5A76A

Kshv lana (orf73) c-terminal domain, open non-ring conformation: orthorhombic crystal form
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
117
structure length
109
Chain Sequence
b'AKARPQHIFYRRFLGKDGRPKCQWKFAVIFWGNDPYGLKKLSQAFQFGGVKAGPVSCLPHPITYCVYVYCQNKDTSKKVQMARLAWEASHPLAGNLQSSIVKFKKPLPL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ORF 73
molecule tags Dna binding protein
source organism Human herpesvirus 8
publication title Kshv But not Mhv-68 Lana Induces a Strong Bend Upon Binding to Terminal Repeat Viral DNA.
pubmed doi rcsb
total genus 26
structure length 109
sequence length 117
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2015-07-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.390 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Epstein Barr virus nuclear antigen-1, DNA-binding domain 5a76A00
2YPYA 4K2JA 4UZCA 1B3TA 2YQ0A 5A76A 4UZBA 2YPZA 4BLGA 2YQ1A 1VHIA
chains in the Genus database with same CATH superfamily
4B3SJ 2FTRA 2GQ2A 4WFAQ 2WBRA 1NRKA 1GK8A 1KD1T 1N33F 1J2VA 5B0AA 2C2OB 2BANA 2QJ3A 1QAJA 2V4JA 4KHPJ 2YNFA 3IR5B 3KKFA 3KK3A 4NCBA 1N5SA 3MZIA 3F41A 2APOA 5HLFB 2PE8A 1ZBTA 4H4KC 4C7QA 1RKIA 2ZH1A 1RYSA 3DLBA 4RW9A 5D4LA 1K1SA 1C1CA 1E6VA 1ZM4A 4B17A 4MH8A 1WI8A 5D0RA 2UUAF 2ILZA 1S0VA 2BJ7A 1JLFB 4CO2A 3E3XA 3VAMA 1LWFB 5FDLA 4I67A 2OEKA 1R27B 2EFOA 3VAJA 2M7SA 1NNDA 2FC9A 4IFYB 1U4BA 3G8QA 4FS1A 7FD1A 2QYGA 3M6VA 2BACA 3B4MA 4NLWA 1EARA 1KLMA 1HWUA 3MCSA 1UVLA 2JRSA 1S1UB 1FK9A 2LU1A 2WONA 4ZP7A 2F65A 2EFPA 3ETMA 1K47A 1FD8A 2DITA 3FFIB 3ZTSA 3I55S 1PC4A 3VHQA 2Y1JA 2NZCA 1H2VZ 2HGMA 4HL9A 3GV8B 2W8LA 1NEEA 4CLTA 3JSMA 1JJ4A 2DNOA 3AQPA 4LF7F 1X4AA 2MQQA 1EETA 2DRDA 2GNKA 2VH7A 4QBUA 3KK1A 2ZHBA 1QUVA 1REGX 2LVWA 1C0TB 1KDNA 2OUGA 2RB7A 3QT6A 4KAIA 1ZM3A 3J7ZT 3W7BA 1U09A 3PDNA 4DUYJ 4JI3F 1RHKB 5KG5A 4Q0BA 3FNNA 2CQHA 4IG3A 1XWLA 3UQSA 4DR3F 2DNYA 1CJUA 2QMUB 3MF5A 2DEJA 2HNYA 1HBNA 2R2UA 4ES1A 1RWKB 1RA6A 1X5SA 4TU8A 3QIPA 4X62F 2XULA 2HAIA 2ZUGA 4PWDA 1GMUA 1H7WA 4YB5A 1GH8A 4TY8B 4DJBA 4U7UK 1RTZA 2KYZA 1RUSA 1S6QA 2LQ9A 4X65J 2CJKA 4IRKA 2B4UA 1DLOB 2AYEA 2B3TB 1SQGA 5A6WA 1FDNA 4XTTA 5K8NA 2DGUA 1F5BA 2LKZA 4P71A 3G86A 3FBEA 4C3MA 1RAAB 1UVMA 1WEXA 1AZSA 3B6BA 1EP4B 4TY9A 1TL7A 3OD2A 4DV2J 8RUCA 1WG4A 2AYMA 4NLXA 4EO6A 3QLHA 3IO1A 2ZH4A 3T3FA 1WTBA 5A0YA 4C3KA 3FGVA 4B3OA 4K50A 3JYTA 2GVDA 1X9SA 1L3KA 2EWHA 2ZKTA 1IR0A 3K2YA 4G3IA 3JSMB 5KT2A 1UWBA 3RRGA 4E2FB 4CYUB 1FJGJ 1G1XA 1IJEB 1EQMA 2K1RA 4MK9A 4HR2A 1TKXA 1EX8A 3PR4A 1RT5A 3R5AA 5BYSA 3MMAA 3I31A 4C0BA 4FNIA 3CD0A 4DV3J 2DR8A 2AF6A 4N47A 4JI8J 3ETOA 4YR2A 2XY5A 2BQ3A 5CYMA 1OQ6A 4WPAA 1TL5A 4PG4A 2NUUG 3NLCA 2PA8D 4ECSA 1N56A 5E3QA 2QLJB 4WYLA 1QDUB 4DPWA 5GADU 3E2EA 3GV5B 2HQDA 5A8KB 4O23A 4ZLPA 3B8HA 1D1UA 2R7XA 3IBWA 1D8ZA 3HULA 4PXEA 5HAOA 5DG8A 2NYIA 5A8WB 1JLGB 2DH7A 2XS7A 1TV6A 3R9LA 2BA9A 2XSFA 3BH7B 2N4CA 1Q1KA 4F4KA 2AJ4A 3K0JA 3GFXA 3DI6A 2HBZB 4P2FA 2OAUA 1PJ7A 4KE5A 2XZWA 3G2XA 4C98A 1S1TB 2QL5B 4U67Q 2KVQE 2XMTA 3DXSX 4ZLNA 3I0RB 4DR7F 5DQIA 3Q8UA 4IYQA 2IYIA 4FS2A 5C24B 1I51B 5F8NA 1WEZA 3PJWA 5EX3A 1EP4A 2AHOB 3R7NB 1PYOB 4F4ZA 3RB0A 4I2QA 1LV5A 5L9XA 2E9TA 1LFPA 5LXRA 4FVMA 1UFKA 2DGVA 2I6WA 4DPXA 1XR5A 3PJ9A 2PMWA 2MQPA 1T3NA 2YH1A 3D6TB 4CZCA 3HFVA 3MPUB 1IXKA 4NMXA 2Q6CA 1JKHA 5GAHU 2OTJS 1F1BB 3L9ZA 2ZVSA 1KOHA 2VPXB 3N6MA 3CWJA 3DDKA 4HDHA 9ATCB 3CF5Q 1U1RA 2CNNB 4AL5A 2ZBPA 4LRBA 4ZIVA 4DLGA 4DU8A 5HVGA 2KFYA 1SL2A 1S1WA 4CLLA 4JV5F 3JQKA 1OYEA 3THVA 3CB4A 3MMBA 2FGCA 3MM5A 1Q5VA 2DR7A 3OXLA 2EFGA 4RW7B 2OSRA 5HI7A 4NLVA 3TVKA 4KQZA 4DSLA 4KHPF 2VQFJ 1YJNS 2OPSB 2IJNA 4DS5A 3PY8A 3I6PA 4BWJA 1F9EB 2B9EA 3EMTA 3H5YA 2G9OA 2R8IA 3OR2A 3J81Y 3C6UB 3I5BA 4IH6A 2HW3A 4ILLA 4I69A 4DR7J 3ISNC 5JMNA 4F0HA 1KHVA 3M2UA 3NGSA 4GC6A 4ENOA 3QJJA 1M1HA 4IOAQ 2CPEA 3C14B 4AQYJ 2E66A 1OSCA 1N48A 2O5DA 2LQJA 1TKZB 1WTFA 1LWFA 3A8IA 4KV8B 2ZEJA 2D74B 3NGKA 1XMQJ 1NKBA 2KT2A 2JJ4D 4F3OA 1FNOA 1V3RA 1L3VA 3PO5A 3GCXP 2EVZA 5K5MA 2LCWA 2JZ5A 3JQJA 1VQ9S 1SIWB 3TAMA 4ZVEA 2CIMA 2CPDA 3D3CJ 2J9DE 3DLKB 3M2VA 1SJRA 2DGXA 4F2SA 2LEBA 1FTRA 1FESA 3KK2A 1YRTA 1FVSA 4KKOA 1RHUB 3CCZA 4DL0C 1KEKA 2JDJA 3VAFA 3C2PA 3GYXB 1JLBB 4OZ1A 4ANCA 3PR5B 2VJVA 3HDSA 5KFZA 5J2MA 1K0TA 3A8KA 3U1NA 3IWLA 2R8GA 4H54A 2QRRA 3DC2A 3TNVA 1G4CA 2ACMA 3LPEA 4OYAA 2BRLA 4WK3A 3JAMY 5CCLA 2JEJA 1AFJA 3D6HB 3W2VB 4P10A 2RH3A 1EQ0A 3LP0B 4OX6A 4X4SA 4D3HA 1IKVA 2VASA 1D9FA 5HP1B 3TAPA 4TYAA 3C15B 5HQMA 3OTDA 1Y5NB 2DNZA 2LEAA 3WHIA 3QRPA 3T6BA 2JVRA 4IG3B 5KFMA 3AD8C 4ED6A 2O66A 4V1Ak 2B6AA 2PSZA 3VQTA 1YK9A 2CNLB 3CW2C 2DH9A 1ZH5A 3HF5A 7FDRA 2QMXA 4M5NA 2EFVA 2J76E 1X8DA 2HEKA 2R3VA 5DO2A 4EZ6A 4OI1A 1QTMA 1H2TZ 1BHNA 1APSA 1CBKA 4FF2A 3UO0A 2WSFC 3BYPA 2QA4S 2A18A 3UDEA 4CTAA 1V6HA 2KVIA 4TVAB 1CJTA 5L39A 3MUTP 3BGLA 1I94F 3CTRA 3K59A 4FF1A 3KMQA 2P6TA 4KYZA 1N52B 3HFKA 2CG4A 2QC3A 4ETZA 1GAOA 1K44A 1NMEB 2B43A 2CKWA 2MKYA 1S7HA 1HNIB 1ZAXA 2F9DA 3BR8A 1S72S 3DLGA 4ILMA 3G8TA 1RYRA 3R1LA 4J5OA 3HX9A 3VQSA 6AT1B 4ES2A 2ROGA 1N54B 2HGLA 3IGVA 4M5HA 3QWUA 3PJXA 4EU0A 1HWKA 2YPZA 3QIPB 3I56S 4NASA 1T94A 2FZKB 3D2WA 1J5OA 3HHLB 5D3GB 3CEDA 3U1MA 1FDBA 1RT6B 4TY8A 2POKA 1HBMA 1FFSB 1SQEA 1XMBA 3KG1A 5BYRA 2XWYA 1ZM2A 1DBDA 3T9NA 5T41A 2XGPA 4OZ5A 3LANA 2HVEA 2JL9A 3MEKA 2HNDA 4OZJA 4Y0FA 4Y2MA 2ZH8A 3HHKA 4YDDB 2UVRA 1LXJA 2NUHA 1XK8A 4RL1A 2N4DA 1RTIA 1KS2A 3T5KA 4J91A 3S7RA 4TQSA 2B6AB 1JJ2R 4LF1A 4PYDA 4N5SA 1XJWB 3AOBA 2CZ4A 4P52A 3IR6B 4N56A 1EIYB 1IBMJ 4IDKA 4RW4A 4G1PA 4Q2MA 1Y9OA 3MM9A 4RKUC 4J9VA 3SQGA 1U1QA 4OI0A 3ET6A 4KRWA 4DCPB 3MOJB 4CO0A 2KXHA 1Q79A 2PGCA 4O4GB 4RW9B 3TANA 3THPA 3IA0A 1X4EA 4CLFA 5KFIA 4ECRA 4KT0C 1TR0A 2BXJA 5KFLA 3MM7A 4DFPA 2PN6A 1F5AA 3AJ2A 4LBPA 5HBMA 4ECWA 2R7OA 2QN6B 1VMBA 4PG8A 1HNZJ 5I42B 4CNZA 4ZCLA 4O3QA 1N5VA 4ECQA 2KHCA 5HN0A 1K0VA 8AT1B 3T1YJ 2EK6A 2NPFA 4ZPCA 4X4OA 1N36J 1M5VC 2HFZA 4BS2A 4UT4A 4WKRA 1JQGA 4UW2A 1OMSA 3KK3B 5DJBA 3M2RB 3D1QA 4I68A 1WHYA 2UXCJ 4YEAA 1B70B 4IQMA 4O44B 1YTYA 1K8AT 1YJVA 1FD2A 1LEOA 1RAJA 2W2NP 4LFBF 5KFVA 4ZJOA 1VBXA 1SC4B 2MJNA 8ATCB 1TVRB 2YPYA 3UN2A 4DSJA 5B0BA 1S6UA 3G82B 3CCES 2EKNA 1T3OA 2XCPA 2XC9A 1PJ6A 5KFXA 5CH7B 5A8RB 3TI0A 3FSIA 1FHTA 2MEWA 3AH6A 1DQAA 2DCUB 3GFZA 5KG6A 4ZITA 3MR2A 4KPYA 1JLCB 1SUQB 1ACMB 3GWCA 1ZETA 3DLLQ 1U7LA 4RW4B 2OFHX 1BQNB 4IFVA 2BMBA 3W8GA 5ETVA 3RBXA 3U1LA 2H9ZA 3MPDA 4LSNB 3ZTQA 1MLAA 5DLGA 3OHAA 4NWBA 2E29A 3G96A 1Q53A 4J9QA 2B0GA 3M2UB 1NKEA 2DNPA 2H5IB 5IQQA 2CRLA 4LF6F 5E3PA 3D3BJ 2DTJA 3T5LA 2ATLA 1NJZA 2EG1A 5G0RA 1LW0A 4L3NA 1WF0A 3MM6B 3IR7B 3LWMA 1CVJA 4JYAF 1RAHB 3UWTA 1LWCB 2FLLA 1W2IA 2R7VA 1SJ1A 3DGPB 2I1RA 4OZNA 3RJMB 6FDRA 3IS9B 2QG9B 2R2SA 4ZJLA 4PQAA 1U2RA 4DEZA 5B0DA 1HR0J 3WBZA 1ZOTA 5HJYA 4J9PA 2W7PA 2LQBA 4I0WA 2YQ1A 4NCAA 1EB0A 1XC9A 2KZMA 1WC0A 2HHUA 2HFUA 3QSIA 4ZIWA 1BC6A 2A0FB 1TL3B 3OTBA 1U6ZA 1B7YB 4KC5A 5AXLA 2QLFB 1ZPWX 4JBCA 2XMMA 3TJAA 4ANDA 4CLKA 4J9NA 3MEDB 1WACA 5F9NA 3DGVA 3EPGA 3VAKA 1VBZA 1DFDA 2DGTA 4O0NA 2GMHA 3D7SB 4NCGA 3W5ZA 4DUYF 3I9ZA 4UZBA 1TL1A 1DHMA 2FIUA 1Z1ZA 5AE1A 2XM3A 3NGUA 2F5GA 5C2CA 5H9EK 5ETTA 1MMNA 1SV5A 4CLPA 3C46A 3VGUA 4JB8B 3FZ2A 4BDPA 5EWGA 1NZAA 1R8PA 1VQSA 3GIIA 2YVSA 4NE9C 3FMWA 2BYCA 1BQNA 3MM8A 2XS2A 3DLKA 2R8JA 3T6JA 4Y2AA 5C7PA 3UNGC 4I2PB 3SDEA 1FXLA 1IVZA 4ICLA 1RK8A 1X9MA 4F25A 3MWBA 1HI1A 1PSDA 2QO3A 2XMJA 2AJ0A 2BKPA 4NX9A 2F63A 4X4NA 3PG9A 3LOUA 1JXVA 3IRXA 1YX2A 5BXIA 3DLEB 5KFNA 5HJXA 3OVSA 1HR0F 4DWIA 1C0UA 2DNKA 2V67A 1M1GA 2FHKA 4OJ1A 3C66A 2V9WA 3QFHA 1DQ9A 3M8RA 2WVCA 2ABYA 2DGQA 2R9LA 1SB6A 2C2RA 4DL5A 1T7PA 3KDOA 1VHFA 2ZE2A 4QYZJ 5B0GA 3CCRS 2CPHA 3QRQA 3BPSP 5A6PA 2D3UA 2GZOA 2HURA 2W2PP 2LQ8A 1NJXA 2OPQA 2BBEA 2RMLA 1RP5A 4OFZA 1S9EA 4Y2CA 4CH1A 2G0CA 2E7XA 1Y3JA 3FQLA 1IKYB 2JNJA 1GEHA 5MAOA 3KLEB 1JLQB 2NZ4A 2HS0A 2VBZA 4KSEB 2V4JB 4EK2A 1W25A 2XHCA 2LA4A 4IG0A 4WFNQ 4NLYA 4NYZA 3ISND 1E6YB 2HHPA 3R27A 4K2XA 2AJ1A 2E1PA 2UUBJ 1URNA 2E9ZA 3Q8QB 4H4OB 2E5HA 4K4WA 1F2HA 2HQFA 2KDOA 1O0PA 2LXIA 2RIJA 2HRTA 4ZN1A 5KFQA 4P73A 4J9MA 1U1PA 3A3PB 3VAIA 4DBQA 2LYVA 3KOAA 1OPZA 3TYTA 4EO8A 1QJHA 3MURP 4Z2XA 4B3RJ 4QYZK 1IWGA 2DXFA 2KU7A 3L4BC 3C6TA 1U02A 5KFOA 1CLFA 4MYUA 5JXSA 5HK4A 3N6NA 4CLZA 2OFGX 4OYXA 2HLTA 3IRXB 1H73A 1U1LA 2O67A 1P27B 1RAOA 3PNIA 4URGA 4AXJA 5IS2A 1CJKB 5DGAA 1B64A 2AYGA 4DCOB 2O3DA 2AIRB 3R5JB 3FK4A 3GYGA 5K14B 1N6QA 3G9CA 1GFWB 1R89A 5EGYA 2GIQA 1WEYA 5F0UA 2CNKB 4URSA 1H72C 2CQ0A 2GMLA 1D0EA 4PKDB 3FJ2A 2MZQA 2E7VA 4DQQA 3OR1B 1S48A 2ZD1B 1NK6A 1KFSA 2HVIA 3CC2S 5D78A 2Q79A 4WXOA 3BR9A 3MM7B 3ENWA 3Q8VA 2FPHX 1FXDA 2OPRA 3VR1A 4RUCA 4UTGA 2YNGB 4AD6A 3KG0A 5CHCB 1QAXA 4PZVA 1SL0A 3LPYA 4RU2A 3PW2A 4J9UE 2GHWA 3WIVA 1NUEA 4EWTA 2AX0A 4ED2A 4JV5J 3H2LA 4YS2A 6FD1A 2PIIA 3TZXA 1BQMB 4IG0B 1XEZA 3CDWA 3D0GE 2RE1A 4GMKA 4DPOA 2R2RA 4QQBA 4EBEA 2HRYA 2LLZA 1WJ9A 1FWKA 2AEJA 2ZH2A 3OTOJ 1CG2A 4FYXB 1JJCB 2I8EA 3GJSB 5D0EA 3R97A 4DCJB 2W9CA 1ICEB 3F73A 4JI5F 2D3ZA 4WIIA 1SQFA 4A8FA 3KHHA 4AXIA 4F4AA 4NA1A 1U48A 1HBUA 3EZOA 2Q43A 2H4WB 2N7YA 2G0IA 4USUA 2HZVA 3NL0A 4Y2KA 4AQYF 3FZBA 2I5JB 4OQJA 3UDVA 4B9MA 3H90A 2QSWA 2WB4A 1DTTA 3DRPA 3HT0A 4FYVB 4F2RA 3R1HA 1CC7A 3PEHA 2AW0A 4USTA 1WELA 1IBLJ 4ZJQA 4DR6J 3BO4A 3CIMA 2ZZNA 1FFGB 3EVWA 2W4DA 3K17A 2CQ1A 3KG4A 1U25A 2MB0B 3TUZC 3GG0A 3TZYA 3TUJC 4OJHA 4F8RA 3HVTA 1Q8IA 1WG5A 2VFSA 3D54A 3QWPA 3N9UC 4N8NA 3W2WB 1YJRA 4YR3A 3CGIA 3QGHA 1QAIA 1BGXT 3HJFA 3PW0A 4OYMA 5A8RA 1Q7LB 2CJQA 4LIRA 4ZPDA 1C4CA 2CWXA 3T1YF 1L5UA 4OLPA 1N36F 2P2CB 2DNQA 1Z2ZA 2Y8YA 1N32J 1Q4RA 2CQGA 1G6BA 5J2NA 4JI5J 3AQOA 3E51A 2FB0A 1F2GA 4B9NA 2ZDOA 4LRCA 4ES3A 4LF8F 1BUXA 2B9WA 4ECZA 1JNRB 2CQ4A 2ROPA 2IMOA 2XEXA 3TOQA 1X4HA 2KZZA 2M88A 2E5GA 2CDRB 5AE3A 2NYHA 2VG5A 3OFEA 3M8QB 1NK0A 5T14A 4K4TA 3H8YA 3O44A 1B4SA 1NH8A 3H59A 1B99A 3UPFA 3SSRA 3TW0A 2QEXS 4J9OA 3GJQB 4C97A 4LIWA 2ZH7A 1M5PC 1HARA 2Q6BA 4AL6A 1P8GA 1LK7A 3KMSA 1DTTB 4L75A 1JK9B 2F8MA 3BO3A 4HYKA 2Y1IA 1IKWA 1MROB 2DBBA 4M1KA 1R7IA 1HYSA 4ERDA 5CYQB 1RB0A 3US5A 4WK1A 3BZQA 2B4VA 5KFJA 4L73A 3PIPQ 3CJ3A 4RZRA 4FDFA 3RBZA 3RR7A 4JI1F 3C3LA 4PG7A 4ECUA 1JXLA 3X1LB 2M4MA 3J80Y 2IMWP 2XG8A 1Q78A 4CH0S 4RW6B 4C8OA 4NLRA 5F8IA 1N0VC 1NK9A 1I3OB 2RQMA 1FRJA 4MJKA 1PKUA 2MMYA 2MQNA 3W63A 1VHIA 2HBQB 2HPUA 1BWEA 3FC9A 3UVJA 2B9XA 9RUBA 3MMBB 5ETQA 1QLNA 1HPZB 2NXEA 2WTFA 2JVOA 4KO0B 2UZAA 3BF4A 2IC3B 3CJRA 3CCSS 3V4IB 1RWUA 1YJTA 1AUSL 1HQUB 1ROFA 2BKOA 2G13A 3DOKB 4IDKB 5E5NA 2RD5C 3OFHA 4Y6IA 2RILA 4YDXA 5HSPA 2RDIA 4WFZA 2Q3PA 2ZBIA 5ETLA 3MAAA 3RAMA 4H4OA 4ID5A 4QIVA 3KLGA 3T1HF 4WIQA 3QGIA 3N5FA 2L41A 1XMOJ 4ZP8A 3TJ8A 1XBWA 3DU6A 3O5TB 3ZTOA 1HW9A 2A6OA 4V19J 1HHSA 1MN9A 4LBHA 4ALZA 2G1HA 3CO0P 3NCPA 5KG0A 2ZH9A 1UCNA 4F02A 4WFXA 3AOCA 2R2TA 1P9YA 1AFIA 3BKUA 1UW4A 3SBMA 4JI0J 1TZ0A 2JX2A 5FLXY 4ZPWR 1IKWB 1MROA 3J80U 3FEZA 4DPTA 4F36A 1T95A 3L09A 3ILIA 4YMEA 1U1NA 2HGNA 3NAHA 4EGLA 1Y3KA 4GO5X 3AY0A 5EWFA 2VA2A 1RGVA 2IA0A 1SC6A 3KDNA 2AWZA 2FHJA 4IH7A 2AD9A 4E0DA 3ONQA 3CXCR 2DXDA 3DM2A 3V2UC 1SH2A 3M30B 1REVB 2GV1A 3F0NA 3ILLA 1ELOA 3G82A 2NS1B 1KC8T 5KFRA 4NXMF 4C8YA 4X2BA 4ZLJA 1LW2A 1R0AB 1S0NA 2E1CA 5H9FK 3DRSB 3ITHA 1VQ8S 1B7FA 3AOAA 2YBVA 4Y65A 4C11B 5LJ3Y 3PFEA 1N5YB 2HHSA 1C2PA 1HPZA 2MZSA 3FBFA 3KXDA 3H25A 1WOSA 3KLVA 2QT7A 2L9DA 3TA0A 3NG8A 1P1LA 2BANB 4HH0A 1VQYA 3W5XA 3ZZUA 3THTA 2XGQA 1T05A 3CMES 4ELTA 4PRFA 4QZVB 3VCDA 5RUBA 1JB0C 1FKPA 1S1XB 4NRTA 1TV6B 5A2QU 3V6JA 1AT1B 1TL3A 1XERA 1VIXA 4F4YA 1HNXF 3DI6B 5DRKA 5DZ6A 5AJ3J 2QFJA 1WDDA 5KT6A 5GADI 1RWNB 2W7AA 3MHYA 5LMNJ 4JI0F 1KHWA 2ZZMA 1TL1B 2DY9A 1V3SA 3S8SA 1P9QC 2AEMA 3HHDA 3F56A 1X4DA 3GLJA 2VC1A 2MQLA 4MKBA 3SCLE 2UUCF 2VB6A 3PXGa 2R7SA 4ZS6A 2RKIA 2RRNA 4DZ6A 1CJTB 2FJEB 3DRPB 3L7OA 4K4SA 1HL6A 2KJWA 3EICA 4UUWA 1H74A 3G87A 2KKHA 2AQ4A 4CCHA 4OYIA 3BH6B 3B82A 4FYYB 4C8NA 4NXMJ 2VFUA 2F4FA 3DOLA 2C22A 2ZDPA 1FCAA 1WC3A 3DRRA 1NK4A 1RCXB 2OGUA 4F50A 2P9CA 4MIAA 2F4VF 1S0MA 4ED4A 1SJ4P 3NOCA 4LFCF 4YP3A 1X5TA 2IYGA 4MKYA 1ZS6A 4MT1A 4R0JA 1BE4A 2KRRA 3NBPB 3KJVB 1PJ5A 2GMJA 3FVYA 2W9CB 4ED0A 1TQLA 2BJ3A 4FKXA 2JLGA 4WZQA 4NCGB 1UAWA 2HNYB 4USKA 1R31A 2J0WA 1C0TA 4Z7CA 2WVEA 5JJBA 3CCVS 3BSOA 4PXBA 4ETXA 1HBUB 1NZ8A 2DT9A 2OD4A 3GIRA 4OX7A 4Y2IA 4WTOB 2JC0A 4Q2LA 3R2CJ 3HMJG 3EX7B 3TR5A 4BBYA 2IBKA 3VGVA 3R6LB 4F67A 3G71S 5JVGQ 4J9RA 2DD8S 2MQMA 1AYEA 5GAGU 2UXCF 1CPZA 3M6XA 1PG5B 2XY7A 1YBAA 3HSZA 3JB9k 1NBEB 2BJ8A 2QMWA 5F8GA 1R3NA 2VFTA 4MMOA 2KYXA 2HIYA 4PABA 1FJ7A 4IRCA 5B7WA 1Q95G 1QSSA 1AA1B 1HQ2A 3R5BA 3NOGA 3E01B 3IBFB 1X5OA 5B0EA 3OTCA 1WUUA 3FRZA 5EHHA 3M1VA 2X3GA 3KK1B 5HROA 5B09A 4MKVA 4DR6F 2K7JA 3BEGB 1NDLA 5CYQA 5CYJA 2YWWA 2ZVIA 1X4CA 2BEFA 2G0JA 2MTLA 3DRXA 3C6TB 4YR0A 4RUBA 3QIDA 2MSSA 2ROEA 4HEA9 1TL7B 1S12A 1JLEB 2B8QA 2C2KB 2IM0A 4DG1B 4ZVPB 3DXBA 4LBIA 2KTQA 1JLQA 2FD2A 4M94A 2D9PA 5L1KA 4ZVHA 3FSXA 3L95X 4LJMA 5K14A 3UD4P 3P49B 1S9EB 4U96A 1ULRA 1QM9A 3TQEA 4C2MA 4AL7A 2DR5A 1WNEA 2FVCA 1HNVB 2DHAA 4K8RA 3GQCA 3H5SA 2FJBB 2HFVA 1NXIA 2QA2A 3IMQJ 4NZ0A 4XDDA 4A8OA 3KUEA 2OPPB 4I64A 4OZ2A 3Q8PB 1X60A 3IRWP 3QT5A 2XMWA 3RB4A 1J27A 3ADAC 3LF0A 2DISA 2JOQA 5IV3A 4KGVB 2NXJA 4MK7A 3LAMA 1S4EA 4X4PA 1N4LA 2ILYA 1SBRA 3DFEA 3PO4A 4RUAA 1AUDA 3OXFA 2EI5A 3I4HX 3D0HE 4FXVA 2GFFA 1RAIB 4GRSA 2DVIA 3MECA 2C3PA 3NWGA 4USMA 3GJRB 3P96A 4LF8J 3MAAB 2GGPB 3B54A 2LQ5A 3EUNA 2QV6A 3IM8A 1Y0HA 5D0HA 4TYBA 5C42A 4LRDA 1VBYA 4N41A 1OPIA 1RLCL 3W64A 2VHGA 3PW7A 4DV4J 4O3RA 2QLXA 3DKDA 4ZVTB 3FSYA 1N6QB 1NPKA 1TAUA 4H4KA 5EN1A 3EXCX 4DOZA 3UVJB 5GAEI 1J5EJ 3HKZD 1V5IB 1T9YA 4I2QB 3ZZRA 3HVWA 1VQKS 1VOMA 2I5JA 4QOTA 1KLMB 4ECXA 3MXHP 3QJPA 2J8AA 2I9SA 2YY3A 2AMCB 4NLDA 1RAEB 2W1BA 2B56A 2FJAB 3P3DA 4FN5A 3PZPA 3CULA 4BCAA 5A8WA 3HJVA 5LXYA 3M8SA 1HBMB 2R7QA 3CJ4A 4K7QA 1YJ7A 4ZKAA 4ECVA 4FP9A 1T9VA 1S10A 4QPXA 5K8OA 4OHYA 2MGZA 1Q8BA 3G6VA 3M8WA 3W8PA 1UVJA 5DDOC 2VKRA 3HVTB 4ZVQB 2OP5A 2BE2A 3W60A 2BM1A 3QMQA 2XYHB 1D8YA 1S1VB 2W01A 2MY7A 2BJEA 3I32A 3EDRB 4KFBB 3DDIA 2JSXA 3AAWB 2D3O1 3R2DJ 2Z2LA 3OHBA 2WVFA 1CJUB 2K2PA 5FLXU 3VAHA 1RE1B 3PIOQ 1CULA 1IQZA 4F26A 4KJIA 4PEOA 3CCJS 2ALZA 1NLKL 2VDHA 2D9OA 3DOMB 2QE5A 4OHVA 5KFEA 2ZH5A 1PGZA 2IA6A 1PCAA 4DV5F 2KO1A 1BWVA 1RT3A 1HMVB 3NAIA 3OPKA 5C42B 1S6QB 2RKIB 4QWDA 2MLZA 2QA4G 2XS5A 4OIXA 4DUZF 2PA3A 5DG9A 1UZDA 1HA1A 4DV6J 4FYDA 4X84A 3GILA 2WSEC 5L46A 3NNCA 2KN4A 1PYSB 4C11A 4B3RF 2VPYB 3V4MA 2CQ2A 4A47A 3QZ7A 2O1PA 4KKOB 1KLNA 1AZSB 4QWBA 4ZA1A 2P5VA 5H9FJ 3A12A 2EBEA 3OV7A 4IQXA 4LF4F 3M9OB 3D9BA 2J6TA 3SCIE 4ANEA 2AT1B 3MR6A 1RA7A 2MKSA 4DV2F 3OW2R 1QSYA 4JI4F 4B3OB 1FKPB 3SYZA 4RNNA 1T9XA 2FVQA 1YZ6A 5ETNA 3KK2B 2V8VA 1KQSR 4DSEA 3CC7S 2AKWB 2Q66A 2ZITA 3PM9A 1WF2A 3AD7C 1S57A 4MTPA 1FERA 2PMZD 4U95A 5IZHA 1IJFB 1H3DA 4FKYA 1K1QA 2QGFB 4IH5A 1RABB 2CQBA 4OV1A 4ZVFA 3SCJE 2WBMA 3WX8A 4OV6A 4ZP9A 1UTAA 2PEHA 2HQCA 3LP0A 3MR7A 3MAQA 2IVMA 2OEJA 3EVOA 4A8QA 3CC4S 3C15A 1S9GA 2QSFA 4KPCA 4OI3A 2HFSA 4KFBA 1VJWA 4JYAJ 3WC0A 4NLOA 1IQTA 3HT3A 2XMKA 4ZVGA 2CJXB 2VZ9A 1FFWB 1N5QA 2DNHA 3TVZA 4E8UA 5CCMA 1TUGB 5J1EB 5DQGA 4OX9J 3H5XA 2LXFA 3V81A 3NP5A 2MLYA 1WC6A 3NKYA 4RBUA 4Q8EA 1RTJB 1T11A 2C3OA 2MPUA 3M2VB 3MMJA 2HBRB 2HZAA 3SFUA 3T1AA 4J9LA 3HVRA 5J2QA 2EFNA 3OSPA 1NSKL 5F8JA 3DRRB 4HACA 1NSPA 2QLWA 3E01A 2HRUA 3CVKA 2R7UA 2OD6A 3E8OA 1IBKJ 1D9AA 2FJXA 5E3CA 3K89A 4QU6A 4DS4A 5D8HB 3WC2A 4FVCA 2PFFB 1LW0B 1RXOB 2CQPA 3IXQA 5M2RA 3MFHA 1M5KC 3NGTA 3PYFA 5KT5A 1D09B 2XYGB 4USWA 3MEEA 5KG4A 4CM2A 5FJ4A 3W5YA 2XI3A 3AJDA 1SIZA 3NCRA 2HHXA 3R6GB 1JLAA 1G7CB 4M5GA 3NXZA 4O3OA 3UNYA 3MCMA 5DDRC 1ITPA 3MI7X 5IQ6A 5KFPA 1YVFA 5J1NA 2WB1D 3PACA 2MY8A 1RWPB 2ZD1A 2LA6A 3N79A 2KL8A 4PYAA 3ZTRA 1U45A 3QPIA 2X1GA 4Y28C 5GMKa 2XLKA 1HQUA 1FE0A 4JI1J 4QIFA 1NU4A 4PUOB 1O5JA 3PX0A 4RU9A 2JFKA 5M2PA 2J7KA 2AJ2A 4KO0A 3KLGB 2F4VJ 3EGZA 2IAJA 4UF4A 2V4QA 1ZAVA 4KBIA 3KJNB 4LFCJ 4DV7J 2UV8A 2M70A 3LP2B 4WFYA 3DOKA 4I6YA 2V2QA 5D4NA 5KOXA 2C2EA 2VODA 2DNMA 2G2OA 1HNVA 3NGDA 4NEYA 2W4CA 1YBTA 2ZNZA 3AB2B 3FEXB 4RPFA 2BOAA 1GXLA 4B3MJ 1QSLA 4PWWA 2EFQA 5JUMA 4RWWA 3BGFA 1VBKA 3CCQS 3LTOA 3W9HA 5C24A 4P2SA 1XNQJ 2FLNA 4MYTA 2L08A 3A1YG 3CSKA 3QNWB 3WDOA 2EEYA 4DF4A 2J9DA 3RAXA 1TK8A 3ZZ0A 3UCGA 2FDNA 5F8HA 1TFWA 1F0XA 3PCOB 2F3JA 1RT1B 4OYOA 1JJHA 2L9NA 2RUGA 3W3SA 3MM9B 3N4WA 3O3LA 3HHLA 3BYRA 5L1JA 3PW4A 1VC0A 5EWEA 4Q8FA 4LUBA 3H40A 1HWIA 4I4BA 2XI2A 2KXFA 5D4PA 4IOBA 2RVJA 2HHWA 3LP1B 4Y34A 3L3CA 5DGBA 1VC6A 2BZ2A 1X7VA 5IT0A 2ZKUA 4NL5A 3FMBA 4NMLA 5CZVA 3DMJA 1AB8A 1YIJS 4X4RA 4WP8A 1VC5A 1HHTP 2UV8G 3QBCA 2WSCC 3PV8A 1RKJA 1DJ0A 1UEUA 2ZC3A 5LMUJ 5DLFA 3RYLA 1LXNA 4DU7A 2GS8A 4NLSA 4W4MA 4ZVOB 3TA2A 1IBCB 2MJUA 3LALA 4R5PB 1HWJA 5DETA 2ZJRQ 3H4DA 3Q2SC 1FWLA 2L48A 1HBNB 1I6JA 1VGYA 2D69A 2HIQA 3SSSA 3H4BA 2ZM6J 3DU5A 4RX6A 5KFWA 1U6FA 3O8WA 2GGPA 5K9FA 3TZZA 5GMDA 4JI7F 3NBPA 1FF2A 2V5HG 3UW1A 3BSNA 4MKAA 1KSPA 1RTHA 3MEGB 1NJWA 3ZZZA 2ZOFA 5L1IA 1N33J 4P75A 1GT8A 1Q8LA 3JAMU 3MUVP 1JWWA 3H0PA 3KLFA 1RHMB 3SIPB 4JV1A 1F6TA 2P6SA 1GTHA 4OI4A 2VIHA 4U7UD 3RBDA 3LW5C 1RLDA 2K7KA 4HI2A 4HLBA 4X66F 2HQ3A 4Q5VA 1UKUA 1ZM9A 3J7YI 4ZP6A 3H2VE 4IKAA 1Z4UA 4RO0A 1KP6A 2FHMA 1KQGB 2IVYA 1VQ6S 3T1HJ 4ER8A 4ZPTR 2HKEA 2J0XA 1DRZA 3KNAA 2CPZA 1S4FA 2ZHOA 1JXEA 3JYTB 3HHLD 5H9EJ 4P74A 1MU2A 3DOLB 4P2MA 3SV4A 2IIHA 2YNIB 4DR3J 1FDAA 1RWXB 3TAQA 4P7TA 4WF9Q 4J90A 2I0XA 2YTCA 2C2MB 2RQ4A 2LEPA 2MQ8A 3Q8YA 4CM0A 2IBOA 3HVAA 5L9NA 5E0OA 2H5JB 2F7VA 3BBBA 2BE2B 2VPWB 3H5UA 1DURA 2EKYA 3IP0A 2OPRB 1NPPA 3JTPA 1S1VA 3K5PA 4OYZA 2DO0A 5KTQA 5KFKA 3G6ES 4IRDA 3MTKA 1O51A 2B8PA 2RQKA 5LL6d 3ZZOA 1OYDA 3IBCB 2OSQA 3PEJA 4HTJA 2C28A 1RT4B 3QYYA 2YX4A 5ETOA 3W9IA 2V4RA 1B3TA 2FY1A 3R5GA 1TFYA 2VOPA 4ZVRB 4ATNA 1YRXA 2YNFB 3SSQA 3NCQA 3ZFVA 1SH3A 1XIQA 3PTWA 4YY3F 1U1KA 1NKCA 2M9KA 4I56A 1UWAA 1HW8A 1IBLF 3KLIA 2FJWA 1UEVA 2Y0SD 1RDRA 3GB0A 1C1CB 1E6VB 3BGRB 3CJ5A 4CO4A 1F60B 1KWMA 4HVZA 4WE1B 5F3TA 2IJFA 1TK0A 4V19X 1O6XA 2IM2A 1HQEA 4FBTA 5FDLB 2QIFA 1MMDA 5T7LA 2E1AA 3C16B 2FZGB 4DV5J 2MYFA 5KG1A 2ERRA 1YG0A 2XO6A 4QCLA 4I7FB 2FLOA 1RWVB 3EM1A 4G6VB 1S1UA 4USHA 4CLYA 3M1VB 1Y00A 5HROB 4GC7A 1OQ3A 5DM7Q 4B3TJ 4JI6J 4X65F 4F3MA 2B4PA 2J8SA 4EUVA 3MFIA 4O3SA 2WK4A 2M3DA 4G65A 5J2QB 1RBOB 3GFHA 2DGSA 5AT1B 4OL8A 1RT7B 1IKXB 3FKBA 2CPIA 1FNXH 2YNIA 1KR4A 1FTCA 1UP1A 4HACB 4WFBQ 3OL9A 2W2OP 3KJQB 2I2YA 3UR0A 4DUZJ 1TUWA 5F3ZA 3H42A 1FI4A 4OI6A 4A8MP 2FLPA 2HHVA 1GNKA 2GC8A 4WU2A 4LT6A 5IV4A 2OPPA 4TKTA 1R6YA 1T02A 2YWKA 4IUFA 1JMTA 1Q8KA 1WHVA 3C8YA 3HLUA 1LW2B 4NLPA 1A9NB 2RT3A 2ASJA 4YY3J 2H1YA 2IPOB 5LOQA 2COLA 3KUGA 5THWA 1A6LA 2YX7A 2ZE2B 1NDPA 1IKYA 1P1TA 2DK2A 2EK1A 3MM5B 2PI5A 4HHUA 3IAM9 4UY85 3OL7A 1VS3A 4ED8A 3GP9A 5IT9U 1WHXA 5J1PA 3DNCA 3HSGA 2VL1A 3M2RA 3H2UB 4XO0A 4LREA 3Q86A 1I5OB 3CCUS 5IT9Y 3I0SB 4X4UA 3KLEA 3GZ7A 3F44A 2LDIA 1UPPA 3QRRA 2IDLA 4BLGA 3IWNC 1S49A 4LR8A 2FHOB 4MIWA 4OZ0A 2C3UA 2MSTA 2CJYB 2V34A 4QR0A 1VQ7S 3ENVA 2EC0A 3ZC4A 5J2PA 4QW9A 1T9TA 2AV5A 3PVXA 1VRUA 2OMOA 2CG8A 1U2FA 2EC2A 3LUYA 4U8YA 2IVFB 3MMCA 4WP9A 1EZZB 4O4RA 4W90B 1VI7A 4WWSA 4WP3A 4L72B 4NI2B 1VFJA 2JLFA 2MHEA 5BJRA 4GKKJ 3U02A 2V8DA 5AXNA 2XY6A 2W8KA 1X4BA 4JV2A 4MFBA 2GVDB 2N3OA 2OTLS 3ZZYA 2Z30B 3HZGA 4LMZA 2VQEF 3DHXA 3GJTB 4YB6A 3UDLA 2KM8C 2W2MP 1EJ7L 2SXLA 3BB5A 4LF5J 1QVFR 2FQQB 4X4VA 1R8CA 5C5JA 1YJUA 1FX2A 4M5DB 3CCLS 3FRYA 3QSYB 2HVZA 4DL7A 4Q44A 4TU7A 2XSJB 3M8ZA 2EW9A 4X64J 1S9FA 1NM2A 4O0IA 1HI8A 4LSLB 2YXLA 1NHKL 2IM3A 4Z7YA 2Z2YB 3A13A 2DHSA 2H65B 4FZVA 1VQOS 5IOLA 5K8MA 2MGZB 2LP4A 2XZTB 3V6DB 1QE1A 2DHXA 1GX5A 3CJ2A 1U1MA 4KR0B 2B4OA 3UDCA 5BYQA 2BUNA 4NYOA 2HLUA 2WCXA 4PG5A 5DZ7A 2Z58B 2W9BA 5CD4H 2HAFA 2V6AA 4H4MB 3OJSA 4DR1J 3DOMA 1SI9A 3RR8A 2BQRA 1DARA 2QLBB 1Y5LB 2BE7D 4L3KA 4K5RA 1KVJA 2L9WA 1VISA 4WJBA 3AJ1A 3OT9A 1M0SA 5KFUA 1BQMA 2MXYA 2ZH6A 1DY3A 3JS9A 4B9UA 5EUHA 1PO6A 3W1YC 5KG7A 2DIVA 4M5JA 4HT7A 1XNQF 5G0RB 3CDEA 5E33A 4IFYA 2G2YA 1FA0A 3MTJA 2G4BA 3M8PA 1RTHB 5HO4A 3IGNA 3UCZP 3CJKA 4YUDA 2ASYA 2GO8A 2GCFA 3OVAA 1Q7YT 1MWYA 1NO8A 1FK9B 2V0NA 2V69A 1WC4A 2B9YA 2CVIA 2XZDB 2WVDA 4MFBB 3QFWA 2NPIA 1SJ3P 2CWKA 1X9WA 3MM6A 2CFXA 4P9SA 5KFAA 3T5JA 5IXUA 2W7OA 3BREA 1RAGB 3IS9A 2RAQA 4EYIB 1X5PA 2H51B 4ED3A 4HI1A 2IRYA 1DAXA 1GXTA 1NCLA 3FEYB 4YN3B 4CIOA 5AJ3F 3NS5A 4D3GA 1YRUA 2CVEA 3EGNA 1U0SA 1TELA 4FPIA 1S97A 1VK8A 2R7TA 2K3IA 2V8GA 4DN9A 1FKOA 1SJQA 1RCOB 2CPYA 3MDFA 4LF4J 2EXUA 1RT2B 4NLQA 2C2NA 1YBUA 2JLEA 2ZM6F 1WHWA 3EVMA 2G1DA 1RU1A 3NWRA 1DZ5A 1HHQA 3V81B 4KGXB 2O01C 2OI2A 4AT1B 1X0FA 3AB4B 2OLWA 4F3QA 1MW7A 2AYBA 2YWGA 3IC1A 3M8YA 5LMUF 1VRQC 2HBYB 2FVSA 3OTEA 1FVQA 4PUOA 4N77A 1YZ7A 2QL9B 4OZ3A 4DR5J 4G1QA 4LRFA 2DNNA 4P7VA 4WE1A 3MAHA 5J1EA 5BR8J 1SKRA 4F0KA 2F1FA 4JP8A 3HK2A 3KLIB 2M5YA 3CMAS 2I38A 4X66J 3CIZA 3NEKA 3SQGB 3SZ2A 3HI9A 3M8PB 1VDHA 4FYWB 1BMQB 2ADBA 4I7FA 4XAKA 2BJ1A 1HD0A 4M8LA 4ZCIA 1R0BG 3EDQB 2JFDA 4LR7A 1S77D 4WZMA 5T7LB 4IO1A 3VF0B 4DLEA 3Q8SB 3O6QA 1B0PA 5MLCV 5A0YB 1YITS 2PI4A 2VOOA 2QYCA 4P72A 3OBIA 3KUHA 4OX8A 3T19A 1L3SA 1U8SA 1Y5IB 2NXCA 4HTIA 2UVUA 1RT4A 5IC6B 5DDPC 2B7CB 2YKNA 3TRGA 2K1RB 2HHHJ 4ZK7M 3CJ0A 2X3DA 1I94J 4RLEA 4CLUA 1N5TA 3D6FB 4Z37A 3Q24A 4DL2A 1KQKA 1FEEA 2H4YB 2WW4A 4AYBD 4X4TA 2AGPA 5D4OA 3PFOA 3EPIA 1YDLA 1RHRB 2VC0A 3OL8A 4R8UA 3VWSA 2GA7A 5CQGA 5IWAF 3O2IA 2OJ3A 2VICA 3CCTA 3QATA 3BSCA 1H2UX 4RNOA 5DDQC 2Y1LB 5E3RA 3GR0A 3A3NB 2W24A 1F5CA 3CJ8A 3T9ZA 1FJCA 2K3KA 3IG1B 4EZ9A 2VKZG 5HANA 3BQ1A 2RU9A 2E5LF 1UVKA 3D0IE 5F8LA 5CD4A 4USJC 2FJDB 3QLHB 3BBFA 2V2VA 1UEKA 4RBTA 3HO1A 1ZA1B 4J7CA 1Q0NA 1YKWA 3VZIA 1FJGF 3MOZA 2HHQA 1WD6A 4A46A 1AW0A 4JI2F 3KLHA 1UW9A 1LNQA 5KFTA 2R4FA 1OSDA 2RS2A 1TKTB 1NHVA 3SMZA 1S76D 2B5JA 3MEGA 3P5BP 3U27A 4DV3F 2XNRA 2Y8WA 2VG7A 2CJAA 4DPUA 2UU9F 3S1TA 3QAEA 2ASLA 5E3AA 3D4JA 3K5NA 2GIRA 1W26A 2LDYA 3FUYA 3Q23A 3HP6A 2K06A 1R43A 2U1AA 3QT7A 3I4PA 4LFBJ 2PO4A 1C4AA 1VLYA 3BQ0A 2YNGA 2KG1A 3DGPA 5I3UA 4JI6F 1UVIA 1YGYA 2GAGC 4OHXA 5U47A 2X1AA 4C4WA 2X1BA 3A8JA 1FRHA 1PAUB 2J6SA 5D3GA 2BW7A 5SUHA 4CNYA 4DX6A 4ZCMA 5B08A 2DO4A 4A8YA 2K8GA 4LFAF 1YQHA 3LGNA 1NDCA 2D1CA 1M1KT 4DR4F 1PBUA 2HYIB 3RB6A 2ZBQA 2Y0BB 1R0CB 3FCHA 4UUXA 4A48A 5D6GA 4Q45A 1QD1A 3ZO7A 2NLWA 3BPDA 4W98A 3W2WA 4QWAA 1QY7A 1MWQA 4RUHA 3NS7B 4J9KA 2DPIA 1VQ4S 2XQCA 5L8RC 4OJGA 1J5EF 4PCQA 1RHQB 2OH2A 2MHNA 1YI2S 4HH1A 1G3OA 1O8BA 2HWTA 3TO8A 2HFOA 2UXDJ 3KLFB 1MNEA 3KNGA 2DHHA 2J6UA 1UJ6A 4ID8A 2NSCA 1H7XA 2J9CA 5E2QA 4DPYA 4KV8A 1Q81T 2UXBJ 4XPCA 1XTZA 2V63A 5HMXA 4ZOSA 3OQ2A 4YB7A 3POTA 1GMWD 2QZ8A 2Y3YA 4MIBA 2FHJD 3M30A 4O3PA 3DYAA 3K8VA 1LK5A 5HQLA 1SKSA 4CLSA 1VJQA 2DH8A 4RJVA 2XSJA 1GQEA 3TAMB 5ADZA 2V68A 3BBCA 5KFDA 2VQEJ 3N6LA 4DR2F 4LF9F 1T03B 3P6YC 4HHHA 1LFWA 2C42A 2PDAA 2PD1A 3D66A 4U7CA 5I42A 2XO7A 2M8HA 1NAQA 5I4MA 1HIYA 2BJ9A 2ZC4A 2PFDA 3FCWA 4DR4J 1M5OC 3LGMA 1T05B 1WDTA 4DSKA 1FRKA 2OHDA 2PC6A 3N5BA 3KFWX 5C25A 4DQSA 2VONA 4O44A 4UQTA 2RDJA 1RT7A 4CRJA 5ITHA 5ETKA 3Q22A 1VLOA 4EEYA 2GVZA 1VIOA 2CQDA 3M6WA 2V94A 4OHWA 3D6MB 4RW8A 1JLBA 5GVQA 3IWXA 4B08A 1MMLA 3T5HA 1V3ZA 2C2ZB 3G4SS 1H38A 4IR9A 1NK7A 2CNOB 2IAJB 1X4FA 3PX4A 4C0HA 2VUGA 1RHJB 1Z2LA 2YKPA 2F9JA 3ZNUA 1UFWA 2OO4A 4QWCA 3OL6A 3SFGA 1F9HA 3SV3A 4DFJA 4OI2A 4C8MA 3KJVA 2IY5B 2A2DA 5A76A 1FJEB 4QWEA 2NXUA 3CJKB 3G6XA 2DJWA 3QO9A 2V8HA 3I5CA 4TQRA 4DFMA 4NEZA 1IWAA 3O1LA 1HQEB 4GKJF 3DRYA 2YNHB 3KYLA 2KFZA 2EG2A 3D67A 3V4IA 4DR1F 3C16A 4NPOA 4NZ7A 3DLHA 4FF4A 5ETPA 4LSNA 5LJ5Y 4J9SA 1VRTA 1OWXA 2XCAA 3POTB 5HL7Q 1HD1A 2GQQA 3MGJA 1Y10A 3U7JA 3GMGA 4CTAB 3DYAB 2VFRA 3VTIA 4DX5A 4RNFA 2P8IA 3EXYA 4RW6A 2KXNB 2YWEA 4F0MA 3I0RA 1IKXA 2H3EB 2AGQA 3ISZA 4JV0A 3TX0A 2KJVA 2VBWA 2E5JA 2AZ3A 1RT2A 4ZPVR 2C2DA 3A8EA 2PMHA 4C9DA 1PILA 3ILJA 1XQIA 4OX9F 4PAAA 3MR3A 2R7RA 4DV1J 1GXUA 2IC3A 1CS4B 4ECYA 3RRHA 4N76A 5F41A 4O3NA 4QIGA 3KTQA 4WU3A 2AX1A 3BKFA 4WYWA 1RT6A 4NLUA 5GAEU 2DNGA 3OXGA 1IUJA 2BKNA 2CYYA 1JLEA 4DG1A 1UPMB 2NR0A 3QZ8A 1FNMA 2AU0A 1PIEA 2CZ9A 5EX0A 4OHZA 1KONA 4P6QA 4TU9A 1W2BR 1LKZA 2AP6A 4Y3CA 4C3LA 1DTQB 2WHOA 3BSAA 1UETA 2YWFA 3V6KA 3J7A1 3ELHA 3UFCX 4I6WA 4AUKA 1SV5B 2UUWA 3GFYA 1RTIB 1TMMA 3PW5A 3EZUA 3JXOA 4FF3A 3AD9C 3V6DA 1SC1B 3CJQA 3HXMA 2HNDB 3JSRA 3R7SB 3QQCD 3CCWA 2BE9B 4ZHRB 2BX6A 2IJRA 1SPBP 2MZRA 4TNOA 4USIA 4ZPBA 1CSJA 2FJVA 3Q83A 3HD2A 4K59A 1FRLA 4CT9A 2W9BB 3MR5A 1CQMA 2AZ1A 2NREA 1UA0A 1C1BB 4NA3A 3MMCB 5F0WA 1RTDB 3TJ9A 4OYPA 2DPJA 2OIHA 1FT8A 2XMVA 1SKUB 1HBOB 5HMYA 1FXRA 4NXNF 2H48B 1WOPA 1N8RT 3EGVA 2HWHA 1UVNA 1UJ4A 3Q2TC 1KVIA 1REVA 1C0UB 5H1SV 4UY8T 4KGZB 3FCVA 3UR3C 1A7GE 4RNHA 4DV7F 5KT4A 3KLHB 2LXUA 2BABA 2MZTA 4DFKA 1R0AA 2JEFA 4U6PA 3R7BB 2A10A 4C0OC 4DL3A 2UUAJ 1KTVA 1YLXA 1H98A 1I1GA 4GVLA 4M5DA 4EI2A 1S0OA 1EETB 2M0GB 2RSQA 4USVA 2N7CA 3D68A 3GR1A 2HVDA 3PRVA 4ZCKA 1BD6A 2IRUA 2RU3A 4B3TF 2MZJA 3CJTA 3ILOA 3DRSA 3AXKA 3ITHB 4PWUA 4CQ1A 1U8WA 3AA9A 1CC8A 3MCOA 3TEGA 2GAHC 4ZVSB 2R8HA 1VQ5S 2DGWA 3RGIA 5J2MB 1QAYA 1L3UA 4X64F 1WC1A 3EJMA 3OR2B 1KTQA 2WOMA 2Z57B 2RRBA 2OKQA 4PXCA 2CXEA 2UVWA 3ET6B 3M6UA 3HHLC 4PPDA 3VGSA 1VCTA 2VG7B 1JLCA 1SUQA 2ADCA 1D9DA 1TL4A 2ZZTA 4ECTA 3QGPA 5JVHQ 5IT4A 4GKKF 2M8DB 4YHHJ 2B7BB 1NJIT 1C1BA 1S6PB 4CO1A 4CT8A 2NQPA 1ZZFA 2Z2MA 5ETRA 2RF2A 2U2FA 3RTVA 4QR1A 2UU9J 4ED5A 1SXLA 4DHVA 4CP5A 2W2QP 3CDBA 5HMWA 5DS7A 1X31C 2WZ1A 4WXWA 5LT5A 5KFHA 1WKLA 1LWEA 3HZEA 3M32B 4OLOA 4DL4A 1GX6A 4JI2J 5L1LA 1ZYQA 2Z8QA 3TZWA 4KH1B 3HPOA 4DF8A 2RRAA 2MKJA 3DCAA 3UI3A 1SCJB 1RBLA 3W9JA 5KOWA 4A8XA 3W2VA 1N32F 4M63A 1HFEL 4FXDA 1GTEA 1HKAA 2FUG9 1U0HB 2YKMB 3ENAA 1RZMA 5FIIA 5LSRA 5DM6Q 3ZZPA 4LFAJ 4F7VA 4QIEA 4ZLLA 1OO0B 1MG7A 2HMIB 2VG6B 3GTYX 2Y9HA 2FVRA 1U6BA 1FO1A 1IN0A 1UJ5A 3GIMA 1FKAF 4G1QB 3UN5A 4NLTA 2KI2A 2BW2A 4HHJA 5HATA 2RQCA 4M5IA 3G6YA 2J0QD 3NMRA 1RAFB 2YH0A 2HS3A 4CI0B 3Q89A 2XLJA 1S7IA 4G1IA 2BR0A 4FBUA 4MAKA 1U2CA 2A2CA 4K4UA 2ALYB 4CWBA 3TUPA 2VD3A 1B0TA 4NZ6A 1WC5A 2QTWA 1Q16B 1XNRF 2A6MA 1PC5A 4F4WA 2VV5A 3M9MB 4ELUA 4IOCQ 3BDPA 3DLJA 3KHGA 2XBPA 4I1TA 1IR1A 1RTJA 1T03A 2HK2A 1HNIA 1S6PA 1RSCA 4K4VA 4UOGA 1VRTB 1YJ9S 3DDNA 4ZN3A 1OY8A 4QU7A 3OJUA 2UXDF 1CQNA 2NCKL 5AXKA 3N0VA 2FC8A 4NA2A 2Z4PA 3PHEA 2CPJA 4I6AA 5C25B 4I2PA 3SDEB 2D7SA 4BC7A 3SI8A 1TKDA 2JC1A 4B3SF 1J5OB 3R8YA 2GVZB 4A8KA 3IN5A 4OJ3A 5C2GA 3D28A 3MEDA 1JLAB 3RG6A 5LSLA 3UD3P 3RUBL 2CJ9A 3AFGA 3M9NB 4R25A 1NB2A 2MKIA 2V2KA 2BV3A 1CS4A 3NY0A 3RW6A 1NPRA 2ZOMA 1T0TV 4AE5A 2A1BA 4ZVUB 3IG1A 2HHHF 2ZFHA 3J7AN 4TLQA 2HHTA 2HNZA 2BJDA 1TP7A 1XN9A 1IM4A 1WOOA 2NSBA 2V50A 4GVBB 4LVOP 4PG6A 4QR2A 4F04B 5HMZA 3MM8B 2DRAA 1TUVA 1XNRJ 1KOOA 1OIAA 4JI8F 3OUYA 1E6YA 2EPIA 4EBDA 1WG1A 4H4MA 3OLBA 3TARA 1WWHA 1H6KX 2IFXA 3KHRA 1TKTA 3ZNJ1 2VBXA 3M8QA 4ED7A 3K57A 3M7VA 5CZXA 2P9EA 5LSOA 3PKYA 1FRMA 4UOCA 3D1HA 3DLEA 2YKOA 1DTQA 4WKYA 5KFYA 4ZHRA 2BOPA 2CZVC 4JUZA 3VVUA 3X3UA 4BC9A 1ZTTA 1U1OA 4K4ZA 2ZWPA 3BDEA 1KKHA 2HSEB 1NK8A 3VALA 2OELA 4TN2A 2DCLA 3TUIC 5I3UB 2VQFF 4KGMA 4KIAA 2A3JA 1U49A 2DGOA 4U8VA 3ULHA 2FGOA 4DR5F 5CAAA 1XMOF 4ZMMA 1WSRA 1S59A 1TTHB 4EYHB 1ZTWA 3QAUA 2VDIA 2PEBA 3TEHB 7AT1B 2X1FA 2L3MA 4IFVB 4EBCA 2LECA 3D1OA 3G8SA 4CYUA 2JHEA 1T9UA 3VVTA 1UA1A 4PR6A 3LP1A 2KT5A 1HBOA 3LWLA 2YKAA 1NSQA 3OR1A 1WF1A 1CJKA 5ETSA 1Y11A 4C8ZA 5FD1A 3LP2A 1D3WA 1YWXA 2GX8A 2IDEA 3FQKA 4IO9Q 3TQ1A 3C19A 4E98A 4AFFA 3I87A 2X7IA 3V6HA 4DV6F 4DQIA 1FDDA 1NSAA 2VPZB 1TVRA 1KNZA 4LRAA 2AJQA 1SJFA 4ZPAA 5CA5A 3PX6A 4DV1F 4TLRA 2ZNYA 3DMJB 5IM0A 3K5LA 2GQCA 1DQ8A 2R42A 1G2EA 2DXEA 2HFNA 4RBVA 2Z2ZA 3GIJA 2MKCA 2PT0A 4ITSA 1K73T 3P5TL 1WKJA 4ZDNA 4DV0J 3P4UB 2E1MC 1TU0B 1WORA 3ENQA 3OFFA 3IAS9 5KFCA 4DQRA 3N01A 2GHPA 1HMVA 1QVGR 3MPYA 4PXDA 1GMVA 1FE4A 2E1RA 4B9LA 3M05A 1S1TA 1RT1A 3V5RA 3K8WA 4RNMA 1BXNA 1JLFA 5B0FA 1R8HA 4JOUA 2KT3A 3NRBA 4GO7X 3J81U 4DXLA 2J7UA 2F8EX 2FZCB 1EAYC 4RR5A 1X0PA 3JTOA 3AA8A 4F4XA 3CO9A 2YNHA 4KB7A 4IR1A 2E5LJ 3OSNA 3MUMP 2CQCA 4LR9A 5KFGA 4PPZA 1LWEB 2Y1RI 2YKQA 4FPRA 3Q8RB 2R7WA 1LWCA 4K4XA 2J5AA 2ZH3A 3TA1A 2ZUAA 3ZTPA 4KH0B 3MD3A 2RJZA 5AE2A 4RW8B 1W7WA 2RF2B 5KT3A 4K0KF 3RAQA 3FFIA 3EE3A 4KHRA 3VV2B 1N34J 3ICLA 1PAEX 3GV7B 3CT9A 3FDSA 1S1WB 2XMAA 1M90T 2V2ZA 3OTOF 1UZHA 2VBYA 3LGHA 4CO3A 3K58A 2OMLA 4OYWA 4C8LA 1WKKA 3HD1A 4R8UB 3WX4A 3W65A 4CLWA 3PRDA 1QE1B 3TWZA 2Z0GA 3KHLA 4QJVA 2KM8B 1OY9A 3CDUA 3QT8A 1A0OB 3GSDA 1S9GB 2MQOA 5SZTA 2MDAA 3UN3A 2ACYA 4M5MA 1VYAA 2FYXA 2YX1A 1UL3A 2MZ1A 1VQMS 1S99A 1KRPA 5KAKA 3HKWA 1V9OA 2DR6A 2GW8A 3CE8A 2VF3A 3NGRA 1DLOA 1Y4ZB 3PYDA 4K4YA 4CH7A 3M32A 4LF2A 4YQWA 4ICLB 3M4XA 1MU2B 3VGTA 1FX4A 1SKWA 5A2QY 2ASDA 1NK5A 3CD6S 1IM6A 2FY8A 1HLWA 2DNRA 2XWXA 2F8HA 3EGWB 1LOUA 2CAJA 4K5SA 3BJYA 1TK5A 4HKQA 3A4TA 1QUPA 4LQ3A 1U0HA 4K0KJ 2W25A 4B02A 4L76A 5K20B 1HYSB 1PBAA 2R8KA 2OPQB 1M5SA 4RWXA 5HBMB 5M2UA 1F3VA 2AGOA 2E5IA 1NJYA 4B9SA 1VR6A 1Y7PA 2BVZA 2DIUA 2AJFE 3B78A 3GCWP 1RTDA 2CUYA 4NXNJ 1IBMF 5K8PA 3MMAB 3ZZTA 3P45B 3NMAA 5DQHA 4PWDB 1N88A 1U24A 1TAQA 3GG1A 1CJVA 1UWBB 2IRXA 2XHWA 2ZWOA 3H98A 3UE2A 4DR2J 5DG7A 2MLXA 1RT5B 2XMUA 4ELVA 3GIKA 1HWLA 4PQUA 3TP2A 5HP1A 1S6OA 4KGKA 1RBAA 2DKOB 3SCKE 2MKKA 4DDFA 3R3TA 4OZLA 5CABA 3RB3A 2D3OR 1FWPA 3MPVA 3KJFB 4HT5A 1T9WA 3I0SA 4B9VA 4NRUA 2BQUA 5IC4B 4XDCA 2N3LA 4DV4F 3K5MA 2DYAA 3CPWR 2QA1A 4U9RA 2XLIA 1CULB 2BDPA 4EMDA 2DHGA 1MN7A 2QFIA 2ZHAA 3JTNA 1M5HA 2JEGA 3EYZA 2C3YA 3AT1B 2VJUA 4K2JA 3TVYA 2GJFA 1KFDA 1S5ZA 3CUNA 2GIFA 3LH2S 4LF7J 4C6AA 3WQPA 1Q5YA 2WRMA 3GONA 3MPWA 1OS5A 1OY6A 1UMJA 3IFEA 4QYRA 3HM9A 2XB2D 2HS4A 3HCXA 3CNQP 4OMFG 5J2PB 5E41A 3J81j 2WVBA 4UOFA 3AODA 2YKNB 2J7WA 5D0GA 4KY3A 3S6EA 5F8MA 2BRKA 3I96A 1HNWJ 4DUTA 3CDAA 4GVBA 1Q82T 4C8KA 4N8OA 4DZDA 1EKRA 3DM2B 1YHQS 2GJIA 3GPAA 2W4PA 5IFMA 1MWZA 2YWHA 2MKHA 3I9V9 4ILRA 4L6V3 5GMEA 3VAGA 3HHNB 3RU0A 2Q1LA 1TMJA 3BGOP 3LAKA 1SVDA 5HLFA 4X62J 4DL6A 5KG2A 2E7WA 3P8BB 2C3MA 1RWOB 4LSLA 1RQ0A 3BQ2A 3ZXWA 5CXTA 2CDQA 2OEMA 3UD5A 1U47A 4B9TA 4JI3J 1KN6A 5KG3A 2VA3A 1VQLS 1EKSA 2KFNA 1OJ4A 1WSVA 2CQ3A 4URQU 4A8WA 5L38A 2WOMB 3NNHA 2HQGA 5I3QA 2RS8A 1S1XA 2H54B 2HK3A 3D5MA 1VK3A 4DMZA 1BY9A 2ZJQQ 2X51A 1XMQF 4DX7A 4Q0BB 3AHPA 5HVFA 3SQOP 4DN0A 3QJLA 2LFVA 3LQVA 2ZBRA 4UOHA 3CD7A 3MECB 3BS9A 3OFGA 1RACB 2KRBA 2C1EB 3DHWC 3KWMA 2DRBA 5GAHI 3R5CA 4R0EA 1N0UA 1X4GA 2H5EA 2KHDA 3L7PA 4L74A 1JKHB 1RU2A 3DN9A 4OYBA 5E7OB 1HI0P 4DQPA 5GAGI 2WONB 3I82A 3BN7A 2P9GA 3R5DA 4N7TA 2CPFA 4NOHA 1FEHA 4BHQA 3QGGA 1TKZA 3SEOA 5KT7A 2ZJPQ 1HNWF 2DR9A 2CQIA 2F40A 2RDDA 3GYNA 1RADB 1S79A 4UZCA 5G4DA 3HHEA 2RHSB 2M2BA 2WW8A 2KH9A 3L7UA 1VQNS 1ZA2B 2HMIA 2VG6A 1RWWB 3H7HB 4DSFA 4JI4J 4W92B 2ZBCA 2GHVC 1RJJA 2IHR1 4S0MA 4XK8C 5IM0B 2YKMA 3EZ5A 3PHTA 3GE9A 4FNHA 2J9EA 1RI7A 1U26A 2CPXA 3BGUA 1FRXA 2HQIA 1F3FA 2EBGA 1HNXJ 2UXBF 1ZZNA 1R8BA 3PRBA 4WBFA 3LA0A 4DI6A 2RNEA 5EDWA 3H20A 3NS6A 3GSIA 3BGRA 5LMNF 1TKXB 2V9KA 4FXWA 2AEFA 3RZAA 3C14A 3JSBA 5IWAJ 3Q0AA 3BO2A 1BQXA 2ATCB 2VG5B 2XTJP 1V5VA 1BLUA 2ZOGA 3CMQA 1RISA 3GU0A 3FBCA 4M5LA 5J2NB 3RRKA 3VZHA 4DV0F 1FKOB 3N28A 1T8EA 2UUCJ 2N82B 4HDGA 1K9MT 4LF9J 4CO5A 2M52A 1SL1A 2E44A 4WTYA 4LVNP 4UQGA 4P2XA 3J7YU 5HVHA 1IBKF 2E9RX 3I5AA 2GJ2A 1UFLA 4ED1A 3AXMA 3HFZB 5LM7E 1IKVB 2HG4A 2RUSA 3PYGA 3B4DA 5KFFA 2NXNA 4DX8H 5BR8F 4XIUA 4J37A 4DSIA 1H0HB 1JLGA 1NDKA 3OUYB 2XNQA 1RT3B 3CD5A 2Z56B 2YQ0A 3FBBA 4ID5B 1R6VA 1NB7A 2UUTA 1IR2A 2DEIA 4YB1P 3RBEA 1VQPS 3OLAA 3UCUP 1LQ9A 3MD1A 4X4QA 2HVHA 1ZPVA 2CADA 4EFAC 3IM9A 5KFBA 2UUBF 5ETMA 2KG0A 3BV8A 3W62A 3K7RA 4YHHF 1LWXA 3OVBA 1MSWD 2HNZB 2UVVA 4Q43A 3JQMA 4GKJJ 5HQ8A 3CJSA 1WI6A 4NYPA 1KQFB 3CCMS 3DLGB 4Y00A 1JIHA 3HSJA 2HWIA 2RHQB 2QL7B 5CYMB 4WCEQ 4C48A 1AROP 1N34F 2XYPB 3SXLA 4R5PA 5F9LA 1P6TA 5A8KA 5D15A 5I3PA 2UP1A 2W9AA 4PQUB 1RWMB 3RW7A 2KB2A 5AXMA 4M95A 4QIWD 1GMWA 2VFVA 2DNLA 2JH3A 4LF6J 1F9FA 3QO9B 1VRUB 3K5OA 3S01A 4A4JA 1YSJA 2GO9A 3W61A 1L3TA 2WAQD 2CJBA 2J0SD 4NI2A 3BKTA 2OPSA 4XPEA 1SH0A 4MK8A 4Q7AA 2FVPA 1B0VA 2YQ3A 2D41A 3J7Z5 2DB1A 3C6UA 3PYEA 3T41A 4CDIA 4YFUA 2IM1A 1ZAWA 3HSDA 4BWMA 2DY1A 4LF5F 3WIUA 3BM7A 1HNZF 1QTNB 1CEZA 1YJWS 5D77A 1PYTA 4B3MF 3NNAA 1SC3B 1KBRA 1NHUA 5KFSA 1R8AA 4TXSA 1EHWA 2LU2A 2QX0A 2V8PA 4M5KA 3MEEB 1CJVB 1KVKA 2VU5A 3A3OB 4QW8A 1JX4A 4KTQA 3EWGA 1URRA 4NLGA 3WZ0A 2HZCA 4O4GA 2B5JB 2JEIA 1N5YA 1XR7A 1NH7A 2B51A 3BN4A 3LO3A 1JNZB 2LMIA 5B0CA 4YOEA 3MCNA 4RW7A 3PKMA 2JWNA 3JSYA 4LSZB 3W66A 1Q86T 1FRIA 2CA9A 4KHMA 2G2ZA 4QPTA 2BM0A 1XR6A 4JI7J 4A8SA 4LQ9A 3TX8A 1AXQA
chains in the Genus database with same CATH topology
2YPYA 4K2JA 4UZCA 1B3TA 2YQ0A 5A76A 4UZBA 2YPZA 4BLGA 2YQ1A 1VHIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YPY A;  4K2J A;  4UZC A;  1B3T A;  2YQ0 A;  5A76 A;  4UZB A;  2YPZ A;  4BLG A;  2YQ1 A;  1VHI A; 
#chains in the Genus database with same CATH topology
 4B3S J;  2FTR A;  2GQ2 A;  4WFA Q;  2WBR A;  1NRK A;  1GK8 A;  1KD1 T;  1N33 F;  1J2V A;  5B0A A;  2C2O B;  2BAN A;  2QJ3 A;  1QAJ A;  2V4J A;  4KHP J;  2YNF A;  3IR5 B;  3KKF A;  3KK3 A;  4NCB A;  1N5S A;  3MZI A;  3F41 A;  2APO A;  5HLF B;  2PE8 A;  1ZBT A;  4H4K C;  4C7Q A;  1RKI A;  2ZH1 A;  1RYS A;  3DLB A;  4RW9 A;  5D4L A;  1K1S A;  1C1C A;  1E6V A;  1ZM4 A;  4B17 A;  4MH8 A;  1WI8 A;  5D0R A;  2UUA F;  2ILZ A;  1S0V A;  2BJ7 A;  1JLF B;  4CO2 A;  3E3X A;  3VAM A;  1LWF B;  5FDL A;  4I67 A;  2OEK A;  1R27 B;  2EFO A;  3VAJ A;  2M7S A;  1NND A;  2FC9 A;  4IFY B;  1U4B A;  3G8Q A;  4FS1 A;  7FD1 A;  2QYG A;  3M6V A;  2BAC A;  3B4M A;  4NLW A;  1EAR A;  1KLM A;  1HWU A;  3MCS A;  1UVL A;  2JRS A;  1S1U B;  1FK9 A;  2LU1 A;  2WON A;  4ZP7 A;  2F65 A;  2EFP A;  3ETM A;  1K47 A;  1FD8 A;  2DIT A;  3FFI B;  3ZTS A;  3I55 S;  1PC4 A;  3VHQ A;  2Y1J A;  2NZC A;  1H2V Z;  2HGM A;  4HL9 A;  3GV8 B;  2W8L A;  1NEE A;  4CLT A;  3JSM A;  1JJ4 A;  2DNO A;  3AQP A;  4LF7 F;  1X4A A;  2MQQ A;  1EET A;  2DRD A;  2GNK A;  2VH7 A;  4QBU A;  3KK1 A;  2ZHB A;  1QUV A;  1REG X;  2LVW A;  1C0T B;  1KDN A;  2OUG A;  2RB7 A;  3QT6 A;  4KAI A;  1ZM3 A;  3J7Z T;  3W7B A;  1U09 A;  3PDN A;  4DUY J;  4JI3 F;  1RHK B;  5KG5 A;  4Q0B A;  3FNN A;  2CQH A;  4IG3 A;  1XWL A;  3UQS A;  4DR3 F;  2DNY A;  1CJU A;  2QMU B;  3MF5 A;  2DEJ A;  2HNY A;  1HBN A;  2R2U A;  4ES1 A;  1RWK B;  1RA6 A;  1X5S A;  4TU8 A;  3QIP A;  4X62 F;  2XUL A;  2HAI A;  2ZUG A;  4PWD A;  1GMU A;  1H7W A;  4YB5 A;  1GH8 A;  4TY8 B;  4DJB A;  4U7U K;  1RTZ A;  2KYZ A;  1RUS A;  1S6Q A;  2LQ9 A;  4X65 J;  2CJK A;  4IRK A;  2B4U A;  1DLO B;  2AYE A;  2B3T B;  1SQG A;  5A6W A;  1FDN A;  4XTT A;  5K8N A;  2DGU A;  1F5B A;  2LKZ A;  4P71 A;  3G86 A;  3FBE A;  4C3M A;  1RAA B;  1UVM A;  1WEX A;  1AZS A;  3B6B A;  1EP4 B;  4TY9 A;  1TL7 A;  3OD2 A;  4DV2 J;  8RUC A;  1WG4 A;  2AYM A;  4NLX A;  4EO6 A;  3QLH A;  3IO1 A;  2ZH4 A;  3T3F A;  1WTB A;  5A0Y A;  4C3K A;  3FGV A;  4B3O A;  4K50 A;  3JYT A;  2GVD A;  1X9S A;  1L3K A;  2EWH A;  2ZKT A;  1IR0 A;  3K2Y A;  4G3I A;  3JSM B;  5KT2 A;  1UWB A;  3RRG A;  4E2F B;  4CYU B;  1FJG J;  1G1X A;  1IJE B;  1EQM A;  2K1R A;  4MK9 A;  4HR2 A;  1TKX A;  1EX8 A;  3PR4 A;  1RT5 A;  3R5A A;  5BYS A;  3MMA A;  3I31 A;  4C0B A;  4FNI A;  3CD0 A;  4DV3 J;  2DR8 A;  2AF6 A;  4N47 A;  4JI8 J;  3ETO A;  4YR2 A;  2XY5 A;  2BQ3 A;  5CYM A;  1OQ6 A;  4WPA A;  1TL5 A;  4PG4 A;  2NUU G;  3NLC A;  2PA8 D;  4ECS A;  1N56 A;  5E3Q A;  2QLJ B;  4WYL A;  1QDU B;  4DPW A;  5GAD U;  3E2E A;  3GV5 B;  2HQD A;  5A8K B;  4O23 A;  4ZLP A;  3B8H A;  1D1U A;  2R7X A;  3IBW A;  1D8Z A;  3HUL A;  4PXE A;  5HAO A;  5DG8 A;  2NYI A;  5A8W B;  1JLG B;  2DH7 A;  2XS7 A;  1TV6 A;  3R9L A;  2BA9 A;  2XSF A;  3BH7 B;  2N4C A;  1Q1K A;  4F4K A;  2AJ4 A;  3K0J A;  3GFX A;  3DI6 A;  2HBZ B;  4P2F A;  2OAU A;  1PJ7 A;  4KE5 A;  2XZW A;  3G2X A;  4C98 A;  1S1T B;  2QL5 B;  4U67 Q;  2KVQ E;  2XMT A;  3DXS X;  4ZLN A;  3I0R B;  4DR7 F;  5DQI A;  3Q8U A;  4IYQ A;  2IYI A;  4FS2 A;  5C24 B;  1I51 B;  5F8N A;  1WEZ A;  3PJW A;  5EX3 A;  1EP4 A;  2AHO B;  3R7N B;  1PYO B;  4F4Z A;  3RB0 A;  4I2Q A;  1LV5 A;  5L9X A;  2E9T A;  1LFP A;  5LXR A;  4FVM A;  1UFK A;  2DGV A;  2I6W A;  4DPX A;  1XR5 A;  3PJ9 A;  2PMW A;  2MQP A;  1T3N A;  2YH1 A;  3D6T B;  4CZC A;  3HFV A;  3MPU B;  1IXK A;  4NMX A;  2Q6C A;  1JKH A;  5GAH U;  2OTJ S;  1F1B B;  3L9Z A;  2ZVS A;  1KOH A;  2VPX B;  3N6M A;  3CWJ A;  3DDK A;  4HDH A;  9ATC B;  3CF5 Q;  1U1R A;  2CNN B;  4AL5 A;  2ZBP A;  4LRB A;  4ZIV A;  4DLG A;  4DU8 A;  5HVG A;  2KFY A;  1SL2 A;  1S1W A;  4CLL A;  4JV5 F;  3JQK A;  1OYE A;  3THV A;  3CB4 A;  3MMB A;  2FGC A;  3MM5 A;  1Q5V A;  2DR7 A;  3OXL A;  2EFG A;  4RW7 B;  2OSR A;  5HI7 A;  4NLV A;  3TVK A;  4KQZ A;  4DSL A;  4KHP F;  2VQF J;  1YJN S;  2OPS B;  2IJN A;  4DS5 A;  3PY8 A;  3I6P A;  4BWJ A;  1F9E B;  2B9E A;  3EMT A;  3H5Y A;  2G9O A;  2R8I A;  3OR2 A;  3J81 Y;  3C6U B;  3I5B A;  4IH6 A;  2HW3 A;  4ILL A;  4I69 A;  4DR7 J;  3ISN C;  5JMN A;  4F0H A;  1KHV A;  3M2U A;  3NGS A;  4GC6 A;  4ENO A;  3QJJ A;  1M1H A;  4IOA Q;  2CPE A;  3C14 B;  4AQY J;  2E66 A;  1OSC A;  1N48 A;  2O5D A;  2LQJ A;  1TKZ B;  1WTF A;  1LWF A;  3A8I A;  4KV8 B;  2ZEJ A;  2D74 B;  3NGK A;  1XMQ J;  1NKB A;  2KT2 A;  2JJ4 D;  4F3O A;  1FNO A;  1V3R A;  1L3V A;  3PO5 A;  3GCX P;  2EVZ A;  5K5M A;  2LCW A;  2JZ5 A;  3JQJ A;  1VQ9 S;  1SIW B;  3TAM A;  4ZVE A;  2CIM A;  2CPD A;  3D3C J;  2J9D E;  3DLK B;  3M2V A;  1SJR A;  2DGX A;  4F2S A;  2LEB A;  1FTR A;  1FES A;  3KK2 A;  1YRT A;  1FVS A;  4KKO A;  1RHU B;  3CCZ A;  4DL0 C;  1KEK A;  2JDJ A;  3VAF A;  3C2P A;  3GYX B;  1JLB B;  4OZ1 A;  4ANC A;  3PR5 B;  2VJV A;  3HDS A;  5KFZ A;  5J2M A;  1K0T A;  3A8K A;  3U1N A;  3IWL A;  2R8G A;  4H54 A;  2QRR A;  3DC2 A;  3TNV A;  1G4C A;  2ACM A;  3LPE A;  4OYA A;  2BRL A;  4WK3 A;  3JAM Y;  5CCL A;  2JEJ A;  1AFJ A;  3D6H B;  3W2V B;  4P10 A;  2RH3 A;  1EQ0 A;  3LP0 B;  4OX6 A;  4X4S A;  4D3H A;  1IKV A;  2VAS A;  1D9F A;  5HP1 B;  3TAP A;  4TYA A;  3C15 B;  5HQM A;  3OTD A;  1Y5N B;  2DNZ A;  2LEA A;  3WHI A;  3QRP A;  3T6B A;  2JVR A;  4IG3 B;  5KFM A;  3AD8 C;  4ED6 A;  2O66 A;  4V1A k;  2B6A A;  2PSZ A;  3VQT A;  1YK9 A;  2CNL B;  3CW2 C;  2DH9 A;  1ZH5 A;  3HF5 A;  7FDR A;  2QMX A;  4M5N A;  2EFV A;  2J76 E;  1X8D A;  2HEK A;  2R3V A;  5DO2 A;  4EZ6 A;  4OI1 A;  1QTM A;  1H2T Z;  1BHN A;  1APS A;  1CBK A;  4FF2 A;  3UO0 A;  2WSF C;  3BYP A;  2QA4 S;  2A18 A;  3UDE A;  4CTA A;  1V6H A;  2KVI A;  4TVA B;  1CJT A;  5L39 A;  3MUT P;  3BGL A;  1I94 F;  3CTR A;  3K59 A;  4FF1 A;  3KMQ A;  2P6T A;  4KYZ A;  1N52 B;  3HFK A;  2CG4 A;  2QC3 A;  4ETZ A;  1GAO A;  1K44 A;  1NME B;  2B43 A;  2CKW A;  2MKY A;  1S7H A;  1HNI B;  1ZAX A;  2F9D A;  3BR8 A;  1S72 S;  3DLG A;  4ILM A;  3G8T A;  1RYR A;  3R1L A;  4J5O A;  3HX9 A;  3VQS A;  6AT1 B;  4ES2 A;  2ROG A;  1N54 B;  2HGL A;  3IGV A;  4M5H A;  3QWU A;  3PJX A;  4EU0 A;  1HWK A;  2YPZ A;  3QIP B;  3I56 S;  4NAS A;  1T94 A;  2FZK B;  3D2W A;  1J5O A;  3HHL B;  5D3G B;  3CED A;  3U1M A;  1FDB A;  1RT6 B;  4TY8 A;  2POK A;  1HBM A;  1FFS B;  1SQE A;  1XMB A;  3KG1 A;  5BYR A;  2XWY A;  1ZM2 A;  1DBD A;  3T9N A;  5T41 A;  2XGP A;  4OZ5 A;  3LAN A;  2HVE A;  2JL9 A;  3MEK A;  2HND A;  4OZJ A;  4Y0F A;  4Y2M A;  2ZH8 A;  3HHK A;  4YDD B;  2UVR A;  1LXJ A;  2NUH A;  1XK8 A;  4RL1 A;  2N4D A;  1RTI A;  1KS2 A;  3T5K A;  4J91 A;  3S7R A;  4TQS A;  2B6A B;  1JJ2 R;  4LF1 A;  4PYD A;  4N5S A;  1XJW B;  3AOB A;  2CZ4 A;  4P52 A;  3IR6 B;  4N56 A;  1EIY B;  1IBM J;  4IDK A;  4RW4 A;  4G1P A;  4Q2M A;  1Y9O A;  3MM9 A;  4RKU C;  4J9V A;  3SQG A;  1U1Q A;  4OI0 A;  3ET6 A;  4KRW A;  4DCP B;  3MOJ B;  4CO0 A;  2KXH A;  1Q79 A;  2PGC A;  4O4G B;  4RW9 B;  3TAN A;  3THP A;  3IA0 A;  1X4E A;  4CLF A;  5KFI A;  4ECR A;  4KT0 C;  1TR0 A;  2BXJ A;  5KFL A;  3MM7 A;  4DFP A;  2PN6 A;  1F5A A;  3AJ2 A;  4LBP A;  5HBM A;  4ECW A;  2R7O A;  2QN6 B;  1VMB A;  4PG8 A;  1HNZ J;  5I42 B;  4CNZ A;  4ZCL A;  4O3Q A;  1N5V A;  4ECQ A;  2KHC A;  5HN0 A;  1K0V A;  8AT1 B;  3T1Y J;  2EK6 A;  2NPF A;  4ZPC A;  4X4O A;  1N36 J;  1M5V C;  2HFZ A;  4BS2 A;  4UT4 A;  4WKR A;  1JQG A;  4UW2 A;  1OMS A;  3KK3 B;  5DJB A;  3M2R B;  3D1Q A;  4I68 A;  1WHY A;  2UXC J;  4YEA A;  1B70 B;  4IQM A;  4O44 B;  1YTY A;  1K8A T;  1YJV A;  1FD2 A;  1LEO A;  1RAJ A;  2W2N P;  4LFB F;  5KFV A;  4ZJO A;  1VBX A;  1SC4 B;  2MJN A;  8ATC B;  1TVR B;  2YPY A;  3UN2 A;  4DSJ A;  5B0B A;  1S6U A;  3G82 B;  3CCE S;  2EKN A;  1T3O A;  2XCP A;  2XC9 A;  1PJ6 A;  5KFX A;  5CH7 B;  5A8R B;  3TI0 A;  3FSI A;  1FHT A;  2MEW A;  3AH6 A;  1DQA A;  2DCU B;  3GFZ A;  5KG6 A;  4ZIT A;  3MR2 A;  4KPY A;  1JLC B;  1SUQ B;  1ACM B;  3GWC A;  1ZET A;  3DLL Q;  1U7L A;  4RW4 B;  2OFH X;  1BQN B;  4IFV A;  2BMB A;  3W8G A;  5ETV A;  3RBX A;  3U1L A;  2H9Z A;  3MPD A;  4LSN B;  3ZTQ A;  1MLA A;  5DLG A;  3OHA A;  4NWB A;  2E29 A;  3G96 A;  1Q53 A;  4J9Q A;  2B0G A;  3M2U B;  1NKE A;  2DNP A;  2H5I B;  5IQQ A;  2CRL A;  4LF6 F;  5E3P A;  3D3B J;  2DTJ A;  3T5L A;  2ATL A;  1NJZ A;  2EG1 A;  5G0R A;  1LW0 A;  4L3N A;  1WF0 A;  3MM6 B;  3IR7 B;  3LWM A;  1CVJ A;  4JYA F;  1RAH B;  3UWT A;  1LWC B;  2FLL A;  1W2I A;  2R7V A;  1SJ1 A;  3DGP B;  2I1R A;  4OZN A;  3RJM B;  6FDR A;  3IS9 B;  2QG9 B;  2R2S A;  4ZJL A;  4PQA A;  1U2R A;  4DEZ A;  5B0D A;  1HR0 J;  3WBZ A;  1ZOT A;  5HJY A;  4J9P A;  2W7P A;  2LQB A;  4I0W A;  2YQ1 A;  4NCA A;  1EB0 A;  1XC9 A;  2KZM A;  1WC0 A;  2HHU A;  2HFU A;  3QSI A;  4ZIW A;  1BC6 A;  2A0F B;  1TL3 B;  3OTB A;  1U6Z A;  1B7Y B;  4KC5 A;  5AXL A;  2QLF B;  1ZPW X;  4JBC A;  2XMM A;  3TJA A;  4AND A;  4CLK A;  4J9N A;  3MED B;  1WAC A;  5F9N A;  3DGV A;  3EPG A;  3VAK A;  1VBZ A;  1DFD A;  2DGT A;  4O0N A;  2GMH A;  3D7S B;  4NCG A;  3W5Z A;  4DUY F;  3I9Z A;  4UZB A;  1TL1 A;  1DHM A;  2FIU A;  1Z1Z A;  5AE1 A;  2XM3 A;  3NGU A;  2F5G A;  5C2C A;  5H9E K;  5ETT A;  1MMN A;  1SV5 A;  4CLP A;  3C46 A;  3VGU A;  4JB8 B;  3FZ2 A;  4BDP A;  5EWG A;  1NZA A;  1R8P A;  1VQS A;  3GII A;  2YVS A;  4NE9 C;  3FMW A;  2BYC A;  1BQN A;  3MM8 A;  2XS2 A;  3DLK A;  2R8J A;  3T6J A;  4Y2A A;  5C7P A;  3UNG C;  4I2P B;  3SDE A;  1FXL A;  1IVZ A;  4ICL A;  1RK8 A;  1X9M A;  4F25 A;  3MWB A;  1HI1 A;  1PSD A;  2QO3 A;  2XMJ A;  2AJ0 A;  2BKP A;  4NX9 A;  2F63 A;  4X4N A;  3PG9 A;  3LOU A;  1JXV A;  3IRX A;  1YX2 A;  5BXI A;  3DLE B;  5KFN A;  5HJX A;  3OVS A;  1HR0 F;  4DWI A;  1C0U A;  2DNK A;  2V67 A;  1M1G A;  2FHK A;  4OJ1 A;  3C66 A;  2V9W A;  3QFH A;  1DQ9 A;  3M8R A;  2WVC A;  2ABY A;  2DGQ A;  2R9L A;  1SB6 A;  2C2R A;  4DL5 A;  1T7P A;  3KDO A;  1VHF A;  2ZE2 A;  4QYZ J;  5B0G A;  3CCR S;  2CPH A;  3QRQ A;  3BPS P;  5A6P A;  2D3U A;  2GZO A;  2HUR A;  2W2P P;  2LQ8 A;  1NJX A;  2OPQ A;  2BBE A;  2RML A;  1RP5 A;  4OFZ A;  1S9E A;  4Y2C A;  4CH1 A;  2G0C A;  2E7X A;  1Y3J A;  3FQL A;  1IKY B;  2JNJ A;  1GEH A;  5MAO A;  3KLE B;  1JLQ B;  2NZ4 A;  2HS0 A;  2VBZ A;  4KSE B;  2V4J B;  4EK2 A;  1W25 A;  2XHC A;  2LA4 A;  4IG0 A;  4WFN Q;  4NLY A;  4NYZ A;  3ISN D;  1E6Y B;  2HHP A;  3R27 A;  4K2X A;  2AJ1 A;  2E1P A;  2UUB J;  1URN A;  2E9Z A;  3Q8Q B;  4H4O B;  2E5H A;  4K4W A;  1F2H A;  2HQF A;  2KDO A;  1O0P A;  2LXI A;  2RIJ A;  2HRT A;  4ZN1 A;  5KFQ A;  4P73 A;  4J9M A;  1U1P A;  3A3P B;  3VAI A;  4DBQ A;  2LYV A;  3KOA A;  1OPZ A;  3TYT A;  4EO8 A;  1QJH A;  3MUR P;  4Z2X A;  4B3R J;  4QYZ K;  1IWG A;  2DXF A;  2KU7 A;  3L4B C;  3C6T A;  1U02 A;  5KFO A;  1CLF A;  4MYU A;  5JXS A;  5HK4 A;  3N6N A;  4CLZ A;  2OFG X;  4OYX A;  2HLT A;  3IRX B;  1H73 A;  1U1L A;  2O67 A;  1P27 B;  1RAO A;  3PNI A;  4URG A;  4AXJ A;  5IS2 A;  1CJK B;  5DGA A;  1B64 A;  2AYG A;  4DCO B;  2O3D A;  2AIR B;  3R5J B;  3FK4 A;  3GYG A;  5K14 B;  1N6Q A;  3G9C A;  1GFW B;  1R89 A;  5EGY A;  2GIQ A;  1WEY A;  5F0U A;  2CNK B;  4URS A;  1H72 C;  2CQ0 A;  2GML A;  1D0E A;  4PKD B;  3FJ2 A;  2MZQ A;  2E7V A;  4DQQ A;  3OR1 B;  1S48 A;  2ZD1 B;  1NK6 A;  1KFS A;  2HVI A;  3CC2 S;  5D78 A;  2Q79 A;  4WXO A;  3BR9 A;  3MM7 B;  3ENW A;  3Q8V A;  2FPH X;  1FXD A;  2OPR A;  3VR1 A;  4RUC A;  4UTG A;  2YNG B;  4AD6 A;  3KG0 A;  5CHC B;  1QAX A;  4PZV A;  1SL0 A;  3LPY A;  4RU2 A;  3PW2 A;  4J9U E;  2GHW A;  3WIV A;  1NUE A;  4EWT A;  2AX0 A;  4ED2 A;  4JV5 J;  3H2L A;  4YS2 A;  6FD1 A;  2PII A;  3TZX A;  1BQM B;  4IG0 B;  1XEZ A;  3CDW A;  3D0G E;  2RE1 A;  4GMK A;  4DPO A;  2R2R A;  4QQB A;  4EBE A;  2HRY A;  2LLZ A;  1WJ9 A;  1FWK A;  2AEJ A;  2ZH2 A;  3OTO J;  1CG2 A;  4FYX B;  1JJC B;  2I8E A;  3GJS B;  5D0E A;  3R97 A;  4DCJ B;  2W9C A;  1ICE B;  3F73 A;  4JI5 F;  2D3Z A;  4WII A;  1SQF A;  4A8F A;  3KHH A;  4AXI A;  4F4A A;  4NA1 A;  1U48 A;  1HBU A;  3EZO A;  2Q43 A;  2H4W B;  2N7Y A;  2G0I A;  4USU A;  2HZV A;  3NL0 A;  4Y2K A;  4AQY F;  3FZB A;  2I5J B;  4OQJ A;  3UDV A;  4B9M A;  3H90 A;  2QSW A;  2WB4 A;  1DTT A;  3DRP A;  3HT0 A;  4FYV B;  4F2R A;  3R1H A;  1CC7 A;  3PEH A;  2AW0 A;  4UST A;  1WEL A;  1IBL J;  4ZJQ A;  4DR6 J;  3BO4 A;  3CIM A;  2ZZN A;  1FFG B;  3EVW A;  2W4D A;  3K17 A;  2CQ1 A;  3KG4 A;  1U25 A;  2MB0 B;  3TUZ C;  3GG0 A;  3TZY A;  3TUJ C;  4OJH A;  4F8R A;  3HVT A;  1Q8I A;  1WG5 A;  2VFS A;  3D54 A;  3QWP A;  3N9U C;  4N8N A;  3W2W B;  1YJR A;  4YR3 A;  3CGI A;  3QGH A;  1QAI A;  1BGX T;  3HJF A;  3PW0 A;  4OYM A;  5A8R A;  1Q7L B;  2CJQ A;  4LIR A;  4ZPD A;  1C4C A;  2CWX A;  3T1Y F;  1L5U A;  4OLP A;  1N36 F;  2P2C B;  2DNQ A;  1Z2Z A;  2Y8Y A;  1N32 J;  1Q4R A;  2CQG A;  1G6B A;  5J2N A;  4JI5 J;  3AQO A;  3E51 A;  2FB0 A;  1F2G A;  4B9N A;  2ZDO A;  4LRC A;  4ES3 A;  4LF8 F;  1BUX A;  2B9W A;  4ECZ A;  1JNR B;  2CQ4 A;  2ROP A;  2IMO A;  2XEX A;  3TOQ A;  1X4H A;  2KZZ A;  2M88 A;  2E5G A;  2CDR B;  5AE3 A;  2NYH A;  2VG5 A;  3OFE A;  3M8Q B;  1NK0 A;  5T14 A;  4K4T A;  3H8Y A;  3O44 A;  1B4S A;  1NH8 A;  3H59 A;  1B99 A;  3UPF A;  3SSR A;  3TW0 A;  2QEX S;  4J9O A;  3GJQ B;  4C97 A;  4LIW A;  2ZH7 A;  1M5P C;  1HAR A;  2Q6B A;  4AL6 A;  1P8G A;  1LK7 A;  3KMS A;  1DTT B;  4L75 A;  1JK9 B;  2F8M A;  3BO3 A;  4HYK A;  2Y1I A;  1IKW A;  1MRO B;  2DBB A;  4M1K A;  1R7I A;  1HYS A;  4ERD A;  5CYQ B;  1RB0 A;  3US5 A;  4WK1 A;  3BZQ A;  2B4V A;  5KFJ A;  4L73 A;  3PIP Q;  3CJ3 A;  4RZR A;  4FDF A;  3RBZ A;  3RR7 A;  4JI1 F;  3C3L A;  4PG7 A;  4ECU A;  1JXL A;  3X1L B;  2M4M A;  3J80 Y;  2IMW P;  2XG8 A;  1Q78 A;  4CH0 S;  4RW6 B;  4C8O A;  4NLR A;  5F8I A;  1N0V C;  1NK9 A;  1I3O B;  2RQM A;  1FRJ A;  4MJK A;  1PKU A;  2MMY A;  2MQN A;  3W63 A;  1VHI A;  2HBQ B;  2HPU A;  1BWE A;  3FC9 A;  3UVJ A;  2B9X A;  9RUB A;  3MMB B;  5ETQ A;  1QLN A;  1HPZ B;  2NXE A;  2WTF A;  2JVO A;  4KO0 B;  2UZA A;  3BF4 A;  2IC3 B;  3CJR A;  3CCS S;  3V4I B;  1RWU A;  1YJT A;  1AUS L;  1HQU B;  1ROF A;  2BKO A;  2G13 A;  3DOK B;  4IDK B;  5E5N A;  2RD5 C;  3OFH A;  4Y6I A;  2RIL A;  4YDX A;  5HSP A;  2RDI A;  4WFZ A;  2Q3P A;  2ZBI A;  5ETL A;  3MAA A;  3RAM A;  4H4O A;  4ID5 A;  4QIV A;  3KLG A;  3T1H F;  4WIQ A;  3QGI A;  3N5F A;  2L41 A;  1XMO J;  4ZP8 A;  3TJ8 A;  1XBW A;  3DU6 A;  3O5T B;  3ZTO A;  1HW9 A;  2A6O A;  4V19 J;  1HHS A;  1MN9 A;  4LBH A;  4ALZ A;  2G1H A;  3CO0 P;  3NCP A;  5KG0 A;  2ZH9 A;  1UCN A;  4F02 A;  4WFX A;  3AOC A;  2R2T A;  1P9Y A;  1AFI A;  3BKU A;  1UW4 A;  3SBM A;  4JI0 J;  1TZ0 A;  2JX2 A;  5FLX Y;  4ZPW R;  1IKW B;  1MRO A;  3J80 U;  3FEZ A;  4DPT A;  4F36 A;  1T95 A;  3L09 A;  3ILI A;  4YME A;  1U1N A;  2HGN A;  3NAH A;  4EGL A;  1Y3K A;  4GO5 X;  3AY0 A;  5EWF A;  2VA2 A;  1RGV A;  2IA0 A;  1SC6 A;  3KDN A;  2AWZ A;  2FHJ A;  4IH7 A;  2AD9 A;  4E0D A;  3ONQ A;  3CXC R;  2DXD A;  3DM2 A;  3V2U C;  1SH2 A;  3M30 B;  1REV B;  2GV1 A;  3F0N A;  3ILL A;  1ELO A;  3G82 A;  2NS1 B;  1KC8 T;  5KFR A;  4NXM F;  4C8Y A;  4X2B A;  4ZLJ A;  1LW2 A;  1R0A B;  1S0N A;  2E1C A;  5H9F K;  3DRS B;  3ITH A;  1VQ8 S;  1B7F A;  3AOA A;  2YBV A;  4Y65 A;  4C11 B;  5LJ3 Y;  3PFE A;  1N5Y B;  2HHS A;  1C2P A;  1HPZ A;  2MZS A;  3FBF A;  3KXD A;  3H25 A;  1WOS A;  3KLV A;  2QT7 A;  2L9D A;  3TA0 A;  3NG8 A;  1P1L A;  2BAN B;  4HH0 A;  1VQY A;  3W5X A;  3ZZU A;  3THT A;  2XGQ A;  1T05 A;  3CME S;  4ELT A;  4PRF A;  4QZV B;  3VCD A;  5RUB A;  1JB0 C;  1FKP A;  1S1X B;  4NRT A;  1TV6 B;  5A2Q U;  3V6J A;  1AT1 B;  1TL3 A;  1XER A;  1VIX A;  4F4Y A;  1HNX F;  3DI6 B;  5DRK A;  5DZ6 A;  5AJ3 J;  2QFJ A;  1WDD A;  5KT6 A;  5GAD I;  1RWN B;  2W7A A;  3MHY A;  5LMN J;  4JI0 F;  1KHW A;  2ZZM A;  1TL1 B;  2DY9 A;  1V3S A;  3S8S A;  1P9Q C;  2AEM A;  3HHD A;  3F56 A;  1X4D A;  3GLJ A;  2VC1 A;  2MQL A;  4MKB A;  3SCL E;  2UUC F;  2VB6 A;  3PXG a;  2R7S A;  4ZS6 A;  2RKI A;  2RRN A;  4DZ6 A;  1CJT B;  2FJE B;  3DRP B;  3L7O A;  4K4S A;  1HL6 A;  2KJW A;  3EIC A;  4UUW A;  1H74 A;  3G87 A;  2KKH A;  2AQ4 A;  4CCH A;  4OYI A;  3BH6 B;  3B82 A;  4FYY B;  4C8N A;  4NXM J;  2VFU A;  2F4F A;  3DOL A;  2C22 A;  2ZDP A;  1FCA A;  1WC3 A;  3DRR A;  1NK4 A;  1RCX B;  2OGU A;  4F50 A;  2P9C A;  4MIA A;  2F4V F;  1S0M A;  4ED4 A;  1SJ4 P;  3NOC A;  4LFC F;  4YP3 A;  1X5T A;  2IYG A;  4MKY A;  1ZS6 A;  4MT1 A;  4R0J A;  1BE4 A;  2KRR A;  3NBP B;  3KJV B;  1PJ5 A;  2GMJ A;  3FVY A;  2W9C B;  4ED0 A;  1TQL A;  2BJ3 A;  4FKX A;  2JLG A;  4WZQ A;  4NCG B;  1UAW A;  2HNY B;  4USK A;  1R31 A;  2J0W A;  1C0T A;  4Z7C A;  2WVE A;  5JJB A;  3CCV S;  3BSO A;  4PXB A;  4ETX A;  1HBU B;  1NZ8 A;  2DT9 A;  2OD4 A;  3GIR A;  4OX7 A;  4Y2I A;  4WTO B;  2JC0 A;  4Q2L A;  3R2C J;  3HMJ G;  3EX7 B;  3TR5 A;  4BBY A;  2IBK A;  3VGV A;  3R6L B;  4F67 A;  3G71 S;  5JVG Q;  4J9R A;  2DD8 S;  2MQM A;  1AYE A;  5GAG U;  2UXC F;  1CPZ A;  3M6X A;  1PG5 B;  2XY7 A;  1YBA A;  3HSZ A;  3JB9 k;  1NBE B;  2BJ8 A;  2QMW A;  5F8G A;  1R3N A;  2VFT A;  4MMO A;  2KYX A;  2HIY A;  4PAB A;  1FJ7 A;  4IRC A;  5B7W A;  1Q95 G;  1QSS A;  1AA1 B;  1HQ2 A;  3R5B A;  3NOG A;  3E01 B;  3IBF B;  1X5O A;  5B0E A;  3OTC A;  1WUU A;  3FRZ A;  5EHH A;  3M1V A;  2X3G A;  3KK1 B;  5HRO A;  5B09 A;  4MKV A;  4DR6 F;  2K7J A;  3BEG B;  1NDL A;  5CYQ A;  5CYJ A;  2YWW A;  2ZVI A;  1X4C A;  2BEF A;  2G0J A;  2MTL A;  3DRX A;  3C6T B;  4YR0 A;  4RUB A;  3QID A;  2MSS A;  2ROE A;  4HEA 9;  1TL7 B;  1S12 A;  1JLE B;  2B8Q A;  2C2K B;  2IM0 A;  4DG1 B;  4ZVP B;  3DXB A;  4LBI A;  2KTQ A;  1JLQ A;  2FD2 A;  4M94 A;  2D9P A;  5L1K A;  4ZVH A;  3FSX A;  3L95 X;  4LJM A;  5K14 A;  3UD4 P;  3P49 B;  1S9E B;  4U96 A;  1ULR A;  1QM9 A;  3TQE A;  4C2M A;  4AL7 A;  2DR5 A;  1WNE A;  2FVC A;  1HNV B;  2DHA A;  4K8R A;  3GQC A;  3H5S A;  2FJB B;  2HFV A;  1NXI A;  2QA2 A;  3IMQ J;  4NZ0 A;  4XDD A;  4A8O A;  3KUE A;  2OPP B;  4I64 A;  4OZ2 A;  3Q8P B;  1X60 A;  3IRW P;  3QT5 A;  2XMW A;  3RB4 A;  1J27 A;  3ADA C;  3LF0 A;  2DIS A;  2JOQ A;  5IV3 A;  4KGV B;  2NXJ A;  4MK7 A;  3LAM A;  1S4E A;  4X4P A;  1N4L A;  2ILY A;  1SBR A;  3DFE A;  3PO4 A;  4RUA A;  1AUD A;  3OXF A;  2EI5 A;  3I4H X;  3D0H E;  4FXV A;  2GFF A;  1RAI B;  4GRS A;  2DVI A;  3MEC A;  2C3P A;  3NWG A;  4USM A;  3GJR B;  3P96 A;  4LF8 J;  3MAA B;  2GGP B;  3B54 A;  2LQ5 A;  3EUN A;  2QV6 A;  3IM8 A;  1Y0H A;  5D0H A;  4TYB A;  5C42 A;  4LRD A;  1VBY A;  4N41 A;  1OPI A;  1RLC L;  3W64 A;  2VHG A;  3PW7 A;  4DV4 J;  4O3R A;  2QLX A;  3DKD A;  4ZVT B;  3FSY A;  1N6Q B;  1NPK A;  1TAU A;  4H4K A;  5EN1 A;  3EXC X;  4DOZ A;  3UVJ B;  5GAE I;  1J5E J;  3HKZ D;  1V5I B;  1T9Y A;  4I2Q B;  3ZZR A;  3HVW A;  1VQK S;  1VOM A;  2I5J A;  4QOT A;  1KLM B;  4ECX A;  3MXH P;  3QJP A;  2J8A A;  2I9S A;  2YY3 A;  2AMC B;  4NLD A;  1RAE B;  2W1B A;  2B56 A;  2FJA B;  3P3D A;  4FN5 A;  3PZP A;  3CUL A;  4BCA A;  5A8W A;  3HJV A;  5LXY A;  3M8S A;  1HBM B;  2R7Q A;  3CJ4 A;  4K7Q A;  1YJ7 A;  4ZKA A;  4ECV A;  4FP9 A;  1T9V A;  1S10 A;  4QPX A;  5K8O A;  4OHY A;  2MGZ A;  1Q8B A;  3G6V A;  3M8W A;  3W8P A;  1UVJ A;  5DDO C;  2VKR A;  3HVT B;  4ZVQ B;  2OP5 A;  2BE2 A;  3W60 A;  2BM1 A;  3QMQ A;  2XYH B;  1D8Y A;  1S1V B;  2W01 A;  2MY7 A;  2BJE A;  3I32 A;  3EDR B;  4KFB B;  3DDI A;  2JSX A;  3AAW B;  2D3O 1;  3R2D J;  2Z2L A;  3OHB A;  2WVF A;  1CJU B;  2K2P A;  5FLX U;  3VAH A;  1RE1 B;  3PIO Q;  1CUL A;  1IQZ A;  4F26 A;  4KJI A;  4PEO A;  3CCJ S;  2ALZ A;  1NLK L;  2VDH A;  2D9O A;  3DOM B;  2QE5 A;  4OHV A;  5KFE A;  2ZH5 A;  1PGZ A;  2IA6 A;  1PCA A;  4DV5 F;  2KO1 A;  1BWV A;  1RT3 A;  1HMV B;  3NAI A;  3OPK A;  5C42 B;  1S6Q B;  2RKI B;  4QWD A;  2MLZ A;  2QA4 G;  2XS5 A;  4OIX A;  4DUZ F;  2PA3 A;  5DG9 A;  1UZD A;  1HA1 A;  4DV6 J;  4FYD A;  4X84 A;  3GIL A;  2WSE C;  5L46 A;  3NNC A;  2KN4 A;  1PYS B;  4C11 A;  4B3R F;  2VPY B;  3V4M A;  2CQ2 A;  4A47 A;  3QZ7 A;  2O1P A;  4KKO B;  1KLN A;  1AZS B;  4QWB A;  4ZA1 A;  2P5V A;  5H9F J;  3A12 A;  2EBE A;  3OV7 A;  4IQX A;  4LF4 F;  3M9O B;  3D9B A;  2J6T A;  3SCI E;  4ANE A;  2AT1 B;  3MR6 A;  1RA7 A;  2MKS A;  4DV2 F;  3OW2 R;  1QSY A;  4JI4 F;  4B3O B;  1FKP B;  3SYZ A;  4RNN A;  1T9X A;  2FVQ A;  1YZ6 A;  5ETN A;  3KK2 B;  2V8V A;  1KQS R;  4DSE A;  3CC7 S;  2AKW B;  2Q66 A;  2ZIT A;  3PM9 A;  1WF2 A;  3AD7 C;  1S57 A;  4MTP A;  1FER A;  2PMZ D;  4U95 A;  5IZH A;  1IJF B;  1H3D A;  4FKY A;  1K1Q A;  2QGF B;  4IH5 A;  1RAB B;  2CQB A;  4OV1 A;  4ZVF A;  3SCJ E;  2WBM A;  3WX8 A;  4OV6 A;  4ZP9 A;  1UTA A;  2PEH A;  2HQC A;  3LP0 A;  3MR7 A;  3MAQ A;  2IVM A;  2OEJ A;  3EVO A;  4A8Q A;  3CC4 S;  3C15 A;  1S9G A;  2QSF A;  4KPC A;  4OI3 A;  2HFS A;  4KFB A;  1VJW A;  4JYA J;  3WC0 A;  4NLO A;  1IQT A;  3HT3 A;  2XMK A;  4ZVG A;  2CJX B;  2VZ9 A;  1FFW B;  1N5Q A;  2DNH A;  3TVZ A;  4E8U A;  5CCM A;  1TUG B;  5J1E B;  5DQG A;  4OX9 J;  3H5X A;  2LXF A;  3V81 A;  3NP5 A;  2MLY A;  1WC6 A;  3NKY A;  4RBU A;  4Q8E A;  1RTJ B;  1T11 A;  2C3O A;  2MPU A;  3M2V B;  3MMJ A;  2HBR B;  2HZA A;  3SFU A;  3T1A A;  4J9L A;  3HVR A;  5J2Q A;  2EFN A;  3OSP A;  1NSK L;  5F8J A;  3DRR B;  4HAC A;  1NSP A;  2QLW A;  3E01 A;  2HRU A;  3CVK A;  2R7U A;  2OD6 A;  3E8O A;  1IBK J;  1D9A A;  2FJX A;  5E3C A;  3K89 A;  4QU6 A;  4DS4 A;  5D8H B;  3WC2 A;  4FVC A;  2PFF B;  1LW0 B;  1RXO B;  2CQP A;  3IXQ A;  5M2R A;  3MFH A;  1M5K C;  3NGT A;  3PYF A;  5KT5 A;  1D09 B;  2XYG B;  4USW A;  3MEE A;  5KG4 A;  4CM2 A;  5FJ4 A;  3W5Y A;  2XI3 A;  3AJD A;  1SIZ A;  3NCR A;  2HHX A;  3R6G B;  1JLA A;  1G7C B;  4M5G A;  3NXZ A;  4O3O A;  3UNY A;  3MCM A;  5DDR C;  1ITP A;  3MI7 X;  5IQ6 A;  5KFP A;  1YVF A;  5J1N A;  2WB1 D;  3PAC A;  2MY8 A;  1RWP B;  2ZD1 A;  2LA6 A;  3N79 A;  2KL8 A;  4PYA A;  3ZTR A;  1U45 A;  3QPI A;  2X1G A;  4Y28 C;  5GMK a;  2XLK A;  1HQU A;  1FE0 A;  4JI1 J;  4QIF A;  1NU4 A;  4PUO B;  1O5J A;  3PX0 A;  4RU9 A;  2JFK A;  5M2P A;  2J7K A;  2AJ2 A;  4KO0 A;  3KLG B;  2F4V J;  3EGZ A;  2IAJ A;  4UF4 A;  2V4Q A;  1ZAV A;  4KBI A;  3KJN B;  4LFC J;  4DV7 J;  2UV8 A;  2M70 A;  3LP2 B;  4WFY A;  3DOK A;  4I6Y A;  2V2Q A;  5D4N A;  5KOX A;  2C2E A;  2VOD A;  2DNM A;  2G2O A;  1HNV A;  3NGD A;  4NEY A;  2W4C A;  1YBT A;  2ZNZ A;  3AB2 B;  3FEX B;  4RPF A;  2BOA A;  1GXL A;  4B3M J;  1QSL A;  4PWW A;  2EFQ A;  5JUM A;  4RWW A;  3BGF A;  1VBK A;  3CCQ S;  3LTO A;  3W9H A;  5C24 A;  4P2S A;  1XNQ J;  2FLN A;  4MYT A;  2L08 A;  3A1Y G;  3CSK A;  3QNW B;  3WDO A;  2EEY A;  4DF4 A;  2J9D A;  3RAX A;  1TK8 A;  3ZZ0 A;  3UCG A;  2FDN A;  5F8H A;  1TFW A;  1F0X A;  3PCO B;  2F3J A;  1RT1 B;  4OYO A;  1JJH A;  2L9N A;  2RUG A;  3W3S A;  3MM9 B;  3N4W A;  3O3L A;  3HHL A;  3BYR A;  5L1J A;  3PW4 A;  1VC0 A;  5EWE A;  4Q8F A;  4LUB A;  3H40 A;  1HWI A;  4I4B A;  2XI2 A;  2KXF A;  5D4P A;  4IOB A;  2RVJ A;  2HHW A;  3LP1 B;  4Y34 A;  3L3C A;  5DGB A;  1VC6 A;  2BZ2 A;  1X7V A;  5IT0 A;  2ZKU A;  4NL5 A;  3FMB A;  4NML A;  5CZV A;  3DMJ A;  1AB8 A;  1YIJ S;  4X4R A;  4WP8 A;  1VC5 A;  1HHT P;  2UV8 G;  3QBC A;  2WSC C;  3PV8 A;  1RKJ A;  1DJ0 A;  1UEU A;  2ZC3 A;  5LMU J;  5DLF A;  3RYL A;  1LXN A;  4DU7 A;  2GS8 A;  4NLS A;  4W4M A;  4ZVO B;  3TA2 A;  1IBC B;  2MJU A;  3LAL A;  4R5P B;  1HWJ A;  5DET A;  2ZJR Q;  3H4D A;  3Q2S C;  1FWL A;  2L48 A;  1HBN B;  1I6J A;  1VGY A;  2D69 A;  2HIQ A;  3SSS A;  3H4B A;  2ZM6 J;  3DU5 A;  4RX6 A;  5KFW A;  1U6F A;  3O8W A;  2GGP A;  5K9F A;  3TZZ A;  5GMD A;  4JI7 F;  3NBP A;  1FF2 A;  2V5H G;  3UW1 A;  3BSN A;  4MKA A;  1KSP A;  1RTH A;  3MEG B;  1NJW A;  3ZZZ A;  2ZOF A;  5L1I A;  1N33 J;  4P75 A;  1GT8 A;  1Q8L A;  3JAM U;  3MUV P;  1JWW A;  3H0P A;  3KLF A;  1RHM B;  3SIP B;  4JV1 A;  1F6T A;  2P6S A;  1GTH A;  4OI4 A;  2VIH A;  4U7U D;  3RBD A;  3LW5 C;  1RLD A;  2K7K A;  4HI2 A;  4HLB A;  4X66 F;  2HQ3 A;  4Q5V A;  1UKU A;  1ZM9 A;  3J7Y I;  4ZP6 A;  3H2V E;  4IKA A;  1Z4U A;  4RO0 A;  1KP6 A;  2FHM A;  1KQG B;  2IVY A;  1VQ6 S;  3T1H J;  4ER8 A;  4ZPT R;  2HKE A;  2J0X A;  1DRZ A;  3KNA A;  2CPZ A;  1S4F A;  2ZHO A;  1JXE A;  3JYT B;  3HHL D;  5H9E J;  4P74 A;  1MU2 A;  3DOL B;  4P2M A;  3SV4 A;  2IIH A;  2YNI B;  4DR3 J;  1FDA A;  1RWX B;  3TAQ A;  4P7T A;  4WF9 Q;  4J90 A;  2I0X A;  2YTC A;  2C2M B;  2RQ4 A;  2LEP A;  2MQ8 A;  3Q8Y A;  4CM0 A;  2IBO A;  3HVA A;  5L9N A;  5E0O A;  2H5J B;  2F7V A;  3BBB A;  2BE2 B;  2VPW B;  3H5U A;  1DUR A;  2EKY A;  3IP0 A;  2OPR B;  1NPP A;  3JTP A;  1S1V A;  3K5P A;  4OYZ A;  2DO0 A;  5KTQ A;  5KFK A;  3G6E S;  4IRD A;  3MTK A;  1O51 A;  2B8P A;  2RQK A;  5LL6 d;  3ZZO A;  1OYD A;  3IBC B;  2OSQ A;  3PEJ A;  4HTJ A;  2C28 A;  1RT4 B;  3QYY A;  2YX4 A;  5ETO A;  3W9I A;  2V4R A;  1B3T A;  2FY1 A;  3R5G A;  1TFY A;  2VOP A;  4ZVR B;  4ATN A;  1YRX A;  2YNF B;  3SSQ A;  3NCQ A;  3ZFV A;  1SH3 A;  1XIQ A;  3PTW A;  4YY3 F;  1U1K A;  1NKC A;  2M9K A;  4I56 A;  1UWA A;  1HW8 A;  1IBL F;  3KLI A;  2FJW A;  1UEV A;  2Y0S D;  1RDR A;  3GB0 A;  1C1C B;  1E6V B;  3BGR B;  3CJ5 A;  4CO4 A;  1F60 B;  1KWM A;  4HVZ A;  4WE1 B;  5F3T A;  2IJF A;  1TK0 A;  4V19 X;  1O6X A;  2IM2 A;  1HQE A;  4FBT A;  5FDL B;  2QIF A;  1MMD A;  5T7L A;  2E1A A;  3C16 B;  2FZG B;  4DV5 J;  2MYF A;  5KG1 A;  2ERR A;  1YG0 A;  2XO6 A;  4QCL A;  4I7F B;  2FLO A;  1RWV B;  3EM1 A;  4G6V B;  1S1U A;  4USH A;  4CLY A;  3M1V B;  1Y00 A;  5HRO B;  4GC7 A;  1OQ3 A;  5DM7 Q;  4B3T J;  4JI6 J;  4X65 F;  4F3M A;  2B4P A;  2J8S A;  4EUV A;  3MFI A;  4O3S A;  2WK4 A;  2M3D A;  4G65 A;  5J2Q B;  1RBO B;  3GFH A;  2DGS A;  5AT1 B;  4OL8 A;  1RT7 B;  1IKX B;  3FKB A;  2CPI A;  1FNX H;  2YNI A;  1KR4 A;  1FTC A;  1UP1 A;  4HAC B;  4WFB Q;  3OL9 A;  2W2O P;  3KJQ B;  2I2Y A;  3UR0 A;  4DUZ J;  1TUW A;  5F3Z A;  3H42 A;  1FI4 A;  4OI6 A;  4A8M P;  2FLP A;  2HHV A;  1GNK A;  2GC8 A;  4WU2 A;  4LT6 A;  5IV4 A;  2OPP A;  4TKT A;  1R6Y A;  1T02 A;  2YWK A;  4IUF A;  1JMT A;  1Q8K A;  1WHV A;  3C8Y A;  3HLU A;  1LW2 B;  4NLP A;  1A9N B;  2RT3 A;  2ASJ A;  4YY3 J;  2H1Y A;  2IPO B;  5LOQ A;  2COL A;  3KUG A;  5THW A;  1A6L A;  2YX7 A;  2ZE2 B;  1NDP A;  1IKY A;  1P1T A;  2DK2 A;  2EK1 A;  3MM5 B;  2PI5 A;  4HHU A;  3IAM 9;  4UY8 5;  3OL7 A;  1VS3 A;  4ED8 A;  3GP9 A;  5IT9 U;  1WHX A;  5J1P A;  3DNC A;  3HSG A;  2VL1 A;  3M2R A;  3H2U B;  4XO0 A;  4LRE A;  3Q86 A;  1I5O B;  3CCU S;  5IT9 Y;  3I0S B;  4X4U A;  3KLE A;  3GZ7 A;  3F44 A;  2LDI A;  1UPP A;  3QRR A;  2IDL A;  4BLG A;  3IWN C;  1S49 A;  4LR8 A;  2FHO B;  4MIW A;  4OZ0 A;  2C3U A;  2MST A;  2CJY B;  2V34 A;  4QR0 A;  1VQ7 S;  3ENV A;  2EC0 A;  3ZC4 A;  5J2P A;  4QW9 A;  1T9T A;  2AV5 A;  3PVX A;  1VRU A;  2OMO A;  2CG8 A;  1U2F A;  2EC2 A;  3LUY A;  4U8Y A;  2IVF B;  3MMC A;  4WP9 A;  1EZZ B;  4O4R A;  4W90 B;  1VI7 A;  4WWS A;  4WP3 A;  4L72 B;  4NI2 B;  1VFJ A;  2JLF A;  2MHE A;  5BJR A;  4GKK J;  3U02 A;  2V8D A;  5AXN A;  2XY6 A;  2W8K A;  1X4B A;  4JV2 A;  4MFB A;  2GVD B;  2N3O A;  2OTL S;  3ZZY A;  2Z30 B;  3HZG A;  4LMZ A;  2VQE F;  3DHX A;  3GJT B;  4YB6 A;  3UDL A;  2KM8 C;  2W2M P;  1EJ7 L;  2SXL A;  3BB5 A;  4LF5 J;  1QVF R;  2FQQ B;  4X4V A;  1R8C A;  5C5J A;  1YJU A;  1FX2 A;  4M5D B;  3CCL S;  3FRY A;  3QSY B;  2HVZ A;  4DL7 A;  4Q44 A;  4TU7 A;  2XSJ B;  3M8Z A;  2EW9 A;  4X64 J;  1S9F A;  1NM2 A;  4O0I A;  1HI8 A;  4LSL B;  2YXL A;  1NHK L;  2IM3 A;  4Z7Y A;  2Z2Y B;  3A13 A;  2DHS A;  2H65 B;  4FZV A;  1VQO S;  5IOL A;  5K8M A;  2MGZ B;  2LP4 A;  2XZT B;  3V6D B;  1QE1 A;  2DHX A;  1GX5 A;  3CJ2 A;  1U1M A;  4KR0 B;  2B4O A;  3UDC A;  5BYQ A;  2BUN A;  4NYO A;  2HLU A;  2WCX A;  4PG5 A;  5DZ7 A;  2Z58 B;  2W9B A;  5CD4 H;  2HAF A;  2V6A A;  4H4M B;  3OJS A;  4DR1 J;  3DOM A;  1SI9 A;  3RR8 A;  2BQR A;  1DAR A;  2QLB B;  1Y5L B;  2BE7 D;  4L3K A;  4K5R A;  1KVJ A;  2L9W A;  1VIS A;  4WJB A;  3AJ1 A;  3OT9 A;  1M0S A;  5KFU A;  1BQM A;  2MXY A;  2ZH6 A;  1DY3 A;  3JS9 A;  4B9U A;  5EUH A;  1PO6 A;  3W1Y C;  5KG7 A;  2DIV A;  4M5J A;  4HT7 A;  1XNQ F;  5G0R B;  3CDE A;  5E33 A;  4IFY A;  2G2Y A;  1FA0 A;  3MTJ A;  2G4B A;  3M8P A;  1RTH B;  5HO4 A;  3IGN A;  3UCZ P;  3CJK A;  4YUD A;  2ASY A;  2GO8 A;  2GCF A;  3OVA A;  1Q7Y T;  1MWY A;  1NO8 A;  1FK9 B;  2V0N A;  2V69 A;  1WC4 A;  2B9Y A;  2CVI A;  2XZD B;  2WVD A;  4MFB B;  3QFW A;  2NPI A;  1SJ3 P;  2CWK A;  1X9W A;  3MM6 A;  2CFX A;  4P9S A;  5KFA A;  3T5J A;  5IXU A;  2W7O A;  3BRE A;  1RAG B;  3IS9 A;  2RAQ A;  4EYI B;  1X5P A;  2H51 B;  4ED3 A;  4HI1 A;  2IRY A;  1DAX A;  1GXT A;  1NCL A;  3FEY B;  4YN3 B;  4CIO A;  5AJ3 F;  3NS5 A;  4D3G A;  1YRU A;  2CVE A;  3EGN A;  1U0S A;  1TEL A;  4FPI A;  1S97 A;  1VK8 A;  2R7T A;  2K3I A;  2V8G A;  4DN9 A;  1FKO A;  1SJQ A;  1RCO B;  2CPY A;  3MDF A;  4LF4 J;  2EXU A;  1RT2 B;  4NLQ A;  2C2N A;  1YBU A;  2JLE A;  2ZM6 F;  1WHW A;  3EVM A;  2G1D A;  1RU1 A;  3NWR A;  1DZ5 A;  1HHQ A;  3V81 B;  4KGX B;  2O01 C;  2OI2 A;  4AT1 B;  1X0F A;  3AB4 B;  2OLW A;  4F3Q A;  1MW7 A;  2AYB A;  2YWG A;  3IC1 A;  3M8Y A;  5LMU F;  1VRQ C;  2HBY B;  2FVS A;  3OTE A;  1FVQ A;  4PUO A;  4N77 A;  1YZ7 A;  2QL9 B;  4OZ3 A;  4DR5 J;  4G1Q A;  4LRF A;  2DNN A;  4P7V A;  4WE1 A;  3MAH A;  5J1E A;  5BR8 J;  1SKR A;  4F0K A;  2F1F A;  4JP8 A;  3HK2 A;  3KLI B;  2M5Y A;  3CMA S;  2I38 A;  4X66 J;  3CIZ A;  3NEK A;  3SQG B;  3SZ2 A;  3HI9 A;  3M8P B;  1VDH A;  4FYW B;  1BMQ B;  2ADB A;  4I7F A;  4XAK A;  2BJ1 A;  1HD0 A;  4M8L A;  4ZCI A;  1R0B G;  3EDQ B;  2JFD A;  4LR7 A;  1S77 D;  4WZM A;  5T7L B;  4IO1 A;  3VF0 B;  4DLE A;  3Q8S B;  3O6Q A;  1B0P A;  5MLC V;  5A0Y B;  1YIT S;  2PI4 A;  2VOO A;  2QYC A;  4P72 A;  3OBI A;  3KUH A;  4OX8 A;  3T19 A;  1L3S A;  1U8S A;  1Y5I B;  2NXC A;  4HTI A;  2UVU A;  1RT4 A;  5IC6 B;  5DDP C;  2B7C B;  2YKN A;  3TRG A;  2K1R B;  2HHH J;  4ZK7 M;  3CJ0 A;  2X3D A;  1I94 J;  4RLE A;  4CLU A;  1N5T A;  3D6F B;  4Z37 A;  3Q24 A;  4DL2 A;  1KQK A;  1FEE A;  2H4Y B;  2WW4 A;  4AYB D;  4X4T A;  2AGP A;  5D4O A;  3PFO A;  3EPI A;  1YDL A;  1RHR B;  2VC0 A;  3OL8 A;  4R8U A;  3VWS A;  2GA7 A;  5CQG A;  5IWA F;  3O2I A;  2OJ3 A;  2VIC A;  3CCT A;  3QAT A;  3BSC A;  1H2U X;  4RNO A;  5DDQ C;  2Y1L B;  5E3R A;  3GR0 A;  3A3N B;  2W24 A;  1F5C A;  3CJ8 A;  3T9Z A;  1FJC A;  2K3K A;  3IG1 B;  4EZ9 A;  2VKZ G;  5HAN A;  3BQ1 A;  2RU9 A;  2E5L F;  1UVK A;  3D0I E;  5F8L A;  5CD4 A;  4USJ C;  2FJD B;  3QLH B;  3BBF A;  2V2V A;  1UEK A;  4RBT A;  3HO1 A;  1ZA1 B;  4J7C A;  1Q0N A;  1YKW A;  3VZI A;  1FJG F;  3MOZ A;  2HHQ A;  1WD6 A;  4A46 A;  1AW0 A;  4JI2 F;  3KLH A;  1UW9 A;  1LNQ A;  5KFT A;  2R4F A;  1OSD A;  2RS2 A;  1TKT B;  1NHV A;  3SMZ A;  1S76 D;  2B5J A;  3MEG A;  3P5B P;  3U27 A;  4DV3 F;  2XNR A;  2Y8W A;  2VG7 A;  2CJA A;  4DPU A;  2UU9 F;  3S1T A;  3QAE A;  2ASL A;  5E3A A;  3D4J A;  3K5N A;  2GIR A;  1W26 A;  2LDY A;  3FUY A;  3Q23 A;  3HP6 A;  2K06 A;  1R43 A;  2U1A A;  3QT7 A;  3I4P A;  4LFB J;  2PO4 A;  1C4A A;  1VLY A;  3BQ0 A;  2YNG A;  2KG1 A;  3DGP A;  5I3U A;  4JI6 F;  1UVI A;  1YGY A;  2GAG C;  4OHX A;  5U47 A;  2X1A A;  4C4W A;  2X1B A;  3A8J A;  1FRH A;  1PAU B;  2J6S A;  5D3G A;  2BW7 A;  5SUH A;  4CNY A;  4DX6 A;  4ZCM A;  5B08 A;  2DO4 A;  4A8Y A;  2K8G A;  4LFA F;  1YQH A;  3LGN A;  1NDC A;  2D1C A;  1M1K T;  4DR4 F;  1PBU A;  2HYI B;  3RB6 A;  2ZBQ A;  2Y0B B;  1R0C B;  3FCH A;  4UUX A;  4A48 A;  5D6G A;  4Q45 A;  1QD1 A;  3ZO7 A;  2NLW A;  3BPD A;  4W98 A;  3W2W A;  4QWA A;  1QY7 A;  1MWQ A;  4RUH A;  3NS7 B;  4J9K A;  2DPI A;  1VQ4 S;  2XQC A;  5L8R C;  4OJG A;  1J5E F;  4PCQ A;  1RHQ B;  2OH2 A;  2MHN A;  1YI2 S;  4HH1 A;  1G3O A;  1O8B A;  2HWT A;  3TO8 A;  2HFO A;  2UXD J;  3KLF B;  1MNE A;  3KNG A;  2DHH A;  2J6U A;  1UJ6 A;  4ID8 A;  2NSC A;  1H7X A;  2J9C A;  5E2Q A;  4DPY A;  4KV8 A;  1Q81 T;  2UXB J;  4XPC A;  1XTZ A;  2V63 A;  5HMX A;  4ZOS A;  3OQ2 A;  4YB7 A;  3POT A;  1GMW D;  2QZ8 A;  2Y3Y A;  4MIB A;  2FHJ D;  3M30 A;  4O3P A;  3DYA A;  3K8V A;  1LK5 A;  5HQL A;  1SKS A;  4CLS A;  1VJQ A;  2DH8 A;  4RJV A;  2XSJ A;  1GQE A;  3TAM B;  5ADZ A;  2V68 A;  3BBC A;  5KFD A;  2VQE J;  3N6L A;  4DR2 F;  4LF9 F;  1T03 B;  3P6Y C;  4HHH A;  1LFW A;  2C42 A;  2PDA A;  2PD1 A;  3D66 A;  4U7C A;  5I42 A;  2XO7 A;  2M8H A;  1NAQ A;  5I4M A;  1HIY A;  2BJ9 A;  2ZC4 A;  2PFD A;  3FCW A;  4DR4 J;  1M5O C;  3LGM A;  1T05 B;  1WDT A;  4DSK A;  1FRK A;  2OHD A;  2PC6 A;  3N5B A;  3KFW X;  5C25 A;  4DQS A;  2VON A;  4O44 A;  4UQT A;  2RDJ A;  1RT7 A;  4CRJ A;  5ITH A;  5ETK A;  3Q22 A;  1VLO A;  4EEY A;  2GVZ A;  1VIO A;  2CQD A;  3M6W A;  2V94 A;  4OHW A;  3D6M B;  4RW8 A;  1JLB A;  5GVQ A;  3IWX A;  4B08 A;  1MML A;  3T5H A;  1V3Z A;  2C2Z B;  3G4S S;  1H38 A;  4IR9 A;  1NK7 A;  2CNO B;  2IAJ B;  1X4F A;  3PX4 A;  4C0H A;  2VUG A;  1RHJ B;  1Z2L A;  2YKP A;  2F9J A;  3ZNU A;  1UFW A;  2OO4 A;  4QWC A;  3OL6 A;  3SFG A;  1F9H A;  3SV3 A;  4DFJ A;  4OI2 A;  4C8M A;  3KJV A;  2IY5 B;  2A2D A;  5A76 A;  1FJE B;  4QWE A;  2NXU A;  3CJK B;  3G6X A;  2DJW A;  3QO9 A;  2V8H A;  3I5C A;  4TQR A;  4DFM A;  4NEZ A;  1IWA A;  3O1L A;  1HQE B;  4GKJ F;  3DRY A;  2YNH B;  3KYL A;  2KFZ A;  2EG2 A;  3D67 A;  3V4I A;  4DR1 F;  3C16 A;  4NPO A;  4NZ7 A;  3DLH A;  4FF4 A;  5ETP A;  4LSN A;  5LJ5 Y;  4J9S A;  1VRT A;  1OWX A;  2XCA A;  3POT B;  5HL7 Q;  1HD1 A;  2GQQ A;  3MGJ A;  1Y10 A;  3U7J A;  3GMG A;  4CTA B;  3DYA B;  2VFR A;  3VTI A;  4DX5 A;  4RNF A;  2P8I A;  3EXY A;  4RW6 A;  2KXN B;  2YWE A;  4F0M A;  3I0R A;  1IKX A;  2H3E B;  2AGQ A;  3ISZ A;  4JV0 A;  3TX0 A;  2KJV A;  2VBW A;  2E5J A;  2AZ3 A;  1RT2 A;  4ZPV R;  2C2D A;  3A8E A;  2PMH A;  4C9D A;  1PIL A;  3ILJ A;  1XQI A;  4OX9 F;  4PAA A;  3MR3 A;  2R7R A;  4DV1 J;  1GXU A;  2IC3 A;  1CS4 B;  4ECY A;  3RRH A;  4N76 A;  5F41 A;  4O3N A;  4QIG A;  3KTQ A;  4WU3 A;  2AX1 A;  3BKF A;  4WYW A;  1RT6 A;  4NLU A;  5GAE U;  2DNG A;  3OXG A;  1IUJ A;  2BKN A;  2CYY A;  1JLE A;  4DG1 A;  1UPM B;  2NR0 A;  3QZ8 A;  1FNM A;  2AU0 A;  1PIE A;  2CZ9 A;  5EX0 A;  4OHZ A;  1KON A;  4P6Q A;  4TU9 A;  1W2B R;  1LKZ A;  2AP6 A;  4Y3C A;  4C3L A;  1DTQ B;  2WHO A;  3BSA A;  1UET A;  2YWF A;  3V6K A;  3J7A 1;  3ELH A;  3UFC X;  4I6W A;  4AUK A;  1SV5 B;  2UUW A;  3GFY A;  1RTI B;  1TMM A;  3PW5 A;  3EZU A;  3JXO A;  4FF3 A;  3AD9 C;  3V6D A;  1SC1 B;  3CJQ A;  3HXM A;  2HND B;  3JSR A;  3R7S B;  3QQC D;  3CCW A;  2BE9 B;  4ZHR B;  2BX6 A;  2IJR A;  1SPB P;  2MZR A;  4TNO A;  4USI A;  4ZPB A;  1CSJ A;  2FJV A;  3Q83 A;  3HD2 A;  4K59 A;  1FRL A;  4CT9 A;  2W9B B;  3MR5 A;  1CQM A;  2AZ1 A;  2NRE A;  1UA0 A;  1C1B B;  4NA3 A;  3MMC B;  5F0W A;  1RTD B;  3TJ9 A;  4OYP A;  2DPJ A;  2OIH A;  1FT8 A;  2XMV A;  1SKU B;  1HBO B;  5HMY A;  1FXR A;  4NXN F;  2H48 B;  1WOP A;  1N8R T;  3EGV A;  2HWH A;  1UVN A;  1UJ4 A;  3Q2T C;  1KVI A;  1REV A;  1C0U B;  5H1S V;  4UY8 T;  4KGZ B;  3FCV A;  3UR3 C;  1A7G E;  4RNH A;  4DV7 F;  5KT4 A;  3KLH B;  2LXU A;  2BAB A;  2MZT A;  4DFK A;  1R0A A;  2JEF A;  4U6P A;  3R7B B;  2A10 A;  4C0O C;  4DL3 A;  2UUA J;  1KTV A;  1YLX A;  1H98 A;  1I1G A;  4GVL A;  4M5D A;  4EI2 A;  1S0O A;  1EET B;  2M0G B;  2RSQ A;  4USV A;  2N7C A;  3D68 A;  3GR1 A;  2HVD A;  3PRV A;  4ZCK A;  1BD6 A;  2IRU A;  2RU3 A;  4B3T F;  2MZJ A;  3CJT A;  3ILO A;  3DRS A;  3AXK A;  3ITH B;  4PWU A;  4CQ1 A;  1U8W A;  3AA9 A;  1CC8 A;  3MCO A;  3TEG A;  2GAH C;  4ZVS B;  2R8H A;  1VQ5 S;  2DGW A;  3RGI A;  5J2M B;  1QAY A;  1L3U A;  4X64 F;  1WC1 A;  3EJM A;  3OR2 B;  1KTQ A;  2WOM A;  2Z57 B;  2RRB A;  2OKQ A;  4PXC A;  2CXE A;  2UVW A;  3ET6 B;  3M6U A;  3HHL C;  4PPD A;  3VGS A;  1VCT A;  2VG7 B;  1JLC A;  1SUQ A;  2ADC A;  1D9D A;  1TL4 A;  2ZZT A;  4ECT A;  3QGP A;  5JVH Q;  5IT4 A;  4GKK F;  2M8D B;  4YHH J;  2B7B B;  1NJI T;  1C1B A;  1S6P B;  4CO1 A;  4CT8 A;  2NQP A;  1ZZF A;  2Z2M A;  5ETR A;  2RF2 A;  2U2F A;  3RTV A;  4QR1 A;  2UU9 J;  4ED5 A;  1SXL A;  4DHV A;  4CP5 A;  2W2Q P;  3CDB A;  5HMW A;  5DS7 A;  1X31 C;  2WZ1 A;  4WXW A;  5LT5 A;  5KFH A;  1WKL A;  1LWE A;  3HZE A;  3M32 B;  4OLO A;  4DL4 A;  1GX6 A;  4JI2 J;  5L1L A;  1ZYQ A;  2Z8Q A;  3TZW A;  4KH1 B;  3HPO A;  4DF8 A;  2RRA A;  2MKJ A;  3DCA A;  3UI3 A;  1SCJ B;  1RBL A;  3W9J A;  5KOW A;  4A8X A;  3W2V A;  1N32 F;  4M63 A;  1HFE L;  4FXD A;  1GTE A;  1HKA A;  2FUG 9;  1U0H B;  2YKM B;  3ENA A;  1RZM A;  5FII A;  5LSR A;  5DM6 Q;  3ZZP A;  4LFA J;  4F7V A;  4QIE A;  4ZLL A;  1OO0 B;  1MG7 A;  2HMI B;  2VG6 B;  3GTY X;  2Y9H A;  2FVR A;  1U6B A;  1FO1 A;  1IN0 A;  1UJ5 A;  3GIM A;  1FKA F;  4G1Q B;  3UN5 A;  4NLT A;  2KI2 A;  2BW2 A;  4HHJ A;  5HAT A;  2RQC A;  4M5I A;  3G6Y A;  2J0Q D;  3NMR A;  1RAF B;  2YH0 A;  2HS3 A;  4CI0 B;  3Q89 A;  2XLJ A;  1S7I A;  4G1I A;  2BR0 A;  4FBU A;  4MAK A;  1U2C A;  2A2C A;  4K4U A;  2ALY B;  4CWB A;  3TUP A;  2VD3 A;  1B0T A;  4NZ6 A;  1WC5 A;  2QTW A;  1Q16 B;  1XNR F;  2A6M A;  1PC5 A;  4F4W A;  2VV5 A;  3M9M B;  4ELU A;  4IOC Q;  3BDP A;  3DLJ A;  3KHG A;  2XBP A;  4I1T A;  1IR1 A;  1RTJ A;  1T03 A;  2HK2 A;  1HNI A;  1S6P A;  1RSC A;  4K4V A;  4UOG A;  1VRT B;  1YJ9 S;  3DDN A;  4ZN3 A;  1OY8 A;  4QU7 A;  3OJU A;  2UXD F;  1CQN A;  2NCK L;  5AXK A;  3N0V A;  2FC8 A;  4NA2 A;  2Z4P A;  3PHE A;  2CPJ A;  4I6A A;  5C25 B;  4I2P A;  3SDE B;  2D7S A;  4BC7 A;  3SI8 A;  1TKD A;  2JC1 A;  4B3S F;  1J5O B;  3R8Y A;  2GVZ B;  4A8K A;  3IN5 A;  4OJ3 A;  5C2G A;  3D28 A;  3MED A;  1JLA B;  3RG6 A;  5LSL A;  3UD3 P;  3RUB L;  2CJ9 A;  3AFG A;  3M9N B;  4R25 A;  1NB2 A;  2MKI A;  2V2K A;  2BV3 A;  1CS4 A;  3NY0 A;  3RW6 A;  1NPR A;  2ZOM A;  1T0T V;  4AE5 A;  2A1B A;  4ZVU B;  3IG1 A;  2HHH F;  2ZFH A;  3J7A N;  4TLQ A;  2HHT A;  2HNZ A;  2BJD A;  1TP7 A;  1XN9 A;  1IM4 A;  1WOO A;  2NSB A;  2V50 A;  4GVB B;  4LVO P;  4PG6 A;  4QR2 A;  4F04 B;  5HMZ A;  3MM8 B;  2DRA A;  1TUV A;  1XNR J;  1KOO A;  1OIA A;  4JI8 F;  3OUY A;  1E6Y A;  2EPI A;  4EBD A;  1WG1 A;  4H4M A;  3OLB A;  3TAR A;  1WWH A;  1H6K X;  2IFX A;  3KHR A;  1TKT A;  3ZNJ 1;  2VBX A;  3M8Q A;  4ED7 A;  3K57 A;  3M7V A;  5CZX A;  2P9E A;  5LSO A;  3PKY A;  1FRM A;  4UOC A;  3D1H A;  3DLE A;  2YKO A;  1DTQ A;  4WKY A;  5KFY A;  4ZHR A;  2BOP A;  2CZV C;  4JUZ A;  3VVU A;  3X3U A;  4BC9 A;  1ZTT A;  1U1O A;  4K4Z A;  2ZWP A;  3BDE A;  1KKH A;  2HSE B;  1NK8 A;  3VAL A;  2OEL A;  4TN2 A;  2DCL A;  3TUI C;  5I3U B;  2VQF F;  4KGM A;  4KIA A;  2A3J A;  1U49 A;  2DGO A;  4U8V A;  3ULH A;  2FGO A;  4DR5 F;  5CAA A;  1XMO F;  4ZMM A;  1WSR A;  1S59 A;  1TTH B;  4EYH B;  1ZTW A;  3QAU A;  2VDI A;  2PEB A;  3TEH B;  7AT1 B;  2X1F A;  2L3M A;  4IFV B;  4EBC A;  2LEC A;  3D1O A;  3G8S A;  4CYU A;  2JHE A;  1T9U A;  3VVT A;  1UA1 A;  4PR6 A;  3LP1 A;  2KT5 A;  1HBO A;  3LWL A;  2YKA A;  1NSQ A;  3OR1 A;  1WF1 A;  1CJK A;  5ETS A;  1Y11 A;  4C8Z A;  5FD1 A;  3LP2 A;  1D3W A;  1YWX A;  2GX8 A;  2IDE A;  3FQK A;  4IO9 Q;  3TQ1 A;  3C19 A;  4E98 A;  4AFF A;  3I87 A;  2X7I A;  3V6H A;  4DV6 F;  4DQI A;  1FDD A;  1NSA A;  2VPZ B;  1TVR A;  1KNZ A;  4LRA A;  2AJQ A;  1SJF A;  4ZPA A;  5CA5 A;  3PX6 A;  4DV1 F;  4TLR A;  2ZNY A;  3DMJ B;  5IM0 A;  3K5L A;  2GQC A;  1DQ8 A;  2R42 A;  1G2E A;  2DXE A;  2HFN A;  4RBV A;  2Z2Z A;  3GIJ A;  2MKC A;  2PT0 A;  4ITS A;  1K73 T;  3P5T L;  1WKJ A;  4ZDN A;  4DV0 J;  3P4U B;  2E1M C;  1TU0 B;  1WOR A;  3ENQ A;  3OFF A;  3IAS 9;  5KFC A;  4DQR A;  3N01 A;  2GHP A;  1HMV A;  1QVG R;  3MPY A;  4PXD A;  1GMV A;  1FE4 A;  2E1R A;  4B9L A;  3M05 A;  1S1T A;  1RT1 A;  3V5R A;  3K8W A;  4RNM A;  1BXN A;  1JLF A;  5B0F A;  1R8H A;  4JOU A;  2KT3 A;  3NRB A;  4GO7 X;  3J81 U;  4DXL A;  2J7U A;  2F8E X;  2FZC B;  1EAY C;  4RR5 A;  1X0P A;  3JTO A;  3AA8 A;  4F4X A;  3CO9 A;  2YNH A;  4KB7 A;  4IR1 A;  2E5L J;  3OSN A;  3MUM P;  2CQC A;  4LR9 A;  5KFG A;  4PPZ A;  1LWE B;  2Y1R I;  2YKQ A;  4FPR A;  3Q8R B;  2R7W A;  1LWC A;  4K4X A;  2J5A A;  2ZH3 A;  3TA1 A;  2ZUA A;  3ZTP A;  4KH0 B;  3MD3 A;  2RJZ A;  5AE2 A;  4RW8 B;  1W7W A;  2RF2 B;  5KT3 A;  4K0K F;  3RAQ A;  3FFI A;  3EE3 A;  4KHR A;  3VV2 B;  1N34 J;  3ICL A;  1PAE X;  3GV7 B;  3CT9 A;  3FDS A;  1S1W B;  2XMA A;  1M90 T;  2V2Z A;  3OTO F;  1UZH A;  2VBY A;  3LGH A;  4CO3 A;  3K58 A;  2OML A;  4OYW A;  4C8L A;  1WKK A;  3HD1 A;  4R8U B;  3WX4 A;  3W65 A;  4CLW A;  3PRD A;  1QE1 B;  3TWZ A;  2Z0G A;  3KHL A;  4QJV A;  2KM8 B;  1OY9 A;  3CDU A;  3QT8 A;  1A0O B;  3GSD A;  1S9G B;  2MQO A;  5SZT A;  2MDA A;  3UN3 A;  2ACY A;  4M5M A;  1VYA A;  2FYX A;  2YX1 A;  1UL3 A;  2MZ1 A;  1VQM S;  1S99 A;  1KRP A;  5KAK A;  3HKW A;  1V9O A;  2DR6 A;  2GW8 A;  3CE8 A;  2VF3 A;  3NGR A;  1DLO A;  1Y4Z B;  3PYD A;  4K4Y A;  4CH7 A;  3M32 A;  4LF2 A;  4YQW A;  4ICL B;  3M4X A;  1MU2 B;  3VGT A;  1FX4 A;  1SKW A;  5A2Q Y;  2ASD A;  1NK5 A;  3CD6 S;  1IM6 A;  2FY8 A;  1HLW A;  2DNR A;  2XWX A;  2F8H A;  3EGW B;  1LOU A;  2CAJ A;  4K5S A;  3BJY A;  1TK5 A;  4HKQ A;  3A4T A;  1QUP A;  4LQ3 A;  1U0H A;  4K0K J;  2W25 A;  4B02 A;  4L76 A;  5K20 B;  1HYS B;  1PBA A;  2R8K A;  2OPQ B;  1M5S A;  4RWX A;  5HBM B;  5M2U A;  1F3V A;  2AGO A;  2E5I A;  1NJY A;  4B9S A;  1VR6 A;  1Y7P A;  2BVZ A;  2DIU A;  2AJF E;  3B78 A;  3GCW P;  1RTD A;  2CUY A;  4NXN J;  1IBM F;  5K8P A;  3MMA B;  3ZZT A;  3P45 B;  3NMA A;  5DQH A;  4PWD B;  1N88 A;  1U24 A;  1TAQ A;  3GG1 A;  1CJV A;  1UWB B;  2IRX A;  2XHW A;  2ZWO A;  3H98 A;  3UE2 A;  4DR2 J;  5DG7 A;  2MLX A;  1RT5 B;  2XMU A;  4ELV A;  3GIK A;  1HWL A;  4PQU A;  3TP2 A;  5HP1 A;  1S6O A;  4KGK A;  1RBA A;  2DKO B;  3SCK E;  2MKK A;  4DDF A;  3R3T A;  4OZL A;  5CAB A;  3RB3 A;  2D3O R;  1FWP A;  3MPV A;  3KJF B;  4HT5 A;  1T9W A;  3I0S A;  4B9V A;  4NRU A;  2BQU A;  5IC4 B;  4XDC A;  2N3L A;  4DV4 F;  3K5M A;  2DYA A;  3CPW R;  2QA1 A;  4U9R A;  2XLI A;  1CUL B;  2BDP A;  4EMD A;  2DHG A;  1MN7 A;  2QFI A;  2ZHA A;  3JTN A;  1M5H A;  2JEG A;  3EYZ A;  2C3Y A;  3AT1 B;  2VJU A;  4K2J A;  3TVY A;  2GJF A;  1KFD A;  1S5Z A;  3CUN A;  2GIF A;  3LH2 S;  4LF7 J;  4C6A A;  3WQP A;  1Q5Y A;  2WRM A;  3GON A;  3MPW A;  1OS5 A;  1OY6 A;  1UMJ A;  3IFE A;  4QYR A;  3HM9 A;  2XB2 D;  2HS4 A;  3HCX A;  3CNQ P;  4OMF G;  5J2P B;  5E41 A;  3J81 j;  2WVB A;  4UOF A;  3AOD A;  2YKN B;  2J7W A;  5D0G A;  4KY3 A;  3S6E A;  5F8M A;  2BRK A;  3I96 A;  1HNW J;  4DUT A;  3CDA A;  4GVB A;  1Q82 T;  4C8K A;  4N8O A;  4DZD A;  1EKR A;  3DM2 B;  1YHQ S;  2GJI A;  3GPA A;  2W4P A;  5IFM A;  1MWZ A;  2YWH A;  2MKH A;  3I9V 9;  4ILR A;  4L6V 3;  5GME A;  3VAG A;  3HHN B;  3RU0 A;  2Q1L A;  1TMJ A;  3BGO P;  3LAK A;  1SVD A;  5HLF A;  4X62 J;  4DL6 A;  5KG2 A;  2E7W A;  3P8B B;  2C3M A;  1RWO B;  4LSL A;  1RQ0 A;  3BQ2 A;  3ZXW A;  5CXT A;  2CDQ A;  2OEM A;  3UD5 A;  1U47 A;  4B9T A;  4JI3 J;  1KN6 A;  5KG3 A;  2VA3 A;  1VQL S;  1EKS A;  2KFN A;  1OJ4 A;  1WSV A;  2CQ3 A;  4URQ U;  4A8W A;  5L38 A;  2WOM B;  3NNH A;  2HQG A;  5I3Q A;  2RS8 A;  1S1X A;  2H54 B;  2HK3 A;  3D5M A;  1VK3 A;  4DMZ A;  1BY9 A;  2ZJQ Q;  2X51 A;  1XMQ F;  4DX7 A;  4Q0B B;  3AHP A;  5HVF A;  3SQO P;  4DN0 A;  3QJL A;  2LFV A;  3LQV A;  2ZBR A;  4UOH A;  3CD7 A;  3MEC B;  3BS9 A;  3OFG A;  1RAC B;  2KRB A;  2C1E B;  3DHW C;  3KWM A;  2DRB A;  5GAH I;  3R5C A;  4R0E A;  1N0U A;  1X4G A;  2H5E A;  2KHD A;  3L7P A;  4L74 A;  1JKH B;  1RU2 A;  3DN9 A;  4OYB A;  5E7O B;  1HI0 P;  4DQP A;  5GAG I;  2WON B;  3I82 A;  3BN7 A;  2P9G A;  3R5D A;  4N7T A;  2CPF A;  4NOH A;  1FEH A;  4BHQ A;  3QGG A;  1TKZ A;  3SEO A;  5KT7 A;  2ZJP Q;  1HNW F;  2DR9 A;  2CQI A;  2F40 A;  2RDD A;  3GYN A;  1RAD B;  1S79 A;  4UZC A;  5G4D A;  3HHE A;  2RHS B;  2M2B A;  2WW8 A;  2KH9 A;  3L7U A;  1VQN S;  1ZA2 B;  2HMI A;  2VG6 A;  1RWW B;  3H7H B;  4DSF A;  4JI4 J;  4W92 B;  2ZBC A;  2GHV C;  1RJJ A;  2IHR 1;  4S0M A;  4XK8 C;  5IM0 B;  2YKM A;  3EZ5 A;  3PHT A;  3GE9 A;  4FNH A;  2J9E A;  1RI7 A;  1U26 A;  2CPX A;  3BGU A;  1FRX A;  2HQI A;  1F3F A;  2EBG A;  1HNX J;  2UXB F;  1ZZN A;  1R8B A;  3PRB A;  4WBF A;  3LA0 A;  4DI6 A;  2RNE A;  5EDW A;  3H20 A;  3NS6 A;  3GSI A;  3BGR A;  5LMN F;  1TKX B;  2V9K A;  4FXW A;  2AEF A;  3RZA A;  3C14 A;  3JSB A;  5IWA J;  3Q0A A;  3BO2 A;  1BQX A;  2ATC B;  2VG5 B;  2XTJ P;  1V5V A;  1BLU A;  2ZOG A;  3CMQ A;  1RIS A;  3GU0 A;  3FBC A;  4M5L A;  5J2N B;  3RRK A;  3VZH A;  4DV0 F;  1FKO B;  3N28 A;  1T8E A;  2UUC J;  2N82 B;  4HDG A;  1K9M T;  4LF9 J;  4CO5 A;  2M52 A;  1SL1 A;  2E44 A;  4WTY A;  4LVN P;  4UQG A;  4P2X A;  3J7Y U;  5HVH A;  1IBK F;  2E9R X;  3I5A A;  2GJ2 A;  1UFL A;  4ED1 A;  3AXM A;  3HFZ B;  5LM7 E;  1IKV B;  2HG4 A;  2RUS A;  3PYG A;  3B4D A;  5KFF A;  2NXN A;  4DX8 H;  5BR8 F;  4XIU A;  4J37 A;  4DSI A;  1H0H B;  1JLG A;  1NDK A;  3OUY B;  2XNQ A;  1RT3 B;  3CD5 A;  2Z56 B;  2YQ0 A;  3FBB A;  4ID5 B;  1R6V A;  1NB7 A;  2UUT A;  1IR2 A;  2DEI A;  4YB1 P;  3RBE A;  1VQP S;  3OLA A;  3UCU P;  1LQ9 A;  3MD1 A;  4X4Q A;  2HVH A;  1ZPV A;  2CAD A;  4EFA C;  3IM9 A;  5KFB A;  2UUB F;  5ETM A;  2KG0 A;  3BV8 A;  3W62 A;  3K7R A;  4YHH F;  1LWX A;  3OVB A;  1MSW D;  2HNZ B;  2UVV A;  4Q43 A;  3JQM A;  4GKJ J;  5HQ8 A;  3CJS A;  1WI6 A;  4NYP A;  1KQF B;  3CCM S;  3DLG B;  4Y00 A;  1JIH A;  3HSJ A;  2HWI A;  2RHQ B;  2QL7 B;  5CYM B;  4WCE Q;  4C48 A;  1ARO P;  1N34 F;  2XYP B;  3SXL A;  4R5P A;  5F9L A;  1P6T A;  5A8K A;  5D15 A;  5I3P A;  2UP1 A;  2W9A A;  4PQU B;  1RWM B;  3RW7 A;  2KB2 A;  5AXM A;  4M95 A;  4QIW D;  1GMW A;  2VFV A;  2DNL A;  2JH3 A;  4LF6 J;  1F9F A;  3QO9 B;  1VRU B;  3K5O A;  3S01 A;  4A4J A;  1YSJ A;  2GO9 A;  3W61 A;  1L3T A;  2WAQ D;  2CJB A;  2J0S D;  4NI2 A;  3BKT A;  2OPS A;  4XPE A;  1SH0 A;  4MK8 A;  4Q7A A;  2FVP A;  1B0V A;  2YQ3 A;  2D41 A;  3J7Z 5;  2DB1 A;  3C6U A;  3PYE A;  3T41 A;  4CDI A;  4YFU A;  2IM1 A;  1ZAW A;  3HSD A;  4BWM A;  2DY1 A;  4LF5 F;  3WIU A;  3BM7 A;  1HNZ F;  1QTN B;  1CEZ A;  1YJW S;  5D77 A;  1PYT A;  4B3M F;  3NNA A;  1SC3 B;  1KBR A;  1NHU A;  5KFS A;  1R8A A;  4TXS A;  1EHW A;  2LU2 A;  2QX0 A;  2V8P A;  4M5K A;  3MEE B;  1CJV B;  1KVK A;  2VU5 A;  3A3O B;  4QW8 A;  1JX4 A;  4KTQ A;  3EWG A;  1URR A;  4NLG A;  3WZ0 A;  2HZC A;  4O4G A;  2B5J B;  2JEI A;  1N5Y A;  1XR7 A;  1NH7 A;  2B51 A;  3BN4 A;  3LO3 A;  1JNZ B;  2LMI A;  5B0C A;  4YOE A;  3MCN A;  4RW7 A;  3PKM A;  2JWN A;  3JSY A;  4LSZ B;  3W66 A;  1Q86 T;  1FRI A;  2CA9 A;  4KHM A;  2G2Z A;  4QPT A;  2BM0 A;  1XR6 A;  4JI7 J;  4A8S A;  4LQ9 A;  3TX8 A;  1AXQ A; 
#chains in the Genus database with same CATH homology
 2YPY A;  4K2J A;  4UZC A;  1B3T A;  2YQ0 A;  5A76 A;  4UZB A;  2YPZ A;  4BLG A;  2YQ1 A;  1VHI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...