4NMLA

2.60 angstrom resolution crystal structure of putative ribose 5-phosphate isomerase from toxoplasma gondii me49 in complex with dl-malic acid
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
257
structure length
249
Chain Sequence
MNPQDKAKQAVGYFAVDTYVRSGMKVGLGTGTTAKFVVERIGQRMQEGSLKDLLCVPTSEATRKQAESLGIPLTTLDGIADLDVAIDGADEILPPTLGLVKGRGGALLREKMIAAAAKTFIVAADETKLVSNGIGSTGALPVEVVVFSGSHTKRLLSALPSVKRHGGRAEFRKRAGAAQEDIREEDRFVTDNGNYIVDLYFTETVPDLHEMDKELKSIPGVVETGFFLDLASVCLIGKADGSVATLTAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Ribulose 5-phosphate isomerase
publication title 2.60 Angstrom resolution crystal structure of putative ribose 5-phosphate isomerase from Toxoplasma gondii ME49 in complex with DL-Malic acid
rcsb
source organism Toxoplasma gondii
total genus 80
structure length 249
sequence length 257
ec nomenclature ec 5.3.1.6: Ribose-5-phosphate isomerase.
pdb deposition date 2013-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06026 Rib_5-P_isom_A Ribose 5-phosphate isomerase A (phosphoriboisomerase A)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4nmlA02
3.40.50.1360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4nmlA01
2O0MA 3AAWB 2RI1A 3LHIA 3DHWC 2P9GA 3KV1A 3K5PA 3NZEA 3BXFA 2JOQA 2LVWA 3IXQA 3L7OA 2QSWA 1DEAA 2W48A 3P96A 4IO1A 1PSDA 3BXHA 2RQKA 3BXGA 1XTZA 3MTJA 2P9CA 4R9NA 1NE7A 3DDNA 1Y89A 3LUYA 3DC2A 1PBTA 3EFBA 3AB4B 2RI0A 1M0SA 4L4ZA 5HJ5A 1JT9A 3TUIC 4GO1A 3OC6A 1Y7PA 5FIIA 1LKZA 3OFGA 3MWBA 2LQJA 1U8SA 2OKGA 4L5JA 1YBAA 2R5FA 1CD5A 2PA3A 4OQQA 3TX2A 1HOTA 4L51A 2J0EA 3KWMA 2MDAA 2DTJA 5IT4A 2GNPA 1SC6A 5JJBA 1UJ5A 2BKVA 4R7TA 3HHEA 5IS2A 3O1LA 3OFEA 4TM8A 3DHXA 1UJ4A 3OBIA 1ZPVA 4LUBA 2P9EA 2NYIA 3HN6A 4OQPA 1UJ6A 3EB9A 1RWUA 4M8LA 2QMWA 3CEDA 4X84A 1FS6A 1FQOA 2J0XA 1KS2A 2H9ZA 3OFFA 3NWPA 3NRBA 3OFHA 3UW1A 3MAHA 1HORA 2CDQA 1VL1A 3U7JA 2DT9A 2BKXA 2KO1A 3N0VA 2F1FA 2RQMA 3BXEA 4TM7A 3LOUA 1O8BA 5T41A 3E15A 3AB2B 4NMLA 4L50A 1FS5A 5IT0A 2F8MA 1FRZA 3TUZC 3TUJC 2I9SA 1YGYA 3LWDA 4PWUA 3ENQA 4GO5X 2WU1A 2PC6A 3W7BA 4GMKA 3CSSA 3CH7A 2QRRA 2ZHOA 2QMXA 3E7FA 4GO7X 1LK7A 4L5IA 2JHEA 3ENWA 2FGCA 3S1TA 2RE1A 1FSFA 3ENVA 3ICOA 3IBWA 4L4YA 2J0WA 1LK5A
chains in the Genus database with same CATH superfamily
2V34A 1ML4A 4Y6GB 4M0DA 1FTGA 3DE3X 1SJRA 3E23A 3ZUGA 4I6YA 3F49S 5EWGA 4DCNA 3AA8A 5DO9A 3INNA 3NASA 2HH9A 1DJ0A 3QEMB 3CGWA 4NLGA 1BXGB 1TZMA 3MRSA 1G55A 2KJQA 2XCIA 1HBMB 3BGOP 1ZC4A 4NI2A 1DJNA 5CHYA 4OQQA 2Y8YA 1BKDR 3ROZA 2C2RA 3S40A 4POOA 5BYJA 5SZHB 2RKOA 3NBYC 3C8ZA 2ZCUA 1YFKA 2KLHA 4WNYA 3FHTA 1G60A 1VJWA 2OEMA 3BE5A 1O5JA 3LBNA 4LK3A 2GCOA 3OVSA 2WQ6A 1TK3A 5K0CA 3C3BA 1FRKA 4MWDA 5DTQA 3CLHA 5DJ5A 5JSHA 5YASA 1Z82A 4DG8A 3CLKA 1U31A 1HQCA 1YZ6A 3QWAA 1VYVA 1HT2E 3E53A 4GNKA 4UMFA 2GIQA 1FS5A 2JF0A 2FEOA 1PQWA 3L6DA 1G1AA 5AVTA 3JVIA 4TWIA 2M6LA 2AN1A 1ZW6A 3QZUA 2VC1A 4M9XA 2AX1A 3UMVA 1UWBB 3SS9X 5C1DA 2OVFA 1AC5A 3OV7A 2LKCA 4Y6PA 3W5ZA 4QR0A 5FOSA 5I8WA 2BI4A 2CCJA 3MWBA 1KQFA 3F5DA 4ZYVA 2HQRA 5E2AA 2JI7A 2R2AA 3ZCRA 3F1KA 1TVRA 2XB6A 4LRDA 3ABZA 2O3RA 2XBPA 1V1RA 1CW2B 1D6MA 1NF3A 1YR8A 2J87A 3OLXA 5LXYA 1W30A 3ILHA 5AVKA 5KHAA 2QF7A 3IUMA 4LSMA 3BSNA 4XASA 3JQFA 1OFTA 3A04A 5DBEX 3BF4A 4FKXA 1LBEA 4URYR 1R0CA 3OJSA 5FOUA 1I1OA 3D3WA 2CJWA 2DHEA 1DXQA 5EGSA 5AESA 3VVCA 1S7IA 1X8LA 1O6XA 3QOYA 2CDRB 3OF3A 3TQTA 4NULA 4FC6A 5MLCV 2QTLA 1MGPA 2G6BA 4K4VA 1ICIA 2KI2A 5DPMA 1Y8ZA 1LSSA 1QFMA 2VHVA 1W85B 1HE2A 2JPDA 2P5VA 2IGTA 2X0IA 3FXAA 1J8QA 1KXZA 2YNMD 4RY8A 2O2JA 2JK1A 1OA1A 1U9ZA 3TI9A 3HBMA 1R27A 4ND8B 1IKWB 1AKQA 4BFLA 2X1BA 4I2PB 1SCAA 3L1HA 2WM8A 4NNJA 1ZS9A 2QAJA 4K81B 1E0KA 4DLZA 4A6EA 3LRXA 5AKYA 4AKIA 5LZ8A 5KFXA 2EGGA 3V8PA 3Q22A 2CRLA 1X9MA 4I2QA 2AZTA 3VO1A 4E6EA 2Y6UA 4WFZA 2GARA 2IHBA 1H9BA 3ABOB 3QHQA 3OUYB 3F7OA 2JJMA 2JRCA 4ZT4A 4WCDA 2NREA 2W7TA 1U2GA 3CNLA 1GZDA 6AT1A 1XDZA 1ODSA 1N5VA 1BCSA 4BVGA 3F78A 1IB0A 5MN5A 1LX7A 4TT3A 2WKSA 4KQKA 3B8HA 4LIPD 4O3SA 3EVZA 1G8AA 2RC5A 3TEJA 2JSXA 3I42A 1G5IA 3QE2A 1N9GA 4LKOA 1RIIA 4BVKA 2PE5A 5DHPA 2FC9A 2R7AA 4LXHA 2IODA 4FILA 4JU8A 4I8IA 5IAEA 1D2RA 4YB6A 4RLSA 1PJ7A 3ZHCA 3CZMA 2AOWA 1QIFA 1SD1A 1SCJA 3DBHA 1QFSA 4KGXB 2GYWA 4V02A 1R0RE 4KAFA 5AW8A 4EPRA 1OHHD 2F43A 4WOPA 3WISA 3ZKWB 4LQ9A 3IEVA 5A0VA 1FW8A 5DZ7A 4D6YA 4UFOA 3R6DA 3IVGA 4OJKA 5GV7A 5T6MA 3IEPA 1TJ3A 4M9CA 2C2KB 1HT3A 1QB8A 1X7WA 1F9FA 3MRVA 4GSLA 4Q9LA 2YCBA 4ND7A 3X43A 1PIWA 5C8YA 3URMA 2Y27A 1LK0A 5DGDA 5E7QA 4G24A 3GRUA 1LLQA 5HKLA 4TWBA 2ZZKA 1T29A 5JPIA 3AB2B 4TTVA 4DL0C 5BSEA 3PUZA 1MP0A 4ESEA 5LQRA 3UMYA 3RJ9A 5LDDC 1CULB 3IP7A 2WWGA 3E01B 3HUUA 2NS1B 2X5XA 1JQGA 4B44A 2DNKA 3STXA 4BO2A 3N8IA 3NT2A 2ZJOA 2ZKTA 4FNHA 4OJYA 3UAWA 3NBAA 3K9CA 4CU2A 1G2QA 3QQ5A 2KJVA 3FFAA 1NJGA 2V0GA 3DV2A 3TXXA 4L2IA 4Q3AA 1EX8A 1S6PB 3DMTA 1LI4A 2Z8XA 2A88A 5J43A 3N6LA 3PE3A 3BWYA 2L3MA 3IAM1 4IF4A 2IYSA 4OYAA 4D9GA 4YMUA 4N8SA 1JWBB 2DNPA 1D7OA 4U63A 4AWXA 1EP9A 4WOBA 5K20A 4LHEA 2V94A 3WYFA 3AUTA 3OX2A 4EECA 4CMBA 1B8PA 3KBOA 1R3DA 3LP8A 3ONFA 3WRVA 1TYZA 3GIJA 3OZRA 4DR3B 3LLSA 1KI1A 2DFPA 3KHUA 3TQRA 1MG7A 3V1TC 1JQJC 1ENZA 4DLRA 3I9V9 2IY8A 3KJQA 1NHWA 3OEWA 4JH0A 1ZVKA 3K0KA 4EF5A 1NMQA 4WNIA 3LG2A 1RT3B 4A4DA 3RH0A 2WAOA 3U19A 3OXGA 1M2OA 5ABPA 2AVDA 1S8AA 1XJWB 1YKWA 3HS3A 1NU4A 2YIMA 3KVOA 1F2UB 3CRW1 1EXVA 2W8KA 1S1UB 5KSOA 5F41A 4J4BA 1Y37A 2H2FA 4DS3A 1CZRA 1Z4NA 1D09B 1WEKA 3PQ6A 1FFAA 2A3JA 2PBLA 2FSFA 3E3MA 5JZ9A 1E3QA 3NBZC 1S1XA 2Q2QA 3SKYA 4XQGA 2AC2A 3O4FA 3BN4A 2B1GA 2ZJRQ 3GRRA 2D62A 3EASA 3PYLA 4KTTE 3GX1A 1EUYA 4D7AA 1IRIA 3MM9B 5HS6A 4BRSA 1R5OA 4KWCA 4BRUA 2BJ8A 2Q1SA 3QMWA 4QLOA 3OQ2A 2VJMB 1KZHA 2F8HA 2YRFA 1GLNA 2RIPA 1ZA2A 2YTCA 2YXPX 3HH8A 1TKCA 4ED6A 1RB0A 1EVZA 1IQRA 4OJ3A 4JI8F 4UU7A 2J9EA 2FWNA 3HVKA 3H97A 4O2AA 2N4DA 2R4UA 1KZ4A 4LK2A 2W9AA 4Y8VA 3OFVA 3ZZ0A 3WE7A 1FRFS 1CQZA 4EHBA 1SBIA 3ASYA 1NPPA 4CLUA 4QEDA 4E46A 2CV1A 5DLPA 2CXRA 2ADCA 2B30A 3AEQB 5AXNA 3VVBA 5KC8A 2DGXA 4QT4A 1FWLA 1M0WA 3DM2B 3NC1C 4ZAXA 4Q0BB 1WEXA 1TCBA 4TLDA 3QY0A 3SXLA 1G63A 3EZ6A 4TZ0A 3PR2B 4TV9A 3I72A 4UZEA 4XARA 5K8LA 1JJFA 5K8NA 4EK9A 5IHPA 1BWVA 2EXXA 1G0NA 3K9LA 3ZE9A 3G8SA 3I9V1 3IPCA 3O8QB 3U39A 1J6UA 4BO6A 1OW3B 2WTMA 2BBTA 1N8NA 5BR8B 2UAGA 3CISA 2CWKA 3AEYA 2J9DE 4XPIA 2I6QA 3SQMA 2QDXA 1ZTWA 1Y1SA 4XD7D 1UKZA 2V67A 3FDZB 4B5LA 5A3JA 3WNZA 1MRNA 1T24A 2LFVA 2VOOA 4C01A 5JNUA 1PJ3A 1EZ4A 3Q3IA 3CIOA 3FYUC 1GL9B 5EIBC 5JFGA 3TTWA 5AJZA 5EJ2A 4BE7B 5FWYA 4ZREA 5MFZA 2XZDA 3CCFA 4O8ZA 4OKNA 1L3TA 2MQPA 4L4SA 1I4DD 2SKDA 3QIPB 4AG6A 3QFCA 5K6TA 1U0TA 3H5SA 2OCPA 2IC3A 5L3QA 1HQ2A 2D2XA 1NIPA 1Y4AE 5KNDH 2WMDA 2HJGA 5ES3A 2Y66A 5EWMA 4RKUC 2A18A 4J94A 1P73A 5G4KA 1LSJA 2W5UA 3G6WA 1WA5A 4NU6A 1A76A 3CF5Q 1JGTA 4F91B 4L4ZA 1XZHA 4EMTA 2AC7A 5E6RA 2W6MA 1CJKC 3OOYA 3WLMA 2YN4A 1JEYB 4G6VB 1P5ZB 3RYTC 4KV8B 4I9GA 4ZQCB 1BN6A 4EW1A 4C5CA 2IUYA 3UK6A 1GCIA 4KQ9A 4BX9A 3KNGA 2FPLA 4JR1A 3ESCA 1REQA 2PMCA 2DR9A 3QJ5A 2ZYSA 4MCJA 3KLHB 1P2UA 3L7KA 1KH3A 4BAZA 5GIPE 4CUKA 1NVXQ 4IGIA 1M6EX 2F00A 1JXOA 3WV4A 1KIAA 1RHJA 3DAOA 1XN1A 4HDOB 2XYRA 1KNQA 3QITA 2EBUA 1XU7A 5LT5A 4RK7A 2WSMA 4GL2A 1MROA 1OQ6A 1SA0A 3ZWCA 2B5OA 1I3LA 3PRYA 2ABWA 4MDFA 1R8AA 2ODAA 1C4XA 3EXFA 2GCGA 4OM8A 5SZTA 4I4IA 3TAHA 1JLGB 3OICA 1KK2A 3GIRA 3CLUD 3DDNA 5CJPA 2PLWA 3QMVA 2AFHE 4DIUA 2JHFA 1ZH4A 3G1UA 3IHWA 4DV4F 1MENA 4IOBA 2QG4A 5M3BA 1YS9A 3ROMA 5J2UB 3UATA 5G0RB 3U3ZA 2Q7XA 3VVMA 2Z08A 2ID7A 2BI8A 2QZZA 1TZBA 5BQ3A 4DT1A 2N42A 3R7SB 5K1ZA 2I8AA 3ZBUA 4HVCA 5AI8A 1WKLA 3A4TA 4X64F 4RK5A 4N9WA 2QUIA 4BGEA 3LC7O 16PKA 2CBXA 5CT8A 4P3OA 3FY4A 1HYEA 2IEIA 4Q9AA 2K5UA 3VFDA 3I2KA 1CUGA 4ENTA 4YA6A 1IWAA 4DR5J 3V2HA 1V3TA 3ZXYA 1Z73A 5TPWB 1I33A 2IYVA 1SU4A 1BHO1 4GE3A 4HFNA 2NO9A 1CY0A 5DT2A 4AUMA 2VRWA 3OCXA 5HJEA 3RJMB 4ZPWR 2G7MC 2WJ6A 3O5AA 5DULA 4UUNA 3CR7A 3SS8A 2K7ZA 1IJKA 3X2SA 5HL7Q 5KG6A 2R7OA 1ITPA 1G3UA 4WW0A 1Z2AA 4G0NA 3FOAA 3ETEA 3CNHA 4ZP6A 1GAEO 3T6JA 6ADHA 4HEHA 2PD4A 5FPKA 2H5IA 2XUOA 3UV6A 1WHYA 4GLFA 2K3KA 5KYXB 3QU2A 3SQNA 1FERA 2JATA 3D8TA 3G17A 4PSVA 3REQA 3KG2A 4D4MA 2J0VA 4JBLA 1UBSB 3C16B 3M1VA 1EGQA 4GVBB 1P3DA 3U48A 3G9XA 4KKVA 5ALVA 3L6UA 4YDDB 1OQ3A 1TMYA 2K8GA 5ENDA 4Q48A 1QNFA 4JSYA 3W65A 1JBEA 4JEIA 2O3TA 3P4YA 1ZA1A 3B85A 4MGHA 1TEZA 5C2JB 3T1TA 3WYDA 2WU1A 1E5DA 3MEEB 2Z2YB 2ZC4A 2HAIA 4E08A 1U9JA 2OQIA 5KG4A 2XY5A 2JFUA 4JYPA 4OUKX 2P40A 3C7DB 4C04A 3AOBA 2CVFA 4K9NA 4DWJA 1IHPA 1P1BA 1E0AA 3QFHA 2VLBA 1KMHA 4QPNA 4DNOA 3POTB 1E4VA 1V2GA 2GJFA 2GCNA 3IJ5A 1GG9A 3MGGA 4YLGA 3HZEA 4EX7A 4IMJB 1PHRA 2VHZA 4CKEB 3KYDA 4BQIA 1D5CA 2N1BA 1ADYA 2WVGA 4ZHQA 1NUTA 4IDQA 5HUHA 1OKKD 4LYEA 3M9NB 1C80A 3D5QA 4JL8A 5EHZA 4DLWA 4FWBA 4M0KA 4XRGA 1A69A 4USKA 5E3HA 1NBWB 1M2WA 2EQBA 4EPWA 1JQ5A 4G5SA 3N2YA 5GJWC 4LX8A 3RSLA 1BQ4A 4DHEA 3DE2X 4QARA 3CS3A 2GR9A 2ZBVA 3D31A 3H86A 4EM6A 1XWLA 1TA0A 5CT9A 4X1YB 1I01A 2WF7A 3NX4A 1VL2A 1CVJA 4R69A 2AEFA 1U24A 1U26A 2RE1A 2GZRA 2XB8A 4XAQA 4DIKA 1Q12A 3K9NA 5D3MA 4OLJA 3NDRA 4DUZJ 1DPGA 2Q3JA 5KYUB 2QX7A 2OBMA 4KYIB 2JI6A 1ZAVA 1PSZA 2KSQA 3LCJA 2FHPA 1L4EA 4ZKAA 1A9NB 3B1JA 1L5HA 1LBIA 5FOVA 4AQDA 1TXGA 1PL6A 2XTNA 1LWCA 3FZQA 2EL7A 2BF4A 2JI8A 3ZYCA 2HHLA 4BC0A 5C24A 2E37A 2W43A 4DF8A 4RMNA 1JJ7A 4CIYA 2PZMA 2QA2A 4DRXB 4NOHA 1P1FA 1N2GA 1ZI6A 4Y1FA 1PUIA 1UBEA 2FMFA 5CP8A 4K7QA 2J9DA 1HH4A 7REQA 1YU6A 4PLFA 5KQSA 1L5ZA 2D3TA 1J2TA 2AEJA 4RPGA 4EL5A 4A46A 1QSLA 4J37A 4LRSB 2NSLA 4IG3A 2TYSB 2I9PA 4B2LA 4PC7A 1O9BA 3HZHA 4BZZA 3W66A 1XNHA 4FSXA 4U7GA 3CVKA 4A91A 3I6YA 1DAIA 3NVDA 2C5GA 4OQFA 3PC6A 3KKFA 3V81B 3AXMA 1BX3A 2LU1A 4XCVA 1IBKB 2UUTA 2CVEA 5CH7B 4WQMA 2UUCJ 1C7QA 1U7HA 5JVDB 3MSCA 5JH7A 2FTKE 3LZ6A 1X5SA 4ZCKA 4R0EA 3K0JA 2QRVB 5JXWA 2CQ2A 4L72A 2X23A 1TMJA 1N2CE 2F2TA 2CMFA 4DL5A 2FA9A 3UMRA 1DWPA 1LDMA 4BVAA 2CQHA 3SOPA 1NVWQ 1Q78A 1ZWKA 3KMQA 4R83A 3FF1A 3DRYA 4I4TA 3D7KA 4IJMA 4B02A 2IIQA 1XZPA 2H0RA 2Z30B 4ZTUB 4O4IF 2YX7A 3IOBA 4YPOA 4IF6A 1UT8A 1VFPA 3W9SA 2I3DA 5ECGC 2ZRMA 2QTCA 1XNRB 1EESA 3VAYA 1B8UA 3J81j 4B3BA 2Z09A 4LJ7A 4AK9A 1IJBA 5D5HA 3HDJA 2JIMA 3MPUB 1HURA 4LREA 3DAPA 3P94A 5SZJA 4PRYA 5HNKA 5D87A 1C0TB 2H9IA 1KMCA 1XCBA 1SZPA 1KKMA 5GV8A 4Q00A 3UYKA 3V4OA 2HJHA 5J2PA 4H1VA 3BHNA 5H83A 5HFAA 1F7UA 2CV0A 2EF0A 3SF8A 4IIJF 2R1TB 3LUAA 3DTVB 2BONA 3CZAA 3V6MA 3AG6A 4RF4A 5A3QA 1X1TA 2HI0A 2PYZA 3WZ0A 2ISCA 3GFOA 5I5EA 2QUBA 2D1YA 1RT2A 2ZJ7A 4U3JA 2CSUA 1Y6FA 1WHSB 1J5XA 1UC9A 2XWJI 1Z63A 4MX8A 3IR5A 3ZTOA 1TM1E 4ES3A 2PUDA 1E6VB 5KUTA 1DKMA 3T3PB 4RV5A 3OPXA 3PIOQ 3BGDA 1BOFA 1UMDA 3Q6IA 3A1SA 1OXVA 1KQ3A 3NC0C 1QUPA 5DQIA 2C95A 1AQLA 1VQ5S 3OJOA 3RAXA 4CTNA 2O3QA 3HJGA 5I9NA 2EZ9A 3O74A 5THWA 4S2EA 1OI2A 4EEXA 1OLUB 1RWVA 2ZBPA 4H1HA 1GQRA 3QEKA 2C83A 5B1YA 4KO0A 1J2VA 3W2TA 3HVAA 3QPVA 3FPHA 2WUGA 4BNVA 2OFWA 4R7GA 2I1LA 4MS4B 3WX4A 4IEIA 3M4NA 3B6ZA 3OQOA 4LQDA 4EW3A 4EG1A 4ISBA 5CIYA 4FDLA 5BMOA 2JFFA 1ATIA 4XE5A 1HFEL 4G9EA 2D3WA 4G9BA 1CQPA 2ECKA 1L3SA 1E5TA 2D2FA 1GXLA 4L75A 1G5TA 2I8CA 4UNRA 5IEJA 4KUEA 2N3LA 1AHIA 2OKCA 1IR1A 3GFTA 3ZZ1A 5JCJD 4JI6F 2I6FA 1QAMA 4PLVA 3U1LA 3RHSA 4QHYA 3H5UA 3AF2A 3FMVA 4N3BA 3R40A 1QP7A 1JTEA 4BNHA 5IN5A 4HUJA 3B2QA 1JIJA 1DHTA 4RE5A 1B74A 1HDOA 3DV0A 3UN1A 3DB2A 1I9GA 4IFBA 1W34A 1LJ8A 1ECFA 4HDMA 2QW0X 1CNMA 1PR9A 3ZHZA 1O94C 3U40A 3VAJA 1XTSA 1UFOA 5GAHI 1MPTA 2IQ5A 1G7SA 5A06A 2B9VA 2YV1A 2IH2A 1PBTA 1BAPA 4JI1J 2C97A 4LZLA 1WNTA 3RS9A 1X7ZB 3JAKA 4BYGA 5TNXA 2A59A 1C29B 1J7JA 4H4CA 3EVCA 5BW6B 4F7DA 1HO3A 3GAFA 3GQBA 4GE0A 4AL5A 3PQFA 3ZEIA 3KNZA 2H63A 4OYZA 4PUOA 3FPJA 3EJWA 3EMBA 4B82A 5HN0A 3UJAA 1X4DA 3U9SA 2NYIA 4LVNP 4MITA 1JI3A 3KLIA 1RRVA 1X3LA 3STUA 5CHEA 3H1BA 4K5RA 1F60B 2OO3A 2Y76A 1AKVA 2WD9A 4TNOA 2H5JA 4CETA 5AM5A 2XE4A 4UCFA 2BVZA 1TFRA 4DQVA 1VGVA 3QPAA 4PZVA 5ITSA 3PZPA 2AF6A 1U0OC 3IMQJ 3M3HA 4B9UA 4REOA 2VBGA 3PSHA 1XJ5A 5A2QU 3KK3A 3UWKA 3VR4A 1E69A 2NLOA 3P5BP 2PE8A 1SC1A 2H4FA 2GQCA 2A1TR 1EDBA 4NIMA 2AFHB 1XK7A 3NMRA 3EZUA 3I0SB 5FUBA 1QTNA 2W8BB 5M7EA 3DBIA 3MM8A 3KWJA 3D2BA 5DTMA 1SQFA 1KEVA 4PLGA 4HDHA 3O21A 3F8WA 3A26A 1OTHA 1IVNA 4EKGA 4L5JA 5BN3A 3OURA 5CFMA 5IRCD 4I3GA 4UF4A 5D77A 1QPZA 2RUSA 4EGAA 3UGQA 5FA5A 3G7NA 4DR5B 4GEKA 5LP6B 2GAHC 2O5VA 1IUPA 2ZUSA 1UBMS 1G6BA 3WWPA 4MPTA 3GIWA 3BJZA 3L41A 2D5LA 3ANNA 1B1CA 3UW1A 3UE2A 4MKBA 1B3BA 3WJAA 4CIXA 4QQKA 3NXZA 3R7NB 1DUSA 1QQBA 2UVUA 2W4IA 2QJ3A 4F2RA 4S3MA 1M6YA 4IDFA 4YR7A 1WVMA 5LCXA 2GLTA 3PI6A 2Z1NA 4KH1A 4WN9B 1OFIA 3LP2A 2ZRIA 5FKJA 2IK8A 1HWIA 1ACMB 1EP2B 4D97A 1GU7A 4O4RA 3WWOA 2P9JA 3FX2A 4UD2A 4JI0J 4KB5A 4FXDA 4G0XA 2PAFA 2CAJA 1K73T 3A05A 3I01M 3GLGA 1H9AA 4BNDA 4DUGA 2D41A 1EWKA 1W5SA 4EI2A 2COKA 4J7AA 3Q7IA 3DUFB 3BFPA 3AJ9A 2H4XA 4C78A 1YBAA 1YI1A 4IO9Q 3RTCA 1Y0BA 4NZZA 3RAJA 3L8ZA 1ZEMA 3V6HA 1BU8A 3AFGA 3OUZA 1SNYA 1N2CA 1FJGF 1VKJA 5CFLA 1W6RA 5JY6A 1N2XA 2RE8A 3F6EX 3JASA 5IJ9B 1RRFA 3R7BB 4WFNQ 5BSRA 2I1QA 3NT4A 4LQ4A 2PSHA 4WPAA 4RPKA 1KEUA 3U5ZB 1R0ZA 4JXKA 5DIZA 2QZPA 1ZRMA 3I64A 1L4UA 1RZMA 1USKA 4MVJG 3SQDA 3EC1A 4B3MF 3E2IA 3OM9A 3MTQA 3L0SA 4QEKA 2HA5A 2HGNA 4GRSA 1UAYA 1ZH0A 2D2IA 3K72B 1OILA 4DCSA 2BZ2A 2OESA 2QB5A 4LTMA 4ARBA 4QYIA 3E1GA 4H15A 4QX6A 4CEJA 1YD7A 4OQLA 2ZJ0A 1Q53A 4I14A 4ARZB 2UUAJ 3M8KA 1N34J 1N32J 4OQ4A 5TSDA 4EHDA 4JXXA 4G5GA 2W6JA 3OZEA 4LDQA 5CYFA 1B0AA 4JB3A 3K5OA 2CLLB 4OH1A 4DXDA 4F1KA 5B2ZA 3D1VA 3A7DA 3KM0A 2H3EB 1V3ZA 1NI4B 4G0MA 3R3TA 4YCBA 4I1YA 2JB9A 1Q95A 1MA0A 1UIMA 3H3XA 2J5BA 3H9UA 2O0KA 3KK0A 2Q4OA 1IJEA 2Y77A 3LAWA 1Q82T 2VXCA 3GJRB 3U3JA 1USUA 1NG1A 2BDUA 2X1HA 4ZVVA 1CUHA 4BP1A 4DUZB 4C9DA 2PY6A 3RBEA 2MKSA 1G291 1H7WA 1K4YA 1Y3BE 2GK6A 1SXJD 2GEBA 1ZGGA 3E8MA 3P2OA 4KYTA 3S1TA 3OZBA 4CLYA 4TKZA 4Y2QA 4G5YA 4ZPXA 5KNLA 4CM4B 2WPDA 5KFDA 2HBQB 2II6A 4F6LA 1YB4A 4MT1A 4N7JA 2Y1RI 1L0BA 3KV3O 1E3WB 4YP9A 1GJRA 3S2IA 3QX9A 3N6VA 5JNLA 2GJ4A 2J4CA 4BO5A 2L9DA 1IK6A 4YI5A 1E5XA 5DHAA 1BN7A 2VF5X 2PS0A 3HGTA 3SBMA 1SCNE 3G2KA 2GN1A 3BWXA 1NRWA 2GVZC 2VFSA 4K4WA 1TYCA 1VG9B 3UUGA 3W5DA 4P6QA 1WOSA 3UUEA 3PA8A 3H16A 3LH5A 3R3SA 4ZU3A 3WAGA 4L8GA 1KTQA 3E03A 3L7DA 4M1TA 1TAQA 1GTJ1 4FN5A 2CMHA 1XZKA 2ZBIA 2UUCB 1YZLA 1ZN8A 4FDUA 4XWOA 2A10A 1LA2A 1PNVA 5JNTA 2PNJA 4NV0A 3ZK9A 4R16A 1D2EA 1QJCA 4K6OA 3MQ4A 1CG6A 3EYAA 1W5FA 3U3RA 4HNAA 4YIHA 3LYHA 1SBNE 1G8GA 2FEWB 4B7ZA 3LL4A 1TKBA 2P9CA 5C7PA 2YKGA 5CQGA 2HWUA 2BIFA 1YCDA 4C88A 5CYQA 2M1XA 2JIQA 2E66A 1ZRHA 1H4TA 4COKA 4AY6A 2WP0A 4DHVA 3TSWA 2CLSA 1ESMA 3T9ZA 4UUBA 1NHVA 2RSLA 2JIZD 2P5SA 2ZT5A 1LWEB 4Q4HB 3C14A 5HAOA 3IULA 1QAOA 3MAQA 2JGLA 4IHJA 4JUBA 1JPJA 4QQRA 3H2UB 3QRQA 1DAPA 2WWHA 5AO9A 1OGJA 4NG4A 3PFWO 1UBUS 4M9UA 5BW4A 1ISMA 1X3SA 3E8SA 2F1IA 4HWOA 3BH6A 1XUOA 1BQ3A 5AW6A 4KXMA 4F38A 4II3A 3GV8B 1ZH2A 1PR6A 2A5LA 2ZRCA 5LMZA 4E14A 1F1JA 3PXGA 5ULLA 3AV0B 1IHUA 4RW0A 1HNVB 4DIOA 6CHYA 1P1LA 3CPEA 4D9MA 3ZCSA 1LQ2A 3NH9A 2IV7A 3Q8MA 3G2HA 5LMNF 3QXSA 2R7RA 5JJLA 4LRUA 1H2ZA 1V5EA 3K15A 1JHMA 4I1UA 2LW7A 2IC5A 4K9DA 4U7WA 2AZ4A 5E1OA 1YCGA 1WZUA 2IPOB 1RCUA 1RXUA 2IIHA 2VVTA 3R9KA 1OIXA 2UZ1B 1F0NA 5J63A 2G0JA 3JB9k 4GKKF 1Q1KA 2QLJA 1YOVB 1NAHA 4K1XA 3JR3A 1K5DA 4IO0A 1SV5A 1IU9A 3HKEA 2EWWA 1LPBB 2PX0A 2XUQA 1DBSA 3QBTA 2ZJFA 2YMPA 2EEPA 3VGJA 2ZRNA 5AM2A 4FVTA 4RCVA 3LKVA 2HLTA 3WKCA 2IYPA 5L9NA 5IWAB 1NVDA 5K14A 4JT8A 5KAPA 5I4BA 5G4LA 5AI6A 4UM9D 4OB8A 3UENA 1W36B 4J1TA 4AY2A 1F14A 2AZ3A 3EDQA 3OIDA 3JQGB 4KXXA 4FVCA 4F93B 1A1VA 3ZY2A 3AKDA 1VKRA 3PT9A 4D8VA 4EYOA 4PLZA 1XFDA 4O1HA 3LD9A 3EVFA 3SEZA 2H7YA 3M2UB 3NZEA 3TB6A 4WERA 1E1QA 4JYAJ 2OH2A 1H6DA 2P3SA 3WGMA 5BWCA 3MGKA 5DI9A 2DECA 1QH1A 3AO0B 1XCGB 1AKYA 4PYRA 4UBJA 4BNUA 3MILA 1W44A 4LFCJ 4KIFA 4X6XA 4IILA 5L7WA 1OIAA 3OX4A 1II8B 3M8YA 4RBVA 2KL8A 1PJRA 1VLHA 4XOUA 3RQIA 5FLYA 3NFRA 1EB8A 5LUAA 1JKHB 2NQTA 1NK6A 4DN6A 3OXLA 1MBZA 3N5FA 1FK8A 2ZHAA 3HCNA 3OE7A 1NKTA 2IA6A 3K1ZA 4FEAA 2HFVA 1P0CA 1WPQA 5KOXA 2G6TA 4ZAYA 4AF8A 4B9TA 1NHKL 4HMPA 1AK1A 2Q9AA 2PXCA 2Z2JA 2B6NA 1NVUQ 2C8JA 2DBZA 2NUAB 4NJEA 4A9AA 1LV7A 4B83A 2ZAIA 3I3OA 3BJRA 2IH4A 3ZTQA 4ZDJA 1L4FA 4ED8A 5KOHB 1UDAA 3NCTA 4L8WB 3BN7A 3QATA 4CNBA 4HYEA 1N88A 1L5VA 2NU6B 3JQPA 3PENA 3C1TA 4S0ZA 4RDCA 3W9BA 2XM3A 2CJYB 3SX2A 1AYEA 1HA1A 1EWRA 3PGA1 1D03A 2FUG9 2ZRFA 2QE6A 3EEFA 4Q21A 1NW9B 1PWZA 2IYRA 2R6JA 2Q27A 1SG9A 3D5MA 4B2IA 3K5HA 3MHYA 3KJZA 3FROA 4DLGA 3PHCA 2WFZA 2YNFA 3DF7A 4JKOA 1Q1BA 1T3GA 1CJUC 2XYGA 4AT1B 3T9AA 1WEZA 5BNZA 1QDUB 1K5HA 1H0HA 4KR2A 2BGLA 2AW5A 3ZUPA 3R0XA 2FVYA 5EQTA 2C84A 2OPQA 1P1CA 4XYEA 2FPIA 2W01A 3AZOA 3BGUA 4QTZA 1OFUA 5IC6B 1JPNA 4CBVA 2OYSA 3ZW8A 4OHUA 2BE7D 1RI1A 3GVHA 1TL5A 5CTAA 5E3AA 4O4GB 5J1PA 1JU3A 2FKNA 5IJ0B 1ZOIA 1D5WA 3RVQA 5AIAA 4HH3C 2R8PA 2ZB3A 2WF9A 3AF1A 2W8ZA 2HFSA 1XD2B 3SC2A 1RYYA 1NM2A 2HZAA 1RIFA 1C9KA 3L1JA 5I7AA 1CEYA 3VZRA 3OOJA 2O8CB 2PKYX 1ZUNB 3IRVA 1GGJA 2WFLA 3RWOA 2LE0A 2CJFA 1Z25A 3TJMA 5F5NA 3BT7A 5F5LA 2I2XB 4FXOA 2HR1A 2HVIA 4RKYA 1JH9A 2AP6A 4FNGA 2HBZB 4EQ6B 2IYTA 3M6AA 4YAIA 3M81A 1W0KD 2BBOA 3GY0A 2HHWA 4RNDB 2IM2A 5EE5B 2MQ8A 5E2IA 4M0MA 3ZDYB 3OFFA 4OFBA 1U02A 5K05A 2BJWA 5TR9A 2OHXA 4U2GA 2GA9A 1KE1A 4NXNJ 3DDUA 3AUJB 3LKZA 4UAUA 2OAGA 4EUNA 2DB1A 3FTQA 3LVRE 2PFGA 3PW2A 1DB3A 3KXDA 3ZXWA 3CDBA 3T1YJ 3VPSA 4X60A 4WFQA 4ZVQB 1Q7RA 2XHEA 1H5QA 1M6HA 1CQJB 3O8OA 3Q2SC 1IVZA 3HA2A 2OBBA 3RVDA 3KLGB 3C3MA 4I55B 2V5HG 4E5KA 3IXQA 2H2HA 2YW2A 3C3PA 3W8NA 3WYBA 4Y1RB 1A4UA 5JZOA 1AK9A 1KEWA 3PGXA 4B6JA 1RHQB 3VZIA 1KFEB 1SCIA 1L5WA 4MK7A 1K0VA 1MO2A 2Q2NA 4IBOA 5BW8A 1UBKS 2CWDA 3OOEA 3GT3A 4DG1A 3RADC 2BLLA 4CFZA 2XLBA 4CQMA 2KFYA 5GJBA 4QR2A 2Y3YA 4HEA6 5A05A 2C5BA 4WOKA 4OZ2A 3CY6A 1BMQB 3DLKA 5AJYA 1T2CA 3R3YA 2UUAB 4RIHA 5CH3A 1DIBA 3IPLA 3NH6A 621PA 1U9IC 5HSPA 5EJAA 1IWBB 1SXHA 5A8RB 6GPBA 1RLUA 2OV3A 3L4EA 1KH1A 4ZXFA 2G83A 4YH1A 4ZVOA 5DK4A 2AFRA 3E9ZA 4HD8A 2ODQA 4DCMA 3PNPA 1SQGA 1B70B 1Q17A 4LJKA 2XDQB 1ZJWA 4F5WA 3B3AA 5HJYA 2JLAA 1NJXA 2W11A 3NHFA 3EHEA 1BY9A 4WFIA 5BSVA 1Q15A 3TM4A 1VJ0A 2AKAB 3DRPB 1ONPA 1HMVA 3M1AA 3T0GA 3VC3A 4ZA1A 1TC1A 3A1VA 3IQXA 4B8YA 1PTKA 2HFUA 2JLUA 2IIVA 3IVXA 2XNJA 5FUWA 4ID3A 3OD2A 4QQ8A 5JMWA 1ODIA 2G76A 2UUBJ 5FJIA 2OCBA 1IKXB 2QRGA 1CSEE 3BJIC 2Z4PA 1T9CA 2NPOA 2D8MA 5FI0B 3BGOS 1FS6A 1SBZA 1PJSA 3BTVA 3TZWA 3G6ES 4CYUB 4LBHA 1MV5A 2QENA 4A8JB 4AJLA 4Q2MA 5DX0A 2F7VA 3VC7A 4FXWA 2IYWA 5K3BA 5FLXA 2WE8A 2ZW9A 4BNIA 4EG6A 2CCGA 1KRHA 3OHBA 4NNPA 3H42B 5ALOA 4QM7A 2OHGA 3H4VA 2ZVIA 4BFWA 5FA6A 1IBLF 1KAMA 3LDAA 4ZVUA 1EP3B 4AQYJ 1LW7A 4AJ4A 3QXXA 4RFVA 3NBPA 5DM4A 4ZVLA 1RTIA 4JDPA 1E7YA 4JYMA 4I5GA 3W9IA 3TUIC 2Y1GA 2OBYA 3C7CB 4NLDA 3S2EA 1XTQA 3UF0A 2E4WA 4UNSA 2XMKA 1ZX1A 4UBLA 4TV8F 1E98A 2PX2A 3FFWA 3SCLE 3MXTA 3T9DA 1EWVA 4R2XA 4ZKEA 2FI1A 5EE1A 3FNBA 3D6UA 1QK5A 1KDNA 1GZSA 3MM4A 3CPWR 2X7XA 2FTRA 1T5BA 2H3HA 4DSAA 1UXGA 2EW1A 2RDMA 4HAVA 4M7WA 4F0JA 2QC3A 1J8MF 1RC8A 4C3ZA 4KQIA 2WONA 1C2YA 2ZI3A 1A7KA 1VE6A 3QF4B 4BLGA 1HEIA 5K8VA 3ED1A 3H2ZA 1W4LA 3ST7A 3LZCA 3J7A1 4MLPA 5CURA 3LGAA 4FQ5A 4NLWA 4CNZA 2AOUB 3LTNC 2BFNA 3PM9A 2GRAA 5KYGA 3UMBA 3HD2A 2BGMA 2HWYA 4JJGA 1KZGB 2B35A 5LXTB 4F2WA 3KU4A 4Y6QA 4U0JA 4QTXA 3ND9A 9LDTA 4C3OB 4AZSA 2EOAA 4M5JA 4ITSA 4DLKA 1THMA 5KHOC 3PXCX 1PW5A 5FWXB 4WAUA 2VK4A 1EVYA 5FP0A 4N77A 3OM0A 3D67A 5H1YA 1DDGA 4KYVA 3HJBA 4KREA 1W4ZA 1L4GA 1JTFA 1VYAA 3VYRB 2Z2XA 4RVUA 4YJ2B 1EE2A 2PSSA 4EFDA 2BGJA 2ZSKA 1WB9A 2A8YA 4J0EA 3DL0A 1PBAA 4DZZA 3L1IA 4KGVA 2FFRA 1NDCA 3NG1A 4N5IX 3FA2A 4NFLA 1VRTB 2QD4A 1C7RA 2YPYA 1GX6A 3WGGA 4YUXA 1MV8A 4GUDA 4Q9HA 2OV1A 4V2UA 3WL8A 3LP0A 3EMDA 3CWZA 4RVDA 4F4ZA 1ORTA 2ONJA 4ERXA 2RB7A 3COWA 4XEUA 3LRPA 2Q46A 1ZONA 2HMYB 3HVHA 2VC2B 3M6IA 3T1HJ 3LDFA 4RO0A 5CGQB 1DNPA 5GONA 3PQ3A 1LI5A 4MB6A 3BFKA 2MSEB 5ANRB 2KKHA 1QYVA 1LWFA 1TQ8A 3DGPA 2I4RA 1K88A 2JWNA 3S7RA 4LYFA 1D2HA 2DUJA 5JASA 1ACLA 3KVYA 4RW7A 1SVKA 2OHOA 1QMPA 2JK0A 1A50B 4OLAA 2PVCA 4I66A 3GRKA 4WE3A 2WOOA 1G7CB 5F7ZA 1ZJ4A 4YRIA 1FE4A 4LRBA 4DL4A 1R4NA 1LDYA 2BL4A 4FZJA 3ZIAA 4BNMA 5DTRA 2BTQB 4KX5A 2H16A 5COBA 2CQIA 1P2VA 3BCSA 4JYAB 3JX9A 3O38A 3N8NA 8RUCA 3W1YC 4ZWNA 3URKA 5JMNA 4P9SA 4IOCQ 4LNUA 1L8OA 1C50A 1WKVA 3CWJA 3ZNQA 2D5AA 4TLCA 2GCOB 4LQCA 3WWDA 3OMWA 4LFCB 1NNSA 1UKAA 1JHYA 3RQSA 5CHCB 1J56A 3RUEA 1H2AS 3D9QX 3MFHA 5AW2A 2R97A 3GR1A 1RAHA 1PLLA 3CNEA 4HYQA 1YJTA 1CC1S 2O0LA 1CEZA 4YMHA 1L5KA 3T3HA 2O23A 3HPRA 5C2GA 2RRAA 1R4MA 1NJIT 3TG2A 2ZSIA 1YL7A 1UOQA 4ZQBA 4MV9A 2DNQA 4Y6IA 2WTXA 2BTOA 3FYHA 4IYQA 3UGKA 2AWNA 2KW5A 2AJDA 1B6RA 2GILA 4N7MA 1NQXA 1DIOB 1O0PA 3FJOA 5GOZA 2CSXA 1IOLA 2H5EA 3U6BA 2DU8A 3PWSA 5KFLA 2G5CA 1QE3A 4TVAB 5BWLA 5MF6A 1TVRB 1NR5A 3CG0A 3UGTA 1IN4A 1N6QA 1V1RB 4FDFA 3MUTP 1YE8A 3PEUA 3GAMA 5B3JA 1QZXA 4WVLA 1J2RA 4G23A 3HKWA 4US0R 1OWMA 4H77A 2HK2A 1R0CB 1YZVA 3D3WB 1R5BA 1FUIA 2QTGA 2CJWB 2Y1OA 3O94A 1VE7A 4CLPA 4CTMA 2VQFF 3HNPA 3UHOA 2L08A 3HHPA 1EM8A 3O73A 2XGJA 2BQUA 4IDOA 3UN3A 3SBEA 5DGBA 2V7WA 3TTXA 3MJHA 5F0WA 1ZIPA 2ZYIA 4H6XA 4UFNA 4BY9E 4C1NA 1TAGA 2Y2UA 4R8VA 2Q66A 1CS4C 3SSNA 1A27A 4DSUA 1GILA 2PMEA 4QXPA 2Z0GA 3OG9A 4F8YA 3PSAA 2ZOSA 3PJDA 3MDFA 4ZI2A 1R27B 3WNCA 4DTIA 1JLAA 2FGOA 3KEFA 1M2FA 4C97A 3PW7A 3RDPA 4J16C 4ZJOA 1C7EA 1AZSC 2ZRAA 4IZIA 3JWIA 2RMLA 4KIAA 1P72A 1T34A 1JR3D 3M9MB 1NVBA 2VAVA 4ZTZB 1Q7YT 4DIEA 1EXWA 4I2QB 5KQPA 2V7GA 3NATA 1PYSB 4DS4A 1GKUB 3LTEA 3ZEAA 1NONA 6AT1B 4KSCA 3EF0A 1CUBA 1N7IA 2RC6A 5JDCC 4ER7A 2V6JA 1XQXA 3E5NA 4N7TA 2M6SA 2X5KO 3DKRA 2FLWA 2KVIA 5K6RA 4NXNB 3TP2A 4N49A 1HDGO 1VQMS 4L1KA 2JJYA 4H1UA 5G41A 1N9GB 1JIIA 5DBIA 3NKFA 1S5PA 2VBZA 3P0FA 4LJMA 3PO5A 4RHUA 4PGGA 2DGVA 5IUJC 3JATA 2ZVQX 3T1YB 2Z8YA 3JQRA 2LCIA 1N25A 5CABA 3V8VA 1QR2A 2QUZA 4H7FA 3B1KA 4U95A 4F5EA 1Z62A 3U4IA 4IXNA 1LWXA 1PGOA 1SCJB 1U65A 3N5KA 2F43B 4D1YA 4CG1A 3THYA 4WOCA 5B7WA 1E3EA 3V1MA 3UJDA 4DL9A 4F4XA 1IPHA 2HVHA 3JS5A 5BSMA 4CKYA 4DV7J 4Y2KA 4EMBA 1X7WB 2VYFA 1VI5A 2PUVA 3IP1A 3I4HX 3GUVA 1P1TA 5JV5A 4IHQA 5JYCA 2GJ9A 4OGFA 5C8YB 4CCHA 3G2NA 4MVJM 5IJAA 3KWFA 1IEXA 4G25A 3JV7A 3MHTA 4XUDA 2YOFA 3GLIA 3BS4A 3CBQA 3X1ZA 3U4AA 1SIUA 1IEVA 4KEAA 5DBHX 1L3IA 1VTKA 1EWQA 1XZBA 3TDNA 5LBIA 1PFVA 2VO1A 4QBHA 4CM9D 2RGNC 5ELXA 3JD3A 3KT8A 4PC2A 4E5SA 1EFRA 5DLGA 2VFRA 3TBKA 2FF7A 4LRAA 4QFBA 3N79A 5U47A 4LPSA 4TQRA 4UCWA 2Q0HA 1YDGA 3TK1A 5TRTA 2W6ZA 5KNDA 2LZ0A 5A6VA 5EOVA 3KG4A 3TW6A 4L2IB 3FHOA 4Z4QA 1X8XA 4AF6A 5KWJA 4RMJA 3AVVA 1IKVA 1OYOA 5HM8A 3S6EA 4EI7A 4J9VA 4HRYA 3ZI4A 3HZOA 3D66A 3KJHA 4LF4F 4B1FA 5FUYA 3KVNA 1Z9BA 2JLYA 2JEFA 3OP4A 5ITZB 4HWKA 3S0JA 4MFBA 3HM2A 3ROXA 4A2CA 4RW9A 4BKPA 3JPWA 3BN3A 2BACA 2BGGA 4TL8A 5K20B 3HU1A 3PUWA 3Q8UA 4Q3CA 1QV7A 3D6JA 1QRRA 4BVFA 3Q7QA 2B98A 1NYTA 2UUBB 4IQFA 2QGFA 2PGDA 2QXTA 2OI2A 3UYLA 1OLOA 3AHIA 4KZKA 2FSSA 3RUCA 3ZE2B 3F6YA 5FBQB 4XM2A 1NF9A 5FLXY 1M2OB 4IRXA 3DMGA 4IKPA 3TL6A 3UAVA 3EFEA 4DLAA 4PC1A 1E3MA 4EI9A 3ZPXA 3Q8LA 3LT0A 2PRIA 1KSPA 4MRPA 4RMHA 4KQMA 5KTNA 5KKCA 1QH0A 1S1XB 1TFUA 3UHPA 4MW7A 4F4JA 3NGRA 4V1CA 1E2GA 5B1EA 2OLKA 2NXUA 4B09A 4RF5A 1WZCA 1WMDA 4AQYB 4WK0B 5AJXA 2L42A 3TJ9A 2PFDA 2FDRA 2QTRA 2F8MA 1G6OA 5KOWA 3M4ZA 4YP6A 2C2ZA 1ZA2B 5TPZA 3IUPA 4WU2A 1KETA 1YVRA 3CEAA 1S48A 2ZD1A 3AM5A 1N33F 3FWZA 1KR2A 4O2AB 2AMFA 4N48A 1ZPDA 3MGAA 4TZ6A 5IQQA 1KF0A 2EJWA 4TTPA 2E5IA 1HD1A 4JLJA 4JI4J 2JFDA 1F9HA 4ZOCA 2E7WA 2QUJA 1Z39A 3OHAA 2BQRA 4DV1J 3P9XA 3MR5A 3EULA 4ZVSA 3R5GA 4GUAA 1F6WA 1NBEA 1M75A 4YAWA 5EP3A 3PHHA 4HKTA 4TV9B 4JZYA 4GGOA 2NXJA 3JZDA 4A8PA 2C1XA 5EKUA 4YMIA 2YWGA 1NI5A 1UAWA 3FKSD 4JC4A 3V1NA 3NHBA 1QOPB 3SHFA 3K6JA 3IQZA 1QDEA 3T5MA 4FPRA 3TOVA 4B32A 2FPOA 1P44A 4PQGA 4RNMA 4R05A 5JHHB 2HXSA 4CTAB 3FWPA 4ZLNA 2L48A 5H16A 2BMDA 4DABA 3EAGA 3SJBA 2SICE 2CJ9A 3RK1A 1R88A 3TGWA 2QSWA 3TWOA 3PC2A 2BDTA 4MYUA 3R7DA 2E5HA 3TI0A 5KT2A 3EFBA 4M37A 3ICCA 1JN0A 4PR0A 4GKBA 1RJWA 2XZDB 2W6IA 2WT4A 2AJ8A 3UIEA 4YMTA 2Y99A 2GD0A 3NIBA 3HXLA 1TJ5A 5EPOA 4QM6A 5L3QB 2C2MB 2IITA 2DXIA 4YRMA 2YIDA 2O1PA 1VIVA 3ZZPA 5EWMB 2HYIB 4LUBA 3WLNA 5CJJA 3BC1A 3UAGA 2VP6A 1MFZA 5EXEA 2XOEA 5G4KB 3OAAD 1OXTA 3JQ7A 4U9UA 2FR1A 4Z53A 4JKIA 4XK8C 2OQVA 3T1HB 2EZTA 2NQPA 5E6RB 5IDYA 1NDHA 1NFFA 1EIYB 1L5UA 5BVHA 1DAKA 5LOVA 1TTQB 1PTJA 2YY5A 3HT3A 2J41A 4DXHA 1U5AA 2E48A 1RI2A 1REQB 1DV2A 1QVRA 2GJ8A 2JLBA 1JFVA 3WYGA 4ZCQA 5DYIA 2EP7A 1LZKA 1KVTA 4YV0A 3AKYA 4FQ8A 4MDHA 5FUQA 3L1VA 4KWEA 1VHTA 5CVUA 3NGKA 2IOYA 4KXVA 3RSZA 4IDAA 5K0BA 4ZOLB 1DHRA 3L9XA 1MROB 1SA0B 1EWTA 4UHCA 1BOOA 3EXFB 3JYHA 1ZP6A 3GXBA 5CYOA 1J0DA 5DMXA 1C0LA 1YNSA 4ITUA 4QYSA 3I5MA 5AI4A 5EMJA 3ZU5A 3W3ZB 3RF7A 2VL1A 1UAAA 2XVXA 4M86A 3B1WA 2GSDA 3IAUA 4Z7CA 2F8EX 2P2LA 1OBFO 3H9JA 3V5RA 1CJSA 1QORA 1T4GA 3N07A 2RK4A 4P86A 2BFPA 1T2FA 3NTVA 3NRJA 2WILA 1Y5LA 1GT8A 3OLQA 2R7MA 3GMIA 1K9SA 1Q16A 1ZU4A 4XD2A 1NGSA 1L5NA 2RG7A 3CLSC 4DT1B 1MKYA 1NJ2A 5I4MA 1DELA 3QK7A 3QJJA 5F3DA 3BPSA 3UCUP 1FUEA 1QX3A 1IDN1 4WGFA 4BVJA 3FDIA 4KR9A 1WLYA 1UCNA 2ICAA 1UDRA 2SXLA 5C7IO 1ECGA 1XN4A 3SEQA 3GZJA 4FQ7A 2ZJ4A 4Q4JA 3ZZOA 2MMYA 3WB9A 1IQPA 2BGIA 4W5RA 1VQYA 4DBLC 1QVZA 1FU7A 5T8KA 4DV0J 4Z7NB 1O95C 4XWWA 2BRLA 3H9GA 2FGJA 4QICA 1BA2A 4DJAA 4TYQA 4EJSC 4LF9F 2O2IA 2VDUE 2CE2X 2F9MA 4QYMA 1QVWA 4LECA 2QSZA 1ILEA 3HABA 1V7CA 1S2OA 5HZHA 4HDAA 4CH7A 3DDIA 3U4DA 4OBBA 3FI0A 4DI6A 4CO1A 1XTJA 2VPXA 1FNDA 4AY3A 3EXG1 4PNPA 3GLGE 2ZYGA 1JHPA 1V96A 2YW9A 5IM0A 1NK5A 1IUKA 4RHCA 4G01B 4RIGA 3REQB 1L8AA 5DSTA 2WZCA 3GDFA 1ULZA 2M32A 5AKXA 2FGCA 2REOA 4OX9J 2RGBA 3ROEA 3A4NA 2PH5A 2N3ZA 2V6FA 4XDZA 1VBZA 4MHTA 2I55A 3NGUA 4RU9A 3G82A 5I9SA 3QUQA 3TZXA 2VAMA 1U1CA 2CDAA 1DLJA 1ZA1B 1L7QA 4KAAA 2GFHA 4UBNA 1FY2A 2QL5A 3F3SA 3WSVA 1W59A 1T1EA 1RUSA 5F8MA 3C39A 4PO9A 2WWRA 2DNOA 5A1JA 3KJVA 3NWEA 3U6KA 2GPNA 2XMZA 4N8EA 5D84A 3LY8A 3OLZA 4CYMA 4N3CA 4I68A 2MY7A 1PKEA 5KKNB 4PCAA 1JNRB 2YMQA 5KKAA 2RRNA 5IJZA 3LS2A 1U9YA 3MMJA 2IYNA 2AKEA 2W2OA 1TGVA 5LD2C 3E7WA 3IVAA 5ETQA 4B4UA 3AVOA 5CVDA 2R6R1 4ESVA 1C3JA 5D4LA 3BXEA 3IIMA 5T5QA 2P68A 3KYDB 2JAXA 2ASEA 4A5SA 1HIYA 1W5AA 4ZHQB 1P75A 5HIMA 1M2GA 2XADA 2R8EA 4PV7A 3FC9A 4DR1J 3J7AN 2P4SA 2WSEC 1W1UA 2KYXA 1LRKA 4QUKA 1US8A 3K1YA 1IUOA 1JZTA 2QD1A 5D8HB 2IXGA 2FB9A 6Q21A 3LBFA 1RSCA 2C2HA 4C0JA 3F6SA 4YHHF 1G8PA 3HUFA 5L3VA 3MCTA 4XCXA 2EBHX 1A9ZA 3D0OA 5M2PA 2W0SA 1X1AA 3DR3A 1PCAA 3SX0A 3P9ZA 3TIIA 4RTPA 5A6PA 3GMSA 3L4BC 3VR5D 3TX8A 1N77A 1G42A 3UA4A 1HOTA 2YBEA 2FWBA 3T8YA 2H1FA 5D3MB 1N1MA 4DV7B 2G9RA 1Y6ZA 1JLKA 1OMOA 1CC8A 1MU2A 5DGXA 5IDQA 3GT0A 4CTOA 2RHMA 1KYYA 1GNRA 5HRCA 5B0GA 3RJ5A 1L5HB 1S4QA 3U3OA 1LWCB 1E8NA 1ZVMA 3JSBA 2C1ZA 4ZVKA 4INPA 5HATA 5C24B 3HWWA 4BBYA 3NNAA 2JIOA 1DCFA 1WZIA 3QVLA 3ZXUB 1UOEA 4Z0NA 1IWOA 1YQUA 5JDIA 1PDOA 1CB0A 3P71T 5L9XA 1QIEA 2PEHA 4V39A 4K05A 1VDZA 6FDRA 4JP1A 7REQB 2YV3A 1X70A 4QXQA 4JMPA 4F36A 1YC5A 4BFSA 1VL6A 5CM9C 2D5BA 1KHTA 3T61A 2I0FA 4LE2A 4MJ7A 1LKZA 4D5GA 3C6BA 2YIVX 4HVZA 3CTMA 3VNUA 1U98A 4ZZ3A 4AWAA 1SGWA 1WHTA 1CEXA 4CF6A 2FUEA 1QO0D 3G3EA 2A0KA 1IPFA 3IDZA 1IHYA 3C98A 1RBOB 3B2EA 1KP3A 3ELHA 1N5YA 3U1VA 1H2YA 3VO9A 1L4NA 3EIWA 4YCAA 5JMOA 5JH7B 1QYCA 3AKEA 2V5AA 4DR2J 3IC5A 3HB4X 3G1TA 1LPAB 1DI0A 1C3LA 4F8JA 4L72B 2EDCA 1TIBA 2E21A 2ZKLA 3Q1LA 1GG5A 1U1QA 3MLAA 3TJAA 1MNQA 3FHCB 3GZNA 3K0BA 3T7TA 4J9UE 4YB7A 1RLDA 4QYWA 3WLOA 4I4TB 1FX4A 3JQ8A 5CA0A 3HJVA 1YDMA 4Q66C 3K5MA 1F3VA 4ZEMA 2IOQA 1LXCA 1LSOA 4GRAA 4M54A 3SIXA 3Q2KA 5KOYA 4OATA 3ETOA 2M8DB 3ZLJA 1J99A 2DBRA 4QYXA 5G0UA 4RORA 4ZT2A 2XMRA 3H8SA 2DD8S 2JAWA 3USES 1YJNS 3OFGA 2VTVA 5IX8A 1YZHA 2EKDA 3C7TA 3HP1A 1I1QB 4OP3A 1FP1D 3PFNA 5E41A 1GU1A 5ADZA 4ENRA 2MKJA 4WZZA 1WOOA 5KU1A 3HTXA 2LBPA 1L7PA 4D4HA 5EJ4A 4GZ5A 4UU1A 1HE4A 1V26A 2Z8ZA 2MT9A 2IGBA 3CF6R 1Q6YA 3ZYZA 3V4LA 1BD6A 2GYVA 2OFFA 1DPFA 3SF8B 1NFQA 1ADJA 5G4DA 5K6AA 4OMCA 1F0XA 1N36J 2P2GA 3PYGA 3QJGA 2LQ5A 2FQ1A 2H0AA 1RT2B 2XNCA 2J9CA 4JI4B 4U3JB 1PWEA 1AIPA 4N5DA 4DV1B 4GICA 4I19A 2CLKB 1W9HA 4BTEA 3IR5B 1Y10A 4DJBA 3EXG2 3T5DA 3DPSA 3R4CA 4RJTA 3SE7A 1A5TA 1GIAA 5IQ6A 3OKFA 3RUFA 4LRCA 4DXLA 3BB4A 3CXCR 1W8IA 4MDYA 1UMDB 1ZGJA 5IF9A 4HRXA 3G23A 3A6EA 3VDMA 5FULA 3LQKA 1YXMA 4CLWA 2GN9A 3KWMA 3R9XA 4UZCA 1RWVB 1QYIA 4URXR 2Q7DA 3LCCA 3OLYA 4X7MA 4KO0B 4A0HA 5T64A 1TW2A 3JQAD 4PYNA 4U4AA 3WKEA 1GTHA 3FOEC 4ZCPA 4KH0B 1EZZB 2Q5QA 1V4BA 4MQLA 3VYWA 3C43A 4XIJA 4AKSA 1O57A 4JL5A 3KSDO 2AQKA 3N8KA 1E3LA 3O83A 2P9ZA 1DGQA 1A8IA 1FPMA 4F3TA 4B47A 2IQIA 3N2GA 1Z0SA 4N0QA 3PCXA 4PFJA 5HDQA 1GPBA 4X61A 4AKTA 4B4VA 3LLVA 3R5AA 4PHTA 2MJLA 3H18A 2QVCA 2ZIZA 1YDWA 1CUJA 5EIWA 3RRHA 1USGA 2HHPA 3M82A 3O3CA 3ULHA 2HQGA 1A88A 4NPOA 1D2MA 1U8UA 2W6PA 4DWIA 4MRAA 4H4KA 3OTIA 3IM8A 2P2CA 1MGOA 2GAIA 2A1TS 4OJNA 1XEXA 4DKXA 4S05A 4E3ZA 1U6JA 4YUZA 1GNKA 4YLYA 3JQ9A 2LQJA 2QN6A 2JAOA 2C4NA 4FF3A 2RAVA 1DXYA 4BQFA 2B4VA 1UM8A 2B4AA 3IOCA 3I76A 1U4SA 2OEJA 4HDMB 4MHOA 2R8KA 3R5BA 5IZCA 1KAQA 1NBMD 1VSUA 5HZKA 2BQ3A 3RD5A 4GC9A 2E9RX 2OWDA 5FWNA 4XFDA 3H5YA 3SC3A 4BASA 4LGYA 4CF3A 3JAKB 3PWTA 2YNMA 5DBGA 2PGOA 1E2JA 4JLAA 3GQBB 1IKYA 1V9LA 1I7PA 1NPTO 1J90A 4OLOA 4PUOB 2EZ8A 5C18A 3DDKA 2G1AA 4Q1EA 3VUEA 1QO7A 3IB6A 3ECSA 1WXEA 1NDLA 5IBCA 4MQEA 2HBRA 3KLIB 1QGOA 3MN1A 3A6KA 4X2BA 2PUBA 2GXAA 1TQ2A 2H5JB 4NI5A 4FW8A 4DPOA 1ZN7A 2MSDB 3ZE0B 4D9NA 4AO6A 1CUCA 1WUTA 1BG6A 5MN6A 2R44A 3TO8A 2ZBFA 3ZOZA 1DG1G 2Q6LA 2AQ4A 4L5BA 1PT9A 5JZMA 4WXHA 3HDGA 4POAA 3X1WA 2OWEA 4D8TA 3KK3B 4F3MA 1E7QA 1NRIA 4TM8A 4X4VA 1VBNA 4V24A 1SC1B 5D3ZA 2VJBA 1UVJA 3B1YA 3TRKA 3C3JA 1AKEA 1QTNB 2X9LA 1WP9A 3ETMA 3NB0A 1LJLA 1ZH6A 1R4ZA 3L4JA 1WC3A 1W0CA 4BU1A 2VONA 3C3DA 1V1JA 2FFHA 2BUBA 2AMCB 3QG1A 3PXGa 5JS7A 2LCWA 5BN3B 5FDLA 1C1BA 4KDRA 1WC5A 4M9ZA 1R4AA 2ZIVB 1FFCA 1UEUA 4RH1A 1VISA 4IV5A 3WLFA 4FYWA 4MKZA 2FLVA 1OHHA 4KPCA 2ZTHA 4ZT6A 4DV0B 3AEUB 3AVUA 5JD5A 3C70A 1MB3A 3TQQA 2P90A 1SEVA 4O4JF 3JZIA 3KOUA 4IS3A 1Q7CA 1T4DA 2JDID 5FRDA 3PEEA 2XUPA 1C9EA 3TCNA 1SIZA 1ZSYA 4IJKA 4E12A 3NBXX 1VLYA 3O84A 2R65A 4LRFA 4MUXA 1OIWA 3QGGA 3KR9A 1OJ7A 2QTTA 2GS8A 2XKAA 4KH1B 5CBPA 4MYSA 3DO5A 4Z4GA 3MS2A 3GQCA 3GP3A 2A84A 3OFEA 4PZ0A 1QIIA 4N1AA 4U8GA 2HFNA 4FNAA 1DX6A 4Q37A 1N5MA 3ICWA 1MDBA 1YFLA 3MUMP 2VDLB 3CCUS 4OX9B 4BNDB 4QFCA 2NO6A 3AY0A 5DNWA 1HQYE 3COZA 3ABSB 2A0YA 2ZROA 3EF1A 4ZI7F 3C1AA 1U0JA 1M1GA 1XD8A 1LD3A 3WWZA 5AFSA 4NFHA 1SG0A 1XQIA 4Y9TA 1DSSG 2CBGA 5C2CA 2HIMA 1N2CB 1GCUA 3HB0A 1FIUA 2QG9A 4GPAA 3OZXA 4MO2A 3JASB 4WJLA 5ETRA 2G4CA 1P9WA 5EGNA 3RUDA 3RVOA 1YWGO 4E5NA 2I4IA 2VUIB 3SSAA 3WKDA 1WCXA 2JOQA 1MDFA 6REQA 3PEVA 3H1FA 2VT6A 2XT6A 2CMDA 2DR3A 4CMHA 4GXRA 2RHBA 3CNNA 5JFTA 1KYWA 2YKNA 3L06A 4EG7A 5HEKA 4N82A 5IDWA 1EB0A 2AH5A 4JI5J 1UL3A 1SZCA 2MLZA 4DR1B 3V2UA 2IZ1A 4DA4A 4QYIB 4NCGA 2UUWA 4CEJB 1MOZA 1ZMRA 4HQLA 3HKBA 4TUYF 1E3SA 4TMKA 2VKTA 4B9AA 2CQGA 4W9MC 1FT8A 1NPKA 1DO0A 2QV0A 2JBAA 3QYPA 1Y4DE 2ZBRA 3KKPA 3Q98A 2PH7A 3AERA 3L6EA 4MPJA 2JGFA 3DL7A 2ZT7A 1B43A 1EUQA 4BBPA 3EUFA 5K0TA 2A1IA 1GPDG 1EDOA 2Q50A 8ABPA 2PUCA 1A4XA 1OI3A 4YT4A 4A16A 4TKTA 2JKZA 3VKVA 3D8UA 5CK5A 4MKVA 3SHOA 5CCEA 1BEEA 2O1SA 2I3BA 1D1SA 5LQMA 4JGBA 3KJNA 5HDBB 3K09A 4QOSA 5F12A 4MO9A 1WBDA 1U1KA 3K0FA 1J21A 4GBMA 2RBEA 4QGBA 4AJEA 1NDQA 3KKZA 3DNMA 3TRDA 3TR6A 1YRAA 4NV1A 1PLJA 3M0EA 1YRUA 2IYAA 3RNOA 4QOIA 1X1CA 2W7AA 2HRRA 2QU7A 2DHGA 3FW1A 4B3GA 4A5OA 3PXAA 4XUGB 3ZK8A 4YTEA 1F2DA 2QE7D 1SHKA 1BQNA 1KP6A 1U7OA 4M0UA 4F2PA 4Y3CA 1NK8A 3SEFA 3NHKA 4R6WA 3L8GA 1ZZEA 4FFSA 1OFUX 3BSOA 2CN1A 1UZDA 1GGVA 5KNCA 5AK3A 1GNQA 3G68A 4DG9A 3TG8A 4YB8A 3HVIA 4OP2A 5JE8A 4B84A 4I5FA 3QI7A 4X62F 5LZ9A 4QUBA 3RANA 1Z5VA 1UVMA 4DR2B 4WZQA 1G2OA 2OPRA 3WRXC 3AXKA 1NSFA 4PKDB 2OSBA 2WVDA 4H35A 4LRWA 4L15A 3PE4A 3MWLA 4ZEVA 3DMJB 4FWIB 3LVBA 4KR0A 3B1VA 1N5KA 5J2TF 2J0UB 2BJ9A 4JI1B 3MM6A 2SNIE 2C9BA 5I4KA 4B3FX 4ABTA 3SDBA 3CMES 2NTNA 3O82A 2Q8NA 2AG0A 4RIFA 1JHRA 4LF5F 2YX4A 2ZZNA 1J33A 5SYAA 5F51A 2VRNA 4XSVA 4TY9A 2IPXA 2ORYA 4B3OA 1G4UR 2WIGA 1DS6A 1E8MA 4AP9A 3SU8A 1ESEA 2OGTA 3I5BA 4Q4AA 2I6XA 4OHRA 3C14B 1PNOA 1ODLA 4FYHA 4IHJB 3WLTA 1XMQJ 1EK0A 3HB9A 5C80A 1F17A 1DWUA 1ISPA 4LC1A 1XK6A 4RUHA 1APBA 2PKEA 3C6KA 2RVJA 1RBQA 3BH6B 3BA6A 4P4SB 2EW8A 3RF6A 3ROGA 2V8HA 2ZU0C 4ND1A 2GEUA 1BVYF 3ETLA 3WRYA 1GGMA 1N36B 1YG0A 4EFAC 4B3TF 3AGQA 1HNWF 4FMCB 5GAGU 2C8LA 1F2GA 4LYHA 4OJQA 4U6SA 3KQHA 1JMTA 1BH2A 4AJ2A 1VSTA 3EVMA 3DBVO 3HCWA 1GXTA 4DSLA 1GL3A 4DANA 1GNPA 5J1NA 2HF2A 4RR5A 4CFSA 5EZQA 2JLZA 2RB4A 1KJQA 4AJJA 1A2KC 2Y4OA 4DL7A 2R87A 3U1TA 4UUAA 1YIAA 5EP4A 3OTOF 3S2YA 2H48A 3JQEA 2HMIA 3SM9A 1P9YA 2QLJB 3K1JA 1SC9A 2PG3A 4B79A 5EHNA 1LLFA 3BE8A 3C24A 1SV5B 3HKEB 2BR4A 3WL6A 4JP2A 4H7DA 4Z7OB 4ZLPA 4ES2A 2PBFA 4HYKA 1ULSA 2FR8C 3UGJA 5H5JA 3WIBA 3UDLA 5K14B 4CM0A 1SL1A 4I6AA 3QTBA 3NDJA 3OC6A 5MHTA 4N3GA 2IF0A 4J9MA 1H0RA 4RTJA 3EDQB 4NY1A 4A8QA 1CJCA 1AB6A 1DBWA 3AI7A 4JI0B 2GOYA 4UTVA 2VDWA 1BE1A 5KX5F 1R0WA 4R5HA 4CM6A 4HI0E 2ZIFA 3C7AA 2OYRA 3ANMA 1J2YA 3SI8A 4LRYA 2AXNA 1Z0UA 1RI4A 2GQQA 2FUG1 1FX1A 2PWZA 3ETDA 3QU5A 4CIAA 1P2FA 4L5AA 2E4YA 3IE1A 2QAGC 1QH1B 3M6WA 2Z04A 3MCUA 5AH0A 2I87A 3RYLA 4K2JA 4QIGA 4I8DA 2BCEA 4D25A 5M2QA 4BX2A 5GADU 3M70A 1MJFA 4KPYA 3IC1A 3Q2TC 2E4ZA 1XAIA 2E87A 3IQHX 4IQXA 2F4VJ 2XG8A 5IM5A 1VYUA 3ZC3A 1R0LA 5F0UA 2R4FA 1BDIA 2FVRA 1BKYA 3MF5A 3FBFA 2CY0A 4G0WA 2F4FA 2CNDA 4NRUA 4R0JA 1DC8A 3Q3CA 4DWVA 2M5YA 4LV6A 2I9KA 1MHTA 5HKBA 3GPAA 1XR6A 4LDAA 4H2DA 4CQNA 5EE0A 3TQFA 1RKJA 1NE2A 4QPDA 3ZXIA 4E15A 3LX4A 4NJEB 1C2PA 3E9CA 4Y2CA 3GARA 4I9HA 4Q34A 1UADA 1UBGA 2PQ0A 1N34B 1N32B 5DM1A 5KQLA 2OV6A 4HC4A 3DLBA 5EESA 4HGOA 3SSRA 5BMVA 4TRNA 3KS9A 3A9RA 3OCCA 2YMMA 2C2GA 1SN7A 4IUFA 3PFGA 2GN8A 1VE9A 4HKQA 3OPYI 1W7AA 2ZZTA 3V1YA 2VTBA 1UVLA 1TT5A 1Y8QA 3P9YA 3N59A 3AUFA 2NG1A 5E95A 4KE6A 4YY3F 2JGEA 1VA5A 1HKUA 4DNPA 2YNFB 3ZZMA 2HN9A 2B37A 1RQNA 1Z0DA 4B9VA 2BKEA 2XYGB 1GKIA 2VJAA 4L4YA 4FSHA 1FDOA 5JAQA 2LP4Y 1H0HB 2YWKA 1OKKA 1IM6A 2W25A 4Z9FA 1OAAA 2OPQB 2KHDA 2FPIB 4I9FA 4EJ6A 2XSZD 5AM0A 2BCJQ 1KY5A 1CJTA 1F3LA 4KFSA 5KYYA 2B92A 4YDRA 1ULUA 2HRDA 1OY1A 3RUAA 3EGVA 5CVJA 1VJ5A 3PRVA 3NHYA 5TGTA 4LCBA 1FD2A 1Z2CA 1E5LA 4BJ6A 3SC2B 4TLRA 4R8SA 3L8MA 3BOSA 3SX4A 1RXYA 3UAOA 1TMKA 1OBOA 4CFYA 3KDOA 3WIVA 1YTUA 1T7PA 1UW4A 4YBRA 2OB1A 1VLZA 2B8TA 2G0IA 4MR9A 3P9IA 2WFLB 3K0AA 2YNGA 2GK3A 2PMHA 5HROB 1SHTX 1EUDA 1JEJA 4BEBA 1EZ1A 5I8PA 1GUZA 4Q5VA 1M1YE 5K0LA 1CS0A 1G3RA 5H59A 3T3DA 1RTDA 1WZ2A 1NW8A 1T05A 4HH0A 4BFCA 4X92A 4MJKA 5IV4A 5JRDS 3D3JA 4TVKA 2DBYA 3U9LA 3EGXA 1KHHA 1NTOA 4KUGA 2QMZA 4J0CA 4O4HA 3FOFC 4RZHA 3L7NA 4FJ1A 1HUQA 2C7PA 2C4WA 4ND3A 1C7IA 3IRWP 5B64A 4K4ZA 3DMNA 4MQ4A 1V4VA 5CB6A 4WFJA 1ISSA 5G0VA 1OY6A 1J97A 5C0OE 2LQ9A 4D4IA 2TSYB 3L0CA 3G6KA 3O8OB 3N3BC 2KM8C 1NV8A 1HZZC 1EA5A 3AW8A 3CW2C 1MCZA 3QU9A 1QRTA 3K70B 2HBYA 3IPYA 2HWXA 4PTYA 2AGPA 4HXYA 3HK2A 3GEGA 3GMDA 4H7IA 2UV8G 4JNKA 1K6EA 1PKUA 5CLQA 3G8QA 4FKYA 4FE3A 2YFYA 3FTNA 1YIDA 3GLIE 4DX8H 3JWPA 4EKNB 1RAFA 2OCGA 3RS0A 4DG1B 4GW3A 4G8BA 2HK3A 1BQXA 2I5JA 4CMCA 4WH0A 1UC4B 1C9NA 3CC2S 1GUBA 4CQMB 2I38A 4JI5B 4ZCIA 1DBIA 2R6CA 4E30A 2RS2A 3NAQA 4RKQA 4C7XA 2RI1A 1P7YA 3EC2A 2W4DA 1SUFA 2B7BA 5HZGA 1S77D 2NO4A 3TA0A 5IXSA 3CPSA 3RSFA 4Z86A 2R00A 2Y67A 4HLDA 3QXGA 3MSXA 4BQQA 1WE2A 4MAMA 3LQRA 2VYND 5HMLA 1YTLA 2CHVA 2MHEA 3OL7A 4OHBA 1CBUA 4ZVOB 3TZYA 5A04A 2J3KA 3LOPA 3EYWA 4MRVA 3FDSA 3PW4A 4LJ6A 2WRMA 2RK6A 1U2RA 1N3YA 3DP7A 2CWXA 4MW4A 3AFMA 4G1MB 2XT0A 3D4JA 2A0WA 4PYQA 4ZRMA 1DXOA 5D2CA 3AFHA 2W7PA 2QZ8A 3L7PA 3UOGA 2WM2A 4NRDA 2KXFA 5T4HA 3WZLA 4Z8XA 1N6HA 2F1HA 5DP2A 1HQUA 2ZHOA 4LBIA 1DAMA 4EBBA 3FCCA 1G98A 2XUIA 1MMFB 3P9RA 3N2NA 4DNXA 4Q7EA 2CXSA 3G4SS 1NXWA 5I4IA 2BJ3A 1ZUD1 3FIJA 4WCFC 4URGA 2WJVA 1TYEB 2XZOA 3L49A 1Q3KA 2B5JA 2PUGA 4HAXA 4Z7QB 4GYYA 3OFJA 2OORC 1CD5A 4ZJPA 1RD4A 4CIWA 2VD3A 1HHTP 2NM0A 2RJZA 3IAS9 3RWMB 2FQQA 4NI2B 3OZGA 5F7OA 2L9WA 2YHSA 1S1WA 4M95A 5A1TA 3ACBA 5ALFA 3DR5A 4YK7A 3KYJB 4TKUA 2JBWA 2FNAA 4ZVUB 3FCXA 1Y1PA 2PO7A 3CV3A 3FF4A 3FK4A 2BKUA 3NBPB 1RTIB 4D3ZA 3S8YA 1A9SA 1EVJA 3HBJA 1A9XA 3O4HA 2ALZA 4QJVA 4LRXA 3QIVA 1D8YA 2YHUA 4DRZA 2FLLA 5FFMA 3O8NA 1DIHA 2L69A 2FQWA 3KR2A 3TFWA 5THQA 4ED0A 1VQNS 3QPBA 3ET5A 2V7UA 5CDGA 1L3UA 3EWIA 3KPYA 4UFPA 4M98A 2M52A 4PXDA 4A92A 1P17A 3B7GA 2WONB 4HDGA 3JTOA 2RQKA 4ZYLA 2JH3A 1S57A 4YDHB 5JCJA 1BC5A 4PLWA 4D9CA 2XE6A 3CMAS 2XY6A 2HW3A 3M7IA 4HSEA 1WIWA 5H1SV 4RXTA 4ANDA 2CW5A 3VBEA 1QGAA 3U2QA 4ZYXA 4FM9A 2VYCA 4FW9A 2BKVA 1H98A 3MXHP 1KQFB 1WX1A 3DB1A 5JCOA 5GMEA 1GUAA 1R8SA 5L46A 2NXEA 3C1OA 2UVVA 3W3AD 1E2KA 4GQAA 4QWAA 2HHXA 1XMQB 2WM9B 5EJIA 3LGXA 4Q05A 3DDCA 1VRQC 4DCUA 2Q4TA 4G4SP 3I0RA 5KAKA 2G82A 2OECA 2X9NA 3ER6A 3UMGA 1SUSA 2MZSA 3ZS8A 1HM5A 1XZNA 2XBLA 4YRQA 4IV0A 5THKA 3CSUA 1PZNA 2W2XA 3D8RA 4KGVB 3RBVA 3QT7A 4WTYA 3HMJG 3B13B 1UUFA 4YYEA 1BDHA 4R5MA 5B1IA 4Q7QA 1SJ9A 1L7VC 4LDNA 5CH8A 2JFQA 5E3JA 1C8KA 1AMNA 1I7QB 3WA6A 5CIQA 1PFQA 1GPUA 2C7VA 1M1KT 3LP0B 4BE4A 4E03A 2VJKA 5A5FA 2AMLA 1VOTA 2VHTA 4UU8A 3ZV4A 4FYDA 5F9LA 2GZ2A 4RF3A 1MJHA 3BHJA 1CUFA 4JI2J 2OV4A 5GONB 5C7OO 1UZAA 3ACCA 4HP8A 6ABPA 4C4SA 3R1IA 2PJUA 1I7NA 3MGJA 5LOQA 3LPCA 2ROEA 1LWFB 3DGPB 2NQ2C 5AI0A 2BE2A 3QLHA 1E2HA 4EO9A 4BKQA 1VRWA 1SH2A 2V55B 2BMEA 3I4LA 2P2NA 4YEDA 3D7RA 1GQQA 1PG2A 3IPRA 2ZH3A 5I9IA 1OPRA 4G9GA 1KO7A 1BCSB 3LHFA 4C21A 1M1YA 2QIPA 1ML3A 5IANA 1SR8A 2IDZA 4BQOA 4G26A 1R4NB 1XLTA 3TVYA 2ET6A 5DMHA 3AF5A 1OC2A 2KT2A 3D1JA 3GCWP 3ELWA 3MCOA 3GHYA 5KFKA 5HMWA 2JLSA 3HMQA 3HN7A 4LNUB 4USVA 1T3ZA 4C8OA 3Q0IA 4ASUD 3B5JA 4M8KA 2F90A 1X8JA 2GIFA 3DBHB 1SKUA 3AVYA 4NNOA 1RRKA 4D9EA 1P4AA 4PRZA 5CAEA 1IZYA 3Q8WA 4PYAA 4A8SA 3DOLA 1OFHA 5KPJA 2IYOA 1RAHB 2F4VB 1GDHA 2XJ4A 1FW6A 2QVBA 3R44A 5DM70 1B15A 3S2FA 2Q8PA 1R4MB 1O8BA 2YZGA 4EDHA 1FRZA 2OAQ1 2G5PA 2ZUGA 4HJXA 1SXPA 5KTYA 4IHAA 2DR5A 2PZAA 4BNJA 4L5IA 4K0KJ 3K8YA 5JATA 3DI6A 2YY7A 3NS6A 1RJJA 1VCNA 2YS7A 5D7BA 5KFGA 1U2DC 3LYUA 4ES6A 1IUNA 3HN2A 3B38A 3O8WA 3VO8A 2I03A 1BQEA 1WMBA 3WYCA 1P74A 2QSFA 2C2EA 2PO5A 4PS1A 1Z6XA 3W2FA 4P4NA 3W2WA 4GM4A 4EX6A 3B3GA 4Q47A 1F8UA 2ASDA 2PA3A 1E6LA 3EWGA 4IWNA 2CD7A 3EEIA 3FYSA 4J2HA 3GLQA 1T9WA 1YA6A 4F4FA 4ETNA 3ILVA 3HCOA 1NXXA 2HGSA 2ZIEA 1J70A 4MRMA 3QQCD 4HAWA 3MVEA 1BYIA 2WG1A 2AZ1A 5C3UA 5H0IA 4NC9A 4IIFA 2WSBA 1MN9A 4ZV7A 1WG1A 1AHHA 3PR5B 4D9JA 3JPYA 2C1EA 5KFRA 2MQQA 2V68A 3IMCA 2O2XA 1MRZA 1KJIA 1QY7A 2XWSA 3KJQB 1ACJA 4DGQA 2EYUA 1TF5A 2G9ZA 3DFMA 5CM2Z 1UKBA 1O4WA 1QG2A 3B20A 3R3VA 3EA5A 3KTAA 5EZYA 5EIBD 1H2RS 4F5YA 3EX7C 1NXTA 3RHZA 2BLNA 3QRWA 2CUZA 2XTMA 5GM2A 1RQGA 1DQZA 3Q9LA 1ZK1A 1IR2A 4EUSA 2WQZA 3A4IA 2IY5B 4BB5A 5BV8A 5K09A 2MZRA 1N78A 2QYSA 2E29A 3BD7A 2DEUA 3H98A 1J5PA 3L3CA 3NHAA 1HYQA 3MTIA 4I4BA 1H8HD 1V5WA 1Z5GA 5DM0A 1M3SA 4L8VA 4FLFA 1P3JA 4CM3A 1SXJA 1XPUA 5DM2A 1FSSA 2MQOA 2Z5LA 5FL7D 1X92A 2XZLA 3RKSA 2ZBDA 5FADA 3TLAA 1GZVA 5ALHA 2FVCA 4LCEA 4XRRA 2QMQA 1AFIA 2ANBA 5KSWB 1LTKA 1KFKB 2RKBA 2UU9J 4N9QA 4CLTA 2CDNA 4QVIA 3R5FA 2OMLA 4W5TA 1A9PA 1WWKA 4X3OA 5JQGF 3JATB 4JJ7A 3VPFA 2WUDA 4Q1VA 2C7QA 5B36A 1BA3A 3RRXA 5I7UA 2V3VA 4U5XA 2TMDA 3W2EA 2QTFA 4KHMA 2QPTA 4MLZA 2E2WA 5LDGA 1NLFA 2MGZA 4RETA 3T35A 2C2OA 4PYMA 3D6MA 1YVPA 3WAJA 3TANA 4TMVA 3MI7X 1JXLA 4Y9UA 1W2GA 2PLAA 1C9YA 4UULA 2XOKD 1KONA 1P9QC 2FVSA 4X90A 3ENAA 4KRYA 1CP2A 3GOHA 1GTG1 1GK8A 2I71A 3OEED 2J7KA 3QKRA 4I6EA 1A4RA 3GLIB 4IOLA 3DAYA 3JYOA 2DK2A 4DMCA 2QMWA 3CEDA 4MIBA 2BEWA 5TQJA 3FSIA 2C03A 2RAQA 2V58A 4DR4F 3EHDA 4PEVA 1S10A 4XPIB 3FBBA 4CM1A 2CPYA 1ZS6A 2BZSA 3JALA 3EPIA 3FRJA 1OWOA 2VUGA 2C8VA 1JEQA 2EVWX 1QUFA 4WZBA 1S3SA 4M8IA 1OB2A 3ANTA 2FZCA 1LBHA 5CDYA 2PT9A 3EOBI 4L4XA 4PAAA 4XUCA 3FCAA 4CTJA 5FWYB 3QSGA 4X1IA 1KK0A 2QLWA 4Y0NA 4QIEA 2JS7A 3GGJA 4PZEA 1NXVA 2EW2A 1DRZA 1IPEA 2CHGA 2JIZA 2WR8A 2IC3B 4ZXPA 1VLOA 4EBDA 5A03A 5HHTA 4ES1A 1EG2A 1U8TA 1OX5A 1Z5WA 5B6IA 4MFBB 3H3FA 3WL4A 1JA0A 4RW9B 4LSNA 1XGKA 1LBQA 3NKLA 1X1DA 3NLLA 3O8LA 1RT9A 2AUMA 5CD9A 4QUEA 1FDTA 2IXEA 2GBCA 5KT3A 5D4PA 1E6WA 2VIIA 4MPRA 1L4MA 1U7UA 3DN9A 2BOAA 2BGNA 3WDLA 2QGFB 3K0SA 3LV8A 1HDXA 3VPDA 1KI9A 2DZDA 3JYTA 1XMOJ 1KNXA 4BNFA 4OEHA 2VAPA 4NR0A 3L8DA 2ERXA 4Q03A 4R8UA 2HDOA 2VTKA 1H05A 4MZDA 1ZY2A 3HLTA 3WGIA 5EEHA 3ZGVA 1JXEA 2IBKA 4HTAA 2ZJPQ 4PZZA 2PQMA 3MMNA 2PV7A 4IRKA 1RHJB 2KG1A 1CDOA 2AXPA 3E70C 2QRJA 2L19A 5DYTA 2Z4RA 5KTQA 3BDIA 1JIUA 3DXBA 4JEUA 5CFZA 5FPQA 5K8UA 1YQHA 4V1CB 5DASA 5C32A 1BWEA 2IZ0A 4WKBA 3E8XA 2WABA 1HI9A 1O87A 4O33A 4FZ3A 1P45A 2C2ZB 3CX4A 3IVMA 3VI3B 3KYCA 4KPUA 3SG0A 1OY8A 5B4TA 3ESZA 2CLOB 5ETKA 2MTLA 1I3CA 2OTJS 2ZD1B 4IQ8A 1KYTA 2GD6A 1QWSA 4D3YA 3BKFA 3UWPA 1M6NA 1WW8A 3P9KA 3UO0A 4TMFA 5F8HA 4Q9KA 1RQRA 3Q11A 4M3NA 4GDMA 4NHOA 3GR0A 3J7AC 1L3VA 3NXSA 3RBZA 1MQAA 2BHNA 5F21A 3EM1A 2V0NA 4HO1X 1VECA 4KCGA 3PXBA 4QQNA 3LBAA 3O93A 4QPCA 3SICE 1SRQA 3ZNJ1 4G3IA 4ZVSB 1YS4A 4MK4A 3CJ3A 1NBEB 2GESA 2HA3A 1Q84A 2CFIA 2MR5A 1K5PA 4WX2B 3SLKA 3PV8A 2X3FA 3TCKA 4PG5A 2VZ0A 1HE3A 3MUVP 1E1CA 3W78A 2A7QA 4PSAA 2DT8A 2Y3IA 1COZA 5C5CA 1WBJB 1P2GA 1UC8A 5H81A 2Q8QA 4RVHA 2WNHA 4ZARA 1TM5E 1O6CA 4L9RA 3I58A 4QBGB 2B78A 3EZ9A 1WMEA 2NZ2A 3ILOA 4CG0A 4H6WA 2DFDA 3GH1A 1JI0A 2CFXA 2H5IB 2CLHB 4QRIA 2MYPA 2Y0SD 3ASVA 4KGZA 4M9RA 3I4CA 1T6ZA 2XHWA 2BGRA 4NWIA 3CUVA 4JGGA 3AL2A 5B30A 4USMA 4M5DA 5KJ6A 3WNBA 2CDQA 3ZY4A 1TKZA 5HX7A 3M1VB 1XNJA 2NPIA 1ZESA 4M38A 4BB9A 1NSYA 5JIBA 3R8YA 4NEYA 2EFHB 1EINA 3HX9A 2C57A 3QAEA 1A8SA 3REFA 3HVJA 1PGJA 1FP4A 1ECPA 4J1NA 4BKRA 3SYTA 5EINA 5KFAA 5IV3A 1FE8A 1LCIA 3ITEA 4WASA