2X1GA

Crystal structure of importin13 - mago-y14 complex
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
91
structure length
90
Chain Sequence
PGPQRSVEGWILFVTSIHEEAQEDEIQEKFCDYGEIKNIHLNDRRTGFSKGYALVEYETHKQALAAKEALNGAEIMGQTIQVDWCFVKGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords RNA-BINDING PROTEIN 8A
publication title Nuclear Import Mechanism of the Ejc Component Mago- Y14 Revealed by Structural Studies of Importin 13.
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 15
structure length 90
sequence length 91
chains with identical sequence C
ec nomenclature
pdb deposition date 2009-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2x1gA00
3FEXB 2ZJPQ 2PE8A 1ZZNA 3VAJA 4IOCQ 2LEAA 5D77A 2JX2A 1DZ5A 2XSFA 1YI2S 1OPIA 2KRBA 1KC8T 1JJ4A 2CPDA 1U1PA 2KT5A 2OSRA 1YIJS 1ZZFA 5DDPC 3RW6A 4P6QA 2NLWA 5DDRC 1VQ5S 2MQQA 2RVJA 1UP1A 2DGWA 5CYJA 4A8XA 2J8AA 1YTYA 2QEXS 5GAHU 2VONA 2FC9A 2HGLA 3CCES 1M5KC 3UCGA 2YH0A 3V4MA 2CQCA 2J0SD 2CQ3A 4WKRA 1JMTA 3THPA 2N3LA 3CMAS 2MQLA 5DM6Q 2ZJQQ 2K3KA 2F3JA 1OIAA 4YUDA 2BOPA 1WHXA 1X5OA 3J7YU 1SJ4P 3NS6A 2OIHA 2DNYA 1X4GA 2N7CA 1X5SA 2VOPA 5FJ4A 2MKKA 2KVIA 1WHYA 1WI8A 4OZ1A 3I55S 2JVRA 2M2BA 3ZZZA 3H2UB 2FC8A 2MKCA 3NNHA 2LECA 5LJ5Y 3CPWR 4EGLA 3MUVP 3CMES 2CQPA 2DK2A 1YWXA 3R1HA 1VQLS 2RQCA 3CC4S 3OW2R 3U1LA 4CIOA 2U2FA 2V94A 3PIOQ 1VC6A 3CTRA 1S79A 2M8HA 3S6EA 3PIPQ 3B4MA 1X4FA 2MKHA 1PGZA 2EVZA 2G0CA 1SXLA 2X1GA 2CQ4A 3P5TL 4F25A 3MURP 1DHMA 2DH9A 2VODA 2MY7A 2XNQA 2L9WA 2D9PA 2DGTA 2UP1A 1M90T 2KXNB 2ZJRQ 2I2YA 1L3KA 3SDEB 1P1TA 2E5JA 1X4HA 1X4EA 2DHXA 1U1NA 2DGSA 3MI7X 4ED5A 5H1SV 2DGXA 1WF0A 2KM8C 1FJCA 3VAMA 2JWNA 2NZ4A 2MYFA 1VC5A 1A7GE 3SMZA 2CQBA 2KXHA 1YJ9S 2E5HA 1HD1A 3UD3P 1KD1T 4W90B 1R8PA 2LA4A 2DNNA 4C0OC 4WFNQ 1VQ4S 3Q2SC 2BZ2A 5GAGU 1X4BA 2U1AA 5CXTA 2X1AA 1X4AA 3IWNC 1VQ7S 2AYMA 3SDEA 1QM9A 3ZZYA 2CQ0A 4WFBQ 3TYTA 4RU2A 4QPTA 2L41A 4C4WA 3D2WA 2CPIA 2M7SA 1S72S 2MGZB 2KRRA 2DO0A 4QU7A 1SJFA 4UQTA 4WCEQ 2XS7A 2MJUA 2M88A 3MDFA 2M9KA 1CVJA 4PRFA 2D3OR 1D8ZA 3LPYA 3DXBA 1RKJA 1PO6A 2AD9A 1QVFR 1WEZA 4ERDA 5JVHQ 1FJ7A 3VAIA 1VQNS 4WF9Q 2LXIA 5IQQA 3IRWP 3I56S 2E5GA 1H2UX 3VALA 1H2TZ 2DISA 3HHNB 2RRAA 3CF5Q 2DNLA 2K8GA 3MUMP 1SJRA 1K9MT 4PR6A 2MGZA 3CC2S 2DNZA 1WHWA 1FHTA 2OTLS 1OWXA 1M5OC 2X1FA 1VBYA 1M1KT 2XB2D 4CQ1A 4WFAQ 1DRZA 1WEXA 2DH8A 2LKZA 2MSTA 1UAWA 2CPXA 2XS2A 3G71S 2MB0B 2DGOA 4BS2A 1NJIT 2I38A 5HO4A 2DNQA 3NNAA 1RK8A 3G8SA 2EK6A 1FXLA 2HGMA 2J0QD 3UD4P 2MZTA 2MHNA 1VQPS 2MY8A 2M70A 2O3DA 1UFWA 2DNGA 3U1MA 1BY9A 1SJQA 3UWTA 5IFMA 3H2VE 2DGUA 3CC7S 5DDQC 3JB9k 2F9DA 2YH1A 4CH0S 2ERRA 1NO8A 2CPJA 2KU7A 2YTCA 2CPZA 2YKAA 2KM8B 3CCMS 1WG1A 1X0FA 1WEYA 2L08A 1VQKS 1B7FA 4Z2XA 1F9FA 1U1MA 3MOJB 3VAHA 1U6FA 3TO8A 2M52A 3CCJS 2OTJS 2KG1A 2RNEA 3ULHA 2DGQA 4TU9A 1U1KA 1KOHA 5LXYA 1X5PA 3LQVA 2LA6A 2X1BA 2LCWA 5DM7Q 4IUFA 4W92B 3R1LA 3TP2A 1VQ9S 3VAFA 2RS2A 1R8HA 5HL7Q 1U6BA 2MSSA 2DNOA 3UCZP 3P3DA 5CA5A 1N52B 1JJHA 2DIUA 2AYBA 3FEYB 4J5OA 2N3OA 1URNA 2RU3A 2A3JA 1WG4A 2MXYA 2LXUA 3L3CA 2RQ4A 3Q2TC 4TU8A 1Q7YT 2DNHA 1VQOS 1W2BR 2MZRA 5EN1A 1FO1A 1IQTA 2DNPA 2MKIA 1HL6A 2KI2A 4F02A 3BO4A 3S8SA 3G4SS 1JJ2R 2MZQA 2LMIA 3B4DA 3R27A 2CJKA 2XS5A 2CQDA 2DHSA 3CCVS 4WIIA 4LJMA 4UY8T 1KOOA 2DNKA 1WF1A 2KFYA 1VBXA 2OJ3A 2EK1A 2OSQA 4TLQA 3MD1A 5GAEU 2HVZA 1U1RA 2HZCA 2GO9A 3EGNA 3MXHP 3CUNA 3US5A 2RUGA 5MLCV 1QVGR 2MKSA 2RRBA 2M0GB 3NS5A 1WTBA 2LEBA 3MD3A 5BJRA 4IO9Q 2JVOA 1OO0B 1U2FA 2Q79A 2MJNA 4Y0FA 1WHVA 2KXFA 1YHQS 3CCSS 2KYXA 3S01A 2MZ1A 1U1OA 5LJ3Y 3NMRA 2JRSA 5LSOA 2DH7A 4FXWA 3J7ZT 1NU4A 4C7QA 2AYEA 2AYGA 2LYVA 1WG5A 1XN9A 3G8TA 3EGZA 2DO4A 2CQ1A 1HA1A 1FNXH 2MKJA 4F26A 3CCLS 1X4DA 2QFJA 3CCRS 5ITHA 2RS8A 1VQ8S 1K73T 2DB1A 2HYIB 5IM0B 1M5VC 3G96A 3EX7B 2E5IA 2DNRA 1U1LA 2G4BA 2DIVA 3VAKA 1K8AT 1YITS 1Q86T 2J76E 2MZSA 3BO3A 2MQMA 4QQBA 1AUDA 1UW4A 1WWHA 4V19X 2PEHA 4YOEA 2FY1A 4OZ0A 4PKDB 5DDOC 3VAGA 1X4CA 1VC0A 2M4MA 2YWKA 3RW7A 1O0PA 2CQGA 2MZJA 2MMYA 2DHAA 2SXLA 5LXRA 1FJEB 2MPUA 3K0JA 3SXLA 1HD0A 2CPYA 2CPFA 4QU6A 2DHGA 5DETA 2FHOB 3UE2A 3THTA 2M8DB 1G2EA 3CCQS 3G9CA 1DBDA 3NNCA 1X5TA 1N8RT 2CPHA 1WELA 2FPHX 3BS9A 2D9OA 2CQHA 1WF2A 5D78A 2KN4A 4ZKAA 2ADBA 1KQSR 5IM0A 3N9UC 2CPEA 4LIRA 4FXVA 4M5DB 2XNRA 4Y00A 1M5PC 2DNMA 3CULA 2QA4S 3CD6S 3G6ES 4LMZA 2DITA 3UCUP 4IOAQ 1U1QA 4TU7A 1H6KX 1Q81T 4U67Q 2WBRA 3MUTP 2MQPA 1A9NB 3VF0B 2CQIA 2N82B 1P27B 2DGVA 2VOOA 5GMKa 5GVQA 1ZH5A 2MQNA 2HGNA 3P49B 2CQ2A 2F9JA 1YJNS 5GADU 3P6YC 2MQOA 3DLLQ 5LSLA 3HI9A 4YB1P 4CH1A 2KH9A 1Q82T 2G1DA 3CCUS 1VQ6S 2ADCA 3BO2A 5JVGQ 2RT3A 2LQ5A 1H2VZ 3BEGB 2KG0A 1VBZA 1N54B 1D9AA 1WI6A 3CXCR 1SJ3P 1FT8A 1N88A 3S7RA 1VQMS 1YJWS 2B0GA 2E44A 2KHCA 2GHPA
chains in the Genus database with same CATH superfamily
2GAGC 3MWBA 3VAJA 1LFPA 2GS8A 3OL7A 2HHHF 3R7NB 2XSFA 1Q4RA 2DTJA 4U7CA 2XMJA 2R9LA 2XYGB 4DDFA 3JTPA 3BBBA 3MR6A 5CYJA 3ZTQA 4J9NA 2XGPA 2P9EA 2J0SD 2CQ3A 3IM8A 1JMTA 3L7PA 4WE1A 2ALYB 2VICA 5KFTA 3TOQA 1RWXB 1WHXA 1KONA 1W26A 1U7LA 1Q53A 3LGHA 2LQJA 3H98A 3IS9A 3MGJA 3BGOP 3GIMA 5CYQB 1N36J 1VFJA 2R7RA 1OY8A 1CS4B 2DRDA 4C11B 4IDKA 2I1RA 1U0HB 3PY8A 2ZJRQ 1X4HA 3MM7B 3TAQA 4J7CA 5E3PA 4UQGA 1C1BB 3OR1B 3KUEA 1WDTA 2KXHA 1HI8A 1GK8A 3SQGB 1YRXA 1R8PA 1Y5NB 2BZ2A 5HSPA 2NXUA 4M5LA 2BE2B 1K1QA 1IBMJ 2EFOA 1AW0A 1S1TB 4OV6A 2C2ZB 4J9PA 3N28A 3BREA 2ZD1A 3IR5B 2EC2A 2FJDB 2ATCB 4I1TA 3ZTOA 2VJVA 2UUAJ 1Z1ZA 2XS7A 2LVWA 3K8VA 2RILA 3MFHA 1RKJA 1OSCA 1WEZA 2KKHA 4C8MA 3EXYA 3JSMB 3GYGA 4B3OA 2OTLS 4KPCA 1KLMA 2R2UA 1U0SA 1NAQA 2B6AA 3ILIA 3W2VA 4HT7A 2QC3A 4ANCA 1NBEB 4M5IA 1TMMA 2QMUB 3IR6B 5DGBA 1T3OA 1YGYA 3LPEA 3UR3C 4BWMA 2MZTA 3M8QB 3MZIA 3DOMB 1LEOA 2M70A 2O01C 4A48A 1BMQB 3HKWA 2DGUA 2L9DA 3FJ2A 4QYZJ 2P9GA 1BQMA 1U2RA 2IM1A 1B7FA 1U1MA 5CABA 4RW7B 1AB8A 1U1KA 1KWMA 4K50A 2GCFA 3QJLA 1S1WA 4NI2B 1R8HA 4X62F 3UCZP 3OXGA 5J2QA 2QTWA 3QQCD 1J5OB 2YNIA 2ZNYA 3KDOA 3L3CA 2RQ4A 2XMWA 1NPKA 4QJVA 3KUGA 4ILLA 1WKKA 2ZDOA 4LREA 1QTNB 3B4DA 1KOOA 1VBXA 3RBXA 3GFZA 3C6TA 5KFKA 4B3TF 2EC0A 4ZDNA 2AJ4A 1FRXA 3EGNA 2QRRA 4WE1B 3MPVA 4O4RA 4A47A 1MMDA 4DV7J 3CEDA 1KTQA 3ZFVA 2WOMA 2XCAA 5GAEI 3JXOA 5DLGA 1YHQS 4U96A 3GLJA 2Y3YA 3IS9B 2DH7A 2X7IA 1TL4A 4XDCA 5D0GA 4C7QA 2AYEA 1TAQA 3TZZA 1RTZA 3C8YA 4OX6A 4GVLA 1NH8A 1Q78A 4IDKB 1OPZA 2EW9A 2QX0A 5IM0B 1M5VC 2GIRA 2F1FA 5IT9U 3CIZA 2HK2A 1H73A 3HHEA 3F41A 3J7YI 2YWKA 3DRXA 4L6V3 4ED2A 1QE1B 1RT3A 3TX8A 2OEKA 2PI5A 2JFDA 4C0HA 4W4MA 4PXEA 3FEZA 3HMJG 1FFSB 1V5IB 4DV4J 1RKIA 2KYZA 2JLGA 4LUBA 2GVDA 2ZD1B 1KS2A 4JV1A 1Q95G 2WBRA 2CG4A 4F4XA 6AT1B 2CQ2A 1AZSA 4A8QA 3H2LA 3GPAA 4ZVSB 3MEEB 1VBZA 1QUVA 1HBMB 2H4WB 4F36A 5GAGI 5KT6A 4B3OB 2VPZB 5D77A 1TK0A 1KLMB 3HHLD 4LR8A 2B6AB 3W2VB 2APOA 3QFHA 3GQCA 4C3KA 4MKAA 4CO4A 4O3RA 1M5KC 2ZH9A 3CMAS 3Q22A 5DM6Q 4KV8A 1UWBB 2FJEB 2RDDA 2R2TA 1SUQA 1BQMB 3M8WA 1WHYA 4OYMA 5CZVA 4RNFA 3KDNA 1D9FA 4FN5A 3A4TA 4O3NA 2VQEF 2JH3A 3OFFA 1IKXB 2W9BA 3MR5A 2R7OA 3FQLA 1TK8A 1WJ9A 3GU0A 1RA7A 4OIXA 1F2GA 1L3KA 2YNIB 5DZ6A 1NDPA 2XMUA 2RJZA 2A6MA 2NPFA 5JMNA 1FE4A 2KM8C 4OZ5A 2MYFA 3M2VA 5GMEA 2UVRA 3OJUA 1E6YA 1MU2A 1KHWA 1Y00A 2IFXA 2MHEA 4ECWA 3KOAA 4EMDA 4J9KA 1JLCA 4RW4A 4ER8A 4NXNJ 3C6TB 5CAAA 1UPMB 3G82A 4LVNP 5DG9A 4USUA 3JSRA 1HI0P 3Q86A 3EXCX 3PG9A 1UVMA 1UVIA 5HQLA 2XMAA 5DG8A 1T7PA 1NCLA 2UXBJ 2KRRA 1GT8A 5J1EA 3Q8VA 3TVZA 2D3OR 3KTQA 2X3DA 2RE1A 2ZBCA 1T0TV 5C7PA 1TL5A 2FVRA 4ERDA 5DS7A 1FD8A 3VVUA 5E7OB 3HM9A 1ZOTA 1H2TZ 4F67A 4CO3A 4OX8A 2HVDA 3J80U 1HQ2A 1JNZB 4LFCJ 2KJVA 5FLXU 3PX4A 4Q44A 1RT3B 3IGVA 3TAMA 1X8DA 4LF6F 4AQYF 5HO4A 5B7WA 4IG0A 4DG1B 2J0QD 4QIFA 1S10A 3JAMY 2C1EB 3U1MA 5K20B 1U8WA 2QLWA 3SBMA 2GVDB 4KT0C 4DQQA 3M1VB 4QWAA 4ANDA 3DU5A 3PRVA 2V5HG 1BWEA 1SV5A 3K57A 1NXIA 1AZSB 4JV5J 2BR0A 2DY1A 2LCWA 5HK4A 4W92B 1QLNA 1UL3A 3R1LA 1RWWB 5HL7Q 1HNVA 3GJRB 4N8OA 1JB0C 3Q8QB 4OYZA 4ES1A 4FYVB 3LH2S 2VG7A 2HNDA 3IBCB 1HL6A 4L3KA 4DL0C 5CCLA 3MMCA 3KLGA 5HJYA 3B82A 1RWPB 4WIIA 1FNOA 1WF1A 1FRKA 5GADI 2HZCA 4U7UD 4KV8B 5AT1B 4DF8A 3NGDA 2IJNA 5ETKA 1SUQB 3R5JB 1XNQJ 3BSAA 2DT9A 3S1TA 1FNMA 1QJHA 2CWXA 4WP9A 3DN9A 2Z2YB 2NSCA 3D3BJ 2CAJA 5LJ3Y 4X4QA 4FXWA 5L46A 4DX6A 1J5EF 4LQ3A 1SVDA 3HPOA 3R9LA 4DUYJ 4UTGA 4C8OA 5L1JA 3HFVA 3TX0A 5HAOA 4HEA9 2W2NP 2BA9A 1E6VA 4X4SA 2NYIA 2ZKTA 4QQBA 4YOEA 2FVQA 3JSBA 5LXRA 1FJEB 3M2VB 1MU2B 2DHGA 1JLCB 3DKDA 1XNRJ 4LRCA 3T3FA 2WZ1A 3RB4A 2UXCF 1BE4A 4I0WA 2FVPA 4M5DB 3D3CJ 1YJRA 2F4FA 1NK0A 2Z8QA 2OPQB 5J1EB 2OFHX 3MM8B 2XZDB 3P49B 1LQ9A 3SFUA 3ZZPA 4DLEA 5LSLA 4YB1P 2Q66A 4ED0A 1H2VZ 4ZPCA 3MECA 1EIYB 1YJWS 2F65A 4WFYA 3GV7B 2YQ1A 3LGMA 2JDJA 3VTIA 4ELUA 1AFIA 3DHXA 2J9CA 2YX1A 1NK7A 2DCUB 4YFUA 3HD1A 2CDQA 4BLGA 5DQHA 4KRWA 4QZVB 1UP1A 4YQWA 1UFKA 4IG0B 5HVFA 3THPA 1GMWD 2P8IA 3HKZD 1QAJA 4CLFA 1X5OA 2VC0A 1FEHA 2QLFB 4DN0A 4OZ3A 4FKXA 4JYAJ 1DFDA 2MDAA 1LFWA 1S77D 2BQRA 4K5RA 4UOCA 3KG0A 3LP2B 1VQLS 2H65B 3D6MB 3W63A 3CCZA 3ZZOA 2W25A 5L39A 3HCXA 4IG3A 2PA8D 4E98A 3J7A1 5I42A 3N6LA 1HNVB 5KFBA 2BE9B 3DM2A 5THWA 4P10A 1RT7A 2ZVIA 4DR7F 2HQIA 3SDEB 2POKA 4R8UA 3MI7X 3A3PB 4PEOA 1U02A 3KLGB 1VC5A 3QGPA 5F9NA 1VK3A 2V6AA 3PRBA 4UOFA 3UD3P 5IT4A 2LA4A 2DNNA 2W4DA 1XMBA 1WTFA 4JI1J 5E3RA 2YPZA 1XBWA 3Q89A 2F8EX 1PC4A 4LF5F 4WFBQ 5KG6A 2DRBA 4DV5J 2HWIA 2IYIA 2A10A 2ZH8A 1IKYA 4QU7A 1RI7A 1NJWA 2MJUA 3LAKA 3DMJA 4F0HA 2XTJP 1RAGB 1S4EA 4WF9Q 4X2BA 3W66A 4EK2A 1TZ0A 3TUPA 3OHBA 2MGZA 1F3FA 2IA0A 3CC2S 3J7AN 5KFSA 1E6VB 1SL0A 3HVTA 4BS2A 3UDLA 3P96A 2HQGA 3NLCA 5HI7A 1XR5A 2C2OB 2HMIB 3WZ0A 3BYPA 4OHWA 2W7PA 2YH1A 3AXKA 1H7WA 2YPYA 2BVZA 2W4PA 2FGCA 4YY3F 5LMUF 1TR0A 3CCMS 1F9FA 2G1HA 4I2PA 4ZVEA 4HI2A 4RW8A 3RR8A 4RKUC 4JI2J 1BD6A 3ISND 4F4ZA 1X5PA 2LA6A 5DGAA 4LSZB 5E3QA 2Z0GA 2HHUA 1VRQC 2QV6A 1LKZA 2ACYA 3MECB 4J5OA 3HJVA 4NA1A 1VHFA 3CJSA 4I67A 4P2XA 4TU8A 3PRDA 1YVFA 4NLPA 2OD4A 1U6ZA 2BM0A 3IGNA 1N4LA 4I7FA 2PFDA 4PZVA 2XULA 1S6OA 2RQMA 4KYZA 2W2PP 5A8WB 4ZPVR 1CJTA 1RHJB 2HBRB 2HRUA 1HWIA 4JI6F 3Q8RB 4TQSA 3W61A 1SC4B 3W1YC 2CUYA 3DOLA 1SH0A 4BBYA 2V63A 4X84A 3G6XA 4IG3B 3G8QA 4CRJA 1MWYA 3CDAA 3DOKA 5KT2A 5I42B 3CCRS 5EWEA 2EBGA 3DM2B 2DVIA 3JQJA 5GAHI 1UKUA 3HO1A 4R8UB 4NEYA 2PEHA 4LT6A 1RBLA 2HHHJ 1R0CB 3PACA 2E1RA 2C2KB 1RAHB 4O3QA 4KH0B 4BDPA 1NHKL 1L3VA 4USHA 2CPEA 1VJWA 4I64A 2ZWPA 4EU0A 4CCHA 4C2MA 1Q79A 4FXVA 2CA9A 4A4JA 1N34F 3OUYA 3T5HA 4CLYA 2QLJB 1IKYB 1T9UA 1YRTA 4FP9A 2GGPB 4DV2F 2R8HA 4RW9A 5HMZA 2BRKA 3DMJB 2ZVSA 3IC1A 3M6XA 5KFDA 4N76A 4FF3A 1N54B 5AXNA 1FERA 3RB0A 4ZK7M 1N0VC 2EXUA 1ZZNA 5KFFA 4AUKA 5KT3A 1VIOA 2O66A 1ZZFA 4UOHA 5A2QU 2MKYA 2OPSA 1NJYA 1ZAWA 1XMOF 4FYDA 2GW8A 2QEXS 3D7SB 3DRYA 4YUDA 4KR0B 2CNOB 2IIHA 2G13A 1TKTA 5KFPA 2GQCA 3O8WA 3H2UB 1SIWB 2IDLA 4KO0A 4RW8B 1UFLA 3VHQA 7AT1B 4ECYA 1YJVA 3IP0A 2AZ3A 3K5MA 3SYZA 1PGZA 1SXLA 5CQGA 4U6PA 2ZBQA 1DHMA 4I2QB 4W98A 3VR1A 3QRPA 4C0BA 4RZRA 1P1TA 5F41A 2BV3A 4PWDA 4WPAA 4FYXB 3KK2B 1S7HA 1S0OA 1HD1A 3QZ8A 3BV8A 1YSJA 1S49A 4I7FB 1GEHA 1RTIA 2OI2A 3T1HF 1NRKA 4RUBA 1XQIA 1VQ7S 3DU6A 4AL7A 1NSPA 2CQ0A 1RGVA 3GG0A 4KHMA 3WHIA 1BLUA 2HQFA 2FLPA 4WYWA 4AE5A 4OI4A 2M88A 1Y9OA 4AYBD 3DLEB 3QLHA 1EARA 1PO6A 2QMXA 1EETA 3Q8UA 4NWBA 1TFYA 1KSPA 3I56S 3EE3A 3HHNB 2HHWA 1SJRA 4X62J 4RLEA 1NK5A 3SSQA 3PW2A 4OLOA 4HHHA 1WEXA 2VJUA 3OSPA 3PJXA 1F1BB 4Q2MA 2IC3A 4Q43A 2C2NA 3TWZA 2O3DA 4B3TJ 1RAOA 3UWTA 4PYAA 3CVKA 5U47A 1VGYA 3OUYB 4S0MA 3ZO7A 2GO8A 2OPPA 4LF9F 5J1PA 4DWIA 2FJVA 2OTJS 1NK4A 2F5GA 2QT7A 1AXQA 1KOHA 1S1XA 1DQAA 2ILZA 4IUFA 4RBVA 2PT0A 4DSJA 3I5AA 5CH7B 2YWGA 3BQ1A 4MK9A 2A3JA 4Q8FA 3M8RA 3RBZA 4C8KA 3LALA 2CJAA 3ILOA 5I3PA 3DI6A 2QZ8A 3K5NA 4NMLA 3K2YA 3AQPA 2OPSB 3DGPA 3LP0A 3PO5A 1XC9A 3MM9A 4F3QA 4J91A 4TLQA 4OZLA 3HT3A 3FZBA 2VASA 4WFZA 3I9V9 5J2PA 3M2UA 4HYKA 2H9ZA 3PM9A 4L73A 1TKTB 3EGVA 2VKZG 4IRKA 3PW7A 2B9XA 5CCMA 4DUTA 3T5JA 4KO0B 3RRKA 2E5LF 2QL9B 1WG5A 1FTCA 4LQ9A 3RRGA 1SIZA 3SSRA 5ETMA 3G8TA 3CD0A 3CCLS 3H20A 3PHEA 5ETQA 3D1OA 2O5DA 4EWTA 3OVBA 3MCNA 3W9HA 2GJFA 2VF3A 3KNAA 4L75A 2XSJB 3BKUA 4PWDB 1FXRA 1NKEA 2FHOB 3THTA 1G2EA 3G9CA 3BS9A 4TVAB 1UA0A 1Q1KA 3N9UC 3DGVA 4K4SA 1P1LA 5D0RA 1OJ4A 2VIHA 2VUGA 3DLGB 4NX9A 4DR6J 1H6KX 5HROB 2A18A 3E3XA 2CQIA 4IKAA 1Q16B 1QSYA 2HGNA 1JIHA 4BCAA 4ED8A 4U8VA 4OYIA 2ADCA 2WONA 2VQEJ 1UETA 4DV1F 1PC5A 3TW0A 4DR2J 3PYFA 4C97A 5DRKA 1YIJS 3I6PA 2C3MA 2EKNA 2JHEA 2IM2A 3KLIA 3C19A 3L9ZA 4Y3CA 1NUEA 5A8KA 2J8AA 4HL9A 5ETPA 2QLBB 2IC3B 1YDLA 1IM4A 1OQ6A 4YB6A 5KFHA 3LP1A 2LDIA 2N3LA 3PX0A 3AOBA 1MROA 4U95A 4YP3A 1GTHA 1HLWA 2OPPB 1S9GA 2RQCA 5F0UA 3OW2R 2V94A 1MSWD 1GX5A 1F3VA 1S1XB 2VD3A 3T1YF 3PIPQ 3B4MA 4MT1A 1ZBTA 4CDIA 3MR2A 4YHHJ 2F40A 4TQRA 4DL6A 1TQLA 3HVAA 1X4EA 4TYBA 2AQ4A 3DRSA 2D3O1 1K47A 2HW3A 3DI6B 3BBCA 4NA3A 5F3TA 5F8IA 3DGPB 4DL4A 4FF1A 3LP0B 5KFVA 3MM9B 2R7XA 2GFFA 4LF6J 4AQYJ 5T7LA 1VQ4S 1Z2LA 2YKMA 2DCLA 5E3AA 2HQ3A 2K1RA 3M2UB 3D0HE 1N56A 3EPIA 2CPIA 1JNRB 3FGVA 3TA2A 1J2VA 5K14A 3IMQJ 3H4DA 5DLFA 4N47A 1T3NA 3EYZA 2J7WA 1Q0NA 3BN4A 3FVYA 5LSRA 4DX5A 4B3MJ 2E5GA 2Z57B 2DY9A 1MN7A 3QAUA 3RBDA 2RRAA 3I31A 3JSYA 1CJUA 4ZLJA 5IS2A 2G0JA 1OY9A 3EICA 4USKA 1R0AA 1NZAA 3WDOA 2XB2D 3HHLC 4H4KA 2DR9A 4ZVQB 4PG6A 2V8GA 5D4NA 3KYLA 5D3GA 2YNFA 4RBUA 4J9OA 3KK1A 2EK6A 1ZTWA 1KNZA 1SC1B 3K59A 3SSSA 4J90A 4CLKA 4HH1A 4K7QA 3OD2A 2D1CA 3CJQA 2B3TB 4NRUA 2CPZA 2ZBRA 1FE0A 2V8DA 5I4MA 3WQPA 1JK9B 2LLZA 2CNLB 4TNOA 1SQFA 2XWXA 2WONB 3VAFA 1J5EJ 3QSIA 2NPIA 2MXYA 4RO0A 2DNHA 1U8SA 2MZQA 3NRBA 3NMAA 1AROP 3CCVS 4UY8T 3KLIB 3NCRA 5C25A 4DN9A 3D0GE 2NSBA 5A8KB 4B9SA 2N4DA 2HVZA 1Y3KA 3LP1B 4NYOA 1TKXA 2UXCJ 1QVGR 1MROB 2BYCA 1S5ZA 1WTBA 1I3OB 2JVOA 4P52A 2JEFA 4M1KA 2HRTA 3RBEA 3QJPA 1RWMB 2KHDA 3OFEA 2PFFB 4Q45A 1S9GB 1C1CA 2JRSA 2XO6A 4K0KF 3HDSA 1CG2A 4QWCA 4USWA 4ZJQA 1APSA 1R6VA 1S1UA 3HT0A 3JQKA 1XR7A 1EX8A 2DR8A 3BZQA 4U9RA 2CQ1A 3GYXB 2HNZB 2QA2A 3FBBA 2MLXA 1WOSA 1K73T 4HVZA 4CI0B 3OXLA 5HJXA 3BH6B 4P7VA 5I3UA 3BR9A 4RJVA 3WX8A 3DRSB 2J9DE 3H8YA 1VC0A 2H5IB 4EZ6A 2AT1B 2OEJA 5EX0A 2XQCA 1WKLA 3NNCA 1NK6A 1HHQA 2HSEB 4P71A 3LA0A 5D78A 5T7LB 5KT5A 2YKMB 2E9RX 2V2QA 3I96A 4DPTA 2RHSB 2DITA 2I5JA 3I0RA 1PAUB 4OHVA 1FEEA 1X9WA 2CJBA 4USJC 5K14B 1P27B 3CCWA 4PABA 2CJ9A 1YJNS 2GZOA 1X9MA 4J9RA 4CLTA 3N01A 2Y9HA 2ZH4A 2Q3PA 4NLWA 4FPIA 4XPCA 1XERA 4X66F 4OZ2A 2AP6A 4ZP8A 2BBEA 2GAHC 1CJUB 3PFEA 3IBWA 3HF5A 1HHSA 4LRAA 4DR7J 3QGGA 2CKWA 4NPOA 3DLKA 5KFUA 2NLWA 5D3GB 2YNFB 3DLBA 4J9VA 1OQ3A 3MFIA 4PUOA 3BR8A 4QIWD 1SJ4P 4UT4A 3A8KA 1HHTP 4LF5J 2XHCA 3NCQA 4EBDA 2DK2A 5SZTA 1Y7PA 3QWUA 4FF2A 2AGPA 2J0XA 3QO9A 4PYDA 4PAAA 5KFGA 4O0IA 3E51A 1S79A 3KKFA 3P5TL 1ELOA 2XNQA 1S4FA 3MTKA 1RP5A 4OI2A 1VRUA 2RQKA 3D9BA 3KLEA 2LU2A 5JUMA 3M2RB 1U1NA 2V34A 4H54A 4CLUA 2AKWB 3FBEA 3LW5C 4XIUA 1A7GE 3CJKA 4K2JA 4DR4F 2E5HA 5C25B 5KFIA 1TELA 4C8YA 2V4JA 3KLFA 3QATA 4ES2A 3N79A 2QE5A 4WTOB 2HQDA 4WK1A 1KBRA 1NJXA 2XY7A 2N7YA 1KVJA 1HBOA 2FB0A 3NWRA 5LMUJ 1C1CB 4YY3J 1NZ8A 1PJ6A 3F73A 1TUGB 3H0PA 2W8KA 1S1UB 4UF4A 3FZ2A 1R27B 1K0VA 3SQOP 3PKYA 4FXDA 2XWYA 4DPYA 2F8MA 3ICLA 4ZHRA 1CC7A 3CF5Q 3G6YA 5AE3A 1IJFB 3PV8A 3OVAA 2CVIA 1VYAA 4PG8A 4CLWA 5I3UB 1OWXA 3BDEA 4IR1A 4NXMF 2CIMA 4CQ1A 1PBAA 4WFAQ 3PCOB 3D6HB 5IOLA 4OX7A 2WW4A 1O8BA 3T5KA 1V3RA 2R4FA 5BYQA 3MEGA 2CFXA 1FXLA 5KG7A 4MIWA 2MLZA 4QPXA 3W5ZA 1VQPS 1P9YA 2MY8A 3CJ2A 2ZH5A 4YR0A 2R7WA 2F9DA 2I5JB 1NO8A 1HMVB 2CNNB 3QWPA 4LIWA 2KM8B 4OX9F 4WP3A 2AJ2A 3BBFA 4JI6J 3GG1A 3M9NB 4IYQA 1FF2A 4DCJB 2RNEA 2YVSA 4Y2MA 1LK7A 3NCPA 4N7TA 4EO6A 8AT1B 4ANEA 1ZAVA 3P3DA 4I6WA 4HACB 5AJ3F 1EKRA 4OLPA 2E7WA 2RU3A 4F2RA 3QT5A 2CNKB 5LMNF 3W5XA 4WXWA 2B43A 2K06A 3G86A 4ZVRB 1TUWA 3DLKB 4DR1F 2CQDA 5F8GA 3R8YA 4K4WA 4LJMA 5DG7A 1UVNA 3D67A 3IR7B 2Z2LA 4FS1A 4PPDA 3IXQA 2BJ9A 4PUOB 3CUNA 3ENAA 2KFNA 1SB6A 1NK8A 1DTQA 2MKSA 4KFBA 3ITHA 1TL1B 1N34J 2Q79A 4MK7A 1UCNA 2CJYB 2XY5A 2OPRA 1V5VA 2QFIA 3NMRA 3O1LA 2R2RA 3NGSA 3M4XA 4PXCA 3QFWA 2OD6A 3E8OA 4DV2J 2C2EA 1Y10A 2RAQA 1PJ5A 4OL8A 3NWGA 5E5NA 1G4CA 4AL5A 1KTVA 1X4DA 3MF5A 2BE7D 1VRUB 2DNRA 3I0SA 3KHRA 2COLA 2Z2ZA 3KLEB 2QGFB 1RHUB 2MQMA 1LW2B 5B0BA 4V19X 3VAGA 1AT1B 2CQGA 1MW7A 3PW5A 2MPUA 3CJKB 1WELA 1NNDA 3U7JA 1XMOJ 4NLOA 4ZKAA 2H5JB 4DV6F 1EQMA 2YNGB 3HD2A 2V4JB 4DV3J 3Q24A 4Y00A 4LF1A 2B9YA 3CD6S 4U67Q 4NMXA 2W2MP 1JXVA 3LANA 2XLJA 1T95A 5GVQA 1IR2A 3UDCA 5A76A 5K5MA 3ISNC 1VK8A 2ZHBA 3P6YC 3QGHA 5ETLA 3GZ7A 2K7KA 3PDNA 3QIPA 1LWCA 4ZJLA 3OV7A 3M8YA 3CXCR 3BGRA 2V2VA 2KZZA 1ZS6A 4LR7A 4B17A 4OYWA 3FEXB 2LQ8A 4E2FB 4IOCQ 1QDUB 2QSFA 1U1PA 1KN6A 3HVWA 1T03B 4B08A 1QSLA 1UW9A 3CCES 5E41A 3UCGA 4WKRA 1VCTA 4X4NA 2XZWA 1NPRA 3T1HJ 5FJ4A 1X5SA 2MEWA 2UU9F 3DNCA 4J9SA 1J27A 2JVRA 2IJFA 2D3ZA 3CMES 3M8PA 4LF8F 3JYTB 1KVKA 5B0GA 4YDXA 2MQ8A 3R5DA 3J81Y 2BMBA 3UO0A 1IKWB 2X1GA 3K5OA 2JNJA 2VFTA 4F25A 2VH7A 2DH9A 4ZVPB 1NDKA 3R2DJ 1ZA1B 4FS2A 4TYAA 1S99A 3LF0A 2JLFA 1I94F 2E5JA 2HFOA 1XK8A 1FJCA 4KHPF 3SMZA 1CS4A 4O44A 3OTBA 5CHCB 4YR2A 4V19J 5F9LA 3CD5A 4GRSA 3ETMA 4WFNQ 3QSYB 4LVOP 3GILA 1SBRA 3UR0A 1DTQB 4C6AA 5LL6d 4KFBB 2DXEA 1HWKA 3OBIA 2IJRA 1C1BA 4UQTA 2OPRB 5L9NA 1X0PA 2M9KA 2NXEA 5K8MA 5K9FA 3QRRA 4LF9J 3UD5A 1PILA 3FCHA 1N6QA 2RSQA 1VIXA 1S1TA 2YNHA 1H2UX 1TK5A 1ITPA 2ASYA 2RKIB 3I9ZA 2PMWA 4DL5A 5HQMA 3W60A 4OV1A 4PG5A 4XK8C 1M5OC 2BX6A 4I6YA 2LKZA 3AD9C 3QZ7A 5KT4A 5HMYA 2CADA 4Y34A 2NXJA 3MAQA 1NB2A 3JSMA 1L3TA 3TJAA 1OS5A 1H38A 3BF4A 3CC7S 3OL6A 1BGXT 2XMVA 3HK2A 1NSAA 3ZTRA 5RUBA 3CJ3A 3AQOA 3R6LB 2DGQA 3JTOA 1LWXA 4OJGA 4B3RF 3PTWA 4A8YA 4QIVA 3M8QA 2RU9A 2UVUA 4BC7A 2E5LJ 3QIPB 1LWCB 3TEGA 2DNOA 3P8BB 3OL8A 5F8JA 4FVMA 1HNZF 4KGZB 1KLNA 4RW7A 5EN1A 4JI0F 3W3SA 3NGUA 3KJNB 3AA8A 3CJ5A 4LSNA 5E0OA 3H5YA 4DPWA 1R7IA 2W2QP 1UJ5A 3CJTA 3NAHA 1TVRA 3EUNA 1J5OA 2KT3A 2ZKUA 4WYLA 1G1XA 3O5TB 4J9UE 2RRBA 1M5SA 5KAKA 4MAKA 2BOAA 5T14A 2DPIA 5T41A 5IZHA 4NL5A 2ASDA 2KYXA 2V67A 2PN6A 3M8PB 2G0IA 4K4UA 3UNYA 1FKPB 3TZWA 3MMBB 4DX8H 4ZIWA 2HPUA 4F4YA 2FJXA 4B9MA 4MYUA 1ACMB 4JUZA 3GIRA 4DV1J 1FKOB 4NLSA 4FKYA 3MOZA 4G65A 4HHUA 1SKUB 1KEKA 3MMJA 1YBTA 1B7YB 4OYOA 3CJ0A 4RW6B 4O44B 1MWZA 4M5NA 4XO0A 2D9OA 2OLWA 2WW8A 3AFGA 5IM0A 1RT4B 3D28A 2H48B 5KFQA 1M5PC 2CVEA 2W24A 3WX4A 4JP8A 4V1Ak 3MAAB 1QE1A 4QYRA 1WC0A 3NBPA 2C3YA 2VG5A 3CDEA 4GKKF 3Q8SB 2AJ0A 5SUHA 4ICLA 1W7WA 2R8JA 1HBUB 4QWBA 1N6QB 5AXKA 1VR6A 2YNHB 3T1YJ 5B0EA 1F2HA 4OHZA 6FD1A 4X4OA 2KHCA 2V68A 4ZN1A 1RAAB 4MIAA 2ZJPQ 1FKAF 2LEAA 1WC5A 2ZZMA 4NE9C 3V6JA 1PG5B 5KG0A 2C2DA 3V6KA 5C2CA 1VHIA 1ZPVA 3W8GA 1UPPA 3MEEA 4KB7A 4ECUA 2FC9A 3ZZ0A 1HBMA 2VFRA 2K3KA 4WBFA 4MYTA 1O5JA 3CD7A 4OZJA 4Z37A 1YJTA 1UJ6A 4QBUA 2I0XA 3NNHA 1UVLA 1OYDA 3PHTA 2LXFA 3HX9A 4CIOA 1VC6A 3CTRA 4FF4A 4IFYB 2YKPA 1UWBA 2JOQA 4ETZA 3VZIA 3TZXA 3QMQA 1RT2B 3K8WA 3PR5B 2C3OA 5IWAF 4JOUA 2C28A 4CWBA 3NL0A 2FJBB 4DZ6A 1YLXA 4F3OA 5J2NB 2BRLA 4TY8A 1RXOB 2W9CA 3UFCX 2EFQA 3KUHA 3CO0P 1IKXA 1MLAA 4LSNB 4PG7A 4OI3A 4DSLA 3O3LA 3IM9A 4UOGA 1TVRB 4O3PA 1X4AA 2AYMA 5KFOA 5KOWA 2WVCA 3ZC4A 1OMSA 1YRUA 3T9NA 1S72S 2X3GA 4UUXA 4K59A 4CO0A 2UUBF 4B9VA 3SIPB 3MDFA 1ZTTA 1FDBA 4F4WA 2QYGA 2AD9A 1IBLF 1H98A 3E2EA 1JLQB 4IQMA 1VQNS 3OTEA 4RUAA 2YKQA 3CGIA 5J2MA 4WFXA 4ECXA 3FC9A 2JJ4D 1ZM4A 2H4YB 1S9EA 3KNGA 1S12A 9ATCB 3CJ8A 3EM1A 1X60A 1N5QA 1NJIT 3RJMB 1WSVA 3HFKA 3TJ8A 3R3TA 2HGMA 2YY3A 4NZ0A 2VQFF 4A8MP 2AX1A 4DCOB 2HS3A 1RU2A 2JEIA 3UDEA 4DS4A 2V4QA 4TN2A 2GJIA 1U45A 2Y1RI 4Y2IA 2ERRA 4ID5A 2CPJA 2YWFA 4ZPBA 3NBPB 2VG5B 1EHWA 4XTTA 2IM3A 4ICLB 4CT8A 4DG1A 4K0KJ 1PYOB 2NR0A 2MTLA 1GNKA 1RTJA 3QNWB 5DZ7A 5LOQA 1H3DA 1URNA 3TZYA 3D68A 2IVMA 2Z56B 3M1VA 1S76D 3LOUA 1KQGB 1ZETA 4QIEA 1R8CA 1RBAA 2AGQA 4IH7A 3G4SS 4DZDA 1YZ7A 4H4OA 4YS2A 4N56A 2HHTA 4CO5A 4CM2A 2L9NA 2OSQA 5KFMA 1Y4ZB 1Q5VA 1RWVB 3MXHP 2LFVA 1XJWB 2RUGA 3VGVA 4NCBA 5BJRA 4LRBA 2YXLA 2HHXA 2HQCA 2FZKB 3PZPA 2Z58B 4URQU 4MH8A 3K89A 1U1OA 4H4MB 2J9DA 3CWJA 3OT9A 1HR0F 4IRCA 2QO3A 4DQPA 1FESA 1XN9A 1EP4A 4ETXA 3J7Z5 5EWGA 2VBXA 2MKJA 1U47A 2RS8A 3JAMU 1RHKB 4I56A 1EQ0A 1B99A 3G96A 3T9ZA 4ECRA 2I8EA 3TVKA 2AU0A 3C66A 1VOMA 3I4PA 1DJ0A 2B8QA 1DY3A 2QMWA 2LQ9A 5F0WA 5EUHA 1HW9A 2DHAA 1U09A 4TY8B 3K0JA 1NHVA 3EGWB 5DETA 3HULA 4FDFA 1JX4A 2W9CB 4JI5F 1N8RT 2CPHA 1NHUA 2CQHA 3KWMA 4N41A 2VBWA 2R42A 1K0TA 2UV8G 1RHRB 3EJMA 1T11A 1SC3B 2WBMA 3ZNUA 3K5LA 1ZH5A 4JI4F 2RB7A 2A6OA 4DQSA 1S48A 2OO4A 7FD1A 2KH9A 3ISZA 2B9WA 2WCXA 3CCUS 4JI3F 2RT3A 4M5DA 1LWEA 1N88A 3T6JA 2JEGA 5J2MB 2IY5B 4N8NA 2OPQA 3MM8A 1ZM9A 3UPFA 1S9EB 2XHWA 5HMXA 4ZP9A 1JJ4A 1PKUA 3DCAA 2OSRA 1D8YA 1IXKA 4L72B 1FDAA 1TKZA 3UW1A 1VQ5S 2MQQA 4ECSA 4DR4J 3ENWA 4USIA 1OIAA 5IV3A 3NS6A 4ID5B 1WI8A 3HHLA 1N33F 3F44A 4JI8F 4IFVA 3PJ9A 3ADAC 2CQPA 2OFGX 4EZ9A 1VDHA 1HPZA 4C8NA 5GMDA 1VLOA 2M8HA 4RWWA 1Y3JA 1SC6A 2V0NA 4P2SA 1H72C 1RTJB 5KFEA 1F5CA 1V3ZA 3HFZB 4CM0A 2WSFC 2XC9A 5B09A 1FRHA 4Q8EA 3H42A 2F63A 3LP2A 2H5EA 5H1SV 4NXMJ 4H4OB 2AJFE 1YBUA 4ZLNA 2EI5A 3AOAA 1LW0A 3DC2A 2WSEC 3SDEA 1TL3A 3TYTA 4QPTA 3IWLA 3QRQA 4Q0BB 2DO0A 4WCEQ 2G2OA 4LF4F 2ZC4A 3R5GA 4ED4A 4OX9J 4N77A 4DUZJ 2J5AA 4E8UA 1EP4B 1WNEA 3CE8A 3VWSA 3DRRA 2DXDA 1UVKA 3OR2A 3R2CJ 2CZVC 2ZITA 5AJ3J 2ZE2A 2AEFA 3DFEA 2DH8A 4O4GA 5LMNJ 5L8RC 4DFMA 3GFHA 1JLGB 3M05A 4DR1J 3P4UB 4TXSA 5KFJA 4X4UA 3AH6A 4RBTA 1SJQA 1LV5A 4ZP6A 5EWFA 5HATA 2FUG9 4M8LA 3T6BA 3HLUA 5HBMA 3SZ2A 4P73A 4K4VA 3GFYA 3FSYA 4Z2XA 1NK9A 1NDLA 4P2MA 1RCXB 5IV4A 2JEJA 2C42A 2X1BA 2R7SA 1WACA 2HMIA 2VL1A 4GC6A 2HKEA 2G2ZA 3PVXA 1FA0A 2EEYA 4MK8A 3KK3A 1LWEB 5CA5A 2DIUA 2QA1A 1SH3A 4QWDA 3FSXA 3BDPA 3FRZA 1TU0B 4RX6A 3Q83A 3ONQA 2PGCA 1VQOS 3RB6A 2CJKA 2KFYA 1TKZB 2YBVA 5D4PA 1HNXF 2B4OA 2R8KA 1WD6A 1GXTA 2BW7A 4OI6A 4DV6J 2IVYA 4OZNA 4HKQA 4J9LA 3HP6A 4IO9Q 4ILMA 4C3LA 4GO5X 1OO0B 3HHLB 2ZH3A 1CJKA 4IFVB 5CD4A 3IWXA 3DRPB 2E1CA 1HPZB 3TUZC 5A6PA 1VISA 3OJSA 2FHMA 1HA1A 4NLTA 4KGKA 5A8WA 3CIMA 4DU7A 1CQMA 3G6VA 3ZZUA 4RPFA 2EBEA 1JLAA 4F3MA 4X65F 2R2SA 1YZ6A 4OZ0A 1X4CA 2ASLA 1HI1A 3RAMA 4A8OA 3D4JA 3W64A 4OYXA 1WF2A 2HEKA 3D6TB 1PYTA 1LW0B 2ADBA 2DR7A 2BJEA 1IJEB 4UW2A 2ZM6F 2RF2B 1WDDA 2VG6A 1TL3B 2CZ4A 2VC1A 4IOAQ 3DDKA 2FVCA 2UU9J 4XPEA 2N82B 1HARA 4DL3A 2F9JA 3WC2A 1S6UA 1QSSA 1JLEA 2WB1D 4LF8J 3TEHB 3QYYA 1BUXA 2XLIA 4F04B 2HLUA 2PIIA 3S7RA 3DRRB 1JLBA 2BJ1A 5F8MA 3OR2B 2B9EA 2YKOA 2BXJA 2LP4A 4WU2A 2GGPA 3C15A 3UVJA 2ZUGA 2ZE2B 2KRBA 1I94J 3X1LB 4O4GB 2GIQA 2WRMA 5DDPC 1OY6A 3KFWX 4JI2F 4K8RA 4KGXB 4P6QA 4UUWA 1FWKA 2HK3A 2ZH1A 5KT7A 2RVJA 4KHPJ 3TI0A 2GHWA 2A2DA 2NREA 2GVZA 2CQCA 3VCDA 2ZJQQ 1V3SA 4ZLPA 2J6UA 2FLLA 2BOPA 2GNKA 3J7YU 3B78A 3N6NA 2DNYA 1NB7A 5HBMB 2MKKA 1N48A 5E3CA 1HNWF 2RUSA 2FC8A 2MKCA 4EGLA 4RL1A 1A0OB 2AF6A 1FVSA 3HHDA 3CC4S 1RT5B 2BKOA 4OMFG 2K2PA 3U1LA 2P6TA 4X4PA 4ZVOB 3M6WA 3TVYA 4DL2A 2EVZA 2CQ4A 3KJFB 3KK3B 1PJ7A 5EGYA 2L9WA 3BQ0A 1Y0HA 2HHVA 4ECQA 2I2YA 5F8LA 3C3LA 1QAXA 1AFJA 2DHXA 4ED5A 2W7AA 3OPKA 2AJ1A 4PQUA 2JWNA 2RIJA 4G1QA 2BJ7A 2CJXB 3GIIA 4M94A 4G3IA 2W9AA 5JXSA 3ZXWA 4LBHA 4I2QA 1S0VA 5GAGU 2W8LA 1X4BA 2U1AA 2AGOA 5AXMA 4RU9A 1QM9A 5E33A 1R6YA 2ZBPA 2FLOA 3KHGA 1TL7A 2PD1A 2EG1A 1CJKB 3DXSX 1MG7A 3RR7A 2WB4A 3KK2A 3K5PA 3NEKA 4PRFA 2AWZA 2I9SA 3NGKA 2ZFHA 2Y0BB 4FNIA 1FJ7A 4ED6A 4B3RJ 1X9SA 2ZH6A 3RAQA 3I82A 1RZMA 4M5JA 3WC0A 2F7VA 2JC1A 5IQ6A 1JLAB 3DLEA 1HNZJ 2YKNA 1HKAA 4DLGA 3CCTA 4JI0J 2DGOA 3UN3A 1CULA 1SI9A 4FZVA 3M9OB 4ZVFA 3ETOA 3FMBA 3NNAA 3G8SA 4ZVTB 4FBUA 1KFSA 3PFOA 4PXDA 3OXFA 3BQ2A 1YQHA 1RAEB 3H2VE 2VG6B 3CNQP 2IHR1 4Y2AA 4LR9A 1RTDB 2NS1B 1AA1B 1NJZA 5KG5A 1WG1A 3AA9A 4ZCLA 3MOJB 1R43A 1RUSA 3VAHA 3TO8A 1FRMA 3PW0A 1JLEB 4NLUA 3R5AA 1HWJA 3RZAA 2RDIA 3D1QA 2HHPA 1JLBB 2XYHB 5KFWA 2BABA 2QSWA 3C15B 4K4TA 1UMJA 3NOGA 1NSQA 3UVJB 3SCKE 2B5JB 3GIJA 2XS5A 2NZCA 1KRPA 2DEJA 2OJ3A 1B0PA 2HS0A 3RGIA 2GVZB 1HIYA 5D15A 3CJ4A 2OEMA 3KJVA 1T02A 2AW0A 3UQSA 1WHVA 2BW2A 3QAEA 2ZOFA 2B4UA 2FJAB 4GKKJ 3MTJA 4N5SA 4O3SA 3EGZA 3LTOA 5KFYA 1HQEA 2JLEA 4PPZA 1XR6A 2BQUA 2FVSA 2V69A 4ELTA 2DIVA 3NP5A 1N5TA 3IAM9 1WWHA 2FY1A 2M4MA 3RW7A 1O0PA 4PQUB 2SXLA 3V4IB 2HFVA 4G1QB 4ED3A 1RABB 1SL1A 1X5TA 2VFUA 3A3NB 3QPIA 2KB2A 3UI3A 4GC7A 3I5BA 2XNRA 2ILYA 3BSCA 4DSKA 3CULA 4JV2A 1TL7B 4LF7F 3T5LA 3MUTP 2XSJA 1ULRA 2VV5A 2DGVA 4CZCA 5D6GA 2HIQA 4MTPA 1FD2A 3TR5A 2V9KA 1I51B 3ENQA 1IUJA 4P7TA 5GADU 3H40A 5B0CA 2AMCB 1FRJA 4D3HA 4ATNA 3LUYA 2V4RA 4P72A 5JVGQ 1T9TA 2KG0A 1IR1A 2R7VA 1GXUA 3DLGA 1SJ3P 4IO1A 1QAYA 5H9EJ 1PSDA 5C5JA 3RTVA 1Y11A 1RLDA 5HROA 3FFIA 3M8ZA 2VBYA 3DYAA 1OPIA 2YKNB 2V2ZA 5IWAJ 4L74A 2C22A 3GV8B 2KZMA 1U24A 3PYEA 3SFGA 1RU1A 1CULB 4H4KC 3H4BA 2GC8A 4CO1A 4HTIA 2DGWA 2ZUAA 1YTYA 4R0EA 2VONA 3ELHA 2HGLA 4LRFA 4MKBA 1F9HA 3G87A 1PYSB 4HT5A 4NEZA 1B4SA 1X4GA 3AODA 2E7VA 4YMEA 4AXJA 3PYGA 2FIUA 3M8SA 1BHNA 3ZZZA 4E0DA 2YQ3A 2R8IA 4JBCA 5EDWA 4ZN3A 3EDRB 2UUBJ 3LGNA 2XI3A 3KXDA 2ACMA 2WTFA 4KC5A 3CDUA 1IBLJ 3MURP 2WVBA 2MY7A 4NOHA 3NY0A 1CBKA 2E66A 4ZP7A 2KFZA 3D0IE 5ETSA 4DMZA 2DGXA 2AJQA 2WVEA 1D9DA 1G7CB 4Z7CA 4ES3A 3GFXA 3O44A 2EWHA 2ASJA 4NLGA 3MPYA 3AY0A 2IYGA 2FD2A 1YG0A 4DEZA 2VPWB 4U8YA 3FKBA 3W8PA 2VQFJ 1GX6A 1K44A 3AJ2A 5K8PA 3KJVB 4EBEA 1TKDA 8ATCB 1TV6A 2FLNA 5BR8F 3OFHA 5DQIA 4X64F 5JVHQ 1HQEB 2BANA 2E1MC 1SCJB 1HQUA 3TARA 5KG1A 3ZTPA 2DNLA 4BC9A 4U7UK 3N5FA 2Y1IA 4DR6F 1WHWA 3WIVA 3BGFA 5F3ZA 1M1KT 4USVA 4QW9A 2MB0B 2BJDA 3W2WA 2R7UA 3B6BA 5ETOA 5KFZA 1RK8A 4P74A 3IRXA 1HWLA 4EYIB 2XGQA 1FDNA 4GMKA 5IT9Y 5IFMA 1S1WB 2XM3A 2GQ2A 5J2QB 4DR2F 3M6UA 1M1GA 4KAIA 1VQKS 2A2CA 1U6FA 3B54A 5LT5A 3IG1A 3FBCA 1C2PA 1UZDA 4G6VB 3MCSA 1ZA2B 4KIAA 4DFJA 5DM7Q 1HR0J 5JJBA 3TP2A 2VA2A 2W4CA 1F5AA 4DQRA 4CLSA 2AYBA 1JWWA 2P6SA 3UN5A 3FFIB 4C8ZA 2MZRA 1FO1A 1JLFA 2MKIA 1VQSA 2DNPA 3MM6A 1ZM2A 1SH2A 3DYAB 3U02A 3BO4A 2WOMB 3KHLA 2IRYA 1EB0A 4MKYA 4I68A 1DAXA 4OHYA 1VLYA 2N4CA 4JI5J 1RYSA 2DJWA 4YHHF 4CT9A 2E7XA 2Q6BA 1R3NA 3AJDA 2Q1LA 3EZUA 3BH7B 4Y65A 4ECTA 2J8SA 2IDEA 3CCSS 4X4TA 1I5OB 1XWLA 2CDRB 3MCMA 3MEKA 4JI4J 2LYVA 4NLXA 3SV4A 4F26A 2V9WA 3BGUA 3KHHA 4JI3J 4AT1B 2V2KA 4R25A 5A8RA 5A6WA 2UUCF 1P8GA 2J76E 2OGUA 3BO3A 3CW2C 2FYXA 4OYAA 3L09A 2MMYA 3CMQA 4DJBA 3SCJE 4KTQA 1DBDA 1URRA 2HNZA 1H7XA 3KLVA 4DX7A 2J9EA 4B3MF 3D66A 2LEPA 1B0VA 3JTNA 4RNMA 5KG3A 3UCUP 3L7UA 4TU7A 1Q81T 3NG8A 1RT1A 3MPDA 4ELVA 1A9NB 1L3UA 1N33J 2VPYB 1TV6B 4DSFA 4JI8J 3VQSA 4ZCMA 1WUUA 4BHQA 2XMTA 3QT6A 4B3SF 1N32F 4HLBA 2BANB 1WI6A 1HQUB 1F9EB 4GO7X 1EAYC 3KG1A 1FRIA 1F6TA 2PE8A 1FFGB 1G6BA 4NYZA 1YI2S 3GV5B 1XTZA 2JFKA 1FX4A 4ZMMA 4NA2A 3W2WB 5FIIA 4A8XA 5GAHU 2WVFA 3IRXB 2YH0A 3RB3A 2BEFA 1IBKF 4EI2A 5B0AA 2XBPA 5HQ8A 3J80Y 1RACB 2W9BB 3BKTA 5AE2A 1T9WA 2IBOA 5ETRA 5KG4A 3AXMA 1MMLA 5FLXY 4DV0F 1ICEB 2ZH2A 5AXLA 4DR3F 3MUVP 2PMHA 1YWXA 3R1HA 3NOCA 2ZC3A 4ZPWR 3IG1B 2GA7A 4LF4J 2HLTA 5EX3A 1E6YB 8RUCA 4OJHA 2MKHA 4RW4B 3QBCA 4AXIA 2EG2A 3G82B 2GX8A 4KH1B 2DGTA 2UP1A 1M90T 2CG8A 2PO4A 2H54B 1VQYA 3NAIA 3QGIA 2DGSA 1JLFB 3MM6B 3VAMA 2NZ4A 2WHOA 2NUHA 4WKYA 2R7QA 2HURA 1PIEA 3VGTA 2XO7A 3EMTA 3RYLA 1AUSL 1IWAA 1VJQA 1RLCL 4JB8B 2XEXA 4RU2A 3M2RA 3FQKA 3HSZA 3V81A 3DDIA 3L95X 3R6GB 4FNHA 5IC6B 4X4VA 5IXUA 2NQPA 4P9SA 1D8ZA 3NGTA 4KBIA 3DXBA 3GSDA 3GIKA 4F2SA 5IC4B 1QVFR 1S59A 3TAMB 3KLHA 4RUCA 3IRWP 3FDSA 1YJ7A 4PR6A 1BWVA 1UTAA 5A8RB 5KG2A 3M32A 2R3VA 4K4ZA 4WZQA 2W7OA 2OH2A 1UAWA 1R8BA 2EKYA 1SKWA 1T94A 1XEZA 2I38A 1SV5B 3AD8C 2VA3A 2HHSA 1CEZA 1HNXJ 1RJJA 1BQXA 3EZOA 3N0VA 1BY9A 4Q5VA 1XIQA 2GMHA 3JB9k 4ILRA 1KHVA 4RWXA 1RT1B 1X0FA 2L08A 2VG7B 3HSGA 4PWUA 4C98A 2HNDB 2VZ9A 1RADB 3MMCB 4FBTA 3H59A 3SI8A 4J9MA 3AAWB 1A6LA 2HHQA 1HMVA 2ZEJA 2N3OA 1WG4A 3LO3A 1ZAXA 4F8RA 4YB7A 1Q7YT 2XMKA 2IRUA 2BQ3A 1VRTA 5L1KA 2J7KA 2KI2A 4QR0A 4X65J 4O0NA 5HVGA 1TAUA 4JI7F 3FMWA 2HVIA 4OHXA 3VGSA 1NEEA 3A8JA 2JC0A 4WTYA 3M9MB 4M5MA 3CB4A 4HACA 1MWQA 2UVVA 4AL6A 3WIUA 3GR1A 3OQ2A 4Q2LA 3PO4A 3FBFA 1UEKA 3AHPA 1EZZB 3NKYA 4KE5A 2ZM6J 1AYEA 2BUNA 4Y0FA 4FYWB 4AFFA 2FGOA 2C3PA 2AYGA 1V6HA 1UVJA 1RT6A 2DO4A 1S9FA 3FRYA 1O51A 3D54A 1RCOB 1TL1A 2QJ3A 4XAKA 2ZWOA 2DPJA 2DYAA 5L1IA 2Z30B 3LWMA 2ZHAA 1UW4A 5DDOC 2NUUG 5L1LA 4LFBF 5L38A 2CPYA 2KVQE 1R8AA 1Z4UA 3GB0A 2QYCA 2PEBA 1KQSR 2GMJA 1QTMA 1S0MA 3T1AA 2DNMA 4HDGA 2J0WA 1LW2A 4GKJF 3PX6A 3V81B 1TMJA 3MMAA 4NASA 2RH3A 3H90A 5GMKa 1HNWJ 4ZS6A 2JSXA 3OLBA 3HI9A 1GH8A 2YNGA 2G1DA 4IOBA 3CJRA 4A8FA 4KJIA 3BO2A 3KLHB 3BEGB 3H5SA 4AD6A 2F4VF 1D9AA 4Q7AA 2JL9A 2CJQA 4RNHA 4PWWA 3W9IA 1U2CA 4C3MA 3GSIA 1H0HB 2PI4A 3M32B 2JX2A 5KFRA 1IM6A 2HVEA 3OHAA 1Z2ZA 4ZITA 4YR3A 3VZHA 3V4MA 2FHJA 2F3JA 1XMQF 1WKJA 3MAHA 5HANA 4CP5A 5I3QA 2ZOMA 2ZZTA 2N7CA 2CWKA 2ATLA 2KVIA 4OZ1A 2HFZA 3IA0A 1RT7B 4HHJA 1T03A 4ZVUB 4R5PA 3W65A 4IR9A 1UEVA 2HWTA 4NLDA 3HSJA 1WORA 2Y0SD 1CJVA 2QG9B 4LSLA 3H25A 2GMLA 1WC1A 4ITSA 2DR5A 1RBOB 2RMLA 2H3EB 4R0JA 3R7BB 3W7BA 1BXNA 1Q8LA 2LDYA 3D5MA 3ZZRA 3HZEA 4URSA 2B8PA 4QYZK 3JYTA 1VRTB 3AJ1A 4NLYA 3ILJA 2AEMA 3PR4A 4QR1A 5CD4H 1F0XA 1IKWA 1U25A 1C4AA 1LNQA 4C0OC 3Q8YA 3JS9A 4ZPDA 1GTEA 4K4YA 2WK4A 1B70B 1FFWB 1W2IA 3D2WA 4F0MA 2MGZB 2M5YA 2HBQB 3HVTB 4B9LA 3N5BA 5M2RA 1HFEL 3BPSP 3FSIA 1RT6B 5FDLA 2GV1A 4WK3A 4B9TA 4DV3F 2DISA 2Y1LB 5H9EK 2K8GA 1K9MT 2ZZNA 1DLOA 2OAUA 3O6QA 1FHTA 1D3WA 2KT2A 3V6HA 3VVTA 3M7VA 2MSTA 2CPXA 1BQNA 1GMVA 3BSNA 3NS7B 3A3OB 4I2PB 2PDAA 1GAOA 2IM0A 3J81U 2RKIA 4OJ1A 4QCLA 2KO1A 3CSKA 3EZ5A 1YBAA 1KR4A 3AB4B 3ET6A 4HTJA 3MMAB 4M95A 3UN2A 1WEYA 4P2FA 3O2IA 2M52A 3C2PA 4DPXA 2YWEA 1GMUA 4TU9A 4NZ7A 4ECZA 3H5UA 2VFSA 3N6MA 1RWKB 2W1BA 4M63A 1WOOA 2FHKA 4LFAF 3FEYB 1DQ8A 2G9OA 3DLJA 1PCAA 2WSCC 2IAJA 2KJWA 1IQTA 1CJTB 4G1IA 4F02A 1T8EA 3S8SA 5CYMA 5J1NA 1QY7A 4ENOA 5KFNA 3MPWA 1JXEA 4HR2A 5HMWA 2EK1A 4MMOA 3L7OA 5FD1A 3DOLB 4RNNA 4UY85 3EVOA 5F8HA 3DOKB 1B0TA 4USMA 1TUVA 3KG4A 2M0GB 2HAIA 1FXDA 3MD3A 1T9VA 3I5CA 1DURA 1U2FA 4O3OA 5BYSA 4DHVA 4IH6A 2MZ1A 1FJGF 4R5PB 3F0NA 5A2QY 1L3SA 4LF7J 5LSOA 2FDNA 1V9OA 1NMEB 2DHHA 2IBKA 3TA0A 1NH7A 1S1VA 3HXMA 3MHYA 1CJVB 4HI1A 4LSLB 5HVHA 1FNXH 1F5BA 2VKRA 4M5GA 4KHRA 5G4DA 1M5HA 1T9YA 2DB1A 2A1BA 1N5SA 2PMZD 2HAFA 1U48A 5CZXA 2EFGA 2B56A 4CTAA 2C2RA 3OFGA 3QT7A 1YITS 5DQGA 1SQGA 3D1HA 3BKFA 3C46A 1FKPA 2D69A 3MMBA 2K7JA 3SXLA 4NCAA 1HD0A 4QU6A 1RWNB 4JV0A 4RW9B 1Y5IB 4ED1A 2HBYB 3HZGA 2FPHX 1LOUA 2FJWA 4DCPB 1KDNA 3M6VA 4ECVA 4WP8A 4CH7A 4ED7A 1FKOA 2QL7B 3CDWA 3BM7A 4LMZA 3G6ES 1WC3A 3GR0A 4O23A 4RW6A 4L3NA 2VOOA 4K2XA 4OI0A 3X3UA 5H9FJ 1U4BA 2G2YA 2GJ2A 1FVQA 1RT4A 5E2QA 2UZAA 2Z2MA 2HFSA 2LQ5A 3FCVA 5FDLB 2BJ8A 2NXCA 2B51A 1VQMS 4NZ6A 2V50A 3MAAA 3PJWA 1JQGA 4CNZA 2ABYA 1DLOB 4USTA 2UV8A 5C24A 5HP1A 1JJCB 4P75A 4DR5F 3AT1B 1N5YA 5D4LA 2ROPA 2AX0A 2VU5A 3UDVA 1BQNB 1HBUA 2UXDF 1RSCA 3PXGa 3CT9A 2E1AA 4MIBA 3N4WA 1KQFB 4EFAC 1Q8BA 4DBQA 2XZTB 4EBCA 2GIFA 1S6QA 4ZIVA 2MQLA 3SEOA 1CLFA 4M5KA 3ZTSA 3T19A 1IBCB 3ET6B 3OTOF 4NCGA 1FK9A 1MNEA 1S6PA 4Z7YA 2E9ZA 3U1NA 2LECA 2HZVA 5LJ5Y 3CPWR 3ILLA 4I6AA 1N5VA 3RUBL 1X4FA 5BR8J 2G0CA 4X64J 2E29A 1RTIB 4C9DA 2KXNB 1WC6A 2V8HA 2DR6A 1YKWA 3SV3A 1SKRA 3GJTB 4KSEB 2IAJB 1FWLA 1S0NA 4WZMA 3HJFA 3PEJA 4DPUA 2C2MB 5CYMB 3K7RA 2EPIA 4B02A 5A0YA 2BM1A 2F8HA 4IFYA 1YJ9S 2FQQB 3QLHB 3R5BA 1FTRA 2GQQA 3FCWA 1RT2A 3SCLE 1EETB 3BB5A 4C48A 3V6DA 3GMGA 3PKMA 1SQEA 1R31A 3EWGA 5K8NA 5J2NA 7FDRA 5BYRA 2HNYA 1N36F 1RE1B 1CVJA 3U27A 1NPPA 1B3TA 1H74A 1LK5A 4NLVA 1S1VB 3T41A 4DFKA 3VAIA 2AHOB 2W01A 9RUBA 4DI6A 3MUMP 3MM5A 2YQ0A 4CTAB 5M2PA 1BC6A 3K17A 3TAPA 2P2CB 3L4BC 2X1FA 1VBYA 1DRZA 2K3IA 3AOCA 3KJQB 2B7CB 4B9NA 1JLQA 2AZ1A 1Q8IA 5C42A 2EFPA 1IBMF 3UD4P 3P5BP 4FPRA 2Q43A 3W9JA 1UFWA 2DNGA 2RD5C 4PQAA 2UUAF 2XMMA 2VHGA 3GTYX 2H1YA 2YKAA 4DFPA 2DRAA 4OFZA 1REGX 4RR5A 1M0SA 1F60B 3KMSA 5LXYA 4PG4A 4A46A 2QIFA 1Q5YA 2Y8YA 1OSDA 1U6BA 1D0EA 2MSSA 3PW4A 2E9TA 2NCKL 1RQ0A 1JJHA 2IA6A 4G1PA 3DHWC 3OL9A 5J2PB 3THVA 5G0RA 5KTQA 1RAFB 5C24B 5HP1B 1W2BR 2UUCJ 1N5YB 2CRLA 2LMIA 2ALZA 2V8PA 3IO1A 4ZVGA 3MD1A 1S97A 1S6QB 2CXEA 3R7SB 3QJJA 1RTHA 1KKHA 3D6FB 3TA1A 1QAIA 2LEBA 3MEDA 1KFDA 4NCGB 2QLXA 1FK9B 1Q8KA 2PA3A 1S6PB 2KXFA 2X51A 1RISA 1M1HA 2XI2A 1NU4A 2Y8WA 1KP6A 5B0DA 3RAXA 4L76A 4OYPA 5AE1A 2QFJA 1VQ8S 4B3SJ 1N32J 2KTQA 3PEHA 4ZJOA 3BYRA 4IH5A 2G4BA 1WC4A 3BSOA 2DKOB 1Q86T 1ZPWX 3M30A 4H4MA 2AEJA 4LRDA 2C3UA 1FDDA 2CPFA 5A0YB 3UE2A 1SKSA 3BPDA 2OHDA 3CCQS 1SL2A 1T05A 3OVSA 4LBIA 2OP5A 4OQJA 1C0UA 3FNNA 2AIRB 5HLFA 3V6DB 1SJ1A 4DV7F 1YJUA 3PYDA 4F7VA 3TUJC 1IBKJ 2P9CA 4F50A 3LAMA 3JQMA 2HNYB 4DV0J 1GQEA 4DR3J 2HFUA 3QIDA 2B4VA 3CO9A 2IPOB 2B0GA 3IAS9 2LU1A 1EKSA 2GHPA 3MM5B 4J9QA 1R89A 3I87A 1RAJA 1SPBP 1DZ5A 4GVBA 4OI1A 2CPDA 4NLQA 2E1PA 3TUIC 3BJYA 1X31C 4F4AA 4DV4F 5DDRC 5C42B 4KGMA 2FTRA 3I4HX 2ROGA 2YX7A 3GYNA 2OIHA 4CNYA 2VOPA 4DPOA 1N0UA 2QL5B 1IN0A 2M2BA 3IBFB 4X4RA 3ZNJ1 3SCIE 3PIOQ 4BWJA 3S6EA 2VODA 1UJ4A 2D9PA 2NXNA 5B08A 2K1RB 1DQ9A 3EPGA 5G0RB 4CO2A 1LXNA 2B4PA 3CDBA 3TNVA 2P5VA 1WF0A 1LWFA 1NSKL 3UNGC 4QWEA 2CQBA 1C0TA 1O6XA 3RRHA 1KD1T 4W90B 2BACA 1DARA 1PAEX 4ZVHA 2X1AA 3IWNC 1RTHB 5ETVA 4EUVA 2HVHA 2L41A 5IT0A 3MEDB 3TANA 2O1PA 2FHJD 2IMOA 2UVWA 1HYSA 1LXJA 1I1GA 1R0AB 1KQKA 3IFEA 3LPYA 1VI7A 4WJBA 3C16A 4B9UA 4ID8A 2LXIA 3KK1B 1IVZA 4PCQA 2W2OP 3VALA 5D0HA 4CLLA 2O67A 1I6JA 4OJ3A 4Q0BA 4HDHA 3M30B 2J6SA 2ZNZA 2XS2A 4NXNF 1HW8A 2WAQD 1RAIB 1T05B 4JI7J 4DOZA 1C0UB 3A13A 4X66J 5HLFB 2OMLA 5EHHA 2UXBF 1EJ7L 2GHVC 1P9QC 3EVWA 2HWHA 1L5UA 1YX2A 2ZH7A 4Y2KA 3MPUB 1JLGA 2OUGA 3CCJS 4ZCIA 3AD7C 4HH0A 2CYYA 4MJKA 1VQ9S 2XG8A 4Y6IA 2RS2A 1UA1A 2HFNA 4LFCF 4MKVA 1RHMB 1TKXB 2DXFA 2D74B 4KY3A 3Q2TC 2R8GA 3OLAA 3P45B 4GVBB 2VBZA 4K5SA 4M5HA 3TJ9A 1D1UA 2DD8S 2FY8A 2HBZB 4LFBJ 3R5CA 4ALZA 4EYHB 3BGLA 5M2UA 3FUYA 2XCPA 4XDDA 1K1SA 3US5A 5BXIA 2CZ9A 4DL7A 2J7UA 4TY9A 2QA4G 1KVIA 2OKQA 1FCAA 2MJNA 1IKVA 4GKJJ 4JV5F 4FYYB 2B7BB 3DLHA 5B0FA 1G3OA 3NXZA 3HSDA 2JZ5A 2LQBA 4J37A 4ZPTR 1CC8A 3C14A 5ITHA 2HYIB 4UZCA 2F4VJ 2UUWA 1U1LA 3VAKA 4PXBA 1K8AT 1HBNA 4LBPA 3I0RB 2IVFB 4PKDB 3DRPA 1REVA 1LWFB 2MZJA 2I6WA 2Z4PA 2KL8A 2M8DB 4DUZF 2YWWA 1VBKA 1C0TB 5ADZA 3E01A 4YEAA 2DEIA 5D8HB 1XNQF 4LIRA 4A8WA 1HNIA 2QA4S 4CYUA 3TQ1A 2WVDA 1GFWB 1GXLA 1XMQJ 4NYPA 3ZZTA 1U1QA 1S57A 5F8NA 2EFNA 1X7VA 2MQPA 3VF0B 4KGVB 4ZPAA 1HYSB 4ZLLA 2KDOA 3VGUA 4QW8A 4Y2CA 1CPZA 4F4KA 3DLLQ 3QT8A 1Q82T 4CH1A 3W62A 3C16B 4DUYF 1VQ6S 3ENVA 4OYBA 2Q6CA 4ZOSA 1T9XA 2RF2A 1DTTA 2ZBIA 3GWCA 2VPXB 1ZM3A 2XLKA 2HRYA 1KC8T 2KT5A 1FRLA 1XNRF 3C6UA 5KFAA 5D0EA 3RW6A 6FDRA 1IWGA 3QO9B 3H5XA 4IQXA 1NDCA 4YDDB 3EVMA 5KFXA 1FWPA 3WBZA 2MLYA 3A8IA 2NYHA 3I55S 4KKOA 3Q8PB 3GJQB 2BJ3A 2U2FA 5KOXA 2UUTA 3OTDA 2YWHA 2R7TA 5D4OA 1RB0A 3A12A 4D3GA 5ETNA 4KQZA 1UEUA 5DO2A 5ETTA 3W5YA 5L9XA 2PSZA 4DF4A 2IRXA 3KLFB 2VDHA 4I4BA 4A8SA 1RT5A 2HIYA 4YB5A 1TTHB 3V2UC 2BDPA 1JKHA 2VB6A 1HBOB 3K58A 3RG6A 5LM7E 1CSJA 2M3DA 1OYEA 4WXOA 3NGRA 1YK9A 1IQZA 3Q2SC 3G2XA 5CXTA 1RDRA 2RHQB 1CQNA 3GP9A 4DSIA 3ZZYA 1R0BG 4ZHRB 4JYAF 4C4WA 3VV2B 2M7SA 4MFBA 2EFVA 1NKCA 1IKVB 4Y28C 1SJFA 2PC6A 2J6TA 5H9FK 2AV5A 2V8VA 1RWOB 3C14B 4DU8A 5IQQA 3MEGB 4IRDA 4DSEA 3OSNA 2XY6A 3POTA 2DNZA 4ZCKA 4LFAJ 4TLRA 4CLPA 1WOPA 4QOTA 1HBNB 1RHQB 1REVB 3G71S 3HHKA 2XYPB 1NKBA 1D09B 1HWUA 4JI1F 2DNQA 2ZOGA 3E01B 3V5RA 5C2GA 2MHNA 3A8EA 2L48A 1B64A 2DBBA 3TRGA 4DV5F 1HNIB 4WWSA 4NRTA 4DXLA 5DDQC 1NLKL 4CH0S 4CYUB 4FVCA 2L3MA 3DDNA 4YN3B 2KU7A 1QD1A 2YTCA 2OELA 4DS5A 4ZA1A 2KG1A 2QN6B 3AB2B 3ULHA 1WSRA 5CYQA 1FJGJ 4RNOA 3LQVA 3BN7A 1UZHA 1PBUA 4C11A 1DTTB 1U0HA 4F0KA 1N52B 1RTDA 4LF2A 3F56A 1P6TA 3MR3A 2LXUA 2HZAA 3MR7A 4TKTA 1C4CA 1UWAA 3MM7A 3RU0A 3ITHB 1S7IA 2VFVA 4URGA 3OR1A 1JJ2R 3R27A 3C6UB 2DHSA 2DNKA 3SQGA 3J81j 3A1YG 2HG4A 2ZHOA 3LWLA 2D41A 2Y1JA 3I32A 2FZGB 5GAEU 3PNIA 1U1RA 2BE2A 2GO9A 1W25A 5KFLA 1RYRA 3MCOA 5MLCV 3NS5A 1FX2A 3Q23A 4A8KA 2B5JA 1Q7LB 4EO8A 1VS3A 4KKOB 4C8LA 2IMWP 2YX4A 3GJSB 3I0SB 2BKNA 3B8HA 5KFCA 3OTCA 3S01A 2VDIA 1JXLA 1QUPA 3J7ZT 5K8OA 1Y5LB 2BKPA 3VQTA 1NM2A 2A0FB 4DQIA 4WIQA 3GCXP 1RWUA 3HVRA 1IR0A 3EX7B 2E5IA 4CLZA 3H7HB 2FZCB 3TQEA 5MAOA 1MN9A 4QR2A 2MZSA 1AUDA 5DJBA 3KMQA 4K4XA 4RUHA 1U26A 1ZYQA 4QIGA 4DR5J 1JKHB 4UZBA 2ROEA 1GMWA 1MMNA 1RA6A 4I69A 4KPYA 2UXDJ 2RDJA 2KN4A 2RRNA 3DOMA 1ROFA 3BGRB 5HN0A 4MFBB 2OMOA 2ZDPA 2HS4A 3R97A 3V4IA 3IN5A 1FI4A 3OTOJ 3Q0AA 4NLRA 2H51B 2MQNA 1VMBA 3GONA 1TFWA 1U49A 2MQOA 4WU3A 1TP7A 2D3UA 4NI2A 3EDQB 3FK4A 4EEYA 1FT8A 3GE9A 2D7SA 2E44A 3POTB 3GCWP
chains in the Genus database with same CATH topology
2OPQA 4C3MA 3TW0A 1H0HB 3MWBA 3VAJA 2PI4A 3MM8A 1LFPA 2HHHF 3OL7A 3M32B 1ZM9A 3UPFA 1S9EB 2JX2A 2XHWA 2XSFA 5KFRA 4C97A 5HMXA 4ZP9A 1JJ4A 3DCAA 1Q4RA 2OSRA 2DTJA 4U7CA 2XMJA 2R9LA 5DRKA 1YIJS 1D8YA 3I6PA 1IXKA 2C3MA 2JHEA 3OHAA 2IM2A 1Z2ZA 3KLIA 4L72B 1FDAA 1TKZA 3UW1A 4DDFA 3JTPA 2MQQA 1VQ5S 4YR3A 4ECSA 3MR6A 5CYJA 4Y3CA 5A8KA 2J8AA 4HL9A 3VZHA 2IC3B 4J9NA 2XGPA 3ENWA 1IM4A 2P9EA 1OQ6A 3V4MA 2J0SD 2CQ3A 4YB6A 4USIA 1JMTA 3LP1A 2LDIA 5KFHA 2N3LA 3L7PA 4WE1A 2FHJA 2F3JA 1XMQF 3PX0A 1OIAA 5KFTA 3TOQA 3MAHA 1WHXA 5I3QA 2ZOMA 1KONA 1MROA 3NS6A 1U7LA 4ID5B 2N7CA 2ATLA 2KVIA 1Q53A 1WI8A 4OZ1A 2HFZA 3HHLA 3IA0A 4YP3A 1N33F 1GTHA 1RT7B 3F44A 4JI8F 4IFVA 2LQJA 3H98A 2OPPB 4HHJA 1T03A 4R5PA 1S9GA 2CQPA 2OFGX 3IS9A 3MGJA 4EZ9A 2RQCA 4IR9A 1UEVA 2HWTA 5F0UA 3GIMA 4NLDA 3OW2R 2Y0SD 5CYQB 2V94A 1HPZA 4C8NA 1MSWD 1GX5A 1VFJA 1S1XB 2VD3A 3T1YF 2R7RA 2M8HA 4RWWA 3PIPQ 1Y3JA 4LSLA 1SC6A 3B4MA 2V0NA 4P2SA 3H25A 2GMLA 4ITSA 1ZBTA 3MR2A 4C11B 1RTJB 2I1RA 4IDKA 5KFEA 2DR5A 3PY8A 1F5CA 1V3ZA 2RMLA 4R0JA 2F40A 3W7BA 1Q8LA 2WSFC 4TQRA 2LDYA 2XC9A 2ZJRQ 4DL6A 5B09A 1TQLA 1FRHA 3D5MA 3ZZRA 3HVAA 3HZEA 4Q8EA 1X4HA 1X4EA 4TYBA 4URSA 2AQ4A 3DRSA 3MM7B 3LP2A 3JYTA 3TAQA 1VRTB 3AJ1A 2H5EA 2HW3A 3DI6B 5H1SV 5E3PA 4UQGA 1C1BB 3OR1B 4NLYA 4H4OB 2AJFE 4NA3A 5F3TA 5F8IA 3PR4A 4QR1A 4DL4A 2KXHA 4FF1A 5CD4H 1HI8A 1F0XA 3LP0B 3SQGB 1IKWA 2EI5A 1U25A 1YRXA 1C4AA 5KFVA 3MM9B 2R7XA 1R8PA 1LW0A 2GFFA 4C0OC 1Y5NB 5T7LA 1VQ4S 3DC2A 1Z2LA 2YKMA 2BZ2A 2DCLA 2NXUA 5E3AA 2BE2B 1K1QA 2HQ3A 4ZPDA 2K1RA 2EFOA 2WSEC 1AW0A 1S1TB 3M2UB 3D0HE 3SDEA 1GTEA 4K4YA 2WK4A 1TL3A 1N56A 1W2IA 3TYTA 4QPTA 4J9PA 3N28A 3BREA 3D2WA 3IWLA 2ZD1A 3EPIA 2CPIA 3IR5B 1JNRB 2MGZB 4Q0BB 3FGVA 2DO0A 2FJDB 4I1TA 3TA2A 4WCEQ 1J2VA 2M5YA 1Z1ZA 2XS7A 5K14A 2LVWA 3H4DA 4LF4F 2ZC4A 5DLFA 4N47A 3K8VA 1T3NA 2RILA 3HVTB 3MFHA 4B9LA 3N5BA 5M2RA 3EYZA 4N77A 1RKJA 2J7WA 1OSCA 2J5AA 1HFEL 1WEZA 4E8UA 3FSIA 1EP4B 2KKHA 1RT6B 4C8MA 1WNEA 3BN4A 3FVYA 5FDLA 5LSRA 3EXYA 3CE8A 2GV1A 4WK3A 2E5GA 4B9TA 3JSMB 3QAUA 4DV3F 3RBDA 2DISA 3VWSA 2RRAA 3I31A 3DRRA 2K8GA 1K9MT 3JSYA 2ZZNA 1UVKA 3OR2A 5IS2A 1DLOA 4B3OA 2CZVC 2OAUA 3O6QA 1FHTA 2OTLS 2ZITA 2ZE2A 1D3WA 1R0AA 1KLMA 1NZAA 2R2UA 2KT2A 3V6HA 1NAQA 3WDOA 3DFEA 2XB2D 3HHLC 2B6AA 4H4KA 2DR9A 4PG6A 2DH8A 2V8GA 4O4GA 3W2VA 4HT7A 2MSTA 2CPXA 1BQNA 5L8RC 3BSNA 5D4NA 3KYLA 4DFMA 3IR6B 4I2PB 5DGBA 2PDAA 3GFHA 5D3GA 1JLGB 1T3OA 2YNFA 4RBUA 3M05A 4J9OA 1YGYA 1GAOA 3KK1A 2IM0A 4TXSA 3UR3C 2RKIA 2EK6A 5KFJA 1ZTWA 4OJ1A 3K59A 4BWMA 1KNZA 4X4UA 2MZTA 3M8QB 3MZIA 3SSSA 4QCLA 3AH6A 2M70A 2KO1A 2O01C 3CSKA 4A48A 4RBTA 1SJQA 1LV5A 4HH1A 3EZ5A 3HKWA 2DGUA 2L9DA 3FJ2A 4ZP6A 5EWFA 4QYZJ 2P9GA 1YBAA 2FUG9 4M8LA 3T6BA 2D1CA 3HLUA 1KR4A 5HBMA 1BQMA 3AB4B 3SZ2A 2B3TB 4NRUA 4HTJA 4K4VA 2CPZA 3MMAB 4M95A 1U2RA 2IM1A 3GFYA 1WEYA 1FE0A 3FSYA 1B7FA 4Z2XA 1U1MA 1NK9A 3O2IA 2M52A 2V8DA 4RW7B 3C2PA 2YWEA 5I4MA 4TU9A 1U1KA 4NZ7A 4K50A 2JEJA 2C42A 1JK9B 2LLZA 2X1BA 4TNOA 4ECZA 2GCFA 1WACA 2R7SA 2HMIA 2VL1A 2VFSA 2XWXA 3H5UA 3N6MA 4GC6A 3QJLA 2WONB 3VAFA 1S1WA 3PVXA 1FA0A 1R8HA 4M63A 4MK8A 3KK3A 4X62F 1LWEB 2FHKA 2NPIA 3UCZP 5CA5A 3OXGA 5J2QA 4LFAF 2DIUA 2QA1A 3FEYB 1SH3A 4QWDA 3FSXA 3BDPA 2MXYA 2YNIA 2ZNYA 3FRZA 1J5OB 1DQ8A 2G9OA 3DLJA 3L3CA 2RQ4A 4RX6A 2WSCC 2IAJA 2XMWA 2KJWA 3ONQA 4QJVA 2PGCA 2DNHA 2ZDOA 1VQOS 4ILLA 1IQTA 1U8SA 4G1IA 4F02A 1T8EA 3S8SA 5CYMA 2MZQA 5J1NA 3NRBA 1QY7A 3NMAA 1AROP 3B4DA 3RB6A 5KFNA 2CJKA 3MPWA 3CCVS 1JXEA 4UY8T 1KOOA 3KLIB 3NCRA 5HMWA 1VBXA 2KFYA 1TKZB 3GFZA 5D4PA 1HNXF 2EK1A 2B4OA 3L7OA 4MMOA 5C25A 3C6TA 4DN9A 3D0GE 2NSBA 5KFKA 5FD1A 4B3TF 2EC0A 3DOLB 2R8KA 4RNNA 4ZDNA 5A8KB 2AJ4A 1FRXA 1WD6A 4B9SA 4UY85 2N4DA 1GXTA 2HVZA 1Y3KA 3EGNA 3LP1B 4NYOA 1TKXA 4OI6A 5F8HA 2QRRA 4WE1B 3DOKB 1B0TA 1TUVA 2IVYA 3KG4A 3MPVA 4O4RA 4OZNA 4HKQA 1QVGR 2M0GB 4A47A 2HAIA 1MROB 1FXDA 1MMDA 2BYCA 4J9LA 3MD3A 3I5CA 3HP6A 4IO9Q 3CEDA 1WTBA 4C3LA 1DURA 1KTQA 2JVOA 1OO0B 1U2FA 4GO5X 4M1KA 3ZFVA 2JEFA 3RBEA 3HHLB 2ZH3A 3QJPA 2WOMA 2XCAA 4O3OA 5GAEI 2KHDA 5DLGA 1YHQS 3OFEA 4IFVB 5BYSA 4DHVA 2PFFB 4IH6A 4Q45A 2MZ1A 1L3SA 4R5PB 1S9GB 1C1CA 5A2QY 2JRSA 3IWXA 3IS9B 5LSOA 2DH7A 2FDNA 3HDSA 4K0KF 1CG2A 1TL4A 1V9OA 4XDCA 4QWCA 3DRPB 3OJUA 4C7QA 2IBKA 2AYEA 1TAQA 3TA0A 1HPZB 2E1CA 1NH7A 1S1VA 3TUZC 3HXMA 1APSA 3MHYA 1S1UA 1XR7A 4HI1A 5A6PA 4LSLB 3OJSA 2DR8A 3C8YA 3BZQA 2FHMA 4OX6A 4U9RA 2CQ1A 1F5BA 1HA1A 3GYXB 2VKRA 4NLTA 1FNXH 2HNZB 4KGKA 4KHRA 2QA2A 5G4DA 5A8WA 3CIMA 1NH8A 1Q78A 4IDKB 1M5HA 1OPZA 1K73T 4HVZA 1CQMA 2DB1A 2EW9A 2A1BA 1N5SA 5IM0B 1M5VC 2PMZD 2GIRA 2F1FA 4CI0B 1U48A 3OXLA 5CZXA 2EFGA 3CIZA 3G6VA 2B56A 4CTAA 3ZZUA 2EBEA 4JI0F