3IGNA

Crystal structure of the ggdef domain from marinobacter aquaeolei diguanylate cyclase complexed with c-di-gmp - northeast structural genomics consortium target mqr89a
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
166
structure length
166
Chain Sequence
AKLSMTDRLTGLLNRGTWENLVDAEYERFRRYGQATSLVMFDIDHFKPVNDTYGHLAGDEVIRHTADVTRNNIRQSDSAGRYGGEEFGIILPETDAESARVICERIREAIEKSTVSTSAGDIQYTVSMGIAQLTETPENYMQWMQKADEALYKAKESGRNKVVVSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Diguanylate cyclase
publication title Crystal structure of a catalytically active GG(D/E)EF diguanylate cyclase domain from Marinobacter aquaeolei with bound c-di-GMP product.
pubmed doi rcsb
source organism Marinobacter aquaeolei vt8
molecule tags Transferase
total genus 52
structure length 166
sequence length 166
ec nomenclature ec 2.7.7.65: Diguanylate cyclase.
pdb deposition date 2009-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00990 GGDEF Diguanylate cyclase, GGDEF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3ignA00
1SV5B 3M8PA 2AU0A 3QLHB 2R2TA 5KFSA 3LANA 4RNNA 4RUCA 4URGA 4DG1B 3TQ1A 2E9TA 4NLQA 2VA2A 1S0MA 5L1LA 1NHVA 3KNAA 1LWCB 1T94A 4ID5B 5T14A 5EDWA 1WNEA 3FFIB 3JSMA 3SI8A 4ECWA 2YNGA 4NCGA 4IQXA 5C24A 5KT6A 1RT1B 2OPQA 2YKNB 2YKMA 3M9NB 4ED1A 3KMQA 1SH0A 3FQKA 1DTTA 2R8JA 2WB4A 3QGGA 4IH6A 5F9LA 2HMIA 1RT6B 1TKZA 3BQ0A 4Q43A 4YR2A 1EETA 1S1TA 1IKVB 1K1SA 3ITHB 1N6QB 2UVWA 5J2QA 3MR5A 2JEJA 5KFGA 3CWJA 1LW0A 4KKOA 2WOMB 4NLPA 4RW9B 4B3OA 5KFQA 4O3PA 1RTHA 4KSEB 2YNHA 3BSCA 4MIBA 1C2PA 3BQ1A 2YNFA 4RW4B 3H59A 2BE2B 1U09A 1RT3A 2IC3B 5F8HA 4ED6A 3T5KA 2FVCA 3I0SB 4IKAA 3KK2A 3KK3A 2V0NA 4J9OA 4ECRA 4R8UB 5I42B 4WXOA 3G6YA 1RTDB 3OHBA 5JUMA 1HQUB 5KFKA 4J9LA 3DRSB 1RT2A 1HPZB 2B6AB 1LWEA 1JLAB 4I2PB 1VRUA 3UR0A 3H5YA 4DL2A 3DM2A 3MFHA 1R0AA 4QWCA 3UDLA 4ZPAA 2BANB 4Y34A 2YNIB 1KLMA 1JLFB 2WHOA 5KFRA 2FVSA 4J9SA 1S1XB 4DL4A 3N6NA 2IM1A 3NKYA 1S9EB 3MEDB 3NAIA 4RW7A 1T05A 3NL0A 3MR2A 1C1BB 3FQLA 2RKIA 4ECZA 5EWGA 5KFTA 4ECVA 2ILZA 4NLYA 1BQNA 2C28A 2JEIA 3T5JA 3KHRA 1FKOA 3E01B 3ISNC 1RTJA 3PW2A 3BGRB 1TL3B 4LSNB 4ED2A 4PUOA 5KT2A 2W7OA 4JV0A 3DMJB 2FLNA 4WYLA 1MMLA 3PJXA 1BQMA 3QIPA 3CJ3A 3IGNA 3FSIA 3G6VA 4IR1A 2ASLA 1QUVA 3MEGB 4WFYA 2I5JA 3T19A 2XC9A 5HLFA 4URQU 2D7SA 5KFFA 3MEEB 3KLIB 3TAMA 4TXSA 3LP1B 4Y2CA 3KHGA 4O44B 3KLHA 3JYTB 4O4GA 4TN2A 2UVRA 4F4WA 5KFMA 3GIIA 2BQRA 3UQSA 1K1QA 3PR4A 4WZQA 3DLEA 5K14A 3CIZA 1DLOA 4K4YA 1TV6A 1IKWA 4NRTA 1XR6A 4QW9A 1RAJA 3QO9A 5DG8A 2AWZA 1HNIB 3IRXA 4DEZA 4KFBB 5DQIA 5C42A 2JEGA 3DLKB 4WFZA 3OL6A 3KLGB 1FK9A 4ZP7A 3GV7B 4LQ3A 1HMVA 1SUQB 2D3UA 3IG1A 3NAHA 4IDKB 4TLRA 2WONB 1RT7B 2WRMA 4H4MA 5KFJA 4Q0BB 3ICLA 4NLTA 5J2PB 2FJXA 5KFBA 2HNZB 3GQCA 2OPSB 2VG5B 3RB4A 3NMAA 1S1UA 2BR0A 4ED8A 3I5AA 2RDIA 3MR6A 1N5YB 2C2EA 3C6TB 2IC3A 5KG2A 4ECYA 4WE1B 1TKXA 3V81B 2IAJA 4XPCA 4RNHA 3V6HA 4I2QA 1IM4A 2R8IA 4ZP6A 1EP4B 3NBPB 4WFXA 3DRPA 1TL1A 4NLGA 1QE1B 1RA6A 4ZPDA 2HNDB 4MFBB 4TQRA 4QW8A 4ZMMA 4PWDA 1HNVB 2C22A 3QZ7A 5KG4A 1NNDA 2BRLA 5J2MA 2OH2A 3KK1B 3SFGA 1S0OA 5CYMB 5DLGA 2IM3A 1D0EA 1HQEB 3PJWA 5D3GA 4XPEA 3V4IB 5DQHA 3N6LA 1XR5A 3LP0A 5KFPA 3RBDA 2QE5A 3LAMA 4ZHRA 1S9GA 2VG7B 3GYNA 5KFHA 4ICLA 3G6XA 2R2UA 5KG3A 3RBEA 3DI6A 4Q8FA 1RT4B 1LWFB 5J2NB 4NLSA 1S6PB 4DL7A 4FS2A 5KFCA 1MU2B 1XR7A 1N48A 4MIAA 2R2SA 1REVB 2FJVA 1S4FA 5CYQA 5DGAA 2R8GA 1JLEB 1S97A 4GC7A 2RDJA 4KV8A 2FVRA 4QWEA 1IKYB 1FKPB 1RDRA 3PHEA 4H4OB 3KLEA 2FVQA 2ZE2A 5F8IA 3M9MB 2R8HA 4YR0A 4ECSA 3BR9A 4IFYA 3V6DB 3DOKA 1N56A 5C25B 3LP2A 3CDEA 2F8EX 4G1QA 5FDLA 4KBIA 4ZP9A 3GV8B 3QZ8A 2FVPA 4IG3B 3FRZA 2GC8A 1RT5A 1TKTB 1Z4UA 2BQ3A 3HVWA 4IFVB 2XWYA 3DRRB 3MF5A 4NRUA 1ZETA 4ECXA 4KHRA 2XI2A 1S1VA 2AGPA 1LW2A 3CDWA 3C6UB 3H2LA 3MECA 3M8QA 3CJ4A 1JLBA 5KFIA 4OL8A 4KO0B 2OPRA 3KJVB 1JLCB 4URSA 4J9RA 4JUZA 4IRDA 3I0RB 4RNOA 1ZTTA 2W9BB 4TY8B 1JXLA 2R8KA 4LSLB 2D41A 1JIHA 1I6JA 1DTQB 4RW6A 4I7FA 3V6JA 1S6QA 2ZD1B 1JLQA 1D1UA 3QYYA 5J1EB 1J5OA 3DOLA 3RAXA 1W25A 2ILYA 1C0UB 1YVFA 1QAIA 1HYSB 4YP3A 3IGVA 2IJFA 5JXSA 3EPGA 3DYAB 3V6KA 1C0TA 5DG9A 2WTFA 2B5JA 3EZUA 1JLGB 2CJQA 4R5PA 1T03B 1RTIB 5CYMA 5HROA 4DL6A 2J6UA 4IRCA 2RF2B 1S0NA 4F4YA 5I3UB 2IA6A 2OPPB 4NLDA 3KLFA 3Q8RB 3DLGB 3HVTB 4F4XA 2JC0A 1S49A 3QIDA 1JKHB 1UWBB 5F8LA 1SV5A 3M9OB 4J9NA 3T5HA 2DPIA 2UVVA 4FBUA 3QLHA 4K50A 1IKXB 4IG0B 3PW5A 2ATLA 3MR3A 3T1AA 4K4WA 4HYKA 1S1WB 3DDKA 3Q8QB 4DG1A 1VRTB 4TYBA 2HNYB 2W9CB 5KFXA 3Q8SB 1LWCA 5HBMB 4ID5A 4PQUB 2VG6B 4MKBA 1GX6A 3M8PB 3FFIA 4ZPBA 4RNMA 4O3SA 2AX0A 4K4ZA 2IM2A 1RT1A 2YKNA 1RA7A 3MTKA 2ASDA 3KMSA 3H98A 1ZTWA 1RT6A 2C2DA 4KB7A 3KHHA 2VA3A 1IKVA 4YR3A 3ITHA 3RAQA 3JSMB 1N6QA 2R2RA 4MH8A 3H4DA 3Q8PB 2YNGB 4NCGB 4RW9A 1T3NA 2W7PA 2WOMA 5C24B 2OPQB 4QWBA 2YKMB 5KFWA 4MK8A 5KFUA 4TQSA 2HWIA 4FS1A 1DTTB 4RW4A 2BE2A 3RB6A 2HWHA 2HMIB 2B43A 4EYIB 4NLVA 3ISND 4K4XA 1TKZB 4O4RA 3I0SA 1EETB 1S1TB 4R8UA 5I42A 1OS5A 3IS9B 4RW8B 5KFEA 4KAIA 4ECUA 1CSJA 2JLEA 1HQUA 5J2QB 1LW0B 4KKOB 1QAJA 1RTDA 4B3OB 1TP7A 3DRSA 4EO8A 3PW0A 1RTHB 4ZVFA 3N6MA 5DQGA 1HPZA 2B6AA 2YNHB 1JLAA 3HKWA 2XI3A 4I2PA 4ECTA 3T5LA 2YNFB 3OL8A 4FBTA 1RT3B 3PZPA 4O3NA 2FJWA 2BANA 2YNIA 3KK2B 3KK3B 1JLFA 3KHLA 4EEYA 4F4ZA 4O3OA 2I1RA 1S1XA 4JV1A 5L1JA 5F9NA 5F8GA 4IOBA 1S9EA 3MEDA 1RT2B 4J9MA 2UVUA 1LWEB 1C1BA 1VRUB 5F8JA 4RU9A 3MFIA 4ED7A 4K4UA 1R0AB 3DM2B 3BQ2A 5KG7A 4NLOA 3OHAA 3H4BA 4IH5A 2E9RX 4RNFA 1KLMB 4DL5A 3CJ5A 3E01A 2XGQA 3BGRA 4YQWA 1TL3A 4LSNA 3GV5B 2V4QA 2FLLA 3PW4A 1T05B 4RW7B 4ZPCA 1RYSA 3DMJA 5EWFA 4H54A 1N4LA 4HKQA 3RB3A 2RKIB 2O5DA 2DPJA 3GILA 3PVXA 2IMWP 3MEGA 5L1KA 1BQNB 3GIMA 3MEEA 4EBCA 1FKOB 3KLIA 4R0EA 4Y2AA 4Q8EA 5KFAA 3LP1A 1RTJB 2XGPA 4DL3A 4O44A 4K4SA 3JYTA 3FDSA 4PUOB 4X2BA 4ED3A 4EYHB 1HARA 5KFNA 1KHVA 1BQMB 3QIPB 2E9ZA 5KFZA 2UUTA 4QPXA 5HLFB 2I5JB 4WZMA 1HNIA 3HVAA 4KFBA 3TAMB 4MKAA 4EBEA 2J6SA 3DLKA 3KLGA 3KLHB 4O4GB 4J9QA 3BSOA 2QV6A 4JV2A 1SUQA 4IDKA 3OLAA 3DLEB 2WONA 1RT7A 5K14B 2AX1A 1DLOB 4NLRA 1TV6B 3OLBA 1RYRA 1IKWB 4Q0BA 5J2PA 2HNZA 5DGBA 2OPSA 3QO9B 2VG5A 5KG1A 3BREA 3IRXB 1N5YA 4ZVGA 3LALA 3IN5A 3C6TA 5C42B 5KT5A 4WE1A 3GIJA 1FK9B 3V81A 3H5SA 1HMVB 3IG1B 2J6TA 3IS9A 4RW8A 4RUAA 5EUHA 4IR9A 4H4MB 1EP4A 3NBPA 4Y3CA 4GC6A 3GIKA 1QE1A 4K4VA 4M94A 1S1UB 2ALZA 2HNDA 4M95A 3PW7A 4MFBA 5KT3A 2EC0A 1HNVA 5F8MA 1TVRB 1TKXB 4MK7A 3RB0A 2IAJB 1S48A 3CO9A 3KK1A 4NLUA 4I2QB 1JX4A 4U6PA 3CVKA 2IJNA 1HQEA 5F8NA 5HP1B 3V4IA 3DRPB 1TL1B 4KE5A 2WCXA 2XCPA 4XO0A 1KHWA 4RZRA 2VG7A 4PWDB 4NZ0A 3BSNA 4EBDA 4EO6A 3CDUA 1RT4A 1LWFA 5J2MB 5J2NA 1S6PA 2UUWA 4QWAA 1MU2A 3BSAA 5D3GB 4ZP8A 3H5XA 1C1CB 1NHUA 3D5MA 1REVA 3LP0B 3BJYA 1JLEA 1TQLA 5L1IA 4ZHRB 1IKYA 1FKPA 1S9GB 4H4OA 4ICLB 2IBKA 4LQ9A 3DI6B 3SFUA 5KG0A 3V6DA 5L9XA 5C25A 3I5CA 1GX5A 3EPIA 5CYQB 4NLXA 4IG3A 4IRKA 3D28A 4KV8B 3QGHA 2AGQA 4NYZA 1TKTA 3OL9A 4IFVA 3DRRA 4U7CA 3KLEB 4ED0A 3CJ2A 4Q44A 2ZE2B 3LAKA 4YMEA 5KG5A 4IFYB 3DOKB 5DG7A 3LP2B 2W8KA 4G3IA 3TVKA 3C6UA 3OSNA 2AQ4A 5KT4A 4G1QB 3E51A 3HHKA 4NLWA 4WXWA 4KO0A 5FDLB 2HAIA 3NGDA 1JLCA 3KJVA 2WK4A 2BRKA 3I0RA 4F50A 1RT5B 2CKWA 1SH2A 2W9BA 4TY8A 4J9PA 4LSLA 1SH3A 4TY9A 4Q45A 2V4RA 1DTQA 4O3QA 2GIQA 1S1VB 1S9FA 1LW2B 2ZD1A 3I5BA 3M8QB 3MECB 4K4TA 1JLBB 3UPFA 4J9KA 2OPRB 5J1EA 2V9WA 3H5UA 2JEFA 4IH7A 4ZVHA 2D3ZA 2W9AA 3VQSA 2ZKUA 5KFLA 1C0UA 2AGOA 1HYSA 4RW6B 4I7FB 1TVRA 1S6QB 3DYAA 5KFDA 1JLQB 3CJ0A 4ECQA 2BQUA 4MK9A 2W8LA 1JLGA 1T03A 2JC1A 1RTIA 3KLVA 1J5OB 2RF2A 5HP1A 2IM0A 5EWEA 3DOLB 3G86A 3OL7A 5I3UA 2OPPA 3KOAA 3DLGA 3QGIA 3HVTA 3OSPA 1JKHA 1UWBA 4KHMA 4TYAA 5KG6A 1C0TB 1IKXA 4IG0A 2B5JB 2C2RA 4O3RA 1S10A 4R5PB 2XCAA 5KFOA 5HROB 1S1WA 5KT7A 2ASJA 4ZVEA 5C5JA 1VRTA 1C1CA 5KFYA 2HNYA 3PR5B 4QWDA 2W9CA 4WYWA 3KLFB 5KFVA 2FLPA 5HBMA 3H40A 4PQUA 2VG6A 5DLFA 2GIRA
chains in the Genus database with same CATH superfamily
4CRJA 2M88A 3OTBA 2WW4A 3W5YA 1YQHA 5L1LA 4USVA 3VAFA 3WQPA 5D8HB 4JI7F 3JSMA 4LF9F 2C2NA 5EHHA 2HRUA 2OEKA 1JJCB 4YR2A 2DRAA 1K1SA 3Q8UA 3TJ9A 1CS4A 2XS2A 5A76A 2XHCA 3VWSA 3J81j 1HQ2A 4ETXA 2R3VA 4A8XA 4ECRA 2GV1A 5I42B 4J9LA 2QLJB 4ID8A 2ABYA 2ACMA 1JLAB 2AD9A 3FUYA 1QAXA 4ETZA 2IPOB 3TNVA 2HHTA 1YG0A 2IY5B 3MR2A 2ILZA 1U2FA 1NDLA 4V19J 3QJJA 1FJCA 1NO8A 2SXLA 4FNHA 1IBCB 5HLFA 2J0WA 3R6LB 1AZSA 4K4YA 3H2VE 4FP9A 1VQ7S 1C4CA 2EBGA 2DNOA 1N36F 4ZIWA 3CMES 3LWMA 3CD5A 3MR6A 2KFYA 1VQ4S 1N0UA 2CG8A 3V6HA 2GQ2A 4CNZA 3NBPB 2E1MC 1QAYA 3W7BA 4DLGA 4AXIA 4DR1F 4XPEA 3THPA 3OVBA 1H98A 1KOHA 3LAMA 2G0IA 4I4BA 2YWFA 5LSLA 4M1KA 1TL7A 5E3AA 2XSJB 2FB0A 2KT2A 4DSJA 2FC8A 1QSSA 1R6YA 3EGZA 2GHVC 2BA9A 1IBKJ 3PFOA 1FKAF 3CDWA 5GADU 2MEWA 2IRYA 4LSLB 1Y4ZB 1NMEB 3SCKE 2F40A 2NZ4A 4X84A 4C11B 2QLXA 5LM7E 2J6UA 2XB2D 2HFSA 3J81U 5HMXA 4J9NA 1ZA1B 3TW0A 4HYKA 3OQ2A 3SXLA 2HEKA 1S4EA 3M8PB 1FJGJ 3C14A 4B3RF 1NDCA 1RHMB 2HHVA 2RB7A 3T1HJ 3HULA 2AMCB 4CT9A 2DR9A 4YR3A 3CCJS 1KFSA 2JDJA 5B0FA 3M6VA 1N5QA 1ZAVA 4HT5A 3I87A 4DV7J 4ZN3A 2YWEA 1CEZA 1S1TB 3DXBA 4R8UA 1HBUB 3L09A 2OIHA 2VFRA 3DRSA 1PYSB 3KHLA 2VBXA 4EEYA 4OJGA 5L1JA 2FZGB 4FKYA 2D9OA 2FJDB 5E3PA 2XS5A 3BO4A 2JX2A 3KUHA 4P74A 2GVZB 5EWFA 2ROEA 3H42A 3RB3A 1R8PA 2J76E 2ZC3A 4EBCA 2DO4A 4O44A 3VAJA 1SQEA 2CNNB 1JWWA 2ZDPA 4Q2LA 4WZMA 3VZHA 2P9GA 3I9V9 1TR0A 3DLEB 1HIYA 4DSKA 2MKJA 1RWUA 3QO9B 3BREA 4RO0A 3G8SA 3MMBA 4LRAA 5EUHA 1PBAA 1N54B 2CVEA 2LEAA 2UUAF 3PW7A 5FLXY 3W9IA 2Z2ZA 2NR0A 5HP1B 4USHA 2DNZA 3JQKA 4MKVA 5IM0A 4RZRA 3D1OA 1S79A 1MU2A 5D3GB 1XNQF 1RHRB 1IKYA 2ZJQQ 3C2PA 4GRSA 2HSEB 5L9XA 5LSOA 3QT7A 3CDAA 3QGHA 4IFVA 2CXEA 1ZPWX 3K2YA 1P8GA 1APSA 4IFYB 2A6MA 1DJ0A 2ZBCA 1DRZA 2WBRA 3CSKA 4K4TA 4YY3F 3Q89A 1Y3KA 1HL6A 1OQ3A 2D3ZA 1HYSA 3DYAA 1JLQB 1TTHB 4RU2A 3G86A 3OL7A 5DM7Q 1HI1A 1RJJA 2DNNA 4ZVTB 3FBCA 1TUGB 2CDQA 1SJ4P 2WW8A 2HNYA 3R7NB 1V3RA 2KXHA 1YRTA 3SEOA 5E2QA 1FESA 3DOMA 1KTVA 2K1RB 1S7HA 4W4MA 2V2VA 2B4OA 2YKPA 2YNGA 1NSAA 4HHUA 3EZOA 5DDQC 5D0HA 3G82B 2QMXA 4YB6A 4LIRA 3AAWB 4B3OA 3A3OB 4FKXA 3VGUA 3B4MA 2CRLA 5CCMA 5LMUJ 1RT3A 2IC3B 2FVCA 2ZH9A 1FWLA 1EIYB 3NGSA 1RT2A 3JQJA 1A7GE 3RJMB 2AKWB 4ERDA 3NAIA 5CHCB 1ZM2A 1L5UA 5KFTA 4ECVA 1F9EB 2OGUA 4NPOA 2F1FA 1FA0A 3RRGA 1TL3B 3M1VA 1WSVA 2JLGA 2D7SA 3MEEB 1K8AT 2GGPB 1HR0F 4F4WA 5IWAJ 3L95X 4FXVA 4ZVOB 5T7LB 3W63A 5DQIA 1Q78A 3D67A 1B70B 2H5IB 2BR0A 3TJAA 1DARA 1VQYA 2VQFJ 3CULA 1RA6A 3R5BA 3ZZYA 1LFWA 4MFBB 1Y7PA 2ZVSA 4UT4A 4USWA 1GFWB 2WSCC 4IOAQ 3AXMA 2R2UA 3W2WA 1HKAA 2PMHA 2V68A 2RHSB 1CJUB 4LF4F 2AYBA 1NJWA 4C0HA 3V6DB 4DSEA 3GFZA 5C25B 3FCHA 1L3TA 2O3DA 5FDLA 1NPRA 5LXYA 3CCSS 3GU0A 1UVMA 3AH6A 3SMZA 2Y1JA 1WG4A 2HK2A 3BS9A 3M8QA 4KO0B 3VGSA 4PZVA 4MT1A 3O6QA 4A8MP 2MY8A 2XLKA 3ISZA 4LR7A 5IT4A 3QYYA 1YJTA 2BXJA 2FY8A 4P75A 1Z2LA 2N3OA 4NA1A 4RPFA 5IT0A 2IJFA 3FVYA 4AE5A 1YGYA 1JLGB 1HBNB 5DDRC 2KRBA 1S0NA 3MM6B 3Q8RB 1RHJB 2A0FB 2MQLA 3QLHA 4N76A 4L3NA 3TRGA 1VOMA 4DR5J 2VHGA 1FXDA 4M5HA 4DG1A 3LQVA 3BZQA 3FBBA 3IA0A 3RAMA 3Q8SB 4PQUB 2DNGA 3PYEA 1MLAA 3KMSA 1E6VA 2MJNA 4KB7A 1N0VC 3BV8A 4M5GA 2Z57B 2A18A 2J7UA 2HWHA 3I96A 3G6ES 1EETB 5D15A 1WUUA 1LW0B 3J7A1 3OXGA 4I2PA 2DY9A 4DJBA 4ECTA 3MM8A 3WHIA 3KK3B 2HS0A 8ATCB 3MUVP 5ITHA 1GQEA 5G4DA 2B4PA 2Q66A 3FNNA 4R25A 5B0CA 4OMFG 3DMJA 1N4LA 2HVIA 3AY0A 3R8YA 1AFJA 1RSCA 3J80Y 2PFDA 3MMJA 4JB8B 2XGPA 5DJBA 4DV0F 4GKJF 2HQCA 2QT7A 4WIQA 1BQMB 1KQKA 1WTFA 4DR3J 3GIRA 2ZM6J 4FF1A 2ZH1A 1KQFB 3C6TA 4WE1A 2GNKA 3IG1B 1YJNS 5J1PA 1F5CA 4A8SA 5AXLA 4M94A 3QRRA 3NXZA 4NLUA 1WHWA 2FIUA 1BLUA 1KLNA 1VQNS 2VASA 4K0KJ 4AQYJ 2IYIA 3QATA 4DV3J 2CWKA 2IBKA 3J7AN 2QTWA 2PDAA 1H7XA 5C2CA 2F63A 3CMQA 1KC8T 3MURP 5KG5A 3HCXA 2XSFA 1G1XA 2XYPB 4J90A 2ZD1A 4ZLPA 5J1EA 5BYRA 3HO1A 2BYCA 2JFKA 3EDQB 2YWGA 3FSXA 2EG1A 1PAUB 2ZZNA 2BQUA 1KQSR 3N79A 5HP1A 2OSRA 2HHPA 3D1QA 4I68A 4NI2B 4LIWA 4PAAA 1H2TZ 4NE9C 5KG6A 2L48A 4IG0A 1FDAA 1NU4A 2QSWA 2C3PA 5KT7A 1FEHA 2VBWA 4YDXA 2XMWA 5IV4A 5HL7Q 3PTWA 4L75A 3GJRB 3HHEA 1S0MA 4JI0J 3D1HA 1G4CA 1RQ0A 1GMWD 1TELA 5K5MA 5C24A 5KT6A 3CT9A 5JVHQ 2VFSA 1IKVB 1N6QB 2JEJA 2LCWA 2BE2B 1UW4A 3T5KA 3O5TB 1GXLA 5EX0A 2GQCA 4D3HA 3G6YA 4N8NA 5B0EA 3ENWA 1UFWA 2E44A 4OHXA 2WHOA 5ETRA 3LF0A 2EEYA 1S9EB 3K5NA 1C1BB 3I4HX 1F5BA 2MKSA 3CCUS 3R2CJ 1RLDA 2HGNA 4TKTA 1RTJA 1ITPA 2ZJPQ 1R43A 4X4SA 3QIPA 1VDHA 2L9WA 3EE3A 3GB0A 1UVKA 2RIJA 1WHXA 2HAFA 3IRXA 3UVJA 2JEGA 3OL6A 1VBKA 1RT7B 3CCES 3MAQA 4N56A 5CD4H 2AHOB 1U2CA 3NMAA 1OYEA 2NQPA 3I5AA 1U0SA 2IC3A 3EZ5A 1IN0A 5A0YA 4M5DB 5A8RA 3BM7A 5GAGI 1Q4RA 3HVRA 3D7SB 4LF8J 4QCLA 2QSFA 3UN5A 2CWXA 4G1PA 1T7PA 3G4SS 4L74A 3HXMA 4LF7F 4FS2A 2AEMA 4OZ0A 1S97A 3MM5A 4QWEA 2UUCF 1Q8IA 2Y1IA 4IG3B 1SKUB 3FRZA 2GC8A 2DH9A 2R7XA 4DX7A 1PGZA 4HDGA 3JXOA 4H4KC 1LW2A 1U8SA 7AT1B 1UEUA 2HBRB 3CNQP 2Z2MA 5J1NA 2H3EB 1F9FA 1FDNA 2CJYB 4YB7A 2Q43A 3BYPA 1S6QA 4EFAC 1PO6A 3BBBA 1R8HA 3OBIA 2UU9F 3D54A 3A4TA 2KO1A 2B5JA 1VC0A 5HROA 2GA7A 4UY85 3I6PA 3KLFA 1RAOA 1G6BA 2JC0A 3M9OB 3QAUA 2EG2A 1VRTB 3WC2A 4AYBD 2W9CB 3PJ9A 3R5CA 2HIYA 3FFIA 3LGHA 1HNWF 2GAGC 4ILMA 4ES3A 2R2RA 4MH8A 4KHPF 2W7PA 4MK8A 1UFKA 1BUXA 5E0OA 3R1HA 4NLVA 1OS5A 3PCOB 2R9LA 1TP7A 5A2QU 3OTOF 3I4PA 2ZBRA 2YNFB 4PYAA 3OR2B 4CWBA 2BANA 2A2CA 3FBEA 1S1XA 3W2VB 4IO1A 4K4UA 5KG7A 1T9UA 3MM6A 1UPMB 4IUFA 4X4OA 4U96A 2CQ3A 1XNQJ 5GAEI 2AJ2A 2RKIB 2CUYA 2DPJA 1H72C 4E2FB 2DHGA 2KTQA 2E1RA 5KFZA 1S0VA 1VQ9S 3GR1A 4AL5A 2EFPA 1FFWB 4JV2A 3OW2R 4DZ6A 1M5HA 1X8DA 2CZ4A 3HFZB 2GQQA 4YY3J 4WKYA 2J6TA 4IR9A 2VODA 1YI2S 1R89A 4NZ7A 4M95A 1D3WA 4MK7A 2M3DA 1FX4A 4DV6F 1FFSB 3CD7A 2KT5A 4Z7CA 3GSIA 3HFKA 4DV1J 3N5FA 4P2XA 1NSKL 4RWWA 2LQ9A 1FKPA 4Q5VA 3N28A 2JFDA 3I32A 2R4FA 4DR2J 3D28A 1DFDA 1YJUA 2POKA 2BBEA 3KKFA 3IBCB 2Z8QA 4PCQA 3HHKA 4NLWA 4WXWA 1Q81T 3NGDA 1U1KA 3WIVA 2W9BA 2RH3A 1SH3A 5K8OA 2GIQA 1I1GA 3TX8A 1S9FA 1HBMA 1Y11A 2QG9B 3UD5A 2ERRA 1HBOA 4JI6J 2K8GA 1QVGR 2AGOA 3OUYA 5KFDA 1UJ6A 2K3KA 3M2UB 2NSCA 1UTAA 2G0CA 4R5PB 4QOTA 2CQIA 2VG6A 2HGMA 4PWWA 1BGXT 4RNNA 1EKSA 1HR0J 3ZTSA 3AA9A 3BH6B 3NCPA 1RT1B 1SH0A 1PC4A 2XHWA 2DEJA 2WSFC 2PA3A 1L3UA 1NBEB 3VR1A 1N34F 1HNXF 1KRPA 2JNJA 1HQUB 5G0RA 3FMBA 4B3SF 3OR1B 3L7UA 3IO1A 2YNIB 5GAGU 5LJ3Y 4RW7A 1NJXA 2E7VA 3KHRA 3P96A 4DR4F 2W4PA 2B4UA 2KHCA 3ISNC 4QR0A 3SZ2A 4JI5J 4DV2F 3EGWB 1KP6A 4KJIA 3A13A 3MEGB 1JXVA 1GMVA 5KFFA 1KVJA 2W1BA 3U27A 2XLJA 4LF6F 1CJTB 2Q3PA 1FK9A 4WKRA 2CFXA 4JI1J 2I9SA 4TLRA 2WONB 2WRMA 3C19A 3L7OA 4NLTA 1N5YB 3RBZA 4ECYA 3VF0B 2UUBJ 3MAAB 3QBCA 4NLGA 3G8QA 1D0EA 4F02A 4CH7A 1S9GA 1X9SA 4Q8FA 1S6PB 4ES2A 4DL7A 3THVA 1REVB 1FRIA 5AE3A 4OLOA 1RWKB 1N56A 2HQIA 2F8EX 4CCHA 3VGTA 4ZJOA 1RT5A 4JI3F 3MF5A 4OHZA 5K8PA 3OFEA 3H2LA 3MECA 3PYGA 3KJVB 1T9VA 2QZ8A 4ER8A 1DTQB 1SJ3P 1N8RT 3GE9A 3OXLA 5D4OA 1D1UA 1IBLJ 3C16A 3HHDA 3DOLA 3AOBA 4CLFA 4YP3A 2DGVA 1TUWA 4DL6A 3IMQJ 2IDLA 2XY6A 1X4CA 1JKHB 3K57A 3T5HA 2KM8C 1Q8BA 1EB0A 3W5ZA 4GKJJ 5KFXA 5GAEU 3A12A 4CO4A 1FD2A 3H90A 4CNYA 4K4ZA 3PO5A 3K59A 1U45A 1U1LA 1Q5VA 5B7WA 5HQLA 3RAQA 3E3XA 3DLLQ 2BJ3A 4ANCA 2KKHA 3G8TA 3RB6A 4HI1A 2XMAA 4FNIA 4KGZB 2VFTA 1RWPB 2DHAA 1T8EA 3HFVA 5HVGA 4BLGA 4PXBA 2KZZA 4H4KA 2WVEA 4JV1A 2V6AA 4ZCIA 4DFMA 2UVUA 1SB6A 4DS5A 3RRKA 4NLOA 2E9RX 1KLMB 4DL5A 3E01A 3ENVA 4DX6A 4BWMA 4AD6A 4QZVB 4B9LA 3TARA 3P8BB 4ED3A 3JSYA 2I5JB 2V4JB 1RAFB 1U1NA 1HNIA 4AT1B 1FRXA 1RWOB 3VAGA 4N7TA 2OPSA 2CPDA 1X4FA 2KH9A 1VQ5S 3HK2A 2V50A 3CJKB 2HS4A 3BDEA 1SIWB 1UW9A 4CTAB 3MOJB 5BR8F 1RU2A 3HLUA 1U1MA 2QL9B 1RCXB 1FTCA 4NA3A 3CO9A 4PG7A 4MYUA 2JJ4D 3BSNA 4EBDA 1Y5LB 2PSZA 4MJKA 2CQCA 3C3LA 4HR2A 3DC2A 4ZHRB 1U02A 5C7PA 4LBHA 3U02A 3MWBA 3CDBA 3EPIA 4ZJQA 1F2HA 3CCWA 3C6UA 5M2RA 3TR5A 1FVQA 3O2IA 4HHJA 4O3QA 1U4BA 4LUBA 2QLFB 2Q6CA 3ETOA 4NEZA 4CO5A 3HX9A 3EUNA 4KR0B 4UOGA 3BYRA 1SC3B 2IM0A 4DLEA 3DLGA 2FHOB 3IBWA 3M7VA 4TU7A 4O3RA 3KJQB 2V2ZA 4OJ1A 2HLTA 4WYWA 4DQRA 5F8GA 2PEBA 4P2SA 4NXMF 1LXNA 2CQ2A 4M63A 1FRJA 3KUGA 4ID5B 2CAJA 3BO2A 4ZVQB 4XIUA 2P6SA 2YBVA 3M8WA 2YKNB 3P45B 2N4CA 4ED1A 3MCMA 3OD2A 4PR6A 1RTHA 1V5VA 4YDDB 1OO0B 1LK5A 1RTDB 1CQNA 3ZTPA 2ZBIA 4DL2A 3DM2A 1IQZA 3RR7A 4Y34A 4CLPA 2F4VJ 4DV5J 4B9SA 4J9SA 4DL4A 3MEDB 4ECZA 1WEYA 5HI7A 4DPYA 3T5JA 2KFZA 4O0NA 4ZS6A 3IXQA 2MQQA 2G4BA 4PUOA 1P9QC 2PO4A 5CH7B 3BGLA 2DXEA 2UUCJ 1WC1A 2ASLA 2MY7A 4ALZA 2Q79A 1XMQF 1FERA 2UVRA 2P9EA 4IDKB 3NAHA 5L46A 4I6AA 1UVNA 1FX2A 4N41A 1N5TA 1QE1B 1Z1ZA 4ZMMA 4PWDA 2BW2A 4NXNF 1VHIA 2YY3A 4QYRA 1Y5IB 5E33A 3VCDA 1SJQA 1FCAA 4OIXA 3IWXA 2VG7B 1LWFB 2BZ2A 4AL6A 4F4AA 3RRHA 1WHVA 1LV5A 3QJPA 3MEKA 4ZN1A 2FY1A 4ECSA 2R8HA 3ZZTA 1T0TV 3T3FA 1VI7A 2BVZA 3MMCB 2P8IA 3W62A 1VLOA 4FYYB 1N5VA 4KHRA 4C3KA 1REGX 1YBTA 2CQDA 5HQMA 1JLCB 3KXDA 3N0VA 1JIHA 2R7TA 1O6XA 3DLJA 5B08A 1J5OA 4FDFA 3NG8A 5U47A 3PDNA 4KH0B 2OLWA 1IR0A 3HVTB 1UWBB 3LGMA 1SV5A 4EMDA 1IKXB 2R7WA 3HJFA 4OZNA 3T1YJ 3DHXA 1XBWA 2C3OA 1LWCA 1GX6A 4F7VA 1SBRA 4ZPBA 2IM2A 1RA7A 1HHSA 2KXFA 3GMGA 3GFXA 2VA3A 3O1LA 1P1TA 3H4DA 1HWLA 3Q8PB 4QWBA 3FSYA 4USIA 1FDDA 2CPYA 4FS1A 1DTTB 4DPWA 3UCZP 4EYIB 3R7BB 1QAJA 5D4PA 3U1NA 4F3QA 3N4WA 4FBTA 4CO3A 1T11A 3SBMA 2DGOA 4X4UA 1VLYA 3EXYA 3QNWB 5IXUA 5F3ZA 5F8JA 3VGVA 4HACA 5ETTA 2Z2LA 4KGMA 2N7CA 4YEAA 3O8WA 2I8EA 3NNCA 3QGPA 2O5DA 2X1FA 1FKOB 1VIXA 4Y2AA 4DL3A 4Z37A 3FC9A 2E9ZA 5JVGQ 1QDUB 5IQQA 2Y3YA 1T9YA 4HTIA 1RYRA 4C8MA 1EQMA 1S12A 2OEJA 2ALYB 1U6FA 3CJTA 1P6TA 1I5OB 1XN9A 3MPUB 4H4MB 1Q7LB 4NOHA 2C2OB 2LDIA 1EARA 4TNOA 2I38A 1SXLA 1S48A 2YX4A 5DZ7A 4I2QB 2IJNA 3O44A 3DRPB 1Q79A 1GAOA 2M0GB 1JLEA 3LW5C 4QU7A 2YXLA 2EPIA 1Q16B 5CYQB 2J9DE 2QGFB 3BN7A 4LFCF 2VDHA 3CJ2A 1X31C 2JLFA 4M5KA 3TA0A 3KJFB 2W4DA 3UR3C 1AFIA 2OAUA 1E6YA 2YPZA 1BC6A 1JLBB 2B56A 2ZFHA 3X1LB 2DNLA 3BR8A 2CJAA 4C3LA 1DQ8A 4RW6B 4B3SJ 2H5JB 4ZPWR 1RTIA 1U0HA 5HK4A 4OYAA 1CJVB 3QGIA 1C0TB 5HAOA 2QMWA 4EGLA 1S10A 4ZVEA 3V5RA 2XS7A 2DCLA 4P6QA 2MSSA 3K17A 4X66J 5KFSA 2R7OA 2VA2A 1YBUA 2A3JA 4ZCLA 2I6WA 2HZVA 2M2BA 4ZVSB 4M5LA 2KJVA 1SJFA 4Q43A 4RW9B 1C2PA 3OTCA 4OI0A 1S76D 3I0SB 4I6YA 1VIOA 4WXOA 2XY7A 3F41A 1VRUA 4LFBJ 2MQNA 1R0BG 5HVHA 3N6NA 1WF0A 3EWGA 2LEPA 3ET6B 1WTBA 1BQNA 1MN7A 1NDPA 4LJMA 2HVZA 2HBQB 3PJXA 1VBYA 3R27A 4AUKA 3KLIB 3M30B 4Y2CA 1X4AA 3KLHA 1OY9A 1N33F 2EFVA 1KONA 1TV6A 4C48A 4ZP7A 1URRA 3MM7B 5KFJA 1NJZA 1TK8A 2OTJS 3QWUA 2IAJA 5B0AA 3NP5A 2HNDB 3MD3A 3QZ7A 3D3BJ 1Q8KA 5DQHA 3N6LA 2QE5A 1ZH5A 4ICLA 3DCAA 2HFNA 5A8WB 2MB0B 2HHHF 1BHNA 1S4FA 2RDJA 1FNXH 2UXCJ 2BOPA 4G1QA 4ED5A 2XBPA 5IT9Y 2QFIA 4ECXA 2MKCA 4HLBA 4OX9F 4P2MA 9ATCB 2DGUA 1I6JA 2HYIB 4CDIA 2ZH5A 8AT1B 1B7FA 3IRWP 1RZMA 2WVDA 1YIJS 2CPXA 1G7CB 1LWXA 4ZCKA 4DF8A 2ZHAA 4OQJA 3FCVA 5I3UB 2OPPB 4OZ5A 2DPIA 3D6HB 1KSPA 3P49B 4K7QA 2CPFA 1URNA 1B3TA 2OFHX 1DAXA 1R31A 2C2DA 2W4CA 3ITHA 2X7IA 3JSMB 1YTYA 1NK4A 2FLOA 1KNZA 2AYEA 1WKKA 3W64A 3IS9B 4OI4A 3ELHA 4EO8A 3T5LA 1CS4B 3OL8A 3F56A 2YPYA 1JLFA 1WC4A 2DCUB 3BQ2A 3A8EA 1QLNA 4C0BA 4RNFA 4Y0FA 2CQPA 3AQPA 2GHWA 2IMWP 3DN9A 1H38A 1XMOJ 4Q8EA 1CC7A 2QA4G 3LP1A 1WG5A 5ETLA 1H2UX 5B0BA 3AB4B 2XY5A 5HLFB 4X64F 3DLKA 1SUQA 2VU5A 4FXWA 4QQBA 4QIVA 1R8CA 3K8VA 3B54A 5HMZA 5CYJA 4LRDA 2DK2A 1YKWA 1YZ7A 3KK1A 3R97A 4U6PA 3I55S 2PD1A 4KE5A 3T6JA 1VQPS 5HANA 4RBUA 4YUDA 5LMNJ 3SDEA 2BMBA 3ILLA 1UCNA 3UI3A 4H4OA 4UW2A 4QYZJ 4B9UA 1QY7A 3MUTP 2RMLA 1TL7B 4JI8J 1NKEA 4LT6A 4QYZK 1TU0B 4B3TF 4CO2A 2BV3A 1NAQA 1FRKA 2V5HG 4A8QA 5ETMA 5SUHA 1PBUA 4PXDA 3M6XA 1C0UA 4DV4J 3TA1A 3M8RA 4OYWA 2F9DA 1SQFA 2PMWA 3M2RA 2JH3A 3OSPA 2XZTB 1N5SA 1JK9B 4WFNQ 5IOLA 3CCLS 2F7VA 3BKTA 3H40A 1NJYA 4OZJA 1YRUA 1HLWA 2KXNB 3W61A 5FLXU 5T14A 2BM1A 3C14B 4EZ6A 4NCGA 2H4WB 3DLBA 3KMQA 4WCEQ 2AP6A 3IWLA 4C8YA 5HJYA 1AT1B 3MR5A 1N52B 1RABB 5JJBA 5IV3A 4OYZA 3KK2A 3DRYA 2V0NA 4R8UB 4CLKA 3DRSB 2E7WA 3MM9A 5KFRA 3OTEA 4KC5A 1T05A 1J5EF 2DNPA 3EGVA 1HA1A 2JEIA 2MZ1A 1XERA 4UQGA 1VC5A 1R8AA 2YWKA 2QIFA 4URQU 1SKWA 1FRHA 4O44B 4O4GA 2XZDB 1VK3A 1NPPA 4ED4A 2AWZA 1D8ZA 4FF2A 1B0PA 4RUBA 3GV7B 1HNZF 2RQKA 3RB4A 1TKXA 4XPCA 3MMBB 4RNHA 4JYAF 2KVQE 2V63A 1TL1A 3TOQA 4E98A 1SJ1A 1YBAA 2MQ8A 1X4DA 1S0OA 5DLGA 2IM3A 5IM0B 1X7VA 5B09A 4W98A 3TZZA 2DTJA 1MU2B 1RAGB 4YHHJ 2R8GA 4GC7A 1IKYB 2KYZA 3B8HA 2A2DA 3KLEA 1LFPA 4DPXA 3DOKA 3LP2A 3CDEA 4GVLA 3I82A 2IRXA 3QZ8A 1RUSA 3GV8B 4JBCA 4OX6A 4ZITA 4IFVB 4NEYA 4X4TA 3IP0A 1V5IB 4URSA 3HHNB 2N7YA 2BE7D 1K0VA 3PNIA 4UOHA 3PHTA 4JI2J 1DQ9A 3SQGA 4I69A 3ZZ0A 1HYSB 3IWNC 2K7JA 3DYAB 3UN2A 2J0SD 5CD4A 3I56S 4U7UD 2ZHBA 3RU0A 3PYFA 3PW5A 1S99A 2QJ3A 4TYBA 2HNYB 4CQ1A 1VJQA 2B9EA 1WWHA 1S72S 1MROA 3CE8A 3DOMB 2V2QA 4V1Ak 1SIZA 2NXJA 2NXEA 4X65F 1RT6A 2IVFB 3KHHA 2YNGB 5I3PA 2HHWA 3KTQA 4TQSA 4RW4A 3RG6A 2HW3A 3NGKA 3HI9A 4K4XA 4JV5F 3VHQA 3GFYA 3DDIA 5KFEA 3NCRA 4B3OB 3PW0A 2B6AA 3AHPA 4Y65A 3C46A 1RT3B 4J9VA 2O66A 4RUHA 1RT2B 3EDRB 1KTQA 2HFZA 1I94J 3C15A 2E5HA 4LSNA 2DH7A 5B0GA 1ZYQA 4N8OA 1W2BR 4ZCMA 3GIMA 2DHSA 3M1VB 1EQ0A 1V6HA 2W2PP 3IC1A 3A8JA 2KU7A 3R5JB 3TUZC 4GKKF 4XTTA 4DXLA 2W7AA 3BSOA 3NEKA 2AX1A 2BJDA 2BM0A 4CYUA 2ZH8A 2VG5A 5K20B 4ZVGA 3IN5A 2H51B 4P7VA 4L72B 3IS9A 4WPAA 4I67A 2ALZA 2F3JA 3R1LA 4LF5J 2XMUA 2W2NP 3ZO7A 5AXMA 2OTLS 2LFVA 3NLCA 4KGVB 1HQEA 3FBFA 3M6WA 2A6OA 2WCXA 1Q1KA 1RT4A 2RU3A 2PIIA 3H5XA 2LP4A 1RWNB 1M1KT 3W2WB 5D0EA 1FRLA 2VPWB 2GW8A 1VYAA 1TKTA 1A6LA 1U7LA 2MZQA 5DG7A 2KHDA 2CIMA 3TVKA 5FDLB 1FO1A 3I0RA 3M8YA 2OKQA 2V4RA 2ZWPA 1IM6A 2DVIA 3M8QB 1DZ5A 2LXFA 3OJSA 2W9AA 1JNRB 1KS2A 3J80U 1FJ7A 4ZIVA 1NLKL 1Y10A 2VQEF 1RTZA 1VRQC 1RBAA 3DHWC 1WG1A 1UJ5A 2E5LF 2NUHA 5KFOA 1S1WA 2ZH4A 3BDPA 3PR5B 4QWDA 5HBMA 3QLHB 1D9DA 3W60A 2QA4S 4DG1B 1Q86T 4DR6J 1OWXA 1FFGB 1E6VB 4IH6A 1H73A 1TKZA 5J2QA 2ROPA 5KFQA 4O3PA 1D9AA 3OPKA 5F8HA 4I0WA 4IKAA 1C4AA 5M2PA 1SL2A 4WTYA 3CIMA 5AJ3J 3ADAC 4F36A 1U48A 4I2PB 3MM8B 2RUGA 3MFHA 1R0AA 1M5VC 3UDLA 4K2XA 3MZIA 2PI5A 4CH0S 2GZOA 2B51A 3DMJB 1CJKA 1H2VZ 4IR1A 4TXSA 3D68A 5KFMA 3GIIA 2OSQA 4P9SA 1IKWA 2RHQB 4A8OA 5CZVA 3HSGA 3POTA 5C42A 2X3GA 2DISA 5K9FA 4Z2XA 3R9LA 4BWJA 2DH8A 2FJXA 4C4WA 3TAPA 3C6TB 4WE1B 2FJEB 1AA1B 2AYMA 4OLPA 2XYHB 2BRLA 3BO3A 3LP0A 1ZS6A 3BKFA 1R7IA 3G6XA 4JOUA 2LQ8A 4NLSA 3ZC4A 1GMUA 2DGTA 2YH0A 5DGAA 5D78A 2N4DA 2FVQA 3HSZA 2XMTA 4ZP9A 2BQ3A 1SC4B 4WU3A 2ZEJA 2PE8A 2AGPA 2KL8A 4OL8A 2MXYA 2XMMA 3Q83A 4Y2MA 1N32J 2ZD1B 2A10A 5J1EB 2NZCA 3TJ8A 2YQ1A 2RILA 3FEYB 1ZAXA 2WTFA 3EZUA 5ETNA 3KFWX 3G96A 3HZGA 4NLDA 5I4MA 2JZ5A 2ADBA 4IG0B 4F8RA 3DDKA 3SSRA 1UP1A 3GFHA 1RKJA 2CJXB 2NPIA 1HD1A 5K8MA 5C24B 1OJ4A 4DUZJ 2LKZA 2QEXS 1CSJA 2HGLA 1IJEB 2E1PA 1JMTA 1ACMB 3JB9k 2QX0A 1X0FA 1YK9A 1QTNB 3VAIA 1VJWA 2UXDF 3QJLA 3OHAA 4Y28C 3SQOP 2YH1A 3OFHA 5L1KA 3TZWA 1EAYC 2EFOA 1UPPA 2CQBA 1RTJB 1SC6A 3KG0A 4B3MJ 4EU0A 3QIPB 2C3YA 3MOZA 3DNCA 2BW7A 4KFBA 1W26A 4B3TJ 3PRDA 4CLZA 4RX6A 2QV6A 2IVMA 3K5OA 3IRXB 3UVJB 3LALA 4OZ1A 1XQIA 4M5IA 3V81A 4OV6A 2WVFA 4WTOB 2RQCA 4Y3CA 4PYDA 2K06A 5F0UA 1JX4A 5A0YB 3L7PA 5A8RB 2HHSA 2ZBQA 3R7SB 1IR2A 2ASYA 4NZ0A 4EO6A 3CDUA 3PV8A 1NKCA 1IBMJ 1WC6A 1IXKA 4ZP8A 3NS5A 4KT0C 3RR8A 1GMWA 2YKQA 2DNMA 4ZLJA 2NUUG 3I5CA 2HRYA 4LRBA 2V94A 3OL9A 3MM5B 4NYZA 3A8IA 5AXKA 4U7CA 4YMEA 2X51A 2J9DA 1X5PA 5KT4A 1IBKF 1IUJA 2BRKA 3MI7X 4C8LA 1LW2B 1HWJA 2DO0A 4ES1A 4J9KA 1M5SA 1VQLS 1NK7A 1S6QB 2M9KA 1R6VA 2DHXA 1T03A 4BC7A 4NYPA 3DU5A 2ROGA 3W5XA 2B5JB 3UDVA 2MKYA 3BPSP 5HROB 3VV2B 3KLFB 2C1EB 1TK0A 4U8VA 2B0GA 1FJGF 3LANA 2C3UA 3HF5A 5IQ6A 2BJ8A 4NLQA 3VALA 3T1HF 2BOAA 2A1BA 1CULA 4GO7X 1ZZNA 2NREA 4M8LA 3FFIB 2VOOA 3QRPA 4XAKA 1O8BA 4DV7F 5F9LA 2VICA 2HMIA 3MPVA 1NH7A 4P7TA 3MDFA 3D4JA 3UW1A 5LOQA 4O23A 4EZ9A 1SVDA 2YNHA 2EK6A 4JYAJ 1OY8A 5KFKA 2XG8A 1J27A 3AOAA 3UDCA 2BANB 3DGPA 4NL5A 1S1XB 4CLUA 2E66A 4BHQA 4NLYA 2GVDA 5HJXA 1PJ7A 3KUEA 4OI6A 1XNRF 3V2UC 3GWCA 3CJ3A 3IGNA 3FSIA 3G6VA 5GMDA 4MIWA 2E7XA 1S7IA 2IMOA 1DLOA 1NDKA 1XWLA 1RAJA 4DUYF 4LQ3A 4LVNP 4WP3A 4C0OC 2BX6A 2RRNA 2CJKA 3TI0A 4WFXA 2UXBJ 1NSPA 2J8SA 4C8ZA 5J2MA 2OH2A 4J37A 4L3KA 2DNKA 4OYPA 3F0NA 3RBDA 1F60B 2V34A 5IC4B 2OMLA 3H25A 1Q5YA 2DR8A 4C98A 4KV8A 1FKPB 5BYSA 3NOGA 2M8DB 2X3DA 2ZE2A 4OV1A 4JI4J 3VZIA 1MMNA 2FVPA 3EVWA 1JJ2R 2LVWA 3HVWA 2MGZA 1UA1A 3AOCA 3EYZA 2V8DA 4CLTA 4FYWB 4JV5J 4K5SA 5DDPC 4LRCA 2W9BB 4F25A 4KYZA 4DPTA 1HBMB 4C7QA 2DXDA 2L08A 1HBOB 3FJ2A 2L3MA 3FZBA 1HFEL 3M05A 3OUYB 1SKRA 1WI8A 2DHHA 5D0GA 4IRCA 4FBUA 4WFBQ 3SCJE 3T1AA 1WD6A 2XYGB 2VB6A 2VG6B 2DYAA 1U6BA 4GKKJ 3MTKA 2P9CA 3H98A 2KJWA 1KR4A 4JI7J 5IZHA 5DO2A 4LF9J 2WOMA 2IVYA 2RRAA 5LMUF 3D3CJ 4UUXA 2JLEA 2XMKA 1X5SA 3N6MA 1HPZA 2JWNA 3NNAA 3R2DJ 3FMWA 4F4ZA 1BY9A 3MXHP 4LR9A 5G0RB 2ZH3A 3RTVA 4F2SA 4Q7AA 4TU8A 3ENAA 3BGRA 4EI2A 2GMJA 3PW4A 3HD1A 4RW7B 3CGIA 5EGYA 1JB0C 2F9JA 2FGOA 4PG6A 2RRBA 3JYTA 2XULA 3S8SA 5IWAF 4C97A 2BE9B 1M1HA 4XDCA 3GR0A 4J9QA 5E7OB 5AT1B 9RUBA 3OLBA 2ZITA 2HNZA 1VQSA 3A3PB 4X4QA 2VUGA 1N36J 1FK9B 6FDRA 4ELUA 1QD1A 2VPZB 2NXNA 4AFFA 3GIKA 2VQFF 3UNYA 2EC0A 1HNVA 3RB0A 1U6ZA 1J2VA 3CVKA 1VBZA 4F04B 4HTJA 1B7YB 2B7CB 3LO3A 4U9RA 4DR1J 1V9OA 5J2NA 1NH8A 3BJYA 4UZBA 3CCRS 2AIRB 1S9GB 3DDNA 4LQ9A 2B7BB 5KG0A 3QQCD 5LXRA 1DQAA 4QR2A 1VHFA 4DI6A 4KPCA 3R5AA 1U24A 1PKUA 2UV8G 3DRRA 3JAMY 4ED0A 1D9FA 1TUVA 1MWYA 4X2BA 4LBIA 1RT5B 3CTRA 4DDFA 4Q45A 2D1CA 2MHNA 3MD1A 3MECB 3UPFA 2V9WA 2IDEA 3T9NA 3G9CA 2FZKB 4ECQA 1U1PA 3HHLC 2PN6A 1XTZA 3C16B 3DOLB 2O1PA 2ZZTA 4P10A 1NSQA 2D3OR 2VH7A 2W2MP 2XCAA 4CO1A 4DR5F 4PEOA 5CCLA 4J7CA 1QUPA 5KFVA 4A46A 2FLPA 2GHPA 2GIRA 2AZ1A 2H65B 4RJVA 4HT7A 1FHTA 3GP9A 1NXIA 3Q86A 3J7YI 3Q8YA 4B3RJ 4F0HA 5HO4A 2V2KA 3GSDA 1JJ4A 3EX7B 2CPEA 2YKMA 5D6GA 5A8KA 5CAAA 3W3SA 1WHYA 4OYBA 2K7KA 1U09A 3BBFA 4CH1A 5JUMA 4QWCA 3HP6A 2E29A 1XC9A 2E1AA 3D0GE 3TUIC 3VQTA 4W90B 1PSDA 1SQGA 3CO0P 1FTRA 2C2KB 4ITSA 1M1GA 3PXGa 3E01B 4DF4A 4JV0A 2FLNA 4UTGA 3B6BA 2UV8A 5B0DA 1RHQB 1PYTA 1H74A 3KHGA 2H4YB 4DR3F 4TN2A 1K73T 1JQGA 1K1QA 4UQTA 2ZM6F 2MPUA 4QW9A 5GVQA 1HNIB 2DT9A 2KVIA 3ICLA 5KFBA 4RL1A 2GMLA 2OPSB 3GJSB 4J9UE 5KG2A 4L76A 3BF4A 4MAKA 2UUAJ 3G87A 4ZPDA 3TAQA 1FWPA 1AXQA 1U8WA 4PWUA 2MTLA 3MCSA 4K0KF 3SFGA 1VS3A 2DRDA 4AQYF 3IM9A 1MW7A 4DV3F 3RBEA 3FRYA 5M2UA 1BD6A 1RACB 5HQ8A 1X9MA 2R2SA 2FVRA 3Q8VA 3X3UA 1GTHA 3M9MB 4YR0A 4KBIA 1ELOA 4NZ6A 1PJ6A 1UAWA 3S6EA 2O01C 2PT0A 2YKAA 1S1VA 3C6UB 2OPRA 2FPHX 4JUZA 1ZOTA 2XNRA 4I7FA 2FJBB 1U25A 3T41A 1TL5A 2C2ZB 1UETA 2MSTA 4PPZA 3EPGA 3M32A 2UXDJ 3TEHB 1MSWD 3PACA 3N9UC 4PXCA 3DLGB 4NA2A 2BQRA 5DS7A 4R0JA 1MN9A 2XMVA 1NZAA 2QFJA 3HD2A 2DITA 2W2OP 4MKBA 2QRRA 4OX7A 4JI0F 1M5KC 2ZUGA 1HWUA 3MMAA 1XJWB 3RUBL 1TMMA 2CJBA 4PG4A 3F73A 1OSDA 2OO4A 3CC2S 4CLYA 1ZM3A 1WACA 3TA2A 1T9XA 1RTHB 4F3OA 3DM2B 3K5PA 2DRBA 4AXJA 5KTQA 5HN0A 2KN4A 2XNQA 2AW0A 4HKQA 1M5OC 2BJ1A 3UN3A 4EK2A 5KFAA 1X4HA 4PUOB 4FF3A 2PA8D 4Y00A 3JTOA 1QM9A 1ZA2B 2BKPA 3KLGA 2CNOB 2EK1A 3RZAA 4P73A 4Q0BA 5J2PA 2RDDA 2YWHA 1UL3A 2HKEA 2PC6A 1NCLA 2IA0A 1EP4A 3NOCA 1F5AA 2YWWA 2CQ4A 4OHVA 5F8MA 2ZOFA 3R5GA 5FIIA 3LPYA 2ZKTA 4LF8F 4HDHA 1F6TA 3V4IA 4FYDA 4G65A 2E5GA 5IS2A 4PWDB 3NGTA 2UUWA 4LMZA 4JP8A 4C2MA 2LQBA 3D5MA 4E0DA 3QFWA 3DU6A 4F67A 1WOSA 1DHMA 3HM9A 1GX5A 4LF4J 3HDSA 3CD6S 1Y5NB 4F3MA 2GJ2A 2HQDA 3JTPA 3R6GB 2W8KA 1HHQA 2HAIA 2QO3A 2RVJA 3J7YU 1RK8A 4TY8A 2GFFA 3DFEA 3A1YG 3I5BA 3QAEA 1Q0NA 2X1BA 3NS6A 5E3RA 1UMJA 4IH7A 1WF1A 4PKDB 2HG4A 3GCXP 1CC8A 1X4EA 1J5OB 2RF2A 5EWEA 3AXKA 1GH8A 2MMYA 2DIVA 4TYAA 4OHYA 2GMHA 1PIEA 1XMBA 1XNRJ 4G6VB 1SV5B 2HFOA 1U1OA 1ICEB 1EX8A 2R2TA 2KG0A 2P6TA 2KRRA 3TQ1A 2MKHA 1AUSL 1LWCB 2QLBB 3ULHA 3GJTB 3IR7B 3ENQA 2OPQA 5I3QA 4DUYJ 4A8WA 3Q0AA 4K5RA 2C3MA 4Q2MA 2ADCA 3NS7B 3TP2A 5H9FJ 2UVWA 5KFGA 4KKOA 1HD0A 4RR5A 3ETMA 4MIBA 1NB2A 4UOCA 4BS2A 3H59A 4USTA 4U67Q 6AT1B 3VAKA 1YITS 5H9FK 4ANEA 1MG7A 3RBXA 1LWEA 3UR0A 2MQOA 2RAQA 2DGWA 1S59A 2IM1A 5HVFA 2HFUA 4KQZA 3IAS9 3Q2TC 1NEEA 4HACB 2MQMA 2CQ0A 3HHLA 4UOFA 3BGFA 4N5SA 1WORA 2EKNA 2ZOMA 3QPIA 5ETQA 3TAMA 4DV0J 1D09B 2IRUA 1O51A 5K14A 3CC4S 4NRTA 2B4VA 2KM8B 3OFFA 1HMVA 2MJUA 1YJRA 3NWGA 2QN6B 4WK1A 3H7HB 1S1UA 4ED8A 2RDIA 1ZM4A 3WC0A 3D66A 4RLEA 2CPIA 4AL7A 1FNOA 2DNRA 2B9XA 4DV1F 2HHUA 1RHKB 4Y6IA 2Y8YA 3EM1A 1XR5A 2QL5B 4C6AA 3JQMA 4KGKA 3D6TB 3GYNA 3M2VA 3DI6A 2JRSA 4NCBA 1XR7A 1F9HA 2Z0GA 1JLEB 1VQ8S 1SL0A 4DR2F 5H9EJ 3CW2C 3QT5A 3PEHA 2NXCA 1X5OA 3FKBA 1Z4UA 2M4MA 5H1SV 5H9EK 4NWBA 3TZYA 4X4RA 2QYGA 4C8KA 1H3DA 4JI6F 5EN1A 4A4JA 3V6JA 1E6YB 2P2CB 4KTQA 2RU9A 3LPEA 3OFGA 4OX8A 2ZBPA 2ZOGA 4DFJA 2OELA 1Y9OA 1YVFA 3CUNA 1RTIB 1P27B 1U0HB 2Q6BA 5MLCV 3S7RA 5E5NA 4F4XA 1S49A 1RLCL 5KOXA 4K50A 2Z4PA 2ATLA 3W9JA 4I64A 1QSYA 2D69A 3Q8QB 1RP5A 3KWMA 4WK3A 4RNMA 2AX0A 2Y9HA 3LUYA 3PRVA 2YQ3A 1KQGB 4P71A 1IVZA 3IFEA 3TYTA 4PG5A 1KD1T 5I42A 1RKIA 1JLAA 5HATA 2WSEC 2FJWA 3H8YA 2MLZA 3OT9A 1D8YA 5DETA 3ZNJ1 2AZ3A 1VRUB 3QRQA 4ED7A 5IT9U 1NK5A 2XGQA 4QIGA 2V4QA 4JI5F 4C9DA 3NWRA 1YSJA 3PVXA 4KIAA 1CPZA 1BQNB 1T02A 4V19X 5BXIA 2H9ZA 2LU1A 4EYHB 1HARA 2OUGA 2VFUA 5HMWA 1ZAWA 3CJSA 4O0IA 4MKAA 3KLHB 1VBXA 4OYMA 3OLAA 4USKA 4JI1F 2AJFE 1TV6B 3PYDA 1HI0P 4GMKA 5KG1A 1JJHA 2DGXA 4IYQA 3Q22A 2UUBF 2VJVA 2NSBA 3NBPA 4GC6A 2JL9A 1F0XA 2VONA 2RUSA 1PG5B 2YX1A 2IAJB 3DRXA 5D4LA 3HMJG 2Q1LA 2RD5C 4WU2A 1KHWA 3WX8A 1GTEA 5DZ6A 2CA9A 1C1CB 5GMEA 4B9TA 4LF7J 4ICLB 5ADZA 2XSJA 4ZLLA 1PJ5A 1YZ6A 4TLQA 2M8HA 5F0WA 4G1QB 3T6BA 2OD6A 2B9YA 4ZDNA 1SH2A 2M5YA 1ZZFA 4LSLA 4DSFA 1PCAA 3EXCX 2F65A 1IBLF 2JEFA 4C11A 2KI2A 1WELA 2O67A 4XDDA 3BKUA 5KFLA 2ZH2A 2GJIA 2W8LA 2UU9J 2VC0A 2KZMA 2W2QP 2PGCA 1ZBTA 4KHMA 4IQMA 4C8OA 4QR1A 2EVZA 3AT1B 4F2RA 5DLFA 1RI7A 3M8PA 2AU0A 4URGA 2E9TA 2Z30B 1WNEA 1KKHA 4IQXA 4NMXA 2CDRB 1EZZB 1ROFA 1QTMA 1HNWJ 1NUEA 1S1TA 3ITHB 4KHPJ 1HBUA 4NLPA 3M6UA 3P4UB 1F2GA 4UZCA 4J9OA 3GG0A 4WP9A 3ZZUA 3OTOJ 3B78A 1G3OA 4K8RA 1JLFB 2FVSA 2GVZA 3EVMA 5EWGA 5AXNA 1RB0A 1AROP 2OJ3A 4ZK7M 2V8HA 8RUCA 5KT2A 2W7OA 3PO4A 4WYLA 2VF3A 4PPDA 5HSPA 4C8NA 3LP1B 3SYZA 1UVLA 1M5PC 3DLEA 3KNGA 3QO9A 5DG8A 1YRXA 3J81Y 1X4BA 3CB4A 3DLKB 3NGUA 4WFZA 7FDRA 1YJ7A 1SUQB 2D3UA 5FJ4A 3DLHA 1RBLA 1PAEX 3GQCA 1CBKA 1B4SA 1WI6A 3P3DA 4A8YA 2VBYA 2X1AA 2BJ9A 2C22A 4DV6J 4X4VA 3KK1B 5D77A 5D3GA 1LK7A 1FEEA 3SDEB 4YN3B 1RWXB 1FT8A 1VQ6S 1RAAB 4PXEA 4DPUA 3D0IE 3GZ7A 4FF4A 4H4OB 2WAQD 3PHEA 4N47A 1UWAA 2B9WA 1TZ0A 4DFPA 4IFYA 4DPOA 2KG1A 3T9ZA 2XTJP 3N5BA 2LXIA 1VGYA 3ZTQA 1ZETA 5KFIA 4CIOA 4DBQA 1WF2A 4RNOA 1JXLA 3RYLA 3CCQS 5CABA 2D41A 2AYGA 3UD4P 1TK5A 1JLQA 2DJWA 3M4XA 4A8KA 1VK8A 4PQAA 3PKYA 3QWPA 1LNQA 5IFMA 1C0UB 1QAIA 3M8ZA 2AEFA 3M2RB 3B82A 2HPUA 3H2UB 3HKZD 3JS9A 2IA6A 5D4NA 5F8LA 2RS8A 2IJRA 3ILIA 2K1RA 2EW9A 3VAMA 3UE2A 1WOOA 1OSCA 1S77D 3G82A 1B0TA 1FD8A 1XEZA 4NCGB 5KFUA 3IR6B 1A0OB 4M5NA 3HT3A 4BBYA 3PIOQ 2DNQA 1WDTA 1N34J 2CVIA 1HNXJ 3PZPA 2HRTA 3KK2B 2F4VF 4DV5F 5L38A 4MMOA 2E5IA 2HZAA 2DY1A 3MM9B 2LLZA 1TL3A 1T05B 1RYSA 4H54A 4KRWA 2PEHA 3HJVA 3DXSX 3GONA 4DR4J 3MEEA 2LU2A 3K89A 2GGPA 1WOPA 2CYYA 4DV2J 2JHEA 1SI9A 5KFNA 2HURA 2G2YA 1Y3JA 1UZDA 2RQMA 5T7LA 2WB1D 4CM0A 2XWXA 4O4GB 4LF6J 4ANDA 3J7ZT 1BQXA 3KG1A 4LR8A 1PC5A 5K8NA 2MDAA 4DR7F 3SCIE 1H7WA 4I1TA 4K4VA 4MFBA 2LYVA 1WSRA 1TKXB 4DSIA 1RWVB 1FI4A 1RAHB 1TL1B 2XCPA 5L8RC 1FJEB 3P5TL 2C2MB 4CO0A 4WIIA 4DCPB 1DURA 1CJUA 2G9OA 3V6DA 5C25A 1RHUB 2RNEA 3UD3P 3PEJA 1B99A 4IRKA 4HI2A 3KLEB 5L39A 2GO9A 3LTOA 3DOKB 3LP2B 2AQ4A 2DNHA 3OSNA 1NZ8A 4KO0A 1O0PA 3AODA 3TUJC 4U95A 3I9ZA 2CKWA 2VJUA 4JI3J 4TVAB 1NKBA 3H5UA 4OFZA 2ZJRQ 1CQMA 2R7UA 1N88A 1JLGA 1HBNA 1RU1A 1RWMB 1EJ7L 2JC1A 4M5JA 3P5BP 3SQGB 1DY3A 2G1HA 3UCGA 4XK8C 1C1CA 1MWQA 1U1QA 3T1YF 2FHKA 4PQUA 1U49A 1GXTA 1YJWS 4LREA 2MLYA 3SCLE 4YOEA 4CLLA 2L9DA 3KNAA 2RJZA 1LQ9A 1MROB 2CNKB 2B8PA 1RT6B 2V8PA 1EETA 1LW0A 1RAEB 3BQ1A 4RW4B 3US5A 4ED6A 1RE1B 3KK3A 3AD7C 1Q82T 3OHBA 2M70A 2H54B 2B6AB 1JNZB 1GXUA 2H48B 2RQ4A 2MKIA 2ACYA 2YQ0A 2FHJA 3GCWP 4L6V3 2K3IA 4DZDA 3LWLA 3FQLA 2KFNA 4OJHA 3JTNA 3C15B 2C28A 5CQGA 3PW2A 4LSNB 3IAM9 3K5LA 1BQMA 1HWKA 2Y8WA 3T19A 2CADA 3BPDA 2AEJA 2WVCA 2CJ9A 3UQSA 2X1GA 2FTRA 1XR6A 3P6YC 4YFUA 4DEZA 2H1YA 5E41A 3O3LA 2PI4A 3IG1A 1L3VA 3BGOP 4J91A 4MYTA 3NMRA 4CYUB 3G2XA 3K8WA 2V9KA 2VG5B 2N82B 3LOUA 2EI5A 4ZA1A 5BR8J 4DN9A 2BJEA 2EWHA 2XMJA 1HQEB 1NPKA 2IHR1 5KFPA 5FD1A 2XO7A 3H20A 5KFHA 1RT4B 3KDNA 1BWEA 1N48A 4N77A 3TVZA 4B9MA 2COLA 4RWXA 3B4DA 5F8IA 3BR9A 2NCKL 4NMLA 5F3TA 1DBDA 1TKTB 4A48A 1FXRA 2XI2A 3TZXA 2ZNYA 1U2RA 2VDIA 3I0RB 1ZTTA 2BUNA 1AUDA 3W8GA 2JOQA 4PABA 1RCOB 5ETSA 1VQKS 2FQQB 3OVAA 2W24A 2R42A 4NI2A 2MLXA 2DGSA 4G1IA 3IGVA 4NX9A 1ULRA 1UEKA 2B8QA 4F4YA 5GAHI 2GIFA 4ELTA 2UVVA 2HHXA 3MR3A 2IIHA 2EFQA 4X66F 1S1WB 3PFEA 5HBMB 3CMAS 3LH2S 2J7WA 2ZNZA 4NXMJ 2P5VA 2DR7A 4DFKA 1LXJA 4Y2IA 1IKVA 1N6QA 3ONQA 1OYDA 1V3SA 1X0PA 1SKSA 2BE2A 4OI1A 4E8UA 1TKZB 4CP5A 2HHQA 5J2QB 4KAIA 3AD9C 3GTYX 3HKWA 5LSRA 4LFBF 4X4NA 5JMNA 1R8BA 1S9EA 1C1BA 3MFIA 1R0AB 3GV5B 2FLLA 4ZPCA 2ZZMA 2L41A 2XEXA 2YTCA 2LQ5A 1S6UA 2LXUA 1CJKB 2QLWA 1S5ZA 2VKRA 4OI2A 4OYIA 4QPXA 2MHEA 1XMQJ 1WEZA 3HVAA 1RGVA 2J6SA 4EBEA 3SV3A 1RT7A 2LDYA 4NLRA 1IKWB 5DGBA 3UFCX 4PG8A 4K2JA 1X4GA 3POTB 4B9NA 5C42B 3GIJA 3D0HE 2ZHOA 2HBYB 2BACA 4M5DA 3VVTA 3CCTA 4OZ3A 3TQEA 4CLSA 4WFAQ 1GT8A 2NXUA 2EC2A 5ETKA 2CNLB 2KYXA 4CI0B 1I51B 3WBZA 4X62F 4B9VA 3QSIA 2W01A 2V67A 4ZVRB 4NXNJ 4QWAA 1NHUA 2AJ1A 3LP0B 1TQLA 5AE2A 3M8SA 1FE4A 1T3OA 3SFUA 2Y0SD 1SCJB 2UXCF 3HSDA 4BC9A 3FEXB 4IG3A 1KN6A 3UNGC 2GS8A 2ZH7A 1Q53A 3PG9A 1K47A 2R7VA 2LA6A 1ZPVA 3KJNB 4J9PA 2FYXA 2Z2YB 4DN0A 3MAHA 1VISA 5BJRA 3W9HA 4WBFA 4WJBA 2ZKUA 3C66A 1CLFA 1OMSA 2AV5A 1BXNA 3KLVA 4A47A 3AJ1A 3KOAA 1PYOB 4IOCQ 1YJ9S 3UO0A 2DIUA 3KYLA 2GCFA 2ASJA 3U1MA 1VRTA 2W9CA 3PX4A 1VQOS 5LJ5Y 3GYXB 5T41A 1T94A 3K58A 3KG4A 1U26A 3SI8A 2DNYA 1T9WA 4FN5A 3FQKA 2R8JA 3QGGA 4PRFA 2E5JA 3TEGA 4EWTA 4ZPTR 3CWJA 3BN4A 4IO9Q 2J0XA 3BSCA 1W7WA 1F1BB 2YNFA 3OR2A 4F26A 4DHVA 2EKYA 3W2VA 3OJUA 1EHWA 3H5YA 2FHMA 4ZPAA 5ETOA 2VPXB 2JVRA 3AJ2A 1H0HB 1LEOA 2RKIA 5EX3A 1PILA 6FD1A 4D3GA 1XMOF 1K0TA 4RKUC 4J5OA 5L9NA 1QUVA 4WFYA 4LFAF 3HZEA 3CCVS 1IQTA 2FC9A 2ZC4A 2F4FA 3CIZA 1SL1A 1FNMA 1YHQS 1MNEA 4KFBB 2G0JA 2VC1A 1QVFR 1NM2A 4HEA9 1OY6A 2CPZA 1KWMA 3WZ0A 3V81B 3AQOA 1IM4A 2R8IA 4TQRA 2LMIA 5ETVA 5KOWA 5LMNF 2PFFB 3AD8C 5CYMB 3PJWA 3AJDA 2EBEA 5DM6Q 4EUVA 2NPFA 5KFCA 1T9TA 5GAHU 5A2QY 1B0VA 2BDPA 2VOPA 3TUPA 3EICA 2H5EA 2HK3A 4JI8F 1UVJA 4HH0A 2HVDA 4Z7YA 3H0PA 4WP8A 2F8HA 4LFCJ 3Q2SC 2DEIA 4NRUA 2FJAB 2AF6A 3CJ4A 2R8KA 2RT3A 4U8YA 1TAQA 5SZTA 4DV4F 3M2UA 4GO5X 2K2PA 1XK8A 1HI8A 3PKMA 1UJ4A 2APOA 5DG9A 4DQSA 3WIUA 4R5PA 1T03B 2U2FA 4NYOA 4QIFA 1WEXA 1HW8A 2E1CA 2W25A 4HH1A 1RBOB 3IM8A 5IC6B 1K44A 2M52A 4HL9A 2NYHA 1RT1A 4LF1A 4TU9A 1CULB 4QJVA 2I0XA 2IBOA 4DR7J 2HWIA 2C42A 2HMIB 2B43A 1V3ZA 4DQIA 4O4RA 1NK6A 4RW8B 1HQUA 1FVSA 4ZVFA 5DQGA 2YNHB 3N01A 3OR1A 4O3NA 2YNIA 4X4PA 2AJ4A 4IOBA 4RU9A 3ILJA 3DGPB 2MQPA 2DB1A 3MCOA 2DKOB 3HPOA 4YQWA 2G13A 2ZH6A 4QIWD 3UWTA 1KDNA 2PMZD 2D74B 3TANA 4FPRA 3MEGA 2GVDB 4LF2A 4K4SA 3HHLD 3RGIA 3HSJA 1KHVA 1UVIA 1CJTA 2J9CA 4I56A 2KB2A 1N33J 2LA4A 2WONA 1KEKA 3L9ZA 1DLOB 4QBUA 4DCOB 4KY3A 2R7QA 2LQJA 1N5YA 1KVIA 3MAAA 3H5SA 1NB7A 5CA5A 4RUAA 3PX6A 3QFHA 5DRKA 2EFNA 4QU6A 2CQHA 5KT3A 5F41A 1IWGA 3GYGA 3ZTOA 3Q24A 2Z58B 4DWIA 3D6FB 2IFXA 2CZVC 5J2MB 1S6PA 3MUMP 2OI2A 3JSRA 3NGRA 1REVA 3CCZA 1P1LA 4YHHF 5L1IA 2Y1LB 4FXDA 1UA0A 2HHHJ 4GVBB 4FYXB 4KV8B 2RS2A 3ZXWA 3CJ8A 3FCWA 4Q44A 2ZE2B 2NLWA 3BBCA 3MPDA 4G3IA 2VKZG 3KJVA 3W8PA 1WKJA 3E8OA 1VC6A 2MGZB 1DTQA 4ZVPB 5A6PA 5DDOC 4OX9J 3ZZZA 2VV5A 4JI2F 1GK8A 1TFYA 4CM2A 3CJ0A 3MTJA 3K7RA 1TAUA 1HW9A 1NJIT 4C3MA 2HLUA 1JKHA 2HZCA 1HWIA 5KAKA 2ZDOA 1G2EA 1S57A 4ZPVR 1AYEA 4UF4A 2QYCA 4B02A 2VFVA 1GEHA 1NHKL 1VCTA 3BH7B 1WC5A 1NHVA 4UUWA 4P52A 2VBZA 1SJRA 4ECWA 1YDLA 4FPIA 2WB4A 3MPYA 3BQ0A 3NCQA 3SSSA 2WOMB 4KSEB 3IR5B 4DOZA 2UP1A 4F0MA 1FE0A 4B08A 2DXFA 2I2YA 1HPZB 3A3NB 3PIPQ 1I94F 3WX4A 1WKLA 3JAMU 1KLMA 3BEGB 3NKYA 4K59A 3NL0A 3PY8A 4F4KA 4P2FA 3NY0A 4LSZB 3BGRB 4ED2A 2I5JA 2XC9A 1A9NB 2HIQA 2V4JA 2XZWA 3JYTB 4DX5A 2XO6A 4WZQA 1UZHA 3CCMS 2FZCB 1XIQA 4X64J 1BMQB 2G2ZA 5LL6d 3EVOA 1VFJA 1T95A 3CJKA 2HVHA 3MR7A 4CTAA 2HNZB 2JSXA 4F0KA 4OI3A 4LF5F 1BWVA 2M7SA 1WC3A 4ZP6A 1UEVA 2U1AA 2VL1A 1VMBA 4DQQA 1Q8LA 1HNVB 5KG4A 1NNDA 4ENOA 3W1YC 3VVUA 4LRFA 3QT8A 4RBTA 3Q23A 4OYXA 4ZVUB 4ZHRA 3D2WA 2CQGA 3QT6A 5J2NB 3FZ2A 3IBFB 1BE4A 4MIAA 3QSYB 1L3SA 4OHWA 4KPYA 1SC1B 3L3CA 1NK9A 4P72A 2NYIA 2CZ9A 2L9NA 4S0MA 5LT5A 1EKRA 2XWYA 3DRRB 1GNKA 2YVSA 2KT3A 3K5MA 2WBMA 4J9RA 4YS2A 4IRDA 1LOUA 1MMDA 3FK4A 1F3FA 4LBPA 1RXOB 3SSQA 3GG1A 3RAXA 1W25A 2ILYA 5CYMA 2HQ3A 3QIDA 2MYFA 1CVJA 1TKDA 1FDBA 4ID5A 2RE1A 3A8KA 2FD2A 3ZZRA 2YKNA 4DR6F 4A8FA 3W65A 1OQ6A 3R3TA 2ASDA 1I3OB 2B3TB 4NASA 2HQFA 4YB5A 1IWAA 1AW0A 2YKMB 5KFWA 1R27B 2GX8A 3ISND 3QMQA 2GAHC 3R5DA 1KFDA 5C2GA 1RTDA 5A8KB 5AJ3F 2XI3A 1YX2A 3ILOA 4X62J 2GO8A 1LKZA 2I1RA 2J7KA 3RW7A 3MEDA 2FGCA 1TMJA 5BYQA 3H4BA 4IH5A 2OP5A 4DL0C 2ATCB 4I6WA 1FRMA 3EJMA 1J5EJ 3PM9A 3W66A 2XM3A 4FVMA 2Y0BB 4KH1B 3RW6A 3ZZPA 1TFWA 2UUTA 2BKNA 2AJ0A 4IDKA 2CPJA 2JVOA 1UFLA 1HNZJ 3BGUA 3MCNA 4RW8A 3U1LA 4CT8A 3SIPB 3J7Z5 1QE1A 3ZTRA 3TO8A 1TVRB 3VTIA 1U1RA 3EGNA 5A6WA 4XO0A 3E2EA 2VG7A 1IR1A 4W92B 5E3QA 1LWFA 4ZOSA 3AA8A 2BEFA 4OYOA 3NNHA 1Y00A 3BB5A 1CG2A 2VZ9A 4QIEA 4DUTA 4NLXA 3MMCA 5ETPA 1Q7YT 3OTDA 2DR5A 4OJ3A 2DR6A 3KDOA 1JLCA 7FD1A 1VR6A 3AB2B 3C8YA 4F50A 4CLWA 1KOOA 2LEBA 4TY9A 1S1VB 3S1TA 1N32F 2OPRB 1NK8A 3L4BC 4OZLA 4ZVHA 2VD3A 3VQSA 4I7FB 4FZVA 2UZAA 1S6OA 3DKDA 2CG4A 4MK9A 1F3VA 4DS4A 2OFGX 4ZJLA 3HVTA 1UWBA 1IKXA 2C2RA 3M32B 3U7JA 4ILRA 1P9YA 1MWZA 2J9EA 1OPZA 4RUCA 4LFAJ 4GVBA 2ZWOA 5EDWA 1AZSB 4HHHA 3CF5Q 2HQGA 2ZUAA 3NRBA 3M9NB 4X65J 1DTTA 3OVSA 3TWZA 4ATNA 4FYVB 3MMAB 3PRBA 2G2OA 4DUZF 3WDOA 1OIAA 4ZKAA 4RBVA 2Z56B 1L3KA 3JSBA 1QSLA 4USMA 1UKUA 4DQPA 2CQ1A 1AB8A 2CPHA 2BABA 2J5AA 3SV4A 1FKOA 2MZSA 3MPWA 2D9PA 2OEMA 1KBRA 4DX8H 1MMLA 4B3MF 2MKKA 1W2IA 3DGVA 4ZLNA 1RAIB 4YB1P 2NS1B 3PR4A 5RUBA 1H6KX 3KLGB 4HVZA 1O5JA 5MAOA 4H4MA 4Q0BB 5J2PB 2C2EA 1Q95G 2F5GA 2AJQA 4QPTA 5CXTA 4I2QA 1EP4B 3DRPA 1NK0A 4QW8A 4DSLA 2G1DA 2ZVIA 3D9BA 1IBMF 3V4IB 2QL7B 2F8MA 4CZCA 4BDPA 2HFVA 3ZNUA 5KG3A 4WF9Q 4USJC 3ZFVA 1OPIA 2BKOA 2FJVA 5CYQA 2QA1A 1QJHA 1RDRA 1B64A 3HT0A 2WZ1A 2HWTA 2EXUA 2MZJA 2J8AA 3TX0A 2XQCA 3OV7A 1JLBA 1M90T 3LGNA 4TY8B 2J0QD 4RW6A 4DU7A 4OZ2A 4UY8T 4M5MA 5D0RA 1X5TA 1CJVA 2VQEJ 3OXFA 1FXLA 5JXSA 3V6KA 1C0TA 2MZTA 2CJQA 2RSQA 1M0SA 1FWKA 2RF2B 4MTPA 3ZZOA 1YJVA 3CXCR 2IYGA 2E5LJ 3TVYA 4K4WA 2V69A 3CD0A 3GLJA 3AFGA 2R7SA 4O3SA 4U7UK 2QA2A 2D3O1 5GADI 1ZTWA 1R3NA 1T3NA 4RW9A 3VAHA 2OPQB 2YKOA 1SPBP 4L73A 3UDEA 4LVOP 3I0SA 4ECUA 4BCAA 4KKOB 2DGQA 4ILLA 3K0JA 3UCUP 3THTA 4O3OA 5F9NA 4J9MA 3PX0A 2XLIA 2FUG9 1LWEB 3GJQB 3ET6A 4ELVA 2DD8S 3D6MB 3FGVA 3CJ5A 2FHJD 1JXEA 5CZXA 4DCJB 2Y1RI 2R7RA 3GILA 1VQMS 3I31A 4USUA 5E3CA 3KLIA 3M30A 1YLXA 2BJ7A 4R0EA 3HHLB 3MHYA 3FDSA 2FDNA 5AE1A 1RWWB 2OMOA 3CJRA 3EMTA 2EFGA 3TAMB 2LECA 3CJQA 1WJ9A 3CPWR 2WVBA 5K14B 3MM7A 3CC7S 3GPAA 2QC3A 3V4MA 1RADB 2OD4A 1HHTP 5KT5A 4DMZA 2HBZB 2HVEA 1HMVB 1FF2A 4WWSA 4FVCA 1S1UB 2UXBF 2HNDA 2YX7A 2VPYB 5F8NA 1RISA 1TL4A 1ZM9A 1X9WA 5THWA 3LA0A 1X60A 3FEZA 5A8WA 3BSAA 4Y2KA 2HS3A 1NRKA 1IJFB 3M2VB 3F44A 3DI6B 4MKYA 1KVKA 5HMYA 2N3LA 5GMKa 1U47A 4JI4F 4B17A 1WC0A 2AGQA 1YWXA 1Z2ZA 2VIHA 3LAKA 1WDDA 3E51A 2WK4A 2AT1B 2DBBA 1K9MT 3S01A 2V8VA 4KGXB 1Y0HA 2KDOA 1TVRA 2OHDA 2QMUB 5I3UA 2V8GA 2OPPA 4DU8A 3G71S 3MGJA 2GJFA 2MZRA 1R0CB 5C5JA 3CEDA 5KFYA 4NCAA
chains in the Genus database with same CATH topology
1GXTA 1YJWS 2M88A 2B0GA 4P2SA 4NXMF 1FJGF 1LXNA 3OTBA 3LANA 2C3UA 2CQ2A 4M63A 3HF5A 5IQ6A 1FRJA 3SCLE 4NLQA 4YOEA 3VALA 1YQHA 2L9DA 5L1LA 3T1HF 3KNAA 2RJZA 2A1BA 4ID5B 4GO7X 1ZZNA 2NREA 3VAFA 3BO2A 4M8LA 4XIUA 3FFIB 5D8HB 2P6SA 1LQ9A 3JSMA 4JI7F 2VOOA 1MROB 2YKNB 4LF9F 2N4CA 4ED1A 4XAKA 5EHHA 1O8BA 2HRUA 4DV7F 5F9LA 2HMIA 1RT6B 3MPVA 1NH7A 4YR2A 4P7TA 1EETA 2DRAA 1K1SA 3MDFA 3UW1A 4O23A 1LW0A 4EZ9A 4PR6A 1RTHA 2YNHA 3BQ1A 2XS2A 2EK6A 4RW4B 3US5A 4YDDB 4ED6A 3VWSA 1OO0B 3KK3A 4ETXA 1Q82T 1LK5A 4A8XA 4ECRA 2GV1A 5I42B 1RTDB 3OHBA 2M70A 4J9LA 1CQNA 5KFKA 4ID8A 2ABYA 2XG8A 2B6AB 2ZBIA 1JLAB 4DL2A 3DM2A 1IQZA 1JNZB 3RR7A 1GXUA 2AD9A 3UDCA 2BANB 3DGPA 4Y34A 2RQ4A 2MKIA 1QAXA 2ACYA 4ETZA 4B9SA 4NL5A 3TNVA 2HHTA 2FHJA 1YG0A 1S1XB 4J9SA 4DL4A 3MEDB 4L6V3 2K3IA 2E66A 3LWLA 3MR2A 3FQLA 2KFNA 4ECZA 1WEYA 5HI7A 4OJHA 4BHQA 3JTNA 2ILZA 1U2FA 4NLYA 2C28A 5CQGA 3T5JA 4V19J 3PW2A 4ZS6A 2MQQA 3IXQA 4OI6A 2G4BA 4LSNB 1XNRF 4PUOA 3QJJA 3IAM9 3V2UC 1P9QC 2PO4A 1FJCA 1NO8A 2SXLA 3BGLA 5CH7B 3K5LA 3GWCA 1BQMA 4FNHA 3CJ3A 1HWKA 3IGNA 3FSIA 3G6VA 2ASLA 2MY7A 3T19A 5HLFA 2J0WA 4ALZA 2Q79A 1XMQF 1FERA 2UVRA 2P9EA 4MIWA 2CJ9A 2E7XA 3UQSA 2X1GA 2FTRA 2IMOA 1DLOA 4K4YA 3H2VE 4FP9A 1XR6A 1XWLA 1RAJA 1VQ7S 1C4CA 4DUYF 3P6YC 2EBGA 4YFUA 4DEZA 5E41A 2DNOA 3O3LA 2PI4A 4LQ3A 4LVNP 1N36F 4IDKB 3IG1A 3NAHA 1L3VA 3CMES 4MYTA 4C0OC 3LWMA 3NMRA 4I6AA 3K8WA 2V9KA 1UVNA 2RRNA 2VG5B 3CD5A 2N82B 3LOUA 2EI5A 3MR6A 2CJKA 2KFYA 1VQ4S 1N0UA 4ZA1A 3V6HA 2GQ2A 4CNZA 3TI0A 3NBPB 4WFXA 4DN9A 4N41A 1N5TA 1QE1B 2BJEA 2E1MC 1QAYA 2EWHA 3W7BA 1Z1ZA 4DLGA 4AXIA 4ZMMA 2XMJA 4PWDA 4DR1F 4C8ZA 2BW2A 5J2MA 4NXNF 2OH2A 4J37A 2YY3A 4QYRA 1Y5IB 5E33A 1HQEB 3VCDA 4XPEA 2DNKA 3THPA 2IHR1 3OVBA 1SJQA 1FCAA 4OIXA 5KFPA 1H98A 3IWXA 1KOHA 3H20A 5FD1A 1F60B 3LAMA 2XO7A 3RBDA 2VG7B 5KFHA 4I4BA 1RT4B 1LWFB 2OMLA 2BZ2A 3H25A 2DR8A 4C98A 1BWEA 1N48A 4AL6A 2YWFA 4N77A 3TVZA 3RRHA 4KV8A 5LSLA 4M1KA 4B9MA 1WHVA 1FKPB