1HA1A

Hnrnp a1 (rbd1,2) from homo sapiens
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
173
structure length
167
Chain Sequence
b'EPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKVDGRVVEPKRAVSREAHLTVKKIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHNCEVRKAL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HNRNP A1
publication title Crystal structure of the two RNA binding domains of human hnRNP A1 at 1.75 A resolution.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Nuclear protein
total genus 51
structure length 167
sequence length 173
ec nomenclature
pdb deposition date 1996-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1ha1A01
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1ha1A02
2CQ2A 3HI9A 2L41A 2OJ3A 1CVJA 4TLQA 4ERDA 2CQ3A 2NLWA 3P5TL 5DDPC 2DNZA 2RNEA 2ZJRQ 1WWHA 1X4BA 2B0GA 2CPHA 2CQHA 2HGMA 2KU7A 2RS8A 2AYEA 2XS5A 3VAJA 3IRWP 2M7SA 1WTBA 2VONA 1VQ5S 4CQ1A 2KXNB 1R8HA 2D9PA 4WFNQ 1X4AA 2J8AA 1IQTA 1VQ6S 3CCUS 1P1TA 4W90B 2MB0B 3THTA 4YOEA 1M5PC 3MUTP 2DGUA 3SDEB 3TYTA 3UWTA 2E5JA 4LMZA 3UCZP 2OSQA 3MXHP 1NO8A 1KC8T 1SXLA 2U1AA 2JWNA 1FNXH 2CQDA 2KYXA 4PRFA 3RW6A 2DNRA 1VQKS 3NS5A 2DHSA 1JJ2R 5GVQA 5CA5A 2G1DA 1VQLS 2KVIA 2CJKA 2K8GA 2RS2A 2N3OA 4YUDA 1YWXA 2KN4A 2DNGA 1WEXA 1U1RA 3CCJS 1WI6A 4C4WA 2G4BA 2N3LA 3OW2R 4ZKAA 1K8AT 3BS9A 5DDOC 2JX2A 2AYBA 2DHAA 2FY1A 3MI7X 1VBXA 3G4SS 2ZJQQ 1X0FA 3ZZYA 2RU3A 3CULA 3VAFA 5H1SV 4QU6A 1Q86T 2OIHA 2X1BA 4F02A 2D9OA 5HL7Q 1F9FA 4CH0S 2DGTA 1PGZA 1YI2S 5LXYA 1X4FA 1VQ7S 4C7QA 2ADBA 3SXLA 4QQBA 3MUMP 2JRSA 3G8SA 2J0QD 1WF2A 5GMKa 2KH9A 1Q7YT 2KXFA 2DO4A 5GAEU 1WG4A 1JJHA 1K9MT 2DGSA 1FJEB 2KFYA 3NNAA 2M70A 2M8DB 1WI8A 4WIIA 1ZZFA 2HVZA 4IOCQ 3PIOQ 1FHTA 1UP1A 2CPFA 2CQ1A 3EGNA 2YH1A 2M88A 1ZH5A 1N8RT 2QEXS 2LEAA 2EK6A 2MQOA 2RVJA 3U1MA 2M9KA 2KRBA 2DH8A 2MY7A 1D9AA 2E5HA 4CIOA 1A7GE 3CTRA 2BZ2A 5LSLA 1WHVA 5IM0B 2MKSA 3TP2A 2F3JA 4LIRA 4YB1P 2DNYA 3CCSS 2MHNA 3J7YU 2ADCA 3EGZA 1H2TZ 2Q79A 1HA1A 3R27A 2HZCA 1H2UX 1FO1A 3NNHA 2VOOA 2E5GA 2RQCA 2DO0A 1VQ4S 4UY8T 1X4HA 2YWKA 2DGOA 1QM9A 2KG0A 3HHNB 2QFJA 1X5OA 2RT3A 1VC0A 1QVGR 3CF5Q 4TU7A 3N9UC 5LSOA 2CQGA 1WHYA 1VQOS 2FHOB 2MPUA 3J7ZT 1SJFA 1G2EA 5LJ3Y 3S6EA 1DHMA 2MJNA 4QPTA 2YKAA 1H2VZ 1A9NB 3UD4P 2HGNA 2O3DA 3UCGA 1B7FA 3S7RA 5BJRA 5GADU 2RQ4A 3LPYA 3CCRS 2GHPA 5CYJA 2HGLA 2F9JA 3NMRA 3FEXB 2M2BA 1YJWS 2JVOA 2M52A 4IOAQ 2MMYA 1UFWA 2LXUA 2MZTA 2N82B 2SXLA 1M90T 2CQBA 1D8ZA 2J0SD 1WG5A 2DK2A 1SJ3P 1KOOA 2FC9A 5ITHA 1N88A 5IQQA 2CQ0A 2KI2A 5EN1A 1OO0B 3BEGB 2MJUA 1O0PA 3CCES 2XNRA 2M8HA 3UE2A 4WCEQ 5JVHQ 2PE8A 1WHXA 1KD1T 2DHGA 1X5TA 1U1MA 4WF9Q 3VAIA 1N52B 1M5KC 4WKRA 2MQQA 3R1HA 2LXIA 2DH9A 2K3KA 3VAHA 1WELA 3RW7A 3I55S 2MQMA 2X1FA 5D78A 5D77A 4PR6A 5GAHU 1JMTA 1U1PA 2LKZA 2VODA 3FEYB 3L3CA 1URNA 2DIVA 3CMES 1RKJA 1VQPS 4CH1A 1L3KA 2MQLA 1VQ8S 4ED5A 3U1LA 2XS2A 2MYFA 2U2FA 2MZRA 1SJQA 2MKKA 1VBZA 2D3OR 2E44A 3MUVP 3ZZZA 4IUFA 2DITA 2CQCA 1YHQS 1NU4A 2DNQA 1SJ4P 3B4DA 3G6ES 1R8PA 2LECA 2YTCA 2MZSA 1KQSR 1U1QA 3CC7S 5CXTA 1HD1A 4M5DB 2DNLA 2DNKA 2CQPA 2X1GA 2PEHA 3CCLS 2KM8B 3BO3A 4BS2A 3CC2S 3Q2SC 1FJ7A 1X4GA 3H2VE 1U1NA 3S8SA 2HYIB 5HO4A 3DXBA 3I56S 3CPWR 2F9DA 1W2BR 1VBYA 3VAMA 3V4MA 4EGLA 1WF1A 3DLLQ 3EX7B 2ERRA 1X5PA 2A3JA 1BY9A 1U6BA 2N7CA 2DGVA 3NS6A 1OWXA 2XSFA 4FXVA 3VAGA 1P27B 1UW4A 2XS7A 2KT5A 4OZ0A 2DISA 5IFMA 1FT8A 1YIJS 1XN9A 2AD9A 3G9CA 1HL6A 1RK8A 2LYVA 1VC5A 2DNOA 1YJ9S 5DM7Q 1S79A 4J5OA 1HD0A 1ZZNA 2MGZA 3CCMS 2X1AA 4Y00A 3BO2A 1DZ5A 2FC8A 4RU2A 2LMIA 2DB1A 2AYMA 2CPEA 2EVZA 4C0OC 2CQIA 3CUNA 2MSSA 2RRAA 1X4CA 1OIAA 2L9WA 2MKJA 2M0GB 3MD3A 2CQ4A 2MKCA 4U67Q 1FJCA 5LJ5Y 2I38A 4WFAQ 4V19X 3CD6S 3MDFA 2DGXA 2MKIA 3JB9k 1DBDA 1PO6A 2MY8A 3US5A 3B4MA 4FXWA 3S01A 2DGWA 3P6YC 5DDQC 1Q81T 2CPXA 2CPYA 3CCVS 1VC6A 3P3DA 2FPHX 2RRBA 3THPA 1QVFR 3K0JA 3MD1A 3VALA 2MSTA 4F26A 2DNHA 3R1LA 1M1KT 1AUDA 2MZJA 3SDEA 2M4MA 4W92B 2KM8C 1KOHA 2LEBA 3LQVA 2DH7A 1U6FA 2MQNA 1M5OC 1U2FA 3VAKA 2DGQA 2RUGA 2VOPA 2ZJPQ 3CCQS 1WEZA 2WBRA 2CPZA 3ULHA 1YJNS 2DIUA 3BO4A 2L08A 3D2WA 3UD3P 4OZ1A 1M5VC 1WF0A 1X5SA 2CPJA 1K73T 5LXRA 3Q2TC 2MZQA 2V94A 1WG1A 3NNCA 2JVRA 3IWNC 2CPDA 1S72S 4WFBQ 1H6KX 2KRRA 2OTJS 2DNNA 4F25A 2XNQA 1VQNS 1X4DA 4UQTA 3SMZA 2NZ4A 5GAGU 3G96A 2MKHA 3MOJB 5FJ4A 1UAWA 3CC4S 3PIPQ 3CXCR 4P6QA 4TU9A 1WEYA 2GO9A 1VQMS 1DRZA 3G71S 2UP1A 1YTYA 4A8XA 1OPIA 1U1KA 1Q82T 3H2UB 2LCWA 2BOPA 2DNPA 4Y0FA 2KXHA 3TO8A 2G0CA 5DDRC 2YH0A 1NJIT 3MURP 2KHCA 3P49B 1WHWA 2OSRA 4LJMA 2DNMA 2E5IA 1N54B 2QA4S 5MLCV 2KG1A 1U1OA 2I2YA 2EK1A 1JJ4A 3UCUP 2MQPA 1FXLA 2CPIA 2DHXA 3CMAS 4TU8A 1U1LA 5DM6Q 2MGZB 3G8TA 1SJRA 5IM0A 3VF0B 4Z2XA 2MXYA 5DETA 2MZ1A 2AYGA 2XB2D 1VQ9S 4PKDB 4IO9Q 2OTLS 1X4EA 4QU7A 5JVGQ 2LA6A 2LA4A 1YITS 2LQ5A 2J76E
chains in the Genus database with same CATH superfamily
1JLQB 4LBIA 2CQ3A 5E3AA 2RNEA 2CQHA 3GU0A 2IMWP 1Q8KA 3QRPA 5C42B 1Y3JA 5KTQA 4ETXA 3E2EA 1SKWA 3CCUS 2C22A 1JXVA 3LPEA 2HNZB 1N0VC 3THTA 3OHAA 2NS1B 1C0UA 1M5PC 1H98A 4P52A 4TY8B 3VGVA 4J9SA 3W9HA 2CNNB 4ZMMA 4KIAA 1CJKA 1RT3A 2QYGA 4ZLLA 4ED8A 2KVIA 2CJKA 3GFZA 4J9VA 2E1PA 4Z37A 5B08A 2DHAA 2RHSB 3HKWA 2ILYA 5K14B 2E7VA 3NY0A 4IDKB 5AE2A 3FBFA 4RR5A 1S9GB 1X4FA 4HLBA 1ZTTA 5LMUJ 2JRSA 1MWZA 4KH1B 1RT1B 4RW4A 3WX8A 2VH7A 1PAEX 1FE4A 3PFEA 3EGNA 5T7LB 1XJWB 2DH8A 3QMQA 2HLTA 1RU1A 3PXGa 2AMCB 4RUCA 5B0EA 1WHVA 3TZYA 3OUYB 1K44A 4LIRA 4X66J 4K4YA 1U45A 4YP3A 1PJ7A 5HROA 5I3PA 3CVKA 3NRBA 2ACYA 1LK5A 4FYXB 3CWJA 2Y3YA 5GAGI 1HPZB 2XGQA 4LF6F 2HWIA 2XLJA 2IYGA 1DHMA 2IBKA 1NKEA 4LVOP 1C1CB 3DGPA 3LP0A 1RTHA 2RU9A 3MM6B 4FYYB 3OJSA 3N6NA 2Z4PA 2MMYA 4XAKA 1UFWA 4ID8A 3NBPB 2MZTA 2SXLA 5ETLA 2CJQA 1HNXF 3GWCA 4J9NA 3MEEB 5EN1A 1OO0B 1J27A 4OX6A 3OBIA 2UV8G 3HZGA 4DPXA 2B6AB 4U9RA 1W26A 3PKMA 4YHHJ 2ATCB 2V8DA 1NKCA 3E3XA 2ZHAA 1DURA 3OSPA 1S0OA 4IR1A 2YPZA 2G0JA 1RWWB 2I0XA 3I9V9 4PR6A 4DI6A 3R5JB 4LR9A 2FZGB 1VMBA 2XS2A 4Y2CA 4DPOA 3TWZA 2WW8A 1VCTA 2HMIB 1N32F 4H4KA 5K20B 2ZITA 1NDKA 2IAJA 5CXTA 1SQGA 1Q4RA 3AAWB 1RJJA 1K0TA 4JI6F 3CC2S 1KHWA 5DQIA 2V9KA 5CYMA 4MIBA 2Q3PA 5HO4A 4ZITA 1VIXA 4D3GA 2QTWA 1D09B 2VIHA 2Y1LB 4JI5J 4PQUA 4K5RA 5F0WA 2CJXB 5IFMA 3D68A 2GHVC 4OJHA 4B3OA 3OVSA 1QAXA 1S79A 1CC8A 4M8LA 1V6HA 2C2ZB 5HQMA 1FRIA 2ZDOA 2BX6A 3BO2A 1DZ5A 2CPEA 2EVZA 4RW6A 5EWEA 4JB8B 4Y2IA 4USVA 2KJVA 3KNAA 2V67A 1TL3B 2RD5C 3CD6S 1NCLA 4RNFA 4RNNA 1UVIA 3L7PA 1S6OA 2XY7A 3AA8A 4BBYA 2M5YA 4EBEA 4G65A 2DNHA 4HH0A 4LF9J 4J9UE 4DXLA 1SKUB 2I6WA 4DOZA 1HR0F 2B9WA 3BYRA 5A8WB 4R0JA 1Y7PA 4QR0A 1YJNS 2DIUA 1P9YA 3WDOA 3FBEA 1U49A 3I32A 3Q2TC 2OKQA 1XK8A 2V8HA 4DX8H 2JNJA 3PTWA 4ICLA 5ETSA 4ZVSB 4M5IA 2MKHA 3CXCR 1U48A 3TI0A 1Q82T 2J6TA 4QR1A 4DUYF 2FLLA 2AZ1A 3Q23A 3CEDA 3HHLA 1NJIT 4GC6A 4J9KA 2KG1A 2EK1A 4X66F 2BVZA 2RQMA 5DG7A 3UCUP 3VCDA 2AJ4A 1SCJB 2YKNB 1NH8A 2RB7A 3GIKA 2AEMA 1X60A 2AQ4A 2E9TA 2BKPA 4IG3A 2VFVA 2VV5A 3GPAA 4DSKA 4TY9A 3PO5A 2BJ1A 2C28A 3KLIB 3NOGA 5EX0A 3SV4A 1HBOB 3KTQA 2ZC4A 4WFNQ 3VQTA 3MAAB 2YNIA 3V6DA 4KFBA 1M1GA 4H54A 4CLSA 2BABA 5EHHA 2U1AA 2DRDA 5L38A 2EKNA 3C14A 4Q8FA 2EBGA 4B9SA 2ASJA 4Q7AA 3TAMA 2YKPA 3CJKA 3G4SS 2VG7A 4OI2A 3ZZYA 4DQPA 3RU0A 3KK2A 2QSFA 1JK9B 2H5IB 1NAQA 5HL7Q 1NZ8A 1T9TA 4YHHF 2ZM6J 4ELVA 3N01A 2ASLA 1FEEA 5GMKa 3UDCA 1HW8A 5IQ6A 2IM0A 5D4PA 1QY7A 4WIIA 1UP1A 2Q6BA 1WKLA 1Y00A 3U1MA 3HKZD 2MY7A 4CIOA 2CJ9A 4X2BA 4LFBJ 1TKTA 3J7YU 3M1VB 4H4MB 2HZCA 1I5OB 1NK7A 2UUCJ 3HXMA 3IGVA 2QFJA 2VFUA 1VC0A 1G6BA 4WP3A 4NCGA 3BPDA 2FHOB 3R8YA 1O51A 2LQBA 4Y34A 2ZD1A 2VG5A 4OLPA 3CCRS 4OV1A 4EYIB 1YJWS 3MM5A 1ACMB 2WOMA 5LOQA 4F4AA 3DGVA 1YKWA 2ZH3A 5B0GA 5KOXA 2V63A 1TL5A 2B9YA 2PGCA 1WHXA 2H51B 1NB7A 3GB0A 4U8VA 2ZNZA 3R1HA 3POTA 3UN5A 2XCPA 3DI6B 3I55S 4JI7J 1KRPA 1FFSB 5GAHU 2WONA 1RTJA 3LGHA 4HDGA 4NXMJ 5GMEA 1C1BB 2ZKUA 4DCPB 2HKEA 5HANA 1VQPS 2Z2YB 1MMDA 2D1CA 4LR8A 2ZBQA 1N56A 2HURA 3CDBA 4USIA 1RAIB 4ED6A 4M63A 3TZZA 2CYYA 2ZNYA 4USWA 3QRRA 4I7FB 1S6UA 1W7WA 2CFXA 3RYLA 4DPUA 2DNLA 2CQPA 2FYXA 4HHHA 1DLOA 2JH3A 3PM9A 1KSPA 1F2GA 4OV6A 3DOKA 2CA9A 1XR7A 5L1LA 2OD4A 5LM7E 1L5UA 2N7CA 5HJYA 2ZUAA 3UR0A 3MR7A 1T7PA 2O66A 4AL7A 2DNOA 1YJ9S 4CO2A 5BR8J 2KL8A 3M2VA 3CB4A 1RHRB 3ILJA 3A8JA 1OIAA 2MKJA 2CQ4A 3KYLA 4KHRA 2YX1A 4Q45A 1LV5A 1DBDA 5A8RA 3MM9B 4ZJLA 1JLGB 1VRUB 3I96A 5DO2A 5HAOA 3BR9A 1QVFR 2A6MA 1EB0A 4L72B 3PDNA 3SSRA 1KTVA 5A2QU 1YG0A 2HVDA 4N8OA 1FE0A 1NDPA 4E98A 2YWFA 1SV5B 5B0DA 2ZM6F 2ZEJA 3M2RB 3PEHA 1YX2A 2B5JA 2H5JB 4CLUA 4F25A 1RWMB 1IBLF 5HLFB 3PNIA 5KG5A 4YN3B 5B0FA 1WEYA 1DRZA 7FD1A 2GV1A 3DU6A 5BYSA 3CCZA 4ILLA 3I87A 2YPYA 4NYZA 3QAUA 3N6MA 2NSCA 3QO9B 4AQYJ 3AXKA 2BJDA 4LFBF 3L7UA 3MHYA 4LSLA 4CLFA 3RGIA 4Z2XA 5KFXA 2UUTA 1KTQA 4PKDB 1VS3A 4O4GA 2UUCF 4LF5F 2HZAA 3G6XA 2XM3A 2MB0B 4URQU 2NLWA 1S1XA 1WOOA 4ZS6A 1WWHA 4I4BA 2KU7A 4PXCA 2BJ7A 2IC3B 1WTBA 1JNRB 1T3OA 3BSNA 4PYAA 2C3OA 2YX4A 3NEKA 2QT7A 3A1YG 3L9ZA 4KY3A 2E5JA 2AJ0A 3AXMA 2R8KA 4B9MA 2DY9A 2H4WB 2RSQA 5I3UA 3C6TB 3NWRA 1C4CA 1ZBTA 3AQOA 1C0TB 2X1BA 1PGZA 2B51A 2HFUA 3AD8C 3FMWA 2R7VA 3OTBA 1Q7YT 5GAEU 3RBEA 1FWKA 2DGSA 4JI7F 1DTTB 1IBMJ 4NXMF 4FZVA 4LF2A 3RB3A 1GXUA 1GEHA 1YRTA 3PYFA 4QCLA 2RVJA 2ZE2A 3LALA 4ILRA 3PO4A 2CWXA 3LGMA 3CTRA 3BBBA 2EG1A 2ZH1A 1HNWJ 1G1XA 5D15A 2P8IA 3NP5A 3M30A 4KO0A 3AY0A 1EETA 2W9BA 2VQEJ 1Y4ZB 3EGZA 1HA1A 1TV6A 2VJUA 3KKFA 2QFIA 3J7Z5 3PG9A 4O44B 1RTDB 2ZBIA 5EWGA 3W5XA 1RXOB 4F4WA 3KHLA 2ZWPA 3DRSA 2WK4A 2R9LA 1FXDA 3QWUA 2F4VF 4A46A 3KG0A 5GMDA 2HHVA 1GX5A 3K5PA 3ISND 3D28A 1KONA 3HZEA 1S76D 5L46A 1WC5A 2BW7A 5I4MA 4X4OA 3TA1A 1REGX 4C0HA 1LWFA 4F67A 4DPYA 3OR2A 4BWJA 2CQ0A 2R4FA 1NDLA 5CAAA 1D9DA 1WNEA 3AT1B 5E3CA 3LH2S 4ZP9A 3SBMA 4UOHA 1VOMA 3VAIA 2HHHJ 1RLDA 4WKRA 4B08A 4RZRA 2K3KA 1XR6A 1LWXA 3FEYB 2OEKA 3L95X 2EEYA 4DR5J 2G0IA 1RCXB 2BBEA 4DR7J 1OJ4A 1R31A 4MIWA 3MUVP 5C24B 5IT0A 1NU4A 1UPPA 2XMMA 3IRXB 1HD1A 4M5DB 3C15A 5F8LA 2GGPB 2XSJA 3CJSA 1JB0C 1S49A 1X31C 4NI2B 2WBMA 4D3HA 3CPWR 2W9CB 2DKOB 3ISNC 2HNDA 3ENQA 3UN3A 1EIYB 1G4CA 2CNKB 4MYTA 2BRLA 2XSFA 3ICLA 1P27B 4KSEB 2LQ8A 4ZLPA 2LYVA 3MMBA 4F2RA 2XMWA 3HP6A 1U0HA 1LW0A 1CJKB 3CJ5A 4FPRA 3QLHA 2DB1A 3J7YI 1Y3KA 3WC0A 1NSAA 2Y9HA 4XDCA 4U67Q 4NLQA 4P2MA 3WHIA 3SQOP 2IYIA 4RW7B 2FHJD 3LAMA 1HQUA 5J2MA 3U27A 3W2VA 2GIFA 4RW4B 3SCJE 1OPZA 2DRAA 2CZ4A 4W4MA 1AUDA 3SDEA 1AW0A 4ANEA 4ZHRA 3K8WA 4LF8F 1NK9A 2JDJA 1U2FA 2HFNA 2VFRA 3ONQA 4LRCA 5D8HB 4FBTA 3ULHA 1LWCB 1JLBB 1K73T 5LXRA 4NLVA 4C8OA 2H3EB 1WG1A 2C3PA 2CPDA 3KJNB 2WSCC 2W2NP 1T05B 4N77A 1UAWA 1E6YB 1IBMF 3HLUA 3H42A 4X62J 4X64J 1YJUA 3KOAA 3UFCX 1ICEB 3MFHA 1X8DA 4FF1A 5DDRC 5GAHI 1MROA 1CC7A 1BGXT 4WU2A 1HNWF 3OL6A 3CO0P 1RAFB 2Q1LA 3LP0B 3M8QB 2GCFA 1VR6A 3G8TA 4PUOB 3VF0B 3FQLA 4C8NA 4DLGA 1NZAA 3ET6B 2VDIA 2QSWA 3KLVA 1YITS 4O4RA 5LT5A 5AJ3J 2CPHA 1KQKA 5FLXU 3MR5A 5DRKA 4LFAJ 2KXNB 1KDNA 2J8AA 1VQ6S 4QBUA 3JXOA 3LP1B 3J7A1 1RBLA 1QSYA 2AF6A 3GJQB 1LW2A 3RAMA 2C42A 3MXHP 3NGUA 1SXLA 4F4KA 4YR3A 4FVCA 2JL9A 1Y5IB 3WIVA 1RUSA 5KFZA 4ZCMA 1JJ2R 1VQLS 4UOFA 2ZKTA 3UDLA 4NPOA 3B78A 4U7UD 2H1YA 1KQGB 5KG1A 2NUUG 3QQCD 2OIHA 3LWLA 3Q22A 4EBCA 2IAJB 2VG6A 3KMSA 5A0YB 1WF2A 5A2QY 4CNZA 1WG4A 5CYMB 3FGVA 2WAQD 3CMQA 3PIOQ 4DR5F 3MZIA 3DHWC 3SSQA 3M6XA 3RBZA 4A47A 1NXIA 2B7BB 1S7HA 2AJ1A 4XIUA 1RTZA 5C5JA 4N5SA 3IMQJ 3W62A 1PC4A 4PXDA 2HQDA 1XTZA 3AHPA 5IT9U 3D67A 2ZBRA 5K5MA 6FDRA 4K2XA 3K89A 1FK9A 4DV5J 1S1TA 1XIQA 1X7VA 2PT0A 3CSKA 2HHUA 2FY8A 1LWEA 1VIOA 1HBMB 4ZPVR 5AXMA 9ATCB 3UDEA 1ZYQA 3J7ZT 2UXCJ 4N47A 1H7WA 3GCXP 2YKAA 4CYUA 2UXBJ 1VLYA 3D5MA 2OMLA 4LRBA 2GHPA 1FKAF 2VD3A 2I1RA 4CO1A 1S1UA 3A8EA 3KK1B 4CZCA 4ZLNA 2POKA 3NAHA 1IQZA 3R7NB 5HN0A 4MKVA 1RWKB 3MMAA 2ZH6A 5ITHA 1S6PB 2ROPA 3IAS9 1KLMA 3HULA 1UVMA 3PHTA 5KFUA 3NGKA 5C2CA 1F9EB 4ZVOB 1P8GA 3R5CA 2A1BA 5F8GA 2M3DA 3TQ1A 2NYHA 1JMTA 1U1PA 3EZ5A 2QC3A 3CMES 3OL7A 1SB6A 1N6QA 4CH1A 4CTAA 3QGPA 4O3SA 1B0VA 2AU0A 1RHJB 4DSEA 4PYDA 3W5YA 4NLPA 1R8PA 2PMHA 3CJQA 4LF1A 1S9FA 3FZ2A 5IWAJ 5D4LA 2OELA 3U1NA 5DJBA 2BANB 2XG8A 2Y8WA 3WIUA 2N4CA 2ZVSA 1QAYA 3JAMU 3D6HB 1U1NA 2F63A 5CYQA 1PC5A 3PFOA 1R0BG 2ERRA 2YNIB 1CULB 4KFBB 2H65B 3TVZA 1IKYB 3HSGA 2UVVA 2QMWA 3W9JA 3OQ2A 3UDVA 2AD9A 3KUHA 4YB6A 1S4FA 3C14B 3JTOA 5CCLA 5K8PA 4F3MA 3OV7A 2EG2A 3B82A 1ZZNA 4Y00A 3IM8A 3ZZPA 5F8NA 1IKWB 4U8YA 1RKIA 2MSSA 3V81A 4FP9A 3DCAA 1IKVB 4CP5A 3ADAC 5L9XA 1YJVA 1GXTA 2MKIA 4R5PB 2W8LA 4OJ1A 3P6YC 2J5AA 4WWSA 2CPYA 1ZM3A 4C3LA 1NB2A 2MSTA 3MPVA 4J9OA 3VHQA 1ZA2B 1RDRA 2DH7A 2BA9A 2HS0A 1GAOA 2DGQA 2VOPA 4OYWA 1R0AB 3BQ0A 4OYIA 1RT5B 3GSIA 1QAIA 2DXEA 3DM2B 1PJ6A 2XNQA 2G2YA 9RUBA 1RT4A 3PIPQ 3VZIA 4ZLJA 1U1KA 3PX0A 3AA9A 5ADZA 4V1Ak 3FUYA 3TO8A 3J81j 1AUSL 3M8PB 2EWHA 3L7OA 2HNYA 1JJ4A 4OZ2A 4DV6J 2ZZMA 2MGZB 2MXYA 1DTQA 5B0CA 1FKPB 3EVWA 3MM5B 3EYZA 3A3PB 4C8MA 4DV5F 1F5AA 3M6UA 4YMEA 4QYZJ 5JVGQ 3QSIA 4E0DA 4GMKA 3R2CJ 3D1HA 2PFDA 3UVJB 3MM8B 3QRQA 3IRWP 2UXCF 2VONA 1CJTB 4WP8A 1F9HA 3QBCA 3VVUA 1HHSA 3HM9A 1TL4A 2UXBF 2IM2A 3IBWA 5HI7A 3GV7B 2E5LJ 2IVMA 4OHXA 1N0UA 2VHGA 1XR5A 2CQDA 2WONB 4ZP6A 3LP2B 1SH3A 2DHSA 4WZMA 2N3OA 1YWXA 2KN4A 5T14A 3QT6A 4DG1A 4ZKAA 3HT0A 2BM1A 1ZA1B 5DGAA 2Z8QA 1DFDA 4F02A 5A8KA 1EARA 2IFXA 3MR3A 5BYQA 3D3BJ 2L9NA 4AT1B 2NREA 2HHPA 3RTVA 5HMWA 3P96A 1S1WA 3MPUB 1ZM9A 4OI3A 2KRBA 1CG2A 1OS5A 1WACA 4K4SA 1H7XA 3T9NA 1F5CA 3MOZA 4Q0BA 4F2SA 1UVKA 2E5GA 1X4HA 4DUZJ 4GO5X 4ZK7M 1T9VA 3Q8UA 3N9UC 5KT2A 5IC6B 1RHMB 3DLKA 1OYEA 3CT9A 3FVYA 1FCAA 4MMOA 1UEVA 4C97A 1RT6B 5J2NA 3S7RA 4NLUA 4YQWA 1HHQA 3CIMA 6FD1A 5FLXY 1KWMA 2JVOA 5KG2A 3IG1B 4IOAQ 1NUEA 1Z4UA 1YZ7A 2K1RA 4Y3CA 5ETVA 1YRUA 1D8ZA 3J80U 3EGVA 2CG8A 2WB1D 1TTHB 3KUGA 3KNGA 2Z56B 2IA6A 4MFBB 2WVFA 4F3QA 4LVNP 1B0TA 4IRCA 3TX0A 4I68A 4LR7A 1AA1B 3EM1A 1R6YA 4MKAA 1CSJA 2MYFA 2XI3A 1HWIA 4QJVA 1VRTB 3AJDA 2YNGA 3ZTOA 2HSEB 3C6UA 1YHQS 4NASA 4P7TA 4KKOA 4ES3A 1RWNB 1YDLA 3IXQA 2X1GA 5T41A 5D3GA 5HP1B 3AODA 1N36J 3D6TB 3NOCA 2EFOA 5D0GA 1LQ9A 4C8LA 1S0VA 5IT9Y 5KT7A 3DYAB 2VZ9A 3T1HF 1XMBA 3DXBA 3I56S 1KHVA 2Y0SD 4GKJJ 1NJZA 1XNRJ 2O5DA 1JLAB 5L8RC 3GFYA 3ZXWA 2HIYA 2XEXA 4DV6F 1YQHA 2ALYB 4WE1A 4J5OA 1IKXA 1HYSB 1KLNA 1UFKA 3OD2A 1R43A 2CDQA 4IG0B 3MD3A 5AT1B 3ENAA 1TK8A 1FI4A 4DR2J 2BE7D 1CJVB 3R6LB 3Q8RB 1Q81T 1S6QB 2GQ2A 3BB5A 2JC0A 4RW8B 3MEGA 3THPA 2ZDPA 4DU7A 3CJ2A 1XBWA 4W92B 5F41A 3SYZA 2BE2A 4QIFA 4KE5A 1YRXA 3BO4A 3M8WA 3BDEA 4B02A 4KBIA 1M5VC 4UQGA 1X5SA 2CPJA 5KFOA 4JI1F 4CM0A 4KO0B 1EETB 4DS5A 2JVRA 1CEZA 2DBBA 4YY3J 2NSBA 2BRKA 3Q8YA 1FTRA 2IIHA 1FWPA 4I56A 2C1EB 1AROP 2V9WA 1SC4B 2K06A 5MLCV 4IFYA 2OPSA 5ETNA 4NL5A 5KFNA 5IM0A 4KH0B 4DLEA 2OPPB 3OR1A 2MZ1A 2W4PA 3OTEA 1S59A 3DKDA 1X4EA 4DUZF 1U7LA 4A48A 4TLQA 4ERDA 2Y0BB 4ECXA 1G3OA 2ZJRQ 1X4BA 4Y6IA 4F8RA 2FZKB 3LOUA 4RX6A 3KJFB 3I5BA 3KDNA 4LSNA 2I9SA 3DXSX 1RGVA 3CJ0A 2EW9A 5E33A 3RB6A 2XWYA 3TYTA 3UCZP 3U7JA 3RW6A 2R2RA 2I5JA 2JFDA 5E7OB 1L3VA 3NS7B 8ATCB 1MWYA 1HBNB 1T11A 1WEXA 2AYBA 2VU5A 5FIIA 3U02A 1F0XA 3TOQA 2RU3A 1JIHA 1H3DA 4JI2J 3G8SA 1RA6A 2XSJB 3CJ3A 1NSPA 4ZPDA 4HR2A 3NNAA 4DR4J 4KGKA 4DFJA 1N4LA 2M88A 2A2CA 3QFHA 3E51A 4OMFG 1TKZB 5F8JA 3I0SA 2GJFA 2ASYA 3R9LA 5CCMA 2E1RA 2E5HA 5E5NA 1H74A 2RAQA 4PZVA 4RUBA 1QD1A 3QIPA 2ADCA 6AT1B 4OHVA 1H2UX 2VOOA 5L1JA 1N36F 1VQ4S 1BMQB 2DGOA 2VPYB 4B9VA 4J91A 4GKJF 1RISA 3V2UC 1HWJA 1VQOS 3AB4B 5EDWA 1N48A 2FVSA 3T19A 1IBCB 1WORA 5G0RA 1R8AA 1ULRA 1UPMB 2CJYB 2XI2A 3O6QA 1BWEA 4P73A 4LF4F 1IBKJ 5GADU 2RQ4A 1CJUB 2PDAA 5CYJA 2G13A 4K4TA 3NMRA 4G1PA 1TUVA 4ITSA 3GMGA 1KQFB 1UEKA 4W98A 5H9EJ 3HFKA 4JV5J 4RUAA 3A13A 4K59A 1QTMA 5KFCA 3CCES 4DR2F 2DRBA 2RF2A 3FFIB 2M8HA 3DDKA 2AEJA 1WDTA 5JVHQ 2RDJA 4WF9Q 2MQ8A 5HMYA 1N52B 4PWUA 3TVYA 4AFFA 4P71A 3IBCB 4OYAA 4A4JA 5D77A 5HMXA 3JSRA 1J2VA 1Y10A 4E2FB 5LMNJ 1NLKL 3Q8VA 3HMJG 1S12A 2ZOFA 3D0HE 4JYAJ 3ENVA 1VQ8S 2J6UA 1KP6A 4O3OA 4IYQA 4ZVGA 3NL0A 3ITHB 3JSMA 2LDIA 3NWGA 1JXEA 1TAQA 1KQSR 1RAGB 1RAHB 1X0PA 2XMVA 3BO3A 3IR5B 3BGRA 3W8GA 3E01B 4P2SA 5BXIA 2NXJA 3KLFB 2HK3A 1H73A 3V6HA 1X5PA 4FYDA 5G4DA 5E3PA 4B3SJ 7AT1B 1VJWA 3T1AA 3PX4A 2OFHX 3MCSA 3H4BA 1EKSA 1DQ9A 1YIJS 4OHYA 1R3NA 5J1EA 4QWBA 4I64A 5DM7Q 2ZVIA 4BC9A 1B3TA 2RKIB 2V34A 1A0OB 3F0NA 3CUNA 2R7TA 2MKCA 2LEPA 2LU2A 4KR0B 2CJAA 4YFUA 1P6TA 2W25A 3MDFA 1Q8LA 3US5A 4DR3J 4Y28C 2B4UA 3IA0A 4RW9A 2RJZA 4HHJA 2W7AA 4ZN1A 3BGUA 4LQ9A 1YLXA 4HKQA 3PW5A 4RUHA 1CS4B 4MKYA 4LRFA 1IXKA 3K8VA 2HFVA 3W7BA 2GA7A 1QLNA 4ETZA 3QZ7A 2FHKA 1S7IA 3CCTA 4QPXA 3KLHA 2PA3A 1LNQA 4WFBQ 3ZFVA 3OL9A 3KDOA 4NLGA 1FK9B 4O3NA 1WC0A 1S1TB 4DR4F 1UWBA 1SUQA 2F5GA 1GMVA 3QIDA 3H2UB 4LSZB 2XULA 1D0EA 2YH0A 4OHWA 4J9PA 3C8YA 4XO0A 3R5GA 3LA0A 4J9MA 1D3WA 4RL1A 3D6MB 5F0UA 3GR1A 1NK8A 1HNVB 3GG0A 4C2MA 4QWEA 4Y65A 1FFGB 3DOLA 2H48B 2R2SA 4ECRA 2YKMB 1O5JA 3RB0A 3LAKA 3M9NB 2GX8A 1MSWD 4KV8B 4BLGA 1S1VA 3NGSA 3HI9A 1RT2B 1J5EF 2GJ2A 3I6PA 2AJQA 1KLMB 4I6YA 2IPOB 1Z2LA 2FVRA 2VC1A 1YGYA 3QATA 4PPDA 3MECA 1TKDA 2ZH5A 4NLRA 3TUPA 2DGUA 5KG4A 3TJ8A 3I4HX 4B3RJ 1EZZB 4TLRA 4PRFA 1VQKS 3M9OB 1HNZF 1N6QB 2PIIA 4JV5F 1VJQA 4TVAB 4CTAB 5DG9A 4A8QA 4DUTA 1V5IB 4J37A 1AYEA 4AUKA 1Y9OA 2N3LA 5DDOC 4AL6A 3O5TB 4TXSA 2AEFA 2COLA 4C7QA 2KXFA 2DO4A 3I5AA 4ZVUB 1LK7A 2QL9B 3BH6B 3P4UB 1JLCB 5LMNF 1REVB 2CPFA 2QV6A 3KLEA 4ED4A 3H59A 2EK6A 1K1SA 4M5JA 5KFEA 1RAAB 3SQGB 4NLDA 2ZBPA 4FF2A 2MKSA 1T03B 1PYSB 4UY85 3THVA 1U2CA 2HHSA 1XMQF 3H20A 4DQQA 3HCXA 3C3LA 3D3CJ 4DV3J 3V81B 3O1LA 4QOTA 4WPAA 2G1HA 4TU7A 2B4PA 4C11A 2HZVA 2MPUA 1KVIA 1S48A 2ZH7A 4QPTA 1H2VZ 2ACMA 2HGNA 3TANA 3TVKA 1S9EB 2AGPA 1TKXB 3GLJA 1MN7A 2GMJA 1B4SA 1SVDA 5LL6d 1KKHA 1NHUA 3R7SB 4DS4A 4NLTA 3RBDA 4MIAA 1WG5A 4KJIA 4KQZA 3MTJA 4H4OB 5CHCB 1KOOA 2FC9A 2CVEA 4CLZA 2YNFB 1NSKL 3PX6A 4DR3F 3OXFA 3BN7A 3BGLA 2ALZA 2J9EA 3M32B 5DG8A 3W8PA 1YJRA 2IJNA 4X4TA 3MEDB 2DH9A 1WC4A 2RMLA 3I31A 3O3LA 1WELA 2QIFA 2VBWA 3OFEA 4AD6A 3L3CA 1HQEB 2MQLA 1JLFB 2XTJP 4DR1F 4K5SA 1E6VB 1VBZA 4OX9F 4DV2J 2D3OR 3D0IE 3DLGA 1HBUB 3HFZB 2QMXA 2JFKA 4Y2AA 3DRRB 1S0MA 3KLGB 2OH2A 3ILOA 4O0NA 2DNKA 5L9NA 3DLEA 3EVMA 4I6WA 4NEZA 2PEHA 3HVTA 1FJ7A 2OHDA 5L1KA 3AOCA 1X4GA 3H2VE 2P2CB 1IN0A 1JNZB 1T9YA 3H25A 2PMZD 1WF1A 5E3RA 3ZTQA 4ATNA 3DLLQ 3RJMB 4ED3A 2A3JA 4R8UB 1Q78A 3JYTB 1UW4A 2BV3A 3BV8A 2R7SA 1FFWB 1FT8A 3GZ7A 1JLEB 1HL6A 4M5MA 5F3ZA 2HAFA 1HI8A 2AW0A 3OT9A 3TR5A 3EZUA 3W66A 2RRAA 3FBBA 2XHWA 4DG1B 1KVKA 1AZSA 1X9MA 3DOMB 3DNCA 4N56A 2R3VA 1N5YA 3K58A 4DSFA 2HBRB 2R7WA 5KG6A 4QW8A 2KO1A 3MMCB 1B0PA 5C42A 5DDQC 2DR6A 2GC8A 4B3RF 2MDAA 1S5ZA 3K0JA 2YWHA 5GADI 5HQLA 2LEBA 4TY8A 3DMJB 3LQVA 1U6FA 3RRGA 3KFWX 4GKKJ 3QGIA 5KG0A 1Z1ZA 4DR6J 2D3O1 3BGOP 2BJ9A 3FKBA 1Q79A 4K4ZA 1SJ1A 1D1UA 4WYLA 4IDKA 4ILMA 1N33J 2RRNA 2MKYA 1S9GA 1SBRA 1K0VA 3R6GB 2DPIA 4X4PA 2C2EA 2DR8A 1RT1A 1WD6A 1YTYA 1BQMA 1HWUA 1UJ6A 2VB6A 3MAHA 2KXHA 5T7LA 1N34J 1VFJA 3NCQA 1VK8A 1U1OA 5D0EA 2DCUB 4ZIVA 2B9EA 4P72A 2FGCA 4TU8A 3KK3B 2XB2D 1X9WA 3V6JA 1PKUA 2ZC3A 1NEEA 4I1TA 1FVSA 2CQ2A 3N28A 2UU9F 3P5TL 3AFGA 2AX1A 2RS8A 4MK9A 2ZWOA 2VICA 1HPZA 2GVDB 1HMVB 1P1TA 1GMWD 1UETA 4K8RA 4YOEA 4NZ6A 1BLUA 2J0WA 4P2XA 1C1CA 4X4NA 4L74A 3MM6A 3IWLA 1TR0A 1AXQA 2DJWA 3K5OA 2W8KA 3NBPA 1N5VA 2R2UA 1R8CA 2FGOA 1X0FA 3MEEA 2D9OA 4CH0S 4N76A 3M8ZA 5LXYA 3SXLA 2YY3A 2AP6A 3FZBA 2KH9A 1R27B 2W2PP 2B6AA 1FEHA 4ECUA 3BKUA 1JJHA 1FJEB 2KFYA 3NLCA 1UA0A 4UZCA 3ZO7A 3AB2B 2QL7B 3R5DA 1U8SA 1SL1A 4DV2F 1Q5VA 1SC3B 2FJXA 3MF5A 3Q0AA 2BJEA 4LFCJ 3CCSS 2VPXB 1VQYA 4IH6A 2LVWA 2AGOA 2DR9A 1FO1A 3K5MA 1NK0A 2HMIA 2QYCA 2OPRB 4UY8T 2F40A 3PYEA 4NZ0A 2NYIA 1SJFA 1APSA 3HSZA 2O3DA 4A8YA 3P8BB 5BJRA 3MEGB 4I0WA 2YKOA 1PIEA 3JQMA 1J5OB 2LXUA 5B0BA 3UD5A 4JI3J 4DJBA 1VYAA 3EGWB 3OFGA 2OUGA 3O2IA 1Y5LB 4IFVB 2F65A 3KWMA 5DS7A 2RIJA 4WTYA 2W01A 3TUZC 4X84A 5HBMB 2PE8A 1U47A 1TL3A 3WC2A 2NPFA 3Q24A 3BKTA 3OXGA 3C2PA 2OMOA 1FKOB 8AT1B 2GIQA 3CJ4A 3VAHA 3PJWA 4DL2A 2HG4A 3AH6A 5H9FJ 4ZCIA 1URNA 1QAJA 4GKKF 4G1QB 3K7RA 1BWVA 4DR6F 4DPTA 5E2QA 1PILA 2FDNA 4Z7CA 4IFYB 3QGHA 1T8EA 5A8WA 5LMUF 2MZSA 1LOUA 4DN9A 2BQ3A 4OI6A 5AXLA 1N33F 1EP4B 2EFNA 3EVOA 3UQSA 2DTJA 1JKHB 4MK7A 3LW5C 2UUAJ 2V50A 4KGVB 2F9DA 2XMKA 2F4FA 3VAMA 1N34F 1KVJA 3FC9A 2B9XA 4DL4A 2XS7A 2KDOA 3PW2A 1AT1B 1TVRA 4L75A 1GH8A 5FDLB 3M8SA 5HVFA 1RK8A 2MTLA 1VC5A 2XCAA 1P9QC 1ZPVA 2YKNA 2R7QA 3W9IA 2AYMA 2EFGA 1X4CA 1NKBA 4FYVB 2OLWA 2HQIA 4GC7A 3G86A 1NK4A 3B4MA 3KLIA 3MAAA 4P75A 1VI7A 2CPXA 1VC6A 3P3DA 2E9ZA 4NMXA 1TMJA 4PXEA 1S77D 2EFVA 3WBZA 4CLWA 2PEBA 4B3TJ 3VAKA 3W1YC 4I2QA 4I67A 3NGDA 2PMWA 2QLFB 5ETKA 4OZ1A 1TL7B 3C16A 1FESA 3DDIA 3IO1A 1NJYA 4JBCA 1ZM4A 3BM7A 2UXDJ 4UQTA 3G82A 4A8WA 3G8QA 3PACA 3RR7A 2YX7A 1T9UA 3NGRA 1RCOB 3PEJA 4YB7A 2JC1A 3MWBA 4UT4A 1I94J 2XMTA 4LJMA 4NCBA 3F56A 2P9GA 4LFCF 2R7UA 4WBFA 3RAXA 3PJ9A 4YS2A 1DQ8A 1SC1B 2OTLS 3M1VA 4H4MA 4KHPJ 1XEZA 3GYGA 2L41A 1CVJA 3SFUA 3EZOA 1GXLA 3BSCA 4JI5F 4KGXB 2M7SA 1VQ5S 3PZPA 2VQFJ 4H4KC 1Q95G 2DY1A 5DQGA 4EYHB 2AGQA 1FD2A 2CNOB 2D3ZA 1RT7B 5KFFA 4MH8A 1WTFA 4IR9A 5KFVA 4AL5A 3O44A 3DFEA 3BS9A 4OJ3A 3CE8A 2HFZA 4ZVPB 1VBXA 1ZAWA 3HHLD 4QU6A 4QYZK 4CLYA 4HI2A 3KUEA 1F9FA 4LF9F 5AXNA 4JI0J 3DRPB 1NNDA 1ZZFA 4MAKA 2RHQB 4GVBB 3DI6A 2W7OA 1FJGJ 2LEAA 4DU8A 2MQOA 4LQ3A 2HQFA 4FKXA 2OEMA 1UWAA 1NSQA 2KB2A 1NRKA 5EUHA 5K9FA 2V68A 1KFDA 4JI8J 2FZCB 3NNHA 2E1AA 4I7FA 2UUAF 1QVGR 4I2PB 4N8NA 4M5KA 4Q8EA 2FJWA 1WHYA 3EE3A 3QGGA 5KOWA 3KMQA 1V9OA 4K4WA 2ZOMA 1DARA 5HATA 4J9RA 3W2WB 3EPGA 3T41A 1FX4A 4OI1A 2AJFE 1GTHA 2F9JA 3FEXB 1SL0A 4CLPA 5F9LA 1UJ4A 3HHLC 2GNKA 5JXSA 3FBCA 2D3UA 1N88A 1TUGB 1O0PA 2CG4A 3I0RB 3QAEA 1KD1T 2UVUA 3NCPA 4ED2A 5KFMA 4OLOA 3M8RA 1X5TA 2L3MA 2LXIA 3TUJC 2GW8A 1GK8A 1JJCB 2DXDA 4FNHA 3MM9A 4WFXA 4NMLA 1JLGA 1VRUA 2MQMA 3GJTB 5HSPA 2DCLA 2LKZA 4B3TF 4KRWA 1VHIA 2XC9A 4ENOA 3LO3A 1TUWA 4U96A 3D1OA 2U2FA 1FWLA 3CDEA 2MKKA 3JTNA 3H90A 5DQHA 5MAOA 3EDQB 2BE9B 2A18A 2ZUGA 2UXDF 1OY6A 3D4JA 2W2OP 2LQJA 4WFZA 1SV5A 5ETPA 2W24A 3H4DA 3M2RA 1S1VB 5KAKA 3TQEA 4C98A 5HLFA 4B3MJ 4L3NA 1T94A 5J2PB 2F8MA 1OMSA 1I94F 4QZVB 3M7VA 3NXZA 1CLFA 2GQCA 4L76A 4MYUA 3EPIA 2KKHA 4ELUA 4P7VA 5E3QA 1IVZA 2DISA 1OY8A 2YWWA 4BDPA 2QL5B 2RDDA 3TA2A 2A10A 4KHPF 4C0OC 1L3SA 1RSCA 1TL1B 4M5GA 2M0GB 1D9FA 2WVDA 4E8UA 4B9LA 1QUVA 2VQFF 1VLOA 2MY8A 5KFSA 2IC3A 2XO6A 2OAUA 1HI1A 2BUNA 3DRXA 1FVQA 3ETOA 4DQSA 2Z30B 3H40A 1TMMA 5IT4A 5D4NA 4A8OA 2R2TA 3VGTA 3CDUA 4EI2A 1WEZA 1RBOB 1NDCA 4ZOSA 1UW9A 4Z7YA 4USUA 1GX6A 1WSVA 1N5SA 4Y2MA 1C0TA 2OTJS 3IWXA 3KJVB 1HNIB 1ELOA 2GAHC 3G96A 4JI0F 5C25B 4RBTA 1DJ0A 4OYPA 1W25A 2MEWA 3MMJA 2OPQA 3G71S 1URRA 1DTTA 3TJAA 2BOPA 1NBEB 1M1HA 2OSRA 4LF6J 2IHR1 3DHXA 4LRAA 2IBOA 3Q89A 3K59A 4KC5A 1TK5A 1Q5YA 5KFIA 1VQ9S 1B64A 2GHWA 4K50A 3DN9A 2LA6A 4CCHA 2GQQA 2J76E 3CCWA 2JLEA 2DD8S 2EFQA 2B0GA 4O44A 3A8IA 2ZHBA 1ZAXA 3M8YA 1RTDA 3H98A 1UVJA 1X4AA 4J9LA 2Q43A 2PSZA 3ELHA 4DZ6A 3FSYA 3VZHA 3F73A 5BR8F 4JI4J 2OSQA 2YQ3A 3TJ9A 1RI7A 3BDPA 5CA5A 2YNHB 2R8JA 3T5JA 4YUDA 3AJ1A 1U1RA 2AT1B 3OW2R 3DLGB 2FY1A 3MAQA 3CULA 1ZETA 3H5YA 1YI2S 4NLSA 3MUMP 1K1QA 3C46A 2HK2A 3HSDA 3Q8PB 3X1LB 2M70A 1WI8A 5CQGA 4F3OA 2CQ1A 2YH1A 1ZH5A 4A8FA 4CI0B 4EO8A 1N5QA 1SQEA 3CIZA 4YDXA 3TP2A 3MCOA 5B7WA 2X51A 4OZ3A 1HKAA 2Q79A 2IJRA 2AHOB 5C24A 3IS9B 2FB0A 2PI5A 2WHOA 1EX8A 1PSDA 4J9QA 4QWCA 3IRXA 1QM9A 4M5DA 1SQFA 3HHNB 3HPOA 4Q43A 2GGPA 2RT3A 1WC6A 3CF5Q 2NXEA 5LSOA 4AQYF 2DHHA 1C0UB 3I9ZA 3S6EA 4NI2A 2B8QA 1Q8IA 3CD5A 2W9CA 1F3VA 1O6XA 2LDYA 4NRTA 2XYGB 3Q8QB 3RRKA 1RT3B 2M2BA 1U4BA 1WSRA 5U47A 4F36A 2FVPA 4L6V3 4AE5A 3FSXA 4CM2A 1SIZA 1EAYC 4ZJOA 3BEGB 1HR0J 2ROGA 1QUPA 1LXJA 3UE2A 4A8KA 1M5SA 4PABA 3BQ1A 1ROFA 1PG5B 2BR0A 4RW7A 4X4RA 5HQ8A 2FD2A 3RW7A 3FEZA 1BQMB 2CADA 2DIVA 2J0XA 4L73A 3ZNJ1 1SJQA 1N5TA 4KGZB 4EBDA 4DUYJ 1RZMA 2MLZA 2DITA 1SJ4P 5HROB 1LWCA 5H9EK 1JLBA 2LECA 2HVIA 1T02A 2KZMA 3P45B 1S99A 1T05A 1E6YA 4TYAA 3DGPB 2W9AA 2KFNA 2HBYB 1RTHB 2VQEF 3QWPA 1FRJA 4FPIA 3D7SB 1IJEB 5M2RA 3M8QA 3G6VA 4HVZA 4DX7A 1SI9A 3EICA 2LU1A 2KFZA 4WU3A 4OZ5A 1BE4A 2AKWB 2NCKL 4PUOA 5KFDA 3J81Y 3SSSA 3ET6A 2L9WA 1GMUA 3TA0A 3BH7B 4NLYA 4DL6A 3M6WA 4MK8A 2DR5A 3FMBA 3HT3A 2AV5A 3BF4A 1FNOA 3G87A 4JI4F 1MNEA 1T9XA 5KFTA 5HVGA 3T5KA 3CCVS 1CQMA 1FF2A 2DYAA 3LP1A 4NA1A 2KM8C 1KOHA 3TEGA 4B9NA 4QYRA 2BKOA 4DQIA 2ZJPQ 3UPFA 1Q53A 1YJTA 2FVQA 2L08A 3JQJA 2C3YA 1IR1A 2F1FA 2HHHF 2BDPA 3RB4A 2V2VA 3W63A 3K2YA 4PWDA 4USJC 1KEKA 3UI3A 3OFFA 4OYOA 3CC4S 2HS4A 4DSLA 5A0YA 4DR7F 1RAOA 1F60B 1QE1A 3QT7A 4G1IA 2IJFA 4PQUB 3L09A 1UTAA 1PBAA 4NXNJ 4LF7J 2KHCA 4QWAA 5J2QA 4B3OB 1LKZA 2W4DA 4NX9A 3GJSB 3CD7A 5KFPA 4J7CA 5THWA 4UTGA 2XLKA 1LEOA 2QO3A 4RW6B 5F8IA 4C48A 1UFLA 2DEIA 3SEOA 2IRYA 2F8EX 2D69A 4OX8A 4JV1A 4KGMA 3BBFA 1IQTA 3SCLE 2R8IA 1HBMA 2VBYA 4W90B 4TYBA 4ZVTB 2ZH8A 4DF8A 2DR7A 4LMZA 5L39A 2X7IA 1FNXH 2KYXA 3VWSA 2DNRA 2JEIA 2FIUA 2ROEA 2PA8D 5GVQA 2G1DA 3F44A 2NPIA 3UNGC 2YVSA 3KK1A 2DNGA 1RAJA 2V8VA 2E29A 3MI7X 3OSNA 3FCWA 3IR7B 2LLZA 1R89A 4DL3A 4ICLB 1S6PA 1Q86T 5I3QA 4ED0A 4WXWA 4AXJA 3WZ0A 2VKZG 2YKQA 3ILIA 3HHLB 1NJXA 3D66A 2CKWA 3ILLA 1Q8BA 1IM4A 3HO1A 1QSSA 2FLPA 2G2OA 1D9AA 4ES1A 4OX7A 3MFIA 5KFBA 4YR0A 3LUYA 1TVRB 2XZTB 3FK4A 2QA1A 2MHNA 4X62F 4X64F 4UW2A 4N7TA 4IG3B 4NA3A 5IC4B 3PVXA 3EMTA 2D74B 5GAEI 2YWKA 1MN9A 2KG0A 3RZAA 2XGPA 3NKYA 2BANA 4IKAA 3V6DB 1G2EA 3GP9A 3VGUA 1RHQB 5M2UA 2APOA 4JV2A 4ZP7A 1IWGA 1CULA 2V69A 1XQIA 1IKYA 1JWWA 2E1CA 4ED1A 1B70B 1RABB 5ETOA 2CNLB 2K7KA 5AJ3F 4OYMA 2CQBA 3TAMB 4I2QB 1UVLA 4LFAF 2DK2A 2YQ1A 3CJKB 3ZNUA 5B09A 1Q0NA 2VG7B 4WYWA 2CRLA 3KK2B 1IKWA 3C16B 4DL7A 2CWKA 1IKVA 4RBVA 4BCAA 4A8SA 3PR4A 2DHGA 3PY8A 3NCRA 4X4VA 2IM1A 2K3IA 3G82B 1M5KC 1SH2A 3RUBL 4DV1J 4DMZA 4R5PA 1FRKA 2GAGC 1K47A 2YXLA 4OZJA 4DQRA 5CH7B 3MPDA 1IBLJ 2VODA 4KPCA 4OI0A 1IR0A 2EC2A 2P6TA 1TKTB 4HHUA 2ZZTA 2CQCA 2EFPA 1FTCA 3A12A 2DNQA 2E7WA 1R0AA 4USKA 2HBZB 3R97A 2DEJA 2HS3A 1RT5A 3DDNA 2XZWA 3CCLS 1PYOB 3F41A 3DM2A 2KHDA 2BQRA 4NCGB 2XY6A 3M9MB 2EBEA 2Z2ZA 1RADB 2HYIB 5F8MA 4LF5J 4NXNF 4LF7F 2ZD1B 2VG5B 2W2MP 3EXYA 1NPKA 3MCMA 1L3TA 1V3SA 1OWXA 3NS6A 3AOAA 5KT6A 2O01C 1UA1A 4C8YA 3M8PA 1PAUB 2WOMB 2YBVA 2AX0A 1TP7A 1WC1A 5IZHA 4ZPAA 3QYYA 4USTA 2MGZA 3KHGA 4ANDA 2X1AA 1NPRA 4M5HA 4O3QA 1FKPA 5EWFA 3KG1A 4WXOA 4G6VB 4XPEA 3UVJA 2ZH2A 3POTB 3MM8A 3FDSA 1CBKA 1RWOB 4LBPA 3S01A 1CJTA 2DGWA 4CT9A 3GG1A 2PO4A 3SCKE 3TRGA 1RTJB 1U0SA 4GO7X 4RO0A 4K7QA 4F0HA 3VALA 3HF5A 2NQPA 4NCAA 1WOPA 5IS2A 3LP2A 3CCQS 4WK3A 3RR8A 2WBRA 2C2KB 2WTFA 4ZN3A 4AYBD 2OEJA 3BR8A 4Q5VA 5E41A 2QLXA 1KN6A 1DLOB 2KRRA 2WB4A 3PHEA 4ZVHA 2BXJA 2Y1RI 4IRDA 3DOKB 4P2FA 1UVNA 3SZ2A 2LCWA 3CGIA 2VL1A 1SKSA 2B3TB 4IQXA 3CJTA 4RNHA 4PG7A 3T6JA 4C8ZA 1I6JA 1RB0A 5HJXA 4EO6A 5IWAF 2Y1JA 1FXLA 3CMAS 2F4VJ 2AIRB 3M2VB 3T9ZA 3BZQA 1QTNB 4F0MA 2AWZA 1RHKB 2CJBA 2E7XA 3PJXA 4QU7A 1KS2A 5JMNA 2Z2LA 3L4BC 1FD8A 4I6AA 5A8RB 1WDDA 3VAJA 4RBUA 3HVAA 4ELTA 4RLEA 1F3FA 4N41A 3MM7A 4ALZA 1IWAA 2HQCA 1SIWB 1RYSA 3RBXA 5K8OA 1LFPA 1RT6A 2XYHB 2V8GA 5A6WA 3NS5A 4DV7J 3ETMA 3DU5A 1OYDA 3Q8SB 3IG1A 3N6LA 2DPJA 3CCJS 1WI6A 2QLBB 2N7YA 2B5JB 2OO4A 3GCWP 2NXCA 4KHMA 3CD0A 3BPSP 2ZBCA 1VQ7S 4DV1F 4QQBA 3E8OA 4MFBA 4PWWA 4ZPTR 2AZ3A 2VF3A 5HVHA 2XWXA 1FDNA 2KVQE 1EQMA 2HVZA 5SZTA 3SI8A 2QEXS 3M05A 3LF0A 3HFVA 1JXLA 4ZCKA 4LSLB 2HHTA 2HWHA 4B9TA 1L3UA 4ZA1A 1Y5NB 2IVYA 4F50A 1FNMA 1VRTA 3KXDA 3BQ2A 4O4GB 2MLXA 4V19J 2J6SA 1GT8A 4HTIA 1S1XB 2RQCA 1S0NA 5CD4A 3GFHA 2V4QA 5HP1A 4K2JA 5CZXA 3BBCA 2C3MA 3DYAA 2FUG9 4CDIA 1JLAA 2O1PA 4JV0A 4MJKA 3C19A 4Q2MA 1RTIA 2J9DA 2M52A 5I3UB 2J8SA 1YK9A 4BC7A 4NEYA 2FLNA 1HYSA 3TNVA 2F7VA 4LF8J 2MJUA 2K7JA 5D0HA 3SFGA 4IG0A 2E5LF 1LFWA 3RG6A 1WUUA 1HARA 3OJUA 5KFLA 1CJVA 1D8YA 3GIJA 2OPQB 5D78A 2ZE2B 4NOHA 1S6QA 4RW8A 3QPIA 2BOAA 5ETRA 3M30B 2FHJA 2Z2MA 2W9BB 4DX5A 2XO7A 2Y1IA 1TV6B 1HIYA 2XZDB 2UVRA 4F7VA 3TZWA 2Z57B 3G2XA 3GJRB 4F4XA 1U1QA 2HAIA 3MCNA 1VQSA 2KM8B 2XY5A 4BS2A 3DRSB 4UF4A 1VK3A 1TZ0A 4EU0A 2HRUA 2QX0A 3QJLA 1Y0HA 1OSDA 4EGLA 4FNIA 2IA0A 4F4YA 5H9FK 2IVFB 3H5XA 4OZ0A 2PC6A 2W7PA 3I5CA 1LWFB 2C2DA 3HHEA 4RKUC 3OR2B 2FC8A 3MPWA 3CDAA 2OPPA 1RQ0A 3HSJA 3D6FB 2I38A 4V19X 5CD4H 3BKFA 1R8BA 1FDBA 5IXUA 1BC6A 1JQGA 2QE5A 4DV4J 4EK2A 3GIRA 3QFWA 2JJ4D 2V4RA 4DV7F 5AXKA 3TZXA 2I8EA 2M4MA 4KT0C 1M5OC 7FDRA 2IDEA 2CPZA 2GMLA 1QSLA 3TEHB 3OTDA 1HBNA 4UOGA 3V6KA 3W61A 4EMDA 3VGSA 4QW9A 1BQNA 4NYOA 3C15B 2QN6B 4UUWA 3NNCA 1S72S 4EEYA 1Z2ZA 1BUXA 1V3RA 1VQNS 1X4DA 3CO9A 4P10A 1NMEB 2FLOA 2L48A 2HNDB 1CPZA 2XQCA 5EGYA 2NZCA 4TN2A 4NLXA 5D4OA 4O3PA 3R5BA 4X4UA 2RILA 4YR2A 1TKZA 2CXEA 3MMBB 4TKTA 2WCXA 4HI1A 4C8KA 1U0HB 1LW0B 4Q44A 5DM6Q 1SJRA 2QA2A 3QLHB 4ECWA 4URSA 2AYGA 2W4CA 2VASA 2HIQA 3BGFA 1XNRF 3PW7A 2XS5A 2HGMA 2A0FB 3OFHA 5KFWA 1HQUB 5J2MB 3W2VB 4FF4A 1F6TA 4P74A 5L1IA 3TARA 1XERA 4ZP8A 1U2RA 2FQQB 1FXRA 4KB7A 4CH7A 5IV4A 3SDEB 2HFSA 4ZHRB 2RE1A 2IRXA 1NO8A 1KC8T 2HHWA 4LREA 4UOCA 4OFZA 3IAM9 1YBTA 3FJ2A 4I69A 1CJUA 3MPYA 1X9SA 1IJFB 1GTEA 4EZ9A 2GVZA 1BQXA 1FERA 2K8GA 1TQLA 3GIMA 3VQSA 2R8HA 4OIXA 2E66A 2VA2A 1WOSA 1U26A 2RQKA 3FFIA 1C4AA 1QJHA 3N5BA 3D1QA 1K9MT 4DCJB 2IDLA 3DLHA 1FDAA 3AQPA 1MROB 2WW4A 4ECYA 4IH5A 4K4VA 4NWBA 3PRDA 5LSLA 4YY3F 3GIIA 4OQJA 4RJVA 5DZ6A 4DDFA 4FDFA 4CLTA 3ITHA 3BSOA 4ECSA 3B54A 5I42A 4CRJA 4C6AA 1X5OA 2CQGA 4RNMA 3V4IA 3E01A 5LJ3Y 4U7UK 1LW2B 2MJNA 3FSIA 3KLFA 3W3SA 3UCGA 4LRDA 2J7WA 2HRTA 4YB5A 4M5LA 4ECQA 4FKYA 4HTJA 3QJPA 4FF3A 3EJMA 2RKIA 2AJ2A 2JLFA 2XNRA 2VG6B 1NK6A 3H5UA 2JEFA 3HJVA 4DV4F 4PWDB 2Z58B 3G6YA 2O67A 5KT5A 1UL3A 1VBKA 1MU2A 1QE1B 3VTIA 2R8GA 4DCOB 2XMUA 4TNOA 3PRVA 4WIQA 2MZRA 1CS4A 2QJ3A 5J2QB 4ECTA 2GJIA 4IUFA 2BYCA 4JI2F 4ZVQB 3B4DA 3G6ES 1U09A 4FVMA 1BHNA 2YTCA 4F0KA 3EDRB 2PFFB 2C3UA 5BYRA 2CIMA 3GV8B 4UUXA 2LP4A 1LWEB 3W64A 2GO8A 2WZ1A 3B6BA 2BMBA 2YQ0A 4ANCA 3S8SA 4QWDA 2X3DA 1VBYA 2H9ZA 4CYUB 1Q1KA 3MGJA 1U6BA 5FD1A 3W60A 4FXVA 2FJBB 3HD2A 4FS1A 4PG4A 4CLLA 2CZ9A 1S1UB 4YDDB 1XN9A 4QIEA 2FVCA 1H0HB 1HNVA 3P5BP 4J90A 3MMAB 1HWLA 3CCMS 4RU2A 4DSIA 2LMIA 3AOBA 1Q7LB 2CQIA 2UUBJ 2YKMA 4DSJA 4QIGA 1FJCA 1OSCA 4KV8A 1NH7A 1XC9A 2DGXA 1IBKF 1RT2A 4DBQA 1KFSA 3M2UA 3CW2C 4M1KA 1NM2A 2ZOGA 3BSAA 4WKYA 1RP5A 3KG4A 4LUBA 2IY5B 5CZVA 4F26A 2WSFC 4RWXA 1MW7A 4EUVA 3FQKA 1M5HA 5ETQA 1WC3A 1RAEB 1BXNA 2UV8A 4DPWA 4K0KJ 1GQEA 4ID5A 2J9CA 1V5VA 4PCQA 3FRYA 2H5EA 2C2OB 3PR5B 2G2ZA 1RYRA 3OHBA 2NZ4A 3UO0A 2BW2A 4TU9A 5CYQB 4JYAF 4AXIA 2DVIA 3B8HA 4USMA 2R7XA 2X3GA 2V4JA 1JLCA 4RWWA 4U95A 1REVA 1WHWA 2I2YA 2E5IA 2ILZA 1ZAVA 3H0PA 4ECVA 2CPIA 3SQGA 2L9DA 2VKRA 3WX4A 3A3OB 1T03A 1YJ7A 2FHMA 4HACA 4ECZA 4X4QA 4IO9Q 4XTTA 3H8YA 1FA0A 2LQ5A 1MMNA 4DHVA 2OJ3A 1TFYA 2FJVA 2IRUA 2AYEA 2BACA 4B3SF 4NLWA 4NZ7A 2D9PA 1XWLA 2K2PA 2D7SA 4DF4A 2BKNA 1SPBP 1UJ5A 3GSDA 1S9EA 1SL2A 2W2QP 5A76A 1TKXA 4WZQA 2E1MC 3PCOB 1YSJA 5AE1A 1B99A 1GFWB 1K8AT 2XMJA 5KFRA 1UEUA 3QT8A 4H4OA 1NJWA 2ZJQQ 3DC2A 3VAFA 2XMAA 5HMZA 1O8BA 1UZDA 2YNFA 2C2NA 1RT4B 3IP0A 2DGTA 4DFKA 2P9EA 2ADBA 1EQ0A 3OTCA 2ZFHA 3GV5B 2NXUA 3QSYB 5B0AA 3M32A 4OZLA 2EI5A 3MEDA 4IOCQ 1FHTA 5J1PA 2JEGA 5JJBA 1PCAA 3OLBA 4LIWA 2HNYB 2HHQA 1HQEA 3T1HJ 4CO3A 1DTQB 1HQ2A 2HQGA 2F3JA 2CZVC 3PW0A 2UZAA 3GONA 1JLFA 2A6OA 1E6VA 4YB1P 2DNYA 4ER8A 4JUZA 2GMHA 1HBUA 2QMUB 3OL8A 2LFVA 2V2QA 2R7RA 3DRRA 3KLGA 3CDWA 2J9DE 2GZOA 4DEZA 2BJ3A 4XDDA 1RA7A 3JSYA 2GS8A 3AD7C 4DL0C 5DZ7A 3QZ8A 3OVAA 1RBAA 1R7IA 3LGNA 1RHUB 3J7AN 4YEAA 1A9NB 4EFAC 2KZZA 4M95A 1TELA 4R8UA 3JYTA 4DWIA 2HEKA 3SV3A 4ZVEA 4A8MP 2QZ8A 1AFIA 2WSEC 1OY9A 4WFYA 3FRZA 1JLEA 5D6GA 2UUBF 1C2PA 1TU0B 2W1BA 4CLKA 1SJ3P 1PBUA 1JLQA 2KI2A 3LTOA 3KHHA 5A8KB 2V2ZA 1T9WA 3DOMA 1KNZA 4DX6A 3ZZTA 4BHQA 1I3OB 1TFWA 1H72C 4X4SA 4JI1J 3V5RA 2HNZA 1FRLA 5HK4A 5M2PA 4XK8C 3MMCA 4C3KA 3HJFA 2X1FA 1S1WB 4DV0J 3WQPA 2B4OA 4LT6A 3TAPA 1RKJA 1L3KA 4ED5A 4OYXA 3MR6A 3DMJA 4CWBA 4K0KF 1S10A 2GFFA 3HDSA 2E44A 1RWUA 4Q0BB 5F9NA 5K14A 3NG8A 5D0RA 3NMAA 4ED7A 4HH1A 2DXFA 4U7CA 5RUBA 1T95A 2ZHOA 3EWGA 3DLKB 3Q2SC 3AJ2A 3GE9A 4DFMA 1W2BR 1OQ6A 3ZZ0A 5J2NB 4WTOB 1AFJA 3MM7B 1BY9A 2QLWA 3N4WA 1I1GA 1YBUA 4ES2A 3LANA 3OUYA 5KFAA 2K1RB 3G9CA 4DV3F 2N4DA 4Y2KA 1HD0A 5KFQA 3K5NA 3D9BA 1UZHA 2CUYA 4C3MA 3KK3A 2OI2A 3VVTA 4EZ6A 2QGFB 4FXWA 3Q86A 2GVDA 5E0OA 1HMVA 4NE9C 4HEA9 2KT3A 1S4EA 1F5BA 1U6ZA 1M1KT 2NUHA 2WVBA 1ZS6A 3T3FA 2KTQA 2JEJA 2MQNA 2YNGB 1SH0A 3C6UB 3H2LA 4KKOB 4JOUA 1FX2A 3D2WA 2VFSA 3UD3P 4IRKA 4RPFA 2V94A 4FXDA 5D3GB 3HD1A 4G3IA 1XNQJ 3K17A 3ZTPA 1XMOJ 4ZCLA 1FRMA 3MOJB 2CVIA 5A6PA 1ZTWA 3ZTSA 4ZPBA 5F8HA 2QLJB 3LWMA 2V8PA 3QJJA 3DLBA 1F2HA 2HPUA 2UVWA 3PRBA 2G0CA 4OL8A 2JZ5A 2ZZNA 1N54B 2QA4S 4USHA 4MT1A 4R0EA 4WE1B 1U24A 3T5HA 1RTIB 2MQPA 1IKXB 2VBXA 5KG7A 4ZVRB 3UR3C 4LF4J 3OXLA 5IOLA 4DN0A 2YWGA 4RU9A 3FCHA 3T6BA 2DNZA 3AD9C 2R7OA 2OPRA 2VC0A 4M94A 4IOBA 4CO5A 4O23A 2GIRA 5LSRA 3T1YJ 1VGYA 3W5ZA 3MUTP 4CO0A 2A2DA 5EX3A 2JWNA 2LXFA 2BE2B 3R2DJ 5J1NA 1RWPB 3ZTRA 4FBUA 1S97A 1WJ9A 1J5OA 4CNYA 2JX2A 1NHKL 2XHCA 3NGTA 4IFVA 4ZDNA 2PI4A 5H1SV 3SCIE 5HBMA 2B8PA 1Y11A 2J0QD 3VR1A 2IM3A 1M0SA 4DV0F 1DY3A 3HHDA 2M8DB 3DLJA 1FKOA 1N8RT 4PG6A 3M4XA 2M9KA 5KFHA 2OPSB 3R3TA 5DLGA 4ZVFA 2V0NA 4TQRA 1P1LA 4G1QA 3IBFB 1FRHA 4HT5A 5IM0B 3OTOJ 3OR1B 8RUCA 3N0VA 3OVBA 1H2TZ 3JAMY 3R27A 4FS2A 1TAUA 3IR6B 4O0IA 2JHEA 2F8HA 4HT7A 4DFPA 1EP4A 2BQUA 4OJGA 2VUGA 2EC0A 1YZ6A 2XBPA 4IO1A 1JKHA 1RE1B 4LSNB 2B7CB 1TK0A 2VBZA 2HBQB 2VA3A 2J7KA 2I5JB 3LPYA 4KYZA 2ZH4A 4PXBA 3PYDA 5FDLA 2OGUA 2N82B 4P9SA 5AE3A 1MWQA 5IQQA 4NYPA 1BQNB 1HBOA 4WCEQ 3EUNA 1MG7A 3N5FA 5KFKA 1EKRA 1HFEL 1U02A 2MQQA 4MKBA 3R7BB 2RDIA 3SIPB 3QT5A 3I0SB 2BJ8A 2EXUA 2ASDA 3QIPB 4Q2LA 2VFTA 3HVWA 2Q66A 4RNOA 1TL7A 1XNQF 3ZZUA 1XMOF 2HVEA 1SKRA 1IM6A 3R5AA 1RACB 3HHKA 1WKKA 3GYXB 5DGBA 4KPYA 5G0RB 1RLCL 3IFEA 4OHZA 3PV8A 3H7HB 1J5EJ 3VAGA 4FYWB 1W2IA 2WVCA 1U25A 3N79A 2VPWB 2FTRA 3TAQA 2GVZB 1IUJA 4NA2A 3FNNA 1T3NA 2G9OA 2RF2B 4C9DA 3CJ8A 3GFXA 4DZDA 1HNZJ 1MLAA 1V3ZA 2CDRB 4WFAQ 3RAQA 3A8KA 5CABA 1Q16B 3JB9k 1PO6A 2BEFA 5C7PA 3T1YF 2OP5A 1PYTA 2B43A 2V2KA 4JI3F 2FPHX 2RRBA 4ZPWR 2VPZB 3MD1A 2MZJA 3Q83A 2FJAB 1RT7A 4LBHA 1DQAA 3ZZRA 3MTKA 4OI4A 2RUGA 3JSMB 1VDHA 2VJVA 1WF0A 2CAJA 3CNQP 1WKJA 1VHFA 3A3NB 1H6KX 3GR0A 2KT2A 5KFGA 3BGRB 3IN5A 5GAGU 4M5NA 2PD1A 2ZH9A 5I42B 5FJ4A 3MR2A 1XMQJ 4P6QA 2GO9A 4GVLA 3OPKA 4B9UA 4L3KA 2FJDB 1A6LA 1C1BA 3DRPA 3V4IB 5K8MA 4WJBA 3HK2A 1BD6A 1R6VA 4GVBA 4XPCA 3IM9A 5JUMA 4ZPCA 2DNMA 5J1EB 2FJEB 3OTOF 3I82A 3ZC4A 2DHXA 3BJYA 2NXNA 2EPIA 4B17A 3JTPA 3O8WA 4K4UA 1OQ3A 2B4VA 1VRQC 2ABYA 2OD6A 1F1BB 3IC1A 4HYKA 5DDPC 4HDHA 1NHVA 4URGA 4RW9B 3PKYA 4CQ1A 3D0GE 1R8HA 2V5HG 2C2MB 2H54B 4I2PA 3J81U 1S57A 3GQCA 1KBRA 3UWTA 2HRYA 3J80Y 3IGNA 2MHEA 2EKYA 3W2WA 1MU2B 2H4YB 2HWTA 2WVEA 2KYZA 2RS2A 5ETTA 4OZNA 4QIVA 1JX4A 4C0BA 2XLIA 4C4WA 2C2RA 2G4BA 3KLHB 4UZBA 1YVFA 1FRXA 4X65J 5KT3A 3A4TA 2B56A 3TW0A 1T0TV 4DR1J 4OX9J 3OLAA 5DLFA 4KAIA 3I0RA 1UCNA 1UWBB 1SUQB 4PG5A 5ETMA 1YBAA 3QNWB 4FN5A 1FDDA 4OYZA 3S1TA 4BWMA 3KHRA 4PG8A 2HHXA 3ENWA 2OFGX 2VDHA 3T5LA 2R42A 3GYNA 1A7GE 2BZ2A 1RWXB 3DOLB 2KJWA 4WP9A 3D54A 3JSBA 4S0MA 4NRUA 2LQ9A 1HLWA 2XYPB 2WRMA 2DO0A 1QDUB 5KT4A 2Z0GA 3ISZA 5F3TA 3MECB 3HVRA 2HVHA 3PYGA 3M2UB 1ZPWX 3QO9A 5J2PA 2Q6CA 3UD4P 2DT9A 1B7FA 1HI0P 4QR2A 2D41A 2HGLA 3GTYX 1VISA 2JOQA 3ZZOA 4OYBA 5KFYA 1M90T 2UUWA 3VV2B 2J0SD 2IMOA 1ITPA 4QIWD 4ID5B 1GNKA 1TL1A 4ZJQA 3UN2A 1B7YB 4MTPA 1U1MA 2P5VA 3RRHA 3M6VA 3MEKA 1PJ5A 3KLEB 1H38A 1HHTP 4PPZA 1EJ7L 4CT8A 1NK5A 3EXCX 2V4JB 3I4PA 4IQMA 1G7CB 3U1LA 3DRYA 3C6TA 1KR4A 3ZZZA 4KTQA 2ATLA 3PW4A 1R0CB 3KJQB 3CJRA 4HACB 3CC7S 5KFJA 4GRSA 3K57A 1RWVB 1ZOTA 4C11B 1FJGF 3KJVA 1HNIA 1UMJA 1I51B 5C25A 2HW3A 1MMLA 4IH7A 4ZIWA 5C2GA 1CQNA 3V4MA 2RUSA 3EX7B 2UU9J 1IR2A 2DGVA 2J7UA 2QA4G 3BREA 1SC6A 2KT5A 4JI8F 2RH3A 2HLUA 3W65A 5KG3A 3HX9A 1DAXA 4F4ZA 2E9RX 3TUIC 2QRRA 2NR0A 2JLGA 1HNXJ 5IV3A 2JSXA 3X3UA 3NAIA 4R25A 5LJ5Y 2BM0A 4PEOA 2P9CA 4K4XA 4PQAA 3GILA 5SUHA 4CO4A 3H5SA 3C66A 3JS9A 3R1LA 4WK1A 3FCVA 2MLYA 2V6AA 1HWKA 4F04B 1GMWA 2YNHA 4X65F 1HW9A 2MZQA 4O3RA 3DLEB 4U6PA 4DL5A 1RU2A 4EWTA 3IWNC 1N32J 3HVTB 2DNNA 3SMZA 4TQSA 1UKUA 4NLOA 4JI6J 4JP8A 3K5LA 2HFOA 2YWEA 1VQMS 1LXNA 2UP1A 3UNYA 4A8XA 1OPIA 2DNPA 4Y0FA 4PAAA 3MURP 1AB8A 3P49B 3JQKA 4HL9A 1EHWA 1NPPA 3BN4A 1ZM2A 2HQ3A 3TX8A 2P6SA 3BYPA 1U1LA 2QG9B 1U8WA 5DETA 5K8NA 2Y8YA 4B3MF 1AZSB 3UW1A 2PN6A 3IS9A 2LA4A 1N5YB
chains in the Genus database with same CATH topology
2L41A 1CVJA 1JLQB 2CQ3A 3SFUA 5E3AA 2RNEA 2CQHA 2XS5A 1GXLA 3BSCA 2HGMA 3MM8B 4JI5F 2IMWP 3IRWP 2M7SA 3OFHA 5KFWA 2UXCF 2VONA 5C42B 1HQUB 5J2MB 1VQ5S 3W2VB 4FF4A 1Y3JA 5KTQA 4ETXA 3PZPA 5L1IA 1HHSA 3HM9A 3E2EA 1TL4A 3TARA 2UXBF 1XERA 2IM2A 3IBWA 3CCUS 1SKWA 4ZP8A 2C22A 1U2RA 4H4KC 2HNZB 1N0VC 3THTA 5HI7A 2NS1B 3OHAA 1FXRA 5DQGA 4EYHB 1C0UA 3GV7B 2AGQA 1M5PC 1FD2A 4KB7A 4CH7A 1H98A 2IVMA 4OHXA 3SDEB 2D3ZA 1RT7B 4ZHRB 2RE1A 2IRXA 1N0UA 4TY8B 1NO8A 1KC8T 4J9SA 2HHWA 4UOCA 4OFZA 3IAM9 1XR5A 3FJ2A 2CQDA 2WONB 4I69A 4ZP6A 3LP2B 4ZMMA 4KIAA 3MPYA 1X9SA 1IJFB 1SH3A 1GTEA 2DHSA 1RT3A 5KFFA 4EZ9A 4WZMA 4MH8A 4ED8A 2KVIA 1WTFA 2CJKA 1BQXA 1FERA 5KFVA 4IR9A 2K8GA 1TQLA 3GIMA 2N3OA 3GFZA 3VQSA 1YWXA 2R8HA 2KN4A 4AL5A 5T14A 3O44A 3DFEA 4OIXA 2E66A 4DG1A 4Z37A 4ZKAA 5B08A 3BS9A 4OJ3A 3CE8A 2DHAA 2HFZA 3HKWA 2BM1A 2ILYA 5K14B 2VA2A 1VBXA 5DGAA 1ZAWA 2Z8QA 4IDKB 1U26A 3HHLD 4QU6A 1DFDA 2RQKA 4F02A 5AE2A 4HI2A 1F9FA 5A8KA 1S9GB 3FFIA 1X4FA 1C4AA 2IFXA 1QJHA 4HLBA 1ZTTA 2JRSA 1MWZA 3MR3A 5BYQA 3N5BA 4LF9F 1RT1B 3D1QA 5AXNA 4RW4A 1K9MT 2L9NA 3DRPB 2NREA 3DLHA 2VH7A 1NNDA 2HHPA 3RTVA 1ZZFA 5HMWA 1FDAA 3AQPA 4MAKA 1MROB 1FE4A 3P96A 3EGNA 3PFEA 3DI6A 5T7LB 2W7OA 1S1WA 2LEAA 2MQOA 4ECYA 4LQ3A 1ZM9A 4OI3A 4IH5A 2KRBA 2DH8A 3QMQA 2HLTA 1CG2A 3PXGa 4K4VA 4RUCA 4NWBA 1OS5A 3PRDA 5B0EA 5LSLA 1WACA 4YY3F 1WHVA 2KB2A 3GIIA 1NRKA 4K4SA 5EUHA 5K9FA 3OUYB 1H7XA 4LIRA 4OQJA 3T9NA 1F5CA 3MOZA 4DDFA 4Q0BA 4K4YA 1KFDA 3ITHA 1U45A 4YP3A 3BSOA 4ECSA 3NNHA 5HROA 4F2SA 1UVKA 2E5GA 2E1AA 5I3PA 4I7FA 5I42A 3CVKA 1X4HA 3NRBA 4GO5X 2UUAF 2ACYA 1LK5A 3CWJA 4ZK7M 1X5OA 1QVGR 5GAGI 4I2PB 1HPZB 4N8NA 3N9UC 5KT2A 4Q8EA 2FJWA 2CQGA 2XGQA 3DLKA 4LF6F 1WHYA 4RNMA 3QGGA 2HWIA 5KOWA 3V4IA 2XLJA 2IYGA 3KMQA 3E01A 3CT9A 5LJ3Y 1DHMA 1V9OA 2IBKA 4U7UK 3FVYA 1NKEA 4K4WA 1LW2B 2ZOMA 1FCAA 2MJNA 4LVOP 1C1CB 1DARA 3DGPA 3FSIA 3KLFA 4J9RA 3W3SA 3UCGA 4MMOA 1UEVA 4C97A 3LP0A 3W2WB 1RT6B 2J7WA 4YB5A 3EPGA 5J2NA 3S7RA 4OI1A 2AJFE 1RTHA 4NLUA 4YQWA 1GTHA 3CIMA 2F9JA 2RU9A 3FEXB 3MM6B 6FD1A 5FLXY 1SL0A 3OJSA 2JVOA 3N6NA 4ECQA 5KG2A 3IG1B 2Z4PA 4IOAQ 2MMYA 4XAKA 1UFWA 1Z4UA 4HTJA 2K1RA 4Y3CA 4ID8A 3NBPB 2MZTA 1YRUA 2SXLA 5F9LA 3QJPA 2CJQA 1UJ4A 1D8ZA 4FF3A 3HHLC 2GNKA 5JXSA 1HNXF 3GWCA 2D3UA 1N88A 4J9NA 3MEEB 5EN1A 2RKIA 2WB1D 1OO0B 1O0PA 2CG4A 4OX6A 2JLFA 3I0RB 2XNRA 2VG6B 3QAEA 1NK6A 3OBIA 3H5UA 1KD1T 2UVUA 3NCPA 2UV8G 4ED2A 3KNGA 3HZGA 5KFMA 2B6AB 4U9RA 2IA6A 4OLOA 4MFBB 3M8RA 2JEFA 1X5TA 3PKMA 2L3MA 4F3QA 4DV4F 4PWDB 2V8DA 4LVNP 1B0TA 1NKCA 4IRCA 2LXIA 3TUJC 2GW8A 3G6YA 3E3XA 2ZHAA 4FNHA 1DURA 2O67A 3OSPA 1S0OA 3MM9A 4IR1A 4WFXA 4NMLA 2I0XA 1JLGA 1VRUA 2MQMA 3I9V9 4I68A 5KT5A 1UL3A 4PR6A 3T6BA 1MU2A 2DCLA 1QE1B 2LKZA 3VTIA 4KRWA 2R8GA 4B3TF 2XC9A 2XMUA 1R6YA 3LO3A 4MKAA 4TNOA 1CSJA 1VMBA 2XS2A 3D1OA 2MYFA 2U2FA 2MZRA 2XI3A 1HWIA 4Y2CA 4QJVA 4DPOA 1VRTB 3CDEA 2MKKA 5J2QB 2YNGA 4ECTA 3JTNA 2GJIA 4IUFA 2BYCA 5DQHA 2WW8A 5MAOA 3C6UA 4JI2F 1YHQS 4P7TA 4KKOA 3B4DA 3G6ES 1U09A 4FVMA 2A18A 4ES3A 2ZUGA 2YTCA 2UXDF 2HMIB 1N32F 2PFFB 2C3UA 4H4KA 5BYRA 2LQJA 2CIMA 2ZITA 4WFZA 3GV8B 2IAJA 5CXTA 3IXQA 4UUXA 1Q4RA 3AAWB 1RJJA 1SV5A 2X1GA 1LWEB 5T41A 2W24A 1K0TA 4JI6F 3M2RA 3H4DA 5HP1B 5D3GA 3CC2S 1KHWA 2GO8A 5DQIA 1S1VB 2EFOA 2V9KA 5CYMA 5KAKA 1LQ9A 4C8LA 1S0VA 5IT9Y 4C98A 5HLFA 5KT7A 3DYAB 2VZ9A 4MIBA 2Q3PA 3S8SA 3T1HF 5HO4A 1XMBA 3DXBA 4L3NA 4QWDA 3I56S 1KHVA 2Y0SD 1VBYA 1T94A 2H9ZA 1NJZA 5J2PB 2O5DA 1JLAB 2F8MA 3GFYA 5L8RC 1VIXA 1I94F 4QZVB 4D3GA 1CLFA 2GQCA 1Q1KA 3MGJA 1U6BA 5FD1A 4MYUA 3EPIA 4FXVA 4PQUA 2KKHA 2FJBB 4ELUA 4P7VA 5E3QA 2XEXA 4K5RA 5F0WA 4DV6F 4FS1A 4PG4A 1S1UB 2DISA 5IFMA 1YQHA 4YDDB 1XN9A 2GHVC 4OJHA 4BDPA 4B3OA 3OVSA 4QIEA 2FVCA 4WE1A 1QAXA 1H0HB 1S79A 4J5OA 1HNVA 1CC8A 4M8LA 1V6HA 1IKXA 3TA2A 1HYSB 3MMAB 1FRIA 1HWLA 3CCMS 2ZDOA 3BO2A 1DZ5A 2A10A 4RU2A 4DSIA 2LMIA 4KHPF 1KLNA 1Q7LB 2CPEA 2EVZA 4C0OC 2CQIA 1L3SA 1R43A 4RW6A 5EWEA 1TL1B 2YKMA 4Y2IA 2CDQA 2KJVA 4DSJA 4IG0B 3KNAA 2M0GB 3MD3A 4QIGA 1D9FA 1TL3B 4E8UA 4B9LA 1QUVA 1FJCA 1OSCA 4KV8A 1TK8A 2RD5C 1NH7A 3CD6S 1XC9A 2VQFF 1J5EF 2DGXA 4RNFA 1IBKF 1RT2A 2MY8A 4DBQA 5KFSA 4RNNA 1UVIA 1KFSA 2AJQA 3M2UA 2IC3A 2OAUA 3L7PA 1S6OA 1HI1A 2XY7A 2BUNA 3AA8A 3DRXA 4M1KA 3Q8RB 1Q81T 2ZOGA 3BSAA 4BBYA 1S6QB 4WKYA 2GQ2A 2M5YA 1RP5A 3BB5A 1FVQA 3KG4A 4LUBA 2JC0A 4RW8B 3MEGA 4EBEA 3THPA 5CZVA 4F26A 2DNHA 2ZDPA 3ETOA 2WSFC 4HH0A 4DQSA 3CJ2A 4RWXA 1MW7A 4EUVA 1XBWA 4W92B 5F41A 3H40A 3FQKA 5IT4A 5D4NA 2BE2A 4QIFA 1M5HA 4DOZA 3SYZA 1HR0F 4A8OA 2R2TA 3CDUA 1WEZA 2B9WA 5A8WB 4KE5A 1Y7PA 1YRXA 4QR0A 2UV8A 2DIUA 4R0JA 4ZOSA 3BO4A 1YJNS 3BDEA 4B02A 3WDOA 4KBIA 1GQEA 1M5VC 4UQGA 4ID5A