5A76A

Kshv lana (orf73) c-terminal domain, open non-ring conformation: orthorhombic crystal form
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
117
structure length
109
Chain Sequence
AKARPQHIFYRRFLGKDGRPKCQWKFAVIFWGNDPYGLKKLSQAFQFGGVKAGPVSCLPHPITYCVYVYCQNKDTSKKVQMARLAWEASHPLAGNLQSSIVKFKKPLPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ORF 73
publication title Kshv But not Mhv-68 Lana Induces a Strong Bend Upon Binding to Terminal Repeat Viral DNA.
pubmed doi rcsb
source organism Human herpesvirus 8
molecule tags Dna binding protein
total genus 26
structure length 109
sequence length 117
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2015-07-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.390 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Epstein Barr virus nuclear antigen-1, DNA-binding domain 5a76A00
4UZBA 4K2JA 1VHIA 5A76A 4BLGA 2YQ0A 1B3TA 2YPZA 2YQ1A 4UZCA 2YPYA
chains in the Genus database with same CATH superfamily
4QYZJ 4CCHA 5ETPA 1ZYQA 2YQ1A 3V4IB 1B7FA 3CCLS 5A8KA 4LF6F 3AQPA 4H54A 3PW7A 4AQYJ 1CJTA 4C0OC 2HGMA 2CG8A 2HFUA 2HFOA 1URRA 4WIIA 5IC4B 1HL6A 2YPZA 4USIA 3CJSA 2DRDA 2N3LA 1S1XA 3U1MA 2UUWA 3ISND 1KP6A 4W92B 4DR4J 2QLWA 3M9OB 2VDHA 3OFEA 1NSKL 3OTOJ 4WKRA 4O4RA 2XS2A 2FLLA 5KFPA 1AZSA 1RGVA 3BSCA 4IOCQ 5C42B 5KT7A 3DLEA 2ROEA 3JAMY 1SJ4P 5D4OA 4DR7F 3HULA 1EQMA 5ETOA 4TVAB 5IT9U 2FJBB 1D9DA 2W9CA 3Q8RB 2IM1A 2RS8A 4WXOA 2A0FB 2XWXA 3I0SA 4JI3F 1F2GA 2E7WA 5IC6B 1M5OC 4NZ7A 1VQ5S 4OL8A 2IYGA 3CCWA 4ERDA 3LPYA 2OFGX 3QFWA 3NNHA 4F8RA 2CDRB 4DPWA 4OYMA 2XYHB 1RHQB 3VQTA 4F04B 3KJQB 3CPWR 2EBGA 2HFVA 2JWNA 4Y65A 1JLEA 3AAWB 3AQOA 4ATNA 5DETA 2XLKA 1Q86T 1YI2S 2AHOB 3MMCA 2AEMA 1H98A 4ID5B 2I8EA 2IC3A 4NZ0A 5IQQA 4J9RA 1IKVB 4WK1A 5E3AA 2BJ1A 2ZE2B 1U25A 4OJHA 1GH8A 3UWTA 2JDJA 3AH6A 2FHOB 2Y1IA 7FDRA 1I51B 1RI7A 3R9LA 1UMJA 4MKAA 4KPCA 1U45A 4DOZA 3CVKA 4CZCA 2YH1A 2B8PA 4WE1B 2HVEA 2AZ3A 4W4MA 1C0TB 2CPYA 4KE5A 2CNOB 1XR7A 1X4GA 1PAEX 3GMGA 1CC8A 3Q86A 3TAMB 2RDJA 2M70A 3G8SA 1BC6A 5HLFA 5FLXY 1KTVA 2EC0A 3H5YA 3MGJA 2PD1A 2ZDPA 4D3GA 3LP0B 3N5BA 2ZH4A 3FCWA 4DL4A 3EDRB 5I4MA 6FDRA 1S1XB 3OQ2A 2V8GA 2QEXS 1DARA 1FI4A 3NKYA 3SFGA 5GAHI 3FMWA 2OPSA 1FDAA 3ETOA 1OSDA 2QL9B 2E5LJ 1HW9A 3CDAA 4F3MA 7AT1B 4JV2A 1GT8A 3HFKA 3HT3A 5D77A 1HNZF 5G4DA 1HW8A 3HX9A 1REGX 3GE9A 3RU0A 4BHQA 4LFAJ 1B99A 1WG1A 2EW9A 2IPOB 3Q22A 3MTKA 1KWMA 2W9CB 1KEKA 1Q82T 1Q4RA 4I2QA 1ZA2B 3IRXA 2MSTA 1LFWA 3M8QA 5H9FJ 4C3LA 2V4JA 5CYQA 2HQFA 1B3TA 4HVZA 2B7CB 2WCXA 2WOMA 3SQGA 3W5XA 2WZ1A 4HDHA 4IQMA 1AUSL 3ZO7A 2D74B 3KLGA 3OFFA 1S59A 2H3EB 2BE9B 2WHOA 1H3DA 5KFNA 2NQPA 2BKNA 5J2NA 2AEJA 2BJ3A 3J7YU 5KFGA 1WKKA 4KHPJ 1HHQA 3N28A 3RB0A 3S01A 4PQAA 1NJIT 1FFWB 4OZNA 3D7SB 2WB4A 3MF5A 3RTVA 2W9AA 3NWGA 1MWQA 4L6V3 3E01B 4NLUA 4EZ9A 4EMDA 2GMLA 2QG9B 4NE9C 4KIAA 1S1VA 2CPEA 1K47A 2RKIA 2XGPA 2GJFA 2PE8A 1S9GA 2ZH1A 2DEIA 2QT7A 5KOWA 2HGLA 3BKTA 3G2XA 5F8GA 2MQPA 3HFZB 2APOA 4TYAA 2KM8B 4ECTA 2HSEB 4PR6A 1S1WA 5LXRA 2E66A 1JX4A 1CJKB 4C2MA 3PW5A 2BA9A 5HQMA 1U6BA 1X31C 2F4VJ 1AW0A 3OTDA 3FBBA 2K3KA 5LOQA 2LMIA 3LP2A 3G71S 2M52A 2LQJA 3US5A 2AV5A 3H5SA 3DC2A 2YKAA 2F9DA 3OL6A 1KSPA 1WKLA 3MPVA 1ZZNA 1MU2A 4OX8A 4EFAC 2UUBJ 2KTQA 4WJBA 5F8JA 2V5HG 1DQ8A 4PG6A 3H2UB 3ICLA 4U67Q 1NKEA 3IBFB 1H2VZ 4KH0B 4ED4A 2JLGA 2V6AA 1TFYA 1T11A 3ZZPA 1GTEA 1FO1A 3MAAA 5A8RA 4DV0J 3BBBA 3UNYA 3CCQS 1FNOA 2HQDA 1RHUB 4AUKA 1KRPA 3HJFA 4ES2A 1MMNA 1U7LA 1N0UA 1JLBA 2R2UA 3CGIA 4S0MA 1S1UA 3SFUA 2CYYA 2B4OA 3HVTB 3V5RA 1PJ7A 1CG2A 5HQLA 2DJWA 3O44A 4A8XA 3Q83A 3DOLA 4YQWA 2I0XA 4NLOA 4UY85 4O3OA 4F4ZA 3DHWC 2DBBA 4B9UA 2CPDA 3SXLA 3IRXB 1SJQA 2WAQD 2W4PA 2IJFA 1FRMA 3AODA 5C24A 2HNDA 2J9EA 3K58A 4I2PB 2VOOA 3SQGB 4P2FA 3EZUA 4YUDA 3TX8A 1X0FA 1UTAA 2BQRA 4P2SA 4M5NA 4RNHA 1ZBTA 1WWHA 4U8VA 1KN6A 2FJWA 4Q5VA 4NZ6A 5KG6A 1HNXJ 2MGZA 5HMYA 1OS5A 3EJMA 1HARA 2MY7A 3PRDA 5E41A 3DXSX 5D4PA 4PRFA 1TQLA 1X4EA 2RS2A 4NYZA 3ITHA 1TL1B 4D3HA 3PX4A 2BACA 3D3BJ 2J0QD 1XMQJ 3NGDA 3TANA 1UW9A 1S9EB 1DTQA 4QPXA 1T94A 1N5QA 2VKZG 5C5JA 4ED6A 1S9GB 3CCJS 1TKTB 2R3VA 1BQNB 4LBPA 1M90T 1QE1A 1N5SA 1U6ZA 5KG5A 4CO0A 3RGIA 5GAGI 2UUCF 3VGVA 1U1OA 4KPYA 3CCZA 5B08A 2KKHA 3ZZTA 3LUYA 3G86A 2GMJA 4AXIA 4C3KA 4ZDNA 3RYLA 2A1BA 4ZMMA 1WHYA 1KHVA 3KOAA 3IR5B 2KYZA 1PKUA 3UE2A 4C8KA 3H4BA 3DLKA 1HWIA 4WWSA 4RNOA 3IR6B 2FUG9 2LXIA 3R1HA 1UPMB 2HMIA 2C42A 2CVIA 3WQPA 2AX0A 1TFWA 1RWUA 1RDRA 1NK7A 2JEJA 2RHQB 3NEKA 1MU2B 4XPCA 3ZZZA 3UCGA 1YG0A 4CTAA 4LF8J 1QVGR 4DF4A 1EAYC 1T02A 2AGQA 1UETA 4OZ2A 2F7VA 5LMUJ 3OV7A 1Q5YA 1KOOA 5IFMA 1VHFA 1TV6B 4EUVA 3BYRA 3TZXA 1RWPB 1ZOTA 2LQBA 3VAGA 1LV5A 2H5EA 3CJ8A 1JQGA 1DJ0A 2C3UA 1N5YB 1HBMA 2ZNZA 1V5IB 3OFGA 3V6DA 2G1DA 1RE1B 1RTZA 4B9SA 3UR3C 1JXLA 4A8SA 4N8OA 4YN3B 3SIPB 2VFTA 4DFJA 5ETTA 1VC5A 1FXRA 4JI4J 3QMQA 3BS9A 1NJYA 4OYBA 4CIOA 3RG6A 2Z0GA 2KB2A 1RT1A 1VLOA 3FBCA 1NSAA 4U6PA 1FDDA 4YR3A 2ZH7A 5B0EA 4WXWA 3BGFA 1TUGB 4X84A 2Q43A 4ZVPB 5KAKA 1XIQA 3C15A 2H4YB 4F3QA 3TZWA 5C25A 2DKOB 3POTB 2VZ9A 5KFRA 1CQMA 3W1YC 3H0PA 4CLUA 1QAJA 3ZZYA 3B4MA 1PBUA 4Y2CA 4FNIA 1NRKA 2R7QA 1RT3B 3N6MA 1AFJA 3HPOA 1V6HA 5LSOA 2MYFA 3OJUA 3U1LA 2JFKA 1K73T 4FF3A 2DR7A 1P1TA 2U1AA 4ZLPA 2FZGB 3GIMA 1U2RA 2ACMA 1XERA 3S1TA 4B3SF 4PPDA 2GIRA 4CO5A 2C2MB 2LCWA 4BC9A 2CXEA 2NXUA 1JMTA 1WG5A 2ZBIA 2QFJA 4YEAA 1S4FA 3PJWA 5A76A 2FTRA 4RLEA 2G0IA 3W9IA 3PKYA 1N6QB 5C2GA 2R2SA 5AT1B 1RBAA 2XHCA 3Q2SC 1NPRA 5DDOC 1YQHA 1JLGA 3F0NA 3RBDA 2V34A 3OR1A 4OZJA 3QO9A 4I6YA 1S48A 1HQEB 3CCTA 2J9DA 1AYEA 2FC8A 4DR6J 4NCAA 1BQMA 4F36A 4ZPDA 5KFVA 3W2VA 3GYGA 1MG7A 1WC6A 2PFFB 2NPFA 2CFXA 1K1QA 2RF2A 3O6QA 4DUYJ 5J2QB 2YX1A 3GG1A 4R8UA 5ETVA 5IXUA 1KNZA 3R97A 3SMZA 2BQ3A 2PO4A 2R7RA 3Q0AA 1HR0J 2FLNA 2NPIA 2VG6B 5D4NA 2DR9A 3ZZRA 4CLFA 1EP4B 2XMKA 3HKWA 3I5CA 1NK8A 3KMSA 1WNEA 2C2ZB 4M1KA 1RT2A 4L73A 2ZOMA 2ZITA 2AJFE 2FYXA 1F2HA 3AFGA 2VUGA 3V6DB 2MZTA 8AT1B 2VA3A 2ZZTA 3EX7B 4M5HA 2R4FA 1UVIA 4NASA 1HBOA 3MI7X 3MMJA 1NK4A 5EX3A 1RTHB 3C66A 3PZPA 2I2YA 3QAEA 3DGPB 3CB4A 3ZTSA 3G6XA 3PJ9A 5BYSA 4X4RA 4TLRA 4RBVA 2ZM6J 3H20A 2YNGB 4BWMA 3LOUA 3KDOA 4OI2A 3W65A 3SBMA 4DV1F 1E6YA 4YS2A 1T8EA 3QGGA 2KT5A 3A3NB 5AXMA 1FT8A 2IAJB 3FGVA 2K2PA 4RWWA 1X4FA 4ZOSA 1XNRJ 1X5PA 3HHKA 2EC2A 4IOBA 3O3LA 3FQLA 3FJ2A 2NYIA 3I96A 2E7XA 3BF4A 1KFSA 2OKQA 4PXDA 4Z7CA 4KKOB 3N0VA 3Q2TC 2KZMA 2XM3A 1Y3JA 3T6BA 2PEBA 3K8WA 2DK2A 2RVJA 2DPJA 2WONB 2MLZA 5DG9A 4WYLA 4F0HA 3C6UA 1HPZB 2H4WB 1WEYA 1KVJA 3VV2B 4F25A 4DV2F 1B0VA 2HHVA 1WOOA 3C6TA 4NRTA 2ZHBA 2XTJP 1C1BB 2FJAB 2LECA 2O67A 1SUQA 1S6PA 4JV5J 2HYIB 4A46A 2HVDA 1U1NA 1JLGB 4OLOA 4RU9A 1SH2A 4NLDA 4ZPBA 2J0SD 2E9ZA 4CO4A 1KVKA 4AYBD 2B5JA 3MTJA 2HNYA 4EU0A 1UA1A 4K4YA 2J7WA 3PYEA 2HS3A 4DSIA 1SB6A 5K20B 1YJUA 2RF2B 1WC4A 5A8WA 3HSGA 1F0XA 4OI6A 4G3IA 1MROA 1XWLA 5CZVA 1FRHA 2F8MA 2J8SA 3THPA 1TL5A 1KBRA 3HHLB 1WI8A 5GAEI 4B9NA 4MH8A 2C1EB 3HD2A 2CG4A 2CQHA 3UCUP 3HVWA 4ZPVR 3JXOA 1RHRB 1YITS 4B3TJ 1Y9OA 4U8YA 1SH0A 1VK8A 3LH2S 1Z1ZA 1O8BA 1O6XA 5CA5A 2UUAJ 5KFXA 5JXSA 4ECUA 3MM8A 1RAEB 2VBZA 1FF2A 4CI0B 4Q0BB 1YBUA 1U1PA 1VC0A 2QIFA 4PYDA 1S97A 2QSFA 1F9EB 2Z2YB 5ETSA 1HBNA 2KL8A 4QIWD 4IRCA 3JSMB 4O3RA 2ASDA 2JX2A 2VOPA 2HWIA 4DU8A 3J7ZT 4PKDB 4F4YA 4J9LA 2ZH8A 1S1TB 3MEDB 4W98A 3BH7B 4LF9J 4X64F 5ETMA 1P6TA 2LVWA 1S4EA 1U1KA 1L3UA 1N34F 3HZEA 4YR2A 3CJ4A 2MXYA 5IT9Y 3RRHA 2EFQA 1FXLA 3HO1A 2HIYA 4V1Ak 3PHTA 1DTTB 2RQ4A 1E6VA 2XHWA 1WDDA 2EG2A 4CM2A 3HFVA 2VHGA 3B8HA 5HAOA 2IM3A 2V67A 4FZVA 1S0NA 2MQQA 3IWXA 5HI7A 2HEKA 2B9WA 5MAOA 3L7UA 5IZHA 4WBFA 3LP1A 4HHHA 4DR7J 3C16B 4X66F 3VWSA 2GGPA 2B5JB 1FRLA 1JLCB 4ZVUB 5ETQA 1U0SA 4OJ1A 2UXCJ 1R3NA 5B09A 4ZPAA 1RWVB 4DQIA 3W60A 2MB0B 3M9NB 2Y9HA 5A8WB 2KM8C 2LKZA 5C2CA 5HP1B 1SJRA 1MROB 5D8HB 2PI4A 2OSRA 3S6EA 3HCXA 4G1QB 3HI9A 1T03A 2B4UA 2QA4S 4RW4A 1KHWA 2MQ8A 3OLAA 3KLFA 4LF4J 3CD0A 2AYGA 2MQOA 1NZAA 2R7XA 3H40A 1C1CB 2BV3A 3DI6A 2OPQA 2KXHA 3S7RA 4K4SA 2HK3A 2VPYB 5I42B 4L75A 4Y6IA 2E9RX 2RAQA 2HBZB 3K17A 4UOGA 5L1KA 1U8SA 4PG7A 3IWLA 1NBEB 2AJ0A 4P52A 1UJ4A 3OVAA 4DJBA 5HROB 4EBDA 3TA2A 2WSFC 2GS8A 5B0DA 3VVTA 1WF1A 3W5ZA 2IVFB 4EEYA 1GMWD 3EUNA 4IYQA 3BBFA 4LF5F 2HLTA 4F67A 1SC6A 1KOHA 5HK4A 1HBNB 3SCLE 5CCMA 1U1QA 2ZZNA 3D2WA 1RBLA 1J5EF 2YNHB 1F5AA 2BJ7A 2LXFA 3TWZA 4DMZA 1Z4UA 3NRBA 1W26A 3AT1B 4A4JA 5KOXA 3JAMU 1KVIA 2YX7A 4EBEA 2F40A 5F41A 2ASLA 3T41A 3QGHA 3GILA 1YZ6A 3I9V9 3SI8A 4DR3F 4GKKJ 1CULB 2W25A 4B3MF 1L3VA 2ZJPQ 5F8MA 3NOGA 3PKMA 1M1GA 4X65J 3UVJB 3IS9A 5DS7A 1VRQC 3T3FA 1B0PA 3J81j 5KFIA 2V94A 4PXBA 3JB9k 4GO7X 1QJHA 5KG4A 3GV7B 2IVYA 4LIWA 2XY6A 2YWWA 2MTLA 2IJRA 4JBCA 3MOJB 3BPDA 4NXNF 2Q3PA 1XNQJ 3MR7A 3IO1A 5J1PA 3BH6B 3I82A 3VAMA 3FC9A 2BBEA 3LP1B 4PABA 5AE2A 4HTJA 2LU1A 4DN0A 4DQQA 4TYBA 4DFKA 4K0KF 1NDCA 3FEXB 2DIUA 5B7WA 5J2PA 3R3TA 2J7KA 3MEEA 3EWGA 2HAIA 1MWYA 2RU3A 1N33F 3DMJB 3MM6A 2ZOGA 3EZOA 4MFBB 2OH2A 1IKWA 3HXMA 2LA6A 2FJDB 3PEJA 4QYZK 4YB6A 4FYDA 1JLQA 2W8LA 1EETB 4C8LA 3NY0A 2D9PA 4JYAJ 2WVCA 2D1CA 3I5BA 3CJTA 4FDFA 1SVDA 1WORA 3D1QA 2GVDB 2VFSA 5D4LA 4A8WA 1YX2A 2BJEA 1RHKB 3DXBA 1VRTB 1Q16B 3MFHA 3WX4A 8ATCB 3R8YA 1RZMA 2OPQB 3UDLA 5K8MA 2CQGA 5FLXU 2MDAA 1BE4A 5D3GB 2AYBA 2MQNA 2UXDF 4WP3A 3QBCA 5F8NA 1NSPA 2RRBA 5T7LB 4Z2XA 4NXMF 3GJSB 2HFZA 5KFKA 1EKRA 3D0IE 5ETNA 5I3UA 3SSQA 1CQNA 4EO6A 4CLZA 5E2QA 1VQSA 4C6AA 3KJVB 3PDNA 3G96A 4ZVGA 3RBEA 4M8LA 3NAHA 2CNNB 3QWUA 1FVQA 4P75A 2EFGA 3CCES 2E29A 1LWEB 3HVRA 3GV5B 2NXJA 2ZH9A 1K0VA 2C2RA 1TKXA 4DI6A 1DFDA 1R8BA 1Y3KA 4C0HA 5M2RA 3PACA 2HWTA 3EDQB 4I1TA 4IFVA 5DZ6A 2YQ0A 4CP5A 3QWPA 4RL1A 2MKCA 4WPAA 5JVHQ 1GNKA 4ZN3A 3BN4A 3H5XA 3AA9A 4WFAQ 3H90A 4PG8A 1UAWA 4ECSA 2N7CA 2M4MA 4U95A 1FK9A 2XBPA 3QRRA 4XPEA 2AJ4A 4RUBA 2VJVA 3MMBB 1Q7LB 3BGRB 4IH7A 1WC3A 2YWHA 1BGXT 4LQ3A 1ZPWX 1T9WA 1J27A 1VGYA 4N47A 1WC1A 4FPIA 3ZNJ1 4MKYA 1S7HA 3GG0A 5IWAJ 2LQ9A 1EX8A 2VF3A 3QZ7A 4NMLA 4U9RA 3AB2B 2AP6A 1RAJA 2DCUB 5J2PB 1JJ2R 1S6OA 1JWWA 2V8PA 2AU0A 4ER8A 4X62J 1U49A 2C3OA 2OFHX 4DQSA 5D0EA 1TK5A 3MM6B 1PG5B 5E5NA 4LRFA 1F6TA 4B9VA 3J7A1 1GX6A 2ROGA 1FRJA 3TZYA 2E1MC 4TY8B 3HKZD 3OXGA 1JLQB 4IR1A 4OMFG 4OQJA 5GMEA 3W5YA 3L9ZA 3OPKA 3R5JB 4KHRA 1UWAA 2WRMA 3JSYA 4JI6F 4NLTA 1M1KT 1HHTP 1ZAVA 1SL0A 1NH8A 1HWLA 5KFYA 5FDLA 3ZNUA 1R43A 1PILA 2PSZA 3DLJA 2V2VA 4U96A 3LANA 1SXLA 4LVNP 3E2EA 3OD2A 2G1HA 2VG5A 1RAHB 2VA2A 4DR5J 4BS2A 1OQ3A 2MZRA 4H4OB 2JSXA 2GAHC 1BWVA 3ZZ0A 4P72A 4RW8A 3M32B 1DLOA 4HI2A 3TX0A 2IYIA 3MDFA 1P9YA 1HYSB 3A8IA 3ENWA 5K14A 1UFKA 4ES3A 2PN6A 2UU9F 1T3NA 4JI0J 2Q6BA 4DX8H 5KFZA 2C3MA 4OX9F 1CJUB 3CCUS 2CJYB 3FSYA 2VIHA 5H9FK 3HM9A 1SIZA 4NCBA 3VGTA 1RTJA 1TVRB 2BW7A 3M30A 4IFVB 4ZS6A 2YH0A 5A6WA 2GIFA 3B4DA 3P8BB 4RKUC 4LSNA 4KGKA 4J9SA 3DNCA 2ZD1A 1XC9A 4OX6A 3CO9A 1MMLA 4G65A 3BPSP 2CNLB 4U7CA 3MECA 3V2UC 1R27B 2HNZB 3CULA 2NZCA 1TKZA 3ISZA 5CYMB 4DV7F 3GSDA 5ETKA 1UJ6A 1RXOB 4CNYA 2ZDOA 4C4WA 3IG1A 3A3OB 9ATCB 4O3SA 1N56A 4RNMA 4CO3A 3UO0A 3IA0A 1WSVA 2CAJA 1H74A 4DG1A 3T1YF 4K4UA 4K4WA 4DN9A 1B64A 5ETLA 2X3GA 1N5VA 5HANA 2DGOA 3VF0B 4AXJA 5GADU 3PCOB 3BO2A 3CJ5A 5CZXA 3DOKA 4XIUA 3FFIB 3DLGA 4Y2MA 3OR2A 2BR0A 1NPPA 1DRZA 2RQCA 4ZIWA 4USJC 1FHTA 2BE7D 2NLWA 2FLPA 3OT9A 3DYAA 2XEXA 2ZKTA 2B9EA 1H72C 1VQ4S 1IBLF 1X4CA 3LWLA 4KO0B 2PIIA 1FEHA 2GQ2A 4GVBB 1D09B 3CJQA 4PYAA 4BC7A 2KYXA 1CVJA 2DRAA 2DRBA 2E44A 2Z56B 1LFPA 1N5TA 4IDKA 4A47A 3EXCX 4KGVB 3L95X 3NOCA 5FDLB 4RZRA 3CMQA 1U47A 2JEFA 1VBKA 2BM0A 3FK4A 4UOHA 2ASYA 4RO0A 3UN2A 4EZ6A 3GB0A 4B3OA 1VISA 3ET6B 1IBMJ 2V4QA 3W64A 2VG5B 4J9QA 1HWUA 1Z2ZA 1S10A 1VQNS 4WCEQ 3NCRA 2VQFJ 5KFDA 2XC9A 1HBUA 3QT6A 2CPIA 1FX2A 3QJJA 4YY3F 2NREA 2QX0A 1X9WA 4WKYA 4WP9A 1GXLA 4FBTA 4UOCA 3CT9A 4ZP8A 3P3DA 1NK9A 3HHLC 2XCPA 2LU2A 2DY9A 2VC1A 2UVUA 3SSRA 2ZH5A 2R7TA 4FS2A 3D0HE 3CW2C 2QRRA 3D6HB 2CA9A 1HNIA 3G82A 2JNJA 5BYRA 3CCRS 4ETZA 5CHCB 3RB3A 3MXHP 2ZH6A 2OTJS 4HH0A 2COLA 2FLOA 2DCLA 1KTQA 3TRGA 4DR1J 2GO9A 1H38A 2MKIA 2Y1LB 4ES1A 2P9EA 2ZH3A 3HK2A 1DZ5A 1REVB 1YTYA 1UL3A 4URSA 3VVUA 3QT5A 2M5YA 1P9QC 3A4TA 3DGVA 4DG1B 5L1JA 4OHWA 3W62A 1LW0B 1N52B 1RT6B 5SUHA 3PR5B 3V6HA 2OPRA 1CEZA 3SV4A 3DOKB 3EGWB 2VQEF 1X4AA 5AE1A 4ED5A 1OY9A 1HMVA 1ELOA 2KI2A 4DU7A 2IRXA 3EZ5A 2BE2A 3QJLA 3LGNA 3DYAB 3L7PA 4O3PA 5KFSA 3EYZA 2HVZA 2C2NA 2D7SA 2KU7A 3MWBA 3QPIA 2WBRA 2Z58B 1RJJA 3M8PA 3PIPQ 2AEFA 1G7CB 1VJWA 1QY7A 3QT8A 4NLYA 4YHHJ 4ED7A 4K7QA 1Q53A 3A8KA 2OD4A 1NHKL 1HD1A 4X2BA 2RT3A 1T7PA 3PG9A 2J7UA 1HI8A 1RP5A 2XB2D 1OYEA 1TL3A 3WBZA 1FTCA 2KO1A 1HI0P 3MPWA 2FVRA 1SPBP 4OZ3A 2MMYA 3DRSB 4WFZA 5AXKA 1O0PA 2C2OB 4YB1P 2GHWA 2ZBQA 2BDPA 4WU3A 2EPIA 3N9UC 1RQ0A 1VQLS 4O3NA 3KK1B 1OJ4A 3CEDA 2PFDA 3B54A 3KLEB 1H6KX 5DGAA 1KLMA 4DV2J 2HS4A 5HJYA 4GKJJ 4PG4A 4YFUA 2YNIA 2UV8A 7FD1A 2IM0A 3SZ2A 4USWA 2QA4G 2H5JB 4DV6F 3NMRA 5DQHA 4IG0B 3BYPA 4KV8B 1ULRA 1S9FA 1EZZB 1CJVA 1T9UA 3M8YA 1RTDA 2QL7B 4KYZA 3KJFB 2YKMB 3CJ2A 3H8YA 3PYFA 4F02A 4ZP7A 2JOQA 1SKWA 1HNIB 2GC8A 3MEKA 2DITA 1RWWB 1F5BA 4CYUA 4AQYF 3NMAA 1LWXA 3X1LB 4F50A 3GJQB 3CJ3A 1H7WA 3MAQA 3THTA 1XTZA 1JB0C 2EKNA 1KR4A 1FEEA 2F8HA 2CZVC 5F8LA 3LALA 4GMKA 2ZNYA 2XYGB 2E5JA 1UWBA 5B0CA 4WTYA 4DR4F 5GVQA 2W8KA 3RW6A 3K2YA 2DNYA 3O1LA 5H1SV 1KDNA 3O8WA 3OUYA 3PM9A 1U48A 4TLQA 4PEOA 3WZ0A 2OSQA 1KKHA 3OHAA 1Q5VA 1VBXA 3ONQA 1Q1KA 1PC5A 4Y0FA 4DX6A 4I56A 2B4VA 2PMHA 1RADB 1FKOB 3R1LA 2VBWA 4L3KA 2H54B 3PV8A 3C14B 4LSLB 2A3JA 4NPOA 1S79A 2JEIA 5EWGA 2FQQB 4O4GB 2VPXB 2G4BA 1G6BA 4AD6A 1PJ5A 2BE2B 1XR5A 4RBTA 3MHYA 4CWBA 4HL9A 4LF7F 2VC0A 1LNQA 4K5RA 2DGUA 4PCQA 4ZVTB 2QN6B 4YB5A 1CBKA 3BZQA 3I87A 2YKQA 2W2PP 3V81A 1WUUA 4ZN1A 4UT4A 3CD5A 4L76A 1XBWA 2MJUA 2YWKA 4EWTA 4C11A 1J5OB 4PZVA 1HI1A 1WHXA 3M2RB 2MHNA 4NLSA 2Y0BB 4M5DA 1IXKA 4HI1A 3KNAA 3OSNA 5IM0B 3CJKB 3IXQA 1N34J 3M8RA 1V5VA 2K3IA 3UW1A 4ZA1A 4FYWB 1SC4B 1ZAXA 1T95A 2UXBF 2HPUA 1FD8A 5J1EB 1UKUA 3KLIA 3BEGB 1X8DA 2E1AA 1LWCA 5LJ3Y 2VG7B 4DUZJ 3D54A 2KRBA 1MWZA 1RHJB 1R6YA 2F8EX 2DO4A 2I5JB 1DHMA 2A6MA 3QNWB 3KFWX 3FRZA 1RT4B 4QJVA 1RA6A 1SV5B 1NHVA 2EK6A 2L9WA 4X66J 4DPOA 2WW8A 1NCLA 1F9HA 2DISA 3M8WA 1YJNS 4FVCA 4MK9A 5J2MA 5E3CA 4ELVA 2BANB 2OUGA 4DCOB 1FJGF 2PA8D 3M1VA 3TOQA 3ZTOA 5I3PA 3GSIA 4N76A 3SV3A 2UVWA 1XEZA 1CSJA 4OYIA 3I0RB 1C2PA 3DRRB 4CH0S 3D9BA 3VZHA 3ZFVA 4DSEA 2X3DA 4B9TA 2KFNA 2VICA 1LWFB 2KT3A 3JSRA 2J6UA 1IKYB 1HNVA 3OUYB 4XK8C 4JI7J 1S6UA 2FDNA 5DQIA 3RZAA 2D9OA 4PWDB 2HHSA 5EWEA 4LFAF 1S12A 5DG7A 1RT7A 4DV3F 1FNXH 2X51A 2R9LA 1GAOA 2OTLS 1ROFA 1T05A 1NNDA 4HACA 1IR1A 2JVRA 3IM9A 1BQXA 1R89A 4IG3B 5HJXA 1HQ2A 2EFVA 4DBQA 3MM9B 3W63A 2ILYA 2ZJRQ 3OSPA 1PIEA 4CH7A 1NJZA 3N79A 1UVNA 1IBKF 1HNWJ 3MUMP 4KHPF 2RDIA 1KLNA 3GLJA 4ZVEA 1S5ZA 3K5MA 1YK9A 3KNGA 5KFJA 2L41A 1C0UA 4Q43A 2CQ0A 1J5EJ 4PPZA 2WBMA 5BR8F 2R8KA 3M7VA 1K8AT 4DSFA 1IJFB 4JV0A 1VHIA 2JC1A 4NI2B 2ZZMA 3CTRA 4ENOA 4K2XA 2XZTB 3C3LA 3PJXA 4M5LA 4OJGA 2QV6A 2ZKUA 3M8ZA 4DR3J 2XNRA 2GNKA 4B3MJ 1RLDA 5K8NA 4I6WA 1Q8BA 4KSEB 3HJVA 2Y8YA 4X4UA 3I4PA 3DM2B 3QLHA 3O5TB 4ED1A 3PYGA 1OSCA 2B7BB 1FKPA 5KG1A 2MPUA 1WDTA 4J9OA 2EFNA 3A13A 4QQBA 2RQMA 2MKKA 1P27B 2XI2A 3SDEA 1HQUB 1GMUA 2K1RA 3I56S 3EGZA 3IFEA 2GZOA 3F41A 1NSQA 4FKXA 2V2QA 2H65B 4ANEA 3LF0A 3LAMA 3D28A 3M6WA 4X4TA 4UUXA 4ZITA 2BKPA 3CCMS 2GV1A 2HGNA 5LL6d 2QTWA 3BO4A 2CQ2A 2JL9A 3MM7A 2QLBB 4HT5A 2UUBF 4XTTA 5E3QA 1RWOB 3UPFA 5A8KB 2X1AA 4ZJLA 3IC1A 1MN7A 1D8ZA 1CJTB 3I9ZA 2ERRA 1AA1B 1DQAA 4MT1A 1UEVA 3IAS9 2V8DA 5MLCV 3ILIA 1S76D 5LM7E 2IY5B 1WEXA 1IBCB 2SXLA 4DV0F 1JKHA 4ZJQA 4JI5J 1RYSA 2Q66A 2R7WA 3JQKA 3JYTA 1U1LA 5FIIA 1LOUA 5F0WA 4ZPWR 5A0YA 2HWHA 4IO9Q 2GW8A 4H4KA 5HATA 1AZSB 1PGZA 4P2MA 2A10A 3V6JA 1U0HA 4F3OA 3DLEB 4DS4A 4NYOA 5EN1A 1T05B 2DIVA 4DL3A 1Y4ZB 2W2NP 3BGUA 3I0SB 1L3TA 4GRSA 1FJCA 2ZFHA 3KG4A 3K8VA 3GFHA 3OJSA 5D78A 3RUBL 2DB1A 2CQ3A 3PNIA 5KFTA 4F4XA 2VDIA 2YWGA 1WD6A 4QWAA 2HLUA 1RA7A 3KK3A 2AW0A 1NAQA 4R25A 1S6QA 3OTBA 2C2DA 1JLEB 2UUTA 3NP5A 1XK8A 1N88A 2DNHA 3MMCB 1FXDA 2W9BA 1FDNA 3TA0A 2IC3B 4ILRA 2I6WA 3MCMA 2LP4A 4YR0A 3EMTA 3G6YA 3FBEA 4P6QA 3BSAA 4Y28C 2GJIA 1ZAWA 1RCOB 2QMUB 1NLKL 3CMAS 2H48B 1SCJB 3OFHA 3EVMA 2POKA 4DV4F 1GTHA 2CQPA 4JI1J 4DXLA 2U2FA 4UUWA 1APSA 2K1RB 1MNEA 2J6SA 3T5JA 4Q2MA 1VQPS 2FZKB 3UN3A 3MZIA 2HHHJ 2V50A 4I4BA 2YKOA 3CC4S 1WOPA 3BQ1A 4H4KC 3QT7A 3NS6A 4ED0A 5HLFB 3IGNA 4LRCA 4URGA 3DDNA 2XLJA 3VCDA 3W9JA 4WTOB 1WTBA 2Y0SD 4LF8F 2AKWB 2DNGA 3RBXA 2QMWA 2WB1D 2DNPA 3K5NA 3NGUA 4ZIVA 4DUTA 5LMUF 5HBMA 4ZVQB 4DF8A 3NBPA 4ILMA 3KLVA 4LRDA 2IMWP 3D67A 1JJHA 3EPIA 1FE0A 4IRKA 1LEOA 2W2MP 2OPSB 1Q79A 1NMEB 3N01A 4MK7A 4JI6J 3RRGA 4QCLA 2V8VA 5C7PA 3T5HA 2NYHA 2RILA 5H9EJ 3KHGA 2EG1A 2A2CA 1CPZA 4JI4F 4I64A 2NCKL 3CD6S 4MKBA 1S72S 3TJ8A 3MEGA 4PQUA 2QSWA 3I55S 2EXUA 3MR3A 4I2QB 3NGRA 4NA2A 5HL7Q 1LW2A 5KTQA 2WVFA 2V9WA 2B6AA 3M8QB 2V4JB 5CYQB 3QSIA 1IKXA 1PC4A 1OIAA 1SIWB 2WOMB 1S0OA 1G3OA 3R5DA 4DWIA 5KT5A 4FYXB 1VRUA 3KLGB 1XN9A 4URQU 4NCGA 4CT9A 5J2NB 4KQZA 4JI8F 1S6QB 2NXNA 3I4HX 2NS1B 1F9FA 4B02A 2NSBA 1Q8IA 4DHVA 2PMZD 5DGBA 3JTOA 1X9MA 2GA7A 1XJWB 1ZM3A 2W9BB 1HIYA 2DY1A 5KFOA 4R5PA 2DNNA 3BB5A 1JLFA 1R8CA 3UD4P 2DNLA 4OYZA 1QLNA 4ELUA 3BSNA 4KB7A 1S1VB 2RKIB 3N4WA 3H2VE 3N6NA 4KGXB 1N36J 4K59A 4RW6A 4WF9Q 4J90A 3LPEA 3MOZA 3BJYA 4ZKAA 2NR0A 5AJ3J 2YNFA 4ZP9A 4I67A 1S1WB 4F2RA 1Q8KA 5GAHU 1XQIA 3LW5C 5GMKa 3DRPA 1OWXA 5T14A 2NXEA 4QIVA 1YLXA 4OI4A 2MQMA 2DVIA 1RYRA 1FKAF 5EUHA 4QYRA 4MMOA 4DL5A 1NB7A 5E3PA 4KFBA 4TU8A 1OPIA 2G0JA 3WIVA 1SKRA 1A7GE 2BJ9A 3LP2B 2CJBA 3TI0A 5CD4H 3OTEA 4DR6F 1SH3A 4ZVHA 4RW9A 4OHZA 3CUNA 4G6VB 5IS2A 2ZBPA 2EFOA 2PT0A 4ZPCA 2V68A 4EK2A 5HBMB 3BKUA 1UP1A 2Y3YA 4O44A 4JOUA 3RB6A 2FY1A 3ZXWA 1QAYA 3P49B 1R8HA 4ICLA 3OL9A 2J0WA 4YP3A 3QSYB 2E5HA 3EPGA 3AJ2A 3MAAB 4I7FA 5A8RB 3V6KA 1QM9A 5L1LA 4LF2A 3FNNA 3PFOA 3AD7C 3ISNC 3W2WA 2XMVA 4NEZA 4HR2A 1TL7A 5DZ7A 1H7XA 3EGNA 3IR7B 2CJ9A 1JLBB 2M8DB 2HHPA 3F56A 1Q78A 1S1UB 2RUGA 3MPYA 1ZETA 3M4XA 3BQ0A 2FJVA 4JUZA 1FRKA 4KRWA 3MEGB 1CS4A 1LXJA 3DOLB 1JXEA 4DV5J 1BMQB 1LW2B 5DDQC 2ZBRA 1VQYA 2B6AB 4OYWA 4CLSA 1VQ9S 2HVIA 1RAOA 5C24B 2HNDB 4YY3J 1RAFB 2MKJA 2IBKA 3S8SA 1R0BG 2ZM6F 4UF4A 4FF4A 3BBCA 4OHVA 3QIPA 1TZ0A 4OX7A 2EBEA 4ZHRA 3UI3A 4NCGB 4E0DA 2O66A 2N3OA 4J9NA 1U09A 2LYVA 2MGZB 2C3PA 4J5OA 4HDGA 4NLPA 3KHLA 2K8GA 3V4IA 1XNRF 1LKZA 3R27A 5HSPA 4J9KA 3Q8QB 3ITHB 1UFWA 3M05A 1S0VA 2QC3A 4HKQA 3DDIA 3GIIA 2DHHA 1DTQB 3WC0A 2ADBA 2E5IA 5IV4A 2R7OA 1NO8A 4Y2KA 2CZ4A 1QE1B 3DFEA 1TMMA 2EVZA 4J37A 4HYKA 1FERA 2WVDA 1DBDA 3VAJA 2HRUA 5F8HA 3R6GB 4NLXA 5L39A 4JV5F 3QAUA 1Y5IB 5KFUA 1YBAA 3P5BP 5C42A 3RAQA 3BR9A 1RU2A 3E3XA 3PO4A 1VBYA 1YGYA 3AA8A 4UTGA 1U6FA 3F73A 1BLUA 3DLKB 3NLCA 1FESA 4MYUA 4A8QA 2WSEC 2HMIB 4RW9B 4Z7YA 4MYTA 1YWXA 2FPHX 3CE8A 2L48A 3PTWA 1WHWA 2HQGA 3GJRB 3VAIA 3AOAA 2XZWA 4CTAB 2MKSA 2LEPA 2LDYA 1NUEA 1N32F 2QE5A 3OXFA 5AE3A 3CIZA 1DQ9A 2XS5A 4NEYA 4CLLA 3VAFA 4A8MP 3CSKA 5DLGA 1QAIA 3I32A 2GAGC 2OPPA 3W2WB 1GMWA 2OMOA 4ID5A 2CUYA 4B9LA 1NK5A 2YXLA 4GVLA 2B56A 1JLAA 3G4SS 1HBMB 2E1CA 4B3TF 2ZE2A 1X4DA 2IFXA 2XMJA 3ILOA 2QLFB 1B0TA 1QUPA 3RBZA 2QYGA 2UUAF 2M8HA 4ECWA 3ZZOA 3WC2A 1R0CB 1RT1B 3PYDA 3T1HF 2HW3A 1FE4A 3ETMA 5G0RA 2WVEA 2MLXA 3IRWP 1U4BA 5GAGU 2CQ1A 1F3FA 4ZCLA 1TU0B 1NDPA 4WE1A 4PXEA 5A2QY 3J7YI 2Y1JA 1C0TA 3C15B 1KFDA 1FFGB 4J7CA 3K0JA 3ZZUA 4YDDB 3ZTRA 5C25B 4UQTA 1YDLA 4QWEA 3TAMA 4PAAA 5HMZA 2V2KA 1QSSA 2F4FA 1IQTA 2R8JA 1JJ4A 1KONA 4LF9F 3DLHA 4Y2AA 2JHEA 3U02A 4X4NA 2OEKA 2BOPA 2W7AA 2FC9A 4CLTA 3IWNC 1IUJA 4WP8A 3BN7A 3PVXA 4XDDA 2RHSB 1EKSA 3SCKE 3LP0A 3KWMA 4DEZA 2GFFA 2X1BA 3T1AA 1K0TA 1LK5A 4P7TA 5LMNJ 2JVOA 4NMXA 2W1BA 2W2QP 1TK0A 3LWMA 4TQRA 3TUIC 4B3RJ 3I6PA 4TY9A 1H2TZ 1VQMS 4DPUA 4NYPA 2HRTA 4MKVA 1JXVA 2QGFB 2KG0A 3CIMA 2UP1A 4KJIA 2OLWA 3OR1B 3HHNB 3QO9B 4KAIA 5KG2A 1S99A 2UXCF 4M5JA 2Q1LA 1R6VA 2O3DA 1R7IA 1VIOA 1BQMB 2QZ8A 2AGPA 4X4VA 3W2VB 1UCNA 5B0BA 1LQ9A 4QBUA 3V4MA 4LF7J 5M2UA 2MKHA 1U02A 2P6SA 4R8UB 4K4XA 2HHWA 3G6ES 4CO2A 1SC1B 2CQIA 2QLXA 2KXFA 2DYAA 2AIRB 2OPPB 2QLJB 2P2CB 2NSCA 1VMBA 4LF4F 4RW7A 1RHMB 4J9VA 3D66A 5KFEA 3ENAA 1RT2B 3E01A 1JLAB 2ZH2A 2FVPA 4DR2J 3AOCA 3LGMA 4JB8B 2BXJA 1Q8LA 4RUCA 4C8OA 2KXNB 2Y8WA 4DZ6A 1FRIA 2UXBJ 4Q45A 4Q8EA 2OP5A 2DXEA 3HLUA 2KJWA 1PYSB 3TUPA 3W66A 2BW2A 3BR8A 4M95A 1HBOB 5A6PA 4IUFA 4LFCJ 5G0RB 1WOSA 1TUVA 4OLPA 3NGKA 4DCPB 2RU9A 2V4RA 1EB0A 1CJKA 2ZC4A 1SJ3P 4CNZA 2Z2LA 2CPFA 1WEZA 2QMXA 2HKEA 4EYIB 3K5OA 2PDAA 2CJAA 5DM6Q 1VJQA 3A12A 4EO8A 1E6YB 2XMAA 4A8OA 2FGOA 3Q8PB 4OZ5A 1TELA 4F4KA 2B8QA 2DH9A 4C7QA 3PY8A 3B6BA 3BGOP 3HZGA 1BXNA 3A1YG 2ATLA 2E1RA 4GKKF 4LF6J 2GJ2A 1T9VA 4EI2A 4X65F 3GONA 1FJGJ 1S7IA 4KHMA 4CLPA 2DO0A 3HT0A 3CC2S 2UZAA 4Q8FA 4N5SA 3LO3A 2XCAA 2LXUA 1RWKB 3C6UB 1UFLA 2OIHA 1M5HA 3DKDA 2PEHA 4DZDA 1UVMA 1XNQF 4ED2A 1RWMB 2C2KB 4FF1A 2A18A 3C6TB 4OYPA 2IDLA 4U7UK 1SUQB 2VJUA 3DDKA 1S6PB 3HVTA 2J8AA 5CABA 4DV3J 2IIHA 3TVZA 3WX8A 3VZIA 3K7RA 4OYAA 2I9SA 4YOEA 2IHR1 1WF0A 2FGCA 4QR2A 3DRYA 2DR8A 2EEYA 3GP9A 2HNYB 5D0HA 4USTA 1OY8A 4DFPA 2PMWA 1K1SA 2CKWA 3GTYX 1FJEB 2G2YA 4I2PA 5GMDA 4JI3J 4ZVOB 4LSZB 1K44A 1IBKJ 1Y5NB 5KFHA 2OELA 1Y11A 2D69A 4WFXA 3CC7S 4NLVA 1KC8T 4ZP6A 4JYAF 3F44A 5EDWA 3R7BB 1KD1T 1XMOF 3EICA 3TZZA 4R0JA 4QIFA 5BR8J 3GJTB 5HN0A 4RW7B 2R7VA 1YJ7A 2B0GA 2N4CA 4HHUA 4XO0A 1TL1A 1FD2A 1ITPA 4BLGA 1X4BA 3J81Y 1UA0A 4IH6A 3OXLA 1S9EA 1FVSA 4A8KA 3H4DA 3FEYB 1FWKA 2M3DA 1IVZA 1TMJA 3FVYA 4ZK7M 1TKTA 1BQNA 3MM5A 3HHEA 3R6LB 3IM8A 2RDDA 1X9SA 3KDNA 1VC6A 5KFQA 3D68A 3LGHA 4MIBA 4ED8A 3MM8B 4FPRA 4DLEA 2OHDA 4DDFA 5DDPC 1URNA 3AHPA 2NZ4A 1PAUB 3SEOA 1U24A 1VS3A 1FTRA 1MSWD 2HQIA 4DPYA 2VD3A 2EI5A 3TNVA 4N41A 2B9XA 2MSSA 5BXIA 4LMZA 4Y00A 1YJVA 4QWCA 2DNRA 2DGVA 1YJRA 4FVMA 2JEGA 5D6GA 1WC5A 2DPIA 4DSKA 2I38A 4F2SA 4RJVA 2MQLA 5DO2A 2XWYA 1BD6A 1G1XA 4K5SA 3O2IA 1LK7A 2OD6A 2JZ5A 2GVZA 2ROPA 2ATCB 2ZC3A 3BKFA 1E6VB 1TV6A 2DHGA 3PRVA 4X4QA 4A8YA 4FF2A 1WJ9A 1X0PA 3HVAA 2OEJA 3R5AA 1D9FA 2R2TA 2FIUA 3NGTA 1RCXB 2AYMA 2CDQA 1G2EA 3D5MA 5IWAF 1ZA1B 1N5YA 5GAEU 4W90B 2OAUA 5LSRA 1HNZJ 1AUDA 3RW7A 1HHSA 3NS7B 4FKYA 3NGSA 3GQCA 3MR5A 3B78A 3A8JA 1NJWA 5FJ4A 2VKRA 5EX0A 2GQCA 1RTIA 4X62F 4N7TA 2V8HA 2GGPB 3EXYA 1EHWA 3KJNB 4RU2A 2J9DE 2ACYA 4JI2F 1NK6A 3L4BC 1RBOB 3G9CA 2GO8A 1YRUA 2FD2A 2VPWB 3KUGA 4PG5A 1DY3A 4ECXA 4X4PA 4JP8A 4TN2A 4L74A 2XG8A 3POTA 2ZVIA 2XMMA 2PA3A 2ALZA 4CRJA 4MAKA 2DH8A 3QFHA 3W7BA 1T03B 4CO1A 4NX9A 4RW4B 3TEHB 4DX5A 3L7OA 3D6FB 3KLFB 1RT3A 4M5MA 2LEAA 1Q95G 4ZCKA 3QQCD 3DI6B 3QIDA 5LJ5Y 3AJ1A 4DR5F 3SCJE 3MM5B 4P10A 3GPAA 2R8HA 2FHJA 4LFBF 4FN5A 1X5SA 4WFNQ 3L09A 4DV4J 1NZ8A 3GIRA 1EQ0A 4LUBA 4JI0F 1N6QA 3PHEA 1H0HB 1D9AA 3TW0A 2Z30B 2OMLA 1H2UX 3TA1A 1JK9B 2PC6A 3P4UB 1MMDA 2P9GA 4WZMA 3T19A 1HQEA 3FBFA 2CJKA 4FBUA 1OMSA 2OJ3A 2AZ1A 2DHAA 1VQ6S 1MLAA 2CJXB 4OI3A 5J2QA 3T5KA 3T6JA 5F3TA 3PXGa 2QL5B 2GVZB 2Z2MA 1FWPA 3IS9B 3NCQA 3BQ2A 3M9MB 5CYJA 2VG6A 3EM1A 3TJ9A 3N6LA 2YVSA 1EP4A 2R7UA 3BO3A 4E8UA 3BDEA 4CDIA 5HO4A 2F1FA 3VQSA 3DCAA 3Q24A 2XMTA 3PEHA 1YZ7A 4OV1A 2MZSA 2Y1RI 2BQUA 1RTIB 5EHHA 2HQ3A 1ZH5A 4H4MA 1SJFA 1SQGA 3MEEB 1RWXB 3TYTA 4BDPA 1C4CA 2X1FA 3J80Y 1RTHA 4I69A 3QJPA 3HHDA 3TAPA 3DGPA 4ANDA 4ZVSB 2YPYA 1HFEL 2YNGA 5KFCA 4KGZB 1IKWB 2BJ8A 2HHTA 1I94F 2KHCA 3KG1A 3FMBA 1PSDA 4JI8J 4A48A 2IAJA 1YJWS 4NOHA 2MKYA 4NL5A 5CQGA 1SBRA 2EWHA 4V19J 2VU5A 1G4CA 5KFLA 5CD4A 2ZEJA 2CQBA 1IBMF 4OV6A 3AJDA 2KDOA 4KKOA 2M7SA 5KT3A 3KTQA 4NLGA 2DGWA 5KT6A 4OZ1A 2J0XA 3FEZA 3H59A 2VQFF 1BHNA 2WONA 1KQKA 1SKSA 3CCSS 4YDXA 2KG1A 4ZVFA 1HPZA 4EYHB 3UDEA 1V3ZA 2CJQA 5I3UB 1PBAA 2UUCJ 2ZOFA 4XDCA 5DJBA 2VBXA 4RBUA 2JRSA 4MIWA 3TO8A 1C1BA 2V63A 3MPDA 1ZPVA 2CWKA 2HHUA 3CDWA 5DG8A 4F4AA 4B17A 5F3ZA 1Q81T 1TKXB 4UY8T 4KT0C 1F1BB 1OYDA 1P1LA 1YSJA 1S57A 4ECYA 4QIEA 1UVKA 2X7IA 2ZUAA 1UZHA 2FHMA 3MPUB 4FYYB 3AOBA 3PW0A 2UV8G 2ZJQQ 1V3SA 4NLWA 4DR1F 3ULHA 4TXSA 4FYVB 1JNZB 2XZDB 3FZ2A 4UOFA 2HZAA 4DSJA 1FK9B 2ABYA 1UPPA 4C98A 1VQOS 3G6VA 3K5PA 3HHLA 1YJTA 2J5AA 2KVIA 1RLCL 1WC0A 2J76E 4F4WA 4N77A 1RB0A 1YRTA 2IJNA 3KG0A 3DLBA 3KXDA 1R31A 4HT7A 4RUHA 2R42A 4CM0A 2RRAA 3W3SA 5T41A 3QZ8A 4H4MB 5B0AA 2VBYA 2AGOA 2B43A 1IN0A 3J7AN 3D1HA 4OYOA 1OQ6A 4Q0BA 1ZZFA 2BABA 1NDKA 2OO4A 3ILJA 3UFCX 2P9CA 3M6VA 4P74A 2B3TB 3JSMA 4C8YA 2DH7A 2W7PA 2UVVA 4YHHF 2NUUG 3M6UA 3ZC4A 2RSQA 5L1IA 5LSLA 4Z37A 2GIQA 4OJ3A 5F0UA 1S1TA 3IAM9 3MEDA 2RUSA 4PWUA 2MY8A 4LBHA 1TAQA 5DLFA 3GZ7A 1ZM2A 4R0EA 1VI7A 2VODA 1QAXA 2DTJA 4QW8A 3IMQJ 2D3O1 3WIUA 4C8ZA 4M94A 1DTTA 3BGLA 1DAXA 4K2JA 1IM4A 2W4CA 4HHJA 2Q6CA 4B3SJ 2GMHA 1RK8A 1B7YB 4RW8B 4U7UD 1DLOB 4C48A 3GR1A 4GKJF 1TK8A 6AT1B 5JJBA 1NHUA 3NAIA 1ZS6A 5CCLA 5K14B 5H9EK 1WF2A 5IT4A 2EK1A 4LF1A 3FZBA 2R8IA 1YKWA 2VV5A 3MD3A 5M2PA 3NXZA 3GIKA 3BM7A 3IGVA 2QA1A 5E7OB 1BY9A 4LR9A 1W2BR 1VQ7S 3C16A 3PFEA 3GV8B 4UW2A 1MW7A 1WSRA 1JLCA 3OTCA 3PW4A 3TVKA 4WU2A 4O0IA 3CJ0A 2AYEA 3KHHA 1RTJB 3JTPA 3EVOA 2BOAA 3M30B 2FHJD 1VQKS 3M2VA 2RMLA 4LSNB 2B51A 3SSSA 4KR0B 2ZD1B 1O5JA 3NL0A 4ALZA 2GCFA 1AFIA 3MUVP 1N32J 1SC3B 5K8OA 5D0GA 2WTFA 5HP1A 4USKA 1TL4A 3KKFA 3MECB 4E98A 1FRXA 3UR0A 4G1QA 4ANCA 1TKZB 1Q7YT 2DXDA 2XO6A 4N56A 1T9TA 3IG1B 3D0GE 4C0BA 2XULA 5K9FA 3MURP 4IOAQ 2CPJA 2BX6A 3PO5A 3TEGA 5K5MA 5JMNA 1C1CA 3KHRA 3C19A 2O1PA 3ADAC 4IH5A 1GMVA 2KVQE 4B9MA 5I42A 3HP6A 2BZ2A 4BCAA 3AD9C 2P5VA 4ECVA 3D6MB 1YVFA 3FUYA 5IQ6A 3DLGB 3GIJA 2H51B 4PXCA 1O51A 5HROA 2HHXA 5KG0A 3OBIA 3OR2B 3IBWA 1Y7PA 3T1HJ 2DEJA 2C2EA 2BM1A 2V69A 4EGLA 1KQGB 2HQCA 1NK0A 2DGQA 1NKCA 2ZWOA 3FQKA 3U7JA 2H1YA 4F0MA 4HTIA 2KZZA 2YNHA 2ADCA 1PJ6A 1T3OA 3Q8YA 1AT1B 4N8NA 4DV1J 5HVGA 4C3MA 2H5IB 4IDKB 1KQSR 1GFWB 1FNMA 2BVZA 2AJ2A 3GU0A 2IA0A 4B3OB 4QR1A 1CULA 4CLYA 1D8YA 2E7VA 1PYOB 2VFRA 3UVJA 4OI1A 3TUZC 1QVFR 2WSCC 2ZUGA 3GYNA 1M5VC 2VFUA 2L9NA 1S0MA 2BYCA 2ZVSA 1L5UA 4DUZF 2DNMA 4IFYA 3W9HA 1FFSB 1VBZA 1HBUB 4KC5A 3FCVA 2RRNA 4L72B 3GR0A 1L3KA 2FY8A 3L3CA 1W2IA 3GWCA 4NRUA 1V3RA 1T0TV 4IO1A 4FNHA 3N5FA 4QU7A 2DHXA 2L08A 3HDSA 2IDEA 5KT4A 1IQZA 2AJQA 4LBIA 4FP9A 2MEWA 2CQDA 3MFIA 1RT5A 2LDIA 4K50A 3VAHA 1RWNB 3G82B 5L8RC 2DR5A 4ZVRB 1HLWA 1HWKA 3DMJA 3M2VB 1A0OB 1EIYB 3NNAA 2RNEA 2C22A 3CD7A 3GFYA 4ID8A 3M2UA 4MFBA 3CDEA 2A2DA 2W7OA 5HQ8A 3PX0A 3E8OA 3MUTP 2WK4A 3TP2A 1EETA 1WELA 2XMWA 5A2QU 4JI7F 1SKUB 3QRQA 3U1NA 3D3CJ 3HSZA 3OTOF 2HZVA 4UZCA 4KBIA 3DRXA 2GVDA 1GXTA 2H9ZA 1X7VA 1WI6A 1A6LA 3TQ1A 3CDBA 2JLEA 1VRTA 4FS1A 1VIXA 2QO3A 3FSXA 1PCAA 2CPZA 3W8PA 4NA1A 5D3GA 1FX4A 5CAAA 2MLYA 2OPRB 2DNOA 2FVSA 3R2DJ 2V9KA 2LEBA 5T7LA 2BKOA 1QD1A 4KY3A 1HMVB 4LIRA 2RIJA 1QUVA 2V2ZA 5L46A 3HHLD 3KJVA 4TQSA 1HNWF 3TAQA 2N7YA 2VB6A 5KFAA 1CC7A 4WK3A 2GHPA 2K7KA 1ACMB 3M8PB 1LWEA 2HURA 4DPXA 5E33A 1BWEA 1AROP 4USUA 1NU4A 2NXCA 1KS2A 2ZHOA 2ZWPA 2ZHAA 2N4DA 4KTQA 4USMA 2WW4A 3NWRA 4ITSA 3R7NB 1QTMA 3D4JA 4WFBQ 4X64J 1TL3B 4G1IA 4MJKA 2UVRA 3UD5A 4KH1B 1F60B 2WVBA 1R0AA 4MK8A 3TARA 5JUMA 4AE5A 3I31A 3MMBA 3BGRA 2HZCA 4IFYB 2W24A 2CVEA 1C4AA 1U8WA 2LFVA 5L9XA 2KN4A 2M88A 2D3UA 4NLRA 4HLBA 1KLMB 5IV3A 1FDBA 1YRXA 2YNIB 2F63A 3QYYA 2ILZA 4QWDA 3DN9A 2JLFA 4QOTA 3KUEA 4ILLA 1GEHA 1CJVB 2CNKB 1RTDB 3FSIA 3G8QA 2KHDA 3P5TL 1RT5B 2G2OA 4LJMA 2O5DA 2BEFA 5DM7Q 2MHEA 3Q23A 4J9UE 3OW2R 2F5GA 4CYUB 4RWXA 2AWZA 4OZLA 3SYZA 2D3OR 2RQKA 2W01A 2HRYA 4ETXA 3M2UB 2DGSA 4OFZA 3CXCR 3P45B 2XSJA 4C9DA 5HMXA 5IT0A 5KFFA 3C46A 4TY8A 4QWBA 4RUAA 4JI5F 3AB4B 4LREA 1UWBB 1VOMA 3VALA 2XS7A 4QIGA 3CNQP 1XMOJ 3UDVA 3GCXP 1B4SA 3UCZP 2E5LF 3CO0P 4ZJOA 3RR8A 6FD1A 4LR8A 3MMAA 4OHYA 1TUWA 4GC6A 1WG4A 3U27A 1HKAA 3ZTPA 3MR2A 3DU6A 3AXKA 1OPZA 5B0FA 2E1PA 4P71A 5GADI 2CPHA 1M0SA 4KGMA 4FXDA 3TQEA 1IR2A 1IR0A 2KFYA 2CADA 2Q79A 2R2RA 4AL5A 4H4OA 5DDRC 4OZ0A 1IJEB 3M32A 2FVCA 2F65A 3NCPA 2RE1A 1HYSA 1YJ9S 5J1NA 3ENVA 5DRKA 4YMEA 3H42A 1JJCB 1N4LA 1I5OB 1Y5LB 2HS0A 3EVWA 3RRKA 4LF5J 3G8TA 4C8MA 2FJXA 3V81B 4XAKA 3SCIE 1CJUA 1RAIB 3HF5A 3NG8A 4C11B 1N48A 4M5KA 4X4SA 3T5LA 1TVRA 4M5DB 5DQGA 3C8YA 4CLKA 5E0OA 1K9MT 3UN5A 4PWWA 5U47A 3RB4A 2IRUA 3BREA 1P8GA 1IM6A 1U2FA 1R0AB 2IM2A 1UW4A 2LLZA 2HNZA 4NWBA 4J9PA 2CRLA 5LT5A 5CYMA 3OLBA 2XQCA 3KLIB 2VPZB 3LQVA 1YIJS 2CPXA 3M8SA 4JI1F 1SJ1A 2FZCB 3GFZA 2YTCA 4ZLJA 1LWCB 2LQ8A 4MTPA 5AXNA 1RU1A 3DU5A 1VYAA 3OVBA 2YBVA 2D41A 2XGQA 4DX7A 2A6OA 4USVA 2XY7A 1Z2LA 2CZ9A 2BRLA 2HBRB 1UVJA 4NXNJ 4TU9A 3UQSA 2F4VF 2W4DA 3VTIA 2HHHF 4ECZA 4IRDA 4TNOA 2KRRA 1X5TA 2O01C 3HSDA 4OIXA 2XSFA 3W8GA 3JTNA 3J81U 3FFIA 1X5OA 3P96A 3D6TB 4O3QA 4K0KJ 5AXLA 1T9YA 3OHBA 2VL1A 1NH7A 4IR9A 2OEMA 1GXUA 2ZBCA 3HSJA 5KFWA 4JI2J 2YQ3A 5J2MB 3KLHA 2R7SA 1JNRB 2B9YA 1N33J 3IBCB 4WZQA 2Z4PA 1RSCA 4I68A 1SL1A 2XSJB 3K89A 3M1VB 3VGSA 4F26A 4KO0A 2FJEB 3WDOA 4CH1A 4GVBA 2G0CA 4DL6A 1U26A 3W61A 4C8NA 5FD1A 1V9OA 2Z57B 2W2OP 4QZVB 1L3SA 3R5BA 1WACA 1HNVB 4FXWA 2HFNA 3MMAB 2IVMA 4I0WA 2YWFA 4LR7A 3TJAA 4DLGA 4DL7A 4MIAA 3A8EA 1VCTA 3ET6A 2G13A 1QDUB 1RT7B 5RUBA 4E2FB 3PX6A 4P73A 3VR1A 4AL7A 1WTFA 4ECQA 2P8IA 3MAHA 2UXDJ 1M5SA 4CQ1A 2GX8A 4WIQA 2JH3A 2P6TA 1F3VA 4LFBJ 4HACB 5K8PA 4NXMJ 4M63A 4V19X 1JIHA 4QPTA 3IP0A 1ZTTA 2XMUA 1D1UA 3CF5Q 1CLFA 3CMES 4Q44A 2AMCB 3OL8A 5KG7A 1HNXF 5KG3A 5ADZA 1ZM9A 3ELHA 2HVHA 1FJ7A 1C0UB 2IA6A 5CXTA 5BYQA 4ZLNA 2G2ZA 3B82A 3MD1A 1ZTWA 2LA4A 1M1HA 2XYPB 4J91A 3QGPA 1XMQF 5SZTA 2PI5A 1N8RT 1WKJA 3WHIA 3MCNA 1R8AA 4PUOA 1N36F 2QA2A 1U2CA 2Z2ZA 5AJ3F 3QLHB 2DD8S 1A9NB 1REVA 2VASA 4CLWA 3EE3A 3KK2A 1FKPB 5B0GA 4ZCMA 3KUHA 3AXMA 2BMBA 4BWJA 4ZLLA 3BSOA 3RAXA 3SDEB 9RUBA 4ECRA 5I3QA 1LW0A 1IWAA 1RT6A 3VHQA 1OY6A 2G9OA 4WFYA 3AY0A 4K8RA 4ELTA 1RAAB 3GFXA 4RPFA 1U1RA 3R5GA 5D0RA 2DGXA 1X60A 5LXYA 1EARA 1AB8A 4Y3CA 3IN5A 3MM7B 1VR6A 3UNGC 1Y0HA 3KLHB 2Z8QA 4P2XA 1BUXA 2EFPA 2ALYB 3KYLA 2XO7A 1GX5A 4K4ZA 3TVYA 2C28A 3RR7A 5E3RA 1WHVA 2HAFA 2YKNA 1I94J 2KFZA 1JKHB 2VH7A 4LT6A 5CH7B 1T9XA 4BBYA 1ZM4A 4X4OA 4UZBA 3E51A 3JYTB 3OVSA 2OI2A 4Q7AA 5A0YB 3G87A 2RD5C 1VFJA 4J9MA 2DNZA 4TKTA 4YB7A 3C2PA 3DRSA 4DL0C 1UVLA 2DHSA 1U0HB 1X4HA 3ILLA 4DV5F 4UQGA 3PIOQ 4RNNA 2DNQA 3KK1A 3H2LA 2F3JA 1HWJA 4LQ9A 5EWFA 1W7WA 4EBCA 1SI9A 3KLEA 3PRBA 1SL2A 1SQEA 3T9ZA 3PW2A 3R5CA 1QSLA 2AQ4A 3H7HB 2M0GB 2BUNA 2KJVA 4C97A 3MCOA 3AD8C 1UEUA 2DT9A 2JJ4D 3DOMA 4IG0A 2L9DA 3DLLQ 1UEKA 1RAGB 4KV8A 2BJDA 2MZJA 4WYWA 2UU9J 1R8PA 2JFDA 1S77D 2FB0A 3Q8VA 2YKMA 3KK3B 4AL6A 3HMJG 1Q0NA 4TU7A 3LA0A 4OX9J 2XY5A 1I6JA 4O23A 3D1OA 3LTOA 5F9NA 1I3OB 3JQMA 3CWJA 1SQFA 2YY3A 2B4PA 1QTNB 4O0NA 3DHXA 1LXNA 1DURA 2CWXA 3BV8A 4PUOB 2VONA 1NPKA 2E9TA 2RH3A 3OL7A 4Q2LA 1N54B 3J80U 3FDSA 1W25A 2FHKA 3TUJC 4LRBA 3H98A 3KK2B 4DV7J 1MN9A 4DS5A 2IMOA 1Y10A 1D0EA 3MR6A 4RR5A 2HG4A 2D3ZA 1NKBA 4F7VA 3Q8UA 1QSYA 4ED3A 1KQFB 3RAMA 1FCAA 3T1YJ 5KFMA 1XR6A 4DSLA 3A3PB 1EJ7L 3JSBA 1FKOA 3C14A 2XLIA 4LSLA 3JQJA 4O4GA 4QU6A 1TP7A 2HBYB 1OO0B 5THWA 3QATA 2N82B 2AF6A 2C3YA 2DGTA 4IQXA 4OHXA 4ZCIA 2YX4A 5IOLA 5F9LA 2R8GA 2YKPA 4FXVA 4DUYF 4USHA 1NM2A 4DQPA 2HIQA 2DXFA 1IBLJ 2DR6A 2YKNB 1HR0F 3NBPB 3R2CJ 1VLYA 4DL2A 1RKIA 3FCHA 5F8IA 2M2BA 5L38A 1D3WA 3Q89A 2OGUA 4M5IA 1J5OA 3M2RA 4NA3A 2J9CA 5IM0A 2M9KA 3Q8SB 2AX1A 1RABB 3CJKA 1TAUA 4HEA9 1B70B 4GO5X 3QRPA 2JC0A 2X1GA 3QGIA 3K5LA 3ENQA 4A8FA 2GHVC 3T9NA 4I6AA 1GQEA 1TR0A 2KT2A 3P6YC 5J1EA 2MZQA 3H5UA 1VDHA 4PQUB 4G1PA 4Y2IA 3X3UA 5JVGQ 2AD9A 2YWEA 1NXIA 3NNCA 2VG7A 2CQ4A 2MJNA 1IKXB 5KFBA 5HVHA 2I5JA 1AXQA 4LRAA 1TTHB 1U1MA 3DOMB 1VRUB 2ASJA 1RT4A 1NEEA 1HA1A 1SV5A 2GQQA 3GYXB 2CIMA 1VQ8S 1ICEB 3THVA 1YBTA 1NJXA 2AJ1A 2J6TA 5HMWA 2E5GA 4F0KA 2FVQA 3PR4A 4L3NA 4R5PB 3HD1A 2BANA 1JLFB 2PGCA 1PO6A 3RJMB 4AT1B 4OYXA 1UZDA 3KMQA 1Y00A 4P9SA 4LVOP 3FRYA 2VFVA 5LMNF 3CJRA 4DQRA 3NS5A 3I0RA 3DRRA 3GCWP 2QFIA 4RW6B 1M5KC 4QR0A 1H73A 1I1GA 4DFMA 2XI3A 1LWFA 4B3RF 1IKYA 2NUHA 2YNFB 2QJ3A 3M6XA 5ETRA 3I5AA 1N0VC 4GC7A 3K57A 3DRPB 4PWDA 1VK3A 2AT1B 2BRKA 4IKAA 2KH9A 1YHQS 4KFBB 2HBQB 1GK8A 1RUSA 1HD0A 3VAKA 3UD3P 4M5GA 3J7Z5 2HFSA 4B08A 2K06A 2VQEJ 1F5CA 2XNQA 5EGYA 2DNKA 2F9JA 4IG3A 5HVFA 4P7VA 3MM9A 1IWGA 1NB2A 2MZ1A 4DCJB 4K4VA 4CT8A 5BJRA 4QW9A 3CDUA 2EKYA 4O44B 2CQCA 2V0NA 4OI0A 1M5PC 1RACB 4ICLB 2K7JA 2LQ5A 4I7FB 2RJZA 5KT2A 4Y34A 4NLQA 4NI2A 1FA0A 1FWLA 1TL7B 3H25A 4DR2F 2L3MA 4JV1A 1RISA 2I1RA 1IKVA 4DPTA 3MCSA 3BDPA 2QYCA 3JS9A 1RKJA 3SQOP 1TKDA 2IBOA 1CS4B 4RX6A 2HK2A 5D15A 3DM2A 4LFCF 1S49A 2IRYA 3UDCA 4AFFA 4K4TA 5ITHA 4ZPTR 1PYTA 1NDLA 1UJ5A 3EGVA 3K59A 1HQUA 5L9NA 4RNFA 1XMBA 3ZTQA 2HHQA 3CCVS 3QIPB 4HH1A 3LAKA 3VGUA 4ZHRB 2RB7A 3FKBA 4DV6J 8RUCA 3TR5A 1J2VA 3R7SB
chains in the Genus database with same CATH topology
4UZBA 4K2JA 1VHIA 5A76A 4BLGA 2YQ0A 1B3TA 2YPZA 2YQ1A 4UZCA 2YPYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UZB A;  4K2J A;  1VHI A;  5A76 A;  4BLG A;  2YQ0 A;  1B3T A;  2YPZ A;  2YQ1 A;  4UZC A;  2YPY A; 
#chains in the Genus database with same CATH topology
 4QYZ J;  4CCH A;  5ETP A;  1ZYQ A;  2YQ1 A;  3V4I B;  1B7F A;  3CCL S;  5A8K A;  4LF6 F;  3AQP A;  4H54 A;  3PW7 A;  4AQY J;  1CJT A;  4C0O C;  2HGM A;  2CG8 A;  2HFU A;  2HFO A;  1URR A;  4WII A;  5IC4 B;  1HL6 A;  2YPZ A;  4USI A;  3CJS A;  2DRD A;  2N3L A;  1S1X A;  3U1M A;  2UUW A;  3ISN D;  1KP6 A;  4W92 B;  4DR4 J;  2QLW A;  3M9O B;  2VDH A;  3OFE A;  1NSK L;  3OTO J;  4WKR A;  4O4R A;  2XS2 A;  2FLL A;  5KFP A;  1AZS A;  1RGV A;  3BSC A;  4IOC Q;  5C42 B;  5KT7 A;  3DLE A;  2ROE A;  3JAM Y;  1SJ4 P;  5D4O A;  4DR7 F;  3HUL A;  1EQM A;  5ETO A;  4TVA B;  5IT9 U;  2FJB B;  1D9D A;  2W9C A;  3Q8R B;  2IM1 A;  2RS8 A;  4WXO A;  2A0F B;  2XWX A;  3I0S A;  4JI3 F;  1F2G A;  2E7W A;  5IC6 B;  1M5O C;  4NZ7 A;  1VQ5 S;  4OL8 A;  2IYG A;  3CCW A;  4ERD A;  3LPY A;  2OFG X;  3QFW A;  3NNH A;  4F8R A;  2CDR B;  4DPW A;  4OYM A;  2XYH B;  1RHQ B;  3VQT A;  4F04 B;  3KJQ B;  3CPW R;  2EBG A;  2HFV A;  2JWN A;  4Y65 A;  1JLE A;  3AAW B;  3AQO A;  4ATN A;  5DET A;  2XLK A;  1Q86 T;  1YI2 S;  2AHO B;  3MMC A;  2AEM A;  1H98 A;  4ID5 B;  2I8E A;  2IC3 A;  4NZ0 A;  5IQQ A;  4J9R A;  1IKV B;  4WK1 A;  5E3A A;  2BJ1 A;  2ZE2 B;  1U25 A;  4OJH A;  1GH8 A;  3UWT A;  2JDJ A;  3AH6 A;  2FHO B;  2Y1I A;  7FDR A;  1I51 B;  1RI7 A;  3R9L A;  1UMJ A;  4MKA A;  4KPC A;  1U45 A;  4DOZ A;  3CVK A;  4CZC A;  2YH1 A;  2B8P A;  4WE1 B;  2HVE A;  2AZ3 A;  4W4M A;  1C0T B;  2CPY A;  4KE5 A;  2CNO B;  1XR7 A;  1X4G A;  1PAE X;  3GMG A;  1CC8 A;  3Q86 A;  3TAM B;  2RDJ A;  2M70 A;  3G8S A;  1BC6 A;  5HLF A;  5FLX Y;  1KTV A;  2EC0 A;  3H5Y A;  3MGJ A;  2PD1 A;  2ZDP A;  4D3G A;  3LP0 B;  3N5B A;  2ZH4 A;  3FCW A;  4DL4 A;  3EDR B;  5I4M A;  6FDR A;  1S1X B;  3OQ2 A;  2V8G A;  2QEX S;  1DAR A;  1FI4 A;  3NKY A;  3SFG A;  5GAH I;  3FMW A;  2OPS A;  1FDA A;  3ETO A;  1OSD A;  2QL9 B;  2E5L J;  1HW9 A;  3CDA A;  4F3M A;  7AT1 B;  4JV2 A;  1GT8 A;  3HFK A;  3HT3 A;  5D77 A;  1HNZ F;  5G4D A;  1HW8 A;  3HX9 A;  1REG X;  3GE9 A;  3RU0 A;  4BHQ A;  4LFA J;  1B99 A;  1WG1 A;  2EW9 A;  2IPO B;  3Q22 A;  3MTK A;  1KWM A;  2W9C B;  1KEK A;  1Q82 T;  1Q4R A;  4I2Q A;  1ZA2 B;  3IRX A;  2MST A;  1LFW A;  3M8Q A;  5H9F J;  4C3L A;  2V4J A;  5CYQ A;  2HQF A;  1B3T A;  4HVZ A;  2B7C B;  2WCX A;  2WOM A;  3SQG A;  3W5X A;  2WZ1 A;  4HDH A;  4IQM A;  1AUS L;  3ZO7 A;  2D74 B;  3KLG A;  3OFF A;  1S59 A;  2H3E B;  2BE9 B;  2WHO A;  1H3D A;  5KFN A;  2NQP A;  2BKN A;  5J2N A;  2AEJ A;  2BJ3 A;  3J7Y U;  5KFG A;  1WKK A;  4KHP J;  1HHQ A;  3N28 A;  3RB0 A;  3S01 A;  4PQA A;  1NJI T;  1FFW B;  4OZN A;  3D7S B;  2WB4 A;  3MF5 A;  3RTV A;  2W9A A;  3NWG A;  1MWQ A;  4L6V 3;  3E01 B;  4NLU A;  4EZ9 A;  4EMD A;  2GML A;  2QG9 B;  4NE9 C;  4KIA A;  1S1V A;  2CPE A;  1K47 A;  2RKI A;  2XGP A;  2GJF A;  2PE8 A;  1S9G A;  2ZH1 A;  2DEI A;  2QT7 A;  5KOW A;  2HGL A;  3BKT A;  3G2X A;  5F8G A;  2MQP A;  3HFZ B;  2APO A;  4TYA A;  2KM8 B;  4ECT A;  2HSE B;  4PR6 A;  1S1W A;  5LXR A;  2E66 A;  1JX4 A;  1CJK B;  4C2M A;  3PW5 A;  2BA9 A;  5HQM A;  1U6B A;  1X31 C;  2F4V J;  1AW0 A;  3OTD A;  3FBB A;  2K3K A;  5LOQ A;  2LMI A;  3LP2 A;  3G71 S;  2M52 A;  2LQJ A;  3US5 A;  2AV5 A;  3H5S A;  3DC2 A;  2YKA A;  2F9D A;  3OL6 A;  1KSP A;  1WKL A;  3MPV A;  1ZZN A;  1MU2 A;  4OX8 A;  4EFA C;  2UUB J;  2KTQ A;  4WJB A;  5F8J A;  2V5H G;  1DQ8 A;  4PG6 A;  3H2U B;  3ICL A;  4U67 Q;  1NKE A;  3IBF B;  1H2V Z;  4KH0 B;  4ED4 A;  2JLG A;  2V6A A;  1TFY A;  1T11 A;  3ZZP A;  1GTE A;  1FO1 A;  3MAA A;  5A8R A;  4DV0 J;  3BBB A;  3UNY A;  3CCQ S;  1FNO A;  2HQD A;  1RHU B;  4AUK A;  1KRP A;  3HJF A;  4ES2 A;  1MMN A;  1U7L A;  1N0U A;  1JLB A;  2R2U A;  3CGI A;  4S0M A;  1S1U A;  3SFU A;  2CYY A;  2B4O A;  3HVT B;  3V5R A;  1PJ7 A;  1CG2 A;  5HQL A;  2DJW A;  3O44 A;  4A8X A;  3Q83 A;  3DOL A;  4YQW A;  2I0X A;  4NLO A;  4UY8 5;  4O3O A;  4F4Z A;  3DHW C;  2DBB A;  4B9U A;  2CPD A;  3SXL A;  3IRX B;  1SJQ A;  2WAQ D;  2W4P A;  2IJF A;  1FRM A;  3AOD A;  5C24 A;  2HND A;  2J9E A;  3K58 A;  4I2P B;  2VOO A;  3SQG B;  4P2F A;  3EZU A;  4YUD A;  3TX8 A;  1X0F A;  1UTA A;  2BQR A;  4P2S A;  4M5N A;  4RNH A;  1ZBT A;  1WWH A;  4U8V A;  1KN6 A;  2FJW A;  4Q5V A;  4NZ6 A;  5KG6 A;  1HNX J;  2MGZ A;  5HMY A;  1OS5 A;  3EJM A;  1HAR A;  2MY7 A;  3PRD A;  5E41 A;  3DXS X;  5D4P A;  4PRF A;  1TQL A;  1X4E A;  2RS2 A;  4NYZ A;  3ITH A;  1TL1 B;  4D3H A;  3PX4 A;  2BAC A;  3D3B J;  2J0Q D;  1XMQ J;  3NGD A;  3TAN A;  1UW9 A;  1S9E B;  1DTQ A;  4QPX A;  1T94 A;  1N5Q A;  2VKZ G;  5C5J A;  4ED6 A;  1S9G B;  3CCJ S;  1TKT B;  2R3V A;  1BQN B;  4LBP A;  1M90 T;  1QE1 A;  1N5S A;  1U6Z A;  5KG5 A;  4CO0 A;  3RGI A;  5GAG I;  2UUC F;  3VGV A;  1U1O A;  4KPY A;  3CCZ A;  5B08 A;  2KKH A;  3ZZT A;  3LUY A;  3G86 A;  2GMJ A;  4AXI A;  4C3K A;  4ZDN A;  3RYL A;  2A1B A;  4ZMM A;  1WHY A;  1KHV A;  3KOA A;  3IR5 B;  2KYZ A;  1PKU A;  3UE2 A;  4C8K A;  3H4B A;  3DLK A;  1HWI A;  4WWS A;  4RNO A;  3IR6 B;  2FUG 9;  2LXI A;  3R1H A;  1UPM B;  2HMI A;  2C42 A;  2CVI A;  3WQP A;  2AX0 A;  1TFW A;  1RWU A;  1RDR A;  1NK7 A;  2JEJ A;  2RHQ B;  3NEK A;  1MU2 B;  4XPC A;  3ZZZ A;  3UCG A;  1YG0 A;  4CTA A;  4LF8 J;  1QVG R;  4DF4 A;  1EAY C;  1T02 A;  2AGQ A;  1UET A;  4OZ2 A;  2F7V A;  5LMU J;  3OV7 A;  1Q5Y A;  1KOO A;  5IFM A;  1VHF A;  1TV6 B;  4EUV A;  3BYR A;  3TZX A;  1RWP B;  1ZOT A;  2LQB A;  3VAG A;  1LV5 A;  2H5E A;  3CJ8 A;  1JQG A;  1DJ0 A;  2C3U A;  1N5Y B;  1HBM A;  2ZNZ A;  1V5I B;  3OFG A;  3V6D A;  2G1D A;  1RE1 B;  1RTZ A;  4B9S A;  3UR3 C;  1JXL A;  4A8S A;  4N8O A;  4YN3 B;  3SIP B;  2VFT A;  4DFJ A;  5ETT A;  1VC5 A;  1FXR A;  4JI4 J;  3QMQ A;  3BS9 A;  1NJY A;  4OYB A;  4CIO A;  3RG6 A;  2Z0G A;  2KB2 A;  1RT1 A;  1VLO A;  3FBC A;  1NSA A;  4U6P A;  1FDD A;  4YR3 A;  2ZH7 A;  5B0E A;  4WXW A;  3BGF A;  1TUG B;  4X84 A;  2Q43 A;  4ZVP B;  5KAK A;  1XIQ A;  3C15 A;  2H4Y B;  4F3Q A;  3TZW A;  5C25 A;  2DKO B;  3POT B;  2VZ9 A;  5KFR A;  1CQM A;  3W1Y C;  3H0P A;  4CLU A;  1QAJ A;  3ZZY A;  3B4M A;  1PBU A;  4Y2C A;  4FNI A;  1NRK A;  2R7Q A;  1RT3 B;  3N6M A;  1AFJ A;  3HPO A;  1V6H A;  5LSO A;  2MYF A;  3OJU A;  3U1L A;  2JFK A;  1K73 T;  4FF3 A;  2DR7 A;  1P1T A;  2U1A A;  4ZLP A;  2FZG B;  3GIM A;  1U2R A;  2ACM A;  1XER A;  3S1T A;  4B3S F;  4PPD A;  2GIR A;  4CO5 A;  2C2M B;  2LCW A;  4BC9 A;  2CXE A;  2NXU A;  1JMT A;  1WG5 A;  2ZBI A;  2QFJ A;  4YEA A;  1S4F A;  3PJW A;  5A76 A;  2FTR A;  4RLE A;  2G0I A;  3W9I A;  3PKY A;  1N6Q B;  5C2G A;  2R2S A;  5AT1 B;  1RBA A;  2XHC A;  3Q2S C;  1NPR A;  5DDO C;  1YQH A;  1JLG A;  3F0N A;  3RBD A;  2V34 A;  3OR1 A;  4OZJ A;  3QO9 A;  4I6Y A;  1S48 A;  1HQE B;  3CCT A;  2J9D A;  1AYE A;  2FC8 A;  4DR6 J;  4NCA A;  1BQM A;  4F36 A;  4ZPD A;  5KFV A;  3W2V A;  3GYG A;  1MG7 A;  1WC6 A;  2PFF B;  2NPF A;  2CFX A;  1K1Q A;  2RF2 A;  3O6Q A;  4DUY J;  5J2Q B;  2YX1 A;  3GG1 A;  4R8U A;  5ETV A;  5IXU A;  1KNZ A;  3R97 A;  3SMZ A;  2BQ3 A;  2PO4 A;  2R7R A;  3Q0A A;  1HR0 J;  2FLN A;  2NPI A;  2VG6 B;  5D4N A;  2DR9 A;  3ZZR A;  4CLF A;  1EP4 B;  2XMK A;  3HKW A;  3I5C A;  1NK8 A;  3KMS A;  1WNE A;  2C2Z B;  4M1K A;  1RT2 A;  4L73 A;  2ZOM A;  2ZIT A;  2AJF E;  2FYX A;  1F2H A;  3AFG A;  2VUG A;  3V6D B;  2MZT A;  8AT1 B;  2VA3 A;  2ZZT A;  3EX7 B;  4M5H A;  2R4F A;  1UVI A;  4NAS A;  1HBO A;  3MI7 X;  3MMJ A;  1NK4 A;  5EX3 A;  1RTH B;  3C66 A;  3PZP A;  2I2Y A;  3QAE A;  3DGP B;  3CB4 A;  3ZTS A;  3G6X A;  3PJ9 A;  5BYS A;  4X4R A;  4TLR A;  4RBV A;  2ZM6 J;  3H20 A;  2YNG B;  4BWM A;  3LOU A;  3KDO A;  4OI2 A;  3W65 A;  3SBM A;  4DV1 F;  1E6Y A;  4YS2 A;  1T8E A;  3QGG A;  2KT5 A;  3A3N B;  5AXM A;  1FT8 A;  2IAJ B;  3FGV A;  2K2P A;  4RWW A;  1X4F A;  4ZOS A;  1XNR J;  1X5P A;  3HHK A;  2EC2 A;  4IOB A;  3O3L A;  3FQL A;  3FJ2 A;  2NYI A;  3I96 A;  2E7X A;  3BF4 A;  1KFS A;  2OKQ A;  4PXD A;  4Z7C A;  4KKO B;  3N0V A;  3Q2T C;  2KZM A;  2XM3 A;  1Y3J A;  3T6B A;  2PEB A;  3K8W A;  2DK2 A;  2RVJ A;  2DPJ A;  2WON B;  2MLZ A;  5DG9 A;  4WYL A;  4F0H A;  3C6U A;  1HPZ B;  2H4W B;  1WEY A;  1KVJ A;  3VV2 B;  4F25 A;  4DV2 F;  1B0V A;  2HHV A;  1WOO A;  3C6T A;  4NRT A;  2ZHB A;  2XTJ P;  1C1B B;  2FJA B;  2LEC A;  2O67 A;  1SUQ A;  1S6P A;  4JV5 J;  2HYI B;  4A46 A;  2HVD A;  1U1N A;  1JLG B;  4OLO A;  4RU9 A;  1SH2 A;  4NLD A;  4ZPB A;  2J0S D;  2E9Z A;  4CO4 A;  1KVK A;  4AYB D;  2B5J A;  3MTJ A;  2HNY A;  4EU0 A;  1UA1 A;  4K4Y A;  2J7W A;  3PYE A;  2HS3 A;  4DSI A;  1SB6 A;  5K20 B;  1YJU A;  2RF2 B;  1WC4 A;  5A8W A;  3HSG A;  1F0X A;  4OI6 A;  4G3I A;  1MRO A;  1XWL A;  5CZV A;  1FRH A;  2F8M A;  2J8S A;  3THP A;  1TL5 A;  1KBR A;  3HHL B;  1WI8 A;  5GAE I;  4B9N A;  4MH8 A;  2C1E B;  3HD2 A;  2CG4 A;  2CQH A;  3UCU P;  3HVW A;  4ZPV R;  3JXO A;  1RHR B;  1YIT S;  4B3T J;  1Y9O A;  4U8Y A;  1SH0 A;  1VK8 A;  3LH2 S;  1Z1Z A;  1O8B A;  1O6X A;  5CA5 A;  2UUA J;  5KFX A;  5JXS A;  4ECU A;  3MM8 A;  1RAE B;  2VBZ A;  1FF2 A;  4CI0 B;  4Q0B B;  1YBU A;  1U1P A;  1VC0 A;  2QIF A;  4PYD A;  1S97 A;  2QSF A;  1F9E B;  2Z2Y B;  5ETS A;  1HBN A;  2KL8 A;  4QIW D;  4IRC A;  3JSM B;  4O3R A;  2ASD A;  2JX2 A;  2VOP A;  2HWI A;  4DU8 A;  3J7Z T;  4PKD B;  4F4Y A;  4J9L A;  2ZH8 A;  1S1T B;  3MED B;  4W98 A;  3BH7 B;  4LF9 J;  4X64 F;  5ETM A;  1P6T A;  2LVW A;  1S4E A;  1U1K A;  1L3U A;  1N34 F;  3HZE A;  4YR2 A;  3CJ4 A;  2MXY A;  5IT9 Y;  3RRH A;  2EFQ A;  1FXL A;  3HO1 A;  2HIY A;  4V1A k;  3PHT A;  1DTT B;  2RQ4 A;  1E6V A;  2XHW A;  1WDD A;  2EG2 A;  4CM2 A;  3HFV A;  2VHG A;  3B8H A;  5HAO A;  2IM3 A;  2V67 A;  4FZV A;  1S0N A;  2MQQ A;  3IWX A;  5HI7 A;  2HEK A;  2B9W A;  5MAO A;  3L7U A;  5IZH A;  4WBF A;  3LP1 A;  4HHH A;  4DR7 J;  3C16 B;  4X66 F;  3VWS A;  2GGP A;  2B5J B;  1FRL A;  1JLC B;  4ZVU B;  5ETQ A;  1U0S A;  4OJ1 A;  2UXC J;  1R3N A;  5B09 A;  4ZPA A;  1RWV B;  4DQI A;  3W60 A;  2MB0 B;  3M9N B;  2Y9H A;  5A8W B;  2KM8 C;  2LKZ A;  5C2C A;  5HP1 B;  1SJR A;  1MRO B;  5D8H B;  2PI4 A;  2OSR A;  3S6E A;  3HCX A;  4G1Q B;  3HI9 A;  1T03 A;  2B4U A;  2QA4 S;  4RW4 A;  1KHW A;  2MQ8 A;  3OLA A;  3KLF A;  4LF4 J;  3CD0 A;  2AYG A;  2MQO A;  1NZA A;  2R7X A;  3H40 A;  1C1C B;  2BV3 A;  3DI6 A;  2OPQ A;  2KXH A;  3S7R A;  4K4S A;  2HK3 A;  2VPY B;  5I42 B;  4L75 A;  4Y6I A;  2E9R X;  2RAQ A;  2HBZ B;  3K17 A;  4UOG A;  5L1K A;  1U8S A;  4PG7 A;  3IWL A;  1NBE B;  2AJ0 A;  4P52 A;  1UJ4 A;  3OVA A;  4DJB A;  5HRO B;  4EBD A;  3TA2 A;  2WSF C;  2GS8 A;  5B0D A;  3VVT A;  1WF1 A;  3W5Z A;  2IVF B;  4EEY A;  1GMW D;  3EUN A;  4IYQ A;  3BBF A;  4LF5 F;  2HLT A;  4F67 A;  1SC6 A;  1KOH A;  5HK4 A;  1HBN B;  3SCL E;  5CCM A;  1U1Q A;  2ZZN A;  3D2W A;  1RBL A;  1J5E F;  2YNH B;  1F5A A;  2BJ7 A;  2LXF A;  3TWZ A;  4DMZ A;  1Z4U A;  3NRB A;  1W26 A;  3AT1 B;  4A4J A;  5KOX A;  3JAM U;  1KVI A;  2YX7 A;  4EBE A;  2F40 A;  5F41 A;  2ASL A;  3T41 A;  3QGH A;  3GIL A;  1YZ6 A;  3I9V 9;  3SI8 A;  4DR3 F;  4GKK J;  1CUL B;  2W25 A;  4B3M F;  1L3V A;  2ZJP Q;  5F8M A;  3NOG A;  3PKM A;  1M1G A;  4X65 J;  3UVJ B;  3IS9 A;  5DS7 A;  1VRQ C;  3T3F A;  1B0P A;  3J81 j;  5KFI A;  2V94 A;  4PXB A;  3JB9 k;  4GO7 X;  1QJH A;  5KG4 A;  3GV7 B;  2IVY A;  4LIW A;  2XY6 A;  2YWW A;  2MTL A;  2IJR A;  4JBC A;  3MOJ B;  3BPD A;  4NXN F;  2Q3P A;  1XNQ J;  3MR7 A;  3IO1 A;  5J1P A;  3BH6 B;  3I82 A;  3VAM A;  3FC9 A;  2BBE A;  3LP1 B;  4PAB A;  5AE2 A;  4HTJ A;  2LU1 A;  4DN0 A;  4DQQ A;  4TYB A;  4DFK A;  4K0K F;  1NDC A;  3FEX B;  2DIU A;  5B7W A;  5J2P A;  3R3T A;  2J7K A;  3MEE A;  3EWG A;  2HAI A;  1MWY A;  2RU3 A;  1N33 F;  3DMJ B;  3MM6 A;  2ZOG A;  3EZO A;  4MFB B;  2OH2 A;  1IKW A;  3HXM A;  2LA6 A;  2FJD B;  3PEJ A;  4QYZ K;  4YB6 A;  4FYD A;  1JLQ A;  2W8L A;  1EET B;  4C8L A;  3NY0 A;  2D9P A;  4JYA J;  2WVC A;  2D1C A;  3I5B A;  3CJT A;  4FDF A;  1SVD A;  1WOR A;  3D1Q A;  2GVD B;  2VFS A;  5D4L A;  4A8W A;  1YX2 A;  2BJE A;  1RHK B;  3DXB A;  1VRT B;  1Q16 B;  3MFH A;  3WX4 A;  8ATC B;  3R8Y A;  1RZM A;  2OPQ B;  3UDL A;  5K8M A;  2CQG A;  5FLX U;  2MDA A;  1BE4 A;  5D3G B;  2AYB A;  2MQN A;  2UXD F;  4WP3 A;  3QBC A;  5F8N A;  1NSP A;  2RRB A;  5T7L B;  4Z2X A;  4NXM F;  3GJS B;  2HFZ A;  5KFK A;  1EKR A;  3D0I E;  5ETN A;  5I3U A;  3SSQ A;  1CQN A;  4EO6 A;  4CLZ A;  5E2Q A;  1VQS A;  4C6A A;  3KJV B;  3PDN A;  3G96 A;  4ZVG A;  3RBE A;  4M8L A;  3NAH A;  2CNN B;  3QWU A;  1FVQ A;  4P75 A;  2EFG A;  3CCE S;  2E29 A;  1LWE B;  3HVR A;  3GV5 B;  2NXJ A;  2ZH9 A;  1K0V A;  2C2R A;  1TKX A;  4DI6 A;  1DFD A;  1R8B A;  1Y3K A;  4C0H A;  5M2R A;  3PAC A;  2HWT A;  3EDQ B;  4I1T A;  4IFV A;  5DZ6 A;  2YQ0 A;  4CP5 A;  3QWP A;  4RL1 A;  2MKC A;  4WPA A;  5JVH Q;  1GNK A;  4ZN3 A;  3BN4 A;  3H5X A;  3AA9 A;  4WFA Q;  3H90 A;  4PG8 A;  1UAW A;  4ECS A;  2N7C A;  2M4M A;  4U95 A;  1FK9 A;  2XBP A;  3QRR A;  4XPE A;  2AJ4 A;  4RUB A;  2VJV A;  3MMB B;  1Q7L B;  3BGR B;  4IH7 A;  1WC3 A;  2YWH A;  1BGX T;  4LQ3 A;  1ZPW X;  1T9W A;  1J27 A;  1VGY A;  4N47 A;  1WC1 A;  4FPI A;  3ZNJ 1;  4MKY A;  1S7H A;  3GG0 A;  5IWA J;  2LQ9 A;  1EX8 A;  2VF3 A;  3QZ7 A;  4NML A;  4U9R A;  3AB2 B;  2AP6 A;  1RAJ A;  2DCU B;  5J2P B;  1JJ2 R;  1S6O A;  1JWW A;  2V8P A;  2AU0 A;  4ER8 A;  4X62 J;  1U49 A;  2C3O A;  2OFH X;  4DQS A;  5D0E A;  1TK5 A;  3MM6 B;  1PG5 B;  5E5N A;  4LRF A;  1F6T A;  4B9V A;  3J7A 1;  1GX6 A;  2ROG A;  1FRJ A;  3TZY A;  2E1M C;  4TY8 B;  3HKZ D;  3OXG A;  1JLQ B;  4IR1 A;  4OMF G;  4OQJ A;  5GME A;  3W5Y A;  3L9Z A;  3OPK A;  3R5J B;  4KHR A;  1UWA A;  2WRM A;  3JSY A;  4JI6 F;  4NLT A;  1M1K T;  1HHT P;  1ZAV A;  1SL0 A;  1NH8 A;  1HWL A;  5KFY A;  5FDL A;  3ZNU A;  1R43 A;  1PIL A;  2PSZ A;  3DLJ A;  2V2V A;  4U96 A;  3LAN A;  1SXL A;  4LVN P;  3E2E A;  3OD2 A;  2G1H A;  2VG5 A;  1RAH B;  2VA2 A;  4DR5 J;  4BS2 A;  1OQ3 A;  2MZR A;  4H4O B;  2JSX A;  2GAH C;  1BWV A;  3ZZ0 A;  4P72 A;  4RW8 A;  3M32 B;  1DLO A;  4HI2 A;  3TX0 A;  2IYI A;  3MDF A;  1P9Y A;  1HYS B;  3A8I A;  3ENW A;  5K14 A;  1UFK A;  4ES3 A;  2PN6 A;  2UU9 F;  1T3N A;  4JI0 J;  2Q6B A;  4DX8 H;  5KFZ A;  2C3M A;  4OX9 F;  1CJU B;  3CCU S;  2CJY B;  3FSY A;  2VIH A;  5H9F K;  3HM9 A;  1SIZ A;  4NCB A;  3VGT A;  1RTJ A;  1TVR B;  2BW7 A;  3M30 A;  4IFV B;  4ZS6 A;  2YH0 A;  5A6W A;  2GIF A;  3B4D A;  3P8B B;  4RKU C;  4LSN A;  4KGK A;  4J9S A;  3DNC A;  2ZD1 A;  1XC9 A;  4OX6 A;  3CO9 A;  1MML A;  4G65 A;  3BPS P;  2CNL B;  4U7C A;  3MEC A;  3V2U C;  1R27 B;  2HNZ B;  3CUL A;  2NZC A;  1TKZ A;  3ISZ A;  5CYM B;  4DV7 F;  3GSD A;  5ETK A;  1UJ6 A;  1RXO B;  4CNY A;  2ZDO A;  4C4W A;  3IG1 A;  3A3O B;  9ATC B;  4O3S A;  1N56 A;  4RNM A;  4CO3 A;  3UO0 A;  3IA0 A;  1WSV A;  2CAJ A;  1H74 A;  4DG1 A;  3T1Y F;  4K4U A;  4K4W A;  4DN9 A;  1B64 A;  5ETL A;  2X3G A;  1N5V A;  5HAN A;  2DGO A;  3VF0 B;  4AXJ A;  5GAD U;  3PCO B;  3BO2 A;  3CJ5 A;  5CZX A;  3DOK A;  4XIU A;  3FFI B;  3DLG A;  4Y2M A;  3OR2 A;  2BR0 A;  1NPP A;  1DRZ A;  2RQC A;  4ZIW A;  4USJ C;  1FHT A;  2BE7 D;  2NLW A;  2FLP A;  3OT9 A;  3DYA A;  2XEX A;  2ZKT A;  2B9E A;  1H72 C;  1VQ4 S;  1IBL F;  1X4C A;  3LWL A;  4KO0 B;  2PII A;  1FEH A;  2GQ2 A;  4GVB B;  1D09 B;  3CJQ A;  4PYA A;  4BC7 A;  2KYX A;  1CVJ A;  2DRA A;  2DRB A;  2E44 A;  2Z56 B;  1LFP A;  1N5T A;  4IDK A;  4A47 A;  3EXC X;  4KGV B;  3L95 X;  3NOC A;  5FDL B;  4RZR A;  3CMQ A;  1U47 A;  2JEF A;  1VBK A;  2BM0 A;  3FK4 A;  4UOH A;  2ASY A;  4RO0 A;  3UN2 A;  4EZ6 A;  3GB0 A;  4B3O A;  1VIS A;  3ET6 B;  1IBM J;  2V4Q A;  3W64 A;  2VG5 B;  4J9Q A;  1HWU A;  1Z2Z A;  1S10 A;  1VQN S;  4WCE Q;  3NCR A;  2VQF J;  5KFD A;  2XC9 A;  1HBU A;  3QT6 A;  2CPI A;  1FX2 A;  3QJJ A;  4YY3 F;  2NRE A;  2QX0 A;  1X9W A;  4WKY A;  4WP9 A;  1GXL A;  4FBT A;  4UOC A;  3CT9 A;  4ZP8 A;  3P3D A;  1NK9 A;  3HHL C;  2XCP A;  2LU2 A;  2DY9 A;  2VC1 A;  2UVU A;  3SSR A;  2ZH5 A;  2R7T A;  4FS2 A;  3D0H E;  3CW2 C;  2QRR A;  3D6H B;  2CA9 A;  1HNI A;  3G82 A;  2JNJ A;  5BYR A;  3CCR S;  4ETZ A;  5CHC B;  3RB3 A;  3MXH P;  2ZH6 A;  2OTJ S;  4HH0 A;  2COL A;  2FLO A;  2DCL A;  1KTQ A;  3TRG A;  4DR1 J;  2GO9 A;  1H38 A;  2MKI A;  2Y1L B;  4ES1 A;  2P9E A;  2ZH3 A;  3HK2 A;  1DZ5 A;  1REV B;  1YTY A;  1UL3 A;  4URS A;  3VVU A;  3QT5 A;  2M5Y A;  1P9Q C;  3A4T A;  3DGV A;  4DG1 B;  5L1J A;  4OHW A;  3W62 A;  1LW0 B;  1N52 B;  1RT6 B;  5SUH A;  3PR5 B;  3V6H A;  2OPR A;  1CEZ A;  3SV4 A;  3DOK B;  3EGW B;  2VQE F;  1X4A A;  5AE1 A;  4ED5 A;  1OY9 A;  1HMV A;  1ELO A;  2KI2 A;  4DU7 A;  2IRX A;  3EZ5 A;  2BE2 A;  3QJL A;  3LGN A;  3DYA B;  3L7P A;  4O3P A;  5KFS A;  3EYZ A;  2HVZ A;  2C2N A;  2D7S A;  2KU7 A;  3MWB A;  3QPI A;  2WBR A;  2Z58 B;  1RJJ A;  3M8P A;  3PIP Q;  2AEF A;  1G7C B;  1VJW A;  1QY7 A;  3QT8 A;  4NLY A;  4YHH J;  4ED7 A;  4K7Q A;  1Q53 A;  3A8K A;  2OD4 A;  1NHK L;  1HD1 A;  4X2B A;  2RT3 A;  1T7P A;  3PG9 A;  2J7U A;  1HI8 A;  1RP5 A;  2XB2 D;  1OYE A;  1TL3 A;  3WBZ A;  1FTC A;  2KO1 A;  1HI0 P;  3MPW A;  2FVR A;  1SPB P;  4OZ3 A;  2MMY A;  3DRS B;  4WFZ A;  5AXK A;  1O0P A;  2C2O B;  4YB1 P;  2GHW A;  2ZBQ A;  2BDP A;  4WU3 A;  2EPI A;  3N9U C;  1RQ0 A;  1VQL S;  4O3N A;  3KK1 B;  1OJ4 A;  3CED A;  2PFD A;  3B54 A;  3KLE B;  1H6K X;  5DGA A;  1KLM A;  4DV2 J;  2HS4 A;  5HJY A;  4GKJ J;  4PG4 A;  4YFU A;  2YNI A;  2UV8 A;  7FD1 A;  2IM0 A;  3SZ2 A;  4USW A;  2QA4 G;  2H5J B;  4DV6 F;  3NMR A;  5DQH A;  4IG0 B;  3BYP A;  4KV8 B;  1ULR A;  1S9F A;  1EZZ B;  1CJV A;  1T9U A;  3M8Y A;  1RTD A;  2QL7 B;  4KYZ A;  3KJF B;  2YKM B;  3CJ2 A;  3H8Y A;  3PYF A;  4F02 A;  4ZP7 A;  2JOQ A;  1SKW A;  1HNI B;  2GC8 A;  3MEK A;  2DIT A;  1RWW B;  1F5B A;  4CYU A;  4AQY F;  3NMA A;  1LWX A;  3X1L B;  4F50 A;  3GJQ B;  3CJ3 A;  1H7W A;  3MAQ A;  3THT A;  1XTZ A;  1JB0 C;  2EKN A;  1KR4 A;  1FEE A;  2F8H A;  2CZV C;  5F8L A;  3LAL A;  4GMK A;  2ZNY A;  2XYG B;  2E5J A;  1UWB A;  5B0C A;  4WTY A;  4DR4 F;  5GVQ A;  2W8K A;  3RW6 A;  3K2Y A;  2DNY A;  3O1L A;  5H1S V;  1KDN A;  3O8W A;  3OUY A;  3PM9 A;  1U48 A;  4TLQ A;  4PEO A;  3WZ0 A;  2OSQ A;  1KKH A;  3OHA A;  1Q5V A;  1VBX A;  3ONQ A;  1Q1K A;  1PC5 A;  4Y0F A;  4DX6 A;  4I56 A;  2B4V A;  2PMH A;  1RAD B;  1FKO B;  3R1L A;  2VBW A;  4L3K A;  2H54 B;  3PV8 A;  3C14 B;  4LSL B;  2A3J A;  4NPO A;  1S79 A;  2JEI A;  5EWG A;  2FQQ B;  4O4G B;  2VPX B;  2G4B A;  1G6B A;  4AD6 A;  1PJ5 A;  2BE2 B;  1XR5 A;  4RBT A;  3MHY A;  4CWB A;  4HL9 A;  4LF7 F;  2VC0 A;  1LNQ A;  4K5R A;  2DGU A;  4PCQ A;  4ZVT B;  2QN6 B;  4YB5 A;  1CBK A;  3BZQ A;  3I87 A;  2YKQ A;  2W2P P;  3V81 A;  1WUU A;  4ZN1 A;  4UT4 A;  3CD5 A;  4L76 A;  1XBW A;  2MJU A;  2YWK A;  4EWT A;  4C11 A;  1J5O B;  4PZV A;  1HI1 A;  1WHX A;  3M2R B;  2MHN A;  4NLS A;  2Y0B B;  4M5D A;  1IXK A;  4HI1 A;  3KNA A;  3OSN A;  5IM0 B;  3CJK B;  3IXQ A;  1N34 J;  3M8R A;  1V5V A;  2K3I A;  3UW1 A;  4ZA1 A;  4FYW B;  1SC4 B;  1ZAX A;  1T95 A;  2UXB F;  2HPU A;  1FD8 A;  5J1E B;  1UKU A;  3KLI A;  3BEG B;  1X8D A;  2E1A A;  1LWC A;  5LJ3 Y;  2VG7 B;  4DUZ J;  3D54 A;  2KRB A;  1MWZ A;  1RHJ B;  1R6Y A;  2F8E X;  2DO4 A;  2I5J B;  1DHM A;  2A6M A;  3QNW B;  3KFW X;  3FRZ A;  1RT4 B;  4QJV A;  1RA6 A;  1SV5 B;  1NHV A;  2EK6 A;  2L9W A;  4X66 J;  4DPO A;  2WW8 A;  1NCL A;  1F9H A;  2DIS A;  3M8W A;  1YJN S;  4FVC A;  4MK9 A;  5J2M A;  5E3C A;  4ELV A;  2BAN B;  2OUG A;  4DCO B;  1FJG F;  2PA8 D;  3M1V A;  3TOQ A;  3ZTO A;  5I3P A;  3GSI A;  4N76 A;  3SV3 A;  2UVW A;  1XEZ A;  1CSJ A;  4OYI A;  3I0R B;  1C2P A;  3DRR B;  4CH0 S;  3D9B A;  3VZH A;  3ZFV A;  4DSE A;  2X3D A;  4B9T A;  2KFN A;  2VIC A;  1LWF B;  2KT3 A;  3JSR A;  2J6U A;  1IKY B;  1HNV A;  3OUY B;  4XK8 C;  4JI7 J;  1S6U A;  2FDN A;  5DQI A;  3RZA A;  2D9O A;  4PWD B;  2HHS A;  5EWE A;  4LFA F;  1S12 A;  5DG7 A;  1RT7 A;  4DV3 F;  1FNX H;  2X51 A;  2R9L A;  1GAO A;  2OTL S;  1ROF A;  1T05 A;  1NND A;  4HAC A;  1IR1 A;  2JVR A;  3IM9 A;  1BQX A;  1R89 A;  4IG3 B;  5HJX A;  1HQ2 A;  2EFV A;  4DBQ A;  3MM9 B;  3W63 A;  2ILY A;  2ZJR Q;  3OSP A;  1PIE A;  4CH7 A;  1NJZ A;  3N79 A;  1UVN A;  1IBK F;  1HNW J;  3MUM P;  4KHP F;  2RDI A;  1KLN A;  3GLJ A;  4ZVE A;  1S5Z A;  3K5M A;  1YK9 A;  3KNG A;  5KFJ A;  2L41 A;  1C0U A;  4Q43 A;  2CQ0 A;  1J5E J;  4PPZ A;  2WBM A;  5BR8 F;  2R8K A;  3M7V A;  1K8A T;  4DSF A;  1IJF B;  4JV0 A;  1VHI A;  2JC1 A;  4NI2 B;  2ZZM A;  3CTR A;  4ENO A;  4K2X A;  2XZT B;  3C3L A;  3PJX A;  4M5L A;  4OJG A;  2QV6 A;  2ZKU A;  3M8Z A;  4DR3 J;  2XNR A;  2GNK A;  4B3M J;  1RLD A;  5K8N A;  4I6W A;  1Q8B A;  4KSE B;  3HJV A;  2Y8Y A;  4X4U A;  3I4P A;  3DM2 B;  3QLH A;  3O5T B;  4ED1 A;  3PYG A;  1OSC A;  2B7B B;  1FKP A;  5KG1 A;  2MPU A;  1WDT A;  4J9O A;  2EFN A;  3A13 A;  4QQB A;  2RQM A;  2MKK A;  1P27 B;  2XI2 A;  3SDE A;  1HQU B;  1GMU A;  2K1R A;  3I56 S;  3EGZ A;  3IFE A;  2GZO A;  3F41 A;  1NSQ A;  4FKX A;  2V2Q A;  2H65 B;  4ANE A;  3LF0 A;  3LAM A;  3D28 A;  3M6W A;  4X4T A;  4UUX A;  4ZIT A;  2BKP A;  3CCM S;  2GV1 A;  2HGN A;  5LL6 d;  2QTW A;  3BO4 A;  2CQ2 A;  2JL9 A;  3MM7 A;  2QLB B;  4HT5 A;  2UUB F;  4XTT A;  5E3Q A;  1RWO B;  3UPF A;  5A8K B;  2X1A A;  4ZJL A;  3IC1 A;  1MN7 A;  1D8Z A;  1CJT B;  3I9Z A;  2ERR A;  1AA1 B;  1DQA A;  4MT1 A;  1UEV A;  3IAS 9;  2V8D A;  5MLC V;  3ILI A;  1S76 D;  5LM7 E;  2IY5 B;  1WEX A;  1IBC B;  2SXL A;  4DV0 F;  1JKH A;  4ZJQ A;  4JI5 J;  1RYS A;  2Q66 A;  2R7W A;  3JQK A;  3JYT A;  1U1L A;  5FII A;  1LOU A;  5F0W A;  4ZPW R;  5A0Y A;  2HWH A;  4IO9 Q;  2GW8 A;  4H4K A;  5HAT A;  1AZS B;  1PGZ A;  4P2M A;  2A10 A;  3V6J A;  1U0H A;  4F3O A;  3DLE B;  4DS4 A;  4NYO A;  5EN1 A;  1T05 B;  2DIV A;  4DL3 A;  1Y4Z B;  2W2N P;  3BGU A;  3I0S B;  1L3T A;  4GRS A;  1FJC A;  2ZFH A;  3KG4 A;  3K8V A;  3GFH A;  3OJS A;  5D78 A;  3RUB L;  2DB1 A;  2CQ3 A;  3PNI A;  5KFT A;  4F4X A;  2VDI A;  2YWG A;  1WD6 A;  4QWA A;  2HLU A;  1RA7 A;  3KK3 A;  2AW0 A;  1NAQ A;  4R25 A;  1S6Q A;  3OTB A;  2C2D A;  1JLE B;  2UUT A;  3NP5 A;  1XK8 A;  1N88 A;  2DNH A;  3MMC B;  1FXD A;  2W9B A;  1FDN A;  3TA0 A;  2IC3 B;  4ILR A;  2I6W A;  3MCM A;  2LP4 A;  4YR0 A;  3EMT A;  3G6Y A;  3FBE A;  4P6Q A;  3BSA A;  4Y28 C;  2GJI A;  1ZAW A;  1RCO B;  2QMU B;  1NLK L;  3CMA S;  2H48 B;  1SCJ B;  3OFH A;  3EVM A;  2POK A;  4DV4 F;  1GTH A;  2CQP A;  4JI1 J;  4DXL A;  2U2F A;  4UUW A;  1APS A;  2K1R B;  1MNE A;  2J6S A;  3T5J A;  4Q2M A;  1VQP S;  2FZK B;  3UN3 A;  3MZI A;  2HHH J;  2V50 A;  4I4B A;  2YKO A;  3CC4 S;  1WOP A;  3BQ1 A;  4H4K C;  3QT7 A;  3NS6 A;  4ED0 A;  5HLF B;  3IGN A;  4LRC A;  4URG A;  3DDN A;  2XLJ A;  3VCD A;  3W9J A;  4WTO B;  1WTB A;  2Y0S D;  4LF8 F;  2AKW B;  2DNG A;  3RBX A;  2QMW A;  2WB1 D;  2DNP A;  3K5N A;  3NGU A;  4ZIV A;  4DUT A;  5LMU F;  5HBM A;  4ZVQ B;  4DF8 A;  3NBP A;  4ILM A;  3KLV A;  4LRD A;  2IMW P;  3D67 A;  1JJH A;  3EPI A;  1FE0 A;  4IRK A;  1LEO A;  2W2M P;  2OPS B;  1Q79 A;  1NME B;  3N01 A;  4MK7 A;  4JI6 J;  3RRG A;  4QCL A;  2V8V A;  5C7P A;  3T5H A;  2NYH A;  2RIL A;  5H9E J;  3KHG A;  2EG1 A;  2A2C A;  1CPZ A;  4JI4 F;  4I64 A;  2NCK L;  3CD6 S;  4MKB A;  1S72 S;  3TJ8 A;  3MEG A;  4PQU A;  2QSW A;  3I55 S;  2EXU A;  3MR3 A;  4I2Q B;  3NGR A;  4NA2 A;  5HL7 Q;  1LW2 A;  5KTQ A;  2WVF A;  2V9W A;  2B6A A;  3M8Q B;  2V4J B;  5CYQ B;  3QSI A;  1IKX A;  1PC4 A;  1OIA A;  1SIW B;  2WOM B;  1S0O A;  1G3O A;  3R5D A;  4DWI A;  5KT5 A;  4FYX B;  1VRU A;  3KLG B;  1XN9 A;  4URQ U;  4NCG A;  4CT9 A;  5J2N B;  4KQZ A;  4JI8 F;  1S6Q B;  2NXN A;  3I4H X;  2NS1 B;  1F9F A;  4B02 A;  2NSB A;  1Q8I A;  4DHV A;  2PMZ D;  5DGB A;  3JTO A;  1X9M A;  2GA7 A;  1XJW B;  1ZM3 A;  2W9B B;  1HIY A;  2DY1 A;  5KFO A;  4R5P A;  2DNN A;  3BB5 A;  1JLF A;  1R8C A;  3UD4 P;  2DNL A;  4OYZ A;  1QLN A;  4ELU A;  3BSN A;  4KB7 A;  1S1V B;  2RKI B;  3N4W A;  3H2V E;  3N6N A;  4KGX B;  1N36 J;  4K59 A;  4RW6 A;  4WF9 Q;  4J90 A;  3LPE A;  3MOZ A;  3BJY A;  4ZKA A;  2NR0 A;  5AJ3 J;  2YNF A;  4ZP9 A;  4I67 A;  1S1W B;  4F2R A;  1Q8K A;  5GAH U;  1XQI A;  3LW5 C;  5GMK a;  3DRP A;  1OWX A;  5T14 A;  2NXE A;  4QIV A;  1YLX A;  4OI4 A;  2MQM A;  2DVI A;  1RYR A;  1FKA F;  5EUH A;  4QYR A;  4MMO A;  4DL5 A;  1NB7 A;  5E3P A;  4KFB A;  4TU8 A;  1OPI A;  2G0J A;  3WIV A;  1SKR A;  1A7G E;  2BJ9 A;  3LP2 B;  2CJB A;  3TI0 A;  5CD4 H;  3OTE A;  4DR6 F;  1SH3 A;  4ZVH A;  4RW9 A;  4OHZ A;  3CUN A;  4G6V B;  5IS2 A;  2ZBP A;  2EFO A;  2PT0 A;  4ZPC A;  2V68 A;  4EK2 A;  5HBM B;  3BKU A;  1UP1 A;  2Y3Y A;  4O44 A;  4JOU A;  3RB6 A;  2FY1 A;  3ZXW A;  1QAY A;  3P49 B;  1R8H A;  4ICL A;  3OL9 A;  2J0W A;  4YP3 A;  3QSY B;  2E5H A;  3EPG A;  3AJ2 A;  3MAA B;  4I7F A;  5A8R B;  3V6K A;  1QM9 A;  5L1L A;  4LF2 A;  3FNN A;  3PFO A;  3AD7 C;  3ISN C;  3W2W A;  2XMV A;  4NEZ A;  4HR2 A;  1TL7 A;  5DZ7 A;  1H7X A;  3EGN A;  3IR7 B;  2CJ9 A;  1JLB B;  2M8D B;  2HHP A;  3F56 A;  1Q78 A;  1S1U B;  2RUG A;  3MPY A;  1ZET A;  3M4X A;  3BQ0 A;  2FJV A;  4JUZ A;  1FRK A;  4KRW A;  3MEG B;  1CS4 A;  1LXJ A;  3DOL B;  1JXE A;  4DV5 J;  1BMQ B;  1LW2 B;  5DDQ C;  2ZBR A;  1VQY A;  2B6A B;  4OYW A;  4CLS A;  1VQ9 S;  2HVI A;  1RAO A;  5C24 B;  2HND B;  4YY3 J;  1RAF B;  2MKJ A;  2IBK A;  3S8S A;  1R0B G;  2ZM6 F;  4UF4 A;  4FF4 A;  3BBC A;  4OHV A;  3QIP A;  1TZ0 A;  4OX7 A;  2EBE A;  4ZHR A;  3UI3 A;  4NCG B;  4E0D A;  2O66 A;  2N3O A;  4J9N A;  1U09 A;  2LYV A;  2MGZ B;  2C3P A;  4J5O A;  4HDG A;  4NLP A;  3KHL A;  2K8G A;  3V4I A;  1XNR F;  1LKZ A;  3R27 A;  5HSP A;  4J9K A;  3Q8Q B;  3ITH B;  1UFW A;  3M05 A;  1S0V A;  2QC3 A;  4HKQ A;  3DDI A;  3GII A;  2DHH A;  1DTQ B;  3WC0 A;  2ADB A;  2E5I A;  5IV4 A;  2R7O A;  1NO8 A;  4Y2K A;  2CZ4 A;  1QE1 B;  3DFE A;  1TMM A;  2EVZ A;  4J37 A;  4HYK A;  1FER A;  2WVD A;  1DBD A;  3VAJ A;  2HRU A;  5F8H A;  3R6G B;  4NLX A;  5L39 A;  4JV5 F;  3QAU A;  1Y5I B;  5KFU A;  1YBA A;  3P5B P;  5C42 A;  3RAQ A;  3BR9 A;  1RU2 A;  3E3X A;  3PO4 A;  1VBY A;  1YGY A;  3AA8 A;  4UTG A;  1U6F A;  3F73 A;  1BLU A;  3DLK B;  3NLC A;  1FES A;  4MYU A;  4A8Q A;  2WSE C;  2HMI B;  4RW9 B;  4Z7Y A;  4MYT A;  1YWX A;  2FPH X;  3CE8 A;  2L48 A;  3PTW A;  1WHW A;  2HQG A;  3GJR B;  3VAI A;  3AOA A;  2XZW A;  4CTA B;  2MKS A;  2LEP A;  2LDY A;  1NUE A;  1N32 F;  2QE5 A;  3OXF A;  5AE3 A;  3CIZ A;  1DQ9 A;  2XS5 A;  4NEY A;  4CLL A;  3VAF A;  4A8M P;  3CSK A;  5DLG A;  1QAI A;  3I32 A;  2GAG C;  2OPP A;  3W2W B;  1GMW A;  2OMO A;  4ID5 A;  2CUY A;  4B9L A;  1NK5 A;  2YXL A;  4GVL A;  2B56 A;  1JLA A;  3G4S S;  1HBM B;  2E1C A;  4B3T F;  2ZE2 A;  1X4D A;  2IFX A;  2XMJ A;  3ILO A;  2QLF B;  1B0T A;  1QUP A;  3RBZ A;  2QYG A;  2UUA F;  2M8H A;  4ECW A;  3ZZO A;  3WC2 A;  1R0C B;  1RT1 B;  3PYD A;  3T1H F;  2HW3 A;  1FE4 A;  3ETM A;  5G0R A;  2WVE A;  2MLX A;  3IRW P;  1U4B A;  5GAG U;  2CQ1 A;  1F3F A;  4ZCL A;  1TU0 B;  1NDP A;  4WE1 A;  4PXE A;  5A2Q Y;  3J7Y I;  2Y1J A;  1C0T A;  3C15 B;  1KFD A;  1FFG B;  4J7C A;  3K0J A;  3ZZU A;  4YDD B;  3ZTR A;  5C25 B;  4UQT A;  1YDL A;  4QWE A;  3TAM A;  4PAA A;  5HMZ A;  2V2K A;  1QSS A;  2F4F A;  1IQT A;  2R8J A;  1JJ4 A;  1KON A;  4LF9 F;  3DLH A;  4Y2A A;  2JHE A;  3U02 A;  4X4N A;  2OEK A;  2BOP A;  2W7A A;  2FC9 A;  4CLT A;  3IWN C;  1IUJ A;  4WP8 A;  3BN7 A;  3PVX A;  4XDD A;  2RHS B;  1EKS A;  3SCK E;  3LP0 A;  3KWM A;  4DEZ A;  2GFF A;  2X1B A;  3T1A A;  1K0T A;  1LK5 A;  4P7T A;  5LMN J;  2JVO A;  4NMX A;  2W1B A;  2W2Q P;  1TK0 A;  3LWM A;  4TQR A;  3TUI C;  4B3R J;  3I6P A;  4TY9 A;  1H2T Z;  1VQM S;  4DPU A;  4NYP A;  2HRT A;  4MKV A;  1JXV A;  2QGF B;  2KG0 A;  3CIM A;  2UP1 A;  4KJI A;  2OLW A;  3OR1 B;  3HHN B;  3QO9 B;  4KAI A;  5KG2 A;  1S99 A;  2UXC F;  4M5J A;  2Q1L A;  1R6V A;  2O3D A;  1R7I A;  1VIO A;  1BQM B;  2QZ8 A;  2AGP A;  4X4V A;  3W2V B;  1UCN A;  5B0B A;  1LQ9 A;  4QBU A;  3V4M A;  4LF7 J;  5M2U A;  2MKH A;  1U02 A;  2P6S A;  4R8U B;  4K4X A;  2HHW A;  3G6E S;  4CO2 A;  1SC1 B;  2CQI A;  2QLX A;  2KXF A;  2DYA A;  2AIR B;  2OPP B;  2QLJ B;  2P2C B;  2NSC A;  1VMB A;  4LF4 F;  4RW7 A;  1RHM B;  4J9V A;  3D66 A;  5KFE A;  3ENA A;  1RT2 B;  3E01 A;  1JLA B;  2ZH2 A;  2FVP A;  4DR2 J;  3AOC A;  3LGM A;  4JB8 B;  2BXJ A;  1Q8L A;  4RUC A;  4C8O A;  2KXN B;  2Y8W A;  4DZ6 A;  1FRI A;  2UXB J;  4Q45 A;  4Q8E A;  2OP5 A;  2DXE A;  3HLU A;  2KJW A;  1PYS B;  3TUP A;  3W66 A;  2BW2 A;  3BR8 A;  4M95 A;  1HBO B;  5A6P A;  4IUF A;  4LFC J;  5G0R B;  1WOS A;  1TUV A;  4OLP A;  3NGK A;  4DCP B;  2RU9 A;  2V4R A;  1EB0 A;  1CJK A;  2ZC4 A;  1SJ3 P;  4CNZ A;  2Z2L A;  2CPF A;  1WEZ A;  2QMX A;  2HKE A;  4EYI B;  3K5O A;  2PDA A;  2CJA A;  5DM6 Q;  1VJQ A;  3A12 A;  4EO8 A;  1E6Y B;  2XMA A;  4A8O A;  2FGO A;  3Q8P B;  4OZ5 A;  1TEL A;  4F4K A;  2B8Q A;  2DH9 A;  4C7Q A;  3PY8 A;  3B6B A;  3BGO P;  3HZG A;  1BXN A;  3A1Y G;  2ATL A;  2E1R A;  4GKK F;  4LF6 J;  2GJ2 A;  1T9V A;  4EI2 A;  4X65 F;  3GON A;  1FJG J;  1S7I A;  4KHM A;  4CLP A;  2DO0 A;  3HT0 A;  3CC2 S;  2UZA A;  4Q8F A;  4N5S A;  3LO3 A;  2XCA A;  2LXU A;  1RWK B;  3C6U B;  1UFL A;  2OIH A;  1M5H A;  3DKD A;  2PEH A;  4DZD A;  1UVM A;  1XNQ F;  4ED2 A;  1RWM B;  2C2K B;  4FF1 A;  2A18 A;  3C6T B;  4OYP A;  2IDL A;  4U7U K;  1SUQ B;  2VJU A;  3DDK A;  1S6P B;  3HVT A;  2J8A A;  5CAB A;  4DV3 J;  2IIH A;  3TVZ A;  3WX8 A;  3VZI A;  3K7R A;  4OYA A;  2I9S A;  4YOE A;  2IHR 1;  1WF0 A;  2FGC A;  4QR2 A;  3DRY A;  2DR8 A;  2EEY A;  3GP9 A;  2HNY B;  5D0H A;  4UST A;  1OY8 A;  4DFP A;  2PMW A;  1K1S A;  2CKW A;  3GTY X;  1FJE B;  2G2Y A;  4I2P A;  5GMD A;  4JI3 J;  4ZVO B;  4LSZ B;  1K44 A;  1IBK J;  1Y5N B;  5KFH A;  2OEL A;  1Y11 A;  2D69 A;  4WFX A;  3CC7 S;  4NLV A;  1KC8 T;  4ZP6 A;  4JYA F;  3F44 A;  5EDW A;  3R7B B;  1KD1 T;  1XMO F;  3EIC A;  3TZZ A;  4R0J A;  4QIF A;  5BR8 J;  3GJT B;  5HN0 A;  4RW7 B;  2R7V A;  1YJ7 A;  2B0G A;  2N4C A;  4HHU A;  4XO0 A;  1TL1 A;  1FD2 A;  1ITP A;  4BLG A;  1X4B A;  3J81 Y;  1UA0 A;  4IH6 A;  3OXL A;  1S9E A;  1FVS A;  4A8K A;  3H4D A;  3FEY B;  1FWK A;  2M3D A;  1IVZ A;  1TMJ A;  3FVY A;  4ZK7 M;  1TKT A;  1BQN A;  3MM5 A;  3HHE A;  3R6L B;  3IM8 A;  2RDD A;  1X9S A;  3KDN A;  1VC6 A;  5KFQ A;  3D68 A;  3LGH A;  4MIB A;  4ED8 A;  3MM8 B;  4FPR A;  4DLE A;  2OHD A;  4DDF A;  5DDP C;  1URN A;  3AHP A;  2NZ4 A;  1PAU B;  3SEO A;  1U24 A;  1VS3 A;  1FTR A;  1MSW D;  2HQI A;  4DPY A;  2VD3 A;  2EI5 A;  3TNV A;  4N41 A;  2B9X A;  2MSS A;  5BXI A;  4LMZ A;  4Y00 A;  1YJV A;  4QWC A;  2DNR A;  2DGV A;  1YJR A;  4FVM A;  2JEG A;  5D6G A;  1WC5 A;  2DPI A;  4DSK A;  2I38 A;  4F2S A;  4RJV A;  2MQL A;  5DO2 A;  2XWY A;  1BD6 A;  1G1X A;  4K5S A;  3O2I A;  1LK7 A;  2OD6 A;  2JZ5 A;  2GVZ A;  2ROP A;  2ATC B;  2ZC3 A;  3BKF A;  1E6V B;  1TV6 A;  2DHG A;  3PRV A;  4X4Q A;  4A8Y A;  4FF2 A;  1WJ9 A;  1X0P A;  3HVA A;  2OEJ A;  3R5A A;  1D9F A;  2R2T A;  2FIU A;  3NGT A;  1RCX B;  2AYM A;  2CDQ A;  1G2E A;  3D5M A;  5IWA F;  1ZA1 B;  1N5Y A;  5GAE U;  4W90 B;  2OAU A;  5LSR A;  1HNZ J;  1AUD A;  3RW7 A;  1HHS A;  3NS7 B;  4FKY A;  3NGS A;  3GQC A;  3MR5 A;  3B78 A;  3A8J A;  1NJW A;  5FJ4 A;  2VKR A;  5EX0 A;  2GQC A;  1RTI A;  4X62 F;  4N7T A;  2V8H A;  2GGP B;  3EXY A;  1EHW A;  3KJN B;  4RU2 A;  2J9D E;  2ACY A;  4JI2 F;  1NK6 A;  3L4B C;  1RBO B;  3G9C A;  2GO8 A;  1YRU A;  2FD2 A;  2VPW B;  3KUG A;  4PG5 A;  1DY3 A;  4ECX A;  4X4P A;  4JP8 A;  4TN2 A;  4L74 A;  2XG8 A;  3POT A;  2ZVI A;  2XMM A;  2PA3 A;  2ALZ A;  4CRJ A;  4MAK A;  2DH8 A;  3QFH A;  3W7B A;  1T03 B;  4CO1 A;  4NX9 A;  4RW4 B;  3TEH B;  4DX5 A;  3L7O A;  3D6F B;  3KLF B;  1RT3 A;  4M5M A;  2LEA A;  1Q95 G;  4ZCK A;  3QQC D;  3DI6 B;  3QID A;  5LJ5 Y;  3AJ1 A;  4DR5 F;  3SCJ E;  3MM5 B;  4P10 A;  3GPA A;  2R8H A;  2FHJ A;  4LFB F;  4FN5 A;  1X5S A;  4WFN Q;  3L09 A;  4DV4 J;  1NZ8 A;  3GIR A;  1EQ0 A;  4LUB A;  4JI0 F;  1N6Q A;  3PHE A;  1H0H B;  1D9A A;  3TW0 A;  2Z30 B;  2OML A;  1H2U X;  3TA1 A;  1JK9 B;  2PC6 A;  3P4U B;  1MMD A;  2P9G A;  4WZM A;  3T19 A;  1HQE A;  3FBF A;  2CJK A;  4FBU A;  1OMS A;  2OJ3 A;  2AZ1 A;  2DHA A;  1VQ6 S;  1MLA A;  2CJX B;  4OI3 A;  5J2Q A;  3T5K A;  3T6J A;  5F3T A;  3PXG a;  2QL5 B;  2GVZ B;  2Z2M A;  1FWP A;  3IS9 B;  3NCQ A;  3BQ2 A;  3M9M B;  5CYJ A;  2VG6 A;  3EM1 A;  3TJ9 A;  3N6L A;  2YVS A;  1EP4 A;  2R7U A;  3BO3 A;  4E8U A;  3BDE A;  4CDI A;  5HO4 A;  2F1F A;  3VQS A;  3DCA A;  3Q24 A;  2XMT A;  3PEH A;  1YZ7 A;  4OV1 A;  2MZS A;  2Y1R I;  2BQU A;  1RTI B;  5EHH A;  2HQ3 A;  1ZH5 A;  4H4M A;  1SJF A;  1SQG A;  3MEE B;  1RWX B;  3TYT A;  4BDP A;  1C4C A;  2X1F A;  3J80 Y;  1RTH A;  4I69 A;  3QJP A;  3HHD A;  3TAP A;  3DGP A;  4AND A;  4ZVS B;  2YPY A;  1HFE L;  2YNG A;  5KFC A;  4KGZ B;  1IKW B;  2BJ8 A;  2HHT A;  1I94 F;  2KHC A;  3KG1 A;  3FMB A;  1PSD A;  4JI8 J;  4A48 A;  2IAJ A;  1YJW S;  4NOH A;  2MKY A;  4NL5 A;  5CQG A;  1SBR A;  2EWH A;  4V19 J;  2VU5 A;  1G4C A;  5KFL A;  5CD4 A;  2ZEJ A;  2CQB A;  1IBM F;  4OV6 A;  3AJD A;  2KDO A;  4KKO A;  2M7S A;  5KT3 A;  3KTQ A;  4NLG A;  2DGW A;  5KT6 A;  4OZ1 A;  2J0X A;  3FEZ A;  3H59 A;  2VQF F;  1BHN A;  2WON A;  1KQK A;  1SKS A;  3CCS S;  4YDX A;  2KG1 A;  4ZVF A;  1HPZ A;  4EYH B;  3UDE A;  1V3Z A;  2CJQ A;  5I3U B;  1PBA A;  2UUC J;  2ZOF A;  4XDC A;  5DJB A;  2VBX A;  4RBU A;  2JRS A;  4MIW A;  3TO8 A;  1C1B A;  2V63 A;  3MPD A;  1ZPV A;  2CWK A;  2HHU A;  3CDW A;  5DG8 A;  4F4A A;  4B17 A;  5F3Z A;  1Q81 T;  1TKX B;  4UY8 T;  4KT0 C;  1F1B B;  1OYD A;  1P1L A;  1YSJ A;  1S57 A;  4ECY A;  4QIE A;  1UVK A;  2X7I A;  2ZUA A;  1UZH A;  2FHM A;  3MPU B;  4FYY B;  3AOB A;  3PW0 A;  2UV8 G;  2ZJQ Q;  1V3S A;  4NLW A;  4DR1 F;  3ULH A;  4TXS A;  4FYV B;  1JNZ B;  2XZD B;  3FZ2 A;  4UOF A;  2HZA A;  4DSJ A;  1FK9 B;  2ABY A;  1UPP A;  4C98 A;  1VQO S;  3G6V A;  3K5P A;  3HHL A;  1YJT A;  2J5A A;  2KVI A;  1RLC L;  1WC0 A;  2J76 E;  4F4W A;  4N77 A;  1RB0 A;  1YRT A;  2IJN A;  3KG0 A;  3DLB A;  3KXD A;  1R31 A;  4HT7 A;  4RUH A;  2R42 A;  4CM0 A;  2RRA A;  3W3S A;  5T41 A;  3QZ8 A;  4H4M B;  5B0A A;  2VBY A;  2AGO A;  2B43 A;  1IN0 A;  3J7A N;  3D1H A;  4OYO A;  1OQ6 A;  4Q0B A;  1ZZF A;  2BAB A;  1NDK A;  2OO4 A;  3ILJ A;  3UFC X;  2P9C A;  3M6V A;  4P74 A;  2B3T B;  3JSM A;  4C8Y A;  2DH7 A;  2W7P A;  2UVV A;  4YHH F;  2NUU G;  3M6U A;  3ZC4 A;  2RSQ A;  5L1I A;  5LSL A;  4Z37 A;  2GIQ A;  4OJ3 A;  5F0U A;  1S1T A;  3IAM 9;  3MED A;  2RUS A;  4PWU A;  2MY8 A;  4LBH A;  1TAQ A;  5DLF A;  3GZ7 A;  1ZM2 A;  4R0E A;  1VI7 A;  2VOD A;  1QAX A;  2DTJ A;  4QW8 A;  3IMQ J;  2D3O 1;  3WIU A;  4C8Z A;  4M94 A;  1DTT A;  3BGL A;  1DAX A;  4K2J A;  1IM4 A;  2W4C A;  4HHJ A;  2Q6C A;  4B3S J;  2GMH A;  1RK8 A;  1B7Y B;  4RW8 B;  4U7U D;  1DLO B;  4C48 A;  3GR1 A;  4GKJ F;  1TK8 A;  6AT1 B;  5JJB A;  1NHU A;  3NAI A;  1ZS6 A;  5CCL A;  5K14 B;  5H9E K;  1WF2 A;  5IT4 A;  2EK1 A;  4LF1 A;  3FZB A;  2R8I A;  1YKW A;  2VV5 A;  3MD3 A;  5M2P A;  3NXZ A;  3GIK A;  3BM7 A;  3IGV A;  2QA1 A;  5E7O B;  1BY9 A;  4LR9 A;  1W2B R;  1VQ7 S;  3C16 A;  3PFE A;  3GV8 B;  4UW2 A;  1MW7 A;  1WSR A;  1JLC A;  3OTC A;  3PW4 A;  3TVK A;  4WU2 A;  4O0I A;  3CJ0 A;  2AYE A;  3KHH A;  1RTJ B;  3JTP A;  3EVO A;  2BOA A;  3M30 B;  2FHJ D;  1VQK S;  3M2V A;  2RML A;  4LSN B;  2B51 A;  3SSS A;  4KR0 B;  2ZD1 B;  1O5J A;  3NL0 A;  4ALZ A;  2GCF A;  1AFI A;  3MUV P;  1N32 J;  1SC3 B;  5K8O A;  5D0G A;  2WTF A;  5HP1 A;  4USK A;  1TL4 A;  3KKF A;  3MEC B;  4E98 A;  1FRX A;  3UR0 A;  4G1Q A;  4ANC A;  1TKZ B;  1Q7Y T;  2DXD A;  2XO6 A;  4N56 A;  1T9T A;  3IG1 B;  3D0G E;  4C0B A;  2XUL A;  5K9F A;  3MUR P;  4IOA Q;  2CPJ A;  2BX6 A;  3PO5 A;  3TEG A;  5K5M A;  5JMN A;  1C1C A;  3KHR A;  3C19 A;  2O1P A;  3ADA C;  4IH5 A;  1GMV A;  2KVQ E;  4B9M A;  5I42 A;  3HP6 A;  2BZ2 A;  4BCA A;  3AD9 C;  2P5V A;  4ECV A;  3D6M B;  1YVF A;  3FUY A;  5IQ6 A;  3DLG B;  3GIJ A;  2H51 B;  4PXC A;  1O51 A;  5HRO A;  2HHX A;  5KG0 A;  3OBI A;  3OR2 B;  3IBW A;  1Y7P A;  3T1H J;  2DEJ A;  2C2E A;  2BM1 A;  2V69 A;  4EGL A;  1KQG B;  2HQC A;  1NK0 A;  2DGQ A;  1NKC A;  2ZWO A;  3FQK A;  3U7J A;  2H1Y A;  4F0M A;  4HTI A;  2KZZ A;  2YNH A;  2ADC A;  1PJ6 A;  1T3O A;  3Q8Y A;  1AT1 B;  4N8N A;  4DV1 J;  5HVG A;  4C3M A;  2H5I B;  4IDK B;  1KQS R;  1GFW B;  1FNM A;  2BVZ A;  2AJ2 A;  3GU0 A;  2IA0 A;  4B3O B;  4QR1 A;  1CUL A;  4CLY A;  1D8Y A;  2E7V A;  1PYO B;  2VFR A;  3UVJ A;  4OI1 A;  3TUZ C;  1QVF R;  2WSC C;  2ZUG A;  3GYN A;  1M5V C;  2VFU A;  2L9N A;  1S0M A;  2BYC A;  2ZVS A;  1L5U A;  4DUZ F;  2DNM A;  4IFY A;  3W9H A;  1FFS B;  1VBZ A;  1HBU B;  4KC5 A;  3FCV A;  2RRN A;  4L72 B;  3GR0 A;  1L3K A;  2FY8 A;  3L3C A;  1W2I A;  3GWC A;  4NRU A;  1V3R A;  1T0T V;  4IO1 A;  4FNH A;  3N5F A;  4QU7 A;  2DHX A;  2L08 A;  3HDS A;  2IDE A;  5KT4 A;  1IQZ A;  2AJQ A;  4LBI A;  4FP9 A;  2MEW A;  2CQD A;  3MFI A;  1RT5 A;  2LDI A;  4K50 A;  3VAH A;  1RWN B;  3G82 B;  5L8R C;  2DR5 A;  4ZVR B;  1HLW A;  1HWK A;  3DMJ A;  3M2V B;  1A0O B;  1EIY B;  3NNA A;  2RNE A;  2C22 A;  3CD7 A;  3GFY A;  4ID8 A;  3M2U A;  4MFB A;  3CDE A;  2A2D A;  2W7O A;  5HQ8 A;  3PX0 A;  3E8O A;  3MUT P;  2WK4 A;  3TP2 A;  1EET A;  1WEL A;  2XMW A;  5A2Q U;  4JI7 F;  1SKU B;  3QRQ A;  3U1N A;  3D3C J;  3HSZ A;  3OTO F;  2HZV A;  4UZC A;  4KBI A;  3DRX A;  2GVD A;  1GXT A;  2H9Z A;  1X7V A;  1WI6 A;  1A6L A;  3TQ1 A;  3CDB A;  2JLE A;  1VRT A;  4FS1 A;  1VIX A;  2QO3 A;  3FSX A;  1PCA A;  2CPZ A;  3W8P A;  4NA1 A;  5D3G A;  1FX4 A;  5CAA A;  2MLY A;  2OPR B;  2DNO A;  2FVS A;  3R2D J;  2V9K A;  2LEB A;  5T7L A;  2BKO A;  1QD1 A;  4KY3 A;  1HMV B;  4LIR A;  2RIJ A;  1QUV A;  2V2Z A;  5L46 A;  3HHL D;  3KJV A;  4TQS A;  1HNW F;  3TAQ A;  2N7Y A;  2VB6 A;  5KFA A;  1CC7 A;  4WK3 A;  2GHP A;  2K7K A;  1ACM B;  3M8P B;  1LWE A;  2HUR A;  4DPX A;  5E33 A;  1BWE A;  1ARO P;  4USU A;  1NU4 A;  2NXC A;  1KS2 A;  2ZHO A;  2ZWP A;  2ZHA A;  2N4D A;  4KTQ A;  4USM A;  2WW4 A;  3NWR A;  4ITS A;  3R7N B;  1QTM A;  3D4J A;  4WFB Q;  4X64 J;  1TL3 B;  4G1I A;  4MJK A;  2UVR A;  3UD5 A;  4KH1 B;  1F60 B;  2WVB A;  1R0A A;  4MK8 A;  3TAR A;  5JUM A;  4AE5 A;  3I31 A;  3MMB A;  3BGR A;  2HZC A;  4IFY B;  2W24 A;  2CVE A;  1C4A A;  1U8W A;  2LFV A;  5L9X A;  2KN4 A;  2M88 A;  2D3U A;  4NLR A;  4HLB A;  1KLM B;  5IV3 A;  1FDB A;  1YRX A;  2YNI B;  2F63 A;  3QYY A;  2ILZ A;  4QWD A;  3DN9 A;  2JLF A;  4QOT A;  3KUE A;  4ILL A;  1GEH A;  1CJV B;  2CNK B;  1RTD B;  3FSI A;  3G8Q A;  2KHD A;  3P5T L;  1RT5 B;  2G2O A;  4LJM A;  2O5D A;  2BEF A;  5DM7 Q;  2MHE A;  3Q23 A;  4J9U E;  3OW2 R;  2F5G A;  4CYU B;  4RWX A;  2AWZ A;  4OZL A;  3SYZ A;  2D3O R;  2RQK A;  2W01 A;  2HRY A;  4ETX A;  3M2U B;  2DGS A;  4OFZ A;  3CXC R;  3P45 B;  2XSJ A;  4C9D A;  5HMX A;  5IT0 A;  5KFF A;  3C46 A;  4TY8 A;  4QWB A;  4RUA A;  4JI5 F;  3AB4 B;  4LRE A;  1UWB B;  1VOM A;  3VAL A;  2XS7 A;  4QIG A;  3CNQ P;  1XMO J;  3UDV A;  3GCX P;  1B4S A;  3UCZ P;  2E5L F;  3CO0 P;  4ZJO A;  3RR8 A;  6FD1 A;  4LR8 A;  3MMA A;  4OHY A;  1TUW A;  4GC6 A;  1WG4 A;  3U27 A;  1HKA A;  3ZTP A;  3MR2 A;  3DU6 A;  3AXK A;  1OPZ A;  5B0F A;  2E1P A;  4P71 A;  5GAD I;  2CPH A;  1M0S A;  4KGM A;  4FXD A;  3TQE A;  1IR2 A;  1IR0 A;  2KFY A;  2CAD A;  2Q79 A;  2R2R A;  4AL5 A;  4H4O A;  5DDR C;  4OZ0 A;  1IJE B;  3M32 A;  2FVC A;  2F65 A;  3NCP A;  2RE1 A;  1HYS A;  1YJ9 S;  5J1N A;  3ENV A;  5DRK A;  4YME A;  3H42 A;  1JJC B;  1N4L A;  1I5O B;  1Y5L B;  2HS0 A;  3EVW A;  3RRK A;  4LF5 J;  3G8T A;  4C8M A;  2FJX A;  3V81 B;  4XAK A;  3SCI E;  1CJU A;  1RAI B;  3HF5 A;  3NG8 A;  4C11 B;  1N48 A;  4M5K A;  4X4S A;  3T5L A;  1TVR A;  4M5D B;  5DQG A;  3C8Y A;  4CLK A;  5E0O A;  1K9M T;  3UN5 A;  4PWW A;  5U47 A;  3RB4 A;  2IRU A;  3BRE A;  1P8G A;  1IM6 A;  1U2F A;  1R0A B;  2IM2 A;  1UW4 A;  2LLZ A;  2HNZ A;  4NWB A;  4J9P A;  2CRL A;  5LT5 A;  5CYM A;  3OLB A;  2XQC A;  3KLI B;  2VPZ B;  3LQV A;  1YIJ S;  2CPX A;  3M8S A;  4JI1 F;  1SJ1 A;  2FZC B;  3GFZ A;  2YTC A;  4ZLJ A;  1LWC B;  2LQ8 A;  4MTP A;  5AXN A;  1RU1 A;  3DU5 A;  1VYA A;  3OVB A;  2YBV A;  2D41 A;  2XGQ A;  4DX7 A;  2A6O A;  4USV A;  2XY7 A;  1Z2L A;  2CZ9 A;  2BRL A;  2HBR B;  1UVJ A;  4NXN J;  4TU9 A;  3UQS A;  2F4V F;  2W4D A;  3VTI A;  2HHH F;  4ECZ A;  4IRD A;  4TNO A;  2KRR A;  1X5T A;  2O01 C;  3HSD A;  4OIX A;  2XSF A;  3W8G A;  3JTN A;  3J81 U;  3FFI A;  1X5O A;  3P96 A;  3D6T B;  4O3Q A;  4K0K J;  5AXL A;  1T9Y A;  3OHB A;  2VL1 A;  1NH7 A;  4IR9 A;  2OEM A;  1GXU A;  2ZBC A;  3HSJ A;  5KFW A;  4JI2 J;  2YQ3 A;  5J2M B;  3KLH A;  2R7S A;  1JNR B;  2B9Y A;  1N33 J;  3IBC B;  4WZQ A;  2Z4P A;  1RSC A;  4I68 A;  1SL1 A;  2XSJ B;  3K89 A;  3M1V B;  3VGS A;  4F26 A;  4KO0 A;  2FJE B;  3WDO A;  4CH1 A;  4GVB A;  2G0C A;  4DL6 A;  1U26 A;  3W61 A;  4C8N A;  5FD1 A;  1V9O A;  2Z57 B;  2W2O P;  4QZV B;  1L3S A;  3R5B A;  1WAC A;  1HNV B;  4FXW A;  2HFN A;  3MMA B;  2IVM A;  4I0W A;  2YWF A;  4LR7 A;  3TJA A;  4DLG A;  4DL7 A;  4MIA A;  3A8E A;  1VCT A;  3ET6 A;  2G13 A;  1QDU B;  1RT7 B;  5RUB A;  4E2F B;  3PX6 A;  4P73 A;  3VR1 A;  4AL7 A;  1WTF A;  4ECQ A;  2P8I A;  3MAH A;  2UXD J;  1M5S A;  4CQ1 A;  2GX8 A;  4WIQ A;  2JH3 A;  2P6T A;  1F3V A;  4LFB J;  4HAC B;  5K8P A;  4NXM J;  4M63 A;  4V19 X;  1JIH A;  4QPT A;  3IP0 A;  1ZTT A;  2XMU A;  1D1U A;  3CF5 Q;  1CLF A;  3CME S;  4Q44 A;  2AMC B;  3OL8 A;  5KG7 A;  1HNX F;  5KG3 A;  5ADZ A;  1ZM9 A;  3ELH A;  2HVH A;  1FJ7 A;  1C0U B;  2IA6 A;  5CXT A;  5BYQ A;  4ZLN A;  2G2Z A;  3B82 A;  3MD1 A;  1ZTW A;  2LA4 A;  1M1H A;  2XYP B;  4J91 A;  3QGP A;  1XMQ F;  5SZT A;  2PI5 A;  1N8R T;  1WKJ A;  3WHI A;  3MCN A;  1R8A A;  4PUO A;  1N36 F;  2QA2 A;  1U2C A;  2Z2Z A;  5AJ3 F;  3QLH B;  2DD8 S;  1A9N B;  1REV A;  2VAS A;  4CLW A;  3EE3 A;  3KK2 A;  1FKP B;  5B0G A;  4ZCM A;  3KUH A;  3AXM A;  2BMB A;  4BWJ A;  4ZLL A;  3BSO A;  3RAX A;  3SDE B;  9RUB A;  4ECR A;  5I3Q A;  1LW0 A;  1IWA A;  1RT6 A;  3VHQ A;  1OY6 A;  2G9O A;  4WFY A;  3AY0 A;  4K8R A;  4ELT A;  1RAA B;  3GFX A;  4RPF A;  1U1R A;  3R5G A;  5D0R A;  2DGX A;  1X60 A;  5LXY A;  1EAR A;  1AB8 A;  4Y3C A;  3IN5 A;  3MM7 B;  1VR6 A;  3UNG C;  1Y0H A;  3KLH B;  2Z8Q A;  4P2X A;  1BUX A;  2EFP A;  2ALY B;  3KYL A;  2XO7 A;  1GX5 A;  4K4Z A;  3TVY A;  2C28 A;  3RR7 A;  5E3R A;  1WHV A;  2HAF A;  2YKN A;  1I94 J;  2KFZ A;  1JKH B;  2VH7 A;  4LT6 A;  5CH7 B;  1T9X A;  4BBY A;  1ZM4 A;  4X4O A;  4UZB A;  3E51 A;  3JYT B;  3OVS A;  2OI2 A;  4Q7A A;  5A0Y B;  3G87 A;  2RD5 C;  1VFJ A;  4J9M A;  2DNZ A;  4TKT A;  4YB7 A;  3C2P A;  3DRS A;  4DL0 C;  1UVL A;  2DHS A;  1U0H B;  1X4H A;  3ILL A;  4DV5 F;  4UQG A;  3PIO Q;  4RNN A;  2DNQ A;  3KK1 A;  3H2L A;  2F3J A;  1HWJ A;  4LQ9 A;  5EWF A;  1W7W A;  4EBC A;  1SI9 A;  3KLE A;  3PRB A;  1SL2 A;  1SQE A;  3T9Z A;  3PW2 A;  3R5C A;  1QSL A;  2AQ4 A;  3H7H B;  2M0G B;  2BUN A;  2KJV A;  4C97 A;  3MCO A;  3AD8 C;  1UEU A;  2DT9 A;  2JJ4 D;  3DOM A;  4IG0 A;  2L9D A;  3DLL Q;  1UEK A;  1RAG B;  4KV8 A;  2BJD A;  2MZJ A;  4WYW A;  2UU9 J;  1R8P A;  2JFD A;  1S77 D;  2FB0 A;  3Q8V A;  2YKM A;  3KK3 B;  4AL6 A;  3HMJ G;  1Q0N A;  4TU7 A;  3LA0 A;  4OX9 J;  2XY5 A;  1I6J A;  4O23 A;  3D1O A;  3LTO A;  5F9N A;  1I3O B;  3JQM A;  3CWJ A;  1SQF A;  2YY3 A;  2B4P A;  1QTN B;  4O0N A;  3DHX A;  1LXN A;  1DUR A;  2CWX A;  3BV8 A;  4PUO B;  2VON A;  1NPK A;  2E9T A;  2RH3 A;  3OL7 A;  4Q2L A;  1N54 B;  3J80 U;  3FDS A;  1W25 A;  2FHK A;  3TUJ C;  4LRB A;  3H98 A;  3KK2 B;  4DV7 J;  1MN9 A;  4DS5 A;  2IMO A;  1Y10 A;  1D0E A;  3MR6 A;  4RR5 A;  2HG4 A;  2D3Z A;  1NKB A;  4F7V A;  3Q8U A;  1QSY A;  4ED3 A;  1KQF B;  3RAM A;  1FCA A;  3T1Y J;  5KFM A;  1XR6 A;  4DSL A;  3A3P B;  1EJ7 L;  3JSB A;  1FKO A;  3C14 A;  2XLI A;  4LSL A;  3JQJ A;  4O4G A;  4QU6 A;  1TP7 A;  2HBY B;  1OO0 B;  5THW A;  3QAT A;  2N82 B;  2AF6 A;  2C3Y A;  2DGT A;  4IQX A;  4OHX A;  4ZCI A;  2YX4 A;  5IOL A;  5F9L A;  2R8G A;  2YKP A;  4FXV A;  4DUY F;  4USH A;  1NM2 A;  4DQP A;  2HIQ A;  2DXF A;  1IBL J;  2DR6 A;  2YKN B;  1HR0 F;  3NBP B;  3R2C J;  1VLY A;  4DL2 A;  1RKI A;  3FCH A;  5F8I A;  2M2B A;  5L38 A;  1D3W A;  3Q89 A;  2OGU A;  4M5I A;  1J5O A;  3M2R A;  4NA3 A;  2J9C A;  5IM0 A;  2M9K A;  3Q8S B;  2AX1 A;  1RAB B;  3CJK A;  1TAU A;  4HEA 9;  1B70 B;  4GO5 X;  3QRP A;  2JC0 A;  2X1G A;  3QGI A;  3K5L A;  3ENQ A;  4A8F A;  2GHV C;  3T9N A;  4I6A A;  1GQE A;  1TR0 A;  2KT2 A;  3P6Y C;  5J1E A;  2MZQ A;  3H5U A;  1VDH A;  4PQU B;  4G1P A;  4Y2I A;  3X3U A;  5JVG Q;  2AD9 A;  2YWE A;  1NXI A;  3NNC A;  2VG7 A;  2CQ4 A;  2MJN A;  1IKX B;  5KFB A;  5HVH A;  2I5J A;  1AXQ A;  4LRA A;  1TTH B;  1U1M A;  3DOM B;  1VRU B;  2ASJ A;  1RT4 A;  1NEE A;  1HA1 A;  1SV5 A;  2GQQ A;  3GYX B;  2CIM A;  1VQ8 S;  1ICE B;  3THV A;  1YBT A;  1NJX A;  2AJ1 A;  2J6T A;  5HMW A;  2E5G A;  4F0K A;  2FVQ A;  3PR4 A;  4L3N A;  4R5P B;  3HD1 A;  2BAN A;  1JLF B;  2PGC A;  1PO6 A;  3RJM B;  4AT1 B;  4OYX A;  1UZD A;  3KMQ A;  1Y00 A;  4P9S A;  4LVO P;  3FRY A;  2VFV A;  5LMN F;  3CJR A;  4DQR A;  3NS5 A;  3I0R A;  3DRR A;  3GCW P;  2QFI A;  4RW6 B;  1M5K C;  4QR0 A;  1H73 A;  1I1G A;  4DFM A;  2XI3 A;  1LWF A;  4B3R F;  1IKY A;  2NUH A;  2YNF B;  2QJ3 A;  3M6X A;  5ETR A;  3I5A A;  1N0V C;  4GC7 A;  3K57 A;  3DRP B;  4PWD A;  1VK3 A;  2AT1 B;  2BRK A;  4IKA A;  2KH9 A;  1YHQ S;  4KFB B;  2HBQ B;  1GK8 A;  1RUS A;  1HD0 A;  3VAK A;  3UD3 P;  4M5G A;  3J7Z 5;  2HFS A;  4B08 A;  2K06 A;  2VQE J;  1F5C A;  2XNQ A;  5EGY A;  2DNK A;  2F9J A;  4IG3 A;  5HVF A;  4P7V A;  3MM9 A;  1IWG A;  1NB2 A;  2MZ1 A;  4DCJ B;  4K4V A;  4CT8 A;  5BJR A;  4QW9 A;  3CDU A;  2EKY A;  4O44 B;  2CQC A;  2V0N A;  4OI0 A;  1M5P C;  1RAC B;  4ICL B;  2K7J A;  2LQ5 A;  4I7F B;  2RJZ A;  5KT2 A;  4Y34 A;  4NLQ A;  4NI2 A;  1FA0 A;  1FWL A;  1TL7 B;  3H25 A;  4DR2 F;  2L3M A;  4JV1 A;  1RIS A;  2I1R A;  1IKV A;  4DPT A;  3MCS A;  3BDP A;  2QYC A;  3JS9 A;  1RKJ A;  3SQO P;  1TKD A;  2IBO A;  1CS4 B;  4RX6 A;  2HK2 A;  5D15 A;  3DM2 A;  4LFC F;  1S49 A;  2IRY A;  3UDC A;  4AFF A;  4K4T A;  5ITH A;  4ZPT R;  1PYT A;  1NDL A;  1UJ5 A;  3EGV A;  3K59 A;  1HQU A;  5L9N A;  4RNF A;  1XMB A;  3ZTQ A;  2HHQ A;  3CCV S;  3QIP B;  4HH1 A;  3LAK A;  3VGU A;  4ZHR B;  2RB7 A;  3FKB A;  4DV6 J;  8RUC A;  3TR5 A;  1J2V A;  3R7S B; 
#chains in the Genus database with same CATH homology
 4UZB A;  4K2J A;  1VHI A;  5A76 A;  4BLG A;  2YQ0 A;  1B3T A;  2YPZ A;  2YQ1 A;  4UZC A;  2YPY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...