1HA1A

Hnrnp a1 (rbd1,2) from homo sapiens
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
173
structure length
167
Chain Sequence
EPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKVDGRVVEPKRAVSREAHLTVKKIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHNCEVRKAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HNRNP A1
publication title Crystal structure of the two RNA binding domains of human hnRNP A1 at 1.75 A resolution.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Nuclear protein
total genus 51
structure length 167
sequence length 173
ec nomenclature
pdb deposition date 1996-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1ha1A01
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1ha1A02
1U1MA 2AYEA 2MB0B 3MOJB 2KXHA 4LMZA 5CYJA 1H6KX 4Y0FA 2CQ1A 2KM8C 3K0JA 4PKDB 4WIIA 1U1QA 5GADU 1VQ6S 4TU7A 2QFJA 2DNPA 2RU3A 1VQLS 4WKRA 3G4SS 2U1AA 1N54B 4QQBA 1Q81T 1UFWA 2MYFA 2AD9A 2MZRA 4TU8A 2MSTA 3RW7A 4ZKAA 1YWXA 3IRWP 2DHXA 1YJ9S 2LEAA 2DGWA 4OZ1A 1YTYA 2D9PA 1KQSR 1WF2A 2HGMA 1VQ9S 2BZ2A 2UP1A 3Q2SC 5ITHA 3US5A 2WBRA 2E5IA 1H2VZ 1L3KA 2AYMA 1WG5A 1X4CA 1DHMA 2D9OA 5GVQA 5BJRA 2MQPA 2XS7A 2DISA 2CPXA 4RU2A 1WG4A 2YTCA 2RNEA 2G0CA 2LCWA 4FXVA 1XN9A 2LA4A 2HVZA 2DGXA 3S6EA 2DO4A 1U1LA 1HA1A 1NJIT 1VQ8S 2MQQA 3NNCA 2YH1A 2M0GB 1AUDA 4C7QA 1M1KT 2CQGA 2MJNA 1WELA 1O0PA 3J7ZT 2E5HA 2XNQA 4YOEA 2FC8A 2AYBA 2VONA 2JVOA 3FEYB 4PRFA 2DNQA 3OW2R 1H2TZ 4QPTA 2KU7A 4YB1P 3G8SA 3G9CA 5HO4A 5LJ5Y 2QEXS 3BEGB 3VAIA 1DRZA 2RT3A 3CC7S 5GAGU 5JVGQ 4FXWA 2DHSA 3SXLA 2XS5A 1U1OA 3MUTP 3L3CA 2DGVA 3HI9A 3N9UC 2DHGA 1JJ4A 3ULHA 5DM7Q 2NZ4A 2DNRA 2CJKA 2JVRA 1PGZA 3IWNC 3NNHA 5JVHQ 1S79A 3BO3A 2EK1A 1OPIA 2B0GA 3CC4S 2HGNA 5LXYA 2MXYA 2Q79A 3EGZA 1U2FA 2F3JA 2MKIA 2F9DA 2MQMA 1FHTA 2FC9A 4UQTA 1NO8A 4OZ0A 2DNHA 4WF9Q 2KH9A 1U1RA 1NU4A 2DH7A 2E44A 1K8AT 2KG1A 3G6ES 1P27B 2KYXA 1X4FA 2FY1A 4ED5A 2JX2A 2MY8A 2LMIA 3I55S 2MHNA 4BS2A 2FHOB 2VOPA 3D2WA 1N8RT 1SJQA 2MZQA 1B7FA 4WFBQ 5LJ3Y 3MXHP 3CUNA 5MLCV 1U1PA 2CPIA 1VQ5S 1JJHA 2CQ2A 1X4GA 3UCGA 3DXBA 4CIOA 2MPUA 5DDRC 3CXCR 3BO2A 1U1NA 4CQ1A 1M5PC 1CVJA 2M2BA 1WF1A 1X4HA 1RKJA 3VF0B 4IOAQ 2CPYA 4IOCQ 5D77A 2X1AA 2D3OR 1FNXH 1A7GE 2J8AA 3LPYA 1JJ2R 2KFYA 2DGSA 3SMZA 2CQPA 2K3KA 2DITA 2ZJQQ 2NLWA 2K8GA 2KN4A 1KOOA 3PIPQ 2CQ0A 2ZJRQ 4M5DB 3JB9k 2KRBA 2DNZA 4ERDA 2MZJA 3VAFA 2L41A 3CCLS 2I38A 1D9AA 1RK8A 2DGOA 1W2BR 4CH1A 2LEBA 4F26A 3CMAS 1VQ4S 2ZJPQ 2G4BA 2KT5A 3CCSS 2DH8A 3UD3P 1X5SA 2KXFA 2CPDA 4F25A 2MGZA 3MUVP 3UCZP 2M88A 3CD6S 1FJCA 2DK2A 1WEZA 1HD1A 2I2YA 2CQHA 3VAKA 1OIAA 3P49B 1G2EA 2KM8B 1N88A 1VQKS 4CH0S 2RS8A 2N7CA 2CPJA 2O3DA 2RRBA 5D78A 4WFAQ 2RUGA 5HL7Q 2KI2A 2FPHX 3SDEA 2N3LA 3CCMS 2LECA 2AYGA 2BOPA 2CQDA 2OTJS 3THTA 3G96A 4A8XA 2MZTA 2GHPA 5DDQC 1K9MT 2MZSA 2SXLA 1X0FA 1FT8A 2MGZB 3TO8A 2XNRA 1U6FA 4Z2XA 1VC6A 3CULA 1M5OC 2DHAA 1FXLA 2DH9A 3R1LA 4LJMA 2X1FA 2KVIA 2MQOA 1R8PA 1X4DA 2LQ5A 3ZZZA 3B4MA 5CA5A 3THPA 3NS5A 2KG0A 2RQ4A 3RW6A 2CPEA 1VC0A 5CXTA 2CQCA 3CTRA 3MDFA 3R27A 2CPZA 2N3OA 1YJWS 2CPFA 3EX7B 1U6BA 1A9NB 3MI7X 4W92B 1WWHA 3I56S 1VBZA 2LYVA 2LXUA 1M90T 2QA4S 1WF0A 2MZ1A 2A3JA 2XB2D 1JMTA 5GMKa 3ZZYA 4C0OC 1HL6A 2J0SD 3CCUS 2M52A 5H1SV 2RVJA 2DB1A 3P5TL 1QVFR 2MJUA 2RRAA 4WFNQ 2X1GA 4W90B 1VQNS 1WEXA 1WHWA 2OJ3A 1WG1A 1WEYA 1UP1A 2DNMA 2RS2A 3MD1A 3BO4A 4J5OA 1F9FA 1WHXA 2VOOA 2KXNB 1N52B 1YHQS 3FEXB 2DNLA 3HHNB 1ZZFA 2JRSA 3U1MA 3CCQS 2DIUA 5LSOA 2M8HA 2LA6A 1WI8A 3CCRS 3UWTA 4YUDA 5DDPC 3MUMP 1SJFA 2MMYA 3H2UB 4V19X 3U1LA 2MY7A 2M70A 1FJEB 1M5KC 3DLLQ 1X4BA 2CQ4A 1WHYA 1VC5A 4IUFA 3H2VE 1M5VC 1FO1A 5EN1A 4WCEQ 1KD1T 3EGNA 2MSSA 2EVZA 2HYIB 1X5TA 3G71S 3NMRA 2XSFA 2JWNA 3BS9A 3VALA 2GO9A 5GAHU 2E5GA 2PE8A 3CF5Q 1VQPS 1Q7YT 2G1DA 3CCVS 2M8DB 1WTBA 2M7SA 3UE2A 3Q2TC 1R8HA 2YH0A 2DNOA 2CQBA 1URNA 2DGQA 2HGLA 2MKSA 4F02A 2OSRA 2DIVA 2N82B 3PIOQ 3NS6A 1VQMS 2CPHA 1WI6A 3MURP 1X5PA 2ADCA 4PR6A 1X4AA 2OTLS 2PEHA 2LXIA 2XS2A 1OWXA 3B4DA 1IQTA 2EK6A 1FJ7A 2MKHA 2RQCA 2OIHA 5LSLA 4TLQA 3NNAA 1SXLA 4QU7A 3S01A 2V94A 4QU6A 2KHCA 5DM6Q 3V4MA 1D8ZA 1OO0B 3CCES 3CCJS 5DETA 1VBXA 1YI2S 2LKZA 1HD0A 2J0QD 3CMES 2M9KA 4UY8T 2DNYA 4U67Q 5IM0A 2F9JA 1VQ7S 3TYTA 2DNNA 1ZZNA 3MD3A 1Q82T 2OSQA 1YIJS 1DBDA 2CQIA 5IQQA 4TU9A 1SJ4P 3UCUP 4IO9Q 5FJ4A 5LXRA 1X4EA 2DO0A 3SDEB 2CQ3A 3UD4P 1U1KA 1P1TA 4EGLA 1VBYA 1X5OA 2ADBA 1Q86T 3G8TA 1PO6A 3VAGA 2DNGA 3P3DA 1QVGR 5GAEU 2E5JA 3R1HA 1SJRA 2ERRA 3S8SA 3J7YU 4Y00A 1KC8T 1VQOS 5IM0B 1BY9A 1UW4A 3VAMA 2MKJA 2DGTA 4P6QA 1YJNS 3CC2S 1SJ3P 2MKKA 4LIRA 2M4MA 2YWKA 1H2UX 1K73T 1KOHA 2MKCA 1WHVA 1S72S 2MQNA 1QM9A 2MQLA 5DDOC 2L9WA 3VAHA 2L08A 2DGUA 2HZCA 2KRRA 1DZ5A 1ZH5A 2VODA 3P6YC 1UAWA 2DNKA 3S7RA 2U2FA 3VAJA 3CPWR 5IFMA 2X1BA 1YITS 3LQVA 4C4WA 2J76E 2YKAA 3TP2A
chains in the Genus database with same CATH superfamily
3CO0P 4M5IA 1CULA 2UXBF 1VI7A 5HP1A 3M32A 1BD6A 1N54B 4BWMA 4NASA 4DQPA 1MMNA 5FLXU 3H59A 1R3NA 2XM3A 1IM6A 4A47A 2MLYA 4Y3CA 4FF2A 1VQ9S 3Q2SC 3US5A 1DTTA 4DMZA 1FJGJ 3DOLA 2D9OA 4O3PA 4QW9A 5A8WA 1N5SA 3CDEA 3ZFVA 1C0UA 3V4IB 4CDIA 1YGYA 4G3IA 1TMJA 4CO4A 4YHHJ 1QUVA 3R8YA 1O0PA 2ZUGA 2XNQA 2BXJA 3PXGa 3OW2R 2IVFB 3BN7A 3Q8VA 3RRGA 4CWBA 2AW0A 1U1OA 1RWUA 4PEOA 2NXNA 1VJWA 2R7UA 3ULHA 2QG9B 3PRBA 2A6OA 3RB6A 2KL8A 2WVBA 3ZZTA 4DV4J 1JIHA 3WQPA 3CJ5A 2HNZA 1JQGA 1KFDA 1M0SA 4OZ0A 3GCXP 3TQEA 1RDRA 4RW8B 2YX4A 3O5TB 1TTHB 2V4JB 2MHNA 2YNIB 4PAAA 4A8SA 1RHKB 1U0SA 3J7Z5 1P8GA 2HFZA 4TY8B 1FEHA 4PUOA 4HT5A 4Y2CA 3MEDA 4AXJA 3CJ0A 4ED4A 1VQYA 3SMZA 5B0AA 4XIUA 2NZCA 1AT1B 4F0KA 1KKHA 3ETOA 5I42A 4CZCA 1NCLA 2HHPA 2LEBA 2V0NA 1S10A 1RAGB 1ZYQA 2DH8A 1OQ3A 4F25A 4LBHA 3EZUA 3MUVP 1RTJB 3GU0A 3ZC4A 3MM7A 3A8IA 1WEZA 2BE7D 4HHUA 2EG1A 3TZWA 3VV2B 2BA9A 3QLHA 3HSDA 1HI1A 1ZBTA 4Q0BB 1QTNB 3J81U 5HQMA 2FJVA 2Y0BB 3GYXB 2AZ3A 2C2ZB 3QGGA 1U6FA 4JV5J 3OVSA 2HHQA 3PVXA 1Q79A 2RKIA 5G4DA 1HNVA 4OQJA 2DBBA 2BANA 3GONA 3THPA 3M8WA 2WSEC 3AT1B 3KHHA 3UD5A 4C3KA 4LR8A 2EG2A 1A9NB 3CJRA 3CCTA 1WWHA 4JB8B 3GIRA 4HACA 3ITHA 1WF0A 4ZP9A 6FD1A 5JMNA 4MIAA 5C2GA 1LW0A 5D15A 3DOKA 2B51A 9ATCB 1IBMJ 4IKAA 4XK8C 1X7VA 3BO4A 1FWLA 4ES2A 3OJUA 1RWVB 2HFNA 3RBZA 3L95X 1HPZB 3T5KA 4DV5J 2O66A 1D9DA 5EN1A 1KBRA 5F8LA 3MAHA 3KLVA 3I87A 4KH1B 3CF5Q 1WTBA 1VIXA 1GEHA 2DXDA 4ZP6A 4DL0C 1NLKL 1TU0B 1QJHA 1X5PA 3EDQB 3V6JA 3B4DA 3DLKB 3BPDA 4O44A 5HAOA 5HBMB 2O01C 1SXLA 3JAMU 1RT5A 2CRLA 3AJDA 2IRUA 3NGTA 3CCJS 5DETA 3NS7B 3CJQA 2DXEA 4F3MA 3A1YG 4KJIA 1GTEA 1DBDA 5FJ4A 2BW7A 2QLWA 1N32J 2KJVA 5IT0A 4AQYF 3EMTA 2L9DA 1T8EA 2WVCA 1VCTA 1UW4A 3VAMA 2EFPA 5KAKA 1WC3A 1WHVA 3C66A 3D5MA 1Z2LA 4Y2AA 2NPFA 3GPAA 3NG8A 4LMZA 1WORA 1RUSA 3SV3A 1XMQJ 4U7UK 2DNPA 4NYOA 1UFKA 2QLFB 2QJ3A 3OTOJ 4RUCA 2AD9A 2QIFA 4RNHA 5DLGA 3PR4A 3RW7A 1Q5YA 3I82A 1YJ9S 2BM0A 2DGWA 2C2NA 1UJ6A 2BE9B 3H8YA 2R8GA 2C3UA 5F9NA 1R0AB 3H5YA 3C3LA 2RNEA 3SQGA 3CT9A 1NPRA 2QFIA 1HNIA 4LRBA 5KOWA 3HJFA 3CEDA 2YPYA 4YDXA 2Z2LA 2YH1A 1AUDA 1MROA 2VPZB 2ZHAA 2YWHA 4O23A 2DNQA 3MMAA 3GZ7A 2R4FA 3W9IA 5KFFA 5IWAJ 3DRXA 3CC7S 1YX2A 3LF0A 4C11A 3Q8SB 3X1LB 2DGVA 2KJWA 2NZ4A 2EBGA 1HFEL 3HVAA 5EWGA 4Q7AA 1GMUA 5HLFA 1WOSA 1IJFB 2HGNA 2OD4A 2PI5A 2Y3YA 4ALZA 4FDFA 1PSDA 5CD4A 1W25A 4I7FB 4URSA 1RBAA 4JI6F 4FS1A 2HZAA 1CQNA 1K8AT 4MJKA 4OLPA 2KG1A 1C4CA 2R3VA 2KYXA 2QMUB 1S49A 2MY8A 1XR7A 3IGNA 5LMNF 3QFHA 2W1BA 1KDNA 5D6GA 1UVMA 4LRDA 4EBDA 1CVJA 2YNFA 2WOMA 1LXNA 4Y2MA 4G1QA 5HANA 1FNXH 3OHBA 3BJYA 1FX2A 2CQPA 5G0RA 3RJMB 4X4OA 1Q7LB 3QFWA 4EYHB 4Y6IA 2CJXB 3VAFA 1IKVB 3PJ9A 1N34J 1Y7PA 4J9KA 1ROFA 3SSRA 4DSJA 4DR3J 3CMAS 4PCQA 1OY9A 1IR1A 1X5SA 4CLTA 1VHIA 5H9FK 4DL5A 4KIAA 4JBCA 1GTHA 3WC2A 1ITPA 1HKAA 2EI5A 4CH0S 2CPJA 5BR8J 1RTHB 5D78A 1VRUA 3N4WA 1RYRA 2VFUA 4XTTA 4UUXA 3TEGA 2N3LA 2AYGA 2MDAA 4E0DA 2SXLA 2HAFA 3CIMA 1U02A 4HLBA 1S6UA 4UT4A 4M94A 2CWKA 1FXDA 3T5JA 5B0FA 3CTRA 5KFLA 3R27A 3NKYA 3R5AA 5LT5A 2LYVA 1M90T 1VYAA 5AE2A 4YDDB 5A8KA 4LF9J 1UVNA 2XB2D 4DL2A 3PW0A 1RTDA 2XLJA 2VBWA 4C8NA 1N0VC 1KLMA 2H4YB 3MAAB 1V9OA 2PA3A 2FJWA 3MF5A 1GXLA 1WHWA 3W3SA 3LP1B 2R7XA 3RAQA 2R7OA 4DR5F 1F9FA 4ED3A 1LEOA 3HHLD 2ILYA 4CCHA 1AFJA 1CLFA 4G1IA 1Y10A 2OMLA 2Q6CA 2HLUA 3MECB 4ZA1A 1AFIA 4NRUA 4CP5A 2D3UA 3IP0A 2LU2A 3TA2A 2ZDOA 4ELTA 4U6PA 2B4OA 2B9XA 3M8RA 3JSMA 1R8BA 2BM1A 3Q2TC 3M9OB 1T3NA 4KGXB 4DV7J 2W7PA 1UPPA 1VMBA 1VQMS 2YWFA 3MMBB 4I4BA 3MM5B 1RXOB 3H40A 5KT2A 2PEHA 4LF7F 2P8IA 3SZ2A 1PIEA 2CUYA 3V6DB 4B3RJ 2ZH3A 4D3GA 1HYSA 1SQFA 3PEHA 4N76A 4ECUA 1RI7A 5C7PA 4GO7X 3GILA 4I67A 1CJUB 4P73A 4X2BA 2DRDA 2CQ3A 3UD4P 1RWOB 4ZK7M 1JLCB 2RDIA 1FXRA 4QR1A 4NLXA 1UEUA 1U0HA 2VG7A 4LFBJ 2E5JA 4RNFA 5IM0B 1KR4A 1YJNS 4DL3A 3CC2S 2YVSA 1GX6A 1KHVA 1KOHA 3KG1A 4DXLA 1NXIA 1M1HA 2MQLA 2R2SA 4W98A 4ZITA 5AXKA 1L3UA 1BQMA 1U4BA 3ILIA 1JLBB 3TP2A 2GA7A 2RD5C 3K0JA 2AGQA 1U1QA 1Q0NA 2JEIA 2PN6A 2QTWA 3WX8A 4QQBA 1EAYC 4OZ2A 1YWXA 5L1JA 3KK2B 5I3QA 1MMDA 2ZC3A 3KLGA 3PDNA 3CW2C 1RADB 1F6TA 2PD1A 1DHMA 1D3WA 3BYRA 2DKOB 4U8YA 3PNIA 4OYBA 3D54A 1O5JA 1VOMA 4KGVB 3OR2A 2DGXA 1RT2B 3RRKA 2ASJA 1LWFB 4JYAF 2MQQA 5D3GB 2VA2A 5KFCA 4DBQA 4ZIVA 4L74A 4CO2A 2E5LJ 5ADZA 1VFJA 2AYBA 2WW4A 4B3OA 2C2RA 2EC2A 1H2TZ 1PJ5A 4YB1P 4C8KA 1S9EA 2RT3A 5JVGQ 4FYXB 4ECQA 1Y3JA 4NA1A 4CLZA 2K7KA 1XMOF 1N5YA 4OYMA 3HSZA 2G9OA 1F9EB 4OLOA 2BJ7A 2HIQA 3UVJA 2W01A 1U09A 2GAHC 1NB2A 3PX0A 2A10A 3GCWP 1RA6A 3QWPA 5E7OB 3AD9C 3TAMB 4I2QA 2MQMA 3KLHB 1C1CB 2H54B 2NYHA 1OQ6A 2F65A 4H54A 1FESA 2I8EA 4JI3J 1EQ0A 1LW2B 3V6KA 1R27B 2OO4A 3LPEA 1HR0J 1JLGA 3IWLA 5BYRA 2BVZA 3N6NA 4OI3A 4DV2J 3HULA 3HO1A 5EUHA 3G82B 2HW3A 5ETVA 4ZS6A 3P45B 1S7IA 5MLCV 1VQ5S 1HARA 3BO2A 2MPUA 2V67A 5L8RC 1LFPA 2CG4A 3GFZA 3HJVA 3CJTA 3TVKA 3K59A 1FE0A 1X60A 3PJXA 3PIPQ 1X31C 1WOOA 2C2OB 4F2RA 4TY9A 2CADA 2YX1A 3NMAA 4K2JA 4FVCA 4WKYA 1FRHA 4KY3A 2AJ1A 2IJRA 5ETRA 2M88A 3CD6S 3RZAA 1IKXB 2AEMA 3DHXA 3LTOA 3SI8A 3TUIC 2A0FB 1KP6A 3CO9A 1REVA 2NSCA 3UN2A 2B7BB 2GFFA 3DGPB 2J5AA 1O51A 4NLQA 3TOQA 4A8XA 4DEZA 3C6UA 5A0YB 5JJBA 2MGZB 2FJAB 2DH9A 2RE1A 1FRIA 3OVAA 4DFPA 2W9BB 5LMUF 3PKMA 2BX6A 2CPZA 5EWEA 3Q24A 2Q43A 1U6BA 5A8RB 4H4MB 4LUBA 1HNZJ 3BDPA 4PXCA 1T3OA 4ID8A 1IR2A 3FBEA 2JJ4D 4CYUB 3KWMA 5DQHA 5IS2A 4ZJOA 2FUG9 4HTIA 2OJ3A 3HHLC 3LO3A 4ZCIA 4P52A 4KHMA 3FK4A 2UUCJ 4C8LA 1NH7A 2DNLA 4Y2KA 1XNQF 2Z57B 1SKUB 2XSJA 4M8LA 2QA1A 1FFGB 4K4ZA 3M8PA 5A6PA 1EQMA 3H2VE 2VJUA 1FKPA 2O1PA 3D6HB 4DG1A 3EGNA 2E1CA 2HNDA 4ZIWA 1RAIB 5GAHI 3N5BA 4DX8H 1M5SA 5KG0A 2N82B 1WDTA 2GHVC 2JH3A 3VGUA 3OHAA 2GS8A 3NY0A 1WOPA 4FF3A 1IQTA 5F0UA 2OIHA 4H4OA 2BDPA 2ATLA 1IQZA 1I5OB 1C0TA 2XGQA 3M6VA 3OT9A 3ONQA 3K89A 4IH6A 2IA0A 4RW9A 1AZSB 5DJBA 3OJSA 4WE1B 3SDEB 1ZETA 3HZGA 4ELVA 1PO6A 4KHPF 4QCLA 4J90A 1H0HB 5CZXA 2VPWB 2XLIA 1NEEA 2VD3A 1NJZA 3GG0A 5J2QA 1U2CA 1S72S 4Q43A 3BKFA 4MIWA 3L9ZA 2VODA 3HKZD 1QAXA 4J9LA 2YKAA 2HSEB 4RW4B 2VHGA 1ZM9A 1KN6A 5A76A 4WIIA 1RZMA 4TU7A 1D9FA 5HMZA 4DQRA 2HS3A 3EM1A 3FEZA 4U7CA 3H5XA 1IM4A 1RBOB 3OTCA 4LSLA 2G2ZA 4AL7A 4ZVSB 4FNHA 2Z30B 5IOLA 4HDGA 2FGCA 5ITHA 3FQLA 3PG9A 3PKYA 3QPIA 2NUUG 2HRUA 3W1YC 3AQPA 4LF5F 4RU2A 5D0EA 5KFTA 2YX7A 1HNXJ 2QZ8A 4QIFA 2VG6A 3M2RB 3MCOA 3HHLB 4ZLJA 4DU8A 2RHSB 2C2KB 1GXTA 3Q8RB 4CLSA 2FC8A 4RR5A 1TL1B 1RHMB 1WDDA 2J0WA 1JK9B 3U02A 3SXLA 1MNEA 5CYQA 5ETQA 2GAGC 3N9UC 2DHGA 5D8HB 2ASLA 1B99A 1S6QB 3KG0A 3K5NA 3Q0AA 2EK1A 2VC1A 2YNIA 1FI4A 1LWXA 1LOUA 4P9SA 4ECRA 2HS0A 5KG4A 2ASDA 3I5AA 2W7AA 4ZPDA 1TKTB 4LF1A 3SIPB 1NU4A 4CLPA 4UUWA 3G6ES 1HI8A 4J7CA 2LMIA 3UNYA 3I55S 4DN9A 1RTIA 1T03B 4K0KF 3MPUB 2IRXA 3DKDA 3NWRA 5LJ3Y 4B17A 3VVUA 3CUNA 4KYZA 1X4GA 4GVBB 4DV0F 2CPYA 1OY6A 1RTJA 4ZMMA 2GO8A 2GMHA 3R6LB 3TNVA 3KXDA 2PFDA 3E3XA 2I6WA 5J2MB 2Y1LB 4Q0BA 1GT8A 2WB4A 4JI7J 3M4XA 3KJVA 1XC9A 4C6AA 2ABYA 2DEIA 2LQ8A 4DSIA 1XTZA 4WTYA 4A8FA 3DLBA 3KHRA 3MOZA 3P4UB 3R5GA 3OPKA 3BGFA 1KQKA 2C3MA 4K4WA 1LKZA 2Q3PA 2YWEA 2DVIA 2Z2ZA 3U7JA 3K5OA 2L48A 5KFSA 2OHDA 2KB2A 1S4FA 1M5OC 1CS4B 4A4JA 3O1LA 3HPOA 3QMQA 1P9QC 3TARA 3HCXA 5KFQA 4WP8A 2XZDB 3RW6A 2YNGB 1YBUA 1SC4B 2XG8A 3NRBA 1HQUB 2J6SA 4MFBB 4IRCA 3LUYA 1VBZA 1F1BB 1E6YA 1TK0A 2JOQA 3PRVA 5FLXY 2HLTA 4CM2A 1HWKA 4O3SA 2R2RA 4YY3F 3VR1A 1N36J 1HPZA 3GFXA 1NMEB 3LAKA 4LFCF 1RCXB 2B56A 3QWUA 1XR6A 4J5OA 1WHXA 5HMYA 1N52B 3FEXB 4J9RA 2OEKA 1ZZFA 4B3TF 3H7HB 3K17A 2MY7A 4X84A 4Q8EA 2G2YA 5IQ6A 5HBMA 3VALA 5A2QU 1NKCA 4AE5A 5K8PA 2W4PA 1CJKA 4F02A 4USJC 2E66A 4ED0A 2HNYB 2PC6A 3RBEA 3FZ2A 4JOUA 5CD4H 1NJYA 4TLQA 5JXSA 4QU6A 4UZBA 2KHCA 3W8PA 2B4UA 1KVKA 2QYCA 1E6VB 5F8GA 2M9KA 2FJEB 4YN3B 3WIUA 3KOAA 1FFSB 4ZHRB 2V6AA 3OQ2A 4UOFA 3AJ1A 3RAXA 4F8RA 2BRKA 4ETXA 5L39A 2JLGA 3IS9A 2R8JA 1SUQB 1YQHA 1WACA 3I9ZA 4OI4A 2ERRA 4HEA9 3OUYB 4C8ZA 4DUZJ 2J0XA 3KLEA 3RUBL 5KFYA 1SJ3P 3E2EA 1WSRA 2OPPB 1H2UX 2K2PA 1QM9A 1K1SA 1Q16B 4BWJA 2L08A 4YB6A 3MAQA 2VFVA 2DHHA 3KK3B 4WU2A 6AT1B 5B0GA 8ATCB 3LALA 4PWWA 4ILLA 4Y0FA 2RU3A 2PMZD 4OX7A 2GVZB 1S0VA 2MZRA 2ZKTA 2HHHF 2B3TB 1TV6B 2HGMA 3J81Y 1CEZA 2LEPA 3DYAA 1Z4UA 2RF2A 5K8OA 3EVMA 4OV6A 4Y34A 1MMLA 5KT6A 2DO4A 4AYBD 4C48A 2Y1JA 2HHSA 4NXNJ 4X66J 5IT9U 5KG5A 1TQLA 2MJNA 3J7ZT 5L38A 1XJWB 4BC7A 3ET6A 1BE4A 1K44A 2OPQB 4QPTA 3G9CA 3O3LA 4OYWA 4B3SF 5GAGU 1PAUB 1F60B 2W8LA 4NLVA 2CAJA 4I7FA 3KFWX 3DMJA 5T41A 4QWCA 2FZCB 2QMWA 2IIHA 2B4VA 4TLRA 4ECWA 3DRYA 3FBBA 3QSYB 3IBWA 4LIWA 1OS5A 4WP3A 4RBVA 5B0DA 2JC1A 4ZVPB 1IWGA 3SSSA 3AY0A 2FC9A 3GSDA 2I5JB 4DCPB 2NUHA 1S99A 3PFEA 2KH9A 3W60A 2FHJA 3OR1B 2ZZTA 1C2PA 2NQPA 3A8JA 1B7FA 1RSCA 1NK8A 3MR6A 1FX4A 4I0WA 2XY5A 4I2PB 3DXBA 2NXCA 3FSYA 1H38A 4UOHA 1A7GE 1B64A 3LPYA 2GJ2A 2JSXA 2VIHA 1HBNB 2C28A 1F5BA 1S1TA 3JAMY 3I96A 3OL7A 1HBOB 2JFDA 5EDWA 1U7LA 2MZJA 1BWEA 4BHQA 2VUGA 4DV6J 3D7SB 4OX6A 3L7OA 1TKZA 4ID5A 4FKYA 4A8WA 2LVWA 2ZH5A 1FJGF 2ZVIA 4DLEA 3OXFA 4ES3A 2Z58B 3HHEA 1GAOA 4EUVA 5K8MA 5L1LA 2E29A 3CCMS 3HVRA 3CJSA 4HYKA 2MZSA 4IH7A 4QIWD 1WC0A 2IAJB 2OFGX 4YHHF 3IRXB 2VZ9A 3NWGA 5HMWA 4J9OA 4KPYA 4PWUA 1X8DA 5CA5A 4QWEA 3HDSA 3MAAA 4KFBB 3LAMA 4O3RA 2VH7A 4MYUA 2H65B 1T02A 3M9NB 1CJTB 4DV4F 1TAQA 5B0BA 2IMWP 4Y2IA 3M6UA 5DG7A 3P5TL 3I4PA 3MECA 4WFNQ 2HRYA 4TXSA 2JEGA 3CJ3A 2FQQB 4KKOB 2CZ4A 4RW6A 4EO8A 3N01A 3HHNB 2CJBA 3CCQS 4OHYA 2RAQA 3DHWC 5KG3A 5I3PA 4RO0A 2P6SA 3CDBA 2O5DA 5DDPC 2M70A 2HBRB 1FKAF 1RYSA 4IG0B 5B0CA 2HYIB 4E2FB 3V6DA 3BGOP 2GO9A 1VRTA 4QWDA 4V19J 4DF8A 3NGRA 1AYEA 3POTB 1WI6A 3NCPA 2MKHA 4ICLB 2HHVA 2CKWA 5LSLA 3OD2A 2I1RA 1Q5VA 3S01A 4IFVB 5E41A 3MWBA 2H51B 1RAJA 4RUHA 3BGRB 2FLPA 5IM0A 3LGHA 1S1VB 1FA0A 2H3EB 2OSQA 4L76A 4LVNP 3DRRA 5IZHA 4K7QA 3BGLA 4JV5F 1Q86T 3TAQA 4EO6A 3P3DA 1QVGR 2A6MA 4OYIA 5H9FJ 3DDIA 2XMJA 2M4MA 4WP9A 4O0NA 1HI0P 4DR2J 5E3CA 2QL9B 3I5CA 3MFIA 3PHEA 4UQGA 1EETB 3KK2A 3TJ8A 4DX5A 3HFZB 1I3OB 2X1BA 2J76E 1LV5A 2ZBQA 3IGVA 1FD8A 2AYEA 2MB0B 2W24A 5KFHA 3T6JA 4RNNA 4FS2A 4DV1J 4GKJJ 2XWXA 2EWHA 1IBMF 3W2VB 1RT2A 4B3MJ 1YKWA 4N8NA 1LWFA 5IV4A 2K1RB 1S1XB 1PJ6A 3MPDA 2FD2A 1KFSA 1JLEB 4WYWA 1L3KA 2KKHA 4P2SA 1WG5A 3GYGA 3RGIA 2GGPA 2NXEA 2ZC4A 5EHHA 4DV5F 3AB2B 4G65A 1U1LA 1RHJB 2VDHA 4FKXA 4ZVTB 1OYEA 3T1AA 4DS4A 3R5CA 1WELA 3I5BA 3FQKA 4NMLA 1R89A 5HQ8A 4PRFA 1YBTA 4JI5J 1R8CA 4CO0A 2ZOMA 4C98A 1RP5A 3TAMA 4USHA 1C1CA 2HAIA 3KNAA 4KPCA 5K9FA 2JVRA 4FNIA 2NCKL 4U95A 2YQ3A 4P2FA 3G82A 3TANA 3DOMA 3P96A 4DFJA 1N32F 2HHXA 2AQ4A 3OV7A 1Y5LB 3PW4A 3NP5A 5D4PA 3KLIA 4ITSA 4J91A 2RB7A 3P5BP 1RKJA 4AXIA 5HVGA 2ZD1B 3JQKA 4LR9A 3RBXA 1RAFB 3G2XA 4B9SA 2GVDA 3CJKB 5AE1A 3TA1A 3I0SA 3NBPA 1XMQF 1VBKA 1RT6B 2CG8A 5K14B 1U8WA 4ZVRB 1VK3A 3OTOF 1RACB 3DGPA 3CCSS 1FVQA 3E01A 5A0YA 2ZKUA 2MGZA 3VGSA 3TUJC 3TZXA 1TAUA 1F0XA 2ALYB 2MTLA 2CQHA 5F8NA 3C14B 4JP8A 2BJ9A 2RRBA 2N4DA 4J9NA 3W2WB 1NDLA 4C3LA 3W62A 3KHGA 4KV8B 3MTJA 2HWIA 2HVEA 2R7VA 2GMLA 1OSCA 3QT5A 3CULA 2DHAA 1FXLA 5AXMA 4LJMA 3UR0A 3DN9A 4TN2A 3FCVA 1TELA 2VPYB 1YDLA 3W5ZA 1RU1A 5IWAF 4CYUA 1TKDA 3DGVA 4RPFA 4Q2LA 2HFUA 2HFVA 2K3IA 1WUUA 3KUGA 4CLKA 1C1BB 3QT8A 3PTWA 4F0MA 5GMKa 1PBAA 4DZDA 1RA7A 3DXSX 2DTJA 2MJUA 4F7VA 1VQNS 3W9HA 2QA2A 5J1PA 1XWLA 4P75A 1U48A 1WEYA 1HW9A 2FTRA 2E1PA 3BB5A 4USKA 4AD6A 5C2CA 3PR5B 2DIUA 4NLSA 3J80U 3T3FA 3H4BA 2OPSA 4R8UB 3KUHA 3IG1A 4JI8J 2W9CB 2KTQA 5E2QA 4GC6A 1M5VC 2XYGB 3O44A 4BLGA 1UJ4A 2MSSA 4NLGA 4R5PA 2BE2A 4OI1A 2JWNA 3GTYX 4X64J 3OTDA 5J2NB 1JLAA 1UVLA 1QSYA 1UVJA 4DS5A 2OSRA 4OHZA 2OTLS 2BOAA 1H7WA 2XS2A 1AZSA 2OELA 4PXEA 4WE1A 4USUA 2LXFA 2QO3A 3DU5A 1MG7A 3ZZRA 5CCMA 2K06A 2AKWB 2UU9J 1P9YA 3EZ5A 1HD0A 1NB7A 1MWYA 4FF4A 2HFOA 4U67Q 5BR8F 3ZTOA 2VQEJ 1ZZNA 1Q82T 3LWMA 2V2KA 3V6HA 2G0JA 1FDNA 1PAEX 1SH2A 2DXFA 5KFRA 3PACA 1QTMA 3R7BB 3Q8QB 2MKCA 3MMCB 3VAHA 2V2VA 5IT4A 4JI2J 3FUYA 4KH0B 5IFMA 4LF9F 3OTEA 5IC6B 3UW1A 3UNGC 4OYAA 4J9MA 2VFRA 3I32A 1WJ9A 4X4UA 4IRDA 2CQ1A 4TYAA 5DZ6A 4B9MA 4ENOA 2WHOA 4F4YA 1FRLA 1T9XA 4MMOA 1UWAA 2U1AA 2ZH9A 1DLOB 3FFIB 3M2RA 3HHLA 2OEMA 3RRHA 4OHXA 2FVSA 3IA0A 2E5IA 3QGPA 2E7XA 1X4CA 2DCUB 1HMVA 2IJNA 1ZA1B 2IM2A 2ZHOA 4FXDA 1C4AA 2LCWA 2NREA 3GJQB 5T7LB 1PYSB 1IKYA 1Q8KA 2EFVA 2UVWA 5HVFA 1CPZA 1MLAA 5HVHA 4QWBA 4BDPA 4F67A 4EZ9A 3FC9A 1SL0A 4ZPVR 3SYZA 3CCWA 1CG2A 2ZITA 2C2EA 1R6YA 4DL7A 5HI7A 1M5HA 1QD1A 4ED7A 4FVMA 3GJRB 3BEGB 3HVWA 2R7WA 1N48A 4FN5A 3DLHA 4FYYB 3SCLE 1RT3B 4E98A 1Y5NB 1TKTA 1UZHA 2R8HA 2DNRA 2NXJA 2ROPA 3RR7A 4I69A 3BN4A 1OPIA 4F3OA 3CC4S 3N79A 1SI9A 2FGOA 1DJ0A 1YG0A 1UEVA 3FNNA 1QE1B 1NO8A 2KO1A 3T41A 5F8HA 2G13A 1FNMA 1D0EA 1RB0A 1KRPA 1Z1ZA 3CWJA 4K4VA 4LFBF 3M7VA 1VIOA 4ED5A 3MEKA 3MPWA 3KG4A 1IN0A 2H5JB 3D2WA 1N8RT 4WFBQ 3QIPB 1FRKA 4YR3A 4DWIA 3FMWA 4OX8A 1L3SA 4NEYA 4DI6A 3BBCA 1FNOA 3ENAA 3DRPB 1YRUA 2QL7B 1UEKA 4IFYB 1JJ2R 3T5HA 3LP2B 2HVHA 2NLWA 3KHLA 3G86A 2UXDJ 3PRDA 3FSIA 2KN4A 4USTA 1CULB 1N5VA 2V2ZA 5DG8A 3JTPA 1ZS6A 1FE4A 2CIMA 3V81A 1YZ7A 5KFUA 4AL6A 2KT5A 1RT7A 2CPDA 1UFLA 3KUEA 1EARA 1G6BA 1AROP 3DOLB 2N7CA 3WDOA 4NLYA 5A8WB 3E51A 2YNGA 2IVMA 1YJ7A 2PT0A 3G96A 4DUYJ 4N7TA 1NK0A 2ACMA 1U8SA 3MEGB 4PQUA 3PO4A 2ZBCA 2E5LF 2E1MC 4AFFA 4XPCA 4FYDA 1MWZA 3W63A 2ZE2B 4M5LA 1YJVA 3EX7B 1JWWA 3MI7X 3FGVA 3SQOP 1QSSA 1JMTA 1BGXT 3IMQJ 4FP9A 4C0OC 4OYPA 2YKQA 4MK7A 3MD1A 3NGKA 3B82A 4JI3F 2EXUA 4LQ3A 3OFGA 5KT7A 4DV2F 3UI3A 1SJFA 2MMYA 2EKNA 3K7RA 4V19X 3ZZOA 1FJEB 2HNYA 3WC0A 2DR9A 4ER8A 1RT1B 3HSJA 1HQEB 5E33A 4EBEA 4PG6A 4XPEA 1S1WB 2X7IA 4DPWA 1RAHB 2E7VA 3TX8A 1F5AA 1E6VA 2MKSA 2BV3A 4LF8J 1CC8A 3MM6B 2FLLA 3EICA 2CNNB 3K5PA 5F8JA 2R8IA 1VJQA 2LXIA 1OWXA 5I42B 1PJ7A 1BQXA 2YY3A 5GMEA 2RQCA 2E9RX 4KBIA 4WU3A 3UR3C 1IKWA 1GFWB 3IM8A 4BC9A 1SUQA 3MM7B 3OFFA 2DNNA 2MKYA 4LFAJ 2IJFA 3HHDA 2OPPA 2DO0A 2AIRB 3TR5A 4EGLA 5KFNA 1S0OA 1X5OA 2IPOB 3QJPA 2VC0A 1MN9A 2ZM6J 3KK3A 2YQ1A 3SSQA 1JLFA 2W4DA 1BY9A 3AFGA 3AD8C 2BANB 4DF4A 1CC7A 1FRJA 3OXLA 2GVZA 1S77D 2DNKA 1HNZF 1TV6A 3LQVA 3ITHB 4L6V3 3BM7A 3MOJB 4ATNA 4OJGA 3FBFA 1L5UA 4KT0C 1Y3KA 2B6AB 3DOKB 1VS3A 2K7JA 4NZ7A 5F41A 4TU8A 4ZKAA 2UUCF 4Q45A 1RJJA 3SFUA 2EW9A 5L9NA 5KFGA 2Q6BA 2ZUAA 2EFGA 2AYMA 5GVQA 1M1GA 1Q8LA 3M30B 1D09B 1WG4A 4RZRA 5EX0A 2QX0A 2VDIA 3QO9B 1S4EA 4K50A 1HA1A 4K4SA 2B5JA 3QSIA 4NE9C 4EU0A 4U9RA 1M1KT 1UTAA 1XMOJ 4O0IA 5MAOA 4DL4A 4NPOA 4DZ6A 1YVFA 2KU7A 4CM0A 4HH0A 1IUJA 5GAGI 2N7YA 4FXWA 1HNWJ 3MM8B 2I5JA 1ZM3A 4RUBA 1Q78A 2DRAA 4J9UE 4C8YA 2AWZA 2XYPB 3OR1A 4KR0B 4M5JA 2UUAJ 4UF4A 2Q79A 2GX8A 1SKRA 3GIIA 2F3JA 2MKIA 4I2PA 2J7UA 4O4GB 4N41A 5BXIA 1Z2ZA 3M1VB 3R2CJ 3M2UB 1NHKL 2DH7A 2DCLA 4WZMA 4F2SA 3WIVA 1K0TA 4RLEA 3UDLA 4S0MA 5FD1A 1HBOA 2DR6A 3OLAA 5KFXA 5DGAA 5A2QY 1HWJA 4TKTA 2CPIA 2IM0A 4FZVA 4MTPA 2LDIA 3DLEA 4HR2A 2IA6A 7FDRA 2QC3A 3GYNA 4NA2A 4CTAA 3LH2S 4J37A 4NLOA 1T9TA 3JB9k 2R42A 2AGOA 2CJQA 2J6TA 4GKKJ 2EC0A 5E3RA 5KFBA 4PQAA 3RYLA 4XDCA 3QYYA 3KYLA 4JV1A 4YFUA 5B09A 3VAKA 3IRXA 4L75A 4PPDA 4MIBA 1N88A 2WVFA 1SL1A 2LFVA 1HNXF 2YQ0A 1BQNA 4KFBA 2JC0A 1RABB 5HJYA 4K59A 2XEXA 1HNIB 3HVTB 3THTA 3U27A 4BBYA 4TQRA 4Q5VA 1V3RA 1CJTA 2OEJA 3AOBA 4I6WA 4K4XA 1VQSA 4LSZB 1MU2A 3NS5A 3MMAB 2KG0A 2YNHB 2RDDA 2DJWA 2WK4A 2LP4A 2QL5B 4KKOA 2BR0A 3DRSA 4NYZA 2F1FA 5J1EB 4ZVEA 3FRZA 2GIRA 2HBYB 2POKA 4P2MA 2W2PP 3TW0A 2M52A 3UN5A 5H1SV 3RB4A 4F4XA 2ZH6A 4DQIA 2L3MA 4C9DA 4HH1A 4OYXA 2RS2A 4IG0A 1YHQS 5AE3A 1JLQA 1RTZA 2XLKA 3T1YJ 1NK4A 3UWTA 3POTA 1NH8A 3MUMP 1NK5A 1H7XA 3QT7A 3GG1A 2V63A 5HATA 4WCEQ 1KD1T 4O3QA 4RJVA 1TL3A 2WOMB 4IFVA 1I1GA 1NDPA 2PE8A 2G1DA 2M8DB 2M7SA 2B9YA 1J27A 3BGRA 3Q22A 5K5MA 5G0RB 5DLFA 2FDNA 4Z7CA 2CPHA 3A4TA 4PR6A 1X4AA 4JI7F 4Q8FA 5K8NA 1RU2A 3GMGA 2WAQD 3SV4A 3VZHA 2CVEA 4ZPAA 4A8OA 1XNRJ 3FBCA 2C2DA 1TK5A 2DPJA 3CMES 4KHRA 2F9JA 3HT3A 3AOCA 1DTQB 1FFWB 2BJDA 5IQQA 1ZTWA 5D0GA 3CSKA 3UCUP 4DSKA 5LXRA 4LF6J 4CO1A 1N4LA 1TL4A 3ZZ0A 4X4QA 1VBYA 2Y8YA 3ISND 2E7WA 1QAIA 1VQOS 4HT7A 4L72B 4LBIA 2HHTA 4KB7A 2YWKA 4F50A 3W2VA 1K73T 2ZOGA 3QAEA 1L3VA 1N5QA 1ICEB 2U2FA 3C16B 3R7NB 1S1XA 2AP6A 5A8KB 1JLEA 3M9MB 4WYLA 1H6KX 2ZZMA 1N36F 3L7UA 4LF5J 4PZVA 1KLMB 3IBFB 3IAM9 2D3O1 2MSTA 3J81j 3NGDA 3KDOA 3K58A 2UP1A 1Q53A 3F44A 4LF2A 2HQGA 2A1BA 4ANCA 2RSQA 1T94A 1MSWD 3R7SB 3S1TA 3ZTPA 1IJEB 1B3TA 1QAJA 3JSRA 3PCOB 4QIEA 4NXMJ 3OLBA 2UVRA 1IBLJ 1UWBA 3A8EA 4P7VA 1KSPA 2XI2A 2BBEA 3FCWA 4DV3J 1MW7A 3VTIA 3HI9A 4PABA 1NBEB 2CNOB 3GJTB 1FCAA 1NDCA 4WFZA 1TFWA 3OVBA 5HSPA 2EPIA 2RIJA 2PI4A 1KVJA 5D4NA 3Q8PB 4ZP8A 2D7SA 2VU5A 4C2MA 3J7AN 2XI3A 2DNHA 1SJ1A 4G1PA 4N77A 4ED6A 2DR5A 2NR0A 1X4FA 2YKMB 1U0HB 2JX2A 2VG7B 1OSDA 2CXEA 1Y0HA 4BS2A 1S48A 2VOPA 3CJKA 1SJQA 4ZVFA 4NI2B 1RT6A 3ZTRA 1R7IA 5K14A 1HWLA 2F4VJ 3Q86A 2L9NA 1YJRA 3LANA 2UUTA 4CIOA 4K4YA 4M1KA 4TQSA 2HK3A 1EKRA 3KK1B 3H5UA 2EFNA 4LSNB 3CDUA 1NM2A 3CCLS 2XMMA 5KG1A 1PKUA 3UD3P 1H3DA 4ZCLA 5HN0A 2HQIA 2I2YA 1G2EA 2CWXA 1HWIA 1ZAXA 2HRTA 2H1YA 2B4PA 2F4FA 1LWCA 1DQ9A 2C42A 1IWAA 2M5YA 1VR6A 4NXNF 4GMKA 4X66F 1X0FA 2WONB 1G4CA 5D4LA 1MN7A 4F4KA 4PG5A 1F5CA 1AUSL 3A13A 1O8BA 1CQMA 2CYYA 4Q2MA 4ZPTR 2F63A 1FKOB 1HLWA 3OBIA 2RQ4A 6FDRA 1S9EB 4EBCA 4CLWA 4QR0A 1T05B 4W92B 3AA8A 2XO6A 3G6YA 1NNDA 5C42A 1N5YB 4NCGA 3TI0A 4B3TJ 2AMCB 1RWWB 3CCUS 5DGBA 1LK7A 4U8VA 2DB1A 4R8UA 1B70B 1G3OA 2W9CA 1U45A 1URRA 2XGPA 4I2QB 3N0VA 1RAOA 1H74A 2E1RA 3JYTA 2KXNB 2HMIB 5J2NA 1RHQB 2F8MA 1WI8A 3ZXWA 2JEJA 3UDEA 2AEJA 4YUDA 2AJ4A 2C2MB 2HBQB 4ECSA 2ZDPA 4R25A 4LF4J 3LWLA 4NA3A 4B08A 3QT6A 1UA0A 2E5GA 3BQ1A 2FIUA 3T1HJ 3W61A 2DNOA 2DGQA 1S6PB 3BR8A 4A8QA 1IBKJ 2ADCA 4DV6F 2UVUA 4QU7A 2V94A 3DI6A 3H25A 5AT1B 2QV6A 4G6VB 3TAPA 4J9QA 2BQUA 3TYTA 3MPYA 1YIJS 3OSNA 1SJ4P 4IO9Q 2Y1IA 3MMCA 2CJ9A 3A3OB 4EYIB 2KT2A 2PGCA 1TL5A 3C6UB 1UETA 2ATCB 4X4TA 1S5ZA 1HWUA 1KC8T 3OFHA 2C3YA 1W2IA 2DGTA 4AT1B 1NJXA 5C25A 1DLOA 4N56A 4KGKA 4NLWA 3EZOA 5C24A 2XZWA 2OD6A 2KRRA 1DZ5A 3IWXA 1KTQA 3MFHA 4C4WA 1HHQA 2W9AA 1RHUB 2W4CA 2KXHA 2DR8A 1LK5A 1S7HA 1P6TA 1T7PA 2OP5A 3MCNA 4OL8A 1CJVB 2ZNZA 4P74A 3G4SS 4UOCA 5F9LA 2NSBA 2CNLB 1AA1B 1HQ2A 4OZ1A 4LQ9A 1WF2A 3UFCX 3KMSA 2BZ2A 3RR8A 2GZOA 2JDJA 4QYZJ 3C19A 3ENQA 1EJ7L 4TNOA 4PXDA 1F3VA 1HBUB 1UW9A 2HVZA 3M8PB 1H98A 4RWXA 2AF6A 4NEZA 3D0HE 5KFEA 1I94F 2PO4A 5BYSA 5LJ5Y 1QE1A 1RWXB 4OIXA 1IXKA 1GXUA 1RWPB 5AJ3J 1X9MA 2Z0GA 3TUPA 3NGSA 3HLUA 2AX0A 3NCQA 5SZTA 1LFWA 3IR7B 4WXOA 1C0TB 1NAQA 2FHJD 4JI1J 4F36A 3KKFA 2AJ0A 2N4CA 5KFOA 2UXCJ 4RW9B 3HSGA 3J80Y 4MT1A 1KQGB 1B7YB 1D8YA 3CJ4A 4X62J 2HPUA 5F8MA 3LP2A 3L09A 2R8KA 4DR7J 4ZJLA 3C2PA 2ZH7A 4DR2F 3GSIA 1NKBA 4OZLA 2OLWA 2CQ2A 5J2QB 4A8YA 3Q8UA 3M8SA 4GC7A 1XERA 2X1AA 2R7RA 2WW8A 4ZLNA 3GE9A 2QA4G 1FDAA 4DV1F 2R7QA 4GKJF 2CQ0A 2G1HA 3X3UA 4OJHA 3JSYA 4U7UD 4IH5A 4B3MF 4B9VA 5E0OA 4D3HA 1NUEA 1R6VA 4LSLB 3HZEA 3MEGA 1Y11A 4WBFA 2IBOA 1SPBP 3P49B 1EX8A 4IG3A 3Q23A 2VBZA 2ZE2A 2PMWA 2DR7A 3D0GE 2CQDA 2LQBA 4IRKA 2VG6B 3NCRA 4K2XA 1TUGB 2XNRA 4C0HA 3BBBA 2R2UA 3QQCD 4ECZA 2MQOA 3R6GB 4JI5F 2AEFA 4FYVB 2XBPA 4RNMA 1TL7A 2RH3A 1YJWS 1S9GB 2CPFA 2JLEA 5CZVA 5CYQB 1N6QB 4J9PA 3P8BB 4H4KC 4B9NA 1HBMB 2R2TA 1K47A 5HJXA 4WJBA 1RT1A 1SCJB 1HQEA 4NLPA 4C8OA 1S1WA 3WZ0A 2MLZA 3U1MA 1EP4B 2IMOA 2IC3B 2M8HA 2LA6A 2ZBIA 3MM6A 1RTIB 3MR3A 2HVIA 2GIQA 3QAUA 1WHYA 3TEHB 3B78A 1RKIA 2EVZA 3V4IA 3BS9A 1OYDA 1QSLA 1REGX 1AXQA 3ILOA 4P7TA 5B7WA 3NS6A 3D9BA 5ETLA 4A46A 3QJLA 2VG5B 3KJVB 5IC4B 4X4SA 5LOQA 2X51A 3HT0A 2VQFJ 1VBXA 2R7SA 2LKZA 1S6OA 3QRQA 1HW8A 4ZVHA 2J0QD 2XMWA 3CE8A 3M05A 1VGYA 1D1UA 1PG5B 2V9KA 2CQIA 2D3ZA 2FVPA 4LRFA 4QYRA 2Z2YB 2BJ8A 4A8KA 4RW8A 1EKSA 4QBUA 1XQIA 5CAAA 4RKUC 2V4JA 3G6XA 3DLJA 3I0RB 2LDYA 2BJEA 4P6QA 3AAWB 4DR4F 2B6AA 4USIA 4TY8A 2L9WA 4UW2A 3P6YC 4OHVA 5I3UB 3PYEA 3HM9A 1W26A 3JQMA 4AL5A 1E6YB 2VBXA 4DUTA 1FVSA 2Q1LA 2VFTA 4CO5A 4YQWA 5GADU 3M30A 2QFJA 4ZPWR 4B9TA 3QO9A 2UUBJ 2FJDB 3D1HA 4NOHA 4MKVA 1PC5A 4USMA 2XS7A 4JI8F 2QRRA 2RMLA 3QNWB 2J8SA 3TVYA 2LA4A 2NPIA 4IDKB 1WNEA 3MM8A 1R43A 1NJIT 4X4PA 3B8HA 4X64F 2ZHBA 2XCAA 2QYGA 3R3TA 3UO0A 2JFKA 4YOEA 1CJKB 1V3ZA 2V34A 2QEXS 4PG4A 1DRZA 5CABA 4XDDA 2KFNA 4O4GA 2HS4A 3M1VA 3M2UA 2UU9F 4J9SA 1FRMA 3PYFA 2A2CA 2PMHA 5F3TA 2J6UA 1KTVA 1S79A 3TQ1A 2VQEF 2MXYA 1ZPVA 3BSCA 4IO1A 2F9DA 4QOTA 4UQTA 3ILLA 3W9JA 1S0MA 3HFVA 2F8EX 2FY8A 2E44A 1ZAWA 3IS9B 3LP0B 4F4WA 2GW8A 4M95A 3PX6A 2MZQA 3THVA 4YP3A 1FF2A 3KLEB 4F0HA 1BLUA 1FWKA 1J2VA 1FERA 4KO0B 3UCGA 1M5PC 5DDRC 1U1NA 4QPXA 4JI2F 2I0XA 4IOCQ 5D77A 3KMQA 2V8GA 1RAEB 1UZDA 1RAAB 5F0WA 1A0OB 1YZ6A 4QJVA 3AD7C 3ISZA 4DLGA 3ETMA 2IFXA 2ZEJA 2ZH4A 3DLKA 3BSNA 3AHPA 4CH1A 2OUGA 1VQ4S 3HVTA 3BREA 4NZ6A 2KXFA 4HL9A 4I6YA 4GVLA 4MK9A 2V5HG 1DAXA 3DYAB 2RF2B 4QIVA 1N5TA 3H42A 3TA0A 2JL9A 1SH3A 2YNHA 1XMBA 1LWEB 2UV8G 4LR7A 3RG6A 3TO8A 1DY3A 1GQEA 4ZVGA 3O2IA 5J1EA 1F2HA 3R1LA 1RQ0A 1T9YA 1R8PA 2QLXA 3GR1A 3ET6B 3CGIA 2CPEA 4DPXA 5CXTA 1VLOA 1WKJA 1P1LA 3V5RA 5KG7A 3DMJB 4JI0J 1GMWD 1WKLA 3IFEA 1L3TA 3D66A 5KFIA 3MEEB 3IC1A 2AJ2A 1GH8A 4LREA 3C6TB 4X65J 3H4DA 2GMJA 4CLUA 1SV5B 1SIZA 2CZVC 4UOGA 2Z8QA 1BXNA 2H5IB 2DNMA 2V4RA 3MCMA 1Q8IA 4XAKA 3CJ8A 3PW7A 2HBZB 3CCRS 1R0AA 3BKUA 3ICLA 2KT3A 4F4AA 3KTQA 4FPRA 2QSFA 2CQ4A 1VC5A 2FVRA 2C3OA 4ETZA 1GNKA 1FO1A 3HD1A 1J5EJ 1SQEA 2DEJA 3UE2A 1R8HA 2UXDF 2Q66A 3DDNA 2CJYB 3ENVA 3G6VA 1S1TB 1DTQA 3MHYA 2QLBB 4DR6J 1RT4B 2W2QP 1QDUB 1TKZB 1SQGA 4ID5B 3BQ2A 5DM6Q 3V4MA 1D8ZA 5CYMB 4DX7A 3V2UC 1SC1B 3BKTA 2H48B 1T9WA 4UY8T 2F40A 3AOAA 3IBCB 3MD3A 2CA9A 2XY6A 2FYXA 1KONA 2HK2A 3ZO7A 1EHWA 4K4UA 1BC6A 2J9CA 1P1TA 4DUYF 5ETOA 4WK3A 3C16A 3D3BJ 4DSEA 2GIFA 1SJRA 1WC4A 1UMJA 4FBUA 2ZH1A 4LIRA 2CVIA 3GIJA 5C5JA 4RW7B 5D4OA 4F3QA 3S7RA 1ZA2B 1YITS 3LW5C 5HMXA 2LQ9A 2KM8C 3LGNA 1IKVA 2VL1A 2WVDA 2BMBA 2V9WA 1JXEA 3IR6B 3VQSA 5KT4A 2C22A 1SL2A 3HK2A 4ZCKA 1BHNA 2W2NP 4RW6B 1YTYA 1GMVA 4O3OA 1S0NA 3BSOA 1RTHA 1R0BG 1NSQA 1FTRA 4FYWB 3BR9A 2CNKB 5F8IA 1XN9A 2W7OA 2XHCA 5B0EA 4P2XA 1JXLA 1WSVA 7AT1B 5CHCB 3CD7A 1B0PA 4M5HA 2LQJA 4WFXA 3PO5A 1XEZA 4P10A 2VV5A 1YRXA 4ED1A 1VRTB 2W2MP 4LF8F 3UN3A 4NLRA 2RILA 3G8SA 2ZOFA 3VAIA 5LL6d 3T6BA 1TMMA 3JTOA 3MUTP 5KG6A 3CNQP 4O3NA 4OFZA 2YKMA 3IWNC 2B0GA 2KZMA 4NI2A 4LFAF 2W2OP 3EGZA 2PEBA 3IM9A 1KEKA 3LP1A 3DRRB 2ZM6F 4MKYA 4JI4J 2WSCC 4URGA 3KK1A 4PWDB 2AJFE 4P71A 5D0HA 3R2DJ 1XR5A 3H98A 4LSNA 5CCLA 1KQFB 3M2VB 4P72A 2KVQE 2HWHA 1X4HA 3DCAA 4EFAC 3VZIA 2B8QA 3PYDA 3D3CJ 2FHKA 4OJ1A 4WWSA 3UQSA 4OYOA 3MMBA 3MM5A 5RUBA 2IDLA 2OPRB 5L9XA 3MR5A 2YXLA 5KOXA 5KTQA 4KGZB 2ZJPQ 2DRBA 3FDSA 4EEYA 2WONA 3UCZP 4YR2A 2DK2A 2C3PA 2MLXA 1NSKL 4OX9J 2KM8B 3VQTA 2VB6A 5KT5A 4Z7YA 2D1CA 2AT1B 2XHWA 4ANDA 2GGPB 4WFAQ 2Y1RI 2FVCA 1CJUA 4CNZA 1FKOA 5HL7Q 4DR1J 2HQDA 1NZAA 1JLCA 2BOPA 1T05A 5H9EK 2GHWA 3BYPA 1DQ8A 3ZZPA 1Y5IB 2P6TA 2EKYA 1TVRB 3ZTQA 1HNWF 3DNCA 2GV1A 3FMBA 1JLBA 1N33J 3QZ8A 2HMIA 1QUPA 2UUAF 5HROB 2UXBJ 4M5GA 3AXMA 4OMFG 2AHOB 1XIQA 3DOMB 1WG1A 2JNJA 3BZQA 3G8QA 2NYIA 1FWPA 1S6PA 5HK4A 1NHVA 4KTQA 2CZ9A 3DU6A 2H5EA 3KLIB 2H9ZA 1X4BA 4IUFA 5HQLA 3OL9A 1X5TA 3G71S 3R5BA 5D3GA 1FDBA 4V1Ak 5E3AA 2E9TA 2PDAA 3C15B 3CCVS 4L3NA 3PIOQ 2GVDB 3I0SB 4F04B 1EIYB 3NBPB 2QE5A 3KDNA 4GKKF 5B08A 2A18A 3HKWA 3MM9B 2EK6A 3NLCA 2P5VA 3E01B 2XMUA 4EI2A 2ALZA 2J9DA 1YI2S 1KVIA 1JKHB 2EEYA 3VGTA 1S1UB 4ZP7A 2IBKA 4TYBA 3IN5A 2GNKA 2GQ2A 1UVKA 3KLHA 2KYZA 1UJ5A 1X4EA 5M2UA 2V50A 1T0TV 4ILMA 2Y0SD 4A8MP 1LW2A 2AZ1A 5J2PB 3R1HA 3KLFB 3J7YU 1ZM2A 3F0NA 4KC5A 1NZ8A 3SCIE 1KLNA 3IR5B 1CJVA 3B54A 2R9LA 2XMAA 2MKKA 4OHWA 1JNRB 4DCOB 3BQ0A 3FSXA 1U1MA 3NEKA 1Q4RA 3RAMA 5CYJA 3GIKA 2MQ8A 5DG9A 4CLLA 1WC1A 3D1QA 3ELHA 4RWWA 1HBUA 4ECVA 2DHXA 4Y65A 4C0BA 1IKXA 3AJ2A 4RUAA 4KAIA 3MGJA 2GJIA 3ZNJ1 3T1YF 5BJRA 2MQPA 2CPXA 1U2RA 2OPSB 3BH6B 1IR0A 5KFVA 3IG1B 1GX5A 2PFFB 3DLGB 2JLFA 3RU0A 1VQ8S 4JUZA 4R5PB 2BE2B 3NNCA 2M0GB 3W66A 5DZ7A 3WBZA 1JLAB 4M63A 2VONA 3FEYB 2W9BA 2WVEA 1SB6A 2KZZA 2UZAA 1RLDA 3VGVA 4OJ3A 2IM1A 5A8RA 2Y9HA 4H4MA 4RNOA 5EWFA 1XNRF 4OZJA 2ROGA 1JXVA 3ZTSA 2YPZA 3BO3A 3CDWA 3D68A 1AW0A 5LXYA 1U2FA 4RU9A 4LF6F 2UVVA 3PW5A 1H73A 1RWMB 3H20A 4ZPCA 2WTFA 4Z37A 4FF1A 3I4HX 4F4ZA 3TZYA 5L1IA 2KHDA 2JEFA 2FY1A 1TFYA 5DQIA 5DS7A 1J5OB 4R0JA 1VISA 1WKKA 2FZGB 3TZZA 1BMQB 2VPXB 2JZ5A 2WSFC 4M5MA 4NLUA 4N8OA 2K8GA 1Q95G 2YKNB 4M5DB 4XO0A 2DNZA 3CD0A 2BACA 2DGOA 1W2BR 5ETTA 3MMJA 2V8DA 2RJZA 3NXZA 4KQZA 2DPIA 3SEOA 5ETNA 3FZBA 4UTGA 5FDLB 4RX6A 3W8GA 2APOA 1ULRA 1HMVB 1N34F 3EVWA 3FCHA 4DR3F 4ED8A 3SDEA 5IV3A 4DOZA 2P9CA 2NXUA 2KDOA 3ADAC 1S9GA 5DDQC 1IKYB 2VICA 1DURA 1FRXA 4PYDA 4DQQA 3DM2B 4K5SA 1N6QA 4AQYJ 4NXMF 4PPZA 3CVKA 1HBMA 1UL3A 3C46A 4HHJA 2QLJB 2LQ5A 3A12A 5E3PA 3ZZZA 1IBLF 3NAHA 1YK9A 3N6LA 1XK8A 4DV3F 3MDFA 4ZPBA 5AXNA 3D28A 2ZBRA 3BH7B 3WHIA 2ZH8A 4MK8A 2MZ1A 4FPIA 5LM7E 4RW4A 3ZZYA 1NK7A 1HL6A 1EP4A 2IC3A 2V68A 3AQOA 4RBUA 4WXWA 1FK9B 3EJMA 4CT9A 3B6BA 1NK9A 2FB0A 2J9DE 4NL5A 5DRKA 5LSOA 2M3DA 1X9SA 1TKXB 1LXJA 2Z4PA 2F4VF 4CRJA 4OZ5A 3DLLQ 4DN0A 1S57A 3D4JA 4J9VA 2VG5A 4QIGA 4QZVB 3JQJA 2FLNA 3BV8A 3NL0A 1VQPS 1LQ9A 4CNYA 1U24A 4C8MA 1TUWA 3K57A 2CQBA 2HGLA 1H72C 2DIVA 1TL1A 3AXKA 3MURP 3GFHA 3BBFA 1FDDA 3V81B 4DCJB 1S6QA 2UV8A 1F2GA 1RT7B 4ANEA 1BUXA 1OO0B 1N56A 4DV7F 2FZKB 3I0RA 2DNYA 4HTJA 2ZH2A 2BYCA 1U26A 9RUBA 2BQ3A 1X0PA 1NHUA 1ZPWX 1ELOA 4B3RF 3BSAA 2LU1A 3QIDA 3KJQB 1VHFA 1U6ZA 2D41A 4JI6J 5I3UA 3JSBA 5CQGA 4ZDNA 3QJJA 2DNGA 5GAEU 3S8SA 4PQUB 1T03A 4HI1A 3MTKA 1U25A 5LMNJ 2HQCA 2RHQB 3W64A 3UDCA 1TP7A 3DDKA 4GVBA 5DDOC 2HZCA 4PXBA 3H5SA 4USVA 3VAJA 3M8QB 2ZZNA 4I64A 4H4KA 1G7CB 5GADI 5J2MA 1B0VA 2XMTA 1VQLS 4WKRA 3R97A 2FJXA 3K5LA 2HKEA 4IDKA 4EK2A 3SFGA 2GQCA 2PA8D 1KQSR 3H2LA 3EUNA 1HHSA 4JV2A 1H2VZ 5AXLA 1O6XA 5HP1B 3M32B 2MEWA 3PEJA 1AB8A 4ES1A 4LF4F 3FJ2A 1WD6A 2B43A 2YKOA 2JHEA 4WK1A 3BGUA 2Y8WA 1CS4A 3T1HF 1Q1KA 2XMKA 1DTTB 1IBKF 5L1KA 3EXYA 3NOGA 2OFHX 4N47A 5HO4A 1HQUA 2XMVA 2RUSA 4MFBA 2XS5A 2HG4A 1NJWA 1C0UB 3QRRA 1IKWB 1JJ4A 1WTFA 1RISA 4DPYA 3LP0A 1PGZA 2XO7A 1YRTA 3LOUA 4N5SA 4DFMA 4UZCA 3AB4B 4ZJQA 2D74B 4KO0A 1FHTA 3M8YA 1U49A 1SC6A 4NWBA 2MHEA 5ETKA 4Y28C 2OKQA 4DR5J 1UPMB 3QGHA 1S12A 2E9ZA 4L3KA 5DQGA 2ZWPA 3RBDA 1JLFB 1KWMA 3CCZA 3PX4A 2HNZB 1U1PA 2EFOA 2M2BA 3HFKA 3VF0B 3GFYA 4QR2A 3QRPA 2I9SA 3CMQA 2EBEA 1HR0F 2J8AA 2KFYA 4FBTA 2K3KA 4LBPA 1KOOA 2RQMA 2ZJRQ 2KRBA 2I38A 4LF7J 1LWEA 1V3SA 3D6MB 2G4BA 3HF5A 4PUOB 2LLZA 1NKEA 1RWKB 3HX9A 2BW2A 4NX9A 3MEDB 2V8HA 1OIAA 2QGFB 1VQKS 2F5GA 3I31A 2QMXA 3G87A 1CBKA 4ZHRA 2KI2A 5BYQA 2DYAA 4IR9A 3PV8A 2DT9A 3L4BC 1FT8A 1NSAA 4ILRA 1K0VA 1VC6A 2B5JB 3SCJE 2PSZA 3OUYA 2AV5A 4DSFA 1TK8A 2KVIA 2X1FA 3CD5A 3MEEA 4B02A 3GJSB 3QLHB 3C6TA 4NMXA 4PYAA 3O6QA 2XZTB 2C1EB 1T11A 1SV5A 3D67A 4IQMA 4LVOP 3WX4A 4RL1A 3HHKA 5AJ3F 3I56S 3PM9A 1OY8A 2LXUA 4I56A 4OV1A 1JJCB 4DHVA 5ETMA 4ZLPA 1W7WA 2RKIB 3H90A 2W25A 3TJ9A 1HNVB 1PBUA 4JI1F 2RVJA 4DU7A 3KJNB 1NPKA 1VLYA 1G1XA 4U96A 2UXCF 2NS1B 2HWTA 3K2YA 3ILJA 4HACB 2VOOA 1WC6A 4MAKA 3TUZC 4X62F 3NOCA 2RQKA 2G2OA 2JRSA 1LW0B 4DR7F 4QWAA 2XQCA 3H2UB 4YS2A 2IYIA 4UY85 3I6PA 1RT4A 4IQXA 2F7VA 3HP6A 1OMSA 1T95A 1DQAA 5KFJA 3MZIA 1SC3B 3NMRA 1Y4ZB 4JYAJ 5CYMA 3DLEB 1RLCL 1Q7YT 3VVTA 4ZVUB 4NCBA 4OI2A 2OPQA 4L73A 4CTAB 2XWYA 2ZWOA 4CI0B 4OZ3A 3M6XA 1IBCB 1FJ7A 4PG7A 4C97A 4URQU 3GB0A 2QT7A 1Q8BA 4IYQA 3CIZA 3A3PB 3CCES 2COLA 1V6HA 1RE1B 4NCAA 3EWGA 2VKZG 3GV5B 1BQNB 4O44B 4RW7A 1SH0A 1RT5B 3HMJG 4NRTA 4MKAA 2ADBA 3EPGA 3VAGA 1APSA 2HIYA 1NPPA 2V69A 5KFZA 3DFEA 4X4NA 4CH7A 3T9NA 3PHTA 2MKJA 1MU2B 4LRCA 1VDHA 3H0PA 4WPAA 2WBMA 2XTJP 2XULA 3GLJA 2DGUA 2QSWA 2V2QA 3GV7B 3DRSB 1RCOB 4LT6A 1HBNA 3CJ2A 4RBTA 2CJAA 3QZ7A 4DQSA 3PW2A 1KHWA 3IAS9 4CT8A 3JTNA 4I6AA 1S76D 3SBMA 1I6JA 2GC8A 4ECTA 2RU9A 1T9UA 1HIYA 5E3QA 1PCAA 1B4SA 3EDRB 2H4WB 4IR1A 3IXQA 1JLQB 2VKRA 1I94J 2DISA 1NSPA 2IDEA 2YTCA 2G0CA 4B9LA 5KFMA 3QBCA 2B7CB 2J9EA 2VASA 4ZVQB 4HHHA 3KNGA 1F3FA 1TZ0A 2WCXA 2IAJA 1EB0A 1TL3B 4C7QA 5KFDA 4NLDA 2CQGA 1EZZB 4DPOA 1IVZA 2B9EA 5D0RA 4YB7A 1FTCA 2O67A 5KG2A 3NGUA 4ECXA 1PC4A 3FRYA 4X4RA 4NZ0A 4ZOSA 3SQGB 5LMUJ 4NLTA 3FKBA 3I9V9 4ZVOB 2FJBB 1I51B 3L3CA 3Q8YA 2VQFF 2CJKA 3F56A 1MROB 2GJFA 4PWDA 1ZAVA 5JVHQ 2DY9A 2BUNA 1KNZA 2J7WA 4B9UA 1R8AA 3GWCA 3M2VA 4C11B 1Y00A 3T5LA 5M2PA 1U1RA 2OH2A 2WB1D 3TWZA 5HLFB 2HVDA 4YMEA 2FHOB 1XNQJ 4WZQA 5DO2A 3OFEA 2OPRA 1JJHA 4WTOB 2F8HA 3CXCR 4CQ1A 3VHQA 3ZZUA 4DFKA 1PYTA 2FLOA 2CDQA 2D3OR 1NDKA 3MR7A 5A6WA 2OMOA 2ZJQQ 1YJUA 5IT9Y 1SKSA 3TRGA 4MH8A 4ICLA 2L41A 1D9AA 1RK8A 2UUBF 4KRWA 2YNFB 4ED2A 4G1QB 3VWSA 1FJCA 3AODA 4K4TA 1K1QA 2ZNYA 3SCKE 2IHR1 3EGVA 1S1VA 5KFWA 4YB5A 2WZ1A 2RUGA 4KGMA 1N0UA 2FPHX 1TVRA 3TJAA 3EGWB 2OTJS 3W5XA 2BKNA 4KHPJ 3BDEA 5ETSA 2BKOA 2DY1A 3GV8B 5HROA 1X4DA 5J1NA 5IXUA 2BKPA 1VRUB 5FIIA 5THWA 1UWBB 3HXMA 2VJVA 4Q44A 3MPVA 4C3MA 2N3OA 1EETA 2A3JA 3OL6A 2BABA 4IOBA 1QVFR 2RRAA 3JS9A 4YEAA 2X1GA 4W90B 2IY5B 3C8YA 1DARA 1UP1A 1RHRB 3JXOA 2K1RA 3D1OA 1GK8A 3C15A 1MWQA 1RTDB 3EVOA 2BEFA 4KE5A 3CB4A 1SBRA 3U1LA 3MM9A 1M5KC 3GP9A 4OYZA 3O8WA 1YBAA 2P2CB 2XSFA 5KFKA 3HD2A 3Q83A 4USWA 4LRAA 1JKHA 4M5NA 2YH0A 1S1UA 1LNQA 7FD1A 2BJ1A 3PJWA 4PG8A 3PFOA 2G0IA 3NNAA 1R0CB 3Q89A 2BJ3A 1RGVA 5J2PA 3JSMB 4MKBA 4EZ6A 3KLFA 3D6FB 4YR0A 2R7TA 4CO3A 2YWGA 1S59A 4TU9A 1JB0C 3U1NA 2V8VA 3CDAA 4DR4J 1LWCB 3UDVA 1U1KA 4ZN3A 4HDHA 3DC2A 1NK6A 4QYZK 2IM3A 3G8TA 3R9LA 1HYSB 5ETPA 2BRLA 3J7YI 3K8VA 2RRNA 4K0KJ 1XBWA 5EX3A 3E8OA 1OPZA 3MR2A 1GMWA 2IYGA 5M2RA 2A2DA 2XC9A 2ZD1A 4DV0J 1ZH5A 4JI0F 3CPWR 2B8PA 2ILZA 2ZBPA 1CSJA 4EMDA 1R31A 5C42B 4DUZF 4NCGB 1HHTP 2QN6B 3QATA 4PKDB 1FD2A 4X65F 1VQ6S 3W5YA 2YBVA 5H9EJ 5T14A 1Q81T 1UFWA 3DLGA 2YKPA 2MYFA 3IRWP 3D0IE 2LEAA 3A3NB 4EWTA 2ZFHA 1BQMB 3D6TB 3JYTB 2D9PA 3R5DA 1TUVA 4DSLA 3C14A 4K5RA 3GQCA 2WBRA 4HKQA 3IO1A 5EGYA 4DJBA 3W2WA 3EYZA 2XCPA 3N6MA 4FXVA 4KV8A 3FVYA 3ZNUA 1SVDA 1V5VA 3S6EA 3RB0A 2Z56B 2Z2MA 3PY8A 1J5EF 3M8ZA 3KLGB 5KFPA 2X3DA 2ROEA 2YWWA 2E5HA 3J7A1 2JVOA 4NYPA 1ZOTA 4DR6F 2XY7A 3OR2B 2D69A 3W65A 4WFYA 2DHSA 1C1BA 4JV0A 5I4MA 5DM7Q 3OTBA 2HHWA 2OI2A 4W4MA 4AUKA 1PYOB 3DI6B 3NNHA 3MCSA 2AJQA 5JUMA 2J7KA 4DDFA 1A6LA 4BCAA 4B3OB 3RTVA 4WIQA 4YY3J 2HZVA 4A48A 4LFCJ 3A8KA 1J5OA 2V8PA 4WF9Q 1ZTTA 1KS2A 1P27B 3K8WA 4MYTA 3UVJB 3BPSP 2P9EA 1TR0A 3EE3A 2XYHB 2VFSA 4M5KA 5U47A 2YKNA 4M5DA 3MXHP 1Y9OA 3K5MA 2AX1A 5C25B 4I1TA 5C24B 3GR0A 1WF1A 2RDJA 4IOAQ 8RUCA 5KT3A 1WC5A 4TVAB 5FDLA 2FVQA 4OZNA 1YLXA 1S97A 2E1AA 2DGSA 1S9FA 2DITA 3L7PA 3N28A 1JLGB 3NAIA 4ZN1A 3AH6A 2UUWA 3M6WA 4ERDA 5F3ZA 2ZVSA 4F26A 2HURA 8AT1B 3PYGA 5LSRA 1HD1A 3DM2A 1U47A 1F9HA 1UKUA 2DD8S 5CH7B 2OAUA 2AGPA 2RS8A 2HQ3A 2O3DA 3OL8A 3ENWA 4ELUA 4K8RA 2LECA 1ACMB 2MZTA 2GHPA 1K9MT 3TX0A 1NRKA 4Z2XA 1YJTA 4CLYA 3F73A 3AA9A 1UVIA 4R0EA 4OI0A 5K20B 3B4MA 4DPTA 4O4RA 2PIIA 2V4QA 4KSEB 2IRYA 1VC0A 1FK9A 1REVB 2CQCA 2CDRB 3ISNC 1ZM4A 1DFDA 2QA4S 1RBLA 1QLNA 2HFSA 1QAYA 1UA1A 2VBYA 3OXGA 1PILA 2J0SD 2ASYA 2GCFA 1TKXA 1V5IB 1X9WA 4I68A 2IVYA 4DL6A 1RWNB 3FFIA 1WEXA 3EPIA 2P9GA 1VK8A 3BF4A 4JI4F 4HVZA 2HHHJ 4ZLLA 2GQQA 3GIMA 2HEKA 2FHMA 2ACYA 3T19A 3VCDA 5T7LA 1T9VA 5KFAA 2OGUA 2CFXA 3LGMA 4GRSA 5E5NA 5GAHU 2VF3A 4QW8A 3TVZA 1B0TA 1OJ4A 3R5JB 1URNA 4DPUA 2XSJB 5GMDA 4B3SJ 1RT3A 1FEEA 3QGIA 1FKPB 4DG1B 3N5FA 2EFQA 2HNDB 2HQFA 1UCNA 2HHUA 5L46A 3EXCX 4OX9F 3W7BA 4GO5X 4ZCMA 1VQ7S 2AU0A 4IG3B 4DR1F 2KFZA 3PZPA 3RB3A 3T9ZA 1VRQC 1JX4A 3LA0A 4H4OB 1QY7A 3UPFA 4ECYA 4E8UA 2X3GA 3M8QA 5GAEI 4X4VA 1YSJA 4DX6A 1BWVA 4Y00A 3KJFB 2VA3A 3QIPA 4HI2A 2BQRA 1JNZB 4OI6A 1TL7B 3OSPA 2MQNA 2WRMA 3DRPA 5SUHA 2B9WA 1SIWB 1SKWA 1UAWA 1N33F 4IFYA 3F41A 4CLFA 2W8KA
chains in the Genus database with same CATH topology
2AP6A 5A8KB 1U1MA 1JLEA 5B0GA 3M9MB 3LALA 4WYLA 1Q4RA 3RAMA 1H6KX 1VI7A 5CYJA 4Y0FA 2ZZMA 4ILLA 2UXBF 3GIKA 1N36F 5HP1A 3M32A 5DG9A 2RU3A 2PMZD 3D1QA 4RWWA 1KLMB 1BD6A 1N54B 4OX7A 4BWMA 1HBUA 4DQPA 3IAM9 1MMNA 1S0VA 2MZRA 2ZKTA 2MSTA 3H59A 4ECVA 3NGDA 1R3NA 2HHHF 2B3TB 2DHXA 4A47A 3K58A 1TV6B 4Y3CA 4FF2A 4Y65A 2HGMA 4C0BA 1IKXA 3J81Y 3Q2SC 1VQ9S 1Q53A 3F44A 2UP1A 3AJ2A 3US5A 1CEZA 2LEPA 1DTTA 3DYAA 4RUAA 4DMZA 4KAIA 1Z4UA 2RF2A 3DOLA 2GJIA 3MGJA 2A1BA 2D9OA 4O3PA 5K8OA 4QW9A 2RSQA 5BJRA 3T1YF 2MQPA 1T94A 1MSWD 2CPXA 5A8WA 4Y34A 1N5SA 1U2RA 2OPSB 3CDEA 1MMLA 1IR0A 5KFVA 3IG1B 5KT6A 3ZFVA 1GX5A 3S1TA 2PFFB 3DLGB 2DO4A 4AYBD 1IJEB 2Y1JA 2HHSA 2JLFA 1C0UA 3RU0A 1VQ8S 4JUZA 4R5PB 2BE2B 5KG5A 1QAJA 3V4IB 3NNCA 3JSRA 2M0GB 1YGYA 1TQLA 4G3IA 3WBZA 2MJNA 4CO4A 1JLAB 1QUVA 4QIEA 4M63A 1O0PA 2ZUGA 3J7ZT 2XNQA 4BC7A 5L38A 3OLBA 2BXJA 2VONA 3PXGa 3FEYB 3OW2R 2UVRA 1UWBA 2OPQB 2IVFB 3A8EA 2W9BA 4QPTA 4P7VA 3G9CA 1KSPA 2XI2A 3O3LA 1SB6A 4B3SF 2UZAA 3BN7A 2KZZA 3RRGA 4OJ3A 2BBEA 5GAGU 1F60B 2W8LA 4NLVA 1MW7A 2IM1A 4I7FA 2AW0A 5A8RA 3VTIA 1U1OA 3KFWX 1RWUA 3DMJA 5T41A 4H4MA 4RNOA 1VJWA 3HI9A 5EWFA 2R7UA 4QWCA 1XNRF 4OZJA 3ULHA 2QMWA 2ROGA 3PRBA 2B4VA 4TLRA 3RB6A 4ECWA 1FCAA 3DRYA 4WFZA 1TFWA 3ZZTA 3BO3A 1JIHA 3CDWA 1AW0A 3IBWA 5LXYA 4LIWA 1OS5A 1U2FA 3OVBA 4RU9A 3CJ5A 4RBVA 4LF6F 5B0DA 2EPIA 2UVVA 2JC1A 2RIJA 3SSSA 2HNZA 3PW5A 1KFDA 2PI4A 5D4NA 3AY0A 3Q8PB 1KVJA 2FC9A 1M0SA 3GSDA 2I5JB 3H20A 4ZP8A 2D7SA 4OZ0A 4C2MA 4ZPCA 2XI3A 2WTFA 4Z37A 1RDRA 1SJ1A 2DNHA 4FF1A 2NUHA 1S99A 3I4HX 3PFEA 4G1PA 2KH9A 4RW8B 2FHJA 4F4ZA 5L1IA 4N77A 2YX4A 3O5TB 2KHDA 3OR1B 4ED6A 2DR5A 2JEFA 1X4FA 2YKMB 2FY1A 2NR0A 2JX2A 2VG7B 1OSDA 2V4JB 1C2PA 2MHNA 1Y0HA 2YNIB 4BS2A 2NQPA 1S48A 2VOPA 3CJKA 1SJQA 4ZVFA 1TFYA 1B7FA 1RT6A 1R7IA 1NK8A 5K14A 1HWLA 4A8SA 5DQIA 3MR6A 2L9NA 1YJRA 4I0WA 3LANA 3J7Z5 2UUTA 5DS7A 2XY5A 4I2PB 1J5OB 3DXBA 4R0JA 4CIOA 1P8GA 2HFZA 4K4YA 4TY8B 1FEHA 3FSYA 1H38A 4M1KA 4PUOA 4HT5A 4TQSA 1A7GE 4Y2CA 3MEDA 4AXJA 1B64A 3CJ0A 3LPYA 2GJ2A 2VPXB 3KK1B 1VQYA 2JZ5A 2WSFC 2JSXA 3SMZA 5B0AA 4XIUA 3H5UA 1HBNB 4NLUA 4N8OA 2C28A 1F5BA 2K8GA 1S1TA 3JAMY 3I96A 2EFNA 2YKNB 3OL7A 1HBOB 4M5DB 2JFDA 4XO0A 2DNZA 3ETOA 5EDWA 1U7LA 2MZJA 4LSNB 3CDUA 4CZCA 3CD0A 5I42A 3CCLS 1BWEA 4BHQA 2BACA 2DGOA 2HHPA 1W2BR 2VUGA 2LEBA 3MMJA 2V8DA 4OX6A 2RJZA 2V0NA 2XMMA 1TKZA 3L7OA 4KQZA 1S10A 2DPIA 4ID5A 5KG1A 1ZYQA 3SEOA 2DH8A 3UD3P 1OQ3A 4A8WA 4F25A 3EZUA 1H3DA 3MUVP 1RTJB 3ZC4A 2LVWA 3FZBA 3MM7A 5FDLB 2ZH5A 1WEZA 4ZCLA 5HN0A 2HQIA 2I2YA 1FJGF 4RX6A 2EG1A 4DLEA 1G2EA 2BA9A 3OXFA 4ES3A 3HHEA 3QLHA 1GAOA 1HWIA 2APOA 4EUVA 1ZAXA 1ULRA 1HMVB 1HI1A 1ZBTA 1N34F 5K8MA 4Q0BB 2B4PA 3FCHA 2E29A 5L1LA 1LWCA 4DR3F 4ED8A 1DQ9A 3SDEA 2C42A 3CCMS 4DOZA 3HVRA 2FJVA 2M5YA 2P9CA 2NXUA 2KDOA 4HYKA 1S9GA 4NXNF 4GMKA 3GYXB 5DDQC 2MZSA 1IKYB 4X66F 1X0FA 4IH7A 2WONB 1DURA 3QGGA 1U6FA 1FRXA 4QIWD 3OVSA 5D4LA 2IAJB 4DQQA 2OFGX 3DM2B 4K5SA 4YHHF 3PVXA 1N6QA 4F4KA 2HHQA 4PG5A 1Q79A 3IRXB 2VZ9A 2RKIA 5G4DA 1F5CA 4PPZA 4NXMF 3CVKA 1HBMA 1UL3A 3NWGA 5HMWA 4J9OA 4HHJA 1HNVA 4OQJA 4KPYA 3C46A 1O8BA 2DBBA 2LQ5A 1CQMA 4PWUA 5E3PA 3ZZZA 2CYYA 1X8DA 2BANA 4Q2MA 3NAHA 3THPA 5CA5A 4QWEA 2WSEC 4ZPTR 3HDSA 1FKOB 3N6LA 3OBIA 2RQ4A 4KFBB 3KHHA 6FDRA 1XK8A 4C3KA 1S9EB 4DV3F 3MDFA 3LAMA 4EBCA 4QR0A 4O3RA 2VH7A 4MYUA 4ZPBA 3D28A 5AXNA 1T05B 2EG2A 1A9NB 3CCTA 4W92B 1WWHA 3AA8A 2ZH8A 4MK8A 3ITHA 1WF0A 4ZP9A 1NNDA 2MZ1A 6FD1A 3G6YA 1T02A 5C42A 3M9NB 1N5YB 4NCGA 4DV4F 4RW4A 3TI0A 1TAQA 4MIAA 3ZZYA 1HL6A 1NK7A 1EP4A 1LW0A 5B0BA 2IC3A 2IMWP 3CCUS 4Y2IA 3M6UA 1LK7A 5DGBA 5DG7A 3P5TL 2DB1A 3I4PA 4R8UA 3DOKA 3MECA 4WFNQ 3AQOA 1G3OA 4RBUA 2W9CA 2HRYA 2B51A 1FK9B 4TXSA 4WXWA 1U45A 4IKAA 2JEGA 1URRA 2XGPA 3CJ3A 4I2QB 4KKOB 3N0VA 2CZ4A 4XK8C 4RW6A 4CT9A 1NK9A 1X7VA 3BO4A 2E1RA 3JYTA 4ES2A 2FB0A 2KXNB 3OJUA 4EO8A 3N01A 3HHNB 2CJBA 2J9DE 2HMIB 4NL5A 5J2NA 2HFNA 3CCQS 5DRKA 4OHYA 5LSOA 3DHWC 2M3DA 2F8MA 5KG3A 1WI8A 1X9SA 1TKXB 5I3PA 2JEJA 1LXJA 2P6SA 4YUDA 3CDBA 2O5DA 2Z4PA 3L95X 5DDPC 2AJ4A 1HPZB 2F4VF 3T5KA 2M70A 4ECSA 4OZ5A 3DLLQ 2ZDPA 4DN0A 4R25A 1FKAF 3LWLA 2VG5A 1RYSA 2O66A 1D9DA 4NA3A 5EN1A 4QIGA 4QZVB 4IG0B 4B08A 5B0CA 5F8LA 2HYIB 2FLNA 3V6DA 3MAHA 1UA0A 3KLVA 3I87A 2GO9A 2E5GA 3NL0A 3CF5Q 1VQPS 3BQ1A 1LQ9A 1VRTA 2FIUA 1WTBA 4CNYA 1VIXA 1U24A 4C8MA 4QWDA 4V19J 3K57A 2DNOA 2CQBA 2DGQA 1S6PB 3BR8A 2HGLA 4DF8A 2DIVA 1TL1A 4A8QA 4ZP6A 3POTB 4DL0C 1WI6A 1QJHA 1X5PA 3GFHA 3MURP 2ADCA 3V6JA 3NCPA 3B4DA 1FDDA 2MKHA 4ICLB 3DLKB 4DV6F 4O44A 3V81B 2UVUA 2HHVA 2CKWA 5LSLA 5HBMB 2O01C 1S6QA 1SXLA 1RT5A 2CRLA 2UV8A 1F2GA 2I1RA 1RT7B 4QU7A 3S01A 2V94A 4IFVB 5E41A 1OO0B 3MWBA