3IGNA

Crystal structure of the ggdef domain from marinobacter aquaeolei diguanylate cyclase complexed with c-di-gmp - northeast structural genomics consortium target mqr89a
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
166
structure length
166
Chain Sequence
AKLSMTDRLTGLLNRGTWENLVDAEYERFRRYGQATSLVMFDIDHFKPVNDTYGHLAGDEVIRHTADVTRNNIRQSDSAGRYGGEEFGIILPETDAESARVICERIREAIEKSTVSTSAGDIQYTVSMGIAQLTETPENYMQWMQKADEALYKAKESGRNKVVVSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Diguanylate cyclase
publication title Crystal structure of a catalytically active GG(D/E)EF diguanylate cyclase domain from Marinobacter aquaeolei with bound c-di-GMP product.
pubmed doi rcsb
source organism Marinobacter aquaeolei vt8
total genus 52
structure length 166
sequence length 166
ec nomenclature ec 2.7.7.65: Diguanylate cyclase.
pdb deposition date 2009-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00990 GGDEF Diguanylate cyclase, GGDEF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3ignA00
3E01B 3I5BA 3UQSA 2RDIA 3N6MA 4K4TA 3PR4A 3PW7A 3T5LA 2D3UA 4DG1B 3IG1B 1S6QA 1TKXB 3DI6B 3MEGA 4ICLA 5J2NB 3LP2B 4ZHRB 4IR1A 3CIZA 2IJFA 3PHEA 3UDLA 1BQMA 2QE5A 1RT3A 3T1AA 2DPJA 3MECA 3LANA 3QO9A 1FKPB 4KE5A 4WE1A 1JX4A 3ITHA 4M95A 1R0AA 1S6PB 2ILZA 3Q8RB 1S9EA 1D0EA 4ECXA 3IN5A 5KFWA 1XR7A 4PUOA 4Y2AA 2W8LA 2ASDA 4KKOB 4Y3CA 4IRDA 5EWGA 4Q43A 2YNIB 5EUHA 1RT7B 4I2PA 3KNAA 5DG9A 4WXWA 5KFOA 4F4ZA 4TYBA 1C0TA 2UUTA 4B3OB 5EWEA 1QAIA 3FQLA 2C2EA 2OH2A 1IKYA 1CSJA 1KHVA 2I5JA 4H4MA 1IKVB 4WZMA 1JLBA 4TXSA 4Y2CA 1UWBA 1MMLA 5CYQB 2VG6B 4ED8A 3CVKA 4IDKA 2RF2A 4ECWA 2IM0A 5KFVA 1JLAA 3I0SB 2C2DA 1J5OB 3DM2A 2FLLA 1JLQA 2HNDB 2D41A 1TL1A 5DGAA 2FVCA 4ZP9A 3D5MA 2V4QA 1Z4UA 3H4DA 2R2RA 4K4UA 5C25A 4LQ3A 3I0RB 4XPEA 5D3GB 5C42B 5K14A 1RTJB 4ZPCA 2JEFA 1LWCA 3BJYA 3MR3A 2YKMA 5CYMA 3PZPA 2UVUA 2AX0A 1SUQA 3V6DB 2VG5B 5F9LA 4O3SA 4KB7A 2HMIA 1LW0B 3N6LA 2V4RA 1DTTA 4M94A 3MEDA 3OHAA 1KLMA 4R8UA 4ECYA 2AGOA 2W8KA 2ILYA 4QW8A 1C0UA 3H2LA 3SFGA 5F8NA 3MEGB 4ICLB 2FJXA 2BRLA 1RTDA 5DQIA 1RTHA 4J9PA 4JV1A 3KMQA 4K4XA 4Q8FA 3DOLA 4MH8A 1SH2A 3IRXB 1HARA 3EZUA 1RT3B 4U6PA 2AQ4A 3DRPA 2VG7B 3MECB 4K4VA 3KLIB 3GIIA 4F4WA 3ITHB 4Y34A 3E01A 5KFDA 4ECTA 3V6KA 2YNFA 1R0AB 5L1KA 5KFCA 4ID5B 3TVKA 4J9QA 5HROA 1JLEA 1S9FA 5KFKA 2VA2A 4QWAA 4PUOB 3MR2A 1TKXA 3DI6A 3CJ0A 1K1SA 4R0EA 2BQ3A 1NHUA 3DLGB 5J2NA 3NBPB 1S48A 2YNGA 2WK4A 4K4ZA 3UPFA 2C2RA 4F4YA 1C0TB 2FVPA 5L1IA 3CWJA 4QWBA 3QIDA 3DOKA 2WCXA 4PQUB 2I5JB 4H4MB 4EO6A 3KLFB 1JLBB 3UR0A 3D28A 4ED6A 4JV2A 5DG7A 2YNIA 4MIAA 4IDKB 1RT7A 5I42A 4FBUA 3GIJA 4IH5A 4WYWA 4J9KA 3V81A 4OL8A 1JLQB 2HNZA 4ECRA 1TL1B 3PW5A 4B3OA 4J9RA 4O3PA 4ZP6A 4ECQA 5C25B 3TQ1A 4WYLA 3Q8SB 2JLEA 4ZVGA 1T05B 5K14B 4H4OB 1S1VB 2YKMB 5CYMB 1REVA 5KFFA 3GV5B 3PVXA 2FVQA 2R8IA 2VA3A 3H98A 2YNHA 5KT4A 2HMIB 3M8PA 1DTTB 1D1UA 3KLEB 2AGPA 1J5OA 1EP4B 3MEDB 1RT1A 4NLOA 3MTKA 4TQRA 1KLMB 3QLHA 4R8UB 4F50A 2BQUA 1IKXB 3I0RA 3LALA 4LSNA 1RTJA 5KFYA 1RTDB 3I5CA 1JLGA 2AU0A 4O3RA 4JV0A 4IFVA 4NZ0A 3MR6A 4DL6A 3V6DA 2GIQA 2VG5A 2OPQA 4IOBA 5HP1A 3GILA 3OL9A 4K50A 2YNFB 3RB3A 2IBKA 1NHVA 3CJ3A 1U09A 4KSEB 5F9NA 3NMAA 5HROB 4QWEA 3M9OB 1JLEB 3SI8A 1IKWB 2ATLA 3DLKB 4LSLA 3JSMA 3QIPB 5F8JA 4NLVA 2JEJA 2YNGB 3ICLA 3IRXA 1W25A 2VG7A 4RNHA 1FK9A 4YR0A 3KLIA 2YKNA 1N4LA 4IRCA 3M8QB 1IM4A 3OL8A 2B43A 3C6TB 3DOKB 4ID5A 4ZVHA 5JUMA 5DLGA 2F8EX 1QE1A 1VRUA 2JC0A 3BR9A 4I7FB 4IFYB 3DLGA 4ZVFA 3OLBA 3FSIA 3BSCA 3NBPA 5KT3A 3CO9A 5I42B 4PWDA 4ECZA 4O3OA 3KOAA 3SFUA 2ASJA 3V81B 2HNZB 2FLPA 5KFUA 3LP0A 5DQGA 4MIBA 5KFSA 3HVAA 4EBEA 5I3UA 3OL7A 3V6JA 1HPZA 5J1EB 4PQUA 1T94A 4DL2A 3LP1A 3KLFA 4J9NA 4RNOA 4KBIA 2J6UA 1DLOA 5JXSA 2HNYB 1REVB 5F8HA 1N6QA 2YNHB 4O44A 5KG4A 5KG7A 2WRMA 3M8PB 4DL5A 1HYSA 5L9XA 5KFIA 4MKBA 1RT1B 4U7CA 4G3IA 2XGQA 5KFAA 3QLHB 1ZTTA 5KFHA 2AGQA 4NRUA 1ZETA 4EO8A 4Q8EA 4I2QB 3KHLA 1S1UA 5J2QA 1JLFA 2AWZA 4LSNB 2W9BA 5F8GA 1T05A 5KFMA 4H4OA 1JLGB 1YVFA 4RUCA 3Q8PB 3NGDA 1S1VA 4IFVB 1S4FA 3V6HA 2XI2A 2OPQB 2UVRA 4WFYA 2D7SA 5HP1B 1RYSA 2WHOA 2IM3A 3GYNA 1EP4A 4NCGB 3KLEA 4TLRA 1NNDA 2WB4A 3PW2A 3MF5A 4FS1A 3H5SA 2IAJA 1RT2A 1RT5B 3CJ4A 2XCPA 2WTFA 1IKXA 2UVWA 5FDLA 2BANA 1WNEA 4ZMMA 3JSMB 4LSLB 4NLDA 4GC7A 3MFIA 5HLFA 3IGNA 1I6JA 1FK9B 2V0NA 4EEYA 2YKNB 1N56A 2E9TA 3CDWA 5J2MA 5J2PA 4NLTA 3GV8B 4NLYA 1QE1B 1VRUB 1IKWA 4DEZA 5F8LA 4J9SA 3PW0A 1SV5A 3DLKA 3NAHA 1S1XA 3QIPA 5KFLA 5DGBA 2V9WA 3M9MB 3H59A 4ECUA 2FLNA 3HHKA 4PWDB 1S9GB 5KT5A 2ASLA 3ISNC 3QYYA 4IR9A 3LP0B 1LWFB 2HWHA 3FFIB 3PJWA 3M8QA 2CJQA 4MK7A 1TVRB 4WXOA 4ZP8A 5I3UB 3C6TA 3BSNA 1HPZB 5T14A 3C6UA 4NLSA 4GC6A 4Q0BA 3LP1B 4IFYA 4I7FA 4NLQA 2GIRA 4ECVA 1DLOB 5L1JA 4DL3A 1N6QB 1GX5A 4IRKA 4O44B 1RYRA 3H40A 1HYSB 1S1WB 3Q8QB 3EPGA 3KK2A 3BQ2A 3PJXA 4F4XA 1RDRA 3HVWA 1T3NA 5KG6A 3T5KA 3OHBA 1TV6A 3KK3B 2ZE2B 5J1EA 1HQEA 4YR3A 1S1UB 5J2QB 1JLFB 3V4IA 2IMWP 2IJNA 5KFJA 2W9BB 4RU9A 1S49A 2BE2A 4RW4B 2HNYA 3T19A 2XGPA 4G1QB 4NLRA 3GQCA 4ED7A 1S0OA 3GIKA 2BRKA 2C28A 2EC0A 3JYTB 3DRSB 4O3NA 2W9CB 4EYIB 2IAJB 1RT2B 3LAKA 3KHHA 1HQUA 4I2QA 5FDLB 1N5YA 4WFZA 3KLHA 2BANB 4KO0B 4IKAA 3GV7B 3G6YA 3T5JA 4ECSA 5HBMB 1JLCA 1XR5A 3DRRB 2R8KA 4K4WA 4ED3A 5HLFB 1S10A 4MFBB 4K4YA 4HKQA 2IA6A 2IC3A 5C5JA 2R2UA 4NCGA 5KFRA 3BREA 1RAJA 5KFZA 5KT2A 2ZKUA 5J2MB 4EYHB 3DDKA 4R5PA 1RT5A 3H4BA 3KHRA 1HNIA 3QZ8A 1LWEA 5J2PB 4O3QA 4URGA 2CKWA 4ED2A 2J6SA 2XI3A 2UVVA 1SV5B 3PR5B 1S1XB 2JC1A 5KFTA 3KHGA 4TY8A 3DMJB 3DYAB 3RB0A 3OSNA 3QGGA 2JEIA 2RKIB 4NLXA 4RW6B 2XC9A 4XPCA 4EBDA 2BR0A 3C6UB 4Q0BB 1TQLA 2FVSA 5EDWA 1TKTB 4YP3A 1HMVA 3QGIA 4RNMA 2HAIA 5KFEA 4YR2A 5DLFA 1BQNB 3TAMA 1EETA 3QGHA 3MR5A 1S9GA 2D3ZA 4FS2A 1HNVA 3KK2B 1LWFA 4QWDA 2BQRA 3FFIA 1RA6A 3DLEB 3CJ5A 4RW8A 1TVRA 1JIHA 1MU2A 3BSAA 1RTIA 1TV6B 2I1RA 5KFBA 1DTQB 1HQEB 4IG0A 4RW9A 4HYKA 3V4IB 1N48A 4NRTA 2R8GA 3BGRA 2QV6A 1QUVA 1TL3B 3KMSA 3G6VA 1GX6A 3CJ2A 2BE2B 4IH7A 3E51A 4NLWA 2WOMA 2JEGA 3HVTA 4XO0A 3RB4A 2W7OA 1S1WA 4K4SA 4MK9A 1TP7A 4Q45A 3KJVA 2IM1A 4DL4A 1HQUB 3RBDA 3KK3A 2ZE2A 1RA7A 1N5YB 3KLHB 3IS9A 2B6AA 5KFPA 1KHWA 2B5JB 3LAMA 4URSA 4J9MA 4WZQA 1JLCB 1LW2A 4NYZA 4RW4A 3OSPA 2XCAA 4G1QA 4TQSA 2WONA 1C1CA 5C24A 1SH0A 2J6TA 4NLGA 2IC3B 3VQSA 3GIMA 3JYTA 1T03A 3DRSA 4RW7A 3ISND 2W9CA 3H5XA 3KK1A 5KFNA 1XR6A 5KG5A 4R5PB 1TKZA 4DL7A 4IG3A 1HNIB 4KFBA 4MKAA 1LWEB 3OLAA 3NL0A 4KO0A 1S1TA 4KAIA 4KV8A 5HBMA 4ZPDA 4O4GB 3DRRA 1RT4A 2OPSB 2HWIA 3KLGA 4ZPBA 4MFBA 3BQ1A 4TY8B 1C1BA 3MFHA 4NLPA 3QZ7A 2OPPA 4TN2A 3KLVA 4ZVEA 5DG8A 2FJWA 4NLUA 2ZD1A 1HMVB 3RBEA 2IM2A 3FRZA 1RT6A 3TAMB 5KG0A 5KFGA 4Q44A 1EETB 2R2SA 3IGVA 2W9AA 1VRTA 3RAQA 3DMJA 3DYAA 1JKHA 1S6QB 4H54A 3H5UA 1FKOA 1HNVB 2OPRA 3MEEA 2RKIA 4RW6A 4RW8B 1JXLA 1MU2B 1RTIB 1BQMB 3H5YA 5KFXA 4IG0B 4RW9B 5EWFA 3QO9B 3OL6A 4RNNA 1S0NA 4WE1B 4QPXA 4X2BA 3BGRB 1TKTA 4J9LA 4ED0A 1BQNA 1S9EB 2WOMB 3RAXA 3M9NB 3HVTB 1K1QA 4KHMA 4ZP7A 3IG1A 4DG1A 2R8HA 3HKWA 3LP2A 4ZHRA 1S97A 3DLEA 3KJVB 4I2PB 4JUZA 5KFQA 2FVRA 2GC8A 1DTQA 3NKYA 5KT6A 3IS9B 2B6AB 2R8JA 2DPIA 2E9RX 1FKPA 4QWCA 1TL3A 1LW2B 1S6PA 4URQU 4ED1A 5F8IA 1IKYB 5KG2A 3BQ0A 1ZTWA 2WONB 1C1CB 4RNFA 5C24B 3NAIA 1T03B 4KKOA 1SH3A 4RW7B 5KT7A 3G6XA 2FJVA 4LQ9A 3KK1B 1UWBB 3T5HA 4IH6A 2R2TA 4TY9A 4QW9A 2RF2B 1TKZB 2AX1A 4IG3B 4KFBB 1OS5A 1JLAB 3FDSA 1S1TB 3DM2B 4KV8B 2B5JA 5KG3A 3FQKA 1RT4B 3BSOA 3KLGB 4YMEA 4FBTA 1C1BB 3RB6A 1S0MA 4J9OA 1IKVA 4WFXA 2XWYA 2ALZA 2OPPB 5CYQA 1LWCB 2O5DA 3EPIA 2VG6A 4YQWA 1SUQB 3CDUA 3CDEA 2W7PA 4O4RA 2C22A 1QAJA 4KHRA 2RDJA 3I0SA 5F8MA 3PW4A 2ZD1B 2HNDA 4ZPAA 4O4GA 1RT6B 2UUWA 4IQXA 2OPSA 2E9ZA 1VRTB 1C2PA 1C0UB 4RZRA 1JKHB 5L1LA 4EBCA 5D3GA 5C42A 1FKOB 3N6NA 1RTHB 2OPRB 4RUAA 3MEEB 4TYAA 5DQHA 5KG1A 3DOLB 3DRPB 1LW0A 3I5AA 3G86A 4MK8A
chains in the Genus database with same CATH superfamily
4G1IA 3PR4A 2F4VJ 1S6QA 1WHWA 2YBVA 4LSZB 2WVDA 3ITHA 2WB1D 1D0EA 2YVSA 4ZJLA 4Y3CA 1SJRA 3DDNA 2CNLB 2V8PA 2E5IA 4LREA 2HS3A 3FQLA 4QBUA 4NL5A 4WZMA 1VIOA 2F4VF 2K7JA 2NSBA 4F3OA 3SCKE 4ECWA 5M2PA 4LQ3A 2YKMA 2UUBJ 4JI5J 3NS6A 1AYEA 3A4TA 5DO2A 5K5MA 3DRPA 1BY9A 3FBBA 2MTLA 5EX3A 3T6BA 5KFCA 4WWSA 3TVKA 3BH6B 2XG8A 5HMZA 4DR4J 3B82A 4GMKA 4F0KA 4OLPA 2C1EB 2UUBF 1X31C 1QM9A 3F0NA 3MR7A 1TTHB 4JI1F 4RWXA 3HPOA 3QNWB 4J9RA 3D2WA 7FD1A 4FPIA 1S77D 2QT7A 1CQMA 2VA3A 4DR4F 1RU2A 3TOQA 1D1UA 2LQJA 3SMZA 5D6GA 2RQ4A 4O3RA 4JV0A 1GXUA 3AD9C 1T3OA 1RKJA 3W61A 1IKWB 3L3CA 1N52B 1QSLA 1FRMA 2OTLS 3AD7C 5B08A 1WKLA 2KH9A 5JUMA 2D74B 1QE1A 1WF0A 4C7QA 2JVOA 4O3OA 2Y1IA 3TQEA 1UCNA 4DL2A 3RUBL 2JVRA 4NCAA 2DO4A 3AAWB 3FZ2A 2HNYB 2ZJRQ 4Y00A 2KM8B 4U7UD 5KFHA 2AGQA 1ZETA 3CJSA 1TL7A 2LQBA 5B0AA 5A0YB 1V3RA 5A6WA 4FDFA 3BO3A 2LXFA 4C11B 1RT5B 3OVSA 3JSMB 4LSLB 4NLDA 3IGNA 1K44A 5ITHA 1TU0B 4J9SA 1VRUB 3TZXA 3M9MB 3AXKA 3LH2S 2AF6A 2VV5A 3C14A 2GO9A 2BM1A 4NLSA 3M2RA 4CT9A 2F8HA 3C16B 4DQRA 1X4AA 1TV6A 1GK8A 3ETMA 2E5LF 1GT8A 4CLTA 4ZPTR 2BKPA 4PWWA 1R31A 1UVJA 1AW0A 4ECSA 3N5BA 1SIWB 1U0HB 2DXEA 2R3VA 2R2UA 1X9SA 4A46A 2HHVA 2QN6B 1RAJA 1NSKL 3MM6A 2GZOA 1LWEA 4PABA 2CAJA 3AQOA 1ITPA 2DNOA 3WX8A 2FJDB 1DRZA 2J7WA 1VC6A 1MMDA 1ZBTA 4OJ1A 1X4FA 2BA9A 3ZNUA 4Y2IA 1NJXA 2PA3A 1TVRA 1MU2A 4X66J 3G4SS 4IG0A 3V4IB 5I4MA 4NRTA 4USKA 3C66A 1FWLA 1KBRA 3FCVA 4KPCA 1WHYA 3FBCA 3EDQB 1DQ8A 2R7SA 3AA8A 4CTAA 1YK9A 1YQHA 2A2CA 4CLKA 3PX0A 1N34J 2J7UA 1UWAA 1CVJA 3R1LA 2O01C 2X51A 1KS2A 4CH0S 2K7KA 4RW8B 1FFSB 2QJ3A 2J0SD 5JMNA 1QLNA 3H5YA 5ETOA 3JQJA 1HD0A 4J37A 1BQNA 1S9EB 3M9NB 4QIFA 2R7WA 3WIVA 3HKWA 4ZHRA 3DLEA 2BJDA 2B6AB 1LW2B 4DPWA 1U25A 2LA4A 2GHPA 4TY9A 1FRIA 1Q8BA 1M5OC 3PKMA 4DUYF 3JSBA 1BQXA 1RSCA 1HHQA 3PRDA 4DR1J 2YTCA 4FYXB 2F9JA 2J0QD 1QAYA 1GH8A 2ZWPA 4DR3J 5D78A 2HNDA 3KUHA 2JFDA 1C2PA 4ZLJA 3N6MA 2ADBA 2X3DA 1I3OB 5ETVA 1RAGB 1FKPB 2ILZA 4KKOB 1WTBA 4FNHA 3BDPA 5HVFA 4U7UK 1NK9A 1QAIA 1GMVA 1DAXA 1CSJA 1KHVA 1JLBA 1UTAA 2VC1A 3DCAA 4DOZA 3DRXA 2CYYA 3I0SB 2C2DA 3DM2A 1Z4UA 3CJQA 2ACMA 3I0RB 4ZPCA 2MKIA 4RR5A 5F9LA 1LW0B 1HW8A 3CDAA 4QYZK 5HO4A 2AEJA 4ICLB 2LVWA 5DQIA 3T1YF 2W2PP 3DOLA 4PG6A 4V19X 2UXCJ 3DDIA 1VLOA 2QLBB 1Q53A 1JLEA 4IUFA 2ZDOA 4KC5A 1K1SA 5T7LB 1S48A 2YNGA 1OYDA 4F4YA 3M7VA 1B70B 2BJ8A 4K0KF 2XMMA 1HHSA 4J7CA 2WSFC 1Q5VA 2UXCF 1E6YB 1H2TZ 1WEXA 1S1VB 5CYMB 4BS2A 5K8NA 5IT4A 1YRUA 3MTKA 4FXWA 2CQBA 3QSIA 4CT8A 3RAMA 4LSNA 1V3SA 4IFVA 4C8ZA 4A8FA 4F0HA 2MSSA 2UV8A 5E3AA 2BJ3A 4NLVA 3ICLA 3TO8A 2DHXA 2VKRA 1HBNB 1WTFA 4CO5A 4QU6A 4ZCKA 5KAKA 4EBEA 3W63A 3V6JA 2YY3A 4BWMA 3VR1A 3QQCD 1FI4A 3M8PB 5KFIA 1T9TA 2X1GA 2Z2ZA 1QTNB 4EO8A 1EJ7L 2ZH4A 1H2UX 1RCOB 4LF9J 5L39A 2UVRA 1NAQA 4DPXA 1NMEB 5B0EA 4NCBA 4YFUA 1M5PC 1WHXA 5J1PA 4X4RA 3CNQP 3UVJB 3H25A 4MTPA 4OYZA 4DL0C 2G2YA 4C0HA 2ADCA 1IKWA 2UUCF 3NAHA 1S1XA 1MMNA 2A6OA 2XSFA 2QL5B 2BQRA 2D9OA 2I8EA 3C6UA 4IO1A 2JL9A 1F5CA 1N6QB 4OHVA 4EMDA 2IVYA 2CG4A 2ZH6A 3EGZA 4DQIA 2UU9F 1GXTA 2HNYA 4DWIA 2RD5C 1YJWS 2XY6A 5FDLB 4WFZA 3T5JA 4DCOB 2R8KA 3PJ9A 1M90T 4MFBB 4K4YA 3DDKA 1K9MT 1RT5A 4CLZA 1R6YA 3PM9A 2FHOB 3Q89A 2V94A 3Q23A 2CDQA 2FVSA 3PNIA 3BM7A 3KYLA 4DSLA 2CQIA 2KO1A 3O2IA 2BMBA 1I94F 1QUPA 2KU7A 3ZZYA 1DTQB 1LNQA 4ZVTB 1NK0A 2WOMA 3JXOA 2W7OA 4AXIA 3C16A 2VFRA 3RBDA 3KLHB 3RR7A 2EKYA 2U2FA 3OSPA 1C1CA 5C24A 3GIMA 4ZN1A 3D1QA 2C2ZB 2FZCB 3MMCB 2FLOA 1HWJA 3KLGA 3AXMA 2YX7A 3MFHA 1U7LA 1U0HA 2HFNA 2I2YA 3KLVA 2NLWA 2DNQA 5DG8A 4DUTA 5SZTA 3KTQA 3TAMB 5KG0A 3D9BA 4Q44A 1X4BA 1EQMA 1HNVB 1QVGR 3D0GE 3F41A 4DZ6A 2ZKTA 4RW9B 2MDAA 3J81U 4KHMA 4HL9A 3UDCA 3SEOA 4I2PB 2RHQB 1NU4A 2MHNA 3LPYA 2ZZMA 2R7UA 4I6WA 4B3RF 2PE8A 3T5HA 2AX1A 2B4OA 3SQGB 3R5DA 3UNGC 3FK4A 3FQKA 2M4MA 5A76A 3JS9A 5CYQA 5LMUJ 2VG6A 1SUQB 4O4RA 2BYCA 5MAOA 2RDJA 3M8RA 4ZPAA 3HLUA 4DI6A 2Q43A 1JKHB 1HWIA 1TKXB 5CZXA 2KVIA 3H8YA 1CJKA 4X4QA 5LMUF 2KB2A 5DZ6A 2IDLA 1S9EA 2ZJPQ 1N36F 1RT7B 3H2UB 1HR0J 1NSPA 4TYBA 1WG4A 3JQMA 1IQTA 3LPEA 5IV4A 1IKVB 3QWPA 1U45A 1Q5YA 3MAAA 4DR5J 3H4DA 3OQ2A 2HBRB 4FYWB 4Z7YA 5IM0B 1RTJB 3OD2A 2B9EA 5I3PA 3CD5A 3IM9A 3QMQA 1O6XA 4ECYA 2G2OA 1GEHA 3H2LA 2BRLA 3J7A1 4D3HA 3PIPQ 5AJ3J 2QLJB 3RJMB 4DR5F 3AY0A 4PUOB 4X4OA 3CJ0A 2Z8QA 4YUDA 1HWKA 1RWPB 2C2RA 1YWXA 3M2VB 4GO7X 5I42A 5AJ3F 1G1XA 3IBWA 2ZUGA 3EUNA 4OJ3A 1KRPA 2RU9A 2CQ0A 1VISA 2ZITA 2LP4A 3QLHA 4KGZB 1LKZA 4M5KA 1UVMA 3I0RA 1DHMA 3PO4A 3IAS9 2NXUA 5EGYA 4DJBA 1I51B 4F67A 2AEFA 3NOGA 4QWEA 2Y8WA 4OX6A 1NZ8A 2VL1A 2MHEA 3QIPB 3Q8UA 4DMZA 4YB7A 1Q16B 1CJTB 3OL8A 1CJVB 3OLBA 5T7LA 1IWGA 2FHJA 4PWDA 4OYBA 3KOAA 4MT1A 4F02A 2MZSA 2OTJS 3U7JA 2J6UA 5F8HA 4OYMA 1E6YA 4C2MA 1S1UA 2RQCA 2RVJA 2PMWA 1S1VA 1YDLA 3V6HA 9RUBA 2DGUA 4DS4A 4V19J 4DV2J 4U8VA 3QAUA 3NWRA 4Y2KA 3JB9k 3TWZA 2J9DE 4DSKA 2V8GA 5ADZA 5KT5A 2ASLA 3ISNC 2MYFA 5J1NA 1CJUB 4Q5VA 3TJAA 5H1SV 4DV2F 2EK6A 1NPKA 3KK2A 5EX0A 3DOMA 2F4FA 3DGPB 4KIAA 5ETRA 4F3MA 2EC0A 1VMBA 2CVEA 1JJ2R 3ISZA 1RT2B 2ZUAA 3K5OA 3GV7B 4CI0B 3AJDA 3HZGA 4K4WA 3ILLA 1PKUA 3K0JA 4HI2A 5J2MB 2ZM6J 3MMBA 2Y0BB 4O3QA 2QEXS 3UVJA 1URNA 2RKIB 2C2MB 3HFKA 1N5VA 1ZS6A 3QGHA 3GMGA 4QWDA 4CP5A 1T95A 5KFBA 4DFKA 1HQEB 3PACA 5CCMA 2FGCA 3JSYA 2HIYA 2B4VA 2APOA 4Y0FA 2IM1A 3NRBA 1V3ZA 2Z2MA 3IS9A 1KHWA 3G96A 2XCAA 2IC3B 3VQSA 3CMQA 4DSIA 2B7BB 3T1HJ 4IG3A 3NGSA 3RR8A 4YB1P 3BF4A 4MFBA 4C0OC 1RWOB 2XULA 3W2WB 4HH1A 3RAQA 2W9AA 4DQPA 4HT5A 4I0WA 4EK2A 3NS5A 1SKWA 3BGRB 3T1HF 4ZKAA 4J9LA 4YHHJ 1ZM9A 3HVTB 1K1QA 3LGHA 2MPUA 3TUJC 2F7VA 4G6VB 4F8RA 1DTQA 2E9RX 1WF2A 1T0TV 2P9EA 5KG2A 1KOHA 1SH3A 3G6XA 2XMUA 1S1TB 4PWUA 4RBUA 1RT4B 2KFYA 1DARA 2QG9B 1CG2A 1SJQA 4I56A 2H4WB 2CZVC 3MMCA 2MLXA 2HGLA 1LXNA 2VBZA 1KC8T 4IQXA 1X4DA 1VRTB 4O0IA 3FRYA 3ZZRA 2HVIA 2HZCA 2HRYA 1IVZA 4YOEA 1IXKA 3AOBA 2HG4A 2V8VA 1YZ7A 3UDEA 2E29A 4KE5A 3FUYA 1VJQA 3IN5A 4WPAA 3IWLA 4I2PA 5KFOA 3ZC4A 5K8PA 4H4MA 2DNRA 4ED8A 1TL1A 5DGAA 4OJGA 1YBTA 2N7CA 4NMXA 5DETA 1SUQA 2XLIA 2RH3A 2RE1A 1P6TA 4N47A 4C8NA 4DV0J 3H20A 1KLMA 4QW8A 1NDKA 2CQ1A 4CQ1A 3GSDA 2ABYA 2V2KA 1HQ2A 1M5KC 1R0AB 1TKXA 2CWXA 1RI7A 1XIQA 1ULRA 3SSQA 4K4ZA 3C15B 3K57A 1C0TB 4CZCA 3ZZZA 4DV0F 2GX8A 2C3YA 3KLFB 3SQOP 4MIAA 1RT7A 1NDLA 2CJXB 1W7WA 4AL6A 3AHPA 2HFZA 4JI0F 4DV7J 4NXMF 3W60A 2M8DB 1TK8A 1FF2A 1KKHA 3PX4A 2PGCA 1W2BR 1QSYA 2R8IA 3H98A 1DTTB 3MEDB 4R8UB 4F50A 2EPIA 2V63A 1RTJA 3IR5B 4DPTA 2I38A 1VQ5S 1G6BA 4F2RA 4K50A 2XZDB 2B9WA 1G7CB 3FEYB 1U48A 1HI8A 5JVHQ 2QMWA 5C2CA 3FSYA 2GGPA 1S76D 1FEEA 3FCHA 1UZHA 4CWBA 2IPOB 1YITS 1LFPA 1RUSA 2IJRA 3HULA 4WKYA 1NH7A 4RNOA 3CB4A 3MXHP 1X60A 4O44A 5KG7A 1RLCL 5AT1B 1JLFA 5KFMA 3N4WA 4GKKJ 3OTCA 1FNXH 1OJ4A 1RAAB 4OQJA 3CJ4A 2XCPA 2UVWA 2J8SA 3ZZ0A 4ZMMA 4KGKA 3IXQA 4PPDA 3ZZOA 1FK9B 1SCJB 1KTVA 3RG6A 3CDWA 4XDDA 4DEZA 4DN0A 1WC5A 1IR0A 3QIPA 3P49B 2WBMA 2HHXA 4P2XA 3EYZA 4IR9A 2HWHA 4DR7F 2B56A 3BSNA 4ZPWR 5CXTA 1FNOA 5CCLA 2KFZA 4IRKA 1RWVB 2KYXA 2KT5A 3O8WA 3OHBA 2ZC3A 2IJNA 1VQ8S 1WKJA 1YX2A 2BE2A 4RW4B 4UY85 2AKWB 2ZH3A 2BRKA 8RUCA 4X64J 3UW1A 2KJVA 3KJFB 2ROPA 2DTJA 1CC7A 4RUBA 4U95A 3ENWA 1C4CA 2KTQA 2KT3A 3BREA 1CPZA 3AODA 1ACMB 3KHGA 3VQTA 4FYVB 4PXDA 4P74A 1CC8A 1HMVA 4RNMA 3D0HE 2XWXA 1CJUA 4HYKA 2P6TA 3CSKA 1TR0A 4DX5A 4LRFA 4K4SA 2LU1A 4MK9A 3P6YC 1TP7A 1RHKB 4ENOA 2J76E 2LA6A 2MY8A 2F3JA 4WZQA 2W7AA 4RW7A 1UZDA 1HNIB 1A6LA 4KV8A 2C2KB 3D54A 2NPFA 4PR6A 5U47A 2BX6A 1C1BA 4P10A 5BYQA 2HBQB 1Y11A 2IDEA 2W25A 3FRZA 5E2QA 4DLEA 2QSWA 2RKIA 3GIRA 3CXCR 3GFYA 1KONA 4WE1B 1D9AA 3J81Y 1U8SA 2G0JA 4C9DA 3VAKA 1LK7A 2W2OP 3HSJA 3UD4P 4ERDA 5KT6A 2BDPA 1APSA 3TA2A 2DITA 3M30B 4ANCA 1UVIA 5K9FA 2G0CA 2KJWA 3N01A 4CNZA 1FFGB 3S1TA 1E6VB 3ZTPA 1LWCB 1DURA 4HTJA 2ZOFA 2HVZA 1RWMB 1S59A 1ELOA 4Y2MA 1S57A 2Y1RI 5C42A 3OR2B 3VVUA 3W2WA 3TA1A 4ID8A 3I5BA 1SQGA 2XNQA 4KHPJ 3LP2B 5IT9U 4C8KA 1VQ9S 3HSZA 2C3OA 3JTNA 1JX4A 3VF0B 2KG0A 2W8LA 2CNOB 1GMUA 3CCTA 1TKDA 3OTBA 1HI0P 4Y2CA 3D66A 4ZS6A 2W2NP 1YSJA 1JLQA 1NHKL 2D41A 3TI0A 2QL7B 1FNMA 4O3SA 2KZZA 2W4DA 1PC5A 4CIOA 1NK4A 3MPYA 4ZJOA 1FERA 5F8NA 3MEGB 3UFCX 1X4HA 3BB5A 1U02A 3IRXB 3T9NA 1N32J 2GQ2A 1DJ0A 1RXOB 3MEKA 3MR2A 2BQ3A 3DLGB 2BACA 3AJ1A 2H1YA 1HW9A 5BYSA 2VONA 5B0BA 3TP2A 4WYWA 3S8SA 2KDOA 3A3PB 4JI7F 4O3PA 1T05B 3OXFA 4K5SA 2DHHA 5K14B 1WJ9A 3GV5B 1PCAA 3GPAA 2HMIB 1QVFR 3SCIE 4NLOA 3T3FA 3TW0A 2AMCB 5KFYA 2XMWA 4FVCA 1Q82T 2M70A 2Q79A 4DPOA 3DLLQ 4PXBA 2YX1A 4ANEA 5D0RA 2XO7A 3DXBA 4YR0A 1V5IB 2HBZB 4R0JA 4IRCA 1RWKB 3DOKB 2AD9A 4ZVHA 4IFYB 2XSJB 2L48A 2VKZG 3BO4A 2DGXA 1BD6A 3C15A 4A8YA 3SFUA 3L95X 2HNZB 2YWHA 1B4SA 1FRXA 4DV3F 2CJYB 3KLFA 3R3TA 2XLJA 1H38A 2OJ3A 5KG4A 3GP9A 2MEWA 2IFXA 4NRUA 2L3MA 3K5MA 2B4UA 4ZLNA 1ICEB 4DN9A 1VBYA 2V67A 5CHCB 2GQQA 3MF5A 2LEPA 2XMJA 3THPA 3ILIA 2CWKA 1RK8A 2LEBA 3G82B 4X62J 2HWTA 4Z7CA 2DNHA 2RIJA 5CAAA 1NZAA 4KQZA 4NI2B 5F3TA 3HHKA 1S9GB 4LRDA 5SUHA 1FJEB 3FFIB 2OEKA 4K8RA 4QOTA 1MG7A 3EPGA 3PJXA 4LF5J 2VQEF 1T3NA 2EK1A 1RABB 1MLAA 2AT1B 3N9UC 4YR3A 5J2QB 3FMBA 3GIKA 4O3NA 3LAKA 4PQAA 4KO0B 3EZOA 3W65A 1BGXT 1XR5A 4CO2A 5HLFB 3QPIA 1FX2A 3WBZA 3G8QA 4LF5F 3TJ9A 4CLYA 2XI3A 3PYGA 3QRRA 3F44A 3M05A 2LDYA 2YWEA 1Y3KA 3GFXA 3QGGA 1D8YA 4NLXA 3PX6A 4XPCA 1HNWF 1TQLA 3MAHA 3W64A 3LTOA 3W62A 4OYAA 2HHHJ 2F65A 1G4CA 1SQEA 4QCLA 4UQTA 4FPRA 2K1RA 4XO0A 1QAXA 2E7VA 1AFIA 1KQSR 4J9MA 3EZ5A 4URSA 4RW4A 3IFEA 3JSRA 3I4HX 1FXLA 1A0OB 1XR6A 1TKZA 3DLBA 3CCQS 3G9CA 4WFNQ 2VFSA 3HHNB 1PJ5A 1FX4A 4NZ7A 1YJTA 5CYJA 3C3LA 5CD4H 3FCWA 5E3QA 1R8HA 2DH7A 2FJWA 3L09A 2ZD1A 3RBEA 1RT6A 4H54A 1OSCA 1FKOA 2G1HA 3UR3C 4DX7A 4X4PA 3BS9A 2HGMA 4X2BA 4NPOA 1IBLJ 2J8AA 4WP9A 5HMXA 2AYMA 5IWAJ 3BEGB 3KJVB 5L38A 1SBRA 4EGLA 3PYFA 3CC2S 2CUYA 4FF4A 5AE1A 4IH6A 1SL2A 4KFBB 4C3MA 4YN3B 2RRBA 2Q6BA 2O5DA 3PFOA 1JWWA 1IBLF 3CDUA 5IWAF 1O5JA 2AP6A 4HLBA 4ZN3A 2Z0GA 2Y1LB 3MM9B 5GAHI 1J5EF 4UUWA 3OJUA 4DUZF 4QJVA 3VAMA 2W2MP 3MTJA 4WE1A 2ZHAA 2DK2A 2UXDF 1T11A 2CADA 3UD5A 5EWGA 2DEJA 4I6AA 8AT1B 2QL9B 4UQGA 4WXWA 3LO3A 2UUTA 1Y4ZB 4P2SA 1RP5A 3D0IE 4ELTA 2RB7A 1AZSA 1QDUB 3J7Z5 1NCLA 4FKXA 4DV6J 3THVA 1SL1A 3CIMA 2HIQA 4I4BA 5D3GB 1LWCA 4OI6A 1J27A 2YQ3A 2V4RA 3GSIA 1A7GE 3B54A 2LXIA 1U0SA 3M6UA 1SPBP 1RTDA 3EX7B 4J5OA 2DCLA 3OR2A 2KXNB 1SH2A 3EZUA 4WCEQ 4Y34A 3POTA 2UUAJ 1OWXA 4C0BA 2RQKA 4R0EA 5LJ5Y 3ENAA 3VWSA 3D6TB 4NYPA 4UOGA 5BJRA 5L1IA 1X5TA 3CWJA 2CIMA 4CM0A 2YKPA 4ZITA 4CRJA 4OX8A 3SSSA 3LGNA 5AXNA 1F9HA 2AGPA 1EP4B 2IIHA 4TQRA 4K59A 2WVFA 2BQUA 4FXVA 2ZH9A 1FO1A 2QYCA 3A8KA 3TA0A 3BGFA 2D69A 4NZ0A 2GIQA 2OPQA 3I56S 3EVWA 3DU6A 1QJHA 1HBOB 1L3SA 2XLKA 2ATLA 4PXEA 1M0SA 2YWGA 3IRXA 1VJWA 3CCES 5AXKA 1CEZA 3DLGA 2Z30B 5KT3A 2QYGA 3AOAA 1RTZA 4WU3A 5JXSA 2CDRB 1S5ZA 4DL5A 3GFHA 4U7CA 4G3IA 5E3CA 1WHVA 4N5SA 3CTRA 1T05A 3SIPB 2W9BA 5F8GA 1Y9OA 3QAEA 2LQ8A 2N3LA 2D7SA 5HP1B 2IM3A 3BGLA 2F40A 3D6MB 3H5SA 4DCJB 1WWHA 2V0NA 4UZBA 4DV4F 3FJ2A 4LR8A 3CJKA 5H9FJ 4PEOA 1LWFB 1O0PA 4RLEA 3RU0A 3W1YC 4OHZA 4Q0BA 4IFYA 2XSJA 2OLWA 1KQFB 5DRKA 1HYSB 1RBLA 3MCOA 4Q2MA 2X1AA 3A13A 1IR1A 1T9VA 1NKBA 2OHDA 1S49A 2LCWA 3CD6S 2KL8A 5G0RB 5KT2A 3KDNA 3QZ8A 5J2PB 3PR5B 2BKNA 2HS0A 1L3TA 3G82A 3DRYA 1N54B 2QTWA 3FZBA 1B99A 3QGIA 5GAGI 5ETLA 3GG0A 1FVQA 1S9GA 5DZ7A 3FFIA 5IV3A 4PG4A 3ADAC 4E98A 3GCWP 5B0CA 1VQYA 2AHOB 2H9ZA 2XS2A 4AD6A 1JLCB 2HVHA 2AW0A 2DY9A 4N77A 5KG5A 4R5PB 3SYZA 4AQYJ 4KO0A 2Z56B 2CNNB 4JI3F 1P9YA 4NLPA 2CRLA 2OPPA 1VQSA 4TU9A 1N8RT 1H0HB 4NLUA 3CPWR 3R5AA 2O1PA 2HKEA 1RWUA 4DR6J 3ET6B 3IGVA 2FDNA 1DBDA 2HHWA 4WF9Q 4KH1B 1RWNB 3RBXA 3RAXA 1YJNS 1FXDA 2GMLA 1GFWB 3HT3A 1S6PA 1IKYB 1OPZA 4DR6F 1LFWA 3SZ2A 1T03B 4LQ9A 4JI8F 1OS5A 1KLNA 1IBMJ 1VC0A 4DS5A 2E1CA 3DFEA 2BM0A 3QFWA 4NYOA 2PMHA 2OAUA 4GVBB 2C22A 1MW7A 2NUHA 4UZCA 3AOCA 2ROGA 4EBCA 2OIHA 4B3TF 4QIWD 1RTHB 3K7RA 4ZCMA 1RWXB 2VBYA 1M5SA 2XYPB 4MK8A 1TUVA 3HK2A 1IBMF 2D3UA 3R5CA 4DG1B 5L8RC 4ILLA 1W2IA 3PHEA 1RBAA 2NS1B 3T1AA 3MECA 2DPJA 1Q78A 2CVIA 4N56A 4X4TA 1R8AA 3PEJA 3UO0A 4DFJA 4PCQA 2DY1A 2IM0A 2QRRA 1WF1A 3A3OB 2OI2A 2JEFA 2LFVA 3EJMA 1UFLA 3N6LA 4WFAQ 3PDNA 1YLXA 3WC2A 1L3KA 2B9XA 3O44A 3BPSP 4K4XA 1HARA 2AQ4A 1RT3B 3MHYA 2MQPA 3CJTA 2VH7A 3W2VA 4P52A 2XY5A 2MLYA 2QA4G 2HHTA 1AUSL 1GTEA 2FVPA 3M6XA 1IR2A 4UOHA 2W1BA 2JH3A 3O1LA 4ED6A 3C8YA 4QIGA 1HWLA 2LECA 4OZ3A 4OL8A 2I6WA 4ECRA 4M63A 2V4JB 4ZP6A 5C25B 4WYLA 1VDHA 3Q8VA 5G4DA 1U6ZA 2V68A 1PAUB 2U1AA 2XMTA 1UFKA 2WW4A 1IKXB 3R5GA 4JP8A 1WEYA 2YNFB 1M5VC 5F9NA 1X5PA 2PC6A 1W25A 6AT1B 2NUUG 3O5TB 4M5LA 1ZZNA 1VQLS 5DQGA 2GMJA 4X84A 3BGOP 5ETNA 1DLOA 2OD4A 1HNXJ 2XYHB 1RT1B 3AFGA 1YRXA 2YKQA 3KHLA 1OIAA 1JLGB 3Q8PB 2BEFA 1CBKA 1FDBA 1EP4A 1MN7A 2GQCA 1IJEB 4ELUA 2UV8G 1FHTA 5CH7B 1X9WA 3W9HA 4EEYA 2YKNB 1HNXF 3L4BC 5F8LA 3HHLC 1SV5A 2DNYA 5DGBA 4YY3J 1X4GA 3U1MA 5K20B 1JB0C 2G2ZA 3VVTA 3VZHA 2MZJA 4I6YA 1VK8A 2RT3A 3HVWA 1R8CA 2DJWA 7FDRA 2H4YB 5H9EJ 1AUDA 3R7SB 4UTGA 2IAJB 1GMWD 1Y5NB 1NPRA 4M5GA 1S10A 2IVMA 3QJPA 3Q8YA 2FPHX 3UE2A 4ED2A 2J6SA 2NXJA 4LFAF 3EVOA 2CQ4A 3TRGA 2MGZB 3K5LA 2ZEJA 3FEZA 4JI6F 1Q7LB 4H4KC 4ZVUB 4YP3A 3SCLE 1LWFA 1JIHA 4B3MF 3WQPA 2R8GA 3KMSA 1VHIA 4QIEA 3E51A 4NLWA 4CDIA 1FDDA 4FF3A 2K3KA 3RB4A 3HX9A 4Q7AA 1R8PA 1HQUB 4B9TA 4OV1A 3TNVA 1ZOTA 1Z2LA 4L74A 1HBUA 4DXLA 2WZ1A 2MXYA 3TUIC 2FZGB 4DL7A 2KVQE 3SCJE 4O4GB 2XHCA 1R43A 2OPSB 5G0RA 1KQKA 2VJUA 4CO3A 4LVOP 1XMQF 2ZBCA 2R2SA 4ILRA 3AB2B 5IOLA 4JI1J 4HT7A 4KYZA 3ZFVA 1RTIB 3WX4A 5EWFA 2W01A 3QO9B 2KG1A 1D3WA 5GADI 2I9SA 1UW4A 1GQEA 2QLWA 3KWMA 3OFEA 3ILOA 1CLFA 1SC4B 2H3EB 3NAIA 2V50A 1VYAA 2R2TA 1L3VA 2C3PA 1T8EA 4YMEA 3RB6A 2EW9A 4WFXA 1VR6A 4LRCA 4YQWA 4A8SA 3PW4A 3DHWC 2AYEA 4OZ0A 3VHQA 3I4PA 4RZRA 3M2UB 3PRBA 5A2QU 2G13A 1YZ6A 4ES1A 1F3FA 1K47A 1PYSB 1YTYA 2DVIA 2M88A 3G86A 5CABA 4I64A 4NA2A 3IG1B 4B02A 4UY8T 1FVSA 2NXEA 3CIZA 3M4XA 4DPYA 2GJFA 3LANA 3U1NA 4F4AA 4C4WA 3P5BP 4TNOA 1P1TA 1KFSA 3QT5A 5EUHA 2Q3PA 1XWLA 3UCUP 2OH2A 1IKYA 1W26A 4PG7A 3CCUS 4IDKA 4JOUA 4K5RA 4DFPA 3SSRA 3QT7A 2XMVA 3US5A 1IBKJ 2GVZB 3BJYA 4GVBA 1UJ6A 2NREA 3T6JA 4OYXA 1RJJA 2AGOA 2HLUA 3K8WA 3J7YU 4TVAB 1VGYA 2ZBRA 1P1LA 4JV1A 1RTHA 1GXLA 1RCXB 3OR1B 2DR5A 4U6PA 3HI9A 4A8WA 1YJ7A 3MDFA 5KFDA 1S99A 5D0HA 2E5LJ 4J90A 3DHXA 1IBKF 2PO4A 1ZM4A 2WK4A 3THTA 4XK8C 2EXUA 4A8MP 2W24A 5DS7A 3GU0A 4PQUB 2I5JB 1JQGA 4B9NA 4ZVRB 4KH0B 1FE0A 1REVA 2Q6CA 1QY7A 2YNHA 3GJQB 2DR7A 2AJ1A 3TZWA 4JYAF 3D4JA 4ATNA 1M1KT 1WC1A 4IOBA 1B0TA 3GILA 5HROB 3M9OB 2QMXA 4RPFA 1WI8A 3DLKB 5IQQA 1T9UA 5F8JA 2JEJA 4DSEA 4ZIWA 4LF7J 4M5DB 2ZH1A 1VOMA 3UI3A 1Y3JA 2ZC4A 5KOWA 4OX7A 3FSIA 2VC0A 1QD1A 3H2VE 1FJ7A 3V81B 2BVZA 2FLPA 1VQ6S 5KFSA 5I3UA 1FXRA 5JVGQ 5IZHA 3TVZA 2FHMA 1FWKA 3B8HA 5L9XA 4I69A 1IJFB 1U2RA 4I2QB 1O8BA 4LF7F 2WSCC 2NZCA 3KJNB 3Q22A 2BZ2A 3IC1A 1IKXA 2BANA 5HI7A 2MKYA 1KOOA 2LXUA 2MZ1A 4X4UA 4E2FB 4OZ2A 3TANA 3VGTA 4NLTA 3PW0A 2VDIA 3Q0AA 5HQMA 4DQQA 1DQ9A 1EIYB 4ES2A 1HBMA 3LP0B 3J7AN 4WXOA 2CJQA 2MKJA 1HPZB 3J80U 5T14A 2KN4A 4DUYJ 3LP1B 1YBUA 1ROFA 1Q4RA 4HH0A 2ZHBA 1TZ0A 2AYBA 2ZE2B 2IRXA 3DU5A 4ED7A 4WKRA 4CLLA 1HKAA 2EWHA 4PAAA 4MAKA 3KHHA 1N5YA 3PEHA 4EWTA 4WIQA 4HKQA 5HVGA 2K8GA 5T41A 2H5JB 2I0XA 1Q8KA 1S0VA 3R5BA 2YKAA 1CQNA 3ZO7A 2VJVA 2HVEA 2KRBA 4HI1A 3ULHA 3ZTOA 2V34A 3CJ5A 7AT1B 3BSAA 5GAEI 4DX8H 1K8AT 3IRWP 3OUYA 4AXJA 4LUBA 4ED4A 4WK1A 1H3DA 1KDNA 3K2YA 4C3KA 1TL4A 3LAMA 3KUEA 3JAMU 3T1YJ 2H5IB 3KK1A 2V2VA 5DDOC 2RILA 2HWIA 4TY8B 1FESA 2N4DA 4USWA 3QZ7A 3MM7B 3UCGA 4K0KJ 3FBEA 3HVRA 1PJ6A 5HL7Q 4HDGA 1NJYA 4GKJF 1EETB 3BPDA 4PZVA 3MEEA 2B3TB 4CLFA 1DY3A 4TU7A 4RU2A 4DBQA 4OYWA 3IWXA 3EVMA 3EMTA 1S97A 4RJVA 5KFQA 1T7PA 2DPIA 4URQU 2MJNA 2W2QP 2X1FA 2WONB 1WDDA 2E5JA 2RF2B 1KR4A 2DRBA 2XZTB 4Y28C 4USJC 2NXCA 3R8YA 2FC8A 1FJGJ 1ZA1B 2HBYB 2LMIA 4O4GA 3Q86A 2OPSA 1NM2A 1UL3A 2OPRB 2XEXA 4IO9Q 1WELA 3I5AA 1VQKS 3E01B 1OO0B 4RX6A 3T5LA 3H42A 2CQGA 3GONA 3MD3A 1D09B 3UDLA 2RRAA 1FJGF 2FIUA 3QO9A 2MQOA 4M95A 4P2MA 2UP1A 2GCFA 2H54B 1N33J 1WEZA 3Q24A 2ZNYA 2YNIB 3NCPA 4P6QA 2MY7A 3GYXB 3CVKA 4ZOSA 2VODA 2UUCJ 2MMYA 1FKAF 1N33F 1H7XA 3L9ZA 3M1VB 3MR3A 3NNAA 2FJEB 2VDHA 2LU2A 2EBEA 1R6VA 1B64A 2E7XA 2R7XA 4U8YA 2FHKA 1HNZF 4MH8A 4LF8F 2GJ2A 2VG7B 2YXLA 3GIIA 3ITHB 4ECTA 4J9UE 5L1KA 2UU9J 1FEHA 4B08A 4ITSA 4BC7A 5AE2A 4WP8A 2WCXA 3D28A 1Y7PA 2M0GB 4CH1A 3NGUA 1PC4A 2AIRB 4MIWA 3AT1B 2JLEA 1S6OA 2OD6A 2YKMB 2FVQA 1ZPVA 4YB6A 2GVZA 2G4BA 5A0YA 1I94J 1PYTA 3PIOQ 4C11A 2GO8A 5FIIA 2JDJA 3JSMA 4LSLA 2RHSB 2CPZA 3TAPA 1VRUA 3PY8A 3BR9A 2ASJA 5KFUA 2IYGA 4PQUA 1PILA 4J9NA 2E44A 3BN7A 2P2CB 4MKBA 1U1QA 1OQ6A 2EG1A 4P72A 2HS4A 1H6KX 2XM3A 2ZDPA 2HFOA 1YVFA 1GMWA 2HHSA 5LXYA 3G6ES 3CD0A 3PG9A 2GS8A 1U26A 4TLRA 5ETPA 3PW2A 2COLA 4HHJA 5MLCV 1WNEA 3LQVA 5LSOA 2JLFA 1R0CB 4RBTA 2E9TA 2X1BA 1SKSA 3NY0A 1QE1B 2N4CA 3DLKA 4B3RJ 2HZAA 3MMAB 4KJIA 2KM8C 1GAOA 4ECUA 2VUGA 3ZZUA 3NXZA 4OZLA 1U24A 3P3DA 4KTQA 1RYRA 1R27B 4V1Ak 3BQ2A 3H90A 1NO8A 3P5TL 3KK3B 3V4IA 1TL7B 5KFJA 1XMBA 4BHQA 4HHHA 4LF2A 2R7TA 5LMNF 4I2QA 2ZZTA 2DHGA 3FKBA 3S6EA 1Q8LA 2PI4A 2JSXA 3MOZA 3OFGA 4E0DA 2CKWA 2EFGA 3E2EA 5KFTA 3DMJB 1N36J 5B0FA 3C14B 2GFFA 3M2RB 1S7HA 3AQPA 3OVBA 1TKTB 2NPIA 3EGNA 5DLFA 1HLWA 1YBAA 2R7RA 2JX2A 2D3OR 3GYGA 1R3NA 4RW8A 4USUA 4ZDNA 1TV6B 1NXIA 2VASA 3CJ2A 2AV5A 1FE4A 3FGVA 5D8HB 4Q45A 2ZE2A 1RA7A 2B6AA 2WAQD 3QJJA 1LW2A 1X7VA 3DLJA 4CM2A 2FJAB 3L7PA 4P7VA 4JI2F 3MM6B 1LWEB 4X65J 5THWA 5M2RA 5IC4B 5LSRA 1OPIA 2G1DA 5EN1A 4CYUB 1F60B 3ZTQA 5RUBA 3IBCB 3PYDA 1SC1B 1PG5B 1YIJS 3CUNA 3R27A 4AFFA 1WKKA 5E5NA 4ZVOB 3G71S 1MU2B 1BQMB 2Y1JA 3BR8A 4IG0B 3D3CJ 4X65F 3UCZP 2LQ9A 2DRAA 1VBXA 5AXLA 5K8MA 1YJVA 3TARA 3NKYA 3ILJA 2A10A 3R7NB 1WC6A 3EXYA 1FKPA 1ZTWA 1UEUA 1KSPA 4KKOA 2KHCA 1UFWA 4HACB 4DZDA 2LYVA 5B0GA 1Y10A 4J9OA 4LVNP 1RB0A 1UETA 1IUJA 3EPIA 5A8KB 2M52A 2W7PA 1JNRB 3I0SA 5M2UA 5A2QY 4OMFG 4OYPA 1X4CA 1LW0A 2Y0SD 2FUG9 2RDIA 1KWMA 3VGSA 4ER8A 4ICLA 4ZHRB 3DGVA 2OMOA 5GAHU 4RBVA 2YWFA 4NA1A 1TUWA 4ECXA 3MURP 2RAQA 3SV4A 1VBKA 4Q43A 2B0GA 3D67A 1X5OA 3EWGA 2E1PA 2BE9B 3W9JA 4B3OB 1UVNA 3HT0A 3U27A 5ETSA 2H48B 3BZQA 3R6GB 2RF2A 1NK8A 3LGMA 2DNLA 2HNDB 2E5HA 2R2RA 4KPYA 2FB0A 4OHXA 2RMLA 2H65B 4OZ1A 1RHQB 5CYMA 2A2DA 3HCXA 1U1PA 4M94A 2EBGA 3SFGA 2FJXA 3KMQA 4JV5F 1YJ9S 2DNGA 2B4PA 3KLIB 3E01A 3KG1A 1RHMB 4QWAA 1IWAA 1PSDA 2CJKA 4MYTA 4XTTA 3DC2A 3AH6A 2D1CA 1LEOA 4M5MA 4C6AA 4B9LA 1JLBB 1HBNA 5ETQA 2YNIA 3GE9A 2RSQA 4K2JA 3GIJA 5HSPA 4ZCIA 4F4KA 3QRPA 5KFFA 1IM6A 3PVXA 5KT4A 3M8PA 1RISA 3S01A 2CPEA 4F7VA 5F0WA 1NJZA 3CC4S 3EM1A 2DIVA 1REGX 3M1VA 2DNNA 3CDBA 3Q2TC 3AB4B 5F3ZA 3RB3A 1VCTA 2FC9A 1JLEB 3R7BB 1MWZA 3KDOA 1WORA 2YNGB 2VG7A 4RNHA 5F0UA 2XQCA 1RACB 4C8MA 3CO9A 4DV5J 2CZ4A 4BBYA 4KGVB 1XK8A 3MCSA 1N6QA 2ERRA 4QR2A 1TAUA 2KZMA 4OYIA 4LR7A 5E3PA 3HSDA 3PRVA 4LSNB 4IFVB 5ETMA 2JNJA 4USVA 2WHOA 4DV5F 1L3UA 5FDLA 1HHTP 3OBIA 2ZVIA 3R2DJ 2J9EA 2DR8A 5AE3A 2XYGB 4DV1J 2RS2A 3E8OA 2XS7A 1J2VA 2IVFB 2DH8A 3QFHA 4JI5F 4OZ5A 1WSRA 3J80Y 4OHYA 2V8HA 4ECVA 3CEDA 5BR8J 4S0MA 2DNKA 4OI1A 4YB5A 3W5YA 3CULA 4F0MA 4RU9A 4DV1F 1JXVA 3GQCA 1S0OA 3TVYA 3TJ8A 3KLHA 4IKAA 2PD1A 2HEKA 5HBMB 4UOFA 5BR8F 1UEKA 5KFZA 2XY7A 1P27B 1B7YB 5HN0A 1S1XB 4I68A 3M8SA 4MKYA 2OEJA 2XC9A 2BR0A 3C6UB 2DGVA 1ZM3A 3MPWA 2W4CA 4FF2A 5ETTA 3MMAA 3TAMA 3X3UA 4FS2A 1HNVA 5H9FK 1V5VA 4NEZA 4RW9A 5GAGU 1QUVA 1TL3B 4BC9A 1LK5A 1S72S 2JEGA 4NE9C 5C2GA 4KT0C 4B9UA 2M7SA 3KK3A 5KFPA 2B5JB 3JAMY 2C42A 2Q1LA 2P8IA 4LF6J 3ISND 5HMWA 3QJLA 2Z57B 4MKAA 3OLAA 2YQ0A 3SQGA 3NMRA 5FD1A 3BH7B 4C98A 2X3GA 3J7YI 4TN2A 3CCRS 2YPZA 4B17A 3L7UA 5KFGA 3DMJA 1JKHA 1U6FA 3C2PA 1AB8A 4LF6F 4E8UA 2XZWA 2FHJD 1B0PA 4JI0J 1TKTA 4NXMJ 4Z2XA 2WOMB 3I87A 1NUEA 3RRHA 2FVRA 5GVQA 2R8JA 2GJIA 2RJZA 1LQ9A 3BQ0A 2MB0B 1C1CB 1BUXA 5C24B 1X9MA 3PCOB 1JLAB 3KLGB 1WSVA 3VAGA 1S0MA 1IKVA 2ALZA 1FFWB 2KKHA 1EZZB 3CDEA 3V2UC 1EHWA 5F8MA 2ASYA 2M9KA 1RKIA 1PO6A 5IM0A 3HKZD 4CYUA 2P6SA 4U9RA 3NCRA 3M8ZA 3K8VA 2P9CA 1BQMA 2QE5A 2M8HA 2M3DA 3QT8A 5GMDA 1VQMS 2IY5B 4PUOA 2XMKA 3RYLA 5LXRA 4IRDA 2R7VA 1FWPA 3QWUA 3M2VA 5E3RA 4DQSA 1FJCA 5CYQB 2VG6B 4HACA 4ETXA 4OI4A 5KFVA 4A4JA 2GIFA 4LR9A 4X66F 3ZXWA 1VQNS 5A8KA 2J0XA 2GW8A 4DR7J 3OHAA 2W8KA 2N82B 4JB8B 2IRUA 3H7HB 4LF1A 1CJKB 3IA0A 3V6KA 1N34F 1S9FA 2N3OA 2VPWB 4OZJA 2QO3A 1YGYA 1CJTA 3LWLA 1CJVA 4P71A 2POKA 3TZZA 1SIZA 3MAAB 2QFIA 4B3OA 4M5IA 2GMHA 2EVZA 4H4OB 1U1KA 3KLEB 4LT6A 1F0XA 2IA0A 3N0VA 2ZBPA 4KR0B 2ZHOA 2YX4A 1KVIA 2YWWA 3Q83A 2MQMA 3AA9A 4DR1F 1D9DA 2C2OB 1XQIA 3KLIA 4DR3F 1IM4A 4DPUA 3BO2A 2OELA 1YKWA 3PHTA 1VFJA 5I42B 2OUGA 2Y3YA 2VOPA 4WTOB 4WP3A 1B3TA 4KBIA 4J9VA 2WRMA 1URRA 4M8LA 2XGQA 3QLHB 3C46A 3DGPA 2AWZA 1AT1B 1S4FA 2PSZA 2VIHA 4YDXA 1PYOB 2WB4A 1WC0A 1N5TA 1RT2A 2H51B 4PPZA 3MFIA 5DM7Q 2HZVA 3K17A 8ATCB 4DR2J 3IAM9 4AL5A 2N7YA 4F26A 5J2MA 3T41A 1BHNA 4HVZA 2V9WA 1BE4A 4USIA 4PWDB 4WK3A 3QYYA 3W8GA 2DB1A 4ZP8A 4GC6A 2WBRA 1NK6A 3Q8QB 4ED5A 4YDDB 4DR2F 3J81j 1Q1KA 1HQEA 1S1UB 3IR6B 2DCUB 1LOUA 2XGPA 4G1QB 4FXDA 1KFDA 1WD6A 4EYIB 4N7TA 1NB2A 1ZYQA 3ZZTA 3B6BA 3GJSB 3OJSA 2IC3A 3HMJG 2M2BA 2HVDA 1VLYA 3FBFA 4G1PA 5D4PA 4YR2A 3MR5A 3KK2B 3DOMB 3B78A 3K89A 3W5ZA 2VBXA 2C3MA 2J0WA 3BGRA 4JI4J 1FD2A 3HVTA 4RUHA 2M5YA 2MQQA 3PO5A 1Q8IA 2NYHA 1N5SA 3TEHB 2CQDA 4NYZA 4OYOA 4NLGA 2KYZA 5KFNA 2BOAA 1FA0A 4L3NA 3MMBB 5H9EK 1S1TA 3LUYA 5HBMA 5IQ6A 4A8KA 1RT4A 4JI4F 5D4NA 2B51A 3G8SA 3FMWA 1RU1A 5BYRA 4ALZA 1XERA 4X4SA 5KOXA 1VRTA 4LF9F 3GG1A 3QATA 2JLGA 2XTJP 3MCMA 4JI7J 4MYUA 2RS8A 4ZP7A 4HR2A 2CQCA 2GHVC 1VI7A 4ETZA 4JBCA 2R7OA 3IS9B 1N5QA 1TL3A 1AXQA 5GADU 1U6BA 2XHWA 2EG2A 4HHUA 2ALYB 1SL0A 4IG3B 4W4MA 2B5JA 5KG3A 3K58A 1SKRA 3L7OA 3KKFA 2BUNA 1QAJA 5ETKA 1RBOB 2PA8D 1XC9A 2FGOA 2QFJA 5DQHA 1IBCB 2A3JA 2AJ0A 4IYQA 4DV3J 4K4TA 3VAIA 1JMTA 2RRNA 4IR1A 2IJFA 3I9ZA 2KRRA 1YRTA 2HQIA 1R0AA 4X4VA 2GAHC 3OXLA 4NZ6A 3MOJB 2OO4A 5A8RB 1C0TA 4QPTA 1X5SA 1NEEA 4NEYA 3RGIA 2ACYA 1JLAA 2GHWA 1J5OB 2H5EA 4ZP9A 3D5MA 3RRKA 3CJRA 1T9XA 4DU7A 1RAHB 1DTTA 3MEDA 1OYEA 3TX0A 4R8UA 2ILYA 4A8XA 2PI5A 1VK3A 1SJ1A 4XIUA 2MQNA 2VQEJ 4NMLA 4C97A 4B9VA 1NHUA 2ZH5A 1ZA2B 4NASA 2HFSA 4WTYA 4H4MB 4JV2A 3GLJA 4MKVA 3G87A 2CQ2A 1TL1B 1RAOA 2K06A 1A9NB 2NYIA 4LFBJ 2QMUB 1FD8A 2V9KA 2CPIA 1ZAWA 1HNWJ 1KLMB 1U1LA 4OJHA 2G9OA 2G0IA 4QYRA 3NMAA 1U09A 4BCAA 3W5XA 3MM8B 2RDDA 4FNIA 4Y6IA 4LFBF 1FK9A 1MN9A 4FYDA 1I1GA 4ZVFA 2NSCA 4LBHA 3CCSS 1SJ3P 3OL7A 5J1EB 1Y5IB 3CGIA 4B3SJ 1ZTTA 2GVDB 4Q8EA 2GAGC 3BV8A 3D7SB 2MZQA 4H4OA 2MKHA 3PKYA 1F1BB 1HWUA 3BYPA 1UJ5A 5LSLA 3LW5C 3KLEA 4NCGB 1NNDA 1U1RA 1HR0F 3VAFA 3ENVA 3FEXB 3KJQB 3M8WA 2D3O1 4CCHA 3FSXA 2XO6A 2GV1A 4GC7A 3QRQA 3G8TA 4GO5X 1I6JA 3KUGA 2GGPB 1F5BA 4B3SF 1KP6A 4EZ6A 4ZPVR 1WACA 2YQ1A 1X4EA 2MKCA 1CS4B 4DDFA 2F63A 1H98A 4CLSA 5AXMA 3ENQA 2VOOA 2QA1A 3BN4A 1LXJA 4O44B 2IMOA 4Z37A 4RL1A 2HW3A 2CA9A 1JLFB 3P45B 2OSQA 1WDTA 2RUSA 3T19A 2Z2YB 4NLRA 2C28A 3DRSB 1SXLA 4AE5A 1J5EJ 2VPYB 5LJ3Y 5DM6Q 2PN6A 3DRRB 2LQ5A 4ED3A 3K5NA 4DUZJ 1SQFA 4EYHB 4FYYB 1VRQC 1TK5A 1HNIA 2VICA 5DDQC 1YJUA 2UXDJ 2CPJA 3GTYX 1P9QC 1U8WA 4I67A 5CZVA 5JJBA 2ZJQQ 4L73A 4RW6B 4LRAA 2NQPA 1RHUB 4ZVSB 2HQCA 4QZVB 1OQ3A 1T9WA 4EU0A 1M5HA 2I1RA 2MZTA 2QV6A 1Q86T 1GX6A 2BE2B 4NXNJ 2AZ3A 4WU2A 3MUTP 9ATCB 5L9NA 3MAQA 2HQ3A 5GAEU 2V2ZA 2HQDA 4GRSA 4ES3A 4DLGA 2DBBA 3HJFA 3M30A 4G1QA 1SH0A 2J6TA 3EE3A 2PIIA 5B0DA 1PJ7A 4NXNF 2KHDA 2OSRA 1E6VA 3VV2B 4WJBA 1HMVB 4NOHA 5IFMA 2EFOA 1FDAA 3H5UA 2DR9A 4C48A 4G65A 2BBEA 2LKZA 2QSFA 1N0VC 3V4MA 4ZLLA 4ED0A 3LP2A 4JUZA 3HD1A 3A1YG 5LT5A 4QWCA 3OFHA 4ED1A 3KXDA 1R0BG 2Z4PA 1F3VA 4RW7B 3EDRB 5HVHA 2DISA 2MQ8A 2NR0A 4AL7A 2ZOGA 2E5GA 3UD3P 4KV8B 2XNRA 1JK9B 1S4EA 3ETOA 3BSOA 1C1BB 1Z1ZA 2DNPA 4CO4A 2PEHA 2CJBA 4KHRA 5FLXU 4FKYA 6FD1A 5L1LA 3UN2A 4FVMA 3LA0A 1FRLA 1RZMA 2OKQA 1XBWA 2JFKA 2FD2A 3PW7A 3DI6B 3MEGA 3GWCA 2EEYA 3ZTRA 2PMZD 2ZM6F 2V8DA 4FP9A 1YHQS 5KFWA 2YKOA 4Y2AA 1JJHA 2OFGX 2BXJA 1M1GA 4PYAA 2RU3A 3U1LA 4USMA 2VPZB 4CLWA 1MMLA 3JQKA 4DV4J 2JHEA 4XPEA 5C42B 4NA3A 5K14A 3V6DB 2VG5B 2HMIA 1KVKA 4CO1A 4ZVPB 3LOUA 1RAEB 3MWBA 1KN6A 3JTPA 1F6TA 4ID5B 2EFVA 3VGVA 3NNCA 2CG8A 2DO0A 3HM9A 3DN9A 2DRDA 3NBPB 2Y8YA 3W9IA 1Z2ZA 1UMJA 1BXNA 2HLTA 3DOKA 3IM8A 4EO6A 3D6FB 3GJRB 1ZZFA 2DNMA 5C7PA 5A8RA 1JLQB 2HNZA 2FY8A 5L46A 1NDPA 2OP5A 2V6AA 4YHHF 2HPUA 4N41A 1J5OA 3IWNC 4TKTA 1U4BA 4L6V3 2C2NA 2HHUA 4KSEB 1UP1A 4ELVA 3ZTSA 1UA0A 4PXCA 1R8BA 2HK2A 2B43A 3M32B 1GNKA 5GMEA 4I7FB 4NI2A 1UAWA 1KEKA 1MWYA 3HJVA 2O3DA 1T94A 4D3GA 2UZAA 2PT0A 4JI3J 3CCLS 5CA5A 3TR5A 1FTRA 3EGWB 4ANDA 3BBCA 5J2QA 4I1TA 1KQGB 2WVCA 2XI2A 1RYSA 2XB2D 1FRKA 3NOCA 3MUVP 1EKRA 2DHAA 1UKUA 5HLFA 1UVLA 4A47A 1VHFA 3CJ8A 1NH8A 1LWXA 2QX0A 3W7BA 1H2VZ 2VD3A 2DGWA 1D8ZA 4NLYA 3MM8A 3NS7B 5KFLA 4JI8J 4L76A 3R97A 3PJWA 4MK7A 3WIUA 1PAEX 2HQFA 2VHGA 2GIRA 1GX5A 1Y5LB 4KGXB 3HP6A 2V69A 3BDEA 5J1EA 2E1AA 2ZVSA 2YPYA 3M6WA 4B3TJ 2W9CB 2GVDA 4ILMA 2YH0A 4YEAA 4DF8A 1V9OA 2IA6A 4KRWA 4NCGA 2ZFHA 1SC3B 3KHRA 3BBBA 3N5FA 4F25A 3OV7A 2XS5A 4DV7F 1D9FA 4QU7A 3OSNA 1I5OB 2JEIA 1VC5A 1F9FA 4L75A 4EBDA 4J91A 3R2CJ 3N28A 2DHSA 1VQ4S 1CS4A 2EC2A 5IT9Y 2P9GA 3CD7A 2E66A 3WZ0A 3SXLA 4QIVA 1AFJA 5HMYA 3D1OA 3KJVA 1WOPA 3VCDA 4AUKA 3DRSA 3A8IA 2HGNA 4KFBA 2JWNA 3MUMP 3CMAS 3HZEA 4ZPDA 3DRRA 3MPDA 3D6HB 4XAKA 1T9YA 4ZVEA 2JRSA 3MI7X 2IM2A 3T9ZA 3NG8A 1HFEL 3RRGA 3PXGa 4GKKF 1H7WA 4RW6A 1JXLA 3MM9A 1WC4A 1QTMA 2K1RB 4DFMA 3A12A 2DR6A 3SV3A 3GR1A 1BWEA 3MGJA 3OVAA 2ATCB 1Q79A 2DYAA 3I55S 2CZ9A 1UWBB 3OT9A 3ELHA 3FC9A 1TKZB 3TYTA 3P96A 3WC0A 4QYZJ 2QC3A 1TELA 3HSGA 2L41A 5HK4A 2AYGA 4U96A 2ZD1B 3GCXP 1RT6B 2UUWA 4A8QA 1NSQA 5D3GA 1FKOB 3N6NA 3B4DA 4X64F 2BJ9A 1WOSA 3UQSA 1XJWB 2JJ4D 2HQGA 3RW6A 1JXEA 1NDCA 1Y0HA 1SJFA 1SVDA 3HF5A 1B0VA 2IBOA 2GA7A 1XMOJ 3UWTA 4RO0A 2HSEB 4HEA9 2ASDA 1TMMA 4A8OA 3BBFA 1F2GA 4F4ZA 4O0NA 2RQMA 1IQZA 3OFFA 5D4OA 2O66A 2PEBA 1S79A 1RE1B 2E1RA 1Q95G 3D1HA 2PFDA 1XMOF 3NNHA 1Q81T 4C8YA 2AX0A 3QBCA 1WOOA 1U2FA 3K5PA 4M5NA 3H0PA 2QGFB 2BW2A 2Q66A 2EFPA 3VALA 4W98A 2OMLA 1HBOA 1SJ4P 1BWVA 5KFKA 2VA2A 3DI6A 4N76A 3RBZA 2F9DA 2D9PA 2FTRA 5DG7A 1AZSB 3IBFB 3I96A 3W3SA 4FBUA 3EGVA 4ECQA 3OTEA 4LFAJ 3VTIA 5DDRC 2O67A 4JI6J 3VAJA 4QR0A 3RW7A 1RTDB 3I5CA 1HD1A 2ZH7A 3MR6A 4DL6A 3V6DA 2VG5A 2BABA 5HP1A 4B3MJ 3CJ3A 3POTB 3BGUA 5HJYA 2A6MA 1ZM2A 4WIIA 1RAFB 4YS2A 3GR0A 4DHVA 3M8QB 4XDCA 3C6TB 4ID5A 4QR1A 3TZYA 3NBPA 5E7OB 3MD1A 4ECZA 2CFXA 3HVAA 3TUPA 2XBPA 4KHPF 4MJKA 1HYSA 3HDSA 5IT0A 3K59A 4CLPA 1N88A 2BV3A 3A8EA 1XMQJ 4TLQA 4PKDB 2LEAA 3NGDA 1TMJA 2OPQB 2MSTA 3GYNA 3O3LA 2WTFA 2VFUA 1UPMB 2CPYA 3C19A 5D77A 4QQBA 1JJ4A 4CO0A 5DDPC 2EI5A 1YJRA 1N56A 2L9WA 5IXUA 5J2PA 1ZAXA 3CT9A 3H59A 2CPXA 4IOAQ 2CXEA 3NGKA 3M32A 4I7FA 4NLQA 5L1JA 4PG5A 4KGMA 3IP0A 1FRHA 3H40A 1RDRA 3T5KA 1N32F 2IMWP 4ZVQB 2KFNA 2W9BB 2AJQA 4LMZA 3CC7S 3MZIA 4GVLA 5D15A 4K7QA 1QSSA 4B9MA 1S7IA 1HA1A 4BDPA 2YH1A 2DT9A 1JLCA 1VIXA 2HHPA 3IO1A 4NX9A 1SKUB 3HD2A 5KFRA 4P2FA 2ZKUA 5A8WB 4R5PA 4URGA 2R4FA 3CJKB 2CQPA 6FDRA 3DYAB 4OX9J 2LLZA 1UJ4A 4Q0BB 2CQ3A 5EDWA 2Z58B 3ET6A 5HQ8A 2L9DA 1N48A 3CCWA 5KTQA 3UN3A 3G6VA 1ZAVA 2KXFA 2DEIA 2AJ4A 2E1MC 1NKCA 2CQHA 4DL4A 4HTIA 4OX9F 3HHLD 3O6QA 5IS2A 3PYEA 2W4PA 4TQSA 1T03A 2W9CA 1OMSA 3H5XA 3NL0A 4DSFA 1U1OA 2DXDA 4ZPBA 2EFQA 2EFNA 4C8OA 2GNKA 5HAOA 2SXLA 4EUVA 1CULB 1OY6A 2B8QA 2FJBB 2QIFA 3OL6A 4RNNA 1UA1A 4QPXA 4HDHA 4AT1B 4DG1A 3OXGA 1KD1T 1H72C 4LF4J 3R5JB 4KY3A 1RHRB 4X62F 2GC8A 3F56A 4A48A 4JYAJ 2F1FA 4L3KA 1WG5A 2AEMA 4RNFA 1RLDA 2HHQA 1XN9A 2NZ4A 2FY1A 2J7KA 3MMJA 3FDSA 2YWKA 2J9CA 2VZ9A 1P8GA 2ROEA 2XWYA 2OPPB 1ZPWX 3NLCA 4LF4F 5FLXY 1HIYA 4LIRA 5K8OA 2V2QA 2HURA 1C0UB 2DXFA 2CNKB 3EICA 4TU8A 4FN5A 3ZNJ1 5J2NB 5A6PA 5E33A 4DCPB 3CCJS 1RT3A 1AROP 5B7WA 1EAYC 1S6PB 3GFZA 1NRKA 3Q8RB 2QA2A 2CPDA 4PRFA 2A0FB 5EWEA 1RADB 4CLUA 4LJMA 4TXSA 2HHHF 1UWBA 4DX6A 1DQAA 2CJAA 2K2PA 3UN5A 3PV8A 2FLLA 2KT2A 2FVCA 2V4QA 2V4JA 4K4UA 5C25A 3PZPA 1TFYA 4OZNA 5EHHA 2F5GA 3OW2R 3U02A 1MSWD 4W92B 2CJ9A 3TUZC 4J9PA 2LDIA 1R7IA 3MECB 4K4VA 4ZA1A 4F4WA 4F04B 3IMQJ 2YNFA 4J9QA 1MNEA 4ZK7M 2K3IA 1PGZA 3DNCA 3FNNA 2QLXA 2QA4S 4QWBA 1NKEA 4ZJQA 3UR0A 4AYBD 4CH7A 3SBMA 3A3NB 3MPVA 1OY8A 1NLKL 4IH5A 5HANA 3BKTA 2KI2A 3Q8SB 4PG8A 2ZBIA 1RGVA 2E7WA 1RHJB 1S6UA 3OTDA 1RT1A 4B9SA 2V5HG 4Q2LA 1JLGA 1KTQA 2AJFE 2L9NA 2NCKL 2IBKA 3GB0A 3SI8A 3W2VB 5E41A 3KG4A 2FYXA 2AJ2A 3DLHA 1U1MA 2YKNA 4DF4A 5IC6B 4F3QA 2JC0A 2VQFJ 4R25A 2BOPA 1UEVA 4MIBA 3JTOA 1G3OA 1Q7YT 1DZ5A 2HFVA 1EX8A 3HHLB 1TUGB 1MROB 5KFAA 1WG1A 3PTWA 4GKJJ 2HYIB 2WVBA 4EI2A 2J5AA 1XTZA 3HXMA 2VQFF 2IAJA 3V5RA 4UUXA 1NJWA 2R7QA 4NWBA 5DJBA 1G2EA 2HAFA 1PBAA 3NEKA 2HFUA 2DD8S 5CQGA 1F2HA 3A8JA 4DV6F 2PDAA 3GV8B 2BJEA 4UW2A 3DKDA 2FLNA 3CCZA 3M8QA 2MGZA 3B4MA 1NK7A 3C6TA 2CPFA 3LF0A 1DLOB 4DL3A 5HQLA 1S1WB 2VBWA 3HFVA 3OTOJ 4EFAC 5KG6A 2ZZNA 5I3QA 2UUAF 1NK5A 2VPXB 2QLFB 3AD8C 3JYTB 1RAIB 1HQUA 2EKNA 1T02A 3G6YA 1WI6A 5C5JA 3OTOF 3AJ2A 1VQPS 2UVVA 1SV5B 1DFDA 5GMKa 3CF5Q 2DIUA 1OY9A 3WDOA 1UVKA 2B7CB 5KFEA 3BKFA 3SDEB 3IR7B 2JZ5A 2D3ZA 3ONQA 2OGUA 3CO0P 2UXBJ 1RTIA 3MM5B 2DNZA 2OEMA 3D68A 4USTA 1X0PA 1UW9A 4BLGA 1FRJA 4LBIA 4F36A 1HNZJ 4LF8J 4CNYA 3PFEA 4N8NA 2UXBF 3BYRA 3BQ1A 4OIXA 1YG0A 1R89A 5A8WA 4EZ9A 3I32A 4UT4A 2RNEA 1LV5A 1KNZA 1VQ7S 3DYAA 1S6QB 1HI1A 3M2UA 3UDVA 2CPHA 5F41A 1U2CA 2HK3A 1S0NA 3I31A 3KG0A 1PIEA 1TK0A 2AZ1A 2WSEC 4ZIVA 3LWMA 4BWJA 3IG1A 1RQ0A 2IYIA 4DU8A 2VF3A 3NP5A 1SI9A 1O51A 3QGPA 1KVJA 1HBUB 5F8IA 2VFTA 4OV6A 2ZWOA 4LIWA 1EB0A 5E0OA 4QW9A 3RZAA 3S7RA 4ZCLA 3NCQA 4FBTA 2B8PA 4OI2A 5HATA 1FT8A 2MLZA 4K2XA 3TEGA 2IRYA 4RUAA 1NBEB 4UOCA 4TYAA 5KG1A 3DRPB 1U1NA 2ZOMA 4WFYA 3HHEA 2BJ7A 2A1BA 2MQLA 1S12A 3R6LB 1CULA 3OR1A 3ZZPA 4O23A 4OFZA 1NPPA 2MKSA 1K73T 1XR7A 3W66A 3Q2SC 2R9LA 3KNAA 5DG9A 3GZ7A 4UF4A 3VZIA 2VFVA 1TL5A 2C2EA 2DH9A 2I5JA 1VQOS 2X7IA 4RWWA 3M8YA 1NB7A 2Y9HA 5BXIA 2WVEA 4USHA 1K0VA 2UVUA 3I82A 3CE8A 1H73A 4KB7A 3CCVS 3FVYA 1JNZB 3NWGA 3P4UB 1C0UA 1JJCB 4FF1A 1UPPA 3KNGA 4AQYF 5HROA 1TFWA 5J2NA 3KFWX 1SC6A 2JOQA 4W90B 2ZH8A 3UPFA 1XEZA 5LMNJ 3J7ZT 4M5DA 3QIDA 5CD4A 2RUGA 4FZVA 4IDKB 2VB6A 4J9KA 3V81A 3PW5A 5FJ4A 3MPUB 4WBFA 3TQ1A 4ZVGA 3I9V9 2ZH2A 2Z2LA 3HO1A 2BE7D 1XNRJ 2C3UA 2FZKB 3LALA 4M1KA 5LM7E 2AU0A 2OFHX 3OL9A 3HHDA 1NHVA 1F5AA 4M5JA 3X1LB 1H74A 3D3BJ 4P7TA 1B7FA 1N4LA 3P8BB 5DLGA 1IN0A 1XNRF 2F8EX 1AA1B 2ZNZA 2DGTA 3EXCX 2MKKA 4OLOA 3BSCA 1U47A 4JI2J 5LL6d 3LP0A 4WFBQ 5HJXA 2P5VA 4LFCJ 1HPZA 2BW7A 3LP1A 4LRBA 1REVB 1X8DA 2YNHB 1SB6A 4P75A 4P73A 4Q8FA 4RUCA 1OSDA 4F2SA 1X0FA 3G2XA 1VS3A 4LBPA 3E3XA 1BC6A 4FS1A 1YI2S 4LFCF 2QZ8A 2J9DA 3M6VA 3BKUA 1EQ0A 5D0GA 2DGSA 1FCAA 4L72B 2R42A 3CCMS 2NXNA 1HL6A 5I3UB 1TVRB 3NGRA 4IQMA 3CW2C 2BKOA 4F4XA 2DGQA 4OHWA 2MZRA 3QSYB 3TX8A 1K0TA 4CTAB 3HHLA 1MROA 1FDNA 1BLUA 1TAQA 2BANB 2KXHA 2XMAA 4MMOA 2PFFB 3H4BA 3N79A 2HRTA 4X4NA 2FQQB 2JC1A 4TY8A 3RB0A 5B09A 5LOQA 2L08A 1HBMB 3MM7A 1U49A 4IOCQ 3GJTB 2ZBQA 2HAIA 2DGOA 3F73A 1BQNB 1EETA 2HRUA 3MCNA 2DKOB 3NGTA 1RA6A 3DLEB 1F9EB 1V6HA 4IH7A 4OI0A 3QT6A 1S1WA 1GTHA 2VU5A 2B9YA 4PYDA 1N5YB 3VAHA 1Q0NA 4RKUC 2WONA 4H4KA 4JV5J 3JYTA 1BMQB 4OI3A 4KAIA 1XNQJ 3UNYA 2BJ1A 1C4AA 4P9SA 4ZLPA 4DSJA 1MWQA 1M1HA 4Y65A 4C3LA 1ZH5A 1Y00A 2OPRA 2MJUA 5KFXA 3DXSX 3HFZB 1EKSA 1XNQF 3OUYB 3SDEA 2F8MA 1N0UA 3VGUA 2R8HA 3OPKA 4N8OA 2WW8A 3R1HA 1VBZA 3MM5A 5D4LA 1FTCA 1EARA 3CMES 1NSAA 2FJVA 4YY3F 4M5HA 5KT7A 1WC3A 3KK1B 1RWWB 3R9LA 3TAQA 3DM2B 3I6PA 3W8PA 4U67Q 1PBUA 1NJIT 2E9ZA 3WHIA 3RTVA 5D0EA 1L5UA 1WUUA 2IHR1 3MEEB 3DOLB 2A18A 4C8LA
chains in the Genus database with same CATH topology
3E01B 1OO0B 2JFKA 3I5BA 4ID8A 2FD2A 4G1IA 4RX6A 3PR4A 2XNQA 3PW7A 3T5LA 1S6QA 2CQGA 3DI6B 1WHWA 3MEGA 3GWCA 3LP2B 3MD3A 3UDLA 2RRAA 1VQ9S 4C8KA 1FJGF 2FIUA 2C3OA 3JTNA 3QO9A 2MQOA 1JX4A 4M95A 3ITHA 3VF0B 2PMZD 2UP1A 2ZM6F 2WB1D 2GCFA 2V8DA 4FP9A 1D0EA 2YVSA 1YHQS 1WEZA 3Q24A 5KFWA 2YKOA 2KG0A 4Y2AA 2W8LA 4Y3CA 1SJRA 2ZNYA 2YNIB 1JJHA 3DDNA 3NCPA 4P6QA 3CCTA 1TKDA 3OTBA 2OFGX 2E5IA 1HI0P 2MY7A 2BXJA 2HS3A 3FQLA 4QBUA 4NL5A 2RU3A 3U1LA 4WZMA 1VIOA 3GYXB 4Y2CA 2F4VF 2VPZB 1MMLA 2K7JA 2NSBA 4F3OA 3SCKE 3CVKA 4ECWA 2JHEA 4ZS6A 4ZOSA 1YSJA 1JLQA 2D41A 3TI0A 2VODA 5M2PA 4LQ3A 2MMYA 4XPEA 1FKAF 5C42B 4NA3A 5K14A 1N33F 1FNMA 1H7XA 3M1VB 3MR3A 2YKMA 3NS6A 3V6DB 4O3SA 2FJEB 2VG5B 3NNAA 2KZZA 2LU2A 2EBEA 2HMIA 2W4DA 1PC5A 1B64A 4CIOA 2E7XA 2R7XA 4CO1A 1NK4A 3MPYA 1FERA 5F8NA 3MEGB 3LOUA 3UFCX 1X4HA 2FHKA 3BB5A 5DO2A 5K5MA 1HNZF 4MH8A 4LF8F 3IRXB 2GJ2A 3DRPA 2VG7B 3MWBA 3T9NA 1BY9A 1KN6A 3JTPA 3GIIA 3ITHB 2GQ2A 4ECTA 5EX3A 3T6BA 5KFCA 5L1KA 1DJ0A 4ID5B 2EFVA 3TVKA 3MEKA 3NNCA 1FEHA 3MR2A 2DO0A 2BQ3A 2XG8A 5HMZA 3HM9A 3DLGB 3DN9A 4B08A 3B82A 4GMKA 4ITSA 4BC7A 3NBPB 5AE2A 1Z2ZA 2BACA 4OLPA 1UMJA 2UUBF 3AJ1A 2HLTA 1QM9A 1HW9A 3DOKA 5BYSA 2WCXA 4EO6A 3D28A 2VONA 1Y7PA 2M0GB 4CH1A 4JI1F 1PC4A 4RWXA 5B0BA 3HPOA 3TP2A 1ZZFA 2DNMA 4WYWA 3S8SA 2KDOA 5A8RA 1JLQB 2HNZA 4JI7F 4J9RA 3D2WA 2OP5A 4O3PA 4MIWA 7FD1A 2G4BA 2JLEA 1S6OA 2OD6A 1T05B 4YHHF 3OXFA 2HPUA 4K5SA 5K14B 1S77D 2QT7A 1CQMA 4N41A 2YKMB 3GV5B 2FVQA 2VA3A 4DR4F 2HMIB 3TOQA 1D1UA 1QVFR 1J5OA 2LQJA 3IWNC 3SCIE 4NLOA 3SMZA 3T3FA 5D6GA 1ZPVA 3TW0A 4YB6A 2RQ4A 4TKTA 5KFYA 1U4BA 4O3RA 2XMWA 4FVCA 4JV0A 4L6V3 1Q82T 1GXUA 2M70A 2Q79A 5A0YA 4DPOA 1T3OA 3DLLQ 4PXBA 2YX1A 1RKJA 3PIOQ 4C11A 2HHUA 4KSEB 2GO8A 5FIIA 2JDJA 1UP1A 4ELVA 1IKWB 3L3CA 3JSMA 4LSLA 1UA0A 1N52B 4PXCA 1QSLA 1FRMA 2XO7A 2OTLS 3DXBA 4YR0A 2CPZA 5B08A 1R8BA 4R0JA 2KH9A 4IRCA 3TAPA 2B43A 3DOKB 2AD9A 4ZVHA 3M32B 5JUMA 2D74B 1GNKA 1QE1A 1VRUA 2XSJB