The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
80
|
sequence length |
257
|
structure length |
249
|
Chain Sequence |
MNPQDKAKQAVGYFAVDTYVRSGMKVGLGTGTTAKFVVERIGQRMQEGSLKDLLCVPTSEATRKQAESLGIPLTTLDGIADLDVAIDGADEILPPTLGLVKGRGGALLREKMIAAAAKTFIVAADETKLVSNGIGSTGALPVEVVVFSGSHTKRLLSALPSVKRHGGRAEFRKRAGAAQEDIREEDRFVTDNGNYIVDLYFTETVPDLHEMDKELKSIPGVVETGFFLDLASVCLIGKADGSVATLTAE
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule tags |
Isomerase
|
source organism |
Toxoplasma gondii
|
publication title |
2.60 Angstrom resolution crystal structure of putative ribose 5-phosphate isomerase from Toxoplasma gondii ME49 in complex with DL-Malic acid
rcsb |
molecule keywords |
Ribulose 5-phosphate isomerase
|
total genus |
80
|
structure length |
249
|
sequence length |
257
|
ec nomenclature |
ec
5.3.1.6: Ribose-5-phosphate isomerase. |
pdb deposition date | 2013-11-15 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF06026 | Rib_5-P_isom_A | Ribose 5-phosphate isomerase A (phosphoriboisomerase A) |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | 2-Layer Sandwich | Alpha-Beta Plaits | Alpha-Beta Plaits | ||
Alpha Beta | 3-Layer(aba) Sandwich | Rossmann fold | Rossmann fold |