;  3W2W A;  1FO1 A;  3ZNJ 1;  3OV7 A;  3E01 A;  5FDL B;  3R5D A;  2VDI A;  2C42 A;  4ED8 A;  4RJV A;  3X1L B;  4DCP B;  4ID5 A;  1U1Q A;  1RAB B;  5ETS A;  1RA6 A;  3A12 A;  1N5Y B;  2FVS A;  1MLA A;  3MCN A;  5B0D A;  2MLX A;  2I8E A;  2ROG A;  1ZA1 B;  3UNG C;  2DGQ A;  2CRL A;  1RHU B;  2D9P A;  2ZBC A;  3MMB A;  5I3U B;  3ZZZ A;  3RB4 A;  2C22 A;  4P75 A;  4UUX A;  1GXT A;  2A3J A;  3GYN A;  4LRF A;  3TJ9 A;  1OPZ A;  2FDN A;  4M63 A;  1VMB A;  2C3M A;  1DQA A;  3QAU A;  4DQI A;  2GO9 A;  1RT3 B;  5MAO A;  4QWB A;  5B0F A;  4LSZ B;  5KT7 A;  4JI7 J;  1NDL A;  2CJB A;  2G0I A;  4QIF A;  3D28 A;  4NMX A;  2O3D A;  4MFB B;  4KC5 A;  2VQE J;  4B17 A;  3HSD A;  3N28 A;  4XPE A;  2BE9 B;  3DMJ A;  5LJ5 Y;  4X4O A;  5D0R A;  1YG0 A;  4NXN F;  1NK6 A;  4QIG A;  3QT7 A;  4OV1 A;  1FE0 A;  3I0R A;  1V3Z A;  4R0J A;  2HKE A;  1C1B B;  4QIV A;  3OTC A;  4CYU A;  3BSA A;  2ZD1 A;  4PQA A;  2HNZ A;  4LMZ A;  2X3G A;  2DO4 A;  2E1M C;  4CNY A;  4X4Q A;  1R8A A;  3MM5 A;  2HHH J;  3DOL B;  2G2Y A;  1EQ0 A;  3AQP A;  2W4C A;  3OSN A;  2HBQ B;  2PEH A;  1AUD A;  5KFI A;  3CT9 A;  4FF1 A;  1NME B;  4NCB A;  2VFR A;  3TWZ A;  3V6H A;  2IA6 A;  4B9V A;  2YNH A;  4F02 A;  4CO5 A;  4J9M A;  4LQ9 A;  4NLS A;  4HYK A;  1HWU A;  1HR0 J;  1NKE A;  3KNG A;  3DHW C;  1FRK A;  1JLB B;  1PJ7 A;  3Q8U A;  3THV A;  3TR5 A;  4DV0 J;  4NLG A;  1WUU A;  3KKF A;  4K2J A;  2OFG X;  3WBZ A;  1T03 A;  2KXN B;  2HLT A;  2JLE A;  2YKP A;  5GME A;  3GB0 A;  1R7I A;  1RWU A;  1WC5 A;  3VVU A;  2CPE A;  1HNX F;  1B0P A;  4YFU A;  4K50 A;  2X1A A;  1ZPV A;  3DRR B;  1ZET A;  3M8Q B;  4B3O B;  4TN2 A;  2ALZ A;  3M2U A;  2XMM A;  5HSP A;  1KKH A;  3MM7 B;  4CO0 A;  2RDI A;  3NOC A;  2VJU A;  2HS0 A;  3KLG A;  1P8G A;  3R1L A;  4IDK B;  3D6M B;  3DRY A;  1RKI A;  2CPX A;  2J9C A;  2EK1 A;  2LU1 A;  4P52 A;  2B7B B;  1SH2 A;  3UD3 P;  4P2F A;  2R7W A;  2GQC A;  2DNY A;  5HMX A;  4K4V A;  5BJR A;  2WB4 A;  2XGQ A;  1XBW A;  1URN A;  4K7Q A;  3KLH B;  4RW8 A;  1LXN A;  2HVI A;  3PRV A;  5A8W B;  5IM0 A;  1RT2 A;  4J9L A;  1YLX A;  5KFC A;  4ZVO B;  1HNZ J;  2VIH A;  5LXR A;  2VH7 A;  4ZP7 A;  4DCJ B;  3MF5 A;  3PXG a;  3H2V E;  1LNQ A;  2ASJ A;  3R97 A;  3F0N A;  5T41 A;  2GGP A;  3ITH B;  1TKT A;  4ZVR B;  1WHY A;  2F9J A;  2DNP A;  3EIC A;  4ZVP B;  3BDP A;  2HHW A;  3A1Y G;  4J9V A;  3TAR A;  4F4Y A;  1RT7 A;  1L3V A;  4YHH F;  2VPX B;  4KH1 B;  4WII A;  4ZP9 A;  3HHL C;  4FNI A;  2AZ3 A;  4WKY A;  2YX1 A;  3RZA A;  4JYA F;  3BM7 A;  4ZN1 A;  4DUZ J;  1HWI A;  3EDR B;  4UW2 A;  1YGY A;  3HJV A;  3K5P A;  1X60 A;  4LF9 F;  3R7B B;  1DQ9 A;  3TA2 A;  3HP6 A;  5A6P A;  1FXD A;  4TU9 A;  4J9P A;  2ROP A;  4G1Q B;  3JSR A;  3GV8 B;  2GVZ A;  2I9S A;  1U0H A;  2HHU A;  4ZVG A;  1MML A;  2QA4 G;  4ILL A;  3U1N A;  4JP8 A;  2RRB A;  3OD2 A;  2FGC A;  2BJ9 A;  4O44 B;  3RJM B;  2ZHO A;  4B9N A;  2BBE A;  4X4T A;  1U8S A;  1UEK A;  4IR9 A;  1N5Y A;  2E5J A;  1F6T A;  3IMQ J;  5KFQ A;  2OD6 A;  5LMU F;  2POK A;  1HHS A;  4J5O A;  2RKI B;  2MY7 A;  3T1H F;  1VQ4 S;  3OW2 R;  3WDO A;  3PW0 A;  2DGV A;  4KR0 B;  3NGT A;  2HGL A;  1NH8 A;  3I0S B;  2LQ8 A;  4WF9 Q;  4B3S F;  3JXO A;  3BBF A;  3HD2 A;  3BEG B;  3GE9 A;  4C48 A;  3BQ0 A;  2EFG A;  3MEG A;  3UO0 A;  3HZG A;  1WOS A;  2OPP A;  4N47 A;  1RIS A;  1HWK A;  5D0E A;  1S1U A;  3DRS B;  2ERR A;  5KFJ A;  5F8I A;  2EW9 A;  1KFS A;  3TQ1 A;  2AMC B;  3P8B B;  4RU9 A;  5H9F K;  2RVJ A;  1XN9 A;  1JLC B;  1R6V A;  1PJ6 A;  5K8M A;  3W5Y A;  3IGV A;  1C1B A;  2JLF A;  4K4Z A;  3P5B P;  5D4P A;  1XMQ J;  4ECV A;  2ZIT A;  2GC8 A;  1OYD A;  4IG0 A;  2N3L A;  1Z2Z A;  1RAG B;  4YEA A;  3NKY A;  4I67 A;  2JDJ A;  4NCG A;  4DL6 A;  5D78 A;  4PG8 A;  2YNI A;  5D77 A;  4ITS A;  5DQH A;  2R8I A;  2DNR A;  3TZX A;  4ZK7 M;  3QMQ A;  4DV5 F;  2C2O B;  2GIF A;  1KQF B;  4YB1 P;  4PPD A;  3BQ2 A;  3AJD A;  2F9D A;  4M5L A;  4FYV B;  1JLB A;  1NCL A;  3DM2 B;  5CYQ B;  4X65 F;  4CP5 A;  3HVR A;  4NYZ A;  1H72 C;  4CM2 A;  3NCP A;  2JH3 A;  3LP0 A;  3J80 U;  3EGZ A;  1X5T A;  2ZH7 A;  5HAO A;  2F40 A;  4X4S A;  2V9K A;  3RBE A;  2FY1 A;  4B02 A;  3CUN A;  2W9C B;  4O3O A;  2V34 A;  3M8S A;  3U27 A;  1LWC B;  1SQG A;  1U1R A;  3BGL A;  3L09 A;  3H2L A;  2WSF C;  3T9Z A;  3T5J A;  1N34 F;  5GAE I;  3US5 A;  3AOC A;  3KJN B;  2Z56 B;  3H59 A;  3MM7 A;  3CJ2 A;  4I69 A;  1Y10 A;  3IR5 B;  3M2V B;  3C6U A;  5DET A;  5KFV A;  2OI2 A;  4IDK A;  4DX8 H;  2IRY A;  5B0C A;  4HH1 A;  3KHR A;  4GMK A;  4MTP A;  4P2X A;  4WFA Q;  3MM8 A;  1SC3 B;  1BXN A;  2QSF A;  1F5C A;  5L1J A;  1SBR A;  4GC7 A;  2R7V A;  3PW5 A;  3CJ3 A;  3FUY A;  5JVH Q;  3D0I E;  1SKU B;  2HHT A;  5DGB A;  4FYD A;  4TU8 A;  5FJ4 A;  1HYS B;  2W7A A;  5ETM A;  4ZP6 A;  2V94 A;  4DPX A;  2GS8 A;  1NDK A;  1GFW B;  4WZM A;  2C3P A;  1ZS6 A;  2DIT A;  2RH3 A;  4R8U B;  2OD4 A;  4LVO P;  2NPF A;  4CO3 A;  3U02 A;  1FKP B;  1QE1 B;  4DR4 F;  2WOM A;  3ITH A;  3JSM B;  2BKP A;  3M1V A;  3U1M A;  2W7P A;  5DG7 A;  3G2X A;  5IV4 A;  4LSN A;  3R9L A;  5H9E J;  4NXN J;  3NXZ A;  3FBE A;  5F0U A;  3GYX B;  3TUZ C;  1YJN S;  3VAF A;  4W92 B;  5GAH U;  1FFW B;  3JSY A;  2D1C A;  5ETO A;  1J5O B;  1RYR A;  1TMM A;  2JWN A;  2CQB A;  2ZFH A;  2QLX A;  2ZE2 A;  3LF0 A;  4OX9 F;  3PHE A;  4HH0 A;  2W9B B;  1YKW A;  1Y4Z B;  3OLB A;  5HBM A;  1K8A T;  2HZA A;  2H48 B;  2SXL A;  3C14 A;  4PXD A;  3K2Y A;  5G0R A;  1UCN A;  2AD9 A;  2RAQ A;  4PZV A;  4WK3 A;  2RRA A;  1HA1 A;  4NXM F;  3V6K A;  2UUC F;  2MZQ A;  3KLF A;  1IBM J;  3QGI A;  1AUS L;  4AQY F;  2LKZ A;  4DU8 A;  1J2V A;  1IWG A;  4LF7 F;  4O3P A;  2WZ1 A;  2APO A;  2FJE B;  1CG2 A;  1FF2 A;  1ZTW A;  5J1E B;  4UF4 A;  3K0J A;  2R4F A;  3D6H B;  2C2Z B;  1PC4 A;  3W9H A;  2M7S A;  1W7W A;  1HNX J;  2M5Y A;  2NSC A;  4ZVT B;  1UVN A;  1CJU B;  2BQ3 A;  3TX0 A;  3OTE A;  2D41 A;  5K14 A;  4QW9 A;  2K2P A;  2BKN A;  2PFF B;  2HS3 A;  2XZD B;  2HNY A;  3CGI A;  2Z2M A;  1REV B;  1F5A A;  5IT4 A;  5GVQ A;  1R8B A;  1U6F A;  3TZW A;  1OY8 A;  1RT1 B;  5CH7 B;  5IZH A;  1SL1 A;  2GJF A;  3VQS A;  3PR5 B;  3DRS A;  4Z2X A;  3CDA A;  2AYB A;  2G0J A;  1FT8 A;  1FD2 A;  1LFW A;  5DG8 A;  5KT5 A;  4JI5 F;  4XPC A;  2GCF A;  1JLC A;  1JMT A;  1T9W A;  5KG3 A;  1FKO B;  4B9L A;  4FF4 A;  2W1B A;  4KBI A;  4ZJL A;  1VHI A;  2BVZ A;  3FGV A;  2LXF A;  3KDN A;  2XTJ P;  2HWT A;  1FEE A;  1WC1 A;  1HBN B;  1CC7 A;  2CUY A;  9ATC B;  5KG1 A;  1U47 A;  3H40 A;  1DQ8 A;  3GCX P;  1QVF R;  2ZDO A;  4NOH A;  2RML A;  2QC3 A;  2LMI A;  3MEE B;  2VG7 B;  2HWI A;  3HVT B;  1NLK L;  3M2R B;  3SQG B;  2KDO A;  4YHH J;  4FBT A;  5K8O A;  1M5P C;  5KFP A;  4LF4 F;  3L3C A;  4OZ1 A;  5IV3 A;  3DM2 A;  2J0Q D;  2ZWO A;  1NND A;  1RAH B;  5GAG U;  3AXK A;  1WSV A;  5F41 A;  4XAK A;  4FS1 A;  1TL7 B;  3QT8 A;  2DR9 A;  3GON A;  2VZ9 A;  2B4P A;  1LWE B;  2BX6 A;  1JLF B;  3MWB A;  4PWW A;  2R7Q A;  5J1N A;  1KVK A;  1RWX B;  5JMN A;  3CJ4 A;  3N79 A;  1RWO B;  2A2D A;  1NJI T;  1T9X A;  3PTW A;  1K73 T;  2JZ5 A;  4DV6 F;  1FES A;  4MKV A;  2UUB F;  3BYP A;  3ET6 B;  3M2V A;  2B5J A;  2MQP A;  2E29 A;  5E33 A;  3NWR A;  2EG1 A;  2B3T B;  2C2M B;  1YJW S;  3IR7 B;  2WVB A;  1NRK A;  2AYE A;  2XBP A;  4OX8 A;  2H4Y B;  5LMU J;  2E5G A;  4N77 A;  2ZH3 A;  4QZV B;  2HAI A;  2DGW A;  2R8J A;  2XM3 A;  3T1H J;  2GJ2 A;  1X0P A;  4DHV A;  4F4K A;  4NLO A;  1SXL A;  3CXC R;  1KLM B;  4J9R A;  1Q53 A;  4B3S J;  5IQ6 A;  1BQN B;  4R8U A;  1ZPW X;  2HHS A;  3NBP B;  3F56 A;  2PGC A;  2KI2 A;  1IBL J;  3HT0 A;  1WF2 A;  1RAI B;  3P45 B;  5D0G A;  1EKR A;  2VIC A;  1KVJ A;  5C42 B;  5KG6 A;  3IRX B;  2Y1J A;  1WTF A;  3R27 A;  3I5B A;  3OVB A;  1J5O A;  2I0X A;  1K44 A;  4OIX A;  2XY6 A;  1QUV A;  4H4M A;  2BR0 A;  2DIV A;  2IY5 B;  2KO1 A;  2JC1 A;  2MZR A;  3IAM 9;  1KLN A;  2YWH A;  2DB1 A;  1UTA A;  3ISZ A;  2HBR B;  5EHH A;  2DXE A;  4GVL A;  4MT1 A;  3OBI A;  4H54 A;  5L1L A;  4Y65 A;  1RB0 A;  4ZCM A;  5BYS A;  1X4D A;  3FEX B;  1KFD A;  4LR7 A;  3AT1 B;  5K8N A;  2XG8 A;  3T1A A;  1FER A;  1UA0 A;  1S9G A;  2DHS A;  4O3R A;  5KFK A;  4FVC A;  3HVA A;  3AY0 A;  1UPM B;  2BEF A;  3MMJ A;  3MOZ A;  2RRN A;  3MD1 A;  3OL9 A;  3FCH A;  5KFW A;  3LP2 B;  1SH3 A;  3WIV A;  4DV5 J;  2RJZ A;  4C3M A;  3UN5 A;  4DJB A;  4PCQ A;  2L3M A;  4OHW A;  3I32 A;  1FDB A;  5I4M A;  1WKJ A;  4JOU A;  4X65 J;  1NXI A;  4EBE A;  1X9W A;  3NLC A;  3OT9 A;  2UVV A;  3KHL A;  2A0F B;  5LT5 A;  1CUL B;  2GZO A;  3L9Z A;  2Z57 B;  2RU9 A;  4K59 A;  4YB6 A;  3W7B A;  1BQX A;  3AB4 B;  4K5R A;  3C16 A;  3QO9 B;  1HI0 P;  2G0C A;  4KGX B;  1VJQ A; 
#chains in the Genus database with same CATH homology
 2MUI A;  2HAF A;  2GZO A;  2GS5 A;  2EW0 A;  2DO8 A;  2HRX A;  2AJ2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...