2EBGA

Crystal structure of a hypothetical protein from thermus thermophilus
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
106
structure length
106
Chain Sequence
MQAVRLFQGYLWHPRALALDLKALLPGEVAGARLLWDEVPPPTPFFEDGTPTHTQRFYQLTLLVLTEEPPEALKPLAEEAAEALGEVLEGLPPEVGWLLLEDLRPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein TTHA0061
publication title Crystal structure of a hypothetical protein from thermus thermophilus
rcsb
source organism Thermus thermophilus
total genus 19
structure length 106
sequence length 106
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11482 DUF3208 Protein of unknown function (DUF3208)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2290 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ebgA00
2EI5A 2EBGA 2EBEA
chains in the Genus database with same CATH superfamily
1QAYA 4Q7AA 2GVZA 4F0MA 2JC1A 4OI0A 7FDRA 1H2UX 4X62F 1F9HA 3MECA 3NBPB 2IDEA 2CUYA 3TOQA 1VMBA 2JC0A 5KFGA 2DKOB 4ZVPB 2XY5A 1TKXA 2XMVA 1SL0A 4X4NA 3ZTRA 2VPXB 3BGRA 2DCUB 3IM9A 4X4PA 4DG1B 1JX4A 4NMXA 2A6MA 4Y2CA 2ATLA 2YKOA 3O8WA 4OYAA 2QFIA 1FRKA 3GYNA 4DFMA 5LSLA 3HP6A 1NM2A 4LIWA 4ZCIA 4F4YA 1R0AB 5MLCV 4TXSA 3RW7A 1VBYA 3J7Z5 3DLGB 4J91A 1SKWA 3LP0B 2NUUG 2CQCA 3LGNA 3PW2A 1Q8LA 2ASDA 2UUTA 2DHSA 2XYGB 3CCRS 3UCUP 1B99A 3GYXB 1HFEL 3DOKA 3TJ8A 2JH3A 4Q0BB 4ED4A 3QRQA 4IH5A 3RBEA 1MU2A 2HNZA 1J5OB 1RCOB 3MM9A 2Z2YB 4BLGA 3GSDA 1OWXA 3OVAA 4DL5A 1U1OA 2HFZA 2WOMB 1FNMA 5J2MA 1GX5A 2KKHA 3R27A 3L7PA 1Y7PA 1TFWA 3IGNA 1SJQA 2AJQA 3W64A 5KFKA 4LFBF 1QSLA 1RYRA 2W2PP 3FK4A 1XWLA 2GW8A 3TWZA 4NYPA 4ENOA 3R6LB 3UD5A 2VG5B 4FKYA 3RR7A 2RQKA 4TLRA 4O3QA 4DL2A 4IYQA 3KYLA 1XR6A 3LH2S 3W5XA 3OSPA 2IY5B 1CJUB 3H5SA 2PA8D 1LXNA 4LFAF 3D1OA 4LFBJ 1FX4A 3TAPA 4OYOA 4PXBA 5A8WB 2FGOA 4HKQA 2YKNB 1IQTA 4B3SJ 1IWAA 2IFXA 3DOMB 4USJC 3UN3A 3PFOA 1FEEA 4LRAA 1H38A 2G0IA 2P8IA 1N5YB 1K8AT 2V0NA 2KVQE 2KFZA 3VAGA 2F65A 4LFAJ 3DLHA 1WG4A 1BY9A 3SEOA 2QSFA 2YKMB 3PYDA 3MEDB 2EKYA 4PG8A 1D8ZA 2AV5A 1IR2A 5FLXU 4ERDA 5IT0A 3JXOA 3MPDA 3VR1A 2H5IB 1FA0A 4K4YA 4OX7A 2BQUA 4C4WA 2MQNA 3DRPA 2XO7A 1VQLS 4DS5A 1N52B 2NREA 3THPA 4X64F 4TY8A 3M2UB 3OW2R 5KFYA 3KWMA 4L74A 4P75A 5D4LA 3JQMA 4CO4A 1F9EB 3BO2A 1RTDA 2N3OA 4FYWB 4DQPA 1RZMA 5F0WA 5KT4A 4WJBA 1XJWB 3MOZA 3ZO7A 3P6YC 1K0VA 1ITPA 1KEKA 4X64J 5J2QA 4IH7A 1PO6A 5HJYA 1MROB 2CQIA 5ETSA 5EX0A 2B5JA 4IRKA 1YJRA 2LXIA 4YR3A 2IYIA 1DAXA 3NMRA 4HT5A 4FNHA 1S1WB 4RWWA 1BQMA 1A0OB 3BBFA 1VQOS 3MZIA 1YX2A 3MXHP 4UOGA 3OXFA 1ZZFA 1MWZA 3H98A 1PBAA 2BJ3A 4K7QA 4DPTA 2JHEA 1YK9A 5HBMA 3JAMU 4CLLA 3MURP 1N6QB 4CO2A 3K57A 4Z7YA 2PIIA 2DGUA 2DRAA 1S0MA 3PJXA 3W9JA 3SXLA 2KXHA 3SI8A 2HMIA 5JUMA 1B7FA 2HQDA 5KOWA 4UUWA 2ACYA 2XMWA 3HSDA 3FSIA 4DQRA 2ZWOA 3CCSS 4WE1A 3PY8A 3DNCA 3GCWP 3T1AA 2D3ZA 1VRTA 2KFYA 4O0IA 3E01A 1QTNB 2W7OA 3QPIA 3F73A 4B9VA 3X1LB 4YHHF 3H25A 1B70B 2C42A 1IBKF 3IBFB 3GU0A 5D6GA 3VAHA 4NLPA 1U6FA 2R2RA 4AT1B 2PEBA 5DQHA 2PO4A 3NBPA 5K8OA 2CQGA 2RF2A 5IM0B 2OPRB 3Q89A 2PFDA 4DBQA 4C3KA 3MMBB 3R5GA 5KG6A 4AL5A 1U24A 2HW3A 1SJ1A 2DXFA 3S7RA 4ZJOA 2GX8A 3CMQA 2C2MB 5K5MA 1DRZA 3DLBA 1VBXA 2ZBQA 5LL6d 1APSA 4WBFA 1IJFB 1YJ9S 3FQKA 1GEHA 3VZHA 4ZVTB 5AXMA 5HVFA 3MFIA 4QIVA 2K1RB 1T11A 4DCJB 3M2VB 3GPAA 1X4AA 4RBVA 1R0AA 4RNOA 3FNNA 1BE4A 4AD6A 3DLGA 4ANCA 4ECZA 2JEJA 1H7WA 2Z2MA 3DLKA 4LSLA 3ENWA 2KT2A 3HLUA 1CJKB 4OYZA 3UWTA 3N0VA 2WHOA 4MKBA 4PXCA 3MR7A 1UWAA 4HDHA 3LUYA 4OV1A 4WIIA 5H9EJ 3TAMA 4ZPBA 1JNRB 3GJTB 2VJVA 2YBVA 1C0UB 4NLDA 3HD1A 3V4IB 2M5YA 3K5NA 1RT5A 1DLOB 2CZ9A 4LQ3A 2ROEA 1N0VC 5C42B 1PC4A 3PIPQ 2FYXA 3K5OA 3OTBA 1NPRA 3TA2A 3CDUA 3PW5A 1Z2LA 1YIJS 4KT0C 4ZOSA 2ASJA 4DUYF 1ZPWX 1SL2A 2PI5A 3AOCA 4RW4B 3TAQA 1T94A 3QT8A 3M32A 1FE0A 1TL1B 2GIRA 2ZH7A 3CC7S 1TFYA 4S0MA 1RTHB 2AZ3A 2Q79A 3AJDA 4O4GB 1CG2A 5EX3A 3VAKA 3W3SA 1PC5A 5J1EA 1U45A 2GJIA 2FHKA 3J80Y 1OPZA 3RB6A 3ENQA 1Q95G 3NMAA 1RA7A 1CJUA 4OHWA 1WI6A 1Q5YA 2VBWA 3PNIA 2KYZA 3V81B 2FLLA 3ZTQA 4Z2XA 3SFGA 1UP1A 1ZM9A 4JI8F 1NAQA 1I6JA 1QSSA 5CYQB 1JXEA 1YVFA 3TW0A 2XG8A 2ZM6J 4EGLA 3R2DJ 2X51A 3CVKA 4DPUA 4H54A 3VZIA 2I2YA 4DR7J 3P4UB 2CQ0A 3ZZPA 2CZVC 1KQFB 3CDWA 3EPGA 2NXJA 5AE1A 1ZM4A 4CLFA 1N5YA 1LK5A 1UVMA 2M70A 3ZFVA 3BSNA 4JI8J 4HTJA 2IBOA 3MEDA 1O5JA 2DRBA 1UEKA 1SJ3P 4Y0FA 2V69A 5LMUF 7FD1A 2L3MA 3PZPA 2G1HA 3Q8RB 1IBLF 2IJRA 1V9OA 5GADI 4YY3F 1XNQF 1P1LA 1RT3B 4CTAA 5B08A 1S9GA 2B4VA 4D3GA 3CCQS 1N36F 3G82B 4YMEA 5THWA 1GTHA 4I6WA 1NDCA 2VB6A 3W66A 1IBLJ 2Y3YA 4LF8F 1R8HA 1XEZA 4X2BA 1KLMB 2IJFA 1WHYA 3Q83A 3AJ1A 1B4SA 2W4CA 2VQFJ 3VGVA 4I6YA 1NJWA 2Z56B 4KQZA 4G6VB 1XNQJ 1PJ5A 3QSYB 5AJ3J 4LT6A 2OP5A 1N36J 2RMLA 3CPWR 2E1PA 2MJNA 1ZS6A 2V68A 2Y1LB 5HMZA 2CPFA 1X5PA 4ED8A 3M8PA 3FDSA 1S1WA 4FF2A 3I31A 5IC6B 2ZD1A 4ECXA 1LFWA 2XS5A 3KLVA 3WHIA 3JSBA 3HVTB 4JUZA 1JK9B 5IC4B 5CH7B 1IM4A 4YFUA 3QT6A 1KQSR 3OR1B 2DYAA 3KJQB 4RUHA 2CPXA 4Y2IA 5BYRA 1NK7A 4OI1A 1RYSA 4KHPF 5D0GA 2J0QD 1HD0A 3C6TB 2VPWB 4UQTA 1PKUA 2W8LA 2ZBIA 3OD2A 2HQFA 4R25A 1E6YA 3CJ3A 4Q2LA 4DL3A 1OY9A 4NLSA 2VICA 1FTCA 3HDSA 5GAEU 2VUGA 4NLGA 5IM0A 2OPRA 2OKQA 3N5FA 2VFRA 3SQGB 1RGVA 1L3KA 1V6HA 1OIAA 3A8IA 1S1VB 3D2WA 4ILMA 3FVYA 1M5PC 2HAIA 3OPKA 4ZCMA 2FLNA 1KHWA 3M8SA 2CPEA 3TQ1A 4U67Q 1TU0B 2Q43A 1NMEB 1J5EF 2FJDB 2MZTA 3EZOA 3BKFA 1D1UA 1N88A 4RR5A 2ZVSA 3PKMA 3AB2B 1SJFA 3PXGa 5L1LA 4DR1F 2FDNA 3TO8A 1XNRJ 2YPYA 2X1FA 2R7UA 1UFLA 2HWTA 4DR6J 1PIEA 2DK2A 4DSFA 3L4BC 1J5EJ 5HN0A 1EAYC 1IVZA 1S0OA 1KR4A 2OAUA 2CPHA 4CNYA 1EP4B 3DDKA 2PA3A 3HVAA 1B3TA 4NZ0A 3QLHB 4J5OA 5DDPC 2UV8A 1XMQF 4WP9A 2MLZA 4IRCA 1FXDA 1X9WA 3MMCB 4DR1J 4N7TA 1RLCL 2NLWA 2R7WA 2CQ2A 3TARA 2P5VA 3K59A 1RCXB 2FQQB 4I2QB 2Q1LA 5C42A 3KTQA 2E1MC 1KD1T 1URRA 4NCAA 1ZZNA 4QIEA 5K8NA 3I32A 3H5UA 1AFIA 2CADA 3PR4A 5U47A 4DUZF 2DNMA 3TVYA 3T3FA 2BE2A 3ZZZA 2VF3A 2DGOA 2W9BB 4CO5A 1Q53A 1UA1A 4RW4A 1Y3KA 4URGA 1TL1A 2FIUA 3OTOJ 4YR2A 1RTHA 4PQAA 4O4GA 2FGCA 2D3OR 3C19A 2C2KB 3DU5A 1LW0B 2N7CA 1JWWA 1GT8A 5DJBA 3OL7A 2KH9A 1HNWF 1VJQA 2KXNB 3V6HA 3T9ZA 3KLHB 5CYQA 5L1JA 4K0KF 1NDLA 1ROFA 2FY8A 2HWHA 2WSEC 3N4WA 4OZ2A 1NKBA 2QX0A 4CP5A 3CJ5A 4JV5F 5SUHA 1IJEB 4EK2A 2YWKA 1HNWJ 2KJVA 1VQKS 4PWUA 1B0TA 1FKPB 4K0KJ 3CB4A 2BJ9A 4KYZA 2L9WA 4WP3A 2QMUB 5KG7A 5KFEA 1IR0A 4ZLNA 4Y34A 1R8BA 2KZZA 1MNEA 4CM2A 1IR1A 1PAEX 1C4AA 4HHUA 3X3UA 4FYDA 5L38A 4TYBA 5ETKA 2OPSA 5LJ5Y 2BVZA 2DBBA 2YNGB 3WC0A 3I82A 1UWBB 1MN9A 2JEGA 1FNXH 4DR5F 3IR7B 4NRUA 1TELA 3EX7B 4ZLJA 4DPYA 1NLKL 1OJ4A 3DXSX 4EMDA 1A6LA 4M5IA 1KLMA 2R8JA 2W2NP 3I4HX 1PYSB 1D9DA 1RDRA 1XIQA 2ZOFA 2E5HA 3QRPA 3MUMP 2ILZA 4DR5J 3MM5A 3NOCA 3CCLS 5KT5A 1QD1A 1JLBB 2IVFB 4ZHRB 4BC9A 2RT3A 4JOUA 4QWEA 2IA0A 3KUGA 2PN6A 1QY7A 1W2BR 4JI2J 5C7PA 4DU8A 4TQSA 3HJVA 4PG4A 3QGHA 1ULRA 1HR0F 2NYIA 1TV6A 2AT1B 3SFUA 3HPOA 2RNEA 3HSZA 2H5EA 2P9CA 3DGPB 4B9UA 4CYUB 5JVGQ 4CH7A 3C6TA 1QJHA 2EC2A 1FNOA 5LXYA 2VH7A 1SC3B 1RAFB 1UMJA 4I4BA 4LF4J 3WDOA 1N5TA 1B0VA 3OXLA 3H4BA 3GFHA 1J27A 2AX1A 2E44A 3LWLA 2OTJS 2NPIA 2HHVA 4M94A 4RNNA 2ZWPA 3SQGA 4TKTA 5IT9Y 4C2MA 4U8VA 3DLJA 1RAJA 4IQXA 2R8HA 2GO9A 5HP1A 1S1VA 3VTIA 2IM0A 3MMJA 1TKDA 4N47A 4CLZA 2B8PA 1KFDA 1RT6A 3R5JB 2DHXA 3GIIA 1IKVA 4ID5A 1ACMB 5K9FA 1H3DA 1FT8A 5I3PA 2CZ4A 5KTQA 2MEWA 3IR5B 5H1SV 5HSPA 4L75A 3EWGA 3JAMY 1KTVA 1U0SA 1YRTA 1HBUB 1S4EA 1Q82T 1S4FA 1HW8A 2HHQA 3W9IA 2QA1A 2MZSA 3IS9A 2Y1IA 4YB1P 1DTTB 2XY7A 2ROGA 3W65A 5MAOA 1S9EB 3ONQA 3AA9A 3M2RA 2HHHJ 1WF0A 3CO0P 3MCOA 1EHWA 2QMXA 1S6OA 4FZVA 1YTYA 5CCMA 1TL3B 5F0UA 3JSRA 2QL5B 3PYEA 3GSIA 3TZYA 2MPUA 2AIRB 4NEYA 2MGZA 1Q0NA 4O3RA 3RAXA 2GHVC 1NKEA 1TKTB 2LEAA 1CC8A 5ETLA 3W8PA 4MKYA 4JI5F 2ZITA 2M52A 1F5CA 2XS7A 3CJ0A 4KGVB 4NLVA 4MKVA 3PJ9A 5KFZA 5IT4A 1HI8A 1IKXA 1Y00A 3OL8A 4UUXA 1WC0A 2VC1A 4MFBB 1IKWB 2VA2A 1AUDA 3MCSA 3VHQA 3V5RA 3GE9A 2RRBA 1HI0P 2RQMA 1QUVA 3EJMA 5LXRA 3JS9A 3ZNJ1 2B6AA 1RT7B 3UFCX 4NCGB 2M9KA 3M8WA 2FVRA 2VFSA 2ZKTA 2CQHA 3KLHA 4RW6B 2JFDA 2FUG9 3AA8A 1S49A 1H73A 2VD3A 1BC6A 4AUKA 4J9VA 1LOUA 1JLFB 5K14A 2AYEA 2RKIA 5BXIA 2CJXB 4DDFA 2F9DA 3R5AA 3J81Y 3UDLA 4NI2B 4ZLPA 3P3DA 1K44A 2IRYA 3VQSA 1ZAWA 1F5AA 1FKPA 3CJRA 4B9MA 2EK1A 5D77A 3HM9A 2A3JA 3ZTSA 1K47A 2MKHA 1TP7A 1HNXF 3SV4A 1S1XA 2NQPA 1B7YB 2KT5A 4KBIA 8RUCA 4C8LA 4C11A 3FFIA 3Q8PB 1X5SA 2J7WA 2OPPB 2HYIB 3KLEB 1H98A 2JVRA 1RTJA 3OQ2A 4XO0A 1M1KT 2XYPB 3JTNA 4NASA 1R43A 1RT1B 3CJ2A 2XWXA 1CJTB 4ZVGA 3Q0AA 1HNXJ 1YZ6A 2IJNA 1KVJA 1Y3JA 1OPIA 1WTBA 3MPYA 2V4JB 5GAHU 2W9AA 1YSJA 4Q5VA 5CYMB 4USIA 4B02A 2QYGA 3QFWA 2HPUA 3DRSB 1JLBA 5AE2A 3OLAA 3M6VA 1VC5A 4DU7A 2O01C 1RWXB 3MEGA 3J7YU 1G6BA 3M4XA 2EFQA 4QCLA 4Y2MA 3ZZOA 3N6LA 4DFKA 2CPDA 3N28A 1S1TB 2HZCA 1WEZA 3BO4A 1HHSA 3LANA 1VBZA 3MEEA 3HHNB 4M1KA 2N7YA 3QGGA 4G1IA 1NXIA 3BDEA 2FPHX 2AJ0A 1TVRA 1LWEA 3Q8VA 4IG0B 2IVMA 2JJ4D 2FZGB 1TAQA 4NLOA 5CYJA 1XN9A 2G0JA 5J2NA 3MGJA 4RNHA 2CWKA 1K73T 4XPCA 1LWCA 4F4XA 2KG1A 3ET6A 3KDOA 4KFBA 2N4CA 1LW2B 4PG6A 5F8LA 2FHJD 2FC9A 3GWCA 1U1NA 4M95A 2UVRA 1VGYA 3UE2A 4EBEA 2EFGA 3R9LA 4PQUB 1U8WA 2UXDJ 2ZH5A 3LP2B 4FF4A 6FD1A 4DV4F 4GC7A 1HBUA 2HQIA 5G0RB 3JSYA 1IWGA 1QAXA 2DR8A 4WCEQ 1KC8T 3RB3A 2ACMA 5FJ4A 3N9UC 4ZP8A 4EYHB 2AJFE 2G2OA 2L41A 2AEJA 2IA6A 3R8YA 4EYIB 2AD9A 2WB1D 4DV4J 4JI0J 2L9DA 1DBDA 3T6JA 2VU5A 1R8AA 2VFTA 2F63A 3IA0A 2DB1A 5K8PA 1FWPA 2R8KA 4ED3A 4LRBA 1TKTA 5A6PA 2RDJA 2HVZA 2AW0A 2ZHBA 5KFVA 4N41A 1XR7A 2CPJA 1KQKA 1XERA 4G1QB 1YJNS 2ZC3A 1LWXA 4MFBA 2MHNA 4NLWA 2GQCA 2B3TB 5HAOA 3EXCX 4WZQA 4OLOA 4Q2MA 5HATA 2J9CA 4C0BA 2UU9F 4UT4A 1RT2B 2DITA 4X4VA 1IBCB 1HQUA 4ED1A 1FESA 1U7LA 3D0IE 2ATCB 4IO1A 4RNMA 1KHVA 3T5KA 5C5JA 1JXVA 3BSOA 1N33F 4DJBA 3GB0A 4I7FB 3RB0A 3TI0A 2ZH9A 1JLFA 4NPOA 3KXDA 1SV5B 1Q78A 2ZEJA 3KOAA 5D8HB 3IG1A 1A9NB 2QGFB 1H2VZ 4C8NA 2CQ4A 2WK4A 2MLXA 2MSTA 4NI2A 3OHBA 3SMZA 1NO8A 2UXCJ 3BQ0A 4MYUA 2ZUAA 2ERRA 1AB8A 3MUVP 5ETVA 3ISZA 3R7BB 4M5GA 3VF0B 1UFKA 3NOGA 2D7SA 1HNIB 2D69A 4F3QA 4LF6F 1KRPA 3ENVA 4IQMA 1L3UA 2ROPA 2EKNA 5CZVA 2HNDA 2FY1A 2BACA 2YXLA 3OTCA 3OXGA 3CJTA 2EXUA 3HF5A 3NWRA 1TQLA 2EI5A 2OPPA 3PHTA 3KLEA 1MMDA 4J37A 1D9AA 2IMWP 4ETXA 1XC9A 3TA0A 5ETMA 3NS5A 2I9SA 1F5BA 3KLGA 4DL6A 1KVIA 2UVUA 4JYAF 1UKUA 3PTWA 2V4JA 2ZBPA 3BKTA 4GO7X 2UUCF 2Q3PA 2BA9A 5HQLA 3DU6A 4OZ5A 2XGPA 1RI7A 2V8GA 4DR4J 2X1GA 4J9RA 2BW2A 4ED0A 1E6VB 2XMKA 1VQYA 1IN0A 1YWXA 1FERA 3HHLA 3KUEA 2FB0A 1SUQB 3HT3A 3FMBA 2VDIA 1UA0A 4EU0A 3G6YA 2GGPB 3UW1A 4ETZA 2PT0A 4B3OB 2V8VA 2Z58B 4PEOA 3NCQA 2A6OA 2QJ3A 1S1TA 1JXLA 1B0PA 1N32J 5GMEA 1C1CB 1RAAB 3UO0A 3IN5A 4RWXA 5C2GA 1HWLA 4KRWA 2ZHOA 1HHQA 4P2FA 2V9KA 4ZMMA 1F6TA 2KB2A 2OPQB 1VHIA 4B3MF 1TAUA 1AT1B 2N82B 2W1BA 2LMIA 3AQOA 4LBIA 1XK8A 1MG7A 3O2IA 3B4MA 4GKJF 5GAEI 4ZCLA 2FVSA 5DGAA 1X9MA 5D3GA 4DLGA 1JKHB 3CCMS 4LRFA 5IQQA 3L95X 5E0OA 2XC9A 1FK9B 2JLFA 5HLFA 2RUGA 2XMTA 4HH0A 2MKJA 4HLBA 2BQRA 1FRIA 1LW2A 4IH6A 2RJZA 4A46A 4P2XA 4IOCQ 1PJ7A 4P2MA 3C16B 4GKJJ 4B9NA 4DSEA 2V8PA 2BV3A 4M8LA 1YQHA 5LMNJ 3HZEA 3BPSP 3CIZA 4ZP9A 5KFSA 1NJZA 5HVGA 4IO9Q 1SH0A 4K4WA 3AOBA 3M9OB 4CLPA 1FJCA 1GMVA 4FYVB 2J6SA 2WSCC 2YNIB 1GXUA 1YJVA 2UXBF 3QRRA 3Q86A 4WFYA 3R7NB 2HHPA 3CDAA 1WC4A 2MMYA 3ITHB 4OHYA 2CXEA 1SH2A 2XNRA 2F4VF 2OUGA 3BZQA 1S5ZA 4RUAA 4B3TJ 1R7IA 3CGIA 2BOPA 2LEBA 3N5BA 2XSJB 5IV4A 1KN6A 2UXBJ 3RBZA 5L39A 2WBRA 2ZE2B 2D3UA 2EFOA 1X4GA 3P96A 5HMXA 3GIRA 1PAUB 2ALZA 3RB4A 3JTPA 3BSAA 1ZA2B 1VQ8S 2F4VJ 1WG5A 1SB6A 4OI6A 2R7VA 2DEIA 2V63A 4IG3A 4ER8A 1X4FA 1VRQC 3LP1B 1T9VA 5F3TA 3M8RA 2I5JB 1FFWB 3HHEA 1URNA 2ZUGA 4DV3F 3Q8UA 5KFBA 3I0SA 1U47A 3IRXA 1WKKA 3CEDA 1RADB 1NK0A 3GONA 5D78A 4PG7A 3QGPA 3SV3A 3DRXA 3LW5C 1RT2A 1KVKA 4LRCA 2XB2D 3NLCA 4M5DB 1NSAA 5JVHQ 3M8QB 3EUNA 3JYTB 3R3TA 2YKPA 3T41A 3FCHA 4JI6F 3DMJB 4PWDA 3HVWA 5BJRA 3RW6A 1Q86T 4QIWD 2LLZA 1DZ5A 3BN4A 4LF5F 3QWUA 1WACA 4NCBA 2RIJA 4E2FB 2DGVA 3KJVA 1UVKA 2NXUA 2DGSA 4ZVHA 2HFVA 1YG0A 4G1PA 2CG4A 2H4YB 1GNKA 4V1Ak 1VQ6S 1HNIA 4FN5A 3CJ8A 4LF5J 4ES1A 4FVMA 1Q79A 3M8ZA 4L76A 1KBRA 5KFNA 2M88A 1MN7A 5KFAA 4LF9J 1Q8KA 2J0XA 1QAIA 1I3OB 4PUOB 3DHXA 1FF2A 3FEXB 4DR2J 4NMLA 2DY1A 3NGTA 4ITSA 3Q23A 2W2QP 5A0YA 3W2WA 1RHKB 5I4MA 4WIQA 5F8HA 2HS0A 3US5A 1WEYA 4HVZA 2W7PA 4L6V3 4F4AA 3J80U 2RRNA 4MJKA 2NUHA 4MYTA 3LPEA 4X84A 2V2KA 3A12A 2G4BA 1VCTA 5KFTA 1TUVA 3QQCD 2G9OA 4OI3A 3I6PA 3RBDA 2CVEA 1SUQA 2DISA 3FUYA 1SIWB 2YQ1A 2EFVA 1U1LA 5I42B 2XWYA 3IWNC 4B3OA 4TNOA 4AQYF 1T9TA 4P6QA 2G13A 2I8EA 2NCKL 1C1CA 4QYRA 2LYVA 1EETB 4DI6A 2C22A 4M5MA 3GG0A 2HHTA 1HBMB 1Q8BA 1C0TB 4NOHA 9ATCB 1IKYA 4LBHA 4IUFA 1L3SA 5B7WA 3CXCR 1QE1A 3QATA 2WZ1A 3TVZA 3M8YA 2NXCA 1NHVA 4MKAA 2HGNA 2OMOA 2MXYA 1VQ7S 3CCJS 4A4JA 2YWHA 5DS7A 4EEYA 1JLAB 2C2RA 3G2XA 3MM7B 4OZLA 1D9FA 5ETNA 4DV6F 5IWAJ 2IC3B 3FBFA 1FK9A 4OYBA 2J8AA 1HLWA 1O0PA 4R5PB 2QLJB 2NZ4A 3K8VA 4HL9A 4B9SA 1CJVB 2OFGX 5AXNA 1OSDA 3EZUA 2YNFB 4R0JA 3SCJE 2Y8YA 3CCUS 3ETMA 1U1KA 2ZDOA 4NLTA 3N01A 5SZTA 4QQBA 4WFNQ 4DZ6A 2CWXA 2V8HA 3G6ES 1AXQA 1H2TZ 2RAQA 3CJKA 3UQSA 3TR5A 5CA5A 1DTQB 3EVWA 4USMA 2C2OB 4DR3J 2DNNA 5BR8F 3W61A 5HMYA 3S1TA 3BGFA 2XHWA 1U0HB 4JV1A 2VDHA 2CPZA 1W26A 4O44A 2VL1A 3CJSA 1S7HA 1RWVB 3QZ8A 1JLEB 3U1MA 2B9WA 4Z37A 3QJLA 1R0BG 3HI9A 1FXLA 3V4MA 3VWSA 1U49A 4LFCF 2A2DA 1S99A 2YY3A 3RGIA 1LWFB 4RKUC 4W90B 2QL9B 2XSJA 4Q8EA 2DR6A 1H7XA 3F44A 3H5XA 1H74A 1DJ0A 3KG1A 2XEXA 1XBWA 3NGSA 4DV0F 3U7JA 3EGZA 5L46A 1RBLA 1G2EA 2W2MP 3RTVA 2PD1A 2Z2ZA 2MJUA 3OVSA 1JJHA 4ZVQB 3D5MA 2QC3A 4LFCJ 5A2QY 2E7XA 3LP1A 3Q8SB 2I5JA 5C24B 4BC7A 1CVJA 3HKWA 3OFFA 2V2ZA 2WSFC 2KN4A 2HHUA 5E5NA 5EDWA 2E66A 4ZDNA 2H3EB 4DV0J 3IGVA 1CPZA 1FE4A 1TL7A 5CQGA 2BYCA 3LO3A 2GMJA 2R7TA 4F4KA 2CNKB 2FJVA 3M8QA 4KGMA 4KHMA 4WPAA 2HLUA 3NGDA 4WKYA 1RTIA 5B0BA 4FP9A 1AYEA 3SYZA 3DMJA 1S57A 1BQNB 4NLRA 4QU7A 2GJFA 4KV8A 2QRRA 3K17A 3PG9A 3OR2B 1VOMA 2QTWA 1FJEB 4F3MA 4JI1F 4NYOA 3VGUA 3DOLB 5AT1B 3FCVA 3ELHA 2OEJA 1LK7A 4PCQA 5FDLB 2EVZA 4YS2A 4LF7J 4NWBA 1M5KC 1T7PA 1NH8A 3OLBA 1N34F 2EBEA 4C8MA 1WC3A 1S6PB 3I55S 3C14B 1HMVB 3IM8A 4C3LA 3KLFA 2H65B 3PO4A 2DR5A 1X4DA 2KU7A 1FXRA 4OI2A 4ECYA 3POTA 3ENAA 3DLLQ 4RBUA 2GFFA 1RA6A 1FRLA 3LALA 2K06A 2VPYB 1U2FA 3GV5B 1N48A 1V5IB 2G1DA 3I5AA 4X62J 1K0TA 4RW8B 1N34J 4EUVA 4ZVRB 5CABA 1NSKL 2LQJA 3A3NB 3AHPA 2FLPA 1SQFA 2H5JB 3QGIA 3R1HA 1LKZA 2EEYA 4ZS6A 1ICEB 2MDAA 1NK6A 2KM8C 4USKA 3DHWC 5GAHI 1NH7A 4WWSA 4OJ1A 4ANDA 3T5JA 5A8RB 3UNGC 2GIQA 4OZJA 5GVQA 1HNZF 2WVEA 4PZVA 3IO1A 2FZKB 1HWJA 2PC6A 4FKXA 3A13A 4X4SA 1R0CB 4C0OC 4M5LA 5HL7Q 4CO0A 4DL4A 3QJPA 3QT5A 2BDPA 3T6BA 3GJSB 3J7YI 5I42A 1P6TA 1Q7LB 1NJYA 1QDUB 4USHA 3CC4S 2F8MA 3EXYA 3I0RB 1ZPVA 4FS2A 4A8KA 3KHRA 2MZQA 1REVB 1SH3A 1P8GA 4UZCA 4U7UK 4V19J 3CJ4A 2LA6A 3GV8B 4KO0A 3D67A 4MAKA 3BM7A 3A8KA 2VG7A 2H9ZA 2KVIA 2XLJA 2RU9A 3FZ2A 2V4RA 1FKOB 1IBMF 3NEKA 3H0PA 5K8MA 2DXDA 4KKOB 1WHXA 2P6TA 4O3NA 3QWPA 2GVDB 4F26A 4H4KA 4DUTA 2HRTA 4Q43A 1U1PA 2UUAF 3U1LA 1P9QC 2DO0A 1UETA 5CCLA 3DRYA 3DRRA 2R7SA 4X65F 3CD7A 3OT9A 4CH1A 4NA1A 1S72S 3WX4A 4F3OA 1CLFA 2H48B 4OZ0A 3RBXA 3BBBA 5D0EA 2ASLA 1S77D 3SDEA 3VCDA 3CIMA 4K4TA 3FMWA 1X5TA 3IFEA 2J7UA 1Z2ZA 4OZ1A 1ZM2A 3G4SS 4H4OB 2HLTA 3PYFA 4N8OA 2GS8A 1QVGR 4A8FA 2LA4A 3FZBA 5BYQA 4X65J 3EM1A 2DH9A 2IRUA 2N3LA 2B9EA 2J9EA 4DMZA 1UW9A 3ZZ0A 1T9UA 4TY9A 1S1UB 4C8OA 1F3FA 2HFOA 2QN6B 1DTQA 2IDLA 1EX8A 3MD1A 4P52A 1RU1A 4IFYB 5C25B 1GK8A 1X4HA 4HTIA 3WIUA 3TP2A 2IVYA 4K4ZA 2B51A 3R7SB 4FXVA 1HBOA 1JLEA 1HPZA 4BDPA 3EGNA 4KH1B 2CJBA 4OZNA 2HVDA 3LOUA 4ECUA 2AEMA 1FJ7A 3K0JA 1LWFA 4P74A 4LMZA 3RZAA 3CE8A 4OYXA 4KPYA 4ZVFA 1WJ9A 1UZHA 1SJ4P 4OJGA 2KZMA 5AE3A 2ADBA 3WX8A 2HFSA 5B0DA 2M8DB 1RE1B 3ULHA 3BGOP 2GQ2A 3BKUA 4Q44A 1HARA 2BRKA 5IT9U 4OJ3A 4TVAB 3D3CJ 2AYBA 3TUIC 5KFOA 4I64A 3E3XA 4LR9A 2LVWA 4YN3B 2Y1JA 1VISA 2Z8QA 3BYRA 1FD2A 2MQLA 3C8YA 2N4DA 3BR9A 2JZ5A 1RHRB 2BKOA 3NS7B 4WU2A 2AF6A 1JLCB 2KXFA 1M5OC 4HEA9 4TU8A 3DCAA 2MQPA 3HULA 3EGWB 4DSKA 2DIVA 2IIHA 3D6TB 1YITS 2E7VA 4DFPA 5B0CA 4H4MB 2RQ4A 1FDNA 3GIJA 4G65A 1RBOB 1BQNA 1WKJA 2HS4A 2ZC4A 5I3UB 3VGSA 1CULB 4RUBA 2W9CB 4TN2A 4DV1F 2XSFA 4CT8A 2NR0A 3OR2A 3BS9A 1EKSA 5DDOC 2XY6A 4IFVA 2FC8A 1RT4B 1OY8A 5LSRA 2K8GA 1VS3A 3LPYA 3W2VB 4DX5A 4C6AA 3J7ZT 5FDLA 2W25A 3TQEA 2R42A 5EUHA 2XMUA 5EWFA 3CD5A 3MF5A 3K5PA 3D1QA 2B7CB 2HAFA 1YJWS 1NKCA 4AL6A 3KNAA 1BGXT 4DV1J 1U02A 4KH0B 4NXNF 2YQ0A 2KJWA 3OVBA 3BR8A 3CSKA 3C14A 1DARA 5KFIA 4WTYA 3UD3P 2MLYA 5F8IA 1NK5A 4MIWA 1JLGB 1XMOF 2VQEF 3PM9A 4MIAA 4YHHJ 1UL3A 4RNFA 3Q8YA 1IBKJ 2A2CA 4NX9A 1VC6A 3FRYA 4DG1A 1VFJA 3PACA 3D4JA 4RW8A 2RDDA 4TU9A 1VQ4S 4NXNJ 4P7VA 3M1VB 3OTDA 3CC2S 2XNQA 4XPEA 2XHCA 4CZCA 4DXLA 2C3UA 2BUNA 1XMBA 3MDFA 2KT3A 1XMOJ 1RP5A 1C2PA 2C3YA 4M5NA 3TANA 3H4DA 5CHCB 3LP0A 5DDRC 2DNQA 4W4MA 1H6KX 2HK2A 5HROB 5T7LB 4GRSA 3NGUA 2XLIA 2A10A 2JLEA 5LM7E 2JLGA 1TZ0A 3J81U 4Q0BA 2OSRA 2WB4A 1Q4RA 2RE1A 3MAAB 1J5OA 4ZPCA 3DN9A 2VIHA 3I0RA 2J6UA 3M30B 2YKQA 3KLIB 2WOMA 3MCNA 4RU9A 2Y0BB 4OHZA 3SCIE 2FJAB 1PSDA 1SKSA 4ZPAA 1KOOA 3KK3B 5B0EA 2DNYA 3TUPA 2UUBF 3L09A 1FKOA 1S10A 2CVIA 1W7WA 4JBCA 2FJEB 4RJVA 4CLWA 4KKOA 4KAIA 3B4DA 5AXLA 3EVMA 4QR1A 4PG5A 2GVDA 3A3PB 1TK5A 3LQVA 4FBUA 3BGUA 4U9RA 3FBEA 3LGHA 3N79A 2EW9A 3HFVA 4GVBB 4GO5X 2VG5A 2Z0GA 3W5ZA 4DQQA 4CDIA 4A8WA 3I87A 3ISNC 3IRWP 2C2ZB 4C48A 4PRFA 4DUYJ 2P9EA 2H51B 3P8BB 2BMBA 2RH3A 4H4OA 3AY0A 5A8WA 2YKNA 1RAEB 3NCRA 3DOMA 1T9YA 2F8EX 2WONB 5CD4A 2C2EA 3P45B 5KAKA 1S1UA 2IM2A 4NL5A 2HGLA 1YJUA 1HBNB 2BJ7A 1KS2A 1X60A 1MMNA 2KL8A 3CT9A 1S6QB 2YKMA 1FDAA 2GVZB 4ELUA 2BJDA 2JNJA 2QYCA 3BREA 4DPXA 1NBEB 1F0XA 3MECB 9RUBA 4CIOA 1YRUA 5DETA 3OBIA 3IC1A 3M9NB 3A4TA 3S8SA 5KFDA 4LREA 2ABYA 3JSMB 3NNCA 2CA9A 3M2UA 3SBMA 4W92B 3BGRB 4RBTA 3ZTOA 2X3GA 1OMSA 2J9DE 1WHVA 3VAMA 2Z57B 4X4QA 2XMMA 2M7SA 3MM6B 3WC2A 3MAHA 2K3IA 3EGVA 1HQ2A 5LMUJ 1SC6A 3F56A 3VGTA 3P5BP 5M2UA 3NY0A 2DH7A 3TZZA 4UOFA 4YY3J 1SQGA 2KG0A 2R3VA 4P7TA 4BBYA 4A8XA 3VAIA 2PMHA 1MROA 4FDFA 3H5YA 5J1NA 2ZHAA 5KFLA 3BQ1A 2POKA 3DOKB 2B8QA 4LF8J 1NHUA 2HHSA 3PW7A 1MU2B 1NCLA 2HNZB 5E33A 4K4VA 1CQMA 2FJXA 1N6QA 3MM9B 1I94F 4KGKA 4F04B 3AFGA 3U02A 4EO6A 2W2OP 4DLEA 1REGX 4XDCA 5I3UA 1CULA 3UCZP 3PEJA 5HANA 5J2MB 2W9CA 2DXEA 3QYYA 4Y6IA 3KMQA 1P27B 3KJFB 4WP8A 2E5GA 1AZSB 1UEVA 2CNNB 2KFNA 1U2RA 1EIYB 2AHOB 3VV2B 1X0PA 4FYYB 2BABA 1KLNA 3EVOA 3GIKA 5KG1A 2DHAA 4IDKB 1MMLA 3QMQA 5F9LA 2VBZA 3PHEA 3MMAB 3GQCA 4ZVEA 3MMBA 4KHPJ 3PFEA 4X4RA 5JXSA 1RHUB 2R7XA 2AZ1A 5E7OB 5A6WA 3R97A 2F7VA 3LWMA 2R9LA 2VG6B 2JX2A 4AL7A 2RU3A 3AXMA 4U8YA 3IXQA 2WVFA 4TLQA 1M90T 1NJIT 2K1RA 2OIHA 4X4TA 3N6NA 3M2VA 3M1VA 4OX9F 3BH6B 1X5OA 2HWIA 2R8GA 2W4DA 2E5LF 2MY7A 2HVEA 2CNLB 1VQMS 2E1CA 3THVA 1CJKA 5HROA 3GYGA 3CULA 3RG6A 3O5TB 4IR9A 1LXJA 3TJAA 1EARA 1MSWD 5F41A 5IS2A 2LFVA 4OX9J 3V2UC 5C2CA 2DPIA 3J7A1 2JVOA 5KG0A 4FF3A 4O23A 1VK8A 3Q8QB 3CF5Q 4WFAQ 1WF2A 1C0UA 3QIPB 2QO3A 3KLIA 3V4IA 2K7KA 1U09A 1DLOA 2MQQA 2RB7A 4LUBA 1FI4A 4DL7A 4ZLLA 4C97A 1RLDA 4OMFG 1D3WA 1N56A 1XMQJ 3ZZRA 2MY8A 4HI1A 4DV2F 3UPFA 3TA1A 2QZ8A 5LOQA 2HZAA 1G7CB 3A8JA 5J2QB 2BEFA 2DNZA 5KFJA 4NLYA 1Q7YT 1SC1B 4EZ6A 3FSYA 2ZJRQ 3QJJA 2U1AA 4LR8A 1WI8A 4Y65A 3HK2A 4PR6A 4RPFA 4UOCA 3LTOA 2HBQB 1BQMB 2KO1A 4E0DA 4DUZJ 1WWHA 3V81A 3FGVA 2B43A 3TNVA 2JEIA 3LF0A 2AGPA 4CCHA 1ZBTA 4BWMA 3I9V9 4F36A 1YJ7A 1FVQA 4GVLA 3D6MB 4WE1B 3MWBA 3I9ZA 3BBCA 3E01B 1VQPS 3PV8A 2MTLA 3U1NA 3W1YC 3GR0A 1S6QA 3GJRB 4ED7A 3H90A 4QW9A 2I1RA 2QLXA 2RVJA 1TK8A 2DNLA 4KJIA 1VIOA 4I0WA 1EQ0A 2KHDA 3L7OA 1EJ7L 1M5SA 2RF2B 2VODA 4PYDA 1XQIA 3UR3C 4JV5J 4OLPA 3DXBA 2XLKA 3OL9A 2D1CA 3JSMA 1RT3A 3ADAC 4U7UD 2IYGA 3KUHA 1CSJA 4YQWA 2NS1B 3CW2C 3G82A 3Q2SC 3NGRA 4KB7A 2LXFA 3MM6A 1VQNS 4I1TA 3MR3A 2CDQA 4UW2A 3UN2A 3PDNA 2Q66A 5A76A 3IMQJ 2LU1A 1QLNA 4ECTA 4ZP6A 4K4SA 5M2RA 4DX6A 3MTJA 3NNHA 4ZN3A 2BZ2A 2FTRA 1NSQA 4IOBA 3DLKB 4LSLB 1WSVA 4PXEA 2C3PA 2MKKA 2PI4A 2AGOA 3IAM9 1SQEA 2J0WA 2NPFA 4LBPA 1ELOA 4AFFA 4QJVA 2ZOGA 4LRDA 2DNOA 3RR8A 3R5BA 2BKNA 2OJ3A 4HHJA 3TAMB 4ZIWA 3HVTA 2XO6A 3KMSA 1M5HA 1VIXA 4GMKA 1JIHA 5EGYA 3QIDA 4UOHA 5JMNA 2QA2A 2GJ2A 3OR1A 1RT5B 1AZSA 1GQEA 3Q22A 3HD2A 8ATCB 5GMDA 3N6MA 4HDGA 4F67A 2B4UA 4K4UA 2VFUA 1NNDA 2C1EB 1RSCA 4IDKA 3GMGA 1VC0A 1OQ6A 1HR0J 1FFGB 1U2CA 3DFEA 4ED6A 4CRJA 2DGXA 3M32B 4B3SF 3MMAA 3LAMA 2R7RA 1GH8A 5KOXA 2J7KA 2F9JA 1SKUB 2DHGA 1CQNA 2Y8WA 3E2EA 5J1EB 2LDIA 3KG0A 2RS8A 4EWTA 5HJXA 3HVRA 3K2YA 3QO9B 2O1PA 4Y00A 2G2YA 2VG6A 4DL0C 1L5UA 2G0CA 1ZOTA 2ZOMA 3GLJA 1A7GE 2PSZA 4C3MA 4EZ9A 4DPOA 3NL0A 5H9FK 1RWMB 1NK4A 3BV8A 4M5HA 1G4CA 1ZA1B 2FVCA 3T19A 1F9FA 4PABA 1RWNB 2YPZA 3C66A 1K9MT 4RL1A 2CPYA 2AKWB 1N0UA 2YH0A 2J0SD 1PG5B 1VJWA 1N4LA 1EP4A 1GTEA 1FHTA 4USUA 2DTJA 3QLHA 2L48A 3MFHA 3W62A 3H20A 4K8RA 2EFNA 2DHHA 1Q5VA 4K5RA 3MMCA 2J5AA 4CTAB 1SI9A 2B9XA 5GAGU 3QIPA 1S9GB 3H2VE 3HXMA 2ZJPQ 1GMWA 1RWWB 4I2QA 5A8KB 1RKIA 1R27B 2RRAA 3GG1A 2I38A 1SL1A 4UY85 2QL7B 3OL6A 1RAIB 2XM3A 3AODA 2BJ1A 2GHWA 3EE3A 4OZ3A 2VKRA 2BRLA 3PKYA 2W9BA 3WIVA 3OUYB 1NDPA 1FWLA 5DM7Q 5DG8A 4R8UB 3M8PB 1WC6A 4KSEB 4JI5J 3PR5B 1BUXA 1LFPA 1X4BA 2ZD1B 3AJ2A 1D0EA 5K20B 2OLWA 4J9NA 1LW0A 2CDRB 4WXWA 3AXKA 2B4OA 1ZTTA 3BSCA 3F0NA 4Y3CA 3MOJB 2FD2A 1V3SA 4NZ7A 1S0VA 3QAUA 3B54A 2U2FA 4YDXA 1HWIA 2WCXA 3FQLA 1X7VA 1U6BA 1XR5A 2JRSA 1BMQB 2R8IA 1T8EA 3DGVA 1K1SA 1E6YB 3UD4P 3HMJG 5KFRA 4J9PA 2MZJA 4P71A 1WG1A 1J2VA 1F2HA 3GFXA 2CQBA 2HNYB 1UJ6A 2W8KA 1FRMA 2WBMA 1KNZA 1D8YA 2IRXA 1SCJB 2GMHA 1QAJA 3HFZB 3G6VA 4URSA 4LIRA 3CMES 5EWEA 1VQ9S 2DO4A 4V19X 2CAJA 1BLUA 2YNGA 1SC4B 3AT1B 1UWBA 1FCAA 1WF1A 4I68A 4OJHA 5LT5A 1EZZB 1C1BB 1LQ9A 2FVQA 1UVLA 5KT7A 4NLXA 5GMKa 3MHYA 1S12A 2NXEA 3NS6A 3KHLA 2HVHA 2CFXA 2FHJA 1KONA 2V5HG 3D9BA 2QG9B 3RAMA 2MHEA 4ZHRA 4DSIA 2OSQA 4F7VA 2OFHX 3H42A 3BH7B 4F25A 4HH1A 2GZOA 3O1LA 5D15A 2AP6A 1Y4ZB 3NRBA 4MH8A 3HT0A 3SIPB 2ZNZA 4QIGA 4DCOB 4EI2A 1NZ8A 1O51A 3CNQP 3HHDA 5KFFA 3RRKA 3DGPA 3T5LA 4CYUA 4DX8H 5KG5A 1X9SA 1KKHA 2ZFHA 1DQ8A 1WUUA 1PYOB 4DCPB 1EB0A 1OO0B 3CTRA 2BE2B 3AH6A 2CIMA 1KWMA 4ZPVR 2ZBCA 2ZM6F 1YHQS 3WZ0A 2PGCA 4DR7F 1F1BB 4YB5A 1TK0A 8AT1B 1DURA 1RACB 3UVJB 2DGWA 2VONA 5A2QU 1MW7A 3K89A 3JTOA 3QO9A 1R6YA 4PPDA 5KFPA 3PIOQ 1AA1B 3M05A 4TYAA 2G2ZA 3BJYA 3O44A 4ZPTR 4IR1A 1RWUA 2OEMA 4URQU 4J7CA 7AT1B 4UY8T 4AXJA 2XQCA 2R2UA 3HHLC 3UN5A 3NGKA 4ED2A 4X4OA 4J9LA 1SVDA 1KTQA 3C6UB 1IUJA 3ILOA 5IV3A 4EBDA 5CZXA 4DF8A 3S6EA 4DX7A 2WRMA 4J9SA 2JDJA 1DTTA 3NAIA 1S9EA 4MMOA 1FRJA 1JLQB 2VQFF 4A8MP 4L3NA 4YB6A 1TL3A 2YX1A 4QBUA 4PYAA 5AJ3F 2HQCA 2QSWA 2YQ3A 4K5SA 1P1TA 5CAAA 2OPSB 2YWFA 5KFXA 5A8KA 3S01A 1I1GA 3BYPA 3B82A 2BANB 1RWKB 5DG9A 1N5SA 2BBEA 4OHXA 2VC0A 4EO8A 1PYTA 3OUYA 3W7BA 1IKWA 4XDDA 2GV1A 3E8OA 2IMOA 3B8HA 4MT1A 4K4XA 3PW4A 5DZ7A 4FYXB 3MM5B 2PMWA 1UAWA 2AJ2A 4R8UA 3CCES 5EN1A 3LGMA 1RU2A 2DNPA 5KFQA 2CJYB 3VAJA 4DV7F 1U26A 4YEAA 1RT7A 3MR6A 4NCGA 1C4CA 2HIQA 1JQGA 3B6BA 3CUNA 4RW6A 2YVSA 2LQ9A 3G87A 4QW8A 2YX4A 1R6VA 3AD8C 1TV6B 4OI4A 2UU9J 4ZK7M 2QIFA 1S0NA 2RUSA 4LVNP 4ECQA 4DV7J 3GCXP 1HWKA 5HI7A 4QWBA 4OX6A 2ZZMA 4KGXB 1N33J 1FEHA 2ASYA 4RW7B 3P5TL 4FBTA 2HNYA 2Q6BA 3SCKE 1G3OA 4O3SA 1KQGB 1RABB 4DEZA 4QPTA 4ZPWR 2YWWA 2CYYA 4PKDB 4Z7CA 3QSIA 3NG8A 1UJ4A 3CDEA 4WYWA 4I67A 4BWJA 5CXTA 2F8HA 4TQRA 3RRHA 5HP1B 1N5QA 4KGZB 1PILA 1XNRF 1DHMA 1WC1A 3TUJC 2O5DA 3OV7A 4LF6J 2ZJQQ 1RT1A 4DR6F 1RT6B 1CJTA 1YBUA 3BQ2A 1C1BA 1NEEA 1IKVB 4ID5B 2J6TA 2I6WA 1I51B 1ZYQA 4QR2A 5DDQC 2CJQA 3GILA 1WSRA 4WU3A 2WVBA 5KFHA 4OHVA 4CWBA 5EHHA 3W9HA 5CYMA 1RTZA 4DQSA 2AEFA 3DLEB 2O3DA 4QWDA 3NNAA 3UI3A 2VFVA 3DRSA 2AU0A 4P9SA 3IS9B 4FPIA 5ETTA 2XCAA 1JJCB 3BEGB 3I5BA 3ZZYA 4JYAJ 1RAOA 3M2RB 4KTQA 2UUCJ 2RD5C 2YX7A 3G71S 3AD9C 1NDKA 1VYAA 2OEKA 1FFSB 3V6DB 4ALZA 1SJRA 2VV5A 1EQMA 2V67A 3OTOF 4AYBD 2AJ4A 2MGZB 5F8GA 2Z30B 3K58A 3KHGA 2ZH2A 4N77A 5HQMA 3L9ZA 4FF1A 4BCAA 2ZKUA 4F2SA 4CI0B 1VR6A 1UEUA 4HYKA 1YBTA 4OL8A 4IG0A 1IXKA 1IKXB 4ELVA 3TUZC 2ZZTA 1BWVA 1S9FA 4WFZA 1MWQA 2J76E 1SKRA 3W63A 3ISND 4F2RA 1RK8A 1X0FA 1HWUA 4PWWA 4USWA 3UVJA 2X7IA 3QT7A 2E7WA 4DOZA 3R5DA 2B6AB 3KHHA 4B3MJ 2JEFA 3GP9A 2AWZA 3OJUA 4WFXA 3FSXA 4YOEA 1VQSA 1DY3A 1T03B 3D28A 2XCPA 4N56A 4PQUA 3MPVA 2B7BB 3BGLA 1Y5LB 5K14B 5FIIA 5KT3A 3LP2A 2RKIB 3L7UA 1W2IA 4QYZK 3HKZD 2J9DA 4P73A 3D0HE 4P72A 2HHWA 4N8NA 3C6UA 3RJMB 1QUPA 2D74B 2Z2LA 5G0RA 3OFHA 2HFUA 1FDBA 2K2PA 2W24A 2MSSA 4WXOA 1U25A 3OTEA 1H72C 1T0TV 1S1XB 1JLQA 2EG1A 2LQ8A 2WW4A 1HI1A 2QA4G 3KNGA 4C11B 3FFIB 1T05B 1T3OA 3EZ5A 1JMTA 2RQCA 1RTJB 5B0GA 3CD0A 3HZGA 1S79A 4FS1A 2DH8A 3TRGA 1FRHA 3GTYX 2BANA 1UJ5A 4A47A 4C8KA 3G86A 4J9OA 4B3RF 3TZXA 2MKCA 4JI2F 5HMWA 4OYIA 3KK2B 4FNIA 3IP0A 4G1QA 3QNWB 3HX9A 2F3JA 3H59A 5DQGA 4C8YA 4IOAQ 4U95A 2PEHA 1VBKA 1VDHA 2V2VA 3HJFA 3MM8B 4CLYA 5I3QA 3MEGB 3U27A 2OI2A 1PGZA 4B3RJ 2B4PA 3BO3A 3D6HB 3RU0A 4DV3J 1HQEB 3C15B 5CD4H 1WC5A 2VHGA 4I7FA 4LF4F 2BQ3A 3IBCB 2DT9A 2HBZB 3PEHA 2DGQA 1SV5A 3V6JA 2WW8A 1F2GA 4HHHA 3FEYB 4OX8A 4OYPA 3EYZA 5FLXY 3MEEB 3M7VA 2KYXA 2V34A 1Q1KA 1R8PA 1TVRB 1OS5A 2FZCB 1LWEB 2RSQA 3KKFA 2IAJB 4P2SA 4JI6J 4RW7A 4RLEA 3B78A 2DJWA 5J2NB 3HHKA 3NCPA 2GNKA 3DI6B 3CDBA 2XYHB 2KRRA 3KG4A 4JI4F 1LWCB 2BR0A 4PXDA 3ET6B 3HCXA 1YJTA 4KFBB 4A8SA 1ZAXA 3PRDA 3IR6B 3SSSA 2BKPA 2M8HA 2SXLA 2P2CB 2YWEA 1NPKA 4J9MA 6AT1B 1U4BA 1RXOB 4W98A 3BDPA 1U1MA 3G9CA 1L3TA 3FCWA 2CQPA 1HIYA 2HHHF 3WQPA 4LJMA 4JI4J 1UW4A 2DEJA 4ZJQA 4QOTA 3I5CA 5DQIA 5E3QA 1TMMA 3MR5A 1RQ0A 4DS4A 3T5HA 3DLEA 4JV0A 1PJ6A 4ZJLA 1E6VA 4NZ6A 4O3PA 4HACB 2R2SA 1HL6A 4MK9A 2M3DA 5D4PA 4ES2A 2B9YA 2ZNYA 4F0KA 4HT7A 4MTPA 4NE9C 4OV6A 1TUWA 2IM3A 1FTRA 2EG2A 4ZVOB 2GGPA 2HG4A 1M0SA 1DQ9A 4KPCA 3MAQA 3D3BJ 2R7OA 1NJXA 3V6DA 2VZ9A 2E9RX 2CQDA 4BS2A 2JSXA 3T1YF 1YZ7A 3HO1A 4E8UA 5KG3A 4FVCA 2HBRB 2KHCA 4HR2A 3G96A 5AXKA 5HO4A 5F8NA 2OPQA 2OH2A 5ETOA 4WK1A 3PX4A 5IZHA 3D54A 2VOPA 1HA1A 4AQYJ 5B0AA 4EFAC 2KRBA 4UTGA 4NXMF 4ILLA 2A18A 3T1YJ 1WD6A 3W8GA 5T41A 5KFCA 3H2LA 1JKHA 2EBGA 2VKZG 1T95A 2ZH4A 4YR0A 1WKLA 5KT2A 3RRGA 4FXWA 1HQUB 4WYLA 1H0HB 1JJ2R 1VLOA 2EFPA 3OHAA 2NSCA 4LSNB 3IWXA 4O0NA 6FDRA 4NXMJ 1T03A 4XTTA 2DY9A 1NZAA 3C16A 4C7QA 2GHPA 2O67A 4DV6J 2Z4PA 4WZMA 2PDAA 3GV7B 1D09B 1UZDA 3MPUB 4GKKF 2E5JA 4ZP7A 2I0XA 3EMTA 5ADZA 4F4ZA 4JI7F 3IG1B 4JI3F 1KSPA 2LECA 4JV2A 5LJ3Y 1GMWD 2DNKA 4C8ZA 3P49B 3K5LA 2YNIA 2AYGA 2P6SA 1WELA 5KFUA 3I56S 3T9NA 3PJWA 2MYFA 3FBBA 3C2PA 4GKKJ 2IPOB 3ITHA 4JI7J 3QFHA 4USTA 2PFFB 3F41A 4B08A 4JI3J 4I56A 4OYMA 3TYTA 2HNDB 3HSGA 1WHWA 1V3RA 2JFKA 2YH1A 3J7AN 3EICA 3QZ7A 1WORA 5E3RA 1S59A 5BR8J 1T05A 2M2BA 2H4WB 4L72B 5GAGI 4MK8A 1OQ3A 4XK8C 1QVFR 2XI2A 2ZE2A 1RUSA 5BYSA 4H4KC 1R3NA 3ZTPA 2YNHB 5D0RA 4L73A 4RX6A 3KLGB 4OFZA 5KFMA 4DV5F 2V8DA 1ZETA 3V6KA 2W4PA 1KOHA 3ETOA 2E29A 3MUTP 3M9MB 3KK2A 3NXZA 4J90A 1R89A 4FPRA 1OSCA 3FRZA 3A8EA 3NP5A 1NUEA 4O4RA 3DYAB 5B09A 5E3AA 3HHLB 1M1GA 4DV5J 3MM8A 4M5DA 3FC9A 4DFJA 4YB7A 2KI2A 2V2QA 1AW0A 3JYTA 1L3VA 2KDOA 1YDLA 3OSNA 1RJJA 3PO5A 1UPPA 2C2DA 1HQEA 1BHNA 2F40A 3C15A 1K1QA 5H9EK 2RHQB 1Q8IA 5F8MA 2HRUA 4DSLA 2XS2A 3GZ7A 4IRDA 2RDIA 2F1FA 1M5VC 4G3IA 2FHOB 3LAKA 2IAJA 4IKAA 4UF4A 3J81j 1QSYA 3TEGA 4DN9A 1U8SA 5D3GB 3RYLA 5G4DA 2UXDF 2MKSA 1VHFA 3SCLE 2HK3A 3DI6A 1S48A 5HLFB 1B64A 2XTJP 4JI1J 4XAKA 2GAGC 5HVHA 4PUOA 1FRXA 3R5CA 2NYHA 4M5KA 1YLXA 2EWHA 3VVTA 1GXLA 2E9ZA 2CQ3A 2HFNA 3JB9k 4DQIA 2XULA 1P9YA 1RAHB 4EBCA 4K50A 4OIXA 2DRDA 2D9PA 4ILRA 5LSOA 4DWIA 2APOA 1V3ZA 1WEXA 4JI0F 1VRUB 3PVXA 2DR9A 4ZPDA 2KTQA 2AQ4A 3ZZTA 3UR0A 3Q24A 5F9NA 3A1YG 1Y10A 4HACA 1GAOA 3AB4B 1TKZB 4CLUA 5J2PB 2D3O1 2MZRA 1TL5A 1YGYA 3AOAA 3QBCA 1IM6A 1AROP 4CNZA 2DNRA 3GFZA 4WK3A 1S76D 2HKEA 2P9GA 1NB2A 5KFWA 1HNZJ 2E1RA 4K59A 2R2TA 3PCOB 3UDCA 2CKWA 3MD3A 2UVVA 4YUDA 4RUCA 1EETA 4B17A 4A48A 1G1XA 1HBMA 3MCMA 3UCGA 2Y9HA 1C0TA 4F02A 3D68A 1DFDA 1O8BA 5L9NA 4OQJA 4NEZA 2D9OA 4UQGA 4WFBQ 2GCFA 1HW9A 4IG3B 5L9XA 4JP8A 1HNVB 2DVIA 2AX0A 1SPBP 5DLFA 3AAWB 2FVPA 1JLAA 1HYSB 3I0SB 3MM7A 3T1HF 3EDQB 3IRXB 4U7CA 5F3ZA 2QLBB 2HGMA 2B56A 2IC3A 1PCAA 5E3PA 1GMUA 3UNYA 1TMJA 4Y2AA 1UFWA 4R5PA 4D3HA 3DKDA 5IFMA 4LF1A 1TL4A 3PRVA 1IBMJ 4LVOP 5HQ8A 4LSNA 2E1AA 1I5OB 5E41A 1WDTA 2FLOA 1CJVA 2UXCF 1S7IA 2F5GA 4K2JA 4UZBA 2XZTB 2YNFA 1VK3A 4USVA 3CMAS 2UUAJ 3T1HJ 4PWDB 1FJGF 2OMLA 2QLFB 3KDNA 4Q45A 5H9FJ 2XMJA 1YI2S 2HHXA 1CS4B 2CJKA 3I4PA 2MB0B 2IM1A 2GMLA 3K8WA 1WTFA 2QA4S 3KJVB 1FKAF 5ETPA 4F0HA 4AXIA 3G6XA 3GFYA 1T3NA 4F8RA 2DNGA 1RHJB 1U0HA 2V50A 1FJGJ 4F4WA 2FJBB 4KY3A 1YRXA 4M5JA 4C98A 5IOLA 3G8SA 1T9XA 3IAS9 3C46A 2WVCA 2RHSB 2LXUA 2BOAA 2C3OA 3HSJA 5ETQA 3EDRB 1NK9A 4DR4F 3MI7X 2XBPA 4A8OA 2AJ1A 4NA2A 2YNHA 1T02A 4I6AA 5A0YB 3R2CJ 3W2WB 4E98A 3O6QA 2BJEA 1NSPA 5C24A 4I2PB 3IBWA 3KFWX 4X66F 1MWYA 3MPWA 2ZBRA 3KK1B 2NSBA 2AYMA 3BPDA 2OHDA 5DM6Q 2QE5A 4RZRA 4GC6A 5E2QA 1N32F 4KIAA 3TZWA 4DPWA 2GA7A 3DYAA 4N5SA 2EPIA 2DR7A 1N54B 1CBKA 1RISA 2MQ8A 4QZVB 2GO8A 2OO4A 2RS2A 1PBUA 2V6AA 4J9KA 1QM9A 2V9WA 5KG4A 2MZ1A 4X66J 3FEZA 3RAQA 2ZH8A 5KT6A 5L8RC 1U48A 3D7SB 4O3OA 4B9TA 2C2NA 4QU6A 4CQ1A 2CRLA 3JQKA 2HZVA 2BX6A 4KC5A 2LKZA 3GIMA 3FJ2A 1IKYB 2F4FA 3DOLA 3DDIA 2X1AA 1QE1B 1VLYA 2B0GA 4WTOB 3CCTA 5J1PA 4JB8B 3DM2B 5D4OA 1R31A 2NXNA 3THTA 1SXLA 4QIFA 4CLTA 2L9NA 3H8YA 5LMNF 3ZXWA 1SBRA 1RWPB 3NAHA 3AQPA 1S6PA 3TEHB 4ATNA 1FDDA 4F50A 3IWLA 1HMVA 2GAHC 1UPMB 1XTZA 1F60B 2MKYA 4MIBA 2HVIA 1Y11A 3VVUA 2CNOB 3BN7A 2LCWA 3HHLD 4ZKAA 3TJ9A 5E3CA 1ZM3A 3VALA 4ZITA 2VOOA 2EC0A 3L3CA 2BM1A 1NB7A 1NRKA 2H1YA 2HS3A 1O6XA 3CJKB 1TR0A 2XMAA 1V5VA 4KR0B 5M2PA 4ES3A 4CM0A 2VQEJ 5A8RA 1VRUA 4B3TF 3TX8A 5L1KA 5ITHA 1WOOA 2LEPA 4ZIVA 2BXJA 3ZZUA 1ZH5A 1FD8A 1LNQA 3M6XA 2HRYA 4ZN1A 2BE9B 2O66A 2Q6CA 4ELTA 4DN0A 2ZH6A 3GR1A 1TKZA 5J2PA 4O44B 1T9WA 3AD7C 3JQJA 2ALYB 2QFJA 2K7JA 4P10A 1IQZA 1X4CA 3SQOP 3BB5A 1U1RA 1VQ5S 1OY6A 4AE5A 5GADU 2YWGA 1BXNA 2D41A 4PPZA 2HEKA 3Q2TC 3D1HA 1REVA 3D66A 1W25A 4ID8A 4LF2A 2MQOA 2OELA 4J9UE 4LR7A 4ECWA 1WDDA 4J9QA 1AUSL 1YKWA 3CO9A 3NKYA 4DHVA 3ICLA 2LP4A 3TX0A 3TVKA 1HNVA 2IBKA 3A3OB 4RW9B 2IHR1 5D0HA 5IXUA 2HURA 4C9DA 4CO3A 1HYSA 3MTKA 2QEXS 3OFEA 3C3LA 5L1IA 5F8JA 2UUBJ 3R1LA 1TL7B 2JOQA 4QWCA 1X4EA 1Y9OA 4RU2A 3GJQB 4ECSA 2M0GB 4OYWA 4PAAA 4TU7A 2X1BA 1GXTA 3W5YA 1JJ4A 1Y5NB 1RTIB 3NWGA 4U96A 1Y5IB 2ILYA 2A0FB 1JNZB 2DNHA 2LDYA 5EWGA 1RWOB 3G8TA 4ZCKA 2CJAA 3M6WA 4KV8B 1CS4A 2E5IA 2C28A 2DPJA 3R6GB 3DC2A 4NRTA 4QWAA 4CO1A 4ICLB 1U6ZA 4MK7A 4IFYA 4LF9F 5C25A 3I96A 1GFWB 5D4NA 3M6UA 2W7AA 3PYGA 1X31C 2V4QA 1WOPA 4DR2F 2NZCA 1S97A 5ETRA 2W01A 2VBYA 1X8DA 1BWEA 3K7RA 2WTFA 2HIYA 2BE7D 2GIFA 2VPZB 1N5VA 1GX6A 2GQQA 3VQTA 2QLWA 1Q81T 2EK6A 2PE8A 4ANEA 3CWJA 4DSJA 4BHQA 3KLFB 2PMZD 4NLUA 3PX0A 1KFSA 1TKXB 3POTB 2VA3A 3EPIA 3CCWA 3D6FB 3WBZA 2UVWA 3CJQA 2ZZNA 3QAEA 1TUGB 3SZ2A 2Y1RI 1SIZA 2HQ3A 2ZDPA 1Y0HA 2C3MA 2UZAA 3PW0A 4LSZB 1N8RT 5RUBA 2CJ9A 3ZNUA 4A8QA 2ZH1A 2Y0SD 4I2PA 2XZDB 1OYDA 2CQ1A 3KK1A 2QMWA 3CD6S 4KE5A 3KJNB 4X4UA 2VJUA 1JLCA 2HSEB 4WKRA 2BM0A 1HD1A 1VI7A 3ILJA 5DLGA 4NA3A 3ZC4A 4DZDA 4N76A 3K5MA 2JL9A 2DGTA 4ZVUB 4H4MA 2OD6A 4C0HA 2VASA 1UVNA 4M63A 4NYZA 2ZVIA 1FWKA 1NU4A 4NLQA 3ILIA 2UV8G 2GC8A 1RBAA 1Q16B 2L08A 5IWAF 1UVIA 4KO0B 2COLA 3CCZA 2E9TA 1RT4A 2VG7B 4LQ9A 3W2VA 1WNEA 1HKAA 3DM2A 2H54B 1I94J 2HQGA 4ZVSB 3H40A 4Y2KA 2UP1A 5JJBA 2X3DA 3BF4A 4RO0A 4I69A 1NK8A 2MKIA 1RKJA 3DRRB 1HHTP 4U6PA 1KP6A 4K2XA 5DRKA 1U1QA 1FO1A 5DGBA 1LEOA 3VAFA 1JLGA 1YBAA 4A8YA 1QTMA 5IQ6A 4L3KA 1FVSA 4CLKA 3SDEB 4QPXA 4DR3F 2CPIA 1RB0A 4ECVA 4CT9A 2DCLA 1CEZA 2A1BA 4WF9Q 1BD6A 4KHRA 3HFKA 1UVJA 3H7HB 2UUWA 4R0EA 1NHKL 2BW7A 1BQXA 3PX6A 3MEKA 1RHQB 1Z4UA 5B0FA 4QR0A 5T7LA 1NPPA 3PRBA 1M1HA 4CLSA 2JWNA 2K3KA 3OJSA 2XI3A 2R4FA 1HBOB 5KG2A 1HPZB 2HBYB 2R7QA 4Y28C 1ZTWA 3MAAA 1JB0C 1KDNA 2E5LJ 2OTLS 4CH0S 2LQBA 3DRPB 2BJ8A 4HI2A 2XZWA 2FJWA 3M30A 4TY8B 3OFGA 3SSQA 2RILA 2WVDA 5FD1A 1DQAA 4XIUA 1TTHB 4ECRA 2ADCA 2MQMA 3KK3A 2FHMA 1RTDB 2ZH3A 4ED5A 1WOSA 3FKBA 1MLAA 1CC7A 1LV5A 1OYEA 1R8CA 3SSRA 1FX2A 4RW9A 3UDEA 5DZ6A 1AFJA 3CCVS 2DIUA 3D0GE 3UDVA 1UCNA 2VBXA 4Q8FA 4YDDB 2LU2A 2AGQA 3O3LA 3ILLA 2QV6A 4DF4A 2B5JB 2OD4A 4GVBA 2DD8S 3FBCA 1RHMB 2KM8B 3LA0A 5DG7A 2YKAA 5HBMB 5T14A 4DV2J 3W60A 2LQ5A 2AMCB 3H2UB 2CG8A 2OGUA 4FXDA 4LF7F 3DDNA 2J8SA 2HMIB 2QT7A 2M4MA 4QYZJ 2WAQD 2WONA 5DO2A 4B9LA 1Z1ZA 1RAGB 1S6UA 5HK4A 4IFVB 1HBNA 1EKRA 1VRTB 2YTCA 1F3VA 4ICLA 3G8QA 2V94A 3RUBL 2XGQA 4ZA1A 3MR2A 3E51A 1UTAA 1ZAVA 4YP3A
chains in the Genus database with same CATH topology
1QAYA 4Q7AA 3M30B 3HHNB 4M1KA 3OTEA 2YKQA 1S1XB 1JLQA 2N7YA 3QGGA 3KLIB 2EG1A 2WOMA 4G1IA 3BDEA 4RU9A 2JC1A 4OI0A 2FPHX 7FDRA 1H2UX 4OHZA 3SCIE 4X62F 1HI1A 2AJ0A 2QA4G 1TVRA 2FJAB 1PSDA 1SKSA 4ZPAA 1KOOA 3KNGA 1LWEA 3MECA 4C11B 3FFIB 3KK3B 3NBPB 1T05B 5B0EA 2DNYA 4IG0B 1T3OA 3EZ5A 2UUBF 3L09A 2IVMA 2JJ4D 3TOQA 1JMTA 2RQCA 1VMBA 1FKOA 2JC0A 1S10A 2CVIA 5KFGA 1TAQA 4JBCA 1RTJB 4NLOA 5B0GA 2FJEB 2XY5A 5CYJA 1TKXA 4KKOA 2XMVA 3CD0A 1XN9A 4KAIA 5J2NA 3B4DA 3HZGA 1S79A 5AXLA 3MGJA 4FS1A 2DH8A 4QR1A 1SL0A 4PG5A 4RNHA 3TRGA 4X4NA 2VPXB 3BGRA 1TK5A 2DCUB 1FRHA 3LQVA 4FBUA 3BGUA 1K73T 4X4PA 4U9RA 2BANA 1UJ5A 4A47A 4XPCA 4DG1B 4C8KA 1JX4A 3G86A 1LWCA 4J9OA 4F4XA 3N79A 2KG1A 2EW9A 4Y2CA 2ATLA 4KFBA 2N4CA 2YKOA 2MKCA 4B3RF 4JI2F 3O8WA 5HMWA 1LW2B 4PG6A 3KK2B 4FNIA 2FHJD 5F8LA 1FRKA 4GO5X 2VG5A 2Z0GA 2FC9A 3GYNA 4G1QA 4DFMA 3GWCA 5LSLA 1U1NA 3HP6A 4M95A 4DQQA 2UVRA 3HX9A 2F3JA 1VGYA 3H59A 4A8WA 4LIWA 5DQGA 4ZCIA 4C8YA 4F4YA 3I87A 3UE2A 4EBEA 4IOAQ 1R0AB 2EFGA 3ISNC 5MLCV 4PQUB 4TXSA 3IRWP 3RW7A 1VBYA 2PEHA 4PRFA 3J7Z5 2ZH5A 3LP2B 3DLGB 4FF4A 2P9EA 1SKWA 3HJFA 3LP0B 2RH3A 3MM8B 4H4OA 5I3QA 3AY0A 2NUUG 5A8WA 6FD1A 2YKNA 2CQCA 3LGNA 3PW2A 1Q8LA 3MEGB 3U27A 2ASDA 1PGZA 4DV4F 2UUTA 3NCRA 3DOMA 2B4PA 2DHSA 2F8EX 3BO3A 2WONB 3CCRS 3UCUP 4GC7A 1HBUA 2HQIA 2C2EA 5G0RB 3GYXB 3RU0A 5KAKA 1HFEL 3JSYA 3DOKA 1HQEB 1S1UA 2IM2A 2JH3A 4NL5A 5CD4H 2HGLA 1YJUA 1QAXA 4I7FA 2DR8A 4LF4F 4Q0BB 4WCEQ 1HBNB 4IH5A 1KC8T 3RB3A 2BQ3A 3RBEA 1MU2A 2HNZA 2DT9A 1J5OB 5FJ4A 3PEHA 2DGQA 3N9UC 1SV5A 4ZP8A 4EYHB 3V6JA 3MM9A 1KS2A 2WW8A 1MMNA 1F2GA 2AJFE 3CT9A 1S6QB 3GSDA 3FEYB 2L41A 4OX8A 1OWXA 3OVAA 3EYZA 2YKMA 5FLXY 4DL5A 1U1OA 3MEEB 1FDAA 2IA6A 4EYIB 4ELUA 2KYXA 2AD9A 2HFZA 2WOMB 1FNMA 2WB1D 1Q1KA 2BJDA 1R8PA 5J2MA 1GX5A 2QYCA 3BREA 2KKHA 1TVRB 1DBDA 2L9DA 1F0XA 3T6JA 1OS5A 3MECB 1LWEB 2RSQA 3KKFA 1R8AA 2IAJB 4CIOA 3R27A 1YRUA 3L7PA 4P2SA 2VFTA 4RW7A 5DETA 3IA0A 3OBIA 4RLEA 3IC1A 3B78A 3M9NB 2DB1A 1Y7PA 1TFWA 3S8SA 5KFDA 5K8PA 3IGNA 1SJQA 2R8KA 2ABYA 4ED3A 2AJQA 2DJWA 3JSMB 1TKTA 5J2NB 5A6PA 3NNCA 3HHKA 2RDJA 2HVZA 5KFKA 3NCPA 3M2UA 2AW0A 4W92B 3BGRB 4LFBF 2ZHBA 2GNKA 3DI6B 4RBTA 1QSLA 3CDBA 1RYRA 2X3GA 2KRRA 5KFVA 3KG4A 2J9DE 1WHVA 3VAMA 4JI4F 1LWCB 1XWLA 2BR0A 4X4QA 2XMMA 2M7SA 3MM6B 1XR7A 4PXDA 3MAHA 2GW8A 2K3IA 1YJTA 2CPJA 4KFBB 4N41A 1KQKA 4A8SA 1ZAXA 4NYPA 1SC6A 1XERA 2VG5B 4G1QB 3PRDA 1YJNS 3RR7A 2RQKA 3IR6B 2ZC3A 4TLRA 3F56A 4MFBA 4O3QA 3SSSA 2MHNA 2M8HA 4DL2A 4IYQA 2SXLA 5M2UA 4NLWA 3KYLA 1XR6A 2GQCA 2YWEA 2B3TB 2DH7A 3LH2S 4J9MA 3EXCX 3OSPA 4WZQA 4OLOA 1U4BA 4Q2MA 3H5SA 2J9CA 4C0BA 3BDPA 2UU9F 1U1MA 3G9CA 2PA8D 1LXNA 1L3TA 2KG0A 4P7TA 1RT2B 2DITA 4LFAF 3D1OA 4BBYA 3TAPA 4A8XA 3VAIA 4X4VA 1HQUA 2CQPA 2PMHA 4PXBA 1FESA 4ED1A 1U7LA 2HHHF 5A8WB 2FGOA 4LJMA 4HKQA 1MROA 2YKNB 3D0IE 1IQTA 3H5YA 4IO1A 1UW4A 4RNMA 1KHVA 3T5KA 2IFXA 5C5JA 5J1NA 4USJC 2ZHAA 4QOTA 3I5CA 3PFOA 3BSOA 1N33F 5DQIA 4DJBA 5KFLA 3BQ1A 2POKA 5E3QA 3MR5A 1FEEA 3DOKB 3GB0A 1RQ0A 4DS4A 3T5HA 1NHUA 3DLEA 2HHSA 4I7FB 3RB0A 3TI0A 4JV0A 2ZH9A 1H38A 1E6VA 3PW7A 4NZ6A 1JLFA 4O3PA 4NPOA 1MU2B 2HNZB 1HL6A 4MK9A 5E33A 2R2SA 1N5YB 4K4VA 1CQMA 1K8AT 2FJXA 1N6QA 1SV5B 2M3DA 1Q78A 2V0NA 5D4PA 3MM9B 2B9YA 4ES2A 2KFZA 2ZNYA 3VAGA 1I94F 4KGKA 3DLHA 3U02A 1WG4A 3KOAA 5D8HB 1BY9A 3IG1A 3SEOA 2QSFA 4EO6A 1A9NB 2YKMB 1H2VZ 4HT7A 4MTPA 4C8NA 2CQ4A 4DLEA 3MEDB 2EKYA 4XDCA 2IM3A 2WK4A 2MSTA 1FTRA 4PG8A 5I3UA 2EG2A 3OHBA 3PEJA 3UCZP 2GGPA 5J2MB 3SMZA 1D8ZA 2W9CA 1NO8A 2HG4A 3QYYA 1M0SA 1DQ9A 2AV5A 4Y6IA 3KMQA 3BQ0A 1P27B 4MYUA 3MAQA 2E5GA 1UEVA 2R7OA 1NJXA 4ERDA 3V6DA 2VZ9A 2ERRA 3MUVP 5IT0A 2E9RX 3ISZA 2CQDA 4BS2A 2KFNA 3VF0B 2JSXA 3VR1A 1U2RA 3T1YF 2D7SA 3HO1A 1HNIB 1FA0A 4K4YA 4OX7A 4E8UA 4F3QA 1X0PA 2BQUA 4C4WA 4LF6F 2MQNA 1KRPA 3DRPA 2XO7A 3ENVA 2BABA 1KLNA 5KG3A 1VQLS 4IQMA 4DS5A 1N52B 4FVCA 2NREA 1L3UA 2KHCA 3THPA 4X64F 3GIKA 4TY8A 2ROPA 3M2UB 3G96A 5KG1A 3OW2R 5AXKA 5CZVA 5HO4A 5KFYA 2HNDA 2DHAA 3KWMA 2FY1A 5F8NA 2OPQA 4IDKB 2BACA 3OTCA 5D4LA 3OXGA 1MMLA 2OH2A 3HF5A 4WK1A 3QMQA 3PX4A 5IZHA 5F9LA 4CO4A 2VBZA 1TQLA 3D54A 3BO2A 1RTDA 3PHEA 3MMAB 3GQCA 2N3OA 2VOPA 1HA1A 2EI5A 2OPPA 5B0AA 4EFAC 4DQPA 3KLEA 4ZVEA 3MMBA 2KRBA 1MMDA 3PFEA 4NXMF 4J37A 4X4RA 2A18A 4ILLA 1D9AA 5JXSA 2IMWP 1WD6A 4ETXA 5F0WA 1XC9A 5KT4A 5T41A 2R7XA 5KFCA 3H2LA 1JKHA 2EBGA 4WJBA 3TA0A 3MOZA 2VKZG 1T95A 3NS5A 2ZH4A 5E7OB 3P6YC 4YR0A 5KT2A 1K0VA 2I9SA 3RRGA 1KEKA 1F5BA 3KLGA 5A6WA 4DL6A 2F7VA 1KVIA 3LWMA 5J2QA 4FXWA 2R9LA 2VG6B 2JX2A 4IH7A 2UVUA 4AL7A 1PO6A 1HQUB 4WYLA 2RU3A 1H0HB 4JYAF 1JJ2R 1UKUA 2V4JA 3IXQA 4GO7X 2EFPA 3OHAA 1MROB 2NSCA 2CQIA 2UUCF 2Q3PA 2BA9A 4LSNB 5EX0A 2B5JA 3IWXA 4TLQA 1M90T 4IRKA 1NJIT 1YJRA 2K1RA 3DU6A 2LXIA 2OIHA 4YR3A 4X4TA 2IYIA 4OZ5A 1DAXA 3N6NA 3NMRA 2XGPA 4HT5A 6FDRA 3M2VA 3M1VA 1RI7A 4OX9F 4FNHA 1S1WB 1T03A 2V8GA 4RWWA 1BQMA 1VQOS 3MZIA 3MXHP 1NZAA 3OXFA 1ZZFA 1MWZA 4C7QA 2X1GA 3H98A 4J9RA 2BW2A 2GHPA 2O67A 1X5OA 2HWIA 4ED0A 2R8GA 2JHEA 1E6VB 2W4DA 2XMKA 5HBMA 2E5LF 2Z4PA 4WZMA 1VQYA 2PDAA 2MY7A 1IN0A 1YWXA 1FERA 3GV7B 3MURP 1N6QB 4CO2A 3K57A 4GKKF 2E5JA 3HHLA 2I0XA 2PIIA 4ZP7A 2DGUA 5ADZA 4F4ZA 2DRAA 4JI7F 1VQMS 1S0MA 3PJXA 2E1CA 3THVA 2FB0A 1SUQB 2KXHA 3IG1B 3SXLA 3HT3A 4JI3F 3SI8A 2HMIA 5JUMA 5HROA 1B7FA 3FMBA 1KSPA 5KOWA 4UUWA 2ACYA 3CULA 2LECA 3O5TB 4JV2A 4IR9A 5LJ3Y 2XMWA 1LXJA 4EU0A 2DNKA 1UA0A 3G6YA 2GGPB 4C8ZA 3UW1A 3FSIA 4ETZA 4DQRA 2PT0A 3CCSS 4WE1A 5F41A 5IS2A 4B3OB 2V8VA 1MSWD 3PY8A 3P49B 3K5LA 2YNIA 2AYGA 2P6SA 3DNCA 1WELA 3NCQA 3V2UC 3T1AA 2D3ZA 5KFUA 3I56S 2DPIA 3T9NA 1VRTA 2KFYA 1S1TA 1JXLA 4O0IA 1B0PA 3E01A 3PJWA 2JVOA 3J7A1 5KG0A 2W7OA 2MYFA 4FF3A 1C1CB 3QPIA 4O23A 1VK8A 3Q8QB 3CF5Q 3F73A 3C2PA 3IN5A 4WFAQ 1WF2A 4B9VA 3X1LB 4RWXA 4YHHF 3H25A 3ITHA 1HWLA 4KRWA 2C42A 2PFFB 2ZHOA 1IBKF 1C0UA 3F41A 3QIPB 4B08A 4I56A 3TYTA 2V9KA 5D6GA 2QO3A 4ZMMA 3KLIA 2KB2A 2HNDB 3VAHA 2K7KA 3V4IA 1U09A 2OPQB 1WHWA 1U6FA 4NLPA 1V3RA 2JFKA 2YH1A 1DLOA 4B3MF 3QZ7A 1TAUA 2R2RA 2MQQA 2RB7A 4LUBA 5E3RA 2N82B 5DQHA 2PO4A 4DL7A 1T05A 3NBPA 2M2BA 5K8OA 2CQGA 2LMIA 2RF2A 3AQOA 5IM0B 4L72B 5GAGI 4MK8A 1OQ3A 1XK8A 2OPRB 4DBQA 4C3KA 4C97A 3MMBB 4XK8C 5KG6A 1QVFR 4OMFG 2XI2A 3O2IA 1D3WA 3B4MA 2ZE2A 1N56A 4GKJF 5GAEI 4ZCLA 2FVSA 5DGAA 1X9MA 5BYSA 4H4KC 4AL5A 1U24A 2HW3A 3ZZRA 1SJ1A 2MY8A 5D3GA 4DLGA 1JKHB 1R3NA 2YNHB 3CCMS 5IQQA 3S7RA 3L95X 4HI1A 5E0OA 2GX8A 3UPFA 4DV2F 2XC9A 3TA1A 4RX6A 3KLGB 2QZ8A 1FK9B 2JLFA 5K5MA 5HLFA 1G7CB 5J2QB 4OFZA 5KFMA 2RUGA 4DV5F 2XMTA 4HH0A 1DRZA 3DLBA 2DNZA 5KFJA 1VBXA 2MKJA 2V8DA 4NLYA 1ZETA 1Q7YT 3V6KA 4HLBA 2W4PA 2BQRA 4EZ6A 5LL6d 1KOHA 1APSA 3FSYA 1IJFB 1FRIA 1YJ9S 2ZJRQ 3ETOA 3FQKA 2E29A 3QJJA 3VZHA 5AXMA 3MUTP 2U1AA 3M9MB 1LW2A 3KK2A 4IH6A 2RJZA 1WI8A 4Y65A 3HK2A 3MFIA 4QIVA 4PR6A 2K1RB 4UOCA 4A46A 1R89A 3M2VB 4IOCQ 1X4AA 1BQMB 4FPRA 4RBVA 1R0AA 4RNOA 4B9NA 4DSEA 3FNNA 2BV3A 4M8LA 1OSCA 1YQHA 2KO1A 3FRZA 3A8EA 3NP5A 4E0DA 1WWHA 3V81A 3FGVA 2B43A 4O4RA 3HZEA 3DYAB 3DLGA 5B09A 3TNVA 4ECZA 2JEJA 3CIZA 5E3AA 3HHLB 4ZP9A 1H7WA 2Z2MA 3MM8A 4M5DA 2JEIA 4DFJA 4YB7A 2KI2A 3LF0A 5KFSA 3DLKA 4LSLA 3ENWA 2KT2A 3HLUA 1AW0A 2AGPA 3JYTA 4IO9Q 1NJZA 3UWTA 4CCHA 1ZBTA 1L3VA 3N0VA 2KDOA 1SH0A 3I9V9 4BWMA 1FVQA 4K4WA 2WHOA 3OSNA 3M9OB 4MKBA 1FJCA 1RJJA 2J6SA 4WE1B 4PXCA 3PO5A 3MWBA 2WSCC 3I9ZA 2C2DA 1HQEA 2F40A 2YNIB 1K1QA 1GXUA 1YJVA 2UXBF 4HDHA 3LUYA 3E01B 4WFYA 1VQPS 3PV8A 2HHPA 3CDAA 4OV1A 1Q8IA 5F8MA 3U1NA 2HRUA 3GR0A 4DSLA 1S6QA 4WIIA 3TAMA 5H9EJ 4ZPBA 1JNRB 2MMYA 3ITHB 4OHYA 2XS2A 1SH2A 4ED7A 2XNRA 4QW9A 2I1RA 1C0UB 2QLXA 4NLDA 2RVJA 1TK8A 2DNLA 3GZ7A 2F4VF 4KJIA 4IRDA 3V4IB 1VIOA 2RDIA 4I0WA 2F1FA 2M5YA 1M5VC 3BZQA 2KHDA 3K5NA 4G3IA 3L7OA 1RT5A 1DLOB 4LQ3A 2FHOB 4RUAA 2ROEA 1N0VC 3LAKA 1M5SA 1R7IA 2IAJA 3CGIA 5C42B 3N5BA 2RF2B 4IKAA 2LEBA 2BOPA 2VODA 1PC4A 3PIPQ 2XSJB 3K5OA 1KN6A 3OTBA 3UR3C 5L39A 4OLPA 1QSYA 3DXBA 2WBRA 3TA2A 3CDUA 2ZE2B 3PW5A 1Z2LA 2XLKA 4DN9A 1U8SA 3OL9A 2D3UA 2D1CA 1YIJS 2EFOA 5D3GB 3RYLA 4KT0C 3JSMA 5G4DA 1RT3A 1X4GA 4ZOSA 3P96A 5HMXA 2UXDF 2MKSA 2ASJA 1VHFA 4DUYF 2ALZA 3SCLE 3DI6A 1ZPWX 1S48A 2IYGA 3JTPA 1CSJA 4YQWA 3RB4A 2NS1B 5HLFB 1B64A 3BSAA 1SL2A 2PI5A 1VQ8S 3Q2SC 1WG5A 1SB6A 4OI6A 2R7VA 4KB7A 4RW4B 4XAKA 3TAQA 1T94A 4IG3A 2LXFA 3MM6A 1X4FA 1FE0A 3M32A 1VQNS 1TL1B 2GIRA 4I1TA 2ZH7A 3MR3A 2CDQA 3CC7S 1TFYA 4UW2A 3LP1B 1RTHB 5F3TA 2I5JB 3M8RA 2Q79A 3PDNA 4PUOA 3HHEA 2Q66A 4O4GB 1URNA 2ZUGA 1CG2A 1FRXA 4DV3F 5EX3A 5KFBA 3R5CA 3I0SA 2LU1A 3VAKA 2EWHA 1PC5A 1U47A 1QLNA 3W3SA 5J1EA 3IRXA 4ECTA 1U45A 4ZP6A 2GJIA 4K4SA 1GXLA 2FHKA 2CQ3A 2E9ZA 5M2RA 1OPZA 3CEDA 3J80Y 2HFNA 3RB6A 3JB9k 3ENQA 3NMAA 1RA7A 1NK0A 4OHWA 4DQIA 3MTJA 5D78A 2XULA 1WI6A