1WF0A

Solution structure of rrm domain in tar dna-binding protein-43
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
88
structure length
88
Chain Sequence
b'GSSGSSGVFVGRCTGDMTEDELREFFSQYGDVMDVFIPKPFRAFAFVTFADDQIAQSLCGEDLIIKGISVHISNAEPKHNSNSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TAR DNA-binding protein-43
publication title Solution structure of RRM domain in TAR DNA-binding protein-43
rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 11
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2004-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1wf0A01
3VAMA 5JVGQ 3RW6A 3CCES 3MD1A 2DNKA 1VBXA 2JVOA 2MKIA 2F9DA 2CPHA 3CXCR 1U6BA 2DNPA 2Q79A 5DDOC 3CCMS 4QPTA 3SXLA 1SJRA 1YIJS 4UY8T 2E5IA 2DH8A 3CD6S 3R1LA 4TU8A 3MOJB 4V19X 2U2FA 3G8TA 1FJEB 5IFMA 1X0FA 4ERDA 2M88A 1RK8A 2LYVA 2MZTA 3R1HA 2M8HA 3S7RA 2DIUA 2VOPA 4IO9Q 2DNMA 1D9AA 1VC0A 2PEHA 2JVRA 1M5VC 2LA6A 2DGUA 2N7CA 2XB2D 1X4FA 2DGOA 3VAJA 2M7SA 3MXHP 2MGZB 2KVIA 3J7ZT 2KG0A 4WKRA 2LEBA 4WFNQ 3J7YU 3MUVP 1WEXA 3UCUP 2X1AA 2ZJRQ 3UE2A 2M4MA 4M5DB 2X1BA 3CTRA 1YJ9S 3P49B 5CYJA 4RU2A 2DISA 3Q2SC 3S01A 1K8AT 1YHQS 4W92B 4TLQA 5LJ5Y 2LECA 3NNAA 1N54B 4EGLA 4Z2XA 2DHSA 2ADBA 2QA4S 1VC5A 2D9OA 1X4EA 1WTBA 2DNOA 1P27B 4OZ1A 3THPA 1XN9A 5CA5A 5DM7Q 1HD1A 2DB1A 1W2BR 2LEAA 3G8SA 2RS2A 2GO9A 3BO3A 4TU7A 4PRFA 3TYTA 2LXUA 3TO8A 1ZH5A 2GHPA 2LKZA 2EK1A 2MJUA 2RRBA 1WI6A 1HL6A 1U1KA 2KRRA 5BJRA 4TU9A 2QEXS 4CQ1A 2F3JA 2HVZA 2CQ4A 2AYBA 1VQLS 1VQMS 1U1PA 5DDQC 2XS7A 1HD0A 1WI8A 3U1MA 2DO4A 1YJWS 1VQ9S 1WF2A 3NS5A 2MKHA 5CXTA 1OIAA 2CQIA 3EX7B 2J0SD 3UCGA 5D78A 2I2YA 1WEZA 2FC8A 3ULHA 1VQ8S 2X1GA 3R27A 2YTCA 5GAGU 1VQ6S 2MZJA 3H2VE 3JB9k 3CMAS 3U1LA 3CCSS 2OJ3A 2O3DA 1OPIA 3Q2TC 2DNLA 1WHYA 2RVJA 2ZJPQ 2MHNA 1FT8A 2RRAA 2FPHX 2FY1A 1U1NA 2KFYA 3P3DA 2MKKA 4LMZA 3G4SS 1PGZA 3H2UB 2HZCA 2CQ2A 3PIPQ 2DGWA 2MZRA 3G71S 2LCWA 1X5OA 4UQTA 3CULA 5HO4A 3CMES 1WHXA 5HL7Q 4OZ0A 1H2VZ 1SJ3P 1QM9A 2J8AA 2DHAA 1CVJA 1WF1A 2CPEA 2MGZA 2MSSA 1M5KC 3TP2A 3DLLQ 2N3LA 1FJ7A 2A3JA 2AYMA 3MDFA 1M5PC 1U1QA 2CQPA 3VAGA 2E5HA 4ED5A 1WEYA 2YKAA 5IQQA 1KQSR 1X4GA 1Q86T 1HA1A 1SJQA 2DK2A 2MMYA 4QU6A 1URNA 3MUMP 5FJ4A 2KRBA 3VALA 2CQBA 2KI2A 3K0JA 2J0QD 5ITHA 2KU7A 1AUDA 5DDPC 4PKDB 2CQHA 2MQLA 3CCQS 1N8RT 1JMTA 1U1MA 1H2UX 2DH7A 3UD3P 3VAFA 3VAIA 2SXLA 1NJIT 5H1SV 2MKSA 3MD3A 1G2EA 3S8SA 3BO2A 1YITS 2XNQA 1WG4A 5DDRC 2E44A 3B4DA 2DNNA 2KG1A 4IUFA 3OW2R 1KOHA 2V94A 2MSTA 4F25A 2ERRA 2WBRA 1VQNS 2CPDA 2RU3A 1DBDA 2MQNA 3LPYA 2DHGA 1P1TA 1X4BA 2DNGA 2L08A 1X5PA 3G9CA 4P6QA 1WG5A 1VQ4S 3BEGB 2MYFA 3CCUS 2LMIA 5GAEU 2G1DA 2KN4A 3ZZYA 1NU4A 3I55S 5LXYA 5LXRA 1K73T 2DGTA 4IOAQ 2M52A 1UAWA 2OSQA 2DGXA 3G96A 2VOOA 2DHXA 2L41A 2DNRA 4YUDA 4WIIA 2D3OR 1WG1A 3CCVS 2M0GB 3UWTA 5IM0B 4LIRA 1X4CA 1UFWA 1UW4A 3VAHA 1A7GE 2UP1A 1DZ5A 5DETA 3CCLS 1VQPS 1IQTA 1VQ5S 1WHWA 2RQCA 3IWNC 2RQ4A 4IOCQ 2DH9A 2RS8A 2LQ5A 1U1RA 2DNYA 1N52B 2M9KA 1R8HA 2K8GA 1YJNS 2M8DB 1OWXA 4FXWA 2LA4A 2LXIA 3V4MA 2VODA 4WF9Q 2BOPA 2JRSA 1A9NB 3SMZA 2DNQA 1N88A 1KC8T 1D8ZA 2I38A 1R8PA 3S6EA 1M1KT 3CC2S 2CQGA 3US5A 3N9UC 2CQDA 1JJHA 1YTYA 1QVGR 3CPWR 5MLCV 2OTJS 4LJMA 2AYEA 2EVZA 4YB1P 3EGNA 4WFAQ 1VBZA 2RT3A 1X5TA 3HHNB 2CPJA 2N82B 3BS9A 3ZZZA 2CPYA 1UP1A 5LJ3Y 1M90T 1M5OC 2NLWA 2CPIA 2MJNA 2M2BA 4Y0FA 3CCRS 1SXLA 4F26A 2JX2A 2MZQA 2KM8C 1YI2S 1JJ2R 1WF0A 2XSFA 2CQ3A 2CJKA 3CC7S 2MQQA 3MUTP 1U1LA 1RKJA 2RNEA 3NMRA 1FHTA 2CPXA 4W90B 4C4WA 2MQOA 4QQBA 3IRWP 2YH0A 1O0PA 1H6KX 1Q81T 1FO1A 3HI9A 1WWHA 2L9WA 3VF0B 3PIOQ 3NS6A 2E5GA 4CH1A 2KXFA 5GAHU 2KXNB 3MI7X 3DXBA 1NO8A 3SDEB 4CH0S 5EN1A 2BZ2A 1L3KA 2DNHA 5D77A 2OTLS 3B4MA 3EGZA 5DM6Q 5IM0A 3CCJS 2MZ1A 1FNXH 4BS2A 2XS2A 1S79A 2G0CA 2EK6A 5GVQA 1U2FA 1BY9A 2ADCA 2MY8A 3LQVA 2B0GA 2J76E 2DIVA 1KD1T 3P6YC 2MZSA 4WCEQ 3UCZP 2KYXA 2QFJA 2M70A 5GMKa 1OO0B 1X4HA 1DRZA 2KM8B 1SJ4P 1U1OA 2DGVA 5GADU 4WFBQ 2CPZA 1VQKS 4Y00A 2HGLA 1U6FA 2YH1A 1X4AA 3FEYB 4J5OA 1WELA 3D2WA 2CQ0A 1DHMA 1Q82T 2AYGA 4YOEA 3UD4P 2DO0A 2X1FA 1FJCA 2MB0B 1JJ4A 1F9FA 2MQMA 4A8XA 2DGSA 4C0OC 1YWXA 1KOOA 1S72S 2YWKA 1B7FA 3P5TL 2DGQA 2XS5A 2CQCA 2MXYA 2RUGA 2OSRA 4PR6A 1QVFR 2MQPA 1X4DA 3G6ES 4ZKAA 2HYIB 1H2TZ 2XNRA 2KHCA 1VBYA 4CIOA 2DNZA 3NNHA 1X5SA 3CC4S 4FXVA 1ZZNA 1SJFA 3RW7A 4F02A 2MKCA 3VAKA 3NNCA 1K9MT 3CF5Q 3FEXB 2KXHA 2PE8A 3THTA 2AD9A 2OIHA 2HGNA 2D9PA 1VQ7S 2HGMA 1VC6A 2NZ4A 2FC9A 2MKJA 2U1AA 2CQ1A 1WHVA 1PO6A 5LSOA 3CUNA 5JVHQ 4C7QA 3MURP 2MY7A 2G4BA 4QU7A 3SDEA 2ZJQQ 2DITA 3L3CA 5LSLA 1Q7YT 2FHOB 2F9JA 2KH9A 4U67Q 2CPFA 2N3OA 1VQOS 1FXLA 2JWNA 1ZZFA 2KT5A 2VONA 2E5JA 2MPUA 3BO4A 2K3KA 3I56S
chains in the Genus database with same CATH superfamily
4DR5F 5DG7A 4TQRA 3JS9A 4G1QA 3FRYA 3DYAA 4KB7A 8ATCB 1C2PA 5DDOC 3SXLA 2BJDA 2XO6A 3I31A 1ZPVA 3LP1B 1CS4A 3A3NB 3VGSA 3L7PA 1PYTA 2J7UA 1VIXA 2CRLA 2HPUA 4R5PB 1LXJA 1REVB 1Y10A 3NOGA 1R8CA 3BBFA 2C3YA 5KFDA 2GC8A 3UCUP 4NE9C 2XMUA 3UE2A 4KR0B 2CUYA 1XMQJ 2DY1A 3T1YJ 4EGLA 2BQ3A 3LPEA 2QA4S 1HNXF 4OZ1A 2ZH6A 2H9ZA 2DB1A 2HURA 2XMAA 1PKUA 4TU7A 2NZCA 5KT5A 3TRGA 3DLBA 1ZH5A 5F8JA 3A4TA 4C48A 4Y2AA 4DG1A 2COLA 2NXJA 2KZZA 2VV5A 1TMJA 5DO2A 5F9NA 3AD7C 3KLIB 3UCGA 1WEZA 5T7LA 4X65F 1TK0A 3DRSA 4N47A 4IH5A 3T1HF 1NH7A 5C24A 5J1NA 1SUQB 1TFYA 4R25A 3PW7A 2FQQB 1VBKA 3H2LA 1Q79A 3QT5A 3CMQA 4IFYB 2D3O1 3V4IB 1YJUA 4CH7A 2KI2A 3G86A 1S0VA 5ITHA 2VKRA 5A2QY 4G3IA 1YLXA 1NK6A 2YWWA 1NJWA 1NPPA 4DL5A 2MDAA 4U6PA 4JV5F 3PR4A 2LXFA 3C19A 3IG1B 1HNIB 3BO2A 1FX4A 3QQCD 1JB0C 4XK8C 1U0SA 4OZNA 3WX8A 2CXEA 1UA1A 4IRDA 5CABA 2IC3B 2E7VA 4NA3A 4F8RA 3DOMB 5H9EK 3UWTA 4LIRA 4ANCA 1X4CA 1FKOA 2C3UA 1RLDA 1AB8A 4C0BA 3D5MA 3VQTA 4WBFA 1F2HA 3ZZOA 2RQCA 3ISZA 1FDDA 4ZCIA 1RWWB 4R8UA 5IT9Y 7FDRA 1OWXA 4DR2F 3HSZA 3EPIA 2E9TA 1Z4UA 1FDNA 2ZNZA 2QA2A 4NLYA 2Z0GA 3VGTA 3A3PB 2AKWB 2B7CB 2ZOFA 1HQEB 4LVNP 4M5LA 4C2MA 4WFAQ 2NLWA 2O1PA 3CCRS 1SXLA 2MZQA 5CHCB 1YI2S 2DEIA 2LEPA 1S0MA 5K9FA 2VG5A 4QR1A 2JSXA 2OPSA 3QLHB 4DR7F 2KXNB 2ZOMA 2VDIA 4AFFA 2V69A 3R5BA 3UPFA 3HZEA 4UOCA 3KHRA 1U4BA 2OPRB 4J9KA 1JLAA 1G7CB 5D4NA 4H4MB 4WWSA 2GIFA 2UXDJ 1N6QA 4ECWA 4KPYA 3G82B 3KNAA 4Q2MA 2QFJA 1JLFA 4J7CA 1ZAXA 3AOAA 5B0GA 1DRZA 5LM7E 2EEYA 1T02A 4J91A 3QGPA 2EBEA 1NK7A 2HAFA 1IKWB 1WELA 3ZNJ1 1R27B 2V0NA 1EARA 3CJ8A 1F9FA 3C6TA 3H0PA 1SC4B 5L1JA 1IKYA 1C1CB 1LWCA 4OQJA 2XBPA 1PBAA 2KHCA 2J9DE 2VICA 5I42A 3JSBA 4TVAB 3RB0A 3DFEA 2C1EB 1RI7A 3JSMA 2KXHA 4GVLA 2D9PA 2VZ9A 1VQ7S 2JOQA 3QATA 3I6PA 1WHVA 2FVCA 1QSYA 5C7PA 2G1HA 3G6XA 3KDOA 2XY7A 2O67A 4DQSA 1BQNB 2AX1A 1XR5A 2PFDA 1VBXA 2MHEA 4JI4J 1IBCB 4QIEA 1DARA 1TP7A 1NDKA 5H9FK 3PYDA 1Z2ZA 2CNLB 4UTGA 4B9UA 2XHWA 3DLEA 2HMIB 2W9BA 1S9EA 3E01A 4NLUA 1DFDA 2AP6A 1NKBA 2MTLA 3OJSA 3MXHP 3R6LB 1R8AA 3UDEA 5LMUF 2ZEJA 4M5KA 1WC0A 4HI1A 3C16B 2CDRB 4K4UA 3MMBA 3SCKE 2CA9A 3I9ZA 3W2VB 2AEJA 2CIMA 5D0EA 3UDVA 2PMWA 4PXBA 3MM9A 2WVFA 4LVOP 2Z2MA 4PRFA 2J6UA 4PWDA 2GMHA 4DFKA 2Y1RI 2Z56B 2F7VA 2P8IA 2APOA 4DR6J 2R7XA 3D1OA 3N01A 4I2QA 4CO4A 1ZAWA 3IR5B 3JAMU 3BREA 5F8HA 4OX9J 3TJ8A 3J7YI 2MHNA 3FBFA 5E3CA 5LT5A 2DD8S 4LF6F 1B70B 4DR1J 3FDSA 4F04B 4LR7A 3L7OA 3CMES 2BUNA 1S7HA 5KFVA 1QM9A 4MAKA 1JXEA 2MSSA 4N76A 1YKWA 3DHXA 1XMOJ 1J27A 2FGCA 1MWZA 3MAHA 1TKXA 1MU2A 3NBPB 2B51A 5HLFA 2E1CA 2L3MA 1Q78A 3KUGA 3ZO7A 4LF1A 3KLFB 3M1VA 4C3KA 4F36A 1KN6A 1FEEA 1N34F 3CCQS 1SL2A 2HFNA 2AWZA 1L3TA 3O44A 2BX6A 1DURA 5F8MA 1HW8A 4F4ZA 4BCAA 4KAIA 1XJWB 2MLZA 4H4KA 4F25A 2CPDA 1VISA 1DBDA 3FMBA 1ACMB 4NOHA 4ER8A 5C25B 3DRRB 1FKPA 1FK9A 1FJGF 3RAQA 4FNIA 4DSEA 5K8OA 2VPYB 4IOAQ 4B3OA 3JQMA 4DR5J 4BWMA 4YP3A 4TQSA 1N5TA 3F0NA 2B56A 1NH8A 3GLJA 4OL8A 1SVDA 1UJ6A 4KHPJ 5J2NA 1OS5A 3MFHA 3HSJA 1DTQA 2QMUB 2JRSA 2JC1A 4HH1A 1RHJB 5B0AA 5GAEI 2B3TB 2G13A 4KKOB 2HFZA 4CO2A 1NBEB 2OTJS 4NCAA 2VL1A 1DQ9A 5E5NA 2FJEB 3UVJB 4PG7A 4F26A 3JQKA 2E7WA 4ENOA 2MQOA 3KYLA 3L4BC 4KGXB 2IM1A 5M2RA 2HNYA 2E5GA 2FHJA 4OLPA 1R0AB 4HLBA 1RA7A 1QD1A 2C22A 4J9RA 4I56A 3AJ2A 1SV5A 4X65J 5IM0A 2D1CA 2GGPA 3T1HJ 1VK3A 1J5OB 2VF3A 5B0EA 3MMJA 1AROP 3R7SB 2AZ1A 4U9RA 4DDFA 1N5QA 1VIOA 1U0HB 2OFHX 4CTAA 1B0PA 4Z7YA 2VFTA 4ED7A 2MB0B 4CLZA 4RW6B 2NXCA 5KT7A 4OI6A 4ZK7M 1QVFR 1L3VA 4P2XA 4I7FA 1TFWA 4DL4A 4JV5J 4F4WA 3CF5Q 3J7Z5 1O8BA 3R3TA 1RTDA 3OJUA 3PYGA 1MMNA 1AA1B 4C7QA 2WOMB 3SDEA 2Z2LA 2FHOB 3FZBA 2KH9A 2CPFA 1FXLA 2OP5A 4C8ZA 5B08A 2PA3A 3CXCR 4X66F 2Q79A 3GE9A 5IQ6A 1DLOA 2KHDA 2U2FA 2RRNA 4OHZA 3LALA 2LYVA 2EXUA 3MR5A 2DIUA 4Q5VA 2W9CA 4Q45A 2BJ9A 1NUEA 2PFFB 5AJ3F 3FSIA 4Y34A 2VUGA 3M9MB 4DR2J 2RIJA 4Z37A 2QA4G 3AJDA 2ZJRQ 4CLKA 1KWMA 3P49B 3ZZ0A 3RYLA 3I5CA 4RUBA 1N54B 4Z2XA 2VJUA 3AOBA 1X4EA 3M8QA 3T5JA 3C6UB 2A0FB 5CA5A 1FWLA 1EZZB 4YR3A 2GO9A 3OD2A 4GC6A 4NI2A 3CJ5A 3GV8B 1S0NA 1WI6A 4CLUA 1S4EA 1IR2A 4CYUA 1FFGB 2MLXA 3H8YA 1U1PA 3KLGA 4IOBA 9RUBA 3NEKA 4FBTA 3A8IA 1FI4A 5C2GA 3FFIA 4X64F 2NREA 3QWUA 2YTCA 2KJVA 3DMJB 1KKHA 1V3RA 2QYCA 3Q2TC 4WK3A 3MEDB 3C15A 1IQZA 3ITHB 2HK2A 2GJFA 2V8DA 4I69A 3FQLA 1PGZA 3H2UB 4ZPCA 4MH8A 2IVYA 2CJXB 1RT7B 1LWEA 4DL3A 2CVIA 1Q7LB 1RZMA 2W8KA 3GSIA 4NMLA 4PYAA 2E5HA 3NXZA 4PPDA 3IFEA 3OLBA 4RR5A 4NMXA 2DCUB 2KU7A 1C0TB 4BWJA 1HQ2A 1H2UX 3PG9A 4IYQA 1IKXB 3DRYA 3TNVA 3MGJA 3LANA 3U1NA 1NJIT 4RWWA 2N4CA 4WKYA 3IWXA 2EG2A 2HQGA 2ERRA 1PJ6A 3LPYA 2X3DA 1P1TA 4MKBA 1NJZA 4IRCA 1VLYA 3A13A 2FY8A 2BKOA 1WSVA 3O1LA 2WSFC 3ZNUA 4ZVHA 1UEKA 3X1LB 2DNRA 4XPEA 2UUTA 2HWTA 4DU7A 2C3OA 5IT0A 2A2DA 3IWNC 2GZOA 5EWFA 1FD8A 4MIAA 4O3RA 3DLKB 3GJTB 3D1QA 1ZBTA 2JJ4D 1N33F 2K7KA 2V6AA 3GSDA 2DNQA 1N88A 2RKIB 1SKUB 4NYOA 2W2NP 1HW9A 2ZDOA 4WFYA 2IA6A 1YTYA 4DEZA 2HHVA 1QVGR 3GP9A 3HP6A 4USTA 4UOGA 3KDNA 4JB8B 3D6MB 4UT4A 4DX7A 2CPYA 1FRMA 4B3RF 3Q22A 2HHXA 2ZUAA 1TL3B 3HKWA 5FIIA 2Y8YA 1HKAA 4E0DA 1RT1B 5HROA 1HNWF 7FD1A 1NNDA 3CC7S 4DV5F 1NDLA 2DT9A 2RNEA 5AT1B 3IM8A 3IRWP 2QZ8A 4NCBA 2L9WA 3DI6A 3UO0A 1SL1A 1Q0NA 2WSEC 3KK3B 4EK2A 4MKYA 4B9VA 5DM6Q 5A6WA 4TKTA 4BS2A 2XS2A 3UN5A 1S79A 2UV8A 3W5XA 1KQFB 3N5FA 2W2QP 4IFVA 4LF6J 5K5MA 4X62F 1QAJA 3W2WA 4C8KA 1NDPA 1U1OA 4ED4A 1BQMB 5AXKA 5D3GA 3EZ5A 4J5OA 4YOEA 4HHJA 4GC7A 3HFZB 4PG6A 1RAAB 3KOAA 3HCXA 4C8YA 2ROEA 4LR8A 2HYIB 1N34J 2RMLA 4CO3A 1KHWA 3IBWA 2PI4A 2W2MP 2NPIA 5KG6A 3QAEA 2PE8A 2AQ4A 1GFWB 4P2MA 4PG8A 4XDDA 1GH8A 1P8GA 2IM2A 2N3OA 2ROPA 5CYMB 2MPUA 1M1GA 1C4AA 4RUCA 1TL1B 3SSRA 2JEFA 2YNGB 4EBDA 1FJGJ 2R7QA 2CKWA 4BDPA 3DXSX 2DNPA 5CQGA 4A8KA 4ID5A 5FD1A 1LOUA 1IJEB 1WKJA 2QT7A 3IM9A 3OL8A 5F3ZA 3D0HE 1F5CA 1IBLF 1AZSA 4RW9B 1GX6A 1CJTA 1D9AA 2DGUA 2KVQE 3KHHA 1AFJA 2IM0A 2KG0A 2LEBA 1Y5IB 3J7YU 4YQWA 2AF6A 1LW0A 3MWBA 1D0EA 2ACMA 1JWWA 3KJFB 1B64A 2GVDB 3TQ1A 4A8QA 3AAWB 4YDXA 1WTBA 3RJMB 1NK4A 1YBAA 1W2BR 1X60A 2IY5B 1MROA 2C3PA 4FPRA 1HL6A 2H3EB 1TKZA 1RWVB 5BJRA 3MM7B 2HVZA 1RT5A 5A2QU 4L76A 1RTJA 1ZA1B 3P4UB 2FZKB 1WI8A 1Q1KA 4JOUA 3IRXB 1HMVB 2HHTA 2H48B 1AFIA 3H90A 5D78A 3QRQA 3H2VE 3W3SA 2E7XA 2DNLA 3LP1A 3K59A 4U96A 2DR7A 4RO0A 1G6BA 4MMOA 2YKPA 2DGWA 3CULA 3VR1A 3RBEA 4ZVOB 4R5PA 5A0YB 5BXIA 1SJ3P 1REVA 2P9GA 5FLXY 2GW8A 5G4DA 3IS9B 2ZH3A 1NAQA 3MDFA 3VCDA 5KOWA 4ITSA 3FCVA 2MMYA 4O3OA 1H0HB 3WIVA 2R7WA 2OKQA 1AUDA 4FDFA 2WVBA 1BD6A 2HVHA 2HHPA 1HPZB 5L9XA 4M8LA 3UD3P 1NDCA 1N36F 3OXFA 3BH7B 2BANB 3KLIA 2VDHA 5E3PA 4X4RA 2MSTA 2DNGA 1HBOB 3T19A 3PW5A 1VQ4S 2VBXA 5GAEU 3PNIA 1N4LA 4QBUA 3T5KA 1SUQA 3CE8A 4ECTA 2ZKUA 3H7HB 4X66J 2YXLA 1Q8BA 3GMGA 2W4PA 4IFYA 2IJFA 1UPMB 4RW4B 2BM1A 4M63A 2BE7D 2M9KA 5AJ3J 3V6JA 4OZ3A 4DI6A 1FA0A 4OYAA 1RHRB 4A8MP 3HHLD 2UXCF 2Z8QA 1FTRA 4U8VA 2QYGA 2CQGA 2BJ1A 3IG1A 1HNIA 3DDNA 1H7XA 4CLFA 1UP1A 3NAIA 4I67A 3MCOA 3K57A 2C2NA 4B3TF 3BPSP 2UXBF 5CCMA 1WF0A 4FN5A 2MQQA 5JUMA 5EX3A 4C4WA 4QCLA 1HBUB 2VQFF 1Y00A 2ZZMA 1WWHA 1I94F 3NS6A 1QLNA 4V19J 3MR3A 1K44A 1S57A 1TELA 5EWEA 4X64J 3DOMA 5C24B 4F0MA 1KR4A 4QIWD 3CJTA 2UU9F 1M5HA 2W4DA 2GCFA 2XMMA 4P7VA 2JFKA 1CJKB 4CZCA 3GV5B 3N28A 4A8WA 4KGKA 3K17A 2K2PA 2OD6A 2XG8A 5C5JA 3D6TB 5HAOA 4DWIA 3VVTA 2Q1LA 1RWMB 3TAQA 2YH1A 4EBCA 1DAXA 4IR9A 3EZOA 3L09A 3PDNA 1UFLA 3SFGA 2DGSA 1HQEA 5KFMA 4UZBA 1S72S 2BJ8A 5J2MB 2RUGA 1BWVA 5CZVA 1BWEA 5F8IA 2DXDA 1VBYA 4F4AA 4N77A 1NMEB 5IC4B 1RSCA 2AD9A 1KONA 2HGNA 2JFDA 1HI0P 1IWGA 3QLHA 5E3RA 4PG5A 2OPQB 4DU8A 2HBRB 5GADI 4ZOSA 5DZ7A 1H38A 1ZYQA 4EMDA 2EW9A 4LUBA 2DTJA 1WOSA 2MKIA 5EX0A 4GRSA 3G82A 4ZVPB 2V2QA 2B4UA 1KLNA 3CD6S 4TU8A 3R6GB 3GONA 5DJBA 3TWZA 3DN9A 1B99A 1GTEA 1IKWA 3Q8YA 4FVMA 3B82A 2AT1B 3OQ2A 1F0XA 7AT1B 3VAJA 1YBTA 4QWDA 4WPAA 1C1CA 1N33J 2X1AA 3W62A 4WXOA 1E6YB 1CBKA 3K2YA 3ZZUA 1KVIA 4ZPBA 5ETQA 1ZTWA 4USHA 2XCAA 3HULA 4MK8A 1U26A 3E8OA 1SKRA 2LXUA 2MJUA 4B3RJ 4JI1J 1F3FA 4YB6A 3EWGA 4PQAA 3OTEA 3J80Y 4DZDA 2AYBA 1HNWJ 4DV5J 1HD0A 2B4VA 1BE4A 2YNFB 4F3MA 1VQ9S 1BQNA 4IH7A 3MTKA 3QFWA 3U7JA 4QWBA 1WD6A 5HATA 2WHOA 4LBPA 1OPIA 3X3UA 3CO9A 2ZJPQ 3HX9A 3LUYA 1U1NA 4U95A 2HMIA 2EC2A 2RUSA 1XNQF 2F8HA 5CYQB 5F0UA 2ABYA 3SCLE 4H54A 4DR4F 1QE1B 1S6PB 1S12A 2WW4A 3C16A 3KLHB 1RHQB 2R2TA 1KSPA 4OHWA 1KS2A 3DKDA 1LWCB 5IQQA 1FXRA 3GIMA 1S10A 3W2VA 1TR0A 1D3WA 2CQBA 3HLUA 3BH6B 5D0GA 3TI0A 1CPZA 3DU6A 4JV2A 1TTHB 3F44A 3R7BB 1VHIA 5I3UB 1IBKF 4J9SA 3D9BA 2JHEA 2G9OA 4PYDA 1Q8KA 1RTIB 1YITS 4V1Ak 4W4MA 1KOHA 1X0PA 4QIVA 3PW0A 1D8YA 4ZHRB 1UL3A 3R5JB 4DV7F 1CULB 2Q66A 4QOTA 3HT3A 5KFAA 3EE3A 5U47A 2QIFA 4NLDA 1HHSA 3QRRA 3DLEB 2RAQA 2VOOA 4Y65A 1WG1A 3SQGB 4WXWA 1B7YB 1SC1B 4P73A 1IBLJ 3PR5B 3W8PA 3G6VA 5ETMA 2HRUA 2DH9A 4D3GA 3UDLA 4TYAA 3QJJA 3TEGA 3KG1A 2ZH4A 3WC0A 3KUHA 3KLFA 4ZVQB 3CD7A 4LBIA 3BBCA 3CO0P 3AD9C 4P7TA 2NYIA 3TX0A 2ZOGA 2L9NA 1S7IA 3H59A 2Z2YB 4U7UD 4LF4F 3MECB 1X9MA 3M32B 3BF4A 2XMJA 4JV1A 4YB1P 4UUXA 3PEJA 4ZVFA 2HIQA 2G2OA 5C25A 2BMBA 3DRRA 4B17A 3AXKA 2KT3A 1UVKA 2C42A 3J7AN 4LR9A 1HNZJ 1S48A 2R2UA 1L3KA 2DNHA 2I9SA 2YQ1A 4ZS6A 4I6WA 3CCJS 4BLGA 3A8KA 4MYTA 1ZM9A 5KTQA 2IRUA 1GMWA 1TKXB 2DYAA 2H4WB 1CJUB 5KT2A 4RNNA 1NSPA 3JSRA 3OFGA 2XI2A 1HBNB 1LK5A 4KFBA 2BRLA 1A0OB 3VZHA 4WFBQ 3BPDA 5T41A 1C1BB 4D3HA 2K3IA 1Q82T 4TNOA 3G8QA 3T9ZA 4KKOA 1RUSA 3J7A1 1Z1ZA 3IC1A 1B7FA 2HZAA 1ITPA 4ED1A 3NOCA 2DGQA 2NUUG 4X4OA 3OUYB 4I0WA 2Z4PA 3UVJA 2AIRB 3LTOA 1MW7A 4LFCF 3HDSA 2X51A 4O4RA 2YVSA 3OTOF 3T9NA 1GMVA 1K9MT 2ALZA 1SPBP 2XWXA 1RADB 4TY8B 3FBCA 4JYAF 2HWHA 2HGMA 4ECSA 1R0AA 5ETLA 1F60B 2GJIA 1LNQA 3H5SA 5KFRA 3IA0A 3Q86A 2DITA 4PXCA 2ZHAA 3KHLA 1NPRA 1L3UA 1J5OA 2QX0A 3QAUA 5DQGA 4QWAA 3NWGA 2CPHA 4QR2A 4M5HA 3VWSA 2W7OA 4QPTA 1ULRA 2GQ2A 5KFSA 4DV3F 1N5SA 1YX2A 4IG3B 5HMYA 3M7VA 2ZH8A 1URRA 1M5VC 4RW6A 2A10A 4KRWA 2VB6A 5FDLB 3V5RA 2X1BA 2UXCJ 3O2IA 5B09A 1HR0F 3S01A 2WBMA 4B3MF 3W61A 1RWXB 2EI5A 3MFIA 1ZAVA 1XN9A 3H5YA 1TAUA 1Q95G 1IM6A 1UEUA 2E1AA 5H9FJ 4ZITA 2BXJA 2WOMA 4GKKF 1U1KA 4TU9A 2CQ4A 2MKYA 3Q23A 4B3TJ 1VQLS 1YZ7A 2C28A 3NL0A 2XYGB 3N6NA 4F0KA 5GMDA 2R7VA 1YJWS 2XLIA 4LRDA 2VQEF 4NLSA 3K5PA 2VQFJ 3CIMA 1RYSA 3D1HA 3ULHA 3R27A 4ZPTR 4O23A 1RWUA 2RDIA 2O3DA 3WC2A 3PHEA 2UU9J 2R7TA 2FY1A 3NCQA 1IN0A 1WORA 2CQ2A 2J9CA 4Q0BA 1T9YA 4ZPVR 2IBKA 3HKZD 2C2EA 2XSJB 4JI8J 2IM3A 3EUNA 1K0VA 1NKEA 4DR3F 1EX8A 2AGOA 1T9WA 4ED2A 4ED5A 2XZTB 3N6MA 4C3MA 5AXNA 1SJQA 1JK9B 1URNA 1JLCB 3C6UA 4AT1B 3RBXA 2YPZA 1GXLA 2XLJA 2W2PP 2YQ0A 2A6OA 4G1IA 1N8RT 3NCPA 2BDPA 1XR7A 3S8SA 3OT9A 3LW5C 5IWAF 5CD4A 2ZM6J 3V81B 4CM0A 4B9TA 1JQGA 3DMJA 3ETMA 3MMCB 5K8MA 3E51A 3PXGa 1D09B 4P6QA 4NWBA 3MEDA 5DS7A 3JXOA 4Q8EA 3PACA 4C8LA 3ITHA 3I55S 4DN0A 1Q5VA 3EGWB 4OYZA 4UW2A 3C14B 3RTVA 3MPWA 2FJXA 1V6HA 3D0IE 1RT7A 4YUDA 4N5SA 3BN7A 1TV6B 1A7GE 2XY5A 3A3OB 3D3BJ 1UEVA 3BSOA 1KBRA 3GILA 5KFQA 1TU0B 2M8DB 2W7PA 2HS3A 4C97A 2XI3A 4PWUA 1C0TA 1KC8T 4ZLPA 2BQRA 1R8PA 3AOCA 4OI2A 3M8SA 4RJVA 1IKXA 2K1RB 4UOFA 2KDOA 2CQDA 2HHHF 3FGVA 3MR2A 2CNOB 3Q8QB 4X4TA 3Q8RB 2CJ9A 3CEDA 3FCHA 2N82B 2FLPA 4UZCA 1YJRA 1LFPA 4EZ6A 4Y0FA 3FCWA 2BVZA 1AW0A 2XYHB 4K7QA 3TR5A 1FHTA 1HI8A 3PHTA 4CNZA 1J5EF 1MN9A 1EHWA 4A8SA 5LOQA 3MEEB 3MI7X 2KKHA 3DLGB 1NO8A 2PI5A 4OJHA 4P71A 5EN1A 4NLXA 3UR3C 3W5YA 2DRBA 4X4QA 3CB4A 3SI8A 4WE1B 4DN9A 5ETTA 1MWQA 2FUG9 3CCTA 3DLKA 3K89A 1KVKA 1XNQJ 3MPDA 4NEYA 5GADU 2XYPB 2CPZA 3FEZA 2RKIA 4DR4J 4C9DA 1U6FA 1X4AA 5CZXA 2XHCA 1EB0A 3TX8A 2OMLA 3VZIA 4DPUA 4J9NA 1YWXA 3HFKA 4X4VA 2B8QA 1EIYB 1IR1A 1H2TZ 2XNRA 1TL3A 1UW9A 1G1XA 1RT1A 2VU5A 1IBKJ 1V5IB 2FDNA 1HI1A 4F02A 1TUWA 2EFOA 3V6KA 3NMAA 1HNVB 3GR1A 3C46A 4M95A 3L3CA 3KK3A 1XNRF 1Q7YT 1UJ4A 2H4YB 1FFWB 3EM1A 2PC6A 1VQOS 5KFLA 2K3KA 4DV7J 3M8PB 2E1MC 4DFMA 1NXIA 3HHLB 5G0RB 5AXLA 5KFHA 4OHXA 4OX8A 2DH8A 1NHKL 3W65A 1IBMF 3RAMA 3G8TA 1FJEB 1X0FA 1BQMA 2DJWA 5SUHA 3S7RA 3D3CJ 2BM0A 4MYUA 2HHWA 3PFOA 2V34A 4X84A 2LA6A 4ZVTB 3DGVA 2DGOA 3T6JA 1AYEA 3EDQB 3PRBA 2ZE2A 2YX4A 3CCWA 5LJ5Y 5FLXU 4W92B 4Z7CA 5KFNA 4FKYA 5HVGA 4NLRA 5DM7Q 1I1GA 1Q16B 3PKMA 1REGX 3CDUA 2PMZD 3TYTA 2B9WA 2YY3A 1WUUA 2LQBA 2KRRA 1MSWD 3CWJA 2XGQA 2QEXS 5CYMA 3NGDA 4MIBA 3POTB 4KT0C 1TL1A 1WF2A 1ZS6A 2YNGA 4O4GB 1FE0A 5DLFA 2X1GA 3D68A 3H4DA 3TEHB 3M9OB 3OL9A 1VQ6S 1RT6B 4DV2F 1MNEA 4QJVA 2GNKA 3H25A 4RW9A 2KFYA 3BQ2A 3W8GA 1TKDA 2HZCA 2XQCA 1WDTA 2BJ3A 3W9JA 4WFXA 1PC5A 1JNRB 5HL7Q 4NZ6A 2BOAA 1S77D 2AYMA 3I4HX 3U02A 1F6TA 5K8NA 2GVDA 1QAYA 4FF4A 2HHUA 1HYSB 4K4WA 4L74A 1BGXT 2B9XA 2XMKA 1VI7A 2FVQA 1U1MA 1SH3A 6AT1B 4CT8A 4LFCJ 2QJ3A 3MM7A 4ZJQA 4NCGB 5H1SV 5ETOA 3OTOJ 3LGMA 5KFXA 2HVEA 3AH6A 3IRXA 1HMVA 4JYAJ 1KTQA 1EETB 1WOPA 4I2PB 2MQNA 4LF8F 3DRXA 1JKHB 3BM7A 2FJBB 2MYFA 4NXNF 1Q8LA 3ENVA 5B0BA 4ECVA 4DL2A 3SBMA 1S5ZA 1H73A 4GO7X 4FVCA 4RW8B 4O3SA 5A0YA 1NPKA 3CCVS 3AJ1A 2DCLA 3IS9A 2F1FA 2J7KA 3UQSA 2BJEA 2EPIA 2RS8A 2JZ5A 1R3NA 5A8RB 1WC3A 2OEJA 3PKYA 4LF7F 1HPZA 1PAEX 1S9FA 2F65A 2FLLA 1FKAF 2XMTA 4KH0B 1JJHA 1MROB 4B3MJ 1NHVA 3SCJE 3I0RA 2ZBCA 2BANA 1NCLA 1U02A 5EGYA 2IPOB 3HHNB 4AL5A 2G0IA 2VFRA 3L95X 1ZA2B 3LWMA 1VDHA 2CPIA 1HBOA 1JJ2R 1MMLA 4DSJA 4GKKJ 2HW3A 2V8VA 5HI7A 4DPTA 5KT4A 1Q81T 2H5JB 3MAAB 2VQEJ 4HTIA 3EJMA 2GFFA 5B0DA 5D77A 4C6AA 4DCOB 2GS8A 4LRBA 1EKSA 2AGPA 3LO3A 4RW4A 2QV6A 2V4RA 2W7AA 2PEBA 2P5VA 4P72A 1U09A 4O0IA 3KHGA 4DUTA 2HBYB 4NRUA 4DR3J 3HK2A 3FEYB 3D2WA 2RF2B 4JI0F 4YHHF 3PRVA 2XS5A 3K5NA 1PG5B 1UVMA 2PMHA 4JP8A 2KYZA 2CADA 3JTNA 4K0KJ 3D6HB 4CLTA 5K8PA 3BGUA 3HD2A 3BV8A 5HQLA 3NNCA 3M8WA 4K4VA 1HBUA 1WC6A 1BUXA 4XDCA 4Y2CA 1JLGB 1QJHA 2MKJA 1T9UA 1NK5A 2PO4A 1VMBA 2QMWA 2RQMA 2LDIA 1HQUB 1GNKA 2FGOA 5E2QA 5AE2A 4EBEA 1S99A 5D0HA 1CJKA 2B9YA 1NSKL 1UVJA 3BQ1A 1RT2B 1X31C 2IMOA 1PCAA 1NSAA 5KG7A 4OYPA 4FYVB 1FVSA 4V19X 5L9NA 4NYPA 3GIJA 5IT4A 1FERA 5HK4A 3T6BA 3ZC4A 5LL6d 3QGHA 3WBZA 2JLFA 1RA6A 2I6WA 2M7SA 2GQCA 2ZH2A 4RW7B 4DV1F 2BJ7A 5J2MA 3ILJA 1RDRA 3QFHA 4DFPA 3AB4B 2HHHJ 4LFAF 1UMJA 4AE5A 2V9KA 3G8SA 3TO8A 1NLKL 3EZUA 4UQGA 2E9RX 2OPQA 2LQ9A 3THVA 4ZA1A 4F50A 4HL9A 5I4MA 2CJQA 2MKHA 5D6GA 1FRKA 2VA3A 3NKYA 1K1SA 1J5EJ 1NB7A 2CNNB 3HD1A 1CJVB 4JI7F 4J9VA 2UV8G 4ECUA 2MZJA 3BSCA 4KO0B 4DQIA 3PIPQ 4DV4F 4CRJA 5A8WB 5DGAA 4ILRA 3H20A 1SKSA 3QIDA 3K5OA 3ICLA 4DSFA 2Q3PA 2N3LA 1E6YA 3JYTB 3VAGA 5DG9A 1LV5A 3HMJG 5A8KB 2M3DA 4P10A 4F4KA 1Q86T 2XO7A 3I96A 2NXUA 4Q8FA 3RB3A 2ZUGA 2J0QD 2LQ8A 3W9IA 1YRTA 2KFNA 2ALYB 1FX2A 2SXLA 5THWA 2QRRA 4F0HA 1G2EA 2YNFA 2OD4A 4OHYA 2ZHOA 4I6AA 4ZVUB 3PEHA 1XNRJ 1T05B 4AQYF 3CCUS 3CJQA 1K73T 2IVFB 2OLWA 4NEZA 2D7SA 5CYQA 2DHXA 3IMQJ 3KKFA 3EGVA 3H98A 4LF5F 1IBMJ 4L6V3 2UP1A 1QE1A 1S6PA 3B54A 4OZ2A 1ZM2A 3KLHA 2DHHA 4DXLA 2YKMB 2ASLA 4ZVSB 2LA4A 1FNOA 4MJKA 2FHKA 3MZIA 2NXEA 5D0RA 1RTZA 2LVWA 1XC9A 2ZFHA 2I38A 4A4JA 1YVFA 5F41A 5I3UA 3CJ2A 3LGHA 4DX6A 2GHWA 1WKLA 1RTIA 4LJMA 2AYEA 4ES1A 2RT3A 4C98A 5HVHA 2MJNA 2AZ3A 2JX2A 2B5JB 1U24A 4ECZA 4ZHRA 2CQ3A 3DC2A 1H7WA 3MUTP 1CULA 2DEJA 2LQJA 3GV7B 4CI0B 1H6KX 1S6OA 3TARA 4ED3A 3MEGB 1KDNA 1HBMB 1UPPA 3B4MA 3SQGA 2QTWA 1JLEB 4DV2J 1RGVA 3GG1A 5LMNF 1VS3A 3MEKA 2D69A 4ZVEA 1BY9A 2ADCA 2R8GA 4RBUA 2P6SA 5HBMB 3ZTPA 4OYXA 2HQ3A 2ZZNA 3UCZP 3RBZA 4XIUA 2M70A 2LDYA 1IM4A 1M5SA 2AJ4A 4URQU 2AW0A 5KFGA 2HGLA 3OTBA 2AYGA 3UD4P 1I6JA 1YDLA 4A8XA 3MECA 2EFNA 4UF4A 3M32A 1SCJB 3HHEA 2HAIA 3MMAB 3QSYB 4CLWA 2X7IA 3M2VB 2DNZA 3CC4S 4FXVA 3H5UA 4QWCA 1DY3A 3T1YF 4FF2A 3GFXA 1PO6A 2V9WA 3M6UA 5JVHQ 4QU7A 1T3OA 2MY7A 3EXYA 1KTVA 4LF8J 1ZZFA 1FEHA 4WFZA 5KAKA 2YKNB 4NXNJ 3I56S 5HJXA 2RSQA 1RAHB 2C3MA 2VPZB 3NWRA 2IJNA 1U6BA 2IBOA 3CJKB 1CJUA 5DGBA 4TN2A 1SJRA 4F67A 3BGRA 3R1LA 1HBNA 2BABA 2F63A 5KFUA 1RWOB 5IFMA 3ZTRA 3DDKA 3TJAA 3NGKA 2ZD1B 1U49A 2VOPA 4K4XA 1C1BA 3CW2C 2QN6B 1S9GB 4KIAA 4HR2A 2HFSA 4LSNB 4QR0A 3ETOA 2VC0A 2X3GA 4WP8A 1IVZA 3OUYA 4M5DB 1UZDA 1QTNB 5CYJA 1B3TA 4CDIA 2DHSA 1HFEL 3LOUA 1PJ7A 4NLQA 1T9VA 4LF9F 3ISNC 4TY8A 5KFBA 1KEKA 1HD1A 3CGIA 3K7RA 3ZXWA 4YS2A 2GHPA 4USMA 4PWWA 1VHFA 5I3QA 4Y3CA 5HP1B 2V67A 2AJQA 4OHVA 1GEHA 2J0XA 4ZCMA 2WTFA 4AL7A 1YZ6A 1F1BB 1N0UA 2AJ2A 3EVWA 1VRUB 1FRJA 5A76A 5D4LA 3ONQA 1S1VB 2ZITA 3D66A 2AEMA 4IG3A 5JJBA 4KFBB 3W5ZA 4XTTA 2V5HG 2D3ZA 2HRYA 1SIWB 5HVFA 5HO4A 1TUVA 1S6UA 1AUSL 3RUBL 4CLSA 5FDLA 4GVBB 5J1PA 2ZH1A 2C2OB 2WONB 2C2DA 3DOKB 1SBRA 3IBCB 2A3JA 1HNXJ 3NGSA 1EAYC 3LAKA 4DLEA 2OUGA 1KNZA 4J37A 2LU1A 4WIQA 1SC6A 2R7UA 2NSCA 4JI0J 4EI2A 1VGYA 1EQ0A 2JH3A 3PW2A 5DDPC 3KG4A 3I0SB 4FF3A 1Y3KA 2DH7A 3AODA 3T5HA 3HT0A 4FBUA 2E66A 2VJVA 4K5SA 4IG0B 4KHRA 1XIQA 2W24A 4OI4A 2OPPB 2AV5A 4ZPWR 4NRTA 1XWLA 4JI5F 2RU3A 4TY9A 4AXJA 1X4BA 4MK9A 2GX8A 4HT5A 3W1YC 2WB4A 2CFXA 2LMIA 2G1DA 4RU9A 4Y6IA 4P2SA 4EO8A 4DJBA 4B9LA 4PAAA 4NYZA 2XSJA 3TA1A 2B7BB 1HWUA 3GIIA 5KT3A 2O01C 1VQPS 2Y8WA 1VQ5S 4H4OB 1O51A 1KRPA 2W25A 1YJNS 3AQOA 1JLCA 2XULA 2QA1A 2LXIA 1YJTA 2BOPA 2R42A 4C11B 2ZH7A 1LQ9A 4RBTA 4J9OA 4RNHA 2ASJA 1M1KT 4NL5A 3CC2S 2I5JB 1VFJA 3US5A 1Q5YA 1U2RA 4A46A 3TZYA 5MLCV 1TL4A 2ZWOA 4LFAJ 3V6HA 2IAJB 2DXEA 3D0GE 3K8VA 4OI1A 3BS9A 2WW8A 3V81A 1UWAA 3CVKA 5BR8F 2KM8C 3MMCA 2ILZA 4IQXA 3E2EA 2QLJB 3VGVA 3BJYA 3QIPB 4W90B 3T5LA 1FO1A 4I4BA 3RR8A 3PIOQ 1WOOA 3C14A 4DPXA 2DR8A 2LFVA 1LWFB 1LXNA 4JI7J 2V2KA 4Q0BB 1TV6A 4ZCKA 3Q8UA 2J76E 2DIVA 2BACA 5KFIA 2R8HA 4DHVA 3UNGC 1GXTA 2EBGA 2I1RA 1HWIA 4CO5A 4LRCA 1UVIA 2K1RA 4EEYA 3KLEB 4KYZA 1Z2LA 2K7JA 2NXNA 4DX5A 3ZZTA 2QL7B 3CDAA 4HKQA 2DRAA 3NS7B 3SZ2A 2B8PA 4ES2A 1ZZNA 2BKPA 1R7IA 4PG4A 3QYYA 4DR7J 1RXOB 2V4QA 5F8LA 1PYSB 1VC6A 4GO5X 1KP6A 4ZVRB 3MEEA 3DLGA 5DLGA 3TUPA 2GIRA 2NUHA 1CC7A 2CVEA 4J90A 2E5JA 1GK8A 1S1UA 3K8WA 4AQYJ 3AT1B 2UZAA 4WE1A 1U8WA 2GHVC 1VQYA 3M8RA 3NAHA 2AU0A 4DR6F 4TXSA 2DNKA 2JVOA 4JI6F 4UY8T 1YIJS 2E5IA 3F73A 1BQXA 2DBBA 2ZC3A 4LF5J 1P9YA 1JJCB 1YSJA 5F8GA 4OV6A 1BXNA 3R1HA 4WU2A 1VYAA 2DNMA 1X8DA 6FD1A 4QIGA 3CD5A 2YNIB 5EUHA 1X4FA 4J9PA 2JLEA 3BGFA 4AD6A 5KFKA 3J7ZT 1CLFA 3Q2SC 2XY6A 1K8AT 5L8RC 4FYXB 4ES3A 2IRXA 1YHQS 2ZDPA 4DPOA 2ADBA 2MEWA 1IWAA 2R2RA 4DUYF 5E33A 3QWPA 3KTQA 2QL5B 2BE2A 2RS2A 1K47A 1HNVA 3RU0A 3LGNA 3R9LA 4FS1A 2XMVA 2H65B 4Y2MA 4ZN1A 5DDQC 3M8PA 3J81Y 5KG0A 1JLBB 1UWBB 3WZ0A 2CQIA 2J0SD 3CIZA 5IOLA 3HHLA 2GJ2A 4ECYA 1VQ8S 5G0RA 1HWKA 3D6FB 3B78A 2UUBF 4Q2LA 3MM6B 2RVJA 1FT8A 3MPVA 5LMNJ 4MT1A 2MKKA 5F0WA 3HF5A 4HDGA 2XGPA 1T8EA 5LMUJ 2J8AA 2RQKA 3MPYA 1CVJA 2CPEA 3AHPA 3NGUA 4QZVB 2HFVA 2CWKA 3SQOP 3M6XA 2Z57B 1M5PC 5SZTA 1S1TB 4RX6A 3GR0A 4ECQA 2PSZA 2Y3YA 1IUJA 1CG2A 1OY8A 1SI9A 2DK2A 4QU6A 5FJ4A 1SKWA 1GQEA 4KHPF 4FKXA 3QGGA 1U48A 3BR8A 4PKDB 2QGFB 2R8KA 2ZBIA 1PAUB 2QG9B 3LAMA 1GTHA 4OYWA 3W64A 3ZZRA 2HS4A 5D8HB 3POTA 2XNQA 5ETPA 1X9WA 5DQIA 2ZH5A 2FB0A 1GAOA 2E44A 4O4GA 3OW2R 1VK8A 2WBRA 3HO1A 2DHGA 3R5AA 2R7SA 4OYBA 1RT6A 1NSQA 5AXMA 4C3LA 2M5YA 5J2QB 1G3OA 1TUGB 3RB6A 1Y5LB 2BW7A 4MKVA 3BGLA 4KQZA 5JMNA 4YN3B 1N48A 5ETVA 2HBZB 5KFCA 4ILLA 1UA0A 4JI2F 3FNNA 5KFFA 1BMQB 2RU9A 1N5VA 4LT6A 2VA2A 4PCQA 2JLGA 2ZE2B 1HYSA 3T41A 4DLGA 2VODA 4IQMA 2ZNYA 2HQFA 2EKYA 1S4FA 1DJ0A 2ZVIA 3F41A 3AD8C 4NCGA 1SJ1A 4LF9J 1VRTB 4OLOA 4DL6A 3ZZZA 3HM9A 5LJ3Y 1Q53A 1EETA 2M2BA 4I2PA 3HSDA 2HQIA 5K20B 4NX9A 1JKHA 3PYEA 5KT6A 1FVQA 3GG0A 6FDRA 2Q6CA 4ELTA 1O0PA 3KK1B 2XTJP 3PJXA 4RW8A 2HQCA 2BZ2A 3N4WA 1NK0A 2OTLS 4ZMMA 4TYBA 1G4CA 4HVZA 2ATCB 5L1KA 1U45A 2QLWA 3PX6A 3FUYA 5A8RA 4CLPA 2KYXA 5GMKa 4OYIA 1YBUA 5HMXA 1PC4A 1XBWA 4ZJLA 4RBVA 3BKUA 2DO0A 2UVVA 3P5TL 4ID8A 4JV0A 3DM2B 2WCXA 1RYRA 2OSRA 3TVZA 3RRHA 1N5YB 1E6VB 4QPXA 3NNHA 3F56A 3VAKA 1WACA 1I3OB 2Q43A 4N8OA 3FBEA 4KV8B 2OEKA 2FC9A 3MAAA 4DL0C 4MFBB 1KHVA 4YR0A 4JI5J 1GMUA 3ZTOA 2F9JA 2R2SA 4HDHA 3QJPA 2J0WA 2VC1A 2JL9A 3KFWX 3M8ZA 3A12A 4B02A 2H1YA 1S6QB 5JVGQ 3OPKA 3QO9B 2F9DA 2ASDA 4WU3A 2J6SA 3FMWA 2M88A 3BSAA 4KGVB 2BKNA 2M8HA 3LA0A 3QPIA 4IO9Q 5IS2A 3G2XA 3Q8SB 4OZLA 1VC0A 3GYXB 5IT9U 3TANA 2RF2A 3TVYA 1FNMA 1H3DA 5JXSA 4F2RA 2J8SA 4WTOB 3MUVP 1D9DA 3I0RB 2FJWA 1BLUA 5ETKA 2LECA 2AEFA 2DPJA 4X2BA 2QO3A 2Y1IA 2YX7A 1P27B 1ZOTA 4AUKA 5LSRA 1RE1B 1JLGA 2P9CA 1YG0A 5BR8J 1HQUA 1R0BG 3QZ8A 4HHHA 2V50A 3BYRA 3HXMA 3MTJA 3PJWA 4EYHB 3UDCA 1QTMA 3EX7B 2R8IA 2I2YA 1RT2A 8AT1B 2Y9HA 3JB9k 5IV4A 4QW9A 4I1TA 3FKBA 2FPHX 3CSKA 3AQPA 5B7WA 3CDWA 4O0NA 2MZRA 3MHYA 1U7LA 4UQTA 1S0OA 3TVKA 3KK2B 1H2VZ 1K0TA 4NA1A 4WJBA 2W2OP 2GQQA 3CD0A 4RW7A 4DZ6A 2EWHA 4WTYA 4USUA 2P6TA 1F3VA 1FJ7A 1OY6A 4QW8A 5EHHA 2YQ3A 1R0CB 4B9SA 2HHSA 3MUMP 3KJVB 3BSNA 3JTOA 3SV4A 1MN7A 1T03B 5HANA 4O3NA 4KH1B 2H5IB 3MD3A 4FP9A 2QLXA 3D7SB 2OGUA 4IDKB 4F3QA 3MAQA 4NLOA 2UUCF 4WZQA 1CJVA 1TKTA 2L08A 2GAHC 1X5PA 3Q24A 3ZZPA 5BYSA 1RT4B 2KN4A 4KO0A 4QYRA 3PV8A 2A6MA 1S76D 2ASYA 5HQ8A 1UAWA 5A8WA 2BA9A 4Q7AA 1T11A 4JI6J 3MM5B 3SSQA 3NRBA 1LW2B 2L41A 2A1BA 2C2KB 5IV3A 4QWEA 2VG7B 4ED0A 3JYTA 2IJRA 1S49A 1WHWA 1UTAA 1HWJA 1RAGB 4YB7A 5A8KA 4XO0A 1J2VA 4ECXA 2XM3A 2E29A 3OV7A 4FXWA 3HVWA 1VRQC 3DLHA 3CJSA 1M0SA 1YK9A 4M5JA 3VV2B 1ZPWX 1B0VA 5I3PA 3HVRA 1JLQB 2IRYA 3Q8PB 3CPWR 2NR0A 4DUYJ 1FWKA 2R9LA 1OQ3A 2VASA 2WK4A 4K8RA 1M90T 3B8HA 1IKVB 4OJGA 3LP0B 2L48A 3SV3A 1T05A 5T14A 2HLUA 3ET6B 3VF0B 3GFHA 4ED6A 2VG6B 2YWHA 5HMZA 2QE5A 1S59A 2GAGC 3OVSA 2MZ1A 2UUBJ 3GFYA 1UCNA 3EICA 2E5LF 2ATLA 2G2ZA 2MY8A 1S1WB 2BBEA 2YKMA 4PUOB 1JXVA 4LSLA 4KPCA 1Q8IA 3Q0AA 2HQDA 2UVUA 1O6XA 4DS5A 3M2RB 2CJYB 1TQLA 4Y00A 2W8LA 3OLAA 3BDEA 1K1QA 1UVNA 1KLMB 2MQMA 2NS1B 5KG1A 3IBFB 4YMEA 5CCLA 1RHMB 2CG8A 5KG4A 2GVZB 2GO8A 3L7UA 3TUJC 2XC9A 1L5UA 5D4PA 3G6ES 4ZKAA 3M30B 2B5JA 3QGIA 1SJFA 2PA8D 2HKEA 1Y4ZB 3EPGA 3V6DB 1QAXA 4L3NA 3PO5A 4FZVA 2HNDB 1Y9OA 2YKOA 4R0JA 2U1AA 4CLYA 4NLTA 3R2CJ 3MEGA 1HBMA 3P96A 5LSLA 1JLEA 2VONA 4X62J 3BO4A 3RW6A 3OXGA 1AT1B 4X4PA 1NK8A 4RNMA 1T0TV 5HBMA 1T9XA 1NKCA 2ILYA 4RZRA 5CD4H 2W01A 4K59A 4JI2J 1NB2A 2IFXA 3CNQP 3GU0A 3ILIA 4DF8A 2XB2D 3KNGA 2KVIA 2AMCB 4DCPB 3GYGA 1U25A 1NJXA 4G65A 2W9AA 3MMAA 3OSPA 3BBBA 3M2VA 1RU2A 4TLQA 4ANDA 3UN2A 2E1PA 2GV1A 2DNOA 1U6ZA 3THPA 4C8MA 5KFTA 3RG6A 4UY85 1LWXA 2QLFB 4ZP9A 2EK1A 1WSRA 2XLKA 3O5TB 3D28A 1OQ6A 3U1MA 2YKNA 3OR2B 4LREA 5CXTA 4UUWA 1H74A 4OYOA 1Y11A 3CJKA 3M05A 1V9OA 4IRKA 3ZFVA 4KBIA 3CMAS 4P2FA 3CCSS 1VJWA 3OVAA 2RRAA 2ZD1A 3P3DA 2C2RA 3P5BP 3G4SS 1S9GA 3PW4A 2YNHB 2LCWA 4L72B 3OHBA 2OELA 4RL1A 3VGUA 2UUAF 3P8BB 2D41A 2JEGA 4LSNA 4L73A 1M5KC 1I51B 1S1XB 3FSXA 3GFZA 2IHR1 3QMQA 3IGNA 4M5DA 1WEYA 2EG1A 2YKAA 3I5AA 1HA1A 3M4XA 1HLWA 4FYYB 4NLGA 2KJWA 3CCZA 4PQUB 1JMTA 1RHUB 4OZ5A 3NY0A 3GZ7A 5HP1A 3TA0A 3CT9A 4U8YA 3C66A 2Z30B 4IO1A 4CO1A 4X4UA 1RTHB 2WB1D 4O44B 3QBCA 1S97A 4TLRA 4XPCA 3DOLB 1AXQA 2CZVC 1VRUA 1UJ5A 1RBOB 3PX0A 4EFAC 5KFWA 3DLJA 5BYQA 1WG5A 2F8MA 3IR6B 3BEGB 1S1VA 1RT3B 5B0FA 3BGRB 3DRPB 1NRKA 4M1KA 2M52A 3G96A 2B6AB 4FNHA 1T7PA 2XCPA 1U8SA 1PJ5A 3A1YG 4AYBD 4K4ZA 4PXEA 4GVBA 2WONA 1A6LA 3DOKA 3HFVA 2NQPA 4IOCQ 1RABB 2LQ5A 4C8NA 2VPXB 3HJFA 3AFGA 3HHDA 2Y0BB 5KOXA 2VKZG 1N36J 3GJRB 3I0SA 4USVA 1T95A 1DTTB 4RNOA 3DGPB 1X9SA 3K5MA 2BV3A 3EGNA 4IG0A 3FSYA 1X5TA 2OPPA 2J7WA 3N5BA 2RD5C 2R4FA 4ZPAA 1QSLA 2CJKA 4LFBF 1EJ7L 5KFEA 3NMRA 5E3AA 1B4SA 2UVWA 2JEJA 5J2PB 1CSJA 2PGCA 3PZPA 2WVEA 2YWFA 1RKIA 3EGZA 1FNXH 5GMEA 5D4OA 1U2FA 2CZ4A 4H4OA 3KUEA 2DR5A 4I64A 1DQAA 1SJ4P 2C2MB 2DGVA 3DNCA 2ZBQA 4C11A 1VQKS 3T1AA 2I5JA 4ZIWA 3KXDA 1KFDA 1KOOA 2ZZTA 3ISND 3UFCX 3BKFA 5CAAA 2AHOB 2IAJA 1TZ0A 3RBDA 2MXYA 2UXBJ 4PR6A 1TL7A 2MQPA 2YWGA 3M6WA 1TK5A 3LP2B 4HEA9 1I94J 2DKOB 3QIPA 3THTA 5ETSA 3V2UC 1WC5A 3TUIC 2HNZB 1BC6A 4DUZF 4USWA 5DRKA 2NZ4A 4WP9A 4ELUA 5LSOA 4L3KA 2UUCJ 1LWFA 1WDDA 4CNYA 3TZXA 3PJ9A 3J81j 3U27A 4MK7A 4E8UA 2ZC4A 4CO0A 4ZJOA 4JI1F 1FESA 4HI2A 1UETA 3H42A 2FHMA 4ZN3A 3RR7A 4URGA 2KTQA 2CYYA 5K14B 1EKRA 1TVRB 2NSBA 1QSSA 3J81U 4RWXA 3TZZA 4OI0A 2EKNA 2RDDA 4ERDA 1RK8A 3OR1B 1N32F 4BC7A 3B6BA 4P9SA 4AXIA 4YR2A 2Z2ZA 1RAEB 2KFZA 3EDRB 3IR7B 1O5JA 2N7CA 1X7VA 3HVTB 3KLEA 2MGZB 3OVBA 4KSEB 1FCAA 2PD1A 2FHJD 1WEXA 4CWBA 5F3TA 1C0UB 3GCXP 1SQFA 4DF4A 1VC5A 3OTDA 1HIYA 3NCRA 4OZJA 4N41A 3EYZA 3BO3A 4WYLA 4DMZA 4HACB 4KC5A 4K5RA 2RHQB 2OFGX 2RRBA 1LK7A 3LF0A 4A8OA 2O66A 2B43A 3ZTSA 1WJ9A 2XS7A 2DO4A 3RGIA 1OIAA 3MOZA 3L9ZA 3UN3A 3WIUA 2IDEA 1PILA 3MPUB 2PT0A 3NGTA 4ZP6A 1FF2A 2V68A 3GTYX 3MM8B 2E5LJ 4G1PA 1NJYA 3M9NB 3SSSA 3A8JA 4WYWA 5DQHA 1WHXA 2YNIA 4NLPA 2HIYA 3CJ4A 3O8WA 2FZCB 3FQKA 1RAIB 2CJBA 3SYZA 3LWLA 1R8BA 2RILA 4DQPA 4ELVA 1KQGB 3GJQB 5L1LA 2MLYA 2AGQA 3JTPA 3R2DJ 1EP4B 4ZCLA 2KRBA 1U2CA 4U7UK 2CQHA 3TAMB 4RKUC 3QT6A 2RB7A 4KTQA 1WKKA 3BKTA 3KMSA 2V2ZA 4M5NA 2V4JB 4Q44A 3M2UB 3W7BA 5C42B 2IVMA 2HSEB 1JLBA 1UWBA 1S1UB 1VQNS 3G9CA 4FYWB 3MM6A 4USJC 1TL5A 4PABA 1UKUA 2P2CB 4UOHA 2IMWP 2OSQA 3CJ3A 4OFZA 3BGOP 1V3ZA 2M0GB 2C2ZB 3I82A 3Q8VA 2ZKTA 1HNZF 2F40A 2HBQB 2R8JA 1S1TA 1N56A 2E9ZA 1FFSB 1OSDA 3MCNA 2J6TA 2GIQA 3UW1A 4WF9Q 5M2PA 1YRUA 4F4XA 3ELHA 1D8ZA 3AXMA 5L39A 1QDUB 2BE2B 3BQ0A 2R7OA 2DR9A 1FRIA 1FE4A 3TOQA 3C2PA 2CJAA 4N8NA 3PRDA 1ZETA 1HHTP 4JUZA 3I5BA 2WSCC 1JIHA 3S1TA 4E2FB 3GCWP 2RH3A 3M6VA 1U1LA 1UFKA 1EQMA 3HSGA 5J2QA 2YH0A 5J1EB 3HI9A 2VFSA 4ICLB 2QFIA 1NZAA 3PTWA 3OL6A 2WVDA 1LEOA 3DU5A 4A8FA 4LF2A 2G0CA 2EC0A 5KFYA 4G1QB 4HT7A 2AJ1A 3DYAB 2EFPA 2VD3A 3P6YC 3TJ9A 4CT9A 4WCEQ 3T3FA 3GYNA 4USKA 1RJJA 1OO0B 2UUAJ 4F4YA 1CS4B 4LF4J 3GWCA 4ETZA 2F5GA 2V2VA 2QSWA 2CQ0A 5F9LA 3I4PA 1JJ4A 4S0MA 1MLAA 3OTCA 1CEZA 3V4IA 3WQPA 4ZLJA 4DPWA 4A8YA 2HVDA 1VRTA 2BE9B 1FWPA 1C4CA 2V8GA 1X5SA 2A2CA 1RQ0A 2ROGA 3OXLA 2OIHA 2HEKA 1H72C 5ETNA 1QUVA 2YX1A 3KK1A 2KT2A 3CUNA 5ADZA 3MURP 4RLEA 2FLNA 5HMWA 1CQNA 4DG1B 2JWNA 2KT5A 4JI3F 3HJVA 3CCES 4OMFG 4QIFA 5T7LB 4DL7A 3AA8A 3DRSB 3SFUA 2HHQA 2IC3A 3QT8A 3OFFA 3SEOA 4C8OA 4RNFA 1NZ8A 5CH7B 3FVYA 4J9LA 2W4CA 2PEHA 4CCHA 1MMDA 1PYOB 4USIA 3H4BA 2HG4A 1LFWA 3QNWB 1ZM4A 1HARA 2IA0A 4IR1A 2OEMA 3DM2A 4BC9A 2QC3A 4F2SA 1FTCA 4YDDB 2ZBRA 3CTRA 4N7TA 3ADAC 1N5YA 4RU2A 4JI8F 1E6VA 2HRTA 4K50A 3A8EA 3KG0A 3R8YA 5KG5A 2V8PA 2KB2A 4KV8A 1H98A 5KFOA 4OX6A 2LKZA 1F9HA 4MFBA 1NK9A 4E98A 2F3JA 4NXMF 3MCMA 5MAOA 1YQHA 1T3NA 4LFBJ 3KWMA 4DSKA 3NS5A 1S6QA 2Y0SD 1SIZA 3N0VA 4DV3J 3QO9A 3C3LA 1VQSA 5B0CA 4DQRA 1VJQA 2A18A 4YY3F 1RCOB 2CNKB 3DHWC 2ZM6F 2Z58B 1IJFB 2OMOA 3UI3A 4ALZA 1X5OA 2FIUA 5DZ6A 1BHNA 2OPRA 4AL6A 3FBBA 4H4MA 2OAUA 2LU2A 1HR0J 1R31A 4PXDA 1FKOB 3IWLA 2I8EA 2FLOA 2D74B 1RAFB 3N6LA 2N7YA 1RLCL 2BR0A 1U1QA 3PX4A 4R8UB 1KQSR 1X4GA 3R5GA 1FXDA 2EFGA 4KE5A 2VH7A 5KFZA 3AB2B 1RACB 2P9EA 5GAGI 3QSIA 3MR7A 1KFSA 2V8HA 2F4VF 4QYZJ 2HK3A 3QRPA 4YFUA 1JNZB 3DDIA 2DR6A 1RISA 4HH0A 2EFQA 2VHGA 4DUZJ 1GXUA 2CAJA 3RAXA 1RBAA 3D54A 2VFUA 2VBYA 1RB0A 1VOMA 3ZZYA 3CDEA 3GB0A 2VG5B 5LXRA 2DGTA 1PIEA 2OPSB 4NASA 2DGXA 3HPOA 1MG7A 4NA2A 4RUAA 2NYHA 3KK2A 2FVRA 3ILLA 3LH2S 4DSIA 2HFOA 1JLAB 5KFJA 4EZ9A 3O6QA 4KHMA 4EUVA 2LLZA 1N6QB 1N32J 3I87A 5EDWA 3GQCA 2XZDB 1XMBA 4DFJA 1JLFB 3KJVA 3GIKA 1HWLA 2Y1LB 1RU1A 2H51B 1OYEA 1OSCA 4IKAA 5IWAJ 1F5AA 1T03A 5DG8A 3C6TB 1FDBA 4N56A 2FD2A 3PCOB 2XWYA 3CDBA 4ZIVA 1IKYB 4IDKA 4NPOA 5I42B 4ZVGA 2XSFA 3J80U 2CPXA 2XMWA 1RT4A 3JSMB 2UUWA 2NCKL 4OV1A 4CH1A 2KXFA 4ATNA 4CH0S 3MM5A 3ZTQA 8RUCA 1LW2A 1MWYA 2W1BA 4DV0F 2VG7A 2IYGA 3QT7A 2EK6A 4P52A 4EO6A 1RWPB 2UVRA 1PSDA 2B0GA 1KD1T 2QSFA 2JC0A 1WTFA 2ZWPA 2FYXA 2B4OA 1JX4A 3BR9A 1NHUA 2AJ0A 2W9BB 1JLQA 1S9EB 3E01B 4C0OC 2HFUA 4K4TA 2YWKA 3NBPA 1UVLA 4B3SF 2CZ9A 5GAHI 1SH0A 1XEZA 1SL0A 1X4DA 2QL9B 1IKVA 2RDJA 3LP0A 3MMBB 4MTPA 1R43A 4LBHA 3TAPA 2VBZA 1TKTB 3FEXB 1W7WA 3MM9B 2JEIA 2DPIA 1T94A 3ET6A 4PWDB 2CQ1A 3RRGA 2VG6A 2Y1JA 4OYMA 3UD5A 1P9QC 3SCIE 5H9EJ 3DCAA 1IR0A 3AY0A 3VAMA 1IXKA 4I2QB 3MD1A 2HS0A 1S1WA 3OBIA 5HQMA 5KG2A 4RPFA 5EWGA 5E7OB 2QMXA 4PUOA 1Y3JA 3GPAA 1XERA 3TW0A 3MOJB 2YWEA 2PN6A 3H40A 1PBUA 4WK1A 4CM2A 2FVPA 3M2RA 4FF1A 2MZTA 4ZLNA 4OI3A 1QY7A 3D67A 4M5IA 5M2UA 3W9HA 5HN0A 2JVRA 1KLMA 1ELOA 1FRHA 3BYPA 4FPIA 4WKRA 4WFNQ 2GVZA 4GKJF 1MU2B 2M4MA 1YJ9S 3M30A 5HLFB 3OFHA 2D9OA 1M1HA 3V6DA 3R5CA 4Y2IA 3Q83A 3M1VB 1VCTA 2RJZA 2LEAA 4G6VB 2HNDA 3PFEA 4NLWA 4WP3A 3H5XA 4X4NA 1OMSA 4ZP7A 3AA9A 3NLCA 4HHUA 2DY9A 4CQ1A 1VQMS 2R3VA 5L1IA 2CWXA 4DV6F 3FK4A 2KZMA 1U47A 3R5DA 4HYKA 3QZ7A 2ZH9A 2V63A 4LIWA 2OJ3A 4LSLB 1FKPB 1FK9B 1QAIA 4OJ1A 4B3OB 1T9TA 2WRMA 4M94A 5E0OA 4OZ0A 1FD2A 5RUBA 4B08A 5AE3A 2BYCA 1WF1A 3P45B 2ACYA 3TP2A 3DLLQ 1V5VA 4B9NA 3D4JA 4Q43A 5J2NB 4OIXA 1U0HA 1RAOA 1DTQB 3VALA 1HHQA 5IXUA 3WDOA 1RBLA 1NEEA 2LP4A 4BHQA 1XR6A 4K4YA 2JNJA 3JAMY 3VAIA 2MKSA 3IO1A 3OR2A 5DDRC 2XEXA 3B4DA 2KG1A 4IUFA 4PEOA 3KJQB 4J9UE 3UR0A 2B9EA 4FYDA 3Q89A 1OJ4A 1RWNB 4JI3J 2HNYB 3IAM9 1TK8A 2YNHA 2VIHA 4R0EA 2EFVA 4LQ3A 2J9EA 2BQUA 4WIIA 2D3OR 4ECRA 1SV5B 5IM0B 2GGPB 4K2JA 2G0JA 1UFWA 3WHIA 1S1XA 1CQMA 2WVCA 1DZ5A 5DETA 1GX5A 4NZ0A 3CCLS 1IQTA 3K58A 3I32A 3TZWA 1Q4RA 1U1RA 2DNYA 1N52B 4EWTA 3RRKA 2PIIA 3GIRA 3V4MA 3GJSB 1XMQF 4CTAB 4KJIA 4PQUA 1F9EB 3S6EA 1CC8A 4LQ9A 4A48A 1V3SA 1FDAA 3PO4A 2OHDA 2ZBPA 3PY8A 1RTHA 1VLOA 2EVZA 3IP0A 3E3XA 2CPJA 4O44A 1D9FA 4MKAA 1M5OC 2Q6BA 3DOLA 2ZVSA 4U7CA 4I7FB 3BZQA 2GMLA 1RKJA 3OL7A 1RT3A 4NXMJ 1RWKB 4QQBA 3DRPA 4K0KF 1RTDB 4M5MA 4DBQA 5ETRA 3W60A 2B6AA 3OHAA 2POKA 3SDEB 2XZWA 1WNEA 4YY3J 1YGYA 2F8EX 1Y7PA 4OX7A 3EVOA 2G2YA 3LQVA 4H4KC 3FRZA 2BRKA 2OI2A 4DOZA 1DLOB 4LF7J 1TAQA 1Y5NB 1X4HA 2KM8B 2FTRA 3MF5A 4KGZB 4P75A 2W9CB 4W98A 1XQIA 1DTTA 4URSA 4NZ7A 2J9DA 2X1FA 1FJCA 3DGPA 4ZDNA 4J9MA 4PPZA 3R7NB 4PZVA 1OPZA 4XAKA 1W25A 4MIWA 2FJAB 1F2GA 5D15A 4O3PA 3VTIA 2F4VJ 2I0XA 5F8NA 3RW7A 2MKCA 3M8QB 4HTJA 3CJ0A 5J2PA 5C2CA 4NI2B 3HHKA 4M5GA 1LKZA 2ZJQQ 3WX4A 2HWIA 4B9MA 3KLVA 4U67Q 4CYUB 2MQ8A 5L46A 2JDJA 2R7RA 3NP5A 3KLGB 4ETXA 1R89A 2BW2A 3CJRA 4CP5A 2YBVA 3FFIB 4ED8A 3CCMS 2NPFA 1N0VC 2YPYA 4L75A 2KL8A 2FJDB 1JXLA 2H5EA 4I68A 4IH6A 3C15B 1RCXB 2AX0A 4A47A 4YHHJ 4LSZB 1ROFA 2B4PA 2FVSA 1LWEB 1YJVA 4DS4A 1QUPA 4KGMA 2N4DA 4YEAA 3FC9A 3PVXA 5L38A 5KFPA 1XK8A 2DISA 3NNAA 3LP2A 4DPYA 3JSYA 2VBWA 1GMWD 2HVIA 3IGVA 4LRAA 2HNZA 5E41A 3MCSA 1B0TA 1P6TA 3W66A 5IC6B 3M8YA 2CDQA 2HLTA 2DXFA 3KJNB 2IYIA 4DCJB 2FC8A 5K14A 2KO1A 1TVRA 3KMQA 5GAGU 3ILOA 4P74A 4ZPDA 3U1LA 4LRFA 1P1LA 1WHYA 4DV0J 3OR1A 2UXDF 3G87A 2VPWB 2DVIA 4LMZA 3RZAA 3G71S 1SQEA 1APSA 4DV1J 1UZHA 1XTZA 2DHAA 3HVTA 2MGZA 3I9V9 4RUHA 1R6VA 1WC1A 2CQPA 1C0UA 3ENAA 1SB6A 1TL7B 1SC3B 3K0JA 4Y28C 1FRLA 4B3SJ 4HACA 2MQLA 3EVMA 3IAS9 1W2IA 2O5DA 9ATCB 3G6YA 2OH2A 2L9DA 3VAFA 1ZTTA 4KY3A 1ZM3A 1WG4A 4EU0A 3N79A 2DNNA 2V94A 1L3SA 3ENQA 5HROB 3EXCX 3VVUA 3VQSA 5E3QA 4DV4J 2F4FA 4ANEA 3MM8A 1NU4A 5LXYA 3FZ2A 2IDLA 3IXQA 4Y2KA 4JI4F 3W63A 3DI6B 3C8YA 4EYIB 1ICEB 3IN5A 5BYRA 1UW4A 3VAHA 4IFVB 2ZHBA 4F3OA 3TA2A 4WZMA 2RQ4A 3TQEA 3QJLA 1R8HA 3W2WB 4C0HA 2K8GA 1EP4A 4YB5A 3ENWA 4FXDA 2WAQD 4OJ3A 1A9NB 3SMZA 4FS2A 3TAMA 5D3GB 4ZLLA 3HVAA 4BBYA 3BDPA 4GKJJ 2DRDA 1I5OB 3RB4A 3N9UC 4I6YA 3TUZC 2GMJA 2V4JA 3PM9A 3M2UA 4JBCA 2IIHA 4DX8H 2QLBB 4GMKA 1WC4A 5C42A 1VBZA 2YKQA 1R6YA 2K06A 1D1UA 2OO4A 1KVJA 1RAJA 1RP5A 3MR6A 4DV6J 2RHSB 4K2XA 5GAHU 3DXBA 2J5AA 4OX9F 1OY9A 5HJYA 3VHQA 3BB5A 4K4SA 1DQ8A 1YRXA 4O3QA 5GVQA 1W26A 3EMTA 4J9QA 4DR1F 3R97A 5IZHA 2FJVA 4DQQA 1GT8A 3SIPB 4ID5B 1OYDA 4F7VA 2MZSA 5KG3A 1XMOF 3NG8A 1SQGA 1AZSB 2HZVA 5AE1A 1CJTB 1KQKA 4DSLA 3NGRA 4NLVA 4X4SA 4ILMA 1DHMA 3UNYA 1RHKB 1TMMA 2H54B 1YJ7A 1SH2A 2CQCA 3HHLC 3HZGA 1Y0HA 3JQJA 4ZP8A 1LW0B 3O3LA 2GA7A 4CIOA 5HSPA 2VFVA 2CG4A 1VR6A 2AJFE 2PDAA 2WZ1A 2D3UA 5J1EA 3PYFA 2FZGB 3OFEA 4ICLA 2RE1A 5A6PA 3K5LA 2G4BA 1FRXA 4QYZK 3FJ2A 1TKZB 4CLLA 3BN4A 1RT5B 3OSNA 1NM2A 1RTJB 2BEFA 1F5BA 2E1RA
chains in the Genus database with same CATH topology
1FESA 2C3MA 4HI2A 1ZYQA 4DR5F 5DG7A 2EW9A 2VPZB 1UETA 4TQRA 4LUBA 4G1QA 2FHMA 3FRYA 2DTJA 3DYAA 4KB7A 2MKIA 1C2PA 2IJNA 5EX0A 4URGA 3RR7A 1U6BA 2IBOA 3CJKB 5DGBA 2CYYA 2KTQA 5DDOC 5K14B 4TN2A 1TVRB 3SXLA 1SJRA 2B4UA 2BJDA 2NSBA 4F67A 1KLNA 3CD6S 3BGRA 4TU8A 1HBNA 3R1LA 1QSSA 2BABA 4RWXA 3I31A 1ZPVA 5KFUA 5IFMA 5DJBA 4OI0A 3LP1B 4ERDA 3DDKA 1RK8A 3OR1B 1N32F 4BC7A 3DN9A 3NGKA 2ZD1B 1U49A 3L7PA 2VOPA 1GTEA 4AXIA 4K4XA 1IKWA 1C1BA 4FVMA 1S9GB 3B82A 4YR2A 3OQ2A 2J7UA 4KIAA 2KFZA 1F0XA 1VIXA 3IR7B 1O5JA 2CRLA 2HPUA 2N7CA 4R5PB 1X7VA 1LXJA 1REVB 4LSNB 3VAJA 3HVTB 3KLEA 2MGZB 3OVBA 4KSEB 4QR0A 3ETOA 1R8CA 1FCAA 4QWDA 2C3YA 2PD1A 2VC0A 2X3GA 2FHJD 5KFDA 2GC8A 3UCUP 1C1CA 1WEXA 3OUYA 2XMUA 2X1AA 3UE2A 4KR0B 4M5DB 4WXOA 1E6YB 5CYJA 3K2YA 5F3TA 1C0UB 3ZZUA 4EGLA 4DF4A 2BQ3A 4ZPBA 1KVIA 2DHSA 1ZTWA 2QA4S 1HFEL 4USHA 2XCAA 1VC5A 3LOUA 3OTDA 4NLQA 4MK8A 1U26A 3E8OA 3NCRA 1SKRA 1HNXF 4OZ1A 4LF9F 3ISNC 2ZH6A 4TY8A 5KFBA 2H9ZA 1KEKA 1HD1A 4OZJA 3CGIA 2DB1A 3K7RA 3EYZA 4N41A 3BO3A 4WYLA 4DMZA 4TU7A 2LXUA 5KT5A 4KC5A 3TRGA 3DLBA 1ZH5A 4K5RA 2GHPA 5F8JA 2MJUA 1VHFA 2OFGX 2RRBA 5I3QA 4Y3CA 4YB6A 5HP1B 4PQAA 3OTEA 1LK7A 3LF0A 4Y2AA 4DG1A 3J80Y 4A8OA 2AJQA 2AYBA 2O66A 2B43A 2COLA 2XS7A 2VV5A 1HD0A 2KZZA 2B4VA 2DO4A 2YNFB 4F3MA 1VQ9S 1BQNA 4IH7A 5DO2A 5F9NA 1OIAA 4OHVA 3MOZA 3MTKA 3KLIB 2J0XA 4ZCMA 3UCGA 2WTFA 1WEZA 5T7LA 3U7JA 4AL7A 4QWBA 1PILA 4X65F 2PT0A 1N0UA 4ZP6A 1TK0A 1VRUB 1FF2A 1FRJA 1WD6A 3DRSA 4N47A 4IH5A 3T1HF 5D4LA 2WHOA 1OPIA 3ONQA 1S1VB 3X3UA 3CO9A 2ZITA 2ZJPQ 3HX9A 3MM8B 4IG3A 5JJBA 3LUYA 1U1NA 4KFBB 1NH7A 4G1PA 1NJYA 2HMIA 5C24A 5J1NA 3M9NB 3SSSA 2V5HG 4WYWA 1SUQB 2D3ZA 1TFYA 5DQHA 4R25A 2HRYA 1SIWB 3PW7A 5HO4A 1WHXA 1XNQF 2F8HA 1TUVA 2YNIA 1S6UA 4NLPA 5CYQB 5F0UA 3CJ4A 3O8WA 3FQKA 2ABYA 3H2LA 1Q79A 5FDLA 3SCLE 2CJBA 4IFYB 5J1PA 2ZH1A 3SYZA 4H54A 2WONB 3LWLA 1R8BA 4DR4F 1QE1B 1S6PB 2RILA 2C2DA 3DOKB 1SBRA 4DQPA 3V4IB 2A3JA 4ELVA 3KLHB 2R2TA 1KSPA 1KQGB 4OHWA 5L1LA 1KS2A 2AGQA 1LWCB 5IQQA 3LAKA 3JTPA 4DLEA 1KNZA 1FXRA 1YJUA 4J37A 4CH7A 2LU1A 3GIMA 1SC6A 1EP4B 1S10A 4ZCLA 3W2VA 2R7UA 2NSCA 1TR0A 2KRBA 1D3WA 2CQBA 2KI2A 3HLUA 3G86A 1S0VA 1VGYA 5ITHA 2VKRA 3TI0A 5A2QY 2JH3A 4G3IA 3PW2A 4U7UK 5DDPC 1CPZA 2CQHA 3DU6A 3TAMB 1NK6A 4JV2A 3KG4A 3F44A 1NJWA 3I0SB 4FF3A 1Y3KA 4DL5A 4RKUC 2DH7A 2MDAA 5I3UB 3T5HA 2RB7A 4J9SA 1IBKF 4KTQA 4U6PA 2JHEA 4JV5F 3PR4A 2LXFA 2G9OA 3KMSA 4FBUA 2V4JB 1HNIB 1RTIB 2E66A 3IG1B 3M2UB 3W7BA 4Q44A 3BO2A 1YITS 4K5SA 5C42B 2IVMA 4IG0B 4KHRA 1JLBA 1UWBA 2W24A 4OI4A 2OPPB 1JB0C 2AV5A 4ZPWR 4NRTA 1S1UB 1KOHA 1X0PA 1XWLA 4QIVA 4JI5F 3PW0A 2RU3A 1VQNS 1D8YA 4XK8C 4TY9A 4AXJA 1X4BA 4MK9A 3G9CA 4OZNA 2GX8A 4ZHRB 3MM6A 4HT5A 4USJC 1UA1A 2WB4A 1UL3A 4DV7F 2CFXA 2LMIA 4IRDA 2Q66A 2G1DA 4RU9A 4Y6IA 4QOTA 4P2SA 2IC3B 5KFAA 4EO8A 1TL5A 3HT3A 1UKUA 5U47A 2IMWP 4DJBA 4B9LA 2OSQA 4NA3A 4F8RA 2QIFA 4NLDA 3CJ3A 4OFZA 1HHSA 3DLEB 2VOOA 4NYZA 4Y65A 1WG1A 3SQGB 1V3ZA 2XSJA 2M0GB 3UWTA 3TA1A 3I82A 4LIRA 2B7BB 1X4CA 1HWUA 1FKOA 3GIIA 2C3UA 2ZKTA 4WXWA 1HNZF 4C0BA 2F40A 3D5MA 3VQTA 5KT3A 2O01C 1VQPS 3PR5B 1VQ5S 4H4OB 3ZZOA 1S1TA 2RQCA 1O51A 3G6VA 1N56A 2R8JA 2E9ZA 1KRPA 2HRUA 3ISZA 1FDDA 2DH9A 4D3GA 3UDLA 4ZCIA 4TYAA 3QJJA 4R8UA 5IT9Y 7FDRA 2W25A 3KG1A 2ZH4A 1OSDA 1YJNS 3WC0A 1OWXA 3AQOA 1JLCA 4DR2F 2XULA 2QA1A 3KLFA 2J6TA 2LXIA 2GIQA 1YJTA 3UW1A 4WF9Q 5M2PA 3CD7A 2BOPA 3EPIA 1YRUA 2E9TA 1Z4UA 4F4XA 4C11B 2ZH7A 1LQ9A 1D8ZA 4RBTA 4P7TA 2NYIA 4J9OA 4RNHA 2ZOGA 2L9NA 5L39A 2BE2B 2ASJA 1M1KT 1FDNA 4NL5A 2ZNZA 3H59A 2QA2A 2I5JB 1VFJA 4NLYA 3CC2S 4LF4F 3US5A 1U2RA 2Z0GA 4A46A 3BQ0A 2R7OA 2DR9A 2B7CB 2ZOFA 1HQEB 3MECB 1X9MA 1FRIA 1FE4A 3M32B 3TOQA 3C2PA 3BF4A 2XMJA 5MLCV 4JV1A 4LVNP 1TL4A 4C2MA 4YB1P 4WFAQ 2IAJB 3V6HA 3D0GE 3K8VA 2CJAA 4N8NA 4OI1A 3BS9A 2WW8A 4UUXA 3V81A 2NLWA 2O1PA 3PEJA 3PRDA 3CCRS 1ZETA 1HHTP 1SXLA 3CVKA 4ZVFA 5BR8F 2MZQA 2HIQA 4JUZA 5CHCB 2KM8C 1YI2S 3I5BA 2WSCC 3MMCA 2ILZA 2LEPA 1JIHA 4IQXA 3S1TA 3E2EA 2RH3A 3M6VA 1U1LA 1S0MA 5C25A 3BJYA 5J2QA 3QIPB 4W90B 3DRRA 5K9FA 2YH0A 2VG5A 3T5LA 4B17A 4QR1A 5J1EB 1FO1A 2KT3A 3HI9A 2VFSA 4I4BA 4ICLB 3RR8A 2JSXA 2OPSA 3PIOQ 1UVKA 3QLHB 4DR7F 2C42A 2KXNB 1NZAA 2DR8A 2ZOMA 3OL6A 1LWFB 4AFFA 1S48A 1LXNA 2R2UA 3R5BA 1L3KA 3UPFA 2DNHA 2V2KA 3DU5A 4Q0BB 2I9SA 4A8FA 1TV6A 3HZEA 4I6WA 4UOCA 4ZS6A 4ZCKA 3KHRA 3CCJS 1U4BA 2OPRB 2G0CA 4J9KA 1JLAA 1G7CB 2EC0A 4MYTA 5KFYA 5D4NA 1ZM9A 4H4MB 5KTQA 1N6QA 2IRUA 4G1QB 4HT7A 2J76E 2DIVA 2AJ1A 3DYAB 2EFPA 2VD3A 4ECWA 4KPYA 3P6YC 1TKXB 2BACA 4CT9A 3KNAA 5KT2A 4RNNA 5KFIA 4WCEQ 2R8HA 3JSRA 4Q2MA 3T3FA 3GYNA 3OFGA 2QFJA 2XI2A 1JLFA 1ZAXA 1HBNB 4DHVA 1RJJA 1LK5A 3UNGC 4KFBA 1OO0B 2BRLA 1GXTA 5B0GA 4F4YA 1DRZA 2EBGA 3VZHA