2QLBB

Crystal structure of caspase-7 with inhibitor ac-esmd-cho
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
92
structure length
92
Chain Sequence
KIPVEADFLFAYSTVPGYYSWRSPGRGSWFVQALCSILEEHGKDLEIMQILTRVNDRVARHFESQSDDPHFHEKKQIPCVVSMLTKELYFSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Plasticity of S2-S4 specificity pockets of executioner caspase-7 revealed by structural and kinetic analysis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Caspase-7
total genus 18
structure length 92
sequence length 92
chains with identical sequence D
ec nomenclature ec 3.4.22.60: Caspase-7.
pdb deposition date 2007-07-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 2qlbB00
3NS7B 2CDRB 4DCOB 2C1EB 1IBCB 1RWNB 1SC4B 1RHJB 1QTNB 2CNNB 3IBCB 2H5JB 1I51B 2Y1LB 3D6HB 3GJQB 1SC3B 2XZTB 1SC1B 2H4WB 4ZVUB 5IC6B 4LSZB 3GJTB 3R6GB 3RJMB 2C2OB 1RWOB 3KJQB 2H5IB 4ZVPB 4ZVOB 3EDRB 1RWMB 2XYHB 1RE1B 1RHRB 1F9EB 4ZVQB 3SIPB 2H48B 1RWWB 5K20B 2QL7B 3R6LB 5IC4B 2H51B 2H4YB 2XYPB 2CNKB 1RWXB 1RHKB 3R7NB 2HBZB 3EDQB 2H54B 1BMQB 1RWKB 1ICEB 4ZVTB 3GJRB 3D6MB 4JB8B 4DCPB 2FQQB 2HBYB 1GFWB 1NMEB 2HBQB 3P45B 2CJYB 1PAUB 3R7BB 2P2CB 3D6FB 2QL5B 3QNWB 1I3OB 2DKOB 1RHUB 2QL9B 2QLFB 2QLBB 2CJXB 3KJNB 3P4UB 2XYGB 2C2ZB 2Y0BB 2C2MB 2C2KB 2HBRB 4ZVRB 3R7SB 3KJFB 1QDUB 2H65B 4ZVSB 4DCJB 3R5JB 1RWPB 2CNOB 3IBFB 2QLJB 1RHMB 3GJSB 2XZDB 1RHQB 2CNLB 1PYOB 1RWVB
chains in the Genus database with same CATH superfamily
3IM8A 5GAGI 1U4BA 1VS3A 5LXYA 1NAQA 1LK5A 4Y3CA 1RTDB 1R8PA 3NG8A 1S1VB 4JI8J 3UN5A 4JV5J 3C15B 1IKVA 3MD3A 3MTKA 2CQCA 3B4DA 4MK9A 1NDKA 1HI0P 4FF1A 1WOOA 5LL6d 3GYGA 4P74A 1IBKJ 2RF2A 4CNZA 3I87A 4WFYA 1N32F 5L9XA 3ZZYA 3VAGA 3PEJA 2ROEA 1TK5A 2WBMA 1SI9A 1JXVA 2QV6A 4LF5J 2LQ5A 1WI8A 2CNNB 2VG6B 2R8IA 2HFZA 4DL0C 2RD5C 1DJ0A 1UTAA 1CSJA 1RTHA 3HP6A 4NCAA 1RA7A 5KFRA 3PRBA 2B9WA 1V3RA 1TL5A 5A0YA 3NWGA 1SC3B 1ZZFA 2XBPA 3IWXA 3CJRA 1E6VA 3P5BP 4A48A 2BR0A 4ELVA 4F8RA 1BC6A 1UEUA 2KRRA 2QMXA 1SXLA 2YWFA 3EVWA 3BM7A 3N0VA 4XK8C 2VG5A 5HMZA 3PW0A 2AEJA 2R7QA 1XK8A 2AJ2A 1UKUA 2E1AA 2PT0A 5KT6A 3OFGA 1HFEL 2XY6A 4KC5A 4LSNB 1JIHA 1VQSA 3DXBA 3KDNA 3QIPA 3FK4A 1KC8T 1RYRA 1REVA 3JAMU 2XNQA 4WYLA 1VC6A 1SVDA 3D0HE 4LFCJ 1UEVA 3I5CA 1TVRA 2Z56B 4QJVA 2HFUA 3CCRS 1WC3A 3I9ZA 1WEXA 1YGYA 4ES2A 5E5NA 4ZJOA 3KLEB 4I2PB 2HFNA 1OY6A 2YH0A 4AE5A 5K20B 3TUPA 5F8LA 4YOEA 4OX8A 2Y8WA 3FEZA 4C11A 1HNWF 1BE4A 2H4YB 3NCQA 5EX3A 2QO3A 3HHEA 5IXUA 3KNAA 1ZPWX 2HRYA 1NK5A 2FGCA 1S0NA 3KHRA 3FKBA 1J5EJ 4EO6A 2AW0A 4NI2A 1YJ9S 2X1BA 1R31A 3SFGA 4X65J 1LOUA 2ALZA 1F2HA 1QJHA 1A6LA 2MJNA 2FZKB 2EXUA 2HLUA 3G87A 1VFJA 4DV0F 5FJ4A 3H4DA 3CDWA 1X4EA 4NXNJ 1X9WA 1S1UA 4FPRA 3RRKA 2XQCA 1NK0A 5AXKA 4ZCLA 5MAOA 3CWJA 2JLGA 2N4DA 4A8SA 1TFYA 3CE8A 3ZTRA 1T03B 1FFWB 3KWMA 1HNIB 3N01A 4MYUA 3DHWC 3DRRA 3NGTA 2V9WA 3PM9A 1R3NA 1T8EA 4F02A 4FP9A 5A6WA 3OL7A 2MDAA 4USVA 3UQSA 2YH1A 2XWXA 2Z2MA 4KFBA 4YQWA 2FHKA 4CQ1A 3M9OB 3QPIA 3GONA 3C46A 4F3QA 4LSLA 1KKHA 1KOOA 2GMHA 4K7QA 4PCQA 4RR5A 2KFYA 2J6UA 4FF2A 2IJRA 1VIOA 3M7VA 3PV8A 5CA5A 5LSOA 4DR5J 4RUCA 2WAQD 4PXCA 2FZGB 2HFVA 2W1BA 2MHNA 3DYAB 1D09B 4USTA 2DRBA 3WC0A 3NAHA 2GO9A 1Q8KA 1R8BA 3Q8YA 4G65A 4J9VA 2WZ1A 3M2VA 2EFGA 2UXDF 2QG9B 4JI5J 3E2EA 5J2QA 1LV5A 3OTOJ 4IDKA 1N5SA 3TZXA 4K4XA 5ITHA 2D1CA 3MMAB 3MXHP 3AJ2A 4JI4F 1WUUA 1RAHB 3GLJA 4KKOA 4NLYA 3TR5A 3HSDA 1UJ5A 4LF8J 5IWAF 3QIPB 4FYVB 2QLJB 4TQSA 3RBEA 1DLOA 1F3VA 2WVBA 2B43A 2V8DA 3DU6A 4TLQA 5CYJA 1RQ0A 2YKNB 2ZM6J 2BE2A 2DCUB 4KJIA 5D6GA 3KK1B 1HWLA 2UXDJ 3TZZA 2GJFA 5DLGA 2PI4A 1HQUB 4DCOB 3F0NA 1N88A 2OELA 3U02A 4CLTA 2EI5A 1T94A 3ZTPA 3RZAA 5DGBA 3JSMB 3CCJS 4KAIA 4YEAA 3BO3A 1UVKA 2HLTA 2DGOA 5I4MA 2DNNA 2CXEA 3HSZA 5EDWA 2HQ3A 4I2QA 1RWNB 2HPUA 4NMLA 2VJVA 4FYYB 2I5JA 4ECRA 4NLWA 3C6UB 5KFGA 4YY3F 1ZZNA 3BYPA 1LFWA 5SZTA 4PKDB 3EPIA 4KGXB 3D0IE 4LF7F 3IBCB 3JSMA 2WONA 3ISND 1IQTA 4G3IA 4DR1F 2GZOA 1T0TV 3ETMA 3NNAA 2XHCA 1TL3B 4IH7A 4A8QA 4F7VA 4A8MP 1S1UB 3PXGa 3V5RA 4F04B 2HAIA 3KLFA 2V34A 3MOZA 4DQPA 4NLOA 2OD6A 2YNHA 3PDNA 3H4BA 1NDCA 5HI7A 4WTYA 1SL2A 1VQ4S 3H90A 1BWEA 4IRCA 1Y10A 3T5JA 2IMWP 1HNIA 1NUEA 3VWSA 3J7YI 1RCXB 3CNQP 2V4QA 2DNPA 2W7PA 2DGUA 3HHDA 3BH7B 1FWPA 5F8NA 1AW0A 4WFBQ 3W9JA 1GAOA 2R7WA 3QRRA 4OX7A 1FHTA 1CJKB 4DFPA 1S9FA 1UVJA 1YSJA 3LUYA 2XEXA 2X1GA 3D3CJ 3IAS9 4K4VA 1KFDA 2B8PA 3H5UA 2K1RB 4MFBA 5FDLA 1PJ7A 3TZYA 5AJ3F 4B3RJ 1APSA 2C3OA 5IT0A 3MPVA 1HMVA 4LQ9A 2NUUG 2GIRA 4OZ5A 3EGWB 1C1CB 2DNYA 3HFVA 2BOAA 1RT7B 5KG4A 4WZQA 2R2UA 2RQKA 1MW7A 3GWCA 3GFYA 2PMZD 1ICEB 3W7BA 4F50A 2BJ8A 5D8HB 1NJIT 2C28A 1UP1A 2VPZB 2Y1IA 3OTOF 1U48A 2BJEA 3P45B 3R7BB 1PAUB 4OL8A 2F8EX 3KJVA 3UW1A 3JAMY 5AXMA 1NRKA 3M8YA 2DNOA 2IVYA 2M52A 3FZBA 4WFAQ 3M9NB 3GIKA 4PZVA 5F3TA 4FF3A 2VKZG 4NLSA 1LW0B 2G9OA 2CQ4A 2DHSA 5BYSA 2W24A 1WG4A 2HSEB 4DL2A 4QCLA 2VD3A 2Y0BB 4NMXA 3BREA 2ZH8A 3RAXA 2CJQA 5J2QB 1ZM2A 4M5LA 3PYEA 2UUBF 1R8HA 1U2CA 2HQIA 2ZKUA 1P9YA 1Q79A 3CDAA 2VH7A 3GG1A 2CRLA 1KP6A 2WSCC 2ZBRA 2E5GA 3KNGA 3R7SB 2QZ8A 4FVMA 3GV5B 3G9CA 2BYCA 5KFHA 4W90B 2C3PA 1CLFA 1UFLA 2CKWA 4K0KJ 2V50A 1FKOB 2H65B 1Q16B 2L48A 1RTIA 2KG0A 1TMJA 1UW4A 1FRIA 4HTJA 1SC6A 3ZZUA 3C3LA 4X4VA 2AZ1A 4DR2J 5KAKA 4NRTA 4ZPCA 2MQPA 1S1VA 2N4CA 2U1AA 1ZAWA 5F8HA 1VRUB 3S8SA 4YS2A 1YTYA 2VDHA 4U96A 1Y9OA 4AXJA 1RTIB 4DZ6A 2G2ZA 3G82B 4F4WA 3UD5A 3OL9A 1M1GA 3TW0A 2CA9A 1FXDA 3OTCA 1B7FA 4HKQA 2EG2A 3EVMA 2BRKA 1WSRA 3LTOA 4ECTA 3HCXA 4ZS6A 4YB7A 3GYNA 2BXJA 5ETOA 4Q45A 1BLUA 1H2UX 1FX4A 2C1EB 1NLKL 2DNGA 3AXMA 3BKUA 2WTFA 2RE1A 2G13A 3MM9B 2Z58B 1TKTA 2I1RA 4ZLJA 1CS4B 1P1LA 1P27B 1S1WB 2OPRA 2JFDA 1RHJB 2W2OP 2ZFHA 1RT3B 1S6OA 3PACA 3QGIA 2J0QD 4MMOA 1KEKA 1XNQJ 5CYMB 1D8YA 2QTWA 1A0OB 2VG7B 4LF9F 3V6HA 4DPOA 3MR3A 1HLWA 2EW9A 4L6V3 4NLDA 3G8TA 3TJAA 1J5EF 3HVAA 3OVSA 2HNZA 4ETXA 4NOHA 3PEHA 2MXYA 4RWXA 2ZBQA 4ZPBA 4F3MA 2GFFA 3M6UA 2E9ZA 2CQ3A 2CJBA 2E29A 2LLZA 1TTHB 5T14A 2HHTA 4OV6A 3A3NB 3AHPA 3ELHA 2ZDOA 4FZVA 3TZWA 4DQSA 4QYZJ 1U09A 3R9LA 2L3MA 1H6KX 3ZO7A 4ZCMA 3V4MA 1N32J 3VGTA 2ZWOA 4C4WA 1RE1B 1NB2A 3PX6A 3A3OB 3HMJG 3KHHA 4F0MA 2GAGC 5EWGA 1YBAA 4J9SA 1HD1A 2PE8A 4EMDA 6FD1A 3BDPA 3ILOA 2VBXA 2FIUA 1F5AA 2DHXA 1I94F 4USJC 4Y6IA 8AT1B 4RU9A 3R6LB 3K2YA 4YN3B 4BDPA 2EPIA 4CNYA 4TQRA 3PX4A 2CIMA 2CPDA 3QWUA 3ZXWA 4A8XA 1RLCL 1I6JA 1YX2A 4K59A 1IKWA 4NYZA 4OIXA 4C3KA 2YNIB 3LH2S 1RWKB 1HYSB 3X1LB 1RB0A 3Q8QB 3TYTA 2FQQB 1P8GA 2ZC3A 3KK2A 3O2IA 2V5HG 1RBAA 1L3UA 1TAUA 3OR1B 1FKAF 4LMZA 4NX9A 4ANCA 1LWFB 1OY8A 1GXUA 4LJMA 4M5KA 2EVZA 5HVFA 3QNWB 3S7RA 2FVPA 2JSXA 1ZETA 4QWEA 1H7WA 5GAHI 4MTPA 5C2CA 3VGSA 5HL7Q 3K59A 4DLEA 1ELOA 4B3MF 2MY7A 1NKBA 3R8YA 5L38A 3K57A 4JI7J 3Q83A 1T3OA 3CTRA 3IGNA 3RBDA 3OJSA 1WOSA 2Q79A 3MM7A 4IH6A 4QWBA 3T1YF 4M94A 4C8ZA 4MYTA 1N33J 5L1KA 3B82A 3BBBA 4OZ0A 2PD1A 3MTJA 2J7WA 4U8YA 1S49A 1UCNA 3AXKA 3R5AA 2VG7A 2PDAA 2V69A 3LPYA 3O3LA 3SQOP 5GAEI 3BJYA 4LFAF 4OI1A 3BQ0A 1KWMA 1HMVB 1XR5A 2FTRA 3IR6B 1RACB 3BQ2A 1NK9A 5IS2A 3SSSA 1QDUB 2GX8A 1S72S 3UDEA 2ZZNA 1NDLA 3D4JA 4NEZA 3R5JB 2AGOA 3DRXA 1RT7A 4ED5A 2V2ZA 2QIFA 3UO0A 2CNOB 4KT0C 4R5PA 3MUMP 2G4BA 4QU7A 1WHWA 4EK2A 5E3RA 2MQNA 3IBFB 3TQEA 5IZHA 1X0FA 5DDQC 4TNOA 2VQFJ 2HHHF 1XQIA 3C6TB 1TKXA 2B3TB 2XZDB 2MKYA 3MR7A 2K3KA 4WK3A 3W8GA 2FPHX 2JEFA 1JLQA 2C3YA 1TELA 4H4OA 4NE9C 5HQLA 1BHNA 2F63A 2DO4A 2OPSB 3GR1A 1HARA 3LPEA 2MQQA 3PCOB 1SV5A 2ZJQQ 3SCLE 3A3PB 1WKLA 2QSFA 3FSXA 4OMFG 2WSFC 3TA1A 1B7YB 4K2XA 1WF2A 1LWCA 4C2MA 3DLEB 4EU0A 4MKAA 1YBUA 3KXDA 3IGVA 3LOUA 5A76A 1RT5B 5D4NA 3D5MA 4A8WA 4NI2B 1QTNB 1S7IA 4XDDA 2ZJPQ 4X4TA 1W25A 2ZWPA 3NS5A 5L1IA 2XMVA 1EP4B 5ETMA 2W9BA 1F3FA 3FGVA 2FHJA 2VDIA 3QJPA 1R0CB 2UV8A 3TANA 3CDEA 3OPKA 1GQEA 2M8HA 3L9ZA 4K2JA 4UOFA 2AZ3A 1BWVA 1LWFA 1PJ6A 2RJZA 3QWPA 3R6GB 2UVVA 3E3XA 3RJMB 1N34J 2R7OA 3MR5A 2KXFA 1FKPA 4ID5B 1GEHA 3SQGA 1T9YA 3AD9C 2DXEA 2CQ0A 1IBMJ 4MFBB 5FDLB 1BGXT 4ECQA 3ETOA 4O3PA 3EUNA 3DOMA 2FJWA 1VRUA 5ETTA 3RBZA 3C14A 3IWLA 5KG5A 1PG5B 4X4SA 4F4YA 2GQ2A 1FDAA 4JI0F 4GKKF 5DETA 2JVRA 1EQ0A 1FRHA 4ILRA 2DRAA 2BE9B 3HLUA 3MMJA 3RUBL 1F6TA 1FCAA 4CLZA 4B9LA 2J7UA 1RWWB 1JWWA 2IAJB 1MWZA 1H2TZ 4G1IA 4DV2J 1CVJA 1MMNA 4OX6A 2FYXA 2Z30B 2RU3A 3OSNA 3PX0A 4CH1A 2FLLA 2HS3A 1T9XA 1NSPA 2R7RA 3SMZA 3AJ1A 3LP2A 5F8IA 2DO0A 5EWEA 2YX4A 1UWBB 1SCJB 2OJ3A 2DJWA 4XDCA 3K5MA 2GGPB 4Z2XA 4F4XA 3D2WA 4WXWA 2UU9F 2G2OA 4RW4B 3RAMA 5CYMA 1E6YA 2UUAJ 2CQ1A 4DCPB 1REGX 2HBYB 2ZBPA 1KBRA 3H0PA 1S97A 1LXJA 3FBFA 3TEHB 3PFEA 3KUHA 4NYPA 1HBUA 3D6FB 3UWTA 2LEBA 4X62F 5CXTA 4BS2A 1YHQS 1RTJA 2GGPA 2VF3A 2VQFF 2Z2YB 4S0MA 5T7LB 5C2GA 1OPZA 2UVWA 4ZIVA 1FRKA 1PSDA 1FVSA 2IY5B 1D9FA 2PA3A 4UUXA 4LIRA 3PRVA 3J7YU 2OFHX 2UUTA 4WP3A 3TA2A 2HHSA 4TY9A 1WC5A 1WC6A 1H73A 2G1HA 2OIHA 4WK1A 4DR4F 1X60A 3A8JA 1AUSL 3I6PA 1FI4A 3Q8PB 1K0TA 4FKYA 5HK4A 4RNNA 3CC2S 3T5KA 1X5SA 7FDRA 2GS8A 2F65A 4KO0A 4QZVB 3GSDA 1FXRA 4ES1A 4O44A 2C2KB 4EEYA 5D3GA 1S4EA 1MLAA 1CQNA 3NGUA 4ECZA 1VRQC 1FJGJ 1X7VA 5GADI 5F0UA 2JOQA 1Y5IB 2LCWA 2ZBIA 3PW7A 2K7JA 4OI0A 2AQ4A 4ZPTR 1V5VA 3GP9A 1JNZB 2E7VA 1JXLA 3EZOA 4IR9A 2ZHAA 3TVYA 1WEYA 1PIEA 5CHCB 1TZ0A 4FVCA 3AQOA 4WTOB 2ASLA 4RL1A 2HRUA 2U2FA 4AFFA 2O01C 4UQGA 4ED2A 3KK2B 1SB6A 1FK9B 1QE1A 2AKWB 3O6QA 3W5XA 5J1PA 1PYOB 1VRTA 2HQCA 2SXLA 4NLGA 4CTAB 4NLPA 1XC9A 2CPIA 1VQYA 3O8WA 3I0SA 5E33A 3RR8A 5J1EB 2P6TA 2GVZB 4KGMA 4HEA9 2UV8G 3G2XA 5HBMA 2VFTA 5K14B 4CLKA 1FX2A 3BGOP 3W9IA 2ZH9A 1SJ4P 3OVAA 2MKHA 1YDLA 3MURP 1SIZA 2L41A 3MEEA 3WBZA 2RMLA 1W26A 3NEKA 2CDQA 3DLHA 4NA3A 4P73A 2Y1JA 5DZ6A 5U47A 3R2CJ 1HBMA 2Z8QA 3LWLA 1LEOA 3E01A 3QT5A 3G8QA 2GW8A 1VLOA 2HIYA 4RW9B 4WWSA 3U1LA 2QFJA 1SUQA 5LMNJ 4LF6F 2Y1LB 4LFBJ 3DRYA 2B7CB 2NYIA 1RXOB 1X5OA 3NY0A 4DL7A 1U6ZA 1QUPA 2V9KA 3AT1B 3MFHA 1IKXA 2CQDA 1NK7A 1WORA 4RBTA 3J7AN 1HNWJ 3TAQA 4DHVA 2YXLA 3KUEA 4I7FA 4RW6A 2EG1A 1OQ3A 2LQ8A 3HHKA 2J9DE 2IA0A 3IWNC 3KLEA 2BDPA 1X9SA 3MI7X 1JK9B 1RT4B 3U1MA 3GB0A 3N4WA 3Q8VA 5HP1B 4Q0BB 3FSYA 1JLEB 2VJUA 3V2UC 3HD1A 3LF0A 1TU0B 4RW7B 4Y65A 1IKXB 2E1RA 5DG8A 2E1CA 3DM2B 1QAIA 4N76A 4OZJA 3QATA 2E9TA 1VBYA 3HO1A 3S6EA 4LRCA 4QIWD 4PPZA 3DGPB 1VQKS 3C2PA 2XB2D 4O3SA 2JNJA 4KYZA 2RQ4A 4AQYF 3V6DA 1RT4A 1Y00A 4UQTA 4JI6J 2V8VA 3T41A 3PTWA 1S5ZA 3DOKA 2A2DA 2H51B 4Q7AA 3HJVA 2DK2A 1RWXB 4PG4A 2I5JB 4N5SA 1HNXF 4ED4A 2W2MP 2MY8A 2CADA 4DUZJ 5F8GA 1NJXA 4HYKA 5KT3A 4PEOA 4EBDA 1WNEA 4ZVTB 4I2PA 4RKUC 3PG9A 1VOMA 5KFFA 4TU7A 2KT5A 4RO0A 3KYLA 2ERRA 3WX4A 4XPCA 3OT9A 3TP2A 5L1JA 1G4CA 2WB4A 3QJLA 5JVHQ 1GMUA 3W60A 2QL5B 3J81j 2XY7A 2ADBA 1RT2B 1WHVA 2XULA 2Q6BA 2W2PP 2FVCA 3PRDA 4N41A 1BY9A 4OZ1A 4USHA 3NAIA 3RGIA 1KFSA 1QLNA 3CCWA 3QFHA 5K14A 2DIUA 1HBNA 1NHVA 2BM1A 2A18A 3B54A 4HACB 4LREA 4OI2A 4C6AA 5KFQA 2E7XA 1NH7A 4X65F 4JV5F 4RUHA 1TKTB 3J7A1 4ID8A 4HH1A 1M1HA 4H4MA 3SCJE 2DH9A 1KR4A 4C0BA 4MKBA 3CO0P 3UE2A 3H59A 3PNIA 5IM0B 2EKYA 2PFDA 2HBRB 4ZVRB 4C0OC 1M5KC 2IM1A 1FE4A 5ETNA 1JNRB 2GQCA 4DPYA 2AIRB 4B3SF 2BJ9A 1FDDA 2MTLA 3PFOA 1YJ7A 4KFBB 2ZC4A 4DV6J 3JYTB 2YKNA 2E7WA 4ZK7M 3BSOA 2XI2A 5H9EJ 4NCBA 1S1XA 2M9KA 2GO8A 4NYOA 4R8UA 3ZZOA 1U8WA 4J9OA 3OXLA 3ZNUA 1IR1A 1U1MA 1IVZA 1HW9A 5BR8F 5AT1B 1JLEA 1RHMB 4ED6A 1OQ6A 1RHQB 2F40A 2MQ8A 5DM6Q 4TU8A 4EBEA 4DQIA 4WFZA 3PKMA 2VPYB 1I5OB 1UVLA 1FNXH 1LWEA 2FD2A 2LQ9A 2QMUB 2YPYA 3MEDB 4Z7YA 4FBTA 1EETB 2PC6A 5DG9A 4P10A 3NGKA 1HI8A 4A47A 2O66A 3A8IA 1IN0A 3CXCR 1KQGB 5H9FJ 3R1HA 2B5JA 3ZTQA 3V6KA 4NXMJ 3CJKB 5L1LA 3I4HX 3JTOA 3I31A 1Z2ZA 2IFXA 4DPXA 1LKZA 5IV4A 2RQCA 4B9SA 3PO4A 3DMJB 5KFYA 5H9EK 1EJ7L 2BJ7A 1WHYA 2K7KA 5J2MB 1R6YA 2IVMA 4Y2MA 4QW9A 5K5MA 2XMWA 3QMQA 3ULHA 3M8QA 4U95A 1T9WA 3OSPA 5B0GA 5L9NA 1UJ4A 4IYQA 3LA0A 1YJWS 4K4UA 3R2DJ 2F8MA 2HS4A 3HVTB 2B5JB 4ZHRA 1F5BA 4BHQA 3TNVA 5DRKA 1NPRA 2HK2A 1ZAVA 3OXGA 3RB0A 1SH2A 5IT4A 3DKDA 1RUSA 4WCEQ 2UUCF 1JLFA 2YKPA 2IAJA 2YWKA 1DQ9A 2UUWA 4Z37A 4FXWA 3IA0A 3VZHA 4JI1J 5KG7A 2EC2A 3WC2A 1RBOB 4ZVOB 1CJVA 3L7UA 4IR1A 1QAXA 1VBKA 2DVIA 3LALA 1PAEX 2GJIA 4ED8A 1F9EB 1F0XA 1RAEB 3HXMA 4QU6A 3VHQA 1RT6A 1OJ4A 2DHGA 4ZOSA 5EX0A 2K3IA 4ETZA 1X4CA 2LXIA 4A46A 1HIYA 1YKWA 2MMYA 5T41A 4BWJA 3J80U 2GNKA 1WG5A 4NCGA 3AA8A 3AFGA 4HR2A 1CJKA 1WJ9A 3V6JA 3PJXA 5B0FA 3MOJB 1YLXA 1U1NA 2XMUA 1HHQA 1IXKA 4ZITA 3DRSA 3GG0A 2HNDA 3Q0AA 4JOUA 5CYQA 5F9LA 4YR3A 3Q23A 1S10A 3M6XA 4OJ3A 4DFJA 3NL0A 3CULA 3IN5A 1DLOB 5KT2A 2CQIA 1XN9A 3FBCA 1NSQA 3NP5A 1ZTWA 1LWEB 1JLGA 2J0SD 3UFCX 2VG5B 1RJJA 2KM8C 2ZNYA 5IWAJ 4ZCIA 1RHUB 1U8SA 1RAJA 5HQ8A 3J81Y 3MAQA 2KFNA 4NWBA 5HVGA 4RUAA 2QEXS 1VQ7S 1S6QB 3MMCB 4HHUA 1RLDA 3DOLB 2QT7A 4LRBA 3EGZA 4GVBB 5A8RB 3CD0A 4DJBA 4X2BA 2Q66A 2NYHA 4UUWA 1BQMA 2IDEA 5LMUJ 1KQFB 1HQ2A 4K4YA 1DTTB 2CPYA 4TY8A 4LF4J 4OYPA 4NXMF 4EZ6A 1C1BB 3GIMA 1VQ6S 4I4BA 4WU2A 4Y2KA 4B08A 4ZVSB 1PBAA 3QT7A 1RYSA 5D77A 4DCJB 4CWBA 4PRFA 3OVBA 1RAAB 2HZVA 2CPEA 5D0GA 4DLGA 4JI7F 4DR7F 4KHRA 3GZ7A 3VV2B 3ZC4A 3OV7A 1JLFB 1TUGB 1D3WA 1RAOA 2COLA 1PYTA 4ZPAA 5M2UA 5D4OA 3H7HB 2F8HA 2O1PA 4MT1A 4DR4J 4WIQA 1O6XA 1UETA 2RRBA 2HG4A 2V4JA 3CDBA 3WHIA 4C9DA 1N6QB 3LQVA 4C8MA 1UFKA 4ZP6A 4WKRA 1G2EA 1UJ6A 2J5AA 3QBCA 4HDHA 3VAIA 2CPFA 1QAYA 5HMXA 4QOTA 4AT1B 3M2RB 4KBIA 5KFBA 1PC4A 1L5UA 2UXBF 4RW9A 2K1RA 4OI4A 4K4SA 5J2PB 3NCRA 4GO7X 3UD3P 1SKSA 2FVSA 4ITSA 4CLWA 3MFIA 5G0RA 1U1RA 2XC9A 2DEIA 3QLHA 4YMEA 1N6QA 2ZH6A 1X4DA 1NHUA 1UWBA 3UCGA 4DEZA 5HLFA 4CCHA 2R2SA 4LRDA 4LF8F 1AZSA 3UCUP 2D7SA 4C3LA 4RX6A 3RRGA 4JI6F 2RIJA 1SKRA 1SKWA 3KLGA 5HANA 5CYQB 4OJ1A 3CCUS 1HNVB 1JQGA 5IFMA 4NPOA 2KJWA 1DFDA 3POTB 4U67Q 2MKIA 2DHHA 4KV8B 3CMQA 3DM2A 2CYYA 4LBPA 3FCWA 1FNOA 4ZA1A 3Q8SB 5HLFB 2QA2A 4WP9A 1U6BA 4R8UB 1VJQA 1RTJB 3QYYA 3FSIA 4DFMA 2VONA 2FHJD 4A8FA 1YK9A 4DFKA 5GMKa 4UT4A 2RH3A 3G86A 2MSSA 4CIOA 1URRA 4K4ZA 2H5IB 2ZVIA 3LANA 2YNFA 2QE5A 3MM5A 3OXFA 5KFMA 2E5LJ 3HSJA 3TA0A 4EYIB 4YR0A 1NDPA 2DNRA 2YPZA 4OYWA 4NLXA 5C5JA 5GVQA 2O5DA 1F60B 3L7OA 5LOQA 4KPCA 3DLBA 3EGVA 1B70B 1HKAA 1NO8A 1P9QC 2PMWA 4CLYA 2QLXA 1G6BA 3G96A 4O44B 3P3DA 3BGFA 3F73A 4IG3B 5D3GB 4DX8H 2AJ4A 3D3BJ 2XGQA 4ILLA 2DISA 3IFEA 3MM5B 3CCVS 2GIQA 3CJSA 3DCAA 3DFEA 3B8HA 3EWGA 1HR0F 3AOCA 1RHKB 1PCAA 1KLMB 2FJAB 3RB4A 1PGZA 1TVRB 3LGNA 4DV1J 3DN9A 3HHLC 2RUSA 1KS2A 1PO6A 3N6NA 1QVFR 1T9UA 3UVJB 4AXIA 2MQLA 3QFWA 5JJBA 1M0SA 3GFXA 3OFFA 3OLBA 3M8SA 5ETVA 3SV3A 1ULRA 1NZ8A 4P2MA 5F41A 1AFJA 1QSLA 2R2TA 2F9DA 1Y3JA 3KUGA 4TYAA 2LDIA 1P6TA 2NXJA 2XCPA 5JVGQ 3G82A 3SEOA 3A8KA 2YQ3A 1VRTB 2ACYA 2YVSA 2LYVA 5F0WA 3L3CA 3DI6B 2AX0A 2FGOA 3D0GE 3OBIA 3SQGB 4RZRA 4JYAJ 3HVWA 2DPJA 2DPIA 1FJGF 2NXNA 5D0EA 1KRPA 2M7SA 2CJXB 1H0HB 1C0TA 4ILMA 3JSYA 2POKA 3JTNA 5DQHA 3PY8A 3M2UB 2QGFB 3AA9A 1ZA1B 2K2PA 3GQCA 4C7QA 2AF6A 4ANEA 1ZH5A 1JLBB 2RHQB 2GVDB 3F41A 3BSCA 1NH8A 2JLEA 3OFHA 2CQPA 3RW7A 2ASDA 2HW3A 1TAQA 3FVYA 2LKZA 1C0TB 4B02A 2K06A 5GAEU 1FDBA 1D8ZA 3FFIA 4RNHA 1VR6A 4F4ZA 2RRAA 2R3VA 1URNA 1X0PA 1TKZB 3MMBB 2DNHA 4ZVHA 1FESA 2OHDA 2E5HA 2BABA 2OSQA 4QIFA 3ITHB 4JUZA 3FNNA 6AT1B 2GVDA 1CJTA 3NWRA 4RW6B 4ED3A 1NK6A 1WF0A 3OUYA 3T6JA 1W2BR 1N5TA 5L8RC 3DRSB 1DTQA 3M1VA 4OV1A 2QX0A 4X66J 3DDKA 1X9MA 4H4KA 4CP5A 1Q95G 2FB0A 1HWUA 4JP8A 2V2KA 2DY1A 1G7CB 4PYDA 1OSCA 5LJ3Y 3MD1A 2IPOB 3KJVB 4E8UA 2R2RA 4DV3J 3JSBA 2BANB 5KFVA 1CJTB 2A3JA 2QLWA 2V2QA 2VBWA 3OTEA 5ETRA 2XCAA 2HS0A 2Y8YA 2NUHA 1UL3A 5A8WA 3QZ7A 4OYXA 3QRQA 3QIDA 2B9YA 2E66A 2E1PA 2J9DA 3V81B 4PWDA 3I56S 1K9MT 5HQMA 2XMAA 1Y5LB 3ET6B 4DL4A 5IT9U 4I56A 4F25A 4DR3J 2DEJA 1Y3KA 3AAWB 3M9MB 1WHXA 2WCXA 3PVXA 4AYBD 5GAGU 2OUGA 2OEMA 4OYIA 4HT7A 4CT8A 3HFZB 2JHEA 1OY9A 3DOMB 3UR3C 4FN5A 4OZ3A 4DV2F 3VR1A 3B4MA 1GMWA 4M1KA 4EGLA 2QYCA 2LP4A 5AXLA 3GJTB 3VGUA 3J7ZT 2VKRA 3IG1B 4I0WA 3VQSA 3IM9A 1Q1KA 3NCPA 2D3OR 1S7HA 4LR9A 1KD1T 4DZDA 2HYIB 2F7VA 2WK4A 2E9RX 4IRDA 3DLKB 3KFWX 2M4MA 2W9BB 3CC4S 4RBUA 3HZGA 2XYHB 2XS5A 3RB6A 4DG1A 3CMAS 4DN0A 4UZBA 1MN9A 2N7CA 4L3NA 1RHRB 5CCLA 4USWA 2MLZA 3CUNA 4JI2J 2HFOA 1QM9A 2CZVC 4IKAA 1S6PA 3VGVA 1T02A 2FVRA 1PBUA 2DH7A 3T1YJ 2VBZA 4DXLA 1N0UA 3MGJA 1FERA 2B4PA 1FF2A 1Q78A 5E3AA 3UDCA 1CEZA 2EBEA 1IBMF 2B4UA 4QYRA 2EKNA 3PR4A 3JYTA 1S1TB 1OYDA 3SSQA 4O0NA 3DDNA 3H42A 4OZLA 2YKAA 3TX8A 2DR6A 2AJ1A 3GCWP 3IC1A 1S6PB 5KFSA 2F4VF 3W61A 1ZYQA 1P1TA 3EZ5A 3GJRB 3W66A 1XBWA 1VC5A 1S48A 3N79A 2KFZA 4IFYA 1GFWB 1UEKA 3Q86A 4HT5A 3IAM9 3OTBA 2FC8A 1DRZA 4CO4A 1Q4RA 2DGSA 2OEJA 2AD9A 1D9DA 3ISNC 4V19J 5D4LA 1U2RA 2V67A 1MU2B 3MEDA 3TO8A 3S1TA 3AD7C 2D69A 3IRWP 2JZ5A 4KH0B 2DKOB 4RW4A 1FNMA 5K8NA 4DV4J 2L9DA 2HVEA 4ER8A 2DNMA 2AJ0A 2CPHA 3RG6A 2NR0A 2MZQA 1REVB 3IS9B 4RW7A 5LSLA 3KHGA 2UVRA 4JI4J 1GTEA 5B08A 3DLEA 4DUTA 2JEIA 4RNOA 3OHBA 4P7VA 5ETPA 2NZCA 3WX8A 1S0MA 1K1QA 2ZH1A 1KNZA 1UVNA 1TL1B 3KTQA 2FJDB 3OR2A 1GXLA 3BKFA 1Q7YT 5F3ZA 4DS4A 3TI0A 1ZOTA 3VTIA 1RT1A 3T5LA 4C11B 5K8PA 3EMTA 2W4PA 3HVTA 5DLFA 5KOXA 5L46A 4M8LA 1Q5VA 4YB6A 3MEGA 5I3QA 4K4WA 4I6WA 1JB0C 1NB7A 1X5TA 2GV1A 2VZ9A 4Y28C 4PR6A 2XM3A 1UMJA 2EBGA 4KB7A 3DU5A 4CT9A 2BACA 4K4TA 2BRLA 2XTJP 2NSCA 4C97A 1IKVB 3CIMA 1AT1B 5RUBA 3KK3A 1FTCA 1L3KA 1M90T 1WOPA 2M0GB 3FBEA 1O5JA 2CUYA 2CNLB 2JRSA 2YKQA 4GVLA 1XWLA 1YI2S 2PFFB 4LF2A 3NS7B 2FJEB 2HVDA 2MLYA 1U1OA 4QR0A 2JL9A 2B51A 4QPXA 1X4FA 1YG0A 4L72B 3UI3A 1JJ2R 4A4JA 4Y34A 3DRRB 2W7AA 5CZXA 1SJRA 2CJKA 5AE3A 1HBNB 1SH3A 3A13A 3UD4P 2VPWB 4M5MA 3MECA 5KFJA 2FVQA 2CG4A 5FLXY 2BE7D 3TAMA 5KFXA 5C25B 4JI3F 1IM4A 1H3DA 1X4AA 1JLAA 5D0RA 2EFVA 4MKYA 2HGNA 5K9FA 3CJ2A 2HK3A 2Q6CA 3KG0A 3Q8UA 2J7KA 4ENOA 2ATCB 4FDFA 4FPIA 4I64A 5HN0A 1J27A 5DJBA 2J8AA 3DRPB 3K5LA 3T5HA 4IFYB 3FQLA 3TJ9A 4DUZF 3RTVA 1SC1B 3K8WA 3M8ZA 4PWUA 4ZVUB 2ZH3A 5HVHA 4IRKA 4J91A 3I0RA 2AYBA 1FT8A 2HNYB 3H2VE 5HAOA 4R5PB 1MROA 4P72A 3HSGA 1FRMA 4PPDA 3DHXA 4PG6A 4ERDA 3G71S 1HNZJ 4WFXA 4G1QA 5EGYA 1B0VA 3EVOA 4I68A 1RWMB 1S0VA 2B6AB 3IS9A 4L73A 1SJ1A 1FEEA 4LR7A 1TMMA 4ZVQB 2RSQA 3K0JA 1U7LA 4KGVB 2HHXA 4I7FB 2VU5A 2APOA 5E2QA 5B0BA 5LXRA 1U25A 2MQOA 3RRHA 3JB9k 2H3EB 1B0PA 1YZ7A 1M5PC 5CQGA 1SQFA 1WELA 5HP1A 4Q0BA 8ATCB 2KG1A 1FEHA 1FKOA 5GMDA 2MKKA 3VAMA 2AT1B 4DX7A 1SBRA 1LFPA 1TQLA 4UOGA 1L3TA 1RADB 2YQ1A 3HVRA 2RDJA 2B56A 2GQQA 2ZOFA 1RCOB 1NBEB 3DGPA 3DMJA 4LFBF 2H54B 3HX9A 3ZTOA 1KVIA 4IQMA 3JQMA 2MZTA 3D6MB 2IBOA 2M3DA 1HQEB 3DGVA 3FBBA 3K89A 3MPYA 4PQAA 4TXSA 1IJEB 1CJUB 3VCDA 1N36F 4KTQA 1WDDA 3FDSA 2V0NA 1Q5YA 2HMIA 4KE5A 1R43A 3GR0A 1JLBA 2BKOA 2MKSA 3MAAB 1Q8LA 4OI3A 3X3UA 4USMA 2DGWA 3I0SB 3NGRA 3NGDA 1FRJA 4RPFA 4J9KA 4EFAC 4IOAQ 4ECWA 3DXSX 3QGGA 2W4CA 2ZZTA 4GKKJ 3K17A 3W63A 2ZM6F 4J9NA 2VODA 1EAYC 1UVIA 2MPUA 1WC1A 2JVOA 3QLHB 3VAJA 2I0XA 1VDHA 4WZMA 3GV8B 2D3O1 2AEMA 1NM2A 2FHOB 4MIBA 3SSRA 2J8SA 2DXDA 1TL7B 4R0JA 3W2WA 3L95X 1BUXA 1X8DA 3KLIA 3MWBA 3R97A 1YJVA 2W9CA 5CH7B 1Z2LA 4MK7A 4ZVFA 1K0VA 2MEWA 3K5OA 1FVQA 1Q8IA 3KJFB 3M1VB 4PABA 3Q8RB 1DZ5A 4JI3J 3W1YC 1FJEB 5ETQA 1W2IA 3SFUA 1SQGA 2AV5A 3MM6A 4YHHJ 3GIIA 3H2LA 4N56A 2QSWA 1NK4A 3KDOA 1R0BG 2E1MC 1XERA 2V8PA 1R0AA 4W92B 2MKCA 2OMOA 3R5GA 5I3UB 2KVIA 2C3MA 2MKJA 2NLWA 5KFNA 1N33F 3VAFA 3IP0A 3S01A 2I8EA 3FFIB 4E2FB 4CLUA 5E41A 2ZZMA 3M05A 2NXUA 4LF4F 2RAQA 3D54A 2KTQA 4J37A 4I6YA 1LK7A 1RU2A 4IDKB 3ZFVA 3ENVA 1C4AA 4G6VB 4O4RA 2Y9HA 4U7UD 5DO2A 1V6HA 1HNZF 2R8KA 1R0AB 2BKNA 4LVNP 3W3SA 2DITA 3DDIA 2O3DA 5AE2A 5KFLA 2UP1A 2VASA 1XTZA 5GAHU 3CW2C 3CC7S 2WSEC 1IUJA 1VQ9S 2VB6A 3DOLA 3LP1B 2MSTA 5E3PA 3TUJC 4ZN3A 2E5JA 2EK6A 3BR9A 4J9MA 4ZPDA 4K5RA 1N48A 2XS7A 4C8OA 3GFHA 2MHEA 3W8PA 2AHOB 3CCQS 3BGRA 4B17A 2KKHA 3M6WA 1ITPA 1R8CA 3OR2B 2H5JB 3VAKA 2RKIB 3T1HJ 3PW2A 4NA1A 3A8EA 5JXSA 5MLCV 1KOHA 4I2QB 1TUWA 1UFWA 1CQMA 2RDIA 2XSFA 4WIIA 3DLGA 3SI8A 3RR7A 1YQHA 4PUOB 4UY85 3HKZD 2VHGA 1RWOB 4OHVA 4P2FA 4B9NA 1FXLA 3W2VB 3M32A 3KLHA 1AB8A 1HL6A 1OS5A 2MQMA 5H1SV 3GMGA 4ZVEA 3SV4A 1VQPS 2Q43A 3M8QB 4ED1A 1IBKF 1MMDA 4U9RA 4LBHA 4PG5A 4ZVPB 4DX6A 4IO1A 2DGVA 3JSRA 4YY3J 1YRXA 4JI8F 4NCGB 5BXIA 3HK2A 4I67A 4ZKAA 2LXFA 3IG1A 4X4QA 1T95A 2ZHBA 1WKJA 1U2FA 2DY9A 5C42B 2PMHA 2W2QP 5HBMB 2QL7B 4AD6A 4XPEA 1CJVB 2I9SA 3TARA 1HBOA 2X51A 1WTBA 2AYGA 3M2VB 1FWLA 3M8WA 4OYBA 5CD4A 4EBCA 2P5VA 1M5SA 2IRXA 5J1EA 4LRFA 4WXOA 2XG8A 1CPZA 3AODA 1TKDA 4DV7J 1AZSB 2HBZB 3D9BA 2WOMA 1RT6B 3CT9A 4P2XA 5LT5A 2ILZA 2MZSA 3MUTP 3PYGA 4M5GA 1ZM4A 4CO0A 2W9AA 5LMUF 1S76D 2L9NA 2DXFA 1MN7A 3WIVA 3H8YA 4DMZA 1I94J 3UN3A 3TUIC 2OTJS 1VGYA 3I5AA 1GXTA 3M4XA 4URGA 2BE2B 4FF4A 1EARA 2OPPB 3EXYA 4Q2MA 1SJQA 1RI7A 5C24B 4Q44A 1YITS 2OPSA 1GK8A 1X4HA 3M30B 1K47A 1E6YB 3T9ZA 3TVZA 3JTPA 5CAAA 4TY8B 2YNGA 4OFZA 4DR5F 1JX4A 4C3MA 2NSBA 1R8AA 3G6VA 1IBLF 1DQ8A 1LQ9A 2HWHA 1IJFB 2CQGA 2ADCA 4KPYA 2CVIA 2LXUA 4LT6A 2H5EA 3V4IA 3GCXP 2JFKA 3D1QA 2UU9J 1VQNS 1HBUB 4IQXA 1JLGB 2AWZA 2OPQB 3GE9A 1IWGA 3CCMS 1BQNA 4B3RF 3BO2A 2IRYA 3M30A 4C8LA 3Q22A 3WIUA 4B9VA 4ECVA 4IG0A 1HNXJ 2XZWA 3DLJA 3FMBA 4JV0A 2PA8D 1OMSA 4IFVA 4LIWA 2ALYB 3DLGB 4CLFA 3PW4A 1XNQF 3CJ5A 1V5IB 1RDRA 2XMKA 3GSIA 3HDSA 2DYAA 2YWHA 2FLNA 5B0EA 4A8OA 3UCZP 1KSPA 1RK8A 3ZZ0A 5KG6A 1SL0A 4EUVA 1C1BA 4CRJA 2J9EA 2BQ3A 3FCVA 2HHUA 3FCHA 4OHWA 3H5XA 2IVFB 4HL9A 3T19A 4DR1J 3Q89A 4MJKA 3VZIA 3AOBA 3E01B 2CPZA 2VG6A 1FE0A 1ZBTA 4EO8A 4YP3A 1SUQB 3K5PA 5B0DA 3JXOA 2FJVA 4ELUA 3QT8A 4OX9J 1IBCB 2R4FA 2FZCB 1NJZA 1M1KT 3QAUA 5DZ7A 3ZNJ1 1DAXA 2ZH7A 1N56A 1SC4B 3G6XA 4O3OA 4DL5A 4LSLB 4E98A 4U6PA 4F4KA 5ETKA 1JJ4A 2A10A 1MMLA 1RTDA 3QZ8A 1SKUB 2BV3A 3LAMA 1X4GA 3CO9A 4LSNA 1K8AT 1WC0A 3D6HB 4G1QB 3BN7A 4G1PA 4PG7A 2YWGA 4NZ7A 4ZCKA 2PEHA 3SXLA 2B6AA 2R42A 1JJHA 3CDUA 3P8BB 4BC9A 4DQQA 3MM6B 2I2YA 3DNCA 1S1WA 1U0SA 2GCFA 2OPRB 2RS8A 3MMAA 3EX7B 1T7PA 3R1LA 4EZ9A 1U24A 2LVWA 2YNGB 1DTQB 4OI6A 1S9GA 4CO2A 2KU7A 2VFRA 4WFNQ 4LF5F 3Q2TC 1EZZB 2CQ2A 3K58A 5D78A 2DCLA 4J5OA 1NPPA 4ZP8A 2GHVC 3T1AA 2Z4PA 2J6TA 4LQ3A 3LAKA 4GVBA 5BYRA 5A8RA 1T9TA 5KG3A 2H48B 3VQTA 2KO1A 2UZAA 2IMOA 4RJVA 4USKA 3QGHA 1ZTTA 1V3ZA 5KFUA 3C16A 2OH2A 3MCMA 5AE1A 4X4PA 1TV6A 2ZITA 3R5DA 4BC7A 2GIFA 1S77D 5B09A 1B64A 2DD8S 1U02A 1WTFA 1ZA2B 1R6VA 2CNKB 3ILLA 2FY1A 2HMIB 4FS1A 2ZH5A 4DPWA 4WPAA 4C8NA 3OLAA 4DV6F 1XMBA 4TLRA 3BGRB 1S12A 5KFIA 4EWTA 3C16B 3FEYB 3NOGA 2XHWA 1VI7A 2OD4A 1VK3A 3PYFA 2HHQA 3KK3B 1WEZA 3HD2A 1YWXA 2CWXA 4USIA 1N34F 4K8RA 2DGQA 3HJFA 4FYDA 1JKHA 2HHHJ 4PUOA 4GMKA 1K1SA 2M70A 2QRRA 3FJ2A 2Z2ZA 4H4MB 5DS7A 2RS2A 3NNHA 4NEYA 2XS2A 2D3ZA 3W5YA 1FKPB 4ID5A 2C2RA 2NREA 2G0IA 4USUA 3QSIA 5IV3A 4DI6A 2B4VA 2NS1B 2ZNZA 1JXEA 2ZDPA 4J9PA 1QUVA 2AU0A 5LJ5Y 4O0IA 4AUKA 3N5BA 4LF1A 3KLVA 2QA1A 4NLVA 2WW8A 4RUBA 3G4SS 1KQSR 4X66F 3OHAA 2B9XA 3FQKA 3HT0A 4M5DA 1S0OA 4RNMA 1LNQA 2VICA 1HBMB 1T03A 1FD8A 3GTYX 3P6YC 4QYZK 1RKJA 3KLGB 3QSYB 1S79A 4GC6A 1Y5NB 5ETSA 4F2SA 5A0YB 2PN6A 2Z2LA 4KV8A 2BQUA 3PO5A 1FRLA 2EFPA 4NASA 4QPTA 1OYEA 1BXNA 1EB0A 2WW4A 1RKIA 2ZUAA 4B9TA 2NZ4A 2WOMB 4CYUB 2A2CA 2EFQA 3KLIB 4H54A 4NLTA 2I6WA 4DV0J 5GADU 5A8WB 1VHFA 1TP7A 3DLLQ 2H1YA 3DYAA 2F1FA 2HZAA 4FYWB 4DF4A 3GJSB 4NLQA 4B3OA 3E8OA 2DIVA 4I6AA 3TOQA 2F3JA 2LDYA 1U45A 4IUFA 3LP1A 4MIAA 2ACMA 4DOZA 2A1BA 1FWKA 2LA4A 4OLOA 4MH8A 4PXEA 1RBLA 4P7TA 3ZZTA 4JV2A 2V8HA 1CG2A 4LFAJ 3OUYB 1QSSA 3V6DB 4ES3A 1EP4A 2FC9A 2CQHA 3LO3A 1Y11A 4GRSA 1PJ5A 4QR1A 3PIOQ 2FUG9 3CGIA 3I4PA 2CAJA 2AGQA 2P9CA 3DC2A 4UOHA 1T3NA 2C2DA 2YKMB 1H38A 2CWKA 1S99A 3CCSS 3MM8B 1EX8A 5K8OA 5KFPA 3PKYA 4LFCF 4N7TA 1Q82T 3LGHA 3M32B 4NA2A 4YHHF 4UZCA 5A8KB 1UPMB 4CDIA 1Q8BA 3VAHA 2A6OA 5EN1A 4D3GA 1N54B 1SV5B 2KXHA 2WVCA 3HULA 3NOCA 2GHPA 1NXIA 1WDTA 3CVKA 1UPPA 2IYGA 4GKJF 2Y0SD 1MWYA 1XEZA 3C6UA 3D68A 4BWMA 1K44A 1X31C 2J0WA 2OSRA 3VVTA 1YJTA 1S9EB 2WONB 4TN2A 5DDRC 2DNQA 1YIJS 4F3OA 4KY3A 2LU2A 1J5OB 1N0VC 3MPUB 4QWDA 3EDRB 3D7SB 3TEGA 1YBTA 1FJ7A 2UXCJ 2ZUGA 1DY3A 3EGNA 3W2WB 4NXNF 1DBDA 1IR2A 2OKQA 3B78A 4I1TA 2WHOA 1XR7A 5CABA 3QRPA 1U0HB 5A6PA 1QAJA 2X1AA 4FBUA 1UZHA 2CQBA 3IR7B 5DG7A 4J90A 3IRXB 4PQUA 2Z57B 5G0RB 1OIAA 5IC4B 2AMCB 2NPFA 4CH0S 3HT3A 4DG1B 4HTIA 2V4RA 2KM8B 4MK8A 3SZ2A 1CS4A 3D67A 5E0OA 3Q24A 3PJ9A 4TVAB 2AX1A 1RT3A 1C0UB 2AEFA 2KT2A 2VFVA 3PR5B 4X64J 1VQMS 4CLSA 4CYUA 2ZBCA 1BMQB 4OJHA 1LW2A 4WKYA 4HI1A 5C42A 4KKOB 1QSYA 3JQJA 4KRWA 3D1HA 2H9ZA 3BB5A 1NMEB 3A12A 1JJCB 3UR0A 1KHVA 1GT8A 3POTA 5BYQA 3AJDA 3BSAA 3CIZA 1S1TA 2KL8A 4M5IA 5KFWA 3KK1A 1N5YA 5F8MA 3H5YA 1EETA 2W8KA 3SDEA 1VBZA 4X4RA 1EKSA 5EWFA 2AP6A 2FLPA 5KG2A 3L7PA 2QLFB 3EXCX 5A2QU 2QMWA 5DDOC 2HNDB 3T6BA 3KJNB 4WE1B 1HR0J 2XYGB 5DDPC 1RT1B 2D9PA 1FD2A 4DU8A 4LVOP 3QJJA 3FRYA 5HJYA 3EJMA 3MM8A 4PXDA 4DSJA 3R5CA 3GV7B 1DURA 2ILYA 2QFIA 2MGZB 3IO1A 1XMOJ 2J9CA 4P2SA 4UW2A 4IG3A 1QVGR 4JBCA 1VISA 5JMNA 1SJ3P 4KGZB 2UUAF 2N3LA 3TAPA 1F9HA 1VK8A 1FK9A 2IM2A 2VQEF 3KKFA 1WSVA 2M88A 2JC1A 4KQZA 1R89A 2JEGA 2X3DA 1N52B 2DNZA 1KLNA 1RWPB 4W4MA 3KMQA 2DGXA 4U8VA 4R25A 3BBCA 3M2RA 2I38A 3FRZA 2JWNA 1QD1A 1HD0A 3QO9B 4PXBA 1F1BB 2BJ3A 2W7OA 3OL6A 2JEJA 4NLUA 3MEEB 5B7WA 2RF2B 1JKHB 1KVKA 3CJ4A 4NZ6A 3TAMB 3UNGC 4HH0A 4CH7A 5C25A 3HM9A 1JLAB 2ZVSA 4UF4A 9RUBA 4K0KF 3GYXB 1OWXA 2HWIA 5KOWA 2CDRB 4KH1B 4MKVA 4NL5A 5AXNA 1U0HA 3OW2R 3L4BC 1U47A 2HRTA 2NPIA 3HF5A 1PYSB 4GO5X 3PHEA 4ZPWR 1WACA 4JI1F 2EK1A 3A1YG 4F0HA 2A6MA 5KT4A 3PW5A 4UY8T 2CJ9A 4N8NA 1Q7LB 2C22A 2UUCJ 2V6AA 1V9OA 3NBPA 3R3TA 3ZZZA 2HNYA 2HEKA 4N8OA 2EWHA 1CC8A 5IOLA 4N47A 5IM0A 2KH9A 1NJYA 2BMBA 3NRBA 2W9CB 5J2PA 7FD1A 4ZDNA 4JI0J 1CULA 2ASYA 4ZP9A 2YBVA 1WF1A 1ZAXA 2IJFA 2YNFB 1C2PA 2E44A 5KFOA 2NXEA 4ECSA 4E0DA 4DS5A 1CBKA 1VIXA 3M6VA 3H40A 2C2EA 4O3QA 1GMVA 1MNEA 4DN9A 2C3UA 2RT3A 1VC0A 2W8LA 4BBYA 2LQJA 1S6UA 3OQ2A 4DQRA 2AYEA 1U1QA 2OAUA 2DR5A 2QC3A 1HNVA 3BS9A 3PYDA 4ZJLA 9ATCB 5DQIA 2RU9A 5I3PA 3HHLB 3D28A 4FXVA 1KTVA 3SBMA 3QQCD 1NHKL 4RLEA 4H4OB 4J9RA 2VOOA 3WDOA 1BQNB 2BANA 4X84A 3SIPB 4YB5A 1HWKA 3A4TA 2HZCA 1NJWA 2DH8A 1NZAA 3TVKA 1DTTA 3THVA 1RZMA 4WP8A 4Y2AA 4DX5A 4ZIWA 4DV5F 2HVHA 3HHLD 2BUNA 5D4PA 4LF6J 4FNIA 3OR1A 4FS2A 1YZ6A 3HFKA 4RBVA 5FIIA 4W98A 4XTTA 4MAKA 3DI6A 3I5BA 1GTHA 1RT5A 3G6ES 3CCES 5KFKA 4WF9Q 1FFSB 3JQKA 5HJXA 1VBXA 1SH0A 3BF4A 1KDNA 4DPTA 5KG0A 1F9FA 4PG8A 2IDLA 3W64A 3AB2B 3FMWA 2R7UA 4DR7J 1N5VA 4FYXB 3NMAA 2GMLA 2DT9A 3I9V9 1HHTP 2XMJA 1KLMA 4DSKA 2QA4G 3CCTA 1KONA 1HW8A 1GH8A 4P75A 4F2RA 4JV1A 2OI2A 3T3FA 2IM0A 1I3OB 2N82B 2QLBB 2QL9B 3G6YA 3PIPQ 2MJUA 1RP5A 2JLFA 1N8RT 1NKEA 3FUYA 1HQEA 2C2ZB 2OLWA 1J5OA 4X4UA 4K50A 1QY7A 4OYMA 4EI2A 4F67A 3CF5Q 5BR8J 1NNDA 4L74A 1QTMA 1M5HA 3CJQA 2N3OA 1HWIA 2P8IA 2QA4S 1XMQJ 1HPZB 2XI3A 2XSJB 1UAWA 2C2MB 2NCKL 2ZEJA 4NZ0A 3J81U 1NSAA 4F0KA 4C8KA 1WI6A 4DSFA 1CULB 1DARA 2RHSB 3DRPA 1M5VC 1TFWA 1TKXB 4Y0FA 4HACA 3D66A 4YR2A 1Q53A 3M2UA 4QWCA 3OJUA 4ECYA 1D0EA 2GA7A 2IA6A 2RVJA 2C2NA 4B3MJ 4JYAF 1KVJA 1YVFA 1UA0A 4IO9Q 4OJGA 2QN6B 1G3OA 4YB1P 1D1UA 2UXBJ 2X3GA 4LF9J 3CJ8A 4WJBA 4QW8A 2MZRA 1HQUA 2JX2A 2BZ2A 4M5HA 3K7RA 2VFSA 2HVZA 4P52A 5ETLA 5EUHA 5SUHA 5CD4H 2HHWA 3W62A 3CB4A 4ZJQA 5HATA 1VLYA 3I82A 5F8JA 2VC0A 1TKZA 1SQEA 2LMIA 4DL6A 2CJAA 1GX5A 2BQRA 3OL8A 5FLXU 4ATNA 3BO4A 1JLCB 3HPOA 3OTDA 2BBEA 3OD2A 1A9NB 3RW6A 1T05A 4OZ2A 1RU1A 4B3SJ 4JI2F 4U7CA 4WE1A 5HO4A 1VHIA 3KG1A 3U27A 1SL1A 1YJRA 2KJVA 2ASJA 4OYAA 3BBFA 2ROGA 3NLCA 1JLQB 2YY3A 3BQ1A 3VVUA 3GU0A 3CCLS 4DUYF 3OFEA 5KTQA 3G8SA 1RTZA 2BJDA 2HIQA 2JJ4D 2RQMA 4JI5F 5KFAA 3UVJA 1AYEA 2HHVA 1DQAA 2V2VA 4OHYA 2F4VJ 4QIVA 3V81A 2UVUA 4PWDB 4DL3A 4TYBA 5M2RA 5BJRA 2XZTB 2X7IA 4OYZA 1K73T 4ZMMA 2OEKA 4LSZB 4DV5J 1LWCB 3M8PA 4XIUA 3LP0A 3W9HA 4PWWA 4B3TJ 3H5SA 3N9UC 4AQYJ 3C19A 2KZMA 2MYFA 3QT6A 5E7OB 4GC7A 2BM0A 3P49B 5HROB 5A8KA 3TUZC 1YRUA 2BA9A 2F4FA 3TWZA 2WB1D 3RU0A 2EEYA 5KFDA 1Q81T 4YDDB 3RYLA 1IR0A 2B8QA 3AOAA 1YJUA 2RILA 2IM3A 2Q1LA 3CJ0A 4Q2LA 3F56A 4HHJA 4QIGA 4ZHRB 2HGMA 4C48A 6FDRA 4J9LA 4AL7A 3CMES 3MM7B 3M8PB 2FJBB 4CTAA 1VQOS 1FTRA 1VJWA 4XAKA 5EHHA 3N28A 1Y0HA 4TKTA 3Q2SC 1VQLS 2CFXA 3DLKA 5B0CA 4GKJJ 3MDFA 2ZOMA 3UN2A 3C15A 3BGUA 3QAEA 1UWAA 2G0CA 4YDXA 1WG1A 3BEGB 3MECB 1UW9A 2CG8A 5KT7A 3HI9A 4HHHA 1YRTA 3BN4A 3NBPB 2OPPA 3ITHA 5C24A 3R7NB 2IBKA 3KOAA 2MZJA 2DGTA 2JDJA 4L76A 5HSPA 2HQFA 1CC7A 2RB7A 3EDQB 1IWAA 1OPIA 5HMYA 2J6SA 1GNKA 2YWWA 4O4GB 2HQGA 2VQEJ 4PQUB 4IH5A 4IOBA 2HBQB 1KN6A 1MWQA 1O0PA 3VF0B 2VOPA 5JUMA 4J9QA 2P2CB 2LU1A 1ROFA 1A7GE 3BGLA 4IOCQ 3THPA 3H2UB 4ECUA 4R0EA 5LM7E 2IC3B 5J2NB 2GHWA 3CEDA 1OO0B 2DTJA 3P4UB 4H4KC 4Y00A 2D3UA 1V3SA 1HA1A 1ZS6A 5KT5A 2R8JA 1WD6A 1F2GA 1EQMA 2P9EA 3UDVA 2DNKA 2HQDA 2DBBA 4KIAA 2A0FB 2BW2A 2BX6A 3GIJA 3CJ3A 2EC0A 2XNRA 2B4OA 4O3RA 2IC3A 1J2VA 3N5FA 4NLRA 1N4LA 2GMJA 2KN4A 2PIIA 3ILIA 4V1Ak 1H2VZ 4EYHB 1TK0A 1RWUA 1W7WA 1TK8A 1Z1ZA 2BW7A 1QE1B 1VYAA 4DV7F 3PZPA 1EIYB 4RW8A 3F44A 3R27A 5KFCA 4DV4F 2R7TA 2FJXA 2DB1A 3W2VA 3KLHB 1C4CA 2DR8A 1BQMB 2IRUA 5HROA 2GVZA 2V94A 4FKXA 1UZDA 4P71A 1S57A 2ROPA 3ZZPA 2D41A 3LW5C 3C14B 3BKTA 3B6BA 1CJUA 4J9UE 4QIEA 3MM9A 8RUCA 5IQQA 3TX0A 4A8YA 2HVIA 3MEGB 1RWVB 2M2BA 3IXQA 3MAHA 1IKYA 4O23A 1Q0NA 4QR2A 5I42B 5KFTA 1DHMA 1FRXA 4URQU 4KGKA 1NEEA 3MPDA 2ZJRQ 1U26A 2VC1A 1H74A 2UUBJ 2W4DA 4ED7A 4DPUA 4XO0A 1M5OC 4DSLA 2XLIA 3H98A 1XMOF 1VCTA 1BQXA 3IMQJ 3HHNB 1UA1A 1VQ5S 2E5LF 2HNZB 1NPKA 1WWHA 3N6MA 4DBQA 2L08A 2AYMA 1D9AA 1HPZA 2XSJA 4QWAA 3I55S 3VALA 3E51A 4AL5A 3M8RA 2PI5A 2XO6A 5CCMA 1I51B 3TQ1A 1Q86T 1B99A 5DQGA 4F4AA 4DV1F 3ENQA 3C66A 1RISA 4B9UA 2XLKA 4ALZA 1N5YB 2C2OB 4C98A 3NNCA 2V68A 2OO4A 2VUGA 4NRUA 5T7LA 1T11A 5KFZA 3L09A 4N77A 2XMMA 1RTHB 3MCNA 5LSRA 1F5CA 4URSA 2CZ9A 1Y4ZB 4P6QA 4DU7A 4B3OB 1S4FA 2DNLA 3AQPA 3DOKB 3C8YA 4K5SA 2PGCA 2FLOA 5FD1A 2IYIA 4HDGA 4X64F 3J80Y 2C42A 1N5QA 2D74B 2W2NP 3MZIA 4KSEB 4OHXA 5D0HA 2LFVA 1SJFA 1NKCA 1NCLA 2MGZA 3EZUA 2R7SA 2YNIA 3MF5A 4OZNA 4ZP7A 1T05B 2HHPA 1IBLJ 1FDNA 1RAIB 4ICLB 1S9GB 4HLBA 4DR3F 3ADAC 4D3HA 2RUGA 2VBYA 2PEBA 5M2PA 3ET6A 1H98A 2XYPB 2YKMA 2Q3PA 1H72C 3R5BA 3SYZA 5DM7Q 3MAAA 2FHMA 4LUBA 1RT2A 2VPXB 5D15A 2GJ2A 2UXCF 4ELTA 1ZPVA 3P96A 2CPXA 1BD6A 3BV8A 3GIRA 1HHSA 3WZ0A 2GC8A 2KVQE 1RSCA 2BEFA 5J1NA 4LR8A 5DGAA 1RGVA 1TV6B 2DHAA 4JB8B 1LWXA 5A2QY 1TL3A 2J76E 4F26A 4KHPJ 3CD5A 1R27B 3BH6B 1PILA 1RA6A 7AT1B 5F9NA 1H7XA 1RABB 2B0GA 2KYXA 3RAQA 1U1PA 3US5A 4X4OA 1PC5A 2B9EA 3O1LA 4DWIA 1FO1A 3AD8C 3ENAA 3H25A 2VV5A 3D1OA 2MB0B 1UVMA 2WRMA 5I42A 3NXZA 4M5NA 4CLLA 3WQPA 5L39A 4TU9A 4LBIA 4M95A 1NSKL 3ILJA 2W01A 2BOPA 1SPBP 3QGPA 2RDDA 2R7XA 2KHCA 4DDFA 5ADZA 5E3QA 2D9OA 1JMTA 2F5GA 4KHMA 4KR0B 2KI2A 3MMBA 4L3KA 4DR2F 4X4NA 2KZZA 4Y2CA 2DR9A 5THWA 2R8GA 3BPDA 2YTCA 3HZEA 3KG4A 1N36J 2Y3YA 2KHDA 5C7PA 2ZD1B 4KHPF 5IQ6A 2LA6A 4MIWA 1XJWB 2OMLA 3MPWA 5K8MA 4OQJA 4UTGA 5KG1A 1G1XA 1HBOB 4HVZA 1B4SA 4DUYJ 2M8DB 5HMWA 1E6VB 4I69A 4B9MA 1RAGB 2ZKTA 1C1CA 1O51A 3BR8A 4M5DB 3SCIE 4CM2A 4CO5A 2AJFE 2K8GA 1ACMB 1MROB 3CPWR 1TR0A 2ZH4A 1S59A 1LW2B 1VMBA 3PHTA 4O4GA 1XR6A 3ONQA 3EPGA 2IJNA 2BKPA 1NU4A 5B0AA 4LF7J 1GX6A 1L3VA 2WVEA 3MHYA 2KXNB 4PAAA 2BVZA 3BYRA 3CJKA 3CCZA 2AGPA 3NGSA 1AUDA 1WKKA 1MSWD 3ZTSA 4ZPVR 1HI1A 4BLGA 4L75A 4C0HA 3T1HF 4UOCA 2R9LA 3IBWA 1AXQA 2V63A 3JS9A 2HKEA 1PKUA 2RNEA 4QBUA 4ZVGA 5E3CA 3U7JA 4DSIA 4P9SA 4A8KA 2M5YA 1AFIA 3H20A 3FC9A 3EYZA 3P5TL 2IHR1 4CO3A 2L9WA 4LRAA 2LEAA 3UPFA 5KFEA 3KLFB 3LP0B 2Y1RI 4HI2A 1I1GA 3ENWA 2YNHB 3O44A 4M5JA 1XIQA 1IKWB 1HYSA 1T9VA 1X4BA 2ZH2A 2HAFA 1S9EA 2MLXA 2AJQA 2NXCA 1XNRJ 2VL1A 2CZ4A 3MEKA 4FNHA 4IG0B 2WVDA 2W25A 4ZN1A 3GJQB 4RU2A 2VA2A 4Y2IA 5AJ3J 2H4WB 1Y7PA 5IC6B 3I96A 4AL6A 2NQPA 1X5PA 1SIWB 1FFGB 1GMWD 2VA3A 2FY8A 1IM6A 5J2MA 3NMRA 3KJQB 2ZOGA 2JC0A 4X62J 4DV3F 2WBRA 1B0TA 4RNFA 2ATLA 2EFNA 3IRXA 3T9NA 4OYOA 2QYGA 2XMTA 3SCKE 3GILA 4ED0A 4CLPA 4J7CA 2V4JB 4OX9F 3KMSA 2J0XA 3LP2B 1U6FA 2CPJA 2LEPA 3BDEA 3RBXA 2F9JA 1C0UA 1TL7A 2XO7A 4M63A 2EFOA 2N7YA 4ZLNA 4FXDA 3N6LA 3THTA 2OFGX 3MR2A 2YWEA 4WU3A 2GAHC 2ZD1A 2VIHA 2XGPA 1KTQA 2LQBA 3W5ZA 4F36A 3D6TB 4BCAA 1B3TA 2YKOA 3ZZRA 2LECA 4B3TF 2HGLA 2P6SA 3PJWA 2XLJA 3ICLA 2FDNA 1EHWA 4ECXA 4CM0A 4DF8A 3FZ2A 1MU2A 1S1XB 2HWTA 2X1FA 3SDEB 1ZM3A 2OP5A 4QQBA 4CI0B 2HURA 2G2YA 1RAFB 5I3UA 4CZCA 3LGMA 2WVFA 5J2NA 2DR7A 2ABYA 3KHLA 1HWJA 1R7IA 3C6TA 4OHZA 1U49A 4Q43A 2OGUA 1U1KA 4ZLPA 3J7Z5 3RB3A 2CJYB 2E5IA 1OSDA 5H9FK 3V4IB 2R7VA 2KB2A 1IQZA 3I0RB 1VQ8S 3LWMA 4DSEA 1JLCA 1TL4A 1ZM9A 2JH3A 2KT3A 4KO0B 1TL1A 3EE3A 2KDOA 2YQ0A 1MG7A 4RWWA 3CD6S 3UDLA 3BZQA 2MZ1A 2ZE2B 1U1LA 3CJTA 2KRBA 1FJCA 1KHWA 3NS6A 1EKRA 2XWYA 2BJ1A 2Z0GA 3AH6A 3HHLA 4IFVB 2VFUA 5GMEA 3TJ8A 4Q5VA 2V8GA 1AROP 4RW8B 3MUVP 2IIHA 4OLPA 2RRNA 1LXNA 2DRDA 2YX1A 2KYZA 2PO4A 3GFZA 3MCOA 3O5TB 4U7UK 2ZHOA 3W65A 3TRGA 3BSNA 4Q8FA 1FA0A 4Z7CA 4ANDA 4Q8EA 4ZLLA 3EICA 3K8VA 3U1NA 2XY5A 4ICLA 3QO9A 2RKIA 1AA1B 3EM1A 2ZE2A 2CVEA 3AB4B 1LW0A 1WC4A 3I32A 3K5NA 4DR6J 1S6QA 3GPAA 3MMCA 5CZVA 5LMNF 2G1DA 1TUVA 3MCSA 3FEXB 2HFSA 2OPQA 4CO1A 3CSKA 4V19X 5G4DA 4YUDA 1IKYB 2OTLS 1XNRF 2P9GA 1O8BA 2PSZA 1NK8A 3AY0A 3CD7A 2G0JA 4O3NA 2B7BB 1KQKA 1YJNS 1L3SA 4C8YA 1Z4UA 3BPSP 4PYAA 4WYWA 3UNYA 1XMQF 2YX7A 3ISZA 3MR6A 3HKWA 2QJ3A 2O67A 3IR5B 3NKYA 4DR6F 5IT9Y 4YFUA 4WBFA 2R8HA
chains in the Genus database with same CATH topology
3NS7B 2CDRB 4DCOB 2C1EB 1IBCB 1RWNB 1SC4B 1RHJB 1QTNB 2CNNB 3IBCB 2H5JB 1I51B 2Y1LB 3D6HB 3GJQB 1SC3B 2XZTB 1SC1B 2H4WB 4ZVUB 5IC6B 4LSZB 3GJTB 3R6GB 3RJMB 2C2OB 1RWOB 3KJQB 2H5IB 4ZVPB 4ZVOB 3EDRB 1RWMB 2XYHB 1RE1B 1RHRB 1F9EB 4ZVQB 3SIPB 2H48B 1RWWB 5K20B 2QL7B 3R6LB 5IC4B 2H51B 2H4YB 2XYPB 2CNKB 1RWXB 1RHKB 3R7NB 2HBZB 3EDQB 2H54B 1BMQB 1RWKB 1ICEB 4ZVTB 3GJRB 3D6MB 4JB8B 4DCPB 2FQQB 2HBYB 1GFWB 1NMEB 2HBQB 3P45B 2CJYB 1PAUB 3R7BB 2P2CB 3D6FB 2QL5B 3QNWB 1I3OB 2DKOB 1RHUB 2QL9B 2QLFB 2QLBB 2CJXB 3KJNB 3P4UB 2XYGB 2C2ZB 2Y0BB 2C2MB 2C2KB 2HBRB 4ZVRB 3R7SB 3KJFB 1QDUB 2H65B 4ZVSB 4DCJB 3R5JB 1RWPB 2CNOB 3IBFB 2QLJB 1RHMB 3GJSB 2XZDB 1RHQB 2CNLB 1PYOB 1RWVB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NS7 B;  2CDR B;  4DCO B;  2C1E B;  1IBC B;  1RWN B;  1SC4 B;  1RHJ B;  1QTN B;  2CNN B;  3IBC B;  2H5J B;  1I51 B;  2Y1L B;  3D6H B;  3GJQ B;  1SC3 B;  2XZT B;  1SC1 B;  2H4W B;  4ZVU B;  5IC6 B;  4LSZ B;  3GJT B;  3R6G B;  3RJM B;  2C2O B;  1RWO B;  3KJQ B;  2H5I B;  4ZVP B;  4ZVO B;  3EDR B;  1RWM B;  2XYH B;  1RE1 B;  1RHR B;  1F9E B;  4ZVQ B;  3SIP B;  2H48 B;  1RWW B;  5K20 B;  2QL7 B;  3R6L B;  5IC4 B;  2H51 B;  2H4Y B;  2XYP B;  2CNK B;  1RWX B;  1RHK B;  3R7N B;  2HBZ B;  3EDQ B;  2H54 B;  1BMQ B;  1RWK B;  1ICE B;  4ZVT B;  3GJR B;  3D6M B;  4JB8 B;  4DCP B;  2FQQ B;  2HBY B;  1GFW B;  1NME B;  2HBQ B;  3P45 B;  2CJY B;  1PAU B;  3R7B B;  2P2C B;  3D6F B;  2QL5 B;  3QNW B;  1I3O B;  2DKO B;  1RHU B;  2QL9 B;  2QLF B;  2QLB B;  2CJX B;  3KJN B;  3P4U B;  2XYG B;  2C2Z B;  2Y0B B;  2C2M B;  2C2K B;  2HBR B;  4ZVR B;  3R7S B;  3KJF B;  1QDU B;  2H65 B;  4ZVS B;  4DCJ B;  3R5J B;  1RWP B;  2CNO B;  3IBF B;  2QLJ B;  1RHM B;  3GJS B;  2XZD B;  1RHQ B;  2CNL B;  1PYO B;  1RWV B; 
#chains in the Genus database with same CATH topology
 3IM8 A;  5GAG I;  1U4B A;  1VS3 A;  5LXY A;  1NAQ A;  1LK5 A;  4Y3C A;  1RTD B;  1R8P A;  3NG8 A;  1S1V B;  4JI8 J;  3UN5 A;  4JV5 J;  3C15 B;  1IKV A;  3MD3 A;  3MTK A;  2CQC A;  3B4D A;  4MK9 A;  1NDK A;  1HI0 P;  4FF1 A;  1WOO A;  5LL6 d;  3GYG A;  4P74 A;  1IBK J;  2RF2 A;  4CNZ A;  3I87 A;  4WFY A;  1N32 F;  5L9X A;  3ZZY A;  3VAG A;  3PEJ A;  2ROE A;  1TK5 A;  2WBM A;  1SI9 A;  1JXV A;  2QV6 A;  4LF5 J;  2LQ5 A;  1WI8 A;  2CNN B;  2VG6 B;  2R8I A;  2HFZ A;  4DL0 C;  2RD5 C;  1DJ0 A;  1UTA A;  1CSJ A;  1RTH A;  3HP6 A;  4NCA A;  1RA7 A;  5KFR A;  3PRB A;  2B9W A;  1V3R A;  1TL5 A;  5A0Y A;  3NWG A;  1SC3 B;  1ZZF A;  2XBP A;  3IWX A;  3CJR A;  1E6V A;  3P5B P;  4A48 A;  2BR0 A;  4ELV A;  4F8R A;  1BC6 A;  1UEU A;  2KRR A;  2QMX A;  1SXL A;  2YWF A;  3EVW A;  3BM7 A;  3N0V A;  4XK8 C;  2VG5 A;  5HMZ A;  3PW0 A;  2AEJ A;  2R7Q A;  1XK8 A;  2AJ2 A;  1UKU A;  2E1A A;  2PT0 A;  5KT6 A;  3OFG A;  1HFE L;  2XY6 A;  4KC5 A;  4LSN B;  1JIH A;  1VQS A;  3DXB A;  3KDN A;  3QIP A;  3FK4 A;  1KC8 T;  1RYR A;  1REV A;  3JAM U;  2XNQ A;  4WYL A;  1VC6 A;  1SVD A;  3D0H E;  4LFC J;  1UEV A;  3I5C A;  1TVR A;  2Z56 B;  4QJV A;  2HFU A;  3CCR S;  1WC3 A;  3I9Z A;  1WEX A;  1YGY A;  4ES2 A;  5E5N A;  4ZJO A;  3KLE B;  4I2P B;  2HFN A;  1OY6 A;  2YH0 A;  4AE5 A;  5K20 B;  3TUP A;  5F8L A;  4YOE A;  4OX8 A;  2Y8W A;  3FEZ A;  4C11 A;  1HNW F;  1BE4 A;  2H4Y B;  3NCQ A;  5EX3 A;  2QO3 A;  3HHE A;  5IXU A;  3KNA A;  1ZPW X;  2HRY A;  1NK5 A;  2FGC A;  1S0N A;  3KHR A;  3FKB A;  1J5E J;  4EO6 A;  2AW0 A;  4NI2 A;  1YJ9 S;  2X1B A;  1R31 A;  3SFG A;  4X65 J;  1LOU A;  2ALZ A;  1F2H A;  1QJH A;  1A6L A;  2MJN A;  2FZK B;  2EXU A;  2HLU A;  3G87 A;  1VFJ A;  4DV0 F;  5FJ4 A;  3H4D A;  3CDW A;  1X4E A;  4NXN J;  1X9W A;  1S1U A;  4FPR A;  3RRK A;  2XQC A;  1NK0 A;  5AXK A;  4ZCL A;  5MAO A;  3CWJ A;  2JLG A;  2N4D A;  4A8S A;  1TFY A;  3CE8 A;  3ZTR A;  1T03 B;  1FFW B;  3KWM A;  1HNI B;  3N01 A;  4MYU A;  3DHW C;  3DRR A;  3NGT A;  2V9W A;  3PM9 A;  1R3N A;  1T8E A;  4F02 A;  4FP9 A;  5A6W A;  3OL7 A;  2MDA A;  4USV A;  3UQS A;  2YH1 A;  2XWX A;  2Z2M A;  4KFB A;  4YQW A;  2FHK A;  4CQ1 A;  3M9O B;  3QPI A;  3GON A;  3C46 A;  4F3Q A;  4LSL A;  1KKH A;  1KOO A;  2GMH A;  4K7Q A;  4PCQ A;  4RR5 A;  2KFY A;  2J6U A;  4FF2 A;  2IJR A;  1VIO A;  3M7V A;  3PV8 A;  5CA5 A;  5LSO A;  4DR5 J;  4RUC A;  2WAQ D;  4PXC A;  2FZG B;  2HFV A;  2W1B A;  2MHN A;  3DYA B;  1D09 B;  4UST A;  2DRB A;  3WC0 A;  3NAH A;  2GO9 A;  1Q8K A;  1R8B A;  3Q8Y A;  4G65 A;  4J9V A;  2WZ1 A;  3M2V A;  2EFG A;  2UXD F;  2QG9 B;  4JI5 J;  3E2E A;  5J2Q A;  1LV5 A;  3OTO J;  4IDK A;  1N5S A;  3TZX A;  4K4X A;  5ITH A;  2D1C A;  3MMA B;  3MXH P;  3AJ2 A;  4JI4 F;  1WUU A;  1RAH B;  3GLJ A;  4KKO A;  4NLY A;  3TR5 A;  3HSD A;  1UJ5 A;  4LF8 J;  5IWA F;  3QIP B;  4FYV B;  2QLJ B;  4TQS A;  3RBE A;  1DLO A;  1F3V A;  2WVB A;  2B43 A;  2V8D A;  3DU6 A;  4TLQ A;  5CYJ A;  1RQ0 A;  2YKN B;  2ZM6 J;  2BE2 A;  2DCU B;  4KJI A;  5D6G A;  3KK1 B;  1HWL A;  2UXD J;  3TZZ A;  2GJF A;  5DLG A;  2PI4 A;  1HQU B;  4DCO B;  3F0N A;  1N88 A;  2OEL A;  3U02 A;  4CLT A;  2EI5 A;  1T94 A;  3ZTP A;  3RZA A;  5DGB A;  3JSM B;  3CCJ S;  4KAI A;  4YEA A;  3BO3 A;  1UVK A;  2HLT A;  2DGO A;  5I4M A;  2DNN A;  2CXE A;  3HSZ A;  5EDW A;  2HQ3 A;  4I2Q A;  1RWN B;  2HPU A;  4NML A;  2VJV A;  4FYY B;  2I5J A;  4ECR A;  4NLW A;  3C6U B;  5KFG A;  4YY3 F;  1ZZN A;  3BYP A;  1LFW A;  5SZT A;  4PKD B;  3EPI A;  4KGX B;  3D0I E;  4LF7 F;  3IBC B;  3JSM A;  2WON A;  3ISN D;  1IQT A;  4G3I A;  4DR1 F;  2GZO A;  1T0T V;  3ETM A;  3NNA A;  2XHC A;  1TL3 B;  4IH7 A;  4A8Q A;  4F7V A;  4A8M P;  1S1U B;  3PXG a;  3V5R A;  4F04 B;  2HAI A;  3KLF A;  2V34 A;  3MOZ A;  4DQP A;  4NLO A;  2OD6 A;  2YNH A;  3PDN A;  3H4B A;  1NDC A;  5HI7 A;  4WTY A;  1SL2 A;  1VQ4 S;  3H90 A;  1BWE A;  4IRC A;  1Y10 A;  3T5J A;  2IMW P;  1HNI A;  1NUE A;  3VWS A;  3J7Y I;  1RCX B;  3CNQ P;  2V4Q A;  2DNP A;  2W7P A;  2DGU A;  3HHD A;  3BH7 B;  1FWP A;  5F8N A;  1AW0 A;  4WFB Q;  3W9J A;  1GAO A;  2R7W A;  3QRR A;  4OX7 A;  1FHT A;  1CJK B;  4DFP A;  1S9F A;  1UVJ A;  1YSJ A;  3LUY A;  2XEX A;  2X1G A;  3D3C J;  3IAS 9;  4K4V A;  1KFD A;  2B8P A;  3H5U A;  2K1R B;  4MFB A;  5FDL A;  1PJ7 A;  3TZY A;  5AJ3 F;  4B3R J;  1APS A;  2C3O A;  5IT0 A;  3MPV A;  1HMV A;  4LQ9 A;  2NUU G;  2GIR A;  4OZ5 A;  3EGW B;  1C1C B;  2DNY A;  3HFV A;  2BOA A;  1RT7 B;  5KG4 A;  4WZQ A;  2R2U A;  2RQK A;  1MW7 A;  3GWC A;  3GFY A;  2PMZ D;  1ICE B;  3W7B A;  4F50 A;  2BJ8 A;  5D8H B;  1NJI T;  2C28 A;  1UP1 A;  2VPZ B;  2Y1I A;  3OTO F;  1U48 A;  2BJE A;  3P45 B;  3R7B B;  1PAU B;  4OL8 A;  2F8E X;  3KJV A;  3UW1 A;  3JAM Y;  5AXM A;  1NRK A;  3M8Y A;  2DNO A;  2IVY A;  2M52 A;  3FZB A;  4WFA Q;  3M9N B;  3GIK A;  4PZV A;  5F3T A;  4FF3 A;  2VKZ G;  4NLS A;  1LW0 B;  2G9O A;  2CQ4 A;  2DHS A;  5BYS A;  2W24 A;  1WG4 A;  2HSE B;  4DL2 A;  4QCL A;  2VD3 A;  2Y0B B;  4NMX A;  3BRE A;  2ZH8 A;  3RAX A;  2CJQ A;  5J2Q B;  1ZM2 A;  4M5L A;  3PYE A;  2UUB F;  1R8H A;  1U2C A;  2HQI A;  2ZKU A;  1P9Y A;  1Q79 A;  3CDA A;  2VH7 A;  3GG1 A;  2CRL A;  1KP6 A;  2WSC C;  2ZBR A;  2E5G A;  3KNG A;  3R7S B;  2QZ8 A;  4FVM A;  3GV5 B;  3G9C A;  2BYC A;  5KFH A;  4W90 B;  2C3P A;  1CLF A;  1UFL A;  2CKW A;  4K0K J;  2V50 A;  1FKO B;  2H65 B;  1Q16 B;  2L48 A;  1RTI A;  2KG0 A;  1TMJ A;  1UW4 A;  1FRI A;  4HTJ A;  1SC6 A;  3ZZU A;  3C3L A;  4X4V A;  2AZ1 A;  4DR2 J;  5KAK A;  4NRT A;  4ZPC A;  2MQP A;  1S1V A;  2N4C A;  2U1A A;  1ZAW A;  5F8H A;  1VRU B;  3S8S A;  4YS2 A;  1YTY A;  2VDH A;  4U96 A;  1Y9O A;  4AXJ A;  1RTI B;  4DZ6 A;  2G2Z A;  3G82 B;  4F4W A;  3UD5 A;  3OL9 A;  1M1G A;  3TW0 A;  2CA9 A;  1FXD A;  3OTC A;  1B7F A;  4HKQ A;  2EG2 A;  3EVM A;  2BRK A;  1WSR A;  3LTO A;  4ECT A;  3HCX A;  4ZS6 A;  4YB7 A;  3GYN A;  2BXJ A;  5ETO A;  4Q45 A;  1BLU A;  1H2U X;  1FX4 A;  2C1E B;  1NLK L;  2DNG A;  3AXM A;  3BKU A;  2WTF A;  2RE1 A;  2G13 A;  3MM9 B;  2Z58 B;  1TKT A;  2I1R A;  4ZLJ A;  1CS4 B;  1P1L A;  1P27 B;  1S1W B;  2OPR A;  2JFD A;  1RHJ B;  2W2O P;  2ZFH A;  1RT3 B;  1S6O A;  3PAC A;  3QGI A;  2J0Q D;  4MMO A;  1KEK A;  1XNQ J;  5CYM B;  1D8Y A;  2QTW A;  1A0O B;  2VG7 B;  4LF9 F;  3V6H A;  4DPO A;  3MR3 A;  1HLW A;  2EW9 A;  4L6V 3;  4NLD A;  3G8T A;  3TJA A;  1J5E F;  3HVA A;  3OVS A;  2HNZ A;  4ETX A;  4NOH A;  3PEH A;  2MXY A;  4RWX A;  2ZBQ A;  4ZPB A;  4F3M A;  2GFF A;  3M6U A;  2E9Z A;  2CQ3 A;  2CJB A;  2E29 A;  2LLZ A;  1TTH B;  5T14 A;  2HHT A;  4OV6 A;  3A3N B;  3AHP A;  3ELH A;  2ZDO A;  4FZV A;  3TZW A;  4DQS A;  4QYZ J;  1U09 A;  3R9L A;  2L3M A;  1H6K X;  3ZO7 A;  4ZCM A;  3V4M A;  1N32 J;  3VGT A;  2ZWO A;  4C4W A;  1RE1 B;  1NB2 A;  3PX6 A;  3A3O B;  3HMJ G;  3KHH A;  4F0M A;  2GAG C;  5EWG A;  1YBA A;  4J9S A;  1HD1 A;  2PE8 A;  4EMD A;  6FD1 A;  3BDP A;  3ILO A;  2VBX A;  2FIU A;  1F5A A;  2DHX A;  1I94 F;  4USJ C;  4Y6I A;  8AT1 B;  4RU9 A;  3R6L B;  3K2Y A;  4YN3 B;  4BDP A;  2EPI A;  4CNY A;  4TQR A;  3PX4 A;  2CIM A;  2CPD A;  3QWU A;  3ZXW A;  4A8X A;  1RLC L;  1I6J A;  1YX2 A;  4K59 A;  1IKW A;  4NYZ A;  4OIX A;  4C3K A;  2YNI B;  3LH2 S;  1RWK B;  1HYS B;  3X1L B;  1RB0 A;  3Q8Q B;  3TYT A;  2FQQ B;  1P8G A;  2ZC3 A;  3KK2 A;  3O2I A;  2V5H G;  1RBA A;  1L3U A;  1TAU A;  3OR1 B;  1FKA F;  4LMZ A;  4NX9 A;  4ANC A;  1LWF B;  1OY8 A;  1GXU A;  4LJM A;  4M5K A;  2EVZ A;  5HVF A;  3QNW B;  3S7R A;  2FVP A;  2JSX A;  1ZET A;  4QWE A;  1H7W A;  5GAH I;  4MTP A;  5C2C A;  3VGS A;  5HL7 Q;  3K59 A;  4DLE A;  1ELO A;  4B3M F;  2MY7 A;  1NKB A;  3R8Y A;  5L38 A;  3K57 A;  4JI7 J;  3Q83 A;  1T3O A;  3CTR A;  3IGN A;  3RBD A;  3OJS A;  1WOS A;  2Q79 A;  3MM7 A;  4IH6 A;  4QWB A;  3T1Y F;  4M94 A;  4C8Z A;  4MYT A;  1N33 J;  5L1K A;  3B82 A;  3BBB A;  4OZ0 A;  2PD1 A;  3MTJ A;  2J7W A;  4U8Y A;  1S49 A;  1UCN A;  3AXK A;  3R5A A;  2VG7 A;  2PDA A;  2V69 A;  3LPY A;  3O3L A;  3SQO P;  5GAE I;  3BJY A;  4LFA F;  4OI1 A;  3BQ0 A;  1KWM A;  1HMV B;  1XR5 A;  2FTR A;  3IR6 B;  1RAC B;  3BQ2 A;  1NK9 A;  5IS2 A;  3SSS A;  1QDU B;  2GX8 A;  1S72 S;  3UDE A;  2ZZN A;  1NDL A;  3D4J A;  4NEZ A;  3R5J B;  2AGO A;  3DRX A;  1RT7 A;  4ED5 A;  2V2Z A;  2QIF A;  3UO0 A;  2CNO B;  4KT0 C;  4R5P A;  3MUM P;  2G4B A;  4QU7 A;  1WHW A;  4EK2 A;  5E3R A;  2MQN A;  3IBF B;  3TQE A;  5IZH A;  1X0F A;  5DDQ C;  4TNO A;  2VQF J;  2HHH F;  1XQI A;  3C6T B;  1TKX A;  2B3T B;  2XZD B;  2MKY A;  3MR7 A;  2K3K A;  4WK3 A;  3W8G A;  2FPH X;  2JEF A;  1JLQ A;  2C3Y A;  1TEL A;  4H4O A;  4NE9 C;  5HQL A;  1BHN A;  2F63 A;  2DO4 A;  2OPS B;  3GR1 A;  1HAR A;  3LPE A;  2MQQ A;  3PCO B;  1SV5 A;  2ZJQ Q;  3SCL E;  3A3P B;  1WKL A;  2QSF A;  3FSX A;  4OMF G;  2WSF C;  3TA1 A;  1B7Y B;  4K2X A;  1WF2 A;  1LWC A;  4C2M A;  3DLE B;  4EU0 A;  4MKA A;  1YBU A;  3KXD A;  3IGV A;  3LOU A;  5A76 A;  1RT5 B;  5D4N A;  3D5M A;  4A8W A;  4NI2 B;  1QTN B;  1S7I A;  4XDD A;  2ZJP Q;  4X4T A;  1W25 A;  2ZWP A;  3NS5 A;  5L1I A;  2XMV A;  1EP4 B;  5ETM A;  2W9B A;  1F3F A;  3FGV A;  2FHJ A;  2VDI A;  3QJP A;  1R0C B;  2UV8 A;  3TAN A;  3CDE A;  3OPK A;  1GQE A;  2M8H A;  3L9Z A;  4K2J A;  4UOF A;  2AZ3 A;  1BWV A;  1LWF A;  1PJ6 A;  2RJZ A;  3QWP A;  3R6G B;  2UVV A;  3E3X A;  3RJM B;  1N34 J;  2R7O A;  3MR5 A;  2KXF A;  1FKP A;  4ID5 B;  1GEH A;  3SQG A;  1T9Y A;  3AD9 C;  2DXE A;  2CQ0 A;  1IBM J;  4MFB B;  5FDL B;  1BGX T;  4ECQ A;  3ETO A;  4O3P A;  3EUN A;  3DOM A;  2FJW A;  1VRU A;  5ETT A;  3RBZ A;  3C14 A;  3IWL A;  5KG5 A;  1PG5 B;  4X4S A;  4F4Y A;  2GQ2 A;  1FDA A;  4JI0 F;  4GKK F;  5DET A;  2JVR A;  1EQ0 A;  1FRH A;  4ILR A;  2DRA A;  2BE9 B;  3HLU A;  3MMJ A;  3RUB L;  1F6T A;  1FCA A;  4CLZ A;  4B9L A;  2J7U A;  1RWW B;  1JWW A;  2IAJ B;  1MWZ A;  1H2T Z;  4G1I A;  4DV2 J;  1CVJ A;  1MMN A;  4OX6 A;  2FYX A;  2Z30 B;  2RU3 A;  3OSN A;  3PX0 A;  4CH1 A;  2FLL A;  2HS3 A;  1T9X A;  1NSP A;  2R7R A;  3SMZ A;  3AJ1 A;  3LP2 A;  5F8I A;  2DO0 A;  5EWE A;  2YX4 A;  1UWB B;  1SCJ B;  2OJ3 A;  2DJW A;  4XDC A;  3K5M A;  2GGP B;  4Z2X A;  4F4X A;  3D2W A;  4WXW A;  2UU9 F;  2G2O A;  4RW4 B;  3RAM A;  5CYM A;  1E6Y A;  2UUA J;  2CQ1 A;  4DCP B;  1REG X;  2HBY B;  2ZBP A;  1KBR A;  3H0P A;  1S97 A;  1LXJ A;  3FBF A;  3TEH B;  3PFE A;  3KUH A;  4NYP A;  1HBU A;  3D6F B;  3UWT A;  2LEB A;  4X62 F;  5CXT A;  4BS2 A;  1YHQ S;  1RTJ A;  2GGP A;  2VF3 A;  2VQF F;  2Z2Y B;  4S0M A;  5T7L B;  5C2G A;  1OPZ A;  2UVW A;  4ZIV A;  1FRK A;  1PSD A;  1FVS A;  2IY5 B;  1D9F A;  2PA3 A;  4UUX A;  4LIR A;  3PRV A;  3J7Y U;  2OFH X;  2UUT A;  4WP3 A;  3TA2 A;  2HHS A;  4TY9 A;  1WC5 A;  1WC6 A;  1H73 A;  2G1H A;  2OIH A;  4WK1 A;  4DR4 F;  1X60 A;  3A8J A;  1AUS L;  3I6P A;  1FI4 A;  3Q8P B;  1K0T A;  4FKY A;  5HK4 A;  4RNN A;  3CC2 S;  3T5K A;  1X5S A;  7FDR A;  2GS8 A;  2F65 A;  4KO0 A;  4QZV B;  3GSD A;  1FXR A;  4ES1 A;  4O44 A;  2C2K B;  4EEY A;  5D3G A;  1S4E A;  1MLA A;  1CQN A;  3NGU A;  4ECZ A;  1VRQ C;  1FJG J;  1X7V A;  5GAD I;  5F0U A;  2JOQ A;  1Y5I B;  2LCW A;  2ZBI A;  3PW7 A;  2K7J A;  4OI0 A;  2AQ4 A;  4ZPT R;  1V5V A;  3GP9 A;  1JNZ B;  2E7V A;  1JXL A;  3EZO A;  4IR9 A;  2ZHA A;  3TVY A;  1WEY A;  1PIE A;  5CHC B;  1TZ0 A;  4FVC A;  3AQO A;  4WTO B;  2ASL A;  4RL1 A;  2HRU A;  2U2F A;  4AFF A;  2O01 C;  4UQG A;  4ED2 A;  3KK2 B;  1SB6 A;  1FK9 B;  1QE1 A;  2AKW B;  3O6Q A;  3W5X A;  5J1P A;  1PYO B;  1VRT A;  2HQC A;  2SXL A;  4NLG A;  4CTA B;  4NLP A;  1XC9 A;  2CPI A;  1VQY A;  3O8W A;  3I0S A;  5E33 A;  3RR8 A;  5J1E B;  2P6T A;  2GVZ B;  4KGM A;  4HEA 9;  2UV8 G;  3G2X A;  5HBM A;  2VFT A;  5K14 B;  4CLK A;  1FX2 A;  3BGO P;  3W9I A;  2ZH9 A;  1SJ4 P;  3OVA A;  2MKH A;  1YDL A;  3MUR P;  1SIZ A;  2L41 A;  3MEE A;  3WBZ A;  2RML A;  1W26 A;  3NEK A;  2CDQ A;  3DLH A;  4NA3 A;  4P73 A;  2Y1J A;  5DZ6 A;  5U47 A;  3R2C J;  1HBM A;  2Z8Q A;  3LWL A;  1LEO A;  3E01 A;  3QT5 A;  3G8Q A;  2GW8 A;  1VLO A;  2HIY A;  4RW9 B;  4WWS A;  3U1L A;  2QFJ A;  1SUQ A;  5LMN J;  4LF6 F;  2Y1L B;  4LFB J;  3DRY A;  2B7C B;  2NYI A;  1RXO B;  1X5O A;  3NY0 A;  4DL7 A;  1U6Z A;  1QUP A;  2V9K A;  3AT1 B;  3MFH A;  1IKX A;  2CQD A;  1NK7 A;  1WOR A;  4RBT A;  3J7A N;  1HNW J;  3TAQ A;  4DHV A;  2YXL A;  3KUE A;  4I7F A;  4RW6 A;  2EG1 A;  1OQ3 A;  2LQ8 A;  3HHK A;  2J9D E;  2IA0 A;  3IWN C;  3KLE A;  2BDP A;  1X9S A;  3MI7 X;  1JK9 B;  1RT4 B;  3U1M A;  3GB0 A;  3N4W A;  3Q8V A;  5HP1 B;  4Q0B B;  3FSY A;  1JLE B;  2VJU A;  3V2U C;  3HD1 A;  3LF0 A;  1TU0 B;  4RW7 B;  4Y65 A;  1IKX B;  2E1R A;  5DG8 A;  2E1C A;  3DM2 B;  1QAI A;  4N76 A;  4OZJ A;  3QAT A;  2E9T A;  1VBY A;  3HO1 A;  3S6E A;  4LRC A;  4QIW D;  4PPZ A;  3DGP B;  1VQK S;  3C2P A;  2XB2 D;  4O3S A;  2JNJ A;  4KYZ A;  2RQ4 A;  4AQY F;  3V6D A;  1RT4 A;  1Y00 A;  4UQT A;  4JI6 J;  2V8V A;  3T41 A;  3PTW A;  1S5Z A;  3DOK A;  2A2D A;  2H51 B;  4Q7A A;  3HJV A;  2DK2 A;  1RWX B;  4PG4 A;  2I5J B;  4N5S A;  1HNX F;  4ED4 A;  2W2M P;  2MY8 A;  2CAD A;  4DUZ J;  5F8G A;  1NJX A;  4HYK A;  5KT3 A;  4PEO A;  4EBD A;  1WNE A;  4ZVT B;  4I2P A;  4RKU C;  3PG9 A;  1VOM A;  5KFF A;  4TU7 A;  2KT5 A;  4RO0 A;  3KYL A;  2ERR A;  3WX4 A;  4XPC A;  3OT9 A;  3TP2 A;  5L1J A;  1G4C A;  2WB4 A;  3QJL A;  5JVH Q;  1GMU A;  3W60 A;  2QL5 B;  3J81 j;  2XY7 A;  2ADB A;  1RT2 B;  1WHV A;  2XUL A;  2Q6B A;  2W2P P;  2FVC A;  3PRD A;  4N41 A;  1BY9 A;  4OZ1 A;  4USH A;  3NAI A;  3RGI A;  1KFS A;  1QLN A;  3CCW A;  3QFH A;  5K14 A;  2DIU A;  1HBN A;  1NHV A;  2BM1 A;  2A18 A;  3B54 A;  4HAC B;  4LRE A;  4OI2 A;  4C6A A;  5KFQ A;  2E7X A;  1NH7 A;  4X65 F;  4JV5 F;  4RUH A;  1TKT B;  3J7A 1;  4ID8 A;  4HH1 A;  1M1H A;  4H4M A;  3SCJ E;  2DH9 A;  1KR4 A;  4C0B A;  4MKB A;  3CO0 P;  3UE2 A;  3H59 A;  3PNI A;  5IM0 B;  2EKY A;  2PFD A;  2HBR B;  4ZVR B;  4C0O C;  1M5K C;  2IM1 A;  1FE4 A;  5ETN A;  1JNR B;  2GQC A;  4DPY A;  2AIR B;  4B3S F;  2BJ9 A;  1FDD A;  2MTL A;  3PFO A;  1YJ7 A;  4KFB B;  2ZC4 A;  4DV6 J;  3JYT B;  2YKN A;  2E7W A;  4ZK7 M;  3BSO A;  2XI2 A;  5H9E J;  4NCB A;  1S1X A;  2M9K A;  2GO8 A;  4NYO A;  4R8U A;  3ZZO A;  1U8W A;  4J9O A;  3OXL A;  3ZNU A;  1IR1 A;  1U1M A;  1IVZ A;  1HW9 A;  5BR8 F;  5AT1 B;  1JLE A;  1RHM B;  4ED6 A;  1OQ6 A;  1RHQ B;  2F40 A;  2MQ8 A;  5DM6 Q;  4TU8 A;  4EBE A;  4DQI A;  4WFZ A;  3PKM A;  2VPY B;  1I5O B;  1UVL A;  1FNX H;  1LWE A;  2FD2 A;  2LQ9 A;  2QMU B;  2YPY A;  3MED B;  4Z7Y A;  4FBT A;  1EET B;  2PC6 A;  5DG9 A;  4P10 A;  3NGK A;  1HI8 A;  4A47 A;  2O66 A;  3A8I A;  1IN0 A;  3CXC R;  1KQG B;  5H9F J;  3R1H A;  2B5J A;  3ZTQ A;  3V6K A;  4NXM J;  3CJK B;  5L1L A;  3I4H X;  3JTO A;  3I31 A;  1Z2Z A;  2IFX A;  4DPX A;  1LKZ A;  5IV4 A;  2RQC A;  4B9S A;  3PO4 A;  3DMJ B;  5KFY A;  5H9E K;  1EJ7 L;  2BJ7 A;  1WHY A;  2K7K A;  5J2M B;  1R6Y A;  2IVM A;  4Y2M A;  4QW9 A;  5K5M A;  2XMW A;  3QMQ A;  3ULH A;  3M8Q A;  4U95 A;  1T9W A;  3OSP A;  5B0G A;  5L9N A;  1UJ4 A;  4IYQ A;  3LA0 A;  1YJW S;  4K4U A;  3R2D J;  2F8M A;  2HS4 A;  3HVT B;  2B5J B;  4ZHR A;  1F5B A;  4BHQ A;  3TNV A;  5DRK A;  1NPR A;  2HK2 A;  1ZAV A;  3OXG A;  3RB0 A;  1SH2 A;  5IT4 A;  3DKD A;  1RUS A;  4WCE Q;  2UUC F;  1JLF A;  2YKP A;  2IAJ A;  2YWK A;  1DQ9 A;  2UUW A;  4Z37 A;  4FXW A;  3IA0 A;  3VZH A;  4JI1 J;  5KG7 A;  2EC2 A;  3WC2 A;  1RBO B;  4ZVO B;  1CJV A;  3L7U A;  4IR1 A;  1QAX A;  1VBK A;  2DVI A;  3LAL A;  1PAE X;  2GJI A;  4ED8 A;  1F9E B;  1F0X A;  1RAE B;  3HXM A;  4QU6 A;  3VHQ A;  1RT6 A;  1OJ4 A;  2DHG A;  4ZOS A;  5EX0 A;  2K3I A;  4ETZ A;  1X4C A;  2LXI A;  4A46 A;  1HIY A;  1YKW A;  2MMY A;  5T41 A;  4BWJ A;  3J80 U;  2GNK A;  1WG5 A;  4NCG A;  3AA8 A;  3AFG A;  4HR2 A;  1CJK A;  1WJ9 A;  3V6J A;  3PJX A;  5B0F A;  3MOJ B;  1YLX A;  1U1N A;  2XMU A;  1HHQ A;  1IXK A;  4ZIT A;  3DRS A;  3GG0 A;  2HND A;  3Q0A A;  4JOU A;  5CYQ A;  5F9L A;  4YR3 A;  3Q23 A;  1S10 A;  3M6X A;  4OJ3 A;  4DFJ A;  3NL0 A;  3CUL A;  3IN5 A;  1DLO B;  5KT2 A;  2CQI A;  1XN9 A;  3FBC A;  1NSQ A;  3NP5 A;  1ZTW A;  1LWE B;  1JLG A;  2J0S D;  3UFC X;  2VG5 B;  1RJJ A;  2KM8 C;  2ZNY A;  5IWA J;  4ZCI A;  1RHU B;  1U8S A;  1RAJ A;  5HQ8 A;  3J81 Y;  3MAQ A;  2KFN A;  4NWB A;  5HVG A;  4RUA A;  2QEX S;  1VQ7 S;  1S6Q B;  3MMC B;  4HHU A;  1RLD A;  3DOL B;  2QT7 A;  4LRB A;  3EGZ A;  4GVB B;  5A8R B;  3CD0 A;  4DJB A;  4X2B A;  2Q66 A;  2NYH A;  4UUW A;  1BQM A;  2IDE A;  5LMU J;  1KQF B;  1HQ2 A;  4K4Y A;  1DTT B;  2CPY A;  4TY8 A;  4LF4 J;  4OYP A;  4NXM F;  4EZ6 A;  1C1B B;  3GIM A;  1VQ6 S;  4I4B A;  4WU2 A;  4Y2K A;  4B08 A;  4ZVS B;  1PBA A;  3QT7 A;  1RYS A;  5D77 A;  4DCJ B;  4CWB A;  4PRF A;  3OVB A;  1RAA B;  2HZV A;  2CPE A;  5D0G A;  4DLG A;  4JI7 F;  4DR7 F;  4KHR A;  3GZ7 A;  3VV2 B;  3ZC4 A;  3OV7 A;  1JLF B;  1TUG B;  1D3W A;  1RAO A;  2COL A;  1PYT A;  4ZPA A;  5M2U A;  5D4O A;  3H7H B;  2F8H A;  2O1P A;  4MT1 A;  4DR4 J;  4WIQ A;  1O6X A;  1UET A;  2RRB A;  2HG4 A;  2V4J A;  3CDB A;  3WHI A;  4C9D A;  1N6Q B;  3LQV A;  4C8M A;  1UFK A;  4ZP6 A;  4WKR A;  1G2E A;  1UJ6 A;  2J5A A;  3QBC A;  4HDH A;  3VAI A;  2CPF A;  1QAY A;  5HMX A;  4QOT A;  4AT1 B;  3M2R B;  4KBI A;  5KFB A;  1PC4 A;  1L5U A;  2UXB F;  4RW9 A;  2K1R A;  4OI4 A;  4K4S A;  5J2P B;  3NCR A;  4GO7 X;  3UD3 P;  1SKS A;  2FVS A;  4ITS A;  4CLW A;  3MFI A;  5G0R A;  1U1R A;  2XC9 A;  2DEI A;  3QLH A;  4YME A;  1N6Q A;  2ZH6 A;  1X4D A;  1NHU A;  1UWB A;  3UCG A;  4DEZ A;  5HLF A;  4CCH A;  2R2S A;  4LRD A;  4LF8 F;  1AZS A;  3UCU P;  2D7S A;  4C3L A;  4RX6 A;  3RRG A;  4JI6 F;  2RIJ A;  1SKR A;  1SKW A;  3KLG A;  5HAN A;  5CYQ B;  4OJ1 A;  3CCU S;  1HNV B;  1JQG A;  5IFM A;  4NPO A;  2KJW A;  1DFD A;  3POT B;  4U67 Q;  2MKI A;  2DHH A;  4KV8 B;  3CMQ A;  3DM2 A;  2CYY A;  4LBP A;  3FCW A;  1FNO A;  4ZA1 A;  3Q8S B;  5HLF B;  2QA2 A;  4WP9 A;  1U6B A;  4R8U B;  1VJQ A;  1RTJ B;  3QYY A;  3FSI A;  4DFM A;  2VON A;  2FHJ D;  4A8F A;  1YK9 A;  4DFK A;  5GMK a;  4UT4 A;  2RH3 A;  3G86 A;  2MSS A;  4CIO A;  1URR A;  4K4Z A;  2H5I B;  2ZVI A;  3LAN A;  2YNF A;  2QE5 A;  3MM5 A;  3OXF A;  5KFM A;  2E5L J;  3HSJ A;  3TA0 A;  4EYI B;  4YR0 A;  1NDP A;  2DNR A;  2YPZ A;  4OYW A;  4NLX A;  5C5J A;  5GVQ A;  2O5D A;  1F60 B;  3L7O A;  5LOQ A;  4KPC A;  3DLB A;  3EGV A;  1B70 B;  1HKA A;  1NO8 A;  1P9Q C;  2PMW A;  4CLY A;  2QLX A;  1G6B A;  3G96 A;  4O44 B;  3P3D A;  3BGF A;  3F73 A;  4IG3 B;  5D3G B;  4DX8 H;  2AJ4 A;  3D3B J;  2XGQ A;  4ILL A;  2DIS A;  3IFE A;  3MM5 B;  3CCV S;  2GIQ A;  3CJS A;  3DCA A;  3DFE A;  3B8H A;  3EWG A;  1HR0 F;  3AOC A;  1RHK B;  1PCA A;  1KLM B;  2FJA B;  3RB4 A;  1PGZ A;  1TVR B;  3LGN A;  4DV1 J;  3DN9 A;  3HHL C;  2RUS A;  1KS2 A;  1PO6 A;  3N6N A;  1QVF R;  1T9U A;  3UVJ B;  4AXI A;  2MQL A;  3QFW A;  5JJB A;  1M0S A;  3GFX A;  3OFF A;  3OLB A;  3M8S A;  5ETV A;  3SV3 A;  1ULR A;  1NZ8 A;  4P2M A;  5F41 A;  1AFJ A;  1QSL A;  2R2T A;  2F9D A;  1Y3J A;  3KUG A;  4TYA A;  2LDI A;  1P6T A;  2NXJ A;  2XCP A;  5JVG Q;  3G82 A;  3SEO A;  3A8K A;  2YQ3 A;  1VRT B;  2ACY A;  2YVS A;  2LYV A;  5F0W A;  3L3C A;  3DI6 B;  2AX0 A;  2FGO A;  3D0G E;  3OBI A;  3SQG B;  4RZR A;  4JYA J;  3HVW A;  2DPJ A;  2DPI A;  1FJG F;  2NXN A;  5D0E A;  1KRP A;  2M7S A;  2CJX B;  1H0H B;  1C0T A;  4ILM A;  3JSY A;  2POK A;  3JTN A;  5DQH A;  3PY8 A;  3M2U B;  2QGF B;  3AA9 A;  1ZA1 B;  2K2P A;  3GQC A;  4C7Q A;  2AF6 A;  4ANE A;  1ZH5 A;  1JLB B;  2RHQ B;  2GVD B;  3F41 A;  3BSC A;  1NH8 A;  2JLE A;  3OFH A;  2CQP A;  3RW7 A;  2ASD A;  2HW3 A;  1TAQ A;  3FVY A;  2LKZ A;  1C0T B;  4B02 A;  2K06 A;  5GAE U;  1FDB A;  1D8Z A;  3FFI A;  4RNH A;  1VR6 A;  4F4Z A;  2RRA A;  2R3V A;  1URN A;  1X0P A;  1TKZ B;  3MMB B;  2DNH A;  4ZVH A;  1FES A;  2OHD A;  2E5H A;  2BAB A;  2OSQ A;  4QIF A;  3ITH B;  4JUZ A;  3FNN A;  6AT1 B;  2GVD A;  1CJT A;  3NWR A;  4RW6 B;  4ED3 A;  1NK6 A;  1WF0 A;  3OUY A;  3T6J A;  1W2B R;  1N5T A;  5L8R C;  3DRS B;  1DTQ A;  3M1V A;  4OV1 A;  2QX0 A;  4X66 J;  3DDK A;  1X9M A;  4H4K A;  4CP5 A;  1Q95 G;  2FB0 A;  1HWU A;  4JP8 A;  2V2K A;  2DY1 A;  1G7C B;  4PYD A;  1OSC A;  5LJ3 Y;  3MD1 A;  2IPO B;  3KJV B;  4E8U A;  2R2R A;  4DV3 J;  3JSB A;  2BAN B;  5KFV A;  1CJT B;  2A3J A;  2QLW A;  2V2Q A;  2VBW A;  3OTE A;  5ETR A;  2XCA A;  2HS0 A;  2Y8Y A;  2NUH A;  1UL3 A;  5A8W A;  3QZ7 A;  4OYX A;  3QRQ A;  3QID A;  2B9Y A;  2E66 A;  2E1P A;  2J9D A;  3V81 B;  4PWD A;  3I56 S;  1K9M T;  5HQM A;  2XMA A;  1Y5L B;  3ET6 B;  4DL4 A;  5IT9 U;  4I56 A;  4F25 A;  4DR3 J;  2DEJ A;  1Y3K A;  3AAW B;  3M9M B;  1WHX A;  2WCX A;  3PVX A;  4AYB D;  5GAG U;  2OUG A;  2OEM A;  4OYI A;  4HT7 A;  4CT8 A;  3HFZ B;  2JHE A;  1OY9 A;  3DOM B;  3UR3 C;  4FN5 A;  4OZ3 A;  4DV2 F;  3VR1 A;  3B4M A;  1GMW A;  4M1K A;  4EGL A;  2QYC A;  2LP4 A;  5AXL A;  3GJT B;  3VGU A;  3J7Z T;  2VKR A;  3IG1 B;  4I0W A;  3VQS A;  3IM9 A;  1Q1K A;  3NCP A;  2D3O R;  1S7H A;  4LR9 A;  1KD1 T;  4DZD A;  2HYI B;  2F7V A;  2WK4 A;  2E9R X;  4IRD A;  3DLK B;  3KFW X;  2M4M A;  2W9B B;  3CC4 S;  4RBU A;  3HZG A;  2XYH B;  2XS5 A;  3RB6 A;  4DG1 A;  3CMA S;  4DN0 A;  4UZB A;  1MN9 A;  2N7C A;  4L3N A;  1RHR B;  5CCL A;  4USW A;  2MLZ A;  3CUN A;  4JI2 J;  2HFO A;  1QM9 A;  2CZV C;  4IKA A;  1S6P A;  3VGV A;  1T02 A;  2FVR A;  1PBU A;  2DH7 A;  3T1Y J;  2VBZ A;  4DXL A;  1N0U A;  3MGJ A;  1FER A;  2B4P A;  1FF2 A;  1Q78 A;  5E3A A;  3UDC A;  1CEZ A;  2EBE A;  1IBM F;  2B4U A;  4QYR A;  2EKN A;  3PR4 A;  3JYT A;  1S1T B;  1OYD A;  3SSQ A;  4O0N A;  3DDN A;  3H42 A;  4OZL A;  2YKA A;  3TX8 A;  2DR6 A;  2AJ1 A;  3GCW P;  3IC1 A;  1S6P B;  5KFS A;  2F4V F;  3W61 A;  1ZYQ A;  1P1T A;  3EZ5 A;  3GJR B;  3W66 A;  1XBW A;  1VC5 A;  1S48 A;  3N79 A;  2KFZ A;  4IFY A;  1GFW B;  1UEK A;  3Q86 A;  4HT5 A;  3IAM 9;  3OTB A;  2FC8 A;  1DRZ A;  4CO4 A;  1Q4R A;  2DGS A;  2OEJ A;  2AD9 A;  1D9D A;  3ISN C;  4V19 J;  5D4L A;  1U2R A;  2V67 A;  1MU2 B;  3MED A;  3TO8 A;  3S1T A;  3AD7 C;  2D69 A;  3IRW P;  2JZ5 A;  4KH0 B;  2DKO B;  4RW4 A;  1FNM A;  5K8N A;  4DV4 J;  2L9D A;  2HVE A;  4ER8 A;  2DNM A;  2AJ0 A;  2CPH A;  3RG6 A;  2NR0 A;  2MZQ A;  1REV B;  3IS9 B;  4RW7 A;  5LSL A;  3KHG A;  2UVR A;  4JI4 J;  1GTE A;  5B08 A;  3DLE A;  4DUT A;  2JEI A;  4RNO A;  3OHB A;  4P7V A;  5ETP A;  2NZC A;  3WX8 A;  1S0M A;  1K1Q A;  2ZH1 A;  1KNZ A;  1UVN A;  1TL1 B;  3KTQ A;  2FJD B;  3OR2 A;  1GXL A;  3BKF A;  1Q7Y T;  5F3Z A;  4DS4 A;  3TI0 A;  1ZOT A;  3VTI A;  1RT1 A;  3T5L A;  4C11 B;  5K8P A;  3EMT A;  2W4P A;  3HVT A;  5DLF A;  5KOX A;  5L46 A;  4M8L A;  1Q5V A;  4YB6 A;  3MEG A;  5I3Q A;  4K4W A;  4I6W A;  1JB0 C;  1NB7 A;  1X5T A;  2GV1 A;  2VZ9 A;  4Y28 C;  4PR6 A;  2XM3 A;  1UMJ A;  2EBG A;  4KB7 A;  3DU5 A;  4CT9 A;  2BAC A;  4K4T A;  2BRL A;  2XTJ P;  2NSC A;  4C97 A;  1IKV B;  3CIM A;  1AT1 B;  5RUB A;  3KK3 A;  1FTC A;  1L3K A;  1M90 T;  1WOP A;  2M0G B;  3FBE A;  1O5J A;  2CUY A;  2CNL B;  2JRS A;  2YKQ A;  4GVL A;  1XWL A;  1YI2 S;  2PFF B;  4LF2 A;  3NS7 B;  2FJE B;  2HVD A;  2MLY A;  1U1O A;  4QR0 A;  2JL9 A;  2B51 A;  4QPX A;  1X4F A;  1YG0 A;  4L72 B;  3UI3 A;  1JJ2 R;  4A4J A;  4Y34 A;  3DRR B;  2W7A A;  5CZX A;  1SJR A;  2CJK A;  5AE3 A;  1HBN B;  1SH3 A;  3A13 A;  3UD4 P;  2VPW B;  4M5M A;  3MEC A;  5KFJ A;  2FVQ A;  2CG4 A;  5FLX Y;  2BE7 D;  3TAM A;  5KFX A;  5C25 B;  4JI3 F;  1IM4 A;  1H3D A;  1X4A A;  1JLA A;  5D0R A;  2EFV A;  4MKY A;  2HGN A;  5K9F A;  3CJ2 A;  2HK3 A;  2Q6C A;  3KG0 A;  3Q8U A;  2J7K A;  4ENO A;  2ATC B;  4FDF A;  4FPI A;  4I64 A;  5HN0 A;  1J27 A;  5DJB A;  2J8A A;  3DRP B;  3K5L A;  3T5H A;  4IFY B;  3FQL A;  3TJ9 A;  4DUZ F;  3RTV A;  1SC1 B;  3K8W A;  3M8Z A;  4PWU A;  4ZVU B;  2ZH3 A;  5HVH A;  4IRK A;  4J91 A;  3I0R A;  2AYB A;  1FT8 A;  2HNY B;  3H2V E;  5HAO A;  4R5P B;  1MRO A;  4P72 A;  3HSG A;  1FRM A;  4PPD A;  3DHX A;  4PG6 A;  4ERD A;  3G71 S;  1HNZ J;  4WFX A;  4G1Q A;  5EGY A;  1B0V A;  3EVO A;  4I68 A;  1RWM B;  1S0V A;  2B6A B;  3IS9 A;  4L73 A;  1SJ1 A;  1FEE A;  4LR7 A;  1TMM A;  4ZVQ B;  2RSQ A;  3K0J A;  1U7L A;  4KGV B;  2HHX A;  4I7F B;  2VU5 A;  2APO A;  5E2Q A;  5B0B A;  5LXR A;  1U25 A;  2MQO A;  3RRH A;  3JB9 k;  2H3E B;  1B0P A;  1YZ7 A;  1M5P C;  5CQG A;  1SQF A;  1WEL A;  5HP1 A;  4Q0B A;  8ATC B;  2KG1 A;  1FEH A;  1FKO A;  5GMD A;  2MKK A;  3VAM A;  2AT1 B;  4DX7 A;  1SBR A;  1LFP A;  1TQL A;  4UOG A;  1L3T A;  1RAD B;  2YQ1 A;  3HVR A;  2RDJ A;  2B56 A;  2GQQ A;  2ZOF A;  1RCO B;  1NBE B;  3DGP A;  3DMJ A;  4LFB F;  2H54 B;  3HX9 A;  3ZTO A;  1KVI A;  4IQM A;  3JQM A;  2MZT A;  3D6M B;  2IBO A;  2M3D A;  1HQE B;  3DGV A;  3FBB A;  3K89 A;  3MPY A;  4PQA A;  4TXS A;  1IJE B;  1CJU B;  3VCD A;  1N36 F;  4KTQ A;  1WDD A;  3FDS A;  2V0N A;  1Q5Y A;  2HMI A;  4KE5 A;  1R43 A;  3GR0 A;  1JLB A;  2BKO A;  2MKS A;  3MAA B;  1Q8L A;  4OI3 A;  3X3U A;  4USM A;  2DGW A;  3I0S B;  3NGR A;  3NGD A;  1FRJ A;  4RPF A;  4J9K A;  4EFA C;  4IOA Q;  4ECW A;  3DXS X;  3QGG A;  2W4C A;  2ZZT A;  4GKK J;  3K17 A;  3W63 A;  2ZM6 F;  4J9N A;  2VOD A;  1EAY C;  1UVI A;  2MPU A;  1WC1 A;  2JVO A;  3QLH B;  3VAJ A;  2I0X A;  1VDH A;  4WZM A;  3GV8 B;  2D3O 1;  2AEM A;  1NM2 A;  2FHO B;  4MIB A;  3SSR A;  2J8S A;  2DXD A;  1TL7 B;  4R0J A;  3W2W A;  3L95 X;  1BUX A;  1X8D A;  3KLI A;  3MWB A;  3R97 A;  1YJV A;  2W9C A;  5CH7 B;  1Z2L A;  4MK7 A;  4ZVF A;  1K0V A;  2MEW A;  3K5O A;  1FVQ A;  1Q8I A;  3KJF B;  3M1V B;  4PAB A;  3Q8R B;  1DZ5 A;  4JI3 J;  3W1Y C;  1FJE B;  5ETQ A;  1W2I A;  3SFU A;  1SQG A;  2AV5 A;  3MM6 A;  4YHH J;  3GII A;  3H2L A;  4N56 A;  2QSW A;  1NK4 A;  3KDO A;  1R0B G;  2E1M C;  1XER A;  2V8P A;  1R0A A;  4W92 B;  2MKC A;  2OMO A;  3R5G A;  5I3U B;  2KVI A;  2C3M A;  2MKJ A;  2NLW A;  5KFN A;  1N33 F;  3VAF A;  3IP0 A;  3S01 A;  2I8E A;  3FFI B;  4E2F B;  4CLU A;  5E41 A;  2ZZM A;  3M05 A;  2NXU A;  4LF4 F;  2RAQ A;  3D54 A;  2KTQ A;  4J37 A;  4I6Y A;  1LK7 A;  1RU2 A;  4IDK B;  3ZFV A;  3ENV A;  1C4A A;  4G6V B;  4O4R A;  2Y9H A;  4U7U D;  5DO2 A;  1V6H A;  1HNZ F;  2R8K A;  1R0A B;  2BKN A;  4LVN P;  3W3S A;  2DIT A;  3DDI A;  2O3D A;  5AE2 A;  5KFL A;  2UP1 A;  2VAS A;  1XTZ A;  5GAH U;  3CW2 C;  3CC7 S;  2WSE C;  1IUJ A;  1VQ9 S;  2VB6 A;  3DOL A;  3LP1 B;  2MST A;  5E3P A;  3TUJ C;  4ZN3 A;  2E5J A;  2EK6 A;  3BR9 A;  4J9M A;  4ZPD A;  4K5R A;  1N48 A;  2XS7 A;  4C8O A;  3GFH A;  2MHE A;  3W8P A;  2AHO B;  3CCQ S;  3BGR A;  4B17 A;  2KKH A;  3M6W A;  1ITP A;  1R8C A;  3OR2 B;  2H5J B;  3VAK A;  2RKI B;  3T1H J;  3PW2 A;  4NA1 A;  3A8E A;  5JXS A;  5MLC V;  1KOH A;  4I2Q B;  1TUW A;  1UFW A;  1CQM A;  2RDI A;  2XSF A;  4WII A;  3DLG A;  3SI8 A;  3RR7 A;  1YQH A;  4PUO B;  4UY8 5;  3HKZ D;  2VHG A;  1RWO B;  4OHV A;  4P2F A;  4B9N A;  1FXL A;  3W2V B;  3M32 A;  3KLH A;  1AB8 A;  1HL6 A;  1OS5 A;  2MQM A;  5H1S V;  3GMG A;  4ZVE A;  3SV4 A;  1VQP S;  2Q43 A;  3M8Q B;  4ED1 A;  1IBK F;  1MMD A;  4U9R A;  4LBH A;  4PG5 A;  4ZVP B;  4DX6 A;  4IO1 A;  2DGV A;  3JSR A;  4YY3 J;  1YRX A;  4JI8 F;  4NCG B;  5BXI A;  3HK2 A;  4I67 A;  4ZKA A;  2LXF A;  3IG1 A;  4X4Q A;  1T95 A;  2ZHB A;  1WKJ A;  1U2F A;  2DY9 A;  5C42 B;  2PMH A;  2W2Q P;  5HBM B;  2QL7 B;  4AD6 A;  4XPE A;  1CJV B;  2I9S A;  3TAR A;  1HBO A;  2X51 A;  1WTB A;  2AYG A;  3M2V B;  1FWL A;  3M8W A;  4OYB A;  5CD4 A;  4EBC A;  2P5V A;  1M5S A;  2IRX A;  5J1E A;  4LRF A;  4WXO A;  2XG8 A;  1CPZ A;  3AOD A;  1TKD A;  4DV7 J;  1AZS B;  2HBZ B;  3D9B A;  2WOM A;  1RT6 B;  3CT9 A;  4P2X A;  5LT5 A;  2ILZ A;  2MZS A;  3MUT P;  3PYG A;  4M5G A;  1ZM4 A;  4CO0 A;  2W9A A;  5LMU F;  1S76 D;  2L9N A;  2DXF A;  1MN7 A;  3WIV A;  3H8Y A;  4DMZ A;  1I94 J;  3UN3 A;  3TUI C;  2OTJ S;  1VGY A;  3I5A A;  1GXT A;  3M4X A;  4URG A;  2BE2 B;  4FF4 A;  1EAR A;  2OPP B;  3EXY A;  4Q2M A;  1SJQ A;  1RI7 A;  5C24 B;  4Q44 A;  1YIT S;  2OPS A;  1GK8 A;  1X4H A;  3M30 B;  1K47 A;  1E6Y B;  3T9Z A;  3TVZ A;  3JTP A;  5CAA A;  4TY8 B;  2YNG A;  4OFZ A;  4DR5 F;  1JX4 A;  4C3M A;  2NSB A;  1R8A A;  3G6V A;  1IBL F;  1DQ8 A;  1LQ9 A;  2HWH A;  1IJF B;  2CQG A;  2ADC A;  4KPY A;  2CVI A;  2LXU A;  4LT6 A;  2H5E A;  3V4I A;  3GCX P;  2JFK A;  3D1Q A;  2UU9 J;  1VQN S;  1HBU B;  4IQX A;  1JLG B;  2AWZ A;  2OPQ B;  3GE9 A;  1IWG A;  3CCM S;  1BQN A;  4B3R F;  3BO2 A;  2IRY A;  3M30 A;  4C8L A;  3Q22 A;  3WIU A;  4B9V A;  4ECV A;  4IG0 A;  1HNX J;  2XZW A;  3DLJ A;  3FMB A;  4JV0 A;  2PA8 D;  1OMS A;  4IFV A;  4LIW A;  2ALY B;  3DLG B;  4CLF A;  3PW4 A;  1XNQ F;  3CJ5 A;  1V5I B;  1RDR A;  2XMK A;  3GSI A;  3HDS A;  2DYA A;  2YWH A;  2FLN A;  5B0E A;  4A8O A;  3UCZ P;  1KSP A;  1RK8 A;  3ZZ0 A;  5KG6 A;  1SL0 A;  4EUV A;  1C1B A;  4CRJ A;  2J9E A;  2BQ3 A;  3FCV A;  2HHU A;  3FCH A;  4OHW A;  3H5X A;  2IVF B;  4HL9 A;  3T19 A;  4DR1 J;  3Q89 A;  4MJK A;  3VZI A;  3AOB A;  3E01 B;  2CPZ A;  2VG6 A;  1FE0 A;  1ZBT A;  4EO8 A;  4YP3 A;  1SUQ B;  3K5P A;  5B0D A;  3JXO A;  2FJV A;  4ELU A;  3QT8 A;  4OX9 J;  1IBC B;  2R4F A;  2FZC B;  1NJZ A;  1M1K T;  3QAU A;  5DZ7 A;  3ZNJ 1;  1DAX A;  2ZH7 A;  1N56 A;  1SC4 B;  3G6X A;  4O3O A;  4DL5 A;  4LSL B;  4E98 A;  4U6P A;  4F4K A;  5ETK A;  1JJ4 A;  2A10 A;  1MML A;  1RTD A;  3QZ8 A;  1SKU B;  2BV3 A;  3LAM A;  1X4G A;  3CO9 A;  4LSN A;  1K8A T;  1WC0 A;  3D6H B;  4G1Q B;  3BN7 A;  4G1P A;  4PG7 A;  2YWG A;  4NZ7 A;  4ZCK A;  2PEH A;  3SXL A;  2B6A A;  2R42 A;  1JJH A;  3CDU A;  3P8B B;  4BC9 A;  4DQQ A;  3MM6 B;  2I2Y A;  3DNC A;  1S1W A;  1U0S A;  2GCF A;  2OPR B;  2RS8 A;  3MMA A;  3EX7 B;  1T7P A;  3R1L A;  4EZ9 A;  1U24 A;  2LVW A;  2YNG B;  1DTQ B;  4OI6 A;  1S9G A;  4CO2 A;  2KU7 A;  2VFR A;  4WFN Q;  4LF5 F;  3Q2T C;  1EZZ B;  2CQ2 A;  3K58 A;  5D78 A;  2DCL A;  4J5O A;  1NPP A;  4ZP8 A;  2GHV C;  3T1A A;  2Z4P A;  2J6T A;  4LQ3 A;  3LAK A;  4GVB A;  5BYR A;  5A8R A;  1T9T A;  5KG3 A;  2H48 B;  3VQT A;  2KO1 A;  2UZA A;  2IMO A;  4RJV A;  4USK A;  3QGH A;  1ZTT A;  1V3Z A;  5KFU A;  3C16 A;  2OH2 A;  3MCM A;  5AE1 A;  4X4P A;  1TV6 A;  2ZIT A;  3R5D A;  4BC7 A;  2GIF A;  1S77 D;  5B09 A;  1B64 A;  2DD8 S;  1U02 A;  1WTF A;  1ZA2 B;  1R6V A;  2CNK B;  3ILL A;  2FY1 A;  2HMI B;  4FS1 A;  2ZH5 A;  4DPW A;  4WPA A;  4C8N A;  3OLA A;  4DV6 F;  1XMB A;  4TLR A;  3BGR B;  1S12 A;  5KFI A;  4EWT A;  3C16 B;  3FEY B;  3NOG A;  2XHW A;  1VI7 A;  2OD4 A;  1VK3 A;  3PYF A;  2HHQ A;  3KK3 B;  1WEZ A;  3HD2 A;  1YWX A;  2CWX A;  4USI A;  1N34 F;  4K8R A;  2DGQ A;  3HJF A;  4FYD A;  1JKH A;  2HHH J;  4PUO A;  4GMK A;  1K1S A;  2M70 A;  2QRR A;  3FJ2 A;  2Z2Z A;  4H4M B;  5DS7 A;  2RS2 A;  3NNH A;  4NEY A;  2XS2 A;  2D3Z A;  3W5Y A;  1FKP B;  4ID5 A;  2C2R A;  2NRE A;  2G0I A;  4USU A;  3QSI A;  5IV3 A;  4DI6 A;  2B4V A;  2NS1 B;  2ZNZ A;  1JXE A;  2ZDP A;  4J9P A;  1QUV A;  2AU0 A;  5LJ5 Y;  4O0I A;  4AUK A;  3N5B A;  4LF1 A;  3KLV A;  2QA1 A;  4NLV A;  2WW8 A;  4RUB A;  3G4S S;  1KQS R;  4X66 F;  3OHA A;  2B9X A;  3FQK A;  3HT0 A;  4M5D A;  1S0O A;  4RNM A;  1LNQ A;  2VIC A;  1HBM B;  1T03 A;  1FD8 A;  3GTY X;  3P6Y C;  4QYZ K;  1RKJ A;  3KLG B;  3QSY B;  1S79 A;  4GC6 A;  1Y5N B;  5ETS A;  4F2S A;  5A0Y B;  2PN6 A;  2Z2L A;  4KV8 A;  2BQU A;  3PO5 A;  1FRL A;  2EFP A;  4NAS A;  4QPT A;  1OYE A;  1BXN A;  1EB0 A;  2WW4 A;  1RKI A;  2ZUA A;  4B9T A;  2NZ4 A;  2WOM B;  4CYU B;  2A2C A;  2EFQ A;  3KLI B;  4H54 A;  4NLT A;  2I6W A;  4DV0 J;  5GAD U;  5A8W B;  1VHF A;  1TP7 A;  3DLL Q;  2H1Y A;  3DYA A;  2F1F A;  2HZA A;  4FYW B;  4DF4 A;  3GJS B;  4NLQ A;  4B3O A;  3E8O A;  2DIV A;  4I6A A;  3TOQ A;  2F3J A;  2LDY A;  1U45 A;  4IUF A;  3LP1 A;  4MIA A;  2ACM A;  4DOZ A;  2A1B A;  1FWK A;  2LA4 A;  4OLO A;  4MH8 A;  4PXE A;  1RBL A;  4P7T A;  3ZZT A;  4JV2 A;  2V8H A;  1CG2 A;  4LFA J;  3OUY B;  1QSS A;  3V6D B;  4ES3 A;  1EP4 A;  2FC9 A;  2CQH A;  3LO3 A;  1Y11 A;  4GRS A;  1PJ5 A;  4QR1 A;  3PIO Q;  2FUG 9;  3CGI A;  3I4P A;  2CAJ A;  2AGQ A;  2P9C A;  3DC2 A;  4UOH A;  1T3N A;  2C2D A;  2YKM B;  1H38 A;  2CWK A;  1S99 A;  3CCS S;  3MM8 B;  1EX8 A;  5K8O A;  5KFP A;  3PKY A;  4LFC F;  4N7T A;  1Q82 T;  3LGH A;  3M32 B;  4NA2 A;  4YHH F;  4UZC A;  5A8K B;  1UPM B;  4CDI A;  1Q8B A;  3VAH A;  2A6O A;  5EN1 A;  4D3G A;  1N54 B;  1SV5 B;  2KXH A;  2WVC A;  3HUL A;  3NOC A;  2GHP A;  1NXI A;  1WDT A;  3CVK A;  1UPP A;  2IYG A;  4GKJ F;  2Y0S D;  1MWY A;  1XEZ A;  3C6U A;  3D68 A;  4BWM A;  1K44 A;  1X31 C;  2J0W A;  2OSR A;  3VVT A;  1YJT A;  1S9E B;  2WON B;  4TN2 A;  5DDR C;  2DNQ A;  1YIJ S;  4F3O A;  4KY3 A;  2LU2 A;  1J5O B;  1N0V C;  3MPU B;  4QWD A;  3EDR B;  3D7S B;  3TEG A;  1YBT A;  1FJ7 A;  2UXC J;  2ZUG A;  1DY3 A;  3EGN A;  3W2W B;  4NXN F;  1DBD A;  1IR2 A;  2OKQ A;  3B78 A;  4I1T A;  2WHO A;  1XR7 A;  5CAB A;  3QRP A;  1U0H B;  5A6P A;  1QAJ A;  2X1A A;  4FBU A;  1UZH A;  2CQB A;  3IR7 B;  5DG7 A;  4J90 A;  3IRX B;  4PQU A;  2Z57 B;  5G0R B;  1OIA A;  5IC4 B;  2AMC B;  2NPF A;  4CH0 S;  3HT3 A;  4DG1 B;  4HTI A;  2V4R A;  2KM8 B;  4MK8 A;  3SZ2 A;  1CS4 A;  3D67 A;  5E0O A;  3Q24 A;  3PJ9 A;  4TVA B;  2AX1 A;  1RT3 A;  1C0U B;  2AEF A;  2KT2 A;  2VFV A;  3PR5 B;  4X64 J;  1VQM S;  4CLS A;  4CYU A;  2ZBC A;  1BMQ B;  4OJH A;  1LW2 A;  4WKY A;  4HI1 A;  5C42 A;  4KKO B;  1QSY A;  3JQJ A;  4KRW A;  3D1H A;  2H9Z A;  3BB5 A;  1NME B;  3A12 A;  1JJC B;  3UR0 A;  1KHV A;  1GT8 A;  3POT A;  5BYQ A;  3AJD A;  3BSA A;  3CIZ A;  1S1T A;  2KL8 A;  4M5I A;  5KFW A;  3KK1 A;  1N5Y A;  5F8M A;  3H5Y A;  1EET A;  2W8K A;  3SDE A;  1VBZ A;  4X4R A;  1EKS A;  5EWF A;  2AP6 A;  2FLP A;  5KG2 A;  3L7P A;  2QLF B;  3EXC X;  5A2Q U;  2QMW A;  5DDO C;  2HND B;  3T6B A;  3KJN B;  4WE1 B;  1HR0 J;  2XYG B;  5DDP C;  1RT1 B;  2D9P A;  1FD2 A;  4DU8 A;  4LVO P;  3QJJ A;  3FRY A;  5HJY A;  3EJM A;  3MM8 A;  4PXD A;  4DSJ A;  3R5C A;  3GV7 B;  1DUR A;  2ILY A;  2QFI A;  2MGZ B;  3IO1 A;  1XMO J;  2J9C A;  4P2S A;  4UW2 A;  4IG3 A;  1QVG R;  4JBC A;  1VIS A;  5JMN A;  1SJ3 P;  4KGZ B;  2UUA F;  2N3L A;  3TAP A;  1F9H A;  1VK8 A;  1FK9 A;  2IM2 A;  2VQE F;  3KKF A;  1WSV A;  2M88 A;  2JC1 A;  4KQZ A;  1R89 A;  2JEG A;  2X3D A;  1N52 B;  2DNZ A;  1KLN A;  1RWP B;  4W4M A;  3KMQ A;  2DGX A;  4U8V A;  4R25 A;  3BBC A;  3M2R A;  2I38 A;  3FRZ A;  2JWN A;  1QD1 A;  1HD0 A;  3QO9 B;  4PXB A;  1F1B B;  2BJ3 A;  2W7O A;  3OL6 A;  2JEJ A;  4NLU A;  3MEE B;  5B7W A;  2RF2 B;  1JKH B;  1KVK A;  3CJ4 A;  4NZ6 A;  3TAM B;  3UNG C;  4HH0 A;  4CH7 A;  5C25 A;  3HM9 A;  1JLA B;  2ZVS A;  4UF4 A;  9RUB A;  4K0K F;  3GYX B;  1OWX A;  2HWI A;  5KOW A;  2CDR B;  4KH1 B;  4MKV A;  4NL5 A;  5AXN A;  1U0H A;  3OW2 R;  3L4B C;  1U47 A;  2HRT A;  2NPI A;  3HF5 A;  1PYS B;  4GO5 X;  3PHE A;  4ZPW R;  1WAC A;  4JI1 F;  2EK1 A;  3A1Y G;  4F0H A;  2A6M A;  5KT4 A;  3PW5 A;  4UY8 T;  2CJ9 A;  4N8N A;  1Q7L B;  2C22 A;  2UUC J;  2V6A A;  1V9O A;  3NBP A;  3R3T A;  3ZZZ A;  2HNY A;  2HEK A;  4N8O A;  2EWH A;  1CC8 A;  5IOL A;  4N47 A;  5IM0 A;  2KH9 A;  1NJY A;  2BMB A;  3NRB A;  2W9C B;  5J2P A;  7FD1 A;  4ZDN A;  4JI0 J;  1CUL A;  2ASY A;  4ZP9 A;  2YBV A;  1WF1 A;  1ZAX A;  2IJF A;  2YNF B;  1C2P A;  2E44 A;  5KFO A;  2NXE A;  4ECS A;  4E0D A;  4DS5 A;  1CBK A;  1VIX A;  3M6V A;  3H40 A;  2C2E A;  4O3Q A;  1GMV A;  1MNE A;  4DN9 A;  2C3U A;  2RT3 A;  1VC0 A;  2W8L A;  4BBY A;  2LQJ A;  1S6U A;  3OQ2 A;  4DQR A;  2AYE A;  1U1Q A;  2OAU A;  2DR5 A;  2QC3 A;  1HNV A;  3BS9 A;  3PYD A;  4ZJL A;  9ATC B;  5DQI A;  2RU9 A;  5I3P A;  3HHL B;  3D28 A;  4FXV A;  1KTV A;  3SBM A;  3QQC D;  1NHK L;  4RLE A;  4H4O B;  4J9R A;  2VOO A;  3WDO A;  1BQN B;  2BAN A;  4X84 A;  3SIP B;  4YB5 A;  1HWK A;  3A4T A;  2HZC A;  1NJW A;  2DH8 A;  1NZA A;  3TVK A;  1DTT A;  3THV A;  1RZM A;  4WP8 A;  4Y2A A;  4DX5 A;  4ZIW A;  4DV5 F;  2HVH A;  3HHL D;  2BUN A;  5D4P A;  4LF6 J;  4FNI A;  3OR1 A;  4FS2 A;  1YZ6 A;  3HFK A;  4RBV A;  5FII A;  4W98 A;  4XTT A;  4MAK A;  3DI6 A;  3I5B A;  1GTH A;  1RT5 A;  3G6E S;  3CCE S;  5KFK A;  4WF9 Q;  1FFS B;  3JQK A;  5HJX A;  1VBX A;  1SH0 A;  3BF4 A;  1KDN A;  4DPT A;  5KG0 A;  1F9F A;  4PG8 A;  2IDL A;  3W64 A;  3AB2 B;  3FMW A;  2R7U A;  4DR7 J;  1N5V A;  4FYX B;  3NMA A;  2GML A;  2DT9 A;  3I9V 9;  1HHT P;  2XMJ A;  1KLM A;  4DSK A;  2QA4 G;  3CCT A;  1KON A;  1HW8 A;  1GH8 A;  4P75 A;  4F2R A;  4JV1 A;  2OI2 A;  3T3F A;  2IM0 A;  1I3O B;  2N82 B;  2QLB B;  2QL9 B;  3G6Y A;  3PIP Q;  2MJU A;  1RP5 A;  2JLF A;  1N8R T;  1NKE A;  3FUY A;  1HQE A;  2C2Z B;  2OLW A;  1J5O A;  4X4U A;  4K50 A;  1QY7 A;  4OYM A;  4EI2 A;  4F67 A;  3CF5 Q;  5BR8 J;  1NND A;  4L74 A;  1QTM A;  1M5H A;  3CJQ A;  2N3O A;  1HWI A;  2P8I A;  2QA4 S;  1XMQ J;  1HPZ B;  2XI3 A;  2XSJ B;  1UAW A;  2C2M B;  2NCK L;  2ZEJ A;  4NZ0 A;  3J81 U;  1NSA A;  4F0K A;  4C8K A;  1WI6 A;  4DSF A;  1CUL B;  1DAR A;  2RHS B;  3DRP A;  1M5V C;  1TFW A;  1TKX B;  4Y0F A;  4HAC A;  3D66 A;  4YR2 A;  1Q53 A;  3M2U A;  4QWC A;  3OJU A;  4ECY A;  1D0E A;  2GA7 A;  2IA6 A;  2RVJ A;  2C2N A;  4B3M J;  4JYA F;  1KVJ A;  1YVF A;  1UA0 A;  4IO9 Q;  4OJG A;  2QN6 B;  1G3O A;  4YB1 P;  1D1U A;  2UXB J;  2X3G A;  4LF9 J;  3CJ8 A;  4WJB A;  4QW8 A;  2MZR A;  1HQU A;  2JX2 A;  2BZ2 A;  4M5H A;  3K7R A;  2VFS A;  2HVZ A;  4P52 A;  5ETL A;  5EUH A;  5SUH A;  5CD4 H;  2HHW A;  3W62 A;  3CB4 A;  4ZJQ A;  5HAT A;  1VLY A;  3I82 A;  5F8J A;  2VC0 A;  1TKZ A;  1SQE A;  2LMI A;  4DL6 A;  2CJA A;  1GX5 A;  2BQR A;  3OL8 A;  5FLX U;  4ATN A;  3BO4 A;  1JLC B;  3HPO A;  3OTD A;  2BBE A;  3OD2 A;  1A9N B;  3RW6 A;  1T05 A;  4OZ2 A;  1RU1 A;  4B3S J;  4JI2 F;  4U7C A;  4WE1 A;  5HO4 A;  1VHI A;  3KG1 A;  3U27 A;  1SL1 A;  1YJR A;  2KJV A;  2ASJ A;  4OYA A;  3BBF A;  2ROG A;  3NLC A;  1JLQ B;  2YY3 A;  3BQ1 A;  3VVU A;  3GU0 A;  3CCL S;  4DUY F;  3OFE A;  5KTQ A;  3G8S A;  1RTZ A;  2BJD A;  2HIQ A;  2JJ4 D;  2RQM A;  4JI5 F;  5KFA A;  3UVJ A;  1AYE A;  2HHV A;  1DQA A;  2V2V A;  4OHY A;  2F4V J;  4QIV A;  3V81 A;  2UVU A;  4PWD B;  4DL3 A;  4TYB A;  5M2R A;  5BJR A;  2XZT B;  2X7I A;  4OYZ A;  1K73 T;  4ZMM A;  2OEK A;  4LSZ B;  4DV5 J;  1LWC B;  3M8P A;  4XIU A;  3LP0 A;  3W9H A;  4PWW A;  4B3T J;  3H5S A;  3N9U C;  4AQY J;  3C19 A;  2KZM A;  2MYF A;  3QT6 A;  5E7O B;  4GC7 A;  2BM0 A;  3P49 B;  5HRO B;  5A8K A;  3TUZ C;  1YRU A;  2BA9 A;  2F4F A;  3TWZ A;  2WB1 D;  3RU0 A;  2EEY A;  5KFD A;  1Q81 T;  4YDD B;  3RYL A;  1IR0 A;  2B8Q A;  3AOA A;  1YJU A;  2RIL A;  2IM3 A;  2Q1L A;  3CJ0 A;  4Q2L A;  3F56 A;  4HHJ A;  4QIG A;  4ZHR B;  2HGM A;  4C48 A;  6FDR A;  4J9L A;  4AL7 A;  3CME S;  3MM7 B;  3M8P B;  2FJB B;  4CTA A;  1VQO S;  1FTR A;  1VJW A;  4XAK A;  5EHH A;  3N28 A;  1Y0H A;  4TKT A;  3Q2S C;  1VQL S;  2CFX A;  3DLK A;  5B0C A;  4GKJ J;  3MDF A;  2ZOM A;  3UN2 A;  3C15 A;  3BGU A;  3QAE A;  1UWA A;  2G0C A;  4YDX A;  1WG1 A;  3BEG B;  3MEC B;  1UW9 A;  2CG8 A;  5KT7 A;  3HI9 A;  4HHH A;  1YRT A;  3BN4 A;  3NBP B;  2OPP A;  3ITH A;  5C24 A;  3R7N B;  2IBK A;  3KOA A;  2MZJ A;  2DGT A;  2JDJ A;  4L76 A;  5HSP A;  2HQF A;  1CC7 A;  2RB7 A;  3EDQ B;  1IWA A;  1OPI A;  5HMY A;  2J6S A;  1GNK A;  2YWW A;  4O4G B;  2HQG A;  2VQE J;  4PQU B;  4IH5 A;  4IOB A;  2HBQ B;  1KN6 A;  1MWQ A;  1O0P A;  3VF0 B;  2VOP A;  5JUM A;  4J9Q A;  2P2C B;  2LU1 A;  1ROF A;  1A7G E;  3BGL A;  4IOC Q;  3THP A;  3H2U B;  4ECU A;  4R0E A;  5LM7 E;  2IC3 B;  5J2N B;  2GHW A;  3CED A;  1OO0 B;  2DTJ A;  3P4U B;  4H4K C;  4Y00 A;  2D3U A;  1V3S A;  1HA1 A;  1ZS6 A;  5KT5 A;  2R8J A;  1WD6 A;  1F2G A;  1EQM A;  2P9E A;  3UDV A;  2DNK A;  2HQD A;  2DBB A;  4KIA A;  2A0F B;  2BW2 A;  2BX6 A;  3GIJ A;  3CJ3 A;  2EC0 A;  2XNR A;  2B4O A;  4O3R A;  2IC3 A;  1J2V A;  3N5F A;  4NLR A;  1N4L A;  2GMJ A;  2KN4 A;  2PII A;  3ILI A;  4V1A k;  1H2V Z;  4EYH B;  1TK0 A;  1RWU A;  1W7W A;  1TK8 A;  1Z1Z A;  2BW7 A;  1QE1 B;  1VYA A;  4DV7 F;  3PZP A;  1EIY B;  4RW8 A;  3F44 A;  3R27 A;  5KFC A;  4DV4 F;  2R7T A;  2FJX A;  2DB1 A;  3W2V A;  3KLH B;  1C4C A;  2DR8 A;  1BQM B;  2IRU A;  5HRO A;  2GVZ A;  2V94 A;  4FKX A;  1UZD A;  4P71 A;  1S57 A;  2ROP A;  3ZZP A;  2D41 A;  3LW5 C;  3C14 B;  3BKT A;  3B6B A;  1CJU A;  4J9U E;  4QIE A;  3MM9 A;  8RUC A;  5IQQ A;  3TX0 A;  4A8Y A;  2HVI A;  3MEG B;  1RWV B;  2M2B A;  3IXQ A;  3MAH A;  1IKY A;  4O23 A;  1Q0N A;  4QR2 A;  5I42 B;  5KFT A;  1DHM A;  1FRX A;  4URQ U;  4KGK A;  1NEE A;  3MPD A;  2ZJR Q;  1U26 A;  2VC1 A;  1H74 A;  2UUB J;  2W4D A;  4ED7 A;  4DPU A;  4XO0 A;  1M5O C;  4DSL A;  2XLI A;  3H98 A;  1XMO F;  1VCT A;  1BQX A;  3IMQ J;  3HHN B;  1UA1 A;  1VQ5 S;  2E5L F;  2HNZ B;  1NPK A;  1WWH A;  3N6M A;  4DBQ A;  2L08 A;  2AYM A;  1D9A A;  1HPZ A;  2XSJ A;  4QWA A;  3I55 S;  3VAL A;  3E51 A;  4AL5 A;  3M8R A;  2PI5 A;  2XO6 A;  5CCM A;  1I51 B;  3TQ1 A;  1Q86 T;  1B99 A;  5DQG A;  4F4A A;  4DV1 F;  3ENQ A;  3C66 A;  1RIS A;  4B9U A;  2XLK A;  4ALZ A;  1N5Y B;  2C2O B;  4C98 A;  3NNC A;  2V68 A;  2OO4 A;  2VUG A;  4NRU A;  5T7L A;  1T11 A;  5KFZ A;  3L09 A;  4N77 A;  2XMM A;  1RTH B;  3MCN A;  5LSR A;  1F5C A;  4URS A;  2CZ9 A;  1Y4Z B;  4P6Q A;  4DU7 A;  4B3O B;  1S4F A;  2DNL A;  3AQP A;  3DOK B;  3C8Y A;  4K5S A;  2PGC A;  2FLO A;  5FD1 A;  2IYI A;  4HDG A;  4X64 F;  3J80 Y;  2C42 A;  1N5Q A;  2D74 B;  2W2N P;  3MZI A;  4KSE B;  4OHX A;  5D0H A;  2LFV A;  1SJF A;  1NKC A;  1NCL A;  2MGZ A;  3EZU A;  2R7S A;  2YNI A;  3MF5 A;  4OZN A;  4ZP7 A;  1T05 B;  2HHP A;  1IBL J;  1FDN A;  1RAI B;  4ICL B;  1S9G B;  4HLB A;  4DR3 F;  3ADA C;  4D3H A;  2RUG A;  2VBY A;  2PEB A;  5M2P A;  3ET6 A;  1H98 A;  2XYP B;  2YKM A;  2Q3P A;  1H72 C;  3R5B A;  3SYZ A;  5DM7 Q;  3MAA A;  2FHM A;  4LUB A;  1RT2 A;  2VPX B;  5D15 A;  2GJ2 A;  2UXC F;  4ELT A;  1ZPV A;  3P96 A;  2CPX A;  1BD6 A;  3BV8 A;  3GIR A;  1HHS A;  3WZ0 A;  2GC8 A;  2KVQ E;  1RSC A;  2BEF A;  5J1N A;  4LR8 A;  5DGA A;  1RGV A;  1TV6 B;  2DHA A;  4JB8 B;  1LWX A;  5A2Q Y;  1TL3 A;  2J76 E;  4F26 A;  4KHP J;  3CD5 A;  1R27 B;  3BH6 B;  1PIL A;  1RA6 A;  7AT1 B;  5F9N A;  1H7X A;  1RAB B;  2B0G A;  2KYX A;  3RAQ A;  1U1P A;  3US5 A;  4X4O A;  1PC5 A;  2B9E A;  3O1L A;  4DWI A;  1FO1 A;  3AD8 C;  3ENA A;  3H25 A;  2VV5 A;  3D1O A;  2MB0 B;  1UVM A;  2WRM A;  5I42 A;  3NXZ A;  4M5N A;  4CLL A;  3WQP A;  5L39 A;  4TU9 A;  4LBI A;  4M95 A;  1NSK L;  3ILJ A;  2W01 A;  2BOP A;  1SPB P;  3QGP A;  2RDD A;  2R7X A;  2KHC A;  4DDF A;  5ADZ A;  5E3Q A;  2D9O A;  1JMT A;  2F5G A;  4KHM A;  4KR0 B;  2KI2 A;  3MMB A;  4L3K A;  4DR2 F;  4X4N A;  2KZZ A;  4Y2C A;  2DR9 A;  5THW A;  2R8G A;  3BPD A;  2YTC A;  3HZE A;  3KG4 A;  1N36 J;  2Y3Y A;  2KHD A;  5C7P A;  2ZD1 B;  4KHP F;  5IQ6 A;  2LA6 A;  4MIW A;  1XJW B;  2OML A;  3MPW A;  5K8M A;  4OQJ A;  4UTG A;  5KG1 A;  1G1X A;  1HBO B;  4HVZ A;  1B4S A;  4DUY J;  2M8D B;  5HMW A;  1E6V B;  4I69 A;  4B9M A;  1RAG B;  2ZKT A;  1C1C A;  1O51 A;  3BR8 A;  4M5D B;  3SCI E;  4CM2 A;  4CO5 A;  2AJF E;  2K8G A;  1ACM B;  1MRO B;  3CPW R;  1TR0 A;  2ZH4 A;  1S59 A;  1LW2 B;  1VMB A;  3PHT A;  4O4G A;  1XR6 A;  3ONQ A;  3EPG A;  2IJN A;  2BKP A;  1NU4 A;  5B0A A;  4LF7 J;  1GX6 A;  1L3V A;  2WVE A;  3MHY A;  2KXN B;  4PAA A;  2BVZ A;  3BYR A;  3CJK A;  3CCZ A;  2AGP A;  3NGS A;  1AUD A;  1WKK A;  1MSW D;  3ZTS A;  4ZPV R;  1HI1 A;  4BLG A;  4L75 A;  4C0H A;  3T1H F;  4UOC A;  2R9L A;  3IBW A;  1AXQ A;  2V63 A;  3JS9 A;  2HKE A;  1PKU A;  2RNE A;  4QBU A;  4ZVG A;  5E3C A;  3U7J A;  4DSI A;  4P9S A;  4A8K A;  2M5Y A;  1AFI A;  3H20 A;  3FC9 A;  3EYZ A;  3P5T L;  2IHR 1;  4CO3 A;  2L9W A;  4LRA A;  2LEA A;  3UPF A;  5KFE A;  3KLF B;  3LP0 B;  2Y1R I;  4HI2 A;  1I1G A;  3ENW A;  2YNH B;  3O44 A;  4M5J A;  1XIQ A;  1IKW B;  1HYS A;  1T9V A;  1X4B A;  2ZH2 A;  2HAF A;  1S9E A;  2MLX A;  2AJQ A;  2NXC A;  1XNR J;  2VL1 A;  2CZ4 A;  3MEK A;  4FNH A;  4IG0 B;  2WVD A;  2W25 A;  4ZN1 A;  3GJQ B;  4RU2 A;  2VA2 A;  4Y2I A;  5AJ3 J;  2H4W B;  1Y7P A;  5IC6 B;  3I96 A;  4AL6 A;  2NQP A;  1X5P A;  1SIW B;  1FFG B;  1GMW D;  2VA3 A;  2FY8 A;  1IM6 A;  5J2M A;  3NMR A;  3KJQ B;  2ZOG A;  2JC0 A;  4X62 J;  4DV3 F;  2WBR A;  1B0T A;  4RNF A;  2ATL A;  2EFN A;  3IRX A;  3T9N A;  4OYO A;  2QYG A;  2XMT A;  3SCK E;  3GIL A;  4ED0 A;  4CLP A;  4J7C A;  2V4J B;  4OX9 F;  3KMS A;  2J0X A;  3LP2 B;  1U6F A;  2CPJ A;  2LEP A;  3BDE A;  3RBX A;  2F9J A;  1C0U A;  1TL7 A;  2XO7 A;  4M63 A;  2EFO A;  2N7Y A;  4ZLN A;  4FXD A;  3N6L A;  3THT A;  2OFG X;  3MR2 A;  2YWE A;  4WU3 A;  2GAH C;  2ZD1 A;  2VIH A;  2XGP A;  1KTQ A;  2LQB A;  3W5Z A;  4F36 A;  3D6T B;  4BCA A;  1B3T A;  2YKO A;  3ZZR A;  2LEC A;  4B3T F;  2HGL A;  2P6S A;  3PJW A;  2XLJ A;  3ICL A;  2FDN A;  1EHW A;  4ECX A;  4CM0 A;  4DF8 A;  3FZ2 A;  1MU2 A;  1S1X B;  2HWT A;  2X1F A;  3SDE B;  1ZM3 A;  2OP5 A;  4QQB A;  4CI0 B;  2HUR A;  2G2Y A;  1RAF B;  5I3U A;  4CZC A;  3LGM A;  2WVF A;  5J2N A;  2DR7 A;  2ABY A;  3KHL A;  1HWJ A;  1R7I A;  3C6T A;  4OHZ A;  1U49 A;  4Q43 A;  2OGU A;  1U1K A;  4ZLP A;  3J7Z 5;  3RB3 A;  2CJY B;  2E5I A;  1OSD A;  5H9F K;  3V4I B;  2R7V A;  2KB2 A;  1IQZ A;  3I0R B;  1VQ8 S;  3LWM A;  4DSE A;  1JLC A;  1TL4 A;  1ZM9 A;  2JH3 A;  2KT3 A;  4KO0 B;  1TL1 A;  3EE3 A;  2KDO A;  2YQ0 A;  1MG7 A;  4RWW A;  3CD6 S;  3UDL A;  3BZQ A;  2MZ1 A;  2ZE2 B;  1U1L A;  3CJT A;  2KRB A;  1FJC A;  1KHW A;  3NS6 A;  1EKR A;  2XWY A;  2BJ1 A;  2Z0G A;  3AH6 A;  3HHL A;  4IFV B;  2VFU A;  5GME A;  3TJ8 A;  4Q5V A;  2V8G A;  1ARO P;  4RW8 B;  3MUV P;  2IIH A;  4OLP A;  2RRN A;  1LXN A;  2DRD A;  2YX1 A;  2KYZ A;  2PO4 A;  3GFZ A;  3MCO A;  3O5T B;  4U7U K;  2ZHO A;  3W65 A;  3TRG A;  3BSN A;  4Q8F A;  1FA0 A;  4Z7C A;  4AND A;  4Q8E A;  4ZLL A;  3EIC A;  3K8V A;  3U1N A;  2XY5 A;  4ICL A;  3QO9 A;  2RKI A;  1AA1 B;  3EM1 A;  2ZE2 A;  2CVE A;  3AB4 B;  1LW0 A;  1WC4 A;  3I32 A;  3K5N A;  4DR6 J;  1S6Q A;  3GPA A;  3MMC A;  5CZV A;  5LMN F;  2G1D A;  1TUV A;  3MCS A;  3FEX B;  2HFS A;  2OPQ A;  4CO1 A;  3CSK A;  4V19 X;  5G4D A;  4YUD A;  1IKY B;  2OTL S;  1XNR F;  2P9G A;  1O8B A;  2PSZ A;  1NK8 A;  3AY0 A;  3CD7 A;  2G0J A;  4O3N A;  2B7B B;  1KQK A;  1YJN S;  1L3S A;  4C8Y A;  1Z4U A;  3BPS P;  4PYA A;  4WYW A;  3UNY A;  1XMQ F;  2YX7 A;  3ISZ A;  3MR6 A;  3HKW A;  2QJ3 A;  2O67 A;  3IR5 B;  3NKY A;  4DR6 F;  5IT9 Y;  4YFU A;  4WBF A;  2R8H A; 
#chains in the Genus database with same CATH homology
 3NS7 B;  2CDR B;  4DCO B;  2C1E B;  1IBC B;  1RWN B;  1SC4 B;  1RHJ B;  1QTN B;  2CNN B;  3IBC B;  2H5J B;  1I51 B;  2Y1L B;  3D6H B;  3GJQ B;  1SC3 B;  2XZT B;  1SC1 B;  2H4W B;  4ZVU B;  5IC6 B;  4LSZ B;  3GJT B;  3R6G B;  3RJM B;  2C2O B;  1RWO B;  3KJQ B;  2H5I B;  4ZVP B;  4ZVO B;  3EDR B;  1RWM B;  2XYH B;  1RE1 B;  1RHR B;  1F9E B;  4ZVQ B;  3SIP B;  2H48 B;  1RWW B;  5K20 B;  2QL7 B;  3R6L B;  5IC4 B;  2H51 B;  2H4Y B;  2XYP B;  2CNK B;  1RWX B;  1RHK B;  3R7N B;  2HBZ B;  3EDQ B;  2H54 B;  1BMQ B;  1RWK B;  1ICE B;  4ZVT B;  3GJR B;  3D6M B;  4JB8 B;  4DCP B;  2FQQ B;  2HBY B;  1GFW B;  1NME B;  2HBQ B;  3P45 B;  2CJY B;  1PAU B;  3R7B B;  2P2C B;  3D6F B;  2QL5 B;  3QNW B;  1I3O B;  2DKO B;  1RHU B;  2QL9 B;  2QLF B;  2QLB B;  2CJX B;  3KJN B;  3P4U B;  2XYG B;  2C2Z B;  2Y0B B;  2C2M B;  2C2K B;  2HBR B;  4ZVR B;  3R7S B;  3KJF B;  1QDU B;  2H65 B;  4ZVS B;  4DCJ B;  3R5J B;  1RWP B;  2CNO B;  3IBF B;  2QLJ B;  1RHM B;  3GJS B;  2XZD B;  1RHQ B;  2CNL B;  1PYO B;  1RWV B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...