4NMLA

2.60 angstrom resolution crystal structure of putative ribose 5-phosphate isomerase from toxoplasma gondii me49 in complex with dl-malic acid
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
257
structure length
249
Chain Sequence
b'MNPQDKAKQAVGYFAVDTYVRSGMKVGLGTGTTAKFVVERIGQRMQEGSLKDLLCVPTSEATRKQAESLGIPLTTLDGIADLDVAIDGADEILPPTLGLVKGRGGALLREKMIAAAAKTFIVAADETKLVSNGIGSTGALPVEVVVFSGSHTKRLLSALPSVKRHGGRAEFRKRAGAAQEDIREEDRFVTDNGNYIVDLYFTETVPDLHEMDKELKSIPGVVETGFFLDLASVCLIGKADGSVATLTAE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribulose 5-phosphate isomerase
publication title 2.60 Angstrom resolution crystal structure of putative ribose 5-phosphate isomerase from Toxoplasma gondii ME49 in complex with DL-Malic acid
rcsb
source organism Toxoplasma gondii
molecule tags Isomerase
total genus 80
structure length 249
sequence length 257
ec nomenclature ec 5.3.1.6: Ribose-5-phosphate isomerase.
pdb deposition date 2013-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06026 Rib_5-P_isom_A Ribose 5-phosphate isomerase A (phosphoriboisomerase A)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4nmlA02
3.40.50.1360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4nmlA01
2H9ZA 2RQMA 5JJBA 3AB2B 1FS6A 3ENVA 4GO7X 4L51A 4L5IA 2PA3A 3TUJC 3DHXA 3NWPA 2BKXA 1PBTA 3BXEA 1XTZA 3LHIA 4L5JA 1JT9A 2I9SA 4R9NA 1UJ6A 3E7FA 1KS2A 3TX2A 1YGYA 1HORA 2QMXA 2RE1A 2QSWA 3OFFA 3CEDA 3KV1A 3LUYA 2ZHOA 3AAWB 1YBAA 3OC6A 3UW1A 3DC2A 2J0WA 3CSSA 4L4ZA 1FQOA 3LOUA 5T41A 3MTJA 2BKVA 3HN6A 2FGCA 2P9EA 4PWUA 2J0XA 1M0SA 3KWMA 2JOQA 3OFEA 4R7TA 1CD5A 4TM7A 1LKZA 3N0VA 3EFBA 1ZPVA 4L50A 3MWBA 3NRBA 3TUIC 4GO1A 1SC6A 1VL1A 3IXQA 3P96A 4TM8A 2PC6A 1FRZA 2RI0A 3L7OA 3IBWA 1NE7A 2GNPA 2QRRA 3HHEA 2RI1A 4OQQA 1FSFA 5IS2A 1LK7A 2DT9A 4LUBA 3TUZC 1Y89A 2MDAA 2R5FA 2CDQA 3O1LA 3BXFA 1LK5A 1FS5A 1UJ5A 3OFHA 4GMKA 2P9GA 4M8LA 2O0MA 2OKGA 5HJ5A 2W48A 3OBIA 5IT0A 2J0EA 3BXHA 3EB9A 4IO1A 2JHEA 3BXGA 3W7BA 1Y7PA 1DEAA 3S1TA 1O8BA 1HOTA 5FIIA 3DDNA 2WU1A 3ENQA 4L4YA 2LVWA 2LQJA 2RQKA 1U8SA 4X84A 1RWUA 3ENWA 5IT4A 4OQPA 2DTJA 3AB4B 2P9CA 1PSDA 3OFGA 3MAHA 3K5PA 3DHWC 4NMLA 4GO5X 3E15A 1UJ4A 3LWDA 3NZEA 3CH7A 3ICOA 3U7JA 2F8MA 2QMWA 2F1FA 2NYIA 2KO1A
chains in the Genus database with same CATH superfamily
1PJLA 3R8XA 4J0EA 1WUYA 2NREA 1BQXA 2Y0PA 3UG7A 1G2EA 3LPAA 3HVKA 5IG2A 1Z9BA 3TXXA 1HORA 1SO8A 1K06A 4Y0NA 1VHWA 1YE8A 4NEHB 2PX2A 3G8TA 2EF0A 1NN5A 4MFBB 3WBKA 1MIHA 2P6NA 3NR2A 2JFKA 1DBSA 4DAEA 3P45B 3F47A 1M10A 3OLZA 3KQQA 4OLBA 2FDRA 1SBIA 1S1VA 4RVUA 4XUEA 4EG5A 1IWBB 2JIOA 2R5FA 5AJ3F 3CTMA 4RESA 1O58A 4CO2A 1JWBB 3TVKA 2FQYA 3LA6A 3ZE2B 2AYYA 1T5IA 2MXYA 4K86A 1WF3A 5LBTA 4B73A 2W71A 3CPWR 2C9ZA 4AF8A 4N77A 3MYYA 1RE1B 3IGNA 1WSVA 3SLKA 2WWGA 5LOVA 2CJYA 5DHSA 1GG5A 1EMDA 2FPWA 2YKNB 5DO9A 1WF6A 1JLQA 4OHPA 3OJWA 4D1YA 4WZBB 3D8RA 2O1EA 1RD4A 2RGYA 1P2FA 1Z0JA 5ETJA 2VDQB 2I65A 4KKXB 1TPYA 4R7GA 2NNWB 3D5TA 3W5IA 4LYDA 5AI8A 1JDVA 1G2QA 1R4MB 1WKBA 1Z0FA 3RRXA 4KGKA 4GKJB 3ZJUA 4V2IA 1XZ8A 2TSYB 1FS4A 2GIFA 2AZXA 4CV3A 2OPPA 3NONA 4IOKA 5EJ8A 5AKLA 1I1QB 2MSNA 4X1YA 4MJLA 4XOUA 2ASYA 3NETA 8GPBA 5CYQA 2HQCA 1MC8A 2JBHA 3UK6A 2RS8A 5EUQB 3U0VA 4KNYA 1EIWA 3MJDA 4NXNF 5A6SB 3ZWAA 1FMTA 2RHJA 1DT3A 3H3XA 3D1JA 1QHHB 4KX5A 5EHQA 4LC9A 2AC2A 4EPRA 1Y80A 3WC2A 3HBMA 5D0HA 4HTAA 4YHHB 2QVGA 1TLFA 2GR9A 4OMCA 4RA9A 2G07A 1UXJA 1FP1D 3TD6A 3U9SA 2XOKA 3KXLA 5EEHA 3I4HX 1DPGA 2G7MC 4XSVA 4NV1A 1V6HA 2JJ8A 3FHOA 1PGQA 2RGGA 3I32A 5FPTA 3TLZA 2XTJP 3NBPB 2IHR1 2P65A 5LB2A 1NBHA 3EUEA 1EFCA 3JR3A 4TYQA 1HFWA 3MTEA 1KMQA 2MQLA 3RAXA 2PG3A 3R7SB 2WG2A 3D0RA 1CUCA 3EG9B 3RABA 1OI7A 4ZAZA 1D8ZA 1EUZA 3W1EA 1DJMA 3QI2A 5IULC 5L39A 2A14A 3FVRA 2QW1A 1JIJA 4RQTA 5EMJA 4EUEA 4DR1F 4IZIA 5ELLA 4BLTA 3B9RA 3GAAA 3PQ2A 4ED6A 2A8YA 2E7ZA 1AA9A 4MDYA 4CIDA 3DUFB 4OJMX 2GIRA 4X60A 1LQUA 2WUFA 2LQJA 2IPLA 1YLXA 4IVRA 2IVFA 5E6RA 5HFJA 3RSOA 2Y2VA 4BUZA 2QBYA 2A9FA 2VA2A 3AR7A 1U1EA 2AOTB 4YT5A 3I6YA 3T1HF 1QYXA 3J81A 5H8WA 3VX3A 4CDNA 1SJ3P 4P7FA 2HQOA 2ATLA 3RODA 3BMCA 5CM8B 5JRZA 2A10A 3JSXA 2VP5A 4JJ6A 4UBMA 4GRIA 3QKSB 2MGZB 4IFVB 4LEIA 4WERA 1ODSA 3KJXA 3M6LA 3EIWA 1G20A 1SCIA 3AZPA 2VCHA 2J0WA 3QOWA 1BQMA 3AGPA 1J42A 3I12A 4NP6A 3EA4A 1YQWA 1TYCA 5DNAA 4LI3X 3CLSC 2QRUA 2ZZMA 1R5BA 3BICA 1DFIA 2IPNA 1P5ZB 3KEGA 4C4TA 3WGIA 4PY2A 4O0NA 1T8PA 3S27A 4HUTA 1PBAA 4QJIA 4DRYA 2IU0A 5KAMA 3QVUA 5KO2A 1SGWA 3GV0A 5FPSA 4QG7A 2Q28A 2EG5A 4K9KA 3DTTA 1JKHA 1XO1A 3CS3A 4KITB 3S1TA 1FCAA 3BULA 4DV7B 4CMGA 1BQNA 3U1BA 3SZGA 3VAMA 1U4NA 3H8SA 1GPBA 2N82B 2HLTA 3QVKA 4UTXA 4F84A 2VUHB 4P08A 3K2EA 4C7BA 3R7NA 1OX4A 4M5HA 2DR5A 3SYRA 3E9NA 1TJ4A 2CFOA 4F0JA 3WS7A 3H4IA 4RXMA 2Z09A 4IW3B 1IQPA 3TSCA 4ZTZB 3C1UA 1PUIA 5D0RA 1CQIB 3O44A 1TA9A 2QTBA 1KHVA 3WMWA 1SKUB 5K3DA 1HNWF 2D5BA 3EFOA 3E70C 1OKKD 2E2WA 2OZPA 5J2MB 4B32A 3FF1A 3D6VA 5D5HA 5L4SA 4YXWD 2FHSA 4JP3A 4NBUA 1E89A 4I5EA 1VKZA 1RYSA 4C4WA 4Y1FA 1GGMA 3MBOA 1PJSA 1M3SA 2YHBA 5LZ9A 4RFSA 4EHJA 2YDYA 1VGVA 1CPZA 2BX6A 1UF9A 3BFXA 4MWZA 2UXBF 2FWAA 1HQUA 3U26A 3KB6A 1KMHA 2IGBA 2QYCA 5CXTA 4KOEC 3HT3A 1EFRD 4JP1A 3I76A 4EUVA 3HJAA 4DF8A 1U2FA 1U1LA 1Q1KA 1ABEA 1M73E 2C03A 1DX9A 1Y3AA 4M9CA 3V8QA 1E61A 2ZVPX 4CYUA 4NPHA 1U7PA 1ZGGA 5JQWA 2OUIA 5LUAA 2HWIA 1VCIA 4M22A 4AU1A 4CW7A 1J00A 1WUJS 4Q5IA 1RYZA 2FMTA 1IVNA 3M5PA 2L2QA 3H5NA 4MH0R 5FNVA 5BW8A 3IBFB 3FOBA 3ZE6A 2EF1A 1AFJA 4D8WA 2XUOA 2CV2A 1KJ8A 1TP7A 3RVPA 2WSCC 1GEHA 1BMTA 2O3JA 3V1KA 1NPPA 3O03A 2WI8A 2XRMA 1N3LA 3KOAA 2QE7A 4NBTA 4TVOA 2V6IA 1SG9A 1XV5A 4OY3A 3P2IA 3W9SA 4OUDA 5KNDH 3VPAA 4BWFB 4MJKA 2JEGA 4IOCQ 4BO3A 1N32J 1NKVA 1FTCA 1CJUB 2RF2A 1BHSA 2HMAA 1FFHA 1FFAA 5KQSA 3M81A 2PGNA 2WJPA 4A2QA 1O87A 2C29D 4PLPA 2ZJ0A 1XLVA 4MQEB 3CD0A 3H4MA 1FJGB 1A4UA 1S1WB 3EQ2A 1K9MT 5H9VA 2XMPA 1B99A 3HXPA 4IH6A 2G06A 4R0JA 5FDLA 5CEFA 2JFGA 4EF4A 3IPLA 2DO4A 5IX8A 1Z82A 2RQMA 1Q77A 4FUTA 3AC0A 3GH3A 4P7BA 3ZN2A 2I4MA 3SE0A 4ZGGA 4R40A 1ZK0A 2XUZA 2YMQA 4FHEA 3MMSA 4EB8A 5GMKa 4J0HA 3RDPA 5I7OA 3ZS9A 3FA2A 5DM60 2ENUA 1YK9A 3A9WA 2IBSA 3RSQA 2DISA 3QOFA 4WQMA 3IBCA 1S4EA 3CGIA 2OYSA 1GL7A 2YWRA 1GYQA 4ZPWR 2VP4A 5KYNA 3GJ4A 3BZBA 2EZ8A 2R11A 3H11A 4GSYA 4JI7B 4CGYA 3H3FA 3D3WB 1RYFA 3VDXA 4XCQA 5JISA 2FXIA 3M8YA 2R7QA 2QZPA 4DMMA 2NACA 3CC2S 2XNSA 1YR1A 3OZFA 2B9WA 4L02A 4N47A 4MDFA 2P4SA 5F1YA 3DOKB 4AP6A 1BXGB 4A8JB 1R9JA 4JXJA 1Q14A 4GKKF 1EUCB 3IIEA 4NWIA 3V34A 4O4LB 4DLVA 4PLWA 1KI3A 4RUBA 4X4VA 3D28A 4CO4A 1IAVA 3C7TA 4DLXA 5B53A 2BPOA 4IILA 1FEZA 3IKMB 2JJ1A 1EP1B 4EB6B 4GO7X 4F3QA 7MHTA 2F9LA 3B1VA 1KO1A 4L5AA 3RD5A 3W34A 1RK8A 1QVAA 4QEKA 2Y8YA 3VTAA 1L4NA 3UJAA 2ZTSA 4ZDIA 2J3DA 5LQRA 3FX2A 2A58A 4Q1CA 3L7DA 1VMKA 4C2TA 3OFEA 3OOHA 1AO0A 3HEBA 2R65A 2BGLA 1KK1A 2W24A 1NZAA 4YRRA 1S7GA 1XPUA 3CONA 3AOBA 4I50A 2AV6A 1L2TA 3HHEA 1SQFA 4X6YA 2EJWA 4PPYA 1CV2A 2G83A 2OB2A 5B58C 2O7RA 1ZMRA 1KEZA 4I7FB 7ADHA 5E7OB 3PXUA 4HI1A 3R5DA 2XTAA 4GWKA 1WA5A 3VPFA 3OSZA 1OV6A 2R1UA 4RABA 3GUZA 3KWFA 4BU0A 4Q4LA 4R5PA 1PYSB 1SG6A 2GN9A 2GEKA 2IYNA 5C25A 3PP8A 4KBGA 3RWMB 3QT6A 1QGUA 4LFAF 2WP8J 2AJLI 3EX7C 3ILYA 2BT4A 2OHXA 2B43A 2OGWA 4BFUA 1ONOA 3LAMA 4DI6A 3JD1A 1HLPA 3CYFA 3QVVA 3NDBB 3PRBA 3E84A 3NCHA 3UM9A 4MJ3A 5KWSA 1GAOA 3GMDA 4JBWA 3VKFA 3FGOA 2FSHA 3G2PA 2NCKL 2REOA 3QZUA 3V6HA 4HS4A 3UENA 3RUEA 4II3A 5HQ3A 2X2OA 3EZXA 3LFHA 2W9XA 1E1CA 2IKSA 3QVSA 3QJ5A 5FWYA 1NKTA 1SKWA 1KQ3A 3PSAA 3SSRA 1NBOA 1F9EA 1IKVB 4RM2A 3G4SS 2Z98A 2FV8A 4MQFA 2A57A 3DDIA 1S7HA 3BORA 5FYDA 4I6AA 5DI3A 1MG7A 2JLFA 2JGDB 4GMHA 4INPA 1CJKC 1R0CA 4PSKA 1V3ZA 2VF3A 3E05A 1C7JA 1R89A 2XGJA 5KG4A 3QX3A 4YUDA 3BGWA 4O4IA 1E2IA 1PG5B 2QFJA 2GSDA 2I2XB 3ZJ5A 2ES4A 2X0KA 1DWQA 2IOQA 1TAUA 3R0IA 4BO9A 1H2HA 5GVQA 1WNEA 3H1AA 2Q3HA 4E32A 3ANSA 4QDZA 1UK7A 1TU0B 4HT5A 2E82A 4TGLA 3GWGA 3HYNA 1MR3F 1J8YF 1SUPA 1NN1A 2CNKA 4U2GA 4FLFA 3A25A 3RHSA 3ZD6A 3JY6A 1HE8B 1NXXA 5BWCA 4G81A 3NIBA 1YR7A 2PQ6A 1GTMA 3DV9A 1Y1PA 5KYYB 2EC5A 1MPTA 3HCAA 1RBYA 5CA0F 4N1AA 2FE4A 5AXBA 5F7ZA 4XSGA 5IJ0B 2JVJA 3BWDD 4PZEA 5DK6A 4NECA 1TT7A 3NDIA 1RU3A 4GFDA 4NCKA 1CJBA 3K15A 1YTLA 1C1CB 1U09A 3F6BX 3OEHD 1SIBE 1P1BA 1PJ2A 5GONF 2OCPA 4NNOA 4C0XA 4EUFA 5A2GA 1R10A 2VWGA 1N33F 2HHAA 4TRNA 2GVNA 2DIUA 5B0FA 1O0CA 2HDNB 5CD4H 4D4KA 3QNWB 2MMGA 3TI9A 3PPIA 3RVDA 2WJYA 1EQAA 2GWHA 3NNNA 4BO4A 4OQPA 4BMXA 3CCQS 3D0HE 2O48X 2IYVA 1B70B 4K8RA 3TZKA 1XQXA 1G59A 5DN9A 4DMZA 1FX1A 1NVTA 3BF7A 4KGVB 2X8AA 4N0EA 1LEHA 5F73A 1ZIPA 4FDTA 1XR7A 1MX1A 3CF4G 4F8EA 3DVAB 1V8DA 3A12A 5DQGA 3CKKA 3HCXA 1U3TA 2IYRA 1SBRA 2YNMC 2XKBA 4XAQA 4LMRA 5JWOA 1M2JA 3F3YA 1XMVA 1SCJA 1RJFA 1LWEB 2HRQA 1GADO 4NMWA 4N65A 4YCAA 4HDRA 1M72A 4GZ3A 4G07A 5JO0A 1HD0A 2DXEA 5HDBB 2K5UA 3V7UA 4F6CA 3GP5A 3QPIA 4H4EA 2AIRA 1W4CA 1PTJA 2MHNA 4LDQA 1G9TA 4PXYA 1RMQA 4GPEA 3EFHA 1ZZFA 4G0WA 2AK2A 3ENKA 3O73A 5LU9A 1M9NA 1AQLA 3MCWA 1T5LA 5JD5A 2WAYA 3I8XA 2QRVA 1ZK3A 4Q47A 2C5GA 4QUAA 2FUG1 2OV1A 3U3OA 4LMPA 5FJJA 3C2PA 1XAGA 3D3KA 2H9ZA 1LLUA 1ISFA 4XRRA 1TEZA 4AUMA 1SCDA 2L08A 3LQFA 2UUTA 3EVWA 5I5GA 1E6CA 1I51B 5KT5A 3DVQX 3D6MB 4JB3A 1D2RA 3P0EA 4R1TA 4GP7A 3A9VA 4NBVA 4Z2XA 3IO5A 5EQDA 1HWIA 4K0KB 1A7GE 2Q8NA 1KPHA 3M6FA 3B8HA 2COUA 3QIDA 3SQGA 4N7TA 3D1LA 1CBKA 4DMGA 4K50A 4LF8B 1XBTA 2M9KA 3WWOA 4KSEB 2CXOA 3LYLA 1P77A 2OM2A 4ZO8A 4BNXA 5H70A 3AW9A 4PYJA 2QG6A 4RK4A 3Q0TA 1E2MA 4UJ5A 1X8JA 2QSUA 4Q37A 1M8FA 1FFEA 1I33A 2XO7A 4QQRA 4R2WA 2C7PA 1QDLB 5L1LA 3DAYA 1STOA 4WF9Q 4JIMA 5HGJA 1K8AT 2X8BA 3VZQA 4AUNA 2IRWA 1MX3A 3V97A 3LV8A 1Y6GA 4XLLA 1R15A 1L8XA 2P40A 1O95D 4K9NA 3L0DA 4B3RF 3ACDA 4RKUC 1XHEA 1X70A 2F8MA 2LVBA 2H2AA 3AOCA 3OIGA 1T3OA 2ODNA 2AXPA 3FDJA 2K4MA 1P2GA 3U6BA 1VSVA 1EFPB 5DU2A 1RT6A 5A6PA 1NDPA 2QMHA 1NG9A 4RY9A 4JI2J 1A7AA 2AW5A 3UEOA 3NDJA 4QR0A 1XU7A 3KG0A 5HKOA 3L82B 4JVMA 1HXHA 4Q1VA 1Y5LB 3T7JA 4FNAA 1H23A 4KQMA 2CQBA 4KDEA 5LQNA 1FVHA 1HR0B 2HHJA 2JZOA 1Z0SA 3L93A 5LL6P 1RHRA 4LBVA 4KPFC 4MINA 3PWTA 3SOPA 4BJ1A 3OTCA 4FIZA 2DEIA 5BW6B 3K89A 5DNVA 3IV6A 5IXJA 1XPRA 2GKGA 3N8DA 4AE5A 4C7KA 1BXZA 3WADA 2IZ1A 5AJ3J 1UBTS 1UJCA 1UT8A 2XNJA 1S0NA 4HB2A 1RPNA 4UE2A 1UPAA 4B1FA 2AD5A 4FF4A 1E9DA 2VOJA 1T0JB 1TKZB 3KRTA 2W70A 3REOA 2LGJA 1V11A 5E41A 4V0SA 2UUCF 1N8RT 3R44A 3GR6A 1P8JA 3N9IA 5BSEA 3LZ6A 2X1AA 2DTEA 5C31A 4IJKA 1I4TD 1R6YA 4I9NA 4QWCA 5EKXA 3L49A 3OLBA 4ECRA 3QV2A 2WILA 1S0VA 3M82A 2HRCA 1V5IA 3QVOA 3W5HA 4L57A 2BBSA 4HDCA 5SICE 4REMA 2EFQA 2GZRA 5JWRA 3DBIA 5FTMA 5CB4F 4P6QA 1X1BA 1H0KA 1KGDA 2BJWA 3EWAA 1EU1A 3IEIA 5FBQB 2BJ9A 1P29A 2DLNA 1F9HA 3QEMB 2V8PA 3C6TA 2VKTA 4EFLA 4N6GA 3L3BA 4OXKA 5FPYA 5IF3A 1WUIS 2E3JA 5K3BA 3H8VA 1YJ5A 5KT7A 1ZETA 3R8CA 4B9AA 4OMDA 2KBFA 1TFYA 4A92A 1VLMA 2IYZA 2XVXA 2X1MA 4NA2A 2WDPA 4XGRA 4X3PA 4KLAA 3RRJA 1J24A 2HRTA 4NXNJ 5IPFA 3QGMA 4M6WA 5ITWA 3HJCA 1RKBA 2V3VA 4QW8A 5KC8A 4EMTA 1U3GA 2FC8A 3E9QA 3S2IA 3U4CA 4ZO7A 1RT7B 2CMDA 3DAFA 4KB5A 4J1SA 3NOOA 5KDLA 3L5OA 2HRBA 1WY5A 5AOAA 5H9FK 1G2IA 1P1TA 2R8PA 1V9LA 2O0JA 4MWSA 4KAAA 2AE2A 1HBMB 2I9PA 2ZCVA 2MTBA 3PPVA 1Z17A 4IQ8A 4CO5A 1I2CA 1SNYA 4W6ZA 4ZTUB 4TUYB 4BFCA 3EDRA 3BGSA 1PJ6A 3KSRA 4HJRA 3MAAB 3LW8A 4UUAA 3V6LA 3TZQA 1WBBA 4JBLA 2NYVA 1ULZA 2AFRA 2OJ3A 1QHSA 3U49A 4PLGA 2GM9A 1PAEX 3QKUA 4J0JA 2F43A 4LE2A 1KI1A 4BX2A 5E4YA 1UZLA 2HWUA 5BQ5A 1KDRA 1MX5A 4RYDA 4DR1J 3V4FA 4NR0A 3EXEA 2F8LA 2HJHA 2QOEA 5J5AA 1LB1B 4M99A 4ND8B 1DIHA 1K8RA 4D57A 3JARA 4YJGB 4OIFA 3TBHA 3ADBA 5ER9A 1Q84A 3HI6A 2EL7A 1OW3B 2CUYA 4GEGA 1NZJA 3IC5A 3QIAA 5SV2A 3T1HJ 5CH7B 3LF1A 1YCDA 2BLLA 5JU6A 3LUDA 1C1BA 4NCHA 3L7BA 5A8KB 4F5ZA 1KC3A 5HK4A 2QYHA 5C53B 4EG1A 4UAVA 2EX0A 1T0TV 3BWBA 4TLMB 2XTJA 4DR6F 5FB3A 4Q1BA 2OGUA 2CUZA 2JHGA 1F14A 2D9OA 5HNKA 3IUQA 3ZVNA 1J8DA 2B8TA 5FUQA 1Z0UA 1U1CA 3ZK8A 5IVDA 2QAIA 5JH7F 2O7VA 2C2YA 2VTBA 3HSYA 1CJTC 1DAGA 2NXCA 1FP4A 4ZC8A 2HDOA 4U8VA 1XTPA 4NEGA 3K4HA 3M8KA 3OVSA 2IA6A 2BKLA 2MINB 4E2FA 1EETA 3PWSA 2ZRNA 3GNQA 4L27A 2WMDA 1KEEB 5HN0A 1Z74A 5L3VA 3FYCA 2UU9F 5AYVA 3M4YA 5K8PA 2VP0A 1U0HC 4PANA 4TTIA 4AYBD 1TIPA 1Y9JA 2QUKA 1EVEA 5EZYB 5D5QA 1IN5A 3EVAA 4COKA 2XJ9A 1W4AA 2FQQA 2EW8A 4ENPA 3LUPA 1I3OB 2KU7A 1H7XA 3ZU3A 3MM8A 4DQ0A 1G63A 2YNFA 3VR0A 1DUVG 1KJYA 1EKXA 4MR7A 1AHNA 3N6XA 3D59A 4IOMA 1RAFB 1EHIA 3RS4A 3A9SA 3POTA 1MU2B 4NOHA 2DGWA 1FP2A 2HSWA 2EFNA 4KH1A 3X44A 1DUIA 2XKKA 3R2DJ 1K6MA 3MAJA 2GJ4A 3BXZA 2XMJA 3TBKA 5EWJA 3LLVA 4OYIA 2AC7A 4ZU1X 1MNQA 2P2GA 2WM9B 3EGXA 1HNWJ 1AN0A 1OBFO 2OXIA 1YWGO 2H2FA 2IGTA 2HKEA 1FXSA 1WC5A 3GLSA 4ALKA 1PFYA 2AQKA 1NJ6A 1TKAA 1P9RA 5KPDA 1VRTB 4ZVFA 2JVRA 3BG5A 3ZLJA 1QMGA 4G09A 3R76A 1OSCA 4ER7A 1TV6B 4E5NA 3NKYA 2ETXA 4PGHA 1RABB 1IXYA 3ANYB 2W2PP 2UYGA 4IIJF 4B7UA 4XW2A 3RSZA 1GXSB 5B3JC 3EGDB 4DF3A 4G3XA 2HLDD 2LCFA 3HG7A 3SS9X 2PRSA 2HJGA 4NZ7A 4E51A 5FHRA 1NLFA 2I1WA 3CGWA 1PSWA 1LDGA 3SYZA 2CZVC 3KKFA 5BORA 4AJNA 2ZWIA 1RLMA 3VAAA 4YI5A 4EYOA 3BFPA 4JYAB 4CCYB 1JIQA 3NGSA 4DX6A 1IJEA 1B00A 1JZSA 4F11A 4DWWA 4OG2A 3CO0P 5I9MA 3SYTA 1VHLA 3G8CA 1OYWA 2Y9HA 2JIRA 3GJXC 3EZ2A 3D7RA 2WNIA 1BHJA 5KMGA 4DN9A 5JXGA 4BQFA 2Q5CA 2D2VA 1YRLA 3PKYA 1A8PA 3OQBA 4DQVA 1RAAA 1B0VA 3QPWA 2QD3A 4BEBA 5TPWB 2VH7A 2IAJA 5J2UF 2ZUDA 4H9GA 3SS8A 3D81A 2IHZA 1QYVA 5TEWA 4C6TA 1BS1A 2ZVIA 2XODA 4TLCA 5IAOA 3R3JA 1E2QA 3N7AA 2H5JB 1O94A 1ZJZA 4BKQA 4HMQA 3DZFA 1UQUA 2YMLA 3E48A 3ET5A 4DF4A 2A9KA 4IUBS 3PF9A 3NAZA 3RNOA 3MQFA 1OFIA 2OA0A 1YDWA 3W66A 4P98A 2KJQA 1ILEA 4KQHA 2IYYA 3C7AA 4RQUA 3AVQA 1OIWA 3LQVA 2CAJA 1H1TA 5EJAA 3QXCA 1URRA 5BYBA 2QP4A 4Y2VA 2PZJA 5CAEB 1U8UA 2QE5A 3HU2A 4PC1A 4M3NA 5LBIA 4O2AF 3Q0EA 4KN5A 5L38A 1RWOB 3OX4A 3OLYA 3LY9A 1VJCA 4QUDA 2X76A 1IBMB 4XDGA 5LXYA 3VC1A 4RWEA 2A6PA 4OLHA 4ERXA 4KY3A 1E5QA 3U1VA 3NWRA 4YECA 3TLJA 5J1TB 3JAKA 3RH0A 4WLOA 4IH1A 3JQ9A 4XX0A 4WUVA 3NWGA 5ALQA 4AN1A 2P2CA 4HAVA 1VJ1A 3P2YA 4IMPA 2Y1FA 4RETA 1ZN7A 3CC8A 3GZ4A 3UVEA 5FA5A 3G82C 2ZPTX 4PQGA 2BJ8A 3AEKB 3WICA 1Y98A 2MZJA 2AKYA 1QQBA 1HC7A 1CUUA 2I6GA 4GKKJ 2IHJA 2NLOA 4IJ5A 2IJNA 3FBTA 2R25B 1A2OA 1NT2A 2BACA 1N5LA 1ES9A 1BDJA 1T8YA 3HPRA 3NLLA 4N7RA 3G7SA 2IC3A 3EXFA 4DBLE 1B26A 5L3QB 3DL0A 4AXXA 3S7TA 1ZOLA 5L3ZA 3UPDA 2Q4TA 4ITVA 5EQJB 1L6IA 1D1TA 4DEVA 1YRTA 4F4WA 3VPCA 4A0SA 3P97A 4CMIB 5I8WA 3N8IA 4DV3B 2JL9A 3PW2A 1HE2A 1FTWA 3FSXA 1BE6A 4KR0A 2WG0A 2ZOMA 4YB6A 3F4KA 4YMUA 4X66F 2XBMA 1RYBA 2X3YA 3OLXA 4KE5A 1YAJA 3ZGXA 4WCEQ 1P39A 2Z6AA 3GRUA 1F0XA 4PFSA 5JTUA 1X7ZB 3T1YB 4WP9A 2GT1A 5E1MA 4ZVKA 4OHBA 3FUTA 4DPXA 1DPFA 3BQ1A 4LFAJ 2BM8A 5LDHA 3D7NA 4RPFA 4ZPVR 4WK4B 1UH5A 3NRJA 1JG4A 2D0DA 1PJZA 3M8ZA 3FRHA 5T41A 2DKOA 2QA2A 2ODBA 4JX8A 3COVA 3FUVA 2ZULA 3AFHA 4O5AA 4XPZA 1J1UA 2QA4G 5FNZA 5HO4A 4LFBF 1UZDA 1II0A 3QITA 2NPOA 4MR8A 5LP6A 1FXLA 5HEKA 1R27A 2HURA 1A1SA 1FK8A 4FKXA 2XCPA 1JFLA 3PNLA 1IKXB 3MEGA 2WSSA 3FYTA 2ZXFA 5EKUA 5HYVA 3VSDA 3QELB 3WK7A 4TXLA 3CJQA 4OA5A 3AR5A 4Q4DA 4CKXA 5CH3A 1N2IA 3F97A 3W06A 4YCCA 1JB9A 5A4FS 3BIJA 4M9SA 4J7AA 8ATCA 2PN1A 1KXJA 1RZVA 2WZBA 2GZHA 1HA1A 2SNIE 4WVLA 2E4YA 2JIPA 4WJLA 5AMXA 2EFPA 1H8ED 3WLEA 4AJOA 2UUAF 1C7QA 3L8GA 4P4NA 3ADOA 1XVLA 3U2QA 5AVJA 2GZ1A 4H60A 3VQSA 1X9SA 1EDDA 3OPVA 1QIKA 4GR4A 4BWYA 2P5TB 1LBEA 4KLRA 2JC3A 2GETA 1S1VB 1X1QA 2V5VA 2NO6A 5AVSA 3NBZC 4WA8A 4Q21A 2NAFA 4CGZA 1S5PA 2X8WA 1C8LA 2C20A 3L0SA 4QO8A 2CPFA 1LLQA 3C4JA 1JNYA 3MD9A 5KOYA 4K8OA 4U96A 4KFBB 4UCWA 3L6BA 4RHXA 2Q2OA 3KOMA 1LI7A 3NH9A 5LOVB 2CJYB 4HLDA 1XR6A 3KK3A 2OFWA 1VA4A 3VH3A 4UVGA 5B1HA 4EBEA 3LMKA 1N33J 2VA9A 2FLPA 1JLQB 3BE8A 3L0CA 2E9TA 3LNCA 3K96A 2B61A 1E1KA 3U13A 1OZ0A 4C0JA 4GH5A 3BPDA 1M34A 3E15A 1C1HA 2Q9CA 3GO4A 1TM4E 2V7GA 2WY2D 4OI6A 5BMVB 4J0GA 4EX7A 4JITA 1P5HA 4RENA 1X3SA 3PDWA 1E4OA 3OF5A 3IQFA 2BGMA 4IUCS 2ZE5A 4IIDA 5IJAA 3DNFA 2GN2A 3VTZA 4AZ0A 2IEIA 2EXXA 3EVBA 2OPPB 3HNRA 3FCVA 3N8HA 4AX8A 4BB6A 1EHCA 1TD1A 1GH8A 4E5MA 4WBFA 4X1YB 1KBQA 1NQUA 3BD7A 3H84A 5LVAA 5CYQB 2L9NA 1MW9X 1VRUA 1PCXA 4FYKA 4QJ3A 4PX9A 3TRDA 1W5AA 2QRKA 1VI7A 1UJMA 1DB3A 4BPBA 2IDKA 3ND9A 2RGUA 1ZW1A 1AUXA 4RXTA 3NNAA 5JEEA 1N2CE 1DLJA 2P9TA 3H7AA 3M4NA 4KXUA 4XX1A 2JI7A 2B0GA 2MR5A 2GAOA 3KK1B 5KFGA 3SEOA 4B3JA 5KQPA 1OE0A 3WXBA 4X4PA 3G59A 2VPXB 1HI0P 1S9FA 2VOOA 3E5RA 3Q8MA 4ZEVA 1L7RA 2AKEA 1IM4A 1AB8A 4GZLA 4R2LA 4DX7A 3BGIA 3J81j 5MGBA 3KMQA 3JZMA 2QR5A 3KTOA 5CYOA 3DU6A 1H73A 5JS8A 1H7WA 3WL7A 3AI1A 3QTBA 3VKHA 4LRYA 2R87A 1NUAA 3A2LA 4GC5A 4OQYA 5GOTA 4OYOA 5KFDA 4OVKA 4UUBA 5JD3A 1UR5A 1Q3TA 1OR8A 4N3CA 1TCCA 1QV6A 3LOPA 2JEJA 3PV0A 3L4EA 2IPXA 3K6JA 1P4JA 5GADl 4UQOA 3JD4A 3ME5A 4OO3A 1ZI9A 4J29A 4EK2A 2CF5A 4BNGA 4LVOP 1N5YA 1GUZA 2IVFB 4DPWA 2LR0A 1BDHA 3RU9A 2QBYB 2XA1A 5EFOA 1UM9A 2VJOA 3G5LA 4RWZA 2KFNA 4G5GA 1WZUA 1ESNA 1ISGA 3F9CA 4ZHQF 1FO1A 4IKPA 4D9JA 5FRDA 2HSEA 3RUDA 4OJ1A 4ECAA 2I78A 1L4LA 3ZIUA 5AK0A 3NHYA 1CDOA 1G20B 2OBLA 3SNKA 4UDYX 1XN9A 4RU9A 1BG6A 2VOEA 1RS0A 1S1XA 1PZMA 4NI2A 5L40A 3EVFA 3OZCA 4KAXA 4INOA 4B3RJ 4HACB 4P3KA 4MP3A 1NASA 5LMUB 4LBHA 5H3HA 1OPIA 2ZM5A 3Q1KA 3VPHA 4WZMA 3WIUA 2WUWE 2QXUA 4M36A 3BKTA 3HN6A 2ZBEA 4M0MA 1UPTA 2W2VA 4OLFA 4Y2GA 2WIKA 3CNNA 2YHIA 5FQOA 3CDBA 1JKHB 3QATA 4Q05A 1TKDA 4HFNA 4JVNA 4CNBA 1U0SA 2YOGA 1EUDB 3ZHQA 1W44A 2Y1WA 3PYXA 4FGWA 5KFJA 3SYNA 4Z1MD 2J6CA 1KSGA 4YHBA 6CHYA 1N7IA 2BHNA 1IQZA 4QXOA 4ND1A 1LJ8A 2ECQA 1ZJ6A 4C0BA 3N5KA 3EYZA 3EAQA 3LP1A 5GWXA 3UAZA 1NP6A 4LPSA 1MH9A 4J8PA 2L17A 4QYZK 1GITA 1SU6A 1OWPA 5JATA 1C0UB 3A4YA 2ZTLA 4KQKA 4RKQA 1BUXA 3K5LA 1V3SA 3D1QA 5CB6A 4E98A 1EG2A 2R6FA 3ENVA 1NJXA 2YY6A 1FNOA 3BR8A 4N48A 2EG1A 3NI2A 1I7DA 1ZUIA 4OQXA 2N42A 4E3WA 3W65A 4RFSB 1G21E 4UMEA 1QJCA 1RQ7A 4OSEA 3Q8WA 3PXXA 3VO1A 4TN2A 3G9UA 3P96A 3L7CA 5LXTF 3TL2A 3GLUA 1QANA 3MECB 2DH5A 1ORVA 2OBXA 2W9AA 3UUWA 2JFZA 4ZAFA 4FWBA 4J5OA 4U9RA 2VUUA 2YKMA 1F3LA 1A9YA 2P1RA 1QH8A 2N7YA 4TLDA 4BHQA 4HFMA 1MXHA 3NDPA 1D2AA 3Q9UA 4HAUA 1I30A 2CL5A 3WYDA 4DSNA 1IHDA 4CMJA 2ZUUA 3DR3A 5B36A 2SKDA 1W36D 1Y8CA 2PFKA 3DYIA 1YJNS 2ID9A 1FSSA 2D1TA 4CDRA 4W99A 1JAZA 1O9HA 4JXKA 2EYUA 4IF6A 2HFJA 4DCJB 2NTNA 1E94E 5E1OA 1JLBA 3WYNA 4OUDB 1TKBA 4Q24A 5H68A 2INGX 2PMKA 1CVJA 3PD7A 1CY4A 4P0PB 3DKPA 4KKOA 3ZDCA 4AYTA 2ZRIA 1URNA 5F4BA 2C2KB 4PLVA 1Q3HA 4TMVA 1WSRA 1SBHA 1C9MA 4IMJB 5GM2A 5GINE 1A8HA 1UP4A 4NLWA 1LSUA 4HT7A 3EODA 3L1IA 4RY0A 2HEKA 1T11A 4D9IA 2FJ0A 4DWVA 4KUHA 3ILLA 1EVKA 4DXDA 2P3QA 2C83A 3VAFA 4U4AA 4FNMA 3DE5X 2YWGA 5FDLB 1K9VF 1N0WA 2CMKA 2WTAA 2ZB3A 2OLJA 3OD5A 1RJEA 2HHXA 1FE8A 2WUDA 2VP3A 4ZVOA 2HQ3A 1QONA 3HUDA 2ZZTA 5TJ9A 1XMQF 2QPLA 4REOA 5AVUA 2OPRB 2NYHA 4FPXA 2HVDA 1TMKA 2E4WA 1RADA 1V4VA 3DKKA 1SCQA 4TWJA 1FDIA 4UUQA 3KZKA 3TF5A 3PNQA 1UPXA 2HW3A 4LT6A 1B15A 4LJ9A 3IBCB 5LZ8A 3H6KA 2XGQA 2ETVA 4YC7A 3BEDA 1PD1A 3A6FA 3BF8A 3EUWA 4LPKA 3C3KA 4QU7A 2XG8A 5DIZA 3ZCRA 1R0BG 1R6TA 2GZ2A 4R41A 1V16A 4R1UA 4RMHA 4TM8A 5IZCA 3GELA 1E62A 2O8EA 2WV9A 2R00C 1PJRA 1P3DA 3SBDA 4DR6J 2PY6A 4YJFA 4QVIA 3AZQA 2ZPAA 3C6ZA 4A0QA 1GTJ1 3ZWYA 2H7VA 3A70A 1H05A 1H5UA 4Z1OA 4HSGA 5IYZA 4M21A 3HZEA 5JIBA 1IZ0A 4I2QA 2RONA 1NRJB 3F4LA 3KD3A 4A23A 3G2KA 4OLAA 4R6WA 1G8JA 2FP3A 5IP5A 3VQTA 5HMLA 2SCUB 2GHVC 3PGVA 2NYIA 2OO5C 2UU9J 2VQFJ 1G8KA 3A8EA 3R3YA 5DCWA 3CLUD 5EIFA 2VFTA 4PZAA 4TTVA 2IBKA 4B31A 3WG9A 3RRMA 2GEVA 1CG2A 4JJ7A 4I50B 1P3JA 2DGQA 3DMTA 4ZDKA 4AK9A 4X4SA 3WBZA 2WHPB 4KXFB 3P0RA 3C7KA 4J7UA 1LNSA 3I39X 2E7VA 2VQEB 3A8JA 4O6VA 5C4IA 3NHMA 4LXXA 2HHCA 1RDRA 2V4ZA 4I1IA 3QW2A 4R5PB 1RCFA 2LV8A 2VFVA 3EZ9A 4N3GA 1GNKA 2EQ5A 1KONA 4QIVA 2B1GA 3CZ5A 3MPVA 2D3OR 4KU4A 1JFTA 3ROTA 4P22A 2RGWA 1ZJJA 1S2IA 4NAHA 1GFIA 3SBXA 1UT5A 3NB0A 2ZQ5A 1AN9A 1HA3A 2KB2A 3KTFA 4S3MA 4ZCKA 2C3YA 2F67A 1BCSA 3OVMA 5HQ3B 1FDSA 3OKAA 1EGQA 4JLAA 3BGLA 3MSXA 5FWYB 5K8IA 3OE4A 4CEIA 1QFMA 3TX2A 2Y8EA 3V4OA 2AXEA 4QX6A 4RO0A 5IKOA 4EKEA 4JC0A 4TMKA 2OIHA 1TPZA 2FB9A 1K5HA 1VYTA 1LY1A 3ZR4B 4X6XA 3MFIA 4YXFA 1PUXA 1UZUA 4R2JA 1MMNA 1UDRA 3G88A 2WTXA 4LIRA 3FF4A 2A18A 3BMNA 3OZXA 3GPLA 4O4IB 4M9ZA 1CY6A 1EJ2A 2NOAA 4Q9LA 1BRMA 3TR0A 3MOIA 4RDCA 1WXHA 1KP3A 3OWXA 5CVCA 1GPDG 2E1RA 5IF9A 4FMBB 4CF7A 5C8XA 5TJHA 3IMQJ 5JJ5A 4ZK2A 2I6WA 3DOMA 2ILZA 2NQ2C 3JTEA 4Z3KA 2D6FA 2BFPA 2HA0A 2R8OA 3K4QA 4XR9A 3L7LA 3EXHA 4J2OA 5D01A 1RLUA 2W2PA 2VT2A 4CQLA 5DMHA 3OZGA 3MD1A 4BGDA 3B12A 1OB2A 3U7QA 4C22A 5KFVA 2ZT7A 5U1PA 4P74A 2MMYA 3PFOA 4YREA 1QF9A 3FZQA 2ZI9A 2CPHA 1KAQA 3C3JA 3VGSA 4PEOA 1WHTA 2NAPA 4KO1S 2C3MA 1XXHB 2G5PA 4J0KA 4UDOA 4HRVA 2XB9A 1LUAA 1ZR2A 5IJZA 3AAWB 3GRRA 5K3FA 3LIPA 1BMQA 1CRLA 1KA9H 2LXUA 1EWKA 1VRQC 5HS4A 4BLOA 2DR0A 5KKCA 2JFBA 3N6RA 3NBXX 4PNZA 1N6OA 5F76A 4RVGA 1L1QA 4NLRA 2C3UA 2GO1A 3O2SB 4MWGA 5ALOA 1NNSA 2W6NA 2NP6A 1T1EA 4K8RB 2FEXA 5KC9A 5DSTA 2JLCA 4EMSA 2CJXA 3HVRA 1XCMA 4WFJA 1G8GA 2H2IA 4PLZA 3VHXA 4FYVA 5IAAA 1J5EF 3LXMA 1YZKA 1MORA 4R5HA 3A8TA 2BF7A 3JZDA 4MZXA 2W58A 2W8BA 1R8AA 4Y2HA 4ENUA 3O8OA 4QDUA 5JJKA 4IVQA 3PC6A 1DRWA 1H93A 4MUMA 5TX7A 2F1FA 1OV4A 4RZQA 4JL6A 3NHWA 1IY2A 4ARVA 4YJ2F 4DEYA 4XB6B 2WWYA 3O26A 4JOSA 4PO8A 4NMXA 4LF7F 2IHYA 1SCJB 3WWPA 1ZRNA 1RZUA 3MUOA 3B6MA 1ZZNA 3R5TA 1MWZA 3FJ2A 2FJPA 4RTMA 3BSCA 4RMJA 4XM1A 4LX0A 3AFIA 2OAUA 3RAEC 2REQA 3NASA 2YXDA 3UB4A 2CMFA 1Q44A 3HUTA 4AS2A 3NWBA 4UEQA 3SZ3A 2R1TA 3GXBA 3P27A 1I13A 2V5UA 3RYHA 1RXYA 3W2GA 5BSKA 2XULA 1XCBA 2UXCB 5EERA 2P6TA 3U81A 4U6SA 3W7BA 2OHDA 3GRZA 5HZMA 1O4WA 1C7RA 1XGKA 3LVBA 1FFWA 4PABA 2GZAA 5DVZA 4IX9A 4G24A 4X66J 5LD2C 1RJWA 1S1TA 4EOGA 3O9VA 1I80A 2AYMA 3V8RA 1UBOS 2MSKA 421PA 1Y63A 5HKLA 1QFSA 3CC7S 3N2KA 1PLKA 4AS1A 4PNPA 3E8MA 5ICGA 4MCIA 2B5VA 3ZEIA 3B1KA 4AD8A 1LTQA 5EHZA 5JZMA 5H9WA 3RC1A 2HWWA 4GOJA 3BWEA 2OPQB 1E9AA 1QKIA 4GBED 1MGPA 2IZOA 1T95A 1AOXA 3ZWPA 4LF6B 3L1VA 1OSDA 3B6KA 3DZCA 3GRPA 4KGDA 5EKDA 3PDNA 2C2WA 2F3QA 5KFLA 5C32A 1HYSA 1P7VA 3NFRA 4LJKA 4J94A 1NSTA 2NUPA 3QVWA 3MB5A 3JR7A 2KDOA 1SUBA 4RW9B 3QSIA 2WOMA 5JNRA 4LFBJ 3OR1B 3DPIA 3BIWA 1XJ0A 3IFEA 2WRMA 3A6JA 1JEDA 2PUBA 4IUDS 1I0LA 4RADA 1Q57A 4LHWA 1DQ9A 3TJRA 4U2KA 3RVKA 4W9MC 4DIOA 2CFSA 3HLUA 5IUJC 5K20A 2QUJA 3M89A 4E8UA 4ETNA 1QSSA 2WT9A 3U7EB 2P0AA 1ULRA 5C9ZA 1SUWA 3Q6NA 2DGTA 2IVZA 3ILVA 5CMLA 1T6NA 4TT8A 4BVHA 4C1NA 1H9CA 5MN4A 4HNTA 4JI5J 4B85A 2C7GA 2H2WA 3FPBA 1I5OA 2C97A 2UUAJ 5LSRA 1YKSA 2Q9AA 2P9EA 2DB1A 3FUWA 3I0SA 1NYRA 1BHNA 821PA 1Q1ZA 3N6LA 4IIYA 2AJQA 4J9OA 2FDCA 1WSAA 3QKRB 2C96A 4LYHA 2WWRA 4YR3A 5EQTA 4P8RA 5BN5B 1EE2A 3USZA 3IVGA 2WU1A 1V11B 5CYMA 1T9VA 3OVBA 2VSQA 4YWHA 4RV5A 2C42A 2F65A 1OWOA 2OMLA 4CMBA 5I4CA 3R7BA 5D3GA 3HKZD 2HK6A 5A76A 2G1AA 4BQRA 4RLFA 1V5IB 4GYJA 2FETA 2C1XA 5GV8A 4Z3DA 3NVDA 3ROMA 4WDQA 1NNEA 2X0JA 3GTYX 2ZTHA 2BTOA 5I51A 4N8OA 1AKUA 2VHXA 4FDAA 3AHFA 4UU8A 2LNDA 2H1IA 4R4JA 4Q0BB 1U4SA 4HDMA 1AQNA 4Q9KA 3DGPA 1WMDA 2FFHA 2HNDB 3UNGC 4HATA 2OT3B 2MY7A 3CWZA 3ED5A 2LTAA 2Y1DA 1KWMA 1LW6E 1Q0PA 2B78A 2VZEA 1W5TA 1NQXA 1HARA 3QLVA 4BFVA 1XTQA 1Z25A 3TX6A 2K3KA 2W9CB 4OHYA 4TTSA 4LX8A 2YC2C 1BU5A 2QTWA 2PJUA 3Q22A 3U9LA 4TU9A 3EDQB 3ZHRA 1ISHA 4AMUA 2PO5A 2HJ9A 3LH2S 4G36A 3VPGA 2IYEA 1BEUB 4L3NA 1DAMA 4DL3A 3HHNB 1EX8A 4WD3A 4DPUA 1L4MA 1JDBB 1ZQ9A 2CNOB 2GCPA 5E2BA 3DNCA 1JHZA 3WGOA 2AOVA 3R0QA 1DQAA 4H7DA 4ZYYA 3ZY4A 2NZUG 5LP1A 2ECOA 3WZ0A 3HZGA 3SF8B 3UT5A 4HTFB 2GK4A 2D8AA 4BP8A 2RGXA 1HQEB 2J3EA 3FHCB 1HQCA 1MOZA 5L1IA 3ECSA 3LPCA 3ZY3A 3QEKA 1O0BA 1WXXA 4KN9S 4RK6A 4PS0A 2PU5A 5J40A 4G2TA 5MAOA 1E6VA 2XCTB 4X8HA 3ZE1B 2I8AA 3CDUA 5G1OA 3U48A 4BY9E 1QTNA 1UADA 3LP0A 3MXOA 3Q2OA 1Z73A 3AMVA 1PT6A 1CS4A 2FKNA 1VISA 3GU3A 2ZBCA 2G17A 4KN8A 1BWRA 2JLWA 4JAVC 1Y5MA 4ZT5A 1FOEB 1T2NA 4DWJA 1XEWX 3DF9A 1SXQA 1AKMA 3FBCA 3ONEA 2ZYDA 4J9QA 2VEDA 5KJFA 3U4QA 1RXEA 3INGA 2AZ3A 1AB6A 1N2HA 4J1QA 5HZGA 3W8PA 1DIAA 5B37A 3AKYA 1QQ7A 4CDGA 3VVCA 1KL7A 1Y5IA 4AY3A 3C7CB 3OZBA 4WX2B 4JYMA 1H8HD 4HDQB 1W93A 2RAPA 5ARDA 3CCES 3T15A 2J87A 4KUEA 3TTUA 3VU1A 3F5DA 2O05A 4JUIA 4C05A 3IG1A 1LRKA 3D5EA 1AHPA 1AUVA 2EU8A 4AKGA 1FP4B 1BMFA 5A9SB 1REQA 3WB9A 2ATXA 4E5DA 3SY8A 2ZJZA 2BSXA 3A0UA 5IABA 1WTAA 3EDCA 1YHZA 4E2FB 2OHHA 4K9OA 5JY1A 4KHMA 3LY7A 4QOIA 4B6OA 1FLAA 2GRAA 4ILRA 4BO2A 1UVMA 2DD8S 2AWOA 2PPLA 4DYDA 1GPYA 1ZGBA 3PC8C 3OOSA 3LTOA 3JQBC 4ZV7A 1E9VA 2ID7A 2B94A 4X6UA 5WRFA 2QA5A 3T19A 4FPRA 4Z2AA 5KG0A 3OM8A 2UVQA 1EEXB 1YZTA 3E1SA 1RKJA 2HV9A 1O3YA 3IR5A 3LNTA 4TTTS 3R5FA 1E0JA 1MSWD 3KQYA 1R43A 5CPFA 2GF0A 3HCWA 2GX8A 5ETPA 1EPUA 1SD1A 5EWJB 2YYAA 5DBIA 2R44A 2W93A 4RH0A 1RJDA 1EB8A 2HBRB 2OG2A 4DA8A 1AHIA 4WZZA 3EGXB 4LYJA 1RISA 5D78A 2AR9A 2ABWA 3H13A 3DZIA 2ZIWB 2IJFA 4FR2A 5K99A 2YC4C 2V59A 3UJ7A 2JATA 3OKFA 2FZLA 1UFRA 4HXYA 1L4KA 1A4RA 4PQEA 1G8HA 5B1DA 1XIVA 3GJ0A 3PRHA 7ABPA 2YVKA 1JJFA 2WG1A 4DA6A 1T9WA 2HWXA 3ZVRA 4DG1A 1M76A 4JELA 2M6KA 3VVBA 3EB9A 4V19J 2H5IA 3HXKA 2NGRA 1J20A 4B0PA 1U81A 4FF2A 3V4MA 5CVJA 2P30A 3HO8A 4LF5B 5FLXY 3D6JA 3W5UA 4AP5A 2C4VA 1IJEB 4WGGA 4KAFA 3CF6R 1Z6AA 3O6QA 3PEJA 3M70A 3CBQA 2H3HA 3IP9A 5KHLB 3TI7A 2R8EA 3DT9A 2YBDA 4MS1A 1H5QA 1T5DX 1X94A 5BYAA 3SICE 4B9SA 2QW0X 1NQ5A 5KMGB 2HXGA 2BA9A 3PEFA 1SC4A 3EVTA 3ZGVA 3M4ZA 4IX1A 5A2QA 4S1NA 2I5PO 5FBWB 4JBCA 1RAAB 2BL4A 4ER0A 1Z68A 2DJ5A 2Q1WA 1HFKA 4O1IA 2XECA 1NFQA 3J7ZT 2FX3A 1TEVA 4WNAA 5DRYA 1DTQA 5AK3A 3DH0A 3HFZB 2IAJB 4ZMBA 2VHJA 2AE1A 3FOCA 4HR2A 5D6GA 2PXAA 4NOJA 2KYXA 4KTTE 1QJ4A 4C6TB 2Q7DA 2CJQA 4ZYUA 4GR9A 4TSFA 2GF9A 1FJXA 3CJ3A 1KBOA 5L1KA 2DE0X 2P69A 4OB7A 4C5BA 5CNKA 2YV3A 3TAMA 1RXCA 4CBVA 5F64A 1PGNA 4G1VA 4TWRA 6YASA 1XQ1A 3THVA 4O23A 1RWVA 1XMQJ 1N2OA 3VZPA 2PT9A 1J56A 2XMSA 5LUBA 4P3NA 1XRQA 4YRDA 3H40A 5LJIA 1E2PA 2AYXA 1UEJA 4JYCA 3ZV6A 4UOZA 1AK2A 4DV1F 3KJHA 2YUTA 1L6RA 1YBVA 4LF1A 4B2IA 3U5TA 3J80A 2I67A 4RPJA 4I36A 1G2OA 3OIWA 1B0AA 4D3SA 2BELA 4EJSA 2MSLA 4M86A 5D00A 3IA7A 3BMXA 1YQUA 4EMBA 2C7QA 1RT4B 4ETMA 4QNRA 2CCKA 2QEXS 3KLMX 4FONA 3KQHA 3N59A 4HPXB 1WABA 5C2JB 2CQGA 4LR9A 1AYEA 4K03A 2F62A 3IEUA 2XHEA 4IIUA 5KU7A 2BDEA 3ZI4A 1VQLS 4WXWA 4EBCA 2CVOA 2WJWA 4N8NA 4FCCA 4MVJD 3H0CA 3EXFB 4J9NA 2MJLA 4B3TF 4BFSA 3GFHA 1K97A 3A05A 3DZKA 1LWCA 1P6TA 4FR0A 3WVNA 2J32A 2I9SA 1PAUB 5IC6B 1UFLA 1LTHR 2QMOA 3PX2A 1ZCAA 3FNRA 2I4TA 3K9CA 4EJ6A 3KOZA 1QWOA 2J0SA 1PJ8A 4EHBA 4D3DA 2YV2A 2LWIA 5K0JA 5A7GA 4XJXA 1F3VA 4WK3A 3I9KA 1Q8LA 3UWDA 2XQGA 3RT1A 5ER6A 1IY9A 5FLEX 2MYPA 2YQ1A 3KHSA 3RFCA 1T4CA 3I28A 2BCGY 2D74A 4MK7A 4X63A 5DG8A 5AVZA 4Z4GA 3WTCA 5CHYA 5EE9A 1ZGJA 3N39C 1Q0QA 1VM6A 1LW7A 1SHTX 4DMFA 2Q5IA 3RJTA 4V0LA 1WORA 5L3SA 4G65A 4CLLA 2E5HA 1B6GA 1X1CA 2B99A 3DCAA 2VI5A 3QRRA 5BXIA 3PNBA 5IM0A 5FUBA 4Q7QA 3DEIA 2JEIA 3PG5A 4CIAA 5C7OO 1EQ2A 3PL1A 4B81A 4BEJA 3ZDAA 3E03A 3F71A 5D4LA 4FSXA 1M8KA 1UA0A 3ICWA 4A4DA 2IIPA 4DE5A 5LP6B 3T35A 1R4ZA 1R27B 2OBMA 3NTQA 1HI8A 2MQQA 2WKSA 4D8YA 1OWLA 1FB5A 2RC5A 1XVIA 4EW3A 3TX0A 2VYQA 3PDIB 3L8MA 1V8OA 3OICA 1OLXA 4BLSA 3QF4B 4DUGD 5A2QU 1CZOA 5A5FA 1WLYA 1G3OA 3OKPA 1OD6A 1XALA 4URYR 2I55A 3FIJA 1RIIA 3NP7A 3T3HA 1P5FA 1GPWB 3RJ5A 3UPFA 4H54A 1L5GB 1TGYA 1QHIA 3ISJA 4TN1A 4I6GA 1WB4A 4DZRA 2GO7A 2V0GA 4Q6BA 6FDRA 4MS3A 4Q7MB 2B9EA 4ONEA 2R7TA 1JDSA 1TL7B 4FMDF 1QNFA 1RAIA 2GAGC 3CZRA 4M9RA 5M2QA 2O3TA 3UDLA 3RKUA 4G0ZA 1JWLA 1VJTA 1UBEA 1OX5A 3EA0A 2D1RA 1U0TA 1WCV1 1E2DA 3WA7A 5KNBA 3GC6A 4Y28C 3AXKA 4CT4B 3W5XA 4HLUC 3THPA 3PPYA 2EIHA 1U28C 3WAGA 1MABA 4X8LA 5D85A 1CT9A 2BJ7A 1BD6A 1RYRA 1P0IA 3L8ZA 2BEVA 3PGXA 1YGPA 1AQYA 1GT91 3RIHA 4PW0A 4QYZJ 4G26A 4HAZA 3EF1A 2NTVA 4FMPA 1C0EA 3L1UA 3KK3B 1ZHOA 2QG9B 3AJ9A 3LGXA 4MLPA 4BIIA 1QIDA 4WTOA 1U9CA 2I8LA 1PYDA 5ISMA 4XTRA 1U2GC 3PQEA 3J80U 3NH6A 4JMLA 4ECUA 2HL6A 4KQWA 4Z7QB 2AT1A 5M2RA 4R9SA 1GAXA 3HFRA 3QE9Y 5DQHA 1EBUA 1OY9A 4Q3EA 1KLNA 1X2EA 2HMUA 3TIIA 3JQFA 2VWQA 1HBUB 2BJ1A 1UEUA 3LXXA 2Y8WA 3EISA 4AZ0B 2K2PA 4ECSA 4DYHA 1J5EJ 4B3BA 3DTVA 5K4AA 4FYXB 1XP8A 2H29A 2UDPA 4X44A 4CUKA 5TE9A 4L5JA 1U3CA 4MVJF 2V69A 4F2HA 2BRUC 1WCXA 2K7ZA 3MS2A 2HMIA 4QSHA 2CVZA 3PFWO 5AUPB 4M49A 4B6EA 1N6QA 4TQ9A 4LF7J 3OXGA 2Q6CA 3I2YX 1LPNA 2W8LA 3IHTA 3P20A 3Q9NA 1F60B 1NH8A 2HKIA 4ID9A 2BGNA 1GU7A 4RMNA 2UXBJ 1KAEA 3UC5A 4CLKA 1CZLA 2VJMB 5EHNA 5ALXA 3E01A 4MI3A 1M1NA 1KVQA 3BSYA 1BGWA 3RGIA 3H87A 1A2KC 3VR2A 1K3TA 5GJBA 3M6AA 4YRTA 1SKYB 3E2IA 3KMSA 5CGQB 2XDAA 3TQHA 4PVCA 1AKVA 3GEPA 3EXIA 4WCVA 2Z2KA 4O08A 2VDJA 3O38A 3UR3C 2J0UA 4FKBA 1JZTA 1D2MA 5LFAA 4JHLA 4N5HX 2XLIA 3W5BA 1U98A 2QU8A 1TMYA 2JD1A 4NCIA 4AMZA 4TMTA 4RZ3A 1S4MA 3WX8A 3LSTA 5GMEA 5JQGA 2V2KA 2VYVD 4KC5A 1MF7A 4WE1B 3UCUP 3AKCA 1N5YB 4NE9A 3LLSA 2AMLA 2HSDA 5TQ2A 4C98A 3W9BA 4PKDB 2PUEA 1UM9B 4WN3A 1I6KA 4NAUA 5C5EA 2PFDA 5DYGA 1YZNA 5CDTA 2HSEB 3EH1A 3G1WA 3GJRA 4IIVA 4YR7A 3GNLA 3O4JA 4LY9A 2H07A 3GFOA 3N5BA 3T5AA 1IN8A 2EKPA 5FUXA 1WP9A 3OCUA 3UDVA 1RVV1 4G5HA 1W0KA 3PQ3A 3H5TA 3TP2A 2EKDA 5TVKA 1L5KA 2DUUA 2WJGA 1BX1A 4F5WA 1J6UA 2K2WA 1WC6A 1FVOA 4FEEA 3REFA 3PHEA 2WTUA 4DS3A 4LRXA 1TZ0A 4UDNA 1UK8A 3UWTA 5DT9A 4DA4A 1UTAA 2M7SA 3R2CJ 2CVEA 1TQDA 2NZYA 4FJ1A 3QYPA 2J3JA 2ZAGA 4U6PA 5ITHA 1AS3A 3B1XA 7REQA 2VHQA 3IBTA 2DHRA 1MFZA 2VTEA 2PUAA 2YHIB 1I10A 1NRIA 1S0MA 3LCRA 2PKQP 2RB4A 3G87A 1GGEA 1DC7A 4U2DA 4ZCSA 3FYHA 3NTVA 4J0DA 1FKAF 2WE7A 3OM9A 3GEDA 4J4BA 1XQIA 4K9DA 3HDQA 2XMMA 5EJ6A 3LRXA 4A6DA 3OLVA 4M76B 3F5MA 2W7AA 3A1VA 2P7IA 3CUVA 3R3HA 1R0ZA 1YJ9S 4HQ6A 2ZUWA 2JRSA 5DOVA 4NHOA 3TNJA 4YONB 4ZN6A 4LXYA 2Q7OE 1FQJA 5DGHA 2G0AA 4OL9A 4HNHA 2HMWA 2LMIA 2BE7A 4BVAA 2DRAA 2PKXA 3CMMA 1CEZA 2C61A 1Z16A 1DQYA 5DTJA 3MJEA 2XNDA 5BQFA 3ABRB 2WBRA 3TCKA 1LVGA 3K94A 2BR0A 2GO8A 3KAKA 3BH6A 4EO6A 4L0DA 3PXGA 1U3UA 1S59A 2WKPA 1Y48E 1E69A 2YVLA 2EFCB 2GUGA 3EAGA 4RW4B 1F2TA 3HU5A 2PO7A 1PZHA 5JPIA 3KYCA 3QIPB 1PBUA 2QKYA 1KAGA 3EJWA 1AZSB 2YKMB 1JQ5A 3BUSA 2FW9A 2UUPA 5DW0A 3Q41A 2GXUA 4LSLA 2QLFA 4V3CA 5A3JA 4H6VA 2B4UA 3AOEA 1O89A 1OZGA 4C8NA 2C95A 3T5HA 1TO1E 2QX9A 1SKRA 5BV0A 1UEIA 2P8SA 4NJMB 1JXAA 4IL5A 1C81A 3L7KA 2EP8A 1PBNA 2B1JA 4M5LA 1JLBB 2B21A 4HN4B 4TY8A 1KYWA 1ONNA 3GGPA 2UYQA 5INTA 3EY4A 2Z4PA 4BC7A 1VCOA 1WCYA 5AM1A 1UDAA 2Y76A 3NNSA 1B7YB 4DC1A 1DDIA 1E2FA 2PTGA 4JA0A 3UAOA 3L6CA 1NK6A 3DTYA 3A4LA 1B1CA 1LQTA 3CF5Q 4TXSA 1X7XA 3H5RA 2QSWA 3F56A 1E6WA 3C8ZA 5CDFE 5FTLA 4GMDA 4KUGA 2CNNA 1IR0A 2J5XA 2RK6A 4WFBQ 3ICVA 5JEDA 2DQSA 3ZYZA 1TEHA 3MT8A 1P81A 3L05A 2LDXA 1VS3A 3DR5A 3GT4A 2BMFA 2BI7A 2XZPA 4CIVA 4ZVOB 1DCKA 1Y3IA 3R74A 3OQPA 1N92A 5KYTA 5IT0A 5E33A 1SCUA 1RADB 2JH9A 1L3KA 4CO0A 3S8MA 2OKCA 3OOYA 5FIIA 3O8CA 3LANA 2F7VA 5EDWA 1C41A 2H31A 3A4IA 3GLHA 4YMHA 4OQMA 3OJFA 4K9LA 4AWAA 4HY3A 1CQJA 2AD1A 1L4UA 3DO6A 1XLWA 4KAJA 4NESA 3DT6A 4ZIWA 4IRDA 3SM3A 4ZI2A 1PIEA 5KTMA 1XBWA 4BN5A 4M1MA 2A3RA 1V16B 1KEUA 1HZZC 1NSAA 1L1EA 4BB0A 2ZTMA 1BVYF 4F4KA 3E9YA 4RZUA 3RYCA 1GZ7A 4F6RA 2O8EB 4D4HA 1EE1A 3QBTA 1Y42X 4CH7A 1E79D 2QLTA 1V39A 4YJFB 1ZH4A 4XVRA 1J33A 2IZ5A 3PXAA 2D3WA 2CE2X 4ANCA 3TUIC 3B38A 3PITA 4ALNA 1NF9A 1IBLF 4CN9A 5AHWA 2NW6A 2LA4A 1RWNA 4KO0A 5IYZB 3GJZA 3W2EA 4FYHA 4NZ6A 5K45A 2FA9A 4AJIA 2APOA 3O4GA 1DOZA 4YX9A 2X7IA 3P8BB 4O4GA 3DDNA 4JIGA 5J4HA 3I9V9 5HSPA 2V7QA 5DNDA 2DY1A 3QPCA 3M8RA 3DLHA 4YP5A 1Q1AA 3FFAA 1JHRA 3NYWA 5U4XA 2DTDA 5AW3A 4KT0C 4YRQA 4LDAA 5TRTA 2DECA 1SOMA 4RHTA 3WLHA 4X4NA 4N40A 5HFAA 2ERYA 4EGJA 4FFSA 4EF6A 2C9MA 1PBTA 5KSZA 1FXUA 4ZU3A 5LXRA 1KS2A 2MKKA 2ILTA 3BJMA 4FKYA 1XNRB 1T9UA 1VIXA 1ZIOA 4GR5A 3TJ8A 2LRHA 5LSLA 1GVNB 5AICA 1MQ9A 4BECA 2EHJA 1XG5A 1N4AA 3RUPA 1U0FA 5HVHA 4IP0A 2WQ6A 3Q72A 5BNZA 4RM3A 4RA9B 2DM6A 1T36A 1QUFA 1EX1A 4AAYA 4M38A 2BQ3A 2XVZA 4YAIA 1U0JA 4FGZA 2XZOA 1V25A 1X1DA 1XK8A 5K6RA 4F2SA 1TZ2A 1R9MA 3G5TA 4RTKA 1BCSB 2VA3A 1GV1A 3NM4A 1MWQA 1OXVA 3UJDA 4MDEA 2HXSA 3U09A 3W9JA 3H9JA 4QFMA 2MDTA 1XU4A 4CEIB 4CM9A 1C29B 4UOCA 2FPLA 3UPTA 2P2ZA 3HF5A 1HW9A 3NGDA 2R9VA 4C9BA 2XUIA 3I42A 1VL5A 4D3YA 1INLA 5A3SA 1MMLA 2QZ9A 3WBFA 2QJ3A 1AUOA 1HT0A 4D80A 1FTQA 5E6RB 4IIHA 1R6UA 1GFSA 4HHHA 4PGFA 2W6IA 3OESA 1QP7A 3BMCB 4J43A 1ZGCA 1DQ8A 3NJ4A 3PQ4A 1ZSYA 3EXHB 4L72A 1CR4A 5KG7A 4YMSA 1I1NA 4O3FA 3FN4A 4CQLB 1JWAB 3O7WA 1BQMB 4Y2JA 3TM5A 2QPAA 4CTNA 5DCUA 4AKTA 3ROPA 3AWIA 1N8TA 3MW8A 3V8BA 3VPXA 1S6YA 3Q7PA 3ZVLA 5EHXA 4MV6A 1F0NA 3JD2A 1NW8A 1YBUA 1KP9A 3GUCA 4RKYA 5HF8A 1U9IA 2GV1A 2WFZA 3TZWA 3MOGA 1BMQB 2WHXA 1BVHA 1VL0A 2FJVA 5K8NA 2FJWA 3CIFA 2B7LA 1YG0A 1NY5A 2CNWD 2X5JO 2FG5A 5EE3A 2XCIA 1FPQA 1WU8A 1YCHA 2JEYA 3GLFE 3S3TA 1XJ5A 4DAOA 4XWWA 4YJ3A 4EAAA 2JLZA 1BQNB 1FNSA 3KTAA 1KO7A 4KX3A 2OPSA 2HZBA 2CJXB 5A02A 4DV1J 1FDDA 2ONYA 1QH1A 3D2AA 2O2YA 1LQ2A 2M2IA 3A6PC 3R7NB 2HQDA 2HQFA 1OX4B 1PR1A 3VHXB 1SIUA 1DG3A 1NHWA 1ORTA 2FY1A 3FXAA 3AVXA 3OU6A 4WFYA 3BXOA 2VICA 1WVGA 1YIOA 2GNAA 4KXLA 2LU2A 2EAUA 3TKAA 3B5IA 1SQGA 3K35A 8MHTA 2W8BB 2GHWA 3IDAA 3O8OB 1IR2A 1J49A 3AHIA 3K70D 2ZXEA 3SS7X 4UVHA 1J39A 1X4AA 2ZC4A 3EFOB 5K03A 4Y3CA 4CI9A 1EHWA 1F5SA 5T4FA 1O95C 3M9XA 4O3SA 5IFKA 2B4KA 1FRKA 3LY5A 1X13A 5A0TA 2I4IA 1G6KA 3K2IA 4NMXB 5G0SA 3ZEAA 3KLPX 3IVAA 3TOZA 1E6YA 2PKWA 2UUCJ 2V7TA 3UXYA 5SY9A 2YKQA 3CCRS 2Z0GA 2FMKA 3UN3A 4EY4A 1HQUB 1N2SA 2EL9A 3KP1A 2CKDA 1KMHB 2REQB 4BNYA 5DCYA 4G4IA 4ZQEA 3V4ZA 3Q85A 4ZZIA 1F4LA 4AIRA 1KXZA 4B3TJ 3SHVA 1R0AA 1QVWA 2YFHA 1MMFB 1BA3A 4NOMA 2K1RA 4CYUB 2ZYHA 3D8SA 3VGVA 3RYHB 2WABA 3ZV5A 1A3CA 2FZVA 1GPNA 5K01A 5DLPA 3KHLA 2GJ2A 2HRUA 5FNVB 3NVKI 1TF7A 2I2BA 1FFWB 4TKTA 2YJ5A 4OGGA 2BSQA 1JHXA 4EEKA 2DHSA 3OPYA 3MINA 3QBVA 1U11A 4F91B 3TRHA 4OGLA 2G40A 1S1TB 3G9CA 1TLTA 4ZQCB 4IO1A 4MWTA 3LBFA 3I96A 4DG5A 5F9HA 4YTEA 2HFUA 2IX9A 1UXIA 1F0PA 5TMPA 1JLHA 2GD1O 2DNLA 3N2KB 3N5FA 2OCYC 3VDMA 1R0XA 4MMZB 5TVGA 2OXCA 3S7ZA 2CPIA 1K7YA 2EFHB 3HHLD 2G28A 4B4KA 2Q1SA 4MQUA 5GAGU 2RF2B 3FM9A 2M8DB 1NJ5A 3C5WP 3TLBA 4ED8A 3IR7A 2QQEA 2IM1A 4Y6LA 4TYWA 3ZHVA 1M2GA 4ZPDA 2JAPA 3QT8A 4LJ4A 3H4DA 3C87A 2ORYA 2IHVA 2NUPB 2VD3A 3BRWD 2WK1A 2IM0A 4M0LA 3EPIA 2OECA 4DUPA 2WOMB 4ZEOA 4Z54A 4NZYA 5H3LA 3QEBZ 5IDYA 4B3OA 1MOSA 3IOBA 1QSLA 4PSCA 1UP6A 4UBKA 1WU7A 4UHHA 3D67A 3I73A 4FFRA 4FZRA 1F1BA 4LZAA 5ECWA 4GDFA 3GJYA 4BFZA 5HANA 3WLOA 2WTMA 1FX2A 1E9RA 3HYRA 4KSYA 1EZ1A 5T4HA 4W1QA 2ZSJA 3GFFA 2CFIA 4EDFA 5IT9Y 3IAS9 4C7QA 4CCHA 5AO9A 1M75A 1RT1A 1UWKA 2EFJA 5I7VA 3LX6A 2XIJA 3H11B 4FFDA 4CV0A 5EIOA 3K0SA 2NO5A 3KKLA 3I0SB 3VDQA 1KQSR 2LPMA 3V5NA 2KX7A 3UT0A 5A5DA 4MULA 3OETA 2JI9A 4ESVA 1WKLA 2DNPA 4DQUA 5E8JA 2G4CA 3WIVA 2WB4A 1YIAA 5EUBA 1UM8A 4CM3A 3IFSA 4M5NA 4LZOA 1WETA 1RNLA 3GJ7A 2WA1A 3QOYA 2YFYA 5ALKA 5CYMB 1ZINA 1P9OA 1RB0A 2FJBB 3EF0A 4LV6A 1NVUQ 3DYBA 2XADA 4HYQA 1C4KA 3UFBA 3VR4A 2ZR0A 4NCBA 2I7CA 3R7BB 5D3GB 4JV5B 5F21A 2POCA 2HJSA 4MXDA 1MGOA 3NYIA 2PUGA 1U2TA 4NTZA 1I6MA 1QYIA 2V67A 2VNJA 2RKOA 4WU3A 1K66A 1R0BA 4NCAA 2LP4Y 2IKQA 1KWGA 3RYLA 2O9JA 3BCSA 4WZQA 2EHDA 3MTGA 1LVHA 2G9OA 1L8OA 2XE7A 4PE5B 2LQ5A 3FRZA 1KO4A 1QRDA 5CCDA 4A8XA 1J2TA 3CUUA 4I4TF 1I6LA 4BLUA 1MW7A 5HUQA 4GOXA 3B8EA 4LQ3A 4D6YA 1LC0A 3CSSA 4U7JA 3KXIA 3N76A 1U1GA 5C25B 4JWTA 3QWHA 5KJ1A 5DNUA 2Z83A 1QGUB 2QTWB 4G0QA 1KYYA 3AJDA 1C9EA 4I4BA 4CNZA 5BYQA 4C4PA 5ALDA 2R7UA 5JCOC 3NEKA 4UEWA 3P2EA 1NU6A 4KB7A 1BXRA 1RM4A 1E2NA 2PS9A 1JTVA 2KMLA 3HEAA 1QG4A 2H8GA 4QOGA 4FYYA 5DDRC 4YBRA 4QICA 3OFSA 4INJA 1N5IA 2V8HA 3UV6A 1VCTA 3AYXB 2BH9A 5E7IA 2YX4A 1ZTWA 4EWLA 1E1CB 2ORED 4WPGA 4HB0A 3UT5B 5EINA 3AJEA 4GPBA 1UAWA 1B3TA 2GS8A 2GVDA 3H9EO 3UGTA 3NEYA 4MRMA 1F9EB 3TJ9A 4TL6A 3FMBA 3WQPA 3TVYA 1BMDA 3Q3CA 4MQFB 3KE8A 4IYJA 5T6MA 5DI3B 1J8QA 1JJ2R 3FUUA 3ESXA 4RS3A 1R0CB 4N49A 2ZS7A 3RWBA 5FDFA 5JFTA 2J9GA 5DX8A 2P3OA 1UPFA 3LUYA 1SPBP 5FPPA 1WR8A 3CMAS 5C1BA 4C1BA 3LP0B 5AW2A 3KVRA 4YGYA 1V4BA 1ZD2P 3R9IA 1CS4B 4QGHA 3UC9A 4TV9F 5CDHA 3COSA 1G1AA 2CNKB 3GIJA 4AJPA 3D66A 4ZLLA 2CKMA 3U4QB 2ZNZA 4O2LA 1ZYQA 3UW3A 4RIEA 1BE4A 5A5GA 2RAQA 2RSLA 3TG2A 1NSKL 2AR7A 2NZXA 4GYYA 2OXRA 1D2GA 3PICA 4IIBA 2RHDA 1VHQA 4PV7A 4H7PA 3UWMA 5LKRA 2RHRA 4YCSA 4MKYA 2BJVA 5C3UA 3T3MB 1L5HA 1Q19A 1CLFA 1Q21A 3IG1B 1Z12A 5BN4A 2BYTA 3H0KA 1E63A 3BHMA 1J9ZA 2V7VA 3L84A 1REQB 4HAYA 4E3ZA 1ZOSA 2BRLA 1J2EA 2N3OA 3AX6A 3JYPA 2CKWA 5TIIA 4YCJA 3Q8LA 3GLJA 3NOXA 4U3JA 2PI4A 4O3PA 5B3AA 1EXWA 2HXYA 2X51A 4OZJA 4MGHA 2XUKA 1XC7A 3FNQA 2VC0A 4B09A 3RBEA 3HA2A 2V7EA 1KOHA 1GDDA 1RLOA 5JZSA 1RTIA 1XF9A 4ENWA 1XDBA 1EFKA 1GGKA 1SOWA 1R0KA 4XVQA 4J9UE 2OFXA 4AUKA 5LYJF 3HJBA 3OFHA 4ZPBA 2CJ9A 1KDVA 3IR5B 2BR3A 3EASA 1G8MA 2I3AA 2O0LA 5ECYA 3KVVA 4DV5B 3N86A 2GTPA 4FKZA 1SOUA 5CFZA 3OHPA 4IDKA 4G5XA 2ZSHA 4LHZA 4MUIA 1RWPA 1M0EA 2MPUA 2HA6A 4HDRB 4BQEA 4B6GA 2O2GA 4CFZA 3ZWBA 2J7WA 4H3HB 1FMFA 1Z5VA 3PUWA 4ED7A 3QYAA 5I01A 2DXFA 5TGDA 4N7BA 3ZCVA 2AIRB 3GYGA 3IP5A 3FLAA 2CB0A 1FNXH 2YN2A 1LSJA 2P11A 3QFWA 5KYKA 2HQIA 4PZDA 4NBSA 4DG1B 1H2XA 2Z5LA 3L0ZA 1R6DA 5J1SB 4B33A 2QRVB 1S99A 5H9FJ 1CUAA 2H5IB 5LQMA 4U00A 1XWLA 1SB6A 3S68A 1P1JA 1MRZA 5I3UA 1J2UA 4ZPXA 4Z9XA 1KOOA 3CDWA 5F8JA 2DFDA 2CMHA 1SXJE 2VNSA 4QGBA 4IFTA 3DXXA 4FQ5A 1FFXA 4UOQA 4YAJA 3LKZA 4IEEA 2IZ6A 4TTJA 3FKQA 3TSZA 1ENPA 3I8OA 4IWYA 3DLJA 3SQGB 4YPOA 4MS1B 5K3CA 1P80A 1HDRA 3PJXA 3CZ9A 3DRYA 1FNDA 2CFTA 4LRSB 4FIDA 4N01A 2QX7A 2EDAA 5DYWA 2QQ5A 1J8VA 4YB1P 3FPHA 2J67A 1C7EA 3WGQA 1JT9A 3EXG1 1QNLA 1GMWA 3LUBA 3ZK9A 3R6WA 3UJBA 3PNKA 5ANRB 3OMLA 4RJJA 3C15A 1LXCA 4GGMX 1Z0ZA 4XPIA 2A84A 4QO7A 4WZAE 2ZWOA 2YZ2A 1CQWA 2Z2YA 1IUNA 4GW3A 4MKVA 1E6EA 4MB2A 1X19A 1YA6A 1N36F 1HH4A 2C8LA 3LX5A 2MZRA 1QRSA 2ZDPA 1S2DA 3TQQA 5JZVA 5FUYA 3TAMB 4A16A 4L4RA 4KR6A 1B93A 4M5DA 4ND2A 3TG8A 2PD3A 1RT6B 2QAGA 4GQBA 3ZU4A 4LR7A 1CHDA 4RL4A 4JUZA 3HI9A 1TL1A 1A9PA 3VR5A 4A73A 5JAZA 3MTIA 3ZDRA 4OYYA 2RH4A 3RIXA 2BH2A 2QRPA 1DBQA 3HCEA 2X7HA 2CK3D 1RHRB 4ZZ3A 2AF3C 3AW8A 3KZCA 1U3FA 2FH5B 2HU2A 4K1LA 3VJLA 1UL3A 4W90B 1CC7A 3M8SA 3KELA 2CL0X 2VK2A 2Z8YA 2NUBA 1Z2NX 1F8YA 2NYAA 3EVEA 1GARA 2EARA 5KTOA 2A7XA 4L5BA 2IXTA 3DW3X 4M7PA 1QK5A 3BJEA 5J4KA 1WACA 2P78A 2AFHE 4D74A 3STUA 3AH8A 2CB9A 5CFLA 4DFMA 3F90A 2H18A 1KP2A 4I68A 4ZLJA 2IV3A 2ZJFA 1Y4ZA 5BUQA 5E9QA 4BLGA 4MWBA 3ACBA 3KXDA 5BUZA 5BN1A 3L18A 5CIYA 3LLUA 4G1UC 4W8GA 4WOPA 1KF0A 5KNDD 2Z30A 4CO1A 2FVYA 2O0MA 4UFOA 5J59A 5JASA 4ACAA 4PNEA 3NUQA 3QUBA 5D7BA 1ZN9A 5AKXA 1QR2A 1IBLJ 4BBJA 1MJ5A 1WXWA 4RGBA 4MYHA 4XD2A 5AE3A 1E1MA 2GBFA 1H0SA 2W4PA 4LDRA 4D4IA 2ZBQA 1LWCB 3T5JA 5JCPA 5G0UA 3LDFA 3CLVA 2IEBA 4OK3A 3EDYA 1LLDA 1MC4A 1JLFA 2CDRA 3C6TB 4BNJA 2A0KA 1FUUA 2QTVA 2G36A 1V35A 4DR4F 3PQ5A 1AUDA 1TK3A 4BLQA 4OA8A 2JIZD 4URZR 2COKA 3RPEA 2RHOA 2ZREA 4DUYB 3MG9A 4ED0A 3VU9A 4LZNA 2IV7A 3WFZA 2IBOA 2IUFA 3WRYA 1EARA 2D74B 2ADMA 4UOFA 2B8QA 1CULA 1XLUA 4M6WB 1AKRA 1PHPA 3I01A 4RZSA 5LSAA 4V3BA 4B46A 3H86A 5H59A 1XQYA 2R2SA 4A1FA 2H0RA 2G6TA 5L3SB 3C0KA 4XVUA 4IQ4A 1SAYA 3I62A 5IM0B 3N0WA 5DB4A 1SVLA 1HQKA 2PEBA 3TI0A 2ZRKA 4ZI7F 4X95A 5C7IO 3OCYA 4YNBA 1VSQA 3ZW7A 2UZIR 5IC4A 1PGPA 4C0HA 1J0BA 2ATIA 3RIGA 3EDRB 3ZKWA 3NTXA 5K0BA 1XHFA 2PWYA 1I4LD 4LAFA 4PO9A 4ZP6A 1E18A 2QM0A 2O2DA 4OV6A 4BNTA 1Y1RA 3KPWA 4CR7A 4G5OA 3D9BA 4UATA 1DC4A 4D3ZA 3ADDA 4RZHA 3HSGA 2F43B 1OLXB 3WL4A 1B43A 1X74A 1NP7A 3NG8A 4N3AA 2ZBIA 1BA2A 5EPOA 4EG4A 2KBEA 3QXJA 1U63A 3EXEB 3KUEA 4DV0F 1AUQA 4C5AA 4PWUA 2OD2A 1V3VA 3DI6A 1XZLA 1Z5NA 1Z0IA 4C89A 4MIAA 3ETEA 5DLGA 1T9CA 1DLIA 4QC2A 3BM7A 3V8MA 3JARB 4C8YA 3DAPA 4M9QA 1YA4A 1TUEA 1MO4A 2NT4A 3ZBUA 2QTGA 1C1BB 3ZI7A 2CLLB 3AOGA 4MTCA 4UEKA 1MOQA 3MVEA 4FI3F 1FJCA 5AXDA 5DBGA 4BCCA 3NBKA 1IH8A 1LS1A 3NV9A 3OY7A 2WVBA 1VPVA 4BAUA 3TQCA 1JFRA 1BEZA 2ZKIA 1MABB 5EWLA 4DDVA 3QOXA 3G6WA 5JYDA 3ZK7A 3T0FA 1M74A 5TNXA 4B02A 2VTBB 3PGJA 3I6QA 1LFDB 3J7AN 2GRJA 4HDAA 2DK2A 2J6UA 1KHTA 1EETB 4TT3D 2BZ0A 3S29A 4D4MA 3CMQA 4I5GA 3PYLA 2PBLA 1QK3A 1ND6A 4HDNA 5K3EA 2D54A 1SZDA 5I6DA 4LVOA 2A1UA 3ZG6A 1QDEA 2ISSD 3R40A 1J70A 3TWOA 4ZWNA 2L42A 2ZRDA 5ALVA 2FQQB 3EAFA 4DJBA 3MM8B 3IPAA 3TUZC 2YNFB 4MR7B 3RYIA 4YRIA 4G01B 1ZRSA 3THXA 4HQ0A 1CJVA 3POTB 4DFPA 3MM5A 2D2IA 4JROA 4KH1B 2CPEA 4D98A 1PW7A 4ICIA 3DTVB 5FP0A 1LDMA 3I34X 5K3AA 3RBDA 2CLMB 1RAOA 4MCJA 5G0RA 4IUYA 4LJ5A 3PT5A 4E5YA 4LSZA 4Q3DA 3SF0A 2NXUA 3HCRA 4BCBA 2AXQA 5CM9C 1Q1GA 5A1JA 3CW2C 1IM2A 3OHBA 1CBUA 2C4UA 4EIWA 1XMJA 3U7RA 2XWXA 3JVUA 4GKAA 4B87A 4D5EA 1VP9A 4XTTA 3OT9A 1NR5A 2DMRA 4BO6A 4JZYA 1H66A 3S2YA 3CF4A 2PBZA 2YYZA 1T9HA 4TQGA 5CA0A 2OCGA 1PFGA 2BEFA 3E01B 5J63A 3A7EA 3ONWA 5ED4A 3TKYA 4KW7A 2D9PA 2EEPA 4HDOB 3RVQA 2B1IA 4I1PA 4G1CA 4HSEA 2IF0A 3KKQA 3FPEA 2BN4A 1VZ3A 4BCAA 1YS2X 2ZJ5A 4B3MB 1QXSA 1QYRA 3OL8A 3TW0A 2CWDA 5J2QA 4ZVSA 1ILWA 2G0IA 2X0IA 3TL6A 1E3IA 1TQ2A 4B7CA 3WGZA 4EO4A 1Z7WA 4TQRA 2QENA 3E7DA 1NV8A 1QUVA 3K70C 4DSAA 2VHWA 1M5TA 5EN1A 3ZE8A 4OM8A 1XYVA 2OC9A 3KU1A 4Y9TA 2CHUA 2FXVA 4R2XA 4P10A 1SQSA 1TT5A 5CABA 5C5IA 4RHUA 3VO9A 2NLWA 4YB5A 4UASA 1SD5A 1ADBA 1KC8T 2E49A 2O2IA 5EC8A 1QMPA 2ZYSA 3IXMA 1G16A 4IR7A 3IMEA 3V8NA 1C3XA 2IITA 1VTKA 4JI1B 1G7SA 1J9EA 3C3DA 4LVCA 5E0KB 1FDAA 3W6NA 1KZ1A 2JJ2D 2R751 2WSBA 3ABIA 3VZIA 5HKKA 5T6BA 3LD9A 1JIUA 2JGNA 2G77B 1EXNA 1CUGA 5ECGC 1FWLA 4JLOA 4R05A 5ITVA 5K0GA 3NBAA 3PBKA 4DNPA 1Q86T 3KDSE 2WM3A 2QRQA 3DKVA 4LWPA 2VJYA 3S2GA 4OYPA 3SZOA 3UG6A 4BZZA 2F1IA 3FTQA 1FU4A 1W36C 1HRKA 7REQB 2BHTA 3FVVA 2VRNA 1Z6XA 4ZHRA 1U24A 4OI0A 2CPXA 3BS9A 1VQNS 4X20A 3NMAA 2ZRBA 1AZTA 1M6WA 4DV6B 2W6JA 1FKPA 3W4IA 1PL0A 2B6HA 4R8MA 5HF6A 5KWIA 4IIGA 2J1LA 3MWKA 1XHLA 4H7JA 4UW9A 2M52A 4IRCA 5GV7A 1UMBA 3HHLC 3RTCA 1XNQF 3RTGA 3JAKB 7MDHA 4ECTA 3FHJA 2XUJA 3HCFA 4OAQA 4XX0B 4PEVA 4CDIA 4GM1A 2P2CB 2YS7A 4F0KA 4GX1A 5C81A 1ZNQO 3E8OA 4G56A 3NC4A 2V6AA 2X0DA 2EFOA 5CYPA 1VYAA 5K0CA 3OT1A 1RHUA 2HUPA 4QM6A 1PW5A 4R3NA 2Y1KA 4DMLA 4S1OA