2QLBB

Crystal structure of caspase-7 with inhibitor ac-esmd-cho
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
92
structure length
92
Chain Sequence
KIPVEADFLFAYSTVPGYYSWRSPGRGSWFVQALCSILEEHGKDLEIMQILTRVNDRVARHFESQSDDPHFHEKKQIPCVVSMLTKELYFSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Plasticity of S2-S4 specificity pockets of executioner caspase-7 revealed by structural and kinetic analysis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Caspase-7
total genus 18
structure length 92
sequence length 92
chains with identical sequence D
ec nomenclature ec 3.4.22.60: Caspase-7.
pdb deposition date 2007-07-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 2qlbB00
4ZVQB 3D6MB 4ZVPB 1RWXB 2Y0BB 5IC6B 1RWKB 2HBZB 3D6FB 1IBCB 3R5JB 3R6LB 2DKOB 4ZVUB 1QTNB 1RWOB 2H48B 2QLJB 2H51B 3KJQB 1NMEB 1RWNB 2QL9B 1RHKB 2H54B 4LSZB 2XZTB 4ZVRB 3R7SB 2CNLB 2XZDB 1RWPB 2C2ZB 3GJQB 1BMQB 4ZVTB 5K20B 3P45B 1SC3B 3R6GB 1RHRB 2XYHB 1I51B 2H4WB 4DCPB 1PAUB 3SIPB 2QLBB 1SC4B 3GJTB 2CNNB 2P2CB 3EDRB 3EDQB 1ICEB 2C2OB 2QL5B 2XYGB 2HBYB 1RWWB 3R7BB 1QDUB 2C1EB 4JB8B 1RHQB 2H5IB 3R7NB 4ZVSB 2C2KB 2Y1LB 1RHUB 3P4UB 1RHJB 1PYOB 3GJRB 1RWVB 2HBRB 2CNOB 3D6HB 2H65B 2QL7B 2H4YB 1GFWB 2FQQB 2HBQB 3QNWB 1I3OB 3IBFB 2H5JB 4DCOB 1F9EB 1SC1B 1RE1B 2XYPB 1RWMB 2C2MB 5IC4B 3NS7B 2CNKB 3KJFB 3KJNB 2CJXB 3GJSB 2CDRB 3RJMB 2CJYB 3IBCB 1RHMB 4ZVOB 4DCJB 2QLFB
chains in the Genus database with same CATH superfamily
2FJXA 4DHVA 2RD5C 3C66A 4L3NA 3WHIA 2FLNA 2HHVA 3DFEA 1QE1B 4M5JA 4QIWD 1TU0B 2DNKA 2HKEA 2VFTA 2Y0BB 5C25B 1KQKA 1BQMA 1R89A 4ZA1A 3AD8C 1NJZA 1RT4B 2CPEA 3I87A 2DT9A 5B0FA 3T41A 4DSFA 3NMAA 5GADI 1JXLA 2IAJA 4H4MB 1APSA 3EICA 2BE7D 3G82A 3Q2SC 4MH8A 2M7SA 2OMOA 4UQTA 5J2PB 2VIHA 1T03A 2QG9B 3G6ES 3I6PA 3ZZYA 5KFKA 3KLHB 2DHGA 2FGCA 5C25A 3T1AA 2DR6A 1KQFB 4X4RA 1FRXA 1PJ5A 5DJBA 1YHQS 4X4UA 3Q86A 4ELUA 3FCWA 5LT5A 4JI6F 1TL7B 2C28A 4UQGA 5T7LA 1RT1A 3TX0A 3NXZA 3DYAB 2E5HA 2MHNA 2EFOA 1NB2A 1C2PA 3B54A 3D3CJ 1OQ3A 2RKIA 4KO0A 4RW6A 1JMTA 4M5KA 5AXMA 3ZTPA 3KLFB 3F0NA 4DUZF 3H2UB 3CTRA 4WU2A 3GLJA 1REGX 1Y11A 3HK2A 2CJ9A 4ED1A 1G3OA 4IH5A 3FBCA 4U8VA 3MMCA 2AYEA 1EX8A 3KG0A 2AGQA 2QEXS 2FLPA 1P8GA 2J8AA 3U1MA 1HQUB 2GAHC 5LSRA 2D3O1 1M90T 1YITS 4LF6F 1HYSB 2JDJA 1G2EA 4IRCA 1XEZA 2CJAA 4X2BA 1PGZA 4DSLA 1ICEB 2E5LJ 5KG5A 2W9CA 4CP5A 5EWFA 4IFVA 5THWA 3JYTB 4O44B 4RR5A 2RAQA 5HO4A 4PCQA 3V5RA 1U47A 1HWUA 3OL9A 4J9MA 3QWUA 1X4EA 4E2FB 1U1MA 2ZNYA 3H5SA 1N5SA 1FKPB 4WZMA 1N32J 1FVQA 2LLZA 2VB6A 1YJTA 3TA1A 3PM9A 5AJ3F 2NPFA 3GIJA 3W5YA 3T5HA 2DXDA 4M94A 4I1TA 2DK2A 4YHHF 1S9GA 5HN0A 3MUMP 1S57A 3LUYA 2O3DA 2UV8G 3MCNA 3ZC4A 3MMJA 1XJWB 4XPEA 2XNQA 3GZ7A 5E3AA 1HBUA 5FIIA 4EO8A 3UN2A 2JC1A 5GMKa 3FQLA 4DV5F 2UUCJ 4KT0C 1WC0A 2EFGA 1LFWA 2MKCA 4N8NA 5L39A 4NI2A 4DF4A 2OFGX 3M6UA 1VBZA 5DZ7A 1KKHA 2M0GB 1FWLA 2OTJS 2HS4A 2GQQA 5FLXU 3UNYA 3NAIA 4FVCA 1IN0A 3KK3A 5L1IA 5HAOA 1CC7A 2K06A 3UFCX 1NRKA 5F9LA 1XNRF 1WG4A 3GIMA 3FBFA 4EMDA 3E01A 3MR5A 2HQIA 3CJKA 1UWBA 3H98A 1FNOA 3HKZD 3GV7B 3HKWA 3GG0A 3DGPB 3BPDA 4MIWA 2UUTA 4WP9A 5HATA 2R3VA 5ADZA 4PQAA 4DR6J 1S1XB 2CJXB 4CWBA 1IKVA 2CQ4A 2CQ1A 2HIQA 3FFIA 1U6ZA 2YX4A 1UVKA 1UEVA 1VRTA 3KKFA 4RWWA 2MZ1A 5KFZA 2PE8A 2CYYA 2UXBJ 5GADU 3KUEA 3HHEA 4LRDA 5KG2A 3Q8QB 1CJKA 3U02A 4DG1A 2BEFA 4U9RA 2EEYA 1LK5A 4ECXA 2HZVA 4DX7A 2GX8A 2ACYA 1FA0A 2VBZA 1H2VZ 1RADB 2QZ8A 1ZTWA 3QMQA 3JQKA 2HFVA 2QIFA 1H72C 3BGFA 4PG7A 4PXCA 1ZZFA 2QA4S 2QJ3A 4LRBA 1TQLA 1VLYA 4KHRA 4B3MJ 3MOJB 1T0TV 2PA3A 1J5EJ 4TY8B 1RDRA 2DJWA 4TVAB 4ZHRB 1D3WA 1LWFB 2COLA 5A8WA 5CZVA 2RVJA 1FRMA 1VC6A 1NPKA 2ZZMA 2B9WA 3NG8A 4MFBA 5F8HA 1VIOA 2IHR1 2Y1IA 3RB3A 1VQ5S 2ZC3A 2ZKTA 3F44A 3KUHA 2ALYB 3L7PA 5GAEU 2V0NA 4DUYJ 1XBWA 3DDNA 2VQFF 2F4FA 3BR8A 5AXKA 2Y1JA 1KQSR 3HHLA 4OYPA 1S48A 1SCJB 2DGVA 3TYTA 5A8RA 1QSLA 2KXFA 4C8KA 4OHYA 3OXGA 3FGVA 3OTBA 1NO8A 1Y0HA 4X4NA 1H0HB 2CNLB 5AE1A 2V4JA 3R5GA 4GMKA 3QSYB 2ADCA 1H74A 2OSQA 1URNA 1BMQB 2C2ZB 4X62J 4ZVTB 4EZ6A 1BQMB 2OKQA 5JUMA 2NREA 2A6OA 1IKWB 1TP7A 2RUGA 2LECA 1HI1A 2H4WB 2CIMA 5E0OA 3CCUS 1YK9A 4CO3A 4CTAB 2QFJA 3S6EA 1VQLS 1C1BA 1UFWA 2I9SA 3W60A 3WZ0A 5B0BA 3AOBA 4E0DA 4CT8A 3WX8A 4DQIA 2XTJP 4WFBQ 2VICA 4KQZA 2DRAA 4CH0S 2FLOA 2FIUA 3BQ2A 1IBMF 4DV1F 2FJAB 2JLEA 1TL5A 1TZ0A 2Q79A 3AT1B 2DGXA 3PYDA 3WIUA 1Q81T 1Y10A 1HKAA 4HH1A 4DV4F 1WKLA 3I0RA 5G0RB 2LVWA 2EW9A 3R1LA 1FK9A 1PG5B 2HS0A 2I5JA 4GVBB 3QLHB 5LJ5Y 5C7PA 4WFNQ 2XCPA 3PX6A 2RQ4A 2DB1A 1OPIA 4OI0A 1V6HA 3QATA 5I3UA 2NXEA 4RW8B 4X66J 2WSCC 1VYAA 1W25A 5B0GA 1NDPA 1J5OB 3RRGA 2DGOA 1BXNA 1EHWA 3Q89A 1WC5A 3H2VE 3BQ1A 3DC2A 1YVFA 3G6YA 1VQSA 2OPRB 4LR7A 1CJUA 1TKXA 2NXNA 2JL9A 3I31A 4NLWA 4OYIA 2BA9A 2EKYA 3OTEA 5B0EA 2ZWPA 4CQ1A 3KHGA 3LQVA 1TV6A 4HLBA 3KLIB 2BJEA 3A3NB 1I3OB 2V4QA 3S01A 3Q8YA 1NZ8A 5KFUA 1OYEA 4LRCA 5DDRC 1YIJS 1VQ9S 4C8YA 1HD1A 4LF8J 2EG1A 1VRQC 5KG3A 1UTAA 5D4NA 3A3OB 1JIHA 5D0GA 3ET6B 1N54B 1EETB 1Q79A 3M6VA 2BJ8A 4QW9A 4BLGA 3V4IB 4EZ9A 4ERDA 1HHTP 3AXKA 2Q43A 3G8SA 3VAHA 3EX7B 2DPJA 5ETQA 4C11A 3PHEA 4ES1A 1N36F 2HRYA 5I3PA 1ZBTA 3ILLA 5HK4A 1HBNB 4KKOB 3KWMA 2ZDPA 1WORA 3HF5A 3GFHA 4AQYF 3KJFB 3I9ZA 5IQ6A 2YVSA 4J9LA 2BANA 5CZXA 5ETMA 2VU5A 4GVLA 3RZAA 1IUJA 2LQ5A 2QMUB 4Q7AA 5IFMA 1ITPA 2VG7B 1FKAF 2JEFA 2CA9A 3KLGB 1KHVA 4Q2LA 1HBMB 5DO2A 1XMBA 1P9QC 2D3ZA 1FK9B 1U25A 5D4PA 1TVRA 3AD9C 3DI6A 3GYXB 5K5MA 4OZLA 5ETNA 4OJHA 1IXKA 4NLDA 2R4FA 3PCOB 5KFWA 4DR1F 1D1UA 4KO0B 1P6TA 3M30A 4KV8A 1M1KT 3NKYA 2BE9B 4LF4J 4NLRA 1BQXA 1TVRB 2X3GA 2I6WA 5KFBA 2AYMA 1SC6A 2IFXA 5F41A 3PKYA 4P2MA 1RWOB 3Q8SB 2ZH1A 2QLJB 1HBOB 2R7SA 3O44A 3FKBA 5IV4A 3QFHA 1L3KA 4GO5X 1YQHA 2YWWA 3PEHA 4DV7F 4QBUA 2E9TA 2R8HA 4V19X 4UUWA 1BLUA 1YSJA 2I5JB 2VH7A 3AY0A 2ADBA 2HYIB 4ZIWA 1FKOA 1VOMA 1KR4A 2YKAA 3FSYA 4M5DA 3JTPA 1GAOA 4CM2A 2UXCJ 5F8IA 4ZKAA 4W90B 1GX5A 1LW2A 3KYLA 3GJQB 2UUAJ 1X4DA 2WSEC 4WWSA 1NAQA 4HL9A 4FVMA 5DGBA 5IM0B 1Q5YA 1U2CA 4F4ZA 3T5JA 3KLGA 1NDKA 3DMJB 3MHYA 2A0FB 2HQDA 3WIVA 3CIZA 3H25A 3CCMS 1UW9A 3KOAA 3DLJA 4FKYA 4HACA 2L9WA 2IA0A 3TJ9A 4ZN3A 3BGOP 2V8VA 4TYAA 1JB0C 3IO1A 4ZCLA 1UP1A 5FDLB 5KG6A 4ETXA 4JI8F 4EEYA 3BEGB 2HVDA 2PIIA 2ZD1A 3D0IE 5IS2A 4EWTA 2CG8A 2IYIA 4KBIA 2HPUA 5B08A 3JSMB 4P71A 2XY5A 1AUDA 1T8EA 5K14B 1VRUA 2A10A 1CEZA 5CYMA 2AJ4A 1SL0A 3OJUA 3MURP 2UVUA 3TWZA 3THPA 2XC9A 4DS4A 3RAQA 2AZ3A 3FDSA 3GR1A 3THTA 2V8PA 3D0HE 4OQJA 1M5PC 3MCMA 2BRKA 2ZWOA 3CCTA 3CJTA 3GB0A 3J7AN 3DRSB 2PEHA 3I32A 2XMKA 4USJC 1RHUB 1T02A 2U1AA 5K14A 4J9NA 1PYOB 3Q83A 5IZHA 4PEOA 3J7YU 1YRUA 2DHSA 3KG4A 4PKDB 3T1HF 1JNRB 1NPPA 2H65B 2FDNA 3FJ2A 2BZ2A 3N6MA 2E44A 3GR0A 2UXCF 4M5GA 5MLCV 5E3CA 1XNQF 5D4LA 1ZS6A 3TQEA 4CLSA 3O1LA 4DX6A 4GKJF 5ETTA 2E5GA 3BYPA 2B9EA 2JFDA 2FVPA 4AYBD 3K5MA 1OQ6A 4QZVB 1N5YB 1IM4A 4Y34A 1WEXA 4RUHA 5BR8F 2LEBA 5A76A 2L41A 4AXIA 2ZOMA 4DSEA 2PI5A 1S59A 4GVBA 4DV4J 1R8HA 2FJDB 1FE4A 2C3PA 1CC8A 1GMUA 2W7AA 2XMWA 2Z30B 3B8HA 2HAIA 2FGOA 4YB6A 2WAQD 5FD1A 5C42A 2CXEA 1QTMA 3CMQA 5C2CA 3M30B 4OYBA 3C14A 1RAFB 4NLQA 5E3PA 4WPAA 4ECRA 1S12A 1U2FA 3W61A 7AT1B 4DF8A 3PHTA 2FYXA 4DDFA 2HRUA 3Q8PB 4A8SA 2ZE2A 1EJ7L 1PJ7A 3I4PA 3TEGA 4DU7A 3GFYA 4RNHA 4AL5A 4FYVB 3KHLA 4QWBA 4JI4F 1OMSA 1NCLA 4XIUA 1Y3JA 2E1MC 4F4WA 1XMQF 5A2QY 2YWKA 2V8GA 3GWCA 1PO6A 1RISA 4OX7A 4JYAF 2MZQA 1OIAA 4ECUA 3VWSA 2E1PA 2IMOA 5HMWA 3ETMA 1MU2A 3PDNA 3U7JA 1DTTB 2E9ZA 3CJSA 2HFUA 1R0CB 2HRTA 1WC4A 3SQGA 1RCXB 4JV2A 3IXQA 3HVTB 1GMWA 4A48A 4WK3A 4LF9J 2DEJA 4USVA 3LWLA 2D3UA 2K1RA 3C19A 3DCAA 4NCBA 1UZDA 4CDIA 1TKZB 4TYBA 2HBZB 4LSLA 4DQPA 1K0TA 5KOXA 3R5JB 2PMHA 4WFYA 5LM7E 4ER8A 2Z56B 4WU3A 4R8UA 1N36J 1FRIA 2J6TA 2PI4A 2WB1D 4K2JA 2NZCA 4Q5VA 2WOMA 1KBRA 4C8NA 5CYMB 4NRUA 3CB4A 3VHQA 4Q45A 4DR1J 3BJYA 2E5LF 2GVDA 2WHOA 1OJ4A 2O5DA 3B78A 2V4RA 4RL1A 4XDDA 1S99A 4DZDA 3TAPA 3OXFA 2J7WA 2VHGA 4B3SJ 1MMNA 4DMZA 2YPZA 2KFNA 4O3NA 1NZAA 2RQMA 3ILJA 3UDCA 3W64A 1S9EA 1K1QA 1RWPB 3MECA 4YN3B 1RYSA 1NK0A 3MGJA 3DDIA 4QR0A 1WEZA 6AT1B 4OHXA 5HVHA 4JUZA 2DO0A 1E6VA 4DCPB 2EFPA 2H5EA 2RDIA 4QR1A 3D1QA 5F3ZA 2HNDB 1X31C 2B4PA 2ZC4A 2L3MA 2POKA 1U7LA 4OHWA 2YWFA 1RT3A 2AWZA 3DXSX 3I5BA 1HARA 1TUWA 3IM9A 2UU9J 4LF9F 2DEIA 4TY8A 2CQBA 4DL2A 1NJYA 3I55S 4IDKB 4Z2XA 4DV1J 2L48A 3S7RA 2KJWA 4DR5J 2D74B 2P8IA 2UUBF 4MAKA 4QIFA 1T9XA 4DSKA 2OH2A 2V69A 2RT3A 3J81Y 1FNMA 4OJGA 1CJKB 1Y3KA 1T9UA 2M4MA 4DG1B 1HNIB 2LYVA 2UUAF 1RBLA 1RBOB 2J8SA 2DRBA 3MM8A 1DZ5A 2JNJA 1JXEA 2NSCA 1S7HA 3GJRB 1JJCB 5HMZA 4N56A 2JX2A 2DNLA 4M5HA 2JJ4D 4U7CA 3TZYA 4N77A 1WF1A 4QPTA 3H5UA 2FHJD 3K8VA 3CJ2A 4AE5A 3H5YA 2C2EA 3W7BA 3ZZZA 2LCWA 2CQDA 2QN6B 2F65A 1UKUA 4ZP8A 4EUVA 2KKHA 4Z7YA 5F8LA 5EX3A 3CC4S 2RMLA 4LFBF 2GO9A 2AJ2A 1Y7PA 3HSGA 1RKJA 2MKYA 1XTZA 2E7XA 3BM7A 4NLVA 3L09A 2DH7A 3IBFB 4JI1J 4PYAA 1RYRA 2ASDA 1S1UB 1H73A 1SBRA 2LEPA 2E66A 5E3QA 1VQ4S 4KTQA 1NK8A 4NLXA 3AHPA 3EGVA 3SMZA 1N0UA 3HFKA 3UE2A 2KZZA 5A0YA 1UMJA 2NCKL 3LGNA 3KXDA 3MAAB 2LQ8A 1ZOTA 4KPCA 5J2NA 3HMJG 2B6AA 1KFSA 2UUBJ 1N5VA 3IFEA 2B56A 4N7TA 3TJ8A 1RTDA 2QFIA 3ISND 1YRTA 2B8QA 4LQ9A 2VUGA 4FZVA 1VBKA 4EBCA 3PIOQ 2RNEA 2VKRA 4R0EA 3CD6S 4USTA 3CMAS 5IT9Y 1HPZA 4GRSA 4IR9A 3BBFA 3R2DJ 1RA7A 3ZTOA 3KLFA 3H40A 3DLLQ 3OUYB 3SQOP 2VPYB 1F9FA 2AHOB 3R5DA 2AGPA 2GFFA 1BC6A 2E5JA 1VQPS 2QE5A 2B4OA 2APOA 2GGPA 3HVWA 2PSZA 2Z2MA 3QYYA 2JVOA 3CD0A 4X64F 2GHWA 2XWYA 5AXNA 5HLFB 4NRTA 3ZZ0A 4DPWA 1WNEA 1VFJA 4ED8A 3AA8A 2CKWA 3KLIA 2F63A 4J91A 3WC0A 3UQSA 1FJCA 1NDCA 4L3KA 4ZMMA 2FJWA 4LR9A 2ZHBA 2HHWA 4DU8A 1EKRA 2LA4A 1HQUA 3QLHA 4RNOA 3K5LA 3LTOA 2JRSA 3MOZA 4ZVUB 4OI6A 1R8BA 3HHKA 2L9NA 3O6QA 5IWAF 4LREA 3KHHA 3DRRA 3HX9A 3JQMA 4IFVB 4DV7J 1VQ7S 2CPDA 2ZBQA 7FD1A 1DQ9A 1N8RT 4DOZA 2NUUG 4I7FB 3SYZA 2PD1A 2C3YA 3AA9A 4PZVA 1FJGF 3A8EA 3CJ4A 1SKWA 4L73A 3R7SB 4BHQA 1X4FA 2ATLA 2KVQE 1U1QA 3QO9A 2W9AA 2R9LA 1S0NA 3PR4A 2B4VA 2AYBA 2N7YA 2HAFA 1GXLA 3M2UB 3DLHA 1HNXJ 4RUCA 3MEDA 1S0VA 2XO7A 4CIOA 3P5BP 3FBBA 4USMA 3UCGA 4F25A 2UVVA 4RZRA 1SV5B 2OMLA 1PAUB 4O3PA 3CULA 4CLWA 3DI6B 3BSCA 4HHHA 2QYGA 2V4JB 2VODA 1M1HA 3R5CA 4J9VA 4C0HA 5ETSA 4IO9Q 1P1LA 4BDPA 2W8KA 3ZTQA 1WSRA 5HP1B 1J2VA 2EBEA 3V6JA 1LV5A 1T7PA 4IG3B 4NXMJ 4O4RA 4QIVA 2JLFA 2U2FA 1BQNA 3EWGA 2W24A 1PYTA 3MR7A 4DL0C 4HKQA 3HPOA 3CF5Q 2XNRA 2EFVA 4ILMA 1M5SA 1Q78A 4KH0B 4J9SA 2VPZB 2XGPA 4ED5A 1KVIA 2IJFA 3RAMA 1RT4A 4NLPA 4K0KF 1E6VB 3T3FA 4OJ3A 1ZM4A 1Z2LA 1BQNB 2F5GA 2M70A 2MB0B 2V5HG 3BKTA 3GIIA 1NKEA 3VGUA 1IWGA 3JXOA 1SUQA 4BBYA 4NCGA 1UJ5A 2YTCA 1BGXT 2Z4PA 3GCXP 4LFCF 1RI7A 1FERA 1KLMA 2QL7B 2H4YB 1XMOJ 3EE3A 2I38A 3DLEA 3UCZP 3OUYA 3MM7B 1CG2A 3DKDA 4M8LA 2WVFA 2FLLA 1KVJA 4NLUA 1J5EF 2RKIB 1TMJA 3D5MA 3D66A 2HVEA 2GHPA 3NCQA 4EGLA 4JI7F 4NMLA 3EZ5A 2CAJA 2D3OR 1UL3A 4FN5A 2YKNB 3VAMA 1SJ3P 1MU2B 4K50A 1LWCA 2BX6A 2O1PA 5KFDA 2GIFA 2WBRA 2H5JB 5EGYA 3TR5A 4WE1B 5JVGQ 1SPBP 5JJBA 4CLTA 3DHWC 5BYRA 2XM3A 2DR9A 4IRDA 2NR0A 3QQCD 1D9FA 3OTCA 1FT8A 2CPYA 1ZTTA 3PW5A 1D8ZA 2EFNA 3H7HB 4LR8A 1S1VB 1RTIB 3H59A 2C2MB 3M32B 4KR0B 1L3UA 3NS7B 1VQ6S 3CCVS 1SKRA 3KJNB 3QGGA 3G8TA 5C2GA 4NI2B 2W1BA 4K4ZA 3WDOA 1K73T 2JWNA 4OZNA 3EMTA 4X4OA 3AB4B 3LP1B 3ZO7A 2YQ3A 3LANA 3J7YI 4C9DA 1CSJA 5FLXY 4RBTA 2JEJA 1NM2A 4WTYA 1W26A 3KK3B 1B0TA 1SJ1A 2DNHA 3HFZB 2IBKA 1N4LA 5SUHA 2BQUA 4B3TF 3HT0A 4YUDA 4M63A 2W2MP 1IBLF 3NEKA 2OI2A 3PRDA 2GJFA 2CQ2A 2HGMA 3VVUA 5KFNA 3DRYA 1IBMJ 2Q66A 4B02A 2CQIA 4DV6F 2CJBA 4F2SA 1FESA 2VG6B 1URRA 3DOLA 1HA1A 1WHWA 2KVIA 4MJKA 5E33A 4BC7A 2ZH9A 2YY3A 2W2OP 3O2IA 2F1FA 2DRDA 4IH6A 1NJXA 4FF2A 5T14A 4OZ3A 2DNPA 1JLFA 2V6AA 4KAIA 1HMVA 4OX6A 4I2PB 2HLTA 1Y5IB 4OZ5A 3IN5A 2ZM6J 4FF4A 4IDKA 2VQFJ 1DBDA 3BR9A 4DLGA 4DL5A 4JBCA 3IAM9 4ZPDA 2XZTB 1FEEA 3MM9B 2QA1A 4Q2MA 5F8JA 2RHQB 1FD8A 1HWKA 1I94F 2I2YA 4USIA 2GGPB 4Q8EA 1C4AA 5F0UA 1TUGB 2KB2A 3ZXWA 1VQ8S 1NPRA 2HEKA 5JXSA 1RSCA 3MUTP 1N32F 3DM2A 4DPYA 1RT7B 3IGVA 4OYAA 4EYIB 1SI9A 3FK4A 3LALA 1ELOA 1T9VA 1TL1B 5AJ3J 2ZJQQ 3NGRA 3QAUA 2MKSA 1VC0A 2HK3A 3QAEA 2WONA 5CCMA 1ZAVA 3L3CA 3UDEA 3OW2R 5LSLA 1C1CA 1FVSA 2DNMA 2QLBB 3A1YG 3JSYA 1SKUB 4OX9J 2IM1A 3A8IA 3TRGA 1FJEB 2BKNA 3SDEA 1OYDA 1DHMA 4C0OC 4NLTA 1TKZA 2XGQA 3LP1A 4B3MF 4JI1F 1D09B 4WZQA 1FTCA 3QT8A 2KT3A 4MIAA 3AJ1A 4OYZA 2QL5B 2QA4G 1NHVA 3DNCA 2GA7A 4F0KA 4DR5F 3IR5B 4IQMA 2IVMA 4DXLA 4DZ6A 4X4VA 5LMNJ 2BW7A 2KRBA 1F5BA 1YGYA 3HD1A 4B9LA 3GU0A 2UV8A 5FDLA 4USKA 1ZPWX 4X65J 3CCRS 1VQNS 3CD7A 4N47A 5J1PA 1DQ8A 2OPPA 3SCKE 2AQ4A 4LBPA 3CMES 5A0YB 3M2VA 2BABA 2HLUA 3NOGA 2V2QA 4IOAQ 2BJ7A 2QMWA 5GVQA 2OEJA 2O66A 1S9EB 4PR6A 4D3HA 4C98A 1J27A 2CADA 3NGDA 1DFDA 3I5AA 1JLCA 1AW0A 4Y2MA 5KFSA 1XIQA 1U45A 3C46A 3PFOA 3TUZC 1RTZA 3NY0A 3GILA 3HO1A 4USHA 4PG8A 1HPZB 2FY8A 3OFGA 2LP4A 2MQNA 4PPZA 3R9LA 3BSNA 3LF0A 2ZH5A 3V81A 5KTQA 2WOMB 1MNEA 5F8MA 1WSVA 2CQHA 4J5OA 5KFHA 3DOKB 4ITSA 4LIRA 2HVIA 5HL7Q 1OO0B 3PRVA 6FDRA 2KXNB 1MMLA 1TL7A 4NCAA 2WVDA 1KS2A 2Y1RI 1NSPA 3DLGA 3VZHA 1X0PA 2XULA 3BBCA 1UJ4A 3DHXA 5H9EJ 1N34F 4I68A 3W3SA 3FZ2A 2LA6A 2J9EA 4DCOB 4PABA 4K4VA 3DLKA 3M8RA 2ZOFA 1RKIA 4K4SA 3C16B 2EC2A 2YKQA 2DPIA 3P49B 3MTKA 2P6SA 3HFVA 3OL8A 2V9WA 4WIIA 2OPRA 3QSIA 4FPRA 4P73A 3UD4P 2HNDA 3LO3A 4OV6A 2EVZA 3EPGA 5D3GB 4CLLA 1NK9A 4ANDA 3PG9A 3K7RA 3MR3A 2MKJA 5AE2A 1RB0A 2EWHA 5B0CA 3CPWR 2AP6A 1Y00A 2VBYA 4LIWA 2HURA 4B9UA 2CJYB 3OTDA 4ZJOA 1PSDA 2K3IA 4EO6A 3WBZA 1LW2B 1L3VA 4PQUA 3C8YA 2RS8A 1U8WA 2QYCA 3N9UC 3ELHA 3VR1A 1QVFR 4C4WA 3I56S 1ZZNA 2DGWA 1REVA 3TUJC 4UT4A 2N82B 2RRBA 3FRYA 3UVJB 2YNIB 3TI0A 1XMQJ 2DHAA 2ZJRQ 3IGNA 4G1PA 2HW3A 1X4AA 5KFGA 4ES3A 3BKUA 4ZCIA 3MEDB 5L38A 4WXWA 2WSFC 1KQGB 3CJ0A 2DR8A 3SDEB 2CQPA 1UPMB 2DKOB 1Q7YT 3PFEA 3QT6A 1TK8A 4KHPJ 2DR5A 2R2RA 3CDWA 3RW7A 1X9WA 2R8JA 1U26A 3IWLA 4KH1B 4WYWA 1WC6A 4IO1A 4CH7A 4Y2IA 8RUCA 2HHTA 1YDLA 1FD2A 4K4TA 1F2HA 2LQ9A 3PO4A 2KYXA 3HVRA 1FJGJ 1KN6A 2K8GA 1FHTA 5IOLA 2HZCA 3BPSP 5CD4H 4JI6J 1IBKF 5D8HB 3QZ8A 4FXDA 1AB8A 2IAJB 4GC7A 1S76D 2XZDB 1C0UB 4A8YA 3NCRA 2ILZA 3D67A 1B99A 1VQMS 2OO4A 1YLXA 3QJJA 3MFIA 2YWGA 2IM3A 1SC3B 3FVYA 2VL1A 4HT5A 1U1LA 3J81j 1Q8LA 2J0QD 1SXLA 1I51B 2HFZA 4ZP7A 3D2WA 2E29A 3H4DA 1FDNA 2DGQA 1FXRA 4C97A 5DDQC 5D6GA 3NWGA 4PUOB 1FWPA 1R6VA 3SIPB 4EU0A 1RU1A 5DQIA 2GW8A 5KFYA 2FJVA 3C6TA 1RAGB 3IRXA 3E51A 4UUXA 2GC8A 1XC9A 3G4SS 1EIYB 2Z58B 1GH8A 3MM7A 2MDAA 1Q82T 3UNGC 4S0MA 5C42B 3IBWA 4ZLLA 4IOCQ 4OFZA 3LGMA 2MXYA 4B9TA 4LRAA 4H4KA 1O0PA 2DNZA 2GS8A 1IJEB 1OY6A 4JOUA 2VBXA 2OFHX 3TANA 1SL1A 3D54A 1W2BR 4F7VA 2XB2D 2MQOA 3SCIE 1B3TA 4K0KJ 4RW9B 1RHJB 4R0JA 1T9YA 2DGUA 1EP4A 2NSBA 1VLOA 2YKMA 2ZD1B 3TZWA 2OAUA 1RTIA 3GYGA 3N6NA 5DM6Q 4K59A 3RB4A 3VAIA 3M6XA 3GONA 3O3LA 2ZH8A 4ICLA 1GFWB 2MZTA 2Z0GA 4PAAA 4RW9A 3QNWB 5EDWA 3A8KA 2MKIA 4OLPA 1E6YB 3N28A 4NL5A 2VDHA 2PFFB 1RCOB 3I9V9 3MF5A 1NSKL 1F5AA 2XQCA 2HHQA 1NXIA 3EYZA 1D9DA 2IMWP 4GC6A 1IQZA 3BH6B 2B0GA 2I1RA 3N0VA 2B7BB 1SQFA 4NYZA 3BN7A 4GKKJ 4ECYA 2MZRA 4I67A 1VS3A 1F60B 4YY3F 1FRKA 1BWVA 1WF0A 4B17A 1RU2A 2G0JA 1IKXA 4ECQA 2XS7A 1YZ6A 1Q8IA 4R5PB 1TL3A 3V6DB 2DD8S 3OFFA 3NP5A 1T3OA 3HJFA 1S9GB 5LMUF 4CTAA 3OVSA 3CCLS 2PT0A 2CDRB 2OHDA 1N5YA 1UVLA 1UVMA 1WOSA 3SXLA 2E7WA 2PA8D 1XK8A 3ITHA 1PKUA 4YR2A 3T1HJ 2ERRA 2GO8A 5I3QA 3T1YF 2HFOA 3S8SA 5A6WA 3ZFVA 2J76E 3ENVA 4BWMA 4DCJB 2M8DB 2EG2A 3AD7C 4FYWB 5E7OB 4PG5A 1W2IA 1U02A 4KSEB 4QOTA 4XDCA 3BV8A 2NYIA 3W65A 5I3UB 1BD6A 3D6FB 4DQSA 4MKAA 5ETKA 2R2UA 3G6VA 2BW2A 2MSTA 1HQ2A 5BJRA 2G1DA 4B9SA 4ZJQA 3OFHA 5GAEI 1Q95G 3W5XA 2HQ3A 3J81U 4XTTA 4YMEA 5LOQA 1UA0A 4G3IA 2QL9B 3BGUA 1U1PA 2J9DA 3JSBA 4K5SA 5M2RA 5GAGU 3FFIB 3PV8A 2R7UA 2HFNA 1CJUB 1TKXB 3A13A 1OS5A 1REVB 4LSZB 4YDDB 4HYKA 1N48A 2JEIA 2QGFB 4CLFA 1Q86T 1MLAA 5K20B 3LOUA 4L6V3 3Q2TC 3VVTA 4QR2A 2HFSA 5CQGA 3P45B 2UXBF 1CBKA 2R42A 1RHRB 1TKDA 3EXCX 2W25A 3D9BA 1X4CA 3L7OA 1IBKJ 2HSEB 1F3FA 3ONQA 1N6QA 3QRQA 1WD6A 2EXUA 5HI7A 2RJZA 3MMAB 5AT1B 4KJIA 4KGZB 4H4MA 1SC4B 3GE9A 4ED2A 1LKZA 3AJDA 4KHPF 2H3EB 3EDRB 2R7QA 4TN2A 4MKBA 4QYRA 5HSPA 1YJUA 4ATNA 1WACA 3C2PA 1T9TA 1QAYA 2BE2B 4UY85 1UVIA 1H7WA 2HBYB 1RT6A 2VG5A 2W2QP 4WJBA 3R97A 1JXVA 1X9SA 3GP9A 1S6UA 1CVJA 3GYNA 5DETA 1QDUB 1WDDA 1NB7A 4IH7A 4JB8B 3TZXA 1T05B 3R2CJ 2GMJA 4DPXA 1WC3A 2YBVA 3EXYA 3K5OA 2VA2A 2OSRA 3K57A 3ZTSA 3IMQJ 4AL7A 4DFMA 2KJVA 3PW2A 2DCLA 1UFLA 3H42A 2VASA 3C14B 2KN4A 2LQBA 4TQRA 3IS9A 1RAOA 2V9KA 2WK4A 2P9GA 4U67Q 3T19A 1S6QA 3HSJA 1HI0P 5BXIA 2HMIB 2FC8A 4NWBA 1HI8A 4ANEA 2MGZB 2BUNA 1C1BB 2W4CA 3MEEB 4NOHA 2C22A 4RX6A 1P27B 3M9MB 3CCES 4LF6J 2HBQB 4LF1A 3V81B 4JI0J 4I0WA 3HCXA 3TAQA 1HMVB 1NJIT 1NHUA 4OYOA 2MKKA 3ENQA 1R6YA 5CYQA 3IM8A 4RNFA 1G4CA 3NBPA 3PTWA 3IP0A 3M6WA 4OYWA 4ZIVA 1RJJA 5A8WB 3T5LA 4DR4F 2CUYA 2QO3A 3H4BA 3K5NA 3PJXA 3N6LA 2N4CA 3OV7A 2FZCB 3CDUA 3FZBA 3UR0A 2V68A 3DRPA 3M1VB 1R31A 2WW8A 3MZIA 1X4GA 4IFYB 4DV2F 4O3SA 1JJHA 2A2DA 1HWIA 1C0TB 1R3NA 2AW0A 3ENAA 2MTLA 3W9HA 8AT1B 5H9EK 4LF7F 5D3GA 1KD1T 4FXWA 4OYMA 2VD3A 2G2YA 1Q0NA 5IC4B 5HBMB 2N7CA 3G96A 3V6HA 3C3LA 1XNQJ 3OVBA 4GKJJ 5CD4A 1HNWJ 2RS2A 1IBLJ 4X66F 1ACMB 1PC5A 2IC3B 3EJMA 4LSNA 5HQLA 4I2QB 2W9BB 2OTLS 3RJMB 5T41A 3JSMA 4ENOA 3QJPA 1LXJA 2ZFHA 3M2UA 1A7GE 4O3OA 3BZQA 3BYRA 4X4TA 3L9ZA 5HBMA 3G9CA 1CJVB 3PYGA 4Y2KA 4DR6F 5D78A 3C15A 1A6LA 4ZLNA 2OD4A 2ZH3A 1W7WA 2VF3A 3MPVA 3D6MB 1TELA 1TKTA 2OPPB 5LL6d 5LJ3Y 3B6BA 4CM0A 2FJBB 1QAIA 2HWHA 2XSJB 2KH9A 2XMJA 5DG7A 3T1YJ 3K2YA 3FCVA 1HWJA 4WF9Q 5KFFA 3UD5A 3AAWB 1V9OA 1YBUA 3DLKB 5SZTA 1TKTB 1S72S 5AXLA 4DI6A 3LP0A 5B7WA 1U8SA 3JQJA 5KFPA 1T05A 5DS7A 1ZM2A 4HTJA 5A6PA 4ETZA 2AD9A 2ALZA 1ZH5A 1TAUA 3VAFA 1FE0A 3D6TB 5HQ8A 4K8RA 3US5A 1N88A 2RRNA 1S6QB 3DRXA 4ZPAA 4F4KA 2PFDA 3N01A 4WYLA 3IS9B 2Z2ZA 1KONA 4UW2A 2UXDF 2P5VA 4A8WA 4ANCA 2UXDJ 2CQCA 3K5PA 4L72B 1AFJA 1IKVB 3HJVA 5J2MA 4X4QA 3HLUA 1PC4A 1R8AA 2VDIA 4UY8T 4Z7CA 5GAHI 4X4PA 1A0OB 2HNYA 5L1JA 1NU4A 1U6FA 2GQ2A 2IRXA 3FSXA 5E2QA 4WFXA 5MAOA 1VJWA 4DFJA 3FRZA 3CJ5A 2ABYA 1Y9OA 4I6AA 1TL1A 2MLXA 3A12A 4KHMA 2VV5A 3JAMU 2XYGB 3B82A 2RU9A 4C3LA 1WJ9A 2A18A 4ECZA 1FDDA 4ICLB 4DQRA 3NGSA 3QWPA 1YBTA 2B5JB 5J1NA 4J9QA 4F26A 1IR0A 3PJWA 4KRWA 3MMBA 2ZHOA 4A47A 4CO5A 4ELTA 3HSZA 3TUIC 2BJ1A 3DLBA 2J5AA 2H5IB 4RBVA 3HHLD 2ZKUA 3N4WA 1WDTA 3FMBA 3LWMA 4ILLA 4ECSA 2D9OA 1RWVB 2D1CA 1LOUA 5KT3A 5IT0A 1WKKA 1HNZJ 1ZAXA 1V5IB 1HQEA 2M52A 4NASA 3EVOA 3MTJA 3OXLA 1DAXA 2I8EA 4QIGA 1KEKA 3F73A 1QVGR 1N5TA 4N8OA 3RBZA 4AQYJ 2J7KA 2FUG9 1RLDA 7FDRA 4LBIA 2RQCA 2AU0A 2DH8A 1H6KX 4MKYA 4URQU 1UVJA 1OY8A 3HSDA 3ZZTA 3TOQA 3J7Z5 3CJ3A 2FB0A 4K4UA 3M7VA 4RLEA 1FWKA 3IA0A 2P9CA 1IVZA 4A8KA 1EQMA 1SH0A 1GMWD 4JI3J 2X3DA 5CA5A 2ZZNA 4A8XA 1VK3A 5K8MA 1IM6A 3BO3A 3QPIA 2RB7A 2VFVA 3CT9A 2AF6A 3NWRA 4ID5B 3V4MA 5DG9A 2JHEA 3PX4A 1M0SA 1D0EA 2ZNZA 3E01B 3GPAA 5KFVA 5F8GA 4RW8A 5ETRA 4F0MA 4A8QA 1F9EB 2Q1LA 1X5TA 2G1HA 2W7PA 1FDBA 4CI0B 3F56A 4ZPCA 2IM2A 4H54A 4YY3J 2MGZA 2EK6A 3OFEA 2GHVC 4ZP9A 4DBQA 1SH3A 4N76A 1JLQA 4K4WA 5A8KA 3NMRA 4TLQA 1LWEA 3KG1A 4WBFA 3MFHA 4NEYA 4PXBA 1CLFA 4PG6A 2JC0A 3UWTA 2HHPA 4ZLPA 2XCAA 1JLBB 2ZBCA 5HVFA 2BOPA 1K0VA 2OUGA 1FXLA 3MCOA 4LFBJ 1HYSA 2AMCB 4LF4F 2MKHA 5J1EB 2KU7A 2YKNA 3QFWA 4C0BA 4I64A 4KB7A 1ZA1B 4X84A 3G86A 2KRRA 1E6YA 1NSAA 2LU1A 1JJ4A 3HI9A 3JS9A 3SSSA 3IG1B 2DY1A 1V3SA 2HZAA 1X5PA 2IDLA 1EARA 4LFAJ 3R5BA 3D3BJ 3J80U 4LFAF 5K9FA 3DLEB 5BYSA 2RDJA 1WKJA 1S49A 1Y5NB 3HP6A 4FNHA 1S1VA 3LH2S 4QU6A 5KT5A 1KSPA 2UVRA 2MLZA 3O8WA 9ATCB 1N0VC 4QIEA 1PBAA 3LW5C 1XN9A 1R27B 1UEUA 5RUBA 1JLEA 4U7UD 1QE1A 3RU0A 1FJ7A 2QA2A 3W63A 1Y5LB 2FPHX 2ILYA 2JZ5A 4DX5A 4ZJLA 1LWCB 4RW7B 5CYJA 2CPFA 2W2NP 2BXJA 4ZVRB 3TUPA 4DR3J 4FS1A 1NLKL 1HNVB 1R0AA 3G82B 3QIPA 1UA1A 2DNQA 3P6YC 3W8GA 2KM8C 2ZZTA 3LAMA 4QWAA 1Q4RA 4DPOA 2HNZB 2XG8A 1RUSA 3KMQA 2LXFA 2ASLA 2D9PA 2XYHB 4JI2F 2HS3A 3T5KA 1IWAA 2ROEA 3OT9A 2KZMA 2YNGB 2YNFA 4XPCA 2LXIA 4O3QA 1IKYB 4FKXA 2CNNB 3PW4A 2CPZA 2RU3A 3FC9A 2ASYA 3BGRB 3SCJE 1WEYA 2F8MA 5IWAJ 3LP0B 4ED3A 2HHSA 1B64A 1RAAB 4DQQA 1X0FA 3SV4A 4Q8FA 2OGUA 2CFXA 5CCLA 1KP6A 2ZVSA 2KG1A 3IWNC 3BDEA 1X5OA 3I96A 2XMMA 4PXEA 1HNZF 3J7A1 2IRUA 2QX0A 1RT3B 1NSQA 4A8OA 3NRBA 2C1EB 1K9MT 1RLCL 2H1YA 3CDBA 2O01C 2ZVIA 2NPIA 3ICLA 5CYQB 3M9OB 2CJKA 1DURA 2PMZD 4W4MA 4P72A 3S1TA 5J2QA 4RUAA 2R7VA 1TMMA 5EUHA 4LMZA 3OTOJ 2HQGA 2CNOB 3D6HB 1UZHA 4MK8A 4W98A 4E98A 3QRPA 2VJVA 2A2CA 4C48A 3CO9A 2V2VA 2HNYB 3MPDA 5KFAA 4ALZA 3CC2S 4JV0A 3OBIA 3MMCB 5LMUJ 4DL6A 2Y8WA 1NDLA 2C3MA 1QJHA 3IC1A 4J9RA 3UCUP 3U27A 4NA3A 4NXMF 2E9RX 4G1QA 2OD6A 5DQGA 3EPIA 1X4HA 4AXJA 2F7VA 2DIVA 4M5LA 1QAXA 4DV3F 1N33F 2QLWA 3DDKA 2AJQA 1CJVA 1HHSA 4PG4A 4RU2A 4ECTA 3K58A 4LSLB 4P74A 3E2EA 3BGLA 3D7SB 1Z4UA 4OJ1A 4FXVA 4U7UK 1HL6A 3B4DA 3M8QB 1B4SA 2PEBA 4WP3A 2ZJPQ 5EWEA 1HNIA 1WUUA 1NKCA 2VKZG 2MQLA 4DPTA 2JFKA 3BBBA 4HH0A 1BY9A 4WXOA 4YP3A 1GXUA 1WC1A 1SVDA 3D28A 3L7UA 3POTB 4TQSA 3OSNA 3MUVP 1KLNA 1N6QB 4CLPA 1KC8T 3GJSB 1OPZA 3E3XA 4H4OA 4RW7A 1N56A 4CYUA 5HROB 4LF2A 4DLEA 2K1RB 3VQSA 4ED7A 4RPFA 2UVWA 4K7QA 1M5KC 4B3RF 1EKSA 1FRJA 2IIHA 4NLSA 3IBCB 5KFEA 1TL3B 3POTA 2XY7A 4WP8A 1WG5A 2CQGA 4EBDA 4KE5A 3GIRA 3SCLE 1FFSB 2ATCB 2ZDOA 3OD2A 3ULHA 5IXUA 3TVKA 4JI2J 4HI2A 4UOFA 2OIHA 1QM9A 1RWXB 1D8YA 1GTHA 2E5IA 1LFPA 1RWKB 2RUSA 5GAHU 3OHAA 3HT3A 5F3TA 1LEOA 1PILA 3BGRA 4ZVHA 3SFUA 5EWGA 2M8HA 4NLOA 1B0VA 5T7LB 3PACA 1MSWD 2CDQA 1MN9A 3PNIA 2ZH6A 2H48B 2HWIA 2B6AB 1VBXA 1KNZA 2H51B 2KFYA 4DPUA 2OJ3A 2G2OA 4DWIA 4DX8H 3MM5B 2ZHAA 5H9FJ 3CGIA 1O5JA 1T11A 2KO1A 3TARA 5ETOA 1X9MA 2G2ZA 3I0RB 4FPIA 1YKWA 2J6UA 2B9YA 2YKMB 3H2LA 4ILRA 2C2DA 3M2RA 4M5MA 1Q5VA 1RTJA 4BCAA 1EP4B 3X1LB 1N5QA 1RAIB 1WHYA 4ZPWR 2KDOA 4KGVB 2UUCF 1JLAB 3W2WA 1EETA 5IM0A 4MTPA 3VV2B 1DLOA 2DNGA 1WHXA 4DR2J 4DS5A 2XHCA 4KPYA 4I6WA 3SFGA 1XERA 2AKWB 2J0XA 2D7SA 3EGZA 1AZSB 2NXCA 1SQEA 2QMXA 3W2VB 3KLVA 4ZVGA 5L1LA 4IRKA 5EX0A 2HHXA 1FX2A 4IOBA 4JP8A 2DHXA 2F4VJ 2DIUA 3LP2B 4MT1A 3KK2B 1IKWA 1Z1ZA 2GVDB 3HHDA 3CC7S 4XO0A 1LXNA 4O0NA 3HM9A 5KT6A 1YJWS 4IG0B 2XWXA 3NGUA 4C7QA 4MK7A 3PY8A 1I5OB 2GMLA 2MQQA 4P75A 4DV3J 1QAJA 3IR6B 1N33J 3KNAA 2MZSA 1AZSA 3W2VA 3QIPB 4QCLA 4TNOA 4OZ0A 4DR3F 1S97A 1YJRA 2QSFA 3UDVA 1IKXB 1HIYA 1RHQB 1U09A 2DGSA 2KL8A 2RQKA 3DOKA 2HIYA 4OI3A 5J2NB 4ZOSA 2YNFB 4ZVSB 5L46A 5C5JA 3GQCA 2C2KB 3N5FA 4JI4J 3HXMA 1NBEB 1WOOA 2HK2A 3EM1A 3BO4A 3NGTA 3VF0B 4D3GA 1DTQB 1WG1A 3M8PB 2PMWA 4HHJA 5HJYA 2FTRA 2WBMA 4L74A 5KT4A 1JLCB 4TXSA 5I4MA 2Y8YA 3ZNUA 2AX1A 1JLQB 2KHDA 5IT4A 3SEOA 1HR0F 1U6BA 2HQCA 3GMGA 1FX4A 3MR2A 2GNKA 2AEFA 3MI7X 1VBYA 4YB7A 2RHSB 3RBDA 4KFBA 3V2UC 1U0HB 3K0JA 2QT7A 2Z8QA 2AGOA 2A3JA 4RW4A 3ETOA 4LBHA 4M1KA 4J9KA 3RB0A 3GCWP 3HZEA 4NZ7A 3W8PA 2N3LA 1Q8KA 4F3MA 5KG7A 5BR8J 2Y9HA 4GO7X 5J1EA 1LW0B 2JVRA 2NXJA 3CNQP 4C8OA 2LDYA 2XEXA 4RO0A 4PYDA 1R8PA 2VQEF 1EQ0A 1OWXA 1AFIA 3ENWA 2WTFA 1ZAWA 3AXMA 3VGSA 5KFLA 1GK8A 2V8HA 1RT7A 4P9SA 3ZZPA 1RBAA 3VAKA 2MQMA 2YKOA 2L9DA 4DV0F 4OHZA 2AV5A 2KFZA 3SBMA 1RWMB 2XHWA 3CJQA 3P96A 4MKVA 5A8KB 2AZ1A 3TX8A 2CWKA 2F40A 3H90A 4G65A 1G1XA 3VAJA 2M5YA 1R0BG 3RBEA 2CNKB 2R2SA 2BR0A 1VQKS 3MD3A 2FY1A 1SJ4P 4Q44A 4F04B 4IG0A 3KUGA 1JLBA 4U96A 4G1QB 2X1AA 3RR7A 1LK7A 1LWXA 3T6JA 3OR1A 1BHNA 3GSDA 3ISZA 2GJ2A 3GV5B 3SQGB 1MMDA 3MAQA 1FKOB 4OI1A 5B0DA 3UDLA 1SB6A 4ZITA 2XBPA 4K5RA 3MMBB 4PPDA 3HVAA 1FNXH 3GG1A 3V6KA 2ASJA 2B51A 2E7VA 4YFUA 4ZDNA 1RGVA 3GIKA 1LNQA 1XR5A 4OI4A 4WFZA 3PVXA 5FJ4A 4O3RA 4HHUA 2V2ZA 2YH0A 3M8ZA 1HBUB 3M05A 4DN9A 4USWA 2KG0A 4X64J 2Z57B 3P8BB 4R5PA 4JI8J 1NUEA 1QTNB 1FCAA 1JLGB 1S1WA 1S4EA 1SQGA 2PN6A 4OMFG 4ED4A 4ZPTR 1CULB 5D0RA 1XNRJ 1HQEB 3CWJA 4NMXA 5DDOC 2MSSA 3AH6A 3A8JA 4C11B 4B9MA 3DU6A 1RWNB 2W7OA 4TKTA 2E1AA 3MEKA 4WK1A 1U1KA 3PYFA 5C24B 4ZLJA 5DLGA 4AD6A 1S5ZA 1VJQA 3HD2A 4Y3CA 4QU7A 3NLCA 3RRHA 3FMWA 3DYAA 2WVCA 2FHJA 2VC1A 3MR6A 3QT5A 2XLJA 3NOCA 4EBEA 4RWXA 4CO4A 5KOWA 5HMYA 4PRFA 2VG7A 3PEJA 3F41A 4KGKA 1RAHB 3KLEA 3AQPA 3TW0A 2WVBA 2GVZB 3EVWA 2C3OA 3BO2A 2RH3A 4F02A 5J2PA 3L95X 4F4XA 1PCAA 3GJTB 4ED0A 1X8DA 1Q8BA 3PX0A 1MWZA 4PUOA 2EC0A 2A1BA 2RF2B 4UOHA 3TEHB 1T3NA 4WCEQ 3NNAA 3MWBA 4XAKA 3GV8B 4DR2F 1AA1B 2JOQA 3VTIA 1HBOA 3I0SA 4DV6J 1L3TA 5KFRA 5KG0A 3M2RB 2LXUA 3M8WA 2V63A 3MPUB 4W92B 3VAGA 4B08A 2YNHB 1PYSB 4G6VB 4DUYF 1XR7A 2NYHA 5K8NA 4C8ZA 2YXLA 1VIXA 2VZ9A 1LWFA 2O67A 4Y2CA 3TZZA 3CJRA 1RACB 1V3ZA 2J0WA 1UFKA 4PWUA 2KXHA 3TA0A 2PO4A 2Y1LB 3Q8RB 1IR2A 5HQMA 4A8MP 1UPPA 3CDEA 1Z2ZA 4A4JA 4E8UA 3CCSS 3AOCA 1M1GA 1NEEA 4U95A 1PIEA 1UAWA 2MQ8A 2YNHA 1VHIA 4O4GA 4P2FA 1VC5A 4XK8C 2K7JA 5GMDA 1S6PB 5L9XA 2WONB 2DYAA 2BV3A 5B09A 2W9CB 1Q1KA 1RAEB 1RT6B 3HHLB 2HHHJ 3MXHP 2ZM6F 1NK4A 1RWUA 2VBWA 2ZBPA 5HROA 2BVZA 4Y65A 1HLWA 4HI1A 4ZPVR 1AROP 1CS4A 3RBXA 2DBBA 3C15B 1EZZB 1A9NB 4J9PA 3A4TA 1QD1A 3I82A 5HJXA 3TVZA 4K4YA 1S1UA 1DARA 1G6BA 1HBNA 3IWXA 4CNZA 3MPWA 2G4BA 2VG6A 3DOLB 5LXYA 1C4CA 2ZUAA 4UOCA 2LMIA 1K44A 4LVOP 4I6YA 2IJRA 5DRKA 1YBAA 1RT2B 4JI7J 4ECVA 1KFDA 1RA6A 2X1BA 4OZJA 4CH1A 4OZ2A 4G1IA 5CAAA 1RT5A 1U4BA 2OP5A 4ZVFA 1UETA 1QSSA 1FFGB 1XMOF 2V8DA 5C24A 2UUWA 3SV3A 4OV1A 2IYGA 4F4AA 2ZEJA 2XI3A 4B3RJ 1O6XA 3DM2B 3CW2C 3PYEA 2YX7A 2MJUA 4QWCA 2YWHA 2ZOGA 3D1HA 2D41A 2DISA 5F0WA 1HHQA 2X51A 2DGTA 4NEZA 1JQGA 3L4BC 5KFOA 1S0OA 2B8PA 2FVSA 2BM0A 1UWBB 3Q8VA 1ZYQA 4IFYA 1U1OA 3EVMA 2NXUA 4O0IA 4HTIA 3CCWA 2EKNA 4FBUA 3QJLA 1B7FA 4ZVPB 2VC0A 4NX9A 3CJ8A 5IC6B 5A2QU 2UZAA 3MEEA 2RF2A 2VPWB 1S1XA 1UW4A 2ZBIA 2GIQA 5EHHA 3J80Y 3BH7B 3M32A 5M2UA 2M2BA 2MY7A 1P9YA 3C16A 1D9AA 4ZCKA 2AIRB 2WW4A 4CZCA 1UCNA 4P2SA 1B0PA 1WOPA 3KJQB 5B0AA 2AT1B 3Q8UA 1GMVA 2LQJA 4LSNB 2R7WA 3DN9A 1KTVA 3K59A 3OR2B 1L5UA 1NNDA 4LJMA 2BKOA 2IJNA 2J9CA 4ES2A 3FEYB 2DO4A 4RBUA 2BACA 4C2MA 3VALA 3SZ2A 1SKSA 5DLFA 3RYLA 4UZCA 1TFWA 3R27A 4FF3A 2RILA 3PRBA 1GT8A 3DOMA 1YTYA 2P9EA 2OPSB 4BWJA 1F6TA 2FVCA 2WVEA 4DUZJ 1S0MA 1HNXF 4CT9A 8ATCB 2KTQA 4Y00A 1RT2A 4ZHRA 2BM1A 4CO2A 1CQMA 2Q6BA 3QT7A 1KHWA 3OTOF 1RQ0A 1FKPA 2Y0SD 5AE3A 3TAMB 3RAXA 1WHVA 4FBTA 1CULA 2MHEA 3I5CA 1BUXA 1S6OA 2BYCA 3UN3A 2HVHA 1S1WB 4Y0FA 1WTFA 2R7RA 1I1GA 3MCSA 1RTDB 3RR8A 2G0IA 4ZVEA 3VCDA 2DVIA 2IBOA 3D1OA 3EDQB 4NXNF 4CLYA 2DNOA 4NXNJ 5CH7B 1EB0A 4DUTA 2C2OB 1FXDA 4F3QA 4RW4B 4IG3A 2EPIA 3DXBA 4N5SA 3LPYA 4F3OA 4KFBB 4USUA 3CXCR 3ZZOA 1KVKA 3R3TA 4ID5A 3FNNA 2LFVA 4Y2AA 2YH1A 2DNYA 2MZJA 3R7BB 3FEXB 3NNCA 2B9XA 2BJ9A 4NA1A 2KM8B 2FZKB 1VR6A 1T9WA 2I0XA 4MYUA 3ITHB 4ECWA 1EAYC 2CZ9A 1R7IA 3FBEA 1H7XA 5KAKA 4P6QA 5LXRA 4CLUA 2HBRB 5LMNF 1VI7A 2OELA 2JEGA 1JLFB 1R8CA 1AT1B 2AEJA 2AJ1A 2KHCA 3BKFA 1GEHA 4LFCJ 1KLMB 1ZPVA 4WFAQ 1C1CB 2HMIA 3M8SA 1IR1A 2F8HA 1X5SA 4NCGB 2F3JA 3DGVA 1WELA 3BN4A 3OR2A 2HGNA 2FQQB 3EGNA 5L1KA 2R8KA 4N41A 3THVA 1DRZA 1CJTA 1RTHB 2BRLA 2GMHA 1TAQA 4TY9A 3EZUA 3CIMA 3G8QA 2VA3A 3IRXB 2BQRA 1U48A 2E1CA 2W4PA 3DOMB 1KRPA 1IJFB 2CG4A 4CLZA 1P1TA 2JH3A 2K2PA 3RB6A 3LPEA 1HW8A 1VMBA 4ZCMA 4LF5F 2HHUA 1PJ6A 4NZ6A 5A8RB 1L3SA 2FD2A 1J5OA 4LF5J 3H20A 5KFQA 3AJ2A 3DMJA 2ZBRA 3DRPB 4OI2A 4EFAC 4KC5A 1AYEA 3SSRA 4CRJA 4NYPA 3D0GE 2MYFA 1WF2A 2OPQB 3BREA 2QTWA 4P2XA 1MROA 4OYXA 2AYGA 5EN1A 1DTTA 1MG7A 2K3KA 3UPFA 2XSJA 4DEZA 2B5JA 3T9NA 9RUBA 3D4JA 2RIJA 3CDAA 4AUKA 1JKHA 3ZNJ1 4IR1A 4YHHJ 4IYQA 4WKRA 2OPSA 1HW9A 5HP1A 3MECB 4JV5J 1S9FA 1F2GA 3UD3P 2CPIA 4FDFA 4Y6IA 2RRAA 1Q7LB 2IRYA 2ZH7A 2XSFA 1GTEA 1M5HA 2NLWA 2YNGA 3TAMA 5KFMA 3OPKA 1LQ9A 4TU9A 2QLXA 2WCXA 1GNKA 3GFXA 2WB4A 2DITA 3PXGa 3M9NB 1LWEB 1XQIA 4DV2J 1RXOB 4I69A 2ZH4A 2B4UA 2DY9A 3VZIA 1RT5B 2W01A 3PZPA 4L76A 1RT1B 1VISA 3B4MA 3D68A 4OLOA 1ROFA 4P7TA 5KT2A 3MM6A 1JX4A 2NZ4A 1DTQA 3M8PA 3CUNA 1SUQB 5I42B 2DNRA 3CJKB 1NMEB 3EGWB 1K1SA 1S4FA 3H8YA 3MAAA 5E5NA 3MEGB 4HT7A 4I2PA 2MLYA 3G6XA 3U1LA 2VOOA 2Q3PA 4DL3A 2QSWA 1JWWA 1Q53A 4WKYA 4DL4A 4NA2A 1UJ6A 1ZA2B 2LEAA 3AOAA 2HVZA 3PO5A 3KTQA 4LUBA 4AL6A 3FCHA 1TL4A 5GMEA 1MW7A 1KOOA 3OLAA 3R6GB 3KLEB 1S77D 2LDIA 4C8MA 2W4DA 2R8IA 2AJFE 3LAKA 1TK0A 3PIPQ 5HLFA 4QPXA 3QO9B 1F5CA 4TU7A 3LGHA 4KY3A 3W5ZA 1TUVA 1DJ0A 2BMBA 3W1YC 4ZN1A 2IA6A 4NLYA 4R25A 4OX9F 1ZETA 5ITHA 2BQ3A 5BYQA 4CCHA 4F8RA 2Y3YA 1JKHB 1G7CB 1MWQA 2CJQA 1VRUB 3MM8B 2IVYA 3R8YA 2IC3A 2GZOA 2CWXA 3HVTA 3ILIA 4O23A 2CPJA 5CABA 3K17A 2ROGA 3GTYX 5F9NA 1VCTA 3RRKA 2N3OA 1ZM3A 1H2UX 1QSYA 2BKPA 4JI5F 1S1TA 3KJVB 4DR7J 3CE8A 5E3RA 3R7NB 5K8OA 3QZ7A 4DV5J 4I7FA 4KIAA 2IVFB 3RGIA 5JVHQ 2WRMA 4FYDA 3K8WA 3DRSA 1AUSL 3CO0P 2XMUA 3AODA 5CHCB 5KT7A 2FJEB 3BDPA 2XS5A 2DH9A 4A46A 1T03B 5DDPC 1MN7A 4HVZA 1PAEX 3BB5A 2C2NA 3TO8A 5H9FK 4QW8A 4AFFA 3MMAA 3NS6A 4KV8B 1M5VC 4F2RA 4U6PA 2NQPA 4JYAJ 4FF1A 4NPOA 4J7CA 2G0CA 3FEZA 1CQNA 1NK6A 3VGVA 1XR6A 4L75A 1JJ2R 2R7TA 5KFIA 1KWMA 3RG6A 2E1RA 2BOAA 3T9ZA 2CPHA 2EFQA 2FC9A 4J9OA 4V19J 4QWDA 3TVYA 1GX6A 5D0EA 3PJ9A 1RAJA 4H4KC 2C3UA 3C6TB 1HD0A 3I4HX 4OX8A 6FD1A 3NL0A 5JMNA 1U1NA 2X7IA 1FFWB 2W8LA 3U1NA 2NS1B 3W9IA 2J9DE 1GQEA 2XMVA 3PKMA 2AJ0A 1HNWF 3GSIA 2CQ3A 4MIBA 4YR3A 1JLEB 4IKAA 4B3SF 1RTJB 2XMTA 3R1HA 3TA2A 2Z2YB 3QGPA 2XO6A 1OSDA 4M5DB 1RHMB 2EK1A 1I6JA 1B70B 1IQTA 1SV5A 3KFWX 2J7UA 3ZTRA 3Q24A 2VQEJ 2VONA 4I2QA 2W9BA 1DY3A 3IG1A 4URGA 1U0SA 1F9HA 4DFKA 4RUBA 1YJ7A 1IBCB 4UOGA 2JSXA 2CRLA 4WTOB 2V50A 4AT1B 4DV0J 3NNHA 1FI4A 3OVAA 4R8UB 3CCJS 2XS2A 2R2TA 1SH2A 2GAGC 3JSRA 3QBCA 4DR4J 1IKYA 3SSQA 3K89A 1NH8A 2GIRA 1SJQA 2VG5B 1U24A 4J9UE 3VQTA 1YG0A 4OZ1A 4PWWA 3IRWP 4MYTA 1ZM9A 3TNVA 4Q0BA 3ILOA 3MAHA 3KLHA 1RK8A 1FRHA 2H54B 2KYZA 2R7OA 3P3DA 2BANB 5D15A 5IQQA 1M5OC 4LQ3A 2YKPA 5U47A 4F4YA 1C0UA 2PGCA 1JLGA 2QV6A 2YQ0A 2YPYA 4YEAA 3W9JA 1NK7A 4B3OA 1HNVA 1R0AB 2VFUA 4J90A 5ETPA 1HR0J 3C6UB 1CS4B 3R5AA 3EZOA 4P52A 5D77A 3P5TL 2DR7A 4B9VA 4RNMA 3OQ2A 4YQWA 3QGHA 3IR7B 4M5NA 1U0HA 1Q16B 3DLGB 4UF4A 2F9JA 3JB9k 4NYOA 3MM6B 4F50A 3V6DA 1SL2A 3NS5A 4HDHA 4ELVA 2J0SD 2P2CB 2FHOB 3NAHA 4A8FA 3ADAC 1S10A 3BSAA 4DR7F 4ZS6A 4RKUC 1YJVA 3SI8A 2NUHA 3RW6A 3MM5A 1H98A 2MEWA 2DTJA 2C42A 1YX2A 1AXQA 1TTHB 5ETLA 1F1BB 5GAGI 4PWDA 1NJWA 2J6SA 1RWWB 2BJ3A 3FQKA 5DGAA 1I94J 2VFRA 4PQUB 1C0TA 1WI6A 3MM9A 4C3MA 2V34A 3X3UA 4CO0A 1NK5A 1N34J 1DLOB 1T95A 3OJSA 2DHHA 3P4UB 1FTRA 1X7VA 2KI2A 2V2KA 3KMSA 4CO1A 2UU9F 2IY5B 4LF7J 2YNIA 4NLGA 4MFBB 4J37A 5KG4A 2XZWA 1UVNA 5KFXA 3RTVA 2OEMA 1MROB 4BS2A 5L9NA 3CEDA 3MD1A 2PC6A 4HACB 3BS9A 3OR1B 5D4OA 2FHKA 3N5BA 1RABB 3UR3C 4EYHB 1WWHA 3PW7A 3M2VB 4ZP6A 4MK9A 5KG1A 1OY9A 1S79A 1VHFA 2ZUGA 5E41A 4H4OB 1SJFA 3HHNB 5IT9U 3Q0AA 2BBEA 2ROPA 2MY8A 1S1TB 3CCZA 1T94A 1RP5A 4HDGA 2N4DA 4O4GB 5G4DA 4YDXA 3KJVA 2EBGA 3MPYA 2WZ1A 1VGYA 3BF4A 2HHHF 1X60A 2LU2A 2AEMA 4X65F 4JI0F 3E8OA 3M8QA 1FF2A 3CSKA 2VOPA 2HG4A 2K7KA 2HNZA 2XMAA 2FVRA 4QYZJ 2GJIA 2QC3A 2XYPB 2XY6A 1YJNS 1V3RA 3RUBL 4LF8F 3ISNC 1N52B 2GCFA 2A6MA 4TLRA 4Y28C 3OL7A 2DCUB 4DFPA 2YWEA 4FS2A 4EI2A 3QIDA 2BE2A 4DN0A 2BDPA 4FP9A 3UO0A 1O51A 3MEGA 1TK5A 2AX0A 3UN5A 2B43A 1FDAA 3LA0A 2YQ1A 5IV3A 5I42A 4JV5F 3EUNA 1QLNA 2YX1A 3HULA 5LSOA 1HWLA 4TU8A 3UI3A 2FHMA 4ZK7M 1LW0A 4F36A 4B9NA 4YS2A 4DL7A 1BWEA 4X4SA 1H38A 3TJAA 2GVZA 4P10A 4ZVQB 1YI2S 3JTNA 2C2RA 3CVKA 1X4BA 4RU9A 1Y4ZB 2P6TA 4PXDA 5J2QB 2HWTA 3T6BA 2IPOB 1MWYA 1TR0A 3R6LB 3JAMY 5F8NA 1FO1A 2OEKA 1TFYA 3KK1B 2SXLA 1VQOS 4C6AA 1JNZB 1KOHA 3KDOA 2HQFA 2ZE2B 4M95A 1GXTA 2F4VF 4PWDB 1UWAA 4JI5J 1O8BA 2XLIA 1VQYA 1F0XA 2ZH2A 4NE9C 3WX4A 1RHKB 4I4BA 2CVEA 2M9KA 4DJBA 4YB1P 2FVQA 4RNNA 4BC9A 3W62A 1R43A 3PR5B 1WTBA 1OSCA 2ACMA 2OLWA 2MQPA 4C8LA 4U8YA 3KK1A 3NGKA 2Q6CA 4YR0A 5DM7Q 3CCQS 3G87A 4X62F 3JYTA 4JI3F 2KT2A 2LKZA 2V94A 4F0HA 5KFJA 4KGXB 1JLAA 1SIZA 2RDDA 3H0PA 3M1VA 3QGIA 5ETVA 3W2WB 4OL8A 3TQ1A 4LVNP 1JK9B 1YZ7A 1PBUA 4EK2A 3W66A 2CQ0A 2BJDA 5HVGA 3HZGA 2DXEA 5M2PA 2X1GA 3A3PB 2RE1A 4DSJA 2OPQA 1NHKL 4K2XA 1SIWB 2CZVC 1HBMA 3HDSA 4LT6A 5H1SV 1H3DA 3OHBA 2L08A 2FZGB 4MMOA 4Q0BB 2Z2LA 2F8EX 4K4XA 1KDNA 3ET6A 4CYUB 4F67A 2W2PP 3MDFA 5K8PA 4QWEA 2VPXB 3C6UA 3WQPA 1DQAA 4B3OB 2IDEA 2R7XA 1WI8A 5CXTA 3OSPA 3Q23A 2KT5A 4NZ0A 4Q43A 1YRXA 1ULRA 2G13A 4QJVA 4CNYA 4GKKF 3DU5A 4C3KA 5DG8A 4V1Ak 1NKBA 3KNGA 1BE4A 4P7VA 4RW6B 2B3TB 5KFTA 4FYYB 3FSIA 4IUFA 3M8YA 3BQ0A 4UZBA 1NH7A 1UEKA 4OHVA 2JLGA 1U1RA 1HFEL 3DGPA 4JV1A 3OL6A 1SJRA 4YB5A 3HHLC 2V67A 3I0SB 2M3DA 3AQOA 2VFSA 3ZZUA 1FRLA 2H9ZA 2MJNA 3FUYA 4OIXA 3VGTA 2MPUA 4CLKA 2G9OA 4ED6A 1VRTB 1S7IA 4FYXB 5D0HA 2R8GA 1VDHA 3JTOA 2CZ4A 3UVJA 3OLBA 1K8AT 5L8RC 2X1FA 3NBPB 5G0RA 4IQXA 1CPZA 4I56A 3Q22A 2XLKA 2MMYA 3J7ZT 3NCPA 2VJUA 5J2MB 4O44A 4QYZK 1KTQA 5KFCA 1F3VA 1RZMA 1CJTB 1RTHA 1V5VA 2ZITA 2HGLA 4URSA 1YJ9S 1K47A 2RSQA 3V4IA 3KDNA 4WE1A 3UW1A 2GV1A 3WC2A 2F9DA 2GQCA 2CVIA 1SC1B 1RE1B 4RJVA 2PDAA 1U49A 2UP1A 1S6PA 4FNIA 1VK8A 3AFGA 3QRRA 1QUPA 2M88A 3ZZRA 2EI5A 4M5IA 3O5TB 4ID8A 3M4XA 4KKOA 3KHRA 3BSOA 1QUVA 5DQHA 2DXFA 4B3TJ 1QY7A 3CD5A 4QQBA 4HR2A 1TV6B 4UTGA 3TP2A 1B7YB 2B7CB 1FEHA 3AB2B 3LP2A 4LRFA 3DRRB 3KK2A 5HMXA 1H2TZ 3H5XA 1YWXA 3GFZA 4Z37A 4YOEA 4ZPBA 4KYZA 2CPXA 5DZ6A 3N79A 2QRRA 3G2XA 4KGMA 4DSIA 4WIQA 3G71S 4HEA9 5HANA 1XWLA 3PW0A 2IM0A 4ZVOB 3IAS9 2XI2A 2D69A 2QLFB 2DNNA 1U2RA
chains in the Genus database with same CATH topology
4ZVQB 3D6MB 4ZVPB 1RWXB 2Y0BB 5IC6B 1RWKB 2HBZB 3D6FB 1IBCB 3R5JB 3R6LB 2DKOB 4ZVUB 1QTNB 1RWOB 2H48B 2QLJB 2H51B 3KJQB 1NMEB 1RWNB 2QL9B 1RHKB 2H54B 4LSZB 2XZTB 4ZVRB 3R7SB 2CNLB 2XZDB 1RWPB 2C2ZB 3GJQB 1BMQB 4ZVTB 5K20B 3P45B 1SC3B 3R6GB 1RHRB 2XYHB 1I51B 2H4WB 4DCPB 1PAUB 3SIPB 2QLBB 1SC4B 3GJTB 2CNNB 2P2CB 3EDRB 3EDQB 1ICEB 2C2OB 2QL5B 2XYGB 2HBYB 1RWWB 3R7BB 1QDUB 2C1EB 4JB8B 1RHQB 2H5IB 3R7NB 4ZVSB 2C2KB 2Y1LB 1RHUB 3P4UB 1RHJB 1PYOB 3GJRB 1RWVB 2HBRB 2CNOB 3D6HB 2H65B 2QL7B 2H4YB 1GFWB 2FQQB 2HBQB 3QNWB 1I3OB 3IBFB 2H5JB 4DCOB 1F9EB 1SC1B 1RE1B 2XYPB 1RWMB 2C2MB 5IC4B 3NS7B 2CNKB 3KJFB 3KJNB 2CJXB 3GJSB 2CDRB 3RJMB 2CJYB 3IBCB 1RHMB 4ZVOB 4DCJB 2QLFB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZVQ B;  3D6M B;  4ZVP B;  1RWX B;  2Y0B B;  5IC6 B;  1RWK B;  2HBZ B;  3D6F B;  1IBC B;  3R5J B;  3R6L B;  2DKO B;  4ZVU B;  1QTN B;  1RWO B;  2H48 B;  2QLJ B;  2H51 B;  3KJQ B;  1NME B;  1RWN B;  2QL9 B;  1RHK B;  2H54 B;  4LSZ B;  2XZT B;  4ZVR B;  3R7S B;  2CNL B;  2XZD B;  1RWP B;  2C2Z B;  3GJQ B;  1BMQ B;  4ZVT B;  5K20 B;  3P45 B;  1SC3 B;  3R6G B;  1RHR B;  2XYH B;  1I51 B;  2H4W B;  4DCP B;  1PAU B;  3SIP B;  2QLB B;  1SC4 B;  3GJT B;  2CNN B;  2P2C B;  3EDR B;  3EDQ B;  1ICE B;  2C2O B;  2QL5 B;  2XYG B;  2HBY B;  1RWW B;  3R7B B;  1QDU B;  2C1E B;  4JB8 B;  1RHQ B;  2H5I B;  3R7N B;  4ZVS B;  2C2K B;  2Y1L B;  1RHU B;  3P4U B;  1RHJ B;  1PYO B;  3GJR B;  1RWV B;  2HBR B;  2CNO B;  3D6H B;  2H65 B;  2QL7 B;  2H4Y B;  1GFW B;  2FQQ B;  2HBQ B;  3QNW B;  1I3O B;  3IBF B;  2H5J B;  4DCO B;  1F9E B;  1SC1 B;  1RE1 B;  2XYP B;  1RWM B;  2C2M B;  5IC4 B;  3NS7 B;  2CNK B;  3KJF B;  3KJN B;  2CJX B;  3GJS B;  2CDR B;  3RJM B;  2CJY B;  3IBC B;  1RHM B;  4ZVO B;  4DCJ B;  2QLF B; 
#chains in the Genus database with same CATH topology
 2FJX A;  4DHV A;  2RD5 C;  3C66 A;  4L3N A;  3WHI A;  2FLN A;  2HHV A;  3DFE A;  1QE1 B;  4M5J A;  4QIW D;  1TU0 B;  2DNK A;  2HKE A;  2VFT A;  2Y0B B;  5C25 B;  1KQK A;  1BQM A;  1R89 A;  4ZA1 A;  3AD8 C;  1NJZ A;  1RT4 B;  2CPE A;  3I87 A;  2DT9 A;  5B0F A;  3T41 A;  4DSF A;  3NMA A;  5GAD I;  1JXL A;  2IAJ A;  4H4M B;  1APS A;  3EIC A;  2BE7 D;  3G82 A;  3Q2S C;  4MH8 A;  2M7S A;  2OMO A;  4UQT A;  5J2P B;  2VIH A;  1T03 A;  2QG9 B;  3G6E S;  3I6P A;  3ZZY A;  5KFK A;  3KLH B;  2DHG A;  2FGC A;  5C25 A;  3T1A A;  2DR6 A;  1KQF B;  4X4R A;  1FRX A;  1PJ5 A;  5DJB A;  1YHQ S;  4X4U A;  3Q86 A;  4ELU A;  3FCW A;  5LT5 A;  4JI6 F;  1TL7 B;  2C28 A;  4UQG A;  5T7L A;  1RT1 A;  3TX0 A;  3NXZ A;  3DYA B;  2E5H A;  2MHN A;  2EFO A;  1NB2 A;  1C2P A;  3B54 A;  3D3C J;  1OQ3 A;  2RKI A;  4KO0 A;  4RW6 A;  1JMT A;  4M5K A;  5AXM A;  3ZTP A;  3KLF B;  3F0N A;  4DUZ F;  3H2U B;  3CTR A;  4WU2 A;  3GLJ A;  1REG X;  1Y11 A;  3HK2 A;  2CJ9 A;  4ED1 A;  1G3O A;  4IH5 A;  3FBC A;  4U8V A;  3MMC A;  2AYE A;  1EX8 A;  3KG0 A;  2AGQ A;  2QEX S;  2FLP A;  1P8G A;  2J8A A;  3U1M A;  1HQU B;  2GAH C;  5LSR A;  2D3O 1;  1M90 T;  1YIT S;  4LF6 F;  1HYS B;  2JDJ A;  1G2E A;  4IRC A;  1XEZ A;  2CJA A;  4X2B A;  1PGZ A;  4DSL A;  1ICE B;  2E5L J;  5KG5 A;  2W9C A;  4CP5 A;  5EWF A;  4IFV A;  5THW A;  3JYT B;  4O44 B;  4RR5 A;  2RAQ A;  5HO4 A;  4PCQ A;  3V5R A;  1U47 A;  1HWU A;  3OL9 A;  4J9M A;  3QWU A;  1X4E A;  4E2F B;  1U1M A;  2ZNY A;  3H5S A;  1N5S A;  1FKP B;  4WZM A;  1N32 J;  1FVQ A;  2LLZ A;  2VB6 A;  1YJT A;  3TA1 A;  3PM9 A;  5AJ3 F;  2NPF A;  3GIJ A;  3W5Y A;  3T5H A;  2DXD A;  4M94 A;  4I1T A;  2DK2 A;  4YHH F;  1S9G A;  5HN0 A;  3MUM P;  1S57 A;  3LUY A;  2O3D A;  2UV8 G;  3MCN A;  3ZC4 A;  3MMJ A;  1XJW B;  4XPE A;  2XNQ A;  3GZ7 A;  5E3A A;  1HBU A;  5FII A;  4EO8 A;  3UN2 A;  2JC1 A;  5GMK a;  3FQL A;  4DV5 F;  2UUC J;  4KT0 C;  1WC0 A;  2EFG A;  1LFW A;  2MKC A;  4N8N A;  5L39 A;  4NI2 A;  4DF4 A;  2OFG X;  3M6U A;  1VBZ A;  5DZ7 A;  1KKH A;  2M0G B;  1FWL A;  2OTJ S;  2HS4 A;  2GQQ A;  5FLX U;  3UNY A;  3NAI A;  4FVC A;  1IN0 A;  3KK3 A;  5L1I A;  5HAO A;  1CC7 A;  2K06 A;  3UFC X;  1NRK A;  5F9L A;  1XNR F;  1WG4 A;  3GIM A;  3FBF A;  4EMD A;  3E01 A;  3MR5 A;  2HQI A;  3CJK A;  1UWB A;  3H98 A;  1FNO A;  3HKZ D;  3GV7 B;  3HKW A;  3GG0 A;  3DGP B;  3BPD A;  4MIW A;  2UUT A;  4WP9 A;  5HAT A;  2R3V A;  5ADZ A;  4PQA A;  4DR6 J;  1S1X B;  2CJX B;  4CWB A;  1IKV A;  2CQ4 A;  2CQ1 A;  2HIQ A;  3FFI A;  1U6Z A;  2YX4 A;  1UVK A;  1UEV A;  1VRT A;  3KKF A;  4RWW A;  2MZ1 A;  5KFZ A;  2PE8 A;  2CYY A;  2UXB J;  5GAD U;  3KUE A;  3HHE A;  4LRD A;  5KG2 A;  3Q8Q B;  1CJK A;  3U02 A;  4DG1 A;  2BEF A;  4U9R A;  2EEY A;  1LK5 A;  4ECX A;  2HZV A;  4DX7 A;  2GX8 A;  2ACY A;  1FA0 A;  2VBZ A;  1H2V Z;  1RAD B;  2QZ8 A;  1ZTW A;  3QMQ A;  3JQK A;  2HFV A;  2QIF A;  1H72 C;  3BGF A;  4PG7 A;  4PXC A;  1ZZF A;  2QA4 S;  2QJ3 A;  4LRB A;  1TQL A;  1VLY A;  4KHR A;  4B3M J;  3MOJ B;  1T0T V;  2PA3 A;  1J5E J;  4TY8 B;  1RDR A;  2DJW A;  4TVA B;  4ZHR B;  1D3W A;  1LWF B;  2COL A;  5A8W A;  5CZV A;  2RVJ A;  1FRM A;  1VC6 A;  1NPK A;  2ZZM A;  2B9W A;  3NG8 A;  4MFB A;  5F8H A;  1VIO A;  2IHR 1;  2Y1I A;  3RB3 A;  1VQ5 S;  2ZC3 A;  2ZKT A;  3F44 A;  3KUH A;  2ALY B;  3L7P A;  5GAE U;  2V0N A;  4DUY J;  1XBW A;  3DDN A;  2VQF F;  2F4F A;  3BR8 A;  5AXK A;  2Y1J A;  1KQS R;  3HHL A;  4OYP A;  1S48 A;  1SCJ B;  2DGV A;  3TYT A;  5A8R A;  1QSL A;  2KXF A;  4C8K A;  4OHY A;  3OXG A;  3FGV A;  3OTB A;  1NO8 A;  1Y0H A;  4X4N A;  1H0H B;  2CNL B;  5AE1 A;  2V4J A;  3R5G A;  4GMK A;  3QSY B;  2ADC A;  1H74 A;  2OSQ A;  1URN A;  1BMQ B;  2C2Z B;  4X62 J;  4ZVT B;  4EZ6 A;  1BQM B;  2OKQ A;  5JUM A;  2NRE A;  2A6O A;  1IKW B;  1TP7 A;  2RUG A;  2LEC A;  1HI1 A;  2H4W B;  2CIM A;  5E0O A;  3CCU S;  1YK9 A;  4CO3 A;  4CTA B;  2QFJ A;  3S6E A;  1VQL S;  1C1B A;  1UFW A;  2I9S A;  3W60 A;  3WZ0 A;  5B0B A;  3AOB A;  4E0D A;  4CT8 A;  3WX8 A;  4DQI A;  2XTJ P;  4WFB Q;  2VIC A;  4KQZ A;  2DRA A;  4CH0 S;  2FLO A;  2FIU A;  3BQ2 A;  1IBM F;  4DV1 F;  2FJA B;  2JLE A;  1TL5 A;  1TZ0 A;  2Q79 A;  3AT1 B;  2DGX A;  3PYD A;  3WIU A;  1Q81 T;  1Y10 A;  1HKA A;  4HH1 A;  4DV4 F;  1WKL A;  3I0R A;  5G0R B;  2LVW A;  2EW9 A;  3R1L A;  1FK9 A;  1PG5 B;  2HS0 A;  2I5J A;  4GVB B;  3QLH B;  5LJ5 Y;  5C7P A;  4WFN Q;  2XCP A;  3PX6 A;  2RQ4 A;  2DB1 A;  1OPI A;  4OI0 A;  1V6H A;  3QAT A;  5I3U A;  2NXE A;  4RW8 B;  4X66 J;  2WSC C;  1VYA A;  1W25 A;  5B0G A;  1NDP A;  1J5O B;  3RRG A;  2DGO A;  1BXN A;  1EHW A;  3Q89 A;  1WC5 A;  3H2V E;  3BQ1 A;  3DC2 A;  1YVF A;  3G6Y A;  1VQS A;  2OPR B;  4LR7 A;  1CJU A;  1TKX A;  2NXN A;  2JL9 A;  3I31 A;  4NLW A;  4OYI A;  2BA9 A;  2EKY A;  3OTE A;  5B0E A;  2ZWP A;  4CQ1 A;  3KHG A;  3LQV A;  1TV6 A;  4HLB A;  3KLI B;  2BJE A;  3A3N B;  1I3O B;  2V4Q A;  3S01 A;  3Q8Y A;  1NZ8 A;  5KFU A;  1OYE A;  4LRC A;  5DDR C;  1YIJ S;  1VQ9 S;  4C8Y A;  1HD1 A;  4LF8 J;  2EG1 A;  1VRQ C;  5KG3 A;  1UTA A;  5D4N A;  3A3O B;  1JIH A;  5D0G A;  3ET6 B;  1N54 B;  1EET B;  1Q79 A;  3M6V A;  2BJ8 A;  4QW9 A;  4BLG A;  3V4I B;  4EZ9 A;  4ERD A;  1HHT P;  3AXK A;  2Q43 A;  3G8S A;  3VAH A;  3EX7 B;  2DPJ A;  5ETQ A;  4C11 A;  3PHE A;  4ES1 A;  1N36 F;  2HRY A;  5I3P A;  1ZBT A;  3ILL A;  5HK4 A;  1HBN B;  4KKO B;  3KWM A;  2ZDP A;  1WOR A;  3HF5 A;  3GFH A;  4AQY F;  3KJF B;  3I9Z A;  5IQ6 A;  2YVS A;  4J9L A;  2BAN A;  5CZX A;  5ETM A;  2VU5 A;  4GVL A;  3RZA A;  1IUJ A;  2LQ5 A;  2QMU B;  4Q7A A;  5IFM A;  1ITP A;  2VG7 B;  1FKA F;  2JEF A;  2CA9 A;  3KLG B;  1KHV A;  4Q2L A;  1HBM B;  5DO2 A;  1XMB A;  1P9Q C;  2D3Z A;  1FK9 B;  1U25 A;  5D4P A;  1TVR A;  3AD9 C;  3DI6 A;  3GYX B;  5K5M A;  4OZL A;  5ETN A;  4OJH A;  1IXK A;  4NLD A;  2R4F A;  3PCO B;  5KFW A;  4DR1 F;  1D1U A;  4KO0 B;  1P6T A;  3M30 A;  4KV8 A;  1M1K T;  3NKY A;  2BE9 B;  4LF4 J;  4NLR A;  1BQX A;  1TVR B;  2X3G A;  2I6W A;  5KFB A;  2AYM A;  1SC6 A;  2IFX A;  5F41 A;  3PKY A;  4P2M A;  1RWO B;  3Q8S B;  2ZH1 A;  2QLJ B;  1HBO B;  2R7S A;  3O44 A;  3FKB A;  5IV4 A;  3QFH A;  1L3K A;  4GO5 X;  1YQH A;  2YWW A;  3PEH A;  4DV7 F;  4QBU A;  2E9T A;  2R8H A;  4V19 X;  4UUW A;  1BLU A;  1YSJ A;  2I5J B;  2VH7 A;  3AY0 A;  2ADB A;  2HYI B;  4ZIW A;  1FKO A;  1VOM A;  1KR4 A;  2YKA A;  3FSY A;  4M5D A;  3JTP A;  1GAO A;  4CM2 A;  2UXC J;  5F8I A;  4ZKA A;  4W90 B;  1GX5 A;  1LW2 A;  3KYL A;  3GJQ B;  2UUA J;  1X4D A;  2WSE C;  4WWS A;  1NAQ A;  4HL9 A;  4FVM A;  5DGB A;  5IM0 B;  1Q5Y A;  1U2C A;  4F4Z A;  3T5J A;  3KLG A;  1NDK A;  3DMJ B;  3MHY A;  2A0F B;  2HQD A;  3WIV A;  3CIZ A;  3H25 A;  3CCM S;  1UW9 A;  3KOA A;  3DLJ A;  4FKY A;  4HAC A;  2L9W A;  2IA0 A;  3TJ9 A;  4ZN3 A;  3BGO P;  2V8V A;  4TYA A;  1JB0 C;  3IO1 A;  4ZCL A;  1UP1 A;  5FDL B;  5KG6 A;  4ETX A;  4JI8 F;  4EEY A;  3BEG B;  2HVD A;  2PII A;  2ZD1 A;  3D0I E;  5IS2 A;  4EWT A;  2CG8 A;  2IYI A;  4KBI A;  2HPU A;  5B08 A;  3JSM B;  4P71 A;  2XY5 A;  1AUD A;  1T8E A;  5K14 B;  1VRU A;  2A10 A;  1CEZ A;  5CYM A;  2AJ4 A;  1SL0 A;  3OJU A;  3MUR P;  2UVU A;  3TWZ A;  3THP A;  2XC9 A;  4DS4 A;  3RAQ A;  2AZ3 A;  3FDS A;  3GR1 A;  3THT A;  2V8P A;  3D0H E;  4OQJ A;  1M5P C;  3MCM A;  2BRK A;  2ZWO A;  3CCT A;  3CJT A;  3GB0 A;  3J7A N;  3DRS B;  2PEH A;  3I32 A;  2XMK A;  4USJ C;  1RHU B;  1T02 A;  2U1A A;  5K14 A;  4J9N A;  1PYO B;  3Q83 A;  5IZH A;  4PEO A;  3J7Y U;  1YRU A;  2DHS A;  3KG4 A;  4PKD B;  3T1H F;  1JNR B;  1NPP A;  2H65 B;  2FDN A;  3FJ2 A;  2BZ2 A;  3N6M A;  2E44 A;  3GR0 A;  2UXC F;  4M5G A;  5MLC V;  5E3C A;  1XNQ F;  5D4L A;  1ZS6 A;  3TQE A;  4CLS A;  3O1L A;  4DX6 A;  4GKJ F;  5ETT A;  2E5G A;  3BYP A;  2B9E A;  2JFD A;  2FVP A;  4AYB D;  3K5M A;  1OQ6 A;  4QZV B;  1N5Y B;  1IM4 A;  4Y34 A;  1WEX A;  4RUH A;  5BR8 F;  2LEB A;  5A76 A;  2L41 A;  4AXI A;  2ZOM A;  4DSE A;  2PI5 A;  1S59 A;  4GVB A;  4DV4 J;  1R8H A;  2FJD B;  1FE4 A;  2C3P A;  1CC8 A;  1GMU A;  2W7A A;  2XMW A;  2Z30 B;  3B8H A;  2HAI A;  2FGO A;  4YB6 A;  2WAQ D;  5FD1 A;  5C42 A;  2CXE A;  1QTM A;  3CMQ A;  5C2C A;  3M30 B;  4OYB A;  3C14 A;  1RAF B;  4NLQ A;  5E3P A;  4WPA A;  4ECR A;  1S12 A;  1U2F A;  3W61 A;  7AT1 B;  4DF8 A;  3PHT A;  2FYX A;  4DDF A;  2HRU A;  3Q8P B;  4A8S A;  2ZE2 A;  1EJ7 L;  1PJ7 A;  3I4P A;  3TEG A;  4DU7 A;  3GFY A;  4RNH A;  4AL5 A;  4FYV B;  3KHL A;  4QWB A;  4JI4 F;  1OMS A;  1NCL A;  4XIU A;  1Y3J A;  2E1M C;  4F4W A;  1XMQ F;  5A2Q Y;  2YWK A;  2V8G A;  3GWC A;  1PO6 A;  1RIS A;  4OX7 A;  4JYA F;  2MZQ A;  1OIA A;  4ECU A;  3VWS A;  2E1P A;  2IMO A;  5HMW A;  3ETM A;  1MU2 A;  3PDN A;  3U7J A;  1DTT B;  2E9Z A;  3CJS A;  2HFU A;  1R0C B;  2HRT A;  1WC4 A;  3SQG A;  1RCX B;  4JV2 A;  3IXQ A;  3HVT B;  1GMW A;  4A48 A;  4WK3 A;  4LF9 J;  2DEJ A;  4USV A;  3LWL A;  2D3U A;  2K1R A;  3C19 A;  3DCA A;  4NCB A;  1UZD A;  4CDI A;  1TKZ B;  4TYB A;  2HBZ B;  4LSL A;  4DQP A;  1K0T A;  5KOX A;  3R5J B;  2PMH A;  4WFY A;  5LM7 E;  4ER8 A;  2Z56 B;  4WU3 A;  4R8U A;  1N36 J;  1FRI A;  2J6T A;  2PI4 A;  2WB1 D;  4K2J A;  2NZC A;  4Q5V A;  2WOM A;  1KBR A;  4C8N A;  5CYM B;  4NRU A;  3CB4 A;  3VHQ A;  4Q45 A;  4DR1 J;  3BJY A;  2E5L F;  2GVD A;  2WHO A;  1OJ4 A;  2O5D A;  3B78 A;  2V4R A;  4RL1 A;  4XDD A;  1S99 A;  4DZD A;  3TAP A;  3OXF A;  2J7W A;  2VHG A;  4B3S J;  1MMN A;  4DMZ A;  2YPZ A;  2KFN A;  4O3N A;  1NZA A;  2RQM A;  3ILJ A;  3UDC A;  3W64 A;  1S9E A;  1K1Q A;  1RWP B;  3MEC A;  4YN3 B;  1RYS A;  1NK0 A;  3MGJ A;  3DDI A;  4QR0 A;  1WEZ A;  6AT1 B;  4OHX A;  5HVH A;  4JUZ A;  2DO0 A;  1E6V A;  4DCP B;  2EFP A;  2H5E A;  2RDI A;  4QR1 A;  3D1Q A;  5F3Z A;  2HND B;  1X31 C;  2B4P A;  2ZC4 A;  2L3M A;  2POK A;  1U7L A;  4OHW A;  2YWF A;  1RT3 A;  2AWZ A;  3DXS X;  3I5B A;  1HAR A;  1TUW A;  3IM9 A;  2UU9 J;  4LF9 F;  2DEI A;  4TY8 A;  2CQB A;  4DL2 A;  1NJY A;  3I55 S;  4IDK B;  4Z2X A;  4DV1 J;  2L48 A;  3S7R A;  2KJW A;  4DR5 J;  2D74 B;  2P8I A;  2UUB F;  4MAK A;  4QIF A;  1T9X A;  4DSK A;  2OH2 A;  2V69 A;  2RT3 A;  3J81 Y;  1FNM A;  4OJG A;  1CJK B;  1Y3K A;  1T9U A;  2M4M A;  4DG1 B;  1HNI B;  2LYV A;  2UUA F;  1RBL A;  1RBO B;  2J8S A;  2DRB A;  3MM8 A;  1DZ5 A;  2JNJ A;  1JXE A;  2NSC A;  1S7H A;  3GJR B;  1JJC B;  5HMZ A;  4N56 A;  2JX2 A;  2DNL A;  4M5H A;  2JJ4 D;  4U7C A;  3TZY A;  4N77 A;  1WF1 A;  4QPT A;  3H5U A;  2FHJ D;  3K8V A;  3CJ2 A;  4AE5 A;  3H5Y A;  2C2E A;  3W7B A;  3ZZZ A;  2LCW A;  2CQD A;  2QN6 B;  2F65 A;  1UKU A;  4ZP8 A;  4EUV A;  2KKH A;  4Z7Y A;  5F8L A;  5EX3 A;  3CC4 S;  2RML A;  4LFB F;  2GO9 A;  2AJ2 A;  1Y7P A;  3HSG A;  1RKJ A;  2MKY A;  1XTZ A;  2E7X A;  3BM7 A;  4NLV A;  3L09 A;  2DH7 A;  3IBF B;  4JI1 J;  4PYA A;  1RYR A;  2ASD A;  1S1U B;  1H73 A;  1SBR A;  2LEP A;  2E66 A;  5E3Q A;  1VQ4 S;  4KTQ A;  1NK8 A;  4NLX A;  3AHP A;  3EGV A;  3SMZ A;  1N0U A;  3HFK A;  3UE2 A;  2KZZ A;  5A0Y A;  1UMJ A;  2NCK L;  3LGN A;  3KXD A;  3MAA B;  2LQ8 A;  1ZOT A;  4KPC A;  5J2N A;  3HMJ G;  2B6A A;  1KFS A;  2UUB J;  1N5V A;  3IFE A;  2B56 A;  4N7T A;  3TJ8 A;  1RTD A;  2QFI A;  3ISN D;  1YRT A;  2B8Q A;  4LQ9 A;  2VUG A;  4FZV A;  1VBK A;  4EBC A;  3PIO Q;  2RNE A;  2VKR A;  4R0E A;  3CD6 S;  4UST A;  3CMA S;  5IT9 Y;  1HPZ A;  4GRS A;  4IR9 A;  3BBF A;  3R2D J;  1RA7 A;  3ZTO A;  3KLF A;  3H40 A;  3DLL Q;  3OUY B;  3SQO P;  2VPY B;  1F9F A;  2AHO B;  3R5D A;  2AGP A;  2GFF A;  1BC6 A;  2E5J A;  1VQP S;  2QE5 A;  2B4O A;  2APO A;  2GGP A;  3HVW A;  2PSZ A;  2Z2M A;  3QYY A;  2JVO A;  3CD0 A;  4X64 F;  2GHW A;  2XWY A;  5AXN A;  5HLF B;  4NRT A;  3ZZ0 A;  4DPW A;  1WNE A;  1VFJ A;  4ED8 A;  3AA8 A;  2CKW A;  3KLI A;  2F63 A;  4J91 A;  3WC0 A;  3UQS A;  1FJC A;  1NDC A;  4L3K A;  4ZMM A;  2FJW A;  4LR9 A;  2ZHB A;  2HHW A;  4DU8 A;  1EKR A;  2LA4 A;  1HQU A;  3QLH A;  4RNO A;  3K5L A;  3LTO A;  2JRS A;  3MOZ A;  4ZVU B;  4OI6 A;  1R8B A;  3HHK A;  2L9N A;  3O6Q A;  5IWA F;  4LRE A;  3KHH A;  3DRR A;  3HX9 A;  3JQM A;  4IFV B;  4DV7 J;  1VQ7 S;  2CPD A;  2ZBQ A;  7FD1 A;  1DQ9 A;  1N8R T;  4DOZ A;  2NUU G;  4I7F B;  3SYZ A;  2PD1 A;  2C3Y A;  3AA9 A;  4PZV A;  1FJG F;  3A8E A;  3CJ4 A;  1SKW A;  4L73 A;  3R7S B;  4BHQ A;  1X4F A;  2ATL A;  2KVQ E;  1U1Q A;  3QO9 A;  2W9A A;  2R9L A;  1S0N A;  3PR4 A;  2B4V A;  2AYB A;  2N7Y A;  2HAF A;  1GXL A;  3M2U B;  3DLH A;  1HNX J;  4RUC A;  3MED A;  1S0V A;  2XO7 A;  4CIO A;  3P5B P;  3FBB A;  4USM A;  3UCG A;  4F25 A;  2UVV A;  4RZR A;  1SV5 B;  2OML A;  1PAU B;  4O3P A;  3CUL A;  4CLW A;  3DI6 B;  3BSC A;  4HHH A;  2QYG A;  2V4J B;  2VOD A;  1M1H A;  3R5C A;  4J9V A;  4C0H A;  5ETS A;  4IO9 Q;  1P1L A;  4BDP A;  2W8K A;  3ZTQ A;  1WSR A;  5HP1 B;  1J2V A;  2EBE A;  3V6J A;  1LV5 A;  1T7P A;  4IG3 B;  4NXM J;  4O4R A;  4QIV A;  2JLF A;  2U2F A;  1BQN A;  3EWG A;  2W24 A;  1PYT A;  3MR7 A;  4DL0 C;  4HKQ A;  3HPO A;  3CF5 Q;  2XNR A;  2EFV A;  4ILM A;  1M5S A;  1Q78 A;  4KH0 B;  4J9S A;  2VPZ B;  2XGP A;  4ED5 A;  1KVI A;  2IJF A;  3RAM A;  1RT4 A;  4NLP A;  4K0K F;  1E6V B;  3T3F A;  4OJ3 A;  1ZM4 A;  1Z2L A;  1BQN B;  2F5G A;  2M70 A;  2MB0 B;  2V5H G;  3BKT A;  3GII A;  1NKE A;  3VGU A;  1IWG A;  3JXO A;  1SUQ A;  4BBY A;  4NCG A;  1UJ5 A;  2YTC A;  1BGX T;  2Z4P A;  3GCX P;  4LFC F;  1RI7 A;  1FER A;  1KLM A;  2QL7 B;  2H4Y B;  1XMO J;  3EE3 A;  2I38 A;  3DLE A;  3UCZ P;  3OUY A;  3MM7 B;  1CG2 A;  3DKD A;  4M8L A;  2WVF A;  2FLL A;  1KVJ A;  4NLU A;  1J5E F;  2RKI B;  1TMJ A;  3D5M A;  3D66 A;  2HVE A;  2GHP A;  3NCQ A;  4EGL A;  4JI7 F;  4NML A;  3EZ5 A;  2CAJ A;  2D3O R;  1UL3 A;  4FN5 A;  2YKN B;  3VAM A;  1SJ3 P;  1MU2 B;  4K50 A;  1LWC A;  2BX6 A;  2O1P A;  5KFD A;  2GIF A;  2WBR A;  2H5J B;  5EGY A;  3TR5 A;  4WE1 B;  5JVG Q;  1SPB P;  5JJB A;  4CLT A;  3DHW C;  5BYR A;  2XM3 A;  2DR9 A;  4IRD A;  2NR0 A;  3QQC D;  1D9F A;  3OTC A;  1FT8 A;  2CPY A;  1ZTT A;  3PW5 A;  1D8Z A;  2EFN A;  3H7H B;  4LR8 A;  1S1V B;  1RTI B;  3H59 A;  2C2M B;  3M32 B;  4KR0 B;  1L3U A;  3NS7 B;  1VQ6 S;  3CCV S;  1SKR A;  3KJN B;  3QGG A;  3G8T A;  5C2G A;  4NI2 B;  2W1B A;  4K4Z A;  3WDO A;  1K73 T;  2JWN A;  4OZN A;  3EMT A;  4X4O A;  3AB4 B;  3LP1 B;  3ZO7 A;  2YQ3 A;  3LAN A;  3J7Y I;  4C9D A;  1CSJ A;  5FLX Y;  4RBT A;  2JEJ A;  1NM2 A;  4WTY A;  1W26 A;  3KK3 B;  1B0T A;  1SJ1 A;  2DNH A;  3HFZ B;  2IBK A;  1N4L A;  5SUH A;  2BQU A;  4B3T F;  3HT0 A;  4YUD A;  4M63 A;  2W2M P;  1IBL F;  3NEK A;  2OI2 A;  3PRD A;  2GJF A;  2CQ2 A;  2HGM A;  3VVU A;  5KFN A;  3DRY A;  1IBM J;  2Q66 A;  4B02 A;  2CQI A;  4DV6 F;  2CJB A;  4F2S A;  1FES A;  2VG6 B;  1URR A;  3DOL A;  1HA1 A;  1WHW A;  2KVI A;  4MJK A;  5E33 A;  4BC7 A;  2ZH9 A;  2YY3 A;  2W2O P;  3O2I A;  2F1F A;  2DRD A;  4IH6 A;  1NJX A;  4FF2 A;  5T14 A;  4OZ3 A;  2DNP A;  1JLF A;  2V6A A;  4KAI A;  1HMV A;  4OX6 A;  4I2P B;  2HLT A;  1Y5I B;  4OZ5 A;  3IN5 A;  2ZM6 J;  4FF4 A;  4IDK A;  2VQF J;  1DBD A;  3BR9 A;  4DLG A;  4DL5 A;  4JBC A;  3IAM 9;  4ZPD A;  2XZT B;  1FEE A;  3MM9 B;  2QA1 A;  4Q2M A;  5F8J A;  2RHQ B;  1FD8 A;  1HWK A;  1I94 F;  2I2Y A;  4USI A;  2GGP B;  4Q8E A;  1C4A A;  5F0U A;  1TUG B;  2KB2 A;  3ZXW A;  1VQ8 S;  1NPR A;  2HEK A;  5JXS A;  1RSC A;  3MUT P;  1N32 F;  3DM2 A;  4DPY A;  1RT7 B;  3IGV A;  4OYA A;  4EYI B;  1SI9 A;  3FK4 A;  3LAL A;  1ELO A;  1T9V A;  1TL1 B;  5AJ3 J;  2ZJQ Q;  3NGR A;  3QAU A;  2MKS A;  1VC0 A;  2HK3 A;  3QAE A;  2WON A;  5CCM A;  1ZAV A;  3L3C A;  3UDE A;  3OW2 R;  5LSL A;  1C1C A;  1FVS A;  2DNM A;  2QLB B;  3A1Y G;  3JSY A;  1SKU B;  4OX9 J;  2IM1 A;  3A8I A;  3TRG A;  1FJE B;  2BKN A;  3SDE A;  1OYD A;  1DHM A;  4C0O C;  4NLT A;  1TKZ A;  2XGQ A;  3LP1 A;  4B3M F;  4JI1 F;  1D09 B;  4WZQ A;  1FTC A;  3QT8 A;  2KT3 A;  4MIA A;  3AJ1 A;  4OYZ A;  2QL5 B;  2QA4 G;  1NHV A;  3DNC A;  2GA7 A;  4F0K A;  4DR5 F;  3IR5 B;  4IQM A;  2IVM A;  4DXL A;  4DZ6 A;  4X4V A;  5LMN J;  2BW7 A;  2KRB A;  1F5B A;  1YGY A;  3HD1 A;  4B9L A;  3GU0 A;  2UV8 A;  5FDL A;  4USK A;  1ZPW X;  4X65 J;  3CCR S;  1VQN S;  3CD7 A;  4N47 A;  5J1P A;  1DQ8 A;  2OPP A;  3SCK E;  2AQ4 A;  4LBP A;  3CME S;  5A0Y B;  3M2V A;  2BAB A;  2HLU A;  3NOG A;  2V2Q A;  4IOA Q;  2BJ7 A;  2QMW A;  5GVQ A;  2OEJ A;  2O66 A;  1S9E B;  4PR6 A;  4D3H A;  4C98 A;  1J27 A;  2CAD A;  3NGD A;  1DFD A;  3I5A A;  1JLC A;  1AW0 A;  4Y2M A;  5KFS A;  1XIQ A;  1U45 A;  3C46 A;  3PFO A;  3TUZ C;  1RTZ A;  3NY0 A;  3GIL A;  3HO1 A;  4USH A;  4PG8 A;  1HPZ B;  2FY8 A;  3OFG A;  2LP4 A;  2MQN A;  4PPZ A;  3R9L A;  3BSN A;  3LF0 A;  2ZH5 A;  3V81 A;  5KTQ A;  2WOM B;  1MNE A;  5F8M A;  1WSV A;  2CQH A;  4J5O A;  5KFH A;  3DOK B;  4ITS A;  4LIR A;  2HVI A;  5HL7 Q;  1OO0 B;  3PRV A;  6FDR A;  2KXN B;  1MML A;  1TL7 A;  4NCA A;  2WVD A;  1KS2 A;  2Y1R I;  1NSP A;  3DLG A;  3VZH A;  1X0P A;  2XUL A;  3BBC A;  1UJ4 A;  3DHX A;  5H9E J;  1N34 F;  4I68 A;  3W3S A;  3FZ2 A;  2LA6 A;  2J9E A;  4DCO B;  4PAB A;  4K4V A;  3DLK A;  3M8R A;  2ZOF A;  1RKI A;  4K4S A;  3C16 B;  2EC2 A;  2YKQ A;  2DPI A;  3P49 B;  3MTK A;  2P6S A;  3HFV A;  3OL8 A;  2V9W A;  4WII A;  2OPR A;  3QSI A;  4FPR A;  4P73 A;  3UD4 P;  2HND A;  3LO3 A;  4OV6 A;  2EVZ A;  3EPG A;  5D3G B;  4CLL A;  1NK9 A;  4AND A;  3PG9 A;  3K7R A;  3MR3 A;  2MKJ A;  5AE2 A;  1RB0 A;  2EWH A;  5B0C A;  3CPW R;  2AP6 A;  1Y00 A;  2VBY A;  4LIW A;  2HUR A;  4B9U A;  2CJY B;  3OTD A;  4ZJO A;  1PSD A;  2K3I A;  4EO6 A;  3WBZ A;  1LW2 B;  1L3V A;  4PQU A;  3C8Y A;  2RS8 A;  1U8W A;  2QYC A;  3N9U C;  3ELH A;  3VR1 A;  1QVF R;  4C4W A;  3I56 S;  1ZZN A;  2DGW A;  1REV A;  3TUJ C;  4UT4 A;  2N82 B;  2RRB A;  3FRY A;  3UVJ B;  2YNI B;  3TI0 A;  1XMQ J;  2DHA A;  2ZJR Q;  3IGN A;  4G1P A;  2HW3 A;  1X4A A;  5KFG A;  4ES3 A;  3BKU A;  4ZCI A;  3MED B;  5L38 A;  4WXW A;  2WSF C;  1KQG B;  3CJ0 A;  2DR8 A;  3SDE B;  2CQP A;  1UPM B;  2DKO B;  1Q7Y T;  3PFE A;  3QT6 A;  1TK8 A;  4KHP J;  2DR5 A;  2R2R A;  3CDW A;  3RW7 A;  1X9W A;  2R8J A;  1U26 A;  3IWL A;  4KH1 B;  4WYW A;  1WC6 A;  4IO1 A;  4CH7 A;  4Y2I A;  8RUC A;  2HHT A;  1YDL A;  1FD2 A;  4K4T A;  1F2H A;  2LQ9 A;  3PO4 A;  2KYX A;  3HVR A;  1FJG J;  1KN6 A;  2K8G A;  1FHT A;  5IOL A;  2HZC A;  3BPS P;  5CD4 H;  4JI6 J;  1IBK F;  5D8H B;  3QZ8 A;  4FXD A;  1AB8 A;  2IAJ B;  4GC7 A;  1S76 D;  2XZD B;  1C0U B;  4A8Y A;  3NCR A;  2ILZ A;  3D67 A;  1B99 A;  1VQM S;  2OO4 A;  1YLX A;  3QJJ A;  3MFI A;  2YWG A;  2IM3 A;  1SC3 B;  3FVY A;  2VL1 A;  4HT5 A;  1U1L A;  3J81 j;  1Q8L A;  2J0Q D;  1SXL A;  1I51 B;  2HFZ A;  4ZP7 A;  3D2W A;  2E29 A;  3H4D A;  1FDN A;  2DGQ A;  1FXR A;  4C97 A;  5DDQ C;  5D6G A;  3NWG A;  4PUO B;  1FWP A;  1R6V A;  3SIP B;  4EU0 A;  1RU1 A;  5DQI A;  2GW8 A;  5KFY A;  2FJV A;  3C6T A;  1RAG B;  3IRX A;  3E51 A;  4UUX A;  2GC8 A;  1XC9 A;  3G4S S;  1EIY B;  2Z58 B;  1GH8 A;  3MM7 A;  2MDA A;  1Q82 T;  3UNG C;  4S0M A;  5C42 B;  3IBW A;  4ZLL A;  4IOC Q;  4OFZ A;  3LGM A;  2MXY A;  4B9T A;  4LRA A;  4H4K A;  1O0P A;  2DNZ A;  2GS8 A;  1IJE B;  1OY6 A;  4JOU A;  2VBX A;  2OFH X;  3TAN A;  1SL1 A;  3D54 A;  1W2B R;  4F7V A;  2XB2 D;  2MQO A;  3SCI E;  1B3T A;  4K0K J;  4RW9 B;  1RHJ B;  4R0J A;  1T9Y A;  2DGU A;  1EP4 A;  2NSB A;  1VLO A;  2YKM A;  2ZD1 B;  3TZW A;  2OAU A;  1RTI A;  3GYG A;  3N6N A;  5DM6 Q;  4K59 A;  3RB4 A;  3VAI A;  3M6X A;  3GON A;  3O3L A;  2ZH8 A;  4ICL A;  1GFW B;  2MZT A;  2Z0G A;  4PAA A;  4RW9 A;  3QNW B;  5EDW A;  3A8K A;  2MKI A;  4OLP A;  1E6Y B;  3N28 A;  4NL5 A;  2VDH A;  2PFF B;  1RCO B;  3I9V 9;  3MF5 A;  1NSK L;  1F5A A;  2XQC A;  2HHQ A;  1NXI A;  3EYZ A;  1D9D A;  2IMW P;  4GC6 A;  1IQZ A;  3BH6 B;  2B0G A;  2I1R A;  3N0V A;  2B7B B;  1SQF A;  4NYZ A;  3BN7 A;  4GKK J;  4ECY A;  2MZR A;  4I67 A;  1VS3 A;  1F60 B;  4YY3 F;  1FRK A;  1BWV A;  1WF0 A;  4B17 A;  1RU2 A;  2G0J A;  1IKX A;  4ECQ A;  2XS7 A;  1YZ6 A;  1Q8I A;  4R5P B;  1TL3 A;  3V6D B;  2DD8 S;  3OFF A;  3NP5 A;  1T3O A;  3HJF A;  1S9G B;  5LMU F;  4CTA A;  3OVS A;  3CCL S;  2PT0 A;  2CDR B;  2OHD A;  1N5Y A;  1UVL A;  1UVM A;  1WOS A;  3SXL A;  2E7W A;  2PA8 D;  1XK8 A;  3ITH A;  1PKU A;  4YR2 A;  3T1H J;  2ERR A;  2GO8 A;  5I3Q A;  3T1Y F;  2HFO A;  3S8S A;  5A6W A;  3ZFV A;  2J76 E;  3ENV A;  4BWM A;  4DCJ B;  2M8D B;  2EG2 A;  3AD7 C;  4FYW B;  5E7O B;  4PG5 A;  1W2I A;  1U02 A;  4KSE B;  4QOT A;  4XDC A;  3BV8 A;  2NYI A;  3W65 A;  5I3U B;  1BD6 A;  3D6F B;  4DQS A;  4MKA A;  5ETK A;  2R2U A;  3G6V A;  2BW2 A;  2MST A;  1HQ2 A;  5BJR A;  2G1D A;  4B9S A;  4ZJQ A;  3OFH A;  5GAE I;  1Q95 G;  3W5X A;  2HQ3 A;  3J81 U;  4XTT A;  4YME A;  5LOQ A;  1UA0 A;  4G3I A;  2QL9 B;  3BGU A;  1U1P A;  2J9D A;  3JSB A;  4K5S A;  5M2R A;  5GAG U;  3FFI B;  3PV8 A;  2R7U A;  2HFN A;  1CJU B;  1TKX B;  3A13 A;  1OS5 A;  1REV B;  4LSZ B;  4YDD B;  4HYK A;  1N48 A;  2JEI A;  2QGF B;  4CLF A;  1Q86 T;  1MLA A;  5K20 B;  3LOU A;  4L6V 3;  3Q2T C;  3VVT A;  4QR2 A;  2HFS A;  5CQG A;  3P45 B;  2UXB F;  1CBK A;  2R42 A;  1RHR B;  1TKD A;  3EXC X;  2W25 A;  3D9B A;  1X4C A;  3L7O A;  1IBK J;  2HSE B;  1F3F A;  3ONQ A;  1N6Q A;  3QRQ A;  1WD6 A;  2EXU A;  5HI7 A;  2RJZ A;  3MMA B;  5AT1 B;  4KJI A;  4KGZ B;  4H4M A;  1SC4 B;  3GE9 A;  4ED2 A;  1LKZ A;  3AJD A;  4KHP F;  2H3E B;  3EDR B;  2R7Q A;  4TN2 A;  4MKB A;  4QYR A;  5HSP A;  1YJU A;  4ATN A;  1WAC A;  3C2P A;  1T9T A;  1QAY A;  2BE2 B;  4UY8 5;  1UVI A;  1H7W A;  2HBY B;  1RT6 A;  2VG5 A;  2W2Q P;  4WJB A;  3R97 A;  1JXV A;  1X9S A;  3GP9 A;  1S6U A;  1CVJ A;  3GYN A;  5DET A;  1QDU B;  1WDD A;  1NB7 A;  4IH7 A;  4JB8 B;  3TZX A;  1T05 B;  3R2C J;  2GMJ A;  4DPX A;  1WC3 A;  2YBV A;  3EXY A;  3K5O A;  2VA2 A;  2OSR A;  3K57 A;  3ZTS A;  3IMQ J;  4AL7 A;  4DFM A;  2KJV A;  3PW2 A;  2DCL A;  1UFL A;  3H42 A;  2VAS A;  3C14 B;  2KN4 A;  2LQB A;  4TQR A;  3IS9 A;  1RAO A;  2V9K A;  2WK4 A;  2P9G A;  4U67 Q;  3T19 A;  1S6Q A;  3HSJ A;  1HI0 P;  5BXI A;  2HMI B;  2FC8 A;  4NWB A;  1HI8 A;  4ANE A;  2MGZ B;  2BUN A;  1C1B B;  2W4C A;  3MEE B;  4NOH A;  2C22 A;  4RX6 A;  1P27 B;  3M9M B;  3CCE S;  4LF6 J;  2HBQ B;  4LF1 A;  3V81 B;  4JI0 J;  4I0W A;  3HCX A;  3TAQ A;  1HMV B;  1NJI T;  1NHU A;  4OYO A;  2MKK A;  3ENQ A;  1R6Y A;  5CYQ A;  3IM8 A;  4RNF A;  1G4C A;  3NBP A;  3PTW A;  3IP0 A;  3M6W A;  4OYW A;  4ZIV A;  1RJJ A;  5A8W B;  3T5L A;  4DR4 F;  2CUY A;  2QO3 A;  3H4B A;  3K5N A;  3PJX A;  3N6L A;  2N4C A;  3OV7 A;  2FZC B;  3CDU A;  3FZB A;  3UR0 A;  2V68 A;  3DRP A;  3M1V B;  1R31 A;  2WW8 A;  3MZI A;  1X4G A;  4IFY B;  4DV2 F;  4O3S A;  1JJH A;  2A2D A;  1HWI A;  1C0T B;  1R3N A;  2AW0 A;  3ENA A;  2MTL A;  3W9H A;  8AT1 B;  5H9E K;  4LF7 F;  5D3G A;  1KD1 T;  4FXW A;  4OYM A;  2VD3 A;  2G2Y A;  1Q0N A;  5IC4 B;  5HBM B;  2N7C A;  3G96 A;  3V6H A;  3C3L A;  1XNQ J;  3OVB A;  4GKJ J;  5CD4 A;  1HNW J;  2RS2 A;  1IBL J;  4X66 F;  1ACM B;  1PC5 A;  2IC3 B;  3EJM A;  4LSN A;  5HQL A;  4I2Q B;  2W9B B;  2OTL S;  3RJM B;  5T41 A;  3JSM A;  4ENO A;  3QJP A;  1LXJ A;  2ZFH A;  3M2U A;  1A7G E;  4O3O A;  3BZQ A;  3BYR A;  4X4T A;  3L9Z A;  5HBM A;  3G9C A;  1CJV B;  3PYG A;  4Y2K A;  4DR6 F;  5D78 A;  3C15 A;  1A6L A;  4ZLN A;  2OD4 A;  2ZH3 A;  1W7W A;  2VF3 A;  3MPV A;  3D6M B;  1TEL A;  1TKT A;  2OPP B;  5LL6 d;  5LJ3 Y;  3B6B A;  4CM0 A;  2FJB B;  1QAI A;  2HWH A;  2XSJ B;  2KH9 A;  2XMJ A;  5DG7 A;  3T1Y J;  3K2Y A;  3FCV A;  1HWJ A;  4WF9 Q;  5KFF A;  3UD5 A;  3AAW B;  1V9O A;  1YBU A;  3DLK B;  5SZT A;  1TKT B;  1S72 S;  5AXL A;  4DI6 A;  3LP0 A;  5B7W A;  1U8S A;  3JQJ A;  5KFP A;  1T05 A;  5DS7 A;  1ZM2 A;  4HTJ A;  5A6P A;  4ETZ A;  2AD9 A;  2ALZ A;  1ZH5 A;  1TAU A;  3VAF A;  1FE0 A;  3D6T B;  5HQ8 A;  4K8R A;  3US5 A;  1N88 A;  2RRN A;  1S6Q B;  3DRX A;  4ZPA A;  4F4K A;  2PFD A;  3N01 A;  4WYL A;  3IS9 B;  2Z2Z A;  1KON A;  4UW2 A;  2UXD F;  2P5V A;  4A8W A;  4ANC A;  2UXD J;  2CQC A;  3K5P A;  4L72 B;  1AFJ A;  1IKV B;  3HJV A;  5J2M A;  4X4Q A;  3HLU A;  1PC4 A;  1R8A A;  2VDI A;  4UY8 T;  4Z7C A;  5GAH I;  4X4P A;  1A0O B;  2HNY A;  5L1J A;  1NU4 A;  1U6F A;  2GQ2 A;  2IRX A;  3FSX A;  5E2Q A;  4WFX A;  5MAO A;  1VJW A;  4DFJ A;  3FRZ A;  3CJ5 A;  2ABY A;  1Y9O A;  4I6A A;  1TL1 A;  2MLX A;  3A12 A;  4KHM A;  2VV5 A;  3JAM U;  2XYG B;  3B82 A;  2RU9 A;  4C3L A;  1WJ9 A;  2A18 A;  4ECZ A;  1FDD A;  4ICL B;  4DQR A;  3NGS A;  3QWP A;  1YBT A;  2B5J B;  5J1N A;  4J9Q A;  4F26 A;  1IR0 A;  3PJW A;  4KRW A;  3MMB A;  2ZHO A;  4A47 A;  4CO5 A;  4ELT A;  3HSZ A;  3TUI C;  2BJ1 A;  3DLB A;  2J5A A;  2H5I B;  4RBV A;  3HHL D;  2ZKU A;  3N4W A;  1WDT A;  3FMB A;  3LWM A;  4ILL A;  4ECS A;  2D9O A;  1RWV B;  2D1C A;  1LOU A;  5KT3 A;  5IT0 A;  1WKK A;  1HNZ J;  1ZAX A;  1V5I B;  1HQE A;  2M52 A;  4NAS A;  3EVO A;  3MTJ A;  3OXL A;  1DAX A;  2I8E A;  4QIG A;  1KEK A;  3F73 A;  1QVG R;  1N5T A;  4N8O A;  3RBZ A;  4AQY J;  2J7K A;  2FUG 9;  1RLD A;  7FDR A;  4LBI A;  2RQC A;  2AU0 A;  2DH8 A;  1H6K X;  4MKY A;  4URQ U;  1UVJ A;  1OY8 A;  3HSD A;  3ZZT A;  3TOQ A;  3J7Z 5;  3CJ3 A;  2FB0 A;  4K4U A;  3M7V A;  4RLE A;  1FWK A;  3IA0 A;  2P9C A;  1IVZ A;  4A8K A;  1EQM A;  1SH0 A;  1GMW D;  4JI3 J;  2X3D A;  5CA5 A;  2ZZN A;  4A8X A;  1VK3 A;  5K8M A;  1IM6 A;  3BO3 A;  3QPI A;  2RB7 A;  2VFV A;  3CT9 A;  2AF6 A;  3NWR A;  4ID5 B;  3V4M A;  5DG9 A;  2JHE A;  3PX4 A;  1M0S A;  1D0E A;  2ZNZ A;  3E01 B;  3GPA A;  5KFV A;  5F8G A;  4RW8 A;  5ETR A;  4F0M A;  4A8Q A;  1F9E B;  2Q1L A;  1X5T A;  2G1H A;  2W7P A;  1FDB A;  4CI0 B;  3F56 A;  4ZPC A;  2IM2 A;  4H54 A;  4YY3 J;  2MGZ A;  2EK6 A;  3OFE A;  2GHV C;  4ZP9 A;  4DBQ A;  1SH3 A;  4N76 A;  1JLQ A;  4K4W A;  5A8K A;  3NMR A;  4TLQ A;  1LWE A;  3KG1 A;  4WBF A;  3MFH A;  4NEY A;  4PXB A;  1CLF A;  4PG6 A;  2JC0 A;  3UWT A;  2HHP A;  4ZLP A;  2XCA A;  1JLB B;  2ZBC A;  5HVF A;  2BOP A;  1K0V A;  2OUG A;  1FXL A;  3MCO A;  4LFB J;  1HYS A;  2AMC B;  4LF4 F;  2MKH A;  5J1E B;  2KU7 A;  2YKN A;  3QFW A;  4C0B A;  4I64 A;  4KB7 A;  1ZA1 B;  4X84 A;  3G86 A;  2KRR A;  1E6Y A;  1NSA A;  2LU1 A;  1JJ4 A;  3HI9 A;  3JS9 A;  3SSS A;  3IG1 B;  2DY1 A;  1V3S A;  2HZA A;  1X5P A;  2IDL A;  1EAR A;  4LFA J;  3R5B A;  3D3B J;  3J80 U;  4LFA F;  5K9F A;  3DLE B;  5BYS A;  2RDJ A;  1WKJ A;  1S49 A;  1Y5N B;  3HP6 A;  4FNH A;  1S1V A;  3LH2 S;  4QU6 A;  5KT5 A;  1KSP A;  2UVR A;  2MLZ A;  3O8W A;  9ATC B;  1N0V C;  4QIE A;  1PBA A;  3LW5 C;  1XN9 A;  1R27 B;  1UEU A;  5RUB A;  1JLE A;  4U7U D;  1QE1 A;  3RU0 A;  1FJ7 A;  2QA2 A;  3W63 A;  1Y5L B;  2FPH X;  2ILY A;  2JZ5 A;  4DX5 A;  4ZJL A;  1LWC B;  4RW7 B;  5CYJ A;  2CPF A;  2W2N P;  2BXJ A;  4ZVR B;  3TUP A;  4DR3 J;  4FS1 A;  1NLK L;  1HNV B;  1R0A A;  3G82 B;  3QIP A;  1UA1 A;  2DNQ A;  3P6Y C;  3W8G A;  2KM8 C;  2ZZT A;  3LAM A;  4QWA A;  1Q4R A;  4DPO A;  2HNZ B;  2XG8 A;  1RUS A;  3KMQ A;  2LXF A;  2ASL A;  2D9P A;  2XYH B;  4JI2 F;  2HS3 A;  3T5K A;  1IWA A;  2ROE A;  3OT9 A;  2KZM A;  2YNG B;  2YNF A;  4XPC A;  2LXI A;  4O3Q A;  1IKY B;  4FKX A;  2CNN B;  3PW4 A;  2CPZ A;  2RU3 A;  3FC9 A;  2ASY A;  3BGR B;  3SCJ E;  1WEY A;  2F8M A;  5IWA J;  3LP0 B;  4ED3 A;  2HHS A;  1B64 A;  1RAA B;  4DQQ A;  1X0F A;  3SV4 A;  4Q8F A;  2OGU A;  2CFX A;  5CCL A;  1KP6 A;  2ZVS A;  2KG1 A;  3IWN C;  3BDE A;  1X5O A;  3I96 A;  2XMM A;  4PXE A;  1HNZ F;  3J7A 1;  2IRU A;  2QX0 A;  1RT3 B;  1NSQ A;  4A8O A;  3NRB A;  2C1E B;  1K9M T;  1RLC L;  2H1Y A;  3CDB A;  2O01 C;  2ZVI A;  2NPI A;  3ICL A;  5CYQ B;  3M9O B;  2CJK A;  1DUR A;  2PMZ D;  4W4M A;  4P72 A;  3S1T A;  5J2Q A;  4RUA A;  2R7V A;  1TMM A;  5EUH A;  4LMZ A;  3OTO J;  2HQG A;  2CNO B;  3D6H B;  1UZH A;  4MK8 A;  4W98 A;  4E98 A;  3QRP A;  2VJV A;  2A2C A;  4C48 A;  3CO9 A;  2V2V A;  2HNY B;  3MPD A;  5KFA A;  4ALZ A;  3CC2 S;  4JV0 A;  3OBI A;  3MMC B;  5LMU J;  4DL6 A;  2Y8W A;  1NDL A;  2C3M A;  1QJH A;  3IC1 A;  4J9R A;  3UCU P;  3U27 A;  4NA3 A;  4NXM F;  2E9R X;  4G1Q A;  2OD6 A;  5DQG A;  3EPI A;  1X4H A;  4AXJ A;  2F7V A;  2DIV A;  4M5L A;  1QAX A;  4DV3 F;  1N33 F;  2QLW A;  3DDK A;  2AJQ A;  1CJV A;  1HHS A;  4PG4 A;  4RU2 A;  4ECT A;  3K58 A;  4LSL B;  4P74 A;  3E2E A;  3BGL A;  3D7S B;  1Z4U A;  4OJ1 A;  4FXV A;  4U7U K;  1HL6 A;  3B4D A;  3M8Q B;  1B4S A;  2PEB A;  4WP3 A;  2ZJP Q;  5EWE A;  1HNI A;  1WUU A;  1NKC A;  2VKZ G;  2MQL A;  4DPT A;  2JFK A;  3BBB A;  4HH0 A;  1BY9 A;  4WXO A;  4YP3 A;  1GXU A;  1WC1 A;  1SVD A;  3D28 A;  3L7U A;  3POT B;  4TQS A;  3OSN A;  3MUV P;  1KLN A;  1N6Q B;  4CLP A;  1KC8 T;  3GJS B;  1OPZ A;  3E3X A;  4H4O A;  4RW7 A;  1N56 A;  4CYU A;  5HRO B;  4LF2 A;  4DLE A;  2K1R B;  3VQS A;  4ED7 A;  4RPF A;  2UVW A;  4K7Q A;  1M5K C;  4B3R F;  1EKS A;  1FRJ A;  2IIH A;  4NLS A;  3IBC B;  5KFE A;  1TL3 B;  3POT A;  2XY7 A;  4WP8 A;  1WG5 A;  2CQG A;  4EBD A;  4KE5 A;  3GIR A;  3SCL E;  1FFS B;  2ATC B;  2ZDO A;  3OD2 A;  3ULH A;  5IXU A;  3TVK A;  4JI2 J;  4HI2 A;  4UOF A;  2OIH A;  1QM9 A;  1RWX B;  1D8Y A;  1GTH A;  2E5I A;  1LFP A;  1RWK B;  2RUS A;  5GAH U;  3OHA A;  3HT3 A;  5F3T A;  1LEO A;  1PIL A;  3BGR A;  4ZVH A;  3SFU A;  5EWG A;  2M8H A;  4NLO A;  1B0V A;  5T7L B;  3PAC A;  1MSW D;  2CDQ A;  1MN9 A;  3PNI A;  2ZH6 A;  2H48 B;  2HWI A;  2B6A B;  1VBX A;  1KNZ A;  2H51 B;  2KFY A;  4DPU A;  2OJ3 A;  2G2O A;  4DWI A;  4DX8 H;  3MM5 B;  2ZHA A;  5H9F J;  3CGI A;  1O5J A;  1T11 A;  2KO1 A;  3TAR A;  5ETO A;  1X9M A;  2G2Z A;  3I0R B;  4FPI A;  1YKW A;  2J6U A;  2B9Y A;  2YKM B;  3H2L A;  4ILR A;  2C2D A;  3M2R A;  4M5M A;  1Q5V A;  1RTJ A;  4BCA A;  1EP4 B;  3X1L B;  1N5Q A;  1RAI B;  1WHY A;  4ZPW R;  2KDO A;  4KGV B;  2UUC F;  1JLA B;  3W2W A;  1EET A;  5IM0 A;  4MTP A;  3VV2 B;  1DLO A;  2DNG A;  1WHX A;  4DR2 J;  4DS5 A;  2XHC A;  4KPY A;  4I6W A;  3SFG A;  1XER A;  2AKW B;  2J0X A;  2D7S A;  3EGZ A;  1AZS B;  2NXC A;  1SQE A;  2QMX A;  3W2V B;  3KLV A;  4ZVG A;  5L1L A;  4IRK A;  5EX0 A;  2HHX A;  1FX2 A;  4IOB A;  4JP8 A;  2DHX A;  2F4V J;  2DIU A;  3LP2 B;  4MT1 A;  3KK2 B;  1IKW A;  1Z1Z A;  2GVD B;  3HHD A;  3CC7 S;  4XO0 A;  1LXN A;  4O0N A;  3HM9 A;  5KT6 A;  1YJW S;  4IG0 B;  2XWX A;  3NGU A;  4C7Q A;  4MK7 A;  3PY8 A;  1I5O B;  2GML A;  2MQQ A;  4P75 A;  4DV3 J;  1QAJ A;  3IR6 B;  1N33 J;  3KNA A;  2MZS A;  1AZS A;  3W2V A;  3QIP B;  4QCL A;  4TNO A;  4OZ0 A;  4DR3 F;  1S97 A;  1YJR A;  2QSF A;  3UDV A;  1IKX B;  1HIY A;  1RHQ B;  1U09 A;  2DGS A;  2KL8 A;  2RQK A;  3DOK A;  2HIY A;  4OI3 A;  5J2N B;  4ZOS A;  2YNF B;  4ZVS B;  5L46 A;  5C5J A;  3GQC A;  2C2K B;  3N5F A;  4JI4 J;  3HXM A;  1NBE B;  1WOO A;  2HK2 A;  3EM1 A;  3BO4 A;  3NGT A;  3VF0 B;  4D3G A;  1DTQ B;  1WG1 A;  3M8P B;  2PMW A;  4HHJ A;  5HJY A;  2FTR A;  2WBM A;  4L74 A;  5KT4 A;  1JLC B;  4TXS A;  5I4M A;  2Y8Y A;  3ZNU A;  2AX1 A;  1JLQ B;  2KHD A;  5IT4 A;  3SEO A;  1HR0 F;  1U6B A;  2HQC A;  3GMG A;  1FX4 A;  3MR2 A;  2GNK A;  2AEF A;  3MI7 X;  1VBY A;  4YB7 A;  2RHS B;  3RBD A;  4KFB A;  3V2U C;  1U0H B;  3K0J A;  2QT7 A;  2Z8Q A;  2AGO A;  2A3J A;  4RW4 A;  3ETO A;  4LBH A;  4M1K A;  4J9K A;  3RB0 A;  3GCW P;  3HZE A;  4NZ7 A;  3W8P A;  2N3L A;  1Q8K A;  4F3M A;  5KG7 A;  5BR8 J;  2Y9H A;  4GO7 X;  5J1E A;  1LW0 B;  2JVR A;  2NXJ A;  3CNQ P;  4C8O A;  2LDY A;  2XEX A;  4RO0 A;  4PYD A;  1R8P A;  2VQE F;  1EQ0 A;  1OWX A;  1AFI A;  3ENW A;  2WTF A;  1ZAW A;  3AXM A;  3VGS A;  5KFL A;  1GK8 A;  2V8H A;  1RT7 A;  4P9S A;  3ZZP A;  1RBA A;  3VAK A;  2MQM A;  2YKO A;  2L9D A;  4DV0 F;  4OHZ A;  2AV5 A;  2KFZ A;  3SBM A;  1RWM B;  2XHW A;  3CJQ A;  3P96 A;  4MKV A;  5A8K B;  2AZ1 A;  3TX8 A;  2CWK A;  2F40 A;  3H90 A;  4G65 A;  1G1X A;  3VAJ A;  2M5Y A;  1R0B G;  3RBE A;  2CNK B;  2R2S A;  2BR0 A;  1VQK S;  3MD3 A;  2FY1 A;  1SJ4 P;  4Q44 A;  4F04 B;  4IG0 A;  3KUG A;  1JLB A;  4U96 A;  4G1Q B;  2X1A A;  3RR7 A;  1LK7 A;  1LWX A;  3T6J A;  3OR1 A;  1BHN A;  3GSD A;  3ISZ A;  2GJ2 A;  3GV5 B;  3SQG B;  1MMD A;  3MAQ A;  1FKO B;  4OI1 A;  5B0D A;  3UDL A;  1SB6 A;  4ZIT A;  2XBP A;  4K5R A;  3MMB B;  4PPD A;  3HVA A;  1FNX H;  3GG1 A;  3V6K A;  2ASJ A;  2B51 A;  2E7V A;  4YFU A;  4ZDN A;  1RGV A;  3GIK A;  1LNQ A;  1XR5 A;  4OI4 A;  4WFZ A;  3PVX A;  5FJ4 A;  4O3R A;  4HHU A;  2V2Z A;  2YH0 A;  3M8Z A;  1HBU B;  3M05 A;  4DN9 A;  4USW A;  2KG0 A;  4X64 J;  2Z57 B;  3P8B B;  4R5P A;  4JI8 J;  1NUE A;  1QTN B;  1FCA A;  1JLG B;  1S1W A;  1S4E A;  1SQG A;  2PN6 A;  4OMF G;  4ED4 A;  4ZPT R;  1CUL B;  5D0R A;  1XNR J;  1HQE B;  3CWJ A;  4NMX A;  5DDO C;  2MSS A;  3AH6 A;  3A8J A;  4C11 B;  4B9M A;  3DU6 A;  1RWN B;  2W7O A;  4TKT A;  2E1A A;  3MEK A;  4WK1 A;  1U1K A;  3PYF A;  5C24 B;  4ZLJ A;  5DLG A;  4AD6 A;  1S5Z A;  1VJQ A;  3HD2 A;  4Y3C A;  4QU7 A;  3NLC A;  3RRH A;  3FMW A;  3DYA A;  2WVC A;  2FHJ A;  2VC1 A;  3MR6 A;  3QT5 A;  2XLJ A;  3NOC A;  4EBE A;  4RWX A;  4CO4 A;  5KOW A;  5HMY A;  4PRF A;  2VG7 A;  3PEJ A;  3F41 A;  4KGK A;  1RAH B;  3KLE A;  3AQP A;  3TW0 A;  2WVB A;  2GVZ B;  3EVW A;  2C3O A;  3BO2 A;  2RH3 A;  4F02 A;  5J2P A;  3L95 X;  4F4X A;  1PCA A;  3GJT B;  4ED0 A;  1X8D A;  1Q8B A;  3PX0 A;  1MWZ A;  4PUO A;  2EC0 A;  2A1B A;  2RF2 B;  4UOH A;  3TEH B;  1T3N A;  4WCE Q;  3NNA A;  3MWB A;  4XAK A;  3GV8 B;  4DR2 F;  1AA1 B;  2JOQ A;  3VTI A;  1HBO A;  3I0S A;  4DV6 J;  1L3T A;  5KFR A;  5KG0 A;  3M2R B;  2LXU A;  3M8W A;  2V63 A;  3MPU B;  4W92 B;  3VAG A;  4B08 A;  2YNH B;  1PYS B;  4G6V B;  4DUY F;  1XR7 A;  2NYH A;  5K8N A;  4C8Z A;  2YXL A;  1VIX A;  2VZ9 A;  1LWF A;  2O67 A;  4Y2C A;  3TZZ A;  3CJR A;  1RAC B;  1V3Z A;  2J0W A;  1UFK A;  4PWU A;  2KXH A;  3TA0 A;  2PO4 A;  2Y1L B;  3Q8R B;  1IR2 A;  5HQM A;  4A8M P;  1UPP A;  3CDE A;  1Z2Z A;  4A4J A;  4E8U A;  3CCS S;  3AOC A;  1M1G A;  1NEE A;  4U95 A;  1PIE A;  1UAW A;  2MQ8 A;  2YNH A;  1VHI A;  4O4G A;  4P2F A;  1VC5 A;  4XK8 C;  2K7J A;  5GMD A;  1S6P B;  5L9X A;  2WON B;  2DYA A;  2BV3 A;  5B09 A;  2W9C B;  1Q1K A;  1RAE B;  1RT6 B;  3HHL B;  2HHH J;  3MXH P;  2ZM6 F;  1NK4 A;  1RWU A;  2VBW A;  2ZBP A;  5HRO A;  2BVZ A;  4Y65 A;  1HLW A;  4HI1 A;  4ZPV R;  1ARO P;  1CS4 A;  3RBX A;  2DBB A;  3C15 B;  1EZZ B;  1A9N B;  4J9P A;  3A4T A;  1QD1 A;  3I82 A;  5HJX A;  3TVZ A;  4K4Y A;  1S1U A;  1DAR A;  1G6B A;  1HBN A;  3IWX A;  4CNZ A;  3MPW A;  2G4B A;  2VG6 A;  3DOL B;  5LXY A;  1C4C A;  2ZUA A;  4UOC A;  2LMI A;  1K44 A;  4LVO P;  4I6Y A;  2IJR A;  5DRK A;  1YBA A;  1RT2 B;  4JI7 J;  4ECV A;  1KFD A;  1RA6 A;  2X1B A;  4OZJ A;  4CH1 A;  4OZ2 A;  4G1I A;  5CAA A;  1RT5 A;  1U4B A;  2OP5 A;  4ZVF A;  1UET A;  1QSS A;  1FFG B;  1XMO F;  2V8D A;  5C24 A;  2UUW A;  3SV3 A;  4OV1 A;  2IYG A;  4F4A A;  2ZEJ A;  2XI3 A;  4B3R J;  1O6X A;  3DM2 B;  3CW2 C;  3PYE A;  2YX7 A;  2MJU A;  4QWC A;  2YWH A;  2ZOG A;  3D1H A;  2D41 A;  2DIS A;  5F0W A;  1HHQ A;  2X51 A;  2DGT A;  4NEZ A;  1JQG A;  3L4B C;  5KFO A;  1S0O A;  2B8P A;  2FVS A;  2BM0 A;  1UWB B;  3Q8V A;  1ZYQ A;  4IFY A;  1U1O A;  3EVM A;  2NXU A;  4O0I A;  4HTI A;  3CCW A;  2EKN A;  4FBU A;  3QJL A;  1B7F A;  4ZVP B;  2VC0 A;  4NX9 A;  3CJ8 A;  5IC6 B;  5A2Q U;  2UZA A;  3MEE A;  2RF2 A;  2VPW B;  1S1X A;  1UW4 A;  2ZBI A;  2GIQ A;  5EHH A;  3J80 Y;  3BH7 B;  3M32 A;  5M2U A;  2M2B A;  2MY7 A;  1P9Y A;  3C16 A;  1D9A A;  4ZCK A;  2AIR B;  2WW4 A;  4CZC A;  1UCN A;  4P2S A;  1B0P A;  1WOP A;  3KJQ B;  5B0A A;  2AT1 B;  3Q8U A;  1GMV A;  2LQJ A;  4LSN B;  2R7W A;  3DN9 A;  1KTV A;  3K59 A;  3OR2 B;  1L5U A;  1NND A;  4LJM A;  2BKO A;  2IJN A;  2J9C A;  4ES2 A;  3FEY B;  2DO4 A;  4RBU A;  2BAC A;  4C2M A;  3VAL A;  3SZ2 A;  1SKS A;  5DLF A;  3RYL A;  4UZC A;  1TFW A;  3R27 A;  4FF3 A;  2RIL A;  3PRB A;  1GT8 A;  3DOM A;  1YTY A;  2P9E A;  2OPS B;  4BWJ A;  1F6T A;  2FVC A;  2WVE A;  4DUZ J;  1S0M A;  1HNX F;  4CT9 A;  8ATC B;  2KTQ A;  4Y00 A;  1RT2 A;  4ZHR A;  2BM1 A;  4CO2 A;  1CQM A;  2Q6B A;  3QT7 A;  1KHW A;  3OTO F;  1RQ0 A;  1FKP A;  2Y0S D;  5AE3 A;  3TAM B;  3RAX A;  1WHV A;  4FBT A;  1CUL A;  2MHE A;  3I5C A;  1BUX A;  1S6O A;  2BYC A;  3UN3 A;  2HVH A;  1S1W B;  4Y0F A;  1WTF A;  2R7R A;  1I1G A;  3MCS A;  1RTD B;  3RR8 A;  2G0I A;  4ZVE A;  3VCD A;  2DVI A;  2IBO A;  3D1O A;  3EDQ B;  4NXN F;  4CLY A;  2DNO A;  4NXN J;  5CH7 B;  1EB0 A;  4DUT A;  2C2O B;  1FXD A;  4F3Q A;  4RW4 B;  4IG3 A;  2EPI A;  3DXB A;  4N5S A;  3LPY A;  4F3O A;  4KFB B;  4USU A;  3CXC R;  3ZZO A;  1KVK A;  3R3T A;  4ID5 A;  3FNN A;  2LFV A;  4Y2A A;  2YH1 A;  2DNY A;  2MZJ A;  3R7B B;  3FEX B;  3NNC A;  2B9X A;  2BJ9 A;  4NA1 A;  2KM8 B;  2FZK B;  1VR6 A;  1T9W A;  2I0X A;  4MYU A;  3ITH B;  4ECW A;  1EAY C;  2CZ9 A;  1R7I A;  3FBE A;  1H7X A;  5KAK A;  4P6Q A;  5LXR A;  4CLU A;  2HBR B;  5LMN F;  1VI7 A;  2OEL A;  2JEG A;  1JLF B;  1R8C A;  1AT1 B;  2AEJ A;  2AJ1 A;  2KHC A;  3BKF A;  1GEH A;  4LFC J;  1KLM B;  1ZPV A;  4WFA Q;  1C1C B;  2HMI A;  3M8S A;  1IR1 A;  2F8H A;  1X5S A;  4NCG B;  2F3J A;  3DGV A;  1WEL A;  3BN4 A;  3OR2 A;  2HGN A;  2FQQ B;  3EGN A;  5L1K A;  2R8K A;  4N41 A;  3THV A;  1DRZ A;  1CJT A;  1RTH B;  2BRL A;  2GMH A;  1TAQ A;  4TY9 A;  3EZU A;  3CIM A;  3G8Q A;  2VA3 A;  3IRX B;  2BQR A;  1U48 A;  2E1C A;  2W4P A;  3DOM B;  1KRP A;  1IJF B;  2CG4 A;  4CLZ A;  1P1T A;  2JH3 A;  2K2P A;  3RB6 A;  3LPE A;  1HW8 A;  1VMB A;  4ZCM A;  4LF5 F;  2HHU A;  1PJ6 A;  4NZ6 A;  5A8R B;  1L3S A;  2FD2 A;  1J5O A;  4LF5 J;  3H20 A;  5KFQ A;  3AJ2 A;  3DMJ A;  2ZBR A;  3DRP B;  4OI2 A;  4EFA C;  4KC5 A;  1AYE A;  3SSR A;  4CRJ A;  4NYP A;  3D0G E;  2MYF A;  1WF2 A;  2OPQ B;  3BRE A;  2QTW A;  4P2X A;  1MRO A;  4OYX A;  2AYG A;  5EN1 A;  1DTT A;  1MG7 A;  2K3K A;  3UPF A;  2XSJ A;  4DEZ A;  2B5J A;  3T9N A;  9RUB A;  3D4J A;  2RIJ A;  3CDA A;  4AUK A;  1JKH A;  3ZNJ 1;  4IR1 A;  4YHH J;  4IYQ A;  4WKR A;  2OPS A;  1HW9 A;  5HP1 A;  3MEC B;  4JV5 J;  1S9F A;  1F2G A;  3UD3 P;  2CPI A;  4FDF A;  4Y6I A;  2RRA A;  1Q7L B;  2IRY A;  2ZH7 A;  2XSF A;  1GTE A;  1M5H A;  2NLW A;  2YNG A;  3TAM A;  5KFM A;  3OPK A;  1LQ9 A;  4TU9 A;  2QLX A;  2WCX A;  1GNK A;  3GFX A;  2WB4 A;  2DIT A;  3PXG a;  3M9N B;  1LWE B;  1XQI A;  4DV2 J;  1RXO B;  4I69 A;  2ZH4 A;  2B4U A;  2DY9 A;  3VZI A;  1RT5 B;  2W01 A;  3PZP A;  4L76 A;  1RT1 B;  1VIS A;  3B4M A;  3D68 A;  4OLO A;  1ROF A;  4P7T A;  5KT2 A;  3MM6 A;  1JX4 A;  2NZ4 A;  1DTQ A;  3M8P A;  3CUN A;  1SUQ B;  5I42 B;  2DNR A;  3CJK B;  1NME B;  3EGW B;  1K1S A;  1S4F A;  3H8Y A;  3MAA A;  5E5N A;  3MEG B;  4HT7 A;  4I2P A;  2MLY A;  3G6X A;  3U1L A;  2VOO A;  2Q3P A;  4DL3 A;  2QSW A;  1JWW A;  1Q53 A;  4WKY A;  4DL4 A;  4NA2 A;  1UJ6 A;  1ZA2 B;  2LEA A;  3AOA A;  2HVZ A;  3PO5 A;  3KTQ A;  4LUB A;  4AL6 A;  3FCH A;  1TL4 A;  5GME A;  1MW7 A;  1KOO A;  3OLA A;  3R6G B;  3KLE B;  1S77 D;  2LDI A;  4C8M A;  2W4D A;  2R8I A;  2AJF E;  3LAK A;  1TK0 A;  3PIP Q;  5HLF A;  4QPX A;  3QO9 B;  1F5C A;  4TU7 A;  3LGH A;  4KY3 A;  3W5Z A;  1TUV A;  1DJ0 A;  2BMB A;  3W1Y C;  4ZN1 A;  2IA6 A;  4NLY A;  4R25 A;  4OX9 F;  1ZET A;  5ITH A;  2BQ3 A;  5BYQ A;  4CCH A;  4F8R A;  2Y3Y A;  1JKH B;  1G7C B;  1MWQ A;  2CJQ A;  1VRU B;  3MM8 B;  2IVY A;  3R8Y A;  2IC3 A;  2GZO A;  2CWX A;  3HVT A;  3ILI A;  4O23 A;  2CPJ A;  5CAB A;  3K17 A;  2ROG A;  3GTY X;  5F9N A;  1VCT A;  3RRK A;  2N3O A;  1ZM3 A;  1H2U X;  1QSY A;  2BKP A;  4JI5 F;  1S1T A;  3KJV B;  4DR7 J;  3CE8 A;  5E3R A;  3R7N B;  5K8O A;  3QZ7 A;  4DV5 J;  4I7F A;  4KIA A;  2IVF B;  3RGI A;  5JVH Q;  2WRM A;  4FYD A;  3K8W A;  3DRS A;  1AUS L;  3CO0 P;  2XMU A;  3AOD A;  5CHC B;  5KT7 A;  2FJE B;  3BDP A;  2XS5 A;  2DH9 A;  4A46 A;  1T03 B;  5DDP C;  1MN7 A;  4HVZ A;  1PAE X;  3BB5 A;  2C2N A;  3TO8 A;  5H9F K;  4QW8 A;  4AFF A;  3MMA A;  3NS6 A;  4KV8 B;  1M5V C;  4F2R A;  4U6P A;  2NQP A;  4JYA J;  4FF1 A;  4NPO A;  4J7C A;  2G0C A;  3FEZ A;  1CQN A;  1NK6 A;  3VGV A;  1XR6 A;  4L75 A;  1JJ2 R;  2R7T A;  5KFI A;  1KWM A;  3RG6 A;  2E1R A;  2BOA A;  3T9Z A;  2CPH A;  2EFQ A;  2FC9 A;  4J9O A;  4V19 J;  4QWD A;  3TVY A;  1GX6 A;  5D0E A;  3PJ9 A;  1RAJ A;  4H4K C;  2C3U A;  3C6T B;  1HD0 A;  3I4H X;  4OX8 A;  6FD1 A;  3NL0 A;  5JMN A;  1U1N A;  2X7I A;  1FFW B;  2W8L A;  3U1N A;  2NS1 B;  3W9I A;  2J9D E;  1GQE A;  2XMV A;  3PKM A;  2AJ0 A;  1HNW F;  3GSI A;  2CQ3 A;  4MIB A;  4YR3 A;  1JLE B;  4IKA A;  4B3S F;  1RTJ B;  2XMT A;  3R1H A;  3TA2 A;  2Z2Y B;  3QGP A;  2XO6 A;  1OSD A;  4M5D B;  1RHM B;  2EK1 A;  1I6J A;  1B70 B;  1IQT A;  1SV5 A;  3KFW X;  2J7U A;  3ZTR A;  3Q24 A;  2VQE J;  2VON A;  4I2Q A;  2W9B A;  1DY3 A;  3IG1 A;  4URG A;  1U0S A;  1F9H A;  4DFK A;  4RUB A;  1YJ7 A;  1IBC B;  4UOG A;  2JSX A;  2CRL A;  4WTO B;  2V50 A;  4AT1 B;  4DV0 J;  3NNH A;  1FI4 A;  3OVA A;  4R8U B;  3CCJ S;  2XS2 A;  2R2T A;  1SH2 A;  2GAG C;  3JSR A;  3QBC A;  4DR4 J;  1IKY A;  3SSQ A;  3K89 A;  1NH8 A;  2GIR A;  1SJQ A;  2VG5 B;  1U24 A;  4J9U E;  3VQT A;  1YG0 A;  4OZ1 A;  4PWW A;  3IRW P;  4MYT A;  1ZM9 A;  3TNV A;  4Q0B A;  3ILO A;  3MAH A;  3KLH A;  1RK8 A;  1FRH A;  2H54 B;  2KYZ A;  2R7O A;  3P3D A;  2BAN B;  5D15 A;  5IQQ A;  1M5O C;  4LQ3 A;  2YKP A;  5U47 A;  4F4Y A;  1C0U A;  2PGC A;  1JLG A;  2QV6 A;  2YQ0 A;  2YPY A;  4YEA A;  3W9J A;  1NK7 A;  4B3O A;  1HNV A;  1R0A B;  2VFU A;  4J90 A;  5ETP A;  1HR0 J;  3C6U B;  1CS4 B;  3R5A A;  3EZO A;  4P52 A;  5D77 A;  3P5T L;  2DR7 A;  4B9V A;  4RNM A;  3OQ2 A;  4YQW A;  3QGH A;  3IR7 B;  4M5N A;  1U0H A;  1Q16 B;  3DLG B;  4UF4 A;  2F9J A;  3JB9 k;  4NYO A;  3MM6 B;  4F50 A;  3V6D A;  1SL2 A;  3NS5 A;  4HDH A;  4ELV A;  2J0S D;  2P2C B;  2FHO B;  3NAH A;  4A8F A;  3ADA C;  1S10 A;  3BSA A;  4DR7 F;  4ZS6 A;  4RKU C;  1YJV A;  3SI8 A;  2NUH A;  3RW6 A;  3MM5 A;  1H98 A;  2MEW A;  2DTJ A;  2C42 A;  1YX2 A;  1AXQ A;  1TTH B;  5ETL A;  1F1B B;  5GAG I;  4PWD A;  1NJW A;  2J6S A;  1RWW B;  2BJ3 A;  3FQK A;  5DGA A;  1I94 J;  2VFR A;  4PQU B;  1C0T A;  1WI6 A;  3MM9 A;  4C3M A;  2V34 A;  3X3U A;  4CO0 A;  1NK5 A;  1N34 J;  1DLO B;  1T95 A;  3OJS A;  2DHH A;  3P4U B;  1FTR A;  1X7V A;  2KI2 A;  2V2K A;  3KMS A;  4CO1 A;  2UU9 F;  2IY5 B;  4LF7 J;  2YNI A;  4NLG A;  4MFB B;  4J37 A;  5KG4 A;  2XZW A;  1UVN A;  5KFX A;  3RTV A;  2OEM A;  1MRO B;  4BS2 A;  5L9N A;  3CED A;  3MD1 A;  2PC6 A;  4HAC B;  3BS9 A;  3OR1 B;  5D4O A;  2FHK A;  3N5B A;  1RAB B;  3UR3 C;  4EYH B;  1WWH A;  3PW7 A;  3M2V B;  4ZP6 A;  4MK9 A;  5KG1 A;  1OY9 A;  1S79 A;  1VHF A;  2ZUG A;  5E41 A;  4H4O B;  1SJF A;  3HHN B;  5IT9 U;  3Q0A A;  2BBE A;  2ROP A;  2MY8 A;  1S1T B;  3CCZ A;  1T94 A;  1RP5 A;  4HDG A;  2N4D A;  4O4G B;  5G4D A;  4YDX A;  3KJV A;  2EBG A;  3MPY A;  2WZ1 A;  1VGY A;  3BF4 A;  2HHH F;  1X60 A;  2LU2 A;  2AEM A;  4X65 F;  4JI0 F;  3E8O A;  3M8Q A;  1FF2 A;  3CSK A;  2VOP A;  2HG4 A;  2K7K A;  2HNZ A;  2XMA A;  2FVR A;  4QYZ J;  2GJI A;  2QC3 A;  2XYP B;  2XY6 A;  1YJN S;  1V3R A;  3RUB L;  4LF8 F;  3ISN C;  1N52 B;  2GCF A;  2A6M A;  4TLR A;  4Y28 C;  3OL7 A;  2DCU B;  4DFP A;  2YWE A;  4FS2 A;  4EI2 A;  3QID A;  2BE2 A;  4DN0 A;  2BDP A;  4FP9 A;  3UO0 A;  1O51 A;  3MEG A;  1TK5 A;  2AX0 A;  3UN5 A;  2B43 A;  1FDA A;  3LA0 A;  2YQ1 A;  5IV3 A;  5I42 A;  4JV5 F;  3EUN A;  1QLN A;  2YX1 A;  3HUL A;  5LSO A;  1HWL A;  4TU8 A;  3UI3 A;  2FHM A;  4ZK7 M;  1LW0 A;  4F36 A;  4B9N A;  4YS2 A;  4DL7 A;  1BWE A;  4X4S A;  1H38 A;  3TJA A;  2GVZ A;  4P10 A;  4ZVQ B;  1YI2 S;  3JTN A;  2C2R A;  3CVK A;  1X4B A;  4RU9 A;  1Y4Z B;  2P6T A;  4PXD A;  5J2Q B;  2HWT A;  3T6B A;  2IPO B;  1MWY A;  1TR0 A;  3R6L B;  3JAM Y;  5F8N A;  1FO1 A;  2OEK A;  1TFY A;  3KK1 B;  2SXL A;  1VQO S;  4C6A A;  1JNZ B;  1KOH A;  3KDO A;  2HQF A;  2ZE2 B;  4M95 A;  1GXT A;  2F4V F;  4PWD B;  1UWA A;  4JI5 J;  1O8B A;  2XLI A;  1VQY A;  1F0X A;  2ZH2 A;  4NE9 C;  3WX4 A;  1RHK B;  4I4B A;  2CVE A;  2M9K A;  4DJB A;  4YB1 P;  2FVQ A;  4RNN A;  4BC9 A;  3W62 A;  1R43 A;  3PR5 B;  1WTB A;  1OSC A;  2ACM A;  2OLW A;  2MQP A;  4C8L A;  4U8Y A;  3KK1 A;  3NGK A;  2Q6C A;  4YR0 A;  5DM7 Q;  3CCQ S;  3G87 A;  4X62 F;  3JYT A;  4JI3 F;  2KT2 A;  2LKZ A;  2V94 A;  4F0H A;  5KFJ A;  4KGX B;  1JLA A;  1SIZ A;  2RDD A;  3H0P A;  3M1V A;  3QGI A;  5ETV A;  3W2W B;  4OL8 A;  3TQ1 A;  4LVN P;  1JK9 B;  1YZ7 A;  1PBU A;  4EK2 A;  3W66 A;  2CQ0 A;  2BJD A;  5HVG A;  3HZG A;  2DXE A;  5M2P A;  2X1G A;  3A3P B;  2RE1 A;  4DSJ A;  2OPQ A;  1NHK L;  4K2X A;  1SIW B;  2CZV C;  1HBM A;  3HDS A;  4LT6 A;  5H1S V;  1H3D A;  3OHB A;  2L08 A;  2FZG B;  4MMO A;  4Q0B B;  2Z2L A;  2F8E X;  4K4X A;  1KDN A;  3ET6 A;  4CYU B;  4F67 A;  2W2P P;  3MDF A;  5K8P A;  4QWE A;  2VPX B;  3C6U A;  3WQP A;  1DQA A;  4B3O B;  2IDE A;  2R7X A;  1WI8 A;  5CXT A;  3OSP A;  3Q23 A;  2KT5 A;  4NZ0 A;  4Q43 A;  1YRX A;  1ULR A;  2G13 A;  4QJV A;  4CNY A;  4GKK F;  3DU5 A;  4C3K A;  5DG8 A;  4V1A k;  1NKB A;  3KNG A;  1BE4 A;  4P7V A;  4RW6 B;  2B3T B;  5KFT A;  4FYY B;  3FSI A;  4IUF A;  3M8Y A;  3BQ0 A;  4UZB A;  1NH7 A;  1UEK A;  4OHV A;  2JLG A;  1U1R A;  1HFE L;  3DGP A;  4JV1 A;  3OL6 A;  1SJR A;  4YB5 A;  3HHL C;  2V67 A;  3I0S B;  2M3D A;  3AQO A;  2VFS A;  3ZZU A;  1FRL A;  2H9Z A;  2MJN A;  3FUY A;  4OIX A;  3VGT A;  2MPU A;  4CLK A;  2G9O A;  4ED6 A;  1VRT B;  1S7I A;  4FYX B;  5D0H A;  2R8G A;  1VDH A;  3JTO A;  2CZ4 A;  3UVJ A;  3OLB A;  1K8A T;  5L8R C;  2X1F A;  3NBP B;  5G0R A;  4IQX A;  1CPZ A;  4I56 A;  3Q22 A;  2XLK A;  2MMY A;  3J7Z T;  3NCP A;  2VJU A;  5J2M B;  4O44 A;  4QYZ K;  1KTQ A;  5KFC A;  1F3V A;  1RZM A;  1CJT B;  1RTH A;  1V5V A;  2ZIT A;  2HGL A;  4URS A;  1YJ9 S;  1K47 A;  2RSQ A;  3V4I A;  3KDN A;  4WE1 A;  3UW1 A;  2GV1 A;  3WC2 A;  2F9D A;  2GQC A;  2CVI A;  1SC1 B;  1RE1 B;  4RJV A;  2PDA A;  1U49 A;  2UP1 A;  1S6P A;  4FNI A;  1VK8 A;  3AFG A;  3QRR A;  1QUP A;  2M88 A;  3ZZR A;  2EI5 A;  4M5I A;  3O5T B;  4ID8 A;  3M4X A;  4KKO A;  3KHR A;  3BSO A;  1QUV A;  5DQH A;  2DXF A;  4B3T J;  1QY7 A;  3CD5 A;  4QQB A;  4HR2 A;  1TV6 B;  4UTG A;  3TP2 A;  1B7Y B;  2B7C B;  1FEH A;  3AB2 B;  3LP2 A;  4LRF A;  3DRR B;  3KK2 A;  5HMX A;  1H2T Z;  3H5X A;  1YWX A;  3GFZ A;  4Z37 A;  4YOE A;  4ZPB A;  4KYZ A;  2CPX A;  5DZ6 A;  3N79 A;  2QRR A;  3G2X A;  4KGM A;  4DSI A;  4WIQ A;  3G71 S;  4HEA 9;  5HAN A;  1XWL A;  3PW0 A;  2IM0 A;  4ZVO B;  3IAS 9;  2XI2 A;  2D69 A;  2QLF B;  2DNN A;  1U2R A; 
#chains in the Genus database with same CATH homology
 4ZVQ B;  3D6M B;  4ZVP B;  1RWX B;  2Y0B B;  5IC6 B;  1RWK B;  2HBZ B;  3D6F B;  1IBC B;  3R5J B;  3R6L B;  2DKO B;  4ZVU B;  1QTN B;  1RWO B;  2H48 B;  2QLJ B;  2H51 B;  3KJQ B;  1NME B;  1RWN B;  2QL9 B;  1RHK B;  2H54 B;  4LSZ B;  2XZT B;  4ZVR B;  3R7S B;  2CNL B;  2XZD B;  1RWP B;  2C2Z B;  3GJQ B;  1BMQ B;  4ZVT B;  5K20 B;  3P45 B;  1SC3 B;  3R6G B;  1RHR B;  2XYH B;  1I51 B;  2H4W B;  4DCP B;  1PAU B;  3SIP B;  2QLB B;  1SC4 B;  3GJT B;  2CNN B;  2P2C B;  3EDR B;  3EDQ B;  1ICE B;  2C2O B;  2QL5 B;  2XYG B;  2HBY B;  1RWW B;  3R7B B;  1QDU B;  2C1E B;  4JB8 B;  1RHQ B;  2H5I B;  3R7N B;  4ZVS B;  2C2K B;  2Y1L B;  1RHU B;  3P4U B;  1RHJ B;  1PYO B;  3GJR B;  1RWV B;  2HBR B;  2CNO B;  3D6H B;  2H65 B;  2QL7 B;  2H4Y B;  1GFW B;  2FQQ B;  2HBQ B;  3QNW B;  1I3O B;  3IBF B;  2H5J B;  4DCO B;  1F9E B;  1SC1 B;  1RE1 B;  2XYP B;  1RWM B;  2C2M B;  5IC4 B;  3NS7 B;  2CNK B;  3KJF B;  3KJN B;  2CJX B;  3GJS B;  2CDR B;  3RJM B;  2CJY B;  3IBC B;  1RHM B;  4ZVO B;  4DCJ B;  2QLF B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...