4NMLA

2.60 angstrom resolution crystal structure of putative ribose 5-phosphate isomerase from toxoplasma gondii me49 in complex with dl-malic acid
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
257
structure length
249
Chain Sequence
MNPQDKAKQAVGYFAVDTYVRSGMKVGLGTGTTAKFVVERIGQRMQEGSLKDLLCVPTSEATRKQAESLGIPLTTLDGIADLDVAIDGADEILPPTLGLVKGRGGALLREKMIAAAAKTFIVAADETKLVSNGIGSTGALPVEVVVFSGSHTKRLLSALPSVKRHGGRAEFRKRAGAAQEDIREEDRFVTDNGNYIVDLYFTETVPDLHEMDKELKSIPGVVETGFFLDLASVCLIGKADGSVATLTAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 2.60 Angstrom resolution crystal structure of putative ribose 5-phosphate isomerase from Toxoplasma gondii ME49 in complex with DL-Malic acid
rcsb
source organism Toxoplasma gondii
molecule tags Isomerase
molecule keywords Ribulose 5-phosphate isomerase
total genus 80
structure length 249
sequence length 257
ec nomenclature ec 5.3.1.6: Ribose-5-phosphate isomerase.
pdb deposition date 2013-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06026 Rib_5-P_isom_A Ribose 5-phosphate isomerase A (phosphoriboisomerase A)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4nmlA02
3.40.50.1360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4nmlA01
3LHIA 1VL1A 3MWBA 4OQPA 2PC6A 2JOQA 4GO5X 3CH7A 1LKZA 3DHWC 1KS2A 3O1LA 2J0EA 5T41A 2MDAA 1FS5A 4GO1A 1XTZA 3E15A 1LK5A 1PSDA 3HHEA 2KO1A 2DTJA 3TUIC 3BXGA 1YBAA 2WU1A 3NZEA 2H9ZA 1UJ4A 2FGCA 3DHXA 1Y7PA 3IBWA 3MAHA 1NE7A 2P9EA 1M0SA 4L5JA 1RWUA 2P9GA 4IO1A 3UW1A 1DEAA 3OC6A 4R9NA 4LUBA 1YGYA 2CDQA 4NMLA 5IT4A 2R5FA 3AB4B 3LUYA 1PBTA 3DDNA 3P96A 2BKXA 1Y89A 3EB9A 3BXFA 3AAWB 2F8MA 3NRBA 5IT0A 3BXEA 2JHEA 3CEDA 1ZPVA 2RQMA 4PWUA 1LK7A 2RI0A 2QSWA 2NYIA 5JJBA 2O0MA 3OFFA 3ENVA 2J0WA 2PA3A 3DC2A 3IXQA 2W48A 4L50A 5IS2A 4L4ZA 3L7OA 2F1FA 3U7JA 4GMKA 2LQJA 2DT9A 1HOTA 3BXHA 3NWPA 4L5IA 3OFEA 3N0VA 1SC6A 3OFHA 1FQOA 1JT9A 2OKGA 3W7BA 5FIIA 2QMXA 3K5PA 1FRZA 3EFBA 3KWMA 4OQQA 2RI1A 3MTJA 2LVWA 1UJ6A 2QRRA 2I9SA 2J0XA 3TUZC 1UJ5A 3OBIA 2RE1A 3HN6A 1FS6A 3CSSA 4L4YA 2RQKA 4X84A 3TUJC 3ENQA 5HJ5A 2BKVA 4TM7A 3LWDA 2QMWA 3E7FA 4L51A 3ICOA 1U8SA 4TM8A 2ZHOA 1O8BA 3LOUA 1FSFA 2GNPA 4GO7X 2P9CA 3S1TA 3OFGA 3ENWA 4R7TA 3KV1A 1HORA 3TX2A 4M8LA 3AB2B 1CD5A
chains in the Genus database with same CATH superfamily
2VFSA 1L7RA 3ETLA 1CQMA 1M34E 2L18A 3OE7D 4I19A 2FJWA 5AH0A 3RRGA 4BWYA 4RA9A 4QBHA 2I1QA 4JOQA 3VF0B 5HS6A 4ETNA 2BE2B 4DSFA 5BXQC 1JEYA 3UHAA 2HVHA 3ITHB 2GIRA 3TNFA 5FIUA 1VGVA 3TJ9A 1UIMA 4HEA1 2AYZA 4EBFA 1F14A 5KT6A 4Z99A 3WBFA 1KEEB 2BP7B 2MYPA 1HNWJ 5BR4A 1JJ4A 1N1DA 1QOQB 4NFYA 1ZZEA 5LA6F 2F63A 4WQMA 3MBIA 5D3ZA 3BXZA 2JATA 2Y1OA 4O44A 1OQ6A 2ZEJA 7FD1A 3FRZA 3NONA 1NAQA 2LPMA 3ZX4A 2KI5A 1YZQA 4IRUB 1T1RA 4PN3A 3KJIA 1HZJA 4LSNB 4YMSA 3EODA 2EBHX 1GNTA 5DYNA 1Z6ZA 5T4EA 2OOSA 3DYIA 4WVFA 1OT3A 1QKJA 4RORA 4EYKA 3M1YA 3PRHA 3DLKB 2XO6A 3NYRA 2P9FA 2OAUA 1LW0B 1Z4UA 4XH9B 1GO2A 3D6HA 4DG5A 1IPHA 3UUWA 2H7XA 3OHSX 2IOYA 1O4VA 2AI3A 1T3SA 3L79A 3OM1A 2H51A 3W1WA 4YJ2B 4TWBA 1N2EA 2DH5A 3LX4A 4BPRA 2N0SA 3FIUA 2YFQA 4L75A 1E7QA 1FJEB 4B4VA 2CFOA 2H85A 3GPCA 1XK7A 3ZCPA 2P78A 1YA8A 3Q22A 1XRJA 3L6BA 4R2HA 4L4RA 3TLKA 2D1TA 1PGNA 4DA0A 2FYXA 3OQBA 2IEDA 3W5YA 4M46A 4PYNA 1NPYA 4P36A 2PL9A 1CU1A 3VVCA 2ZKUA 3SD7A 6AT1A 4FKZA 1ZD2P 2O3TA 3B1FA 4D4GA 3PNLA 1ZL2A 1Q21A 5D0HA 2Z2KA 4F6RA 4MDFA 3D59A 2IIBA 3P27A 4N56A 1NN5A 2VOOA 2GQCA 2K3KA 1IBCB 2ZNYA 2VVTA 4OXXA 5TB5A 3GRRA 3WZ2A 1Q0HA 2PGAA 3X3HA 4HB3A 1NJ8A 1RU3A 2GPAA 1JIKA 4BNTA 3T7IA 3TW0A 1CLEA 1HQKA 1NNDA 2B5WA 4MVXA 1WXIA 4AS2A 3IPCA 3DOMB 1DBIA 2IKQA 3UD3P 1DP4A 2NSJA 5FI1B 1E1QD 3L0YA 4UPVA 2QSFA 3AU8A 4CTKA 3WLIA 3LMKA 3OCZA 2I1RA 3IMGA 4WTOB 4XVHA 2ZR7A 1KH3A 2PX5A 1DUVG 2ENUA 3IOMA 4JV5B 3OL7A 2HF2A 4M0MA 2EYQA 3CW9A 2XUPA 1ND6A 4DANA 4RMHA 3HV0A 5D51S 3K6KA 3CMES 1X7HA 5DP2A 1AGRA 1EQMA 5GONA 1QGED 3LVBA 3IB6A 2PH1A 4RJLA 3IILA 2IXBA 4HQFA 5IHXA 4CGZA 1YZLA 3M32B 4RHEA 4MO2A 3M7IA 1WJ9A 3IP9A 1WV0A 2WW8A 4DX5A 4UQGA 1NBEA 3UCUP 2W2OP 4YAWA 4B3MJ 5JEEA 3W5BA 1IBSA 3CDAA 3O3LA 4ZIVA 3G71S 1SH0A 1ZISA 2YWWA 2OPQA 4DL9A 5IH7A 3CH6A 1CSEE 1FYEA 2DTDA 4EJFA 2WIFA 3VAAA 2SKEA 2BJ8A 1D2EA 4NI2A 2QYOA 3S2FA 3CGWA 3E03A 4I4TB 3VQTA 2B51A 3ULKA 1Y7HA 1MVLA 4KXWA 3AF2A 2WUGA 1MROA 3EGOA 2GO8A 4MB2A 1RT3B 2ZI4A 3M9WA 5HILA 1J00A 3N53A 3KHGA 2CV2A 2JFZA 3PQ3A 1G2PA 4JWKA 2ADCA 4QVIA 1H0KA 1QH1B 5IZ4A 1WLSA 4OMDA 2VHVA 4XGRA 2PRSA 3ZYZA 2IBTA 1A9XB 5DK4A 1YZHA 4K9NA 2W2MP 1Z16A 2YHUA 4V1Ak 3OQOA 2YNHA 2FMKA 2VJMA 1TR0A 3WHLA 4MUEA 4DIKA 4ED3A 3FSGA 4HL9A 2JEGA 2CBXA 4ARCA 2REQA 4INAA 3CC8A 4JU9A 1CPZA 1SMKA 1YX2A 2GGSA 3T19A 4QBUA 1VE6A 1ZM4A 1E9RA 3CPSA 3ND7A 3ET6B 2AYBA 4EY3A 1KDNA 2OYSA 3HXKA 4NA3A 5REQB 4OBEA 4IRXA 4Y0NA 1SG0A 3UMFA 3I5AA 4D9BA 4FP9A 3TANA 1O8BA 2FB0A 1OWNA 4DJ5X 5KFGA 1P1KA 4RW9B 1YBFA 2WIBA 5C1OA 2CUYA 3JU3A 4FNGA 1E0AA 4DM3A 1Y3CE 1YJVA 3C3MA 4H4MB 4GKJJ 4NLGA 3ZOZA 2OD9A 3WKCA 5KT7A 5A3JA 1X5PA 3RSQA 1LX6A 3PEWA 4BWVA 2CEKA 1M34A 1VSTA 4ETIA 5CFLA 1EUCA 1NJ2A 3IAM1 1SD5A 3A9CA 1SXJE 4GRSA 3HFJA 1YVPA 1NP3A 1JQGA 2JLBA 1TUVA 2R7TA 4F3OA 3E22A 3PJXA 4ZOLA 2AN5A 3RW6A 4WXRA 4C9BA 1STOA 4I1VA 5LMNB 2PRJA 3LQYA 4IQ4A 4F5EA 1RB0A 4RKWA 5DJBA 1EX1A 1EVJA 5A8RA 2CW5A 3GNTA 4RHCA 3V55A 3KYIB 1QBGA 3TZHA 5KNCD 3N2GA 3D8TA 3DD5A 2LU1A 4DPKA 3QQPA 1CEXA 1CY2A 3T5BA 4BGIA 3HP6A 2WJPA 1QH1A 4CMGA 2UUAB 3A9VA 2GPBA 2XRFA 8GPBA 2LYVA 1E3SA 1NZAA 2J0SA 1DEXA 3KFXA 1E77A 2PYIA 3KL4A 2J0EA 4C6TB 3NYIA 3VKHA 2GUWA 3DNMA 1L9KA 4XD2A 3TZQA 4ZCTA 2WA2A 1SL1A 2DUWA 3OLXA 3FCWA 3IVAA 4IWXA 1U1FA 2CNOB 3N8NA 4RW6A 3R41A 3OZUA 1LWCB 4V1CI 1H42A 1C5KA 5AM0A 1I2MA 3AZQA 1HNWB 4F02A 1KYIA 5HLFA 4K46A 4NZ9A 2W6OA 5KVCA 4Q8EA 4XIIA 3AOCA 1JU4A 4CIOA 3JWHA 5TQ2A 4I8XA 2ACKA 3GXOA 2GZAA 1XCPA 1TKBA 4HUQA 4DG9A 3RDPA 3ZGNA 2BYCA 2P4UA 4UTZA 1FMJA 3HGQA 4YNBA 4LXQA 4OLBA 1NDUA 2GO9A 1BS2A 2J1LA 1V8OA 4QGSA 1HA1A 4QVGA 3KUKA 2QA4S 4IIJF 3R76A 1OIAA 1GPMA 3IP3A 2QU7A 4FT4A 4S1PA 5IULC 3I5UA 2HHSA 3UNYA 3UUGA 2QN6A 4X61A 2J9DA 2CFXA 5I9SA 5D77A 1POXA 1TYAE 3KYDA 5BXYA 3JQRA 4NXMF 2D3UA 2RHGB 1IKXB 2WONA 2ZB8A 2ZJ2A 2NYUA 4HN9A 3CRNA 3C4JA 3R9XA 4PC3A 1IMOA 3DOMA 5TQ2B 1CZUA 3UPTA 3I9OA 1THTA 4QNNA 3SEAA 4U6PA 2B4UA 4ENRA 1OYWA 4NCIA 4IM7A 5AW3A 4NPOA 3E8OA 5B7WA 5CYGA 3ITDA 4QWEA 1XV5A 3DBHB 4MVJF 3SY8A 3DC2A 3HSGA 4QKQA 2UAGA 3H1FA 8MHTA 1UEVA 1BRMA 3DPIA 1M2OA 2D1CA 3CNNA 1ZN9A 2PKQO 4ID5A 2MKHA 3QE3A 2JBWA 2RI1A 2G80A 2GILA 4OZ3A 1SJQA 1X8XA 3VAYA 5AYVA 2XMCA 1PWEA 3HSZA 5DTQA 3RFTA 4P0TA 1VLMA 4N18A 2E2WA 3RHZA 7REQA 3C8DA 3NETA 2C9OA 1F6WA 4ISCA 3U1LA 3A1SA 3MPUA 3MTKA 1A96A 5HM6A 1QG0A 1WW8A 1FMCA 4DV2J 4YY3J 5ALWA 1XD8A 1RM0A 3LT1A 1E6CA 2I9KA 3FHJA 3ZH9B 3KAKA 1U81A 5JXHA 1C9EA 3BE4A 4YOEA 3SC4A 3ZD9A 4R7GA 1V3TA 4IS3A 4R8RA 4F85A 3IJEB 2HF8A 4ZT5A 5A1JA 2CF6A 2ONJA 2J09A 1XZNA 4NOJA 3COVA 2EG9A 1CULB 1OW3B 1IFXA 4UBIA 2OB2A 3F67A 2QMUA 2G2ZA 1QYVA 3FCXA 3VSBA 3DO6A 3QYPA 2AVNA 3O6VA 4A8OA 1S4FA 3OJ0A 1OB2A 3ZNUA 2CJQA 1ORVA 3S7ZA 2OQRA 1UA1A 2AJFE 3MS7A 4XPEA 3T3PB 4RGBA 2JCBA 4Y2GA 2OB1A 1H98A 3W2FA 3OMWA 2F1IA 2YS7A 3AHFA 2VK4A 1G38A 2SNIE 1AKTA 2PS0A 4MTLA 2IP1A 2BUAA 4AJKA 3BKWA 1G8FA 4I14A 4I67A 3H5RA 2H4YB 1XVVA 3DHNA 5IT9U 3VI4B 5ARBA 2NU8A 1CJKC 3V2IA 2CLMB 3QVGB 1RJFA 1V3ZA 1VLVA 2HRRA 3GP8A 1CKEA 3H25A 3ZJVA 3U4QA 2DNNA 2JJ1A 2VF7A 2I62A 2M1XA 1CJKB 2X3DA 3DXYA 2WAMA 3FUWA 1SHJA 3RRJA 3BKTA 3WK5A 1E2PA 2R7AA 4I2PB 3DM5A 3OTHA 4A0FA 1X0PA 2F1KA 2NZXA 1KL7A 2JASA 1C1XA 2GKOA 3PEUA 4KX3A 3QGPA 3DZKA 1XVTA 3LQ2A 5TPZA 1E6VA 4IG3A 2E85A 1BRTA 1H6CA 1IR2A 5B7PA 1JXVA 3PLNA 1II9A 1SQEA 1Q1KA 1KVTA 3W5VA 3HK2A 3OD2A 1OJ4A 3CRZA 2WSCC 3QFFA 1SHKA 1O97C 2FG5A 3MWYW 3SDEB 3KJFA 2PWZA 3BAZA 2P3LA 3B1XA 1E2IA 4MWDA 5KFTA 3PNIA 3SYRA 4GNKA 5B3KA 5KG7A 1YQWA 5AOCA 5ECWA 4OQDA 3NS6A 3E9CA 1NMEB 4G9BA 3ABIA 1JDNA 2BP7A 4LJKA 4O0NA 5KG5A 5IG2A 2GRAA 5JNUA 4MI3A 4QYIB 3GLHA 3ME5A 3MF5A 3KPVA 2BL4A 3EDMA 4K59A 1JX4A 2FDNA 4BLOA 4MUHA 2BE2A 5KB3A 4WHMA 1TIBA 3GZ7A 4AZ0B 1Z75A 4R1OA 1GGMA 1P77A 3WXMA 2HA2A 3CXUA 4JNKA 1N5VA 4E70A 1R5BA 2B3TA 4C6TA 4NMLA 2BFDA 4MA5A 3FFBA 2QT1A 4G3XA 3GIMA 2C2WA 4GKJF 2HNDB 3A1TA 1WZ2A 2VPWA 1G4AE 1I4WA 1KU0A 5IDQA 3Q2SC 3NIBA 2X4IA 4MHOA 1XYGA 2Z08A 4F21A 1W36D 2QE6A 3VAKA 3QFCA 2I91A 2YXBA 2VJVA 1AHIA 5IC6B 5E6RB 5HJ7A 1BWSA 1EDDA 1VJGA 4XB2A 1IM5A 1UJ5A 4ELVA 1T8WA 3KLPX 3RYHA 5AQEA 5CVDA 1AYEA 4L9SA 3ADCA 3F98A 4L51A 1AD2A 2YJNA 3IAFA 1DJLA 1UXOA 1B3BA 2O20A 4NOMA 4Z1OA 2ZJBA 1HOXA 3CF0A 4H77A 4YMEA 4O44B 5G53C 4NYJQ 3NIFB 3QLUA 1RAGB 4IH9A 3F2IA 4G63A 3W8EA 1A5BB 4ZVTA 4WKRA 1NHKL 5DGHA 2FR0A 3FOBA 5EMMA 3IR5A 5F35A 3GJTB 1GGHA 4DS5A 4HKQA 2BGNA 2AXEA 2HXGA 2YYYA 3FYDA 1I32A 3S8MA 3NC0C 4D9JA 5BW4A 4IHKA 3R7WB 3K94A 1AS0A 3JYNA 3EWNA 4GRAA 2RB4A 3EQ6A 2XJ4A 4L27A 3SCZA 3KRTA 4OP1A 1A9YA 3FPFA 4PO9A 1GR0A 1QUVA 4OOEA 1GPYA 3IYLW 1R0YA 4Q3KA 3QEAZ 2QPTA 3CCBA 2R87A 4P4LA 1FXDA 4YCCA 3VYVA 1RYEA 3K57A 4UHJA 1DIBA 3PBKA 2IRYA 4G85A 3TI7A 2CQ0A 1Y3HA 5E7JA 3RUBL 2XCTB 2ZE6A 1CG6A 1NVGA 4NLLA 2R4QA 1NW3A 1V0JA 4G37A 1NMZA 4FBMA 4YJGB 5EWMB 4CTOA 1M1YB 4RVFA 1RMTA 2LQ9A 2V6FA 2QA2A 2W7TA 2PQ6A 3S28A 4GO5X 4KMOA 2FH5B 3SYZA 2HRCA 4H3SA 2BFFB 2VNHA 2GAAA 1D9AA 3S29A 1LQ2A 4QBKA 2FG7C 1GGJA 4KQFA 3O3OB 1VBYA 2OKCA 4BO6A 2J0QA 3N7TA 4EO4A 3EPKA 3TM4A 1YDLA 1LVGA 3OA0A 3R7DA 5BR8J 3E4CA 3UPDA 4Z7OB 3SQWA 3I0SA 3VR1A 4O2AA 4PWUA 1ODCA 3LW7A 3HJVA 1IJEA 1US8B 3BGIA 3E9EA 1ZK4A 2C98A 2JGMA 1TVEA 2XOEA 3R7FA 5F7XA 4GX1A 1VHFA 3AERA 1SCQA 1RT6A 2JC0A 2HX1A 1G7RA 1PX0A 3MD1A 2CJWB 3PHGA 4G5SA 5AI0A 4RA9B 2XULA 4U2FA 4E5PA 2BMEA 3R1HA 4A2QA 1SQFA 2A59A 4RFLA 2DYAA 1GZUA 2QXYA 1E3QA 2BDUA 1GPKA 2BGLA 5BWBA 5LYJB 4ELUA 3TTXA 3INGA 4KHZA 1P0FA 4LDRA 3EOBI 5K3EA 1FE0A 1XR6A 4BEWA 3UJ6A 3R3XA 4PPGA 3PIDA 4TLQA 1H66A 1D5CA 2JGDA 4IYJA 1RYNA 1WS6A 5ALLA 2YJ5A 1R7IA 4PYDA 4DUZB 3QP9A 4ZO9A 1OUMA 3ZBPA 1E5QA 1Q1GA 1T5HX 3O92A 4DV7B 4REQA 5BMVB 4KXUA 3CLSD 2OCGA 4IH7A 4ANCA 1YO6A 3I61A 5KOYA 3FOCA 1OREA 3BM5A 2RRNA 3SOZA 1SC1A 3IS9A 2RAPA 3D8SA 5C24A 3UI3A 2NG1A 2R8PA 4PQRA 3SIXA 4P3OA 3JQGB 2C2MB 5AXMA 4XDYA 1TGVA 2W43A 2W7OA 5D3KA 1B0ZA 5E9QA 3K70D 1AKRA 1VIXA 4MRVA 4F0KA 3FUVA 4NI2B 4WF9Q 2O4CA 2MQ8A 2IL1A 4FHDA 3QNUA 1WF6A 1SVOA 1M2JA 1WHXA 3NBPA 1CB7A 1Y48E 2I78A 1NKSA 4B3FX 3P52A 2GIFA 4JITA 4W7SA 2GBIA 2YIVX 3DKVA 1Z8NA 4DAOA 4RNCA 1JNZB 1LLCA 1MWQA 4DUZF 2ZRDA 2B34A 2GV1A 2BR3A 4Z4EA 3I8XA 1D9DA 4LGMA 1W5BA 1I1OA 4B3JA 4HWKA 3OZDA 2UYHA 1SXJC 1X13A 2HW8A 4S1OA 3UY4A 2YHIB 2IZ0A 2I8EA 5FI5A 5BMVA 1P1FA 3IBFA 5LKAA 1BG6A 1EK2A 4BKRA 5ILOA 4K9PA 5IM0B 2OBXA 5EC8A 1OAOA 4RJIA 4TXJA 1NDKA 4IOMA 4YFYA 4P2XA 3OSNA 1FTNA 3FMVA 3JQQA 4B6JA 3GFGA 2QGFA 5C2GA 3PYGA 1SBZA 1AB8A 4WGGA 5JH7A 2ZAOA 5B58C 1L3SA 1PU2A 4G1IA 1E0SA 5JJLA 4HPWA 1Q5VA 4PY2A 2BEUB 1K5DA 5EXPA 2ANCA 2XQIA 2FN9A 4IDOA 2DHSA 4JZKA 3TTUA 1VBMA 3L49A 2I2BA 4KSBA 2Y1KA 5LNK6 1GFWA 4IGEA 3QEOA 3EEIA 2HGMA 3HEBA 1I0ZA 4ZZ0A 3RF7A 2ECKA 1LW6E 3QTLA 3IEPA 4EJ6A 2ZTUA 3PVCA 3I1IA 4LW8A 5JCJD 4G4SP 3D5QA 3GUVA 5FWNA 5DJ5A 2QX0A 3C5VA 5DGTA 1G8YA 1M76A 1DRZA 3BO3A 3PXBA 4QIGA 1RCTE 1FSSA 2VD3A 3UVEA 2LDBA 2ZATA 3CY6A 4RK4A 2WP0A 1XR5A 3KV3O 2JZ5A 4AO8A 4Q82A 4UHHA 4II3A 2ID4A 2OCDA 4OZJA 4HH1A 3ZZ0A 3R3YA 1MLAA 4NJEB 3R24A 3J81j 5A4KA 2XB2A 1ULTA 1EB0A 2J9CA 5ALZA 3AM1A 3SZLA 4A1OA 1M1GA 1M6VB 2GVZB 5SYNA 3MMAB 1TU0B 1LPPA 2Q8QA 2FZVA 1S57A 4EEXA 1DTWB 4MYDA 2YWRA 2H4WA 4GOOD 1WC3A 4BV9A 3D0RA 2XAUA 1KFCB 1LK5A 2XWJI 4LOAA 1AV7A 4GZ6A 2D54A 5F9LA 4NQZA 3CCMS 1BQNB 2BAGA 5J63A 1M2EA 3IJ5A 2REOA 3AIMA 5JH7B 3CB2A 5FDLB 3M4NA 2CDBA 4WOJA 2PAAA 3DB2A 1DAFA 3RC7A 3VGPA 1PQPA 5JPCA 1Y5NB 2AX0A 2ZWOA 1V9OA 1ZNQO 2D1QA 2OM2A 4BC9A 4Q2LA 1Z73A 3FQKA 1DKOA 4PXDA 2FFJA 3ZCRA 3TDNA 3KT3A 3VKGA 1Y80A 3RBXA 4B6PA 3I45A 4UMEA 4QBFA 3T9CA 4CQMD 2YASA 4N0EA 5ELMA 2PZ8A 2FZCB 3CZQA 3Q7RA 1L7VC 1IOLA 3V1MA 2QRQA 4WXEA 3TX8A 3TJ8A 1AE1A 3WJ1A 1PS0A 3IRVA 3AR7A 4NY1A 4DS4A 5BR1A 1RXUA 1BHJA 1XZDA 4WOBA 3SOPA 3M2VA 2EL9A 4G9GA 1Q1BA 3OX3A 4ECAA 2YC2C 1UM9A 6LDHA 2ADBA 4PANA 2BE7D 2PEYA 2PNFA 5HRCA 4RNNA 2WUVA 1ZQ1A 5I7WA 1JDTA 2YJ4A 3H9UA 2X6TA 4CU5A 3RRNA 2F3JA 4LTDA 1PILA 2ZDHA 4RU9A 1U5BA 5JVDB 1AXEA 2XKJE 3GEMA 3UDLA 1KFBB 3DVAB 2QQ0A 4FR2A 4USMA 3OM0A 2D62A 2DY0A 3DV0B 3RODA 1XTIA 4JDPA 1AX9A 4RYLA 3ENNA 4GL4A 1BH6A 2FTKE 4ZALA 2CWXA 2WHXA 4HAXA 4LA4A 2H1YA 4K4WA 2IHNA 3D6AA 4WZ6A 3K6SA 1HQ2A 5EE9A 1RE0A 3H4TA 3EE6A 3OBIA 5CM2Z 3P9ZA 5DZSA 2H9AA 3Q8YA 3FN4A 1U7ZA 1G7CB 4NARA 4ETWA 3GXBA 1E2KA 1X5OA 3RYHB 4BLQA 3UV6A 2FRDA 4RVGA 3GPDG 1CD5A 4YREA 4JC4A 3NXZA 2SCUB 4DL0C 4GVPA 1Q0TA 2FJEB 3GYNA 2IVMA 2XADA 1NHWA 3LC1O 2QRVA 3ROPA 4RH3A 3KQWA 4R5HA 2IPAB 5AJTA 1JR2A 1BKSB 3Q89A 3MUVP 2R751 2JKZA 3B3JA 1AM4D 2O5CA 5KT3A 4CIWA 4IOCQ 2V6IA 3IBYA 4YBZA 1IONA 1HM5A 3U7HB 3OZWA 4X4QA 2CVEA 4FS8A 4ENUA 1Q7CA 1V25A 4PYIA 3AF4A 3I4LA 3DEFA 3FMPB 2IYXA 1IQTA 4RHXA 3R5FA 3ZK7A 2Z58B 3TDMA 1E32A 1X1BA 2VP2A 5FWYA 1EA5A 4GPEA 1S12A 1PTJC 3PM9A 3L0ZA 3Q3JB 5COAA 4F7DA 2ZBDA 5JSHA 4WY2A 1OILA 4RD3A 1P6UA 4BFSA 1S6QB 1OMSA 3TLBA 5A0YA 1JQKA 2YCLA 2O50A 2W6ID 2Q3PA 1S2IA 4PZVA 3MUMP 1TJ3A 2NN3C 1W5FA 3SFUA 1G9TA 3V2HA 2F8TA 4O0MA 3CD7A 1X1RA 1CJBA 1PJQA 2FG6C 4FYVB 4DGQA 1XCMA 4AL6A 3PTWA 2RHRA 2FGKA 2HL6A 3Q8WA 3V6DA 4AN0A 1R8PA 5CA5A 3AVOA 2I87A 3OEHD 2OPRB 3HM2A 2FRXA 2R8XA 4RFSA 4B9VA 1OY9A 5JXGA 2AQ4A 5JCZA 1JLFB 4RBUA 4J4HA 2KT3A 1PBTA 3DEKA 3SHWA 5JXWA 2BZ0A 1WXDA 5KWIA 2B5JB 1ZIOA 4BB0A 1TYZA 3LSTA 1C3LA 2HZBA 4EG6A 3I87A 2LE0A 3DLGB 1R88A 4Q7AA 4UNSA 3HL0A 1XCGB 3JSXA 5A6VA 4P32A 4KIFA 2HZCA 2WYIA 3ESAA 5HE8A 2UUPA 3KHTA 1K68A 1N6HA 2YNGA 3VHQA 5FTKA 2II6A 2P6PA 3EXIB 4MFBB 2RAUA 4CDRA 1EQUA 5I7EA 1Q0UA 3VNSA 1E1RA 1BOOA 1PJRA 3OLQA 3B52X 1JE1A 2VG5A 2WOMB 2LA6A 1V8DA 1W30A 4O2LA 3FJ1A 3UT6A 1VJDA 1NM2A 4AIRA 3DP9A 3K89A 2QVBA 5CB4A 1D2HA 3JW8A 4R51A 4BVAA 3AD9C 2V94A 1VC0A 3LIPA 4P4TA 1XTSA 3ON5A 1VXOA 4WASA 1OTXA 2JD0A 3QIAA 3PTLA 3AJRA 1Y4SA 4XWKA 5JRDS 3HGTA 5E7MA 2HIYA 1F5AA 4YCNA 4IRMA 5I5EA 3RYLA 3GLTA 3ELYA 4QXQA 1M5PC 2XYHB 4KAAA 3OETA 2CQ2A 2H54B 2FSVC 4HG2A 3ZWOA 3K2BA 5SZIA 2FZGA 1DKMA 2WONB 2A6OA 2J6SA 4CF6A 3QVOA 3SXPA 4DWOA 5AW9A 4KQEA 1NBAA 3PV0A 5JCPA 3TZKA 2P2CB 1ZC4A 4FKBA 4Z53A 3VH4A 3GA7A 1U0TA 4CLUA 3QUTA 1UJMA 4IJQA 4M5HA 1N5DA 4W9NC 2QYCA 3JAWA 1J0AA 1ESNA 1IQPA 3NL0A 4Z8YA 3COSA 1TMGE 4DR5B 1Z83A 1XZPA 2GQ0A 1RWOB 2X7HA 1R3NA 1X7XB 2R1ZA 1JXEA 1U0EA 3RC3A 1U63A 1QPGA 3DT9A 1K0FA 5LYJF 4BMCA 5J23A 1ZAXA 3WL7A 4TWJA 3UMGA 5KG3A 5FA6A 1MG7A 4JY7A 4F4JA 4UEWA 3V5RA 3WSWA 5AUOB 1RTJB 4KR7A 1QU2A 4DLUA 2VLIA 4D56A 2ID9A 2AG0A 2XLIA 1AUXA 1Z28A 1FTWA 1HQYE 3IODA 2CNWA 1MAUA 1EG2A 4Z3KA 2QP3A 4EELA 1UBOS 1X1DA 1EGHA 4ZVVA 2W9AA 4FDTA 3L82B 1U8EA 3DBOB 2R6AA 4L4XA 4K4XA 3NWPA 4ECZA 1Z47A 3T3HA 4TY8B 2QR2A 4CUJA 1VLLA 2G40A 2GK7A 1DWUA 4OJYA 3DMPA 2R47A 3IEXA 1GQQA 3CSSA 4AJPA 2XZTB 5KFUA 1PNVA 1XJ0A 4FFNA 4EGJA 2JAQA 3HKBA 1IYZA 1L3TA 1HE8B 1MN7A 2XMGA 4WY8A 2PSHA 2C3YA 4PZAA 3ZXXA 4TZ6A 2DRAA 2QP9X 5AJ3J 4RWWA 1DFIA 3RI3A 5DGCA 4LF5J 4DB4A 4PYQA 3A6ZA 5JAMA 3H0KA 5JAQA 3EEOA 4YYEA 3NMAA 3PDWA 2PD6A 5K8UA 5CX1B 4IUBS 2OO5C 4AG5A 1KI2A 1RQPA 1QP4A 4RV4A 1FYVA 2VRCA 5DBOA 3OEEA 3SBOA 1UL3A 4DU8A 1E7RA 2DRIA 3ACDA 2ASVA 2O8EB 4XQCA 4XIUA 1G6Q1 2OYCA 3OFFA 1B8PA 3QU2A 1PR9A 4OM7A 5KG4A 3DMDA 4TV9F 4EZBA 4B9UA 4J4BA 4C0OC 2QG9A 3I39X 1B99A 1G6KA 4M1OA 1YWXA 4OYIA 4G0OA 3NEYA 4MUMA 4JJFA 2IOQA 2OLWA 1X86B 4KLNA 1XMOJ 3NP9A 1GV1A 2IXTA 1IZZA 3C43A 1LH0A 1SQ6A 3RB4A 1ISHA 4L95C 1V9LA 2H29A 4AMVA 2LCIA 2VTKA 3QUCA 3ZWNA 4DLVA 1HBMA 3K31A 1P3JA 3R8CA 4KI7A 1QUPA 4XTTA 5I7VA 4P33A 1JLKA 4LY6A 4MKRA 4IKPA 1YNOA 2QUJA 4KQCA 1IQZA 2QW1A 4JWTA 4L28A 1UF9A 2YKNB 2D5CA 4WWSA 1NNSA 1JLLA 2HA5A 2QV0A 4MV4A 2HKEA 2JBAB 4UQLA 4C7KA 2X23A 1TFUA 1T2UA 3ILVA 5FV4A 2QVCA 2RHDA 4YMUA 3E05A 1DQ9A 3MAQA 4A23A 5AVRA 1V8ZA 4N49A 5FPSA 2O5VA 4E11A 4MW0A 1FFGB 2QMZA 3BD8A 3AR8A 3AJ8A 3FPGA 4MICA 2H2AA 3QLEA 3M9OB 3THOA 4BEBA 3WWPA 2ENWA 2XUGA 3PLRA 3I5YA 3SCKE 4NYIR 4DLPA 1VI6A 2R6DA 2AHOA 3DUWA 5G0WA 2C9BA 1FNOA 3VR2D 2CCGA 5HQ3A 1I6MA 5H9FJ 1E2LA 4ND5A 1N5YB 4UM5A 2NR0A 1HTTA 3NHLA 2AVDA 4IQXA 4DI6A 2IBKA 1P7CA 5TGZA 4ZVSA 1R8HA 4BP1A 4RLEA 3MMXA 1O51A 3PLAE 1BEEA 3P2YA 3O8OA 3ED1A 2RG7A 2VUUA 1PLLA 5THXA 3GN1A 2MSKA 3KT8A 2E4ZA 4FZJA 4P31A 4EKGA 1CS0B 1Q7LB 3HHPA 2XZPA 4ENTA 2EP5A 3UHJA 2XITA 3R8XA 1WKBA 5KTPA 2EWWA 4JSYA 4QYXA 5J2NB 1KMHA 1YONA 2OXIA 4DB2A 4ABTA 1UMCB 3WQSB 3UGJA 3R7WA 4IIJA 2H2DA 3IT0A 3I9KA 4JV2A 3CHYA 4O8ZA 4BBZA 3ENZA 3UC5A 5JD5A 4H7PA 1ZRMA 2OO4A 3IJPA 4K86A 3MEDB 4R9UC 1XN1A 4PSVA 5C8VA 3DU5A 1U0OC 3S8SA 4FBTA 2HU7A 3RU9A 3R6LB 4USHA 3A37A 3J81A 2O1XA 5B4TA 3R3TA 2OT3B 3H1AA 4US2R 1U0GA 1SUPA 4ZQEA 2PNJA 3U26A 1GSHA 4B6RA 2DEUA 4TU8A 3UH0A 3CN7A 3FETA 1LNQA 2YINC 4YAIA 4LR7A 2PSZA 2F59A 1M5TA 5ESWA 3C6TB 4B09A 2NO0A 5HG0A 2VUHB 5IN5A 3P2JA 3EVDA 3BD9A 1F2GA 2P77A 3C3DA 4GHWA 2C8VA 1G1MA 2J0VA 4JBXA 3E9ZA 5EJFA 4LV8B 1XTVA 1FESA 4BE7B 4CMIB 3RRKA 1WDMA 3DEJA 1ZPVA 5KQGA 4HLQB 4HACB 5L8VA 3HY4A 5HZHA 4FPXA 3MMCA 1E6YB 1HLDA 4WZBA 3QATA 1A5AB 2CJYA 4IZ6A 2C2GA 5DGIA 3TBHA 2VDIA 4NLXA 4B9TA 4H6WA 5CVEA 4K2HA 4AFNA 2APOA 3AVXA 2G5GX 2AJCA 1S72S 3WP0A 3HHLA 3EH1A 4NV3A 4CGYA 4ICLA 1E3IA 2DRBA 2ZANA 2EXXA 2AA3A 4EG7A 3NANA 4RLHA 4DV1F 2I66A 2YJ3A 4D7AA 2O5EA 1E62A 1NUTA 2XGQA 1Y6GA 2Y8EA 4N0MA 1GKYA 4AZTA 2YBVA 2ZD1A 5IXUA 1KC1A 3ZYCA 1XLVA 4O4RA 4LXUA 2HG4A 1N2BA 2M98A 1U1PA 2F3QA 1PJ7A 3QKIA 4YRPA 2MSEB 1RSCA 5K8VA 3G96A 3C66A 4NLOA 4R1TA 2QLBA 1H93A 4LIPD 4PGGA 3W5CA 3VR5A 1ZPDA 5DZ6A 4E1BA 3MLBA 2X86A 1MB3A 2VBXA 4LBWA 1IN6A 2FEKA 3NHPA 1V3RA 4D8YA 3GGPA 2ZTHA 2I33A 2KYXA 2VUGA 5CCMA 3JQKA 5TLSA 1NOIA 4F04A 3WBZA 3SEFA 3T61A 3RAFC 3TA2A 1ISGA 5K14B 1EFVA 2FKNA 1GXLA 1F2HA 3LY9A 4ZKEA 4WIIA 2UYGA 4RDXA 3H04A 1F9AA 3BF7A 1TAHA 5EZQA 5FI3A 1E5VA 1WC5A 1J5EJ 3R7BA 4Y2KA 3EUWA 4B2YA 1U0BB 2AGPA 3FROA 1A7GE 2ZIVB 1NK8A 4JIGA 3BGOP 3R09A 4CE6A 4D4HA 2O3RA 1I33A 1QE1B 1HA3A 4UHEA 3OJWA 3SM3A 2OAGA 4ZC8A 4EVSA 3NWEA 2V8VA 3PCXA 1PJ2A 2CFIA 1UEJA 3OFNA 4P3KA 1JZQA 4A27A 1O6XA 4Y0FA 3FXAA 1KJ8A 4NV0A 2IZ1A 4A92A 1S6QA 3BBCA 3JQAD 2OG1A 2RJNA 2GXUA 2QDXA 3W64A 1CJTA 3C48A 1C1BB 3GJZA 4DXLA 3OURA 2CV1A 2RGBA 2IJNA 1FLNA 1YL7A 3E0XA 1QAXA 3BQ9A 3B3AA 1DKRA 5JCJA 4HZGA 2GYWA 1X9MA 1BIFA 2ZAYA 3ZU3A 4WFYA 3K8OE 3VAGA 2XLCA 3KLMX 3ZIAA 1JNYA 4E5MA 3AJ1A 4DRYA 2QMXA 5JJ5A 1TT5A 3OD1A 4I1TA 5ALDA 2BANB 3D4JA 4DQQA 2XVXA 3JQ9C 1AZTA 2ILZA 1N6OA 4E13A 4KITB 1C1XB 3NQ41 3PY8A 1M2VB 2R7WA 3NC4A 2CB0A 1VJTA 3PW2A 1JS1X 1N3YA 2PMHA 3AEYA 1USVA 2O8VA 3VSEA 1U7XA 4M6WA 1DZIA 5ALPA 4D82A 3LVFO 4J9QA 2QPOA 1U3DA 1DWPA 1QFZA 1PD0A 1WHWA 4S2EA 5T41A 2JIOA 2AFHB 1QAQA 5EZSA 4PHGA 4PCLA 5CH8A 5FTMA 1L8OA 3H42B 3KT0A 3O3NB 2DIVA 5MGNA 3B1JA 2ZJRQ 1A27A 3AGQA 1WKLA 1H9AA 2F2TA 3R8FA 1NLMA 4CT5A 2QUHA 4TWRA 5CW2A 3PUHA 1NRWA 5K0NA 1ZSNA 1I6JA 1X8DA 1AUQA 3PC2A 2JI8A 4CKBA 4G1QB 4HGNA 3IUNA 2C20A 3E8MA 5F5NA 3LXMA 4U7GA 5A9TA 3AWDA 2BOAA 3UR3C 1EDEA 5EJGA 2ONYA 2M6SA 3LUAA 2MEWA 1ZG3A 1N52B 4HYKA 3GPIA 1IEQA 1UKEA 5J2TA 5BOVA 1CYDA 1O6CA 5EE5B 4MJKA 3O26A 5CNJA 3I0NA 4MO9A 2RGGA 3I6YA 1SVLA 1BGWA 1SO8A 2GTHA 4R9RA 1SIZA 4G09A 5BSMA 3QUSA 2FUG6 2NZVG 1HYSB 1UT6A 1GVHA 5H02A 3RUHA 3KPYA 4NEZA 2B8TA 4OH7A 3M4XA 3LTNC 5F5XA 2JLCA 4F4KA 4NSNA 2BKUA 4J0KA 3W5ZA 4DL4A 3FPKA 2V74B 3K1AB 4DQVA 4KQWA 1VMIA 3TQ1A 2PV7A 1YJBA 3UR0A 2YV2A 3UFXB 1CQJB 4F0JA 1FCAA 5ECYA 4LHEA 1R0WA 3T7CA 2ZHAA 4D45A 2HVEA 5LZ7A 4CFYA 1DXYA 3ZY6A 5D4LA 3MT7A 1G8SA 2G1PA 3I9LA 3RK4A 3HN7A 2FU5C 1E0JA 1GU0A 3QI2A 1QS0B 4L57A 3FPLA 5BUZA 1AGNA 3ZTPA 4OA5A 2OD7A 3O4VA 1ZM2A 1U24A 3ER9A 2DXEA 3KAJA 3M2VB 3RROA 1E9CA 1C7FA 3CKKA 4CIXA 2H18A 4D25A 4BN4A 4M5KA 4J0HA 3H6GA 3NZEA 3MMJA 2OECA 2GEFA 1H3FA 4JBNA 4RTLA 3RUCA 4ZCKA 2XGPA 4DCNA 4ENWA 4MW7A 3ORQA 3VTIA 2XUFA 1C81A 3JVIA 4PYRA 1OA0A 3D3BJ 1N4AA 1C0EA 3QELB 2OTLS 4HZUA 4OIMA 1FDBA 2FHJD 1W0CA 1V1JA 3LW8A 1XZMA 4XPCA 1VBFA 1J33A 3USCS 5KYGA 1KDVA 2CLIB 2AJ0A 2CQDA 1I3NA 1WEZA 2ERYA 4K4TA 2HK7A 4Y6OA 1C3XA 3NYWA 1ZIDA 3RK1A 4PX5A 4A0RA 1DLIA 3AD8C 4RIGA 4Z4CA 5B36A 2W9CA 2C4TA 1FQKA 3GGGA 5KFPA 2PGDA 3W9YA 2C28A 13PKA 4OXRA 1KJJA 2FJUA 4HBGA 4M9QA 5DLEA 2MTLA 4WFKA 3PJGA 1T9YA 1EPUA 7ABPA 3H8VA 1NSQA 2C7QA 2QJRA 2B1RA 4L6IA 2FQ1A 4V2IA 3FDXA 2PO5A 4KWTA 3ZDXB 4LWPA 4JJ8A 2CY0A 3C8UA 1YBAA 3TNVA 1JHYA 4JLWA 3VZCA 1H5UA 4TWIA 3L1VA 3I1JA 5EUCA 4IUFA 4IDQA 1DRWA 1FD2A 3DKPA 4RKUC 1EAMA 4BFCA 2OK7A 5HZMA 4DL3A 2JC3A 1ZD5A 4OGLA 3GLIE 2CZCA 3RSSA 1YK0A 2IYOA 3NCHA 2WHPB 3W2EA 3RO7A 1CTQA 4TNOA 3JAKB 3UT0A 3SSAA 4KKXB 1DSSG 4K9RA 2Y66A 4O23A 1T8SA 5B0BA 4M7PA 2IPOB 1XAJA 2FHSA 1QK4A 1DAGA 2RHBA 2DXDA 5HTOA 4ZJPA 3RJMB 2OHXA 1AA1B 3V7UA 4D5EA 1LF5A 1FFEA 1UBGA 2O2EA 4ZPAA 4W9RA 4YN3A 4MVYA 1ZIPA 4R8UA 2WTNA 5DIFA 3NASA 3PK0A 1FRLA 4LY0A 3U3DA 1QAIA 1VQ4S 1WP4A 1OVMA 2NREA 4IJWA 2C3UA 5AUQA 2NZ4A 5K8MA 5E7QA 2BRLA 3B78A 4YFUA 3EZYA 1TFWA 2FA9A 1J22A 2ZJ5A 3QF7A 4ZREA 3ZZZA 5JS1A 2P65A 3D3NA 3T7AA 3TQSA 4ZQGA 3RASA 5IT0A 1WF3A 4UUBA 3OOYA 4V0OA 2OV2A 1H23A 5GADU 2JAUA 4BMZA 1CJUC 3LQQA 2P62A 4PFQA 9GPBA 2G08A 1BD3A 4KLRA 3CGGA 3D2WA 2W2KB 3BPSA 5IVHA 4X0EA 5F3ZA 4Q37A 2BF7A 4NX2A 3TUZC 5E3PA 1JJHA 4MWTA 3KLEA 5MDHA 3L1JA 4OZNA 1Y3JA 4MRNA 1VG0B 3TB6A 4ARZA 3IC1A 3GMDA 4G0YA 1K9MT 4JBGA 4CN8A 3ZCTA 3PWZA 3OLBA 3LLSA 3NGTA 3K6JA 3F7NA 1QC5B 3QT5A 4E7OA 3WK6A 3HXPA 4C0LA 5FP0A 1X7DA 4H0CA 1VJCA 2P8SA 2P9GA 5CFRA 2ET6A 3ISNC 3RIGA 1REQA 3D67A 2NUUG 1ECFA 3FNFA 5IRCD 2EXUA 3TD6A 1GA4A 2PUGA 4D81A 3E4DA 4MIWA 4XJSA 1Y6JA 4QG7A 4NS1A 2CQCA 4R8UB 3DLBA 3G0HA 2Q29A 4CEHA 3PHIA 2IEBA 1MC5A 3SVZA 5SZHB 5ERGB 2E4YA 1GT6A 1T4CA 1ZN7A 2EZ9A 2PUFA 5KTTA 4P75A 2DF8A 1SCJB 2YUTA 3DRPB 2HEKA 3CO9A 3NTLA 4L2IB 1Z0KA 5CT4A 3V6LA 1KJIA 4CCYB 5K4AA 2PO7A 1MO3A 4L76A 3VKVA 6ABPA 4NU0A 1VSVA 2RARA 3QT7A 3TNDA 1UJBA 2IZ5A 3W5UA 4YJGA 2HUNA 3KR1A 4YT2A 4M1WA 1BVHA 1A3CA 3NDBB 3ZDQA 3ZD6A 1JEEA 1NRKA 4DJTA 1MJ5A 4ECUA 1K8XB 1Y7PA 2Y27A 4R1PA 1JIUA 4DYDA 4UBNA 3ONWA 5C8XA 1JI3A 1Y98A 4B2LA 2Y92A 3B13B 3PXUA 1Z33A 1K44A 2RU3A 4A8JC 3WGLA 1GV0A 4P73A 1VKJA 3WMXA 3I64A 4H1UA 1XNQF 4LF6J 4A2CA 1E9SA 3CUVA 1RC8A 1Q79A 1CJMA 3A2MA 1DJQA 1PR5A 2HWUA 3VOTA 1KRPA 4F6RB 2C4HA 3AERB 3D4PA 4FQ8A 2PBLA 1X4HA 2FUCA 3C3WA 3EF3A 4L5CA 1M5SA 1L5VA 4ZIRA 5F7OA 4ALJA 2I34A 5IXJA 1DZ5A 1YBTA 4H1WA 1TU0A 1P4GA 1UBFA 1U6IA 3WRVA 4F86A 2DK2A 1J24A 2NXUA 1GMUA 5LJLA 1PNQA 4WN9B 1H4SA 1MWZA 1Q16B 3ZWDA 1E1MA 2GWRA 1AHPA 1FFWB 2OFPA 1L3CA 3E5HA 4YRMA 5EXTA 3NC1C 2PUEA 4GPZA 4PSCA 3JPWA 4JLUA 4WESA 2LP4Y 2GO1A 5M5BA 1UW9A 5HCUA 4CLXA 2F64A 5K1ZA 1ZCFA 4URHA 2OO3A 2IXFA 3BUSA 3IJRA 2AEJA 3LAWA 3SCIE 4AF7A 1NK0A 4LMAA 2OQ2A 1IRIA 2ZRNA 1U8UA 4YAKA 5FHQA 3WFZA 2H54A 4TRJA 1J90A 3ASUA 1P0PA 4O5OA 3RLFA 4M37A 5E7OB 3TOCA 3C6UB 1DC8A 4GPAA 1F60A 1YB5A 2R48A 2MY8A 3HMQA 3B38A 2QG4A 1NJ5A 2CEAA 3UYLA 4WEQA 5HJYA 3UK1A 2GRJA 4I81A 5ITVA 4LMBA 1Z2CA 2V3CC 4TS1A 4H3HB 2ACVA 3WISA 1BA3A 1W0KD 5KVSA 4YUDA 2GUGA 4HRAA 3JQGA 4FYJA 4H0FA 1SKRA 3KJNB 1JE0A 1QYDA 5EZYF 3WB2A 4UAVA 4ODIA 5C24B 4RYDA 1S0MA 4AMGA 4EWLA 3M2RA 1BTOA 2CVPA 1SU4A 4MS1A 2AN9A 2YWHA 4IYQA 3KJHA 4BVLA 5A3QA 3EG9B 3IBSA 1MHTA 1U2QA 3T9DA 3ZWVA 2VDLB 5GQSA 3D9QX 4I2QB 4QXMA 1PT6A 4EBCA 4ENVA 3ZVNA 3AAWB 1KEWA 1F7UA 2K6GA 2QO3A 5KNCH 2BGTA 3QV1A 3TIFA 2JAWA 3AW9A 3TCKA 3SVLA 2Y76A 1O54A 4KVAA 2C2RA 3VAMA 5GVSA 4RS3A 1Q74A 2C4NA 2C7GA 4K0KJ 4J0QA 2Z09A 1YVEI 1PYDA 4S0XA 3DQPA 1GTHA 8ATCA 4W99A 4A26A 3RB0A 4PXYA 4EHIA 3D3WB 4F91B 2OV4A 2C2NA 4YMTA 4X24A 2BFDB 2ZH3A 5KQPA 2PIAA 3N5CA 4FILA 3O82A 1LLDA 2ZT8A 3UOGA 3JS5A 1UFVA 3STVA 5KFXA 1RAFA 2I4TA 1XF1A 2XGOA 3ICOA 2O48X 1A82A 3PJWA 1W8DA 1CBUA 1NI4A 2PD4A 1NA5A 3RTBA 2NYVA 2C94A 3V1LA 3IM8A 4JBWA 2OBBA 1YC5A 1NNEA 1DADA 1ABBA 1HT0A 4B9LA 1UFOA 3MHPA 2PSDA 3NAQA 5CYMB 2M32A 1Y1LA 4LTMA 1OB5A 1EHWA 1NNI1 4AI6A 5LP6F 2PCLA 2GM4A 2AF6A 1Y1TA 3E01A 1FSPA 4KH1A 3PR3A 3T3EA 3IMFA 3DDNA 1PYTA 3RVLA 3FCEA 3KJFB 4DN6A 1T9CA 1ZFNA 3RIXA 2I6WA 2Y4OA 1RZMA 4A46A 1DWQA 1VCOA 2VH1A 5AHXA 3DLEA 4DR4F 5CVVA 2KMLA 2OD4A 1G5IA 1C7ZA 1RU2A 1Q91A 1R0BA 3DDUA 4MPDA 2CSXA 3DUFB 4OXIA 3PRJA 2JGNA 4YMGA 3RADC 3QWPA 3QOFA 4ZJUA 2VJYA 1PEKE 3OTCA 1BXGB 2QOEA 3GY0A 3WYAA 2ZRHA 4J8PA 4OBBA 1YCGA 2V65A 3E9NA 4AZVA 1TF7A 4WBSA 2FXIA 2PKXA 2FHJA 1RK8A 2QORA 4NWBA 2ZXFA 1R8XA 4KTTE 3ZXYA 2WU0A 4ID9A 4L73A 4QLBA 3PG9A 3MJRA 3CTRA 1NMSA 4O4LA 3IR7B 1VDHA 4CKXA 3CH4B 2PJZA 5JV5A 1CUZA 5IYZA 1REQB 4MRMB 4P84A 5A05A 4ZCPA 3ZZTA 4Q7QA 3QXCA 5C1BA 4M1EA 2ZYGA 2G6BA 3NUGA 2G9ZA 2XMAA 1FMFA 4HO1X 2R2AA 5J5VA 3DRRB 3PIRA 1MGOA 4ZQIA 1HR0J 1ZCBA 2P9YA 3HHLB 3DE0X 5LBTA 4M9CA 3QPWA 5DDPC 4YMLA 2FVRA 3GRKA 2IU6A 1M7HA 1WE2A 3TYXA 1LJUA 2ILVA 1ETUA 3D64A 4CMKA 4C0QC 5TEVA 4Q4AA 2DPMA 4GC9A 2G9UA 1M2VA 3JWJA 4CQNA 3H5UA 1XCBA 4O59O 4XWTA 2EFHB 3RVDA 3SMZA 4OI2A 3GFTA 4YA6A 7ADHA 3OSUA 2COUA 4D6YA 3L09A 2W6ZA 2AL7A 3FYUC 3E3AA 1P44A 2JJ4D 3FVVA 2X7IA 3VUEA 1XR7A 5GONF 3MIIA 2YXLA 4R8LA 3HVWA 5FPQA 4LDJA 1E9EA 4FXOA 1L5KA 5IVDA 3CPJB 4CEIB 2EGUA 3DBRB 3PRYA 3WKAA 2EJUA 3WGZA 3LYHA 4P82A 2B94A 4Z0PA 1I1NA 2XMZA 3EEBA 3R75A 2CQBA 3EAFA 5IAOA 4KIGA 3OTOF 3EVMA 2FK7A 5IBRA 3FSEA 4F96A 2X4DA 4E5NA 3AR3A 2KI2A 3GV5B 3GDFA 2X3UA 1V7CA 3M2UB 2CYBA 4Z37A 4HNVA 4HWGA 1TW2A 1XTTA 5C4GB 4ANFA 3PNVA 4K05A 4G0UA 4NEQA 1WHSB 3UQZA 4QASA 3L0IB 3D68A 4JI7J 1OY1A 3FCUB 3CKLA 2Y0BB 3EYWA 1LPMA 1IM6A 2J48A 3CJRA 3AEXA 5JS7A 1WSAA 1XELA 4AJIA 3LBYA 1LBIA 2JB9A 5LQMA 2CWWA 3IAM6 4B4WA 4G1UC 4OYBA 1F9FA 4H35A 4YR9A 5TY0A 3AF3A 1QCDA 3PNOA 2B1GA 3M5PA 4CTMA 1NHUA 4FSDA 3VYTB 3NVDA 1VIOA 2OQVA 3WIUA 2EG1A 4NPAA 2XM3A 2AZDA 2QHXA 4N41A 1IKVA 3UANA 2V6GA 2XLJA 1RCFA 4I50B 4XPZA 3SR4A 1P81A 5JBQA 3Q0EA 4HWRA 4ZVQA 2BI8A 3X1DA 3FPJA 2YWKA 3IBCA 4GIBA 1G6OA 5E95A 4HAIA 2QMYA 4TL9A 5CXUA 4DM4A 4B44A 1EKSA 1N2HA 1B8OA 2J3IA 1MDBA 3M30A 1CVRA 4IXDA 4X6YA 2XDQA 3RVQA 3LALA 1Y5RA 3R7NB 3LPCA 5I9IA 1NK5A 3BRWD 3F6YA 3ZZNA 3AZPA 2ZH8A 4V1CB 2Z04A 3W8NA 4MV5A 2YQ4A 1ULHA 2ATEA 5DH9A 1ZA2B 2R6HA 2BSQA 1EYZA 2BZ1A 1C8BA 5GJBA 1OTHA 1I4LD 1NJGA 5KWEA 3T7EA 2W6JA 5KZMB 4A15A 2JNJA 3I1FA 4PU0A 5DHAA 4GP7A 5EIAA 4ECQA 3FSRA 2XBUA 4GVXA 4EX6A 3DEAA 4H7HA 2IYGA 4Q6WA 5CW1A 2QROA 2I6SA 4G2TA 1U2TA 3Q98A 5DHRA 3CIZA 1BHSA 3BREA 5BWOA 4PG4A 4ENQA 3FD8A 5AESA 3E9QA 4TLMB 4C7BA 1RI7A 1M0TA 1T0TV 2WDZA 2FI1A 2PZKA 3N70A 5TMDA 3WNZA 4AMBA 4HYYA 3N39C 2OMKA 2YH1A 2VATA 4GQIA 2B69A 5FOXA 3T6JA 1TYCA 2EJVA 2FMIA 5JHGB 1NTRA 1OXKB 2D9OA 3LP2A 1DC6A 3CINA 4DCOB 2XOKA 4L7QA 3R9WA 1L7DA 5BQOA 4P80A 1TFYA 4PRYA 3MJFA 2JJQA 4XQEA 4B6EA 3FMBA 4BO4A 3FUXA 3MS2A 1VMKA 1NI5A 5LMUJ 2FPPB 3ED5A 4WCDA 4DR6J 3ELWA 3KBOA 3CWZA 1Z15A 3RSFA 1H2ZA 2INGX 5EWFA 4NLSA 2W4IA 2QU8A 2W42A 3WLTA 4E14A 3CPWR 2ZFHA 1RPTA 4NFLA 4Z54A 4BQIA 1XR3A 4FMCB 1RI5A 2IHR1 2OORC 3N6NA 2FZKB 4ZPJA 1TKCA 1PSDA 2Q4OA 1X8JA 2VP5A 1Z8FA 4YXWD 4TT3D 1TKZA 2HF9A 3ENAA 1BQMB 3RRMA 3FNRA 2A9OA 1TMMA 5DGDA 2ASYA 4DCOA 4LSLB 1ESMA 3QLUC 3O8BA 1T0HB 5TPWB 3FZ2A 1E6MA 3SEQA 5HP1B 4CMEC 1NBOA 1K5GA 3U27A 2WAYA 4OM8A 3GHHA 1YRUA 1L7AA 2GETA 5ADZA 3HSKA 5LKRA 4X7MA 4V02A 2XJ9A 1JIXA 2UXDF 2BOPA 2ZR9A 1M8KA 1FTGA 3TCNA 3V6HA 3QUBA 2XEDA 4EKIA 2O6LA 3M6VA 4WP9A 5DG9A 2E5WA 3DMHA 2G6TA 1RBZA 5JATA 3FRIA 5J1SB 1MN9A 1TZMA 1G8HA 3PPYA 4CODB 2GBPA 5LYJA 1YZFA 4K8RB 2JGIA 2YRFA 3O94A 1A8IA 4D0SA 3U61B 3OT5A 3PDIB 4ZI7F 2RDDA 2CXQA 1IHYA 3VDMA 3TQEA 2MR6A 1FE8A 1KAGA 5HE9A 5KFQA 4MAFA 1EKXA 3B7GA 5JBIA 2C59A 1AZSC 5GMDA 3AB8A 4V1CA 2HPAA 2H9ZA 1MOQA 4V24A 4BRZA 2DTEA 2B30A 2O1PA 2AT1B 1JDZA 1OJ7A 5IAGA 5LQCA 2ZBIA 4G0ZA 4R68A 1H38A 4CQMA 4Q00A 1U2DA 3WMWA 1M6YA 5JNWA 3GJ4A 3I12A 3OICA 1RVV1 1FJGF 4IH1A 1N25A 2J59A 2HQGA 2LMIA 5C8YF 5H59A 4BP8A 1HOTA 1WACA 2A0FA 2NUAB 1L8AA 4MWBA 5A04A 2ERXA 1OXBB 3BA1A 8LDHA 3BTUA 5FWAA 4W6QA 1TMYA 1DIOB 3PC3A 1YE8A 3IKLA 3VZQA 2ZWVA 2REQB 1ODKA 1LPSA 1HYSA 4P4SA 1V35A 4WN3A 3NX4A 2IYUA 5L3ZA 3HTXA 2JC1A 3I6PA 2HFVA 3EGCA 3E1SA 3LPYA 3OIUA 3PU6A 3VU9A 4CLEA 1EFCA 1KKHA 1QHYA 3JRWA 4LSLA 5THKA 3SQMA 2IW3A 4UE2A 1IJFB 2BEVB 4HEA6 1TKZB 1YQXA 5CDUA 3W2IA 4U8GA 2A9QA 4X65J 2V03A 3OO0A 1H2BA 1W88A 3AONB 4IUDS 3Q8QB 2W6CX 4A0GA 1DC3A 3QTTA 1OZGA 3IAHA 1Z5OA 2G8LA 1OS5A 3IT3A 2GA7A 4JL6A 1P0IA 4S24A 4DW8A 1APBA 2GS8A 1N1EA 2B98A 3GGSA 3H98A 1N0VC 4LWOA 5AK0A 5BN3A 2G4BA 4BCAA 1ML4A 3OUUA 4E4YA 1QH8A 5AKEA 4G4JA 3C8HA 5G2OA 5IW8A 1U9CA 2H3EB 2ZTMA 2ODAA 3C7DB 4D2IA 3TQIA 4Q7EA 2B0GA 2I2DA 3ILOA 1M1XB 4OFXA 5D8DA 5LLTA 2ZE8A 2EYUA 2BGGA 2VG7A 3P5TL 4FT2A 2DNHA 2O2YA 1B73A 2QVXX 3P9XA 2AH5A 3CTMA 1WB5A 4V39A 3TNYA 4TTVA 4E7PA 4ZLJA 4DLNA 3NAIA 3LT2A 3C85A 2HA0A 5HQTA 2NU7B 1I9CA 3CLTC 1OXMA 1F38A 2YIJA 2JIDA 1N6PA 1E5TA 4MROA 4BC7A 2W90A 4UZCA 1QZ3A 2RSLA 4IFVA 4FMBB 3EXEB 2WNIA 4R5PA 2Q50A 4CKBB 4JI0B 3DNFA 4L16A 3SG0A 4B35A 1ABEA 2A4KA 3DMTA 1GRNA 2QL7B 1U5CA 4NAUA 3ZDCA 4NZ6A 1IR0A 4ED5A 5ENVA 4CG1A 2PXAA 1R15A 3UN5A 4OXYA 4OKNA 3G02A 4XSHA 4RMJA 3ZGZA 4Q3BA 1F06A 3FBFA 2PFKA 4PQEA 1PK9A 1LK0A 4EPWA 1HX7A 2VXCA 3DP7A 1MJGM 4UULA 2HA4A 2V7TA 1PT7A 4MUYA 5EE3A 3TZ6A 4L8WB 3DNPA 1VBXA 2ZVQX 1E4EB 1A8SA 2C88A 3UJ7A 4V3CA 4N8NA 4NXMJ 1HNVA 1KEUA 1ADGA 1W75A 2ZRQA 2P5UA 4C2TA 1NHVA 1VGQA 4RKQA 4OKIA 4AL5A 3W3ZB 1FFYA 3FDIA 4BRSA 1YACA 1AA6A 1HE3A 3PITA 1DFHA 3SXUA 1KBQA 1PYOA 4L5AA 2VLBA 1GQRA 1QAMA 1NH7A 3D43A 1YRQA 2G76A 4AXJA 5IKPA 2X9LA 3RC2A 2O2HA 2MZTA 2H5IA 5F1YA 5B0AA 1JYEA 1I2DA 3F6RA 2H2IA 5IKMA 4XB6B 2BM0A 1LS1A 4LHZA 4ROTA 2DB3A 1F6DA 1OZAA 2HQ1A 1NO8A 1EEHA 1N2SA 2VDUE 2RH9B 2PGOA 4YDRA 4KVFA 1Z5NA 4QU0A 3OHBA 4UNRA 2PT7A 4IQ0A 1EETA 4OKSA 4PLHA 4HEQA 4RSMA 1P91A 3ZHVA 1G21E 2MMCA 4F4FA 1ITPA 1XMQB 2ZSHA 1QOZA 2FNAA 5KNCA 4AG6A 3VNBA 2RVJA 3DGFC 4BIMA 1WNFA 4OJ1A 3HUDA 5IZHA 1XJQA 2DULA 5AWFC 3JSBA 4QXOA 4GSYA 3GR0A 3FVRA 1VIAA 3SZUA 4LDPA 2QXUA 3BWVA 3ZWYA 1EZ1A 1CJSA 4G5YA 4JB0A 1BQ3A 3HRHA 5JLJA 2EBEA 3PEYA 4JL5A 2WU4A 1Y3FE 1NXTA 2Q6BA 4MKHA 4PWWA 1X1CA 2BT4A 4MKYA 2D5LA 4ECVA 4JVMA 2DO0A 3TR0A 3MLEA 4Q93A 2P8IA 3K0FB 4QEDA 2AQ8A 3JB9k 2BEJA 1M75A 1ABFA 4M7OA 4NE9C 4TXSA 3OZVA 4URZR 1U25A 4JHLA 1TLFA 2VHJA 4PPFA 4ML3A 3KDPA 5ETVA 2FE1A 1OYEA 1QP8A 4AYWA 2RC5A 2CXSA 5LZ2A 5IVIA 1O08A 4RM2A 3UBMA 1HHQA 2R8JA 5U9CA 3ZLBA 1MJGA 3R3VA 1NLYA 3KUGA 2JDJA 4TYBA 5J59A 5D3MA 4KUGA 4X4OA 4MYCA 3RHTA 4ZDNA 1RLTA 4UPDA 4X65F 3KHRA 3H1GA 3ZZUA 4DG1B 3C3YA 3S6JA 4UM9B 1ID1A 1DBVO 2Q4TA 3ROZA 1DHMA 2I7XA 2WYUA 3VAZA 3V34A 3FEZA 3CZCA 4ILKA 3KR2A 3EMBA 5E2BA 3RBVA 3RC1A 3RRFA 4AY3A 3P9PA 4BNFA 1BS1A 5AM3A 4KR0A 5LXYA 3FK4A 3OR2B 1RM4A 3W6ZA 2GEVA 2I2CA 5EFZA 1B23P 4KPUB 3ETDA 3A3OB 2Y8WA 2RI6A 5SZKB 1H6AA 3G68A 2XPCA 5B7QA 3L7DA 4KO3S 2EKLA 5AMXA 3RG2A 1O58A 3HI6A 4CM3A 2AUTA 2EFGA 3ZCQA 2SICE 2AE1A 3P1JA 4J7XA 2DQZA 3IQGX 5JSKA 4DUPA 5CCBA 3NRJA 3IRXA 3KTAB 4ZT6A 2P9ZA 2D3ZA 3I1YA 2FOIA 5DETA 3WADA 1PS9A 1NW7A 4JD5A 1CVIA 2HDNB 5JC8A 4R3NA 4AZ3B 4CLOB 2VC2B 4NZMA 1ZM3A 5LIRA 3CZ5A 4I9GA 1XN9A 2VDMB 3E2MA 4K9SA 1JLQB 4OI3A 3M5CA 4BLVA 4F60A 3GGJA 2QTTA 1TL5A 2MDAA 2B7BA 3UTDA 5FTNA 4LRAA 3VMFA 3KDOA 4CQMB 3RTGA 3UB4A 2VI5A 4XLTA 2DHEA 4PXEA 4BVEA 2F9JA 1XMSA 2QIPA 2ID7A 3C16C 2VHUA 2IEGA 4MP8A 1RLJA 1QV9A 4QUJA 1DCMA 4FS1A 3ICPA 4X20B 2W2PA 2PZEA 2B56A 4Y2SA 4JXZA 4RF4A 4U2BA 1S0UA 1EFPB 1AKQA 2DHQA 4Y2RA 1P1CA 5A5GA 4UREA 3LA6A 3D3WA 3EUAA 2M7SA 2WHEA 3R5XA 4C7XA 1IN1A 5A8WB 1FFAA 3WLSA 2BZGA 2I7CA 4DV4B 2PZFA 1A5SB 4BEVA 2R1TA 2PMDA 3GUCA 4DMCA 3KYDB 1IZ0A 1YJ5A 5HF8A 1Z7GA 1LTHR 1YQUA 4XM0A 2B9VA 1P3Y1 1FUIA 4MLZA 4F72A 2P9JA 1RYMA 3I09A 3RUPA 2P6SA 3TZZA 3RUAA 4WUTA 5JVHQ 5CURA 1EZZA 3OM8A 5FO0A 1FRVA 2EIHA 4BUJA 1Q53A 3KZVA 4RTNA 2WJIA 1WUYA 4Y6LA 1XKLA 3DLHA 3DRPA 1Y10A 4EYOA 3KAPA 3MM5B 4LN1A 3ORSA 1RWWB 4BTVA 3W8RA 4WFQA 4MW1A 3AXKA 4NYMR 3DOHA 4DIMA 5LMUF 3ONDA 2GF9A 4B6SA 3A9SA 4BO9A 3E3XA 2GYVA 2HFJA 4QTXA 2IVZA 3MTQA 4QG3A 3WYEA 4WXHA 1F3FA 4TMTA 2B92A 5BWMA 2QN2A 1RAHB 5HDQA 3V8RA 3OZSA 4ZEOA 2E21A 4XPIA 5F7JA 2B25A 2PMWA 3H9GA 3FYHA 1Y4ZB 1XSEA 2NTYC 1NATA 5EP1A 3EX7B 3U4IA 1H5NA 1YDHA 1YA4A 2PZGA 3QPAA 1RT2B 5JJCA 4F2PA 1BVRA 2JJ1D 2PSSA 3HO1A 3G6XA 1WOPA 5ALQA 4DSNA 1G2QA 4E1AA 4HDSA 1WCWA 4IY1A 2ZI3A 2Q1LA 3UA3A 3OG9A 4LV5B 4LOLA 5LQSA 1LUAA 1E18A 2KBEA 1XL0A 2AI1A 2OVBA 2A8YA 1UJ4A 4B7XA 2IZ7A 3D1JA 3PWSA 2XWYA 2VAPA 1W4BA 4CKEB 3P19A 1DG3A 3R5JB 2HIAA 5A2QU 4DV3J 1XEWX 5HKBA 2IXEA 4KGMA 3FF4A 3VTKA 5LMCA 4HEJA 2GMJA 2N4CA 4F4AA 3GLQA 1IIRA 1I4TD 5B53A 4XIGS 2BGKA 3KLVA 5HJXA 1LC0A 2CZ4A 1E64A 1CY6A 4QA9A 4P3PA 4JI3F 1DLJA 5TPZD 3DBIA 4DRZA 1VC6A 2PX8A 5JANA 4KLZA 3T7SA 3M9LA 5KNBA 1VHJA 3R7NA 5A8KA 4X8MA 4CP5A 5F98A 4CYUB 1KSPA 3H5YA 3O8LA 3R5KA 3ESYA 4L8GA 2EGGA 6AT1B 3OEHA 1L5HB 1V7ZA 4BL5A 1LSOA 2ROQA 1UDBA 4XM1A 1VKHA 1WC0A 1R27A 3NTQA 2FETA 5KQSA 4LBHA 5HMZA 1WD5A 5DYTA 2AGVA 4ZP1A 4LISA 1GILA 1TOAA 1TC1A 1CF4A 2FPMA 4A8JA 2GZMA 5EWLA 2HTFA 3GELA 9RUBA 2GN2A 2ZWMA 2KT2A 1Z4IA 4TMKA 5TR9A 4JQCA 5F9MA 4IIFA 2JK1A 4NENA 3E7PA 2VRNA 5IARA 4RTPA 3W1EA 2Z2LA 1V1RA 2P6TA 4J07A 4PRKA 2ATXA 2ZETA 4DR3F 3QLVC 4M1ZA 3L4KA 2AD1A 1XZKA 2V6MA 2QA4G 3Q1LA 1SOUA 4DSZA 5A9SB 3M8ZA 1AG9A 4RFSB 3NG8A 3VAIA 1NKCA 3QGIA 4P7FA 4FB5A 1BW9A 4NYPA 2XHCA 3RIMA 3K5PA 2IHZA 4Q24A 1UXHA 2HW3A 5JPDA 3ZTYA 1JLEB 5M3BA 2ZRFA 5HROB 4BMPB 3ADDA 1N36F 2HHHJ 4UXJA 3ZG6A 2H1LA 2OY0A 4YVFA 2QENA 5K05A 4O3PA 4KQKA 3L8HA 3M8QB 1J2UA 2P8JA 1KZ1A 3KU1A 1P1TA 2ORED 3IURA 1S1VA 3BB3A 4MGKR 5L53A 3JQMA 4Q9HA 5FORA 1TUEA 2XQKA 5ED4A 3LSYA 2HHQA 3H0EA 1GZ4A 1SCBA 2JGLA 3CVXA 1QE0A 3V4VB 1E3WA 5BPHA 4ER7A 2WWXA 2Q4EA 3IAUA 3GEIA 2XW6A 3UCFA 3PEEA 4EPXA 4X97A 3PDHA 3HPRA 1U28C 1N0UA 1ZHOA 1Y4DE 2YQ0A 3OZXA 1ONNA 1XZFA 3PHLA 3ZV6A 2PX6A 4HDNA 1Y11A 3D4IA 1IOWA 4KMMA 3NM6B 3WNDA 4ZLNA 2PWAA 3W1YC 2VPPA 3ZCSA 2Q49A 3OFJA 4XB1A 1RVDA 3JAMY 4HVTA 3IP5A 4CT4B 5MFPA 1BCSA 1FEEA 4LQ4A 1SBQA 2W2KA 4RSHA 1W5SA 2BEKA 3WRXA 2UUCJ 2E9SA 3U3KA 4LQCA 1YJAA 2ZSDA 3RBZA 2WI8A 2WIJA 5L7YA 3T3OA 4M54A 2MLZA 3O8DA 1PEDA 3N5BA 1TYBE 1OFVA 3LCJA 2CVFA 3A3PA 4JI3J 2FVYA 3TLAA 5I7UA 3H9EO 3EDQB 2JVOA 4JI7F 1RZVA 3JTPA 3H3FA 4OAOA 1ICEB 4OHXA 3H5OA 4G1QA 4U7UD 1ZBTA 1WSDA 1KBRA 2E4AA 4XWYA 2A4MA 4ZAFA 3WL5A 1F4LA 4V0LA 1KEPA 3G13A 2DPJA 4A2PA 1UEXC 4URWR 1NTOA 4JV0A 4MV3A 4EY5A 3C74A 4BGUA 2DQ4A 4NCKA 4ZA1A 1AMOA 4KHPF 1E2NA 2XUHA 3DRXA 2H65A 1UBKS 2DQYA 4DV4J 1EI9A 1CJCA 3C6XA 1PJCA 1LFAA 2AIRB 1RPJA 2GVZA 2FPOA 3KQQA 2V3WA 3SJAA 1OWPA 4W7IA 3R5DA 2CLSA 1SIUA 4E30A 1X1QA 3L8EA 1BLUA 2YKAA 1I3LA 3KUCA 3LQRA 1UPPA 3Q2KA 3ZTQA 4V0RA 2G13A 5CDSA 1SBRA 5ESDA 4BDSA 2Z2MA 4QIWD 3B70A 4B7AA 4LFBF 1JX6A 1KDPA 4LJAA 1KERA 4AXIA 4IWNA 1MX9A 1QWSA 4PZPA 2YKQA 4HVCA 3P6YC 1XNQB 2UVPA 1J7JA 1QAYA 1FA9A 3F0NA 5CG2A 1XIQA 2N82B 4QOIA 2W6PA 4UHKA 3LQVA 1FX0A 3CD6S 1EK0A 4J1NA 4DQPA 1QZUA 4P54A 5EIWA 1GPWB 1USIA 1VK8A 3BYPA 3WLHA 3QVGA 2XODA 1RRVA 3G7UA 1FI4A 1UWBA 2BQUA 2VG6A 4WY5A 4QPTA 1WAMA 3DVRX 1BHQ1 1D6JA 1GQFA 3CWJA 1NW6A 5C7LO 1GKLA 4OUDA 2PRYA 3PF8A 3VWSA 1I0IA 1ISPA 1LLUA 2AKAB 1R6BX 4Q47A 3H4DA 4PHTA 5D4PA 1TD1A 5HSPA 3GR1A 2R7KA 2XZOA 1MB9A 3UK0A 2XV1A 5DHPA 5FUXA 3WKBA 3PC7A 4W63A 2LDXA 1FDVA 1OLUA 4P7BA 2NTVA 2ZUTA 2J3HA 3NWJA 2MYTA 3TLCA 3O73A 1NVXQ 4PEOA 1UJNA 4AK9A 1A9PA 4M6WB 2IZOA 2CD7A 2DECA 2XUKA 4RVUA 2C31A 1PG5B 3DONA 5JQGF 3KS9A 1GGNA 1K8ZB 1JQBA 5CAEA 3F73A 1T6NA 1EX6A 1PZNA 4Q4HA 5CGQB 5AVYA 3X1KA 2XUAA 4J5OA 4DNQA 3T7DA 2C3MA 1UBMS 3NYQA 1Z5GA 3H2KA 5CUQA 3T6KA 5FUVA 5C34B 1BDMA 1LF0A 1QUFA 2Z56A 1GGKA 4PUOA 2O8NA 1W36B 1T2CA 4EFLA 1MEJA 2E5LJ 2I2AA 4WN9A 4N5HX 2ZRGA 3IKVA 4MV0A 4O2BF 3DMRA 3HU3A 2XMTA 1QHFA 3TP2A 4ALLA 4V2UA 4QYWA 3UHOA 1C50A 3BEDA 4EMBA 3MFQA 3UMMA 2LXUA 2GT1A 5LQAA 5IJXA 4DV0J 4AJJA 4ZVRA 1H1LB 5AIBA 3K16A 2QMWA 2DNZA 2ZU0C 3F7OA 3EJ6A 4UFNA 1H2YA 3Q8MA 3VX3A 4WLFA 3TG8A 1DV1A 1TJNA 2FFBA 1PVVA 3WFIA 1NLFA 1EIZA 1EJ7L 1ZGBA 3EZOA 2JANA 4Q4LA 4R5PB 1KXJA 2XRZA 4QNMA 1VP3A 4PZEA 5A2QA 2AOVA 4HNGA 3NHAA 4JVNA 1MJFA 1TQDA 1ZH0A 1YBUA 1M10A 1RKXA 5G0SA 2PTGA 2QRVB 1EH5A 1E1DA 4DUYF 3C16A 5KYWB 2F3RA 5IM0A 3NBZC 3MOZA 1ELOA 3W9BA 1PJ3A 3F6EX 1MAAA 3IGNA 3IBFB 1L7XA 2VJLA 1ZOTA 4CETA 2CMDA 3A25A 2BFAA 4B3RJ 4ZDWA 1U2DC 1AURA 5F4BA 5SICE 1C7IA 4IO0A 4CCSA 1W35A 4TV8A 3QIDA 2O0LA 3U4QB 2VK2A 1C0UA 1Q16A 2GS9A 2H3EA 2V0GA 1SBNE 3K96A 4MQEB 3W4IA 2YQ5A 3PRVA 1LRLA 4B45A 3AFNA 2PXHA 2HRZA 1UPAA 4ESEA 1NBHA 4KE6A 2DJWA 3FFTA 2AEEA 3LP8A 4CKCA 4QFMA 3NNNA 4CQLA 1D04A 1KVIA 2C2DA 5AVTA 1JHRA 3NY0A 1HPZB 3ZDAA 1WKVA 2JEZA 1VJ1A 1C9DB 4C1NA 3BFPA 4EB6A 2P6UA 1U1DA 3OPKA 1VE1A 2GHWA 3UAOA 3BGOS 2W4QA 5AUPB 2QA1A 1EP2B 1OFGA 3Q7TA 2R4TA 1QFSA 1T5IA 4GWGA 3RABA 1Z63A 1ZJ4A 3AEUB 4EVQA 1PI3A 3QXJA 3VVLA 2NU9B 3ROTA 3A70A 1Z13A 2BFFA 1LFDB 3KLNA 1FXSA 1BEZA 3OLVA 4BNDA 2Z5FA 2LKCA 4CCYA 4LZLA 4IH4A 5L1KA 1SXIA 4B0PA 3L40A 3IWLA 3GFBA 3UTCA 1FA0A 4Y3UA 1JUDA 3D4LA 1F3OA 1D0IA 1W94A 4M22A 2OM6A 2R5NA 5BQ3A 2IIHA 1Q0LA 1EDZA 1Z1ZA 3BFXA 4MHSA 2IEYA 2WSIA 3EQZA 4CWAA 5CLGA 3BKFA 2Z4TA 4IDKB 1BSVA 5F33A 5BN3B 4G26A 3DYVA 4DQ0A 1JG1A 4YB6A 3KD3A 1VLZA 3O8CA 3U3OA 1TVKA 3CJ5A 3QEMA 3F2VA 3SQLA 3QKRA 2A78A 1MW8X 1QIMA 1QUEA 1X8LA 1LX7A 3VJLA 3D28A 2PA3A 1FSGA 1WOMA 2J31A 3BZUA 4P2FA 4RD0A 1WPQA 2X0NA 3RJMA 1Q84A 2V9WA 2NU6A 4DUYJ 2V7XA 4FYYB 2R6CA 1DG9A 3R9LA 1AQJA 3A1VA 2PU5A 4GI2A 1JQLB 1UCNA 3BS9A 1EXWA 4MVWA 3JTEA 4INPA 1Y5LA 3HKDA 3K9NA 5F3TA 3PVSA 2X9NA 3VU9B 3WA7A 3CCCA 4QYZK 4O02B 3A6KA 2Q5OA 4L3VA 2P2ZA 1JTFA 3L1KA 4RJJA 3ESBA 2C4MA 2VYND 1FVXA 4CT8A 3KU4A 5HVGA 1MRSA 2G4VA 1CC1S 3L8GA 4OYOA 3D66A 3P4UA 1U8AA 1M6HA 2RJOA 3EICA 1WETA 4KK3A 4JLJA 2IUSA 4Y98A 3LX5A 1KIMA 5MGBA 1DAMA 4UM7A 1QDUA 1JDBB 5JY1A 5L46A 5IJ0B 3CURA 1Z0DA 3BN4A 2VP6A 3M8SA 4YI3A 3COZA 3HCRA 4YB8A 4DIUA 3H8JA 3S68A 3ESZA 4WNCA 3GJTA 1E79A 4TL7A 2Z57B 2RC6A 5A2GA 1RAEA 3GCWA 2BACA 3D1OA 1D2NA 3HC7A 4OX7A 2OG2A 2GVDA 1E4YA 3VR6D 2BDEA 3H2BA 5IUKC 1A9QA 3P4UB 1K6JA 1QO0D 1AGPA 4IYRA 4WP3A 2DAPA 2WQ7A 3HJRA 2R8OA 4B46A 3BRCA 4HH0A 2PBFA 4PLWA 1S89A 2DGSA 3MMBB 1E89A 3WNCA 3AJDA 3G0DA 2FXVA 3L8CA 3WGNA 4D57A 2EC0A 4L22A 2Q5EA 2EDCA 3QMPA 3T5KA 2JIRA 4C8MA 2J9FA 2FHKA 1ATZA 3AI7A 2CFCA 5G1PA 1YOBA 5DT9A 2FPIA 3OY7A 4MH0R 5KQRA 2VYQA 3IULA 3KJQB 1H8EA 1NYTA 2C82A 1H2EA 2OEPA 4M5DA 4PBSA 4BQQA 3OR2A 3L07A 3PQEA 3RYIA 2DXFA 1QY7A 1NUQA 1T2VA 1SFRA 2E5LB 3LGAA 1FNNA 5BOSB 4ZVKA 5AW5A 4MIAA 4TYMA 1P2VA 4L3OA 2R66A 3HYSA 2QD2A 2GN1A 2C22A 2XH8A 2NAFA 2Y1XA 4D3YA 1RTJA 2G0IA 3QE4A 1SH2A 2XQFA 5IJ0A 1ZR2A 3M6FA 2VAXA 2QLTA 1M90T 2QRGA 4ZPVR 1A71A 4QARA 4DA9A 3I4PA 2G77B 1EB8A 2HFNA 1RJ9B 4HI0E 5KT2A 1EU1A 2QL7A 3NOQA 1R8AA 4KN8A 5KOJB 2KZZA 3KM0A 2OPBA 5IAKA 3ESXA 1KI1A 1ZMBA 2VYVD 5LDGA 5AK3A 1U6JA 2XC9A 2HRYA 3H9BA 3ZJ5A 4J91A 1FX2A 3PXGA 2NZ2A 2I0XA 2R5WA 1W2BR 3BSCA 1T0BA 2GD2A 3KOXA 2Z3WA 3AYXB 1PFKA 3VR3A 4OQXA 5H8WA 3DI6B 5C8DA 2Q46A 2FR8A 4BQRA 3IFEA 1JBEA 4ZP6A 2JI4A 2NXCA 3DF9A 2YV4A 4K9DA 4PAAA 1RLDA 3GG2A 4B3RB 3N9UC 3LYAA 1XG5A 2Q6TA 3GAZA 1SC4A 4L50A 4X41A 1GKIA 2PBRA 3PD1A 3LP5A 4DV3F 6REQA 3ENKA 3DULA 2PRKA 2KL8A 1Q83A 5A5EA 1G5QA 3BMNB 1JGTA 4C4XA 2RIJA 2PI4A 4L0DA 2I9SA 1C0KA 4G5FA 1WMDA 1GNSA 5CDYA 2WVBA 1FXWF 1TTHA 1MV8A 1P72A 1HFEL 4FNMA 2G0CA 4JBIA 3ZCVA 1B00A 1COWD 4GOJA 4WCFC 1RZ3A 1RJWA 3CCES 3VR4H 2BPOA 2GW8A 1CDOA 4JP1A 2OFHX 4NPHA 3U56A 1MEOA 1PWHA 1GEGA 3COYA 1JHPA 2BTQA 1RAGA 2HURA 2JFHA 2O1EA 1IWAA 3SJUA 1JJ7A 1U48A 2KO1A 1V6HA 4F3TA 3WL6A 5FLKA 1Z0AA 2KU7A 5AJUA 1C0UB 2YQZA 2GN8A 2VK8A 3PS9A 3BBBA 4LFBB 4NCJA 1CR4A 1QPBA 5T67A 4IUCS 4ZEXA 4IG0A 1HKUA 1GAWA 1EG7A 5NLLA 3D1HA 3NRCA 2BEVA 2DR3A 1S76D 1ZH6A 4KZPA 2X40A 3QSGA 2OK8A 4OX8A 3P2OA 1COWA 1Y7LA 1VR6A 2CPDA 1TK2A 3AC0A 3CVUA 1ZH8A 1OI7A 4JYCA 2FTRA 1G9SA 3V33A 2QN3A 4KW7A 2HS4A 3SR0A 2R00A 3TQRA 4EKYA 1FC0A 2X5XA 2QZ9A 5IUNC 4LF9J 3CXCR 3PA6A 4FCTA 3P5BA 3CNHA 2A1UB 3CXRA 4RADA 1P9QC 1LTKA 3EXHB 4V0ME 3A8TA 4IVRA 1T36B 3L2OB 3N5FA 1I8TA 4R2KA 1WZIA 4BQSA 4XI9A 2NWQA 4XGNA 4HT7A 2PYZA 3U9SA 4CWBA 3QU7A 5K0EA 3ZFVA 1QG2A 1IBKB 3QBCA 3GA0A 1T9VA 2IYFA 2HPUA 1LWOA 5THQA 5K6RA 5P8WA 1WP9A 3WK4A 3OCYA 5CYQA 4FS2A 2Y1LA 5FLEX 2KHZA 2FYTA 4YP6A 1JEYB 3AT1B 4FGSA 2VTBA 1YIOA 5EXEA 4C4AA 3CGIA 1YDGA 1VPLA 1EIWA 2JFVA 4DPOA 1K7FB 2D1YA 1X7VA 1MB0A 5GIOE 1YTYA 5BT8A 4JOUA 4DUYB 3F97A 2OORA 4O4JB 1M1NB 2W9BA 3ANSA 2W25A 1EGVB 1HQUA 4CIVA 3FZGA 3DRSA 4DQXA 3KVRA 1NB7A 2YR0A 2X6QA 2Q0SA 3VYSB 2QE7A 1OAOC 3LL4A 3HDTA 3JSMB 3C16B 2RHMA 1DGQA 3U44A 3CKMA 3F7MA 3TTYA 3T1TA 4YALA 2DH7A 3SYKA 4MQ5A 1IIBA 1N5LA 4HFJA 2O5DA 3LYUA 1V5IB 1ZUWA 2PSJA 4WA7A 4JUBA 3PQ5A 2DT5A 2ZBGA 2GR9A 3C5WP 3CCJS 3KOWA 5JAIA 4LX8A 2WU8A 3NVKI 4ZVRB 4RY0A 1ZQ9A 1NUAA 4J0EA 3OU7A 3ZJUA 4B84A 3IM9A 3BDIA 2LIPA 3HCAA 4S04A 1R8BA 5DXJA 2WZCA 3GD5A 2DWQA 3DBLB 2WUFA 4JFAA 4MMYB 3KWLA 2IH2A 4DQDA 1PW5A 2ORWA 4TPKA 4FOLA 3IEIA 1OKKA 2HYIB 2JAOA 1E1LA 2OIHA 3U0BA 3I9V6 3SEOA 1UBHS 1FFSB 4JLBA 1UJ6A 1H0HA 4QDJA 5JASA 1YR6A 3LKVA 4R0VA 2BKAA 4GKKJ 3DD1A 1HG0A 2O8DA 4FFOA 3KSMA 2OJ3A 4MWOA 1G7TA 2ZREA 1I9GA 2H59A 4KHMA 4CI0B 2R2GA 1E79D 3H9JA 2AHRA 4F04B 4NLRA 4CV2A 1Y9DA 1PG5A 2F40A 4GDFA 2J0UA 1OCEA 1WL8A 1G8JA 3C8ZA 2XWSA 3CH7A 1W5EA 1KF0A 2KRBA 2BD0A 4RLQA 3BX1A 1JR3A 3CZ9A 3QIVA 3BFVA 3G8SA 3SS7X 4ZOCA 3KG0A 3DXZA 2GJIA 4OJQA 1QGZA 3ISTA 3AH6A 4LXIA 1F9HA 2VP3A 5KNBD 2ZUFA 1R8CA 4K6CA 3G1TA 3WDSA 1CZHA 3O8NA 1FUYB 1RWMA 1SC3B 2KG0A 5HK8A 2MZSA 2IKSA 1NONA 3MN1A 4WFBQ 4G01B 4IZOA 3KOYA 5HKKD 1ZWKA 3NXKA 3O1JC 4X8HA 2H06A 521PA 1H94A 5ETLA 3SQGA 1VPWA 2Q45A