1HA1A

Hnrnp a1 (rbd1,2) from homo sapiens
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
173
structure length
167
Chain Sequence
EPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKVDGRVVEPKRAVSREAHLTVKKIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHNCEVRKAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Nuclear protein
molecule keywords HNRNP A1
publication title Crystal structure of the two RNA binding domains of human hnRNP A1 at 1.75 A resolution.
pubmed doi rcsb
source organism Homo sapiens
total genus 51
structure length 167
sequence length 173
ec nomenclature
pdb deposition date 1996-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1ha1A01
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1ha1A02
2ERRA 4M5DB 2JWNA 4YOEA 1JJ4A 3VALA 2LCWA 1HL6A 1SXLA 2YH0A 2MZSA 4CH0S 3B4MA 4IOAQ 1VQLS 1UAWA 3G9CA 1WTBA 1Q82T 3LPYA 2X1GA 2CQGA 1WEYA 2N3LA 2MZ1A 2J76E 3PIPQ 3Q2TC 1R8PA 2HGNA 2M4MA 1X0FA 2DO0A 2KG1A 2AYGA 2OIHA 1X5SA 3P49B 1YWXA 5DETA 1VQOS 4LJMA 4BS2A 2KHCA 4WFNQ 3CCQS 2QEXS 2K3KA 2FPHX 2E5HA 1VBYA 1X4BA 1VQ5S 2CPXA 3MURP 1VQPS 1KOOA 1X5PA 1PO6A 2BOPA 2KH9A 2LECA 4W92B 3S7RA 1U1KA 2NLWA 1SJ4P 2CQIA 2LA6A 4WCEQ 3ZZZA 3MDFA 2CPEA 2G1DA 3BS9A 3CCSS 2DNHA 1K73T 2DNPA 2PEHA 3IRWP 4C4WA 3B4DA 4QQBA 3VAGA 1N8RT 2E5JA 2OSRA 1ZZNA 1JMTA 3L3CA 4J5OA 4WFBQ 3UD4P 2MQNA 3G4SS 3P3DA 2KM8C 1OO0B 2MMYA 2LQ5A 4ZKAA 1QVFR 1Q7YT 3K0JA 2DK2A 2MGZB 1YTYA 2OTLS 3D2WA 5JVGQ 2M7SA 2M70A 3EGNA 3J7ZT 3G8TA 2O3DA 3FEXB 4ERDA 2YWKA 2CPDA 1OIAA 2VODA 2CPYA 3NNAA 1P27B 2L08A 3JB9k 1OWXA 2RRAA 1QVGR 2KXHA 2F3JA 1DZ5A 1FJCA 4A8XA 2RQCA 1Q86T 2MJUA 4U67Q 1B7FA 3SDEA 1D8ZA 2ADCA 1WG1A 2CPHA 2U2FA 1U1PA 1K9MT 1NO8A 1X5TA 3S01A 3CCRS 3BEGB 3BO4A 2KRBA 3SXLA 1YHQS 2KXNB 2KFYA 1L3KA 3TO8A 1YIJS 2MSSA 5H1SV 3LQVA 4PR6A 1VC5A 3CCJS 2FC9A 1U1LA 2XNQA 2G4BA 4EGLA 2AYEA 2LYVA 2CQ0A 2PE8A 2FY1A 1A9NB 3ZZYA 5D77A 1KOHA 2DGOA 3CUNA 2HGLA 2L41A 2CQ4A 2D9OA 3U1LA 3MUVP 1WI6A 2UP1A 1O0PA 2MZQA 4YUDA 2L9WA 5LXRA 3G6ES 1UP1A 2MKIA 3HHNB 2RNEA 2KYXA 5IM0B 3RW7A 3DLLQ 3MI7X 2J8AA 2VONA 1VBZA 1WG4A 2DIVA 4P6QA 2DGVA 2MB0B 3CULA 5IFMA 3SDEB 1SJ3P 1DRZA 1XN9A 2J0SD 2DGQA 2LXIA 3J7YU 2OSQA 2RS8A 2DB1A 3IWNC 3CCVS 2E5IA 1D9AA 2I38A 2MGZA 5GVQA 5IQQA 1JJ2R 1R8HA 1X4GA 1RKJA 1IQTA 1HA1A 1VQKS 2HYIB 2GHPA 2KU7A 2OJ3A 3CCUS 1X4DA 2MXYA 5GAEU 1U6BA 2DHSA 2CQ2A 3VAHA 5LJ3Y 3VAIA 1U1OA 4C0OC 2EVZA 2XB2D 5MLCV 1WHWA 5DDPC 3UD3P 3PIOQ 5GADU 5LJ5Y 2MZRA 2DNZA 2K8GA 1VQ8S 1FJEB 2MSTA 2M0GB 3VF0B 3I55S 1H2VZ 1URNA 4Y0FA 3UCZP 3VAJA 2ZJPQ 5HL7Q 2MHNA 4YB1P 3R1LA 1WF0A 4UQTA 3CMAS 2RQ4A 4Z2XA 3NNHA 5JVHQ 5HO4A 2KG0A 3FEYB 2MKHA 3N9UC 4IO9Q 3CC2S 2DGXA 2YKAA 1G2EA 2DGWA 1X4FA 1QM9A 2CPZA 3P6YC 2DHGA 4OZ0A 2MKJA 2AYMA 1ZZFA 4WF9Q 2DHXA 2E44A 1YJWS 2DNOA 1U1QA 1M5OC 1FJ7A 2HVZA 3EX7B 2MY7A 2RS2A 3CF5Q 1VQ4S 4FXWA 3MD1A 1UFWA 1VQ6S 3NMRA 2CQDA 2DIUA 4RU2A 3UWTA 5IM0A 2LMIA 2HZCA 3H2VE 4PKDB 1H2UX 1U2FA 3SMZA 3MOJB 1M5VC 3MXHP 1FT8A 2KN4A 1H2TZ 3CXCR 5BJRA 2LA4A 2EK1A 3NS6A 3I56S 3THPA 2XNRA 3NNCA 1N88A 1NJIT 2DNMA 1VBXA 2DNLA 5ITHA 2FHOB 1VQ7S 5LXYA 1DHMA 2RUGA 1YJNS 4WIIA 4WKRA 3S6EA 2DNGA 2CQPA 2KI2A 2CQCA 4CH1A 2F9DA 2HGMA 2G0CA 1X5OA 2LEBA 2CJKA 1W2BR 5FJ4A 3UCGA 1WEZA 5EN1A 3TYTA 2KVIA 2MZJA 1VC0A 2QA4S 1WHXA 1U1MA 2DITA 2RRBA 1M5PC 2DNYA 2MZTA 4CIOA 3H2UB 2B0GA 3TP2A 4UY8T 2MQQA 1VQMS 2MQLA 2GO9A 3G96A 4V19X 5D78A 1WWHA 3CCES 2YTCA 2FC8A 1FXLA 4TU7A 2M88A 3UE2A 3CMES 2CPFA 2ADBA 3P5TL 1FHTA 3MUTP 2J0QD 4TLQA 1HD1A 1WHVA 2CQBA 2RU3A 4FXVA 1SJRA 2DO4A 3CPWR 1ZH5A 4F26A 2M8HA 2LKZA 2U1AA 4IOCQ 1X4EA 1DBDA 1YI2S 3DXBA 4IUFA 2QFJA 2AD9A 4Y00A 5DDRC 5CXTA 1S79A 2WBRA 2YH1A 1BY9A 1PGZA 4QU7A 3BO2A 3RW6A 3ULHA 2MKCA 3VAFA 2XS5A 1X4AA 2DNKA 5CA5A 2N3OA 5GAHU 1H6KX 2DNRA 3G8SA 2JVOA 2JX2A 1NU4A 1YJ9S 4LIRA 2E5GA 4ED5A 1WHYA 2X1FA 2M9KA 3R27A 1P1TA 2MKKA 2A3JA 2CQHA 1FNXH 3CCLS 1WEXA 2OTJS 2RT3A 5GAGU 3OW2R 1KC8T 3CCMS 1M1KT 2LEAA 2CPIA 2XS7A 2V94A 1KQSR 2LXUA 1WF1A 2KXFA 2MPUA 4OZ1A 2SXLA 2MY8A 2DNNA 5LSOA 1CVJA 5DM6Q 2M8DB 4LMZA 3NS5A 3R1HA 5LSLA 2JVRA 2M52A 3US5A 2X1AA 4F25A 4WFAQ 2ZJQQ 2D3OR 1WG5A 1K8AT 3EGZA 2F9JA 1U6FA 3CTRA 2CPJA 2DGSA 1WELA 1JJHA 2BZ2A 4TU9A 2KT5A 2N7CA 2MJNA 3MUMP 2XS2A 2VOPA 1SJQA 2M2BA 2MYFA 1F9FA 4W90B 1YITS 3VAMA 5DDOC 1OPIA 1U1RA 4QPTA 1WI8A 2CQ1A 4C7QA 3CC7S 1VQ9S 4QU6A 2DISA 2DH7A 2KM8B 2NZ4A 1VC6A 2D9PA 2DNQA 2JRSA 3CC4S 1A7GE 2DH8A 3HI9A 2MKSA 3G71S 1AUDA 1M90T 1WF2A 2CQ3A 1N52B 2DHAA 2Q79A 1X4HA 1HD0A 2I2YA 2RVJA 2KRRA 1RK8A 3MD3A 1X4CA 1VQNS 5GMKa 3CD6S 3V4MA 3BO3A 4TU8A 5DM7Q 3UCUP 1N54B 2MQPA 2X1BA 2EK6A 2N82B 3Q2SC 2ZJRQ 4F02A 5CYJA 1FO1A 2DH9A 1U1NA 3U1MA 2DGTA 2MQOA 5DDQC 2AYBA 4PRFA 1UW4A 1M5KC 1S72S 1KD1T 1SJFA 4CQ1A 2VOOA 1Q81T 2XSFA 3THTA 2MQMA 2DGUA 3S8SA 3VAKA
chains in the Genus database with same CATH superfamily
2ERRA 3OXLA 1NSQA 2YH0A 1QAYA 2C2OB 4HT5A 4EZ9A 1BC6A 5HQ8A 2GMLA 3LPYA 1PC5A 3RG6A 2H5EA 1U09A 4C8OA 2HGNA 6FDRA 2OIHA 5HSPA 1EX8A 4KV8A 1NAQA 1U02A 1KOOA 3D0HE 4PQAA 3QJJA 3D3CJ 4K5SA 4O4GB 4DSEA 2J5AA 3IWXA 3DYAB 3DRRB 4EK2A 1BUXA 5K20B 2OAUA 5LMUF 3K0JA 1YTYA 4EEYA 2HHVA 3CJ2A 3J80U 1NHKL 4CLTA 5HJXA 5DS7A 3JQMA 1AROP 3QAEA 2H65B 1R6VA 2AP6A 3UD5A 1N5QA 1HBMA 1UVKA 3I4PA 5A0YA 3W5YA 3MEEB 4CT9A 2ZZTA 4IFVB 3CJKB 2HVDA 2N4CA 1VRTB 3BEGB 2PI4A 4J9SA 2CXEA 3QWUA 1HBOB 1NDLA 1OY9A 2CWXA 4PR6A 3W7BA 4EFAC 1ROFA 3EGWB 2RDDA 4Q45A 4N8NA 1IBLJ 2BVZA 2B8QA 3C6TB 2KYXA 4EBCA 4UUXA 2DGVA 5IFMA 4OYAA 1KTVA 3GONA 2MGZA 4B3RF 3TAMA 1ZPVA 2OMOA 3JAMY 3C16A 2X3DA 1HA1A 2MXYA 2AJ4A 5AJ3F 1XBWA 4C3LA 2HW3A 3KJVA 3VF0B 2HQDA 3PXGa 3SCLE 4UQTA 2B43A 3MAAB 4R25A 4NA1A 2QTWA 4ID8A 1VISA 1TTHB 4A8WA 4WXWA 3DLGA 4KYZA 4BCAA 3CD7A 1JJCB 3BQ0A 3KDNA 1FKAF 3GFHA 3HXMA 1FJ7A 1NEEA 4KHRA 1FD2A 1TMJA 3T41A 1S1VA 2CNKB 2IAJA 3UWTA 3OLAA 5IM0A 1HNXF 1FWPA 4OV6A 2XZWA 5I42A 3N4WA 3LAKA 1KHWA 3Q8RB 1VR6A 2DNLA 4OIXA 4Q2MA 1RTDA 2IDLA 4KHMA 1FI4A 1CEZA 3EYZA 3HM9A 2AX0A 4DR1F 3D0GE 1I94F 3KLIA 4DQRA 4C8ZA 2MZTA 4CIOA 2AX1A 5J2MA 2FC8A 2FHJA 3KLVA 2VKRA 3SI8A 3HVAA 5K9FA 5B7WA 3OFHA 2IRYA 1T3OA 3P45B 4DUYJ 2CNNB 2QFJA 3FKBA 3ISZA 3RYLA 3EXCX 3FSXA 2IVFB 3ICLA 1H6KX 5KT5A 5DLFA 2V0NA 4YR0A 3OTDA 3TVKA 4OZ2A 2OEKA 1LK5A 2M9KA 3DRSB 3R27A 2CQHA 1RHMB 3R6LB 3PV8A 1QUVA 4DR2J 4G65A 4DZDA 2HHUA 2KXFA 4OZ1A 1CVJA 3TUZC 3HJFA 3BKFA 2PT0A 4DPOA 3DRYA 2OP5A 4NEZA 2YNGA 3ZZTA 2RB7A 2C42A 3HKZD 1SJQA 1HNWF 2V4JA 3N01A 3GLJA 3W64A 1Q16B 2UUAF 1CPZA 1RWWB 1WI8A 3R5DA 4DHVA 1NPPA 5CABA 1ITPA 2XO6A 2IA6A 3KHHA 3HX9A 3O44A 1N52B 4AFFA 2HRUA 3PYGA 2AEJA 5DRKA 4Y28C 5KG7A 3JSBA 2YVSA 2QMXA 1WNEA 1JNRB 1FK9B 2P6TA 1DURA 1H73A 2FJBB 4UT4A 4M5DB 1LWEB 2DR7A 3VALA 1WC4A 1Q8BA 2E1MC 5DGBA 4I0WA 1CJUB 1UCNA 2ZUAA 1HMVB 1OYDA 1EKRA 2CQGA 4K59A 2N3LA 2FLLA 4PG8A 3O3LA 1R8PA 5AXKA 1LFWA 4O3OA 2OKQA 1RU2A 2R2RA 2D7SA 1VQPS 3HO1A 2DXFA 1F6TA 1CS4B 3CCSS 4DI6A 4B02A 1N8RT 4B9VA 3ET6A 4ZKAA 1LEOA 2VFUA 4P72A 2R7XA 1OIAA 4WJBA 1FEHA 3CJSA 4UW2A 1BD6A 1P27B 3W2VA 1N34F 2JC1A 1UEVA 2WBMA 2HEKA 4Z7YA 3W2WB 2U2FA 3L4BC 1WORA 1FXDA 3KG0A 1X5TA 5HLFB 3S01A 1YIJS 4ZPAA 2YWHA 1Q0NA 1WJ9A 3ZZYA 4EUVA 2CQ4A 5KG1A 2GNKA 4GKKF 3PJ9A 2AEFA 1Y00A 3RBZA 3FFIA 3QGGA 5B0FA 2YPYA 1U48A 1D9AA 3IWLA 4ZN3A 2RU9A 3IS9B 2QG9B 3B54A 3KK2B 1E6YB 1SQFA 1JJ2R 4QW9A 2IC3B 2HYIB 2RIJA 2FVCA 1U1OA 4J9QA 4C0OC 4B9SA 3PR4A 5K5MA 3ETOA 2RJZA 1HW8A 3AY0A 2K8GA 4NA2A 4I2PB 2IYGA 4DPXA 1KSPA 3MECB 2E9TA 3VZIA 4AUKA 3H2LA 2G1HA 2E1RA 1GT8A 2XG8A 4KBIA 2NXCA 5KT2A 1Q78A 1RXOB 3HHEA 1M0SA 2XYPB 4IR1A 4OI3A 4JI8J 3UDVA 4RWWA 2HQIA 4YDDB 4AE5A 4KSEB 2ASDA 3ZNJ1 5HQMA 5B08A 1FE0A 5CYMB 2KL8A 5HMZA 5HMXA 2V8GA 5T14A 2V34A 4MIBA 2OO4A 5F8GA 4I2QB 2I5JB 2OPSA 3UVJA 3L95X 2HHSA 4OHYA 3ENWA 2CJQA 3BR8A 3T1HF 4AL5A 5KFYA 1JLCB 1RWVB 1C4AA 3OBIA 5KFHA 2VFTA 2YTCA 4B3SF 4PYAA 2AJ2A 5B0EA 4C2MA 1S1WB 3V81B 4FVMA 4PXCA 4YY3F 4IOCQ 4RUAA 3TWZA 3TNVA 1IR0A 3UNGC 2W25A 4QU7A 1XIQA 3QRRA 1X4AA 4B3MF 4Z37A 4F8RA 1T05A 2OFGX 4GKKJ 5CD4A 2RT3A 3QGHA 2GFFA 3QLHA 4U9RA 1TL7B 4KTQA 3PR5B 1KP6A 4WFZA 3U1NA 3R1HA 1MU2A 4K5RA 2B6AB 2NYIA 5J2QB 1PBUA 1TAUA 4J9RA 3CJTA 4NLDA 3QSIA 3HT0A 4MKYA 3D7SB 2MYFA 3DMJB 3PZPA 4IRCA 2G0JA 4LRAA 5KFRA 4LF8F 5FLXY 1QUPA 4ZVHA 3OL9A 4Q0BA 3GZ7A 1YLXA 3HVWA 3R7BB 3U7JA 3T1YJ 2W4DA 2DHAA 1UEUA 1HD0A 2GA7A 1DTTB 4M5NA 2DVIA 3CD6S 4RW8B 4GVBB 2C2KB 4GKJJ 4N8OA 2YQ0A 2HVHA 1PJ5A 2ZBRA 1LWFA 2B9XA 3IMQJ 5DDQC 3DHXA 2LU1A 1S7HA 2BXJA 1HNVB 1CSJA 1KD1T 1T3NA 3PFEA 4HL9A 2MQMA 4JI4F 3MM9A 3UI3A 4CLWA 1CC8A 4CM2A 3M2RB 5BR8F 2HHWA 2W9BA 2KZZA 4RW9B 4UZCA 4RUHA 2GVZA 1SPBP 3C14A 4X4OA 2HHPA 2NCKL 2COLA 2DR6A 4WFNQ 4I7FA 1HR0J 1X4BA 1RACB 4LF7F 4RBUA 1VOMA 2XLKA 3EM1A 2LECA 2DNHA 4C4WA 4Q8EA 3X1LB 2AGPA 3IM9A 1SBRA 1SIZA 3UD4P 2OGUA 5KFFA 1IKVB 3KHLA 5AXLA 4YY3J 4FKXA 2WK4A 5JVGQ 5A8WA 3ENQA 3FEXB 1VLYA 1F5AA 2H1YA 3NNAA 1SC1B 1G4CA 1REVA 4L3NA 4RL1A 3CCZA 4N7TA 3OR1A 2R2TA 4DL3A 4CLUA 2F63A 1D8ZA 2ADCA 3BGOP 5G0RB 2CYYA 1JXEA 1T9WA 2ZBIA 2KFYA 4DUTA 1SL0A 1TL3B 1RDRA 3J81U 4DCOB 1TK8A 3M6VA 2W2MP 2YNHB 3GYGA 5HN0A 3KUGA 2UU9F 5KFPA 4USTA 3E8OA 3G6ES 5DG8A 1N0UA 3QATA 2ZFHA 1HNZJ 2QIFA 3DYAA 3DRRA 3MOZA 4LF8J 1XWLA 4PG5A 1T94A 1R8BA 5EX3A 2DXEA 1O6XA 1A6LA 2GHPA 2DHSA 2IFXA 2EVZA 2E7XA 4L76A 1HWJA 4XPCA 4GVLA 3OL7A 3GIMA 1WDTA 4IFVA 3CW2C 2GJFA 3AODA 1BHNA 2HIQA 2CAJA 2XGQA 1U26A 2MKHA 2QMUB 2YNIB 2DY9A 1HBOA 2J9DA 5C25B 2P5VA 2M3DA 2DBBA 2Z58B 3JSRA 2L3MA 1M5OC 1SH3A 2HFUA 4QWDA 3MZIA 2BDPA 3SSSA 2BJ7A 2P2CB 1NJXA 3SMZA 2R8JA 2KN4A 4KFBB 4B9NA 2LA4A 1F5BA 2Y8WA 3T6BA 4LF7J 1VYAA 3QQCD 1AZSB 4ZN1A 2RE1A 5FDLB 4NWBA 2XMTA 4KKOB 2RRNA 3QZ7A 1VFJA 3RRGA 1L3SA 2ROPA 3IXQA 4DV3F 2HFVA 2XLJA 1F1BB 1WWHA 3MAAA 4TU7A 4OYIA 2FVSA 2Y1LB 3VGSA 1SL1A 3P5TL 2W8LA 4IG3B 3ZTSA 4LT6A 2J9EA 2GGPA 2E7VA 3SFUA 4F26A 2M8HA 4CO1A 2OPRB 1MMNA 3DXBA 4PG7A 5IT9U 4DSJA 4DFMA 2G2YA 2YKQA 2AJ0A 3EXYA 1DJ0A 2B8PA 2DNRA 4USVA 1OSCA 1X9SA 4F3OA 3NKYA 3BV8A 4DQPA 2FY8A 1KFDA 3TQEA 5IZHA 2CPIA 4NLWA 3DLHA 4P2SA 2VA2A 3D28A 4MFBB 4CO2A 2SXLA 1SQGA 2OHDA 4BC9A 2JFKA 3CO9A 4NMLA 1T11A 4TVAB 4KGKA 5L39A 2D3OR 2VPYB 4DV7F 1UVNA 2HHHF 4EO6A 2HLUA 2Y1RI 4PEOA 3SZ2A 4ECVA 3KXDA 5E33A 3I31A 1OPIA 4LF2A 4DR7F 3F56A 3D66A 3BM7A 3W9HA 2ZH9A 2C3MA 3V6KA 3IM8A 1GNKA 2LQBA 3C6UA 1RE1B 2GIFA 5KFLA 2I2YA 4M5IA 3BGFA 2R42A 4LFCF 4ILLA 3V4MA 3K58A 3LANA 1X9MA 2EK6A 3DRSA 3Q2SC 3CGIA 3VQTA 4DL2A 1NK5A 2ZH2A 5F8NA 2NSCA 2XHWA 3G86A 5GAGI 2HHQA 2DGUA 1NCLA 5CCMA 3VAKA 5KFMA 1UPMB 2W2OP 3NAIA 3KK1B 3MMCB 4F50A 2H3EB 4URQU 3LW5C 1SC4B 1R43A 3P96A 1IXKA 3CCQS 2K3KA 5KG3A 2N7YA 4WZMA 3FSYA 3JTNA 3HK2A 1HPZB 3VVUA 2A10A 3KJFB 2OSRA 2VZ9A 5K8NA 3M8ZA 4YB7A 1NZAA 4RZRA 4K4WA 1UJ6A 2EBGA 4NRUA 3A3OB 3HSGA 1P6TA 1RCOB 1SV5B 5I3UB 4U7UD 2L08A 3O1LA 1HNIB 2KXHA 4M5DA 4DL7A 3TARA 5T7LB 4UZBA 4USWA 1NO8A 4KE5A 3AXMA 1ZYQA 1CJUA 3RB6A 5IWAJ 3SXLA 2C3UA 1N36J 5KFZA 4X4TA 3PJXA 2E1AA 3GU0A 1AYEA 1B0PA 1VI7A 1LXJA 4F3QA 2WOMA 2HAFA 2ZH4A 2AYEA 3WX8A 2FY1A 5D77A 4CO0A 4DV7J 2BRLA 3MUVP 1O0PA 2MZQA 2MKIA 4C8NA 4A48A 4P7TA 3H42A 3QBCA 4ECUA 1GXUA 5A8KB 2RSQA 4E2FB 5F8LA 2IDEA 2J0XA 2UVWA 1R8HA 2G13A 5KAKA 1VQKS 1DAXA 2CUYA 2BQRA 5E3PA 1U6BA 3EVWA 3MPDA 4HHHA 3MCOA 2EWHA 4Y6IA 1VQ8S 2PEBA 1S6PB 3I55S 4ELUA 3W2WA 3K59A 1QJHA 4FS2A 3FQKA 5J2NB 5HLFA 2FJDB 3HHDA 3ITHA 4XTTA 1FJGF 3FEYB 3EZUA 3I9ZA 2XYHB 1QM9A 4EYHB 3CDWA 2D41A 4OZ0A 3LGHA 2POKA 3GSIA 2HSEB 2NS1B 1BQMB 1OS5A 2C3YA 1TFYA 2KYZA 1VQ4S 8ATCB 4QWEA 1RHQB 1FDNA 4ECWA 1FNMA 2FJEB 3N5BA 4QWAA 2WRMA 4O44B 3V6JA 1JKHB 1N88A 3Q0AA 3IS9A 3KK2A 1I6JA 4F36A 1E6YA 2QSWA 4WFXA 3OSPA 2IC3A 2PN6A 1J5OB 4D3GA 5DG7A 1KN6A 3DLEA 1I51B 3T5JA 4UUWA 4I2PA 4ANEA 1U8SA 4JI1F 1D1UA 1E6VA 4EMDA 2B0GA 1NDPA 2VC1A 3N28A 2E7WA 2BKNA 2K2PA 1SKSA 4K8RA 1T0TV 2AF6A 1P8GA 3FCWA 2HURA 5IV3A 2HFNA 2C2DA 4HTJA 4ZLNA 3OPKA 4M1KA 3W5XA 1FDDA 3M2UB 4OJHA 2L9NA 3CEDA 1YBTA 3IBFB 2C2EA 1V6HA 3VAFA 5CA5A 2J7KA 5CYMA 2H4YB 2JX2A 3NG8A 1ZTWA 1ZOTA 1NDKA 4ED4A 4I2QA 2HFOA 3BKUA 3D1OA 3QO9B 2I5JA 2VPWB 1S4FA 1PYTA 1JX4A 3GFYA 4ZP6A 3I4HX 1FFGB 3H5SA 5EUHA 3AOBA 2ACMA 1JLCA 1WG5A 2Z30B 4OYXA 3TVZA 1T9VA 3RAQA 2GCFA 3Q8PB 4DS4A 1UZHA 4W90B 3LOUA 2HRYA 2HRTA 1S1WA 1D8YA 1KBRA 4TY9A 4ZP9A 3AAWB 4DQIA 4QU6A 4P74A 1VC6A 2D9PA 3CC4S 1Q95G 1XJWB 2HWTA 5GADI 3DOLA 5EX0A 2G2ZA 2QL7B 3UR0A 4TU8A 4DFJA 2N82B 4CTAB 4DV6F 1HLWA 1RHUB 1SIWB 1Y7PA 1JLQB 1PBAA 1TL7A 3RTVA 1M5HA 1FKPB 4X84A 1YX2A 1EKSA 3DRXA 3GMGA 7FDRA 5B0CA 4X4QA 4YMEA 4ZLPA 5HJYA 2YWWA 1RWUA 2BJ1A 2X1GA 2ZD1A 5HVFA 1N56A 3QPIA 3M8RA 5E5NA 1RAHB 3DMJA 5HMWA 3IBCB 1MG7A 4ALZA 2I9SA 3AB2B 2ZKTA 3DFEA 1RADB 4RNOA 4W92B 1RTIA 1SJ4P 2LA6A 3NL0A 3IAM9 4OI0A 3VAGA 2E5JA 1DTTA 4ID5B 5D6GA 3DHWC 3EUNA 3HZGA 4JYAJ 2DRBA 1WKKA 4N76A 2CJAA 4RW8A 1Q7YT 4GVBA 2KJVA 2B4UA 2KDOA 5C24B 3TUPA 2O3DA 5D4NA 2G2OA 5L8RC 1J2VA 4FF3A 4RX6A 3GIJA 1RGVA 4W98A 4AL7A 3JAMU 5A2QU 2MDAA 3OR2B 2RRAA 2F1FA 3QZ8A 2ALZA 1PSDA 3M2RA 3QIPB 4ZCKA 2F65A 4C48A 5M2UA 1GTEA 4RW9A 3M6UA 5KG5A 3IFEA 1VC5A 3SBMA 3P4UB 2DR5A 1JWWA 3ENAA 4WK1A 4FBTA 1GXTA 4K4YA 3DLLQ 3D6MB 2Q66A 3JSYA 4MK7A 4ZVSB 4LF6J 4C8YA 2R7OA 3H5YA 1O51A 1D0EA 1LWCB 1IKVA 3PJWA 3Q22A 2N4DA 1UMJA 4OZ5A 1S59A 2MEWA 3AJDA 3IG1B 2OLWA 5LM7E 3VAHA 3OXGA 5DDPC 1OPZA 1L3TA 2UXBJ 3AD8C 5LL6d 1FJEB 1NPKA 3AT1B 5HL7Q 3R1LA 2XMKA 3A1YG 2AJ1A 4IQMA 2GHWA 1ZAVA 5G0RA 2IIHA 2R7QA 3CJ0A 3NAHA 4MJKA 2XWXA 1VRQC 1TL3A 5KFVA 4A4JA 4P71A 2ZH7A 2BE7D 1IM4A 2X7IA 1XMOJ 1C0TA 2W1BA 3EX7B 2HBZB 2UVRA 1K1SA 1U2FA 3UDLA 2ZZNA 3MMBB 1H2TZ 2PA3A 4TKTA 4ILMA 1YBAA 2L9DA 3I56S 1SKWA 3S1TA 5F9LA 2F40A 3KNGA 3TQ1A 2CNLB 2LU2A 4LUBA 2BA9A 3EICA 1YSJA 4F0MA 5EGYA 4JI7J 4G6VB 2B4VA 1NB2A 5CZXA 4NEYA 3KLFA 1UTAA 4OI4A 1G1XA 2YXLA 5F9NA 3DU5A 3NWGA 3R5GA 5B0GA 2YNIA 4D3HA 3FVYA 4WWSA 1AB8A 1P9QC 2J0QD 2RQKA 3CD5A 4CZCA 3DLJA 9ATCB 4RLEA 4PXEA 2YKMB 3OLBA 3AFGA 5IT0A 4IG0B 1V3ZA 3DRPA 4A46A 5DQIA 1VLOA 4ECQA 1S79A 4FVCA 2BR0A 3I87A 2N3OA 4KFBA 1S6QB 2JVOA 3CVKA 3N5FA 1PKUA 3SEOA 1AZSA 3MMAB 3BPSP 4FNIA 1WACA 5FDLA 2IJNA 2LEAA 2XS7A 1QAIA 4KKOA 4LMZA 4JV1A 2CPJA 3FDSA 1ZM2A 2BZ2A 4TU9A 1Q4RA 4FPIA 3HHLD 4R5PB 4ANCA 1IKWB 2GAGC 4ECTA 4IG3A 3SQOP 2JDJA 4NOHA 3J7YI 5DZ7A 1KQKA 1NK6A 3PRBA 1SL2A 2IBOA 1MROB 2OPRA 2UXDF 2E1CA 1B0TA 4LF1A 4B3OB 1MLAA 1JLFB 1RCXB 2MKSA 4F67A 5HBMB 1BLUA 2WONB 2B51A 2FLPA 1UVIA 2ZEJA 1X4CA 1VQNS 5ETSA 4J9MA 4JI2J 3A12A 1SC3B 1F5CA 1NM2A 3RZAA 2ZJRQ 3K5NA 2ZH3A 2AYBA 1UW4A 2CJXB 2YBVA 5KFAA 1C2PA 3R7NB 2JEGA 2YKNB 4MFBA 3RBXA 4C98A 4L6V3 1Y5IB 1Y0HA 1S1UB 2HZVA 1YJ7A 4OLPA 2PDAA 5DQHA 4XAKA 4IOAQ 1VQLS 1UAWA 3DI6B 4KGMA 2VQFF 3WDOA 2QRRA 1HHTP 2QA1A 1OJ4A 3KMQA 2AYGA 3THVA 2FHJD 2BE9B 1S0OA 2ZNYA 5C2CA 1WD6A 5EWGA 2V4RA 2YX1A 4JV5J 3O6QA 3EDRB 3SCJE 2AGOA 1PIEA 2CQIA 4WCEQ 3RR7A 3BS9A 3CDAA 3BKTA 3R2DJ 2WZ1A 3TOQA 4IDKB 2XWYA 3DNCA 4FF4A 2MQNA 4A8KA 3G4SS 2MMYA 3LGNA 2NUHA 2OTLS 4X65J 2JOQA 4IO1A 3F73A 4PXDA 3ZTQA 1V9OA 2KHDA 3M32A 1CBKA 3TZZA 1OWXA 1B4SA 3H90A 2Y1JA 2MJUA 2W2QP 1S6OA 3K5LA 1K9MT 1VHIA 4DXLA 5LSRA 3EGVA 2FGCA 3KK1A 1FRXA 1NSPA 3MMCA 1R0AB 2W9CA 2J6SA 1HARA 1GMWA 4Q43A 4DU7A 2Q6CA 3CCJS 1R27B 4USKA 2DYAA 2H5IB 2APOA 5FIIA 2VA3A 3WIUA 1JXLA 1LWXA 2UP1A 2CADA 1XC9A 4O4RA 4MKAA 1ZM9A 1TMMA 4ZVTB 2IPOB 4I68A 1HI1A 4WP9A 4NXNF 4ICLB 1SV5A 4OMFG 5I3UA 3BZQA 5F0UA 2DKOB 3Q24A 4ED1A 2WB4A 1HNIA 4O3NA 2EFOA 4RW4B 5T7LA 1XTZA 2BEFA 3VAJA 3OTOF 4U8YA 4Z2XA 5HO4A 2VIHA 5JJBA 4ZDNA 2YKAA 1HFEL 1XNRJ 2H48B 3MR3A 4JBCA 4ECSA 4ZVPB 4N56A 2DNOA 2RHQB 5E7OB 3A8KA 5AXNA 4NZ6A 3CF5Q 4NLSA 2CQDA 3ISND 3WQPA 3HFKA 2HZCA 4P2XA 1RWKB 1M5VC 1U6ZA 1QE1B 4ZA1A 5A8KA 3NGUA 2XNRA 2V8PA 2OEJA 4QYZJ 5KT7A 5H9EJ 2VQEF 4MKBA 4DUZJ 3K7RA 1TV6B 2V9WA 3FNNA 2PFFB 2XZTB 1S6PA 2JH3A 3L7PA 2PSZA 2B5JB 2DNYA 3H2UB 5J2NA 3JS9A 4DR5J 3G96A 1EZZB 2AT1B 3CMES 1RA6A 2BM0A 1NJWA 4TLQA 3KUHA 4MYUA 2O01C 2D3UA 1ZH5A 2XY5A 3BGLA 4OHWA 1RHRB 3UPFA 4QWBA 4M5KA 3OV7A 3BBFA 5IOLA 4V19J 2MKCA 2W01A 4O44A 2BW7A 2R8IA 4CP5A 2K06A 2X1FA 1WC3A 4KH0B 1LW0A 1J5OA 3VGUA 3GP9A 3TX8A 3OW2R 1U0HB 2CZ4A 4RJVA 1WF1A 4LRFA 3PX6A 2YQ3A 2KTQA 5ETKA 4TXSA 4QIGA 3H0PA 5HP1B 4RR5A 3M9MB 3FC9A 2HQFA 3A4TA 4H54A 1U4BA 4IKAA 4NXMF 2HWIA 4BHQA 4KHPJ 1XNQF 3W62A 4RW6B 2EFPA 3V6DB 3GSDA 2GJ2A 1N0VC 4QPTA 2GQQA 4NLYA 2YX4A 4LFBF 3CT9A 4CO3A 3MEDB 1A7GE 4YR3A 3M2UA 5E3QA 3NXZA 1J5EF 1YJRA 2JEFA 5GMKa 1IKYB 2DJWA 2IM2A 1IJEB 3QO9A 2X1BA 1S77D 2F8HA 3HVTB 4BWJA 1QAJA 3FZ2A 1VMBA 4B17A 2V8VA 4PRFA 2R9LA 2F8EX 3J81j 3PG9A 1S72S 3W63A 3Q8VA 2XSFA 4HLBA 2E1PA 3OTBA 2F4FA 3TA1A 4DG1B 1TKDA 1HL6A 3B82A 3BH6B 3EPIA 4DPWA 3DC2A 1NK4A 3PTWA 2VBXA 1GH8A 1SVDA 4CO5A 3Q2TC 1LFPA 1JLEA 2DO0A 2KG1A 2RH3A 2FQQB 3R8YA 2H9ZA 4O3SA 1UWBA 3K2YA 2BOPA 3CIMA 2O66A 5KFKA 3ZZZA 1TL1B 3IRWP 1AT1B 4QYZK 2F7VA 4DV4F 3MPWA 3P3DA 3TA0A 1FD8A 3WHIA 4CTAA 2A2CA 5HVGA 4X4SA 4BWMA 3V6HA 2YWKA 2X3GA 2BANB 1NKEA 1JLQA 2HIYA 2Y0BB 1FKPA 4W4MA 1QVGR 1B7FA 2IY5B 1Q7LB 2WTFA 2MLYA 1H98A 4WXOA 3TO8A 1UJ4A 5L1IA 2FC9A 2VPZB 4F3MA 2GJIA 2W2PP 3I0RB 5D3GB 2HGLA 2BJDA 5CD4H 3M8SA 4FYXB 1UP1A 4R0JA 3X3UA 3QSYB 4R8UB 1G6BA 1FFWB 5B0BA 1C1BB 4DFPA 1P1LA 3D6TB 4ID5A 4PXBA 3SDEB 3IC1A 1RT5B 1SJ3P 2LXIA 2E5IA 3HF5A 3DOMA 5C24A 3GV8B 1R8AA 3N6LA 3W61A 2BMBA 3RAMA 4O3RA 3E2EA 1J5EJ 5LJ3Y 2XMMA 1EJ7L 2JEIA 5MLCV 3UD3P 4KAIA 2DRDA 1FTRA 2LXFA 2E5LJ 3OR2A 2MHNA 5KT3A 3CMAS 1XK8A 2XI3A 4FKYA 3UQSA 3QIPA 3CC2S 4PWUA 2OPPA 1NXIA 5LOQA 2E44A 3DGPB 1D9FA 5K8PA 1I5OB 4ZPTR 4JOUA 3TZXA 3G82B 3HZEA 3G2XA 2KB2A 2PMHA 4RU2A 2LEPA 5KT4A 2LMIA 3H2VE 1RT6A 3CXCR 5BJRA 1LWCA 2F4VJ 3NNCA 3H40A 3J7AN 2HWHA 1GMVA 2R8KA 3IG1A 4WKRA 2UUTA 3L7OA 4QBUA 4MIWA 3O5TB 3RUBL 1NHUA 2KVIA 2MZJA 3M9OB 1WHXA 2YKOA 4GC6A 3MWBA 4TQRA 3VQSA 3GV7B 1VQMS 1UPPA 3FMBA 2HVIA 3C15B 4ED0A 3WZ0A 4C8KA 1WTFA 2IHR1 1VQSA 4OX9F 1JXVA 5F8JA 2CQBA 2RU3A 5L9NA 3NEKA 3ZZPA 1KRPA 4B9LA 2WVBA 1T9YA 1YI2S 2B9WA 2V67A 3DM2B 4HT7A 5CCLA 4CLLA 2F8MA 4IUFA 4PABA 1GFWB 5DDRC 4LR8A 3MMBA 2UZAA 4WE1B 4AT1B 2UUCF 1MN7A 2AW0A 2XO7A 2W4PA 2WAQD 3T6JA 2DTJA 4FPRA 2LQ8A 2V94A 1SUQA 2AWZA 2DNNA 2UXCJ 1GEHA 4F0HA 4CCHA 3NS5A 2IM3A 1RAJA 3CTRA 3PNIA 4ZOSA 2GC8A 1VIXA 2FVQA 3LUYA 4AQYJ 4RW7B 3VVTA 3MPVA 2VDIA 2BBEA 5KTQA 4J9PA 4ZK7M 2V63A 2CJYB 2W2NP 2KM8B 2IM1A 2JLGA 4IG0A 2V50A 2HPUA 5L46A 3AB4B 4NPOA 3BB5A 4L73A 1K44A 2DEJA 3K57A 2C22A 2Q79A 3W66A 4QPXA 4YHHF 1S6QA 2V2KA 4L74A 3C3LA 2KT3A 2X51A 4FNHA 2QA2A 3UCUP 5KFNA 4JI0J 3MMAA 4ELTA 1HKAA 3GJQB 1CJVB 5KG4A 3MR2A 3SYZA 3V4IA 4B9TA 3T1AA 4DZ6A 3K8VA 5A2QY 2QLFB 4R5PA 1IKWA 5L1LA 1T9TA 3IO1A 2RDIA 4HACB 4G1QB 4ZPBA 1V5VA 1VQOS 4FYYB 3CE8A 3PY8A 1MROA 2XSJB 4DV5F 1IWAA 4HI1A 3EPGA 2YQ1A 1X5PA 5B09A 4JI5J 2YWFA 4B3OA 1JLFA 3S7RA 1M1HA 2ZZMA 2WONA 1ICEB 1B99A 1GX6A 3HLUA 2PIIA 2JLFA 3DCAA 3M4XA 1EIYB 2R2UA 3EGNA 1R31A 1X9WA 5A6WA 4ZCLA 2FDNA 1AFIA 2YKNA 4X2BA 4NE9C 4M5HA 1NLKL 4DV0F 1IR2A 1HQEB 1S1UA 2CVIA 1FJCA 2HVEA 2LDIA 2LLZA 3FSIA 1TZ0A 2ZBQA 3DI6A 2ZHBA 4G1PA 3K17A 2QN6B 4C0BA 2V2VA 3PKMA 4EGLA 3PACA 2PE8A 4K0KF 4DOZA 4LF4F 3CUNA 5LMUJ 1EETA 4X66F 5K8OA 3QNWB 3LP1A 2RNEA 5AE3A 3H4DA 2MB0B 1R3NA 4IDKA 4KPYA 4OI6A 2BQ3A 2OSQA 2RS8A 5HMYA 2XM3A 3K5PA 5GVQA 4GMKA 5IQQA 3OHAA 3JQJA 3CCUS 2W7AA 3OFFA 3D54A 5GADU 1SKUB 3OVAA 2R8HA 4CH7A 1W25A 4Y65A 4YB1P 1SI9A 2RQ4A 2WB1D 4TNOA 1R0AA 1X4FA 2DHGA 4HI2A 1S76D 2DHHA 2DHXA 4H4MB 4NYOA 2H51B 2AZ1A 2MY7A 4B3RJ 1REGX 1RT2B 1XEZA 5J1NA 1FNOA 3BSNA 1OQ3A 3HHLB 5DG9A 5AJ3J 1TK0A 4QYRA 3IRXB 2A2DA 1H72C 3THPA 4UF4A 4N5SA 3MFIA 2IJFA 4DV2F 4ICLA 2RUGA 1Y5NB 2CWKA 3S6EA 1FXRA 1FKOB 3D3BJ 4Y2KA 4BBYA 4DS5A 1WEZA 1YZ6A 4FZVA 4DX7A 3C66A 1VC0A 1FRKA 1FEEA 3TP2A 4UY8T 2MQQA 2GO9A 4P2MA 4TQSA 5KFSA 5I42B 3OXFA 5L9XA 4FDFA 3NGDA 5HAOA 2B4PA 2W4CA 1HNXJ 3FQLA 2ZUGA 4DV0J 2EPIA 2OMLA 3GIKA 1TKXB 1Y4ZB 4J9OA 3SQGB 2MLZA 2C1EB 2UVVA 3ELHA 4E0DA 3PCOB 1N6QB 1O5JA 5CZVA 3NGTA 4GRSA 3KLIB 4DR1J 1QE1A 1SJ1A 1YJ9S 2XMUA 3O2IA 1CC7A 2HBRB 3LH2S 4ED5A 1I94J 4H4KA 1URRA 5K8MA 2YPZA 3CMQA 4X62F 3CCMS 1LNQA 4ZPCA 1NSKL 3NCQA 1FVQA 1EHWA 1BQXA 1UFLA 3T5KA 2WCXA 2MHEA 4OX6A 3TVYA 1MSWD 2B5JA 1K8AT 4EI2A 2ZH1A 3KDOA 2AQ4A 2XS2A 4LF9F 3KYLA 1IVZA 4IYQA 5DDOC 3FZBA 5DO2A 4IFYB 4DR4F 5IT4A 1JNZB 2VDHA 1XR6A 1O8BA 3TZYA 3KUEA 1BE4A 1TQLA 5J1EB 1R89A 4OHVA 3KJNB 2Q3PA 2VG5B 1N54B 1Z2ZA 2XTJP 4PQUB 2FZCB 3WIVA 2VHGA 5CYJA 2FJWA 3WC0A 1FO1A 2DGTA 2WHOA 5I4MA 2V4JB 1U0HA 3I96A 4ENOA 3B6BA 2QJ3A 3NWRA 4B9MA 1HNWJ 2AV5A 1T8EA 2UUAJ 5KG0A 5HP1A 2GMJA 2C3OA 1V5IB 2DCLA 3A8JA 2VD3A 4YQWA 4RW6A 3LP0B 4F2SA 4DL6A 3GJTB 1YWXA 2VG6B 3PX0A 4HHJA 4ANDA 2ROEA 2CJBA 3QJLA 2EFQA 1WC6A 3MEDA 2G1DA 1RT3A 3KHRA 1CLFA 4IH5A 1D9DA 2BOAA 1NUEA 2BKPA 4ZIWA 2A18A 3EWGA 4C3KA 2DK2A 1T95A 1PJ7A 3PX4A 3HVTA 1NDCA 3J7ZT 3HDSA 2C2RA 2OH2A 4PPZA 3MM5A 2CPDA 2CPYA 4M5JA 4OYMA 4DU8A 2KVQE 3RAXA 2RILA 5IC4B 1IKXB 2BE2B 3FGVA 1R6YA 2FB0A 4A8MP 1C1CB 2KXNB 1DFDA 4WU2A 3Q23A 5GAHI 3NS7B 3OJSA 1KWMA 4ED7A 4PG4A 5JMNA 4P75A 2J6UA 3AA8A 3T19A 5LXRA 1JLGB 4JI6F 3W2VB 3KLHB 2J0SD 2DGQA 3J7YU 1BWEA 1N34J 5B0DA 2GQ2A 3W3SA 4DN9A 4DV1F 1RJJA 5F8IA 1MWQA 4RPFA 4LFAF 3GR0A 2BANA 3BQ1A 1X4DA 5GAEU 2CQ2A 2PMWA 3HFVA 2VH7A 5BYRA 2RF2B 3CCTA 3W65A 5KFBA 3EJMA 2DNZA 1IBMF 1U2CA 3NGRA 2HHXA 5KFGA 4HDHA 1RTHB 4Y0FA 4USUA 1TAQA 2LFVA 3I9V9 1ZPWX 4PWDB 3FFIB 2EBEA 1TKTB 4WPAA 3KMSA 2OFHX 2XEXA 3QT6A 2FLOA 2HNYB 3SV4A 2QE5A 2PC6A 4LF5F 1F60B 3LTOA 1X7VA 3I0RA 2OUGA 3KLEB 5D3GA 2FGOA 2HVZA 4USIA 2V2ZA 3MAQA 1YZ7A 4RWXA 2RMLA 3KWMA 3GV5B 3NLCA 1PAUB 4I67A 4R8UA 2J7UA 3CO0P 1FT8A 1S9FA 1RT5A 3IAS9 3W60A 5KT6A 3I0SA 2J0WA 3WC2A 4P2FA 2DNMA 4ZVFA 3IR7B 3LPEA 4RNNA 1DHMA 3MGJA 3LGMA 3J7A1 2FHKA 2CQCA 4CH1A 2JEJA 4DMZA 4C0HA 4DR6F 2C2ZB 1HW9A 2UV8A 3TAPA 2A6OA 2ZVSA 5EN1A 3WX4A 4WK3A 1ZA1B 3BSCA 5F3TA 3HULA 4ES3A 4V19X 3I32A 5D78A 4TN2A 4OYBA 1N32F 3LWMA 3GE9A 1KQGB 1RTJB 4NLQA 4WYLA 1HD1A 2WVCA 3DGPA 4ED6A 2QMWA 5ETTA 3RRHA 5AE1A 2FVPA 1DBDA 3K5OA 2V68A 5CXTA 1RAEB 1IUJA 2XZDB 1BMQB 4NYZA 1TU0B 4QWCA 3T5HA 3GTYX 2YWEA 3T1HJ 3IP0A 1ZS6A 1C0UB 1FNXH 1LW2B 2NSBA 2ZBCA 3EZ5A 1LOUA 4QR2A 2AEMA 1KC8T 1M1KT 4B3SJ 3GB0A 3A13A 3TJAA 4ECZA 5EWFA 3OL6A 5DM6Q 1UETA 4DV1J 1FX2A 3EGZA 2AGQA 4LFAJ 1RABB 4M63A 2JC0A 1TELA 3C15A 3HD1A 4KGVB 1T05B 3HPOA 1BXNA 1F9FA 3T3FA 4M5MA 3FK4A 4J9VA 2QX0A 2VG7A 4FF1A 1IJFB 4C7QA 4B3MJ 3CC7S 3DLKB 4HR2A 3M9NB 1DTQB 3DM2A 2Y0SD 4ED3A 2YNFB 3TJ8A 3QRQA 3EZOA 3OD2A 4CLKA 2B4OA 4KGXB 3GG0A 5HQLA 1FRLA 4WE1A 4NI2B 2HBYB 2V4QA 3BO3A 3R2CJ 3OFEA 2XQCA 3GFXA 2Y8YA 2MQOA 2NXUA 2Z0GA 6FD1A 3MM6B 4O4GA 4I6YA 1RP5A 1KTQA 4K4ZA 4Q0BB 5DQGA 2EC0A 3ADAC 1WTBA 4DLEA 4RW7A 2M4MA 2VF3A 2XLIA 5MAOA 2HBQB 4LR7A 1H7WA 4UOCA 2ZNZA 1VBYA 1GAOA 4PAAA 3MEEA 4LVNP 3CJKA 1NJZA 1FWKA 4KJIA 3ZTOA 1QY7A 1NNDA 3VCDA 3U27A 1KVKA 1VRTA 2H54B 4CLFA 2FVRA 3QFWA 4J5OA 1IBLF 1JLAB 4JI4J 3ILIA 1VJWA 4ZCMA 5IS2A 1RQ0A 3K8WA 2GVZB 2FJAB 3C14B 5BR8J 3C6TA 1Q79A 2VASA 1VBKA 1S0MA 5B0AA 2RQCA 2XYGB 4G1IA 2KZMA 4WZQA 5AT1B 4O0IA 2WW8A 3N6NA 1J27A 4KH1B 3GWCA 4HACA 4NZ7A 3PDNA 4G1QA 3LQVA 4I6WA 5JXSA 1RB0A 2G4BA 2B9EA 1FE4A 3QGPA 3R5BA 4JI3F 2XSJA 4CYUB 3BPDA 5E2QA 2NQPA 1EQMA 1PYOB 1HQ2A 3RGIA 2VONA 4OYOA 2FUG9 1I1GA 3CULA 4RO0A 1DRZA 2GO8A 1UVJA 3MTKA 1FX4A 2DB1A 3IWNC 1QSSA 3CCVS 2I38A 2FJXA 2B56A 4ZIVA 1KFSA 3VAIA 3ILLA 1TUVA 4A8FA 2CNOB 5HI7A 3PIOQ 2XCPA 2IVYA 4IH7A 1HQEA 1H2VZ 1NJYA 1U2RA 1UL3A 5KFQA 3QJPA 4C8LA 2BKOA 3NNHA 5JVHQ 3BR9A 1T03B 2UU9J 2BJEA 2ZM6F 2HK3A 1R0BG 3M1VB 1LQ9A 4URGA 3BDEA 3GR1A 2IJRA 2R3VA 5J2PB 1NBEB 2VBWA 3M7VA 1RT4B 1KR4A 2D3O1 2MKYA 1NK0A 2DIUA 4AYBD 4M95A 2HQGA 1AA1B 2HLTA 4ZPVR 3MXHP 4A8SA 1NRKA 3SFGA 2VFSA 4DWIA 3K89A 4DUYF 1K47A 3QAUA 2ATLA 5D0HA 2O67A 2QL5B 4J9LA 1S9EB 2ZDPA 2F9DA 2OEMA 3RB0A 4E98A 2FIUA 4K4TA 1W2BR 3TYTA 4U8VA 3TAQA 2WVEA 3PRDA 2ZOFA 1S0NA 3CCES 1S57A 3UW1A 2IRXA 4DR2F 2R2SA 3UR3C 4NRTA 1X8DA 4H4OB 2V69A 4Y2AA 3SV3A 4XDCA 4H4MA 1GMWD 4A8QA 1S1TB 3UN5A 1OYEA 4RUCA 1RT2A 5L1KA 1XR7A 2WBRA 1PC4A 2MTLA 1DARA 3BO2A 3R9LA 3HHLA 4QZVB 3M2VB 4JI3J 3IRXA 1IBKF 1GK8A 2WSCC 5SUHA 1IWGA 4NLVA 4DV3J 1U47A 2OTJS 1FKOA 3G6XA 2GGPB 1HWUA 1CJKB 3QMQA 4NLXA 4DJBA 2Y9HA 1EQ0A 2M8DB 5BXIA 1VIOA 1JIHA 4F25A 4LSNB 5KFOA 1FRMA 1Y10A 2BABA 2UV8G 3FRZA 2M2BA 1UJ5A 3VAMA 3CJRA 1FK9A 1TKXA 1U1RA 1N5SA 5KFDA 3SQGA 1LWEA 1RLCL 5CAAA 3VV2B 2ZM6J 1HYSB 1BWVA 1N6QA 1HMVA 5HATA 3AHPA 2JHEA 5D0RA 3MFHA 1DQ8A 2CG8A 1HBNB 1FA0A 4ZS6A 3BN4A 1BQNB 3IGNA 2BW2A 1M5KC 4DSKA 2HHHJ 1HWLA 1CS4A 1Q81T 3S8SA 2CG4A 4Y34A 4LSLB 1I3OB 2LCWA 4DR7J 4CH0S 1TFWA 1YQHA 3C6UB 1DLOB 1Q82T 1HI0P 1LV5A 5M2RA 2J76E 2DR9A 4Z7CA 2QLWA 4OV1A 1S1XB 1X5SA 4DPUA 1EAYC 5D0GA 4BS2A 2KHCA 3JYTB 4IFYA 2B9YA 2CPXA 4LFCJ 1ZA2B 2KH9A 2CPEA 4DFKA 2GZOA 2P9GA 5J1EA 1VCTA 2XBPA 3TR5A 1GTHA 2VG5A 2LQ5A 3DOKB 1SH0A 4PQUA 3AQOA 4F4KA 4DF8A 3FBBA 2BJ9A 4ERDA 3LF0A 1Z4UA 5KG6A 3RBDA 2RAQA 4ZMMA 1IBKJ 1DZ5A 3T9NA 2QV6A 1PG5B 2Z2YB 4ZVEA 3M8PB 4NCGB 3R6GB 2BQUA 2KRBA 1RT1B 1X31C 5H1SV 2OI2A 3LP0A 1U1LA 3PO5A 2A6MA 3POTB 2VG6A 1A9NB 4OZ3A 5I3QA 2XCAA 1V3SA 2L41A 1MWZA 1KLMB 3QT7A 3MECA 8RUCA 3RW7A 1HQUB 4TY8B 1FRHA 3H8YA 2L48A 5ETRA 1RBAA 1YBUA 2QLJB 4JI8F 4Y2CA 2JFDA 1ZM3A 2DPIA 1BGXT 2WOMB 3GJRB 1KNZA 5LJ5Y 4MK9A 1IKXA 3L7UA 2BE2A 4C97A 3CJ5A 1C1CA 4JB8B 3AXKA 2GVDB 2QLXA 4LBIA 3T5LA 1VGYA 2CPZA 3CNQP 2MKJA 2GMHA 4OYWA 4AL6A 2ASLA 1U1QA 4HKQA 1K0VA 2IMOA 2M5YA 1JLGA 3NMRA 3MEKA 4PKDB 2V8DA 3KLHA 3A8IA 3H5UA 4OJ1A 2EK1A 4QIFA 3ITHB 3FBFA 3V81A 3R3TA 1D09B 4DSLA 3H20A 2DNGA 1FJGJ 2RF2A 4TYAA 2VBZA 2ALYB 2BYCA 4N47A 1RTHA 4FBUA 1VRUB 1RHJB 2RRBA 1FWLA 3C19A 2R7RA 2CZ9A 4PWDA 1RAFB 2ZOGA 2M88A 1TKTA 1NH8A 4EYIB 2HNYA 3MUTP 1AXQA 2OPQB 1SJRA 3QFHA 3KLEA 2BJ8A 3DLEB 1JK9B 2B6AA 5J2QA 3DDIA 4Q7AA 1BY9A 3W8GA 1E6VB 3G8SA 3I5AA 4DQQA 1RHKB 1HHSA 4JI1J 4FS1A 2MKKA 4MYTA 4RKUC 3T1YF 2EI5A 1PAEX 4GC7A 1Q5YA 5KFCA 1IQZA 2OELA 4OQJA 2HG4A 2MPUA 4CLZA 4LRDA 4DX8H 4H4KC 4GKJF 1S7IA 5KFEA 3OVBA 3PFOA 2M52A 1S4EA 4PYDA 3Q86A 3PRVA 1VJQA 2J9CA 2JZ5A 1JJHA 1X60A 1RTJA 1SB6A 4Y2IA 2HFSA 3FUYA 1HNVA 2JJ4D 1RBLA 3BBCA 4HDGA 1FESA 2CQ1A 4PUOB 3MPYA 1VQ9S 5C5JA 4LR9A 5CQGA 4QIEA 1N48A 3DDNA 5CYQB 1VHFA 1OQ6A 1RLDA 1X4HA 4HVZA 3PW4A 2KRRA 2I8EA 2XHCA 1HR0F 3GIIA 2MQPA 4DL4A 4RNHA 1C0UA 2IRUA 4P7VA 1LW2A 4S0MA 1U1NA 3C8YA 4ZPDA 2Z57B 2Q1LA 2IM0A 4WFYA 3QWPA 3T9ZA 4CDIA 4PPDA 5C2GA 1IN0A 3PW2A 1SXLA 3B4MA 3QYYA 1XQIA 2J8SA 4YB6A 1IBCB 2EXUA 2VFVA 4UOFA 2YY3A 3DOLB 4ECYA 1H74A 4ZVQB 1WEYA 2QZ8A 5IC6B 3IA0A 4ZVUB 3DLKA 5C42B 1DTQA 4CM0A 3MURP 5IXUA 4J7CA 2YNFA 4DV6J 3MDFA 2W9AA 1K73T 2DNPA 2DRAA 2VU5A 4NI2A 5KFIA 5IV4A 4DCPB 1GMUA 4KRWA 4Y3CA 2WSEC 1B3TA 2ZD1B 2M7SA 2YNHA 4LQ3A 2VODA 3UO0A 1HNZF 4G3IA 3NOGA 4USHA 3MM6A 1TKZB 3HSJA 2VFRA 3FCVA 1Q86T 1PJ6A 3RRKA 2CPHA 1PILA 3MM7B 2DPJA 1RTIB 3UFCX 4CRJA 4K50A 3CCRS 1P9YA 1F2GA 3G6VA 3MR5A 1YGYA 2H5JB 2MSSA 3KKFA 3CDEA 1ZBTA 3G6YA 3HFZB 3ZTPA 2DGOA 4J37A 2D9OA 4YUDA 1YRTA 3SIPB 1WC0A 4MKVA 2H4WB 3MI7X 1Q8LA 1UEKA 3RB4A 1MWYA 5C25A 2CRLA 1JLAA 2WVDA 4OLOA 1F3FA 2OJ3A 3IBWA 3EVMA 3CCWA 4DN0A 2MZRA 4NA3A 3PYFA 2M0GB 4ZVOB 4J9KA 2V2QA 1QSYA 2RHSB 2NXJA 3N9UC 3PEHA 4IO9Q 4Q8FA 5C7PA 3P6YC 2E66A 3DLBA 2AYMA 1WOOA 4WF9Q 5T41A 2W8KA 1N33F 1YJWS 2VBYA 4CYUA 4ETXA 4RBVA 1R8CA 4FXWA 4A8OA 3HHKA 4F4XA 1JLBB 3BYPA 1HBUB 2AIRB 3MOJB 1B0VA 3P8BB 4FXDA 5KFWA 2FD2A 1T9XA 4UOHA 1RWOB 3NS6A 1YJTA 1UZDA 2PD1A 4OI2A 1RTZA 2J7WA 5ETLA 4UQGA 4WIIA 5GAEI 2G0CA 1F0XA 4KB7A 2ZH6A 2CJKA 1C0TB 4XDDA 2V5HG 3TEHB 2YWGA 3TI0A 5A76A 2DITA 1RYRA 4PWWA 2MQLA 3CDUA 1T03A 3ZXWA 2CFXA 1RAGB 2CPFA 2ILYA 2QA4G 3M1VA 2XY7A 1S97A 5J2PA 4NLTA 4NLPA 5E0OA 1RT4A 1W7WA 4O0NA 2AD9A 2VV5A 3N6MA 6AT1B 3KLFB 3TZWA 3BSAA 2DNKA 5GAHU 1AW0A 1NU4A 3Q8QB 3KOAA 2DEIA 2HFZA 1ZETA 3CSKA 3ZZUA 4ATNA 1S9EA 4RNMA 5EHHA 3HVRA 4NLRA 1QD1A 2BM1A 3I82A 3NBPB 2Y1IA 1KQSR 4KQZA 3R7SB 1RWMB 2R4FA 5LSLA 1QLNA 3DRPB 3LO3A 3OTEA 2CZVC 4OFZA 1CJTB 1Y3KA 2VJUA 1WC5A 3OUYB 4H4OA 4Q5VA 2EKYA 3DDKA 3Q89A 4ZJOA 1N4LA 5EDWA 4K2JA 3TUIC 4MMOA 1S1TA 1EB0A 2DH7A 2EKNA 3AD9C 3PKYA 1WOPA 2V9KA 4NLGA 2ACYA 4IQXA 3KNAA 2IMWP 1W2IA 3PYEA 1N33J 3M2VA 3RB3A 3TX0A 1QTNB 2GHVC 1DQAA 3ILJA 1NHVA 2DH9A 1YK9A 5L1JA 4CT8A 1CJKA 4TYBA 1UWAA 1SJFA 1HPZA 2P9CA 1MMLA 4DSFA 2QT7A 4ZLJA 2LVWA 2JWNA 3QIDA 1K0TA 2XC9A 4LSNA 4LRBA 5DLGA 1XR5A 2UXDJ 2G9OA 1MNEA 4HH1A 3Q8SB 3P5BP 1X0FA 4KO0B 4ED2A 2FZGB 3CJ8A 5DETA 2Y3YA 1FDBA 3IR6B 4NCAA 2BRKA 5IWAF 1N36F 1PO6A 3VTIA 1HYSA 1ULRA 3MEGB 1H0HB 1Q53A 3D0IE 2IYIA 4DEZA 1FRJA 1ZZNA 3L3CA 3HCXA 4WFBQ 1SH2A 2KM8C 1HBNA 4NASA 3F44A 2UVUA 2HHTA 1D3WA 1BQNA 4CLYA 3DKDA 3UNYA 4URSA 1VS3A 2VQFJ 1PYSB 4LSLA 4P52A 3OJUA 3M30B 1GX5A 3FBCA 3FJ2A 1DLOA 3ZNUA 4RNFA 3I6PA 2I1RA 2HNZB 5ADZA 1S0VA 3NRBA 1RAAB 2WSFC 2I0XA 3SCIE 4XPEA 3CJ3A 1S1XA 3C2PA 2XNQA 2LYVA 3KK3B 2JNJA 1NK9A 3JYTA 4USJC 4UY85 3EDQB 5DZ6A 1WI6A 4DCJB 3R5CA 1L3VA 3M32B 2KFZA 2OD6A 1WG4A 3J80Y 2ZHAA 3NP5A 2IA0A 3DOKA 5U47A 2W9CB 1BQMA 5F3ZA 4N41A 2ZE2B 3TRGA 2VICA 3G8QA 4YS2A 3IR5B 3KLGB 2EC2A 3FEZA 4K2XA 1S6UA 5BYSA 1ZTTA 3L9ZA 3UCZP 1RWXB 4WTOB 3M8PA 2D69A 4NCGA 2V6AA 3LWLA 1RWPB 1JKHA 1B70B 1RT1A 1U0SA 4WTYA 2ILZA 2OD4A 3POTA 1HWIA 3FMWA 3D1HA 2W7OA 2HMIB 2D1CA 3DN9A 1SCJB 4ZHRB 2RS2A 1KLMA 1TL5A 3PEJA 4NXNJ 4ECRA 1HQUA 4TY8A 1H7XA 3EVOA 2Q43A 7AT1B 2FLNA 3E01B 1CULB 5JUMA 3OTOJ 2FHOB 5D4PA 2HQCA 2AKWB 3M6XA 2KI2A 3D67A 3E3XA 3K5MA 3KTQA 4MIAA 2HS0A 2NYHA 4C3MA 3H59A 4M94A 3M05A 2GVDA 3H98A 3MM8B 3OSNA 1S99A 3U02A 4X4RA 4ITSA 2ZDOA 3M8QB 4C11B 3VHQA 2LKZA 2PFDA 2RKIB 2QL9B 1FF2A 3ZFVA 2I6WA 4ZVGA 2VQEJ 2XS5A 4YDXA 2J9DE 4P9SA 1RU1A 1EP4B 1G3OA 1Q8IA 4C9DA 2Z8QA 1ACMB 2XGPA 1B64A 1QSLA 3M8WA 3HHLC 4OJGA 2LXUA 4OI1A 2CA9A 4NX9A 5LSOA 3ZZRA 5RUBA 2XULA 1FCAA 4MK8A 2JVRA 1VRUA 3US5A 3J7Z5 4WFAQ 2X1AA 2ZJQQ 1IR1A 2F9JA 4AXIA 2FZKB 4F2RA 2HQ3A 4YP3A 1WELA 2MJNA 2VOPA 1Z1ZA 4CLSA 1RSCA 1UA1A 1N5TA 1LK7A 2OPQA 1U45A 8AT1B 3OVSA 2ZC3A 1LW0B 3BGRB 1RT7B 2FHMA 2WVFA 3GYNA 4U7CA 1M90T 2ZC4A 3CJ4A 3N0VA 2ZBPA 1WUUA 4I69A 4J9NA 5D0EA 2ROGA 3A3NB 3PHEA 2DY1A 3A3PB 2IBKA 2B7BB 5LT5A 4QJVA 5I3PA 1PCAA 3LAMA 3U1MA 4U7UK 2Z4PA 3RR8A 4JYAF 2QYCA 4NXMJ 3Q8UA 1XNQJ 4K4VA 1FVSA 3BDPA 3IN5A 4JV0A 4WP8A 5EWEA 1F9EB 4LFBJ 1RBOB 1YJUA 1RA7A 1ZAWA 3KG1A 2ASJA 2JL9A 5HROB 3H25A 1FRIA 1KLNA 3ILOA 4DX6A 2ZH8A 1M1GA 2PMZD 3LP2B 4PUOA 4A8YA 2QEXS 3DXSX 2E5HA 3ETMA 3RU0A 2QYGA 3QRPA 2ABYA 1U49A 5CYQA 1U1KA 1TVRB 4LSZB 4CO4A 1ELOA 3MHYA 2ZITA 4QQBA 1S5ZA 4B9UA 2KO1A 4OYZA 5E41A 3GILA 1ZAXA 2ASYA 4NZ0A 3W5ZA 4ES1A 3D2WA 4ZP8A 3WBZA 3G8TA 4LF6F 1JLEB 4OZLA 5KOXA 2EFGA 4WBFA 4M8LA 1UVMA 5IQ6A 2JSXA 5D15A 5K14B 3MTJA 1UWBB 4ED8A 4K7QA 4M5GA 2EW9A 3NCPA 5M2PA 4DL5A 2WW4A 3BO4A 2HS3A 3BGUA 1YHQS 1NB7A 2UXBF 3A8EA 2BACA 3VGTA 4ZITA 4ECXA 2BUNA 2AZ3A 3AOAA 2O5DA 4DV4J 2CDRB 5C42A 4OZNA 3JQKA 3U1LA 4Y2MA 2D74B 3DGVA 2XMWA 2L9WA 3HHNB 1WSRA 3PO4A 1LKZA 3HT3A 1F3VA 1UFKA 4YFUA 4I6AA 1XMOF 4ZCIA 2P6SA 3NY0A 3FCHA 3MR7A 1TR0A 1RKJA 1IQTA 3PHTA 1NZ8A 1QDUB 1RZMA 2XB2D 3BYRA 4C8MA 3GCWP 3JSMB 1TKZA 2EFNA 2MSTA 3ZZOA 1Q5VA 1T02A 4PG6A 1YG0A 3MM7A 1TUWA 2EFVA 3OQ2A 3QT5A 4U95A 4LBHA 3MCSA 3PW7A 3ISNC 4JI7F 4HTIA 1G2EA 4LIWA 3GYXB 3NOCA 2QGFB 2CJ9A 1DQ9A 3DOMB 2K7KA 3R5AA 4X4VA 3AOCA 2GS8A 4WIQA 1S9GB 4EWTA 3W8PA 2KFNA 2VB6A 3LALA 1HIYA 1APSA 4GO5X 2VPXB 1F2HA 5J1PA 4ZPWR 2E29A 3HSZA 2GV1A 1FTCA 2EEYA 2RD5C 3AH6A 1VBXA 2ZVIA 3BREA 2HNDB 2YKMA 3BSOA 2OPPB 5DJBA 1YJNS 4CNZA 3TEGA 2HGMA 2VC0A 3OFGA 3D1QA 2AJQA 4OHZA 3H4BA 1N5YB 5FJ4A 2ZOMA 4DPTA 3ZTRA 3KJQB 7FD1A 4WP3A 4OYPA 1G7CB 1Q8KA 2K1RB 1T7PA 5FD1A 1RT6B 2ADBA 4IH6A 4EBEA 4QIWD 1Z2LA 5ETMA 5A8RB 3B78A 3CPWR 2U1AA 4QW8A 4EBDA 3AQPA 1RKIA 4NCBA 1Y5LB 3ENVA 1RAIB 1FDAA 4Y00A 3W9IA 4DR3F 1JLBA 4WU3A 1CG2A 1HBUA 2YH1A 2IVMA 2BV3A 2BJ3A 3GFZA 2YKPA 2DT9A 2C28A 4MH8A 2V8HA 3CCLS 1WEXA 1RWNB 5HBMA 2ZH5A 1KDNA 4I56A 4ZJLA 3BQ2A 4JI2F 3JXOA 1S48A 4EU0A 1OY8A 4OX9J 4QCLA 3MPUB 4PCQA 3TW0A 4JV2A 1U6FA 4EZ6A 2VL1A 1QAXA 2KT5A 1RAOA 1S12A 1C4CA 2QC3A 4F4ZA 1MN9A 1YITS 4E8UA 4KV8B 1YRUA 2UUCJ 3CDBA 3CD0A 1F9HA 4OHXA 1HHQA 3NCRA 2R7WA 2JRSA 3G71S 5KFUA 1SUQB 3NMAA 4I1TA 1S10A 5AXMA 3W9JA 1KHVA 1N5VA 3GCXP 4JV5F 2BX6A 5F0WA 3M8YA 2VJVA 3GIRA 4PZVA 4XIUA 4BDPA 3NBPA 1M5SA 4CQ1A 5ETQA 2AJFE 2VOOA 1HBMB 2W7PA 5A0YB 4X65F 5ETNA 3PM9A 2NZCA 2KT2A 3EE3A 4U6PA 2DCUB 3MF5A 1CJTA 2P8IA 2NR0A 2R7TA 1B7YB 2RDJA 3OUYA 3OT9A 3PIPQ 4FF2A 2NUUG 4U96A 5HK4A 4IOBA 3GG1A 4YHHJ 4LJMA 5AE2A 2FPHX 4JUZA 1KVIA 1YRXA 4ZJQA 3OTCA 4UTGA 3V5RA 2NLWA 3MCMA 3UN2A 2XMVA 3AJ2A 4AXJA 2ZHOA 4OJ3A 2LP4A 3V2UC 2PO4A 2HZAA 2HK2A 3TA2A 4MT1A 3V4IB 4XO0A 1QVFR 2AMCB 4NYPA 2MGZB 2FYXA 2GX8A 3TAMB 3QT8A 3C16B 2E9ZA 4DR3J 4KGZB 1H3DA 3PVXA 1X0PA 4X64F 2F5GA 5KFJA 3I5CA 3KJVB 3CB4A 2AU0A 2F3JA 4A8XA 1QTMA 2G0IA 1WG1A 1U1PA 3G87A 3UDEA 4O23A 5CHCB 1WDDA 4DV5J 4M5LA 2D3ZA 1TK5A 4ILRA 4X4PA 4DF4A 4KO0A 1NK8A 3DLGB 4DL0C 5E3RA 3GJSB 1ZM4A 2CQ0A 2HS4A 1HWKA 1UW9A 1KOHA 2P9EA 4K4SA 1TL4A 4RW4A 4KC5A 1S1VB 1H38A 1XNRF 2IAJB 3MEGA 4MTPA 5IM0B 4NL5A 4HHUA 2J8AA 4K4XA 1VBZA 2B3TB 2DIVA 3TJ9A 1HI8A 1OY6A 1XN9A 2LQ9A 1K1QA 3GQCA 2LQJA 3R5JB 1KQFB 1KVJA 3F41A 1YVFA 4F7VA 1X4GA 2KKHA 2KU7A 3RBEA 1RTDB 3DU6A 4B08A 2NREA 4CI0B 5H9FJ 1EETB 1URNA 3VWSA 3J81Y 2QSFA 3LP1B 4XK8C 4K0KJ 3M30A 4LF4J 5J2MB 5BYQA 2ZWOA 4X66J 4F4WA 2O1PA 3OL8A 4F4YA 4DUZF 2DGXA 2DGWA 2HNZA 5D4OA 4EO8A 1OSDA 4K4UA 5D8HB 4LRCA 4WYWA 3KK3A 1TV6A 4ZVRB 2XI2A 2DR8A 4DR5F 3KHGA 4CLPA 5DGAA 4X4NA 1UFWA 2JLEA 1T9UA 2CIMA 1U24A 4L72B 5CH7B 2HKEA 3UDCA 1NJIT 1FFSB 2E9RX 1JQGA 1TP7A 1NH7A 5LXYA 2ZE2A 2CQPA 2VKZG 4DLGA 3KLGA 4ES2A 3N79A 4F0KA 2YX7A 1R0CB 2R8GA 2ZWPA 5G4DA 3UCGA 2AHOB 1OMSA 3BN7A 4KY3A 1U1MA 1M5PC 1Y3JA 2Z2LA 1FXLA 4NLUA 2YNGB 4FYWB 3UE2A 1FHTA 3M6WA 4X64J 1UVLA 1U7LA 1WHVA 3CJQA 2Z2MA 2HMIA 5L38A 4ZHRA 1GQEA 3NGSA 4QOTA 4B3TF 1X4EA 3H5XA 4DV2J 3R97A 1Y9OA 3D5MA 4KHPF 4DQSA 2Q6BA 3O8WA 4UOGA 3SCKE 1SC6A 5KG2A 3V6DA 4TLRA 4FYDA 1P1TA 1CULA 3E01A 4RBTA 2A3JA 2RUSA 4FYVB 2GAHC 4DSIA 4OX8A 4DPYA 4O3PA 2MY8A 1XMQF 4BLGA 4YB5A 1AUSL 1Q1KA 4L3KA 3TANA 2R7UA 1IKYA 5ETVA 2Z56B 4ETZA 2GQCA 1SKRA 3MM8A 3D4JA 3MUMP 4NLOA 5IT9Y 3M8QA 4C11A 3KFWX 1A0OB 3D6FB 2DISA 3ZZ0A 3SSQA 4DG1A 2RKIA 2DH8A 5KFXA 4YR2A 4X62J 2RVJA 2GIRA 4USMA 2C2MB 1V3RA 3MD3A 1EP4A 3ET6B 3B8HA 5ETPA 5F8MA 1RI7A 2XY6A 5H9FK 4J90A 2R7VA 3AD7C 4R0EA 4F02A 1CQNA 1YKWA 3VR1A 1XERA 3BH7B 1TL1A 3THTA 4LF9J 1IM6A 4CWBA 4YOEA 3ONQA 1JJ4A 1L3UA 2MZSA 4Q2LA 4WKYA 1L5UA 3G9CA 4DR4J 2NPFA 3JTOA 4F04B 5FLXU 4QR0A 4P73A 1Y11A 2MZ1A 3BJYA 2UUWA 4LQ9A 4X4UA 3AA9A 3P49B 3PYDA 1VQ5S 3BGRA 3TUJC 4BC7A 1RT7A 2RQMA 3HJVA 1GXLA 2PEHA 2UUBF 3B4DA 4N77A 4OZJA 4IR9A 1NK7A 2ATCB 1JMTA 4DDFA 4J9UE 1OO0B 4B3TJ 1WSVA 2M70A 1RUSA 4ELVA 3FBEA 3MAHA 1MW7A 4O3QA 4J91A 1VK3A 3JB9k 4ZLLA 1C1BA 3D9BA 1VQYA 4U67Q 3SDEA 1WOSA 2R7SA 4V1Ak 4DX5A 2PA8D 4KR0B 3Q83A 1RT3B 4KIAA 3HMJG 3CWJA 3I5BA 1L3KA 3E51A 5LMNF 2Z2ZA 1FERA 2CVEA 5HROA 2E5LF 1VK8A 3LP2A 1XMQJ 3RJMB 2QO3A 5KFTA 3MM5B 2EG1A 5A6PA 3GPAA 5E3CA 2CKWA 4HYKA 2DXDA 5KOWA 1TVRA 2CDQA 2C3PA 2J6TA 3BF4A 4P6QA 2ZKUA 1NKCA 2GW8A 1SQEA 2QFIA 4NMXA 4OX7A 4RUBA 3IGVA 3KG4A 2OPSB 1YDLA 2PGCA 3UVJB 1NSAA 3G82A 3H7HB 3OHBA 2XMAA 1WHWA 4IRDA 1YJVA 2HAIA 1KONA 1KS2A 5K14A 3W1YC 3HSDA 2F4VF 3HP6A 4QIVA 2NPIA 2ZJPQ 1WF0A 2DD8S 5ETOA 1EARA 3UN3A 2NXEA 2KG0A 5HANA 4I64A 3C46A 4JI6J 5H9EK 1ZZFA 4LREA 5E3AA 1LXNA 3D6HB 4DBQA 3CIZA 3MD1A 1UA0A 1VQ6S 4I4BA 2LDYA 1CQMA 4JP8A 3LA0A 5SZTA 1H2UX 1JB0C 4HH0A 1IBMJ 4L75A 3SSRA 5ITHA 3PW0A 3QGIA 2B7CB 3ZO7A 1VQ7S 1W26A 2A1BA 3QLHB 1S49A 2UUBJ 1X5OA 3JSMA 2LEBA 4OL8A 4AD6A 4CNYA 4LF5J 5GMDA 1MU2B 2QA4S 3HD2A 1VDHA 1MMDA 1NMEB 3VGVA 4ER8A 2VUGA 4YEAA 3JTPA 4Q44A 3I0SB 2UXCF 4MAKA 2FTRA 4FXVA 4RU9A 2DO4A 1KEKA 4FP9A 1S9GA 1U8WA 1NPRA 2MLXA 4KT0C 4AQYF 2NXNA 1DY3A 5F41A 5LMNJ 3ZC4A 1PGZA 3RW6A 3ULHA 4DR6J 3D68A 4F4AA 4LIRA 4FN5A 2E5GA 1WHYA 2XMJA 2HNDA 2GIQA 5THWA 2K7JA 1LWFB 2A0FB 3FRYA 5GAGU 4IRKA 3MR6A 1N32J 1NKBA 4LBPA 5F8HA 3VZHA 4GO7X 2FJVA 2W24A 3MCNA 1N5YA 4YN3B 1WKLA 3MM9B 1AFJA 4JI0F 2QLBB 1RYSA 2K1RA 2KJWA 2DGSA 5D4LA 3F0NA 2N7CA 2W9BB 4HEA9 1XMBA 3AJ1A 1WKJA 1CJVA 1KKHA 1RISA 4C6AA 4ZP7A 4LVOP 3MMJA 5HVHA 5A8RA 1TUGB 4I7FB 3Q8YA 1UKUA 2NZ4A 2DNQA 3HI9A 3L09A 1AUDA 1WF2A 2C2NA 2CQ3A 3NGKA 2K3IA 2PI5A 1RK8A 9RUBA 1WC1A 5DM7Q 4P10A 4JI5F 4A47A 5A8WB 4KPCA 3PW5A 4QR1A 2EG2A 3HKWA 5GMEA 2MQ8A 2VG7B 1U25A 1REVB 1R7IA 3OR1B 3BBBA 3EMTA
chains in the Genus database with same CATH topology
3GMGA 2ERRA 2LVWA 7FDRA 2JWNA 2AV5A 3OXLA 5B0CA 1T8EA 4X4QA 3QIDA 5KG0A 1K0TA 2YH0A 1QAYA 4YMEA 2XC9A 4LSNA 4HT5A 1BC6A 4EZ9A 4ZLPA 5DLGA 5HP1A 1XR5A 5HQ8A 2GMJA 2C3OA 1RWUA 2GMLA 3LPYA 2X1GA 2ZD1A 1N56A 1PC5A 2H5EA 1U09A 2DCLA 3QPIA 2G9OA 5E5NA 3M8RA 1MNEA 4C8OA 4HH1A 3Q8SB 2VD3A 3DMJA 5HMWA 2HGNA 1X0FA 4KO0B 4YQWA 4RW6A 3LP0B 6FDRA 4ALZA 4ED2A 2OIHA 4F2SA 4DL6A 1YWXA 5DETA 2VG6B 1FDBA 2I9SA 3AB2B 4HHJA 4KV8A 3PX0A 3IR6B 2ROEA 4NCAA 1NAQA 2BRKA 5IWAF 2ZKTA 2CJBA 3DFEA 3QJLA 2EFQA 1KOOA 3D0HE 4RNOA 1N36F 1PO6A 3MEDA 3VTIA 4W92B 1HYSA 1RTIA 1ULRA 3MEGB 1H0HB 1SJ4P 1Q53A 4PQAA 2LA6A 3NL0A 3QJJA 3IAM9 4OI0A 2G1DA 4O4GB 4K5SA 3D0IE 1RT3A 2IYIA 3KHRA 4DEZA 4DSEA 2J5AA 3VAGA 1FRJA 2E5JA 3IWXA 1DTTA 4ID5B 5D6GA 1CLFA 1ZZNA 4IH5A 3DHWC 1D9DA 3EUNA 3HZGA 3DYAB 3DRRB 3L3CA 4WFBQ 2OAUA 5LMUF 1SH2A 2A18A 2DRBA 2KM8C 4N76A 3K0JA 1HBNA 2CJAA 4RW8A 3F44A 4C3KA 2DK2A 1Q7YT 2UVUA 1YTYA 2KJVA 4EEYA 1T95A 3CJ2A 3PX4A 2B4UA 2HHVA 2KDOA 5C24B 2HHTA 1D3WA 3HVTA 1BQNA 3J7ZT 3HDSA 2C2RA 2OH2A 2O3DA 5D4NA 4PPZA 3MM5A 5DS7A 5L8RC 2CPDA 1AROP 2CPYA 3QAEA 1J2VA 4FF3A 4RX6A 2AP6A 3GIJA 1RGVA 4URSA 1VS3A 1N5QA 1HBMA 4AL7A 2MDAA 3RAXA 3OR2B 2RILA 2F1FA 2RRAA 1UVKA 3I4PA 5A0YA 4LSLA 1IKXB 3MEEB 2BE2B 4CT9A 4IFVB 3FGVA 3CJKB 3QZ8A 2ALZA 3OJUA 1R6YA 2FB0A 1PSDA 2N4CA 3M30B 1GX5A 4A8MP 1C1CB 3FJ2A 3M2RA 1DLOA 3QIPB 4ZCKA 1VRTB 3BEGB 4RNFA 2PI4A 4J9SA 3I6PA 2KXNB 2I1RA 1DFDA 4WU2A 5M2UA 1GTEA 3QWUA 4RW9A 1HBOB 2HNZB 3M6UA 5KG5A 5ADZA 5GAHI 3Q23A 1S0VA 3NRBA 3IFEA 3OJSA 4PR6A 2WSFC 2I0XA 3SCIE 4XPEA 1VC5A 3W7BA 3CJ3A 1S1XA 4EFAC 3C2PA 2XNQA 1ROFA 4ED7A 2LYVA 3KK3B 4PG4A 1NK9A 3JYTA 4USJC 4UY85 3EGWB 2J6UA 2DR5A 1JWWA 4Q45A 3AA8A 4N8NA 3T19A 1WI6A 2BVZA 4WK1A 4FBTA 1GXTA 5LXRA 4K4YA 1JLGB 3C6TB 4JI6F 2KYXA 3W2VB 3R5CA 3DLLQ 1L3VA 2Q66A 3JSYA 3M32B 4MK7A 4EBCA 2KFZA 4UUXA 4C8YA 3KLHB 2OD6A 1WG4A 2DGVA 2R7OA 3H5YA 3J80Y 1O51A 5IFMA 1D0EA 2ZHAA 2J0SD 2DGQA 3J7YU 1BWEA 1LWCB 1IKVA 5B0DA 1KTVA 3NP5A 3PJWA 3Q22A 2GQ2A 2IA0A 2N4DA 3DOKA 3W3SA 2MGZA 4B3RF 1UMJA 5U47A 2W9CB 3TAMA 4DN9A 1ZPVA 2OMOA 3JAMY 4DV1F 1RJJA 1BQMA 5F3ZA 5F8IA 1HA1A 4OZ5A 4LFAF 4N41A 2ZE2B 3GR0A 2BANA 3BQ1A 3IG1B 1X4DA 2OLWA 2MXYA 5GAEU 3TRGA 2CQ2A 3VAHA 2AJ4A 3OXGA 2VH7A 5BYRA 2RF2B 3G8QA 3CCTA 3IR5B 3KLGB 5AJ3F 5DDPC 1XBWA 1OPZA 4C3LA 5KFBA 1L3TA 3FEZA 2DNZA 4K2XA 2HW3A 3KJVA 5LL6d 1FJEB 1S6UA 1IBMF 3VF0B 2HHXA 5BYSA 1ZTTA 5KFGA 4HDHA 1RTHB 4Y0FA 3UCZP 3PXGa 1TAQA 3M8PA 3I9V9 4NCGA 2XMKA 3SCLE 5HL7Q 3A1YG 4UQTA 3LWLA 3R1LA 2AJ1A 2B43A 1JKHA 4IQMA 2GHWA 1ZAVA 1ZPWX 4PWDB 3FFIB 5G0RA 2EBEA 4R25A 4NA1A 1RT1A 1TKTB 2R7QA 3KMSA 2OFHX 3CJ0A 4ID8A 3NAHA 2XEXA 4MJKA 2XWXA 4WTYA 1TL3A 4A8WA 2FLOA 2HNYB 5KFVA 4WXWA 2ILZA 3SV4A 2QE5A 3DLGA 4A4JA 2OD4A 4BCAA 2PC6A 2ZH7A 3CD7A 4LF5F 1F60B 3BQ0A 3POTA 1HWIA 3FMWA 3D1HA 2W7OA 2HMIB 1X7VA 3I0RA 1FKAF 3GFHA 1IM4A 2D1CA 3DN9A 3KLEB 3HXMA 5D3GA 2FGOA 2HVZA 1FJ7A 4USIA 4ZHRB 1C0TA 1NEEA 4KHRA 3EX7B 1FD2A 2RS2A 3MAQA 1KLMA 1S1VA 2IAJA 1TL5A 4RWXA 3UWTA 3OLAA 2RMLA 5IM0A 3KWMA 3GV5B 1HNXF 3NLCA 1K1SA 2UVRA 3PEJA 4I67A 4R8UA 2J7UA 4ECRA 1HQUA 2XZWA 1U2FA 4TY8A 3UDLA 5I42A 1H7XA 1FT8A 1S9FA 2ZZNA 1RT5A 3MMBB 3N4WA 3LAKA 1H2TZ 3IAS9 2PA3A 4TKTA 5KT6A 3I0SA 4ILMA 2Q43A 1KHWA 1YBAA 2J0WA 3WC2A 2L9DA 3Q8RB 3I56S 2DNMA 2DNLA 4ZVFA 1SKWA 2FLNA 3E01B 5JUMA 3S1TA 5F9LA 2F40A 2FHOB 3IR7B 3KNGA 4OIXA 3TQ1A 4RNNA 5D4PA 1DHMA 4Q2MA 1RTDA 2LU2A 3MGJA 3LGMA 4LUBA 4KHMA 2BA9A 3M6XA 3J7A1 2FHKA 2KI2A 2CQCA 1CEZA 3EYZA 4CH1A 2JEJA 1YSJA 3HM9A 5EGYA 4DMZA 4C0HA 2AX0A 4DR1F 4DR6F 3E3XA 4G6VB 2B4VA 3K5MA 3D0GE 3KTQA 5CZXA 1HW9A 2UV8A 3TAPA 3KLFA 2ZVSA 4MIAA 4OI4A 1G1XA 2HS0A 5EN1A 1I94F 3WX4A 4WK3A 3KLIA 5F9NA 3DU5A 4DQRA 4C8ZA 4C3MA 2MZTA 3BSCA 4CIOA 2AX1A 5F3TA 4ES3A 5J2MA 4V19X 3H59A 3I32A 5D78A 4M94A 3NWGA 3M05A 4TN2A 5B0GA 2FC8A 1N32F 2FHJA 2YNIA 3KLVA 4D3HA 3LWMA 3H98A 3GE9A 3MM8B 3OSNA 1KQGB 2VKRA 3SI8A 1RTJB 1S99A 3FVYA 3HVAA 4NLQA 3U02A 5K9FA 4X4RA 1P9QC 2J0QD 5B7WA 4WYLA 1HD1A 2RQKA 4ITSA 3CD5A 4CZCA 3OFHA 2ZDOA 3DGPA 4ED6A 2QMWA 2IRYA 1T3OA 3DLJA 3M8QB 4C11B 3RRHA 5AE1A 2LKZA 4RLEA 4PXEA 2YKMB 3OLBA 2FVPA 1DBDA 3K5OA 2QFJA 2RKIB 4IG0B 5IT0A 1V3ZA 3DRPA 4A46A 5DQIA 3ISZA 4ECQA 5CXTA 1FF2A 3RYLA 3EXCX 1S79A 4FVCA 1IUJA 3ZFVA 4ZVGA 4NYZA 2BR0A 3FSXA 2IVFB 2XS5A 3ICLA 3I87A 4YDXA 2J9DE 2N3OA 1H6KX 4KFBA 5KT5A 1S6QB 2V0NA 4QWCA 5DLFA 1EP4B 4YR0A 1G3OA 3T5HA 1Q8IA 2JVOA 3CVKA 3OTDA 3TVKA 4C9DA 3N5FA 3SEOA 2YWEA 2Z8QA 1LK5A 2M9KA 3DRSB 3R27A 2CQHA 1C0UB 1FNXH 1LW2B 2NSBA 2ZBCA 2XGPA 3EZ5A 3MMAB 1B64A 1LOUA 4QR2A 4FNIA 1WACA 1QSLA 1KC8T 5FDLA 3HHLC 3PV8A 1M1KT 2IJNA 3GB0A 1QUVA 2LEAA 2XS7A 1QAIA 4OJGA 2HHUA 2LXUA