2EBGA

Crystal structure of a hypothetical protein from thermus thermophilus
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
106
structure length
106
Chain Sequence
MQAVRLFQGYLWHPRALALDLKALLPGEVAGARLLWDEVPPPTPFFEDGTPTHTQRFYQLTLLVLTEEPPEALKPLAEEAAEALGEVLEGLPPEVGWLLLEDLRPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a hypothetical protein from thermus thermophilus
rcsb
source organism Thermus thermophilus
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein TTHA0061
total genus 19
structure length 106
sequence length 106
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11482 DUF3208 Protein of unknown function (DUF3208)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2290 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ebgA00
2EBEA 2EBGA 2EI5A
chains in the Genus database with same CATH superfamily
1I1GA 1L3TA 1GQEA 1XMBA 4YEAA 1PJ5A 2I5JB 2IDEA 3IRXA 2UZAA 3DLKB 4CM0A 2KI2A 1XERA 4O3QA 1GTHA 1TMJA 2FD2A 3Q2TC 1Q16B 2MQPA 5CYMA 1EETA 1LWCB 3IGVA 3MM6B 5AJ3F 5E2QA 4M5MA 5CA5A 5LMUJ 3TI0A 2H51B 1NNDA 3NGDA 2Z8QA 5IQQA 4K4VA 1H72C 2VPWB 4DLEA 4XAKA 4OI0A 2QSWA 1KN6A 1IKVA 4RW6A 2HQIA 3HZGA 3AJ2A 3VAGA 1M5VC 3S01A 2ZITA 3PRDA 4LRDA 2POKA 4PWWA 1MWQA 2J6TA 1HNZJ 3AJ1A 4ED5A 3MCSA 3OR2B 4QJVA 1LW0A 1OMSA 2DGSA 1WHXA 2MDAA 2IPOB 4ID5A 1KD1T 5ETLA 4JV0A 1NSAA 3CCZA 1WNEA 1WC0A 2FY1A 5AE3A 4DOZA 2LFVA 4FZVA 4NYPA 4DQPA 3ITHA 3P3DA 2F7VA 4I0WA 3R97A 2OEMA 4DUYF 1SIWB 4QPXA 4U6PA 2MEWA 4QU6A 4LF7F 4OFZA 1KDNA 1SH2A 4ZHRB 2LA6A 4IFVA 5AXLA 4RU2A 1SKUB 3A8JA 1T3OA 5F8JA 1T9VA 1F0XA 1OPIA 1R27B 3MUMP 1S9EA 2Q1LA 1KS2A 1IKXA 2XB2D 3BSAA 4WCEQ 3JSYA 3A1YG 1T03B 4OHVA 4DV6J 1FXRA 3RB6A 4MIBA 1F3FA 1X4DA 2C3YA 3DCAA 3K8VA 4I2PB 2HHHJ 2E1PA 3TJAA 2B5JA 2HBQB 4CLKA 1Q5YA 4DSEA 4LQ3A 3IM8A 1FFSB 1HQUB 5KOXA 2KT3A 4YY3J 2XS5A 3B78A 3NCQA 3HFVA 1MG7A 2AX1A 2DGUA 3TQ1A 2PMWA 3DHXA 1IBKJ 1SJQA 2N4DA 3BEGB 2AZ1A 1L5UA 4X4QA 2N7CA 2E29A 2RF2B 1PCAA 4I56A 2W24A 2VG5B 2MKKA 3CUNA 4B3MJ 3R2DJ 2HIYA 1DY3A 3HHNB 2L48A 1TTHB 2GS8A 3DLEB 5U47A 1CLFA 4CM2A 4CYUA 3FMWA 2B51A 5B0EA 4F04B 2CNNB 3THTA 4DMZA 2LVWA 5ETRA 2BRKA 1VIOA 2V8HA 2CQHA 1PBUA 2FZGB 2MZQA 4CNZA 2D3OR 4J9KA 1VBXA 1VC0A 4OI6A 4KHPJ 2UVWA 3POTB 2MZRA 4Z7YA 4F67A 1CVJA 3JSMA 4GC7A 3G82A 1WDTA 1FEEA 1HNVA 2HGMA 4NLDA 3QT5A 4C8MA 1FFGB 2F8MA 2XSJA 3RB3A 5H9EK 4WU2A 2IRUA 3LGHA 5DJBA 1L3UA 1QAIA 3M2UA 1FDAA 1HI8A 2BJ8A 2KXHA 1ZA2B 5C2CA 1W25A 2C2NA 2W2OP 2OD4A 5F8IA 4QWEA 5JVGQ 4DN9A 3PO4A 5IV4A 3GJSB 5C5JA 3GR0A 2BR0A 1ZOTA 4DFJA 1ZM2A 4F2SA 5HAOA 1EX8A 2J5AA 2D9PA 2W9AA 2XY6A 4XO0A 1VLOA 1ZS6A 4DR4J 1OSCA 1S9GB 2WB4A 3K2YA 3G86A 1YITS 2HQGA 2QMXA 2ADCA 5E33A 3TRGA 1KNZA 3GLJA 1RB0A 2RUSA 2O66A 5CZVA 5HMZA 5DM6Q 5CYQA 2B4UA 4DPTA 4TY8B 2IVYA 2V63A 3D28A 1OQ6A 1H2UX 4EMDA 2XWXA 2MLXA 3G4SS 2YTCA 4C0OC 3BO4A 3D5MA 2HKEA 3HSGA 5DS7A 4MIWA 4USIA 4DPUA 2VPZB 3KJVB 1QE1A 3CE8A 1WC4A 2JWNA 4L3KA 3J81Y 2HQ3A 1UWBB 3R5CA 1A6LA 3NGKA 3PG9A 4PG4A 4IFVB 4FBTA 5JJBA 3ISND 2VIHA 3M8PA 2ZH2A 4B9VA 3CDBA 4NXNF 1FE0A 2H5EA 1RT2B 2WSFC 5CQGA 2AW0A 2OI2A 4ZCIA 1SC4B 4QIEA 2KXFA 1RU2A 2KG1A 2UUWA 2EFVA 4EWTA 4YUDA 2MQMA 6AT1B 4QU7A 1C2PA 1RT1A 2JOQA 2YKAA 3M8ZA 4KO0B 1GXLA 3TA0A 2RU3A 3MR6A 1TK5A 1FRHA 4RW4B 4L76A 3NLCA 3MDFA 3W9JA 3HO1A 4HDGA 4KR0B 5GMEA 1SJ3P 3HK2A 2RQ4A 1VRQC 3IGNA 1LK7A 1PGZA 2ZWPA 4KGKA 5KTQA 2RDJA 2D3UA 3VGUA 3KK1B 1TL1B 2RD5C 1LWCA 2W7AA 5FD1A 2OPQA 4O0IA 4Y65A 2AEMA 2DXFA 4ED0A 2DR7A 2DH8A 2BJ7A 5ETVA 3IRXB 3SXLA 3V2UC 3HLUA 2HMIB 5KFHA 3H42A 1CBKA 3R7SB 2IY5B 1HR0J 1SQFA 3BS9A 4ZN1A 2KFYA 1VBYA 4B17A 1FF2A 2V2KA 3QPIA 3FVYA 2P6TA 2B43A 2ZH8A 1NKBA 1M1HA 2HBRB 3KJQB 4BC7A 1TK8A 1WKLA 2HG4A 4M63A 2LQ9A 4LFAJ 1NO8A 4OX9F 1TKXB 3T6JA 1HNIA 1XBWA 3OVSA 3ZTSA 4BC9A 3I9ZA 4NLXA 1JLQA 4U96A 3KLHB 5EWFA 3G6ES 1URNA 4UOHA 2CPYA 1JIHA 3X1LB 3M8QB 5HLFA 2YVSA 2ATLA 4ETXA 3HVTB 3ELHA 2AGPA 3NRBA 2LQ8A 3E2EA 4W98A 3CCRS 3RB0A 1TL3A 4DG1A 2PFFB 2CWXA 2CPXA 2ZBQA 1F5AA 3D68A 3NBPA 4NI2A 4M5JA 4XDCA 1ZTTA 1Y11A 1R8AA 2MSTA 4NA2A 1JMTA 3TARA 1S76D 2Y8WA 1YG0A 2ZBRA 3VTIA 2GFFA 2K1RB 4O4GA 4DR7J 4F4AA 1U6FA 2ZD1B 5D78A 3GILA 2OIHA 3W9HA 2M0GB 4M95A 2KVIA 4HL9A 2PI4A 2QMUB 1FHTA 2JEFA 1O51A 3BGRB 1FFWB 3CULA 3ILOA 2GAHC 3WC0A 2CQPA 4ZOSA 2MZJA 4XTTA 1NHUA 2WVCA 4YR0A 1NDKA 3M1VB 3KHLA 1AFIA 4MYUA 3RAXA 3AOBA 1GMUA 1KFDA 2CKWA 4KH1B 4DCPB 4PWDB 3QT7A 5LXYA 4I2QB 2Z0GA 2XLIA 3LF0A 3L3CA 1SCJB 3KUEA 2V4QA 3I96A 5LMUF 4PG5A 3JTPA 2A2CA 2RF2A 1UZHA 4KHMA 4LR8A 4UOGA 6FD1A 3WX4A 4LBPA 2LA4A 4RUAA 3MAHA 1IM6A 3MR2A 4EYIB 1NXIA 1UFKA 1OYDA 3OTBA 3V4IB 1N33F 2GV1A 4H4KC 1VC6A 2DH7A 2J0WA 5KFJA 2J0QD 4ERDA 5LOQA 1VS3A 3P6YC 2R7UA 2P9CA 3DLHA 2XGQA 3ICLA 5T41A 2CQ3A 3T1HJ 3SV3A 1JLAB 2H3EB 4LIWA 2W4DA 4Y2KA 3TZYA 3BDEA 3MPUB 4LSZB 2VKRA 1NK5A 4HACB 1UEUA 5AE2A 3E51A 4ZVEA 2VJUA 4MTPA 4QIVA 3QZ7A 1VYAA 2XMWA 3I0RB 4ELTA 5F8LA 3GB0A 2ACMA 3W61A 1JX4A 3F44A 5GMDA 3W2VB 1VQ7S 2BKNA 3J7YI 2V4RA 2EFNA 1S79A 3NS6A 1WKKA 3NOCA 5D4OA 3W66A 3OVAA 2XC9A 3G8TA 1N5TA 1B0PA 3VGSA 2ZH5A 2VBYA 1VI7A 3HHEA 1CJUA 2AIRB 4WE1A 3JAMU 1I94F 3C3LA 1TKZA 2HS4A 3SCJE 3BGRA 1HWKA 2DPIA 3UDEA 3SI8A 3CD5A 2R2RA 1S1XB 1NZAA 5C24A 3PW7A 1SC6A 3FBFA 3THPA 1FJ7A 2VG6A 3DFEA 3O3LA 4UF4A 2XO6A 2DEJA 4NYOA 3RB4A 2C3MA 2RB7A 2BJ1A 3P5TL 1RWUA 2OLWA 4O3NA 3MFIA 3PX4A 2PMHA 5LL6d 2HHVA 5FLXY 4FP9A 3NBPB 2QN6B 4LBIA 5FIIA 2UUBF 2HNYA 2B8QA 2YWEA 4C97A 1T9YA 2FLNA 1GH8A 4U95A 1NDPA 1JK9B 2E1MC 2HFUA 3L7PA 4PABA 3F41A 3J80Y 2PGCA 4GMKA 1GFWB 1DQ8A 3NNAA 2LXIA 2F63A 1S48A 3NAIA 2XMUA 3R6LB 4RKUC 5D3GB 1JLQB 1U1LA 1RTIB 2W4PA 5IWAJ 1Q8BA 4QR1A 3K5LA 2CDQA 3A8EA 5KFPA 4LF9J 1LNQA 4X4SA 1Q7YT 1DTQB 2R3VA 3U1NA 1XC9A 1FNMA 1PILA 1RT7B 3CCQS 1NAQA 2MQ8A 2QJ3A 1YRTA 3OXFA 4Q2MA 3WX8A 1VJQA 4EUVA 2BA9A 3PX6A 1V5VA 2MB0B 4ILLA 1U1NA 3PW4A 2GJFA 2DO0A 2M88A 3CC2S 1JWWA 3CJSA 2E1CA 4C4WA 1ZPWX 2JSXA 4ZPVR 2BE9B 4KGXB 2K06A 4M1KA 1SXLA 2CZ4A 1PYSB 2Z57B 4ZVOB 3GIIA 5E7OB 3VVTA 4J37A 1S1TB 1O8BA 1T9XA 3P4UB 2QFIA 3CJ0A 4DL4A 1C1BB 3QWPA 4TLQA 1U1OA 1VK3A 1WC6A 1HBOA 3OR2A 1VBKA 5DDOC 3L7UA 2WCXA 2QFJA 3QT6A 4I68A 1YTYA 4KV8A 4K4TA 3JQJA 1TL7A 2PI5A 4MK9A 2C28A 3GR1A 2BOPA 1TFWA 5IZHA 4Q45A 1URRA 3MD3A 3HF5A 3VZIA 4PUOB 2EWHA 3LP1A 1TKTA 2HNDB 3UD4P 4Q44A 2V8PA 1HARA 1Y5NB 4CLFA 4QZVB 4NLQA 4CRJA 2XLKA 4ED6A 1C0TB 1RHMB 1KFSA 3M2VB 4DPWA 2DCUB 4DR2F 4UZBA 4UOCA 3MEEA 5HL7Q 3V81A 1XEZA 2NPIA 1V5IB 1UW4A 3AQOA 2ALZA 1SPBP 2V9WA 2H54B 2ZH1A 4DR1J 2BW7A 4UT4A 1MROB 4AUKA 3DRPA 2IVFB 4IO9Q 4GKKF 3CDAA 3BR8A 3UN3A 2CWKA 4WFBQ 1U26A 4DEZA 5C7PA 2E5IA 1U8WA 2FC9A 1ITPA 2BM0A 2J9EA 2WK4A 3T41A 4GVLA 3VZHA 2DGVA 5JVHQ 3CJ3A 2Y1RI 2CFXA 2IBOA 4Z2XA 3KUHA 3PJWA 4K4XA 2IVMA 3I0SA 4M5KA 2JLEA 5CYQB 3HKZD 3V6HA 3PW2A 3BN4A 2Y1JA 4DL2A 1BXNA 2IJNA 3DDKA 3G2XA 2YWHA 5J2MB 4ES3A 1QDUB 3IO1A 1DJ0A 4NASA 2DIUA 2F9DA 1PG5B 2CZVC 2HAIA 1AA1B 4B3SF 2G2OA 1B0TA 2DBBA 3AJDA 5GADU 3PW0A 1QJHA 2ZFHA 2VKZG 1CQNA 1M5SA 3CF5Q 4IH7A 1SJFA 4N41A 2RE1A 2F4FA 5KG7A 5SZTA 5KFIA 3Q89A 1FRLA 5H9EJ 4O0NA 4YB5A 4CO0A 5I4MA 2RRNA 1SL0A 1VQ6S 1UVKA 3KFWX 4N5SA 5ETPA 4B3TF 4LF8F 3J7AN 2QRRA 5L8RC 2LYVA 3KMQA 1DQ9A 1GMWD 2VDIA 2J7KA 3TUJC 3BH6B 4RW7A 4IG0B 1WEXA 2N3LA 3CJQA 3JSMB 1SL1A 4JI1F 1WDDA 2RVJA 4RUHA 1KLNA 3MEDB 4ZDNA 4ZJLA 1XMQF 1FVSA 4F3OA 2XG8A 1H0HB 1U2RA 3GIRA 1LW2B 4X4RA 1VLYA 3CJRA 4NLYA 3UNYA 5LMNF 4ZPAA 2GJIA 2I9SA 3K5OA 5A8RB 1OWXA 1SC1B 3C19A 1RWWB 3IS9B 1U0HB 2ROEA 1PKUA 2CNKB 4JI8F 4A8OA 4KT0C 4DL6A 1GX6A 3TP2A 1TP7A 4OYXA 2HLUA 2WW4A 4WK1A 3JYTA 4HTJA 2PEHA 3O6QA 5IM0B 2RHSB 4M5DA 2KT2A 3LWLA 1JLBB 2AP6A 4OI2A 3CCJS 2MQNA 5L1IA 5KFNA 3U1LA 1S4EA 1Z2LA 1SVDA 1IKYB 1S1WA 1LWEB 1HQUA 2A0FB 5KT5A 3LO3A 4NZ6A 1X0FA 1S6UA 2M5YA 2YNHB 3MPVA 2HHWA 2RRBA 2W9BB 3H59A 5ETNA 2FYXA 5IQ6A 3DXBA 1S6QB 1ZM4A 2MKSA 2HS3A 3MMAB 4DJBA 4PG7A 4Y34A 1SV5A 3LP2B 1FEHA 3DKDA 4UOFA 1HMVA 3OL8A 2CQ1A 4G1IA 2MQLA 1S9EB 2QL5B 3HSZA 4IFYA 1T7PA 1Z1ZA 3US5A 4C8NA 3MUTP 1HFEL 1APSA 3L4BC 1B7YB 2VBXA 3JXOA 4NYZA 1C0TA 4AT1B 2GVDA 1NJYA 3DRRA 5M2RA 5B0FA 4ECUA 2MZTA 1X9SA 4Z7CA 1N88A 4F4WA 4X65F 5D0GA 5EWGA 4DV3F 3E8OA 2WVFA 4K59A 1YIJS 1VQ9S 1YQHA 2XYHB 4YHHJ 1QSYA 1NPPA 4FVCA 3C16A 3TANA 2F4VJ 3AAWB 1S7HA 3EE3A 3AXKA 2B7CB 2YX4A 3NS5A 4LREA 3MD1A 3VGVA 4C2MA 4YP3A 4F02A 4GVBA 1E6VA 2EG2A 3C15A 3KLIB 2UV8G 4WF9Q 1C1BA 2D9OA 1NPKA 1Q1KA 1QUVA 2EXUA 3AB2B 3D0IE 3EGVA 2XZWA 4S0MA 3V4MA 4PKDB 2VA3A 2UXBJ 4JUZA 5C25B 3I6PA 2RS2A 2M4MA 2AYEA 4RR5A 3MCNA 2K7KA 3TOQA 4LF5J 2L3MA 1YGYA 1IBKF 1AB8A 4E2FB 3ZO7A 1RA6A 2JLGA 3MR3A 2W7PA 3LWMA 1EQ0A 3PR4A 1DURA 4K4WA 2GHPA 4DSKA 4LRBA 2GIRA 1P1TA 3LOUA 2OEJA 1UCNA 3JYTB 2CQCA 1HW8A 2B0GA 2FY8A 4U8VA 3OTOF 4J9SA 1YX2A 1HBUB 4P73A 1S12A 2DNQA 1VBZA 3FK4A 3VQTA 3D1QA 3R5DA 3SMZA 2NQPA 1NK4A 1DZ5A 2ZOGA 4DV6F 1W2IA 3UWTA 3CIZA 1RTIA 4ZVRB 4I1TA 1K1QA 1KOOA 3HX9A 3VAKA 2UUCJ 1EHWA 2DHHA 3AQPA 1OSDA 4ZVQB 2ZJQQ 4NA1A 5AT1B 1VQ5S 2ZUGA 3CJ8A 3ETMA 3QMQA 3MHYA 5LJ5Y 2C3UA 1RBOB 2V94A 2DH9A 4IG0A 1UPPA 4ETZA 1WORA 1U09A 5L9NA 2EBEA 3DLBA 1HNXF 1UVNA 4L74A 1Q8LA 1DQAA 1VQPS 2XTJP 1JLEB 4BCAA 3HZEA 3CJ5A 2CPZA 2ZM6F 2U1AA 2E9RX 4EO8A 3BO2A 2G2ZA 3AY0A 3CO9A 3VAMA 2LMIA 3BGLA 4WWSA 3RZAA 2ZM6J 1ACMB 1LK5A 1RI7A 3OLAA 2Y3YA 5CHCB 2GIQA 2AJ0A 4WFAQ 3KDOA 2BACA 3MMBB 2IDLA 4L73A 2DXDA 1CJUB 2LDYA 1RT5B 2YNGA 2L9NA 4HHUA 4LSNB 1X5SA 4KAIA 4NPOA 1BC6A 1NM2A 1WC5A 2EFGA 1NK8A 3WQPA 3C6TB 3BSOA 2IC3B 1RU1A 2MY8A 2V2ZA 4OZNA 4I69A 4ZP9A 4WFNQ 1LKZA 1MWZA 4NOHA 4B3RF 1UEKA 3DOLB 2GCFA 2DVIA 1EZZB 1B4SA 1KRPA 1OY8A 2MKHA 4U7UK 2WBRA 3ENQA 1KOHA 2YNHA 1WC3A 2J0XA 3I5BA 4X4TA 2HWTA 3PY8A 1WUUA 4K0KJ 5GAGI 3FCWA 1GNKA 4BBYA 5F8MA 5B0DA 3AD8C 3NOGA 2XY7A 2CNLB 1NK7A 5HP1A 1ZTWA 3MM7B 4MH8A 3DMJA 4ECRA 2HRUA 2HZCA 2NLWA 3LTOA 3KDNA 3LAKA 1VIXA 2B3TB 4QYZJ 2ILZA 1UJ6A 3BKUA 4KGZB 4WKYA 2ZDOA 4ECTA 3QGIA 2DR8A 3MECA 3D9BA 1R43A 2P6SA 3M6WA 5BXIA 1N36J 5IC4B 3MPDA 3G6YA 1Q7LB 1CJVA 4ZVGA 3SIPB 5KFSA 4AXIA 1TL7B 5DLGA 2C2MB 2HFSA 4DV2J 1D8ZA 2BZ2A 4RLEA 3BGFA 4LBHA 4RO0A 5BJRA 4EBCA 1YI2S 4K50A 3H20A 3TUIC 2R7TA 4CT8A 4IH5A 3CT9A 2B8PA 4R8UB 2DR5A 1FKOA 4JI4J 2DHAA 2DHXA 3OW2R 2WHOA 4HEA9 5F0WA 3CO0P 2HFVA 3UNGC 4UY8T 4KKOA 5IFMA 3K58A 3AH6A 3N6MA 2ASJA 1RAOA 3P8BB 5IV3A 1NJWA 3RBXA 3H0PA 3MMCA 5IC6B 3ZXWA 3QNWB 5K20B 3MZIA 5EWEA 2JH3A 2DRAA 1FX2A 2X1BA 1IWGA 4AXJA 4P2MA 4A8MP 1LOUA 1RWNB 1YJVA 3SZ2A 3AB4B 4CTAB 1TL3B 4DG1B 1T95A 3GV5B 2PEBA 4IKAA 5K14A 1U1KA 2XCPA 2I8EA 3GIMA 4CO5A 2VQFF 3CCVS 3D1OA 4DHVA 1S6QA 1X9MA 1G3OA 1SJ4P 1HNWF 2IMOA 2K7JA 1BMQB 3LA0A 4ED2A 5KT6A 1IKWA 2EC2A 2J8SA 2DNZA 5THWA 2B4PA 3I0SB 2P8IA 4WTYA 4P71A 2QTWA 5LM7E 2YH1A 2WBMA 3KK3B 2QLXA 5AXMA 3DLLQ 1WWHA 2OPRA 3OBIA 3FSIA 2OUGA 2G0CA 1WI6A 3GJRB 1RKIA 1X0PA 3ILLA 4PXCA 4H4OB 4WYWA 7AT1B 4JOUA 3MFHA 1PC4A 3H40A 2AJQA 1HD1A 2MMYA 1V3SA 4EZ6A 1R6VA 2V68A 4ALZA 5H9FK 2H48B 3C15B 1VHFA 4GVBB 2NXEA 1HBMA 3WZ0A 1UWAA 4PXDA 1H74A 1LWXA 2BM1A 2IM3A 2VPYB 3MEEB 3CCUS 2N7YA 2FJXA 1ZH5A 2F40A 5D4NA 4EYHB 3AXMA 2ZDPA 1RTZA 4NA3A 1R8CA 1TL1A 2AMCB 2BOAA 4OJGA 1A0OB 3H5XA 3LALA 5L9XA 1RAHB 5T14A 3VR1A 4X64J 4RW7B 4PAAA 3T1YF 4ZCLA 5J1NA 4AD6A 5HK4A 5FJ4A 2ASDA 2NXUA 3CD0A 4CLLA 2BEFA 1DTTA 2GGPA 2F5GA 3IRWP 4MMOA 4YB1P 3MF5A 2KO1A 3H5SA 1Y9OA 5E3RA 2UU9F 3G8QA 2OP5A 1XR7A 2HHSA 3MMAA 1HHQA 2R2TA 3DYAB 3TWZA 1KVJA 2MZ1A 4WTOB 4JV1A 4CNYA 3H2VE 2A10A 1HQEA 3EZUA 4TU7A 3KHRA 1SQGA 2AEJA 1VQNS 3VWSA 3TAQA 1K44A 1KP6A 1XWLA 2YKMA 2A6MA 2CQ2A 2B9XA 2UP1A 1U4BA 1JLCA 3EYZA 2P5VA 1BWVA 1QVFR 1R7IA 4OYWA 2DRDA 1YDLA 3CJKA 3IR7B 4M5IA 4E8UA 1G6BA 1FCAA 4Y2AA 2QSFA 4F36A 3THVA 5D8HB 4FKYA 4I2QA 1TFYA 2H5IB 1KQKA 2ZOMA 4PWDA 4USMA 4F4YA 1F6TA 3OTCA 3PYGA 3IN5A 3M6VA 3CWJA 5IOLA 2HSEB 3MGJA 4D3GA 1TVRB 2LECA 5J2NA 4FS1A 2FJAB 2QIFA 3N5BA 3OTEA 2XWYA 3CMQA 3H98A 1S10A 1RWKB 4IRKA 2C2ZB 3UVJB 3SQGB 1XNRF 4DPOA 2QV6A 4ECVA 4IDKB 1L3KA 1X9WA 5GAEU 2BE2A 3QLHB 3DDNA 4LFBJ 4EI2A 3EGNA 2W2NP 3TYTA 2CZ9A 5KAKA 1RWVB 1F3VA 3N79A 2G1HA 3O5TB 4NI2B 1WEZA 4FYWB 4RNFA 3C6UB 3M8YA 4DQSA 2V2VA 2FVQA 5HANA 2RSQA 1ZBTA 2KHDA 3I87A 1S1TA 4GO5X 1GEHA 1N32J 2HQCA 5GAEI 2BANB 2GHVC 4KFBB 2WONB 4QIWD 2B9YA 1Q86T 1KHWA 2VU5A 4KC5A 1U0SA 3P5BP 4C6AA 2FTRA 5HROA 1S1UB 1LFPA 4QYRA 2QE5A 5J1EB 5K8MA 2D41A 3BBCA 3IBFB 4ECSA 2HZVA 1FRMA 1OS5A 3OJSA 5E0OA 3LGNA 3R5AA 3T9NA 4ECYA 2MGZB 3OT9A 1KKHA 2ZHBA 4J9NA 2ZWOA 4DS4A 2DY9A 5FDLB 1U7LA 4DZDA 5EGYA 2HVIA 2FLOA 2LEPA 2ZKUA 3R3TA 4O3SA 1RAJA 1Y10A 2M2BA 3V4IA 3CCMS 3HFKA 4YQWA 2R7RA 1HI1A 2G9OA 3DRSB 2HURA 1NSQA 5KFWA 5CD4A 4XK8C 3DXSX 1ROFA 1XNRJ 3RG6A 3K17A 3LAMA 1T03A 3H90A 1M5PC 4KIAA 2J7WA 3ZC4A 1NSPA 4X62J 2YWFA 3UI3A 4K0KF 1N5QA 3QO9A 3PIOQ 3VCDA 3FUYA 3QRRA 3OHAA 1VQOS 2GO9A 3KNGA 4ZHRA 2NSBA 2XYGB 5B0CA 3C46A 3T9ZA 4J9UE 1S0MA 3PYFA 3I32A 1KHVA 2HVEA 1VJWA 1S97A 3CMAS 2DK2A 2H4WB 2WOMA 3N28A 3R7BB 5KG2A 1NHVA 4CH7A 3HP6A 1CEZA 1QTNB 3EUNA 1SB6A 2DCLA 2KRBA 5DQIA 1FTCA 2DNHA 2O01C 4M5LA 2E1RA 5J1PA 4DUZF 3UN2A 4DI6A 2FB0A 1R8BA 3OJUA 2Y1LB 4IRCA 3QJLA 3Q8VA 3HVAA 3RGIA 1CJTA 1JLGA 2DNLA 3B6BA 4H4OA 3RYLA 3KJVA 1R0BG 5KFDA 2BUNA 4QR2A 3KLFB 3S7RA 1RT7A 4M94A 3OVBA 4NLRA 4AQYF 4TVAB 2HIQA 4OJ1A 2KFZA 4QIFA 4DQQA 3DRSA 3TEGA 1HWLA 3M8SA 5L38A 3FCVA 2Z2LA 2G13A 4JB8B 3W8GA 5CYJA 2XQCA 2XBPA 3H2LA 1QSSA 1HNIB 1X8DA 3A3PB 4B3OA 3ZZ0A 1TKXA 5BR8F 3CGIA 1FKPB 3DM2B 3M32A 3PEHA 3KLFA 3FFIA 2G0JA 4MKBA 5HVGA 1AZSA 4FF2A 1A9NB 2UUCF 4LF5F 1GTEA 2BE7D 2JZ5A 4ED7A 3EJMA 3FRYA 5J2PB 3L09A 1VQSA 1YBUA 2FZCB 4LF6F 2R8GA 4RNNA 2UXCJ 1U02A 2B9WA 2VFUA 3Q83A 3UPFA 2ROPA 4FN5A 5HROB 2X51A 2K3IA 2C3OA 1M5KC 2WZ1A 2IJFA 1MNEA 3OTOJ 3CDEA 4YS2A 1OJ4A 3G82B 3ETOA 4ITSA 4OV6A 1FKOB 5KFKA 3QGHA 3MEDA 2CJKA 2IYIA 5L1LA 4XIUA 1R31A 1BD6A 4M8LA 3W8PA 4ZP8A 4JI0J 2VASA 4N7TA 3HT3A 4OL8A 2EC0A 2X1FA 1VQ8S 1NB2A 4EBDA 4F2RA 2DHSA 2KYXA 4Q0BB 4NZ7A 2UVUA 3HDSA 4U7UD 1N8RT 3MMJA 4CO3A 3VAHA 3LP0A 4DQIA 1IN0A 2BE2B 3AHPA 2LXFA 3QLHA 3DRYA 4XDDA 3UR0A 3Q8SB 3TVYA 4ZPTR 4CI0B 5HQLA 2XO7A 2QA4S 5JXSA 2ALYB 3FQLA 3QIPB 4QIGA 5F9LA 4WZMA 3JAMY 1RAEB 3EWGA 3MM7A 2YQ3A 2M52A 2GJ2A 3NXZA 3D6MB 2QYCA 5ETMA 3AOAA 3VV2B 1U1MA 2Y8YA 1BQNA 2VDHA 2QL9B 3M32B 3TQEA 2HHQA 1H2TZ 2VF3A 4OHWA 3KLGA 3FBCA 3G8SA 4MFBB 4ZVTB 4K7QA 2FHMA 3WBZA 4Q5VA 1UWBA 3PDNA 3J7YU 1LFWA 4K2XA 5LT5A 5FLXU 5J2MA 1S0VA 5CCMA 1FWKA 1QE1B 2IA0A 5E3CA 4NMXA 3MUVP 2V8VA 1DBDA 1YJ9S 1B3TA 4OX6A 5J1EA 4L72B 1FWPA 1RE1B 2BVZA 2M9KA 2A3JA 1WG1A 3K8WA 2HFNA 4TKTA 4ZVPB 5A2QY 3KTQA 1MWYA 3PJXA 1B70B 5I3PA 4RNHA 2JDJA 2P9GA 1IR2A 4N77A 2CVIA 5HN0A 5DG9A 4OZ3A 4KPCA 4HDHA 3CJ4A 3HXMA 3VQSA 4DN0A 4DCJB 4DV3J 4ED3A 1X4AA 4ZJOA 4NXMF 1TQLA 2M3DA 1ZZFA 2JFDA 5KT7A 2ZH9A 5SUHA 4DV7F 1UVIA 4OYIA 4AL5A 3LANA 2R9LA 1IQZA 2ATCB 1RYSA 2E9ZA 1YBAA 3M8WA 1U45A 2NZCA 1I51B 3OV7A 2WOMB 2CAJA 2DY1A 1QUPA 1RTHB 2YH0A 3UCZP 2CYYA 3KK1A 4ED1A 3IA0A 2V2QA 3M2UB 1YRXA 2I0XA 4TY9A 1O5JA 2O5DA 3GYNA 1LWFA 1YWXA 2FVSA 4WIIA 5HO4A 3H4DA 4J9PA 1P9YA 4YHHF 1IKVB 4RW6B 3KK2B 1UP1A 3OFGA 2KRRA 2Y0BB 4FPIA 4DUTA 1IBMJ 2QLFB 1TL5A 2ZHOA 1AUSL 3B4DA 2YPYA 5A6PA 1U6BA 1YSJA 3BREA 1S99A 2ZE2A 1FD8A 3QATA 2CPIA 4C8OA 3HHDA 1HD0A 1NH7A 3CJ2A 4Y0FA 1AROP 4P10A 4WU3A 3ZTPA 1T8EA 1LV5A 3HFZB 1U1PA 2K3KA 3M8PB 1BUXA 1HLWA 3I5CA 2MGZA 1XR6A 1B0VA 4Z37A 2DRBA 2HPUA 1RYRA 4PYAA 2Y0SD 5H9FJ 3I56S 1GMVA 1WSRA 2OPRB 1SJRA 2YKMB 4NX9A 4DXLA 1DTQA 3DRXA 2AD9A 1IBLJ 1D09B 2ZZTA 2HHHF 4BS2A 2VBWA 4AL7A 3PEJA 5HMYA 3R1LA 2MKCA 2WONA 1Y3KA 1FTRA 5HVFA 4U8YA 2VOPA 3R2CJ 8ATCB 4I2PA 3T5HA 3D1HA 5DG7A 1QLNA 3ZZRA 4OJ3A 4ELVA 1K1SA 4NCAA 3IP0A 2VFSA 3OXGA 4DSIA 1WKJA 2I1RA 3FQKA 2Z2MA 4Y6IA 1XMOJ 4X4NA 2JC0A 3FBBA 1VQKS 1YJ7A 4E0DA 3MCMA 3EICA 4N56A 4LRCA 2V8GA 1EQMA 3Q0AA 2KKHA 3BKFA 2HNZA 1T05B 3TUPA 2R7WA 1FXLA 3MMCB 2IBKA 2EFOA 3FC9A 4JI0F 3RRKA 1Y0HA 4QPTA 4UZCA 5MLCV 4KHPF 1VQYA 4IG3B 4TYBA 4CH0S 3ZZZA 1Y7PA 3GTYX 3UVJA 2EFPA 3MM9B 3M9MB 1REVA 1Q8IA 1WTFA 4I6WA 3NP5A 2PT0A 1IVZA 1HBMB 3ENVA 3HSDA 3LUYA 3Q86A 2XMKA 1S5ZA 2JJ4D 5GAGU 3MPYA 4Q43A 2Z58B 2JVOA 2OHDA 4ZJQA 4DL3A 3EVOA 2CPJA 1N34F 1CULB 3HJFA 2ABYA 2RUGA 1Y5LB 3M7VA 5DLFA 1DLOB 2XM3A 4ECWA 4B3SJ 1WJ9A 2ADBA 5IT0A 2JEGA 3CB4A 1FJEB 3IR5B 3MEKA 4USTA 1PO6A 4HHJA 1KTQA 2FUG9 1X4CA 2VQEJ 4M5HA 2BYCA 3GPAA 4DR2J 1KWMA 3KLEA 1WOSA 2O67A 2PA3A 2WVDA 1ZETA 3KLGB 3TX8A 2VFVA 4X2BA 2MLZA 3D6HB 3QYYA 1N5YA 2KTQA 4TN2A 3HD1A 4LF6J 1RTDA 5AE1A 3OXLA 2RMLA 2MPUA 3Q8PB 1FKAF 1D9DA 2XNRA 5BYQA 4Y00A 4EO6A 3RR8A 1PIEA 4WIQA 1F9HA 4G6VB 4QOTA 4HH1A 2HRTA 4GKKJ 3BQ2A 4DR1F 3PHEA 5D15A 3LP0B 4P2FA 4G1PA 1Q53A 1ZAVA 3PJ9A 5HMXA 3CXCR 2IM0A 4R25A 4ANDA 4DUYJ 1U6ZA 2GGPB 4EBEA 1N48A 3KG1A 1UFWA 2DYAA 3ZNJ1 2XMMA 2L41A 1ZM9A 1NUEA 4GKJJ 1R8HA 5DDQC 4A8SA 1Q79A 3POTA 4IOAQ 5BYRA 4LSNA 1C4CA 2E7VA 3ZTRA 3KYLA 2F3JA 5E3AA 4DWIA 3ENAA 3GJQB 1S0NA 4USHA 2CQ0A 1RWMB 4A48A 2C3PA 2WB1D 4JI4F 3NGRA 3KOAA 4QWAA 1OIAA 2CVEA 2CG8A 1GMWA 2AEFA 2FQQB 2KHCA 3PIPQ 2IRYA 1RHRB 1DRZA 4FXDA 4DV2F 3DLEA 3HSJA 4B9SA 1HIYA 4FNHA 1EKRA 1WC1A 2VG5A 2V34A 3SQGA 4WP8A 5KOWA 2WVBA 4RW8A 3CEDA 5CCLA 1T9UA 5AJ3J 4CH1A 1YJNS 2KM8B 3T3FA 1NKEA 3G6VA 4B9MA 3D4JA 5CD4H 4ZP7A 4ZLLA 3SFGA 3P45B 5KFTA 3UR3C 1IR1A 1PC5A 2FHOB 4CQ1A 4DV4F 2QG9B 4CLTA 5CYMB 5GADI 5LJ3Y 5HI7A 4GKJF 2UUBJ 3AOCA 1NMEB 2FC8A 1IKWB 2J6UA 2W01A 2XULA 3LW5C 2W9CA 1H2VZ 3Q22A 4W92B 1UEVA 3K89A 4RBUA 5DDPC 2AJFE 2XMVA 2GQQA 3ET6B 1YBTA 3DOLA 5K14B 1IKXB 5HQMA 2FJVA 2CQGA 1S0OA 2KDOA 3GFZA 2ZBPA 4LRFA 4DX7A 3GONA 4TQSA 1DHMA 1GK8A 1XR5A 2LQJA 4WYLA 5B7WA 3T1HF 1U49A 1FESA 2I2YA 3JSRA 3BBBA 2CQIA 3IG1A 3FRZA 4RW9A 5K8NA 3G71S 4C7QA 2OELA 1TKTB 4DFPA 2QGFB 3NGSA 4A47A 3OSNA 3UW1A 4DV1F 3NKYA 1B7FA 1GXUA 1AW0A 1HQEB 1R3NA 5C42B 2V9KA 4BDPA 4ID5B 3Q8RB 2GMHA 3DLJA 2OSQA 2D3O1 2APOA 3TX0A 1WHVA 4JI3J 1UPMB 5T7LB 5A6WA 1RLCL 5KFOA 5A8KA 3Q8UA 4J90A 2IAJA 4DL7A 4DBQA 2BKOA 4YR2A 3HCXA 3MECB 1UTAA 4IOBA 3CCSS 1VQMS 1I94J 2RH3A 1R6YA 5DQGA 4PQAA 1PSDA 1S72S 3PRVA 4FXVA 5F0UA 3BYPA 1U2FA 1WELA 1RISA 4C8LA 4JI7J 1EETB 3MM6A 4K5SA 3R7NB 1CC8A 2VQEF 2IHR1 5KT2A 3AA9A 1H38A 4YN3B 2FGCA 3UQSA 4PRFA 3CD7A 1OYEA 2CIMA 3BB5A 2Q66A 3PZPA 3NNCA 5FDLA 3MWBA 4A8XA 2IA6A 1X5PA 3PFOA 4ENOA 4RL1A 3KJNB 1I6JA 1IKYA 1S1WB 4OQJA 1NK0A 4LUBA 2KB2A 4IQXA 1PAEX 2K2PA 1U1RA 2BKPA 1D3WA 4M5DB 1KQGB 5D0HA 4DPYA 2R2UA 2XI3A 2HZAA 4C8ZA 2Q43A 3NGTA 5D0EA 1PBAA 3J7Z5 2HQFA 4OYZA 2A2DA 3C6TA 2RU9A 4DR7F 5IT9Y 2NREA 3OL6A 5L39A 3KG4A 1RT5A 2YNGB 3M8RA 2W2MP 4K2JA 3MAQA 3TAMA 1F2HA 4OI1A 3U7JA 4RNMA 1S1XA 2KJVA 3LPEA 3D7SB 5IS2A 3OL9A 4QQBA 4TNOA 1UJ4A 4Y2MA 3T1AA 3RRHA 3DI6B 5DGAA 2DGOA 3CDUA 2FPHX 3HMJG 4PQUA 1WACA 3GFHA 2XGPA 4O4RA 4IDKA 5I3UB 2DGTA 1JQGA 2J8AA 3CVKA 1JXVA 3U1MA 1NJXA 4KKOB 4OJHA 4HKQA 2ZH7A 5KFQA 4CLUA 3IWNC 2CADA 3GSDA 3PR5B 1RCXB 4MYTA 1QTMA 1HBNA 2OJ3A 1TVRA 2O1PA 1TELA 2HFZA 4EU0A 1H3DA 2WSEC 4YDXA 4PQUB 1IBMF 1EP4A 3BSCA 1RQ0A 4HHHA 5F8HA 4QWDA 4NXNJ 1KVIA 4TU8A 3GZ7A 2OPPB 2MKIA 3MTJA 1FRJA 2BXJA 5DM7Q 1NRKA 2DO4A 3TAMB 4LR7A 1QAJA 3E3XA 1HWJA 2Q6BA 2RQKA 2MHEA 4X64F 3GIJA 1TMMA 1YZ6A 1F1BB 4USJC 1ULRA 2IJRA 3SV4A 2QLWA 1SKRA 1XN9A 2AX0A 3VHQA 2PO4A 2OPSA 1JXLA 4TYAA 3FCHA 3RUBL 1U0HA 2GMJA 5B0AA 4OIXA 3J80U 4C3MA 1KEKA 3TW0A 4OYOA 4AFFA 4DV7J 3H4BA 4KRWA 2L9WA 3DGVA 1P1LA 4J91A 2VONA 3ULHA 4F50A 2DB1A 2HVHA 3W1YC 5A76A 5C25A 2F65A 1YJWS 1EIYB 2R7VA 2BJ9A 3NCPA 3IM9A 4MK8A 3W7BA 3D0GE 1VC5A 2F1FA 2PSZA 3DYAA 3M9OB 3SFUA 1T94A 3OSPA 2V4JB 2X7IA 4PPZA 1HHTP 3W65A 5KFVA 1OPZA 1RBAA 2HS0A 1W26A 1CQMA 2IC3A 4RBVA 3MM9A 2YQ1A 5DETA 3C16B 4ED8A 5KG4A 3SCLE 5KFXA 4IG3A 3CW2C 2VBZA 5KFFA 5C2GA 3F73A 4O4GB 3OFEA 4ED4A 2HNDA 2LEAA 3GIKA 5K5MA 1OY9A 2OSRA 2GVDB 4RBTA 2GNKA 3L95X 1TUWA 5IT9U 2FIUA 4TLRA 4K8RA 2FDNA 2F8EX 2RNEA 1HQ2A 4ZKAA 1UA0A 2OO4A 1N4LA 1K0TA 1N36F 3R9LA 3I31A 3SSQA 1ZPVA 1RACB 1HMVB 3D0HE 2E5GA 4IRDA 1BGXT 3C2PA 4C11B 1L3SA 3PYEA 4Y3CA 2Z2YB 1C0UA 1YKWA 1WG5A 1T0TV 2GA7A 2W9BA 3RBDA 4HI2A 4B3MF 4OI4A 1VRUB 1NK6A 5DG8A 2QA2A 3RU0A 4R5PA 1OO0B 3DOKB 3I5AA 4KQZA 4LSLB 4PYDA 2Y1IA 3CJTA 3D6TB 5CH7B 1U1QA 2J7UA 3JTOA 4LFCJ 1NU4A 1IBCB 3VALA 1AXQA 4JP8A 4FYXB 4A8FA 2YNIB 1IXKA 1Z2ZA 3GFXA 4YY3F 1N6QB 4X4VA 1QM9A 1B99A 2KH9A 1N5SA 3IMQJ 3TZWA 4XPEA 4ZVUB 3J81U 4C0HA 3EZ5A 2M8DB 4NXMJ 3KXDA 1PJ7A 3CCTA 2HGNA 3BBFA 4L6V3 5B0GA 2LXUA 4B02A 2R8IA 4DSLA 3Q23A 2M7SA 2RAQA 1R89A 4RWXA 4WP3A 3R8YA 3TVKA 1HBUA 1VDHA 4P74A 5I3QA 1J5OB 1Q78A 3PTWA 3E01B 5LXRA 3AA8A 4CP5A 1P6TA 2JC1A 4ZVHA 2YNIA 2MQQA 1WD6A 1N33J 2FHJD 5KG5A 4R0EA 3RW7A 4JBCA 5A2QU 3TVZA 3Q2SC 2BDPA 3ONQA 2HQDA 5BR8J 4WXOA 2D69A 3IBCB 5DZ7A 2A1BA 2HNYB 4OHZA 4BLGA 2VOOA 1K0VA 4IQMA 3KK2A 3GYXB 4OI3A 2LQ5A 1FDBA 1LWFB 1V3RA 2MHNA 3FMBA 4W4MA 5A8KB 4R8UA 3D2WA 2J6SA 3H2UB 2DGQA 1H7WA 3NG8A 1TK0A 2BRLA 1KQFB 2UXDF 3A3OB 3FEZA 2ZNZA 4I4BA 2UXCF 2XZDB 3SSRA 1RTHA 1CSJA 1MMDA 2GX8A 4NMLA 2GQCA 1SQEA 2BMBA 2G0IA 4ILRA 4N47A 4N8NA 4URGA 2YY3A 2YWKA 4ZPCA 4LRAA 4PR6A 4ICLA 3C8YA 1WSVA 4X66J 3IWXA 4GO7X 4RW9B 3X3UA 5DDRC 1BQMA 3F0NA 4J5OA 4DUZJ 1LXNA 3IG1B 3H5UA 1N0VC 1RHUB 3DRRB 4CDIA 3CPWR 1RDRA 4X66F 4KE5A 4CCHA 1QSLA 5F8NA 4A4JA 3OD2A 3TUZC 3J7ZT 1Y3JA 2AYBA 1S1VA 3LPYA 5F3ZA 3T5LA 4FBUA 1H7XA 2GIFA 3CCWA 1V9OA 1UZDA 5HP1B 1XNQF 3QAEA 3WC2A 2EKYA 1HYSB 3KNAA 4AQYJ 3ILIA 3RAMA 1XNQJ 3WDOA 4HACA 2HBYB 2LU1A 2MJUA 1MW7A 4KGVB 2WAQD 1R0AB 1K73T 1N0UA 4CLWA 4OZJA 4LQ9A 2R4FA 2NR0A 3UD3P 1G4CA 2HK2A 4R0JA 1RHJB 2KT5A 3PHTA 1TL4A 4CLSA 4ECXA 1N5YB 3UN5A 3V6JA 5ETSA 3HHLB 5DO2A 4C98A 4DR5J 2BQRA 1JLFB 1RT6A 3BYRA 4P7VA 1Y5IB 3LH2S 1XK8A 1U8SA 3BPSP 4I7FA 2ZH6A 1JXEA 3NGUA 1X4FA 2OPSB 3L9ZA 4O44B 4IH6A 2BBEA 2VFRA 2ZNYA 3K5PA 4ZPDA 3ZNUA 4EZ9A 3Q8YA 2VG7B 2YKNA 4F0KA 2CQ4A 2UXBF 1HPZA 2EEYA 4H4KA 2LCWA 1HNZF 1FX4A 2FVCA 1CC7A 1TR0A 5KFAA 4XPCA 3RR7A 3MOJB 2CRLA 2JNJA 3LP1B 1LW2A 4Q0BA 3BR9A 4UY85 4G3IA 1Q5VA 2GMLA 1HNVB 2Q3PA 4GC6A 4OX7A 1TKZB 2ZJPQ 2DNKA 2CNOB 2KL8A 1R0CB 3EVMA 4WE1B 2C2KB 1YLXA 2NZ4A 5HJYA 4X65J 1D1UA 3J81j 2XYPB 3IFEA 2PIIA 1FNOA 5L46A 1B64A 3FBEA 3TR5A 1RT3B 4CYUB 2V8DA 4L75A 2ZD1A 1HKAA 4EK2A 2EG1A 2K1RA 4OX8A 3PW5A 4ZMMA 5DQHA 4KJIA 1F2GA 4DR6F 1DARA 1P9QC 3NEKA 4M5NA 9ATCB 1NJIT 4AL6A 2BW2A 5IT4A 1S77D 2KU7A 1F5BA 2MY7A 2B6AA 5J2PA 4IUFA 4MAKA 3DGPA 4X62F 1YK9A 3G6XA 1IQTA 4OYPA 3OUYB 4K4SA 2NUUG 3PV8A 3HVWA 4A8WA 2ERRA 1NBEB 2VPXB 5KG1A 2NS1B 3BGUA 3D3CJ 3OTDA 5D4PA 3KLEB 3T5JA 2WRMA 3AD7C 3M8QA 3OHBA 5JUMA 2CJ9A 2FVPA 1UA1A 5D3GA 3SCKE 2G4BA 2KFNA 4P2SA 3ZZUA 1NSKL 5KT3A 3EDRB 5K8OA 2O3DA 1EKSA 4JI8J 3DU6A 2LQBA 5KFLA 4DV5F 3ILJA 4J9RA 2AU0A 2QT7A 1QVGR 3RRGA 1SUQA 2EKNA 4OLPA 2FVRA 3AD9C 4OZ2A 1X4BA 3ZZTA 1RP5A 3BZQA 3QT8A 2HWHA 2EBGA 3SQOP 2RDIA 4KSEB 5L1KA 1M90T 3HKWA 4UTGA 1MN7A 2RKIB 4ZS6A 4JI5J 2XI2A 3IXQA 3M1VA 1E6VB 4CLPA 4X4UA 1F9EB 4ES1A 3GP9A 4I64A 4UQTA 1REVB 1UKUA 4MKAA 3JSBA 3V81B 5EUHA 3P49B 2FHKA 3M2VA 2CXEA 2PC6A 3GSIA 3ISZA 5LSOA 1F60B 3H7HB 2HNZB 2VB6A 1JJCB 3C14B 4RJVA 5A8WB 1T05A 2NXNA 2RQCA 3HJVA 3NWGA 4F25A 4X4OA 2HWIA 4J9QA 3RBZA 5E3QA 5MAOA 5DRKA 3N5FA 3NMRA 2E5JA 3ZZOA 3QBCA 2ZC4A 4USWA 2J76E 2RQMA 4UUWA 1RWXB 4B08A 1XMQJ 1RTJA 4WXWA 4ZIWA 2XY5A 1SV5B 3LP2A 2AYMA 1YHQS 2DNOA 1KLMA 2EFQA 4FNIA 4P9SA 3PO5A 2JHEA 2WW8A 3QRQA 3MXHP 3IAS9 1XQIA 3BJYA 2HFOA 3BGOP 4NLPA 4WBFA 3WIUA 2MXYA 2M70A 1P8GA 1JLAA 2IMWP 4LF1A 5EN1A 4B3TJ 1GAOA 1CS4B 3RAQA 3BO3A 1LWEA 1HA1A 4ES2A 4LF8J 2ZC3A 1UMJA 2RKIA 4K4UA 2JX2A 1IUJA 4OV1A 1JKHA 3Q24A 1FXDA 2YKQA 3FGVA 4P7TA 1RXOB 3WHIA 1ZAXA 4H54A 4DZ6A 3V6DA 3FZ2A 2ZUAA 4WZQA 1RAGB 2AJ2A 3EX7B 3QGGA 4LVNP 4DX6A 2N82B 2VH7A 1RHQB 5KG3A 3EGWB 4C3KA 5K8PA 4B9UA 3MR7A 3DLGB 4N8OA 1CJKB 1Y4ZB 4MJKA 1GT8A 4JI2F 2Z30B 1WOOA 2AZ3A 3B54A 2BANA 4KFBA 5EX0A 3UCGA 3HM9A 1Q4RA 1HWUA 1VRTA 3NAHA 4V1Ak 4UQGA 4NRTA 2AGOA 4FYDA 3ZFVA 1AYEA 2YKPA 3N9UC 1KQSR 2E5LJ 3M30B 2VV5A 3PX0A 1S9GA 3JQMA 3KUGA 4BWMA 2AYGA 5BYSA 2N3OA 3CTRA 3T5KA 1TU0B 3FEYB 4HI1A 2VL1A 1CG2A 2IM2A 5EX3A 3RBEA 1RK8A 3G87A 2CUYA 1FDNA 2YBVA 3QIPA 2BX6A 1ZAWA 4WFZA 8RUCA 4Q7AA 1LEOA 3W5ZA 2MKYA 2XS7A 2ILYA 3QFHA 3N6LA 2DD8S 2DNPA 1TV6A 1TV6B 4NEYA 2CDRB 1Q95G 1RA7A 2DNMA 1WHWA 3M05A 4OZ1A 4QWBA 2DXEA 4KO0A 3OLBA 3KLVA 4F0MA 4ZITA 4ECZA 2YWGA 3T1YJ 4Q2LA 3DHWC 3R6GB 1PJ6A 2ZOFA 1U2CA 1RABB 1XJWB 3A12A 4ZCMA 4KTQA 3I4HX 4ATNA 1YJTA 1RT2A 2NYHA 2VC1A 2QA1A 1QAXA 3DOMB 3M6UA 3W60A 1TZ0A 5KFEA 4DCOB 1D9FA 2H4YB 4USUA 3D3BJ 1KR4A 3QZ8A 3GG0A 5KFYA 4ILMA 2FZKB 5GAHU 1VHIA 4JI5F 1H6KX 3DLGA 1H73A 2H1YA 2VQFJ 3M4XA 3KJFB 3PACA 5KFBA 1PAUB 3VAFA 4TY8A 4CLYA 2ZKTA 4OYAA 4Q8EA 1KONA 5IWAF 3B4MA 3A13A 3RTVA 2AWZA 2UUAJ 2YX1A 1X31C 3O1LA 2H65B 4FPRA 3BQ0A 1RTDB 4JI7F 4CO2A 4MFBA 4DV5J 4I7FB 3BDPA 1E6YA 4DU8A 3QIDA 2JEJA 5ETQA 1M1KT 3QFWA 3DRPB 5M2PA 4B3OB 2CJQA 3HHLD 1UFLA 3I4PA 2KN4A 3JTNA 2C2RA 4ZPWR 4UW2A 1LQ9A 1S6PA 4CT9A 1IM4A 4HT7A 2VUGA 1RUSA 3SEOA 3GWCA 4P6QA 3MEGA 2Y9HA 4C8YA 3GCWP 1J5EF 3D67A 4JYAF 3PM9A 1NJZA 2NUHA 4LF9F 1V3ZA 3DNCA 2J0SD 1X7VA 4DV0F 1NZ8A 2FJBB 4DV1J 4WK3A 1PYTA 3D66A 1NB7A 2QEXS 4DS5A 2E66A 1VK8A 1RHKB 1F5CA 3DOMA 3NMAA 4AE5A 1SKWA 2F9JA 2QA4G 1FRXA 4DLGA 3QJJA 4CO1A 1RT1B 2MKJA 3RW6A 1ICEB 2WVEA 1FJCA 2E5HA 4PPDA 3QSYB 2W4CA 4DV0J 1LW0B 4NL5A 2VODA 1ZM3A 1WTBA 1X5TA 3K0JA 3BV8A 1X5OA 3L7OA 5HATA 3CCES 2AGQA 3FZBA 3ADAC 1NH8A 2KYZA 2HLTA 2OFHX 4PG8A 1I3OB 4M5GA 3B82A 3KHGA 3NL0A 1AUDA 1FRIA 2P2CB 3FFIB 3IAM9 4KHRA 4LIRA 1SUQB 3K57A 2HRYA 3CMES 5E41A 2G2YA 3S1TA 4NE9C 4B3RJ 5D77A 4NLUA 3D54A 3PKMA 3M2RB 4LR9A 2CPEA 4P75A 1VRTB 1YZ7A 2VC0A 5CZXA 3TJ8A 3ZZYA 4LVOP 4FF3A 2W1BA 2RJZA 1NHKL 2D7SA 1HNXJ 1J5OA 1G7CB 2C22A 1YRUA 2RHQB 7FD1A 1JLGB 1M1GA 3VAIA 1RBLA 3ZTOA 3W9IA 2DKOB 2W2PP 4OZ5A 2B6AB 3TJ9A 2Z4PA 1HI0P 3HHKA 1HW9A 1VOMA 3J7A1 2PD1A 3MR5A 2KG0A 2GHWA 2C2OB 2UXDJ 4TU9A 2VG6B 1HWIA 2MTLA 3HHLC 2E44A 2HMIA 2XSJB 1RGVA 5EDWA 2DTJA 3FJ2A 2ZE2B 3R5GA 1C1CA 4QW8A 4OMFG 2DR9A 4FYYB 4NCGA 4LF7J 3JB9k 3C6UA 3A8IA 2CJBA 2CA9A 2GC8A 5K9FA 4O3RA 1MLAA 2QX0A 2QZ8A 4USVA 1N52B 4HLBA 4ID8A 2DNYA 4URQU 3BSNA 2DITA 3QO9B 3SYZA 1U47A 3W3SA 3C14A 4PXEA 4DR6J 4YOEA 2Z56B 3H5YA 3OFHA 3W63A 3I0RA 5HJXA 3MEGB 4FYVB 4X84A 3KWMA 1R8PA 5B08A 7FDRA 4C48A 2E5LF 2X3DA 2XS2A 4G65A 2MQOA 4A8QA 3GYGA 1OY6A 4EGLA 3GG1A 1UJ5A 2JRSA 4RWWA 4NLWA 3Q8QB 4FDFA 4LFCF 2V4JA 2PA8D 4LF2A 5H1SV 4J9LA 2X3GA 3M30A 4JI2J 1E6YB 4P72A 3N0VA 3O8WA 4K5RA 4Y2CA 3W2WB 4ECQA 4C0BA 1DAXA 4LFAF 3FSXA 4F3QA 3CC7S 4NCBA 1FDDA 1EJ7L 1KTVA 2B4OA 2CPFA 2B5JB 3IR6B 1HHSA 4FXWA 3CCLS 2FJEB 2QLJB 4IR9A 1R0AA 1Y00A 4OYMA 3S8SA 1L3VA 4URSA 3CJKB 1S1UA 2W2QP 2YX7A 2FJWA 1AFJA 1HR0F 1FE4A 3UO0A 3W5YA 3MOZA 4JI6J 1GX5A 4AYBD 1KVKA 5B09A 2CPDA 2HHTA 2BJ3A 2KZMA 4DU7A 1D9AA 5A0YA 1BHNA 1JKHB 3GE9A 2BABA 1FJGJ 1NDCA 2AJ4A 1S4FA 1IBLF 2VHGA 4USKA 2R7XA 2EK6A 2Q79A 1VQLS 1UVJA 3FKBA 3EM1A 3GU0A 2V67A 4DPXA 1XMOF 2OTJS 4O3PA 3D6FB 3VVUA 1N5VA 2YNFA 3ENWA 3PVXA 2ACYA 3UDLA 2PN6A 3GQCA 5IXUA 2E7XA 1MSWD 1RTJB 1Q81T 1HBNB 2LP4A 4WJBA 4ZLPA 4ZIVA 4DSFA 1RT3A 2F4VF 4LT6A 1RAIB 1JLEA 1K9MT 1T02A 1RSCA 1WF2A 3T19A 1WF1A 3KKFA 4F4XA 4FF1A 2XEXA 1Q8KA 2MJNA 3IC1A 2KJWA 4H4MB 5A8WA 2DGWA 1SBRA 2OKQA 1FK9A 1WI8A 4YFUA 5I3UA 2LKZA 2QMWA 2YWWA 5J2NB 2NXJA 3HVTA 1NPRA 5HLFB 4O3OA 2HHXA 2RILA 4CZCA 2C1EB 3DLKA 4MKVA 4Q8FA 2BQUA 2LLZA 3BH7B 3VF0B 2ROGA 3M6XA 3FDSA 2D74B 1ZZNA 2UVRA 2QO3A 4KBIA 4PZVA 2FGOA 4D3HA 1U48A 2EPIA 4TXSA 2E7WA 3FEXB 2OH2A 5G0RA 2L08A 3PNIA 1AZSB 3MCOA 4BWJA 2QC3A 4O44A 5I42A 1RJJA 2HVDA 3KK3A 2GVZA 1FD2A 4OYBA 3HHLA 1S9FA 2R7SA 2FJDB 2NPFA 3ZTQA 2R8HA 4LSLA 3JQKA 1CS4A 3KMSA 4DSJA 1QY7A 3KG0A 3M2RA 1C0UB 4G1QB 3R5JB 2OPQB 3ISNC 4ZVFA 2V69A 1H98A 2I6WA 3UDCA 4C11A 1YJUA 1Q0NA 3QAUA 4IO1A 4RX6A 2HVZA 4CO4A 5LMNJ 1S6OA 3K5NA 1VGYA 3B8HA 2IIHA 4HH0A 4NEZA 2AJ1A 4DL5A 2HGLA 1CJTB 2MZSA 2VFTA 1S1VB 3BF4A 2CJXB 4I6YA 1JNZB 1WEYA 2N4CA 3W62A 4MK7A 3F56A 3BQ1A 5J2QA 1FRKA 1U24A 1EARA 2CQDA 3IBWA 1SH3A 4RW4A 4ZK7M 4JI1J 1BLUA 2MYFA 3PFEA 1MN9A 3ITHB 4UUXA 5G4DA 1TUVA 4ELUA 4F7VA 4JI6F 3RJMB 2W25A 4ER8A 1SIZA 1VFJA 2MLYA 1SJ1A 4NRUA 2CG4A 5F9NA 2XLJA 1IWAA 1TUGB 4IFYB 2CJAA 2R7QA 4OHXA 2H9ZA 3W64A 4P52A 4JV2A 3NNHA 1UAWA 3OR1B 4CWBA 4Y28C 4YMEA 2B7BB 3DU5A 2HBZB 3MTKA 1HL6A 3HULA 2ASYA 5KFGA 5HSPA 4A8KA 4C9DA 2R7OA 4ZLJA 5DGBA 2WSCC 4J9MA 1D8YA 2AV5A 4O23A 4F4KA 1FJGF 1RAAB 2HW3A 3SBMA 1AT1B 1KSPA 3TEHB 1RCOB 2DHGA 4DR5F 5IM0A 2HHUA 3NWRA 5HQ8A 4IYQA 1NCLA 2SXLA 2V50A 2I5JA 4NZ0A 4KY3A 1VCTA 4F26A 1VISA 2AQ4A 2ZZMA 5GAHI 3IS9A 3UFCX 2JEIA 3WIVA 1IJEB 3T6BA 2BQ3A 1NKCA 3MM8A 2W7OA 1UETA 1EB0A 2ZBIA 3MAAA 3NY0A 3P96A 3OUYA 1RWOB 1JJ4A 3DC2A 2J9DA 2AKWB 2JL9A 4LJMA 3QJPA 2PMZD 2X1AA 1N54B 5GVQA 3UE2A 3H25A 5L1JA 2WTFA 2C2DA 2HHPA 2E9TA 3M9NB 4WPAA 5ETKA 2D1CA 3K7RA 4FS2A 1M5HA 2XNQA 2KZZA 3DOKA 3CSKA 1FNXH 2I38A 3QGPA 4H4MA 3U27A 2A18A 1VRUA 3FNNA 4V19J 5EHHA 4V19X 3QRPA 3EPGA 3VAJA 3CNQP 1MMNA 3O2IA 4IR1A 2L9DA 3CIMA 1JNRB 9RUBA 3CD6S 1CPZA 2QLBB 1M0SA 1GXTA 1REGX 4EFAC 3MMBA 3TNVA 4FF4A 2YNFB 2HEKA 2CQBA 2V5HG 4GRSA 3HVRA 4A46A 2W8LA 1FT8A 2UVVA 1BWEA 1M5OC 4QCLA 1RZMA 2XMTA 3TA1A 3A3NB 2IM1A 3MPWA 4J7CA 5F8GA 2Z2ZA 5A0YB 2OAUA 1S57A 2YKNB 4EEYA 5CXTA 2QYGA 3MM5A 3G96A 2RS8A 1BQXA 1JB0C 3QSIA 3MURP 2R8KA 2IYGA 1VQ4S 5KFRA 3IWLA 1NLKL 2JVRA 3VGTA 2XSFA 1T9TA 4ZLNA 1O6XA 4I6AA 4ZP6A 4U9RA 2DNNA 3AFGA 2U2FA 4K4ZA 4A8YA 3HPOA 4HYKA 2JLFA 2G1DA 3MAAB 4NLVA 3EVWA 4X4PA 1VR6A 1FERA 2DIVA 1J5EJ 1FWLA 1Q82T 1HYSA 1MROA 3BN7A 4B9LA 2Q6CA 2PDAA 4DX8H 1IJFB 4ZCKA 2W8KA 2D3ZA 1JLCB 5B0BA 4DFKA 3GCXP 5D6GA 2OEKA 4IOCQ 3I82A 2R2SA 1N6QA 4DV4J 1FA0A 1O0PA 2M8HA 4PXBA 4RUBA 3DN9A 1RADB 4W90B 3QQCD 8AT1B 3AT1B 4FVMA 4N76A 1BQMB 3TA2A 2C2EA 2B56A 3GV8B 2JFKA 1T9WA 4R5PB 1F9FA 1DLOA 4ICLB 2XZTB 4PUOA 2OPPA 5CABA 3ZZPA 4NLTA 5AXKA 2K8GA 2IAJB 2V0NA 2HAFA 3HD2A 5JMNA 2COLA 1PYOB 2GZOA 2ZEJA 3EDQB 1KLMB 3PCOB 2VZ9A 2R42A 3OR1A 2IFXA 3KLIA 2ZVIA 3BM7A 4KYZA 5E5NA 1RWPB 2DNRA 1UW9A 2YQ0A 4KPYA 2VD3A 1C1CB 1WF0A 1DTTB 4OZ0A 3TZZA 2DISA 4OLOA 1MU2B 1IR0A 2RRAA 2BV3A 2UUTA 1N32F 2NCKL 2YKOA 5DZ6A 3PRBA 2RIJA 2XHCA 2NSCA 1YVFA 2EW9A 3N6NA 3PXGa 2FLPA 1U25A 2UV8A 3I9V9 4YB7A 2C42A 2ZZNA 2DT9A 4WFXA 4B9NA 3EGZA 3G9CA 4DDFA 5HVHA 1W7WA 2LU2A 2UUAF 2A6OA 4MKYA 1RAFB 3EXCX 4DF8A 2DPJA 3E01A 1ELOA 3N4WA 4DL0C 2VA2A 2E1AA 1NK9A 1A7GE 4JYAJ 2BJDA 2X1GA 5F41A 5HMWA 1KBRA 1W2BR 2FLLA 3MM8B 4OZLA 4HR2A 4C3LA 4RUCA 3TAPA 1KC8T 4LF4F 4ANEA 5KFUA 4FKXA 5KG0A 1J2VA 4G1QA 4P2XA 3U02A 4F8RA 4QBUA 1N34J 2AT1B 3LQVA 4MT1A 4TQRA 2RDDA 2VICA 4PCQA 2HK3A 1TAUA 3CDWA 1K8AT 4B9TA 3TZXA 4DQRA 1G1XA 2NYIA 3EMTA 3OL7A 5ITHA 1WG4A 4JV5F 1LXJA 2OFGX 2F8HA 1SH0A 2ASLA 1WHYA 3TO8A 1J27A 3V5RA 1RKJA 3GV7B 3QWUA 2LEBA 2J9CA 4LFBF 5LSRA 2KVQE 4NLSA 1FI4A 1RT4A 2B4VA 1UL3A 2GO8A 4DFMA 1SKSA 1QD1A 1UVLA 5KFMA 4PWUA 2CPHA 1OQ3A 2BJEA 4CTAA 4F3MA 5C24B 6FDRA 3DGPB 3S6EA 5KT4A 3K59A 1X60A 2VJVA 2UU9J 3HI9A 1EP4B 5ADZA 4RPFA 2ZH3A 4NLOA 5LSLA 2OD6A 1FK9B 1ZA1B 3EZOA 5HBMB 5KG6A 2HYIB 4LMZA 4Y2IA 2EK1A 4RNOA 4DF4A 3BKTA 1TAQA 4KB7A 1MU2A 4WKRA 3EXYA 3K5MA 3W2VA 3SDEB 1V6HA 1BY9A 4YDDB 1I5OB 4PG6A 5T7LA 1EAYC 2GW8A 3DDIA 3CC4S 4NLGA 4YB6A 3O44A 4ZN3A 1QAYA 2ZVSA 1CJVB 4J9VA 4QYZK 2DGXA 1C4AA 1JJHA 2RT3A 1S6PB 5ETTA 4CLZA 5C42A 1Z4UA 2ZJRQ 1S59A 2ZBCA 1FVQA 2DNGA 3MI7X 1WOPA 4QR0A 4QWCA 4C8KA 3GMGA 3R1HA 4JV5J 2GVZB 1HPZB 1JLBA 1P27B 5KFCA 1X4EA 2VG7A 3H8YA 3LGMA 5I42B 4DR3F 3SSSA 5AXNA 4OHYA 1SI9A 3DMJB 1X4HA 2OMOA 2FHJA 3A4TA 1N56A 4CIOA 4OX9J 2DEIA 4ANCA 5A8RA 2YXLA 3UDVA 1JLFA 1RT6B 1S7IA 3EPIA 2LDIA 1S49A 3UD5A 4LF4J 5CAAA 5ETOA 2W9CB 4DR3J 4J9OA 3R5BA 1UVMA 1CULA 4DX5A 4WP9A 4I67A 5D0RA 3PKYA 1NDLA 4MIAA 4K4YA 4QW9A 3W2WA 3GFYA 4F0HA 2EI5A 5RUBA 1JJ2R 4E98A 1BQNB 3I55S 1SL2A 4HVZA 1D0EA 2CJYB 2V6AA 2KXNB 3SCIE 1SC3B 3SDEA 4BHQA 1ZYQA 3MM5B 2IRXA 4PEOA 4RW8B 1T11A 5M2UA 2OGUA 3KHHA 3A8KA 4ZA1A 2EVZA 2DR6A 2NXCA 5HBMA 2AHOB 4HTIA 2ZH4A 4DR4F 3DI6A 3OFFA 3V6KA 4L3NA 4JI3F 1G2EA 4U7CA 5J2QB 1DFDA 2YPZA 1X4GA 3R27A 3FSYA 2AF6A 3OPKA 4WFYA 3HT0A 2J9DE 1MMLA 1RLDA 2B9EA 4KV8B 5D4LA 4ZVSB 2XCAA 2MSSA 3AODA 3UCUP 1HBOB 2P9EA 5GMKa 4U67Q 5E3PA 1RT4B 1XIQA 4NCGB 1XTZA 4ZPBA 4YR3A 5KFZA 2ZHAA 2OMLA 1T3NA 3NS7B 4F4ZA 1FO1A 1YJRA 2GQ2A 3KLHA 1HNWJ 2DJWA 4RU9A 1CJKA 4KGMA 3N01A 2PFDA 3GJTB 3OQ2A 1VMBA 4RZRA 3BPDA 2H5JB 3W5XA 3JS9A 1BE4A 1NEEA 2XMJA 2R8JA 2KM8C 3C66A 2OTLS 2QL7B 1K47A 5G0RB 3PYDA 2XMAA 3V6DB 4NWBA 3NCRA 4HT5A 1FKPA 3DM2A 2GAGC 2PE8A 4KH0B 5F3TA 3ET6A 1TKDA 2XHWA
chains in the Genus database with same CATH topology
1I1GA 1L3TA 1GQEA 1XMBA 4YEAA 2I5JB 3IRXA 2UZAA 3DLKB 2KI2A 1XERA 4O3QA 1GTHA 2FD2A 3Q2TC 1Q16B 2MQPA 5CYMA 1EETA 1LWCB 3IGVA 3MM6B 5AJ3F 5E2QA 5CA5A 3TI0A 1NNDA 3NGDA 2Z8QA 5IQQA 4K4VA 2VPWB 4DLEA 4OI0A 4XAKA 1KN6A 2QSWA 1IKVA 4RW6A 2HQIA 3HZGA 3AJ2A 3VAGA 1M5VC 3S01A 2ZITA 3PRDA 2POKA 2J6TA 3AJ1A 4ED5A 3MCSA 3OR2B 4QJVA 1LW0A 2DGSA 1WHXA 2MDAA 4ID5A 1KD1T 4JV0A 3CCZA 1WNEA 2FY1A 5AE3A 4DOZA 4FZVA 4NYPA 4DQPA 3ITHA 3P3DA 2F7VA 4I0WA 4DUYF 1SIWB 4QPXA 4U6PA 4QU6A 4LF7F 4OFZA 1SH2A 4ZHRB 2LA6A 4IFVA 5AXLA 1T3OA 5F8JA 1F0XA 1OPIA 1R27B 3MUMP 1S9EA 2Q1LA 1KS2A 1IKXA 2XB2D 3BSAA 4WCEQ 3JSYA 3A1YG 1T03B 4OHVA 1FXRA 3RB6A 4MIBA 1X4DA 2C3YA 3DCAA 3K8VA 4I2PB 2B5JA 4DSEA 4LQ3A 1HQUB 5KOXA 2KT3A 2XS5A 3B78A 3NCQA 2AX1A 2DGUA 3TQ1A 3DHXA 1SJQA 2N4DA 3BEGB 1L5UA 4X4QA 2N7CA 2E29A 2RF2B 2MKKA 4I56A 2W24A 2VG5B 3CUNA 3HHNB 2L48A 3DLEB 5U47A 1CLFA 3FMWA 2B51A 5B0EA 3THTA 4DMZA 2LVWA 2BRKA 1VIOA 2V8HA 2CQHA 2MZQA 4CNZA 2D3OR 4J9KA 1VBXA 1VC0A 4OI6A 2UVWA 3POTB 2MZRA 4F67A 1CVJA 3JSMA 4GC7A 4NLDA 1FEEA 1HNVA 2HGMA 3RB3A 4C8MA 2F8MA 2XSJA 1QAIA 4WU2A 2IRUA 5DJBA 1L3UA 3M2UA 1FDAA 1HI8A 2KXHA 5F8IA 1W25A 3PO4A 2OD4A 5JVGQ 4QWEA 4DN9A 5C5JA 3GR0A 2BR0A 1ZOTA 4DFJA 1ZM2A 4F2SA 2W9AA 2J5AA 2D9PA 2XY6A 4XO0A 1OSCA 1S9GB 2WB4A 3K2YA 3G86A 1YITS 2QMXA 2ADCA 5E33A 1KNZA 2O66A 5CZVA 5HMZA 5DM6Q 5CYQA 2B4UA 4TY8B 2IVYA 3D28A 3G4SS 1OQ6A 1H2UX 3BO4A 2XWXA 2YTCA 4C0OC 3KTQA 3D5MA 5DS7A 4MIWA 4USIA 2VPZB 3KJVB 1QE1A 3CE8A 2JWNA 3J81Y 2HQ3A 1UWBB 3R5CA 1A6LA 3NGKA 4PG4A 4IFVB 4FBTA 5JJBA 3ISND 3M8PA 2ZH2A 4NXNF 3CDBA 1FE0A 2H5EA 1RT2B 2WSFC 5CQGA 2AW0A 4ZCIA 4QIEA 2KXFA 2KG1A 2UUWA 2EFVA 4EWTA 4YUDA 2MQMA 4QU7A 1C2PA 1RT1A 2JOQA 2YKAA 4KO0B 3TA0A 1GXLA 2RU3A 1TK5A 3MR6A 1FRHA 4RW4B 3NLCA 3MDFA 3HO1A 4HDGA 4KR0B 1SJ3P 3HK2A 2RQ4A 3IGNA 1LK7A 1PGZA 4KGKA 5KTQA 2RDJA 2D3UA 3KK1B 1TL1B 2RD5C 1LWCA 2W7AA 5FD1A 2OPQA 4O0IA 4Y65A 4ED0A 2DR7A 2DH8A 3V2UC 2HMIB 3IRXB 3SXLA 3HLUA 5KFHA 3BS9A 2KFYA 1VBYA 4B17A 1FF2A 2V2KA 3QPIA 3FVYA 2P6TA 2B43A 2ZH8A 1NKBA 4BC7A 1TK8A 2HG4A 4M63A 2LQ9A 1NO8A 4OX9F 1TKXB 3T6JA 1HNIA 1XBWA 3OVSA 4BC9A 3I9ZA 4NLXA 1JLQA 3KLHB 1URNA 5EWFA 3G6ES 2CPYA 1JIHA 3X1LB 3M8QB 5HLFA 2YVSA 2ATLA 4ETXA 3HVTB 2AGPA 3NRBA 3E2EA 3CCRS 3RB0A 1TL3A 4DG1A 2PFFB 2CPXA 3NBPA 1F5AA 4XDCA 1ZTTA 1R8AA 2MSTA 4NA2A 1JMTA 3TARA 1S76D 1YG0A 3VTIA 2GFFA 2K1RB 4O4GA 1U6FA 2ZD1B 5D78A 3GILA 2OIHA 2M0GB 4M95A 2KVIA 4HL9A 2PI4A 1FHTA 2JEFA 1O51A 3BGRB 3CULA 3WC0A 2CQPA 4ZOSA 2MZJA 1NHUA 4YR0A 3M1VB 3KHLA 1AFIA 4MYUA 3RAXA 1KFDA 2CKWA 4PWDB 5LXYA 4I2QB 2Z0GA 2XLIA 3LF0A 3L3CA 2V4QA 3I96A 5LMUF 4PG5A 3JTPA 2A2CA 2RF2A 6FD1A 4KHMA 3WX4A 2LA4A 4RUAA 3MAHA 4EYIB 3MR2A 3V4IB 3OTBA 2ERRA 1N33F 2GV1A 4H4KC 1VC6A 2DH7A 2J0WA 5KFJA 2J0QD 4ERDA 2R7UA 1VS3A 3P6YC 2P9CA 3DLHA 2XGQA 3ICLA 5T41A 2CQ3A 3SV3A 1JLAB 4LIWA 2W4DA 4Y2KA 3BDEA 2VKRA 1NK5A 1UEUA 5AE2A 3E51A 4ZVEA 4MTPA 4QIVA 3QZ7A 2XMWA 3I0RB 4ELTA 5F8LA 3GB0A 1JX4A 3F44A 3W2VB 1VQ7S 2V4RA 3J7YI 1U6BA 2EFNA 1S79A 3NS6A 5D4OA 4F02A 2HHSA 2XC9A 3G8TA 1N5TA 1B0PA 2ZH5A 2VBYA 1VI7A 3HHEA 4WE1A 1I94F 3C3LA 1TKZA 2HS4A 3SCJE 3BGRA 1HWKA 2DPIA 3SI8A 3CD5A 2R2RA 1S1XB 1NZAA 5C24A 3PW7A 1SC6A 3THPA 1FJ7A 2VG6A 3DFEA 3O3LA 3RB4A 2C3MA 2RB7A 3MFIA 3P5TL 1RWUA 2OLWA 4O3NA 3PX4A 2HHVA 2PMHA 5LL6d 5FLXY 4FP9A 3NBPB 5FIIA 2UUBF 2HNYA 2YWEA 4C97A 2FLNA 1GH8A 3J80Y 2E1MC 1JK9B 3L7PA 1S9FA 3F41A 2PGCA 4GMKA 1DQ8A 3NNAA 2LXIA 1S48A 3NAIA 2XMUA 4RKUC 5D3GB 1JLQB 1U1LA 1RTIB 2W4PA 1Q8BA 4QR1A 3K5LA 2CDQA 3A8EA 5KFPA 4X4SA 1Q7YT 1DTQB 3U1NA 1XC9A 1FNMA 1PILA 1RT7B 3CCQS 1NAQA 4EUVA 1YRTA 3OXFA 4Q2MA 2MB0B 2BA9A 3PX6A 4ILLA 1U1NA 3PW4A 2DO0A 2M88A 3CC2S 1JWWA 2E1CA 4C4WA 1ZPWX 2JSXA 4ZPVR 4M1KA 1SXLA 2CZ4A 3GIIA 5E7OB 4J37A 1S1TB 1O8BA 3CJ0A 4DL4A 1C1BB 3QWPA 4TLQA 1U1OA 1VK3A 5DDOC 1HBOA 3OR2A 2QFJA 2WCXA 4I68A 4KV8A 4K4TA 2PI5A 4MK9A 2C28A 3GR1A 2BOPA 1TFWA 5IZHA 4Q45A 1URRA 3MD3A 3HF5A 3VZIA 4PUOB 2EWHA 3LP1A 1TKTA 2HNDB 3UD4P 4Q44A 2XLKA 1HARA 1Y5NB 4QZVB 4NLQA 4ED6A 1C0TB 1KFSA 3M2VB 4DR2F 2DCUB 4UOCA 3MEEA 3V81A 1XEZA 2NPIA 3AQOA 1UW4A 2ALZA 2ZH1A 4GKKF 1MROB 4AUKA 3DRPA 2IVFB 4IO9Q 3CDAA 3BR8A 4WFBQ 1U26A 4DEZA 2E5IA 2FC9A 2BM0A 2J9EA 2WK4A 3VZHA 2DGVA 5JVHQ 3CJ3A 2Y1RI 2CFXA 2IBOA 4Z2XA 3PJWA 4K4XA 2IVMA 3I0SA 2JLEA 5CYQB 3HKZD 3V6HA 3PW2A 3BN4A 2Y1JA 4DL2A 2IJNA 3DDKA 5J2MB 2YWHA 4ES3A 3IO1A 1DJ0A 2DIUA 2F9DA 2CZVC 2HAIA 4B3SF 1B0TA 2DBBA 5GADU 3PW0A 1QJHA 2ZFHA 2VKZG 1CQNA 1M5SA 3CF5Q 4IH7A 1SJFA 4N41A 2RE1A 5KG7A 5SZTA 5KFIA 5H9EJ 1FRLA 4YB5A 4CO0A 5I4MA 2RRNA 1SL0A 1VQ6S 1UVKA 3KFWX 4N5SA 4B3TF 4LF8F 2QRRA 5L8RC 2LYVA 3KMQA 1DQ9A 3TUJC 2J7KA 4RW7A 3JSMB 4IG0B 1WEXA 2N3LA 1SL1A 4JI1F 2RVJA 4RUHA 1KLNA 3MEDB 4ZDNA 1XMQF 1FVSA 4F3OA 2XG8A 1H0HB 1U2RA 1LW2B 4X4RA 1VLYA 4NLYA 5LMNF 4ZPAA 2GJIA 2I9SA 3K5OA 5A8RB 1OWXA 3IS9B 4JI8F 2ROEA 4A8OA 4KT0C 4DL6A 1GX6A 3TP2A 1TP7A 2HLUA 4WK1A 3JYTA 4HTJA 2PEHA 3O6QA 5IM0B 4M5DA 2KT2A 3LWLA 1JLBB 2AP6A 4OI2A 3CCJS 2MQNA 5L1IA 5KFNA 3U1LA 1Z2LA 1IKYB 1S1WA 1LWEB 1HQUA 1X0FA 5KT5A 3LO3A 4NZ6A 1S6UA 2M5YA 2YNHB 3MPVA 2HHWA 2RRBA 2W9BB 3H59A 5IQ6A 3DXBA 1S6QB 1ZM4A 2MKSA 2HS3A 3MMAB 4DJBA 4PG7A 4Y34A 1SV5A 3LP2B 1FEHA 3OL8A 1HMVA 2CQ1A 4G1IA 2MQLA 1S9EB 1T7PA 4IFYA 1Z1ZA 3US5A 4C8NA 3MUTP 1HFEL 1APSA 1NJYA 2VBXA 4NYZA 1C0TA 3DRRA 5M2RA 5B0FA 4ECUA 2MZTA 1X9SA 4F4WA 1N88A 4X65F 5EWGA 4DV3F 3E8OA 4K59A 1YIJS 1VQ9S 1YQHA 1QSYA 4FVCA 3AAWB 1S7HA 2B7CB 2YX4A 3NS5A 4C2MA 3MD1A 4YP3A 1E6VA 2EG2A 3KLIB 2UV8G 4WF9Q 1C1BA 2D9OA 1Q1KA 1QUVA 3D0IE 3AB2B 2XZWA 3V4MA 4PKDB 2VA3A 4JUZA 5C25B 3I6PA 2RS2A 2M4MA 2AYEA 2K7KA 3TOQA 2L3MA 1YGYA 1IBKF 2JLGA 1RA6A 3MR3A 2W7PA 3LWMA 3PR4A 1DURA 4K4WA 2GHPA 4DSKA 2GIRA 1P1TA 3LOUA 3JYTB 2CQCA 1HW8A 2B0GA 3OTOF 4J9SA 1NK9A 1HBUB 2DNQA 1VBZA 3VQTA 3D1QA 3R5DA 3SMZA 2NQPA 1NK4A 1DZ5A 2ZOGA 4DV6F 1W2IA 3UWTA 3CIZA 1RTIA 4I1TA 1K1QA 1KOOA 3HX9A 3VAKA 3AQPA 1OSDA 2ZJQQ 4NA1A 1VQ5S 2ZUGA 3QMQA 3MHYA 5LJ5Y 2C3UA 2V94A 2DH9A 4IG0A 3DLBA 4ETZA 5L9NA 1U09A 1UVNA 2EBEA 1HNXF 1Q8LA 1DQAA 1VQPS 1JLEB 4BCAA 3HZEA 3CJ5A 2CPZA 2ZM6F 2U1AA 2E9RX 4EO8A 3BO2A 3AY0A 3CO9A 3VAMA 2LMIA 3BGLA 3RZAA 1LK5A 1RI7A 3OLAA 5CHCB 2GIQA 2AJ0A 4WFAQ 2BACA 3MMBB 4NX9A 4WTYA 2LDYA 4LSNB 1RT5B 2YNGA 2L9NA 1BC6A 1X5SA 4KAIA 4NPOA 2EFGA 1NK8A 3C6TB 3BSOA 2IC3B 2MY8A 4OZNA 4I69A 4ZP9A 4WFNQ 1LKZA 1MWZA 4NOHA 4B3RF 3DOLB 2GCFA 2DVIA 1KRPA 2MKHA 4U7UK 2WBRA 3ENQA 1KOHA 2YNHA 4X4TA 2J0XA 3I5BA 2HWTA 3PY8A 5GAGI 1GNKA 4BBYA 5F8MA 5B0DA 2XY7A 1NK7A 5HP1A 1ZTWA 3MM7B 4MH8A 3DMJA 4ECRA 2HRUA 2HZCA 2NLWA 3LAKA 1VIXA 2B3TB 4QYZJ 2ILZA 1UJ6A 4WKYA 2ZDOA 4ECTA 3QGIA 2DR8A 3MECA 1R43A 2P6SA 3M6WA 3G6YA 1Q7LB 4ZVGA 5KFSA 4AXIA 5DLGA 1S0OA 1D8ZA 2BZ2A 4RLEA 3BGFA 5BJRA 4EBCA 1YI2S 4K50A 2R7TA 3H20A 3TUIC 4CT8A 4IH5A 3CT9A 4R8UB 2DR5A 1XNRF 1FKOA 2DHAA 2DHXA 3OW2R 2WHOA 4HEA9 5F0WA 3UNGC 4UY8T 4KKOA 5IFMA 3K58A 3AH6A 3N6MA 2ASJA 1NJWA 3MMCA 3MZIA 5EWEA 2JH3A 2DRAA 2X1BA 4AXJA 4A8MP 1LOUA 3SZ2A 1YJVA 3AB4B 4CTAB 1TL3B 4DG1B 1T95A 3GV5B 4IKAA 5K14A 1U1KA 2XCPA 2I8EA 3GIMA 4CO5A 2VQFF 3CCVS 3D1OA 4DHVA 1S6QA 1X9MA 1G3OA 1SJ4P 1HNWF 2IMOA 2K7JA 4ED2A 5KT6A 1IKWA 2DNZA 5THWA 2B4PA 3I0SB 2YH1A 2WBMA 3KK3B 2QLXA 5AXMA 3DLLQ 1WWHA 2OPRA 3OBIA 3FSIA 3VR1A 2G0CA 1WI6A 3TANA 1RKIA 1X0PA 4PXCA 4WYWA 4H4OB 3MFHA 4JOUA 1PC4A 3H40A 2AJQA 1HD1A 2MMYA 1V3SA 4EZ6A 4ALZA 1VHFA 1HBMA 3WZ0A 4PXDA 2VPYB 2BM1A 2IM3A 3MEEB 3CCUS 2FJXA 2N7YA 1ZH5A 2F40A 5D4NA 4EYHB 2ZDPA 4NA3A 1R8CA 1TL1A 4OJGA 3H5XA 3LALA 5L9XA 5T14A 4RW7B 3T1YF 4ZCLA 5J1NA 5FJ4A 2NXUA 3CD0A 2GGPA 1DTTA 3IRWP 4MMOA 4YB1P 3MF5A 2KO1A 3H5SA 1Y9OA 5E3RA 2UU9F 3G8QA 2OP5A 1XR7A 3MMAA 2R2TA 1KVJA 3DYAB 2MZ1A 4JV1A 4CNYA 3H2VE 2A10A 1HQEA 3EZUA 4TU7A 3KHRA 1VQNS 3VWSA 3TAQA 1XWLA 2YKMA 2CQ2A 2B9XA 2UP1A 1U4BA 1JLCA 3EYZA 2P5VA 1QVFR 1R7IA 3CJKA 3IR7B 4E8UA 1G6BA 1FCAA 4Y2AA 2QSFA 3THVA 5D8HB 4I2QA 1TFYA 1KQKA 2ZOMA 4PWDA 4F4YA 3OTCA 3IN5A 3M6VA 3CWJA 4D3GA 3MGJA 2LECA 5J2NA 1TVRB 1M90T 4FS1A 2FJAB 2QIFA 3N5BA 3OTEA 2XWYA 3H98A 1S10A 4IRKA 3SQGB 4DPOA 2QV6A 4ECVA 4IDKB 1L3KA 1X9WA 5GAEU 2BE2A 3QLHB 3DDNA 3EGNA 3TYTA 5KAKA 3N79A 3O5TB 1WEZA 4RNFA 3C6UB 4DQSA 2FVQA 2RSQA 1ZBTA 2KHDA 3I87A 1S1TA 4GO5X 5GAEI 2BANB 2GHVC 4KFBB 2WONB 4QIWD 2B9YA 1Q86T 1KHWA 4KC5A 2FTRA 5HROA 1S1UB 1LFPA 4QYRA 2QE5A 5J1EB 5K8MA 2D41A 4ECSA 1FRMA 1OS5A 3OJSA 5E0OA 3LGNA 3R5AA 3T9NA 4ECYA 2MGZB 4J9NA 2ZHBA 4DS4A 5FDLB 1U7LA 5EGYA 2HVIA 2FLOA 2LEPA 2ZKUA 3R3TA 4O3SA 1RAJA 2M2BA 3V4IA 3CCMS 3HFKA 4YQWA 2R7RA 1HI1A 2G9OA 3DRSB 5KFWA 4XK8C 3DXSX 1ROFA 3LAMA 1T03A 1M5PC 4KIAA 2J7WA 3ZC4A 4K0KF 2YWFA 3UI3A 1N5QA 3QO9A 3PIOQ 3VCDA 3OHAA 1VQOS 2GO9A 3KNGA 4ZHRA 2NSBA 3C46A 5B0CA 3T9ZA