5FJ4A

Structure of the standard kink turn hmkt-7 as stem loop bound with u1a and l7ae proteins
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
97
structure length
97
Chain Sequence
b'TRPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKMKGTFV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U1 SMALL NUCLEAR RIBONUCLEOPROTEIN A
publication title A Critical Base Pair in K-Turns Determines the Conformational Class Adopted, and Correlates with Biological Function.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 26
structure length 97
sequence length 97
chains with identical sequence B, E, F
ec nomenclature
pdb deposition date 2015-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5fj4A00
2X1BA 2MGZA 2QEXS 4WKRA 2MGZB 2VODA 3NS6A 1FO1A 3CCSS 5MLCV 2DK2A 3K0JA 3BO2A 2RQ4A 2KI2A 4FXVA 3G71S 2DITA 1U1KA 1NJIT 2XB2D 3MI7X 2V94A 2DNRA 3CCLS 2MY7A 3UCZP 3NNAA 1WEYA 1HD0A 2U1AA 2MZTA 1WG4A 2LXUA 2RT3A 4C0OC 1KC8T 1HL6A 4Y00A 4A8XA 4QU6A 1VQLS 1QVFR 2DB1A 3CCJS 3CCRS 2G0CA 2KRRA 1QM9A 3CULA 4PRFA 1X4DA 2LA6A 2HVZA 2I38A 2FPHX 2GO9A 2RVJA 5LJ3Y 2KM8B 3R1HA 1URNA 1XN9A 5DM6Q 3CCVS 1M5PC 1Q86T 2AYGA 1WHWA 4WCEQ 2XSFA 3MUMP 1H2VZ 2MQQA 2E5JA 2OTLS 1P27B 2DO0A 4CH0S 1U1PA 2F9JA 4TU9A 3HHNB 1VQ5S 4U67Q 1RK8A 1U1QA 1OIAA 3B4DA 2AYEA 1A7GE 1SJRA 4CH1A 2KXHA 3EX7B 2ADBA 4LMZA 2DNOA 4F26A 2DGQA 4QQBA 5CXTA 2CQDA 3DXBA 2OSRA 2YTCA 2DNKA 2G4BA 1A9NB 1N52B 2DNQA 2HGNA 3EGNA 2BOPA 2RU3A 2DNNA 3US5A 2LXIA 1M5OC 3RW6A 2EVZA 3J7ZT 3SMZA 3NNHA 2DGSA 2DNZA 1K9MT 2DNGA 3FEYB 3G8TA 1W2BR 1FT8A 3B4MA 1VQPS 5JVHQ 1VQKS 1U6BA 4V19X 1NO8A 1WG1A 1X4CA 2RRAA 2RS2A 1M5VC 3CTRA 3D2WA 1O0PA 4IOAQ 1VQ8S 5DDOC 2M4MA 3R1LA 1OPIA 1U2FA 1NU4A 2KXFA 1VC5A 1WF2A 2JX2A 1U1LA 2EK6A 2M8HA 3UD4P 1WI8A 3ZZZA 3UCUP 1X4EA 1UFWA 1Q7YT 1KOHA 2ERRA 2HZCA 2KHCA 2M0GB 1X4AA 2OJ3A 1R8HA 1PGZA 1FXLA 2LKZA 2N82B 3CC4S 2MZSA 2RRBA 2JRSA 1KQSR 1H2TZ 2DHAA 3VAIA 1WELA 5HO4A 3L3CA 5LSOA 1UAWA 3CCQS 1FJCA 2MKJA 1X4BA 1X0FA 2KM8C 4C7QA 1CVJA 5DM7Q 3S6EA 2M88A 1H2UX 2JVOA 2DH9A 2KU7A 3P6YC 1BY9A 1D8ZA 2M9KA 4ERDA 2MSTA 3G9CA 2LA4A 2KG1A 3Q2SC 2LQ5A 2LECA 1FJ7A 3HI9A 2J76E 1X5OA 2CPIA 1UW4A 2DHXA 1PO6A 3U1LA 2RQCA 2PE8A 5DDQC 3CUNA 5IM0A 1U6FA 1WHYA 2CQ4A 5IM0B 2VOPA 3VAFA 2MKSA 2GHPA 4WFAQ 2XS2A 5CYJA 2LCWA 1N88A 3CCMS 1FNXH 2DNPA 2KG0A 1JMTA 2QA4S 1R8PA 3H2UB 2CPXA 3J7YU 1HD1A 2RNEA 2DH8A 2F3JA 1VQNS 3MXHP 2D9PA 3MD3A 1F9FA 4QPTA 2YWKA 2X1AA 2KYXA 3CPWR 1M90T 3TO8A 2ZJRQ 2DISA 3BO4A 2YH0A 3ZZYA 2G1DA 4F02A 1SJ4P 1U1NA 4W92B 1KOOA 2MZRA 3MUTP 4C4WA 2FY1A 1AUDA 3S01A 3CF5Q 1DHMA 1DBDA 3N9UC 2E5IA 2VONA 1U1RA 3IRWP 2DIUA 3THTA 1SXLA 1VQMS 2K3KA 2DGXA 3NMRA 1SJ3P 2CQ3A 2DHGA 1JJ2R 4WIIA 2J8AA 3CXCR 1VQ6S 2OSQA 1H6KX 2CQIA 2CQPA 3MDFA 4Y0FA 3CMES 3UE2A 5LSLA 4IOCQ 3VAGA 5ITHA 5GVQA 4Z2XA 1X4FA 4LJMA 3VALA 2CPDA 1WF0A 2ADCA 1JJ4A 1S72S 2KH9A 3SDEA 1YIJS 4CIOA 3UD3P 2RUGA 2CQGA 5DETA 2YKAA 3VAKA 4PR6A 2JVRA 2HGMA 1WI6A 1YJ9S 3MUVP 4PKDB 5EN1A 2QFJA 2DNYA 5GADU 2MZQA 1U1MA 1B7FA 2FC8A 3I55S 2CPJA 3LQVA 2MKHA 2E44A 2D3OR 2KVIA 2D9OA 2MQLA 2DHSA 4W90B 5JVGQ 3P3DA 1VBZA 2M2BA 5LXRA 2CPYA 5DDPC 3EGZA 2A3JA 4WFNQ 2MB0B 2FC9A 1K73T 3PIOQ 4QU7A 2L08A 5GMKa 3G6ES 2J0SD 2DH7A 4UY8T 2L9WA 3THPA 3CCUS 2CQCA 2CPFA 2MXYA 5HL7Q 1VBXA 2AYBA 4RU2A 5BJRA 1VQ7S 2U2FA 1S79A 3CMAS 2CQHA 2JWNA 4TU8A 2MZJA 2MKIA 2NLWA 3NS5A 3MOJB 2WBRA 2MYFA 1JJHA 2MMYA 3G96A 4TLQA 5GAHU 2N3OA 2DGUA 2KXNB 1WF1A 4F25A 3CC7S 3VAJA 1Q82T 5GAGU 2M8DB 2OIHA 2DO4A 2CQBA 2AD9A 1WG5A 3UWTA 1VC0A 5FJ4A 2HYIB 3BO3A 1YJNS 5CA5A 2DNMA 1K8AT 1X5SA 2CQ1A 2KT5A 2MZ1A 3S8SA 2SXLA 2YH1A 1IQTA 2LMIA 3UCGA 1WEZA 1OO0B 1YTYA 1P1TA 1VC6A 2MQNA 1ZZNA 2PEHA 4ZKAA 1G2EA 4OZ1A 3TP2A 1X5TA 2KFYA 1UP1A 2M70A 4IO9Q 3V4MA 1WEXA 2CQ0A 2E5HA 3R27A 1M1KT 2MKKA 3BS9A 2J0QD 1WHXA 4IUFA 2BZ2A 3CD6S 4ED5A 2K8GA 3JB9k 2CPHA 1FJEB 1SJFA 2HGLA 5IFMA 1VQOS 1YWXA 1YITS 1X4GA 4FXWA 1DRZA 3MURP 1L3KA 1RKJA 3Q2TC 1WWHA 4WFBQ 2AYMA 2MHNA 2DNLA 1X5PA 2DGOA 3P49B 3G4SS 2LYVA 3ULHA 5LXYA 3U1MA 1FHTA 5D77A 1VQ9S 4OZ0A 2M7SA 4P6QA 3LPYA 1OWXA 2E5GA 2MJUA 4YUDA 2NZ4A 3RW7A 1VBYA 3TYTA 3I56S 2DGVA 1WHVA 2OTJS 3S7RA 3IWNC 2DGWA 1D9AA 2F9DA 2KN4A 2MJNA 2FHOB 3SDEB 3FEXB 2VOOA 1YJWS 2XNRA 2MQMA 5LJ5Y 2RS8A 3H2VE 2XS5A 2CPZA 3VAHA 2MSSA 4UQTA 2UP1A 4WF9Q 2MQPA 1DZ5A 2CQ2A 2X1FA 3OW2R 4CQ1A 4J5OA 3VF0B 2MKCA 3MD1A 1M5KC 1HA1A 2EK1A 1N8RT 2CPEA 4M5DB 1X4HA 2MQOA 2DNHA 2N7CA 2M52A 2N3LA 2XS7A 2DGTA 3CC2S 4BS2A 5DDRC 2KRBA 2O3DA 2MY8A 3VAMA 1U1OA 2B0GA 2Q79A 3G8SA 1YHQS 4LIRA 2L41A 2ZJQQ 2XNQA 3NNCA 4YB1P 1YI2S 5D78A 3BEGB 5GAEU 3P5TL 1VQ4S 3DLLQ 1Q81T 1SJQA 3PIPQ 1KD1T 3CCES 1ZH5A 3SXLA 4EGLA 1QVGR 2CJKA 4TU7A 2I2YA 1WTBA 5H1SV 2LEBA 2DIVA 2X1GA 4YOEA 1ZZFA 2LEAA 2MPUA 2ZJPQ 5IQQA 1N54B
chains in the Genus database with same CATH superfamily
3SFUA 1FDBA 2NUHA 4I69A 3U7JA 5EWGA 3BO2A 2KI2A 2EFPA 2C2OB 2BABA 4DUYF 1VI7A 2E1RA 3RB0A 4FVCA 4NYZA 4DX8H 1HL6A 2VBWA 2C2ZB 2QLJB 2IRUA 2HVZA 1TK0A 3D1QA 1XN9A 1E6YA 1T02A 4PPZA 5A76A 1R3NA 3MMBA 1OQ6A 2VQEF 5H9EK 1RAOA 4RX6A 4U67Q 1FFSB 1VRQC 1ZAWA 1RAFB 1U1QA 2VG7B 5J2MB 2YNHA 3ILOA 2I9SA 2QA4G 3UN3A 3TANA 2NXEA 1FD8A 3IS9A 3LAKA 3LA0A 3TUPA 2Z2LA 4EBCA 4IOBA 3DLEA 2DT9A 2E7XA 1K9MT 2NXCA 5A8RA 4QIWD 5JVHQ 3ZNJ1 1OJ4A 4DV0F 1RWMB 1TL3B 4YHHJ 3CTRA 5DDOC 3KJVB 3TAMB 1M0SA 1OPIA 2F40A 1WF2A 1S6QA 1WKKA 4XPCA 4QIFA 2E1PA 2ERRA 1M5SA 3DOMB 2ZKTA 2N82B 2I5JB 5KFZA 2NUUG 4QW9A 1S6PA 3A3OB 7AT1B 3VAIA 2GJFA 1SKWA 3KK3B 4C7QA 1VIOA 1HBNA 5ADZA 2GVZB 5AJ3F 4HTIA 2D3ZA 3HMJG 1S1VA 1R6YA 3N5BA 4A48A 1NKBA 3CUNA 2B5JA 1U6FA 2CQ4A 3AD9C 5KFPA 3VAFA 1XERA 4WFAQ 5D4NA 4WP8A 1I94F 2YWFA 1FNXH 1EB0A 1UJ4A 2AT1B 3SCIE 4CLYA 4P2FA 1TL7B 4NA3A 1F9FA 4RBVA 4ZCKA 1RT5A 1KONA 1M90T 4X64F 2ZBIA 4ED8A 2XEXA 1T9WA 2MZRA 4C4WA 2YX7A 1JLEB 2Y1LB 3HF5A 1QDUB 1UCNA 1JK9B 4ECSA 4JUZA 3D1HA 1SJ3P 1VQ6S 5F8GA 4WYLA 4LJMA 1ULRA 4LF9J 3HJVA 1HNWF 3SDEA 1YIJS 2CQGA 2WCXA 4LF7F 2AX0A 3LP1B 3VAKA 2HGMA 3S1TA 2AEJA 1XIQA 2CJBA 2GAHC 3NOCA 4NOHA 2MB0B 1RAHB 2FC9A 4PAAA 4OHWA 3DXSX 5DZ6A 4WKYA 3OL9A 1NUEA 1V5VA 4FF1A 3ZTSA 3LP0B 3QIPB 2Z8QA 4WP9A 4C0HA 3DOLB 3AXKA 3D54A 3BO3A 1Y0HA 1HNVA 4LFBF 3CE8A 1X5SA 4CTAB 4ILLA 2MZ1A 3AAWB 4DPTA 2SXLA 4OIXA 3J80Y 2IVYA 3ZTOA 4ZP7A 4AT1B 3TA0A 3UCGA 3O3LA 2BOAA 5D4OA 2XMUA 1G2EA 1R0CB 3MAAA 1WHXA 2BZ2A 3LF0A 4NCAA 3L7OA 3N79A 3IM8A 3D1OA 4PG7A 1LQ9A 4F0HA 4V1Ak 3HSGA 3F56A 3M1VA 3LALA 2HW3A 3CWJA 3HHDA 4JI7J 1YZ6A 4CNYA 1WHVA 3GYNA 3JSYA 2OTJS 4I56A 2DGWA 1TP7A 2FHOB 1YJWS 3GCXP 2W2QP 4LVNP 3T1YF 3I0RB 2P9EA 4UQTA 1GT8A 2H1YA 3Q8YA 4KAIA 3MM6B 4FYXB 3WC2A 2NXNA 1X4HA 3AY0A 1GMUA 1T9YA 3BKFA 5DDRC 3VAMA 2VC0A 2W4PA 3NNCA 2HNYA 3PIPQ 3SCKE 4CO1A 3R6GB 1EARA 3KLVA 2N4DA 3MGJA 2DVIA 3IG1B 3VVUA 1XNQJ 1LFWA 5K14B 1H7XA 3UCZP 1NDPA 2Y3YA 4DMZA 3QO9B 1BMQB 1MROA 1KHWA 4QU6A 4FN5A 3CULA 1VDHA 2VICA 3DMJA 1ACMB 2Q3PA 3DHXA 2VASA 5DM6Q 1Q86T 1H2VZ 1KBRA 3KLFA 1PYSB 3D28A 1CULB 3PTWA 4LFCF 4I2QB 1KQFB 1LK5A 3WC0A 4DFPA 4JV1A 1EQ0A 3HCXA 2HSEB 4RUAA 3LWMA 4DF8A 2HGNA 3GV5B 3GFYA 1TK5A 1TKXA 1QTMA 1U6BA 1X4CA 4AL6A 2FYXA 4ENOA 3HHLA 1PKUA 3NGDA 4DCPB 2HWTA 1NH8A 2VPXB 3SV4A 2J6TA 4DR3F 2JX2A 3UW1A 2AW0A 2HQGA 4L74A 4CLUA 3IBCB 3DGPA 2DHAA 3VTIA 4NE9C 1S77D 2JH3A 2WVBA 3BGFA 3OFGA 1DAXA 1F6TA 2Z4PA 3C6TB 4YN3B 2R2TA 1KTVA 1T95A 3MM9A 1LFPA 2HFVA 4ED2A 2B7CB 5HVFA 4UOFA 4ZLLA 2MKSA 3M8PB 2YQ3A 1N88A 4DR6F 2GFFA 4W98A 1I3OB 5CH7B 3HSDA 4NEZA 4M94A 1M1HA 1N36J 1GTHA 1T05B 2K7KA 2D41A 2QLXA 2BQRA 4AL5A 3QNWB 4B3MJ 2E9TA 5KFEA 3EXYA 4Y2KA 4JI3F 1WC6A 4OZ5A 2YWKA 4IKAA 2PN6A 2KYXA 3R7SB 3BGUA 4YDXA 3OLAA 1FNMA 2FY1A 1EZZB 3CJRA 2JNJA 3LTOA 3THTA 2GC8A 4LSLB 2DHGA 1U02A 4JV5F 2OPRB 3RBZA 2L48A 2F4VF 2WW8A 2W9CB 2EBEA 4PQUA 3SSRA 1TR0A 2G13A 5J1EA 4AL7A 1J5OA 2BE2B 3I87A 5AT1B 1MMNA 3CCWA 2FVPA 4K4TA 4YMEA 1FDNA 3GJSB 4DX5A 1FKPB 2Z2ZA 5IT0A 2XM3A 2H5JB 1S48A 2RDJA 1PC4A 4K5RA 5E0OA 2FVCA 2HFUA 3CD0A 4UOCA 4W90B 2YWGA 4WFNQ 2L08A 4H4MA 4ZVQB 3X1LB 2DH7A 3THPA 1NPRA 1DFDA 4B9TA 1BE4A 4EFAC 4EWTA 2HHXA 2MYFA 4ZITA 1JJHA 4MFBB 1S9EA 1ICEB 1RT3B 2RSQA 1NKCA 2HYIB 2HVHA 3MR3A 2XMWA 3UVJA 2GGPA 3ILJA 3BQ2A 4YB6A 1R8CA 3KJQB 4OZ1A 3AODA 2ZWPA 2KFYA 4G3IA 2CQ0A 3PVXA 3QAUA 4MMOA 1N34J 2CDRB 2VZ9A 4OYIA 4CM2A 2E7WA 1V3SA 3I0SB 2NQPA 2AYMA 1C4CA 1S1XB 1IWAA 3ULHA 2BEFA 4IRKA 2MJUA 4F4WA 4AXJA 5E7OB 2R8GA 2JOQA 3DRYA 3DYAA 5HANA 4RU9A 4NXMJ 3QZ8A 5J1NA 2HLTA 2HBRB 1JWWA 2XS5A 5F9NA 5KFUA 4ELVA 3V5RA 1DZ5A 1REVA 4D3GA 2ASJA 2MKCA 2C3OA 3D68A 4XTTA 4UZBA 4ZVSB 2QE5A 1FFWB 2XYGB 1W26A 5HLFA 2KTQA 4IR1A 2OPSA 2XNQA 4J9UE 4ES3A 3EVMA 2A2CA 3I9V9 2E9ZA 4MKYA 4PWDA 1BWVA 3ZZRA 1GXLA 5GMDA 3G87A 4WTOB 1RLCL 4MKAA 1NDKA 5B0FA 3KXDA 2MGZB 5C42B 3GIKA 1S9FA 3LP2A 4FP9A 1Q95G 4OMFG 3BPSP 2QA2A 3L9ZA 4USHA 4BC7A 2FVRA 3W9HA 4ECRA 1BGXT 3CCJS 4PRFA 2EPIA 3HHLD 1KQKA 4FNIA 4IH5A 4JI4F 3HD2A 2R2RA 4LF5J 2YKOA 4UOGA 4ZLPA 4EO6A 4YR0A 4LR7A 4K4YA 1S1TA 4WU2A 2DRBA 1NDCA 1SJRA 2A18A 3FZ2A 3UNYA 4DV2F 1SH3A 5DGBA 3MPYA 4OYAA 2Q1LA 1D1UA 1RQ0A 1JLCA 4OZLA 4YR3A 2PI5A 3IWXA 3M8YA 2CVEA 3NNHA 2UUAF 2B6AB 2DNGA 4K8RA 1NO8A 1Q4RA 2GVDA 1NPPA 1RT1B 2V8HA 2E1MC 4CO0A 3BDPA 3KLIB 4NRUA 3H5YA 2KXFA 2UZAA 2FJDB 3A3PB 1YJUA 3TUJC 3ZZZA 2IJFA 1IKXA 1WTFA 3KK1A 1EHWA 1ZAVA 2ZZTA 5A6WA 4J7CA 4RW9B 4BWMA 3R7NB 4P7TA 2KU7A 2H48B 4PXBA 3ILIA 4BWJA 3G6XA 4K4VA 1FVSA 5DQHA 5KFKA 1RWOB 1UW4A 1UJ5A 4X66F 1Z2ZA 3NCQA 5EWFA 4MKBA 1FI4A 3VHQA 4DG1B 4OQJA 3MEDB 3HM9A 5KFVA 3G82A 4M63A 1S1UA 1JXVA 4QYZJ 3EMTA 4ZVHA 4P52A 4IDKB 3ZZUA 4KPYA 2DH8A 2GMJA 3O8WA 3K5NA 1Q8BA 3V4IB 1U45A 2CG4A 3T19A 2DISA 2GX8A 1Q8KA 1QY7A 3D3CJ 3FGVA 3BN7A 3IBWA 3EJMA 1HMVA 3U1NA 2COLA 2CYYA 3LGHA 3F0NA 5ITHA 1CJKA 1RA7A 1S72S 2VFUA 1DLOB 4ICLB 2IRXA 4Y6IA 3VV2B 1HQ2A 5EN1A 1IBLF 4CZCA 1RDRA 4DEZA 4M5DA 3KLGB 2QT7A 3GJQB 3DOKA 4DR4F 2DHSA 3L95X 5ETOA 2BACA 2ZE2A 1N56A 1TKTB 2AGPA 2RF2B 3AB4B 4QZVB 4F4XA 2IJRA 1PG5B 5B7WA 3C14B 1AZSB 5K20B 2OMLA 1S1WB 3PRVA 3M32B 5KAKA 1F2GA 1TQLA 2ALZA 1W2IA 1QAYA 2XYPB 3ET6B 4JI8J 1RAJA 4N8NA 1DY3A 1QAJA 2LMIA 4LQ9A 1CJUB 1PBUA 2Z2MA 3RU0A 1L3UA 1PCAA 1HBMB 2CFXA 3NGUA 2K06A 3R27A 1NMEB 2ZUAA 2IC3B 1YVFA 1LV5A 3VGSA 2QIFA 1UWBB 1YK9A 2HHPA 2PI4A 4M5KA 2P9GA 3NG8A 4PYDA 2DNLA 5D15A 3FNNA 5J2MA 1UMJA 3U1MA 5G0RB 2BJDA 3LPYA 4FF3A 5KFXA 4RBTA 4DL6A 4C8MA 1PIEA 3R9LA 4MK8A 2DR8A 4I67A 2F9DA 3QPIA 3T5JA 1N5YA 2VC1A 4ZHRB 4KV8A 4FYDA 1HWUA 4A8SA 1KKHA 2ZEJA 2E1AA 4CDIA 1PBAA 2XSJB 2RDDA 3MM7B 1TL3A 4O0IA 2NSBA 3KJVA 1YRUA 4KIAA 3L7UA 3B6BA 3NRBA 2XLKA 5F8MA 5IV4A 4USIA 3TZYA 3CCTA 4LBPA 2HIYA 2L41A 3OR1A 5D78A 3CJKB 4A8YA 3HFZB 2I5JA 2V9WA 5KG4A 4RNMA 3KK3A 3K8WA 4DV1F 3TOQA 5HAOA 3BKUA 2KT3A 4B02A 1JLQA 1MNEA 2GVZA 1IBMJ 2DCUB 4FF2A 3ZZTA 1RT6A 1JLGB 1CC7A 2U1AA 4GMKA 2RT3A 2PMHA 3SQGB 2VU5A 4Y00A 2NYIA 1O51A 2PA3A 3BPDA 4ED3A 5JXSA 2VL1A 1OSDA 4ZA1A 2BA9A 2OI2A 4NLTA 3CCVS 1UJ6A 4ANEA 1TL7A 5D0GA 1RAEB 5F8LA 4IO1A 4FYVB 3OR2B 1TELA 1OIAA 4ID8A 3PJWA 1JLEA 3C15B 5CXTA 3CJ4A 2AMCB 3MMAB 2G4BA 1NB7A 1N52B 1ZPVA 5CD4H 2QG9B 2HBYB 3HZEA 1LWFB 5KFRA 3R8YA 4C3MA 4KE5A 4B9MA 5A8KB 1JLFA 3M9OB 3GONA 4DWIA 3KNGA 3R3TA 3DKDA 3R6LB 4K50A 3TR5A 1VC5A 3BKTA 3JSRA 3VZHA 1NK8A 3MPVA 3MCMA 2PC6A 2MKYA 3KYLA 4F50A 1KS2A 1T9TA 3M8RA 3PRBA 1XMOJ 1JXLA 3CC4S 3PHTA 2FJBB 2PMZD 2WK4A 4FPIA 2E1CA 1TUGB 1FJCA 2DHHA 2MKJA 3CD5A 3P6YC 2HQIA 2Y8WA 4OHVA 3THVA 4Q45A 2M9KA 4ES1A 4HHHA 3LP0A 1JLAB 4DPWA 1KSPA 4B08A 3H40A 1RHRB 1AFIA 2RD5C 3DOLA 4CRJA 1RT4B 1WHYA 5CHCB 1RHUB 4TN2A 4CTAA 4X4NA 1IBCB 3TJAA 2H3EB 3RYLA 3RRKA 5HROB 2DCLA 1LEOA 3V6DA 2ZITA 3K59A 1F5CA 3N28A 3CJ0A 3A3NB 1VQNS 1OQ3A 4A8FA 5C2GA 3FBCA 5KT6A 2NSCA 4DQRA 1SJ4P 1MG7A 3EGVA 3PHEA 2QX0A 5AXKA 2GNKA 2QSFA 4IH7A 2V4QA 2RU9A 4PYAA 1K1SA 2HIQA 3I96A 4M5LA 2CQIA 3MFIA 3VAGA 3FRYA 5DO2A 3VALA 1JJ4A 4DCJB 4IFVA 5EX0A 2RUGA 1K0TA 2M3DA 4OI6A 1YJ9S 1SKUB 4IR9A 2BKNA 2YKNB 5E5NA 2VDIA 2CPJA 3UR0A 3MM6A 2AQ4A 2HBQB 4F36A 5T41A 4PZVA 5I3UB 1YBAA 2MXYA 3O6QA 2HQDA 1WF1A 2CJXB 4MTPA 4ZPWR 1IKYB 4YB5A 4LF8J 4DR2J 4G65A 3GSDA 4DLEA 3F73A 2ZOFA 5K14A 3S8SA 3NWRA 5CAAA 5IT9U 1FRLA 4ANDA 1OO0B 1O5JA 2JFKA 3QO9A 3R5GA 3CJSA 4ZVUB 4JI5F 2E5HA 3W9JA 3HHLC 2MEWA 4CYUA 1S7HA 3CJQA 4L75A 5B0AA 2ZBRA 1YWXA 3SEOA 5F8IA 4TYAA 1CULA 1JJCB 2W7PA 4RNOA 4WFBQ 4I2QA 3V6JA 4CLZA 3MWBA 1VQ9S 4DR1F 3KUEA 3TYTA 4K0KF 1ELOA 3FEXB 1UEUA 4URGA 1FTCA 1WOSA 1WDTA 4I6AA 4KKOB 1Q79A 4WF9Q 1GH8A 3GG1A 4EI2A 1FESA 1YJRA 2LDYA 3ZZOA 1FVQA 2I6WA 2B7BB 5B08A 4ECUA 3NGSA 2B0GA 1X8DA 3IO1A 1U4BA 1VQ4S 3DLLQ 3MM8A 1NSKL 3P5TL 4XIUA 4QWAA 1SJQA 1MLAA 5LSRA 1ZH5A 2IAJB 1VS3A 2J9DE 4JOUA 3Q22A 1EP4B 4IFYB 5DGAA 1UA0A 3BREA 5L1JA 2LEBA 1G7CB 3CDUA 4OZ2A 4CLTA 2ZJPQ 5A6PA 3C6TA 3CCSS 3RB3A 4NLSA 1D0EA 2I1RA 3LGNA 4WP3A 4MIWA 3AOBA 1B0VA 1TAUA 2YWWA 1VBKA 1BQNA 1KHVA 1RACB 2I38A 2I0XA 2RVJA 1URNA 4A4JA 1V9OA 4KHMA 2F9JA 3MMBB 4LREA 4WFZA 2HFSA 1BUXA 4H4KC 2AYEA 2BRKA 3PXGa 1A7GE 5C7PA 5JMNA 1G3OA 2YNHB 3PYFA 2VBZA 3EGNA 2DNNA 2WOMA 4GKJF 1FX2A 1DQ8A 4LSLA 3RW6A 3J7ZT 1VR6A 3QQCD 4L73A 3DLEB 2LP4A 2ZWOA 2V2KA 3ZNUA 2OPRA 3PZPA 2O67A 3ENAA 1UVIA 2G2YA 3B54A 4OLPA 1VQ8S 3SI8A 4DV4J 1XBWA 1N5TA 1FKPA 1NU4A 2RKIB 2JSXA 1RKIA 2EEYA 4B3OB 2KHCA 2R7OA 1FE0A 1VLYA 2AJ4A 1RBAA 2DEIA 4EEYA 3PX4A 4L3NA 5LSOA 4N77A 1CVJA 2C2EA 1RE1B 4DL3A 1QUVA 1EAYC 1N32F 3QGPA 2RQKA 4MFBA 1UEKA 3WHIA 1RT3A 2CRLA 5CYJA 1CPZA 3KHHA 3RRHA 1NDLA 2D1CA 2YBVA 1ZYQA 4Y3CA 4Q8FA 1B3TA 3A8IA 2XWYA 4Q43A 4NA2A 4NYPA 1RLDA 4WFYA 1UVJA 2KJVA 4ZMMA 2H5EA 1T9XA 1RHMB 3DLKB 1L3SA 3NAHA 5BR8F 4U95A 5H9FJ 3KHLA 8AT1B 4W92B 2EBGA 3CF5Q 4DXLA 5M2UA 1UZHA 3EVOA 2F65A 4WE1B 3I0SA 2VONA 1U1RA 3IRWP 5L38A 4X62J 1S1XA 3GZ7A 3PW5A 5IQ6A 2E7VA 4ZK7M 2YNIB 2EC2A 2PDAA 1EIYB 4OI2A 1X4FA 2YNFB 3UD3P 3NAIA 3W61A 3K5PA 1UWAA 4F2SA 3K5OA 2R7XA 5E2QA 1NJXA 2IYIA 2ZZMA 2FJXA 2DNYA 3CDAA 3ONQA 1FTRA 1RAGB 3AT1B 2VA2A 1C2PA 4Y34A 4UT4A 1J5EJ 4J9QA 4F4AA 1IR0A 2FDNA 5HP1B 5L9NA 3TRGA 1HFEL 2XLIA 4XK8C 3CJ2A 3CIZA 1U48A 3MF5A 2V2QA 4C3KA 4RW6B 5F3ZA 1RWWB 3JTOA 3AOCA 4DSFA 2N3OA 2ZC4A 2XY7A 1Q0NA 5CA5A 4A8MP 1K8AT 4GVBB 1RTJB 1S10A 1X9SA 2OMOA 2VFTA 2J7UA 3JTNA 6FDRA 1K0VA 1S9GB 3D0HE 1WC1A 2FHMA 4OYXA 3TJ8A 3MEGA 2HNZB 1KVJA 1LW0B 1WEXA 4DZDA 3RBXA 3MAAB 3BR8A 3LH2S 2XTJP 3ZO7A 4ED5A 2V34A 2VH7A 3CD7A 2MDAA 2UVVA 4DV5F 1NH7A 1APSA 3W65A 2LQ8A 4UW2A 1WSRA 2VG5A 3DI6B 3OTOF 3G4SS 3JAMU 4BDPA 2HBZB 3FCWA 3HSJA 3H59A 1VK3A 3Q8QB 4KT0C 4LRAA 4UQGA 5LT5A 5D0EA 2B6AA 3OFHA 4F4KA 2XMTA 3R5CA 1RT1A 3OW2R 1U2RA 1HA1A 4IG0B 1N6QA 3KLIA 4ZLJA 1IJEB 2DNHA 4KGKA 2FGCA 4Z37A 4LF6F 2WVCA 4DV3J 3LW5C 2FTRA 3L7PA 3RBDA 1DURA 4DU7A 4KPCA 2X1BA 4BBYA 3H7HB 1QE1A 1QTNB 1D09B 2G0IA 4FXVA 4LF4F 2R42A 1NJIT 1URRA 3IMQJ 5FLXU 3UNGC 4U9RA 1RT7A 3H8YA 3MEDA 2G0CA 2UXBJ 3PFOA 3HPOA 4OX7A 2GO9A 2UVUA 5C5JA 3MMCB 4G1QB 2ZM6F 2J9EA 1XNRF 3V4IA 2OTLS 4Q5VA 2BQ3A 4DR5J 2KZMA 2YKQA 2LLZA 5AE2A 1RCXB 3EX7B 1W25A 2ZH9A 4IQXA 4EBEA 2V0NA 3N6NA 1A9NB 1GXUA 4RW7B 1RWPB 3MTKA 4FYYB 3EZOA 5KT4A 3P8BB 3I82A 4NI2B 5CABA 1HNZJ 3PRDA 5DRKA 3G6VA 1Q8IA 2RS2A 1DLOA 4ICLA 3PCOB 2V67A 4IRCA 1MMDA 1HQUB 1TTHB 4NWBA 3N6MA 4TLRA 3H98A 2Z2YB 4PXEA 2A6MA 5DZ7A 2LKZA 3OTBA 3AJ1A 5HO4A 1I5OB 5HQMA 3TARA 4BHQA 1BY9A 1FNOA 3PO4A 3CO0P 4KYZA 4PPDA 3C14A 3PYDA 3ZTPA 4MH8A 2XCPA 1S1WA 4L6V3 4A47A 4NASA 2R8HA 2UUBJ 4O0NA 2W2OP 2CZ4A 1F5BA 2XWXA 3PW2A 1CJUA 2DD8S 2XQCA 1JMTA 2UV8G 1HBMA 1HD1A 5DG9A 2BR0A 2IDLA 4C0BA 3HDSA 4P2MA 4DI6A 4JI2J 2GIQA 2IC3A 1HI8A 2BYCA 4GKKF 1UWBA 2VA3A 3R2CJ 2OEKA 4P9SA 1TAQA 2B9WA 2FJWA 4OJGA 2UXCJ 5LOQA 2BDPA 4TQRA 4FXDA 4RZRA 1FJGF 4I7FA 2XGPA 2POKA 4Z2XA 1RSCA 1U25A 4ZHRA 4K4XA 5E41A 4LFAF 2OEMA 8ATCB 3KJFB 5IWAF 3GPAA 3E2EA 1QSLA 3MM7A 5E3QA 4DZ6A 3NXZA 2D9OA 2MQLA 1Z4UA 5DDPC 1GK8A 1SQFA 3LPEA 4DFKA 4NLDA 2CPFA 2LXFA 3G6YA 4LRBA 2MMYA 4AUKA 2Z0GA 2OH2A 1S9EB 2HHTA 4U7CA 3VAJA 4P72A 3PX0A 2VB6A 3VCDA 3HVAA 4YQWA 3KUGA 1JLGA 2QTWA 3OUYB 5U47A 3HKZD 1Y5LB 3SQGA 3QLHB 1U0HB 2BM1A 4X4UA 4RUCA 3FMBA 4FS1A 6AT1B 4N41A 4K7QA 4ZP6A 4DOZA 1S57A 2AJQA 1SL0A 3IAS9 3OR2A 3RAQA 2LYVA 1RT2B 3W62A 3TWZA 3OL8A 2ROEA 3NEKA 2NZ4A 3T9ZA 2GQCA 5KFFA 1YSJA 3LGMA 1K1QA 3DYAB 3JAMY 1TMJA 5LJ5Y 1LWFA 3KMQA 1HR0J 2MQPA 4OX6A 1REVB 3D4JA 5ETNA 5DS7A 1R8BA 3RAXA 2M52A 2DXFA 2RHQB 4DUZF 3CC2S 4UUWA 1K47A 4RR5A 2OPSB 2ZJQQ 1ZTWA 2YQ1A 1RXOB 4USUA 4RPFA 2P9CA 1B0PA 4ZPCA 3BGOP 4PWDB 4ANCA 3TNVA 1GEHA 3F44A 3GJTB 3CC7S 4URQU 1N54B 4OI4A 2QEXS 4WKRA 1VK8A 4LIWA 3LP2B 4IH6A 2Z58B 2DITA 4X2BA 1U1KA 2V94A 1PAEX 2MY7A 2FHKA 2IIHA 4B9LA 3TX8A 4C0OC 1RT4A 3ZTQA 1VRTA 4DL5A 1WOPA 4OYBA 2K2PA 3M9NB 3CCRS 2KRRA 1V3ZA 5IOLA 4PQAA 3PKMA 1FRMA 2UXDJ 2KM8B 1KVIA 5FLXY 1RWUA 3DM2A 1LXNA 2V2VA 4LRCA 1CJVA 2XMKA 1EKSA 3J7A1 4Q7AA 1FWKA 1WOOA 3DRRA 2DR6A 2OAUA 4ECZA 2N7YA 4CH1A 1HLWA 1VYAA 1PJ5A 1ZS6A 1F3FA 1JLCB 5D8HB 1RCOB 3PEHA 2H54B 1YRXA 2DNZA 2ZH4A 1FT8A 1VQKS 2EI5A 3Q8RB 2HNDB 3Q8SB 2HRUA 4MYUA 2M4MA 1TU0B 1NEEA 2W01A 2YKNA 1U1LA 2XYHB 1VCTA 1M5HA 5HVGA 3IGNA 1WORA 4DLGA 3L09A 1WELA 4RO0A 2J0XA 1X0FA 1X4BA 4QIGA 4X65F 1C0TB 2HS4A 1XMQF 2VQFF 4RLEA 2MSTA 5HATA 2AF6A 5BYQA 2VDHA 3SCJE 5KFOA 5ETVA 4FYWB 1WKLA 3LANA 3GILA 2X3DA 1RJJA 2PE8A 1IKYA 3TAPA 5GAGI 3RGIA 1QAXA 3FQLA 4TKTA 3IR7B 4JP8A 3R5DA 3AQPA 1HW9A 2OFHX 3A8EA 1F5AA 3IC1A 1HHSA 2MHEA 4QPTA 1VQYA 4X4RA 1J27A 1R6VA 1YJTA 1KNZA 3BO4A 1JQGA 3WX4A 2K3KA 3ITHB 4JI0J 1HMVB 2OSQA 2CQPA 1PYTA 1FWLA 1DARA 3NKYA 3UN5A 5B0CA 2XGQA 4P2XA 2QYCA 2IA0A 2AGOA 2H4YB 2XY5A 2M5YA 4MJKA 4PWWA 2HHUA 3HLUA 3M05A 3WQPA 2BJEA 3KTQA 1AW0A 3M7VA 2E5LJ 4DV7J 5I4MA 2LQBA 2K1RB 4USVA 3FSYA 3DOKB 3A13A 2DKOB 4DPUA 1HHTP 2XMAA 2ZE2B 2J0SD 4UY8T 3CCUS 3T9NA 1SL1A 1VBXA 4RU2A 5BJRA 3OXGA 3D67A 1NK7A 4Z7CA 3ZTRA 4IFYA 4HHJA 3R5BA 1TK8A 4OJHA 5CCMA 3GB0A 1CQMA 4RW4B 2BM0A 2ZHBA 5CYQB 3CJ3A 1Q53A 3HHKA 4FKXA 4DS5A 5DG8A 3WIVA 1T7PA 3M2RB 1RUSA 2DY9A 4C8LA 3UDCA 4YS2A 2CNKB 1GMVA 1ZBTA 4RBUA 5T7LA 2K8GA 3C3LA 2PSZA 4I2PB 3CB4A 5IFMA 1SB6A 4O4GA 4D3HA 4X4QA 3Q2TC 4B3SJ 5HQLA 3GIJA 2YPYA 4WYWA 1FDDA 3DLJA 2QA1A 3BGRB 5I3PA 5ETRA 2HLUA 4J9NA 1N5YB 2VJVA 1YLXA 4KV8B 1WDDA 4LT6A 3OTCA 4PG6A 1HBUA 3M6WA 3T5KA 3EGWB 1IN0A 2RKIA 1FKAF 4GC7A 4B3OA 4ITSA 4JYAF 2Q79A 4HL9A 4YB1P 2IMWP 3OR1B 1O6XA 3IR6B 4DR7F 4YR2A 2WAQD 4I6YA 1QVGR 1XMBA 4QYRA 1A0OB 1ZZFA 3NBPA 4B3RF 1CG2A 1KN6A 1JLQB 1ZM2A 2DTJA 2DK2A 4ZVOB 3H25A 2CA9A 3J7AN 1RT6B 3JSBA 3BSOA 4AFFA 1EETA 1SVDA 1HD0A 4CLSA 2QMWA 2GAGC 4ZCLA 4ETXA 4RNFA 1HNXJ 1VQLS 2QLWA 3FRZA 1QM9A 1DJ0A 1D9DA 1YRTA 3GV7B 2EW9A 1S7IA 3I5CA 4IRDA 3TQ1A 3DLKA 3MUMP 5DJBA 4OHZA 5L1KA 2Q6BA 2AGQA 4YP3A 4F26A 1YZ7A 2HKEA 2ASLA 4AQYJ 4WE1A 1B0TA 2OO4A 5ETSA 1ZETA 2B43A 3MAQA 3GV8B 2YNIA 2OKQA 1YQHA 3K5MA 1U0SA 3AJDA 3Q89A 4B9SA 2YNFA 1JLFB 4MAKA 3FK4A 1H98A 2EK6A 3A12A 2HZCA 1X7VA 5LMNJ 4DDFA 3L3CA 3ZZ0A 1FFGB 1VGYA 5HP1A 4EZ9A 3S6EA 1MSWD 3FC9A 4YHHF 3VGTA 4RW6A 3M9MB 1OPZA 4K4WA 2LQ5A 3W5ZA 4HEA9 2DHXA 2ASDA 3BQ0A 1TV6A 5IM0A 1HWKA 2BANB 2CJQA 2H65B 4GVBA 1NK5A 1RTJA 4GC6A 4NXNJ 7FDRA 3EPIA 1RISA 2WTFA 3DRXA 1S9GA 2QA4S 3G86A 3V6DB 5IV3A 2HNZA 4QWEA 1LW0A 4F0KA 2C2RA 3N4WA 2KHDA 3GFXA 3ZZYA 3DLGA 1U1NA 1KOOA 3BBFA 2IVMA 4EMDA 1MWZA 3DI6A 1HI1A 1C1BA 1SXLA 3KG4A 2ZH7A 1NJYA 3AA9A 3J81j 4KR0B 3IP0A 4M8LA 1LNQA 3FCVA 2G1HA 3TQEA 4OX9J 5DETA 2JEIA 4IFVB 3QRQA 2GQ2A 2DY1A 4MYTA 5AE3A 1REGX 3MUVP 1ZOTA 2MZQA 5G4DA 1TL1A 2FVSA 4IG0A 1VBZA 2NZCA 2V4JB 4DF4A 3KNAA 4DFJA 4QU7A 3BH6B 4J37A 4CLLA 4M5MA 4UTGA 4LF9F 3DRPB 2FZGB 2B51A 2MZJA 2MKIA 2GO8A 3TUIC 5GAEI 5FIIA 4EYIB 1GX6A 3MOZA 1X9WA 5KFWA 5GAGU 2E66A 1WG5A 3Q83A 4P7VA 3UWTA 2V9KA 3V6HA 3GE9A 1N48A 4TXSA 3T1HJ 5KFDA 1S6OA 5T14A 1NKEA 2PEBA 1OS5A 1SCJB 2AEFA 4ALZA 1S0OA 3T5LA 4JI6J 1HBOB 1XK8A 1M1KT 2MQ8A 3GJRB 2NS1B 2WVFA 3FMWA 3BS9A 2CPHA 4ZVTB 4CYUB 3MMCA 1Y5NB 1WD6A 4G1QA 3TUZC 2XLJA 5F8HA 4K2XA 3P5BP 5I42B 3T5HA 2GMHA 3QRRA 3HFVA 1RHQB 1S59A 3EWGA 2C2KB 4ZVGA 3BBCA 3IWNC 4A8OA 4RW7A 4KFBB 1RTDA 3QMQA 1TL5A 2UU9J 4OL8A 2KDOA 4DSIA 4WZMA 4HT7A 1IWGA 1SC3B 3KFWX 3QATA 2CPZA 3VAHA 4NI2A 3HFKA 3EICA 1AFJA 3KJNB 3CDEA 2HEKA 4J5OA 5THWA 1M5KC 3CDWA 4U7UK 2ATLA 1F60B 2Y1JA 2NCKL 2KJWA 2CJ9A 4BS2A 3A8JA 1HQUA 3PW7A 4JI7F 4ZCMA 4KHPJ 4HH0A 1HI0P 3PX6A 5D4LA 4LSNB 4F7VA 3GFHA 3BH7B 3MM8B 2ATCB 2R3VA 3SXLA 4EGLA 1B7YB 2R4FA 2I2YA 3PR4A 2VV5A 2C2MB 4ED6A 3GIRA 4P2SA 1LK7A 1IBKJ 3T6JA 2QFIA 1SPBP 4WZQA 1UETA 2IMOA 3LOUA 4DCOB 1HQEB 5BYRA 3TZZA 4ZJOA 3E01B 1S12A 1R89A 1BQNB 4ZVFA 2D7SA 5KFGA 5HJXA 3R1HA 1KR4A 1U2CA 5KG5A 1M5PC 2IM3A 2V68A 4OI1A 1MMLA 4N47A 4WFXA 2JEGA 3NL0A 4NZ7A 4ED1A 2NR0A 1XNQF 2R2UA 3GP9A 3LO3A 1QSSA 2A0FB 3M8QB 3UN2A 2OSRA 4DSKA 2MLXA 4WPAA 4Y2IA 4TQSA 5KFAA 2WOMB 1KDNA 3SMZA 2UVRA 2G9OA 1AROP 4J9SA 1Y4ZB 3CJ8A 4JI1J 3FEYB 3EXCX 1QD1A 2ROGA 4E8UA 3K5LA 2LVWA 2HZAA 4IOAQ 1UL3A 2HFOA 5KG1A 3FKBA 3R1LA 2VD3A 4B3TJ 3H90A 1WKJA 4DV6J 3UD4P 1UFWA 1JX4A 2OJ3A 2PD1A 1FXLA 2MZSA 2K7JA 2ZFHA 2ZH1A 3DLBA 4OX8A 4MKVA 3KHGA 3JSMB 2CUYA 2J9CA 2BMBA 1HYSA 3CIMA 3DU6A 1IM6A 1KTQA 2W4CA 3FEZA 3ZC4A 1YKWA 4C9DA 2GQQA 5KFCA 4MIBA 3C66A 3HHEA 2FJEB 5HMZA 2FZKB 2HHHF 4KRWA 2XS2A 4M5IA 2JFDA 1RTIA 4PUOB 4PWUA 1N33J 3HP6A 3OUYA 2VKRA 1BQMB 3QLHA 4BC9A 1U0HA 1RHKB 3D3BJ 3MXHP 3MD3A 4X4TA 1U24A 3NGRA 2ROPA 1KFDA 2YH0A 2C2DA 1X60A 2CJAA 4F02A 3H42A 3MUTP 4ECQA 2EXUA 2QC3A 1DBDA 3D9BA 2E5IA 2OPQB 4DL4A 2RILA 4AYBD 3HKWA 2CDQA 2C3MA 1N36F 2RUSA 3CGIA 1RT2A 3A1YG 1JB0C 3MDFA 3UE2A 4B3MF 1NAQA 1N0UA 4HVZA 1WC3A 1UZDA 4OYWA 2AZ3A 1MU2A 4RNHA 1P6TA 4PR6A 2UUCJ 1WI6A 2W9AA 3FCHA 3I32A 2QFJA 1SIWB 4NZ0A 1AUSL 5E3PA 3RUBL 2LDIA 2W2PP 4I68A 2B3TB 2ABYA 3QSIA 3TAQA 4G1IA 5IC4B 4YEAA 4F67A 2ZUGA 2IHR1 4OZNA 2L9NA 4OHXA 2CWXA 1SQGA 1H3DA 1V3RA 1VQSA 4P73A 4M5GA 4O3NA 5E3CA 2Y1IA 3G96A 4TLQA 2DGUA 2HQFA 1ITPA 2HVEA 2OIHA 1RWVB 3PW0A 4PG8A 5FJ4A 4C8KA 2QMUB 1RU2A 5FD1A 3K89A 1L3TA 1YTYA 1TUVA 4ZVEA 4DQPA 4QOTA 4ZOSA 1G4CA 4YY3J 1UP1A 3IWLA 3MEGB 5LMUJ 1ZA2B 2WONA 4IUFA 4ZCIA 3IN5A 3JB9k 1R0AA 2HGLA 4XDDA 1MWYA 2ZVSA 1EJ7L 3H5XA 2VG5B 1C0UB 1TZ0A 3EE3A 5D77A 4OZ0A 1WACA 1XR7A 4ZIVA 3I6PA 3I56S 2KN4A 1P1LA 1N34F 5I3QA 3H2VE 5CZXA 2GIRA 3TVKA 3W2VA 1KLMA 1NK6A 2HNDA 3OT9A 2X1FA 1H72C 4M95A 4F4YA 1FEEA 2B56A 2EK1A 4DN0A 2CPEA 4TYBA 1CS4A 5KFSA 1N6QB 5KTQA 4DUYJ 2JHEA 2ZD1A 3BSNA 1U1OA 1OYDA 4DQSA 2BRLA 2R7WA 5GAEU 5IZHA 4NXMF 1VJQA 1HNIB 4F4ZA 3C6UB 5D3GA 2E9RX 2X1GA 4MK9A 2MPUA 4ZS6A 1C0TA 4OJ1A 4KTQA 3J80U 2IA6A 5B0GA 3F41A 5HSPA 1R0BG 1FO1A 1T9VA 1QE1B 4JB8B 3D7SB 3MR5A 2RQ4A 4EO8A 5K8PA 2VQEJ 1CJTB 3CCLS 4YDDB 1FRKA 2D3O1 4NLXA 4RUHA 1WG4A 2PGCA 2W24A 4A8XA 2A1BA 3M2VB 1RT7B 2GW8A 1U26A 1X4DA 2LA6A 5LJ3Y 4CLWA 5C24A 4PABA 4DV0J 2GZOA 1P27B 4KGZB 4ECWA 1IVZA 3J7YI 1U7LA 3FBFA 1NB2A 3RR7A 4DBQA 1O8BA 2ZH2A 2BQUA 4QQBA 4FBUA 4ECYA 3DXBA 2CNLB 2BOPA 1VMBA 4ZLNA 1VRUB 3ITHA 3KDNA 1XQIA 4DPYA 1RADB 4GO5X 1T11A 5J1PA 2W9BB 4QR1A 2KT2A 3QJJA 3NOGA 4QIEA 1W2BR 4LF5F 2ZNZA 3NP5A 1WG1A 5F8JA 2LFVA 4EYHB 2B8PA 5KFNA 3MPDA 4CCHA 5AJ3J 4Y2MA 1S4EA 1S97A 3NWGA 4DSLA 4LVOP 5B0BA 4DU8A 4USMA 1RTHA 1UA1A 5GADI 2NPFA 5CD4A 2K1RA 5KG3A 2VUGA 1I94J 3W63A 5K5MA 1UTAA 5F3TA 3M30B 1UAWA 3MFHA 3CCQS 3RB6A 4XPEA 3EPGA 2M88A 3DLHA 3MR6A 3CDBA 1JNRB 3Q23A 4X64J 4RW4A 4I4BA 3JXOA 2DBBA 3KLEB 4U8VA 5CYQA 1UEVA 2RH3A 2RHSB 5CQGA 1U8SA 4ZDNA 4U7UD 1NK9A 1LW2B 4HKQA 3M2RA 2VG6A 1U6ZA 3TEGA 2WVEA 1NHVA 1VLOA 4RWXA 1NRKA 1HNWJ 3QIDA 4O3QA 3MTJA 2X1AA 4LF7J 2BV3A 3OVAA 4I2PA 2ZJRQ 2OD4A 2EFQA 4XO0A 5FDLB 4QWBA 1UVMA 5KFMA 4LUBA 3I5BA 2DIUA 5HN0A 2CQ3A 3AD7C 4WIQA 2J8AA 4J9LA 4I7FB 4UUXA 3FDSA 3BGRA 3EVWA 3SQOP 3JYTB 3BQ1A 1VISA 4H4OB 4OYZA 1WUUA 4L72B 2FZCB 4FBTA 3HX9A 3K7RA 5E33A 5EDWA 2OD6A 3T1AA 4LFBJ 2M2BA 2CPYA 1NZAA 4K2JA 3ADAC 4WXOA 3QWPA 2KFNA 5HL7Q 2AYBA 2ACMA 5IC6B 3SYZA 4M5HA 2CKWA 3RB4A 4DFMA 5J2NA 3DCAA 5DLFA 2DO4A 4J90A 2F63A 3VWSA 2QGFB 4ELTA 2ZHOA 1JLBB 5KFJA 3KK2B 5F0WA 1BXNA 4WXWA 1ZPWX 2ZC3A 5HJYA 3EDQB 3KUHA 3MZIA 3QSYB 2WSEC 4CT8A 1TKDA 3CJTA 4OI3A 1DTTB 4NYOA 4IYQA 3M4XA 3T1YJ 1U49A 2DR5A 4P74A 3HSZA 4FXWA 2UUWA 4AD6A 1RAIB 1NSAA 4JI8F 3HVRA 1L3KA 1W7WA 4R5PA 4MIAA 4YB7A 5KT2A 4KO0B 4X4PA 3EZUA 5LXYA 2V8PA 1IUJA 1FXDA 2R7VA 1OWXA 2ZVIA 4NLRA 4N76A 3PACA 3W60A 4ID5A 4O3SA 2QRRA 4CO5A 1WC5A 4R0JA 2YX4A 2APOA 1RBLA 4N56A 1Y7PA 4NPOA 4F8RA 2JC1A 2R7QA 4ELUA 1P9YA 4HDHA 3D5MA 3L4BC 1BWEA 1U09A 1R7IA 2WRMA 5K8OA 1LWXA 1XEZA 2C2NA 3G8SA 1YHQS 4LIRA 2F8HA 3BEGB 1PSDA 4C8OA 1F9EB 1WTBA 3EZ5A 4TY8A 4K4SA 2LEAA 4C11A 3DHWC 1FEHA 1RI7A 4LFCJ 1N4LA 1H74A 4Q44A 3OJSA 4F2RA 3LUYA 4ZIWA 3NNAA 2L9DA 3TZXA 3MAHA 1SKRA 1T03B 2ZH5A 2HMIA 2BANA 1LKZA 5AXNA 1VRTB 2UUTA 4X4VA 4KH1B 3AFGA 1PJ6A 3MCSA 3DM2B 2DXDA 5EWEA 5KOWA 1CJVB 1IBMF 3PV8A 4ZP8A 3I31A 5JJBA 1FRXA 3JTPA 1TL4A 3DRRB 4DR3J 4EU0A 2JLFA 2VFVA 2B4UA 2FIUA 3HK2A 4HHUA 3SSQA 3ELHA 3G8TA 2R9LA 4S0MA 2VHGA 4O44B 4EUVA 2OGUA 5A8WA 2ZDPA 5L39A 2RE1A 4NX9A 5J2PA 1X4EA 4LSZB 5EHHA 2M0GB 1PGZA 3O1LA 2BBEA 4DR6J 2JDJA 4F0MA 5L9XA 2V4JA 2BKPA 4KC5A 3VGUA 1S0MA 3U27A 2HPUA 1NJWA 3UDLA 3DRPA 3M6UA 4JI3J 4CLFA 2PMWA 2HRYA 4ERDA 2PFDA 3FJ2A 4HLBA 3E3XA 4YFUA 2CPIA 2RQCA 3BBBA 5DDQC 3DN9A 5AE1A 1BHNA 1OYEA 2HS0A 3AOAA 1Q5YA 1XMOF 4CO3A 1S76D 3V81A 1XC9A 4LR8A 4FKYA 3OVSA 4ECVA 3ZFVA 4JV5J 2WVDA 3M6XA 2Z57B 4F3OA 1UVNA 3I4HX 3R2DJ 1R8PA 3J7YU 4GRSA 5E3AA 5HK4A 1HBOA 2F4VJ 2ZBCA 2B4VA 3DRSB 3PM9A 2GIFA 2QL7B 3CW2C 3M6VA 3GSIA 4ECXA 4WWSA 4DQIA 5J2QA 2DPIA 1LWCA 1GXTA 2XBPA 5I42A 3W64A 7FD1A 2DGXA 3NMRA 4DPXA 3HO1A 3CXCR 2V63A 1EX8A 1TKZB 1H0HB 3GQCA 5GVQA 4DS4A 3MPUB 1WF0A 4KFBA 4RW8B 2WBMA 3U02A 3TEHB 1RZMA 1CBKA 3QFHA 5GADU 4R0EA 4AXIA 2HHHJ 2IY5B 2VPWB 2R7UA 2ZNYA 2OFGX 5SUHA 2BUNA 3P3DA 5LXRA 3EGZA 3MEKA 1Y00A 2DR7A 1NBEB 1SC6A 3G6ES 2E29A 1GFWB 4FNHA 2W8KA 4LSNA 3IR5B 2YKMB 1V6HA 3Q8UA 1TVRB 3IGVA 2JWNA 4RL1A 2NLWA 2MTLA 3NS5A 3V6KA 3W3SA 1BC6A 2AD9A 2O01C 2CQ1A 1UVLA 5B0DA 4QIVA 2YH1A 1IQTA 1WSVA 1I6JA 1FA0A 1HQEA 3E01A 2BJ3A 3OVBA 4LF2A 4DL0C 4WK1A 1N5VA 1I51B 5T7LB 1FJEB 2BJ9A 1RU1A 4O4GB 1R27B 4LF8F 4DR2F 3GR0A 3VVTA 2NXJA 2MHNA 2OPPB 1OSCA 1PC5A 3BR9A 3M8QA 5K9FA 4M5NA 3Q0AA 1D9AA 2XZTB 1FK9B 3VQTA 3W8GA 2MJNA 4NCGA 1OY8A 4Y2AA 2HHQA 2JEFA 2H9ZA 2D3UA 4U8YA 4J9VA 1HBUB 5HI7A 2JZ5A 4H4KA 1YBUA 2IYGA 4KQZA 1ZM9A 1H7WA 4RWWA 2KRBA 3HT3A 2D69A 2RJZA 3OSNA 3I4PA 4TU7A 3NCRA 3JSMA 4LRDA 4JI4J 5IQQA 2V6AA 1VHIA 3NBPB 3K0JA 2BE9B 5C25A 2QL9B 2XB2D 1SV5B 2DNRA 4QPXA 1SQEA 4DUTA 1EETB 2MZTA 4DV2J 3IRXB 3C19A 3N0VA 1EKRA 3QT5A 1T8EA 4PUOA 1RAAB 1PAUB 5HBMB 1QVFR 3TJ9A 1BQMA 4ATNA 2AWZA 3P4UB 1WC4A 2UUAJ 2EG1A 2AYGA 2MQQA 4TU9A 2LU1A 1VQ5S 1Y5IB 3DU5A 3OXFA 1K44A 4DHVA 3H4BA 2DNKA 2RB7A 2OPQA 1S0NA 2UVWA 2XG8A 4C2MA 3AQOA 2RDIA 1JNZB 2NREA 2G2OA 3H20A 3GG0A 4PCQA 3NS7B 4HDGA 2ASYA 3WIUA 3QGIA 2HVDA 1U2FA 2VBXA 2AJ0A 4X66J 1E6VB 1YDLA 1R8HA 2R8KA 5KG6A 1C4AA 3A4TA 4F04B 2KM8C 5DM7Q 4OYOA 3D6MB 2IDEA 1ROFA 3G9CA 4PG5A 1B99A 4EZ6A 4DV4F 4M1KA 3Q2SC 5HQ8A 1Q8LA 3U1LA 3IBFB 4ZPDA 1VHFA 3KWMA 1TV6B 5IM0B 5GAHI 3RR8A 4CP5A 3BZQA 2PIIA 2J9DA 4NMLA 4ILRA 1JIHA 2XZDB 3BSAA 2LEPA 2BJ7A 3H2UB 2CNNB 3GLJA 5D6GA 5IT9Y 1NHUA 4DPOA 3TO8A 2EWHA 2G1DA 1SJ1A 4JV2A 4DSJA 3NGKA 2NYHA 2PA8D 3DLGB 1BQXA 2W7AA 1IBLJ 2WSCC 4QR2A 4B9UA 4FVMA 1FXRA 1C1BB 1VQMS 1C0UA 4DR4J 2OELA 3FQKA 2DXEA 1J2VA 2XZWA 2B8QA 2ZKUA 2V4RA 4UF4A 1FERA 4Q0BA 3JQJA 2CPDA 4N7TA 1IKVA 5EUHA 3D6FB 3M8WA 2YKAA 1FKOB 3W5XA 2AV5A 4JBCA 3C16A 4OZ3A 1B7FA 3I55S 1TL1B 1GNKA 4WJBA 4X62F 5F8NA 2YX1A 2W4DA 3CEDA 3CO9A 2A3JA 2V2ZA 1NXIA 2JJ4D 3UR3C 4K5SA 3PIOQ 2XO7A 2GJIA 2CQCA 4XDCA 4A8KA 2Z30B 5HMYA 1NLKL 3O5TB 1HNIA 3ZZPA 2CQHA 2H51B 3O2IA 3C6UA 4TU8A 2YKPA 2HQCA 3OTDA 2WBRA 3BDEA 2KXNB 2M8DB 3K2YA 3KLHB 4QWCA 2CQBA 5LL6d 1VC0A 2DYAA 1J5EF 2QV6A 1CJTA 5IT4A 2WSFC 4CLPA 1YG0A 2Y8YA 3UO0A 3G2XA 4AE5A 3QT6A 4O3OA 1X5TA 3M2VA 4IO9Q 2MKKA 4O3PA 2BE7D 3SZ2A 3PR5B 3KKFA 2CADA 5D0HA 5A0YB 4TNOA 4Z7YA 1HWJA 1YJ7A 3ISZA 1XR5A 1X5PA 3H5UA 1AYEA 2DGOA 3SCLE 1D9FA 1UKUA 2RRNA 1RYSA 1VRUA 1Y10A 1RTDB 2XNRA 2GS8A 4J9RA 2RS8A 1RWKB 2W9BA 4USTA 2WB1D 4DV1J 1C1CA 2GHVC 3IAM9 2CQ2A 1YX2A 3O44A 2N3LA 3VZIA 2AJFE 3DGVA 3WBZA 2O3DA 2V8VA 1Q81T 3Q86A 1ZAXA 3DNCA 3NY0A 3M30A 5H1SV 2F4FA 4C6AA 2I8EA 3QGGA 2NPIA 2Y0BB 1T9UA 1G6BA 2XO6A 3W9IA 4CH7A 3KLEA 3TZWA 5AXLA 5F0UA 4NLUA 1IR2A 4DV3F 2FJAB 6FD1A 2O1PA 2V8GA 3TX0A 2CVIA 1LW2A 2GA7A 2AEMA 2WZ1A 2YVSA 4DQQA 3I5AA 2EKYA 2P6SA 1IR1A 2CNOB 3KG0A 4WCEQ 3M2UB 2IM2A 2O66A 4DX6A 2QZ8A 2DO0A 4NZ6A 3J7Z5 1Q1KA 2AKWB 4R8UB 2VG7A 3WZ0A 5FDLA 4KGVB 2KXHA 3OJUA 1HPZB 4URSA 1M1GA 2RU3A 3P96A 1AA1B 2UXBF 2LXIA 2EVZA 5HVHA 2N4CA 5MAOA 2RQMA 3CT9A 3OFEA 1L3VA 3B4MA 4V19X 2JEJA 4B17A 3JYTA 4J9KA 4H4OA 4DR5F 3DFEA 2IVFB 1O0PA 2RMLA 2FVQA 3TAMA 3DC2A 1RBOB 4MK7A 4QWDA 2IRYA 3GWCA 3H2LA 1MWQA 2M8HA 3UCUP 1HARA 1KOHA 1UPMB 3DOMA 1HW8A 4HACB 2JRSA 1QLNA 3RBEA 1NCLA 2QYGA 3MECB 4DL2A 4QBUA 1MN7A 5KFTA 4EBDA 3DDKA 1HYSB 1HNZF 1H2UX 4K4UA 4O3RA 1TMMA 2LA4A 3FBEA 2HRTA 3W2WB 5L1LA 2KG1A 3AHPA 2PT0A 1UFKA 1FJ7A 1RWXB 2FLPA 2OUGA 2AZ1A 2W2MP 3TVYA 3PYEA 4ED4A 2F8EX 1Q7LB 4LRFA 1F0XA 1JLBA 2KO1A 2PFFB 1RTIB 2ACYA 5IS2A 4OV1A 2XHCA 3KK2A 4XAKA 4WU3A 1ZTTA 3RG6A 1H38A 3K57A 1YJVA 1S5ZA 4KGMA 4FPRA 2CZVC 1DTTA 4C48A 4UOHA 3OHBA 4NRTA 4QYZK 5KT5A 2EFGA 3UDEA 5B09A 1G1XA 2UUBF 2VFSA 2HK2A 1GQEA 4KO0A 1YGYA 3D66A 4FF4A 2DEJA 1SUQB 2BW7A 2O5DA 2QN6B 4OFZA 3QYYA 1LWEB 3BGLA 3FUYA 3WDOA 3LP1A 2C3UA 4JI2F 2MLYA 3BM7A 1MU2B 4V19J 2JVRA 1TFWA 1T3NA 1FRJA 1PYOB 4LBHA 4NA1A 1U1MA 1SC1B 1Y3KA 2C1EB 2D3OR 4CWBA 2UXCF 1GMWA 4J9MA 3GMGA 2D74B 3GFZA 5E3RA 5CYMB 1K73T 3OPKA 5GMKa 4NLOA 4A46A 1RA6A 2C42A 5D4PA 2U2FA 4HTJA 5DQIA 3MCNA 1S79A 1JKHB 4JI5J 3NMAA 3QIPA 1DTQB 4HYKA 5GAHU 4J91A 4CM0A 3FBBA 1WC0A 1GAOA 1S0VA 4QR0A 1BD6A 2HZVA 4Y2CA 2V69A 4R25A 1NSQA 4OI0A 1SH2A 1T03A 2MQNA 5KG0A 4DR1J 1UW9A 1IJFB 1KVKA 3SIPB 1VIXA 1GTEA 4K0KJ 2X7IA 5H9EJ 4IG3B 5K8NA 4OLOA 2WONB 5KFLA 4NEYA 1N5QA 1VQOS 1R0AB 1NSPA 2IFXA 1X4GA 3GCWP 2Z56B 8RUCA 1WWHA 3QAEA 2L3MA 1KQGB 1SH0A 1RABB 3P49B 3K8VA 1IM4A 2M7SA 2VF3A 4YUDA 4ZPVR 2CIMA 1VBYA 2KKHA 1SIZA 3HZGA 1Q78A 1P9QC 3OSPA 4B9NA 3FSIA 3MM5B 3I0RA 1FD2A 2J6SA 3LWLA 3AJ2A 5KFBA 2MSSA 3W2VB 1KLMB 2UP1A 3K17A 4KH0B 4BCAA 3UQSA 2R7RA 4O44A 2V5HG 4CQ1A 1CS4B 1XJWB 2ALYB 2XS7A 2DGTA 3ILLA 3RTVA 2ZD1B 4ILMA 3IXQA 1JXEA 1R31A 4ER8A 5KFQA 3Q8VA 5D0RA 4PXDA 2XMJA 5D3GB 2FD2A 1HR0F 4A8QA 3NS6A 2RAQA 2WW4A 5MLCV 2H4WB 5EX3A 3PEJA 3HULA 1N5SA 3IG1A 2DRDA 2YQ0A 3MEEB 4E98A 3HVTB 1CSJA 3OXLA 1WEYA 2V8DA 3OBIA 3VQSA 1KC8T 4NLVA 2DB1A 4HH1A 4GKJJ 5JUMA 2OLWA 5GMEA 5ETTA 2YNGB 5EGYA 2LQJA 4DSEA 1WHWA 4KY3A 2XSFA 5C24B 2HAFA 4ED7A 3SV3A 4Y28C 1U1PA 4J9PA 3DRSA 2EFOA 1UPPA 3HXMA 2YWHA 3MR2A 2XI3A 4QCLA 4LMZA 1FCAA 1R8AA 4PEOA 2P6TA 2DNQA 3MHYA 1NPKA 2UXDF 2QLFB 3T6BA 1TKZA 2FQQB 4K4ZA 3QGHA 4CT9A 1X31C 2ZDOA 2FLOA 1B70B 1KRPA 1N32J 4RW8A 2P8IA 1TFYA 2QL5B 1M5VC 3D2WA 3POTB 2KFZA 5L46A 4P10A 2J7KA 3B8HA 3TA2A 4RJVA 1FE4A 4ETZA 1IKWB 3FFIB 3QJPA 3JQKA 4CO4A 4LBIA 1FDAA 2FGOA 2AJ2A 3DDIA 1RTHB 2ZHAA 1RP5A 4X4OA 1KQSR 1QAIA 2AJ1A 4LR9A 3QT8A 3LAMA 2HQ3A 2YKMA 2DH9A 1Y9OA 2K3IA 1TVRA 2DJWA 3SSSA 5BR8J 3GR1A 2LECA 3HI9A 2WHOA 3TVZA 5ETQA 4ZVRB 3M8PA 2VOPA 5CCLA 2GHPA 3MMJA 2LCWA 3W1YC 3QZ7A 1T05A 4W4MA 2XMMA 4WK3A 2CZ9A 3OL7A 1E6YB 2VG6B 5IXUA 3PY8A 2BXJA 2F3JA 3CSKA 3TW0A 1MW7A 4X84A 3W7BA 1U8WA 1KWMA 1GMWD 4LQ3A 1Y3JA 1DHMA 2XMVA 5CZVA 5KFIA 4N8OA 1QSYA 3IS9B 3ISND 2OPPA 1B4SA 1H6KX 1CQNA 5A8RB 1RYRA 2W9CA 2X51A 1FK9A 5M2RA 2ADCA 5HMXA 2BE2A 4UZCA 2KH9A 1TUWA 4RUBA 3EDRB 5A2QU 4HI2A 3R5AA 1Z1ZA 3OV7A 4N5SA 1S6QB 9RUBA 2MKHA 1T3OA 2E44A 2HFNA 3A8KA 1X0PA 1S6PB 4JI0F 2QMXA 1F1BB 5K8MA 2C3PA 3BN4A 3ENQA 2BW2A 4M5JA 1N0VC 1HBNB 1CEZA 2BJ1A 1S6UA 1BLUA 4G6VB 5J2NB 1S1VB 3UI3A 3BV8A 4DV5J 1X9MA 1Q82T 5DG7A 2B5JB 3EUNA 2E5LF 4KB7A 4DV7F 1D8YA 2KT5A 3GTYX 3OTOJ 2CG8A 4P71A 1SV5A 1L5UA 1QUPA 2PEHA 2KZZA 3IRXA 2B9EA 2JLGA 2GJ2A 5HBMA 2HK3A 3V4MA 2F5GA 1WNEA 2J0QD 1RT5B 5KOXA 1HHQA 5KT3A 1FX4A 1ZA1B 2AP6A 4G1PA 3PJXA 3V2UC 1SC4B 2EFVA 2KVQE 5F41A 3KG1A 4R5PB 2AU0A 4ZN3A 4LF6J 3RW7A 2C3YA 3SFGA 2IPOB 1D3WA 3S7RA 2QJ3A 1IQZA 2B9YA 2FB0A 3SDEB 2VOOA 3FZBA 1SI9A 3OLBA 2MQMA 2R8JA 4ID5B 2UV8A 4C98A 3PYGA 3VGVA 2YXLA 2VBYA 4DJBA 1RTZA 2MQOA 4B3SF 2N7CA 3AXMA 4LF4J 1HWIA 3J81U 3OQ2A 2MY8A 4QJVA 2FUG9 2P2CB 1E6VA 3HJFA 1KD1T 2W1BA 1LXJA 2W8LA 4C8NA 3MPWA 4NL5A 1Q16B 4L76A 4H54A 4YOEA 4TY8B 2ZM6J 2MGZA 5C42A 1XNRJ 3NGTA 4C11B 1HNVB 2KL8A 3PDNA 3TI0A 1V5IB 3KMSA 3MI7X 4Q2MA 2J7WA 4WBFA 2LXUA 2BJ8A 2OEJA 4ZN1A 5DLGA 3ETOA 3BSCA 4ZPBA 2HMIB 2A10A 3R7BB 3Q8PB 2W25A 4Q8EA 3UPFA 2IM1A 1AB8A 2FPHX 2VPYB 2QO3A 3IM9A 4Y65A 3TA1A 4RNNA 4CH0S 4OJ3A 1RK8A 2ZBPA 3M1VB 2Q6CA 3B4DA 5BYSA 2CAJA 2DGQA 4RKUC 2YTCA 2Y1RI 3H4DA 1HNXF 1RGVA 1M5OC 1P8GA 2HS3A 4B9VA 2WB4A 3HD1A 1VQPS 4CNZA 1XWLA 1XTZA 2IBKA 1NJZA 5B0EA 3N6LA 5A8WB 4P75A 3DDNA 1FKOA 2W2NP 4I0WA 4GO7X 3D0IE 2HWHA 1WI8A 2B4PA 4AQYF 1Q7YT 2HHSA 5J2PB 4TY9A 3M8ZA 1X4AA 5AXMA 2HNYB 3ENVA 2ZH6A 2QLBB 3I9ZA 1H73A 3E51A 4RW9A 5LM7E 2FHJA 3P45B 2RIJA 2GHWA 4NLGA 2KYZA 5L1IA 1CLFA 1FF2A 3CNQP 4FZVA 3WX8A 2F8MA 2J76E 3KLHA 1PO6A 4GKKJ 2DRAA 2Q43A 1ZM3A 1MROB 4DG1A 2PO4A 2R7TA 5LMNF 3PW4A 3CCMS 1HKAA 3V81B 2FY8A 1DQAA 2DNPA 3NCPA 4C8ZA 3DMJB 1FJGJ 3OFFA 1KEKA 1T94A 4IDKA 2CPXA 1XR6A 1AT1B 3KLFB 4USKA 1HWLA 4LFAJ 1OY9A 5A0YA 5IWAJ 5F9LA 2V50A 5J2QB 1NM2A 1LWCB 2Y0SD 3S01A 3MCOA 3PO5A 3NLCA 2FJVA 4E0DA 3N5FA 2AIRB 4NXNF 3UFCX 1JJ2R 2JL9A 2XCAA 5H9FK 4Y0FA 3CMES 1TKXB 3GYGA 4K59A 3D6TB 4CIOA 3HHLB 3N01A 3AA8A 3D0GE 4UY85 4NLYA 3GIMA 1DQ9A 2FC8A 2HHVA 5A2QY 3LQVA 4DL7A 2GMLA 3KLGA 2KB2A 4CI0B 1Y11A 3DGPB 2XC9A 4ZJQA 2CXEA 1RWNB 1TKTA 2RF2A 2L9WA 4OX9F 2G0JA 2YWEA 2G2ZA 1VQ7S 5ETKA 3MOJB 3FVYA 1AZSA 3BB5A 4F3MA 3MM9B 2H5IB 3M32A 3QFWA 4F25A 4NLPA 1F9HA 4Q2LA 1IXKA 1R43A 3ET6A 1YJNS 1EQMA 2DNMA 2J8SA 1S99A 2ILZA 2HVIA 3PG9A 3VR1A 4GVLA 2MLZA 3QT7A 1P1TA 1NHKL 1VC6A 3RZAA 4ZKAA 5SZTA 2M70A 3KOAA 1SKSA 1F3VA 5RUBA 1SJFA 4CLKA 1Q5VA 3RAMA 1YITS 3M2UA 3ETMA 4KSEB 3MURP 3OD2A 4OYMA 3QWUA 1NK0A 4R8UA 3T1HF 2P5VA 2J6UA 2JLEA 5G0RA 1FHTA 4DUZJ 3D6HB 4C97A 2E5GA 2IBOA 1RB0A 1HPZA 3EYZA 4JI6F 5BXIA 4PQUB 5J1EB 1J5OB 4NCGB 2XSJA 3T41A 4MT1A 3SBMA 3VF0B 3MD1A 1N8RT 1VFJA 2XI2A 4NLWA 5ETLA 1FRIA 4X4SA 4H4MB 1RHJB 3CJKA 3W66A 1YI2S 4HACA 3CCES 3AD8C 2UU9F 1KLNA 3G8QA 3J81Y 3AB2B 2CJKA 3ICLA 3MECA 2DPJA 3ZXWA 2DIVA 4OYPA 3B82A 2XHWA 3MR7A 2VODA 1OMSA 3W2WA 1UVKA 3HVWA 3G71S 3T3FA 2DR9A 4EK2A 5C25B 4C8YA 3H5SA 4KBIA 3UVJB 2GGPB 1KFSA 4KHPF 4HT5A 2HG4A 1KP6A 2BX6A 2EG2A 3H0PA 3EM1A 1ZM4A 3RJMB 3IFEA 3W8PA 3RRGA 4FDFA 1MN9A 1IBKF 2E5JA 3HT0A 5KFHA 3HHNB 2B9XA 5C2CA 2VIHA 2ADBA 2DNOA 3C15A 4TVAB 2HHWA 3MMAA 2CQDA 4JV0A 2FHJD 3M8SA 3ISNC 2AX1A 3US5A 3UDVA 4HR2A 2DGSA 1SUQA 4QW8A 3R5JB 3QBCA 2NXUA 2R8IA 4X65J 1LWEA 5KG2A 5A8KA 1XMQJ 2RRAA 2FLNA 1AXQA 2VQFJ 2YY3A 5ETPA 5HLFB 4USJC 1FRHA 4J9OA 2BKOA 2J0WA 2LU2A 2RRBA 3C2PA 1H2TZ 5CYMA 3PJ9A 1NZ8A 2HAIA 2EC0A 4JI1F 2C28A 2ZOGA 2JVOA 1S4FA 1JKHA 1D8ZA 2OP5A 3PFEA 3FSXA 1JLAA 4O4RA 1DTQA 4B3TF 4I1TA 1X5OA 2ZZNA 4DV6F 4I6WA 1OY6A 4E2FB 4A8WA 4DN9A 4ECTA 5HROA 5M2PA 3OHAA 2A6OA 2A2DA 4KJIA 2KG0A 2AHOB 4C3LA 2RNEA 3ENWA 4U6PA 4IG3A 2D9PA 4LF1A 4O23A 1FWPA 1UFLA 3UD5A 3B78A 2B4OA 3CPWR 1LOUA 4ES2A 1S1TB 3QJLA 2GV1A 1AUDA 4OV6A 3N9UC 2XULA 3JQMA 2XY6A 5KFYA 1N33F 1SL2A 4WIIA 2ZH8A 5HMWA 2C22A 5LSLA 4IOCQ 4Q0BB 1GX5A 2GVDB 3E8OA 4WTYA 1IKVB 4ZJLA 3MM5A 2HWIA 1NNDA 4PKDB 2YPZA 3C16B 1VOMA 3K58A 2KVIA 5DQGA 1IKXB 2Q66A 5JVGQ 4USWA 5ETMA 3KK1B 2EFNA 1U47A 3BYRA 4U96A 5I3UA 4NMXA 1NK4A 3C8YA 3BYPA 3CCZA 2QSWA 3CMAS 3W5YA 4NCBA 3GU0A 2HURA 1SBRA 3IA0A 4OZJA 2UUCF 4ZPTR 3QRPA 1B64A 4ED0A 3KDOA 2IM0A 4L3KA 4DX7A 2W7OA 2F1FA 3MEEA 3HVTA 2HFZA 9ATCB 1PJ7A 3G82B 1F2HA 1WEZA 1S1UB 1ZZNA 3PNIA 2GCFA 3CMQA 3TP2A 1HIYA 1PILA 2FLLA 4PG4A 2X3GA 2JC0A 3CD6S 2YNGA 2ZBQA 1VJWA 4OHYA 2J5AA 1T0TV 2F7VA 4PXCA 5KT7A 3KHRA 1DRZA 3C46A 3GYXB 1RKJA 2LQ9A 3BF4A 3X3UA 1A6LA 3AH6A 1I1GA 2ZOMA 4P6QA 4KHRA 2OHDA 4ZP9A 4JYAJ 2DGVA 4HI1A 1CJKB 4YY3F 5L8RC 2EKNA 5LMUF 4DR7J 2R7SA 3CVKA 2ZH3A 4NLQA 2Y9HA 4KKOA 4ZPAA 2CJYB 1C1CB 4B3RJ 4I64A 3PKYA 4F3QA 2VJUA 1CC8A 1S49A 3Q24A 4M5DB 4KGXB 3GIIA 2VPZB 1WJ9A 3POTA 1Z2LA 2VFRA 4BLGA 3BJYA 2CWKA 3CJ5A 2VKZG 1YBTA 2ILYA 1IKWA 2R2SA 3FFIA 3OTEA 4FS2A 4ZVPB 2IAJA 1EP4A 4IQMA 4CO2A 2IJNA 5KG7A 3OL6A 3R97A 1QJHA 3JS9A 2BVZA
chains in the Genus database with same CATH topology
3SFUA 3C6TA 5A6PA 1FDBA 4P2SA 2NUHA 4I69A 2I8EA 3CCSS 1LK7A 3QGGA 2NPIA 3T6JA 3RB3A 1G6BA 3U7JA 5EWGA 3BO2A 2KI2A 2EFPA 4WZQA 4NLSA 1D0EA 2I1RA 3LGNA 1UETA 2BABA 4DUYF 2IMOA 1VI7A 3LOUA 4MIWA 4CH7A 2E1RA 3KLEA 3RB0A 4FVCA 1HQEB 5BYRA 4NYZA 5AXLA 5F0UA 4NLUA 1B0VA 1TAUA 4DX8H 4DV3F 1HL6A 2VBWA 3E01B 2FJAB 6FD1A 1BQNA 2O1PA 2V8GA 1R89A 1BQNB 1KHVA 4ZVFA 2CVIA 1LW2A 2D7SA 5KFGA 2GA7A 2IRUA 2HVZA 2I38A 2I0XA 1TK0A 2YVSA 2RVJA 3D1QA 3R1HA 1URNA 4DQQA 1KR4A 1XN9A 3I5AA 5KG5A 1M5PC 1E6YA 2EKYA 2IM3A 4A4JA 2P6SA 1V9OA 1T02A 4OI1A 1MMLA 3KG0A 4PPZA 4WCEQ 3M2UB 4N47A 2IM2A 2O66A 4WFXA 2JEGA 2QZ8A 1R3NA 3NL0A 3MMBA 1OQ6A 2DO0A 4KHMA 4NZ7A 4NZ6A 2F9JA 3MMBB 4WFZA 3J7Z5 2VQEF 1Q1KA 4ED1A 4U67Q 4RX6A 2NR0A 1XNQF 2R2UA 1ZAWA 4R8UB 2VG7A 1U1QA 4H4KC 3WZ0A 2VG7B 2AYEA 2BRKA 3LO3A 1A7GE 5FDLA 3PXGa 5J2MB 2KXHA 2YNHA 1G3OA 1QSSA 2YNHB 2I9SA 2QA4G 3M8QB 2VBZA 4DSKA 2OSRA 3TANA 3OJUA 1HPZB 4Y2IA 3EGNA 4URSA 1FD8A 2RU3A 3P96A 4TQSA 3IS9A 2DNNA 2WOMA 3LAKA 4GKJF 5KFAA 1DQ8A 4LSLA 2UXBF 2LXIA 2WOMB 2Z2LA 4IOBA 4EBCA 3RW6A 2EVZA 3J7ZT 3DLEA 2DT9A 3SMZA 2UVRA 2N4CA 5MAOA 3DLEB 2RQMA 2G9OA 1AROP 2E7XA 4J9SA 1Y4ZB 2V2KA 1K9MT 3CT9A 5A8RA 3OFEA 2OPRA 3FEYB 4QIWD 2O67A 3PZPA 1L3VA 3B4MA 3EXCX 5JVHQ 4V19X 2JEJA 4DV0F 4B17A 3JYTA 2ROGA 1UVIA 4E8UA 4J9KA 4H4OA 3K5LA 1TL3B 2LVWA 4DR5F 3CTRA 3DFEA 2IVFB 1O0PA 2RMLA 4OLPA 2FVQA 4IOAQ 1VQ8S 3TAMA 5DDOC 3SI8A 1UL3A 3DC2A 2HFOA 3KJVB 3TAMB 5KG1A 4MK7A 1M0SA 1XBWA 3R1LA 1N5TA 2VD3A 4QWDA 1OPIA 2IRYA 1FKPA 1NU4A 2F40A 1WF2A 2RKIB 3GWCA 3H2LA 1S6QA 2JSXA 1RKIA 2M8HA 4XPCA 4QIFA 3UD4P 4B3OB 3UCUP 1UFWA 1HARA 1KOHA 2ERRA 1M5SA 2KHCA 2R7OA 3DOMA 1JX4A 2OJ3A 1FE0A 1VLYA 2PD1A 1HW8A 1FXLA 2ZKTA 2N82B 2AJ4A 2I5JB 2MZSA 2NUUG 2JRSA 5KFZA 1S6PA 4QW9A 1QLNA 2K7JA 2ZFHA 3RBEA 2ZH1A 4EEYA 3DLBA 3VAIA 1SKWA 3PX4A 4OX8A 3KHGA 3MECB 4L3NA 5LSOA 3KK3B 4DL2A 4N77A 3JSMB 4QBUA 4C7QA 5KFTA 2C2EA 2J9CA 4DL3A 1VIOA 1CVJA 1HYSA 4EBDA 3DDKA 1HYSB 1HNZF 1H2UX 4K4UA 1QUVA 3CIMA 4O3RA 3DU6A 1N32F 1HBNA 3QGPA 5ADZA 1KTQA 2LA4A 3W2WB 2W4CA 5L1LA 3FEZA 2RQKA 5AJ3F 3ZC4A 2KG1A 4HTIA 2D3ZA 4C9DA 3AHPA 4MFBA 3HMJG 1S1VA 2PT0A 1FJ7A 1R6YA 2GQQA 3N5BA 2FLPA 5KFCA 4A48A 1NKBA 4MIBA 3C66A 1RT3A 3HHEA 2FJEB 3CUNA 3TVYA 2B5JA 1U6FA 5HMZA 2F8EX 2HHHF 1Q7LB 2CQ4A 5KFPA 3VAFA 1XERA 4KRWA 4WFAQ 2CRLA 5D4NA 2XS2A 5CYJA 2JFDA 1CPZA 1RTIA 1F0XA 1JLBA 2KO1A 1I94F 4PUOB 3KHHA 2PFFB 1RTIB 2YWFA 2ACYA 2D1CA 3RRHA 5IS2A 4OV1A 4PWUA 1FNXH 3HP6A 3KK2A 4XAKA 3OUYA 2VKRA 1ZYQA 1UJ4A 4Y3CA 4Q8FA 1BQMB 3SCIE 2XWYA 4Q43A 3QLHA 4NA2A 4NYPA 4WU3A 4WFYA 4BC9A 1UVJA 2KJVA 4ZMMA 2H5EA 1ZTTA 3DLKB 4NA3A 1L3SA 3MXHP 3MD3A 3K57A 1H38A 1F9FA 4RBVA 4X4TA 1YJVA 1U24A 4ZCKA 4KGMA 4FPRA 3NAHA 1RT5A 1KONA 2CZVC 5BR8F 1M90T 1DTTA 4X64F 2ROPA 2ZBIA 1KFDA 5H9FJ 2XEXA 4ED8A 2YH0A 2C2DA 3OHBA 2CJAA 4NRTA 3KHLA 4F02A 4W92B 2MZRA 4C4WA 3MUTP 2YX7A 4ECQA 1JLEB 5KT5A 2EFGA 2EBGA 3CF5Q 5B09A 3HF5A 5M2UA 1DBDA 1G1XA 4WE1B 2E5IA 2UUBF 3I0SA 2VFSA 1JK9B 4ECSA 1U1RA 3IRWP 2OPQB 3D1HA 4JUZA 1GQEA 5L38A 2RILA 4DL4A 4AYBD 3HKWA 4KO0A 1S1XA 2CDQA 2C3MA 1YGYA 1SJ3P 1N36F 3CGIA 1RT2A 3GZ7A 3PW5A 3A1YG 5F8GA 1VQ6S 5IQ6A 1JB0C 4FF4A 3MDFA 1SUQB 2YNIB 4ZK7M 2PDAA 3UE2A 2O5DA 4WYLA 1NAQA 4B3MF 1N0UA 4HVZA 4OFZA 4OI2A 1X4FA 1ULRA 4LJMA 3QYYA 1LWEB 3BGLA 3WDOA 1HNWF 2YNFB 3SDEA 1YIJS 3UD3P 3LP1A 3NAIA 2C3UA 2CQGA 2WCXA 4JI2F 4LF7F 2AX0A 3LP1B 3BM7A 3K5PA 1MU2A 4F2SA 1MU2B 3K5OA 4RNHA 1P6TA 2R7XA 5E2QA 3VAKA 4PR6A 4V19J 2JVRA 1NJXA 2HGMA 1WI6A 2W9AA 1TFWA 2IYIA 3S1TA 1T3NA 3FCHA 2ZZMA 1FRJA 3I32A 4NA1A 1SIWB 2DNYA 3CDAA 4NZ0A 2QFJA 1Y3KA 1U1MA 3ONQA 1FTRA 2CJBA 5E3PA 2VA2A 1C2PA 2D3OR 4Y34A 2LDIA 2UXCF 4J9MA 3GMGA 2D74B 4I68A 2B3TB 2ABYA 3GFZA 4NOHA 4J9QA 3TAQA 4G1IA 5E3RA 5CYMB 2MB0B 2FC9A 1K73T 4YEAA 4F67A 1IR0A 2FDNA 2ZUGA 3OPKA 5GMKa 2IHR1 4OZNA 4NLOA 4OHWA 5L9NA 2L9NA 4OHXA 3TRGA 4A46A 5HP1B 1RA6A 1HFEL 2XLIA 4XK8C 3CJ2A 3DXSX 2C42A 5D4PA 4WKYA 3OL9A 1H3DA 3CIZA 1U48A 3MF5A 1V3RA 2U2FA 4HTJA 5DQIA 1VQSA 1S79A 4FF1A 1JKHB 4C3KA 3LP0B 4O3NA 3NMAA 4RW6B 5F3ZA 5E3CA 3QIPA 3JTOA 1DTQB 3QIPB 4HYKA 2Y1IA 3G96A 2Z8QA 4TLQA 5GAHU 2N3OA 4C0HA 2DGUA 4DSFA 2OIHA 3PW0A 2ZC4A 4PG8A 3DOLB 1GAOA 2XY7A 5FJ4A 4C8KA 3D54A 3BO3A 5CA5A 4A8MP 1S0VA 1Y0HA 4QR0A 1BD6A 1K8AT 1HNVA 4Y2CA 4LFBF 3CE8A 1X5SA 4CTAB 4ILLA 4R25A 5FD1A 2MZ1A 1RTJB 3AAWB 1S10A 4OI0A 1SH2A 2SXLA 1X9SA 2OMOA 2VFTA 2J7UA 4OIXA 2IVYA 3J80Y 1L3TA 4ZP7A 3TA0A 3UCGA 3JTNA 6FDRA 1YTYA 3O3LA 1TUVA 1T03A 2MQNA 5KG0A 5D4OA 2XMUA 4ZVEA 1K0VA 4DQPA 1S9GB 4QOTA 4ZOSA 1G2EA 1IJFB 3D0HE 2FHMA 1VIXA 1UP1A 3IWLA 3MEGA 1GTEA 2HNZB 1KVJA 3MEGB 1LW0B 1WEXA 5H9EJ 4IG3B 5K8NA 2WONA 4OLOA 1WHXA 4IUFA 2WONB