4NMLA

2.60 angstrom resolution crystal structure of putative ribose 5-phosphate isomerase from toxoplasma gondii me49 in complex with dl-malic acid
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
257
structure length
249
Chain Sequence
MNPQDKAKQAVGYFAVDTYVRSGMKVGLGTGTTAKFVVERIGQRMQEGSLKDLLCVPTSEATRKQAESLGIPLTTLDGIADLDVAIDGADEILPPTLGLVKGRGGALLREKMIAAAAKTFIVAADETKLVSNGIGSTGALPVEVVVFSGSHTKRLLSALPSVKRHGGRAEFRKRAGAAQEDIREEDRFVTDNGNYIVDLYFTETVPDLHEMDKELKSIPGVVETGFFLDLASVCLIGKADGSVATLTAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 2.60 Angstrom resolution crystal structure of putative ribose 5-phosphate isomerase from Toxoplasma gondii ME49 in complex with DL-Malic acid
rcsb
source organism Toxoplasma gondii
molecule tags Isomerase
molecule keywords Ribulose 5-phosphate isomerase
total genus 80
structure length 249
sequence length 257
ec nomenclature ec 5.3.1.6: Ribose-5-phosphate isomerase.
pdb deposition date 2013-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06026 Rib_5-P_isom_A Ribose 5-phosphate isomerase A (phosphoriboisomerase A)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4nmlA02
3.40.50.1360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4nmlA01
2FGCA 3L7OA 4R9NA 3OFGA 2ZHOA 3BXEA 3DDNA 3ENQA 3CSSA 3N0VA 3P96A 4GMKA 2R5FA 3K5PA 4L5JA 2BKXA 4GO7X 4GO5X 2RQMA 3BXFA 2NYIA 5IS2A 3LUYA 3TUZC 3MWBA 4GO1A 3MAHA 1NE7A 2QRRA 2RI1A 1JT9A 1PBTA 1FS6A 3E15A 2QMWA 2P9CA 2O0MA 3O1LA 4NMLA 3TUJC 1HOTA 3CEDA 2RI0A 3BXHA 2H9ZA 4R7TA 2J0XA 3LWDA 3UW1A 3OFHA 1YBAA 3EFBA 3KV1A 3LOUA 3ENVA 4PWUA 1XTZA 1LK5A 3KWMA 3LHIA 3NWPA 1LKZA 3ENWA 3DHWC 2RQKA 3OC6A 3TUIC 1YGYA 2KO1A 1DEAA 1LK7A 2J0WA 3DHXA 3ICOA 2WU1A 2P9EA 3EB9A 1VL1A 1PSDA 1HORA 2F8MA 2P9GA 4M8LA 1SC6A 3IBWA 3IXQA 3CH7A 3E7FA 1KS2A 2DTJA 2QSWA 2DT9A 1FS5A 2PC6A 2RE1A 4TM7A 1U8SA 1O8BA 3NRBA 1Y89A 4L50A 1FQOA 4X84A 3TX2A 3OBIA 4OQPA 2CDQA 2OKGA 2JHEA 3W7BA 5IT0A 4IO1A 2BKVA 2W48A 4L5IA 1UJ6A 4OQQA 3AAWB 1Y7PA 3AB4B 2I9SA 1FRZA 4L51A 5HJ5A 1M0SA 1UJ4A 3NZEA 3OFEA 1ZPVA 2JOQA 3HHEA 3AB2B 3BXGA 2LVWA 2F1FA 3U7JA 3DC2A 2PA3A 5FIIA 4TM8A 2LQJA 4L4ZA 2GNPA 1CD5A 1FSFA 5T41A 4L4YA 2QMXA 3MTJA 1RWUA 4LUBA 3HN6A 2MDAA 5JJBA 3S1TA 1UJ5A 3OFFA 2J0EA 5IT4A
chains in the Genus database with same CATH superfamily
2YKPA 4Y00A 1U02A 5BQXA 2CCKA 3IM9A 2XMWA 3HHKA 1W88B 4CDRA 3BMCB 5ICFA 2FJAB 3MJ4A 4P7GA 3CEAA 1ZNXA 4IIHA 4OJMX 1KF0A 3FMBA 3GPBA 3Q3CA 4IIJB 1K6MA 2DRBA 2XGQA 1TXGA 4UUOA 1D07A 5LOVA 3QFHA 2ECQA 1FWKA 2QFIA 3SYTA 3AUXA 3V5NA 2MSSA 1F0YA 1LBSA 3QA3E 3IAM6 5DK4A 4CO4A 3TQRA 4PAGA 3A06A 5BNTA 4YJ2B 4AJHA 2QSFA 3AK4A 2Q8NA 3ZBUA 4IV8A 2D7JA 2H7VA 1YA4A 3FDZA 2DGDA 3GLIE 4ZI3A 3WGYA 4HXFB 2JLUA 5YASA 4RW8A 2FRDA 4WU3A 3QV1A 2MKHA 2FB9A 3ZW7A 1T6XA 4JB8B 1B14A 4GX0A 3QWFA 4S1WA 1M5PC 2YNIA 1WG8A 2HHSA 2LGJA 1WVGA 4ILMA 4V0KA 4YDXA 3TTTA 3A2LA 2PT9A 1DIGA 4UHHA 3H5WA 3M4ZA 2WW4A 3WAGA 3HPRA 3MCZA 4DSEA 3BICA 5E3PA 4AK9A 5DPMA 5E2QA 1F14A 1BG6A 2WJYA 4HQ6A 3JS9A 2BR5A 4NA2A 4JX8A 4YP1A 1QSSA 3K1TA 5IYZA 1YASA 1W2IA 3PIRA 3SY8A 3PX7A 2WAQD 5J2NA 4TZTA 3IRXA 1QG2A 5FBWB 2FR8C 2FHJD 3DVAB 5K01A 1L2TA 4RU2A 1X19A 2HREA 4O33A 4MIYA 1N6LA 1AGYA 3K8VA 2QX4A 3T1VA 3EWNA 3B9PA 1MU0A 1QIKA 3CS3A 1XFAA 1T5TA 3IRVA 2WVEA 1RYNA 1OVMA 1VSBA 3IKTA 4F3YA 4H27A 1F2VA 1UCFA 4Z7QB 2MYUA 3K70B 1QGUA 2IGBA 3EIXA 2Y3IA 1F4LA 3SF8B 1MB4A 2NIPA 4RHCA 4HGQA 1WXDA 4MR9B 2J3QA 4QELA 2P67A 2ZJPQ 3MMXA 2JCXA 1E2LA 4CF6A 4DLVA 4HQFA 4D3XA 2ISCA 4DDKA 2C4UA 1GSHA 2ZIUB 4ALNA 1SPBS 4FXWA 4FFSA 3U4DA 4F9GA 2CSXA 1D8TA 2OEJA 1EQUA 1E61A 3OVSA 3IO1A 3ZEAA 2V6AA 1BSVA 2FNAA 2Y0EA 4YRKA 3AU9A 3T95A 3DAPA 1A2QA 3WKEA 1WB4A 1QSLA 4ED5A 3EGZA 2AR9A 3L5OA 2REQA 4MVJA 3MD1A 2F1JA 4P6QA 2EF0A 1YR9A 4OG2A 1VQKS 1TLTA 2NTVA 4NNOA 1GT91 4K26A 2KBEA 1HRDA 3D7SB 3OPKA 2Q62A 3LO8A 3LNCA 4DCUA 5HKLA 4CF7A 3Q41A 3M2UA 3GEDA 3NNAA 3OX2A 5CFPA 3VHLB 5F3TA 3VNQA 3FDIA 4QQ8A 1YZVA 1DMRA 5E3CA 2FE4A 1OTXA 3VU9B 1BWEA 2FN4A 4C76A 4CKEA 4MT1A 3U1BA 3C19A 2CKMA 3OO1A 2HK9A 4YV0A 3D6FB 2HU2A 4CF3A 1J5OA 5EPUA 3NHSA 3H1EA 1GKLA 1U8AA 5J2UB 2RK6A 1WBBA 3H9CA 2O3SA 2JZNA 1ZK3A 1KQOA 4J7AA 3D6AA 2A78A 1ROFA 4G1MB 2FWMX 3ZKWB 4QYZJ 1SKAA 1PS8A 1YDFA 3UKOA 1H2BA 1R37A 1U9IA 1A2KC 4B3JA 2C20A 3GDOA 4DR3B 1U94A 4EY3A 1TYAE 4YRPA 2GMLA 4NXNF 2AMLA 4CNZA 2UYOA 3QNWA 4B4KA 4ZC8A 4BNLA 2I3ZA 4LF4F 1Y5NA 4E12A 2EEPA 3KAPA 4OA8A 1GGFA 5CYQA 3P32A 1A9RA 4MVJH 1G7TA 2PGLA 4QHYA 1U8FO 4M5IA 2HRBA 5K4GA 1KQNA 5TIIA 1TMMA 3TPCA 1TGYA 5EWEA 4USJC 1IFXA 4UM9B 3C5EA 3OQPA 2HIAA 4RH0A 4CO5A 1E0DA 3LAWA 4DJTA 4CO3A 1WB6A 2LR0A 3AFNA 3UMBA 4ICLA 1WUUA 2NQ2C 4W6QA 3ZV4A 1L3BA 2I4NA 1ZD2P 3NO4A 4IDNA 3QHQA 3GRUA 3LHKA 2YJ3A 2BJVA 3CHYA 4L1KA 2HZAA 4M38A 3VXKA 1UBEA 1TTQB 1WVIA 3HUDA 3RB3A 3W3SA 5CAAA 5A04A 4QW9A 1BQMA 5IBPA 4ZJYA 4PWUA 4NLTA 3N05A 3P6YC 2X4GA 3P4XA 3VZDA 3U9TA 2DBQA 4WV3A 2HLDD 3EH1A 4F8JA 3EFOB 4D41A 2GH1A 2L2QA 2XMCA 4M1EA 3FCSB 3FQLA 1GTG1 3BD7A 1F48A 2NV2B 3TRGA 3W8GA 4RDHA 1H0HA 1KMHB 1Z2DA 5EHQA 1S2MA 5I8PA 4ENQA 3RB0A 5IXUA 3G2HA 2QBYB 1MJFA 1ZQ1A 1EH5A 2BCJQ 2I7XA 2P9JA 2IW3A 3L3CA 1TGVA 1Z88A 2XVMA 4HDOB 3DS8A 4YJFB 1P1IA 3QUSA 3IR6B 4D5EA 4YO8A 4BWFB 3NT2A 1W0JA 4ZT7A 4ZPTR 1F20A 3VO2A 4MMZB 3QRRA 1O8CA 4E15A 2HRYA 1DZ5A 3QLEA 1KVKA 3R2CJ 4YGXB 3RS3A 4BP9A 2J5XA 3RW7A 2Q9CA 5CMLA 4J90A 4AZWA 3G86A 5ESRA 2PFGA 4JHXA 1KEWA 4EHJA 2D1TA 4YUXA 2DFPA 4EVSA 1GTL1 2QTWB 5GV7A 1AQNA 2AV5A 3PQFA 4OQMA 3VKUA 4DJFC 3D0OA 2QPOA 2H0RA 4KUHA 2XMGA 4WL0A 3DYBA 3E1SA 4IUDS 3HB7A 2DULA 1JMYA 3QGIA 3IVMA 3IP9A 3F7NA 2ZIEA 2W93A 1TLFA 3SU8A 3M7IA 2N7CA 1Z6PA 3QAEA 5A3QA 3OQMA 1A9ZA 3AERB 3GCDA 5DX1A 3THYB 4XYMA 2BE2B 4LJMA 4JT8A 1FD8A 3CDUA 3TPFA 2BKLA 2A5JA 3ZZZA 2JFDA 2KE5A 1R74A 4P2MA 1JXAA 4Y2YA 1L4NA 4RCVA 1T2VA 4PQYA 1SBNE 1OH5A 4IYJA 5L3SB 1E5DA 4D0GA 4M9RA 1Y5MA 3AOAA 1JVSA 1SC3A 2R8EA 2VUTA 3OA0A 4LNUA 1NQVA 4HDCA 5E4JA 1WZ2A 2BH9A 1A77A 5HNKA 3ELBA 4MVJF 1W30A 3DZFA 1U80A 1SC9A 5A8KA 1TR0A 3EYWA 2WWXA 2D3OR 3MW8A 5F2NA 2W2VA 2BHLA 1SB8A 4B2LA 1JXMA 3NLLA 1VYTA 2F59A 1PFUA 3VZIA 4XWYA 1SHUX 4PGFA 2IYZA 3PIIA 8AT1B 1VHTA 3IKLA 1NW6A 4DCOB 2VI5A 2BM1A 2ZR9A 2REXB 1O08A 2A0WA 1LLUA 3LGSA 4DANA 1YUBA 2XLJA 1RHRB 4YA6A 3AR5A 3FJ1A 2JFKA 2E82A 4IFVB 3QGGA 3D0HE 3VZSA 1I3OA 4DJBA 1I4TD 4E1AA 4YJGB 2V8BA 1X0PA 3DP7A 2E1MC 3SIXA 1QVFR 1X1AA 3ILYA 4QQKA 5B53A 4XDYA 3F4LA 5CBPB 2KT5A 2O2JA 4D79A 3RI3A 2UUCJ 5EJ4A 1KDNA 3LLVA 3HP4A 1YMVA 1P2UA 3INNA 1P0PA 2H51A 3AP1A 3HN2A 3OW2R 2V7QA 3F1LA 5ALJA 3M8YA 3P9ZA 1R4MB 2AWNA 1LK0A 2EG2A 1KVQA 1FO1A 4TV8B 1Z25A 3TKAA 3FZYA 1UBJS 1H2UX 1WF1A 4AY5A 4JOQA 1RHKB 4RBUA 5CRIA 3DLGB 1QH8A 1GU1A 4G1VA 4NENB 1U1NA 2GHPA 3K8OE 1HTBA 5LP1A 2WG2A 1F5NA 3L79A 1E2BA 4B3RF 1BE4A 4EO6A 3FRZA 4FHCA 1E59A 3A1YG 2NYRA 4ZV4A 4C8YA 1NW3A 2O2IA 2DGQA 4DFPA 3VR1A 1FY2A 2X77A 3B4DA 3TSWA 3UVJB 1WMFA 4A27A 4TYMA 2P5TB 5ILOA 5EIBD 4TLEA 3WL6A 1HBJA 3A8TA 3HVHA 2NR0A 4X7MA 3VAGA 3BFPA 3K8ZA 4ZI5A 1RLMA 3BXPA 4TVAB 4YEDA 5DH9A 1JFVA 2C5BA 3R40A 3JYHA 1FF2A 3UD3P 3UW3A 2Q3HA 3BWCA 4J0EA 4U00A 2EVWX 5K9FA 1JFRA 5BUQA 1JB0C 4AN0A 2PVSA 2WVDA 1RMQA 2DFVA 5EHHA 3ROGA 4Z2AA 4B7CA 4TS1A 1GY8A 3BHJA 4RETA 5EMNA 1QU3A 3K1AB 1UCNA 2XNCA 4DSZA 1EK6A 1NI3A 4CTKA 1JBEA 2RIJA 2F63A 1T2UA 1EIZA 2JHPA 1Y4UA 3TX6A 5E41A 4P74A 2OECA 3FGNA 3AFOA 3OZDA 1RC0A 3QSIA 3ZZRA 2PUEA 4ND5A 2JBWA 4DC0A 1PZNA 2ADFA 1Q14A 2CB9A 1KVIA 1L4UA 4Z37A 2P30A 2OO5A 3FUUA 3FTNA 4C20A 1VCNA 2V1XA 4P86A 2VWPA 5HATA 4X8HA 1T5DX 1GX5A 1JTEA 4JLAA 1UZHA 2HQRA 2ZYWX 4TYPA 2Q3MA 4W63A 3LY9A 2G9OA 1IHOA 1T3HA 5TEWA 3B78A 1IQTA 2BA9A 1KJQA 3G0CA 2Q0SA 2H9ZA 1CFZA 3GZNA 3UO8B 1GSAA 4EEYA 3SQDA 1MB9A 3PT9A 2DISA 3IUPA 3KLHB 4AYXA 1KOFA 3EEYA 1D6MA 3Q85A 1LJUA 3BKTA 5LZ7A 2UUOA 4XCXA 1THZA 2RD2A 2Q9AA 4GZ3A 3TLYA 1DWQA 4ZMMA 4M6WB 4B6EA 4D8VA 2XKJE 2Q1LA 3LFHA 4EVIA 2JLXA 1TL7C 4KWEA 3AVPA 4R8SA 1NGSA 4CQMD 3A9SA 1AHHA 1VJCA 2E4VA 2IEBA 2WU0A 3QEOA 4G8DA 1EFUA 3N8GA 2DWOA 3BSNA 2VZEA 2YWKA 2BT4A 4BOYA 4LJKA 4PWWA 1BDMA 1F6WA 3JQAB 4IWXA 2HYIB 1SCUA 1A3CA 2W58A 1OU4A 3JQAD 2M2BA 4CNBA 4PRFA 5J2MB 1RVDA 3EEIA 3VPFA 3BB3A 3CLRD 3HJBA 5FNVA 2DVIA 2BDUA 2I67A 4ZVFA 1SB9A 4UTOA 1LWCA 2QB5A 1DKLA 5AKHA 5BNZA 3WIDA 4LV5B 4R5PA 5DEIA 4BMYA 4ZCTA 3HRKA 4L8LA 3CJSA 3BEGB 3OC6A 5KQSA 5DIFA 3ZJYA 3EK2A 2X2PA 5D85A 1ISJA 1FQOA 1RSZA 2AXPA 2JPDA 3GLGB 2C2XA 3ISVA 2C2WA 2VPIA 2MZTA 4URXR 4CG2A 4KO1S 1ZUIA 3NKVA 1S3SA 2J6IA 4K6OA 3V9PA 1S77D 2XQJA 3AJAA 1RWUA 2BF7A 1OPZA 3IP3A 1J2VA 4KREA 2D4HA 5GONF 2AVDA 3NBQA 2L42A 3DBLB 4P81A 2GPYA 5B6IA 4CKCB 1V11A 4Y1FA 1N5IA 3UQYS 1J24A 4G5YA 4N0QA 5FI0B 4GO7X 1WNFA 1JDJA 3T3HA 3ZDFA 4CTNA 5AW9A 4YOEA 1VRTA 2FSGA 2RJOA 4MTCA 2FWIA 4IIFA 2BGUA 1ACJA 1SQ0A 1QHXA 1E77A 4E94A 2WJWA 2VFAA 1AZWA 4MKYA 2VAXA 1IVYA 2PT6A 4HDKB 3W5ZA 4OZLA 3OQ2A 3SDSA 3UEOA 4IF4A 2J46A 4YQEA 3U7FB 1Q82T 5THQA 1SZPA 4XD7A 2FPIB 4OHOA 3RARA 1XZAA 5BSKA 3GVIA 5CEJA 1FKOB 3K2EA 4GXTA 3GLFB 1EVEA 1QM9A 2B2CA 1XJWB 2VJLA 2JFGA 3BAFA 4BMSA 4FD2A 1ZH5A 3AUSA 4LW8A 1UM9B 5KJ6A 3D3QA 4QUKA 2B9EA 1PGNA 4LQ4A 4DPMA 3SG0A 3IBFB 3K0FB 4UUAA 1HHQA 3Q0AA 4Z5XA 2Q1UA 3HSKA 1OPRA 3RIEA 1AIPA 5DLEA 3VRHA 2RH5A 1FMTA 3OFGA 1PR1A 1UEXC 4G1EB 3SHOA 5F2KA 4L3NA 5KFZA 3IAS1 4HGRA 3L0PA 3ZCTA 1T29A 3BDPA 4YJ3A 2FJDB 3GELA 4IVPA 5C80A 2VDNB 1W73A 4J0JA 4U0JA 1XNQJ 2XB6A 2H1CA 2QLBB 1W4AA 1PRYA 1GGHA 3PKZA 1NVGA 3VH1A 1BS9A 1EWQA 4FYMA 3AHHA 1LUAA 3CF4G 4Q82A 4FFMA 1N4AA 1Z5PA 1SG0A 5DYTA 4TYAA 3QMPA 4S0ZA 2F67A 4TWRA 1NMEB 2CPIA 3RADC 5K2MA 4I5FA 4DV3F 4NIMA 4RMIA 2OVBA 3BYPA 3E3LA 4DR2F 3LI2A 2HSJA 1HTWA 1Z34A 2LECA 2E5LF 4ZVEA 2IHNA 4D9GA 2CADA 2Q9UA 2WRZA 4P4SA 4B17A 2VJKA 2OENG 4QXMA 5JXJA 4X7RA 1Q21A 1W5BA 3AM5A 4K6FA 5DTMA 4X97A 3AYXB 4LSWA 1OSNA 1GWNA 4CIXA 2CT8A 2RKBA 3OECA 3D4NA 1HG0A 1V25A 2MMYA 2EKDA 1I7NA 3G85A 4DCNA 3EVEA 2ZH8A 5TRTA 1MJGA 5T6MA 4URGA 1RYRA 1ZMOA 2JVIA 1FKPA 5AXCA 2PWPA 1E1CB 2VBWA 1U98A 4PANA 1DC5A 3V4MA 3UAOA 4LXIA 3C5WP 3EG9A 1ELOA 1MC8A 3S2EA 4UQTA 2GT1A 2VV5A 1FTNA 1NHKL 4DGQA 5FA6A 4DR6J 1BY9A 1UAYA 5L38A 2COUA 4BNJA 5HF6A 2Y71A 1NVBA 4LC1A 2YMLA 1MGOA 3F47A 2XXJA 1P27B 4U95A 2YQ4A 3SEQA 3F9CA 4TXSA 1N2XA 3HNRA 1QHFA 2Y4NA 3MTAA 1AHIA 5ITZA 2E87A 2G2OA 3LT1A 4KV8A 3CNHA 1QVVA 2ZQYA 2C07A 1QB7A 2BGWA 1XYYA 3QGMA 4DQIA 1L4KA 2QMXA 3NNDA 2PMDA 5LP6B 1FTYA 2JFPA 1M6EX 3G96A 3BXZA 4IIXA 1OXBB 1FFXA 2DUJA 3UFXA 4NECA 4C05A 5IDVA 4QXRA 4Q02A 4DG1A 5H16A 3CUUA 4PINA 2IE8A 3UPUA 4JAVC 4G89A 4Q8FA 2V65A 3ZD7A 2C0CA 4L4RA 4PC3A 4HP8A 4X85A 2FEXA 3VUFA 1CUBA 2AKYA 4IGAA 5JZSA 3PGXA 1WIWA 2W2PP 2HAEA 3GZTB 5BN5B 4X4TA 3P2EA 3QSGA 5LXTB 2EQBA 2AF6A 2RVJA 1RCOB 5CURA 5LA6F 1IK6A 4WRRA 1FX2A 4EGSA 1LNQA 1W2BR 5FBQB 2BGNA 5DRKA 3AUJB 5DM7Q 4L74A 1N7HA 1U0BB 3UWPA 3AEXA 2R6FA 3T1QA 3C4QA 3FLMA 4BDTA 2FHKA 4EBCA 4WXWA 2NN3C 5THKA 3KT0A 2BZ1A 4YAWA 1ONPA 4L2IB 4JYCA 1FDWA 3TAXA 2XZOA 3U4IA 2E7XA 1RLOA 4HNAB 4IRKA 5AW7A 2IJNA 2VP0A 1MD9A 2DP4E 3RD5A 4FXPA 2YIJA 3NJ4A 5H83A 2VQEJ 5KSPA 3JD0A 1JJIA 2G1UA 4RPKA 1ZVJA 4DBQA 1KIMA 1M1HA 4D3FA 5GZ3A 4IKOA 1DFHA 4O4LF 1L3KA 1FTSA 1K6IA 3GFHA 2H85A 2V5HG 1SJQA 2XVYA 2OOKA 4LSLA 3PC8A 4ED8A 3QUTA 3QQPA 4DR4B 3OQIB 2O1EA 3UPFA 3P9NA 1VFJA 3T5LA 3A26A 4GOKA 3UB4A 3TAUA 5CX1B 3FCAA 5JWHA 3V6HA 4TMWA 4OMDA 3CX6A 1RKIA 3CUNA 4EA9A 4OZ2A 1Y8CA 3GWGA 5D15A 4FF4A 3NBUA 2Z3ZA 2EFCB 2OHJA 2P11A 3JPWA 1QNFA 2X2OA 3BSWA 3KUCA 1O96A 1SUQA 4NZNA 3PWKA 1RYZA 3E7DA 3UXMA 2H48A 2W4CA 3NC0C 4K0KB 2CAJA 4ESVA 4TSKA 1WF6A 3GV8B 5LQNA 3W6ZA 1A8PA 3USCS 2H29A 2DHSA 2J5QA 3R5FA 4EUNA 1P5RA 2H1FA 3FPHA 5AKGA 3M1LA 4Z99A 1SJ4P 3M33A 2X0DA 2W43A 4YRQA 5HO4A 3C85A 2YY6A 3KR0A 4QEDA 1FA0A 5GMDA 4LE2A 5LOVF 4DA0A 3AR2A 2DCLA 1JZSA 2E9TA 4OHRA 3C41J 1TIPA 4NSNA 4US0R 1UAGA 4AMZA 2EVZA 4JQZA 1UPCA 3DHVA 3QU9A 2LFVA 3MEGA 3DRSA 4IDKB 2BBSA 3SZMA 3OJCA 1CW2B 4UEQA 5AJHA 3QX7A 4RTPA 4KGKA 4IYQA 4ZCIA 3U1VA 2D0DA 1W4BA 3LVBA 3QFTA 4TT3D 1BEEA 4ZO7A 2H9YA 5J40A 3Q8KA 3IS9B 4LY0A 1UT5A 1UZDA 4QYRA 5EVCA 3G49A 4IGEA 2ALJA 4OI2A 2HHXA 4NEGA 4E5UA 1T0JB 2FZWA 4RFSA 1DU4A 2AG6A 4XD2A 4DLKA 3WMRA 4CKWB 2VBIA 1FDTA 4QYXA 5AJXA 4FMDF 2IELA 2FHMA 1DX4A 3TEMA 2DVMA 4LQDA 2GBGA 5LVAA 2WP0A 3CFYA 4Q3LA 3UJ9A 4HKQA 3VVBA 3QEKA 1J2TA 16PKA 4ECYA 5FUVA 1RABB 1N36F 3OVMA 1KEEB 1TKTA 4OAPA 3IOBA 5JS1A 1T36A 2B2XA 2IMOA 4PYMA 4TTQA 4D3SA 1TQ6A 4WP9A 4H4OA 1XRSB 4RTOA 4QWBA 1THGA 1AQ6A 3EW7A 1KQPA 2OBBA 3JWPA 1UDBA 3MTKA 3B53X 1VLLA 5J4LA 4QYIA 4C4OA 2LV8A 5AVUA 2PGXA 3G1WA 2BJHA 3R5AA 2FPMA 2GN0A 1A8UA 1W2WB 2GDJA 2PA0A 4Y9SA 3PPVA 3A3NA 2XJ9A 3ELUA 1U6JA 3PYEA 3OZIA 4ZFNA 1KK1A 3I64A 4UHKA 1EFPA 1XNRJ 3OHAA 4BKMA 1FYDA 2Y0BB 2IPOB 4LQ3A 3IV7A 1LDMA 5H3HA 4OSEA 5EUCA 1L8LA 3WYFA 3MCOA 4QW8A 2XNJA 3K0HA 2WWHA 1RCXB 2IBTA 2AKWB 1I9CA 4RBVA 2ZRJA 1XUOA 4XJSA 1CUEA 4LF8F 2H0QA 3I2HA 4PYIA 2X6RA 2Z5GA 4D46A 3RGWS 3L0YA 3DOKB 3OVBA 3R5JA 3ZY3A 1S12A 1NFFA 1HQUB 3NWEA 3O8BA 3P45B 1VBZA 1ORTA 2FHOB 3OF3A 3JASA 1HDIA 2EX0A 5H3LA 1OH8A 3JXOA 1Q19A 1JEQA 3AQIA 5INTA 2ILTA 5BSMA 4B31A 2YXLA 1J5EF 3OQNA 2HDNB 1G4CA 3DV2A 1QSGA 3NVAA 3RRZA 3EGXB 4U2KA 2XXAB 1Y98A 4ZVRB 4UXIA 2Y8EA 2V4QA 3GHHA 1A5AB 4NWBA 2B99A 2Z83A 4FNGA 4V3CA 1MOQA 1EX6A 1ZM9A 2E6UX 1WB9A 2QJOA 1R6DA 2GHVC 1QYDA 3GXOA 1SKSA 4UUQA 1NN1A 1ZEMA 1D9XA 3DT6A 4OXQA 1I2MA 3TLGA 3ELHA 4Q4CA 3M3PA 4AL4A 4WBNF 4P31A 1A4RA 1Z7BA 3PQ7A 2WYWA 2ZSUA 3L8ZA 3RJTA 3ADPA 3TQFA 1MQ8B 3WL8A 1Y1PA 1MOZA 3WL7A 2QOEA 1OKKA 4Q9IA 4D9CA 1GRRA 1KO1A 3KG0A 5LQAA 4NRTA 3MJDA 4CYUB 4OLHA 2R8ZA 3A6EA 1QNLA 1WHVA 3MSCA 2CK3D 3M1YA 3U81A 3CMMA 1ZD4A 1NVWQ 3IJPA 1TE2A 3LBAA 5T8KA 3CEDA 3SFVA 4Z1MD 2QAJA 4RJTA 1NHUA 2CHFA 3DZBA 2MGZB 3ZNQA 3QOXA 4HX5A 3IEUA 3IPXA 4MS4A 4LWZA 2LMIA 2GZ1A 1X7WA 3QZUA 2FZVA 2QTFA 5HROA 1HPZB 4Z8YA 3TLAA 2C2HA 4O1MA 5IN5A 2JGKA 4HR7A 1PHRA 1W5TA 2F3PA 1SUCA 3ITDA 3LWNA 2V0NA 1XLVA 4FGJA 2FK7A 4JBGA 2BFCB 3IVXA 5KFKA 2OEMA 4NYJQ 4OI4A 4Z4HA 1QIIA 1X74A 3PEEA 4NOLA 1FU8A 5LZ9A 5DG8A 3OH8A 2FDNA 4YFUA 2A3JA 2BTOA 3CCQS 1HNXB 2D1FA 1R4AA 4R1TA 3WB2A 1JA1A 4FVMA 1R64A 3LDHA 1PR5A 1E1DA 2V3WA 3ISNC 5K0EA 2FLLA 2B8QA 1E1NA 4N5IX 1AN0A 5K2OA 1CJVC 4KG7A 4JL5A 4HD8A 1G3IA 2W2LA 4BKPA 4JYAF 4ZVOB 3UWKA 2HMAA 2X6TA 5T3UA 2H3EA 1RTIB 5EMLA 1RT5B 3AJRA 5DNWA 3I87A 2ANBA 4FT4A 3H2HA 3STVA 2CQDA 2EKPA 2J3HA 1WXXA 2AZXA 1NPRA 2PLRA 3UCEA 1VZ3A 2P41A 3DHXA 3CR8A 3FBBA 2GRUA 4BVEA 1S5ZA 4K9DA 1UVNA 1HYGA 1BEZA 4RTLA 2ZH2A 2UVDA 5G41A 4ZKEA 4R6WA 2C8VA 3BG5A 4EJ2A 1G38A 3QEMA 1YUMA 5LJ5Y 4DWJA 5K8UA 2B1JA 1NU8A 2IIVA 2PA3A 3RGGA 4M0FA 1GCGA 5JU6A 4E88A 5GINE 1N32B 2GHTA 4EQ6A 4OM7A 1XFDA 2Y6VA 2R8PA 1GZ3A 2H4HA 2FQQA 1QQAA 3DDNA 2QTBA 4CV0A 4HGYA 3C14B 4OVKA 4PGHA 4NH0A 5KG4A 3ROMA 4FLEA 3HSGA 2IYVA 4OD0A 4OYAA 2Y0SD 5D4LA 2O4CA 1QGYA 2NX2A 2X1MA 3RAJA 4FKMA 3AEYA 3PYFA 2X0JA 4CQLA 3AETB 4OQDA 1SK8A 3GUYA 2XWYA 2O5DA 3HK2A 2OUIA 4M88A 1L5OA 2VG7B 5B0CA 1KJZA 2IA6A 1A5TA 4RKFA 3IKMB 3W8RA 1UKYA 3HQ4O 1OA1A 3FDFA 4CLWA 3B6EA 3ORYA 1PGPA 1FPQA 1PQYA 4MV0A 5E3IA 3R6WA 4Q2LA 2XUFA 3IP1A 721PA 1AD2A 3IYLW 5FUYA 3UMFA 3FMPB 4CI0B 1TJPB 2XUDA 3IMKA 4V0MA 2OV8A 2RHWA 4YJHB 3RSCA 3OPNA 1KYWA 5LLSA 4A2CA 1DZ3A 3SZGA 3R7SA 1N1MA 4G97A 1QVGR 1GGKA 4C0KA 4K2JA 1TUWA 2NAFA 3ROFA 5IC6B 3ZDCA 5K8NA 1Y9AA 1QJCA 3T1HF 1LC3A 1ZDMA 3R97A 4A2WA 3F3SA 1WHXA 1QQ7A 2DHRA 2ANCA 3HSZA 2FR8A 3CUKA 4MK9A 4OX6A 4X64F 4KV7A 2NO0A 1UBUS 1EFHA 5JATA 3PUZA 3VNUA 1UC8A 1EDEA 4E09A 4OK5A 1OTHA 2FKAA 2WLSA 4R2LA 4LNAA 1YQHA 4CCHA 2OEPA 1YE8A 1VQ7S 2BTQA 2IDZA 3B1WA 3UBMA 2JIZA 1U2RA 3V4VB 3W5BA 3K9NA 2EGUA 3L1HA 5K8IA 1I6LA 2BGMA 4FC6A 1GM5A 1CS4C 3RKRA 4NCKA 2ODTX 4JYBA 4HNSA 3NIWA 4PLVA 4EYKA 4ZQEA 3LECA 4RK7A 2WG1A 3RS5A 3CV3A 5FPQA 3PJFA 3SVTA 1VMBA 4CT0A 3WS7A 2AR0A 3I9OA 3ESCA 2YCLA 4OV1A 2PL9A 1TCVA 1RRKA 5FEUA 3T3IA 5HOQA 1GUBA 1TC2A 4KO3S 1ZIOA 4A8MP 3SXUA 1OYYA 1N34B 2G5TA 1V6HA 1JB9A 3JAKB 3VMFA 4FTWA 2JATA 5KT6A 2GFFA 2OFPA 2PX4A 3EGWA 4HQKA 1HY3A 5E7JA 4DKJA 3C8MA 5B7PA 1YONA 3JWGA 4XVQA 1QIFA 3MR7A 2XB2A 4K2AA 1QV7A 3O4JA 3DBRA 4Q4JB 4BUJA 3AIKA 2WUDA 3TZEA 4B6OA 4J16A 3UCUP 3ER8A 2DHCA 3W1VA 5BVHB 1KRPA 4N4AA 1Y8RB 3O6VA 4WJZA 1JILA 2L82A 3V4LA 1RXCA 3T1HB 3SDEB 4OHZA 4OP2A 2I6QA 1U0TA 4MAKA 3TAMB 1SJFA 4I9HA 3EIEA 1BOOA 2YW9A 1U0HB 1UKBA 4FS1A 1AA1B 1RU2A 5D3MA 4HPJB 1R89A 4KDRA 2IGTA 5DZSA 4DJEC 3E8MA 1BA3A 2FSUA 1HYEA 1RZRD 4R3WA 2EJCA 1Z0JA 1N6IA 4I4TA 4TTJA 5GP1A 3DTVD 3NFYA 4ZP6A 4BCBA 1A1SA 5H81A 5HKAA 5H82A 3S1TA 1SVLA 4NARA 3FNNA 3K32A 4OZ5A 3IXMA 4EPVA 2XCSB 4L3OA 3QNMA 3WO0A 3DO6A 1RPNA 1JX6A 4K40A 1N4DA 1FQWA 5BW8A 3K2YA 2XZLA 1C2TA 3UFCX 1SH7A 3SV3A 1AA9A 3I8XA 1N9KA 1R7RA 1E89A 2VS1A 4KO2S 4Y2VA 5LXYA 2K2QB 3PP8A 3OA2A 3T3EA 3SN6A 2GZOA 2XM3A 3ZTWA 5I4MA 1QB8A 1OKKD 4HN4B 3B7WA 3CIZA 1Y8QB 1T9GR 1FEHA 4UARA 5AOCA 5FPTA 3UGTA 1W1IA 1XR5A 3HFGA 3H5LA 3F78A 2G88A 3PIDA 4A8OA 1TUEA 1M33A 3EXCX 4RQUA 3H8VA 4CH1A 1Z0UA 2NXCA 4RW7B 4R4JA 3IAM9 1JFFA 5DM4A 1PFYA 3AB2B 3T7TA 2YXEA 2CLHB 2OG1A 4LIWA 3D28A 1V3UA 3TF5A 4WU2A 2WJGA 1RP7A 1E7SA 3L4JA 2RGNA 3G2KA 3LCMA 4X65J 4MRVA 2AJ4A 4R0EA 1QRRA 2RAFA 1MRZA 1CS0A 1OWNA 1Y7LA 1S4MA 2MTBA 4KUEA 2Q0XA 2C29D 4ZVTA 2J8ZA 2HIQA 3ZJTA 4J03A 3L1KA 1BH2A 4QZVB 4BPRA 1DTQB 2BFFB 2FFRA 3JQ8A 2BEKA 3E2IA 1U28C 3CWQA 3PEUA 1X31C 2RJZA 3DPSA 3BSOA 1DQ8A 4Y9RA 5BORA 4FHGA 4EW2A 3M6VA 4URQU 4GYJA 1EPUA 3MEDB 4N5HX 1YBMA 4DPKA 5LB2A 2YMMA 1PDOA 4RD1A 3U3ZA 4KYIB 3EA0A 1NJYA 4RDXA 2AN5A 3A4VA 4JMPA 4DV4F 4OLFA 4DR2J 2EF1A 1HE1C 3LRPA 4PWDB 4PXAA 1NX6A 1G3UA 5IT9A 3NXSA 1YKWA 4PU0A 1AN9A 5DLGA 2CJXA 2BKPA 4LFBJ 2DF8A 4CYMA 4Z0PA 2CE7A 4GP7A 2QTVA 2ADMA 3HR7A 1FDRA 4RVDA 2PSDA 3EF0A 2UXBB 2FPRA 2PR7A 4O2BB 2P5YA 1WTAA 1P9NA 3WI7A 5DQHA 2RAUA 1NY6A 1ESZA 2BKNA 1CEXA 4DJ5X 5BN3B 3C7DB 4JQOA 2X1GA 1RISA 4N6GA 2YKOA 3AB8A 1DAEA 5JNTA 1YJWS 1V39A 5K8CA 4F2DA 4HYTA 4M36A 4F4JA 1N78A 3BO4A 1FP1D 3FMFA 1EBFA 3E9MA 1KE1A 5CLQA 1RT7B 3CXCR 6CHYA 4G0ZA 3SSSA 5J1PA 2WVFA 3GGPA 2EKQA 4TKVB 2HQIA 2JJYA 3BGOP 3LFTA 2QA2A 1N5OX 3M82A 3O26A 1BMTA 4CM9D 3GLHA 2Y1XA 2JVOA 2G7ZA 1T5BA 1IBMB 4DWVA 2YDYA 2VYNA 4YRAA 2GJIA 1T9ZA 2I1WA 4RYLA 2QYOA 5JJBA 2MKSA 2CDNA 5B30A 3O1IC 4UUBA 2W70A 3A6PC 4UASA 4RF3A 2IQIA 2P6MA 3PGVA 2WUGA 1SXGA 4ALKA 4LF5B 4RD3A 4TMKA 2YVUA 2PQ6A 1TA9A 2LP4Y 1UOPA 4QDXA 4I1YA 5EXPA 3G8AA 2YNMA 2VNJA 1R1DA 1SD1A 3N2KB 5T14A 2N3ZA 3IHLA 3KBBA 4O3QA 3MEEA 3WBZA 2V7GA 4YACA 2K8GA 2A6OA 1COWD 3K6JA 4LVUA 4XVCA 4NOHA 1KQ3A 2E3JA 1QO9A 2R7XA 4USIA 4WI1A 1PEDA 3E23A 5HKKD 1RC8A 4NI2A 8GPBA 5A0VA 3DN9A 1SUBA 4QGSA 3KTQA 2CJWA 5DWVA 4NULA 4A03A 4BNVA 5JDCA 3SQGB 5IN4A 3EZYA 2XMRA 1I9GA 1U47A 5K20A 3DKRA 4RKQA 1NTOA 1G6OA 4D82A 3HJNA 2H1VA 2ZT8A 4KKOA 1ESDA 3TEFA 4MWCA 2BGGA 5DDPC 4D9HA 5KC8A 4FC7A 2Z6VA 2RB7A 3GT0A 1KFJB 2PMBA 3WDSA 1C30A 5IJXA 3IPAA 2CYCA 2ZHOA 4HY3A 1XWFA 5JIBA 3D3EA 4BGEA 4GMKA 4MIKA 2C3MA 3K8QA 3AM1A 2VKRA 3ZBQA 1RPTA 4ENTA 1G59A 4OQLA 2IHUA 3S6JA 2O8NA 5JFTA 5EKSA 3M9OB 2I1QA 3R8CA 2AF3C 3OTDA 2RGXA 5J47A 1VHFA 2QA4S 3PFGA 5A1TA 1H8HA 2RI6A 4YO7A 1U8WA 1Z6XA 1X14A 1X9GA 1XNGA 5T4HA 4BMPB 3OUYA 1SJ3P 1XA0A 3GD7A 4DHEA 4KQCA 2C5HA 1O6CA 2DGXA 2A33A 1WF3A 3NHFA 3KSAC 2IITA 4P4TA 2NU9A 4CLZA 1U8YA 4IHAA 1T2FA 3R9WA 3KLNA 4WBNB 4IG0A 1KI6A 2LXNA 3CLHA 3W2GA 1RAGB 1PJLA 1MMLA 1R8JA 3AW9A 3TR6A 3LO5A 1X39A 2CLCX 4OO3A 3ILXA 4BXOA 1HBMA 2K2WA 4ERDA 4HK4A 2LD4A 1Q95A 4ZVQB 4M7PA 2FN3A 4KQHA 1WULS 4YIHA 3JALB 1NK8A 1KYIA 1S8NA 2DQYA 1KFKB 1TD9A 4GE3A 1ZWLA 1TB4A 2O8DB 3M32B 3MJCA 1JNYA 2WI8A 3JR7A 4HWRA 4KR9A 3N6LA 4IJ5A 1GMWA 1TF2A 4GR4A 3Q3JB 3KKQA 3TUZC 1USIA 3JSYA 5HJXA 2M88A 1NVVQ 1U8EA 2WJ4A 1JMTA 3RFCA 4RMNA 1CLFA 2VQFJ 5HE9A 4YR3A 1LBIA 2VNIA 4NYMR 3TD6A 5SICE 5KSZA 5EDWA 3P9YA 5CA1F 1W46A 2OCIA 8RUCA 1HNVB 4HUQA 2NNWB 3DKVA 1ZM4A 4AQYJ 4WXYB 4EWLA 1OV4A 2KMLA 4EG0A 2AX4A 1CQJB 3MM7A 5B1HA 2NO1A 3KZOA 2WTAA 1E1LA 1V16A 5JSHA 1CRLA 3O93A 1OYEA 1Z6GA 3ZQUA 2X9GA 1R7IA 4J29A 3NX4A 2DR8A 4QDOA 3G0OA 3O9VA 1XZDA 2YXNA 3PHHA 3H5IA 4N56A 4RV4A 1VRUA 2ZJ8A 2WKWA 1Y10A 5EZYA 5DHTA 4PPNA 3SOZA 1UDRA 1BQ3A 1JPNA 4LY6A 1Z62A 1T1GA 3LRXA 2YTZA 1Y9ZA 3CIFA 1M66A 1SD2A 4H1UA 3IPRA 2VJOA 2W9AA 2GN6A 5KT5A 3L4EA 1Y3JA 4L3KA 1BMDA 3MT8A 3GGSA 3W0LB 4RIIA 4BO2A 1GPUA 4AKGA 1AX9A 3MAGA 2HNZB 5L45A 3TCXB 5LMZA 2OPSB 2VHQA 3C15B 2C2KB 3ULHA 1NZJA 1RYEA 2RCNA 4R2MA 4JMLA 2N42A 4BFCA 3WAJA 3AODA 3H0EA 3RYCA 3B8HA 4WGGA 3HYNA 3JD2A 5C4MA 2JBAA 3WNCA 5ARDA 4O4LB 4J9MA 3A6FA 4JI3J 3I6QA 4UUMA 4RNNA 4LBVA 3MS7A 1FWPA 2SKEA 3WBJA 1P2VA 5M7EA 6ADHA 4GG1A 3GJ4A 2I9SA 3VR3D 3GN2A 1UBHS 4MWSA 2MKKA 2QORA 3RSOA 4LF8J 1W44A 2GR9A 2ZTMA 3GJ5A 2JJ8A 4X71A 2MEWA 3LW5C 4MMXB 3PNQA 2XYPA 2J07A 2Y0DA 2FGCA 1YZKA 2VSOA 3AJ9A 2CQPA 4ZRNA 4QIGA 4DUZB 1ILWA 1EK1A 1MVLA 3IAFA 2KDOA 4BNDB 2DPMA 2ZSIA 2QDXA 3D0QA 4EZ6A 4CR8A 3UUWA 4LMAA 2Q6CA 2YNFB 3WWCA 1CC7A 4ABYA 1AUOA 3VKWA 2ZYDA 5FDFA 4HVCA 3WQQA 4XQEA 5EZSA 1KLNA 4I50A 1TCUA 3HN7A 2QXYA 4KIFA 2JC3A 1BS1A 1JLLA 4I5GA 3PDJA 2J0QA 3NGMA 4BTEA 3TOZA 1XX6A 1V8DA 1YI0A 3C97A 5EMHA 5IAJA 2J9RA 5EJAA 4R81A 3ES9A 2CVPA 2UZ0A 1FP4B 1SIWB 4WE1B 4N0PA 4UCFA 2WTUA 2OV3A 1JSRA 4WZBE 1QZ3A 2CJKA 1RE1A 3U4QA 4PXBA 3DAGA 4QLOA 1WX1A 4JIMA 5LD2C 1MUUA 2HA0A 4CKXA 3VVTA 4PYJA 1USGA 4XOUA 1XLTA 4NRUA 1RGVA 1P3DA 1CYEA 3DOEA 5D00A 3BRWA 1GPYA 2ZE6A 2QL5B 5EJFA 2HSEA 2D59A 3KHSA 3AKZA 3QRQA 3EQZA 3Q8VA 1NJ8A 2O4UX 2V7TA 4D8YA 2XTJA 2CRLA 5LC1A 2IRXA 4L72B 2NSBA 1L5GB 1RXWA 4JI6F 4QJIA 4E98A 3HHDA 2AJQA 2Y67A 4CLUA 1EFDN 1Z4JA 2V34A 1CP2A 4ZVLA 3HHLB 4CHTA 3K17A 4QRIA 1VFNA 3JQGB 1S0MA 5HBRA 4IHJA 4M55A 3UK2A 3RUPA 4IV0A 1GARA 5ECWA 3N5KA 3ETLA 2O6HA 2A9OA 2GVDA 3RYIB 4LRYA 5C42B 1M1ZA 4DEVA 4DSNA 2DHEA 4CUZA 1O94A 2ZXEA 1H6BA 4ETNA 4CCYA 1XWWA 3D6TB 1Y4SA 4L51A 4TU9A 3E5NA 4YY3F 2Y9MB 3HYTA 1XVAA 2PMKA 4GUAA 4NYPA 1A9OA 3W1WA 1OIVA 4ER8A 2GLTA 3IHKA 4D1YA 1X1SA 1S02A 1FF9A 3L02A 1R0XA 5B4VA 4PAWA 1M1NB 3B6ZA 3BM7A 2YC2C 1TVRA 4HHJA 1R10A 3DU5A 2MOKA 2QXUA 4WDQA 4B7UA 2W24A 1IG0A 5JWRA 3JYLA 4KAIA 1JX4A 4ZI7A 2B25A 4QC2A 4K4YA 2YMPA 5A3SA 1L7NA 3KYLA 3JQRA 2F9JA 1DC8A 4OMUA 1OWMA 5EXDA 2WNSA 4K9KA 4KMSA 3KK2B 1Q2XA 2J3LA 1VHDA 3PK0A 5KWEA 1NJWA 5CFOA 5FYQA 4E2XA 5ENVA 5CM8B 3KR9A 3OR2A 4TGLA 3T9EA 1KETA 4PKDB 4DR3J 3RAPR 5K3DA 1KI7A 4DV2B 2ICAA 3CNBA 2PT0A 3O4RA 5K8LA 3RE1A 1KWMA 1FDVA 4RAOA 3V7UA 3WGMA 3V2IA 1KPIA 4RYDA 1XMQB 3T8YA 2Q21A 3GLIB 4LHWA 1ZZEA 2FFAA 5JARA 1WNEA 2HSZA 1BXZA 1PUJA 4MUJA 4L3VA 3FFIB 2CEAA 2EQ5A 1FK9A 3HVWA 3L7AA 2OXCA 5KYKA 1B42A 3LC2O 2ZR0A 4DREA 1OLUB 4KEAA 4J07A 2XWXA 3HL4A 1X77A 1YTUA 4ZHQF 4JLUA 3SYZA 4GW3A 1E9DA 5B3KA 4B6QA 1EXMA 5KOWA 4RW9A 3GFXA 3RYFB 1H05A 1R6VA 5JD4A 2GVZA 2O2GA 1RI7A 4EB6A 1Y37A 2H2GA 4P22A 4CL8A 3PL5A 2OZVA 1FDNA 2AJ1A 4PQUA 4NE2A 3B6MA 3FBWA 5JJCA 2ONJA 2C4WA 2PQ0A 3RRBA 3CCTA 3QFWA 4U9HS 3F6PA 2YYYA 1DQRA 4RENA 3Q10A 2C2BA 1Y4DE 1NLYA 4LYYA 4L73A 3MR3A 3PG9A 3GCXP 3RQSA 4FXOA 3U44A 1HC7A 3IALA 4UZEA 4O2BF 4UHJA 1KIFA 2Y1JA 1WKJA 3ABQB 3RK1A 2JGJA 4FEEA 1GT6A 4A23A 1CJKA 1F5BA 1VE5A 1S6PA 2I54A 4RVGA 2W83A 2ZATA 1QOPB 1RT3B 5IT9Y 2OD2A 3B2QA 4P5PA 4B3MJ 3D7SA 5KYYA 2OPRB 1M8FA 3EUFA 1H2RS 1WLYA 1TL3B 5LB4A 2GCPA 1HDEA 4KQJA 4RS3A 2HFZA 4L5JA 4H60A 2HA3A 2FPUA 4A2QA 4WA7A 3IG1B 1IBKF 4EU0A 2GJ2A 1DWPA 2QRRA 4DY4A 3DWEX 4U2GA 5IWCA 3QYPA 3BN4A 2C04A 2XD4A 4PTZA 2JA2A 3EAFA 2YN4A 2UU9J 2EDAA 3WGIA 1NAHA 4BEJA 4DLXA 2FAXA 1YBHA 1ZAVA 1Y6ZA 4MPPA 2C9BA 4MGZR 2JAQA 5KT7A 4EUVA 2QRMA 1BDIA 3W78A 2LNDA 1HQEA 3F56A 1YIDA 4PQRA 2X8WA 2G2YA 1GILA 1P33A 4I2QB 4GKVA 4JEMA 3LOQA 3VU0A 3PQ2A 3QV2A 1QHHB 3SYKA 3RVDA 4RQTA 5TJ9A 3CRVA 1WW3A 3BH7B 3J80Y 3SAJA 1MG5A 1EJ6A 1QANA 4F2PA 3RU0A 1AKNA 2R6ZA 1CNMA 1MGPA 3D6UA 4BAUA 4JLSA 5CNKA 3SZ3A 3D2WA 3A6DA 1RXVA 3CWJA 4B4UA 1YR1A 4D8WA 4CM0A 4D0SA 3B2EA 3T5JA 5A62A 3P52A 1GQYA 1V8FA 5HVGA 2ZYUX 1ST3A 3B9BA 3MUVP 2AYEA 3ZX5A 4E30A 3MIZA 2JHFA 5GMKa 2LPMA 1P81A 3GFGA 2NPIA 1QP0A 3AHEA 5F8MA 1KO8A 2RARA 1MN6A 4YRBA 1UAAA 4AZ3A 2XQIA 2K5UA 4IOAQ 1C0UA 1L9XA 4L27A 3HD1A 2VCHA 1REVB 4DC1A 2RSLA 2BWJA 1Q3KA 3B1XA 4KC5A 3TGLA 2XXBA 4QBUA 1S5PA 1NDQA 3KG2A 2HKEA 2W2XA 4PCLA 3D54D 4WK1A 3IUNA 1PR6A 1V0JA 1NJ1A 3SKYA 1Q7CA 4XX1A 1TF7A 5IF3A 5CT6A 4Z4FA 2IYXA 4Y6QA 2ZSFA 4FGUA 3EZFA 3EZXA 2KYXA 1HBNA 4G1QA 1MFPA 4EPYA 1GRNA 3W4IA 3RFXA 1T9WA 3C74A 2W7TA 4Z9FA 3R3UA 5A06A 4LPKA 3WLRA 2DK2A 3TNLA 2DGSA 4LZOA 1FFWB 1N6PA 4KHMA 2QUIA 2FD2A 3VZPA 4R5HA 5FOWA 3UAWA 5B1EA 2J9DE 1NR5A 3PPWA 4WFBQ 3EICA 4FN4A 1DC6A 2JBHA 3OQ1A 2D0IA 3US5A 3C46A 3ZXSA 4ALZA 1PWYE 1XPJA 4D0NA 3QVTA 4BQQA 1VQNS 4MJLA 4YHBA 1YZYA 2I2CA 1GZUA 5K3SA 1M72A 4MS3A 5NULA 2DIVA 1R9NA 2XYVA 1FRMA 2HIMA 3SIPA 3R1LA 3JVVA 2OHFA 1HSZA 3VDRA 4X44A 2AZ3A 4LCBA 3EVDA 1U24A 4NG5A 1X4DA 2BBOA 1NJSA 1R5NA 1S8FA 1EZ4A 4KK3A 4A5OA 2IYAA 4FOTA 2XBMA 4OXIA 2Z8ZA 4WFQA 1T4MA 1RTHB 1U0SA 5JTUA 2I1VB 3JYPA 2YKNA 5K8TA 1ZAXA 2J0EA 3MINA 1TZBA 5LL6d 3QE4A 3OTCA 3H2SA 1H65A 3DE7X 1F12A 3SSQA 1NYTA 4WNYA 3W9BA 2W6IA 1VHLA 2D6FA 2ZETA 1J90A 3COZA 5EY5B 2QMZA 1P2BA 4DV6J 2ATXA 4D6YA 3H17A 4KLZA 4CQMA 1D2GA 2J0SA 3MECA 2X3FA 3M70A 2J0XA 1JWAB 3ZTQA 1JKFA 4DLRA 4OMFG 1TYBE 2QPTA 2HW8A 3GUVA 5L3SA 1VRCA 1WM1A 3FFAA 4K9PA 2IH2A 2OWEA 4V3BA 3VJRA 3JQ9C 1SC3B 1VC6A 4LNUB 5JH7F 3B70A 2GCFA 2YZMA 4HWPA 2A92A 3X1LB 1PR0A 1U0FA 3CD7A 1USWA 4GE0A 3CR7A 5B5SA 3NG8A 3MIIA 1PZGA 5EG5A 2VWGA 3D02A 3H4TA 2DPGA 5CVEA 4UZBA 1UT6A 5IC5A 2GCOA 2QU7A 1TU0B 2VSFA 2ZM6F 5IDYA 1C7ZA 5G1OA 1U28A 3ZN2A 2DCMA 4KN6A 3WMEA 2ZVPX 2BBWA 4KX3A 2BL4A 3CO0S 3KQUA 4ETIA 1GGMA 4MULA 1YDMA 1U3CA 2RILA 5J9FA 4RVCA 3AI3A 4ALIA 4K50A 2ZSJA 4K87A 3KDPA 4ELUA 2C98A 3HEMA 1WOYA 3Q8SB 2VJMA 1WRBA 2EIHA 2SHKA 4PYKA 1FXWF 2ZRKA 3DVSX 2GN4A 1E32A 2VPXB 3UV7A 4K2HA 1K1EA 2PSJA 4XYLA 3A58B 1I1OA 3QXXA 1WMEA 3GSDA 1UH5A 3O8NA 3FWZA 4DB4A 1ZIPA 2D0OB 1YRAA 3W5XA 1OWPA 2WZBA 2QV7A 1G291 2CBGA 2J8SA 3ILIA 2AC2A 1MPXA 5DRTA 3VKGA 2NXWA 3C3WA 4F50A 3UTDA 3G3EA 1TM7E 1EAYA 3JU3A 1LRKA 2FLWA 1SVSA 1PG0A 1XOIA 1JU9A 1C2YA 4IRUB 4OUKX 3NBPA 2XDAA 4HAXA 3RSGA 2XV1A 3PE4A 2VWQA 3SLRA 3CNNA 3PFKA 1ADCA 3DLHA 4LSNB 4BQNA 4QAQA 2HDOA 4EFKA 2DXFA 3M6WA 3PO5A 3H4IA 4XX0B 3PF9A 1ZY2A 3QU7A 1WORA 4X7BA 5CW2A 2BMAA 1FDUA 3BTVA 3KJNA 5I9LA 1S1UB 3Q3GE 2G0CA 3K31A 2DFTA 3G1UA 1OE0A 2VC0A 1U9IC 2FMHA 2X1HA 3OKFA 1NVMB 1DBRA 2PE5A 1TOAA 5FF9A 3R6DA 2UYCA 3FPAA 3ELDA 3SCLE 1RFLA 4XARA 4H77A 1E2KA 5AI9A 5LKRA 1NNLA 3ON5A 3NNCA 1HMVA 2XMSA 5AI5A 1O5IA 2VP6A 3CPSA 1VL8A 3S7TA 2DXIA 2CVOA 1Z3IX 2VSXA 2B7CA 1K3FA 4J9SA 3A3YA 1FDBA 2HPHA 1I14A 2IUYA 4FX5A 4P53A 4I9NA 1FNNA 3NGXA 1D5CA 2DH6A 2COKA 4L75A 1DIHA 4HLNA 4KPGA 2O3TA 4TL8A 1MO4A 2RHLA 4MMOA 1S0OA 2H1YA 2Q7OE 3RSZA 4LZJA 3IB6A 3ZE6A 1IULA 2CV1A 1IQUA 1RWKB 4X1KA 5AE3A 1AO0A 3R7WA 1J5EB 1DO8A 3TA0A 1GEHA 2CFCA 4FW8A 1R0WA 1IN5A 4TS9A 3SSNA 1NDCA 5CH7B 3N8IA 3PDIB 1IKXA 3DHEA 4JKOA 2IYWA 3MLBA 3MWDA 3S28A 4AP6A 3GQBA 4GOND 3DQQA 3V7FA 1K8QA 1SU6A 4DQ0A 3RHTA 3BSFA 3BE4A 4OJ3A 4ZPWR 5D51S 2JFYA 2O8FB 2I29A 5HR5A 3SC3A 2VWHA 2D2FA 2CL6X 5K14A 1LEHA 3ET5A 1RRMA 5MF6A 4MQUA 4DLLA 4PNEA 4ARCA 3W5YA 3MFQA 2CGEA 2Z1NA 4ZVPA 4REQB 4LRUA 5BR1A 3LT5A 4B9NA 1G8HA 1B1CA 2XUOA 4RD0A 2A86A 2LWIA 1UC9A 2BZ0A 3RFTA 2PZEA 2OUGA 3IDAA 3IQHX 4M6WA 4G85A 4OUDB 1EAYC 4BRSA 3FVVA 3I5YA 1NOJA 2TMGA 5L9XA 3CVVA 2JEOA 1U1GA 1Z73A 4EJ6A 2NNLD 4DM3A 2HOQA 2VNHA 4RW8B 1YE3A 2ZSDA 1JKHA 4EY4A 2ORYA 3W3AA 2E5FA 3I6YA 5IX8A 1ZIYA 4JV2A 1I7LA 4JV0A 4IX9A 4NZOA 3PRDA 3N2NA 3WK4A 2ZS8A 3HGQA 4EY6A 2CCGA 5DI3B 4BN0A 5M2UA 3GT4A 4YCNA 1HNXF 3QWPA 5FPHA 3OAAD 2K1RA 1DV2A 4GM0A 4EKIA 2AOVA 4UMVA 1NSAA 1SAYA 4XEHA 4LF6F 1XPUA 3N6RA 4NZZA 4D9KA 2XBPA 4DU8A 3QPBA 2N75A 2ZAOA 3I30X 1E3JA 1Y7HA 1YJUA 2VTDA 4FFVA 2A3RA 4YYEA 4JI4F 1F5SA 3REFA 4M9XA 2HQDA 2AMVA 3H2YA 4R2JA 1Z74A 1NG1A 3RC8A 1NP6A 4N01A 4Q7QA 3M30B 3DVQX 2HHLA 3IQIX 5TQVA 2ATEA 3QIAA 2HS3A 2QRPA 1VJRA 1CVIA 2HBQB 1CRQA 3G79A 2G76A 1PKUA 2QUAA 1BVUA 4P2GA 2HFOA 3H16A 1YDEA 4J4BA 3KNZA 4UZFA 4X4UA 1VB3A 1ZM7A 3DBLA 1K4MA 5KWVA 3DONA 4BNIA 1QAQA 3ENWA 1UR5A 2AW0A 4J0CA 3HXLA 3ZU3A 4EL5A 3CN9A 4BLQA 1D2RA 2HADA 3GT7A 2DHQA 2JSXA 2R60A 3GJRB 1R9JA 5E6SB 1PR2A 4NZ9A 1JDBC 3MFYA 2FYXA 2MMGA 2GK3A 8OHMA 3HKCB 1C3VA 4EO7A 1T8SA 1T25A 1SQFA 2FE1A 2GQ0A 3OJLA 2WYVA 4JI0J 1VQMS 1Y6FA 2NV0A 1GZSA 2JCVA 4TLCA 3E22A 3JRWA 1BJKA 1XAJA 5AVTA 2VH5R 5GV8A 1Z35A 4UHBA 4TYBA 3UCFA 5CUQA 1RJ9A 5E0KB 2XCTB 3HZEA 2P62A 5KBYA 3RU7A 5JVDF 4ANDA 4OXRA 4FNHA 1IRXA 3EEFA 3IDSA 4HSGA 1PJ3A 1W19A 1Y33E 4TXNA 4NS4A 5EIXA 2DQ4A 3D81A 2B30A 1OI3A 1ADBA 4G1UC 2H2HA 1R88A 1UMDB 4PXEA 3QHPA 2E1RA 1BXKA 2IBKA 1Y1QA 2EKYA 2YWDA 5A8RA 5KPJA 3D6HB 1MG0A 3KHHA 4QHSA 3RDPA 1K9SA 2J0QD 4OBBA 6AT1A 3C0KA 2HIHA 1T6YA 3I2YX 4EF4A 1TRHA 4XSVA 3ZYZA 1BYIA 3THOA 5JLAA 4U67Q 2C1EB 1SOUA 4AJ4A 5A4FS 4CKBA 2WSIA 4V19J 3O0DA 4JBIA 1SV5A 3HCEA 3JD1A 1RWXB 2IDKA 3ZG6A 2E21A 5JMOA 3Q12A 1SXQA 1R5JA 2R8HA 5TSDA 2WU8A 3DE3X 3FM9A 4IIYA 4ZJZA 1Z28A 4Q47A 1WXGA 2VQEB 1NH8A 1EA5A 5CYQB 3OSPA 2J6TA 5A8WA 4F9EA 3TZQA 3WZMA 4W98A 1I10A 1CNEA 4FPXA 2VYCA 2AIRA 3RVMA 1X92A 2QEQA 2ZUEA 1YDGA 3MWFA 1U3DA 2EBEA 4QWWA 3GGJA 3SQNA 5A9RA 3CNQP 1NJ2A 3H99A 4ZPBA 2PG3A 4DR4J 4ZVUA 2QLXA 2PE8A 1BFUA 1AM4D 1X42A 5T5QA 3H13A 3G6XA 4RV9A 3HO8A 4MA5A 3MRSA 1F2TB 3M34A 4K59A 2XTNA 2N3OA 1L5HB 5TMEA 3ZY6A 2P9TA 1NP3A 3PL1A 4E33A 2VVTA 2D9OA 5TGZA 1X5SA 2IIPA 2OA0A 1FUYB 3QJLA 4JS0A 3FI0A 1FYXA 4R05A 1MVOA 1FB5A 1QK4A 3X1ZA 2ADCA 1LOUA 4WBSA 1EE2A 1A2OA 3SMQA 4MYUA 4HFJA 3PXBA 2AYMA 3CT9A 1NM2A 3TJ9A 4AZVA 2PUHA 5ITZB 1JYEA 2ARKA 4ON9A 4QBIA 2QRUA 2EG9A 3GLJA 4LTDA 2YVLA 1J6UA 4MUAA 4MI1A 3OTHA 4GAEA 1W88A 4LRBA 3HP1A 2CPYA 5LP6A 4DQQA 4DJDC 3VHQA 1FFYA 1XRJA 2BOVA 4AUMA 3LK7A 1PVDA 3V8NA 4C0OC 1Z4IA 1GUAA 4FKXA 1E4EB 2WIDA 4HRVA 1T2EA 4DPLA 1UPXA 4JUDX 3GVHA 1G7CB 1NOKA 2VDMB 1V4VA 5E0OA 1QWSA 3IJRA 2HF7A 4FSHA 4TM7A 3CZPA 4YFYA 4LK2A 4X93A 2QVLA 4ZAZA 4KAJA 1JQKA 4P93A 5AVYA 2UZIR 2Q43A 3J81k 1GTEA 4IM7A 2OO4A 1AB6A 2OMLA 1PFGA 3JARA 4ENWA 4FZ3A 2CNKA 4G0NA 3FA2A 2D62A 2PUJA 4M9ZA 1OIAA 1C4OA 1JHYA 2B4UA 5KTKA 4F4FA 2MR6A 4E5DA 1I3KA 5JADA 2FPPA 3Q8UA 1N5QA 3CO9A 3RWOA 1E18A 4IFTA 4WKGA 4FZJA 3OEWA 3R7NA 1CQXA 5F4ZA 1KFEB 2FOXA 3C8UA 3F7OA 3CLUD 3ONVA 3NCRA 1IHDA 5E33A 2X8JB 5DYGA 4MIOA 3KQLA 4JBXA 1H8HD 1LSJA 3KDNA 1JG4A 2G83A 2QLNA 1GQRA 5CIYA 1WHTA 2JFBA 2HGMA 5KS2A 5AJUA 2Q4RA 5KFIA 3CNOA 4D4HA 4MHTA 3L43A 2COLA 3LPYA 3BPSP 4CMBA 2QN2A 4O4GB 2C7QA 2DH8A 1MG7A 3DR3A 1GAOA 4LK3A 4KGVA 2QTCA 1C80A 5DN9A 4MS1B 1LI7A 5CYMB 1JQGA 1AMNA 5A8KB 1NPYA 1PR3A 2V2VA 3OXFA 2DNOA 3EEOA 3GMGA 1JZQA 2PXXA 1J8DA 3DRYA 2IXDA 3SF8A 3AL3A 1QDUA 1TO1E 1W4CA 4CMCA 3BDVA 2IHJA 2IOFK 4U5XA 2BGLA 3CONA 2XECA 1G63A 3B1KA 1IJFA 5KNCD 4YTEA 3ESXA 1BUXA 2IQ5A 3G82C 1GGNA 2JFWA 5C37A 4UQPA 1RACB 3AR8A 3EDRB 1C1BA 3LCCA 1LA2A 2CHEA 4J2TA 5BT9A 1QLJA 2F4VB 4PE5B 1F6BA 5CVCA 3VC3A 3C7CB 3ETOA 3RJMA 2CPZA 2HJ9A 1NXVA 2PT5A 1JYSA 1Z0KA 3CF5Q 2JFUA 1WHSB 3HJCA 2Q29A 1XJWA 4G5XA 5C46F 5EIAA 3G0DA 3OIUA 5DSXA 3P4YA 1AU9A 3DJYA 4JOBA 4Y0AA 2JLGA 2FEMA 4CIAA 1R8CA 3C39A 3PY8A 2H51B 1YZ6A 2YL2A 1U5AA 3FF4A 3VZHA 5LZ5A 3HNPA 3O8QA 4L8VA 4GYWA 4DPOA 1GLNA 1T1RA 1K8YB 4CFSA 5FL3A 4JVLA 4RPJA 4R9UC 1PYTA 3UUGA 3VAJA 1WCV1 1YQTA 7FD1A 4G3IA 3BMOA 4RPGA 3D31A 4BUCA 3O73A 4AG6A 2HPZA 1U1OA 4ZI7F 1KEVA 3E9YA 5E1OA 1T3TA 1NBEB 1GL7A 2ZS7A 2OZLA 3HHPA 3OY7A 2RAPA 4EGFA 1H1LA 2O8CA 3D1OA 4TY8B 3CC2S 4M21A 1IBMF 2EBHX 1TKTB 1BX3A 1RBYA 5KSYA 2ZT5A 4XK8C 4TUYA 2XVZA 3GJ6A 5JXWA 5CZVA 2JDIA 2PD3A 4ZDNA 5FUBA 5JD5A 3TA1A 3T5AA 5A5FA 2Z56A 1U3GA 4ZWNA 5AKEA 4CM8B 4PLFA 2WJ3A 4RBTA 5D87A 3CRRA 3FSGA 3C70A 5C8YA 2BHRA 1G1MA 2NUTA 4XB1A 4FCWA 5AKYA 4K9LA 4GRSA 3AF3A 3E7PA 2OV4A 3RVBA 5ALIA 5J2QB 5CGZA 4TN2A 3LD9A 4M8SA 4NE9C 5H7XA 1R0ZA 4JI4B 4F1JA 1L3SA 5DT2A 3NAHA 4J9NA 4IINA 1I7DA 2IPOA 4OSOA 1EIWA 1TL1B 1VCMA 4E22A 4ER6A 3RABA 3OZWA 4UBLA 1S3FA 2VZ9A 2ZR7A 1V45E 3DMHA 4IWNA 3VNBA 2J5BA 3ZHBA 3I6IA 3KK0A 4MXDA 2FOIA 1YA8A 3LGNA 1GR1A 1XRNA 2RONA 2X1FA 4BMVA 5BWCA 5CFQA 1FP2A 1AO3A 1I1GA 2NSYA 4AS3A 1LLDA 3QOFA 4Q8EA 3D3WA 5EUQB 2IU6A 3LA0A 3BTUA 3FBFA 3QLJA 1NASA 4HH0A 9LDBA 3OZ7A 1AC5A 3X1DA 5FQNA 2VPQA 4KV8B 2VJNA 1JV2B 3IHWA 2CJYA 1Z8NA 3MCTA 4D97A 3C24A 5IQQA 3HFVA 2WA1A 2BKUA 1AB8A 1H0HB 2GVDC 4X8OA 5KJFA 2VHYA 4I3FA 2QX6A 3SKVA 3AQOA 4KODA 2P9FA 3AFGA 2Z9DA 2WYIA 3NHBA 4DQRA 5G0UA 2G4BA 2C2ZB 1RS0A 1S9EA 5I47A 4FCCA 5JY6A 1PD0A 4RF2A 3DMYA 1WMBA 2ZKUA 3Q8QB 4DSIA 1FYVA 2QZZA 2QL7B 3IR6A 3SXLA 4KGZA 2XRYA 1NRWA 2Q1WA 4BWYA 4K0KF 3IP0A 5IVIA 3FYUB 2O7VA 1PJTA 2FPXA 2MQNA 4PV7A 3AXSA 1G3MA 3RCBA 3DW3X 1L5RA 2B9VA 2D4AA 4NPAA 1KJYA 4F4AA 2QLTA 3ZHOA 4RANA 1C1HA 4MV6A 1KKLA 1DHRA 4PEVA 5FI1B 2OPPB 1FNXH 4B2PA 1QYRA 4DC9A 1TIBA 2VTEA 4OI1A 1Y6QA 3E8XA 1U31A 3CH4B 1SK9A 3W2VB 5FNVB 1GHTA 2WVGA 3NR2A 1TDJA 2QIFA 3LBFA 2CN1A 3MRVA 3K89A 1IE3A 1CWUA 1XMIA 4X4QA 2JD1A 2VT3A 5HS4A 1UEIA 3A27A 3E7WA 2YICA 2ID4A 5ADWA 1R0LA 1E2PA 3IP5A 1Z4OA 4U1RA 5JAHA 3P2MA 4FYXB 4O6VA 1QHGA 3OOYA 1YIJS 1RVV1 3ZGNA 1WD5A 5FD8A 2ZJ1A 2V8VA 2PBFA 1N5VA 1UKEA 4LQ9A 1C0LA 1DL5A 1Y9EA 3M2VA 4P2SA 4AURA 1FRHA 3AT1B 1EZ1A 5F78A 3GRZA 2BJ3A 4DARA 1EQMA 3SFGA 4U6SA 3EX7B 4RW0A 4WOKA 3P7MA 2C2MB 1NF9A 1IBLB 3H6KA 4MRPA 4RXTA 5K5EA 2AN9A 1XG5A 4KHPF 1MLDA 4B3FX 3I52A 1RQRA 1Y4ZB 4FSDA 4UHDA 1JTVA 4ZVOA 2OZEA 5IWAF 3FDJA 1DUSA 4CKCA 1I13A 4B3HA 3UAYA 1YUNA 4QPZA 1U1FA 1GEEA 2HNAA 5AK3A 3T06B 3NBFA 4KQ9A 3DQPA 4G0OA 2DGWA 1SR8A 5E1BA 1VRTB 4Q7MB 1L5YA 3L9WA 1N5DA 2IKSA 4DE5A 4PS1A 1YC5A 4XCQA 1LWXA 4IHKA 2V54A 3CSUA 4X4OA 1PG5A 4RC9A 1BD3A 3JQFA 3DO5A 3OZGA 1D1QA 1WPGA 3NKFA 5T7LA 4MV1A 4QX6A 1FDDA 4WADA 4R8LA 5AR1A 1NI4B 4BFSA 1UAWA 4LXUA 4P7BA 2NU6B 4PQEA 3GIKA 1I3OB 1XKLA 3HB5X 4GZMA 3T54A 1V8ZA 3EDOA 3W1YC 2ZYAA 4E32A 3GFFA 3QT8A 3E3XA 5KFTA 3PW2A 1P0QA 1UM9A 4C7JA 5CB0A 1RIIA 1KC8T 2OCYC 3HCWA 5ICMA 1FMCA 3AUUA 1FXUA 3QVJA 5JNSA 3OJSA 3M9NB 5JHGB 1JIHA 1OFVA 2JX2A 3KTAB 3LSYA 1G8GA 4DLWA 2IRUA 3CZMA 4I64A 2AE1A 2JI6A 4XFKA 5CNJA 3RRFA 2ZRAA 3DD5A 3SQOA 5CFLA 4FU0A 1RHKA 5M2PA 1IBLF 4K9MA 4WNAA 3VYSB 2JJ2D 2FMFA 3GXBA 4G9EA 3NOGA 3T1YF 3LXRA 1VJWA 1Y82A 3IPCA 2DLDA 5SY6A 1QK5A 1Q20A 3G1TA 2QLFA 1EDBA 4Q5VA 3WMGA 3J7AC 1UPAA 1ZL0A 1RHJA 4NEYA 4HRAA 5F52A 2JLEA 3WKDA 4YUAA 3A28A 2DC1A 1Q8BA 3KLEA 5IV3A 1UJNA 1V1MB 4DLNA 1F9HA 3DYIA 4ARSA 1N2HA 4BNNA 3PUVA 1AF7A 3DFUA 4C7QA 2VUIB 2VJPA 2H18A 1S79A 3QEAZ 4KPEC 1XTKA 1IN7A 3AZPA 4JUZA 4HDMA 1UA0A 3EGCA 2DR5A 4FLFA 1W0KA 1DLOA 2PMEA 1UJMA 3FRHA 4WFIA 1Y3CE 3FVQA 1K9MT 2W6JD 2I2WA 4Z0NA 2CUNA 2GK7A 2Y0CA 4ESEA 2GN2A 2ZWPA 1L7PA 3PCTA 1UBCA 5J2PB 1PNQA 1N8TA 4QTZA 1B74A 1EUDB 3QLHB 5GAHU 2ZCJA 5IKPA 2M98A 1U9ZA 1E9AA 3NBAA 2J33A 2YWJA 4XIGS 2BFEA 3PZBA 1NJZA 2QY6A 2NZ2A 3JQBC 1PUXA 4C0HA 1DQPA 3DWFA 2G0TA 3QJPA 4HNRA 1G66A 2R68A 3AR3A 1MJGM 4L0MA 3LP5A 3ZD8A 2IYQA 2RH8A 4AQ7A 2IYRA 5FTWA 1YU9A 1D9AA 1WSDA 4S0XA 5TGTA 3DFEA 1GNLA 1FSPA 5EXSA 1C1YA 4ZAWA 4ZT3A 3KBOA 4QSMA 1BHQ1 1U0JA 1NN0A 4E2FA 5HA5A 2CD9A 2GBFA 1N48A 1IPFA 1WXFA 3G7SA 3JAWA 2F9MA 5FPYA 4Q5IA 5IK2A 3PX3A 5JJIA 3S2IA 4M4SA 1NTRA 3VPCA 1Q8LA 4PPYA 3WGZA 3LPAA 1REQB 3GFVA 2G06A 1KQSR 3FOAA 4NEHB 5B7WA 3GP3A 4RL1A 4WESB 3H9BA 3MJSA 4C4AA 4OP1A 2IWHA 3MNFA 1XN1A 2QN7A 3R7DA 2P5SA 2ZRPA 5BR4A 1U0HA 1FZTA 2DLCX 1JSZA 2CNOB 3ZOZA 2OY0A 2FWAA 3C3EA 2PPVA 2CXPA 3C6TB 4OHPA 1WELA 3B52X 5C34B 2CQ2A 4QU9A 2M32A 2D3O1 2VJUA 1ZOIA 3HULA 1N0HA 3IWXA 2ABWA 4M1YA 1ETUA 1TPZA 1LVUA 1YRWA 4NXMB 1QPBA 4GD3Q 3C3BA 4G1PA 3QWBA 3O1LA 1Q95G 2FUG9 4Q4DA 1X87A 2JLRA 1HWUA 3GTYX 4H3KB 3BZBA 3PZRA 3I34X 1E6VA 1WUJS 1KTQA 2CQGA 2P78A 2OILA 2OGUA 5F73A 2WIFA 4JGBA 2KXFA 1HR0F 4AF6A 1X9WA 2DIUA 3GJSA 2J5RA 5DI9A 1Y8QA 4EUHA 1NXPA 3HHEA 4MPTA 2PT7A 1Q8KA 3PFNA 2VRCD 1W75A 4CDNA 2GOYA 1OSDA 3CZQA 3UQZA 3MM8B 3KEGA 3BE6A 2V4JA 5LYJB 1H6DA 3VO1A 3LAKA 1DRVA 4RKRA 1VKZA 3ZU2A 3IUMA 1JQEA 2ZUBA 2NTNA 3ACBA 2B4YA 5ITSA 4JI8B 1HSOA 1X38A 1O97C 4MUYA 4RVHA 2RMKA 1VBMA 4CLXA 2ISSD 3NM6B 3PGKA 3TNDA 4H3HB 1R43A 5K4AA 1X70A 3OLAA 1RAFB 2KU7A 1XAHA 4UVGA 5AXKA 2KI5A 5DCWA 4DV6F 3NLCA 4BJHB 4YT2A 1MN9A 2MZQA 3TNJA 2VHTA 3LF0A 3P9KA 3F6YA 5F8GA 5G0RA 1ZIXA 2R7AA 1GNPA 4LJLA 5EP3A 2OCLA 2JB9A 5ALEA 4QZVA 1ZZGA 1YULA 1BKDR 4X60A 2I0FA 1PFKA 2J7WA 1QMGA 3ZU6A 5F8HA 4L0QA 1D2EA 3O7WA 3A1CA 2MT9A 2V7BA 3MCWA 1SVDA 2QAGA 4HEA6 1G20B 4KGXB 1SG9A 1ZRNA 3B20A 2ZH6A 1SHKA 1G60A 1A4XA 4F92B 1DOHA 1WPRA 3GLFA 3AY3A 1XCLA 4EFDA 5HZGA 3NHPA 5DBOA 3NOQA 3HY6A 3WVNA 2WUFA 5HOEA 3NWRA 1PDVA 1M1XB 4EM6A 2DERA 4ARZA 4BFWA 4KH1B 1UT8A 3PD7A 5LUAA 4BVFA 5FR2A 1AS0A 1JKIA 4L6V3 5DLPA 4Z53A 4F21A 3BQMB 2AG1A 1LS6A 4JB3A 2CQIA 3K9LA 1I7SB 4LMPA 1NW8A 2QIPA 5EGYA 5E3JA 3SLKA 4CKWA 1QCZA 3AETA 5FUXA 2YJ5A 4R0MA 5BV2P 1D8YA 2H7XA 1S1TA 4ELTA 1UTAA 3GMIA 4TTVA 3LTEA 2XBUA 4EABA 2NO4A 1GFSA 5GWXA 1ZK0A 5L1LA 4IDFA 5CM9C 2G09A 4YHHJ 1O94C 1T03A 3GPLA 1EX8A 5JOQA 1R8AA 2CLIB 4ZN1A 3N2LA 4R0VA 5E95A 2NVBA 2O01C 4HB0A 1I2BA 3NCHA 2QG9A 5BSRA 4R25A 4O1IA 1ZRHA 3TX2A 3WY9A 4B3BA 3VGPA 3MURP 2J3DA 3R6TA 1DAFA 5DRYA 5HMWA 3PD0A 2DNQA 3VSBA 2H65B 3QMQA 4ZYUA 3KYBA 4FINA 4H4OB 4A8SA 4CCWA 5KTPA 5IOLA 3PNSA 2VDKB 4PPDA 1GZ6A 2QSUA 5C7OO 2H92A 3NASA 2J3IA 4OJYA 2BDPA 1NQXA 4C3OB 1CUAA 1HHTP 2NLWA 1VK8A 2IP4A 1AV6A 2OB2A 3WLPA 3PHJA 2QQGA 2C3UA 3J7Z5 1Y0BA 3E35A 4ZCRA 1YZ3A 1MRSA 2EOAA 4EELA 3W61A 2LEAA 3CMQA 1PZMA 1DVRA 1P4HA 5AW6A 4D3ZA 1ZU4A 4JC5A 2VQFB 3PC3A 3DW1X 1R0CB 1J2UA 3IC5A 2VH2A 4DV1B 1ZN7A 3R0ZA 2ZR8A 4G56A 4RLHA 1JDUA 2JFQA 3KJVA 1E20A 4N3AA 1R6BX 2RE1A 3N2KA 1T35A 1I8TA 2FVPA 3KTDA 3W5DA 1CT9A 2F65A 3QRWA 1IOZA 4ZXFA 1RXSA 3EASA 3C1AA 2WNHA 3R5JB 1QQTA 3E27A 4FKBA 4Z0HO 1H6CA 4B7ZA 1JKMA 2QRQA 2E37A 4N7MA 2IA5A 5B0DA 4PLZA 4CQJA 5K4HA 4BNKA 4EKDA 5EEHA 3PSAA 1KZ7B 1R3DA 3UXEA 1CPZA 3IAM1 1TMOA 3SXUB 4JLOA 3CGWA 4M1KA 2IC3B 2B43A 4XPZA 4GBMA 4OLPA 5LMUB 4BC7A 1LPOA 3CX4A 1OB5A 2C03A 5CH3A 1KH1A 2PK3A 1JJCB 1CZRA 1QAMA 2ZXFA 3COPA 1FD2A 4U2DA 4S1VA 1YH3A 3U13A 3LBHA 3OTOB 1ZK2A 3IGFA 2WTFA 4G5FA 4ISBA 1Y8RA 4PZ9A 3NGKA 1E5VA 5AJ3J 4LGYA 1FFEA 5JE8A 2EXXA 3ZV6A 3QPVA 2BC9A 4L5AA 2JHAA 3TAMA 3SR4A 1XEXA 4G2NA 1AKWA 3C3KA 1KR5A 2M1XA 2G08A 2WB4A 3RBDA 3G2PA 4MWZA 2F1HA 2WMDA 2Q3LA 2VQ6A 2B82A 1YS7A 4KX5A 1SBHA 1HW9A 3R7BA 1UWKA 5CYPA 5A7HA 1R0BA 3I37X 2P6OA 1M74A 3QKWA 2R4TA 3O8OA 3AQ4A 3P5BP 1N5YB 4BQFA 2FVSA 1YV9A 2GYVA 3JQJA 4JLDA 4B3XA 3TIIA 4L15A 1P72A 3H9EO 4UHFA 5EQDA 4W7SA 2QM3A 2H11A 4QOJA 3OTIA 1XXHB 1BMQB 2Q5QA 1K75A 4FYDA 2NUAA 2OL4A 3LL7A 2I33A 3N0RA 3MWBA 4N65A 2KBFA 4OHUA 4F4WA 4M2LA 2POQX 4YALA 3L84A 4R8UB 3BDEA 4PGMA 3RC2A 2LCQA 3EXEA 2CDAA 4DIEA 3PEWA 3TX0A 2OH2A 4QPDA 2XQCA 3HSDA 1WY5A 4WCEQ 4MW0A 4ZAXA 2UVRA 2FZCB 4DB2A 1GAQA 4C3LA 2VL7A 1JYFA 3VV2B 3K9FC 3SQWA 4KTQA 3CCSS 1FRJA 1KLMB 1PFQA 3C6XA 2B8NA 3TZZA 3L6CA 2UUAJ 1XTTA 3THVA 1Q7RA 3C8YA 2XDYA 3SBDA 3NTVA 2GJ4A 2W5UA 4O4RA 2FGJA 2Q5EA 3WB9A 2Q45A 1MXFA 3KYCA 3INTA 2YVQA 3UPTA 3D8UA 3HA7A 5C9ZA 4C2AA 1OASA 2QAGC 1F5CA 5L8RC 4DMUB 4PNPA 1U25A 4P8RA 3WXBA 2QA4G 5KYXA 2AC7A 1YB5A 1OIXA 5JAOA 2MDAA 1CS0B 2I66A 4UCQA 1WZUA 3WGHA 2JVJA 3ZLJA 3LGHA 1VSVA 2V7PA 2YKMA 5EZYB 4H35A 1U6IA 2NZCA 3T6BA 1GG8A 4F5YA 1WEXA 4WBFA 5HANA 4I4LA 3T9FA 2Y76A 4K3UA 3WZ0A 4FGLA 1VC0A 4PZYA 3LX5A 2NU8A 1DTEA 4DX8H 5IWAJ 1BEUB 5E4FA 2ROQA 3AMVA 1S9GB 2PO5A 3X1MA 2F9DA 3RVRA 2A10A 5WRFA 4JFRA 3HBAA 3RK4A 1E6MA 3HMQA 2H1IA 3DMJA 5HZMA 4RDCA 2CDBA 4GVPA 4MUXA 5FAXA 3VAZA 1WETA 4ZYZA 1FNMA 1SIBE 3GRVA 2ZRQA 5A2GA 3IS9A 1I80A 1ORHA 2RC6A 1YT5A 3KZ1E 4N5DA 3O31A 4AFNA 1ZBDA 3VWSA 4C0XA 4GX1A 4CR6A 3ZDDA 3EXYA 3BV8A 1U1CA 5EXEA 5LPNA 3DZCA 4XA8A 1J8VA 2IU4A 1TKCA 1U5BA 2R6GA 2RIPA 2AQKA 4KB5A 2ZIFA 2GARA 1K3UB 1ZD1A 4R9SA 5L7WA 2RQMA 1BGVA 4DUYF 1XTIA 2QNBA 1S57A 5BQ5A 2Z6QA 3JATA 1RKJA 1ZISA 3LX6A 2H2WA 4O3OA 2ODWA 3GLUA 4BQSA 3OTWA 4OX9B 1WNTA 1KEEA 2FQWA 1RT7A 1H38A 5BW5A 2QS9A 4YCLA 4PIVA 5CA0B 3ICQB 3C1OA 2GGPA 3NOOA 3PLAE 1X7XA 2CF5A 3NONA 3SP1A 1VQ5S 3PVXA 3GR1A 2AV6A 3QXHA 1G0OA 1W29A 4RVUA 3N53A 1QORA 1YS2X 2AF4C 2GKGA 1DCKA 2WIJA 1GCOA 2EFGA 1KHTA 3T12A 2MKCA 3KQVA 2W4QA 3GX1A 1QO0A 3ITKA 2CFOA 4DYHA 1QF7A 1ZVVA 5L1KA 4N5NA 1EFPB 1NHGA 4LWOA 3Q5GA 4ZVGA 1X3LA 2XKKA 2GZSA 2XGJA 4ZAFA 1OTYA 2HDWA 4MV9A 2ZPAA 2FJBB 4K6KA 2I34A 4B3OA 2XMPA 4MKGA 1TK5A 2J67A 2PS9A 4Q93A 1C9EA 2L9DA 3ECCA 1IM5A 1NULA 2XAUA 5ALVA 3DOKA 3TVZA 1B6GA 4CLYA 4CCSA 1V8PA 3WB1A 3ITNA 4J3NA 3TI7A 2VHJA 3GAZA 4R16A 4Q3OA 4HAVA 4GKKB 4ZICA 4DMLA 4QUGA 2ZJRQ 3OHMA 2MKJA 1SBTA 3PR4A 4I67A 4IFEA 4QBHA 1C1CA 1DX6A 2EYQA 1DG1G 1RE0A 1CUUA 4ZOEA 4XIJA 3JAKA 2CLLB 2IHTA 3BZQA 2G82A 1L3VA 2MZRA 1XD2B 1XK7A 1TU4A 3EFHA 4ZN3A 1SQSA 1O58A 3HHLA 4A6DA 4XH9B 3OLCX 1OX4A 3CDEA 4U7UK 3CIOA 1MCZA 3DBRB 3JQGA 5KHOC 5CXUA 5DDOC 3CNLA 2VEOA 1VC5A 2PTGA 1H2AS 3A8EA 3U26A 1UPPA 4F3MA 5K09A 1N5LA 3EIOA 4KQZA 3DXZA 2XNQA 2R2GA 3BA1A 1VQ1A 2O8VA 1OAOA 4HB3A 4B3MB 5D3GA 2RGBA 1IQZA 4QPXA 3PYXA 4LZNA 4W5OA 3GCGA 4ABTA 3R0VA 3Q23A 1IDOA 4PSUA 3E1GA 4FYHA 4P3XA 4O4JB 3N01A 2ZYIA 3TTVA 1ESEA 3IOMA 1KPHA 1W5SA 4IRMA 3NVMB 1T5LA 3PUXA 4EGAA 5J43A 3AO0B 2UU9B 4DL6A 4ZGBA 2DWQA 1Z5OA 5FFFA 8ABPA 4J2OA 3LP0A 3PNPA 2VAWA 1X7WB 3I4LA 4KR2A 1HBMB 3JQPA 1GPH1 2W2MA 1MWYA 2EFQA 4RULA 1VHQA 3ZQ4A 4DWOA 1FFSA 1HLFA 4MWDA 5A5GA 4IUYA 4TV8F 4JYMA 1ZO8A 5D4NA 4JU8A 1GKKA 5E3RA 1E4VA 1XR3A 5MHTA 1J8MF 3THTA 1U6BA 3JXEA 3K9CA 4H54A 1EQ2A 1J2JA 2XLCA 1YBVA 1NKBA 1RDRA 4MK7A 1J99A 5LZ4A 2OFWA 5E1MA 2JEZA 2DITA 3QXSA 3DE0X 2XSZD 3ZWAA 2XX3A 3MJTA 1BWVA 1MV5A 4ZKAA 3F5DA 5AJVB 1P4SA 3BYZA 4U39A 4UREA 3GY0A 2QVBA 4X4NA