1HA1A

Hnrnp a1 (rbd1,2) from homo sapiens
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
173
structure length
167
Chain Sequence
EPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKVDGRVVEPKRAVSREAHLTVKKIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHNCEVRKAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the two RNA binding domains of human hnRNP A1 at 1.75 A resolution.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Nuclear protein
molecule keywords HNRNP A1
total genus 51
structure length 167
sequence length 173
ec nomenclature
pdb deposition date 1996-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1ha1A01
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1ha1A02
2MZQA 2E5IA 2AYBA 2BZ2A 2WBRA 2M70A 3UCGA 4QPTA 2KM8C 1D9AA 5LXYA 1IQTA 2YH0A 2XS7A 3R1LA 2F9DA 1N8RT 2CQCA 5D78A 2M2BA 4QU7A 2DK2A 1K8AT 4J5OA 2MZ1A 1WELA 3NNCA 2LEBA 2D9OA 2MKJA 1U1MA 2LXUA 1SJRA 4IOAQ 2PEHA 2CQ2A 2OTLS 5EN1A 2L08A 3PIPQ 4Z2XA 2KRRA 1U6BA 4QQBA 4ED5A 4YUDA 2HYIB 2J0QD 3ZZYA 2M8HA 2MJUA 4IOCQ 2F3JA 2LMIA 2RNEA 3MUVP 1DRZA 2VODA 1FXLA 1WTBA 2K8GA 1JJ4A 4WKRA 3CC2S 2DGWA 2CPEA 4WCEQ 3K0JA 1A9NB 2MZJA 2NZ4A 1G2EA 2CJKA 2VOPA 1K73T 2MYFA 5FJ4A 2KHCA 3N9UC 3NMRA 2KG1A 1QM9A 2KXNB 3Q2TC 3PIOQ 1FHTA 2E44A 3IWNC 2YKAA 3DLLQ 1U1OA 2MQOA 2DGOA 3VAFA 2J8AA 1YI2S 2KM8B 1U1QA 2M0GB 1UFWA 2RQCA 2DNZA 1DZ5A 2K3KA 1O0PA 2MZTA 1NU4A 2MKSA 2LQ5A 2RUGA 2X1AA 2ADBA 2XNQA 3CCSS 1KOHA 2OTJS 1DHMA 2RS2A 1M5KC 1R8PA 2CPXA 1YJNS 3CULA 2EK6A 1BY9A 1PO6A 5CYJA 2CPFA 5GVQA 3LQVA 1UW4A 3UCZP 3VAJA 1UP1A 2BOPA 1WG1A 3G4SS 3EGNA 2D3OR 1PGZA 2I2YA 1VQPS 3CCVS 2CQ1A 2RS8A 1Q7YT 5IFMA 3THTA 3CTRA 3CPWR 2DHGA 2HVZA 3CMES 4F26A 4C7QA 2DNNA 1AUDA 4TU7A 1ZZFA 4OZ0A 1WG5A 2DH9A 2DNMA 3BO4A 4OZ1A 2E5HA 3MDFA 1F9FA 2FC9A 3SXLA 2MQMA 2CQGA 3US5A 2OIHA 2DNKA 5DDQC 2ZJPQ 2YWKA 2CPIA 2XB2D 1VBZA 2MKKA 2HGLA 1YHQS 3THPA 2FHOB 4BS2A 2CPHA 1QVGR 1HL6A 2EVZA 4F25A 4PRFA 2DNHA 3CCUS 3UWTA 2RU3A 1H6KX 2DNRA 2XSFA 3IRWP 1X4CA 3VF0B 5IM0A 4YOEA 2CQHA 2CQ3A 2DH8A 2KG0A 5LSOA 1M5PC 3CCMS 3SMZA 2MKHA 4LJMA 1QVFR 1VC0A 3HI9A 3MXHP 3B4MA 2HGNA 3J7YU 2OJ3A 5MLCV 1HA1A 2CQ0A 2CPJA 3NS5A 4EGLA 3SDEB 3P49B 2DNQA 2FPHX 3VAHA 2CQIA 2NLWA 3BS9A 2B0GA 5GAGU 3DXBA 3U1LA 1X5SA 2ADCA 1VQ4S 3CD6S 2LA6A 2MHNA 2RT3A 3UD3P 3Q2SC 1WEYA 1FT8A 3S8SA 2UP1A 2MZRA 5JVGQ 1Q86T 2YH1A 1RKJA 3R1HA 3U1MA 1WHXA 2LXIA 3P5TL 3G71S 3VAKA 1HD1A 1WHWA 1WWHA 5DM6Q 5GAHU 2MY8A 2KFYA 2MQQA 4UY8T 1H2UX 3TYTA 2LECA 1KC8T 2MY7A 2XNRA 2MSTA 1VQKS 2D9PA 2QFJA 2XS2A 2MQPA 2MPUA 2MXYA 3S6EA 1VBYA 1FJEB 1SXLA 2MQLA 1FO1A 1WF1A 2PE8A 2L9WA 4LIRA 1WI8A 2CPYA 4TU8A 3VAIA 2M4MA 3I56S 2M8DB 1Q81T 2RVJA 4TU9A 2KH9A 1YJWS 2MGZB 4PKDB 3R27A 3CCES 1X4FA 2LKZA 1U1KA 2F9JA 3BO2A 1S72S 3EGZA 4F02A 4WFNQ 2DNYA 1NJIT 1SJ3P 2DNLA 2DISA 2KN4A 2A3JA 2LA4A 2EK1A 3CXCR 1X4AA 4CH1A 3L3CA 4IUFA 1M5OC 1WEZA 1WHYA 5GADU 3G8TA 4RU2A 3CC4S 2DGTA 1L3KA 1N52B 1U1RA 2MKIA 2DHSA 2DIVA 2L41A 1K9MT 2E5JA 1OO0B 1M5VC 2HZCA 5DDOC 1M90T 3UD4P 2X1GA 1U1PA 2DO4A 2VOOA 5HL7Q 2JX2A 4A8XA 2CQ4A 3MD3A 5H1SV 3CCJS 4ERDA 3FEYB 3MI7X 2DGXA 2KXHA 2N3LA 1P1TA 3CCLS 1HD0A 4WIIA 2G0CA 1VQ6S 2DNOA 5CA5A 1FNXH 3FEXB 2AD9A 1OIAA 3HHNB 2ERRA 5BJRA 3VAGA 3LPYA 3G8SA 4LMZA 2HGMA 4M5DB 4PR6A 2DGUA 1VQ5S 2KU7A 3VAMA 3ZZZA 4V19X 1JMTA 4CH0S 3CUNA 1VBXA 2G1DA 1X4DA 2CPDA 1WI6A 4C0OC 4WFBQ 1JJHA 2J76E 4W92B 4Y00A 2RQ4A 1FJCA 1OPIA 1X4EA 3VALA 4ZKAA 2MZSA 1CVJA 4IO9Q 1S79A 3TO8A 2OSQA 4QU6A 1WF0A 4WF9Q 4Y0FA 5CXTA 4WFAQ 1X4BA 3RW7A 2MB0B 2U2FA 2DGVA 1R8HA 5LJ5Y 1H2VZ 1YIJS 5DETA 1U1NA 3D2WA 1KQSR 4C4WA 1N88A 2DO0A 2JRSA 2YTCA 2O3DA 1YTYA 3S7RA 2ZJRQ 2LCWA 3MD1A 2MGZA 2M88A 2DITA 2V94A 2M52A 1FJ7A 3EX7B 2DH7A 4UQTA 3NNHA 2DGSA 1YWXA 2MQNA 2LEAA 5LXRA 3CMAS 1WG4A 2M7SA 1DBDA 2MJNA 2AYGA 5IM0B 2DB1A 1SJFA 1U6FA 1KD1T 1N54B 1U2FA 3G6ES 1KOOA 2RRAA 2X1BA 2CQBA 3S01A 1VQLS 3OW2R 1U1LA 2AYEA 4W90B 2MMYA 4FXWA 2VONA 2SXLA 3ULHA 3JB9k 1D8ZA 3NNAA 2DGQA 1B7FA 1YITS 3P3DA 1VC5A 2DNPA 2N7CA 3NS6A 2QA4S 5JVHQ 1VQOS 4TLQA 2OSRA 2Q79A 2DIUA 1UAWA 3B4DA 1WHVA 1VQ9S 1URNA 3SDEA 1X5PA 2U1AA 3CC7S 3I55S 2FC8A 2DNGA 3BEGB 4CQ1A 2N3OA 5DDPC 1H2TZ 3MURP 2XS5A 1WF2A 3RW6A 2G4BA 3V4MA 2MKCA 1VC6A 1P27B 1VQMS 2DHXA 2JVRA 2MSSA 3MOJB 3MUTP 5IQQA 1SJQA 1RK8A 5D77A 2CPZA 1JJ2R 1X5TA 1NO8A 2KVIA 1W2BR 3BO3A 2X1FA 2JWNA 2M9KA 1X4HA 1VQ8S 3CCRS 2LYVA 4FXVA 1YJ9S 3CCQS 1X0FA 2RRBA 1VQNS 2FY1A 5ITHA 5GMKa 1ZH5A 2AYMA 5LSLA 4U67Q 4P6QA 2J0SD 5HO4A 1ZZNA 1M1KT 3TP2A 1SJ4P 3J7ZT 1WEXA 4YB1P 4CIOA 5DM7Q 2DHAA 2N82B 3G96A 2GHPA 3CF5Q 3UE2A 3G9CA 2KI2A 2I38A 2KRBA 1X5OA 1XN9A 3H2UB 1Q82T 3P6YC 2KXFA 2CQPA 3MUMP 1VQ7S 5LJ3Y 3H2VE 2QEXS 5DDRC 1X4GA 2JVOA 2E5GA 2GO9A 2KT5A 2ZJQQ 3UCUP 2KYXA 5GAEU 2CQDA 1A7GE 1OWXA
chains in the Genus database with same CATH superfamily
1EP4A 2CZ4A 2MZQA 3A3NB 3PW5A 1MW7A 4HHHA 4CM2A 3H5XA 1T0TV 2Q3PA 1ZA1B 4OZNA 1XNQF 2B8QA 4ZPWR 4KB7A 1EKSA 3PCOB 2CJXB 2M70A 3VVTA 3Q8SB 5KAKA 1PYSB 4CM0A 9ATCB 5LXYA 2HHHJ 4ZPDA 1S0VA 2V34A 2VU5A 3KYLA 3BDPA 2B6AA 2EI5A 3KLGB 1B64A 2F9DA 4BLGA 1N8RT 2BE7D 4OI4A 1JLCB 1F5BA 1Y11A 2P9CA 4J9RA 4Q2MA 1N5VA 2B4OA 1RT7B 2QLWA 4YB5A 1RT4A 1Y5NB 1RTHA 1Y0HA 3HHLA 4OI0A 3SCLE 5EHHA 1HARA 2NCKL 3AXMA 4L74A 3BBBA 1AZSB 1WTFA 2P8IA 4PG6A 2V2ZA 4ZVRB 1RWOB 4L72B 3ETOA 2P5VA 4IOAQ 2KL8A 1TVRB 1RT2A 2PEHA 1ZAXA 2DR6A 2H3EB 2L08A 2WCXA 3D54A 1R0BG 3M6XA 3QIDA 2PDAA 2YQ1A 1NK8A 1JXEA 2BEFA 2GAHC 2DRAA 2IHR1 5ETVA 1HI1A 3W7BA 4DZ6A 2W7AA 2HYIB 4QYRA 4ED5A 2M8HA 5KFMA 1UWAA 2RNEA 1QLNA 2C3YA 1RHKB 1NPKA 2W4CA 4OHVA 5A0YA 4FVMA 2UUAF 2HWTA 4I2PB 2VODA 3OVBA 3OT9A 1WKJA 1S99A 3SSSA 3T5JA 2FYXA 1JJ4A 1Y00A 2DXDA 1H98A 2PGCA 4NLYA 2DGWA 4K2JA 3LP2A 4WCEQ 3K0JA 1JLQB 3NWRA 4ZP9A 3CE8A 3D1QA 3E3XA 2QMUB 1DLOB 2RUSA 3MEDB 4I7FB 4PABA 2VOPA 2MYFA 4I2PA 5FJ4A 2B43A 3CB4A 2UU9F 1XK8A 3TX0A 3R5CA 4ZN1A 3R5JB 4M5GA 3MR3A 1ZPVA 2WTFA 5KG4A 2KXNB 3I0RB 2Y1IA 1FDBA 3QWUA 3PIOQ 3UD5A 2BANB 3ET6A 3C6TB 3NGRA 1FHTA 2VH7A 3MR7A 1XR7A 2COLA 2VV5A 2YKAA 4MIBA 4ZOSA 4PG4A 3ZFVA 4DXLA 1U1OA 4JYAF 5H9FK 1H7XA 2DGOA 3N6MA 3KG4A 4ZVTB 3VAFA 4RLEA 1SKWA 2F8EX 5LMUJ 2I8EA 2YKNA 2J8AA 2ALYB 3HX9A 3GYXB 4PYDA 1PILA 2IVYA 3I87A 1YI2S 1U1QA 1M5SA 2E1MC 1Q8BA 5C5JA 1OY9A 5FIIA 2MZTA 1MN9A 4FBTA 3JTNA 5G0RB 4N5SA 4Q0BA 3DU5A 1RAGB 3HT0A 4H4KC 2MKSA 3RYLA 2C3MA 2ADBA 3HXMA 3UDEA 2E1PA 3BH7B 4QZVB 1QSYA 3VQTA 2JLFA 3AAWB 2XCPA 4ZIVA 4K4TA 1R8CA 3RAQA 1M5KC 4WBFA 2BABA 4OYAA 4DL0C 3V6JA 2KDOA 3W5ZA 1FRKA 3KNAA 2BKOA 1PO6A 5CYJA 2CPFA 4OZ3A 2XYHB 2HNDB 4YN3B 5GVQA 4F67A 3K59A 3VAJA 3UCZP 1QAIA 4RW7A 1FRJA 1WG1A 2CVEA 4JP8A 5A0YB 1X9SA 1IBMJ 2BOPA 2UXBJ 5HBMA 3CCVS 1MMNA 1WSVA 2CQ1A 2RS8A 2R8IA 2HHTA 5IFMA 5J2NB 2DXFA 4DV2F 1ULRA 3IBFB 1J5OA 1YGYA 4M5JA 2WK4A 1GMWD 4F26A 2EKYA 5AJ3J 1GT8A 4A8MP 2MQ8A 3HPOA 1N4LA 4IYQA 1T94A 3CJQA 3EDRB 4LBPA 4P73A 4TU7A 2BE2B 2NR0A 4LRAA 3DOKB 4ED1A 4OZ5A 4DMZA 1NHVA 2V4JB 1EQ0A 3P4UB 2LEPA 4K0KF 2VD3A 1TL5A 1DQ9A 3HP6A 2ASDA 2BANA 3ET6B 3VCDA 2QG9B 4RW6A 1QD1A 5HP1A 5EUHA 3R6GB 1GFWB 2E5HA 3MDFA 4DBQA 1S1XB 3PR5B 1HQEA 2DBBA 2FC9A 3MEGA 2XULA 3SIPB 4AL5A 1VFJA 1Y4ZB 3SXLA 2MQMA 2Y8YA 1FWLA 2GVZA 1S1VB 4JV0A 3WX8A 2EKNA 2CPIA 1JLEA 3MPDA 2GJFA 2DY9A 3MM6B 1JB0C 1XJWB 5M2RA 2MKKA 1HQEB 4BC7A 4KO0B 2CAJA 2W4PA 1NPPA 3BN4A 4CLZA 2F7VA 3IC1A 2VDHA 4RPFA 2ASJA 5AT1B 1K0TA 4F0KA 2P6TA 2B9EA 1HL6A 2GX8A 1U09A 1TKXB 2P2CB 3BR9A 4PRFA 1EARA 4YY3F 3AXKA 2CFXA 3DOLB 4Z37A 3MFIA 2AU0A 2E9RX 2UXDF 2RU3A 5T14A 3BGFA 3SCKE 2GMJA 3RR7A 4HKQA 4KHPF 1JWWA 1LFWA 1NB2A 2XSFA 4NLDA 4J9KA 2PMZD 2OGUA 2YBVA 3HVTB 4X4UA 2CQHA 3M8WA 2KVQE 4MK8A 1OSCA 1M5PC 1AFIA 5KFLA 3E01B 1FJGJ 1WC0A 4ED2A 2G1HA 2WONB 1FVQA 1X8DA 4LF9F 3VQSA 3TW0A 4BHQA 1QVFR 4DR1J 1HBNB 3HI9A 3BBFA 2GMHA 4F8RA 4DL2A 5L1LA 3H59A 2H65B 1XC9A 2AW0A 2R7OA 4F2RA 3QJJA 3LOUA 1U2CA 3CDBA 4PEOA 1ZM3A 3C2PA 4B9VA 1ZS6A 2I1RA 3ZTRA 5LMNJ 4IG0A 3DOKA 1HA1A 1FKOA 1HBNA 4B3RJ 3DLEB 1HNWF 2VA2A 3WZ0A 2YNIB 4QR1A 2FPHX 2DR5A 1RBLA 3TAMA 3BS9A 3BGRB 4WP3A 3TJAA 3VGTA 1ZOTA 4WTOB 2RDJA 1NJZA 3BREA 4MYTA 1X5SA 3R6LB 3U1LA 2W2PP 4FXDA 2VG6B 1VIXA 1NKBA 4CO3A 6FDRA 1VQ4S 4B9MA 2MHNA 3PRBA 2BOAA 1WEYA 1FT8A 2MLXA 3TAMB 2MZRA 5K8NA 5JVGQ 1UJ5A 2HNZA 5GADI 3JAMU 2YKMB 2ZH5A 2HBYB 1AB8A 3KLVA 1UETA 4CTAA 3GIKA 1F3FA 1KVIA 1EX8A 2LXIA 3MMBA 2OHDA 1S1UA 1SQFA 5J2QA 3T6JA 1P6TA 2BRKA 3R3TA 4ETXA 5DM6Q 5BXIA 4IQMA 2ZZMA 4WYLA 5I3PA 4UY8T 4DR7J 2XMTA 3GFYA 4WE1B 3TYTA 1TMMA 2WHOA 3AFGA 3I5CA 3IGNA 3OBIA 5BYQA 4J9PA 5I3QA 4I67A 2ZNZA 2HAIA 2QSFA 3I5BA 2A2DA 1KC8T 4JV5F 1HNZF 4FF4A 4XAKA 4UOHA 3TEGA 2XNRA 2D3UA 3KJNB 3POTB 5E7OB 4I6WA 1HNXJ 1SKUB 2GGPB 1S49A 2C2KB 2PFFB 3M8PB 4DSEA 3IO1A 4KGXB 5KG0A 4PXCA 1VMBA 1WF1A 2J9DE 1NPRA 2X7IA 4LIRA 1WI8A 1YRUA 2FVCA 5B08A 1F0XA 3CCWA 2HFOA 1RT6A 2M4MA 2YPYA 4MT1A 2VFUA 1S6PB 1LV5A 5HAOA 3AQPA 4FN5A 2UUWA 1NKEA 2KFNA 4MIAA 3RBEA 1IWAA 1Q81T 2FHJA 2CWKA 3A8IA 1NSKL 2BUNA 2MGZB 1TFWA 1ACMB 4NLQA 3AA9A 3LP2B 1S6PA 2GVDB 3IA0A 1B0PA 2ZBRA 4P71A 4X2BA 5HROA 1U1KA 5A6WA 2F9JA 3HZEA 3K89A 2UUCF 5HSPA 2BJ8A 3SV4A 4AXIA 3BSNA 4GVBA 1SH0A 3A1YG 1HWIA 2KHDA 2V6AA 1RA6A 2DISA 2UXDJ 4XIUA 1H0HB 1N5TA 2OP5A 2EK1A 3FEZA 3NAHA 4ZVPB 1HNZJ 4IRDA 2OMOA 4NCAA 2JH3A 4U8VA 4DUYJ 4CH1A 3L3CA 4JI1F 3M6UA 1HHSA 1HWKA 5EX0A 3IAS9 5D15A 5FDLB 1WEZA 4RUAA 4NZ6A 5J2QB 2B7CB 3GYGA 2DGTA 3L09A 5HVGA 5HVHA 2DR7A 5F8MA 1GH8A 2ROEA 4Z7CA 1UTAA 3RB6A 2DHSA 2GQQA 3LA0A 3R7SB 4LF9J 1RT1B 2YNGA 2E5JA 3IFEA 1RTJA 3EVMA 4X65F 5DDOC 2Z56B 3D6FB 3IS9B 1W7WA 1M90T 3GIRA 3UD4P 1KN6A 2YNFA 3O44A 4U96A 2H4WB 2RQKA 2DO4A 1XIQA 2J7KA 3QPIA 5E33A 2JX2A 4R0EA 4LF4F 3TVKA 5E5NA 2HURA 3AOCA 4CO0A 2E1CA 3MD3A 3RB4A 2NXNA 1RWWB 4I68A 4O3NA 4TVAB 3MM5A 3M2UB 3NGKA 4I4BA 3OD2A 5KFOA 5I3UB 3SQGB 3KKFA 1D0EA 1QSSA 3DRXA 2VF3A 2DGXA 2N3LA 4ZHRA 3HMJG 2JL9A 3I96A 3GPAA 4WIIA 1NJXA 1OJ4A 2DNOA 3E2EA 3D1HA 2XMAA 5SUHA 1FNXH 3HHNB 4LIWA 3L7OA 4ILRA 2CJBA 4NLOA 3LPYA 5BJRA 4M63A 2GIFA 3DGPA 3G8SA 4M1KA 4UZBA 3MAAB 3TEHB 4RNFA 5C2CA 4B3MF 3ZZPA 3QBCA 4LMZA 2W2OP 1ZTWA 2DGUA 1N56A 1SUQB 3LAKA 2VKZG 4N8OA 1UEKA 4U7CA 5J2NA 3BM7A 2KYZA 3W9HA 3H20A 2QV6A 1C0UB 2BKNA 4GRSA 1O51A 1FKPB 2HRYA 1MWQA 3A4TA 1AUSL 3C16A 3G82B 3HFVA 3QO9A 4C6AA 4ZCIA 1RTHB 3CUNA 1VBXA 3T5LA 1BWEA 2NZCA 3V81B 1X4DA 3ILOA 1NDPA 2AZ3A 2QYGA 2ZDOA 2EFPA 5DS7A 3GSIA 1HLWA 4NLPA 2CNOB 1WDTA 2OUGA 1S7IA 3PDNA 4Y2CA 3NGSA 4W92B 5B0CA 2RQ4A 1RA7A 1OPIA 2W24A 1FJCA 4JI6J 3P5BP 1JLBB 4LREA 3T6BA 1N33F 4IFYB 3JSMA 2V63A 1RT5A 4BC9A 2IC3A 4IO9Q 3ILIA 3SSRA 1CVJA 1WC4A 4IFVA 2OMLA 2RF2B 2OO4A 4ED6A 2EBGA 2E7VA 1HWUA 4LSLB 3W5YA 4R5PA 1P9QC 3MTKA 5CXTA 4LF8J 3BSAA 4WFAQ 4DQRA 2ACMA 1RE1B 2ZE2A 3LTOA 4KO0A 4QWAA 4X4TA 4DR4J 1RT5B 2AJQA 1PSDA 5LJ5Y 4K4WA 1GQEA 2RRNA 2JEJA 3GYNA 3P8BB 4OJ3A 4K0KJ 3T1AA 3D2WA 3UQSA 3TA1A 2Y1RI 2B3TB 3WQPA 4Q44A 1S6UA 4ETZA 1YTYA 3UN2A 1B7YB 4BDPA 4JI2J 2ZOGA 1NM2A 5IC6B 3T1YF 2M88A 2PMWA 1TUGB 2PO4A 2WRMA 4WTYA 2DH7A 2VFRA 3ZZ0A 2JLGA 3QIPB 2UU9J 3I0RA 2AWZA 3NNHA 5J1EB 3KXDA 4MH8A 4EUVA 3PV8A 4NLGA 2DY1A 3D0GE 4C8ZA 3Q83A 4KJIA 4GC6A 2DVIA 1WG4A 3M32B 1NAQA 2M7SA 3PFEA 4IQXA 2APOA 5IM0B 4FF2A 4FP9A 5J1EA 3KHRA 3MR2A 4OX6A 5L1IA 1UVNA 3CJ3A 5KFWA 5LMUF 4JBCA 1U6ZA 2HFVA 2X1BA 2Z0GA 3S01A 1L3SA 1VQLS 3I6PA 1F5AA 2GW8A 2QLJB 3I4PA 5KT4A 4A8WA 1U1LA 5KOWA 2WVEA 4NYPA 4GKJF 3ENAA 3FC9A 3FJ2A 4QIEA 1HNVA 1P8GA 4IKAA 2XGQA 2XHWA 1D8ZA 2YKMA 3DC2A 2IDLA 5KFXA 3GSDA 4CT9A 1UZHA 2DNPA 3K8VA 4FYXB 3BGRA 5KG6A 4WJBA 2N7CA 1W26A 2AJ0A 1Q78A 2OSRA 1WDDA 2Q79A 3PHEA 4TLQA 1WHVA 4WFZA 1QAXA 3SDEA 3W8GA 4CO2A 2ZH8A 2XY7A 2EFGA 4LF7J 2B5JA 3KK2B 2B4PA 1R6VA 3CC7S 4OZLA 4ECQA 3CJKB 2WB4A 1FESA 2AEMA 2GS8A 5HLFB 1KS2A 3BEGB 5EX3A 2WW8A 2EG2A 2EFQA 1C1CA 4ZVSB 3MURP 3KHGA 2IMOA 4P2XA 2V9WA 4B9LA 2XS5A 1NZ8A 2VFSA 3H8YA 2HG4A 1Q5YA 2KKHA 3DRPB 1UMJA 6FD1A 1VC6A 3R8YA 1IBMF 4RO0A 3RR8A 2K3IA 4USJC 4PPZA 1UL3A 3HFKA 2WVBA 5K8MA 1EHWA 4QWCA 1ZAWA 4DQQA 4JV1A 4NXNF 2BX6A 3RG6A 5J2PA 4P2SA 4F2SA 1KLNA 1TL3B 1UA1A 1HW8A 5D8HB 2BYCA 2FD2A 2NPIA 4QPXA 2XG8A 2FVSA 1QE1A 1BHNA 8AT1B 4FKXA 1BXNA 3LANA 1JJ2R 2AMCB 3MEEB 5E3CA 1NDKA 2YKOA 4JV2A 2D3O1 3TUJC 3CJ2A 2KVIA 1VBKA 5LM7E 2EFVA 4DR5J 2YNHA 3NKYA 1CQNA 1W2BR 3QGIA 4OX7A 5HMXA 4B9UA 5DLGA 3K17A 5CHCB 2VHGA 4DR7F 4WU3A 4RW9A 1SH2A 2OEJA 1NHKL 3W66A 2C3PA 3OTOF 3HM9A 3CD5A 5B0FA 1TZ0A 1U1RA 1NK0A 4A8OA 2R8GA 4ZLNA 4JI7F 2LXFA 4NRTA 2I9SA 4W4MA 2FJBB 1UPPA 1VQYA 3ITHB 5AE3A 2W7PA 1H74A 1ZZNA 2O5DA 2I0XA 1HNVB 3CCZA 4QR2A 3J7ZT 3SCIE 4CIOA 3QGGA 2NQPA 3H5YA 5EDWA 4DJBA 3GIIA 2DCLA 3DN9A 1KTVA 4LR8A 3PO4A 2BQRA 1RI7A 4JI2F 3CF5Q 4LT6A 4M8LA 2GCFA 5KT2A 4ANCA 4FYWB 1S9EA 4DL6A 2KFZA 2AJ1A 2I38A 1RT1A 2LQBA 2YNGB 1GTEA 1X5OA 1SC6A 1XN9A 2ZDPA 4USTA 5HATA 3H2UB 3KUGA 3OL8A 2FGCA 3E01A 2J9EA 5KFPA 1KR4A 2VA3A 2A18A 1I3OB 3FSYA 2A6MA 3U7JA 5ETOA 1SH3A 3TA2A 2A1BA 2ZUAA 4H4MB 4AL6A 1R0AB 5D0EA 4Y2MA 3EGWB 2KYXA 3PYGA 4KFBB 3FBCA 1Y10A 3UVJA 5KFBA 3J80Y 3BQ0A 3H90A 4AXJA 5RUBA 4ECYA 1RWVB 4AUKA 4CLYA 1OWXA 3ISNC 2E5IA 2E7WA 4HI2A 3HT3A 2J6TA 1HQUA 4Y2IA 4IDKB 2Q66A 2K1RA 1KKHA 3BDEA 3I4HX 5M2UA 1JLAA 4TXSA 2HHHF 2FQQB 4OV6A 3OXLA 1BMQB 1T95A 3TARA 2VBYA 2Y0BB 1HBUA 1TQLA 2VIHA 4B3OA 4X62J 4KHPJ 3QGPA 3H7HB 3CDWA 3KFWX 5KFRA 2AGQA 5BR8F 1SI9A 4I64A 3QNWB 4NA2A 5D78A 4HEA9 1FXRA 4R8UA 4DLEA 2DK2A 3J81U 4C97A 2RIJA 2ZFHA 2JFKA 1WC5A 4EMDA 4B3SJ 2KTQA 2YVSA 5A2QY 2K06A 4DQIA 3QLHA 1N34F 1UVMA 5C7PA 3BBCA 3DCAA 1UZDA 3KK1B 2ZH4A 2LEBA 2FJXA 3NNCA 3DLGA 1UVKA 2LXUA 3A3OB 1BD6A 1UWBB 1FEHA 1S7HA 3Q8YA 4RW8A 5D0HA 3VZIA 4AYBD 1RWMB 1PJ5A 3A13A 3ZZTA 4FS1A 2EG1A 3FQKA 2R8JA 2Q1LA 3FBBA 2WB1D 2L9NA 2HLTA 1AZSA 3L4BC 2Q43A 4ED7A 4QQBA 4DV1F 1VHFA 2CXEA 2YX4A 4O44B 4P9SA 1RACB 2MJUA 2VG5B 3AJ2A 2J0QD 3N6NA 3I5AA 4RU9A 1F9HA 1DRZA 4X66F 3D0IE 4F04B 3CD0A 3LP0A 4AD6A 4BCAA 1CQMA 2CADA 3M4XA 4BBYA 4D3GA 2K8GA 2XMWA 2R7WA 3CC2S 4WKRA 2NSCA 4NYZA 4USMA 4LFBJ 1NDLA 2CPEA 3M05A 1X9WA 3W2WA 4C2MA 2FDNA 4ALZA 1UVLA 5CCLA 3HSZA 2POKA 3UPFA 4H4MA 5KFEA 3R7NB 3KLEB 3UVJB 4QWBA 1XMBA 4ZCKA 1N33J 5A76A 3KLIB 4NCGB 1YBAA 2H5EA 1JLQA 1T9XA 4DU7A 5GAGI 2KG1A 2RKIB 1T05B 3Q2TC 3OVSA 4XO0A 3MM7B 3H0PA 3MMCA 4NX9A 1HQUB 1VK3A 2FJEB 2J0WA 2WVFA 4JI6F 3GQCA 4C8YA 5AXMA 3CT9A 4PQUB 2MQOA 1FRLA 1EKRA 2V8GA 1JQGA 4OMFG 3LGMA 3ZNUA 2R7RA 3VTIA 3GFZA 4USIA 1IXKA 1E6YA 2XY5A 4ILLA 3AOAA 4IG0B 1FTRA 5HQLA 2C1EB 2FHKA 2PMHA 2UZAA 3GONA 1I5OB 3K5OA 3W9IA 2KM8B 3EVOA 2L3MA 1HW9A 1KTQA 3A8JA 3B6BA 2GZOA 3O5TB 4RL1A 3V2UC 3C15A 4YHHJ 3KLHA 2RQCA 1WOOA 4OYWA 2NUHA 3RB3A 3C3LA 3HHLB 3ICLA 1SB6A 1CULA 2RJZA 1DFDA 2LQ5A 2X1AA 4DR6F 5E41A 1IKVA 3CO0P 4UTGA 3QSYB 1OS5A 2ZD1A 3TI0A 1OSDA 2PI5A 3H98A 3J80U 2VUGA 1DHMA 2JHEA 2W9CB 2PC6A 1WC3A 1HBMB 2LQ9A 1U25A 4Q7AA 4UOFA 4JYAJ 1RT4B 5EWGA 1KFSA 2B5JB 1CPZA 2EK6A 1UJ4A 2HZAA 5CABA 4X65J 2FJVA 1SV5A 3LQVA 1FDNA 3M8RA 1UP1A 1YKWA 1MMDA 2JDJA 3LP0B 3EGNA 2D3OR 1Q8IA 3HHEA 2AGPA 5T7LA 2I2YA 1TVRA 1NH8A 4O0NA 4PCQA 4FVCA 1IBCB 2GC8A 3MEKA 4AE5A 4ATNA 2IDEA 5KFHA 3CTRA 3M8SA 3ISND 1FERA 4DDFA 2HVZA 3L7PA 3KK2A 4ID8A 1CS4B 5A8WB 2K7KA 1FKAF 1AUDA 4LRCA 2N4DA 1WG5A 4USWA 1GXUA 3H4BA 2DNMA 2XI2A 5AXNA 5I4MA 5CD4H 3V6KA 3TZYA 3KK3A 1CS4A 1Q8KA 3N28A 4MIWA 4MJKA 3MWBA 3EXYA 2PSZA 3QT6A 3G6XA 1F2GA 1IBLF 4H4OB 1UPMB 3US5A 2VBWA 4K59A 4OLPA 3R97A 2YWKA 1HQ2A 3M2UA 1IVZA 1RT3A 1YJTA 2IM1A 1VBZA 4LF1A 4RBUA 4JI8J 2HGLA 1YHQS 4F0MA 3VWSA 3ONQA 4KQZA 1S6QA 4PWDA 1IKYA 3R9LA 5CH7B 3HD2A 2A6OA 2YNHB 2EPIA 2FHMA 4OX9F 3JSMB 1PYOB 4C98A 2C3OA 1JJCB 1RHMB 1OY6A 4EBCA 3KTQA 2CNKB 5KG5A 3GJQB 3PW7A 2E9TA 1FRIA 3UWTA 5EWEA 3FUYA 4OJGA 1FFGB 3CD7A 1H6KX 3GCXP 2B8PA 2DNRA 3O1LA 3TQEA 1X7VA 2KZMA 1X4CA 3VF0B 4DR3F 4ZDNA 1MMLA 4YOEA 3M9OB 4LBIA 2CQ3A 4YP3A 2DH8A 4WP9A 4DFPA 5L8RC 1SJ1A 5HI7A 4R25A 1RHJB 4LFAJ 2OPPA 1NJYA 1S5ZA 4M5LA 4Y6IA 3RZAA 3KG1A 2W2NP 3QAUA 3M2VA 2B56A 3R7BB 4LJMA 3M8ZA 3HHLD 1TL7B 4ICLB 4LF5F 3HHDA 3IWXA 4EYIB 3MXHP 1DQ8A 2AHOB 2OJ3A 4RZRA 3ZTOA 3PX6A 4KHRA 1BGXT 1N5SA 4HT5A 2QN6B 4UZCA 2B51A 3ZZRA 5EGYA 3CWJA 1TK0A 2CPJA 3NS5A 4M5IA 2RU9A 4F50A 4AFFA 1G3OA 5E3AA 4F36A 1MWYA 1VYAA 2ZE2B 2DNQA 3D6MB 3LF0A 4KV8A 4RUBA 5DLFA 2CQIA 8RUCA 1UEVA 2B0GA 4OX9J 1NXIA 1PBUA 3PY8A 2XYGB 1K0VA 4CLFA 3CD6S 4LFCF 3C8YA 2UUTA 4OYMA 2VQFF 2UVVA 3EM1A 1S1VA 2AT1B 3FFIB 3W2VB 4KV8B 3TZXA 4N76A 5F8NA 2XMUA 3PHTA 2UP1A 4N56A 3DLBA 1FFWB 1Q86T 2YH1A 3MM6A 4ZLPA 3R1HA 3DM2B 1EP4B 2RB7A 4R0JA 2R3VA 4KHMA 3G71S 2HRTA 2IA6A 2CYYA 4CCHA 1VK8A 2KFYA 1WSRA 3D1OA 1IJFB 4OI6A 4DV4J 2W01A 1HBOA 2ZHAA 1H2UX 4JI3F 1FI4A 2O01C 1JLCA 2GVZB 4FYDA 4X4NA 4JI5J 1RT7A 2MY7A 3MECB 2D1CA 1U48A 1LW2B 3Q23A 3C14A 5IWAF 2MSTA 3QFHA 4UUWA 1QTMA 3OHAA 1V6HA 3G87A 3ZTSA 2QFJA 1YJRA 4O3RA 2MQPA 4NI2A 5IV4A 1R43A 4WWSA 4ZVGA 5A8RA 3MPUB 1HWLA 4P7TA 1FJEB 2MQLA 2XMVA 1FO1A 3C14B 1T3OA 3QZ7A 2R2UA 3SV3A 3AT1B 2RHQB 2B9WA 4IRKA 2L9WA 1XNRJ 5CYMA 2QIFA 2HWIA 3OL7A 1LWEA 2XSJA 2XTJP 2UV8A 2ZH2A 3VAIA 4ECWA 3EPIA 4O44A 3JSBA 1T9TA 5GMEA 4LRFA 5F0WA 3I56S 4DF4A 2HIQA 3PW4A 4NPOA 4XDCA 3CGIA 2HRUA 2KJWA 2W1BA 2RVJA 1I94J 4C3MA 3EGVA 4TU9A 1T05A 4KGKA 1Q53A 4QOTA 4OQJA 4PKDB 1TV6B 5F8JA 2OFGX 2V5HG 1RWKB 2BA9A 3R27A 4URSA 4HLBA 5KFIA 3V6DA 5H9EK 2XMKA 1ITPA 2XZTB 1T9YA 1SQGA 3EGZA 3ILLA 2X3GA 3D68A 1RQ0A 3GE9A 2JEFA 1HNIB 4F02A 1VJQA 4WFNQ 1F9EB 2B4UA 1NJIT 1KVJA 2XO6A 1CBKA 1ROFA 3D66A 1S48A 3EUNA 2LA4A 1BQMB 1NCLA 4EU0A 4I2QA 1KEKA 3CXCR 1FXDA 3K2YA 1CJUB 2CJ9A 1SL2A 4WIQA 3OR2A 2BM0A 1U8WA 4GO7X 4GVBB 1CSJA 4EEYA 1QE1B 3HSJA 3N5FA 4U7UK 2YQ0A 3AHPA 4YDXA 3UDCA 5KG7A 3G8TA 1NBEB 1X31C 2XBPA 1L3KA 4KAIA 1N52B 4FNHA 2E7XA 4DV7F 1RB0A 4J9NA 3PW0A 4QIGA 3ADAC 2GHVC 2DIVA 3KUHA 1N5YA 3QATA 2EC0A 3MM8B 1K9MT 4S0MA 4O3PA 1PCAA 4NEYA 1FRXA 2AEJA 3KHLA 2AP6A 1W25A 3IXQA 2JEIA 2X1GA 1U1PA 2F40A 2VPWB 5ETLA 2MTLA 2HS4A 4A8XA 4NASA 3C19A 2HVEA 1N36F 1QSLA 2F63A 4QIFA 3D7SB 2BJ3A 3CCJS 4KKOB 1TMJA 5KT7A 1YJVA 5HLFA 2VB6A 2NXEA 3SBMA 2GMLA 2I5JB 2R42A 1WOPA 2VC1A 3CIZA 1Q8LA 1C4AA 1P1TA 5D4NA 2BQ3A 1HD0A 4RJVA 2G0CA 3W5XA 4QW9A 1VQ6S 2HHSA 1RAJA 2AD9A 1OIAA 2RILA 2W8LA 2ERRA 1YK9A 4F3QA 4GKKJ 3TOQA 2KT3A 5H9FJ 2I5JA 3ILJA 3N01A 5J2PB 4B3MJ 4KC5A 4QYZJ 1U0HB 1DTTA 3OJSA 5F0UA 2R4FA 3AJ1A 4FBUA 1NSQA 4A48A 2ZBIA 1MU2A 2VBXA 4DV4F 2RH3A 2FLNA 4CH0S 3UI3A 3NGDA 3U27A 4EBDA 2Z30B 1J5OB 1S1TB 5ETKA 3OUYB 4DL5A 3HD1A 5A8KA 2QJ3A 4QYZK 3D28A 1ELOA 4RWXA 4C0OC 2ZM6F 3RB0A 2OD4A 1B70B 2ABYA 2YWGA 3I9V9 3MEDA 4OHYA 2GHWA 3A12A 3NWGA 1X4EA 3BYRA 1LNQA 4PWDB 4UW2A 3TJ8A 2G13A 3UR0A 2XWXA 4Y28C 1O8BA 4ZKAA 1C2PA 2MZSA 4OIXA 3KOAA 4DX7A 2W9BB 3TO8A 2ZC4A 5DZ7A 5JMNA 2LLZA 3ZXWA 4J9MA 1T9WA 1OPZA 3FCVA 3W65A 3RBDA 1X9MA 2V50A 1RXOB 2Q6CA 1NLKL 3CNQP 1RJJA 1TL4A 3QWPA 2U2FA 2DGVA 4NMXA 2IC3B 2Y3YA 1R8HA 4MKBA 4XK8C 4B9NA 2J6UA 5D3GA 4K4UA 1KQSR 1U02A 2XGPA 1U45A 2JRSA 2ASLA 2YTCA 2VQEF 4M94A 2O3DA 2ILYA 3S7RA 2F4FA 2HBRB 2HFNA 3FSXA 3F41A 2KJVA 3MD1A 4B3OB 2JJ4D 5F41A 2DITA 3M30A 3JQKA 4ICLA 4WFYA 2BBEA 1IBLJ 4NLSA 1FJ7A 5DQHA 1DJ0A 4UQTA 5FD1A 4PQAA 4Q8FA 3FNNA 2DGSA 2MQNA 5ADZA 5LXRA 1SC3B 3IG1A 1RHUB 4MKAA 4ZCMA 7FD1A 3CMAS 4CDIA 3DGPB 4TN2A 5KFUA 4C0BA 3NOGA 2HNYA 3HULA 3HVTA 4EI2A 1U6FA 3M2VB 4UQGA 1FRHA 3BQ2A 1KD1T 1J2VA 1N5QA 1YRXA 3IRXB 3KDNA 1LEOA 1U2FA 4ZVUB 3FCWA 5ETSA 4J9LA 3T5HA 1RGVA 3G6ES 4KTQA 1BC6A 4ZP7A 2Z2LA 4MK9A 1QAJA 1WNEA 4C3LA 5LT5A 5THWA 3X3UA 3MR6A 1Q1KA 1YJUA 1NUEA 1DLOA 3AD7C 2GA7A 4FKYA 3DNCA 4FPIA 3M9MB 4YHHF 2MMYA 2KZZA 3LAMA 2BKPA 2YWHA 2W9AA 3KG0A 4M5MA 2SXLA 1XMQF 4IR9A 5CCMA 1YITS 3HKWA 1P1LA 3FRZA 3GZ7A 3WX4A 4A8YA 3P3DA 5JVHQ 2GV1A 3TVZA 3DLEA 4ZJOA 4DCJB 1VQOS 2EFOA 3UNGC 2WW4A 3OL6A 1VQ9S 2V68A 3RU0A 1FF2A 2BJ9A 1URNA 4LF5J 1X5PA 2QL9B 3MMAA 3BQ1A 2IVMA 3M2RA 1TL1A 1VRTA 1KP6A 1Y3KA 3AB4B 4PG7A 2YX1A 2N3OA 5HP1B 1LW2A 1H2TZ 3OXFA 1WF2A 2ZOMA 3BYPA 3HDSA 2X51A 3TR5A 3V4MA 1YJ7A 3CJKA 3RRHA 4KGMA 3T9ZA 2DHXA 4B02A 5GAHI 1HBOB 5BYSA 5L1KA 4O4GA 1JK9B 1PAUB 3MUTP 1SJQA 4PWWA 5A2QU 1TKTA 3DRSB 2WOMB 3LP1A 2ASYA 4ZMMA 4DFKA 2AGOA 4ZPAA 1TUWA 1U24A 5DJBA 4DR6J 4FF1A 3CDAA 2LDIA 3LUYA 2HHVA 2XMMA 1CJVB 4OYIA 3J81j 4C0HA 4DG1B 2GAGC 1IR1A 5D77A 1IR0A 1NO8A 4QBUA 3J7Z5 2DPJA 2J0XA 3DDKA 3CW2C 1X60A 4DQSA 3BO3A 2ZH7A 2DD8S 2M9KA 3MCMA 4TQRA 1LWCB 3CCRS 4U8YA 2LYVA 1KRPA 2B7BB 2XYPB 1K47A 2IY5B 3NS7B 4FXVA 4IH5A 1YJ9S 1RBOB 3UW1A 2RRBA 2V8VA 3W61A 4DR2F 4AQYF 2IMWP 1VQNS 4IH6A 4CO1A 2UXCJ 1C1BA 4JI7J 5IT9Y 4KH1B 2AYMA 4U67Q 2D74B 4YB6A 3AD8C 5E3QA 2NPFA 1REVA 4DL7A 1IKYB 2QRRA 5J1NA 3TZZA 1M1KT 5JXSA 3TP2A 4UOCA 5ETTA 3GFHA 3OXGA 2HMIA 1MSWD 3CO9A 3I0SA 3PKYA 4OYOA 1O5JA 5ITHA 1RTZA 5K8OA 4C8NA 4V19X 1FRMA 3W8PA 5KOXA 3DMJA 3HZGA 1T9UA 1CULB 1Q95G 1KQGB 2A0FB 1Q0NA 2OKQA 2ZITA 4G65A 4NYOA 1BQNA 3G96A 2FB0A 3UE2A 3ZTPA 3G9CA 4X62F 4DV6J 3PKMA 3KLFA 4LFBF 3MMAB 2NSBA 2LU1A 1ZTTA 4NLVA 5KFSA 3P6YC 3JSYA 3KJFB 4Y65A 2D3ZA 3CSKA 2C2ZB 4QCLA 1RADB 3H2VE 4YB7A 2QE5A 4LFAF 2ZH9A 1ZPWX 1AXQA 3HVWA 4KYZA 2GO9A 2KT5A 3UCUP 2IRYA 4Y2KA 4MKYA 3ENVA 3W3SA 4C48A 3OFEA 1XQIA 1TP7A 3SYZA 1B99A 1TELA 1V3SA 4CNZA 5IV3A 2WBRA 3EZUA 4Q45A 3DYAB 1RWXB 1VOMA 2ATCB 1GTHA 5KFJA 2KM8C 4Q43A 4J37A 2OELA 4DV1J 2QYCA 1IQTA 3E51A 4ES1A 4EO6A 1AW0A 4KKOA 3MPWA 4FNIA 4ELVA 4YS2A 2XS7A 2V8PA 1FNMA 3V4IB 3HHLC 1FVSA 4DR3J 3R1LA 2HW3A 2HZVA 2CQCA 2VJUA 3UO0A 5C24A 1CJTB 1EQMA 5AE2A 4QU7A 4DSJA 4F0HA 2YKQA 3TAQA 3QAEA 4UY85 3PACA 4LUBA 3K5MA 1U47A 1K1QA 4KGZB 5B0AA 1VIOA 2MZ1A 2V67A 3V4IA 3OJUA 1N34J 2H5IB 2Z8QA 1RAAB 3HJVA 1MROA 2OPRA 4DV5F 2AV5A 1CJTA 1Q5VA 1SJRA 3BB5A 3CDUA 2CQ2A 2OTLS 3HO1A 4N77A 2BJ7A 2N4CA 2J5AA 2QFIA 3PIPQ 4Z2XA 4J9OA 2VPXB 1A0OB 1GNKA 3PG9A 5KTQA 2E5LJ 3MPYA 4AQYJ 2UXCF 1SUQA 4YUDA 2OPQB 3ZZYA 3KJVA 1LW0A 2LMIA 2VBZA 2JZ5A 1BQNB 3V81A 1BLUA 3GR1A 2PA3A 2NXJA 4PG5A 4EO8A 3GV8B 1NZAA 1V5VA 3OFFA 1FXLA 3NBPA 2R7QA 5IS2A 2GIQA 4HACA 4Y34A 1UVJA 3T19A 1A9NB 2MZJA 4E98A 3H25A 2VG7B 4K7QA 4CWBA 2VL1A 2JC0A 3DRRA 3SEOA 1JLFA 1RSCA 5D4LA 2QA1A 2PI4A 4HDGA 1QM9A 1URRA 3OR1A 5DZ6A 1PJ6A 2HSEB 3W2WB 1NK5A 2ZUGA 4J91A 1HWJA 5CZXA 3DYAA 2HVDA 1FJGF 2V8DA 2XLIA 1RU2A 3MECA 3IWNC 3FVYA 4MFBA 2VASA 4EWTA 5L9XA 3DRYA 4TQSA 4L75A 2CZVC 1MLAA 3M8PA 5F8HA 4NA1A 4I1TA 4DHVA 1IM4A 1JIHA 3MMCB 3MM7A 3IR5B 4OLOA 2O67A 3M30B 1CC8A 4NEZA 4HDHA 2M0GB 2AKWB 3QIPA 2EFNA 2DNZA 4DPWA 2K3KA 3QMQA 4LSNA 1IKWA 2RUGA 3HF5A 1PJ7A 3FBEA 4JI4F 3CCSS 1KOHA 2BMBA 3B54A 2O66A 5HMYA 1RCXB 1RCOB 4YDDB 4ZPTR 1NRKA 1R27B 1ZAVA 1S4FA 4RW8B 5AXKA 3RBZA 1W2IA 2HNZB 1HPZA 2CWXA 4PPDA 3PYFA 4PXDA 3DFEA 4UF4A 3V6DB 2BW7A 3G2XA 3ZC4A 4DN0A 4RUHA 4DV7J 4WFXA 3TJ9A 2WSCC 2BXJA 3TUPA 1Q4RA 2FZKB 2OAUA 4ZN3A 3QT7A 3DKDA 5KT5A 1JLGB 1UW4A 1NMEB 3KHHA 1FDDA 2CDRB 1HR0J 2DR8A 3OHBA 3G4SS 3WC2A 5L46A 4GMKA 1RAOA 3ELHA 5F3ZA 5DQGA 5K14B 4CLSA 1Q7YT 4DN9A 3PEHA 3THTA 2FGOA 5F9LA 5IT0A 2DHGA 3CJTA 3CMES 2DNNA 2IJRA 4DPTA 2Y1LB 4NI2B 1H7WA 1NJWA 5D0GA 1ZZFA 3MHYA 4DR4F 2E9ZA 5DRKA 2R9LA 3M1VB 5ETQA 1R8BA 3W63A 4JUZA 4KPYA 3QSIA 2V0NA 4DV3F 1U0HA 4DG1A 2DH9A 2AX0A 3M6VA 4EZ6A 3C6UA 4PYAA 3IWLA 4QWEA 1EZZB 2D7SA 2QL7B 3VV2B 3GFXA 3DRPA 4DR5F 2A2CA 3BN7A 4DS4A 1TK8A 2CVIA 1HYSB 4NOHA 2ZZNA 4ZP6A 1RTIB 1T7PA 4LF6J 3BKUA 1ZM2A 2CIMA 2CQGA 2MDAA 2F8HA 2BJ1A 2GJ2A 5DDQC 4OZJA 3GIMA 2ZJPQ 5D0RA 2UUBJ 4EZ9A 2XB2D 2PEBA 2HK3A 5JJBA 5ETRA 3VVUA 4NRUA 3THPA 2FHOB 3VGSA 5F3TA 3UDLA 5IQ6A 3IGVA 2DJWA 3WDOA 2EVZA 3OSNA 3OSPA 2VDIA 3BSCA 4LR7A 4F25A 2XM3A 4F3MA 3GJSB 3UDVA 3W62A 5AE1A 1N32J 2P9GA 1WACA 5M2PA 4PXBA 1LWXA 1RT6B 1S9GB 3KLHB 4O0IA 3KMSA 1QUVA 4P52A 3MFHA 5IM0A 4QIVA 2CG4A 4WKYA 4Q0BB 4RW9B 2KG0A 1RLDA 5LSOA 3IR6B 1S59A 2ZWOA 1VS3A 3T1HF 3SMZA 2OFHX 2HBQB 2WZ1A 1NSAA 4JOUA 4K5SA 3FQLA 2RAQA 2DT9A 4P75A 3WIVA 1DAXA 3IS9A 1F3VA 3QRQA 2RD5C 1VC0A 4X4SA 2JFDA 3K5LA 2OPPB 2PN6A 4ZPVR 4YQWA 3KLFB 1HR0F 4L76A 4J9UE 4NZ0A 5MLCV 2C3UA 4H54A 4KPCA 4PG8A 1FE0A 2CQ0A 1UA0A 3H2LA 3UNYA 1XERA 1BQXA 4CLTA 4EGLA 4C11B 9RUBA 5HBMB 4DS5A 1V5IB 3SDEB 3ENWA 1HHQA 1RYSA 3GCWP 2GQCA 3VAHA 4M95A 3NMAA 2NLWA 4CH7A 3BGLA 1R6YA 1YVFA 3DXBA 2QZ8A 3IM8A 1JXLA 1RHQB 5HANA 3DI6B 4DSKA 2HPUA 2CNLB 1C1CB 2LA6A 1FX4A 3UD3P 3JQMA 2CJQA 3Q2SC 3RAMA 3EPGA 3U02A 4LF8F 3AODA 3EXCX 5EWFA 1VHIA 3DU6A 4RX6A 1XNRF 2PT0A 3R2DJ 1HIYA 1HMVB 3V6HA 1R3NA 3PX4A 1FTCA 3UR3C 3UN3A 1RKJA 2HHXA 3U1MA 1RHRB 3KK3B 3ETMA 1PC4A 1WHWA 2AIRB 2AZ1A 2FHJD 3EJMA 2MY8A 1RZMA 2ZZTA 1G4CA 4L3NA 3QJPA 3MEGB 4K8RA 5K20B 2IYGA 2UUBF 2R7TA 6AT1B 1XMOF 4M5NA 3BJYA 2CA9A 1AFJA 1T03B 1D09B 1OYDA 2ROPA 1VQSA 2XWYA 1IR2A 3GB0A 3VGUA 3W60A 3HVRA 2R7SA 3O8WA 4KY3A 3K57A 2VFTA 2OPSA 4RNOA 3IBCB 5D4OA 3PZPA 1VQKS 3CIMA 1XNQJ 2XS2A 2YKPA 3WBZA 2HS0A 2MPUA 3H5UA 1VBYA 2V2KA 2AJ2A 3S6EA 4YY3J 3QLHB 2DR9A 2XI3A 1SXLA 1S12A 1SIZA 2ZHOA 3LWLA 3DGVA 3JYTA 2CPYA 4TU8A 1ZETA 1TKZA 4HVZA 1XMQJ 3OV7A 5D3GB 1OYEA 3ITHA 1DTQB 2BACA 4FZVA 5DG7A 2M8DB 3Q8UA 3RUBL 1WUUA 2RSQA 3G8QA 2W8KA 4CLUA 3OR1B 4DI6A 1YJWS 3JTPA 1UFLA 1Y7PA 2VG5A 1CG2A 1R0CB 3O2IA 4P10A 1TR0A 2IFXA 1SCJB 2KT2A 4P2FA 2WAQD 3OTCA 3Q24A 1PC5A 2LKZA 1NKCA 1S77D 2X3DA 3BO2A 1VGYA 3CJ4A 3B78A 1KSPA 3DXSX 5DG8A 2IYIA 2KO1A 5HK4A 2HNDA 4DFJA 2FVQA 5KFVA 2EW9A 1RDRA 4X4PA 1N32F 3SCJE 1YBUA 2A3JA 5L9NA 3LP1B 3K58A 2BV3A 4RNNA 5KT6A 1RP5A 2PFDA 2IBKA 1T11A 3HKZD 1VLOA 2DCUB 1N48A 2OD6A 3LH2S 2HWHA 1IBKJ 4J7CA 4RU2A 4N47A 4CLWA 2BE2A 1U0SA 2H54B 2IJNA 2ACYA 3NG8A 2LFVA 3Q0AA 3J7A1 1MWZA 2L41A 2VC0A 3PRVA 3N6LA 4V1Ak 4XPCA 1J5EJ 1S6OA 2Z2YB 3BV8A 4EFAC 1FK9B 3TQ1A 2IRXA 4FDFA 2DKOB 3MZIA 2CJYB 2XHCA 1SC1B 2IM0A 3I82A 5HL7Q 1KFDA 4DL3A 2VOOA 3ZZOA 4URQU 2IM2A 5KFFA 4OFZA 3GG1A 3MAHA 3ENQA 2VZ9A 4KGVB 5H1SV 2XC9A 4F4XA 1ZYQA 2HHUA 4A8KA 4B9TA 1Y3JA 4ED3A 4ERDA 4ELTA 1WD6A 1LKZA 3FEYB 3W1YC 3MI7X 3WIUA 1HI0P 2KXHA 1IKVB 1SQEA 3HFZB 3R5GA 1IQZA 4NZ7A 3T9NA 5A6PA 4O4RA 2W25A 3JYTB 4MTPA 3GP9A 3CCLS 4OYXA 1I6JA 5CA5A 1RWPB 4CLPA 1TKZB 2YWEA 4Y2AA 4HTIA 3D3CJ 4NLRA 5AXLA 3VAGA 3OFHA 2NXUA 3R2CJ 3KUEA 3AJDA 4ZA1A 1Z4UA 2R7XA 2HS3A 5KFZA 2HQGA 4PR6A 3NCQA 1D9FA 4OHWA 2J8SA 3PEJA 1RT2B 2F5GA 4E8UA 1VQ5S 2D41A 3W64A 1LWFA 2C2DA 3BGUA 4ZVEA 2ZBQA 3ZNJ1 3VAMA 2HVIA 3RRGA 1JMTA 4FPRA 4ZS6A 1U7LA 1DARA 1F2HA 3GJTB 5KT3A 4WP8A 3K5NA 1LWFB 1WI6A 1IKXB 1M1HA 4C8MA 1GX6A 1VLYA 1PBAA 1VISA 4USVA 5L38A 2ROGA 3NOCA 4WFBQ 2IBOA 4EK2A 5DGAA 4RBVA 1UW9A 2XMJA 3H40A 4PAAA 5F8LA 3MCSA 4GKKF 4C9DA 1S79A 2HLUA 3P96A 1HBUB 5JUMA 2OSQA 4ZPCA 2ZH6A 3MM9A 4QIWD 2FTRA 4QU6A 4I0WA 4WF9Q 2DEJA 4WK3A 2MEWA 1L3TA 2ALZA 2WSFC 1TK5A 1X4BA 4OZ2A 4NL5A 3RW7A 4ED4A 3RTVA 4HACB 2Y0SD 4K5RA 2MB0B 1I51B 1H2VZ 1RKIA 3NL0A 2H4YB 2YKNB 2HFUA 3SFGA 4C4WA 1N88A 3O6QA 2DO0A 1TU0B 1XBWA 5BYRA 1T3NA 4I6AA 2ZJRQ 4OHZA 2LCWA 4NMLA 1S10A 3H42A 4DSIA 4F3OA 2ZM6J 2MGZA 4Q8EA 5I42A 1EETB 1NNDA 2M52A 2V94A 2E1AA 1KLMB 3DHWC 4TY8A 2R7VA 3RBXA 4X64J 3QT8A 3U1NA 3QQCD 2M5YA 3A8KA 3FBFA 1IN0A 1SVDA 3N79A 3WHIA 3TNVA 1Z2LA 2FIUA 2G2ZA 2Y8WA 2AYGA 1SJFA 3F44A 5CD4A 2WBMA 1SC4B 4DPOA 2DPIA 2O1PA 3BGOP 5L1JA 1D1UA 1TL7A 4JI0J 2K1RB 1SPBP 3FMWA 1KOOA 1UEUA 1A6LA 2HQ3A 1GK8A 1R31A 4CLKA 1AT1B 4TYBA 1K1SA 8ATCB 1KHVA 4PUOA 2ZOFA 4W90B 3NCRA 1S1WB 3WC0A 1ZM4A 4ZVQB 1H3DA 2VONA 3ULHA 3JB9k 1HMVA 2G0JA 2NUUG 4R8UB 4DUZF 2Q6BA 1RABB 5BR8J 4LF4J 3GR0A 3UN5A 3H4DA 2JOQA 2YNFB 2HIYA 1LXNA 4YR0A 2B4VA 3B4DA 1FKPA 4KE5A 3DI6A 4JI5F 1LK7A 2G9OA 3GV5B 3TVYA 3OTBA 3LW5C 2HFSA 3I55S 1F6TA 1TAUA 2FC8A 3S1TA 5C25A 4NLWA 2DNGA 1GEHA 4KR0B 4RW6B 4MYUA 3SZ2A 2Z2MA 4WPAA 2DHHA 4ZLLA 1KBRA 4ANEA 1FNOA 3FK4A 1FD2A 5CYQA 2MHEA 2EXUA 3CJ0A 5LMNF 4ZJLA 2MKCA 5GAEI 2G4BA 4UOGA 3Q89A 1V3ZA 1KQKA 1P27B 1VQMS 4USHA 2JVRA 1V9OA 3TWZA 4CTAB 1WKKA 3MOJB 3MMJA 1IUJA 2XLJA 4M5DA 3ZTQA 4DR1F 4JI4J 2XO7A 1S0OA 5AJ3F 2FZCB 1BUXA 2C2RA 5K5MA 3HHKA 4DPYA 2W9CA 4A8QA 4NXMF 5IC4B 1CLFA 1WC1A 2ZBCA 3DOMB 1Y9OA 1C0UA 5GMDA 2QLXA 3SFUA 1H38A 2CPZA 2XY6A 1TKTB 3DRSA 5KFCA 1ZM9A 4RUCA 2C2EA 3CJ8A 1ICEB 2Z57B 3D6HB 2X1FA 1T9VA 1NSPA 3KNGA 4FYYB 3RGIA 1TKXA 3PJ9A 4ZP8A 1N0UA 2MLZA 4J90A 4ECXA 1F5CA 3IM9A 5A8RB 1GMUA 1TUVA 5ETPA 4ENOA 4FF3A 2ZVIA 2FY1A 1UJ6A 2DXEA 1OY8A 1JLBA 1HI8A 2CKWA 3L7UA 1VRUB 2IVFB 3NY0A 1LWCA 5LSLA 1LFPA 4P6QA 1E6YB 4ES2A 5SZTA 2J6SA 4PUOB 5CZVA 2WVDA 2EWHA 3ISZA 3LWMA 2FJWA 2DYAA 2JNJA 1TV6A 4ECTA 2RQMA 3AQOA 2HKEA 2IA0A 3M1VA 5ETMA 1SJ4P 4ELUA 2VFVA 2JC1A 4WZQA 3C15B 4IRCA 1RBAA 2C22A 1M0SA 4B08A 1B0VA 2YWWA 3C66A 4UUXA 4LSNB 4ER8A 2GHPA 1MNEA 2RMLA 4WXWA 4C8KA 3DDNA 4MAKA 2HVHA 3FRYA 1RTIA 5DGBA 1KONA 1GXTA 1BQMA 1JNZB 2KRBA 3D4JA 2QTWA 3AH6A 5HQ8A 2RKIA 1T8EA 3HK2A 4QW8A 1N0VC 1EB0A 2KXFA 3DMJB 5C25B 1Q82T 1XTZA 2CQPA 3C6TA 4Z7YA 2WVCA 3PXGa 5LJ3Y 4RNMA 4G1QA 2QEXS 4DCOB 1X4GA 2E5GA 5DQIA 3D6TB 3W2VA 2ZJQQ 4HR2A 1UKUA 3IAM9 4DL4A 4O3OA 2CQDA 4HT7A 4DV5J 1V3RA 3VR1A 2V4RA 3MM8A 1QTNB 1D3WA 2ZKUA 1GXLA 4MMOA 5HJXA 4CO4A 3Q8PB 3PNIA 2R2SA 4N41A 2AYBA 2BZ2A 1XEZA 5DO2A 2R8HA 3T3FA 3D3BJ 5MAOA 3UCGA 4QPTA 4X4VA 1D9AA 1UFKA 2YY3A 2YH0A 1T02A 4LRBA 4OJ1A 3RRKA 5FLXU 1AA1B 4I6YA 3NAIA 4JI1J 4DOZA 2VKRA 2C2NA 1JNRB 4R5PB 1IM6A 5D6GA 1QJHA 3HSGA 1S0NA 1YDLA 4F4ZA 4L3KA 1S9FA 1YRTA 4HH0A 2M2BA 3LGHA 2OEMA 3T1HJ 3I32A 4M5KA 4OX8A 1K8AT 2QMWA 4J5OA 1KQFB 5G0RA 4ZCLA 3ZZUA 3EDQB 1NDCA 3QFWA 4A8SA 1WELA 3SI8A 1RWNB 2QC3A 1KNZA 2AJFE 1REVB 2D9OA 2MKJA 1U1MA 1XWLA 5EN1A 3OPKA 5KFNA 2HMIB 2B9XA 2KRRA 3BPDA 2NYHA 1U6BA 4DV0F 4F4WA 2AF6A 2E5LF 4G1PA 4ZVOB 5HJYA 5E3RA 4B3RF 1DTTB 4OI3A 1GMWA 4F7VA 4DX8H 2MLYA 4IOCQ 2F3JA 3MM9B 5F8IA 3MUVP 4K4ZA 4ED0A 2GVDA 3OTEA 1G6BA 5B7WA 3IN5A 1APSA 4KT0C 4E2FB 2GNKA 3P45B 2IAJB 4FYVB 4W98A 4YMEA 5C42A 3FFIA 1WTBA 4ILMA 3MTJA 4ECRA 1WORA 2F1FA 1LW0B 3A8EA 2NZ4A 1G2EA 4P2MA 2CJKA 1NB7A 4ZVHA 1K73T 3MGJA 2KHCA 4OI1A 3J7YI 2Z2ZA 4USUA 2RDIA 1XR5A 3N9UC 3NMRA 1GAOA 4KBIA 5E0OA 1U49A 4IFVB 3AOBA 7AT1B 2NYIA 3OTOJ 1OMSA 2ILZA 3AB2B 2H9ZA 1RU1A 2E44A 1JLFB 4IO1A 5F8GA 4YR3A 1N36J 1S6QB 4CO5A 3DLLQ 2IIHA 1RAIB 3CEDA 4XPEA 3K7RA 3EE3A 5D4PA 1RTJB 1Y5LB 5KG2A 4KFBA 4OJHA 4YR2A 2R2RA 3OVAA 5KFYA 4NWBA 3IP0A 4DV0J 3KWMA 5J1PA 4B3TJ 1WJ9A 1UFWA 4G1IA 1XR6A 3G6YA 1M1GA 4F4YA 3AA8A 4WK1A 1L3UA 1F60B 3HLUA 1DZ5A 4O3SA 3EYZA 4QJVA 1O0PA 1NU4A 2HHWA 1WC6A 2F8MA 2XNQA 4C8LA 1F1BB 2AX1A 2BR0A 2OTJS 2V8HA 3OUYA 3V5RA 3EZ5A 1IBKF 1TTHB 4DF8A 3MM5B 1FWKA 4X4OA 1RISA 1YZ6A 2UV8G 4PZVA 4CLLA 3GILA 3QJLA 5HMZA 2HQCA 5C24B 2RS2A 3N5BA 2QA2A 3IBWA 3T1YJ 1FK9A 2OLWA 3B8HA 4TNOA 2BJEA 4CI0B 4EBEA 1R8PA 2CPXA 1YJNS 3CULA 3RW6A 2QLFB 3IR7B 3MOZA 1BY9A 2QMXA 2AQ4A 4DZDA 1Q16B 2UXBF 3TZWA 5HN0A 1FKOB 2Y9HA 2IRUA 1PGZA 3GV7B 4Y3CA 4DR2J 3PR4A 3EVWA 3NBPB 1VQPS 4DFMA 1MG7A 2YNIA 4DWIA 2E66A 3KJQB 4DX5A 3N0VA 3EMTA 3Q8QB 2QLBB 2HQIA 3CPWR 2XLKA 5A8KB 2D69A 3G82A 3QO9B 4C7QA 3BSOA 3PYEA 2FJAB 3HVAA 2PIIA 1QDUB 2CUYA 2F4VJ 4USKA 4OZ0A 1S1XA 1X0PA 4CZCA 1N6QA 1Q79A 4WXOA 3BPSP 2FLOA 2YX7A 4X4QA 2C28A 5B0GA 3BO4A 4LRDA 2W2QP 1LQ9A 1Q7LB 1U8SA 4OZ1A 3H5SA 4LVOP 1VI7A 3F0NA 4MFBB 2Y1JA 4DSLA 1F9FA 1KDNA 4DQPA 1E6VA 3GWCA 3KK1A 1VDHA 3CMQA 1FA0A 1U4BA 4GC7A 2DNKA 2DTJA 2OIHA 1EJ7L 4K4XA 1SKSA 1S97A 4LF7F 4CT8A 1I94F 4ZVFA 1HHTP 4DV2J 2C2MB 1L3VA 3NGUA 1FD8A 1VRUA 3MMBB 1FEEA 2RDDA 4D3HA 4HHUA 1RAFB 2HBZB 2HEKA 1UCNA 1Z1ZA 1TAQA 1IWGA 3KDOA 3Q8VA 4F4AA 4BS2A 2K2PA 3NLCA 2CPHA 1QVGR 4Q5VA 1NHUA 3L9ZA 3DLKB 4OV1A 2JEGA 3GIJA 4B3TF 3MEEA 2DNHA 4CP5A 4HI1A 4I69A 2HQDA 3CCUS 5CYMB 1LXJA 4RNHA 1HNWJ 4IDKA 4NXNJ 3FSIA 1HPZB 4DPXA 3M32A 1QY7A 1C1BB 1FX2A 3D9BA 3QGHA 3IRWP 1RUSA 2FLPA 4AT1B 1YX2A 2Z4PA 2ZBPA 1PAEX 4DPUA 2M3DA 4G6VB 2UVUA 4H4KA 3QZ8A 1P9YA 3HSDA 3TA0A 3CCMS 4XTTA 2MKHA 1KHWA 3Q22A 2QT7A 3K5PA 4JI3J 2AEFA 1U26A 2YWFA 3CDEA 1B0TA 3L95X 2B9YA 5KFQA 1HFEL 3GTYX 1ZBTA 4ECSA 1KLMA 2FUG9 3FGVA 3RAXA 3I0SB 2HHQA 4N8NA 3B4MA 3RJMB 2HGNA 4B17A 3J7YU 4RW4B 4ED8A 3PVXA 5IZHA 2ZC3A 4K4VA 4DX6A 1S9EB 4JI8F 3OR2B 1AROP 4DLGA 1ZA2B 3LGNA 3P49B 1GX5A 2FZGB 1RWUA 3IMQJ 3D5MA 5LL6d 4ID5B 4TKTA 1TL1B 1VRTB 3F73A 3M8QB 2CDQA 4L6V3 3NXZA 5GAGU 5IT9U 4UT4A 1N5YB 1NK4A 2ADCA 1E6VB 4ITSA 2KB2A 2RT3A 4OHXA 1R0AA 4A47A 3S8SA 1KVKA 4ID5A 2BM1A 2ZH3A 4M5HA 1C0TB 2NREA 2BW2A 3E8OA 1SBRA 4I7FA 4RWWA 1WHXA 3P5TL 2JLEA 1HYSA 3VAKA 1HD1A 3R5DA 2WOMA 2IPOB 1WWHA 5GAHU 1S1TA 3POTA 3JQJA 2EC2A 2LP4A 4ES3A 5ETNA 2MQQA 4OYZA 3SSQA 4K50A 4LVNP 1CJVA 2PA8D 7FDRA 2G2YA 4U7UD 1PKUA 2HNYB 2LECA 3SQOP 5CAAA 2BRLA 4ZITA 1BWVA 3M9NB 5CYQB 4LQ3A 2RE1A 1MN7A 5I42B 2D9PA 3EWGA 1MROB 2OPRB 3GU0A 3MAAA 3PRDA 3OTDA 4HL9A 3TAPA 5A8WA 4WU2A 1DY3A 2MXYA 3C46A 3K8WA 4DSFA 4K4YA 3SQGA 3AY0A 1D9DA 1UVIA 2G0IA 2PE8A 5KG3A 2NXCA 3CVKA 1YSJA 2FJDB 4QR0A 3LO3A 3A3PB 4E0DA 2V2QA 3X1LB 4NA3A 4LFCJ 4L73A 5E2QA 5HROB 1AYEA 4YEAA 1JKHA 3T5KA 2IAJA 4TYAA 2KH9A 2CRLA 2OPQA 1HKAA 2YPZA 3DLJA 5L39A 2CNNB 1HBMA 1RT3B 2VG7A 3CCES 2UUCJ 1X4FA 3JS9A 4CNYA 1S72S 4IFYA 1K44A 3IG1B 3OQ2A 3PJWA 1CJKB 2W9BA 2DNYA 3MR5A 1SV5B 5FDLA 3B82A 1SJ3P 3PO5A 1FCAA 3OLAA 2DNLA 2HHPA 3FZBA 4KSEB 2KN4A 1IJEB 1OQ6A 4MK7A 4ZK7M 3IRXA 5K8PA 1X4AA 4X66J 2N7YA 1TFYA 4RBTA 4IUFA 4C3KA 1L5UA 1M5OC 2GJIA 1B3TA 1WHYA 2XZDB 1FE4A 3DOMA 5GADU 1NH7A 3CC4S 3VGVA 5IT4A 3LPEA 2VQFJ 2VQEJ 4NLTA 2MKIA 3T41A 2VJVA 4RR5A 2V4JA 1NK6A 2H5JB 2R2TA 2GO8A 1NK7A 2ZNYA 3G86A 1OO0B 2HFZA 2W7OA 1M5VC 2HZCA 1J27A 3LALA 1J5EF 1VRQC 1VR6A 4OI2A 3CJRA 3W9JA 3NEKA 4ZIWA 4YFUA 5I3UA 3CCTA 2H48B 1H73A 1QUPA 4DUTA 1JLAB 1JXVA 4ZHRB 2QA4G 4HYKA 4ECUA 4O23A 5KFDA 4AL7A 4H4OA 5DG9A 2CQ4A 3G6VA 3JAMY 4IR1A 1S57A 2AJ4A 3CJSA 2FVPA 3I31A 1IKWB 1JLEB 1RAHB 2C2OB 4JB8B 1QAYA 4DU8A 1S76D 1T03A 5IOLA 4EYHB 1CC7A 1VCTA 3FEXB 4LF2A 4ANDA 2WSEC 1UWBA 3QYYA 1BE4A 2OPSB 4DV3J 5B0BA 1SL0A 5K9FA 2DRBA 3J7AN 2ZEJA 3MPVA 4O4GB 5LOQA 2HGMA 3DDIA 4M5DB 3FKBA 3GG0A 2R8KA 2QGFB 2DEIA 4Q2LA 2K7JA 2FVRA 4LR9A 3PW2A 1WKLA 1RTDB 2KU7A 3OFGA 3FCHA 4LBHA 1YLXA 4P7VA 4NE9C 5T7LB 3ZZZA 3Q8RB 2ZH1A 2LVWA 4B9SA 1S1UB 4TLRA 1JX4A 1VJWA 1U2RA 3M2RB 5T41A 2G1DA 2CPDA 4NLXA 1RTDA 1FDAA 3M7VA 4BWMA 3DRRB 1JJHA 1YBTA 2J76E 2LQJA 2RF2A 3HCXA 4HHJA 4KIAA 4O3QA 5KFTA 4Y00A 4J9QA 2QSWA 1FFSB 2BVZA 2CZ9A 2IM3A 2MKYA 3VALA 3ZO7A 3DLHA 3HJFA 1DQAA 2RHSB 2VPYB 3TUIC 2J9CA 3GMGA 4CRJA 4NCGA 3AD9C 3GLJA 1B4SA 1PG5B 1SKRA 3VHQA 3KLEA 2BE9B 3DOLA 2E29A 1WF0A 2BDPA 2XEXA 4URGA 3O3LA 4LQ9A 4Y0FA 1RYRA 2OEKA 2FLLA 3MCOA 1LOUA 2F4VF 2H51B 4ZPBA 5C42B 3TRGA 3VZHA 2G2OA 1YIJS 5DETA 1U1NA 2VG6A 3EZOA 3MCNA 1TKDA 3FDSA 5C2GA 4B3SF 1NK9A 1RLCL 5LSRA 1KWMA 1RAEB 4K4SA 2GIRA 3MF5A 3JTOA 4KRWA 4G3IA 2R7UA 1TL3A 3OLBA 1S9GA 2I6WA 3PFOA 4G1QB 3EX7B 3QRPA 5HQMA 4X64F 3D0HE 5B09A 2OH2A 1YWXA 4WZMA 2LQ8A 4RW4A 4FS2A 2UVRA 2LEAA 2ZD1B 4OL8A 2CG8A 1NEEA 1XMOJ 4WE1A 3KJVB 1EETA 4V19J 1C4CA 1DBDA 2J7UA 2MJNA 4I56A 4TY8B 2DB1A 2L48A 4JI0F 2FY8A 3D67A 1G1XA 4P74A 1N54B 2PD1A 3M6WA 3PM9A 1GMVA 2V2VA 1YZ7A 4CYUA 3M8QA 2RRAA 2CQBA 1S4EA 1YQHA 2F65A 2LU2A 3OW2R 3BKFA 2AYEA 3NP5A 2P6SA 3FZ2A 2JSXA 4GVLA 2BJDA 4FXWA 4OYPA 4GKJJ 4DCPB 3NNAA 4A46A 4RW7B 4DUZJ 1C0TA 2DGQA 1REGX 4C11A 2ZWPA 1B7FA 1LWEB 2XSJB 4BWJA 4J9VA 4LF6F 4RKUC 1VC5A 3NS6A 2QA4S 3UFCX 1S1WA 2DIUA 1UAWA 1MU2B 2YQ3A 5B0DA 1D8YA 4JV5J 2Z58B 2U1AA 5KFKA 1S0MA 3OL9A 2LDYA 1HNXF 4XDDA 2A10A 4CQ1A 2OI2A 4ZLJA 2IJFA 2P9EA 1IKXA 5FLXY 1R89A 2V4QA 5DDPC 2W4DA 4N7TA 3MAQA 2QO3A 2GFFA 1EIYB 3J81Y 2GGPA 1DURA 1SIWB 2L9DA 3PYDA 3GJRB 3JSRA 3QT5A 5U47A 2E1RA 3BR8A 4IG3A 2MSSA 3DM2A 4U95A 2GQ2A 4P72A 5IQQA 4DUYF 4I2QB 1PYTA 4KH0B 3FMBA 4DV6F 1RK8A 1LK5A 1CJUA 4K2XA 4NXMJ 4NCBA 4IG3B 2EEYA 1PIEA 2V69A 3F56A 3NRBA 2HAFA 4X4RA 2ATLA 5J2MB 5IXUA 1O6XA 4PXEA 2C42A 5H9EJ 1CEZA 1X5TA 3CJ5A 4X84A 3TX8A 1G7CB 2B6AB 3I9ZA 2HQFA 3KLGA 5CQGA 2XZWA 3Q86A 2JWNA 5KG1A 1X4HA 1VQ8S 2VICA 3NCPA 3DHXA 4DEZA 4ECVA 4QWDA 2NS1B 4U6PA 5B0EA 5J2MA 3KMQA 2YXLA 2ZVSA 1H72C 2HK2A 5K14A 3CCQS 1I1GA 1X0FA 3EICA 4HH1A 1DTQA 4CYUB 1FWPA 4PWUA 2XCAA 2J7WA 5GMKa 4J9SA 1ZH5A 1JKHB 2ZKTA 4NLUA 4U9RA 3DLGB 4IH7A 3BZQA 4TY9A 5HO4A 5IWAJ 5KFGA 4GO5X 2ZHBA 2QL5B 4LSLA 2UUAJ 3PTWA 4IOBA 3DLKA 1N6QB 3BH6B 1R7IA 3THVA 5F9NA 2DRDA 3TUZC 1WEXA 3N4WA 4ZJQA 4YB1P 5DM7Q 3BF4A 2QX0A 2DHAA 3C6UB 2N82B 4A8FA 1CJKA 2V9KA 1Z2ZA 3M8YA 3R5BA 4WYWA 2KI2A 4OYBA 5KFAA 5G4DA 1OQ3A 1HNIA 3BKTA 1M5HA 3PJXA 2H1YA 5HMWA 4ECZA 3QRRA 1WOSA 3MUMP 2UVWA 1VQ7S 2W2MP 3NGTA 3R5AA 4HTJA 2XQCA 2WONA 2BQUA 4PQUA 5E3PA 5DDRC 2J0SD 1R8AA 3C16B 2JVOA 4MKVA 4F4KA 1YG0A 3PX0A 1Y5IB 1EAYC 5HVFA 1JLGA 5GAEU 2CJAA 3JXOA 4LSZB 3TANA 1A7GE 1SL1A 3KLIA 2EBEA 2VPZB 4A4JA 2J9DA 4C8OA
chains in the Genus database with same CATH topology
1EP4A 2CZ4A 2MZQA 3PW5A 1MW7A 3H5XA 2Q3PA 4OZNA 1XNQF 4ZPWR 4KB7A 2M70A 3Q8SB 5KAKA 1S0VA 5LXYA 4ZPDA 3KYLA 3BDPA 2B6AA 2EI5A 3KLGB 1B64A 2F9DA 1N8RT 4OI4A 1JLCB 1F5BA 2P9CA 4J9RA 4Q2MA 1N5VA 2B4OA 1RT7B 2QLWA 4YB5A 1RT4A 1Y5NB 1RTHA 1Y0HA 3HHLA 4OI0A 3SCLE 5EHHA 1HARA 4PG6A 1WTFA 4L72B 3ETOA 2P5VA 4IOAQ 2WCXA 1TVRB 1RT2A 2PEHA 1ZAXA 2L08A 3D54A 3M6XA 3QIDA 2PDAA 1JXEA 2DRAA 2IHR1 1HI1A 3W7BA 4ED5A 2W7AA 2HYIB 4QYRA 2M8HA 5KFMA 2RNEA 1QLNA 2C3YA 2W4CA 4OHVA 5A0YA 4FVMA 2UUAF 2HWTA 4I2PB 2VODA 3OVBA 3T5JA 1S99A 3SSSA 1JJ4A 1Y00A 1H98A 2PGCA 4NLYA 2DGWA 3LP2A 4WCEQ 3K0JA 1JLQB 4ZP9A 3CE8A 3D1QA 3E3XA 3MEDB 1DLOB 4I7FB 2VOPA 2MYFA 4I2PA 5FJ4A 2B43A 3CB4A 2UU9F 1XK8A 3MR3A 3R5CA 1ZPVA 2WTFA 5KG4A 2KXNB 3I0RB 2Y1IA 1FDBA 3QWUA 3PIOQ 2BANB 1FHTA 3C6TB 2VH7A 4ZOSA 1XR7A 2COLA 2VV5A 2YKAA 4MIBA 3ZFVA 4PG4A 1U1OA 4JYAF 1H7XA 2DGOA 3N6MA 3KG4A 3VAFA 4RLEA 1SKWA 2F8EX 2I8EA 2YKNA 2J8AA 3HX9A 5B0AA 3GYXB 1YI2S 1PILA 2IVYA 3I87A 1U1QA 1M5SA 2E1MC 1Q8BA 5C5JA 5FIIA 2MZTA 4FBTA 3JTNA 5G0RB 4N5SA 4Q0BA 3DU5A 4H4KC 2MKSA 3RYLA 2C3MA 2ADBA 3HXMA 4QZVB 1QSYA 3VQTA 2JLFA 3AAWB 2XCPA 4K4TA 1R8CA 3RAQA 1M5KC 2BABA 4DL0C 3V6JA 2KDOA 1FRKA 3KNAA 1PO6A 5CYJA 2CPFA 2HNDB 5GVQA 4F67A 3K59A 3VAJA 3UCZP 1QAIA 4RW7A 1FRJA 1WG1A 2CVEA 5A0YB 1X9SA 2BOPA 5HBMA 3CCVS 1MMNA 2CQ1A 2RS8A 2R8IA 2HHTA 5IFMA 5J2NB 4DV2F 1ULRA 1J5OA 1YGYA 2WK4A 4F26A 2EKYA 1GT8A 4A8MP 1N4LA 3HPOA 4IYQA 1T94A 4TU7A 2NR0A 2BE2B 3DOKB 4ED1A 4OZ5A 4DMZA 1NHVA 2V4JB 2LEPA 4K0KF 2VD3A 1TL5A 1DQ9A 3HP6A 2ASDA 2BANA 3VCDA 4RW6A 5HP1A 5EUHA 2E5HA 3MDFA 3PR5B 4DBQA 1S1XB 1HQEA 2DBBA 2FC9A 3MEGA 2XULA 4AL5A 1VFJA 1Y4ZB 3SXLA 2MQMA 4JV0A 1S1VB 2CPIA 1JLEA 3MM6B 5M2RA 1JB0C 2MKKA 1HQEB 4BC7A 4KO0B 2W4PA 3BN4A 2ASJA 2F7VA 3IC1A 1K0TA 2P6TA 1HL6A 2GX8A 1U09A 1TKXB 3BR9A 4PRFA 4YY3F 2CFXA 3DOLB 4Z37A 3MFIA 2AU0A 2E9RX 2UXDF 2RU3A 5T14A 3BGFA 3SCKE 2GMJA 3RR7A 4HKQA 4KHPF 1JWWA 1LFWA 2XSFA 4NLDA 4J9KA 2PMZD 3HVTB 2CQHA 4MK8A 1OSCA 1M5PC 1AFIA 5KFLA 3E01B 4ED2A 2WONB 1FVQA 1X8DA 4LF9F 3VQSA 3TW0A 4BHQA 1QVFR 1HBNB 3HI9A 2GMHA 4F8RA 4DL2A 5L1LA 3H59A 1XC9A 2AW0A 2R7OA 4F2RA 3QJJA 3LOUA 3CDBA 1ZM3A 3C2PA 4B9VA 2I1RA 4IG0A 3DOKA 1HA1A 1FKOA 1HBNA 3DLEB 1HNWF 2VA2A 3WZ0A 2YNIB 4QR1A 2FPHX 2DR5A 3TAMA 3BS9A 3BGRB 2RDJA 1ZOTA 1NJZA 3BREA 4MYTA 1X5SA 3U1LA 4FXDA 2VG6B 1VIXA 1NKBA 4CO3A 6FDRA 1VQ4S 4B9MA 2MHNA 3PRBA 1WEYA 1FT8A 3TAMB 2MZRA 5K8NA 5JVGQ 1UJ5A 2HNZA 5GADI 2YKMB 2ZH5A 3KLVA 1KVIA 1UETA 4CTAA 3GIKA 2LXIA 3MMBA 5J2QA 1S1UA 3T6JA 1P6TA 2BRKA 3R3TA 4ETXA 5DM6Q 4IQMA 2ZZMA 4WYLA 5I3PA 4UY8T 2XMTA 3GFYA 4WE1B 3TYTA 2WHOA 3I5CA 5BYQA 4J9PA 3IGNA 3OBIA 5I3QA 4I67A 2ZNZA 2HAIA 2QSFA 3I5BA 2A2DA 1KC8T 4JV5F 1HNZF 4FF4A 4XAKA 2XNRA 2D3UA 3POTB 5E7OB 4I6WA 2GGPB 1S49A 2PFFB 3M8PB 4DSEA 3IO1A 5KG0A 4PXCA 1VMBA 1WF1A 2J9DE 4LIRA 1WI8A 1YRUA 2FVCA 5B08A 1F0XA 3CCWA 2HFOA 1RT6A 2M4MA 2VFUA 1S6PB 1LV5A 3AQPA 4FN5A 2UUWA 1NKEA 2KFNA 4MIAA 3RBEA 1Q81T 2FHJA 2BUNA 2MGZB 1TFWA 4NLQA 3AA9A 3LP2B 1S6PA 3IA0A 1B0PA 4X2BA 5HROA 1U1KA 5A6WA 2F9JA 3HZEA 2UUCF 3SV4A 4AXIA 3BSNA 1SH0A 3A1YG 1HWIA 2KHDA 1RA6A 2DISA 4XIUA 1H0HB 1N5TA 2OP5A 2EK1A 3FEZA 3NAHA 4IRDA 4NCAA 2E9ZA 2OMOA 5D8HB 2JH3A 4CH1A 3L3CA 4JI1F 3M6UA 1HHSA 1HWKA 5EX0A 3IAS9 5FDLB 4RUAA 1WEZA 4NZ6A 5J2QB 2B7CB 2DGTA 3L09A 2DR7A 5F8MA 1GH8A 2ROEA 3RB6A 2DHSA 2GQQA 1RT1B 2YNGA 2E5JA 3IFEA 1RTJA 4X65F 5DDOC 3IS9B 1KN6A 1M90T 3UD4P 2YNFA 3O44A 3K5LA 2RQKA 2DO4A 2J7KA 3QPIA 5E33A 2JX2A 4R0EA 4LF4F 3TVKA 5E5NA 4CO0A 2E1CA 3MD3A 3RB4A 4I68A 4O3NA 3MM5A 3M2UB 3NGKA 4I4BA 5I3UB 5KFOA 4X4UA 3SQGB 3KKFA 1D0EA 1QSSA 3DRXA 4ZHRA 2N3LA 2DGXA 3HMJG 2JL9A 3I96A 4WIIA 1NJXA 3E2EA 2DNOA 3D1HA 1FNXH 5SUHA 3HHNB 4LIWA 3L7OA 4ILRA 2CJBA 4NLOA 3LPYA 5BJRA 4M63A 3DGPA 3G8SA 4M1KA 4B3MF 4RNFA 4LMZA 4LFBF 3ZZPA 1ZTWA 2DGUA 1N56A 1SUQB 3LAKA 2VKZG 4N8OA 4U7CA 5J2NA 3BM7A 2KYZA 3H20A 2QV6A 1C0UB 4V19X 1O51A 1FKPB 2HRYA 3QO9A 1N33F 4ZCIA 3CUNA 1RTHB 1VBXA 3T5LA 1BWEA 3V81B 1X4DA 2ZDOA 2EFPA 5DS7A 4NLPA 4W92B 3PDNA 4Y2CA 5B0CA 2RQ4A 1RA7A 1OPIA 2W24A 1FJCA 1JLBB 3T6BA 4IFYB 3JSMA 1RT5A 4BC9A 2IC3A 4IO9Q 3SSRA 1CVJA 4IFVA 2OMLA 2RF2B 2OO4A 4ED6A 2EBGA 4LSLB 1HWUA 4R5PA 1P9QC 3MTKA 5CXTA 3BSAA 4WFAQ 4DQRA 2ZE2A 4KO0A 2AJQA 4QWAA 4X4TA 1RT5B 1PSDA 5LJ5Y 4K4WA 1GQEA 2RRNA 2JEJA 3GYNA 4OJ3A 3T1AA 3D2WA 3UQSA 3TA1A 2Y1RI 2B3TB 4Q44A 1YTYA 1S6UA 4ETZA 4BDPA 2ZOGA 3T1YF 2M88A 3ZZ0A 2PO4A 2WRMA 4WTYA 2DH7A 2VFRA 2JLGA 3QIPB 3I0RA 2AWZA 3NNHA 5J1EB 4MH8A 4EUVA 3PV8A 4NLGA 4C8ZA 3D0GE 4KJIA 4GC6A 2DVIA 1WG4A 3M32B 1NAQA 2M7SA 3PFEA 4IQXA 2APOA 5IM0B 4FF2A 4FP9A 5J1EA 3KHRA 3MR2A 4OX6A 5L1IA 1UVNA 3CJ3A 5KFWA 5LMUF 4JBCA 1U6ZA