2X1GA

Crystal structure of importin13 - mago-y14 complex
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
91
structure length
90
Chain Sequence
b'PGPQRSVEGWILFVTSIHEEAQEDEIQEKFCDYGEIKNIHLNDRRTGFSKGYALVEYETHKQALAAKEALNGAEIMGQTIQVDWCFVKGP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA-BINDING PROTEIN 8A
publication title Nuclear Import Mechanism of the Ejc Component Mago- Y14 Revealed by Structural Studies of Importin 13.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transport protein
total genus 15
structure length 90
sequence length 91
chains with identical sequence C
ec nomenclature
pdb deposition date 2009-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2x1gA00
2DNOA 2U2FA 2X1AA 1A9NB 3R1LA 1JJ2R 3Q2SC 1VQLS 1SXLA 2GO9A 1WI8A 3HHNB 4W90B 3CCRS 1VQ4S 2F3JA 3G96A 5MLCV 1PO6A 2E5GA 3CC7S 2DNYA 2FY1A 4TU7A 1NU4A 2DHXA 1FJ7A 3G8SA 1VC0A 3D2WA 2UP1A 3CC4S 4PR6A 3S6EA 4WIIA 4Y00A 5IQQA 4C7QA 5EN1A 3UWTA 3B4DA 1U6FA 4LIRA 2RUGA 2LEAA 2U1AA 1VQPS 2EK1A 3ZZYA 1SJQA 3CMAS 1WG4A 4OZ1A 1KD1T 2M70A 2CPXA 1UAWA 3MUVP 1AUDA 3VAKA 3VF0B 1VBYA 2HGLA 3BEGB 2YTCA 2MZJA 1M1KT 1UFWA 2PEHA 2LXUA 5DDPC 4QU6A 1OWXA 2CQIA 3H2UB 3G9CA 1OO0B 1U6BA 3MUTP 2XS7A 1FO1A 5D78A 3CCLS 1HD0A 2DNRA 1R8HA 3HI9A 3UD3P 4WFAQ 3MOJB 1VQKS 2YH1A 1VQMS 1U1KA 2MKHA 2M8DB 2SXLA 2CPIA 2M88A 2KN4A 1X4AA 2M52A 5IM0A 2CPYA 5GAEU 1JJHA 2N82B 3MI7X 1FXLA 4FXWA 3P5TL 3CXCR 1FJCA 5DDOC 1FJEB 3B4MA 1X5PA 3CTRA 2MJUA 2AYMA 5JVHQ 3CCUS 4WCEQ 4CH0S 3DXBA 2J0SD 2OJ3A 4PKDB 5IM0B 2JVRA 2CPEA 5FJ4A 4WFBQ 2MZQA 4ERDA 5LXYA 5IFMA 4QU7A 2M8HA 2DNMA 5GAHU 1VQ8S 2DGVA 2DIVA 2DK2A 1R8PA 2HVZA 3RW7A 2K8GA 3U1LA 1YI2S 2MSTA 4CIOA 2MGZB 1K9MT 4LMZA 2NZ4A 3SXLA 1HD1A 3MDFA 1H2TZ 1URNA 4M5DB 1SJRA 2OTLS 1X4FA 2VOOA 1H2VZ 2YKAA 2AD9A 5GVQA 2MQNA 5DDQC 2MKSA 2LYVA 2MQLA 3NMRA 1K8AT 1N54B 3J7ZT 2AYEA 2MQOA 2XNQA 2L08A 2DGUA 2LECA 2DNHA 2DNNA 3S7RA 2I2YA 2KM8C 1U1MA 2CQ3A 1U1NA 3MUMP 1X5OA 2CQ0A 1VBZA 4TLQA 2MZRA 1U1PA 2ZJPQ 3P6YC 2JWNA 3P3DA 3NNAA 1W2BR 5LXRA 2DHAA 2DHGA 2KH9A 4CH1A 1VQ6S 2X1BA 3CCES 2J76E 1XN9A 2MY8A 3RW6A 1HA1A 3FEYB 3MD1A 1VQ9S 2BOPA 3H2VE 3TO8A 3ULHA 3MURP 2XS2A 4BS2A 5LJ5Y 2KRRA 5GAGU 2LA6A 1U1LA 3IRWP 1X4DA 2FPHX 4RU2A 2PE8A 1VQNS 2X1FA 3NNCA 2DHSA 1N88A 2DH7A 2DGWA 3LQVA 2XSFA 1VQOS 2MMYA 5CXTA 2CQCA 2DGXA 3UCGA 3EX7B 2DGSA 2DH8A 1G2EA 1YJWS 1WHYA 1QM9A 2MZTA 2DO0A 1VC5A 4WFNQ 1H6KX 3PIPQ 1BY9A 2DO4A 2YH0A 1RKJA 2DGOA 1WF0A 2KXNB 2RNEA 4IOCQ 1B7FA 4FXVA 2F9DA 3SDEA 3FEXB 2MXYA 1VQ5S 3U1MA 3THTA 5D77A 2M7SA 4C0OC 1Q82T 4C4WA 2CQGA 4Y0FA 2DIUA 2KI2A 2CQ2A 2J8AA 3VALA 2MKIA 1YWXA 3SDEB 2Q79A 1DZ5A 4ED5A 2WBRA 2RRAA 2LA4A 3CF5Q 3VAFA 1OIAA 2MHNA 2CPZA 2M9KA 2BZ2A 2CPFA 2KXHA 2RS8A 2X1GA 4ZKAA 1ZZFA 2MKCA 1UW4A 2GHPA 3L3CA 1SJFA 1M5OC 1M5PC 1JMTA 4Z2XA 3EGNA 2KXFA 2E5HA 3JB9k 2DH9A 1WG5A 2CQPA 2OSRA 2NLWA 1VBXA 2CJKA 4YB1P 3EGZA 2O3DA 2RS2A 2DNQA 2D9PA 3I56S 3MXHP 2RRBA 3Q2TC 2MKKA 2KYXA 3TP2A 1YHQS 3CUNA 1WHXA 2D3OR 5LSLA 2DGQA 2E44A 1SJ4P 1M90T 2N3OA 1U1RA 1YIJS 1N8RT 1F9FA 1K73T 1DBDA 1PGZA 5JVGQ 2MQMA 3CCVS 2DNGA 3CC2S 2KT5A 5HO4A 1NJIT 5DM7Q 2F9JA 2CPJA 1QVGR 1WHWA 5DM6Q 1U2FA 2LKZA 3NS6A 4YUDA 2G4BA 3V4MA 2MPUA 2DB1A 2A3JA 1U1QA 4QPTA 2VODA 2ERRA 4IUFA 4CQ1A 3LPYA 2QA4S 1N52B 2MB0B 3G71S 1X5SA 2E5IA 4A8XA 1S72S 2CQDA 2MYFA 3DLLQ 4IOAQ 2EVZA 1WF1A 1X4EA 4EGLA 1X4HA 3VAIA 4WF9Q 2OSQA 1WG1A 2DNLA 2N3LA 3R1HA 4WKRA 5LJ3Y 2L9WA 2L41A 2FHOB 1P27B 1HL6A 3N9UC 1X5TA 2K3KA 3TYTA 2RU3A 3R27A 1WHVA 2M4MA 1VC6A 1ZH5A 3PIOQ 1YITS 1L3KA 2KHCA 2KG1A 5DETA 5GMKa 2RQCA 3THPA 1IQTA 2HYIB 3I55S 1CVJA 3SMZA 2ZJQQ 2CPDA 2JRSA 1WTBA 2XB2D 4IO9Q 3K0JA 1UP1A 2D9OA 3CPWR 3G8TA 1M5KC 1YTYA 4TU9A 3CCQS 1X0FA 3G4SS 1WWHA 1KC8T 3CD6S 1X4CA 1WEYA 2FC9A 5ITHA 1KQSR 1Q86T 2KU7A 2KFYA 2DITA 1SJ3P 1DHMA 1JJ4A 4YOEA 1Q7YT 4W92B 1WEXA 3UD4P 3ZZZA 3CMES 4P6QA 2M2BA 1Q81T 2B0GA 2KRBA 2RQ4A 2MJNA 3UE2A 5CA5A 2KM8B 4TU8A 4V19X 3CCJS 1ZZNA 1YJ9S 4UY8T 1D9AA 2I38A 2CQ4A 4PRFA 5DDRC 3VAMA 4U67Q 3NNHA 2ADBA 2XS5A 1WEZA 3US5A 2G0CA 1M5VC 2DNPA 2G1DA 2XNRA 2JX2A 2LEBA 3UCUP 2LMIA 1RK8A 3BO2A 5GADU 3BO4A 2HGMA 2LQ5A 5CYJA 3BS9A 2RT3A 1FNXH 1FHTA 1A7GE 4F25A 4LJMA 3OW2R 2OIHA 1H2UX 3IWNC 3VAHA 2HGNA 3NS5A 2YWKA 1YJNS 1P1TA 1S79A 2E5JA 3VAGA 2V94A 2EK6A 2MKJA 2JVOA 2RVJA 2MSSA 2MGZA 1X4BA 1QVFR 4F26A 2QFJA 1OPIA 2DNZA 2ZJRQ 1WF2A 5BJRA 1U1OA 2CQHA 1D8ZA 4OZ0A 2VONA 2LCWA 5H1SV 1VQ7S 4F02A 2J0QD 1WI6A 2MY7A 5LSOA 3UCZP 2FC8A 3MD3A 2CQBA 4J5OA 2MQPA 3J7YU 2KG0A 1FT8A 2DISA 1KOHA 2DGTA 2HZCA 2QEXS 4QQBA 1X4GA 3CULA 2M0GB 2KVIA 3CCSS 2DNKA 2AYBA 3CCMS 3S8SA 3BO3A 2MQQA 2CQ1A 1DRZA 3VAJA 2AYGA 2LXIA 3G6ES 1WELA 4UQTA 3S01A 2OTJS 2VOPA 1NO8A 2MZSA 2CPHA 2N7CA 5HL7Q 1O0PA 1KOOA 3P49B 2MZ1A 2ADCA
chains in the Genus database with same CATH superfamily
4ZVPB 2LU2A 4AL5A 4JYAF 5C24B 3UDEA 3IGNA 1F5AA 3CCTA 1N6QA 3B6BA 1NJWA 1TZ0A 4WIIA 2A1BA 4WZQA 4N5SA 3KUGA 1SJQA 3V6DA 1KFDA 3LP1B 1D1UA 5DQHA 1HFEL 4UZCA 1HI0P 1PKUA 3KK1B 2AEJA 3QFWA 3TJ9A 4X65F 1EP4B 2PEHA 3TRGA 2P5VA 4WXOA 1R8AA 4OHXA 4A8QA 1GX6A 3BQ2A 4ELVA 5L9NA 2O66A 1R8HA 1F5CA 3HVTB 1S7IA 2CPYA 2ZITA 1NKEA 4UUXA 1FJEB 2UXBJ 4O4RA 2HLUA 3AJDA 4J9PA 1TL7B 5J1NA 5A6PA 3MEGA 5GAEI 2PN6A 4KY3A 2XO7A 2C3YA 3RAXA 1N33F 1SQEA 2HW3A 2GJFA 2WW8A 3OJSA 2VFUA 3JTNA 2OTLS 1X4FA 4O0IA 5J2MB 2VQEF 2AD9A 3R6LB 5FLXY 1BWVA 1LEOA 3LF0A 2OPQB 1K8AT 4IH5A 2FIUA 3S7RA 1U1MA 2Q6CA 3QLHB 1PBAA 2MZRA 4H4KA 4DI6A 4IR9A 1JLGB 4YHHF 1WDTA 4X66J 3LUYA 4ED2A 3QJPA 1R0BG 4K4VA 3JQMA 3FGVA 1TVRA 1PYSB 4C8LA 1U1LA 4G1IA 5HP1B 1P8GA 3P4UB 1T9XA 3SV3A 1K0TA 2DH7A 2DGWA 2IC3B 1EAYC 3IBCB 1DURA 1IBCB 4ANCA 5GAGI 2B51A 1N5YB 1LW2A 2QLWA 1S9GA 2B43A 1IM6A 2KXNB 4TN2A 2BA9A 3SDEA 3KG1A 4X2BA 3DOMA 4IQMA 2AMCB 1HPZB 3ZZRA 2ZFHA 4ILLA 3AHPA 5EDWA 5E3RA 2B9YA 4O3SA 3EXYA 2YPYA 2PI5A 1ZM4A 2KXHA 3NBPA 2A2CA 2ZHOA 2CQPA 4UZBA 1F3VA 3C66A 4PYAA 2MKKA 2Y1IA 1YZ6A 3FSYA 3SSQA 3OUYA 1B7YB 1TL1A 2HS0A 5F41A 2HIYA 5T7LB 4C8KA 5B7WA 1JKHA 3ZTOA 3M1VB 1IWGA 2QX0A 3FBBA 3NL0A 1Q4RA 4Q45A 2O1PA 1HBMB 2KYZA 2DR6A 1JXLA 2C2RA 3ICLA 3DLLQ 1CJTB 1BQNA 3SSRA 2OSQA 4XAKA 1RCOB 3L09A 2FY8A 1VFJA 3O6QA 3EGVA 3JQJA 3DHWC 3CNQP 1IKWA 1RCXB 1HBNA 3DRYA 1LWEA 3H42A 4JI0F 2F4VJ 4PWDA 5DG9A 4EEYA 1NRKA 2A6OA 2VASA 4LRCA 2H48B 2R42A 1UWBA 4MKVA 1QSLA 1C1CB 1RTIB 1TQLA 3D1OA 3D1QA 2G2OA 4ZOSA 2HQCA 3UE2A 5KFWA 5K5MA 2XY7A 1NK7A 3RRHA 3HXMA 2BDPA 2VBYA 2IVMA 2BMBA 2YNIB 2LEBA 3MEDB 2JL9A 4B9VA 3KJVB 4IH7A 1UA0A 2X3DA 4MAKA 4I6YA 3PYDA 2OIHA 2HVEA 3GWCA 2HGNA 3NWRA 2YWKA 1P1TA 1S79A 1RTJB 4NMXA 2RB7A 1BMQB 2J7WA 2YVSA 3TAMA 3NRBA 5BJRA 4MKYA 4B3RF 3PKMA 4TKTA 4F02A 5HLFB 1APSA 1NH8A 4P2SA 3BH7B 2QEXS 1T03B 5F8IA 2KVIA 4B3MJ 3W61A 2DNKA 2N4CA 1DRZA 2DR8A 1T95A 2P2CB 2EW9A 5D4NA 4KPYA 4NEZA 1NJZA 3OTDA 2GHWA 1WELA 3GIRA 1G4CA 1RHQB 2IDEA 5HL7Q 3QNWB 5I4MA 3I82A 4PWUA 2WONB 2WSFC 1SIWB 5MLCV 2YY3A 2KTQA 3T9ZA 4URQU 3W3SA 1E6YB 2OPPB 1X9MA 5CYMB 3GFZA 1U26A 2FJWA 2IBOA 4KH1B 3ZZYA 3Q23A 3H98A 4RNMA 4D3HA 3MM8B 3O44A 5D0GA 2JH3A 4IFYA 2C1EB 1K1QA 3VF0B 4DV0J 1PCAA 2HGLA 1H7XA 3OQ2A 3M2UA 3NCRA 3RBEA 4CTAA 4YEAA 2DR9A 1LXNA 1T3NA 3A8JA 4B3SF 4YDXA 2VQFJ 3N4WA 1U8WA 5KFDA 4PYDA 4LF8J 1LWCA 4U8YA 4PG8A 4CNYA 4DFKA 1N5TA 2JVRA 2JLFA 3R3TA 4ERDA 3DU6A 3GYXB 2V2KA 5CCMA 4J9NA 2K8GA 3QT8A 1AYEA 2MGZB 3AH6A 2NZ4A 1HD1A 5KG4A 3W2VA 1RWWB 3DLBA 3TJAA 4J7CA 4Y2AA 2DGUA 2DNHA 3MWBA 3M8WA 4ZIVA 2CQ3A 2B6AA 4TLQA 4F2SA 2XMTA 2QC3A 3B82A 4K5RA 3GCWP 1ZTTA 4DLGA 2QTWA 1XTZA 3KJFB 5ETTA 4DR4J 2JEIA 1FKPA 3TX0A 1C0UB 1N36J 5A2QY 4LF7F 2G13A 2HWIA 1X4DA 2PE8A 3KK2A 5EWEA 4IFVA 4KSEB 4DDFA 7FDRA 2P9GA 2WB1D 3H25A 2MMYA 4P7VA 3EX7B 3HF5A 2QL9B 4WU2A 2UU9J 2RE1A 2HBYB 5G0RA 3NKYA 3PIPQ 3MMBA 5HATA 2DGOA 4DZDA 2YKNB 2I5JB 3HT0A 2VIHA 1VQ5S 2GJ2A 1TKTA 4OHVA 3VQTA 1KS2A 2R8KA 2RRAA 2CPZA 4CYUA 3OLAA 2KDOA 1XK8A 2E7WA 1KR4A 3EGNA 4DL3A 3M8PA 2LDIA 1HYSB 1UJ4A 4ECQA 1U47A 3EGZA 4U7CA 1F2GA 4DPTA 4USWA 5F8JA 4P2FA 3TOQA 1WHXA 4NEYA 2CNNB 2DGQA 2N3OA 2BRLA 4W98A 2UUWA 2J8SA 1KLMB 2MQMA 1RWVB 4R25A 4HACB 2V9WA 2CPJA 3RU0A 2FZGB 2CZ4A 1VK8A 1HNVA 4DV6J 1NB2A 2GMHA 4DQPA 2A3JA 3TANA 2MQ8A 4NL5A 1UVKA 4ZITA 3H59A 2FVQA 2GFFA 3KWMA 4Y2IA 3R1HA 2L9WA 3AOAA 5KG3A 4DSKA 4UW2A 2FVSA 3R27A 2FB0A 3MMAB 4AD6A 3JAMY 1J5OA 3DFEA 1FCAA 1WJ9A 2UVVA 1HNIA 4DUZF 1MU2B 1WTBA 3CPWR 4C8NA 2VPWB 2OEMA 1QDUB 3CT9A 1Z4UA 1X0FA 1WOSA 2DYAA 2CAJA 1X4CA 4Y34A 1KDNA 1BQMB 3SFUA 1Q8IA 4QWBA 1DHMA 2Z57B 5IC4B 4G1QA 1S1WB 4TU8A 3SIPB 4DR3F 2ZBCA 3AODA 3A3NB 3AJ2A 4ED4A 1JLEA 3KG4A 4TYBA 4USKA 4QYRA 4G65A 4LRAA 4TNOA 2OH2A 2P6SA 4CH7A 2V8VA 1LNQA 2NPFA 2LMIA 3GR0A 4H4MB 2PFFB 1RK8A 4K2JA 3BO2A 4FKYA 4FPIA 2UV8A 4GKJF 1QAIA 3VAGA 1NNDA 3ILOA 4DX5A 4X4VA 1WDDA 1Q5YA 4CLSA 1CJVA 3HPOA 2OEKA 2W9BB 3HDSA 4OZ0A 3AB4B 2GHVC 3CWJA 1NPKA 4KKOA 1GQEA 4DR1J 4X84A 5BXIA 2DGTA 1XMOF 4WP3A 2BJDA 2FQQB 2G1HA 4RBVA 2KO1A 1P1LA 3PHTA 4TQRA 4IG3A 3ZTRA 5KFMA 1UVIA 2V4JA 2OGUA 4YB5A 2QLBB 1A9NB 3R7NB 3CSKA 1JJ2R 3DOLB 1Y11A 1HWKA 3CC7S 2DNYA 5AJ3J 2IM0A 1NMEB 2UXCJ 3ET6B 2RD5C 4DN9A 3B78A 4U6PA 3B4DA 1S6QB 4LIRA 3TZZA 2XWYA 2D3ZA 4H4OA 1TL3A 2MLZA 3CMAS 4IQXA 1NAQA 4QWAA 2UVWA 4USMA 1JWWA 4N8OA 5LMUF 4TY8B 1N33J 1S12A 4EK2A 2R4FA 1UAWA 3P45B 3VAKA 4Y3CA 2D3O1 2NXUA 1RE1B 2R2SA 1M1KT 4HL9A 5HAOA 4CDIA 1MW7A 2OELA 3IRXB 2VQEJ 4OJ1A 2XS7A 3PR4A 1FO1A 5D78A 3MOJB 5D15A 4X4SA 2COLA 1QAXA 3N0VA 1JJHA 2OPSA 3PEJA 3OTBA 4Q0BB 3CDAA 5FJ4A 1VRUA 4YHHJ 1TKZA 5HMYA 3WQPA 2DIVA 1R8PA 2Z2YB 3V4IA 3DM2A 2LFVA 2DXFA 1VGYA 3LAMA 4UQGA 3CJ4A 3ZTPA 4HHHA 2L08A 3HFKA 3DLKB 1I3OB 1HW8A 3ILLA 2HQGA 2FZCB 4BLGA 3Q83A 5A8RB 4DV7F 1NK5A 4AXJA 2P9CA 3CEDA 4KPCA 2BVZA 5DLFA 3IRWP 4RU2A 1TR0A 1DTTA 2BE2B 2LLZA 2D1CA 4NXNF 1QD1A 3TA2A 2W7OA 3R2CJ 4K50A 1IBKF 1WF0A 4NYPA 1TKXB 3C15B 3U1MA 3THTA 1B0TA 4C4WA 4LSLB 4Y0FA 1IKXB 4IH6A 1M0SA 1MN9A 2XI3A 3C8YA 2E9ZA 3L3CA 6AT1B 1SL2A 1RT4B 5B0DA 1XIQA 1VBXA 3PRBA 4O0NA 3SCKE 2B56A 2DNGA 4KAIA 2NUHA 4X4TA 1DQ9A 2XBPA 3FBFA 4JI0J 5DM6Q 2RHQB 1S77D 2K7KA 5C2GA 4K5SA 1AZSB 1UPMB 1NSQA 3Q8VA 2Z2ZA 3D5MA 2LEPA 5DZ7A 3MEEA 1GMVA 1RB0A 3QAEA 2WBMA 2A6MA 4USUA 1O8BA 4EO8A 1FEEA 5I3UB 2R7WA 1VLOA 3NOCA 5C24A 4LQ9A 1L3KA 2VZ9A 2CNLB 1IQTA 1KTQA 4DR5F 3ISNC 3AFGA 3H4BA 2HS4A 4ZVFA 2OAUA 4MT1A 3R8YA 1UFKA 3CJSA 3IG1A 1RT6A 3QGGA 1SJ3P 4PXDA 4Z7CA 4FVMA 1SPBP 1VRQC 1MWQA 2YQ0A 5BYQA 4MIAA 2H5EA 4CLFA 3SYZA 1EP4A 2KRBA 5CA5A 5K8MA 2KT3A 4ZVSB 2E29A 1HBUB 2B4UA 2CQ4A 3KTQA 2OI2A 2JEJA 1XJWB 1YZ7A 2R7UA 3HVTA 1T3OA 1CS4A 2B4PA 4C98A 5KFZA 2MDAA 5KFJA 1TL7A 4OZNA 1B0VA 2EC0A 4I4BA 1V5IB 3D28A 2QFJA 1H3DA 4ED3A 2DNZA 2VFSA 2R7RA 1QY7A 2HAIA 5A76A 5J2MA 2R8IA 3Q8YA 4DXLA 3CD7A 1K1SA 3PX4A 5SUHA 1A0OB 4C8ZA 1SV5A 2H5IB 1PIEA 3TUPA 3QLHA 1YDLA 1NKBA 3NGUA 2ZOGA 4TY9A 2HZAA 2IRUA 1JLGA 4I2PB 3M8RA 2CPHA 3NOGA 4F4XA 1RADB 5C25B 2FDNA 3JSMB 2DNOA 2U2FA 1LV5A 1VQLS 4A8MP 1SXLA 3VVUA 2FJXA 3PV8A 1VQ4S 3D6FB 2IC3A 2HVIA 3ELHA 2CZ9A 4B3SJ 2UXDF 3D2WA 2WRMA 2V63A 3PVXA 4ZP9A 3HCXA 4B9TA 1NM2A 2GIQA 2J9DA 1HPZA 5GMEA 2I1RA 5J2NB 3GG0A 1LWXA 3V6KA 1RWPB 4QU6A 3G9CA 4DS4A 3DGPA 3X3UA 3TEHB 2NREA 1T11A 2SXLA 1JXVA 3TA0A 4OX9F 4IR1A 2C42A 4FXWA 3K8VA 4ZJLA 4HH1A 1RTDB 3JTOA 1RAOA 2MZQA 3J81U 2ZH6A 2M8HA 3M1VA 4I1TA 2HVZA 2QLXA 1UVLA 1S6OA 3HD1A 4LF7J 1S97A 1URNA 2DTJA 3GIKA 2YKAA 2JJ4D 3UNGC 5GVQA 1HBMA 1RT1A 4YN3B 5DDQC 4DWIA 4CP5A 1CSJA 2XNQA 1CJTA 1XWLA 1R6VA 3OTEA 1IJEB 5ETOA 2HAFA 4KRWA 3KLVA 4MKAA 9ATCB 1NJYA 2VPYB 1FK9B 1D0EA 4IG0A 3VV2B 5KFCA 4KGKA 1RGVA 3I87A 4KT0C 2ILZA 2GVZA 3KHRA 5HBMB 2XSFA 2LQ9A 2VDIA 5KFVA 2GCFA 1WORA 1NXIA 2DGXA 2MLYA 1G2EA 1C1CA 4ELUA 1JNZB 2CG4A 1RTIA 2B9EA 2PA8D 1S6UA 2AJFE 4F4WA 4DCJB 3TZXA 1UJ6A 2PIIA 3LPEA 3K7RA 3R5DA 3R5AA 5ETLA 3SEOA 4LUBA 4FBTA 2WVFA 1SI9A 2OMLA 1FKAF 4JI8F 3KDNA 4ED5A 3HZGA 4O3QA 3NEKA 1IR1A 4ZKAA 3MEDA 1HI1A 2GHPA 1JMTA 2RF2A 3KJVA 2P6TA 3I56S 4J9UE 5ETMA 2UZAA 3VZHA 1RZMA 1F9FA 5FLXU 4KV8B 3N6MA 1MROB 2YQ3A 3NY0A 5JXSA 1NPRA 4K4SA 5HLFA 3IS9B 4OYIA 3TVYA 4DUZJ 4ETZA 1T03A 2BUNA 1T05B 4F4YA 3LPYA 4DPXA 4N47A 3DYAB 1REVB 2QO3A 1ZAXA 1X4EA 5KTQA 1L5UA 2R8GA 3TI0A 2RU3A 4DX7A 3RR8A 3KLHA 5ETSA 2PC6A 2WONA 2ZBPA 2W2OP 3ZTQA 3THPA 2DEIA 1RT5A 2OPPA 5CYMA 3HZEA 3MMCB 5HROB 4A8WA 4ECUA 3G4SS 4GKJJ 1EKRA 1ZM3A 1WEYA 3MM8A 3PFEA 2BKOA 4PABA 5D0HA 1UEUA 1FFSB 4W92B 3Q86A 2M3DA 2IFXA 2ZH7A 4CM0A 4JI2F 3WZ0A 2M2BA 2NQPA 4X4QA 4OMFG 4DEZA 3LGNA 5KT7A 4ATNA 4OIXA 4DHVA 2K7JA 3VGVA 3N28A 1XR6A 1Y10A 1RAHB 1WC1A 1A7GE 4C3LA 3VZIA 2MGZA 1HLWA 4F26A 2UUCF 4FYVB 1BXNA 1U2RA 3E01B 3D68A 2VONA 2AWZA 1HMVB 2Y1RI 5DRKA 3I96A 3J7YU 2AKWB 4DQSA 4LVOP 2ZKUA 2VC1A 3QIPB 2ZH2A 5LMUJ 3C46A 4L3NA 1QUPA 4XTTA 5DZ6A 4C48A 2N7CA 1RLCL 5KFEA 1C0UA 5IV4A 2RDIA 4OZ5A 3Q2SC 2GO9A 5HI7A 4NLWA 3CCRS 4WFYA 1CC7A 1OY8A 3HFVA 4BC7A 1IWAA 3RUBL 1SUQA 1N6QB 4OZ1A 1OSCA 4CO2A 3AY0A 2YKNA 4TQSA 2I5JA 2XO6A 3M9NB 4FZVA 4G6VB 1WSVA 4DUTA 2RQMA 2WOMB 1GMWA 2E1PA 3QPIA 1EJ7L 2V6AA 4L75A 2GV1A 3H2UB 1BLUA 3EUNA 3RBXA 1J2VA 5KFFA 4EBEA 2ACYA 3PW0A 1HYSA 2V67A 5A6WA 1YK9A 2AT1B 1L3SA 1VJQA 4DL6A 3KNAA 4RUHA 3GIJA 4DPUA 3JXOA 5KT3A 4DV7J 4CLKA 1BGXT 2VF3A 1ZPWX 4DS5A 3RW7A 5C7PA 4ANEA 1S6PA 3TW0A 1UA1A 4M5DB 4UOHA 3H4DA 1NKCA 2MQNA 2WCXA 3J80Y 2F7VA 1H73A 1KP6A 3DRRB 4OZJA 4JI5F 3K17A 4ZK7M 4NLRA 4NXNJ 3OT9A 3N5FA 2JWNA 3NNAA 3POTB 2EFNA 5EUHA 3DGVA 4DX8H 1UWAA 2DHGA 3TEGA 5K20B 2HZVA 5KG0A 3GJTB 4BS2A 5LJ5Y 2KRRA 2LA6A 3NXZA 1FNMA 5I3PA 3F56A 1BQMA 2ZBQA 1RWUA 1MG7A 1SH2A 1N0UA 2YNGB 3Q8PB 3C3LA 4F8RA 2NYIA 2BE9B 3AD9C 1S9GB 4AQYF 4KGVB 5KFLA 2ZH9A 2G2YA 1AFIA 2OFHX 1YRUA 1T7PA 1S9EB 1XMQJ 3SDEB 4ZP6A 3D6MB 4K4YA 2X1GA 2XHWA 4HVZA 4A8KA 3HLUA 4ZPWR 4Z2XA 1BD6A 1F9EB 2JZ5A 4FYDA 3CJKB 2XMMA 2D74B 1SC6A 4NA3A 3WX8A 1XERA 2G0JA 2FJAB 1HR0J 5LSLA 4ZVEA 1VMBA 2BQUA 2W9BA 3MCSA 2YPZA 2VBZA 2A0FB 2W9CB 2JFKA 1RHRB 1JLCB 1JKHB 4F67A 5IS2A 2IHR1 1RHUB 3W60A 3OTOF 1HQEB 4ZVQB 3DOKB 2MB0B 1KHWA 3IBWA 3ENQA 4FYWB 3QRRA 3RYLA 2DBBA 2EVZA 3D1HA 3VAIA 4XO0A 3MR6A 5B0EA 2DNLA 1OYDA 5JMNA 1GXTA 1HL6A 2K1RA 5A2QU 3N9UC 4WK3A 4PQAA 4A47A 3O8WA 4DV1F 2RAQA 2BJ8A 4RNOA 3DOLA 2Q66A 6FDRA 2KHCA 4RW6B 2DR5A 4DFJA 2CWXA 3C6UB 1TAQA 5ETRA 4DV2F 1TUGB 1GAOA 2N4DA 2UUBJ 2OPRA 1LWEB 4KB7A 4D3GA 4PWDB 5KG7A 3MAAB 5DJBA 1J5EF 2N7YA 1DARA 5RUBA 4P6QA 4MKBA 1NZAA 4LT6A 3W7BA 1F1BB 3IRXA 2PEBA 2C22A 2I38A 3KLIB 4I6AA 4KTQA 2DD8S 4M8LA 2I0XA 2XS5A 4ZLPA 1WEZA 4AL7A 1IUJA 2G1DA 4DUYF 1FVSA 4RW9B 3KKFA 5CYJA 4Q0BA 5KOWA 4U95A 2Y8WA 4F25A 4LJMA 4CRJA 4JBCA 2E5JA 2AGOA 1OPZA 5AE2A 2JVOA 1IQZA 2OLWA 2CQHA 1KQGB 1D8ZA 3IA0A 3VTIA 2E66A 5LSOA 5DQGA 2UVUA 2UXDJ 5JJBA 2HBZB 3DLKA 4FS1A 2BANA 4JI3J 1WC5A 1NHKL 4UOFA 4DL0C 1YJTA 4GKKF 2ZH3A 2V50A 1OMSA 4JI6F 3JAMU 2UXBF 4B9NA 2OTJS 1WC4A 5A8WB 3H0PA 2VICA 1KRPA 1NDKA 5KFNA 1TL5A 2HWTA 3GV5B 2F3JA 2BE2A 2EBEA 2ZH1A 4RW7B 3G8SA 1HQUB 1J27A 3BSAA 4CI0B 1X7VA 2XC9A 2O01C 1Y3JA 2BEFA 2AGQA 1CJKB 1TKXA 3C15A 4ZP7A 3IXQA 3I0SB 4LSLA 1IKXA 1UMJA 2YTCA 3UNYA 2CQIA 5IT9Y 4IFYB 1OO0B 4EUVA 5D3GB 4X66F 1N5QA 4ZA1A 3UD3P 1RT4A 2CPIA 2IMWP 3K57A 3GIIA 4JI1F 5HQLA 4ZJQA 2XCAA 1QTMA 5K8NA 4Z37A 5JVHQ 1R8BA 1WSRA 1PC5A 3G82A 5LXYA 1YBTA 1LWCB 1F5BA 1ZM9A 2DNMA 1HBOA 1JLAB 1YQHA 2Q3PA 2ALZA 1RWXB 2IYIA 1AZSA 4U9RA 1M5HA 1HWUA 3OPKA 5LOQA 4LF5F 5EX3A 2C2ZB 4BBYA 1EARA 2HHWA 2QT7A 3PZPA 1DLOB 3RBZA 5B0CA 4N8NA 1W2IA 3TUJC 2HHUA 4K4XA 2H9ZA 3TVKA 2J0WA 2OKQA 1L3VA 1NLKL 2MY8A 1XNQF 3FUYA 2HRYA 2RILA 3RB4A 3MURP 2XS2A 3GLJA 1RWMB 1ZAWA 4LREA 4QIVA 4HTIA 4DSLA 1SH3A 2CNKB 2EG2A 3NNCA 1FKPB 3BJYA 1VQOS 2I6WA 4PG4A 1M1GA 2DH8A 1QM9A 2HMIB 3SCLE 3CJ5A 3M4XA 4EFAC 3MPVA 1B7FA 2RJZA 2QIFA 3IAM9 1FTCA 5G0RB 1H38A 1HBUA 4ZMMA 3HT3A 3W5ZA 4QYZK 3RB6A 2XGPA 2BX6A 2AV5A 3VAFA 4PG6A 2Y9HA 2R8JA 1LWFB 2ZUGA 2MKCA 1TV6B 4DR6F 2PI4A 1OQ3A 4R0JA 2QYCA 2ALYB 3K5MA 4LFBF 5J1EB 2D3OR 1VIXA 2E44A 2YWWA 5HVGA 2CDRB 1S5ZA 3A8IA 2CIMA 5JUMA 1DBDA 5DG7A 1FJGF 3FRYA 5F3TA 2F8HA 5IT4A 1UZHA 4WTOB 1BWEA 4Z7YA 2R2UA 5HVHA 4IUFA 4CQ1A 2J6SA 2MYFA 4ECRA 1X4HA 3MM9B 3KFWX 3PYGA 4RNFA 4I2PA 1RU2A 4LR9A 4P2MA 2XMUA 5LL6d 4NLDA 1U7LA 4JI2J 1X5TA 4C8MA 2W2PP 4TYAA 2QMXA 3PFOA 3BYPA 1FXDA 3KUHA 4FXDA 1N32F 4NZ6A 2CPDA 3PYEA 3BM7A 2B8PA 3TQ1A 3J7AN 2QZ8A 3VVTA 4NOHA 1RBOB 2PDAA 2C3MA 3IM8A 3AXKA 5ETNA 5IZHA 3EWGA 4YR2A 2UUCJ 2R7XA 2KM8B 2A18A 3PW4A 3OHAA 4M94A 1D9AA 1EB0A 4FBUA 3FQKA 1VRTB 3CDUA 1JLEB 1RTDA 2KZMA 1R0AB 4FF3A 3BS9A 2BJ7A 4KO0A 3KUEA 1ZOTA 5B0GA 2RDDA 3D9BA 2XZDB 3Q8UA 2MSSA 1VIOA 2C2NA 2ROGA 4NPOA 2ZJRQ 4DV0F 3FFIB 2JC1A 1LKZA 1RHMB 2M0GB 1JXEA 3DRSA 5F8NA 4R5PB 2UUAF 5B0BA 4JV5F 1Q53A 4J9VA 2HBRB 2LU1A 4EBCA 3PHEA 5KFBA 1B3TA 4HR2A 3U02A 4IG3B 4CLUA 3P49B 3LAKA 4RLEA 5E2QA 3NAIA 5HBMA 1QJHA 2UP1A 2PMZD 2RUGA 3GJQB 3A3PB 1PJ6A 5THWA 4L6V3 2ZUAA 3R2DJ 1QUVA 2GIFA 4AFFA 3V81B 1UFWA 3P96A 1YG0A 3IFEA 3MFHA 5CAAA 1KSPA 5GAEU 4JI5J 5I3QA 2B8QA 4RPFA 4KHMA 1VCTA 4JOUA 4QWEA 2GC8A 4CH0S 1KBRA 2EKYA 4U7UD 2I8EA 5K8OA 4QU7A 3ZNJ1 1VQ8S 2LQJA 1MROA 3M32A 3DLJA 1VRUB 4RW4A 2GNKA 1YJVA 1SJRA 1TKZB 3BN7A 1C2PA 4ZCKA 3N6NA 3PJXA 1T05A 3O1LA 2LYVA 2ASLA 1TELA 2VBWA 3DYAA 1KQFB 3I6PA 1REVA 1U09A 2DNNA 1AROP 1BQXA 3C2PA 3QT7A 1FD2A 1V3RA 8ATCB 1Q0NA 5B0FA 1FA0A 4AQYJ 3SCIE 3BGFA 4OQJA 1GT8A 4P10A 5BYSA 4DPOA 1VQ9S 3TO8A 2KHDA 5GAGU 2GS8A 3T3FA 3MMCA 2EFGA 4F04B 1D8YA 5KFPA 4WFNQ 2VL1A 2C2EA 4MFBB 2IJFA 2W8KA 3MR2A 3AD7C 4LF6F 3A8EA 4FXVA 1N56A 4I2QB 5KG5A 4CLZA 3I32A 4OJ3A 3CO9A 2M7SA 3E51A 1GK8A 1Y4ZB 1S4FA 3FC9A 4J91A 2MHNA 4C97A 4DCPB 2IBKA 1SJFA 3DRXA 3OTOJ 1M5OC 3T1HF 3DDKA 2QA2A 4CLYA 4GVBB 2OSRA 5M2PA 5E7OB 4KC5A 2O3DA 2VH7A 1HIYA 4C0HA 4LFAF 3GU0A 2CADA 3MOZA 2RRBA 4ILMA 2OEJA 2QMUB 2ZDOA 4DV1J 1CLFA 1HHSA 2V4QA 2W01A 3SQOP 7AT1B 4F3MA 1RAGB 4Q8EA 4DV2J 1XNRF 1U45A 4ZN3A 4CCHA 1S10A 3MCMA 1X5SA 1Y00A 1S72S 3QIPA 1NK4A 3T6JA 2F4FA 3I9V9 2EPIA 1FRMA 2QRRA 2ZVSA 1VISA 1HNXF 1NK0A 3P8BB 1ZH5A 1NK6A 4QWCA 4ELTA 2W25A 5DGBA 2VU5A 2XG8A 4DUYJ 4PG7A 2HNDA 5A0YA 1HARA 5DLGA 4DR1F 4FDFA 5AXKA 3H8YA 3FBCA 4EI2A 1XR5A 1ACMB 2KFNA 3OXFA 2HEKA 4P9SA 4RKUC 3GFXA 2LQ8A 1VBKA 2WOMA 3IG1B 5K14B 1Q81T 1RT6B 2VKRA 2MJNA 2YWHA 1S1VB 3W5XA 5L46A 2XYPB 2ZBIA 3FJ2A 4DBQA 1NEEA 1FRIA 3UCUP 3DLHA 1H7WA 5AJ3F 2W7PA 2LQ5A 2UXCF 4GKKJ 1CS4B 4USJC 4FYYB 2V9KA 4JI6J 4MYTA 1R7IA 1PC4A 4HDGA 4K7QA 3HMJG 4B9LA 4ZJOA 2ASDA 1FF2A 1HNWF 4MK9A 8RUCA 4M5DA 3K5PA 2DCLA 2VV5A 4N76A 2KFZA 4RBUA 2ZD1A 2J0QD 4F4ZA 2MEWA 3EE3A 4M5KA 4B9SA 3DRRA 4NLOA 1KVKA 4PCQA 5D8HB 3DNCA 3MECA 2D7SA 1HW9A 3POTA 1SV5B 1OJ4A 3EZ5A 1NK9A 1S0OA 4DG1B 3KMQA 1F6TA 1GX5A 1WI8A 2D3UA 1PO6A 4RUCA 4FP9A 4U7UK 1ELOA 3A13A 1VQYA 2EC2A 3SSSA 4JI1J 4UOGA 1B0PA 1R3NA 2U1AA 1VQPS 3OFHA 2YNGA 2EWHA 4YR3A 1WG4A 1L3UA 3CB4A 2FD2A 4K4WA 3ZTSA 3EVWA 1VJWA 1S9EA 1JNRB 3KJNB 2GAHC 4NLSA 4YB6A 2XQCA 1DY3A 1U6BA 2HWHA 4TLRA 3K5NA 1HD0A 2YKMA 4XK8C 4LF5J 1U1KA 2MKHA 2IJNA 3ISZA 3LWLA 3CJKA 2X51A 3DGPB 4WTYA 4WE1A 1TK8A 2ATLA 3ISND 5L1LA 1UEVA 3HSGA 3IR5B 3PW2A 4BWJA 3IMQJ 2JNJA 4NLGA 4FS2A 2C3PA 3UW1A 1UETA 1X8DA 1U49A 2J9DE 1XNQJ 1K9MT 2W9CA 2E9TA 4QR0A 1JLCA 3TQEA 5F9LA 2XMAA 1HQEA 3NMRA 3DOKA 1WACA 4YS2A 5DO2A 2VG5B 1TK5A 4DX6A 1RP5A 3W8GA 4DFMA 1RT1B 2HG4A 1S1UB 3UN3A 3W66A 3TZWA 2ZJPQ 4I64A 3R7BB 2C2DA 2AJ2A 3T5KA 2DXDA 2OD4A 3VWSA 1PBUA 1JLBB 3RW6A 4KGXB 4OX6A 4ZVOB 4RW6A 3C6UA 3R5BA 1R43A 2QMWA 1VQNS 4IG0B 4DR6J 2X1FA 4CWBA 2Z2MA 4DR7F 1JLQB 2Y0BB 3UCGA 4L3KA 3MAAA 2GVZB 4LFBJ 2GMJA 2GVDA 5G4DA 2PGCA 3EZOA 3R7SB 2EFOA 2RNEA 2F9DA 4JUZA 3GR1A 2MXYA 4ZPTR 4C0OC 1FJGJ 3KLIA 3ZXWA 3C16B 3VALA 1R27B 1DZ5A 1RQ0A 4ALZA 3CF5Q 2XMJA 4Q2LA 1FDDA 4RW9A 2R7OA 4V19J 1WOOA 3B8HA 4MMOA 1RT7A 3PJ9A 3SQGB 2RF2B 1KNZA 3BBBA 4B3TF 4PXCA 3MMJA 3MEKA 4FN5A 2Z0GA 3KMSA 3J80U 2BV3A 4GC7A 3Q89A 1N32J 3W62A 2KT2A 4YUDA 3LGMA 1EKSA 2MPUA 3W9IA 2DB1A 2Y3YA 5F8MA 5J2PA 2O67A 4I6WA 3DMJA 4FF4A 4CT9A 5A8KA 3MM7B 4ED8A 3W63A 3MTJA 4OL8A 1IXKA 4LF4F 2GW8A 3G87A 4JP8A 2JHEA 2J7UA 5A8WA 4JI4F 1RTZA 2Y1LB 5HANA 3CE8A 3TWZA 1WHVA 2M4MA 2ZH5A 5I42A 4MIBA 2Q43A 2FHMA 2F5GA 3LANA 4RW7A 3KLHB 1HQUA 3VR1A 2V34A 1UP1A 1ZPVA 3BPSP 4KQZA 4HH0A 2J6TA 1RT5B 1CJKA 5F3ZA 4DJBA 4DPWA 4F4KA 3I0SA 3TR5A 1W25A 2BM0A 3ZZZA 2E9RX 5HQ8A 5IWAF 4BCAA 5D3GA 3QO9A 4DU7A 3M8YA 3OV7A 2XNRA 3QT6A 4J37A 1H0HB 2H5JB 1QSSA 4NWBA 1V5VA 5EGYA 2UUAJ 3BO4A 2CJXB 3NCPA 3T1AA 4JV5J 4LR8A 3OW2R 5CABA 1H2UX 1MWYA 1NK8A 2W2QP 2R2RA 5GADI 2VFRA 4PPDA 1JLAA 2WVDA 4LF9F 2XZWA 3PY8A 4K4UA 3OLBA 4LVNP 1PSDA 2V0NA 4NXMF 2XWXA 1S57A 4QZVB 2K06A 4MTPA 5KT5A 4C0BA 3NGDA 3QATA 3K5OA 1DLOA 4K4TA 5FIIA 4UQTA 3T41A 2G9OA 1SJ1A 4KHRA 2HBQB 1WTFA 2ACMA 1IKYB 1MMDA 2HHVA 2BACA 2R7TA 2FJEB 3I4PA 4JB8B 1E6VB 2P9EA 3Q0AA 5EN1A 2IRXA 2HMIA 2ASJA 1RAIB 3KYLA 2BR0A 1EX8A 2QN6B 1PAEX 2R3VA 1W26A 1S1TA 3M6VA 2WSCC 1SUQB 4ECYA 1RTHB 3I5CA 4OZ3A 3NLCA 2C2OB 4QWDA 2GQ2A 1S1XA 1LWFA 1TV6A 1F2HA 2VPZB 2VG6A 3RRKA 2HQDA 1EIYB 4OFZA 3Q24A 3OFFA 2GMLA 4DL5A 2VA3A 1VQSA 2ZM6F 5D6GA 3MGJA 1X5PA 5J1EA 4UTGA 3DXBA 2XHCA 2CFXA 2F40A 4F7VA 5GAHU 3KNGA 3ETMA 1NUEA 3U1LA 2MSTA 3SXLA 2DY9A 2POKA 3MDFA 2H4WB 4NLUA 2C2KB 3F41A 3L4BC 3MR3A 2RSQA 1S6PB 3PG9A 2ZWOA 2HKEA 1AT1B 2VHGA 3KLFB 2AYEA 2VPXB 1RJJA 2XLKA 3MM9A 5E3QA 2RQKA 3I4HX 4DF8A 3D3BJ 3PR5B 3NAHA 3HSDA 4LF6J 4J9QA 3W2WB 1CC8A 2KH9A 3MM6A 1QE1B 2X1BA 3BGRB 3CCES 4MJKA 2BOPA 3HHLD 5LSRA 1FX2A 1WKLA 4A8YA 2L9DA 3PJWA 3I5BA 4A46A 5AXNA 3KJQB 4WFXA 2B3TB 3T1HJ 4HTJA 3QBCA 2GX8A 5FDLB 1YJWS 3A3OB 4LFAJ 5KFQA 2XY5A 2GAGC 4O3OA 3MPUB 3A1YG 5ADZA 1ULRA 4L72B 1RXOB 3OVBA 4OHZA 1VK3A 5D77A 1LFWA 2HNZA 3BR9A 1VRTA 2B4OA 5BR8F 1XNRJ 2HQIA 2M9KA 2H3EB 3FMBA 1M5PC 1R0AA 2KXFA 3JB9k 4LR7A 3QMQA 2D41A 1I1GA 2ZBRA 3IBFB 3C6TA 4HEA9 5EWFA 2XEXA 4Q43A 2AW0A 1HNXJ 1U1RA 1V3ZA 2ROPA 1WC3A 2MLXA 3K58A 4XIUA 3FFIA 4WZMA 5M2UA 2HVDA 3RAMA 1TUVA 2YKQA 1FFGB 1WHWA 3HO1A 3K2YA 3WX4A 3ILJA 1Y5LB 3WDOA 3HX9A 4IKAA 1S0MA 4QPTA 5IXUA 1YVFA 2F65A 2WVEA 2AX1A 4R5PA 1LK5A 2PA3A 2ASYA 2FZKB 4EGLA 3HD2A 4GC6A 4CLLA 4N41A 4WKRA 2W9AA 3MM5B 2E7XA 1HKAA 2YBVA 1Q1KA 3L95X 4B3OA 2K1RB 3H5SA 4WK1A 1R89A 8AT1B 1RISA 3JSYA 2YX1A 3SMZA 2CJAA 2FHJD 4IO9Q 4V1Ak 4DSJA 1KN6A 4OYZA 4TU9A 4Y2MA 1CJUB 1FRHA 2OPRB 2QL5B 1Q86T 1FRKA 4KJIA 2AHOB 2Y8YA 3V81A 3UDVA 4KBIA 1QLNA 1HNWJ 2AJQA 4C3KA 4RX6A 2RDJA 1ZZNA 4QIWD 1YJ9S 4RW8B 3H40A 2FJDB 1D3WA 3BH6B 2FLPA 3TARA 2ADBA 4ICLA 1M5VC 2IJRA 2VUGA 1X9WA 3BKTA 4ID8A 4LIWA 4YMEA 2CJ9A 2KB2A 4CO1A 1X4BA 4DF4A 5CD4H 1WF2A 1XR7A 4ILRA 4F3QA 3BYRA 4A8OA 3OD2A 3UCZP 4E98A 2B4VA 2ABYA 4L73A 2JEFA 2MQPA 1RBAA 4LF2A 3HK2A 5L38A 5GAHI 2PO4A 3ONQA 1ZS6A 2CG8A 4URSA 5T41A 2MQQA 2VB6A 3VAJA 2AYGA 4WXWA 1GTHA 1FKOB 4L74A 2BANB 3LW5C 3S1TA 5L1JA 4PG5A 3M8SA 3KXDA 3M9OB 5F8LA 3D6HB 5DQIA 4I56A 2MZ1A 3DXSX 4OI4A 2JC0A 3G96A 1LK7A 4CM2A 3O3LA 3PO5A 3EDQB 2KKHA 1HNZF 4MFBA 4RWWA 4ENOA 5H9FJ 4YP3A 1GH8A 3BQ0A 2ZZNA 4I2QA 2QFIA 3F44A 3OXGA 3HVRA 2IVYA 2ZDPA 3NGKA 2B5JB 3BGLA 2XM3A 3IWXA 3LOUA 4M63A 2IPOB 4OI0A 2DCUB 3OBIA 3J81j 1FWKA 2Q6BA 2GA7A 3CCLS 2DNRA 1KKHA 1VQKS 2YH1A 1VQMS 4GVBA 1K0VA 2M52A 5IM0A 3MFIA 3MZIA 2AGPA 3P5TL 1XQIA 2HRTA 3CCUS 3GB0A 1FDAA 4DV4J 1WOPA 1RAFB 2DGVA 3DI6A 4NLVA 1YJRA 3G82B 4LMZA 1TTHB 3MAQA 2Z4PA 2E1CA 3PYFA 1HBOB 2IM1A 3A12A 2C3OA 1XMQF 2MQLA 1N54B 4K0KJ 4M5NA 2CKWA 4DR7J 5HMXA 1JK9B 1FWPA 3T5JA 2LECA 3FBEA 4RU9A 4RNNA 2VJUA 3ZZOA 5F0UA 3NGRA 4Y2KA 3KHHA 2FGCA 5LXRA 2YWEA 1SL1A 1GFWB 3V2UC 5AE1A 1HR0F 5CCLA 4B9MA 3FDSA 3R5CA 3THVA 2RU9A 4B9UA 1ZA2B 2Z30B 4QJVA 2FPHX 3CIMA 3FNNA 5KFSA 1RDRA 1BC6A 5CXTA 4BC9A 3NG8A 5C2CA 1BY9A 1QAYA 3CDWA 1REGX 4B3TJ 4K2XA 3P5BP 5K14A 4LRDA 1S1VA 1FVQA 4E2FB 2MKIA 2NYHA 3GP9A 1FTRA 5L1IA 2ZZMA 5IV3A 1DJ0A 3IAS9 3N79A 3ZZUA 1NSKL 2CJKA 4YB1P 3O2IA 2UUBF 4ZLNA 4OJGA 4LF4J 4DV3F 3KDOA 4FKXA 2QL7B 1F0XA 4JI4J 2GQQA 4QOTA 3OSNA 4LRFA 2KT5A 2W4PA 5B09A 1I5OB 1HQ2A 4ZVHA 4OI3A 1RABB 2V2QA 4ID5B 4RUBA 3I9ZA 4EWTA 4Q2MA 3PRVA 4WKYA 2DT9A 1XBWA 3HVWA 4M95A 2CJBA 1X60A 2VC0A 3PM9A 1FEHA 2FHOB 3RGIA 2CA9A 5F8GA 4ER8A 4DG1A 4ZHRA 1F60B 5IWAJ 1YITS 5L8RC 2KG1A 2PSZA 2XMVA 1YX2A 1V3SA 5GMKa 1D9DA 1FNOA 3DRPA 3MCNA 3UO0A 2PFDA 2XMKA 2F63A 3M7VA 4U8VA 3W9JA 4KHPJ 3K0JA 2ZKTA 4DU8A 2Y0SD 2D9OA 1YTYA 2YWGA 2QA1A 1KC8T 4JI3F 2HRUA 5FD1A 2CXEA 1P9YA 3RRGA 2FLOA 1RUSA 2V5HG 1NDPA 1G3OA 3G86A 4LF9J 2EFQA 3DC2A 2IM2A 2VA2A 2R9LA 3EMTA 2HFSA 2LXFA 1O5JA 3W9HA 2W2NP 4M5LA 4NXMJ 5KFXA 3ADAC 3GILA 3GMGA 4OYMA 1H74A 2DNPA 3QYYA 2DPIA 3TX8A 3ZC4A 2YNHB 3Q8RB 1TL4A 2E7VA 2CYYA 1FNXH 4OLOA 2GO8A 4ZPDA 3IWNC 1Q8BA 1YJNS 4WU3A 2ZNYA 3JYTB 4KO0B 3G6XA 2VFVA 3PXGa 3EYZA 4PEOA 2OMOA 1WI6A 2MY7A 2DISA 2VG5A 1X4GA 4ECVA 3AA8A 1S1UA 2NSCA 3OHBA 4MH8A 1GXLA 5U47A 4GMKA 3DRSB 4GO5X 4I68A 1JLBA 3GYNA 1M1HA 5KG6A 5E3AA 2X1AA 5L1KA 4F0HA 3LALA 2CRLA 2E5GA 2WW4A 4XDCA 2RKIB 2HLTA 4LSNB 4FF2A 2QV6A 1JLQA 4QIEA 4PR6A 3RJMB 2ZM6J 3G2XA 4OX8A 3WHIA 2LEAA 2EK1A 1WC0A 2Z58B 1URRA 3E3XA 3AOCA 4HT5A 1NDLA 3Q22A 1X0PA 5AE3A 1YJ7A 2MHEA 4YY3F 3KG0A 1TMMA 2O5DA 1IR0A 4DV5F 3MUVP 1R31A 3C16A 4Q44A 1VBYA 2LXUA 1S76D 2H51B 1OWXA 2WK4A 5CYQB 2M8DB 4P72A 1FXLA 3SQGA 3BSNA 1I94F 3PW5A 3CTRA 4GRSA 2J0SD 2OJ3A 2XSJB 5KAKA 1KLNA 4F50A 5IFMA 4JV1A 4CIOA 2AJ4A 4AE5A 4B02A 3SCJE 3T6BA 4IOBA 3QQCD 1LXJA 2KL8A 3M32B 1MMLA 2PT0A 1ZAVA 3MTKA 4RW4B 1N5SA 4EYIB 3QZ8A 3MM7A 1SKRA 2FUG9 5H9EK 1T9TA 5M2RA 1YJUA 3D67A 1I6JA 2VJVA 2M5YA 5IT0A 2QG9B 1AW0A 1W2BR 4UF4A 4NYZA 2E5LF 2J76E 3MD1A 3UR3C 3GJRB 4Q5VA 1O51A 1RKIA 3HHLA 2IMOA 4PQUB 1PYOB 5BR8J 4UY85 2HHSA 1RWNB 4ZCMA 2ZNZA 1VC5A 2BW2A 3FZBA 2ZC3A 2HVHA 1OSDA 1MWZA 1AXQA 1XC9A 1R6YA 2VG7A 2GZOA 3FCWA 2GGPB 4N56A 5D4OA 2HQFA 4LBHA 2YX4A 4LFCF 3CD5A 3HKZD 4DR2F 2ILYA 3M2RA 4G1PA 3D54A 1OY6A 3FVYA 4AT1B 2DHHA 2WVBA 1YKWA 1EQ0A 2NLWA 2ZOMA 3RR7A 2J6UA 3MXHP 2XULA 2AIRB 2DKOB 2QLJB 1CG2A 1NHVA 2W1BA 3UI3A 1QSYA 5DM7Q 5LM7E 4WFZA 3LP0A 2DJWA 2DRDA 2YNFA 1U2FA 2IYGA 1U0HB 1YBAA 1ITPA 2RHSB 3OVAA 4F0MA 1U48A 3HP6A 4QCLA 2IA0A 1WG1A 2N3LA 4XPEA 4RO0A 2B9WA 2NR0A 4OI2A 3TYTA 1BUXA 3ILIA 1VC6A 3MPWA 1IKYA 5F9NA 2XY6A 1LQ9A 3N5BA 1E6VA 2FHJA 3GJSB 4X64F 3W5YA 3SFGA 4RWXA 3WC0A 3TA1A 2HNDB 5A0YB 1IN0A 1SC3B 3H20A 2DEJA 1VHIA 4KR0B 1RTHA 4DCOB 1JJ4A 5AT1B 2Z2LA 4DL7A 2KZZA 4LBIA 2NSBA 1JX4A 3TNVA 3AXMA 3CCJS 2KJVA 1I51B 3BB5A 3VAMA 4U67Q 3NNHA 3OR2B 1RAEB 2FVCA 3HFZB 2HS3A 5KFIA 2HGMA 2CWKA 3EVMA 1GEHA 4GO7X 4YQWA 4RL1A 2MKJA 3CJTA 1U2CA 3H5UA 5KG1A 3IWLA 1OPIA 3JSRA 1RT2B 3K8WA 2XMWA 3GG1A 1VQ7S 4OV1A 3UFCX 2FC8A 1DQAA 2KG0A 3KLFA 4WJBA 1HNZJ 2ZD1B 2HFZA 2NS1B 3S8SA 4ZPBA 5L9XA 2I9SA 3W2WA 1U6ZA 2IAJA 4FNHA 3FZ2A 3BN4A 1QE1A 3SZ2A 3BGRA 3MECB 1ICEB 1Q7LB 1IM4A 1XN9A 2H1YA 1H98A 1PJ5A 3KLEB 1UTAA 4W90B 4DPYA 5KFOA 3HJVA 4ZDNA 4R8UB 1HHQA 3OJUA 1SIZA 2GJIA 3CC4S 3CDEA 5FDLA 2QYGA 1DQ8A 4WPAA 3RB3A 4DSEA 1UJ5A 2CZVC 3JQKA 1U0SA 3M6XA 5HK4A 2V68A 4OHWA 2FVPA 3BEGB 1IVZA 1IBMF 3SI8A 1P9QC 2PMHA 5BYRA 4J9RA 3AD8C 4QW8A 2IY5B 1H72C 4ES3A 4CZCA 3RAQA 3TJ8A 1X4AA 3AB2B 4P73A 5KG2A 3K89A 1UL3A 5F0WA 3B4MA 4TVAB 2YKMB 2MJUA 1EETB 1L3TA 2UV8G 4WE1B 4X62F 1VR6A 2JSXA 1OS5A 1YI2S 2R8HA 3C19A 3EPIA 3A4TA 4JYAJ 2HSEB 1NSAA 3HVAA 1KVJA 3PX6A 4Q7AA 2BKNA 1T02A 5B08A 1Y5NB 1B64A 5KFKA 1Z2ZA 2KM8C 3MM5A 1VBZA 1U1PA 4NZ0A 1EZZB 3CIZA 4MK8A 5ETQA 4NCGA 4ECZA 4X65J 1Q8LA 4ED7A 2IA6A 3H2VE 1C1BA 3ULHA 5CZXA 4OI1A 4IYQA 3CCWA 2NXNA 4PXEA 3CDBA 3EM1A 4DZ6A 1D9FA 1CJUA 2CQCA 3FSIA 3C14A 3UVJB 2BJ1A 2MZTA 3LO3A 5C5JA 4DV3J 5J2QB 1WKJA 2W4CA 2B7CB 3D0GE 2NXCA 3VGTA 3FK4A 2EEYA 1PYTA 3UPFA 1RT3A 1GMWD 2GVDB 2WHOA 4RW8A 1B70B 4A8FA 2CQ2A 4ECSA 1MNEA 4EYHB 2HHPA 2BZ2A 3CJQA 3M05A 2DH9A 3A8KA 2XYGB 2HQ3A 4ZVTB 4I0WA 4PAAA 3HHDA 1RT7B 3ZNUA 3CMQA 3M8ZA 2FGOA 1MSWD 2DRAA 3HHKA 2NPIA 3EPGA 1QVGR 1LW0A 2EKNA 1X31C 4O44B 3QSIA 3H7HB 4AL6A 2AX0A 3KHGA 1NSPA 4DL2A 4DOZA 2L3MA 1FKOA 1N34F 3IM9A 3BDPA 5J2PB 4J9SA 3DMJB 2XI2A 2QA4G 3GSDA 2KVQE 3RZAA 4RBTA 5A8KB 2IM3A 3BPDA 1PG5B 2LQBA 4RR5A 3PIOQ 3HKWA 1C0TB 4P75A 2AZ3A 2BJ3A 1TKDA 2XCPA 3I55S 3DLEB 5I42B 2ZJQQ 2AP6A 1WNEA 2XB2D 1KTVA 3W8PA 3D4JA 4YDDB 4FYXB 1WWHA 4USVA 3GQCA 3KLGB 2V8PA 1KQSR 2RMLA 3KHLA 3H90A 4A8SA 1VS3A 2B5JA 1Q7YT 3CJ2A 4ETXA 1IKVA 3UD4P 2Q1LA 2W24A 4A48A 3MPYA 5EHHA 4F4AA 5AXLA 2RQ4A 2QLFB 4UT4A 4DQRA 4CLWA 2APOA 3IGVA 4ZP8A 3ZZ0A 3M9MB 5KT6A 2AJ0A 3QO9B 4URGA 3AQOA 2FVRA 2BW7A 4ZS6A 1FHTA 1V9OA 4CO0A 4O3RA 4RJVA 1F9HA 4KGMA 1C4CA 2RVJA 3E2EA 3CW2C 4C11B 1S0VA 5H1SV 3BSCA 3LP2B 3MD3A 2NUUG 1KOHA 1KEKA 1G7CB 3ZO7A 3VHQA 2WVCA 4NLYA 2AYBA 3IO1A 2W7AA 4WP8A 3CCMS 3Q8SB 4J9LA 2J0XA 4MYUA 4YY3J 3U7JA 3G6ES 4DV5J 3QWPA 2MZSA 4NLTA 3AA9A 3OR1B 2ADCA 1HWIA 1KONA 3R1LA 3R5JB 2ZH8A 2EXUA 3HHNB 1VC0A 1UVNA 4C7QA 3UWTA 3SV4A 4MIWA 3LP1A 1I94J 4PPZA 3NCQA 3CVKA 4QPXA 1YLXA 4K59A 3KK1A 2DR7A 3EGWB 4IRDA 5C42B 4F0KA 4NLPA 1IBLF 4B3RJ 3AJ1A 4OYOA 2OO4A 4ZCLA 1S1TB 1XEZA 5DDPC 1TUWA 1FX4A 4O4GB 1UW9A 3RTVA 2IRYA 2FHKA 4NE9C 2W2MP 1S1XB 5F8HA 2N82B 2VG6B 5HQMA 2RUSA 2V69A 4PKDB 3H5YA 2E5LJ 2ZWPA 2AQ4A 4CO3A 3G6VA 4O23A 3ITHB 1T0TV 1Q16B 2OPQA 2K3IA 5L39A 3TAQA 2VOOA 1H2VZ 4ID5A 5E33A 4NA2A 1RLDA 3N6LA 2MKSA 4IDKB 2JOQA 4J9KA 2AEFA 4LRBA 2I2YA 3OL7A 1U1NA 3W1YC 3I0RB 1YRTA 2IDLA 4W4MA 3QIDA 1MMNA 4NLXA 4YFUA 4NMLA 2E1RA 1RWOB 3HSJA 2HNYB 2PMWA 5HP1A 1C4AA 4LFCJ 4DR2J 1TFWA 3MM6B 3W65A 4QW9A 1N5YA 1N88A 3M8QB 3LQVA 2G0IA 2EFVA 2L48A 4USTA 1SKUB 1H6KX 3ETOA 4FPRA 2V2ZA 4OLPA 1Y5IB 4IO1A 1FE4A 4KH0B 3BSOA 2WTFA 3WBZA 1RHKB 3IR6B 1T8EA 2VFTA 1OIAA 1CULB 4H4KC 1PAUB 2L9NA 3AAWB 3ZZPA 3M2VB 1FRLA 2AEMA 4ZN1A 2HNZB 2YNHA 1WG5A 4OX7A 2HURA 3OSPA 1TAUA 3TUIC 2DNQA 5T7LA 3CUNA 3JYTA 4X4NA 4U96A 1YIJS 1NPPA 4PXBA 2ZE2B 1PGZA 3C6TB 3EXCX 1Y7PA 1FI4A 1K47A 2CJQA 2FLNA 3R9LA 3BKFA 4KFBB 1S4EA 4BWMA 3MCOA 1U1QA 4X64J 3SBMA 3M6UA 2QA4S 1N52B 4ANDA 3G71S 2CQDA 4PUOB 4OV6A 2AF6A 3PKYA 4WYWA 3GZ7A 2CVIA 2L41A 1P27B 1NBEB 2A2DA 2JLEA 2K3KA 4A4JA 2UVRA 4LSZB 1ZTWA 2RRNA 2R7QA 2F8MA 4AUKA 2H65B 2RKIA 4LSNA 4JV2A 4KGZB 4B3OB 3DCAA 3BF4A 2V8HA 1M5KC 1PILA 1TMJA 1UVJA 2Z56B 4S0MA 5IQ6A 2FLLA 2KFYA 2FTRA 2HFOA 3V6JA 4QBUA 1FE0A 3NP5A 1T9VA 3M30B 2YNIA 3FQLA 3NGSA 5CYQA 1RAAB 1W7WA 1ZBTA 2JX2A 4HKQA 4R0EA 3QGHA 1FFWB 1UVMA 2BOAA 3R6GB 1RTJA 4ICLB 2RT3A 2XSJA 3EJMA 1N48A 3GSIA 5KFAA 3OFGA 5DS7A 4HHUA 1YRXA 1OQ6A 4F2RA 1RYSA 1TK0A 4PZVA 2C3UA 3X1LB 2XLJA 4P7TA 4E0DA 3GFHA 2OFGX 3GTYX 2UUTA 3D3CJ 1FT8A 1JLFB 3FMWA 3FCHA 1GNKA 4NLQA 3QRQA 1SH0A 3WIVA 3KK3B 2R7VA 3QAUA 2OP5A 3EDRB 6FD1A 2BJEA 4PWWA 4DR3J 4OYWA 1NO8A 4XPCA 1IBMJ 2VD3A 4PQUA 1FD8A 3B54A 4C9DA 4WBFA 1E6YA 1G6BA 4TU7A 1NU4A 1FJ7A 2HFUA 4YB7A 3BREA 4ZVRB 1U6FA 2ZH4A 4NI2B 1OY9A 2BXJA 5DGAA 3H2LA 3UQSA 1CBKA 1P6TA 4ZPCA 4X62J 2CPXA 2GGPA 1N5VA 3DLGB 4ZCIA 1AUDA 4M5JA 4FVCA 1WD6A 1XMOJ 3QT5A 2CUYA 4JV0A 4RNHA 3QSYB 2KN4A 5KFGA 4ZPAA 3BZQA 4I7FB 3L7UA 3OVSA 5DDOC 3QGIA 1SCJB 4LBPA 4H54A 1T9UA 5IM0B 3HHLC 2CPEA 4OZLA 3T9NA 1Q5VA 4NRTA 5CD4A 2DK2A 3GCXP 3T1YF 4ECXA 1U0HA 3GV8B 2NXJA 3DDIA 3OL8A 3DI6B 3IC1A 1TP7A 4NRUA 1JIHA 3J7ZT 2OD6A 1X5OA 3MR7A 4EBDA 1TU0B 2BQRA 3BBCA 1EQMA 4ED1A 3T5LA 4CH1A 5K8PA 2C2MB 1DTQB 2H4YB 1VOMA 3M6WA 2DVIA 5SZTA 3OFEA 2DHSA 5H9EJ 3UD5A 3FCVA 4J90A 3IP0A 4HLBA 2IVFB 1Y9OA 1SB6A 3CJ0A 3V6DB 3JSBA 1G1XA 2EI5A 3PTWA 2XLIA 2CNOB 3FEXB 5KFRA 1KWMA 2CQGA 2KI2A 3QJLA 1NDCA 3OXLA 2Q79A 4ZIWA 2WBRA 3OR2A 2LA4A 1WUUA 5KT2A 2F1FA 2RS8A 1UW4A 2R7SA 2EBGA 4DMZA 1U02A 1N34J 3CJRA 4JI7F 1NB7A 1BHNA 4QR2A 5D0RA 4IRCA 1KLMA 3Q2TC 3TP2A 1YHQS 1M90T 4K4ZA 4HACA 3MEGB 1N8RT 1RT2A 1U25A 4KYZA 5HVFA 3CC2S 4BHQA 5HO4A 2F9JA 3NS6A 3GV7B 4ZVGA 3V4MA 4FF1A 1Q78A 3BGOP 2JFDA 2E5IA 4A8XA 3WIUA 3R97A 5IOLA 1IBKJ 2A10A 5KT4A 2C28A 3I31A 3U27A 2EG1A 2CDQA 3MMAA 4FNIA 2DPJA 4HT7A 3HHEA 3KLEA 1UCNA 4P2XA 1MU2A 5DETA 4DLEA 3FRZA 2RQCA 3U1NA 1TVRB 4R8UA 4ZHRB 3UN2A 3DDNA 2JRSA 4DL4A 3HJFA 4OYBA 5LMNF 4DQIA 4LF1A 4OI6A 5KFHA 3DRPB 3G8TA 3CCQS 2BABA 2B9XA 3CD6S 2V8GA 1LW2B 5ITHA 3HSZA 1S1WA 2DITA 4YOEA 1UZDA 4F36A 3J7A1 5D4PA 4EZ9A 3CMES 3N01A 1RWKB 3DOMB 1SC4B 4C8OA 1Q79A 4H4MA 4USHA 2G0CA 5DG8A 1S48A 3NBPB 1EETA 1T94A 5IC6B 5GADU 3AOBA 1SVDA 2AU0A 3CJ8A 1S7HA 4Y2CA 1NH7A 4Q8FA 1S99A 3BR8A 3VAHA 4UUWA 3OUYB 1TL1B 1QVFR 4M5MA 4CO4A 1U1OA 4DR5J 3BV8A 1O6XA 3LTOA 3WC2A 2HZCA 4M5IA 4I67A 1A6LA 2QSWA 3CCSS 1S9FA 5EWGA 4XDDA 1LFPA 3J7YI 4HDHA 2EFPA 1BQNB 2VKZG 4ECWA 1IBLJ 2FJBB 3LH2S 5K9FA 2QE5A 2HK2A 1WKKA 4DV4F 1B99A 2DXEA 1JJCB 2HHHF 1IKWB 3ET6A 3VGUA 4MK7A 1FRJA 2WAQD 1S6QA 1HBNB 2HFNA 2FY1A 2DHXA 3UN5A 3UVJA 3S6EA 5IQQA 5E0OA 5J2QA 4TY8A 2KJWA 4K0KF 3QFHA 1UWBB 2WZ1A 3RB0A 2ROEA 1KD1T 1RHJB 5MAOA 3MAHA 4AXIA 2E1AA 2IIHA 3NMAA 1FERA 4IRKA 2MZJA 2QSFA 2HHQA 2HPUA 4ZVUB 1CPZA 4Y6IA 1HI8A 3BBFA 3E8OA 4USIA 3GPAA 2M88A 3F0NA 3MI7X 1B4SA 3CXCR 1TFYA 1UPPA 1RYRA 1NZ8A 3ENWA 2H54B 4WFBQ 1V6HA 4WIQA 3PACA 3HULA 1RBLA 3CGIA 1UKUA 5AXMA 2VBXA 3TAMB 2HHTA 4TXSA 3TUZC 4O44A 3BKUA 1PJ7A 2JLGA 5ETKA 3QWUA 2V2VA 2J5AA 5A8RA 3W64A 3NS7B 2BQ3A 3DN9A 2CQ0A 5E3CA 3QGPA 3P6YC 3AQPA 3P3DA 2J9EA 1FESA 5KFYA 2XYHB 3V5RA 2DRBA 2MKYA 2X7IA 3RG6A 3QJJA 4HI1A 1NHUA 1VQ6S 2HIQA 5CHCB 4NA1A 1HA1A 3FEYB 1C0TA 4AYBD 3DLEA 4OX9J 3HHLB 2F8EX 2DGSA 3BDEA 4CT8A 4ZLLA 3FKBA 1WHYA 1IR2A 3KLGA 5D4LA 2JEGA 4ITSA 1Y3KA 2DO4A 9RUBA 3ENVA 1RKJA 1WC6A 1RSCA 1GTEA 4IOCQ 2AZ1A 2B7BB 1AFJA 4X4UA 1Q82T 3CO0P 2BKPA 2J8AA 3D6TB 1SKSA 3M2UB 2VG7B 1HHTP 4CTAB 3ENAA 5KOXA 3IR7B 2CPFA 3G6YA 1EHWA 4OYAA 1NCLA 3M2RB 1VI7A 5HSPA 3NWGA 2LVWA 4KHPF 3O5TB 2RS2A 2VDHA 2ZEJA 2BYCA 5D0EA 2KYXA 4J9OA 2BRKA 2YXLA 1RI7A 3D66A 3JS9A 4WYLA 4C11A 5JVGQ 4X4RA 1SQGA 1SBRA 4CLPA 4E8UA 3OL9A 3MPDA 4B08A 4G3IA 3LP2A 4DSFA 4ES2A 4WP9A 2G4BA 3W2VB 4RUAA 3LP0B 2W8LA 2VODA 4M5GA 2HFVA 2ERRA 5CQGA 2YNFB 3D0IE 4QIGA 1RU1A 5HMZA 4IOAQ 1WF1A 4WF9Q 4NASA 3MR5A 4OYPA 3OL6A 5I3UA 5LJ3Y 2B6AB 2DY1A 1U4BA 3OR1A 4JI8J 1FDBA 1ZYQA 4EU0A 5E41A 2HYIB 1U8SA 2CVEA 3KK2B 1UFLA 1T9YA 3PEHA 3EZUA 3JTPA 4L76A 4IFVB 2PD1A 2Z8QA 4N7TA 2WB4A 5C42A 3R5GA 2ZZTA 1T9WA 4KIAA 3MMBB 1R8CA 4ED6A 4QIFA 1OYEA 2BM1A 4DFPA 1TKTB 4O4GA 1RAJA 4EMDA 5HJYA 4UY8T 4OYXA 4X4PA 4PRFA 1FWLA 3V6HA 5DDRC 4CNZA 4GVLA 3VQSA 2F4VF 4DN0A 1N0VC 3US5A 4CYUB 1CEZA 3LWMA 1ROFA 3DHXA 3M8PB 2HHXA 3L7PA 1FDNA 3NS5A 3H5XA 2EK6A 3ITHA 5KFTA 1BE4A 1VDHA 1S0NA 3CD0A 1Q8KA 3FEZA 2MTLA 4O3NA 2ZHBA 2CQBA 4J5OA 4IDKA 1ZETA 3ZZTA 1HNVB 3CULA 4HYKA 3LGHA 3BO3A 3I0RA 2CQ1A 5J1PA 1FXRA 2RH3A 1K44A 5C25A 2XTJP 3JSMA 3PCOB 3S01A 2VOPA 4Y28C 5KFUA 2HNYA 1O0PA 2IAJB 1KOOA 1J5OB 3M8QA 1QAJA 2NXEA 4Y00A 4NX9A 1HNIB 2YKOA 1MLAA 2NZCA 3BGUA 4B3MF 3FSXA 3UDCA 1KHVA 3L7OA 5J2NA 4C6AA 4K8RA 2M70A 1JQGA 3VCDA 3TZYA 3T1YJ 5IT9U 3AT1B 2FYXA 5ETPA 1AB8A 5HMWA 1CULA 4G1QB 4ES1A 3M2VA 3MUTP 2ZC4A 3HI9A 4WFAQ 1JB0C 1LOUA 2WSEC 4HHJA 4ZPVR 4P71A 1VLYA 1FJCA 4HI2A 2AYMA 4WCEQ 1ZA1B 2QGFB 2YX7A 2ZE2A 4QR1A 1SKWA 1AA1B 2X3GA 2AJ1A 1M5SA 2J9CA 1MN7A 4QYZJ 2ZVIA 2D69A 1CJVB 1GMUA 4NZ7A 4KFBA 1H2TZ 3NGTA 4BDPA 4KKOB 1KQKA 2XZTB 5B0AA 2MQOA 3EVOA 4PUOA 1SL0A 2VQFF 3UR0A 3MUMP 1Y0HA 4P74A 1XMBA 4LF8F 5H9FK 2ZOFA 1FK9A 1D09B 5LT5A 1CQNA 5HJXA 1IJFB 2DHAA 1R0CB 4CLTA 3TAPA 4Y65A 2V4JB 4NYOA 1U24A 4NCGB 4LQ3A 2BJ9A 3Q8QB 3PDNA 1S59A 5ETVA 2BE7D 2QJ3A 2W4DA 1C1BB 5CZVA 4ECTA 3T5HA 4KE5A 3I5AA 4JI7J 2CJYB 2DO0A 4I69A 3PW7A 2ZHAA 4H4OB 1TL3B 2YH0A 3EICA 3C14B 4C3MA 3K5LA 5EX0A 4C2MA 3DKDA 3M30A 1VHFA 1KFSA 2DIUA 4DR4F 1RT3B 1YWXA 3CJ3A 4OZ2A 1N36F 4X4OA 1S49A 4UOCA 3F73A 1ZZFA 3GONA 5GMDA 2E5HA 3PRDA 2UU9F 1HWLA 2OPSB 2D9PA 3QRPA 3J7Z5 4CO5A 2G2ZA 2GQCA 4KV8A 4WWSA 3ZFVA 2YKPA 1SJ4P 1YSJA 1SC1B 3MHYA 2K2PA 3QZ7A 1K73T 3CCVS 3IS9A 1Z1ZA 2OUGA 1NJIT 1SQFA 4ZLJA 3V4IB 1JLFA 2LKZA 2RIJA 3DM2B 3GE9A 7FD1A 5LMNJ 1YBUA 3KK3A 1LW0B 1F3FA 1GXUA 2NCKL 4ED0A 3LA0A 5E3PA 1DAXA 4P52A 2GIRA 3DU5A 3D7SB 1AUSL 4DSIA 2HK3A 4DQQA 3L9ZA 1DFDA 3OTCA 2LP4A 5HROA 1RA6A 2V4RA 4DV6F 1CVJA 4EO6A 5HN0A 3BQ1A 1DTTB 4NI2A 3CCZA 2OHDA 3G8QA 5CH7B 2FC9A 1VYAA 1CQMA 2KU7A 2BBEA 3DLGA 3RBDA 4M1KA 1WEXA 4NCBA 1FRXA 2YWFA 2B0GA 2E1MC 3GIMA 1RA7A 4V19X 3PNIA 3MF5A 4C8YA 1Z2LA 1IKVB 1N4LA 3VGSA 2V8DA 3HM9A 2LDYA 4I7FA 1HWJA 4YR0A 4RZRA 3PO4A 4OHYA 1NJXA 3K59A 4NCAA 2V94A 5E5NA 3E01A 1HMVA 2HHHJ 4M5HA 4B17A 3J81Y 2LCWA 2YQ1A 4J9MA 2R2TA 2J7KA 1Q95G 4QQBA 2Y1JA 3D0HE 3GFYA 3IN5A 1J5EJ 3KOAA 2ATCB 3TVZA 2LXIA 1QTNB 2XGQA 1YGYA 3MEEB 4N77A 1UEKA 4OJHA 2FJVA 1ZM2A 3T19A 2JDJA 4EZ6A 3UDLA 1RACB 1DTQA 5T14A 3PX0A 4O3PA 3GYGA 4F3OA 1X9SA 2P8IA 1KVIA
chains in the Genus database with same CATH topology
1HWIA 1KONA 2LU2A 4OZ5A 3R1LA 2ZH8A 3Q2SC 2GO9A 5HI7A 1IKYB 1MMDA 4NLWA 4AL5A 3HHNB 5C24B 3CCRS 4JYAF 2BACA 2HHVA 2R7TA 2FJEB 4WFYA 1CC7A 1F5AA 3I4PA 3IGNA 3CCTA 1E6VB 1VC0A 2P9EA 1N6QA 3Q0AA 1UVNA 1NJWA 1TZ0A 4WIIA 4C7QA 4BC7A 5EN1A 2A1BA 3UWTA 3SV4A 4WZQA 4N5SA 4MIWA 3LP1A 4PPZA 2IRXA 2HMIA 3NCQA 3CVKA 2ASJA 1SJQA 4QPXA 3V6DA 1SUQA 3KYLA 1N6QB 4K59A 4OZ1A 1OSCA 3KK1A 2BR0A 2DR7A 1KFDA 3EGWB 3LP1B 4CO2A 4IRDA 3AY0A 2YKNA 4TQSA 2I5JA 1D1UA 5C42B 5DQHA 3M9NB 1HFEL 1S1TA 4FZVA 4G6VB 3M6VA 2WSCC 1SUQB 4NLPA 1IBLF 1HI0P 4ECYA 1RTHB 3AJ1A 2RQMA 3I5CA 2OO4A 3KK1B 2WOMB 3NLCA 4QWDA 4ZCLA 3QPIA 4X65F 1EP4B 1S1TB 2PEHA 3TRGA 2P5VA 4WXOA 1XEZA 2GQ2A 5DDPC 1S1XA 1R8AA 2GV1A 3H2UB 4OHXA 1BLUA 1LWFA 4O4GB 4A8QA 1GX6A 3EUNA 3BQ2A 3RTVA 4ELVA 1TV6A 2VPZB 5L9NA 2O66A 2VG6A 1R8HA 1J2VA 3RRKA 2IRYA 2FHKA 5KFFA 1F5CA 4EBEA 3HVTB 1S1XB 2ACYA 3PW0A 4OFZA 3Q24A 1HYSA 3OFFA 5F8HA 2GMLA 4DL5A 2CPYA 2VA3A 5A6WA 1VQSA 2ZITA 2N82B 1NKEA 2DVIA 2ZM6F 1L3SA 5D6GA 4UUXA 4DL6A 3MGJA 2VG6B 3KNAA 4RUHA 1FJEB 3GIJA 1X5PA 5J1EA 4O4RA 2HLUA 3DXBA 4PKDB 2CFXA 4J9PA 5J1NA 5A6PA 3MEGA 2F40A 5GAEI 2PN6A 2XO7A 5KT3A 3H5YA 2C3YA 3RAXA 2AQ4A 1N33F 1SQEA 4CO3A 2HW3A 1BGXT 3KNGA 5GAHU 3G6VA 4O23A 1ZPWX 3U1LA 4DS5A 3RW7A 2WW8A 3ITHB 2MSTA 1S6PA 1Q16B 2OPQA 3SXLA 3OJSA 3TW0A 2K3IA 2POKA 3MDFA 2VFUA 1UA1A 4NLUA 3JTNA 3F41A 5L39A 4M5DB 2OTLS 1X4FA 3TAQA 4O0IA 2VOOA 3MR3A 1H2VZ 4ID5A 5J2MB 3H4DA 5E33A 2VQEF 2AD9A 1NKCA 4NA2A 2RSQA 5FLXY 3N6LA 3LF0A 1S6PB 2MQNA 2OPQB 2MKSA 2WCXA 3J80Y 1K8AT 4IH5A 2F7VA 4IDKB 2JOQA 3KLFB 2AYEA 2VPXB 1RJJA 4J9KA 2FIUA 3DRRB 3S7RA 2I2YA 2XLKA 4OZJA 3MM9A 3OL7A 4JI5F 1U1MA 5E3QA 2Q6CA 4ZK7M 1U1NA 4NLRA 2RQKA 3I4HX 4DF8A 3QLHB 2MZRA 3I0RB 3PR5B 1YRTA 3N5FA 3QIDA 4H4KA 3NAHA 2JWNA 3NNAA 1MMNA 4NLXA 4J9QA 3POTB 2EFNA 3W2WB 5EUHA 1CC8A 4YFUA 4NMLA 4IR9A 4DX8H 2DHGA 2KH9A 1JLGB 3MM6A 4YHHF 1QE1B 2X1BA 2E1RA 3BGRB 3CCES 4MJKA 2HNYB 5HP1A 2BOPA 4ED2A 3LUYA 5KG0A 1C4AA 3QJPA 4K4VA 3FGVA 1TVRA 4BS2A 1TFWA 3HHLD 5LJ5Y 4C8LA 3MM6B 2KRRA 2LA6A 1U1LA 4QW9A 5LSRA 4G1IA 5HP1B 1P8GA 3SV3A 4A8YA 2L9DA 3PJWA 3I5BA 4A46A 5AXNA 1N5YA 1K0TA 1FNMA 1N88A 2DH7A 2B3TB 2DGWA 3LQVA 2IC3B 3M8QB 4WFXA 5I3PA 1DURA 3F56A 2EFVA 4HTJA 2L48A 5GAGI 2GX8A 5FDLB 2B51A 1YJWS 1BQMA 1N5YB 1LW2A 2QLWA 5KFQA 1S9GA 1RWUA 1H6KX 2B43A 3ETOA 2XY5A 4FPRA 4O3OA 1SH2A 1Y5IB 1N0UA 2YNGB 4OLPA 4IO1A 3Q8PB 3A1YG 3C3LA 5ADZA 4F8RA 1FE4A 2NYIA 4TN2A 2KXNB 2BA9A 3SDEA 3KG1A 1S9GB 4AQYF 1ULRA 4X2BA 4L72B 3DOMA 5KFLA 4IQMA 2ZH9A 4OHZA 3OVBA 1HPZB 1VK3A 5D77A 3BSOA 3ZZRA 1LFWA 1AFIA 2WTFA 3WBZA 2OFHX 1YRUA 1T7PA 1S9EB 2ZFHA 2HNZA 3BR9A 3IR6B 4ZP6A 3AHPA 3SDEB 5E3RA 5EDWA 4ILLA 2B9YA 1T8EA 4O3SA 3EXYA 2VFTA 1OIAA 1VRTA 4K4YA 4H4KC 2PI5A 1ZM4A 2B4OA 2L9NA 5BR8F 2HQIA 2M9KA 3AAWB 3ZZPA 2KXHA 1FRLA 2X1GA 2XHWA 3FMBA 3M2VB 4HVZA 4A8KA 1M5PC 3NBPA 2HNZB 2YNHA 3HLUA 4ZPWR 4Z2XA 2A2CA 1R0AA 2KXFA 3JB9k 1BD6A 1WG5A 2ZHOA 2CQPA 4OX7A 2JZ5A 4FYDA 3OSPA 3CJKB 3C66A 3QMQA 2XMMA 3TUIC 1TAUA 2DNQA 2D74B 5T7LA 2D41A 1SC6A 1I1GA 4NA3A 1XERA 2MKKA 3C6TA 4HEA9 2Y1IA 3CUNA 5EWFA 2FJAB 2XEXA 3JYTA 3FSYA 4Q43A 5LSLA 2AW0A 3SSQA 4ZVEA 1VMBA 3OUYA 1U1RA 4X4NA 1V3ZA 2ROPA 1TL1A 1YIJS 2HS0A 5F41A 4PXBA 2ZE2B 5T7LB 4C8KA 2BQUA 2W9BA 1PGZA 3C6TB 3EXCX 1Y7PA 5B7WA 3K58A 1JKHA 4XIUA 2CJQA 3M1VB 3MCSA 2FLNA 3FFIA 4WZMA 2VBZA 5M2UA 3RAMA 1TUVA 2YKQA 2JFKA 1WHWA 2W9CB 3HO1A 3K2YA 4KFBB 3WX4A 1JLCB 1Y5LB 1JKHB 3WDOA 3NL0A 4BWMA 1Q4RA 3HX9A 4F67A 4Q45A 4IKAA 1U1QA 1S0MA 4QPTA 5IXUA 2O1PA 2IHR1 1HBMB 1YVFA 5IS2A 3M6UA 3OTOF 2AX1A 2KYZA 1HQEB 4R5PA 1N52B 3DOKB 2QA4S 2MB0B 1KHWA 3G71S 1LK5A 3IBWA 3ENQA 1JXLA 2CQDA 2PA3A 2C2RA 2ASYA 3RYLA 4PUOB 3ICLA 2DBBA 3DLLQ 2EVZA 3D1HA 4EGLA 3VAIA 4XO0A 1BQNA 4GC6A 2AF6A 3SSRA 2OSQA 3PKYA 3MR6A 5B0EA 2DNLA 4WYWA 3GZ7A 4N41A 2CVIA 4WKRA 2W9AA 3MM5B 2L41A 4XAKA 1P27B 3L09A 2A2DA 1GXTA 1HL6A 2E7XA 2K1RA 3N9UC 1VFJA 4WK3A 4PQAA 2JLEA 3O6QA 4A47A 1Q1KA 2K3KA 3L95X 3O8WA 4A4JA 4DV1F 3DHWC 2UVRA 1IKWA 4B3OA 4RNOA 3DOLA 2Q66A 6FDRA 1ZTWA 2K1RB 2KHCA 1HBNA 3H5SA 4RW6B 2DR5A 3DRYA 1LWEA 1R89A 2RRNA 4WK1A 2R7QA 4DFJA 2F8MA 3C6UB 4AUKA 2RKIA 4LSNA 4JI0F 1RISA 3JSYA 4JV2A 4PWDA 5DG9A 2YX1A 1TAQA 4EEYA 4DV2F 3SMZA 4B3OB 3DCAA 2CJAA 3BF4A 2N4DA 1GAOA 2FHJD 2V8HA 1NRKA 4IO9Q 2OPRA 2VASA 1LWEB 4DSJA 1KN6A 1M5KC 4KB7A 4D3GA 1UWBA 4TU9A 4PWDB 1PILA 4Y2MA 1UVJA 1FRHA 5KG7A 5IQ6A 1QSLA 2FLLA 5DJBA 2OPRB 1C1CB 1J5EF 1Q86T 1FRKA 4KJIA 1RTIB 2KFYA 1TQLA 2FTRA 2N7YA 3D1OA 2HFOA 1DARA 3V81A 3V6JA 4KBIA 1QLNA 3D1QA 4QBUA 2AJQA 4C3KA 4P6QA 1FE0A 4ZOSA 4RX6A 4MKBA 1NZAA 4LT6A 3UE2A 3NP5A 3W7BA 5K5MA 5KFWA 2XY7A 3M30B 1NK7A 3IRXA 2RDJA 4QIWD 1ZZNA 1YJ9S 2YNIA <