5A76A

Kshv lana (orf73) c-terminal domain, open non-ring conformation: orthorhombic crystal form
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
117
structure length
109
Chain Sequence
AKARPQHIFYRRFLGKDGRPKCQWKFAVIFWGNDPYGLKKLSQAFQFGGVKAGPVSCLPHPITYCVYVYCQNKDTSKKVQMARLAWEASHPLAGNLQSSIVKFKKPLPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Dna binding protein
molecule keywords ORF 73
publication title Kshv But not Mhv-68 Lana Induces a Strong Bend Upon Binding to Terminal Repeat Viral DNA.
pubmed doi rcsb
source organism Human herpesvirus 8
total genus 26
structure length 109
sequence length 117
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2015-07-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.390 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Epstein Barr virus nuclear antigen-1, DNA-binding domain 5a76A00
2YPZA 4UZBA 2YQ1A 2YQ0A 2YPYA 4K2JA 1B3TA 5A76A 1VHIA 4BLGA 4UZCA
chains in the Genus database with same CATH superfamily
4HACB 4QWDA 1UCNA 1RTHB 4MKYA 3CJKB 3CD6S 3R5CA 1GNKA 2YKAA 2J9DE 4LSNB 2OPQA 3I6PA 5AXKA 3MAHA 1MWYA 4DS5A 4P2SA 2ZH1A 2DPJA 4TN2A 1FKOA 1S4FA 2MPUA 2YX7A 3S6EA 4UY8T 4TU9A 2D9OA 4A46A 5HLFB 2DRAA 1RAGB 4Z7CA 1YJWS 5LSLA 3A8EA 2OEKA 1FX4A 4KGZB 1WC4A 2ALYB 3N28A 2KVQE 2GJ2A 1KVJA 4QJVA 2J7WA 2XLJA 1RT6B 2OPRB 2YWFA 5I3UA 4DSKA 1G4CA 4YDDB 3PHTA 4L3NA 2L3MA 5FJ4A 2PFFB 1TL4A 3BV8A 1NDKA 4KFBA 1TELA 4M5NA 3GCWP 2DK2A 3CMQA 5ETTA 3DRSA 3WZ0A 2EK6A 3PYGA 2RKIA 2W4CA 2OTJS 2WONA 4DR7F 1SPBP 2W9BB 1U7LA 1F60B 2B9XA 4MIAA 1R8BA 2CZ9A 1UWBB 4NRTA 4AYBD 4E2FB 3GV5B 2CJQA 2C3YA 4O0NA 7FD1A 1SIZA 4CLUA 1GMWD 2AX0A 4EFAC 2OELA 1WHWA 2VG5B 2VF3A 2WB1D 4LF6F 4LSZB 3SCLE 3TUJC 2VFVA 3A8JA 3TQEA 2JWNA 4MK7A 1FKPB 1NM2A 4Y65A 3R5GA 1IBMJ 2X3DA 2MJNA 1LWCA 2FB0A 3JQMA 3LOUA 4CIOA 4XK8C 1S99A 4A8QA 1HI8A 1Q8BA 5KFPA 4FP9A 2R7SA 3PW7A 1UZHA 1S6QA 1YJUA 2K2PA 4USTA 3RUBL 2XY5A 2H5EA 4RWXA 1K0TA 1KKHA 5HO4A 4EBEA 1S79A 3DU5A 3PX6A 3NGRA 2V4JA 1U1LA 4R8UB 4E8UA 4JBCA 4KBIA 1EB0A 3OLBA 2DIVA 5KFDA 2KZMA 3VWSA 5M2RA 1OPZA 2QC3A 1MNEA 4A8KA 2KT5A 5EDWA 1YJRA 2W9CA 2IJNA 4O23A 2BM0A 3ZNJ1 1Q81T 3TZZA 4NLPA 4RR5A 2DXDA 1U2RA 1N32J 4CO3A 4ZITA 2MLYA 2BJ3A 3PJ9A 3TNVA 4KTQA 4DFMA 4ZVEA 2B8QA 3HDSA 3V6JA 4DQQA 1AYEA 3GSIA 4DF4A 2JEFA 3H90A 2RSQA 2QZ8A 3ZXWA 1SQGA 1D9DA 4P7VA 1Q8LA 2DNPA 3EJMA 2GMJA 2DGUA 2KM8B 3I0SA 3V6KA 3LAKA 4ZPAA 2BXJA 3IR5B 1F3FA 2AJ2A 2DHSA 3OJUA 2YKQA 3P49B 1NLKL 2J9EA 4TY8B 3ILIA 3CJRA 1S48A 1EJ7L 1JLEB 2ZM6F 4GRSA 3BSAA 4CLSA 1RWXB 3N01A 2ZJPQ 3LAMA 3I9V9 5CH7B 3OTOF 3LGHA 3NGTA 4N77A 3ZTSA 2MKJA 4CRJA 4FF1A 2XEXA 4CNYA 4NLUA 3GCXP 5IT9Y 1C4AA 3I32A 4HT7A 2FZCB 1WC5A 3NNHA 4U96A 3AB2B 4ECWA 2QL5B 2C22A 2F8EX 1LXJA 1O8BA 2WSFC 2FC9A 3HM9A 4G1QB 4B9UA 2BE9B 2IVMA 4CT8A 1Q7LB 1CJUB 3QRRA 2J0WA 3R5BA 1XR6A 4B08A 4R25A 4USIA 1URNA 3TA1A 1KN6A 5F0UA 1DJ0A 1TMJA 2MZRA 3FFIA 2CQ1A 2A0FB 4DR3J 2HHPA 4B9VA 4S0MA 1QVFR 4ID5A 4YS2A 5KFOA 1CULA 2AYMA 3W3SA 4JI2J 3K17A 4GVBA 3WQPA 1T05A 5KFHA 2KB2A 4Y6IA 1IKWB 2BANA 4K4WA 4I69A 3AY0A 2MKYA 4MKAA 2KZZA 1S97A 3R2DJ 1WC1A 1Q0NA 2KT3A 2E5GA 3BF4A 5C24A 1UVJA 4W4MA 3F44A 1SBRA 2OLWA 3OFGA 2QMUB 1VQ4S 4TU7A 1J2VA 3NRBA 2ZZNA 3MM6A 1BY9A 4K2JA 3OTDA 5KFLA 3EVWA 3N5BA 2G4BA 2AEJA 3VAIA 1HQUB 2RF2A 2RQMA 4DLGA 1Q4RA 3CJ3A 4LF1A 4DLEA 3H5SA 4NYOA 4HL9A 3RGIA 3HVTA 4LF5J 3VGSA 3GYGA 4ETZA 1WJ9A 4NPOA 3NCQA 5L1JA 1X5SA 3QAUA 4KRWA 5A2QY 1LW0B 4Y2MA 3W2VA 1M5OC 3BYPA 4CH0S 3RBEA 4ZP6A 2QYCA 1U8SA 1EHWA 2VOPA 3JSRA 1N4LA 1VYAA 2CWXA 2G0IA 5ETOA 4DG1B 4WU3A 4DCOB 5BJRA 1T9UA 4TNOA 1N6QA 3QRPA 2NS1B 4G65A 4Y28C 2B0GA 4OQJA 1IBCB 1VDHA 1GK8A 1TL3B 3T9ZA 2DB1A 3Q8VA 2XZDB 1DQ8A 3M6VA 5H1SV 5CHCB 4ZVSB 5HQMA 2AJ1A 1WOOA 4IRCA 2XHWA 3MR2A 2KVIA 2NCKL 3B4MA 2XMKA 3K2YA 2XLKA 1XQIA 2D41A 5CD4A 4DV7J 4P10A 4ED2A 3W7BA 2BKPA 3OR2B 2A3JA 1T02A 4Y3CA 3EWGA 5JUMA 1FRMA 1JNZB 2HYIB 3MMCB 2DHGA 4I6WA 1H72C 4RW4A 2YQ0A 4I2PA 2H9ZA 1U09A 1TK0A 1OPIA 3DLEA 4OZ5A 4K0KJ 4MFBA 1JWWA 3VZHA 5B08A 4OZLA 4W92B 3D1HA 3LP1B 4LSLA 1JB0C 3QRQA 3MAQA 3D0IE 2XMTA 2ATLA 2DR6A 4JV2A 4WCEQ 3T1HJ 2J6UA 4J9SA 1Q8IA 2HBYB 4LBHA 2I6WA 2CNLB 3LGMA 3OUYB 2FTRA 4ER8A 1MROA 2W2PP 1K44A 1IQZA 1VFJA 2MZTA 2LQBA 1S1WA 2R2UA 2B6AB 4F4XA 2EBGA 2H4WB 2CJ9A 1S1XA 4YMEA 3BBBA 4WBFA 2GHPA 1LWFA 1PG5B 4K0KF 1B3TA 4JI0F 4XO0A 1S7HA 2YKOA 1UEKA 2WVDA 2CPEA 1ICEB 4QYZJ 4NLVA 3MXHP 3M30B 2HQCA 2RHSB 3CD7A 3WC0A 3T1HF 1VQ8S 2POKA 4ZVFA 2RNEA 3OD2A 3PZPA 3MM7A 4OZ3A 3FBEA 2ZOGA 2IVYA 4XTTA 1FO1A 2PA8D 4J9LA 3C6TA 2BE2A 5IV4A 3CWJA 1LKZA 1QAXA 1NDPA 4Q7AA 3ZC4A 2NREA 2WVBA 2HVEA 3GR1A 4AL6A 1VQYA 4UW2A 1UFWA 2ADCA 2HMIB 2DHXA 3I56S 1FHTA 1HR0F 3PX0A 4TLRA 2RD5C 3FQKA 5LMUJ 3QGHA 3CO0P 1NK9A 3K8VA 3MAAB 1T9YA 1F2HA 3R1HA 3Q8YA 3NCRA 2RE1A 5CABA 2FVPA 2HSEB 1JLBB 4B3RJ 2DR9A 1FK9A 2IC3B 2E1AA 5DQHA 4FYVB 1WHXA 4RJVA 4ECZA 1HQEB 2VB6A 3B78A 2RILA 1FFWB 3N6NA 4NLRA 3CMAS 1DAXA 4ZLJA 2CQ2A 4JI5J 1TUVA 1U6ZA 3IGNA 4CO2A 4RKUC 3EPIA 4LVNP 1R0CB 2KRRA 2KFYA 2OMLA 3E8OA 4OJHA 1NSPA 4AXJA 1BQNA 3MHYA 2B51A 4H4MB 2W8KA 4MKBA 3Q0AA 3POTB 1CBKA 4HDHA 4M1KA 3OL9A 1PAUB 2NXJA 2H5JB 4ILRA 3D1OA 2ASLA 1KTVA 4R0EA 1T95A 7AT1B 4GKJF 2EG2A 1U0HA 2ZBIA 2MQPA 3OV7A 2C1EB 4JI5F 5L46A 2XSFA 5DETA 3GONA 2BQ3A 1N52B 2D3OR 2GJIA 4UQTA 2NYIA 3RB0A 3EDQB 4MAKA 3M2VA 3NGUA 2HZCA 1I1GA 1RADB 2CPZA 3R6GB 1U1OA 2O1PA 3MMAA 3IR7B 4EU0A 1I94F 1NDLA 4J9QA 2IM0A 1QAYA 2XWYA 4K4TA 1FERA 5IOLA 2X1BA 1XC9A 3IS9B 3MM8B 3CCMS 5BYSA 2DEIA 3S01A 4NYZA 1B0PA 1HBNA 1NNDA 1QSYA 5A8RA 4L73A 1XMQF 1EETB 1FXDA 3GJTB 1RT1A 1F0XA 5LM7E 2WOMB 1MWQA 2LQ5A 2CPIA 2EPIA 1KNZA 2ZOFA 3TUIC 1NJYA 3GJQB 4C0HA 1HWIA 5BYRA 5ETNA 1NK5A 5J1PA 1SB6A 2HW3A 4L75A 4YB7A 2XZWA 2LDYA 2Y3YA 2XYGB 2AJ0A 1Y10A 3MPYA 3OL6A 4HACA 1RTHA 3CJKA 3N4WA 2F40A 3TUPA 2PMWA 4DL0C 4FN5A 3C3LA 3MDFA 4LSNA 3CTRA 1ZS6A 3DRRB 3E01B 1PJ7A 1GX6A 2PMZD 1UVKA 4O3RA 1Q1KA 4FYWB 3BR8A 4DU7A 5HLFA 4OI4A 4KY3A 5LJ5Y 3J81j 1VQOS 2ALZA 3G8TA 3CJ2A 4Q2LA 1M5VC 2ZJRQ 3QJPA 3GR0A 4RW7B 4ZLNA 4LQ9A 2I8EA 4FVCA 4OYAA 3TA2A 4J7CA 2EFQA 2VOOA 3WBZA 4JI1J 5JVHQ 3I5AA 4PXBA 2LQ8A 4F36A 2UV8A 3VAJA 4HR2A 6FDRA 5GAGI 3VF0B 2W9BA 3GU0A 4TQSA 2NLWA 4CP5A 3NS5A 1WF1A 2Y1RI 1ZZNA 1UWBA 2B4VA 8RUCA 3VGTA 1SQFA 2J0XA 2WRMA 2XMVA 3OT9A 3QSIA 4GO5X 4AD6A 2Y8WA 3EXYA 4CO5A 2VG7A 2VG5A 3VALA 4CLWA 4KC5A 4JI1F 1R43A 1FKPA 4ILMA 8ATCB 4O4RA 3KK1B 4B9NA 1FFGB 5KFWA 1S77D 1WDDA 4YB6A 2MQQA 4Z7YA 3CDWA 2AKWB 4N7TA 2BQUA 4DV2F 3BDEA 4AFFA 2FLOA 1VQ7S 2V69A 4DOZA 6FD1A 2DO4A 5HVHA 4Q44A 2GNKA 4JI4F 3GYXB 1GH8A 2YWHA 1YITS 2HLTA 2OD6A 4ELTA 1RBLA 2QV6A 3M7VA 3I31A 4R8UA 3W5YA 2MSTA 3AD8C 2F4VF 1BGXT 5D78A 3W5ZA 3P6YC 3D5MA 2VDIA 1NHKL 1JJ4A 3VGUA 3CDUA 2P9CA 3TW0A 2R3VA 4ZLPA 2ZH6A 3FZ2A 5KFMA 3FBBA 4WYWA 2BW7A 2Y1JA 4K4VA 3Q86A 4F4KA 3BGOP 2R7VA 3TZWA 2DY9A 4HT5A 4KJIA 4NXNJ 3KMQA 1JJ2R 3EPGA 3OPKA 2H48B 3EVMA 1JLAA 1SJ4P 1FRXA 2D3UA 4JI7J 5H9FJ 1B64A 1H98A 2HGNA 2HPUA 1U1MA 1M5PC 1WEZA 2QIFA 3A12A 1EP4B 3TUZC 4FF3A 5KG6A 1V3SA 2Z30B 2CZVC 1ITPA 3CSKA 1KD1T 2XB2D 3EDRB 1D8ZA 3R7NB 1T9TA 2MHEA 2IJRA 5C7PA 1SV5B 2YKMB 3HD2A 4HI1A 4TY8A 2R7UA 1JLEA 4P52A 1J5EJ 3DLJA 1HLWA 1S9GB 2AJQA 1VIXA 1UPPA 1FNOA 3SZ2A 3JTNA 2FHJA 2DGXA 2KU7A 5HAOA 4RBUA 5E3RA 1VISA 1AA1B 2UUTA 2MQMA 2D69A 4DQRA 1QJHA 3Q22A 2VD3A 5ETKA 2OD4A 1ZM4A 3N0VA 3ILLA 2FUG9 3SXLA 3DM2B 1QSLA 4U7UK 4QYRA 1S7IA 3MFIA 4M5HA 4G1QA 3UD3P 4O0IA 3MD1A 4JP8A 4RW8B 4FBUA 3MUVP 1WUUA 2MEWA 1U0SA 5H9EJ 1J5EF 4X4TA 1RHKB 4ZP8A 1S76D 2HWTA 3G6XA 3PNIA 1JLQB 3MCMA 1YLXA 2N7YA 3GZ7A 4LR8A 1Q79A 3NS6A 4WTOB 5FDLB 4MT1A 3QGPA 2LU2A 3C15B 4C11B 2Z2ZA 2ASDA 3THTA 1CVJA 2JOQA 3IAM9 5LSRA 2VJVA 3KHLA 1PYTA 2Z57B 1KLMA 2CDRB 1NJZA 1Q8KA 2C3UA 4WYLA 1IKWA 3HJFA 4OX8A 2R4FA 3O1LA 1YBAA 2ZZTA 1FRJA 1WHVA 5KFIA 3HHNB 2HNZB 1Y4ZB 3ISNC 4GVLA 4KO0B 1SC6A 4LF8F 2V0NA 1K8AT 2YBVA 1HBMB 1EIYB 5B0CA 2XZTB 5LOQA 1ZAXA 2HVIA 1WELA 2IM1A 4OZ2A 3KHGA 1UA0A 2AYGA 3CB4A 3L7UA 1UZDA 2BEFA 1HQUA 3DLGB 2OSQA 4UQGA 4O44A 2VHGA 4FNHA 1AXQA 2PN6A 1TAQA 2VFRA 3QIPB 1VC0A 1KDNA 2H51B 1F6TA 5KT3A 2W2QP 4UOHA 4AE5A 3IO1A 3D0HE 4RW6A 4DR5J 1KS2A 4KH0B 3M32B 1W7WA 1LW0A 2J76E 5B0GA 4NE9C 2WW4A 5KFTA 5GAGU 2P2CB 4ECVA 1YBTA 3OR1B 4OMFG 3KLHA 3ONQA 4DG1A 1RYRA 3A8KA 2QMXA 4DQIA 2GCFA 2KG0A 1C0TA 2BW2A 2B8PA 2P8IA 2IYGA 1V3RA 3ZTRA 4YR2A 1TL3A 1N0VC 2UU9F 1IR1A 3GFXA 3HLUA 4WP9A 1RT4B 4LF7J 2DCUB 4MK9A 4DR5F 4Y2AA 4WWSA 5D3GB 3TVZA 4XDDA 5F8LA 4ETXA 2QX0A 1BQMB 4M5KA 5ETLA 5DLGA 2HBZB 3OR2A 4ZLLA 1TKDA 3M8WA 4OX6A 1FJGJ 2NXUA 4C3MA 1ZYQA 9ATCB 1HFEL 1S9EB 4DSJA 5A0YB 3JS9A 3G6YA 3HULA 2V8DA 1LWXA 2DTJA 4U6PA 2H3EB 2XYPB 4ID8A 1REVB 2AT1B 1RU2A 3VAFA 2HIQA 5J2NA 4LR7A 2A6MA 1X4DA 3LP1A 1U1NA 3OLAA 2UP1A 1IKXB 4LF7F 4QIVA 3IR6B 2DR8A 1T3OA 2E7WA 1MMNA 2E29A 1WHYA 3W9IA 1PO6A 2B9EA 2RS2A 3ZZUA 3OUYA 1RJJA 3WDOA 4Z37A 2AYBA 2QA2A 2OFGX 3CJ5A 1CJKB 2CG8A 4ES1A 3IXQA 3KOAA 3KK2B 3AJ1A 2FJWA 1F5CA 1KWMA 2M2BA 4PEOA 2ATCB 3PJXA 4CM2A 1RT5B 2CAJA 4X64J 2XCAA 1FEHA 2R8IA 3HZGA 4IFYA 2MY8A 3CIZA 1NKCA 4QWAA 4WFXA 3T9NA 3CIMA 3M30A 3H2VE 3VAKA 4I7FA 3JAMU 4F04B 1SJ1A 4Q43A 3PKYA 5IZHA 4LRCA 4DR6J 1SI9A 2C28A 1U2CA 1DTTB 5KG1A 2XGQA 4QOTA 2GVDB 4EGLA 2QSWA 5HMZA 2XTJP 1M0SA 2I1RA 2Q43A 4DL7A 1KFDA 4ALZA 3BDPA 4OI2A 4DUYJ 5DS7A 3I55S 3FEYB 3QNWB 2OEJA 5I4MA 3Q2TC 1MG7A 3M8QB 2XC9A 1L5UA 3J7YU 1G2EA 1AB8A 2GQCA 4JI3J 5KFFA 4YR3A 2MLXA 3RR8A 2DXEA 4PWDB 1VQ9S 3C6UB 1D9FA 2CJXB 5KG0A 1U6FA 2YX4A 4D3HA 1FJCA 3A4TA 3CJ4A 5IQQA 1R8CA 5KFBA 2CQPA 2MY7A 1JLBA 5T7LB 1BQXA 2IC3A 1A6LA 2QFIA 1SKWA 1D1UA 3TO8A 1HQEA 5DDRC 3K5MA 3UR0A 3IGVA 1MN7A 4PG6A 1WI6A 3FBFA 1X5PA 1YRXA 4DUYF 2DISA 3M9OB 3TEGA 3AQOA 3QZ7A 4XPCA 4QR0A 4LIRA 1MW7A 1C1CB 3VVUA 1M1HA 5KT4A 3NAHA 4I6AA 3QFHA 3T5HA 4NLQA 5AE2A 5IV3A 1SXLA 3UDEA 2Z4PA 3MEDB 4G6VB 4UZBA 4CLYA 1HHTP 2F7VA 4RX6A 3HHLB 1SH2A 3Q8QB 1MU2B 1RWVB 2IBOA 3H40A 4B3SJ 1B70B 2MB0B 3NAIA 2VG6A 1SIWB 3W5XA 3WX8A 4NI2A 4LF9J 4F4YA 1FDAA 1ZM3A 2Z8QA 4LJMA 1U1KA 2FVCA 1O51A 4KAIA 4FXVA 4W98A 2QMWA 1H74A 4ENOA 4OFZA 5HMXA 4FNIA 2QYGA 3TAMA 4PG5A 1HHSA 2HRTA 1GFWB 3ZTQA 2N3OA 4FPIA 2HHUA 1FA0A 3MM8A 3DOMA 2AMCB 4LFBJ 2Z2LA 2E5JA 2R9LA 4KE5A 5L38A 2E5LJ 5EX0A 1I51B 2RQ4A 1EETA 2BVZA 5CZVA 3FSIA 2PA3A 1CJTA 2WOMA 2QE5A 1DLOA 4DPWA 1IBKJ 3GJSB 1LW2B 4PABA 2IAJB 5M2PA 3ILJA 3CCSS 2CQ4A 2BKNA 3ITHB 2JVOA 4DPOA 4H4OB 4X4OA 3DHWC 2GIQA 2LU1A 2RDDA 1Y5LB 3KUHA 1RTIB 1RLDA 1RA7A 4IRDA 2Q6BA 4DSEA 3MFHA 4ZPDA 3G9CA 5KTQA 1KRPA 2FHJD 2LP4A 1G6BA 4A8OA 2GMLA 2DRDA 2E5LF 2SXLA 4YFUA 2IDLA 3DRRA 5KT7A 3T1AA 2ILZA 1T9WA 3LF0A 3JB9k 4ZP7A 3IM8A 4QWBA 3QT7A 2YNGB 4CLPA 3BO4A 2DJWA 4CT9A 2F65A 3SFGA 5K20B 1CEZA 2MYFA 3AD7C 1E6YB 2IDEA 2ASJA 2CNKB 4EEYA 1U8WA 1OY8A 3C8YA 5DQIA 1HPZB 1PC4A 2CQCA 3LP0B 1OQ3A 4EUVA 3HFVA 4X2BA 1YKWA 2HHVA 4DMZA 2BJ9A 1VHIA 1YZ7A 2LCWA 2Q3PA 4WP8A 2CDQA 4C8NA 1UMJA 4EZ6A 4FDFA 4YP3A 1TKXB 1KOHA 3TVKA 4K5SA 3W9HA 3I82A 4DL4A 3GPAA 3L7PA 1BWEA 2CPYA 3MR5A 3DXSX 3O5TB 1GMUA 4HDGA 3H98A 1PIEA 2ZC4A 1M5HA 2DNKA 4PXDA 2JEIA 5J1EB 1X4CA 2DD8S 2DVIA 1HW9A 4GKKJ 4JV5J 3V4MA 4NEYA 1HBUA 2V8HA 3KLVA 3UN5A 3AQPA 2OHDA 4P75A 3KK1A 5D0HA 1YSJA 2Q66A 4IG3B 1RDRA 1GT8A 1G1XA 3OQ2A 3FMBA 3KNGA 3S7RA 1HL6A 1H7XA 1RQ0A 3SCJE 1NKEA 2I38A 4HHUA 3IG1A 1TMMA 3PRVA 1RHMB 3NY0A 3M9NB 3P3DA 2OMOA 4F4AA 1XMOJ 2DNLA 1IUJA 3N6LA 4AL7A 4GKKF 3QZ8A 3GE9A 3KG1A 2JDJA 1K9MT 4CM0A 2VICA 3QGIA 4C98A 3IRXB 3BH7B 1YIJS 3FQLA 4A48A 2HBQB 1E6VB 1T3NA 1BWVA 5EWEA 1QUVA 3U1MA 5HROB 1TKTB 4DV3J 1RP5A 3Q89A 3GIJA 4YOEA 3O8WA 3J80U 1RWNB 4OYMA 2QA4G 3HPOA 3Q83A 4DL2A 2FHMA 5K8PA 3H5UA 2AW0A 3QLHB 2LQJA 3R7BB 4PQUB 4OYZA 1N5QA 3ETMA 3MCNA 3CULA 2XMUA 1IVZA 4GC6A 4CNZA 4JV0A 1XMOF 1RKIA 3JTOA 3B82A 1EP4A 4LF4J 3KK3B 1RTJB 1NHUA 2CA9A 1BXNA 3BGUA 2YNFB 2AGPA 4ZPBA 2C2ZB 2DNHA 2KRBA 4CYUB 2YWGA 1KEKA 1NSAA 1VK8A 1SV5A 5B0DA 3ELHA 4WK3A 5E7OB 3CCJS 1HNZF 2HHHJ 1MSWD 3T1YF 2CUYA 3MZIA 2RRNA 3Q2SC 3D66A 3LQVA 4NLGA 3D6TB 4Q8EA 1S9GA 4OHZA 5HVGA 2MKCA 5DDOC 2E1CA 3BSCA 1WEXA 3KDOA 4OYIA 3GIRA 1XTZA 4B9MA 3IWNC 2P9GA 2IM3A 5K8MA 2RDIA 1X5OA 1VC5A 4M5LA 2MSSA 3DM2A 2K06A 2FHOB 4C8KA 3BEGB 2XULA 5HSPA 4U8VA 1F3VA 1IWGA 4RW8A 3PM9A 4RNFA 2HHHF 1YGYA 1Q53A 5JJBA 2ZD1B 2HGMA 3M9MB 2BJDA 3D67A 1KQKA 1MMLA 1JLQA 2OTLS 3T19A 3M2UB 2EK1A 1QD1A 1I6JA 5F8IA 4OZJA 1K1SA 3QFWA 2IY5B 5CYQB 5FDLA 4K4XA 4C4WA 3C15A 4C11A 2RUSA 3DNCA 4KHMA 1Y7PA 4CLZA 2MDAA 3D28A 5J2PB 3K89A 1OJ4A 1FEEA 4G3IA 3SMZA 4AT1B 5I3QA 2A2CA 4DU8A 5E3QA 3CCLS 4WF9Q 2PSZA 5KG5A 3V6DB 4FF2A 3NWGA 4PWWA 1DQAA 3W2WA 4M5JA 2B7CB 5IS2A 5LXRA 3MI7X 2RMLA 3NBPB 2NXEA 4YY3J 5EGYA 4IUFA 4UZCA 2P5VA 4ECQA 2HVDA 2NXNA 5D0GA 4GMKA 4KO0A 1DQ9A 4DI6A 2MTLA 4BBYA 2W7AA 2K7JA 3KLEB 1HBMA 5EHHA 1QLNA 1ZZFA 1RU1A 3DYAB 4DL6A 3D54A 2B56A 3DLGA 2GJFA 2FLLA 2IA0A 2AD9A 3NS7B 4DV4F 2HZAA 1G3OA 3QIPA 5HMWA 3KLFA 3R5AA 4OV6A 2E66A 1VLOA 3GLJA 1OO0B 3K59A 4RW9B 3HJVA 3CF5Q 1X9SA 3UDLA 2L9DA 3M1VB 1R8HA 1WKJA 3OBIA 3MMBA 3OR1A 1GQEA 1IBLF 5L1IA 2U2FA 2DYAA 1JLCB 2N4DA 2UUBJ 2QA4S 4OJGA 2HAIA 3BBCA 3RBXA 2AX1A 1NBEB 3PTWA 2IHR1 3GFYA 2VBYA 1FDDA 2WSEC 5A2QU 3Q8UA 4U67Q 2VQFJ 3F0NA 4TYBA 3HT3A 3UN2A 4DX8H 2VASA 1L3TA 3MPVA 2LXUA 1RT4A 4OLOA 2P9EA 5F8MA 3K57A 5I3PA 4YQWA 1OS5A 1RT2B 5D3GA 2NUUG 3G96A 2R8KA 1HARA 1RT3B 3BSOA 3ET6B 2EFGA 3IWXA 1DFDA 2GMHA 3AHPA 2UUBF 1JLGB 3K0JA 1S9EA 5A0YA 3D7SB 2DNMA 2UXBJ 3CCTA 2FJEB 4AQYJ 1TL1B 2HZVA 5MLCV 2XCPA 4IYQA 1HW8A 4DS4A 1REVA 3IBCB 1WG4A 2K8GA 3QMQA 4PG8A 4P2FA 3UN3A 2D3ZA 3DLKB 1IKXA 1IXKA 1FF2A 1YJ7A 5G0RB 4IH7A 3EMTA 4E98A 2V4RA 3TP2A 2LQ9A 1HMVA 1WACA 2OEMA 2DGVA 3CCRS 1WC3A 2N82B 3BB5A 3X3UA 1RAHB 1UTAA 2EEYA 3DI6B 1ACMB 1VRUA 2BZ2A 1OSCA 1CJKA 5DGBA 2GV1A 9RUBA 3V4IA 1WD6A 1RWKB 3BR9A 3W8GA 2LFVA 2N3LA 1FVQA 1H3DA 1URRA 1YX2A 1RT5A 5DDPC 1NZ8A 4CWBA 1TTHB 1U49A 2AWZA 3MUMP 3VCDA 4GO7X 2UXDF 4ELUA 2E9ZA 4DX6A 4ICLB 1ZM2A 2F4FA 4OJ1A 3PIPQ 2I5JB 2P6SA 1VK3A 3BN7A 3CMES 1X0FA 5KAKA 2Y0SD 1BC6A 3ZZ0A 4PZVA 2GVDA 3QPIA 2DIUA 1ZTWA 4OYPA 3ULHA 2PDAA 3CGIA 5FD1A 3PXGa 3T5JA 4PRFA 3ENWA 2APOA 3I9ZA 2R7OA 1Q5VA 1DHMA 4NMXA 3M8QA 2V67A 4IR9A 4K50A 1RUSA 4DXLA 3C16B 2K1RA 2RHQB 4PWDA 3C6UA 5L9XA 4DR7J 5GMEA 2HS4A 3C66A 1RWWB 1VJWA 1VQLS 3VTIA 5T7LA 5F8JA 3JSYA 4BS2A 2AZ1A 2WHOA 4X4PA 2JLEA 4FS1A 1EQ0A 4OHWA 3VV2B 2VBZA 2H54B 2ZH2A 2X7IA 1FRKA 4CI0B 4LF6J 2V94A 1BUXA 3MEEB 3AOBA 2KHCA 1T0TV 3BGRB 5A8KA 2NUHA 4Y0FA 3H5XA 2VA3A 5BR8J 4ED1A 2G0CA 2VDHA 1NAQA 2E5HA 1H7WA 1RHQB 4ECSA 4M5MA 1FRIA 2KFNA 3MEDA 4MIBA 4N47A 1BMQB 3B8HA 3N9UC 5F8HA 2BE7D 2XHCA 3WIUA 1T03B 1SJRA 1KQGB 3K5LA 3KKFA 3CCVS 3HHLA 1QAIA 1MU2A 2VC0A 1RCXB 5BYQA 4LIWA 4ED5A 2NSCA 2R2TA 4QWCA 3LANA 3QO9A 3J7Z5 3A3OB 2BR0A 5CZXA 1X0PA 3BO2A 1LFPA 2B4PA 3W61A 3BM7A 2B5JA 3V6HA 1RISA 1XMBA 5BR8F 2HFNA 4C8OA 1KHWA 2LMIA 1VCTA 4ZJOA 3D6HB 4P2MA 2LDIA 4N8NA 4EZ9A 1RAIB 3MM9A 1F2GA 1N88A 2X1GA 3H4BA 4ZVRB 3M6WA 3DFEA 2Y8YA 5E2QA 3QWUA 4J91A 4EBCA 3J7AN 4ANDA 2O5DA 4K7QA 1QM9A 3P96A 3SIPB 4DQSA 3FEZA 2BQRA 4ED3A 4RL1A 4USHA 4ZJQA 2ZH5A 3SYZA 3UO0A 4HH1A 5B0FA 1KP6A 1SVDA 2V2VA 4QBUA 4U7UD 2HWHA 3QWPA 4C48A 2NSBA 2XWXA 5C5JA 4FYYB 1P1LA 5GMDA 1ZOTA 4WIQA 2CQIA 1LXNA 1LW2A 4FBTA 4I0WA 1NPKA 3MECB 2H4YB 4DQPA 4QIWD 2A1BA 4H4OA 2XO6A 4HTIA 1W26A 3M8PB 4R5PB 4A8MP 4ZVOB 1RTIA 2BX6A 4I67A 3BN4A 2QLJB 3HSDA 2ZM6J 1YJTA 2DXFA 4DR2J 3Q23A 1XIQA 2W1BA 1S1TB 1FT8A 3QT5A 3OTOJ 2CQ3A 4KGMA 2PIIA 4OHYA 1J27A 1XN9A 5SUHA 1Y00A 1TV6B 1Z4UA 2ZH4A 2D1CA 3TQ1A 1YDLA 1F9EB 3BKTA 3Q8SB 3W62A 1PCAA 2YX1A 2W01A 1IQTA 1FNMA 2RT3A 3NOGA 2YNGA 3D4JA 3KTQA 3KG0A 1M5KC 2XLIA 3GMGA 3FMWA 1E6YA 3FCVA 2XO7A 4J37A 3BQ2A 2AU0A 4WPAA 3M8SA 3UNYA 2CPXA 1RABB 3LP0A 2ZHAA 3GQCA 4DR2F 4WFAQ 1X5TA 5DRKA 3FEXB 1U1PA 4ZPTR 2YQ1A 3AAWB 1NPRA 1R0AB 4UOFA 2ZH9A 4A8YA 2MQNA 1VQNS 2Q6CA 4KQZA 3OSPA 2ZVIA 5CD4H 4P72A 4U9RA 5GAEU 1TKXA 2F8HA 4J9RA 3P5BP 2JX2A 2VFTA 1H6KX 3D3BJ 3V81A 4A8XA 4DFKA 1VQKS 1HKAA 3G87A 1MMDA 2CVIA 3FRZA 2Y9HA 3NMRA 2XY6A 4B9TA 2Q79A 2IPOB 2Q1LA 5ETMA 4PUOB 2OO4A 5IT0A 1ZH5A 2PT0A 4K5RA 4U95A 2MXYA 2E9RX 1N5YA 5L8RC 2V8VA 3I0SB 3CJQA 3LTOA 3X1LB 1N5TA 4HLBA 2AGQA 4LT6A 2XI2A 2AP6A 3EXCX 1ZA1B 1TVRB 4M63A 2V5HG 2K7KA 1WC6A 2L41A 4IG3A 2EVZA 2VC1A 4BHQA 2MKKA 2JLFA 4URGA 3OJSA 1U4BA 1P27B 3PVXA 2DNZA 3M2RB 3HP6A 4F0MA 4KHPF 4WZMA 5CYMB 1W2IA 1NO8A 2BJ8A 4NA3A 2BOAA 2MMYA 4RPFA 2C2DA 4EMDA 2QLFB 3PEJA 4F25A 4URSA 1ZAVA 1TUWA 3ZZPA 5C2GA 3TJ9A 3EGWB 2Y1IA 1F1BB 5KFVA 2BJEA 2UUAF 2X1AA 3K7RA 1HNXJ 3E3XA 3IRXA 1RACB 1E6VA 5FLXU 3HK2A 4RUAA 2L9NA 3DKDA 1TKTA 1VQPS 3JTPA 4CLFA 2WK4A 2GO9A 1KBRA 1WC0A 3VVTA 4K4SA 1NH7A 4TKTA 3FFIB 3OHAA 1YQHA 4MTPA 4FYDA 4K59A 3EGNA 2DNGA 3QLHA 3TI0A 4PQUA 5LT5A 1CULB 2DKOB 1EQMA 3CC7S 3DCAA 4LFCF 4OYWA 1Z2ZA 4I64A 2ZH7A 3CCUS 3EGVA 1CQNA 4ZK7M 1N36F 1YBUA 1HNXF 3KK3A 1B7FA 2YNFA 3E51A 4QPXA 3D68A 1YJ9S 3FDSA 5C24B 5E41A 3BBFA 2HNDB 1S6UA 4CYUA 1OY9A 3AODA 7FDRA 4KKOA 4P9SA 4NLOA 4ZVGA 3M6XA 4Q8FA 4X66F 1RAFB 5F3TA 4IG0A 1KOOA 2G0JA 3QBCA 2E7VA 4NZ6A 4WK1A 1RB0A 1XNRF 3KHRA 4GC7A 3OFFA 5E3CA 2V8PA 4NLSA 4M5IA 1PYSB 4ZMMA 3HI9A 3OTCA 1S0OA 2V2QA 1RWPB 2E1PA 4CTAA 1QE1A 5BXIA 3DLHA 3L9ZA 4V1Ak 2OPSB 5G4DA 5B0EA 4F26A 4X62F 3OXFA 3UCZP 5ETSA 2R7WA 4B02A 1IKYB 3JXOA 4C97A 4O4GB 2ZD1A 4IFVA 2LVWA 3WIVA 2HAFA 1I5OB 1N34J 1HQ2A 4JI0J 3M2UA 2O3DA 1AUDA 3H2UB 2E1MC 2WAQD 3FCWA 5CYQA 1UETA 3PYDA 2CPDA 4UT4A 1FVSA 3AXKA 4P74A 1Y0HA 1H38A 4AXIA 5J2PA 3RRKA 5ETVA 1BLUA 3HKZD 2NZ4A 2C3MA 2DH7A 3C19A 3EE3A 2DEJA 3V6DA 5C42B 4ED0A 3PCOB 2VBXA 4JYAF 3NBPA 4EO8A 1FXRA 4NLYA 1BHNA 5F41A 4OYBA 2DBBA 2FGOA 1D8YA 2MKSA 2A6OA 4KGVB 4J9PA 2E7XA 2RU9A 2H5IB 2XY7A 4RNMA 1N34F 4O3OA 4I2PB 3KLEA 3G6VA 4ZVQB 1RAOA 2EC2A 1Q7YT 1HR0J 4RUCA 1B0TA 4F2SA 1YTYA 2EFPA 4PAAA 3HF5A 4C6AA 3DYAA 4ZCLA 1R27B 4KH1B 4C3LA 3CE8A 4DDFA 2W9AA 1H0HB 2RRAA 2GFFA 3ICLA 2M4MA 4DZDA 4G1PA 1HNWF 4NCAA 4K8RA 1Y5IB 4IDKB 1WF2A 4TXSA 1SUQB 2I0XA 3K5OA 2F8MA 2HVZA 3DLLQ 2V63A 1GTEA 5CCMA 5DM6Q 3P4UB 5E0OA 4RW9A 4HVZA 1ZM9A 2DGOA 4NLDA 2A18A 2KM8C 1B7YB 2AJFE 3M1VA 4UOCA 2FC8A 2HQFA 1X31C 3N6MA 4DR4F 3SCKE 3IWLA 5D0EA 3R27A 1JLCA 1C1BA 4F4WA 2ZKTA 2JZ5A 1S49A 3G82B 1UVIA 1AZSB 1NXIA 3R97A 5F0WA 3RB6A 2FZGB 2ZE2B 2H1YA 2DNYA 1HWJA 2J6SA 1DARA 3SBMA 6AT1B 4CH7A 1WG1A 4RU9A 4WJBA 5THWA 5EX3A 4GKJJ 4JUZA 1FE4A 4ZCMA 4QU6A 4LFAJ 1UVMA 4JI8J 1N48A 4ZPVR 5AXNA 2ZWOA 1RT2A 5KFJA 2BE2B 1RBOB 4I2QB 4MJKA 4F0KA 5KFYA 4ES2A 3PY8A 2DGTA 4DUZF 1RT3A 3ET6A 1P6TA 2J7KA 2M3DA 1I94J 1JLGA 1PYOB 4C3KA 4NYPA 4EK2A 5E3AA 1YJVA 5J1NA 4B3TF 3BSNA 5F8GA 5IM0B 2MGZA 1TL1A 4URQU 1A9NB 3OSNA 4CLLA 1X9MA 1TL5A 3RB4A 2C2NA 4CLTA 1CC8A 3TZXA 4RBVA 1MLAA 3HO1A 4X4RA 4N56A 3DLKA 2HNYA 1XMQJ 4LFAF 2BDPA 4JI8F 5G0RA 3EM1A 4PCQA 2GQ2A 3KLGB 4OX9J 4MYUA 3A1YG 5JMNA 3AJDA 2UUCJ 3GB0A 2DRBA 1SL2A 3QATA 4CO0A 2NPIA 2EC0A 3K8WA 1VQ5S 2IJFA 1GXUA 3DI6A 1NH8A 4A8FA 4OJ3A 2FJXA 4Q45A 1K47A 5HATA 4RNOA 3CD5A 5JXSA 1A0OB 2CKWA 5J2MB 4DL5A 4OZ0A 2H65B 2GQQA 2N7CA 3MD3A 3PYEA 4ZOSA 5KG3A 1U47A 3BKFA 1RTDB 1WTBA 2HRYA 3RW6A 1X4FA 3S8SA 3TA0A 1O6XA 3I0RA 3G6ES 1NEEA 4OX9F 2CADA 2UUCF 3HSGA 2CRLA 4P6QA 3R5JB 1U0HB 1WDTA 3V2UC 4ELVA 4X4NA 2CVEA 1L3KA 3LGNA 1W2BR 2I5JA 4CCHA 3FGVA 2VFUA 1NZAA 5K9FA 4QPTA 4ZVUB 3BJYA 1J5OB 1Q82T 2LECA 3DRPA 4KSEB 2FY1A 5KT6A 1HI1A 4W90B 2G2ZA 4DN9A 1JQGA 2JSXA 4DX7A 1TQLA 5D15A 2XSJB 2YVSA 3C16A 2FJVA 5D4NA 2D9PA 2V2KA 2V2ZA 3RRGA 1XNQF 4KR0B 5ADZA 1H73A 4M8LA 2L48A 4YN3B 1P1TA 4BDPA 2B9WA 3IC1A 3L4BC 1RT6A 2OPRA 2R7RA 2M7SA 4FVMA 2HHQA 4NASA 3MEEA 1G7CB 5DQGA 1Z2LA 3BGRA 3N5FA 2ROEA 3FRYA 2Z58B 2W2MP 2MKIA 3WHIA 4M5DB 3KHHA 3SDEB 4PPZA 3R7SB 2XMWA 4DV2J 5I42B 2HQIA 1FD8A 2GGPB 4IO1A 5LMNJ 1T03A 2R8GA 3H2LA 3DDNA 3KUEA 3B4DA 1SL1A 3DLBA 4KHRA 4NZ7A 1L3UA 4JI4J 4EYHB 2MKHA 3LW5C 2BRLA 3A3PB 2MQ8A 4E0DA 1EAYC 2KXNB 4PPDA 3HD1A 2F4VJ 4DJBA 1GX5A 2JJ4D 3OL8A 1XR5A 3U27A 4ITSA 5AXMA 1NSKL 4PXEA 2ZBQA 2ZDOA 4ZDNA 1UKUA 3O3LA 1N54B 2HK2A 2BV3A 5LMNF 4J9OA 4C8ZA 1SL0A 1SJFA 4WXWA 2VPZB 1IJEB 2YPYA 2BYCA 2HFUA 2HGLA 4I56A 4HKQA 1XK8A 2ZOMA 3C46A 2GIRA 2W2OP 5HQ8A 1H2VZ 1VC6A 2VG7B 3MR6A 3UFCX 3T41A 3MECA 4F50A 3I96A 5DM7Q 3UR3C 1VRQC 3MPUB 3TEHB 1PILA 5KG2A 1TK5A 4J5OA 3M8PA 4R5PA 1JJCB 2YY3A 3H20A 2COLA 1D0EA 4LR9A 4ZJLA 3LWMA 1S1TA 4C2MA 2LYVA 5IC6B 2QN6B 2ILYA 4I4BA 5D4PA 4AUKA 4I1TA 3OXLA 1TV6A 3QAEA 2XMMA 4DV0J 1LK5A 3J80Y 1BD6A 3SQGB 4PKDB 2JFKA 2YNHB 1Q95G 5EN1A 2A2DA 3TOQA 1TFYA 4NMLA 4ATNA 2ZUAA 5DO2A 3ZZTA 1EZZB 1V5IB 1KTQA 1GTHA 1IBMF 4O3SA 3AB4B 4DPUA 1S5ZA 2V34A 2VZ9A 2CNOB 3UNGC 5KFUA 2R7QA 4K2XA 5B7WA 3HVRA 3CUNA 3MURP 1RXOB 1R0AA 1FJEB 2HHTA 1S6OA 1D9AA 1RI7A 1JLAB 1VOMA 1LWEB 3DHXA 3T5KA 3GWCA 1RT7B 4DV0F 3PG9A 2R8JA 1R3NA 2GW8A 1JXVA 3L95X 3NGDA 4FXDA 3J7YI 2XG8A 1RAEB 1JLFB 4C8LA 4PUOA 2VUGA 4HHJA 2UV8G 2GIFA 1CJUA 3UQSA 2WVEA 3AOCA 3BGLA 3AJ2A 4XAKA 3R2CJ 1OWXA 1R6YA 4M5GA 5B09A 4LF8J 2DO0A 4C8MA 3CPWR 1VIOA 1TVRA 3BGFA 3M6UA 3E2EA 5AE1A 1VQ6S 4HHHA 1Y5NB 2QSFA 4WU2A 3LP2B 4EBDA 2W4PA 4QYZK 3I5CA 3R8YA 2HKEA 1N32F 2LKZA 2VBWA 3TRGA 3M2RA 5CYMA 4N76A 1S9FA 1R0BG 3UCGA 2G1DA 2B4OA 2ACYA 2WTFA 4RNHA 4Z2XA 1IM4A 3KWMA 4KPCA 3B54A 1SKSA 5KFSA 2IIHA 2BMBA 3IMQJ 2C2EA 2JRSA 3JQKA 4PYAA 1U1QA 2GZOA 2KO1A 4YB1P 3BQ1A 3D3CJ 3CDBA 1WKLA 1VRTB 1WOSA 5U47A 3MEGB 1YI2S 4HTJA 4M94A 5LL6d 1QDUB 3QIDA 3JYTB 3ZFVA 1HYSB 1F9FA 1YWXA 1GXTA 4DSFA 2JC1A 4ZVTB 1NK8A 1V6HA 2KYZA 4MYTA 2JNJA 4L6V3 1KONA 3I4HX 3U02A 3MM5B 8AT1B 4JV1A 1V9OA 2AGOA 1VR6A 3R1LA 2D74B 1WWHA 4H4KC 5KFRA 2OJ3A 2UU9J 3CC2S 4O3PA 3OXGA 4FYXB 4ZKAA 3GSDA 1KLMB 3J7ZT 1KSPA 4TY9A 4QWEA 5IT4A 4P7TA 1HNIB 2AJ4A 3G4SS 2CQHA 4OYOA 4ECYA 1PBAA 1JKHB 2HNDA 1PBUA 1AFJA 1PAEX 5D4LA 2KTQA 3GG1A 2DH8A 4DR3F 2F63A 4HYKA 4LUBA 2CPJA 2VODA 3NGSA 4JI2F 4N5SA 3BO3A 2PI4A 1WG5A 2PI5A 4O44B 3AA8A 2GAGC 2WBRA 1SKRA 3DMJB 3IFEA 3NWRA 3KG4A 3I5BA 2AQ4A 2NR0A 5CA5A 1N56A 1SC4B 3GIIA 3PV8A 4QCLA 3JQJA 1NUEA 4RW6B 1TAUA 4QZVB 1IKVB 2FJAB 4K4UA 4NCGB 3MMCA 4NA2A 2OPSA 1N8RT 1T94A 4V19J 4IQMA 4ZHRB 3VR1A 4KPYA 3P5TL 3TYTA 3ZTPA 4Q0BB 4DSLA 2F9JA 2XI3A 3KLHB 1RKJA 4YEAA 1IKYA 1R8PA 4O4GA 3PFEA 4DPYA 1TU0B 3KDNA 4NX9A 4ECUA 5JVGQ 3SV3A 2HQ3A 3RRHA 3TJ8A 1FKAF 1C0TB 1UJ4A 2HVHA 3FVYA 4I6YA 3LUYA 5HI7A 2HG4A 2YPZA 3OTBA 4LF5F 4N41A 1S1VB 3AFGA 3DOLB 4F3QA 2FIUA 4USUA 4NXMJ 2F9DA 2D7SA 5C42A 2C3OA 5KT5A 5KFAA 2JL9A 2HURA 2B6AA 3PEHA 5K14B 3PACA 3H4DA 5AE3A 2L9WA 4LQ3A 2ZDPA 4USWA 1SC3B 2KFZA 1RGVA 5KOWA 2V8GA 2CJBA 2E44A 2LXFA 3OVAA 3FJ2A 5J2NB 1RA6A 2X51A 2HK3A 1S0NA 3ZZZA 1XERA 1X9WA 2VU5A 4O3QA 5A76A 4NXMF 2OUGA 3J81U 4P2XA 3ENAA 4DV7F 2QLWA 2YKNB 4ZCIA 5F3ZA 2XYHB 4RZRA 1CJVB 4NLWA 4IDKA 2KYXA 1SUQA 3ENQA 1HNVB 4BC9A 2RB7A 1SKUB 4BWMA 4N8OA 2KT2A 1TZ0A 2GC8A 2ROPA 1UJ6A 4NWBA 3L7OA 3DDKA 5L9NA 2HMIA 3HFZB 3P45B 4UOGA 2G9OA 1WSVA 1KHVA 3DGVA 2M8DB 3T6JA 3PW0A 3THPA 3Q24A 2RVJA 4NCBA 1ULRA 4OI6A 3QJLA 3MAAA 2YWEA 4CZCA 4KT0C 3RBZA 3G82A 2B43A 3KMSA 1AZSA 1A7GE 4IFYB 4ED4A 2DNQA 2ZE2A 4ES3A 2Z0GA 4L74A 3JSMB 3CCES 2QRRA 4I7FB 2R2SA 4ZIVA 3UDVA 2OKQA 3MCOA 4EI2A 2QO3A 4I2QA 3UE2A 2YNIB 2RAQA 3ISZA 1VMBA 2B9YA 2Y1LB 5AXLA 2GS8A 1FDNA 3IM9A 5DDQC 4H4MA 3U1NA 4KV8B 3POTA 1QTMA 1U02A 3D2WA 2ZITA 5IM0A 5KFQA 3KJQB 3PFOA 3OTEA 4DR1J 3PO4A 4NZ0A 2JFDA 2CFXA 5HVFA 2IMOA 3KLGA 2LXIA 2NXCA 3DDIA 2K3IA 5ETQA 3KJNB 1T9XA 2DGQA 3ILOA 5A8WB 3MCSA 3HSJA 3CJ0A 4OZNA 2HEKA 3CO9A 2HFSA 1TFWA 2J9CA 2ZH8A 1FTCA 3MR3A 4F3MA 3GILA 5J2MA 5LMUF 3IS9A 1O5JA 1ZA2B 3H5YA 3RAQA 4DR1F 5H9FK 1HBOB 2RQKA 1VBYA 2W8LA 1RTDA 3PRBA 2UZAA 3K5PA 3R3TA 4B3RF 1NKBA 1HD1A 5CAAA 3EX7B 2W4DA 4LREA 2KDOA 2XMJA 3RYLA 1RLCL 2QLXA 5E33A 2VG6B 5T14A 2JEJA 2W7PA 2FVQA 3KLIB 4NI2B 2OPPB 1VBKA 1XR7A 3ZO7A 1X4AA 5LJ3Y 3G86A 4QR1A 3W63A 3C2PA 5MAOA 4RLEA 3NMAA 3LO3A 3TAMB 3PX4A 3H7HB 1J5OA 3FK4A 4LVOP 4U7CA 4KB7A 2ZUGA 4I68A 5KFXA 2CQBA 1SQEA 4H4KA 2DR5A 4ZN3A 5E3PA 3PJWA 5KG4A 4K4ZA 4ED8A 2VPXB 3GV8B 4DZ6A 4UUWA 2XQCA 3DOMB 3E01A 3BH6B 2XSJA 2W7OA 4Y2CA 2J0SD 3TARA 1M5SA 2VPWB 1P9YA 4OHXA 1FXLA 2B7BB 1CS4B 1RWOB 4ED7A 5B0AA 1CJTB 3M8ZA 2B4UA 1DLOB 2ZFHA 4RW7A 2C42A 1UEUA 2QEXS 4MMOA 5H9EK 5D77A 4IOBA 2ZH3A 2LEBA 2KN4A 2MJUA 5CXTA 3KYLA 2V6AA 4DCPB 2E1RA 3H8YA 2ZBCA 4X4SA 2HFZA 1S10A 3UD5A 2BRKA 3CT9A 4XPEA 4ED6A 4M5DA 3K5NA 2BM1A 3UDCA 3SDEA 1D3WA 5GMKa 1R6VA 3BQ0A 2M8HA 4L72B 5I42A 4D3GA 2GGPA 1EARA 2JLGA 1WNEA 2KJWA 3FC9A 3TVYA 5HBMB 1FWLA 1VS3A 4DSIA 1B4SA 1LFWA 2DHHA 5A6WA 5EWGA 4KYZA 1HWKA 4QQBA 1B0VA 2LEPA 1NSQA 3LALA 5HQLA 2YXLA 2NPFA 2FVSA 4WFBQ 3VQSA 1X4BA 2QL9B 2QJ3A 2ZBRA 4BC7A 3TZYA 2PO4A 1XBWA 3UW1A 1WTFA 2EI5A 1RYSA 2QT7A 4EWTA 3RAXA 1DZ5A 1K0VA 1YK9A 1TR0A 2BOPA 3C14B 3NEKA 3CVKA 3T5LA 1R7IA 1RHRB 3IP0A 2KXHA 1IM6A 1S57A 4FF4A 5D8HB 4ZS6A 5C25B 3D9BA 3OHBA 3DOKB 1KLNA 1EKRA 2MZQA 4Y2IA 2DNOA 3K58A 1P8GA 4OHVA 5KT2A 3MWBA 1L3VA 2CJYB 2FQQB 1KC8T 1C0UB 1U1RA 1HBUB 4OI1A 4FXWA 2D3O1 5KFEA 3HSZA 2EXUA 3U1LA 1DRZA 1VLYA 3KXDA 1Q86T 1R89A 4DL3A 1FCAA 1HNZJ 1NJXA 3T1YJ 2YH0A 1KR4A 4MKVA 1VQMS 4WXOA 3OFEA 2VONA 3EGZA 5B0BA 3BZQA 3T3FA 3PYFA 1CG2A 5F9NA 3IAS9 3TAQA 3CJ8A 5IQ6A 2FPHX 4HH0A 4CH1A 3BKUA 4PXCA 2Z2MA 5FLXY 2IRXA 3IG1B 3LA0A 3CJTA 2B3TB 2XBPA 4F67A 4C7QA 1RSCA 3SQGA 5EWFA 1CPZA 2DT9A 3FSXA 2YNHA 4B9SA 1ZETA 1X4GA 3HMJG 1RWMB 5KOXA 2YKMA 4X65J 3TAPA 4LRBA 2IMWP 4WE1B 1F9HA 4MIWA 2VIHA 4FKYA 1JXLA 5T41A 5GADI 3F73A 5E5NA 2BUNA 4HEA9 1XEZA 2VKRA 3RR7A 1UAWA 1KQFB 2PFDA 1AFIA 1ELOA 3CCWA 1NJIT 3HCXA 2MQOA 1LWEA 1TKZB 1LV5A 5J2QB 2DY1A 3HT0A 1PJ5A 1RT7A 3IA0A 4X84A 4BWJA 3FZBA 1NRKA 1JLFA 3G2XA 4J90A 3HHLC 2PE8A 3NP5A 1DURA 1YHQS 5IT9U 1N0UA 4WKYA 3QT6A 1WF0A 3AT1B 1K1QA 4NLXA 4X65F 1HWUA 3RG6A 3H42A 3ZZYA 5L1LA 3EZOA 2EWHA 3TWZA 2UUWA 5DG8A 4BLGA 2R7TA 1D09B 2XM3A 4NXNF 3EZ5A 1PKUA 4C9DA 2ACMA 3LP2A 4DF8A 2ZVSA 4LBPA 4Y34A 1DY3A 3CEDA 2GX8A 3FSYA 4XDCA 4JI7F 1SJ3P 1NCLA 1YRTA 2CPHA 3NCPA 4DV4J 4QU7A 1FFSB 2GA7A 3WC2A 4NRUA 1CSJA 1NB2A 2F5GA 2ASYA 2HNZA 2LEAA 3BYRA 5HP1B 2OP5A 4ZCKA 5HJYA 4XIUA 2ZBPA 2BJ7A 1VRTA 3MEGA 2U1AA 4R0JA 1IBLJ 3JYTA 3ZTOA 5K8NA 4C8YA 3DRXA 1HYSA 2GHWA 1U48A 2PMHA 3DU6A 2FJDB 4U8YA 5KG7A 3MM5A 4UY85 2AIRB 3QT8A 4OI0A 1NK7A 1IJFB 2CNNB 2GVZB 1VQSA 1RZMA 1U26A 3ZNUA 1IN0A 2FHKA 1TL7B 1AW0A 3CDEA 1HNIA 2HWIA 1RCOB 1UFKA 3W2WB 5CYJA 3M05A 4DN0A 2C2KB 3MGJA 3M32A 1RTZA 5D4OA 3GJRB 3OVSA 1Z1ZA 2E9TA 1JKHA 1DBDA 3W65A 5A6PA 1T11A 5HMYA 4A47A 2R7XA 2KH9A 2CPFA 2DITA 4RUBA 3CDAA 2KKHA 2WVCA 2YWKA 3FCHA 2EFVA 2C2RA 3GYNA 2XS5A 5KFZA 2CYYA 2ZNYA 1IR2A 2CJAA 1GAOA 3DMJA 2W24A 1VBZA 2CQGA 3KLFB 2M88A 4ERDA 1YZ6A 1WKKA 5ETRA 2JHEA 4PYDA 4KIAA 2MZJA 1S72S 1PC5A 1DTQB 1BQMA 5DZ7A 2UVRA 2OAUA 1SC1B 3R5DA 1IKVA 3I87A 3SCIE 4NCGA 3FKBA 2EFNA 2GHVC 1X60A 1CQMA 2BBEA 4ZHRA 3VHQA 2PGCA 3MMBB 4F2RA 2BACA 2RUGA 4Q0BA 3PIOQ 3RTVA 1EX8A 1HI0P 2L08A 3IBWA 2OGUA 2DGWA 2WB4A 2Z2YB 5AT1B 1Q5YA 3H0PA 1FJ7A 2CQ0A 4IH6A 3ISND 4KGXB 5M2UA 2HHXA 4FZVA 1RAAB 2ZNZA 1AUSL 1UVNA 2CIMA 4OV1A 2IM2A 4WFNQ 1KVKA 1S1VA 4DV6J 3EVOA 3DOLA 2UXDJ 5GAEI 4WIIA 3AOAA 2VV5A 2ROGA 3MPWA 2FYXA 1RAJA 4CLKA 1UL3A 3QJJA 1LNQA 4OI3A 3KK2A 1ZPVA 4WFYA 5K14A 4C0BA 2BJ1A 2EKNA 3Q8RB 1M1GA 3IRWP 2BKOA 5IWAJ 3LPEA 4J9KA 1NDCA 5KFGA 2KHDA 4JI6J 1UJ5A 3F56A 3L09A 5HK4A 3M8RA 1NMEB 2J6TA 2FVRA 2XS2A 4B3OB 3HFKA 2DHAA 3DGPB 4DV6F 3L3CA 5K8OA 2VQEJ 5D0RA 3MR7A 1JMTA 1LK7A 3N79A 3US5A 1HMVB 2YKPA 4IR1A 2BABA 1DTTA 3G8QA 5GADU 4QW9A 2YKNA 1CJVA 4NA1A 5KFCA 4F8RA 4M95A 4P73A 5DGAA 3ZZOA 3DRYA 1HNVA 3HHEA 3SFUA 1VRUB 1OSDA 1FJGF 3MTKA 3A13A 1HA1A 1H2TZ 5IWAF 1OY6A 3HHDA 4DV1J 1ZPWX 3V4IB 2DNRA 4JI6F 1S6PB 1U2FA 2VH7A 4A8SA 1SH0A 2GO8A 4HI2A 2AYEA 3FNNA 2DR7A 2X1FA 1JK9B 3MMJA 3ADAC 4L3KA 2WZ1A 4OLPA 3NOCA 2VQEF 3KUGA 2AZ3A 1M90T 4UUXA 4B9LA 3JSMA 3LPYA 4ZVPB 4F7VA 2J8AA 4CO4A 1S1UB 5CQGA 3UVJB 2P6TA 4CQ1A 4IOAQ 4LBIA 4P71A 3U7JA 3SV4A 1WI8A 4DV1F 3KJVB 2FZKB 2YNIA 2CZ4A 2HRUA 4DBQA 3F41A 2V9KA 1C1CA 1JJHA 4OIXA 3DC2A 3MPDA 2MLZA 4B3MJ 2J5AA 1WSRA 1OYDA 3RJMB 1QUPA 4X64F 2ZZMA 3RAMA 1S12A 2OPQB 1IR0A 4KV8A 2FY8A 2NYHA 2VJUA 1F5AA 1FKOB 4TLQA 2K1RB 3NG8A 4C0OC 2LLZA 1ZTTA 2PEBA 3CJSA 1RE1B 2HS0A 4WTYA 4A8WA 2G2OA 1Y3JA 4ILLA 3NXZA 3CD0A 1UA1A 3EICA 2QGFB 2X3GA 4OZ1A 2J7UA 4DR6F 1PGZA 2AHOB 2DCLA 3H25A 3DXBA 1CLFA 1S0MA 4DUTA 3B6BA 1L3SA 3KFWX 1RHJB 3VAGA 2WBMA 2MHNA 5I3UB 5A8WA 3T6BA 5DLFA 5A8KB 2IRUA 1Y9OA 4B3MF 4ECXA 4MK8A 5KFNA 2G1HA 1C2PA 1UFLA 3W8PA 1HD0A 4KFBB 4JI3F 3GTYX 3M4XA 3W66A 3SEOA 3LH2S 2RDJA 3DRSB 3FBCA 4QIEA 2RKIB 2IRYA 2WONB 4LRDA 1HBOA 1N5SA 2HFVA 3UD4P 1RBAA 2RRBA 1UWAA 2HHWA 2RJZA 2XS7A 2FLPA 2AEMA 1FRHA 1F5BA 3O44A 1CC7A 1Y3KA 1S4EA 4EO6A 1Q78A 3ENVA 3QO9B 3IBFB 3KLIA 3G71S 2OPPA 3HX9A 4F4ZA 2HBRB 2IAJA 4YUDA 4YR0A 3ITHA 2M5YA 2B5JB 3QSYB 2V9WA 4G1IA 2OIHA 2JEGA 3KNAA 2FGCA 4TVAB 4ZP9A 1LWCB 4Q5VA 4DEZA 4USJC 2DNNA 3MM9B 1VBXA 3UI3A 4A4JA 3W1YC 2CQDA 4J9VA 1OIAA 4TQRA 4ECRA 2CWKA 1T8EA 4LRFA 1S6QB 1T7PA 4B3SF 1XJWB 1R8AA 1NHVA 1CS4A 4DFPA 4LF9F 3PRDA 5L39A 3RBDA 1X7VA 1H2UX 2O66A 2V4JB 3PW2A 3GFZA 3TX0A 5C2CA 4B17A 2XMAA 3HKWA 4NL5A 1HPZA 4UTGA 3W60A 1V5VA 3EUNA 2PD1A 1UW4A 3BREA 2R2RA 3SSSA 2FDNA 2KXFA 1U24A 2W9CB 2VPYB 5DJBA 2HQDA 2IYIA 3GIKA 4F0HA 4CO1A 1T9VA 4PQAA 4LFBF 2M52A 4X4QA 1N5VA 4NLTA 2V50A 1QAJA 4L76A 2LA4A 4KHPJ 4WKRA 2HIYA 3D6MB 2AEFA 4IH5A 2JC0A 5KFKA 4RWWA 5HBMA 1LQ9A 3TR5A 1IBKF 4QW8A 5F9LA 1RK8A 2W2NP 5J1EA 2UUAJ 4O3NA 1S0VA 1NK4A 4USKA 4F3OA 1XWLA 2NQPA 4QIGA 2XGPA 1YVFA 1V3ZA 2HLUA 2PEHA 2OH2A 3V5RA 3NGKA 1AROP 1YG0A 1FRLA 3C14A 2VA2A 4EYIB 1JXEA 1ZAWA 3PW5A 3PR4A 1C4CA 3CW2C 5C25A 5HJXA 3V81B 3DOKA 4LFCJ 2VKZG 2C2OB 2QL7B 1FTRA 4IO9Q 2WSCC 1YJNS 1I3OB 3VZIA 4CDIA 1S59A 1N36J 1UP1A 1N5YB 3AD9C 1NJWA 4YB5A 2QLBB 4J9NA 1TUGB 2QA1A 1SCJB 5HROA 2AF6A 1C0UA 4DWIA 3CCQS 1Y11A 5D6GA 4Y2KA 3MTJA 2MZ1A 2HS3A 2WVFA 3RB3A 2ZHOA 2M9KA 3JSBA 1YRUA 4ID5B 3GIMA 4X66J 4DPXA 3P8BB 4GVBB 2UVUA 1FWKA 5ITHA 1JIHA 2OFHX 3GFHA 5EUHA 1X8DA 1N33J 4IQXA 1U25A 1XNRJ 1T05B 4WZQA 2BANB 1GXLA 1NK0A 2JVRA 2YWWA 1RTJA 1QVGR 4WP3A 1JX4A 1GMWA 2GAHC 2ZJQQ 4NOHA 2EFOA 1OMSA 4JV5F 2CXEA 4H54A 1QSSA 2LA6A 2ABYA 3ZZRA 1SH3A 2KI2A 3G8SA 3IN5A 4X62J 2O01C 3GG0A 1FD2A 3MM6B 4WE1A 4DX5A 2Y0BB 2FD2A 4FPRA 3VAHA 1QY7A 4X4UA 4ZIWA 2XNQA 2ZC3A 1VI7A 4BCAA 3PW4A 4JOUA 2RF2B 1OQ6A 3CXCR 4LRAA 1N33F 4RU2A 4OL8A 3QYYA 3VAMA 2G13A 4DHVA 4YDXA 1UW9A 1TKZA 3HVTB 1KFSA 5J2QA 3LWLA 2R8HA 2M70A 2VFSA 1SJQA 3BPSP 3AH6A 3W2VB 2PC6A 2W25A 4JYAJ 3NLCA 3H59A 3HVAA 4DV3F 1PSDA 4PR6A 4RUHA 2XNRA 1O0PA 2R42A 1Q16B 1UPMB 4RNNA 3PHEA 1N6QB 4KKOB 1FWPA 3UCUP 4IG0B 3ETOA 1MN9A 1KQSR 1GEHA 1W25A 2KJVA 5GAHI 4Q2MA 3TX8A 1WORA 5ETPA 5LXYA 3O6QA 4FKXA 3RU0A 4LF4F 3MUTP 5DZ6A 1TK8A 1HNWJ 3OVBA 1FNXH 4CTAB 4IRKA 2OSRA 4DPTA 1QE1B 2C3PA 3NL0A 3RW7A 4ZPCA 5HP1A 1UEVA 3M8YA 4RW4B 1NPPA 2CG4A 2RH3A 2UXCJ 3D0GE 4OX7A 1RHUB 4PG4A 2YTCA 2K3KA 4LMZA 2RS8A 4RBTA 2OI2A 1VJQA 3DLEB 4IFVB 4DR4J 4MFBB 2MZSA 2DH9A 3AA9A 1FDBA 1HWLA 2VL1A 1VHFA 1RWUA 2F3JA 2HFOA 4LSLB 5AJ3J 1R31A 2O67A 3GP9A 3QGGA 1REGX 5DG7A 2GVZA 3OW2R 4UF4A 3CNQP 1TL7A 3UPFA 2IA6A 2J0QD 3MEKA 2V68A 1MROB 4ECTA 2MQLA 5IXUA 2A10A 5SZTA 2EKYA 2ZKUA 2F1FA 4TYAA 3SI8A 4ZA1A 1FI4A 1FX2A 4USVA 1S1WB 1MWZA 3A8IA 2UXCF 1S1XB 2E5IA 4ANEA 3GV7B 3JAMY 4DUZJ 2FLNA 4ANCA 1LWFB 2QG9B 2EBEA 4MH8A 3Q8PB 2RIJA 2ZHBA 1X4EA 3SQOP 5GVQA 3J81Y 3TJAA 1HIYA 5AJ3F 4OYXA 4IOCQ 4ZN1A 4B3TJ 3HHLD 1P9QC 1LOUA 3PDNA 2BA9A 5IC4B 3MOJB 3SSQA 2KG1A 2IBKA 3MM7B 5HN0A 2QFJA 4K4YA 3BPDA 4TU8A 2YH1A 3W64A 4JB8B 4ZVHA 3C6TB 4QIFA 3CCZA 3OL7A 4YY3F 4Y00A 3UWTA 1DTQA 1ROFA 1PJ6A 3HZEA 2DGSA 2ZWPA 4F02A 2I9SA 2UVVA 3HVWA 1VGYA 3VQTA 2G2YA 5RUBA 5HL7Q 3PO5A 3D1QA 1C1BB 3HHKA 4LF2A 3NKYA 2M0GB 4AL5A 2J9DA 3O2IA 1K73T 1FK9B 4J9MA 2ADBA 1M1KT 4J9UE 3NNCA 2C2MB 2QTWA 3THVA 2YQ3A 1BE4A 1KVIA 5DG9A 2V4QA 3EZUA 2I2YA 3WX4A 2ZEJA 1LEOA 4QR2A 4DV5J 4DCJB 2FJBB 1NB7A 2IFXA 1HHQA 3FUYA 2ERRA 4NEZA 4X4VA 3S1TA 1WEYA 1BQNB 3KJFB 5HANA 3W9JA 2NZCA 3RZAA 1U6BA 5IFMA 4PG7A 2MGZB 2J8SA 2VQFF 1X4HA 1GMVA 4YHHJ 2CJKA 2RQCA 4B3OA 2DPIA 5CCLA 2WCXA 3MOZA 1XNQJ 1TP7A 3DGPA 3AXMA 2HNYB 3CC4S 1APSA 4ZPWR 4ICLA 2HQGA 1AT1B 4IKAA 3PR5B 3SSRA 2HHSA 3M2VB 3OFHA 4DV5F 1FE0A 3MMAB 1QTNB 3I4PA 1ZBTA 2JH3A 4V19X 3D6FB 3NNAA 4USMA 4WFZA 3HXMA 5K5MA 1FESA 1S6PA 2IVFB 1WOPA 5L1KA 2UXBF 1UVLA 4AQYF 4RO0A 2KL8A 4YHHF 4KGKA 4FS2A 1NU4A 1HBNB 2RU3A 3A3NB 1B99A 1NK6A 3TANA 2AV5A 5A8RB 3QQCD 4PWUA 3DN9A 2UVWA 1JNRB 1RT1B 3I0RB 1S1UA 5LSOA 2WW8A 1EKSA 1U45A 5F8NA 2EG1A 3UVJA 3J7A1 1IWAA 2Z56B 4DFJA 3MF5A 3PKMA 5FIIA 3KJVA 3VGVA 3R6LB 3BS9A 5GAHU 3EYZA 1OYEA 2EW9A 3R9LA 2N4CA 3DRPB
chains in the Genus database with same CATH topology
2YPZA 4UZBA 2YQ1A 2YQ0A 2YPYA 4K2JA 1B3TA 5A76A 1VHIA 4BLGA 4UZCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YPZ A;  4UZB A;  2YQ1 A;  2YQ0 A;  2YPY A;  4K2J A;  1B3T A;  5A76 A;  1VHI A;  4BLG A;  4UZC A; 
#chains in the Genus database with same CATH topology
 4HAC B;  4QWD A;  1UCN A;  1RTH B;  4MKY A;  3CJK B;  3CD6 S;  3R5C A;  1GNK A;  2YKA A;  2J9D E;  4LSN B;  2OPQ A;  3I6P A;  5AXK A;  3MAH A;  1MWY A;  4DS5 A;  4P2S A;  2ZH1 A;  2DPJ A;  4TN2 A;  1FKO A;  1S4F A;  2MPU A;  2YX7 A;  3S6E A;  4UY8 T;  4TU9 A;  2D9O A;  4A46 A;  5HLF B;  2DRA A;  1RAG B;  4Z7C A;  1YJW S;  5LSL A;  3A8E A;  2OEK A;  1FX4 A;  4KGZ B;  1WC4 A;  2ALY B;  3N28 A;  2KVQ E;  2GJ2 A;  1KVJ A;  4QJV A;  2J7W A;  2XLJ A;  1RT6 B;  2OPR B;  2YWF A;  5I3U A;  4DSK A;  1G4C A;  4YDD B;  3PHT A;  4L3N A;  2L3M A;  5FJ4 A;  2PFF B;  1TL4 A;  3BV8 A;  1NDK A;  4KFB A;  1TEL A;  4M5N A;  3GCW P;  2DK2 A;  3CMQ A;  5ETT A;  3DRS A;  3WZ0 A;  2EK6 A;  3PYG A;  2RKI A;  2W4C A;  2OTJ S;  2WON A;  4DR7 F;  1SPB P;  2W9B B;  1U7L A;  1F60 B;  2B9X A;  4MIA A;  1R8B A;  2CZ9 A;  1UWB B;  4NRT A;  4AYB D;  4E2F B;  3GV5 B;  2CJQ A;  2C3Y A;  4O0N A;  7FD1 A;  1SIZ A;  4CLU A;  1GMW D;  2AX0 A;  4EFA C;  2OEL A;  1WHW A;  2VG5 B;  2VF3 A;  2WB1 D;  4LF6 F;  4LSZ B;  3SCL E;  3TUJ C;  2VFV A;  3A8J A;  3TQE A;  2JWN A;  4MK7 A;  1FKP B;  1NM2 A;  4Y65 A;  3R5G A;  1IBM J;  2X3D A;  2MJN A;  1LWC A;  2FB0 A;  3JQM A;  3LOU A;  4CIO A;  4XK8 C;  1S99 A;  4A8Q A;  1HI8 A;  1Q8B A;  5KFP A;  4FP9 A;  2R7S A;  3PW7 A;  1UZH A;  1S6Q A;  1YJU A;  2K2P A;  4UST A;  3RUB L;  2XY5 A;  2H5E A;  4RWX A;  1K0T A;  1KKH A;  5HO4 A;  4EBE A;  1S79 A;  3DU5 A;  3PX6 A;  3NGR A;  2V4J A;  1U1L A;  4R8U B;  4E8U A;  4JBC A;  4KBI A;  1EB0 A;  3OLB A;  2DIV A;  5KFD A;  2KZM A;  3VWS A;  5M2R A;  1OPZ A;  2QC3 A;  1MNE A;  4A8K A;  2KT5 A;  5EDW A;  1YJR A;  2W9C A;  2IJN A;  4O23 A;  2BM0 A;  3ZNJ 1;  1Q81 T;  3TZZ A;  4NLP A;  4RR5 A;  2DXD A;  1U2R A;  1N32 J;  4CO3 A;  4ZIT A;  2MLY A;  2BJ3 A;  3PJ9 A;  3TNV A;  4KTQ A;  4DFM A;  4ZVE A;  2B8Q A;  3HDS A;  3V6J A;  4DQQ A;  1AYE A;  3GSI A;  4DF4 A;  2JEF A;  3H90 A;  2RSQ A;  2QZ8 A;  3ZXW A;  1SQG A;  1D9D A;  4P7V A;  1Q8L A;  2DNP A;  3EJM A;  2GMJ A;  2DGU A;  2KM8 B;  3I0S A;  3V6K A;  3LAK A;  4ZPA A;  2BXJ A;  3IR5 B;  1F3F A;  2AJ2 A;  2DHS A;  3OJU A;  2YKQ A;  3P49 B;  1NLK L;  2J9E A;  4TY8 B;  3ILI A;  3CJR A;  1S48 A;  1EJ7 L;  1JLE B;  2ZM6 F;  4GRS A;  3BSA A;  4CLS A;  1RWX B;  3N01 A;  2ZJP Q;  3LAM A;  3I9V 9;  5CH7 B;  3OTO F;  3LGH A;  3NGT A;  4N77 A;  3ZTS A;  2MKJ A;  4CRJ A;  4FF1 A;  2XEX A;  4CNY A;  4NLU A;  3GCX P;  5IT9 Y;  1C4A A;  3I32 A;  4HT7 A;  2FZC B;  1WC5 A;  3NNH A;  4U96 A;  3AB2 B;  4ECW A;  2QL5 B;  2C22 A;  2F8E X;  1LXJ A;  1O8B A;  2WSF C;  2FC9 A;  3HM9 A;  4G1Q B;  4B9U A;  2BE9 B;  2IVM A;  4CT8 A;  1Q7L B;  1CJU B;  3QRR A;  2J0W A;  3R5B A;  1XR6 A;  4B08 A;  4R25 A;  4USI A;  1URN A;  3TA1 A;  1KN6 A;  5F0U A;  1DJ0 A;  1TMJ A;  2MZR A;  3FFI A;  2CQ1 A;  2A0F B;  4DR3 J;  2HHP A;  4B9V A;  4S0M A;  1QVF R;  4ID5 A;  4YS2 A;  5KFO A;  1CUL A;  2AYM A;  3W3S A;  4JI2 J;  3K17 A;  4GVB A;  3WQP A;  1T05 A;  5KFH A;  2KB2 A;  4Y6I A;  1IKW B;  2BAN A;  4K4W A;  4I69 A;  3AY0 A;  2MKY A;  4MKA A;  2KZZ A;  1S97 A;  3R2D J;  1WC1 A;  1Q0N A;  2KT3 A;  2E5G A;  3BF4 A;  5C24 A;  1UVJ A;  4W4M A;  3F44 A;  1SBR A;  2OLW A;  3OFG A;  2QMU B;  1VQ4 S;  4TU7 A;  1J2V A;  3NRB A;  2ZZN A;  3MM6 A;  1BY9 A;  4K2J A;  3OTD A;  5KFL A;  3EVW A;  3N5B A;  2G4B A;  2AEJ A;  3VAI A;  1HQU B;  2RF2 A;  2RQM A;  4DLG A;  1Q4R A;  3CJ3 A;  4LF1 A;  4DLE A;  3H5S A;  4NYO A;  4HL9 A;  3RGI A;  3HVT A;  4LF5 J;  3VGS A;  3GYG A;  4ETZ A;  1WJ9 A;  4NPO A;  3NCQ A;  5L1J A;  1X5S A;  3QAU A;  4KRW A;  5A2Q Y;  1LW0 B;  4Y2M A;  3W2V A;  1M5O C;  3BYP A;  4CH0 S;  3RBE A;  4ZP6 A;  2QYC A;  1U8S A;  1EHW A;  2VOP A;  3JSR A;  1N4L A;  1VYA A;  2CWX A;  2G0I A;  5ETO A;  4DG1 B;  4WU3 A;  4DCO B;  5BJR A;  1T9U A;  4TNO A;  1N6Q A;  3QRP A;  2NS1 B;  4G65 A;  4Y28 C;  2B0G A;  4OQJ A;  1IBC B;  1VDH A;  1GK8 A;  1TL3 B;  3T9Z A;  2DB1 A;  3Q8V A;  2XZD B;  1DQ8 A;  3M6V A;  5H1S V;  5CHC B;  4ZVS B;  5HQM A;  2AJ1 A;  1WOO A;  4IRC A;  2XHW A;  3MR2 A;  2KVI A;  2NCK L;  3B4M A;  2XMK A;  3K2Y A;  2XLK A;  1XQI A;  2D41 A;  5CD4 A;  4DV7 J;  4P10 A;  4ED2 A;  3W7B A;  2BKP A;  3OR2 B;  2A3J A;  1T02 A;  4Y3C A;  3EWG A;  5JUM A;  1FRM A;  1JNZ B;  2HYI B;  3MMC B;  2DHG A;  4I6W A;  1H72 C;  4RW4 A;  2YQ0 A;  4I2P A;  2H9Z A;  1U09 A;  1TK0 A;  1OPI A;  3DLE A;  4OZ5 A;  4K0K J;  4MFB A;  1JWW A;  3VZH A;  5B08 A;  4OZL A;  4W92 B;  3D1H A;  3LP1 B;  4LSL A;  1JB0 C;  3QRQ A;  3MAQ A;  3D0I E;  2XMT A;  2ATL A;  2DR6 A;  4JV2 A;  4WCE Q;  3T1H J;  2J6U A;  4J9S A;  1Q8I A;  2HBY B;  4LBH A;  2I6W A;  2CNL B;  3LGM A;  3OUY B;  2FTR A;  4ER8 A;  1MRO A;  2W2P P;  1K44 A;  1IQZ A;  1VFJ A;  2MZT A;  2LQB A;  1S1W A;  2R2U A;  2B6A B;  4F4X A;  2EBG A;  2H4W B;  2CJ9 A;  1S1X A;  4YME A;  3BBB A;  4WBF A;  2GHP A;  1LWF A;  1PG5 B;  4K0K F;  1B3T A;  4JI0 F;  4XO0 A;  1S7H A;  2YKO A;  1UEK A;  2WVD A;  2CPE A;  1ICE B;  4QYZ J;  4NLV A;  3MXH P;  3M30 B;  2HQC A;  2RHS B;  3CD7 A;  3WC0 A;  3T1H F;  1VQ8 S;  2POK A;  4ZVF A;  2RNE A;  3OD2 A;  3PZP A;  3MM7 A;  4OZ3 A;  3FBE A;  2ZOG A;  2IVY A;  4XTT A;  1FO1 A;  2PA8 D;  4J9L A;  3C6T A;  2BE2 A;  5IV4 A;  3CWJ A;  1LKZ A;  1QAX A;  1NDP A;  4Q7A A;  3ZC4 A;  2NRE A;  2WVB A;  2HVE A;  3GR1 A;  4AL6 A;  1VQY A;  4UW2 A;  1UFW A;  2ADC A;  2HMI B;  2DHX A;  3I56 S;  1FHT A;  1HR0 F;  3PX0 A;  4TLR A;  2RD5 C;  3FQK A;  5LMU J;  3QGH A;  3CO0 P;  1NK9 A;  3K8V A;  3MAA B;  1T9Y A;  1F2H A;  3R1H A;  3Q8Y A;  3NCR A;  2RE1 A;  5CAB A;  2FVP A;  2HSE B;  1JLB B;  4B3R J;  2DR9 A;  1FK9 A;  2IC3 B;  2E1A A;  5DQH A;  4FYV B;  1WHX A;  4RJV A;  4ECZ A;  1HQE B;  2VB6 A;  3B78 A;  2RIL A;  1FFW B;  3N6N A;  4NLR A;  3CMA S;  1DAX A;  4ZLJ A;  2CQ2 A;  4JI5 J;  1TUV A;  1U6Z A;  3IGN A;  4CO2 A;  4RKU C;  3EPI A;  4LVN P;  1R0C B;  2KRR A;  2KFY A;  2OML A;  3E8O A;  4OJH A;  1NSP A;  4AXJ A;  1BQN A;  3MHY A;  2B51 A;  4H4M B;  2W8K A;  4MKB A;  3Q0A A;  3POT B;  1CBK A;  4HDH A;  4M1K A;  3OL9 A;  1PAU B;  2NXJ A;  2H5J B;  4ILR A;  3D1O A;  2ASL A;  1KTV A;  4R0E A;  1T95 A;  7AT1 B;  4GKJ F;  2EG2 A;  1U0H A;  2ZBI A;  2MQP A;  3OV7 A;  2C1E B;  4JI5 F;  5L46 A;  2XSF A;  5DET A;  3GON A;  2BQ3 A;  1N52 B;  2D3O R;  2GJI A;  4UQT A;  2NYI A;  3RB0 A;  3EDQ B;  4MAK A;  3M2V A;  3NGU A;  2HZC A;  1I1G A;  1RAD B;  2CPZ A;  3R6G B;  1U1O A;  2O1P A;  3MMA A;  3IR7 B;  4EU0 A;  1I94 F;  1NDL A;  4J9Q A;  2IM0 A;  1QAY A;  2XWY A;  4K4T A;  1FER A;  5IOL A;  2X1B A;  1XC9 A;  3IS9 B;  3MM8 B;  3CCM S;  5BYS A;  2DEI A;  3S01 A;  4NYZ A;  1B0P A;  1HBN A;  1NND A;  1QSY A;  5A8R A;  4L73 A;  1XMQ F;  1EET B;  1FXD A;  3GJT B;  1RT1 A;  1F0X A;  5LM7 E;  2WOM B;  1MWQ A;  2LQ5 A;  2CPI A;  2EPI A;  1KNZ A;  2ZOF A;  3TUI C;  1NJY A;  3GJQ B;  4C0H A;  1HWI A;  5BYR A;  5ETN A;  1NK5 A;  5J1P A;  1SB6 A;  2HW3 A;  4L75 A;  4YB7 A;  2XZW A;  2LDY A;  2Y3Y A;  2XYG B;  2AJ0 A;  1Y10 A;  3MPY A;  3OL6 A;  4HAC A;  1RTH A;  3CJK A;  3N4W A;  2F40 A;  3TUP A;  2PMW A;  4DL0 C;  4FN5 A;  3C3L A;  3MDF A;  4LSN A;  3CTR A;  1ZS6 A;  3DRR B;  3E01 B;  1PJ7 A;  1GX6 A;  2PMZ D;  1UVK A;  4O3R A;  1Q1K A;  4FYW B;  3BR8 A;  4DU7 A;  5HLF A;  4OI4 A;  4KY3 A;  5LJ5 Y;  3J81 j;  1VQO S;  2ALZ A;  3G8T A;  3CJ2 A;  4Q2L A;  1M5V C;  2ZJR Q;  3QJP A;  3GR0 A;  4RW7 B;  4ZLN A;  4LQ9 A;  2I8E A;  4FVC A;  4OYA A;  3TA2 A;  4J7C A;  2EFQ A;  2VOO A;  3WBZ A;  4JI1 J;  5JVH Q;  3I5A A;  4PXB A;  2LQ8 A;  4F36 A;  2UV8 A;  3VAJ A;  4HR2 A;  6FDR A;  5GAG I;  3VF0 B;  2W9B A;  3GU0 A;  4TQS A;  2NLW A;  4CP5 A;  3NS5 A;  1WF1 A;  2Y1R I;  1ZZN A;  1UWB A;  2B4V A;  8RUC A;  3VGT A;  1SQF A;  2J0X A;  2WRM A;  2XMV A;  3OT9 A;  3QSI A;  4GO5 X;  4AD6 A;  2Y8W A;  3EXY A;  4CO5 A;  2VG7 A;  2VG5 A;  3VAL A;  4CLW A;  4KC5 A;  4JI1 F;  1R43 A;  1FKP A;  4ILM A;  8ATC B;  4O4R A;  3KK1 B;  4B9N A;  1FFG B;  5KFW A;  1S77 D;  1WDD A;  4YB6 A;  2MQQ A;  4Z7Y A;  3CDW A;  2AKW B;  4N7T A;  2BQU A;  4DV2 F;  3BDE A;  4AFF A;  2FLO A;  1VQ7 S;  2V69 A;  4DOZ A;  6FD1 A;  2DO4 A;  5HVH A;  4Q44 A;  2GNK A;  4JI4 F;  3GYX B;  1GH8 A;  2YWH A;  1YIT S;  2HLT A;  2OD6 A;  4ELT A;  1RBL A;  2QV6 A;  3M7V A;  3I31 A;  4R8U A;  3W5Y A;  2MST A;  3AD8 C;  2F4V F;  1BGX T;  5D78 A;  3W5Z A;  3P6Y C;  3D5M A;  2VDI A;  1NHK L;  1JJ4 A;  3VGU A;  3CDU A;  2P9C A;  3TW0 A;  2R3V A;  4ZLP A;  2ZH6 A;  3FZ2 A;  5KFM A;  3FBB A;  4WYW A;  2BW7 A;  2Y1J A;  4K4V A;  3Q86 A;  4F4K A;  3BGO P;  2R7V A;  3TZW A;  2DY9 A;  4HT5 A;  4KJI A;  4NXN J;  3KMQ A;  1JJ2 R;  3EPG A;  3OPK A;  2H48 B;  3EVM A;  1JLA A;  1SJ4 P;  1FRX A;  2D3U A;  4JI7 J;  5H9F J;  1B64 A;  1H98 A;  2HGN A;  2HPU A;  1U1M A;  1M5P C;  1WEZ A;  2QIF A;  3A12 A;  1EP4 B;  3TUZ C;  4FF3 A;  5KG6 A;  1V3S A;  2Z30 B;  2CZV C;  1ITP A;  3CSK A;  1KD1 T;  2XB2 D;  3EDR B;  1D8Z A;  3R7N B;  1T9T A;  2MHE A;  2IJR A;  5C7P A;  1SV5 B;  2YKM B;  3HD2 A;  4HI1 A;  4TY8 A;  2R7U A;  1JLE A;  4P52 A;  1J5E J;  3DLJ A;  1HLW A;  1S9G B;  2AJQ A;  1VIX A;  1UPP A;  1FNO A;  3SZ2 A;  3JTN A;  2FHJ A;  2DGX A;  2KU7 A;  5HAO A;  4RBU A;  5E3R A;  1VIS A;  1AA1 B;  2UUT A;  2MQM A;  2D69 A;  4DQR A;  1QJH A;  3Q22 A;  2VD3 A;  5ETK A;  2OD4 A;  1ZM4 A;  3N0V A;  3ILL A;  2FUG 9;  3SXL A;  3DM2 B;  1QSL A;  4U7U K;  4QYR A;  1S7I A;  3MFI A;  4M5H A;  4G1Q A;  3UD3 P;  4O0I A;  3MD1 A;  4JP8 A;  4RW8 B;  4FBU A;  3MUV P;  1WUU A;  2MEW A;  1U0S A;  5H9E J;  1J5E F;  4X4T A;  1RHK B;  4ZP8 A;  1S76 D;  2HWT A;  3G6X A;  3PNI A;  1JLQ B;  3MCM A;  1YLX A;  2N7Y A;  3GZ7 A;  4LR8 A;  1Q79 A;  3NS6 A;  4WTO B;  5FDL B;  4MT1 A;  3QGP A;  2LU2 A;  3C15 B;  4C11 B;  2Z2Z A;  2ASD A;  3THT A;  1CVJ A;  2JOQ A;  3IAM 9;  5LSR A;  2VJV A;  3KHL A;  1PYT A;  2Z57 B;  1KLM A;  2CDR B;  1NJZ A;  1Q8K A;  2C3U A;  4WYL A;  1IKW A;  3HJF A;  4OX8 A;  2R4F A;  3O1L A;  1YBA A;  2ZZT A;  1FRJ A;  1WHV A;  5KFI A;  3HHN B;  2HNZ B;  1Y4Z B;  3ISN C;  4GVL A;  4KO0 B;  1SC6 A;  4LF8 F;  2V0N A;  1K8A T;  2YBV A;  1HBM B;  1EIY B;  5B0C A;  2XZT B;  5LOQ A;  1ZAX A;  2HVI A;  1WEL A;  2IM1 A;  4OZ2 A;  3KHG A;  1UA0 A;  2AYG A;  3CB4 A;  3L7U A;  1UZD A;  2BEF A;  1HQU A;  3DLG B;  2OSQ A;  4UQG A;  4O44 A;  2VHG A;  4FNH A;  1AXQ A;  2PN6 A;  1TAQ A;  2VFR A;  3QIP B;  1VC0 A;  1KDN A;  2H51 B;  1F6T A;  5KT3 A;  2W2Q P;  4UOH A;  4AE5 A;  3IO1 A;  3D0H E;  4RW6 A;  4DR5 J;  1KS2 A;  4KH0 B;  3M32 B;  1W7W A;  1LW0 A;  2J76 E;  5B0G A;  4NE9 C;  2WW4 A;  5KFT A;  5GAG U;  2P2C B;  4ECV A;  1YBT A;  3OR1 B;  4OMF G;  3KLH A;  3ONQ A;  4DG1 A;  1RYR A;  3A8K A;  2QMX A;  4DQI A;  2GCF A;  2KG0 A;  1C0T A;  2BW2 A;  2B8P A;  2P8I A;  2IYG A;  1V3R A;  3ZTR A;  4YR2 A;  1TL3 A;  1N0V C;  2UU9 F;  1IR1 A;  3GFX A;  3HLU A;  4WP9 A;  1RT4 B;  4LF7 J;  2DCU B;  4MK9 A;  4DR5 F;  4Y2A A;  4WWS A;  5D3G B;  3TVZ A;  4XDD A;  5F8L A;  4ETX A;  2QX0 A;  1BQM B;  4M5K A;  5ETL A;  5DLG A;  2HBZ B;  3OR2 A;  4ZLL A;  1TKD A;  3M8W A;  4OX6 A;  1FJG J;  2NXU A;  4C3M A;  1ZYQ A;  9ATC B;  1HFE L;  1S9E B;  4DSJ A;  5A0Y B;  3JS9 A;  3G6Y A;  3HUL A;  2V8D A;  1LWX A;  2DTJ A;  4U6P A;  2H3E B;  2XYP B;  4ID8 A;  1REV B;  2AT1 B;  1RU2 A;  3VAF A;  2HIQ A;  5J2N A;  4LR7 A;  2A6M A;  1X4D A;  3LP1 A;  1U1N A;  3OLA A;  2UP1 A;  1IKX B;  4LF7 F;  4QIV A;  3IR6 B;  2DR8 A;  1T3O A;  2E7W A;  1MMN A;  2E29 A;  1WHY A;  3W9I A;  1PO6 A;  2B9E A;  2RS2 A;  3ZZU A;  3OUY A;  1RJJ A;  3WDO A;  4Z37 A;  2AYB A;  2QA2 A;  2OFG X;  3CJ5 A;  1CJK B;  2CG8 A;  4ES1 A;  3IXQ A;  3KOA A;  3KK2 B;  3AJ1 A;  2FJW A;  1F5C A;  1KWM A;  2M2B A;  4PEO A;  2ATC B;  3PJX A;  4CM2 A;  1RT5 B;  2CAJ A;  4X64 J;  2XCA A;  1FEH A;  2R8I A;  3HZG A;  4IFY A;  2MY8 A;  3CIZ A;  1NKC A;  4QWA A;  4WFX A;  3T9N A;  3CIM A;  3M30 A;  3H2V E;  3VAK A;  4I7F A;  3JAM U;  4F04 B;  1SJ1 A;  4Q43 A;  3PKY A;  5IZH A;  4LRC A;  4DR6 J;  1SI9 A;  2C28 A;  1U2C A;  1DTT B;  5KG1 A;  2XGQ A;  4QOT A;  2GVD B;  4EGL A;  2QSW A;  5HMZ A;  2XTJ P;  1M0S A;  2I1R A;  2Q43 A;  4DL7 A;  1KFD A;  4ALZ A;  3BDP A;  4OI2 A;  4DUY J;  5DS7 A;  3I55 S;  3FEY B;  3QNW B;  2OEJ A;  5I4M A;  3Q2T C;  1MG7 A;  3M8Q B;  2XC9 A;  1L5U A;  3J7Y U;  1G2E A;  1AB8 A;  2GQC A;  4JI3 J;  5KFF A;  4YR3 A;  2MLX A;  3RR8 A;  2DXE A;  4PWD B;  1VQ9 S;  3C6U B;  1D9F A;  2CJX B;  5KG0 A;  1U6F A;  2YX4 A;  4D3H A;  1FJC A;  3A4T A;  3CJ4 A;  5IQQ A;  1R8C A;  5KFB A;  2CQP A;  2MY7 A;  1JLB A;  5T7L B;  1BQX A;  2IC3 A;  1A6L A;  2QFI A;  1SKW A;  1D1U A;  3TO8 A;  1HQE A;  5DDR C;  3K5M A;  3UR0 A;  3IGV A;  1MN7 A;  4PG6 A;  1WI6 A;  3FBF A;  1X5P A;  1YRX A;  4DUY F;  2DIS A;  3M9O B;  3TEG A;  3AQO A;  3QZ7 A;  4XPC A;  4QR0 A;  4LIR A;  1MW7 A;  1C1C B;  3VVU A;  1M1H A;  5KT4 A;  3NAH A;  4I6A A;  3QFH A;  3T5H A;  4NLQ A;  5AE2 A;  5IV3 A;  1SXL A;  3UDE A;  2Z4P A;  3MED B;  4G6V B;  4UZB A;  4CLY A;  1HHT P;  2F7V A;  4RX6 A;  3HHL B;  1SH2 A;  3Q8Q B;  1MU2 B;  1RWV B;  2IBO A;  3H40 A;  4B3S J;  1B70 B;  2MB0 B;  3NAI A;  2VG6 A;  1SIW B;  3W5X A;  3WX8 A;  4NI2 A;  4LF9 J;  4F4Y A;  1FDA A;  1ZM3 A;  2Z8Q A;  4LJM A;  1U1K A;  2FVC A;  1O51 A;  4KAI A;  4FXV A;  4W98 A;  2QMW A;  1H74 A;  4ENO A;  4OFZ A;  5HMX A;  4FNI A;  2QYG A;  3TAM A;  4PG5 A;  1HHS A;  2HRT A;  1GFW B;  3ZTQ A;  2N3O A;  4FPI A;  2HHU A;  1FA0 A;  3MM8 A;  3DOM A;  2AMC B;  4LFB J;  2Z2L A;  2E5J A;  2R9L A;  4KE5 A;  5L38 A;  2E5L J;  5EX0 A;  1I51 B;  2RQ4 A;  1EET A;  2BVZ A;  5CZV A;  3FSI A;  2PA3 A;  1CJT A;  2WOM A;  2QE5 A;  1DLO A;  4DPW A;  1IBK J;  3GJS B;  1LW2 B;  4PAB A;  2IAJ B;  5M2P A;  3ILJ A;  3CCS S;  2CQ4 A;  2BKN A;  3ITH B;  2JVO A;  4DPO A;  4H4O B;  4X4O A;  3DHW C;  2GIQ A;  2LU1 A;  2RDD A;  1Y5L B;  3KUH A;  1RTI B;  1RLD A;  1RA7 A;  4IRD A;  2Q6B A;  4DSE A;  3MFH A;  4ZPD A;  3G9C A;  5KTQ A;  1KRP A;  2FHJ D;  2LP4 A;  1G6B A;  4A8O A;  2GML A;  2DRD A;  2E5L F;  2SXL A;  4YFU A;  2IDL A;  3DRR A;  5KT7 A;  3T1A A;  2ILZ A;  1T9W A;  3LF0 A;  3JB9 k;  4ZP7 A;  3IM8 A;  4QWB A;  3QT7 A;  2YNG B;  4CLP A;  3BO4 A;  2DJW A;  4CT9 A;  2F65 A;  3SFG A;  5K20 B;  1CEZ A;  2MYF A;  3AD7 C;  1E6Y B;  2IDE A;  2ASJ A;  2CNK B;  4EEY A;  1U8W A;  1OY8 A;  3C8Y A;  5DQI A;  1HPZ B;  1PC4 A;  2CQC A;  3LP0 B;  1OQ3 A;  4EUV A;  3HFV A;  4X2B A;  1YKW A;  2HHV A;  4DMZ A;  2BJ9 A;  1VHI A;  1YZ7 A;  2LCW A;  2Q3P A;  4WP8 A;  2CDQ A;  4C8N A;  1UMJ A;  4EZ6 A;  4FDF A;  4YP3 A;  1TKX B;  1KOH A;  3TVK A;  4K5S A;  3W9H A;  3I82 A;  4DL4 A;  3GPA A;  3L7P A;  1BWE A;  2CPY A;  3MR5 A;  3DXS X;  3O5T B;  1GMU A;  4HDG A;  3H98 A;  1PIE A;  2ZC4 A;  1M5H A;  2DNK A;  4PXD A;  2JEI A;  5J1E B;  1X4C A;  2DD8 S;  2DVI A;  1HW9 A;  4GKK J;  4JV5 J;  3V4M A;  4NEY A;  1HBU A;  2V8H A;  3KLV A;  3UN5 A;  3AQP A;  2OHD A;  4P75 A;  3KK1 A;  5D0H A;  1YSJ A;  2Q66 A;  4IG3 B;  1RDR A;  1GT8 A;  1G1X A;  3OQ2 A;  3FMB A;  3KNG A;  3S7R A;  1HL6 A;  1H7X A;  1RQ0 A;  3SCJ E;  1NKE A;  2I38 A;  4HHU A;  3IG1 A;  1TMM A;  3PRV A;  1RHM B;  3NY0 A;  3M9N B;  3P3D A;  2OMO A;  4F4A A;  1XMO J;  2DNL A;  1IUJ A;  3N6L A;  4AL7 A;  4GKK F;  3QZ8 A;  3GE9 A;  3KG1 A;  2JDJ A;  1K9M T;  4CM0 A;  2VIC A;  3QGI A;  4C98 A;  3IRX B;  3BH7 B;  1YIJ S;  3FQL A;  4A48 A;  2HBQ B;  1E6V B;  1T3N A;  1BWV A;  5EWE A;  1QUV A;  3U1M A;  5HRO B;  1TKT B;  4DV3 J;  1RP5 A;  3Q89 A;  3GIJ A;  4YOE A;  3O8W A;  3J80 U;  1RWN B;  4OYM A;  2QA4 G;  3HPO A;  3Q83 A;  4DL2 A;  2FHM A;  5K8P A;  3H5U A;  2AW0 A;  3QLH B;  2LQJ A;  3R7B B;  4PQU B;  4OYZ A;  1N5Q A;  3ETM A;  3MCN A;  3CUL A;  2XMU A;  1IVZ A;  4GC6 A;  4CNZ A;  4JV0 A;  1XMO F;  1RKI A;  3JTO A;  3B82 A;  1EP4 A;  4LF4 J;  3KK3 B;  1RTJ B;  1NHU A;  2CA9 A;  1BXN A;  3BGU A;  2YNF B;  2AGP A;  4ZPB A;  2C2Z B;  2DNH A;  2KRB A;  4CYU B;  2YWG A;  1KEK A;  1NSA A;  1VK8 A;  1SV5 A;  5B0D A;  3ELH A;  4WK3 A;  5E7O B;  3CCJ S;  1HNZ F;  2HHH J;  1MSW D;  3T1Y F;  2CUY A;  3MZI A;  2RRN A;  3Q2S C;  3D66 A;  3LQV A;  4NLG A;  3D6T B;  4Q8E A;  1S9G A;  4OHZ A;  5HVG A;  2MKC A;  5DDO C;  2E1C A;  3BSC A;  1WEX A;  3KDO A;  4OYI A;  3GIR A;  1XTZ A;  4B9M A;  3IWN C;  2P9G A;  2IM3 A;  5K8M A;  2RDI A;  1X5O A;  1VC5 A;  4M5L A;  2MSS A;  3DM2 A;  2K06 A;  2FHO B;  4C8K A;  3BEG B;  2XUL A;  5HSP A;  4U8V A;  1F3V A;  1IWG A;  4RW8 A;  3PM9 A;  4RNF A;  2HHH F;  1YGY A;  1Q53 A;  5JJB A;  2ZD1 B;  2HGM A;  3M9M B;  2BJD A;  3D67 A;  1KQK A;  1MML A;  1JLQ A;  2OTL S;  3T19 A;  3M2U B;  2EK1 A;  1QD1 A;  1I6J A;  5F8I A;  4OZJ A;  1K1S A;  3QFW A;  2IY5 B;  5CYQ B;  5FDL A;  4K4X A;  4C4W A;  3C15 A;  4C11 A;  2RUS A;  3DNC A;  4KHM A;  1Y7P A;  4CLZ A;  2MDA A;  3D28 A;  5J2P B;  3K89 A;  1OJ4 A;  1FEE A;  4G3I A;  3SMZ A;  4AT1 B;  5I3Q A;  2A2C A;  4DU8 A;  5E3Q A;  3CCL S;  4WF9 Q;  2PSZ A;  5KG5 A;  3V6D B;  4FF2 A;  3NWG A;  4PWW A;  1DQA A;  3W2W A;  4M5J A;  2B7C B;  5IS2 A;  5LXR A;  3MI7 X;  2RML A;  3NBP B;  2NXE A;  4YY3 J;  5EGY A;  4IUF A;  4UZC A;  2P5V A;  4ECQ A;  2HVD A;  2NXN A;  5D0G A;  4GMK A;  4KO0 A;  1DQ9 A;  4DI6 A;  2MTL A;  4BBY A;  2W7A A;  2K7J A;  3KLE B;  1HBM A;  5EHH A;  1QLN A;  1ZZF A;  1RU1 A;  3DYA B;  4DL6 A;  3D54 A;  2B56 A;  3DLG A;  2GJF A;  2FLL A;  2IA0 A;  2AD9 A;  3NS7 B;  4DV4 F;  2HZA A;  1G3O A;  3QIP A;  5HMW A;  3KLF A;  3R5A A;  4OV6 A;  2E66 A;  1VLO A;  3GLJ A;  1OO0 B;  3K59 A;  4RW9 B;  3HJV A;  3CF5 Q;  1X9S A;  3UDL A;  2L9D A;  3M1V B;  1R8H A;  1WKJ A;  3OBI A;  3MMB A;  3OR1 A;  1GQE A;  1IBL F;  5L1I A;  2U2F A;  2DYA A;  1JLC B;  2N4D A;  2UUB J;  2QA4 S;  4OJG A;  2HAI A;  3BBC A;  3RBX A;  2AX1 A;  1NBE B;  3PTW A;  2IHR 1;  3GFY A;  2VBY A;  1FDD A;  2WSE C;  5A2Q U;  3Q8U A;  4U67 Q;  2VQF J;  3F0N A;  4TYB A;  3HT3 A;  3UN2 A;  4DX8 H;  2VAS A;  1L3T A;  3MPV A;  2LXU A;  1RT4 A;  4OLO A;  2P9E A;  5F8M A;  3K57 A;  5I3P A;  4YQW A;  1OS5 A;  1RT2 B;  5D3G A;  2NUU G;  3G96 A;  2R8K A;  1HAR A;  1RT3 B;  3BSO A;  3ET6 B;  2EFG A;  3IWX A;  1DFD A;  2GMH A;  3AHP A;  2UUB F;  1JLG B;  3K0J A;  1S9E A;  5A0Y A;  3D7S B;  2DNM A;  2UXB J;  3CCT A;  2FJE B;  4AQY J;  1TL1 B;  2HZV A;  5MLC V;  2XCP A;  4IYQ A;  1HW8 A;  4DS4 A;  1REV A;  3IBC B;  1WG4 A;  2K8G A;  3QMQ A;  4PG8 A;  4P2F A;  3UN3 A;  2D3Z A;  3DLK B;  1IKX A;  1IXK A;  1FF2 A;  1YJ7 A;  5G0R B;  4IH7 A;  3EMT A;  4E98 A;  2V4R A;  3TP2 A;  2LQ9 A;  1HMV A;  1WAC A;  2OEM A;  2DGV A;  3CCR S;  1WC3 A;  2N82 B;  3BB5 A;  3X3U A;  1RAH B;  1UTA A;  2EEY A;  3DI6 B;  1ACM B;  1VRU A;  2BZ2 A;  1OSC A;  1CJK A;  5DGB A;  2GV1 A;  9RUB A;  3V4I A;  1WD6 A;  1RWK B;  3BR9 A;  3W8G A;  2LFV A;  2N3L A;  1FVQ A;  1H3D A;  1URR A;  1YX2 A;  1RT5 A;  5DDP C;  1NZ8 A;  4CWB A;  1TTH B;  1U49 A;  2AWZ A;  3MUM P;  3VCD A;  4GO7 X;  2UXD F;  4ELU A;  2E9Z A;  4DX6 A;  4ICL B;  1ZM2 A;  2F4F A;  4OJ1 A;  3PIP Q;  2I5J B;  2P6S A;  1VK3 A;  3BN7 A;  3CME S;  1X0F A;  5KAK A;  2Y0S D;  1BC6 A;  3ZZ0 A;  4PZV A;  2GVD A;  3QPI A;  2DIU A;  1ZTW A;  4OYP A;  3ULH A;  2PDA A;  3CGI A;  5FD1 A;  3PXG a;  3T5J A;  4PRF A;  3ENW A;  2APO A;  3I9Z A;  2R7O A;  1Q5V A;  1DHM A;  4NMX A;  3M8Q A;  2V67 A;  4IR9 A;  4K50 A;  1RUS A;  4DXL A;  3C16 B;  2K1R A;  2RHQ B;  4PWD A;  3C6U A;  5L9X A;  4DR7 J;  5GME A;  2HS4 A;  3C66 A;  1RWW B;  1VJW A;  1VQL S;  3VTI A;  5T7L A;  5F8J A;  3JSY A;  4BS2 A;  2AZ1 A;  2WHO A;  4X4P A;  2JLE A;  4FS1 A;  1EQ0 A;  4OHW A;  3VV2 B;  2VBZ A;  2H54 B;  2ZH2 A;  2X7I A;  1FRK A;  4CI0 B;  4LF6 J;  2V94 A;  1BUX A;  3MEE B;  3AOB A;  2KHC A;  1T0T V;  3BGR B;  5A8K A;  2NUH A;  4Y0F A;  3H5X A;  2VA3 A;  5BR8 J;  4ED1 A;  2G0C A;  2VDH A;  1NAQ A;  2E5H A;  1H7W A;  1RHQ B;  4ECS A;  4M5M A;  1FRI A;  2KFN A;  3MED A;  4MIB A;  4N47 A;  1BMQ B;  3B8H A;  3N9U C;  5F8H A;  2BE7 D;  2XHC A;  3WIU A;  1T03 B;  1SJR A;  1KQG B;  3K5L A;  3KKF A;  3CCV S;  3HHL A;  1QAI A;  1MU2 A;  2VC0 A;  1RCX B;  5BYQ A;  4LIW A;  4ED5 A;  2NSC A;  2R2T A;  4QWC A;  3LAN A;  3QO9 A;  3J7Z 5;  3A3O B;  2BR0 A;  5CZX A;  1X0P A;  3BO2 A;  1LFP A;  2B4P A;  3W61 A;  3BM7 A;  2B5J A;  3V6H A;  1RIS A;  1XMB A;  5BR8 F;  2HFN A;  4C8O A;  1KHW A;  2LMI A;  1VCT A;  4ZJO A;  3D6H B;  4P2M A;  2LDI A;  4N8N A;  4EZ9 A;  1RAI B;  3MM9 A;  1F2G A;  1N88 A;  2X1G A;  3H4B A;  4ZVR B;  3M6W A;  3DFE A;  2Y8Y A;  5E2Q A;  3QWU A;  4J91 A;  4EBC A;  3J7A N;  4AND A;  2O5D A;  4K7Q A;  1QM9 A;  3P96 A;  3SIP B;  4DQS A;  3FEZ A;  2BQR A;  4ED3 A;  4RL1 A;  4USH A;  4ZJQ A;  2ZH5 A;  3SYZ A;  3UO0 A;  4HH1 A;  5B0F A;  1KP6 A;  1SVD A;  2V2V A;  4QBU A;  4U7U D;  2HWH A;  3QWP A;  4C48 A;  2NSB A;  2XWX A;  5C5J A;  4FYY B;  1P1L A;  5GMD A;  1ZOT A;  4WIQ A;  2CQI A;  1LXN A;  1LW2 A;  4FBT A;  4I0W A;  1NPK A;  3MEC B;  2H4Y B;  4DQP A;  4QIW D;  2A1B A;  4H4O A;  2XO6 A;  4HTI A;  1W26 A;  3M8P B;  4R5P B;  4A8M P;  4ZVO B;  1RTI A;  2BX6 A;  4I67 A;  3BN4 A;  2QLJ B;  3HSD A;  2ZM6 J;  1YJT A;  2DXF A;  4DR2 J;  3Q23 A;  1XIQ A;  2W1B A;  1S1T B;  1FT8 A;  3QT5 A;  3OTO J;  2CQ3 A;  4KGM A;  2PII A;  4OHY A;  1J27 A;  1XN9 A;  5SUH A;  1Y00 A;  1TV6 B;  1Z4U A;  2ZH4 A;  2D1C A;  3TQ1 A;  1YDL A;  1F9E B;  3BKT A;  3Q8S B;  3W62 A;  1PCA A;  2YX1 A;  2W01 A;  1IQT A;  1FNM A;  2RT3 A;  3NOG A;  2YNG A;  3D4J A;  3KTQ A;  3KG0 A;  1M5K C;  2XLI A;  3GMG A;  3FMW A;  1E6Y A;  3FCV A;  2XO7 A;  4J37 A;  3BQ2 A;  2AU0 A;  4WPA A;  3M8S A;  3UNY A;  2CPX A;  1RAB B;  3LP0 A;  2ZHA A;  3GQC A;  4DR2 F;  4WFA Q;  1X5T A;  5DRK A;  3FEX B;  1U1P A;  4ZPT R;  2YQ1 A;  3AAW B;  1NPR A;  1R0A B;  4UOF A;  2ZH9 A;  4A8Y A;  2MQN A;  1VQN S;  2Q6C A;  4KQZ A;  3OSP A;  2ZVI A;  5CD4 H;  4P72 A;  4U9R A;  5GAE U;  1TKX A;  2F8H A;  4J9R A;  3P5B P;  2JX2 A;  2VFT A;  1H6K X;  3D3B J;  3V81 A;  4A8X A;  4DFK A;  1VQK S;  1HKA A;  3G87 A;  1MMD A;  2CVI A;  3FRZ A;  2Y9H A;  3NMR A;  2XY6 A;  4B9T A;  2Q79 A;  2IPO B;  2Q1L A;  5ETM A;  4PUO B;  2OO4 A;  5IT0 A;  1ZH5 A;  2PT0 A;  4K5R A;  4U95 A;  2MXY A;  2E9R X;  1N5Y A;  5L8R C;  2V8V A;  3I0S B;  3CJQ A;  3LTO A;  3X1L B;  1N5T A;  4HLB A;  2AGQ A;  4LT6 A;  2XI2 A;  2AP6 A;  3EXC X;  1ZA1 B;  1TVR B;  4M63 A;  2V5H G;  2K7K A;  1WC6 A;  2L41 A;  4IG3 A;  2EVZ A;  2VC1 A;  4BHQ A;  2MKK A;  2JLF A;  4URG A;  3OJS A;  1U4B A;  1P27 B;  3PVX A;  2DNZ A;  3M2R B;  3HP6 A;  4F0M A;  4KHP F;  4WZM A;  5CYM B;  1W2I A;  1NO8 A;  2BJ8 A;  4NA3 A;  2BOA A;  2MMY A;  4RPF A;  2C2D A;  4EMD A;  2QLF B;  3PEJ A;  4F25 A;  4URS A;  1ZAV A;  1TUW A;  3ZZP A;  5C2G A;  3TJ9 A;  3EGW B;  2Y1I A;  1F1B B;  5KFV A;  2BJE A;  2UUA F;  2X1A A;  3K7R A;  1HNX J;  3E3X A;  3IRX A;  1RAC B;  1E6V A;  5FLX U;  3HK2 A;  4RUA A;  2L9N A;  3DKD A;  1TKT A;  1VQP S;  3JTP A;  4CLF A;  2WK4 A;  2GO9 A;  1KBR A;  1WC0 A;  3VVT A;  4K4S A;  1NH7 A;  4TKT A;  3FFI B;  3OHA A;  1YQH A;  4MTP A;  4FYD A;  4K59 A;  3EGN A;  2DNG A;  3QLH A;  3TI0 A;  4PQU A;  5LT5 A;  1CUL B;  2DKO B;  1EQM A;  3CC7 S;  3DCA A;  4LFC F;  4OYW A;  1Z2Z A;  4I64 A;  2ZH7 A;  3CCU S;  3EGV A;  1CQN A;  4ZK7 M;  1N36 F;  1YBU A;  1HNX F;  3KK3 A;  1B7F A;  2YNF A;  3E51 A;  4QPX A;  3D68 A;  1YJ9 S;  3FDS A;  5C24 B;  5E41 A;  3BBF A;  2HND B;  1S6U A;  4CYU A;  1OY9 A;  3AOD A;  7FDR A;  4KKO A;  4P9S A;  4NLO A;  4ZVG A;  3M6X A;  4Q8F A;  4X66 F;  1RAF B;  5F3T A;  4IG0 A;  1KOO A;  2G0J A;  3QBC A;  2E7V A;  4NZ6 A;  4WK1 A;  1RB0 A;  1XNR F;  3KHR A;  4GC7 A;  3OFF A;  5E3C A;  2V8P A;  4NLS A;  4M5I A;  1PYS B;  4ZMM A;  3HI9 A;  3OTC A;  1S0O A;  2V2Q A;  1RWP B;  2E1P A;  4CTA A;  1QE1 A;  5BXI A;  3DLH A;  3L9Z A;  4V1A k;  2OPS B;  5G4D A;  5B0E A;  4F26 A;  4X62 F;  3OXF A;  3UCZ P;  5ETS A;  2R7W A;  4B02 A;  1IKY B;  3JXO A;  4C97 A;  4O4G B;  2ZD1 A;  4IFV A;  2LVW A;  3WIV A;  2HAF A;  1I5O B;  1N34 J;  1HQ2 A;  4JI0 J;  3M2U A;  2O3D A;  1AUD A;  3H2U B;  2E1M C;  2WAQ D;  3FCW A;  5CYQ A;  1UET A;  3PYD A;  2CPD A;  4UT4 A;  1FVS A;  3AXK A;  4P74 A;  1Y0H A;  1H38 A;  4AXI A;  5J2P A;  3RRK A;  5ETV A;  1BLU A;  3HKZ D;  2NZ4 A;  2C3M A;  2DH7 A;  3C19 A;  3EE3 A;  2DEJ A;  3V6D A;  5C42 B;  4ED0 A;  3PCO B;  2VBX A;  4JYA F;  3NBP A;  4EO8 A;  1FXR A;  4NLY A;  1BHN A;  5F41 A;  4OYB A;  2DBB A;  2FGO A;  1D8Y A;  2MKS A;  2A6O A;  4KGV B;  4J9P A;  2E7X A;  2RU9 A;  2H5I B;  2XY7 A;  4RNM A;  1N34 F;  4O3O A;  4I2P B;  3KLE A;  3G6V A;  4ZVQ B;  1RAO A;  2EC2 A;  1Q7Y T;  1HR0 J;  4RUC A;  1B0T A;  4F2S A;  1YTY A;  2EFP A;  4PAA A;  3HF5 A;  4C6A A;  3DYA A;  4ZCL A;  1R27 B;  4KH1 B;  4C3L A;  3CE8 A;  4DDF A;  2W9A A;  1H0H B;  2RRA A;  2GFF A;  3ICL A;  2M4M A;  4DZD A;  4G1P A;  1HNW F;  4NCA A;  4K8R A;  1Y5I B;  4IDK B;  1WF2 A;  4TXS A;  1SUQ B;  2I0X A;  3K5O A;  2F8M A;  2HVZ A;  3DLL Q;  2V63 A;  1GTE A;  5CCM A;  5DM6 Q;  3P4U B;  5E0O A;  4RW9 A;  4HVZ A;  1ZM9 A;  2DGO A;  4NLD A;  2A18 A;  2KM8 C;  1B7Y B;  2AJF E;  3M1V A;  4UOC A;  2FC8 A;  2HQF A;  1X31 C;  3N6M A;  4DR4 F;  3SCK E;  3IWL A;  5D0E A;  3R27 A;  1JLC A;  1C1B A;  4F4W A;  2ZKT A;  2JZ5 A;  1S49 A;  3G82 B;  1UVI A;  1AZS B;  1NXI A;  3R97 A;  5F0W A;  3RB6 A;  2FZG B;  2ZE2 B;  2H1Y A;  2DNY A;  1HWJ A;  2J6S A;  1DAR A;  3SBM A;  6AT1 B;  4CH7 A;  1WG1 A;  4RU9 A;  4WJB A;  5THW A;  5EX3 A;  4GKJ J;  4JUZ A;  1FE4 A;  4ZCM A;  4QU6 A;  4LFA J;  1UVM A;  4JI8 J;  1N48 A;  4ZPV R;  5AXN A;  2ZWO A;  1RT2 A;  5KFJ A;  2BE2 B;  1RBO B;  4I2Q B;  4MJK A;  4F0K A;  5KFY A;  4ES2 A;  3PY8 A;  2DGT A;  4DUZ F;  1RT3 A;  3ET6 A;  1P6T A;  2J7K A;  2M3D A;  1I94 J;  1JLG A;  1PYO B;  4C3K A;  4NYP A;  4EK2 A;  5E3A A;  1YJV A;  5J1N A;  4B3T F;  3BSN A;  5F8G A;  5IM0 B;  2MGZ A;  1TL1 A;  4URQ U;  1A9N B;  3OSN A;  4CLL A;  1X9M A;  1TL5 A;  3RB4 A;  2C2N A;  4CLT A;  1CC8 A;  3TZX A;  4RBV A;  1MLA A;  3HO1 A;  4X4R A;  4N56 A;  3DLK A;  2HNY A;  1XMQ J;  4LFA F;  2BDP A;  4JI8 F;  5G0R A;  3EM1 A;  4PCQ A;  2GQ2 A;  3KLG B;  4OX9 J;  4MYU A;  3A1Y G;  5JMN A;  3AJD A;  2UUC J;  3GB0 A;  2DRB A;  1SL2 A;  3QAT A;  4CO0 A;  2NPI A;  2EC0 A;  3K8W A;  1VQ5 S;  2IJF A;  1GXU A;  3DI6 A;  1NH8 A;  4A8F A;  4OJ3 A;  2FJX A;  4Q45 A;  1K47 A;  5HAT A;  4RNO A;  3CD5 A;  5JXS A;  1A0O B;  2CKW A;  5J2M B;  4DL5 A;  4OZ0 A;  2H65 B;  2GQQ A;  2N7C A;  3MD3 A;  3PYE A;  4ZOS A;  5KG3 A;  1U47 A;  3BKF A;  1RTD B;  1WTB A;  2HRY A;  3RW6 A;  1X4F A;  3S8S A;  3TA0 A;  1O6X A;  3I0R A;  3G6E S;  1NEE A;  4OX9 F;  2CAD A;  2UUC F;  3HSG A;  2CRL A;  4P6Q A;  3R5J B;  1U0H B;  1WDT A;  3V2U C;  4ELV A;  4X4N A;  2CVE A;  1L3K A;  3LGN A;  1W2B R;  2I5J A;  4CCH A;  3FGV A;  2VFU A;  1NZA A;  5K9F A;  4QPT A;  4ZVU B;  3BJY A;  1J5O B;  1Q82 T;  2LEC A;  3DRP A;  4KSE B;  2FY1 A;  5KT6 A;  1HI1 A;  4W90 B;  2G2Z A;  4DN9 A;  1JQG A;  2JSX A;  4DX7 A;  1TQL A;  5D15 A;  2XSJ B;  2YVS A;  3C16 A;  2FJV A;  5D4N A;  2D9P A;  2V2K A;  2V2Z A;  3RRG A;  1XNQ F;  4KR0 B;  5ADZ A;  1H73 A;  4M8L A;  2L48 A;  4YN3 B;  1P1T A;  4BDP A;  2B9W A;  3IC1 A;  3L4B C;  1RT6 A;  2OPR A;  2R7R A;  2M7S A;  4FVM A;  2HHQ A;  4NAS A;  3MEE A;  1G7C B;  5DQG A;  1Z2L A;  3BGR A;  3N5F A;  2ROE A;  3FRY A;  2Z58 B;  2W2M P;  2MKI A;  3WHI A;  4M5D B;  3KHH A;  3SDE B;  4PPZ A;  3R7S B;  2XMW A;  4DV2 J;  5I42 B;  2HQI A;  1FD8 A;  2GGP B;  4IO1 A;  5LMN J;  1T03 A;  2R8G A;  3H2L A;  3DDN A;  3KUE A;  3B4D A;  1SL1 A;  3DLB A;  4KHR A;  4NZ7 A;  1L3U A;  4JI4 J;  4EYH B;  2MKH A;  3LW5 C;  2BRL A;  3A3P B;  2MQ8 A;  4E0D A;  1EAY C;  2KXN B;  4PPD A;  3HD1 A;  2F4V J;  4DJB A;  1GX5 A;  2JJ4 D;  3OL8 A;  1XR5 A;  3U27 A;  4ITS A;  5AXM A;  1NSK L;  4PXE A;  2ZBQ A;  2ZDO A;  4ZDN A;  1UKU A;  3O3L A;  1N54 B;  2HK2 A;  2BV3 A;  5LMN F;  4J9O A;  4C8Z A;  1SL0 A;  1SJF A;  4WXW A;  2VPZ B;  1IJE B;  2YPY A;  2BYC A;  2HFU A;  2HGL A;  4I56 A;  4HKQ A;  1XK8 A;  2ZOM A;  3C46 A;  2GIR A;  2W2O P;  5HQ8 A;  1H2V Z;  1VC6 A;  2VG7 B;  3MR6 A;  3UFC X;  3T41 A;  3MEC A;  4F50 A;  3I96 A;  5DM7 Q;  3UR3 C;  1VRQ C;  3MPU B;  3TEH B;  1PIL A;  5KG2 A;  1TK5 A;  4J5O A;  3M8P A;  4R5P A;  1JJC B;  2YY3 A;  3H20 A;  2COL A;  1D0E A;  4LR9 A;  4ZJL A;  3LWM A;  1S1T A;  4C2M A;  2LYV A;  5IC6 B;  2QN6 B;  2ILY A;  4I4B A;  5D4P A;  4AUK A;  4I1T A;  3OXL A;  1TV6 A;  3QAE A;  2XMM A;  4DV0 J;  1LK5 A;  3J80 Y;  1BD6 A;  3SQG B;  4PKD B;  2JFK A;  2YNH B;  1Q95 G;  5EN1 A;  2A2D A;  3TOQ A;  1TFY A;  4NML A;  4ATN A;  2ZUA A;  5DO2 A;  3ZZT A;  1EZZ B;  1V5I B;  1KTQ A;  1GTH A;  1IBM F;  4O3S A;  3AB4 B;  4DPU A;  1S5Z A;  2V34 A;  2VZ9 A;  2CNO B;  3UNG C;  5KFU A;  2R7Q A;  4K2X A;  5B7W A;  3HVR A;  3CUN A;  3MUR P;  1RXO B;  1R0A A;  1FJE B;  2HHT A;  1S6O A;  1D9A A;  1RI7 A;  1JLA B;  1VOM A;  1LWE B;  3DHX A;  3T5K A;  3GWC A;  1RT7 B;  4DV0 F;  3PG9 A;  2R8J A;  1R3N A;  2GW8 A;  1JXV A;  3L95 X;  3NGD A;  4FXD A;  3J7Y I;  2XG8 A;  1RAE B;  1JLF B;  4C8L A;  4PUO A;  2VUG A;  4HHJ A;  2UV8 G;  2GIF A;  1CJU A;  3UQS A;  2WVE A;  3AOC A;  3BGL A;  3AJ2 A;  4XAK A;  3R2C J;  1OWX A;  1R6Y A;  4M5G A;  5B09 A;  4LF8 J;  2DO0 A;  4C8M A;  3CPW R;  1VIO A;  1TVR A;  3BGF A;  3M6U A;  3E2E A;  5AE1 A;  1VQ6 S;  4HHH A;  1Y5N B;  2QSF A;  4WU2 A;  3LP2 B;  4EBD A;  2W4P A;  4QYZ K;  3I5C A;  3R8Y A;  2HKE A;  1N32 F;  2LKZ A;  2VBW A;  3TRG A;  3M2R A;  5CYM A;  4N76 A;  1S9F A;  1R0B G;  3UCG A;  2G1D A;  2B4O A;  2ACY A;  2WTF A;  4RNH A;  4Z2X A;  1IM4 A;  3KWM A;  4KPC A;  3B54 A;  1SKS A;  5KFS A;  2IIH A;  2BMB A;  3IMQ J;  2C2E A;  2JRS A;  3JQK A;  4PYA A;  1U1Q A;  2GZO A;  2KO1 A;  4YB1 P;  3BQ1 A;  3D3C J;  3CDB A;  1WKL A;  1VRT B;  1WOS A;  5U47 A;  3MEG B;  1YI2 S;  4HTJ A;  4M94 A;  5LL6 d;  1QDU B;  3QID A;  3JYT B;  3ZFV A;  1HYS B;  1F9F A;  1YWX A;  1GXT A;  4DSF A;  2JC1 A;  4ZVT B;  1NK8 A;  1V6H A;  2KYZ A;  4MYT A;  2JNJ A;  4L6V 3;  1KON A;  3I4H X;  3U02 A;  3MM5 B;  8AT1 B;  4JV1 A;  1V9O A;  2AGO A;  1VR6 A;  3R1L A;  2D74 B;  1WWH A;  4H4K C;  5KFR A;  2OJ3 A;  2UU9 J;  3CC2 S;  4O3P A;  3OXG A;  4FYX B;  4ZKA A;  3GSD A;  1KLM B;  3J7Z T;  1KSP A;  4TY9 A;  4QWE A;  5IT4 A;  4P7T A;  1HNI B;  2AJ4 A;  3G4S S;  2CQH A;  4OYO A;  4ECY A;  1PBA A;  1JKH B;  2HND A;  1PBU A;  1AFJ A;  1PAE X;  5D4L A;  2KTQ A;  3GG1 A;  2DH8 A;  4DR3 F;  2F63 A;  4HYK A;  4LUB A;  2CPJ A;  2VOD A;  3NGS A;  4JI2 F;  4N5S A;  3BO3 A;  2PI4 A;  1WG5 A;  2PI5 A;  4O44 B;  3AA8 A;  2GAG C;  2WBR A;  1SKR A;  3DMJ B;  3IFE A;  3NWR A;  3KG4 A;  3I5B A;  2AQ4 A;  2NR0 A;  5CA5 A;  1N56 A;  1SC4 B;  3GII A;  3PV8 A;  4QCL A;  3JQJ A;  1NUE A;  4RW6 B;  1TAU A;  4QZV B;  1IKV B;  2FJA B;  4K4U A;  4NCG B;  3MMC A;  4NA2 A;  2OPS A;  1N8R T;  1T94 A;  4V19 J;  4IQM A;  4ZHR B;  3VR1 A;  4KPY A;  3P5T L;  3TYT A;  3ZTP A;  4Q0B B;  4DSL A;  2F9J A;  2XI3 A;  3KLH B;  1RKJ A;  4YEA A;  1IKY A;  1R8P A;  4O4G A;  3PFE A;  4DPY A;  1TU0 B;  3KDN A;  4NX9 A;  4ECU A;  5JVG Q;  3SV3 A;  2HQ3 A;  3RRH A;  3TJ8 A;  1FKA F;  1C0T B;  1UJ4 A;  2HVH A;  3FVY A;  4I6Y A;  3LUY A;  5HI7 A;  2HG4 A;  2YPZ A;  3OTB A;  4LF5 F;  4N41 A;  1S1V B;  3AFG A;  3DOL B;  4F3Q A;  2FIU A;  4USU A;  4NXM J;  2F9D A;  2D7S A;  5C42 A;  2C3O A;  5KT5 A;  5KFA A;  2JL9 A;  2HUR A;  2B6A A;  3PEH A;  5K14 B;  3PAC A;  3H4D A;  5AE3 A;  2L9W A;  4LQ3 A;  2ZDP A;  4USW A;  1SC3 B;  2KFZ A;  1RGV A;  5KOW A;  2V8G A;  2CJB A;  2E44 A;  2LXF A;  3OVA A;  3FJ2 A;  5J2N B;  1RA6 A;  2X51 A;  2HK3 A;  1S0N A;  3ZZZ A;  1XER A;  1X9W A;  2VU5 A;  4O3Q A;  5A76 A;  4NXM F;  2OUG A;  3J81 U;  4P2X A;  3ENA A;  4DV7 F;  2QLW A;  2YKN B;  4ZCI A;  5F3Z A;  2XYH B;  4RZR A;  1CJV B;  4NLW A;  4IDK A;  2KYX A;  1SUQ A;  3ENQ A;  1HNV B;  4BC9 A;  2RB7 A;  1SKU B;  4BWM A;  4N8O A;  2KT2 A;  1TZ0 A;  2GC8 A;  2ROP A;  1UJ6 A;  4NWB A;  3L7O A;  3DDK A;  5L9N A;  2HMI A;  3HFZ B;  3P45 B;  4UOG A;  2G9O A;  1WSV A;  1KHV A;  3DGV A;  2M8D B;  3T6J A;  3PW0 A;  3THP A;  3Q24 A;  2RVJ A;  4NCB A;  1ULR A;  4OI6 A;  3QJL A;  3MAA A;  2YWE A;  4CZC A;  4KT0 C;  3RBZ A;  3G82 A;  2B43 A;  3KMS A;  1AZS A;  1A7G E;  4IFY B;  4ED4 A;  2DNQ A;  2ZE2 A;  4ES3 A;  2Z0G A;  4L74 A;  3JSM B;  3CCE S;  2QRR A;  4I7F B;  2R2S A;  4ZIV A;  3UDV A;  2OKQ A;  3MCO A;  4EI2 A;  2QO3 A;  4I2Q A;  3UE2 A;  2YNI B;  2RAQ A;  3ISZ A;  1VMB A;  2B9Y A;  2Y1L B;  5AXL A;  2GS8 A;  1FDN A;  3IM9 A;  5DDQ C;  4H4M A;  3U1N A;  4KV8 B;  3POT A;  1QTM A;  1U02 A;  3D2W A;  2ZIT A;  5IM0 A;  5KFQ A;  3KJQ B;  3PFO A;  3OTE A;  4DR1 J;  3PO4 A;  4NZ0 A;  2JFD A;  2CFX A;  5HVF A;  2IMO A;  3KLG A;  2LXI A;  2NXC A;  3DDI A;  2K3I A;  5ETQ A;  3KJN B;  1T9X A;  2DGQ A;  3ILO A;  5A8W B;  3MCS A;  3HSJ A;  3CJ0 A;  4OZN A;  2HEK A;  3CO9 A;  2HFS A;  1TFW A;  2J9C A;  2ZH8 A;  1FTC A;  3MR3 A;  4F3M A;  3GIL A;  5J2M A;  5LMU F;  3IS9 A;  1O5J A;  1ZA2 B;  3H5Y A;  3RAQ A;  4DR1 F;  5H9F K;  1HBO B;  2RQK A;  1VBY A;  2W8L A;  1RTD A;  3PRB A;  2UZA A;  3K5P A;  3R3T A;  4B3R F;  1NKB A;  1HD1 A;  5CAA A;  3EX7 B;  2W4D A;  4LRE A;  2KDO A;  2XMJ A;  3RYL A;  1RLC L;  2QLX A;  5E33 A;  2VG6 B;  5T14 A;  2JEJ A;  2W7P A;  2FVQ A;  3KLI B;  4NI2 B;  2OPP B;  1VBK A;  1XR7 A;  3ZO7 A;  1X4A A;  5LJ3 Y;  3G86 A;  4QR1 A;  3W63 A;  3C2P A;  5MAO A;  4RLE A;  3NMA A;  3LO3 A;  3TAM B;  3PX4 A;  3H7H B;  1J5O A;  3FK4 A;  4LVO P;  4U7C A;  4KB7 A;  2ZUG A;  4I68 A;  5KFX A;  2CQB A;  1SQE A;  4H4K A;  2DR5 A;  4ZN3 A;  5E3P A;  3PJW A;  5KG4 A;  4K4Z A;  4ED8 A;  2VPX B;  3GV8 B;  4DZ6 A;  4UUW A;  2XQC A;  3DOM B;  3E01 A;  3BH6 B;  2XSJ A;  2W7O A;  4Y2C A;  2J0S D;  3TAR A;  1M5S A;  2VPW B;  1P9Y A;  4OHX A;  1FXL A;  2B7B B;  1CS4 B;  1RWO B;  4ED7 A;  5B0A A;  1CJT B;  3M8Z A;  2B4U A;  1DLO B;  2ZFH A;  4RW7 A;  2C42 A;  1UEU A;  2QEX S;  4MMO A;  5H9E K;  5D77 A;  4IOB A;  2ZH3 A;  2LEB A;  2KN4 A;  2MJU A;  5CXT A;  3KYL A;  2V6A A;  4DCP B;  2E1R A;  3H8Y A;  2ZBC A;  4X4S A;  2HFZ A;  1S10 A;  3UD5 A;  2BRK A;  3CT9 A;  4XPE A;  4ED6 A;  4M5D A;  3K5N A;  2BM1 A;  3UDC A;  3SDE A;  1D3W A;  5GMK a;  1R6V A;  3BQ0 A;  2M8H A;  4L72 B;  5I42 A;  4D3G A;  2GGP A;  1EAR A;  2JLG A;  1WNE A;  2KJW A;  3FC9 A;  3TVY A;  5HBM B;  1FWL A;  1VS3 A;  4DSI A;  1B4S A;  1LFW A;  2DHH A;  5A6W A;  5EWG A;  4KYZ A;  1HWK A;  4QQB A;  1B0V A;  2LEP A;  1NSQ A;  3LAL A;  5HQL A;  2YXL A;  2NPF A;  2FVS A;  4WFB Q;  3VQS A;  1X4B A;  2QL9 B;  2QJ3 A;  2ZBR A;  4BC7 A;  3TZY A;  2PO4 A;  1XBW A;  3UW1 A;  1WTF A;  2EI5 A;  1RYS A;  2QT7 A;  4EWT A;  3RAX A;  1DZ5 A;  1K0V A;  1YK9 A;  1TR0 A;  2BOP A;  3C14 B;  3NEK A;  3CVK A;  3T5L A;  1R7I A;  1RHR B;  3IP0 A;  2KXH A;  1IM6 A;  1S57 A;  4FF4 A;  5D8H B;  4ZS6 A;  5C25 B;  3D9B A;  3OHB A;  3DOK B;  1KLN A;  1EKR A;  2MZQ A;  4Y2I A;  2DNO A;  3K58 A;  1P8G A;  4OHV A;  5KT2 A;  3MWB A;  1L3V A;  2CJY B;  2FQQ B;  1KC8 T;  1C0U B;  1U1R A;  1HBU B;  4OI1 A;  4FXW A;  2D3O 1;  5KFE A;  3HSZ A;  2EXU A;  3U1L A;  1DRZ A;  1VLY A;  3KXD A;  1Q86 T;  1R89 A;  4DL3 A;  1FCA A;  1HNZ J;  1NJX A;  3T1Y J;  2YH0 A;  1KR4 A;  4MKV A;  1VQM S;  4WXO A;  3OFE A;  2VON A;  3EGZ A;  5B0B A;  3BZQ A;  3T3F A;  3PYF A;  1CG2 A;  5F9N A;  3IAS 9;  3TAQ A;  3CJ8 A;  5IQ6 A;  2FPH X;  4HH0 A;  4CH1 A;  3BKU A;  4PXC A;  2Z2M A;  5FLX Y;  2IRX A;  3IG1 B;  3LA0 A;  3CJT A;  2B3T B;  2XBP A;  4F67 A;  4C7Q A;  1RSC A;  3SQG A;  5EWF A;  1CPZ A;  2DT9 A;  3FSX A;  2YNH A;  4B9S A;  1ZET A;  1X4G A;  3HMJ G;  1RWM B;  5KOX A;  2YKM A;  4X65 J;  3TAP A;  4LRB A;  2IMW P;  4WE1 B;  1F9H A;  4MIW A;  2VIH A;  4FKY A;  1JXL A;  5T41 A;  5GAD I;  3F73 A;  5E5N A;  2BUN A;  4HEA 9;  1XEZ A;  2VKR A;  3RR7 A;  1UAW A;  1KQF B;  2PFD A;  1AFI A;  1ELO A;  3CCW A;  1NJI T;  3HCX A;  2MQO A;  1LWE A;  1TKZ B;  1LV5 A;  5J2Q B;  2DY1 A;  3HT0 A;  1PJ5 A;  1RT7 A;  3IA0 A;  4X84 A;  4BWJ A;  3FZB A;  1NRK A;  1JLF A;  3G2X A;  4J90 A;  3HHL C;  2PE8 A;  3NP5 A;  1DUR A;  1YHQ S;  5IT9 U;  1N0U A;  4WKY A;  3QT6 A;  1WF0 A;  3AT1 B;  1K1Q A;  4NLX A;  4X65 F;  1HWU A;  3RG6 A;  3H42 A;  3ZZY A;  5L1L A;  3EZO A;  2EWH A;  3TWZ A;  2UUW A;  5DG8 A;  4BLG A;  2R7T A;  1D09 B;  2XM3 A;  4NXN F;  3EZ5 A;  1PKU A;  4C9D A;  2ACM A;  3LP2 A;  4DF8 A;  2ZVS A;  4LBP A;  4Y34 A;  1DY3 A;  3CED A;  2GX8 A;  3FSY A;  4XDC A;  4JI7 F;  1SJ3 P;  1NCL A;  1YRT A;  2CPH A;  3NCP A;  4DV4 J;  4QU7 A;  1FFS B;  2GA7 A;  3WC2 A;  4NRU A;  1CSJ A;  1NB2 A;  2F5G A;  2ASY A;  2HNZ A;  2LEA A;  3BYR A;  5HP1 B;  2OP5 A;  4ZCK A;  5HJY A;  4XIU A;  2ZBP A;  2BJ7 A;  1VRT A;  3MEG A;  2U1A A;  4R0J A;  1IBL J;  3JYT A;  3ZTO A;  5K8N A;  4C8Y A;  3DRX A;  1HYS A;  2GHW A;  1U48 A;  2PMH A;  3DU6 A;  2FJD B;  4U8Y A;  5KG7 A;  3MM5 A;  4UY8 5;  2AIR B;  3QT8 A;  4OI0 A;  1NK7 A;  1IJF B;  2CNN B;  2GVZ B;  1VQS A;  1RZM A;  1U26 A;  3ZNU A;  1IN0 A;  2FHK A;  1TL7 B;  1AW0 A;  3CDE A;  1HNI A;  2HWI A;  1RCO B;  1UFK A;  3W2W B;  5CYJ A;  3M05 A;  4DN0 A;  2C2K B;  3MGJ A;  3M32 A;  1RTZ A;  5D4O A;  3GJR B;  3OVS A;  1Z1Z A;  2E9T A;  1JKH A;  1DBD A;  3W65 A;  5A6P A;  1T11 A;  5HMY A;  4A47 A;  2R7X A;  2KH9 A;  2CPF A;  2DIT A;  4RUB A;  3CDA A;  2KKH A;  2WVC A;  2YWK A;  3FCH A;  2EFV A;  2C2R A;  3GYN A;  2XS5 A;  5KFZ A;  2CYY A;  2ZNY A;  1IR2 A;  2CJA A;  1GAO A;  3DMJ A;  2W24 A;  1VBZ A;  2CQG A;  3KLF B;  2M88 A;  4ERD A;  1YZ6 A;  1WKK A;  5ETR A;  2JHE A;  4PYD A;  4KIA A;  2MZJ A;  1S72 S;  1PC5 A;  1DTQ B;  1BQM A;  5DZ7 A;  2UVR A;  2OAU A;  1SC1 B;  3R5D A;  1IKV A;  3I87 A;  3SCI E;  4NCG A;  3FKB A;  2EFN A;  2GHV C;  1X60 A;  1CQM A;  2BBE A;  4ZHR A;  3VHQ A;  2PGC A;  3MMB B;  4F2R A;  2BAC A;  2RUG A;  4Q0B A;  3PIO Q;  3RTV A;  1EX8 A;  1HI0 P;  2L08 A;  3IBW A;  2OGU A;  2DGW A;  2WB4 A;  2Z2Y B;  5AT1 B;  1Q5Y A;  3H0P A;  1FJ7 A;  2CQ0 A;  4IH6 A;  3ISN D;  4KGX B;  5M2U A;  2HHX A;  4FZV A;  1RAA B;  2ZNZ A;  1AUS L;  1UVN A;  2CIM A;  4OV1 A;  2IM2 A;  4WFN Q;  1KVK A;  1S1V A;  4DV6 J;  3EVO A;  3DOL A;  2UXD J;  5GAE I;  4WII A;  3AOA A;  2VV5 A;  2ROG A;  3MPW A;  2FYX A;  1RAJ A;  4CLK A;  1UL3 A;  3QJJ A;  1LNQ A;  4OI3 A;  3KK2 A;  1ZPV A;  4WFY A;  5K14 A;  4C0B A;  2BJ1 A;  2EKN A;  3Q8R B;  1M1G A;  3IRW P;  2BKO A;  5IWA J;  3LPE A;  4J9K A;  1NDC A;  5KFG A;  2KHD A;  4JI6 J;  1UJ5 A;  3F56 A;  3L09 A;  5HK4 A;  3M8R A;  1NME B;  2J6T A;  2FVR A;  2XS2 A;  4B3O B;  3HFK A;  2DHA A;  3DGP B;  4DV6 F;  3L3C A;  5K8O A;  2VQE J;  5D0R A;  3MR7 A;  1JMT A;  1LK7 A;  3N79 A;  3US5 A;  1HMV B;  2YKP A;  4IR1 A;  2BAB A;  1DTT A;  3G8Q A;  5GAD U;  4QW9 A;  2YKN A;  1CJV A;  4NA1 A;  5KFC A;  4F8R A;  4M95 A;  4P73 A;  5DGA A;  3ZZO A;  3DRY A;  1HNV A;  3HHE A;  3SFU A;  1VRU B;  1OSD A;  1FJG F;  3MTK A;  3A13 A;  1HA1 A;  1H2T Z;  5IWA F;  1OY6 A;  3HHD A;  4DV1 J;  1ZPW X;  3V4I B;  2DNR A;  4JI6 F;  1S6P B;  1U2F A;  2VH7 A;  4A8S A;  1SH0 A;  2GO8 A;  4HI2 A;  2AYE A;  3FNN A;  2DR7 A;  2X1F A;  1JK9 B;  3MMJ A;  3ADA C;  4L3K A;  2WZ1 A;  4OLP A;  3NOC A;  2VQE F;  3KUG A;  2AZ3 A;  1M90 T;  4UUX A;  4B9L A;  3JSM A;  3LPY A;  4ZVP B;  4F7V A;  2J8A A;  4CO4 A;  1S1U B;  5CQG A;  3UVJ B;  2P6T A;  4CQ1 A;  4IOA Q;  4LBI A;  4P71 A;  3U7J A;  3SV4 A;  1WI8 A;  4DV1 F;  3KJV B;  2FZK B;  2YNI A;  2CZ4 A;  2HRU A;  4DBQ A;  3F41 A;  2V9K A;  1C1C A;  1JJH A;  4OIX A;  3DC2 A;  3MPD A;  2MLZ A;  4B3M J;  2J5A A;  1WSR A;  1OYD A;  3RJM B;  1QUP A;  4X64 F;  2ZZM A;  3RAM A;  1S12 A;  2OPQ B;  1IR0 A;  4KV8 A;  2FY8 A;  2NYH A;  2VJU A;  1F5A A;  1FKO B;  4TLQ A;  2K1R B;  3NG8 A;  4C0O C;  2LLZ A;  1ZTT A;  2PEB A;  3CJS A;  1RE1 B;  2HS0 A;  4WTY A;  4A8W A;  2G2O A;  1Y3J A;  4ILL A;  3NXZ A;  3CD0 A;  1UA1 A;  3EIC A;  2QGF B;  2X3G A;  4OZ1 A;  2J7U A;  4DR6 F;  1PGZ A;  2AHO B;  2DCL A;  3H25 A;  3DXB A;  1CLF A;  1S0M A;  4DUT A;  3B6B A;  1L3S A;  3KFW X;  1RHJ B;  3VAG A;  2WBM A;  2MHN A;  5I3U B;  5A8W A;  3T6B A;  5DLF A;  5A8K B;  2IRU A;  1Y9O A;  4B3M F;  4ECX A;  4MK8 A;  5KFN A;  2G1H A;  1C2P A;  1UFL A;  3W8P A;  1HD0 A;  4KFB B;  4JI3 F;  3GTY X;  3M4X A;  3W66 A;  3SEO A;  3LH2 S;  2RDJ A;  3DRS B;  3FBC A;  4QIE A;  2RKI B;  2IRY A;  2WON B;  4LRD A;  1HBO A;  1N5S A;  2HFV A;  3UD4 P;  1RBA A;  2RRB A;  1UWA A;  2HHW A;  2RJZ A;  2XS7 A;  2FLP A;  2AEM A;  1FRH A;  1F5B A;  3O44 A;  1CC7 A;  1Y3K A;  1S4E A;  4EO6 A;  1Q78 A;  3ENV A;  3QO9 B;  3IBF B;  3KLI A;  3G71 S;  2OPP A;  3HX9 A;  4F4Z A;  2HBR B;  2IAJ A;  4YUD A;  4YR0 A;  3ITH A;  2M5Y A;  2B5J B;  3QSY B;  2V9W A;  4G1I A;  2OIH A;  2JEG A;  3KNA A;  2FGC A;  4TVA B;  4ZP9 A;  1LWC B;  4Q5V A;  4DEZ A;  4USJ C;  2DNN A;  3MM9 B;  1VBX A;  3UI3 A;  4A4J A;  3W1Y C;  2CQD A;  4J9V A;  1OIA A;  4TQR A;  4ECR A;  2CWK A;  1T8E A;  4LRF A;  1S6Q B;  1T7P A;  4B3S F;  1XJW B;  1R8A A;  1NHV A;  1CS4 A;  4DFP A;  4LF9 F;  3PRD A;  5L39 A;  3RBD A;  1X7V A;  1H2U X;  2O66 A;  2V4J B;  3PW2 A;  3GFZ A;  3TX0 A;  5C2C A;  4B17 A;  2XMA A;  3HKW A;  4NL5 A;  1HPZ A;  4UTG A;  3W60 A;  1V5V A;  3EUN A;  2PD1 A;  1UW4 A;  3BRE A;  2R2R A;  3SSS A;  2FDN A;  2KXF A;  1U24 A;  2W9C B;  2VPY B;  5DJB A;  2HQD A;  2IYI A;  3GIK A;  4F0H A;  4CO1 A;  1T9V A;  4PQA A;  4LFB F;  2M52 A;  4X4Q A;  1N5V A;  4NLT A;  2V50 A;  1QAJ A;  4L76 A;  2LA4 A;  4KHP J;  4WKR A;  2HIY A;  3D6M B;  2AEF A;  4IH5 A;  2JC0 A;  5KFK A;  4RWW A;  5HBM A;  1LQ9 A;  3TR5 A;  1IBK F;  4QW8 A;  5F9L A;  1RK8 A;  2W2N P;  5J1E A;  2UUA J;  4O3N A;  1S0V A;  1NK4 A;  4USK A;  4F3O A;  1XWL A;  2NQP A;  4QIG A;  2XGP A;  1YVF A;  1V3Z A;  2HLU A;  2PEH A;  2OH2 A;  3V5R A;  3NGK A;  1ARO P;  1YG0 A;  1FRL A;  3C14 A;  2VA2 A;  4EYI B;  1JXE A;  1ZAW A;  3PW5 A;  3PR4 A;  1C4C A;  3CW2 C;  5C25 A;  5HJX A;  3V81 B;  3DOK A;  4LFC J;  2VKZ G;  2C2O B;  2QL7 B;  1FTR A;  4IO9 Q;  2WSC C;  1YJN S;  1I3O B;  3VZI A;  4CDI A;  1S59 A;  1N36 J;  1UP1 A;  1N5Y B;  3AD9 C;  1NJW A;  4YB5 A;  2QLB B;  4J9N A;  1TUG B;  2QA1 A;  1SCJ B;  5HRO A;  2AF6 A;  1C0U A;  4DWI A;  3CCQ S;  1Y11 A;  5D6G A;  4Y2K A;  3MTJ A;  2MZ1 A;  2HS3 A;  2WVF A;  3RB3 A;  2ZHO A;  2M9K A;  3JSB A;  1YRU A;  4ID5 B;  3GIM A;  4X66 J;  4DPX A;  3P8B B;  4GVB B;  2UVU A;  1FWK A;  5ITH A;  1JIH A;  2OFH X;  3GFH A;  5EUH A;  1X8D A;  1N33 J;  4IQX A;  1U25 A;  1XNR J;  1T05 B;  4WZQ A;  2BAN B;  1GXL A;  1NK0 A;  2JVR A;  2YWW A;  1RTJ A;  1QVG R;  4WP3 A;  1JX4 A;  1GMW A;  2GAH C;  2ZJQ Q;  4NOH A;  2EFO A;  1OMS A;  4JV5 F;  2CXE A;  4H54 A;  1QSS A;  2LA6 A;  2ABY A;  3ZZR A;  1SH3 A;  2KI2 A;  3G8S A;  3IN5 A;  4X62 J;  2O01 C;  3GG0 A;  1FD2 A;  3MM6 B;  4WE1 A;  4DX5 A;  2Y0B B;  2FD2 A;  4FPR A;  3VAH A;  1QY7 A;  4X4U A;  4ZIW A;  2XNQ A;  2ZC3 A;  1VI7 A;  4BCA A;  3PW4 A;  4JOU A;  2RF2 B;  1OQ6 A;  3CXC R;  4LRA A;  1N33 F;  4RU2 A;  4OL8 A;  3QYY A;  3VAM A;  2G13 A;  4DHV A;  4YDX A;  1UW9 A;  1TKZ A;  3HVT B;  1KFS A;  5J2Q A;  3LWL A;  2R8H A;  2M70 A;  2VFS A;  1SJQ A;  3BPS P;  3AH6 A;  3W2V B;  2PC6 A;  2W25 A;  4JYA J;  3NLC A;  3H59 A;  3HVA A;  4DV3 F;  1PSD A;  4PR6 A;  4RUH A;  2XNR A;  1O0P A;  2R42 A;  1Q16 B;  1UPM B;  4RNN A;  3PHE A;  1N6Q B;  4KKO B;  1FWP A;  3UCU P;  4IG0 B;  3ETO A;  1MN9 A;  1KQS R;  1GEH A;  1W25 A;  2KJV A;  5GAH I;  4Q2M A;  3TX8 A;  1WOR A;  5ETP A;  5LXY A;  3O6Q A;  4FKX A;  3RU0 A;  4LF4 F;  3MUT P;  5DZ6 A;  1TK8 A;  1HNW J;  3OVB A;  1FNX H;  4CTA B;  4IRK A;  2OSR A;  4DPT A;  1QE1 B;  2C3P A;  3NL0 A;  3RW7 A;  4ZPC A;  5HP1 A;  1UEV A;  3M8Y A;  4RW4 B;  1NPP A;  2CG4 A;  2RH3 A;  2UXC J;  3D0G E;  4OX7 A;  1RHU B;  4PG4 A;  2YTC A;  2K3K A;  4LMZ A;  2RS8 A;  4RBT A;  2OI2 A;  1VJQ A;  3DLE B;  4IFV B;  4DR4 J;  4MFB B;  2MZS A;  2DH9 A;  3AA9 A;  1FDB A;  1HWL A;  2VL1 A;  1VHF A;  1RWU A;  2F3J A;  2HFO A;  4LSL B;  5AJ3 J;  1R31 A;  2O67 A;  3GP9 A;  3QGG A;  1REG X;  5DG7 A;  2GVZ A;  3OW2 R;  4UF4 A;  3CNQ P;  1TL7 A;  3UPF A;  2IA6 A;  2J0Q D;  3MEK A;  2V68 A;  1MRO B;  4ECT A;  2MQL A;  5IXU A;  2A10 A;  5SZT A;  2EKY A;  2ZKU A;  2F1F A;  4TYA A;  3SI8 A;  4ZA1 A;  1FI4 A;  1FX2 A;  4USV A;  1S1W B;  1MWZ A;  3A8I A;  2UXC F;  1S1X B;  2E5I A;  4ANE A;  3GV7 B;  3JAM Y;  4DUZ J;  2FLN A;  4ANC A;  1LWF B;  2QG9 B;  2EBE A;  4MH8 A;  3Q8P B;  2RIJ A;  2ZHB A;  1X4E A;  3SQO P;  5GVQ A;  3J81 Y;  3TJA A;  1HIY A;  5AJ3 F;  4OYX A;  4IOC Q;  4ZN1 A;  4B3T J;  3HHL D;  1P9Q C;  1LOU A;  3PDN A;  2BA9 A;  5IC4 B;  3MOJ B;  3SSQ A;  2KG1 A;  2IBK A;  3MM7 B;  5HN0 A;  2QFJ A;  4K4Y A;  3BPD A;  4TU8 A;  2YH1 A;  3W64 A;  4JB8 B;  4ZVH A;  3C6T B;  4QIF A;  3CCZ A;  3OL7 A;  4YY3 F;  4Y00 A;  3UWT A;  1DTQ A;  1ROF A;  1PJ6 A;  3HZE A;  2DGS A;  2ZWP A;  4F02 A;  2I9S A;  2UVV A;  3HVW A;  1VGY A;  3VQT A;  2G2Y A;  5RUB A;  5HL7 Q;  3PO5 A;  3D1Q A;  1C1B B;  3HHK A;  4LF2 A;  3NKY A;  2M0G B;  4AL5 A;  2J9D A;  3O2I A;  1K73 T;  1FK9 B;  4J9M A;  2ADB A;  1M1K T;  4J9U E;  3NNC A;  2C2M B;  2QTW A;  3THV A;  2YQ3 A;  1BE4 A;  1KVI A;  5DG9 A;  2V4Q A;  3EZU A;  2I2Y A;  3WX4 A;  2ZEJ A;  1LEO A;  4QR2 A;  4DV5 J;  4DCJ B;  2FJB B;  1NB7 A;  2IFX A;  1HHQ A;  3FUY A;  2ERR A;  4NEZ A;  4X4V A;  3S1T A;  1WEY A;  1BQN B;  3KJF B;  5HAN A;  3W9J A;  2NZC A;  3RZA A;  1U6B A;  5IFM A;  4PG7 A;  2MGZ B;  2J8S A;  2VQF F;  1X4H A;  1GMV A;  4YHH J;  2CJK A;  2RQC A;  4B3O A;  2DPI A;  5CCL A;  2WCX A;  3MOZ A;  1XNQ J;  1TP7 A;  3DGP A;  3AXM A;  2HNY B;  3CC4 S;  1APS A;  4ZPW R;  4ICL A;  2HQG A;  1AT1 B;  4IKA A;  3PR5 B;  3SSR A;  2HHS A;  3M2V B;  3OFH A;  4DV5 F;  1FE0 A;  3MMA B;  1QTN B;  3I4P A;  1ZBT A;  2JH3 A;  4V19 X;  3D6F B;  3NNA A;  4USM A;  4WFZ A;  3HXM A;  5K5M A;  1FES A;  1S6P A;  2IVF B;  1WOP A;  5L1K A;  2UXB F;  1UVL A;  4AQY F;  4RO0 A;  2KL8 A;  4YHH F;  4KGK A;  4FS2 A;  1NU4 A;  1HBN B;  2RU3 A;  3A3N B;  1B99 A;  1NK6 A;  3TAN A;  2AV5 A;  5A8R B;  3QQC D;  4PWU A;  3DN9 A;  2UVW A;  1JNR B;  1RT1 B;  3I0R B;  1S1U A;  5LSO A;  2WW8 A;  1EKS A;  1U45 A;  5F8N A;  2EG1 A;  3UVJ A;  3J7A 1;  1IWA A;  2Z56 B;  4DFJ A;  3MF5 A;  3PKM A;  5FII A;  3KJV A;  3VGV A;  3R6L B;  3BS9 A;  5GAH U;  3EYZ A;  1OYE A;  2EW9 A;  3R9L A;  2N4C A;  3DRP B; 
#chains in the Genus database with same CATH homology
 2YPZ A;  4UZB A;  2YQ1 A;  2YQ0 A;  2YPY A;  4K2J A;  1B3T A;  5A76 A;  1VHI A;  4BLG A;  4UZC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...