1WF0A

Solution structure of rrm domain in tar dna-binding protein-43
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
88
structure length
88
Chain Sequence
GSSGSSGVFVGRCTGDMTEDELREFFSQYGDVMDVFIPKPFRAFAFVTFADDQIAQSLCGEDLIIKGISVHISNAEPKHNSNSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords TAR DNA-binding protein-43
publication title Solution structure of RRM domain in TAR DNA-binding protein-43
rcsb
source organism Homo sapiens
total genus 11
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2004-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1wf0A01
2NZ4A 3P6YC 1KQSR 2X1FA 1OO0B 1Q86T 1M90T 2N82B 3Q2SC 3G71S 2DNYA 2CQ1A 3CMAS 1VQ4S 2MQNA 3MUVP 2YKAA 1WWHA 5IM0A 2MKIA 1AUDA 3BO4A 3G4SS 2MZTA 1VQ8S 2KHCA 2EVZA 4WFBQ 3CCLS 4CQ1A 2CPHA 2U1AA 5GAEU 4C4WA 1P27B 1WF2A 3MOJB 1FT8A 2KI2A 1R8PA 1SJ3P 2CQBA 3FEXB 2MQQA 1Q81T 5IFMA 2FC9A 4TU8A 3L3CA 2KU7A 4RU2A 3S7RA 3CPWR 2XB2D 1U1QA 2AYGA 2M88A 2ZJRQ 3UCZP 2DH8A 3NNAA 3JB9k 1VQLS 1W2BR 3I56S 1VQ6S 1NU4A 2K8GA 3CCQS 2J76E 3CCVS 1U1OA 2OTJS 2OIHA 3K0JA 2G1DA 1X4CA 4F25A 3LPYA 1VQMS 4QPTA 5DDOC 3OW2R 2KRBA 3PIPQ 1WG1A 4CH1A 3THPA 3MDFA 4Z2XA 5IQQA 1RKJA 2MZJA 2J0QD 4QQBA 2EK6A 2MZRA 2M9KA 1YWXA 1HA1A 1OWXA 1WHVA 2EK1A 2RRAA 1VQKS 4PRFA 1O0PA 2CQIA 2KG1A 2DGVA 2DGXA 2WBRA 1N54B 2DNPA 2Q79A 2K3KA 3IRWP 2HYIB 2E5HA 4LMZA 1X4BA 2M0GB 2DIVA 1YI2S 2VODA 5BJRA 1H6KX 3CF5Q 3MUMP 5H1SV 2MY8A 2LEAA 5ITHA 3NNHA 1B7FA 2FHOB 4C0OC 1WG4A 2OTLS 2AD9A 3HHNB 1QVFR 2CPXA 3UCUP 4OZ0A 2DNNA 2AYEA 2MSSA 2SXLA 1G2EA 5LJ3Y 1S79A 3ZZYA 1X4HA 5CXTA 3D2WA 1N8RT 1FJ7A 3MI7X 2CPZA 2CQGA 2E5GA 5DM6Q 2DNGA 2DNRA 2CJKA 1R8HA 2F9DA 1M5KC 3UCGA 1X4DA 2G0CA 3U1LA 2MGZB 3VAHA 2BOPA 2M4MA 2E5JA 5CYJA 1U6FA 4YUDA 3CXCR 1FJCA 1BY9A 3NS5A 3MD3A 5DDPC 1A9NB 5EN1A 3EGNA 1NO8A 4ED5A 1U1MA 2RT3A 2LYVA 2N3LA 2DO4A 4FXWA 3N9UC 4IO9Q 4YB1P 2DHGA 1WHWA 1H2UX 5DDRC 1CVJA 1URNA 3P49B 2I38A 1U2FA 2HVZA 4WFNQ 1D9AA 2MQMA 1WHYA 1A7GE 3J7YU 1YIJS 2RS8A 2GHPA 2KG0A 4C7QA 2MMYA 2FC8A 1YJWS 1VC6A 2MZSA 2KYXA 1VC5A 2DNOA 3VAJA 2DNHA 2ADBA 2CQ3A 2MQPA 1VQ7S 2CPIA 2MJNA 2KFYA 1UAWA 4WF9Q 4W90B 2DNKA 2NLWA 4WCEQ 1X5PA 2KXNB 3CULA 1HL6A 2CPYA 3H2UB 4ZKAA 5LSLA 2KXHA 2M52A 1K8AT 1JJ4A 2DGTA 1FO1A 2XSFA 3VALA 5HL7Q 1L3KA 1OPIA 2YH0A 1N88A 2F3JA 2MZ1A 2LCWA 5LJ5Y 3VAIA 1K9MT 5JVHQ 3EX7B 3TP2A 4V19X 3CMES 4EGLA 1WTBA 3P5TL 1WF0A 2CQ0A 2DIUA 2DNLA 5D77A 5GADU 1KOHA 3SDEB 1FHTA 1VQ5S 2MKCA 3UE2A 2HGMA 5DM7Q 1PGZA 5HO4A 4WFAQ 3UD4P 1QM9A 1N52B 1WG5A 4F26A 1X5TA 2DB1A 2X1BA 2DITA 1UFWA 1HD1A 3UD3P 2BZ2A 2DGQA 2XS7A 2DGUA 2F9JA 2N7CA 2DGOA 3VAGA 2MY7A 2LXUA 2KH9A 1JMTA 3RW6A 3BO2A 2X1GA 5IM0B 2OSRA 2ZJPQ 1NJIT 2MZQA 2MQLA 1M1KT 3NNCA 4Y00A 2JRSA 2M70A 2JWNA 1DZ5A 2FPHX 2CPEA 1WI8A 1X0FA 4U67Q 1SJFA 3MURP 2D3OR 2PE8A 3CCRS 3VAKA 1SXLA 2HZCA 1FNXH 3ULHA 2D9PA 2YTCA 3CC2S 2MKJA 4ERDA 2J0SD 3MD1A 3B4MA 2LECA 1X4EA 1WEYA 3RW7A 4P6QA 5LXRA 1PO6A 2JX2A 2DHSA 2QFJA 2RNEA 2DISA 2D9OA 2DGSA 1WF1A 4PR6A 1VQOS 1UW4A 2JVOA 2QA4S 2CPJA 3MXHP 2KN4A 3CD6S 3G96A 2RRBA 3DXBA 4WKRA 3NMRA 2DGWA 2MPUA 1SJQA 2XNQA 2DH9A 3CCMS 1K73T 1H2VZ 3R1LA 1Q7YT 4TU7A 1WHXA 2RUGA 3VAMA 4IOCQ 5GAGU 5LSOA 1U1RA 4TLQA 1WELA 1P1TA 1FJEB 3HI9A 2MJUA 1WEZA 3ZZZA 2JVRA 3PIOQ 2HGNA 2XS5A 1KC8T 2OSQA 3NS6A 2M2BA 2MKSA 2RQCA 1M5OC 1ZZFA 3DLLQ 1U1PA 3FEYB 1FXLA 1S72S 5DDQC 2KM8C 4IOAQ 2MKHA 2CQHA 3CCJS 1WI6A 5D78A 3H2VE 2CQPA 2RS2A 2J8AA 2QEXS 4IUFA 3R1HA 4WIIA 1JJ2R 1YJ9S 2DNMA 2E5IA 2LEBA 1YITS 2VONA 1X5OA 2DO0A 2MQOA 3V4MA 1YJNS 2FY1A 2M8HA 1F9FA 5GAHU 3J7ZT 4UQTA 1M5PC 1VQ9S 5FJ4A 3CC4S 5GMKa 2GO9A 1KD1T 2RU3A 4UY8T 2CPDA 3UWTA 1WEXA 4YOEA 1RK8A 1X4GA 2LKZA 2MSTA 1IQTA 2A3JA 2DNZA 3VAFA 1SJ4P 3Q2TC 2VOOA 3CUNA 3S8SA 4LIRA 2DNQA 3G9CA 4BS2A 1KOOA 3S01A 2MGZA 2YH1A 3G6ES 3SXLA 4J5OA 3TO8A 1DHMA 1Q82T 1ZH5A 2KM8B 3CCUS 1X4AA 2CPFA 2AYMA 3IWNC 5GVQA 4W92B 4Y0FA 3TYTA 2M8DB 2YWKA 2XS2A 1VBXA 3CCES 2OJ3A 1OIAA 2CQ4A 3BS9A 2KRRA 4PKDB 1M5VC 2UP1A 2L08A 2KT5A 3EGZA 2KVIA 2MKKA 1X5SA 3I55S 2LA6A 3CC7S 4QU7A 3P3DA 1U6BA 3R27A 2O3DA 3MUTP 2B0GA 3G8SA 4FXVA 2HGLA 4OZ1A 2M7SA 4TU9A 3BEGB 4A8XA 2ADCA 4CIOA 1YHQS 4LJMA 2RVJA 2ZJQQ 5DETA 3B4DA 2LXIA 2L41A 2I2YA 2CQ2A 2DK2A 1U1LA 2RQ4A 2DHAA 4CH0S 2MXYA 5CA5A 1QVGR 3S6EA 3SMZA 1YTYA 2V94A 2G4BA 5MLCV 1HD0A 2MHNA 1DBDA 1VQNS 2PEHA 1U1KA 3THTA 3CCSS 3US5A 3U1MA 1H2TZ 1ZZNA 4F02A 4M5DB 2L9WA 4QU6A 2CQCA 2X1AA 2DHXA 1VQPS 2LQ5A 3BO3A 1XN9A 1DRZA 2MYFA 1U1NA 2U2FA 3CTRA 2E44A 5JVGQ 1D8ZA 2ERRA 2LA4A 3SDEA 1VBZA 2CQDA 5LXYA 2MB0B 2VOPA 1X4FA 1VBYA 2XNRA 3G8TA 1UP1A 2LMIA 1VC0A 1SJRA 3LQVA 2AYBA 3VF0B 2N3OA 2KXFA 1JJHA 2DH7A
chains in the Genus database with same CATH superfamily
3KK1B 3M05A 4NRTA 3DU5A 3H25A 5U47A 4PABA 4GVBB 2ASJA 2JJ4D 1R6YA 1WWHA 5F8LA 3ENWA 1C0TB 5KG0A 1KFDA 3GSDA 2MZTA 2KHCA 2BRLA 4WFBQ 1FEHA 3UQSA 1FJGJ 1DTTA 1RTHA 5M2UA 1V5IB 4ZN1A 2HW3A 1Q81T 1PJ5A 3J81Y 4TU8A 1QAYA 1UVLA 1LXNA 5HROA 2W7OA 3UCZP 2OKQA 4NASA 3M6UA 4NRUA 1VFJA 4C8YA 4I67A 4PPZA 3H8YA 3D6MB 4AE5A 4LFBF 4KO0B 3TVZA 4J9VA 3DKDA 2AEFA 2RIJA 2FHJD 5KFQA 5BJRA 3RAMA 2WSCC 3TQ1A 3EM1A 4DL2A 3MUMP 1YBAA 1SKWA 2P8IA 1G2EA 5JMNA 2PFDA 3HD1A 3LO3A 3T1YJ 5DZ7A 5DM6Q 1URRA 4OJHA 1Q5VA 1HYSA 1RA7A 1UWBB 1FD2A 1EZZB 2X3DA 1CJVB 3DCAA 5HMZA 3K5MA 5F8MA 2DRAA 3BSOA 5E7OB 4LRAA 2DHGA 2E1MC 1Q95G 3FCVA 1ZYQA 4NXMF 3OR1B 2IJFA 1QTNB 1JQGA 4K59A 4WFNQ 1FRKA 1TMJA 5GMDA 3VGTA 2GHPA 2KG0A 2VH7A 2FVSA 1U4BA 4CCHA 4YR2A 2VC0A 3ZXWA 4ECXA 2BJDA 3QPIA 5AT1B 1EQ0A 5THWA 9ATCB 5F8GA 4OV6A 2MZ1A 3TAQA 2LEPA 4ZVHA 3M32B 4P73A 4CNZA 3DOKB 2UUWA 1VK8A 4Y2KA 4OZ3A 2QG9B 1KVIA 3LWMA 4X4NA 4YEAA 3Q83A 4DSIA 5FD1A 3LGMA 3A12A 2V8PA 2X1BA 1EX8A 3MOZA 1RT2A 4F0MA 5KFXA 4JI1J 1MMDA 2XHWA 5IT9Y 2NS1B 3V5RA 3SV4A 5IXUA 1U0HA 2FPHX 4H4KA 1S9FA 4CTAA 2HVHA 2W4CA 2K06A 4I6YA 3MD1A 3KFWX 4CO2A 3B4MA 3RW7A 2JLEA 2HAFA 4X4SA 3NRBA 5C5JA 3LAKA 4ZVPB 3WC2A 4RKUC 1NSAA 4B3SF 1F9EB 3MECA 1TZ0A 4IG0B 4DV6J 1SB6A 4USUA 3TZXA 2FUG9 2HNDA 4F3QA 2FVRA 1T8EA 4Z37A 2GVZA 4ID5A 2YWWA 1HNWF 4LR9A 3KUEA 4Q45A 1H3DA 3VVUA 2C2EA 4ZPCA 4OJ1A 2DRBA 1T0TV 4DCPB 4FKYA 2YXLA 3GCWP 3BSNA 4IQXA 2IM1A 3D6HB 5CYMB 4B9TA 4UF4A 3R2DJ 1MNEA 1ZA1B 4F4KA 4DPOA 1KD1T 1TAQA 1MSWD 1X4GA 1SIWB 2DNZA 2A10A 2B6AA 4QWAA 1FRLA 1KOOA 1S6UA 4HT7A 1NK0A 1LWEA 4QWBA 2C2MB 1VCTA 4JBCA 3IRXA 2C2OB 2JDJA 1UA1A 5F41A 2V2VA 1C2PA 4GMKA 3KKFA 1J5EJ 5A8WB 1HR0F 4OX8A 1PC4A 3QBCA 1U48A 4CLSA 4NXNF 4FXVA 2F8MA 4H4KC 2XMVA 3MM9B 4LIWA 4ZPTR 4U95A 3KMSA 4DR2J 3SBMA 1BUXA 1RAFB 3PX0A 1GTEA 2QC3A 3JTNA 4J9OA 4PG5A 2QLJB 2R3VA 1EKSA 4X84A 2E7WA 2X3GA 3G82B 4KGMA 3M8QB 1UVIA 1EKRA 5KFCA 4KJIA 5I42A 4WBFA 1PBUA 3G8TA 3BQ1A 3OUYA 3M2UA 3GP9A 4ES2A 4L72B 3Q23A 1HBMB 5ETRA 2N3OA 2IRYA 3DYAA 2CQ1A 1J2VA 4ZPDA 4JI4J 5B0CA 4RNFA 1NK6A 2MLXA 3MTJA 3ZNUA 5T7LA 4ECRA 3U7JA 2NCKL 4QWCA 2PEBA 3ILOA 3UR0A 1GT8A 4A4JA 2QJ3A 4NYZA 3KUGA 2AYGA 2MEWA 3QATA 2WBMA 2J76E 1CC7A 4UOCA 3BBCA 3CJTA 2EG2A 3UD5A 3DRPA 2AMCB 3K89A 5IQQA 3OSNA 1UJ4A 1YWXA 3KLIA 2ILZA 2WBRA 4JI5F 4IH5A 4Q5VA 3JQMA 1VRUB 1G4CA 1SV5A 2OPPB 2EW9A 2XULA 1S1XB 1D0EA 2OD6A 3CW2C 4B3RJ 4ALZA 5CXTA 3JSRA 1U24A 3R8YA 4QCLA 2CPZA 4NMXA 2DNRA 2NXUA 5DGBA 2YWFA 3BH7B 4ZP8A 2GAHC 4U96A 3MM8A 2PSZA 2DO4A 1NSQA 4I2QA 4DPTA 4LF8J 4PXDA 1A7GE 3CJ0A 4RPFA 4FBTA 4IH6A 4B3MJ 2RS8A 2C1EB 5HQLA 4RNMA 1MMNA 4I64A 2MQPA 1TAUA 5CABA 2HQ3A 1H73A 1UJ6A 1JLAB 4KHPJ 3UNYA 3NGUA 1KLMB 2E7XA 3T5KA 3MZIA 3BBFA 3SCIE 1YZ7A 3DOMB 2KTQA 4OX7A 3GMGA 3UW1A 1KOHA 4OHVA 2GVDB 1GXLA 4HR2A 4DR5F 2KHDA 4M5DA 3W60A 3J7Z5 2OGUA 3UD3P 2DGQA 1I94F 2H51B 4DR4J 5IV4A 4OL8A 3CMQA 3R5JB 1TKZA 2ZDPA 4YP3A 3E3XA 3MPYA 4ZPBA 3R2CJ 2V0NA 3UDEA 4URGA 3I4HX 1TL3B 2VQEJ 1EETB 1RABB 2D9OA 4ED7A 1VS3A 1HBNB 3TWZA 4LSLB 3HDSA 3CD6S 4WKRA 3C2PA 5EWGA 2C2KB 3AFGA 4ID8A 5KG6A 4DV7J 1WHXA 4I56A 1IBCB 1FVQA 3QMQA 3W62A 1IKVB 3TZZA 1P1TA 5L1IA 4KGVB 1F6TA 2PA3A 3PIOQ 2WZ1A 1WACA 1DY3A 4PXCA 5C2GA 1S6OA 1FXLA 4O0IA 2QIFA 2P6SA 5J1PA 4OZ5A 4RBTA 2HNZB 4WIIA 4CLYA 2NSBA 2VONA 1CPZA 4R5PB 1UA0A 1R7IA 2ZBRA 3PY8A 3HHLD 3CJ5A 3BDEA 3GTYX 4DF4A 3WC0A 4K7QA 1XR6A 3M8YA 1FRJA 1AXQA 4LIRA 3TNVA 4J5OA 4PG6A 1C0UA 2R8HA 3PFEA 1NPPA 5IT4A 1RT6A 3TYTA 4A8KA 4MK8A 4O23A 2D74B 1Q8LA 3G6YA 1M5VC 1VMBA 3EGZA 4N56A 3RBZA 1TUGB 1NKBA 3RRHA 3WQPA 1LW2A 4O3PA 1LWFB 1FTCA 1TL7A 1YHQS 1S1WB 2IPOB 3BF4A 3ITHA 1T7PA 4X66F 1S0MA 4FPRA 1UFLA 1YTYA 1LW0A 2ZH1A 5IT0A 5HVGA 4DV3F 4MJKA 1H2TZ 2X7IA 2LU1A 2B4OA 3D1HA 1NCLA 4B9LA 1CULA 5J1NA 4HL9A 3R5BA 3BO3A 2WAQD 3CTRA 3RBEA 5LXYA 4ED8A 4KT0C 1UP1A 1HBOA 3EVWA 3CEDA 4LVOP 5A8KA 2Q1LA 2F1FA 2P9CA 1TMMA 1P9QC 3LGNA 2ZH8A 2ROPA 5HI7A 2A6OA 3KJFB 3WBZA 3MR3A 3G71S 5LL6d 4IOBA 4DV1F 1TKTB 2W2MP 1DJ0A 1JJCB 2OD4A 1QSYA 1H7WA 4LF1A 1W26A 2J6UA 1P27B 4BWJA 5KT3A 1BWVA 1FXRA 2IMWP 1M0SA 5KFOA 1NU4A 1U1OA 4P71A 2XMWA 5DG8A 1DTQA 2FJXA 2J5AA 1RSCA 2A2CA 2MZJA 1EHWA 2EFVA 1GMWA 4I2PB 3T1HF 4U7CA 4DF8A 3GG1A 3R5GA 3DLGA 4B9SA 4Y28C 3MHYA 3R7BB 4A46A 1B7FA 3CD5A 2OTLS 1A0OB 3U27A 4DL0C 4LQ9A 1RHKB 1NKCA 2D41A 3MI7X 4FYVB 1IBLJ 2E5GA 1NJWA 2R42A 4KSEB 2PO4A 5CYJA 1N34F 3CXCR 4DUZJ 3NS5A 4Q7AA 3HZGA 1S1UA 2EFGA 1T05A 2OFHX 4F7VA 4ED5A 2ZH4A 4YDDB 5F8IA 3MMBA 2G13A 1KVKA 3HSDA 1FKPA 1JLFA 1JLCB 4LF2A 2APOA 3FRYA 4FF4A 3M8ZA 1IKXB 5HSPA 3VZIA 1HHTP 3M8PA 1RAOA 3DMJB 3KNAA 2DNHA 1SL1A 2FVPA 5KFIA 4BHQA 4QPXA 3W5ZA 1MWQA 4L75A 1NUEA 3DGVA 4WXOA 1XMQF 1T03A 1S12A 2N7YA 3AXKA 2POKA 3GFYA 4J7CA 1FHTA 2PC6A 2V4JB 4Y2MA 2W8KA 1WG5A 1RT1A 2ZFHA 2GHVC 4FYDA 6FD1A 4RW6A 2DGUA 5BYSA 2FIUA 2HFUA 4UTGA 4G1QA 2ZJPQ 3M6VA 2MQLA 1ZAVA 3MPUB 2B5JB 2UUBJ 2HHWA 5IWAF 3PW4A 2D9PA 3T1AA 1EP4B 3G2XA 3LGHA 2RKIA 3AD9C 1Z1ZA 2DGSA 5KFZA 3O2IA 1RBLA 3N5BA 3TW0A 3G96A 4ZVUB 1NDLA 3P4UB 4KYZA 4ZCLA 3V4IB 2XNQA 2AEMA 1IVZA 2H5JB 5DGAA 4BCAA 3W7BA 4NZ6A 4Q2MA 2FJBB 4O3RA 3FBFA 2Y0BB 3HD2A 5KOXA 4B3OA 4QWEA 2J0XA 1Z2ZA 4JV1A 3EXCX 3H4BA 4L6V3 2DPIA 5DJBA 3W1YC 2UXDF 4LR8A 4IDKA 1YKWA 4Q8FA 2E9TA 2BANB 3TA1A 3B82A 2BKOA 2DT9A 3C16A 3JTPA 5D78A 3H2VE 1VRTA 1JXEA 1HHSA 3W8GA 3ET6B 4NLRA 5GAHU 3J80Y 4LFAF 4ED0A 5E41A 2F8HA 4QYZJ 4QBUA 1MMLA 4K0KJ 1X31C 4NMLA 3TO8A 3MAAA 2HNYB 3HJVA 1HFEL 4K8RA 3O8WA 3M30A 4QIWD 2B9EA 4Q2LA 1NRKA 4TY8A 2QLFB 4N47A 2MTLA 4P72A 5D3GB 1DQ9A 3R5DA 2I5JB 2ZVSA 3HVRA 2IFXA 2HGLA 3IFEA 4TU9A 1J27A 2ADCA 4F4ZA 2UXBJ 4LF6F 3FQKA 2AJ1A 1O5JA 3L4BC 4NEZA 1R27B 2XYPB 4DR7F 5C42B 3CCSS 1HNWJ 3QWUA 2RJZA 1Y9OA 2HMIB 4UOFA 1GEHA 2V4QA 2U2FA 3HFZB 4ED1A 4X4VA 3MEEB 2E1RA 3OJUA 2G1HA 2MB0B 2VOPA 1S5ZA 3J7A1 4Y65A 3PRBA 1BQNA 3AQPA 5KFTA 4YB7A 1R8PA 2WSFC 3M2RA 3P6YC 4OYBA 4PG8A 4PAAA 4KBIA 3TJAA 2VG7A 2QL7B 1SC3B 3I5AA 2WVFA 2FHJA 4DG1B 3PW7A 3W61A 4B17A 2U1AA 3MEGB 3AHPA 3DRSB 4NLUA 1XERA 1SJ3P 3FEXB 2FC9A 4L73A 3HFVA 5KFUA 2W8LA 4K4TA 4KTQA 3HULA 1PILA 5C24A 1VQ6S 1CEZA 1HMVB 1XMOJ 1PBAA 1R3NA 4QPTA 1RWPB 3THPA 1HQEB 4HVZA 4F04B 5GADI 4QQBA 8AT1B 4U8YA 3U1NA 2GA7A 3HP6A 2RRAA 4PCQA 1HQUA 3DRYA 2DHHA 4U8VA 1IBKJ 1P1LA 3PVXA 2UZAA 1MW7A 3S1TA 1FRXA 4QYRA 3HHNB 1FDBA 3QRQA 3M6WA 5K14B 2C3PA 3CNQP 2NXCA 5KFVA 3PW2A 5KAKA 4KFBB 1CG2A 5D4PA 5J2NB 1SC4B 3R7SB 3DLKA 2C2RA 3T6BA 2YKNA 3GV7B 5A8RA 3BBBA 2ZE2B 3PNIA 1H7XA 3H90A 1NO8A 1YRXA 3MAHA 4FXWA 2R7VA 4ZHRB 1UPMB 1NPKA 2Z56B 2GHWA 5MAOA 4C11A 3K5NA 3H5UA 4PQAA 4C7QA 4ZVQB 2JH3A 2F63A 4UOHA 2WOMA 1U02A 3T5JA 2VASA 2HBYB 1UVMA 3QO9A 1VLOA 2B9YA 1NLKL 3PR5B 1FA0A 4JI6F 4WF9Q 4DHVA 3MCOA 1X5PA 4IRCA 4P75A 1J5OB 4CWBA 3OXFA 4NLDA 5GMEA 1XQIA 2BJ7A 3VAIA 4PWWA 4USWA 2DNLA 3M8SA 4DFMA 2R2SA 1S1VB 3TEGA 4J9LA 4JOUA 3DDIA 4KKOB 4OYIA 2CADA 2DB1A 5B0GA 3CT9A 1ROFA 2DGOA 4UY85 1ICEB 3THVA 2OFGX 5F8NA 2OEKA 1GMUA 1NJIT 2K3IA 3K2YA 4Y00A 2JRSA 3N4WA 1MU2B 3KK1A 1HI0P 1S7IA 2PDAA 4GVBA 4X4TA 3U02A 1FXDA 3RRGA 1C0TA 3FEZA 5ETTA 2DISA 3F56A 1WF1A 5CH7B 1HNZF 2O1PA 4AYBD 2D69A 1HWIA 3MPWA 4UQGA 1HPZB 3RYLA 4DQPA 3CJ2A 2A2DA 2CRLA 4HYKA 1XNQJ 5IC4B 3CJ8A 1NK9A 1U1RA 4NLOA 2Z2MA 2V63A 4UZBA 1WEZA 1L3VA 2FVQA 2JVRA 3AOAA 1CSJA 1U49A 3WX4A 2HGNA 2IJRA 1JLEB 2HFNA 3I4PA 5DDQC 3D6TB 4KO0A 4CTAB 4FVCA 1S59A 4OZLA 3LA0A 4IFYB 5K20B 3V6KA 3JXOA 4ILLA 1JJ2R 3SFGA 1F5AA 3I82A 2ZEJA 2DO0A 2MQOA 3V4MA 4DL7A 1REVB 4DDFA 3N6LA 3CDWA 2AGOA 3J81j 1HI1A 5LSRA 1N48A 3BPSP 1MWYA 3T19A 1UWBA 4R8UB 3G6ES 1FWKA 1Q82T 1CJVA 5KFKA 1CJUB 3T3FA 3VGUA 1NPRA 3A3PB 1VBXA 1YVFA 3FBCA 4L3KA 2VBYA 5H9EK 1RI7A 3K58A 4O44B 4YR0A 3OR1A 5AJ3J 4ES1A 4M5MA 3LWLA 4WE1B 2QSWA 2ZH3A 2DXEA 2M7SA 1S4EA 4LJMA 2RVJA 3M2VB 3KHRA 3N5FA 1Y3JA 1RHRB 2B51A 1KKHA 4F2RA 3PX6A 1UVJA 5D4LA 4CH0S 5CA5A 1VQNS 4P2SA 3BR9A 4U7UD 1TK8A 3IGVA 2OEMA 1ZZNA 4RUBA 3M32A 4OI4A 3DOKA 1SI9A 2LA4A 2CQDA 2OLWA 1REGX 3UVJB 2XNRA 4YFUA 1D9FA 4JI0F 3FZBA 3VF0B 2ZM6F 2H4YB 2ZBCA 1UMJA 4OHYA 1SQGA 4ECQA 5E3AA 5HVFA 4QJVA 4O3NA 3M4XA 3PRVA 3TEHB 1VQ8S 1JK9B 1RUSA 3R7NB 2HZVA 1LK5A 3W66A 4DSEA 4ZMMA 5AXLA 2CDRB 5FIIA 4MYUA 3CPWR 1S7HA 1I6JA 4QIEA 1QAJA 1W25A 5HK4A 4LF4F 1RAGB 5L9NA 1WG1A 3OFGA 3OD2A 3PX4A 4IG0A 1YG0A 4KGXB 3CDAA 4EYHB 4HI2A 1RACB 4A8WA 4OYAA 4XDCA 5F8JA 2VODA 1NHVA 3D3CJ 1PYOB 3I96A 2FHOB 4YHHJ 2HS0A 2AJ0A 3RAXA 4RL1A 2SXLA 1KFSA 2VFTA 2KVQE 3DOLA 3ZO7A 3FBBA 3FFIB 2DNGA 1M5KC 5CYMA 1X4DA 3PJWA 4DFPA 2VBWA 2E5JA 3EXYA 4ED4A 4B9MA 3BGLA 1TL5A 5T41A 2HBQB 3KLFB 1O6XA 3GSIA 4TQSA 4RJVA 1NJYA 1HWLA 2IRXA 2QL9B 3CJ3A 4ZVEA 2UXCF 1URNA 4P7VA 4ZN3A 1PYTA 4DUTA 2V8DA 2MQMA 1EB0A 5LMNJ 2FC8A 1FTRA 4HI1A 2MZSA 5A8WA 1V3RA 4IYQA 2IHR1 2KT2A 2AZ3A 5AE2A 4N5SA 1U47A 1JKHB 5EHHA 1IJFB 4WFYA 2YKOA 4DFKA 5K5MA 3MM9A 2YKPA 2OMLA 4V19X 4EGLA 1AA1B 2KDOA 2GQCA 5DLGA 2UV8A 2XWXA 3W5XA 2MKCA 4DSKA 3TAMB 2HHHJ 3IBCB 2HGMA 5JUMA 4ZOSA 4DPWA 4ANCA 3D4JA 3DC2A 3MCSA 3QGHA 3G82A 3EZ5A 3M8QA 4JV5F 2LXUA 3BV8A 4XDDA 1WKKA 2EXUA 3HPOA 2YKMA 3I87A 1HBMA 1DZ5A 2JWNA 5F3TA 3RBDA 3CCRS 3VAKA 4G1IA 3CC2S 1CQMA 2MKJA 4KY3A 3L95X 3KG1A 3V6DB 2QN6B 3W9JA 2P9GA 1G7CB 3D66A 4TN2A 5I3UB 1YBUA 4OJ3A 3PJXA 4F8RA 2OO4A 1QY7A 3W8PA 2IIHA 1B4SA 4ZS6A 3K57A 1NZAA 1LWXA 3M9NB 2F40A 4MK9A 4DFJA 3T1YF 3DN9A 5KT6A 1VJQA 3HXMA 3H40A 1KC8T 1ACMB 2OSQA 2BUNA 3FVYA 3CCTA 1RWXB 5HQ8A 1XMQJ 3DLBA 2CQPA 1GNKA 3LP2B 4AQYJ 2RAQA 1VRUA 2Y1JA 4WIQA 2OPPA 3TAPA 3C15B 1YITS 3CO0P 4K2XA 4NLPA 2HQIA 4DMZA 1S1XA 2WSEC 1RP5A 2RU3A 1R8CA 3BKTA 1SJ4P 3D28A 2W2QP 2M3DA 4F4WA 1YJRA 3EUNA 5L1JA 1X4AA 5IWAJ 5ETQA 3UDVA 3PYDA 3PYGA 3CCES 3FSYA 3C14B 1Q8KA 3CDUA 2V67A 3MEDB 3DNCA 3H98A 1LNQA 2FQQB 3DGPB 2BJEA 1SCJB 4E0DA 2B0GA 3FC9A 1LV5A 2XQCA 5KG7A 4JI1F 3PO4A 1H74A 1U1LA 1OY6A 3D67A 4WK3A 3TJ8A 1JLAA 3L09A 3EMTA 1KLMA 2ALYB 3U1MA 3QWPA 4N8NA 1VIOA 2OUGA 3DOMA 3GZ7A 2IAJB 2CQCA 1CJKB 1RB0A 2ERRA 2HURA 3HHLC 2UUTA 2FZCB 2MKYA 2IM2A 2GVDA 3SCLE 4X4QA 2YX1A 2WVEA 1JJHA 1VDHA 2FLOA 3A8EA 4LRBA 4OHZA 2DNYA 4MH8A 3PTWA 4DV6F 5DO2A 1Q8BA 1QAXA 2XC9A 1T94A 3CCZA 1R8AA 3E51A 2ATCB 2J9DA 4HTJA 2JOQA 3HX9A 3WDOA 3HHEA 4ZVOB 5CD4A 2XO7A 4L76A 3FCHA 1TL3A 4I6WA 1HBNA 4AUKA 2VB6A 3K0JA 4LSLA 1VQSA 4F25A 5ADZA 2KRBA 3UN3A 2XY6A 1WC1A 3IG1B 4O3SA 1WHVA 4LBIA 1IKVA 1O0PA 5SZTA 3M8RA 1FK9B 3IRWP 1Q0NA 3CF5Q 2J9EA 2CJAA 3AY0A 5EX3A 2YQ1A 1W2IA 3LPEA 1NJZA 2DNNA 3GG0A 2BQUA 5E5NA 2B4VA 4M1KA 2HNZA 2IVFB 2CVEA 1J5EF 1S4FA 2AHOB 2CJKA 3UCGA 1DURA 4R5PA 5HLFB 2R2RA 2HFZA 3MD3A 1VHIA 3I0SB 2C3MA 1IKYB 3ZTOA 3E2EA 4DR2F 3N9UC 2HBRB 4ER8A 1Z4UA 3G86A 4A47A 3VWSA 2W2OP 4EMDA 1WHYA 2FJEB 4RW8B 2EEYA 4OI3A 4KH0B 4F4XA 5KFLA 2VFVA 5I3QA 2CPIA 1AW0A 2DNKA 3D6FB 3IAM9 2XZWA 4G3IA 2DGTA 1LWFA 2HLTA 5HL7Q 4NLQA 1DAXA 1L3KA 1S1WA 3W64A 2NSCA 3TP2A 4JI4F 1WTBA 4K4VA 3SDEB 3GILA 5H9FJ 1TL1B 3UE2A 2AX0A 6FDRA 1F3FA 2VBZA 2EC2A 3BN4A 2DY1A 2V8VA 3HVTB 2XM3A 4NCGB 1OYDA 2OSRA 1RA6A 4J9KA 1Q78A 2MZQA 3CD7A 2KFNA 2M70A 2Z2LA 4CT8A 4XPEA 3MURP 4TYBA 2CZ9A 3OTDA 1RWUA 4ERDA 4ZVFA 1TKTA 3O1LA 4LRFA 1X4EA 2FJAB 4D3HA 4DQSA 2KZZA 2JFKA 4PZVA 1CC8A 3OFEA 2RNEA 2CPJA 3MXHP 4A8YA 4B9UA 4ECYA 5ETKA 2VV5A 1SJQA 4WYWA 1HNXJ 2XMJA 3DU6A 2Z30B 3H5SA 4B3RF 1I51B 4DV4J 2DCUB 5G0RB 5KG3A 2MJUA 3NMAA 1RAJA 2HVIA 4PWDB 4USMA 2HHXA 1FFSB 3CCJS 4L3NA 1RT5B 4I2PA 4K5RA 2VHGA 5BXIA 1NH8A 2LEBA 3GFHA 4LF8F 4ZP7A 4ZVRB 4LF7J 4DQIA 4OYWA 2CJ9A 2NYIA 4NYPA 2XTJP 4B3MF 1SH2A 1WEXA 3CIZA 1NB2A 2A3JA 3VAFA 2R7TA 5AE3A 4E2FB 5BYQA 5CHCB 1AFJA 1YLXA 1ZH5A 4KHPF 4M5NA 5GVQA 2CJXB 4M95A 2XWYA 4QR1A 2WB4A 2XS2A 1OIAA 4EEYA 1VHFA 3FDSA 2F7VA 2LQ8A 4PKDB 2CZ4A 2UP1A 4IRKA 2GMHA 5F9LA 4TVAB 1P9YA 1JLCA 1IKXA 2JEFA 1Q16B 4YB6A 5LMUF 3DMJA 4RBUA 4DR4F 3PRDA 5EGYA 3D1OA 3N6NA 2FVCA 2UUCJ 2V94A 1JX4A 1WOPA 5HJXA 2JFDA 4QU6A 2EFQA 2MYFA 2V4RA 3SI8A 3POTA 4RNNA 2V4JA 1HIYA 5HMWA 2VQEF 3LQVA 1G6BA 3G6XA 2HQCA 2HWTA 4RW7B 4PEOA 2NZ4A 2GMLA 5K8OA 2EKYA 3CMAS 3UDCA 1SUQB 3R5CA 3DHWC 1XR7A 3DI6B 4RUHA 2B5JA 3PV8A 4P74A 4JI7F 4USKA 2CPHA 1RBOB 1WF2A 5CD4H 4DR1J 3QIPB 2MQQA 2IA6A 2RDIA 3S7RA 1EP4A 1U1QA 2J6TA 3IP0A 3O3LA 4OFZA 4ECVA 3NNAA 2DH8A 1VQLS 3RB3A 1WC6A 1XK8A 5HBMB 2G1DA 1QDUB 3OR2B 5DRKA 4CH1A 4EO6A 3MDFA 4LVNP 5B09A 3QAUA 2DEIA 3NOGA 2M9KA 3Q8SB 1XWLA 4NPOA 1NSKL 1GAOA 1X4BA 2M0GB 2YKQA 1OMSA 3Q86A 3TUIC 2BM1A 2MY8A 5KFNA 2BANA 4HEA9 3MR2A 4DN9A 1NM2A 2VA2A 3RR7A 1S79A 3GE9A 3CJ4A 4K50A 4QIGA 2PGCA 1JLQB 3ET6A 4EBDA 1WORA 3P45B 3AD8C 2VA3A 2XLKA 2WVCA 1U6FA 2UUAJ 4EFAC 3IO1A 1XIQA 3FBEA 1XBWA 1U1MA 3NGKA 5E2QA 3EYZA 5DDRC 3Q24A 1VJWA 2RDJA 1SJ1A 4NEYA 3DLJA 2HNYA 1GX5A 2VPZB 2MLZA 2RF2A 4ILMA 1YJWS 5EX0A 3AH6A 3LAMA 5KFFA 2XGPA 1RTDB 2XI2A 1UEUA 5D3GA 3NL0A 4WCEQ 1XEZA 1HL6A 3HZEA 4LF4J 1D09B 3H2UB 5LSLA 1KN6A 2KXHA 1JJ4A 1FO1A 1Y7PA 3DLKB 3ZTSA 1YQHA 3DRRB 2UV8G 1NNDA 1WF0A 5HN0A 3CWJA 1UTAA 1N52B 2PI4A 5C42A 4F26A 1X5TA 5HJYA 1OSCA 4A48A 5L1KA 2HMIA 3PYFA 2KH9A 2ALZA 3RW6A 5LOQA 2C2DA 3MEEA 3EVMA 1NHUA 1U2RA 3OHAA 3HCXA 3LW5C 1RWOB 4MT1A 3D7SB 3NGSA 2YTCA 1MROB 3FNNA 3EGVA 4Y2CA 1OY8A 2OPSB 3IBFB 4DG1A 3NBPB 4EI2A 3MEGA 3DRSA 4EU0A 3CSKA 3QT5A 2FGOA 4TNOA 1ZTTA 1T3NA 3H42A 5D0GA 1FJEB 1HMVA 2A0FB 1IBLF 2GZOA 3K5LA 4OYXA 2VFUA 1HQEA 2XS5A 4RWWA 3NS6A 4DX6A 1M5OC 2OI2A 3IR7B 3P5BP 2FD2A 4PQUB 1K44A 2JC1A 1SBRA 2WRMA 1TP7A 2BRKA 4ZA1A 4Q8EA 3BB5A 4IKAA 4WKYA 2YNFB 3J7ZT 4ZLJA 5K14A 4XK8C 2GV1A 3JAMU 4CM0A 4KFBA 4JV5J 3W9HA 5J2NA 1PSDA 3CUNA 1RKIA 1ZBTA 2PMHA 3QNWB 4KRWA 4DXLA 2CAJA 3SXLA 2KM8B 2CPFA 3IWNC 2ZE2A 4Y2AA 4PUOB 4JV2A 3Q8RB 3FZ2A 2QYCA 4UOGA 4ZHRA 4ZJLA 1SQEA 1TVRA 2KT5A 4HT5A 3I55S 2NXJA 4ITSA 4DU7A 1KONA 4A8XA 5EWEA 4DZ6A 3HHDA 2AU0A 2MXYA 4XAKA 3JSYA 2G4BA 1DBDA 3OTOJ 2UUBF 2PEHA 3D3BJ 4FYXB 1J5OA 1VISA 3A8IA 4MTPA 3R3TA 2WW8A 1VBZA 3CJKB 1S6PB 1S1VA 1DLOB 4C8MA 4KKOA 4I6AA 4U9RA 1ZM2A 3KLGB 2MDAA 3ISND 3BO4A 1QTMA 3KYLA 2C42A 3GONA 2EVZA 4CO5A 4CQ1A 3BREA 3H20A 1MU2A 2BEFA 1LOUA 3BYRA 4IG3B 3QGGA 3EPGA 4DWIA 4G65A 1U8WA 2KU7A 4RU2A 4B9VA 4WU3A 3CDBA 5BR8J 3EDQB 1VRQC 4ELTA 1HPZA 1WDDA 2R9LA 2OPRB 4WU2A 4LRCA 2E66A 4RBVA 1RADB 3OLAA 2HRTA 1RCXB 2H5IB 4C0BA 2E5HA 3BGRB 4K0KF 2HS3A 1KTVA 2XMMA 5H1SV 1LK7A 1NJXA 3IAS9 1JLEA 1CJTB 2I1RA 1JXVA 3EDRB 1C1CB 3WIUA 4X62J 4DCOB 4IFYA 2CJQA 4V19J 1TTHB 3BGUA 2F4VJ 3ENQA 1FJCA 1REVA 1C4AA 4WYLA 1A9NB 4QW9A 2AGQA 1FX4A 2RT3A 2UXBF 4NE9C 4DSJA 3M1VB 2IM0A 1I5OB 4KE5A 1SH0A 5KT4A 4R8UA 3FK4A 4LUBA 3P96A 1FI4A 1WC4A 2ZHBA 5LM7E 2XZDB 1CJUA 3J7YU 2XYGB 2WK4A 1Y4ZB 3M9OB 4Y3CA 3BH6B 2AEJA 2DNOA 2IVYA 4O44A 1HW9A 4URQU 2ROEA 4OI1A 3DOLB 1HBUB 4F0HA 8ATCB 4WE1A 3BQ2A 4X64J 1RAAB 2J9CA 3M2VA 3V81B 2HK3A 3FKBA 3EX7B 3CIMA 3A13A 2DIUA 2XLIA 3I9ZA 5DM7Q 3OQ2A 4WFAQ 5D8HB 3GU0A 1NK7A 4P9SA 4NLXA 3GV5B 3VAGA 4FYYB 2JLGA 3RUBL 4DQRA 3J7AN 5CZVA 1ZETA 2XEXA 2P2CB 1S0OA 3UVJA 1D1UA 4DEZA 3TQEA 4J37A 5DZ6A 1XMOF 3GJQB 2QZ8A 4LF9J 2PE8A 3PHEA 1FNXH 5FDLB 3M9MB 1BGXT 2R8KA 4JP8A 5E3RA 2JEIA 4DU8A 1IBKF 4PR6A 4JYAF 3D1QA 1Q8IA 2GW8A 2V34A 3MEKA 3DXBA 3CCMS 2AIRB 3IWLA 1Q7YT 3QSYB 2JHEA 4F3MA 3QIDA 3OSPA 1WELA 1PAUB 1D8YA 2FB0A 1GK8A 4PG4A 4ZVSB 1EAYC 4FXDA 4ZCMA 2YKMB 1MN9A 2MKSA 1PG5B 2WCXA 4ICLB 2GC8A 3Q0AA 1WOSA 3W2WB 4USTA 2AX1A 1YJ9S 3A4TA 1FRIA 2BR0A 1Z2LA 1N33J 2CKWA 4KH1B 1G1XA 3MMJA 5K8NA 4CYUB 2LKZA 3HHLB 1C1BB 2RSQA 3FFIA 4NA2A 3KLEB 5DQIA 5C7PA 2B7CB 1T02A 1RYSA 3KLFA 1T9VA 5E3CA 4CLFA 4ZLLA 1IKWB 2DR8A 1UEKA 3SV3A 4F67A 2CQ4A 2Q6CA 2HQFA 1TKXB 2D3O1 2ZZTA 3I31A 2PMWA 4USIA 1C4CA 2ZH5A 2H1YA 3RR8A 2V6AA 5KT7A 1YJTA 3N28A 4TYAA 2Z0GA 1QD1A 1D9DA 1WC0A 4WP3A 1T9WA 2CUYA 5A6PA 2L41A 1S57A 2I2YA 2VFSA 4DN0A 1T9XA 2P9EA 2AV5A 2PMZD 5EWFA 1V6HA 3QZ8A 1JKHA 5KFMA 5KTQA 4QWDA 2GCFA 1TR0A 1RCOB 2L9WA 4H4MB 2I9SA 3SCKE 3MFHA 3T5HA 2QV6A 2X1AA 2DHXA 1X9SA 4FVMA 3TAMA 1X4FA 1RTZA 1T9UA 3NG8A 4HHUA 2LMIA 1L5UA 4F50A 1WC3A 2FYXA 2X1FA 1UKUA 1Q86T 4I4BA 1VQ4S 4J9UE 2YKAA 5FLXU 1AT1B 3DLHA 1RWMB 1XNQF 4J9MA 2BVZA 4OLOA 1ZTWA 2EBGA 4LBHA 5KFPA 5IS2A 2XYHB 2UU9J 2FJDB 5GAEI 4C0HA 4FF3A 3EZOA 1T11A 2X51A 3V6DA 2Q3PA 5J2MB 3H2LA 3QLHB 2OTJS 2GIRA 5I3UA 3LPYA 3A1YG 5G4DA 4DR3J 1QAIA 4USVA 1HWKA 5LMUJ 4CLKA 1UETA 2HYIB 5KG5A 3KTQA 2V8GA 1H6KX 3GYNA 4WPAA 2HSEB 1F5CA 5KFJA 7AT1B 1SPBP 3LP2A 1XR5A 2ZNZA 3MMCB 3GJSB 3PKMA 1R43A 1VR6A 5AJ3F 1IN0A 2ZOFA 3C15A 2G0CA 1U0SA 1KQGB 3OFFA 3EGNA 3BPDA 3N79A 3DDKA 2CDQA 4YB1P 5DLFA 2D3ZA 1CVJA 3HVAA 2DEJA 3R6LB 3QQCD 2DVIA 4JI7J 2P6TA 3GB0A 1KWMA 4LSZB 2RQMA 2W2NP 2JNJA 4A8SA 1VC6A 3C14A 1R31A 3FMWA 1BE4A 3MEDA 2KFYA 1Y00A 3DGPA 2NREA 3DXSX 1H38A 4FBUA 3VVTA 3GLJA 4NCAA 2H9ZA 3HT0A 1VQ5S 4RNOA 1R6VA 2YPYA 4DS4A 4DL4A 4PG7A 2DITA 2BBEA 3X3UA 2IAJA 2O01C 4OV1A 1CJKA 1LWCB 2ZWPA 2MY7A 1N5VA 5I4MA 4ES3A 3NGRA 5IM0B 4C6AA 2AGPA 1XMBA 3QSIA 2ASDA 4ILRA 2LU2A 3IM8A 5LXRA 3NOCA 1N5SA 2CNNB 1RHQB 3ETOA 1VQOS 1YZ6A 2Z2YB 3MTKA 5A2QU 2L48A 2DGWA 5E3QA 1S48A 2PT0A 4YHHF 1X60A 3CE8A 3AB2B 3VAMA 1GMWD 4CO1A 3FCWA 2DBBA 4OYOA 4TLQA 2YY3A 5L46A 3Q22A 2Z58B 5L39A 4FDFA 1ZA2B 1XTZA 3IG1A 1ZZFA 3FEYB 1S72S 3GR0A 4IOAQ 2JC0A 5L8RC 2GMJA 3QFHA 2J8AA 5ETSA 1FE4A 1FK9A 1NBEB 1KQKA 5HP1A 1FD8A 3OLBA 1HNVB 2ZHAA 1T9TA 2KJWA 2BE2B 1YDLA 2YWHA 4FP9A 5LMNF 2FY1A 4O3QA 1LXJA 1AFIA 2WONB 4NI2B 4UY8T 2CPDA 4KPCA 3UDLA 3Q2TC 3NAIA 2QA1A 3PCOB 1S1TB 2XGQA 3Q8YA 4UUXA 1ZS6A 3PZPA 3T9NA 5HLFA 3I0SA 2XO6A 1ELOA 4ED2A 1IKYA 4YS2A 3QGIA 2KJVA 2DY9A 3BS9A 2ZHOA 4O3OA 4B9NA 3CD0A 1RHUB 2L08A 2HHHF 2YVSA 4Y34A 2B7BB 1W7WA 3G8SA 4RW8A 1JLGB 4CIOA 3D0HE 2ACMA 4TXSA 2H4WB 3L7PA 3IS9B 4JV0A 1S6QB 1S77D 6AT1B 1AUSL 2VBXA 1NXIA 2EBEA 3V6HA 1FESA 1TV6B 4F02A 4NA3A 1APSA 5JVGQ 2VPWB 3SDEA 4ZCKA 1Q7LB 1TL1A 5L9XA 1VBYA 3HKWA 3SIPB 3OJSA 2E5LJ 4C8LA 2KXFA 4GKJJ 4HHHA 1U09A 3TZWA 4NL5A 1KQSR 3TVKA 1M90T 3Q2SC 3TJ9A 3HVTA 2CJBA 4NCGA 3ADAC 1M1GA 1RT7B 1SIZA 4CT9A 5D4NA 3JYTA 1NK8A 1UJ5A 4DL5A 1XNRJ 4H4OB 4WFXA 3OTBA 1U7LA 1JWWA 4O4GB 2YNHB 5IFMA 3CVKA 2DXDA 3JB9k 3MFIA 4P2MA 4Q0BB 4AQYF 2K8GA 2E7VA 3POTB 2CXEA 1QSLA 1X7VA 2B9XA 2JEGA 2MZRA 4RW9B 1X8DA 2EC0A 4K4ZA 5A0YB 5G0RA 1SKUB 1E6VB 2FLNA 2Q79A 3KDOA 5KT5A 1S9EB 2ACYA 2CVIA 1U6ZA 2YWEA 3OV7A 1IM6A 3ELHA 4PWDA 1F1BB 3MGJA 2DRDA 1RT5A 4LREA 5LJ3Y 3C3LA 2NXNA 1IWAA 3IGNA 3ILIA 3MR7A 1GXTA 1FERA 2H54B 4UUWA 4GKKJ 3VAHA 2BOPA 4DV2J 5JJBA 3IBWA 2ZD1B 3MAQA 2BX6A 4G1PA 3R9LA 2H5EA 4BBYA 2UVRA 3ZZ0A 3BN7A 5C2CA 4EK2A 3R6GB 3TANA 1RTIB 3K17A 1F2GA 3GFZA 1ULRA 1B0PA 2CQ3A 1NZ8A 3ZNJ1 2MJNA 4QOTA 1Q4RA 2KXNB 2ZITA 2XY7A 3VALA 2HBZB 1N88A 4XIUA 5LJ5Y 2JEJA 1YRTA 1X0PA 1V3ZA 4DL3A 2BE7D 4W4MA 2V9WA 1FWPA 1E6YB 5BYRA 1QM9A 4ECZA 3MMAB 4AXIA 2BQRA 2GIFA 1S99A 4N7TA 1FE0A 4U6PA 2RF2B 3GYXB 4NLVA 2CPEA 2LP4A 4RW7A 1X0FA 4HHJA 1S97A 4ZVTB 4DUYJ 1SUQA 3H7HB 2LDIA 3H4DA 3DI6A 4DBQA 4BC7A 2R7RA 2ZOGA 3EWGA 4OMFG 2C3OA 4J9NA 2CNOB 3UN2A 3QIPA 3OVBA 1K73T 2HQDA 4TU7A 2ASYA 4CLLA 5LSOA 1PCAA 2QSFA 5KFEA 3HI9A 5HBMA 2ABYA 3OR2A 4FNHA 1RAEB 1KDNA 2M2BA 3KNGA 2WB1D 3ICLA 4OHWA 3R1HA 3OFHA 2DYAA 2YX4A 1B64A 3C46A 1VQ9S 2LXFA 1V9OA 3VGVA 5AXNA 2CG4A 4J9SA 2BOAA 1YK9A 1JLQA 3G9CA 2ZUGA 3EJMA 1IBMJ 4K2JA 4X4PA 3BJYA 3PYEA 3IWXA 4JB8B 4JI3J 1OJ4A 2JLFA 3LALA 4V1Ak 2GNKA 4ZP9A 1N4LA 2QLWA 1FCAA 2NQPA 3ZTQA 3UN5A 4CM2A 3W65A 3MR5A 3G8QA 3HK2A 4JYAJ 5CZXA 5B7WA 4X65J 2XHCA 3BEGB 4C8OA 2WW4A 1OY9A 2YNGB 5DG7A 2ZJQQ 3B4DA 3PO5A 5D0RA 3VZHA 2HWHA 1RTDA 1IQZA 2ZH7A 1RZMA 1CBKA 2LFVA 4ZIWA 2IDEA 4NOHA 3DRRA 3PW5A 2PIIA 3LP0B 5F0WA 4IQMA 1N5YB 2LQ9A 4F3OA 3A8KA 2DCLA 2DKOB 2AT1B 2ZZNA 4M5IA 2W9BB 4NX9A 1TVRB 4OLPA 4KGKA 1QE1B 3C66A 5IV3A 4FF2A 1HNXF 2MQNA 3J81U 1WD6A 2H3EB 3D54A 4LFCJ 2VZ9A 4DV4F 1RLDA 4JI2J 1HQ2A 4ED3A 4O4RA 4R25A 4CP5A 1D3WA 1M1HA 3MOJB 2IRUA 3MM7B 2R4FA 3IA0A 1MROA 4I0WA 4NZ7A 5KFDA 2VQFJ 5EUHA 2OPSA 3NBPA 1W2BR 3I56S 1PYSB 2GGPB 4EUVA 1X9WA 2OIHA 5KFSA 2BQ3A 2GJ2A 3MF5A 3OW2R 2MHEA 1CS4B 2ASLA 3OL7A 4LF7F 4ECSA 4A8QA 2YX7A 4MFBB 1HA1A 2ILYA 3WHIA 2OAUA 1VI7A 1N54B 1IWGA 4ZCIA 3QJPA 5IC6B 4OZ2A 1T3OA 3ZTPA 3N0VA 4JI8J 4C9DA 4DV0J 3UCUP 3EVOA 4PQUA 1MWZA 4DSFA 3ISNC 4ZPWR 1GQEA 2CQGA 1KEKA 2VF3A 2MGZB 4I7FB 2RHSB 2YNFA 1DFDA 3K7RA 1S9GB 3QYYA 2BW2A 3KLVA 3LH2S 3W2VB 1N36J 3I0RB 4LSNB 3G87A 2KZMA 2UUCF 1Y10A 2NUUG 1U2CA 2ZC3A 4OHXA 2E1PA 3TARA 4OI6A 2E9ZA 4PUOA 5H9EJ 4M63A 4CI0B 1FFGB 2ZOMA 2ZBIA 2KYXA 1UAWA 4AL6A 2Z2ZA 3AB4B 3OVSA 1JXLA 1OPIA 3QRRA 1F3VA 1S0VA 5M2RA 4ZVGA 5IT9U 3WIVA 4YN3B 2PFFB 4OQJA 4Y6IA 1NH7A 1TKDA 4OI0A 4DR1F 2IA0A 1HD1A 2IM3A 4OJGA 2Y8YA 3SQOP 4TKTA 3AJ1A 4LQ3A 2X1GA 1BC6A 3CJKA 1S6PA 4YB5A 2D1CA 1DLOA 1TFYA 3K5PA 1T95A 2VJUA 3A3NB 1N5TA 2BYCA 4AD6A 3KLGA 3RRKA 4EBEA 4RU9A 2LECA 1B3TA 3N6MA 3NCRA 5HQMA 1UW4A 3GV8B 4OYPA 2R7OA 2MQ8A 4IG3A 4P10A 2XCPA 4PXBA 1NEEA 1RT4B 1QSSA 3UNGC 4IOCQ 2CYYA 4UT4A 2XBPA 2NYHA 5M2PA 1RWKB 2W7AA 2OPRA 4FS2A 3NWGA 3G6VA 2UUAF 4Q44A 5ETMA 1N5QA 1U1PA 1FKAF 2Y1RI 2KM8C 1YSJA 3KK2B 3K8VA 3BGRA 3IR6B 3KK3B 4CDIA 3CJSA 4DLGA 1CJTA 3DDNA 2RD5C 2W9CB 3TX0A 5B0EA 1C1CA 3H59A 4ELUA 4YOEA 2DR6A 1RTJB 2XSJB 2R8JA 2YH1A 3EZUA 4RW4B 4P7TA 4B3TJ 2AJ4A 1EJ7L 1ZM4A 2M8DB 2BA9A 3M1VA 1I3OB 5T14A 3MM6B 3Q8QB 1ITPA 1X5SA 1NB7A 2LA6A 2W24A 2NZCA 3I32A 3P3DA 1SQFA 2EWHA 3NEKA 4OZ1A 1BWEA 3GYGA 5CYQB 2DK2A 2B4UA 3S6EA 4FNIA 1RE1B 3OT9A 1HWJA 4B02A 1HBUA 4WWSA 3A3OB 3ILLA 4LR7A 3V81A 2F8EX 4DR6J 3QJJA 4KB7A 3DLEB 2LQJA 2FHMA 2EG1A 1BQXA 2YBVA 2BV3A 2C3UA 1SC6A 3MWBA 2HS4A 5F8HA 1OO0B 5B0DA 3MUVP 4DV5J 1SL2A 1HNIB 1WKLA 3G4SS 4USHA 2BKNA 2YWGA 3J7YI 4OX9J 1S10A 4BC9A 5GAEU 3LP1B 4NZ0A 2RILA 3VGSA 5FDLA 1P8GA 1SVDA 3VCDA 4LF5J 3LANA 2QT7A 3UI3A 5K8MA 2N4DA 4Q43A 4M94A 1TL4A 3HSJA 3ZC4A 4C8KA 1VQMS 1VBKA 3VTIA 3OHBA 1UVNA 1ZOTA 4IFVB 1VQKS 4DJBA 1YJVA 2CQIA 3T6JA 2K3KA 1BHNA 4E8UA 1QJHA 1VGYA 2ZBPA 4HDHA 1TFWA 2JL9A 4F0KA 2QMUB 1HKAA 1Y5IB 2RMLA 4ICLA 3KLHB 3MPVA 1LFWA 4NA1A 3W2WA 1UL3A 3BKFA 2OHDA 2WTFA 4OX6A 4EYIB 2R7QA 4YUDA 1RT3B 3KDNA 4J9QA 4CYUA 3HHLA 2VIHA 1AZSB 1C1BA 3MM5B 1FNOA 4IO9Q 2EFNA 4ANEA 4AXJA 2UVUA 3KLEA 4CNYA 3P49B 4QIVA 3OTOF 2FJWA 2HVZA 2G2OA 4O0NA 1VQYA 1IKWA 3GCXP 4FKXA 2CWXA 3RB6A 4LRDA 5A6WA 3HHKA 3VAJA 2XLJA 5F0UA 1TKXA 4DPYA 4I69A 2DJWA 3CULA 4A8OA 3FUYA 4DI6A 1MLAA 1RAIB 4JUZA 3MCMA 2IC3A 2F3JA 2LCWA 4ZITA 3CMES 3P5TL 5HMXA 2CQ0A 1Y5LB 1DQ8A 3V6JA 1N6QB 4WJBA 2L9NA 2XI3A 1UFWA 4H4MA 3AODA 2V2KA 2F9JA 2HIYA 4HACB 5DS7A 3KHHA 2YQ3A 1GH8A 2QX0A 4EZ9A 5BR8F 2HHTA 2VKRA 2N4CA 3TZYA 1GX6A 1R0BG 2O67A 1OSDA 4PPDA 2OPQB 4Z7CA 4FZVA 3OL9A 4P6QA 2BACA 4WZQA 4PWUA 4F36A 2QFJA 2JVOA 3KWMA 3RTVA 2RU9A 5KOWA 2W2PP 3RG6A 2W01A 2FLLA 3JTOA 5KT2A 1UVKA 2RUGA 2HFOA 3TR5A 5KFHA 5J1EA 5J2MA 4X62F 3QLHA 2PN6A 3C6UB 3KUHA 2EPIA 3BKUA 2F4VF 2CZVC 2B43A 3GIRA 4TLRA 4DS5A 3DLLQ 4FPIA 3KJVB 1NDKA 4C8NA 3RBXA 1DQAA 5L1LA 3E01B 3EGWB 1H72C 3SCJE 1YJNS 4ECTA 2F4FA 3SSQA 1QUVA 5GMKa 2GO9A 4LFBJ 3MMCA 1RK8A 1N56A 1IQTA 5F3ZA 2VFRA 3S01A 5SUHA 2CFXA 1DHMA 1JNZB 4OYZA 4YR3A 1R89A 4DQQA 4X64F 4DPXA 4KV8B 2YWKA 2GO8A 5J2QB 3JSMB 1P6TA 3ZZRA 2D7SA 3DM2B 4OZJA 4QW8A 2VL1A 4H54A 2HK2A 4XTTA 1R0AB 5HP1B 3QFWA 5AXMA 1ZM9A 2D3UA 2ZC4A 4OIXA 4N77A 2R7WA 2WHOA 2V68A 4IR1A 1BQMB 1N0UA 2DHAA 5KG1A 4HDGA 4NXMJ 2LDYA 4OYMA 3ISZA 2B56A 1FKOB 1JLBB 2O5DA 3B54A 4DZDA 1U1KA 3GIIA 4LF9F 2VKZG 1RAHB 4C3LA 4ETZA 1ZAWA 2MLYA 5D4OA 2VICA 4UW2A 2ZKTA 2LQ5A 2R7SA 2P5VA 3MPDA 3AAWB 3KG0A 4MK7A 2I6WA 1ZAXA 4F2SA 2HHVA 1QUPA 3CCWA 5ETVA 2J7WA 4J9RA 1LWCA 2RHQB 3IM9A 1YBTA 1KLNA 5IM0A 3GWCA 1T9YA 1KNZA 2AF6A 3C6TB 7FDRA 4C4WA 3PKYA 2B8QA 3HF5A 1FT8A 4ED6A 2H48B 4G6VB 3GQCA 3JS9A 1KP6A 3RGIA 4CH7A 5KG2A 1UWAA 3WX8A 3AA9A 5HMYA 3AA8A 3D0IE 2W4DA 1F9HA 1S0NA 4ZIVA 2GX8A 1N33F 4AFFA 3SSSA 4B08A 2J0QD 3LUYA 2EK6A 2RQKA 1IJEB 2NPIA 3VHQA 2EK1A 1UZDA 3R5AA 3O5TB 4E98A 1FWLA 3KHLA 2IBOA 2XMTA 3OL6A 2HHSA 1RXOB 3JYTB 4B3SJ 4C0OC 4MKAA 2RH3A 1WG4A 3EPIA 1CQNA 5C25B 2MSSA 3F73A 3ZZYA 4RZRA 1FDNA 2B3TB 3D2WA 2HFSA 3OTCA 1A6LA 1HNVA 4NYOA 3SQGB 4RWXA 2G0JA 2BE2A 4NLTA 4QYZK 2M4MA 2Z8QA 1LKZA 5J2PB 2K7JA 3PW0A 2WONA 4NI2A 2ZWOA 3A8JA 3BQ0A 1NDCA 3D68A 2N3LA 2VG6B 4YMEA 1WHWA 2FTRA 1S1TA 2K1RB 2HIQA 1U2FA 5CCMA 3ZFVA 1NK4A 2L9DA 2RRNA 3RAQA 2VG5B 1FFWB 2H65B 3BZQA 2Q43A 4CO0A 2YNIB 5KFGA 4DX5A 4X2BA 1GMVA 3N01A 4U7UK 2VD3A 1UFKA 1BD6A 4W90B 2NLWA 2E1AA 1HWUA 3C19A 3PACA 4ECWA 2HPUA 1JLGA 4RUAA 2YH0A 3QRPA 2V9KA 1K9MT 3BGOP 3IS9A 4J90A 1S6QA 2BJ9A 3EE3A 1HR0J 5D77A 2GQ2A 3OVAA 2HVEA 2W9AA 3HJFA 3FGVA 4LT6A 3UD4P 2Z4PA 1B0TA 1KR4A 4NXNJ 2FLPA 1TV6A 2Y9HA 2K2PA 2UU9F 2BZ2A 2XS7A 1O8BA 2BDPA 1U26A 4MKBA 1DTTB 1RTHB 1YGYA 2QO3A 3TX8A 1LQ9A 3O6QA 5D0EA 2DPJA 4DR3F 2IBKA 3W9IA 1RT7A 3ILJA 3TOQA 5HROB 3ONQA 4AT1B 4H4OA 1CLFA 3HFKA 4ZLNA 1XJWB 3NMRA 4O4GA 2YNHA 2DH9A 2G2ZA 2W7PA 3KJNB 5I3PA 3ETMA 1WDTA 2RDDA 4Y2IA 5B0AA 4KIAA 4DSLA 2HHUA 4DX8H 4Q0BA 4KR0B 5DQHA 3ZZZA 5GAGI 3QZ7A 2VPYB 3LOUA 4PXEA 4D3GA 3DFEA 3J80U 1NHKL 4RW9A 1JNRB 3D0GE 4K4UA 2CQHA 3PEJA 1B70B 5A0YA 4IUFA 1E6VA 1YRUA 1PJ6A 4DOZA 3ZZTA 1S9EA 2Z57B 1HYSB 2M8HA 4UZCA 2QMWA 3DHXA 4PYAA 3UWTA 1B99A 2MSTA 4JI5J 4WFZA 4URSA 3PHTA 4W98A 2W1BA 1F5BA 2Y1IA 2ZD1A 2WVDA 3JQKA 4IR9A 4W92B 5A76A 3JAMY 3GIMA 2KRRA 1YJ7A 2FGCA 3W63A 2KVIA 5AXKA 4RUCA 3QT8A 3CC7S 4QU7A 5IQ6A 1RTIA 3CDEA 4CLTA 1WJ9A 1UZHA 1FRMA 2CQ2A 1N32F 3NCPA 2HG4A 3RB4A 2BXJA 3OL8A 1H98A 3Q8VA 1TU0B 1GTHA 5MLCV 3FSIA 2RUSA 3THTA 3US5A 3OPKA 1RISA 1RT2B 5ETLA 1PC5A 1DRZA 1U1NA 4C97A 2E44A 3B78A 2GS8A 1RHMB 1Y0HA 9RUBA 1E6YA 4HH0A 5ETPA 4QR0A 2VPXB 3M7VA 2AYBA 1U0HB 3OTEA 5CQGA 1V5VA 3MMAA 5HANA 3NXZA 5B08A 2N82B 5D15A 3FMBA 3DRXA 1KVJA 1Y3KA 3HSGA 3O44A 3QJLA 5E0OA 2QLXA 1N0VC 4A8FA 2NUHA 2BMBA 4DR5J 4N41A 5EDWA 4FS1A 3TI0A 1I94J 4WZMA 2J7KA 1RBAA 3MECB 4KGZB 3L3CA 4M5JA 2GAGC 2HNDB 4RR5A 3CO9A 2COLA 5AE1A 4ETXA 2GVZB 3CCQS 5B0FA 4GC7A 4ID5B 3VV2B 2UVVA 4M5HA 1FDAA 1R0CB 4EO8A 3T41A 2C22A 4N8OA 4XO0A 1OWXA 2R8IA 1WC5A 3PXGa 1TK0A 2V2QA 3M8WA 1OS5A 1S76D 3SYZA 3QT7A 1LEOA 3AOCA 3TVYA 2AJ2A 1RU1A 3TA2A 1L3TA 1X4HA 1FJ7A 1OQ6A 1KS2A 4K4SA 4QIFA 2J0WA 2B9WA 2F9DA 2B6AB 3U1LA 3TA0A 1LWEB 1F0XA 4MIAA 1FNMA 2QYGA 2HRYA 3QGPA 3IRXB 5DDPC 5EN1A 2JSXA 3VQTA 1Y11A 4ANDA 4FYWB 1H2UX 4ZP6A 2QFIA 2I38A 3EICA 3KHGA 4C98A 2UVWA 4YY3F 2XMKA 1VC5A 2A6MA 3KG4A 3PR4A 1NAQA 3ENVA 2E5LF 2CPYA 4GKJF 2M52A 1K8AT 2CWKA 4RX6A 2YNGA 4WP9A 2DR9A 5I42B 4ATNA 5LT5A 3I5CA 2RB7A 5HO4A 3OUYB 3M2UB 1XNRF 2FHKA 1X9MA 3DYAB 2AZ1A 1NMEB 2VDIA 2G9OA 1G3OA 3LP0A 2N7CA 1N5YA 4X66J 3BO2A 2FZKB 1M1KT 2QA4G 2KO1A 2QLBB 5T7LB 1WI8A 4DV3J 2W9BA 2D3OR 3OXLA 2E29A 3R97A 1QE1A 4ZDNA 1V3SA 1Q79A 1KQFB 4ZPVR 3RU0A 2AQ4A 4WTOB 2AKWB 3CJRA 4KPYA 4USJC 1SC1B 4I68A 1WUUA 3MM7A 4C8ZA 3T5LA 3DRPB 4TY9A 4BDPA 3PG9A 1HHQA 2CJYB 2V50A 4DV1J 3KLIB 2HKEA 4GVLA 2GGPA 2GFFA 5E3PA 2I0XA 4GKKF 1F60B 1SV5B 1CS4A 1IR2A 4DV2F 4ZJOA 4MFBA 1GFWB 2F5GA 2W25A 1JIHA 4MKVA 2MKHA 3GPAA 2QEXS 5IZHA 3GFXA 3NP5A 4RLEA 2DNMA 3Q8PB 5CAAA 3RJMB 1NSPA 1X5OA 1IUJA 4M5GA 1M5PC 3FJ2A 3CC4S 4PYDA 1FRHA 2GQQA 3T1HJ 4P2FA 1PIEA 3MM8B 2VOOA 1FJGF 4BWMA 3BDPA 2LQBA 4I2QB 2VDHA 2MGZA 4I7FA 4KC5A 1S49A 2AYMA 1S9GA 3AQOA 3L7UA 1PAEX 2ZUAA 3W2VA 2HHQA 3I0RA 2DR5A 5B0BA 4LSNA 2XG8A 4X4OA 1H0HB 4K5SA 2NXEA 4J9PA 1TUVA 1N34J 2O3DA 2WVBA 5CCLA 4RNHA 2AP6A 2IDLA 3HMJG 2ROGA 2XY5A 5DETA 2LXIA 3OXGA 3HT3A 5D0HA 1ZPVA 2W4PA 2LLZA 3SMZA 1L3SA 4ELVA 2BABA 1HD0A 4HTIA 4IRDA 3B8HA 4EBCA 4M5DB 3JQJA 4DUYF 4C2MA 2F65A 2JZ5A 3F44A 4CO3A 1TKZB 1FVSA 2VU5A 1WOOA 4WK1A 4K4YA 3NKYA 5L38A 2J8SA 3K5OA 4HKQA 1U25A 4MYTA 3HSZA 2QL5B 1RJJA 2MKIA 3RB0A 2FJVA 2IYGA 3NAHA 3CCLS 5ETNA 4EWTA 1Q1KA 2KYZA 2Y8WA 1VLYA 2BJ1A 2OEJA 4EZ6A 2HHPA 4CLPA 5FLXY 2ZDOA 4YDXA 2ZJRQ 3CCVS 4K4XA 2R2UA 2Y3YA 1X4CA 4Z2XA 1RKJA 1RT4A 2HEKA 1FEEA 2KFZA 2QRRA 4CLZA 3KOAA 1ZPWX 4MAKA 4OI2A 4QZVB 2J9DE 2KG1A 2DNPA 2R7XA 1K47A 1RDRA 4I1TA 4LMZA 3I9V9 1NDPA 1HARA 1U8SA 1IBMF 2GJFA 2CPXA 1Q53A 4WXWA 2IJNA 3M6XA 4JI3F 5E33A 3KK2A 1SKRA 1N8RT 3KK3A 1R8HA 1VK3A 3V2UC 1AYEA 2UXDJ 4L74A 1C0UB 4CRJA 4X65F 2W9CA 1RT6B 3E8OA 2BW7A 2DTJA 2B8PA 4HH1A 3AXMA 1RTJA 2XSJA 3SEOA 2AJFE 4RW4A 2CNLB 4DL6A 2XCAA 5D6GA 1LW2B 3UPFA 3LF0A 1TL7B 3ITHB 4LFAJ 5KFRA 2XMUA 4DLEA 2AW0A 3MM6A 5KFWA 3LTOA 1MG7A 1LW0B 1IR0A 2DXFA 4ZKAA 3AD7C 1B7YB 2HLUA 5HATA 1CULB 1F2HA 1EETA 5JVHQ 1EIYB 5CYQA 3BM7A 4LFCF 2Y1LB 4JI2F 3TUPA 1HBOB 1EQMA 5A8KB 3JSBA 2KT3A 2KKHA 1SKSA 4LF6J 2DH7A 2VQFF 4J91A 2HQGA 3DLEA 3TUJC 1TQLA 3AJDA 4GRSA 2G2YA 3AJ2A 3NNCA 4DR7J 1SJFA 3H5XA 3IMQJ 2HZCA 4M5LA 8RUCA 3QAEA 1K0VA 5IOLA 2ATLA 1M5HA 1HNIA 1RU2A 1WEYA 4N76A 2IC3B 3AOBA 2DHSA 2YPZA 5HAOA 3LP1A 3H5YA 4GC6A 2ZKUA 2KN4A 1HW8A 1B0VA 2RRBA 1DTQB 3L7OA 4JI8F 1AROP 2EKNA 4DV0F 1TELA 1JB0C 4OZNA 3R1LA 1R8BA 2PA8D 3Q8UA 2V8HA 3AT1B 2FZGB 1Q5YA 1VOMA 3DLGB 4ZLPA 5A2QY 2ZZMA 3CB4A 2CG8A 2RQCA 3ENAA 3NGDA 3RZAA 2ZH6A 3FRZA 3TUZC 2HVDA 2O66A 3QT6A 2C2ZB 4IFVA 1WI6A 2V69A 3NGTA 1N36F 2IVMA 4NCBA 2RS2A 1WKJA 4KAIA 4M5KA 2I8EA 2A18A 3PDNA 4KHMA 3F41A 4CZCA 3WZ0A 2HWIA 1RYRA 3KLHA 1S1UB 5FJ4A 3UFCX 4DCJB 3KMQA 1T05B 4IO1A 1M5SA 3KXDA 5JXSA 2AWZA 3IN5A 3VQSA 3MCNA 3W5YA 3S8SA 2AJQA 2DNQA 3MMBB 4BS2A 2OELA 4P52A 4FF1A 5J1EB 1RT3A 3CGIA 1FKPB 1JLFB 3CCUS 3PM9A 5HVHA 1YJUA 3BSCA 4Y0FA 3NLCA 3M8PB 2C3YA 1AZSA 3MM5A 3NS7B 1KHWA 4A8MP 2ZVIA 2IY5B 2IMOA 3D5MA 1UCNA 5KG4A 2DD8S 1U6BA 2L3MA 3R27A 3PEHA 5K8PA 1AB8A 2EI5A 2VUGA 1T03B 1FDDA 4X4UA 2V2ZA 2LVWA 2RQ4A 1QVGR 3T9ZA 2OMOA 3B6BA 1RT1B 5H9FK 4ZPAA 1MN7A 4NWBA 2R7UA 4RW6B 3ZZPA 2RE1A 1K1SA 1L3UA 1VQPS 1OPZA 1D8ZA 4G1QB 3I6PA 2KB2A 3HLUA 4JI6J 1N6QA 4MMOA 1RLCL 3VR1A 3SZ2A 4HACA 1UPPA 2A1BA 2HRUA 3ZTRA 1AUDA 1KRPA 2RKIB 2ZBQA 1KHVA 1XC9A 5DQGA 2C2NA 1LFPA 2YQ0A 2KI2A 2ZNYA 4WTYA 2CQBA 2HFVA 2OPQA 2XB2D 2M88A 4IH7A 1U45A 3C8YA 4B3OB 4S0MA 4HLBA 3NY0A 5DDOC 3IC1A 2J7UA 4TQRA 3PIPQ 5KFYA 1RWVB 3IXQA 4IDKB 3CJQA 1IR1A 3C16B 4PRFA 4CO4A 1VRTB 2DGVA 2DGXA 3C6UA 1HNZJ 1N32J 2BE9B 3BSAA 4MKYA 1HLWA 4X4RA 2CNKB 2HAIA 2DIVA 1YI2S 4XPCA 3OBIA 2LEAA 5ITHA 3NNHA 2AD9A 4B3TF 5F9NA 4YQWA 3KJVA 1QVFR 4R0EA 1I1GA 4OZ0A 2AYEA 3SSRA 2VC1A 4CLWA 2E1CA 3E01A 1PKUA 4ZK7M 1RWNB 2E9RX 3SFUA 3GIKA 3P8BB 2CIMA 1BY9A 3MAAB 4AL7A 2EFPA 2LYVA 3M30B 4TY8B 3BR8A 2ZH2A 3HVWA 1BLUA 1D9AA 4DPUA 3Q89A 3GR1A 1YIJS 4DV7F 2FY8A 3F0NA 2MMYA 4KV8A 2XMAA 4FN5A 5J2QA 1SH3A 3D9BA 3JSMA 4DR6F 2Q66A 3DM2A 4M8LA 2ADBA 3H0PA 3BYPA 4ZJQA 1VQ7S 1OYEA 2BM0A 3PFOA 4MIWA 2NR0A 2OP5A 4KHRA 1R0AA 2QTWA 5RUBA 2KL8A 2XSFA 4F4YA 1PJ7A 2G0IA 2BJ8A 4GO7X 4C48A 2K7KA 4LBPA 4DV5F 1BQMA 1UEVA 5GADU 1OQ3A 1WTFA 1PGZA 4OX9F 3V4IA 1FKOA 1JLBA 3GJRB 1BQNB 4C3KA 4GO5X 4C3MA 3M2RB 1BMQB 1RWWB 4LF5F 2QMXA 4CLUA 3FSXA 1KTQA 2GJIA 1JMTA 3KJQB 3X1LB 3HO1A 2VG7B 3BGFA 2R2TA 4WP8A 2BKPA 1BXNA 4U67Q 4RO0A 4KQZA 1SXLA 4NLYA 3ULHA 1WSVA 4Z7YA 2J0SD 2NPFA 3NWRA 1O51A 2XZTB 1KSPA 1PO6A 1FX2A 2JX2A 3HM9A 3C6TA 1ZM3A 3HKZD 2BJ3A 4NLWA 5C24B 5KFBA 4JI0J 2QA4S 2ZM6J 2QE5A 1DARA 2V5HG 3GJTB 3UR3C 1IM4A 3ZZUA 2MPUA 1H2VZ 4YY3J 2CA9A 5GAGU 1HQUB 4ENOA 2Q6BA 1IXKA 2QA2A 4K4WA 1YX2A 5K9FA 3NCQA 2QGFB 2GIQA 2PD1A 2M5YA 1UW9A 3ZZOA 2IYIA 2I5JA 1KBRA 7FD1A 3MR6A 2E5IA 1K1QA 1SL0A 1F9FA 2YKNB 4QR2A 1EARA 4UQTA 5A8RB 5C25A 1RHJB 3GIJA 1NK5A 4NLGA 5GAHI 2EFOA 4BLGA 4R0JA 1VIXA 3SQGA 4C11B 3TRGA 5J2PA 2J6SA 2OH2A 2Y0SD 2PI5A 2ZH9A 3W3SA 3L9ZA 2OJ3A 4NLSA 2WOMB 2VG6A 1WSRA 2DR7A 3I5BA 3QO9B 1TUWA 1GXUA 2MKKA 4DX7A 3UO0A 1RGVA 2K1RA 1VYAA 2VJVA 3MUTP 2B4PA 4MIBA 2C28A 2VG5A 5ETOA 1NKEA 5KFAA 2YNIA 1WNEA 4AL5A 3K8WA 1TK5A 4ECUA 1K0TA 2UXCJ 2MHNA 1Y5NB 1RQ0A 1QLNA 2R8GA 2FDNA 5DG9A 1XN9A 2HZAA 3PJ9A 1HI8A 4F4AA 3FQLA 1SJRA 4P2XA 1FF2A 4DUZF 3K59A 1VC0A 3IR5B
chains in the Genus database with same CATH topology
4ECQA 3KK1B 3M05A 5E3AA 2X1FA 1UKUA 4J9RA 4NRTA 3DU5A 1Q86T 3H25A 4I4BA 1LWCA 5U47A 1VQ4S 4QJVA 4O3NA 2ASJA 2JJ4D 1R6YA 2YKAA 1WWHA 5F8LA 3ENWA 5IM0A 1KLNA 3M4XA 3DLHA 1C0TB 5KG0A 3GWCA 1KFDA 3GSDA 1KNZA 1XNQF 2MZTA 4J9MA 1VQ8S 2BVZA 4OLOA 1JK9B 2AF6A 1ZTWA 2KHCA 3C6TB 7FDRA 2BRLA 4WFBQ 2EBGA 5KFPA 5IS2A 1FEHA 3UQSA 4C4WA 1DTTA 3PKYA 1RTHA 3HF5A 5M2UA 1FT8A 4ED6A 1LK5A 4G6VB 2FJDB 3GQCA 4DSEA 5GAEI 2HW3A 4C0HA 1Q81T 4ZMMA 4FF3A 3J81Y 4TU8A 5AXLA 1QAYA 1UVLA 5FIIA 4MYUA 3CPWR 1S7HA 1I6JA 1LXNA 5HROA 2W7OA 4CH7A 4QIEA 5KG2A 3UCZP 2OKQA 2X51A 3V6DA 1W25A 1QAJA 2Q3PA 3AA9A 3M6UA 5HMYA 5J2MB 3H2LA 4LF4F 3AA8A 3D0IE 3QLHB 2OTJS 2W4DA 1S0NA 2GIRA 5L9NA 5I3UA 4NRUA 3LPYA 1WG1A 1VFJA 3A1YG 3OFGA 2GX8A 1N33F 4AFFA 3SSSA 3PX4A 4B08A 4IG0A 2J0QD 4C8YA 5G4DA 4I67A 4PPZA 3LUYA 1QAIA 2EK6A 2RQKA 3H8YA 1HWKA 1IJEB 2NPIA 1YG0A 4AE5A 3CDAA 2EK1A 4KO0B 4LFBF 3TVZA 4EYHB 3R5AA 4HI2A 3O5TB 4E98A 4A8WA 1UETA 4XDCA 2HYIB 5F8JA 3KHLA 5KG5A 2RIJA 2FHJD 2IBOA 2XMTA 3KTQA 5KFQA 2VODA 3OL6A 2V8GA 5BJRA 1H6KX 2WSCC 3RAMA 3TQ1A 3GYNA 1NHVA 4DL2A 3MUMP 2HHSA 3JYTB 1F5CA 1YBAA 3I96A 2FHOB 4C0OC 4MKAA 2RH3A 1WG4A 3EPIA 1CQNA 2HS0A 5C25B 5KFJA 2AJ0A 1SKWA 3RAXA 2MSSA 2SXLA 1G2EA 3F73A 3LP2A 1XR5A 2VFTA 2ZNZA 3ZZYA 1KFSA 3DOLA 3MMCB 1FDNA 2B3TB 4RZRA 3D2WA 3PKMA 1R43A 3LO3A 3OTCA 1A6LA 1HNVA 4NYOA 3FFIB 2DNGA 3SQGB 5DM6Q 1URRA 4RWXA 4OJHA 1M5KC 1HYSA 2BE2A 1RA7A 1UWBB 5CYMA 5AJ3F 1IN0A 1X4DA 2ZOFA 2G0CA 3PJWA 2VBWA 4NLTA 1FD2A 4DFPA 2M4MA 2E5JA 2Z8QA 1LKZA 3EXYA 5J2PB 4B9MA 2K7JA 1KQGB 3DCAA 3BGLA 1TL5A 5HMZA 5T41A 3OFFA 3EGNA 3PW0A 3KLFB 2WONA 3N79A 3DDKA 3K5MA 3BQ0A 5F8MA 2CDQA 4TQSA 1NJYA 1HWLA 2N3LA 2DRAA 2IRXA 2VG6B 5E7OB 3BSOA 4YMEA 4YB1P 2DHGA 2E1MC 1WHWA 5DLFA 3CJ3A 4ZVEA 2D3ZA 2UXCF 1ZYQA 2FTRA 1CVJA 4NXMF 1URNA 3HVAA 3OR1B 1S1TA 2IJFA 4P7VA 2K1RB 2HIQA 1U2FA 5CCMA 4K59A 4WFNQ 3ZFVA 2DVIA 1NK4A 1FRKA 2V8DA 2MQMA 2L9DA 2P6TA 3GB0A 2GHPA 2KG0A 2RRNA 3RAQA 2VH7A 2FC8A 2FVSA 2RQMA 2VG5B 1U4BA 4CCHA 1FTRA 3BZQA 4HI1A 2Q43A 4CO0A 4YR2A 4A8SA 2VC0A 2YNIB 1VC6A 2MZSA 5KFGA 4X2BA 1R31A 5A8WA 3FMWA 1V3RA 3N01A 4ECXA 3MEDA 4U7UK 4IYQA 2BJDA 2IHR1 2VD3A 3QPIA 2KT2A 2KFYA 1BD6A 4W90B 1Y00A 2NLWA 5AE2A 2E1AA 1HWUA 1JKHB 3DGPA 4N5SA 1U47A 5EHHA 3PACA 4ECWA 2HPUA 5THWA 1IJFB 4WFYA 2NREA 3DXSX 5F8GA 1JLGA 2YKOA 4RUAA 4DFKA 2YH0A 1H38A 4FBUA 5K5MA 2V9KA 3MM9A 2MZ1A 3TAQA 1K9MT 2LEPA 4ZVHA 2YKPA 2OMLA 3M32B 4V19X 3IS9A 4CNZA 4EGLA 1S6QA 3DOKB 2KDOA 2GQCA 2UUWA 5DLGA 1VK8A 2UV8A 2H9ZA 5D77A 4NCAA 2XWXA 4Y2KA 2GQ2A 3OVAA 1KVIA 1VQ5S 2MKCA 4DSKA 3TAMB 4RNOA 3LWMA 2W9AA 3HJFA 4X4NA 2HGMA 3FGVA 5JUMA 4LT6A 4YEAA 3UD4P 4ZOSA 2Z4PA 1B0TA 4DS4A 4DL4A 5FD1A 4DSIA 1KR4A 3LGMA 4PG7A 3DC2A 2FLPA 1TV6A 2X1BA 2DITA 3MOZA 1RT2A 2BBEA 2K2PA 3MCSA 2UU9F 3X3UA 2BZ2A 2IAJA 3K59A 2O01C 2XS7A 4OV1A 5KFXA 1O8BA 3QGHA 1LWCB 3EZ5A 3M8QA 4JV5F 1MMDA 2MY7A 2BDPA 1N5VA 2LXUA 4XDDA 2XHWA 5I4MA 4ES3A 5IT9Y 1U26A 5IM0B 2NS1B 4MKBA 3V5RA 3HPOA 3SV4A 2YKMA 5IXUA 3I87A 1HBMA 1DZ5A 2JWNA 5F3TA 2AGPA 2FPHX 4H4KA 1S9FA 1DTTB 3RBDA 1RTHB 3CCRS 4G1IA 1YGYA 3VAKA 2QO3A 4CTAA 2HVHA 2W4CA 3TX8A 4I6YA 1XMBA 1LQ9A 3CC2S 1CQMA 2MKJA 3O6QA 2DPJA 3L95X 4DR3F 2ASDA 3MD1A 2IBKA 3KFWX 4CO2A 3B4MA 4ILRA 2LU2A 3RW7A 1RT7A 3TOQA 2JLEA 5LXRA 5HROB 3ONQA 1N5SA 3KG1A 3V6DB 2P9GA 1G7CB 3ETOA 4H4OA 3NRBA 4X4SA 1VQOS 5C5JA 1CLFA 3LAKA 3HFKA 4TN2A 3WC2A 3MTKA 4RKUC 5I3UB 2L48A 4OJ3A 3NMRA 2DGWA 5E3QA 4O4GA 2YNHA 3PJXA 4B3SF 2DH9A 1S48A 2W7PA 4F8RA 2PT0A 1TZ0A 3MECA 2OO4A 4IG0B 5I3PA 4YHHF 1SB6A 1QY7A 4Y2IA 3CE8A 2FUG9 5B0AA 2HNDA 4KIAA 3AB2B 4ZS6A 3K57A 1NZAA 4CO1A 4F3QA 4DX8H 3VAMA 1T8EA 2FVRA 4DSLA 3M9NB 2HHUA 2DBBA 4Z37A 4Q0BA 4TLQA 2F40A 2YY3A 4KR0B 4MK9A 5DQHA 4DFJA 4ID5A 3T1YF 3DN9A 5KT6A 1HNWF 3ZZZA 3Q22A 5GAGI 3HXMA 3QZ7A 2VPYB 3LOUA 3H40A 5L39A 1KC8T 4PXEA 2OSQA 4D3GA 2BUNA 3FVYA 1XTZA 4Q45A 3DFEA 3IG1A 3CCTA 1H3DA 1ZZFA 2C2EA 3FEYB 4ZPCA 4OJ1A 4RW9A 1S72S 1JNRB 2DRBA 3D0GE 3GR0A 4IOAQ 4K4UA 2CQHA 2JC0A 5L8RC 3PEJA 5HQ8A 2GMJA 3DLBA 5A0YA 2CQPA 1GNKA 3LP2B 2J8AA 4IUFA 1E6VA 1FE4A 1FK9A 1KQKA 3BSNA 1VRUA 5HP1A 1FD8A 1YRUA 2Y1JA 3OLBA 1HNVB 4DOZA 2ZHAA 3ZZTA 2KJWA 1S9EA 2OPPA 1HYSB 4IQXA 2IM1A 2BE2B 5CYMB 3TAPA 4B9TA 1YITS 2YWHA 4FP9A 1MNEA 5LMNF 2FY1A 2M8HA 4K2XA 4DPOA 4O3QA 4F4KA 4NLPA 1LXJA 2HQIA 4DMZA 2QMWA 1S1XA 1AFIA 2WSEC 3DHXA 1KD1T 2WONB 1RP5A 2RU3A 4UY8T 2CPDA 1TAQA 3UWTA 1MSWD 3UDLA 1X4GA 1SIWB 2MSTA 2DNZA 4WFZA 1R8CA 1SJ4P 3D28A 4URSA 3Q2TC 3NAIA 2QA1A 2A10A 2M3DA 2B6AA 1F5BA 2Y1IA 4F4WA 4QWAA 1FRLA 1KOOA 1S6UA 4HT7A 1NK0A 1S1TB 2XGQA 1YJRA 3EUNA 4UUXA 1LWEA 4QWBA 5L1JA 3PZPA 3T9NA 4JBCA 5HLFA 2ZD1A 1X4AA 3IRXA 3I0SA 2JDJA 1UA1A 4IR9A 4W92B 1ELOA 5F41A 4ED2A 1IKYA 3JAMY