1F5CA

Crystal structure of f25h ferredoxin 1 mutant from azotobacter vinelandii at 1.75 angstrom resolution
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
106
structure length
106
Chain Sequence
b'AFVVTDNCIKCKYTDCVEVCPVDCHYEGPNFLVIHPDECIDCALCEPECPAQAIFSEDEVPEDMQEFIQLNAELAEVWPNITEKKDPLPDAEDWDGVKGKLQHLER'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FERREDOXIN 1
publication title Crystal structures of ferredoxin variants exhibiting large changes in [Fe-S] reduction potential.
pubmed rcsb
source organism Azotobacter vinelandii
molecule tags Electron transport
total genus 31
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 2000-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00037 Fer4 4Fe-4S binding domain
A PF11953 DUF3470 Domain of unknown function (DUF3470)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1f5cA00
2FD2A 3HKZD 7FDRA 2PA8D 2IVFB 2GMJA 2WSCC 1FDAA 2PMZD 1BC6A 1R27B 3MMBB 1C4AA 1Y4ZB 2FJDB 2VPYB 1G6BA 2WSEC 1B0VA 1F5BA 3EGWB 1FCAA 2VPZB 1K0TA 5BYRA 2V2KA 2WB1D 3C8YA 1FDBA 1Y5LB 4XK8C 3OR1B 1IR0A 1ROFA 3MMAA 1KQGB 1PC4A 2FJAB 5FD1A 1BLUA 2O01C 3MMAB 3MM7B 4ID8A 4YDDB 1Q16B 6FD1A 1SJ1A 3MMBA 3MM5B 2Z8QA 1AXQA 1JB0C 1Y5NB 2UZAA 1F5CA 1H0HB 2WAQD 3MM9B 3GYXB 1JNZB 4XDCA 1FDNA 1Y5IB 3IR7B 1GTEA 1FEHA 5CH7B 3OR1A 2C42A 4OMFG 2WSFC 3OR2A 1A6LA 1B0PA 1FRHA 3MM7A 1F2GA 3OR2B 5E7OB 1JNRB 1FRXA 1DFDA 1D3WA 1GTHA 1H7WA 3IR5B 1FTCA 3MM6B 3MM5A 2GMHA 1FXRA 1FXDA 1DAXA 1RGVA 5L8RC 1BD6A 2FDNA 3MM9A 1BWEA 5BYSA 4XDDA 3PNIA 1FF2A 1B0TA 1WTFA 2C3UA 4KT0C 2C3OA 2VPWB 2C3MA 4OV1A 1GT8A 1KEKA 3EUNA 2ZVSA 3MMCA 1FERA 2Y0SD 3MMCB 3MM8A 2C3PA 5CHCB 4CI0B 4RKUC 1DURA 1H7XA 2VPXB 6FDRA 3MM6A 3MM8B 1SIZA 1KQFB 5BYQA 7FD1A 1FD2A 3EXYA 1BQXA 2V4JA 1G3OA 1FRJA 1SIWB 1FRKA 1IQZA 1XERA 2V4JB 1HFEL 2C3YA 2PDAA 2FJEB 4L6V3 1CLFA 4Y28C 1FDDA 2FJBB 2XSJA 3LW5C 1FRMA 4DHVA 1GAOA 1FRIA 1PC5A 2XSJB 1C4CA 4AYBD 1FRLA 1VJWA 1H98A 3IR6B 2FGOA 2VKRA
chains in the Genus database with same CATH superfamily
3HHLB 4BS2A 1XR6A 4IO1A 3OTDA 4RU9A 5IV3A 3BKTA 2R8JA 3GV7B 5KFWA 5I42A 2NXNA 1NXIA 1NH8A 1VI7A 3MD3A 1RHKB 1NDKA 5EWFA 3T1AA 3GONA 2RH3A 2VICA 1IBCB 2R7WA 1B7YB 4FKYA 3LAKA 5A8KB 1HWLA 1KVKA 2P2CB 2MQOA 3HX9A 4DJBA 1ZAWA 1RLDA 4DS4A 2H5EA 3HD1A 4CCHA 3A3NB 5K9FA 2BXJA 4DMZA 1M90T 1YVFA 5C25B 4P2SA 3A8IA 1WI6A 4RKUC 1HBNB 2CJYB 2DNNA 3GFHA 1U6FA 2P8IA 4B3MJ 3TUJC 4C8NA 1QDUB 5I3PA 2B5JA 4RUBA 1GAOA 2JOQA 2KT2A 3G6YA 2MB0B 2WBMA 3MOZA 4RLEA 1N6QB 2KKHA 3T9ZA 2VA2A 3QJJA 2JEJA 3CEDA 3TZYA 1AA1B 3FJ2A 3NS7B 2F8EX 3NGTA 1ZA2B 1U0HB 1RE1B 2ZM6F 4ZHRA 2JLFA 4OI1A 4OJHA 5AJ3F 3PHEA 1V3RA 4A8SA 1QTNB 5F3TA 3IRXA 4OI6A 2IM0A 4D3GA 4MYTA 3LF0A 2DY9A 1XR5A 2ZH1A 3M2RB 4NA3A 3LP0B 2VFSA 3M6XA 5J1EA 1I5OB 3I55S 4M5DA 4LIWA 1B7FA 4LSNA 1IJFB 3M9OB 4QIWD 4PUOB 4BWMA 3UN5A 1Z1ZA 5A8RB 3LP2B 1SIZA 4DR1F 1QJHA 3CCJS 1C1BA 3HHNB 4ZDNA 3DDIA 1V5IB 1IBKJ 3DLBA 1F3FA 1NSAA 1VQNS 3J7ZT 4LF5J 1JLAB 2DTJA 1N5YB 1TP7A 1HHTP 5LXRA 1SC3B 1U1KA 2CJAA 4KHPJ 2FVSA 1Q7YT 1T05B 2AGQA 4HTJA 3LGNA 2EWHA 5J2MA 1RT7A 3MI7X 3QWUA 3BDPA 3VHQA 4USKA 1FJ7A 1HNXJ 3SQGB 3GV5B 3C46A 4PZVA 5KOXA 3OR2B 3MM5A 3NLCA 5CYJA 3CXCR 2CNNB 4ZPWR 1S1TB 5J2QB 3M2VA 4WXWA 2V4QA 4DR4J 5CXTA 1LNQA 4UOCA 4B3RJ 3GPAA 3C16B 2NSBA 1T02A 1KFSA 2WK4A 2E1RA 2DGTA 2MQLA 2VBZA 2EBGA 3NS5A 4ES1A 2KJVA 4KO0B 3DC2A 1ZM4A 1J5OB 2P9EA 5HROB 3QZ7A 1C4CA 4AYBD 3ZZYA 1OPIA 2P9CA 3R1HA 4EBDA 2IJRA 2JNJA 2XMMA 4UQTA 2EKYA 5F9LA 1A7GE 2LP4A 1N4LA 2HQIA 3K8VA 2MZTA 2FIUA 3KOAA 1NJXA 2V2KA 1RAGB 4M5GA 4Z7YA 3C8YA 3R5GA 3MMAA 2NUUG 3PACA 4FNHA 1KHWA 1WEXA 3IFEA 1XR7A 3TJ9A 4B9MA 2C2NA 3AJ2A 1FX2A 5IWAF 4W98A 3DRRA 1CJTA 5F3ZA 3MEKA 4JI7J 3W61A 1FTCA 3TARA 3CPWR 4ATNA 4RBUA 4KH0B 2YY3A 4M5JA 1Z2ZA 5B09A 5KOWA 4HHUA 3T1YJ 1RWPB 3AOAA 1RT6B 5LMUJ 3ETMA 4TQRA 3MEGA 3AA8A 3DRPB 3E2EA 2ROGA 3OFGA 3CMES 3EICA 2PFDA 4RZRA 3TUPA 1Y7PA 1S1XA 2F9JA 1NBEB 3DKDA 1NSKL 2HFVA 3DDKA 3SSRA 4JOUA 5HVFA 3HVTA 4KV8B 1HNWJ 3AD7C 4UZBA 3OT9A 1IBLF 3MEEB 1FI4A 2FC8A 2BE2A 4PRFA 1SV5B 4DF4A 4F4WA 2EFQA 2I5JB 5HP1A 4C4WA 3OL6A 3GB0A 3A3PB 3HHLA 1N34J 1T9UA 4OYZA 4FNIA 4AL5A 2E7WA 1N0UA 4B02A 2AX0A 3NGDA 2XGQA 4YR0A 4ZLNA 3M2UB 2E5JA 1GXLA 4M63A 4RWWA 3DMJB 2J6TA 1WC4A 1K8AT 1S1WB 3R9LA 1SC1B 3AD8C 4EGLA 1JKHB 2EEYA 4ILLA 5KFLA 1FT8A 2G0IA 3TR5A 2GO8A 1M5PC 4OLPA 2V4JA 3TI0A 3R2DJ 1K1QA 4B9NA 4FS1A 5LMNF 4RU2A 1X4FA 3CJKB 4RNFA 4DUZJ 1WD6A 1HBNA 4H4MB 2XZTB 4X4PA 4DLEA 1B70B 2XULA 3MUMP 4AL7A 4QR0A 1R27B 3D9BA 3KXDA 4LRFA 1VQMS 1UVJA 2YKMB 3HHEA 2ZH4A 3KK3B 4YB1P 4MIBA 2KRBA 2PC6A 3BN7A 5AE2A 2ZZNA 5E41A 2RHSB 1R8CA 1RUSA 2HWHA 3OJUA 1LW2A 2UXDJ 1IR2A 5F8JA 2AJ0A 1BQNB 1S4EA 2W1BA 1N36F 1HI0P 5LJ3Y 1WF0A 2WB4A 4JYAF 2YQ0A 2QV6A 1YWXA 3KUHA 3DRXA 2HWIA 2QJ3A 4WXOA 3LP0A 4PPDA 1YRUA 2BJ8A 1RHQB 4LF1A 1F6TA 1IKYB 5HMZA 1JLQB 1WHYA 3LWMA 3MFHA 1BXNA 5HVHA 4LBPA 3TYTA 4PUOA 2FJEB 2WOMB 2IA6A 3G82B 2GIRA 4NCGA 1S9GB 3LP2A 3H5SA 3UQSA 5JVHQ 2CJBA 4TNOA 2UV8G 2Y3YA 2OKQA 3DFEA 3EZ5A 2RKIA 2QMUB 1S6QB 2Z2LA 3OD2A 3MCOA 1WG4A 1UVIA 1WC6A 1TL7B 2RRBA 5D0GA 1JLAA 2UUCF 1N5YA 3C6UA 3MXHP 3TX0A 2MKYA 1F5CA 3SFGA 1KOHA 1T05A 2NXJA 1X9MA 3FQLA 3ADAC 1SL2A 4PAAA 2HGMA 5DJBA 3P6YC 3Q23A 3SQGA 2D3UA 3PIPQ 2ZNYA 1FWPA 4DX6A 2VDHA 2AZ3A 2VPXB 3NKYA 2VG7A 4ZPBA 1RT1A 2VHGA 2H48B 4N47A 1S1TA 2CFXA 3A8KA 2NYIA 2WVCA 2ATLA 1LFPA 4MK7A 4ZJQA 3C16A 3SCIE 2Q66A 4RJVA 2LCWA 2WZ1A 3LH2S 1VBZA 4CM0A 4MKVA 1R0AA 1O51A 4ZPAA 4C3KA 5HROA 1T9WA 4FXDA 1TL3B 3HT0A 3RB4A 4MIAA 3PIOQ 5A2QU 2LMIA 3KG0A 3IWLA 2FVCA 2M5YA 2ZH8A 3KK1A 1LWEA 1RTIB 1CS4A 1C1CB 4CIOA 1SL0A 2L9NA 3J7YI 4Q0BA 4P2XA 3VAJA 2QIFA 2JL9A 4QYZK 5E3RA 4WJBA 1M5KC 1NHVA 1R8AA 3Q22A 2VPWB 3H5YA 5L46A 3RB3A 1GX6A 1WOPA 1IJEB 4ES3A 4E8UA 4X2BA 4NEYA 1BE4A 3EDRB 2DHXA 3LP1A 2GVZB 2FQQB 4X66J 3LGHA 2FLPA 2OPSB 3VV2B 3KNAA 1EAYC 2QLJB 4ZVGA 2IVFB 4RX6A 2VPYB 1Q4RA 4DXLA 5IM0A 2HRYA 2P6SA 1FVQA 2PE8A 3KMQA 1YIJS 2HQGA 3IS9A 3W9IA 1VBYA 4KV8A 1MMLA 2QYCA 2X3GA 5B0FA 2Z8QA 3G4SS 4M5NA 4CO4A 2RVJA 3OL9A 2I5JA 2AEFA 2YVSA 4B3TJ 2CA9A 3ONQA 1X0PA 4K4UA 3U1MA 1NJWA 1FFGB 3FSXA 3SCJE 2XO6A 4C9DA 1S6PA 1JLBA 2GVDB 4CI0B 1KS2A 5JMNA 2XLIA 2J7UA 3IBFB 3PFOA 5F41A 3C2PA 4P10A 1S1UB 2FHOB 3D4JA 1X4CA 4I6WA 3RTVA 4NE9C 1JKHA 3UI3A 2ASYA 4KIAA 2CZ4A 2BOAA 4ED7A 3TX8A 3P5TL 5IC4B 2OP5A 3CIMA 1GK8A 3B54A 2B51A 5HJXA 1F5BA 4F02A 3THVA 4M8LA 2AEMA 3POTB 1RTJA 1L5UA 3W5ZA 2RHQB 4O0NA 3SCKE 2G1DA 4EK2A 3R5AA 1F0XA 1VQOS 1JLFB 4V19J 2HHVA 1QSLA 2ZZMA 3CDAA 1OYEA 3KK3A 5DDQC 2DNPA 4LSZB 4ZLLA 3CJ4A 1VQSA 1HNIB 2K1RB 1BWEA 3GV8B 1V3SA 2LQ8A 5K8MA 3G6XA 2W2QP 3DOMB 1BQNA 3JYTB 3RRHA 1RACB 5ETMA 4N41A 3ZZPA 1SI9A 3HHLD 2AX1A 3IA0A 3FQKA 4OHZA 2YKPA 1VR6A 2GO9A 2Z0GA 1VRTA 3DOKB 1T9VA 1Q5YA 1SXLA 1IKYA 1PJ5A 1KC8T 3NMAA 1WI8A 4A8KA 4IH6A 2JZ5A 2PMZD 2VC0A 4DFJA 3NWRA 2CPJA 4WYLA 5ETLA 3AB4B 5LSOA 3G82A 3F56A 1S9GA 1LWXA 1SKUB 2WB1D 3Q89A 4ELVA 4YHHF 3CJ2A 1U2CA 1CJUA 4FXVA 4KPYA 3WDOA 4WFZA 1AZSA 1CJKA 2ROPA 1WC3A 4P52A 4UQGA 1Y5IB 4U96A 1T95A 1QUPA 1U6ZA 4P73A 5D8HB 2HNDB 3EVWA 2W24A 4O3NA 3SYZA 4KAIA 4AXJA 1KBRA 3V4IA 1Q81T 2VQEF 3TJAA 4WTOB 1XMQJ 3E3XA 1DQ8A 3CC4S 4NYOA 3F0NA 2CADA 2ZFHA 1JJHA 1XERA 3QGGA 4WWSA 1REVA 2B4OA 2CYYA 2XWYA 4OZ2A 5KT4A 3D6FB 2NYHA 2HS0A 2Z30B 1NPKA 2EG2A 3DRSA 3K5OA 5D6GA 4L75A 2B9EA 2J9CA 1TMJA 4DCOB 4OHVA 2JHEA 3I0RA 3TA1A 4C0HA 1NU4A 3K58A 4NXNF 1TUWA 3CWJA 4ZP9A 3N6NA 3VALA 2GA7A 1SJ3P 1MNEA 3FRZA 2CG8A 3AD9C 2IYIA 1SKSA 3OPKA 3MUTP 3O8WA 2V8HA 4EFAC 2HAIA 3D1QA 4IRKA 2N7CA 1WSVA 3F44A 1SQGA 2QL5B 4PWDB 2WONB 4C0BA 4CWBA 4FVMA 1NKCA 2EBEA 3ILJA 3QIPB 5D0HA 1S7IA 3NNAA 4NRTA 4USTA 4GO5X 1RTIA 1C1CA 3BH7B 2CVEA 1IKVB 5KG5A 3W2WB 5HMYA 1IUJA 1Q7LB 3MCMA 1RA7A 9RUBA 5KG2A 1IQZA 3NCPA 2XEXA 4LT6A 2W2OP 4RWXA 2JH3A 4CYUB 4A48A 4ALZA 4JI0F 1FKOB 4DUTA 2VL1A 2UP1A 4ZKAA 3DU5A 4X4QA 2F65A 2E7XA 1CC7A 1T94A 2MY7A 5KT7A 5K8NA 2AKWB 2IC3B 2FVRA 4LQ3A 1FDBA 1ROFA 2LYVA 2GS8A 5KTQA 2OPSA 3DM2A 1TVRA 4DV3J 3HP6A 2KG1A 4RBVA 4GKJF 3VGVA 3QJPA 1VGYA 3UD5A 2IA0A 2RQKA 3UDCA 3HO1A 4A46A 5IZHA 1GTEA 3KLEB 5CYQA 2HHTA 1RLCL 4HKQA 2PEHA 2AIRB 4ANDA 1HBUB 2R2RA 4HT5A 3VQTA 4IO9Q 1M0SA 4M94A 3MD1A 3JSMA 1SCJB 2DR9A 1NK7A 4I2PB 3PW5A 3RZAA 3TP2A 4ZVUB 3TQEA 5D15A 1KHVA 1VC5A 4C2MA 2KFYA 5DQGA 2C28A 1QAYA 1UEUA 3D68A 1WC0A 2MTLA 3TUZC 3OVSA 1VK8A 1HW8A 4QU6A 4F4KA 3ZZUA 4USHA 2C22A 4RL1A 1P1TA 1R43A 3LPEA 3TA2A 4DSKA 1MROB 2KN4A 2GX8A 4K4SA 5KFHA 4ZVQB 5CAAA 3GJRB 1IKXB 2BVZA 2YNFB 1TK8A 3UR3C 5L1JA 1UPPA 5E5NA 3DHXA 2MSSA 2UU9F 3B8HA 3QAUA 2EC2A 2LDYA 3ZTSA 1FJGJ 1REGX 4R5PB 2QO3A 2GHWA 2SXLA 2ZD1A 1S7HA 1TKXB 2WSFC 1V5VA 2J9DE 3SCLE 2ZE2B 3WIVA 4ZLPA 1DAXA 3M6VA 2C2KB 3K5PA 4YY3J 4OI2A 1EKRA 4G1IA 2D3OR 2D69A 2AEJA 1VRUA 4ZN3A 5IT4A 1DRZA 3P4UB 4RW8B 2IRYA 3KJVB 3HJFA 2F8HA 2IJNA 4CO1A 1QUVA 2D9OA 1Q1KA 4ELUA 4DL4A 5D3GB 3CC2S 2KHCA 5GAEI 3H5UA 4C8KA 2B9YA 1MN7A 2HKEA 1X31C 2DRAA 4MJKA 1WF2A 4Q2MA 1KLMB 1U02A 4NEZA 5KG4A 2BRLA 2VIHA 2W7AA 1YTYA 4ANEA 2QTWA 2UVRA 3BF4A 3TANA 3U02A 2O3DA 2WTFA 1N8RT 2CVIA 4BLGA 2QFJA 1FRHA 1WDTA 2DO4A 4IUFA 2CQIA 1D3WA 2GCFA 2RRAA 4GMKA 4MAKA 3S6EA 2XS2A 1RDRA 4TU7A 1FHTA 3EUNA 2ERRA 2ZUAA 2HNDA 4JI8J 1Z2LA 3CW2C 3TZWA 4K0KJ 1R6YA 2EK6A 4Z37A 1PG5B 1F5AA 2X1FA 2B7BB 2MKSA 1SIWB 1FRKA 3UCZP 1G4CA 4MFBA 4I64A 1J5EJ 3BGRB 4G1QA 4DQRA 5KAKA 1YJTA 2K7JA 4ECQA 3FNNA 3Q8UA 2CJ9A 3DLKB 1RHJB 2DR6A 1R0BG 2KFNA 3EGZA 2BZ2A 2IJFA 2YNHB 3PR4A 2OAUA 1Z4UA 3EE3A 1ZPVA 1DJ0A 3QT6A 4O4GB 8RUCA 1TV6A 4OV6A 5ETVA 3MURP 3FCWA 4OFZA 4IH7A 4DV0F 2UUBJ 1MLAA 2RUSA 2FYXA 3UW1A 5HATA 2B6AB 1XNRF 1Q79A 1FRXA 4TYAA 2HRUA 2J8SA 1WOSA 4MMOA 1D09B 5BR8F 2VQFJ 3CC7S 3FZ2A 2YX1A 3H5XA 1U49A 1KVIA 4B9VA 2VFTA 2AWZA 2CG4A 3W2VB 4JI2F 5CHCB 3HT3A 2V8VA 1LWFB 1JLGB 3M8QB 2HHSA 2E44A 5D4LA 2YX7A 3CE8A 1P8GA 3GTYX 4HR2A 3TWZA 4DU7A 1IKVA 1S97A 2HGNA 3PYDA 3IXQA 3W2WA 5RUBA 3KLGB 3M9NB 1IBMF 1BC6A 2QRRA 4ELTA 1S0VA 1QAJA 1M5HA 1FJEB 1PO6A 3UE2A 4CYUA 4ZK7M 2CQCA 1X9WA 1FKOA 4DV2F 3BB5A 2VBWA 1UWBB 2B4UA 1C0UB 4LBHA 4LF6F 2CPDA 4MK8A 1KTQA 3Q0AA 6AT1B 3TOQA 4MK9A 1RHMB 4OYAA 4ETXA 4BWJA 1SB6A 2ZBIA 4NOHA 4C97A 4G6VB 4OZ1A 4Y65A 1F2GA 1QY7A 3UWTA 5D4PA 1UEKA 5EX0A 2CPHA 1NZAA 2FY1A 3AA9A 4ITSA 4J5OA 2XM3A 3KLEA 1RT5B 4OL8A 2KVIA 2KYXA 5EDWA 4DR7J 3AFGA 3NRBA 2GIFA 3PKYA 3QWPA 3PDNA 3BGUA 2Q79A 2C2EA 3HK2A 4FN5A 2MQPA 4I2PA 1LW0B 4DSEA 4X84A 4QWDA 2OI2A 1P1LA 2AP6A 4AD6A 4BDPA 3CVKA 3CCQS 4XO0A 3AQOA 2E9ZA 1E6VB 3CCWA 4WZMA 1D9AA 4ED3A 4YDDB 2B4VA 3C14B 2GZOA 5KFAA 3UDEA 3ITHB 4OYMA 2NZCA 3W8GA 4JI6J 4DR2J 2AV5A 4KHRA 4J9VA 4FBUA 1IKXA 3DOLA 2QA2A 2YNFA 5L39A 4DV1F 2HBRB 3UCUP 2QYGA 5GAHI 4J9OA 5J1PA 2KH9A 4B9UA 4R5PA 1UWAA 2IBOA 1RYRA 1TKXA 4MH8A 2VFUA 3AAWB 2ZC4A 3MMCB 4FYVB 4KGXB 4BBYA 1K47A 2MZSA 4F36A 3ELHA 1N33J 4LR7A 1VQ7S 3MWBA 3L4BC 1XN9A 2V8DA 1MWYA 3NOGA 3CCSS 3CCMS 1RWMB 4P71A 3NGUA 4N56A 5HO4A 3V5RA 3VGUA 3TAMA 3P96A 2Y1LB 5KG6A 2G9OA 4ID5B 3KJVA 1BGXT 3KJQB 4QIEA 1Y5LB 1CPZA 4KR0B 2DIVA 1S5ZA 2Z2YB 3M8PB 3BKFA 2DR8A 3BEGB 3DYAB 3Q83A 3BQ1A 4U8VA 2HHUA 3N9UC 3DI6A 4LF4J 4IFYB 3JAMU 2V9KA 3WQPA 2Q3PA 4DL5A 1H74A 4EO8A 2V5HG 2QA1A 1JLEB 3D0HE 3G8SA 2RS8A 4NXMJ 3R6GB 2P5VA 3MHYA 4ZCMA 3NS6A 2R8KA 2MQMA 4Q5VA 3PW0A 3MM8A 3M8YA 1FTRA 1XNQF 2ASDA 2RILA 2FLLA 1SQEA 5ADZA 5ETKA 3ILLA 2BR0A 3FCHA 1X7VA 5SUHA 1NPRA 4FPIA 4K2JA 3HZEA 1IWGA 3PVXA 2OH2A 4C8OA 2MKIA 1H72C 3T5HA 1UMJA 3K89A 1D8ZA 1GXUA 2EKNA 1U1QA 4RW4B 3DLKA 1BLUA 2O01C 2LLZA 4QU7A 1GFWB 2HVZA 2YQ1A 4LFCJ 4DPOA 1WDDA 4MIWA 3GYXB 3QJLA 3GYNA 3HVAA 2V67A 1QD1A 1CBKA 5B7WA 1C0TB 1I51B 1VIXA 4R0JA 2A10A 1ACMB 2NCKL 2C3UA 4JV1A 1UJ6A 4ED1A 2JDJA 3FUYA 5EUHA 4W4MA 2ZOFA 3KUGA 3PG9A 4J90A 1X4BA 2MKHA 4H4KC 4PXDA 2L48A 2JLEA 3PO5A 5D4NA 4WP9A 2DEIA 3VAKA 3HSZA 3ETOA 1RABB 1ZM3A 3CJ3A 3PY8A 3R1LA 1JLGA 5J2PB 1ZETA 4AFFA 1LWCB 3M8QA 4WZQA 3D1HA 1FNOA 4LUBA 1KSPA 4DCPB 3W64A 3TRGA 2GQQA 5BYRA 4CLFA 1UA0A 5JXSA 4TY9A 4OX9J 4DLGA 2IM2A 1BQMB 2XMWA 3KLGA 3I5CA 2VJVA 2ZH7A 4UOGA 4KJIA 4DV5J 3CJRA 2VUGA 1NSQA 1SJQA 1UWBA 1HBMA 3RBXA 2FJXA 4DR3J 1GMWA 3FMWA 2V4RA 3VAGA 2F8MA 3CDUA 2CNKB 2OELA 3D0GE 3G2XA 2R7TA 5AXNA 1DBDA 4A8FA 2N4CA 2NZ4A 1SC6A 2P9GA 2HLUA 4G1PA 2MQ8A 1H38A 1HHSA 2AD9A 1Q8BA 1RTDB 3QSYB 1RT5A 5CA5A 3UR0A 2WW4A 3A8EA 4RNHA 4KKOB 2UUWA 2B8PA 4LF8J 2JC1A 5I3UB 1OMSA 1RXOB 2MPUA 3PYGA 1AROP 1LW0A 5F8GA 2C2ZB 1JMTA 1M1GA 2RDJA 3A4TA 1RA6A 5GMKa 2N3OA 2FZCB 3IWNC 5KFGA 2HRTA 1YRXA 2E1CA 2XYPB 2W2NP 4JYAJ 5CD4A 4CLKA 4NLWA 2G1HA 1CG2A 2WW8A 1T8EA 3M1VA 4K59A 1S76D 3EGNA 4ZIVA 3TUIC 2FHJD 4KGMA 4J9QA 2VBXA 4PCQA 4TKTA 4J9SA 4HLBA 2JLGA 3GIMA 2I2YA 2KI2A 1DTQB 2YNGB 1R8PA 2KFZA 3ZZOA 1M1HA 3IMQJ 3KLIA 3GG0A 4HDHA 3CDEA 4UT4A 3H4DA 2AYBA 4FF4A 2A3JA 2MZRA 4PG4A 4B9SA 1S9FA 3P5BP 3W9JA 5GAEU 4B3MF 2UUCJ 2ZITA 2HSEB 1PYTA 3BSOA 2DPJA 4JBCA 1QE1A 1T03B 3IG1B 2FB0A 1I3OB 2KT5A 2HQ3A 3I56S 4ID5A 5D78A 2F1FA 3S01A 2L41A 4KFBA 5KFCA 1T11A 3MFIA 3D6HB 4RW9B 2IDLA 3N5BA 2QLXA 3M8PA 4C8YA 4FF1A 3WC2A 2AJFE 1RWKB 4USJC 3T5LA 4WP3A 2DB1A 5E2QA 1KONA 2EFPA 3EZUA 3M8ZA 3VCDA 3OFEA 2GJ2A 4PXEA 4K4YA 3IBWA 2VJUA 3PX0A 2CAJA 3HFVA 2BYCA 1JLEA 3V6KA 1FE4A 2OPPB 2UUAF 2YH0A 3FFIA 3GCXP 2YKNA 2GQCA 3UDLA 2D9PA 1WORA 2R9LA 2DRBA 3H7HB 5HJYA 1VDHA 3MPDA 5KFUA 2ZDOA 5LOQA 4QQBA 2YPYA 4RNNA 1RBLA 2RJZA 1IBKF 3MAAB 5CYMB 2W01A 3M32A 3NNCA 5HQ8A 1CULB 4DV4J 1JIHA 1X5PA 4LF5F 3ZXWA 3W9HA 3UD4P 4PWUA 2E9TA 1TMMA 4FKXA 1RT2A 2LXFA 2LFVA 3C19A 2VA3A 1J27A 2HZAA 4ECSA 1S9EB 4KHPF 2DR7A 4QW9A 4D3HA 4FVCA 1UJ4A 3FVYA 1H3DA 3KLFB 4A8QA 1UVLA 2EXUA 2DITA 2VKZG 1V3ZA 4KSEB 2IFXA 2DT9A 1PCAA 1HWUA 5DLFA 1HNXF 1C0TA 1T3OA 4OYPA 2MGZB 1DURA 2CXEA 2O5DA 5D0RA 1TKDA 1YSJA 3OL7A 4PPZA 4A8YA 4NLQA 2XO7A 5IC6B 5I3QA 1JLCB 4PG7A 4X4OA 2HK2A 3S7RA 3DHWC 3FBFA 3GYGA 4DR4F 2AMCB 2KVQE 3DDNA 5A8WB 4USIA 1F3VA 4B3RF 1RTHA 2V68A 2LKZA 3GCWP 3T5KA 1FESA 1NJZA 4NLGA 2DKOB 4ZVFA 1R31A 2ZOGA 1PGZA 2C1EB 5ITHA 5C2CA 1LWCA 3VGSA 1FNMA 2PEBA 3KLHB 4JB8B 3LOUA 3AHPA 2Q43A 1VQ4S 1AW0A 3OXLA 1ZTTA 2W9BB 5JVGQ 1TL1B 2J0QD 1X9SA 4O3OA 2D7SA 1BQMA 2K06A 1TK0A 3CMQA 1A9NB 1BWVA 4RNOA 4HH0A 5EWGA 4CH7A 2Y9HA 2I8EA 4OX7A 3W62A 3N01A 2VG5B 2BJ3A 1RT3B 4J9LA 2PA3A 4JI5J 3GSDA 3GG1A 2BA9A 2Z56B 4OHYA 1KFDA 2IIHA 2RRNA 2IAJA 4JI7F 2VFVA 4PWWA 4C3LA 4O23A 2ZH9A 2DNLA 2KDOA 2XNQA 1A0OB 5F8IA 2HLTA 3I31A 1RADB 4QW8A 3EVMA 2XYHB 4JI4J 4A8MP 4FYDA 3V81B 1KQSR 1QAIA 2DVIA 3CCLS 3VAMA 3JTNA 3KFWX 3T1YF 1SUQA 4LF9J 2W4PA 1NK0A 4EMDA 5LMUF 3EPGA 4LRAA 1C4AA 2NUHA 1HWJA 4PKDB 4ZVPB 3EXCX 4I0WA 1ZYQA 3ZNJ1 2BANB 2IY5B 4KKOA 1XTZA 1SJ1A 1RHUB 2YKAA 3QBCA 4M5IA 2FPHX 3QAEA 5C2GA 1QM9A 2ZBQA 1H0HB 2MXYA 1XMOJ 1HNWF 3LANA 2HFSA 3C6TB 3G8TA 4DR6J 1VMBA 3CSKA 4ZP6A 2PO4A 3LWLA 2QN6B 2KTQA 2V9WA 3DGVA 4DU8A 1N34F 4ECWA 2W2MP 4X4NA 2Y0BB 5MAOA 1HYSA 3WC0A 3KHGA 3SFUA 3H2UB 1N5QA 2O67A 1O5JA 1UFKA 2P6TA 4L6V3 1JX4A 2DGOA 2V2VA 2BE7D 4CLZA 1VJWA 1PYOB 3U7JA 1OIAA 5K8OA 4I68A 4XIUA 2FHMA 4L74A 1H6KX 2FJWA 1GMWD 2JJ4D 3HI9A 2CDQA 5KFQA 1NM2A 3M4XA 2GJFA 4YHHJ 4LJMA 2DGUA 3HM9A 4ER8A 2OO4A 4WCEQ 4F0KA 1S0MA 3D5MA 3ZTRA 4DUZF 1ZZNA 3I9V9 5E0OA 3OW2R 4GVLA 1HBOB 5FLXU 3HFZB 3FEZA 1NLKL 4DG1B 1NB7A 5T7LA 3Q8QB 2VQEJ 5B0CA 2R8HA 3IG1A 3MM6B 4O3PA 4UUXA 2G0JA 3HLUA 3ICLA 2MKCA 1O6XA 3Q2TC 3BQ2A 4NLOA 4YS2A 3VGTA 3CCES 1FDDA 1S0NA 1OPZA 2XSJB 3LA0A 4RW7A 2GJIA 3WBZA 4BC9A 1OSDA 1ELOA 2PA8D 4JI1J 1E6YA 4QCLA 4ED0A 1FFWB 2MLZA 1VHFA 1ZZFA 2WSEC 1RZMA 1EQMA 3W7BA 3TA0A 3CJQA 1NPPA 3G6VA 1H2VZ 1BUXA 3R7BB 4WFAQ 1RBAA 5KT2A 2QA4S 2UZAA 2VF3A 1U4BA 3D2WA 1AB8A 1FDNA 1YGYA 1NH7A 3I32A 5CYMA 2E1PA 4PQUB 2ATCB 1D0EA 1FE0A 2QGFB 1JNRB 4EEYA 1CULA 4TY8B 4P7VA 2FDNA 2HNYA 3BPDA 3PNIA 4GKKJ 3JQKA 2XMTA 4JUZA 1QSSA 1SL1A 2HAFA 3MOJB 4Y00A 1VLOA 1ITPA 2OPRB 2HFOA 1L3UA 4ICLB 3UPFA 3OTEA 2Z2ZA 4R0EA 4JI0J 1Y0HA 3CB4A 5IT9U 2GW8A 2DH8A 3N4WA 5AT1B 5CD4H 1HMVA 4ECZA 1N5SA 3K2YA 4EZ9A 4YB7A 4N77A 2BQRA 1RKIA 4J9PA 4NLPA 2GMJA 5H1SV 3K8WA 4DQQA 4QIVA 3W3SA 4LSLA 4KQZA 3B4DA 4IR9A 5F8NA 4TXSA 1FKPB 3PCOB 2DY1A 3JAMY 4KYZA 3QT7A 4E98A 5C42B 1FNXH 5A8WA 2HVHA 1F1BB 2DHSA 3IP0A 3O44A 2U1AA 1HQEB 5ETNA 3HCXA 3PV8A 1NJIT 1XJWB 4WIIA 4C8ZA 2C42A 4Y2IA 2RQMA 4CO2A 2MKKA 1YX2A 4XPEA 3MR7A 3TJ8A 3R7NB 1XC9A 2KHDA 3OUYA 2W9BA 4N7TA 2OMLA 3RJMB 1TL1A 2CKWA 1DARA 2V34A 5A6WA 2GNKA 2H65B 1MMDA 4WIQA 3NCQA 1ULRA 7FD1A 1BQXA 4NA2A 4ZPVR 1NUEA 1BMQB 3BGOP 3VZIA 3HSDA 2OJ3A 2MKJA 4L73A 4CO3A 1FRLA 4ERDA 2YXLA 3CUNA 3E8OA 5LSLA 3AXKA 2LA6A 5JJBA 1B0VA 4NA1A 1DLOB 3V81A 3SI8A 2XCAA 4H4OB 3NXZA 4X66F 2E9RX 1S6OA 3OTOJ 3EZOA 2HHQA 1Y5NB 4C8LA 2WAQD 3MM9B 2Q6BA 2DIUA 3KJNB 4U7UD 1X5SA 2BANA 5DETA 4CLUA 3X1LB 2Y8WA 3BKUA 2APOA 3UNYA 1P9QC 2DGVA 2CWKA 3EM1A 1HNVB 5DGBA 5EX3A 3N79A 3RAQA 4ED6A 4WFYA 4DL6A 3RAXA 3W5XA 3AOBA 1PIEA 4IFVA 3AT1B 4OZLA 2DO0A 3KHRA 3ZZRA 2DHAA 4DPWA 1KVJA 3D7SB 3QRPA 3PJWA 4YN3B 1WC5A 2H51B 2BABA 5F9NA 1EIYB 3TVYA 1TFWA 2RT3A 1RT4B 4FYWB 4YEAA 5H9FJ 2ZJQQ 3KJFB 4GVBB 1ZTWA 2VC1A 4HYKA 2M2BA 2YNIB 1NSPA 2RB7A 2ZBCA 5FD1A 4J9KA 4AQYJ 1VQLS 5EHHA 1PBUA 4A8XA 1WEZA 1HNZJ 5F8LA 3MGJA 4FP9A 2LEPA 3QRRA 1EP4A 5F0WA 3CD5A 2K3IA 5G0RB 4OIXA 3DLGB 3OXFA 5H9EJ 4LMZA 3OV7A 2OSRA 4JV5J 3D54A 3QFHA 2YKOA 3DXBA 4CLPA 4F4AA 4NLRA 2M8HA 1QTMA 3R2CJ 3MEDB 2E1AA 3AXMA 1T9YA 3MM6A 1N5TA 1R8HA 3J81U 2FJVA 2J76E 2QG9B 1RB0A 2DNRA 2HZCA 1UFWA 2VG6B 3KDOA 2XLKA 3OVBA 3EVOA 1S59A 1HR0J 5LL6d 4NL5A 4ZMMA 2CJQA 2KZZA 2XWXA 8AT1B 3A8JA 1YJNS 1GMUA 4NLYA 1Q16B 3CCTA 4B17A 1YJUA 1ICEB 5A6PA 3T41A 5A8KA 1MSWD 3BN4A 1PAEX 3DGPB 3GFYA 5KG0A 3ENVA 2CQDA 1Y9OA 3G8QA 4U6PA 1FF2A 3D0IE 5C25A 4JI2J 1SBRA 2UXBF 3TZZA 2YBVA 1KN6A 4L72B 3H2LA 4K4XA 2OUGA 4PQUA 2ABYA 4IRDA 1N5VA 2MHNA 4TY8A 5HN0A 2MY8A 2MYFA 2ZNZA 5KFSA 1APSA 4F2SA 2CQPA 2KZMA 1LXNA 1TAQA 2V63A 1KTVA 4B3OB 5DO2A 3PRVA 1XMQF 1N6QA 4DWIA 4Y2CA 1D9FA 4DQIA 2R3VA 3CDBA 1S0OA 2QL9B 4UY8T 5MLCV 2EPIA 1SKWA 2DISA 5IS2A 1R6VA 2F4FA 4IG3B 5KFNA 2BUNA 5J2NB 3NG8A 5CZXA 5FJ4A 1U0HA 4MKYA 1AFJA 5A0YB 5BJRA 2CJKA 3GZ7A 2Y1JA 3PRBA 3SDEB 1ZA1B 2RQCA 2R2SA 1D1UA 1FO1A 3GJQB 3O5TB 4FZVA 4NASA 3KDNA 3M2RA 4OI4A 1JJ2R 4DX5A 2FHKA 2CQ1A 2ALZA 3OFHA 2O1PA 4JI3F 3NGKA 4X62F 1FXDA 4UOHA 3TVKA 3PHTA 3TAQA 5A8RA 4X65J 1F9EB 1V6HA 2QT7A 5GAGU 3T5JA 2XMJA 3FKBA 3VAFA 3LUYA 2OFHX 1EQ0A 4JV2A 1AT1B 3VTIA 1HPZB 1NNDA 5IV4A 2E5LJ 1RSCA 1RI7A 3HDSA 3FGVA 3I87A 2KYZA 1IQTA 4OYXA 1FCAA 1K73T 1SQFA 4N5SA 3GJSB 1RAJA 4ECVA 1X4HA 4NLUA 3ISND 4M5MA 1CEZA 4KB7A 3P45B 3GQCA 2HHXA 4C7QA 1NDCA 3MCNA 2VDIA 3ZTPA 5GMEA 3OR2A 4DL2A 4H4OA 2DXDA 1H7WA 2XZWA 4DR5J 4CM2A 4LRCA 3THTA 2N4DA 3VZHA 5KFOA 2VOPA 3MM9A 2EFOA 5J2QA 4DV3F 4LF7J 4OZJA 2BM1A 1U2FA 1MG7A 4LR8A 2DPIA 4A4JA 3MMJA 4PABA 2UXCJ 4KO0A 1VC0A 2A2DA 2Z57B 1FRJA 2D3ZA 2R7XA 3FDSA 1S10A 1J5OA 3V4MA 1HNVA 4DOZA 2QC3A 2B5JB 4QYRA 4ZVSB 2LEAA 5AE1A 1W26A 1HIYA 1WELA 2A0FB 3M6WA 1S12A 2ZWOA 4NZ7A 3R27A 1YLXA 3NEKA 1UA1A 3KK2B 4TLRA 5LJ5Y 3R5BA 4L3NA 4NLVA 3B78A 4BHQA 2QMXA 4P6QA 2XMKA 2J6UA 4ZHRB 4KGKA 1S79A 4I69A 4FBTA 4QPTA 1AXQA 3HHDA 1SH3A 3IRXB 2JEFA 1OY9A 3UNGC 4NYPA 2H9ZA 3TVZA 1DQ9A 2XYGB 3DN9A 4F8RA 2RD5C 2J5AA 5J1EB 4M5DB 2HS3A 2FTRA 1KP6A 4I67A 2VONA 4OX8A 4LSNB 2X1BA 1W2IA 1RT6A 5G0RA 1VK3A 2XC9A 3IM8A 4NWBA 3DLGA 5KG7A 1FJGF 3DRPA 2ZBRA 2H4YB 2V8GA 2ZC3A 4EUVA 4PEOA 3QMQA 1XIQA 1K1SA 3FCVA 3GR0A 3CJ0A 3V6JA 1Q53A 4U7UK 3QZ8A 2FD2A 4YY3F 2R7UA 2BACA 1CVJA 2E5GA 3MEEA 2QSFA 1YKWA 1SV5A 4YDXA 3AB2B 4WU2A 1PBAA 2O66A 5L9XA 1RCXB 2VG6A 1WC1A 2J9EA 1RK8A 2KXNB 3EGVA 3OQ2A 1SH2A 4YFUA 2X51A 3M2UA 3AOCA 3DMJA 4ZN1A 2RF2B 1S1WA 1OYDA 1TUVA 2H5JB 4P72A 4J37A 3W60A 1XK8A 5C5JA 1Y3JA 3UCGA 1XEZA 1FFSB 4GRSA 4DZDA 3EWGA 4HHHA 4RUHA 4DV7J 3I0SB 1Q82T 2R4FA 4TU9A 1DQAA 3CJKA 5I4MA 3T3FA 2AJ1A 2VV5A 1N88A 1NHUA 4ZOSA 4H4MA 2X7IA 4MKBA 4JI8F 3S8SA 4HDGA 2YKMA 2ACYA 2J9DA 5FLXY 1WG5A 4B3OA 1J5EF 2WCXA 4LBIA 3MMAB 4OHXA 3RR7A 4Y2MA 3SMZA 4CNZA 1I94J 3GR1A 4IG3A 3MZIA 4O3SA 4LFAJ 5J2NA 3CIZA 2DGXA 5CH7B 1X4AA 1CJTB 4FPRA 2Y8YA 4Y2AA 3SDEA 1PILA 1YI2S 3E01B 2EG1A 1UJ5A 5KFEA 1IVZA 4NI2B 1WHVA 3DNCA 3M8RA 1U8WA 1JLQA 3MEGB 2UUBF 1FD2A 5CABA 2WOMA 2W7PA 1RJJA 2ZWPA 1X8DA 1ZPWX 1ZOTA 2W8LA 2VQFF 1NKBA 1S1XB 4ZPCA 1W25A 2K3KA 2IMWP 3HVWA 4ZJOA 1RQ0A 2BMBA 3HVTB 2HFUA 1V9OA 4CLSA 3PM9A 7AT1B 1S6QA 4KGZB 3NNHA 2CDRB 3NBPB 5J1NA 4DI6A 1TL7A 5DZ7A 3GJTB 5HP1B 3JQJA 2R42A 4HACB 1N32F 5L1LA 3QFWA 1U1OA 1U48A 1URNA 2XBPA 3RRKA 3RB6A 2AJ4A 3OLBA 1JNZB 3IM9A 1R7IA 2A1BA 5AXKA 1TK5A 4CLYA 4C11B 1UVMA 5IT9Y 1NDLA 5KFBA 5CCMA 2V50A 1FERA 2DHHA 5IT0A 2HHHJ 1TFYA 2B0GA 3OTCA 2W25A 2CZVC 2KJWA 2LA4A 1M1KT 1PSDA 3FBEA 2V4JB 3JSRA 2C3YA 4K4WA 3BSAA 4DSFA 1SPBP 1GH8A 2L08A 4ZJLA 2UVWA 5KFJA 1Y4ZB 4KE5A 1T9XA 3O1LA 2UUTA 1DY3A 3HHLC 3M30B 4DR7F 4TU8A 1TL3A 5T14A 1KQGB 4B9LA 3KK2A 2Q1LA 2OTLS 4QYZJ 4UTGA 3SXLA 4ECRA 1WEYA 4F3QA 4USWA 4WU3A 1FK9B 3IR7B 2QMWA 4ECYA 1LW2B 5L1IA 2XSFA 3FEXB 2XI2A 2XLJA 3GLJA 2N3LA 2HEKA 5EGYA 2DGQA 4XAKA 3ISZA 3Q24A 4UZCA 2DXEA 4WBFA 4NCBA 4DV6J 2JEGA 5KFKA 2KU7A 3WZ0A 3CJTA 1OO0B 4JI6F 2YTCA 3LTOA 4DR2F 3R97A 2XG8A 2CUYA 2MZQA 5DDOC 2UUAJ 5DQIA 1IM4A 2FVPA 4F0MA 4ZP8A 2GVZA 4F4ZA 3BBFA 1HD0A 3FZBA 3HHKA 4NCGB 4HHJA 4YMEA 1RISA 1GNKA 2OIHA 3CGIA 2CQGA 4U8YA 2FUG9 4WK1A 3Q2SC 2BX6A 1UKUA 2RKIB 1RAOA 3WX4A 3HULA 1N33F 2XNRA 5GVQA 4NLTA 3C6UB 2BEFA 3BO2A 3UDVA 4DDFA 4L3KA 2ZOMA 2YWFA 4O4RA 2GHPA 2X1AA 1ZBTA 2BM0A 4CRJA 3NGRA 3QLHB 2BKOA 1KLNA 4ZS6A 1ZM2A 3M8SA 2ZVIA 4U7CA 3BBCA 3T1HF 3JSBA 2GVDA 2RF2A 1NZ8A 1F9FA 2V6AA 3D6TB 1S1UA 2RDDA 2HURA 2VG7B 4LF4F 4C6AA 2UVVA 1RT1B 2W8KA 1TUGB 2J0WA 3NL0A 2JEIA 2E5HA 4KRWA 2B7CB 2XHWA 4OHWA 4NXMF 2JSXA 2NQPA 4PXBA 3I0SA 3MAHA 1DHMA 1R0AB 3OLAA 3POTA 3EGWB 2E5IA 4E0DA 2KT3A 4RBTA 2HVDA 3R7SB 5ETSA 4WTYA 5KT5A 1JLFA 2QEXS 3L95X 2MQNA 1RBOB 3NY0A 5KFIA 3DRYA 5A76A 1H2TZ 3KK1B 4Q7AA 3AY0A 3BSCA 1JXEA 4IG0B 2A6OA 2VU5A 1LWEB 1CS4B 5M2PA 3GIRA 3LALA 4Q0BB 2IBKA 1HNIA 3MPUB 2K1RA 4QWCA 3J81Y 2KB2A 3DOMA 3T19A 2E7VA 2NPIA 4QJVA 2ZEJA 4LFCF 3JYTA 1U0SA 2DJWA 2J8AA 4J7CA 4C8MA 3E01A 2DGWA 1VQPS 2CJXB 4NI2A 2GHVC 3DOKA 4LFBJ 3JB9k 2HHPA 3LP1B 3CD0A 4ECXA 2LVWA 3PO4A 5KFVA 2HW3A 3IN5A 5M2UA 2JWNA 3H20A 1IN0A 3WIUA 4QWEA 4DUYJ 4N76A 2G2ZA 5IM0B 4GC7A 4NMLA 4X64J 3QRQA 1TKZB 4LVNP 3OJSA 3IS9B 1EETB 2V0NA 3OVAA 3QPIA 4QBUA 2OMOA 3CNQP 1JB0C 4F3OA 4OYOA 3NBPA 5ETRA 2J0XA 1YJ7A 4HACA 5E7OB 4N8NA 2ZH5A 1SJ4P 5SZTA 4OX9F 5FDLB 1MN9A 4KT0C 2BKNA 3CCZA 1YJ9S 2BQ3A 2OGUA 2LDIA 5EN1A 1S6PB 2JC0A 4DV5F 3BDEA 5GADI 5B0BA 3L7UA 1JLBB 3V6DB 4U9RA 4C11A 1XBWA 3PXGa 4DR3F 2W9CB 5D4OA 3ILIA 4WFNQ 3J7AN 3PX4A 1S72S 1NK8A 1KNZA 4EU0A 3I5BA 1UZHA 2RU3A 1S99A 1TR0A 1TTHB 2COLA 2E66A 5E3QA 1C2PA 2PMHA 4YB6A 3CT9A 1RTJB 1SJRA 2POKA 3KNGA 3BV8A 3SBMA 1X60A 4ID8A 3CO9A 3ENQA 4UUWA 6FD1A 1VC6A 2D1CA 3O6QA 2YH1A 2GAHC 2G2YA 3J7YU 3UN3A 3M30A 4NLXA 2HVEA 4LF8F 4J9MA 4BC7A 2OHDA 2YPZA 4PWDA 2WONA 1RAFB 2RNEA 4UY85 4IQMA 1KD1T 3QIPA 5LT5A 1T9TA 3P49B 1FK9A 3FEYB 3AQPA 1GT8A 4C0OC 1VYAA 2NXEA 2Q6CA 5F0UA 3FBCA 1OWXA 4WF9Q 3RW6A 3B6BA 2FHJA 2W2PP 4M5HA 1G3OA 4CH0S 4WFBQ 3J80U 1LKZA 1GXTA 3HZGA 3A1YG 4DFPA 1VRTB 1PC5A 5IFMA 4CO5A 5KT6A 2CPFA 4PYDA 3RYLA 4W90B 2NSCA 1XWLA 4C98A 3IGVA 4TVAB 4QWAA 2F7VA 3PW7A 1L3VA 4P9SA 4U67Q 2IC3A 2PT0A 4YQWA 2ZJRQ 4K4ZA 1HHQA 4OZ3A 4AUKA 2B4PA 1FD8A 1R89A 3A13A 4I1TA 4WP8A 4GO7X 2RIJA 2D74B 1CJUB 2XS5A 1VS3A 1AZSB 1TZ0A 2R8GA 4KBIA 1CJKB 3K59A 3L7PA 3QSIA 1FEHA 2QLFB 3M8WA 1HBUA 4DFKA 2CPZA 2BOPA 3N28A 4E2FB 4URQU 2AJQA 1CQNA 1N56A 3V4IB 4WYWA 3AJ1A 3KKFA 2RMLA 5D0EA 1WOOA 3F73A 3TW0A 4HT7A 1LQ9A 1LFWA 4X4VA 1JXLA 2FY8A 2F4VF 3H59A 3OHAA 2BJ7A 3JSYA 3QLHA 3SV3A 5DM6Q 2VOOA 2OD4A 4PR6A 3UFCX 2ZM6J 1REVB 5AJ3J 2X3DA 3PW2A 1FRIA 3T9NA 1RWXB 1NDPA 1PYSB 4OJ3A 1HA1A 2I1RA 3DRSB 5LSRA 3QGPA 1MROA 2DXFA 2H54B 1X4DA 4R8UB 3I0RB 2VPZB 5HSPA 2F9DA 4DX7A 2ILYA 1U1MA 3C66A 3KHLA 2ADCA 4DR1J 2KO1A 3RG6A 3DCAA 2ZE2A 2LXIA 3R5DA 4QZVB 3ULHA 3R5JB 2CQ0A 3MPVA 4IG0A 4DV4F 3HVRA 2JRSA 2ASJA 1YBUA 3MR6A 1JJCB 3RRGA 5KFTA 4EO6A 3K7RA 1YBTA 4RW8A 2QE5A 1HL6A 5KG1A 3NWGA 4HEA9 3BO3A 1RWUA 1U26A 5D3GA 4URSA 2UV8A 3LQVA 3HKZD 1NMEB 4L76A 2IM1A 5AXLA 4FF3A 2J7KA 1PJ7A 1KLMA 3H8YA 2G13A 5HQMA 2PN6A 2J6SA 3N6MA 4RO0A 3VQSA 3DM2B 1TVRB 3SIPB 3Q8SB 3ILOA 3HMJG 4Q44A 4OZNA 2E29A 1JK9B 3RBZA 3K57A 5AE3A 1MMNA 1TKZA 5CYQB 1EETA 1YZ7A 2DBBA 4O44B 4O3RA 4DSLA 3IR5B 3JTPA 3ZZ0A 4ZVTB 4ECTA 1B0TA 3J81j 3IC1A 1KEKA 1U1PA 3JSMB 4EWTA 1HARA 2WHOA 2H4WB 2RUGA 1YZ6A 4TLQA 3W66A 5FDLA 3T6BA 3AJDA 2BW2A 3BGRA 3L9ZA 1S1VB 2HNZB 3A12A 4NLSA 2RAQA 3D1OA 5IWAJ 2HS4A 4JI5F 3RAMA 3V6DA 2XY6A 4WE1B 3OXGA 3G87A 4F67A 1EZZB 2OEMA 2W9CA 2C2MB 3HJVA 3GSIA 4IOAQ 4HTIA 3BYPA 1RCOB 2YNHA 5ETQA 2YKQA 1UVNA 4B3SF 1EHWA 2HHWA 3IAS9 1YG0A 1AFIA 4JI4F 3G71S 4K4VA 2ZHBA 4O4GA 4LF9F 1SJFA 3FRYA 4FF2A 2B6AA 4A47A 2ZD1B 4F4YA 4DCJB 3HD2A 2RS2A 4ENOA 1VJQA 3OBIA 4LVOP 1Q86T 1I6JA 5HMWA 5HQLA 2ZZTA 4OQJA 1NKEA 3W2VA 1IBLJ 1LWFA 1XMOF 4K5RA 2A18A 1B99A 2DYAA 1VRUB 4DR6F 3ENAA 4DL3A 3P3DA 3CF5Q 1P27B 3EPIA 2NLWA 4ZPTR 4CH1A 3ZO7A 3QNWB 1RAAB 1ZAVA 1UVKA 2XMUA 3I96A 3PYFA 1P9YA 1WG1A 4UW2A 2IM3A 1GQEA 2MLXA 1Q0NA 1IWAA 2U2FA 4I7FB 2WVDA 3A3OB 2V2ZA 1N52B 3QO9B 5E3PA 3OSPA 2M9KA 1G6BA 1TELA 3ZFVA 3P8BB 2HBZB 2FLOA 2LQ5A 3I4HX 1AUDA 1JXVA 2LXUA 2V94A 4Z7CA 4NCAA 1C0UA 2FGCA 2ZKUA 4OLOA 2KM8B 4O0IA 5ETTA 4CO0A 1ZH5A 1FX4A 2HVIA 5KG3A 4A8WA 5HLFB 1MW7A 2VH7A 2QLWA 3QGHA 1N54B 3NGSA 3NOCA 5LMNJ 2UXBJ 5DDPC 5BYSA 4FYXB 4ZIWA 2DK2A 2F63A 1LV5A 2G2OA 5THWA 1U6BA 1H73A 4ZCIA 3TQ1A 5DQHA 4K8RA 2Z58B 4ILMA 1RWNB 4MFBB 2L9DA 4V1Ak 3H42A 2R7QA 2HQFA 4EI2A 5T41A 3LW5C 3CDWA 3EJMA 4G1QB 4CTAB 1U45A 1VFJA 3THPA 2Y1RI 3GU0A 1LXJA 3DLLQ 2ALYB 3MMBB 2NXCA 1SC4B 2KM8C 1N36J 5K8PA 1K0TA 4LRDA 2EFNA 1E6VA 4ED2A 1T0TV 4RUCA 3C14A 2F5GA 4KY3A 3ITHA 4RUAA 3VF0B 1S4FA 1X0FA 5C7PA 9ATCB 5BXIA 5HBMB 2MQQA 4R8UA 4JI1F 1TV6B 3CULA 3RBEA 4JI3J 4J9NA 1NK5A 4X62J 2GAGC 2RE1A 1RP5A 2UVUA 3O2IA 2OLWA 1BD6A 3BR8A 2OFGX 2BRKA 1RHRB 2IVYA 2YWWA 2QX0A 3MMCA 4LR9A 1O0PA 1KWMA 2YWGA 1R8BA 2LECA 2W4CA 1UAWA 3N5FA 4W92B 2NREA 3GFZA 3DLEB 3N0VA 4GKKF 1YRTA 2ZHOA 2K2PA 1MWQA 2MSTA 3CJ8A 3I5AA 3SV4A 4DSJA 1GEHA 2XGPA 1UW9A 4Y2KA 3GIIA 4EYHB 1FWLA 1GX5A 2V8PA 4ZLJA 3IBCB 2PFFB 2AQ4A 2G4BA 3QT5A 2CRLA 1PAUB 3H25A 4YP3A 3DYAA 4OYIA 5B0DA 5KFMA 3Q8RB 2OEJA 5D77A 4K50A 4IFYA 2A6MA 5HAOA 1LEOA 3TEGA 1F2HA 4EYIB 4M5LA 5DS7A 2ZDPA 2HFNA 4TQSA 1X4EA 4XDDA 4DL0C 2DCLA 2IYGA 2J0SD 3J7Z5 3E51A 3CJSA 4QOTA 3FSIA 3GP9A 4O44A 2ZJPQ 1I1GA 4K2XA 1KQFB 1DZ5A 4IR1A 5BYQA 2JFKA 1G7CB 3RGIA 1U2RA 2DEJA 2NPFA 1U09A 5GADU 4S0MA 3SSSA 2XQCA 4H4KA 2BW7A 2HBQB 1XQIA 2NR0A 2ILZA 3KG1A 1YITS 1UZDA 2E1MC 2ZHAA 1WNEA 1HI8A 3SSQA 3IRWP 2XMVA 2Z4PA 3UVJB 3KTQA 1KR4A 1YK9A 2XHCA 2G0CA 3BGLA 1S1VA 3CMAS 3BBBA 1UEVA 2HNZA 4DS5A 2MZ1A 3GFXA 3I9ZA 4RW4A 2YWEA 3H2VE 4WE1A 2QL7B 2DRDA 4XDCA 3IAM9 4XTTA 3UN2A 3G86A 4F04B 3DOLB 4USVA 2MLYA 4ZPDA 3BR9A 3MECB 2PI5A 2EFVA 2AGOA 4DSIA 2ZH3A 3OTOF 4F26A 4PXCA 1H7XA 5FIIA 4CT9A 4DL7A 2DH9A 2HQDA 1B4SA 1WACA 1Q8LA 3CD7A 2M4MA 4DHVA 4Y0FA 4DBQA 5J2PA 2FGOA 3SEOA 4DN9A 1VLYA 5KFXA 1AUSL 3F41A 1VBXA 3PTWA 3TAMB 3MAQA 5KFYA 2CQ3A 2AHOB 2CPXA 1UCNA 2YQ3A 1UL3A 2DCUB 1KOOA 1YJRA 4I7FA 4LRBA 1U8SA 2KXHA 2CQBA 4ZCLA 4I6AA 1URRA 3QO9A 5C24B 1Y00A 1XMBA 1GMVA 2OPQB 2BDPA 2YWKA 2IPOB 3HSJA 5EWEA 3ET6B 2R7RA 1HWIA 3DI6B 1FEEA 2MHEA 1GTHA 1S49A 2OEKA 3EMTA 1KRPA 1Q95G 5HLFA 4AQYF 1HNZF 3FBBA 2ZVSA 4PG6A 4KPCA 4U95A 3CCUS 1MU2B 3V6HA 3MM8B 1VBKA 5LXYA 4DF8A 1RTDA 2QFIA 3NAHA 4JV5F 2M0GB 3NMRA 3KYLA 3G6ES 3TO8A 5I3UA 2L9WA 2I6WA 5KFRA 5E3AA 4CLLA 4CTAA 2XZDB 1YDLA 2AYEA 1L3SA 5KT3A 5KFPA 3R5CA 3MMBA 2W4DA 2CPIA 2DH7A 4Z2XA 5DRKA 4RR5A 2C2DA 3O3LA 3KMSA 3G9CA 1EX8A 2IVMA 3M6UA 1HR0F 1OY6A 5GAHU 3QT8A 4HH1A 4IRCA 4DPXA 1VQYA 2ZUGA 1WWHA 4QR2A 3TEHB 3J80Y 5HBMA 3PEJA 4A8OA 1WTFA 4NZ0A 4OI3A 4F50A 1QLNA 2Y0SD 1LK7A 1DTQA 3TZXA 1WSRA 2YNGA 3SZ2A 5E3CA 2N82B 2AJ2A 1B3TA 2M88A 3MTJA 3VAIA 2AU0A 3SQOP 2D41A 5KFFA 1UW4A 4OV1A 3NAIA 1NK9A 2CPYA 1WUUA 1TU0B 2BJDA 3CD6S 3DLEA 2XI3A 1L3KA 1N32J 2ZH6A 3BQ0A 3RW7A 4NX9A 1T03A 1Q5VA 1CJVB 1WTBA 4B9TA 5HVGA 2NXUA 2QSWA 3CO0P 3JS9A 5B0AA 4P2FA 1WJ9A 2LU2A 5L9NA 2I38A 2GQ2A 2B9WA 4DPTA 4RW9A 4X4UA 1HBMB 2UXDF 1RWOB 3QATA 2X1GA 3U27A 1IR1A 1YJVA 2HG4A 1OY8A 2M8DB 2C3MA 1B64A 2FVQA 3QYYA 4M5KA 3DU6A 2IRUA 2W9AA 2DNQA 4RNMA 2HMIB 2B8QA 3TNVA 2HIQA 3GILA 4NXNJ 4LIRA 3QQCD 3I6PA 1NCLA 2OPPA 4AXIA 3K17A 1HD1A 4QWBA 1VOMA 2H5IB 2IHR1 1EKSA 2Y1IA 5HK4A 1H98A 3L09A 4DPUA 3JTOA 1YHQS 1EJ7L 4X65F 1RU2A 2FC9A 3MUVP 2V2QA 5LM7E 4I56A 2JFDA 4R25A 3MAAA 1HQUB 3OR1B 4P75A 4AL6A 4ZVHA 5A2QY 2NS1B 4DQPA 4JV0A 2H1YA 3JQMA 3UVJA 2E5LF 4BCAA 4F2RA 4ETZA 2DNKA 4CT8A 3DXSX 1S9EA 1Y11A 1A6LA 5U47A 5AXMA 1D9DA 5DDRC 3PZPA 3M1VB 3BJYA 3PW4A 2HYIB 4IH5A 3D28A 3KLFA 3CCVS 1OSCA 3C15B 5DLGA 3PFEA 2HZVA 2MGZA 2C3PA 3NP5A 3K5NA 4YUDA 1UFLA 4OYWA 2HQCA 3Q8VA 3D67A 3MECA 1JLCA 2R7SA 4Y34A 4DR5F 2RQ4A 5CQGA 3HXMA 1HWKA 1UPMB 2LEBA 1JQGA 3KLIB 4GKJJ 4FDFA 1UETA 3Q8PB 4LF7F 1G2EA 4PG5A 1PKUA 2VZ9A 4QIFA 4ZCKA 4LF2A 5HMXA 2MEWA 1EARA 2UXCF 4IDKB 3GMGA 1IM6A 2C2OB 2M70A 4CLWA 2HK3A 3B4MA 4ES2A 2DR5A 3KLHA 4P74A 1QE1B 4B08A 2XS7A 5DGAA 1LOUA 4HL9A 5JUMA 2BJ9A 4IOBA 2MDAA 4KFBB 4PYAA 4ILRA 1YJWS 3GE9A 1HI1A 1VQ8S 5C24A 1ZM9A 3BYRA 3JXOA 4RPFA 3BZQA 1BHNA 1FXRA 2VG5A 2XCPA 2OPQA 1RT3A 3T1HJ 4CDIA 3ET6A 1X4GA 4QPXA 2N7YA 5F8MA 4F3MA 3EDQB 2QLBB 1U24A 1K0VA 3EXYA 4WK3A 1VQ5S 3IGNA 2B56A 2VD3A 4WFXA 5L38A 5G4DA 4ZITA 4V19X 3W5YA 1MU2A 2UU9J 3OHBA 3FFIB 2YKNB 4JP8A 1OQ6A 2YX4A 2WSCC 5K20B 4ZP7A 1VQKS 4MTPA 4TN2A 3X3UA 4UF4A 2CNLB 2VODA 3S1TA 1KDNA 1TKTB 4USMA 4MT1A 2DNGA 1PC4A 2LQBA 4DFMA 1SH0A 2VFRA 3GWCA 2OSQA 3M32B 2LQ9A 1VQ9S 3BM7A 2AZ1A 4I2QB 3C6TA 1RT2B 1NRKA 1RTZA 4X4SA 3VVUA 3H4BA 1WKLA 1FA0A 4DZ6A 2DGSA 4NPOA 4ZVEA 4P7TA 5DG9A 4B3TF 4F7VA 2R7OA 3R6LB 2M52A 3CTRA 3ZTOA 2ASLA 1FJCA 3MPYA 3BREA 1W2BR 2IDEA 3MPWA 2WRMA 3BO4A 5B0EA 3MR2A 1F60B 1YBAA 3RUBL 3VVTA 3ZNUA 3WX8A 1OQ3A 2HFZA 3D66A 1HQ2A 2YWHA 1VCTA 2PSZA 1WF1A 1LK5A 3MF5A 3ZZZA 3HPOA 2B3TB 3D6MB 3PJXA 1RTHB 2GIQA 2GC8A 5K14B 4Q8EA 2HPUA 4J9RA 2CZ9A 4DV7F 2AYMA 4G65A 2B9XA 3H40A 1CSJA 3RU0A 2FLNA 2HWTA 2K8GA 4F4XA 1HBOA 4QIGA 2BQUA 4DG1A 1RAEB 2C2RA 4I4BA 1KQKA 1CJVA 4EZ6A 1FWKA 5M2RA 2EW9A 2GMHA 4Q45A 1HLWA 1JWWA 4GC6A 3VAHA 4AT1B 4UOFA 1I94F 4Y3CA 4LFAF 4TYBA 3WHIA 3R3TA 4C3MA 2PIIA 2IAJB 4IOCQ 2GGPB 4G3IA 3N6LA 2BE9B 4ED4A 2QZ8A 2XSJA 4X4RA 5IOLA 2K7KA 4CQ1A 2XY5A 3LO3A 1RWWB 4ECUA 1S6UA 2VKRA 5IQ6A 2HMIA 2WBRA 1NK6A 1SUQB 3W1YC 1HKAA 3H98A 3EX7B 3PRDA 2VASA 4DV0J 3DLHA 5HI7A 4PQAA 1XNRJ 1YQHA 2IRXA 2DD8S 3BS9A 4X4TA 5BR8J 1Y3KA 3HSGA 3DLJA 4IYQA 1RU1A 3PR5B 3OSNA 2I9SA 2BBEA 8ATCB 1IKWB 1R3NA 2RU9A 4MKAA 3OL8A 1R0CB 1S48A 2XTJP 2EI5A 1HQUA 3OR1A 3V2UC 3PKMA 4K4TA 1RAHB 4KGVB 2DNHA 2AYGA 3B82A 1U1RA 4QR1A 5L8RC 1EB0A 1NO8A 2R7VA 2BKPA 3FK4A 3HFKA 4OZ5A 3M9MB 4F25A 4O3QA 1IBMJ 2OPRA 1Y10A 3PJ9A 4ICLA 1HYSB 1U25A 4DV2J 1U1LA 1HFEL 2LU1A 3RR8A 2W7OA 4LF6J 3M05A 3UO0A 5ETPA 3FMBA 2AT1B 3BH6B 1FRMA 3C15A 3PYEA 4YR3A 1NAQA 3FSYA 5DZ6A 2CIMA 4OZ0A 3D3BJ 2KG0A 4YOEA 1U7LA 2HHHF 3ZZTA 2FZGB 3ENWA 3FC9A 3RBDA 1FKPA 3QGIA 1TL5A 1X5TA 4HI1A 1IR0A 4RW6B 5C42A 3RB0A 3MM7B 5IXUA 1ZAXA 2VBYA 2WVEA 1DTTB 5B0GA 1HQEA 1OJ4A 4IDKA 4Y6IA 1CQMA 4URGA 3HF5A 2ZH2A 4HI2A 1M5OC 4OMFG 4ANCA 3K0JA 3CCRS 3BSNA 2R2UA 1VHIA 4AE5A 1U47A 2OTJS 5T7LB 1Q8KA 2H3EB 1M5SA 2BJ1A 4HVZA 1QVGR 1Q8IA 1K9MT 1QSYA 4ED8A 2F4VJ 2GMLA 4CZCA 5CCLA 2FZKB 1VRQC 4CNYA 2BJEA 4KTQA 4DEZA 4ED5A 3GIJA 1NJYA 3MDFA 4K5SA 3M7VA 5I42B 3IO1A 4DV6F 4RW7B 4CLTA 4EBCA 4OI0A 2BV3A 2EFGA 1E6YB 2M7SA 2B43A 2ADBA 1U1NA 1DLOA 2EVZA 4DV1J 2CQHA 3LPYA 3LAMA 4Q8FA 3ZTQA 2MJUA 4NMXA 5IQQA 1J2VA 3OFFA 4P2MA 4ZA1A 2A2CA 4WPAA 5K5MA 1TKTA 2CWXA 2M3DA 4F0HA 3L3CA 4OX6A 5L1KA 1TQLA 4KHMA 4USUA 4I2QA 2HNYB 1S57A 5DM7Q 2RDIA 5GMDA 3J7A1 3VWSA 2ROEA 1VISA 2VB6A 1RAIB 3EYZA 4LQ9A 1S77D 3L7OA 2DNYA 3D3CJ 2HIYA 3KLVA 2DNOA 3T6JA 4KC5A 2CQ2A 4M1KA 1NK4A 1HMVB 4LREA 1FKAF 1T3NA 1RKJA 1RT4A 1ZS6A 2EK1A 4GVBA 2KL8A 2ZKTA 2RSQA 4LSLB 3GIKA 4FS2A 2YNIA 1Q78A 2WVBA 1WKKA 3UD3P 2FJAB 2PI4A 1SKRA 2PGCA 2GV1A 2XB2D 3Q8YA 5K14A 3PEHA 4FYYB 1XNQJ 1TAUA 1TL4A 4EBEA 2AW0A 3U1NA 3C3LA 1UTAA 1C1BB 2LQJA 1RGVA 1RWVB 3K5LA 3OUYB 3ISNC 3H0PA 4DN0A 3MEDA 5F8HA 4OJ1A 5HANA 2KRRA 2JX2A 4NLDA 4WKRA 1QVFR 6FDRA 2I0XA 1SVDA 3IWXA 3I82A 4DQSA 1IXKA 3I4PA 1QAXA 1WHXA 4Y28C 2EC0A 2HGLA 4H54A 2ZBPA 1BY9A 1X5OA 5GAGI 5CZVA 5J2MB 1RT7B 1H2UX 4ZVRB 1FDAA 2J7WA 4PG8A 2GGPA 2FJDB 3TAPA 3MR5A 2R8IA 1AYEA 4B3SJ 3NCRA 4NYZA 1P6TA 3AODA 4XK8C 4K7QA 2D3O1 4LFBF 3KHHA 2QA4G 5B08A 4FXWA 4OYBA 2ACMA 3MM5B 4DPYA 2OD6A 1D8YA 4CP5A 2WVFA 1G1XA 2F40A 3M2VB 2MMYA 3QIDA 4NRUA 4DUYF 3DGPA 5KFDA 1B0PA 3AH6A 3MR3A 1NEEA 3W65A 4X64F 1DFDA 5ETOA 1K44A 1IKWA 1KKHA 1NB2A 1N0VC 4Q2LA 3HKWA 2C3OA 4OJGA 1L3TA 1VQ6S 2XMAA 2CNOB 5DG8A 4IKAA 1CC8A 1NHKL 5DG7A 4IFVB 5HL7Q 1O8BA 4K0KF 4J91A 2IMOA 3ZC4A 2KXFA 2FJBB 3H90A 2XY7A 4IQXA 1WKJA 2JVOA 2PD1A 3OTBA 1UP1A 3Q86A 4M95A 7FDRA 1N48A 4C48A 3R8YA 4DX8H 2CPEA 1WHWA 2AGPA 3CJ5A 3DRRB 3BGFA 5A0YA 2GFFA 4MYUA 2JVRA 3U1LA 2MZJA 2F3JA 1F9HA 3KG4A 3K5MA 1T7PA 5H9FK 1FXLA 4N8OA 4NZ6A 3G96A 1RYSA 3US5A 2R2TA 1EP4B 4Q43A 1HW9A 4XPCA 4RW6A 4WKYA 1M5VC 3MM7A 2PMWA 3BPSP 1PJ6A 2V69A 4I6YA 3PX6A 2AF6A 1FVSA 1DTTA 4J9UE 1JJ4A 2HBYB 2Z2MA 3LGMA 3W8PA 2MJNA 2L3MA 4YR2A 4ZVOB 1MWZA 4KH1B 5H9EK 4YB5A 3W63A 3MCSA 5KFZA 3KUEA 3VR1A 5E33A 2DNZA 1VIOA 2DNMA 2PDAA 3MTKA 2BE2B 2CQ4A 1HPZA 1CLFA 2DHGA 3KWMA 1W7WA 1OS5A 3IR6B
chains in the Genus database with same CATH topology
3HHLB 4Y2CA 4BS2A 1D9FA 3IXQA 3THPA 3W2WA 4DQIA 3CDBA 1XR6A 2Y1RI 1S0OA 3KLGB 3M9NB 4UY8T 5MLCV 4IO1A 3OTDA 2EPIA 4RU9A 1SKWA 1IBMF 1LXJA 1BC6A 2QRRA 3MMBB 2DISA 3DLLQ 1QAJA 4ELTA 1M5HA 1FJEB 1S0VA 5IS2A 1PO6A 3UE2A 2KM8C 2R8JA 4IG3B 3GV7B 5KFNA 4ZK7M 2BUNA 2CQCA 3NG8A 5CZXA 5J2NB 5K8PA 5KFWA 1X9WA 5FJ4A 1K0TA 1FKOA 2EFNA 4MKYA 4DV2F 1E6VA 1AFJA 5I42A 4ED2A 3BB5A 5A0YB 5BJRA 2VBWA 2CJKA 1UWBB 2B4UA 1C0UB 4RUCA 4LF6F 3GZ7A 2Y1JA 1NH8A 1VI7A 3MD3A 3PRBA 3SDEB 3ITHA 4RUAA 2CPDA 4MK8A 3VF0B 2RQCA 1S4FA 1KTQA 2R2SA 1X0FA 1FO1A 1D1UA 3Q0AA 5HBMB 3O5TB 5EWFA 4FZVA 3TOQA 2MQQA 4R8UA 3T1AA 4MK9A 4OI4A 3M2RA 2RH3A 4ETXA 2R7WA 1JJ2R 4JI1F 1TV6B 4BWJA 1SB6A 3CULA 2FHKA 3RBEA 2ZBIA 3LAKA 4NOHA 4C97A 4G6VB 4OZ1A 4J9NA 5A8KB 1NK5A 2CQ1A 4Y65A 2ALZA 1HWLA 1F2GA 2RE1A 3OFHA 1RP5A 2MQOA 2UVUA 1QY7A 3UWTA 2O1PA 3HX9A 4DJBA 5D4PA 4JI3F 3NGKA 1ZAWA 4X62F 5EX0A 2CPHA 1FXDA 1NZAA 2H5EA 3O2IA 4DS4A 2OLWA 1BD6A 3TVKA 3BR8A 4CCHA 2FY1A 3AA9A 4ITSA 4J5OA 5K9FA 3TAQA 5A8RA 3KLEA 1RT5B 2OFGX 2BRKA 2BXJA 4DMZA 1M90T 1YVFA 2IVYA 5C25B 2KVIA 4OL8A 3MMCA 1O0PA 4P2SA 2YWGA 2KYXA 1R8BA 2LECA 1WI6A 4RKUC 1HBNB 5EDWA 2DNNA 2W4CA 3GFHA 1U6FA 1V6HA 3NRBA 2QT7A 3PKYA 1UAWA 3TUJC 3N5FA 3QWPA 3PDNA 3BGUA 2Q79A 4C8NA 5GAGU 3T5JA 4W92B 2C2EA 3HK2A 2XMJA 4FN5A 3VAFA 5I3PA 3LUYA 2NREA 2B5JA 2OFHX 2MQPA 3GFZA 4JV2A 3DLEB 3VTIA 1GAOA 1HPZB 1NNDA 2JOQA 4I2PA 2KT2A 3G6YA 1LW0B 2MB0B 3N0VA 4DSEA 2WBMA 4GKKF 1YRTA 4X84A 3MOZA 2ZHOA 2K2PA 4RLEA 1N6QB 2KKHA 3T9ZA 2MSTA 4QWDA 2VA2A 3I5AA 2JEJA 3QJJA 1RI7A 3HDSA 3CEDA 3SV4A 4DSJA 1P1LA 3FGVA 2AP6A 3I87A 2KYZA 1IQTA 3FJ2A 2XGPA 2F8EX 4BDPA 4Y2KA 3GIIA 4EYHB 3CVKA 1FCAA 1GX5A 3CCQS 4XO0A 1K73T 3AQOA 2E9ZA 2PFFB 4N5SA 2AQ4A 1E6VB 2ZM6F 4ZHRA 2JLFA 4OI1A 4OJHA 1RAJA 3CCWA 1D9AA 3PHEA 5AJ3F 1V3RA 4YDDB 4ED3A 4A8SA 2G4BA 2B4VA 4WZMA 2CRLA 4ECVA 1X4HA 5KFAA 4NLUA 3ISND 3ITHB 4YP3A 3H25A 5F3TA 1CEZA 3IRXA 4OI6A 3DYAA 2IM0A 4D3GA 4KB7A 5B0DA 5KFMA 3GQCA 4MYTA 2HHXA 3LF0A 4C7QA 3Q8RB 5D77A 1XR5A 2ZH1A 2AV5A 4KHRA 3M2RB 4NA3A 4K50A 3LP0B 2VFSA 4FBUA 1IKXA 3DOLA 4IFYA 3OR2A 3M6XA 2QA2A 2YNFA 4DL2A 4H4OA 5L39A 4DV1F 5J1EA 3I55S 4M5DA 3UCUP 1H7WA 2XZWA 4LIWA 4EYIB 3THTA 5DS7A 1B7FA 2ZDPA 2N4DA 2HFNA 3VZHA 1X4EA 3MM9A 4LSNA 5KFOA 2EFOA 5GAHI 4XDDA 4TQSA 4J9OA 5J2QA 1IJFB 5J1PA 2KH9A 4B9UA 4R5PA 4DV3F 4DL0C 2DCLA 3M9OB 4QIWD 2IYGA 4OZJA 4PUOB 2IBOA 4BWMA 1Z1ZA 2J0SD 5A8RB 3E51A 2BM1A 1TKXA 3J7Z5 1RYRA 4MH8A 1U2FA 2VFUA 3AAWB 2ZC4A 3LP2B 3MMCB 4QOTA 3FSIA 4O44A 4BBYA 2ZJPQ 1I1GA 2DPIA 4A4JA 4K2XA 1SIZA 3MMJA 1KQFB 4DR1F 1DZ5A 4IR1A 5BYQA 1QJHA 2JFKA 1C1BA 3CCJS 3HHNB 2MZSA 4KO0A 1VC0A 2A2DA 1FRJA 2D3ZA 4ZDNA 3FDSA 2R7XA 1S10A 1J5OA 1G7CB 3V4MA 1U2RA 1HNVA 2NPFA 1U09A 4DOZA 5GADU 3DLBA 1VQ7S 3MWBA 1XN9A 2B5JB 3SSSA 2V8DA 4H4KA 4QYRA 1MWYA 3CCSS 3CCMS 2LEAA 5AE1A 3J7ZT 1WELA 1VQNS 2NR0A 2ILZA 3KG1A 1YITS 3M6WA 4N56A 5HO4A 2E1MC 2ZHAA 4NZ7A 1JLAB 1WNEA 3R27A 1HI8A 2DTJA 1N5YB 1TP7A 1UA1A 1HHTP 5LXRA 3KK2B 3V5RA 3TAMA 4TLRA 5LJ5Y 1U1KA 3P96A 3SSQA 3IRWP 3R5BA 5KG6A 2XMVA 2Z4PA 2CJAA 3KTQA 1KR4A 4L3NA 2G9OA 4ID5B 2FVSA 3KJVA 2G0CA 3BGLA 1S1VA 3CMAS 1Q7YT 1T05B 2AGQA 4NLVA 3B78A 1UEVA 2HNZA 4HTJA 4DS5A 1BGXT 4QIEA 4BHQA 2MZ1A 3GFXA 3I9ZA 4RW4A 1Y5LB 2QMXA 2YWEA 3H2VE 4P6QA 2XMKA 3LGNA 2J6UA 1CPZA 2EWHA 4ZHRB 4KR0B 4WE1A 2DIVA 5J2MA 1RT7A 1S79A 4KGKA 4I69A 4FBTA 4QPTA 3M8PB 3MI7X 1AXQA 3QWUA 3BDPA 2DR8A 3HHDA 1SH3A 3IRXB 2JEFA 3BEGB 3DYAB 3UNGC 1FJ7A 4NYPA 3BQ1A 4XDCA 3SQGB 2HHUA 3GV5B 3N9UC 2H9ZA 3IAM9 3TVZA 1DQ9A 3C46A 3DN9A 5KOXA 3DI6A 3G86A 4F8RA 4IFYB 3DOLB 3OR2B 2RD5C 4ZPDA 2J5AA 2V9KA 3BR9A 5J1EB 3MM5A 2Q3PA 4M5DB 3NLCA 2HS3A 5CYJA 3CXCR 4DL5A 4ZPWR 2FTRA 4I67A 2VONA 4EO8A 3MECB 2PI5A 2EFVA 2AGOA 4OX8A 1S1TB 2V5HG 2QA1A 1JLEB 3D0HE 4LSNB 3G8SA 5J2QB 2RS8A 3M2VA 2X1BA 4DSIA 4WXWA 1W2IA 2V4QA 2ZH3A 5CXTA 1RT6A 5G0RA 1VK3A 3OTOF 2XC9A 2P5VA 3MHYA 4ZCMA 4UOCA 3NS6A 4NWBA 2R8KA 2MQMA 3DLGA 5KG7A 4Q5VA 4F26A 3PW0A 1FJGF 3MM8A 4PXCA 2NSBA 3DRPA 1T02A 1KFSA 1FTRA 1H7XA 2WK4A 1XNQF 2V8GA 2ASDA 5FIIA 2ZC3A 4EUVA 2E1RA 2DGTA 2RILA 2FLLA 1SQEA 2MQLA 2VBZA 2EBGA 5ADZA 3NS5A 3QMQA 2KJVA 4CT9A 4ES1A 4KO0B 3DC2A 2DH9A 4DL7A 1K1SA 1ZM4A 2BR0A 3GR0A 3CJ0A 1WACA 3FCHA 3V6JA 1Q53A 1J5OB 1Q8LA 1X7VA 3CD7A 5SUHA 2M4MA 2P9EA 5HROB 4DHVA 3QZ7A 4U7UK 4Y0FA 1C4CA 4AYBD 3ZZYA 4DBQA 1OPIA 2P9CA 3QZ8A 5J2PA 2FGOA 3R1HA 4EBDA 3SEOA 2FD2A 4DN9A 4YY3F 2R7UA 2BACA 3HZEA 1CVJA 2XMMA 3PVXA 2E5GA 2OH2A 4UQTA 1VLYA 4C8OA 5KFXA 2MKIA 2EKYA 5F9LA 1A7GE 1N4LA 3MEEA 2HQIA 2QSFA 3F41A 3K8VA 1VBXA 3TAMB 3T5HA 1UMJA 1SV5A 3MAQA 4YDXA 2MZTA 5KFYA 2FIUA 2CQ3A 3AB2B 3KOAA 2CPXA 4WU2A 1NJXA 2O66A 2YQ3A 1UL3A 1KOOA 2DCUB 5L9XA 2V2KA 1YJRA 1D8ZA 3C8YA 1GXUA 3MMAA 2VG6A 2NUUG 4RW4B 1U1QA 3DLKA 3PACA 4I7FA 1BLUA 1U8SA 2KXHA 2O01C 4FNHA 2CQBA 2LLZA 4ZCLA 1KHWA 1WEXA 4I6AA 3IFEA 2J9EA 4QU7A 1URRA 2HVZA 1XR7A 3QO9A 5C24B 1RK8A 4B9MA 1XMBA 1Y00A 4DPOA 2KXNB 2OPQB 3AJ2A 5IWAF 3OQ2A 1SH2A 4MIWA 3GYXB 2BDPA 4YFUA 2X51A 3DRRA 3QJLA 2YWKA 3M2UA 5F3ZA 3GYNA 3MEKA 5EWEA 3HVAA 3DMJA 2R7RA 1HWIA 2RF2B 3DI6B 5B7WA 1C0TB 1VIXA 1FEEA 1S1WA 2MHEA 1GTHA 1FTCA 1S49A 4R0JA 1KRPA 3TARA 2A10A 3CPWR 1TUVA 4RBUA 4ATNA 2YY3A 5HLFA 2C3UA 4JV1A 4AQYF 1Z2ZA 5B09A 5KOWA 4J37A 1XK8A 5C5JA 1UJ6A 4ED1A 1HNZF 2ZVSA 1Y3JA 2JDJA 5EUHA 1RT6B 4PG6A 2ZOFA 3UCGA 4TQRA 1XEZA 3CCUS 3MEGA 1MU2B 3AA8A 3V6HA 3MM8B 3DRPB 5LXYA 1X4BA 2MKHA 4H4KC 2ROGA 4PXDA 4RUHA 3E2EA 3OFGA 2L48A 4DF8A 2JLEA 1RTDA 3I0SB 3CMES 3PO5A 5D4NA 1Q82T 2R4FA 4TU9A 4RZRA 1DQAA 3CJKA 1Y7PA 3NAHA 5I4MA 1S1XA 4JV5F 2F9JA 3T3FA 2AJ1A 2M0GB 1N88A 1NHUA 2VV5A 4H4MA 4ZOSA 3VAKA 3ETOA 1ZM3A 3CJ3A 3NMRA 3DDKA 3KYLA 3PY8A 3SSRA 3R1LA 1JLGA 4JOUA 5J2PB 4AFFA 1LWCB 3HVTA 3M8QA 4KV8B 1ZETA 4WZQA 3G6ES 4MKBA 3D1HA 1FNOA 3TO8A 5I3UA 4JI8F 3S8SA 2L9WA 1IBLF 4HDGA 2YKMA 4LUBA 1KSPA 3MEEB 2FC8A 2ACYA 2BE2A 2J9DA 5FLXY 4PRFA 1SV5B 1WG5A 5KFRA 4DF4A 4F4WA 5E3AA 3TRGA 2GQQA 5BYRA 1UA0A 2EFQA 4B3OA 5JXSA 2I5JB 4CTAA 4TY9A 5HP1A 1J5EF 4C4WA 3OL6A 4DLGA 3GB0A 2IM2A 2WCXA 3HHLA 2AYEA 1BQMB 2XMWA 1L3SA 5KT3A 3MMAB 5KFPA 3KLGA 3I5CA 3R5CA 4OHXA 3RR7A 4Y2MA 4FNIA 3MMBA 4AL5A 2W4DA 2E7WA 2CPIA 3SMZA 2ZH7A 4CNZA 4KJIA 3GR1A 1N0UA 2DH7A 4IG3A 4B02A 3MZIA 2AX0A 5DRKA 4Z2XA 3NGDA 4O3SA 5J2NA 3CIZA 2C2DA 3O3LA 3KMSA 3G9CA 2XGQA 2VUGA 4YR0A 2IVMA 2DGXA 3M6UA 5CH7B 1HR0F 1SJQA 1UWBA 1X4AA 1GXLA 2E5JA 3M2UB 1HBMA 4M63A 5GAHU 4FPRA 2FJXA 4RWWA 4Y2AA 3DMJB 4HH1A 3SDEA 2J6TA 1PILA 1YI2S 4IRCA 1VQYA 2ZUGA 3FMWA 1WWHA 2V4RA 3VAGA 1K8AT 2F8MA 4QR2A 1S1WB 3E01B 3J80Y 2EG1A 5HBMA 3CDUA 1UJ5A 3D0GE 3PEJA 4EGLA 5KFEA 1JKHB 4A8OA 1WTFA 4ILLA 2R7TA 5AXNA 5KFLA 1DBDA 1FT8A 4A8FA 1WHVA 2N4CA 4NZ0A 4OI3A 3TR5A 4F50A 1QLNA 3DNCA 2NZ4A 2Y0SD 2GO8A 3M8RA 1LK7A 1SC6A 2P9GA 1DTQA 2HLUA 1JLQA 2YNGA 3MEGB 1M5PC 2UUBF 3SZ2A 1FD2A 4G1PA 4OLPA 2V4JA 5E3CA 1H38A 1HHSA 2N82B 2AD9A 2WOMA 1Q8BA 3TI0A 1K1QA 4B9NA 2W7PA 4FS1A 1RJJA 5LMNF 1RTDB 2M88A 1RT5A 3MTJA 1X8DA 1ZPWX 4RU2A 5CA5A 3VAIA 1ZOTA 2W8LA 2AU0A 1X4FA 3UR0A 2VQFF 3CJKB 1NKBA 2D41A 3A8EA 5KFFA 4RNFA 1S1XB 4ZPCA 1UW4A 1W25A 2K3KA 1WD6A 4RNHA 1HBNA 4H4MB 4OV1A 4X4PA 2IMWP 4DLEA 3HVWA 3NAIA 1NK9A 1RQ0A 4KKOB 2XULA 2UUWA 2CPYA 3MUMP 3HVTB 4AL7A 4QR0A 1R27B 1V9OA 2JC1A 5I3UB 1UVJA 1VQMS 2MPUA 3PM9A 2BJDA 2YKMB 3HHEA 1S6QA 3CD6S 3DLEA 2XI3A 2ZH4A 3NNHA 1AROP 1L3KA 3KK3B 3NBPB 2ZH6A 4YB1P 5J1NA 3BQ0A 3RW7A 1LW0A 4MIBA 4NX9A 5F8GA 2KRBA 5HP1B 2PC6A 1JMTA 3BN7A 5AE2A 2RDJA 1T03A 1RA6A 1N32F 1WTBA 5GMKa 4B9TA 5L1LA 2NXUA 2ZZNA 2QSWA 2N3OA 5E41A 1U1OA 1U48A 1URNA 2XBPA 3RRKA 5KFGA 5B0AA 3IWNC 3RB6A 1YRXA 2E1CA 2LU2A 1R8CA 2HWHA 5L9NA 2AJ4A 3OLBA