2QLBB

Crystal structure of caspase-7 with inhibitor ac-esmd-cho
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
92
structure length
92
Chain Sequence
KIPVEADFLFAYSTVPGYYSWRSPGRGSWFVQALCSILEEHGKDLEIMQILTRVNDRVARHFESQSDDPHFHEKKQIPCVVSMLTKELYFSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Caspase-7
publication title Plasticity of S2-S4 specificity pockets of executioner caspase-7 revealed by structural and kinetic analysis.
pubmed doi rcsb
source organism Homo sapiens
total genus 18
structure length 92
sequence length 92
chains with identical sequence D
ec nomenclature ec 3.4.22.60: Caspase-7.
pdb deposition date 2007-07-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 2qlbB00
3GJSB 1I51B 3QNWB 4DCOB 2H48B 4ZVUB 4LSZB 4ZVQB 2XYPB 1RHUB 3KJNB 2QL5B 1RHJB 2CNLB 2QL7B 2Y0BB 2XZDB 1I3OB 2H51B 4DCPB 3NS7B 2XYHB 3R6GB 3GJRB 2H65B 3IBFB 2HBQB 2H4WB 1RHKB 3EDQB 3GJTB 3KJFB 2H54B 2FQQB 1RWKB 2CNOB 2H4YB 2C2KB 1RWWB 2QLJB 2HBYB 1BMQB 1RWOB 3R7SB 2HBRB 3P45B 3GJQB 2H5JB 1RWXB 3R5JB 1ICEB 1SC3B 3IBCB 1RE1B 1RHRB 3P4UB 2QL9B 2CJXB 1QDUB 1RHMB 4ZVOB 4ZVTB 1RWNB 5IC6B 1IBCB 2C2OB 3EDRB 1RWVB 2XZTB 1RWPB 2C2ZB 2H5IB 4JB8B 2QLFB 1SC1B 2HBZB 3D6FB 3SIPB 1SC4B 1QTNB 3R6LB 5IC4B 2QLBB 2CDRB 1NMEB 2CNKB 2CJYB 1RWMB 2C2MB 2Y1LB 1PYOB 4DCJB 5K20B 2P2CB 1RHQB 1PAUB 3RJMB 1F9EB 3D6HB 3KJQB 1GFWB 2CNNB 4ZVPB 4ZVSB 2DKOB 3D6MB 4ZVRB 2C1EB 2XYGB 3R7NB 3R7BB
chains in the Genus database with same CATH superfamily
2OPRA 2V2ZA 2UXDJ 1FRHA 4USIA 2M3DA 3W2VA 2LDYA 1WHVA 1YJ9S 3RUBL 1LW0A 1U1PA 3HJVA 3HHNB 3BR9A 2DH8A 3U02A 2PMHA 3B78A 1RWKB 3UD4P 1F60B 2I8EA 2QJ3A 2UUBF 2W4PA 3O6QA 2OIHA 1U1LA 1QLNA 2AKWB 1PC5A 4P73A 2W2PP 4CH1A 1N8RT 2ZBQA 3FZBA 4EUVA 2LLZA 2RMLA 4MKBA 2FJVA 2AGQA 4H4OA 1KTVA 4JYAF 4WJBA 3OJSA 2QA1A 4A8QA 2DD8S 3CIMA 2DNOA 3BEGB 2KYXA 3BSNA 3G6YA 3PO4A 1IKWB 4QR2A 1RTJB 2MKSA 1BQNB 3GG1A 3Q8UA 5IT4A 2XY6A 2FHJD 2RAQA 2AJQA 5F3TA 4Q0BA 4ED7A 3FC9A 3NMRA 3KJVB 2C3UA 1FHTA 4DI6A 3FUYA 2BA9A 3X3UA 3BSAA 2GQCA 1WOPA 2H51B 1U6FA 1IWGA 5KFYA 5KG2A 1N34J 2W9BB 2DIVA 1A9NB 3WC2A 3QGGA 2ZITA 1P9YA 5B0EA 4F3MA 3QRPA 4YHHF 2GC8A 5KG0A 2O1PA 2CG4A 5B0GA 2HRTA 3E3XA 1YITS 1DRZA 5HP1A 2AQ4A 5KG7A 5ETOA 3N4WA 4OZ3A 2AZ3A 2RF2B 1FK9A 3EPIA 1UWBA 3BH7B 1S5ZA 2IVMA 3V4IA 4ZJQA 3MDFA 2JLEA 3IM9A 3GE9A 5J2MB 4OZ0A 4ID8A 1S59A 2OAUA 5D0GA 3CCZA 1BQMA 3TUIC 3TUZC 1VYAA 1DHMA 1XWLA 3DRXA 4OZ2A 3LF0A 4QIGA 2RRBA 5B0CA 4U8YA 4DCOB 5H9EJ 1SL1A 1IKXA 1VQ7S 5KFPA 3HHDA 1NU4A 4P7VA 1VBYA 4OI0A 1Q95G 3VZIA 4D3HA 2E5JA 2D3OR 3H40A 4UZCA 2AEFA 2GQ2A 2FHJA 2ABYA 4CO2A 4JI8J 2XMTA 2UV8G 4UQTA 2WW8A 5T7LB 1CS4A 3SFUA 4UUXA 3C16B 1JJHA 4ES3A 3BO3A 1S7HA 1N5YA 1TKZB 4E0DA 1Z1ZA 4G3IA 2RB7A 2R8IA 2HVDA 3M2UB 2RKIB 2CUYA 3D6FB 4CO5A 3QLHB 4WIIA 1HD1A 4KPCA 2QMUB 2GHWA 2O5DA 2BJ3A 2LA6A 2D3O1 3EM1A 5D4OA 2R9LA 3RR8A 1N6QB 2CXEA 3CD0A 4CLTA 3NOCA 1X0FA 3CCTA 2QZ8A 2EK6A 1XR6A 2B7BB 4X4OA 3O3LA 3G6ES 3NL0A 2RU3A 2KG0A 2MDAA 3LPEA 5B0DA 1FDNA 2Y1RI 1YRUA 3M8QB 1JKHB 4F26A 5A6WA 1FJCA 1KFDA 1RWOB 3DHXA 3DU5A 2NXEA 1UFWA 3H5UA 3TVZA 2W2OP 4Z2XA 4DZDA 2GO9A 3QGIA 4YR3A 4ERDA 2KM8B 4YDXA 1U1KA 4KBIA 1TKXB 2Z56B 4NLWA 2JFKA 4ZS6A 1NK0A 1IKWA 2VQFF 2UXBJ 2V94A 1RTJA 3P5TL 3HT0A 2NSBA 2YX1A 1RAIB 2HAIA 2JEFA 1OIAA 1PG5B 1BQNA 1UVKA 5EX3A 4B9SA 5DDPC 1WACA 4Y2IA 2FZGB 3KJVA 1NB2A 2UXCJ 5LMUF 4WK3A 4WTOB 1SPBP 4DCPB 4NPOA 3H98A 4ZPBA 2LEBA 5GADI 1LOUA 3KMSA 4FYYB 2V2QA 3AXMA 2BE2B 4KB7A 1TAUA 2W9BA 4PKDB 2HMIB 3ZZPA 2HHHJ 1Q78A 4DV5F 1REGX 4J5OA 2VOOA 3DLEB 3GB0A 4MT1A 3DKDA 1RGVA 1RE1B 4DL4A 1B7FA 2KT5A 2Q6CA 2CWXA 1S12A 4CYUB 5EN1A 2E5LF 1SVDA 4Q2MA 2RF2A 3DDNA 3JXOA 2C2OB 1F6TA 3JQKA 5AXLA 4F7VA 2ASLA 2QYGA 1RT1B 1T03B 2MKKA 5J2MA 2B6AB 2B51A 4N77A 2MXYA 3EPGA 4B9NA 4M5HA 3QZ8A 2DGVA 3SSSA 4F2RA 4ECQA 3SEOA 2LQ5A 2MZTA 2VBXA 4A48A 3S1TA 1H3DA 4L76A 5ETSA 4USJC 1T95A 1FFGB 1FNOA 3DHWC 4ZLJA 3VGTA 1XNRJ 2PA3A 2ZBPA 4ZJLA 4HT5A 3OL7A 1FWPA 3Q83A 2KXHA 3UCZP 3DLLQ 1FE4A 4O3RA 3KHHA 2M5YA 2G2YA 3WHIA 5KFAA 2YNGB 5EWFA 1T8EA 3ZC4A 1SJ4P 3PR4A 2J0XA 2VC0A 4JI6J 1RWWB 5CYJA 1IKVB 3EGWB 4OYBA 1N52B 2DB1A 1X9WA 5T7LA 1EJ7L 2ZH6A 3C16A 4I2PB 2DK2A 1TKZA 3BQ2A 1RWVB 1E6YB 1KNZA 4ED3A 3M2UA 2RKIA 2NCKL 3QLHA 2Q79A 2W24A 2DNLA 3AD8C 1TV6B 3P3DA 4NCAA 2FLNA 2HIYA 1S49A 1AB8A 2WSFC 1GNKA 3PW5A 4ZDNA 4DL0C 3I82A 3GU0A 3KKFA 3KNGA 2R2RA 1N6QA 5AE1A 4C11B 1SI9A 2R7VA 4QW9A 1HW9A 3UNGC 5L1LA 4O0IA 3RAXA 1X60A 1Q7LB 4TXSA 5MLCV 4DQRA 2VFUA 1SQEA 3FBBA 1L3KA 3M8QA 4WF9Q 1JKHA 3QGHA 2VUGA 2ZZNA 3DNCA 4ELVA 3QWPA 2HW3A 3KTQA 3IBCB 2V50A 4F25A 5GAHU 1HFEL 3L9ZA 3OL9A 4UT4A 3GR1A 1N36J 1EP4B 4ZVOB 2J8SA 4YY3J 1V3SA 2RQCA 2YXLA 1W2IA 4A8YA 1SL2A 3T6BA 2QTWA 1BWEA 4DV6J 3I6PA 3DLGB 3D67A 4P2FA 1TKXA 1YZ7A 2KL8A 3CE8A 4RX6A 3D4JA 3UN2A 4DR2J 1Q16B 2JL9A 1ELOA 2RQ4A 3MMJA 3J80U 4NLTA 4MFBB 3ENVA 1UW9A 2XYGB 1RK8A 2MKJA 3W1YC 1XEZA 1GTHA 4TLQA 3OLAA 4KHPF 3M05A 2ZM6F 4P9SA 1K0VA 3K2YA 1RKJA 2QSFA 2BJ8A 3C8YA 2RIJA 4LF9F 4DJBA 4J9VA 4QWDA 2PN6A 1ZTWA 1RAAB 2BE2A 1Z2LA 2XHWA 2KN4A 4M5KA 1VC6A 2HMIA 4KGKA 3EX7B 3R97A 2J7WA 1S57A 2H5JB 3ZTRA 4DEZA 2B8PA 4NXNJ 3DLEA 3I32A 4OZ1A 3FGVA 1RI7A 2VIHA 1ZTTA 5C2CA 1Q53A 1WEZA 2V2VA 1Q5VA 4CYUA 3R1LA 2ZWOA 2PD1A 1FX2A 1NBEB 3DLJA 2IM1A 1WI8A 4A8FA 2R8JA 2R7TA 4B17A 1RT1A 1SC4B 2AF6A 2Y1IA 1T03A 2AJ4A 4F4XA 4KGVB 2I6WA 4EBEA 1W7WA 2B6AA 1WDTA 2YTCA 5DM6Q 5ETNA 5C7PA 2WONB 3CEDA 1VRTB 3KOAA 4JI5J 4M63A 1JLBB 4I56A 3VAJA 3W8GA 3DRYA 2XYPB 2ADCA 3OR1B 4EFAC 3P49B 2HRYA 2C3YA 3VGUA 2A6OA 2VQEF 2ZD1B 3NS7B 2VB6A 3RU0A 2WVDA 4IH7A 4W98A 4DR1J 5J1EB 2M88A 3HFKA 4P2SA 4XPCA 2V8VA 2YNGA 4FXVA 3ZZRA 3QAEA 1B64A 4DS5A 4I6WA 5KOXA 2CQ4A 1IKVA 4LUBA 4I7FB 3BB5A 1SXLA 2NZCA 3S8SA 4M94A 1WELA 3VAKA 1S9FA 3OPKA 4IR1A 4NWBA 4I2PA 4YMEA 1FWLA 2IDLA 5AXKA 3PX4A 4LR7A 5J1PA 5F9NA 1Q0NA 1E6YA 5FLXU 1F3FA 3LTOA 2YY3A 1JLQB 3FSYA 2B3TB 1KVKA 1LNQA 4NXMF 4P2MA 1PAEX 4X62J 2KDOA 4IH5A 3F0NA 4LRAA 3QRQA 2FIUA 1FTRA 2JVOA 3X1LB 1TV6A 3ADAC 2I5JB 3OBIA 5HJXA 3OFGA 1RHUB 1M90T 1IBKF 1HQEB 4C11A 2ZHOA 2FYXA 3O2IA 2ZH3A 2IVFB 3W9IA 3GFYA 3KUEA 1C1BB 1O51A 3M9OB 1CQNA 1QAIA 4HHJA 3CDAA 2LQ9A 1BMQB 2XO7A 5KG4A 2HBRB 2E1PA 5A0YB 3N0VA 3MUMP 3UDCA 2ZHBA 1CULB 3NAHA 1WC3A 3TZXA 1ZH5A 2RILA 2EFGA 1Y10A 2DNQA 1IQZA 4USTA 1EP4A 1IBCB 2XI3A 3LPYA 3DOKB 4ID5B 4C3MA 2IM2A 2H1YA 4HL9A 2AT1B 2IAJB 3SMZA 3HULA 3WC0A 5BJRA 1HPZB 3DLGA 3H20A 1FDAA 3CVKA 3K17A 3GYNA 4TU7A 4BHQA 1TUVA 2CKWA 2KT3A 5ETMA 5GAGI 4B3MJ 5BR8J 4MFBA 5K9FA 2F8MA 5KFWA 2FUG9 1WUUA 4GKJJ 3AOBA 3H2UB 3L7OA 1XMQJ 4DQIA 4C2MA 2FLLA 3I56S 4LQ9A 3M8RA 3M4XA 4ZJOA 3OL8A 4NLPA 5D4PA 4G6VB 2MZRA 1NPRA 3MPYA 4DUZJ 2HGLA 3M6UA 5LSLA 1IR0A 2L48A 1WOOA 2OMLA 2R8HA 1YJWS 4Q7AA 2R7WA 3VALA 1R7IA 1ZS6A 3P96A 2J6UA 4DV7J 2CJ9A 1CJVB 2DHHA 1B0PA 5F8NA 3NY0A 4RU2A 3C14B 2HHUA 3HP6A 2JDJA 5HL7Q 3NNHA 1U2FA 5HK4A 5LJ5Y 3RZAA 3T1YF 2F9DA 1WG1A 2VFTA 3NCRA 1FKOB 1KQSR 2GJ2A 5KFDA 4M5MA 2WONA 1VRTA 3G4SS 3I4PA 3PYEA 3QAUA 2A3JA 1JLBA 2FY8A 2KHCA 1S76D 3QYYA 3OR1A 2F9JA 2Q66A 3ENAA 3VAHA 4NA1A 5BXIA 2ZOGA 2ZD1A 4DV3F 1FO1A 1EZZB 4OZNA 3S7RA 5J1EA 1VGYA 4YR0A 2LA4A 4IQMA 3RAMA 4R0EA 5F3ZA 2HVEA 5M2RA 4ICLB 3DN9A 2DNHA 1JLGB 3G86A 4I7FA 1FRJA 1G1XA 2MQNA 3C2PA 3MTKA 3DXSX 5D0RA 1T9WA 3EDRB 1XNRF 4WKYA 2HVHA 3H2VE 3J81U 3MM8B 4JB8B 1RT3B 2CJBA 2KFNA 3SIPB 1NK4A 2FVPA 1F9HA 2E1MC 2Q3PA 2UVWA 1JLQA 2HGMA 2XY5A 4KT0C 4FBTA 4FS2A 5H9FK 4NZ0A 4B9VA 2I5JA 4LBHA 2P9CA 1S0VA 1SH3A 3UNYA 1FWKA 1RTHB 4O44B 4Y3CA 4GC7A 5K8OA 3AY0A 2KFZA 2ZVSA 1HQEA 4O0NA 5HMWA 4ED4A 4NYPA 2UP1A 5DQHA 3VQTA 1C1BA 3QO9B 3GJTB 4K4VA 3U1MA 1QY7A 4B02A 5IFMA 4NLXA 3AD9C 3V2UC 4RWWA 4FF3A 2DH7A 4DSLA 1S1TB 2YWGA 4LFBJ 2FLOA 5A0YA 2YKAA 1WG4A 2ZUAA 1CULA 3P8BB 1KVJA 4QR0A 4MYTA 3JQJA 4DUYF 3K8VA 5IC6B 2MQLA 3GIMA 4ECXA 4JV1A 1OJ4A 4DR5J 2LVWA 1Y4ZB 1QVFR 4URGA 1T0TV 1X9SA 3DOKA 4ID5A 1GTEA 2IAJA 1P27B 1DARA 2C28A 4QU7A 2V2KA 3HMJG 1HPZA 1HNIB 1RT6B 4WPAA 4I6YA 3RB6A 1IXKA 4UF4A 5L1KA 1RISA 2HGNA 4C0OC 3CD5A 4A4JA 1NCLA 2E44A 4WFAQ 2ROGA 1N36F 3CT9A 2GCFA 3W9HA 2PMWA 1P1TA 2HS0A 4WZQA 4DV6F 1RAOA 2V69A 4QWEA 1FJ7A 5DRKA 4O3QA 4QWAA 1WOSA 1Y7PA 4K4WA 4DL5A 4S0MA 3SSQA 3NNCA 2NQPA 4DV0J 2V8PA 1N33J 4DG1B 2CPFA 1FXLA 1NZ8A 3L95X 2D69A 3S01A 3M7VA 2I9SA 3ZTOA 4GRSA 1VC0A 1Y11A 2U1AA 1CJVA 1WI6A 2WBRA 2AP6A 1X4FA 3C14A 2W4CA 4NLYA 2CDQA 1QTNB 1DTTB 1DQ8A 3VQSA 3C19A 1WNEA 1QVGR 2VJUA 2W7AA 1FE0A 4L3KA 1FKOA 4NLUA 1G7CB 3M6VA 4QCLA 1UVNA 2XG8A 3D6TB 3ITHB 1N56A 4DQPA 5DLFA 4DSIA 2J7KA 2KU7A 3E01B 3NCQA 4ZPCA 4WXWA 1YJTA 3R8YA 4JI3J 1PJ6A 4JI1F 5E3QA 1KSPA 3KJFB 2A18A 3T6JA 3NGRA 4M5LA 2G0IA 1TP7A 4CM2A 2HVZA 3DRPB 1T9YA 4M5DB 4XIUA 1V9OA 1B70B 1S72S 2DCLA 4ICLA 2OELA 1S6OA 4FZVA 1Q1KA 4QIVA 3OV7A 2VOPA 2B56A 3N28A 2KZMA 1JLGA 1VRUB 4FP9A 2DY9A 2R3VA 3M6WA 3EXCX 3RRHA 3DOMB 2VZ9A 4KAIA 3MM8A 5KFBA 2HHWA 2OTJS 1RT3A 4USVA 4NMXA 5EX0A 2IA6A 1WC4A 4ZLLA 1Q8BA 2CFXA 2G1HA 1D9DA 3AJ2A 3PVXA 2C2EA 2KFYA 4CP5A 1XC9A 2EEYA 5GMEA 1N5QA 1RDRA 5LSOA 4N8OA 5DZ6A 4WE1B 3U7JA 4I64A 1RTHA 1ZZFA 4O44A 2QL5B 2NR0A 1OPZA 2HHXA 1KOHA 1VMBA 2F4FA 5HMXA 3LGNA 4FXDA 2H4WB 3QJJA 2IBKA 4G1QB 4CWBA 3W2WB 2DEIA 3A8KA 3QO9A 2K06A 1EQMA 4EBCA 4BC9A 2HLUA 2RD5C 1S6PB 2Y8YA 1S1TA 1D3WA 1HHTP 3DDKA 1BXNA 4X66J 2HYIB 3CC7S 2YNFB 2RUSA 2ATLA 1APSA 2Q6BA 2BOAA 2VA2A 3LGHA 1MWZA 4JUZA 4MK8A 2AX0A 4Q2LA 3IN5A 5KTQA 1OS5A 2C2MB 4J9NA 1PO6A 1GXTA 3W66A 2HQFA 2EC0A 4ECTA 1HNIA 1RT6A 2FHMA 3K89A 4ZVPB 4FVMA 4PG5A 1UVMA 2DGSA 3IAS9 1MLAA 5CAAA 2QA2A 4RW8B 4BCAA 3KJNB 3CCUS 3CJ0A 4FYWB 1U49A 3NOGA 3Q86A 3Q8PB 1UEVA 5B0BA 2YQ0A 1T05B 4O3NA 3NGKA 3PEJA 4P6QA 3POTB 1FCAA 2LKZA 3J7YI 1R3NA 2XMKA 1IJFB 4AXIA 3CJRA 1K1QA 1OPIA 3BR8A 3ZZYA 3LW5C 3O8WA 3UFCX 4DG1A 4KYZA 4MKAA 2JNJA 3A3NB 3KK2B 4GKKF 4P52A 1SC1B 4EZ6A 1HD0A 1X5OA 3MECB 4ILRA 3ICLA 3T5LA 1EARA 2WZ1A 1M5PC 1DTTA 1YRXA 1AT1B 4QZVB 1JIHA 4ZN1A 5KFMA 4DF4A 3CXCR 4B3SJ 2CQCA 3BGLA 2ZH8A 1D0EA 3IGNA 3PFEA 5K8PA 2R2SA 2M7SA 3IFEA 1WWHA 1KP6A 3JTPA 3BGFA 1XIQA 3ITHA 1NJYA 4NLSA 4X4PA 3E01A 2HBQB 3KLHB 4IDKB 2E1CA 2ASDA 1W26A 3FCWA 3W5XA 5F8MA 3PDNA 2C2RA 4P75A 2VJVA 2DCUB 4E2FB 3O44A 3ULHA 1I6JA 2DPJA 1MMLA 4A8KA 1Q86T 4M5DA 3BJYA 2K7JA 1VQLS 3IAM9 1RA6A 5DDQC 3TOQA 3CULA 1KQFB 3HM9A 1VRUA 1YK9A 2O3DA 1EKSA 3HD2A 2QLFB 2QSWA 4J9SA 4CNZA 1F5CA 3DOMA 3T5KA 2DNZA 4IUFA 3V6JA 4DFJA 3VAGA 1RADB 5CXTA 2HK2A 3Q24A 5JXSA 4J9KA 5D77A 4YP3A 3NCPA 4DX7A 5AJ3J 2B0GA 3UDEA 1LKZA 2UU9J 3H2LA 1PYTA 4PXEA 2HURA 1NDPA 3W7BA 2AEJA 2WSCC 3D0HE 2QFIA 4WE1A 1UZHA 4DDFA 1HBOB 1TQLA 2CPXA 1OYDA 3AJDA 2DNKA 1PIEA 4G1QA 3W2WA 3PYDA 3ETMA 2QA4G 4ECVA 1BHNA 1L3SA 1PC4A 1LXJA 2R8GA 4B08A 1S6PA 1FA0A 2NLWA 3PCOB 2YWFA 1FJGF 1RUSA 3HKWA 2YNFA 1RBAA 2B9EA 4L72B 1WTFA 5CZVA 2ZH9A 2HBZB 1EETB 4ANCA 3ZTQA 2N3OA 3JTNA 3NGUA 2J0SD 3GR0A 3HHLB 3GV8B 3I5CA 1HQ2A 1PYOB 2FHKA 3GCWP 3D3BJ 3Q8RB 3IR6B 3RBEA 2E5IA 1S1VB 2QX0A 2PE8A 4TU8A 1NB7A 4RW7B 3KK3B 1KWMA 3TEGA 4LFBF 1AZSB 5EHHA 4DZ6A 4ZVQB 4K59A 3DDIA 1KQGB 4RW8A 3AAWB 1J27A 2XULA 4J9UE 4ED1A 2MYFA 2YPZA 3IS9B 1RP5A 3EMTA 3QSYB 3CCQS 2UUCF 2Q43A 1SKUB 1T05A 1S6UA 3TX8A 3OT9A 3DLHA 2F65A 3LANA 3POTA 4RUCA 3D0GE 2VBZA 5KFQA 2IVYA 2KI2A 4ZMMA 1S79A 5EUHA 4LRDA 1U1QA 2DXEA 3NRBA 4DR7J 4ZCKA 2V6AA 3KK2A 4OL8A 4PABA 2KXFA 1OY9A 3CCRS 2AW0A 3MECA 4AL6A 3DGVA 4ZPTR 1KDNA 3PEHA 4DPOA 3M8YA 3A3PB 1YSJA 1R6YA 2GZOA 3A8JA 4DPTA 1UA0A 3PIOQ 1X4EA 5CD4H 1VQMS 3R7BB 1PYSB 5T14A 2H5EA 1S7IA 5E3RA 4DV0F 4X4TA 1AUSL 3CWJA 4O23A 3AOCA 3GJRB 3G2XA 1M0SA 3KLHA 4IDKA 4XDCA 1RCOB 3TAMB 3E8OA 3NNAA 3SV3A 3HHLD 1X4AA 4I1TA 1K9MT 3HJFA 3TQ1A 1U2RA 2CPIA 3LQVA 3O1LA 4Q45A 1YI2S 1P1LA 2HNZB 4QW8A 4O3SA 1LV5A 2BJ9A 4TN2A 5D15A 1QJHA 4PRFA 2LQJA 2P5VA 4F67A 5E2QA 5IWAJ 3CJ4A 1BGXT 1T94A 2ACYA 1TL3B 1MG7A 3CCLS 2BBEA 3VVTA 3QQCD 3D28A 2UVVA 3MAAB 2Z8QA 1VQOS 4CDIA 5B0AA 1IR1A 1SBRA 2W2NP 3FQKA 5I42B 3NP5A 2J6TA 3ZO7A 2AJ1A 2DBBA 1TUGB 3C6UB 3EGVA 1VQNS 1OSDA 2P9GA 5B09A 4FF1A 2P6TA 4OYZA 2EFVA 5LSRA 1HBOA 3PRBA 2IMWP 4LF8J 2BYCA 2CVIA 3GIKA 4ECSA 4AYBD 1WTBA 3K5LA 1Z4UA 3CCJS 3GIIA 1HKAA 2ZDPA 1UCNA 1W2BR 3THVA 1FFWB 4PQAA 1SC3B 5ADZA 1DAXA 2V4RA 2KG1A 2G1DA 1WSVA 2CJXB 4Q8FA 2FVRA 1Q8KA 4N8NA 2DEJA 2GMHA 4IG3B 4J9OA 1H73A 3GWCA 2K7KA 2CQBA 1G6BA 3Q8VA 1EETA 3AD7C 5KFKA 4ECWA 1S6QB 3NLCA 4NLDA 3HHLA 4N47A 4U9RA 4P72A 5AE3A 2NXJA 3TJ9A 1HQUB 1U0HB 1S1VA 1PJ7A 2DRBA 4MIBA 3PYGA 4RW7A 3KK3A 4YOEA 5ITHA 4ENOA 3D1OA 4CTAB 1AZSA 1FEHA 2V5HG 2XEXA 4MK7A 2MJUA 3CJ8A 2DPIA 2B43A 3PTWA 3IS9A 1VJWA 1NDLA 3TZWA 5HMZA 3EZUA 1VBZA 1I94F 2GO8A 1RJJA 4DL3A 3GSDA 1SL0A 4AD6A 4HYKA 4USMA 2CZVC 5GMKa 4QWBA 1U1OA 3FKBA 4JI4J 2WB1D 3BREA 4FS1A 1IKYB 4AQYJ 4K4TA 4KHRA 1AFJA 1XMOF 2XM3A 2ZH1A 4U67Q 2RNEA 3GZ7A 2HZAA 4PYDA 3QBCA 4CZCA 1NMEB 1O0PA 2GW8A 3B54A 2MZQA 1D8ZA 2DGUA 1WC0A 2FHOB 2DTJA 4PXDA 1U26A 2HFZA 4MMOA 5IS2A 1ZAVA 5LMNJ 2AIRB 4FPIA 3ZTPA 1FDDA 3KK1B 2N4CA 2QRRA 1DQAA 3MMCB 2VHGA 4X4RA 8ATCB 4ELUA 2MQ8A 4EZ9A 5E3PA 3QJLA 3MCMA 2AGPA 1TMMA 4RUAA 3ILIA 3EGNA 3EZ5A 3H8YA 5I3PA 2HWTA 2RU9A 2XNQA 4O4GB 4RBTA 1UPPA 2X1GA 4B9MA 3ISND 1VC5A 1Y9OA 3PYFA 3D2WA 3F41A 1AA1B 3TAMA 4F4WA 1I1GA 1N32F 2WVCA 3RW7A 3HZEA 2LFVA 3TUJC 2F40A 2M4MA 5A8RB 4PPZA 1OYEA 1K0TA 2IJNA 4KGXB 2HNZA 2Z0GA 2GFFA 1R0BG 2DXFA 1OQ6A 3KHLA 1FX4A 1RSCA 4AT1B 4JBCA 4DF8A 2L3MA 4BDPA 3KNAA 1NKCA 3H5YA 4LF6F 5LJ3Y 2EBGA 1TL3A 2CNKB 1FKPB 3LA0A 2JRSA 2MZ1A 2KM8C 3T5HA 4JI0J 3MAAA 4K0KF 5ETQA 1HWUA 4HTJA 5K8NA 3OD2A 2FJDB 3PW0A 5I42A 2J9EA 2NSCA 3CTRA 2F7VA 1Y3JA 1FF2A 3VWSA 4LF5J 5GAHI 3C6UA 2IHR1 3CDEA 5HATA 1YX2A 3H4DA 1U6ZA 4TKTA 3WIUA 1PBAA 2EG2A 4RPFA 2R7OA 2IYGA 2HKEA 1RYSA 4KFBB 1U6BA 3KLVA 1REVB 3FMWA 3MI7X 1JQGA 4DU8A 4OYAA 3OUYB 5KFGA 1KEKA 1TTHB 4KPYA 1NK7A 3FEXB 3CDBA 3W9JA 3KLEB 3ENWA 2N7CA 4J37A 4X84A 1TU0B 2N4DA 4F50A 3IG1B 4USWA 4QBUA 4IG3A 1KFSA 1SIZA 4HDGA 5C24B 4GMKA 3M30B 3OQ2A 3SI8A 2HFOA 4CLUA 4N7TA 1HA1A 1S6QA 2P2CB 1VLYA 4M8LA 3HCXA 4HH1A 2LP4A 1HQUA 1U0HA 5KT6A 5CD4A 3KLIB 4YS2A 3QATA 1WEXA 2PEHA 4CTAA 1QAYA 3FFIB 4QWCA 1JJCB 2RHSB 5E3CA 1JWWA 2NXUA 4NEZA 3ENQA 5AE2A 5U47A 3LP1B 1OY6A 5KG5A 3UN5A 2B9YA 2DHGA 4NYOA 3HKZD 2MLZA 1IR2A 2X3GA 1R43A 3MWBA 4A8XA 2ZHAA 2BMBA 3FMBA 1ZM4A 2XLIA 2K2PA 3T3FA 3IC1A 4Z37A 5F8GA 2VFVA 1IKYA 2HQIA 4ZVGA 4OYWA 2PI5A 1TK8A 4C0HA 1IQTA 4IO1A 4QOTA 3MPVA 3GIJA 4EYIB 3GG0A 4I4BA 2GMLA 1WDDA 2ZJPQ 1T02A 1TL4A 4URQU 2CJKA 5DO2A 2DRAA 3MCNA 4LF2A 7AT1B 3SBMA 1SJFA 1U09A 3KK1A 3MMCA 3OTOJ 3RB4A 4LFAF 3Q0AA 1RTDB 5DM7Q 1FEEA 4ITSA 2K3KA 1YKWA 2XWXA 3TJ8A 2ZKTA 3JS9A 3RTVA 2Y0SD 4ZHRB 1NK9A 3G82B 1Q8LA 3QZ7A 4X65J 4O4GA 5BYRA 2DO0A 1QTMA 2VG5B 3ILOA 1UJ4A 4PAAA 3MAQA 2CPEA 3AB2B 2X51A 2FD2A 2MHEA 2VD3A 2QFJA 1UKUA 5E41A 3AODA 3CGIA 4A47A 4HDHA 4OZLA 1WC5A 3GCXP 3CJTA 3TVYA 3A8EA 1RBLA 5A8RA 4OHWA 2VODA 2R42A 2W25A 2B7CB 2JLFA 2VBYA 1ZBTA 2VFRA 2LXUA 2XSJB 2GIQA 5CCLA 3C46A 3EE3A 2LXIA 2UUAF 1RACB 5IV4A 2ZZMA 4GVBB 4DR6J 1FKPA 4BBYA 1HNZF 2HQCA 4Z7YA 1DLOB 1GT8A 2XTJP 1LEOA 2NUUG 3KDNA 2XB2D 2EVZA 5G0RB 1URNA 3I0RB 3TZYA 4KIAA 3UVJB 2AJ2A 2XZDB 2QMXA 3SQGB 1ZPWX 3UD5A 1S9GB 3A3OB 3MF5A 7FDRA 1U8WA 1BUXA 1NXIA 3L7PA 3I9V9 1FXRA 4KFBA 4H54A 2V0NA 1REVA 3C6TB 4C8MA 5LM7E 1LWEB 2CNOB 1PKUA 1A0OB 3OUYA 2E7WA 2HHPA 3ZZOA 1SKSA 3B8HA 4WXOA 3KLEA 4FVCA 3CNQP 3CCMS 2VG7B 3GIRA 2HQDA 1H2VZ 4RNHA 2OPPB 5L46A 3IG1A 3PKMA 3UCUP 4MH8A 4CH7A 3JAMY 5ETKA 4PWUA 2EK1A 2BKOA 3MM7B 5C24A 4C3KA 2J0WA 4LFCJ 3M30A 4NI2B 1VBKA 2OHDA 2CIMA 4NA3A 2V63A 2X1AA 1LWXA 2CNNB 1NPKA 4BWJA 2E7XA 4NX9A 4ZVRB 3MURP 4FDFA 3KLIA 3UR3C 1V6HA 3KFWX 1I3OB 1WKJA 3FFIA 2OEMA 2VPWB 4X64J 1XR5A 3B4MA 3LP1A 1FJEB 5LL6d 3AA9A 2MHNA 2LEPA 1G4CA 2DY1A 4DV2F 2F4VF 3EGZA 4KTQA 2EPIA 1VISA 2KKHA 3G8QA 1VLOA 2F63A 1QDUB 2CZ4A 2QLXA 4Q5VA 2RJZA 2ZVIA 4ZIVA 4X2BA 3MOZA 4CT9A 3SFGA 5K14B 3OTEA 2PFFB 1FNMA 1CEZA 5JMNA 2BQ3A 4ZA1A 4K7QA 3V4MA 1IBLJ 1AW0A 4WP3A 4LT6A 1NNDA 3D6HB 3W64A 3SCIE 4ECYA 4W90B 3R5GA 3B82A 1D1UA 2YKMB 1QUPA 2J8AA 1B3TA 1U47A 1QAJA 1OO0B 1ZPVA 1H7XA 1FKAF 1A7GE 5KT4A 1X4HA 2CPZA 2CJAA 4NASA 1B0VA 5C25B 2MTLA 2ZOMA 4AQYF 1VOMA 2DH9A 1RTDA 5F8IA 1URRA 3HZGA 3PW2A 1R6VA 1R89A 4V1Ak 3MEEB 2ZDOA 2DXDA 4MJKA 1R8BA 1S4FA 3G82A 4ZHRA 1HNWJ 5E0OA 1T3NA 1BD6A 5KAKA 5AXNA 4LRCA 2C2DA 2XI2A 3BDPA 1XNQJ 1SV5B 3H42A 2LXFA 3IGVA 3MPWA 2VG5A 3A4TA 2ZKUA 1OQ3A 2XY7A 4FF2A 2BVZA 2JC0A 3OTCA 1Q5YA 4R0JA 3RGIA 1EQ0A 1WHXA 3VGSA 4OX7A 3NBPB 2PFDA 1HWLA 2EW9A 2V8DA 2BRLA 1F5AA 2K3IA 3BGOP 4OFZA 2IRXA 2XSJA 4ECZA 1Y5LB 1GMVA 2C3OA 1CJTB 2C3PA 1NSAA 4JI7F 3H5XA 4QYZK 2EFOA 4GVBA 3KJQB 5A8WB 3OR2B 2R2UA 3MMBB 1DLOA 3SXLA 4DR4F 3MZIA 4ZPWR 4B9UA 5CA5A 5G0RA 2JHEA 3I0RA 4IOBA 3UVJA 1SIWB 3GFZA 2UUWA 3M8PB 4N56A 4ILMA 2QLWA 2MLXA 1GH8A 3SQGA 1S9GA 3BBCA 4JV0A 2IYIA 2IRYA 2HSEB 2E5HA 4QPXA 3C6TA 4DX6A 2XNRA 1LWEA 2ROPA 1J5EJ 1NSKL 3GV7B 1VQ5S 3Q89A 3BH6B 3BBBA 1S1WB 2R7QA 4CO1A 1HL6A 2VG7A 3MM6B 5CZXA 3VGVA 2BX6A 4LF5F 3FNNA 2NYIA 2LEAA 4YUDA 3DC2A 2OPPA 1GX6A 4YB1P 4RR5A 1CQMA 5IC4B 2FPHX 2NS1B 1UTAA 4BWMA 5GAEU 3TA2A 3MM7A 2FY1A 5IT9Y 4ZP6A 2MKCA 5DG7A 2VBWA 3BSCA 4NI2A 1NKEA 3K0JA 3NWGA 2HG4A 1N88A 5HLFB 1GK8A 4N5SA 4RU9A 3CJ3A 3KG1A 4BS2A 1HWKA 3ZTSA 4N41A 3DOLB 3BV8A 2BANB 2D41A 2UUBJ 4OI6A 1IJEB 3MD1A 3TI0A 2W2MP 4LF4F 1JXEA 3QJPA 2B9WA 1AROP 1WC1A 3LGMA 1CSJA 2H4YB 4FF4A 4GVLA 3M6XA 3DM2B 3HFVA 1HNXF 4YB6A 1LW2B 3RB3A 1VQPS 2YNIB 3OTDA 4DV1F 4X4UA 3R2DJ 3IRXB 4RZRA 2YKQA 1YG0A 4ECRA 4DQSA 3OLBA 1RWPB 2G2OA 3I31A 3TR5A 1KS2A 1DJ0A 5K14A 1HHSA 3R2CJ 4CH0S 3M9NB 2ZJQQ 3BGUA 3PJ9A 1IM4A 1PSDA 4IRKA 1ZA2B 3N6LA 1WG5A 2BKPA 2DNPA 4YHHJ 2YKMA 1UJ6A 1NH7A 4JV5F 2MQOA 3WX8A 2BOPA 2RRNA 5C25A 2KTQA 4DXLA 2DR7A 4YR2A 4PG4A 4Y2KA 1L3TA 3BKUA 4DN9A 4DS4A 4DSJA 5KFTA 1OY8A 3KMQA 3MEEA 3SSRA 4ECUA 9RUBA 3R1HA 5L9NA 3JQMA 1SV5A 2RH3A 2XMUA 2G2ZA 4NRTA 4DN0A 5D8HB 3P4UB 3FZ2A 2IY5B 4HACB 4CI0B 2QL9B 3ILLA 2WSEC 1HBUB 1VQSA 1V3RA 5FDLB 2PC6A 2XGPA 1UA1A 2RHQB 4JV2A 1K73T 4ZK7M 3OTOF 2MQQA 2B4UA 1KQKA 2AYMA 2UUTA 3NBPA 3HX9A 3T41A 4LJMA 1KLNA 2GVDB 2L9WA 3PXGa 4M95A 2BR0A 1CJTA 2G4BA 1CBKA 1ZETA 4A8MP 4NRUA 1MNEA 4F0HA 2OFGX 5A8WA 3OR2A 3OVBA 3MMBA 1SUQB 3GJSB 3M9MB 5KFVA 4CLWA 2ASJA 4U8VA 3FVYA 3M8PA 4F0KA 2DO4A 2EKYA 2Y9HA 3AXKA 4OI2A 2X1FA 2YWHA 2UXDF 1HHQA 5HVGA 1B99A 3P45B 3GJQB 5E3AA 4ZCIA 4LSNB 3JSYA 4M5JA 5C5JA 1PILA 4RW4B 4ES2A 4B9TA 1UPMB 2YWKA 1S9EB 4JP8A 4H4KA 1EHWA 5IOLA 2DRDA 2F8EX 1S1WA 3RBZA 5KFIA 5KFZA 3MM6A 1KRPA 2BJDA 1HMVB 2YBVA 4FKYA 2KRBA 1ZOTA 4PG7A 1ZM9A 1U2CA 4QR1A 1NHUA 2CJYB 1YGYA 2IJRA 4I68A 2XQCA 3PZPA 3AHPA 3PJXA 4RUHA 4DSEA 2XS5A 4IRCA 5IZHA 1DBDA 2M8DB 1VQ4S 3HVAA 2IJFA 1UVLA 4ES1A 5HANA 1TELA 1AXQA 5HLFA 5D0HA 2JOQA 4Y2MA 4MTPA 4IYQA 3DOLA 2BANA 4FPRA 1YBTA 2MKHA 1JLFB 4AE5A 4LBPA 3BPDA 3D66A 4KJIA 2BV3A 1RT7B 5HI7A 1Q8IA 2ZH2A 2CG8A 3CJ5A 3PM9A 3VAFA 3HLUA 2C2KB 2QLJB 2DHSA 3NXZA 1X5SA 2JZ5A 2RDDA 1JLCB 3CMAS 3DM2A 1MN7A 4NOHA 2OSRA 1HI1A 1LW2A 1VDHA 2VQFJ 2ALZA 2Z2ZA 2BW2A 1N34F 2YNIA 4U95A 5DETA 3VTIA 3IRXA 3NGSA 1WC6A 2FVSA 2DHAA 3MCOA 1O6XA 4WFZA 2AEMA 4LIRA 1VCTA 1T3OA 3TAPA 3K8WA 5LMUJ 1RAFB 1HYSB 2XCAA 4CQ1A 2PIIA 3UR0A 4ZP9A 1X9MA 3ZNUA 3BS9A 4OX6A 4C97A 3G9CA 1RQ0A 3D0IE 4DV5J 4KC5A 4K4UA 3RRGA 2RDJA 4RJVA 1SH0A 3DLKB 1M5HA 4DR3J 2BZ2A 4YB7A 2E5LJ 2LYVA 3LUYA 2N82B 3QT7A 1VJQA 4IQXA 4PQUB 1AFIA 5ETPA 2YKPA 1D8YA 1UJ5A 3D1HA 3VVUA 1BC6A 3GP9A 4L73A 1IN0A 2W4DA 4HACA 2GMJA 3N6NA 5D78A 2WVFA 1HBUA 1JB0C 5FDLA 2XZTB 2RQMA 3IA0A 1NH8A 4JI8F 3D5MA 4D3GA 2ZZTA 4LF1A 2GVDA 4C98A 1VQYA 2JWNA 3TP2A 3PKYA 1NSPA 2O66A 4WYWA 1XNQF 2GX8A 2HHSA 1SKRA 4F3QA 1S48A 1SUQA 1OMSA 5DGAA 4MIAA 2XMMA 3QWUA 3HXMA 3T9ZA 3FBEA 4OI3A 1NDKA 2HQ3A 1HWJA 4EK2A 5GVQA 4YQWA 4OMFG 2UZAA 3N79A 4ANDA 1KN6A 3ZZ0A 1U8SA 3I87A 5KT2A 4J9QA 4ZCMA 1SQFA 4TQSA 1WJ9A 3HSGA 4FXWA 3I0SB 2VU5A 3HO1A 2R7XA 1R8CA 3IBWA 4LSNA 2P8IA 2KVIA 2KRRA 4ELTA 4RW4A 4OLPA 2PA8D 4IFYB 3RG6A 1HLWA 3UW1A 1S9EA 4GO5X 2PMZD 2KB2A 3CF5Q 3GYGA 1CPZA 5CH7B 2VL1A 2CAJA 5FJ4A 4OI4A 3EICA 2CQIA 4KO0B 1VRQC 1HMVA 2BABA 4A8OA 3LAKA 4F0MA 3HSDA 4NLRA 1FRIA 4CO4A 1S4EA 2VDIA 4PG6A 4R25A 5DZ7A 4EMDA 3W63A 3KHRA 3IMQJ 1ZM2A 3US5A 3C3LA 4WKRA 4CO0A 4BC7A 2HHTA 3BF4A 2UXBF 2W2QP 1FI4A 1VQKS 2EWHA 1VBXA 3H0PA 1JLFA 1DURA 2J6SA 4IOAQ 1YJ7A 3QT6A 4CLFA 2D9OA 1RT7A 2UVRA 3MR7A 2DITA 1U45A 1O8BA 1TZ0A 4C9DA 2J5AA 5M2UA 2UXCF 2FTRA 2F8HA 3D54A 1T9VA 3VZHA 1JLCA 4G1IA 4K8RA 4N76A 4LMZA 1Q4RA 1UEKA 3OTBA 5BYSA 3AOAA 2POKA 1RT4B 1OSCA 3HT3A 4ED2A 1VR6A 2HHHF 3SCKE 3FJ2A 2JJ4D 4KR0B 1FD8A 3TX0A 4KHPJ 3EYZA 5KG1A 4DCJB 3K7RA 2ZM6J 1NJWA 1EIYB 4P7TA 3MUVP 3J7ZT 3OVSA 5KFJA 1HYSA 1T9XA 2ZEJA 2OUGA 3M8ZA 1NPPA 2OMOA 3GTYX 4LF9J 2OGUA 5I4MA 1GMUA 1YZ6A 2RQKA 3NGDA 2F3JA 2FJAB 3NKYA 3MR3A 2CPDA 3U27A 1N48A 3W61A 5JVHQ 2W01A 1ZAXA 2VASA 5DDOC 2QEXS 3P5BP 3DLKA 1D09B 2ZNYA 3CPWR 4DPWA 2VPXB 3OW2R 4C8LA 2B8QA 1L5UA 1NJZA 4EGLA 1NO8A 3NWRA 4PQUA 2BE9B 2GAGC 2MZSA 3W65A 5D4NA 4HT7A 1DFDA 1S77D 5HJYA 3TA0A 4KH0B 5DS7A 3FEYB 4JI6F 1EAYC 2F1FA 1X4BA 1HARA 2Q1LA 3TANA 3W3SA 5KT3A 4U6PA 3DGPB 2BJ7A 2LECA 3GQCA 1WKKA 2VQEJ 5LT5A 1R8PA 3G87A 2KH9A 2FJWA 3RJMB 4KH1B 5A76A 3JYTB 3HHLC 2ACMA 5HROB 3UN3A 1XK8A 2B4PA 2BXJA 3T1HJ 4MKYA 1P8GA 2VF3A 2HLTA 1PBUA 1BE4A 5DQIA 4W4MA 1W25A 2FGOA 2BW7A 3KG0A 2OPQA 3PIPQ 1D9AA 1S97A 2EKNA 4FKXA 2FZCB 2EFNA 3L4BC 3ET6B 2HZVA 3MPDA 4OZJA 3EJMA 5SUHA 3I0SA 5B7WA 1NZAA 1S0MA 1N4LA 1LXNA 3FCHA 4ZP7A 4NXMJ 1GXUA 4HHUA 3TRGA 3R5AA 4IFYA 2MPUA 4K2JA 4Y00A 3OVAA 4PG8A 2A2DA 4C8KA 1RAGB 4OZ5A 4GO7X 4ZCLA 4CCHA 3WZ0A 4KO0A 4Y6IA 2I38A 4Z7CA 1LWCB 4I69A 4NCBA 1IBKJ 3AH6A 1CVJA 4YY3F 2VDHA 4C8ZA 2LQBA 3JB9k 4UQGA 1M1GA 4P10A 2DGXA 2D7SA 2HNDB 1F9FA 4OHZA 4NLVA 4C8OA 4DR2F 4WZMA 2XWYA 3JAMU 4HH0A 1LFPA 2B5JB 1NUEA 2ZOFA 4ZVHA 4NZ7A 2C3MA 2XMVA 3BN7A 1RB0A 2CQ0A 1XJWB 3TW0A 4FN5A 4ZVTB 3SCJE 2PGCA 4OX9J 3A1YG 1RT4A 3SCLE 2CPYA 3G8TA 1UP1A 5HVHA 3BPSP 1FNXH 2IM0A 4NXNF 4QIEA 4FYXB 2HFNA 3HVTB 2DGQA 4UZBA 2PDAA 3RR7A 1PCAA 2K8GA 4OIXA 5EWEA 1MROB 1CLFA 4A46A 3A12A 4CLKA 4OV6A 3R27A 3OHBA 3CCVS 4G1PA 2H3EB 4WU2A 2CPJA 2WTFA 2Z57B 2ZC3A 1OWXA 2HS3A 4DPXA 2LU1A 1KR4A 3T1AA 3AFGA 3R6GB 2HEKA 1UEUA 1ZM3A 1T9UA 4JI5F 4WFXA 1XN9A 3TYTA 2CQ1A 4FNIA 4IKAA 4MK9A 1B0TA 4DHVA 1U0SA 1WORA 4M5NA 4YFUA 4WP8A 3MM5B 2X7IA 2AJFE 1HBMB 3T1YJ 5L9XA 3D1QA 3BO4A 1RAJA 1UZDA 4C6AA 2KXNB 4UY8T 1MWYA 2ZC4A 3HVRA 4DR1F 4QIWD 2D3UA 2JC1A 2C42A 1DTQB 5CYQB 1V5IB 3CJKB 3G96A 3H90A 5KFFA 1Q82T 3MR6A 4DR3F 3NEKA 2AZ1A 1VHIA 3SQOP 1PAUB 4NMLA 3TO8A 5HQMA 3E2EA 3ISNC 3N5FA 3H5SA 3DGPA 1GFWB 2M52A 4WFBQ 3RB0A 1X5PA 2ERRA 2M2BA 2MSTA 4DV3J 3TQEA 3OJUA 1Q81T 3JYTA 2CQGA 3R5CA 2IBOA 2IPOB 5HROA 4IG0B 4WFYA 4QIFA 4B3TJ 5I3QA 3M8SA 5C42B 1YBAA 2MSSA 4X62F 3AB4B 2UVUA 1MMNA 1M5OC 5J2NB 2CQHA 4A8SA 2CJQA 1WD6A 2BUNA 3HK2A 2OJ3A 3TAQA 3Q23A 4CT8A 3MEDB 4V19J 4EYHB 4HHHA 4ALZA 2EBEA 3ET6A 4IR9A 5K8MA 1E6VB 1RTIB 5THWA 2BDPA 2QYCA 3MFIA 4DX8H 2NYHA 3DXBA 1U1NA 3MD3A 2JEJA 4M1KA 1AUDA 2W1BA 4XO0A 4NCGB 3CIZA 1KHWA 2CDRB 4J9PA 1S1XB 2PT0A 1LWCA 4K2XA 3DLBA 3KUHA 1K8AT 3MFHA 2RSQA 2FJEB 3CD6S 4R8UB 1L3VA 2JH3A 4L74A 4O3PA 1YQHA 2MLYA 3CC2S 3GMGA 1X31C 2IC3B 2XHCA 4Y65A 4U7UD 4EO8A 4B3RJ 2HNDA 4B3OB 4XAKA 3UPFA 1X8DA 3N01A 3SV4A 3MGJA 4C4WA 4DUYJ 2M0GB 4OJGA 4TQRA 4B3MF 2B5JA 1H98A 5BR8F 5IT9U 4C8YA 5F9LA 3CDUA 3I5AA 4KGZB 4GKJF 3MUTP 5KT7A 1XMQF 1LQ9A 4DFKA 2OH2A 4X4NA 5F8JA 9ATCB 2W9AA 2PI4A 3NGTA 4K4SA 3LAMA 3EVWA 4RWXA 4ZOSA 2OEKA 3PX6A 2B4OA 1LK7A 4DUZF 5KFSA 4XTTA 1WHWA 1H2TZ 3LOUA 4OJHA 2ZH5A 1KKHA 4RKUC 1YDLA 4DFMA 2B9XA 3HVTA 2MGZB 3DI6B 2OD4A 2JX2A 4TU9A 4DV7F 1U1RA 3QFWA 2QT7A 4IRDA 2ILZA 3OFFA 2J7UA 3Q8SB 5F0WA 1MROA 3V6DB 4KQZA 4OX8A 4UOFA 2N7YA 4LR8A 2XMWA 4OYOA 2COLA 3FBCA 4QYZJ 2R7UA 2QIFA 1LK5A 1H2UX 3J7A1 1SJ1A 3DFEA 4WTYA 2IIHA 4F2SA 2BQRA 4KV8B 2ZUGA 3M1VB 3OXLA 1X4DA 1ICEB 3DCAA 3AA8A 2QMWA 3MM5A 1BQXA 1YJVA 5HQ8A 1HBMA 1TK5A 5DQGA 3PG9A 2RDIA 5ETTA 2P9EA 3ELHA 3FRZA 1DTQA 5CYQA 3CJKA 1SH2A 4QPTA 1KVIA 4KSEB 4W92B 5SZTA 2WB4A 4ANEA 1VQ6S 2OD6A 1TKTB 1HW8A 1TVRB 4OJ3A 2XGQA 4TY8B 1IM6A 3N5BA 4JI1J 4O3OA 3F56A 4CNYA 4LRFA 1ZZNA 1WKLA 3E51A 4IG0A 5EGYA 2CNLB 1DZ5A 5C42A 5BYQA 5GMDA 2EXUA 1KD1T 3CO0P 4P2XA 5J2NA 5G4DA 4HI1A 3GYXB 2YQ3A 1UW4A 5FIIA 4C48A 2Y3YA 3MEDA 4J9MA 4PXBA 4B9LA 4F02A 1TK0A 2E7VA 5L1IA 2LU2A 4ED8A 1E6VA 1RTIA 5JVGQ 2WOMB 1B4SA 1LFWA 2DNNA 1VS3A 2HVIA 3UE2A 3T1HF 2ALYB 1GQEA 3R6LB 1KOOA 2AYEA 4NCGA 1VFJA 2CRLA 5K20B 1S1XA 2ZE2B 2AD9A 4DSFA 3OSNA 1JNZB 3K5NA 4CRJA 4ZKAA 4DR5F 4USUA 3EVMA 4R8UA 4WYLA 3D9BA 4I6AA 2QV6A 3QMQA 3W5ZA 2IC3A 2MY7A 2FLPA 4B3OA 3BQ1A 2DR6A 3MR2A 3J81j 2ZJRQ 3IWNC 4QQBA 1F2HA 1XR7A 2CQ2A 3CB4A 3RAQA 4RBVA 2XMJA 2NPFA 4KY3A 2D3ZA 1GMWD 2EFQA 2K1RB 3HSJA 2LCWA 5ETRA 4I67A 1AYEA 3RRKA 1Y00A 1F0XA 3SZ2A 4AFFA 4ETZA 2MKIA 1N33F 3CD7A 4URSA 3WQPA 3MXHP 3K59A 3PRVA 2MGZA 2NREA 2V8GA 3DI6A 1C4CA 5KFRA 1TFYA 3IXQA 2J9CA 3FRYA 1QSLA 3ISZA 2OPSB 4HKQA 1TMJA 2HRUA 1N5TA 4DL2A 2MQPA 3MEGB 5CABA 1JXLA 3V6DA 2ZH4A 2QL7B 3K57A 1QSSA 3LP0B 2MQMA 2HIQA 4NA2A 4OX9F 1R27B 2I1RA 2BE7D 4ATNA 2VA3A 4DBQA 3MM9B 4EO6A 1NEEA 4GKKJ 1GXLA 4RNNA 2ZNZA 2RS8A 4DU7A 4FNHA 3MMAB 4KV8A 2E9TA 3M1VA 1UL3A 1WHYA 3THTA 1HR0J 2FC9A 1XBWA 1U1MA 1H6KX 4R5PB 4JI3F 3JTOA 1ROFA 2L41A 1RWNB 4ZP8A 2CVEA 1RBOB 1M1HA 4IFVB 1FDBA 2V67A 2H5IB 2BJ1A 4ZPVR 4PR6A 4Q44A 3H59A 4IO9Q 3LALA 1FVSA 2G0JA 1X0PA 1FTCA 1KHVA 5D0EA 3PHEA 1B7YB 1FESA 2FJBB 4CLSA 5EDWA 1GMWA 1RAHB 1TKTA 1TVRA 4TY8A 1I51B 2E29A 2FVQA 5KFCA 4WP9A 1ULRA 1FFSB 2ZWPA 4ZN3A 3WIVA 2IDEA 4ZLNA 1WSRA 1WEYA 3KWMA 4ZLPA 1C2PA 2MEWA 4G65A 5B08A 1G2EA 2XYHB 3V6KA 4RW9B 2RS2A 1KONA 5GAEI 3R5JB 4PPDA 1U24A 1SJQA 1NK5A 2SXLA 2FGCA 3CJQA 3AQOA 2BRKA 3K5PA 4NLOA 2BJEA 1NJXA 4RNMA 4IH6A 4LSLB 4CIOA 2WOMA 4B3TF 2U2FA 4X66F 3UWTA 3LO3A 4MYUA 4PZVA 2YX4A 2ZE2A 1F9EB 1YHQS 4RUBA 4WFNQ 1NAQA 1JXVA 3CJ2A 2H48B 3OHAA 5MAOA 5ETLA 4U7UK 2MJNA 4Y0FA 3BGRB 4M5GA 3RBDA 1RCXB 1SC6A 2F5GA 1JLEB 1MW7A 1FJGJ 3BO2A 3PY8A 3P6YC 3VF0B 3U1LA 2KVQE 2YX7A 4OHYA 5DJBA 3PACA 3THPA 4AL5A 2C2NA 2WVEA 1N0VC 5A2QY 2K1RA 2ATCB 4H4MB 3OFHA 4L6V3 2LDIA 4OLOA 4MIWA 3PRDA 4B3RF 4JI2J 4LF7J 2AYGA 5K5MA 2WAQD 3K58A 4C7QA 1KC8T 1M5SA 2NXNA 2NPIA 3FQLA 2M70A 2GHVC 2UUCJ 2VICA 2AU0A 2VKZG 3TZZA 1EX8A 2OPSA 1YWXA 3NMAA 2R8KA 1GX5A 1CC8A 3CMQA 1RTZA 2XC9A 3MEGA 4K4YA 2DGTA 4ZPAA 1MSWD 4X4SA 1QSYA 3JSMB 3I5BA 5KFUA 4HR2A 4B3SF 3LP0A 2DNMA 2H65B 1X7VA 2XSFA 4P71A 5L39A 4K5SA 1NSQA 3MM9A 5DG9A 3RW6A 1VQ8S 1Z2ZA 2H54B 1FRXA 1YJUA 1NDCA 1Q7YT 4KE5A 2R2TA 1RWXB 1S0NA 3AQPA 3MMAA 2HHQA 5I3UB 1RLDA 1VHFA 3V81B 1ITPA 2VH7A 4R5PA 2A6MA 3R5BA 5GADU 3FCVA 4NE9C 2Z2MA 1Y5NB 4IFVA 5J2QB 3FSIA 4H4KC 4J9RA 1RAEB 1S10A 4ZVFA 3L09A 2D1CA 2H9ZA 2Y1LB 3PNIA 3KLGB 1MU2B 1F1BB 4E8UA 4F4AA 1YVFA 2Y1JA 3D68A 2O67A 3F73A 2JVRA 2QE5A 3A13A 4A8WA 3KYLA 3QNWB 4LSZB 1N5VA 5A6PA 2KJVA 6FD1A 5HAOA 6AT1B 5A8KB 3N6MA 3H7HB 2HQGA 1YRTA 4DPUA 2VG6B 5AJ3F 4UOGA 4GC6A 2QA4S 1GEHA 2XCPA 2AYBA 2UU9F 4OYXA 5J2PB 2CWKA 4RW9A 3MEKA 3L7UA 2AV5A 4NEYA 4M5IA 1L3UA 2YQ1A 1TAQA 3IR7B 1RYRA 5DLGA 3BKTA 5DGBA 4NYZA 4K5RA 4JOUA 3IR5B 4LSLA 4PXCA 3AT1B 5H9EK 2A0FB 4DPYA 1QE1B 2E9ZA 3NS5A 2MY8A 3M32B 2I0XA 3W8PA 1YTYA 3QFHA 6FDRA 3G8SA 2FB0A 2RRAA 5KFEA 2V68A 4XK8C 2W7OA 3HI9A 1P6TA 3KG4A 1ZYQA 1T9TA 1JLAB 1S99A 2XBPA 3BGRA 3PX0A 4LVOP 2WRMA 2VONA 5DG8A 4J91A 3Q8YA 5E5NA 5LXRA 3Q2SC 4TVAB 4WBFA 1JLEA 4BLGA 1MMDA 5LXYA 3KDOA 3DYAB 2I2YA 1ZAWA 1VK3A 2M8HA 3M2RB 4DV4J 3V5RA 1FXDA 3VR1A 1O5JA 3LWLA 1IBMJ 3UI3A 2V4QA 4V19X 2IA0A 4H4MA 3PW7A 2QGFB 5RUBA 4K50A 4I2QB 2MB0B 2Z30B 4YDDB 8RUCA 1UVIA 2OTLS 4LR9A 4I0WA 4AUKA 3FDSA 4DR7F 1RXOB 1R0CB 1I94J 3DRSB 2KJWA 3RBXA 2N3LA 2GAHC 2CPHA 2G0CA 4CLZA 1TL5A 1HWIA 1C1CB 4DOZA 3KUGA 3MTJA 4ZITA 1GAOA 1FD2A 4RO0A 1YJRA 3NG8A 3JSMA 3UCGA 8AT1B 2VFSA 5L1JA 3HPOA 4DFPA 3T5JA 1TR0A 1HBNB 1TL1B 1XMOJ 2FDNA 4NLQA 4OHXA 1X5TA 3EXYA 3Q22A 3PHTA 1YBUA 2XS7A 2AWZA 3Q2TC 2XO6A 3GV5B 4DQQA 1PGZA 4LRBA 3PO5A 5KG3A 3IM8A 5I3UA 1UAWA 2GA7A 3V81A 4E98A 4K4ZA 4CLPA 2D9PA 2RUGA 4YN3B 5J2QA 1EKRA 3IP0A 2QC3A 3LH2S 4RL1A 3BKFA 1ZA1B 2Z4PA 1MU2A 3KLGA 3I55S 1F5BA 3BN4A 1ACMB 2ZH7A 4OYIA 3LP2B 1RABB 4O4RA 4Q43A 1M5VC 4CM0A 5IWAF 1SB6A 1CJUB 1HR0F 4Y34A 5IM0B 1RHJB 1H38A 2RT3A 2DR5A 1N32J 5A8KA 1UMJA 3BQ0A 1KBRA 2HFSA 2VG6A 1RA7A 1JMTA 4OYMA 1XMBA 2FQQB 1FT8A 5KG6A 1N0UA 3HF5A 4P74A 5CHCB 5J2PA 4X4QA 2E1RA 3GFHA 2JLGA 3DMJB 3FBFA 4U96A 4KKOB 3ZXWA 5EWGA 4LF6J 1HNVB 4DMZA 2R4FA 4LF8F 1NKBA 2J0QD 1H72C 3RYLA 4WCEQ 2L9NA 2OFHX 2VPYB 1K47A 3TARA 3B4DA 4K0KJ 1QD1A 4MAKA 3SYZA 3DRPA 1SKWA 2CQ3A 3CO9A 3ZZZA 2HK3A 3IO1A 1QE1A 2APOA 2X1BA 3M32A 2L9DA 5JUMA 1QAXA 4YEAA 1NM2A 2GGPB 2WVBA 4ZVSB 4XDDA 1BLUA 2FC8A 2VV5A 2JSXA 2JEIA 3BYRA 4KRWA 4OYPA 2BEFA 5CYMB 1H74A 5KFXA 5T41A 5KFHA 3DU6A 5KT5A 1EB0A 4PUOB 1XQIA 2GIFA 1JLAA 3JSBA 4OQJA 5F8LA 2VPZB 3PJWA 5LOQA 1SCJB 3MAHA 5D4LA 5AXMA 1QM9A 3DYAA 5DDRC 3M2RA 5E33A 2MMYA 2WW4A 1UWAA 1RKIA 1IVZA 4OHVA 3UD3P 5E7OB 1NRKA 4USHA 3LWMA 3ZFVA 3VAMA 4JI4F 3VAIA 2C22A 2GJIA 2FJXA 2V9KA 4I2QA 3VHQA 2GJFA 2E5GA 3T9NA 4NLGA 1JJ2R 3DRSA 3GONA 3J7Z5 4J9LA 1XERA 3WX4A 1C1CA 1Y3KA 1NLKL 3GSIA 5IQ6A 2DGWA 2W9CB 3MCSA 3QIPB 1TL7B 5LMNF 1VIOA 2OO4A 4Y28C 5F8HA 3CC4S 4WU3A 4JI2F 1DY3A 4LF7F 1HBNA 1TL1A 5GAGU 4ZVEA 3CSKA 3T19A 2DNRA 5CQGA 4XPEA 2V4JB 2XLKA 2PEBA 4F36A 1R0AB 3EUNA 2MKYA 2DYAA 2V34A 2HAFA 1U48A 2OKQA 2HHVA 3O5TB 3C15B 3I4HX 3G6XA 2PO4A 3HHEA 2JFDA 4LFAJ 1NJIT 3QRRA 5HO4A 3IWLA 4DX5A 1DQ9A 2B4VA 2EG1A 1Y5IB 1NK6A 4LVNP 2P6SA 3PW4A 3TVKA 4HI2A 3LP2A 1S1UB 2OI2A 1IUJA 4EU0A 5L8RC 3QT8A 1CJUA 4CO3A 4LBIA 2DVIA 4HVZA 2HFUA 4FYDA 1BY9A 5IM0A 4JI0F 3OXFA 2J9DE 4F8RA 3ZZUA 2UV8A 1R31A 4QU6A 2NXCA 2BM1A 1RHKB 3KLFB 3ILJA 2E9RX 1U25A 2ZFHA 2HNYB 1RT2B 3TEHB 2WK4A 3HVWA 1RT5B 4C8NA 1H0HB 3DMJA 1K44A 2PSZA 2CADA 2UUAJ 4KKOA 1HNVA 3BM7A 1QUVA 4HEA9 3NS6A 2HWIA 1HNZJ 2CQPA 2E66A 3NAIA 3OXGA 2A10A 2ROEA 3UQSA 2YWEA 2Z2YB 1T11A 4ED6A 3CUNA 2Z2LA 2AHOB 3V6HA 1RU2A 3TA1A 3K5OA 3QIDA 5F41A 3MHYA 2ADBA 4OI1A 1VK8A 1CC7A 2BACA 2GGPA 4RLEA 1Y0HA 1YJNS 3ONQA 1R8AA 2G13A 5IXUA 2YWWA 4X4VA 4JYAJ 5HMYA 1C0UB 4NL5A 5CYMA 2DJWA 4PWDB 4MKVA 2L08A 3EWGA 4PUOA 3CDWA 3HSZA 1VIXA 5FD1A 2FVCA 2WBMA 1V3ZA 3FEZA 1F2GA 1RLCL 2GVZB 4ETXA 1FERA 3W5YA 3J80Y 3K5MA 3B6BA 2DNYA 2CZ9A 3VV2B 4J90A 4UUWA 2YH1A 4OV1A 3FSXA 3WBZA 1UFLA 4QYRA 1M1KT 3N9UC 3L3CA 4LREA 4RBUA 1TUWA 2QLBB 4J7CA 2ZBIA 2X3DA 1UVJA 3MOJB 2QN6B 2DT9A 4PYAA 3OFEA 4PCQA 2DKOB 1YLXA 1U7LA 1C4AA 4DV4F 2AJ0A 4ZVUB 5IQQA 4UTGA 1IBMF 4UOCA 1KTQA 1YIJS 2OEJA 5CCMA 2A1BA 4DV2J 2KHDA 2CYYA 2F4VJ 3OL6A 5IV3A 4EBDA 5F0UA 5D3GB 3ZNJ1 3IBFB 2W9CA 1J5OB 3QIPA 2BQUA 1TL7A 2YNHB 3G6VA 1BWVA 3JSRA 3CCSS 3PR5B 3R7SB 5HN0A 3GFXA 3ZZTA 1RHRB 4ZIWA 3CJSA 2WHOA 1TKDA 4CLYA 2M9KA 2V4JA 2W7PA 1R0AA 1JNRB 4X65F 4ED0A 2AMCB 3GILA 3W62A 3DRRB 3BDEA 3IRWP 4RW6B 3C15A 1G3OA 3SDEB 5J1NA 1NK8A 4UY85 2XZWA 3CMES 3I96A 1TFWA 1M5KC 3UDLA 2NUHA 2RVJA 3C66A 4ILLA 3Q8QB 2KYZA 2O01C 1RZMA 2C1EB 3GLJA 3R7NB 1CJKB 1LWFB 3AJ1A 2QO3A 1S1UA 1XTZA 2IRUA 3CCES 3R9LA 4EEYA 3EZOA 5HBMB 2HS4A 1JK9B 1MWQA 4EI2A 4DR6F 3IWXA 5H1SV 5KFLA 4F4ZA 4TNOA 4OJ1A 4C0BA 4K4XA 3F44A 4F4YA 2R7RA 5FLXY 3CW2C 3EDQB 5KFNA 3I9ZA 1VI7A 3OSPA 3KLFA 2HNYA 2ZBCA 1RT2A 2Z58B 4WIQA 4ER8A 5KFOA 1JX4A 3TUPA 3GPAA 2IM3A 4YB5A 1IWAA 1RT5A 4TY9A 4F3OA 1RU1A 2W8LA 1SJRA 3WDOA 4DL6A 3M2VB 5M2PA 1A6LA 1WF2A 4U7CA 4JI7J 3D3CJ 4F04B 1D9FA 5HQLA 4DR4J 1KLMB 2HFVA 2DHXA 2DIUA 4EWTA 1WF0A 3BZQA 1FRMA 4IOCQ 2V8HA 2GIRA 3M8WA 4KGMA 2BM0A 2YKNB 2XS2A 3J7AN 1NHVA 1C0TB 2DR8A 3CCWA 2D74B 3HHKA 3S6EA 3QGPA 5KOWA 3D6MB 2OPRB 3MPUB 1U4BA 4HTIA 3W2VB 3BYPA 5C2GA 1HI0P 4LFCF 2GQQA 1LW0B 2FZKB 2Y0BB 1C0UA 2LMIA 2HZCA 4PWWA 4PWDA 5ETVA 4QJVA 4Q8EA 2KZZA 2CQDA 3PFOA 2AX1A 4KHMA 3ETOA 2GNKA 2HBYB 1UETA 2LQ8A 5HVFA 4RNFA 2IFXA 2IMOA 3VCDA 4AXJA 2EI5A 2GVZA 1NHKL 1SJ3P 1N54B 4UW2A 2YVSA 4X64F 4ED5A 3U1NA 3H25A 4H4OB 4USKA 2YPYA 1RWUA 1JJ4A 3D7SB 1F3VA 4TYBA 1WF1A 4WK1A 4Y2CA 2BKNA 4DWIA 2QG9B 1P9QC 4AL7A 1RWMB 4LF4J 2GV1A 3EVOA 2DR9A 1Q79A 2G9OA 2EFPA 3KHGA 4Q0BB 3BBFA 5A2QU 4RNOA 3UO0A 4FBUA 1V5VA 3R5DA 1I5OB 2ILYA 4UOHA 1HNXJ 2XLJA 3FK4A 1IBLF 1S0OA 4DV1J 2VC1A 5D3GA 4TYAA 2YH0A 1J5OA 2EC2A 2VKRA 1HI8A 2YNHA 3TJAA 5HP1B 3TWZA 2Y8WA 4HLBA 5AT1B 2E1AA 1FK9B 1N5SA 1PJ5A 4LIWA 4LQ3A 1UWBB 4WWSA 4FYVB 3BSOA 3V4IB 2A2CA 2HWHA 1HNWF 2AGOA 5L38A 2DNGA 3J7YU 4PEOA 2OSQA 1MN9A 2DISA 2YKOA 3DRRA 4DLGA 4JV5J 4Y2AA 1UFKA 4RW6A 3HFZB 3SDEA 2RE1A 2R7SA 1BQMB 4DLEA 2GS8A 3R3TA 5B0FA 1FVQA 1FRKA 7FD1A 2OPQB 4ZPDA 5HSPA 4TLRA 3H4BA 1HIYA 4F4KA 1IKXB 1CG2A 3HDSA 2DGOA 5JJBA 1CJKA 1LWFA 1SQGA 4L75A 2WCXA 5D6GA 3UDVA 5HBMA 1VQ9S 2J76E 3J81Y 2V9WA 3W60A 2GHPA 3KXDA 3QSIA 2HPUA 1K1SA 1X4CA 1R8HA 5IT0A 4DUTA 2XMAA 1CS4B 2KT2A 3G71S 3HD1A 2J9DA 5H9FJ 3QT5A 4CLLA 1N5YB 4NZ6A 4C3LA 2MZJA 2CA9A 1RHMB 3M2VA 3QPIA 2NZ4A 2OLWA 2C2ZB 1J5EF 3MR5A 1T7PA 1KLMA 1U02A 1X4GA 1FRLA 1J2VA 1RHQB 2ZBRA 3A8IA 1H7WA 2YKNA 4L3NA 4DL7A 2ASYA 1C0TA 2OP5A 2KO1A 3PV8A 2W8KA 3TNVA 4DSKA 2JEGA
chains in the Genus database with same CATH topology
3GJSB 1I51B 3QNWB 4DCOB 2H48B 4ZVUB 4LSZB 4ZVQB 2XYPB 1RHUB 3KJNB 2QL5B 1RHJB 2CNLB 2QL7B 2Y0BB 2XZDB 1I3OB 2H51B 4DCPB 3NS7B 2XYHB 3R6GB 3GJRB 2H65B 3IBFB 2HBQB 2H4WB 1RHKB 3EDQB 3GJTB 3KJFB 2H54B 2FQQB 1RWKB 2CNOB 2H4YB 2C2KB 1RWWB 2QLJB 2HBYB 1BMQB 1RWOB 3R7SB 2HBRB 3P45B 3GJQB 2H5JB 1RWXB 3R5JB 1ICEB 1SC3B 3IBCB 1RE1B 1RHRB 3P4UB 2QL9B 2CJXB 1QDUB 1RHMB 4ZVOB 4ZVTB 1RWNB 5IC6B 1IBCB 2C2OB 3EDRB 1RWVB 2XZTB 1RWPB 2C2ZB 2H5IB 4JB8B 2QLFB 1SC1B 2HBZB 3D6FB 3SIPB 1SC4B 1QTNB 3R6LB 5IC4B 2QLBB 2CDRB 1NMEB 2CNKB 2CJYB 1RWMB 2C2MB 2Y1LB 1PYOB 4DCJB 5K20B 2P2CB 1RHQB 1PAUB 3RJMB 1F9EB 3D6HB 3KJQB 1GFWB 2CNNB 4ZVPB 4ZVSB 2DKOB 3D6MB 4ZVRB 2C1EB 2XYGB 3R7NB 3R7BB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GJS B;  1I51 B;  3QNW B;  4DCO B;  2H48 B;  4ZVU B;  4LSZ B;  4ZVQ B;  2XYP B;  1RHU B;  3KJN B;  2QL5 B;  1RHJ B;  2CNL B;  2QL7 B;  2Y0B B;  2XZD B;  1I3O B;  2H51 B;  4DCP B;  3NS7 B;  2XYH B;  3R6G B;  3GJR B;  2H65 B;  3IBF B;  2HBQ B;  2H4W B;  1RHK B;  3EDQ B;  3GJT B;  3KJF B;  2H54 B;  2FQQ B;  1RWK B;  2CNO B;  2H4Y B;  2C2K B;  1RWW B;  2QLJ B;  2HBY B;  1BMQ B;  1RWO B;  3R7S B;  2HBR B;  3P45 B;  3GJQ B;  2H5J B;  1RWX B;  3R5J B;  1ICE B;  1SC3 B;  3IBC B;  1RE1 B;  1RHR B;  3P4U B;  2QL9 B;  2CJX B;  1QDU B;  1RHM B;  4ZVO B;  4ZVT B;  1RWN B;  5IC6 B;  1IBC B;  2C2O B;  3EDR B;  1RWV B;  2XZT B;  1RWP B;  2C2Z B;  2H5I B;  4JB8 B;  2QLF B;  1SC1 B;  2HBZ B;  3D6F B;  3SIP B;  1SC4 B;  1QTN B;  3R6L B;  5IC4 B;  2QLB B;  2CDR B;  1NME B;  2CNK B;  2CJY B;  1RWM B;  2C2M B;  2Y1L B;  1PYO B;  4DCJ B;  5K20 B;  2P2C B;  1RHQ B;  1PAU B;  3RJM B;  1F9E B;  3D6H B;  3KJQ B;  1GFW B;  2CNN B;  4ZVP B;  4ZVS B;  2DKO B;  3D6M B;  4ZVR B;  2C1E B;  2XYG B;  3R7N B;  3R7B B; 
#chains in the Genus database with same CATH topology
 2OPR A;  2V2Z A;  2UXD J;  1FRH A;  4USI A;  2M3D A;  3W2V A;  2LDY A;  1WHV A;  1YJ9 S;  3RUB L;  1LW0 A;  1U1P A;  3HJV A;  3HHN B;  3BR9 A;  2DH8 A;  3U02 A;  2PMH A;  3B78 A;  1RWK B;  3UD4 P;  1F60 B;  2I8E A;  2QJ3 A;  2UUB F;  2W4P A;  3O6Q A;  2OIH A;  1U1L A;  1QLN A;  2AKW B;  1PC5 A;  4P73 A;  2W2P P;  4CH1 A;  1N8R T;  2ZBQ A;  3FZB A;  4EUV A;  2LLZ A;  2RML A;  4MKB A;  2FJV A;  2AGQ A;  4H4O A;  1KTV A;  4JYA F;  4WJB A;  3OJS A;  2QA1 A;  4A8Q A;  2DD8 S;  3CIM A;  2DNO A;  3BEG B;  2KYX A;  3BSN A;  3G6Y A;  3PO4 A;  1IKW B;  4QR2 A;  1RTJ B;  2MKS A;  1BQN B;  3GG1 A;  3Q8U A;  5IT4 A;  2XY6 A;  2FHJ D;  2RAQ A;  2AJQ A;  5F3T A;  4Q0B A;  4ED7 A;  3FC9 A;  3NMR A;  3KJV B;  2C3U A;  1FHT A;  4DI6 A;  3FUY A;  2BA9 A;  3X3U A;  3BSA A;  2GQC A;  1WOP A;  2H51 B;  1U6F A;  1IWG A;  5KFY A;  5KG2 A;  1N34 J;  2W9B B;  2DIV A;  1A9N B;  3WC2 A;  3QGG A;  2ZIT A;  1P9Y A;  5B0E A;  4F3M A;  3QRP A;  4YHH F;  2GC8 A;  5KG0 A;  2O1P A;  2CG4 A;  5B0G A;  2HRT A;  3E3X A;  1YIT S;  1DRZ A;  5HP1 A;  2AQ4 A;  5KG7 A;  5ETO A;  3N4W A;  4OZ3 A;  2AZ3 A;  2RF2 B;  1FK9 A;  3EPI A;  1UWB A;  3BH7 B;  1S5Z A;  2IVM A;  3V4I A;  4ZJQ A;  3MDF A;  2JLE A;  3IM9 A;  3GE9 A;  5J2M B;  4OZ0 A;  4ID8 A;  1S59 A;  2OAU A;  5D0G A;  3CCZ A;  1BQM A;  3TUI C;  3TUZ C;  1VYA A;  1DHM A;  1XWL A;  3DRX A;  4OZ2 A;  3LF0 A;  4QIG A;  2RRB A;  5B0C A;  4U8Y A;  4DCO B;  5H9E J;  1SL1 A;  1IKX A;  1VQ7 S;  5KFP A;  3HHD A;  1NU4 A;  4P7V A;  1VBY A;  4OI0 A;  1Q95 G;  3VZI A;  4D3H A;  2E5J A;  2D3O R;  3H40 A;  4UZC A;  2AEF A;  2GQ2 A;  2FHJ A;  2ABY A;  4CO2 A;  4JI8 J;  2XMT A;  2UV8 G;  4UQT A;  2WW8 A;  5T7L B;  1CS4 A;  3SFU A;  4UUX A;  3C16 B;  1JJH A;  4ES3 A;  3BO3 A;  1S7H A;  1N5Y A;  1TKZ B;  4E0D A;  1Z1Z A;  4G3I A;  2RB7 A;  2R8I A;  2HVD A;  3M2U B;  2RKI B;  2CUY A;  3D6F B;  4CO5 A;  3QLH B;  4WII A;  1HD1 A;  4KPC A;  2QMU B;  2GHW A;  2O5D A;  2BJ3 A;  2LA6 A;  2D3O 1;  3EM1 A;  5D4O A;  2R9L A;  3RR8 A;  1N6Q B;  2CXE A;  3CD0 A;  4CLT A;  3NOC A;  1X0F A;  3CCT A;  2QZ8 A;  2EK6 A;  1XR6 A;  2B7B B;  4X4O A;  3O3L A;  3G6E S;  3NL0 A;  2RU3 A;  2KG0 A;  2MDA A;  3LPE A;  5B0D A;  1FDN A;  2Y1R I;  1YRU A;  3M8Q B;  1JKH B;  4F26 A;  5A6W A;  1FJC A;  1KFD A;  1RWO B;  3DHX A;  3DU5 A;  2NXE A;  1UFW A;  3H5U A;  3TVZ A;  2W2O P;  4Z2X A;  4DZD A;  2GO9 A;  3QGI A;  4YR3 A;  4ERD A;  2KM8 B;  4YDX A;  1U1K A;  4KBI A;  1TKX B;  2Z56 B;  4NLW A;  2JFK A;  4ZS6 A;  1NK0 A;  1IKW A;  2VQF F;  2UXB J;  2V94 A;  1RTJ A;  3P5T L;  3HT0 A;  2NSB A;  2YX1 A;  1RAI B;  2HAI A;  2JEF A;  1OIA A;  1PG5 B;  1BQN A;  1UVK A;  5EX3 A;  4B9S A;  5DDP C;  1WAC A;  4Y2I A;  2FZG B;  3KJV A;  1NB2 A;  2UXC J;  5LMU F;  4WK3 A;  4WTO B;  1SPB P;  4DCP B;  4NPO A;  3H98 A;  4ZPB A;  2LEB A;  5GAD I;  1LOU A;  3KMS A;  4FYY B;  2V2Q A;  3AXM A;  2BE2 B;  4KB7 A;  1TAU A;  2W9B A;  4PKD B;  2HMI B;  3ZZP A;  2HHH J;  1Q78 A;  4DV5 F;  1REG X;  4J5O A;  2VOO A;  3DLE B;  3GB0 A;  4MT1 A;  3DKD A;  1RGV A;  1RE1 B;  4DL4 A;  1B7F A;  2KT5 A;  2Q6C A;  2CWX A;  1S12 A;  4CYU B;  5EN1 A;  2E5L F;  1SVD A;  4Q2M A;  2RF2 A;  3DDN A;  3JXO A;  2C2O B;  1F6T A;  3JQK A;  5AXL A;  4F7V A;  2ASL A;  2QYG A;  1RT1 B;  1T03 B;  2MKK A;  5J2M A;  2B6A B;  2B51 A;  4N77 A;  2MXY A;  3EPG A;  4B9N A;  4M5H A;  3QZ8 A;  2DGV A;  3SSS A;  4F2R A;  4ECQ A;  3SEO A;  2LQ5 A;  2MZT A;  2VBX A;  4A48 A;  3S1T A;  1H3D A;  4L76 A;  5ETS A;  4USJ C;  1T95 A;  1FFG B;  1FNO A;  3DHW C;  4ZLJ A;  3VGT A;  1XNR J;  2PA3 A;  2ZBP A;  4ZJL A;  4HT5 A;  3OL7 A;  1FWP A;  3Q83 A;  2KXH A;  3UCZ P;  3DLL Q;  1FE4 A;  4O3R A;  3KHH A;  2M5Y A;  2G2Y A;  3WHI A;  5KFA A;  2YNG B;  5EWF A;  1T8E A;  3ZC4 A;  1SJ4 P;  3PR4 A;  2J0X A;  2VC0 A;  4JI6 J;  1RWW B;  5CYJ A;  1IKV B;  3EGW B;  4OYB A;  1N52 B;  2DB1 A;  1X9W A;  5T7L A;  1EJ7 L;  2ZH6 A;  3C16 A;  4I2P B;  2DK2 A;  1TKZ A;  3BQ2 A;  1RWV B;  1E6Y B;  1KNZ A;  4ED3 A;  3M2U A;  2RKI A;  2NCK L;  3QLH A;  2Q79 A;  2W24 A;  2DNL A;  3AD8 C;  1TV6 B;  3P3D A;  4NCA A;  2FLN A;  2HIY A;  1S49 A;  1AB8 A;  2WSF C;  1GNK A;  3PW5 A;  4ZDN A;  4DL0 C;  3I82 A;  3GU0 A;  3KKF A;  3KNG A;  2R2R A;  1N6Q A;  5AE1 A;  4C11 B;  1SI9 A;  2R7V A;  4QW9 A;  1HW9 A;  3UNG C;  5L1L A;  4O0I A;  3RAX A;  1X60 A;  1Q7L B;  4TXS A;  5MLC V;  4DQR A;  2VFU A;  1SQE A;  3FBB A;  1L3K A;  3M8Q A;  4WF9 Q;  1JKH A;  3QGH A;  2VUG A;  2ZZN A;  3DNC A;  4ELV A;  3QWP A;  2HW3 A;  3KTQ A;  3IBC B;  2V50 A;  4F25 A;  5GAH U;  1HFE L;  3L9Z A;  3OL9 A;  4UT4 A;  3GR1 A;  1N36 J;  1EP4 B;  4ZVO B;  2J8S A;  4YY3 J;  1V3S A;  2RQC A;  2YXL A;  1W2I A;  4A8Y A;  1SL2 A;  3T6B A;  2QTW A;  1BWE A;  4DV6 J;  3I6P A;  3DLG B;  3D67 A;  4P2F A;  1TKX A;  1YZ7 A;  2KL8 A;  3CE8 A;  4RX6 A;  3D4J A;  3UN2 A;  4DR2 J;  1Q16 B;  2JL9 A;  1ELO A;  2RQ4 A;  3MMJ A;  3J80 U;  4NLT A;  4MFB B;  3ENV A;  1UW9 A;  2XYG B;  1RK8 A;  2MKJ A;  3W1Y C;  1XEZ A;  1GTH A;  4TLQ A;  3OLA A;  4KHP F;  3M05 A;  2ZM6 F;  4P9S A;  1K0V A;  3K2Y A;  1RKJ A;  2QSF A;  2BJ8 A;  3C8Y A;  2RIJ A;  4LF9 F;  4DJB A;  4J9V A;  4QWD A;  2PN6 A;  1ZTW A;  1RAA B;  2BE2 A;  1Z2L A;  2XHW A;  2KN4 A;  4M5K A;  1VC6 A;  2HMI A;  4KGK A;  3EX7 B;  3R97 A;  2J7W A;  1S57 A;  2H5J B;  3ZTR A;  4DEZ A;  2B8P A;  4NXN J;  3DLE A;  3I32 A;  4OZ1 A;  3FGV A;  1RI7 A;  2VIH A;  1ZTT A;  5C2C A;  1Q53 A;  1WEZ A;  2V2V A;  1Q5V A;  4CYU A;  3R1L A;  2ZWO A;  2PD1 A;  1FX2 A;  1NBE B;  3DLJ A;  2IM1 A;  1WI8 A;  4A8F A;  2R8J A;  2R7T A;  4B17 A;  1RT1 A;  1SC4 B;  2AF6 A;  2Y1I A;  1T03 A;  2AJ4 A;  4F4X A;  4KGV B;  2I6W A;  4EBE A;  1W7W A;  2B6A A;  1WDT A;  2YTC A;  5DM6 Q;  5ETN A;  5C7P A;  2WON B;  3CED A;  1VRT B;  3KOA A;  4JI5 J;  4M63 A;  1JLB B;  4I56 A;  3VAJ A;  3W8G A;  3DRY A;  2XYP B;  2ADC A;  3OR1 B;  4EFA C;  3P49 B;  2HRY A;  2C3Y A;  3VGU A;  2A6O A;  2VQE F;  2ZD1 B;  3NS7 B;  2VB6 A;  3RU0 A;  2WVD A;  4IH7 A;  4W98 A;  4DR1 J;  5J1E B;  2M88 A;  3HFK A;  4P2S A;  4XPC A;  2V8V A;  2YNG A;  4FXV A;  3ZZR A;  3QAE A;  1B64 A;  4DS5 A;  4I6W A;  5KOX A;  2CQ4 A;  1IKV A;  4LUB A;  4I7F B;  3BB5 A;  1SXL A;  2NZC A;  3S8S A;  4M94 A;  1WEL A;  3VAK A;  1S9F A;  3OPK A;  4IR1 A;  4NWB A;  4I2P A;  4YME A;  1FWL A;  2IDL A;  5AXK A;  3PX4 A;  4LR7 A;  5J1P A;  5F9N A;  1Q0N A;  1E6Y A;  5FLX U;  1F3F A;  3LTO A;  2YY3 A;  1JLQ B;  3FSY A;  2B3T B;  1KVK A;  1LNQ A;  4NXM F;  4P2M A;  1PAE X;  4X62 J;  2KDO A;  4IH5 A;  3F0N A;  4LRA A;  3QRQ A;  2FIU A;  1FTR A;  2JVO A;  3X1L B;  1TV6 A;  3ADA C;  2I5J B;  3OBI A;  5HJX A;  3OFG A;  1RHU B;  1M90 T;  1IBK F;  1HQE B;  4C11 A;  2ZHO A;  2FYX A;  3O2I A;  2ZH3 A;  2IVF B;  3W9I A;  3GFY A;  3KUE A;  1C1B B;  1O51 A;  3M9O B;  1CQN A;  1QAI A;  4HHJ A;  3CDA A;  2LQ9 A;  1BMQ B;  2XO7 A;  5KG4 A;  2HBR B;  2E1P A;  5A0Y B;  3N0V A;  3MUM P;  3UDC A;  2ZHB A;  1CUL B;  3NAH A;  1WC3 A;  3TZX A;  1ZH5 A;  2RIL A;  2EFG A;  1Y10 A;  2DNQ A;  1IQZ A;  4UST A;  1EP4 A;  1IBC B;  2XI3 A;  3LPY A;  3DOK B;  4ID5 B;  4C3M A;  2IM2 A;  2H1Y A;  4HL9 A;  2AT1 B;  2IAJ B;  3SMZ A;  3HUL A;  3WC0 A;  5BJR A;  1HPZ B;  3DLG A;  3H20 A;  1FDA A;  3CVK A;  3K17 A;  3GYN A;  4TU7 A;  4BHQ A;  1TUV A;  2CKW A;  2KT3 A;  5ETM A;  5GAG I;  4B3M J;  5BR8 J;  4MFB A;  5K9F A;  2F8M A;  5KFW A;  2FUG 9;  1WUU A;  4GKJ J;  3AOB A;  3H2U B;  3L7O A;  1XMQ J;  4DQI A;  4C2M A;  2FLL A;  3I56 S;  4LQ9 A;  3M8R A;  3M4X A;  4ZJO A;  3OL8 A;  4NLP A;  5D4P A;  4G6V B;  2MZR A;  1NPR A;  3MPY A;  4DUZ J;  2HGL A;  3M6U A;  5LSL A;  1IR0 A;  2L48 A;  1WOO A;  2OML A;  2R8H A;  1YJW S;  4Q7A A;  2R7W A;  3VAL A;  1R7I A;  1ZS6 A;  3P96 A;  2J6U A;  4DV7 J;  2CJ9 A;  1CJV B;  2DHH A;  1B0P A;  5F8N A;  3NY0 A;  4RU2 A;  3C14 B;  2HHU A;  3HP6 A;  2JDJ A;  5HL7 Q;  3NNH A;  1U2F A;  5HK4 A;  5LJ5 Y;  3RZA A;  3T1Y F;  2F9D A;  1WG1 A;  2VFT A;  3NCR A;  1FKO B;  1KQS R;  2GJ2 A;  5KFD A;  4M5M A;  2WON A;  1VRT A;  3G4S S;  3I4P A;  3PYE A;  3QAU A;  2A3J A;  1JLB A;  2FY8 A;  2KHC A;  1S76 D;  3QYY A;  3OR1 A;  2F9J A;  2Q66 A;  3ENA A;  3VAH A;  4NA1 A;  5BXI A;  2ZOG A;  2ZD1 A;  4DV3 F;  1FO1 A;  1EZZ B;  4OZN A;  3S7R A;  5J1E A;  1VGY A;  4YR0 A;  2LA4 A;  4IQM A;  3RAM A;  4R0E A;  5F3Z A;  2HVE A;  5M2R A;  4ICL B;  3DN9 A;  2DNH A;  1JLG B;  3G86 A;  4I7F A;  1FRJ A;  1G1X A;  2MQN A;  3C2P A;  3MTK A;  3DXS X;  5D0R A;  1T9W A;  3EDR B;  1XNR F;  4WKY A;  2HVH A;  3H2V E;  3J81 U;  3MM8 B;  4JB8 B;  1RT3 B;  2CJB A;  2KFN A;  3SIP B;  1NK4 A;  2FVP A;  1F9H A;  2E1M C;  2Q3P A;  2UVW A;  1JLQ A;  2HGM A;  2XY5 A;  4KT0 C;  4FBT A;  4FS2 A;  5H9F K;  4NZ0 A;  4B9V A;  2I5J A;  4LBH A;  2P9C A;  1S0V A;  1SH3 A;  3UNY A;  1FWK A;  1RTH B;  4O44 B;  4Y3C A;  4GC7 A;  5K8O A;  3AY0 A;  2KFZ A;  2ZVS A;  1HQE A;  4O0N A;  5HMW A;  4ED4 A;  4NYP A;  2UP1 A;  5DQH A;  3VQT A;  1C1B A;  3QO9 B;  3GJT B;  4K4V A;  3U1M A;  1QY7 A;  4B02 A;  5IFM A;  4NLX A;  3AD9 C;  3V2U C;  4RWW A;  4FF3 A;  2DH7 A;  4DSL A;  1S1T B;  2YWG A;  4LFB J;  2FLO A;  5A0Y A;  2YKA A;  1WG4 A;  2ZUA A;  1CUL A;  3P8B B;  1KVJ A;  4QR0 A;  4MYT A;  3JQJ A;  4DUY F;  3K8V A;  5IC6 B;  2MQL A;  3GIM A;  4ECX A;  4JV1 A;  1OJ4 A;  4DR5 J;  2LVW A;  1Y4Z B;  1QVF R;  4URG A;  1T0T V;  1X9S A;  3DOK A;  4ID5 A;  1GTE A;  2IAJ A;  1P27 B;  1DAR A;  2C28 A;  4QU7 A;  2V2K A;  3HMJ G;  1HPZ A;  1HNI B;  1RT6 B;  4WPA A;  4I6Y A;  3RB6 A;  1IXK A;  4UF4 A;  5L1K A;  1RIS A;  2HGN A;  4C0O C;  3CD5 A;  4A4J A;  1NCL A;  2E44 A;  4WFA Q;  2ROG A;  1N36 F;  3CT9 A;  2GCF A;  3W9H A;  2PMW A;  1P1T A;  2HS0 A;  4WZQ A;  4DV6 F;  1RAO A;  2V69 A;  4QWE A;  1FJ7 A;  5DRK A;  4O3Q A;  4QWA A;  1WOS A;  1Y7P A;  4K4W A;  4DL5 A;  4S0M A;  3SSQ A;  3NNC A;  2NQP A;  4DV0 J;  2V8P A;  1N33 J;  4DG1 B;  2CPF A;  1FXL A;  1NZ8 A;  3L95 X;  2D69 A;  3S01 A;  3M7V A;  2I9S A;  3ZTO A;  4GRS A;  1VC0 A;  1Y11 A;  2U1A A;  1CJV A;  1WI6 A;  2WBR A;  2AP6 A;  1X4F A;  3C14 A;  2W4C A;  4NLY A;  2CDQ A;  1QTN B;  1DTT B;  1DQ8 A;  3VQS A;  3C19 A;  1WNE A;  1QVG R;  2VJU A;  2W7A A;  1FE0 A;  4L3K A;  1FKO A;  4NLU A;  1G7C B;  3M6V A;  4QCL A;  1UVN A;  2XG8 A;  3D6T B;  3ITH B;  1N56 A;  4DQP A;  5DLF A;  4DSI A;  2J7K A;  2KU7 A;  3E01 B;  3NCQ A;  4ZPC A;  4WXW A;  1YJT A;  3R8Y A;  4JI3 J;  1PJ6 A;  4JI1 F;  5E3Q A;  1KSP A;  3KJF B;  2A18 A;  3T6J A;  3NGR A;  4M5L A;  2G0I A;  1TP7 A;  4CM2 A;  2HVZ A;  3DRP B;  1T9Y A;  4M5D B;  4XIU A;  1V9O A;  1B70 B;  1S72 S;  2DCL A;  4ICL A;  2OEL A;  1S6O A;  4FZV A;  1Q1K A;  4QIV A;  3OV7 A;  2VOP A;  2B56 A;  3N28 A;  2KZM A;  1JLG A;  1VRU B;  4FP9 A;  2DY9 A;  2R3V A;  3M6W A;  3EXC X;  3RRH A;  3DOM B;  2VZ9 A;  4KAI A;  3MM8 A;  5KFB A;  2HHW A;  2OTJ S;  1RT3 A;  4USV A;  4NMX A;  5EX0 A;  2IA6 A;  1WC4 A;  4ZLL A;  1Q8B A;  2CFX A;  2G1H A;  1D9D A;  3AJ2 A;  3PVX A;  2C2E A;  2KFY A;  4CP5 A;  1XC9 A;  2EEY A;  5GME A;  1N5Q A;  1RDR A;  5LSO A;  4N8O A;  5DZ6 A;  4WE1 B;  3U7J A;  4I64 A;  1RTH A;  1ZZF A;  4O44 A;  2QL5 B;  2NR0 A;  1OPZ A;  2HHX A;  1KOH A;  1VMB A;  2F4F A;  5HMX A;  3LGN A;  4FXD A;  2H4W B;  3QJJ A;  2IBK A;  4G1Q B;  4CWB A;  3W2W B;  2DEI A;  3A8K A;  3QO9 A;  2K06 A;  1EQM A;  4EBC A;  4BC9 A;  2HLU A;  2RD5 C;  1S6P B;  2Y8Y A;  1S1T A;  1D3W A;  1HHT P;  3DDK A;  1BXN A;  4X66 J;  2HYI B;  3CC7 S;  2YNF B;  2RUS A;  2ATL A;  1APS A;  2Q6B A;  2BOA A;  2VA2 A;  3LGH A;  1MWZ A;  4JUZ A;  4MK8 A;  2AX0 A;  4Q2L A;  3IN5 A;  5KTQ A;  1OS5 A;  2C2M B;  4J9N A;  1PO6 A;  1GXT A;  3W66 A;  2HQF A;  2EC0 A;  4ECT A;  1HNI A;  1RT6 A;  2FHM A;  3K89 A;  4ZVP B;  4FVM A;  4PG5 A;  1UVM A;  2DGS A;  3IAS 9;  1MLA A;  5CAA A;  2QA2 A;  4RW8 B;  4BCA A;  3KJN B;  3CCU S;  3CJ0 A;  4FYW B;  1U49 A;  3NOG A;  3Q86 A;  3Q8P B;  1UEV A;  5B0B A;  2YQ0 A;  1T05 B;  4O3N A;  3NGK A;  3PEJ A;  4P6Q A;  3POT B;  1FCA A;  2LKZ A;  3J7Y I;  1R3N A;  2XMK A;  1IJF B;  4AXI A;  3CJR A;  1K1Q A;  1OPI A;  3BR8 A;  3ZZY A;  3LW5 C;  3O8W A;  3UFC X;  4DG1 A;  4KYZ A;  4MKA A;  2JNJ A;  3A3N B;  3KK2 B;  4GKK F;  4P52 A;  1SC1 B;  4EZ6 A;  1HD0 A;  1X5O A;  3MEC B;  4ILR A;  3ICL A;  3T5L A;  1EAR A;  2WZ1 A;  1M5P C;  1DTT A;  1YRX A;  1AT1 B;  4QZV B;  1JIH A;  4ZN1 A;  5KFM A;  4DF4 A;  3CXC R;  4B3S J;  2CQC A;  3BGL A;  2ZH8 A;  1D0E A;  3IGN A;  3PFE A;  5K8P A;  2R2S A;  2M7S A;  3IFE A;  1WWH A;  1KP6 A;  3JTP A;  3BGF A;  1XIQ A;  3ITH A;  1NJY A;  4NLS A;  4X4P A;  3E01 A;  2HBQ B;  3KLH B;  4IDK B;  2E1C A;  2ASD A;  1W26 A;  3FCW A;  3W5X A;  5F8M A;  3PDN A;  2C2R A;  4P75 A;  2VJV A;  2DCU B;  4E2F B;  3O44 A;  3ULH A;  1I6J A;  2DPJ A;  1MML A;  4A8K A;  1Q86 T;  4M5D A;  3BJY A;  2K7J A;  1VQL S;  3IAM 9;  1RA6 A;  5DDQ C;  3TOQ A;  3CUL A;  1KQF B;  3HM9 A;  1VRU A;  1YK9 A;  2O3D A;  1EKS A;  3HD2 A;  2QLF B;  2QSW A;  4J9S A;  4CNZ A;  1F5C A;  3DOM A;  3T5K A;  2DNZ A;  4IUF A;  3V6J A;  4DFJ A;  3VAG A;  1RAD B;  5CXT A;  2HK2 A;  3Q24 A;  5JXS A;  4J9K A;  5D77 A;  4YP3 A;  3NCP A;  4DX7 A;  5AJ3 J;  2B0G A;  3UDE A;  1LKZ A;  2UU9 J;  3H2L A;  1PYT A;  4PXE A;  2HUR A;  1NDP A;  3W7B A;  2AEJ A;  2WSC C;  3D0H E;  2QFI A;  4WE1 A;  1UZH A;  4DDF A;  1HBO B;  1TQL A;  2CPX A;  1OYD A;  3AJD A;  2DNK A;  1PIE A;  4G1Q A;  3W2W A;  3PYD A;  3ETM A;  2QA4 G;  4ECV A;  1BHN A;  1L3S A;  1PC4 A;  1LXJ A;  2R8G A;  4B08 A;  1S6P A;  1FA0 A;  2NLW A;  3PCO B;  2YWF A;  1FJG F;  1RUS A;  3HKW A;  2YNF A;  1RBA A;  2B9E A;  4L72 B;  1WTF A;  5CZV A;  2ZH9 A;  2HBZ B;  1EET B;  4ANC A;  3ZTQ A;  2N3O A;  3JTN A;  3NGU A;  2J0S D;  3GR0 A;  3HHL B;  3GV8 B;  3I5C A;  1HQ2 A;  1PYO B;  2FHK A;  3GCW P;  3D3B J;  3Q8R B;  3IR6 B;  3RBE A;  2E5I A;  1S1V B;  2QX0 A;  2PE8 A;  4TU8 A;  1NB7 A;  4RW7 B;  3KK3 B;  1KWM A;  3TEG A;  4LFB F;  1AZS B;  5EHH A;  4DZ6 A;  4ZVQ B;  4K59 A;  3DDI A;  1KQG B;  4RW8 A;  3AAW B;  1J27 A;  2XUL A;  4J9U E;  4ED1 A;  2MYF A;  2YPZ A;  3IS9 B;  1RP5 A;  3EMT A;  3QSY B;  3CCQ S;  2UUC F;  2Q43 A;  1SKU B;  1T05 A;  1S6U A;  3TX8 A;  3OT9 A;  3DLH A;  2F65 A;  3LAN A;  3POT A;  4RUC A;  3D0G E;  2VBZ A;  5KFQ A;  2IVY A;  2KI2 A;  4ZMM A;  1S79 A;  5EUH A;  4LRD A;  1U1Q A;  2DXE A;  3NRB A;  4DR7 J;  4ZCK A;  2V6A A;  3KK2 A;  4OL8 A;  4PAB A;  2KXF A;  1OY9 A;  3CCR S;  2AW0 A;  3MEC A;  4AL6 A;  3DGV A;  4ZPT R;  1KDN A;  3PEH A;  4DPO A;  3M8Y A;  3A3P B;  1YSJ A;  1R6Y A;  2GZO A;  3A8J A;  4DPT A;  1UA0 A;  3PIO Q;  1X4E A;  5CD4 H;  1VQM S;  3R7B B;  1PYS B;  5T14 A;  2H5E A;  1S7I A;  5E3R A;  4DV0 F;  4X4T A;  1AUS L;  3CWJ A;  4O23 A;  3AOC A;  3GJR B;  3G2X A;  1M0S A;  3KLH A;  4IDK A;  4XDC A;  1RCO B;  3TAM B;  3E8O A;  3NNA A;  3SV3 A;  3HHL D;  1X4A A;  4I1T A;  1K9M T;  3HJF A;  3TQ1 A;  1U2R A;  2CPI A;  3LQV A;  3O1L A;  4Q45 A;  1YI2 S;  1P1L A;  2HNZ B;  4QW8 A;  4O3S A;  1LV5 A;  2BJ9 A;  4TN2 A;  5D15 A;  1QJH A;  4PRF A;  2LQJ A;  2P5V A;  4F67 A;  5E2Q A;  5IWA J;  3CJ4 A;  1BGX T;  1T94 A;  2ACY A;  1TL3 B;  1MG7 A;  3CCL S;  2BBE A;  3VVT A;  3QQC D;  3D28 A;  2UVV A;  3MAA B;  2Z8Q A;  1VQO S;  4CDI A;  5B0A A;  1IR1 A;  1SBR A;  2W2N P;  3FQK A;  5I42 B;  3NP5 A;  2J6T A;  3ZO7 A;  2AJ1 A;  2DBB A;  1TUG B;  3C6U B;  3EGV A;  1VQN S;  1OSD A;  2P9G A;  5B09 A;  4FF1 A;  2P6T A;  4OYZ A;  2EFV A;  5LSR A;  1HBO A;  3PRB A;  2IMW P;  4LF8 J;  2BYC A;  2CVI A;  3GIK A;  4ECS A;  4AYB D;  1WTB A;  3K5L A;  1Z4U A;  3CCJ S;  3GII A;  1HKA A;  2ZDP A;  1UCN A;  1W2B R;  3THV A;  1FFW B;  4PQA A;  1SC3 B;  5ADZ A;  1DAX A;  2V4R A;  2KG1 A;  2G1D A;  1WSV A;  2CJX B;  4Q8F A;  2FVR A;  1Q8K A;  4N8N A;  2DEJ A;  2GMH A;  4IG3 B;  4J9O A;  1H73 A;  3GWC A;  2K7K A;  2CQB A;  1G6B A;  3Q8V A;  1EET A;  3AD7 C;  5KFK A;  4ECW A;  1S6Q B;  3NLC A;  4NLD A;  3HHL A;  4N47 A;  4U9R A;  4P72 A;  5AE3 A;  2NXJ A;  3TJ9 A;  1HQU B;  1U0H B;  1S1V A;  1PJ7 A;  2DRB A;  4MIB A;  3PYG A;  4RW7 A;  3KK3 A;  4YOE A;  5ITH A;  4ENO A;  3D1O A;  4CTA B;  1AZS A;  1FEH A;  2V5H G;  2XEX A;  4MK7 A;  2MJU A;  3CJ8 A;  2DPI A;  2B43 A;  3PTW A;  3IS9 A;  1VJW A;  1NDL A;  3TZW A;  5HMZ A;  3EZU A;  1VBZ A;  1I94 F;  2GO8 A;  1RJJ A;  4DL3 A;  3GSD A;  1SL0 A;  4AD6 A;  4HYK A;  4USM A;  2CZV C;  5GMK a;  4QWB A;  1U1O A;  3FKB A;  4JI4 J;  2WB1 D;  3BRE A;  4FS1 A;  1IKY B;  4AQY J;  4K4T A;  4KHR A;  1AFJ A;  1XMO F;  2XM3 A;  2ZH1 A;  4U67 Q;  2RNE A;  3GZ7 A;  2HZA A;  4PYD A;  3QBC A;  4CZC A;  1NME B;  1O0P A;  2GW8 A;  3B54 A;  2MZQ A;  1D8Z A;  2DGU A;  1WC0 A;  2FHO B;  2DTJ A;  4PXD A;  1U26 A;  2HFZ A;  4MMO A;  5IS2 A;  1ZAV A;  5LMN J;  2AIR B;  4FPI A;  3ZTP A;  1FDD A;  3KK1 B;  2N4C A;  2QRR A;  1DQA A;  3MMC B;  2VHG A;  4X4R A;  8ATC B;  4ELU A;  2MQ8 A;  4EZ9 A;  5E3P A;  3QJL A;  3MCM A;  2AGP A;  1TMM A;  4RUA A;  3ILI A;  3EGN A;  3EZ5 A;  3H8Y A;  5I3P A;  2HWT A;  2RU9 A;  2XNQ A;  4O4G B;  4RBT A;  1UPP A;  2X1G A;  4B9M A;  3ISN D;  1VC5 A;  1Y9O A;  3PYF A;  3D2W A;  3F41 A;  1AA1 B;  3TAM A;  4F4W A;  1I1G A;  1N32 F;  2WVC A;  3RW7 A;  3HZE A;  2LFV A;  3TUJ C;  2F40 A;  2M4M A;  5A8R B;  4PPZ A;  1OYE A;  1K0T A;  2IJN A;  4KGX B;  2HNZ A;  2Z0G A;  2GFF A;  1R0B G;  2DXF A;  1OQ6 A;  3KHL A;  1FX4 A;  1RSC A;  4AT1 B;  4JBC A;  4DF8 A;  2L3M A;  4BDP A;  3KNA A;  1NKC A;  3H5Y A;  4LF6 F;  5LJ3 Y;  2EBG A;  1TL3 A;  2CNK B;  1FKP B;  3LA0 A;  2JRS A;  2MZ1 A;  2KM8 C;  3T5H A;  4JI0 J;  3MAA A;  4K0K F;  5ETQ A;  1HWU A;  4HTJ A;  5K8N A;  3OD2 A;  2FJD B;  3PW0 A;  5I42 A;  2J9E A;  2NSC A;  3CTR A;  2F7V A;  1Y3J A;  1FF2 A;  3VWS A;  4LF5 J;  5GAH I;  3C6U A;  2IHR 1;  3CDE A;  5HAT A;  1YX2 A;  3H4D A;  1U6Z A;  4TKT A;  3WIU A;  1PBA A;  2EG2 A;  4RPF A;  2R7O A;  2IYG A;  2HKE A;  1RYS A;  4KFB B;  1U6B A;  3KLV A;  1REV B;  3FMW A;  3MI7 X;  1JQG A;  4DU8 A;  4OYA A;  3OUY B;  5KFG A;  1KEK A;  1TTH B;  4KPY A;  1NK7 A;  3FEX B;  3CDB A;  3W9J A;  3KLE B;  3ENW A;  2N7C A;  4J37 A;  4X84 A;  1TU0 B;  2N4D A;  4F50 A;  3IG1 B;  4USW A;  4QBU A;  4IG3 A;  1KFS A;  1SIZ A;  4HDG A;  5C24 B;  4GMK A;  3M30 B;  3OQ2 A;  3SI8 A;  2HFO A;  4CLU A;  4N7T A;  1HA1 A;  1S6Q A;  2P2C B;  1VLY A;  4M8L A;  3HCX A;  4HH1 A;  2LP4 A;  1HQU A;  1U0H A;  5KT6 A;  5CD4 A;  3KLI B;  4YS2 A;  3QAT A;  1WEX A;  2PEH A;  4CTA A;  1QAY A;  3FFI B;  4QWC A;  1JJC B;  2RHS B;  5E3C A;  1JWW A;  2NXU A;  4NEZ A;  3ENQ A;  5AE2 A;  5U47 A;  3LP1 B;  1OY6 A;  5KG5 A;  3UN5 A;  2B9Y A;  2DHG A;  4NYO A;  3HKZ D;  2MLZ A;  1IR2 A;  2X3G A;  1R43 A;  3MWB A;  4A8X A;  2ZHA A;  2BMB A;  3FMB A;  1ZM4 A;  2XLI A;  2K2P A;  3T3F A;  3IC1 A;  4Z37 A;  5F8G A;  2VFV A;  1IKY A;  2HQI A;  4ZVG A;  4OYW A;  2PI5 A;  1TK8 A;  4C0H A;  1IQT A;  4IO1 A;  4QOT A;  3MPV A;  3GIJ A;  4EYI B;  3GG0 A;  4I4B A;  2GML A;  1WDD A;  2ZJP Q;  1T02 A;  1TL4 A;  4URQ U;  2CJK A;  5DO2 A;  2DRA A;  3MCN A;  4LF2 A;  7AT1 B;  3SBM A;  1SJF A;  1U09 A;  3KK1 A;  3MMC A;  3OTO J;  3RB4 A;  4LFA F;  3Q0A A;  1RTD B;  5DM7 Q;  1FEE A;  4ITS A;  2K3K A;  1YKW A;  2XWX A;  3TJ8 A;  2ZKT A;  3JS9 A;  3RTV A;  2Y0S D;  4ZHR B;  1NK9 A;  3G82 B;  1Q8L A;  3QZ7 A;  4X65 J;  4O4G A;  5BYR A;  2DO0 A;  1QTM A;  2VG5 B;  3ILO A;  1UJ4 A;  4PAA A;  3MAQ A;  2CPE A;  3AB2 B;  2X51 A;  2FD2 A;  2MHE A;  2VD3 A;  2QFJ A;  1UKU A;  5E41 A;  3AOD A;  3CGI A;  4A47 A;  4HDH A;  4OZL A;  1WC5 A;  3GCX P;  3CJT A;  3TVY A;  3A8E A;  1RBL A;  5A8R A;  4OHW A;  2VOD A;  2R42 A;  2W25 A;  2B7C B;  2JLF A;  2VBY A;  1ZBT A;  2VFR A;  2LXU A;  2XSJ B;  2GIQ A;  5CCL A;  3C46 A;  3EE3 A;  2LXI A;  2UUA F;  1RAC B;  5IV4 A;  2ZZM A;  4GVB B;  4DR6 J;  1FKP A;  4BBY A;  1HNZ F;  2HQC A;  4Z7Y A;  1DLO B;  1GT8 A;  2XTJ P;  1LEO A;  2NUU G;  3KDN A;  2XB2 D;  2EVZ A;  5G0R B;  1URN A;  3I0R B;  3TZY A;  4KIA A;  3UVJ B;  2AJ2 A;  2XZD B;  2QMX A;  3SQG B;  1ZPW X;  3UD5 A;  1S9G B;  3A3O B;  3MF5 A;  7FDR A;  1U8W A;  1BUX A;  1NXI A;  3L7P A;  3I9V 9;  1FXR A;  4KFB A;  4H54 A;  2V0N A;  1REV A;  3C6T B;  4C8M A;  5LM7 E;  1LWE B;  2CNO B;  1PKU A;  1A0O B;  3OUY A;  2E7W A;  2HHP A;  3ZZO A;  1SKS A;  3B8H A;  4WXO A;  3KLE A;  4FVC A;  3CNQ P;  3CCM S;  2VG7 B;  3GIR A;  2HQD A;  1H2V Z;  4RNH A;  2OPP B;  5L46 A;  3IG1 A;  3PKM A;  3UCU P;  4MH8 A;  4CH7 A;  3JAM Y;  5ETK A;  4PWU A;  2EK1 A;  2BKO A;  3MM7 B;  5C24 A;  4C3K A;  2J0W A;  4LFC J;  3M30 A;  4NI2 B;  1VBK A;  2OHD A;  2CIM A;  4NA3 A;  2V63 A;  2X1A A;  1LWX A;  2CNN B;  1NPK A;  4BWJ A;  2E7X A;  4NX9 A;  4ZVR B;  3MUR P;  4FDF A;  3KLI A;  3UR3 C;  1V6H A;  3KFW X;  1I3O B;  1WKJ A;  3FFI A;  2OEM A;  2VPW B;  4X64 J;  1XR5 A;  3B4M A;  3LP1 A;  1FJE B;  5LL6 d;  3AA9 A;  2MHN A;  2LEP A;  1G4C A;  2DY1 A;  4DV2 F;  2F4V F;  3EGZ A;  4KTQ A;  2EPI A;  1VIS A;  2KKH A;  3G8Q A;  1VLO A;  2F63 A;  1QDU B;  2CZ4 A;  2QLX A;  4Q5V A;  2RJZ A;  2ZVI A;  4ZIV A;  4X2B A;  3MOZ A;  4CT9 A;  3SFG A;  5K14 B;  3OTE A;  2PFF B;  1FNM A;  1CEZ A;  5JMN A;  2BQ3 A;  4ZA1 A;  4K7Q A;  3V4M A;  1IBL J;  1AW0 A;  4WP3 A;  4LT6 A;  1NND A;  3D6H B;  3W64 A;  3SCI E;  4ECY A;  4W90 B;  3R5G A;  3B82 A;  1D1U A;  2YKM B;  1QUP A;  2J8A A;  1B3T A;  1U47 A;  1QAJ A;  1OO0 B;  1ZPV A;  1H7X A;  1FKA F;  1A7G E;  5KT4 A;  1X4H A;  2CPZ A;  2CJA A;  4NAS A;  1B0V A;  5C25 B;  2MTL A;  2ZOM A;  4AQY F;  1VOM A;  2DH9 A;  1RTD A;  5F8I A;  1URR A;  3HZG A;  3PW2 A;  1R6V A;  1R89 A;  4V1A k;  3MEE B;  2ZDO A;  2DXD A;  4MJK A;  1R8B A;  1S4F A;  3G82 A;  4ZHR A;  1HNW J;  5E0O A;  1T3N A;  1BD6 A;  5KAK A;  5AXN A;  4LRC A;  2C2D A;  2XI2 A;  3BDP A;  1XNQ J;  1SV5 B;  3H42 A;  2LXF A;  3IGV A;  3MPW A;  2VG5 A;  3A4T A;  2ZKU A;  1OQ3 A;  2XY7 A;  4FF2 A;  2BVZ A;  2JC0 A;  3OTC A;  1Q5Y A;  4R0J A;  3RGI A;  1EQ0 A;  1WHX A;  3VGS A;  4OX7 A;  3NBP B;  2PFD A;  1HWL A;  2EW9 A;  2V8D A;  2BRL A;  1F5A A;  2K3I A;  3BGO P;  4OFZ A;  2IRX A;  2XSJ A;  4ECZ A;  1Y5L B;  1GMV A;  2C3O A;  1CJT B;  2C3P A;  1NSA A;  4JI7 F;  3H5X A;  4QYZ K;  2EFO A;  4GVB A;  3KJQ B;  5A8W B;  3OR2 B;  2R2U A;  3MMB B;  1DLO A;  3SXL A;  4DR4 F;  3MZI A;  4ZPW R;  4B9U A;  5CA5 A;  5G0R A;  2JHE A;  3I0R A;  4IOB A;  3UVJ A;  1SIW B;  3GFZ A;  2UUW A;  3M8P B;  4N56 A;  4ILM A;  2QLW A;  2MLX A;  1GH8 A;  3SQG A;  1S9G A;  3BBC A;  4JV0 A;  2IYI A;  2IRY A;  2HSE B;  2E5H A;  4QPX A;  3C6T A;  4DX6 A;  2XNR A;  1LWE A;  2ROP A;  1J5E J;  1NSK L;  3GV7 B;  1VQ5 S;  3Q89 A;  3BH6 B;  3BBB A;  1S1W B;  2R7Q A;  4CO1 A;  1HL6 A;  2VG7 A;  3MM6 B;  5CZX A;  3VGV A;  2BX6 A;  4LF5 F;  3FNN A;  2NYI A;  2LEA A;  4YUD A;  3DC2 A;  2OPP A;  1GX6 A;  4YB1 P;  4RR5 A;  1CQM A;  5IC4 B;  2FPH X;  2NS1 B;  1UTA A;  4BWM A;  5GAE U;  3TA2 A;  3MM7 A;  2FY1 A;  5IT9 Y;  4ZP6 A;  2MKC A;  5DG7 A;  2VBW A;  3BSC A;  4NI2 A;  1NKE A;  3K0J A;  3NWG A;  2HG4 A;  1N88 A;  5HLF B;  1GK8 A;  4N5S A;  4RU9 A;  3CJ3 A;  3KG1 A;  4BS2 A;  1HWK A;  3ZTS A;  4N41 A;  3DOL B;  3BV8 A;  2BAN B;  2D41 A;  2UUB J;  4OI6 A;  1IJE B;  3MD1 A;  3TI0 A;  2W2M P;  4LF4 F;  1JXE A;  3QJP A;  2B9W A;  1ARO P;  1WC1 A;  3LGM A;  1CSJ A;  2H4Y B;  4FF4 A;  4GVL A;  3M6X A;  3DM2 B;  3HFV A;  1HNX F;  4YB6 A;  1LW2 B;  3RB3 A;  1VQP S;  2YNI B;  3OTD A;  4DV1 F;  4X4U A;  3R2D J;  3IRX B;  4RZR A;  2YKQ A;  1YG0 A;  4ECR A;  4DQS A;  3OLB A;  1RWP B;  2G2O A;  3I31 A;  3TR5 A;  1KS2 A;  1DJ0 A;  5K14 A;  1HHS A;  3R2C J;  4CH0 S;  3M9N B;  2ZJQ Q;  3BGU A;  3PJ9 A;  1IM4 A;  1PSD A;  4IRK A;  1ZA2 B;  3N6L A;  1WG5 A;  2BKP A;  2DNP A;  4YHH J;  2YKM A;  1UJ6 A;  1NH7 A;  4JV5 F;  2MQO A;  3WX8 A;  2BOP A;  2RRN A;  5C25 A;  2KTQ A;  4DXL A;  2DR7 A;  4YR2 A;  4PG4 A;  4Y2K A;  1L3T A;  3BKU A;  4DN9 A;  4DS4 A;  4DSJ A;  5KFT A;  1OY8 A;  3KMQ A;  3MEE A;  3SSR A;  4ECU A;  9RUB A;  3R1H A;  5L9N A;  3JQM A;  1SV5 A;  2RH3 A;  2XMU A;  2G2Z A;  4NRT A;  4DN0 A;  5D8H B;  3P4U B;  3FZ2 A;  2IY5 B;  4HAC B;  4CI0 B;  2QL9 B;  3ILL A;  2WSE C;  1HBU B;  1VQS A;  1V3R A;  5FDL B;  2PC6 A;  2XGP A;  1UA1 A;  2RHQ B;  4JV2 A;  1K73 T;  4ZK7 M;  3OTO F;  2MQQ A;  2B4U A;  1KQK A;  2AYM A;  2UUT A;  3NBP A;  3HX9 A;  3T41 A;  4LJM A;  1KLN A;  2GVD B;  2L9W A;  3PXG a;  4M95 A;  2BR0 A;  1CJT A;  2G4B A;  1CBK A;  1ZET A;  4A8M P;  4NRU A;  1MNE A;  4F0H A;  2OFG X;  5A8W A;  3OR2 A;  3OVB A;  3MMB A;  1SUQ B;  3GJS B;  3M9M B;  5KFV A;  4CLW A;  2ASJ A;  4U8V A;  3FVY A;  3M8P A;  4F0K A;  2DO4 A;  2EKY A;  2Y9H A;  3AXK A;  4OI2 A;  2X1F A;  2YWH A;  2UXD F;  1HHQ A;  5HVG A;  1B99 A;  3P45 B;  3GJQ B;  5E3A A;  4ZCI A;  4LSN B;  3JSY A;  4M5J A;  5C5J A;  1PIL A;  4RW4 B;  4ES2 A;  4B9T A;  1UPM B;  2YWK A;  1S9E B;  4JP8 A;  4H4K A;  1EHW A;  5IOL A;  2DRD A;  2F8E X;  1S1W A;  3RBZ A;  5KFI A;  5KFZ A;  3MM6 A;  1KRP A;  2BJD A;  1HMV B;  2YBV A;  4FKY A;  2KRB A;  1ZOT A;  4PG7 A;  1ZM9 A;  1U2C A;  4QR1 A;  1NHU A;  2CJY B;  1YGY A;  2IJR A;  4I68 A;  2XQC A;  3PZP A;  3AHP A;  3PJX A;  4RUH A;  4DSE A;  2XS5 A;  4IRC A;  5IZH A;  1DBD A;  2M8D B;  1VQ4 S;  3HVA A;  2IJF A;  1UVL A;  4ES1 A;  5HAN A;  1TEL A;  1AXQ A;  5HLF A;  5D0H A;  2JOQ A;  4Y2M A;  4MTP A;  4IYQ A;  3DOL A;  2BAN A;  4FPR A;  1YBT A;  2MKH A;  1JLF B;  4AE5 A;  4LBP A;  3BPD A;  3D66 A;  4KJI A;  2BV3 A;  1RT7 B;  5HI7 A;  1Q8I A;  2ZH2 A;  2CG8 A;  3CJ5 A;  3PM9 A;  3VAF A;  3HLU A;  2C2K B;  2QLJ B;  2DHS A;  3NXZ A;  1X5S A;  2JZ5 A;  2RDD A;  1JLC B;  3CMA S;  3DM2 A;  1MN7 A;  4NOH A;  2OSR A;  1HI1 A;  1LW2 A;  1VDH A;  2VQF J;  2ALZ A;  2Z2Z A;  2BW2 A;  1N34 F;  2YNI A;  4U95 A;  5DET A;  3VTI A;  3IRX A;  3NGS A;  1WC6 A;  2FVS A;  2DHA A;  3MCO A;  1O6X A;  4WFZ A;  2AEM A;  4LIR A;  1VCT A;  1T3O A;  3TAP A;  3K8W A;  5LMU J;  1RAF B;  1HYS B;  2XCA A;  4CQ1 A;  2PII A;  3UR0 A;  4ZP9 A;  1X9M A;  3ZNU A;  3BS9 A;  4OX6 A;  4C97 A;  3G9C A;  1RQ0 A;  3D0I E;  4DV5 J;  4KC5 A;  4K4U A;  3RRG A;  2RDJ A;  4RJV A;  1SH0 A;  3DLK B;  1M5H A;  4DR3 J;  2BZ2 A;  4YB7 A;  2E5L J;  2LYV A;  3LUY A;  2N82 B;  3QT7 A;  1VJQ A;  4IQX A;  4PQU B;  1AFI A;  5ETP A;  2YKP A;  1D8Y A;  1UJ5 A;  3D1H A;  3VVU A;  1BC6 A;  3GP9 A;  4L73 A;  1IN0 A;  2W4D A;  4HAC A;  2GMJ A;  3N6N A;  5D78 A;  2WVF A;  1HBU A;  1JB0 C;  5FDL A;  2XZT B;  2RQM A;  3IA0 A;  1NH8 A;  4JI8 F;  3D5M A;  4D3G A;  2ZZT A;  4LF1 A;  2GVD A;  4C98 A;  1VQY A;  2JWN A;  3TP2 A;  3PKY A;  1NSP A;  2O66 A;  4WYW A;  1XNQ F;  2GX8 A;  2HHS A;  1SKR A;  4F3Q A;  1S48 A;  1SUQ A;  1OMS A;  5DGA A;  4MIA A;  2XMM A;  3QWU A;  3HXM A;  3T9Z A;  3FBE A;  4OI3 A;  1NDK A;  2HQ3 A;  1HWJ A;  4EK2 A;  5GVQ A;  4YQW A;  4OMF G;  2UZA A;  3N79 A;  4AND A;  1KN6 A;  3ZZ0 A;  1U8S A;  3I87 A;  5KT2 A;  4J9Q A;  4ZCM A;  1SQF A;  4TQS A;  1WJ9 A;  3HSG A;  4FXW A;  3I0S B;  2VU5 A;  3HO1 A;  2R7X A;  1R8C A;  3IBW A;  4LSN A;  2P8I A;  2KVI A;  2KRR A;  4ELT A;  4RW4 A;  4OLP A;  2PA8 D;  4IFY B;  3RG6 A;  1HLW A;  3UW1 A;  1S9E A;  4GO5 X;  2PMZ D;  2KB2 A;  3CF5 Q;  3GYG A;  1CPZ A;  5CH7 B;  2VL1 A;  2CAJ A;  5FJ4 A;  4OI4 A;  3EIC A;  2CQI A;  4KO0 B;  1VRQ C;  1HMV A;  2BAB A;  4A8O A;  3LAK A;  4F0M A;  3HSD A;  4NLR A;  1FRI A;  4CO4 A;  1S4E A;  2VDI A;  4PG6 A;  4R25 A;  5DZ7 A;  4EMD A;  3W63 A;  3KHR A;  3IMQ J;  1ZM2 A;  3US5 A;  3C3L A;  4WKR A;  4CO0 A;  4BC7 A;  2HHT A;  3BF4 A;  2UXB F;  2W2Q P;  1FI4 A;  1VQK S;  2EWH A;  1VBX A;  3H0P A;  1JLF A;  1DUR A;  2J6S A;  4IOA Q;  1YJ7 A;  3QT6 A;  4CLF A;  2D9O A;  1RT7 A;  2UVR A;  3MR7 A;  2DIT A;  1U45 A;  1O8B A;  1TZ0 A;  4C9D A;  2J5A A;  5M2U A;  2UXC F;  2FTR A;  2F8H A;  3D54 A;  1T9V A;  3VZH A;  1JLC A;  4G1I A;  4K8R A;  4N76 A;  4LMZ A;  1Q4R A;  1UEK A;  3OTB A;  5BYS A;  3AOA A;  2POK A;  1RT4 B;  1OSC A;  3HT3 A;  4ED2 A;  1VR6 A;  2HHH F;  3SCK E;  3FJ2 A;  2JJ4 D;  4KR0 B;  1FD8 A;  3TX0 A;  4KHP J;  3EYZ A;  5KG1 A;  4DCJ B;  3K7R A;  2ZM6 J;  1NJW A;  1EIY B;  4P7T A;  3MUV P;  3J7Z T;  3OVS A;  5KFJ A;  1HYS A;  1T9X A;  2ZEJ A;  2OUG A;  3M8Z A;  1NPP A;  2OMO A;  3GTY X;  4LF9 J;  2OGU A;  5I4M A;  1GMU A;  1YZ6 A;  2RQK A;  3NGD A;  2F3J A;  2FJA B;  3NKY A;  3MR3 A;  2CPD A;  3U27 A;  1N48 A;  3W61 A;  5JVH Q;  2W01 A;  1ZAX A;  2VAS A;  5DDO C;  2QEX S;  3P5B P;  3DLK A;  1D09 B;  2ZNY A;  3CPW R;  4DPW A;  2VPX B;  3OW2 R;  4C8L A;  2B8Q A;  1L5U A;  1NJZ A;  4EGL A;  1NO8 A;  3NWR A;  4PQU A;  2BE9 B;  2GAG C;  2MZS A;  3W65 A;  5D4N A;  4HT7 A;  1DFD A;  1S77 D;  5HJY A;  3TA0 A;  4KH0 B;  5DS7 A;  3FEY B;  4JI6 F;  1EAY C;  2F1F A;  1X4B A;  1HAR A;  2Q1L A;  3TAN A;  3W3S A;  5KT3 A;  4U6P A;  3DGP B;  2BJ7 A;  2LEC A;  3GQC A;  1WKK A;  2VQE J;  5LT5 A;  1R8P A;  3G87 A;  2KH9 A;  2FJW A;  3RJM B;  4KH1 B;  5A76 A;  3JYT B;  3HHL C;  2ACM A;  5HRO B;  3UN3 A;  1XK8 A;  2B4P A;  2BXJ A;  3T1H J;  4MKY A;  1P8G A;  2VF3 A;  2HLT A;  1PBU A;  1BE4 A;  5DQI A;  4W4M A;  1W25 A;  2FGO A;  2BW7 A;  3KG0 A;  2OPQ A;  3PIP Q;  1D9A A;  1S97 A;  2EKN A;  4FKX A;  2FZC B;  2EFN A;  3L4B C;  3ET6 B;  2HZV A;  3MPD A;  4OZJ A;  3EJM A;  5SUH A;  3I0S A;  5B7W A;  1NZA A;  1S0M A;  1N4L A;  1LXN A;  3FCH A;  4ZP7 A;  4NXM J;  1GXU A;  4HHU A;  3TRG A;  3R5A A;  4IFY A;  2MPU A;  4K2J A;  4Y00 A;  3OVA A;  4PG8 A;  2A2D A;  4C8K A;  1RAG B;  4OZ5 A;  4GO7 X;  4ZCL A;  4CCH A;  3WZ0 A;  4KO0 A;  4Y6I A;  2I38 A;  4Z7C A;  1LWC B;  4I69 A;  4NCB A;  1IBK J;  3AH6 A;  1CVJ A;  4YY3 F;  2VDH A;  4C8Z A;  2LQB A;  3JB9 k;  4UQG A;  1M1G A;  4P10 A;  2DGX A;  2D7S A;  2HND B;  1F9F A;  4OHZ A;  4NLV A;  4C8O A;  4DR2 F;  4WZM A;  2XWY A;  3JAM U;  4HH0 A;  1LFP A;  2B5J B;  1NUE A;  2ZOF A;  4ZVH A;  4NZ7 A;  2C3M A;  2XMV A;  3BN7 A;  1RB0 A;  2CQ0 A;  1XJW B;  3TW0 A;  4FN5 A;  4ZVT B;  3SCJ E;  2PGC A;  4OX9 J;  3A1Y G;  1RT4 A;  3SCL E;  2CPY A;  3G8T A;  1UP1 A;  5HVH A;  3BPS P;  1FNX H;  2IM0 A;  4NXN F;  4QIE A;  4FYX B;  2HFN A;  3HVT B;  2DGQ A;  4UZB A;  2PDA A;  3RR7 A;  1PCA A;  2K8G A;  4OIX A;  5EWE A;  1MRO B;  1CLF A;  4A46 A;  3A12 A;  4CLK A;  4OV6 A;  3R27 A;  3OHB A;  3CCV S;  4G1P A;  2H3E B;  4WU2 A;  2CPJ A;  2WTF A;  2Z57 B;  2ZC3 A;  1OWX A;  2HS3 A;  4DPX A;  2LU1 A;  1KR4 A;  3T1A A;  3AFG A;  3R6G B;  2HEK A;  1UEU A;  1ZM3 A;  1T9U A;  4JI5 F;  4WFX A;  1XN9 A;  3TYT A;  2CQ1 A;  4FNI A;  4IKA A;  4MK9 A;  1B0T A;  4DHV A;  1U0S A;  1WOR A;  4M5N A;  4YFU A;  4WP8 A;  3MM5 B;  2X7I A;  2AJF E;  1HBM B;  3T1Y J;  5L9X A;  3D1Q A;  3BO4 A;  1RAJ A;  1UZD A;  4C6A A;  2KXN B;  4UY8 T;  1MWY A;  2ZC4 A;  3HVR A;  4DR1 F;  4QIW D;  2D3U A;  2JC1 A;  2C42 A;  1DTQ B;  5CYQ B;  1V5I B;  3CJK B;  3G96 A;  3H90 A;  5KFF A;  1Q82 T;  3MR6 A;  4DR3 F;  3NEK A;  2AZ1 A;  1VHI A;  3SQO P;  1PAU B;  4NML A;  3TO8 A;  5HQM A;  3E2E A;  3ISN C;  3N5F A;  3H5S A;  3DGP A;  1GFW B;  2M52 A;  4WFB Q;  3RB0 A;  1X5P A;  2ERR A;  2M2B A;  2MST A;  4DV3 J;  3TQE A;  3OJU A;  1Q81 T;  3JYT A;  2CQG A;  3R5C A;  2IBO A;  2IPO B;  5HRO A;  4IG0 B;  4WFY A;  4QIF A;  4B3T J;  5I3Q A;  3M8S A;  5C42 B;  1YBA A;  2MSS A;  4X62 F;  3AB4 B;  2UVU A;  1MMN A;  1M5O C;  5J2N B;  2CQH A;  4A8S A;  2CJQ A;  1WD6 A;  2BUN A;  3HK2 A;  2OJ3 A;  3TAQ A;  3Q23 A;  4CT8 A;  3MED B;  4V19 J;  4EYH B;  4HHH A;  4ALZ A;  2EBE A;  3ET6 A;  4IR9 A;  5K8M A;  1E6V B;  1RTI B;  5THW A;  2BDP A;  2QYC A;  3MFI A;  4DX8 H;  2NYH A;  3DXB A;  1U1N A;  3MD3 A;  2JEJ A;  4M1K A;  1AUD A;  2W1B A;  4XO0 A;  4NCG B;  3CIZ A;  1KHW A;  2CDR B;  4J9P A;  1S1X B;  2PT0 A;  1LWC A;  4K2X A;  3DLB A;  3KUH A;  1K8A T;  3MFH A;  2RSQ A;  2FJE B;  3CD6 S;  4R8U B;  1L3V A;  2JH3 A;  4L74 A;  4O3P A;  1YQH A;  2MLY A;  3CC2 S;  3GMG A;  1X31 C;  2IC3 B;  2XHC A;  4Y65 A;  4U7U D;  4EO8 A;  4B3R J;  2HND A;  4B3O B;  4XAK A;  3UPF A;  1X8D A;  3N01 A;  3SV4 A;  3MGJ A;  4C4W A;  4DUY J;  2M0G B;  4OJG A;  4TQR A;  4B3M F;  2B5J A;  1H98 A;  5BR8 F;  5IT9 U;  4C8Y A;  5F9L A;  3CDU A;  3I5A A;  4KGZ B;  4GKJ F;  3MUT P;  5KT7 A;  1XMQ F;  1LQ9 A;  4DFK A;  2OH2 A;  4X4N A;  5F8J A;  9ATC B;  2W9A A;  2PI4 A;  3NGT A;  4K4S A;  3LAM A;  3EVW A;  4RWX A;  4ZOS A;  2OEK A;  3PX6 A;  2B4O A;  1LK7 A;  4DUZ F;  5KFS A;  4XTT A;  1WHW A;  1H2T Z;  3LOU A;  4OJH A;  2ZH5 A;  1KKH A;  4RKU C;  1YDL A;  4DFM A;  2B9X A;  3HVT A;  2MGZ B;  3DI6 B;  2OD4 A;  2JX2 A;  4TU9 A;  4DV7 F;  1U1R A;  3QFW A;  2QT7 A;  4IRD A;  2ILZ A;  3OFF A;  2J7U A;  3Q8S B;  5F0W A;  1MRO A;  3V6D B;  4KQZ A;  4OX8 A;  4UOF A;  2N7Y A;  4LR8 A;  2XMW A;  4OYO A;  2COL A;  3FBC A;  4QYZ J;  2R7U A;  2QIF A;  1LK5 A;  1H2U X;  3J7A 1;  1SJ1 A;  3DFE A;  4WTY A;  2IIH A;  4F2S A;  2BQR A;  4KV8 B;  2ZUG A;  3M1V B;  3OXL A;  1X4D A;  1ICE B;  3DCA A;  3AA8 A;  2QMW A;  3MM5 A;  1BQX A;  1YJV A;  5HQ8 A;  1HBM A;  1TK5 A;  5DQG A;  3PG9 A;  2RDI A;  5ETT A;  2P9E A;  3ELH A;  3FRZ A;  1DTQ A;  5CYQ A;  3CJK A;  1SH2 A;  4QPT A;  1KVI A;  4KSE B;  4W92 B;  5SZT A;  2WB4 A;  4ANE A;  1VQ6 S;  2OD6 A;  1TKT B;  1HW8 A;  1TVR B;  4OJ3 A;  2XGQ A;  4TY8 B;  1IM6 A;  3N5B A;  4JI1 J;  4O3O A;  3F56 A;  4CNY A;  4LRF A;  1ZZN A;  1WKL A;  3E51 A;  4IG0 A;  5EGY A;  2CNL B;  1DZ5 A;  5C42 A;  5BYQ A;  5GMD A;  2EXU A;  1KD1 T;  3CO0 P;  4P2X A;  5J2N A;  5G4D A;  4HI1 A;  3GYX B;  2YQ3 A;  1UW4 A;  5FII A;  4C48 A;  2Y3Y A;  3MED A;  4J9M A;  4PXB A;  4B9L A;  4F02 A;  1TK0 A;  2E7V A;  5L1I A;  2LU2 A;  4ED8 A;  1E6V A;  1RTI A;  5JVG Q;  2WOM B;  1B4S A;  1LFW A;  2DNN A;  1VS3 A;  2HVI A;  3UE2 A;  3T1H F;  2ALY B;  1GQE A;  3R6L B;  1KOO A;  2AYE A;  4NCG A;  1VFJ A;  2CRL A;  5K20 B;  1S1X A;  2ZE2 B;  2AD9 A;  4DSF A;  3OSN A;  1JNZ B;  3K5N A;  4CRJ A;  4ZKA A;  4DR5 F;  4USU A;  3EVM A;  4R8U A;  4WYL A;  3D9B A;  4I6A A;  2QV6 A;  3QMQ A;  3W5Z A;  2IC3 A;  2MY7 A;  2FLP A;  4B3O A;  3BQ1 A;  2DR6 A;  3MR2 A;  3J81 j;  2ZJR Q;  3IWN C;  4QQB A;  1F2H A;  1XR7 A;  2CQ2 A;  3CB4 A;  3RAQ A;  4RBV A;  2XMJ A;  2NPF A;  4KY3 A;  2D3Z A;  1GMW D;  2EFQ A;  2K1R B;  3HSJ A;  2LCW A;  5ETR A;  4I67 A;  1AYE A;  3RRK A;  1Y00 A;  1F0X A;  3SZ2 A;  4AFF A;  4ETZ A;  2MKI A;  1N33 F;  3CD7 A;  4URS A;  3WQP A;  3MXH P;  3K59 A;  3PRV A;  2MGZ A;  2NRE A;  2V8G A;  3DI6 A;  1C4C A;  5KFR A;  1TFY A;  3IXQ A;  2J9C A;  3FRY A;  1QSL A;  3ISZ A;  2OPS B;  4HKQ A;  1TMJ A;  2HRU A;  1N5T A;  4DL2 A;  2MQP A;  3MEG B;  5CAB A;  1JXL A;  3V6D A;  2ZH4 A;  2QL7 B;  3K57 A;  1QSS A;  3LP0 B;  2MQM A;  2HIQ A;  4NA2 A;  4OX9 F;  1R27 B;  2I1R A;  2BE7 D;  4ATN A;  2VA3 A;  4DBQ A;  3MM9 B;  4EO6 A;  1NEE A;  4GKK J;  1GXL A;  4RNN A;  2ZNZ A;  2RS8 A;  4DU7 A;  4FNH A;  3MMA B;  4KV8 A;  2E9T A;  3M1V A;  1UL3 A;  1WHY A;  3THT A;  1HR0 J;  2FC9 A;  1XBW A;  1U1M A;  1H6K X;  4R5P B;  4JI3 F;  3JTO A;  1ROF A;  2L41 A;  1RWN B;  4ZP8 A;  2CVE A;  1RBO B;  1M1H A;  4IFV B;  1FDB A;  2V67 A;  2H5I B;  2BJ1 A;  4ZPV R;  4PR6 A;  4Q44 A;  3H59 A;  4IO9 Q;  3LAL A;  1FVS A;  2G0J A;  1X0P A;  1FTC A;  1KHV A;  5D0E A;  3PHE A;  1B7Y B;  1FES A;  2FJB B;  4CLS A;  5EDW A;  1GMW A;  1RAH B;  1TKT A;  1TVR A;  4TY8 A;  1I51 B;  2E29 A;  2FVQ A;  5KFC A;  4WP9 A;  1ULR A;  1FFS B;  2ZWP A;  4ZN3 A;  3WIV A;  2IDE A;  4ZLN A;  1WSR A;  1WEY A;  3KWM A;  4ZLP A;  1C2P A;  2MEW A;  4G65 A;  5B08 A;  1G2E A;  2XYH B;  3V6K A;  4RW9 B;  2RS2 A;  1KON A;  5GAE I;  3R5J B;  4PPD A;  1U24 A;  1SJQ A;  1NK5 A;  2SXL A;  2FGC A;  3CJQ A;  3AQO A;  2BRK A;  3K5P A;  4NLO A;  2BJE A;  1NJX A;  4RNM A;  4IH6 A;  4LSL B;  4CIO A;  2WOM A;  4B3T F;  2U2F A;  4X66 F;  3UWT A;  3LO3 A;  4MYU A;  4PZV A;  2YX4 A;  2ZE2 A;  1F9E B;  1YHQ S;  4RUB A;  4WFN Q;  1NAQ A;  1JXV A;  3CJ2 A;  2H48 B;  3OHA A;  5MAO A;  5ETL A;  4U7U K;  2MJN A;  4Y0F A;  3BGR B;  4M5G A;  3RBD A;  1RCX B;  1SC6 A;  2F5G A;  1JLE B;  1MW7 A;  1FJG J;  3BO2 A;  3PY8 A;  3P6Y C;  3VF0 B;  3U1L A;  2KVQ E;  2YX7 A;  4OHY A;  5DJB A;  3PAC A;  3THP A;  4AL5 A;  2C2N A;  2WVE A;  1N0V C;  5A2Q Y;  2K1R A;  2ATC B;  4H4M B;  3OFH A;  4L6V 3;  2LDI A;  4OLO A;  4MIW A;  3PRD A;  4B3R F;  4JI2 J;  4LF7 J;  2AYG A;  5K5M A;  2WAQ D;  3K58 A;  4C7Q A;  1KC8 T;  1M5S A;  2NXN A;  2NPI A;  3FQL A;  2M70 A;  2GHV C;  2UUC J;  2VIC A;  2AU0 A;  2VKZ G;  3TZZ A;  1EX8 A;  2OPS A;  1YWX A;  3NMA A;  2R8K A;  1GX5 A;  1CC8 A;  3CMQ A;  1RTZ A;  2XC9 A;  3MEG A;  4K4Y A;  2DGT A;  4ZPA A;  1MSW D;  4X4S A;  1QSY A;  3JSM B;  3I5B A;  5KFU A;  4HR2 A;  4B3S F;  3LP0 A;  2DNM A;  2H65 B;  1X7V A;  2XSF A;  4P71 A;  5L39 A;  4K5S A;  1NSQ A;  3MM9 A;  5DG9 A;  3RW6 A;  1VQ8 S;  1Z2Z A;  2H54 B;  1FRX A;  1YJU A;  1NDC A;  1Q7Y T;  4KE5 A;  2R2T A;  1RWX B;  1S0N A;  3AQP A;  3MMA A;  2HHQ A;  5I3U B;  1RLD A;  1VHF A;  3V81 B;  1ITP A;  2VH7 A;  4R5P A;  2A6M A;  3R5B A;  5GAD U;  3FCV A;  4NE9 C;  2Z2M A;  1Y5N B;  4IFV A;  5J2Q B;  3FSI A;  4H4K C;  4J9R A;  1RAE B;  1S10 A;  4ZVF A;  3L09 A;  2D1C A;  2H9Z A;  2Y1L B;  3PNI A;  3KLG B;  1MU2 B;  1F1B B;  4E8U A;  4F4A A;  1YVF A;  2Y1J A;  3D68 A;  2O67 A;  3F73 A;  2JVR A;  2QE5 A;  3A13 A;  4A8W A;  3KYL A;  3QNW B;  4LSZ B;  1N5V A;  5A6P A;  2KJV A;  6FD1 A;  5HAO A;  6AT1 B;  5A8K B;  3N6M A;  3H7H B;  2HQG A;  1YRT A;  4DPU A;  2VG6 B;  5AJ3 F;  4UOG A;  4GC6 A;  2QA4 S;  1GEH A;  2XCP A;  2AYB A;  2UU9 F;  4OYX A;  5J2P B;  2CWK A;  4RW9 A;  3MEK A;  3L7U A;  2AV5 A;  4NEY A;  4M5I A;  1L3U A;  2YQ1 A;  1TAQ A;  3IR7 B;  1RYR A;  5DLG A;  3BKT A;  5DGB A;  4NYZ A;  4K5R A;  4JOU A;  3IR5 B;  4LSL A;  4PXC A;  3AT1 B;  5H9E K;  2A0F B;  4DPY A;  1QE1 B;  2E9Z A;  3NS5 A;  2MY8 A;  3M32 B;  2I0X A;  3W8P A;  1YTY A;  3QFH A;  6FDR A;  3G8S A;  2FB0 A;  2RRA A;  5KFE A;  2V68 A;  4XK8 C;  2W7O A;  3HI9 A;  1P6T A;  3KG4 A;  1ZYQ A;  1T9T A;  1JLA B;  1S99 A;  2XBP A;  3BGR A;  3PX0 A;  4LVO P;  2WRM A;  2VON A;  5DG8 A;  4J91 A;  3Q8Y A;  5E5N A;  5LXR A;  3Q2S C;  4TVA B;  4WBF A;  1JLE A;  4BLG A;  1MMD A;  5LXY A;  3KDO A;  3DYA B;  2I2Y A;  1ZAW A;  1VK3 A;  2M8H A;  3M2R B;  4DV4 J;  3V5R A;  1FXD A;  3VR1 A;  1O5J A;  3LWL A;  1IBM J;  3UI3 A;  2V4Q A;  4V19 X;  2IA0 A;  4H4M A;  3PW7 A;  2QGF B;  5RUB A;  4K50 A;  4I2Q B;  2MB0 B;  2Z30 B;  4YDD B;  8RUC A;  1UVI A;  2OTL S;  4LR9 A;  4I0W A;  4AUK A;  3FDS A;  4DR7 F;  1RXO B;  1R0C B;  1I94 J;  3DRS B;  2KJW A;  3RBX A;  2N3L A;  2GAH C;  2CPH A;  2G0C A;  4CLZ A;  1TL5 A;  1HWI A;  1C1C B;  4DOZ A;  3KUG A;  3MTJ A;  4ZIT A;  1GAO A;  1FD2 A;  4RO0 A;  1YJR A;  3NG8 A;  3JSM A;  3UCG A;  8AT1 B;  2VFS A;  5L1J A;  3HPO A;  4DFP A;  3T5J A;  1TR0 A;  1HBN B;  1TL1 B;  1XMO J;  2FDN A;  4NLQ A;  4OHX A;  1X5T A;  3EXY A;  3Q22 A;  3PHT A;  1YBU A;  2XS7 A;  2AWZ A;  3Q2T C;  2XO6 A;  3GV5 B;  4DQQ A;  1PGZ A;  4LRB A;  3PO5 A;  5KG3 A;  3IM8 A;  5I3U A;  1UAW A;  2GA7 A;  3V81 A;  4E98 A;  4K4Z A;  4CLP A;  2D9P A;  2RUG A;  4YN3 B;  5J2Q A;  1EKR A;  3IP0 A;  2QC3 A;  3LH2 S;  4RL1 A;  3BKF A;  1ZA1 B;  2Z4P A;  1MU2 A;  3KLG A;  3I55 S;  1F5B A;  3BN4 A;  1ACM B;  2ZH7 A;  4OYI A;  3LP2 B;  1RAB B;  4O4R A;  4Q43 A;  1M5V C;  4CM0 A;  5IWA F;  1SB6 A;  1CJU B;  1HR0 F;  4Y34 A;  5IM0 B;  1RHJ B;  1H38 A;  2RT3 A;  2DR5 A;  1N32 J;  5A8K A;  1UMJ A;  3BQ0 A;  1KBR A;  2HFS A;  2VG6 A;  1RA7 A;  1JMT A;  4OYM A;  1XMB A;  2FQQ B;  1FT8 A;  5KG6 A;  1N0U A;  3HF5 A;  4P74 A;  5CHC B;  5J2P A;  4X4Q A;  2E1R A;  3GFH A;  2JLG A;  3DMJ B;  3FBF A;  4U96 A;  4KKO B;  3ZXW A;  5EWG A;  4LF6 J;  1HNV B;  4DMZ A;  2R4F A;  4LF8 F;  1NKB A;  2J0Q D;  1H72 C;  3RYL A;  4WCE Q;  2L9N A;  2OFH X;  2VPY B;  1K47 A;  3TAR A;  3B4D A;  4K0K J;  1QD1 A;  4MAK A;  3SYZ A;  3DRP A;  1SKW A;  2CQ3 A;  3CO9 A;  3ZZZ A;  2HK3 A;  3IO1 A;  1QE1 A;  2APO A;  2X1B A;  3M32 A;  2L9D A;  5JUM A;  1QAX A;  4YEA A;  1NM2 A;  2GGP B;  2WVB A;  4ZVS B;  4XDD A;  1BLU A;  2FC8 A;  2VV5 A;  2JSX A;  2JEI A;  3BYR A;  4KRW A;  4OYP A;  2BEF A;  5CYM B;  1H74 A;  5KFX A;  5T41 A;  5KFH A;  3DU6 A;  5KT5 A;  1EB0 A;  4PUO B;  1XQI A;  2GIF A;  1JLA A;  3JSB A;  4OQJ A;  5F8L A;  2VPZ B;  3PJW A;  5LOQ A;  1SCJ B;  3MAH A;  5D4L A;  5AXM A;  1QM9 A;  3DYA A;  5DDR C;  3M2R A;  5E33 A;  2MMY A;  2WW4 A;  1UWA A;  1RKI A;  1IVZ A;  4OHV A;  3UD3 P;  5E7O B;  1NRK A;  4USH A;  3LWM A;  3ZFV A;  3VAM A;  4JI4 F;  3VAI A;  2C22 A;  2GJI A;  2FJX A;  2V9K A;  4I2Q A;  3VHQ A;  2GJF A;  2E5G A;  3T9N A;  4NLG A;  1JJ2 R;  3DRS A;  3GON A;  3J7Z 5;  4J9L A;  1XER A;  3WX4 A;  1C1C A;  1Y3K A;  1NLK L;  3GSI A;  5IQ6 A;  2DGW A;  2W9C B;  3MCS A;  3QIP B;  1TL7 B;  5LMN F;  1VIO A;  2OO4 A;  4Y28 C;  5F8H A;  3CC4 S;  4WU3 A;  4JI2 F;  1DY3 A;  4LF7 F;  1HBN A;  1TL1 A;  5GAG U;  4ZVE A;  3CSK A;  3T19 A;  2DNR A;  5CQG A;  4XPE A;  2V4J B;  2XLK A;  2PEB A;  4F36 A;  1R0A B;  3EUN A;  2MKY A;  2DYA A;  2V34 A;  2HAF A;  1U48 A;  2OKQ A;  2HHV A;  3O5T B;  3C15 B;  3I4H X;  3G6X A;  2PO4 A;  3HHE A;  2JFD A;  4LFA J;  1NJI T;  3QRR A;  5HO4 A;  3IWL A;  4DX5 A;  1DQ9 A;  2B4V A;  2EG1 A;  1Y5I B;  1NK6 A;  4LVN P;  2P6S A;  3PW4 A;  3TVK A;  4HI2 A;  3LP2 A;  1S1U B;  2OI2 A;  1IUJ A;  4EU0 A;  5L8R C;  3QT8 A;  1CJU A;  4CO3 A;  4LBI A;  2DVI A;  4HVZ A;  2HFU A;  4FYD A;  1BY9 A;  5IM0 A;  4JI0 F;  3OXF A;  2J9D E;  4F8R A;  3ZZU A;  2UV8 A;  1R31 A;  4QU6 A;  2NXC A;  2BM1 A;  1RHK B;  3KLF B;  3ILJ A;  2E9R X;  1U25 A;  2ZFH A;  2HNY B;  1RT2 B;  3TEH B;  2WK4 A;  3HVW A;  1RT5 B;  4C8N A;  1H0H B;  3DMJ A;  1K44 A;  2PSZ A;  2CAD A;  2UUA J;  4KKO A;  1HNV A;  3BM7 A;  1QUV A;  4HEA 9;  3NS6 A;  2HWI A;  1HNZ J;  2CQP A;  2E66 A;  3NAI A;  3OXG A;  2A10 A;  2ROE A;  3UQS A;  2YWE A;  2Z2Y B;  1T11 A;  4ED6 A;  3CUN A;  2Z2L A;  2AHO B;  3V6H A;  1RU2 A;  3TA1 A;  3K5O A;  3QID A;  5F41 A;  3MHY A;  2ADB A;  4OI1 A;  1VK8 A;  1CC7 A;  2BAC A;  2GGP A;  4RLE A;  1Y0H A;  1YJN S;  3ONQ A;  1R8A A;  2G13 A;  5IXU A;  2YWW A;  4X4V A;  4JYA J;  5HMY A;  1C0U B;  4NL5 A;  5CYM A;  2DJW A;  4PWD B;  4MKV A;  2L08 A;  3EWG A;  4PUO A;  3CDW A;  3HSZ A;  1VIX A;  5FD1 A;  2FVC A;  2WBM A;  1V3Z A;  3FEZ A;  1F2G A;  1RLC L;  2GVZ B;  4ETX A;  1FER A;  3W5Y A;  3J80 Y;  3K5M A;  3B6B A;  2DNY A;  2CZ9 A;  3VV2 B;  4J90 A;  4UUW A;  2YH1 A;  4OV1 A;  3FSX A;  3WBZ A;  1UFL A;  4QYR A;  1M1K T;  3N9U C;  3L3C A;  4LRE A;  4RBU A;  1TUW A;  2QLB B;  4J7C A;  2ZBI A;  2X3D A;  1UVJ A;  3MOJ B;  2QN6 B;  2DT9 A;  4PYA A;  3OFE A;  4PCQ A;  2DKO B;  1YLX A;  1U7L A;  1C4A A;  4DV4 F;  2AJ0 A;  4ZVU B;  5IQQ A;  4UTG A;  1IBM F;  4UOC A;  1KTQ A;  1YIJ S;  2OEJ A;  5CCM A;  2A1B A;  4DV2 J;  2KHD A;  2CYY A;  2F4V J;  3OL6 A;  5IV3 A;  4EBD A;  5F0U A;  5D3G B;  3ZNJ 1;  3IBF B;  2W9C A;  1J5O B;  3QIP A;  2BQU A;  1TL7 A;  2YNH B;  3G6V A;  1BWV A;  3JSR A;  3CCS S;  3PR5 B;  3R7S B;  5HN0 A;  3GFX A;  3ZZT A;  1RHR B;  4ZIW A;  3CJS A;  2WHO A;  1TKD A;  4CLY A;  2M9K A;  2V4J A;  2W7P A;  1R0A A;  1JNR B;  4X65 F;  4ED0 A;  2AMC B;  3GIL A;  3W62 A;  3DRR B;  3BDE A;  3IRW P;  4RW6 B;  3C15 A;  1G3O A;  3SDE B;  5J1N A;  1NK8 A;  4UY8 5;  2XZW A;  3CME S;  3I96 A;  1TFW A;  1M5K C;  3UDL A;  2NUH A;  2RVJ A;  3C66 A;  4ILL A;  3Q8Q B;  2KYZ A;  2O01 C;  1RZM A;  2C1E B;  3GLJ A;  3R7N B;  1CJK B;  1LWF B;  3AJ1 A;  2QO3 A;  1S1U A;  1XTZ A;  2IRU A;  3CCE S;  3R9L A;  4EEY A;  3EZO A;  5HBM B;  2HS4 A;  1JK9 B;  1MWQ A;  4EI2 A;  4DR6 F;  3IWX A;  5H1S V;  5KFL A;  4F4Z A;  4TNO A;  4OJ1 A;  4C0B A;  4K4X A;  3F44 A;  4F4Y A;  2R7R A;  5FLX Y;  3CW2 C;  3EDQ B;  5KFN A;  3I9Z A;  1VI7 A;  3OSP A;  3KLF A;  2HNY A;  2ZBC A;  1RT2 A;  2Z58 B;  4WIQ A;  4ER8 A;  5KFO A;  1JX4 A;  3TUP A;  3GPA A;  2IM3 A;  4YB5 A;  1IWA A;  1RT5 A;  4TY9 A;  4F3O A;  1RU1 A;  2W8L A;  1SJR A;  3WDO A;  4DL6 A;  3M2V B;  5M2P A;  1A6L A;  1WF2 A;  4U7C A;  4JI7 J;  3D3C J;  4F04 B;  1D9F A;  5HQL A;  4DR4 J;  1KLM B;  2HFV A;  2DHX A;  2DIU A;  4EWT A;  1WF0 A;  3BZQ A;  1FRM A;  4IOC Q;  2V8H A;  2GIR A;  3M8W A;  4KGM A;  2BM0 A;  2YKN B;  2XS2 A;  3J7A N;  1NHV A;  1C0T B;  2DR8 A;  3CCW A;  2D74 B;  3HHK A;  3S6E A;  3QGP A;  5KOW A;  3D6M B;  2OPR B;  3MPU B;  1U4B A;  4HTI A;  3W2V B;  3BYP A;  5C2G A;  1HI0 P;  4LFC F;  2GQQ A;  1LW0 B;  2FZK B;  2Y0B B;  1C0U A;  2LMI A;  2HZC A;  4PWW A;  4PWD A;  5ETV A;  4QJV A;  4Q8E A;  2KZZ A;  2CQD A;  3PFO A;  2AX1 A;  4KHM A;  3ETO A;  2GNK A;  2HBY B;  1UET A;  2LQ8 A;  5HVF A;  4RNF A;  2IFX A;  2IMO A;  3VCD A;  4AXJ A;  2EI5 A;  2GVZ A;  1NHK L;  1SJ3 P;  1N54 B;  4UW2 A;  2YVS A;  4X64 F;  4ED5 A;  3U1N A;  3H25 A;  4H4O B;  4USK A;  2YPY A;  1RWU A;  1JJ4 A;  3D7S B;  1F3V A;  4TYB A;  1WF1 A;  4WK1 A;  4Y2C A;  2BKN A;  4DWI A;  2QG9 B;  1P9Q C;  4AL7 A;  1RWM B;  4LF4 J;  2GV1 A;  3EVO A;  2DR9 A;  1Q79 A;  2G9O A;  2EFP A;  3KHG A;  4Q0B B;  3BBF A;  5A2Q U;  4RNO A;  3UO0 A;  4FBU A;  1V5V A;  3R5D A;  1I5O B;  2ILY A;  4UOH A;  1HNX J;  2XLJ A;  3FK4 A;  1IBL F;  1S0O A;  4DV1 J;  2VC1 A;  5D3G A;  4TYA A;  2YH0 A;  1J5O A;  2EC2 A;  2VKR A;  1HI8 A;  2YNH A;  3TJA A;  5HP1 B;  3TWZ A;  2Y8W A;  4HLB A;  5AT1 B;  2E1A A;  1FK9 B;  1N5S A;  1PJ5 A;  4LIW A;  4LQ3 A;  1UWB B;  4WWS A;  4FYV B;  3BSO A;  3V4I B;  2A2C A;  2HWH A;  1HNW F;  2AGO A;  5L38 A;  2DNG A;  3J7Y U;  4PEO A;  2OSQ A;  1MN9 A;  2DIS A;  2YKO A;  3DRR A;  4DLG A;  4JV5 J;  4Y2A A;  1UFK A;  4RW6 A;  3HFZ B;  3SDE A;  2RE1 A;  2R7S A;  1BQM B;  4DLE A;  2GS8 A;  3R3T A;  5B0F A;  1FVQ A;  1FRK A;  7FD1 A;  2OPQ B;  4ZPD A;  5HSP A;  4TLR A;  3H4B A;  1HIY A;  4F4K A;  1IKX B;  1CG2 A;  3HDS A;  2DGO A;  5JJB A;  1CJK A;  1LWF A;  1SQG A;  4L75 A;  2WCX A;  5D6G A;  3UDV A;  5HBM A;  1VQ9 S;  2J76 E;  3J81 Y;  2V9W A;  3W60 A;  2GHP A;  3KXD A;  3QSI A;  2HPU A;  1K1S A;  1X4C A;  1R8H A;  5IT0 A;  4DUT A;  2XMA A;  1CS4 B;  2KT2 A;  3G71 S;  3HD1 A;  2J9D A;  5H9F J;  3QT5 A;  4CLL A;  1N5Y B;  4NZ6 A;  4C3L A;  2MZJ A;  2CA9 A;  1RHM B;  3M2V A;  3QPI A;  2NZ4 A;  2OLW A;  2C2Z B;  1J5E F;  3MR5 A;  1T7P A;  1KLM A;  1U02 A;  1X4G A;  1FRL A;  1J2V A;  1RHQ B;  2ZBR A;  3A8I A;  1H7W A;  2YKN A;  4L3N A;  4DL7 A;  2ASY A;  1C0T A;  2OP5 A;  2KO1 A;  3PV8 A;  2W8K A;  3TNV A;  4DSK A;  2JEG A; 
#chains in the Genus database with same CATH homology
 3GJS B;  1I51 B;  3QNW B;  4DCO B;  2H48 B;  4ZVU B;  4LSZ B;  4ZVQ B;  2XYP B;  1RHU B;  3KJN B;  2QL5 B;  1RHJ B;  2CNL B;  2QL7 B;  2Y0B B;  2XZD B;  1I3O B;  2H51 B;  4DCP B;  3NS7 B;  2XYH B;  3R6G B;  3GJR B;  2H65 B;  3IBF B;  2HBQ B;  2H4W B;  1RHK B;  3EDQ B;  3GJT B;  3KJF B;  2H54 B;  2FQQ B;  1RWK B;  2CNO B;  2H4Y B;  2C2K B;  1RWW B;  2QLJ B;  2HBY B;  1BMQ B;  1RWO B;  3R7S B;  2HBR B;  3P45 B;  3GJQ B;  2H5J B;  1RWX B;  3R5J B;  1ICE B;  1SC3 B;  3IBC B;  1RE1 B;  1RHR B;  3P4U B;  2QL9 B;  2CJX B;  1QDU B;  1RHM B;  4ZVO B;  4ZVT B;  1RWN B;  5IC6 B;  1IBC B;  2C2O B;  3EDR B;  1RWV B;  2XZT B;  1RWP B;  2C2Z B;  2H5I B;  4JB8 B;  2QLF B;  1SC1 B;  2HBZ B;  3D6F B;  3SIP B;  1SC4 B;  1QTN B;  3R6L B;  5IC4 B;  2QLB B;  2CDR B;  1NME B;  2CNK B;  2CJY B;  1RWM B;  2C2M B;  2Y1L B;  1PYO B;  4DCJ B;  5K20 B;  2P2C B;  1RHQ B;  1PAU B;  3RJM B;  1F9E B;  3D6H B;  3KJQ B;  1GFW B;  2CNN B;  4ZVP B;  4ZVS B;  2DKO B;  3D6M B;  4ZVR B;  2C1E B;  2XYG B;  3R7N B;  3R7B B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...