1F5CA

Crystal structure of f25h ferredoxin 1 mutant from azotobacter vinelandii at 1.75 angstrom resolution
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
106
structure length
106
Chain Sequence
AFVVTDNCIKCKYTDCVEVCPVDCHYEGPNFLVIHPDECIDCALCEPECPAQAIFSEDEVPEDMQEFIQLNAELAEVWPNITEKKDPLPDAEDWDGVKGKLQHLER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords FERREDOXIN 1
publication title Crystal structures of ferredoxin variants exhibiting large changes in [Fe-S] reduction potential.
pubmed rcsb
source organism Azotobacter vinelandii
total genus 31
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 2000-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00037 Fer4 4Fe-4S binding domain
A PF11953 DUF3470 Domain of unknown function (DUF3470)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1f5cA00
7FD1A 1FTCA 1H0HB 1R27B 3IR5B 1KQFB 6FD1A 1FDNA 7FDRA 5FD1A 1BC6A 3LW5C 1KQGB 3EUNA 2Z8QA 3IR7B 3MMCB 4RKUC 1Y4ZB 1HFEL 1B0PA 3EXYA 2UZAA 1VJWA 2O01C 3MM5A 2IVFB 4AYBD 1AXQA 2V4JA 3C8YA 1GAOA 1IR0A 1FF2A 3MMBB 1F5CA 3MM7B 1CLFA 2GMJA 3MM6B 3OR2A 1RGVA 1FRHA 3MMCA 1H98A 1Q16B 1G6BA 1BQXA 2VKRA 2C3UA 2WB1D 1H7WA 4YDDB 4L6V3 2PMZD 1F2GA 4KT0C 2FJDB 3MMBA 1FRJA 3MM7A 2XSJB 3MM8A 2FJBB 2WAQD 1PC5A 3MMAB 3MM9A 1C4AA 1PC4A 1DAXA 5CHCB 1K0TA 1G3OA 4Y28C 1GT8A 1IQZA 2PDAA 4OV1A 1B0VA 1JB0C 3PNIA 5L8RC 5BYSA 1FEHA 2FJEB 1D3WA 1F5BA 1H7XA 1FDBA 2XSJA 1FD2A 2FD2A 1FRXA 2C3YA 3MM5B 1JNRB 1FRMA 3EGWB 2V4JB 1C4CA 1DURA 1FRLA 1XERA 2C42A 2VPZB 2C3PA 3MM6A 1FDAA 1GTEA 5BYRA 2V2KA 2VPWB 1JNZB 1SIZA 1FXRA 2FDNA 1BD6A 2GMHA 3OR1B 1B0TA 2C3OA 2Y0SD 2ZVSA 1KEKA 3OR2B 1GTHA 2C3MA 1BWEA 5BYQA 1A6LA 1Y5NB 1SIWB 1Y5IB 1DFDA 2WSEC 2WSFC 4XDCA 4CI0B 1FDDA 1Y5LB 1SJ1A 1FXDA 5E7OB 1ROFA 3MMAA 3HKZD 4XDDA 4OMFG 1FERA 2PA8D 1FRKA 2FGOA 2VPXB 4ID8A 5CH7B 6FDRA 1FRIA 2FJAB 3MM8B 1FCAA 4DHVA 1WTFA 1BLUA 3MM9B 2VPYB 2WSCC 3OR1A 4XK8C 3GYXB 3IR6B
chains in the Genus database with same CATH superfamily
2VC1A 3PDNA 6FD1A 1NSKL 4GKJJ 2R8JA 1HI8A 3H20A 2VIHA 1AXQA 3NNHA 4NRUA 4TU9A 4F0HA 1TL7B 3ZNJ1 3UWTA 5DG8A 2P2CB 2GMJA 2LA6A 1HNXJ 5B0AA 2IMWP 4XPCA 2WVEA 2XNRA 1OJ4A 1KOHA 1U2FA 2DRBA 3LP0A 3K57A 5CHCB 2HIYA 1NJXA 4F7VA 1N34J 3MPDA 2GO9A 2BVZA 1PJ6A 3RAMA 4QIWD 4USIA 3HHLA 3TR5A 4CYUA 1LK5A 1N54B 3W66A 2R2RA 2MTLA 2NYIA 3BGLA 1RAFB 3DLBA 4PWWA 2XMWA 1TKTB 2DCLA 5GAEU 3RU0A 3CJ3A 5KFJA 1U1QA 3FEXB 4OX7A 3HHDA 1AA1B 4HACA 1OY9A 2RAQA 3E2EA 1HQEA 3NGRA 4DCJB 5DZ6A 5L1LA 3ZFVA 2HW3A 5DDRC 1YIJS 1B0PA 4F4YA 3NG8A 3DOLB 1SC4B 1HR0F 4DSJA 5AE1A 4MIWA 1DY3A 2GS8A 3ETOA 4ZVRB 4PR6A 4EO8A 3G8SA 4URQU 4Q44A 3EE3A 1X8DA 3QIPA 2BUNA 1S57A 3C14B 1OWXA 1KFSA 4B3OA 1FK9B 3D1OA 1FJGF 1XMOJ 3ZZUA 3LP1B 3I32A 5AE2A 1UA1A 4DFPA 2UV8A 3MUTP 5D77A 3PCOB 4QYZK 1RE1B 2CQ4A 2IC3B 1UVIA 4ZLJA 4O0NA 2H4YB 1R8BA 3M05A 4MKAA 4KY3A 1PKUA 3QGHA 2OUGA 4DR7J 4WK3A 1UWAA 2HQDA 3IFEA 1VQMS 4EBDA 1RJJA 4BWJA 3SFUA 1VJWA 5LJ3Y 4UF4A 1DLOB 3KJVA 2QSWA 2FC9A 3PKMA 1CLFA 4I67A 2NUHA 3N4WA 3RAXA 4ZVSB 3IMQJ 1O8BA 3RRGA 4I2QB 4OJ1A 5HP1B 4JI7F 5HVHA 3H4BA 5F8GA 3DLEB 3Q8SB 1V9OA 5A76A 3D6FB 2F8HA 3OPKA 4ZP8A 5CQGA 2YWWA 3Q24A 4K5RA 3GCXP 5F0WA 2B6AB 3EGWB 4AD6A 4WFNQ 3V6KA 2DNNA 2YKMB 2MZTA 3R5JB 3MPYA 3UN3A 4AFFA 4P7VA 4W90B 1C2PA 2WOMB 2H48B 1DARA 1U1KA 4EK2A 2FHJD 1RTIA 2VBXA 4KB7A 5AE3A 1HWIA 2KXHA 1I1GA 1U0SA 4NEZA 5CYQA 4TNOA 4CP5A 1D9AA 4J9LA 1S10A 3N28A 4H4OA 4UOHA 3FDSA 4RNNA 2LXUA 1T8EA 3LALA 3GYGA 4RBVA 1Q53A 3OLAA 1MWQA 3GV5B 2K3KA 3IRXA 3QJLA 2XBPA 5A8KB 2VBWA 5C24A 3MCNA 1V6HA 1NK6A 4EI2A 4ZVUB 1S4FA 2B9YA 4J9QA 5JXSA 5KFKA 2M3DA 2OAUA 2V63A 2HHTA 1RT1B 1T11A 3HZEA 4YB6A 3BO4A 2AYBA 5G4DA 3Q8UA 5GMEA 2GQ2A 2QA4S 1JXVA 2V2ZA 1VHFA 2OI2A 5KG6A 2GHPA 2W9BA 2KJWA 2MMYA 4DI6A 1KD1T 4RUBA 5LMUJ 2C3MA 3OW2R 1KN6A 4GKKJ 5E7OB 4NXMF 4C9DA 4C98A 4ZJQA 2IC3A 6FDRA 1ZTWA 4ELVA 4RBTA 2LQJA 4J91A 2JVOA 1J5OB 4LT6A 5JVGQ 2J6SA 3QO9A 4CNZA 2HHQA 1ELOA 2Z8QA 1M90T 3W9IA 4GMKA 2X3GA 5IV3A 1TAUA 3NNCA 2VG7A 2HNDB 2QN6B 1DBDA 3UCUP 1HWKA 2WK4A 2Z2MA 3CDAA 3NWRA 2MY7A 1PAUB 3IM9A 2W4CA 1BQXA 4ZPVR 4ZJOA 2QJ3A 4OHXA 1RHKB 3QLHA 1WI8A 3A3PB 4DMZA 2XO7A 4TQSA 2EFQA 2NXUA 2OEMA 4D3GA 2AMCB 4B9MA 1JLEA 5DG7A 3SDEB 1WHWA 3L4BC 3A8IA 1ZM3A 3T1YF 1ZTTA 4LF4J 4I2QA 1OIAA 3P45B 5IWAF 3KK2B 2BX6A 1L3SA 1NHKL 3KHGA 2C3PA 3ZTQA 1VIOA 4W92B 3AXMA 3BKTA 3TAQA 2QTWA 1FDDA 5AXKA 4KGMA 2B6AA 4QU6A 1ROFA 4IG0A 3FBFA 5J2NA 1UW9A 4CO5A 5G0RB 5HL7Q 1RK8A 1L3VA 2QSFA 2CNOB 3IR5B 4DJBA 1N8RT 2WOMA 1S0OA 3R9LA 4O23A 3KG0A 3KJFB 4ZKAA 2FVPA 2AZ1A 3MM5A 2HNZB 2YVSA 3KG4A 2CJYB 3C15B 4RW8B 2FY8A 3G82B 1HNWF 4NLPA 3HFVA 4DSIA 4OQJA 2ZHAA 4LF1A 4LF7F 1NK8A 1WF0A 3BN4A 3FMBA 4HI2A 2JH3A 1TL3B 1VQ9S 1HARA 1X4BA 2BJEA 5HQLA 1H7XA 2ZUGA 2V50A 2M8DB 2C2OB 2X1FA 1RWPB 5HMZA 2YPYA 5C42B 1N56A 1JJCB 4JI4F 1KTQA 3I0RB 2E5LJ 5L46A 3A8JA 1RWWB 2VJUA 4F3MA 3SSSA 1GH8A 4X4TA 3SCKE 1CULB 1FCAA 1HW9A 3W8GA 2H1YA 3MEDA 4RUAA 5D0RA 5J2MA 2LA4A 2N7YA 2DGUA 4MAKA 5B0FA 1ZM4A 1JWWA 3ONQA 1M5VC 1J5OA 4TYAA 2GIQA 2V9KA 4DF8A 4DV5F 4OLOA 2HHWA 2PFDA 2MZSA 4JI5J 5IZHA 4QWDA 1HNZF 1UCNA 5GAGU 2D9PA 4FYWB 4WTOB 4B3RF 2L3MA 2HNDA 1AB8A 4K8RA 1UAWA 3G2XA 4TY9A 4NZ0A 3IGNA 3B82A 3P96A 1WC1A 2EC0A 5B0EA 3J7YU 3H2LA 3DLHA 2YH0A 1MMDA 3MEGA 2UP1A 2M9KA 4KSEB 3SQGA 4O44B 3Q23A 1VR6A 3AHPA 2JL9A 2QIFA 5FLXY 3OR1B 1X4DA 4Y00A 2I38A 4ZPDA 1UJ5A 2HPUA 5EWFA 3M2RB 3KK2A 1JLBB 1GMWA 4KC5A 2FZGB 4F25A 3HVTB 2E5JA 1TVRA 2DNRA 2CQ0A 2ZWPA 1RKJA 1QDUB 1BC6A 3V81A 4JV0A 3KHRA 3J81j 1KQSR 5G0RA 5GMKa 2GHWA 4DSFA 1FJEB 1UVKA 3VHQA 3M8YA 4J9MA 2CJ9A 4HTJA 2B5JB 3A4TA 5JMNA 3M6XA 4CDIA 2NR0A 4EMDA 3EYZA 4KV8A 3DDKA 5FLXU 1CPZA 1U6FA 1KP6A 1S1TB 2M52A 2DXFA 4IH5A 1XN9A 1WI6A 2DNLA 1VBZA 2KHDA 2HZAA 3KUEA 3SMZA 4H4MA 1MMNA 4LMZA 1CJTB 5DGBA 3PIPQ 2G1HA 5KFTA 3M2VA 1HHTP 2H5JB 3MEKA 1XR7A 4HT5A 1KSPA 4V1Ak 4PZVA 3C6TA 2PE8A 2JEIA 4JI3F 1UJ6A 3WIUA 3LTOA 2BABA 4DCOB 2VU5A 2ZKTA 4UZBA 3DDIA 4LFAJ 1L3TA 4RJVA 4JI6J 1X0PA 3ZZPA 1WC5A 1VQ5S 3J81Y 3OFEA 2HFVA 3DHWC 1CULA 2JX2A 3GLJA 1JKHA 1T94A 2ALYB 1B99A 3SEOA 1RT7A 3PFOA 3GIKA 5DM6Q 1YKWA 1AROP 1REGX 4J9OA 1K73T 3DKDA 4DR6F 3AB4B 3TWZA 5K20B 2E7VA 2P9GA 3DM2A 4LSZB 2DRAA 2ZE2B 2KL8A 1U6ZA 4A8OA 1U24A 2E5HA 3QT8A 2Y8YA 2Z57B 1ZOTA 4NYZA 3J81U 2XHCA 5KT4A 3SCLE 1PILA 2OPQA 2VOOA 2YNGA 1QAXA 2RQCA 2W01A 1VIXA 2FGOA 3IBWA 2BMBA 2XLKA 4ECSA 4LBHA 2YNFB 1U0HB 3OR1A 3TAMB 5IC4B 4X4PA 5FD1A 2MKJA 2LQ9A 4LF9F 1HQUA 5C5JA 5H1SV 4AYBD 4ELTA 2N7CA 2J0QD 1Y9OA 2UXDJ 4DV1F 1VI7A 1S1WA 2ZH9A 1NKBA 2QLFB 2ALZA 4UZCA 4NZ7A 3MURP 3UFCX 3AD8C 5KOXA 3E51A 1VQ4S 1S0NA 3MTKA 2DH9A 4DQPA 1UP1A 2KDOA 5F8NA 1O51A 1S6QB 4UOGA 2AGOA 2ZVIA 4ZCIA 2LCWA 3HHEA 5LT5A 2DNKA 5KFWA 3T5HA 4LQ9A 4M5JA 3K0JA 4Y2CA 5IT9U 4ECZA 4RNFA 2BKOA 2L08A 3GR1A 2ZD1B 5IT4A 2FHOB 3RBZA 1SV5B 4IFVA 4J9VA 1B0TA 2RUGA 1WNEA 3OXGA 4R25A 4X4SA 3HVWA 1X9SA 2HNYB 3EZOA 1Q7LB 5CD4H 1LFPA 4WU2A 4DQQA 5F8JA 4ZK7M 5B0DA 3G6YA 3EX7B 3GG0A 3BREA 4Q2MA 3JTNA 3IXQA 3OTOJ 4DV4F 1C1CA 3O6QA 1RXOB 3Q8PB 3HD1A 2O01C 1ZYQA 3M8PB 2MKKA 4G6VB 2GC8A 2H3EB 1FNMA 1QE1A 1RADB 1LKZA 1ZAVA 1TUWA 1Q8IA 3DRPB 2C2EA 1DHMA 3T5LA 4ECQA 4L6V3 2GO8A 5KG0A 2R2SA 1DRZA 1I6JA 1U09A 5ETTA 4RW4A 1PSDA 3AJ1A 2EKNA 4LF5F 4IR9A 1YVFA 1IKVA 4D3HA 4TYBA 1J2VA 2HSEB 1H3DA 1FJCA 2AEFA 2IJFA 1GTEA 2OIHA 4A8SA 3NNAA 1IN0A 3OSNA 1RABB 3C3LA 3OLBA 2Q3PA 4DR1F 2VDHA 3PX4A 3PM9A 3GV7B 2FJAB 4ECRA 3EPIA 4ZN1A 5D3GB 2WSCC 3H40A 3F56A 4G1QA 1CVJA 3EUNA 1O5JA 3R1LA 4MH8A 4OHZA 1CJUB 1QSLA 2VG5B 1NJYA 1VRTB 3NP5A 1U0HA 5ETNA 5IQ6A 2E1CA 2V67A 2HLUA 4ZCKA 3KHHA 1VQKS 1Q16B 1WG5A 1NB7A 3CGIA 4KT0C 3OXLA 1YRUA 2FPHX 1FHTA 3HK2A 2Z56B 1EHWA 3DFEA 4ZHRA 4CH1A 3R97A 2J7UA 5M2UA 4JI8J 1FA0A 1NPRA 3TZZA 1MMLA 2LDIA 3GU0A 1FWKA 5KFZA 1DQ8A 2AU0A 1PO6A 5C25B 1YK9A 4W98A 1Q1KA 1VCTA 2GAGC 5K8OA 3MMAA 2GW8A 4HI1A 4DL0C 1VDHA 1SH0A 1SV5A 1WTFA 4P2XA 4F2RA 1HIYA 1RTZA 2RSQA 1T0TV 2EK1A 3K5MA 2HQ3A 3UVJB 1NPKA 5GADI 2PA3A 5DQHA 1WG1A 4DQSA 5T41A 3CC4S 2UUBJ 2V94A 4DUYF 2BYCA 2ADBA 2RF2B 5IC6B 3D6MB 4P2MA 2E5IA 1WOOA 1C0TB 2UUAF 4IOBA 2KU7A 1UL3A 4RW6A 4JI0F 2AJ0A 2R7VA 5KG2A 3CB4A 1S9EA 2XI2A 2A6OA 3DRPA 4Z37A 5LMNF 4TQRA 2CNLB 1RP5A 3QGPA 4J90A 1TKXA 1RA6A 3MDFA 2E29A 2DR8A 1FI4A 2GVZA 1WEXA 3JQMA 2RDDA 1W26A 3CMES 3X1LB 4M63A 1M5SA 2ZKUA 3BO2A 1UPPA 1RWNB 3EZ5A 3N6NA 3VAFA 3V6DA 1YBTA 4V19X 2EG1A 5KFPA 3LH2S 2HMIB 1F2HA 1S7HA 2H54B 1RUSA 1S0MA 1HNVA 1R8AA 2FVCA 5E3AA 1M1HA 2DYAA 4ZVHA 3O44A 1TKZA 4K4UA 3R2DJ 3W5XA 2V4QA 5CABA 3T5JA 2KRBA 4ZN3A 3NGDA 5J1EA 1D09B 3ENVA 2F4VJ 2CVIA 1NO8A 1S77D 2R7RA 3L95X 4RWXA 1RAIB 5KFAA 4EGLA 2OSRA 4ER8A 3CD7A 5K14A 3CW2C 2XZWA 2B8QA 1FJ7A 4B9SA 3H2VE 3TARA 2HLTA 2A18A 3MAAB 5K8PA 4UOCA 3BGRB 4K4TA 3KNAA 1R8PA 2QV6A 4DX7A 5GVQA 3PR5B 5K8MA 5C25A 2FJVA 3N0VA 1R27B 4X64J 3D66A 1CJKA 3HDSA 4CIOA 4YY3J 1RWMB 3M7VA 2V4JA 3MEEB 2ASDA 3RR8A 2HRTA 3PACA 2CUYA 2YNHB 2NSBA 2F8MA 2MKHA 4O4RA 1VC5A 1IWAA 3UVJA 3DCAA 3NLCA 1S6PA 2HVZA 3FCHA 5F9NA 3RW7A 5F8LA 1H2UX 3M32B 5DGAA 3AJ2A 3RG6A 2H65B 1IQZA 2RQMA 1HWUA 5J2QB 3FSYA 1N5YB 4ECVA 1VQSA 2A1BA 4M5DB 3JB9k 3RB6A 2C2ZB 1HBMB 3V4MA 1IXKA 1TMMA 3GJSB 1EKSA 4QIGA 2RRNA 3FQLA 3K5NA 4USHA 1A0OB 3KK1B 2C28A 3GPAA 2X3DA 2POKA 4DHVA 4I1TA 4TU7A 2RILA 4Y0FA 4DQIA 1GFWB 3AJDA 4H54A 2D3OR 3IG1B 4P52A 4AQYF 1N32J 2XYPB 2WHOA 2EKYA 2OMOA 3C8YA 3W61A 4X4QA 2ZZTA 4Q43A 3MMBB 1NK5A 4F3QA 1SL0A 5A0YB 8AT1B 4URSA 4ZLNA 2HMIA 4NX9A 3TRGA 2DHHA 3VVUA 3RRHA 3CDBA 2FJBB 2M7SA 1NH7A 4LRBA 2JEJA 2QL7B 4LVNP 3MR2A 2ADCA 3P8BB 4B9LA 2GCFA 2KT5A 2I2YA 3NBPB 3GQCA 1F9HA 1MU2A 1RTJB 1S6OA 1JNRB 4KH0B 1VLOA 3D4JA 1XERA 4GRSA 2D7SA 4WYLA 4G3IA 2CJQA 1QJHA 3LWMA 3JSYA 4AUKA 3KMSA 3S01A 5KG4A 2PMHA 1RBAA 1PYTA 1IVZA 5J2PB 4Q45A 2VBYA 1WSRA 3I4HX 1RISA 3CJ0A 4C8LA 4M5KA 5IS2A 3Q8QB 1SH2A 3EM1A 3T6BA 3ET6A 4ED7A 1F9EB 2B7BB 2IM3A 3BBBA 3LA0A 3UN2A 1Q4RA 2DO0A 5DM7Q 2APOA 3THVA 1RT2A 2HFSA 3I0SB 3R1HA 3P49B 5M2PA 1RDRA 4ICLB 2QG9B 2DD8S 3J7Z5 2C2DA 2VKRA 4WFAQ 4PUOB 2GHVC 2EFPA 2HZCA 2AEJA 3TUPA 3FCVA 1E6YB 4URGA 4DDFA 1EP4B 5L8RC 1TMJA 1RWKB 4X65J 4ZLPA 4I7FB 5HBMA 2MGZB 3KLGB 4X4RA 3TVYA 3PO4A 3ILJA 4P72A 4Y65A 4NMXA 4QIFA 2G13A 2UVUA 3AD7C 1FD8A 3CJKA 1Y5NB 2D3ZA 3DC2A 2HEKA 3NGUA 1X0FA 4O0IA 2BRLA 1HD0A 2B56A 4PWUA 4EWTA 5EWEA 2XZTB 2IJNA 1EETA 4PG7A 1X4AA 5CAAA 4KQZA 4WP8A 5DG9A 4ZPCA 4JV1A 4OIXA 2JC1A 3HF5A 3MECA 3OSPA 2IBOA 1S9GB 1WEZA 1WKKA 2JEGA 2PC6A 4O4GB 1SKSA 1X4GA 4MKYA 1VQ7S 4Y34A 1W7WA 1R3NA 2HURA 4NI2A 4DUZJ 2HGNA 1F2GA 4FPIA 2XMMA 3MMBA 5IM0B 2J76E 3MM8A 4J9NA 2R7OA 3JS9A 3AOBA 5JUMA 3R5AA 1VQPS 1DAXA 3B78A 4DX5A 5KFRA 3B54A 2KJVA 2BBEA 3TUZC 2EI5A 1JXLA 1RAAB 4EO6A 2FVRA 3V4IB 2ASLA 1HNXF 4N76A 5BYRA 4OLPA 3VGUA 2C2MB 2J5AA 2B9EA 3GFZA 1SC1B 1Y5LB 3I6PA 4NA2A 5CH7B 3H2UB 1N34F 2YX1A 2OH2A 4DPWA 1SKUB 3KK3B 3J7ZT 2RE1A 3FJ2A 4NCGA 1KQFB 4U7CA 2ZDPA 1N5VA 3WX8A 3QJPA 3DRSA 1CS4A 4KH1B 1KFDA 2D3O1 2RHQB 2W2PP 5EDWA 1WOPA 3MAQA 1HWLA 2OGUA 3VVTA 4DBQA 3DGPB 2IA6A 3QZ8A 2FLOA 1NUEA 5D78A 5H9EJ 1X4EA 4KIAA 3Q0AA 2IM0A 4ZPAA 4DL3A 4DZ6A 1ZZFA 5LSRA 2BJ7A 2ABYA 3M8WA 4ICLA 1HD1A 3K5PA 4U67Q 1U1RA 3JSMA 4OZ1A 2FJWA 2GZOA 2NUUG 2DO4A 4JOUA 4A8MP 1FRMA 4EZ6A 3KLHA 3NAHA 1EP4A 2Z30B 3W2WB 3D3CJ 4TVAB 4KGXB 2WONA 2WVCA 4KTQA 1Y5IB 1GX6A 2EFOA 3G87A 1Y00A 3MPVA 4YR2A 3H4DA 3LAMA 4N7TA 2G0IA 3JYTA 1Z4UA 4KKOA 5HVGA 4OYOA 4USTA 1NBEB 1IUJA 5F3TA 3IS9A 2R7QA 5HQMA 3CCMS 2DGOA 1VQLS 3J80Y 4DV0J 5KTQA 4ID5B 3BB5A 4HHUA 3OR2A 1RT6B 4MFBB 1G6BA 3D68A 4DOZA 4DR7F 4UTGA 3CNQP 4OYBA 1S9GA 2B9WA 3N6LA 3W8PA 2HGMA 2NZCA 2JRSA 2R2UA 2O1PA 4WE1A 4FKYA 3E3XA 1AUDA 2HHHF 1NNDA 1K9MT 1IM6A 4W4MA 2J6UA 1X7VA 1UEVA 2QLWA 4ECWA 2CQ1A 3CDEA 1S1VA 1QLNA 1HYSA 2XYGB 4DU7A 1WC6A 3VZIA 4FN5A 2ASYA 2ZH8A 3J80U 1C0UB 3JAMY 3BM7A 3BSAA 3KLFA 1FKOA 1KWMA 1BE4A 2QGFB 1IJFB 3UNGC 3D3BJ 4M95A 4WFZA 3M1VB 2JDJA 2ROGA 3HX9A 3MR5A 1T03B 5DJBA 4KFBB 2VA2A 1TZ0A 1N6QA 3OFHA 4N5SA 1RCOB 5F0UA 5K5MA 2FLPA 1S1UA 2IJRA 4DV3J 4F0KA 2AT1B 3H42A 3T9NA 2CPFA 2BOPA 3M4XA 5A8RA 2F9JA 2J8SA 4TY8B 4ILMA 3T1HJ 1U6BA 5MAOA 2W8KA 3TVZA 1IKYA 4OYAA 4A47A 4JI2J 3GWCA 4IO1A 3JAMU 3FGVA 4LRAA 1YSJA 2E7XA 2XGPA 1S4EA 4I4BA 3RW6A 1IBCB 3NWGA 2KRRA 4FNIA 4YN3B 1F9FA 3ZZTA 4R8UA 2JVRA 4K59A 3L09A 4KRWA 2YKOA 1S49A 4OZ3A 4OZLA 1EZZB 1YJ7A 1SCJB 3UO0A 2ZH7A 4J9RA 1SB6A 1N52B 2MJUA 2GMLA 3D2WA 3H25A 4ES3A 4C11B 1F6TA 1NCLA 5EWGA 1FTCA 1IKXA 1NZ8A 2ZH4A 4QOTA 3HHLC 5AXMA 2MQQA 1NXIA 1LW0A 2LYVA 1RT3B 1LWFA 2VL1A 3VQTA 1SI9A 4LBIA 1WORA 3ZZRA 3K59A 4USUA 4OHYA 4WZMA 5LMUF 3IBFB 4P2FA 3GFYA 2DNYA 1WELA 4X66F 1JLCB 2FUG9 1FJGJ 1HL6A 3MM9A 2WZ1A 3TJ8A 2I8EA 3HKWA 5B0BA 4X4NA 5BYSA 2QLXA 1TL1B 3HCXA 1U1MA 3DU5A 2R8KA 4WPAA 3KNGA 3UDCA 3MR6A 2I5JB 5KFNA 4YFUA 5HVFA 5HROA 1Y0HA 1R31A 5KFQA 3VV2B 1DFDA 3DOMB 5EHHA 1NK4A 2IIHA 1X9MA 1HA1A 2I0XA 4OMFG 4ETZA 1P27B 2RQ4A 1QAIA 2B3TB 1CSJA 2EC2A 1SQFA 5LXRA 1UWBA 3CJ2A 1C0UA 2FTRA 2RH3A 2K1RA 3DU6A 4IFYB 2AIRB 5F41A 1QTNB 4IDKB 2V4RA 2MZQA 1JLGA 1NRKA 4N77A 2E44A 5D4NA 1T03A 4KFBA 5E5NA 1XNQJ 5ETLA 3S6EA 1G7CB 3WHIA 2MPUA 3EWGA 4RNMA 3WIVA 2K7KA 1U26A 3DI6A 4DZDA 1OSCA 3W62A 3FFIA 1R0AA 3R2CJ 2K2PA 1C1BA 3I9ZA 3W7BA 1CJVA 4O3PA 2XWXA 3KLEB 2F7VA 3PJWA 3NY0A 4O3QA 3OUYB 4CH0S 2HAIA 1SIZA 3NGTA 1N5SA 1K1QA 4CTAB 3DLLQ 2IM1A 2XO6A 4JYAF 2V6AA 2EBEA 5HSPA 2D41A 4HR2A 2H4WB 2P9CA 4HVZA 2KH9A 1N0UA 1M5HA 3W64A 2V2QA 1SVDA 4U95A 1VJQA 3O5TB 4YEAA 3U1NA 1WHXA 3ZZOA 1RT5B 4ZVEA 3G6XA 2EBGA 3UDLA 2JNJA 3DYAB 4CCHA 2A0FB 2GGPB 5T7LB 4ZVPB 1APSA 1S76D 2HRYA 1HBUB 3AA8A 1H6KX 2DGTA 2DR6A 1T05B 2KZZA 3VAKA 1JQGA 3KJNB 5HJYA 3OT9A 2RVJA 3D0HE 3R8YA 3BSOA 3LP2A 3MUMP 4KHMA 5E2QA 4BBYA 2VASA 2DT9A 2DRDA 4JI5F 2IAJB 2J0SD 3HPOA 4LR7A 3OBIA 1GNKA 2VG6B 5I3UB 2HQIA 4ZVTB 3G6VA 4I69A 3JQKA 4OI6A 4J5OA 4G65A 2HGLA 4A8XA 2OP5A 4OYXA 2VFUA 3UD5A 3FBEA 1SKWA 2CAJA 4IG3B 3PX0A 4ILLA 2HWIA 4TLQA 3GYNA 2I1RA 1OQ3A 2XMAA 2QYGA 2OKQA 1LWCA 5JVHQ 3BPDA 1H7WA 4IFYA 1D8ZA 1TAQA 2OPSB 5DZ7A 2DY9A 3C2PA 4NMLA 3GILA 4FPRA 1LOUA 2VDIA 1KDNA 3FCWA 5IWAJ 1OPZA 2MKCA 1KHWA 1IR2A 2M2BA 5HLFA 1B0VA 3NKYA 2XI3A 5KFSA 1KVIA 1FO1A 4ED4A 1JLQA 3MM6A 1FDAA 3E8OA 3F0NA 4LFCJ 4K5SA 4IOCQ 4K4ZA 3RB0A 4C8YA 1PBUA 3MGJA 2G4BA 2I9SA 3H5SA 1W25A 3TX8A 3AAWB 2F63A 4P74A 3OUYA 4YR0A 3HSGA 3LP0B 5IOLA 1XIQA 3OL6A 3M8ZA 4OYWA 1HNWJ 2J9CA 3ZTPA 1Y4ZB 4LF7J 2QZ8A 4QU7A 3ETMA 2BQUA 2BOAA 3HHLB 4CYUB 2PMWA 3NGKA 4NXNF 2GJIA 1X5PA 3A13A 1J27A 1HW8A 5MLCV 4YB7A 4FS1A 1T9XA 3M9NB 4NRTA 1RT5A 4LFAF 3GV8B 1IKWB 4HACB 2G2YA 3FRZA 4I6YA 1HQEB 2KT2A 4FDFA 2JLEA 3VAHA 1NLKL 4JI4J 1NJWA 3B8HA 2F40A 4X4VA 2OTLS 1HBUA 2FD2A 1MROA 4C0OC 2RS8A 2JLGA 1U49A 3W5ZA 3M6VA 5DDQC 3RGIA 2J0WA 5KFMA 2UU9F 2OPRA 1RLCL 3P4UB 1REVB 3UCZP 2HZVA 2QFJA 4FKXA 1VBKA 1TK5A 3IM8A 2C2RA 4XDDA 1N5QA 2PI5A 2C2KB 3MHYA 3QIPB 2CDRB 7FDRA 2YKQA 2YY3A 2NLWA 4RKUC 4B3OB 3LPYA 4YQWA 1B7YB 3ILOA 3W2VA 2Z2YB 3MUVP 3JSBA 3OTEA 3I82A 1G3OA 4JI1F 2E66A 4U6PA 4XAKA 2FJXA 2AD9A 1TQLA 1YRTA 3P3DA 2DNOA 3AT1B 4LBPA 3POTA 5GAEI 2QFIA 2OTJS 3KJVB 5DO2A 1SUQA 1RT4A 1AFIA 2LEPA 4P7TA 3HHLD 2DGXA 1A7GE 3CO0P 3BBFA 3IBCB 3CMAS 5FDLA 2ATLA 3K17A 2GNKA 5GAHI 4DFMA 1ZM9A 1XC9A 5D8HB 2RHSB 1B64A 2HBQB 3AY0A 1RTDA 5A8WA 1DQAA 4GC7A 2CWKA 2EG2A 2R9LA 5DDPC 2QO3A 1L5UA 2K3IA 1DZ5A 1U48A 1U7LA 2WB1D 4USKA 3IA0A 1X5OA 4MIAA 1PC5A 1P1LA 4DV2F 5ETPA 5I42A 4IQXA 1V5IB 3I56S 1T3NA 1RTIB 3QRPA 4BCAA 3OTOF 1WSVA 3BGOP 3PTWA 1XWLA 2PEBA 3I5BA 2KG1A 4F4WA 5CYQB 1QTMA 4HH1A 4H4OB 1IKWA 2C42A 2VFVA 3R7SB 2PN6A 4DF4A 1CG2A 3UNYA 4HHJA 3IRXB 2NZ4A 4I6WA 3TI0A 1FXDA 5C24B 4BC7A 1RACB 1REVA 1GQEA 2ZOMA 3GIIA 2R7SA 4NLSA 5AT1B 4K7QA 1PCAA 4DXLA 3QQCD 4DPYA 2VH7A 3E01B 3SSQA 4DR6J 2KB2A 2W9BB 3LOUA 4OYPA 4TN2A 1YJNS 1Z2LA 4WKRA 1IBLF 1U8WA 2LQ5A 1GMUA 4G1IA 3M8QA 1NDKA 1Q5YA 5KG5A 3PJXA 3OJUA 4GVBA 4A8YA 2ATCB 2VFRA 3J7AN 4Y2KA 2CG8A 2FIUA 2ZNYA 5IFMA 2FHKA 3M6UA 2LECA 3QO9B 1NDPA 4LRDA 1T9YA 4QPXA 2YH1A 2VG7B 4RUCA 4RL1A 5D4PA 3MR3A 2RDJA 4RU9A 2EFVA 4USJC 3QFHA 2OFHX 3US5A 4DS5A 4LF9J 3QLHB 2HWTA 4O3RA 4E0DA 3GYXB 2DEJA 4DV1J 2PT0A 1NMEB 1JLEB 3BQ1A 3PX6A 1M0SA 2DH7A 4N8NA 4USWA 2RD5C 4DR3J 5F9LA 4WFBQ 1QVGR 2J9DE 4Q7AA 1R8CA 4UQTA 3BQ2A 3AD9C 4RBUA 1RGVA 3LANA 4F26A 2RB7A 4IH6A 3BQ0A 1SJQA 1K8AT 2GIFA 1H73A 4DN0A 4HTIA 2DNMA 4IG0B 1RWVB 5J2NB 3TUIC 3IC1A 3MCOA 1RAJA 2FVSA 1S97A 4KGZB 2J0XA 4NLWA 4MK9A 4NWBA 4O3NA 2HKEA 2HFNA 3MM5B 3R27A 4FYXB 3TJAA 1HQ2A 1VBXA 2FZCB 2PEHA 5KG3A 4YR3A 4ZPWR 5AXNA 4P75A 4NLQA 1LW2A 1EAYC 3RUBL 5E3RA 2EVZA 3RTVA 3OTCA 4DV4J 3RB4A 2M70A 3CMQA 4PEOA 4DWIA 2F4FA 3ZZYA 4ECYA 3PO5A 3NEKA 3FRYA 3NS7B 1HNIB 1VRUA 3MMCB 5HMXA 4MKVA 2W2MP 4CNYA 1U1OA 4YUDA 2VKZG 2W2QP 3UI3A 1SQEA 2IRXA 2DXEA 1EJ7L 2AX0A 2FLLA 2C3UA 1RAGB 3A3OB 1N5TA 3SCJE 4DL5A 4LFBJ 3FEYB 2VF3A 1FRJA 4EZ9A 3D6TB 3E01A 2CZ9A 1WTBA 2MQNA 1BQMA 5LL6d 3MEDB 2VODA 4X84A 3I9V9 5J2MB 5CA5A 3CD6S 2CWXA 3GJRB 3D9BA 3ZTSA 1C4CA 1HI0P 4DV6F 3SCIE 2HFOA 1BD6A 3I31A 2QLJB 5IV4A 3BDEA 1P8GA 1B70B 3RJMB 3U27A 3BH6B 3OD2A 1LWEA 2YWEA 4ZCMA 3C16A 2JFDA 4AXIA 1Q78A 3WX4A 1H38A 4CT9A 3B4MA 4UT4A 3GFHA 4PXEA 2A10A 2LDYA 3MEGB 4K50A 2Y1LB 2VJVA 3SQGB 3PKYA 2B4OA 4NLRA 3LF0A 1SPBP 3I4PA 3KDOA 3FK4A 5ETKA 2F9DA 5HJXA 2LFVA 1DQ9A 2E1PA 4OI4A 2JJ4D 1SH3A 3OVSA 3CJ5A 1SL1A 2CXEA 4F2SA 3BZQA 3TQ1A 1NHVA 4X64F 3N9UC 4ZIWA 2DB1A 4TU8A 1TVRB 3NCQA 2GJFA 4A8FA 5HQ8A 4OV6A 2R4FA 3V81B 2HAFA 3TZYA 4CLLA 2BZ2A 2RKIB 4LRFA 3BSNA 2CVEA 4C97A 2ZH1A 3CC2S 1U1LA 2OFGX 3MCMA 3OTBA 3K5LA 4M1KA 1SXLA 3M30A 4L75A 2BV3A 2IDLA 4KV8B 3V2UC 1RTHA 4P71A 4KHPF 3D67A 4O3SA 1N88A 4MT1A 1AZSA 5E3QA 3VGVA 1UW4A 3QWUA 4FF3A 1R6YA 4DUYJ 4TXSA 4H4MB 2EW9A 4X62F 2FB0A 5GAGI 4B3SF 2VA3A 5BXIA 1UKUA 3Q86A 1AYEA 3M2VB 1XR6A 2UUAJ 4I6AA 3J7A1 4JI0J 1HNIA 1FWPA 3QJJA 3MMCA 1L3KA 3C6TB 3N5BA 5L1IA 3CTRA 3J7YI 2DITA 5C7PA 1K47A 1KBRA 5HK4A 1R7IA 4J7CA 1VMBA 4ZMMA 1JLFA 1NAQA 4OI3A 1JLAA 1F5BA 2DGSA 3GG1A 3UD3P 2YX4A 1HKAA 1JKHB 3L7OA 2J8AA 1RT7B 3DXBA 4ALZA 3NS6A 4KJIA 2XMUA 5KT6A 2WSEC 3GIRA 5KT3A 4DX8H 2W4PA 3EVOA 2PFFB 1Y7PA 1EX8A 3DNCA 1GMWD 2CPDA 5A2QU 5HMWA 2N82B 1RQ0A 2AYEA 2ZITA 4FBTA 3S8SA 3DM2B 2DR7A 2HHUA 1G1XA 3SV3A 3ILLA 1UZHA 1M5OC 1YWXA 4IR1A 2CRLA 4AE5A 2WVDA 4CH7A 2F5GA 3C46A 2F3JA 1YBUA 4NYPA 1I5OB 4DR5F 2Y3YA 1D9FA 2OPQB 2P5VA 2YNGB 4DR4J 4Q8FA 4YB1P 2ILZA 4LRCA 3D0IE 4L74A 2G0JA 1TUVA 3PNIA 2ZZMA 1XK8A 1YQHA 1HQUB 1YZ6A 3GCWP 4IYQA 2X1AA 4PRFA 3QWPA 4M5HA 2MLZA 2BQ3A 3BKFA 4RW7A 4WBFA 2CYYA 1T9VA 4JV5J 2XS5A 4C2MA 2ZOFA 1S1WB 3K89A 3NL0A 2B7CB 4KAIA 4OYIA 1YTYA 4WF9Q 2DY1A 5KFCA 2RKIA 3HXMA 1MWYA 2HYIB 2RMLA 1H0HB 4U96A 3K7RA 3DRRA 3TX0A 4X65F 1MNEA 1FTRA 1XNRJ 5KOWA 4HH0A 2KYXA 2NREA 3WZ0A 2O3DA 3AOAA 1W2IA 4HT7A 4CRJA 1XMBA 6AT1B 4DL4A 4QBUA 4Y2MA 4IFVB 2NXJA 1ZA2B 3SQOP 3QAUA 5KT2A 3BJYA 1WF2A 4OFZA 3IRWP 1GT8A 2LEBA 2WBMA 3EMTA 3GSDA 4HDHA 5E33A 1F5AA 4OZ2A 1C1CB 4ILRA 1S9FA 2Z2LA 3PYFA 2WVFA 4NLXA 4UUXA 4I2PA 2J7KA 5KFFA 5BR8J 1QE1B 4DUZF 2CA9A 4PG5A 2B51A 2HQCA 1UFWA 3ITHA 3SXLA 1TL4A 4FVCA 4AQYJ 5H9FJ 2CPIA 8ATCB 3PYGA 4GC6A 1NDLA 2MZRA 2VPYB 2AGQA 2BM0A 3W1YC 2FC8A 4RW4B 1VYAA 3F44A 5K9FA 2QA2A 1WJ9A 3HT0A 4M5NA 2IVFB 4LSLA 1IKVB 2WW8A 3MCSA 4Q0BA 1WC0A 2BJ3A 2HK2A 2U1AA 2QLBB 3OTDA 4YB5A 3AOCA 3HJVA 3MD1A 3CUNA 3KLIA 4F4XA 2JC0A 2HK3A 4PXCA 3B4DA 4LREA 3F41A 3VCDA 5CCMA 4F4KA 2W2NP 5I3PA 3AQOA 4G1QB 4NE9C 3BGUA 1XJWB 1G2EA 3THPA 3HSDA 4RNOA 2OSQA 1TP7A 3ISNC 5IT9Y 4YHHF 1JNZB 4CLUA 5DDOC 3AODA 2UUTA 1FE0A 1Q95G 2B0GA 1V5VA 4PQAA 1X9WA 1QD1A 3P5TL 3CSKA 1J5EJ 1FX4A 2DNHA 3OQ2A 4ERDA 4MIBA 5ETSA 4A8WA 4IOAQ 1HBOA 4ZHRB 1KR4A 3LW5C 4ED3A 2YXLA 3DRXA 3PVXA 4C3LA 3EDQB 2EXUA 2QYCA 2DPIA 4CLWA 3QRQA 3BN7A 1QY7A 1RI7A 4ECUA 2IA0A 2ZJQQ 3GMGA 3W3SA 4RLEA 1U2RA 2D9OA 3DLJA 2DHXA 1ZH5A 2G0CA 1ULRA 3MMAB 3UR3C 2EWHA 4K2JA 2KTQA 2ROPA 3A1YG 2VQFJ 4QCLA 2KYZA 2BRKA 2ROEA 1OQ6A 2P8IA 3D0GE 4AL5A 4NLUA 2P6TA 4M8LA 4M5GA 3M2UA 2IRUA 2WTFA 3VZHA 4Q5VA 4QWEA 4PPZA 4OHWA 1E6VA 3HSZA 3ISZA 3HKZD 2GIRA 4RW6B 2FGCA 3EGNA 4ZP7A 1RHJB 2IRYA 3KXDA 2BE2A 1S9EB 5CCLA 3M8RA 3H7HB 1KQGB 3CJRA 2YWKA 2XMTA 1S0VA 1NEEA 2QMWA 4ATNA 3T3FA 2CQHA 1HBNA 1TKXB 3LPEA 4LF6J 1F5CA 2GVZB 4ETXA 1WD6A 3S7RA 3UCGA 3TNVA 4LF8J 1SKRA 1TV6A 3KTQA 3PEHA 5CYMA 4C0HA 3DLKA 2VD3A 3V6DB 2MKYA 4ZCLA 4H4KA 2HVHA 2YKNA 1NM2A 3L9ZA 1UTAA 3ZTOA 4DV3F 2R7XA 2CJBA 1PBAA 2NXEA 2XEXA 1RB0A 3KOAA 1HNVB 2ERRA 1T9TA 4FYDA 1QVFR 4E2FB 1TKZB 3PV8A 1SL2A 1RAEB 3T1HF 3SIPB 1B3TA 4AT1B 5LXYA 1FRKA 1UVLA 2ZUAA 4U8YA 4JI2F 5AJ3J 2MQLA 5J1EB 3VTIA 4LF2A 4LR9A 2KM8C 1S6UA 1NZAA 2IM2A 1Q8BA 1V3ZA 4C8NA 4PQUA 1BQNA 1HMVA 2CFXA 4RR5A 1DTQA 1OY6A 4B9UA 5K14B 3X3UA 4JV2A 1IM4A 5GAHU 1GMVA 3GJTB 3ZC4A 1PYOB 2VONA 3QT5A 4RW9B 4X4UA 1MSWD 4C3KA 4HKQA 1U02A 3DDNA 1ZBTA 2UUWA 4ZVGA 3O3LA 4WP9A 2EFGA 1H2TZ 4LSNA 3T19A 3TEHB 2CPEA 4UW2A 1CJKB 2AJQA 1YDLA 2V4JB 3PW7A 5CZVA 5LJ5Y 4K0KJ 3LGMA 2VPWB 1ITPA 3CULA 2Y0SD 3T41A 5CXTA 3DN9A 4DFKA 1S6PB 2BDPA 4WP3A 1FERA 2NQPA 4UQGA 4B3MF 5HATA 3BO3A 1JJ4A 4F3OA 1BLUA 3W63A 2OJ3A 4M5IA 1UEUA 2DKOB 2XULA 1SJRA 2CNNB 1IBMF 1FF2A 3BDPA 2HQGA 2DHGA 5DETA 1LQ9A 1FRHA 4DR2J 2DGWA 3ULHA 1L3UA 3CCTA 4R5PA 2HHHJ 3O8WA 4K4YA 1VQ6S 2CPYA 5E0OA 3NAIA 4LIWA 2YKAA 2O5DA 3W60A 3FZBA 3KFWX 4IQMA 4NL5A 1S59A 2AW0A 1WOSA 2P9EA 2FJEB 3NS5A 3SYZA 1A9NB 1IJEB 4C8OA 2BEFA 1TL7A 4DPXA 1VFJA 1RWUA 1XNQF 2XS2A 3HT3A 1KEKA 4QW9A 5BYQA 1XMQJ 3HFKA 3N01A 4NZ6A 1IBKF 2E5GA 2A3JA 1U1NA 1OO0B 4AL7A 2XY5A 4A46A 1RCXB 3ZNUA 9RUBA 2ZJRQ 5F3ZA 1PJ7A 3PFEA 2DK2A 1MU2B 3VGTA 2XS7A 3TO8A 1IR0A 2L48A 4NLDA 2V0NA 4WYWA 2OHDA 2Q1LA 4IKAA 2W7PA 3RRKA 1X4HA 4F50A 3EGZA 5DLFA 2UXBF 4ZPTR 1TKTA 3K2YA 2MXYA 1S72S 5FJ4A 1O6XA 3CXCR 2CQPA 4QWAA 2XY7A 3OXFA 3LAKA 1SJ3P 5IXUA 2QL9B 4WJBA 2DVIA 2DXDA 2PSZA 1U1PA 4NPOA 3ET6B 3BPSP 4WKYA 4ZITA 4DSKA 3L7UA 2UXCJ 2BJ9A 3DOLA 1OPIA 4RW9A 2VC0A 3VGSA 2GQQA 3I87A 2A6MA 2ZNZA 1EB0A 2KZMA 2FDNA 1RT2B 1GTHA 4PKDB 3WBZA 1SC3B 2FHJA 3T9ZA 3QNWB 1MN7A 2NS1B 2A2CA 3MF5A 3C14A 2L9NA 2IY5B 2MLXA 4JBCA 1FK9A 4PPDA 2QEXS 2BANB 3LP1A 4HEA9 4PAAA 2W9CB 2WVBA 2IVYA 1GK8A 3DLGB 3T5KA 5L1KA 3Q89A 3R7BB 4CLPA 2Y1RI 5HBMB 4ED2A 2A2DA 4X66J 2CQIA 1K0VA 2IYIA 3Q2TC 1H72C 3CJKB 3D6HB 3PYEA 4PG4A 2M8HA 1UVMA 4F02A 1CC7A 1VK8A 2CNKB 4OI2A 2BJDA 2D3UA 3ISND 3DRYA 3SV4A 2UUCJ 1URNA 2QMXA 2NPIA 1EETB 4CLSA 1MG7A 3FQKA 2QA4G 4R0JA 3GTYX 1DLOA 3KYLA 1VISA 3I5AA 4CLFA 2KT3A 3MECB 1BGXT 1Q79A 3C6UB 3HLUA 3ENAA 3NXZA 5F8HA 3G96A 2VOPA 3GZ7A 3UR0A 1SIWB 2WW4A 4NI2B 5HP1A 4L3NA 1EKRA 2AJ2A 3CJ8A 2R2TA 3HVRA 3MM8B 1VGYA 4QYRA 3BKUA 3DLEA 2WB4A 1FWLA 1D8YA 4CO3A 1UJ4A 2ZM6F 2ZZNA 4JP8A 3Q83A 1YJVA 2PGCA 1QUPA 3MTJA 1OY8A 3CCES 2YKMA 2MQOA 4LFCF 2KM8B 3LUYA 1KLMB 3EICA 4QZVB 1N33F 3KMQA 1MLAA 3M6WA 1ZM2A 3TYTA 3UW1A 4OX9F 2XSJB 2MYFA 2XZDB 1NK9A 1WACA 3KG1A 2UV8G 4CO1A 3PW5A 1JB0C 4NCGB 4ANDA 3MPUB 1GXLA 1URRA 3QSIA 1WC3A 2DH8A 4JYAJ 3DGVA 2AP6A 3DRSB 3CCUS 1CS4B 9ATCB 2E1RA 4E98A 1FFGB 3CDUA 4NCBA 2XG8A 1U8SA 4F67A 4N56A 3PIOQ 5A8KA 2ZVSA 1Z2ZA 4EYHB 2ZWOA 1A6LA 1Q7YT 4YS2A 1EQ0A 3D54A 4DX6A 2J7WA 3H0PA 4N8OA 2DHSA 1FRIA 4RUHA 3FC9A 3VALA 1RT1A 2XTJP 3OJSA 4RZRA 3MOZA 2DR5A 3JSMB 2OELA 2U2FA 1I3OB 4NCAA 1QSYA 2VV5A 2ZJPQ 4OZ0A 4ZDNA 2MEWA 4XIUA 3CCLS 1KC8T 3A8KA 3QFWA 1I51B 3KLHB 2ZBRA 2BANA 2W9CA 3PG9A 5JJBA 3D5MA 3DLGA 2WONB 4ZJLA 5FIIA 1U47A 1VQOS 2M0GB 3JQJA 3JYTB 3IO1A 2E9RX 4F4ZA 4OYMA 4KKOB 5DQGA 4L3KA 2XLIA 1FDBA 2O66A 3CPWR 4OZJA 5B08A 2XMVA 3IS9B 3TQEA 1T95A 1QUVA 2OPPB 1QSSA 1X31C 1FKAF 1VK3A 4FXWA 4MJKA 3OR2B 2FZKB 2KO1A 4CT8A 2WSFC 5M2RA 2BQRA 3C6UA 3MZIA 2Z4PA 2AZ3A 3GE9A 1P9QC 4LIRA 4WE1B 1NSQA 3SDEA 4QWCA 1PYSB 4K4WA 1LFWA 2VQEJ 1UPMB 1JK9B 3MI7X 1YJTA 3QSYB 2ZEJA 1FEEA 4C3MA 1T9UA 4B3TJ 4GKJF 2Q66A 1S79A 2UVRA 1S1VB 2IPOB 4NLOA 2Y1IA 1HYSB 1RWOB 2DBBA 1N36J 3Q22A 5ETOA 1KRPA 3GSIA 4DL2A 2LQBA 4WTYA 3N5FA 3KLFB 1KLMA 1FKOB 4LR8A 3ICLA 4NLYA 5I3QA 2ZDOA 3NCPA 1M5PC 4ZOSA 2AQ4A 4MYTA 1R43A 2MZJA 2V5HG 4PXDA 1Y10A 2HNZA 4KPYA 3UPFA 3C15A 2XSJA 4OHVA 4RW8A 3G82A 1N6QB 1S1UB 1DURA 3MWBA 4LJMA 4NEYA 3NOCA 3G4SS 1S12A 4V19J 4EBEA 2LLZA 5KFGA 1KOOA 5A8RB 1IR1A 1O0PA 2RNEA 1I94J 4BDPA 4DPTA 2FLNA 2Y8WA 4OL8A 1TL3A 2QRRA 3FMWA 1X4CA 2G9OA 5C2GA 3IAM9 4WZQA 7FD1A 1BY9A 2KXNB 1IKYB 2GVDB 4ZP6A 4NXNJ 1KQKA 3BF4A 3EJMA 4C0BA 3B6BA 4ITSA 3H8YA 2V8VA 2L9DA 2JSXA 3IWLA 5C42A 4J9KA 4Z7CA 3I0RA 4R8UB 4FF1A 2HBRB 1BUXA 1H74A 2DNPA 4RX6A 4MK7A 2BACA 1ZETA 1TK8A 1IWGA 2DTJA 2XCPA 3I5CA 1FT8A 2UU9J 1IKXB 4KE5A 2YKPA 2QX0A 3C19A 1LW0B 4BS2A 3IWNC 2V69A 2R3VA 4UOFA 1LWFB 3Q2SC 1RZMA 5LOQA 3GIMA 2HBYB 1RAOA 4DV7J 1XMOF 2PO4A 3CCJS 3R3TA 1UZDA 1WG4A 2OPPA 1HLWA 2VPXB 1WHVA 3MM9B 2F8EX 2ZH6A 5DRKA 1WEYA 5HI7A 4B9NA 4F4AA 4F04B 4LVOP 1NSAA 2DIUA 3W9HA 2RRBA 2JZ5A 4O44A 3EVWA 1YZ7A 4RPFA 2X51A 3TANA 2ZOGA 2R8GA 5KT5A 2XYHB 4CO4A 1H98A 5HROB 4JI1J 3M2RA 4WK1A 1CQMA 3LO3A 4B08A 4QR1A 1JLBA 3QGIA 3H90A 1X60A 1NPPA 3R6GB 3QRRA 2KXFA 1Q8KA 3HVTA 3IP0A 2KHCA 1JX4A 4ECTA 4KBIA 4Y28C 3FBBA 3OVBA 1T9WA 5T14A 4WIQA 4DR3F 1UWBB 3C66A 2LU1A 2F1FA 2C3YA 4ENOA 4C6AA 3PR4A 2K1RB 4EYIB 2B5JA 3H5UA 1JLGB 3PYDA 1S5ZA 2E1AA 1VQNS 1S1TA 4C8ZA 2RQKA 3GB0A 5HAOA 3R6LB 5BJRA 4ED5A 3DI6B 3RB3A 3FFIB 1R0AB 1C1BB 1CJTA 2BJ1A 1Q8LA 1LV5A 2CQCA 1RHUB 1FNOA 2Q43A 4I0WA 1P1TA 1CJVB 1NSPA 4OX8A 3NRBA 3CT9A 1NH8A 2GVDA 4DV2J 3IAS9 3R5DA 2YPZA 3TUJC 1AW0A 5LSOA 2W1BA 2IDEA 5D15A 4DPUA 1YRXA 2HHPA 4Y2IA 2GX8A 2HFUA 1LK7A 5J1PA 2RS2A 3TA2A 5B0GA 1QAJA 1FEHA 2N3LA 4CO0A 1FRXA 3ENWA 2AYGA 4A48A 3QBCA 2AJ1A 2GJ2A 4Q8EA 1HR0J 3VAIA 2B4UA 4LFBF 2HHVA 2CQ3A 3P5BP 4MK8A 5KFIA 1VQYA 1EQMA 3WC2A 3N6MA 2E9TA 1G4CA 5EN1A 1K44A 2JLFA 1F1BB 2LVWA 4GKKF 2ZE2A 4Z2XA 1ZAWA 2HBZB 5IQQA 5LM7E 5SZTA 3LP2B 1IBLJ 5DLGA 3LQVA 4PG6A 2PIIA 2ZBPA 2HWHA 2BR0A 3K58A 2OMLA 3G6ES 3DXSX 2ILYA 4KO0B 4DUTA 4P2SA 4RU2A 2AJFE 4RNHA 2YNFA 3TAMA 1VHIA 5H9FK 2QA1A 4QQBA 3R5BA 3L3CA 2DPJA 2RDIA 3QT6A 1D3WA 4CO2A 4IO9Q 2XHWA 2ZBQA 2HQFA 4OJHA 3CCSS 4LF4F 2C3OA 2K06A 3AH6A 1LWCB 3ELHA 5HN0A 2MKSA 4FXDA 1S6QA 2OD4A 1JJ2R 3EGVA 4L76A 4JI7J 1SJFA 2AHOB 1XBWA 5HMYA 5HLFB 3SBMA 1T02A 2VFTA 4F8RA 2ZD1A 3MM7B 1BWVA 1JLQB 3MM6B 2HNYA 1YHQS 4WIIA 5IT0A 3FUYA 3U1MA 2Y0BB 4WFXA 1Q81T 3ZZ0A 1UVJA 1R8HA 1ZS6A 5HO4A 4ED8A 2NCKL 4N41A 1YLXA 3GFXA 3M8PA 1VLYA 3EZUA 4MKBA 4I56A 3CD0A 2R42A 3MFIA 1HPZB 2HVIA 1SJ4P 4CLYA 5GMDA 4ED1A 2AKWB 4XDCA 1HWJA 3BYRA 1RYRA 3HZGA 4P6QA 1U45A 2YNIB 2E5LF 3HMJG 2DNQA 2CPXA 2AGPA 1NU4A 2Y9HA 3IR7B 5A6PA 4PYAA 1SC6A 2E7WA 1RLDA 4OI0A 1MROB 2B8PA 3BV8A 2XGQA 5ETRA 3PW0A 1FX2A 2MHNA 2X1BA 1GX5A 3LWLA 2OPRB 5E41A 1WKJA 3KKFA 5GADU 2RJZA 2G2OA 3M9OB 2LQ8A 3GR0A 4LQ3A 2OD6A 5D3GA 2MHEA 4OI1A 5DS7A 4NXMJ 5U47A 2R7TA 4NOHA 4X2BA 2IBKA 2V2VA 5THWA 4KO0A 3KHLA 4DV6J 2CQDA 1HHSA 3VQSA 3UD4P 1CJUA 4B9TA 2VG5A 3NOGA 1VRTA 4FF4A 2VPZB 1WDTA 3R5GA 4DR4F 4CI0B 4IRDA 4BWMA 3W2VB 3HHNB 1KHVA 1T3OA 2CJKA 2W9AA 4HHHA 5D6GA 2H9ZA 4EBCA 3S1TA 1YJRA 1N4LA 3BGFA 3H5XA 1FFWB 3R7NB 2Q6BA 3I96A 2FQQB 3JTPA 2UZAA 4ANEA 4WU3A 3NGSA 3AQPA 3M9MB 2MZ1A 2GV1A 3T1YJ 3POTB 4JV5F 3PRBA 1VC6A 1SUQB 1RT4B 4DG1B 4FBUA 2OO4A 1XQIA 1ZA1B 4MYUA 3NCRA 3RBEA 1GXUA 4Q2LA 4G1PA 2AEMA 3PHEA 5FDLB 3MM7A 4KPCA 1K0TA 1UFLA 1XNRF 4U9RA 4ELUA 4KGVB 2L41A 1N48A 2VBZA 4Y6IA 1RTDB 2XCAA 5A8WB 4GVLA 4J9UE 2KVQE 1X5TA 3CF5Q 3HM9A 2W25A 3O1LA 2ZBIA 3TW0A 2DGVA 3KDNA 1EIYB 2RF2A 1TTHB 4KHPJ 3UDEA 3U1LA 1C0TA 3WDOA 4CWBA 2V8PA 3TJ9A 4F36A 2DGQA 1OYEA 1RKIA 1OS5A 4DLGA 3NMAA 3G8QA 1HPZA 4X62J 4B3SJ 2VICA 5I42B 2CPJA 2E9ZA 4TLRA 2C22A 2GQCA 4NLGA 1RU1A 2YNIA 4QYZJ 5BR8F 1OMSA 4JI6F 3OHBA 2XMKA 1W2BR 4RWWA 1VBYA 1R89A 3IN5A 4BLGA 3VAGA 3AFGA 1CBKA 2R8IA 1F3VA 1TL5A 3FSXA 2BXJA 4ZA1A 1AFJA 3Q8RB 2R7UA 3L7PA 3IWXA 4NA1A 2NPFA 2HS3A 2MLYA 4DSEA 4ED0A 4NLVA 3TA0A 1K1SA 3CCZA 4WXOA 1KNZA 4IRCA 4F0MA 3K5OA 4Z7YA 3PHTA 4ANCA 2EPIA 1RHRB 4FXVA 3G71S 4DV5J 1UFKA 1HNZJ 2IFXA 3HULA 4B3RJ 3PRVA 3DMJB 5K8NA 3P6YC 3M8QB 5KG1A 4USVA 3VF0B 2AX1A 1D1UA 4GVBB 2DNZA 2BE9B 3OVAA 1GXTA 1GEHA 3SFGA 4EU0A 2XM3A 4QR0A 4DR5J 4Y3CA 2GAHC 1GAOA 3HP6A 2DHAA 2CDQA 3IGVA 4PWDB 2YBVA 2D74B 4NLTA 3MAAA 3BGRA 2KKHA 3OL8A 2UXDF 1N0VC 1Q86T 1J5EF 2WAQD 4ZPBA 1VQ8S 4DG1A 3D7SB 4ZVFA 5ITHA 3MAHA 1P6TA 2J9DA 4P73A 2UVVA 3MEEA 1RA7A 2V8GA 5L39A 3CJQA 4FNHA 3FZ2A 5L9NA 3M8SA 2YWFA 3SZ2A 2YNHA 1RU2A 3K8WA 1UMJA 5KFXA 3ILIA 1PIEA 3MFHA 4YP3A 4KGKA 2RU3A 2ZC3A 4HLBA 3EPGA 7AT1B 3M32A 4K2XA 4C8MA 2DEIA 3QATA 3EDRB 2VQFF 5J2QA 1N5YA 1TK0A 3MR7A 2BKNA 2NXCA 3PEJA 4M5DA 1HBMA 2B9XA 1QAYA 3CJ4A 2FHMA 3N79A 2Q79A 3CO9A 1BMQB 4KR0B 2XY6A 2FY1A 4K4XA 3KK1A 1FXLA 2BE7D 2XWYA 5A6WA 3CWJA 2CKWA 3VAJA 3ENQA 4I64A 1M5KC 1ZZNA 1LW2B 2VUGA 5I4MA 3DHXA 2JOQA 2ACYA 4JI3J 2R8HA 3RAQA 4GO7X 4MTPA 4TKTA 3QMQA 4DEZA 3IG1A 2Y1JA 5HANA 2CQBA 3V6HA 3BR9A 1VRUB 4LF6F 5D0HA 3WC0A 1XR5A 4CLKA 2HRUA 5A0YA 3KUGA 2CG4A 4DU8A 5KFOA 3MXHP 3CEDA 4PG8A 1NK0A 4LF8F 4M5LA 3DOKB 2NSCA 3AXKA 4FF2A 4RO0A 2MQMA 2PD1A 2MQPA 3TP2A 3LGHA 1RWXB 1FFSB 4OJ3A 2X1GA 2BA9A 4DL6A 3NBPA 1BQMB 2Z2ZA 1RTJA 2OEKA 4OZ5A 3DMJA 2V9WA 2XNQA 3OL7A 4HL9A 2B4PA 2W4DA 4BC9A 5J2PA 1FVSA 4QIEA 3MD3A 1PGZA 5AJ3F 1RBLA 4PWDA 2QT7A 1OSDA 1WHYA 2KI2A 3CCWA 4OV1A 4HDGA 2QE5A 1LWEB 2W2OP 3C16B 4YHHJ 3CE8A 2CQ2A 4P9SA 2XLJA 2RU9A 2JEFA 2CIMA 2K8GA 5F8IA 2KFZA 4HYKA 4PCQA 4NASA 2MJNA 4FZVA 2MSTA 3I0SA 3CCQS 2V68A 2Z0GA 5KFEA 1FXRA 1QM9A 4JI8F 4PUOA 1WC4A 4CZCA 4XO0A 3A3NB 4QR2A 3CJSA 1WDDA 1E6YA 4PYDA 1PAEX 2DISA 3Q8YA 3BSCA 5KG7A 1ZPVA 4I7FA 3TAPA 5ETQA 3EXYA 2MGZA 1PJ5A 4ZIVA 3KLGA 4K0KF 3PJ9A 1Q0NA 1R0CB 1VOMA 2VB6A 3D28A 3HJFA 4FVMA 3H98A 5CZXA 5RUBA 2N4CA 2M88A 1YG0A 1X5SA 4AL6A 2G2ZA 5EX3A 1BXNA 4X4OA 2MKIA 4XPEA 3OL9A 2UUBF 2YTCA 3M30B 5D0GA 1JMTA 3CIZA 3G8TA 3QT7A 1RTHB 3V6JA 2J9EA 5CD4A 5KFLA 2W7OA 4KHRA 1LXJA 2LXFA 3SI8A 1AZSB 1FNXH 1SQGA 4C7QA 1MN9A 2E1MC 5F8MA 1TUGB 3GIJA 2H5IB 4LUBA 1ACMB 4O4GA 2WCXA 4M5MA 4J9SA 4DR2F 2V2KA 3JXOA 2RRAA 4E8UA 2GMHA 4R0EA 2ZH5A 2ZBCA 1HHQA 1T7PA 5IM0A 2BJ8A 4QIVA 4YDXA 1Z1ZA 3GONA 4BHQA 4UUWA 3DOKA 2B4VA 2C1EB 1VS3A 5B09A 1MWZA 1JLFB 2EK6A 1KVKA 4QJVA 1KKHA 3RZAA 4J9PA 3BBCA 1JLAB 1R0BG 4CM0A 2F65A 2NXNA 4LF5J 3V4IA 3BH7B 4GO5X 4FP9A 1XMQF 3D1QA 3EVMA 4CM2A 5ETMA 1CC8A 4B02A 1KONA 1YBAA 4ZLLA 1C4AA 4CLZA 4DR1J 3KK3A 3QAEA 3RYLA 2GFFA 2LU2A 2PDAA 4USMA 1ZPWX 2VHGA 4EFAC 1DTTB 4FS2A 1YJUA 1FD2A 1U4BA 2COLA 3CJTA 4A4JA 1YITS 1CQNA 4DN9A 2F4VF 3CVKA 1AUSL 3DGPA 2YWHA 4IUFA 1YJ9S 3VWSA 1KVJA 1S1XB 1RHMB 8RUCA 2IVMA 3EXCX 5L1JA 1DJ0A 3QPIA 5L9XA 4P10A 3OFFA 1D9DA 1RSCA 3AB2B 4H4KC 1LXNA 2HHXA 4ID8A 2H5EA 1U25A 2M5YA 2QC3A 1YX2A 1OYDA 4XK8C 1H2VZ 1TELA 4S0MA 4J37A 2R7WA 2AWZA 4DPOA 2BW7A 1FDNA 2UXCF 3I55S 5D4OA 1SBRA 2DCUB 3A12A 1LWXA 3CD5A 1MW7A 3UE2A 1NJIT 2LEAA 1FKPB 4RW7B 1RHQB 3T1AA 4C48A 3W2WA 1S7IA 2JWNA 4YY3F 2J6TA 3RBDA 2N4DA 3FBCA 4EEYA 3U7JA 1PC4A 2Q6CA 3BS9A 2ZH2A 5H9EK 2ZH3A 3DRRB 2IHR1 2ZC4A 4B17A 3PZPA 4PABA 2RIJA 1LNQA 4ID5A 3W5YA 4QWBA 3V5RA 2UVWA 1RT6A 4MFBA 4B3MJ 2AJ4A 3QGGA 1JXEA 3MMJA 2EEYA 4IRKA 1V3RA 4IH7A 3ZXWA 3CCRS 1SJ1A 1B4SA 3F73A 3HVAA 4UY85 2VFSA 4PXBA 3QZ7A 1JIHA 4DCPB 2UUCF 1HI1A 3H5YA 3VAMA 5D4LA 1IBMJ 1NDCA 1UETA 2P6SA 1UA0A 2YQ3A 5LMNJ 5KFDA 2CPHA 1ZAXA 1TU0B 5A2QY 3W65A 4DSLA 3KWMA 4FYYB 3UDVA 1R6VA 5L38A 4EUVA 1PG5B 3GP9A 2Z58B 4I2PB 5SUHA 5EGYA 2GA7A 3RBXA 1N32F 2D69A 2XQCA 5AXLA 5EX0A 3HO1A 4JB8B 3ITHB 2VZ9A 3OFGA 4WCEQ 5B0CA 2LP4A 3AA9A 5ADZA 3M1VA 3JSRA 2MB0B 1EARA 3HSJA 2V8HA 2PI4A 1VRQC 3H59A 1NKCA 4Y2AA 3HI9A 4DS4A 1M1KT 4LSLB 2AV5A 1IBKJ 2V8DA 4Q0BB 2HG4A 1DTTA 1YI2S 1Y11A 4TY8A 2NYHA 3JTOA 3TZXA 3KUHA 5J1NA 4DQRA 5E3CA 4I68A 3TZWA 3KLIB 1S1XA 4XTTA 2CZ4A 4L72B 1UVNA 2QL5B 1NKEA 4U7UK 1WKLA 4CQ1A 2UXBJ 4C8KA 2KN4A 2KFNA 4NA3A 3G86A 4QPTA 2CADA 3TEGA 3LGNA 2HVEA 1V3SA 1RAHB 2IYGA 2PMZD 2MDAA 5C2CA 2ZFHA 5KFYA 2YX7A 2C2NA 3PXGa 5KFVA 1FKPA 3MPWA 4C11A 2XB2D 1WUUA 2LMIA 5LSLA 2FYXA 1Y3KA 1BHNA 4U7UD 1TFWA 4CLTA 5B7WA 4OZNA 2I6WA 1RT3A 1HBOB 4UY8T 2N3OA 2HS0A 4WXWA 3FKBA 1NHUA 3ZO7A 4K4SA 3Q8VA 3BR8A 3KJQB 1CEZA 1BWEA 2CJXB 2K7JA 5D0EA 1JLCA 2WBRA 1RYSA 4FYVB 2RT3A 1F3FA 3RR7A 3PY8A 1KLNA 2BW2A 2X7IA 1IQTA 1TL1A 1NK7A 2WRMA 2DIVA 4OJGA 4WFYA 1FE4A 1JJHA 1HFEL 3R5CA 3TA1A 2YWGA 3U02A 2FVQA 2ASJA 2MY8A 1VC0A 2CZVC 4MMOA 2I5JA 2AYMA 2OEJA 3PW2A 3M2UB 1FESA 5CYJA 1S48A 3DOMA 3QIDA 5ETVA 3UQSA 4M94A 1KS2A 1E6VB 3NMRA 1B7FA 2RUSA 2HHSA 3CCVS 4AXJA 2KVIA 3O2IA 4ZS6A 2VQEF 2BE2B 5EUHA 3UN5A 5KFUA 4B3TF 4IDKA 1HBNB 1AT1B 3HD2A 1ICEB 3CC7S 1N36F 1D0EA 4N47A 3D1HA 3FEZA 4C4WA 2ZM6J 4B9VA 2LXIA 4ZP9A 1Q5VA 3CDWA 2LKZA 4DFJA 1TV6B 2B43A 2XMJA 4A8KA 5CYMB 3IR6B 3DLKB 2JHEA 1YJWS 5KFBA 2AF6A 2D1CA 2M4MA 1XTZA 3FSIA 2YKNB 3KLEA 1LEOA 2CJAA 3FVYA 3SSRA 1N33J 2BM1A 1U2CA 3HFZB 2SXLA 2ZHBA 2ACMA 3G9CA 4OX9J 2JFKA 4CTAA 2ZHOA 4OX6A 4ZVOB 1I94F 4YDDB 4YMEA 1FVQA 1WWHA 4NYOA 2W24A 3ZZZA 2YQ1A 3K8VA 1TFYA 1S99A 3PRDA 1X4FA 2W7AA 2XSFA 2BKPA 1NJZA 1UEKA 2OLWA 5DQIA 5KFHA 2HIQA 1WF1A 4PQUB 1RBOB 1FRLA 4QW8A 2CPZA 1BQNB 1HMVB 4YOEA 2HS4A 1DTQB 1F60B 4ES2A 4O3OA 2O67A 3DYAA 1Y3JA 2GGPA 5T7LA 2CQGA 2XC9A 1F0XA 3THTA 2YQ0A 2PA8D 2IMOA 1T05A 3KLVA 2DJWA 5E3PA 3BYPA 1M1GA 2HFZA 3TVKA 4WWSA 3W9JA 4ES1A 4LSNB 3FNNA 4DLEA 3VR1A 3QYYA 2IAJA 4KYZA 3PW4A 3CIMA 2W8LA 4DV7F 2DR9A 5KT7A 3ZTRA 2VG6A 5I3UA 3OHAA 3T6JA 2QMUB 2KFYA 1NB2A 3A8EA 1YGYA 4ECXA 2FJDB 4DV0F 1Q82T 2HVDA 2EFNA 4ZVQB 1TR0A 2MQ8A 3HHKA 2MSSA 4U8VA 4ED6A 5KAKA 4OYZA 2H51B 1XEZA 4L73A 4IG3A 2KG0A 3OV7A 4DL7A 3WQPA 2OPSA 4A8QA 2DNGA 3TOQA 4JUZA 4R5PB 3BEGB 1KTVA 4K4VA 1P9YA 3GJQB 2V34A 2L9WA 3ADAC 2G1DA 3MOJB 1TKDA
chains in the Genus database with same CATH topology
1SH2A 2E9TA 5E3QA 3T6BA 5EN1A 2VC1A 3PDNA 6FD1A 1UW4A 3QWUA 2JLFA 2LVWA 4ED7A 4GKKF 2ZE2A 4FF3A 4Z2XA 1ZAWA 1R6YA 2B7BB 2IM3A 4TXSA 2R8JA 1HI8A 3H20A 4H4MB 2EW9A 4X62F 2FB0A 5GAGI 5IQQA 4B3SF 1AXQA 5SZTA 2VA3A 4NRUA 4TU9A 3LP2B 3NNHA 1UKUA 1Q4RA 2DO0A 3M2VB 1XR6A 5DLGA 3LQVA 5DM7Q 4PG6A 4I6AA 3J7A1 2APOA 3UWTA 1RT2A 5DG8A 3THVA 2PIIA 2GMJA 2HWHA 3I0SB 1HNIA 3R1HA 3P49B 3QJJA 2LA6A 5M2PA 1RDRA 3MMCA 4ICLB 2BR0A 2DD8S 3J7Z5 1L3KA 3C6TB 3K58A 2VKRA 3N5BA 2OMLA 5B0AA 2C2DA 3G6ES 2IMWP 4XPCA 3DXSX 5L1IA 2ILYA 4KO0B 4RU2A 4P2SA 4WFAQ 3CTRA 2XNRA 4PUOB 3J7YI 2AJFE 2DITA 4RNHA 1KOHA 1U2FA 2YNFA 2DRBA 1R7IA 3TAMA 3LP0A 2GHVC 1VMBA 3K57A 2QA1A 4QQBA 5CHCB 2EFPA 2HZCA 4ZMMA 1JLFA 1NJXA 1E6YB 4URGA 1NAQA 3R5BA 4OI3A 1EP4B 4DDFA 2GO9A 5L8RC 3L3CA 2DPJA 2RDIA 2BVZA 1JLAA 1D3WA 1F5BA 2DGSA 3GG1A 4CO2A 3RAMA 4ZLPA 3UD3P 4IO9Q 4QIWD 4USIA 4I7FB 2YX4A 2XHWA 5HBMA 2MGZB 3HHLA 4OJHA 3KLGB 3TR5A 4X4RA 1LK5A 1JKHB 3TVYA 3PO4A 3L7OA 1N54B 2J8AA 4Y65A 1RT7B 3DXBA 4QIFA 4ALZA 3NS6A 2R2RA 2G13A 3CCSS 2UVUA 4LF4F 4KJIA 2C3OA 2XMUA 1FD8A 2NYIA 3AH6A 1LWCB 3BGLA 3CJKA 5KT6A 3DLBA 5HN0A 1Y5NB 2D3ZA 2MKSA 2XMWA 2WSEC 1TKTB 3DC2A 2DCLA 5KT3A 3RU0A 5GAEU 3CJ3A 4DX8H 1X0FA 2W4PA 4O0IA 5KFJA 1U1QA 2BRLA 3FEXB 4OX7A 1HD0A 4FXDA 3HHDA 2B56A 1S6QA 2OD4A 4PWUA 4EWTA 2PFFB 1Y7PA 5EWEA 1JJ2R 3E2EA 1HQEA 3DNCA 2IJNA 1EETA 4PG7A 2CPDA 5L1LA 1X4AA 1SJFA 5HMWA 3ZFVA 4KQZA 2HW3A 2N82B 5DDRC 1RQ0A 2AYEA 2ZITA 4FBTA 1XBWA 5HMYA 5HLFB 5DG9A 3S8SA 1YIJS 1B0PA 4ZPCA 1T02A 3DM2B 4F4YA 2DR7A 2HHUA 1G1XA 4JV1A 3SV3A 4OIXA 2JC1A 3HF5A 3MECA 3OSPA 2VFTA 3NG8A 1M5OC 1YWXA 2IBOA 4IR1A 3DOLB 4F8RA 2CRLA 2ZD1A 1S9GB 1WEZA 4AE5A 2JEGA 2PC6A 1HR0F 3MM7B 4CH7A 4O4GB 1SKSA 3C46A 1JLQB 1X4GA 2F3JA 3MM6B 4NYPA 4DSJA 5AE1A 4MKYA 1VQ7S 4Y34A 2HNYA 4DR5F 4MIWA 1D9FA 1R3NA 1YHQS 3ETOA 2OPQB 4WIIA 5IT0A 4PR6A 4EO8A 2HGNA 2P5VA 2YNGB 3G8SA 1F2GA 4URQU 2XMMA 3MMBA 5IM0B 4Q44A 3U1MA 4WFXA 1Q81T 2J76E 4Q8FA 3MM8A 4J9NA 4YB1P 2R7OA 2ILZA 3ZZ0A 1UVJA 1X8DA 5JUMA 3D0IE 3R5AA 1R8HA 3QIPA 1VQPS 1DAXA 2BUNA 5HO4A 4ED8A 3B78A 1OWXA 1KFSA 1TUVA 4N41A 4B3OA 3PNIA 2ZZMA 1FK9B 1XK8A 3D1OA 1YQHA 5KFRA 1FJGF 3ZZUA 2KJVA 2BBEA 3GFXA 3LP1B 3I32A 1HQUB 1VLYA 3M8PA 4IYQA 5AE2A 2X1AA 3EZUA 3QWPA 1UA1A 4PRFA 4MKBA 2BQ3A 4I56A 4DFPA 3TUZC 2EI5A 3CD0A 2UV8A 5D77A 3MUTP 1JXLA 4RW7A 2CYYA 2FVRA 4EO6A 3V4IB 3MFIA 2ASLA 1HPZB 1HNXF 4N76A 2CQ4A 2IC3B 4OLPA 5BYRA 1UVIA 2J5AA 2XS5A 2HVIA 4C2MA 2ZOFA 1SJ4P 1S1WB 1R8BA 3GFZA 3M05A 4MKAA 3NL0A 4ED1A 2B7CB 3QGHA 4XDCA 4KAIA 1YTYA 4WF9Q 1Y5LB 1HWJA 1RYRA 5KFCA 3I6PA 2RKIA 3HZGA 4WK3A 3HXMA 4NA2A 4P6QA 5CH7B 1U45A 2YNIB 3IFEA 1VQMS 3H2UB 4EBDA 1MWYA 1N34F 2E5LF 2HYIB 2YX1A 2OH2A 2RMLA 3HMJG 2DNQA 3J7ZT 3KK3B 2RE1A 1H0HB 3FJ2A 2CPXA 3K7RA 4NCGA 3DRRA 1KQFB 4X65F 2AGPA 1NU4A 1RJJA 4BWJA 1MNEA 1FTRA 4U7CA 2ZDPA 3IR7B 5KOWA 1N5VA 5A6PA 3QJPA 3SFUA 1VJWA 3DRSA 4HH0A 5LJ3Y 1DLOB 1SC6A 3KJVA 1KFDA 2KYXA 2E7WA 2NREA 4OI0A 3WZ0A 2O3DA 5EDWA 1MROB 2QSWA 3MAQA 1HWLA 2FC9A 4DBQA 3PKMA 2IA6A 1CLFA 1W2IA 2FLOA 4HT7A 3QZ8A 1XMBA 4DL4A 4I67A 5D78A 4QBUA 2XGQA 3PW0A 2MHNA 5H9EJ 2X1BA 1GX5A 3LWLA 4Y2MA 2OPRB 5E41A 2NUHA 3KKFA 4IFVB 3N4WA 3RAXA 1X4EA 4KIAA 5GADU 2RJZA 3M9OB 3Q0AA 1O8BA 3RRGA 2IM0A 3GR0A 4LQ3A 4ZPAA 2OD6A 4DL3A 4I2QB 4OJ1A 5HP1B 1ZZFA 5D3GA 2MHEA 4OI1A 5DS7A 5LSRA 4JI7F 3QAUA 5U47A 5KT2A 4NOHA 2R7TA 4X2BA 3BJYA 2IBKA 1WF2A 2ABYA 3H4BA 4OFZA 4ICLA 3IRWP 1GT8A 2LEBA 1HD1A 5THWA 5F8GA 3DLEB 3Q8SB 1V9OA 3K5PA 2WBMA 3GSDA 4U67Q 4HDHA 1U1RA 4KO0A 3KHLA 3JSMA 2CQDA 1F5AA 5E33A 1HHSA 4OZ1A 3VQSA 2FJWA 1C1CB 3UD4P 2F8HA 3OPKA 2NUUG 4ILRA 4ZP8A 2VG5A 4B9TA 5CQGA 2DO4A 4JOUA 3Q24A 1S9FA 1VRTA 2Z2LA 4K5RA 4A8MP 5F0WA 2B6AB 4FF4A 1FRMA 3EGWB 4WFNQ 3V6KA 4NLXA 4EZ6A 4UUXA 4I2PA 2J7KA 5KFFA 3KLHA 2DNNA 2VPZB 2YKMB 3NAHA 1EP4A 2MZTA 1QE1B 3MPYA 4AFFA 4DUZF 3W2WB 4PG5A 2B51A 4P7VA 4W90B 2WONA 1C2PA 4DR4F 4KTQA 1Y5IB 2WOMB 1UFWA 1GX6A 3ITHA 4CI0B 2EFOA 3SXLA 1DARA 1TL4A 4FVCA 1U1KA 4BWMA 4IRDA 3W2VB 3HHNB 1Y00A 3MPVA 1KHVA 4YR2A 1T3OA 3H4DA 2FHJD 1RTIA 2VBXA 3LAMA 5H9FJ 4KB7A 2CPIA 5AE3A 2CJKA 2W9AA 4GC6A 3JYTA 1HWIA 2MZRA 2VPYB 2AGQA 1Z4UA 2KXHA 1I1GA 2H9ZA 5D6GA 4EBCA 5CYQA 2BM0A 4KKOA 4TNOA 2FC8A 3S1TA 1YJRA 4RW4B 1S10A 1D9AA 4J9LA 3N28A 3F44A 4H4OA 3FDSA 4RNNA 2LXUA 1N4LA 3BGFA 3H5XA 5K9FA 1T8EA 2QA2A 2Q6BA 3LALA 3I96A 4RBVA 1Q53A 3JTPA 2UZAA 2IVFB 1IUJA 4WU3A 3AQPA 3OLAA 3M9MB 2MZ1A 2GV1A 3IS9A 5F3TA 2R7QA 3POTB 4LSLA 4JV5F 1IKVB 3CCMS 3GV5B 3PRBA 2DGOA 2WW8A 3MCSA 3J80Y 1VQLS 5KTQA 4ID5B 2K3KA 4Q0BA 1VC6A 3BB5A 1SUQB 1RT4B 4DG1B 4FBUA 2OO4A 3IRXA 3OR2A 4MYUA 2U1AA 3QJLA 1RT6B 4MFBB 3OTDA 4YB5A 1G6BA 3NCRA 3RBEA 1GXUA 2XBPA 4DOZA 5A8KB 4DR7F 2VBWA 5C24A 4Q2LA 4G1PA 3MD1A 3PHEA 5FDLB 1S9GA 3CUNA 2B9WA 3N6LA 1V6HA 2HGMA 3KLIA 3MM7A 1NK6A 4F4XA 2JC0A 2JRSA 2R2UA 2O1PA 4WE1A 4PXCA 3B4DA 1S4FA 3E3XA 1K0TA 3F41A 1UFLA 2B9YA 3VCDA 4J9QA 1XNRF 4U9RA 5CCMA 5JXSA 1AUDA 5KFKA 4ELUA 2HHHF 4F4KA 2L41A 1NNDA 2VBZA 1N48A 4Y6IA 2M3DA 5I3PA 1K9MT 2OAUA 1RTDB 3AQOA 2XCAA 2HHTA 1RT1B 5A8WB 3HZEA 4G1QB 4YB6A 3BO4A 3BGUA 1X5TA 1G2EA 2AYBA 5G4DA 3HM9A 3CF5Q 3THPA 2W25A 3O1LA 4RNOA 2ZBIA 2GQ2A 2QA4S 2OSQA 3TW0A 2DGVA 2J6UA 1X7VA 1UEVA 1VHFA 2QLWA 4ECWA 2CQ1A 3CDEA 1S1VA 1QLNA 1TP7A 5KG6A 2GHPA 1HYSA 3ISNC 2RF2A 2W9BA 2KJWA 5IT9Y 4YHHF 1JNZB 5DDOC 3VZIA 4FN5A 2MMYA 1KD1T 2ASYA 1C0TA 3U1LA 2ZH8A 2UUTA 3WDOA 1FE0A 2B0GA 2C3MA 3OW2R 4PQAA 1KN6A 2DGQA 1RKIA 5E7OB 4NXMF 1C0UB 1X9WA 3JAMY 3BM7A 3BSAA 3KLFA 1OS5A 4DLGA 1FKOA 3NMAA 4C9DA 3G8QA 1HPZA 4C98A 6FDRA 2IC3A 1ZTWA 4ELVA 3P5TL 1IJFB 4RBTA 2LQJA 3UNGC 3CSKA 4M95A 4WFZA 5I42B 3M1VB 2DNHA 2JVOA 2JDJA 3OQ2A 2ROGA 3HX9A 1J5OB 4LT6A 4ERDA 2CPJA 4MIBA 5JVGQ 2J6SA 2E9ZA 4A8WA 4TLRA 4IOAQ 1HBOA 4ZHRB 3QO9A 4CNZA 2GQCA 1KR4A 5DJBA 3MR5A 3LW5C 2C22A 1T03B 1ELOA 4KFBB 4ED3A 2VA2A 4NLGA 2Z8QA 1M90T 1TZ0A 4GMKA 1N6QA 3OFHA 4N5SA 2X3GA 3DRXA 5F0UA 2YNIA 5K5MA 2FLPA 1S1UA 3PVXA 3NNCA 2VG7A 4QYZJ 1TAUA 2HNDB 4C3LA 5BR8F 1DBDA 3UCUP 4JI6F 1HWKA 2QYCA 2DPIA 2WK4A 3OHBA 2Z2MA 3BN7A 2XMKA 3CDAA 2MY7A 1W2BR 3T9NA 4RWWA 1VBYA 1QY7A 2CPFA 1R89A 1RI7A 2W4CA 3IN5A 4ECUA 2BOPA 3VAGA 3M4XA 2R8IA 2IA0A 5A8RA 1BQXA 2ZJQQ 4ZPVR 2F9JA 1TL5A 3FSXA 2BXJA 3GMGA 4TY8B 4ZA1A 4OHXA 3W3SA 1AFJA 4RLEA 3Q8RB 4ILMA 1U2RA 2D9OA 2R7UA 3DLJA 2DHXA 3L7PA 1ZH5A 3QLHA 1WI8A 2HHQA 4DMZA 2XO7A 2G0CA 1ULRA 3MMAB 4TQSA 1U6BA 2EFQA 3IWXA 4NA1A 2NPFA 2NXUA 3UR3C 2HS3A 2EWHA 4D3GA 5MAOA 4DSEA 2W8KA 4B9MA 3TVZA 1IKYA 1JLEA 4NLVA 4A47A 4ED0A 3GWCA 4IO1A 1K1SA 3TA0A 2KTQA 2ROPA 3FGVA 3CCZA 3A1YG 1YSJA 2E7XA 3SDEB 2KYZA 4WXOA 2XGPA 5DG7A 1KNZA 4QCLA 1WHWA 4IRCA 1ZM3A 2BRKA 3T1YF 1ZTTA 3K5OA 2ROEA 4I2QA 4I4BA 3RW6A 1OQ6A 3D0GE 4AL5A 1OIAA 5IWAF 3KK2B 3NWGA 2KRRA 4NLUA 1L3SA 2P6TA 2EPIA 4FNIA 3KHGA 2C3PA 1F9FA 3ZZTA 1VIOA 4M8LA 4W92B 4R8UA 2JVRA 4K59A 3L09A 4KRWA 2YKOA 3M2UA 2IRUA 1S49A 4FXVA 3G71S 3TAQA 2WTFA 4OZLA 3VZHA 4Q5VA 4QWEA 4PPZA 4OHWA 2ZH7A 1FDDA 5AXKA 1E6VA 2IFXA 2B6AA 4KGMA 4QU6A 3ISZA 1ROFA 3HKZD 4J9RA 4IG0A 1SB6A 1N52B 2GIRA 3DMJB 2MJUA 2GMLA 3M8QB 5K8NA 5J2NA 3P6YC 4CO5A 3D2WA 5KG1A 4RW6B 3H25A 4ES3A 3VF0B 5G0RB 2FGCA 4C11B 2AX1A 3EGNA 1RK8A 5HL7Q 4ZP7A 1L3VA 2QSFA 1D1UA 2IRYA 2BE2A 1S9EB 5EWGA 1FTCA 1IKXA 3IR5B 2ZH4A 4DJBA 5CCLA 4QOTA 1N8RT 3M8RA 3HHLC 2WOMA 1S0OA 2DNZA 5AXMA 2MQQA 4O23A 1KQGB 1GXTA 3KG0A 3OVAA 1LW0A 4ZKAA 2FVPA 2YWKA 3SFGA 4EU0A 2LYVA 2XMTA 1RT3B 1S0VA 3MM5A 1LWFA 2HNZB 2VL1A 2YVSA 4QR0A 4Y3CA 3VQTA 3KG4A 1NEEA 2QMWA 4ATNA 3T3FA 2CQHA 1SI9A 1HBNA 4RW8B 1GAOA 1TKXB 1F5CA 3ZZRA 3K59A 4OHYA 1HNWF 4NLPA 4ETXA 3HP6A 2DHAA 5LMUF 1WD6A 4DSIA 4WZMA 2CDQA 3IGVA 4PWDB