4NMLA

2.60 angstrom resolution crystal structure of putative ribose 5-phosphate isomerase from toxoplasma gondii me49 in complex with dl-malic acid
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
257
structure length
249
Chain Sequence
MNPQDKAKQAVGYFAVDTYVRSGMKVGLGTGTTAKFVVERIGQRMQEGSLKDLLCVPTSEATRKQAESLGIPLTTLDGIADLDVAIDGADEILPPTLGLVKGRGGALLREKMIAAAAKTFIVAADETKLVSNGIGSTGALPVEVVVFSGSHTKRLLSALPSVKRHGGRAEFRKRAGAAQEDIREEDRFVTDNGNYIVDLYFTETVPDLHEMDKELKSIPGVVETGFFLDLASVCLIGKADGSVATLTAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 2.60 Angstrom resolution crystal structure of putative ribose 5-phosphate isomerase from Toxoplasma gondii ME49 in complex with DL-Malic acid
rcsb
source organism Toxoplasma gondii
molecule tags Isomerase
molecule keywords Ribulose 5-phosphate isomerase
total genus 80
structure length 249
sequence length 257
ec nomenclature ec 5.3.1.6: Ribose-5-phosphate isomerase.
pdb deposition date 2013-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06026 Rib_5-P_isom_A Ribose 5-phosphate isomerase A (phosphoriboisomerase A)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4nmlA02
3.40.50.1360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4nmlA01
1LK5A 4IO1A 4L51A 1FQOA 3U7JA 1PSDA 2P9GA 2NYIA 2OKGA 3NWPA 1UJ5A 4LUBA 1FRZA 5IT0A 1HOTA 3DHWC 2WU1A 1NE7A 3W7BA 1FS5A 3LWDA 1U8SA 3AB4B 4GO5X 5T41A 3UW1A 2P9CA 4L50A 3BXGA 2PA3A 3ENQA 2JOQA 2RE1A 3KWMA 1XTZA 1O8BA 2J0EA 2LQJA 4GO7X 1KS2A 5IS2A 4OQQA 1JT9A 4TM7A 2MDAA 2QRRA 2CDQA 3MAHA 3CSSA 3BXFA 3TUZC 1YGYA 2RI1A 3BXHA 1Y7PA 3AB2B 3OC6A 4R7TA 3DDNA 1DEAA 1UJ6A 2BKXA 2QMXA 2F8MA 5IT4A 1LK7A 4M8LA 2O0MA 2H9ZA 2LVWA 2DTJA 3ENWA 1ZPVA 3LHIA 1YBAA 2W48A 4GMKA 1M0SA 4NMLA 3KV1A 3OFFA 3TUIC 3P96A 2BKVA 3S1TA 2J0WA 2RQKA 2I9SA 1Y89A 2RI0A 1CD5A 3NRBA 2FGCA 3E7FA 3N0VA 1PBTA 3NZEA 2DT9A 2QSWA 3DHXA 4L5JA 4OQPA 2RQMA 3TX2A 4L4ZA 1FS6A 3HN6A 3TUJC 3MTJA 5HJ5A 3AAWB 3CEDA 2P9EA 4R9NA 1UJ4A 1SC6A 1FSFA 3HHEA 1RWUA 3CH7A 5FIIA 1LKZA 3K5PA 1HORA 3OFGA 3L7OA 3EFBA 3OBIA 2QMWA 4L4YA 3EB9A 2PC6A 1VL1A 3E15A 4L5IA 2F1FA 2KO1A 3O1LA 4X84A 3ICOA 3OFEA 3DC2A 4PWUA 2R5FA 2JHEA 3ENVA 3LOUA 3OFHA 2GNPA 4TM8A 3LUYA 4GO1A 3BXEA 3IBWA 3IXQA 3MWBA 2ZHOA 5JJBA 2J0XA
chains in the Genus database with same CATH superfamily
2CZ4A 3PX7A 4YJ2A 2FC9A 4UMVA 3I9V9 4S35A 1K86A 2IS4A 3W2WB 1W49A 2GM4A 2VTDA 2JGDB 1DJMA 2X0RA 1GZ3A 4FE7A 5TDHA 2A5GA 4MQMA 4LOAA 3K0CC 3REFA 3RS0A 3C0KA 5AWFC 2IIQA 3ULKA 1ZOOA 3R0QA 3LQ2A 1KDVA 2ALZA 3MGBA 1O6ZA 1KEEA 2HL6A 2QTHA 2I4IA 3CX6A 5HSGA 5J4HA 3KDOA 5C5IA 2WNIA 3A2NA 1V5VA 1DC7A 4F0HA 3S6EA 1PWHA 5FL3A 1YE5A 2VK1A 4L78A 3NCHA 4DL5A 2GJKA 2BKUA 1YTUA 1SKUA 4G5YA 2QZZA 2Y1JA 4BIIA 1DRWA 3U2QA 4F4UA 1L8OA 3EPPA 3OMLA 4KRWA 2W8BB 3R1HA 4AG3A 5K6AC 1R7RA 4HYTA 4NPHA 1YH3A 1TGVA 3PVZA 5EN1A 2HJ9A 3EMVA 3KHHA 5SICE 1NHGA 3JD2A 2XUKA 5HN0A 4Y2IA 1ZETA 3CJKB 2N75A 1NKBA 3I0SA 4YPOA 2HPVA 5AJYA 1T4GA 4KXXA 3V4SA 4NXNB 4MAAA 2ENUA 4CV3A 3TLZA 3KSRA 3MM4A 3U7FB 1MN7A 2QM7A 2W24A 1Q0HA 4I6JA 1SELA 1VLMA 3C7CB 1TYAE 1R8AA 5H81A 3TOZA 4NIMA 2ZPAA 1LH0A 8GPBA 1C7JA 2OD9A 5LP6C 2GVNA 2GHIA 1R4AA 4ZT4A 4K0KJ 2IE8A 3WLJA 3S40A 1RIIA 3O8OB 3P32A 1NJZA 4LGCA 4RLHA 3T7EA 1FPQA 4M60A 2ZJ6A 4IJKA 2F1KA 4D4HA 2C5GA 5EXPA 3IBFB 3GP9A 3MJHA 1UW9A 3MR5A 3VF0B 3DBRA 4XI9A 2P68A 3FC9A 3THWB 2RB7A 1XCMA 3FNHA 2ZPTX 3ZEAA 2XDYA 4OGWA 3RRFA 2ZYUX 2R7RA 3WVNA 2BFCA 4Q3OA 2K1RB 2C59A 3G17A 3AUXA 2XKJE 2YV1A 4RJJA 1HPZA 2EX1A 2ZYDA 1BJTA 1T34A 4C2TA 5KSZA 2QP3A 3MTQA 1EH5A 5CPBA 3O8QB 1GXSA 3WRXC 2HLTA 1U1CA 1U2GA 3KU4A 4IFTA 2D0OB 3F5FA 1OY1A 2Y9HA 2MPUA 4Q9LA 2K3IA 1T03B 3G9UA 2BFEA 2ZREA 7MDHA 5LKAA 4RL6A 3C6BA 1PSZA 2YJ6A 1K98A 4LQCA 4LV5B 2YINC 1T8EA 4DANA 4LJSA 1V3QE 3PF9A 4ZLNA 2P8JA 3P4XA 4UM9D 1CQXA 4UC0A 4X3OA 1U0OC 3IPRA 4XEUA 2PH5A 2JLYA 2VFUA 3RFFA 2Y6VA 5GQSA 5KQSA 1D9DA 4JIGA 4OV6A 1KFSA 5DNCA 3LA6A 1NK6A 5BWNA 1ODKA 4HDNA 2YZ2A 4IVQA 2C83A 3IBCA 1DURA 1FFSA 1RHUA 4HFMA 3SD7A 1RSCA 4PTYA 4IGFA 2R8YA 4GYWA 4DB4A 4OM7A 3CR7A 3I9V6 2NQPA 3KAKA 4WESA 3QLHB 1Z6YA 3ELDA 4Q47A 4W5TA 1XPOA 1PZXA 2R87A 4X97A 3OT9A 2R1TB 5FOVA 1GNLA 1COZA 1KMNA 4KXVA 4PR6A 3VC1A 3E22B 1EVEA 2AL7A 4Z6KA 3QEMA 4K4TA 2AWZA 4IILA 4I2PA 2CUTA 2HHLA 3SGLA 1QTIA 3EWSA 2BUNA 3T6JA 4NWBA 2DT8A 2RHGB 3JQAB 1HKAA 1K6XA 1L7AA 2GCOB 5AW0A 2M7SA 3HCEA 3HYSA 5CFQA 3PD7A 1A9PA 3D2AA 1KPHA 5D84A 1YFJA 2HGSA 4CM8A 3R2JA 3R4CA 4AJKA 2EJBA 3TOQA 1YRLA 2A2DA 3U80A 4WZAA 3PEFA 4RD1A 3WGJA 3TZXA 1SUSA 3NGLA 2HAIA 3QLEA 3E81A 5L38A 3CZMA 3W4JA 1UADA 2RHLA 2RKBA 4PYNA 1N7JA 4B76A 1PL7A 1LDGA 2JCVA 4MV5A 3A4LA 3PXEA 3UO0A 1RGVA 2QLMA 1DJQA 2XTMA 1TL3B 1RBMA 1PJZA 2ZUDA 2JARA 1E1DA 4B09A 3KLPX 2YWDA 3NVKI 2MHNA 2CPIA 2I6FA 3HBAA 1UVIA 2H9YA 1ZA1B 5K0NA 4DQLA 2Y2UA 2EJUA 4B4UA 3PDIB 2ZJYA 2JFZA 3FBTA 4XVHA 2XNRA 2YNFA 1OAOC 5KWJA 2HU8A 5LJ3Y 1JKJA 5BSWA 3F44A 1WUJS 4D96A 1IY2A 5BPFA 3OQJA 4ZVOA 2R62A 1JQDA 4E09A 3HK2A 3T9NA 2OWDA 1EK1A 3ZHTA 4DDUA 2HRUA 4H6VA 5HVHA 2V63A 1YIAA 4A9AA 2AF4C 2M9KA 1U94A 3RFXA 2NU7B 3OQHA 4KQFA 2IMOA 5JZ9A 5FTJA 5B1EA 2BKNA 4R51A 4WL0A 5LMNB 4NX2A 1ZN2A 3OT1B 1FUEA 3QVTA 3CSDA 3ONFA 1E1RD 2XUAA 1PBAA 4JJFA 1YUMA 1P61B 1SCJB 4OI2A 2G17A 4B31A 2HMUA 1TO6A 2PX2A 3LGSA 3ZCPA 4WK1A 4OGFA 3THXA 3SX4A 3R5GA 3CNBA 2V3CC 3P7MA 1JLLA 3SHTA 4YFUA 3PR2B 4BQFA 4PPFA 3N9UC 3DOIA 3IP5A 4FFDA 3I72A 3IQEA 5T4EA 3X1WA 3TUPA 2HUNA 4M54A 2F8MA 3ETGA 2YWCA 4JI5F 2A9VA 1Z37A 1Z47A 5BNZA 1K08A 3S28A 3JAMY 2NZ8A 4EG5A 4AYTA 3G6WA 5AW9A 1U6ZA 4MYUA 1JLCA 1FDBA 2X2EA 2OBXA 2ZI3A 2X3UA 3QU9A 3LMKA 4ZLJA 2XUDA 3N0RA 4IJ6A 4O0LA 1S59A 4OMFG 3B1YA 3AK4A 4HGYA 3DH0A 2EGHA 4MR9A 4ZA1A 1D8ZA 2ECOA 4P2GA 4B3SF 5IM0B 2F17A 2B7BB 3BXGA 4LJRA 3DHEA 3QWPA 2PPVA 5FOTA 4M86A 3G9QA 3H1FA 3L95X 4RVSA 3QVXA 4RLEA 2YRFA 1RPZA 4LPKA 1C4WA 4QOIA 1H8EA 5BR7A 3IBYA 2B4VA 3WG9A 4X65B 2DTXA 4YREA 2LEBA 2NO1A 1S9DA 5IUJC 4MB6A 1JMVA 1E1RA 5DO9A 4P0TA 3LPMA 5B5SA 1C0LA 3CV3A 2M2IA 4BV2A 5AW3A 5KFFA 4ZYUA 4EZEA 4B9LA 4RUBA 2IYLD 1KIMA 4MJKA 5I3QA 4KWHA 1G5PA 3THPA 4ZHRB 1YQEA 5DBIA 4EVSA 2BJHA 1SBNE 1Z13A 4ZVTA 4TLRA 2I6UA 3BL6A 2XXBA 1BJKA 1U0BB 1E20A 1OA0A 5HQJA 5CXUA 821PA 3EZ6A 3QOWA 1KDYA 1JDUA 4MPJA 4M0KA 4TV9F 2WMNB 3RC2A 1XX6A 2COLA 2AOWA 1EE9A 3NBYC 4OOEA 1Z2CA 1EDEA 4B6EA 3PW7A 1X7YB 3M8SA 1TU4A 1CPZA 2OUGA 4JKOA 3FDZB 1LQ2A 1SM4A 3HI6A 3K1ZA 4GS5A 3SWWA 1X2BA 2Z2YA 5DTEA 5GADI 4ZI2A 3BMQA 3VDQA 4B46A 4E98A 2YFHA 5ES3A 4E3ZA 5H9WA 5EKSA 2XOXA 3VKUA 1UFKA 4AJ1A 2Q5LA 3BGFA 3SEZA 2FMIA 1JLHA 2ZKLA 1YWXA 2HQDA 4XYEA 2A86A 4MS4A 4D8YA 1TEXA 1Z6ZA 3LLMA 4YRSA 3RR7A 5G4KB 2VNKA 4LNUB 2VHVA 4YALA 4Y1FA 2OXIA 5JDCA 5BR8B 4G63A 3Q8SB 4Z9YA 2ACEA 4EYSA 3K73O 3DVSX 2WYWA 1OLSB 4ZV9A 3V81A 3FTFA 4WI1A 2EARA 3A06A 2WTAA 1IG0A 2EWMA 1L8AA 3A8TA 2PT5A 5CXTA 4Q19A 3VI3B 4IIBA 3S29A 2XWSA 1X8LA 3ZHQA 3GUUA 3GQVA 3A6FA 4RFSA 4N65A 1EFHA 5I7RA 4W5HA 4C88A 4OX9F 3RYCB 4LQ4A 5KFBA 1KU0A 3F7MA 1R8CA 1Q92A 1FDUA 3HJGA 3MT8A 1XJCA 3PVSA 5KX5B 2V7WA 3RHTA 1WDKA 1T2AA 2CD7A 1X0VA 3JVEA 5UKDA 3RT9A 2GI4A 1TTQB 1SZDA 2EWWA 2JIZD 1E8DA 4JSYA 4AG6A 3KZMA 3J81A 1TUWA 2QL9A 3WMFA 1Y6ZA 2E4WA 1VHWA 3KX2A 3KHUA 4WERA 4INOA 4MQBA 4B84A 2XGJA 1W94A 1E32A 2J4CA 721PA 2HPHA 3ZTTA 2JDID 2R8GA 5LOVB 5LMZA 3GVCA 3R40A 4LF6B 1NRWA 4IYJA 4YP0A 1TF7A 4F6LA 1XCBA 1CY7A 1GAQA 2LDYA 4DPYA 1Y3DE 2WT4A 2ZJZA 4I68A 4KBIA 4AK9A 3S2EA 1N1DA 4GKBA 4UBMA 3OR2B 4CUZA 2REXB 2FFQA 1XYVA 4O0IA 2BMFA 1KOGA 3MGGA 3HMJG 2VAVA 4JAVC 2C29D 1G21A 3MAGA 4GMHA 4M9QA 3PW5A 2CJBA 3OT4A 4FR0A 4H77A 1KFEB 2F3JA 2C1XA 4P08A 1R6XA 2IYXA 1EBUA 3P2JA 2CK3A 4ZRNA 2FPIA 3V4VB 4MJ3A 3NVMB 1I0IA 3HDVA 2JASA 2M6KA 1VK8A 3PACA 4EWLA 2NUBA 4D9FA 3FZNA 2GDZA 1R8QA 2DHRA 2WSBA 3STUA 1LW7A 2GS8A 1HOXA 1O08A 1T9YA 4DV2B 4G1IA 3MMCB 4L72B 1C0UA 2DY1A 5GVRA 3DOJA 3WJ2A 4GD3Q 5C1BA 4CI0B 2EQ5A 4XWYA 2BMAA 4RWXA 2W6PA 1RQRA 2HQCA 2W37A 2OUKA 3CNQS 5LWQA 2R7XA 2PM8A 5A2QY 4D99A 1XU7A 4B3FX 1OX5A 1BMFD 1CXZA 1E6VA 5TMEA 1OE0A 2H5EA 3W2VB 2LE0A 5HZGA 1I32A 4D3ZA 5GIPE 4C3LA 4P53A 4EY5A 4M63A 2HMIA 2PC6A 1JWLA 4MX8A 2VG7B 4RYDA 1P3DA 4ZV4A 3MJTA 4U63A 3NIFB 3UXYA 5L3QA 3HM9A 5A4IS 4M9XA 2EKQA 4BWFB 5A9TA 1UMBA 4N7RA 3MB5A 3DM2A 4ZO8A 2EZ8A 1GR1A 5HJ2A 6FDRA 1YRUA 1DDOA 1LSOA 1SV5B 3QVSA 3CDEA 2A14A 1Q0UA 2HZCA 3ORRA 4DA0A 4LRBA 2C3MA 2DNLA 5IJXA 4FKZA 4FF1A 3SS9X 4HUJA 2QRZA 4O3MA 1IJFA 2GBPA 1ZLYA 2BISA 1PC5A 4QZVB 3DOHA 4U7UD 3QXCA 1Z45A 1J0DA 1GZVA 4JEHA 5FYQA 2XIJA 2VF3A 3DWFA 1Z82A 2GJAA 3LCCA 5LDHA 3F9IA 4US0R 5LJIA 1IXYA 1WF0A 1LF0A 2VDJA 5ER6A 2YY6A 3V2HA 4QULA 2QR5A 1XP8A 2ZETA 2CL6X 3PK0A 5EE9A 3AKZA 4LZPA 4RSGA 2EP8A 1QYVA 3JQ8A 3W06A 3E3NA 3TB4A 3RS5A 4MGZR 1CUSA 5DX0A 1HBUB 1EVYA 3BWEA 2H54A 3OFGA 2VF7A 3IAS9 1JA9A 1AGNA 2VEDA 1LBQA 1QD1A 5FFFA 3HJAA 2F3QA 1KO8A 1KJ8A 3AVUA 2E4XA 2G04A 3WNQA 4PBTA 1M0TA 3KOZA 2VPTA 3FY4A 2DPIA 2YOHA 4FDAA 4AS3A 4M1KA 2WW8A 2FEMA 1I3LA 3FCWA 4ZPDA 2XZPA 1Q5PA 4OHCA 4EU0A 2H2FA 1I3OB 1SVMA 5HRCA 1J2VA 4WN9B 1P1TA 1HR0B 1AZLA 4H4MB 4L2IA 5KKNB 1U63A 5A8WA 1FNSA 4ZDWA 2CAJA 1X8KA 3L7JA 3FJ1A 3PTLA 4Y2SA 4DHVA 3W2GA 4A82A 4M9ZA 2V3WA 2XQVA 2LPMA 4NS4A 1AQ6A 1RHJB 1UINA 2LIPA 3VHXB 1UETA 2EPIA 2O8DB 4QTUB 1AUVA 1S3GA 3LT4A 5F76A 1JLFA 4Q34A 1KSFX 1E6MA 4LDPA 2NSHA 2EYQA 5REQA 3R3ZA 2B4UA 4B32A 1C3OB 2KMLA 1YQWA 1OIAA 1B15A 3NMRA 1GH8A 5ECGC 3WSWA 4PC3A 1IY8A 4ZICA 1RACB 2IOFK 3B53X 3EMDA 2AGVA 1JEQA 2AJQA 2YHIA 4BNMA 5BW8A 5IVPA 1FDAA 4ZQEA 2WW4A 1OSDA 1G8MA 2ROPA 1VG8A 3OUUA 1MAVA 5GVSA 4XWAA 1YFZA 4G24A 4W5OA 4KR3A 3TNYA 1XMQJ 1QP0A 4UATA 3JZMA 4QDKA 4XM0A 1NXIA 3OTEA 3D6MA 2V68A 4PLYA 5ALPA 4DJFC 1RISA 3AODA 4QUIA 3CD0A 5T4FA 3FMOB 1FP4B 2YXEA 3ZI4A 4K0KB 4IYQA 1M10A 4P9NA 2K5UA 2DWQA 1S49A 2VU5A 4CQJA 1MKYA 1NT2A 3E51A 3T7KA 3SHWA 1VC5A 2P6RA 2VOJA 4KXUA 4FMDF 4I7EA 3OO0A 3ZWBA 5KJFA 4KFTA 3OUYA 4YRJA 3L8MA 5IAJA 1OH7A 4R8SA 2XZDB 4B2IA 4RCVA 3R1IA 1OPRA 4QSHA 4O3RA 1GSIA 1GVHA 3KYCA 1P19A 5EPOA 3FRYA 3TIGA 1E1MA 5JCJD 1MO2A 2ZHAA 2FPUA 1N8TA 2Q2WA 2IA0A 1PAEX 1VLLA 4LOJA 1RE0A 2G63A 1P27B 4RKQA 3UE2A 2G1KA 3B3QA 2PO4A 2ZJ7A 4ZJZA 2HVDA 3WGOA 1P31A 5H3LA 4LSLB 4ZHQB 1JR2A 3E2EA 1AG9A 3I58A 2ASYA 4IR1A 3BMOB 4WE1A 2O48X 5DGXA 1E66A 5DJ5A 3U81A 5HMLA 2QRHA 5ITZB 2EJTA 2ZWVA 3FBFA 2JHCA 3QFSA 1XMSA 2D0PB 1FS4A 1RU3A 1UBCA 1VGQA 2RD5C 3PUJA 5DBOA 3LBNA 2A9KA 1QQTA 4OBBA 1OUMA 2HK8A 1EAYC 1N6QA 4FFRA 3UA4A 3WWPA 4QIEA 1IBLJ 1G19A 1QU2A 4PG6A 4WCDA 4L8WB 3MPWA 3C3BA 4XX0B 3GEEA 1YVFA 1F5AA 1KC3A 4MP6A 4UPDA 2E4VA 5EIBD 3STVA 5GTDA 2YCBA 4BDPA 4DV0J 4UNIA 4JVOA 1SA0B 4M9RA 1NBEA 4PYKA 2FJUA 3O4FA 2X1LA 1LW6E 1XMVA 1YBFA 4Y2HA 3OTBA 2K2WA 3WRWA 3WIBA 5ALFA 2YBVA 2QGFA 4GKKJ 1E94E 1RWPA 5IC6B 4USIA 4ZP1A 5KNDD 5EXTA 4R5MA 1EKXA 3X1ZA 1PCAA 4HX5A 1DNPA 4YDDB 2OCIA 2UZ1A 4E08A 3OM9A 4WCFB 4WLVA 3KTAA 5U4XA 3ADDA 4G2NA 5K3CA 3Q89A 3VCDA 1HNXJ 4WNAA 3VAKA 4F2HA 5KFIA 4MUAA 3CKKA 3P5SA 1P0CA 2P2DA 2RQ4A 1SKYB 4Z49A 1WUHS 5D3GA 3JQAA 1XXHB 3D43A 2JI8A 1XA0A 2C9CA 3WWZA 5FOSA 1MB3A 4L1KA 4Y1GA 1RKJA 3O26A 4P81A 3VXKA 5F8NA 1TEZA 4AY3A 1K8RA 1HO3A 1JW9B 2XV1A 4J2TA 1Y9JA 3DMTC 5HPYB 3P4UA 4XM2A 2RBEA 3C3XA 3MEEA 4RV4A 4IOJA 3SFVA 2B4RO 1LWEA 1D2AA 1HDRA 1W25A 3WLKX 1P5HA 2ZJ0A 4HD8A 1ZBQA 3BORA 4DFKA 1N8KA 3RB3A 4W82A 3FYHA 1X86B 4KNYA 5E38A 4TGLA 4CKCA 1P9RA 5TNXA 1TOAA 2A1UB 1U4OA 3RFUA 1HI1A 1P8GA 1C1DB 2CVFA 2FWIA 3UB2A 4ZO4A 4RFVA 5HEKA 2DH9A 1Y5RA 2HNYB 2Z8XA 3CO0P 1Z16A 2JC3A 2ZTVA 3WLAA 2XE7A 5JS6A 3Q8KA 4GLJA 4RKYA 1G6HA 1OJ4A 1NVFA 3NDPA 1P29A 4MEAA 4KXYA 1HYSA 1AHIA 2OPBA 1Z2AA 1N34B 5I8PA 4MR7B 2WY2D 4KO3S 1I30A 2VXCA 3NS7B 1GSAA 4RK6A 4QSMA 4DQIA 1X0XA 4FS3A 2A84A 3FUWA 1L3BA 4EFKA 1R66A 4IIJB 4ILRA 2F1RA 4OY3A 1ZM2A 1ESDA 2B8NA 1DKPA 4LRAA 3P9KA 4G41A 1JG6A 3PL1A 3OVAA 4RKUC 2BJ1A 4OYWA 3K8QA 1QZUA 3TRHA 1V6CA 1HHSA 2CWWA 2VCYA 1Z28A 1SIWA 1KMCA 1Z15A 5FF9A 4YECA 2V67A 3WL3A 4ILMA 1FYVA 2O1WA 4REOA 2LQ9A 4L0DA 4NCIA 2DNNA 3PF8A 3ZCUA 1S5ZA 3LVQE 1KF0A 1CR2A 2JJ2A 2FUG6 1YITS 1H7XA 5C37A 4YMVA 3ESRA 2BKOA 1CJUA 3LSYA 3HF5A 3QKWA 4AYBD 4J0IA 2IUYA 1VRUB 3D3EA 4MVJG 4TMZA 3WRYC 2ZOGA 1D2MA 1SBYA 4IV5A 2QTZA 3K8WA 3VAIA 3RC9A 4KPYA 1N92A 3OOSA 4WCVA 2R48A 2XCIA 3BEDA 4DPTA 4GM0A 2FG6C 4HVZA 2DCUB 3BTUA 4DV7J 1VA5A 2AN1A 3W8EA 3RIXA 4DFDA 4HDAA 2OEJA 1OZ0A 1FE0A 3VOSA 1WB9A 1T9CA 5A04A 3L0OA 2XTJP 4LTNA 3KLMX 2AD9A 1GPMA 1N9GB 1RSZA 4O3FA 2P4HX 1FFBA 1OPZA 4OZ5A 3EXFB 3FM9A 1HYGA 3VNAA 4IZHA 2AA3A 1Q0LA 2IITA 1I4LD 4EABA 3LAWA 2LR0A 1NXTA 1NOKA 1W30A 4A8WA 2ZSJA 3OPXA 4EAAA 1EESA 1KAGA 1MN6A 4V3CA 1C8KA 4OHUA 2H54B 2JLGA 1OKKD 5HHTA 2DNPA 4H27A 4YCSA 1WNTA 1FRXA 3W8DA 5HIJA 4FFPA 1K75A 4WLFA 1HDZA 1D0VA 5CB4B 4FXPA 3GB9A 3RSHA 4JI6B 2F8LA 4EHIA 1RT5A 1GL3A 1BXRA 5CT8A 2RHOA 3KSZO 4LWZA 5JI3E 1JLAB 2QNBA 3RBZA 5IP5A 1YDMA 1G21B 2GAHC 2D1QA 3TX0A 5SZKB 1S8FA 5DIFA 4JI0F 3E05A 2HU2A 1AW0A 2BMWA 4EBFA 4WT7A 2OENG 4ZYZA 5C5DA 2X1AA 3CZRA 1Y7TA 4XX0A 1B4DA 3OR1A 3OPVA 5KFWA 4NENA 1WCIB 2FUG1 1NR5A 2G8LA 4KJZA 4L4YA 2LU1A 1RHMB 4UREA 1NSTA 4F4XA 1DS6A 16PKA 2BE9B 3CT6A 4MV9A 1FFYA 1RAIA 5E6SA 4KQJA 3N8NA 3WQHA 1NJ2A 3HVJA 5EMJA 1E3JA 4JEIA 3RANA 3OQOA 4XQCA 2AH5A 3WYEA 1ITZA 1Q6ZA 2VAXA 4LJ4A 4D9JA 4DR2F 1JPVA 3MURP 4ZJOA 3EGXA 2YH1A 1CS4B 2CLDX 4TXMA 4DIEA 1GNVA 3EMKA 3OQ2A 3GFPA 3FB1A 3I2FA 3VVTA 1CETA 2JIOA 2M88A 1XZJA 4HOYA 1AV6A 1XTZA 2QA4S 1SCJA 3GA5A 4HAWA 1IQZA 4EYOA 3W3SA 4KNWA 1T4CB 2PO7A 2XMMA 4NL4H 1R5BA 2GCNA 2FFRA 5J40A 4D7AA 1CJVC 4UTGA 1ISMA 3V9PA 3GTYX 5FKJA 5D2CA 1UMBB 5B1DA 2DTJA 3N6LA 2FJEB 2ZATA 5LVAA 1HRDA 3DGPA 2VF5X 5IMBA 4F4ZA 3QJ5A 5D4LA 5IC4A 3E01A 1NSQA 3WYGA 4TKZA 1NVMB 1GPBA 3AY0A 2BABA 1JJFA 5HFJA 4Q18A 3EUNA 1XIQA 3FFBA 1VGVA 1X6VA 1XALA 1JFRA 4S3MA 4URQU 1H2AS 2QLNA 1QRAA 4MRMA 1S0VA 3WQQA 4YLGA 4GI2A 2WONA 3BDIA 3NMAA 1TW3A 3M1IA 3OZFA 3HXTA 5KT6A 3U3ZA 1L9XA 1ZNWA 1CQIA 2P9GA 2ZRMA 3FVTA 5ICFA 2NZXA 5FD1A 3CKMA 1WPXA 1ISFA 3SP1A 1B42A 3AY6A 3PGMA 3PWZA 1E6YB 3KEMA 3U1BA 4DCPB 3PUYA 5BT8A 3SCLE 1ONOA 5DOZA 4M95A 4CG3A 1M8FA 1P62B 2F43B 3OQMA 1FNBA 3DM9B 3BWYA 4RLQA 4OU4A 4MR7A 3ZWCA 3U0VA 4BJ6A 4OI0A 2RGBA 3BMNB 4CO2A 1UODA 1SC4B 4TSFD 3KJHA 3AKEA 4CGYA 4Z1OA 2CLKB 4IIHA 3FWYA 2ZBCA 2G76A 4UDNA 3HJCA 3EW9A 1HZJA 1T6XA 2BZ1A 1TL3A 1Q7BA 5LYJF 2YQ5A 4I9UA 3UT0A 3MJ4A 5BWMA 3D3BJ 4JNCA 1HE8B 5B64A 1Z39A 2IYZA 4MQLA 3F3SA 3GEPA 1XWWA 1THGA 2RGYA 2R8EA 3TNVA 1YL7A 1PFGA 3CGWA 1E4YA 4EYIB 2CQ2A 2WOMA 2HKEA 1UT8A 1RYDA 3J7YI 3OJXA 3TXYA 4LXHA 1BS9A 3FK4A 4HDOB 3UV7A 1R5NA 3UOWA 5LXRA 3PC4A 3PG5A 3V2GA 2BRLA 3CD7A 3JZDA 1GRRA 3AF5A 1NJ5A 2WVAA 3AGQA 2JA1A 1SB6A 2HX1A 3KQQA 5C25A 4CFYA 3HRKA 4WBNB 4KXLA 1WMEA 2XBUA 4K9KA 4LV6A 5BV7A 1Q7YT 3BE6A 4DXDA 5I7FA 4Q0BB 3DTVD 3FIJA 1IEWA 2YKPA 3LO8A 3OT1A 4FUQA 2Z3VA 4USKA 4IGAA 5K6TA 1JYEA 5A5GA 3B6KA 2ZD1B 3VZPA 3E2MA 1FFSB 4FBMA 3ZD9A 2DK2A 2Q3HA 1TF2A 3LUJA 2HMIB 1ZRMA 4JC8A 4L6AA 2XGSA 5HVNA 1OGJA 5F21A 4OH1A 3GE9A 2DPJA 5F52A 3R8FA 5TLSA 1O5JA 5GAGU 4X5OA 4DS5A 2Q6TA 5L3RA 3HLYA 3DM2B 1K9MT 4LSMA 3U3RA 4RCZA 2VF8A 2BM1A 4HQ6A 5F35A 2GPYA 3U49A 1MMDA 4DXAA 3DKDA 3D8HA 5KAPA 3LSTA 3M9MB 4I7FA 1UDRA 4LDQA 4RHEA 2HBQA 1HTWA 2R4UA 3EASA 3GFFA 3LIPA 3AB4B 2D59A 3ZW8A 5EPUA 1EWKA 1LSUA 3MOJB 2B35A 2V03A 2GKSA 3ZDEA 4R5PA 2GS9A 1QHFA 3CXCR 3CPHA 1DJOA 3IX7A 3NCTA 2H4YB 4R98A 1DKUA 3R7SB 4O23A 1SJ3P 2XTAA 4DCMA 2HGMA 4CLOA 3MTBA 3QIVA 2ZAIA 2H5JA 3I1IA 4G1MB 1W6RA 4XJXA 5I3UB 2XCOA 3RS9A 5EG5A 4AJLA 1NH7A 5IM0A 1JT2A 3MM9B 3GUYA 1IVYA 1LWCA 3H2VE 4PQFA 3DKIA 4IOLA 3SIRA 1YHYA 5BVHA 3F9RA 2Y93A 1QS0B 1CR4A 3MCNA 1ZCAA 1SKBA 2QB5A 2W4CA 4JJAA 3ROKA 1B0VA 1IEQA 1YK9A 1UEXC 1CV2A 1UKVY 3VU0A 3JZFA 3DC2A 3X1MA 1MFPA 1V6SA 5M04A 1S6PA 2Q1SA 1LK0A 4HL6A 4ZU6X 1GG5A 5CABA 3UJHA 1EVLA 2MDTA 4OQJA 1DTTB 4IO1A 4UY8T 3LDAA 3D2BA 3WGIA 4JLVA 1Y3CE 3TZQA 1SJFA 4ZVPB 2O2EA 2HJSA 5FI3A 4L2IB 4S24A 1TAUA 4G0UA 2HK6A 1Q8KA 4GLLA 1KQPA 4ZT7A 3MWEA 4HHEA 1WKJA 5CCBA 3UTDA 2F3PA 4K9PA 1D2RA 2YWHA 1GFSA 4DIMA 3GWCA 4INAA 5TPZA 3ZS8A 3F4KA 1OROA 4KBGA 3K5MA 1TVRA 4ARUA 2UUAF 1JR3D 2CHFA 4B7ZA 4PWYA 1R27B 1U8AA 3MWGA 5KC9A 5KYYA 3TZZA 1E0DA 4A48A 3IGFA 3JQEA 3GUHA 3BKXA 4RJTA 3N5FA 4MUHA 1PGPA 2KN4A 2ZPUA 4FDUA 3CN7A 2OJ3A 1HWJA 1I3MA 1OIXA 4DWIA 2WFMA 4E21A 4PYMA 4ZVMA 1HNWB 4YR7A 4OQMA 3DSRA 4J9LA 5F64A 4UEWA 5IJ0A 1GAJA 3SC6A 1NN5A 5BN5B 4JQYA 3A6HA 1U04A 1MORA 1D6JA 1VP3A 1J23A 3UJBA 4ZK2A 5GVQA 1EFVA 2YNMA 3AWIA 2I2WA 1Y8QB 3UAVA 2F43A 4DV3B 2NP7A 4F25A 3UCGA 4PBSA 2I34A 4LTDA 3U60B 2I6QA 3EGDB 5C2GA 2GARA 4C48A 5JIBA 4FYVB 4DR4J 3HEBA 7ADHA 2FKNA 1XNRJ 2EFNA 1EQMA 2C7QA 1OZFA 2A4KA 3FN4A 1NH8A 3NHRA 3CW2C 3B6MA 3ADOA 1KYWA 3QLUC 1ZFNA 2PZKA 2VA9A 2BUCA 5AK0A 1CIPA 1XZPA 1IDOA 1EETA 2QPOA 2RQMA 3AVOA 2Q1YA 1OWOA 2X8LA 1BXNA 1BKDR 5C7LO 4W5JA 2F9FA 1DV2A 2K8GA 1NBMD 3ASZA 1PVOA 4JYAB 2OK8A 1KEWA 3QYJA 1KK3A 1K92A 1XTJA 4JYBA 4HPXB 3W1VA 4IFVA 5ALOA 2O5CA 3H7HB 2B69A 4WWHA 4CLSA 3TANA 1XMPA 2TYSB 3ITDA 4IKEA 2FEWB 1VQLS 3CU5A 4TL7A 3A7DA 3CN9A 2FVPA 4XR9A 4HR2A 4Q4CA 4DJBA 5H4HA 2SECE 4TL9A 3BGVA 2AB0A 3DF9A 5TX7A 3HJHA 3IMCA 4ZAYA 3CCBA 1VXOA 3CUTA 1GPDG 5DHSA 4DWWA 2O8NA 3RC1A 3I0ZA 2YDYA 5FQOA 3FNGA 1GTJ1 3TEGA 4YY3J 1PK9A 3AJEA 3EIUA 2FPIB 4O25A 1XE3A 3AOCA 1YLXA 2E6UX 2P2ZA 2IA6A 2JA2A 1AY0A 2LDIA 3CLKA 2FR8C 4KKVA 3RSCA 3KHLA 2Y92A 3ILJA 1B16A 2HA5A 4CM9D 3QK7A 4L72A 4ITSA 4W5NA 3ITHA 5ITHA 3ETNA 3OEWA 4XDDA 5ALUA 5AVVA 1DY3A 3IJ5A 4H54A 2O7RA 1FUKA 3T1YB 5JEDA 3AR7A 1BRMA 1YFKA 3PFKA 3CVYA 1I5OA 5KTKA 5MN5A 1P33A 1E6CA 3LXUX 2A9QA 2NYIA 2W0SA 4QXPA 1VQYA 3UN5A 1EXDA 1Q16A 2FEAA 1N75A 1UP1A 1XVVA 1QX3A 1Y4AE 3IAUA 3WB9A 4E0DA 4LVNP 4CLOB 3UF0A 2H1SA 5BUQA 5A7HA 2RHQB 4IMRA 4GKAA 2PBFA 1RQPA 2G1DA 4XWGA 2Q6KA 2ORIA 3ECCA 4RGVA 3AF4A 5C32A 4YO7A 3SEAA 5F9NA 2MU1A 1UFRA 2Q8NA 2UUPA 5KFTA 4KZKA 4NBVA 3UVJB 1W9MA 2JJ4D 3EVAA 2GT1A 4ZDKA 1NNI1 1RT3B 4H3HB 3GR1A 4OA5A 5JR3A 2VBXA 2EIXA 1HG1A 2DNRA 1C3VA 3EVBA 4MW6A 4MVJE 2ZDQA 1TKDA 1QIIA 3W9YA 1GR0A 1P2FA 3L7KA 4QZVA 2CUZA 1GG9A 1WEKA 1H6KX 3UUWA 4CKCB 5HMXA 2KWIA 4I66A 3T1TA 4OM8A 3AFIA 1DQAA 3ZNNA 1GT6A 3HFRA 3TIVA 1FWPA 4XFKA 4LF8B 1KZ7B 4HAIA 2PXXA 1GXTA 5GIOE 3KTDA 3ZWOA 1T6ZA 1V35A 3Q87B 1BDHA 3EICA 2VHZA 4YDHB 5KTPA 4XWWA 2YZNA 1BVYF 2RDIA 2F8SA 1NSPA 4ZPXA 1JHMA 4D97A 4F6CA 2W6ZA 3QMVA 5I7WA 5DYTA 2P9TA 4X20B 2H51B 3VMMA 3H2ZA 1X4CA 1UVKA 3IUYA 1W34A 4I36A 1T2VA 3RVDA 3K94A 3MWLA 3TA2A 4U39A 3CXUA 3MGKA 1TMOA 1YG0A 2Q2NA 5AUNB 1RWKB 4KWEA 4U2CA 4I5GA 2HFJA 2AD1A 5FWAA 1NXOA 4MS1A 5LCXA 1I8TA 3ZQUA 3QQ5A 1Q4RA 3C14C 3B5JA 4NDZA 5HZHA 1M3SA 2PRJA 3Q98A 3C3WA 1TK9A 3NNSA 5C7IO 1RWBA 2QBYB 1U6JA 1P2DA 1N2SA 4USUA 1UK6A 5E1MA 3QLHA 3M6LA 1WDLA 1FDVA 3BSYA 3RVKA 2P6PA 5CXSA 1ND6A 5F8LA 2D3O1 4F71A 4KR9A 4UDOA 4J9PA 1PNRA 1LWFA 2QU8A 3C74A 3JALA 2CQDA 3D0GE 4HQRA 5AKIA 3POTA 3E22A 4WEQA 1QQBA 3KJQA 5GPBA 1FXLA 5L4NA 4ZOAA 3ZXUB 3AW8A 2K7FA 4CYMA 2VSXA 4GUAA 4EPYA 1HY3A 2G77B 2XNCA 2ZS8A 3IAS1 4AQYB 5AI0A 4W8OA 2IRXA 4DV7B 1IN4A 1KYTA 4CLWA 1DOZA 4WKGA 4GOKA 1J9ZA 1EVZA 1P91A 4CG2A 3SKVA 3D4BA 3P5TL 1Y6QA 2OV4A 1VPWA 3DE7X 3HXQA 1Q1AA 4EJSA 5K14A 2HNZB 4JLAA 3GGJA 1AQJA 3DLPX 3D6HB 2JSXA 2RJOA 3IKMB 2A3NA 1ZR4A 4ASUA 3O3OB 3MUEA 1UJ4A 1L4BA 2ZKUA 1F6DA 2DIUA 3V81B 2PS0A 2W6IA 3WK6A 2O7SA 3KZVA 4MVCA 3RU0A 3K05A 1IKVB 4IG9A 1TL1A 1KH2A 4AICA 2JD2A 2XVMA 4QG3A 1KTQA 1D4FA 4B6OA 3MJEA 4DGQA 4Q9JA 3FFXA 4A8TA 3A1EA 2VC2B 5CTAA 5P8WA 4DV5B 3VU3A 1SGWA 4GPEA 4L9SA 4Q3KA 2J3HA 2VONA 3AR3A 4PX2A 4JOSA 4IUBS 3LQVA 3HKBB 4P71A 5KC8A 5K0JA 4P8RA 4CCYB 4DRYA 4ZEMA 2HU7A 3D8BA 2DR3A 1L0BA 2ADOA 5EP3A 5I9IA 3GLKA 3O2NA 3BWCA 5IZCC 2BM0A 3S6JA 2HK9A 2KYXA 3FZEA 4I3FA 1RMQA 4NZ9A 3CCSS 1E60A 4P86A 2V1UA 2R3SA 1SWWA 5EIOA 2GZMA 3EIQA 1BRTA 5CJJA 1CY4A 3T4UA 3VPBA 1VFPA 3PU6A 2QGZA 2ZSEA 3BSSA 4Y6IA 2BXJA 2R1ZA 1NQ5A 1CZOA 5CYOA 2GNPA 2XBMA 1R0SA 3NV9A 4FXVA 1E7SA 2KBFA 3MTIA 2PLFA 2XQFA 2BFAA 4MB2A 4AMZA 5KFHA 2YXDA 3P94A 3GMTA 3VYVA 2CFSA 1R0BG 3WMWA 3NEKA 4XGNA 2J0SA 1XNJA 4EVIA 3VZIA 4EBCA 1AHPA 1P4RA 4WZBE 1YVEI 5FNZA 5F33A 3DE4X 2JFYA 3ESQA 3MLEA 5BN4B 4KLZA 1HEYA 3OOJA 3M2RB 2YYSA 5B1SA 2EC2A 2Y1IA 3EGIA 2O3SA 2Y66A 2AKYA 4YB6A 1NXVA 3GLVA 1CRQA 2VT7A 1Z25A 3H5VA 4I7FB 1NQWA 1GPJA 3TSYA 5A5FA 1SXJA 3ZR4B 2Q62A 4EK9A 4J16A 1T3GA 3TD9A 4MUEA 1YJQA 4NBLA 4RTNA 1P2TA 3BSAA 2XMJA 2B7BA 4L7QA 4C3VA 2YV3A 1NDPA 2F00A 3OSNA 4D5EA 1TQ2A 2X7HA 1UFLA 1UZMA 2R7SA 3EXAA 3V42A 2VXYA 3UJPA 4EO4A 1OF1A 3AKYA 1HBNA 4BNXA 3ENVA 2C9DA 2J09A 4JFRA 2IPMA 2H5JB 2X5JO 3GF4A 4JODA 3TTVA 4OX9J 4W9NA 4RTQA 2DXIA 2AYEA 4QXMA 2ZYWX 4AN4A 2YYYA 4MDFA 2C5EA 3LNTA 4C7VA 1M7GA 1WMAA 2VJPA 3Q88A 4DX7A 4UUWA 3I2IA 3GQBA 1DTEA 2YJNA 4J1SA 4HG2A 1UEKA 1ZA2A 3AD8C 1LBSA 1NK9A 2PRYA 2F4VJ 1H2FA 1KRXA 4F8JA 4TWIA 3IJRA 4XOUA 3OU6A 3NS6A 1XYGA 4TYQA 1O0PA 3AJAA 4AZ0A 5JYCA 4MULA 3FH0A 1M1GA 5BUZA 1T7PA 3VTIA 3OUYB 3H8SA 1RFGE 3PTZA 2XXAA 1Z7BA 1J2UA 3E9DA 2FZKB 1LS1A 4O59O 1Y89A 3R6GA 2PT9A 3BM5A 1KD1T 3E9ZA 2X15A 1F8XA 5LQJA 1NKCA 1PD0A 4GSYA 3PIDA 4CIOA 1G8FA 3IHWA 4RLSA 1A98A 1I7SB 4F4DA 4NENB 2Z4SA 3PEUA 1IBKF 2XE8A 4ZLLA 3TA0A 5KOJB 3WK8A 1ZH0A 3I04M 4FLEA 5JSZA 1DQRA 2O0LA 2YNHB 4GW3A 4QJBA 4OB8A 4A46A 3I9MA 5BQOA 1IHOA 3OTIA 1DKLA 4WU2A 3HQ4O 4JLNA 3VR5D 4HDQB 2R2SA 5ESDA 4K2JA 4GBMA 1GN8A 2QN2A 3LPNA 4DBZA 1PYTA 4E0BA 3NHKA 4KK4A 4YCLA 2G6BA 1D2GA 3IBCB 1SNYA 3BD9A 2XA9A 4G84A 4Y34A 5EAIA 3FMBA 1JDNA 4OJGA 4EW1A 1IM8A 3ZKAA 3EGWA 1NV8A 4TVBA 4U7UK 1GGNA 1B1CA 5LPNA 1SN7A 2XEXA 1FFHA 4QU7A 1Q1EA 4QLAA 3EYWA 3BE8A 2YWRA 5EJ9A 1UFQA 3BTVA 1T11A 2KB0A 3B1VA 4IQFA 4IWXA 3N2KA 4Q4HA 6ADHA 1A6LA 4TWRA 4CEJB 1F12A 1FUIA 3O44A 2IHNA 1L5WA 4AURA 3PE4A 4O4IF 4N0PA 4BHTA 1HWUA 5LC1A 4WKOA 1WCV1 1E5QA 1A2BA 2Q6LA 2HCRA 2XB2A 3WX8A 4RK4A 5ALEA 1E9DA 2WONB 5KFEA 3PLAE 2B5JB 2EFPA 2CJXB 1EUCB 1SK8A 3A04A 3GJRB 4KEAA 1S99A 3DQQA 3PC3A 4Y2CA 4QATA 4RVOA 1F17A 2X7XA 1FKPA 1O2DA 4ZREA 4G9BA 4B1FA 5DCLA 2BPOA 2BSQA 3I2YX 2LWIA 5ECYA 2ZIXB 3KR9A 4LSLA 2CBGA 3LPAA 1LWCB 2RGDA 3BGRB 5CEFA 2K7KA 4MMOA 1F60B 4HSEA 3SYRA 5LXTF 3ZY6A 3STTA 4PY2A 2FLLA 3PGLA 4EMDA 4P32A 3U27A 2W70A 2OORC 2W2XA 2GD1O 2Q0XA 4FYWB 2DEJA 2QTBA 4ZVRB 2V8PA 1S2IA 1ZD1A 4UCFA 3IKJA 3HI9A 3DZJA 2QHXA 2ZR9A 3MERA 5GGXA 1XWLA 4EP1A 2OHJA 4V2UA 1FT8A 2BE2A 4F6RA 2WZ1A 1M66A 3PY8A 2HOQA 1EIWA 4RNHA 4M5LA 3BQMB 1JDSA 1ODSA 1N34F 1P1HA 1RWNA 4G8BA 3QE0A 3LPCA 5J23A 1NJSA 1DQZA 3MOZA 1HE5A 2SKCA 3R0VA 2FFBA 4ZOSA 5TJ9A 5CVUA 2F3RA 3CJ8A 4XRRA 4L8YA 4ZMRA 1XTBA 1MZPA 2AZMA 4IDDA 1UBUS 3AJ1A 4J7XA 1L5GB 1A2OA 3OE1A 4IHKA 4PNPA 3DVAB 4YAEA 3M7VA 5KOYA 4MPDA 1G1MA 3Q2OA 5DVZA 3H9GA 2WPDD 5DSTA 2Z2LA 1RT9A 2WAMA 2WDZA 1P6TA 5ELLA 2ZRBA 3U4QA 1EDOA 1ECJA 3GRFA 2Y0BA 5J2UF 4NTZA 3WL6A 4KY3A 3NBZC 3J7A1 5CFMA 2GBFA 1ZBDA 3I6ZA 4QPNA 4KHPB 4D6XA 3WLLA 3TVYA 3UXEA 4KMOA 5CW1A 4QE3A 5EX0A 5JCPA 3GFQA 1U2PA 2Z2JA 2QRQA 3KO8A 3O5AA 3INRA 4ZO9A 3SM3A 4A8SA 1NK0A 1AGXA 3M4JA 4PQGA 4DR6F 1N48A 3ZV7A 3KTFA 1B8OA 4PPZA 4YLYA 4UASA 5K3AA 3MUTP 3VBCA 5AE1A 5LQAA 1PEKE 2V7PA 3IXQA 2UUAB 2VBIA 2BR5A 4X8MA 1ZGCA 5HE8A 1P4JA 1OMOA 1ZD4A 3LTEA 1X4HA 4DV3J 4F1JA 3PEHA 1E79A 4URYR 3FDXA 2HVIA 4P3XA 1PGJA 3KHSA 1ORRA 3WLHA 2IDZA 4XLLA 4MUMA 2EBUA 1JJ4A 3IUBA 4E2ZA 1DBDA 4LVOP 5J1PA 3SIPA 2J7PA 4K8RB 1QQ5A 4JOCA 2H4FA 4LFAF 1SD2A 3CZ5A 3DVRX 2R6GA 1FU7A 1RRCA 4W92B 3V1YA 5BYKA 1Y1LA 4U7JA 1TE2A 3BGOP 2OSQA 1MQ8B 1OS5A 3MM9A 4C7JA 4RKWA 4GRSA 2NV2B 3NBAA 2HK7A 1LA2A 2VBYA 5B36A 5EJ8A 2GX8A 1I1NA 1VIXA 4YJHB 2I2BA 2DFKB 4PTZA 3NBXX 3CMMA 4PO3X 5G0WA 1X1RA 1Z63A 3WBJA 2EKBA 3V6KA 5LLDA 1W5AA 1V3UA 2QAIA 5GM2A 3KZOA 3HXKA 2UAGA 2BFCB 2C2EA 3BHMA 3Q11A 3SMZA 4PQEA 3VZSA 1QNFA 1UBGA 2ECFA 2V7QD 1H0SA 2JEOA 3RG6A 1LU9A 3RB4A 4C5CA 1VMDA 3T06B 1M5RA 1T1RA 3ODGA 4KMSA 4B5LA 1UK7A 3ND5A 2WICA 4IP0A 2OAQ1 3OZCA 5GMOA 1Z0IA 5B3LA 1UOQA 4FD3A 4FX2A 3OXGA 2YVUA 4DSTA 2YKMB 2LVWA 1WCYA 1KH3A 5AR1A 2C7RA 4XYBA 1XN1A 3IMKA 1V0JA 3R27A 3DDSA 4RANA 1ZIDA 1JBKA 1Y6JA 2GLUA 4O3PA 2ATCA 3W34A 5B7PA 1Y8RA 3Q0IA 4GH5A 1RACA 1BQ4A 3KVVA 1SXPA 2M1XA 4RZXA 3LV8A 4EI9A 2JFBA 3K09A 4DNQA 2DR6A 3PCXA 4QTXA 5CFZA 2XITA 3KVOA 4H1HA 4CKEB 2QTRA 3E9YA 1GPWB 4OLHA 3PENA 2F1OA 5CBKA 1ZTTA 3ZI0A 4X66J 2B6AB 4KIGA 3ORHA 4BEJA 4ZDNA 2QX4A 4I4CA 2AOUA 2O1SA 1T8TA 3WV5A 3TQHA 1JAXA 1WOOA 3QVGB 2FF7A 1EAYA 1MJ5A 3NWRA 4ML3A 3SLRA 2I4MA 3B2EA 5ALGA 1P72A 3DWEX 2Z30A 4IO9Q 3I5BA 1FMLA 1PD1A 3AKCA 5A3SA 3COYA 3W5SA 3H4BA 4DR6J 1OXKB 1ZK3A 3QELB 4R31A 5DPMA 3DCAA 2XUGA 4QFMA 3FE2A 3SVTA 3BK1A 2TMGA 4FMBB 1UZHA 1YQDA 2FETA 3CTMA 4X94A 3ZNJ1 2QN7A 3K7EA 1QP8A 2E1PA 1X4DA 4UHFA 2X51A 3PWSA 3CH5A 1ORIA 1GAXA 4YV0A 3GIRA 2P2YA 3MR6A 4PNZA 2HIHA 1NQUA 3DBVO 3VH1A 3IT3A 1RBLA 2BFBA 3BTSA 4Q7AA 1J9EA 1O0BA 4BQSA 2A18A 1PWYE 4B6QA 3J81U 1N2HA 2LBPA 2AOXA 3CR8A 2LQBA 5BQ3A 1L7XA 2ZJ1A 1YQGA 2VNHA 5AJTA 4D0NA 1JHVA 1KLNA 4F72A 1UTAA 4TOIA 4DL2A 3GLGB 5FUWA 1YA4A 3T3PB 2QMUB 2IZZA 2OBBA 3TWZA 2C9MA 2IZ5A 1JEOA 5GONB 2WU8A 3L6EA 2VP6A 3UHPA 4CV1A 4YJ3F 4TM7A 5DLDA 4YQWA 1JAIA 3MD9A 5CHEA 4DQQA 2IS2A 1CEEA 4PYIA 2IE0A 4BFCA 2AYGA 4FXWA 1C2YA 4AYXA 2VSFA 4OJ3A 1ZEJA 1CVLA 5KWSA 4G0VA 4DS3A 4NMLA 3P8BB 1E59A 4MXDA 5E4FA 3L8HA 4DUGD 3L84A 2H18A 3A32A 1HLWA 3A1FA 2DEIA 4Z3OA 1I94F 4QDJA 5T6MA 5HKBA 1NTOA 3SF0A 1C0UB 2BSAA 1RWWB 5AVUA 1GCIA 1T2NA 1G5RA 3AVQA 1A9SA 3C2PA 4ERXA 4ZQGA 1K1EA 2XLBA 3W5UA 2I8EA 3LW7A 3VGUA 1ZN9A 4KXWA 2J3KA 2JVKA 3VV2B 3OJFA 4MI6A 1ZUHA 3FZQA 2X2FA 3C15A 2YCLA 3IPAA 4W8HA 5AKHA 1C0KA 1KC8T 3DMGA 4MYSA 2DGOA 1PR0A 3N8HA 3JWHA 5CLIA 1WNFA 1PV2A 1QV9A 4MRMB 5L7TA 3MMAA 2RT3A 3IOEA 1L5NA 4EHLA 3LFHA 1NMEB 3RYHB 2EFGA 4PTLA 4ARZB 4S0XA 4CFZA 2ZBDA 2DNHA 5ALIA 2FD2A 5CGQB 4IEIA 4MWGA 2YKGA 3COSA 2E29A 4JWTA 3RTGA 3P9PA 3K53A 1BWQA 4OK3A 2DPHA 3V5NA 4KQCA 5BN5A 1ZI9A 4HGNA 5KFMA 1J5OB 2OSVA 3EEYA 2D62A 1POXA 4O2BF 4RS4A 2GZDA 1L3KA 3RS8A 1JSXA 2FGJA 1ECGA 3JSXA 3HRIA 2XSFA 4FOLA 1PYSB 3U56A 4JITA 2B3TB 4KW7A 1L4LA 3PKJA 1RADB 2WK1A 4X62B 4HADA 1U5CA 3ADBA 2ACWA 1I6KA 3NNHA 1PVDA 1RAFA 4UM9B 1VIDA 4DX5A 2R2GA 5BRNA 1D04A 1DADA 1ZJ4A 3BKUA 1I1OA 3JU3A 1ZUWA 4MAKA 3PICA 4XKJA 1R0RE 3A6PC 3JPYA 4QC2A 1H8HA 5G2OA 1ZMOA 3QHQA 5BW5A 1TM5E 4ECRA 5JE8A 4F96A 4JSTA 3GYBA 1J5EB 1N5TA 5EIBC 2Q0HA 2CQ3A 2D5CA 3BO4A 4WCFC 5ALXA 3SK0A 4Q3DA 4XUCA 1PSWA 3UB4A 5IBQA 5H68A 4GWLA 3QFHA 3K70B 4UXJA 2ZDOA 1O0SA 1G6KA 1LDMA 1OGIA 4NECA 2QDKA 1WUKS 3G2LA 3DV0A 2ZR7A 1JAHA 1Q2XA 4JY7A 2IX9A 5A0YB 2NP6A 2B4OA 2ZUFA 4HRVA 2OHHA 4Q39A 2TS1A 3EG9B 3FUUA 1L3SA 4ITUA 1W85A 2PGLA 5EJ6A 3ME5A 4Y2RA 2PIIA 4O63O 5IABA 2JFGA 3E15A 5EIFA 1JWBB 4A16A 2IXAA 1G16A 1FDNA 3MAAA 4EENA 3SXJA 4N03A 4N5SA 4MSUA 2ID9A 3ANNA 4ZIVA 1SOUA 4XWKA 4MMXB 5KCZA 1E5XA 4GPZA 3G0DA 4OUKX 5DG9A 1H9CA 3T3EA 2Y3YA 2W9AA 5DN6A 1P1KA 3TI7A 2BY4A 1CHDA 4G0QA 1Q15A 2QA4G 5FUVA 3W9IA 3ZZYA 2J5QA 2Q3BA 5LMNJ 3I2JA 4D80A 3SYZA 4G8DA 2HGLA 1PAUB 4KLNA 1XVUA 1VSQA 1IQ0A 3TZLA 3KK1A 4RNCA 1RXWA 5F1PA 2C7VA 4KVZA 3Q7EA 1EZZA 2C58A 1GYRA 2V7GA 1W0JA 1D0EA 1YI2S 5DDRC 4MUGA 5KOHB 5HF6A 2HQGA 2HHAA 3OCUA 1CF9A 1A9XB 2G13A 1BQMB 1YTLA 4I14A 1UC5B 2NGRA 1IM4A 4B3TF 1JP7A 3BDVA 1WB6A 2DJIA 3OFSA 1E4OA 2VQFB 2EF1A 2X86A 5DWQA 6GPBA 1RTJA 4IUCS 4LW8A 2FEOA 1QGYA 1L6IA 5LP1A 3UBTA 3T9AA 5J5CA 4ID8A 3FHCB 1A5SB 1RT3A 1TYDE 4J07A 4DUPA 4ZARA 2V2QA 1L3VA 5C42A 4EGLA 4UD2A 5DP1A 3SZLA 3PV8A 3LECA 1RCTE 1L5HA 4ND7A 2P1ZA 1CRZA 4QIGA 5FFMA 4S1PA 4F0JA 1QE1B 1UK9A 4V19X 1WULS 1W87A 2OCAA 2O3TA 2DNZA 1BX1A 2BFDA 3NBMA 2J5KA 1WSWA 3CURA 3KKLA 4U2DA 1VQOS 1TO1E 3GRCA 3ETHA 5K8IA 3IHTA 1ZD8A 3KKKA 3UQZA 1F9AA 1AOXA 1NC1A 3H9UA 2HS0A 4PKDB 4OGKA 2FRDC 5I47A 1LPAB 2ZSFA 3FF1A 3GPAA 3GZ7A 1ZMXA 2E1MC 5HF5A 4TLAA 2IJFA 1NVVR 5KYYB 1RI5A 1O4VA 1LPOA 4DC0A 2H2GA 4YDRA 1Z2ZA 5KKAA 1YQHA 4ZJLA 4TT3A 5B53A 3UKOA 1S8OA 2AJ1A 3HHKA 3DO5A 2UXDJ 4II7A 4XPIA 2DYKA 2OTLS 1VHTA 1IRIA 2AGQA 2O8EB 1CUGA 4AJHA 2HO4A 4E31A 2KBEA 1UXGA 2C57A 4E11A 3G82A 3JQMA 1CEZA 3OM0A 1UMDB 2R7MA 3GV7B 5AUQA 4K05A 4FI3F 1XAIA 4YX9A 3MMCA 1R6UA 4N8SA 1HDXA 5FDFA 3G5UA 3VZQA 2CYAA 5DRTA 5G3YA 3LNCA 1X7DA 1YONA 5KT5A 3SYLA 3GUZA 1POWA 4D56A 2AGOA 2H2AA 1NYLA 4QBFA 3WX4A 1KY5A 3H18A 1G0OA 3V8PA 1XTRA 1WP4A 3QF7A 3QRWA 3KJQB 5DHUA 2PMCA 4IM7A 2G1PA 2VH2A 1NI3A 1M1ZA 4F2WA 1TTHB 5TQ2B 5CFLA 3EYZA 1G8PA 4POOA 4A8MP 1RYFA 3TSAA 4IRCA 1X7VA 3N5KA 1YCDA 2I3ZA 2C2KA 1BVRA 4NAHA 3NAGA 3C6TB 1AK9A 2AMJA 3VTKA 3C6KA 1E1NA 1IXZA 2WP8J 3T35A 5IMSA 1JHUA 4HWTA 1RT4B 4I4TB 5EJFA 3M05A 3VTFA 1A1VA 2IVFA 4XX1A 4CN9A 3QZ7A 1RQXA 5KS2A 2JDIA 3UFCX 1S1VA 3JYTA 2DUMA 3CC2S 2PL3A 3R0IA 1JX6A 3V34A 2M70A 2D2FA 2Q5CA 4Q8EA 4V24A 4A0GA 3TNJA 1RB0A 2NPIA 4GYYA 4WXYB 3LP8A 2GEKA 1TNDA 2GO8A 1HD0A 2NTNA 4YIKA 2BEVB 3PJGA 3GSDA 1XELA 2BMJA 2WSLA 4PVCA 2ASLA 5SZHB 5IULC 1A9YA 2WZCA 2IEZA 1BVUA 2GSDA 1CFJA 3J7ZT 1TUBB 4E8UA 3W2EA 1IHDA 5J1EB 4DUZB 2BX6A 2QVGA 4HDRA 4QA9A 2WTNA 3ZGNA 4YHHF 2BKVA 1QAYA 1B43A 1U1FA 2IRYA 2J9DE 3UANA 2FW6A 3JQ8B 2RKIA 5HQMA 4KDRA 4MJ7A 4E13A 2DHGA 2HH9A 1WKLA 2KFZA 4AN0A 1R9NA 1IBKB 3A6ZA 3DMDA 3V6JA 4D82A 3G87A 1RJEA 4QPZA 4PAMA 5J1TB 1ZCFA 3RWMB 4YI3A 4YYEA 1EJ2A 1TK3A 1YE3A 2FDRA 1C8BA 4F2SA 1WZUA 1N8SA 5JY1A 5DZ7A 2ATCB 4ZV7A 4TT8A 5DLYA 1QC5B 3UQYS 4RX1A 2PX4A 1W96A 5FLEX 3I0SB 3AM1A 3WLFA 3SXLA 1O3YA 5DQGA 1VKZA 3O9VA 5F41A 1UOEA 5EHIA 2R751 4BPRA 2JH3A 4QQ8A 2VICA 1QYRA 5I8ZA 4BEBA 4IQGA 4GC7A 1JMTA 5H1YA 3GGSA 1KP9A 2QPTA 2JFWA 1LV8A 4FYYA 4H1UA 2XWPA 1MN9A 3VGJA 3GYGA 4IGKA 2I5JA 1E9BA 3FPSA 3C70A 1FLNA 4B4WA 3ROPA 1IKYA 4JI1F 2AOTB 4J91A 2FA9A 2BDPA 2RUSA 1RTZA 2VOEA 3PVCA 2HBQB 4ZPVR 2WT8A 1JXVA 1Z29A 3K9HA 5DETA 4I55A 1S1UA 1MJFA 3D0IE 1XZFA 4XSHA 2AN9A 2Q99A 3RKRA 4R0VA 2ZDGA 3TKYA 3ZVMA 4RJLA 3MBKA 4CIDA 1W75A 4C1BA 4H3VA 2N1BA 4Z86A 5AKEA 5E8RA 3P97A 3R5JB 2XEDA 5HOEA 3D81A 3S99A 2NLOA 1YWGO 3EC1A 1KPGA 3I6IA 4KB7A 1BMQA 2KXNB 1Z7WA 4K81B 2BGKA 1BJRE 5IKEA 3EJ6A 2RHBA 4J0GA 2OOSA 2BR4A 2GBGA 5J3JA 5C46F 4LDRA 5B55A 2OP5A 5BVGB 2XF2A 1KOLA 2JFUA 1RYYA 3HCDA 2G71A 2J5RA 3RJ5A 2Z3ZA 2CVEA 2IFXA 1Z2EA 3N4WA 1OBCA 4GI5A 1XR3A 1A50B 2DNGA 5A05A 3TQFA 3GEGA 1DC3A 2KZZA 1DIOB 2ZH4A 4H7DA 4I50B 4NA1A 1GU1A 5BOVA 3LL7A 3HDYA 3ZNPA 4U4AA 1IKXA 3BXEA 4C29A 2VSYA 1LXNA 2ZHOA 1VBXA 2NREA 2QI9C 2GERA 4K1XA 1XAGA 2YTZA 3FTNA 3ZDFA 4PUOA 1TYZA 2GMJA 1Z5OA 2W7TA 3MWEB 1TA0A 4QARA 3ZJTA 2N46A 1KE1A 3GLSA 3HR8A 4CFSA 4UOQA 3EVWA 4O1MA 2W11A 4N5DA 1XNRF 2E5LF 3HXMA 4J4HA 4WECA 4K46A 1VG0B 1D1UA 1K6EA 3L8DA 3UAXA 2APOA 2X0EA 2PT6A 3I01M 4AAYA 1K73T 1PRYA 4N5LA 4QYXA 4KPUB 4RZHA 1QDUB 4BFWA 3UDVA 2ALYB 2HSJA 5EQFA 3W5AA 1U11A 4DV1J 3QEMB 3BXZA 1S48A 3CDUA 1GPUA 1YZNA 2WVBA 3VDRA 3OHAA 4OFWA 2RK6A 1UWKA 2FEXA 4R9NA 3TD6A 4DIKA 4KI7A 2R8ZA 6AT1A 1K06A 3PA6A 1NULA 1JQGA 3F1LA 1FJEB 2RAPA 2QGNA 2TMDA 4K1LA 4II2A 3PX0A 4XPEA 1S1VB 3JYTB 2QX7A 5DO2A 2DM6A 2DUNA 2P4QA 3D54A 4E2FA 2WBMA 2W2MA 3R5FA 5H5JA 4N82A 3LUCA 3BH6A 3MINA 1J6UA 1YBHA 3WL5A 4L07A 3U4IA 2LP4A 3RFCA 2WSYB 4IICA 2DVIA 1S9EB 2QLXA 3S44A 4KPCA 2GGSA 2XHEA 3ZTPA 1KBRA 2Y1RI 4NFYA 1FFGA 5C42B 3W78A 4KYTA 2Q2VA 3IDZA 1YJCA 2Q6IA 1BHNA 3VO2A 1SVUA 1WUYA 4RJ2A 2I33A 2QVYX 1EUCA 3QFWA 3D5MA 2Y8WA 4ZAWA 3MXTA 3VNRA 4ZRMA 2EX4A 3C15C 1I10A 3MM7B 3PUVA 4L3WA 4NE9A 4FWIB 1CQWA 4TRRA 5HQLA 1XHFA 3LL4A 2NU6B 4BVLA 4N77A 1S2GA 3NTQA 2ZIUB 4EG0A 1B3TA 3K2EA 3SLGA 2A94A 3KLFB 3NBPA 2EFCB 3L04A 2YMPA 2M6SA 1AKEA 3QVOA 5FOUA 4HGRA 5G0VA 1Q5YA 2FOLA 4XVUA 3EUEA 2QUAA 4NFSA 4QWCA 4YB1P 2GVDB 3P6YC 1J49A 3T9FA 4HXEB 1E1QD 1N8RT 3C7KA 3M6UA 2PWZA 4ALMA 2BJ9A 4TLBA 1T4BA 4M9CA 4DWVA 3NTRA 5K45A 2P9BA 3UYKA 1RVDA 4L3KA 1EA5A 4EAQA 5F2NA 3STYA 4NL5A 1R0ZA 4PZUA 1QPZA 1O87A 3F73A 4ZVSA 5I7EA 3L3CA 4D9GA 3WOHA 3FBWA 4A23A 3QX8A 5AM5A 3JASB 2B2NA 4XB6B 4I99A 3CGIA 2HZ7A 4KQIA 1E9RA 4FE3A 2AOTA 2Z8ZA 1ZL2A 1EQ0A 2HTFA 5INTA 4PXSA 3R7WB 1JKMA 1NMXA 4HHHA 1SXJB 2EKDA 4CMJA 4PNEA 4X8HA 1IN7A 2AEFA 1MDBA 1PNQA 3N76A 3D6JA 1UDAA 1TM2A 4N3CA 3IR5A 1BCSA 3D3JA 1N3YA 3BN7A 2FN4A 3HU3A 5G53C 4MHOA 1OOEA 1MWQA 4UOFA 2PT7A 3DLKA 5D7BA 2XRFA 3A6EA 3WNVA 1RZRA 1NLYA 4HT7A 1MB0A 2ZSDA 1DVRA 1ZAVA 3PBKA 1O1YA 3MFYA 2Q9CA 3VSBA 4Q6WA 1SVNA 2O8VA 3BRQA 5JAUA 3CNQP 2F6RA 2MZRA 3MGJA 1OWPA 2I7TA 4ME6A 4CEJA 2FK8A 5DEOA 2FMFA 2BEKA 2VPQA 2IC3A 5BV0A 3L4BA 1X39A 1WXXA 4B81A 3EN0A 4JJKA 3O7MA 3INTA 1JH9A 1GTZA 5A1JA 2R9LA 1QNLA 1RWUA 4CDRA 1QHSA 4HDRB 2IYVA 2OE2A 4BO9A 4TXNA 2QO3A 2G4CA 3LVBA 1K7CA 5G40A 2I55A 2AUNA 5DGBA 1QAIA 1I2AA 3G0GA 2KLHA 4B8ZA 4B3CA 3VHQA 4LTMA 2ZJ8A 4MW4A 3OY2A 1RHRA 1FWKA 1ZAWA 4H7EA 2ODBA 3HFKA 5ETPA 1UDWA 4ZOLA 4TQRA 2FF5A 2XADA 4ZPWR 1XXLA 3LRPA 3A2KA 3HHLC 2CD9A 3ZU2A 3RWBA 1Q3TA 1RU2A 4BO5A 3E0QA 2IYNA 4GP9A 5KSPA 3RAQA 1ZRNA 2A6MA 4N6GA 4NV0A 4RHUA 2A9OA 5JXJA 4DA7A 1Z56C 2O0HA 4D4MA 3MEKA 1TCAA 1NVUQ 3M5PA 1N8NA 3ZIUA 2VUUA 4LBIA 4LJYA 2PGIA 1EFKA 4ILLA 1CULC 2ZCUA 3ZCSA 2C7PA 1G7SA 1SXHA 3KEFA 4DFMA 5LQDA 5HO4A 2IPLA 2FUKA 1OQ6A 4G23A 3TZ6A 4Z37A 2H31A 5EUQB 1HIYA 1DQNA 2DHQA 4RKEA 3HO1A 1BD3A 2GF0A 1VQ7S 2X4GA 3SS8A 3KTQA 2WFLB 2GDJA 4RFLA 4NU5A 1SVWA 2ZXEA 1Z7YA 3PT5A 2R0QC 7REQA 1P0IA 4LJ8A 1QG6A 4ZTBA 1N5RA 3QSYA 2YMMA 1GILA 1RU1A 1K97A 3H1BA 1EARA 4NK4A 2RDMA 4AFFA 5I7OA 5ALNA 4Z8XA 1XVLA 1V1RB 5KYXA 1T5BA 4MV4A 1YZHA 1B0AA 4ER8A 3O4VA 4CT5A 2NVOA 3OEED 1T9VA 2Q46A 3ZHVA 1P2VA 4QGAA 3NLCA 3P5BP 3K5OA 3CVKA 1L4NA 3SSQA 3ON5A 2NACA 1RJ9A 1GNPA 3B9RA 3N7TA 1KTIA 1Z1ZA 2FHJA 3J81k 4DBLC 4CKBA 1YNOA 4UMEA 1KRWA 3CF2A 5CQGA 3IAS6 1P8JA 1VYTA 4FFBB 1JIXA 2DYAA 3MM7A 1SUAA 1WORA 4MRPA 4CTAB 2V9ZA 4QFBA 1GQQA 2QLBB 1Y3AA 1KI2A 1FA0A 4CM4A 2P78A 1CPYA 1ARZA 4HKQA 2IUFA 1FRHA 4C7KA 3CCTA 1K9VF 4KQXA 3LOQA 1GV1A 5FHRA 4R1UA 4CV0A 1V25A 1OH5A 1HE2A 2GHVC 3K0BA 1YRBA 2E4UA 3QA9A 1W2WB 4RA6A 3V4IA 3TDKA 3DDUA 1ZVQA 3LU1A 2D8MA 2X8JB 2QIOA 3MPOA 2LECA 1SHKA 3QW4B 1OWMA 2QZ9A 3RG8A 1OA1A 2MOKA 2D4AA 3KZCA 3H3XA 1UXOA 4W1PA 4DYDA 2RILA 3Q3VA 4DR2J 2Q6VA 4OQFA 5C8YB 2VIIA 2HDOA 4OXNA 4X63A 1B6RA 4H15A 3BD7A 3A3PA 2IX3A 4RUKA 1GKIA 4Y2UA 1GTG1 1SHTX 5A4AA 4U2KA 4DR1F 1XTPA 4MUBA 3PFNA 3AUYA 5HDQA 4QQFA 4EUFA 2C28A 5IG2A 5F2KA 4DZTA 3Q0EA 1FRJA 1S9HA 2X40A 4YMSA 2ZT5A 3LQYA 4NPCA 4NG5A 3ICEA 3ILSA 5JVHQ 2HYIB 4TWBA 3ZY2A 2Z1NA 2QM0A 3V32A 3GG2A 5FUXA 2FG7C 2W2OP 4CH1A 1EQ2A 4WY5A 4TLQA 5HYVA 3G2PA 1XXHE 2W9BB 3WK5A 4ZZ2A 5A9SB 4JV5B 1JIVA 2XT0A 3RYFB 3LOUA 3OCWA 1JGTA 4XJTA 2VJLA 3HVTA 2VG7A 3W64A 4Q9HA 4Q3BA 5GAEI 3IRWP 1A7AA 3ETEA 2VZ9A 1SVOA 4C0HA 1GCAA 1QO7A 4I19A 3I83A 3BMCB 1GTSA 3G2NA 2YN0A 4BS9A 4P0QB 2J9FA 3I0NA 2OCYC 2UUCJ 4Z4GA 4DDWA 2NUTA 1G8YA 1C0PA 1U31A 3K9CA 3ZW7A 4IMPA 3S2GA 1AIPA 1DO2A 4FNOA 4HFJA 2NXCA 3U16A 1I6WA 2NWQA 1KDTA 1OB2A 1LSSA 4XWOA 4L8FA 3T1QA 3EDQB 1YRXA 2CEAA 4B6RA 1IJFB 1CJKA 4L22A 2OA0A 1RTHB 3E53A 5GJWC 3AI2A 2WC1A 1A77A 1D09B 1YR2A 3ZWYA 3KYDA 5KBYA 3PHBE 3SSOA 5DM7Q 4JP5A 1O5OA 3P9SA 1OV4A 2ZXUA 1NVKA 1RYNA 3P2EA 3FFAA 2WUVA 3I5XA 2FPLA 1UEJA 3OD5A 3L1JA 4YR2A 4Q01A 1SR8A 1S1TB 3BBLA 3QEAZ 4B7AA 1TECE 2CJPA 4ITVA 2W9XA 4IWYA 2C9YA 2YQ4A 1W4CA 3NJ4A 2KE5A 3BB1A 4DCJA 1RC1A 4OI6A 1GEHA 1CUXA 3ZBQA 3C1UA 4QUKA 4TKTA 3HP6A 3AV3A 2FXVA 4RDHA 5A0TA 2ORVA 3I9LA 5IK2D 4R5PB 3NJ8A 4Y2VA 1R0LA 1T94A 3BGWA 1TK8A 4YR3A 3VPAA 3H6KA 1C1YA 4BP8A 4K2HA 2VFRA 4PYJA 3N2NA 4B83A 4LHZA 3VQTA 3R6LB 1JSCA 3V5RA 1STOA 2LRHA 4UUOA 3RHFA 1DTWB 3MMJA 1Q1ZA 1YOVB 3PI6A 1XERA 2YWEA 1GXSB 2RJNA 2Z5GA 3B82A 4I3GA 5CIYA 4O4LF 4E6PA 4TKMA 3B3FA 3PC6A 5FJIA 3IWLA 2OPPB 3KG2A 2IUUA 4KGXA 4GOXA 2HSGA 4OU5A 1KQFA 1DMSA 1LWOA 2A2CA 1TIBA 4HJRA 3FNEA 4LNHA 4W63A 1I4TD 1Q0SA 3UAZA 4BDSA 2P2LA 5CGZA 4EY3A 4L8VA 1N0IA 2Z2YB 4TM8A 2PG3A 5JMWA 1T1JA 4USHA 1H2ZA 3W8FA 4WP8A 2GHPA 3DV0B 1MCZA 3VAHA 1BO6A 3A05A 1JXEA 1RYSA 3DEFA 4M0MA 4PVDA 5C8XA 5ETVA 3EEIA 4Q4DA 1SUFA 3V1MA 3L7MA 4X6YA 3HSDA 2GN8A 1Z2OX 1JRLA 3UAGA 1E3WA 1DG1G 1JIKA 5ADZA 5AVQA 3MELA 3KJFB 3AEZA 3OUZA 5LBUA 2MQMA 2V6GA 4BJ5A 4Z8YA 5I4CA 3H9CA 5JU6A 2RH5A 3POTB 1WC4A 2VYNA 2I3AA 3D8TA 4OP3A 1DXHA 1F9HA 1VQMS 1BUXA 1U9YA 1P9QC 4L5YA 4MGEA 1QIHA 2Z1DA 3CUEF 3L9WA 3DB1A 3RYCA 3VAAA 4DEYA 3GVHA 3WLRA 4UVIA 1E8NA 3T5KA 1M7HA 3M5DA 5JSQA 3M2UA 4EW3A 1DFDA 2O2YA 1VBMA 4KR2A 1G2EA 1NHUA 4RORA 4DR5F 5AVZA 1DRKA 4OX9B 4JUZA 1QIDA 2Q21A 2ZRGA 1OC4A 2RRBA 3OEYA 3CMCO 3G13A 5K01A 2JWNA 4PZVA 1QO0D 5F8MA 2WD7A 1R12A 5C5JA 2F3TA 5F4BA 4MQ6A 1V3ZA 2IJNA 1RAEB 1HL3A 4HCJA 4QR1A 3TOCA 4HMPA 2D0IA 3UWOA 4QECA 4TUYF 1GA6A 2G1JA 4Q3CA 3AB2B 3MDFA 2XVYA 3COVA 3GIMA 2M6LA 1UL3A 2K6GA 3ZD8A 4I1SA 4J43A 1V8ZA 2C4KA 2CK3D 1XDGA 5FPPA 3KOXA 3O2IA 4MCAA 4I67A 4LJ7A 2RHWA 1L4UA 4KUEA 3SZUA 1A8PA 4HZGA 1M8PA 4AD8A 3A26A 4FF4A 3V8RA 2FP3A 1RTDA 2GZSA 1JSRA 2NNLD 2BGIA 3EVDA 3LUFA 4K4XA 2CB9A 4Q37A 4R05A 1T8RA 2ZIEA 4ED8A 2XAUA 4A6EA 3F7OA 1G0NA 1JKHA 4DCTA 4JB0A 2G88A 1ORHA 1BWSA 2LKDA 2WI8A 3L0SA 5YASA 3U61B 3LWLA 3GLHE 2CJKA 4BGVA 3GLFE 1DFIA 5AKJA 1DJLA 1QHYA 1NLZA 5HKKA 1OVGA 4K8OA 2PI5A 2NU7A 1NDCA 3DV9A 5A6VA 4M98A 5ILOA 4UUAA 4P7FA 2FWAA 1NWCA 3NU1A 3PITA 4WIQA 5EY5B 2AI2A 3C5CA 5D3QA 3KR2A 5TMBA 2QOEA 4OCZA 3BKFA 4FDVA 3EDCA 3D5QA 3DUWA 3P9YA 1Q0PA 1YVUA 5EWGA 2C2YA 4WEOA 4DSEA 3LZ6A 5DTMA 3D0HE 4IW3B 4O2BB 4XQ9A 4R9RA 3B2QA 3DYAA 4B3OA 1IL0A 1U98A 2UZIR 3KYBA 3DNPA 2QTFA 1UBMS 1FDTA 1B0ZA 3GR6A 4DTCA 3T3NA 3EEQA 3OOEA 3H8VA 4WVFA 5F3DA 2BBSA 1I94J 3MK31 4WMLA 1IATA 5AD1A 2VH5R 4KVFA 3IEUA 3LRTA 2VPWB 5T57A 1Q57A 4DGSA 4OMCA 3GFTA 1R88A 4OYIA 1NCLA 4XUDA 1RAFB 2Z58B 4LFAB 2H00A 1JLCB 1U8WA 4RABA 4K8RA 2F7SA 3WZLA 1UFOA 4HAOA 4FR2A 1IVZA 1L8XA 2QUZA 3ZLTA 3FKSA 1LWXA 3K1TA 3JW8A 3ZKWB 1MROB 4NZZA 3ZUGA 5IXSA 4BLOA 3IHLA 4K4ZA 4ZODA 2RAFA 2GAJA 1F38A 4CMKA 4JH0A 4OYLA 3K71B 2VRCD 2HSEB 2XLKA 3BGLA 1YBAA 4FZJA 2MGZB 2X4LA 3FHJA 1DPFA 4BB6A 2CQGA 1SHJA 4EBEA 2ZROA 3CZQA 2UYOA 4CNBA 1MAHA 5TQ0B 1N5IA 1J97A 3MRTA 1D5WA 3TW8B 4ID5B 5LA6B 2BQ3A 4FSHA 2UXCF 2CQBA 5I7AA 4CCSA 3THWA 1RZVA 3DMRA 4LWOA 1EFRA 2OCXA 5CD1A 4OB6A 2GXUA 3GDOA 1OSCA 3H2SA 2BSXA 2XXAB 3WS7A 2YJZA 5LL6d 3Q23A 3GO4A 3AU9A 1R0AB 4L51A 4WBXC 4CM6A 3OSPA 2WQ7A 3HDGA 2CIMA 4IIJF 1FQJA 1FJ2A 3BK7A 1Y1RA 1FP7A 3HJRA 3ABIA 3DFEA 3GLUA 3DCJA 4ERDA 1RM4A 2HNDA 3GRUA 4R8RA 4EITA 4NEZA 4RUHA 5BO5A 2J9FB 5HUQA 4UMFA 2UUOA 3ENZA 4GRDA 4QQBA 421PA 5F2OA 3PPYA 1FVXA 4MTCA 4PYLA 1HE4A 1APBA 3GT3A 1Y80A 4EYGA 1JECA 4B02A 4KR0A 4XQGA 4CKEA 5GJVC 4QYTA 1GXUA 1J8DA 2WB4A 2PIDA 4IS3A 4BRUA 4PCAA 4D02A 3LP1B 1ODTC 3Q85A 2W2NP 2DT5A 4GEGA 5F8HA 2VWQA 2VS1A 1LDNA 3H1TA 1M5TA 3F6EX 3T1YF 3DL2A 1RXOB 1AXRA 3EVNA 4MW7A 4DR1J 5K51A 1G2PA 4ESVA 2QX9A 5IH7A 2IDLA 4ETWA 4RW7A 4FGLA 1FS5A 3GNSA 5JQGA 3K5NA 2OLWA 2H5LA 2WSFC 4CM4B 4OL8A 1BXGA 4MT1A 2IHJA 1OPXA 1FLDA 2X0IA 3CCMS 2WQ6A 4AX8A 2ZQYA 1TJPB 1SVLA 3BOSA 4K50A 1RRMA 3G5LA 4RAOA 2CDNA 4NICA 4Z4CA 4R16A 3LGAA 5HBGA 2A7XA 2D2IA 3UHOA 4WKYA 1ID8A 1WD6A 1V26A 4U96A 3FTQA 1M1XB 4Y00A 2VI5A 2CRLA 2CFOA 1J06A 2X4DA 4LV8B 1IIRA 3LUAA 2HFUA 3T1HF 4NXNF 2XJ9A 1HEUA 2Y1DA 4KRYA 3QU7A 1FXWF 3WRVA 3FGZA 2C3OA 3QLVC 3ZTWA 5CM9C 3WXMA 1X87A 2A1TR 2WZDA 4P7TA 1JR4A 3BWDD 2OZKA 3WY9A 3ER6A 1QQAA 1UJBA 4H7FA 3DKVA 3A8EA 8AT1B 3GLGA 4LBHA 1DX6A 4OLJA 4HH3C 2HQFA 4LSZA 5JVGQ 4KV7A 3MR7A 1F2DA 2KRRA 1EFPA 2JAHA 3VC3A 3VTAA 4GBGA 5TIIA 3H4MA 1AMOA 2AC7A 2H48B 4CHTA 2B8QA 2VQFJ 5EUCA 1TW2A 3NALA 3DFMA 3ORFA 3M1VA 3NDJA 4KQ1A 1ZUNA 1DEOA 3W3AH 3NV7A 1D07A 2HZVA 4K9MA 3RU3A 5D0HA 4HFRA 3K89A 3TL3A 1QB8A 1U7ZA 1WUUA 4DT1B 2YQ3A 3M6IA 4DCGA 3ZBUA 2MDAA 2B9VA 1NVVQ 1IB0A 1PJ3A 3VR5H 4B75A 1WW3A 3NONA 1QCDA 3OE4A 1M1YA 1QDEA 3I53A 2CZVC 3KV1A 3O84A 3M8ZA 5ED0A 1NMQA 5IZ4A 5JNVA 1XLWA 2VJCA 4IFYA 2GLXA 2GQCA 2HIAA 2G9VA 3G1TA 1MIHA 4MUXA 1BKSB 2GZ2A 4HS9A 1NP3A 1S8AA 1OLUB 4CTOA 4KPUA 2G0JA 2BI7A 3GAFA 2CBXA 4ZCPA 3LP5A 2W01A 2D1FA 4WPAA 2JLWA 1H3NA 4YT4A 2YW9A 3G2JA 1ABBA 1KMMA 2WHPB 2VA2A 1K6JA 1DDGA 3ZZZA 1E18A 3OPYI 5F98A 1QFMA 3B7GA 1HDEA 2VCHA 2H16A 4OB7A 4S1TA 5FOQA 1OLXB 1XNQB 1I7QB 3I39X 4CLPA 3DDWA 3K70C 2CPXA 3H1PA 3M4NA 2WD7B 2X0FA 4US2R 4C1NA 3H17A 4FFBA 4RZUA 1AZTA 4H7HA 2AUMA 4P1ZA 3U31A 3X1YA 3OTQA 3CRRA 2ZUGA 2GLTA 1FY2A 4ZVGA 5I7VA 1OZAA 1ORWA 3DR5A 2ZCJA 3KCNA 2ZU6A 2I7CA 1S7HA 1N5OX 1NN3A 1G8JA 4CU5A 2OB1A 4I3HA 2DB3A 5B4VA 3A10A 1AZSC 4FYJA 3V9AA 1XZ8A 4LGVA 3F7TA 4ZN1A 3FYUC 5HTOA 4N7BA 4K5SA 2XMKA 5FJJA 5CLHA 3NNDA 3SCZA 1ORTA 4TS9A 4HN2A 3N0TA 1ZW1A 3ZFVA 4B3MB 5T67A 4GMFA 4MRSA 1RKVA 4LX8A 5GMEA 4C20A 3N9IA 4FB4A 1GRVA 1BEUB 3ITKA 3G0IA 1AU9A 2HIMA 3E2IA 1M2OA 3AG5A 1FSSA 3N70A 4ZOLB 1GDTA 1KU6A 5B2ZA 2C04A 2XRYA 4TKUB 3FQLA 1HBJA 1FNOA 2AVDA 2AZXA 4C0SA 2QV7A 2GJ8A 3RS2A 4LF9B 1Y7PA 3T5HA 3ENKA 2VTBB 1VE5A 5DH9A 3CRW1 2P7HA 4HZUB 1M0WA 4R8LA 5EWEA 4HVLA 1PV4A 4EL0A 1E2HA 1LNSA 4UDYX 2ZWPA 4ABYA 4JYAJ 2XS5A 1XMOB 2P9HA 3D4OA 2TSYB 5IQ6A 2DXFA 1GUBA 1U48A 4R01A 4QL3A 1USVA 1YZFA 1QYDA 3TLAA 2ESRA 3OHSX 3VOBA 5IKPA 4BPBA 2O20A 4FPIA 3NB0A 4U0KA 3X0DA 2F67A 1QRTA 2BI8A 3ZDBA 2LUOA 1LNZA 2XO6A 1IJBA 1AB8A 2HB6A 2JEYA 2V98A 2ZRCA 1F51E 3FUXA 2E7XA 3AUKA 4U9RA 5BV8A 1VYUA 2ASDA 2NUTB 2P41A 2CXEA 4Y8VA 1QTNB 1H65A 4RY0A 1JU3A 1E3QA 3TXXA 1IWOA 1PAUA 4B43A 3I1JA 3DMNA 2VZ8A 5IDWA 5JANA 2OCKA 4MLPA 4DTIA 5FWNA 2UXCJ 1QC5A 1E2UA 1EZZB 2OEKA 4CW7A 2VKQA 2RH8A 4AXXA 4WNCA 4J37A 3NHAA 2FQXA 3WB2A 3VR2D 3FFIB 3KHKA 3GAMA 1QH1B 4E5NA 4MA4A 3KD3A 1SIBE 2IW3A 5I3CA 2PX6A 1BS2A 1GZ6A 2X76A 5A62A 4F4IA 4ENUA 1KMHB 2I62A 4ED7A 5I01A 3SCJE 1C29B 3NEAA 4JA0A 1NF9A 3U7IA 4IUYA 1FYDA 1GZ7A 2OBFA 2V8DA 3UKDA 3RREA 5IAGA 3GJ0A 2NG1A 4I69A 1FLVA 2FYXA 1U4BA 2OO3A 1EAMA 3IELA 3A31A 5C8ZA 5KYTA 4EGFA 2WYOA 3Q40A 1OPIA 1Z0SA 1IUKA 3OZXA 2CVHA 2WD8A 2OHOA 2QR3A 1AKTA 1AZSB 4EB6A 5C35A 3PR4A 1MJHA