5FJ4A

Structure of the standard kink turn hmkt-7 as stem loop bound with u1a and l7ae proteins
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
97
structure length
97
Chain Sequence
TRPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKMKGTFV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords U1 SMALL NUCLEAR RIBONUCLEOPROTEIN A
publication title A Critical Base Pair in K-Turns Determines the Conformational Class Adopted, and Correlates with Biological Function.
pubmed doi rcsb
source organism Homo sapiens
total genus 26
structure length 97
sequence length 97
chains with identical sequence B, E, F
ec nomenclature
pdb deposition date 2015-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5fj4A00
4WFBQ 3VALA 2NLWA 4F25A 2F3JA 4OZ1A 1U1PA 3P6YC 1S79A 3BO4A 2JWNA 4Y0FA 1DHMA 2MZSA 1FHTA 2RT3A 3MXHP 4EGLA 1U1MA 3G96A 1P27B 3DLLQ 1IQTA 2MKSA 2G1DA 2J76E 3EGZA 2MMYA 1VQ8S 2FC8A 1X5PA 1WHXA 2RS2A 2M8DB 4IO9Q 3VF0B 2L08A 3SXLA 3R1LA 4PR6A 4TLQA 5DDQC 2KXFA 3CD6S 1VQ5S 1YI2S 3LPYA 1U1OA 2AYMA 2KYXA 2DB1A 2AYEA 2XNQA 1P1TA 3VAHA 5ITHA 2KVIA 2V94A 4TU8A 2M70A 5DDPC 1D8ZA 3DXBA 4W90B 5FJ4A 1WI8A 2RVJA 2EVZA 4CH0S 2UP1A 1X5SA 1KD1T 1WEZA 1WG4A 2VOPA 2LA4A 2MZTA 3NNHA 4WF9Q 5IM0A 5DETA 2MY7A 2LEAA 3RW6A 5JVHQ 1FJCA 2MQMA 2CQ4A 2DHXA 2CQCA 5JVGQ 3H2UB 3VAGA 1OO0B 1X4GA 1N52B 1A7GE 2HGLA 2DHSA 2CQHA 2OSRA 1DZ5A 1F9FA 2MZRA 4UQTA 1A9NB 2PE8A 1VQ4S 5LXRA 1X5OA 1WF1A 4ZKAA 2N82B 3VAJA 3UD4P 2KM8C 3MD3A 3CCUS 1VQOS 2CQ2A 2DITA 2FPHX 1UP1A 3L3CA 1Q81T 3VAKA 3NNAA 2M4MA 3I56S 2CPXA 1JJ2R 5LJ3Y 2F9JA 3UWTA 3UCZP 1FO1A 5GVQA 1VC0A 3V4MA 1R8HA 2D9PA 2M0GB 1VBYA 1WF2A 5D78A 5CYJA 3CCES 1YHQS 1X0FA 2WBRA 3D2WA 3BS9A 2DIVA 2DNMA 3FEXB 2XS2A 2LEBA 2SXLA 2HGNA 2MGZB 1KOOA 2MXYA 3PIOQ 1CVJA 2PEHA 1RK8A 5D77A 1DRZA 1H6KX 1M5KC 2JX2A 2DH8A 2MJUA 4TU7A 5DDRC 3ULHA 3BEGB 2XS5A 2N7CA 3IWNC 1YITS 1VC6A 2AYBA 2U1AA 2MY8A 2ADCA 1FJ7A 1L3KA 3VAFA 2X1GA 3CCLS 4FXWA 2M8HA 3S7RA 2MKIA 3VAMA 2JVOA 5GAHU 3MUTP 2O3DA 1HD0A 5MLCV 2LMIA 3CXCR 5CXTA 1K73T 1O0PA 3CMES 3S6EA 2XS7A 2OTJS 3SMZA 1N54B 1YWXA 2YWKA 1WEYA 4F26A 4CH1A 3CTRA 2DGWA 1U1NA 3CC4S 1W2BR 2DGQA 5LXYA 2OIHA 3B4DA 4C4WA 2FY1A 1M90T 3ZZZA 3VAIA 4QU7A 2L41A 1YJNS 4J5OA 2QFJA 2M7SA 2RQCA 3MUMP 1M5PC 2HZCA 2KI2A 3R27A 3UE2A 2CPFA 3CCMS 1U2FA 2AD9A 2DNHA 4ERDA 1SJFA 2MZ1A 2MQLA 1M5VC 1WHWA 1ZH5A 2MSSA 1SJQA 2DNPA 3P3DA 3IRWP 3MURP 2LCWA 2QA4S 2M9KA 2MGZA 1X4FA 2DHAA 3G8TA 1YJ9S 1OPIA 4LMZA 2RRBA 1VQ7S 3SDEA 2LYVA 3EX7B 2ADBA 2MB0B 2E5JA 1N88A 1FXLA 4QQBA 2RS8A 4C0OC 2CQDA 2I2YA 3PIPQ 2LA6A 2FHOB 2G0CA 1OIAA 1H2VZ 4WFAQ 5HL7Q 2LXUA 5GAEU 2LQ5A 2MSTA 1U1KA 2MZJA 1N8RT 4M5DB 3N9UC 2NZ4A 3G4SS 2KRBA 5GMKa 1VQLS 3NNCA 3ZZYA 2X1BA 1RKJA 2VODA 3HHNB 2RRAA 2DIUA 3CCQS 1YJWS 2DNYA 2J0QD 2EK1A 2CQPA 2DNNA 2CPHA 2J8AA 3CC7S 3Q2TC 2MJNA 3CCJS 1M5OC 1WHVA 5BJRA 3K0JA 2LXIA 4YB1P 1R8PA 1JJ4A 1UW4A 2D9OA 3MI7X 1Q82T 3BO3A 3RW7A 1WG1A 2CPZA 1PO6A 1DBDA 2U2FA 1HA1A 2YH0A 2MQPA 2KG0A 3BO2A 2QEXS 1FNXH 1KOHA 3G6ES 2KFYA 2DGSA 2KG1A 4FXVA 2M52A 1VQPS 2HYIB 2DO4A 3SDEB 2DNGA 1X4AA 2CPDA 1K9MT 1VQ6S 3TO8A 3S01A 2F9DA 2CPJA 2DK2A 2EK6A 1UAWA 2E5HA 4U67Q 3US5A 2XB2D 2N3LA 3CCSS 5LSLA 1WEXA 3NS5A 2HVZA 2MKCA 3MUVP 4PRFA 1U6FA 2GO9A 4CQ1A 2DGVA 3NS6A 1SXLA 1NU4A 2KH9A 2E44A 1VQMS 2DNQA 2KRRA 3EGNA 2X1AA 4IOCQ 1WTBA 1G2EA 2MKHA 2FC9A 1X4BA 3G9CA 2KU7A 4QU6A 2CQIA 1M1KT 2MZQA 1WELA 2AYGA 1KC8T 3CMAS 1U1RA 5CA5A 2OSQA 1VC5A 1VQNS 1ZZFA 2K8GA 4P6QA 2OJ3A 1NJIT 1URNA 2LKZA 2A3JA 1WWHA 3THPA 1WG5A 2J0SD 3CC2S 3B4MA 1SJ3P 4IOAQ 2RQ4A 2DO0A 3P5TL 2I38A 1X4EA 2DNKA 2CQ3A 3H2VE 5DM6Q 3HI9A 1JJHA 1QVFR 1UFWA 4LIRA 2RUGA 1VBZA 1WI6A 2N3OA 1Q86T 2DHGA 3CULA 4ED5A 4LJMA 3CUNA 1KQSR 1ZZNA 4F02A 2BOPA 2Q79A 1FJEB 1U6BA 1X4CA 2DNZA 1YTYA 3S8SA 2ZJQQ 1HD1A 2MPUA 2X1FA 3G8SA 1H2UX 1U1LA 3THTA 2MQOA 1SJ4P 2BZ2A 2DH9A 2MYFA 2DGTA 2JVRA 2KXHA 3JB9k 2YKAA 4RU2A 1BY9A 4IUFA 3U1MA 2MQNA 2M88A 2LECA 5DDOC 1AUDA 2DGUA 4WCEQ 3TP2A 2KXNB 2DNOA 2RNEA 4UY8T 4WFNQ 2MKJA 3G71S 3U1LA 1YIJS 2E5GA 2E5IA 1HL6A 2CQ0A 4CIOA 4TU9A 2M2BA 4Z2XA 1XN9A 5EN1A 2CQGA 2CJKA 1S72S 4OZ0A 2DNLA 5H1SV 3UCGA 5HO4A 3OW2R 4V19X 2RU3A 4A8XA 3MOJB 2DGOA 2L9WA 2JRSA 1X4DA 1Q7YT 3MD1A 2KT5A 2ZJPQ 1SJRA 5DM7Q 2CPIA 1X5TA 1JMTA 5LSOA 3J7ZT 2XSFA 2CPYA 2OTLS 5GAGU 1NO8A 5GADU 4WKRA 5LJ5Y 3TYTA 4QPTA 2G4BA 2DGXA 1QVGR 4WIIA 1FT8A 1WHYA 3CCVS 1WF0A 3UD3P 2YTCA 4YUDA 2HGMA 1PGZA 2ERRA 3R1HA 2K3KA 4C7QA 3CCRS 2YH1A 2VOOA 4YOEA 3P49B 2B0GA 1QM9A 3LQVA 4PKDB 1K8AT 2CQBA 3UCUP 1B7FA 3CPWR 3Q2SC 1U1QA 2KM8B 4BS2A 2MKKA 2MQQA 3J7YU 3NMRA 2VONA 2CQ1A 1VQKS 2ZJRQ 2D3OR 2GHPA 3I55S 2KHCA 2DISA 4W92B 2CPEA 2XNRA 2KN4A 1D9AA 3FEYB 2DNRA 1OWXA 5IFMA 2MHNA 3CF5Q 3MDFA 4Y00A 1VQ9S 2DH7A 1X4HA 5IQQA 1H2TZ 5IM0B 1VBXA
chains in the Genus database with same CATH superfamily
5KFCA 4ED1A 3P6YC 2HHUA 3OL7A 1RT2B 5BYSA 1WKKA 1SC4B 2RT3A 3IR5B 3Q8PB 5ETTA 1MMLA 3CW2C 2HQFA 3CSKA 4MIBA 3K7RA 3N79A 4ELTA 3BGRA 4R25A 2A18A 2FDNA 4ED4A 4KFBB 1Y3JA 2Q1LA 3HKWA 1QAJA 1NZAA 1NK0A 1N36J 3UR0A 3K5OA 3FFIA 4I67A 2HKEA 2V2QA 1UZDA 1S97A 4Y34A 1KHWA 1WG4A 2G2ZA 4ZVOB 3QJLA 3NNHA 1G3OA 1FA0A 1FKPA 4B3OA 3DOLB 3MEDB 2OSRA 3R8YA 4RW9B 2AGPA 2ZD1B 5KG2A 5LXRA 1MMDA 2W4CA 4XTTA 1CBKA 4DOZA 3IN5A 3T9ZA 4LBHA 3GJQB 2M4MA 1RSCA 2OFGX 5GVQA 3V4MA 2YQ1A 3BGUA 2V4JB 4FYDA 4F04B 3PHTA 5LL6d 3CD7A 2MLYA 1JK9B 5HQLA 1S7HA 4YEAA 2B9EA 2L9NA 4R0EA 4GKJF 3OUYA 4AFFA 1JXEA 3WIUA 4ZS6A 1JXVA 3W60A 3IWNC 1S6UA 4O3PA 3UO0A 1UETA 1L3KA 1XWLA 4ZP8A 4ZPWR 3MM7B 3KLFB 4FXWA 3IXQA 4YR2A 1CC7A 4NOHA 4NXNJ 3EJMA 3CTRA 1W2BR 2DKOB 4KO0A 2QFJA 1H72C 2RQCA 1M5PC 3KDNA 1FKOB 2OFHX 3MM9B 2DNPA 5IV4A 3HVTB 4PZVA 4ZITA 3F56A 4DG1A 5GAGI 3OVSA 2UVWA 3I4HX 3V81A 2O5DA 4ZCMA 2UUAJ 4CWBA 2FHOB 4K0KF 4MH8A 5EWFA 1NLKL 4M5KA 1RWOB 1OMSA 4ZP9A 2V6AA 2BM0A 5DGAA 1S1TA 1RKJA 1UVKA 3IO1A 4WPAA 3G2XA 2XY7A 5F0UA 4DL2A 2RHQB 1W26A 1UZHA 2JHEA 2HNYB 2WONA 3N6NA 4UW2A 3CCJS 2OUGA 2W7PA 9RUBA 2CPZA 3GP9A 2QEXS 5C7PA 2ZVSA 2NPFA 5KFFA 3IAS9 4RW7B 3QBCA 2VPXB 3J81Y 2VDIA 1UAWA 5HMZA 2H1YA 2B8PA 3US5A 2HHHJ 5KT6A 3OHAA 1B0TA 3EZUA 3TI0A 1BMQB 3J81j 3QO9B 2GS8A 3OXGA 1ZM2A 2OMLA 1HNZF 3DXSX 3CJ4A 5G0RB 5B0CA 3TAMA 1VQNS 1QSLA 1FNMA 4C0BA 1LW0A 5AXKA 3ETOA 4UT4A 1X4EA 2YKQA 1JIHA 3M2RA 5CYMA 1SV5A 4ED5A 1SUQB 3CUNA 3NRBA 1JNZB 2WSFC 2F5GA 1YQHA 1H2UX 2OEKA 3LGHA 2IPOB 2LECA 3OTDA 3I6PA 2J9DA 3QAEA 4UOFA 4XPCA 1U2RA 3ZTRA 2M2BA 2EBEA 3X3UA 5J2QB 1HR0J 3C14A 3RBXA 2RU3A 2CJBA 2EFVA 2CDRB 1X4DA 4PUOA 3VGSA 3W2WA 3VHQA 3KLEA 2IIHA 1FE0A 2ZNYA 1XNRJ 4XDCA 2QSFA 4PG7A 3LP0B 1HBOB 4TVAB 4RW4A 3CCVS 3PJWA 1KVIA 2LP4A 3IS9B 2ERRA 2K3KA 5E3AA 3PVXA 3D1QA 2B0GA 4WXWA 3B82A 2GA7A 3FUYA 1NSAA 4PG4A 2R8IA 1RJJA 2QO3A 3J7YU 4WFZA 4DPXA 2HQIA 2PI4A 2ZHOA 1U0HA 1N48A 3FEYB 3PW2A 4J9PA 4LT6A 1RAAB 5CD4H 1NHUA 4HR2A 4H54A 4UOCA 4X84A 5KFLA 3MXHP 3I9ZA 4Q45A 3FBCA 1RKIA 2YKNA 5IT9U 3BDEA 2EXUA 3HVWA 5GAEI 4QYRA 2XI2A 4AD6A 2FLNA 2CNLB 2W7AA 4IO9Q 4EBEA 4AXIA 3VF0B 4TLQA 3W9IA 2KXFA 3GG1A 3LPYA 2C3MA 1H0HB 3SQGA 5KG5A 3BN4A 3WX8A 1F5AA 2B4UA 2XO7A 2BUNA 1YJUA 5DDPC 1SQFA 3DXBA 2JLGA 2FVRA 1X0PA 4W90B 5J2NB 2WVBA 2QIFA 2ROEA 2LA4A 4R5PB 4B3RF 1FVQA 4K4WA 3TANA 2ZBIA 5D4LA 3RW6A 5JVGQ 4DV4F 3QGIA 4N77A 1B99A 4OX6A 4K5RA 2QLJB 3FEZA 1XQIA 4NE9C 4GRSA 4WU3A 2MZRA 1NK4A 3NWRA 2W9BB 1X60A 3N01A 2ZFHA 2R8JA 4ZKAA 3C6TA 1LWFA 3VAJA 1RAEB 3SSSA 4WZMA 3VAKA 1HQUA 3KLGB 5C42B 3DGPB 2OO4A 1E6VB 1FO1A 4JI3J 2J7WA 5D78A 4YB6A 4TY8B 3V5RA 1W25A 2OD4A 2LEBA 1TK8A 3MGJA 1WD6A 4JI5F 3RZAA 3PRVA 2V8VA 4C8LA 1TK5A 1HKAA 2ZH3A 2O66A 4KJIA 4AXJA 5CXTA 3QWUA 3M9MB 1O0PA 1EX8A 4F0HA 1VRQC 2R9LA 1U1NA 2DGQA 5LXYA 4QU7A 4BCAA 2DTJA 2HZCA 2B3TB 1T05A 2VPWB 3GJSB 3MMCB 4PQUB 2ALZA 3OTEA 1M5VC 3HHDA 4UOGA 4DV7J 3IBWA 1IBKF 1H74A 4DL4A 3SCIE 1L3VA 2NYIA 1G4CA 4LRAA 4PXEA 5E41A 3U27A 4WFAQ 1XR7A 2D41A 2QZ8A 4NZ0A 4YHHF 4UY85 3FSXA 2NZ4A 2FGOA 2HVEA 2J9EA 4C8YA 4NCGA 3H4DA 8AT1B 3VTIA 2J0QD 4H4KC 2R8KA 4YQWA 2R7SA 2D9OA 4WP3A 3H42A 1WG1A 3DRPB 2U2FA 3HX9A 3AJDA 2OPSB 3SDEB 2B9YA 1LFPA 2NR0A 2JNJA 4M8LA 2HSEB 1VRUB 1G7CB 1IKXA 4J9LA 1WDTA 2BMBA 1N4LA 1N5TA 1SJ1A 4F0MA 4XPEA 2VFUA 5K8MA 1VQMS 3EGNA 1MSWD 5KT4A 3NEKA 3BH6B 3T1YF 1Q8IA 2DCUB 3SIPB 2HQCA 4KQZA 2OJ3A 2UU9F 2Y0SD 1OQ3A 2DYAA 4ID8A 3HSZA 5F9NA 1SJ3P 2DO0A 1HWUA 4QW8A 4ZLNA 5FD1A 2Z4PA 2CJQA 4F4AA 2V2ZA 3H5UA 2QLXA 1NSPA 3PYGA 1DAXA 1S6QB 3DYAA 2JVRA 3AJ2A 2YKAA 1FDBA 3U1MA 3GIIA 1RTZA 5DDOC 4UY8T 2UZAA 2X51A 5E7OB 2R7WA 1FD8A 4GO5X 4P71A 5KFRA 2L9WA 2Z2ZA 4C98A 4RR5A 3MWBA 3ZZRA 4CTAA 3DHXA 1S0OA 3TYTA 3UD5A 3CJKA 2DGXA 4GVBA 1N36F 4NX9A 2ZZTA 4B3MF 5ETKA 4L6V3 3BF4A 4M5JA 5B0DA 2EKNA 4MMOA 1TV6B 1MWQA 1RT6A 3LQVA 4CO4A 2PIIA 2W2OP 1LWCB 5A8KB 2QG9B 4EFAC 2E1AA 2VD3A 1XBWA 3FSYA 3MECB 1UWAA 3J80U 4FVCA 2HNZB 2K06A 5J1EA 2GVDB 1TMMA 3DOMA 1DQ9A 1EZZB 4P9SA 4B3SJ 2NXEA 3KJVA 3G82A 4C8OA 2XO6A 3K5LA 3BYPA 4LUBA 3AY0A 1QDUB 1CS4A 3ENQA 2AEMA 3I87A 1BUXA 1RT5A 4F2SA 3EXCX 2RVJA 4DL6A 4R0JA 3RR8A 5F41A 4NXNF 2IC3A 4Y28C 2K2PA 3FKBA 1S1XA 4HACB 1A9NB 4IO1A 4CO5A 5F9LA 3CO9A 1PC4A 4USIA 1VQOS 3EDQB 1QY7A 4NLOA 3W2VA 4HVZA 3EYZA 4C6AA 3CCES 4S0MA 1NKBA 3D2WA 2DNMA 2UUAF 5KFYA 2HW3A 2SXLA 4Q0BA 4ZCIA 2OI2A 1JQGA 4DR4J 3KUGA 3T9NA 1M5HA 3K2YA 4C3LA 3M6UA 2IBKA 2XS5A 5KFIA 1CULA 2HQ3A 3C15B 2RB7A 1RAFB 4ZVEA 3W62A 3W8GA 3I4PA 4JYAJ 2ZDPA 3SMZA 3PKMA 4EUVA 3AAWB 4JI6F 2XWYA 2KT2A 4C8NA 1AXQA 1T03B 3AB4B 3T6BA 4TNOA 2E5LJ 5E5NA 3FVYA 1NUEA 3VZIA 4KKOA 4Z37A 1RDRA 1SJQA 5U47A 5K9FA 2HHHF 2QA4S 2VQEJ 4H4KA 2HS3A 3POTA 4QQBA 3OVBA 2W4DA 3BBCA 2AJ0A 4IFYA 2XC9A 3QLHB 4LF8F 4M5NA 4DPYA 4P10A 4WFYA 1RBAA 3CDAA 3ET6A 3L09A 5SUHA 1DLOA 3N9UC 3WC0A 3QATA 1FXRA 2P9CA 1JKHA 2ILZA 4ECWA 2CG4A 1TKTB 2NXNA 3H7HB 4USWA 2J8AA 3EVMA 2MJNA 3DRSB 4HT5A 3PO5A 5K5MA 1JJ4A 1U02A 3EXYA 3BO3A 5KG0A 4N56A 4J90A 2VPYB 3MAHA 1KOHA 4DF8A 1TKZA 4ZLPA 2HYIB 3AODA 2DNGA 2CPDA 2HVHA 3IRXA 2HFZA 2RSQA 3Q8QB 4L75A 3G86A 2XB2D 2N3LA 3GTYX 2H65B 1HR0F 2V2VA 4BLGA 2FY8A 2K7JA 2KH9A 1PCAA 1HNVA 2HEKA 4FNIA 1XNRF 3HULA 1Q5VA 5L46A 1FRJA 3M30B 4USVA 4NLQA 3CDEA 2CNKB 4B9SA 1S1VB 2Z2LA 2FJWA 2QL5B 2X3DA 1HHSA 1Q5YA 1YSJA 1WC5A 1S7IA 3O1LA 3FDSA 3HLUA 5KG3A 3BM7A 1AFIA 2WBMA 3I0SA 2DNZA 3BGFA 2YPYA 2MPUA 1MWYA 4LVOP 1GNKA 3UN5A 1JLGB 3P96A 1TKDA 2HLUA 1RTDA 5T41A 3G6YA 2Y1LB 5AE3A 4M94A 1YIJS 4N41A 4U8VA 4CLSA 2Y0BB 3VR1A 3M9OB 2GNKA 2JRSA 1QSYA 4NRUA 4CO2A 1ZTTA 3V4IA 4HEA9 5L8RC 1HQEB 3KK2A 2G4BA 4X4VA 1QLNA 4MKVA 3OJSA 2PFFB 1WHYA 4Q2MA 2YTCA 4PXCA 3IP0A 4IDKA 2XSJB 4E0DA 2Q66A 2XMMA 5I42A 1GMVA 1MMNA 4A8QA 4YY3J 2CWXA 4RKUC 5KOWA 4V19J 2UXBJ 3RB3A 2GVZB 3OJUA 2VBWA 3SCJE 3PZPA 3MDFA 3K8VA 1SQEA 5A0YA 3EZOA 5ETMA 1S79A 4NLRA 1YVFA 1FHTA 3OTCA 2ZDOA 4DUZJ 1KR4A 1HBUA 3G6VA 4F4ZA 1K47A 1CJTA 3KUHA 2IBOA 2OPRB 3W61A 2RS2A 4B17A 4M63A 4LRFA 3CD6S 1B0PA 3M05A 1R6YA 4RW6B 4DQPA 1T3NA 5ITHA 2V94A 1PG5B 3JSMA 1N5QA 4JV1A 1CG2A 3HHLC 1YRXA 1X5SA 1NPKA 4GO7X 1VFJA 2MZTA 3M8QB 2BE2B 4BDPA 2MY7A 4MTPA 3H2UB 3KG4A 4ECQA 2DR6A 1F9FA 1KS2A 3DNCA 1VQ4S 2VHGA 1WF1A 1WKLA 5I4MA 2C28A 1U8SA 3L3CA 4DV7F 3QGGA 3I56S 4AL5A 1C1BA 1V5IB 3WX4A 5CYQA 2GMLA 3N28A 2DXDA 4XIUA 1BWEA 3FSIA 4FKXA 3AQOA 2JEFA 3NBPB 2NSCA 1FRHA 3HSGA 1T3OA 4ZN3A 2R2SA 2OPQB 4OJ3A 4CYUA 4ZPBA 3H40A 2DEJA 1QTNB 1ZYQA 2YNIA 3CDUA 4ECYA 4X4NA 1KTQA 4J5OA 1HYSB 2YWWA 1G6BA 3AA9A 2D3UA 4NPOA 2UXDJ 4TYAA 2HHVA 4YFUA 2XMUA 3ENAA 2MSSA 2J6UA 3RB4A 2JEGA 1NSQA 4R8UA 1BQNA 2WW8A 2G0CA 2AEFA 2APOA 1H2VZ 1D8YA 1U1KA 4MIWA 1IUJA 3N5FA 2C3YA 1XMBA 4KAIA 3NNCA 2XBPA 3HHNB 3I0RA 1V3RA 4E2FB 2RH3A 3R3TA 2D3ZA 1M5OC 1FTRA 5BJRA 3K0JA 1S9GA 1R8PA 1DTQB 4L3KA 4AE5A 2KHDA 1TL7B 3SEOA 4L74A 5FDLA 4DLGA 2AHOB 2FVPA 4WWSA 3GLJA 2DGSA 2IMOA 3JAMY 4HDGA 2R7RA 4K7QA 1S99A 4X66J 1JX4A 3KG1A 2QJ3A 2EK6A 2E5HA 2WB1D 1JLCB 4PRFA 3UW1A 1KHVA 3FNNA 1OPZA 1WC1A 5A2QU 1IXKA 2WVEA 4IOCQ 2FC9A 1X4BA 5L1JA 2AJ1A 2JC0A 4U7UK 2YVSA 1HNWJ 1U1RA 5HVFA 4LBIA 4A47A 2GV1A 2R7XA 4CLFA 1N6QB 1FRIA 1AA1B 1UA1A 2B6AB 1CJVB 2B4PA 4IKAA 1JLBB 4MYTA 4OHXA 5BR8J 1FJEB 2HNDB 2HVIA 2ZJQQ 1B7YB 1XMOJ 1S57A 5C24A 1CQNA 3Q83A 1VBKA 4ZK7M 3UNYA 5B09A 4OZ3A 2XGPA 2DNOA 3H5SA 1RT4A 2Q6BA 1C0TA 3RAQA 4B3SF 4O3NA 3GJTB 3PTWA 1I5OB 2HHWA 3T5JA 3FRYA 1T11A 2BJEA 4NEZA 2J0WA 2POKA 3HSDA 5LSOA 3IG1B 5GADU 1F6TA 4Y3CA 2HS0A 1ZBTA 4NZ7A 2O1PA 2VKRA 3RBDA 3LWLA 2FLPA 3MM6A 5IOLA 1XMQJ 2KZZA 4RBVA 2QA2A 1P9YA 2VOOA 3KDOA 1QM9A 1QJHA 3BZQA 2KTQA 2GO8A 3DDKA 1KVJA 1RA6A 2D3OR 3GCXP 1RZMA 4DQIA 2F8EX 4ID5B 3I5CA 3KHLA 4OZ1A 3EDRB 1DHMA 1RTHB 2A6OA 4DR6J 1RGVA 1E6YB 2G0JA 3U02A 3UVJB 5EDWA 3HHLA 3THVA 3NY0A 3EGZA 1K1SA 3R9LA 3TUZC 1MWZA 4C3KA 1UFKA 3KJQB 1WHXA 3KLIB 1HMVB 4HTIA 2OEJA 2VICA 1UPMB 4DR4F 3KHHA 2KYXA 2JJ4D 1RWXB 4IQXA 1RA7A 2B9WA 5K14B 2OELA 5J2PA 1FRLA 4B9VA 3R2DJ 4B9MA 3MPUB 1WI8A 2A1BA 1JLEB 3V6DA 2ZE2A 4JYAF 4YMEA 3DLEA 2V5HG 2FJDB 2DCLA 3KK3B 3K5MA 1RYSA 3H98A 3T41A 1RT2A 4LBPA 2IJFA 3M8SA 1A7GE 3LAKA 5JMNA 1DZ5A 2E1CA 4FZVA 2E1RA 2E5LF 1HWLA 3CT9A 2EFOA 2BW7A 1GMUA 4ZVQB 2VQEF 2YKMA 3DM2A 3G8QA 4KFBA 3DRRB 4OI4A 1WF2A 5CYJA 1MLAA 4J9NA 3QFWA 3FEXB 2KB2A 1HPZB 3MAAA 1M5KC 2ZVIA 3LF0A 3D4JA 1SC1B 5F8GA 1S9FA 1MG7A 2U1AA 2MY8A 1FJ7A 4CM0A 2MDAA 4NMLA 2C2KB 1UTAA 3VAMA 2JVOA 2FHKA 3DOLA 4CDIA 2LMIA 3MEDA 4RW9A 2ZD1A 4BC7A 2EFPA 1YWXA 2CVIA 2EFNA 3EPIA 2H54B 4EO8A 4F26A 3CC4S 5B0FA 2HURA 2GIQA 3PCOB 5KT5A 4C8ZA 1UEUA 1UVIA 1Y0HA 3JS9A 1H7WA 2V4RA 1EETB 1K1QA 1WHWA 1DARA 3S1TA 3G8TA 1YLXA 1V9OA 2J9CA 1RE1B 2LYVA 4PG6A 4WP9A 4QBUA 4DX5A 1R0CB 1N5SA 1TUGB 3IBCB 4DSEA 3L95X 3MM7A 3KLFA 3SSRA 4WK3A 3J7YI 2DPJA 3A4TA 3CCQS 3J81U 3R6GB 3L9ZA 3HXMA 5KAKA 1PILA 1TL5A 2KZMA 3IM9A 5KFPA 2EFQA 3J7Z5 2HWHA 2R7VA 4M95A 1FNXH 1FKOA 5FLXY 1KLNA 3HVTA 1YBAA 4K50A 1TVRB 1LOUA 4O3RA 1X9MA 1UMJA 4ECRA 2JLEA 1LK7A 3FGVA 4JI2F 4G3IA 3A8KA 5L1IA 1FI4A 1V3SA 1Z2ZA 1GTEA 4HYKA 3GIRA 3OBIA 2MZQA 4ECTA 4QWEA 4P2SA 3R7NB 3V6HA 1GX6A 4A8YA 2A3JA 2HNYA 2V63A 1WWHA 3T6JA 3B4MA 1LW2B 1S5ZA 2MEWA 4L73A 4B9NA 5IC6B 1NK5A 3P5TL 4DR2J 3H2VE 3HI9A 1KRPA 2UXBF 5EUHA 1F1BB 4LFBJ 2KFNA 2VV5A 3LA0A 1NCLA 2ABYA 3AD9C 4RW7A 4F02A 2GC8A 1TAUA 1HD1A 3UPFA 3G8SA 4ES1A 2DGTA 4QR0A 2HFSA 2HFNA 3TARA 1M5SA 2J7KA 3TVYA 2KXNB 4NLXA 1RWUA 3QO9A 1HBNB 5DRKA 4DUZF 1HL6A 3C19A 2YKOA 3TUPA 4EYHB 4Z2XA 3T1HJ 5F8LA 2NUHA 1NHVA 5G0RA 3OW2R 4ZN1A 5F8HA 1RCOB 4MKBA 3MD1A 1Y9OA 1FWKA 3DDNA 2WSEC 3J7ZT 4Q7AA 2OP5A 3MR2A 4F67A 1VLOA 2A2DA 1S1WB 4C8MA 1XIQA 1WSVA 2ZC4A 3K8WA 2HGMA 3LP2B 2QTWA 1ZAWA 1SUQA 1XTZA 3QRPA 2V4QA 4EZ6A 3OL8A 1K8AT 2MKKA 1C0UB 3Q89A 4ALZA 4QPXA 3LP1B 3E01A 2KN4A 1W2IA 2BKPA 3DC2A 1FE4A 1X4HA 2K1RB 2LFVA 3BBFA 5J2QA 1S59A 3N6LA 2G13A 3PR5B 1UEKA 3TW0A 3GCWP 4FP9A 3LH2S 1VYAA 2P6SA 3LP0A 2D1CA 1HBOA 2XGQA 4ER8A 2EPIA 4AL6A 5D0RA 1F3VA 3IS9A 3D0IE 1QTMA 3PW5A 1NMEB 2V68A 1T9TA 3R5BA 4OJ1A 4Q43A 3T5HA 3C66A 4DV1J 2HK3A 4U96A 3D3BJ 3DRYA 2EVZA 2F63A 4I6WA 4IFVB 3OD2A 5ETPA 4ZPAA 3GB0A 3PEHA 4WF9Q 2HLTA 2VG7B 3Q8UA 1EB0A 2QSWA 2MQMA 2HHXA 4LF4J 3OTOJ 4K2XA 3M6WA 4ELVA 2XMWA 5DO2A 1EIYB 2UXDF 2DRAA 3CCUS 4FYYB 1URRA 2B4VA 3UCZP 1GX5A 4NA3A 5D3GB 1VBYA 4Y65A 2B8QA 4LRCA 1NNDA 1APSA 3MR3A 1RT3B 3GILA 1NDLA 1ZA1B 3G87A 2VDHA 2GQQA 1EARA 4IQMA 4HH0A 1S76D 8RUCA 2WCXA 3BEGB 4R5PA 2HIYA 4ZCKA 3W1YC 5D8HB 3ICLA 3JQMA 3KMQA 3TJAA 3TA1A 2VB6A 4NYOA 4RNNA 1SL2A 4A8MP 5E3PA 1CLFA 3LWMA 3DGVA 2W9BA 2BA9A 3EE3A 3NOCA 2P2CB 2AJ2A 1LFWA 3FBFA 4XDDA 2ZH4A 2HHQA 1VS3A 3MR5A 4LF2A 2W2PP 5C42A 3DGPA 1E6VA 4X66F 2MQLA 5RUBA 3MURP 2GIFA 3E3XA 1X4FA 2W9CB 1FK9A 3PM9A 3EX7B 2BV3A 3R5CA 3OQ2A 1FWLA 2OKQA 2Z30B 1OYDA 4FYWB 2FVSA 2JEJA 3HJFA 3Q8SB 1HNWF 2WVFA 4C11A 4RWWA 2MSTA 4UOHA 2D74B 3L7OA 4J37A 3CJQA 5GMKa 3W65A 3MFIA 3W63A 3ZZYA 1RTJB 1NXIA 3Q8RB 4KHMA 2IA0A 1WDDA 2DNNA 2N7YA 1TKXA 5EHHA 1FRXA 1UW4A 4N7TA 4CLTA 4EI2A 1HA1A 1XMOF 2BEFA 2E66A 5I3QA 5F8IA 5IS2A 2KFYA 4HKQA 3LUYA 3GU0A 2V34A 3T5KA 1K9MT 1FX2A 1D3WA 2FJXA 2QT7A 3J7A1 4ED8A 5A8RB 4DCOB 4W4MA 5ETSA 5K8NA 4N76A 4PPDA 2MKCA 2DXEA 1PIEA 1NU4A 1FVSA 2DNQA 4PWWA 2MKHA 1JLFB 1FF2A 3O6QA 1S48A 3PV8A 1NSKL 1WELA 3HVAA 3QFHA 5CA5A 2RUSA 4X4PA 3OSPA 2E7WA 2Z0GA 1TFWA 5HATA 4Y2AA 3QT6A 2ZBRA 1XMQF 4NYZA 1U24A 1Z2LA 3AA8A 3DRPA 4QIWD 4D3GA 2BRKA 1JJHA 1EP4B 2CXEA 1RI7A 2OPSA 4UTGA 3WZ0A 2EC2A 2DBBA 2QC3A 3H2LA 4DQSA 4F50A 1NB2A 4J9OA 4JI7J 1O8BA 4GKKF 4QR2A 1VRUA 1HNIB 1RHQB 1UW9A 1N33F 1Q95G 2DGUA 3H5XA 5AXLA 1XK8A 5L9NA 4DR6F 4CLPA 4ED3A 4OHVA 3FCVA 4ILLA 2R7OA 3I5BA 2R8GA 4P52A 2XLJA 5MAOA 5J2MB 2HVDA 4OJGA 2CJAA 3F0NA 1MROB 2H4WB 1X5TA 4O0NA 1XC9A 4DL5A 2YY3A 4O4GB 2V8DA 1T9YA 3R1HA 2CIMA 2AGQA 3CCZA 3CIMA 3P49B 3LW5C 4PKDB 2CQBA 1HW9A 1TELA 1XEZA 2J5AA 1S6QA 5A8WB 2E9TA 3TNVA 1NJYA 1JLAA 2W9AA 3OXLA 3CF5Q 4KGXB 1R27B 4U6PA 3O2IA 1WC6A 4DEZA 3CGIA 1OSCA 3C16B 5DG7A 1ROFA 4I2QB 5CHCB 4LSNB 4PAAA 4IG0B 5F0WA 4RW4B 1R0AB 4I56A 4C0HA 1F9EB 2BJ3A 2QRRA 1IKVB 2P6TA 1TV6A 3TJ9A 1P1TA 4JI8J 1SBRA 4YB7A 2ZM6J 3VAHA 3CJ2A 2IHR1 1LWCA 1U0HB 4FVMA 1UA0A 3CJ3A 3MTKA 3MECA 1P8GA 2ACMA 3I9V9 2AU0A 4RLEA 2ASLA 2VOPA 2PGCA 5C2GA 2HNZA 1RCXB 2E1PA 4X64J 2GVDA 4O4RA 5T7LB 3ZO7A 3KG0A 2YKNB 1X5OA 1GT8A 5D6GA 3VQTA 1L3UA 1N5VA 4J9VA 4G1IA 3NGRA 1UP1A 3ILOA 2K7KA 5IQ6A 3CB4A 3UWTA 1IWGA 2VBXA 2D9PA 3ILIA 1WKJA 3BS9A 1JXLA 5A6PA 2MGZB 2XMVA 1KOOA 3PIOQ 1SKSA 3TZZA 1LXNA 2H5EA 2HAIA 4L76A 1FTCA 4P7VA 4OZ5A 3AB2B 2QLBB 4DPWA 2Y1RI 2AYBA 4NYPA 1JNRB 1IBKJ 4CLKA 4DV0F 3KKFA 4A8WA 3GFYA 1S49A 3TEHB 3CXCR 1K73T 3CMES 4E98A 3BPSP 2LEPA 2Z58B 1MU2B 4CH1A 2IRYA 3ONQA 2GGPA 2AW0A 4MFBB 4EBDA 4YHHJ 1WSRA 2LU2A 3C8YA 4OYPA 1GXUA 2O67A 1U2FA 4ES2A 5L9XA 2AT1B 1DQ8A 2MZ1A 3MTJA 4IYQA 4RUCA 2R42A 4WK1A 2WZ1A 2CQDA 3K5NA 5LMNJ 2BW2A 1DY3A 1B70B 3C15A 2A0FB 4NLUA 4NEYA 2NPIA 4Y2KA 4YN3B 2F4VJ 1U49A 3GYXB 2IM0A 2XHWA 2EK1A 4DR2F 2CPHA 2R2TA 5M2RA 5DG8A 4LFBF 1T03A 4DS5A 2PA8D 4LF9F 2RDJA 2W2NP 4TQSA 2KG0A 3G6ES 1ZPWX 3ITHB 3NAIA 1PJ5A 3PYFA 3S01A 3M8ZA 5KT3A 3GZ7A 2F9DA 4CO1A 2HRYA 5HROB 4WFXA 2VFRA 2FUG9 2OAUA 1FERA 2V9KA 3T1HF 3NMAA 1WEXA 3UNGC 3HFVA 3HVRA 1ZETA 1PJ6A 5E33A 2EG2A 1SH2A 3M4XA 1M1KT 2N4CA 1OS5A 1TKTA 1VC5A 1SKRA 1VQYA 1ZZFA 3CNQP 4M5MA 4P2MA 1VGYA 3THPA 3DRSA 3NCQA 2HBYB 3IBFB 1LV5A 2VU5A 2CQ3A 4ETXA 1R7IA 1UVNA 3K57A 1Z4UA 1U6BA 4ZPTR 5B0AA 4LF7J 2XWXA 1IKXB 4B3MJ 4FF3A 5J1PA 2IYIA 1FXDA 3W66A 4DFJA 4WCEQ 4WE1B 3FZ2A 1R8AA 1T8EA 3R97A 3ZZUA 3HKZD 2UUCJ 1N34J 3RGIA 3M30A 1F9HA 4LIWA 3MOJB 2CA9A 4OLOA 3OL9A 1S1VA 1DFDA 2ZBPA 1Y00A 2CPYA 3BQ0A 4WKRA 4ED7A 4OX9J 3AHPA 1Q7LB 4DV1F 1XERA 3GFHA 2PMHA 2R7TA 3M1VB 2H9ZA 3DYAB 1U1QA 2XYGB 1JLGA 2ZH2A 2B43A 2ZJRQ 4LF4F 3OTOF 2GZOA 2W1BA 1D9AA 1V6HA 2EEYA 2MHNA 3IGVA 1VQ9S 2KKHA 2ZWOA 1SKUB 2NXUA 3ZTOA 4ZVUB 3A13A 5D4PA 4DSIA 1S77D 5D4OA 3DLBA 2GMJA 4PXBA 1HQEA 1L3TA 3OSNA 3IMQJ 1NKCA 2A2CA 4MIAA 2I1RA 2W8KA 5HLFA 1O51A 2XSJA 2F4FA 4F3QA 3UDCA 4DS4A 5EWEA 2M5YA 5HMXA 1C1CB 3ZZPA 5I3UB 3T5LA 2GVZA 1PKUA 3SFGA 3BQ2A 4OZNA 4LR7A 5JUMA 2RHSB 2UP1A 3PYEA 3MEGB 4KE5A 5J1EB 5CD4A 1TUVA 2YWFA 4LVNP 5DETA 2IM3A 2LEAA 4ZP6A 3FJ2A 4LFCF 4H4OB 3BPDA 1NH7A 3KJVB 4TN2A 1MW7A 1S9EB 4FDFA 1Q1KA 2GFFA 1UVMA 2V8HA 2OPRA 2KYZA 3NS7B 1Y5LB 2BXJA 4QYZJ 3HP6A 3N6MA 4HHHA 4JI6J 3UN2A 1U2CA 4DL7A 4RW6A 3QYYA 1UWBB 1Q0NA 4KH0B 2BJ9A 2CNNB 4WU2A 2PMWA 1GXTA 2IC3B 3ULHA 3MMBB 3M8QA 2BE2A 1RT1B 3K17A 2ADCA 3VAFA 3C2PA 3D1HA 3FMBA 1N56A 4QJVA 1KFSA 2P8IA 1BLUA 4FS1A 4LF8J 2DGWA 3MF5A 2LQBA 1M90T 2L41A 3IWXA 3AFGA 4DR5J 1FCAA 2AD9A 4ZVPB 4EWTA 4DPTA 3A8JA 4Q0BB 2YNFB 3AXMA 3R5DA 2M9KA 5IV3A 4OZLA 1RXOB 4KB7A 3A1YG 5GADI 1RT7B 2ASJA 3NBPA 4URQU 2OPQA 2Y1IA 1S6PB 1I3OB 4WIQA 1RU2A 2V67A 2KRBA 3GSIA 3SZ2A 4HI1A 2X1BA 2W01A 3P45B 4ED6A 3TVKA 3NL0A 4P2FA 3RTVA 4HL9A 5L1KA 1HYSA 3NGSA 1F0XA 3IWLA 4NCBA 5B08A 3OV7A 2Z57B 5CH7B 2F1FA 4JI7F 5E3QA 1DBDA 2MQPA 4ITSA 4USTA 5CZXA 2DO4A 4ZLLA 4MYUA 2VC0A 2ZH7A 3B78A 4O3QA 4NMXA 4AYBD 4M5IA 3N4WA 1U26A 5K8PA 3JTPA 1U6FA 2VBYA 3SQOP 3TRGA 2AQ4A 1WTBA 5KOXA 4QU6A 4PYAA 1JKHB 2CQIA 1N5YB 5M2PA 2CAJA 3M2VB 1SVDA 3EICA 3UI3A 1N32J 1PYOB 3IR7B 2C3OA 5CQGA 3MPYA 3X1LB 1NZ8A 1DTQA 3CE8A 2JLFA 3O8WA 1TL7A 2RDDA 4RJVA 2DNKA 3GJRB 1QVFR 1UFWA 3O5TB 1WI6A 3KTQA 1O5JA 3ZNUA 1CEZA 1RABB 2QL7B 3UR3C 1RBLA 2WOMB 1JLCA 4BC9A 2EW9A 1NHKL 1R8CA 4LREA 4GC7A 1KONA 4QW9A 3G71S 2E5GA 1Q8LA 5HO4A 1IJFB 3QQCD 3GONA 4WBFA 3W5ZA 1KBRA 3BBBA 2XTJP 3PW7A 2J7UA 1JMTA 1N6QA 2YX4A 2GJFA 1Y5NB 2B6AA 1CJVA 1JJCB 3LANA 4JI8F 1R0BG 2ZM6F 3P5BP 1JLBA 4V1Ak 4DFMA 2ZEJA 2BE9B 1B64A 3PXGa 3I5AA 4K4UA 3CCRS 2HNDA 2ZH5A 2L48A 1U09A 2KM8B 3KK1B 2VA2A 3HFKA 4E8UA 4X64F 1IWAA 3KXDA 4HH1A 4O23A 4KGZB 3BN7A 5IQQA 4A48A 5IM0B 1FEHA 4K4SA 4FBUA 1U1PA 1Q16B 4CH7A 2C2DA 4NASA 1TTHB 3D1OA 3G96A 4ANDA 3IG1A 2J76E 4A8KA 5ETNA 3HHKA 2JZ5A 1L5UA 4F3MA 1YI2S 1QD1A 2HZAA 1KWMA 3LGNA 4ECZA 5FJ4A 2BQRA 1B3TA 4CH0S 1Q53A 2ALYB 4OYIA 1WEZA 3DCAA 4ID5A 2CDQA 1RAIB 4KIAA 4QIGA 1RACB 3K89A 1SH3A 1HBUB 1RTHA 1CJKB 1E6YA 1T9VA 5EGYA 3EWGA 3UVJA 3MD3A 4MK7A 3DI6B 3KLIA 1HMVA 1WC3A 3NNAA 2VH7A 1AROP 1T94A 2F9JA 2XZTB 4ZHRB 2BBEA 5F8NA 3MEEB 3QMQA 2ZC3A 1J27A 5LMNF 3JSMB 2NCKL 2MXYA 5K14A 4PWDB 2PEHA 2P5VA 4M5GA 2JX2A 1LKZA 4I68A 2Y9HA 1VJQA 1JLEA 1TUWA 2XLIA 2VQFJ 2I8EA 4NLVA 3KK3A 2F4VF 1NH8A 5LOQA 4ELUA 2R4FA 2BM1A 5IT4A 2M8HA 3NGUA 1X31C 2MLXA 2YWKA 2J9DE 3DFEA 1IR2A 1D0EA 1YJNS 1QAIA 3MMAB 3RBEA 4USJC 2IYGA 2BABA 3CCMS 3DRRA 4OYBA 1SJFA 1YRTA 4QIEA 4KTQA 4OFZA 1I51B 2ZH1A 5CYQB 3IRWP 4DCPB 1HPZA 4O44B 2FHJD 4QYZK 5KFJA 2A10A 3PIPQ 3W5XA 7AT1B 3MCNA 2VKZG 5HL7Q 1WACA 5F8JA 4NLSA 5KG4A 1EKSA 4JV2A 1UVJA 3H5YA 2XZWA 3G4SS 5FLXU 3BGOP 4DHVA 3MMJA 1FJGJ 2VA3A 4OV1A 1AYEA 3PKYA 1WOOA 1TL3B 3QNWB 3CD5A 4JI0J 1YJWS 3QIPB 3CEDA 2HFVA 3D6TB 4CO0A 4MK9A 4J9KA 5KG1A 3MM5B 4FYVB 4KV8B 2AEJA 1Q82T 2B9XA 3MM8A 3PNIA 3VVTA 4LF7F 2XMAA 5J1NA 1SH0A 1X4AA 1BQNB 1BQMB 3KLHA 5ETRA 2UUCF 3W3SA 3CCSS 4I0WA 1SB6A 4C48A 1N34F 2HVZA 2C2ZB 4CZCA 2QMXA 4FN5A 2DGVA 2PMZD 1D9FA 4WZQA 2KU7A 1U45A 3R6LB 3CWJA 2G1HA 3D0HE 2PI5A 2JC1A 4QWBA 4OMFG 3EVOA 4DUTA 3ZTSA 2OSQA 1J5OB 4OX9F 3TZXA 3CC2S 2ZBCA 4K4ZA 2B51A 2ILYA 4F7VA 4ZVTB 1FDNA 1VIOA 4ANCA 4DUYJ 1NK8A 5H9EJ 1FFWB 2VL1A 3MPWA 3ZFVA 1TVRA 2RQKA 2CZVC 2PFDA 1YJRA 2DH9A 3QT8A 2YPZA 3JB9k 3Q8YA 4UZCA 4B9UA 4P7TA 4ED0A 3FZBA 1LWEB 1W7WA 2CQ0A 5DZ6A 2CFXA 2CQGA 5EN1A 3F73A 3TR5A 1CJUB 2UXCJ 4MK8A 1JLQA 2YWEA 3PG9A 3HJVA 2ZJPQ 2OH2A 3RUBL 5F3ZA 5EX3A 1LW2A 3V6KA 1QVGR 1CC8A 2HBZB 1PGZA 2H48B 5ADZA 3FC9A 3L4BC 3DLKA 2ZITA 1TK0A 2W24A 3UCUP 2D69A 3IM8A 4N8NA 3OFGA 2AJFE 3ENWA 2XNRA 2C2NA 1WOSA 3IA0A 1HBNA 5KFHA 1C0TB 4Y00A 3JSRA 3VGVA 1QAXA 1Q8BA 2F3JA 4F25A 1Q79A 4RUBA 2JWNA 4WTOB 4Y0FA 3PW0A 4X4QA 4DL0C 4C3MA 4YR3A 1PSDA 4N5SA 2VIHA 4ECSA 5A2QY 2AJQA 2MMYA 2H51B 5HQ8A 1S1WA 1YK9A 3MM6B 2X3GA 2XM3A 4G1QB 2HMIA 2V8GA 2L08A 1NJWA 3LP2A 1BD6A 2H5IB 2PA3A 2AYMA 3AJ1A 4OX8A 3M9NB 1C0UA 4G65A 2M70A 3H59A 3KHGA 2HWIA 4W98A 2G2YA 5HK4A 1SPBP 3LO3A 4DFPA 4DR7J 1ZTWA 3MCMA 2Z2YB 4NRTA 1UKUA 2K1RA 5JVHQ 1FX4A 3OR1B 3VAGA 4UQTA 3HHLB 4DR5F 2N82B 2JOQA 1TAQA 2DITA 3M8PB 2UUWA 2DEIA 3H4BA 4CLYA 1RADB 2VUGA 2FQQB 5LJ3Y 1RWPB 1R8HA 3MOZA 4GMKA 5KFBA 1YHQS 4CLLA 3AT1B 2Y1JA 3KFWX 2H5JB 4NL5A 5HSPA 1L3SA 3QJJA 1VI7A 1ITPA 5E3RA 2CADA 1RU1A 2EI5A 4FBTA 1AZSB 4IFVA 4O3SA 3RYLA 2B7BB 4TU7A 3DLEB 2N7CA 2PC6A 2VG7A 3C3LA 2ZHBA 3MCOA 1TFYA 2QYCA 4K59A 4OHZA 4C8KA 2O3DA 1HD0A 4DI6A 2W2MP 2E29A 4OHYA 1HIYA 5IT0A 2ZHAA 3PO4A 3CCWA 3M32B 2EKYA 5C25B 2YKMB 1NRKA 2Z8QA 3DM2B 2KI2A 3JTOA 4NLYA 4RNMA 5D3GA 3GV5B 4USUA 2BOAA 3D6FB 3MAAB 1RT3A 2DT9A 2RRBA 1UCNA 2OPPB 1R6VA 1GMWD 1HI0P 2CJXB 5E3CA 3TX8A 1WC4A 2ATCB 3NCPA 3QGPA 2LQ5A 3ISND 1N32F 2OLWA 2HRTA 1XNQF 1GEHA 2IDEA 2D3O1 4U7UD 3LPEA 1FEEA 4JI2J 4B08A 1RWMB 4B9LA 4OYWA 3N0VA 3MR7A 4DSKA 3BO2A 4Q44A 3R5JB 3FCWA 4CI0B 1WOPA 1S0VA 2WRMA 2QE5A 2W9CA 2HS4A 2OGUA 4QIVA 3M8YA 2N4DA 4J9UE 4Q8EA 3NS5A 2CZ4A 2I9SA 1GH8A 1YRUA 2UUTA 3D66A 3HDSA 2X1AA 1NPPA 3ETMA 3HMJG 1RTJA 1KC8T 1KEKA 4I6YA 4FF4A 2K8GA 4P6QA 3GFZA 1URNA 2E7VA 1JB0C 4HT7A 3GR1A 4ZJLA 4K4XA 4O3OA 2DRDA 1NJZA 1HHTP 2I38A 2Q3PA 5HBMA 3BJYA 1U8WA 3OL6A 3W8PA 3CULA 3HSJA 4YS2A 2R7QA 1I1GA 2Y8YA 4J9MA 5A8RA 1RWNB 5A76A 1OJ4A 1YG0A 3GPAA 2MQOA 1BXNA 1SJ4P 3EM1A 2MQNA 2IJRA 1SC3B 1VOMA 2V9WA 1JLFA 3DLGA 2QGFB 5SZTA 2F65A 2Y3YA 3DN9A 4QOTA 2BANB 2W7OA 5JJBA 3DKDA 3PX4A 5K8OA 2KT5A 5IXUA 4USHA 2CPIA 3AOAA 1Y10A 1YZ6A 4CCHA 5LSRA 4OI0A 3W7BA 1EP4A 4LF6J 4YR0A 4YUDA 2CUYA 3ZZ0A 1U4BA 4NA1A 3Q2SC 1TZ0A 2BJ8A 2CYYA 3QZ7A 3UQSA 1HNIA 4X4TA 4EK2A 1YJTA 2KHCA 5KFQA 2BACA 2DNRA 5KFVA 5H9EK 1MN7A 2NSBA 2GQCA 2ASYA 5IWAF 4RNFA 4QWCA 4I64A 5HMWA 2IM2A 2AMCB 3MPDA 4PWUA 5J2MA 2HZVA 4RWXA 4OYZA 1MROA 1CQMA 3H0PA 4OLPA 2V0NA 4U8YA 2FC8A 4QWAA 1WORA 4ZJQA 4O4GA 3DU6A 4JV5J 1REVB 4F3OA 5BYRA 1FRMA 2VF3A 1Y11A 1RP5A 4Q8FA 2AYEA 2WW4A 4J91A 1H7XA 2XNQA 2GJ2A 2VQFF 4G6VB 1SQGA 4RL1A 5A8WA 4TU8A 1HWKA 4KRWA 3OVAA 1T02A 3E01B 4LFAJ 4ZOSA 4DV5J 1K0TA 3CDWA 4FPRA 1DTTB 3NAHA 3QAUA 2RKIB 3PFEA 3GQCA 2CQ4A 5KG7A 4YDDB 3CJ8A 5ETVA 3T3FA 3C16A 4I2QA 4LSNA 4IG0A 1H73A 1JWWA 3A8EA 3D7SB 3K58A 4QR1A 4IR9A 1R0AA 2QA1A 3I96A 2CPXA 1IKWB 1IKVA 3UN3A 1SI9A 2WBRA 5HVHA 3QRRA 2DIVA 3VQSA 4K2JA 4PG5A 5THWA 2BE7D 3H25A 2HBRB 1XR5A 5D77A 5KFKA 2YNHA 3OPKA 1VK3A 2A6MA 2YX1A 4LQ3A 2FGCA 1FJGF 3HFZB 4JI0F 3S7RA 5T7LA 1S0NA 3TA2A 5MLCV 1P9QC 2AP6A 2EWHA 1HNXJ 4NLDA 1PAEX 4C2MA 2BX6A 2Q6CA 1RWKB 3SFUA 3FQLA 4TKTA 1KSPA 4MAKA 2XCAA 4MT1A 2W4PA 3FRZA 2Z2MA 4OYOA 2BQ3A 2XULA 2VPZB 2P9EA 4OI3A 3FMWA 3P3DA 2MGZA 1O6XA 2DHAA 1YJ9S 4UQGA 1OSDA 4I2PB 4I7FA 4C0OC 2I2YA 1KQKA 2GX8A 3UDLA 2GQ2A 2WB4A 3EUNA 4DV3J 2LXUA 2MZJA 1N8RT 2AIRB 3DDIA 4M5DB 5I3PA 2LDIA 2BR0A 4LSZB 5KT7A 5AXMA 1VQLS 1VK8A 5AT1B 2QLFB 3M2UA 3HT0A 2I5JB 1MU2A 2VFTA 4A8OA 1F60B 2O01C 3SBMA 3Q23A 2DNYA 5HP1B 4MFBA 1NK7A 5DQGA 3Q2TC 3CJ0A 4DUYF 4H4MB 4XO0A 2EFGA 4QWDA 2IAJB 1HQ2A 5DLFA 1HI8A 4RW8B 1SC6A 1FK9B 4RPFA 5A6WA 3TO8A 2ZH8A 5CZVA 1KLMB 3BSAA 1QUVA 2GAGC 2YWGA 4ZPDA 4C11B 1FWPA 1OQ6A 1ZAXA 2GO9A 4CQ1A 4NLPA 1D1UA 1AUSL 4FNHA 2UXCF 2KRRA 4DFKA 2F40A 3G9CA 4GKKJ 4NI2B 2HK2A 1Y7PA 4J9RA 1N33J 3SI8A 3M7VA 3WDOA 4J9QA 1TKXB 2HAFA 1T7PA 3RAMA 4JOUA 1WG5A 2WVDA 1A0OB 3BH7B 2E1MC 2PSZA 4J7CA 3D67A 3PJ9A 3ITHA 4GVLA 1IKYB 1BGXT 4LJMA 1YKWA 3TVZA 3CCTA 2VG6A 2BOPA 1X4CA 5HROA 4OYAA 3OR2B 4DV2F 4RU2A 2V8PA 2M88A 1ZA2B 1U25A 1IBMJ 3KJFB 3TP2A 2WTFA 1HBMA 4WFNQ 2MKJA 1RLCL 3QPIA 3OHBA 3A3PB 2J6TA 1XN9A 2CJKA 1S72S 4OZ0A 5H1SV 3RAXA 4LSLB 2CRLA 2FJAB 4V19X 4FF2A 3TQEA 3BSNA 3JYTB 2W2QP 5DG9A 1N0VC 2J0XA 4A46A 2NXCA 2H4YB 5LJ5Y 1VIXA 1T0TV 3TUJC 1WF0A 3CMQA 1Y5IB 1F5CA 4FXDA 1ZPVA 4DR7F 4EZ9A 1VRTB 5KFGA 4DBQA 2AWZA 3NMRA 2HFUA 2FJBB 2Q43A 1RHJB 2DISA 4Q2LA 3D9BA 4WE1A 4W92B 2R7UA 1RHUB 1VBXA 4WFBQ 2NLWA 2B5JB 4KBIA 2LU1A 2R8HA 3HZEA 3W9JA 2XMTA 2GCFA 1ZOTA 4RZRA 3IGNA 4OI2A 1QE1B 4TQRA 1X5PA 2M8DB 3TAQA 4CT9A 2PDAA 5DDQC 2W25A 2XEXA 1ELOA 3M1VA 5FIIA 2V4JA 3ZXWA 2XG8A 1YJVA 1JLAB 1AFJA 2FTRA 2BDPA 1KD1T 2XCPA 3ELHA 1RTIB 2FVQA 4DSJA 2FJEB 2CQCA 3DMJB 5DQHA 1OY6A 2KDOA 5E0OA 2DJWA 5LT5A 2VG5B 4WYLA 4DV0J 2KM8C 3BDPA 4Y2CA 3BSCA 4LR8A 1RAGB 1G1XA 3DLJA 1BWVA 1JJ2R 3NP5A 3VWSA 3C6UB 1KTVA 3W9HA 3Q86A 3AD8C 2CJYB 2ZUAA 4P72A 1C1CA 3MM9A 4CP5A 2HGNA 1CVJA 2FYXA 1RK8A 3WBZA 5I3UA 9ATCB 1DRZA 4EBCA 2YWHA 2C3UA 4LF5J 3MEGA 3TZYA 1FFSB 2YNGB 2X1GA 3CCLS 1VHFA 5HQMA 5GAHU 3MZIA 4H4OA 3Q22A 4B02A 2DXFA 3NWGA 2IRXA 5H9FJ 1VISA 3KYLA 3JSYA 1S9EA 3B4DA 1S6OA 3ZZZA 4AQYJ 4OZ2A 1RQ0A 1T9WA 4Z7YA 4OHWA 3JTNA 1UJ6A 3BV8A 3EMTA 4UZBA 1UWBA 1TL1B 2OHDA 1OPIA 3ENVA 4IH5A 1EHWA 2DR9A 4LF9J 4DR1J 5D4NA 2NS1B 3AD7C 2D7SA 3MMBA 4MKAA 2VFSA 1RT1A 2XQCA 3VGTA 3IAM9 2DR7A 3TEGA 1NDKA 2RF2B 4Q5VA 1UJ4A 4RBUA 3A12A 3JSBA 3DOKB 1Z1ZA 2GGPB 2DIUA 4OV6A 4D3HA 2ASDA 1U48A 4ED2A 2OMOA 4DSFA 4L3NA 1HLWA 4KPCA 1PO6A 2HQDA 2NYHA 1NDCA 2UUBJ 4IG3B 2YNFA 1ZS6A 3BKUA 1RBOB 2XMKA 2XY5A 1RT7A 4FPIA 3JQJA 1F5BA 4TXSA 1H98A 4WJBA 5LSLA 3KHRA 2RRNA 3PACA 5M2UA 1J5EJ 1SIZA 4DPOA 1S6PA 1C4CA 1CPZA 4RUHA 1N0UA 2KJVA 4DN0A 2R2UA 3OT9A 1GK8A 4LF6F 3U7JA 4N47A 8ATCB 3B6BA 4ZLJA 2ZWPA 2G0IA 2LLZA 3ZC4A 3NCRA 2RUGA 4G1PA 2HHTA 4JI4J 2FZKB 3WHIA 1VQSA 4CLZA 4ES3A 4ICLB 1S1UB 3AOCA 3THTA 2LVWA 1FNOA 1AUDA 1R3NA 1DQAA 4JI1J 3R2CJ 1RHMB 2XHCA 3PDNA 5KFWA 3PX0A 4IRKA 1N5YA 2IRUA 3M6VA 3UCGA 3M2VA 2K3IA 4OJHA 3BKFA 3O3LA 3UFCX 2DGOA 1X8DA 3KLVA 3BSOA 4JV5F 2DY9A 4Z7CA 5BXIA 3BGRB 4DX7A 3E51A 1NPRA 4DR3J 1HWIA 4LFAF 1V5VA 4CT8A 4DV5F 1B4SA 4NZ6A 4YOEA 4MJKA 2QX0A 4RO0A 5KFXA 1UL3A 3HD2A 3FFIB 2Z56B 2FZCB 1NKEA 2WOMA 2FZGB 2QA4G 2CQ1A 3LOUA 4JBCA 4B9TA 2C1EB 2HBQB 2CPEA 5J2NA 4L72B 2WSCC 4I1TA 2DH7A 2BJ7A 2GHVC 2HIQA 5KFMA 1FKPB 4B3OB 4CO3A 1B0VA 4EGLA 4EU0A 1EKRA 3ZZOA 4CLUA 3E8OA 1P27B 2HRUA 2MKSA 1WTFA 4CM2A 2UVUA 4LFCJ 2V2KA 1H3DA 2IMWP 5KTQA 3KLGA 2ATLA 1FESA 1T95A 1EAYC 1M0SA 4TY8A 3KK1A 3E2EA 3BGLA 3OUYB 4KH1B 1Q8KA 2OEMA 5IM0A 1RHKB 1HNXF 2LXFA 2LQ8A 4ECVA 4MKYA 2WHOA 2DHXA 4X4RA 3DHWC 3TQ1A 6FDRA 2CQHA 7FD1A 1Q78A 4I6AA 4KO0B 4M5HA 2FPHX 2AF6A 4PCQA 4DQRA 4P74A 4ENOA 2AV5A 2LDYA 5HLFB 5B0GA 3TUIC 4DDFA 3MMCA 4PQUA 3PYDA 4TYBA 4KR0B 2HHPA 2ZUGA 1IR0A 2NUUG 4DG1B 1AT1B 4DV3F 1X9WA 3Q0AA 3VCDA 3V81B 5BYQA 2MJUA 4ECUA 2CNOB 1GQEA 1VC6A 4X65J 3OLBA 1TQLA 3GIMA 4WTYA 4C9DA 3CJ5A 1CJKA 3H90A 4OYMA 1HWJA 1S1TB 1N54B 4JI3F 2MLZA 3QT5A 1ICEB 3DI6A 1UEVA 3VAIA 1HW8A 2WONB 2EC0A 4JP8A 3UE2A 2CPFA 2F8MA 2DNHA 4BBYA 4ZHRA 3MEEA 1ZH5A 1QAYA 1RAJA 2F8HA 4C97A 4PWDA 3N5BA 3SDEA 5CCLA 3G6XA 2ADBA 2H3EB 1FXLA 3ILLA 4RUAA 3LTOA 4KT0C 2FLLA 2CVEA 4IRCA 1Y3KA 4UUWA 2IDLA 3RBZA 1LEOA 1C4AA 2RAQA 3CDBA 3LAMA 2XYHB 3TAMB 4DF4A 5AJ3J 3CC7S 4TY9A 2MTLA 3MMAA 2J6SA 2EBGA 1LW0B 1S10A 2VBZA 3ADAC 3J7AN 1U6ZA 5AE2A 5H9FK 4FXVA 3M2RB 5CYMB 1SV5B 1WJ9A 1T9XA 5KFSA 4O44A 1IBMF 1LK5A 3QZ8A 1WUUA 3T1AA 3F44A 2I0XA 4LRDA 3NGKA 3UDEA 4F4YA 1WC0A 4ETZA 5KFDA 3RRHA 4FYXB 4K5SA 1KVKA 3C14B 1TL3A 3CMAS 1P1LA 5IC4B 2AZ1A 3QIPA 1NJIT 4PUOB 1NAQA 3W2WB 2NREA 3KLEB 3ISZA 3MM5A 4KV8A 4DJBA 1IR1A 2XI3A 5DM6Q 1CSJA 5D0EA 1VBZA 3BREA 1KQSR 3U1NA 1ZZNA 4B3TJ 2Q79A 4BHQA 2C2EA 4X62J 4OQJA 1BQMA 5B0BA 3CD0A 2ZNZA 5A8KA 1BY9A 2ZOFA 2UVVA 5DLGA 1OY8A 3BR8A 2RDIA 3P8BB 3U1LA 4KHPJ 5B0EA 1F3FA 5KFAA 1DJ0A 1J5OA 3SYZA 3QSIA 2RQMA 5DM7Q 3HCXA 3JQKA 1FDDA 5GAGU 2HFOA 2F7VA 5KT2A 1UFLA 3A8IA 1YX2A 1FFGB 3HT3A 3VZHA 3SQGB 3EPGA 2FIUA 2MQQA 1NK9A 2GAHC 2CJ9A 4KGMA 1SKWA 2HPUA 1EJ7L 1QUPA 1LWEA 3ILJA 2GW8A 4KHRA 1AW0A 3FK4A 3SCKE 3BO4A 5IZHA 3PR4A 2RD5C 2FJVA 1CJUA 2MZSA 4ECXA 4HI2A 4HACA 5CCMA 3KOAA 2EG1A 3HK2A 3C6TB 1LWFB 1S4EA 2G1DA 4DV6J 3DRXA 4OI6A 3SV4A 4ZPCA 1HQUB 2BJDA 3M8WA 3MAQA 2CZ9A 5C2CA 3PY8A 3C46A 4LF5F 1VHIA 2KVIA 5IT9Y 1DURA 1D8ZA 3I32A 3KUEA 2ROPA 3W5YA 3RR7A 3IR6B 1NK6A 4KY3A 4F0KA 2LQJA 2NZCA 1FJCA 2IVMA 3D28A 2P9GA 3GG0A 3GYGA 2DHSA 2PE8A 4ZVHA 4ZVGA 1I94J 4AQYF 1S4FA 1U0SA 1RISA 5JXSA 4WYWA 1Q81T 1X9SA 1F2GA 1T05B 4G1QA 4K4VA 4CRJA 5AE1A 1VC0A 1U7LA 2M0GB 4WKYA 1SL0A 4DR1F 4F36A 2ZKUA 2JFDA 3LALA 2XS2A 1C2PA 1YZ7A 4NXMJ 3CVKA 1H6KX 4O0IA 5GMEA 1OYEA 5DDRC 3ZNJ1 3QLHA 4IRDA 1IVZA 3OR1A 5LMUJ 1FKAF 4CLWA 2V69A 4LF1A 2MKIA 3MUTP 3R5GA 3S6EA 2OTJS 4P2XA 5D0GA 4NCGB 3R5AA 2HWTA 1IJEB 2OIHA 3SCLE 3TX0A 3BQ1A 3M8PA 3TOQA 2UUBF 5DS7A 1S0MA 3PW4A 3R27A 4M5LA 2ZBQA 3T19A 1IBLJ 4XK8C 4ERDA 3QWPA 3TJ8A 3AQPA 4OI1A 3B54A 4USKA 3K5PA 2LCWA 2IA6A 3HF5A 1GFWB 1J5EF 2XYPB 1SIWB 1N88A 2RS8A 1HFEL 2WVCA 1AZSA 2JEIA 1GAOA 4KGVB 4RU9A 5GAEU 2QMWA 4I69A 4Y2IA 2DD8S 1YDLA 1RAHB 4RX6A 2AJ4A 2RE1A 2VODA 1PYSB 4F4KA 5L1LA 1J2VA 3NGDA 3M32A 1GXLA 4RNOA 1KDNA 4JI4F 1WNEA 1WHVA 5C25A 5C5JA 1PC5A 2BRLA 1KP6A 2X7IA 4HTJA 2AKWB 3AXKA 2QN6B 2M52A 2BVZA 1FRKA 5HJXA 4JI1F 2CPJA 2OPPA 2PEBA 2UV8A 4U67Q 4PQAA 4ZIWA 2L9DA 3BKTA 2QMUB 3MUVP 4KGKA 2ZZNA 2GMHA 2JL9A 3NS6A 3GWCA 2IY5B 3NKYA 1G2EA 4CNYA 2VJVA 2AYGA 3M6XA 4URGA 4NCAA 4USMA 2KL8A 4ILRA 3GE9A 4ZVSB 2LKZA 3TA0A 4IH6A 1I6JA 1SCJB 4DR3F 4CTAB 2BYCA 4DX8H 4DXLA 3MM8B 2RQ4A 5HMYA 3CJKB 4GVBB 2IFXA 4DZDA 1Q4RA 2N3OA 2DHGA 4A8SA 3A3OB 2IVYA 1YBUA 2C2OB 2RU9A 3KLHB 1RT6B 4URSA 2X1FA 3HHEA 3RRKA 2BZ2A 2MYFA 2KXHA 3QRQA 2JDJA 4PABA 2RNEA 2QFIA 3CJSA 3HHLD 2C22A 1Q7YT 2PO4A 4K4TA 3DOMB 3KNGA 4EEYA 1XR6A 2OTLS 2B7CB 3G82B 1FD2A 1UPPA 4YB5A 4WIIA 1KN6A 2W8LA 2KVQE 1D9DA 3QIDA 1CS4B 3EZ5A 2ZOMA 6AT1B 1YBTA 1RT5B 3GSDA 4UUXA 2V50A 3B8HA 1HARA 2QL9B 5IFMA 5ETLA 2ROGA 3RRGA 3RJMB 3HM9A 4U9RA 4BWMA 3VALA 3QSYB 1PJ7A 1S1XB 3TAPA 4WXOA 5HJYA 1REGX 4U7CA 1JLQB 2BANA 5F3TA 4DSLA 3L7UA 3P4UB 3HPOA 3OFHA 1IQTA 2KFZA 2ZOGA 4WP8A 2XLKA 5KG6A 1Y4ZB 5DJBA 2DHHA 1VQ8S 3IFEA 4YY3F 3J80Y 3W2VB 1PBAA 4ZP7A 5D0HA 3SXLA 3BR9A 3V6JA 4RNHA 3DLKB 2XY6A 1VQ5S 4AL7A 5AXNA 2AZ3A 2AX1A 3JXOA 4X65F 2DPIA 1XJWB 4JB8B 3DU5A 5L38A 1CULB 3GV7B 2YKPA 4ZMMA 5KFNA 1ULRA 2YQ0A 3Q8VA 1KFDA 2HGLA 4P73A 1BHNA 3OLAA 5HANA 2GJIA 1NM2A 3JAMU 3UD4P 2WAQD 1RLDA 1IM6A 2HMIB 1REVA 4XAKA 4KKOB 1M1HA 2C2RA 1X0FA 3FBEA 3ZTQA 4A4JA 5F8MA 1MN9A 3POTB 5GMDA 3MR6A 4DU7A 3CIZA 1DTTA 4IFYB 2R2RA 5KFZA 1VR6A 2RKIA 3GFXA 4DU8A 2ACYA 2C3PA 5AJ3F 3ET6B 2JFKA 1DLOB 4ZDNA 1BE4A 2XS7A 4PG8A 3D0GE 2B4OA 1WEYA 2BKOA 4C4WA 1R31A 2QYGA 1RB0A 1TMJA 3NLCA 1XNQJ 2NXJA 3MCSA 1HHQA 3KNAA 3H20A 1IKWA 3VGUA 1TKZB 3A3NB 4N8OA 4BWJA 2YXLA 1VJWA 4DX6A 1P6TA 3IRXB 4LMZA 1VQ7S 2PT0A 1QSSA 2MB0B 2E5JA 1VDHA 1K0VA 3PFOA 2GIRA 4DZ6A 1R8BA 3WIVA 3MEKA 1LNQA 3R7SB 4GKJJ 3PRBA 1HNVB 4A8FA 2RILA 2YX7A 2RRAA 4NLWA 4JV0A 1LQ9A 2QLWA 4YB1P 4B3TF 2QV6A 5HN0A 4X62F 1UJ5A 2HG4A 1BQXA 3QJPA 2ZH9A 2ZH6A 3I0SB 3KWMA 4I2PA 2DK2A 4ZVRB 4KHPF 2I6WA 3RG6A 1TL4A 1RTDB 2YBVA 4RBTA 1SXLA 2FHJA 2PD1A 4DWIA 4M5DA 3H8YA 3QT7A 2HQGA 3OFFA 4K0KJ 2RIJA 2I5JA 2NQPA 1RYRA 3GIKA 4FKYA 5HP1A 2AGOA 1PAUB 4X4UA 1PBUA 2COLA 2DR5A 3V4IB 3NGTA 2YQ3A 4ZPVR 2J0SD 4H4MA 3MPVA 3NG8A 3CJTA 5K20B 4F2RA 3KK2B 4IOAQ 1RHRB 2IAJA 3GYNA 3I82A 3GMGA 1GTHA 4RW8A 4LIRA 4HHUA 4ZVFA 3VV2B 1Q86T 1TR0A 3GR0A 2BJ1A 4GC6A 2RMLA 4IDKB 5I42B 1YTYA 2CWKA 1F2HA 1FDAA 1KLMA 1U1LA 3ZTPA 1M1GA 3O44A 3ISNC 3CJRA 5HAOA 4IUFA 2CG8A 4P75A 2HHSA 5KFUA 3D5MA 4DN9A 3R7BB 2VJUA 3F41A 4CIOA 5A0YB 4TU9A 2VASA 1KQFB 4NI2A 2MQ8A 2DNLA 4DV6F 2FD2A 3VVUA 4K8RA 2GHWA 5L39A 2KT3A 3NXZA 2IM1A 1HNZJ 5BR8F 2XSFA 1CJTB 5IWAJ 2B56A 5HBMB 1FT8A 5EWGA 5GAHI 2KJWA 1IKYA 3UD3P 1IM4A 4IOBA 1IBCB 1UVLA 3DLHA 4I4BA 4ANEA 2YH1A 2VFVA 2IVFB 2UV8G 4PPZA 1SL1A 1B7FA 3OR2A 2FB0A 3RU0A 2VONA 1VQKS 2GHPA 4IH7A 2BQUA 5KFOA 1OWXA 3DLGB 3WC2A 1I94F 1H2TZ 3EGWB 4LSLA 1YGYA 1R43A 3RB0A 3EVWA 1U1MA 4DCJB 3JYTA 3L7PA 3DLLQ 2OD6A 3AH6A 4PYDA 4QZVB 4OL8A 4X4OA 1A6LA 4NXMF 3R1LA 1LWXA 4PR6A 4AT1B 3W64A 1C1BB 4HHJA 4LR9A 1U1OA 2DB1A 1KQGB 1VRTA 3HO1A 3OTBA 5LMUF 4AUKA 4PEOA 4EMDA 1NDPA 1VCTA 2B5JA 2XZDB 2XMJA 4CYUB 1OO0B 1X4GA 1N52B 4OYXA 2AX0A 4ZJOA 4Y2MA 2YNIB 1VLYA 2ZKTA 1IBLF 1QE1A 3FCHA 2CQ2A 3TWZA 4HLBA 2FHMA 4PXDA 3BB5A 4TLRA 2L3MA 3SSQA 2RJZA 1EETA 4EO6A 4DMZA 1NJXA 1TU0B 4DL3A 1KNZA 5B7WA 2J8SA 2JH3A 4R8UB 4K4YA 1ZM4A 4NLTA 1RWWB 2DH8A 5ETOA 4NLGA 1YITS 3Q24A 1RTIA 2G2OA 1IQZA 3CO0P 3DMJA 1LXJA 3M8RA 2WK4A 4J9SA 1NEEA 4B3RJ 2G9OA 1ACMB 2VG5A 3V2UC 4FF1A 3I0RB 4DV4J 3GV8B 4LRBA 1EQMA 2FY1A 2M7SA 3PRDA 3MUMP 1S9GB 5KFEA 4EYIB 3C6UA 5FDLB 2M3DA 2MKYA 3SV3A 3D6MB 4KSEB 4ZCLA 3TZWA 3KMSA 5HVGA 5HI7A 5LM7E 1NBEB 2YNHB 5DZ7A 2Y8WA 4CNZA 2IJNA 6FD1A 2LA6A 4QCLA 1OIAA 2DRBA 2YNGA 4JI5J 3GIJA 1V3ZA 3PJXA 4JUZA 1ZM3A 4YP3A 7FDRA 4DQQA 3KJNB 4NWBA 3K59A 1S12A 3OXFA 2CQPA 2E9RX 5D15A 1D09B 4KYZA 1PYTA 2LXIA 1T9UA 1RWVB 3WQPA 3MI7X 3RW7A 1RUSA 2YH0A 3I31A 3PEJA 2KG1A 1VQPS 4OX7A 1AB8A 5E2QA 1TL1A 1VQ6S 1ZAVA 4I7FB 1U47A 4F4WA 4KPYA 5DQIA 5C24B 1NB7A 5G4DA 4NA2A 2E9ZA 2E44A 1RT4B 2RF2A 2PN6A 1GMWA 3AOBA 1R89A 2UVRA 3M2UB 3DOKA 4F4XA 4DV2J 3NOGA 4KC5A 4LQ9A 3D3CJ 4F8RA 3FBBA 2FVCA 2BKNA 3ZZTA 4QIFA 2C42A 1IN0A 3HD1A 1KKHA 2DVIA 2CKWA 3D68A 3UDVA 4Y6IA 5CAAA 5ETQA 3RB6A 4IG3A 3D6HB 5DGBA 4YDXA 4UF4A 5EX0A 3S8SA 4ZA1A 3HZGA 4M1KA 1VMBA 4ZIVA 2FLOA 1EQ0A 1ZM9A 3MHYA 4OZJA 3D54A 1MNEA 3LP1A 2LQ9A 2E5IA 3OFEA 4IR1A 2R3VA 3QGHA 3IC1A 1X7VA 2JSXA 4DPUA 4A8XA 1HI1A 1H38A 1OY9A 3LGMA 5CABA 1SJRA 2DY1A 1NO8A 2C2MB 4OIXA 3T1YJ 3PHEA 4QPTA 4X2BA 3PX6A 1K44A 3MFHA 2UU9J 2E7XA 4X4SA 4HDHA 2VG6B 4U95A 4C7QA 2ZZMA 3BYRA 3EGVA 4ICLA 1S1UA 2VZ9A 1RAOA 2DR8A 3CPWR 4BS2A 5T14A 4ILMA 5J2PB 4DLEA 2KO1A 1TP7A 3I55S 1HBMB 3FQKA 2VC1A 3V6DB 2ZE2B 4FS2A 1BC6A 1YJ7A 5KFTA 4ATNA 2MHEA
chains in the Genus database with same CATH topology
5KFCA 4ED1A 3KHLA 4K4SA 2GHVC 4OZ1A 2HIQA 4FBUA 5KFMA 1U1PA 3P6YC 2HHUA 3OL7A 1Q16B 1RT2B 1FKPB 5BYSA 4CH7A 4B3OB 4CO3A 1DHMA 2C2DA 2RT3A 1B0VA 3IR5B 4EGLA 4EU0A 3Q8PB 1RTHB 3ZZOA 3D1OA 1RGVA 1E6YB 3G96A 3E8OA 1MMLA 1P27B 2HRUA 3U02A 2MKSA 5EDWA 1WTFA 3CSKA 3HHLA 3THVA 4MIBA 3IG1A 3K7RA 2J76E 3EGZA 3N79A 4ELTA 1K1SA 3TUZC 1MWZA 4C3KA 3BGRA 4R25A 4A8KA 2A18A 2FDNA 1WHXA 3KLIB 1HMVB 2UVUA 4HTIA 3HHKA 2JZ5A 2V2KA 1H3DA 2IMWP 5KTQA 4KFBB 3KLGA 1Y3JA 2Q1LA 2ATLA 1L5UA 3HKWA 1QAJA 4F3MA 4DR4F 1YI2S 3KHHA 2KYXA 1NZAA 1NK0A 2JJ4D 4IQXA 1FESA 3UR0A 1RA7A 1T95A 2B9WA 3K5OA 1M0SA 4TY8A 3FFIA 3KK1A 5K14B 3LGNA 5J2PA 3E2EA 1FRLA 4B9VA 4I67A 4ECZA 4B9MA 5FJ4A 3BGLA 1S97A 1WI8A 2BQRA 4CH0S 1Q53A 4Y34A 2A1BA 1KHWA 3OUYB 1WEZA 1JLEB 3V6DA 1WG4A 2ZE2A 3QJLA 3DCAA 3NNHA 4ID5A 4JYAF 4YMEA 3DLEA 2V5HG 2FJDB 2DCLA 1G3OA 5IM0A 2CDQA 3KK3B 1HNXF 2LXFA 3K5MA 4KIAA 4QIGA 1FA0A 4ECVA 4MKYA 2WHOA 1RYSA 2DHXA 4X4RA 3H98A 1RT2A 1FKPA 3DHWC 4B3OA 3TQ1A 2IJFA 3M8SA 1SH3A 3DOLB 6FDRA 1A7GE 3MEDB 2CQHA 2OSRA 1HBUB 1RTHA 3LAKA 4RW9B 2ZD1B 7FD1A 2AGPA 1DZ5A 1Q78A 5KG2A 5LXRA 1E6YA 1MMDA 2E1CA 2W4CA 4FZVA 4DOZA 5EGYA 3IN5A 4I6AA 2E1RA 3T9ZA 2E5LF 1HWLA 3CT9A 3MD3A 4MK7A 4KO0B 3DI6B 2FPHX 2AF6A 4PCQA 4DQRA 3KLIA 1HMVA 2AV5A 2EFOA 3NNAA 2M4MA 2LDYA 2VH7A 1AROP 5HLFB 5B0GA 2VQEF 1T94A 2YKMA 2F9JA 3TUIC 2OFGX 3DM2A 3G8QA 4KFBA 4DDFA 5GVQA 3DRRB 3V4MA 4OI4A 3BGUA 3MMCA 1WF2A 4ZHRB 5CYJA 2BBEA 4PQUA 5F8NA 3MEEB 2V4JB 3QMQA 4TYBA 4J9NA 2ZC3A 4FYDA 5LMNF 3FEXB 3JSMB 4KR0B 2HHPA 2KB2A 1IR0A 2NUUG 2ZUGA 5K14A 2PEHA 3CD7A 5LL6d 2P5VA 1JK9B 1HPZB 4PWDB 4DG1B 4DV3F 1X9WA 1M5KC 2JX2A 1LKZA 1S7HA 3LF0A 4I68A 3Q0AA 4YEAA 3VCDA 3V81B 2L9NA 5BYQA 4R0EA 4GKJF 2MJUA 3OUYA 4ECUA 1JLEA 4AFFA 5F8GA 1JXEA 4ZS6A 2XLIA 2I8EA 1S9FA 3IWNC 1S6UA 1GQEA 1VC6A 4NLVA 4O3PA 3KK3A 2U1AA 2MY8A 2F4VF 1UETA 1L3KA 1FJ7A 1NH8A 4ELUA 2MDAA 2R4FA 2BM1A 4NMLA 3OLBA 5IT4A 1XWLA 4ZP8A 4ZPWR 3MM7B 3KLFB 4FXWA 2M8HA 1TQLA 3VAMA 2JVOA 2FHKA 3DOLA 3IXQA 4YR2A 1CC7A 3GIMA 2LMIA 3MEDA 4WTYA 4C9DA 3CJ5A 4RW9A 2ZD1A 4NOHA 4BC7A 2EFPA 1HWJA 1S1TB 1N54B 1YWXA 2CVIA 2EFNA 2YWKA 3EPIA 4JI3F 4EO8A 2J9DE 4F26A 3CTRA 3DFEA 3CC4S 5B0FA 1W2BR 2GIQA 5KT5A 1D0EA 4C8ZA 4KO0A 3DI6A 1UEVA 1UEUA 3VAIA 1UVIA 1YJNS 1HW8A 2WONB 1Y0HA 1QAIA 2QFJA 2RQCA 2EC0A 3MMAB 1M5PC 3RBEA 4USJC 1H7WA 2IYGA 3UE2A 2BABA 2CPFA 2F8MA 2V4RA 3CCMS 1EETB 2DNHA 3DRRA 1SJFA 1YRTA 4QIEA 4BBYA 4KTQA 4ZHRA 1K1QA 1FKOB 3MEEA 4OFZA 2ZH1A 1WHWA 1ZH5A 2OFHX 1DARA 5CYQB 3MM9B 2DNPA 3IRWP 1QAYA 3S1TA 1RAJA 2F8HA 4C97A 3HVTB 3G8TA 3N5BA 4PWDA 1HPZA 1V9OA 4O44B 2J9CA 3F56A 3SDEA 4DG1A 5GAGI 2LYVA 4PG6A 3OVSA 5CCLA 3G6XA 2FHJD 2ADBA 2UVWA 1FXLA 3I4HX 5KFJA 2A10A 3V81A 2O5DA 4RUAA 4QBUA 3PIPQ 4ZCMA 1N5SA 2FHOB 4KT0C 4K0KF 2FLLA 4MH8A 5EWFA 4DSEA 2VKZG 3L95X 1WACA 5HL7Q 5F8JA 2CVEA 4IRCA 1Y3KA 4NLSA 5KG4A 4UUWA 3MM7A 3KLFA 4ZP9A 4JV2A 1UVJA 3H5YA 1C4AA 2XZWA 3G4SS 4DHVA 3SSRA 3MMJA 2BM0A 4WK3A 3J7YI 2VA3A 3CDBA 4OV1A 3PKYA 5DGAA 2DPJA 3LAMA 1S1TA 1TL3B 1RKJA 1UVKA 3IO1A 2XY7A 3CD5A 3TAMB 3CCQS 5F0UA 1YJWS 3QIPB 4DL2A 3CEDA 4DF4A 2JHEA 4CO0A 3HXMA 5KAKA 2HNYB 4MK9A 3CC7S 2WONA 4J9KA 3N6NA 4UW2A 4TY9A 3CCJS 1PILA 5KG1A 3MMAA 3MM5B 2J6SA 1TL5A 2KZMA 2W7PA 2EBGA 4KV8B 1LW0B 1S10A 2VBZA 2EFQA 5KFPA 1Q82T 3J7Z5 2HWHA 2R7VA 2CPZA 2B9XA 3MM8A 3PNIA 4LF7F 2QEXS 4M95A 1FNXH 1FKOA 1U6ZA 5AE2A 5FLXY 2ZVSA 2NPFA 1KLNA 4FXVA 3M2RB 5CYMB 5J1NA 1SH0A 1SV5B 5KFFA 3HVTA 3IAS9 1X4AA 4RW7B 5KFSA 2VPXB 4O44A 3J81Y 1IBMF 1YBAA 4K50A 1LK5A 1TVRB 1LOUA 4O3RA 3QZ8A 1BQNB 1BQMB 1UAWA 1UMJA 3KLHA 1X9MA 5HMZA 3T1AA 3US5A 2UUCF 4ECRA 2JLEA 1LK7A 3W3SA 3FGVA 3CCSS 5KT6A 3OHAA 4I0WA 1SB6A 1N34F 3F44A 4JI2F 4G3IA 1B0TA 2HVZA 2I0XA 4CZCA 3NGKA 2QMXA 4FN5A 5L1IA 2DGVA 3EZUA 3TI0A 3QO9B 1V3SA 2PMZD 1D9FA 4F4YA 1Z2ZA 3OXGA 1GTEA 1ZM2A 4WZQA 2KU7A 4ETZA 1U45A 5KFDA 4HYKA 2OMLA 3RRHA 3CWJA 1HNZF 3DXSX 3CJ4A 3D0HE 3OBIA 2PI5A 2MZQA 4K5SA 2JC1A 4QWBA 5G0RB 1TL3A 4OMFG 3CMAS 4ECTA 4QWEA 4P2SA 5B0CA 1P1LA 2OSQA 1J5OB 4OX9F 3TAMA 1VQNS 3V6HA 3QIPA 1QSLA 1FNMA 1GX6A 4C0BA 1NJIT 4PUOB 1NAQA 4A8YA 2A3JA 2HNYA 3T6JA 1WWHA 3W2WB 2NREA 3KLEB 3ISZA 3MM5A 4KV8A 3B4MA 1LW0A 2ZBCA 3CC2S 5AXKA 4DJBA 1LW2B 4K4ZA 3ETOA 2XI3A 2B51A 4B9NA 2ILYA 1NK5A 3P5TL 5DM6Q 1X4EA 3H2VE 3HI9A 2YKQA 1KRPA 1CSJA 1VBZA 1JIHA 3M2RA 1FDNA 1VIOA 5CYMA 2UXBF 5EUHA 1SV5A 4ED5A 1NK8A 3BREA 2KFNA 2VV5A 1SUQB 2ABYA 3CUNA 4RW7A 3NRBA 3U1NA 2GC8A 5H9EJ 2Q79A 2VL1A 3MPWA 1ZZNA 4F02A 1TAUA 1JNZB 2WSFC 3ZFVA 4BHQA 2C2EA 1TVRA 1HD1A 4OQJA 3UPFA 1YQHA 2CZVC 2RQKA 1BQMA 3G8SA 1H2UX 1YJRA 2DH9A 4ES1A 2DGTA 3CD0A 5B0BA 4QR0A 3JB9k 2ZNZA 5A8KA 1BY9A 2HFNA 2ZOFA 3TARA 4B9UA 2LECA 1M5SA