4NMLA

2.60 angstrom resolution crystal structure of putative ribose 5-phosphate isomerase from toxoplasma gondii me49 in complex with dl-malic acid
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
257
structure length
249
Chain Sequence
MNPQDKAKQAVGYFAVDTYVRSGMKVGLGTGTTAKFVVERIGQRMQEGSLKDLLCVPTSEATRKQAESLGIPLTTLDGIADLDVAIDGADEILPPTLGLVKGRGGALLREKMIAAAAKTFIVAADETKLVSNGIGSTGALPVEVVVFSGSHTKRLLSALPSVKRHGGRAEFRKRAGAAQEDIREEDRFVTDNGNYIVDLYFTETVPDLHEMDKELKSIPGVVETGFFLDLASVCLIGKADGSVATLTAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 2.60 Angstrom resolution crystal structure of putative ribose 5-phosphate isomerase from Toxoplasma gondii ME49 in complex with DL-Malic acid
rcsb
source organism Toxoplasma gondii
molecule tags Isomerase
molecule keywords Ribulose 5-phosphate isomerase
total genus 80
structure length 249
sequence length 257
ec nomenclature ec 5.3.1.6: Ribose-5-phosphate isomerase.
pdb deposition date 2013-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06026 Rib_5-P_isom_A Ribose 5-phosphate isomerase A (phosphoriboisomerase A)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4nmlA02
3.40.50.1360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4nmlA01
2PC6A 4TM8A 3EFBA 3TUZC 4L4YA 3LWDA 1CD5A 3O1LA 3MWBA 3TUJC 3TUIC 3LOUA 2QMWA 2RQMA 3W7BA 2KO1A 2J0XA 1ZPVA 3DDNA 3TX2A 4LUBA 3BXFA 3OBIA 3ENQA 1XTZA 3NWPA 2P9GA 5FIIA 1FRZA 2QSWA 3E15A 3S1TA 3OC6A 2R5FA 2W48A 4L51A 1SC6A 4NMLA 2P9EA 2JOQA 2RQKA 1JT9A 4TM7A 1LKZA 3P96A 3IBWA 3KWMA 4X84A 3DHWC 3BXGA 3LHIA 4L4ZA 4R9NA 2ZHOA 5IS2A 3OFGA 2O0MA 3HHEA 5T41A 3BXEA 3AB2B 2NYIA 2CDQA 3K5PA 1YGYA 2QMXA 1Y7PA 3ENWA 3KV1A 5HJ5A 3ICOA 1HORA 1KS2A 3MAHA 4L5JA 2QRRA 1VL1A 2LQJA 3EB9A 1FS5A 3IXQA 2LVWA 3L7OA 3NRBA 4GO7X 1RWUA 1U8SA 4GO5X 4L50A 2FGCA 4R7TA 3E7FA 2RI1A 5IT0A 4L5IA 3UW1A 1O8BA 3OFHA 2RI0A 4M8LA 4OQPA 2WU1A 2PA3A 2RE1A 1PSDA 3CSSA 2I9SA 3MTJA 2JHEA 1NE7A 2BKVA 2GNPA 1FS6A 3LUYA 3OFEA 2BKXA 4GMKA 4OQQA 3HN6A 3ENVA 1LK7A 1UJ5A 3CEDA 3N0VA 1LK5A 1FQOA 2OKGA 4IO1A 2J0WA 3U7JA 3BXHA 3NZEA 3DHXA 3OFFA 5JJBA 2J0EA 2DT9A 4PWUA 1YBAA 3AAWB 1DEAA 4GO1A 1HOTA 3CH7A 1PBTA 3AB4B 2F8MA 5IT4A 1FSFA 1Y89A 2F1FA 1M0SA 1UJ4A 3DC2A 1UJ6A 2H9ZA 2MDAA 2P9CA 2DTJA
chains in the Genus database with same CATH superfamily
1OZ0A 4OI4A 5AXAA 1K27A 1KEZA 4UVEA 2WSFC 3VPSA 4Q03A 2HU7A 4X4OA 4JUDX 1M0WA 2LV8A 3F49S 1HBNB 2EKNA 5JCZA 1MU2B 5DP1A 2HREA 1T4CB 1ZPDA 1T0UA 2QSWA 3GYBA 3IKLA 3NDPA 5BPHA 1LLDA 5CP8A 1IN1A 1QAOA 4KNYA 4I4IA 4M3NA 4KWTA 4LRUA 3OTHA 1U1KA 2WCXA 1RADB 1U1IA 3DI6A 2CHFA 2KKHA 2R86A 1LDNA 5C1IA 1CJUC 1LTKA 2HMTA 4E51A 3FZYA 3IUSA 5BW4A 3RIGA 1U49A 2GUGA 3PCOB 1TJ3A 2AI3A 3I04M 4IDQA 4D7AA 3UNXA 1FP1D 3B1ZA 2UZ1B 1OW3B 4RNNA 3K0CC 3RKSA 4NYPA 4OU5A 4ZPDA 3VH4A 1U3WA 4J1QA 3PW5A 3RSSA 3DT6A 1HLWA 1F0YA 2O2JA 2WWIA 5AK4A 1NJXA 4Q9HA 1HWLA 1UFWA 1IM6A 4MTPA 4CRJA 1GGFA 2ACYA 1RAGB 1X4GA 1WUTA 3L5KA 5T64A 4X65B 4PCQA 1I2MA 1JIXA 2XQKA 2B0JA 2VBZA 1L7EA 2C4TA 4YP7A 2J7UA 2EIXA 2BUBA 2VF8A 4HT3B 2ATLA 3ENQA 1KBRA 2V4JB 3KOAA 2XBUA 2XCAA 1Q74A 4CMBA 1GTHA 2VA2A 4X64F 4UCQA 1DKQA 2Q1LA 1U2EA 4MQFB 3I5XA 5DJ5A 2BEVA 4HN2A 3RW9A 1V3ZA 4ES6A 4JV5F 2NU8A 2VSYA 4CYMA 1M7GA 4PLPA 3MJCA 2P3LA 2ZRBA 4YREA 3TNJA 2A10A 1OQ6A 5DASA 3SCZA 3BTUA 1YI8A 2XA1A 4FGJA 1FD2A 2OPQA 2RHTA 3BBCA 3PNVA 2V59A 1HQEB 5AXCA 2AC7A 2ZIEA 4BB9A 1SJQA 2G36A 4KCGA 3RV3A 3A9VA 2VDNB 2M8DB 1SAYA 4CM8A 4PLHA 3ABOB 1KDNA 4R2IA 4HMQA 4Y3UA 4N49A 1SUBA 2DULA 3E9ZA 5FWNA 4DSTA 4FWIB 2JI9A 4LGCA 5B2ZA 4N47A 5ERYA 2A84A 4I0WB 3L1KA 1GQSA 2F3SA 5L40A 2QSUA 1VHDA 521PA 5ALDA 4IQ8A 1UM8A 1UEUA 2C2GA 1M74A 4IDAA 3U61B 4N8NA 3EGDA 1KBQA 4EW2A 3JYHA 1OF1A 3UQYS 4HZUA 2QW8A 3F1LA 4Q9KA 5JAQA 3KR1A 1KZ1A 5IZCA 3DEFA 3IUMA 4ZJOA 1Z2DA 2DEIA 4H0CA 4UEWA 2XLJA 2BFPA 2PGJA 1IRIA 1NLKL 5K8LA 1FPMA 3QUAA 1C30B 4L5JA 2ZYHA 3L6BA 1JN0A 4A2PA 1X7ZA 1E2LA 1UM9A 1ADJA 2QTAA 4NNJA 1Y8QB 4M8KA 5F5LA 2WF6A 1AHNA 2LIPA 2E0IA 4Z1OA 3FOFC 4ICLA 3V1YA 5KFDA 1P17A 3W7AA 2HW3A 4MICA 1DADA 2ET6A 5B1DA 4IVNA 4AN0A 3WNCA 1M34E 1TZMA 2HVZA 1UPFA 4PAAA 1N1DA 4DG1A 1R0WA 2FX3A 4IOAQ 3V8VA 4PZDA 5D0HA 4EX7A 2SNIE 3D8TA 3L7UA 3GA7A 2MMYA 2K06A 3OLXA 2P27A 4DEZA 2DQYA 5BV1A 4P52A 5IYZF 1NUQA 4RDIA 1QCZA 4EI7A 2V8GA 4ZTUB 1DEKA 1R0RE 3VV3A 1B7GO 4E6EA 1NAQA 3I53A 4TYAA 5BYJA 3S44A 1G63A 1UKZA 2PVCA 2W37A 3REQB 1GXSB 4GKJB 3HU2A 3OE1A 2ZYSA 3WMGA 1RM0A 4CF7A 3MLBA 3ONEA 1E4EA 3CDEA 2YOFA 1GKLA 4YEDA 2XB6A 1UJ2A 3NIDB 3K0FB 5BV7A 5CA0A 3DOJA 1XEFA 3HXMA 2BM9A 2JGKA 4JDPA 1C8BA 3I4CA 1LQUA 3ESQA 4PZAA 4DA9A 3WRWA 5CD1A 1V3QE 1L5RA 2DHAA 5BSVA 1PTJC 3EXHA 1ZETA 4JEUA 4F06A 2I9SA 5KT3A 3I09A 3E53A 3RHFA 3EPPA 5M3BA 5K5EA 5F51A 3Q8UA 1U99A 3PSHA 2MYUA 2WM2A 5FV4A 4HATA 1QVRA 1P9WA 3OJCA 1PNOA 5BMVA 2FN7A 4GR9A 1QYIA 2PD1A 2D2EA 3OZSA 4E3ZA 1LJ8A 4I55F 1JQGA 2FP3A 4JLNA 3JVEA 1QY7A 3PA6A 3AJ8A 3TRGA 2VHWA 3PHGA 2A0UA 1F7VA 2DC1A 1C80A 1XPJA 3CNLA 4KI7A 1S1VA 4TV9B 4YT8A 4IVQA 5CA1A 1JJ2R 3LGMA 4PGMA 3FMGA 1P72A 2MSCB 3J7Z5 3VU9A 5K5MA 4Z9FA 1TA4A 4P7TA 4FYXB 3TFOA 3HV2A 1PI3A 4MWEA 5JD3A 1IEQA 4MRRA 4R2HA 4DCMA 2HPUA 5F7XA 3BWMA 5E6SB 1VK3A 3KLEA 4WOCA 4Q2LA 3ZJ5A 1VI2A 4HG2A 3HADA 2QG6A 3QUQA 2QLNA 1NMQA 4AMYA 4EL5A 5HSGA 2IIQA 3LUCA 1S97A 4BS2A 2G5GX 3I2YX 3NM6B 4A9AA 4JI8F 3EWSA 4ZI7B 1FMLA 1EFUA 4LGMA 5C8YA 3V81B 5ISMA 1L4LA 1FRLA 3AOEA 4AZ3B 1ZW6A 1Z25A 2MTLA 1L1RA 4G67A 1YKGA 5IM4F 3CSKA 4NEQA 3EUWA 3GJRB 5IT9Y 3M32A 1OBVA 3ZTOA 4CTOA 2OB1A 3SIPB 2MKYA 3TJZA 4F2PA 3KQUA 3QZUA 3EGXA 3QPBA 4N3NA 3AXKA 3H9CA 3SDEA 1CXZA 5JAUA 4AM8A 2BKPA 4MKBA 4PLCA 1BCSA 3NR2A 3H5TA 2H54B 3OM8A 6GPBA 2QL7B 3S70A 3R7BB 3F3SA 2MJLA 2EEYA 2R1TB 3LRXA 5B08A 1UC8A 2GTPA 3MM4A 4XLZA 3L41A 4TKZA 1CQPA 4F6RB 5DISB 1XZJA 3LT1A 1IBMB 1Y5LB 3HZHA 2PUHA 5A6SA 1ISJA 4DQKA 4KDEA 5DV9A 3D7RA 3FSJX 5IJ0B 3H4VA 2JFQA 2O8BA 4I2NA 3UY4A 2HKEA 1KFEB 3G2IA 1QYCA 2RHLA 1IBMJ 2BSAA 1I6JA 1SBZA 1I3OA 4B79A 4DFKA 1KJIA 1HDGO 1S5ZA 3GLIB 4JZKA 4ZV7A 4X62F 1QLHA 5C7OO 2MGZB 1AK9A 4Q5VA 2ROGA 3H99A 4I2QA 4UY8T 2ODNA 2WVAA 3ENAA 4G01B 3PGJA 1YXMA 3EUAA 1S59A 2H7VA 4EO4A 3O4HA 3PNPA 4K28A 1NU4A 3S2FA 3F9CA 3IOMA 5FKJA 3K5LA 1XZCA 2X7XA 4OXIA 1JT9A 1CC7A 1R89A 1RKJA 1TL1B 2AD5A 2JW5A 1LV7A 4G1QA 2Z56B 3CF2A 2PI4A 5B0CA 1RXEA 1SIWA 1T0IA 5DM6Q 5SYAA 4PPGA 5A2QU 4NLPA 2V8HA 3L6CA 5K0GA 1UXIA 4B9UA 2DQ4A 1KHTA 2BKXA 3PL1A 1K0TA 5T14A 2R25B 3KLPX 4BL5A 1BTOA 5CB4A 4IOBA 2W2KB 1EDZA 1P9NA 2FPMA 1Y9AA 3MG9A 2ZWOA 4PSCA 2KT5A 1ESMA 4WJZA 3THTA 2XMCA 4ND2A 3VM6A 3PF9A 2NU9A 2WIGA 2Q1SA 2QMUB 1ZRSA 3W5VA 5I7HA 1GGMA 2F7VA 2GZ3A 4A8HA 1IQ0A 2P2YA 2QQ5A 3GAZA 1EQAA 1QO9A 3H2YA 1T2UA 1W19A 4RTRA 3K7RA 3EDMA 3OQ1A 5LB2A 4KB5A 2JF0A 1HX7A 1P3Y1 4AULA 1P8AA 3GP9A 4GNKA 3TAMB 3I1YA 2Z4SA 4LF2A 3W06A 4CFSA 5DTEA 4IHAA 5JADA 2CC2A 2J6CA 1CUFA 2EJWA 2G0NA 2VWHA 4X1IA 1LFDB 4DWIA 4ND3A 1EE1A 2RIRA 1ZJYA 3VGSA 1MR3F 1KSPA 1WKJA 2DGDA 3E18A 3G8CA 4B3XA 3ICWA 2GPTA 1MB9A 3V4PB 1JRLA 4UCWA 4WZAA 5CFOA 3RHTA 2QOEA 4JBHA 4CIOA 3W1YC 2VNKA 2B9EA 2XLCA 1PZHA 3IWXA 1KORA 1SK9A 3DAFA 3E81A 1TZBA 4RW4A 3A6PC 2BHNA 2ZH5A 1R31A 4W4TA 4EY7A 3PUKA 4U0KA 1T0JB 4U5XA 3LP1A 1DBDA 4B02A 2IY5B 3I4LA 1NDKA 3TW6A 4KXQA 1P39A 2OO5C 2N46A 5DBHX 1ADGA 2Q5IA 2HNBA 5FPKA 3BHJA 5EE0A 1K92A 3EC7A 4UXJA 4TN5A 3HDYA 3OP4A 5DT9A 3KZCA 4Q43A 5FI3A 3RANA 3BB3A 4KP7A 4D74A 5LZ2A 3RRZA 1HTBA 1W94A 5G2OA 3RREA 5A7GA 4WK3A 4PW0A 4ZC1A 2O3JA 3M34A 3AT1A 1SJ3P 4F0MA 2Q6VA 5IP5A 1KEEB 4GOND 1FFSA 1AX9A 1O89A 3COYA 1JU3A 4O4JF 2HTEA 2FD2A 4DA8A 5A4JA 1T9GR 4NBUA 2N1BA 1V1MB 3CEPB 1D9DA 2ON6A 3H5RA 4JUBA 5LA6A 2QU8A 3CJ3A 2Q5LA 1K68A 5HGXA 4A23A 2P6MA 2YWKA 2HLHA 2G63A 5AVRA 2QTRA 4CCSA 1JJHA 3R6LA 2QV6A 2ZRKA 1GPBA 1D7AA 4FJ1A 4CN8A 4X4NA 4O8CA 1Z39A 3ZD6A 3BS4A 5AOBA 4ECAA 1FFHA 1VJ1A 4MUYA 1WHWA 3IQFA 3PFWO 4KFSA 1L3SA 3EFOA 1YTUA 3VR6D 3HA7A 4GQAA 5E2AA 5CD4H 3B3AA 3IR6B 4PIVA 2C96A 1T35A 1SH3A 3MUMP 4USUA 1HXHA 4HH0A 3GGGA 3V8BA 3T3PB 3AOEC 4JT9A 1GV0A 2O2SA 4HXGA 4UOQA 1D9AA 4KFBA 3NGXA 3OXGA 3L09A 5F3TA 4LF4F 3SVZA 3DEYX 4DMLA 2YKNA 1FJ2A 2YKAA 2RGDA 3NETA 2YV1A 2Q66A 2CVZA 3A9WA 4HDAA 3OW2R 5ALUA 1XWIA 2PK3A 5DRTA 5G0RB 1OFUX 2AGVA 3KJEA 4YJHB 3H8YA 3D4PA 2O4UX 2AYZA 3THYA 2PUVA 2W4DA 4CWBA 5U47A 2I66A 3WX8A 3HCXA 3GNSA 4ISCA 4B3IA 1KQ3A 3A0UA 3QI7A 3E3OA 4DSEA 5BN4A 4M5KA 1S99A 1NA5A 2B0CA 4X7PA 1L4EA 1KQGA 5FBZA 1ZPWX 5KU1A 3GZ4A 4F8RA 3FFAA 4QYMA 1EAMA 3U3ZA 4OQNA 1EX9A 5G02A 1U3GA 3LY8A 5EIAA 2WVHA 4EYKA 3L3BA 1N1GA 2WVGA 4RPFA 4MHTA 3AA9A 5EJIA 2PSEA 5F1KA 3ROMA 1COZA 1BW9A 2B7CB 3L0ZA 4B3RJ 3VHLB 5BP7A 1HR0B 2L3MA 3JZIA 4C9BA 2G1DA 1HORA 4QTTB 3IUPA 1OFTA 4QECA 3WLMA 1Q11A 3JYNA 3QOYA 3QLEA 4KK3A 4BEBA 4BB6A 1DC8A 3CX4A 2QRLA 3V1KA 1X5PA 3JZAA 4PLFA 2RRBA 3I0NA 2CCKA 1Z2CA 3NFRA 1U0HB 5EUQB 3VR6H 5A1TA 3LSTA 2OMLA 4TLBA 1MROB 3B9QA 1Q0NA 5LQMA 1XVAA 2IV2X 3B5EA 3FWHA 4P2MA 5IBCA 4BKRA 4UM9D 6ABPA 1VPVA 4PX3A 1RTZA 4FHCA 1E6VB 4J7CA 3JPYA 4Y2KA 4YB8A 1RI5A 4U6PA 4PAOA 5ALQA 3GUYA 4AWBA 4DR5F 4KYUA 3X1ZA 2HA6A 3K9LA 4DF4A 4PSVA 4S35A 1ZNYA 4UTZA 3NVKI 3W4IA 4ZKAA 1BJKA 3L46A 1WSVA 1LCIA 2H1OA 4G37A 1RTJA 5CB6A 1X13A 2P0EA 1U7XA 2Y2UA 4TLEA 1ZGHA 4WPGA 5BNIA 3OJLA 4NCJA 1NQOA 3WYGA 1TTQB 2QXTA 2R68A 1MJGA 2CCGA 3F6CA 3UHFA 5BMVF 3M2UB 4O2BA 1RWPB 1C7ZA 4I1TA 3GT7A 2Q5CA 2CJAA 4D45A 4GECA 4UTXA 2GCOB 1Z3CA 3OETA 4FCTA 5BWNA 1H6DA 4EJ2A 4G8BA 1ONNA 5K3CA 4ALLA 2XTJA 4KW7A 3GPCA 4ZAVA 1MU2A 1T4CA 1ZS9A 1FSPA 4A36A 1EK2A 4ZHSA 3BHNA 1MJFA 4F5EA 1UOPA 2FN8A 4ALNA 4D0SA 3PNYA 4GX2A 4MKHA 4K4VA 4M86A 2JK0A 4YCDA 1KO8A 2P9FA 3TQTA 1U3UA 1YUMA 5FNVB 1YWGO 1Q81T 2WAMA 1H22A 1KONA 2FPXA 4K2HA 3OFSA 2K1RA 2VPQA 3KTOA 1J1UA 3LFHA 3PV8A 3DR5A 2R7VA 1GXUA 2FZKB 2VXYA 5HL7Q 2QW1A 1MXHA 3EWIA 1YE3A 1PGZA 1SCAA 4YCSA 2WJWA 1J21A 5KYWB 1UODA 5GAHU 3GBVA 5HQTA 2MR5A 4OP3A 3ZQKA 1M1ZA 1IJEA 4OZ5A 4MVCA 1Y4SA 4WYLA 1IDOA 4F6CA 4R54A 5A3VA 3RC7A 1QP4A 1BQNA 1PQ4A 3GLGE 1NHUA 3MINA 2FHJD 2RI0A 4NRUA 4IGIA 3IN5A 4HUJA 1TJNA 3OTOJ 2HTFA 4M83A 3A7EA 2CJWA 4R9VA 2HC9A 3UJNA 4AXIA 4MKAA 4DNQA 2A7XA 2IODA 4TRJA 1ECJA 2OKGA 4L4SA 4ED0A 2BEVB 4JJEA 2HIAA 3IAM1 1OZFA 1NYQA 3UJ7A 2O6HA 2WF9A 3M30B 4JI5B 4FBGA 1CJTC 3V8RA 3EZYA 4J0QA 2OZVA 4UTRA 3AF5A 4EBEA 1EHIA 1Y8RA 5C24A 3LE8A 2FZ5A 4I50F 2V8PA 1RK8A 4IFIA 4U95A 3HU1A 3PNBA 1UAAA 3TZ6A 1AO3A 2DTEA 2W5UA 4P38A 1KAEA 1C4CA 2JLSA 5BR1A 4O3FA 4HYQA 3ETGA 4XJTA 3NT5A 1PN3A 4Q9IA 2NS1B 4DR4B 1DTTA 1FZTA 3DPIA 2QJRA 1EFKA 4ZQHA 2YXEA 4B2PA 4DMKA 3SEAA 1T2VA 3VGVA 2P1RA 4I6AA 3AV3A 3FLAA 3EGDB 2BJ1A 3O4JA 4DL2A 5B0AA 3EA5A 3QATA 2GN1A 1DIAA 4HRXA 5TPWB 3PPXA 4BWMA 4QD3A 1GNPA 3OUTA 1G5RA 4BFWA 2NAPA 4F0HA 3C1UA 4YFYA 5ENDA 3OZTA 4UE6A 1HD0A 5FLEX 2HYDA 4IJMA 3OAAD 3MFHA 3TZQA 2HBQB 3CVXA 1I5OB 1NW9B 4PCUA 1OPZA 1RPNA 1XMQJ 4WTYA 5KNCD 4RV9A 1KS9A 1M6VA 4EQZA 1EFDN 3VC1A 3IBGA 3H40A 4HI0E 5HS4A 4YMSA 4XD2A 4KOAA 5ALGA 3UUEA 2DR9A 4ICLB 1VISA 5FBHA 3WLFA 3HRHA 3KCQA 1VG9B 3NW9A 4NFLA 1P6QA 4LRSB 4TVBA 4IFVB 4NYIR 2Q7DA 1X9MA 3E3LA 1FDUA 2HQBA 3WGNA 4DG1B 1I33A 4WKBA 3FSGA 3N1UA 4K86A 4MVWA 4K46A 4AQ7A 4K3VA 2A1TS 2H2DA 2BGUA 1UMCA 4E22A 1DQ9A 2CPIA 4RVCA 4ACBA 2OCIA 3ZCUA 5JXSA 4BQIA 1Y1PA 4QZVB 3BXXA 3KKNA 3RB3A 3X1LB 5J2UA 4I5EA 4ITRC 5FOXA 1F8FA 3TQRA 4MPDA 1L5LA 2JBHA 1DC5A 2WQ7A 1GPDG 3AC0A 3LFTA 1KLMA 1OYYA 4OGFA 1IG3A 1IVYA 2H4FA 2X9NA 1YO6A 1XJQA 3I0SA 4TU8A 4H3HB 5CT9A 4L0MA 1E4EB 1H2WA 4RSHA 3E2PA 4JLMA 2OV8A 4QXQA 4YRPA 5HRUA 3E5NA 2RC6A 3IIKA 5JMOA 2JH8A 4WFYA 3WJ2A 2DR0A 1GPMA 5AE1A 1TRKA 5A5FA 4E94A 2W2MA 2HLTA 2JNJA 1K7CA 3EXHB 2ETVA 2J5AA 4A48A 4F46A 3HBMA 1XNJA 5F35A 3FCYA 2C5HA 1VJ5A 3DR3A 3VPAA 3R4CA 1H5UA 1WX1A 4C3LA 3RG8A 4UNNA 5JYEA 3RVJA 4MI9A 4LBZA 1LRJA 4D96A 1YR3A 3I82A 1R64A 1BYIA 3CUTA 2JL9A 1NR5A 1B26A 3Q8PB 5B30A 3ZEAA 5CXXA 1NVMB 1Q8IA 1SVSA 1YRXA 1Z8FA 1PAUA 1BKYA 4X7MA 4TWRA 4B6QA 1GR0A 4RDHA 1UJ5A 1RISA 2OPSB 5CA1B 4WKYA 1X19A 2QQEA 1QU3A 1KFSA 3F6BX 3MPUA 4PPFA 5E1MA 2Y1WA 3QHPA 4UT4A 4RZSA 2K3IA 1JDJA 4KXVA 4YVFA 4DXLA 3HKDB 4PRZA 2B4KA 2MMCA 3BE4A 1J49A 4UEOA 1NKBA 3MC1A 1THZA 3CRNA 2HGNA 2QLBB 3WMFA 4I1OA 3V8MA 2C61A 4DYDA 5CVVA 3CTMA 4NMHA 2Q6OA 1ADBA 1ZJ6A 3PGLA 1W5FA 3I87A 4DARA 3TUPA 1BH2A 2JLGA 4QWAA 3SR0A 1QX4A 3RS2A 4CKCA 1ZOLA 1XDGA 2XG8A 1Q0RA 3MJDA 1G6HA 4UDNA 2NADA 3R6DA 2FPRA 2NU6A 1A9TA 1QRAA 2V8BA 4WY8A 4DMCA 2EFOA 3MMNA 4YDQA 3IMKA 4YP9A 1E7SA 2ENWA 4QBTA 3CO9A 4YJ2F 4EEZA 2V03A 1VSUA 4A82A 2AGPA 5ECYA 3P0FA 1PLJA 1ZBTA 5BSEA 3OOHA 1BLUA 3F98A 3A7DA 3EGXB 1KJ9A 3OTOB 1WZEA 2MDTA 4O6VA 4GIBA 4ILEA 1NSYA 1OR8A 3RJZA 1LPNA 2IYAA 5FFFA 5LL6P 4ND6A 3OZBA 4BPBA 2A8YA 1EEHA 3CO0S 4F4XA 2Y66A 3M1LA 1E7WA 2OSBA 4EYGA 3HCAA 4EFMA 3KB1A 4EWLA 4CKYA 3AP3A 2RQ4A 1Q7LB 2NSCA 4F6RA 5HKBA 2H4ZA 1UQUA 4OMCA 4EUHA 1YL6A 3H87A 3DMDA 5A6SB 3BDEA 3BGVA 3G59A 2EERA 2ROPA 1I13A 4EJFA 2O8BB 4AUNA 1ZIYA 4JI7F 1L3IA 1SXJB 2ZCUA 2QVGA 3LOQA 3KELA 4X85A 5ELXA 2IYGA 4LI0A 1KHVA 3GLIA 1X1BA 4O4LB 2RRNA 4I2QB 5AUNB 2VNHA 4QU9A 2BFBA 1L8AA 2KLBA 1E2KA 3AEZA 3MGBA 1LQ9A 4OSEA 2DFPA 3YASA 2VZ8A 2XDQB 3NKLA 3DM9B 3DHYA 2PXHA 3L4EA 2V1UA 1YZGA 4TZ0A 1E6KA 4DUYF 4O1HA 3TLZA 4DA6A 3DAOA 4JIGA 3IQDB 1S7CA 1NAHA 3DNCA 4K6KA 4L16A 1G20A 4Y7CA 1E69A 2XQFA 1NVTA 4KLRA 2O7SA 3GLIE 5CIWA 1ZUWA 4B34A 5HQMA 1HA1A 4IF6A 2FCRA 3ECCA 2IV7A 3NCQA 1RWNB 4C48A 1ZC3A 4I36A 4OYWA 3WQBA 2MYPA 3LQRA 3HZEA 4LQ4A 4A4DA 4DR3J 4DLZA 1YBHA 3QQPA 2ZR9A 4R81A 1N34B 3SXUA 2ZQ5A 4R1LA 1MQ9A 1QKJA 4D81A 2AE1A 3FRYA 1DP4A 3FHCB 1OXTA 4DS4A 3SK0A 4RIIA 3SEFA 3HVJA 5AW0A 4R2XA 3F67A 4RHUA 4ZYXA 3QBDA 2IP2A 5FOUA 2UZ3A 1N92A 3DMHA 4IMRA 5KFIA 3GIWA 2M6KA 1ULSA 4B3MJ 3DJFA 4LTDA 2NYVA 2J9DE 2L17A 2AMYA 4NYMR 3BDAA 1WXXA 3CJTA 4RXUA 2XLIA 5G0UA 3SS9X 3E2EA 2I9KA 5IXJA 5FD1A 2XUGA 5H70A 2MSTA 1R8QA 5DN6A 1AZSC 3I05A 1XTZA 3SI7A 3LS2A 4YMTA 2JC3A 4YFUA 2Z9DA 4ZP6A 2OXEA 1JI0A 2FGJA 1D2HA 5FJ4A 3SEQA 3PEJA 2Y3YA 3C8DA 1YB4A 1SIBE 5ITHA 4RW4B 3ZY6A 1ZR2A 4DSNA 1U8SA 4GYWA 3SG0A 3SOZA 2EBGA 3WKAA 1M8JA 3C45A 3N0XA 2OV6A 5LP6B 3AJAA 4DZRA 2NU7A 3EBLA 3MN1A 3ZVKA 2AW0A 3M6WA 1JR4A 1HMYA 4C76A 3ZI4A 3EVDA 4H1VA 1RYDA 4NASA 1NPTO 4Z7NB 1YVFA 1AF4A 2EAUA 2VDOB 2YRXA 2DX7A 3TOSA 1DJMA 5DRYA 4OXXA 2XUHA 4HDRA 3N8DA 5D4LA 2TMYA 4WFJA 1V39A 4QRHA 4C43A 1KJZA 1FFSB 1DLIA 1T24A 5EP3A 3TW0A 1OPXA 5JVDA 3AH8A 2Q5HA 2RUGA 3H6HA 4MA0A 5LLDA 2GA7A 3ZGNA 2A1UB 3D4OA 4XEHA 1VE3A 4DR3B 3I2IA 4RZRA 2JA1A 1KIFA 4JBNA 5LJLA 3RDPA 3DLJA 2E6UX 1EGMB 4Q4HB 1GGVA 1UW4A 2FUG1 2N82B 2VPWA 1CY6A 1YWXA 2DH7A 1Y1LA 5JQGF 4ZCRA 1KEUA 3KB6A 2G71A 2ZRGA 2PN1A 2HQRA 1EJBA 4K9OA 2WOMB 1SCDA 2KT3A 4YPFA 1D2MA 2IBKA 3T5DA 2Z8YA 1G8AA 4KFBB 1HNWF 2WYIA 4EY8A 4URGA 3BWEA 1O6ZA 1TL7A 1N34J 1OREA 1BE6A 2A1IA 4EJ6A 4E1BA 4FMCB 4EF6A 4ENQA 4CDMA 1BFKA 1JR3D 2J8SA 3Q8QB 1ZAWA 1C4OA 4FEGA 4F5DA 3OLWA 3CWQA 2DGXA 3F47A 2VDPB 3BGUA 3ZH2A 2I1VB 1K1QA 5TDHA 2RF2A 5EE5B 1ZJWA 5C80A 3PXDA 1A95A 3DBLA 4Z8XA 1G6OA 4WASA 3Q6MA 1KQGB 2VF5X 3WLKX 5LMUB 4JI7B 4OQFA 2REQA 1XB2A 3WL5A 4M63A 4Y65A 4FF1A 5E3AA 1Z4NA 3JVUA 3ITKA 2B7CA 2D3ZA 3B1JA 2DOKA 1X60A 5CITA 4QULA 1W581 4J2OA 4TX1A 3HR7A 3W6UA 3JTPA 3OXLA 5A71A 1EK0A 1P1FA 2ZS7A 2DO0A 3UB4A 5DYNA 3MPVA 4G81A 2RAQA 3IHKA 4EJ0A 4UE2A 3CLSC 4B47A 3A05A 3RRJA 3DDOA 2QRVA 1PNTA 1QH8B 4YWHA 3SYNA 3GR6A 4JA0A 3T9NA 2R8XA 3R0XA 3MTEA 5ETNA 4AJIA 3GB0A 1FE0A 3W5AA 1K73T 2LCQA 1WD7A 2YXDA 1GITA 3HA5A 4G0UA 4DV0F 2PVSA 5BUSA 2FXVA 1WCIA 4QQBA 1NJGA 3F5MA 1GV1A 5IT0A 2DGQA 2C9CA 2BV3A 2OHXA 4JWKA 1JEQA 3VWSA 2QTHA 3PR5B 3P9YA 3AILA 4Y6GB 4BJ6A 1FYWA 4MCHA 2YVSA 1EH5A 1VRUA 2GK6A 1Y3AA 4Z9YA 2EFVA 3ILVA 3LHFA 3BTOA 1UOEA 3K05A 5DHAA 4UM9B 1RVDA 1X7XB 4DIEA 4EPWA 1J0DA 4KH1A 3O8DA 1BMQA 2UYQA 1KDOA 4XH9B 3WOHA 4JVSB 3VAMA 1KAGA 3KXIA 3JWJA 4K9DA 4ZO6A 1UFLA 3FB1A 1FX0B 1GR1A 4EUFA 3LGNA 1S1MA 3AHEA 4BKQA 5JAOA 3E4DA 5C3MA 4HFJA 1EWKA 3O4VA 4CP5A 1A2QA 3FWKA 1RPAA 1PZEA 1E9VA 4A8JA 1UBTS 1BJTA 3UV6A 3BCSA 3JY6A 3DUFA 3VR2A 4EUSA 1U7DA 1CQIB 4BNDB 1Z0IA 1JFTA 3HNOA 4X4VA 4Y6OA 4PG8A 4O4GA 1BSVA 3I76A 1V2GA 1D6NA 1Z2NX 4NMXB 1SKBA 1X4FA 2VJBA 4Z3DA 1P1LA 2Z5LA 3HT3A 5K3BA 2H1SA 2LBPA 2RNEA 5DGDA 3OL7A 1GTG1 1HNIA 2QB5A 4C8OA 2POCA 2VS1A 4WXOA 4GS5A 2K1RB 3DE6X 3KPJA 1AA9A 4GC9A 4GZ3A 4F4WA 1BU5A 1MFPA 4NQZA 3N5KA 3B1XA 2HRBA 3P20A 2IPAB 5EC8A 3ESZA 1O5JA 2ZDGA 4FQ7A 5K2OA 3MOZA 4BCAA 1T8TA 3V2HA 4AKIA 1OZHA 1FFGA 4R84A 3QKIA 2VQ6A 1DE0A 4BO1A 4E32A 3MINB 1US8B 5I9TA 3CB4A 2XNDA 4ZMMA 2PWZA 1O6GA 1DDOA 1W6RA 4I50A 3ZK7A 2B8TA 5LZ7A 1TU3A 2VBGA 3OSUA 3KDNA 4F96A 4ZPCA 2PAAA 4EVRA 1Z36A 3MEQA 1F3FA 3ZBUA 2M0GB 1CJUB 1M2HA 4IS3A 3DRRA 4DSZA 1V8BA 1GFWA 4R83A 3DNMA 3A1NA 1IHUA 3AWDA 4RY9A 3C85A 3RQIA 4E07A 4HX5A 4KYVA 3SCKE 3OQIA 3UMBA 3JS5A 4LF5J 4O1MA 4UU1A 1SHTX 5AM3A 2I6QA 1LK5A 5DNAA 2F67A 4AYXA 3Q8SB 1GXLA 2PLFA 1S9HA 3U13A 1PBTA 4DV4B 1SWVA 1OXXK 2KE5A 1JVNA 1FRXA 4Q1VA 4NXNJ 3ESBA 2DH9A 1TGYA 1KARA 4LFCB 1E9FA 4I9FA 1EWYA 2O50A 3IEPA 2X3DA 5AJHA 4DA4A 1OJ4A 5KOIA 1Q21A 2HNYB 3WJAA 5E1DA 1C50A 1ORVA 3VNUA 1U2DC 4BV2A 3PHHA 3FRIA 1CUJA 2PHZA 5FADA 3M6VA 4H3VA 3EIOA 3L1UA 2HK3A 1YQHA 4I1VA 2IEGA 3CY6A 2OL4A 3AD9C 1I3CA 1MWYA 4N8DA 3L0OA 2V68A 1SOAA 4G5OA 2FEKA 5KFFA 2I7CA 4G1MB 1XKLA 3ZHUA 3T4PA 3BSSA 2FFRA 3PJRA 3N7UA 4AJHA 4IX1A 4JP8A 3BERA 4UNQA 3I6PA 4M8SA 3WG9A 4TTTS 3GRKA 2XS2A 1K0VA 1V4NA 2EKLA 3P45A 1ML3A 1WDTA 5JZVA 1X9IA 2J41A 3W3AD 2QYTA 3M1IA 1DZ3A 1WC0A 1KR5A 4ZHRB 1Q0LA 3RM3A 3V6DB 2NVUA 4JJ4A 3QBEA 2H9ZA 1F1JA 3FSRA 4K2JA 3IT1A 3R5SA 1NWCA 3ZO7A 2LRHA 2KPOA 3B12A 3LRPA 1WW3A 2QX9A 4OPMA 4KE7A 4TWJA 3AUKA 3SU8A 1JEYB 1O5TA 5KBYA 1AFJA 3ADDA 4OYYA 4RCVA 5J2UB 3HXTA 4ECQA 4HX2A 4P74A 2DHRA 5E6RB 1ZHFA 1URRA 1KLMB 4E5YA 3B2QA 3GARA 3HO6A 1NBWB 3IILA 4CLZA 2FW9A 3GT3A 2ECKA 4JQCA 5FLXY 1T9ZA 1F48A 3RRBA 2VPXB 2ECFA 1MCZA 4NOHA 4OZNA 1E1QA 4Q1FA 4YAGA 4GICA 4A8JC 4HGZA 2YJGA 4C30A 1Y1TA 4F3TA 1P5HA 5EZSA 3ZIAA 2GEKA 3AR2A 3AOCA 3FNEA 3V5RA 3CZQA 3TNYA 5IOLA 3DVSX 1PO7A 4UVGA 2QRNA 4CMEA 1M1YB 3TKAA 5BSHA 3NJ8A 2GF0A 1NKCA 1IBSA 2ZZNA 3K8WA 2FGKA 2XTZA 3GLHA 3VBEA 1O2DA 4LNAA 4ZVTB 4H4DA 3WHIA 1VLOA 2F1OA 1HYSB 2VH2A 5L3QB 4ZVOB 4HDSA 4H31A 4JSRA 1UA0A 3BF8A 1LDBA 5AVWA 3GG9A 4B9NA 3DPSA 3SSAA 5L8VA 1NNEA 1AO0A 1U0GA 2OPSA 3AWIA 2RGWA 1T1RA 1XL0A 3GJTA 2PMBA 5LMZA 1KU6A 2C0CA 2OCXA 4C2BA 5KYVA 2VG5A 1HRKA 2BPOA 1D0SA 2J0SA 4UBKA 4X1YA 1WOPA 4HT5A 4L5IA 2P9BA 2D6FA 3A27A 4HN4B 4Q3BA 1KMHA 1HT2E 1KK0A 1C0IA 1VGQA 3FIUA 3H9BA 4OJKA 2ZYUX 3H5LA 3BRSA 4L07A 2VK4A 1K86A 4UPDA 1Y9OA 3VAGA 2YBEA 1X1SA 2BWJA 2IYFA 2DUWA 2HX1A 3DNFA 3B6JA 5EGYA 3PB3A 3WK7A 1JV2B 2HHWA 3FMWA 1VYAA 1U3DA 3MPYA 3H11A 1TGVA 8GPBA 4YYZA 2W11A 3I55S 4GFDA 4WBNB 4MCJA 3LOPA 2IQIA 1RRCA 3NXKA 1NUHA 4D6YA 3LX4A 2IY8A 3UN1A 3ZVLA 3KETA 3O2QB 1XLVA 1VHJA 3M81A 1FJ7A 2WFLA 2EKDA 3G2PA 1BXRA 3DDKA 5C7PA 5WRFA 4NYOA 2AFHE 2NYHA 5F2KA 5CH8A 3EZ2A 4ZC8A 4D43A 2NUTB 1Y1RA 3US5A 4IMIB 1JE0A 2WC1A 2JSXA 3FG9A 5EZ6B 1NGSA 3NWJA 2PKCA 5HNKA 1RDRA 4TUYB 2IX9A 1P61B 4YCJA 4F4UA 2XZDB 2WMYA 3F3MA 4C21A 3KKPA 3BXPA 3D3EA 1GPAA 2XQJA 2F4VJ 3SP1A 3TOXA 5CYFA 1S9EB 1PEYA 4PGFA 2JATA 2KYXA 3W3AA 1TUVA 2MJNA 4G86A 2I4MA 3W8EA 3L92A 3MD9A 3H18A 1G5TA 3U9SA 5D8DA 4YLEA 2H5IB 3ILIA 4E8UA 1UK6A 3PS9A 4O2AF 2N3ZA 6REQB 1ZM9A 3BC1A 2GRUA 4EVSA 4YRSA 3PJ9A 1M2NA 1NRJB 3BXFA 2BFBB 2ZTHA 2O5EA 2VSNA 5K03A 4EG7A 3V7WA 2H2FA 1R5JA 1OC2A 1PILA 1Z6GA 2PBFA 4DNOA 3KD2A 1VE1A 1FU8A 2OPRB 3T7JA 3ZN2A 4UMFA 1TTHB 4BO7A 1SBTA 1SFRA 5LMUJ 1QG6A 1MEOA 4QTXA 1ONPA 5FUYA 3PYFA 4WGFA 3LTEA 4QSMA 1EGVB 2EC2A 1G20B 2Q3JA 1A4UA 2EWWA 3B3FA 2V58A 1PJSA 3U7GA 4YT4A 4NLSA 1FRKA 3AVWA 3R2DJ 1SBHA 5KFXA 4U7CA 4MYSA 1PK8A 1J06A 2W9CA 4HXEB 3WX0A 4OI2A 2HU2A 2HA5A 1NP3A 3R6TA 4WNAB 3J7TA 4U7JA 3NUZA 3UA3A 4EFLA 3PDHA 4KBIA 4ZP8A 3R0QA 2F8HA 2C58A 1AKMA 1IKXB 4HI1A 4FMDB 4U8VA 1CJKC 3MCNA 5AKJA 3DWGA 3FR7A 2HSGA 3FTEA 5BWCA 3F6PA 3IFEA 2Q9CA 1GIAA 2VDLB 2HJ9A 1APBA 4K6GA 2B4VA 2IU4A 1E8DA 3QXHA 1BQXA 3CW8X 1EBBA 3PG5A 3KK1B 1JLGA 2C99A 4IYQA 4IIJF 5BYQA 1PV4A 3ZY2A 4YXWD 3LQYA 2XADA 5B3LA 5C5EA 4M5DA 4C7VA 1N0IA 2OEMA 1VSVA 3OCXA 4ND7A 1RADA 3NONA 4BQSA 1WB5A 3BSNA 5HKKD 1N2XA 2WF7A 5A0FA 1JEJA 2ZI5A 1W36D 1NEEA 3UXYA 3RRGA 3QRRA 1DIGA 2EV9A 2DXEA 5AESA 5ER6A 4CCWA 2I6UA 2UZ1A 1SKAA 1UMBA 1S01A 4WXPA 5LIRA 4GRDA 3ZDCA 4RW7A 2O1PA 5FTMA 4RKWA 2F64A 2Q28A 5AE2A 1JBEA 4C3VA 2WWWA 4DR6F 2WD8A 3ZLTA 1U48A 2CPJA 3CVYA 1BXKA 1XDZA 3MMAA 4DCOA 2I22A 2BD0A 1LSJA 4CNZA 1KJWA 2V4JA 1PV1A 1OXSC 1SHKA 5LP6A 1XYYA 4MA5A 4RNHA 4Y0AA 1E64A 1L7NA 2BA9A 4KNWA 3TAHA 2IC3A 1T9BA 3CZMA 2HIMA 1SC3B 1XRMA 2NU8B 1LPMA 2LCFA 4XM2A 2Z4PA 1RZMA 1BWPA 1R37A 1X7YB 3RBAA 5D3GA 2PJZA 5TMEA 5I4BA 4GMFA 1UT6A 2CFIA 2Z3WA 3EOBI 4OIMA 4OL8A 4AQDA 3JQ9A 2RS2A 4IMJB 4K05A 1LX7A 5EY5B 3PNOA 3QWFA 3FW1A 4QUAA 4OY3A 2DFNA 2GBLA 4HQKA 1V43A 5HVNA 1YZ6A 1UBOS 3U7JA 1NONA 4JXXA 4QUHA 3OZGA 4S1VA 3ADOA 2QZJA 3VYSB 4UQOA 4I0WA 3AVPA 3MB8A 4CVNA 5ECWA 1CDZA 4BS9A 3DOHA 4V24A 1E9DA 4C0HA 4B3CA 3T7KA 1HE8B 1KEPA 1WJ9A 4WESB 5GVSA 1FRHA 3OBIA 3LBNA 2O6LA 4XWAA 4FDUA 4RQBA 3TW8A 2HPZA 2W7OA 2H51A 5TIIA 4M9ZA 5CHCB 4MUXA 1CS0A 1RWBA 4J9QA 2Y1LA 4PAMA 3BPDA 4ZJUA 1S2NA 1VBKA 3IDFA 3W60A 3DSRA 4DQXA 4Q01A 1C0TB 3CD7A 2EGGA 4R98A 1DU4A 1VBYA 1A7UA 1PJQA 1NNI1 3K30A 1T1JA 4LZLA 5D5HA 4OQZA 4XWOA 2J7WA 3SJAA 4K5RA 1N57A 2EZ4A 4ZYUA 3ZV5A 3DCJA 3A1TA 2B8JA 1NBMA 1MNAA 4C4WA 3KLHB 2J9GA 3UAVA 2FLNA 1YR7A 1C0UB 1S57A 4ZGGA 5J4VA 4O3OA 4F3QA 1SHZA 2GRAA 3BOSA 2RK3A 1P8JA 5CW1A 4G1VA 4BMOB 3SCLE 4BFLA 2GETA 4MRAA 2GM3A 2OAUA 5KTTA 2YN0A 5J2TB 2X9VA 3EUFA 2RF2B 2HHVA 3FOEC 5J2MB 4RHFA 4DYVA 4DLEA 3OC0A 1FFAA 2YMMA 1QQ7A 2R96A 2M98A 4WGGA 3OMLA 3HBNA 1XQXA 5BT8A 3I5BA 2Y0EA 1T4BA 3H2JA 1YS2X 2ZH4A 2XCUA 1IRXA 3OEHA 2REQB 5KFLA 1WZUA 1ZD1A 2OMKA 5L9AA 1G6KA 3U4GA 2B2NA 3AFIA 1OZGA 2XI3A 5F0UA 3C98A 3PIRA 1C9NA 3MLAA 4PHGA 1XAIA 4YPOA 1VQYA 3STXA 5CA0B 2H3EB 2JJMA 1L1EA 2ZIZA 3ADCA 3BB4A 3TOQA 3QVMA 2X77A 2NSJA 4BN5A 1CG2A 3W65A 3HCCA 4A6DA 1JR3A 5JEDA 2DG2A 2HFJA 2D3WA 1CCWA 3O8OB 4EM6A 4YAIA 2JC0A 3RBEA 3PQCA 3MSXA 1RQPA 4CLRA 1P9OA 4JLUA 2TMGA 2D1CA 3ABSB 3N2IA 2QRVB 3ENVA 2NT4A 3FVWA 3T1OA 4F8EA 4LSMA 3U4IA 1E2JA 4KQZA 5L3SA 2JIMA 3AEQA 1URPA 1WDKA 5IW8A 2QPTA 3C4JA 3IP6A 3X3UA 2K2QB 1C9KA 3EC2A 3QE3A 2PI5A 3WP0A 1PUJA 3DONA 4C8LA 3H5VA 1Q8LA 3L8EA 1CF2O 1QPBA 3K70D 1WCIB 2DHCA 4GXQA 3VO8A 4KIFA 1WF3A 2J3KA 1Z0UA 5I3ZA 1V45E 1WKCA 4RNFA 3AFMA 4ZO9A 4JJIA 1E6YA 2CQIA 3Q8WA 2ONYA 5DGXA 1S1VB 3B54A 4YJDA 2WSBA 4J7AA 3A1FA 4OL9A 4ZWNA 4M22A 2Y8WA 2IL1A 3BD9A 2QF7A 1VBFA 2DUUA 4LMBA 1Y37A 3CCQS 2Z58A 4FYXA 5I7SA 1E18A 1XTQA 2EZTA 2FSPA 5E6SA 3BWDD 1RHMB 1SU7A 4ML3A 5CM9C 3JRXA 2XCQA 3EZ5A 3UUFA 2I0XA 1U1GA 2GYVA 1X4DA 1FX0A 2CSXA 4YCAA 3SJ7A 4WFIA 2OKQA 3AV0B 4RETA 3I5AA 2GIFA 3HVIA 3STYA 3E7XA 2P6RA 3TCXB 3WGHA 4ZQGA 5CEEA 1RT3B 4N5NA 4BC1A 4AZ3A 1B6TA 3GHYA 3K9QO 4RW8A 2VD3A 3OIVA 2IM1A 3QSYB 5B0FA 1MAAA 4FKZA 4ZPBA 4OYRA 3KKLA 2O57A 3UR0A 3VNBA 4URVR 3T0GA 2IBTA 1KWGA 3A8JA 3E05A 4EATA 3WLNA 5EEGA 2D59A 4TXMA 2LUOA 3LBYA 4OO3A 2DR6A 1TT7A 4A7PA 3FEXB 2R6HA 1U45A 5LU9A 3EH2A 4P7FA 3SDEB 2OG2A 2W0SA 3QEOA 1V37A 4XI9A 4DB4A 2G7MC 3CFYA 4JJZA 3R7BA 2VA8A 1D2NA 3ZE1B 4ARCA 4L6CA 1Z18A 4LXGA 2VDQB 3R3SA 3B13B 4M94A 2P6NA 3N2KB 3F0TA 3FN4A 2PKQP 2DR3A 5GOZA 1SA0B 4EEYA 4LOIA 4DMGA 3PITA 4BO8A 4LHEA 1Y5LA 3WZ2A 1OUMA 3QKWA 4GQBA 2VHEA 2ZT8A 3ANNA 3ZK8A 2VFUA 5A8WB 3R5JA 3AM1A 1TAHA 1JHXA 2BCEA 1NPPA 4P73A 2QL5B 4IOMA 2Z6AA 4CV2A 4GMHA 3ZXXA 4RA9B 2GJ2A 5KDDA 4ECTA 3BYZA 4MK7A 2ZDHA 1H4SA 3TX6A 1GFWB 3WC2A 1A5TA 3H42A 4URSA 2GQCA 1NIPA 3WGYA 2QTFA 1BGVA 4FCCA 2XOKD 1UK8A 3LCCA 3T3NA 4Q3CA 3OQIB 4FJ0A 1WEYA 1WCYA 1H1LB 2WU0A 5C5IA 4Q7AA 2VHUA 4LJRA 2KVIA 4EW3A 3RYLA 3IDAA 4AK9A 3JQJA 4B9TA 2Y1KA 4Q6WA 4OLAA 2AGOA 4NONA 2ZUAA 5DRKA 3SBMA 1OYDA 3M2VA 5EN1A 1H2TZ 4FLFA 5IXSA 4XIGS 1KP6A 3RS4A 2BACA 4R1TA 1R8YA 1RXOB 4JL8A 3ZE7A 3TAUA 4KPFC 1ZNXA 3OFVA 5HKKA 3EVNA 1II9A 3D81A 2A78A 4NDAA 2ZBFA 2ASDA 1VLVA 2QX6A 1DJOA 1SH7A 2W2KA 4KWCA 3H0KA 5IK2D 4IG3A 2GQ2A 3DMYA 4PWZA 2BHTA 1P4AA 3AVVA 4H1WA 4Q8FA 2F3RA 4CLEA 3V4SA 1CF9A 2XEDA 4BZQA 1C4XA 4JUIA 3DQZA 2MLXA 1P7WA 1WUHS 1S7IA 4TN2A 4RUAA 1DRVA 2VHTA 5DQIA 5EWJB 3VOAA 3F9IA 1G20E 2CXXA 3MJEA 3LQKA 2YKPA 4AS3A 3U4DA 3LIPA 1GCIA 5GAGI 3NP7A 5B37A 5CNIA 2CZ9A 5FX2A 3CC4S 3QELB 3DZJA 3L9WA 2O07A 2KYZA 2GO9A 3EIUA 4M0UA 1I1HA 3UE2A 4JC0A 2ORIA 4CDIA 4P7JA 3DU5A 1XBWA 3HUFA 1T15A 2B8NA 3DE1X 2K8GA 3ZWCA 3PDUA 5KT5A 5CLJA 4LQLA 1OSDA 1SC9A 3INTA 4GKAA 1SIUA 5F5XA 1F3OA 5DNCA 2W2VA 4X8OA 4S3MA 2ZSFA 4DVJA 5GP1A 5E2IA 4L7QA 3SZLA 1TMGE 4ITVA 1YI1A 1U31A 5ALTA 2E82A 1ECCA 2HLUA 4AYBD 4KQWA 2YQ1A 2QAGC 5HPYB 4CGYA 4UNSA 2R7KA 3WDSA 2OBXA 4LC0A 3GWGA 2FTRA 3GYGA 2AP6A 3B85A 2VPXA 1IR1A 5D51S 2O0LA 4IYJA 4PTYA 3MM7B 4Q7EA 2PRZA 4RPHA 3OJFA 1NCLA 3P5BA 4X65J 3NWPA 1P1IA 3FLMA 3FCUB 2LP4Y 3KUEA 1FLVA 3VR6A 5A8KB 1WW8A 3DKVA 3FCWA 1U0EA 4EAAA 2JRLA 4GU5A 4IRMA 1QIIA 1Z16A 2G1KA 2G80A 1V6SA 3EPHA 1HDCA 3AT1B 1QRSA 3NHAA 5A8RB 2GDJA 2C3OA 3G5TA 1HL3A 1L5SA 2XBLA 4BLRA 4O4HA 4KBGA 2C3MA 3D2BA 3O8LA 2KRBA 2BE2A 1C9YA 4P4LA 2EBEA 4AICA 2ZUEA 3UN3A 5GAEI 1HYSA 2VYQA 1M5PC 4ECYA 1LB1B 2GO1A 4DY6A 1H85A 1GTJ1 5D4OA 4BWYA 3EVMA 2W2MP 2D8AA 5J2UF 5HE9A 4HFNA 3CA8A 4GX1A 5C5JA 1XDSA 1T0HB 2AX3A 3UO0A 4LYEA 4AL4A 2VYNA 4AG5A 3GJTB 1SO8A 5I9NA 3WB2A 3RB4A 4HAUA 2OBLA 2JGEA 3ONQA 9LDTA 1II8A 2Y67A 1ONOA 4XOUA 3ER8A 1H2RS 4FF3A 8AT1B 2SCUB 3EGEA 2PWYA 2C9MA 4CG2A 4OQXA 4HAOA 4DILA 3KAQA 1U4OA 4EKGA 5IC5A 4PZEA 4Q21A 1G16A 3PLRA 1PEAA 2G9QA 2JAXA 4NBVA 4HR7A 3GMIA 1WMAA 1GL7A 4C4OA 1WHXA 4DIMA 4MRSA 4FONA 2OA0A 2YKNB 4YRRA 5G3ZA 1NJ6A 4EX6A 4ZEWA 2JK1A 4MH8A 3FJYA 3K6RA 2D5BA 1HBMA 3CJ4A 1SD1A 5HMXA 4GOKA 4K6FA 1V16A 3CUVA 3L77A 4DWVA 3ANMA 4W5HA 1Z4UA 1JNYA 2XCRB 4DC9A 3E6AA 3X0DA 6LDHA 4MLZA 1YBVA 4OZ0A 2X23A 1V48A 4LVUA 1R8HA 4M53A 3HGTA 4AUKA 5DYIA 3WNQA 4Y2CA 4DBQA 2WBMA 1AE1A 4TVKA 4CWAA 4E70A 1N4DA 4OG2A 2G07A 3DOEA 2GARA 1A2BA 2X14A 2C4KA 3UKOA 2JPDA 2KWIA 2FC8A 3LQ4A 3EZGA 1X80A 2YXPX 3AUFA 5DNWA 4JI6F 5K3DA 3NQ41 3R6GB 3VO9A 3EMBA 4TL6A 4FHGA 1LC3A 4FFBA 4ZIVA 1BJRE 4AMGA 1QE3A 3N28A 1I0IA 5C5DA 5H8WA 1KSJA 2Q5JA 1N6LA 5EKDA 1A9SA 1P4HA 4MCIA 2BR0A 3OOWA 4E88A 4DQRA 2PZKA 3PC2A 4MGKR 1TU4A 3DB2A 4F0JA 2BZ0A 1OPRA 1R8SA 3IVXA 1J24A 5ENVA 2O3QA 3QX7A 4ZT3A 1PFYA 4C6AA 3CXCR 5FL3A 1HLGA 2A57A 3F6RA 1UBFA 5DHQA 3QU2A 1GYQA 3G02A 3EVBA 2I6WA 1GGEA 5ALLA 1UDAA 1GZ6A 4DHEA 1U0SA 4A4JA 4F04A 3OR1A 5ITWA 4OK6A 3OKPA 5ELMA 5JVHQ 2I4RA 4QIGA 5LKRA 3TANA 4C4PA 3SNHA 4XVUA 3C16B 3G5MA 1YI0A 4W99A 3TNDA 2CL7X 2FWBA 1H38A 1G0NA 1NXWA 4IM7A 4WNAA 5C42B 4EMSA 2NVWA 2WP0A 2NO1A 4BWFB 2V5UA 4DRYA 2LLZA 2QRQA 5HIAA 4HLQB 2GC8A 5LLSA 5H9FK 4LVCA 5TF4A 4OMUA 4NMWA 1FVOA 3M2UA 4C7MA 3PTLA 2Z5VA 4QPCA 3EJ6A 4LSLB 3ORRA 4R7TA 1Z75A 1ZU5A 3VVCA 3PC7A 4HDKA 3H1TA 5LR6A 4KQCA 5KG0A 2DUNA 4I46A 3L84A 3OLAA 4ECSA 1ENYA 1GAJA 2CB0A 1K7FB 4NV1A 3EDQA 3KK1A 1MAWA 1HURA 2X9QA 4USIA 2IF2A 4CO3A 4LYDA 1IXKA 1S12A 5JSUA 4R1MA 4DR7J 3S3TA 2YJNA 2CJ9A 4NBSA 4V0RA 4RGQA 4QE3A 4X2BA 3KMQA 4MWOA 1RHUA 4OSPA 2YZKA 3KQKA 4B35A 4HAWA 3KT0A 2EFJA 1IHOA 3HSSA 4I1YA 3BFVA 1Z73A 5LUBA 5LQRA 3RVLA 2HV9A 3F4KA 2C22A 1IN8A 2OD9A 5KYWA 2REOA 2DIUA 2O7QA 1KNXA 1L3BA 2GN6A 2K2WA 4OMFG 1X39A 1IJEB 3L8DA 3V4IB 4PCVA 4R8KA 2IDLA 1B00A 2DNYA 2F1RA 3OJOA 3F71A 2HIGA 4Y1RA 2FY8A 1RWKA 4DL0C 2ZAMA 3WLQA 4MWSA 4FFMA 2OBYA 3GBPA 2BFMA 4GM1A 3KALA 2BBSA 3ND9A 1NK5A 1JHDA 4UM8B 2DPHA 5CIQA 2OORC 1U9IA 4OQDA 4N5SA 3GW8A 3IQEA 3T5CA 4KE6A 2B1IA 1H2EA 1FVHA 1X0FA 1RB0A 2RIPA 2YPYA 3KNAA 5IAOA 4E1VA 2O2IA 3I9V6 1RBYA 1TK2A 5KKAA 4DCJA 3M30A 5K4HA 1SG9A 1OMOA 3R1HA 4P22A 4A27A 1FE8A 1LH0A 1FNMA 5D3GB 2IOFK 5EIBD 4CM9A 4LNHA 3PYEA 4MWGA 1N2CB 3W77A 1AMNA 3KG0A 3K59A 1QO0D 4P3OA 3UWOA 5E38A 4RBNA 4AE5A 4CKBB 4KVGA 4BDPA 1VQ8S 1JLQA 3HDGA 4WE1A 1R8XA 3MGJA 3DMJA 1LFWA 2PA8D 1D2AA 1GKUB 3PXCX 1DZIA 5D6NA 4N6OA 1XOIA 4Q1AA 2GRJA 4ZAYA 2HFOA 1XZLA 4Y0NA 3WLOA 1LWFA 1XRPA 4D0RA 3TSAA 5M2RA 5FTJA 3WNDA 4D9GA 1F0KA 3CJ8A 3JYQA 3OZVA 4IG9A 2RBGA 1I10A 3V6JA 4HFMA 4Y00A 1WW2A 4W9NA 5BT9A 2H1VA 1N5JA 2PMHA 3DPUA 3HHLC 5LSAA 4J0JA 4YBRA 2RAVA 1SG0A 3GZ7A 1CULA 5KWVA 1IN4A 5AI5A 1X5TA 3W64A 1NI3A 5IAAA 1A71A 3BBLA 4BKMA 4RJ2A 1ZCZA 1IKWA 2HYIB 4BRUA 1IQRA 3CJ2A 3K8OE 2X76A 1VSQA 2KJQA 2CN1A 4L4YA 5EPUA 4B85A 4XTCS 5DLDA 2M6LA 5LQDA 3A8TA 3AKCA 4Q39A 5EIOA 3P9KA 1GEEA 3OPXA 1FNOA 3LP0A 4LF5B 1P9RA 2IPNA 4CW7A 1NVKA 2O06A 3N9IA 4IFVA 5JNTA 1VMIA 1JSLA 3O6VA 3SBXA 3EDRA 4M2LA 1IONA 4A8TA 2GEUA 2DP4E 2ZZTA 4CTMA 5CDYA 1HQDA 2FWJA 5J2MA 1W2HA 4UMVA 3W79A 3MUFA 1UXJA 2V7QD 4YRAA 4DRZA 2MSSA 5MLCV 4XJVA 1FDRA 2CE7A 2ZPAA 4PHHA 8ABPA 3BG5A 2DFKB 4LX8A 5T6BA 3W5ZA 1NXSA 3LPEA 4HS4A 4XE5A 3DEJA 4C97A 1ZAVA 3ELDA 2I7TA 5A3SA 2WHPB 1E2GA 4JQYA 2OFHX 5DG9A 1NPKA 4OHVA 4NZ7A 2J07A 4MVJP 4KPGA 4R7GA 3HWSA 3QPVA 1UJ4A 4U7PB 3PJDA 2GO8A 4R7ZA 4W6ZA 5KCZA 1N36F 1OWOA 4FN4A 3FNBA 4RH0A 2I3GA 3IBSA 2ZE6A 4L28A 4GZMA 1X0XA 3O8OA 5SZIA 2R7MA 2GEFA 4DN9A 3D2CA 4KI0A 3KK2A 2UDPA 2NO5A 3IIIA 1FDOA 4TTRA 1TEVA 4NE7A 5IC6A 2JFHA 3KTQA 3MFYA 2YBDA 1CVLA 5E4YA 1W88B 5BYAA 4PFQA 1W6UA 2YHIB 1VQSA 2E5IA 1JNZB 4LDJA 4PX2A 1XRLA 1SB9A 4CLOA 4EA9A 4M7PA 1E63A 4O59O 1RC8A 3H3FA 4BIIA 1FXWF 4LVNA 3PX0A 1Z06A 2JLYA 3RU9A 1Z2LA 1QV6A 3GH3A 2KH9A 5K0ZA 3M49A 3ZCQA 5JYBA 3UPUA 2R9LA 4RTQA 5GWXA 4IDGA 5CLLA 2KU7A 1A72A 1RAIA 1NRXA 2JGRA 3S27A 4S2EA 3L7MA 3VZSA 2BGKA 4B7UA 2L42A 2ZE2B 2PVPA 1Z0FA 4DVGA 3TIIA 2FW6A 4U0JA 1IVZA 1YSCA 5AIAA 2WRMA 5B1YA 1F2HA 1GGHA 1MWZA 1H2XA 3OQBA 3RIHA 3WGTA 1URNA 1CJVB 2P79A 3SFZA 3N0TA 4N48A 4MJLA 3B1KA 2WYWA 3MUEA 1EI9A 4XIYA 3D8BA 3HO1A 5KEIA 2Z95A 4TKVB 2I8AA 2KDOA 3FNGA 4LRCA 2ZTLA 4P5DA 2B9WA 1RRVA 1QG0A 2W8ZA 3MLEA 4CIAA 2PZLA 3ZLVA 3LHSA 2BMWA 2B5OA 2ZIGA 2HV8A 1JLEB 2WYUA 2CUZA 3KQPA 1MB0A 1UBRS 2H8KA 1LTQA 1YZTA 3QSYA 2GESA 2Y9HA 4KN5A 3IMQJ 3D0KA 4M49A 1XMOF 3LIIA 3H17A 4UMEA 5BR4A 3I0MA 1SPXA 5CNJA 4OGGA 4OBWA 4MROA 4UD2A 5F3WB 3C2PA 5JAZA 2OKCA 1RR6A 2HEIA 4P82A 2Q3MA 4HWRA 3WDMA 1OKKA 2C2WA 2CVQA 2YQ5A 5A0VA 3OJXA 3GFXA 3HHLA 1KC8T 3SHWA 4FFWA 1WEKA 3WLLA 1UBEA 4QM7A 3MZIA 2D7CA 3DXFA 1TMMA 3PEFA 4BQFA 4Q4JA 3DE3X 5F9MA 2AV6A 4JI1F 4R5MA 4J90A 4N5LA 1ZY2A 4N7RA 1V9SA 1XTBA 5ADUS 2DNQA 2X13A 4PG4A 2CDCA 5AHKA 5TT1A 5IAJA 1ZTTA 1ZCFA 1XWWA 1GDHA 3W8PA 3E0QA 4LFBB 5A8WA 1FWKA 1IAVA 3Q98A 2H0AA 2ZYVX 3O73A 3KJNB 4DFJA 4IGFA 4NZ6A 4ZVHA 5C25A 1SCNE 2JKYA 5J1NA 4F5ZA 5BN3A 4AJJA 2KTQA 3BWXA 3ZZZA 1MO3A 4ZPTR 4LHXA 3KRTA 3BEGB 2NZUG 1DC3A 4XKJA 2B1JA 4QLOA 3SWWA 4B31A 2P7IA 5HP4A 1PJ2A 1EXMA 1RLDA 3L9ZA 1G3OA 1S3GA 3CJQA 4UHJA 1G7CA 2B6NA 3SJUA 1FCAA 9ABPA 2EF1A 3AM5A 2DK2A 3UMGA 1O9BA 1I6WA 1X87A 5IH3A 1DC6A 4JLAA 4JMPA 3U60B 3COJA 1FTSA 2OCKA 1T26A 4IG0A 4PQAA 1VL0A 3R0ZA 1QIDA 2IIVA 2PLAA 3DLHA 2A5GA 2RHGB 5JMPA 3PFBA 3M2VB 3IRXA 3V6KA 3B9RA 4JFRA 1RUSA 3PM9A 2V0NA 1D0EA 1BRTA 3PQ8A 3HRKA 4L73A 4HB4A 4HACA 3GFSA 4JR2A 3Q10A 1ZTWA 3IQGX 4D25A 5IFMA 3OHSX 2OILA 1ODFA 4D9HA 1VM6A 4HQNA 3B7PA 2FKNA 1N7JA 1M33A 3CRVA 4KPEC 3LWMA 1DX9A 3R7NB 1RYNA 3BIOA 4FDMA 1JA1A 1T1GA 5BVGA 4CR6A 1KTVA 4QWBA 4C04A 4FOPA 4NDZA 4C0JA 1HBNA 2G06A 3UHAA 3ISJA 1Q14A 2R84A 1BH6A 1UQRA 4JI3F 3I01A 4DPLA 4CT9A 3QYJA 1ESNA 2JGAA 2GUWA 2ECOA 3FVQA 1ZI8A 4LSGA 3ILHA 1HM5A 2ZOSA 2FLOA 5EJ5A 3Q9SA 4ARAA 5AJ3F 2OP1A 5KDOA 1JBKA 1VQKS 4DFPA 1V8FA 1EHCA 3WK8A 2ZE5A 2HUNA 2QQ0A 3PXXA 4IZ6A 3CO0P 4W8OA 3HJHA 2WWFA 4KFRA 1LWXA 5FB3A 3QGPA 1QHFA 3QT5A 4Q4LA 4R0JA 4YYEA 1MQAA 2DY0A 3A3KA 1VLJA 2WRZA 2O2DA 4R8UA 3UGQA 4L22A 3KOYA 2YV4A 5AJXA 3COPA 3O5AA 1KI3A 5E3RA 2CD7A 3D4BA 3HE3A 2JEZA 1XRQA 1GU1A 4XUCA 2A9VA 1XBTA 5HIJA 1DQNA 3NOXA 4UJ3A 4P4GA 3W4KA 1MW8X 4B9VA 4N7MA 2PJDA 3VZQA 5CAEA 2J59A 4HRAA 1CDDA 5J5CA 1L7OA 3GSDA 3IKTA 3C39A 3DO6A 2E85A 4L3KA 2WUVA 3R5HA 2IW3A 1E0SA 3PNIA 5T8KA 4BO4A 1IZYA 3PGKA 2W42A 2HA7A 3W8FA 3F8WA 3NORA 1U2PA 3C5CA 3S4YA 2HMVA 3AO0B 5IK2A 3AXTA 3AKDA 4K3UA 3EM1A 2LXIA 3N79A 3CH6A 1PZGA 1JAZA 3LF1A 4TSRA 2AMFA 4D26A 4B82A 4U63A 4MB0A 1IEXA 4HVLA 2Z30B 4ZLPA 4YR3A 4F7VA 3GJ7A 2AZDA 3LT4A 3IBTA 2A2DA 2NTYC 1LBQA 4OD0A 2PT0A 1G6Q1 4KLNA 5ITZB 1P2DA 2XPCA 2DVMA 1VPDA 2B9VA 3REGA 3CEHA 4LOJA 2V69A 3R0VA 2YWGA 3TS1A 4BNXA 4MWZA 2ZRAA 1YHNA 3H2SA 1FYVA 1A8PA 3W5XA 3EXYA 3EQZA 1J22A 3HB9A 3ZV3A 3I96A 4URZR 5K0BA 3BKTA 1QHGA 4OX9F 1Q50A 2BFEA 3OFHA 5IDWA 3DFKA 1PZXA 3PFKA 3UBTA 1JJAA 1CW2B 1XFDA 2CXSA 4QWMA 3OU6A 1MN9A 3E1SA 2QMYA 1KY4A 3JSRA 3ROEA 3AVOA 3I9KA 5DI3A 4QU8A 3PNQA 3P2JA 3GRRA 4W90B 2ES4A 1JPNA 1DDGA 1K8RA 5L95A 4F11A 2W43A 1Y8QA 2VICA 4G8CA 4RIFA 4ECRA 2QMWA 4F56A 5JCOA 3T1NA 3B8EA 3JAKB 1EP2B 3R9KA 4CMEC 4D9FA 3TRJA 1R8BA 3DF7A 3TB4A 5CHEA 5FIUA 4LXUA 3RHZA 4X62B 1D4OA 2R4QA 2ALJA 4HMOA 4RL4A 4NA2A 3VC3A 1WVMA 4HN9A 5BV8A 4CF4A 2V7EA 1FS5A 4JEIA 4WK0B 2C82A 3UOGA 1OLXB 4ZJYA 1KQKA 4NU8X 1LRKA 4JP5A 1GXSA 2NSLA 3JQKA 1SCUB 5J2NB 5G0TA 3AHFA 1PZMA 5FULA 3R9WA 2V1XA 2X0IA 1EG7A 2B5WA 1CUEA 2HXYA 3TW4A 3JWHA 1V6AA 4GRSA 2OZEA 1QS0B 5DYGA 4H3SA 4IQXA 4ZAGA 2QAGA 3LCMA 4P75A 1X7WA 5B58C 2B6AB 1WF1A 3WIOA 3JXEA 3V42A 3K9FC 3K6SA 2GJ9A 4BKPA 2XE7A 4D5GA 2CCJA 2E9ZA 4J9MA 1LNSA 3OIFA 4KHPF 2I2YA 2IOQA 3BDIA 1U0JA 5AP9A 3Q8KA 4DKXA 5BMVB 3B1FA 2N1MA 1MO2A 4L4XA 3RKRA 2CJXA 3M9XA 1WTAA 1A2KC 3DVAB 3PRVA 2ERXA 2YQZA 3DYBA 3HZGA 4NX2A 4CT0A 5KJFA 1B15A 3H6KA 5IVKA 1JB0C 2YMQA 1N5TA 1AA1B 3OJWA 1KZ4A 4EPYA 1T3LA 1NN0A 4CMAA 2BR5A 2IVFA 5F1PA 4W9RA 4EUEA 3OR2A 4X3OA 3EY4A 3UGTA 2AU0A 1FLDA 2KS6A 3EK2A 4CFZA 1TO6A 1YZQA 2GFHA 4MO9A 3GG1A 2D0PB 1HW8A 5I8PA 3ZTTA 4KMOA 4UZBA 3O92A 4PWUA 1TT5B 4DR4J 2CJKA 3GFRA 4KH1B 3R20A 1RQGA 1SKUB 2CBZA 2DUMA 1HOXA 4C6HA 2MDAA 1N33B 3CGGA 1D4ZA 3L49A 1ECPA 3CEJA 4YC7A 1LPPA 1CJBA 3PYMA 3DLBA 3LPCA 3KZOA 1Q1BA 4HDKB 4WFXA 5CW2A 3AFNA 1JILA 3GLRA 1OCEA 4OFXA 1JNRB 4BMSA 2W9XA 4PRFA 3O03A 2CNBA 4G5XA 3IS3A 4OB8A 2HHHF 1A8UA 3ZJ4A 3DUFB 3O0TA 3FBEA 2B25A 5FA6A 4HNTA 4JOCA 3U48A 4DQQA 3RBXA 3O31A 4WK6A 4BNWA 3M4XA 1EIWA 3BSCA 1XR5A 3C3XA 4D3GA 1T4MA 2ZC3A 1E3DA 1FMJA 4DTCA 2GVZB 4OHWA 5JVGQ 4FFNA 1B4DA 4OQQA 4TTPA 1ZUNB 1FQWA 2X7HA 1YJTA 4CLHA 5LXTB 1JIQA 1IMJA 1OS5A 1R66A 4BX2A 3TM4A 4G0XA 3DQPA 3WLSA 2ZS8A 1R0ZA 4OXQA 2DLDA 1VZ2A 4EF5A 2QM0A 1P2UA 4DWOA 1OJ7A 2OVBA 4Z9BA 1HWKA 1BHJA 1FFGB 1M72A 2FHKA 4N12A 1K5PA 5DLFA 4W7SA 1E0KA 1G7RA 1S0UA 1LC0A 4YUDA 1EESA 1X0PA 4I50B 5JAPA 4AFNA 1I3OB 3R8YA 1C1DB 2A14A 4ED7A 3AERA 1BE4A 5TQVA 2PY6A 4F26A 2C9YA 2CDRA 2B7BB 1QYXA 3OPYA 5HJ5A 3OCCA 1VKJA 4FYVB 4WP3A 1PQPA 2C5LA 2CVEA 2CGEA 1QFMA 2G1PA 3T34A 2CNDA 4DCJB 3NYRA 4KYTA 3H2GA 2VJAA 3S55A 3CCVS 1AU9A 2X5KO 1YRAA 2J3LA 4BUJA 3JCZA 5KFEA 4Q4DA 3L9XA 3G89A 3CCZA 1ZA1B 3TNLA 2XMWA 3IRWP 4RZHA 1YJXA 2PD6A 5FTNA 2ZSKA 3DDWA 4X6LA 4AL7A 1FVQA 4OUDA 1GUDA 1VRWA 4URWR 1REVA 4HTFB 2Z56A 1Z4QA 2IDMA 3D3WB 4A1FA 3CEMA 3NHBA 2CNLA 3GLFA 1SIWB 4J9SA 4EHLA 4PBTA 1X1AA 4MV7A 1KN6A 3GJ3A 4USTA 3NV7A 4CR7A 1XF1A 1GKIA 2C04A 3NMUF 4H3KB 1ZBDA 1PJAA 3FDJA 5EMMA 1P6TA 2XY5A 4BMXA 4PYRA 5IM4A 1ENZA 3S2SA 3GPAA 1XMBA 3Q0IA 4HS9A 2GAIA 4QOHA 3QJYA 1JSCA 1EWVA 2V6GA 2GI4A 5F4ZA 4D9BA 2ZBQA 3EAQA 1OYVA 4QIFA 3HDQA 4H7IA 3QW4B 2VKTA 3OSPA 4F4CA 3FWZA 1Z7YA 3L2OB 1SULA 2OOSA 4GE3A 2RE8A 2X1GA 2ZJAA 2GXUA 3HNPA 4RACA 2NV6A 1VMKA 2C2XA 3ZWBA 1GMUA 1RMQA 2XT6A 4BLQA 3K8ZA 1GX6A 1E3SA 2GZRA 3KU1A 1AHHA 1WI6A 2KN4A 4G6ZA 3EVCA 3QKRA 5BQPA 2VPTA 1AUOA 4F3NA 4FGSA 4C7QA 3L7KA 2ZM5A 2XHCA 4NLOA 2W2OA 4NARA 3TL3A 3EDRB 1H0SA 2BE7A 1AV7A 4X1IB 1CK4A 2NG1A 1VHQA 5DDPC 4YJ3A 3B48A 4OIXA 3K9CA 4DQDA 1IZZA 2IJFA 2Z1DA 1C1BA 3CPSA 5EWEA 2H0RA 3FWNA 5TSDA 3WRXC 1ZMOA 3B51X 4JI7J 4MGEA 1TQ8A 1YBUA 2EJVA 2P1DA 4YONB 4X00A 2QYGA 2M6SA 3HMQA 3TCNA 3BQMB 2BGJA 4V0LA 2PKQO 1VSTA 1YDMA 5JJCA 1Q7BA 3BGIA 1P7VA 3Q4GA 3LQ1A 2AJ4A 1YDHA 3MMSA 3T9DA 2COEA 3C6UB 3D4LA 1Z08A 3USZA 3VF0B 5KTPA 1EFLA 4YO8A 5AT1A 4PO1A 4RWEA 1BIFA 5BSUA 1I2CA 4EOGA 1D6MA 2GJIA 1Z88A 5EUCA 1L7DA 3CXRA 1K0FA 2ZOMA 4LCBA 1KEEA 3OFKA 4NAHA 1W88A 5JAHA 3G82A 3OHMA 3WADA 2YHIA 2E9TA 2QN1A 1GY8A 4EG4A 4CLOB 1A1SA 1L5VA 2HHAA 2GSWA 3R7WB 1SZPA 4W7HA 4CF3A 1V1MA 4KGZB 1QB8A 4FFPA 2JLVA 3U4HA 5LA6B 5C4IA 3IV7A 1U0FA 1UC5B 5DULA 3G8AA 3M8KA 1MT0A 2ZE2A 1N9ZA 2CXUA 3QEBZ 2D9PA 3RQSA 1BWSA 1I3NA 1M75A 1V6HA 3WHPA 4BNGA 2Q3LA 1XVTA 3HL4A 2IH4A 1AA6A 1GMWA 2OOKA 1W30A 2QVXX 3IR6A 4M95A 2HHJA 3PWZA 2ACKA 1N36B 3EWNA 4ZT7A 4RNMA 4YRFA 1E7YA 3WV5A 1NJWA 4TKVA 3AVXA 5L53A 4Q3AA 5J2PA 4TMZA 2IA5A 2VNJA 2H16A 3L6OO 4HPXB 2WJGA 4K4UA 2IYUA 1TXGA 3QYAA 5KYYB 1ZESA 2WJVA 4H7JA 4R8SA 3U5TA 3ROZA 2DYAA 3KDPA 2XE6A 4FEAA 4JNKA 4MIYA 3KVVA 1O0BA 3ZD8A 3WC4A 1AUPA 4PX5A 1EFRD 1RYZA 4V2IA 2YJZA 1OWPA 2HLNA 3O21A 3A9RA 2J32A 2Z83A 3NOOA 1EJ2A 3GCXA 3A26A 3FPCA 4GC6A 4NLQA 1NNUA 4FZJA 2A1BA 4BLSA 1H9AA 1UVKA 2EZUA 2Q4EA 3R7SB 3FRJA 1TUIA 1UVIA 3ETDA 2KFZA 3WWZA 3GIRA 4J0DA 3L3CA 2PE8A 1QC5A 1NOKA 4J1NA 4H18A 3HVRA 1OT5A 2J85A 1TOAA 4HNRA 5KFWA 3OVAA 1XJ0A 3P26A 1PJRA 3GEIA 3DLCA 4UVHA 3M9WA 4KTTE 4F7WA 1MN7A 4DM3A 3HEBA 1QM9A 1Y9JA 3PJFA 3AR9A 4YJGB 4XB6B 4H7FA 1G64A 3GAFA 5JSKA 4D4KA 3RBZA 3TL2A 1DFIA 1XK7A 1H8HA 2ZLBA 3PDWA 4BCCA 3T95A 3SS8A 2ZXFA 2G9UA 1EJ6A 1ZQ1A 3RAQA 3IMGA 1WCV1 2VXOA 4F3RA 1UPXA 1HWYA 3ITDA 2FSVC 5BW8A 2RD5C 5C25B 4XGIA 3SC3A 2UU9J 4AYTA 3H4BA 5CLHA 4G1BA 4DANA 3VNSA 4G84A 2IA6A 4ZQBA 3NT4A 4QOEA 4BBAA 2CW5A 3KJVA 2Z5GA 2YVLA 3QOXA 2YW9A 4ZVNA 1GARA 2A5LA 2VBCA 4ZA1A 4QQKA 3PFNA 4J49A 4MS1B 3EQ6A 5H16A 1JG1A 1XT6A 1TTHA 3TNVA 1HE3A 1NU6A 2ATCB 4QC2A 1NSAA 1A2OA 5AVVA 4WRRA 1G7CB 3R3WA 1QZ3A 3GLQA 1FK8A 1F5SA 1P9YA 2EL9A 1A27A 4B0PA 3LDAA 2MR6A 1LPAB 3GJ8A 2ATEA 1JLAA 2LA4A 2RE1A 1Z8DA 3PR4A 1EE2A 4NU6A 5D84A 4AF7A 9LDBA 3AY3A 2IUUA 4J6EA 5C2JB 3IRXB 4F38A 4HGNA 2FVYA 2WHQA 3BMQB 4TXSA 3LM8A 4Y2SA 2YWEA 3N5CA 1UP1A 2FQXA 2PGLA 4B7AA 2GXQA 1IKXA 5A3JA 4I8DA 3QWPA 2VL1A 3A04A 3IKVA 4O2BB 4L9AA 3THWA 2HS0A 1ZU4A 4XFJA 4FS8A 1XFAA 5BV2P 2C7VA 3L8HA 1DBIA 2IM3A 5LZ4A 2ZU0C 4QJVA 3AJ2A 4X44A 2QY6A 1AY0A 1DFDA 5EWMA 4TL8A 3ENKA 2BFFB 2HW8A 2G6BA 1NLFA 2DZDA 1IPHA 2ZSIA 2AR9A 1BXGB 3BD7A 3KK3B 1R27B 3ZJYA 5CDGA 4YX9A 2WW4A 3KSDO 1VZ3A 3OZAA 4WA8A 4L2IA 1RFGE 3KFLA 3QFRA 3COWA 3T6BA 2EZ9A 4A8YA 2J8ZA 1S02A 4Q2MA 3TVYA 3S2ZA 1NVDA 1LDEA 3LJKA 3QVOA 1S6OA 1A82A 2E48A 4AMVA 1CZRA 5B6IA 1VMDA 1RWQA 1FS6A 2J9CA 2GT1A 3DGVA 3SHQA 4EKIA 1YB1A 2RGBA 3CZPA 1SZCA 3DMRA 4TTSA 2VQFB 2X22A 4M54A 3QRWA 1Q78A 2ZAOA 3RYIA 2QUKA 4G0VA 1THGA 4I1UA 3GRYA 4C87A 4ZRNA 3AJDA 4P6VF 1BQNB 3GFOA 3GLUA 3MM8A 4ZI3A 5EE9A 2BFOA 2C2MA 2JJQA 1K98A 4R3WA 4TYPA 1DXOA 1N2GA 4MVJG 2R8EA 4QODA 3U2QA 4LN1A 1RLUA 2CXPA 1XNHA 2Q4TA 1H72C 4INAA 1CVIA 4QFBA 1SC3A 2AWOA 2YYAA 1H2FA 4ZRMA 1AKEA 3RUHA 1GT8A 3MAAA 1HNWJ 3ANXA 4UQPA 3E61A 4N3CA 1EWTA 2AH5A 1OBFO 4BQOA 1VCTA 3G4SS 1E98A 1DQAA 4C78A 4B3SB 4BLWA 2RFLA 1LW0A 1ST2A 1VQNS 2P7HA 3S28A 2H6EA 4ZOCA 3CF6R 3EQ7A 3I30X 4KT0C 3FYUC 2C28A 2BZ1A 2G8NA 5TPZA 1DTTB 2I2WA 5B3KA 3ZNPA 1R0CB 4X9XA 5LZ5A 3K1YA 2B83A 3DULA 3E7PA 1Z22A 3AP2A 3IBYA 1FF9A 1RLTA 3NBKA 2O3SA 3FSGD 3P52A 3V32A 1FTNA 1TADA 2BFEB 3I37X 1IWPB 2J31A 2Y76A 1Z5VA 1PJ5A 2WZDA 4J0EA 3JQ8A 1D4FA 1JSZA 4XWGA 3TW8B 1QK5A 2DAPA 1CUUA 2IDZA 5HFNA 2Q3EA 5IJZA 3F8TA 1N9GB 1TL7C 5AI8A 4WKOA 1VYVA 1M6VB 2ZT7A 5KOHA 3BE5A 3MD1A 4P2BA 9ATCA 1IOWA 2KMLA 4US2R 3Q8XB 2FUG9 2G9VA 1KEKA 1JTFA 5K9ZA 3CLRD 3ED1A 1SKYB 2FZEA 2GLTA 4NR0A 1U2GC 2ZB8A 1UBNA 1D2GA 4ANEA 1S6UA 4KGXB 3KHKA 2VOEA 1XUOA 3W3ZB 1UKUA 3ZHCA 1A9XB 3NWRA 4GQIA 4TXJA 4MW0A 2MYTA 3PDCA 2P5VA 3OH8A 2JAUA 4XPEA 4LJ7A 1O97D 4RA6B 5EP4A 2QTTA 1UMCB 1LWCB 1M0SA 2X41A 4MRPA 1TUEA 3H4IA 2XTMA 2M3DA 4U9UA 4QZVA 2CNKA 3PIOQ 3KXLA 3MXTA 3KM0A 2LW7A 2Z5FA 3GGSA 4D1YA 3LBHA 1LFPA 1FDTA 1SCUA 5J2NA 4ID9A 1N52B 4BDSA 2XUIA 2W6OA 1ORRA 2WU4A 2DWPA 1E9SA 2AFIA 1QGYA 3FSYA 3K92A 3CIMA 1MG5A 4GWKA 1QS0A 1SCIA 5KSOA 2ILYA 3EUNA 2RK6A 2PGCA 1ZH6A 3HCBA 1A9PA 2CPZA 4IICA 1X7WB 2Y9PB 5CXSA 7FDRA 3ORHA 3HD2A 2IP1A 1MO5A 4DR7B 2XGSA 3P9CA 2QTZA 4XM1A 1DTSA 4YJ3F 3MPWA 3JVDA 1GGJA 3S01A 3T0IA 4P10A 2FPIB 3G96A 2B94A 2IEZA 2GLUA 5ICCA 2WFMA 2NLWA 4EZ6A 4RUBA 1B76A 1W73A 2V5VA 2V8OA 2QKYA 4LECA 1QQ6A 1HWIA 3SXJA 1EUZA 4ANFA 4QUJA 3TSOA 1GAWA 5DWVA 3RIEA 1S3FA 1SUDA 3DVAA 3LO5A 4IHQA 5FPPA 1J8MF 2K6GA 5E9WA 4EAQA 2EEZA 1VC2A 3C48A 3KLIA 4IFBA 1I7NA 2RKIA 1FDIA 2KXFA 5C53B 3S5JA 1KI8A 1M7BA 1Q86T 1UL1X 5J23A 4C11A 1L5FA 2FJDB 3OESA 2ZD1B 1FJXA 2HFUA 3EVAA 2FSGA 5BRAA 2Z58B 2ICAA 4Q9AA 1CR0A 2R4UA 5E3QA 5LBIA 4YT2A 3HUUA 2C2BA 2FQQA 4E5VA 4ILLA 4YS6A 2X1HA 4IO0A 1JB1A 3GRFA 1DRKA 1XLUA 1QQBA 2DJWA 4OVKA 1JHPA 1P4GA 2N9UA 4PXBA 1U3VA 4FDVA 2XGOA 1D9XA 4C89A 5JRJA 4JJ8A 4PIPA 2WT4A 1H1TA 4V1Ak 2PCJA 3D54D 3U27A 4DV4F 3T99A 4AMBA 2N3OA 1G1XA 3WHLA 1KSFX 3WLIA 2JI7A 2X0KA 4P4UA 1Q57A 1DRWA 3FMIA 2BW7A 3BQ0A 2VPYB 1TCVA 2BOAA 2I9PA 3L4SO 4QWDA 3GLTA 1SM4A 3IBWA 5IQQA 1QGZA 4L4ZA 3B89A 3ZXWA 5BYRA 4QUBA 4J16A 2OGWA 4X63A 3EVTA 4KQEA 3ESAA 4CO0A 1B8VA 4PYJA 2VK2A 1T2FA 1U8UA 1P5ZB 4NPCA 4PQFA 1ZM2A 3O4IA 1W7WA 2PXAA 4OTZA 2A5YB 3T1YF 4DV3B 1Y33E 3DBVO 1K4KA 1AFIA 1NQ5A 3AHGA 1G7TA 5SZHB 3AOAA 1H69A 5DHFA 3OTDA 1NW8A 2QGNA 4JR1A 1RABA 2FR1A 2HXGA 2WSYB 5DZ6A 1FRIA 4WCFC 2WJ6A 3PKMA 2B7BA 1NLMA 3I61A 2WINI 3F78A 2HCFA 2JRCA 4UW2A 3TUIC 3DGPB 5A4FS 1RLCL 3QKTA 1ZM7A 1U6IA 2XDQA 1NVGA 2JJ4D 3QMPA 3R3ZA 1QE1B 2FWIA 4OZ1A 1M76A 3SDBA 4KITB 1AQUA 3CRZA 4RR5A 3S8MA 3V6LA 5JFOA 2WILA 4HOYA 5E3IA 3G85A 1F60A 2H9AA 3LW5C 1IY2A 3HNRA 3VR0A 2PX3A 3WAJA 5H3HA 5AVSA 5AKLA 4LGYA 1G2PA 1RWNA 4IJ6A 4J7UA 1DJLA 4HL9A 2IQ5A