4NMLA

2.60 angstrom resolution crystal structure of putative ribose 5-phosphate isomerase from toxoplasma gondii me49 in complex with dl-malic acid
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
257
structure length
249
Chain Sequence
MNPQDKAKQAVGYFAVDTYVRSGMKVGLGTGTTAKFVVERIGQRMQEGSLKDLLCVPTSEATRKQAESLGIPLTTLDGIADLDVAIDGADEILPPTLGLVKGRGGALLREKMIAAAAKTFIVAADETKLVSNGIGSTGALPVEVVVFSGSHTKRLLSALPSVKRHGGRAEFRKRAGAAQEDIREEDRFVTDNGNYIVDLYFTETVPDLHEMDKELKSIPGVVETGFFLDLASVCLIGKADGSVATLTAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribulose 5-phosphate isomerase
publication title 2.60 Angstrom resolution crystal structure of putative ribose 5-phosphate isomerase from Toxoplasma gondii ME49 in complex with DL-Malic acid
rcsb
source organism Toxoplasma gondii
molecule tags Isomerase
total genus 80
structure length 249
sequence length 257
ec nomenclature ec 5.3.1.6: Ribose-5-phosphate isomerase.
pdb deposition date 2013-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06026 Rib_5-P_isom_A Ribose 5-phosphate isomerase A (phosphoriboisomerase A)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4nmlA02
3.40.50.1360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4nmlA01
2BKXA 2OKGA 1FS6A 1VL1A 4L4YA 4L5JA 5HJ5A 3MWBA 2BKVA 3BXEA 1UJ6A 3IBWA 5IT4A 2J0XA 1PSDA 3N0VA 3CSSA 2GNPA 4L51A 1LK5A 2RQKA 1HORA 4GO1A 2JHEA 1YGYA 4L5IA 2P9CA 2QSWA 3OBIA 2W48A 3K5PA 2QMXA 1SC6A 5JJBA 2RQMA 3HN6A 3ICOA 3LUYA 1PBTA 3IXQA 1KS2A 5FIIA 1LKZA 1FQOA 2H9ZA 3BXGA 2F1FA 1M0SA 2JOQA 1HOTA 3ENQA 4PWUA 3EB9A 1Y7PA 2DT9A 2I9SA 3AAWB 3HHEA 4GO7X 2R5FA 3CEDA 5T41A 2ZHOA 3TUIC 4M8LA 4GO5X 4R7TA 4OQQA 3S1TA 2PC6A 3L7OA 3BXFA 2J0EA 3NWPA 4L4ZA 1XTZA 2QMWA 3ENWA 1FRZA 4TM7A 2QRRA 3TX2A 3MTJA 1LK7A 1ZPVA 3LWDA 3OFFA 4NMLA 1UJ4A 4IO1A 1O8BA 5IT0A 2RI0A 4TM8A 3BXHA 3OFGA 3AB4B 3TUZC 3LHIA 3W7BA 2RE1A 3AB2B 1UJ5A 3DHWC 3U7JA 3NZEA 2CDQA 3DC2A 4OQPA 3KWMA 1Y89A 1YBAA 3ENVA 3DHXA 3NRBA 2P9GA 2WU1A 3CH7A 4R9NA 3OFEA 2P9EA 2J0WA 1RWUA 3EFBA 2LQJA 1DEAA 2F8MA 4GMKA 5IS2A 3O1LA 3OC6A 2NYIA 4L50A 3LOUA 1FSFA 2DTJA 3P96A 2KO1A 2MDAA 1JT9A 2O0MA 4LUBA 1NE7A 3E15A 3E7FA 1U8SA 4X84A 2RI1A 3KV1A 2LVWA 3DDNA 2PA3A 3OFHA 3UW1A 1CD5A 2FGCA 3TUJC 1FS5A 3MAHA
chains in the Genus database with same CATH superfamily
2IDLA 2XVMA 1Q0TA 1EFPB 1QHHB 4U6SA 2CDAA 4TYMA 3WGJA 2VJMB 1HI9A 4Y00A 3WLFA 3B2EA 3RB6A 1KK1A 3GGDA 4E14A 1WXWA 4F6CA 2JZ5A 1JJAA 2DU8A 1T29A 3UO0A 1MJNA 2PBZA 4U9IS 4FGLA 3C98A 3SBOA 4PO8A 2ZT8A 1Y5IA 3UBMA 1UWAA 4LF9J 1K0UA 1XPUA 3NHJA 1Z83A 3JQAA 3GCDA 2QMUB 2JOQA 1XALA 3AR6A 4LZAA 2FQQA 3PC4A 4BGIA 5K8NA 4ZOBA 2IFTA 3QIPB 4OI4A 4B73A 4PWZA 3GIWA 5ALYA 2A5DA 3PC6A 3V1YA 1DTEA 4AMBA 3B9PA 3UMJA 3ZK9A 1WUYA 1YO6A 2M4MA 4CO0A 2W9AA 1K27A 3ZQKA 4FI3F 4LIWA 2G25A 4GL2A 3K2YA 4IOMA 3LFHA 4O4JA 4TMWA 1VJQA 4OK6A 4S1OA 4KYVA 3INGA 2M8DB 1GTSA 5IKXA 1U3WA 4OZ2A 2Q1XA 1V37A 4NMXB 1PJ6A 2QOEA 2A9KA 1QDUB 1RISA 1CJKC 2Z5VA 3T1HB 3NDBB 5AKJA 1OAOA 2OMEA 4RW7B 1PO6A 4ZLLA 4C76A 3B7PA 3MGBA 4JC0A 1PG5A 1KYTA 4AKTA 3GG9A 2OHFA 1FK9A 3QPAA 4ECXA 3ZV7A 1XEXA 4ACBA 1VSBA 5HMMA 4CM0A 3QWFA 3VDXA 2YMMA 3MM6B 2P9TA 5BOSB 4G1MB 4X66B 4YHHB 1JF8A 2PBRA 4DUYB 2R79A 1I4DD 2J3DA 4UVGA 2R5FA 1OVGA 2OH2A 4FC6A 2QENA 3TX0A 3A3PA 3RFCA 3M9LA 4YASA 4NLTA 2YHIB 1Z16A 2AF4C 3MGGA 2LXUA 3FZBA 4HYYA 3HU1A 2RU3A 3QPCA 4JUBA 3K0FB 4F3TA 1BA3A 4FONA 3JAMA 3LX6A 2JDJA 2B30A 4JSYA 3DJYA 3GB0A 4JJ4A 3V00A 2ZH2A 2C92A 3BDIA 4O2RA 3OCUA 2JGMA 2BE2B 3BSNA 2IP1A 1T9HA 2JL9A 3QVKA 5TSDA 4PQAA 3MIZA 3EZUA 1YA8A 1GJRA 1DIOB 1V8ZA 3EDRB 2CLDX 1KDVA 3DT6A 2CNLB 4DVJA 4OMDA 3PFFA 4Z7NB 4FFVA 1SCBA 4F4FA 4V0NA 2GZ1A 5EQDA 4LJMA 5ICEA 5JFTA 2WSMA 2DBYA 1JMYA 1J5XA 2PR7A 3JV7A 5FIIA 3GV8B 2X4GA 1W0KD 2WBLC 4S1PA 1WOPA 2ASLA 4Q9AA 3DEIA 3V97A 4C7QA 5C1PA 3H6KA 5FUQA 3HYSA 5E2IA 3GEDA 4JHLA 1UOPA 2RRNA 1U1OA 1W4RA 4ZT7A 2X42A 3QRWA 5A5GA 5I01A 4KHPJ 4XR4A 3NAMA 1OB5A 3IAS6 2WRMA 2Q7OE 1IAQA 3G7SA 1T0HB 5DN9A 5KG5A 4Z9XA 5IF3A 4Z4QA 4QYRA 4MQEA 5D4PA 1K0VA 2WUVA 1T8PA 4OJTA 3PJXA 4MR8B 1U0SA 5IQQA 4QYWA 2QMQA 3OWHA 3H17A 2QE7D 3ZH2A 1VKRA 4I56A 4YO8A 3UZUA 1XEZA 4HH0A 4Q7MB 3W04A 3S8EA 4R81A 5FULA 5AW6A 1N4AA 3KTAA 2E6KA 2F3TA 2C7GA 2Q3LA 5IYZA 3L0CA 4OQJA 4RF4A 3BO2A 1SVNA 1PJZA 1EFKA 1QGDA 1YHYA 1L4NA 2NS1B 2F00A 1FYXA 4BCCA 5CURA 2YMLA 2CE7A 3M9MB 3LK7A 2OPSA 1UKBA 4TMZA 4QGAA 1GEHA 2PLNA 3AFHA 3FKSA 3FTNA 1CNEA 3FWNA 4CJXA 5HVNA 2GJ8A 4G6ZA 3LPEA 2FUCA 3GF4A 5FWAA 4B3MF 1FRZA 1HDGO 1SA0A 4MICA 4WZAE 3DM2B 1TJ5A 2EJUA 4OQMA 1WMSA 4N01A 1Z73A 2ID4A 4OM7A 2LECA 4NI2A 1BDBA 2C8LA 1OMSA 4J2OA 4BY9E 3GT3A 4TLEA 4N0MA 4ZK6A 1E7YA 3SSOA 1YVRA 1JJFA 5F5NA 1WDMA 4DR7B 3FPLA 3AEYA 2AN4A 2P91A 2ORWA 3SQMA 3CSDA 2HD4A 5F52A 3H1FA 5K0TA 5AE3A 3K16A 4LMZA 3QLHA 3FNEA 3DMFA 2PY6A 3TLYA 1I3MA 3LP6A 2BF4A 1JG1A 2GBLC 4UFPA 1U1DA 4S05A 1YBUA 1X0PA 3H5VA 4RVFA 1Q2XA 3JRXA 2I6FA 2JI8A 4OL9A 4M86A 4REMA 2XKBA 5M2UA 3N8DA 5JI2E 1OIXA 4X1YA 2NXJA 4KGKA 5K0GA 1BFUA 4H59A 1XC9A 4TQSA 1L6RA 3RYCB 4CTAB 5FR2A 3H7HB 4LRAA 4AL6A 1JDSA 3FN4A 4X91A 3E3LA 3B5EA 1TYEB 1S2GA 3LVQE 2J09A 1AK1A 4YY3J 1R6UA 2PUVA 1NVUQ 3ZCSA 2R25B 5K8UA 3ELDA 1B1CA 1LLQA 3UT0A 3T5MA 3UGTA 2QM3A 1ICEA 1RTKA 4O59O 1YZ7A 3AUKA 5SYNA 1I2AA 1GKUB 3ZC4A 3L01A 1TT5A 2AT1A 4YCDA 4ZVKA 4N7RA 4EW1A 4EABA 4F7WA 3D81A 4P4SA 3E3MA 3OEEA 4Z51A 3S2ZA 2QA4G 3HKWA 3PRJA 1CJCA 1F2UA 2VA3A 3OCZA 2HHHJ 1V3ZA 2NO5A 2BW7A 3IQWA 1J00A 1N9ZA 2DLNA 5LM3A 4B3OA 4B5KA 4EB8A 1NM5C 4FDTA 3NGTA 1O97C 4B7AA 3UQZA 5I4CA 1KPGA 1ZOLA 4P34A 2R6AA 4N77A 4DV7F 1U8FO 4MO9A 5T67A 5AKIA 1FESA 1E99A 1VE5A 1ZCBA 2FSVA 3E9DA 1CIJA 4ICLB 4CXMA 1J97A 2FW6A 2X1GA 5KOXA 1N9KA 2O8BB 3EDCA 3M1VB 3WKEA 2W22A 3CCWA 3JASA 1QFZA 4CQJA 2ORED 4A6XA 3IG1B 2VRWA 4B3BA 5KFBA 2WF9A 4AIRA 5JOQA 3J7TA 2PGDA 4W5TA 5AKXA 2E1PA 1ZC3A 1R3DA 2ZWVA 4F67A 4KPEC 2IXEA 4A0SA 1XMOB 1JX6A 4C7BA 4PVDA 4F4UA 3HYTA 3SM3A 4WNCA 4QTXA 3ZV4A 3RW7A 1W34A 4RPIA 1MOPA 4J5OA 2PZGA 5JALA 1EP1B 3AO0B 1NUTA 4GYJA 5FTKA 4A8FA 1M2JA 2JIPA 3Q8UA 3TLJA 1AXEA 4DFMA 2LKZA 1LDBA 3DBIA 4AULA 3TLMA 1G42A 4DR1J 5FOQA 4Z4GA 4E5NA 3QZ7A 2KZMA 1AC5A 4C3ZA 3EG5A 3JQBC 4KHZA 2ZH9A 1U0LA 1QK4A 4B7XA 1WCYA 1M76A 4KDEA 4O3QA 3USCS 3LC2O 1C8LA 3AF2A 3QIAA 1MLAA 3DCIA 2OY0A 3O73A 2W7TA 2HWUA 1XR3A 4FWIB 5D6NA 1FU4A 2X9VA 3N01A 3BQ1A 1CY8A 3K57A 3C8YA 1CUDA 5A1JA 3HKBA 3R7SA 4IEEA 3D4PA 3NOVA 3LH5A 2NZUG 2OP5A 1ZM3A 3KUKA 3STWA 4LF4B 1B42A 4R2JA 2VWQA 3MRTA 3FSRA 4G5SA 3U44B 4P2FA 2EC5A 2QX4A 3SYTA 4D9HA 3OPYB 4Q9DA 1SQ6A 1D6JA 3TMYA 1N6NA 4GNRA 1P29A 4L8YA 2JGFA 5KYNA 1X0XA 5EHZA 3DTVA 3QKSA 3E70C 3NG8A 5KNBD 1BD4A 2HWYA 3R7LA 3R7WB 3KUGA 1NPKA 2V9ZA 4NXNF 4TMTA 2O2EA 2HT1A 2DHCA 5E6RA 2EX0A 4HZIA 5CDFE 2P4UA 3G2QA 3LWMA 4DX7A 4EHDA 2YX4A 3TXYA 3AU9A 2LUOA 2C4NA 4L4SA 2FUEA 1S2LA 2BMJA 1PQWA 1Y6GA 2B5OA 3POTA 3AK4A 3FYCA 1ZM2A 3R5AA 5BWNA 3TINA 5HSGA 4QHTA 3T0IA 1ZA1A 3A06A 3UHPA 3O03A 3EZ6A 3QFCA 5H83A 1RJDA 1R88A 4C4OA 1L8AA 1GNRA 2IHJA 3VF0B 5FUYA 1C3OA 1XQ9A 4YWHA 3HXMA 3ETJA 4XSGA 4G1QA 2WP0A 4FEGA 1XVVA 1B93A 3NW9A 4DXLA 1H22A 4S0XA 4II7A 2VZ0A 4ZJOA 3JVVA 4PY2A 3KQWA 4TKUB 4K4WA 1NXOA 4LQCA 2CV1A 4CKZA 2Q2QA 1A5TA 1NONA 4UTZA 2UV8G 1P3DA 4V0SA 3R3UA 3CX8A 2BX6A 3HUFA 2O66A 1Q50A 4X44A 3PC2A 4ZCPA 3MJRA 3WC2A 2NO1A 1QVWA 3M4YA 3V9AA 4U95A 5J2QB 5IM0B 1BDMA 3K2QA 1XDGA 1VYHA 4AVYA 4QL3A 1IZYA 2EBUA 1VLMA 2WSYB 1G4HA 1Y82A 4AUEA 2A9OA 2DPYA 1WWHA 3E22A 3CWJA 3CVOA 4JB8B 1XZJA 1OYVA 5P21A 2B6AA 1XZEA 1DEKA 4NONA 2HBQB 1G1AA 1LJUA 1VMBA 4DCNA 2YNFA 1B15A 1VBNA 2JRLA 4MW5A 3AXKA 2WD7B 1HARA 2CZGA 4PANA 2DFDA 2AZDA 4KR9A 3FYUB 4OI2A 3PXDA 3ROQA 1TL7C 3PY8A 2CLEB 3Q12A 2B4QA 4CQMB 3B13B 1QGUB 1EVIA 3EEYA 4AT1B 2EKLA 3CIZA 1ZJWA 2AWOA 2NU8A 3UYLA 1BY9A 2VDHA 3QNWB 4RIIA 1KE1A 3H8JA 4L85A 2HQCA 2VPZA 2QA2A 4ECTA 3H05A 4JBGA 4B76A 3QATA 2B7CB 2XQGA 4ZYWA 2IPLA 2CFCA 2OV6A 3F4BA 3ISND 3HJNA 4ZPJA 3IKTA 2QB5A 1QR2A 4RF3A 1X7ZA 2QG9A 4DPWA 3BAFA 2DXEA 2M1XA 2WMYA 4ANEA 4YDXA 4O4IF 2J9XB 4N0QA 1UFWA 3FM9A 4DLAA 3NJ4A 3OZXA 1JAHA 3FTFA 3MT9A 3W1EA 5B6JA 4IXDA 1KHVA 4ZAXA 3A12A 2XTZA 4YH1A 4M0KA 5L9NA 3PJWA 5IAAA 1SOMA 2WYWA 3PUKA 4J29A 2GD1O 4GZ3A 3I9ZA 4R1MA 4ANFA 3DOFA 4CNZA 2BXJA 2JL1A 1N5JA 3JQRA 3AHIA 4HNSA 1GDDA 3IMCA 3EAQA 3TCKA 2HZCA 4NZ0A 1OR8A 2ZP1A 5BMVB 1RAEA 2BFFB 1L4YA 4KQ2A 4MTPA 4UFOA 4OJKA 3M6WA 1UDAA 3SIPB 5L1KA 1O6ZA 1RWPB 5CA1A 4LZLA 1GU7A 1QAMA 1CS4C 5ALJA 4C4AA 5BW8A 1NHVA 3D3KA 3DOOA 1Z13A 3HVKA 2R9LA 3DMTC 4YALA 1G6Q1 4ID8A 4Y18A 2FR8A 2OHVA 4AAYA 3FCWA 3BS9A 3J81k 2C1EB 1X4GA 1WA5A 2HMTA 2Q3HA 3LZ6A 3B6MA 1DCKA 3ICQB 2HYIB 4CM5A 2G71A 4Z0HO 2Z04A 5FOWA 1E6VA 4LRBA 1L7VC 4QXAA 1LDMA 2ZAGA 3PTWA 4ZT2A 1D2AA 4EFNA 1QSSA 4J0KA 4RWXA 4KFUA 1NDKA 1V4VA 1T8RA 3LSYA 2D41A 1ZIDA 2PZLA 3HWX1 1IQRA 1Z6PA 2FX2A 1SRRA 1B0UA 5FNVA 1DDIA 3PE6A 2PX3A 4MV5A 2XSZA 4L7QA 1R0AA 3G7NA 1YRAA 2Y6UA 4BDPA 4B6EA 3LUGA 5BYBA 4AMYA 2HLPA 4LCEA 1MAWA 1DQSA 3DUFB 1GP2A 2JJQA 3PGKA 2OK8A 2ZYRA 4YV0A 1PT5A 2O07A 3ZDXB 3FPSA 2CYCA 3IQHX 3I23A 1B3RA 5HS6A 1C9KA 2UVPA 4MS4A 2NG1A 1M34B 5DISB 3OV7A 2G9OA 3E5HA 4RKEA 1HI1A 1JIUA 2QZJA 4KACA 3MCOA 2YTZA 5A0TA 3HGTA 4E13A 1J39A 1FVSA 2AA3A 1YB7A 3FEYB 5F8IA 2BTEA 2ZVPX 2W01A 2YCBA 3KHGA 3USES 5TB5A 4XH9B 5I3ZA 4DL6A 5EUBA 3AD7C 1YAJA 1AKRA 1IJFA 3UWPA 2DRIA 5JS8A 1M5KC 1JJ7A 1QVVA 1E79D 4BLUA 5FBHA 4ZEVA 1NG1A 4BNDB 1Z4OA 2QQEA 3ETNA 2FPPB 2QGFA 4QGBA 1UVKA 3SJUA 3O4IA 4E07A 1VG0B 4DLTA 2BGNA 1ZN2A 2AP6A 2FK8A 1JPNA 2IZ0A 1NI4B 4WTOA 4CETA 3OZBA 3GUYA 1QAJA 5DASA 4EZ9A 1EVKA 2KB2A 3P96A 4PFSA 3FGOA 1HNVB 4RZSA 4XJSA 4I4BA 5JAHA 2O3UA 5LSAA 3MJEA 2JI4A 4YB7A 4P98A 3MTBA 1AMUA 3QY9A 4J91A 1YC5A 1NU8A 3AVQA 1LXCA 3AEUB 1N52B 4PGHA 5KOYA 1QLJA 5M2PA 1GZSA 1IOZA 1MH9A 4C7XA 5LMZA 3L02A 1Y5NB 4GGMX 1KDTA 4ENQA 4UHDA 1DJLA 1QAIA 5J1TB 4C0AC 4QQ8A 2QN6A 5KZMB 2E5FA 1DXYA 3D3JA 3B1WA 4RPKA 1XTTA 5M2QA 2PEHA 2XPCA 2HXSA 1HNWJ 1U0TA 4NCJA 1YLXA 4N6OA 1RT3B 3GLGB 1FEEA 5G3YA 1FFSA 1K89A 3ASZA 4QWEA 3CTRA 1X4EA 1EEXB 1ADGA 1ZZGA 4BEBA 2ENWA 3DTTA 4OBWA 3PPIA 3WSVA 1EBUA 4H4KC 4Q4DA 4YP9A 3FY4A 4MXDA 5EE3A 4E70A 4XFJA 3TS1A 5CFMA 5HP1B 3DLGB 4RDHA 4WIIA 4BFUA 1RWMA 3JZIA 3G8DA 2IEYA 4DSLA 3AFIA 5IG2A 5J5CA 4D9NA 2AMCB 2V7TA 3MEEA 1R0YA 4OHWA 3O1IC 2GPYA 3SD7A 1TJNA 3G88A 3V2HA 5BR7A 3T8YA 4U8VA 1H5UA 2FG6C 1CYDA 1V8FA 4TWJA 4MAFA 1JZTA 4MPJA 5KYUA 2HSJA 3ONFA 1T1IA 4RF2A 4EUFA 2ERYA 3FRIA 5D15A 3GRRA 1XNRJ 4YCMA 1W47A 3ZXIA 5HK9A 1UZMA 2JVKA 3WRYC 5EYPB 4B3HA 1KI7A 2ZCVA 1WEHA 3GHHA 1FX0A 3GJSA 8ATCA 1XDWA 3DBVO 3HGMA 1FKAF 2PO5A 4WESB 3UN3A 4JI5F 5KG7A 3A6FA 5DYWA 3IOCA 3CCCA 2V0GA 1Y8ZA 3QT8A 3H9UA 2ZRGA 2HHVA 3PHIA 3R6LB 5IKEA 3TW8B 1NVAA 2RBGA 4MDHA 1RZRD 1KI9A 3IR5B 2Y92A 5CM8B 4BVHA 2XULA 4DQPA 4PPZA 1EP9A 1H1LA 3OSZA 5C5DA 4AF7A 5LDDC 2ACEA 1DFHA 4JOBA 3AH6A 2JFKA 6Q21A 1HLGA 1VL1A 2PSSA 1RHUB 4DV3B 3KJGA 5DTRA 1KDRA 1YZYA 3A6LA 2FCRA 4LI0A 4U39A 4PRFA 3V4LA 4J03A 4DCTA 4YJ3F 1XQ6A 3W9JA 3UDEA 5AK6A 4G4SP 5JBQA 2BJDA 2CUNA 5CHEA 1XLVA 4MYCA 1B99A 2ZUUA 2ZT7A 4R68A 1RQGA 1UZNA 4DCCA 2ZIZA 2N1MA 4J2HA 3AAWB 3OF3A 2DO4A 4OAOA 2HNZA 2HSZA 3NVAA 5HYVA 1GZ6A 3KAKA 1N8RT 4HVLA 2CGEA 4IJMA 2JVIA 2QTVB 2FSPA 2QVBA 1HQUA 2COKA 1JWWA 1X8DA 4NY1A 5KWSA 5BW4A 1XJWB 3RYHA 2U2FA 5D3MB 4X8HA 1Z25A 3OTIA 1XNJA 3MFQA 1NXIA 2DGTA 4DR6F 3A58B 4ARZB 5GV8A 4IEIA 5GONB 4A8OA 1I6LA 2UUAB 2CBXA 2O1EA 1DOAA 4FU0A 2D74A 1HQYE 4BZXA 4W8GA 2C9BA 2ZSHA 2MPUA 4MGHA 5BR8F 3UXHA 4N6NA 3NOOA 1NHWA 1RYNA 2N3LA 2BFDA 2OFHX 1PK9A 4P84A 4ECSA 4DDMA 3QU7A 1IDN1 2CWWA 2E1CA 3IBCA 4KX3A 1X6VA 1UPFA 4O1MA 1CULB 2FG7C 2Q2VA 2EDCA 5T4EA 1PWXA 3C6UA 2QV0A 4FJ2A 4HWKA 2CL5A 4K9DA 4M36A 5F3TA 5F1YA 2DHXA 5H1YA 1PEAA 4FINA 2YWJA 3Q0AA 4Q3CA 2ZJ1A 3H04A 4Q0BB 4KOAA 3M8ZA 1V3TA 1X8JA 1UOOA 2J3JA 4B71A 2OZLB 4MKHA 4ICIA 2G5GX 3PG5A 3OQPA 3BB4A 1RBQA 1Y4UA 5A5EA 4IOAQ 5F9NA 3SDZA 3C3DA 3VVTA 1OY6A 4JR0A 3W61A 3CEMA 5CA5A 5JNTA 1PL0A 4R8KA 3LF2A 5A7GA 1T3TA 3GMSA 4TZTA 1IY9A 3IP0A 1NUQA 4HXYA 2P9ZA 1BQXA 1CD5A 2CEKA 5DYTA 3FOWA 5AW7A 5D0RA 5C9ZA 3OLZA 4I2QA 4MVJH 3CE9A 3RUAA 4TVAB 4MIEA 1PX0A 3K0JA 3A28A 3ZDEA 5AXDA 3MOGA 1ISMA 4RFVA 3QOXA 4JI6F 1U3FA 2Q6CA 3D1QA 3G1WA 5KYWB 1I51A 3Q7PA 2NV6A 2A5LA 4I55F 3HZGA 3KO8A 3KJQA 4ZP8A 2QTBA 2E5GA 2I8EA 1J8DA 2OUIA 4H1WA 4ND5A 1KK0A 4QNNA 2AUTA 4HZUA 1YZGA 4U6PA 5E8JA 3L82B 3I37X 1TEZA 4G1IA 3GEHA 1B64A 1IU9A 1LLUA 2XLKA 3LDFA 4QSHA 3WZLA 4P08A 4Y6OA 3L6CA 1JA0A 1N32F 2R6DA 4HQLA 3K6KA 1Y11A 5BWMA 4GKBA 2Y3IA 2RHMA 1KONA 1C81A 3ZDAA 4Z7YA 2FY1A 1Z6XA 3BO3A 1U45A 3G68A 1DCTA 1YBAA 3FCVA 3SZRA 2JLXA 3MNFA 2R7NA 3OQHA 1IBLB 3GVPA 3NHZA 5JW6A 3JR3A 5IJ9B 4UATA 3G8SA 2JC1A 2QGNA 2VJNA 1ADFA 2FVXA 3HX9A 1VQ9S 3EFOB 3WMRA 1U04A 1FTNA 3B6EA 1CP3A 5A9SB 2QNRA 4B44A 3U17A 4POOA 2VJKA 3A9UA 2AZ3A 2WLTA 4OYMA 3RAPR 3HDYA 4C11B 1RHJB 1YV9A 2ZUWA 2LCWA 5KOIA 1TLLA 1DU4A 4GSKA 4LF5J 4KK3A 3JYQA 1FYVA 5AXAA 2EF0A 4YJ2B 4ALKA 4Q00A 1RBLA 1CJUB 3Q4GA 3WV5A 3IA0A 1AO3A 5DWVA 1U2CA 1EWYA 3QGHA 4RJJA 1VIVA 3PW4A 2ECKA 2VNAA 3GA7A 1MFPA 1CDEA 4LDNA 1ZMRA 4BV2A 5IDWA 4C22A 3M9OB 1YMUA 5TQ0B 3L95X 3HD2A 3IQEA 1WKJA 4HVZA 4OK3A 2ZCJA 1IUNA 3HKEB 3ZYZA 5H3HA 1QJ4A 3EC2A 2NVOA 4DJEC 4IIEA 2ZZNA 1PN3A 1UTAA 5CBPA 1ZM7A 2Q66A 5HJEA 1FTQA 3BMQB 3NNSA 4CCWA 3T5AA 3D0IE 2ASJA 4HB2A 3OIYA 2IW3A 1UBTS 1FDSA 2O8EA 1R66A 4CM4A 3CUUA 5EE1A 1SFRA 1TU0A 1GGEA 4ODIA 4BQFA 4D3ZA 1XKQA 1NH7A 3VYTB 1NP3A 2BRUC 2YKPA 4TLLB 4NARA 1G1MA 2Q7DA 1PNRA 2DNKA 2QEQA 2H7CA 1A50B 1UBUS 2OCAA 3VNVA 3WZ0A 3KZKA 3OTOF 2FMXA 2BKNA 3SFGA 3LT4A 5AKLA 3UJHA 2YASA 3I1YA 5AI4A 1H9CA 3TO5A 4HFMA 2ZJ7A 1FLDA 1U0GA 4Q8EA 3DOMB 1DIBA 3GEIA 4OGGA 1H8ED 2FX3A 4DMCA 1G8KA 3RC7A 4IILA 3AL3A 1QVZA 2R9VA 4LRYA 3AVTA 3A4TA 1K9SA 3MAAB 1Z9BA 3RAGA 1Q1ZA 2IV7A 4C2BA 2DH6A 3VR6A 1M1XB 2AGQA 2XMAA 5G0RB 1ECGA 4ZI3A 2UUCJ 1NVVQ 3TGWA 4TYYA 2VTDA 5K0EA 4PG5A 3KLBA 1TMYA 2QRHA 1RWKB 5HW0A 5J2TF 2IUUA 1N4LA 1FJCA 4MTCA 4L9WA 5CHCB 3QHQA 4K8RB 3AHDA 4J7XA 4ZMMA 3CC2S 1RU2A 2VDPB 1TZBA 4MGKR 3QLEA 5IM4A 2CA9A 4X3CA 3FFIB 5KQRA 3VZCA 4GE0A 1GG2A 2P30A 2E1RA 3SHWA 2MZ1A 2J08A 1BZYA 2BFEB 2NZXA 1QP0A 2GO8A 2WIKA 3VZSA 3I28A 3QVVA 4O4HF 2NGRA 4DAOA 1QG4A 5CH5A 3N7TA 3JWPA 1DBVO 2AW3A 2UP1A 4K88A 1FDVA 3CMCO 2V7WA 2Y1FA 1CUJA 4B8WA 5JNUA 3KT0A 2QLJA 4YFYA 1RADB 5JCOA 4DF3A 5H9VA 2GSDA 1OBCA 2ZSKA 2PC6A 1R7IA 4ECYA 4MGEA 3HKCB 3NT5A 4GU5A 4KI7A 3UB4A 2DB3A 2WHEA 3WXBA 3WO1A 1HMVB 3H2JA 1WHSA 4KQIA 1P4SA 5DTQA 3NWBA 1SPBS 4PSUA 5G0TA 2ZIWB 4EBBA 1Q77A 2B3DA 3QE3A 2DD8S 3COJA 2WSSD 1L6IA 4X1IA 1CB0A 2FGCA 1HNIA 4IRDA 2XX3A 5I9TA 2PXXA 1M2OA 3OIWA 2RAPA 2VEDA 4O33A 3Q40A 2XWJI 5FFMA 4M0PA 2JGAA 4IXWA 1ECPA 1GZUA 2EYQA 4EHAA 3W5BA 2VHWA 5ESWA 3L8CA 1BWRA 3CEAA 5B5SA 1J23A 4RZQA 2XT6A 1PHRA 1ML3A 4LKRA 1VXOA 2C2YA 1F6WA 3WBKA 3R4VA 2QXYA 4BNUA 1F60A 3BIWA 2FP4B 4KK4A 4M5MA 3BILA 5DGXA 3EWIA 1HGXA 3NORA 5HGXA 4OFXA 1RPJA 4KRGA 3RB0A 2W0MA 2DE0X 4UNPA 3JYOA 5CGZA 3OM0A 3KHSA 4M0DA 1RDFA 3N5CA 1P45A 1TL3A 2G77B 4FBLA 3E0QA 2PZBA 1RABB 2P5UA 5FAXA 4CMJA 3BTOA 1X2EA 1SBHA 1ZIPA 1QR6A 4U2DA 2WOMB 2QROA 5LZ5A 4NYMQ 5AKZA 4Q9NA 1BH6A 3OKPA 3COPA 1L5KA 5I5GA 3P0EA 1IBRA 2R5WA 1H4QA 1DNPA 2ZC3A 5KPDA 1E1LA 4LNUA 3D1JA 2ZRLA 1NO8A 1KI1A 4JVNA 4WADA 4C0LA 2J9GA 4GT1A 2C4MA 2V8OA 2EJCA 3BB1A 4TSRA 3UUWA 5J4KA 3LP0A 3ABQB 2YUTA 2VPTA 2AXEA 4EKNB 3K1AA 2JA1A 1J70A 4KXNA 1OPIA 4UEOA 1TCVA 3KWLA 3RUCA 1GPAA 1DQPA 2OC4A 1PR5A 2P1ZA 4Q3OA 4P3KA 1JS1X 4LVOA 1XKTA 2ZI3A 1IHUA 4D25A 2C7BA 3R5CA 1RXOB 3WWYA 1GG5A 3H59A 3CBQA 1V1MB 4XLLA 1U0JA 2XJ9A 3TP2A 3EVDA 2R87A 1U02A 3T3DA 2FPIB 4E51A 1NZAA 4KMSA 1LQ9A 1UKYA 2XHWA 4OH1A 4TZKA 1SD1A 3F5DA 3IB6A 4LF7J 4PWDA 1VFNA 5DTMA 3L5OA 5CB4A 2PRIA 1PT9A 4YRGA 4XJXA 4ED8A 2CD9A 3G2IA 2LDIA 3PGLA 3KM0A 5IAGA 2PA3A 4DFPA 4A82A 3L7JA 4JLUA 2HS4A 4DSUA 2WSEC 4Q9HA 3TRHA 4ZMBA 1G5FA 5F64A 3E18A 3OR1A 2QMXA 1O5IA 5IASA 4GHWA 3I72A 2MHCA 5TS3A 3LBAA 1WOSA 1FA0A 1EGVB 2WAYA 5A6PA 1B0AA 1UMDA 2GOYA 2BFCB 1LEHA 4IV5A 1UFLA 1N48A 1LPOA 1PW5A 3FNFA 1IK4A 1QE3A 4HDCA 3DXSX 3RFXA 1VQKS 3FUCA 1S5ZA 1X0VA 3V7WA 3IP1A 4H6WA 2P27A 2Y9HA 3KEFA 3PJDA 1RTIB 1KC1A 2XNKA 1G8YA 1J42A 3ORQA 4NEGA 2ZZKA 3G2HA 4ZVNA 4FKYA 1N2HA 2ORIA 1EDOA 4BJ6A 2OEKA 5KYYA 2ZOGA 1AK9A 3FVWA 3GYNA 2Q1UA 4HNQA 1HLDA 3EZ9A 4UOZA 1HNXF 1H05A 3DAHA 4IG0A 5CB8A 1RXUA 2FNAA 3BD8A 2C4KA 3HZZA 3C3KA 4U7JA 4G0XA 1XTQA 5CJPA 2ZUVA 4EQZA 4WLUA 3LWZA 1IY8A 2WHPA 1M1KT 3CDWA 2YVKA 4DR5F 5TS2A 4LHXA 3M1LA 3HT3A 1T9DA 2DC1A 3T7AA 2ANCA 3F90A 2HFNA 3D3CJ 3V6KA 1EI9A 1NUEA 4UBOA 4ZWNA 4Q82A 2D69A 1F14A 1GSIA 2JGLA 2JAPA 1M5HA 1L0BA 1VDHA 4IH7A 3J7YU 2QZ4A 1PYGA 2O2JA 2CQ0A 5I7AA 4C4YA 4UUBA 4QC2A 1OFUA 5EP1A 2VQDA 2DR5A 2XM3A 3BWVA 1FU7A 2DBRA 2YWEA 1R4ZA 2IXAA 4ZREA 2G9VA 2VNSA 3UVEA 4TOIA 3E48A 1F0PA 1ORRA 1HDCA 4Y6SA 1D2GA 2A6PA 2CJXA 5HE8A 4DJFC 4QU0A 1RAFA 1JVNA 4BN4A 2JIZA 3B6BA 1HBJA 2AC7A 2FC8A 3Q0TA 1JG6A 1MD9A 3G86A 1WHTA 4FBTA 4BEWA 1ZTWA 4UNQA 2KHDA 2P90A 4BZZA 3TQ1A 2HX1A 4AW9A 1NJWA 1WCIA 2VCYA 3DU6A 5CT6A 2IH2A 3U3OA 3NKYA 1IJEB 4C06A 1Z36A 1E66A 1KOOA 4Q9KA 1ZJ6A 3OCVA 5D00A 3VGPA 5DGDA 1RP1A 3D7NA 3RS4A 2XOKA 1O95C 4BMOB 4MS1B 4DTCA 3K5OA 4QOFA 4E46A 2V3VA 5HZMA 4IDBA 4H31A 2A6MA 1QYVA 1KVIA 1P62B 1VJWA 1K47A 1PGPA 1UEJA 1UFOA 3M1YA 4KTTE 4Q3LA 3AXTA 3C6QA 1TM4E 4WP9A 4E7PA 4RMNA 4HMQA 1FTWA 1OW3B 4WA8A 3RFUA 2C2OA 3PKIA 3W8GA 2HADA 3OLWA 5BW6B 3CEHA 2WFZA 4D9GA 4B9NA 2XZLA 1Z17A 2B21A 1Y5LB 4IZOA 3Q3VA 2PGIA 1SOAA 1PGQA 2YN4A 2XVAA 4W1RA 3BS4A 4HX2A 3U7HB 1ZI8A 3EJMA 4B09A 4GPZA 4AMUA 3PG9A 2WSBA 4Z6KA 4UU8A 2I4OA 4M1QA 1VRQC 2KJVA 3ER6A 4C07A 3H9BA 1OLSB 4LF6J 4TXLA 4Q4CA 2BMEA 5E4FA 3QXGA 3ZLBA 1BMQA 1JLMA 2JBAB 2CSXA 3OHPA 3WLHA 5HVFA 3QFWA 4TVBA 2DPXA 4OP1A 1TZ0A 3M32A 4DUTA 4FT4A 1UPAA 3OI7A 3WDSA 4X4OA 1OC2A 5A5DA 3DMJB 5B6PA 4LDJA 4B9LA 6REQB 1MMDA 3RUHA 1JALA 1ZIYA 1TVKB 2GCNA 3GC6A 2DNHA 4L4ZA 4B45A 2QRVB 3ZLTA 4D3HA 3G82A 5JZBA 4FFDA 4RPJA 3SFZA 3HDSA 3DZHA 4FHFA 2ZRMA 5DX8A 1E3WA 1E2KA 4P8RA 1QWSA 1EIWA 3W34A 5FX2A 1QV9A 4MUYA 1DTQA 3WDOA 2NVUA 4Q4HB 3KB8A 4F0KA 5FJIA 2XMMA 1NNLA 3NS7A 3BVPA 1IM4A 3SMQA 3R9IA 2CRLA 4C8MA 1DWQA 4M5KA 2QL6A 1A4XA 3R6WA 2ZTHA 2HHJA 4FMPA 2Z08A 1NK5A 1KH1A 2WJIA 4AD8A 1T1GA 3VC7A 2PYDA 1L7NA 1YZNA 1C0TA 4HEA6 3R9WA 1H4TA 3EEFA 4EPVA 3UEOA 1JFFA 4EARA 3WLNA 3KBBA 4F02A 4ZO4A 3CTPA 3Q9SA 4EHJA 4MAKA 1QCZA 5DLQC 3TZQA 1KIFA 2EG9A 3HKDA 3MEGA 5JARA 2H1LA 5C7PA 5DM2A 1QVRA 4BQPA 1T2UA 2JVJA 1JKFA 4IIGA 5ALVA 2Q3EA 2CC2A 4DT1B 2IIPA 1UJ5A 4US1R 4D74A 1FRFS 5ILQA 1RACA 1RNLA 4LIPD 4MWDA 1ULRA 2WB1D 5ANRB 2ZYTX 2V59A 1RUSA 5EZYB 3HDVA 5J2MA 2IS6A 5J5VA 1BE8A 3FNNA 4PLZA 1NUAA 1T36B 1XU4A 5I42A 3U4QB 2WHRA 3OVBA 3GJ0A 2PX8A 2RHSB 3IGVA 1PD0A 1GCGA 3FNIA 3VSEA 4QR2A 4EA6A 3U1LA 3E9MA 1J0CA 3U3JA 4YQWA 2W6JA 3F3SA 1TFYA 4RABA 2E82A 2WTBA 1NC3A 4Z4IA 4H4EA 2WHQA 5IEBA 2NVBA 2X1MA 4RTRA 4R8SA 2HIQA 1KYVA 1OHHA 4NK4A 2IS4A 2XCTB 2OPPB 4XIFA 3LL4A 4XWOA 3FBWA 4LE2A 3NHKA 2AOUB 8MHTA 2AB0A 5JTUA 1KK3A 3JS5A 4IJUA 1YH3A 2CUZA 3ZBPA 5EERA 1A0OA 4MK8A 1B8UA 1K6JA 4KE6A 4G0VA 2AZ1A 1FZQA 1GPKA 4GKAA 2P79A 3IODA 2AX1A 4F5YA 1XRLA 4JI3B 2NYIA 1N7IA 2R6FA 3DDOA 1UXOA 2FMHA 5TEWA 1FKOB 2ZYGA 2IDEA 5HMWA 4B3MJ 1KWMA 4NX2A 1ZI9A 4QJIA 3NHAA 3BK2A 4G86A 1QU3A 3BQ9A 5FUWA 1YRQA 1Z45A 3V1KA 4QTUB 2XCIA 2GFIA 1SVDA 2A88A 3CJSA 5GADU 1RYEA 1E6YA 4QIGA 4RCZA 2PSFA 4YGXB 3TBHA 3JQJA 2AGOA 1QQAA 2LLZA 1TL5A 4RANA 2FWPA 2BKEA 4OV6A 1R8XA 4YWJA 3PC8A 2FWAA 4YUDA 1P2FA 3M9WA 2MHNA 1VHWA 2VYFA 4O0MA 3HCEA 3TAPA 3HJUA 1Z0IA 1M5RA 4PNPA 1JLGA 4LNHA 4DJDC 1L7XA 1L8XA 2EC0A 2B9XA 1A1VA 3E8SA 3NJ8A 1I3LA 2AFVA 4WIQA 2E44A 1EP2B 4LYFA 2JKYA 2CD7A 1IN1A 1BG6A 1IBKJ 1THTA 5CCBA 4TQAA 5HRCA 5KYXB 2CBGA 2K2QB 4OHUA 1PG2A 2XGJA 4CYMA 1NXVA 1TZCA 2AV5A 1TL1B 3MCZA 5HUJA 3PKJA 2FF7A 3ADOA 3NHRA 1QBGA 3W05A 2HF7A 1QHSA 3R7FA 4XVHA 2WHYA 3BF7A 2W2VA 3FLBA 4GVBB 4LVUA 4XX1A 1E2JA 3USZA 2VTBB 1YASA 2Y05A 1CR6A 3CFYA 1PQYA 3GBPA 4H6VA 3KOAA 4WYWA 2G83A 3OE1A 4BYMA 1W93A 4U2EA 2DWPA 5AQ1A 2XI4A 4C7OB 4D45A 4H15A 1GAOA 1FQOA 4D0SA 3RREA 1PR4A 4IGEA 1KVJA 1XL1A 1JMTA 4EX7A 1XMPA 4F21A 1HOTA 2K3IA 1FOEB 4DV7J 3DFZA 3O8RA 1TZKA 2L2QA 2PVCA 4P2SA 4RXTA 1DTTB 1CZHA 2ZH1A 4NBRA 1BEUB 1CVIA 4ZJQA 3S1SA 4YB6A 1XJQA 5C5CA 1AS0A 1RWWA 2RHHA 3SPXA 3KLHB 2UU9F 4KY3A 4LBZA 1SY7A 2J0WA 3PV0A 4C9DA 1NFFA 4Y2JA 1X7WA 4QIWD 3KLGA 4ENSA 2LKDA 2A2DA 4Q37A 3TRJA 4IHQA 3L7MA 1NF3A 2DHHA 5IANA 3GCXP 4JN6B 2F40A 4BWMA 5IT4A 1JLRA 4R1PA 1H72C 3OSPA 3PA6A 2YJ6A 3FPJA 1FQWA 4DIMA 3AQ4A 1L5UA 2WWGA 4IRMA 2YKMA 2YWGA 1N2CB 2D3WA 2VAPA 3O1JC 3OP1A 4URVR 2IOFK 1UADA 2DR8A 5HQ3B 1X1SA 2WKQA 4P75A 2IVYA 2ZSJA 3SDEA 2SICE 1Q79A 1LX6A 1SH0A 2N9UA 2VUHB 3K9FC 4WNAB 1E61A 3WYEA 3M6VA 3ETLA 4QT0A 1EWKA 1DLOB 4XPIB 3RS0A 2QT7A 2NSDA 4K9OA 2J33A 1SNYA 1ID1A 2B69A 1AN9A 4AK9A 4LV8B 2Y0BB 1B6TA 1CEQA 1KQGB 3HU3A 4XQEA 1AN0A 1GHTA 1OYEA 1T9BA 4W9NC 3IOEA 2DUWA 4UEQA 2WD8A 4ERDA 1OX5A 2LVBA 1TU3A 3RRHA 2XE6A 2QYHA 5K9FA 4U00A 5LM7E 4MV1A 1DI0A 2FEMA 2LCIA 3D4NA 1JLEA 5DBHX 5DX0A 1YOVA 3EVCA 1X4CA 4N54A 1LBSA 3DL7A 4P1ZA 3LYAA 4QG7A 1YGYA 5CH8A 3IIIA 3WL4A 4R84A 4M4SA 3B2NA 1NNDA 3OT1B 3DV0A 1P9NA 2FXIA 3OVMA 3IAHA 4NXNJ 4R54A 3IPLA 4JOCA 3ZZPA 4PFKA 1CX9B 3UH1A 3BH0A 4JJ7A 1SKRA 4GR9A 4TROA 3AZOA 1TJ4A 1G6HA 3ASUA 1NV9A 1N36F 1CFJA 1PR2A 3G0IA 3BCSA 3IILA 4YHBA 1M6WA 2XD4A 4PN3A 1C30A 5ECYA 2P9HA 2O6LA 2DCLA 3P45B 2R1VB 3ASYA 1H6AA 3DE2X 5D6GA 4MVWA 4HQFA 3A1EA 3ENAA 4KZKA 2Q41A 4HKTA 1BQMA 3I5UA 1IVZA 4JB2A 1QRTA 1S1XA 5J59A 3A1VA 2GVNA 4MFBA 3KNZA 2HFSA 3WB9A 4YMLA 5EA2A 2CQBA 4YAEA 2OHOA 4JI8B 1KYZA 3I01M 4V0LA 3BRQA 2ZQ5A 4BBAA 4GOLD 4N7MA 3JARB 3FKBA 2XVXA 2Y2VA 3R7NB 4GMXA 2DNGA 1EUCA 3HP4A 2FHOB 2XLIA 2AYYA 4UUNA 4HNTA 3BL5A 3L49A 4EZEA 2ZR9A 1K4MA 5G4KB 1FFEA 3QBJA 1KRWA 3ZCPA 4NZOA 2O1SA 2ZH8A 1MVNA 2X4LA 2Y1OA 1KSJA 3M05A 4BVLA 1FUIA 2WQ6A 4MPPA 5ARDA 1Z4LA 3MUVP 5CDUA 2VK4A 3ORFA 4J0IA 1W5EA 5L7WA 1AZSB 1HQ2A 4LGYA 3GRYA 2NU6A 1FJ7A 3MCAA 5L1IA 3QU4A 3CLKA 3GA5A 3MG9A 4WH0A 2GO1A 1SZJG 4NJMB 1QP4A 2BTQA 4MWEA 1NQXA 1U7PA 3NIDB 5EVJA 1AHNA 4G4GA 3TF5A 2Z8QA 2JEIA 1U80A 2WF8A 4EKIA 4LSWA 2GHIA 1PG0A 1LX7A 1RZVA 2NSJA 1RBAA 2GVDB 4XUEA 4NJOA 3D68A 1LW6E 3KJNA 3TR5A 1E2GA 2XCUA 1Y4ZB 3EDOA 2QY6A 2XTAA 3LWBA 1H6BA 1HORA 4G67A 1X4FA 1NKBA 3ORRA 1F4PA 3EXCX 3C15C 5DYNA 4V1CI 1VKOA 2CYYA 1NX6A 5HQLA 1SI9A 3FUUA 3MJCA 4EGJA 3DZKA 4E11A 2H9ZA 3A6ZA 4K6KA 4UHEA 2J9YB 2VG5B 3H5WA 1QS0B 2BV3A 4ON9A 1CF4A 3EUAA 4XAQA 3LIIA 3JWIA 1E1KA 4X4RA 3OQJA 3BSFA 1ZM4A 1R0ZA 4BYGA 3DNPA 2MSLA 2O3RA 2QORA 2OO5A 4YLGA 2EXUA 5C42B 1TW2A 3GK3A 4ZZ2A 3O44A 5HRUA 3R9XB 5IUNC 3T1TA 3PUIA 1NDCA 1ZK4A 3FX2A 4ZV9A 1EHYA 4U02A 3NT4A 3T06B 2YWCA 4L50A 4ESEA 2V03A 4IGAA 3H9JA 2DTJA 1IEQA 1CQXA 2YNMA 1LQTA 4ETNA 4KIUA 3ETHA 4OIFA 2CG4A 1X77A 2EJVA 4LCJA 3GRCA 4DUGD 4E5SA 3FTPA 1OX6A 2F8LA 5FO1A 5H9EK 4E0DA 5LOVB 1HBMA 3TW4A 3VZBA 2VQFF 4DABA 1XRJA 3BSOA 1E4YA 3T1YB 2IHVA 3OUUA 5ALRA 4NZ7A 2XY6A 4WN3A 4CG3A 4JI4B 4AKHA 1N6QA 4LFCB 3ROZA 1LNQA 2IPOA 2XXAA 2BGMA 1V35A 1C0UB 3F8SA 1AFJA 1U63A 1U1NA 3GFSA 3IESA 4XOIA 4JBXA 3OPMA 3X3HA 5BP7A 2QAGB 3H5AA 2YICA 3L0ZA 3GZNB 3T9AA 2A0KA 3HULA 2ZRKA 5EQJB 2Q6VA 4UM5A 5ALGA 2F1OA 3GQBB 2RHLA 1FFGB 1UKEA 2V4QA 2RJ3A 1DQ9A 4CLYA 1FFBA 3EC1A 3T12A 4ALLA 3FZNA 2YXDA 1CK4A 4A8YA 2JI7A 3LV8A 3SYZA 3Q6IA 1U7ZA 1U1FA 5KX5F 1CG6A 5FDLB 1SVKA 3B60A 4UBIA 3H11A 1KWGA 1N57A 4RGYA 4V3BA 1XWFA 2AJ8A 3H5LA 2JSXA 2MEWA 1Y6FA 3BBPA 2FLKA 1W0CA 1M2KA 2XTJA 5BQ5A 1F5SA 3PDIB 3TNVA 3N07A 1YVFA 3NXSA 3BE5A 2WWIA 4FNIA 3UPFA 2VUIB 4X7PA 2Z9BA 4YTEA 4WA7A 2W2PA 2R60A 4IJKA 3SE7A 1JR2A 3MCVA 4O2BF 5DZ6A 4DLSA 3OZVA 1BXKA 1U0NA 4IS3A 2DPIA 2RJZA 3QUSA 5JJLA 4JI1B 1RCUA 3SE0A 1RPZA 1CXZA 2HDHA 4JQZA 4DQVA 3R3YA 4TN2A 3RBXA 2HXYA 5K4HA 1FDBA 3CF6R 1U0FA 3AXSA 1PGNA 2PA8D 1JNZB 4IH4A 1P8GA 5K14A 4JI2F 2HKIA 1TM5E 4DC9A 2DFKB 2B98A 1P18A 2MKYA 4UPVA 2CJQA 2JH8A 1UBGA 1UM9A 2XDYA 4IIJB 1U7HA 2CUYA 3QBEA 2HQ3A 1S4QA 2Q8PA 4IO0A 5AW9A 3FMGA 1SJ1A 4K9SA 5L3SB 2G1PA 2V54A 3IAS9 5A0YB 2BFBA 3BXPA 1FU8A 5DGAA 3TE7A 1DCFA 1XMQF 1WVIA 1ZGAA 2VA9A 3FPBA 3NDJA 4Q03A 1YCDA 1P4GA 1NSFA 2M98A 3WBJA 3EASA 3V1NA 2ZDGA 3DL4A 3E9EA 4Y2KA 4NLRA 4UCWA 1CZOA 4FDVA 3LCMA 2W9XA 1I4WA 2BBTA 5ADUS 2H4XA 1SH7A 4N9QA 1X7YA 1JU9A 2ES4A 2VNIA 2GEKA 3M2PA 4DMZA 2XBMA 2NZ4A 2AYEA 1ZDMA 2OWEA 2XWPA 4GWKA 3OJUA 4MJLA 3BQNB 1USWA 4NAVA 4R41A 2XCRB 1H65A 5AESA 4UDYX 4YJFA 4BP3A 1A8UA 3DYAA 3PNSA 3ZPXA 2YFKA 3W3ZB 1ORWA 4B8ZA 1QH8A 2JD2A 4K4SA 3C7TA 3VTIA 5KTPA 1IKYA 3AHGA 3WSTA 1S9EA 4D9BA 2YFHA 4ZK2A 1SKWA 1F9FA 1ZPDA 2HUNA 1CJKA 3O3LA 3MEKA 2J6BA 1ZS6A 2NCKL 1DHRA 4LYEA 1N1GA 3PFGA 1ZGJA 3KK1B 2IHNA 1RHRA 4ZO8A 1JKHA 5EX0A 5JVDF 4PSCA 1S1TA 3CX3A 2RKIB 4AG5A 4B87A 1FERA 4BX3A 3OX3A 5T4HA 1COWD 2WONB 1NBOA 2ZT6A 2HA2A 2X41A 5F8MA 4M55A 3BT7A 2AOTB 3HVWA 4PM4A 2W2OP 3UAZA 4OA8A 2QL9A 5L8RC 5H3CA 1F38A 3UT6A 1V3SA 4RCVA 4QDTA 4Y1RA 4MKIA 4MLDA 4ZOLB 5IT5A 4L3OA 2BEFA 5C8YF 1J06A 4DR4B 3D7SB 1PCAA 3VTFA 1W5AA 3NKVA 2VKQA 3U62A 1EK1A 2WYHA 1XAGA 2G06A 4B9TA 3S6JA 3LXXA 3OQIA 4JI5J 1N9GA 2EFNA 1P73A 4QOIA 1OWOA 1YOBA 3UAVA 3C3EA 4LQDA 4LRUA 2BM0A 2MKCA 3W5CA 2ZS7A 2CDCA 4I81A 2K8GA 4CM9A 4L5CA 4QU9A 2R7UA 5FI5A 3I2IA 1GV1A 3EX7B 3ND9A 2L41A 1YBHA 3ASVA 2NPFA 4C6TA 4QDJA 3UCXA 1NEEA 3ZDYB 2G13A 2ZD1B 4CRWB 1XCMA 5FPHA 5C80A 4G65A 1XA4A 3VALA 4Q6WA 2HMSA 1FWLA 1GSHA 3UD5A 1FTGA 3U9TA 1YJQA 3EEBA 3H1BA 3PCRB 1A5AB 2W24A 4D8XA 1PTKA 1WW2A 4BC9A 1Q2UA 1ZHFA 4TPKA 5ES4B 2WJ3A 4IH1A 3ETOA 2NTNA 4B3CA 5AI9A 5DP1A 4EK9A 3EQ9A 1UF9A 4HL6A 2DGSA 3QUBA 3U56A 4P31A 1IL0A 3V2IA 1BJRE 3V81A 5AW4A 3LA0A 2MINA 5E8RA 4JT4A 3OQ2A 4QQNA 1ZK2A 3LQ1A 5F12A 2R66A 4YA6A 1D1QA 4RA9A 3FSEA 3FZEA 2Q3DA 1XERA 4LFBB 2ILTA 4A3SA 4RW6B 4RUAA 1P1LA 1MB0A 4DR6J 2PN1A 2QV7A 2Q3PA 4HWTA 1M5PC 3OMXA 2FUG6 1B7GO 4RKFA 3BBFA 1M1YB 4MWTA 3JYTA 2KVQE 3RANA 2HJHA 2PX0A 3T5CA 1C1DA 3K53A 1VHJA 1SVOA 3TVYA 5I9BA 4V38A 1BCSB 4WZQA 2VF7A 4OQEA 1R4MB 1VYTA 3AH8A 5DLYA 3LIPA 3LM8A 2DXDA 4YUXA 2UUTA 2JRSA 4KYUA 5EJ9A 3N39C 1NNEA 2W8KA 3JSAA 3DCNA 3HDJA 1BEEA 3BZQA 2P2CA 1DG1G 1R5OA 4DV1F 3N2KB 4GH5A 4IDGA 2D5CA 1PAUA 2Y9MB 1N77A 2V68A 2Q6LA 2H54B 4YB5A 3PHHA 2XIQA 3OJCA 9ATCB 4BIIA 1EFDN 3HBMA 3LGMA 3LQVA 4BP8A 2XBLA 3DVQX 3PXBA 2HZAA 3ES9A 2V6FA 4B3RB 3R3JA 1PZFA 3KB6A 3QSGA 4TV9A 3SEZA 2PS9A 4Q47A 4CKBA 1NPRA 1IHPA 4DREA 2GBLA 1NGSA 4NEYA 1UWKA 5B0DA 4I4TB 2ADCA 1KFDA 4OB7A 4BFTA 2QLLA 1NW3A 3W2EA 2FVSA 1NPPA 5BPFA 3KQQA 4CM8A 1HEUA 3OZGA 4FKBA 4JI6J 3L7IA 3E03A 4IDCA 3QSYB 3O7MA 1FFXB 3FMBA 4P7TA 2XZTA 2E5LB 1LC0A 5DV9A 1T5LA 3IDQA 3DZGA 5K3CA 5BYKA 4RDCA 3LQRA 3AKEA 3I01A 1DJQA 1IZ9A 1DAGA 1G5RA 2D59A 1KJIA 1MDFA 1Y89A 4LYGA 3I83A 5HNKA 5GPBA 3L0OA 4W7SA 4J9NA 3LZDA 1I7LA 3CWZA 1X9SA 4X66F 2Y1WA 5MN6A 1MPXA 3UATA 4YHHF 3TLXA 1CWUA 3EAGA 2QEXS 4OF4A 1RTHB 1ZJ4A 2GF0A 4LDQA 4AZ0A 5J47A 4EYEA 3ADAC 1E2MA 5ETMA 2PMZD 4KBYA 3NEPX 4C7JA 1NWHA 3L0BA 4M1YA 4FR0A 3V8VA 1NM5A 2CLHB 3ZK7A 3SK0A 1MIOA 3DV9A 3O0DA 2CCKA 2QT1A 1JFSA 3EODA 3ZE2B 4BO9A 3NDIA 2IZOA 2H65B 2MY8A 4N41A 2HDWA 3NNHA 2ZSEA 4NPHA 4X61A 2QA5A 5HHTA 2E85A 2MR6A 2Y67A 3FWKA 1OWPA 1WCXA 2IC3A 2P6SA 5TDHA 4AYXA 3ND8A 4LTMA 1L4EA 3ZV3A 2DLCX 1NULA 1DDGA 3MW8A 5T6BA 4XVUA 1AHIA 2TYSB 1J21A 5KNBH 3QSIA 1R5NA 3RVRA 4FCVA 1EJ6A 3DR5A 3NGRA 3GLFA 2IKQA 5ADHA 2ZYHA 4YMTA 1S0OA 4GM1A 3M7VA 2XWXA 3U40A 2IH5A 5E3CA 5GAGI 4W5NA 3OG9A 1TAQA 2R6R1 2WJHA 2DUNA 4CLFA 4J4BA 2BHSA 1A2KC 1GWNA 3ZTSA 1UBJS 2BEUB 2GAHC 4XWWA 1G8SA 1JE1A 3JB9k 4ZOAA 1BOOA 3THXA 2IGBA 3ROKA 1W5BA 3NFRA 1Q0NA 4DSKA 1FDUA 1V8BA 4ES2A 4CDIA 1M1UA 2Y0EA 2IY9A 3JQBA 3QJGA 1NF2A 1D2CA 1NU6A 2W58A 3K8QA 1NL3A 3DVAB 2Q4BA 2DIUA 1SG0A 1G4AE 3KSZO 4DGQA 4F8EA 4M0FA 5BORA 1ST3A 4R0NA 3S8YA 2PTHA 2KS6A 1OYOA 1N8KA 2HCRA 1Z34A 1CJTA 1CVRA 1NK6A 2OFPA 1VQ8S 1QGYA 1YK1A 4K6OA 2MZJA 1IRXA 3DCAA 4NXMF 4AWXA 5AH0A 3OTOJ 4CTOA 4JLOA 4M0UA 1SBYA 3ZWVA 3THWA 3I4LA 5AW0A 3MJDA 3B6IA 1F20A 2Q4EA 4X84A 1KKUA 1FKPA 1G21B 2W2NA 4BFSA 1Y6RA 2DHSA 4C6RA 2WK4A 2ESRA 1VQOS 1ZD5A 5COBA 2N4CA 2EKQA 1B1AA 3RHFA 1R0CA 1YE3A 3REQB 3DOCA 3U7IA 4IOKA 1RDRA 3DAYA 1YVDA 3ILIA 1L7AA 3MECA 5A0VA 1RVV1 4CLOA 2Z6VA 3WBBA 1J0DA 2VJAA 3SQGB 2X3UA 3HVRA 2KYXA 2X77A 3NBPB 2QRQA 1KKMA 2R44A 1QD1A 1Q14A 4RC9A 1WKKA 2ZI7A 3QRPA 4EZ6A 3O4RA 3KJFB 4XB2A 1YRTA 3RK1A 2AOWA 4E21A 3FIJA 1GVHA 2LR0A 2L82A 2ONCA 3O8OB 1PVOA 2IIBA 3X1JA 1JQBA 1G2QA 1H5NA 4IFBA 2QZ9A 2BA9A 3UANA 3U6BA 3IBYA 1EBBA 1RAIB 2CNOA 4DXAA 2ZDHA 3MCWA 3PTLA 1PDOA 4JI7F 1NLZA 3N2ZB 1S6QB 2R3VA 3PYLA 1T0JB 3OM1A 4NCXA 2H08A 2JGJA 1J90A 4U0JA 3D6VA 3RRNA 1Q44A 2NU9B 3II6X 2FPKA 3PX2A 4OXRA 5JJCA 1TV6B 1KVQA 1QGED 1MAHA 5IBCA 1CZRA 2EFQA 2XG8A 4DV5B 2ZRPA 2GPNA 3V8EA 4KSEB 2Y9PB 4ED2A 4JOSA 2W2MA 2POQX 4DQIA 2JFFA 2A9FA 4GLOA 3DVLA 4X65F 4MLPA 1W75A 1DG3A 2FLWA 1JU4A 1SXHA 2GTHA 5J5AA 3OQ6A 4BLWA 2WF7A 3VR0A 3DYVA 3LMKA 2W00A 4OQQA 3BORA 2WLSA 5EMLA 2IYSA 1N2GA 1LTHR 1AH2A 2Z09A 2CLCX 2A6OA 3D28A 3OZ7A 4QJVA 4ELTA 5FNZA 1TL7A 1DFDA 2IODA 2APJA 4IKAA 4USHA 2H9YA 4YRRA 5AM3A 1K6MA 1L2TA 2R4FA 4C98A 3E2PA 5J2PA 3GRVA 1W25A 1ZG3A 2PSJA 1X7VA 5DDPC 1X38A 4HBZA 1D6MA 5K3AA 1P7YA 1WPQA 1HD1A 2WUEA 2ZE6A 4H7HA 3OW2R 3NH9A 3D3BJ 3ZWWA 1RAHA 3KG4A 1NIJA 3PYDA 3JTMA 4HC4A 4LTDA 3ITHA 1K92A 3I05A 1NCLA 1X9GA 4RXUA 3EVZA 4UKDA 3L7NA 1FXLA 1A4RA 5DK4A 4BZQA 5ELMA 2AWZA 1TP7A 5J1EA 4O25A 1EQ2A 1E9CA 4TWIA 2DFVA 2Z56A 3EVMA 4I6WA 2EJWA 1K63A 4TSFA 3RUDA 4DV0F 1J56A 3MPVA 2BQUA 1EGMB 2UZ1A 3OM8A 2XRFA 3VR1A 3VH1A 5HOQA 2AZTA 4JV0A 2P1DA 2BFAA 4CBVA 1EMDA 4NRUA 5LWHA 1TCAA 3NS6A 1K2WA 1G2EA 1PFWA 2W7PA 1DKRA 5JAUA 2QLXA 4LWZA 3REFA 1XWWA 1SKUB 2CAJA 2A33A 1NKSA 2DLDA 5L1JA 3OX2A 4DLLA 2XITA 2J45A 2YWBA 1P3JA 3VC1A 2XW6A 3K30A 5F3ZA 3WOHA 4BV9A 5MFPA 1U0RA 3E15A 3H87A 3IN5A 5KYKA 3A3OB 3EWAA 2EKZA 3B4MA 2GQQA 2CZQA 1CS4A 3QF4A 3SSSA 2E4VA 2C4VA 2BANB 3IE2A 2IZ7A 4FBUA 4LF4F 5FD1A 3UMCA 1O6XA 3DMTA 4LE0A 4C3LA 4MYHA 1BFDA 1NSPA 3M83A 2RGUA 1C3JA 4XXHA 1KF0A 3PR3A 3JZAA 2RVJA 3S28A 3V7UA 1XNHA 3AF5A 2JARA 3AD9C 3VOAA 4P9SA 1HTWA 1XBTA 3PTAA 4B83A 2IBMA 3OZCA 4WKPA 3PR1A 1YE8A 3ROXA 2EQAA 1FC0A 1NQAO 3GZ7A 4JXKA 4YUZA 5F4BA 3M34A 3O94A 4KKOB 4I1UA 3OPKA 1ZH6A 3RKUA 3H5YA 5LP6F 1AGYA 3CH5A 2HK3A 1A04A 1YRYE 1S1WB 3NTVA 4LT6A 3HFSA 1OFIA 2BUCA 4TYQA 1BAPA 1MQSA 2D9PA 5EJ4A 1EDDA 2ZRFA 3V1LA 3OXFA 1ABBA 3KQPA 4WFAQ 1R4AA 3MTDA 5GMEA 4LBIA 4I9FA 2XYGB 1MC8A 1UEIA 1TQ2A 1U49A 3BRCA 1EK0A 2IYGA 1UWBB 4OHRA 2FW9A 2R00C 1NRJB 3HSKA 4PLPA 3TRKA 1E4OA 2QRLA 2Z2YB 3EGNA 1YQQA 4D0LB 3FGNA 4IJVA 1TTHA 3IFSA 5CYMA 1UODA 4HTFB 5DHSA 4QSMA 2I4NA 3IAM1 3O4VA 1Q21A 3U3KA 3FDZA 1ZCJA 2Q4OA 4DIDA 4OP2A 1XDBA 1U2DC 3J80U 3HK2A 3BMOA 3QHPA 3H0KA 1EK6A 3K9NA 4RK1A 2X0EA 2E5JA 3KLIA 1G5HA 2P6RA 3ZZNA 2X7HA 1I2MA 1U7WA 4UQPA 1SUAA 3EIEA 2OJ3A 3QNMA 3TLZA 5F7OA 2YXEA 3AHCA 4WFXA 2X1VA 1WDKA 4HGRA 1RR6A 1AIPA 3Q6MA 1AZLA 1Z18A 2RH5A 1WEZA 4YRSA 3HYRA 4C5CA 1XZBA 4DR5J 2VK1A 4QYZJ 2W8BB 4KC5A 4RWEA 4MQFB 4MVJP 2HUPA 3X1DA 4ZVOA 4DEXA 4NZNA 2H92A 4ZZIA 2OPRB 3UK7A 5IAJA 2KYZA 2CPHA 3OOSA 3IEIA 1TJ3A 4ZRNA 4OJ3A 1C9JA 4R5HA 3CRMA 2CADA 4EKEA 3HYLA 1RIFA 5JJKA 3MMBB 2PBFA 4F3YA 2FE4A 4PIVA 3RVJA 4NE7A 5HROA 2TSYB 1WF1A 4DCJB 5K0LA 3IE1A 1P6QA 4C0BA 4PUOA 1Q8LA 2OSQA 2O8DB 2CE2X 2NACA 2VDOB 5LQDA 1QPGA 5FXMA 2P8SA 2PUJA 2ACWA 3PEWA 3NM6B 1BWVA 2J6TA 4ZMSA 3KALA 2B51A 1YQ9A 1NYLA 4YS2A 2AR0A 3GL9A 4RV5A 1L4UA 2O8CA 3ZX4A 3L04A 2GEDA 3CB2A 4QUKA 5DYGA 2OOSA 5E1BA 2GEUA 3ZDRA 2G9ZA 2PN6A 5K0NA 3VSDA 4S12A 1R6DA 1YJXA 1SVLA 1HDOA 2AKWB 1S8FA 1EFTA 5AFSA 4YRBA 4RVHA 4H4KA 1J1ZA 4YONB 2QW8A 4KAAA 4PGFA 4TSKA 3O2QB 3AU8A 3JQGA 2A9JA 2CHVA 4UBKA 2PRKA 3UM9A 1XELA 5ENZA 4CLDA 4WK3A 4QGHA 4QASA 1S77D 4MRMA 3MVEA 4DNFA 4EJSC 4O0NA 1BE4A 3QELA 4CCYB 3COSA 1D2NA 5HPYB 2V6AA 1I6JA 4KRFA 3VH4A 3VMMA 4OYOA 3CO5A 4P4NA 4KNYA 1P5JA 1AD2A 3WRYA 2FTKE 3VR2A 3JVIA 2PK3A 1ZYUA 1NT4A 4QM7A 4UE2A 2W6IA 2MU1A 3B70A 4F2RA 3SEQA 2JRCA 3DDKA 1G3IA 1R74A 2VNJA 3SEOA 3RVPA 4WQMA 1UBCA 1MDBA 4CLSA 2DNNA 3GLSA 1WIWA 1X13A 1V7PC 3G3EA 2GO9A 2QTAA 4HT7A 5I7SA 4MW4A 1TYAE 3SQOP 4A8KA 4OIMA 3EXG2 3IVRA 2PNJA 1D0EA 4R2LA 2HAEA 2FLOA 1GPWB 3FB1A 3ZIUA 3W9SA 1DKMA 3EUEA 1U6JA 1PAEX 1TMJA 4WJZA 2ZYSA 5GWXA 1UXGA 1OFTA 1NZJA 3QK7A 5TPWA 3IPYA 3TANA 4MP8A 3BA6A 4IUBS 1NJZA 4LOHA 3TLBA 5JNSA 3CZAA 2G0IA 4A8SA 2O2CA 3OJLA 3UWKA 2JLYA 1GNSA 3C3YA 3HSJA 2MHEA 5C31A 2QVCA 4IR1A 1NZ8A 4U9UA 4F5ZA 4EIWA 5DM6Q 3QPUA 4D0RA 3Q8VA 1WB4A 5LFAA 4NBKA 4HFJA 3COWA 4BQEA 3OEHD 2DZDA 2M6KA 2I5PO 5CW1A 5BYJA 4U7CA 2XYHB 1OROA 3K71B 5EJ7A 5KC8A 1VGQA 4J9UE 4LAFA 2HSEA 4CWAA 1CY1A 3HB1A 4HNAB 1YFZA 4ED1A 2QW1A 1PT7A 3OURA 4G09A 3K5LA 4DFJA 5ERGB 1Q0QA 1PL6A 4G89A 4LF2A 5F35A 5ICFA 4F38A 4JGIA 4KBGA 1T6ZA 4GUDA 1QK5A 4U3JB 4XIGS 3KRTA 4JJZA 2ZRQA 3CLRD 3NTLA 1D9FA 4ARIA 1Z15A 5CR9A 1OBOA 2YJ5A 1ZOOA 1KLMA 4WERA 2UYHA 2ZBCA 5ALHA 1AGPA 2PDAA 1XSEA 2ZH7A 3QWPA 1Z4PX 3H1AA 1WY7A 2IXTA 1MO2A 1C1BB 1PS8A 3FNBA 5DCUA 1FRVA 1X19A 4AB1A 2GN8A 4PN7A 1YCFA 2YHUA 4F12A 5CPFA 4UMFA 5BNZA 3CLTD 2EZTA 2WMOB 4KXWA 3HPRA 5MHTA 1BQNB 5KJ1A 3RQSA 1KEWA 5KMGB 4RYDA 2VJBA 3QGPA 3CUSA 3IR6B 4J49A 1G4UR 3V2GA 3IAS1 4IFIA 4K5RA 1OBFO 2FEAA 5EG5A 1LD3A 4A8TA 2PMBA 5IZCC 1ZUD1 1RI1A 4B85A 3DRYA 2I3GA 3LUKA 3FGVA 2BH2A 4JV5F 1E3EA 3RUIA 5KWEA 1UBKS 4ABYA 2KJWA 1V1JA 5LL6d 4FZJA 4JC4A 4Q7AA 3H1TA 5DQIA 2GVZB 2ZR8A 3C7AA 4K81B 2DNPA 2BSAA 4ER5A 4RGVA 1J8FA 4LY3A 3TFQA 1GZ4A 3I09A 4DLKA 3BFJA 4Q5IA 5LJIA 5FLXA 3W66A 4ZTUB 5AM4A 1W5TA 3LP8A 1E3JA 1W85A 1MW9X 4MW6A 3OIDA 4EAAA 1AUQA 1B6RA 5IP5A 2X51A 4O3MA 4Y1GA 4RHTA 3AF3A 1Z5GA 4YT2A 3PR2B 1V25A 4I1YA 1FNNA 4MUAA 5L39A 3FRHA 3LCCA 5AJYA 3CRVA 1DELA 1C3VA 2WJVA 3N3AC 1WE2A 3EIHA 4WFJA 4C7KA 5EKSA 2XQVA 2UVRA 3AT1B 4FOTA 1NN5A 3FYHA 3N6VA 3TZWA 4ENUA 2FFRA 1EA7A 3CKKA 2QF7A 4ZCMA 5IZ4A 1FP1D 5FL7D 1Q17A 1XDZA 1GPMA 1M2VA 1U31A 4JLWA 2ODTX 2YNHB 1TQ8A 4A92A 3NEKA 1SJFA 1YR2A 3T3IA 3VR3A 5EINA 1EQUA 1CS0B 3CUTA 5LZ9A 2XMVA 3DLTA 3F6PA 3OLCX 4XX0B 1LWFB 1ODCA 1Z6AA 4CMIB 1NYTA 4CLXA 1XOIA 3VDQA 5HVGA 2FUKA 4NLPA 5L1LA 2CXSA 4KREA 3AEXA 3PWKA 1EQMA 4B3DA 3FCUB 4FZ5A 5U47A 2X9QA 1RA6A 3L8YA 1PHPA 3B4DA 1SHTX 2REOA 3EPKA 3KOWA 2IM3A 4JL8A 1I0LA 5IF9A 1ZZFA 4QXQA 3R5DA 4X6YA 2FWMX 4HWSA 3HVTB 5EY5B 1JLHA 3IV9A 4OXQA 2JJYA 3DEJA 1ISGA 2QY9A 3C14C 4FYVA 2GGSA 5GP1A 1BKDR 2QT0A 2ZIEA 5KO2A 1NQTA 2UU9J 1CJMA 1OCEA 1QJHA 1RTDB 4HY3A 2DKOA 2CJWA 3T1OA 4CLUA 2W9CA 3QKIA 4ZGBA 2Z0GA 2C2NA 4KWEA 2CLIB 3D9QX 3L2OB 3Q83A 2YZNA 2C7RA 1O87A 1IWOA 3IM9A 2XCLA 4YRFA 4BLQA 2KH9A 2BRUA 1Z6YA 5K8PA 4W5HA 2O7RA 1KO7A 1G5TA 4R71A 5GONF 1BXGA 1FDRA 3HCBA 1ZN9A 2IX3A 2GZOA 1BOFA 4ED6A 3L7KA 2H2FA 2ZM5A 2MTBA 2HMIA 1LUAA 2DTEA 2DNRA 3PEEA 3ZH9B 3KKMA 4FE7A 2UYOA 5DMXA 4Y7DA 2WNIA 4AJJA 1S7GA 4GOND 3O21A 1NJIT 5JAQA 2KB0A 4M95A 2NSHA 4AECA 2B78A 2E7WA 1DWUA 3OC6A 3BF4A 2Y1LA 4GRDA 3QYFA 4I6YA 1L7MA 5CA0F 1I01A 4AIIA 1REVB 1N5VA 4KW7A 3HY6A 4EHBA 3HUDA 3W06A 1U8XX 4TWAA 1EVYA 3LO3A 3K32A 1VCMA 1X1DA 1VJTA 1X7XA 5C81A 2DPLA 1DC4A 2ZJYA 3ESBA 2XNJA 4BBZA 5DOZA 2JJ2D 3G2LA 4XIYA 4QUAA 3W79A 3OQ1A 4WN9A 1Q7CA 5HO4A 4LR8A 4WF9Q 3S68A 5B2ZA 3GR1A 1CSJA 2Q4TA 1GT8A 4GPIB 2C31A 3HVUA 1KSFX 3GRAA 3LCUA 4V1CA 4MITA 4MX8A 1KP6A 2JANA 4CLTA 1SMKA 4ZT6A 2Q3JA 5B0FA 2ZATA 2RH8A 1SH3A 3V9PA 4CMCA 1MGOA 1GGMA 2X3GA 5A4AA 4X1OA 4Q24A 1Z22A 3D6FB 1XZAA 1ZWKA 5CXQA 3PFIA 1Q81T 1R31A 3WYDA 5A05A 3ZW8A 3C3WA 4R5PA 1N36J 3U7QB 4J0HA 5IS2A 3W8FA 3QY0A 3CR8A 4XYEA 2R8GA 1A9NB 2A0YA 5EMNA 2Q4DA 4OBEA 3PJRA 1VL6A 5JVGQ 1Y9AA 2I4RA 3FCXA 4NYJQ 2ZROA 2RRAA 1PTJC 3MEDB 3AEQB 1F2TB 1IVNA 4ED0A 2UUPA 3GOHA 5KFWA 4NFHA 3PRVA 3UJ8A 4K9QA 3T7DA 5T3UA 1KVKA 3CE6A 4C4RA 1Z35A 2BBEA 4DQRA 4GVPA 5LMUB 1N34B 5KNCD 1IE3A 2YXBA 1GAQA 1IBLF 3QPBA 3DAPA 3PZRA 3HZEA 3EEOA 1A69A 4KKXB 3STTA 3RTDA 3DLAA 4C97A 2B82A 4NOKA 4UNRA 1SUEA 3R6GB 2HU2A 4G8CA 2D3UA 3SQDA 3JD3A 3R6TA 4AUNA 4G4SO 2VG6B 1VZ2A 4C6HA 2GIQA 3B53X 1I4LD 3PPWA 3L40A 4FNOA 1N5RA 4KLNA 4NJEB 3JATB 1O54A 3T19A 1XT6A 2P9YA 2WYIA 3AINA 1G6BA 4BO8A 5K8TA 3JQAD 3L0PA 1DRZA 5B58C 3FOAA 3M49A 3SFVA 3TLKA 3I9MA 4KQ9A 1H2BA 2SKEA 5HJ5A 2Z1NA 3R5JA 2IV3A 2PUWA 4BP1A 1OHHD 4K4YA 2DNQA 3MM7B 1QWOA 3SR3A 2Q07A 4HS4A 1NSKL 2QO3A 3CCMS 1OIAA 2UV8A 1C9NA 2VDJA 3RADC 5DXJA 4HG2A 3RF7A 4HAYA 3ND6A 3O8QB 4B9UA 4M8LA 1GXSB 2BOAA 3DS8A 4MUHA 2J9FB 4KE9A 2J0UB 3HNPA 5LA6A 3D1OA 5EVCA 1D8AA 2JVRA 1UH5A 3IQFA 4IO1A 5ETQA 2DR9A 2GZDA 4HLNA 4UHHA 4EM6A 4P0PB 3DBHA 3G0GA 1XAJA 4CDNA 2D06A 3T52A 3GLFE 4KR6A 1RW4A 2YYYA 4TLCA 3UNGC 2A8YA 1VMAA 2GPWA 1KYXA 3BIJA 2VPYB 2DWUA 4DQ0A 5DJBA 3Q3CA 4KXLA 5HK4A 2XO6A 1X60A 1Y00A 2LA4A 3IAM9 2OCPA 4AP9A 1SKMA 3I2FA 4UEJA 1UMCA 1K86A 1J07A 3OMWA 1HR0F 4DLEA 1D4OA 1TOAA 4H16A 2QYSA 3GIJA 4HGYA 1VBMA 4B6OA 3QFTA 3DPIA 2V5AA 1T8TA 1EDEA 5IEJA 1B2RA 3N74A 3AYZB 3RIXA 2F90A 3D6TB 5AJZA 5IFLA 3KKOA 2VQFJ 4HDKB 2PSHA 4ZZ3A 3EIXA 4OHCA 2NYVA 3PXEA 3CHYA 4JJKA 3PX0A 5IVPA 1R10A 4BLTA 5TMBA 1X7DA 1FNBA 2XVYA 4JYPA 1VQMS 5AIAA 1MAUA 1I4TD 4AMZA 3HLTA 4B46A 1LWXA 4PAOA 2F63A 3HFGA 1P72A 1PYOA 3AMVA 3KIPA 4BNZA 3I30X 5H81A 3E5MA 4IP0A 1IG3A 1AA6A 3F44A 3QEBZ 1DLJA 2HQBA 4WYLA 5DNVA 2D0DA 2GAOA 5D0GA 1X8XA 3ZTWA 3UCFA 4P71A 2VQSA 4O4LF 2XQIA 5D84A 2YQ4A 3COVA 3SHQA 2AG8A 2I4TA 4X7RA 3AETB 5IDXA 4IRCA 5LYJF 1T1SA 4IKOA 3MM5B 3KE8A 1QH1B 1VSUA 4WKRA 3CPHA 4RHYA 6AT1B 2ZOFA 3GB9A 1GFIA 3I39X 3H5OA 1FW6A 3L7BA 3L8EA 5EKDA 4GDFA 2DQZA 5DSXA 4IJQA 3TAQA 1HPZA 1Z7EA 3PYGA 3WICA 4DMFA 1P0MA 2VEOA 3BGRB 3HP7A 4UVDA 3WLPA 3DU5A 3MN1A 3JQCA 3N5KA 3N7AA 4RVCA 5I4KA 2YBVA 1JJVA 1MX3A 1NLFA 2D7JA 1T94A 3GCZA 1ECFA 2OLEA 4MT1A 2BH9A 1QB8A 5KYVA 2ZQYA 1CRWG 3WKAA 4BRZA 1AB6A 1BHO1 3A8EA 3LDHA 1Z2PX 2CPXA 4WCFC 3KBOA 2WSFC 3FKSD 3R6DA 1XNQB 4PINA 1T0BA 1BA2A 3FUYA 3PLAE 1ZD8A 3IEPA 4MCJA 3INTA 3NJRA 4HACB 3CG0A 4Q48A 1U2QA 1LW0B 4AQDA 4LRFA 1YS4A 5HBGA 1XMIA 2JAUA 3BKUA 4GS5A 4U7WA 4JI2J 3Q87B 1ZK1A 3KVVA 2IRUA 5FADA 2GAJA 2D3O1 3ISZA 4JBLA 1N5OX 4L7VA 2IDZA 5AM2A 3NHUA 4F56A 5CFZA 1XPRA 2KDOA 3DW3X 4IUCS 1Y9DA 2YYZA 4TWBA 1A9RA 4RD4A 2I9SA 3SKYA 2E18A 4N9WA 2AJ1A 5E2AA 2ATVA 2EFGA 1P5HA 1Y1SA 4HEQA 2ZBDA 3ZG6A 2PZKA 3S29A 2D7CA 3KAJA 2GBFA 1EB0A 1HEIA 1TCCA 3R2DJ 3T3HA 4QE3A 1XMQJ 4CM2A 3EMBA 2AQIA 2RILA 4LW8A 5AICA 5B7GA 2BVZA 1O95A 3IVXA 2EX4A 3AESA 4RJKA 1FNMA 2MGZA 2VP0A 1CB7A 5AHRA 3UJ6A 5ICGA 3MHTA 2X1FA 4MQMA 3N2GB 4P7KA 4B80A 1ABFA 3M33A 4ECWA 1C7FA 3W4KA 1WX1A 3BHNA 3FBTA 4UUPA 4F0MA 1I5OA 2AG5A 3ZVMA 5FTNA 1FHTA 4QYSA 1L5RA 1YVEI 1XP8A 2Z1DA 5EC8A 1N54B 2F1IA 3DP9A 4CUZA 1RC8A 1LV5A 3OEED 2YBDA 3DF9A 4I2PA 3DW1X 5TXGA 3L1HA 5KFOA 4AF8A 2MTLA 1UJCA 5ENVA 3HB5X 3ENZA 2C9OA 1SXLA 1HMPA 3KK0A 1FEZA 1NE2A 3C43A 1QV7A 4R1NA 1D1TA 4NKRA 3C1OA 2Z4PA 1MORA 4V02A 2OCIA 3WGOA 1WO8A 1ZVJA 5EWJA 4PAGA 2EK6A 3BE6A 5AXCA 3LAKA 5JTTA 1JQLB 2RHWA 1R6YA 4CIOA 3KSRA 1N88A 3EZXA 4LBWA 3I82A 3OY7A 5KAKA 3CO9A 3H3JA 3OU2A 1JTEA 1JV2B 4DA8A 5JSZB 3OVAA 3BKWA 1JA1A 2Q9BA 4WSOA 1SC9A 5BXIA 4PWWA 5DPMA 2AXQA 3U81A 4EATA 5A8RA 2HDOA 3WHLA 4KXYA 1WPGA 1QF9A 3I3OA 1JIXA 3C16C 3GU3A 1S8NA 2BGTA 4BE4A 1II0A 2YWXA 4GM4A 3IHWA 5TJHA 4EITA 3HCNA 1SL0A 4TRNA 2JGNA 1VBYA 2XE4A 7AT1B 3OCCA 3RSFA 1Y3HA 5C0OE 4W6QA 3EFEA 4BNNA 4E22A 5KFJA 1IB6A 1REQB 3B20A 5L4NA 4NATA 4TV8F 2VP5A 1II8B 2FFBA 2VHUA 2ZBEA 3P4YA 5EMKA 4DSAA 5J4HA 3OUYB 3QU2A 2FWIA 4IIFA 4Q1FA 5JQGF 1US8A 3ECAA 3UYKA 1VE3A 2BI7A 3W1VA 1VTKA 2WAQD 1YQDA 4Z3DA 4PAMA 1CUYA 5MDHA 2HHXA 4FLEA 3FBBA 2WU8A 3JR7A 2PFSA 3ZQUA 1XAIA 4KV7A 1MOSA 4EHFA 4EDFA 4IFYB 2JI6A 1SC3A 1ZSNA 4IRUB 3KHLA 1WETA 2GEFA 2IITA 3BQ2A 2B3TA 1IKXB 4Q3KA 1OC4A 4M83A 3N6MA 3I0MA 3E8OA 1VJ0A 2VQEB 2RGRA 2Y0CA 4WK4B 1E58A 5E5NA 2WJGA 5JY1A 2FWJA 4A8JB 4LXHA 2XB2A 4RL6A 4WPGA 1KORA 1NY5A 5KJ6A 4JXZA 4W5OA 1NJ8A 3L8GA 1CYEA 1A7JA 4EY6A 3AZQA 2BQRA 1JDJA 1WPXA 4IHJF 2JHEA 1GAEO 4R3UC 4UU1A 1WC4A 3V8NA 2BJWA 3EVOA 4RJ2A 3DTVD 2PS1A 4IFTA 1AA1B 5KT4A 4BHTA 1SC1A 4LF8B 3JPYA 2CJAA 1IY2A 1SC4B 1WV1A 4HWGA 1Z47A 1RP7A 1ARZA 3HYCA 3CCUS 1TKAA 2R6HA 1ZWLA 5LDHA 1NJGA 3ZYCA 3T7TA 3NHFA 3M6FA 3L7AA 5EHHA 2XDWA 4MRSA 4Q19A 4G84A 2V2QA 1PNTA 2HLDA 4MA4A 3HCCA 4J4TA 1GMVA 1AXGA 3ONEA 1B43A 4BNWA 4NLSA 3R5SA 3MSXA 2XZWA 3T3FA 2AF6A 3PUWA 2IYXA 2V65A 4K46A 2EKNA 3B78A 3VX3A 4KH0A 4XDDA 4A16A 5JC1A 1U8UA 3DOIA 5BRNA 3HCFA 1POXA 2H5IA 4Q16A 4UE3S 1I2CA 3A3NA 2ZTMA 2IWHA 4WFQA 4KN8A 5FPTA 1T4CA 5IBPA 1VRTA 1ZU4A 1UW4A 4RMHA 1V6CA 3DCYA 3BXEA 6YASA 1DAXA 4DV1J 1TK2A 1HD0A 3DLIA 2JJ1A 4DLNA 4WAUA 4NMWA 4I8XA 3KB2A 5K6TA 1PBTA 1RI4A 1P4HA 2OBNA 1QAOA 6CHYA 4Y9SA 2ZS8A 4GOMD 1S49A 1VMKA 4ZVMA 3OBBA 4QEDA 1RAGA 1M67A 4PYLA 2RHQB 1MO6A 3TSAA 4KDCA 3MJHA 4QVIA 4D4MA 1ANKA 2HPUA 2PD6A 4O23A 1T2EA 4OGLA 5LBTA 5E6SA 5I3UA 1M74A 5KTOA 3UWSA 3LQYA 3PE4A 1ONOA 5M34A 1TKTA 3B6ZA 1KWKA 4H0NA 1PV4A 3RVMA 2ZSBA 3OHAA 4OYYA 4Q02A 2QNBA 2JATA 3IBTA 3C3LA 2MDTA 3DDWA 3MLBA 3THYB 4B81A 1JNRB 2XUGA 3IP3A 3LHFA 4CEJA 1UVIA 2KPOA 2C3MA 2QDXA 2HRBA 2EFOA 2FZWA 4YRKA 1Z2EA 3EBLA 3BPDA 1FYFA 1XD2A 4ZARA 2HA4A 4X95A 1LFDB 5IC4B 2C58A 2IL1A 2Q0HA 1GLVA 2HJWA 4MKXA 4OO3A 4NG5A 4AS2A 4YHHJ 1A7UA 2REXB 2GV1A 5HBMB 1RE1A 3HY3A 4MYRA 3TIVA 3HSGA 5HSPA 1MU2A 3R9KA 4G6VB 4C0HA 4KPFC 4EY8A 4S0MA 4OLHA 1G8PA 3CVXA 2A0UA 2C5SA 2QZZA 4R0VA 4ND4A 2O2IA 2FE1A 3IT0A 4XW2A 2EFPA 1AURA 4I3FA 5LZ8A 4ZAVA 4JP5A 4UREA 4N5HX 3CUKA 1I4EB 3MJSA 2XUZA 1FLNA 2D2XA 4EAQA 4XIIA 2Z4RA 4P53A 2EJBA 2OA0A 4OXKA 3HO1A 1WI8A 2WYVA 3F74A 3RJTA 1R7RA 5I9IA 5K3FB 2M6SA 2VXBA 2FN4A 1ZK0A 4HAOA 5KFRA 3QVJA 2FRDC