2QLBB

Crystal structure of caspase-7 with inhibitor ac-esmd-cho
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
92
structure length
92
Chain Sequence
KIPVEADFLFAYSTVPGYYSWRSPGRGSWFVQALCSILEEHGKDLEIMQILTRVNDRVARHFESQSDDPHFHEKKQIPCVVSMLTKELYFSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Caspase-7
publication title Plasticity of S2-S4 specificity pockets of executioner caspase-7 revealed by structural and kinetic analysis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 18
structure length 92
sequence length 92
chains with identical sequence D
ec nomenclature ec 3.4.22.60: Caspase-7.
pdb deposition date 2007-07-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 2qlbB00
1GFWB 1RHQB 2QL9B 2CJYB 3RJMB 2XZDB 3IBFB 4ZVUB 2C1EB 1RHRB 3R7SB 1SC3B 1PAUB 3KJNB 1ICEB 1RWWB 1I51B 2P2CB 3NS7B 2CNKB 2CNNB 1SC1B 2H65B 2QL7B 2CNOB 2XYPB 2H5JB 2QLFB 2FQQB 2HBZB 1RWXB 2C2ZB 4ZVSB 5IC4B 2CNLB 3GJQB 4ZVPB 1SC4B 4ZVOB 2HBRB 1QTNB 2CDRB 3D6MB 3D6FB 2H48B 2HBYB 1RHKB 4DCPB 2H54B 2XYHB 1RE1B 3IBCB 3EDRB 2QLBB 2QL5B 4DCJB 1BMQB 2H4YB 2C2MB 1RHMB 3P4UB 2H5IB 1QDUB 1I3OB 2XYGB 3GJSB 3SIPB 3GJRB 3P45B 5IC6B 2H51B 2C2OB 4JB8B 2QLJB 2C2KB 3R6LB 1RWMB 1RHJB 3R5JB 1RWKB 4ZVRB 2Y1LB 1IBCB 1F9EB 3KJQB 4ZVQB 2Y0BB 3R6GB 1RWOB 3R7NB 3QNWB 1RWPB 3D6HB 2CJXB 3GJTB 5K20B 3R7BB 1RWVB 2XZTB 1PYOB 3KJFB 2DKOB 3EDQB 4DCOB 2H4WB 2HBQB 4LSZB 1NMEB 1RWNB 1RHUB 4ZVTB
chains in the Genus database with same CATH superfamily
3TZXA 2C28A 2A1BA 2VASA 2FC8A 5BR8F 3LH2S 1HPZA 3W1YC 2OUGA 2VKZG 4IH7A 2AYEA 2CADA 3IP0A 4QR2A 2BM0A 3NAHA 2XMKA 5DLFA 1X4FA 3C6TA 4UT4A 1WF1A 5C42B 4ATNA 1JX4A 4JI0F 1FE4A 2H48B 4ZJOA 1NHKL 1E6YA 3MR2A 1HWJA 2XTJP 4YB1P 5FDLA 5KFCA 2JH3A 3VR1A 1QUPA 3PCOB 4L3KA 4HYKA 4MFBB 1NPPA 2EFOA 2BJ8A 2YKQA 5KT3A 5GMEA 4RWWA 1SV5A 1FKOA 1PG5B 1TKTB 2V63A 4UUWA 4CH7A 2YNFA 4Z37A 3BJYA 3I9ZA 1UEUA 3DRPB 3NGKA 2CPZA 2DTJA 4NLPA 4QIGA 4ECSA 3CW2C 3ZZOA 2VJVA 3PW5A 1Q7YT 2OTLS 3M8SA 2DNQA 1S59A 2Q1LA 1JLFB 3D1OA 3QWPA 1QVGR 3MPWA 1JNZB 3J80U 1SC1B 1EP4B 4WCEQ 1EQMA 3SFGA 2PFFB 3TA2A 3UWTA 3ENAA 3HVTB 4LF7F 1FK9A 3SI8A 4NEYA 2RU9A 1VIOA 2NXEA 1N56A 3FRYA 3US5A 2CDRB 1RAEB 3OXLA 4L6V3 1N36J 2I38A 4DCPB 3V6HA 2RDJA 4MKVA 4DX5A 3DKDA 3DFEA 1SKRA 1NH7A 1ZYQA 5HP1A 2DT9A 4GVBA 4MMOA 3B6BA 3IRWP 1SB6A 3MM5B 5EX0A 1CJTA 4X4NA 4P6QA 2R2RA 3HHKA 5LMNJ 1S48A 4DZDA 2CYYA 3GTYX 4C8KA 1V6HA 4X65J 2F3JA 4DV1J 2XLIA 4U9RA 2FC9A 2J6SA 3KKFA 2HQGA 3MCOA 3BO2A 2PGCA 4DL6A 4C9DA 4DX6A 1ZM4A 2NZCA 4I2PA 2DR8A 2CUYA 2CJBA 3POTB 5FJ4A 3ETOA 2ZH4A 4MKBA 5HLFB 1VQ9S 4WKRA 3R5BA 4IUFA 4NCBA 3DDNA 4ZJLA 1AZSA 4DL0C 1DFDA 2UUCJ 2L3MA 4PCQA 1NHVA 1YZ6A 4QYZK 5D8HB 1WNEA 2WONA 2J0XA 4B3RJ 2HNDB 5L1IA 2F1FA 1V3ZA 4LFCJ 4DR5F 5F9NA 2DGSA 3MMJA 3KHGA 2GHWA 1HNVA 4JOUA 1NU4A 4KIAA 3ET6B 1O51A 4Q43A 4ZVQB 2W01A 3DRSB 4J9QA 4ECZA 3M8PB 2WVCA 2DBBA 3EGZA 3TOQA 3M9MB 5KFDA 3T1HF 3MMAA 5D3GB 5KFAA 2VOPA 4LVNP 1MWYA 3GYXB 3EZUA 2OH2A 1KVJA 4X4RA 4ECQA 2FB0A 4PPZA 5E3CA 4KGZB 3EGVA 1TL5A 2D3UA 4RBVA 4QYRA 2QL7B 1N6QA 2VBWA 2QA1A 1NDKA 3WQPA 1NAQA 2DNMA 1FTRA 4F4XA 2RRBA 4QW8A 1HBOB 2XMTA 3MOJB 4J9UE 2ZUAA 4UTGA 2ZHOA 3F56A 3FJ2A 2DPJA 4URGA 1KTVA 3PYGA 2ILYA 4DQPA 5IS2A 2MSTA 4M5LA 3BO3A 2J8SA 3MD1A 3U27A 3W64A 2UZAA 5HANA 1N8RT 3JQMA 1X4AA 1GTHA 3EGWB 3NBPB 3TRGA 3ZNJ1 4DV4F 1MMNA 3MR6A 4DCOB 1KVIA 2V9KA 1NCLA 3L09A 4PPDA 2MHEA 5B7WA 1RT7A 1KQKA 1JLBA 4CIOA 4NLVA 1AROP 3IGVA 1PC4A 2EFGA 1SIZA 3EUNA 2YKNB 1IBMF 2RHSB 4AQYF 1DY3A 1H2UX 3LPEA 2DISA 2IBOA 2XYPB 3CCRS 4CLWA 2IYIA 4EBEA 2K3KA 4FP9A 4KGVB 2DNHA 4OFZA 3V6JA 5KOXA 4CI0B 4WFZA 2BJ3A 4O0NA 1WEYA 2HQIA 5EWGA 2WZ1A 1T9XA 1XK8A 2FGCA 2QO3A 2A6OA 2IC3A 1N34F 4WFBQ 2YWKA 5LM7E 1RT2B 3MEEB 2JEJA 2ACMA 1F3FA 3M9OB 2F7VA 3T41A 1CJUB 3HKZD 1NUEA 3IR7B 1I5OB 2CJQA 2MPUA 1UMJA 4JI5J 1RTDB 2FHKA 2ZOMA 2V4RA 1RACB 4WP9A 3KLIB 5KFNA 2AEMA 1QAIA 1CULB 3C8YA 1GAOA 2LQ9A 3H2VE 2YNGA 2MQQA 4ED4A 2MQOA 3FSYA 4RZRA 1AT1B 3HHLA 4LUBA 2RF2A 3KK3A 5A0YA 3TJ8A 3G6VA 1S6QA 1UCNA 4RW4B 4DV3F 3CD5A 2J9CA 1NDLA 1NK6A 1DTTA 3KMSA 1Q53A 1JXEA 4K2XA 2PEBA 1N33J 3PKMA 4LSNB 5A76A 3DDIA 3UD3P 3JQKA 3EXCX 4AL5A 3M7VA 1LWFA 1DHMA 3O6QA 5KFKA 1D09B 3NP5A 1TKZA 4KC5A 4J9LA 3FQKA 1B99A 2BBEA 2E5LJ 2ZKTA 1VRUA 2BM1A 3GIIA 4KJIA 4BWJA 1JIHA 3M2UB 3M8WA 4GO5X 5KFXA 2IRXA 1YX2A 4CM2A 3E01B 3BN4A 2A3JA 2CPIA 4B9NA 2FY1A 3N5FA 4B3OB 5HMZA 2XGPA 3MGJA 4NYPA 5F3ZA 1SKUB 2HQ3A 4DR6F 3FRZA 2GQ2A 4ZPCA 1S5ZA 1Z4UA 4LFBJ 1H2TZ 2ZVIA 3PW7A 1NB7A 4GRSA 3W9HA 1RT5A 3HKWA 3DRRA 4ZPAA 3V6DA 1RT3B 4O44A 4EGLA 1CSJA 5LJ3Y 2O67A 2R8JA 3CJ8A 3D1QA 3Q8YA 5DG8A 3KMQA 2SXLA 3N0VA 1VQ5S 3DMJB 4LF2A 2VUGA 3KHLA 5KT2A 3VALA 4ZPWR 4MK7A 4JV0A 4LF8J 1VQ8S 2XO7A 2BX6A 2DR9A 3D3CJ 5EWEA 2AF6A 4NLTA 4ZVRB 5DDPC 4EI2A 4XDCA 3LP2B 4JI6F 2HHHJ 1LXJA 2CDQA 3CJ0A 4FF3A 1U1MA 1K0VA 1IBKJ 1HNWF 1PILA 2OPQB 2AIRB 5MLCV 1U0HA 4LSZB 1NXIA 4R25A 4IFVA 1SQFA 1H2VZ 2B9EA 2ZH6A 3DCAA 4ZCLA 2FZKB 3HP6A 2DGUA 2U1AA 4BLGA 1S4EA 1I51B 2WOMA 3ZTSA 1KD1T 1LNQA 1VFJA 2C3OA 4ZCIA 3CJKA 4C3LA 2ZH5A 2NPIA 4C11B 1WEXA 1J27A 5LL6d 3HFZB 4P52A 2B4VA 3OL6A 3CPWR 5HBMB 3QFWA 3CO9A 4ECVA 4OZ2A 2HHVA 2FHJD 2ASYA 1XNQF 3WZ0A 1T05A 2Z0GA 4NEZA 4ZPDA 4ZIWA 2HFZA 4JI3F 1Q5VA 1NK4A 4DV5F 1APSA 3MM9A 3GFYA 4G1IA 3Q2SC 1JLQA 3G8TA 1Y10A 3UFCX 2APOA 3JSMB 2CJKA 4OI4A 2F5GA 5F8IA 2CQ3A 4DV6J 2A2CA 1IQTA 1UWBB 3CJ2A 1PC5A 3QIPB 4FXWA 3G9CA 2J9EA 4YUDA 1FCAA 2OKQA 2DNLA 4XPCA 3AOAA 5F0UA 3GV7B 1TL7A 4UQTA 3RW6A 1D0EA 5LT5A 1VRTB 4CM0A 4ILMA 3T5LA 1S72S 5IC4B 4ZVPB 1BE4A 2BRLA 2DGVA 3D0HE 1ZA1B 3C3LA 1FJGF 2HBYB 1KLMB 1KFDA 2CQCA 5KFGA 3PJ9A 2KTQA 3QIDA 4AYBD 3H4BA 1SPBP 4F50A 1RA7A 2FZCB 1F0XA 3CWJA 3CE8A 2WBRA 4K8RA 2QE5A 1RKJA 1XWLA 2YNHA 2IBKA 3GMGA 3UR3C 4WYLA 4DQIA 2GAHC 1ACMB 5IM0B 1LWXA 2BQ3A 2UUBJ 1XR5A 3KJQB 3KUHA 1TL3B 5GADI 2AGPA 1F5CA 1W26A 5LMUJ 1CG2A 2J9DE 4DR2J 3R2DJ 3BQ2A 4WBFA 1WKLA 2I5JA 4OMFG 2W24A 1JLCB 3HHEA 3KK1A 2PC6A 3OTDA 3DDKA 3MCNA 5AJ3J 3HSJA 4USVA 4I0WA 3A13A 1IKWA 4DSEA 1S6PB 1ZA2B 2V9WA 4F26A 2ABYA 3MZIA 4LIWA 3GZ7A 3QFHA 4HI1A 2JZ5A 4EZ6A 1RT4A 2XY5A 3AA9A 4O3QA 3Q0AA 4F67A 1Y0HA 3I5BA 2G13A 5LJ5Y 4PYDA 4PQUB 1FWPA 2HHSA 5CQGA 4FPRA 1FNMA 3WIUA 3R7NB 5A6PA 5DRKA 1S4FA 5A8KB 4PUOA 3LTOA 1W25A 1U1NA 2B6AB 2RQKA 1HPZB 3MPYA 3N28A 1S1XA 4QBUA 2M9KA 2Y1IA 5RUBA 3IBFB 1AFIA 3R27A 4C8YA 2MQPA 1WORA 4QPTA 3C6TB 4KBIA 2LECA 1N5VA 3BSOA 2MKHA 4EBDA 3FDSA 3PR4A 2GMLA 5J2QA 4QIFA 5H9FJ 4F4KA 5IV3A 3MMBA 4RW8A 1NJXA 2YBVA 2R9LA 4RLEA 1FRKA 5D0HA 2DNZA 3N79A 1J5EJ 1SUQB 1SV5B 3D5MA 2DNGA 4LVOP 2KI2A 3KG1A 2MZSA 2NXCA 2XYGB 2YNFB 1RXOB 3CXCR 4DUYJ 5EWFA 3NEKA 1JXLA 1DAXA 1S0NA 2WW4A 3PYDA 2FJAB 3VAKA 1MSWD 2LA4A 2W25A 2ZUGA 3U02A 1VQPS 3MMCB 1UTAA 2VL1A 4KKOA 2VG6A 1BQXA 1HR0F 3W9IA 1YQHA 3CCVS 2B9WA 3DGPA 3PRVA 4Q2LA 2CQPA 4DR7F 3O1LA 1BQMB 3SQGA 3M6VA 1HNXJ 3VTIA 3G86A 4X66F 3PEHA 1FK9B 5B08A 4ZPTR 2OD4A 5EHHA 4O3NA 2RKIB 3G96A 3UDVA 5C2GA 2DHSA 3TANA 3HK2A 2YH0A 4KO0A 1UVMA 4JYAJ 4YR0A 1D9AA 3QSIA 1N5QA 2IM0A 1SVDA 4TN2A 2OELA 2XSFA 1GMUA 1X9MA 4K50A 2LU2A 4OLOA 4CT9A 2D9OA 3CCUS 9RUBA 1WG4A 4IDKB 2XLJA 3T5JA 1VQYA 1FFWB 4NYZA 2GCFA 8AT1B 5KFZA 3MR7A 2K2PA 4DX8H 3P45B 5H9EK 1VQSA 2H51B 4K4WA 4JI0J 1TAUA 1QVFR 3NXZA 4MJKA 1CJVB 2O5DA 5B0GA 4PRFA 4DDFA 3C15B 2P9CA 1X4EA 4OZ0A 2P6SA 1L3UA 1U2CA 2OO4A 3G87A 3RJMB 2LDIA 1DQ8A 3KJNB 4FXDA 2EFPA 3VQTA 1H38A 3OT9A 1OO0B 4ED8A 1QD1A 5F8HA 2BEFA 4IO9Q 4KH1B 3PHEA 1AZSB 4LRAA 1WC4A 4I69A 1VC6A 4RPFA 2WONB 1N4LA 4I1TA 4NOHA 3PY8A 1R89A 1N32F 2VJUA 2OD6A 2XM3A 3JYTA 3EDRB 1RUSA 2L9NA 4QIEA 1HNVB 2NREA 4JI4F 5CH7B 3A3OB 5A8WA 4MT1A 2EC0A 4FNIA 1RLCL 3KG4A 4LF7J 1RCOB 2R7SA 4DU8A 1GMWA 5GAHI 4YS2A 2OGUA 4CP5A 2LQ5A 1YKWA 2Z57B 1RWVB 4QOTA 3GSIA 4ED5A 3ZTRA 1GEHA 2M8HA 5L39A 2AQ4A 1N6QB 1DRZA 4AL6A 4Y2IA 4FBTA 2ZNYA 3QSYB 1WHVA 4BHQA 5K8PA 4O4RA 2RS2A 4BWMA 2BJDA 2AJ1A 4FKXA 5FIIA 4DG1A 3W8GA 4AL7A 2E7VA 1F3VA 3HFVA 1QSSA 5JJBA 3VAGA 1ROFA 2UVUA 2YY3A 3LUYA 2OSQA 2HVHA 2C2MB 4DWIA 4KV8B 3G2XA 4DHVA 3PO5A 5J2PA 5I4MA 4OYZA 5A8RA 1U8SA 2HLUA 2AZ1A 1YBTA 4HHUA 2UP1A 3QGGA 3ZFVA 5KOWA 1JJHA 3R1LA 3W61A 2VFUA 3EJMA 5KFFA 4FZVA 3DOKB 4DLEA 2PMWA 2HVZA 2Z2YB 4TLQA 2AGQA 2YKPA 3SFUA 2HRUA 2VBZA 4C8MA 4QIVA 3AOCA 1SH2A 2HHQA 3OR2B 5ETPA 1ZPVA 3D0GE 1QLNA 4NRTA 3KDOA 1S57A 3R5GA 1H72C 2GVZA 2XS7A 3BGOP 3NCRA 2GX8A 3Q86A 3B82A 4N56A 4PAAA 5K8MA 4QR1A 4ALZA 3B4DA 1C0UA 2XHCA 2MQMA 3AA8A 1M1KT 3UVJB 4L74A 1VBYA 4ECYA 4M5DB 1CJKA 3AXMA 4LJMA 3HHLB 4M63A 1EARA 4IRDA 2RNEA 4UZBA 2IJNA 3Q8RB 4RW6B 5E2QA 1IBLJ 2AJQA 4O3PA 1HA1A 3ISNC 3MEKA 2JLEA 1JQGA 3LAMA 4Y6IA 1VHFA 4F3MA 1GMWD 2JFKA 3CMES 4NXNF 4OHZA 3FBFA 3VAFA 4DV4J 2GHPA 2VQFJ 1IKVA 2W8LA 2KRBA 5THWA 1WD6A 3L9ZA 1QTNB 1TKZB 5F3TA 1EX8A 1HARA 2JX2A 1X4CA 4DSKA 5J2MA 2BE9B 4CO4A 3OTOF 3QJJA 2FDNA 2G0CA 1NSKL 1SH3A 4AQYJ 2BA9A 4NA1A 5E3PA 4WK1A 2DK2A 1NJZA 3Q8VA 4IH5A 4L75A 2GGPB 3RB4A 4OI2A 1WELA 4U8VA 5I3UA 5AT1B 1RAFB 1VBKA 1RWKB 3DYAB 3QATA 1WOPA 1HQEA 1QSLA 2VPYB 5L1JA 3G82B 2VV5A 5CA5A 1TV6A 1REVA 3BBFA 2FVSA 1N34J 3BREA 2H3EB 5F8LA 3CCSS 5KT5A 3AT1B 3UCZP 2YQ3A 3MFIA 3ENWA 1UAWA 1RT5B 4RBTA 1BQNA 1GFWB 3DI6B 1XMBA 1IN0A 2YX7A 4CNZA 2VOOA 5C25B 4R5PB 4OYAA 4CRJA 2ZC4A 3GYNA 3RU0A 2LXUA 3UR0A 1RABB 1QM9A 5E3AA 3DLGB 5MAOA 1CQMA 1Q79A 2HNZA 1YRXA 4QCLA 2HRTA 1Q95G 3RR8A 2Z2LA 3T1AA 4ID5B 2F40A 4FKYA 4DV3J 5DETA 5DQIA 4QPXA 3KNGA 1KP6A 3ZZYA 2O66A 5DM7Q 3BPDA 5CYMB 4K0KF 1PBAA 3HLUA 3PX4A 1FJCA 1U0HB 3KNAA 2DCLA 4OYOA 2WVDA 3KLGA 4IFVB 5AE2A 3QBCA 5BYSA 1N88A 3LP1A 4U95A 4YQWA 2KM8C 4KR0B 1HMVA 2DHHA 4Q0BB 3EX7B 2WOMB 3CC7S 4ZVTB 5J2NA 1TUWA 4CT8A 2FVQA 2CJYB 3PG9A 3IBWA 2ZH7A 2NLWA 3CJKB 4QWAA 3MM8B 4ZN3A 2KYZA 4N47A 2L48A 2JRSA 4N76A 4P73A 2H65B 2P6TA 4P75A 5CYQB 2I6WA 1D8ZA 3I31A 5C42A 3A8IA 1S9FA 1SJ1A 1LEOA 1REGX 4ZVOB 2YPZA 4IR1A 3MPDA 1R8PA 2HFSA 4KT0C 3RZAA 2GJFA 4CLYA 1KQSR 1TMMA 1T05B 1SI9A 1VQ7S 4JBCA 4MFBA 2DVIA 1RYSA 1JLGB 2BKOA 1WHWA 3GSDA 1VCTA 2DR5A 2X1GA 1TKTA 2E7XA 3KUGA 4OL8A 3BM7A 3F44A 2LKZA 4ELVA 2BMBA 3DRPA 2FVPA 4N41A 4F2SA 4R8UB 1ZAWA 4X84A 4B3SF 3NGUA 1T95A 2D7SA 2NR0A 4EYIB 2R7XA 4JV1A 3NWGA 3X3UA 4B02A 3ITHB 1JLFA 4V19X 1U1KA 1WEZA 5E3RA 4QJVA 1XBWA 4JI6J 3LP0B 3HVTA 4DBQA 3PIPQ 1KHWA 2WBMA 3M6WA 2E29A 1U45A 1H7WA 1OS5A 5CYJA 3GR0A 4PG5A 3PYEA 5AXMA 1Q8KA 1T7PA 4HHHA 1UVLA 4A8KA 4ZIVA 3OUYB 2J6TA 3FUYA 4NASA 2HVDA 1EKSA 2KG1A 3MM5A 5F8NA 2NPFA 3DRYA 3A1YG 2G2ZA 1I6JA 2POKA 3K8WA 2VBYA 4CO5A 4WFNQ 2FJDB 3H20A 1DTQB 3K89A 1Z1ZA 5D4NA 4USIA 2BJ9A 2EBGA 2ZM6F 4F4ZA 2XZTB 1XMQF 5KFIA 1XNQJ 2YVSA 2XMMA 1UP1A 4NA3A 5KFRA 1XERA 3KK1B 3N6NA 3VAJA 2H1YA 5IWAJ 4JI3J 1SQEA 4DV5J 5LSLA 4NLXA 2J8AA 2V8HA 1IKWB 3POTA 2K06A 1YRTA 2HHTA 4HHJA 2KFZA 3P96A 5HLFA 1QE1A 2DNOA 3TYTA 1EQ0A 2CVEA 3D3BJ 3DM2A 2LQ8A 3DRXA 4O3RA 1P9YA 3TARA 2HNDA 3U1LA 4KE5A 1SL1A 5BXIA 1TKDA 3SIPB 1FFSB 3BDEA 2EVZA 2AMCB 4YN3B 1UPMB 4EEYA 4PUOB 2Z4PA 2QLJB 2C2KB 4ZKAA 1FJGJ 5IXUA 1S1XB 3GIJA 5D3GA 1UW9A 1XNRF 4Y2CA 2W2MP 4TU7A 4YFUA 4Q5VA 2CRLA 4OX8A 4RW8B 4EU0A 5IFMA 2J0SD 5D0EA 4Y2AA 3TA0A 2AJFE 4ES3A 2AX0A 2YWFA 4KTQA 4LSLB 5A2QU 4JI2F 3N5BA 2C2ZB 4ZLLA 3HVRA 2BW7A 2Y0SD 1HBOA 2KKHA 2DEJA 2ZC3A 4TY9A 2XMJA 4HDHA 2NZ4A 3HZEA 2HZVA 4CH1A 1YJWS 2RE1A 5HMXA 3J81Y 2W9BB 1B0VA 2FJBB 3OW2R 3WDOA 1DLOA 1FD2A 2PMZD 2XHWA 1GK8A 2R8IA 4KKOB 3ICLA 3QJLA 2MEWA 2BV3A 1EETB 4Y34A 5GAEU 2EWHA 4O3OA 2M8DB 4IR9A 1T02A 1RWMB 3NBPA 3DGPB 4IQMA 4JV5F 3UD5A 4YMEA 4WJBA 1JLEB 4IH6A 3SQGB 3R6GB 2MKIA 5I42A 5ETLA 1S1TB 4MK8A 1YBUA 2V68A 1Q86T 2OSRA 4JI8F 5LSOA 2E1CA 1IR0A 4UOCA 1EB0A 5JXSA 4RL1A 1PYTA 1RWNB 5K5MA 2HK3A 1URNA 3TZWA 1UA0A 3D66A 4XK8C 2LLZA 1FA0A 3NAIA 2N3LA 4KFBA 1Y5IB 4G1QB 3IAS9 1S79A 4C2MA 4G65A 3C14A 1KHVA 5KFPA 4P2MA 1B7YB 5HATA 1FDDA 2XNRA 5KG3A 5DGBA 5LXYA 1T9TA 4ZLNA 1DQ9A 5F9LA 1RT2A 3MEEA 4XDDA 3ZZZA 1MLAA 4Q8FA 3IR6B 2D69A 1CJUA 1LW0B 1T11A 2W2PP 4OZLA 1YI2S 1U6ZA 1R8HA 1RTDA 3L7PA 3S6EA 4DUZF 3KLIA 4LR7A 3VV2B 1VK8A 3KYLA 1CULA 3BKUA 1ZTWA 4OV6A 1IM4A 1X5SA 3D6HB 4EMDA 3S7RA 4IG3B 3IG1B 3GP9A 3SZ2A 2MZQA 1S0MA 1HBUB 4KGXB 1JLAB 4RW4A 4CLKA 2XMUA 4TLRA 2COLA 2B0GA 2VKRA 2PI4A 3HM9A 1X5OA 2IJFA 5FD1A 4DR7J 4MKAA 5DDQC 3KHRA 2MZ1A 1FJEB 3FSXA 3S8SA 5L38A 4WTYA 3AD8C 3CCJS 1ZM2A 2XQCA 2BYCA 2QLXA 1VQ4S 3NS5A 3M2UA 2WSEC 3E01A 2R42A 1WF0A 2R7UA 3CDWA 4URSA 1YIJS 5DO2A 4F36A 1HQ2A 1GX5A 1U1QA 4RNFA 3MEGB 5C24B 1N5YA 5C2CA 1OIAA 2RDIA 5ITHA 4HEA9 2GS8A 2YWEA 5FLXY 3CJQA 3T1YF 1S9EB 1RT3A 4TVAB 4DG1B 2YKAA 1K8AT 4ZMMA 1V5IB 1A9NB 2HFVA 3IRXA 3EVOA 2GO8A 2FJXA 3DMJA 2D41A 2CAJA 3TQ1A 4J90A 4OZ5A 3HT3A 4CLLA 5BYQA 2OEKA 3CD6S 1U26A 3R5DA 5J2PB 1TL1B 3WBZA 1H3DA 1HLWA 2O01C 5I3PA 3AQOA 3X1LB 3K7RA 1SXLA 2VDHA 2FJVA 2KZMA 2D3ZA 5T7LA 1Y00A 3D4JA 3LP2A 4JV2A 3N01A 1UFKA 4ED6A 2DR7A 2YX1A 1N5TA 4P10A 3MHYA 1N32J 3M8RA 2HHWA 3NS6A 1FWKA 3R97A 2HWIA 2YQ1A 4DV7F 2DKOB 1F60B 4ZVHA 4Y2MA 4JI4J 1PJ7A 1XC9A 2G9OA 1V5VA 1KRPA 4FXVA 3M2RB 3OSNA 2W8KA 1FKPB 1A0OB 2K1RA 4URQU 5D0GA 4WE1B 3H40A 1M5OC 4LFAF 3O8WA 2BANB 4C11A 3ZTPA 2VPWB 4NI2B 2VODA 3ZXWA 2CNLB 4BC7A 2XI3A 4U7UK 1KBRA 4XAKA 5HBMA 3SSRA 3GYGA 2MY7A 5HROB 3UE2A 1VJQA 4C0HA 4DPUA 2WCXA 3WC2A 3A8JA 3L7UA 2UUAF 3H98A 2E66A 4ZVEA 5HVGA 1RYRA 4C8LA 3DC2A 1A7GE 3JQJA 3SSQA 2OPSA 2ZOGA 3G6ES 3NL0A 3HVWA 2FVRA 3JSMA 2JL9A 4F2RA 3JAMY 2LMIA 1F9HA 4H4OA 1LK7A 3IM9A 4YHHF 1UWBA 3R7BB 2C3MA 2XS5A 2LCWA 3M2VA 5KG6A 1KN6A 3OR1B 3TJ9A 1ZH5A 3I4HX 2DRAA 2HMIB 1NMEB 1EJ7L 4PKDB 1PSDA 2CQHA 3BH7B 4EO6A 2R2UA 4F4YA 1S6UA 3MD3A 4G1PA 3SCLE 5IT4A 2XBPA 4LT6A 3MAAB 2AW0A 4JI1F 1VRTA 1RT6B 2Y3YA 3W8PA 3ILOA 3OL7A 1KEKA 1W7WA 2RHQB 4I2QB 1NJIT 2V8DA 5DZ7A 3QMQA 1KLMA 2YPYA 3BGRB 1FEEA 1BD6A 3D67A 3HD1A 2DIUA 1RHKB 2DNRA 2JJ4D 1YJUA 1TP7A 3IBCB 3FEZA 4OI3A 5HJXA 3QZ8A 1HQEB 2UV8G 3V4MA 3QRRA 1NSAA 1VBZA 3PFEA 4PWUA 4K4VA 5IM0A 3TEGA 1TL3A 1XR7A 3CJRA 2GJIA 3HD2A 3EZ5A 2QYGA 4L73A 3PX6A 4UOGA 2Q79A 2W7AA 1VQNS 3AJ1A 4F3QA 3C2PA 2BUNA 4I64A 3VF0B 3PJXA 1KR4A 2W9CA 4ZVGA 1GXUA 2CG8A 2VC1A 1QAXA 1PO6A 2CPYA 2ZJPQ 1JKHB 4P72A 4DN9A 4AD6A 1HIYA 3VVTA 1S6PA 3G71S 3J80Y 1UVJA 3AB4B 3ILLA 4ZOSA 2QZ8A 2VIHA 4ED3A 3VQSA 1Y5LB 4OZJA 3VAMA 3OTCA 2MSSA 2KRRA 1RISA 4OYXA 4QU7A 3UD4P 3CIZA 1EZZB 2PDAA 4ZPBA 3U7JA 3LGNA 4NXNJ 2L9DA 1KQFB 2LVWA 2NSBA 3TEHB 1S9GB 4PQUA 1EKRA 4A8XA 3MURP 1RTIB 2NXJA 1HMVB 3BBBA 4F4AA 3IA0A 1MU2B 1S7IA 2E9RX 4WYWA 2WTFA 4QIWD 2B43A 2A18A 2IY5B 1S77D 3DHWC 5A8KA 5J2NB 4DJBA 2B6AA 3NWRA 1PCAA 2N4CA 5KFUA 2X1FA 3R5AA 4NLWA 2IIHA 5KFQA 5KFEA 1UZHA 4HT5A 4NLUA 3VHQA 1RDRA 2UVVA 1E6VB 2KT2A 2GNKA 2HVIA 4CNYA 2H5JB 4EWTA 1ZETA 3GG0A 1Q16B 3BB5A 5BJRA 1U4BA 1ZTTA 2EFNA 4DZ6A 4L72B 2WHOA 2GAGC 1BC6A 1SUQA 2ZD1B 4NYOA 3QZ7A 2MLXA 1P6TA 3K5LA 1R0CB 2AP6A 2DNKA 4DN0A 2B7BB 3IMQJ 2FGOA 2NCKL 3CDUA 1FKAF 3H59A 2GVDB 1KQGB 4F3OA 5IC6B 5LMNF 2QRRA 1SBRA 4HACB 2VH7A 3MMCA 1HHSA 3R5JB 4DV1F 5L9XA 2MYFA 3W65A 4DPYA 2VD3A 4MK9A 5LXRA 3NCQA 2ZH8A 4H4KA 1BQMA 3CCLS 1IQZA 2CIMA 5B0CA 3P8BB 4DR3J 3C6UA 4OZNA 4QWBA 4DU7A 2F4FA 3W62A 3MUVP 3I56S 1HNZF 2RKIA 6AT1B 3T5HA 2ZBRA 1NM2A 4WK3A 2UXCF 5K14B 2W7OA 2D3O1 2RS8A 4M8LA 1VIXA 1OPIA 1AB8A 4IDKA 2IFXA 5IT9U 1DURA 2AHOB 4LFCF 2K8GA 2QMWA 4Y3CA 2Q66A 2HHXA 1O8BA 4ED7A 4N7TA 1ZBTA 5CZVA 1P1LA 1IWGA 2ROPA 1CJVA 3FGVA 1AUDA 5EX3A 1VMBA 3C15A 1Q0NA 3PM9A 4OX7A 1HI1A 1VJWA 3H5XA 4Q2MA 2YWGA 3MTJA 2BABA 3KJFB 1TK5A 2HYIB 4KRWA 5BYRA 3FSIA 1Q8BA 2GZOA 1QE1B 2DGXA 4PG7A 4ANCA 2L41A 5E33A 3DM2B 2AT1B 3IR5B 1RLDA 2R3VA 3EGNA 2Z30B 2LYVA 1HHQA 4B3SJ 1LWCB 4N8OA 4OZ1A 4RBUA 4B9VA 2B8PA 2FQQB 2MJNA 2RQMA 3TX0A 2HAFA 5ETKA 1R8CA 3PTWA 4RW9A 3AFGA 4QW9A 4DPTA 1M5HA 2DRBA 1MN9A 2RRNA 1KOHA 4K2JA 2QX0A 1CS4B 3CNQP 1HWLA 1RU1A 3KLHB 2ZVSA 2OHDA 2UU9F 2KVIA 2DRDA 2ZFHA 2ZBQA 4I6AA 2IYGA 3V81A 2FIUA 2AU0A 1NK0A 3S1TA 4N77A 1HW9A 2V6AA 2J0WA 1RHQB 4USUA 1WKJA 2CXEA 1ZS6A 2JWNA 1T0TV 1YZ7A 2BE2B 3BGFA 2LEBA 2R2TA 4EUVA 2ZM6J 5CAAA 1XMQJ 1SL0A 1YWXA 4RW7A 4F04B 3HHNB 2CPFA 1DLOB 2YX4A 3TAPA 2HPUA 4YOEA 3LWMA 1U48A 3CIMA 4DXLA 4XIUA 3H7HB 4KV8A 3H2LA 4NLRA 2I1RA 3P5BP 1JJ2R 3M6UA 1M90T 1R27B 3MCMA 4P74A 5I42B 1P1TA 4ELUA 1S97A 4OI1A 5DM6Q 3K0JA 1MWZA 1V3RA 4MH8A 1FRMA 4ECRA 1C0TB 1XEZA 3B4MA 2Y9HA 3F41A 2AYMA 1RI7A 3PFOA 4LF9J 3OFHA 4UOHA 5D77A 4CO0A 2OMLA 3R2CJ 4C0BA 2XNQA 2DXDA 4KFBB 1LK5A 5H1SV 1X5TA 3DOKA 3DLEA 3C14B 2CZ9A 1T9UA 2PA3A 2ZDPA 4IOBA 3Q2TC 2OTJS 4TU9A 4WFAQ 2AKWB 4RWXA 1N33F 1FVQA 1RWUA 3OBIA 3ENQA 3RRKA 3OR2A 4D3HA 1UA1A 3D6FB 1TK0A 4CWBA 3SCIE 3I4PA 4W90B 4NA2A 2E5LF 4I6YA 4A8MP 2XCPA 4DR4J 3M30A 1IWAA 2ERRA 5H9FK 4JUZA 5HQMA 5CZXA 4RU2A 4PWDB 4NLOA 4M5KA 4FN5A 3UVJA 1RHJB 1FT8A 1TMJA 4LQ3A 2V8GA 4M5DA 3MEDA 2I8EA 1B3TA 4V1Ak 3WX4A 2IMWP 2YXLA 3I87A 4RW6A 4ES1A 3NGRA 2B3TB 2J76E 4P7TA 4GVLA 2B4UA 1YGYA 3GQCA 4J37A 3V2UC 1YK9A 4JV5J 5E7OB 3GPAA 2FLLA 1VQLS 4OZ3A 3RBZA 1U02A 1M1GA 4HT7A 2XSJA 3ISND 4U6PA 2XLKA 2BDPA 1VBXA 2VFTA 4ELTA 1WC0A 1CC7A 2YWHA 4LF8F 3P5TL 2L08A 2GGPA 1I3OB 4O3SA 2AV5A 4A47A 3SCKE 3HJVA 2V4JA 1PAEX 1TUGB 5D15A 4Z2XA 3DYAA 2MQNA 1N5YB 5KG4A 5T14A 4DQRA 3G82A 4U7UD 1P8GA 4PG8A 4Q44A 3TI0A 4FS1A 5T41A 3DI6A 3EXYA 1NZAA 2HAIA 5C25A 3AY0A 4CLPA 1Z2ZA 3RW7A 4R5PA 4DUZJ 1UWAA 3AH6A 2F8HA 1RZMA 3IRXB 4GC6A 2HSEB 3E51A 1IKXB 4PG4A 4UW2A 4KGMA 3H4DA 4X4TA 3M8YA 3DLGA 1WDDA 3PVXA 4H54A 4DSFA 3AD7C 4TYAA 5ETMA 4TU8A 3NOCA 3DLJA 4OX9J 1TL4A 2H54B 4X4UA 3LW5C 4ID5A 2QL5B 2PE8A 4FYWB 5T7LB 4OJ1A 2QLWA 4ZPVR 2CQ2A 1UPPA 3NNAA 2OI2A 5CYMA 1QAYA 1F6TA 2G1DA 2C2EA 1CVJA 5KT4A 4NCAA 3HSZA 4FYDA 3M9NB 1NBEB 1VC5A 3CC2S 1X9SA 2BOAA 3NG8A 1X9WA 5A6WA 2QA2A 4OJHA 3SXLA 4Q0BA 4ED0A 2WW8A 2W2QP 4NWBA 2K1RB 5HVFA 1AFJA 5KT7A 2GIRA 2DHGA 4LF6F 3MM8A 1RTHB 2GO9A 4A8YA 5CYQA 3GILA 1HNIA 2LEAA 3K5NA 2KJVA 3DU6A 3UI3A 1BXNA 1RTJB 3HHLD 3FC9A 4X62F 1LXNA 1NK9A 1RGVA 2R8GA 3CGIA 2W1BA 2IDLA 2EEYA 1R31A 3M8ZA 1JLGA 2KHDA 3T1YJ 2GQCA 1S76D 3BGUA 2ADCA 2OPSB 1LWEB 3VGVA 3CUNA 2ZJQQ 4TNOA 5B0FA 2N7CA 3MFHA 2KDOA 4DFMA 4H4OB 3ZNUA 3L7OA 5HQ8A 3CT9A 1CLFA 1Q5YA 1KKHA 4OHYA 3M2VB 4IO1A 1U7LA 1B0PA 2Q43A 4R8UA 4OI6A 1HHTP 1PIEA 4UQGA 1SIWB 2ATCB 4R0JA 1ZM9A 4DUTA 4DR2F 1D3WA 3ITHA 4ZCKA 4PQAA 1UJ4A 4WKYA 4CYUB 3OV7A 5LOQA 1T9WA 2XEXA 4X4SA 2CQ0A 3Q83A 1WF2A 3CCZA 3LO3A 2MHNA 3GONA 2U2FA 2YQ0A 4XPEA 3CVKA 3LP0A 3GE9A 2MZRA 3LWLA 5KFBA 2E5HA 1RAAB 3OSPA 4O0IA 4ANEA 2ASLA 4DV7J 3RYLA 4CTAB 4C3MA 2B56A 1NJYA 3BSNA 5DLGA 3A4TA 2LP4A 6FDRA 3OUYA 2M5YA 2DHXA 2ZJRQ 4DL2A 5HAOA 2ASJA 2RUGA 4USTA 2R7TA 2HFUA 4UUXA 1FRJA 4PR6A 3M6XA 2W2OP 4LFAJ 4I67A 4F0KA 3T3FA 2HW3A 2MTLA 1DTQA 5EDWA 3QPIA 1FRXA 2K7JA 1R6YA 4FVCA 2ACYA 1OWXA 2XY6A 3R6LB 3LAKA 3FCVA 2AX1A 4RUAA 1H73A 4KB7A 2ZOFA 1IBCB 2VU5A 1FO1A 1VK3A 3DLBA 5ETNA 1GQEA 2W9CB 2F4VF 3LANA 4B3TF 2UUAJ 3L3CA 3AAWB 4DF8A 3CTRA 2KG0A 4DPOA 3OVAA 4YY3F 1Q7LB 3J7Z5 3IN5A 1C4AA 1WJ9A 4E0DA 3I82A 3AD9C 2HFOA 1J5OB 1CC8A 1U24A 4DL5A 2IM3A 4ECXA 2AYBA 2HK2A 4RUHA 3GR1A 4C48A 1KSPA 2CPXA 3J7YU 4NPOA 5G0RB 3DLKB 2DH7A 3KLEB 4HLBA 2HGLA 2NSCA 1X5PA 4LMZA 5JMNA 2RH3A 3SDEB 2QLBB 5GAEI 4J5OA 4JI1J 4P2FA 2EG2A 4USJC 1NSPA 3D7SB 5M2RA 2R7OA 1WOSA 1U1LA 3KLVA 4GC7A 3DOMB 4R0EA 5M2PA 3QO9B 4EO8A 3ZC4A 3WIVA 1P27B 1HWIA 2GHVC 2CPDA 1DQAA 1RKIA 1IVZA 2UXDF 1RWOB 2JDJA 5F8GA 3OLAA 5HO4A 5DG7A 4CLFA 1VLYA 3KOAA 1UZDA 4TXSA 4LRBA 4DEZA 4A4JA 4HKQA 5D6GA 5CD4H 1URRA 4OHWA 3R5CA 2IVMA 2RJZA 1WG1A 3THVA 3HFKA 2EI5A 2ZWOA 4LSLA 2J9DA 2W7PA 3HX9A 1QAJA 1L3TA 2DXEA 2E1PA 2MZJA 2J7KA 3GU0A 1MMDA 2OAUA 2W9BA 3LA0A 3P6YC 5CCLA 2XZWA 2ZBPA 3ENVA 3OVSA 2H4YB 1TKXA 3PR5B 3HI9A 1EETA 3RGIA 2IJRA 3EE3A 2DB1A 3Q8PB 1JLEA 2NXUA 4K4TA 2V67A 1F2GA 5KG5A 1S1TA 5DG9A 2Y1LB 2MMYA 1X0PA 2IHR1 2CZVC 3MWBA 1R0AA 3C6UB 4QQBA 1Q8LA 1PYOB 1IUJA 2VHGA 4CH0S 2KHCA 3HSGA 1Q82T 3ILJA 1YITS 1RBOB 1FRIA 3W3SA 2QL9B 1NSQA 3IWXA 1RHRB 4KYZA 5D78A 1BUXA 2DYAA 2NXNA 2IA0A 4G1QA 3BSCA 3NS7B 4P7VA 1OJ4A 4B08A 3PEJA 4F7VA 1U25A 5BR8J 4Z7CA 4DS5A 3L95X 1U2FA 1Q4RA 2D9PA 5KAKA 2RSQA 4GO7X 2KXFA 4ICLB 1MG7A 1S1WA 3SEOA 2P5VA 3MM7A 1W2IA 2JEFA 1LW0A 2QFIA 1HW8A 2RT3A 2NYIA 1H98A 1D8YA 2HZAA 2EKYA 4ZLJA 1T03B 2UV8A 2R7RA 3JTOA 4IG0A 2OIHA 3ELHA 4P2XA 3J7A1 4OIXA 4PXDA 2MKYA 3KLFB 2HEKA 1KVKA 5KG2A 1OMSA 2P9EA 1RWPB 4IG3A 4ITSA 3RUBL 3IG1A 2FJEB 1XIQA 1YJNS 4DV0F 1M5SA 2R7WA 2L9WA 2ZEJA 3IO1A 1HBUA 4DLGA 1QJHA 1TK8A 1JLAA 4MYUA 3FFIB 3EVMA 2XS2A 1RWWB 3BEGB 1V3SA 3I5AA 4RW9B 3MR5A 3HHDA 2MGZB 5IQ6A 1IM6A 2BJ7A 4CLSA 1I94F 1RU2A 1NPKA 1TTHB 3MAQA 4KHPF 3WHIA 2ZHBA 5KFJA 4FF1A 2YH1A 2IRYA 2XG8A 2ZNZA 2ZE2B 3FMBA 4Y28C 1C1BB 5HN0A 5F41A 3TA1A 1HNZJ 3PDNA 3FKBA 1OSCA 2UXCJ 4WFYA 3FBBA 1WWHA 2EW9A 2V2QA 3GJRB 1FESA 3V81B 3UCUP 3ISZA 2VFRA 3FZ2A 1X60A 2B9XA 4IRKA 3MEGA 4LQ9A 3CCMS 3SQOP 5C24A 4ED2A 1YJ9S 2F63A 1N48A 4H4KC 2NYHA 5F8JA 3GJTB 3ULHA 3PIOQ 1M5PC 3MM6B 2HGMA 3BKTA 2OFGX 5ETTA 3VAIA 2QSFA 4MIWA 4W4MA 3TP2A 1S9EA 3GWCA 2E1AA 1WDTA 3R7SB 1VOMA 1RP5A 2JC1A 5D0RA 3CD7A 4RW7B 3AODA 1S6OA 2PO4A 4J9VA 2ZZNA 2VPZB 4UF4A 4KH0B 4QR0A 1VI7A 1A6LA 2HBZB 1RSCA 4RX6A 2VF3A 1YDLA 3D2WA 2IMOA 1TUVA 3MXHP 3K5PA 1TL1A 5J1PA 4J7CA 2JVOA 3TJAA 4ZLPA 4LRCA 3NNHA 1BMQB 4X2BA 1U1OA 3BBCA 1C4CA 4L76A 5AXKA 2WRMA 1SJRA 3CDEA 2EFVA 2KB2A 1P9QC 3IXQA 1S1VA 4CO2A 4ID8A 4P9SA 4DR5J 1RT1B 4QWDA 2W9AA 4YEAA 2OJ3A 4ECTA 4NXMF 2QG9B 3LOUA 3RAMA 5AE3A 3S01A 3KJVB 2ILZA 4GKKF 3DLEB 1IBLF 4FNHA 3RBDA 3M2RA 1UKUA 1FKPA 1SL2A 2WVEA 5F8MA 3H8YA 3T1HJ 2DGQA 4WE1A 5ETVA 2UU9J 2BANA 5KT6A 2J6UA 2VQFF 2WSFC 4WTOB 1PBUA 4NI2A 1ITPA 2PSZA 1T3NA 1X7VA 4C7QA 4HR2A 5HROA 2J0QD 2DGTA 1HWKA 4B3MF 4LR9A 2X1BA 2QFJA 4HDGA 3K8VA 3M30B 1M1HA 5L1LA 5B09A 3D28A 1CEZA 1NH8A 8RUCA 4UOFA 1N54B 4ZK7M 4WXWA 2VQEF 2CWXA 2VFVA 4WZMA 4GKJF 3MEDB 4I7FA 2DJWA 2B51A 2Z2ZA 4Y65A 2BJEA 2QJ3A 1VISA 4WPAA 5ETSA 5L46A 3BV8A 1BWVA 2R7QA 1UL3A 2VG7B 3D54A 3OR1A 1S49A 2RU3A 1UFWA 3KXDA 2C3YA 2HMIA 1PYSB 2ADBA 2HURA 3RBXA 1KWMA 4FYYB 2FLNA 4DV2F 1ZOTA 4J9KA 3TAQA 2PN6A 2WAQD 2OPPA 5J1EB 1ZPWX 1MWQA 3MAAA 2QV6A 1FRHA 3W63A 4RR5A 2DH8A 3QRQA 1RT6A 2V0NA 1FXRA 2XSJB 3SMZA 4I2QA 3TR5A 3I0RB 3Q8QB 3W5XA 2X7IA 4DPWA 4YDDB 1IBMJ 4B9MA 1T8EA 5CABA 4ERDA 1PGZA 3BGRA 2OEMA 3GB0A 5ETOA 2FHJA 2QA4S 2BKNA 3TUPA 1S0OA 4KPYA 4XO0A 4USKA 1KONA 2V4JB 1OYDA 1VYAA 2HNYB 3EPIA 2ZWPA 2C42A 4NMXA 1UFLA 3CDAA 3WX8A 5C5JA 3MECB 5DDOC 1HI0P 3BS9A 4J9MA 1YJ7A 5IV4A 5M2UA 1FEHA 1HBNA 1G7CB 1RAJA 1N0UA 1NLKL 4C8NA 1JK9B 2M2BA 4UY85 4H4MB 2HVEA 5KFMA 4LF5F 4UY8T 3GIKA 1FVSA 4X4VA 4USMA 4IKAA 1RHUB 2KN4A 2E9TA 1U6BA 1IJEB 4E98A 4ZVUB 1OQ6A 4RJVA 4Y0FA 2MZTA 4Q8EA 3IGNA 2KO1A 1JKHA 2C2DA 3PX0A 3NRBA 4OHXA 1C2PA 2DY9A 2VONA 5GMDA 3CC4S 3CCWA 2QLFB 1GNKA 5JUMA 5DGAA 2ROEA 1NZ8A 4ZP7A 4KAIA 1CPZA 4ETZA 2HBRB 3PZPA 4F4WA 4FS2A 2XI2A 1YVFA 3PXGa 2F8MA 1T3OA 4OQJA 3RB6A 1KFSA 3Q22A 2WSCC 3N4WA 3CCES 1L3KA 1S9GA 3L4BC 1ZM3A 2VC0A 2BZ2A 3QQCD 4G6VB 4BC9A 4A8SA 1RTIA 4WP8A 2F9DA 1MU2A 4O4GB 3HHLC 3V4IB 2BQRA 2RAQA 2R2SA 1L5UA 4NRUA 4HH0A 3ADAC 2JVRA 1TR0A 3BKFA 3CCQS 2WK4A 3NCPA 4YR2A 4FPIA 2WB4A 5DJBA 3NGTA 2MKKA 1R3NA 1HNIB 2PD1A 1NRKA 3AB2B 3O44A 4ZA1A 1E6VA 3TAMA 1NO8A 5E41A 3M32B 4P71A 4DR6J 3PRBA 2KT5A 3CDBA 2KJWA 2RIJA 3D6TB 4X4QA 1WKKA 1H7XA 4LREA 2ZD1A 3DOLB 2E9ZA 2YNIB 3KK2A 4PEOA 4CO3A 4AUKA 1UVKA 2WB1D 4LF4F 5K8OA 3O2IA 2QMUB 1CBKA 3ETMA 3UN2A 3Q24A 2GVDA 3N9UC 2XCAA 3IS9B 3GJSB 1S7HA 4HACA 2EXUA 1VLOA 5GAGI 2FYXA 1TVRB 1KDNA 2B5JB 2QC3A 4CLTA 3OHBA 3I32A 3M05A 2AEJA 3K5MA 3IM8A 4RU9A 4M5GA 3R3TA 4TY8B 1KOOA 2LXIA 4NLQA 5IWAF 2LU1A 4S0MA 4ES2A 2H4WB 2JSXA 1NPRA 1IR2A 4KY3A 2Z8QA 3IFEA 1HNWJ 3TUJC 2DNYA 3OTEA 1R43A 2VZ9A 4QYZJ 4IYQA 3N6MA 2O1PA 3H90A 2HQCA 5K14A 3QGHA 2MLZA 4MYTA 1TZ0A 4DR1F 2CPJA 2IAJA 5A2QY 4TQRA 4LR8A 5C7PA 3HCXA 4LF6J 3PHTA 3TUZC 2HS0A 1UEKA 5B0EA 4K4YA 3UPFA 4ED1A 4N8NA 2V69A 1UEVA 3AHPA 1RB0A 5E3QA 4DPXA 3GCWP 3D9BA 2W4CA 1S1UB 2ZH2A 3Q23A 1NK5A 2V34A 3M1VB 1U2RA 4X62J 1FTCA 3PW2A 1XN9A 1Y3KA 1EHWA 3LGHA 3LGMA 1B7FA 1O5JA 5K9FA 2QN6B 3EDQB 3MPVA 3GLJA 3PW4A 4OYIA 5B0DA 3T6BA 1Q78A 1Y11A 1ZZFA 3UDLA 4A8WA 2MY8A 2NS1B 4U7CA 1WC6A 2K3IA 3E8OA 1LWCA 1B64A 3OTBA 1NKBA 3UN5A 1YSJA 2BQUA 2Y1JA 3GFZA 5DQHA 3M8QB 3EVWA 2BR0A 2CA9A 3VZIA 4WU2A 2RMLA 3D1HA 2LDYA 2V50A 2J5AA 1CS4A 4KPCA 3ILIA 2ZITA 5HJYA 4YB5A 3KLHA 3U1MA 2VA3A 1FERA 2VDIA 3NOGA 4RO0A 5KTQA 1HQUB 2OEJA 1KTQA 3KDNA 1KS2A 3DNCA 4ILRA 3CJ5A 1RBLA 4WXOA 3ZTQA 4IFYA 1U49A 3OJSA 4K5SA 1KNZA 4A8OA 1LW2A 3SV3A 1JMTA 1S12A 2XZDB 3DU5A 1AYEA 2YKMB 1M5KC 1PAUB 1V9OA 2BE2A 4ENOA 1PJ6A 4BS2A 1TFWA 3TZYA 1D1UA 2CNOB 4ZJQA 4ZVFA 2F4VJ 4DMZA 4B3TJ 2D3OR 1WI8A 1B70B 3T6JA 4C6AA 1M5VC 2M70A 3DXBA 3H42A 1MN7A 4OJGA 1RAOA 2KFYA 2KH9A 1TKXB 4YY3J 1U6FA 2B8QA 2E5GA 3QJPA 2C3UA 2HIYA 3N6LA 3G4SS 1E6YB 3K17A 3CSKA 1F9FA 1T9YA 5FDLB 3BN7A 1WC1A 5IT0A 4A46A 2ZH1A 2HS4A 5KFSA 1R0AB 3IWNC 1C0TA 4DQQA 5HK4A 2PIIA 1AUSL 5HI7A 2W4PA 4HTIA 1FWLA 1F5BA 2OPRA 1FKOB 2IA6A 1UVNA 4FYVB 1JNRB 1ELOA 2C2RA 3Q8UA 2ZBCA 5CD4A 5HSPA 2ROGA 1MNEA 1Y4ZB 3PO4A 2CQDA 3TW0A 2Q6CA 2DNNA 4USWA 2B4PA 1IR1A 1VDHA 1MMLA 3VGSA 2V8VA 5KFOA 2XO6A 1S1WB 3ZZTA 4K59A 2DO4A 2UXDJ 2B9YA 3MM7B 2KFNA 1NK7A 3FMWA 1U1RA 2VG5A 2XB2D 3GV5B 4XTTA 3ZO7A 3HT0A 4I68A 1X8DA 3VCDA 1U09A 1DBDA 2IM2A 4DFPA 1SJ4P 2W2NP 2GC8A 1HBMA 1FX2A 2Q6BA 4A8QA 3VVUA 4NLGA 2PEHA 2RVJA 3MI7X 4IG0B 5ADZA 3R8YA 4LBIA 4OLPA 4PWDA 5L1KA 2AZ3A 3K57A 4ZITA 1IKYA 5HP1B 1VS3A 3MPUB 1QUVA 4GVBB 2NQPA 1WC5A 3P3DA 3RG6A 1XJWB 1X4GA 4RNOA 2ZKUA 4Y2KA 3CMAS 2FTRA 1F9EB 4I6WA 1RAGB 2FZGB 1XMOF 1CJTB 2R7VA 2KXNB 5DS7A 3NY0A 1WUUA 1HR0J 2IDEA 1OYEA 1N0VC 4ZCMA 3OHAA 4DSIA 1SC3B 3GV8B 2KT3A 3FCHA 2JC0A 3ZZ0A 3CJ3A 1Q8IA 4X66J 3T5KA 4KSEB 3A3NB 2CG4A 4I2PB 4X64F 1NB2A 5D4PA 3W66A 2G1HA 3TO8A 2FD2A 1HKAA 3EM1A 3BYRA 2GA7A 2Z56B 2XYHB 3GIMA 1WSVA 3PNIA 3G6YA 3HDSA 4QU6A 2G2YA 3A12A 2ALZA 3BYPA 3W2WA 4ECWA 2BW2A 4IOAQ 4EZ9A 3MUTP 3QLHA 2QYCA 1RJJA 1SC6A 3A8EA 1HYSA 4DOZA 3TVZA 1H74A 5L9NA 4NLYA 1T94A 3BH6B 4GMKA 4K4ZA 3ZTOA 2CJXB 2HLTA 4LIRA 3FBCA 3OQ2A 4NCGA 3R1HA 2RD5C 2XWYA 2RRAA 4AE5A 2JLGA 4Z7YA 3UDEA 4DSLA 3MMAB 1H0HB 3SSSA 4Q7AA 2EC2A 1WTBA 4A8FA 4U67Q 3FK4A 1IKXA 1RAHB 1YRUA 2DD8S 2BOPA 4K4SA 2YTCA 1DZ5A 1GXTA 2PFDA 2EFQA 4DV0J 2MKJA 3T19A 1I1GA 3BO4A 2CKWA 2N3OA 4ZHRA 1NKCA 5U47A 4M5NA 2VBXA 5I3QA 4WZQA 1IXKA 1PKUA 2CVIA 4J91A 2X3DA 3FVYA 3HVAA 1S1VB 2FLOA 4J9SA 1VQKS 4F0MA 1G4CA 3JS9A 3HXMA 2V2KA 5KG0A 4OI0A 3QYYA 4AFFA 2M3DA 1T9VA 1I94J 2IVFB 3FBEA 2UXBF 4K4UA 3C66A 7FD1A 3LQVA 4JI7F 4KHPJ 2AJ2A 4YB7A 2CJAA 3KFWX 3VAHA 3AJ2A 3BQ1A 4EK2A 2E1MC 3OJUA 1RTHA 3NMAA 1SQGA 5EUHA 2JEIA 3TQEA 1RT7B 3AJDA 2M7SA 1JLBB 2YKOA 3NGSA 2GIFA 3EYZA 4MAKA 2QSWA 3PJWA 2NUUG 2N4DA 2AWZA 1RTJA 1ZAVA 4B9TA 3F73A 2HHUA 1GT8A 2IRUA 1AW0A 1BY9A 2Y8WA 5KFHA 3I0SA 5KG7A 4OYWA 1LWEA 5L8RC 4I7FB 3KTQA 2X1AA 1DARA 4FDFA 3MTKA 3THPA 1K9MT 1UVIA 3GCXP 4PXCA 2IC3B 1C1CA 1RQ0A 4AT1B 2MQLA 1LOUA 2KXHA 2HIQA 3IWLA 2QA4G 4KHRA 4CYUA 2OPPB 2UVRA 2D1CA 3T9NA 2JFDA 4YDXA 4CZCA 4I56A 2YNGB 2KM8B 1R8BA 1WOOA 3KHHA 1Q81T 2P2CB 2DO0A 3J7YI 4NXMJ 2JHEA 1UETA 4CTAA 2RF2B 2BVZA 3KK3B 3BR9A 5AE1A 2A10A 5A0YB 5CXTA 1RA6A 2PMHA 4GKKJ 1S6QB 1N5SA 4CO1A 1LFWA 1ULRA 1DTTB 3O3LA 5CHCB 3QAUA 5K8NA 3B8HA 2CPHA 4NLDA 3VGUA 2RDDA 1HBNB 2GMHA 3FZBA 1LWFB 2FPHX 1WHYA 4QWCA 1NHUA 2C2NA 3P49B 3D0IE 3MOZA 4RUBA 4NMLA 4ANDA 4B3MJ 1VRUB 1NNDA 4C98A 3EWGA 3HMJG 3H5UA 2VQEJ 3J81j 2A2DA 4B17A 2DGOA 1OSDA 1S99A 3QGIA 4GKJJ 1XR6A 5SZTA 3I6PA 2XC9A 2Y1RI 3C16A 4QZVB 3QT7A 3IAM9 1XQIA 4FYXB 1J5OA 4OV1A 4USHA 4WIQA 5IZHA 3TVKA 1YG0A 2I9SA 2MB0B 4X4OA 2DY1A 3H2UB 3DRRB 4C8OA 3NKYA 4Q45A 5G0RA 3DLKA 3V6DB 3KLEA 3K58A 4O44B 1K47A 4F0HA 3RAQA 4DV2J 2AGOA 5LSRA 2ZH3A 2LQBA 4EBCA 3SDEA 2CQBA 2H9ZA 3ZZUA 2P9GA 2XY7A 2CPEA 3OFFA 1FI4A 5IT9Y 1FDNA 1YJVA 3QWUA 3DOMA 3A3PB 3OTOJ 4IOCQ 5B0BA 3QO9A 2AEFA 4ECUA 2G0JA 1SKSA 3B78A 3W2VA 1OQ3A 2B4OA 3CO0P 5KG1A 2HWTA 1H6KX 1NK8A 3RRHA 3QT5A 4DR3F 4KQZA 1MROA 3TAMB 4FVMA 4E2FB 1Y9OA 4LRDA 4RUCA 2WVBA 5GMKa 1N36F 4M1KA 1W2BR 2XMVA 3QAEA 4A48A 4V19J 2G0IA 1JXVA 3KK2B 3TX8A 2ALYB 4LF5J 5H9EJ 1AXQA 1VQOS 1LV5A 4X4PA 1FJ7A 4E8UA 3HF5A 3QT6A 2HKEA 1DJ0A 1HWUA 3UO0A 5KFVA 2PI5A 2F8EX 1GH8A 4X65F 2AJ0A 4J9OA 4PABA 5JVHQ 1OY6A 2JOQA 3OL8A 2R4FA 3RB3A 2YWWA 2IVYA 3PW0A 3JTPA 3JSBA 2BACA 3MDFA 4K0KJ 3MM9B 1FXLA 2DHAA 5GVQA 1JLQB 3UW1A 4DF4A 3QNWB 3I9V9 4FF4A 3OFGA 3EMTA 4ETXA 3OLBA 3SBMA 3PKYA 3FEYB 5JVGQ 4IRCA 2XGQA 1YHQS 2V94A 2Z58B 1CQNA 1HL6A 2IAJB 1RAIB 2RUSA 2XULA 1L3SA 3LALA 2UUCF 1WTFA 2MQ8A 1NDPA 2CNKB 2M0GB 4B3RF 2XWXA 3K5OA 2QMXA 5DDRC 2DITA 3F0NA 4ICLA 3GFHA 2MJUA 1TL7B 1RWXB 1FNOA 3UNYA 4ZVSB 4C97A 2BKPA 4CLUA 3CD0A 1K44A 5HL7Q 1FHTA 4P2SA 4WIIA 3JTNA 4NZ0A 2FHMA 1EP4A 5ETRA 6FD1A 3OFEA 4J9NA 4HI2A 2J7UA 4LBHA 1U1PA 5KFTA 1T03A 2RILA 4OYMA 4D3GA 5GAGU 3BF4A 4PYAA 3RB0A 4M5IA 3I96A 1SKWA 3RAXA 3FQLA 3KLFA 2C2OB 5E0OA 2E5IA 2N7YA 2YNHB 4K7QA 1JJCB 3G6XA 4IQXA 4LF4J 2UVWA 1SH0A 3W5YA 4WP3A 2GMJA 1LKZA 4YP3A 2HBQB 2A6MA 1J2VA 4RNMA 3FFIA 2DXFA 2FUG9 1KC8T 4WFXA 4HTJA 3K59A 2I5JB 3BQ0A 2UUWA 2MXYA 3OVBA 3FCWA 1S10A 4HL9A 4U8YA 2OP5A 2MGZA 2HS3A 3JSRA 1MW7A 5DZ6A 2HFNA 3GIRA 3BR8A 2P8IA 3TUIC 1Y5NB 1FDAA 1YLXA 2ZE2A 2EBEA 1C1BA 3HPOA 2LA6A 2DNPA 2V2ZA 2C3PA 3IC1A 4RNNA 1K73T 1PJ5A 2KYXA 3H5YA 3LF0A 4LF1A 1K1SA 3GG1A 1RT4B 1TELA 3I5CA 4DR1J 4K5RA 3RTVA 4MIAA 2M4MA 3BDPA 4IFYB 4OYBA 3Q89A 2ZZTA 1R0BG 2G4BA 4F25A 3KWMA 1EIYB 1HD1A 2J7WA 1LW2B 4LF9F 1R6VA 2I0XA 3HJFA 3MM6A 2PT0A 4ZP9A 3MR3A 2HQFA 5E5NA 3TZZA 2DGWA 1VQMS 2B7CB 4DL4A 2HWHA 3ET6A 1JJ4A 3D68A 3DRSA 3M8PA 5GADU 2QIFA 2VICA 1D9DA 5DQGA 2FY8A 4PXBA 3EZOA 3CMQA 2MDAA 5J2QB 2X3GA 1FXDA 3GFXA 3MF5A 9ATCB 1NJWA 1S0VA 1UJ5A 3MMBB 4JI5F 2VA2A 1FF2A 5KFWA 3W5ZA 2ZBIA 4OJ3A 1YJRA 4W98A 3THTA 4J9RA 4DR4F 3QRPA 1RE1B 5AXNA 3OPKA 4JP8A 1VR6A 1GXLA 2E7WA 2V2VA 2CQ1A 2OPRB 5KFLA 3JXOA 2ZDOA 1BLUA 2LQJA 1X4HA 4PZVA 1M0SA 1RT1A 3H5SA 2O3DA 3RRGA 2E44A 2KVQE 1X31C 3KJVA 3T9ZA 2WVFA 2RQCA 1JB0C 3RR7A 1WC3A 2HZCA 3BSAA 5F0WA 2VG6B 1FX4A 2F9JA 2JLFA 3JB9k 1XNRJ 1TQLA 2GJ2A 2DH9A 1NDCA 2BE7D 2VG5B 4NZ6A 3UQSA 2FJWA 1NKEA 4WF9Q 1ICEB 1O6XA 3PRDA 1JWWA 3E3XA 1EAYC 4BBYA 4Y00A 5B0AA 1HBMB 2D74B 3O5TB 4B9SA 3EPGA 2YKNA 3BGLA 4JI2J 4KO0B 5IOLA 1SJQA 1QSYA 3ZZRA 4MTPA 1RTZA 1VGYA 1IKYB 4EYHB 4RNHA 1X0FA 2CFXA 3HULA 3UDCA 2E5JA 4JB8B 2N82B 4AXJA 1HFEL 2Z2MA 2EKNA 4LFBF 2VG7A 1F2HA 2CQIA 5CCMA 5HMYA 3NNCA 2ASDA 2W4DA 1OY9A 2LFVA 5J1EA 4L3NA 4JI8J 4LBPA 1RADB 4ZDNA 4AXIA 3FEXB 3I0RA 2X51A 1FDBA 1VQ6S 3CEDA 3DN9A 4DFKA 1LFPA 2CNNB 3AOBA 4TKTA 4RKUC 4PWWA 3LPYA 2A0FB 1ZAXA 3BZQA 2GQQA 2F65A 4OX9F 2XMWA 1SC4B 2JEGA 3J7AN 4DFJA 1BGXT 4TQSA 2KZZA 4CQ1A 3J81U 4K4XA 3W2WB 2K7KA 2HNYA 4ZS6A 2DPIA 2HHHF 1SJ3P 2RQ4A 1OY8A 1IBKF 5SUHA 2ATLA 3MECA 3OXFA 2XMAA 3OD2A 3CULA 3QLHB 3JYTB 2V5HG 4DS4A 1TFYA 3CJ4A 4F02A 1QDUB 2NUHA 3FNNA 1R7IA 5IQQA 1HYSB 4LSNA 2EK1A 2HQDA 5A8WB 1VC0A 2DCUB 3DLLQ 1WSRA 1WG5A 4H4MA 3UCGA 5HMWA 3CJSA 1RBAA 4NCGB 2OLWA 1RCXB 1X4BA 3V6KA 4DQSA 2CQGA 5K20B 1D9FA 1Y3JA 2Y8YA 3QGPA 2E1RA 4UZCA 4OHVA 3VGTA 4C0OC 1O0PA 4DX7A 2PA8D 4B3OA 4OX6A 2R8KA 4NL5A 3VWSA 2LEPA 4ZHRB 1XMOJ 2CJ9A 3MCSA 4NLSA 4FBUA 3CCTA 4LRFA 2M88A 3Q8SB 2EPIA 1GTEA 4J9PA 4BCAA 2I2YA 1YBAA 3CB4A 2KL8A 4DV6F 1G1XA 1RHMB 3MUMP 4OYPA 1VRQC 4MKYA 3AQPA 4O4GA 7AT1B 3CJTA 4ZP6A 4X64J 3K2YA 3V4IA 4ER8A 3SYZA 2H5EA 5A8RB 4PG6A 2GW8A 2Y0BB 3PACA 1TU0B 4ZP8A 3DHXA 5GAHU 1IJFB 3AXKA 1BHNA 3I55S 3G8QA 5D4OA 3C19A 3DGVA 2RB7A 3M32A 4BDPA 1X4DA 2OPQA 3JSYA 4DSJA 4NZ7A 3PV8A 1G2EA 2V4QA 3E2EA 2IPOB 3I0SB 3A8KA 2JNJA 2BJ1A 3NGDA 2GFFA 3B54A 3DOLA 2CWKA 2YNIA 3TNVA 1WACA 2G2OA 4O23A 4HH1A 1G6BA 4EFAC 3H0PA 3G8SA 3TVYA 2DEIA 1OPZA 3W7BA 1Z2LA 2GIQA 1FD8A 1B0TA 4M95A 2MLYA 2UUBF 1C1CB 1HD0A 2AJ4A 4WWSA 2FLPA 4ZN1A 2LXFA 2IM1A 3IS9A 2MKCA 4DCJB 4M5MA 5LMUF 4YB6A 1RK8A 1R8AA 1TVRA 2GVZB 1G3OA 2B5JA 2DIVA 5G4DA 5EGYA 3OL9A 5D4LA 2AYGA 5ETQA 3R9LA 4DL7A 1K0TA 4FF2A 4TYBA 2V8PA 4KGKA 4M5JA 3DLHA 4TY8A 2M52A 5AJ3F 1C0UB 3H25A 3W9JA 3M4XA 3HZGA 4B9LA 2HGNA 4C8ZA 4U96A 1SCJB 1FRLA 1QTMA 5FLXU 1WI6A 2ZZMA 1CJKB 1HI8A 1UW4A 4N5SA 4CCHA 3KG0A 2C1EB 3UN3A 2UXBJ 4JI7J 2OMOA 3BPSP 8ATCB 1VHIA 1FFGB 3W60A 3WC0A 4PXEA 1UJ6A 3OXGA 1XTZA 4M5HA 2HRYA 3QIPA 4NE9C 1B4SA 3PYFA 2CQ4A 5HVHA 1IKVB 3D6MB 1KLNA 2EK6A 3HO1A 3SCJE 2QT7A 1TAQA 2Q3PA 1L3VA 1S1UA 4C4WA 2DR6A 5J2MB 3P4UB 3M1VA 2H5IB 4MIBA 2VB6A 3UNGC 1U47A 1QY7A 5AXLA 1ZZNA 3QT8A 2EG1A 2HHPA 4G3IA 1WHXA 4DL3A 2QTWA 5I3UB 2ZHAA 1GMVA 2FHOB 4WU3A 1Y7PA 3C16B 3J7ZT 1TV6B 2BRKA 1REVB 1F5AA 2QGFB 4YHHJ 2QEXS 3V5RA 3VZHA 4YR3A 1LQ9A 4KHMA 3C46A 3DXSX 1J5EF 4C3KA 1K1QA 1BQNB 3NLCA 3MAHA 2AD9A 3TWZA 4B9UA 4I4BA 1U0SA 1Q1KA 3EICA 5HQLA 2UUTA 2ZH9A 1F1BB 5EN1A 1JLCA 4DUYF 1FNXH 1BWEA 3M8QA 2CZ4A 1SJFA 3GJQB 3KUEA 1U8WA 1NEEA 2OFHX 3ONQA 4CDIA 4QWEA 2KU7A 1YJTA 1FE0A 3U1NA 1GX6A 3RBEA 2HNZB 2R8HA 2GV1A 4ILLA 1YTYA 5J1NA 4F8RA 3W2VB 4M94A 4W92B 1HQUA 3NMRA 4CLZA 7FDRA 2VFSA 1HNXF 5KFYA 1AA1B 3SV4A 3JAMU 1MROB 4NX9A 2C22A 1N52B 2HG4A 2FVCA 3KLGB 3LP1B 4JYAF 2VPXB 2MKSA 3HSDA 3ZZPA 3CF5Q 4DI6A 4HVZA 2BXJA 2YKMA
chains in the Genus database with same CATH topology
1GFWB 1RHQB 2QL9B 2CJYB 3RJMB 2XZDB 3IBFB 4ZVUB 2C1EB 1RHRB 3R7SB 1SC3B 1PAUB 3KJNB 1ICEB 1RWWB 1I51B 2P2CB 3NS7B 2CNKB 2CNNB 1SC1B 2H65B 2QL7B 2CNOB 2XYPB 2H5JB 2QLFB 2FQQB 2HBZB 1RWXB 2C2ZB 4ZVSB 5IC4B 2CNLB 3GJQB 4ZVPB 1SC4B 4ZVOB 2HBRB 1QTNB 2CDRB 3D6MB 3D6FB 2H48B 2HBYB 1RHKB 4DCPB 2H54B 2XYHB 1RE1B 3IBCB 3EDRB 2QLBB 2QL5B 4DCJB 1BMQB 2H4YB 2C2MB 1RHMB 3P4UB 2H5IB 1QDUB 1I3OB 2XYGB 3GJSB 3SIPB 3GJRB 3P45B 5IC6B 2H51B 2C2OB 4JB8B 2QLJB 2C2KB 3R6LB 1RWMB 1RHJB 3R5JB 1RWKB 4ZVRB 2Y1LB 1IBCB 1F9EB 3KJQB 4ZVQB 2Y0BB 3R6GB 1RWOB 3R7NB 3QNWB 1RWPB 3D6HB 2CJXB 3GJTB 5K20B 3R7BB 1RWVB 2XZTB 1PYOB 3KJFB 2DKOB 3EDQB 4DCOB 2H4WB 2HBQB 4LSZB 1NMEB 1RWNB 1RHUB 4ZVTB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GFW B;  1RHQ B;  2QL9 B;  2CJY B;  3RJM B;  2XZD B;  3IBF B;  4ZVU B;  2C1E B;  1RHR B;  3R7S B;  1SC3 B;  1PAU B;  3KJN B;  1ICE B;  1RWW B;  1I51 B;  2P2C B;  3NS7 B;  2CNK B;  2CNN B;  1SC1 B;  2H65 B;  2QL7 B;  2CNO B;  2XYP B;  2H5J B;  2QLF B;  2FQQ B;  2HBZ B;  1RWX B;  2C2Z B;  4ZVS B;  5IC4 B;  2CNL B;  3GJQ B;  4ZVP B;  1SC4 B;  4ZVO B;  2HBR B;  1QTN B;  2CDR B;  3D6M B;  3D6F B;  2H48 B;  2HBY B;  1RHK B;  4DCP B;  2H54 B;  2XYH B;  1RE1 B;  3IBC B;  3EDR B;  2QLB B;  2QL5 B;  4DCJ B;  1BMQ B;  2H4Y B;  2C2M B;  1RHM B;  3P4U B;  2H5I B;  1QDU B;  1I3O B;  2XYG B;  3GJS B;  3SIP B;  3GJR B;  3P45 B;  5IC6 B;  2H51 B;  2C2O B;  4JB8 B;  2QLJ B;  2C2K B;  3R6L B;  1RWM B;  1RHJ B;  3R5J B;  1RWK B;  4ZVR B;  2Y1L B;  1IBC B;  1F9E B;  3KJQ B;  4ZVQ B;  2Y0B B;  3R6G B;  1RWO B;  3R7N B;  3QNW B;  1RWP B;  3D6H B;  2CJX B;  3GJT B;  5K20 B;  3R7B B;  1RWV B;  2XZT B;  1PYO B;  3KJF B;  2DKO B;  3EDQ B;  4DCO B;  2H4W B;  2HBQ B;  4LSZ B;  1NME B;  1RWN B;  1RHU B;  4ZVT B; 
#chains in the Genus database with same CATH topology
 3TZX A;  2C28 A;  2A1B A;  2VAS A;  2FC8 A;  5BR8 F;  3LH2 S;  1HPZ A;  3W1Y C;  2OUG A;  2VKZ G;  4IH7 A;  2AYE A;  2CAD A;  3IP0 A;  4QR2 A;  2BM0 A;  3NAH A;  2XMK A;  5DLF A;  1X4F A;  3C6T A;  4UT4 A;  1WF1 A;  5C42 B;  4ATN A;  1JX4 A;  4JI0 F;  1FE4 A;  2H48 B;  4ZJO A;  1NHK L;  1E6Y A;  3MR2 A;  1HWJ A;  2XTJ P;  4YB1 P;  5FDL A;  5KFC A;  2JH3 A;  3VR1 A;  1QUP A;  3PCO B;  4L3K A;  4HYK A;  4MFB B;  1NPP A;  2EFO A;  2BJ8 A;  2YKQ A;  5KT3 A;  5GME A;  4RWW A;  1SV5 A;  1FKO A;  1PG5 B;  1TKT B;  2V63 A;  4UUW A;  4CH7 A;  2YNF A;  4Z37 A;  3BJY A;  3I9Z A;  1UEU A;  3DRP B;  3NGK A;  2CPZ A;  2DTJ A;  4NLP A;  4QIG A;  4ECS A;  3CW2 C;  3ZZO A;  2VJV A;  3PW5 A;  1Q7Y T;  2OTL S;  3M8S A;  2DNQ A;  1S59 A;  2Q1L A;  1JLF B;  3D1O A;  3QWP A;  1QVG R;  3MPW A;  1JNZ B;  3J80 U;  1SC1 B;  1EP4 B;  4WCE Q;  1EQM A;  3SFG A;  2PFF B;  3TA2 A;  3UWT A;  3ENA A;  3HVT B;  4LF7 F;  1FK9 A;  3SI8 A;  4NEY A;  2RU9 A;  1VIO A;  2NXE A;  1N56 A;  3FRY A;  3US5 A;  2CDR B;  1RAE B;  3OXL A;  4L6V 3;  1N36 J;  2I38 A;  4DCP B;  3V6H A;  2RDJ A;  4MKV A;  4DX5 A;  3DKD A;  3DFE A;  1SKR A;  1NH7 A;  1ZYQ A;  5HP1 A;  2DT9 A;  4GVB A;  4MMO A;  3B6B A;  3IRW P;  1SB6 A;  3MM5 B;  5EX0 A;  1CJT A;  4X4N A;  4P6Q A;  2R2R A;  3HHK A;  5LMN J;  1S48 A;  4DZD A;  2CYY A;  3GTY X;  4C8K A;  1V6H A;  4X65 J;  2F3J A;  4DV1 J;  2XLI A;  4U9R A;  2FC9 A;  2J6S A;  3KKF A;  2HQG A;  3MCO A;  3BO2 A;  2PGC A;  4DL6 A;  4C9D A;  4DX6 A;  1ZM4 A;  2NZC A;  4I2P A;  2DR8 A;  2CUY A;  2CJB A;  3POT B;  5FJ4 A;  3ETO A;  2ZH4 A;  4MKB A;  5HLF B;  1VQ9 S;  4WKR A;  3R5B A;  4IUF A;  4NCB A;  3DDN A;  4ZJL A;  1AZS A;  4DL0 C;  1DFD A;  2UUC J;  2L3M A;  4PCQ A;  1NHV A;  1YZ6 A;  4QYZ K;  5D8H B;  1WNE A;  2WON A;  2J0X A;  4B3R J;  2HND B;  5L1I A;  2F1F A;  1V3Z A;  4LFC J;  4DR5 F;  5F9N A;  2DGS A;  3MMJ A;  3KHG A;  2GHW A;  1HNV A;  4JOU A;  1NU4 A;  4KIA A;  3ET6 B;  1O51 A;  4Q43 A;  4ZVQ B;  2W01 A;  3DRS B;  4J9Q A;  4ECZ A;  3M8P B;  2WVC A;  2DBB A;  3EGZ A;  3TOQ A;  3M9M B;  5KFD A;  3T1H F;  3MMA A;  5D3G B;  5KFA A;  2VOP A;  4LVN P;  1MWY A;  3GYX B;  3EZU A;  2OH2 A;  1KVJ A;  4X4R A;  4ECQ A;  2FB0 A;  4PPZ A;  5E3C A;  4KGZ B;  3EGV A;  1TL5 A;  2D3U A;  4RBV A;  4QYR A;  2QL7 B;  1N6Q A;  2VBW A;  2QA1 A;  1NDK A;  3WQP A;  1NAQ A;  2DNM A;  1FTR A;  4F4X A;  2RRB A;  4QW8 A;  1HBO B;  2XMT A;  3MOJ B;  4J9U E;  2ZUA A;  4UTG A;  2ZHO A;  3F56 A;  3FJ2 A;  2DPJ A;  4URG A;  1KTV A;  3PYG A;  2ILY A;  4DQP A;  5IS2 A;  2MST A;  4M5L A;  3BO3 A;  2J8S A;  3MD1 A;  3U27 A;  3W64 A;  2UZA A;  5HAN A;  1N8R T;  3JQM A;  1X4A A;  1GTH A;  3EGW B;  3NBP B;  3TRG A;  3ZNJ 1;  4DV4 F;  1MMN A;  3MR6 A;  4DCO B;  1KVI A;  2V9K A;  1NCL A;  3L09 A;  4PPD A;  2MHE A;  5B7W A;  1RT7 A;  1KQK A;  1JLB A;  4CIO A;  4NLV A;  1ARO P;  3IGV A;  1PC4 A;  2EFG A;  1SIZ A;  3EUN A;  2YKN B;  1IBM F;  2RHS B;  4AQY F;  1DY3 A;  1H2U X;  3LPE A;  2DIS A;  2IBO A;  2XYP B;  3CCR S;  4CLW A;  2IYI A;  4EBE A;  2K3K A;  4FP9 A;  4KGV B;  2DNH A;  4OFZ A;  3V6J A;  5KOX A;  4CI0 B;  4WFZ A;  2BJ3 A;  4O0N A;  1WEY A;  2HQI A;  5EWG A;  2WZ1 A;  1T9X A;  1XK8 A;  2FGC A;  2QO3 A;  2A6O A;  2IC3 A;  1N34 F;  4WFB Q;  2YWK A;  5LM7 E;  1RT2 B;  3MEE B;  2JEJ A;  2ACM A;  1F3F A;  3M9O B;  2F7V A;  3T41 A;  1CJU B;  3HKZ D;  1NUE A;  3IR7 B;  1I5O B;  2CJQ A;  2MPU A;  1UMJ A;  4JI5 J;  1RTD B;  2FHK A;  2ZOM A;  2V4R A;  1RAC B;  4WP9 A;  3KLI B;  5KFN A;  2AEM A;  1QAI A;  1CUL B;  3C8Y A;  1GAO A;  2LQ9 A;  3H2V E;  2YNG A;  2MQQ A;  4ED4 A;  2MQO A;  3FSY A;  4RZR A;  1AT1 B;  3HHL A;  4LUB A;  2RF2 A;  3KK3 A;  5A0Y A;  3TJ8 A;  3G6V A;  1S6Q A;  1UCN A;  4RW4 B;  4DV3 F;  3CD5 A;  2J9C A;  1NDL A;  1NK6 A;  1DTT A;  3KMS A;  1Q53 A;  1JXE A;  4K2X A;  2PEB A;  1N33 J;  3PKM A;  4LSN B;  5A76 A;  3DDI A;  3UD3 P;  3JQK A;  3EXC X;  4AL5 A;  3M7V A;  1LWF A;  1DHM A;  3O6Q A;  5KFK A;  1D09 B;  3NP5 A;  1TKZ A;  4KC5 A;  4J9L A;  3FQK A;  1B99 A;  2BBE A;  2E5L J;  2ZKT A;  1VRU A;  2BM1 A;  3GII A;  4KJI A;  4BWJ A;  1JIH A;  3M2U B;  3M8W A;  4GO5 X;  5KFX A;  2IRX A;  1YX2 A;  4CM2 A;  3E01 B;  3BN4 A;  2A3J A;  2CPI A;  4B9N A;  2FY1 A;  3N5F A;  4B3O B;  5HMZ A;  2XGP A;  3MGJ A;  4NYP A;  5F3Z A;  1SKU B;  2HQ3 A;  4DR6 F;  3FRZ A;  2GQ2 A;  4ZPC A;  1S5Z A;  1Z4U A;  4LFB J;  1H2T Z;  2ZVI A;  3PW7 A;  1NB7 A;  4GRS A;  3W9H A;  1RT5 A;  3HKW A;  3DRR A;  4ZPA A;  3V6D A;  1RT3 B;  4O44 A;  4EGL A;  1CSJ A;  5LJ3 Y;  2O67 A;  2R8J A;  3CJ8 A;  3D1Q A;  3Q8Y A;  5DG8 A;  3KMQ A;  2SXL A;  3N0V A;  1VQ5 S;  3DMJ B;  4LF2 A;  2VUG A;  3KHL A;  5KT2 A;  3VAL A;  4ZPW R;  4MK7 A;  4JV0 A;  4LF8 J;  1VQ8 S;  2XO7 A;  2BX6 A;  2DR9 A;  3D3C J;  5EWE A;  2AF6 A;  4NLT A;  4ZVR B;  5DDP C;  4EI2 A;  4XDC A;  3LP2 B;  4JI6 F;  2HHH J;  1LXJ A;  2CDQ A;  3CJ0 A;  4FF3 A;  1U1M A;  1K0V A;  1IBK J;  1HNW F;  1PIL A;  2OPQ B;  2AIR B;  5MLC V;  1U0H A;  4LSZ B;  1NXI A;  4R25 A;  4IFV A;  1SQF A;  1H2V Z;  2B9E A;  2ZH6 A;  3DCA A;  4ZCL A;  2FZK B;  3HP6 A;  2DGU A;  2U1A A;  4BLG A;  1S4E A;  1I51 B;  2WOM A;  3ZTS A;  1KD1 T;  1LNQ A;  1VFJ A;  2C3O A;  4ZCI A;  3CJK A;  4C3L A;  2ZH5 A;  2NPI A;  4C11 B;  1WEX A;  1J27 A;  5LL6 d;  3HFZ B;  4P52 A;  2B4V A;  3OL6 A;  3CPW R;  5HBM B;  3QFW A;  3CO9 A;  4ECV A;  4OZ2 A;  2HHV A;  2FHJ D;  2ASY A;  1XNQ F;  3WZ0 A;  1T05 A;  2Z0G A;  4NEZ A;  4ZPD A;  4ZIW A;  2HFZ A;  4JI3 F;  1Q5V A;  1NK4 A;  4DV5 F;  1APS A;  3MM9 A;  3GFY A;  4G1I A;  3Q2S C;  1JLQ A;  3G8T A;  1Y10 A;  3UFC X;  2APO A;  3JSM B;  2CJK A;  4OI4 A;  2F5G A;  5F8I A;  2CQ3 A;  4DV6 J;  2A2C A;  1IQT A;  1UWB B;  3CJ2 A;  1PC5 A;  3QIP B;  4FXW A;  3G9C A;  2J9E A;  4YUD A;  1FCA A;  2OKQ A;  2DNL A;  4XPC A;  3AOA A;  5F0U A;  3GV7 B;  1TL7 A;  4UQT A;  3RW6 A;  1D0E A;  5LT5 A;  1VRT B;  4CM0 A;  4ILM A;  3T5L A;  1S72 S;  5IC4 B;  4ZVP B;  1BE4 A;  2BRL A;  2DGV A;  3D0H E;  1ZA1 B;  3C3L A;  1FJG F;  2HBY B;  1KLM B;  1KFD A;  2CQC A;  5KFG A;  3PJ9 A;  2KTQ A;  3QID A;  4AYB D;  3H4B A;  1SPB P;  4F50 A;  1RA7 A;  2FZC B;  1F0X A;  3CWJ A;  3CE8 A;  2WBR A;  4K8R A;  2QE5 A;  1RKJ A;  1XWL A;  2YNH A;  2IBK A;  3GMG A;  3UR3 C;  4WYL A;  4DQI A;  2GAH C;  1ACM B;  5IM0 B;  1LWX A;  2BQ3 A;  2UUB J;  1XR5 A;  3KJQ B;  3KUH A;  1TL3 B;  5GAD I;  2AGP A;  1F5C A;  1W26 A;  5LMU J;  1CG2 A;  2J9D E;  4DR2 J;  3R2D J;  3BQ2 A;  4WBF A;  1WKL A;  2I5J A;  4OMF G;  2W24 A;  1JLC B;  3HHE A;  3KK1 A;  2PC6 A;  3OTD A;  3DDK A;  3MCN A;  5AJ3 J;  3HSJ A;  4USV A;  4I0W A;  3A13 A;  1IKW A;  4DSE A;  1S6P B;  1ZA2 B;  2V9W A;  4F26 A;  2ABY A;  3MZI A;  4LIW A;  3GZ7 A;  3QFH A;  4HI1 A;  2JZ5 A;  4EZ6 A;  1RT4 A;  2XY5 A;  3AA9 A;  4O3Q A;  3Q0A A;  4F67 A;  1Y0H A;  3I5B A;  2G13 A;  5LJ5 Y;  4PYD A;  4PQU B;  1FWP A;  2HHS A;  5CQG A;  4FPR A;  1FNM A;  3WIU A;  3R7N B;  5A6P A;  5DRK A;  1S4F A;  5A8K B;  4PUO A;  3LTO A;  1W25 A;  1U1N A;  2B6A B;  2RQK A;  1HPZ B;  3MPY A;  3N28 A;  1S1X A;  4QBU A;  2M9K A;  2Y1I A;  5RUB A;  3IBF B;  1AFI A;  3R27 A;  4C8Y A;  2MQP A;  1WOR A;  4QPT A;  3C6T B;  4KBI A;  2LEC A;  1N5V A;  3BSO A;  2MKH A;  4EBD A;  3FDS A;  3PR4 A;  2GML A;  5J2Q A;  4QIF A;  5H9F J;  4F4K A;  5IV3 A;  3MMB A;  4RW8 A;  1NJX A;  2YBV A;  2R9L A;  4RLE A;  1FRK A;  5D0H A;  2DNZ A;  3N79 A;  1J5E J;  1SUQ B;  1SV5 B;  3D5M A;  2DNG A;  4LVO P;  2KI2 A;  3KG1 A;  2MZS A;  2NXC A;  2XYG B;  2YNF B;  1RXO B;  3CXC R;  4DUY J;  5EWF A;  3NEK A;  1JXL A;  1DAX A;  1S0N A;  2WW4 A;  3PYD A;  2FJA B;  3VAK A;  1MSW D;  2LA4 A;  2W25 A;  2ZUG A;  3U02 A;  1VQP S;  3MMC B;  1UTA A;  2VL1 A;  4KKO A;  2VG6 A;  1BQX A;  1HR0 F;  3W9I A;  1YQH A;  3CCV S;  2B9W A;  3DGP A;  3PRV A;  4Q2L A;  2CQP A;  4DR7 F;  3O1L A;  1BQM B;  3SQG A;  3M6V A;  1HNX J;  3VTI A;  3G86 A;  4X66 F;  3PEH A;  1FK9 B;  5B08 A;  4ZPT R;  2OD4 A;  5EHH A;  4O3N A;  2RKI B;  3G96 A;  3UDV A;  5C2G A;  2DHS A;  3TAN A;  3HK2 A;  2YH0 A;  4KO0 A;  1UVM A;  4JYA J;  4YR0 A;  1D9A A;  3QSI A;  1N5Q A;  2IM0 A;  1SVD A;  4TN2 A;  2OEL A;  2XSF A;  1GMU A;  1X9M A;  4K50 A;  2LU2 A;  4OLO A;  4CT9 A;  2D9O A;  3CCU S;  9RUB A;  1WG4 A;  4IDK B;  2XLJ A;  3T5J A;  1VQY A;  1FFW B;  4NYZ A;  2GCF A;  8AT1 B;  5KFZ A;  3MR7 A;  2K2P A;  4DX8 H;  3P45 B;  5H9E K;  1VQS A;  2H51 B;  4K4W A;  4JI0 J;  1TAU A;  1QVF R;  3NXZ A;  4MJK A;  1CJV B;  2O5D A;  5B0G A;  4PRF A;  4DDF A;  3C15 B;  2P9C A;  1X4E A;  4OZ0 A;  2P6S A;  1L3U A;  1U2C A;  2OO4 A;  3G87 A;  3RJM B;  2LDI A;  1DQ8 A;  3KJN B;  4FXD A;  2EFP A;  3VQT A;  1H38 A;  3OT9 A;  1OO0 B;  4ED8 A;  1QD1 A;  5F8H A;  2BEF A;  4IO9 Q;  4KH1 B;  3PHE A;  1AZS B;  4LRA A;  1WC4 A;  4I69 A;  1VC6 A;  4RPF A;  2WON B;  1N4L A;  4I1T A;  4NOH A;  3PY8 A;  1R89 A;  1N32 F;  2VJU A;  2OD6 A;  2XM3 A;  3JYT A;  3EDR B;  1RUS A;  2L9N A;  4QIE A;  1HNV B;  2NRE A;  4JI4 F;  5CH7 B;  3A3O B;  5A8W A;  4MT1 A;  2EC0 A;  4FNI A;  1RLC L;  3KG4 A;  4LF7 J;  1RCO B;  2R7S A;  4DU8 A;  1GMW A;  5GAH I;  4YS2 A;  2OGU A;  4CP5 A;  2LQ5 A;  1YKW A;  2Z57 B;  1RWV B;  4QOT A;  3GSI A;  4ED5 A;  3ZTR A;  1GEH A;  2M8H A;  5L39 A;  2AQ4 A;  1N6Q B;  1DRZ A;  4AL6 A;  4Y2I A;  4FBT A;  2ZNY A;  3QSY B;  1WHV A;  4BHQ A;  5K8P A;  4O4R A;  2RS2 A;  4BWM A;  2BJD A;  2AJ1 A;  4FKX A;  5FII A;  4DG1 A;  3W8G A;  4AL7 A;  2E7V A;  1F3V A;  3HFV A;  1QSS A;  5JJB A;  3VAG A;  1ROF A;  2UVU A;  2YY3 A;  3LUY A;  2OSQ A;  2HVH A;  2C2M B;  4DWI A;  4KV8 B;  3G2X A;  4DHV A;  3PO5 A;  5J2P A;  5I4M A;  4OYZ A;  5A8R A;  1U8S A;  2HLU A;  2AZ1 A;  1YBT A;  4HHU A;  2UP1 A;  3QGG A;  3ZFV A;  5KOW A;  1JJH A;  3R1L A;  3W61 A;  2VFU A;  3EJM A;  5KFF A;  4FZV A;  3DOK B;  4DLE A;  2PMW A;  2HVZ A;  2Z2Y B;  4TLQ A;  2AGQ A;  2YKP A;  3SFU A;  2HRU A;  2VBZ A;  4C8M A;  4QIV A;  3AOC A;  1SH2 A;  2HHQ A;  3OR2 B;  5ETP A;  1ZPV A;  3D0G E;  1QLN A;  4NRT A;  3KDO A;  1S57 A;  3R5G A;  1H72 C;  2GVZ A;  2XS7 A;  3BGO P;  3NCR A;  2GX8 A;  3Q86 A;  3B82 A;  4N56 A;  4PAA A;  5K8M A;  4QR1 A;  4ALZ A;  3B4D A;  1C0U A;  2XHC A;  2MQM A;  3AA8 A;  1M1K T;  3UVJ B;  4L74 A;  1VBY A;  4ECY A;  4M5D B;  1CJK A;  3AXM A;  4LJM A;  3HHL B;  4M63 A;  1EAR A;  4IRD A;  2RNE A;  4UZB A;  2IJN A;  3Q8R B;  4RW6 B;  5E2Q A;  1IBL J;  2AJQ A;  4O3P A;  1HA1 A;  3ISN C;  3MEK A;  2JLE A;  1JQG A;  3LAM A;  4Y6I A;  1VHF A;  4F3M A;  1GMW D;  2JFK A;  3CME S;  4NXN F;  4OHZ A;  3FBF A;  3VAF A;  4DV4 J;  2GHP A;  2VQF J;  1IKV A;  2W8L A;  2KRB A;  5THW A;  1WD6 A;  3L9Z A;  1QTN B;  1TKZ B;  5F3T A;  1EX8 A;  1HAR A;  2JX2 A;  1X4C A;  4DSK A;  5J2M A;  2BE9 B;  4CO4 A;  3OTO F;  3QJJ A;  2FDN A;  2G0C A;  1NSK L;  1SH3 A;  4AQY J;  2BA9 A;  4NA1 A;  5E3P A;  4WK1 A;  2DK2 A;  1NJZ A;  3Q8V A;  4IH5 A;  4L75 A;  2GGP B;  3RB4 A;  4OI2 A;  1WEL A;  4U8V A;  5I3U A;  5AT1 B;  1RAF B;  1VBK A;  1RWK B;  3DYA B;  3QAT A;  1WOP A;  1HQE A;  1QSL A;  2VPY B;  5L1J A;  3G82 B;  2VV5 A;  5CA5 A;  1TV6 A;  1REV A;  3BBF A;  2FVS A;  1N34 J;  3BRE A;  2H3E B;  5F8L A;  3CCS S;  5KT5 A;  3AT1 B;  3UCZ P;  2YQ3 A;  3MFI A;  3ENW A;  1UAW A;  1RT5 B;  4RBT A;  1BQN A;  1GFW B;  3DI6 B;  1XMB A;  1IN0 A;  2YX7 A;  4CNZ A;  2VOO A;  5C25 B;  4R5P B;  4OYA A;  4CRJ A;  2ZC4 A;  3GYN A;  3RU0 A;  2LXU A;  3UR0 A;  1RAB B;  1QM9 A;  5E3A A;  3DLG B;  5MAO A;  1CQM A;  1Q79 A;  2HNZ A;  1YRX A;  4QCL A;  2HRT A;  1Q95 G;  3RR8 A;  2Z2L A;  3T1A A;  4ID5 B;  2F40 A;  4FKY A;  4DV3 J;  5DET A;  5DQI A;  4QPX A;  3KNG A;  1KP6 A;  3ZZY A;  2O66 A;  5DM7 Q;  3BPD A;  5CYM B;  4K0K F;  1PBA A;  3HLU A;  3PX4 A;  1FJC A;  1U0H B;  3KNA A;  2DCL A;  4OYO A;  2WVD A;  3KLG A;  4IFV B;  5AE2 A;  3QBC A;  5BYS A;  1N88 A;  3LP1 A;  4U95 A;  4YQW A;  2KM8 C;  4KR0 B;  1HMV A;  2DHH A;  4Q0B B;  3EX7 B;  2WOM B;  3CC7 S;  4ZVT B;  5J2N A;  1TUW A;  4CT8 A;  2FVQ A;  2CJY B;  3PG9 A;  3IBW A;  2ZH7 A;  2NLW A;  3CJK B;  4QWA A;  3MM8 B;  4ZN3 A;  2KYZ A;  4N47 A;  2L48 A;  2JRS A;  4N76 A;  4P73 A;  2H65 B;  2P6T A;  4P75 A;  5CYQ B;  2I6W A;  1D8Z A;  3I31 A;  5C42 A;  3A8I A;  1S9F A;  1SJ1 A;  1LEO A;  1REG X;  4ZVO B;  2YPZ A;  4IR1 A;  3MPD A;  1R8P A;  2HFS A;  4KT0 C;  3RZA A;  2GJF A;  4CLY A;  1KQS R;  1TMM A;  1T05 B;  1SI9 A;  1VQ7 S;  4JBC A;  4MFB A;  2DVI A;  1RYS A;  1JLG B;  2BKO A;  1WHW A;  3GSD A;  1VCT A;  2DR5 A;  2X1G A;  1TKT A;  2E7X A;  3KUG A;  4OL8 A;  3BM7 A;  3F44 A;  2LKZ A;  4ELV A;  2BMB A;  3DRP A;  2FVP A;  4N41 A;  4F2S A;  4R8U B;  1ZAW A;  4X84 A;  4B3S F;  3NGU A;  1T95 A;  2D7S A;  2NR0 A;  4EYI B;  2R7X A;  4JV1 A;  3NWG A;  3X3U A;  4B02 A;  3ITH B;  1JLF A;  4V19 X;  1U1K A;  1WEZ A;  5E3R A;  4QJV A;  1XBW A;  4JI6 J;  3LP0 B;  3HVT A;  4DBQ A;  3PIP Q;  1KHW A;  2WBM A;  3M6W A;  2E29 A;  1U45 A;  1H7W A;  1OS5 A;  5CYJ A;  3GR0 A;  4PG5 A;  3PYE A;  5AXM A;  1Q8K A;  1T7P A;  4HHH A;  1UVL A;  4A8K A;  4ZIV A;  3OUY B;  2J6T A;  3FUY A;  4NAS A;  2HVD A;  1EKS A;  2KG1 A;  3MM5 A;  5F8N A;  2NPF A;  3DRY A;  3A1Y G;  2G2Z A;  1I6J A;  2POK A;  3K8W A;  2VBY A;  4CO5 A;  4WFN Q;  2FJD B;  3H20 A;  1DTQ B;  3K89 A;  1Z1Z A;  5D4N A;  4USI A;  2BJ9 A;  2EBG A;  2ZM6 F;  4F4Z A;  2XZT B;  1XMQ F;  5KFI A;  1XNQ J;  2YVS A;  2XMM A;  1UP1 A;  4NA3 A;  5KFR A;  1XER A;  3KK1 B;  3N6N A;  3VAJ A;  2H1Y A;  5IWA J;  4JI3 J;  1SQE A;  4DV5 J;  5LSL A;  4NLX A;  2J8A A;  2V8H A;  1IKW B;  3POT A;  2K06 A;  1YRT A;  2HHT A;  4HHJ A;  2KFZ A;  3P96 A;  5HLF A;  1QE1 A;  2DNO A;  3TYT A;  1EQ0 A;  2CVE A;  3D3B J;  3DM2 A;  2LQ8 A;  3DRX A;  4O3R A;  1P9Y A;  3TAR A;  2HND A;  3U1L A;  4KE5 A;  1SL1 A;  5BXI A;  1TKD A;  3SIP B;  1FFS B;  3BDE A;  2EVZ A;  2AMC B;  4YN3 B;  1UPM B;  4EEY A;  4PUO B;  2Z4P A;  2QLJ B;  2C2K B;  4ZKA A;  1FJG J;  5IXU A;  1S1X B;  3GIJ A;  5D3G A;  1UW9 A;  1XNR F;  4Y2C A;  2W2M P;  4TU7 A;  4YFU A;  4Q5V A;  2CRL A;  4OX8 A;  4RW8 B;  4EU0 A;  5IFM A;  2J0S D;  5D0E A;  4Y2A A;  3TA0 A;  2AJF E;  4ES3 A;  2AX0 A;  2YWF A;  4KTQ A;  4LSL B;  5A2Q U;  4JI2 F;  3N5B A;  2C2Z B;  4ZLL A;  3HVR A;  2BW7 A;  2Y0S D;  1HBO A;  2KKH A;  2DEJ A;  2ZC3 A;  4TY9 A;  2XMJ A;  4HDH A;  2NZ4 A;  3HZE A;  2HZV A;  4CH1 A;  1YJW S;  2RE1 A;  5HMX A;  3J81 Y;  2W9B B;  1B0V A;  2FJB B;  3OW2 R;  3WDO A;  1DLO A;  1FD2 A;  2PMZ D;  2XHW A;  1GK8 A;  2R8I A;  4KKO B;  3ICL A;  3QJL A;  2MEW A;  2BV3 A;  1EET B;  4Y34 A;  5GAE U;  2EWH A;  4O3O A;  2M8D B;  4IR9 A;  1T02 A;  1RWM B;  3NBP A;  3DGP B;  4IQM A;  4JV5 F;  3UD5 A;  4YME A;  4WJB A;  1JLE B;  4IH6 A;  3SQG B;  3R6G B;  2MKI A;  5I42 A;  5ETL A;  1S1T B;  4MK8 A;  1YBU A;  2V68 A;  1Q86 T;  2OSR A;  4JI8 F;  5LSO A;  2E1C A;  1IR0 A;  4UOC A;  1EB0 A;  5JXS A;  4RL1 A;  1PYT A;  1RWN B;  5K5M A;  2HK3 A;  1URN A;  3TZW A;  1UA0 A;  3D66 A;  4XK8 C;  2LLZ A;  1FA0 A;  3NAI A;  2N3L A;  4KFB A;  1Y5I B;  4G1Q B;  3IAS 9;  1S79 A;  4C2M A;  4G65 A;  3C14 A;  1KHV A;  5KFP A;  4P2M A;  1B7Y B;  5HAT A;  1FDD A;  2XNR A;  5KG3 A;  5DGB A;  5LXY A;  1T9T A;  4ZLN A;  1DQ9 A;  5F9L A;  1RT2 A;  3MEE A;  4XDD A;  3ZZZ A;  1MLA A;  4Q8F A;  3IR6 B;  2D69 A;  1CJU A;  1LW0 B;  1T11 A;  2W2P P;  4OZL A;  1YI2 S;  1U6Z A;  1R8H A;  1RTD A;  3L7P A;  3S6E A;  4DUZ F;  3KLI A;  4LR7 A;  3VV2 B;  1VK8 A;  3KYL A;  1CUL A;  3BKU A;  1ZTW A;  4OV6 A;  1IM4 A;  1X5S A;  3D6H B;  4EMD A;  3S7R A;  4IG3 B;  3IG1 B;  3GP9 A;  3SZ2 A;  2MZQ A;  1S0M A;  1HBU B;  4KGX B;  1JLA B;  4RW4 A;  4CLK A;  2XMU A;  4TLR A;  2COL A;  2B0G A;  2VKR A;  2PI4 A;  3HM9 A;  1X5O A;  2IJF A;  5FD1 A;  4DR7 J;  4MKA A;  5DDQ C;  3KHR A;  2MZ1 A;  1FJE B;  3FSX A;  3S8S A;  5L38 A;  4WTY A;  3AD8 C;  3CCJ S;  1ZM2 A;  2XQC A;  2BYC A;  2QLX A;  1VQ4 S;  3NS5 A;  3M2U A;  2WSE C;  3E01 A;  2R42 A;  1WF0 A;  2R7U A;  3CDW A;  4URS A;  1YIJ S;  5DO2 A;  4F36 A;  1HQ2 A;  1GX5 A;  1U1Q A;  4RNF A;  3MEG B;  5C24 B;  1N5Y A;  5C2C A;  1OIA A;  2RDI A;  5ITH A;  4HEA 9;  2GS8 A;  2YWE A;  5FLX Y;  3CJQ A;  3T1Y F;  1S9E B;  1RT3 A;  4TVA B;  4DG1 B;  2YKA A;  1K8A T;  4ZMM A;  1V5I B;  1A9N B;  2HFV A;  3IRX A;  3EVO A;  2GO8 A;  2FJX A;  3DMJ A;  2D41 A;  2CAJ A;  3TQ1 A;  4J90 A;  4OZ5 A;  3HT3 A;  4CLL A;  5BYQ A;  2OEK A;  3CD6 S;  1U26 A;  3R5D A;  5J2P B;  1TL1 B;  3WBZ A;  1H3D A;  1HLW A;  2O01 C;  5I3P A;  3AQO A;  3X1L B;  3K7R A;  1SXL A;  2VDH A;  2FJV A;  2KZM A;  2D3Z A;  5T7L A;  1Y00 A;  3D4J A;  3LP2 A;  4JV2 A;  3N01 A;  1UFK A;  4ED6 A;  2DR7 A;  2YX1 A;  1N5T A;  4P10 A;  3MHY A;  1N32 J;  3M8R A;  2HHW A;  3NS6 A;  1FWK A;  3R97 A;  2HWI A;  2YQ1 A;  4DV7 F;  2DKO B;  1F60 B;  4ZVH A;  4Y2M A;  4JI4 J;  1PJ7 A;  1XC9 A;  2G9O A;  1V5V A;  1KRP A;  4FXV A;  3M2R B;  3OSN A;  2W8K A;  1FKP B;  1A0O B;  2K1R A;  4URQ U;  5D0G A;  4WE1 B;  3H40 A;  1M5O C;  4LFA F;  3O8W A;  2BAN B;  4C11 A;  3ZTP A;  2VPW B;  4NI2 B;  2VOD A;  3ZXW A;  2CNL B;  4BC7 A;  2XI3 A;  4U7U K;  1KBR A;  4XAK A;  5HBM A;  3SSR A;  3GYG A;  2MY7 A;  5HRO B;  3UE2 A;  1VJQ A;  4C0H A;  4DPU A;  2WCX A;  3WC2 A;  3A8J A;  3L7U A;  2UUA F;  3H98 A;  2E66 A;  4ZVE A;  5HVG A;  1RYR A;  4C8L A;  3DC2 A;  1A7G E;  3JQJ A;  3SSQ A;  2OPS A;  2ZOG A;  3G6E S;  3NL0 A;  3HVW A;  2FVR A;  3JSM A;  2JL9 A;  4F2R A;  3JAM Y;  2LMI A;  1F9H A;  4H4O A;  1LK7 A;  3IM9 A;  4YHH F;  1UWB A;  3R7B B;  2C3M A;  2XS5 A;  2LCW A;  3M2V A;  5KG6 A;  1KN6 A;  3OR1 B;  3TJ9 A;  1ZH5 A;  3I4H X;  2DRA A;  2HMI B;  1NME B;  1EJ7 L;  4PKD B;  1PSD A;  2CQH A;  3BH7 B;  4EO6 A;  2R2U A;  4F4Y A;  1S6U A;  3MD3 A;  4G1P A;  3SCL E;  5IT4 A;  2XBP A;  4LT6 A;  3MAA B;  2AW0 A;  4JI1 F;  1VRT A;  1RT6 B;  2Y3Y A;  3W8P A;  3ILO A;  3OL7 A;  1KEK A;  1W7W A;  2RHQ B;  4I2Q B;  1NJI T;  2V8D A;  5DZ7 A;  3QMQ A;  1KLM A;  2YPY A;  3BGR B;  1FEE A;  1BD6 A;  3D67 A;  3HD1 A;  2DIU A;  1RHK B;  2DNR A;  2JJ4 D;  1YJU A;  1TP7 A;  3IBC B;  3FEZ A;  4OI3 A;  5HJX A;  3QZ8 A;  1HQE B;  2UV8 G;  3V4M A;  3QRR A;  1NSA A;  1VBZ A;  3PFE A;  4PWU A;  4K4V A;  5IM0 A;  3TEG A;  1TL3 A;  1XR7 A;  3CJR A;  2GJI A;  3HD2 A;  3EZ5 A;  2QYG A;  4L73 A;  3PX6 A;  4UOG A;  2Q79 A;  2W7A A;  1VQN S;  3AJ1 A;  4F3Q A;  3C2P A;  2BUN A;  4I64 A;  3VF0 B;  3PJX A;  1KR4 A;  2W9C A;  4ZVG A;  1GXU A;  2CG8 A;  2VC1 A;  1QAX A;  1PO6 A;  2CPY A;  2ZJP Q;  1JKH B;  4P72 A;  4DN9 A;  4AD6 A;  1HIY A;  3VVT A;  1S6P A;  3G71 S;  3J80 Y;  1UVJ A;  3AB4 B;  3ILL A;  4ZOS A;  2QZ8 A;  2VIH A;  4ED3 A;  3VQS A;  1Y5L B;  4OZJ A;  3VAM A;  3OTC A;  2MSS A;  2KRR A;  1RIS A;  4OYX A;  4QU7 A;  3UD4 P;  3CIZ A;  1EZZ B;  2PDA A;  4ZPB A;  3U7J A;  3LGN A;  4NXN J;  2L9D A;  1KQF B;  2LVW A;  2NSB A;  3TEH B;  1S9G B;  4PQU A;  1EKR A;  4A8X A;  3MUR P;  1RTI B;  2NXJ A;  1HMV B;  3BBB A;  4F4A A;  3IA0 A;  1MU2 B;  1S7I A;  2E9R X;  4WYW A;  2WTF A;  4QIW D;  2B43 A;  2A18 A;  2IY5 B;  1S77 D;  3DHW C;  5A8K A;  5J2N B;  4DJB A;  2B6A A;  3NWR A;  1PCA A;  2N4C A;  5KFU A;  2X1F A;  3R5A A;  4NLW A;  2IIH A;  5KFQ A;  5KFE A;  1UZH A;  4HT5 A;  4NLU A;  3VHQ A;  1RDR A;  2UVV A;  1E6V B;  2KT2 A;  2GNK A;  2HVI A;  4CNY A;  2H5J B;  4EWT A;  1ZET A;  3GG0 A;  1Q16 B;  3BB5 A;  5BJR A;  1U4B A;  1ZTT A;  2EFN A;  4DZ6 A;  4L72 B;  2WHO A;  2GAG C;  1BC6 A;  1SUQ A;  2ZD1 B;  4NYO A;  3QZ7 A;  2MLX A;  1P6T A;  3K5L A;  1R0C B;  2AP6 A;  2DNK A;  4DN0 A;  2B7B B;  3IMQ J;  2FGO A;  2NCK L;  3CDU A;  1FKA F;  3H59 A;  2GVD B;  1KQG B;  4F3O A;  5IC6 B;  5LMN F;  2QRR A;  1SBR A;  4HAC B;  2VH7 A;  3MMC A;  1HHS A;  3R5J B;  4DV1 F;  5L9X A;  2MYF A;  3W65 A;  4DPY A;  2VD3 A;  4MK9 A;  5LXR A;  3NCQ A;  2ZH8 A;  4H4K A;  1BQM A;  3CCL S;  1IQZ A;  2CIM A;  5B0C A;  3P8B B;  4DR3 J;  3C6U A;  4OZN A;  4QWB A;  4DU7 A;  2F4F A;  3W62 A;  3MUV P;  3I56 S;  1HNZ F;  2RKI A;  6AT1 B;  3T5H A;  2ZBR A;  1NM2 A;  4WK3 A;  2UXC F;  5K14 B;  2W7O A;  2D3O 1;  2RS8 A;  4M8L A;  1VIX A;  1OPI A;  1AB8 A;  4IDK A;  2IFX A;  5IT9 U;  1DUR A;  2AHO B;  4LFC F;  2K8G A;  2QMW A;  4Y3C A;  2Q66 A;  2HHX A;  1O8B A;  4ED7 A;  4N7T A;  1ZBT A;  5CZV A;  1P1L A;  1IWG A;  2ROP A;  1CJV A;  3FGV A;  1AUD A;  5EX3 A;  1VMB A;  3C15 A;  1Q0N A;  3PM9 A;  4OX7 A;  1HI1 A;  1VJW A;  3H5X A;  4Q2M A;  2YWG A;  3MTJ A;  2BAB A;  3KJF B;  1TK5 A;  2HYI B;  4KRW A;  5BYR A;  3FSI A;  1Q8B A;  2GZO A;  1QE1 B;  2DGX A;  4PG7 A;  4ANC A;  2L41 A;  5E33 A;  3DM2 B;  2AT1 B;  3IR5 B;  1RLD A;  2R3V A;  3EGN A;  2Z30 B;  2LYV A;  1HHQ A;  4B3S J;  1LWC B;  4N8O A;  4OZ1 A;  4RBU A;  4B9V A;  2B8P A;  2FQQ B;  2MJN A;  2RQM A;  3TX0 A;  2HAF A;  5ETK A;  1R8C A;  3PTW A;  4RW9 A;  3AFG A;  4QW9 A;  4DPT A;  1M5H A;  2DRB A;  1MN9 A;  2RRN A;  1KOH A;  4K2J A;  2QX0 A;  1CS4 B;  3CNQ P;  1HWL A;  1RU1 A;  3KLH B;  2ZVS A;  2OHD A;  2UU9 F;  2KVI A;  2DRD A;  2ZFH A;  2ZBQ A;  4I6A A;  2IYG A;  3V81 A;  2FIU A;  2AU0 A;  1NK0 A;  3S1T A;  4N77 A;  1HW9 A;  2V6A A;  2J0W A;  1RHQ B;  4USU A;  1WKJ A;  2CXE A;  1ZS6 A;  2JWN A;  1T0T V;  1YZ7 A;  2BE2 B;  3BGF A;  2LEB A;  2R2T A;  4EUV A;  2ZM6 J;  5CAA A;  1XMQ J;  1SL0 A;  1YWX A;  4RW7 A;  4F04 B;  3HHN B;  2CPF A;  1DLO B;  2YX4 A;  3TAP A;  2HPU A;  4YOE A;  3LWM A;  1U48 A;  3CIM A;  4DXL A;  4XIU A;  3H7H B;  4KV8 A;  3H2L A;  4NLR A;  2I1R A;  3P5B P;  1JJ2 R;  3M6U A;  1M90 T;  1R27 B;  3MCM A;  4P74 A;  5I42 B;  1P1T A;  4ELU A;  1S97 A;  4OI1 A;  5DM6 Q;  3K0J A;  1MWZ A;  1V3R A;  4MH8 A;  1FRM A;  4ECR A;  1C0T B;  1XEZ A;  3B4M A;  2Y9H A;  3F41 A;  2AYM A;  1RI7 A;  3PFO A;  4LF9 J;  3OFH A;  4UOH A;  5D77 A;  4CO0 A;  2OML A;  3R2C J;  4C0B A;  2XNQ A;  2DXD A;  4KFB B;  1LK5 A;  5H1S V;  1X5T A;  3DOK A;  3DLE A;  3C14 B;  2CZ9 A;  1T9U A;  2PA3 A;  2ZDP A;  4IOB A;  3Q2T C;  2OTJ S;  4TU9 A;  4WFA Q;  2AKW B;  4RWX A;  1N33 F;  1FVQ A;  1RWU A;  3OBI A;  3ENQ A;  3RRK A;  3OR2 A;  4D3H A;  1UA1 A;  3D6F B;  1TK0 A;  4CWB A;  3SCI E;  3I4P A;  4W90 B;  4NA2 A;  2E5L F;  4I6Y A;  4A8M P;  2XCP A;  4DR4 J;  3M30 A;  1IWA A;  2ERR A;  5H9F K;  4JUZ A;  5HQM A;  5CZX A;  4RU2 A;  4PWD B;  4NLO A;  4M5K A;  4FN5 A;  3UVJ A;  1RHJ B;  1FT8 A;  1TMJ A;  4LQ3 A;  2V8G A;  4M5D A;  3MED A;  2I8E A;  1B3T A;  4V1A k;  3WX4 A;  2IMW P;  2YXL A;  3I87 A;  4RW6 A;  4ES1 A;  3NGR A;  2B3T B;  2J76 E;  4P7T A;  4GVL A;  2B4U A;  1YGY A;  3GQC A;  4J37 A;  3V2U C;  1YK9 A;  4JV5 J;  5E7O B;  3GPA A;  2FLL A;  1VQL S;  4OZ3 A;  3RBZ A;  1U02 A;  1M1G A;  4HT7 A;  2XSJ A;  3ISN D;  4U6P A;  2XLK A;  2BDP A;  1VBX A;  2VFT A;  4ELT A;  1WC0 A;  1CC7 A;  2YWH A;  4LF8 F;  3P5T L;  2L08 A;  2GGP A;  1I3O B;  4O3S A;  2AV5 A;  4A47 A;  3SCK E;  3HJV A;  2V4J A;  1PAE X;  1TUG B;  5D15 A;  4Z2X A;  3DYA A;  2MQN A;  1N5Y B;  5KG4 A;  5T14 A;  4DQR A;  3G82 A;  4U7U D;  1P8G A;  4PG8 A;  4Q44 A;  3TI0 A;  4FS1 A;  5T41 A;  3DI6 A;  3EXY A;  1NZA A;  2HAI A;  5C25 A;  3AY0 A;  4CLP A;  1Z2Z A;  3RW7 A;  4R5P A;  4DUZ J;  1UWA A;  3AH6 A;  2F8H A;  1RZM A;  3IRX B;  4GC6 A;  2HSE B;  3E51 A;  1IKX B;  4PG4 A;  4UW2 A;  4KGM A;  3H4D A;  4X4T A;  3M8Y A;  3DLG A;  1WDD A;  3PVX A;  4H54 A;  4DSF A;  3AD7 C;  4TYA A;  5ETM A;  4TU8 A;  3NOC A;  3DLJ A;  4OX9 J;  1TL4 A;  2H54 B;  4X4U A;  3LW5 C;  4ID5 A;  2QL5 B;  2PE8 A;  4FYW B;  5T7L B;  4OJ1 A;  2QLW A;  4ZPV R;  2CQ2 A;  1UPP A;  3NNA A;  2OI2 A;  5CYM A;  1QAY A;  1F6T A;  2G1D A;  2C2E A;  1CVJ A;  5KT4 A;  4NCA A;  3HSZ A;  4FYD A;  3M9N B;  1NBE B;  1VC5 A;  3CC2 S;  1X9S A;  2BOA A;  3NG8 A;  1X9W A;  5A6W A;  2QA2 A;  4OJH A;  3SXL A;  4Q0B A;  4ED0 A;  2WW8 A;  2W2Q P;  4NWB A;  2K1R B;  5HVF A;  1AFJ A;  5KT7 A;  2GIR A;  2DHG A;  4LF6 F;  3MM8 A;  1RTH B;  2GO9 A;  4A8Y A;  5CYQ A;  3GIL A;  1HNI A;  2LEA A;  3K5N A;  2KJV A;  3DU6 A;  3UI3 A;  1BXN A;  1RTJ B;  3HHL D;  3FC9 A;  4X62 F;  1LXN A;  1NK9 A;  1RGV A;  2R8G A;  3CGI A;  2W1B A;  2IDL A;  2EEY A;  1R31 A;  3M8Z A;  1JLG A;  2KHD A;  3T1Y J;  2GQC A;  1S76 D;  3BGU A;  2ADC A;  2OPS B;  1LWE B;  3VGV A;  3CUN A;  2ZJQ Q;  4TNO A;  5B0F A;  2N7C A;  3MFH A;  2KDO A;  4DFM A;  4H4O B;  3ZNU A;  3L7O A;  5HQ8 A;  3CT9 A;  1CLF A;  1Q5Y A;  1KKH A;  4OHY A;  3M2V B;  4IO1 A;  1U7L A;  1B0P A;  2Q43 A;  4R8U A;  4OI6 A;  1HHT P;  1PIE A;  4UQG A;  1SIW B;  2ATC B;  4R0J A;  1ZM9 A;  4DUT A;  4DR2 F;  1D3W A;  3ITH A;  4ZCK A;  4PQA A;  1UJ4 A;  4WKY A;  4CYU B;  3OV7 A;  5LOQ A;  1T9W A;  2XEX A;  4X4S A;  2CQ0 A;  3Q83 A;  1WF2 A;  3CCZ A;  3LO3 A;  2MHN A;  3GON A;  2U2F A;  2YQ0 A;  4XPE A;  3CVK A;  3LP0 A;  3GE9 A;  2MZR A;  3LWL A;  5KFB A;  2E5H A;  1RAA B;  3OSP A;  4O0I A;  4ANE A;  2ASL A;  4DV7 J;  3RYL A;  4CTA B;  4C3M A;  2B56 A;  1NJY A;  3BSN A;  5DLG A;  3A4T A;  2LP4 A;  6FDR A;  3OUY A;  2M5Y A;  2DHX A;  2ZJR Q;  4DL2 A;  5HAO A;  2ASJ A;  2RUG A;  4UST A;  2R7T A;  2HFU A;  4UUX A;  1FRJ A;  4PR6 A;  3M6X A;  2W2O P;  4LFA J;  4I67 A;  4F0K A;  3T3F A;  2HW3 A;  2MTL A;  1DTQ A;  5EDW A;  3QPI A;  1FRX A;  2K7J A;  1R6Y A;  4FVC A;  2ACY A;  1OWX A;  2XY6 A;  3R6L B;  3LAK A;  3FCV A;  2AX1 A;  4RUA A;  1H73 A;  4KB7 A;  2ZOF A;  1IBC B;  2VU5 A;  1FO1 A;  1VK3 A;  3DLB A;  5ETN A;  1GQE A;  2W9C B;  2F4V F;  3LAN A;  4B3T F;  2UUA J;  3L3C A;  3AAW B;  4DF8 A;  3CTR A;  2KG0 A;  4DPO A;  3OVA A;  4YY3 F;  1Q7L B;  3J7Z 5;  3IN5 A;  1C4A A;  1WJ9 A;  4E0D A;  3I82 A;  3AD9 C;  2HFO A;  1J5O B;  1CC8 A;  1U24 A;  4DL5 A;  2IM3 A;  4ECX A;  2AYB A;  2HK2 A;  4RUH A;  3GR1 A;  4C48 A;  1KSP A;  2CPX A;  3J7Y U;  4NPO A;  5G0R B;  3DLK B;  2DH7 A;  3KLE B;  4HLB A;  2HGL A;  2NSC A;  1X5P A;  4LMZ A;  5JMN A;  2RH3 A;  3SDE B;  2QLB B;  5GAE I;  4J5O A;  4JI1 J;  4P2F A;  2EG2 A;  4USJ C;  1NSP A;  3D7S B;  5M2R A;  2R7O A;  1WOS A;  1U1L A;  3KLV A;  4GC7 A;  3DOM B;  4R0E A;  5M2P A;  3QO9 B;  4EO8 A;  3ZC4 A;  3WIV A;  1P27 B;  1HWI A;  2GHV C;  2CPD A;  1DQA A;  1RKI A;  1IVZ A;  2UXD F;  1RWO B;  2JDJ A;  5F8G A;  3OLA A;  5HO4 A;  5DG7 A;  4CLF A;  1VLY A;  3KOA A;  1UZD A;  4TXS A;  4LRB A;  4DEZ A;  4A4J A;  4HKQ A;  5D6G A;  5CD4 H;  1URR A;  4OHW A;  3R5C A;  2IVM A;  2RJZ A;  1WG1 A;  3THV A;  3HFK A;  2EI5 A;  2ZWO A;  4LSL A;  2J9D A;  2W7P A;  3HX9 A;  1QAJ A;  1L3T A;  2DXE A;  2E1P A;  2MZJ A;  2J7K A;  3GU0 A;  1MMD A;  2OAU A;  2W9B A;  3LA0 A;  3P6Y C;  5CCL A;  2XZW A;  2ZBP A;  3ENV A;  3OVS A;  2H4Y B;  1TKX A;  3PR5 B;  3HI9 A;  1EET A;  3RGI A;  2IJR A;  3EE3 A;  2DB1 A;  3Q8P B;  1JLE A;  2NXU A;  4K4T A;  2V67 A;  1F2G A;  5KG5 A;  1S1T A;  5DG9 A;  2Y1L B;  2MMY A;  1X0P A;  2IHR 1;  2CZV C;  3MWB A;  1R0A A;  3C6U B;  4QQB A;  1Q8L A;  1PYO B;  1IUJ A;  2VHG A;  4CH0 S;  2KHC A;  3HSG A;  1Q82 T;  3ILJ A;  1YIT S;  1RBO B;  1FRI A;  3W3S A;  2QL9 B;  1NSQ A;  3IWX A;  1RHR B;  4KYZ A;  5D78 A;  1BUX A;  2DYA A;  2NXN A;  2IA0 A;  4G1Q A;  3BSC A;  3NS7 B;  4P7V A;  1OJ4 A;  4B08 A;  3PEJ A;  4F7V A;  1U25 A;  5BR8 J;  4Z7C A;  4DS5 A;  3L95 X;  1U2F A;  1Q4R A;  2D9P A;  5KAK A;  2RSQ A;  4GO7 X;  2KXF A;  4ICL B;  1MG7 A;  1S1W A;  3SEO A;  2P5V A;  3MM7 A;  1W2I A;  2JEF A;  1LW0 A;  2QFI A;  1HW8 A;  2RT3 A;  2NYI A;  1H98 A;  1D8Y A;  2HZA A;  2EKY A;  4ZLJ A;  1T03 B;  2UV8 A;  2R7R A;  3JTO A;  4IG0 A;  2OIH A;  3ELH A;  4P2X A;  3J7A 1;  4OIX A;  4PXD A;  2MKY A;  3KLF B;  2HEK A;  1KVK A;  5KG2 A;  1OMS A;  2P9E A;  1RWP B;  4IG3 A;  4ITS A;  3RUB L;  3IG1 A;  2FJE B;  1XIQ A;  1YJN S;  4DV0 F;  1M5S A;  2R7W A;  2L9W A;  2ZEJ A;  3IO1 A;  1HBU A;  4DLG A;  1QJH A;  1TK8 A;  1JLA A;  4MYU A;  3FFI B;  3EVM A;  2XS2 A;  1RWW B;  3BEG B;  1V3S A;  3I5A A;  4RW9 B;  3MR5 A;  3HHD A;  2MGZ B;  5IQ6 A;  1IM6 A;  2BJ7 A;  4CLS A;  1I94 F;  1RU2 A;  1NPK A;  1TTH B;  3MAQ A;  4KHP F;  3WHI A;  2ZHB A;  5KFJ A;  4FF1 A;  2YH1 A;  2IRY A;  2XG8 A;  2ZNZ A;  2ZE2 B;  3FMB A;  4Y28 C;  1C1B B;  5HN0 A;  5F41 A;  3TA1 A;  1HNZ J;  3PDN A;  3FKB A;  1OSC A;  2UXC J;  4WFY A;  3FBB A;  1WWH A;  2EW9 A;  2V2Q A;  3GJR B;  1FES A;  3V81 B;  3UCU P;  3ISZ A;  2VFR A;  3FZ2 A;  1X60 A;  2B9X A;  4IRK A;  3MEG A;  4LQ9 A;  3CCM S;  3SQO P;  5C24 A;  4ED2 A;  1YJ9 S;  2F63 A;  1N48 A;  4H4K C;  2NYH A;  5F8J A;  3GJT B;  3ULH A;  3PIO Q;  1M5P C;  3MM6 B;  2HGM A;  3BKT A;  2OFG X;  5ETT A;  3VAI A;  2QSF A;  4MIW A;  4W4M A;  3TP2 A;  1S9E A;  3GWC A;  2E1A A;  1WDT A;  3R7S B;  1VOM A;  1RP5 A;  2JC1 A;  5D0R A;  3CD7 A;  4RW7 B;  3AOD A;  1S6O A;  2PO4 A;  4J9V A;  2ZZN A;  2VPZ B;  4UF4 A;  4KH0 B;  4QR0 A;  1VI7 A;  1A6L A;  2HBZ B;  1RSC A;  4RX6 A;  2VF3 A;  1YDL A;  3D2W A;  2IMO A;  1TUV A;  3MXH P;  3K5P A;  1TL1 A;  5J1P A;  4J7C A;  2JVO A;  3TJA A;  4ZLP A;  4LRC A;  3NNH A;  1BMQ B;  4X2B A;  1U1O A;  3BBC A;  1C4C A;  4L76 A;  5AXK A;  2WRM A;  1SJR A;  3CDE A;  2EFV A;  2KB2 A;  1P9Q C;  3IXQ A;  1S1V A;  4CO2 A;  4ID8 A;  4P9S A;  4DR5 J;  1RT1 B;  4QWD A;  2W9A A;  4YEA A;  2OJ3 A;  4ECT A;  4NXM F;  2QG9 B;  3LOU A;  3RAM A;  5AE3 A;  3S01 A;  3KJV B;  2ILZ A;  4GKK F;  3DLE B;  1IBL F;  4FNH A;  3RBD A;  3M2R A;  1UKU A;  1FKP A;  1SL2 A;  2WVE A;  5F8M A;  3H8Y A;  3T1H J;  2DGQ A;  4WE1 A;  5ETV A;  2UU9 J;  2BAN A;  5KT6 A;  2J6U A;  2VQF F;  2WSF C;  4WTO B;  1PBU A;  4NI2 A;  1ITP A;  2PSZ A;  1T3N A;  1X7V A;  4C7Q A;  4HR2 A;  5HRO A;  2J0Q D;  2DGT A;  1HWK A;  4B3M F;  4LR9 A;  2X1B A;  2QFJ A;  4HDG A;  3K8V A;  3M30 B;  1M1H A;  5L1L A;  5B09 A;  3D28 A;  1CEZ A;  1NH8 A;  8RUC A;  4UOF A;  1N54 B;  4ZK7 M;  4WXW A;  2VQE F;  2CWX A;  2VFV A;  4WZM A;  4GKJ F;  3MED B;  4I7F A;  2DJW A;  2B51 A;  2Z2Z A;  4Y65 A;  2BJE A;  2QJ3 A;  1VIS A;  4WPA A;  5ETS A;  5L46 A;  3BV8 A;  1BWV A;  2R7Q A;  1UL3 A;  2VG7 B;  3D54 A;  3OR1 A;  1S49 A;  2RU3 A;  1UFW A;  3KXD A;  2C3Y A;  2HMI A;  1PYS B;  2ADB A;  2HUR A;  3RBX A;  1KWM A;  4FYY B;  2FLN A;  4DV2 F;  1ZOT A;  4J9K A;  3TAQ A;  2PN6 A;  2WAQ D;  2OPP A;  5J1E B;  1ZPW X;  1MWQ A;  3MAA A;  2QV6 A;  1FRH A;  3W63 A;  4RR5 A;  2DH8 A;  3QRQ A;  1RT6 A;  2V0N A;  1FXR A;  2XSJ B;  3SMZ A;  4I2Q A;  3TR5 A;  3I0R B;  3Q8Q B;  3W5X A;  2X7I A;  4DPW A;  4YDD B;  1IBM J;  4B9M A;  1T8E A;  5CAB A;  4ERD A;  1PGZ A;  3BGR A;  2OEM A;  3GB0 A;  5ETO A;  2FHJ A;  2QA4 S;  2BKN A;  3TUP A;  1S0O A;  4KPY A;  4XO0 A;  4USK A;  1KON A;  2V4J B;  1OYD A;  1VYA A;  2HNY B;  3EPI A;  2ZWP A;  2C42 A;  4NMX A;  1UFL A;  3CDA A;  3WX8 A;  5C5J A;  3MEC B;  5DDO C;  1HI0 P;  3BS9 A;  4J9M A;  1YJ7 A;  5IV4 A;  5M2U A;  1FEH A;  1HBN A;  1G7C B;  1RAJ A;  1N0U A;  1NLK L;  4C8N A;  1JK9 B;  2M2B A;  4UY8 5;  4H4M B;  2HVE A;  5KFM A;  4LF5 F;  4UY8 T;  3GIK A;  1FVS A;  4X4V A;  4USM A;  4IKA A;  1RHU B;  2KN4 A;  2E9T A;  1U6B A;  1IJE B;  4E98 A;  4ZVU B;  1OQ6 A;  4RJV A;  4Y0F A;  2MZT A;  4Q8E A;  3IGN A;  2KO1 A;  1JKH A;  2C2D A;  3PX0 A;  3NRB A;  4OHX A;  1C2P A;  2DY9 A;  2VON A;  5GMD A;  3CC4 S;  3CCW A;  2QLF B;  1GNK A;  5JUM A;  5DGA A;  2ROE A;  1NZ8 A;  4ZP7 A;  4KAI A;  1CPZ A;  4ETZ A;  2HBR B;  3PZP A;  4F4W A;  4FS2 A;  2XI2 A;  1YVF A;  3PXG a;  2F8M A;  1T3O A;  4OQJ A;  3RB6 A;  1KFS A;  3Q22 A;  2WSC C;  3N4W A;  3CCE S;  1L3K A;  1S9G A;  3L4B C;  1ZM3 A;  2VC0 A;  2BZ2 A;  3QQC D;  4G6V B;  4BC9 A;  4A8S A;  1RTI A;  4WP8 A;  2F9D A;  1MU2 A;  4O4G B;  3HHL C;  3V4I B;  2BQR A;  2RAQ A;  2R2S A;  1L5U A;  4NRU A;  4HH0 A;  3ADA C;  2JVR A;  1TR0 A;  3BKF A;  3CCQ S;  2WK4 A;  3NCP A;  4YR2 A;  4FPI A;  2WB4 A;  5DJB A;  3NGT A;  2MKK A;  1R3N A;  1HNI B;  2PD1 A;  1NRK A;  3AB2 B;  3O44 A;  4ZA1 A;  1E6V A;  3TAM A;  1NO8 A;  5E41 A;  3M32 B;  4P71 A;  4DR6 J;  3PRB A;  2KT5 A;  3CDB A;  2KJW A;  2RIJ A;  3D6T B;  4X4Q A;  1WKK A;  1H7X A;  4LRE A;  2ZD1 A;  3DOL B;  2E9Z A;  2YNI B;  3KK2 A;  4PEO A;  4CO3 A;  4AUK A;  1UVK A;  2WB1 D;  4LF4 F;  5K8O A;  3O2I A;  2QMU B;  1CBK A;  3ETM A;  3UN2 A;  3Q24 A;  2GVD A;  3N9U C;  2XCA A;  3IS9 B;  3GJS B;  1S7H A;  4HAC A;  2EXU A;  1VLO A;  5GAG I;  2FYX A;  1TVR B;  1KDN A;  2B5J B;  2QC3 A;  4CLT A;  3OHB A;  3I32 A;  3M05 A;  2AEJ A;  3K5M A;  3IM8 A;  4RU9 A;  4M5G A;  3R3T A;  4TY8 B;  1KOO A;  2LXI A;  4NLQ A;  5IWA F;  2LU1 A;  4S0M A;  4ES2 A;  2H4W B;  2JSX A;  1NPR A;  1IR2 A;  4KY3 A;  2Z8Q A;  3IFE A;  1HNW J;  3TUJ C;  2DNY A;  3OTE A;  1R43 A;  2VZ9 A;  4QYZ J;  4IYQ A;  3N6M A;  2O1P A;  3H90 A;  2HQC A;  5K14 A;  3QGH A;  2MLZ A;  4MYT A;  1TZ0 A;  4DR1 F;  2CPJ A;  2IAJ A;  5A2Q Y;  4TQR A;  4LR8 A;  5C7P A;  3HCX A;  4LF6 J;  3PHT A;  3TUZ C;  2HS0 A;  1UEK A;  5B0E A;  4K4Y A;  3UPF A;  4ED1 A;  4N8N A;  2V69 A;  1UEV A;  3AHP A;  1RB0 A;  5E3Q A;  4DPX A;  3GCW P;  3D9B A;  2W4C A;  1S1U B;  2ZH2 A;  3Q23 A;  1NK5 A;  2V34 A;  3M1V B;  1U2R A;  4X62 J;  1FTC A;  3PW2 A;  1XN9 A;  1Y3K A;  1EHW A;  3LGH A;  3LGM A;  1B7F A;  1O5J A;  5K9F A;  2QN6 B;  3EDQ B;  3MPV A;  3GLJ A;  3PW4 A;  4OYI A;  5B0D A;  3T6B A;  1Q78 A;  1Y11 A;  1ZZF A;  3UDL A;  4A8W A;  2MY8 A;  2NS1 B;  4U7C A;  1WC6 A;  2K3I A;  3E8O A;  1LWC A;  1B64 A;  3OTB A;  1NKB A;  3UN5 A;  1YSJ A;  2BQU A;  2Y1J A;  3GFZ A;  5DQH A;  3M8Q B;  3EVW A;  2BR0 A;  2CA9 A;  3VZI A;  4WU2 A;  2RML A;  3D1H A;  2LDY A;  2V50 A;  2J5A A;  1CS4 A;  4KPC A;  3ILI A;  2ZIT A;  5HJY A;  4YB5 A;  3KLH A;  3U1M A;  2VA3 A;  1FER A;  2VDI A;  3NOG A;  4RO0 A;  5KTQ A;  1HQU B;  2OEJ A;  1KTQ A;  3KDN A;  1KS2 A;  3DNC A;  4ILR A;  3CJ5 A;  1RBL A;  4WXO A;  3ZTQ A;  4IFY A;  1U49 A;  3OJS A;  4K5S A;  1KNZ A;  4A8O A;  1LW2 A;  3SV3 A;  1JMT A;  1S12 A;  2XZD B;  3DU5 A;  1AYE A;  2YKM B;  1M5K C;  1PAU B;  1V9O A;  2BE2 A;  4ENO A;  1PJ6 A;  4BS2 A;  1TFW A;  3TZY A;  1D1U A;  2CNO B;  4ZJQ A;  4ZVF A;  2F4V J;  4DMZ A;  4B3T J;  2D3O R;  1WI8 A;  1B70 B;  3T6J A;  4C6A A;  1M5V C;  2M70 A;  3DXB A;  3H42 A;  1MN7 A;  4OJG A;  1RAO A;  2KFY A;  2KH9 A;  1TKX B;  4YY3 J;  1U6F A;  2B8Q A;  2E5G A;  3QJP A;  2C3U A;  2HIY A;  3N6L A;  3G4S S;  1E6Y B;  3K17 A;  3CSK A;  1F9F A;  1T9Y A;  5FDL B;  3BN7 A;  1WC1 A;  5IT0 A;  4A46 A;  2ZH1 A;  2HS4 A;  5KFS A;  1R0A B;  3IWN C;  1C0T A;  4DQQ A;  5HK4 A;  2PII A;  1AUS L;  5HI7 A;  2W4P A;  4HTI A;  1FWL A;  1F5B A;  2OPR A;  1FKO B;  2IA6 A;  1UVN A;  4FYV B;  1JNR B;  1ELO A;  2C2R A;  3Q8U A;  2ZBC A;  5CD4 A;  5HSP A;  2ROG A;  1MNE A;  1Y4Z B;  3PO4 A;  2CQD A;  3TW0 A;  2Q6C A;  2DNN A;  4USW A;  2B4P A;  1IR1 A;  1VDH A;  1MML A;  3VGS A;  2V8V A;  5KFO A;  2XO6 A;  1S1W B;  3ZZT A;  4K59 A;  2DO4 A;  2UXD J;  2B9Y A;  3MM7 B;  2KFN A;  1NK7 A;  3FMW A;  1U1R A;  2VG5 A;  2XB2 D;  3GV5 B;  4XTT A;  3ZO7 A;  3HT0 A;  4I68 A;  1X8D A;  3VCD A;  1U09 A;  1DBD A;  2IM2 A;  4DFP A;  1SJ4 P;  2W2N P;  2GC8 A;  1HBM A;  1FX2 A;  2Q6B A;  4A8Q A;  3VVU A;  4NLG A;  2PEH A;  2RVJ A;  3MI7 X;  4IG0 B;  5ADZ A;  3R8Y A;  4LBI A;  4OLP A;  4PWD A;  5L1K A;  2AZ3 A;  3K57 A;  4ZIT A;  1IKY A;  5HP1 B;  1VS3 A;  3MPU B;  1QUV A;  4GVB B;  2NQP A;  1WC5 A;  3P3D A;  3RG6 A;  1XJW B;  1X4G A;  4RNO A;  2ZKU A;  4Y2K A;  3CMA S;  2FTR A;  1F9E B;  4I6W A;  1RAG B;  2FZG B;  1XMO F;  1CJT B;  2R7V A;  2KXN B;  5DS7 A;  3NY0 A;  1WUU A;  1HR0 J;  2IDE A;  1OYE A;  1N0V C;  4ZCM A;  3OHA A;  4DSI A;  1SC3 B;  3GV8 B;  2KT3 A;  3FCH A;  2JC0 A;  3ZZ0 A;  3CJ3 A;  1Q8I A;  4X66 J;  3T5K A;  4KSE B;  3A3N B;  2CG4 A;  4I2P B;  4X64 F;  1NB2 A;  5D4P A;  3W66 A;  2G1H A;  3TO8 A;  2FD2 A;  1HKA A;  3EM1 A;  3BYR A;  2GA7 A;  2Z56 B;  2XYH B;  3GIM A;  1WSV A;  3PNI A;  3G6Y A;  3HDS A;  4QU6 A;  2G2Y A;  3A12 A;  2ALZ A;  3BYP A;  3W2W A;  4ECW A;  2BW2 A;  4IOA Q;  4EZ9 A;  3MUT P;  3QLH A;  2QYC A;  1RJJ A;  1SC6 A;  3A8E A;  1HYS A;  4DOZ A;  3TVZ A;  1H74 A;  5L9N A;  4NLY A;  1T94 A;  3BH6 B;  4GMK A;  4K4Z A;  3ZTO A;  2CJX B;  2HLT A;  4LIR A;  3FBC A;  3OQ2 A;  4NCG A;  3R1H A;  2RD5 C;  2XWY A;  2RRA A;  4AE5 A;  2JLG A;  4Z7Y A;  3UDE A;  4DSL A;  3MMA B;  1H0H B;  3SSS A;  4Q7A A;  2EC2 A;  1WTB A;  4A8F A;  4U67 Q;  3FK4 A;  1IKX A;  1RAH B;  1YRU A;  2DD8 S;  2BOP A;  4K4S A;  2YTC A;  1DZ5 A;  1GXT A;  2PFD A;  2EFQ A;  4DV0 J;  2MKJ A;  3T19 A;  1I1G A;  3BO4 A;  2CKW A;  2N3O A;  4ZHR A;  1NKC A;  5U47 A;  4M5N A;  2VBX A;  5I3Q A;  4WZQ A;  1IXK A;  1PKU A;  2CVI A;  4J91 A;  2X3D A;  3FVY A;  3HVA A;  1S1V B;  2FLO A;  4J9S A;  1VQK S;  4F0M A;  1G4C A;  3JS9 A;  3HXM A;  2V2K A;  5KG0 A;  4OI0 A;  3QYY A;  4AFF A;  2M3D A;  1T9V A;  1I94 J;  2IVF B;  3FBE A;  2UXB F;  4K4U A;  3C66 A;  7FD1 A;  3LQV A;  4JI7 F;  4KHP J;  2AJ2 A;  4YB7 A;  2CJA A;  3KFW X;  3VAH A;  3AJ2 A;  3BQ1 A;  4EK2 A;  2E1M C;  3OJU A;  1RTH A;  3NMA A;  1SQG A;  5EUH A;  2JEI A;  3TQE A;  1RT7 B;  3AJD A;  2M7S A;  1JLB B;  2YKO A;  3NGS A;  2GIF A;  3EYZ A;  4MAK A;  2QSW A;  3PJW A;  2NUU G;  2N4D A;  2AWZ A;  1RTJ A;  1ZAV A;  4B9T A;  3F73 A;  2HHU A;  1GT8 A;  2IRU A;  1AW0 A;  1BY9 A;  2Y8W A;  5KFH A;  3I0S A;  5KG7 A;  4OYW A;  1LWE A;  5L8R C;  4I7F B;  3KTQ A;  2X1A A;  1DAR A;  4FDF A;  3MTK A;  3THP A;  1K9M T;  1UVI A;  3GCX P;  4PXC A;  2IC3 B;  1C1C A;  1RQ0 A;  4AT1 B;  2MQL A;  1LOU A;  2KXH A;  2HIQ A;  3IWL A;  2QA4 G;  4KHR A;  4CYU A;  2OPP B;  2UVR A;  2D1C A;  3T9N A;  2JFD A;  4YDX A;  4CZC A;  4I56 A;  2YNG B;  2KM8 B;  1R8B A;  1WOO A;  3KHH A;  1Q81 T;  2P2C B;  2DO0 A;  3J7Y I;  4NXM J;  2JHE A;  1UET A;  4CTA A;  2RF2 B;  2BVZ A;  3KK3 B;  3BR9 A;  5AE1 A;  2A10 A;  5A0Y B;  5CXT A;  1RA6 A;  2PMH A;  4GKK J;  1S6Q B;  1N5S A;  4CO1 A;  1LFW A;  1ULR A;  1DTT B;  3O3L A;  5CHC B;  3QAU A;  5K8N A;  3B8H A;  2CPH A;  4NLD A;  3VGU A;  2RDD A;  1HBN B;  2GMH A;  3FZB A;  1LWF B;  2FPH X;  1WHY A;  4QWC A;  1NHU A;  2C2N A;  3P49 B;  3D0I E;  3MOZ A;  4RUB A;  4NML A;  4AND A;  4B3M J;  1VRU B;  1NND A;  4C98 A;  3EWG A;  3HMJ G;  3H5U A;  2VQE J;  3J81 j;  2A2D A;  4B17 A;  2DGO A;  1OSD A;  1S99 A;  3QGI A;  4GKJ J;  1XR6 A;  5SZT A;  3I6P A;  2XC9 A;  2Y1R I;  3C16 A;  4QZV B;  3QT7 A;  3IAM 9;  1XQI A;  4FYX B;  1J5O A;  4OV1 A;  4USH A;  4WIQ A;  5IZH A;  3TVK A;  1YG0 A;  2I9S A;  2MB0 B;  4X4O A;  2DY1 A;  3H2U B;  3DRR B;  4C8O A;  3NKY A;  4Q45 A;  5G0R A;  3DLK A;  3V6D B;  3KLE A;  3K58 A;  4O44 B;  1K47 A;  4F0H A;  3RAQ A;  4DV2 J;  2AGO A;  5LSR A;  2ZH3 A;  2LQB A;  4EBC A;  3SDE A;  2CQB A;  2H9Z A;  3ZZU A;  2P9G A;  2XY7 A;  2CPE A;  3OFF A;  1FI4 A;  5IT9 Y;  1FDN A;  1YJV A;  3QWU A;  3DOM A;  3A3P B;  3OTO J;  4IOC Q;  5B0B A;  3QO9 A;  2AEF A;  4ECU A;  2G0J A;  1SKS A;  3B78 A;  3W2V A;  1OQ3 A;  2B4O A;  3CO0 P;  5KG1 A;  2HWT A;  1H6K X;  1NK8 A;  3RRH A;  3QT5 A;  4DR3 F;  4KQZ A;  1MRO A;  3TAM B;  4FVM A;  4E2F B;  1Y9O A;  4LRD A;  4RUC A;  2WVB A;  5GMK a;  1N36 F;  4M1K A;  1W2B R;  2XMV A;  3QAE A;  4A48 A;  4V19 J;  2G0I A;  1JXV A;  3KK2 B;  3TX8 A;  2ALY B;  4LF5 J;  5H9E J;  1AXQ A;  1VQO S;  1LV5 A;  4X4P A;  1FJ7 A;  4E8U A;  3HF5 A;  3QT6 A;  2HKE A;  1DJ0 A;  1HWU A;  3UO0 A;  5KFV A;  2PI5 A;  2F8E X;  1GH8 A;  4X65 F;  2AJ0 A;  4J9O A;  4PAB A;  5JVH Q;  1OY6 A;  2JOQ A;  3OL8 A;  2R4F A;  3RB3 A;  2YWW A;  2IVY A;  3PW0 A;  3JTP A;  3JSB A;  2BAC A;  3MDF A;  4K0K J;  3MM9 B;  1FXL A;  2DHA A;  5GVQ A;  1JLQ B;  3UW1 A;  4DF4 A;  3QNW B;  3I9V 9;  4FF4 A;  3OFG A;  3EMT A;  4ETX A;  3OLB A;  3SBM A;  3PKY A;  3FEY B;  5JVG Q;  4IRC A;  2XGQ A;  1YHQ S;  2V94 A;  2Z58 B;  1CQN A;  1HL6 A;  2IAJ B;  1RAI B;  2RUS A;  2XUL A;  1L3S A;  3LAL A;  2UUC F;  1WTF A;  2MQ8 A;  1NDP A;  2CNK B;  2M0G B;  4B3R F;  2XWX A;  3K5O A;  2QMX A;  5DDR C;  2DIT A;  3F0N A;  4ICL A;  3GFH A;  2MJU A;  1TL7 B;  1RWX B;  1FNO A;  3UNY A;  4ZVS B;  4C97 A;  2BKP A;  4CLU A;  3CD0 A;  1K44 A;  5HL7 Q;  1FHT A;  4P2S A;  4WII A;  3JTN A;  4NZ0 A;  2FHM A;  1EP4 A;  5ETR A;  6FD1 A;  3OFE A;  4J9N A;  4HI2 A;  2J7U A;  4LBH A;  1U1P A;  5KFT A;  1T03 A;  2RIL A;  4OYM A;  4D3G A;  5GAG U;  3BF4 A;  4PYA A;  3RB0 A;  4M5I A;  3I96 A;  1SKW A;  3RAX A;  3FQL A;  3KLF A;  2C2O B;  5E0O A;  2E5I A;  2N7Y A;  2YNH B;  4K7Q A;  1JJC B;  3G6X A;  4IQX A;  4LF4 J;  2UVW A;  1SH0 A;  3W5Y A;  4WP3 A;  2GMJ A;  1LKZ A;  4YP3 A;  2HBQ B;  2A6M A;  1J2V A;  4RNM A;  3FFI A;  2DXF A;  2FUG 9;  1KC8 T;  4WFX A;  4HTJ A;  3K59 A;  2I5J B;  3BQ0 A;  2UUW A;  2MXY A;  3OVB A;  3FCW A;  1S10 A;  4HL9 A;  4U8Y A;  2OP5 A;  2MGZ A;  2HS3 A;  3JSR A;  1MW7 A;  5DZ6 A;  2HFN A;  3GIR A;  3BR8 A;  2P8I A;  3TUI C;  1Y5N B;  1FDA A;  1YLX A;  2ZE2 A;  2EBE A;  1C1B A;  3HPO A;  2LA6 A;  2DNP A;  2V2Z A;  2C3P A;  3IC1 A;  4RNN A;  1K73 T;  1PJ5 A;  2KYX A;  3H5Y A;  3LF0 A;  4LF1 A;  1K1S A;  3GG1 A;  1RT4 B;  1TEL A;  3I5C A;  4DR1 J;  4K5R A;  3RTV A;  4MIA A;  2M4M A;  3BDP A;  4IFY B;  4OYB A;  3Q89 A;  2ZZT A;  1R0B G;  2G4B A;  4F25 A;  3KWM A;  1EIY B;  1HD1 A;  2J7W A;  1LW2 B;  4LF9 F;  1R6V A;  2I0X A;  3HJF A;  3MM6 A;  2PT0 A;  4ZP9 A;  3MR3 A;  2HQF A;  5E5N A;  3TZZ A;  2DGW A;  1VQM S;  2B7C B;  4DL4 A;  2HWH A;  3ET6 A;  1JJ4 A;  3D68 A;  3DRS A;  3M8P A;  5GAD U;  2QIF A;  2VIC A;  1D9D A;  5DQG A;  2FY8 A;  4PXB A;  3EZO A;  3CMQ A;  2MDA A;  5J2Q B;  2X3G A;  1FXD A;  3GFX A;  3MF5 A;  9ATC B;  1NJW A;  1S0V A;  1UJ5 A;  3MMB B;  4JI5 F;  2VA2 A;  1FF2 A;  5KFW A;  3W5Z A;  2ZBI A;  4OJ3 A;  1YJR A;  4W98 A;  3THT A;  4J9R A;  4DR4 F;  3QRP A;  1RE1 B;  5AXN A;  3OPK A;  4JP8 A;  1VR6 A;  1GXL A;  2E7W A;  2V2V A;  2CQ1 A;  2OPR B;  5KFL A;  3JXO A;  2ZDO A;  1BLU A;  2LQJ A;  1X4H A;  4PZV A;  1M0S A;  1RT1 A;  3H5S A;  2O3D A;  3RRG A;  2E44 A;  2KVQ E;  1X31 C;  3KJV A;  3T9Z A;  2WVF A;  2RQC A;  1JB0 C;  3RR7 A;  1WC3 A;  2HZC A;  3BSA A;  5F0W A;  2VG6 B;  1FX4 A;  2F9J A;  2JLF A;  3JB9 k;  1XNR J;  1TQL A;  2GJ2 A;  2DH9 A;  1NDC A;  2BE7 D;  2VG5 B;  4NZ6 A;  3UQS A;  2FJW A;  1NKE A;  4WF9 Q;  1ICE B;  1O6X A;  3PRD A;  1JWW A;  3E3X A;  1EAY C;  4BBY A;  4Y00 A;  5B0A A;  1HBM B;  2D74 B;  3O5T B;  4B9S A;  3EPG A;  2YKN A;  3BGL A;  4JI2 J;  4KO0 B;  5IOL A;  1SJQ A;  1QSY A;  3ZZR A;  4MTP A;  1RTZ A;  1VGY A;  1IKY B;  4EYH B;  4RNH A;  1X0F A;  2CFX A;  3HUL A;  3UDC A;  2E5J A;  4JB8 B;  2N82 B;  4AXJ A;  1HFE L;  2Z2M A;  2EKN A;  4LFB F;  2VG7 A;  1F2H A;  2CQI A;  5CCM A;  5HMY A;  3NNC A;  2ASD A;  2W4D A;  1OY9 A;  2LFV A;  5J1E A;  4L3N A;  4JI8 J;  4LBP A;  1RAD B;  4ZDN A;  4AXI A;  3FEX B;  3I0R A;  2X51 A;  1FDB A;  1VQ6 S;  3CED A;  3DN9 A;  4DFK A;  1LFP A;  2CNN B;  3AOB A;  4TKT A;  4RKU C;  4PWW A;  3LPY A;  2A0F B;  1ZAX A;  3BZQ A;  2GQQ A;  2F65 A;  4OX9 F;  2XMW A;  1SC4 B;  2JEG A;  3J7A N;  4DFJ A;  1BGX T;  4TQS A;  2KZZ A;  4CQ1 A;  3J81 U;  4K4X A;  3W2W B;  2K7K A;  2HNY A;  4ZS6 A;  2DPI A;  2HHH F;  1SJ3 P;  2RQ4 A;  1OY8 A;  1IBK F;  5SUH A;  2ATL A;  3MEC A;  3OXF A;  2XMA A;  3OD2 A;  3CUL A;  3QLH B;  3JYT B;  2V5H G;  4DS4 A;  1TFY A;  3CJ4 A;  4F02 A;  1QDU B;  2NUH A;  3FNN A;  1R7I A;  5IQQ A;  1HYS B;  4LSN A;  2EK1 A;  2HQD A;  5A8W B;  1VC0 A;  2DCU B;  3DLL Q;  1WSR A;  1WG5 A;  4H4M A;  3UCG A;  5HMW A;  3CJS A;  1RBA A;  4NCG B;  2OLW A;  1RCX B;  1X4B A;  3V6K A;  4DQS A;  2CQG A;  5K20 B;  1D9F A;  1Y3J A;  2Y8Y A;  3QGP A;  2E1R A;  4UZC A;  4OHV A;  3VGT A;  4C0O C;  1O0P A;  4DX7 A;  2PA8 D;  4B3O A;  4OX6 A;  2R8K A;  4NL5 A;  3VWS A;  2LEP A;  4ZHR B;  1XMO J;  2CJ9 A;  3MCS A;  4NLS A;  4FBU A;  3CCT A;  4LRF A;  2M88 A;  3Q8S B;  2EPI A;  1GTE A;  4J9P A;  4BCA A;  2I2Y A;  1YBA A;  3CB4 A;  2KL8 A;  4DV6 F;  1G1X A;  1RHM B;  3MUM P;  4OYP A;  1VRQ C;  4MKY A;  3AQP A;  4O4G A;  7AT1 B;  3CJT A;  4ZP6 A;  4X64 J;  3K2Y A;  3V4I A;  4ER8 A;  3SYZ A;  2H5E A;  5A8R B;  4PG6 A;  2GW8 A;  2Y0B B;  3PAC A;  1TU0 B;  4ZP8 A;  3DHX A;  5GAH U;  1IJF B;  3AXK A;  1BHN A;  3I55 S;  3G8Q A;  5D4O A;  3C19 A;  3DGV A;  2RB7 A;  3M32 A;  4BDP A;  1X4D A;  2OPQ A;  3JSY A;  4DSJ A;  4NZ7 A;  3PV8 A;  1G2E A;  2V4Q A;  3E2E A;  2IPO B;  3I0S B;  3A8K A;  2JNJ A;  2BJ1 A;  3NGD A;  2GFF A;  3B54 A;  3DOL A;  2CWK A;  2YNI A;  3TNV A;  1WAC A;  2G2O A;  4O23 A;  4HH1 A;  1G6B A;  4EFA C;  3H0P A;  3G8S A;  3TVY A;  2DEI A;  1OPZ A;  3W7B A;  1Z2L A;  2GIQ A;  1FD8 A;  1B0T A;  4M95 A;  2MLY A;  2UUB F;  1C1C B;  1HD0 A;  2AJ4 A;  4WWS A;  2FLP A;  4ZN1 A;  2LXF A;  2IM1 A;  3IS9 A;  2MKC A;  4DCJ B;  4M5M A;  5LMU F;  4YB6 A;  1RK8 A;  1R8A A;  1TVR A;  2GVZ B;  1G3O A;  2B5J A;  2DIV A;  5G4D A;  5EGY A;  3OL9 A;  5D4L A;  2AYG A;  5ETQ A;  3R9L A;  4DL7 A;  1K0T A;  4FF2 A;  4TYB A;  2V8P A;  4KGK A;  4M5J A;  3DLH A;  4TY8 A;  2M52 A;  5AJ3 F;  1C0U B;  3H25 A;  3W9J A;  3M4X A;  3HZG A;  4B9L A;  2HGN A;  4C8Z A;  4U96 A;  1SCJ B;  1FRL A;  1QTM A;  5FLX U;  1WI6 A;  2ZZM A;  1CJK B;  1HI8 A;  1UW4 A;  4N5S A;  4CCH A;  3KG0 A;  2C1E B;  3UN3 A;  2UXB J;  4JI7 J;  2OMO A;  3BPS P;  8ATC B;  1VHI A;  1FFG B;  3W60 A;  3WC0 A;  4PXE A;  1UJ6 A;  3OXG A;  1XTZ A;  4M5H A;  2HRY A;  3QIP A;  4NE9 C;  1B4S A;  3PYF A;  2CQ4 A;  5HVH A;  1IKV B;  3D6M B;  1KLN A;  2EK6 A;  3HO1 A;  3SCJ E;  2QT7 A;  1TAQ A;  2Q3P A;  1L3V A;  1S1U A;  4C4W A;  2DR6 A;  5J2M B;  3P4U B;  3M1V A;  2H5I B;  4MIB A;  2VB6 A;  3UNG C;  1U47 A;  1QY7 A;  5AXL A;  1ZZN A;  3QT8 A;  2EG1 A;  2HHP A;  4G3I A;  1WHX A;  4DL3 A;  2QTW A;  5I3U B;  2ZHA A;  1GMV A;  2FHO B;  4WU3 A;  1Y7P A;  3C16 B;  3J7Z T;  1TV6 B;  2BRK A;  1REV B;  1F5A A;  2QGF B;  4YHH J;  2QEX S;  3V5R A;  3VZH A;  4YR3 A;  1LQ9 A;  4KHM A;  3C46 A;  3DXS X;  1J5E F;  4C3K A;  1K1Q A;  1BQN B;  3NLC A;  3MAH A;  2AD9 A;  3TWZ A;  4B9U A;  4I4B A;  1U0S A;  1Q1K A;  3EIC A;  5HQL A;  2UUT A;  2ZH9 A;  1F1B B;  5EN1 A;  1JLC A;  4DUY F;  1FNX H;  1BWE A;  3M8Q A;  2CZ4 A;  1SJF A;  3GJQ B;  3KUE A;  1U8W A;  1NEE A;  2OFH X;  3ONQ A;  4CDI A;  4QWE A;  2KU7 A;  1YJT A;  1FE0 A;  3U1N A;  1GX6 A;  3RBE A;  2HNZ B;  2R8H A;  2GV1 A;  4ILL A;  1YTY A;  5J1N A;  4F8R A;  3W2V B;  4M94 A;  4W92 B;  1HQU A;  3NMR A;  4CLZ A;  7FDR A;  2VFS A;  1HNX F;  5KFY A;  1AA1 B;  3SV4 A;  3JAM U;  1MRO B;  4NX9 A;  2C22 A;  1N52 B;  2HG4 A;  2FVC A;  3KLG B;  3LP1 B;  4JYA F;  2VPX B;  2MKS A;  3HSD A;  3ZZP A;  3CF5 Q;  4DI6 A;  4HVZ A;  2BXJ A;  2YKM A; 
#chains in the Genus database with same CATH homology
 1GFW B;  1RHQ B;  2QL9 B;  2CJY B;  3RJM B;  2XZD B;  3IBF B;  4ZVU B;  2C1E B;  1RHR B;  3R7S B;  1SC3 B;  1PAU B;  3KJN B;  1ICE B;  1RWW B;  1I51 B;  2P2C B;  3NS7 B;  2CNK B;  2CNN B;  1SC1 B;  2H65 B;  2QL7 B;  2CNO B;  2XYP B;  2H5J B;  2QLF B;  2FQQ B;  2HBZ B;  1RWX B;  2C2Z B;  4ZVS B;  5IC4 B;  2CNL B;  3GJQ B;  4ZVP B;  1SC4 B;  4ZVO B;  2HBR B;  1QTN B;  2CDR B;  3D6M B;  3D6F B;  2H48 B;  2HBY B;  1RHK B;  4DCP B;  2H54 B;  2XYH B;  1RE1 B;  3IBC B;  3EDR B;  2QLB B;  2QL5 B;  4DCJ B;  1BMQ B;  2H4Y B;  2C2M B;  1RHM B;  3P4U B;  2H5I B;  1QDU B;  1I3O B;  2XYG B;  3GJS B;  3SIP B;  3GJR B;  3P45 B;  5IC6 B;  2H51 B;  2C2O B;  4JB8 B;  2QLJ B;  2C2K B;  3R6L B;  1RWM B;  1RHJ B;  3R5J B;  1RWK B;  4ZVR B;  2Y1L B;  1IBC B;  1F9E B;  3KJQ B;  4ZVQ B;  2Y0B B;  3R6G B;  1RWO B;  3R7N B;  3QNW B;  1RWP B;  3D6H B;  2CJX B;  3GJT B;  5K20 B;  3R7B B;  1RWV B;  2XZT B;  1PYO B;  3KJF B;  2DKO B;  3EDQ B;  4DCO B;  2H4W B;  2HBQ B;  4LSZ B;  1NME B;  1RWN B;  1RHU B;  4ZVT B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...