1F5CA

Crystal structure of f25h ferredoxin 1 mutant from azotobacter vinelandii at 1.75 angstrom resolution
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
106
structure length
106
Chain Sequence
AFVVTDNCIKCKYTDCVEVCPVDCHYEGPNFLVIHPDECIDCALCEPECPAQAIFSEDEVPEDMQEFIQLNAELAEVWPNITEKKDPLPDAEDWDGVKGKLQHLER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of ferredoxin variants exhibiting large changes in [Fe-S] reduction potential.
pubmed rcsb
source organism Azotobacter vinelandii
molecule tags Electron transport
molecule keywords FERREDOXIN 1
total genus 31
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 2000-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00037 Fer4 4Fe-4S binding domain
A PF11953 DUF3470 Domain of unknown function (DUF3470)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1f5cA00
1D3WA 1HFEL 1FTCA 3C8YA 3MMAA 3OR1B 3IR5B 3LW5C 5BYRA 1H7WA 5CH7B 1B0VA 1FRMA 2PMZD 1FRXA 3MM8B 1AXQA 5CHCB 2C3MA 2C42A 2FDNA 1BWEA 3HKZD 2FD2A 1K0TA 3MM5A 1ROFA 2WSFC 1FCAA 5E7OB 1A6LA 2VPWB 4YDDB 2C3OA 2ZVSA 1BQXA 2FJEB 3MM5B 1JNRB 6FDRA 1KEKA 2UZAA 1Y4ZB 3EXYA 1FRJA 1FRIA 4OMFG 3OR2B 1FD2A 2PDAA 1F5CA 1DURA 1G6BA 2WSCC 2XSJA 3GYXB 3IR7B 3MMCA 5FD1A 2FJAB 4CI0B 1FRKA 3OR2A 1BD6A 2GMJA 4OV1A 2Z8QA 1IQZA 2XSJB 1SIZA 3MM7B 1Y5LB 1H0HB 3MMCB 1H98A 1Y5IB 1C4CA 2O01C 1WTFA 2V4JB 1SIWB 2VKRA 1GTEA 1DAXA 1GTHA 2VPYB 2VPXB 2C3UA 3IR6B 2WB1D 3MM9A 4RKUC 1Q16B 1FDNA 2VPZB 1C4AA 1FXDA 2IVFB 4ID8A 1VJWA 6FD1A 4DHVA 4XDDA 3MM9B 2FGOA 1F5BA 1BC6A 1FEHA 1FRLA 1H7XA 1FDAA 1BLUA 7FDRA 1FRHA 1FXRA 4AYBD 4XDCA 1Y5NB 1KQFB 1B0PA 1RGVA 3MMAB 1JNZB 2V2KA 1F2GA 3OR1A 3MM7A 3MM6A 2PA8D 1JB0C 1GAOA 1XERA 2V4JA 3MMBB 2FJDB 2Y0SD 1IR0A 3MM8A 1R27B 5BYSA 3MM6B 3EUNA 1FF2A 2C3PA 5L8RC 4Y28C 1FDDA 1FERA 5BYQA 1KQGB 1PC4A 1G3OA 3MMBA 3PNIA 4XK8C 4L6V3 7FD1A 1B0TA 4KT0C 1FDBA 1CLFA 1DFDA 1GT8A 2WAQD 1SJ1A 1PC5A 2FJBB 2C3YA 2WSEC 2GMHA 3EGWB
chains in the Genus database with same CATH superfamily
1JJCB 1K44A 4CLWA 1KKHA 1SQEA 2YKMA 5CABA 5GMKa 5EWEA 4YB7A 2B6AB 4CCHA 4C8MA 1XMOJ 1VBZA 2DHHA 3AJ1A 4K2JA 4YS2A 4N56A 3G8TA 2HMIA 4ANCA 3MI7X 3GJSB 2HHWA 4X4NA 2OP5A 1AUDA 4YB1P 3OL6A 1XMQJ 4NXMJ 2RHSB 3BKFA 3THPA 5DQGA 3M8PB 1UEKA 2XZTB 4CLPA 2PI5A 2HHSA 2M8DB 2ZD1B 2H9ZA 1Q0NA 2W25A 3UW1A 2M4MA 4NCGA 4WFAQ 2CG4A 2FYXA 1MN9A 2OLWA 4ECZA 3OL7A 2VV5A 2HGLA 1MG7A 1XTZA 3DLLQ 2YNGB 1UW4A 1WHWA 4O44A 1KWMA 4EBDA 1S9EB 4LVNP 3QBCA 4M8LA 4I69A 4ZP8A 2FVQA 1OS5A 3C6TA 2JLEA 2MQ8A 4IKAA 2CWKA 4F3OA 3B54A 4QWBA 1A6LA 1FI4A 2GAHC 3E2EA 3QMQA 2CVEA 3PDNA 4D3GA 3M7VA 3QLHB 1TVRB 2HS0A 2ZVSA 2B4OA 3NS5A 4NYPA 1DRZA 4K4SA 3DNCA 4TLRA 1FRJA 3UO0A 2ZH1A 3BSCA 1RSCA 3HVAA 3A1YG 4RW6B 3AD8C 3AA8A 3PKYA 2VASA 4U9RA 2CXEA 1G6BA 3EE3A 4EO8A 3ZZ0A 4AUKA 5GMEA 1Q8KA 1UVKA 2MEWA 2RS8A 3SBMA 3W7BA 3CMAS 4W92B 2BE2B 5EHHA 2HHTA 2YWWA 2DHSA 2KVIA 2FHMA 1IQZA 3HF5A 4ZVTB 3CD0A 4RNOA 4A8MP 3C3LA 3FZBA 1GH8A 2Z30B 3FBEA 1LK7A 3H20A 2D3UA 1VBYA 2VQEF 4EZ9A 1RU1A 2XWXA 5A0YB 1X9MA 2JSXA 3CJSA 1R6YA 3VV2B 3M8QB 5LMNF 4CWBA 4KHPF 1LXJA 1TL5A 2RMLA 3OL9A 3E8OA 1PJ6A 1Q16B 2NZ4A 2FZCB 5I42B 1N52B 3MD1A 5FIIA 3WZ0A 4R8UB 3LTOA 3GV8B 4DR4J 3LA0A 2W2QP 3DC2A 5JJBA 1VQ9S 3M1VA 1P6TA 3GCXP 4FYYB 4KAIA 3KLIA 4ANDA 2A6MA 2B7BB 1FDAA 2QLJB 3QATA 4U7CA 3EZ5A 2UUCJ 3CMES 3DLJA 2LXIA 2KRRA 4LUBA 4RZRA 4YR2A 5HQLA 4LF4F 3NCRA 3BKTA 4O4GA 3TAPA 2OGUA 2GC8A 4OI3A 1JLBB 3NGKA 4LFAF 1JK9B 3GB0A 3R5JB 5HP1A 1TQLA 5C25A 2BJ3A 5T14A 1FJGJ 3MM6A 1LWXA 3NGSA 4KR0B 4E8UA 2HHQA 5IT9U 1NSKL 2PA8D 2I38A 4B3SF 4O4GB 1U48A 3H59A 3SQGA 2DR8A 4BWJA 1XNRJ 2YKOA 3H90A 2OMOA 2BRLA 3ADAC 2UP1A 3E01A 2GV1A 5GAHI 3SZ2A 3EUNA 5J2NA 1N6QB 1FERA 3F56A 3W9IA 2BV3A 3ONQA 4LREA 3PX4A 4ELVA 4JV2A 2DXEA 4HDHA 4XK8C 4NOHA 2W9BA 1XK8A 2QEXS 4WFNQ 5KTQA 4EK2A 1G2EA 1HNXJ 1WC3A 2FPHX 2LQJA 2CG8A 4PWWA 2WSEC 3HLUA 2M2BA 2WVDA 4NA3A 4ECXA 1P9YA 2HVHA 4M5MA 3SXLA 1U0HA 2AYMA 5K8MA 3KNAA 4N76A 4QIGA 2LP4A 3VF0B 2LECA 4NXNJ 2V50A 1SVDA 1U26A 1TZ0A 1X4AA 2BW7A 3UDCA 1CULA 2DGOA 2HZVA 4IRCA 2BR0A 1RP5A 3C16A 2OIHA 2BACA 5L39A 2UU9F 4V19X 1C0UB 1WWHA 2ZVIA 2CYYA 3POTB 2EC0A 1QDUB 4OV6A 4I2QB 2VD3A 5IZHA 4KY3A 3K5NA 2AQ4A 1FEEA 3PYFA 1RLCL 1HQUB 1UWBA 2DNKA 4WFYA 4M5JA 2IBOA 2JNJA 3POTA 3JB9k 1VIXA 3R5DA 5KFZA 2DNQA 2E5HA 4E98A 1UWBB 4OYZA 3H0PA 5E0OA 3UQSA 3MEGB 4UT4A 1DJ0A 2LXUA 2XMKA 4IOBA 3CCQS 3CC7S 2D41A 3T1HJ 4NLPA 4NZ0A 4QIEA 1U24A 3H2VE 3KUHA 3BQ0A 2OD6A 4Q45A 2VPWB 4K7QA 1VLOA 4NLQA 2XLJA 3DM2A 2XNQA 3P6YC 2ROGA 1BQXA 4PQAA 4OHVA 1JNRB 3ETMA 4RUBA 3G9CA 3SFGA 1G1XA 1WOPA 1X4EA 4EYIB 2MMYA 1UVMA 2R8KA 2P9EA 1N5SA 3CCVS 3SCKE 2PD1A 2VG6A 4UZCA 5L1KA 4OI1A 3RRHA 2UUCF 2J7KA 2V8HA 1RT7B 1IQTA 1QM9A 1Q79A 2EFQA 4OI0A 4OX9J 2XMAA 3LO3A 1Z4UA 2LCWA 3LP2B 3D5MA 2B7CB 4LF7J 4USKA 4OV1A 3A12A 3FSYA 3OSNA 1YZ7A 1Y11A 4UOCA 3ZTRA 5IQ6A 1VMBA 3RYLA 4B9SA 4WKRA 1FJGF 3PO5A 4ZPCA 2NXUA 3MPDA 3RRKA 5C25B 4K4ZA 1TELA 2EBEA 3G82B 2CPEA 2HKEA 2HS4A 4OYMA 4L75A 3TYTA 1RHMB 4AL6A 4URSA 2V2VA 3CC4S 4E0DA 2P2CB 3M8RA 4ED7A 2HNYA 1PAUB 2K8GA 1OY8A 3D6FB 1S1XA 4CO3A 5GMDA 4LF8F 3DHXA 3A4TA 4QWEA 3VVTA 3IR6B 1UA1A 3I0RA 3LAKA 1UAWA 2RU3A 4NMLA 4HHHA 1D9FA 1J5EJ 1WI8A 3TX0A 4I6WA 5LXYA 3BPSP 3C66A 2E7VA 3RBEA 2OO4A 2POKA 5KG2A 4WPAA 3I0RB 3F73A 4K4TA 2BVZA 4KFBA 5C42A 3WC2A 3LGMA 2RKIB 1WC5A 2WONB 3UD5A 2VA2A 3O3LA 1VQSA 3HSJA 3ZC4A 2KFYA 2Y8WA 1B3TA 1FVSA 4FPIA 2A0FB 2EKYA 3AXMA 4X4OA 3FJ2A 1YG0A 3PW0A 2MY8A 2AYBA 5CYQA 2OUGA 1FNXH 2FZGB 3MEKA 4WFBQ 1YJUA 2I2YA 2J0SD 2F7VA 4RNNA 4Q2LA 1SKRA 4B9UA 2MZ1A 1FTRA 4DPXA 1Q8IA 3CCSS 1S97A 4KHMA 4QQBA 1XERA 1JJHA 5KT5A 2KM8C 3MMBB 2W9AA 3Q0AA 2E5LJ 4JI5F 4JI6J 3MECB 1KOOA 2V4QA 4MIAA 2ALYB 4JB8B 4A8KA 2Q66A 1YJWS 2AGOA 1RAOA 2BW2A 2HIYA 4YEAA 2AX1A 3MMBA 4ZJOA 3MEGA 2Q79A 3PNIA 1IBMF 3CDEA 2B4UA 4ZPVR 4DUZJ 1HQEA 5ETQA 3TJ9A 3WIUA 1N36F 4LFCJ 1L3TA 1YVFA 1PC5A 2JHEA 3FBBA 3GG1A 2DO0A 2J8SA 3GZ7A 3S1TA 4F3QA 2J6TA 1N5YA 3JSMB 3TR5A 2DR7A 3RRGA 1RT2A 2V8GA 1FFSB 1HARA 3THTA 5ETKA 1SC3B 5KFBA 5L1LA 4DX7A 3P4UB 5GAGI 2DNMA 1S6QB 3HJVA 2ZJPQ 2XMMA 4CH7A 3H4DA 2MKHA 1ELOA 5A6PA 4DSKA 2CWXA 4IG0A 1Q5YA 4LF7F 1YJ7A 2XI3A 2MZTA 2DB1A 4MIWA 3PR5B 4KGVB 4DS5A 2QMUB 4A8FA 4LVOP 4USVA 2YXLA 4KGXB 4PXBA 1S72S 4W98A 1IM6A 2NPIA 1Y0HA 2DIUA 3HI9A 4JYAF 1T9UA 3ENAA 4GVLA 3W2WB 3RB6A 2YNIB 3DRPA 3G82A 4KSEB 4DSJA 4IRDA 3PY8A 5F9NA 2FD2A 4IH5A 1FWKA 1PILA 1GNKA 1T94A 4PABA 1KQKA 1BXNA 1RAEB 4PPZA 4WP3A 3EVOA 1TL3A 3W2WA 3KNGA 2Z58B 2HHXA 4QCLA 2DPIA 3AODA 3KLHB 2H51B 3MM5B 4DEZA 2V8PA 3G8QA 2H65B 3EXYA 3MAAA 4LF1A 3AB2B 3PW2A 2M88A 1NJYA 2VUGA 4OMFG 4IRKA 4NLWA 2ROEA 3C19A 3ITHB 1S1VA 4R0JA 5GAEU 2EKNA 1LW2A 2I0XA 3IRWP 2RUSA 4DV5F 1W26A 3WC0A 5KFFA 1DHMA 3DRRA 3DU6A 3CCTA 1DY3A 2B5JA 3P45B 2AJ4A 3H5UA 2RIJA 4H4OA 4FS2A 4QIFA 3CEDA 4TY8A 2P6SA 3BZQA 1Q8LA 3MR2A 4DR6J 1Q53A 1QJHA 1U6BA 4RW8B 3IAS9 3RB3A 4A47A 3O5TB 2QMWA 2IM3A 2EI5A 2BANB 2QFJA 5G0RA 2CPHA 2UUAJ 2GO9A 1VRQC 5MAOA 3OLAA 3NL0A 2NZCA 2F3JA 2LEPA 4FDFA 2IRYA 3D28A 4OZ1A 4DPYA 3CCMS 1XNQJ 3K8WA 3D68A 3FEZA 3R8YA 4Y00A 4MFBB 4KGKA 7AT1B 4V19J 1F3VA 2QZ8A 3R7BB 1YJNS 4L72B 4O0NA 2IPOB 3WX8A 4QPXA 3KK2B 5EDWA 2JX2A 1S0MA 5FDLB 1JLFB 2HQFA 5GADI 4RNMA 2R7XA 4RW4A 4JI4J 1PCAA 3DLBA 2BKNA 1IM4A 1HI1A 3SI8A 2X1AA 4DL7A 3BS9A 2GHWA 1P8GA 1RHUB 1UJ6A 1B7YB 3T9ZA 1LFPA 5FDLA 4C98A 1U1NA 3JXOA 1EHWA 1F0XA 4K4UA 5IT4A 1HR0F 1O6XA 1XMOF 2G0JA 3HHDA 1S5ZA 4DXLA 3KTQA 1AZSA 1V3RA 3OPKA 2IJNA 3W2VA 1RE1B 3N5FA 2W4PA 3W5XA 4JI2J 3PEHA 3VZIA 3HD2A 2F63A 3HHKA 2NPFA 1R43A 1TL1B 4ZLPA 5LXRA 3BQ2A 1HI0P 5BYSA 3I4HX 2QO3A 4EZ6A 2XULA 2H4YB 4OI6A 1NKEA 4X4SA 1FDDA 3RB0A 2NYHA 4B3RJ 1YJRA 1KQGB 2Z2LA 5HMXA 4IR1A 1T0TV 4IO1A 1YI2S 2BQ3A 3HFZB 3NMAA 1IBKJ 2QRRA 1EX8A 2NUUG 1RCOB 4FVMA 3VAMA 4B9LA 2J9CA 1PIEA 4GO5X 1U49A 5GVQA 4ZMMA 1XMBA 3SYZA 1HPZA 1ULRA 1U09A 2AV5A 2KN4A 3F41A 4IR9A 1HBOA 5B0GA 5HLFB 1D3WA 1CS4A 1EB0A 1S49A 1YBAA 2BYCA 3T41A 3VWSA 2FIUA 4AFFA 2R4FA 4F2RA 3BREA 2ZFHA 2DH9A 2HBYB 3IR5B 3EWGA 1OIAA 3E3XA 3M6WA 3R2DJ 2NXCA 1YTYA 2K7KA 1TU0B 4USIA 1B0VA 3DRRB 2W9CA 2P5VA 4J9KA 3PW7A 4O44B 1VBXA 4P74A 2ZHOA 2K1RA 1GQEA 5A8RB 1PGZA 3ELHA 3I5AA 3PTWA 1BE4A 1RBOB 2AWZA 3HT3A 2IJFA 1QAIA 4WU3A 2HQ3A 4DZ6A 1T9WA 2B9EA 4LMZA 4IYQA 3O44A 4AQYF 2UUAF 2KXNB 4LF5F 3PFOA 5K14A 2DNZA 4DV2F 2BJEA 2ATCB 4ENOA 3GTYX 4KO0A 2GVZB 1SKWA 1R8AA 1YJVA 5DDRC 1KVKA 3BGOP 2KYXA 5D3GB 4OYXA 3AA9A 3C6TB 5KFIA 4S0MA 3DOMB 3W9JA 3CUNA 4CTAA 3U27A 4KHRA 5DRKA 4DZDA 1SC1B 5K8NA 3I9ZA 1KHVA 1TTHB 2D69A 1FD2A 2MHEA 4H4KA 5FLXY 1M5SA 4FXDA 1FT8A 4ZVRB 2KG0A 2WSCC 4MT1A 3SCIE 2MZRA 3A8KA 2BABA 2ZNYA 5D4OA 5E33A 4ZVEA 1EP4A 2XI2A 1YX2A 5F8GA 2GMLA 2ERRA 1JWWA 4CI0B 4RNHA 3ZTSA 3EJMA 3BDPA 4ZVHA 2GHPA 3FCHA 4ZA1A 2JEIA 4I4BA 1S0OA 3OTDA 4BC9A 1HBNB 3ILLA 4EU0A 5SUHA 2GIFA 3D1OA 3FUYA 5HANA 1AZSB 4QU6A 5CXTA 2EBGA 3X1LB 1H98A 1N0UA 1C4CA 5KFSA 4C97A 3JQKA 4WJBA 1SIWB 2Z0GA 4MK9A 2DR9A 3M2UA 3J7Z5 4IQMA 1JJ2R 1KC8T 1RU2A 2OPQA 5K8OA 5DLFA 2YWHA 5ETNA 2ADBA 4Y2MA 2WB1D 4IOAQ 2XMUA 4NLSA 4ANEA 1OY6A 2RE1A 3OFGA 3OQ2A 3N0VA 3G6YA 4ER8A 2BQUA 3TAQA 3OTBA 3SQOP 2VG7B 2CJBA 2K06A 3KJNB 4QJVA 3P5BP 4EWTA 1DZ5A 2AYGA 2UVVA 5DETA 3PXGa 1HNXF 3VAHA 1F5BA 3IRXA 4WYWA 3A3NB 3G87A 2EFGA 1BC6A 3BGFA 4MKAA 5E3AA 2EXUA 1ZYQA 3RBDA 1FXRA 2ZH5A 4DL6A 4PR6A 5KAKA 1HD1A 3KK1A 3LPEA 1VGYA 4DFKA 2G1DA 5A6WA 3LWMA 4NRUA 1KOHA 1SV5A 2KT2A 2SXLA 3SCLE 2XO6A 4B3TJ 2HMIB 3MM7A 4KKOB 1N36J 3T3FA 1S76D 4LJMA 3OL8A 1V5IB 1MN7A 2FLOA 2OSRA 2V9KA 2IIHA 1B7FA 1UWAA 5E41A 3PIOQ 1G7CB 2W9CB 4C4WA 1VQ8S 1NM2A 4WFZA 1Q95G 1M0SA 2K3IA 3NWGA 1JLCA 2W4CA 2HVZA 1CC7A 3MM6B 3CB4A 3M05A 4QZVB 1IKWB 2E44A 5THWA 2CPIA 3P8BB 2NCKL 2BE9B 3CJQA 4C48A 3OHBA 3KLGA 4YFUA 3LH2S 4H54A 3DDIA 1JXVA 1ZAVA 3NWRA 1TL4A 3K7RA 3OHAA 2HWTA 4F4WA 1GT8A 2D3O1 2HQGA 3SMZA 1CLFA 1SJ1A 2GVZA 1U1QA 3DKDA 2JJ4D 1RTJB 4RW7B 1TMMA 4XAKA 3W5ZA 1RA7A 3C6UB 3MAQA 4LF4J 3C8YA 1HBUA 5A2QU 2HFNA 4OJHA 1BUXA 1V6HA 4KGZB 3FC9A 1NH7A 3ILOA 1TAUA 1RABB 3UCZP 3LWLA 1FRMA 3R5CA 2PMZD 2FVCA 3D67A 2Z2ZA 4JI2F 3NAIA 4CLTA 2N7CA 2MGZA 2RQCA 2AJQA 4WF9Q 2CNOB 4DV0J 1HWIA 3B4MA 1C0UA 1RWXB 4KB7A 1RWPB 3DGPA 1GMVA 2ZJQQ 2VODA 1Z2LA 4CIOA 4AL5A 3CVKA 1JLAB 4TU7A 2ACYA 2AMCB 2LQ5A 2MZJA 3Q8PB 1H2VZ 3DM2B 4QOTA 3BSOA 3BGLA 4N8OA 3GWCA 1YIJS 1FFGB 1YQHA 2RAQA 2UXDF 3QRRA 2E66A 4A46A 3HHLA 3K59A 3BN7A 5CYMA 2LKZA 1CQNA 2LQBA 4MMOA 3KJFB 2A3JA 3V6DA 4FNIA 2CQ4A 3G6ES 3FGVA 4C6AA 3ICLA 4X4PA 4CH1A 2DR5A 2B4PA 2R3VA 2W2OP 4F0MA 1D0EA 3S8SA 1RWKB 1UFWA 1HNWF 2XCPA 4X62J 1IJFB 4DUTA 2WTFA 3O2IA 1WKKA 3D6TB 3QIPB 1M1KT 1WC6A 3GIMA 1KLMB 1GXLA 5LOQA 1UA0A 2AW0A 4GO7X 4ELTA 1IBLF 1XQIA 3CDUA 1OYDA 2X1GA 2QGFB 4DPUA 2JRSA 5DM7Q 2AT1B 4F2SA 2CJXB 4ZVQB 1CQMA 2J9DA 3DHWC 2ZNZA 2XGPA 3SV4A 4PUOA 1U25A 4ZOSA 1KS2A 2MKYA 4ES2A 1M5OC 2JVOA 4ED5A 4JBCA 1AB8A 2CQ3A 2XM3A 1MWQA 2E1AA 4MYUA 3E01B 1VRTB 1IUJA 3N4WA 2ASLA 3HFKA 1VC6A 2EK6A 1YHQS 4ZJQA 4Z37A 4KFBB 3KLGB 3D9BA 5J2MA 2QYGA 3B82A 3QWPA 4NZ7A 1H2TZ 2OHDA 3KLEB 1DTQA 1UJ4A 1S1XB 2HQDA 2KO1A 2QL5B 2O67A 4OYOA 3MEDB 2IVFB 1NNDA 3C14B 1OPZA 3SSQA 5DGBA 4B9NA 3CCJS 3Q8UA 4ZPBA 5B08A 5J2PB 4C8YA 4NLGA 1RTJA 1EZZB 1HKAA 4ZKAA 3KHRA 4OHYA 1TKZB 4DR2F 3HKWA 2R7SA 3C6UA 3IGNA 1RLDA 3NCQA 3C14A 3KUGA 2ZH6A 1B64A 2ZC4A 3BYRA 3GSDA 3MHYA 2R7WA 4WCEQ 1I94J 1HBMB 5F9LA 3P3DA 1FVQA 1Q4RA 2AEJA 3D6HB 3VCDA 2FVSA 5I3QA 3ISND 4NYZA 4G3IA 1P27B 1NPKA 4KH1B 4CO1A 1QAXA 4OL8A 4EUVA 2EEYA 5AJ3J 4O3PA 1KP6A 2XMWA 3UNYA 1R27B 1SH3A 5KT4A 2HRUA 3QJLA 3M9OB 1KN6A 5IC6B 5B0DA 2A2CA 1TUVA 4LBHA 3A8EA 3H5SA 2CJQA 4M5DA 4MYTA 4LIRA 4FYXB 4MAKA 2DGQA 1PC4A 3C15A 2IC3B 1S1TA 1VFJA 1N8RT 3JSMA 3SSSA 4I6YA 1U6FA 2G2OA 1VQYA 3H98A 5HMYA 5J2QB 5DLGA 3PYEA 1AUSL 2P6TA 2CQ0A 2GS8A 4DG1A 2HS3A 2Q1LA 2W2NP 3IG1B 2BJ7A 4OQJA 1S57A 2DHXA 3OJSA 3M6VA 1HQEB 2CIMA 4G1PA 4DR5F 1OQ6A 4NL5A 4JV1A 1NJIT 1Z1ZA 2M8HA 2ZWPA 5LT5A 1HNWJ 2WZ1A 1YWXA 3ZXWA 2DHGA 5CD4H 1X0FA 2CJYB 1FKOB 3H7HB 1NK8A 3K5PA 4B08A 4JI6F 1QSSA 3L7UA 2E5LF 1F3FA 5E5NA 3MM8B 3PJWA 3VGVA 4ECRA 1S6OA 2DY1A 4H4KC 3TI0A 1L3UA 2E29A 5F8NA 2C42A 5JMNA 4ZDNA 4NA1A 3MFHA 5KFCA 4DFJA 8ATCB 1K0TA 2HWHA 3EZOA 3KK3A 4IFYB 3M32B 2ASDA 5EX0A 2YPYA 3KG0A 2HNYB 4Z7YA 4NLOA 4CLUA 2WSFC 2AD9A 1H73A 1MW7A 1P1TA 3EVWA 5H9FK 2MKKA 4TLQA 4BS2A 4EYHB 2JLFA 5A8KB 3FBCA 2HHUA 2V63A 3M2RA 1LKZA 5DO2A 4QBUA 3LALA 3EDRB 3H2LA 2AKWB 5IT0A 2XS7A 2C2ZB 3NNAA 4ED4A 3MEDA 2H54B 4C3LA 4JI4F 2ZKUA 3KHHA 2XY7A 5LJ5Y 4A4JA 2WONA 3GYXB 1YKWA 1UVLA 1RHKB 2WRMA 2JH3A 3N6MA 4ZLNA 1L3VA 4BHQA 4M5HA 5KT6A 2L41A 3FQKA 4KBIA 2LFVA 3UN5A 1RTIA 3HJFA 1S1VB 2CDRB 1VYAA 3Q89A 4CO0A 2BANA 3D0IE 3CJ2A 4O23A 3M2VB 2RRAA 4J9VA 1NXIA 5F3ZA 3DXSX 4J7CA 1UFLA 2XS5A 2B9WA 4Y3CA 4CNZA 2GO8A 2XYGB 2GVDB 3PX6A 1XN9A 1VDHA 3D4JA 4QR0A 2HFUA 4DOZA 2HVIA 1T9YA 4J5OA 3TANA 4LQ3A 1RWMB 2XB2D 2BOPA 1JLQA 1RT1B 2OFGX 5G0RB 3U02A 2GQCA 1LK5A 2HHHJ 2DH8A 1D9DA 4P2SA 4NCAA 3MWBA 1SL1A 4Y65A 5L9XA 3HHEA 2QA4G 1T8EA 1NH8A 1OSCA 2LYVA 2NLWA 2ZC3A 5D4LA 4C2MA 5C2GA 7FDRA 3ZTOA 2OPRA 3CF5Q 2HNZA 5DDOC 1K8AT 4I7FB 2PI4A 3EYZA 5CCMA 4LF6J 2ZH3A 1RGVA 2MJUA 3PIPQ 3I4PA 2AX0A 3HXMA 2CA9A 4TQRA 4DL2A 3VGTA 2UV8A 5LJ3Y 3F44A 3A8IA 1BY9A 2MY7A 3X3UA 4WTOB 2ROPA 1FKOA 2CQ1A 2QLFB 2DCUB 3PFEA 2Y0SD 3EZUA 3RBXA 1U2RA 3UN3A 2UXCF 2HBQB 2XHWA 3KMSA 3W2VB 4UF4A 4DL5A 3NNCA 4DFMA 3J81j 2BQRA 3NBPB 4OJGA 4OYPA 1ZZFA 2VBZA 2GIRA 1ZTTA 1A9NB 4JUZA 4DV2J 5HLFA 4C9DA 3I82A 3WIVA 2FC9A 1R0CB 1XR5A 2HGMA 3ETOA 3CXCR 3QT6A 5D0EA 1IKYB 4GKJJ 2HK2A 2YKAA 3KLFB 4C8OA 3DRSA 2DGVA 1M5VC 2MB0B 2CJ9A 4CT8A 1TK5A 2JL9A 3MCMA 2DXDA 2HRYA 1U1RA 5E3PA 2UVRA 3TUPA 4K50A 1IKYA 2LA4A 3IGVA 2EK1A 1MU2A 3LQVA 3NS7B 5IV3A 3J7ZT 1NK7A 1WOSA 4ICLA 2G0CA 5H9EK 1I51B 3HHLC 2MLYA 3ZZYA 3U1MA 4A8QA 3RAQA 3LW5C 4ED8A 4LQ9A 3OLBA 4XPCA 3CO9A 1LWCA 4GVBB 3HVRA 2A10A 2B6AA 4HR2A 4LF9F 1CJKA 4YUDA 3R7NB 2F8HA 2LEAA 2CVIA 2G2YA 2XTJP 2WBRA 4UOGA 2ZZNA 4J9OA 1R0BG 3GLJA 2IM2A 1VK8A 1WJ9A 9ATCB 3AAWB 3D6MB 2CQHA 2HFVA 2V0NA 5AE3A 2BZ2A 1MMLA 1TV6A 2IM0A 2NXEA 1AA1B 4OI2A 1HNVA 2YKQA 1RK8A 3I5CA 3MPYA 2M5YA 4CTAB 1FCAA 2ZH2A 4PQUA 4RJVA 2Y1RI 2IAJB 2YNGA 4C8KA 4PWDB 1J5EF 2Z56B 1HNIA 2B9YA 4NWBA 1QTMA 2RUGA 2QA4S 3EM1A 5K14B 3FQLA 5KG7A 2V9WA 2RHQB 1WC1A 2PE8A 3MR7A 5HJXA 2CNNB 1KR4A 1N5QA 5HQ8A 3BYPA 5KFDA 5EWGA 5D3GA 4RPFA 1UPPA 1YRUA 1NHKL 2B4VA 2C2KB 2OPSA 2AJ1A 3MDFA 4TQSA 1RT4A 3IR7B 2ZWOA 2DT9A 4I2PB 3NP5A 5ADZA 2V4RA 3I56S 2ZBRA 2N4DA 4I7FA 5L1JA 2Z4PA 1VQ4S 1IKXA 2RQMA 4X4RA 3FMBA 2H48B 4IG3A 1ZTWA 1W25A 3GFXA 3M2UB 1SIZA 4BLGA 2JOQA 1UETA 3CJ5A 3KG4A 3CNQP 1A7GE 1BQNB 1RTHB 5LSOA 2R2UA 3UFCX 2VZ9A 4K0KF 4A8OA 1RWVB 1Y5IB 1K9MT 3TRGA 4F25A 2I6WA 1GMUA 1WELA 5IC4B 4AQYJ 2QLWA 1ACMB 1RACB 3A3OB 3FNNA 1LW0A 4DUYJ 1A0OB 2ABYA 4DR3F 1VQ5S 2CPZA 4O4RA 2MQOA 1ZOTA 4OX7A 4AL7A 3AJDA 1VHIA 3IRXB 4U6PA 3NBPA 4KRWA 3Q24A 3AFGA 3K8VA 3MTJA 1W2BR 1RYRA 1SJRA 1Z2ZA 2OPQB 1SL2A 4LFCF 1NEEA 3CJKB 4NYOA 3CGIA 3IO1A 3FEYB 2VDIA 2R2SA 2VICA 3JTNA 1TFWA 3HO1A 5IQQA 1RT5A 2O3DA 4KKOA 2L9DA 2WVBA 2K7JA 2ZBIA 2F9DA 2N3LA 3N01A 1S0NA 2YKMB 1Y3JA 1TKTA 2HFSA 4B3OB 1NKCA 2I5JA 2QJ3A 3R27A 3BBBA 4DBQA 3WDOA 4M5GA 2M0GB 4M5KA 4HTJA 2L48A 1O51A 1J2VA 2RRNA 3QSIA 2GJ2A 3V2UC 4HTIA 3W8GA 4B3OA 1SV5B 2BM1A 4ZCIA 2OEKA 5A8RA 1WC4A 3KUEA 4B3MF 2DXFA 1UFKA 2L9WA 3NGRA 4NCGB 1XR7A 5J1NA 3K58A 2V2ZA 4ZCKA 1PYSB 1YBTA 5BYQA 1CJVA 4ZPTR 1TK8A 1RT3A 1G3OA 2WVFA 2MKIA 4UTGA 2BOAA 2HVDA 5B0CA 1JQGA 1S4EA 2GAGC 2H5JB 1VBKA 2YNHA 3PCOB 5KFQA 3GIJA 4MH8A 2WAQD 3W63A 2V68A 3OJUA 4ELUA 1WNEA 1TKXA 1SL0A 2C3YA 1MWZA 3NLCA 2B51A 4MKYA 2G0IA 4ZVPB 2KYZA 3KWMA 4OZ2A 3K89A 1TAQA 2G9OA 5F0UA 3DLEB 1HW8A 3US5A 1HFEL 3DRXA 4ED3A 1TKXB 4FBUA 1FTCA 2DGTA 5IM0A 1NDPA 3QRQA 1J27A 3HFVA 3W60A 3GSIA 3BJYA 4ED6A 1VI7A 3HT0A 2MKCA 4LSNB 4ITSA 2C2DA 2HW3A 4ZITA 4DV5J 2KKHA 5IV4A 5D0RA 1WG1A 1K1QA 4CLZA 2DO4A 1UJ5A 1CJTB 2MTLA 5CA5A 3B4DA 3TVZA 1TUWA 3GILA 4X65J 1VHFA 4ECTA 4JI5J 2KT3A 1AT1B 4AE5A 5F8MA 3MPVA 4ZIVA 3NOGA 3PYGA 2C2OB 4Q7AA 4TXSA 5F3TA 3K5LA 4J9RA 4IO9Q 3EDQB 5B0BA 1YLXA 2GJIA 3IBCB 2A18A 2AHOB 4PPDA 2DNHA 5HSPA 3CCES 2Z2YB 2QG9B 4YOEA 2B3TB 3UR0A 2XZWA 4DUZF 1VOMA 3MEEB 1T9TA 1R3NA 4QPTA 2J7UA 3TA1A 2VG5A 2YY3A 5LMUJ 2UXBF 1WSRA 1RAIB 3NKYA 3P49B 2DTJA 1HYSB 1QE1A 1NDLA 1CJUB 3R5BA 3FSXA 2HHVA 4DQPA 4M94A 1RTDA 3CCWA 4EEYA 2BM0A 4FVCA 1QVGR 1X5SA 1M1HA 2HEKA 2VKZG 4DPOA 3T5LA 4FF3A 3OVBA 3ZTQA 2CFXA 3PHEA 4R5PA 1E6YA 2QIFA 3M1VB 3C16B 3D2WA 1XNRF 2MKSA 4I56A 5AXKA 3V6DB 3WX4A 2XYHB 1GX5A 2EFOA 4C3MA 3J7YU 3UCUP 3CD6S 2VC0A 4DCPB 1HHQA 3V6JA 2Z8QA 1TL7A 2DNOA 1S4FA 3CPWR 3CJ8A 4IOCQ 1KHWA 2EG2A 2X3DA 2MZSA 3BKUA 1WTFA 4N47A 5KT7A 4FN5A 1VQ7S 4TU9A 3JSRA 1KLMA 1RAJA 2OEMA 3FRYA 3WBZA 3T5HA 2E5JA 2VPYB 1JLCB 2NR0A 3BN4A 2XC9A 1SQFA 2F8EX 3ZNJ1 5KFWA 4F8RA 4G1QA 5C5JA 4KQZA 3UN2A 1VQ6S 2FTRA 2RILA 2W01A 3ZTPA 2U2FA 4DLEA 2VQFJ 2YQ1A 3TQEA 3KKFA 4HEA9 3B8HA 4DL4A 3UD4P 5I3UA 3T6JA 2AJ2A 4NRTA 4DV3F 1NJXA 1IBKF 3SDEA 1N32F 4P71A 1CPZA 1URNA 2FGOA 4B9TA 5F0WA 1VC5A 1F1BB 4LIWA 4NA2A 1VQKS 3N5BA 1HBMA 2R7UA 3Q8VA 4X84A 1HMVB 4RW7A 2CPDA 3TZZA 4X62F 2LDYA 2M7SA 1S1WA 1X5PA 3LP0B 1RISA 4NLDA 3CD5A 3CULA 2V8DA 3ISZA 5GAHU 5IM0B 3EX7B 2PFFB 4ZIWA 3PRDA 4AXIA 4N5SA 2ASJA 3DN9A 2NREA 2UU9J 2XLKA 1DARA 1MNEA 4G6VB 1Y3KA 2YNFB 2XS2A 1FX4A 2YKNA 5CYQB 4FXWA 3ZZTA 4FKYA 2Y8YA 2U1AA 2GFFA 5HATA 2IC3A 2HG4A 4L3NA 4P2XA 2YWEA 3VGUA 2HFZA 1RYSA 4NLXA 2R8HA 1BQMA 4M5IA 3QYYA 1M90T 2F4VF 2W4DA 1X7VA 3GE9A 4AXJA 3IC1A 1DFDA 3QO9A 4B9MA 1NDKA 2HRTA 5KFGA 2QX0A 3HVTA 4L73A 2KXHA 3W61A 2R2TA 2AJFE 3HDSA 2DEIA 3C15B 4W90B 1R7IA 2IBKA 5JVHQ 2F5GA 3NMRA 1SQGA 1I6JA 2DISA 1YK9A 2VOPA 2YX4A 2HK3A 3FKBA 2D3ZA 2VONA 2BE7D 3I96A 2D3OR 1SC6A 2DH7A 1WG4A 2RRBA 4PAAA 5HQMA 4WFXA 4ZHRA 2PA3A 1KVJA 3GU0A 5KG1A 2JFKA 1LQ9A 2VBWA 3IP0A 5T41A 3T5JA 2R7QA 2ATLA 1WHYA 2NSBA 4JI8J 3KXDA 1Q5VA 4A8YA 2DJWA 1R31A 3MECA 4ES1A 4F04B 2VU5A 3M32A 3O8WA 4ZVFA 3AHPA 2V2QA 4RBVA 3TUZC 1REVB 1RHQB 2FDNA 4RW9A 4DV6F 1JKHB 3FBFA 3G96A 3QRPA 2DY9A 4RX6A 4B3RF 4CRJA 2OSQA 3EGNA 2V5HG 5ETMA 1EQ0A 3PYDA 4ATNA 2FJWA 3BB5A 3KFWX 1KBRA 3W64A 3KJVB 4OJ1A 2YNIA 1YSJA 1KRPA 4G1QB 4CO2A 1RKIA 1B70B 1RTZA 1WDDA 5CQGA 4F0KA 1SKUB 1KEKA 4CQ1A 4P9SA 4V1Ak 3KLEA 2KZZA 2KM8B 1NJZA 5KG4A 4ZN3A 3BO4A 1YRTA 4IDKB 3OR2B 2PDAA 4DI6A 1Q86T 2MSSA 1NAQA 1DURA 2GZOA 1GXTA 2DGXA 4OYIA 5FD1A 1VQPS 1FESA 2FJAB 4K5SA 2MJNA 4J91A 4IDKA 4OYBA 1S9GB 3OW2R 3ISNC 2FHJA 1XBWA 3FEXB 2P9CA 3RJMB 3TAMA 2KG1A 2XSJB 2OFHX 2ZDOA 1VQOS 1NK6A 1Y5LB 2Y3YA 1HQ2A 1V5VA 1W7WA 2XEXA 2B5JB 4H4OB 1M5PC 4PWUA 4OYWA 3EICA 2OPPA 2QTWA 1RBAA 3LGNA 3EXCX 5KG0A 4C0BA 4LF5J 2C3UA 1J5OB 3DI6A 4C0HA 4TVAB 4C11A 3UE2A 4DSLA 2RU9A 2UXBJ 1RKJA 2OJ3A 1YGYA 3BEGB 4C0OC 2DBBA 4PEOA 1U6ZA 3HHLD 4M95A 2VPZB 1S1TB 3BPDA 3U1NA 1C4AA 1TK0A 2CRLA 3CIMA 2OI2A 4FYDA 4ID8A 3CO0P 3QWUA 4RBUA 4F26A 1REGX 3FVYA 3BGUA 1QAJA 1RAGB 1UW9A 4C8LA 5KFRA 2MLXA 1RT1A 4YB5A 4OJ3A 4ZLJA 4DN9A 4DV4J 1LW2B 3TOQA 1RI7A 3IG1A 2UV8G 4PG6A 3UR3C 5CCLA 2ZH7A 5HN0A 1RAFB 1RXOB 2M52A 2D9PA 4AYBD 4PXCA 2F9JA 1DBDA 2CUYA 3TVYA 1VIOA 3MMAB 1JNZB 3N79A 4MJKA 3AXKA 3OXFA 1JMTA 2V2KA 2QL9B 2MYFA 4TY8B 1UZDA 3ZZOA 2JVRA 5BR8F 2OPRB 5IWAF 2NSCA 3IWLA 4WKYA 4UUXA 5KFKA 4ED0A 3S7RA 4ZPWR 3ENVA 3HSZA 1KFSA 3M8YA 2MKJA 1SJ3P 2EPIA 1I3OB 2LU1A 5IOLA 1FX2A 1IR0A 1WI6A 5HBMB 4DV7J 3PVXA 2JC0A 1R0AB 4QYZK 1DTTB 4P7TA 4UOFA 4MIBA 3JYTB 1S1UB 2J9EA 3NEKA 2P9GA 2YH1A 2IYIA 4HT7A 2IA6A 2JEGA 2E1RA 5LSLA 2HHHF 2VQFF 2YPZA 3DU5A 4IFYA 1B0TA 3TEGA 5KFUA 4UZBA 4YP3A 2RDJA 3CE8A 1UCNA 2KRBA 3LF0A 1QUVA 4J37A 1TL3B 4X64J 2BJ9A 3QPIA 2HVEA 1FHTA 1EJ7L 1IWGA 3TUJC 1WEXA 1LWFB 2QSWA 5IXUA 2DKOB 1WUUA 2W8KA 3Q22A 2XQCA 1WKLA 4B02A 3M2RB 2CQCA 3MAAB 5KFEA 2KI2A 3RR8A 1MWYA 2BKOA 3H5XA 4LF6F 3AOCA 1PBAA 5D4PA 2NUHA 2RDIA 1CJKB 2AYEA 3OR1B 3C2PA 3T1YF 2G2ZA 2VHGA 1X4BA 4M5NA 4WE1B 5JXSA 3A13A 2E1MC 1PBUA 1CSJA 2BUNA 1WD6A 5KFPA 1ZPWX 2CJAA 4HH0A 2HYIB 5F8JA 2WCXA 2DPJA 3L3CA 1XWLA 2QN6B 1TV6B 2ZJRQ 1IBLJ 2UXCJ 2VDHA 1WC0A 3VAKA 3NNHA 3R2CJ 3TWZA 2DNRA 4K0KJ 2DRDA 3CC2S 3FK4A 1U1MA 1VRUB 4WWSA 4LR8A 4WZMA 3NRBA 1L3KA 4KTQA 3NGTA 2GVDA 1ROFA 2H1YA 1XC9A 4HH1A 4UY8T 5E7OB 3MR5A 2MSTA 1WG5A 2I8EA 3V5RA 4K4XA 4WK3A 4QW8A 4ZPDA 4EBEA 3PG9A 3DFEA 2AP6A 2ZBQA 4OHZA 3TVKA 3W9HA 4I67A 1Y10A 2QFIA 2X1BA 2ZE2A 2Z57B 1EKSA 3BGRB 1YRXA 2HZCA 3GP9A 5IS2A 1JLFA 3DOLB 4O3NA 1IKXB 3CIZA 4DCJB 1SH2A 3GFYA 2MXYA 4Q0BB 4Q44A 4NLTA 2JWNA 5K9FA 3WQPA 5M2UA 1QUPA 4Y6IA 1R6VA 4I6AA 3RU0A 3FSIA 3BSAA 2ZH8A 2QLXA 3VAGA 3UNGC 2BKPA 4KPCA 4JI8F 3B6BA 1HI8A 3JSBA 4LFAJ 3Q8YA 5HK4A 2OPSB 2NXJA 4DV0F 3HCXA 4L76A 4LRDA 1HR0J 3H8YA 3GYGA 2OTLS 1LW0B 2QA1A 4DR7J 4PG5A 1DQAA 2EFPA 5DGAA 1SJ4P 1NPPA 2O01C 3QGHA 4NASA 2IMWP 2HQCA 4ZS6A 4B3MJ 2R7OA 4LRBA 4CLKA 2BX6A 2HZAA 1OJ4A 1S6PA 2CPFA 2GQQA 2HGNA 2IHR1 4NCBA 1H38A 1VC0A 2RVJA 1F2HA 1U1OA 3UPFA 4J9MA 4O3OA 5DG8A 4CLFA 4RKUC 3VALA 1Q7LB 2VA3A 3PR4A 2EG1A 1N4LA 2ZEJA 1E6VB 4Y2IA 4Y2CA 2J9DE 3W65A 4N41A 3GQCA 2AGPA 4TYAA 3DMJB 4PXEA 4OIXA 2IVYA 3HZGA 2DR6A 2KTQA 2DGSA 4R25A 3PZPA 3AOAA 5E2QA 4O3QA 1B0PA 2WOMA 4X4QA 2XY5A 1QLNA 2ZM6J 3J81U 1NPRA 2PO4A 2IA0A 3IBWA 2CPXA 2CZVC 4RUCA 1HNZJ 3CWJA 4FBTA 1Y7PA 3KK1B 2IMOA 2WOMB 4YMEA 1KDNA 1TUGB 5A0YA 4DLGA 2R9LA 2V4JA 2F4FA 1N5TA 4USWA 5T7LB 2I5JB 1UTAA 1X0PA 3PV8A 1ZM9A 1SB6A 2C2EA 1JJ4A 4PG7A 5DDQC 5GAEI 3GG0A 1Q8BA 4IUFA 5L8RC 1ZH5A 4NPOA 1YZ6A 5JUMA 4W4MA 4ZVSB 3QJPA 2AIRB 2VFSA 5T7LA 8RUCA 1NBEB 3CJRA 3CJ0A 3BSNA 2UUBF 2I9SA 1TR0A 4NI2A 2GIQA 5L46A 1PO6A 3AH6A 5LMUF 4BDPA 4LRCA 3MCOA 3CCZA 5ETRA 2NYIA 2QSFA 1S9FA 1RT3B 1ZM4A 2DHAA 1NHVA 3NXZA 3QLHA 1CBKA 3QGGA 5RUBA 3QT7A 2FJXA 3HM9A 4J9NA 1N33J 3R6LB 3HD1A 4NI2B 2HWIA 2ZKTA 1R8CA 5FLXU 1V9OA 1ZA2B 2ZOMA 2XGQA 2RQ4A 4RU2A 1O0PA 1XR6A 4FNHA 2QT7A 4KV8B 4PCQA 5EUHA 3ZZZA 3M8PA 1I94F 2C22A 4RNFA 3K0JA 2R7VA 2PMWA 4U67Q 5B0EA 1TP7A 3AQPA 3GJRB 2IFXA 3MCSA 5KFTA 4FKXA 5D77A 2H3EB 1EP4B 3SSRA 3U1LA 3R6GB 3KHLA 3BM7A 2R2RA 4L74A 1N34J 4B3SJ 5GADU 1PSDA 1NK5A 1FRXA 1NSAA 4LSNA 1AXQA 5CHCB 3MEEA 1N6QA 1UP1A 4DPWA 1JIHA 4O0IA 2E5IA 4F50A 1SXLA 3D3CJ 2JDJA 4YHHJ 1FO1A 3QQCD 4X64F 2OEJA 2N7YA 1LEOA 2YBVA 4X2BA 2CQDA 2ZUGA 2A6OA 3TO8A 2QL7B 4USHA 1X5TA 1RWOB 3G4SS 1F60B 5KFJA 3VAIA 2OAUA 5I42A 2FLNA 2YKPA 1T11A 4U8YA 4DV3J 1N32J 5ETTA 4M1KA 5M2PA 3VHQA 1EARA 3ZO7A 2RQKA 1U4BA 1HYSA 3KDNA 3DMJA 4DWIA 1RTDB 1C1CB 2PSZA 5ETSA 5EX3A 3T1YJ 2UVWA 2DNGA 3M6UA 2RD5C 3M8ZA 4EGLA 3DYAA 4X66J 1FRKA 1SJQA 2VBYA 2IYGA 3K17A 4CO5A 2CAJA 2AZ3A 4RR5A 1IJEB 3BQ1A 2XNRA 4G65A 1JLBA 4PG4A 4KE5A 4DSEA 3HHNB 5D4NA 3MM7B 4BC7A 1HNZF 3DYAB 1NUEA 4LSLA 4U7UD 3AD9C 3SV3A 1WOOA 4GRSA 4J90A 3ZZPA 3EMTA 3G86A 1OO0B 1VS3A 2HNDA 3SQGB 1DAXA 3D0HE 2HURA 2ZUAA 2KT5A 3N6NA 3T1HF 1YITS 1M5KC 2H4WB 2P8IA 4MKBA 4K4WA 1U2FA 3MCNA 2B9XA 1IKWA 4PUOB 3JAMU 1PJ5A 5D15A 2LA6A 1CJVB 2WW4A 1FJCA 1MMDA 1X4HA 1LOUA 1HD0A 3J81Y 2YNHB 1ZPVA 2LLZA 3UWTA 4A8SA 1N48A 3D7SB 2G1HA 1C0TB 3MXHP 1NU4A 3MZIA 2CZ4A 5AXMA 4FF4A 4Y2AA 4KH0B 1T9VA 3OT9A 5F41A 5I4MA 5KFMA 4ECYA 4LFBJ 2J76E 5EWFA 1PKUA 1V3SA 4RL1A 3RW6A 3LP2A 3R7SB 4HI1A 2PN6A 4Q5VA 1CULB 3GJQB 1EETB 4FZVA 1HMVA 4HHUA 1NSQA 2YX7A 1MLAA 3MGJA 3QGIA 1VQMS 3JAMY 1S99A 2XY6A 2FHJD 1SCJB 2FY8A 4DMZA 1ZZNA 4N77A 3SIPB 2MGZB 3I55S 4DR1F 3PX0A 1HQUA 2O66A 1Q7YT 2B56A 4HDGA 4GKKF 1OSDA 5M2RA 3AJ2A 3W3SA 3QO9B 2W1BA 2DK2A 3ILIA 2HLTA 3PRVA 2QYCA 4DSIA 3RUBL 3AB4B 2RJZA 3K2YA 4L6V3 2MQMA 4P73A 1QVFR 3H25A 3DRYA 1C1BA 2E9TA 2UXDJ 4FYWB 2ZZTA 4PYAA 2DD8S 4TU8A 1QAYA 2GMHA 1UMJA 3QFWA 4PYDA 1ITPA 2EWHA 2RKIA 1CJUA 3VAJA 2Z2MA 4Y34A 3TNVA 1NJWA 4Q8FA 5J2QA 4MK7A 4RUAA 3OXLA 2HAFA 1NB2A 4NLYA 3VGSA 5AXLA 5HMWA 5KT2A 3MFIA 4X4VA 4DG1B 5IFMA 3PW5A 2VG6B 1HL6A 4USTA 2AGQA 2YWFA 2RSQA 4LT6A 4TYBA 1UVJA 3OVSA 5KFYA 1ZETA 4X4TA 2CQPA 1TKDA 2CADA 2CPJA 4WIIA 1TL7B 3DOKA 3OV7A 1Y9OA 3FCVA 1SPBP 1H74A 2IRUA 3OTOF 1XEZA 2E7WA 1IKVB 1TMJA 4NE9C 2J0QD 4DR4F 2BJDA 3FMWA 3CTRA 1KVIA 3G6XA 1AFIA 4P6QA 2DNNA 3CW2C 4LR9A 3BV8A 2IDEA 1RHRB 3R9LA 1SI9A 2GGPB 4Y2KA 4Z7CA 2IDLA 2BJ1A 2ZHAA 4FS1A 2MHNA 2XHCA 4URQU 5DG7A 1JLGA 1LV5A 2HQIA 5CYJA 4UOHA 2FJEB 4OI4A 5KFHA 3D0GE 1RT7A 1NMEB 1Y4ZB 4F4AA 5B0AA 1FRIA 1DTQB 3HZEA 4LBPA 5ETOA 1ZM2A 2LDIA 1C0TA 4C8NA 4QYZJ 4ZPAA 5GAGU 2BJ8A 4KGMA 4TKTA 4P52A 2R7TA 1UPMB 4DV4F 4CH0S 5A8KA 1H2UX 3DLGB 2PFDA 2XSJA 3EGZA 1TKZA 2M70A 2FY1A 2Q43A 2ADCA 2ILYA 1HIYA 2E1PA 4OHXA 3S01A 1SH0A 4BCAA 2M3DA 3UDLA 4DL0C 3Q8SB 3R5GA 4DL3A 3CJTA 3QAEA 2J6UA 2R8GA 3H42A 4DX5A 3Q83A 4J9PA 4ED1A 2IVMA 4OHWA 2BRKA 3DI6B 3IBFB 1F9EB 3PACA 9RUBA 1L3SA 4DV6J 3DRPB 5AT1B 3ULHA 2X1FA 1RTIB 4JV5J 1FFWB 1S9GA 3PW4A 4GKKJ 2FC8A 3VAFA 3AD7C 4CLLA 5A8WA 2L08A 3MD3A 3MTKA 4QWCA 1LWEB 3HVWA 1CEZA 3BH7B 2ZBPA 4P2FA 4A8XA 1ZBTA 5I3PA 1NB7A 3TEHB 3HULA 1T02A 3DGVA 3VR1A 3TJAA 5C42B 5HO4A 4F4KA 4KJIA 4ECWA 3TA0A 4CLYA 1FNMA 2LXFA 2Q3PA 1QTNB 5LL6d 2XLIA 4ERDA 3M4XA 1NO8A 3GCWP 1T05B 2FUG9 4WXOA 5SZTA 3V6KA 4OZ5A 4B17A 4JI1F 3SFUA 1CC8A 3OBIA 3OFEA 1N5YB 1URRA 5KT3A 1FJEB 3I0SB 3IS9B 2MQPA 2KJWA 4HACB 3IWXA 2Y1IA 4X66F 4XDCA 1Y5NB 2PT0A 4LBIA 3W62A 3H5YA 2CNLB 5ETLA 4NEYA 3EPIA 1T05A 1VR6A 3QFHA 3NG8A 2GCFA 4NMXA 1F2GA 3R1LA 2VL1A 4ZHRB 1R0AA 2HNZB 3FDSA 2Y9HA 3JYTA 2PMHA 2RB7A 3TZXA 1VQLS 3QZ8A 2JFDA 3E51A 3LANA 1NZ8A 3DDKA 4WBFA 5HI7A 4USMA 4F4XA 4DS4A 2M9KA 1AFJA 5E3RA 2K3KA 3QT5A 1FF2A 1IKVA 4IH6A 2H5IB 4CT9A 3Q8QB 4BBYA 1S79A 4DU8A 4YY3J 1JLQB 3L95X 1T3OA 3GMGA 4P72A 5DDPC 4K2XA 4KT0C 5HBMA 1FDBA 1K1SA 3O6QA 5B0FA 5C24A 4WP8A 3S6EA 2X51A 4JI0J 2VH7A 4D3HA 3T1AA 1XIQA 2QA2A 4U8VA 4RWXA 2DVIA 3PEJA 1U2CA 1FE4A 1S6QA 1S77D 2KVQE 1F6TA 3FRZA 3PO4A 2L3MA 3KLHA 2V67A 3BO2A 4Q8EA 1FKPA 3KJQB 1UVIA 3QIDA 4IG0B 3R97A 5KFLA 1UVNA 1UKUA 3TQ1A 4KIAA 2BDPA 1HWUA 2RF2B 3DRSB 1FK9B 1W2IA 4AT1B 2VJUA 2FLPA 1JLEA 4UQGA 4L3KA 4YDXA 3VZHA 1S0VA 1O5JA 1HLWA 4QWDA 2G4BA 2ZBCA 3ZNUA 3QZ7A 1KONA 4HL9A 3H2UB 1I1GA 1NK4A 1VRUA 3CD7A 4RLEA 3TAMB 1EQMA 4OFZA 3LPYA 1GMWA 4WE1A 4ZP7A 2YX1A 4DV7F 1RT6B 1RADB 1WHVA 2XZDB 2J0XA 3IM8A 3CMQA 3M2VA 4EBCA 1T3NA 3IFEA 3UD3P 3HKZD 1FJ7A 4CP5A 2EVZA 5DZ6A 1WF1A 2CNKB 2RH3A 4PXDA 4K4YA 3DLHA 4LRAA 4WTYA 1WEZA 5L1IA 3BGRA 5F8HA 2I1RA 2RDDA 3IXQA 1T03B 3ENQA 3KLFA 3RGIA 5HVFA 4F0HA 4NLRA 5L38A 5LSRA 5LM7E 4PQUB 4X4UA 5KG5A 2RNEA 2F40A 4ILRA 4FF2A 3KMQA 1LNQA 4F02A 4ICLB 4J9SA 4EFAC 1JXLA 2B0GA 3RG6A 5HL7Q 4OZLA 2JC1A 4OZ3A 1KNZA 2AJ0A 4N8NA 1VJQA 2J0WA 4LF2A 2ZM6F 2IM1A 2ZH9A 1MROB 5J1EA 3FFIA 1NKBA 4MTPA 4DF8A 2XSFA 4OX8A 2GHVC 2COLA 4Y0FA 1HW9A 1S6PB 3OTEA 3I87A 1CG2A 1MMNA 1Y00A 1R8PA 3KYLA 2KZMA 1S9EA 1U8WA 2CKWA 2VFRA 1U7LA 2VKRA 4MFBA 3DLKB 1HNVB 1TL1A 3T9NA 1N88A 2MLZA 4KO0B 5KFXA 5KG6A 1X9WA 1BQNA 1RTHA 3H4BA 1HHTP 2XO7A 2HPUA 4NLUA 4XO0A 4YQWA 3MPWA 3MUMP 2W7OA 3QJJA 4UUWA 1TVRA 1HNIB 1S6UA 2ZOGA 3BH6B 3AOBA 1GFWB 4N7TA 3RBZA 3TZWA 3L4BC 2CQBA 3U7JA 4CM0A 4NX9A 4UQTA 1H3DA 1VJWA 4DSFA 3MR6A 4RO0A 3KDOA 2B8QA 1VISA 4WP9A 2EFVA 1S12A 2GX8A 4Q2MA 1H7XA 1RHJB 1RT4B 1BLUA 4I2PA 3PJXA 4ES3A 3A3PB 2DNYA 1KQFB 2JEJA 5MLCV 1BWVA 2DRBA 2N4CA 4K5RA 4ILMA 3HMJG 2VFVA 1H72C 3OR1A 4QR1A 5DM6Q 4HYKA 2WK4A 3ET6A 2UVUA 5K20B 4DPTA 4IQXA 4JI3F 4YR0A 1M5HA 1GMWD 4PRFA 3ZZRA 4QW9A 1JB0C 4JV5F 2MDAA 3UI3A 4ID5A 1D09B 5HROA 3EPGA 5F8IA 2LQ8A 1KSPA 5D8HB 3ET6B 2KHCA 2CZ9A 2XBPA 5KFOA 3HPOA 4JYAJ 2J8AA 2DCLA 5CZXA 4QYRA 4Y28C 1X4GA 4JI7F 3TZYA 3OUYA 4ECVA 1U02A 1HPZB 7FD1A 4R8UA 2VBXA 4UW2A 3J7A1 3W1YC 5EN1A 1CS4B 3PKMA 2YVSA 1BGXT 4C3KA 3RAXA 1NCLA 2V34A 1T03A 1KTQA 1I5OB 2VFTA 1N54B 1RT5B 2C1EB 4HI2A 5D6GA 5H9EJ 1APSA 2ZE2B 1HWKA 3BO3A 4QIWD 1FA0A 1RAAB 4ALZA 4XPEA 4XIUA 3Q23A 1TKTB 1SBRA 4ZLLA 4CM2A 4Q0BA 2XWYA 5HP1B 1IXKA 1H6KX 1UEUA 3BDEA 5DQIA 2MQNA 5BYRA 1H7WA 2RT3A 2BXJA 2W24A 4USJC 1ZM3A 1T95A 2MZQA 4C7QA 2C2RA 3OVAA 4WXWA 3I5BA 2ZZMA 2YWGA 4MK8A 3ENWA 5J2NB 5KG3A 1HBNA 2PGCA 3MF5A 3RB4A 3M30B 2VQEJ 2Q6CA 3I6PA 2E1CA 3EGVA 3I31A 2W9BB 2ZD1A 4R0EA 1WKJA 1IBMJ 2DNPA 1IR1A 4CZCA 4F67A 1RQ0A 4CDIA 1EAYC 4U95A 2IY5B 1PYOB 2CDQA 2DRAA 4GKJF 4JOUA 3NGUA 3NGDA 1NDCA 4HVZA 5AXNA 3IA0A 1C1CA 3H40A 4ZN1A 3G8SA 2HBRB 3NS6A 3UVJA 3DCAA 3W5YA 4J9LA 2VG5B 1NHUA 3GFHA 1RWWB 4YN3B 3CJKA 3VVUA 4UY85 5C2CA 2F8MA 4WU2A 1QE1B 5HVHA 2J6SA 1RA6A 3GIRA 2YQ0A 3D1QA 3K5OA 3OD2A 2ZH4A 2FZKB 4KHPJ 2E7XA 2LMIA 4ZVGA 5H9FJ 2HBZB 1E6YB 2APOA 4O3RA 2LU2A 5HMZA 3DDNA 3M6XA 2E9ZA 2VC1A 4ZP6A 5BR8J 4ED2A 2F1FA 2DITA 1ZAXA 4Q43A 2OH2A 3QGPA 3TJ8A 4YB6A 3R5AA 4F4ZA 4Z2XA 1KD1T 4OZ0A 1C2PA 2V4JB 5DZ7A 1XJWB 5ETVA 4YHHF 1Q81T 1IVZA 2GJFA 2VPXB 4LR7A 3SCJE 4DQQA 1K73T 1X60A 2L9NA 4DN0A 3F0NA 1U8SA 1WEYA 3HHLB 3J80Y 4AD6A 3BF4A 3OUYB 3TA2A 4ZVUB 2Y1JA 1FDNA 5HVGA 2QV6A 3M8QA 3KLIB 2J7WA 3N9UC 2LVWA 2B8PA 4LSZB 3UDVA 2PEBA 1FXLA 3TX8A 3MOJB 4P7VA 5G4DA 5DG9A 3MMJA 3KHGA 1DLOB 4RUHA 2QC3A 2G13A 4CO4A 1AROP 1EETA 4XTTA 3R3TA 1RB0A 1HWLA 5KFAA 1R8HA 3T6BA 3G6VA 3DLEA 5FJ4A 1GX6A 3GYNA 4KV8A 5F8LA 4FF1A 1WSVA 1WF0A 2HAIA 4QIVA 3CT9A 1HBUB 2V94A 4TN2A 4ETXA 1YJ9S 1S1WB 1FWPA 1VLYA 2HFOA 3K57A 5CZVA 4A48A 3QAUA 4KPYA 4DR6F 3L9ZA 4KYZA 1CJTA 3LAMA 4X65F 4DQIA 2CQGA 3I32A 5KOXA 1ICEB 4DV1F 1T7PA 2N3OA 4DUYF 2IRXA 2C3PA 1PG5B 3LUYA 3PM9A 3CDBA 4YR3A 1YDLA 4F36A 3M30A 2OMLA 3IN5A 2DYAA 3AQOA 2KFNA 4QU7A 2FHOB 3ZFVA 5I3UB 1U0HB 3RAMA 1X4CA 3G71S 2FJBB 2A2DA 2CQIA 4NZ6A 3GV7B 2AF6A 2B43A 4HHJA 4CLSA 3IMQJ 5CYMB 3CDWA 1B4SA 2D7SA 4U7UK 4F3MA 4URGA 2FJVA 1OPIA 2QMXA 3UVJB 3B78A 4I2QA 4EO6A 5B09A 3HVTB 3M9NB 4ECQA 2OKQA 1Q82T 1VQNS 1OQ3A 4R5PB 4ZP9A 1IN0A 1S7HA 3MOZA 1N0VC 1KFDA 2DGUA 4JP8A 5DS7A 1LXNA 2QLBB 3L09A 5H1SV 4DFPA 4FPRA 6AT1B 1WTBA 4JI3J 4OX9F 3DGPB 2XCAA 4I64A 3QNWB 2NXNA 2HHPA 3O1LA 4F4YA 3VQTA 1JLAA 1RZMA 3MR3A 4FP9A 5BXIA 4DR1J 1P1LA 2XYPB 2C28A 3JTPA 2Y0BB 2PEHA 3QIPA 3IAM9 4A8WA 2GGPA 2C3MA 2WVCA 3V6HA 1EIYB 4DR7F 4LSLB 1BWEA 4M5DB 4JI7J 5DQHA 2VIHA 3HK2A 2MPUA 1VCTA 2KL8A 2ZDPA 3PRBA 3ZZUA 2FQQB 3DOKB 2HNDB 3MUTP 1X9SA 4GMKA 2MQQA 3CDAA 1REVA 4RW9B 1U47A 1JKHA 1NK9A 5AE1A 1U0SA 4YDDB 2CJKA 4ETZA 2FHKA 1L5UA 1OMSA 5J2MB 3JQJA 3DLGA 5A2QY 5AE2A 1UEVA 1X31C 3BR9A 3GV5B 4TY9A 4DR5J 4ILLA 4NXNF 1N56A 1R8BA 2V6AA 3SDEB 5A76A 3JQMA 3OTCA 1RCXB 3IM9A 4PZVA 2W7AA 5D78A 2W7PA 3T5KA 1DLOA 2Y1LB 4E2FB 5J2PA 3GJTB 4RU9A 3GONA 4OX6A 3NOCA 3KG1A 2HLUA 1DQ9A 3MMCA 2OELA 1IBCB 3AT1B 3JSYA 3LP0A 3KLVA 3V81A 3OR2A 1BD6A 3J80U 2O5DA 3NAHA 1PYTA 2DNLA 4ZCMA 2WHOA 4WZQA 4EMDA 4DQSA 4U96A 4EI2A 1B99A 2QE5A 4J9UE 1IR2A 3QSYB 1D8YA 2NS1B 3MMCB 2ILZA 1VRTA 2YNFA 1RWUA 2WB4A 1D8ZA 2YKNB 1BMQB 1O8BA 3M9MB 1GK8A 1LFWA 3MAHA 1GTEA 4MKVA 4GC7A 1X4FA 2KDOA 5U47A 2CPYA 3BBCA 2JLGA 2ALZA 4K4VA 3LGHA 2WW8A 1F9HA 3UDEA 1BQMB 2V8VA 3D3BJ 3CJ4A 3MPUB 4PKDB 3HP6A 3MM9A 5D0GA 4DF4A 2R8JA 4YY3F 2OPPB 1U45A 1DQ8A 4OLOA 1OWXA 3I0SA 1LWEA 1FXDA 8AT1B 1C1BB 3D66A 4C11B 4RBTA 2IJRA 4DX6A 4H4MB 2C2MB 1RJJA 3MM9B 4RWWA 4J9QA 1FKAF 3SEOA 4DQRA 1FEHA 1M1GA 1OYEA 1FD8A 2D9OA 3FCWA 3L7OA 4P10A 2ZITA 4WIQA 1FRHA 4F7VA 5JVGQ 1NZAA 1EKRA 1ZS6A 2AU0A 4H4MA 3J7YI 1HWJA 3LP1B 1MSWD 2JZ5A 1Q78A 3IS9A 4IFVB 1G4CA 2W2PP 3RR7A 1JXEA 4RW8A 3IWNC 1TFYA 1ZA1B 2XMVA 1XMQF 4NXMF 3JS9A 4K59A 2FLLA 1GAOA 4LF9J 1YJTA 2FJDB 1WACA 2BBEA 3MM8A 5C24B 4IFVA 5C7PA 2N82B 4OZNA 5KFNA 1SC4B 2J5AA 2C2NA 3BR8A 1S10A 4LF8J 3GPAA 2BEFA 1VK3A 2VJVA 1BHNA 2KXFA 2YWKA 1Q1KA 1K0VA 3KK3B 3V4MA 1RT2B 2R8IA 3KK2A 1HHSA 1FNOA 4FXVA 2EC2A 1S1UA 2H5EA 3HX9A 3Q8RB 5ITHA 3KJVA 1V3ZA 1N5VA 3JTOA 3V4IB 3TARA 1JLGB 1FK9A 2GA7A 4JI1J 2O1PA 3D1HA 1R89A 2DEJA 3C46A 3CJ3A 4P2MA 5J1PA 2HIQA 3V4IA 1FE0A 2ASYA 3MMAA 2PIIA 4OLPA 5L9NA 2YTCA 4DJBA 4B3TF 4ECUA 3FZ2A 1AW0A 3M8SA 3RZAA 2D1CA 5CH7B 4QWAA 3V81B 2RF2A 4OZJA 4I1TA 2AEFA 3RW7A 3PJ9A 5B7WA 2UUWA 3TW0A 4IH7A 4HT5A 4CNYA 1JLEB 3K5MA 1U1PA 1NRKA 4DV1J 2FVPA 1DTTA 1QY7A 1X8DA 3Q2TC 2F4VJ 2A1BA 1SUQA 2RS2A 2BA9A 2ZHBA 3CSKA 2XMJA 4M5LA 5IT9Y 2X3GA 4ZJLA 3P5TL 3M8WA 3W66A 2KJVA 2OD4A 3MM5A 1S7IA 2UUBJ 5A8WB 4JI0F 1ZAWA 1UZHA 2W2MP 2YH0A 1SUQB 1F5AA 4WK1A 3G2XA 1S59A 4DR3J 1J5OA 4HKQA 1XNQF 1NSPA 2DIVA 2BMBA 2C3OA 3GR0A 3ITHA 3LOUA 1KQSR 3GR1A 5HAOA 3R1HA 6FDRA 1N33F 2UZAA 1X4DA 2PC6A 4USUA 4NEZA 4ZVOB 1SKSA 3N6LA 4ZK7M 4HLBA 1MROA 1F5CA 2DGWA 2GW8A 4LRFA 5J1EB 1IWAA 2AEMA 2VB6A 2FGCA 1UL3A 4G1IA 1GXUA 1NLKL 4HACA 3PHTA 2R7RA 1N34F 2V69A 1LWCB 3DOLA 4GVBA 1QSLA 2GNKA 2GMJA 1WORA 4B9VA 1HA1A 2K1RB 3LP1A 3BBFA 4FYVB 1RAHB 3HSDA 5K8PA 1RWNB 3D54A 1YBUA 3DLKA 3NY0A 2KH9A 3THVA 5IWAJ 1H0HB 1RDRA 2R42A 1K47A 2UUTA 5HJYA 1P9QC 3FFIB 5BJRA 2KU7A 1GTHA 5ETPA 5AJ3F 3L7PA 2CQ2A 1KTVA 2VF3A 1GEHA 1AYEA 1T9XA 2WVEA 1PJ7A 2XG8A 5DJBA 4CYUB 4DU7A 2W8LA 1PAEX 2JEFA 5D0HA 1WHXA 4RW4B 1X5OA 3TUIC 3RTVA 4O3SA 3Q86A 1S48A 1KLNA 1D9AA 3DOMA 3CCLS 1U1LA 2AZ1A 3VQSA 4CYUA 3OFFA 4RW6A 6FD1A 4DHVA 4XDDA 1OY9A 4ZCLA 3MURP 2F65A 4NLVA 4TNOA 3HSGA 3NCPA 3AY0A 4K8RA 4JV0A 3GFZA 3WHIA 1LWFA 5CD4A 1FRLA 2EFNA 5KFVA 2HSEB 5CAAA 5KOWA 3OSPA 1CVJA 3MUVP 1FKPB 2BE2A 3QT8A 3OFHA 4P75A 5K5MA 2LEBA 4IG3B 1FWLA 4BWMA 3GIKA 2X7IA 2GQ2A 2D74B 5E3CA 2KB2A 3I9V9 3T19A 4PG8A 5HROB 2YQ3A 3N28A 4ECSA 2NQPA 2OTJS 1RBLA 3GIIA 2ZOFA 2Q6BA 2FVRA 3ILJA 2VFUA 1JX4A 3KOAA 1D1UA 1WDTA 4WYLA 4GC6A 4I0WA 4M63A 2EW9A 4DX8H 1WF2A 3CCRS 5LMNJ 2LQ9A 4I68A 2VOOA 2ACMA 3EVMA 3Q2SC 1U1KA 1RT6A 3OTOJ 2E9RX 3DXBA 2FB0A 1F9FA 4KC5A 1NK0A 1RUSA 2KFZA 4ID5B 2KHDA 3A8JA 1E6VA 2VG7A 2K2PA 3P96A 1HBOB 3W8PA 5EGYA 3CCUS 4DCOB 3UCGA 1QD1A 2WBMA 3OXGA 5E3QA 1SJFA 3TP2A 4QR2A 2MQLA 3VTIA 2XMTA 4OYAA 3J7AN 2IAJA 4PWDA 1MU2B 4DDFA 2E5GA 1QSYA 4LFBF 3EGWB 4C8ZA 4DR2J
chains in the Genus database with same CATH topology
1SQEA 2YKMA 5GMKa 5EWEA 4YB7A 2B6AB 4CCHA 4C8MA 1VBZA 3AJ1A 4N56A 3G8TA 2HMIA 3MI7X 2HHWA 4X4NA 2OP5A 1AUDA 4YB1P 3OL6A 3THPA 5DQGA 3M8PB 2HHSA 2PI5A 2M8DB 2ZD1B 2H9ZA 2W25A 3UW1A 2M4MA 4NCGA 4WFAQ 2CG4A 4ECZA 2OLWA 3OL7A 2VV5A 2HGLA 1XTZA 3DLLQ 2YNGB 1UW4A 1WHWA 4O44A 4EBDA 1S9EB 4LVNP 4M8LA 4ZP8A 4I69A 2FVQA 1OS5A 3C6TA 2JLEA 4IKAA 4F3OA 4QWBA 1A6LA 3E2EA 3QMQA 2CVEA 3PDNA 4D3GA 3QLHB 4W92B 1TVRB 2HS0A 2ZVSA 2B4OA 3NS5A 4NYPA 1DRZA 4K4SA 3DNCA 4TLRA 1FRJA 2ZH1A 3BSCA 3HVAA 4RW6B 3A1YG 3PKYA 3AA8A 2VASA 4U9RA 1G6BA 4EO8A 3ZZ0A 4AUKA 1UVKA 2RS8A 3W7BA 3CMAS 2BE2B 5EHHA 2HHTA 2DHSA 2KVIA 2FHMA 1IQZA 3HF5A 4A8MP 3CD0A 4RNOA 3C3LA 3FZBA 1GH8A 1LK7A 3H20A 2D3UA 1VBYA 2VQEF 4EZ9A 2XWXA 5A0YB 1X9MA 2JSXA 1R6YA 3M8QB 5LMNF 4KHPF 1LXJA 1TL5A 2RMLA 3OL9A 3E8OA 1Q16B 2NZ4A 5I42B 1N52B 3MD1A 5FIIA 3WZ0A 4R8UB 3GV8B 3DC2A 5JJBA 1VQ9S 3M1VA 1P6TA 4KAIA 3KLIA 2B7BB 1FDAA 4U7CA 3EZ5A 3DLJA 2LXIA 2KRRA 4LUBA 4RZRA 4YR2A 4LF4F 3NCRA 4O4GA 3TAPA 2GC8A 4OI3A 1JLBB 3NGKA 4LFAF 1JK9B 3GB0A 5HP1A 1TQLA 5C25A 5T14A 3MM6A 4KR0B 4E8UA 2HHQA 2PA8D 2I38A 4B3SF 4O4GB 1U48A 3H59A 3SQGA 2DR8A 4BWJA 2YKOA 2OMOA 2BRLA 2UP1A 3E01A 2GV1A 5GAHI 3SZ2A 3EUNA 5J2NA 1N6QB 1FERA 3F56A 2BV3A 3ONQA 3PX4A 4JV2A 4ELVA 4XK8C 4HDHA 4NOHA 2W9BA 1XK8A 2QEXS 4WFNQ 5KTQA 1G2EA 2FPHX 2LQJA 2WSEC 3HLUA 2M2BA 4NA3A 4ECXA 2HVHA 3SXLA 2AYMA 5K8MA 3KNAA 4N76A 4QIGA 3VF0B 2LECA 3UDCA 1U26A 1TZ0A 1X4AA 2DGOA 4IRCA 2BR0A 1RP5A 2OIHA 4V19X 2BACA 5L39A 2UU9F 2EC0A 1C0UB 1WWHA 2CYYA 3POTB 4I2QB 2VD3A 5IZHA 3K5NA 2AQ4A 1FEEA 4WFYA 1UWBA 1HQUB 2DNKA 2IBOA 3POTA 3JB9k 1VIXA 3R5DA 5KFZA 2DNQA 2E5HA 4E98A 1UWBB 5E0OA 3UQSA 3MEGB 3CCQS 1DJ0A 2LXUA 2XMKA 4IOBA 3CC7S 2D41A 4NLPA 4NZ0A 4QIEA 1U24A 3H2VE 3BQ0A 2OD6A 4Q45A 2VPWB 4NLQA 2XLJA 3DM2A 2XNQA 3P6YC 2ROGA 1BQXA 4PQAA 4OHVA 1JNRB 3G9CA 3SFGA 1G1XA 1X4EA 4EYIB 2MMYA 1UVMA 2R8KA 2P9EA 1N5SA 3CCVS 3SCKE 2PD1A 2VG6A 5L1KA 4OI1A 3RRHA 2UUCF 2J7KA 2V8HA 1RT7B 1QM9A 1Q79A 2EFQA 4OI0A 3LO3A 1Z4UA 2LCWA 3LP2B 3D5MA 2B7CB 4OV1A 3FSYA 3OSNA 4UOCA 4WKRA 5IQ6A 4B9SA 1VMBA 3RYLA 1FJGF 3PO5A 4ZPCA 2NXUA 3RRKA 5C25B 4K4ZA 2EBEA 2CPEA 2HS4A 3TYTA 4AL6A 4URSA 3CC4S 4E0DA 3M8RA 4ED7A 2HNYA 2K8GA 4CO3A 4LF8F 1S1XA 3DHXA 4QWEA 1UA1A 3IR6B 3I0RA 3LAKA 1UAWA 2RU3A 4NMLA 1WI8A 4I6WA 5LXYA 3C66A 2OO4A 2POKA 5KG2A 3I0RB 3F73A 4K4TA 2BVZA 4KFBA 5C42A 3WC2A 3LGMA 2RKIB 2VA2A 2WONB 3O3LA 1VQSA 3ZC4A 2KFYA 1FVSA 4V19J 4X4OA 2EKYA 3PW0A 3FJ2A 1YG0A 2AYBA 2MY8A 5CYQA 1FNXH 3MEKA 4WFBQ 1YJUA 2I2YA 2J0SD 2F7VA 4RNNA 4Q2LA 1SKRA 4B9UA 2MZ1A 1FTRA 1Q8IA 3CCSS 1S97A 4KHMA 4QQBA 1XERA 1JJHA 5KT5A 2KM8C 3MMBB 3Q0AA 4JI5F 4DR4F 3MECB 1KOOA 2V4QA 4MIAA 4A8KA 1YJWS 2AGOA 2BW2A 4YEAA 2AX1A 3MMBA 3MEGA 2Q79A 3PNIA 1IBMF 3CDEA 2B4UA 4ZPVR 1HQEA 1N36F 1L3TA 1YVFA 1PC5A 2JHEA 3GG1A 2DO0A 3S1TA 3GZ7A 4F3QA 2J6TA 1N5YA 3JSMB 3TR5A 2DR7A 3RRGA 1RT2A 2V8GA 1HARA 3THTA 5KFBA 5L1LA 5GAGI 2ZJPQ 2DNMA 1S6QB 2XMMA 4CH7A 3H4DA 2MKHA 1ELOA 5A6PA 4DSKA 4IG0A 4LF7F 2XI3A 2MZTA 2DB1A 4MIWA 3PR5B 4DS5A 4A8FA 4LVOP 4PXBA 1S72S 4JYAF 3HI9A 2NPIA 1Y0HA 2DIUA 4WZQA 3RB6A 3W2WB 2YNIB 3DRPA 4KSEB 4DSJA 4IRDA 3PY8A 5F9NA 2FD2A 4IH5A 1PILA 1GNKA 1T94A 1KQKA 4PPZA 1TL3A 3W2WA 3KNGA 2HHXA 4QCLA 2DPIA 3KLHB 3MM5B 4DEZA 3G8QA 3EXYA 3AB2B 3PW2A 2M88A 1NJYA 2VUGA 4OMFG 4IRKA 4NLWA 2ROEA 3ITHB 1S1VA 4R0JA 5GAEU 1LW2A 2I0XA 3IRWP 4DV5F 3WC0A 5KFFA 1DHMA 3DRRA 3DU6A 3CCTA 4Y2IA 2B5JA 4H4OA 2AJ4A 3H5UA 2RIJA 4FS2A 4QIFA 3CEDA 4TY8A 2P6SA 3BZQA 1Q8LA 3MR2A 1Q53A 1QJHA 1U6BA 4RW8B 3IAS9 4A47A 3O5TB 2QMWA 2IM3A 2EI5A 2BANB 2QFJA 5G0RA 2CPHA 2GO9A 5MAOA 3OLAA 3NL0A 2F3JA 2LEPA 2IRYA 3D28A 4OZ1A 3CCMS 3K8WA 3FEZA 4Y00A 4MFBB 4KGKA 1YJNS 2QZ8A 4L72B 4QPXA 3KK2B 5EDWA 2JX2A 1S0MA 5FDLB 1JLFB 5GADI 4RNMA 2R7XA 4RW4A 3DLBA 1IM4A 1HI1A 3SI8A 2X1AA 4DL7A 3BS9A 2GHWA 1P8GA 1UJ6A 3T9ZA 1LFPA 5FDLA 4C98A 1U1NA 1F0XA 4K4UA 5IT4A 1HR0F 1XMOF 3HHDA 3KTQA 1V3RA 3OPKA 2IJNA 3W2VA 3N5FA 2W4PA 3PEHA 3VZIA 2NPFA 3HHKA 4ZLPA 1R43A 1TL1B 5LXRA 3BQ2A 5BYSA 3I4HX 2QO3A 4EZ6A 2XULA 4OI6A 1NKEA 4X4SA 1FDDA 3RB0A 1YJRA 1KQGB 2Z2LA 5HMXA 4IO1A 2BQ3A 1YI2S 3NMAA 2QRRA 2NUUG 4B9LA 3VAMA 4FVMA 2J9CA 1U49A 4GO5X 5GVQA 4ZMMA 1XMBA 3SYZA 1HPZA 1ULRA 1U09A 2AV5A 2KN4A 3F41A 4IR9A 1HBOA 5B0GA 5HLFB 1D3WA 1S49A 1YBAA 2BYCA 3VWSA 4AFFA 2FIUA 2R4FA 4F2RA 3BREA 2ZFHA 2DH9A 3IR5B 1OIAA 3E3XA 3M6WA 1YTYA 2K7KA 4USIA 1B0VA 3DRRB 2W9CA 2P5VA 4J9KA 3PW7A 4O44B 1VBXA 2ZHOA 2K1RA 1GQEA 5A8RB 1PGZA 3I5AA 2AWZA 3HT3A 2IJFA 1QAIA 4WU3A 2HQ3A 4LMZA 4IYQA 3O44A 4AQYF 2UUAF 2KXNB 4LF5F 3PFOA 5K14A 2DNZA 4DV2F 2BJEA 1SKWA 4KO0A 1R8AA 1YJVA 5DDRC 2KYXA 5D3GB 3AA9A 3C6TB 5KFIA 3CUNA 4CTAA 3U27A 4KHRA 5DRKA 5K8NA 3I9ZA 1KHVA 2MHEA 5FLXY 1FD2A 4H4KA 4FXDA 1M5SA 1FT8A 2KG0A 2WSCC 3SCIE 1KD1T 2MZRA 5E33A 2ZNYA 2BABA 5D4OA 4ZVEA 5F8GA 1EP4A 2XI2A 3T5HA 2ERRA 2GMLA 1JWWA 4CI0B 4RNHA 3BDPA 4ZVHA 2GHPA 3FCHA 4ZA1A 2JEIA 4I4BA 1S0OA 3OTDA 4BC9A 1HBNB 4EU0A 5SUHA 3D1OA 4QU6A 5CXTA 2EBGA 3X1LB 1H98A 1N0UA 1C4CA 5KFSA 4C97A 4WJBA 1SIWB 2Z0GA 4MK9A 2DR9A 3M2UA 3J7Z5 4IQMA 1JJ2R 1KC8T 2OPQA 5K8OA 5DLFA 2YWHA 2ADBA 4Y2MA 2WB1D 4IOAQ 2XMUA 4NLSA 2RE1A 3OFGA 3OQ2A 3G6YA 3N0VA 2BQUA 3TAQA 3OTBA 2AYGA 2VG7B 2CJBA 4QJVA 4EWTA 1DZ5A 2UVVA 5DETA 3PXGa 1HNXF 3VAHA 1F5BA 3IRXA 4WYWA 1BC6A 2EFGA 3BGFA 4MKAA 5E3AA 1ZYQA 3RBDA 1FXRA 2ZH5A 4DL6A 4PR6A 5KAKA 3KK1A 1VGYA 4DFKA 2G1DA 5A6WA 3LWMA 4NRUA 1KOHA 1SV5A 2KT2A 2SXLA 3SCLE 2HMIB 3MM7A 4KKOB 3T3FA 1S76D 4LJMA 3OL8A 2FLOA 2OSRA 2V9KA 1B7FA 5E41A 3PIOQ 1G7CB 2W9CB 4C4WA 1VQ8S 4WFZA 1M0SA 2K3IA 3NWGA 1JLCA 2W4CA 2HVZA 1CC7A 3MM6B 3CB4A 3M05A 4QZVB 1IKWB 2E44A 5THWA 2CPIA 3KLGA 3OHBA 4YFUA 3LH2S 4H54A 1ZAVA 1TL4A 3K7RA 3OHAA 2HWTA 4F4WA 1GT8A 1CLFA 3SMZA 1SJ1A 1U1QA 2JJ4D 1RTJB 4RW7B 4XAKA 3MAQA 1RA7A 3C6UB 3C8YA 1HBUA 2HFNA 4OJHA 1V6HA 1NH7A 3UCZP 3LWLA 1FRMA 3R5CA 2PMZD 2FVCA 4JI2F 2N7CA 2MGZA 3NAIA 2RQCA 2RS2A 2AJQA 4WF9Q 1HWIA 3B4MA 1C0UA 4KB7A 3DGPA 2ZJQQ 2VODA 1Z2LA 4CIOA 4AL5A 3CVKA 1JLAB 4TU7A 2ACYA 2LQ5A 2MZJA 3Q8PB 1H2VZ 3DM2B 4QOTA 3BSOA 3BGLA 4N8OA 3GWCA 1YIJS 1YQHA 2UXDF 2E66A 4A46A 3HHLA 3K59A 3BN7A 5CYMA 2LKZA 1CQNA 2LQBA 4MMOA 2A3JA 3V6DA 4FNIA 2CQ4A 3G6ES 3FGVA 3ICLA 4X4PA 4CH1A 2DR5A 2B4PA 1HNWF 1D0EA 3S8SA 1UFWA 2XCPA 1IJFB 2WTFA 3O2IA 1M1KT 3QIPB 3GIMA 1KLMB 1GXLA 1UA0A 2AW0A 4GO7X 4ELTA 1IBLF 3CDUA 2X1GA 5DM7Q 4F2SA 2JRSA 1CQMA 2J9DA 3DHWC 2ZNZA 2XGPA 3SV4A 4PUOA 1U25A 4ZOSA 1KS2A 4ES2A 1M5OC 2JVOA 4ED5A 4JBCA 2CQ3A 2E1AA 4MYUA 3E01B 1VRTB 1IUJA 3N4WA 2ASLA 3HFKA 1VC6A 2EK6A 1YHQS 4Z37A 4KFBB 3KLGB 5J2MA 3B82A 3QWPA 4NZ7A 1H2TZ 3KLEB 1DTQA 1UJ4A 1S1XB 2KO1A 4ILMA 2IVFB 2O67A 3SSQA 3MEDB 5DGBA 1NNDA 1OPZA 4B9NA 3CCJS 4ZPBA 5B08A 5J2PB 4C8YA 4NLGA 1RTJA 4ZKAA 4OHYA 3KHRA 1TKZB 4DR2F 3HKWA 2R7SA 3C6UA 3IGNA 3NCQA 2ZH6A 1B64A 2ZC4A 3GSDA 3MHYA 2R7WA 4WCEQ 1HBMB 5F9LA 3P3DA 1FVQA 1Q4RA 3VCDA 2FVSA 5I3QA 3ISND 4NYZA 4G3IA 1P27B 4CO1A 1QAXA 4OL8A 4EUVA 4O3PA 2XMWA 1R27B 1SH3A 5KT4A 2HRUA 3QJLA 3M9OB 1KN6A 5B0DA 2A2CA 1TUVA 3A8EA 3H5SA 2CJQA 4M5DA 4MYTA 4LIRA 4MAKA 2DGQA 1PC4A 2IC3B 1S1TA 1VFJA 1N8RT 3JSMA 3SSSA 4I6YA 1U6FA 1VQYA 3H98A 5HMYA 5J2QB 5DLGA 2P6TA 2CQ0A 4DG1A 2HS3A 2Q1LA 3IG1B 4OQJA 3OJSA 2DHXA 3M6VA 1HQEB 2CIMA 4G1PA 4DR5F 1OQ6A 4NL5A 4JV1A 1NJIT 1Z1ZA 2M8HA 5LT5A 1YWXA 2DHGA 5CD4H 1X0FA 1FKOB 1NK8A 3K5PA 4B08A 4JI6F 1QSSA 2E5LF 3TI0A 5E5NA 3MM8B 3PJWA 4ECRA 1L3UA 1S6OA 4H4KC 5F8NA 2E29A 2C42A 4ZDNA 4NA1A 3MFHA 5KFCA 4DFJA 1K0TA 2HWHA 3KK3A 4IFYB 3M32B 2ASDA 5EX0A 3KG0A 2HNYB 4NLOA 2WSFC 2AD9A 1P1TA 1MW7A 2MKKA 4TLQA 4BS2A 4EYHB 2JLFA 5A8KB 2HHUA 5DO2A 3M2RA 1LKZA 4QBUA 3LALA 3H2LA 5IT0A 2XS7A<