4NMLA

2.60 angstrom resolution crystal structure of putative ribose 5-phosphate isomerase from toxoplasma gondii me49 in complex with dl-malic acid
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
257
structure length
249
Chain Sequence
MNPQDKAKQAVGYFAVDTYVRSGMKVGLGTGTTAKFVVERIGQRMQEGSLKDLLCVPTSEATRKQAESLGIPLTTLDGIADLDVAIDGADEILPPTLGLVKGRGGALLREKMIAAAAKTFIVAADETKLVSNGIGSTGALPVEVVVFSGSHTKRLLSALPSVKRHGGRAEFRKRAGAAQEDIREEDRFVTDNGNYIVDLYFTETVPDLHEMDKELKSIPGVVETGFFLDLASVCLIGKADGSVATLTAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribulose 5-phosphate isomerase
publication title 2.60 Angstrom resolution crystal structure of putative ribose 5-phosphate isomerase from Toxoplasma gondii ME49 in complex with DL-Malic acid
rcsb
source organism Toxoplasma gondii
molecule tags Isomerase
total genus 80
structure length 249
sequence length 257
ec nomenclature ec 5.3.1.6: Ribose-5-phosphate isomerase.
pdb deposition date 2013-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06026 Rib_5-P_isom_A Ribose 5-phosphate isomerase A (phosphoriboisomerase A)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4nmlA02
3.40.50.1360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4nmlA01
2WU1A 2FGCA 2P9EA 5JJBA 1ZPVA 2NYIA 2DTJA 3OBIA 3OFGA 4X84A 1PBTA 3AB4B 3LWDA 3EB9A 3BXFA 2PC6A 2QRRA 4GMKA 1HORA 4TM7A 1DEAA 2ZHOA 3N0VA 3S1TA 4GO5X 1FS6A 2I9SA 2LQJA 3DHXA 3IXQA 2BKVA 3MTJA 4L5IA 4L51A 3TUJC 1JT9A 2O0MA 4L4ZA 2J0WA 4M8LA 5FIIA 2RI1A 1CD5A 1RWUA 1M0SA 2W48A 3LHIA 5HJ5A 3OC6A 3BXGA 3W7BA 3E15A 5IT0A 4L50A 3NRBA 3KV1A 3HHEA 1YBAA 2F8MA 3OFFA 3DC2A 3TUZC 3MWBA 2RQMA 3EFBA 3NZEA 3BXHA 3AB2B 1HOTA 5T41A 4R9NA 2MDAA 3OFEA 4LUBA 1Y89A 2JHEA 4IO1A 4L4YA 3ENQA 1FS5A 3BXEA 4L5JA 3ENVA 3CH7A 5IS2A 3K5PA 2JOQA 2R5FA 4R7TA 2J0XA 2QMXA 1YGYA 3E7FA 2QSWA 4OQPA 1LKZA 3MAHA 1Y7PA 3OFHA 4GO7X 2CDQA 1NE7A 2J0EA 2F1FA 1UJ6A 3CEDA 3ICOA 1O8BA 2BKXA 1U8SA 2H9ZA 4NMLA 2P9GA 3DDNA 5IT4A 2PA3A 1LK5A 2LVWA 3O1LA 4OQQA 3HN6A 2RQKA 1LK7A 2RE1A 3U7JA 2QMWA 1FQOA 3NWPA 2DT9A 1KS2A 2OKGA 2KO1A 2GNPA 3ENWA 3TX2A 3KWMA 1VL1A 1FRZA 3AAWB 1FSFA 1UJ5A 3TUIC 1XTZA 3LUYA 2P9CA 4TM8A 3IBWA 4PWUA 4GO1A 1PSDA 1UJ4A 3UW1A 3LOUA 2RI0A 3CSSA 3L7OA 3P96A 3DHWC 1SC6A
chains in the Genus database with same CATH superfamily
3RYIA 4LSMA 3Q4GA 1NJGA 3MEKA 2Q50A 4FF4A 4TMYA 1DPGA 1ZAWA 2EZ9A 4B3DA 2PMFA 5TE9A 1H05A 1W0KA 4PQUB 1ZGGA 4U4AA 2DBQA 1HNZF 2HNBA 2EJTA 5I42B 4YAUA 1U45A 4DLAA 3LPEA 1LFAA 4LDQA 3KAQA 4U6SA 4RMHA 3FKQA 2FW9A 4NP6A 4ZTUB 5JMOA 4I46A 4MDEA 5KVVA 3GRRA 2V0GA 1J5EJ 2H0RA 1JR6A 2FLVA 5CD4H 1KAHA 5BYKA 2XZTA 1MR3F 3UW3A 4L74A 5A0FA 4QIWD 2J8ZA 2IYZA 5KFTA 2Y8EA 3LMKA 2QR5A 3CZPA 4Q1CA 2AFIE 3O3CA 2W00A 3ZWMA 1A7AA 4IOMA 4OXKA 2ASYA 1RU3A 3RQIA 4KRWA 2NYRA 1WHSA 3MRXA 3ROFA 4YCDA 3L2OB 2JAUA 4GGOA 3ECAA 2WU1A 5AUQA 1RKJA 4LVCA 1PGJA 1ZPVA 2HFNA 1GD1O 2NW6A 5IM5A 2AJ8A 2DFPA 5DDRC 5FH9A 3O90A 4AJ9A 2CD9A 3N5BA 2C1XA 4JUZA 2QRKA 1BWEA 5KFOA 1NUPA 5C42B 1S1UB 2MKKA 5IV4A 1SIUA 3H3FA 3E5RA 4W6QA 1ZD9A 1KONA 2G25A 3TGPA 3MS4A 2GXAA 4CEJB 4EABA 3BF4A 1L5MA 1M8PA 2Q2OA 2UZ1A 1QPGA 4XQGA 4QLAA 3ECCA 1CULC 1JILA 4LF5J 2B2XA 1SOUA 4QUAA 2EFVA 3L04A 1ZS9A 1I5RA 2PUVA 2IOYA 5BMVA 2XQKA 4CDGA 1KQFA 4E2FA 4CWBA 4OJMX 5GJCA 4JYAJ 4RPKA 3FWZA 3EDRA 2IYXA 1AXEA 4PWDA 2HSGA 1T02A 3Q9LA 4C03A 3N0WA 2ZI6A 3VHLB 2XYPB 4O0IA 3H5IA 4EEKA 2CY0A 3W2FA 2KBFA 3CC8A 4RHTA 4O2BA 2ZKTA 3ROEA 2Y93A 3W61A 1FTCA 3D02A 1BW9A 2R6AA 4JK3A 3HNOA 2Q0XA 2XCLA 4TTIA 2FPSA 2AKYA 1TJ4A 4LJ8A 3O8LA 4D3YA 4RZHA 1L5NA 3TMAA 4KV8A 3JB9k 1CRWG 3OTWA 4JOCA 3FBWA 4E1VA 3EXFA 4ZYXA 1IYZA 3ELYA 4JSTA 1J5OB 1M5PC 1P75A 4YIKA 5KQGA 4ZK7M 2D5LA 2VTDA 3T1HF 5AW8A 3N8GA 3KR2A 1SR8A 4PC3A 4Y9SA 4UHDA 3N05A 2IYIA 5C51B 4A6EA 1JX6A 1RLJA 2QLJA 1PDOA 2J5BA 1GG5A 4DFJA 1B3RA 1MB0A 2AR9A 2HAIA 2NTJA 4RD0A 4N6GA 4WFBQ 4K6OA 4HVTA 1FFEA 4BWVA 1G7CB 1H0RA 1T2NA 3Q72A 2AUTA 3UWMA 2PZGA 3BPDA 4N7RA 3OX1A 1ISRA 1GSOA 2JGDA 3G2KA 3C6UA 1EDOA 1N8SA 3DHYA 3QSYA 2CLSA 1SI9A 3KYDB 1E79D 3QU7A 4CIAA 5D0RA 1MSWD 4F0MA 4QR2A 3ZHRA 5I7VA 1Q78A 1J8YF 2YL2A 4LHZA 4CNZA 5EFZA 4MQFB 2I6TA 4OUKX 2OD9A 3OFFA 3Q2OA 5AKHA 4DLPA 2G0TA 4YBZA 4M8KA 1MAUA 3LOPA 2BR3A 5GZ3A 2O3QA 4QOHA 1G0OA 2R7SA 1VBNA 1U9CA 4FX5A 1SVLA 3OJWA 2VICA 3J81Y 1ORVA 3VU8A 1WG8A 1A9SA 2WHEA 2J85A 3UCUP 1W26A 1D0EA 4AJJA 3T6BA 1MOSA 3HZEA 1V26A 4US2R 3DO6A 1XCBA 1OYEA 4ZXPA 2EKLA 3LL4A 4G1UC 5D4PA 3AESA 2OCXA 3C7DB 5A6PA 1XX6A 1XZQA 3FCHA 3LHKA 2CN1A 3OSPA 2JRCA 1IR0A 2HNZA 3EZ5A 5F2NA 4GLFA 4B82A 4HMOA 2TSYB 4UEOA 3DYAB 1O0CA 2QN6B 4O23A 4P32A 5BW6B 5A71A 3VHXB 5CX1A 3R09A 2CPDA 1X7YA 3EXEA 1F2TB 4GOXA 3RSHA 5A9SB 5DYIA 1JDZA 1BE6A 4DCNA 1I0IA 1YR9A 1NJYA 3SIPA 4XAQA 3E8XA 4DZRA 2X76A 3NEYA 4PX2A 2ZBRA 1YUNA 3C8YA 1WO8A 3X1DA 1V3SA 4H1UA 1OLXB 2SHKA 2C61A 1U2SA 3FZYA 2BFEB 2CVFA 3FZEA 1GAJA 2H4WB 4QDXA 5IMSA 3QWHA 2VZEA 2VYVA 3HCFA 4CFZA 1HTBA 5C32A 3QGIA 2JZNA 2VHEA 2PJUA 3M49A 3EXG1 3RU2A 5MN6A 1R0AB 4WGGA 3WP0A 2NU8B 2GA8A 2O3JA 3RJ9A 1KO1A 1IPEA 2G3YA 5E4YA 4QWCA 2HJ9A 3T3GA 4HI0E 3T9EA 2ANCA 3PXGA 3UKDA 3NBYC 3JR3A 2KT5A 3QEJA 3DM9B 1FSSA 1C1XB 4LQLA 3ZNQA 4V0MA 1KXZA 4X4NA 1C1CB 2HCFA 4EA6A 5DBIA 4YDHB 2LD4A 3BZQA 3O6VA 1S01A 1QYIA 1I33A 4N41A 1UA0A 1TKAA 1X9MA 2FMIA 4MW2A 4K6KA 4LE0A 3UJ7A 4ESVA 5JXSA 4HF7A 5A0VA 2O6HA 4YMTA 3HHDA 1FXWF 2ZTHA 2LEAA 2TMGA 2W01A 4ZVEA 3RWMB 1AS2A 1ZAVA 4RVGA 1RTHB 1TVRA 3ZYCA 4F92B 5A7FA 4LVNP 3OEHA 1S12A 5IT9U 4DX6A 5JRZA 3P5BA 4ZHRB 4X44A 3QHQA 2QD2A 2F7SA 1JHQA 1GTMA 4YR0A 2CFXA 2LEBA 1RXVA 1VI5A 3FGVA 4HFRA 2WZQA 2EKDA 2IXBA 3BBPA 5I9IA 4I5EA 1AQLA 3AQOA 1A5TA 1B16A 3IN5A 4FXVA 3QLJA 3UJBA 1A9ZA 1UBOS 1BA3A 4QIGA 2OECA 3NBKA 4N49A 3FTNA 1RYMA 1R6UA 3NJRA 1RXWA 4IR9A 4BLRA 4CRJA 4WY5A 1EE2A 1M6EX 3QTBA 2HLDD 1NPTO 2JRLA 1RKUA 3CT9A 2Q49A 2M6KA 4LJKA 1U1PA 3KSBC 1YS7A 4II2A 1X7HA 1UAWA 3QFCA 4K3VA 3DMDA 4R9VA 2X3DA 3KJVB 3W6OA 1J70A 4NBUA 1D9AA 1Q0QA 1HKHA 2Z57B 4EEXA 2NM0A 4NH4A 4XVCA 2QMUA 1ISHA 2WJ3A 1W4AA 3IEUA 2AKWB 1C7FA 3EF3A 3B4DA 2CUKA 4EB6A 3BG5A 2VDWB 4OQ4A 3JTNA 2GK4A 2SXLA 4KACA 3U1MA 2ZB2A 2HGLA 1GPWB 1KTQA 1EK6A 5BR8B 1KMIY 1HLDA 2RGBA 1RZ3A 4KQMA 1G20B 2BE9B 1Y6QA 1EJ2A 4PTYA 1QUFA 3FSJX 3ZGNA 1QLNA 2HQCA 1GAOA 1S1WA 2OHJA 2BZ0A 3R27A 3Q8PB 4NX2A 4BNWA 4GMGA 4YT4A 5K3CA 5KFLA 2EZTA 3UO8B 1HHSA 2OAQ1 4OQXA 2CZCA 1AGYA 3PO5A 5AVJA 3IXQA 3CG0A 1TK5A 2C3MA 1R8HA 4YFYA 5C2GA 3QFTA 1LPPA 2M4MA 2HRUA 1EQUA 2YJ6A 5FUVA 3RAQA 2B6AB 4X4RA 4K9QA 3QOFA 1DURA 2DAPA 4ZVQA 3RVLA 4IDBA 2GLXA 3EEYA 1IULA 3EFBA 4P6QA 6CHYA 2Z3ZA 4AL5A 5AVTA 3DE7X 3KZNA 1AKYA 3BT7A 5IQ6A 2NSDA 2QP3A 3SAJA 1ZGAA 2BUNA 3QUAA 3COZA 1PGNA 1T43A 2ROEA 4FNOA 4A1OA 2LIVA 4MYRA 3HXLA 4C0LA 2H57A 3PGMA 1VA4A 2X1GA 4DV4J 5DDPC 5DCLA 1W49A 4XTCS 3PPIA 1P7CA 1YASA 3KK2B 4B80A 3QM1A 5HE8A 2I4MA 3KOXA 1T03B 2Q3HA 4RVCA 4KO0A 1YTYA 2MYPA 2FPPB 4H1VA 2ZFHA 3T7IA 2Q8PA 3W2WB 2Z4RA 3WSTA 3MJHA 2Q4TA 4DSAA 3BGRA 1YVRA 3LLUA 3T5DA 2QAIA 4RADA 3VAYA 3NWJA 1HDYA 1YHZA 1SIWA 1ZIYA 2DUUA 4LZPA 3STXA 3EF0A 4LRAA 2P41A 2COUA 4MICA 4PHGA 4COKA 1UVIA 1G7SA 3BA6A 2VONA 1PR9A 2R5WA 4HI2A 3KLGB 2W90A 3N4WA 1PEKE 1K7EB 1OY1A 1PT5A 5EKSA 4J0JA 3V3KA 5LMNB 4ES3A 2ZE7A 2BFDB 4RW7B 4M9XA 5BOSB 2ZH9A 1TQDA 5HRAA 1RT6B 3AF1A 2BHNA 4YQWA 3Q7PA 4RUKA 1Z38A 4DCCA 5CDYA 3OR1A 1BJTA 1GKKA 1SPXA 3L4KA 4UUOA 3QBTA 4QZVB 2EYUA 3UXYA 2YVQA 4NCGB 2GZRA 1S2GA 2UYQA 3VX4A 2JFKA 3WWOA 1CF4A 1HKUA 2FSUA 4WNAA 3OIGA 2PT6A 4UBJA 5CNIA 4WJLA 1C3JA 4OSOA 2YQ1A 1B0PA 4B3BA 1VCIA 4FYHA 4FWBA 1ZBQA 5KAKA 1Y7IA 3AVTA 2K1RA 2XDYA 2ZTSA 1F14A 3DOMB 3MEGA 1AIPA 3EXIB 4IJVA 1V7QA 3L5KA 3I4CA 3HJAA 3M7VA 4C7KA 4L72A 5KT2A 5EN1A 3OD5A 3FKJA 4ND5A 1K27A 1T5IA 3SI7A 3AP3A 1JLAB 4JU8A 1X4BA 4YQZA 4N6OA 3M2TA 1QGUA 1FSFA 1CP2A 3MWEB 1Y63A 3AUXA 3EZ2A 4KPYA 1ECCA 2F6RA 3AEKA 4Q3CA 3EM1A 1MB4A 2XE7A 2XC9A 5A4JA 3TJAA 3ZUGA 2PTHA 4XUEA 2I2YA 1UKCA 1RTJB 1SCUB 1ZKDA 2EGGA 5KDDA 2FHMA 4PS1A 1WY7A 2R1ZA 3GY0A 3R0JA 1GL6A 3CPHA 2C2HA 4IGAA 2CC2A 3H5XA 3L7CA 4UM9B 1F6DA 2F4VB 5KOWA 2Q9CA 2C9ZA 2CMDA 4KAXA 3MAAB 2YOFA 4KB7A 2MSTA 4YS2A 4NYJQ 3E7XA 1E79A 3WYEA 3AJEA 2N4CA 4TZKA 2IXTA 5JXGA 2IXAA 4LF4F 3F6PA 4O1IA 2BT4A 3A4NA 3KVOA 5CXQA 4L02A 4FFMA 1XA4A 3T7SA 5B1HA 3TNJA 1Z56C 1C7QA 1IXYA 2I91A 1HPLA 3KUUA 2CV0A 4LF9J 3OHAA 3K1ZA 3DAGA 2NUUG 4YRPA 1V11A 3BIJA 3ZWYA 4NMXB 1Z36A 4LQ3A 3BSWA 3ZJTA 3RT7A 4I3GA 5F8LA 5HILA 2J6CA 3CVWA 3AM5A 3FHOA 2XMQA 1ISGA 3IURA 3BH0A 1K8YB 3OZ7A 3CW8X 3FAKA 1DZ5A 5DNCA 4URHA 1YZYA 1PNOA 4GKVA 2C94A 5F41A 2KG0A 1X94A 2VOPA 3S6JA 4DA6A 4MWOA 3O8WA 2O3DA 4HLNA 5K6AC 1R88A 7MHTA 1CULA 3BO4A 2DYKA 5LKRA 5AI9A 4G0QA 2IE8A 3FSIA 4R1SA 1U7ZA 4RZUA 1PT6A 3PC4A 4PLZA 1GTG1 3G5MA 4YRTA 1U7UA 2QRPA 2IF0A 1XVLA 3F9CA 1CLUA 3VNSA 1U8WA 1YZ6A 5CYJA 1KEPA 3QJJA 1JIXA 2RS8A 3NEJA 1Y4ZA 5JXWA 3L09A 4LUBA 4CKBB 2HLHA 5L6LB 1R7IA 2XLJA 4GPBA 3GZ4A 3Q41A 4NU8X 4ECWA 1T0HB 4C8LA 4LV6A 4W5HA 2DBZA 5LM7E 4NA3A 1XERA 4BGUA 1H73A 3NBMA 3PL5A 1NQTA 8ATCB 2D5BA 1MQ9A 3ZDCA 3NI2A 5IHXA 2H1VA 3HSGA 2IJNA 2A9PA 2ABWA 3IIJA 2BFMA 5J2UA 4WFZA 5GAEU 3EVWA 3SCLE 2VJUA 3QTLA 3M2VB 3B6JA 4MYUA 4I50A 2XUOA 5IVHA 1H6CA 3QFSA 8AT1B 2QN7A 3PNYA 3QWIA 1RAFA 1G9SA 5HATA 4AJNA 4FYJA 4DLEA 3II6X 4NULA 5JZSA 2AA3A 4PV7A 3UH0A 1U8CB 3I8XA 1BXRB 2Y1LA 4KE9A 2GZOA 3EX7C 3ZNNA 4P75A 4YJ2B 3RHZA 3FQLA 1VRVA 4DLKA 1S0MA 1BMDA 3SKYA 2VKQA 4LDPA 1AKTA 3ZJYA 2QLFB 3JRXA 1YV9A 4M0FA 1J9GA 1XMVA 3IDQA 3N70A 4RMGA 3ITDA 4O4GB 1GIAA 2LKCA 2XWPA 1P19A 4D5GA 4W63A 3G9QA 2R6FA 4HTFA 4M0PA 3M30B 4J1TA 1PJLA 4DWWA 3OCYA 1IUNA 1ZRHA 1NNDA 2ZATA 5TPZA 4KVAA 4PICA 2DNQA 1JEQA 4WHMA 1E7WA 3M4XA 1YB6A 4DCMA 3UKOA 1JFTA 4BPBA 3W6NA 3SY8A 1J09A 1QHHB 1WD6A 3L5OA 4Q1DA 3I4LA 5H1YA 2QRHA 4AB1A 2C7OA 3KLOA 3KFXA 3UWKA 4EDFA 1URNA 2VDLB 4JBCA 4IVQA 5KYTA 3BH6A 3D0OA 3W5IA 5EIOA 5D1HA 4JN6B 4WZAE 1JKFA 4X62J 1DIHA 4DG9A 4B8WA 4R1QA 2I99A 1E1CA 1I3MA 1AQYA 2VFAA 1UJCA 5ETJA 4E0DA 5DT9A 2HHPA 2QTFA 1QYXA 1RABB 2HA6A 4PZCA 3T5KA 1D9FA 3CNBA 1W85B 3M82A 3P32A 4ML3A 2CPHA 1U65A 2LKDA 5BUCA 1RT7A 4MDHA 3VR2D 1JEDA 2FMTA 3I82A 3CF2A 4LFBB 5D8HB 2D5IA 2JLYA 4OYOA 5JAZA 2H1FA 4QVKA 4USWA 1NRJB 3EDQA 2XMBA 4YJ3B 5GAEI 4YXFA 2ALYB 2AQ4A 3BYRA 4EKNB 2POKA 3VTIA 3PD0A 1H3EA 4TV9F 3AEXA 2DR3A 2NSHA 3MTQA 3TM4A 2YHIA 4F71A 2VPZB 3AR5A 3AXSA 3WBJA 2BPOA 4U7UK 3MAQA 3LSTA 5KB3A 2RDMA 1O0BA 1WF2A 3GROA 4NI5A 3AHJA 5HXAA 3WHPA 2HPZA 3I5YA 3H3XA 3RC8A 2VT6A 4MKHA 3WK6A 1SXHA 2QY6A 1XNQF 3BV8A 1JR3D 3AETB 1VI6A 2B4QA 4BEJA 4BZZA 5K20B 3QIVA 1M7BA 3LW5C 1XR7A 2V6GA 1A5ZA 2AFHA 2FVYA 2XCRB 4G5FA 1T34A 3L8CA 4TKUB 1F60A 3IUBA 3R1HA 3RSQA 2XUQA 4XPEA 2D1CA 4MKGA 2J3JA 4YAJA 4RK0A 5TPWA 3IUYA 3P9CA 4N48A 2AMVA 1ZH2A 2UUAF 5ALWA 3CTPA 5ETTA 3C6XA 4LJYA 3WYBA 3QP9A 3DLKB 2ET6A 5ERGB 3ORFA 3CF5Q 4U7JA 3FBCA 2IS1A 4X45A 4EM6A 4ETNA 5FLXA 4CMEC 2C78A 3EIXA 4QTXA 5DX8A 1V9LA 2VLBA 4F4JA 2ZOMA 3LUYA 4EGSA 1XWFA 2V5HG 3UT6A 3U3ZA 3DKIA 1UJNA 3CMCO 1DKOA 2IYUA 2B7BA 3UIEA 4JI0B 1VLJA 1YJCA 4ZT5A 2JC0A 2SKCA 3U17A 2LRHA 3U49A 1DC3A 4MITA 5ALFA 1KVKA 3DOLA 2PLFA 2HPAA 1IU9A 1Q95A 9LDTA 4LHEA 4W1SA 2I6UA 4B8YA 3TVKA 1AKQA 5KTQA 5AI6A 2H31A 4I81A 4UNNA 4MH0R 3I4FA 4PYLA 2NU6B 2FCAA 1AZTA 1BYIA 1VFNA 4Z6KA 1EESA 3MK31 1IM5A 2A92A 5DHSA 3OL8A 3ZG6A 1IBMJ 5JCXA 2PGLA 1YKFA 4YCJA 4AJKA 2N47A 3B9QA 3DVLA 4H4EA 1XHLA 1K7XB 2I2AA 4B75A 1N2HA 5D15A 3FKSD 3DFZA 4PLHA 5L3QA 2ZWAA 2EVZA 1G5TA 3FYSA 3SFTA 2DNOA 5T3YA 4Q43A 4XPCA 4MR8A 4M0MA 3OCZA 2WVDA 3ZZTA 1EHCA 1QS0B 2QVYX 3JQGB 4WBNB 1UBJS 2W2LA 4L08A 1N2BA 4JUAA 1WG4A 2I3ZA 4B5KA 4LWZA 4QX6A 2OV4A 5K3FB 3UNYA 4BBAA 2IFXA 1QMGA 5KWEA 1NVUQ 1IOVA 3LXXA 3PQFA 2QRZA 3PJRA 3IBCA 2FUG1 2AOUA 2BHTA 2B21A 4FD2A 3HN2A 2W9BB 1QSGA 1R9NA 3EGCA 3WTBA 4D96A 5HLFB 1N6NA 1UDAA 2IYVA 2ZRGA 3KWFA 4O4IF 3K0KA 1Z0UA 3S6EA 4UC0A 5HR5A 4KSYA 5IDWA 1JJ7A 4E22A 3VPXA 3KDOA 3D3BJ 2FZKA 1Q0PA 1VQPS 4FSDA 3CISA 2QEQA 4EG3A 2C7VA 1RI4A 1CQIA 3JRWA 1X1SA 1U6IA 4U96A 1SJQA 3BKFA 5JAHA 4NJEB 1Y11A 2MQNA 4CF6A 3O8DA 1T9WA 1CLFA 4MGKR 4M88A 1V3TA 4XLZA 3CVOA 5AK6A 3R76A 1FWPA 3FCEA 1C30A 3I9KA 3MRVA 4U2EA 5IJ9A 3WQSB 1KYZA 3I3OA 2AGVA 1CJUB 4LOAA 1X80A 1ZTWA 5F3TA 5HQJA 3O38A 4HYQA 3VR6H 1LFDB 2G72A 3DRRB 3EOZA 4W7IA 3SQOP 2H2FA 1T2DA 1DEXA 5B4VA 1FD2A 2O8BB 3F56A 3KBOA 5T7LB 4ZI5A 6REQA 5L1JA 2CNLB 1SCQA 3F0TA 4XIIA 3D3KA 5EJGA 3EPRA 4YJGB 2JCXA 5IXJA 1G21E 3KPYA 5HK9A 4P34A 4JCOA 4DR6J 1ZH6A 3J7AC 3B1YA 4R8MA 5A1TA 5KOJB 2SNIE 4C2TA 2J1LA 1RQLA 3WWEA 1BCSA 2ODBA 1Z0SA 5LDHA 2M2IA 1NK6A 1QCCA 2C9CA 4C6AA 1RACB 3BQ0A 2DMRA 3OE4A 3COJA 3F4LA 2IVYA 4HRVA 1NBAA 1WEKA 1Y1RA 4KUHA 3M8QB 4YIHA 1YZVA 2HQGA 2X0RA 4I6EA 1O6BA 6ABPA 2QTVA 2X4IA 1YQTA 3I6MA 4NAUA 5CDTA 3EJ6A 2OD6A 4ZO9A 1EFUA 3SHTA 4QREA 1YZ7A 3AOAA 3OIYA 4PY2A 1Z4NA 2Q1LA 4INZA 3O3OB 5I7HA 1YGPA 2DNGA 4DJTA 1Q4RA 4ZT3A 3L8HA 1M2WA 1M6VA 5BNFA 5DI3B 1U8ZA 3C3KA 3IKLA 1SAYA 5AVSA 4JBYA 3JQAD 1N3LA 1HDIA 4MRMA 2HKEA 3OO1A 4PM4A 5L51A 4PLFA 5BOVA 1LKZA 2YDYA 3PW0A 4MS1B 2I6XA 1ZUWA 4JJ6A 3L1HA 2B51A 2GBIA 4W6ZA 2E9ZA 4AYBD 4NTZA 1Q8IA 1UFQA 2PJZA 4D6XA 1OSDA 4U63A 4EATA 5M2RA 1XPRA 1XKLA 1D3AA 3KPUA 5LQRA 5CFPA 2HDHA 3QLTA 4J16C 4F7WA 1DG1G 4ROTA 5LD2B 4QT4A 5LP6F 1U6BA 3AB4B 3HDVA 3GP8A 2NP6A 1VC2A 3OPYI 4DUGD 3TNYA 1JJ4A 5BVHA 2I2FA 1T15A 2B8NA 2WIGA 3FCXA 3LP0B 4I1PA 3UVJA 2UVQA 4CIDA 2XQJA 3QPCA 3RUCA 3SC6A 3ZUPA 4P72A 4PG5A 2RMLA 3V6DB 4YO7A 3QEAZ 3H84A 1GAXA 1Y9AA 2ISCA 3UJ8A 4RORA 1T9CA 5KSWB 4WIIA 1BVRA 3DEHA 4KXNA 1U6KA 1JJFA 3NTRA 1UP6A 2C2MA 2O6LA 4G4SO 2A7QA 3KLPX 4OQJA 3TQFA 1U2CA 5D01A 1W0KD 1FZQA 3OLYA 4I2QB 5U4XA 4X6XA 2I8CA 4H7IA 2J9ZB 2F3UA 4QU5A 2P2CB 2Z1NA 4PYIA 5TQ2B 3ZI0A 5K7SA 2XNJA 4NEYA 1EFDN 4F5EA 5AMXA 4BTVA 4CH7A 5GM1A 4KBYA 4MCAA 2HL6A 5EXTA 3GWZA 1JXOA 2QTWB 4D8YA 5IVIA 3GCXA 1UKVY 1XEZA 1AXRA 4RFSB 4YRNA 3CNQS 5C3MA 4BX2A 3ORRA 5DQIA 1V4BA 4ZJOA 1P5HA 2R7KA 4DADA 4DCGA 1SBQA 4P0PB 1TUWA 3IFSA 5D3GA 4IUYA 4H6PA 1BMQB 2R8KA 3TAQA 4UQTA 4FDAA 4NONA 4BU1A 1VDHA 1MWZA 1W1IA 5K6AA 1ZONA 4MJXA 4DUTA 5DDQC 2Z95A 1A50B 2ZDOA 4IIEA 3BJRA 4ZT2A 4YRAA 3VR2A 1Y82A 2EBGA 5IT4A 2WLTA 1SRQA 4WLNA 1KHTA 1Q7LB 4KGDA 2IAJB 1N9KA 3GUHA 5BRNA 2X3FA 1JLRA 4OK3A 4RZXA 1KE1A 1QHIA 4BBYA 5DE3A 2AU0A 3NC1C 3FK4A 4B3MJ 1K8RA 1QZXA 1E1LA 4FXOA 4JI2B 3NOGA 5AXCA 2V7VA 2OV3A 3WLMA 1A98A 2Y9HA 3SBEA 2J7KA 1OXKB 4IKOA 2P9FA 3BA1A 4L5CA 4LSWA 4EFAC 1XMPA 2R6ZA 4IHJF 3VALA 1EVQA 3GFXA 1XRRA 2P5YA 5FJIA 5ICSA 1JQEA 3ICWA 5JJKA 1CQXA 4CV2A 4FFVA 4EQZA 1PR1A 1W34A 2HCRA 5BT8A 3MN1A 4TQRA 1RHRB 1XAHA 1M2GA 1Z74A 4YMUA 3L93A 1QHSA 3VR5A 4LCJA 4Y0FA 3ESQA 3U6KA 4EI9A 3ZBQA 2IUSA 1Z3IX 1DJQA 3EPIA 2WRZA 4EO7A 2GHVC 1KVSA 1TK0A 1CJBA 4ZGGA 4ZODA 4G63A 5LQMA 1M8GA 1QKIA 4LISA 1R37A 1VPDA 1AUVA 3EBOA 2ATCA 2ID7A 4YROA 2PMZD 3EXAA 1NB2A 4XM0A 4TV9B 3I0ZA 4D9KA 5JSZB 5DM1A 4D4HA 4GKKF 2X8JB 1MF7A 1SXLA 1UBFA 5BV2P 5AKYA 3V2IA 4OD0A 4NRUA 1D1UA 2QM8A 1NE2A 1XZBA 3LU1A 2HA0A 2JAOA 3SFUA 2GM3A 5AYVA 4E2YA 3QBVA 3QX8A 4Q1EA 4HDAA 2CPEA 3KXIA 3E61A 5JTUA 1PF7E 4USIA 2XNKA 1U2QA 4CLFA 1ZR2A 1YDHA 4R5PB 2ZU0C 3AY0A 5I4KA 3LQ2A 2BH9A 3TLGB 5JDIC 1WVMA 1ZGCA 5HROA 3PDIB 1JW9B 1NUUA 1Q53A 1IB0A 2A0YA 2GHQA 3JYPA 1LF0A 4E4TA 1YVFA 2NZ2A 2Q99A 2CE7A 3UAZA 1PC4A 2BONA 1KOOA 4Q0BB 4JJAA 2AWOA 3K6RA 2UUAB 3IVCA 3UXMA 1OIAA 1EX1A 1S4QA 4MK9A 1I0ZA 1TYEB 2PVPA 3LPDA 4YGXB 4C4YA 3UR0A 3A6KA 2FJAB 4KYUA 4GH5A 2IZ6A 3PEYA 1O9GA 3POTA 3RRFA 1U2GC 5ETVA 3FKSA 3AUKA 2H85A 2F1OA 4X64F 2MIIA 5EOVA 4OXYA 1JDUA 4OYIA 4L6CA 2DR6A 3MWYW 4N03A 1XD2B 1QRDA 3GAZA 3UG7A 3L95X 3IVXA 4JGIA 3DLBA 5ALIA 2KH9A 3FVTA 3ENNA 5BXIA 2HM7A 2BFPA 4YCAA 1FVQA 1CRPA 2Q2QA 4H7JA 2ZSHA 2L42A 2G40A 2PGOA 3I04M 4P35A 2ADBA 3MHTA 3QHPA 1E2GA 1VRTB 1U0EA 3JYQA 2CXXA 4GS5A 4ITVA 2AOWA 3OQMA 1H7WA 3J81A 2DGVA 3AHHA 2KX7A 5I3PA 1IQZA 3BDVA 3F5SA 1T0BA 3OQHA 3I23A 2G71A 5GM2A 3KMSA 3ZQ6A 1QZ3A 1QSYA 4I6GA 1VE3A 1FXSA 1XRQA 2RKIA 3TH5A 3OTIA 4K9SA 1RRPA 1DLOB 3TIXB 1IKYA 1Q84A 1ZEMA 3CW9A 4YUDA 2MHNA 4D9NA 4A16A 3BXZA 3I6PA 4W9RA 1BC6A 2XMDA 1MIOB 3VV2A 1G3UA 2B8PA 3L77A 2EFDB 3R20A 4CV0A 1NVXQ 3AVQA 3TZWA 4N3CA 2PSFA 2WWIA 2EZUA 2WBMA 2G80A 1Z68A 3W77A 3RV3A 4Q7JB 4H4OA 1YDMA 3VJKA 3TZEA 2IHTA 2PO7A 3K70C 1MNQA 3SYMA 1C7ZA 1EK1A 2DT8A 4CMEA 1R3UA 4DR5J 1TM1E 4LJRA 1ILEA 2J0WA 3V6LA 1NKSA 3C8DA 4AZ3B 2BMDA 1XNGA 3M05A 5I3QA 3KETA 1H85A 1TKCA 1EGHA 3OMWA 3IIIA 2ESRA 4CT5A 4NCXA 4IIBA 1JYEA 1T4CB 3A4YA 3TEGA 4X20B 4KQKA 4JZYA 4RWZA 3WKEA 3MMCB 1HXHA 1I1OA 3PFFA 2YASA 4N8SA 4WLVA 4MFBA 3TA2A 1VJGA 1YA8A 3BMQA 5EQFA 5F73A 5E41A 3IMCA 3W1EA 4EX6A 2ZIXA 2ZYIA 1EVEA 5DCUA 2LE0A 4O4IB 2A1IA 1NN5A 3JRNA 1EB9A 5DGBA 1U47A 2B1IA 2O23A 2HW3A 3P2OA 1XDBA 4DR1B 1X2EA 2OD2A 4KMSA 1I2AA 2E4ZA 3DWEX 4J8PA 2HBYA 2IP2A 5GGXA 4NLTA 3N0RA 3IALA 4BMYA 4J90A 1JV2B 2PWPA 3K8YA 5K05A 2DP4E 1I7SB 1BLUA 4D4MA 3C6ZA 3QBJA 3QF4A 1KK0A 2XVYA 3EWSA 3I2HA 4G3IA 2Z58A 5I9TA 2RGYA 2FEOA 5J1PA 3SHQA 2W2NP 1XZ8A 4XDZA 3IXMA 2C4WA 4DOZA 1N2CE 3J81k 5B12A 5KFYA 2X5XA 1F06A 3WIVA 3VBCA 1E1QD 1IM6A 3Q3VA 3JSXA 1L4UA 1DCFA 5J4VA 2B4YA 5C46F 4CCAA 4C4ZA 2VC1A 1YRQA 4UAGA 1TYAE 5E3PA 1FFSA 4K4YA 4IIJB 3MOSA 3GMSA 3GHHA 1IL0A 3R40A 3HUFA 5EHZA 3JQAA 2EWVA 2ZBFA 3SR0A 1FFAA 3MWDA 2HIGA 2OKGA 3I28A 1HNIA 4QKQA 2QZPA 2RU3A 4D3FA 5CB0A 3KHSA 3GGCA 4BKMA 3FTQA 3PLAE 2B8JA 5CA1A 3IEKA 5D78A 2VDVE 2BJ7A 5CRIA 1JNYA 3RRHA 3PE3A 1C0TA 2H1WA 1S5ZA 3R6WA 4Z7NB 5KYYB 2Q46A 1YCHA 4GVXA 4HDRB 3IH5A 2AGQA 3EDOA 3IQDB 2YV3A 1UWLA 4EP1A 3WWZA 1O7JA 5GIPE 5KTOA 1SH2A 1GVHA 4GOKA 2WF8A 4R5HA 4NPHA 3DBHA 3KLHA 2DFNA 3W06A 4CGYA 1TF7A 3F1KA 4Y98A 2XR1A 4FFRA 4F5YA 1KQGA 2QTRA 4XYGA 1E2JA 3DRPB 2L69A 3L0BA 2B3TB 3H2BA 2HQSA 1KQOA 1R4MB 2Z2YB 1VMBA 3PW2A 1RAEA 3K70D 5JRJA 1UBKS 3TYTA 1ZRMA 5BO5A 5JHHB 3HU1A 4TXMA 4E4RA 5JH7B 1OYDA 2Y4OA 5BSEA 1E0SA 5EUBA 4KITB 5CEJA 4P2XA 3OSUA 2CNBA 4O4JB 1W88B 2PL5A 3FPAA 5G53C 2ANBA 1F9HA 1UZAA 3TLEA 3EZ9A 4GVBB 1SHZA 3M6VA 5EZQA 4IY1A 4YC7A 4PG6A 2VTBB 3ROKA 1P9NA 4BNKA 5DM7Q 3DBVO 4LHYA 5JW6A 2ZB8A 3CWJA 1U3CA 4LMRA 1UKEA 2XSFA 5ALVA 3UYLA 4C6TB 2VP0A 3PTAA 2VZ9A 4HWTA 1T9GR 5DIFA 1NN0A 3D7NA 2JEGA 3TXAA 1E4EA 2GAJA 4CZ2A 5HK4A 4K50A 3S7ZA 2ZCJA 3RK0A 1MMFB 1TFUA 2DEIA 4P5DA 3PJGA 5AVUA 2DTDA 5DTQA 2XHZA 4EVRA 3D8UA 2XTZA 1PRYA 4H3HB 3MTKA 4AJ1A 1ISIA 1VJRA 4DF3A 3T7TA 4Q8EA 3BJZA 3PR2B 2PA0A 5CYQA 5MN4A 5F5XA 4Q9AA 4PNPA 5L1KA 3GZ7A 5BN4B 3PT5A 5ALLA 3KT0A 2VT3A 1VCTA 3ETJA 2MSLA 2AFIB 1IN4A 4ADSG 4UDYX 2YUIA 4YHHB 2V6JA 1K75A 3IBTA 3AI7A 1Y4SA 2DKOA 1SB8A 4KDRA 4I1OA 3RH0A 4UD2A 2JZ5A 1YFZA 2YY6A 2XY6A 1RKVA 2NYVA 3NHFA 4B44A 4GDFA 4FD3A 5A7GA 3AWIA 4J9NA 1WL8A 3ZKAA 4HOYA 4F2DA 4GX2A 3H18A 3WGHA 3NIBA 1FMFA 4FUTA 1S4EA 3H5YA 4RESA 5J59A 3NXSA 1PVOA 5F8GA 2W2OA 4BX0A 1CXZA 2J09A 2V9WA 1TL1A 2Q7OE 4LGYA 4PRLA 2RKBA 4F8YA 1A4XA 2DK2A 2RQMA 4J16A 2PMHA 4MQBA 3OZWA 4NYZA 2MQPA 1DQYA 4YP7A 4GUAA 3S2UA 2D2IA 1P4SA 5K0JA 2RDIA 1I94F 2AW5A 1BHO1 3C39A 4Q2LA 1O8BA 3R24A 1MT0A 3DTTA 2ZD1B 4AP5A 1ACLA 3AR3A 2RILA 1YIDA 5AW2A 4N3BA 4M1WA 5BYSA 3KLMX 3OCJA 1KSHA 2ECOA 2CCGA 4G1EB 5HFAA 2X2OA 2H5LA 2CJYA 1VISA 3LW8A 3FAZA 2DNYA 4AWXA 4IFYB 4JYMA 3ZJ4A 1SC4A 3WLPA 4H1WA 4NI2B 3S3TA 2RH8A 1CQJB 1JB0C 1KH2A 5SYNA 5BUQA 3H5OA 3N2ZB 5EVJA 1II8B 2GEKA 3EDMA 1UWCA 4KR3A 5LZ2A 2LQ9A 4MS3B 3OJ0A 1RC8A 1PNVA 5LZ4A 5AXKA 4YT8A 3W62A 4B34A 3K7EA 1FJGJ 4L8WB 1W4CA 3G5LA 1RRCA 3VOBA 4HNHA 4IHJB 3R3ZA 2I7VA 1SKYE 4WLEA 3DLJA 3BGLA 1TYDE 3IBSA 3AIKA 3BICA 4D92A 4M0DA 2B4TO 1GEEA 2XGGA 2BMFA 2PV0A 1OXVA 1TM3E 4A46A 3K0AA 2DIUA 4XGRA 4PZ9A 1WDTA 2YKMB 3T1YF 5LKAA 5A6WA 4J1TC 1OUMA 4O44B 4BMSA 3HJFA 2PPLA 3SDZA 4G37A 1NBEA 3L06A 4Y2AA 1YCDA 1YRXA 4D99A 5E6SB 1IN8A 2ACWA 1GXSB 1RHUB 4BFWA 1WZNA 3F7NA 1XQ1A 1JZTA 4M0LA 2BVNA 2RHMA 1B8PA 1JHDA 1FRLA 3JQFC 2G13A 1E2DA 3B13B 3FWYA 1TMJA 3N01A 2R0QC 4C0SA 2CL5A 4QASA 2REBA 1J07A 2C9MA 3R6DA 1JDNA 1FBNA 1PZHA 4Q3NA 1R0KA 2POQX 2VPQA 4J7AA 2BW7A 3QMMA 1HNWF 4LWOA 1EKXA 4FFBB 4EMTA 1Q1BA 2A94A 1O9HA 3I5MA 1MEJA 4BZWA 1G7RA 3VRHA 1Z28A 3IXLA 4FYVB 2FE4A 2NZWA 5EWEA 7YASA 1TKZB 3AR7A 5FWXA 3ZE9A 1C1BA 3E9DA 4Z9BA 5G2OA 2YW2A 3NTLA 1Y8QB 1GZSA 1GG9A 4C20A 5IKPA 4Y2IA 2NGRA 1F4VA 1KLMB 5DLYA 3CTMA 3EFOA 2OHDA 4C76A 4DABA 1QH1B 4P2FA 1ZXLA 1BS9A 2CBZA 4IRXA 5LYJA 4IOAQ 1QGDA 2B0JA 2WIJA 5ADVA 4V3CA 3ZWAA 4Q3EA 5JJ5A 1X38A 2DPXA 5EP2A 3E6AA 4OJHA 3IDOA 4PAWA 5EMMA 1SKWA 5F76A 3D8RA 2W4MA 5KYWB 1Q7BA 1IQTA 3URKA 1FDOA 1K1SA 4NKRA 1F0NA 3NNHA 2WJHA 3KTQA 1WBJB 3RRGA 3ED1A 2LYVA 1VQ1A 1P2UA 4KG7A 4MCIA 4NECA 2YBVA 3PE4A 3T3NA 2W6CX 1QRAA 2ODPA 4DHEA 4I1TA 4N5SA 2O7QA 3P4UB 5E0OA 4TWZA 3V97A 2X1BA 1JX4A 5IEJA 1KYVA 1N5RA 4JJ4A 5AR1A 4TKVA 3IT2A 2H92A 3ROTA 1ZD3A 2HMWA 3O3NB 5KTKA 4MVCA 4EFNA 1AH2A 4ARVA 5JDIA 5BP7A 2HBRA 3KHLA 2Y1EA 4PPQA 1HQ2A 3T3FA 5GY7A 4YAFA 3MFHA 3RUHA 4IIYA 3B60A 4PQEA 2O8DB 3UDEA 1ZD8A 4GZMA 4HXYA 2WEKA 3LT1A 4PCAA 4KLNA 2GRUA 3ANLA 4YWHA 1M5TA 3IIMA 1ITZA 1QHFA 2NO0A 1G4CA 3AEYA 5TPZD 4DWVA 1NJ8A 4UVDA 2YHSA 2IEGA 1SL1A 4H0NA 2QROA 2ZB3A 3O26A 4B4OA 3TNVA 4E31A 1P8GA 3SEAA 1UDWA 5JZVA 2CEAA 4WI1A 1U2GA 4N5NA 3HXOA 3EUFA 1VQLS 4WECA 3PHCA 1V3VA 2UVUA 2DGDA 3RBAA 4NPOA 1JU4A 4KWTA 3EIUA 3WLQA 1E1QA 1PV4A 3UPUA 1WG1A 2G0IA 4GO7X 3V4VB 5KFPA 2O01C 4KHPJ 4G1QB 2GBPA 1P3Y1 3D3WB 1WDWB 4CKCB 3AUYA 1HHTP 3VTFA 4B2LA 1ORDA 2AZMA 1N5KA 5SYMA 2WVFA 2XMMA 4XI9A 2CZGA 5MN5A 1A4IA 4AO7A 1EGVB 2H51A 5LXYA 2HHHB 2YJZA 1GNQA 2W0MA 2FMUA 5EI5A 3UD5A 1AT1A 2I4IA 2MYNA 4GRAA 3BTSA 4JLVA 4PO3X 3LT5A 5CCDA 2J9CA 3UK2A 3EG9A 1IAQA 5EC8A 3TRHA 4OB6A 3VPGA 4P93A 1WQ3A 3RJ5A 1U7HA 1FS6A 2R62A 1YJXA 4C0AC 2IYPA 2PZEA 4Z0TA 2QUHA 3KK3B 1DS6A 3MT9A 3PV0A 4MR9A 4ECZA 1QYWA 3SJUA 1MV5A 1S8FA 3MF4A 2CXOA 3I5BA 2XOEA 1L7XA 3OO0A 1E2IA 2WJJA 3O3MB 3ZE8A 4HZUB 5CDSA 2XAUA 2J6HA 4ETZA 3H4MA 3H5LA 2AC7A 4PXCA 1VSTA 4ZD6A 2ZDPA 5JZ9A 3AR8A 2YCLA 5IQQA 1EUCB 3AKCA 4KFSA 3U5ZB 2RH5A 3DWFA 5IOLA 4GC9A 3R7BA 4PUOA 4ZP6A 4U2CA 2IWRA 4X85A 1NOJA 3NXZA 3RARA 2ACEA 2RG1A 4PFSA 5J5VA 2CZ9A 4ZN1A 1Z2ZA 4ENUA 3IP0A 2X5KO 3H5WA 3K9LA 1CETA 3E4CA 2ASDA 2RI0A 3NKVA 3EXHB 1UVMA 2G9QA 4KREA 5C5IA 5EXDA 1V8OA 1IN6A 2D1FA 5HQTA 2A14A 5JASA 1CR2A 3TBKA 4K8RA 5F1OA 2GZ2A 3OJOA 3ZDAA 1QIEA 3ULKA 2IHJA 4WY8A 2CFIA 3LAWA 5DYGA 1X92A 4F4XA 2OXIA 5LSOA 3VMMA 4DTIA 1KDVA 4REMA 4BP8A 1RWQA 4FYXA 1IHDA 4QXRA 4AY5A 4JBLA 3RF6A 1W73A 3PENA 4KI7A 4EKDA 4QOFA 2A9VA 3EK2A 3DZDA 2E89A 1HOXA 4JLOA 1L4NA 3A6DA 4UE3S 4XXHA 2QXTA 4L8VA 2WYVA 1PK9A 4CO3A 4EYSA 4O3NA 1TT5B 4MR7A 1EI9A 3HU3A 4Q5VA 1T0PA 5KIAA 2WSEC 2AQHA 5KREA 1IXRC 1O1YA 3RK1A 4MUIA 1I6MA 1DCMA 1CVRA 4Z8YA 1BEEA 3EJMA 3CEJA 2G0CA 1NA5A 1TU0B 4RHCA 1XMBA 3L7MA 4MK4A 4DV3J 1EBFA 3D2CA 4KE6A 4XWTA 3GJQA 3HYSA 1RQPA 3N2IA 1JU9A 2FW6A 4D0NA 4KQXA 3KHRA 1EP9A 2O2DA 1FK8A 3ILJA 3I6ZA 4EJ0A 1F9AA 1PKUA 1MXFA 3TOQA 4MVJH 3IQFA 4EG6A 4FS1A 1F2GA 1YRAA 5KFKA 1UIRA 3IV9A 1YJQA 1HNZB 1S2LA 1RYEA 2CJKA 3JQ8B 2V8DA 2GAHC 1MORA 1S5PA 4CHGA 4ES1A 3CCZA 4GSLA 4ZHQA 1E7QA 4HVCA 3HL4A 3TDMA 3R0QA 3I56S 1UMKA 4JL8A 4AZ0A 3HSKA 3VAGA 3GEMA 5TSDA 1HW9A 4I7FB 4B3CA 1A04A 1KWGA 2ECKA 4OYBA 3TLYA 1WC1A 2W2LD 5H80A 4FHEA 5CT8A 2GCGA 5C2JB 3WP1B 1H0HB 1THMA 1YOVA 1JXVA 3FFTA 5HK8A 3T35A 3GFZA 1E3EA 2N1BA 4Q05A 5CXSA 5E3QA 3IDSA 5AOAA 3NM6B 3Q11A 2HMVA 4QYZK 1QG0A 4ENRA 4JEUA 4ILRA 3WJ1A 3E4DA 3R6GA 4CLPA 1C3EA 5HQ8A 2OCGA 3OA0A 4HYKA 5I9MA 1O5JA 2JSXA 5H9EK 1Y0HA 2QMYA 1OR8A 3RK4A 2P4QA 5CVCA 1T2UA 2V2QA 2YRWA 4E11A 2XCAA 5ESWA 2JHAA 2ZH4A 2ZM6J 1VOTA 1TD9A 2J4CA 4JS0A 4KIUA 2ATIA 1NLKL 4ZQBA 3O8QA 2HFOA 1PAUB 4O3PA 1IK6A 1JEJA 5B0DA 3OZFA 1N8NA 3GK3A 4CM7A 3GV5B 3M3PA 2Z8XA 2QQGA 3M6XA 3KQLA 1E7MA 1NVVQ 3BCHA 1UFLA 3PRKE 3IQXA 1VIXA 4ZWNA 1CR4A 4RVHA 1F2DA 1Z2OX 2ZJ5A 5TGTA 4PAQA 3NWGA 1R6AA 2HWXA 3PX2A 1X39A 2DBBA 1FUKA 3NOXA 2IIVA 1ZM2A 3PHLA 2B34A 5JCPA 3B85A 1UZHA 4B3RJ 1OH8A 1I94B 4FF3A 1CY2A 1SBNE 1VPTA 3GFGA 3O44A 2VUGA 2HRDA 1NVTA 4IHAA 5AOCA 2I6WA 4YASA 1JH8A 3VPDA 4XCXA 2YJ3A 4ZS6A 2HKIA 4AG6A 1BJRE 1X3LA 1XMQF 1FUEA 2XMJA 1ZW1A 3KR9A 2I29A 3GUYA 1NUAA 5CM9C 3D1VA 4ACBA 2IXDA 3R9XA 2JCVA 2YZGA 2IYSA 4R1NA 5ENVA 2RHOA 2IYYA 4OP3A 3P2EA 3WQBA 4CBVA 3NC4A 5HP4A 1QAXA 1O94C 4KFBA 2FQWA 4AJ4A 1XDDA 1VIYA 2QYTA 5G4KA 3PI6A 3ET6B 1M1ZA 2HQ3A 2VYFA 1AMUA 3MMAA 3DPUA 5GONA 1NKTA 2F63A 2QTNA 3OE5A 1R64A 1OVMA 5YASA 4MGYR 1D6SA 1AKVA 1F20A 3KLNA 3O8RA 3B1VA 1RTDB 2C98A 1LLUA 3V34A 2PV7A 2BN4A 4OHBA 1N4AA 3SXUB 2W4QA 2GXQA 3EHDA 3QVWA 3T1HB 1XTIA 4PYOA 1H0KA 2XMPA 1UOPA 3AEZA 1PJRA 3K2QA 5E7MA 3UGTA 1DE0A 2P75A 4F25A 5HP1B 2B56A 2Q2VA 4BCDA 4IWYA 3MJSA 3ASUA 2XY5A 2PDAA 2DH7A 3TQOA 2DGSA 1XP5A 2ZVSA 1DV2A 2KLBA 2QZ9A 1Z8FA 2C2OB 1G8AA 4OKNA 3TGLA 1N8TA 3LM8A 3LWDA 2A1UA 2PT5A 3VUEA 1SOAA 3RAGA 3LUAA 2AUNA 4BNDB 2XADA 2QVZX 5JAMA 3C46A 4WA7A 4E5PA 2FPKA 5CFOA 3L82B 2IHYA 4ZYVA 3ZVMA 4ZEOA 2HFKA 3BXGA 3DVQX 2HCTA 5CT6A 5DXJA 1NJ2A 5LB2A 1DFDA 3L0ZA 2X8BA 4Z0NA 4GRSA 1KTIA 2HF7A 2UV8G 4XIJA 4JASB 4DLRA 3JWEA 5BSHA 2QL5B 3C8HA 3EH2A 4F04A 1NW4A 5I4BA 4CIBA 2VRNA 4LYHA 2SCUB 4KQ2A 2QS9A 1WSWA 4ED1A 3CC4S 1NQWA 2IV7A 2QGZA 1KOFA 5DT2A 3SNKA 1JKXA 5JC8A 1LTKA 3HHLC 1XO1A 3QXCA 1RT1A 4N0QA 1HDXA 3FPKA 3IQEA 1WHYA 2HLTA 4DPMA 2I2XB 4DJ5X 1N88A 5UKDA 4ELVA 3P9SA 3IEMA 3KOZA 3A1NA 4WDRA 3NVAA 2BEVB 3R1IA 1Q0HA 4IEEA 4PNEA 5AJWA 1YRTA 4ICLA 5K8JB 3I31A 1BDHA 4YAIA 5C24A 1HR0J 1HG0A 2FG5A 4ECQA 4DZTA 1VPVA 1V16B 4OATA 4C4TA 4I64A 2REQA 2F43A 2AN9A 2R1TA 4N7TA 3ASYA 3WL6A 4UKDA 3KYBA 4R3WA 3W5SA 1I32A 1I4OA 3WX8A 3L6RA 1MMDA 5C31A 4PGHA 3KG1A 4CMIB 1SCNE 1IRIA 1O94D 5TT0A 4RENA 3WB2A 1QFMA 3JQFA 2CG4A 4NL5A 2FLWA 1NEEA 2VL7A 1S9EA 3BGOS 3B4MA 4FC7A 1ZZGA 4MQEA 3BMOA 3RANA 3LBYA 2WU0A 2Q1XA 3K94A 1LUAA 2ZJ1A 4YMHA 2G1DA 3L7NA 2CHEA 4G5YA 4WZAB 1JIIA 4WLFA 1RK8A 3K8VA 5E6UA 2ZTUA 2MSDB 3BMCB 3HR8A 2NXWA 3FM9A 2Z2ZA 2QF7A 3OG9A 3DCJA 4MUAA 1D1PA 4XSGA 4L5YA 4GF5A 4M22A 3E70C 4IKPA 4RL4A 1OB2A 1IZ9A 4DR4F 3O8CA 1VZ2A 2A3JA 2BM1A 1KYIA 3G2LA 1H42A 1W36C 5IS2A 5BQPA 1AQUA 4RZIA 3QVGB 4HDHA 2F3QA 4KLRA 3BXXA 2KJWA 1M2EA 1EK0A 2NPOA 3ICOA 1U1GA 5BUZA 4HRAA 5HOEA 2IDZA 3CJ4A 1DKUA 1FMCA 3ROPA 5D2CA 5TJHA 4UHHA 5CQGA 1TK3A 3V80A 4AZVA 1Q1QA 2FUCA 3V8BA 3G8YA 2J6TA 3R44A 3W9UA 5JVDA 4RK1A 4Q12A 2XGQA 4QR1A 4X8OA 5EE3A 3GXOA 3EVFA 4RA9A 1TMKA 3BGFA 4BXOA 1SNYA 1HFKA 2OP5A 4RUCA 5IASA 3HHLD 1TVCA 2OB2A 1RCTE 3VR5D 3RHFA 1XLWA 1NF8A 5ES4B 2E9TA 2HCBA 2C9BA 2YZ7A 1GMWD 2FUKA 2H0QA 1HDRA 3JY6A 3DMPA 2FZ5A 4HFJA 4H2DA 2JLXA 4F4AA 3IAHA 1T94A 2FHJD 5M29A 1ABFA 1ZNXA 3EVGA 4BY9E 4G1BA 3CR3C 2Q9UA 1Q6ZA 4E5DA 3KFVA 4UAVA 4I9UA 3UFBA 2ZR9A 1ROFA 2YNFA 5AVOA 4M83A 5IF9A 3R0ZA 1RMQA 1RBQA 1KVQA 3D6AA 1G2EA 3AOBA 4US0R 2PJDA 4ZKDA 1GADO 2G2YA 4TVSA 5DLQC 2AQKA 3FOBA 2YVLA 3KUEA 4EF6A 1RAHB 3Q2KA 4B74A 4FFNA 3GJRB 2B5VA 3LKDA 5LMUF 2CNOB 5KJ6A 1JTEA 3DO8A 5I7WA 2E9RX 2FSHA 4IJWA 1RLMA 4YY3J 1RT3A 2WD7A 2XNCA 3RB6A 1ZOIA 1LWCA 2FW0A 2QBYA 4MVYA 1FRIA 3OU2A 5A2QU 1VE7A 1I14A 4DR3F 3FD8A 4W98A 3GRCA 1JHYA 3NH6A 1BE8A 1QIFA 2HRQA 3SYTA 1RWBA 2IOHA 2IP4A 1JSZA 3GE9A 2AFHE 3QI7A 3TA1A 3WKCA 2E18A 2MQMA 3ETNA 3TRDA 4KR0A 4BX3A 1T5HX 1A72A 1OTHA 5JDCA 3KDAA 4FB4A 3PPVA 2RGWA 4M0UA 1QGZA 2GAIA 2ILTA 5CK4A 1FTNA 4ZVPA 1PJ3A 5BWOA 4KN8A 3RUBL 2RQKA 1E77A 1P9OA 2FE1A 4ND3A 1OO0B 1WMFA 3IE1A 1KXJA 4JXZA 2DRAA 1R00A 4CF7A 4F3NA 1W36D 1NPDA 1QAOA 3WMEA 4KGVB 4IH4A 1EVIA 1GRQA 5AKJA 3GRYA 1I24A 1QORA 1U98A 3ICQB 4JLSA 4AKHA 3BTOA 1YJTA 4TYWA 3FDZA 3SM9A 4CCYB 1RCUA 4BVFA 3L79A 2JW5A 2AXNA 5CHCB 1DBQA 4J9RA 5DEOA 4JI4F 1APSA 1U9ZA 4N5LA 3MOZA 4IYQA 2DH5A 3DULA 1MENA 1I9CA 1EFPB 1GX6A 4WTOB 3EGZA 1FP4B 3UWPA 2Z4SA 1H2AS 4ZVNA 3NBPA 3D3EA 1ZM9A 1U02A 3HKBB 3SJCA 4EYEA 3CO5A 3FLBA 3FSEA 5SICE 3FEYB 3FZ2A 1FE4A 1CUSA 4XASA 3LCRA 2VSXA 5H70A 1KORA 2OZPA 3DDIA 2BI7A 2VG5A 3SI8A 3WGJA 5FOTA 2HFUA 3M5WA 4AULA 1N9GB 3OLBA 4MO2A 1JECA 2RGUA 3HBLA 3N87A 4TYYA 1VHIA 2RRAA 3OZUA 3HKEB 4YR3A 2H2IA 2ZXUA 3JATA 2WW8A 1BA2A 3CUUA 2ZREA 3FPGA 1LOUA 5IXSA 4OLAA 1QFYA 3H04A 1VL2A 4QYMA 4WESA 3ZCUA 3NMRA 4O0MA 1YFLA 2WZCA 3GLSA 5KYXA 3AYXB 3R5KA 4CIYA 3NHWA 4OQEA 3B1JA 1YITS 1CU1A 1SVUA 4MW6A 1XRPA 3W4IA 3HJHA 2GVZA 3FPBA 3L07A 2Y3YA 4KPUA 4W8HA 1FVHA 2O14A 3UNGC 1BFUA 4A9AA 5DDIP 4BNUA 3DTVB 3EMKA 5B7GA 1FSZA 2AG1A 1RT2A 1RC0A 4C05A 1WEHA 5F8HA 1XVTA 1NI5A 4LNUB 3BUSA 2CXRA 4EIWA 5DHTA 3NGDA 2DIVA 2QHXA 2A30A 2LQ8A 3GMDA 4XUDA 4BFXA 1HYBA 5BN3A 3EJWA 4IFEA 4DQDA 2IA5A 5EN4A 1E6YA 1G21B 2GN0A 1V6AA 2WOJA 2GJIA 4OGKA 3C7AA 4Z4GA 1U5BB 4LCEA 2QT1A 4KGMA 3WX0A 4AIIA 3SC2A 2F9JA 3OEWA 2R6GA 4NCIA 3KKQA 3GLJA 5KO2A 2ZZKA 4WAUA 1RU2A 3FDSA 4C7XA 2K7JA 1MHTA 1TO6A 5AW0A 2B8QA 3NT2A 1TPZA 1RI1A 4I6JA 2Q3PA 2BGIA 1IQ0A 3U7IA 2IY8A 1U2PA 3HCAA 4DSTA 4EX7A 3H65A 1F1BB 1XRMA 1H4QA 3DEZA 2J9FB 1RKIA 1XMQB 2BA9A 4KOEC 2CUTA 3HZZA 1L1RA 2PGXA 2QN2A 4M1TA 1XAGA 3BHJA 4FNAA 1ADGA 1NX9A 4BQOA 3LKVA 4LF4B 4MV3A 3ESXA 2Y2VA 4F93B 3PITA 4WUVA 5TNXA 1V96A 3I53A 3RC9A 2GVDB 2D54A 1GGVA 2JAPA 3ILIA 3ADPA 2WBRA 1YONA 3FCOA 5E3RA 1QG2A 2BKXA 4KH1A 3SX0A 4CN8A 2OVBA 2XAAA 3X2FA 3M9MB 1AUSL 4LPSA 3THTA 4JUCA 3HVTA 3ZNPA 1J5PA 3ZWXA 1WHTB 5C1OA 2P62A 3TSWA 3K20A 2Q6KA 1QQAA 4DJAA 1GEHA 2PGCA 4Z2YA 5HCNA 1YE3A 1ADBA 3NIFB 1X4EA 2FGCA 2V9CA 4U2DA 1YR3A 3GP9A 4KPEC 3G5AA 3L1UA 4ZJQA 3DN9A 1YQWA 4WW0A 2B5JB 4IQFA 3QELB 2A0FB 4RLEA 1VLOA 4Q7EA 3RVJA 3I87A 4P3NA 4RD2A 4KHRA 1HY3A 2AYGA 4D0SA 4H27A 2NZ8A 1KY3A 3K6KA 2IPNA 4FHDA 4GI3A 3Q7RA 4NLSA 3LHIA 1GUZA 4BC7A 4M95A 2DPMA 2E1AA 1I2CA 2RGDA 2B4RO 4HB3A 5FULA 1MH1A 5KNCD 2N46A 2XUGA 4KB5A 3WZ2A 1E9CA 1RTTA 2AB0A 3CKYA 3OKAA 4LE2A 2VOOA 3TI7A 4L75A 3H13A 5COAA 3HA5A 4AXXA 1K98A 2DNHA 1SVMA 3FNNA 4NRTA 2OFOA 3MT7A 1O94A 4CMGA 4BNIA 3AVYA 3DBRB 4J4HA 1N5DA 1US8B 4F3YA 4CLRB 1A5AB 2GPYA 1OFGA 3R4CA 2IE0A 1NZJA 1K3UB 2DNZA 2RGEA 4HYYA 4QUGA 4NZ9A 3H1FA 1TQ2A 1KBOA 2B9VA 1C9NA 2UVPA 3CR8A 3BQ1A 4B3XA 1OI4A 3CCVS 1OCEA 5ALTA 1A0OB 2EDCA 3DW3X 5TQVA 1NJFA 4P7JA 1EP3B 4ZPCA 4A3SA 4LRTB 1K9VF 1U48A 2ZUUA 4ZN3A 1FVXA 3OVBA 5L45A 2W7TA 4OHZA 3D43A 1KJZA 4LRQA 1D4FA 4DYVA 1D09A 2CNNB 3BAZA 2J46A 2R48A 4DF4A 3OWOA 2XS2A 3TFQA 1IHOA 4OZNA 3BXEA 2BF7A 4GZ6A 2Z30B 5KCZA 1N6QA 1XFAA 3QV1A 4UE6A 4Q9JA 4CKYA 2PYDA 1K5GA 1NIPA 3OF3A 3D6HB 1EWTA 1MZVA 4IMRA 5SZHB 1I4DD 3ODGA 3PE6A 2BMEA 2DLDA 3AM1A 1GFSA 4Z2XA 4EVQA 1CUZA 1TIKA 4G5GA 3R9LA 3TR0A 1NJIT 2QRLA 1G8HA 1HYEA 4H0CA 3SFGA 2VTEA 1VB5A 3A70A 3MCUA 4A15A 4WSOA 3V9PA 5A1JA 1FRVA 3F6EX 5SUHA 1TX4B 1Y9JA 1IUKA 5ALJA 3RFCA 4Q19A 4D8XA 1S49A 2XBLA 3MMBB 2VSFA 3RTGA 2OLKA 4L2IB 3HHLA 3VOTA 3P2IA 2JCGA 1VL0A 3QVOA 1PIEA 3NAHA 3KQQA 3CO0S 1ZYQA 3WQHA 3CC7S 1GMWA 4KV9A 3G6WA 2DWQA 1CR0A 5CFMA 1PFKA 1IZZA 4WCDA 2G06A 2J31A 2FHJA 1U90A 3EPHA 1RAGB 2NSJA 1D1QA 2VH2A 4RK6A 3HKDB 4EL5A 4Z99A 1J97A 4KGXB 2W8BA 2QQ0A 4KRFA 3UUGA 2QG4A 3WGMA 1MW8X 4HXEB 4GICA 3L4EA 3GAMA 2QWXA 1Z4MA 2LPMA 3Q22A 1T6ZA 3L0IB 4F2WA 1UA1A 4KODA 2UVRA 1JJAA 1LU9A 3DOKB 1XNQB 4WCFB 3L92A 2M1ZA 1UEIA 1TA9A 4DJEC 1T5SA 3PKMA 2CFOA 4LK3A 1CJSA 4ISBA 1W1WA 2YC2C 1EXWA 2ZWPA 1YFJA 2JEYA 4BJ3A 4CN9A 1UPPA 2ZPTX 5THWA 1VQOS 1JR3E 2G4VA 3KB6A 2FRVA 1O57A 2B4OA 3TVYA 1Z7GA 1ML3A 1WKCA 1BO6A 4RE6A 5HJYA 2C5SA 2VPYB 1HSOA 3K58A 4OXRA 2R79A 4DC0A 2X4DA 2K7KA 4MLPA 3VPHA 1TTHA 3ZFVA 4EG0A 4KX5A 2WTFA 4W5TA 1AZSB 2DHQA 3UCZP 2LTAA 1SQSA 5DU2A 1GUBA 4AWAA 2XQCA 3O8OA 3KJNB 3MM9B 4P82A 5MF6A 4YRZA 1LGYA 4FYYA 4X6YA 5T6MA 5F3ZA 3DLLQ 1JIUA 1YBHA 1II9A 5E7QA 5ESRA 2VHVA 5ITZB 3QE3A 3MSXA 4B32A 2FDCA 5LMUB 3ZKWB 4M8IA 4JVLA 4HWOA 4ZVTA 1RRVA 3D0IE 2NSYA 1TFWA 5F33A 3ZDRA 1JBQA 3HJRA 4BLOA 4NLGA 5CH8A 2WA1A 4AXJA 3RAFC 5IT9Y 2HDOA 2FP4B 2RB7A 2RGNC 4L4ZA 3MIIA 2PX3A 5HKLA 3FYUB 3AR2A 3DCAA 5EE1A 3FWNA 4HNQA 3JAWB 2FX5A 3BD7A 2EAUA 2HFSA 2BGUA 3VPAA 2FWJA 1FKPB 1X87A 1FKOA 4PFQA 3PIRA 1WDDA 1CBUA 2A35A 1K3TA 2PTGA 5K8NA 2XTAA 3UN3A 3CJSA 4JUIA 1ZH5A 1R10A 4MS4B 4IDCA 4K9RA 3HB9A 1KBZA 1UW4A 1SPBS 2VXBA 4USMA 3IV7A 2M6SA 3U56A 1QLHA 3KKZA 2G09A 4UPEA 5KG2A 2PFGA 4NCHA 5L9AA 2H2AA 2OQIA 2O7NA 3JVUA 2JKYA 2F17A 1GU1A 4IVRA 2V7UA 2AHOB 3NHLA 3PQEA 4MKFA 4MPDA 4KDFA 4F9GA 4BLPA 3V7YA 1H8HD 5HOQA 2GPSA 3A8JA 1U1EA 2QSZA 2WF7A 5DLDA 1K7YA 3BQ9A 5J4KA 3D68A 3KMQA 4A36A 3JD4A 2JLAA 3NS7B 1OYWA 2ZLBA 4LKRA 1S7CA 3FF1A 4E03A 1A7KA 4NLDA 4XIYA 2VPIA 1MU0A 1Z16A 5F9FA 3MXHP 4DDFA 2P2YA 1PS8A 3G1WA 1VYTA 2WTAA 3P0JA 3BXOA 4Q39A 3TQIA 4WXYB 3R3SA 3MCZA 4AUKA 1I3LA 4KNWA 3RIEA 1EHWA 3B82A 2MY8A 4JYPA 1U0OC 2ZJ0A 2UUWA 2HGMA 4NCJA 5LU8A 1V4VA 4DC1A 5FV7A 3KXDA 1JKJB 2LCIA 4XWKA 3ZN2A 3V4MA 5ICMA 4M36A 2ZUGA 3BS9A 1DMSA 2JD2A 1K6IA 2BKAA 3PRBA 5EYPA 1EMDA 3A4TA 1RFGE 3KOYA 5AT1A 3D4LA 3FIJA 3IGNA 1S9HA 1PV1A 4M1MA 2WFLB 2I76A 2DITA 1RT5A 3EQ7A 1DG3A 4U02A 1NXOA 1KJQA 2FN9A 1VHWA 2EATA 5B6PA 5CURA 1N8RT 3W5UA 2ZRDA 3RS8A 5K9ZA 4OKSA 3NGTA 1ECPA 1EZ4A 1UBGA 3C4QA 1EWYA 4DG5A 2RHWA 4MTPA 4JJZA 4KFCA 3AUFA 4DT1A 2EL7A 4MVJP 2P4UA 4CKXA 2R60A 3HY4A 3M3DA 4QYIB 4CTAB 4HGOA 3KK1B 2QJ3A 1OX5A 1SCBA 4B3TJ 1I6WA 4CHTA 1M0SA 1A88A 1N2CB 4LC0A 1EP4B 3TL3A 2VKZG 4DQQA 2I1LA 1K47A 3OY7A 4ILLA 2OMOA 3B5IA 3K5OA 1ARZA 1T29A 4CT9A 4LECA 1P9RA 1G16A 2DSTA 4BO1A 2YWRA 2A9KA 2XUKA 3WYGA 4R8KA 1W9HA 4CT4B 3RSLA 1R50A 3T5AA 1TCUA 4XM1A 2C4HA 3LT2A 4XH9B 3B9BA 4GR4A 3OUUA 2OMLA 3TKYA 2A59A 3PYDA 4DUZJ 1J2UA 2HJWA 1JVSA 5D3MB 4L57A 2AD5A 4TYQA 1BVUA 4QEDA 4AWBA 2L9WA 4X1YA 3UFCX 3RBEA 2W7AA 3ZGOA 5EHXA 1EVJA 1AGRA 4BN4A 4HQ0A 2QQEA 5AWFC 1QPBA 3C1TA 4HX2A 2PMWB 5EWFA 4X4QA 3V42A 5C5JA 2GQQA 3GLRA 1C4AA 3CLVA 2WF5A 2FJBB 1DOAA 1S1XB 1Y6ZA 3QVKA 2HYDA 3MR6A 1Z06A 1ZH0A 3CBGA 2YH0A 4XYLA 4TS3A 2YQZA 4TU8A 1ZO8A 3R3HA 4LAFA 3WGUA 5GQSA 4FYDA 1COZA 5DM2A 1X7ZA 1EKRA 1S1TB 2UUCF 3R7NB 1SA0B 5HAOA 4C29A 3HDJA 4WK3A 2VBGA 1OAKA 3GNLA 2FEAA 4P36A 4HN9A 4Q9LA 3I9ZA 2GEFA 5KNCA 2W8KA 1E3DA 4O4HA 4M7OA 2GXUA 2FZCA 4JR0A 5K6TA 3EN0A 1SJ9A 4Y2HA 3L4JA 5LNK6 3RUAA 1I51B 2JGKA 2Z1MA 2GA7A 2BHRA 4FXDA 3L84A 1T7PA 2HRCA 1XGKA 1RYDA 4J9MA 3LPYA 5DTJA 2W7OA 4HWGA 3UW1A 1ZJJA 1PR2A 5IFMA 3CHYA 3ULHA 3KYLA 5LP6B 2IRYA 3STVA 2CG8A 1J90A 2IDEA 4DNXA 1EGQA 1JHMA 1SUQA 4CM8B 1E3WA 1K4YA 1PN3A 4UNIA 4C4PA 2I3GA 1Y4AE 3ZHYA 2ZAYA 4Q9IA 4GX1A 1K1QA 1PFVA 1TUBA 3LYAA 4PLTA 2VHCA 3I52A 1M76A 1OZGA 4XX0B 2SKEA 3QVMA 4RGBA 3L8ZA 3CD7A 4QGGA 1S79A 4Q3AA 1ZK1A 3KHHA 1N48A 1IK4A 4ARSA 1XEFA 1Q1EA 2EV9A 1JFVA 5ECWA 1GT91 2MY7A 1XRNA 2G77B 3B6BA 2HJGA 4Z9AA 2CDQA 2ECPA 4I9HA 1IKWB 2AK2A 2ILYA 3BSCA 1ZI8A 2ZJ4A 2TMKA 1FE0A 4K26A 1E2UA 1ZSNA 1AXQA 3A1EA 1GLVA 1J2TA 4YRGA 2PRYA 2J3KA 3WGLA 1WNEA 3BQMB 4TKTA 1EZZB 3MLBA 3V5RA 4UTPA 4G0WA 4XGKA 1OFUX 4L07A 4WFNQ 2FZEA 3PX3A 3GLFA 1PJZA 1TEHA 3K0FA 4EUFA 2DFLA 1GGHA 1LX6A 1TTPB 1XDUA 2XSJB 3ANSA 4K7QA 1NU8A 1X0VA 3HBFA 3J81j 5EIXA 2UU9F 3U7QA 1YR6A 3GU3A 4U0JA 1ZQ1A 1KI1A 4V0RA 1X4AA 4BASA 3Q89A 1I30A 1KRWA 3FNBA 1Q79A 1WC3A 3E3LA 3VGTA 1L7BA 3WA7A 5ITSA 3DXYA 3GDOA 4C14A 1Y5RA 3WC2A 4IAOA 4V0KA 3TA0A 3TTXA 1UMBA 1A8PA 1V7CA 3IS9B 2BOVA 2ZUDA 3CO9A 2IRXA 5M2PA 2BV3A 1E3IA 1OTXA 4HB0A 1TYCA 1ZITA 2EW8A 3MPDA 4X7BA 2H3EA 1OQ3A 3A28A 1M1KT 1NU4A 1YHQS 4P5PA 5HBRA 1INLA 1EXNA 2W5UA 1UJ5A 3K73O 3R5TA 2EGUA 2ZJYA 5EE5B 2C5EA 2PUTA 3DR5A 4YUAA 3NAGA 1Q82T 2W4IA 2B37A 1FNXH 1XC7A 1G5IA 5BSKA 3VVLA 1LW0A 4ZAZA 4YP6A 4U2FA 3K9NA 2YFHA 1PP4A 1GQEA 4RW6B 4OX9J 4IDKA 2CHVA 3O1IC 5A76A 4ZKEA 2ZIWB 5IUJC 3E9NA 4G8JA 1UXKA 2AZ4A 3LWBA 5LZ8A 5F8IA 4R0JA 6NULA 4AQ7A 4LOJA 4DBLE 4L50A 3TAMA 2QA4S 4ILMA 1JPVA 2CJXB 1Q0UA 2ZSKA 3UT0A 2I1RA 1UZMA 4URGA 4RSGA 4HH4A 1ZSYA 2ZR0A 4BAGA 3LDGA 2VHYA 3Q9UA 1N5YB 2VJBA 3QX3A 3H9CA 2BF4A 2YIJA 3O2NA 4GSKA 2ZWVA 2D06A 3THXB 4FF2A 2XOXA 3KT3A 4CP5A 3MCMA 4KPGA 4FTWA 2B9YA 2NV0A 4GKKB 1ACJA 1T95A 5EUCA 5KVCA 2OXFA 2V4RA 3SVTA 3MCNA 5HF8A 4HZIA 1NW7A 3UOGA 7FDRA 1SVNA 1HNNA 3LCVB 4YX9A 1JALA 3WFZA 4I19A 4CT8A 3D64A 2AG6A 3NTUA 5FAXA 4V1CI 3U2QA 2XCIA 2JJYA 1Y81A 5K3AA 2GNOA 2RVJA 1JNZB 3CZAA 3QUQA 1GXTA 1S0NA 2PWBA 4B2IA 1P9WA 1OXUA 3UT5A 3ELBA 3AHEA 4RWXA 9RUBA 5ALDA 4V0OA 4A8FA 3ZGYA 3T3OA 2MSWA 4U7PB 2QLXA 3E9MA 5K3DA 3OX2A 3P2YA 1PUJA 3JV7A 1QJHA 3IAEA 1QZZA 3PCTA 4CEIA 4C6HA 3TAHA 4JJ7A 1HI0P 1JVNA 4NBVA 5COBA 2AD1A 3JQ7B 5SY4A 1K4MA 3PX7A 4LVOP 1J2EA 1LDBA 3O2QB 3IP1A 1AB6A 4XFDA 1TELA 4X64B 3UPDA 5E1BA 4HACB 4PHFA 2FC9A 1UXOA 2BANA 5ETMA 1T8PA 1ZZNA 1U1QA 3ETCA 1T1GA 2RFLA 1B7YB 5CVJA 3G2MA 3QWUA 1H8HA 2NU7A 1RM3A 3OIUA 3ABIA 4LVNA 1WJGA 4NWIA 4OEHA 2FGOA 4RIIA 1P18A 1P74A 4PYJA 2JANA 3QATA 3W8RA 4HQNA 1JXQA 3UMBA 1JXEA 4ZVSA 4NOMA 4TL7A 3JARA 1EUZA 1AHHA 1UK6A 1T2VA 1VK8A 3WGVA 1G6Q1 4XJTA 2I78A 1KEWA 2HK2A 1WHXA 2XDQA 3EIQA 2Z1DA 1M2OA 5AW7A 4R1PA 4NBLA 3FZNA 1G8PA 3ZW9A 1NW8A 1W5AA 5TGZA 1WKBA 2CMHA 1Q19A 1DBWA 1I2DA 3ZZMA 3KWMA 2YHUA 5DGHA 4U2GA 3VOSA 3PC6A 4B9AA 3UMFA 3USCS 3C41J 2CLFB 4X8LA 4TY8B 3OT1B 1U1RA 1YJNS 5DP1A 2XG8A 4GPIB 4CKWA 3I34X 1NK0A 4RUHA 3IAM6 1DWPA 3OUYB 2B61A 4FR5A 3I32A 2BGMA 5KWIA 1ULTA 1T3TA 1NIJA 4HTJA 4UXHA 1KQ3A 4INOA 2WJGA 1S7HA 1T8YA 1NZFA 4Q3BA 4I3HA 1EIWA 3OZXA 4R81A 3M34A 4PVCA 4C01A 4Q7LA 1ZN8A 4CNBA 4B33A 3H1AA 1A9XB 1B74A 3ZDDA 5CVUA 1UXJA 1UWVA 2YN2A 2Q4EA 2VWQA 5K0CA 1Z34A 2NUPA 5AXMA 2NZXA 2UUBF 2X1AA 3KJZA 1NLFA 1VRCA 2N42A 4Y6IA 2RGNA 1X3SA 1NXPA 4P7KA 4P73A 3DMRA 3T5GA 5JDCC 2XF8A 3DPIA 1TZCA 3Q86A 3OP4A 4PCLA 2DCUA 1X14A 3GRAA 4YREA 3UCEA 2RJ3A 3BK2A 2AC4A 4V0ME 1ZJWA 1WF6A 4IXWA 3RWBA 3YASA 1RJ9B 3G2OA 3D1QA 1MJGA 5FL7D 3V00A 3NALA 1WY5A 4BMOB 3DKDA 3F5FA 3QXSA 2R8YA 2QLBB 5E2AA 4A0FA 4DR2J 3MAJA 4DWJA 3A58B 2OOKA 4QJVA 4DLGA 1B7GO 4C7OB 4YAGA 2PZ8A 4D3GA 4LTNA 4M1ZA 2CL0X 1DTTB 4FB5A 1EVLA 1WMDA 1O5OA 4LRWA 3GU0A 2HSEA 3OOJA 2QJOA 5D6OA 1OLUA 1OPRA 4CMCA 3GEBA 5HKOA 1DNPA 3KTAB 5JAQA 2FH5B 1NTRA 4CFYA 1J56A 3WLEA 4RAOA 3DQPA 4EMBA 5DNVA 5D0EA 4L3OA 1FESA 3I83A 2ZT7A 4QOEA 1LFWA 4G36A 1GZ7A 4AMBA 2BXJA 4XOIA 1JG7A 1R1DA 1CWUA 3OQ6A 4LG1A 3SK0A 1WDLA 1YNOA 3GPAA 1CPYA 3FNFA 5CG1A 2C99A 4EL0A 1SU7A 2EFQA 5A4IS 2DWCA 4DPWA 2O19A 2ZE5A 1PFUA 3QWAA 3RRBA 3LHFA 5TC4A 2EP7A 1N0VC 5KX5A 2FVCA 1CE8A 3U4HA 5KYUB 2PO5A 4UFNA 1HLWA 2GS8A 1UWBB 1X0XA 2X14A 3MAGA 2V7PA 1RM5A 5MFZA 1KJ9A 4DKJA 3EEQA 4FS3A 1TK9A 1F2UB 2GVZC 2FFAA 2BFCA 3TBFA 3STTA 3PYFA 3FG9A 3M9LA 3AT1A 1W2WB 1KZ9A 1DEKA 5EXEA 2WVGA 1BNCA 1GRNA 2H59A 1Y34E 4LZJA 3MERA 1J25A 1GPNA 1Q44A 3OVSA 5A3VA 3ESBA 3QSIA 2GFHA 2JAWA 2XLIA 3M6MD 4E5SA 2ERXA 1HG1A 3OU6A 4WKCA 3SBDA 3WKAA 1M0EA 1R27B 2WQ7A 3L46A 3MWGA 4MZDA 2WJPA 3G0HA 1QO9A 1HWJA 1M5VC 2AW3A 5JCZA 1IKVB 3OXGA 4EAQA 1M33A 5TX7A 2P6SA 1U26A 2JD0A 3AH8A 3IFEA 1FXDA 3CSDA 3IRXB 2WUWE 3WB1A 3LQVA 3ELUA 2JLVA 2JH8A 4IR7A 2O50A 2J67A 5BWLA 1JI3A 4TYAA 4DQ0A 8LDHA 4XSHA 1RWXB 4EUVA 2OPPA 1C8VB 1KDTA 3GEDA 2X6QA 2C04A 3QQCD 4AP9A 3I2KA 5DM60 4JL6A 3RIMA 4A7PA 2XHEA 3DVAA 3ZWCA 3RUIA 4ZAYA 3PL1A 2AJ4A 3E35A 2NO1A 1DO0A 5FBHA 5IN5A 2AYEA 4Q4DA 2YQ5A 1HA1A 4ZJZA 5DPMA 1V48A 1H74A 3KHTA 2XV1A 3ANTA 3U1TA 2P6TA 2CQPA 5C7OO 3D81A 4HKTA 1YE8A 1HWKA 1EFTA 2REXB 3OI7A 2I55A 2VPXA 3FFBA 5EQTA 4ZJPA 4ZQGA 1LW2A 4AKGA 3X1JA 2WONB 2VBFA 4DV2F 2Y9MB 3CMQA 3KLFB 1JPUA 5HPYB 1VZ3A 2E5JA 3L7YA 4O0LA 4UHCA 3WK8A 3GVHA 2QM7A 3KE9A 4WZBA 2JIOA 3DOEA 4N56A 4LMZA 1L5ZA 4R71A 1T4BA 1OBVA 2CADA 1IEQA 1D2AA 2QJFA 3LT0A 4DEVA 1VG0B 2W2KA 4GHWA 3C16B 4I6WA 1EQAA 1RP5A 2CA9A 1F3OA 4RIGA 5JO9A 3B1ZA 3F41A 3AUJB 5LA6A 2DJWA 2CQ0A 4MIOA 1F8YA 3V6JA 9ATCA 1R0SA 3KTDA 1ZZFA 2OCIA 1VOMA 4DL3A 1K0TA 2FPGA 2DHXA 5A8RB 2Q66A 5BWCA 2JAXA 1UC5B 1DXOA 2FWIA 1Y9DA 1FFGA 4MLZA 1U4BA 4LWPA 5B1YA 4HH3C 2PKYX 3HGMA 2LNDA 1UFRA 5KWVA 1SB6A 1X8JA 2RU9A 1U0GA 2R8IA 4WOKA 3FOFC 4K2JA 3SSOA 2W2XA 3LANA 4YJKA 1ZNQO 2P9BA 2M6RA 3CJ5A 4PZPA 4E2ZA 3S40A 3IAM9 4Q02A 4EHJA 3JAKB 3R3YA 4G85A 4MIAA 4L0CA 2WSYB 3LIPA 1QUVA 1K7SN 2VODA 3G9CA 5ER6A 1U1KA 3WICA 3OFGA 2Z4TA 1V9OA 1RYSA 3FLAA 2DGWA 1XDZA 3D5QA 1REVB 4EHDA 1U9JA 4I1YA 4BJHB 2GHIA 3OF2A 2YNIB 3G89A 3O2IA 1D7OA 2B78A 3N9UC 2H5JB 2AHRA 4M5JA 5J2MB 4YB5A 2GPBA 5B0AA 2D3UA 2WHRA 3UMSA 5JEEA 1SC9A 4URFA 5HBGA 1KIMA 3RW7A 4EFLA 4J9SA 2Q0QA 3S8MA 3C3DA 2NZ4A 1HBMB 4GKJF 2AX3A 1T8WA 3GNTA 5DO2A 2F8LA 5H3HA 3IWNC 1NQXA 1F0YA 4BKPA 3T1YB 1MPXA 3GQCA 3JS9A 3Q83A 4UU0A 4ETIA 4FYWA 3RJMA 2HZCA 1GNTA 2VHGA 1YC2A 3DMJB 1U7OA 5D85A 3D0KA 3OMXA 1OC2A 1KZ4A 3I5AA 4R25A 1CSEE 2W22A 4EI7A 3TTUA 3MMNA 1JAHA 1SXQA 3LP1A 2RHDA 2JLRA 2EKPA 4G0MA 2HXYA 3QZUA 1DJOA 5H9WA 3GRVA 2P67A 3OM9A 2MZSA 2PCJA 1FQWA 4F67A 5CDFA 3CIMA 3TLXA 3M8SA 3RADC 4S2EA 2EEYA 3ZU3A 4WZ6A 2HZBA 3FVYA 3RVRA 1D6MA 3SMQA 2I9KA 5F0UA 3SEOA 3DHNA 1HNWB 2J3DA 2GDJA 2XYVA 3AOCA 1WB5A 1GX5A 4FSXA 1T3GA 1VSVA 1IMOA 1Q0ZA 1S9DA 3R6LB 3UA3A 3RBDA 2E29A 2M9KA 2NSBA 4KVFA 2A9RA 5IM4F 3G82B 4JB8B 2FLKA 1M0TA 5DLFA 2HFVA 1G9TA 1Y42X 1ZUIA 1WELA 5E7JA 4COOA 3LF1A 1JAYA 5LJLA 1SK8A 3RAEC 4FWTA 1U3UA 4Z4IA 4YDDB 4O2AA 3GJXC 2GAGC 3AOGA 1H94A 3UQZA 1JIVA 3ERCA 1S9GB 3A7DA 3E1GA 3K6JA 4B08A 3HCBA 2X7XA 2JVRA 4UZCA 1R6YA 1TM2A 4BV9A 3HFJA 4WOBA 1CQZA 3RT1A 3WL3A 3H1GA 2ZOFA 2BGWA 1FTWA 5HTOA 3O4IA 1CZLA 1BH6A 5FFFA 3ITEA 4EJ6A 2GD2A 3CN9A 3P71T 4MROA 3H8VA 3ZBUA 3WGGA 3C7KA 1P0FA 1QXSA 2YZKA 3K53A 2XXAB 1RZVA 1MW9X 4ECVA 4ANEA 4KIJA 3W7BA 3MA0A 1HGXA 4A0GA 2QQFA 4S1TA 4C9DA 3UJPA 3K4PA 1RADB 3MXTA 1YJBA 5I4MA 1NQVA 3PFOA 2H08A 4HDMA 3N6LA 3OQIB 2Q3BA 5KG3A 4HT7A 2V5AA 2O8EA 1XTSA 1XZFA 2O8FA 1QH9A 3BKXA 1ORWA 3DM2A 1TKBA 3LNTA 3BGSA 5HQ3A 4YPOA 2GMHA 1U6ZA 3NBFA 3ZBPA 3H87A 3X43A 2ERCA 4I0WB 2HRBA 5L4SA 1RWOB 4HBGA 1ZDMA 1GPJA 2EC5A 1KAEA 1NASA 4EGCB 5L3SA 2YXDA 3CJQA 3QNWB 1CC8A 2XA9A 3CCJS 2YYYA 5JS2A 2CSXA 1H2BA 1LS6A 1NH7A 5BYQA 4ZOAA 2YQ0A 4HH1A 4RM2A 5FL7A 1CR1A 3E22B 4NXMJ 4IQXA