2HAFA

Crystal structure of a putative translation repressor from vibrio cholerae
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
185
structure length
185
Chain Sequence
b'SDIEVGHSMNLTNHFLVAMPSMKDPYFKRSVIYICEHNQDGAMGLMINAPIDITVGGMLKQVDIEPAYPQSHQENLKKPVFNGGPVSEDRGFILHRPRDHYESSMKMTDDIAVTTSKDILTVLGTEAEPEGYIVALGYSGWSAGQLEVELTENSWLTIEADPELIFNTPVHEKWQKAIQKLGISP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative translation repressor
molecule tags Translation repressor
source organism Vibrio cholerae
publication title Crystal structure of a putative translation repressor from Vibrio cholerae
rcsb
total genus 45
structure length 185
sequence length 185
ec nomenclature
pdb deposition date 2006-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02622 DUF179 Uncharacterized ACR, COG1678
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1300 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits VC0467-like domains 2hafA02
3.40.1740.10 Alpha Beta 3-Layer(aba) Sandwich VC0467-like VC0467-like 2hafA01
2GZOA 2AJ2A 2GS5A 2EW0A 2HRXA 2DO8A 2MUIA 2HAFA
chains in the Genus database with same CATH superfamily
1Q8BA 3FVYA 2IBOA 2LKZA 4ECQA 4F8RA 2V50A 3GCWP 1XMOF 3H2VE 2MKJA 1DHMA 2AYBA 3MEKA 3KJVA 4DV2J 4ED8A 4CDIA 2B9XA 1S1VA 2ZWOA 1KVKA 2KI2A 1Q7YT 5JUMA 5F8GA 1ICEB 2CJYB 2V4QA 2NXCA 2VFRA 5KG7A 1UVNA 4UUXA 1B3TA 2JLGA 5I3QA 1W25A 3BREA 4Q45A 4F2RA 4AL6A 4IH5A 2MYFA 3R3TA 2R8IA 1XC9A 1WWHA 1QLNA 1S7HA 1ZPVA 4ITSA 3HSGA 3K5MA 1NHUA 4WKRA 5M2RA 4K4YA 2R7VA 2QLXA 3ULHA 1RTDA 4MYUA 2VA2A 3A3NB 2V2VA 3I0RA 4WFYA 3KNAA 2FJWA 2W7AA 1LWEB 2PMWA 3MCNA 5GAGU 1DFDA 4DUTA 4X66F 2IBKA 3HZGA 5B0FA 1UW9A 1SIWB 1WJ9A 1GFWB 3HD1A 4OZ1A 3PEJA 2R4FA 1HQEB 2WB4A 3KJNB 2CPDA 4UOGA 1DLOA 5A76A 1PC4A 4TYBA 2MGZA 3JTPA 3J7Z5 5GMKa 2LXIA 3CJ4A 3D1QA 2IVMA 1NCLA 2XSFA 4YUDA 3HHDA 1U7LA 3M2RB 2R8HA 1PYTA 2XMTA 1V3RA 1E6VA 3PY8A 5KFJA 2UXBJ 4ILRA 1B99A 3LAKA 4HT5A 5K14B 4DR3J 4DR4J 3DDKA 2EBGA 5KFDA 2DNMA 3UR3C 2QL7B 4I64A 1FFSB 2RB7A 2Z58B 2MKHA 4I68A 4F50A 3WX4A 1R31A 2O66A 2C28A 4NLTA 1WC6A 4I0WA 2B9WA 1IKVB 1K73T 3FMBA 1N34J 4NXNF 2DTJA 2JOQA 2F9DA 3BEGB 1NZ8A 2B8QA 3DLBA 1DJ0A 4F0KA 1HL6A 3ENVA 3PVXA 2XWXA 4EK2A 4KFBA 1NSKL 1CC7A 3DHXA 4DL3A 2C2ZB 4ZLNA 3NNHA 4LF2A 3PX6A 1FWLA 4I2QA 2K2PA 3NCRA 1D9DA 2MQLA 3R7NB 3TAMA 5LMNJ 2CQ3A 2FUG9 5M2PA 1LK5A 1S5ZA 2OPPA 5KFRA 3T1HF 1V5IB 5A6WA 3SCJE 5I42B 1GMVA 4RWXA 1XNQF 4JP8A 4CTAB 2MUIA 2F63A 2WVDA 5DM6Q 3IA0A 1ZTWA 4P6QA 1H73A 3I56S 1F2HA 3CUNA 1RWUA 4Q5VA 2W8KA 2AIRB 1AW0A 3W3SA 1KFDA 2NLWA 2PA3A 2WVCA 2PFDA 4W98A 1HWUA 4OQJA 4IDKB 3DLEB 5KTQA 2HQIA 1ZM4A 4YMEA 5KAKA 3TA2A 1JJ4A 1UA0A 3CT9A 2YXLA 3OTEA 3DLGA 3Q8UA 1ZM2A 3MMAB 4NLUA 4NEZA 2MJUA 4GO7X 4X4UA 2ZEJA 1SV5A 2C2MB 2ZOGA 1B7FA 1MNEA 3BGLA 1HHTP 2BQUA 2N7YA 3BBFA 1NNDA 3HP6A 3QZ8A 1NSPA 3J80Y 4B9UA 2K06A 2EC2A 1NKBA 4WFAQ 3NNCA 1T8EA 3OLAA 1S9EB 3T1AA 2VPWB 1BHNA 1R8HA 2OPSA 4OX8A 4UF4A 2C3OA 3PXGa 2F65A 5HQLA 2ZE2A 1S1WA 3QT6A 5ETKA 2E5LF 2EXUA 4EO6A 1TMJA 4LSLA 3BYRA 4RX6A 4DMZA 3Q8YA 3BSNA 2MZSA 4IQMA 2HMIB 1J27A 3EVWA 3D6FB 2QV6A 3OHAA 1VBXA 1C1CA 3I0SA 3BQ0A 3M2UB 3TX0A 4B3TF 1TL1B 2CQBA 4JB8B 3O2IA 3SMZA 1KOOA 2CVEA 2ZD1B 3DCAA 3EZUA 3UWTA 3KK1A 4M94A 4X4VA 1QM9A 1RHKB 1YSJA 3FEZA 4HHUA 1B70B 2UUAF 4QCLA 2EW0A 1HNIB 1OYEA 1GXUA 1TL4A 3VCDA 2WTFA 3IRXA 5H9FK 4CYUB 3QZ7A 1T94A 3NKYA 1G3OA 4RW8B 1Y4ZB 4OFZA 3EGNA 3K5NA 2Z57B 1NDCA 1NUEA 1TKXB 1X31C 2M2BA 4R0EA 3K89A 4ECTA 1TTHB 2K7JA 2Y8YA 1S1XA 4ZKAA 2I1RA 2GAHC 3GYNA 1U4BA 4FPRA 1OQ6A 2DNLA 3TOQA 4DQRA 3B82A 3EXYA 1X9MA 3J80U 1NK7A 2VQEJ 2MQPA 2ZHAA 3PRDA 3NGKA 3TQEA 4BC9A 1NSQA 4LVOP 4LRDA 1OYDA 2JVRA 3D1HA 1BQXA 3VZIA 1FEEA 2JHEA 3DNCA 4A8XA 3MUMP 1HA1A 3CCUS 1RAOA 5DO2A 4ECWA 1VJWA 1Q1KA 1RA7A 4WK3A 5GMEA 1FRIA 4ETZA 1HR0J 1D8YA 2ZUGA 4N47A 2GX8A 3GIIA 2GHPA 2RD5C 2Y1LB 3PEHA 2J6TA 3MM5A 4EWTA 1S12A 2LU1A 2VFTA 1P9QC 1UL3A 4ANEA 2N4DA 9RUBA 3AQPA 2AEMA 2DH8A 2LDIA 2JDJA 3AXKA 3D54A 4HHHA 1MROB 3DYAB 2O67A 1RQ0A 5AE2A 4X62F 2ZM6J 4O3SA 3VHQA 2AMCB 4A8KA 1RTJB 1CLFA 4WZMA 4Q44A 4I6AA 1S79A 2EVZA 4DI6A 2QYCA 1IR1A 4U6PA 3T5JA 4YR0A 4JI2F 4YR3A 1ZH5A 1Y3KA 1T9XA 1NDKA 1S1TA 1CQNA 1X9SA 5HJYA 1RK8A 3TW0A 2B3TB 2XCAA 2RQCA 3VAMA 5LJ3Y 1R8AA 2BABA 2HBQB 4U9RA 4EMDA 2IA6A 4EYIB 4EBDA 3KDOA 2CQ1A 4USKA 4USWA 2JX2A 3OW2R 4ICLA 1FKAF 3NNAA 4B9NA 3GG0A 4ZN3A 2AF6A 3N5FA 3V5RA 3GTYX 4DX5A 5L1JA 4G1QA 1JQGA 3DU6A 2W9CA 4PQUA 2G9OA 2J0QD 1WD6A 3SCKE 2MHEA 2PEHA 1B0PA 2E5IA 4LRBA 2DR5A 4H4OA 3BSOA 4CNZA 1XNQJ 4M1KA 4RBUA 1S6PB 2JWNA 2B5JB 2LYVA 2RUSA 4X4RA 3QJLA 2MKYA 3AQOA 2LA6A 4NRUA 4RO0A 4J9MA 5HLFB 3BH6B 1CULA 4LJMA 3T3FA 1AZSA 3TVYA 3VGSA 1QVFR 1REVA 2L9WA 3MUVP 3AJ1A 2VODA 3H59A 3PM9A 3PRVA 4G65A 4DV5F 2YTCA 5B0GA 3QRQA 2RRNA 4AE5A 3KUHA 4NCBA 2XMJA 3CJ8A 1HBMA 2B4VA 3T1YF 3CDBA 3QLHB 1PSDA 4ECUA 2OH2A 5F41A 2YNHB 3Q8PB 1WF1A 2EPIA 3GCXP 3FSYA 3QQCD 4Y0FA 1WG4A 1YK9A 2V9KA 4OV6A 4AQYJ 3SDEA 1N5YB 2M52A 4WFNQ 1RHRB 4IFVB 2BE2A 1PO6A 3CWJA 1YJWS 3F44A 1I1GA 4TY9A 4FYDA 1AA1B 3PV8A 1N6QB 4NLGA 4CO3A 4P2SA 1QAXA 1RE1B 1RLDA 3OTDA 4OX6A 4JI1J 1APSA 2DHAA 4PAAA 3W5YA 2XY5A 4OYWA 1CEZA 1NMEB 3TI0A 1HI1A 3RB6A 4K4UA 2H5IB 2V67A 1RT6B 3LP0B 3VGTA 2J0SD 3SIPB 2CQDA 3O8WA 1SH3A 5DS7A 3N6LA 4L76A 1CJTA 2MJNA 3LH2S 5E3RA 1SJFA 1WHVA 2CPXA 3D68A 2BV3A 4C3KA 2QLFB 3D6TB 1GX6A 3QT7A 3UN5A 2UXBF 4RL1A 2GMLA 2CWXA 2MQNA 3QPIA 5IT4A 2DNKA 3R6GB 1QTNB 5KT4A 3KFWX 2KJWA 5E7OB 4DUYJ 4NLSA 1PCAA 4OYBA 2ERRA 1AB8A 3ILJA 2VL1A 1FD8A 2IC3B 2V34A 1U02A 3AOCA 1RT1B 3FBBA 3GE9A 2XMWA 3I0RB 3MEEA 4G1IA 4A47A 2R2UA 2VV5A 2MQMA 1RYSA 4C6AA 3NG8A 3BO2A 3HKWA 5GMDA 5IOLA 2V8VA 2G0CA 2FJBB 1UW4A 1SQEA 2YWGA 3M6VA 1XJWB 2YNGB 2KM8C 1S6OA 2OMOA 2WVBA 1N5VA 1U0SA 1C1BA 4K5SA 2KFYA 1FJEB 4E2FB 3VVTA 4HH0A 2BM0A 3UR0A 4F04B 4B3SJ 3C16B 1N32J 1UZDA 3M2RA 1DARA 2VIHA 1IUJA 3MPDA 1Y3JA 4WIQA 3EWGA 1Q8KA 3NWRA 1JLAA 3DN9A 4B3OA 2K7KA 4KGVB 1KQGB 3IBWA 4FKXA 4ZCLA 1SQFA 3HHLC 1SKWA 2YNFB 3EE3A 5KFWA 3DLKA 3KK2A 1FDAA 4NYZA 3EZ5A 2E1CA 4CO5A 3OD2A 3MAQA 2BOAA 3G82B 4ETXA 5K8PA 2KHCA 2X3GA 3W7BA 3ZZPA 3M8PA 5CXTA 4Y2IA 3N4WA 4ECSA 1GTHA 1QDUB 3M8YA 3SQGB 4B9VA 3SZ2A 3KJFB 3H5XA 3DM2B 5EN1A 1QE1A 2DEIA 3S7RA 3V4IA 3R2CJ 3VAIA 3CCSS 5EDWA 1FK9B 3DRRB 3B6BA 3P8BB 1LWCA 1H72C 1IKYB 1WC4A 4YP3A 3M6WA 2AU0A 3DI6B 1F0XA 3T41A 4DSFA 2OI2A 4Y2CA 4R5PA 1U1MA 2YVSA 3IAM9 4V1Ak 1Y11A 2ZBRA 4ED2A 1FTRA 3T9NA 1K9MT 2JEFA 1NJYA 2BANA 1HQEA 3FGVA 1AUSL 1GAOA 1KC8T 1VBYA 5C25A 4OJGA 3CMAS 3FMWA 1BQMB 5A0YB 4WFXA 1VHFA 4C2MA 5F3ZA 1S9GA 4HH1A 4Y00A 2EWHA 1RTZA 2V2ZA 4DQPA 2XBPA 3V4MA 2YPYA 4DPXA 2AX1A 2QJ3A 3CDEA 1S1WB 1Y5NB 4GVLA 4M5DB 2A6MA 4NLOA 4AUKA 1K47A 1UFKA 3S1TA 3BR9A 2UV8G 3DRSA 4RNHA 4O0NA 5GADU 1VRUA 3FZ2A 4F4KA 3R27A 1TL1A 2GAGC 3RBDA 3PZPA 3MM6A 5ETTA 2UV8A 2XS5A 1TUVA 2J5AA 4DV6J 1DZ5A 1PYSB 2DNNA 1A7GE 1GK8A 3W62A 2LP4A 3DDIA 2HQDA 3TZWA 1XMBA 2GCFA 3PYFA 3R7BB 2ZOMA 4CLYA 3IM9A 1A6LA 1XMOJ 4FNIA 2ADBA 1CS4A 3MMCA 3E51A 1PILA 2ZE2B 1RJJA 3P45B 4FDFA 1TKZA 3BO4A 3TJ9A 3PW5A 3I82A 2WBRA 2OPPB 2Q1LA 2Q6CA 1Z1ZA 2CPHA 2CQ2A 1NEEA 3FQKA 4KTQA 3FNNA 4URQU 2C1EB 3S6EA 3M2UA 4UZCA 4UW2A 3H4DA 1H0HB 3KXDA 2NPIA 2ZH4A 4LF9F 2PC6A 3F41A 1XR5A 1VK8A 3H2LA 1W2IA 2IIHA 4QIVA 2E66A 1OPIA 2FY8A 4YB7A 3MCMA 4ECXA 4OMFG 4DZ6A 2MB0B 3FBEA 3VQSA 2QIFA 1H2TZ 3ZXWA 1VFJA 2IM2A 2VHGA 4ZPWR 4X4PA 2LDYA 2GJFA 3QNWB 4EEYA 1JLBB 3F0NA 2GV1A 2PE8A 3MMAA 4PEOA 4ZVOB 5LMUF 1VC5A 1FHTA 2MHNA 2DYAA 3CGIA 3WHIA 3HPOA 3GFYA 3EGVA 1TKXA 2FPHX 2Q79A 4DV4F 2DR6A 4FYYB 5HBMA 2GJIA 3ETMA 1LXNA 2HQ3A 1K0VA 3M7VA 4Y28C 2CQ4A 5K8MA 3Q8VA 1UAWA 5E0OA 5DQHA 1UVIA 2VJUA 2VZ9A 1RT7A 3FK4A 4KHPJ 2XS7A 2H3EB 2C42A 1RSCA 5K8OA 4RUBA 3M9NB 1H2UX 1EJ7L 4MAKA 3MF5A 2IJRA 1T7PA 1G2EA 4USJC 4XO0A 4JBCA 1JNRB 1GT8A 3FRYA 4LBHA 1NSAA 5KOXA 2R7WA 1M5SA 2DNYA 3RJMB 3TJAA 1HBUB 4WJBA 4QIGA 2DBBA 3SDEB 1WACA 2AJ2A 5KFCA 1NJWA 2BE2B 4M63A 4K2JA 4HI1A 1PAUB 3N01A 3D66A 1RT2A 1RT3A 2B6AA 2R42A 3AJDA 1RZMA 3MECB 3H8YA 4C7QA 1SC4B 1LXJA 3KG1A 1GEHA 1R7IA 4MIWA 4URGA 1LWFB 1V5VA 2HBZB 2LEPA 3BSAA 4PZVA 4QOTA 2BKPA 5KFXA 5AE3A 2CJ9A 4KGMA 3MR5A 4DV5J 2KFZA 1VQ9S 1Z2ZA 2X1FA 1T05A 4ED3A 2YQ1A 3OHBA 3QWUA 2VJVA 2NCKL 2ZKUA 1VBKA 2AX0A 3NGTA 3GWCA 4JV2A 2BJEA 2OTLS 5F8IA 4M5IA 5E41A 4DSIA 1ZAXA 2N4CA 3TX8A 2BE9B 3K7RA 4ZVGA 4USMA 2R7OA 3K58A 2VQFJ 5D15A 1P6TA 1WC0A 1X4DA 3MEEB 3ZZ0A 1Z4UA 3QLHA 4NOHA 4UZBA 3GV7B 1RBOB 4KAIA 5DDOC 2HRUA 1Y10A 2IHR1 4DG1B 4LF6F 5THWA 1S99A 1HIYA 4DS5A 3M2VA 4B9SA 2BYCA 1KP6A 2HNDB 1LFWA 4EU0A 2YNGA 3QRRA 4O3QA 2GHVC 2UXCF 3GIMA 2OFGX 3NAHA 4F67A 2QLBB 1U2RA 2DNGA 2E7VA 2VPXB 2YKAA 3HFZB 4IFVA 4DN9A 3W63A 3KLEB 3R2DJ 1R8PA 2BX6A 3MM8B 4J5OA 1EQMA 4K4XA 1YHQS 4ERDA 1UETA 1RWKB 1JLAB 1VRQC 1A0OB 2HNZA 2KVQE 3AHPA 5F0WA 5KG0A 3GV8B 2AJ0A 3SSRA 4TY8A 1U26A 1YBTA 2HLUA 2KZZA 1B7YB 1Q16B 3N5BA 4U8VA 1HQ2A 2P9EA 3BH7B 2F40A 3MPVA 3BJYA 1D9AA 1FFWB 3FBFA 5B09A 4MIBA 2GNKA 2YNHA 4DQIA 3ITHA 5J2PA 4DQSA 4DPTA 3G6ES 3R1HA 2YKOA 1M90T 3LP2B 2H65B 2JFKA 3TZZA 3D9BA 3H5SA 3HM9A 1VQ8S 3KTQA 3V6DA 5CD4A 2NS1B 4FYXB 1U6ZA 1EKSA 4N8OA 3KLGA 3HSDA 1VS3A 5HK4A 2NYHA 1IKYA 2JFDA 4DSEA 2CG8A 2XMUA 2YX7A 4JI6J 3ZNJ1 5AXKA 2QN6B 4B9LA 1W26A 1RAEB 2HS0A 2V63A 2BR0A 3OTBA 4HT7A 5HI7A 5BXIA 2GS8A 2HG4A 5G0RA 1G1XA 2HVHA 5A8RA 1U47A 1JXEA 1ZM3A 3IG1A 1KKHA 5L9NA 3G6YA 3PO4A 1JNZB 2YKPA 3CCVS 5BYSA 1R27B 4ZIVA 3UNGC 2RKIA 3KG4A 4FXVA 4YS2A 2PGCA 1L3SA 3BGRB 4OZ3A 1TV6B 3MFHA 2EFPA 4F02A 4C3LA 2V4RA 1U0HA 2HWHA 1XR7A 1OSDA 3NEKA 4LRAA 1I94J 4WYWA 2OTJS 2L9NA 3PDNA 3ZNUA 3IR6B 3TRGA 3BR8A 4JI8J 3ONQA 2RS8A 2V68A 4RUAA 4DR7J 1TAUA 2RQKA 1RAIB 4DL0C 4J9PA 2M8HA 1JLFA 1OY6A 1NPRA 2G1DA 3SQGA 4K4ZA 1UFWA 4IR1A 2A0FB 1QUVA 2GVDA 4Z7YA 2CZVC 3L7PA 4RU9A 2HWTA 2R2TA 1N4LA 1RACB 2YQ0A 3D5MA 1IJFB 2YWEA 4QR1A 5G4DA 4XPEA 2CIMA 1EKRA 1LWCB 2GC8A 3IP0A 1LV5A 1YBUA 1WEYA 3C16A 1TKTA 3O44A 2DXEA 4QZVB 4WE1A 3THVA 1HFEL 2KU7A 2PIIA 3QGIA 6AT1B 1VQYA 2UP1A 4YDXA 4DR3F 3H90A 4Q8EA 1UWBB 1FJCA 4B3OB 4R8UB 4MK9A 4KE5A 5HSPA 3CCMS 3OFFA 3MM7A 1X5SA 1OJ4A 2GO9A 2CPFA 1IJEB 1YVFA 4ZVUB 2L08A 5A0YA 2HNYB 2PA8D 1N5SA 2BEFA 1SI9A 2MZJA 3HKZD 4DV1F 3OL9A 2KFNA 4WTYA 1C4AA 3OFHA 5J2MA 3NGDA 1HD0A 5IV3A 3FKBA 1QSSA 4ZHRB 2WBMA 2IDLA 4M5DA 3GYXB 3LTOA 4Y34A 3W2WB 4QW8A 2CNKB 3O3LA 2KXNB 2AYMA 1AUDA 1OMSA 1A9NB 3S01A 5HROA 4PYDA 2OEMA 4ZLLA 3L09A 1FKPA 2DGVA 3P96A 1E6YA 2IC3A 2ILYA 4KIAA 3SCIE 1EP4B 3MPUB 1EETA 1FE0A 4FNHA 3TARA 2ROGA 4R0JA 4R5PB 4FF2A 2XI3A 3J81j 2R7TA 2B9EA 1RLCL 3TEGA 1NH8A 1U2FA 2ASYA 2XEXA 1PBAA 4QPXA 3FEYB 3QO9A 4YB5A 2BANB 4GKJJ 4C9DA 1UJ6A 1HYSB 1SB6A 4Y2KA 1LW2B 2QG9B 2V69A 3HF5A 4RBVA 3MAAB 3MI7X 3P4UB 5CD4H 5D3GB 2KXFA 1SJQA 4O44A 1F1BB 5D0EA 4ZVRB 1H2VZ 3FBCA 1FESA 1TKZB 5L39A 1VQ5S 4TU9A 1JLQA 3NP5A 1RYRA 2H54B 3CPWR 1Y9OA 3QIDA 4WZQA 2CVIA 3HFVA 4EBEA 3CMES 2CA9A 3K5PA 1GMWD 1M5KC 1T11A 2C3MA 4USHA 2W25A 3SCLE 3TJ8A 3MM6B 5I3UB 1UCNA 1GXLA 5L1KA 4PXDA 1MWZA 2VBZA 4OYXA 3OSPA 4JV5J 1GQEA 5KT6A 1XNRJ 1CJKB 2DD8S 5U47A 4DV4J 3UDLA 1KQKA 2ACMA 1UMJA 4EUVA 1HQUB 2H5JB 1FXLA 5A2QY 1S7IA 3LPYA 1CPZA 4KT0C 4LR9A 1CS4B 2MZ1A 2C2DA 3AA8A 3NL0A 2R7QA 1UPMB 1RHQB 2AZ3A 3BPDA 1NXIA 1R0BG 2J9EA 3AAWB 2D3ZA 4ZLJA 5H1SV 2N82B 2AV5A 3CB4A 4FS2A 1UVMA 2XY7A 2VD3A 3H25A 4QIWD 4CLPA 2HIQA 1JLCA 2W2OP 2OSRA 4M5LA 5C25B 2HRXA 4ELTA 1CVJA 5HMWA 2RRBA 4OHYA 1HW8A 4DUYF 1F6TA 3O6QA 4A8OA 1N56A 2WAQD 1WKLA 1JLEB 2KM8B 3D2WA 1QAJA 2CZ4A 1VQ4S 1CQMA 1MU2B 1FRXA 1VRTA 1F9HA 1MMDA 4OZ5A 1YKWA 3D3BJ 5CYMA 3UW1A 4Z2XA 5CAAA 2F3JA 5KFOA 2RT3A 4ENOA 3T5HA 5SZTA 4FBUA 1UPPA 3DMJA 5MLCV 3KMQA 1URRA 2MSTA 3DRSB 2Q3PA 2ROEA 3FFIB 1JLBA 3BF4A 1Q7LB 1Z2LA 3MMBB 1RAAB 1TL5A 1P9YA 1QAYA 4RW4A 3RTVA 2HQGA 4BC7A 3MCSA 4XK8C 2HVDA 3UFCX 1RWXB 3SSQA 2OELA 3D7SB 3OR1A 3PKMA 3E8OA 2GIQA 1HWJA 3FUYA 4HEA9 2YNIA 2DNZA 1WELA 1PJ7A 2IDEA 4KGZB 2GHWA 3Q89A 1FE4A 4C8NA 1OWXA 1X4HA 2VBXA 4QR2A 4I69A 3T6JA 2N3LA 4NZ0A 4LBIA 5H9FJ 2HFOA 2FY1A 4IRCA 1U1QA 4LF8F 4K8RA 1CJVA 2FJEB 2JC0A 5B0EA 1FI4A 1ZZFA 3L3CA 2RQMA 3OJSA 3PG9A 1U49A 5HO4A 2OFHX 4J7CA 4DDFA 2XHCA 3W1YC 4RZRA 4JUZA 2FDNA 2M3DA 3Q2TC 1RT2B 2XYPB 1P8GA 3ZZOA 2ZH9A 1C2PA 4MT1A 1H98A 3EPGA 4TLRA 3D6HB 5L38A 2W9BA 3V6JA 1XN9A 1NK8A 2XSJB 2UUBJ 3EVMA 1X5OA 3NRBA 4PABA 2BUNA 5AJ3F 1DLOB 4C8ZA 1FRKA 5C24B 3KUGA 3IFEA 5CA5A 4IG3B 1T05B 2PI5A 3ZZYA 3GLJA 3PCOB 4KO0B 2ZVSA 3MGJA 4BHQA 1FCAA 1VLOA 1MWQA 3ELHA 4Q2LA 5KG1A 5KG2A 4UY85 1UVLA 2EFVA 3RB0A 3CJ5A 4H4MB 3DRPA 3VAKA 1N36F 1S76D 2X1GA 2NXJA 4KGXB 4B3RJ 1K0TA 3T19A 2HURA 3W61A 4X65J 3HT0A 3KOAA 5A2QU 3JB9k 4NLVA 2ZC4A 2DGQA 4MKBA 4NXNJ 4MKVA 1YRXA 2MDAA 4LIWA 3CCQS 3CDWA 2F8MA 1T9WA 1MWYA 1SVDA 2V2QA 5D4NA 4OIXA 3M2VB 3R5DA 5HMZA 3ENWA 3POTB 5AT1B 3V81B 2C2RA 2R8KA 1F60B 5DZ6A 4XIUA 5D77A 3KJQB 1Q82T 2HYIB 2IMWP 3AOAA 1WG5A 4NXMJ 2XCPA 4Y2MA 1IWGA 1EZZB 3NLCA 4NLRA 8AT1B 3HZEA 1R8BA 3EYZA 1YIJS 1HNVB 3R6LB 4MH8A 1FJGJ 3ZTOA 3TNVA 1ZTTA 2JRSA 3LGMA 2V4JA 1VIXA 2XB2D 1YWXA 5ETQA 3TQ1A 4BS2A 2HQFA 4A48A 4KHRA 1R43A 2WK4A 1BC6A 1EIYB 2RDJA 1NBEB 1VQ6S 2WHOA 3ZZRA 4JI8F 4C97A 3PIOQ 1UEUA 3M8QB 1Y0HA 3NBPA 3HVRA 1K8AT 2L3MA 4X2BA 3QT8A 1FXDA 3Q23A 2D3O1 1GH8A 3TUPA 3ITHB 5J2PB 1TV6A 1RCOB 5KFYA 3DLEA 3HVTA 4DV0F 1VYAA 9ATCB 4ZJOA 2J0WA 2AZ1A 1JLGB 2HRTA 3HVWA 4JV1A 3QAEA 2HSEB 4ZPTR 5GAHI 4QU6A 1D09B 2XULA 4J9NA 3DLGB 4KH0B 1FEHA 1RBLA 3PW7A 2GMHA 2ZFHA 2ZITA 4PXEA 2IVFB 2ZZNA 1WOOA 2P2CB 5GAEI 5J2QA 1LWEA 4N7TA 2OPQB 1R89A 2CNNB 3N28A 1FWKA 5L46A 1DTQB 3ENAA 3TAQA 2J6SA 3NMAA 2E5JA 3RYLA 4K59A 1EQ0A 1XTZA 2XO6A 1Q78A 3EDRB 4JOUA 4CH1A 2JJ4D 2AKWB 5EWFA 7FD1A 2OGUA 2UXDF 3P49B 1X5PA 2PD1A 4YB1P 1D8ZA 4E98A 3CULA 3ADAC 3IBCB 3G8SA 4N41A 2W01A 2IA0A 2VFVA 5A8WB 5C42A 1HNZF 3VTIA 4ELVA 4WP8A 5HVGA 4DR5J 3I31A 1RAGB 4DPUA 2BACA 3CJ2A 1YJNS 1S0MA 3C46A 4ZPDA 1FA0A 3L7UA 4B3TJ 4DWIA 2J8SA 1ZYQA 1M5HA 4OJ3A 4GKKF 1LKZA 3CCZA 4DR2J 3M1VA 1HNWJ 3CJQA 2YWKA 3SBMA 1BE4A 1Q0NA 2UVRA 4ZP6A 4O3NA 1KR4A 1WUUA 3QBCA 3CCJS 4K4TA 2W2PP 4P10A 4P72A 3W2WA 2DIUA 5A8KB 5KT7A 2H9ZA 5CYQA 1TUWA 5DJBA 5CQGA 4AYBD 4J91A 5HROB 1GTEA 4MKYA 3Q22A 5D0GA 4EZ6A 1TKTB 4WE1B 2RU3A 1KLNA 3CO0P 1H7WA 2CQPA 3RUBL 3ET6B 3C2PA 4CH0S 1REGX 2RMLA 5KT2A 2FZGB 3RZAA 4B08A 1ZPWX 3G86A 3KLIA 4KKOA 2KDOA 4R8UA 4YDDB 5DQGA 4DL7A 4DCOB 2VG7B 3PO5A 1T9TA 3AA9A 3IBFB 3IGNA 3W8PA 4XPCA 3OVAA 2LA4A 1UTAA 4OJHA 4P73A 4O4RA 3GSIA 1N5QA 5DM7Q 1KLMB 1JB0C 3PFEA 3IXQA 4IFYB 4X84A 1NH7A 1U25A 3OLBA 5F9LA 4HACB 5F8MA 5HATA 2NUHA 2Z0GA 4ZK7M 3LAMA 2J9CA 2RNEA 3BKTA 2ZDPA 1XNRF 3M8WA 1TL7A 4H4KA 4P2MA 1L3TA 5IT9U 3DXBA 1KOHA 2KT2A 3BBBA 3D6MB 4PXCA 5E2QA 2MY7A 1T9YA 4ATNA 5B0CA 4RW7A 1XK8A 2CPJA 2WCXA 2PSZA 3FRZA 4YY3F 3HMJG 4TXSA 2CJAA 4N8NA 1EETB 3QAUA 3RG6A 4TQSA 2DO4A 2F7VA 2ZHOA 5T7LA 5LSOA 1HBNA 3WQPA 1RT4B 1RU1A 4HLBA 4LR8A 4PPZA 2NZCA 3TP2A 4EGLA 1J5EJ 3UNYA 4G1PA 3TR5A 3W60A 3GFHA 1HHSA 2AT1B 2EFNA 3JSMB 2GMJA 1S72S 4RR5A 4ZJLA 4P9SA 2CPEA 1KQSR 4WU2A 2C2KB 2QSWA 4DX7A 1VDHA 2C3PA 4WIIA 5FDLA 5KFIA 4ECYA 3FSIA 2QFJA 2UVUA 3UDCA 5KG6A 1T9VA 3U1MA 3CCES 3CIZA 4DLGA 4TNOA 2HHTA 3I6PA 5SUHA 2ADCA 4GKKJ 3MEGA 2W4PA 1WC5A 4PG7A 5B7WA 4DV3J 3DLLQ 1TAQA 2MMYA 1TFWA 1PIEA 4WF9Q 3NCQA 4J9OA 1SC3B 5J2MB 1F5BA 3SFUA 1TK5A 4GC6A 1MU2A 1VRTB 5EGYA 2XLIA 1S1UA 3A12A 5KG3A 4U7UD 4I4BA 2I0XA 3IR5B 4NYPA 2HHHF 2RS2A 1KTQA 1T9UA 3UPFA 2XSJA 4F4YA 5LL6d 2AGOA 1AT1B 2DNQA 1Q5YA 1WEZA 4AXJA 4KB7A 2MQOA 3JAMU 3OJUA 2FVRA 2L48A 3FCVA 3UD5A 3RAQA 1WHWA 4USIA 1N34F 3CEDA 1LNQA 1KRPA 1C0UA 4OJ1A 4WCEQ 5DZ7A 4ED7A 2Y1JA 1NM2A 1WSRA 3TO8A 3J7AN 2HHXA 2YWWA 3D0GE 2OSQA 1LW2A 2NSBA 1ZBTA 1VI7A 1SC1B 4CO0A 4DBQA 4FBTA 2CQIA 2OPSB 3R5GA 3RAMA 2J9DE 2HHSA 2X7IA 4XAKA 5ETRA 6FD1A 2LECA 5LXYA 3HHKA 4KR0B 2QC3A 4OLPA 1YJRA 1LEOA 1BMQB 2NSCA 4LRFA 3QFHA 5LMNF 4DR7F 5E3PA 2HFVA 5E3QA 1ULRA 2DITA 2OD4A 3CMQA 3N6NA 1XMQJ 2DRDA 2PFFB 1N5YA 1HPZB 4YQWA 4B9TA 2G4BA 1NK6A 1EAYC 2D9OA 4ZN1A 3DC2A 2YPZA 3BKFA 2ILZA 2ZUAA 1TK8A 1U1PA 1CBKA 3OPKA 4JI1F 4K5RA 3VGUA 2NREA 2ZBCA 4W92B 1HD1A 3CD0A 4KBIA 5B0BA 1N48A 2HHWA 1GX5A 4PQUB 3CD5A 2I5JA 3TZYA 2ZWPA 4DHVA 1WNEA 1D9FA 3QGGA 3OVBA 4KHPF 4PWDA 4IOCQ 2BW7A 1KDNA 1BQNA 2L9DA 1HNXF 3US5A 1OQ3A 4BWJA 1JJHA 1S6PA 1LQ9A 3NBPB 3RRKA 3PFOA 3H42A 4DL6A 4IO9Q 1CJTB 3RBEA 5D8HB 2E1RA 3I55S 4N77A 4ZVHA 3C15B 3DGVA 1U1NA 3HX9A 3HSJA 1JLCB 3MM9B 2YKNA 3U27A 2WSCC 3VQTA 3EX7B 3R8YA 4J9KA 5HAOA 4ZPBA 1KBRA 4RKUC 5FLXU 2QTWA 1RAFB 5JVGQ 1S0OA 3LWLA 5FJ4A 3PW2A 2FYXA 2DPIA 3AB4B 2R8JA 1O8BA 2CQCA 2B43A 2KJVA 1IBKF 1U1OA 2XM3A 2VG6A 2V6AA 2MQ8A 4MFBA 4M5KA 4QYZJ 3HVAA 2EI5A 3M30B 2W9BB 4B17A 5LJ5Y 4ANCA 2GW8A 2GA7A 3A4TA 3MOJB 2KT3A 4IG3A 3N6MA 2F1FA 1YJVA 3TYTA 3U7JA 4NI2A 4RW4B 2ZH1A 1EHWA 3R1LA 3P5BP 1VC0A 1FJGF 1KVIA 2FIUA 1WC1A 3PYEA 1DTTA 2PT0A 5KFVA 1AZSB 5KOWA 1N5TA 4ID5B 4CT8A 2BJDA 1WEXA 2YH1A 1FJ7A 2H5EA 1MROA 3DYAA 4KQZA 2R9LA 4EZ9A 1C0TA 1HWLA 1YDLA 4K4VA 1HBMB 1OY9A 1PJ6A 3R97A 4C3MA 1VBZA 2QYGA 1KQFB 4C48A 4I2PA 5KFGA 3E2EA 3L4BC 2ZJRQ 4DCPB 4C8YA 1S1TB 1AFIA 1X4AA 2KVIA 2W4DA 1AYEA 3GJSB 2DNHA 5CYQB 5ITHA 3KHRA 2B7BB 3DRRA 3EDQB 3U1LA 4ZIWA 2IRYA 3CTRA 3ZC4A 5IV4A 2XI2A 1VLYA 2ZM6F 3K0JA 4CT9A 2IVYA 1GMUA 3OTOF 1T95A 1HLWA 2ZNZA 2OLWA 3GIKA 3SI8A 1Q86T 4ZVSB 4LF1A 4DFJA 4LF4J 1F5AA 1RADB 3ZFVA 1NDLA 3JSBA 4OI4A 2Z4PA 4TKTA 1TFYA 1UP1A 4ED0A 1YX2A 1UA1A 2HS3A 2HRYA 4HR2A 1RDRA 3UDEA 5KFEA 1VQ7S 1RHMB 1IBLF 1M5PC 3MHYA 2UU9J 5A8WA 2Z56B 4M8LA 2QL9B 4OI2A 4NZ7A 3MPYA 4OLOA 4DFKA 5ETSA 5CZXA 1J2VA 4HVZA 5CABA 4ECZA 2V0NA 4DQQA 3CDAA 4JI6F 1L3VA 2XS2A 3DLKB 3KK2B 2WONA 3AD8C 4GVBB 4ZP8A 2FVSA 2AWZA 5KFNA 1T03A 1URNA 3I9V9 3M1VB 2LQ9A 3PKYA 3ISNC 2LQ8A 3VR1A 4JI2J 1LW0A 5ETMA 4JI3J 3SXLA 2UUCF 2MLYA 3C6UA 2IYIA 1QD1A 1VMBA 1FK9A 1QJHA 3WIVA 3MOZA 1HMVA 1R8CA 2RHQB 3R5BA 2FJVA 1CC8A 2NUUG 3EJMA 1SH2A 3BN4A 3M6XA 2G0JA 4F25A 1XERA 5JMNA 5J1PA 2Q66A 1CJUA 2W9AA 4IR9A 1FFGB 2IAJA 3LUYA 1I94F 4ZP9A 2PEBA 5GAEU 2XLKA 2QMXA 3TANA 3AT1B 5B0DA 3VV2B 3M32A 3FCHA 4P2XA 1WHYA 5E5NA 2YNFA 3HHLD 2E7XA 2LFVA 3LW5C 5EX3A 3V2UC 1Y00A 2APOA 3DOLA 1VQLS 4DR6F 2M0GB 1KNZA 3C66A 2NQPA 4AQYF 4NEYA 3B4DA 3M8PB 4WFZA 1JX4A 2RUGA 3ILIA 1J5OB 4CLSA 1JXLA 1D0EA 3AD9C 4HACA 1B0VA 5RUBA 1ZM9A 3V6KA 2J6UA 1S1UB 2X1AA 4U7CA 3J7YI 1N52B 2QGFB 2I38A 2CG4A 2M4MA 3LPEA 4M5NA 3AB2B 4QR0A 1FNOA 2DCUB 2FZKB 2IMOA 2IRXA 3HHLA 2XNRA 4J90A 3F56A 2UUBF 2Z2LA 5BR8J 1S6QB 5F8HA 2MZTA 5MAOA 3MDFA 2AP6A 2E5HA 1O5JA 4KPCA 5HVFA 1YBAA 1PGZA 1PAEX 2ZJQQ 4F0HA 5HBMB 1C1BB 2ZH7A 5JJBA 1Q8IA 2CFXA 2U1AA 3G8QA 3KNGA 5J1EA 5KG5A 2UU9F 4NLWA 2MZRA 2XMVA 2XG8A 3M4XA 3MMCB 5C2CA 4LF7J 1VQPS 3R7SB 3DGPB 3HULA 3R5AA 4ZPVR 4DFPA 2ATLA 1NK9A 1VHIA 3A8IA 3VAGA 1IBCB 2LEAA 2VG5B 1YITS 1SJRA 3KYLA 1TVRB 2VFSA 2QRRA 5EWGA 2D3UA 1HBUA 2LQ5A 3PX0A 1VRUB 4I1TA 1SJ4P 2CDRB 3ENQA 4ALZA 4DSKA 2M9KA 3VAJA 4TQRA 2LVWA 3JS9A 3W5ZA 4OI0A 3GQCA 3FJ2A 3MMJA 4QWAA 2Z2ZA 3QFWA 1RT4A 2AYGA 2IPOB 1VCTA 4NXMF 4L3NA 2D9PA 1QTMA 1NPKA 4CO1A 2VKZG 3V4IB 1V6HA 4B3MJ 4ECVA 3BGUA 1ZA2B 2DHGA 3QSYB 3WDOA 3E01B 1AROP 3VWSA 2JEIA 2RHSB 4GC7A 1H38A 3MXHP 3CJRA 1W7WA 4QIEA 3D0HE 4ELUA 2BVZA 2RF2B 4LF5F 1N0VC 1BXNA 2X3DA 5IT9Y 1F9FA 4RU2A 1FO1A 2RSQA 2D74B 2DHHA 2AJ4A 2LXFA 1TK0A 4BCAA 2Z2MA 1FDBA 3IS9A 3PYGA 4J9LA 4FVMA 2MZQA 1N0UA 3LALA 2D69A 3CSKA 3IWXA 3B8HA 3C19A 4NA1A 4RWWA 1M1GA 3IC1A 4MKAA 4OYPA 2EK6A 1V3SA 2OPRA 3DXSX 4WPAA 3M30A 2EFGA 2HNDA 2KL8A 4J9SA 2FVCA 4LQ3A 2XHWA 3GJQB 4CZCA 1KSPA 2VC1A 2VUGA 1DBDA 4I7FB 4A8WA 3W9HA 2M8DB 1S0VA 2HFUA 4WP9A 1RGVA 2VF3A 3I87A 1FDNA 2KRRA 2MSSA 2OMLA 4HL9A 4IG0B 1FDDA 1RWPB 2FJDB 3MM8A 4A4JA 1C0UB 4MK8A 4DV7F 2YQ3A 4A8MP 1RTHA 2IJNA 3J7ZT 4CO2A 2WVFA 4OHZA 3A1YG 1XEZA 3GONA 3BKUA 2VFUA 2A3JA 1HNZJ 4OHVA 3IN5A 4XTTA 4PWDB 3BGFA 1FERA 3HD2A 3AFGA 1X4BA 3L7OA 1Q95G 3NGRA 1ROFA 2J9DA 4OI6A 4PWWA 2ZVIA 1MN9A 1BGXT 3OFEA 2FHKA 3TUIC 4PG6A 4AT1B 4QWDA 3JYTB 4J9QA 1S4EA 2CJQA 2K1RA 2PMHA 4NA3A 2CQGA 1K1SA 4N5SA 1RHUB 2RDIA 1HNWF 3UN3A 1JKHB 2J76E 3CJ0A 2K3KA 2E1MC 2MPUA 2V8GA 3B54A 2DGTA 3KG0A 3MEGB 2YKMA 3G6XA 1QUPA 4DV6F 3OV7A 1YQHA 3TVKA 3Q24A 1NJXA 1DQ8A 2CJKA 1RP5A 2DB1A 5KFUA 4P7TA 4OX9J 1Q4RA 1SUQB 4A8QA 3N0VA 2Q6BA 1B4SA 4Z37A 4YHHJ 1LOUA 2VG6B 3QYYA 1DY3A 5HJXA 5JVHQ 4A8YA 4RNMA 2M70A 4ANDA 1P27B 1WORA 2BZ2A 2H1YA 3KDNA 1LWFA 3OVSA 2ZH3A 4K7QA 4WWSA 5C5JA 2DK2A 3IG1B 3JTNA 4HI2A 2YKQA 1PC5A 2DKOB 4UQGA 3CJ3A 2MTLA 1EARA 2RU9A 2YWHA 5GAGI 1IBLJ 2AJ1A 2A18A 3IWLA 4CLZA 3EICA 2FHJA 4R25A 2XNQA 2EFOA 1WDTA 3I5CA 1S0NA 1VQSA 1ZOTA 3HSZA 3ICLA 2FLNA 4V19X 3H98A 2HNZB 2GVZB 3NS6A 5LT5A 3CXCR 2O1PA 2F9JA 2RVJA 2I2YA 3HCXA 2HZVA 4M5GA 2DY9A 2CADA 3EM1A 4OI3A 1X9WA 2B7CB 3RAXA 2DGSA 2VDIA 2XYHB 2HW3A 4YY3J 2CDQA 3QMQA 5IM0A 5C2GA 3T1HJ 5KG4A 1ZAVA 2HK2A 3RBXA 5DLGA 1LW0B 5AJ3J 4GO5X 4F2SA 1P1TA 5ETOA 4AL5A 3Q0AA 2HFZA 2QA1A 2XTJP 3FCWA 3BGOP 2O5DA 2XMAA 2U2FA 3KLGB 4LF9J 4W4MA 1IKXB 3JTOA 4GMKA 4CLTA 2WVEA 4ZPCA 3W2VB 1RBAA 4YEAA 2COLA 3M8ZA 2B6AB 3CVKA 3Q8QB 1UWBA 2C2EA 1U1RA 2CUYA 2I5JB 2F8EX 3Q2SC 4NLPA 1JK9B 4NWBA 5A8RB 4CIOA 1BQNB 1KEKA 1S1VB 3GJTB 5LMUJ 5D0HA 3VAFA 1F3VA 2XLJA 1X0FA 3GFXA 4X4OA 2CKWA 3W66A 1IR2A 4PWUA 5D4LA 3J81Y 4I2PB 5DETA 3MZIA 4FYVB 1XR6A 5LXRA 5IC6B 4OZ0A 3GU0A 4QQBA 1S49A 1OO0B 4LFAF 2AJFE 4LUBA 3MR6A 2AGQA 2XZWA 1TZ0A 4OYOA 2P9GA 1VIOA 4JV0A 4JYAJ 2ZZTA 4LR7A 5BYQA 1UEKA 2D7SA 3GV5B 5JXSA 2HS4A 4DLEA 5I3PA 1JLFB 2PDAA 2JSXA 3T6BA 4B3MF 3C3LA 2IRUA 5GAHU 5HP1A 1NAQA 2HGLA 2LU2A 3UDVA 2OUGA 2QE5A 4HDGA 4L72B 4EI2A 3SV4A 2MGZB 2DR9A 4DR6J 2DRBA 1HYSA 2KZMA 1Q53A 2VC0A 2SXLA 2UUAJ 1RUSA 4I6WA 2QA4S 3C6TA 1FNMA 1FRLA 3AY0A 2VH7A 4H54A 3TAMB 2BBEA 4ES1A 1MG7A 2EFQA 4YFUA 1YRUA 2IAJB 3M9OB 1TELA 1ZETA 2KYZA 2VA3A 4DU8A 2VPZB 4PG5A 1N88A 2KHDA 2W2MP 2R8GA 2BW2A 4PG4A 4TY8B 1B0TA 3CJTA 2Z8QA 3U02A 5F8JA 2IJFA 2JLEA 4J9VA 4DV2F 1HWIA 2DNOA 4QWBA 1SIZA 3GFZA 3OQ2A 1Q8LA 3AJ2A 2HNYA 3DOMA 2CQHA 4LSNB 4AFFA 5HVHA 5BR8F 2W7PA 2MKKA 6FDRA 4NMLA 2G0IA 4F4AA 2PN6A 4CH7A 2DH7A 1S77D 4CWBA 4PCQA 4C8OA 4ZCIA 4CLWA 1VC6A 3H7HB 5HL7Q 2UXDJ 3V6DB 3OL6A 4NLYA 3E01A 4L6V3 1I3OB 4X4TA 2GIRA 4Q7AA 5EX0A 1XMQF 1NKEA 4LFCF 4M5JA 1SPBP 1XWLA 4FKYA 1YI2S 1VQNS 1S6QA 1LFPA 2ZH2A 1HNXJ 4HTJA 4ZPAA 5AXLA 2RF2A 1FX2A 3RBZA 1HR0F 4K50A 4IYQA 4ED4A 2CYYA 5CYJA 3R5CA 3A8JA 1LK7A 1WKKA 2DGWA 4LQ9A 4KGKA 1T02A 4DEZA 2EC0A 1TMMA 3EZOA 4CTAA 1TU0B 3K17A 3DOLB 1S4FA 3IS9B 5ETPA 2UXCJ 4OYAA 3MAAA 5HMXA 1AFJA 2GS5A 2ZOFA 4D3HA 5J1EB 2RKIB 3HJFA 7AT1B 3MPWA 3H4BA 2FGOA 2DIVA 4PQAA 2B56A 5IQ6A 4O44B 3LANA 1DRZA 1R6VA 3H40A 4ZHRA 3VAHA 3HHNB 3H2UB 2YY3A 3WBZA 2XMKA 1JLQB 2VOPA 1VK3A 5F9NA 2P5VA 4LRCA 4TLQA 3DU5A 3K8VA 2XO7A 3RB3A 5H9EK 4U96A 3PJWA 2F4VF 2R2SA 4DR4F 2WONB 4GVBA 1E6YB 1MN7A 2FHMA 4I6YA 4IOAQ 1EP4A 2QLJB 2E1AA 1SJ1A 3OUYB 1SV5B 5KFBA 4PXBA 2OIHA 3DKDA 3CCLS 4LF5J 3J81U 1ZA1B 3MM5B 1F2GA 2ZC3A 3ILOA 4ZJQA 1H6KX 3H5UA 3C6UB 4IKAA 1FRHA 1GNKA 4KFBB 4DPOA 2CZ9A 4HKQA 2PO4A 3M9MB 3K59A 1YJUA 3RW6A 3G6VA 5HN0A 4FS1A 1HBOA 1SH0A 2GGPA 3JYTA 3A13A 1N54B 3DGPA 2V2KA 1IWAA 3FC9A 1Y5IB 5KFSA 1LWXA 2JNJA 2QMUB 4AXIA 4CLUA 4X4SA 1VISA 4RNFA 1CSJA 2B0GA 4WP3A 1S1XB 3QSIA 5ADZA 2WZ1A 3DOKB 3VGVA 2W4CA 3JXOA 2NXEA 3HO1A 4IQXA 1SBRA 2UUTA 2HHUA 3PIPQ 3WC0A 2QFIA 2ZNYA 3CC4S 3AXMA 4DV7J 1HWKA 3OR2B 2B4UA 2CAJA 1NJZA 4DU7A 4EFAC 2DXFA 5EHHA 1HNIA 4WU3A 1VQOS 5J2NA 2FGCA 4FXWA 3M05A 4KV8A 4LF4F 1M5OC 3T1YJ 4CYUA 3G87A 1SJ3P 1RT5A 1TL3A 4L73A 2V94A 3LWMA 4UOFA 3MMBA 2FJAB 4ILMA 1YTYA 1O51A 4ZLPA 4QWEA 4CQ1A 1U45A 4JI7J 1HKAA 1Q81T 3UCZP 2PMZD 1KN6A 3KLFB 1U8SA 3ISZA 2DHXA 2Y0SD 3DRPB 4OX7A 1REVB 3W8GA 1RABB 2HFSA 3JQJA 4NA2A 3DDNA 4B3RF 4OYMA 2RJZA 2Y1RI 4NASA 1ZS6A 1NU4A 3GMGA 4Y3CA 1N8RT 4UY8T 4NLDA 4JI4F 4F4WA 1MMNA 8ATCB 1F9EB 2Z2YB 5DGBA 4K0KF 5IM0B 5D4PA 2J8AA 4J9UE 4P52A 4NRTA 2BKNA 3OL8A 2DR8A 3D4JA 1CJVB 4C0HA 1S97A 1JKHA 3Q86A 1C4CA 3MD1A 1RWVB 2JC1A 1C1CB 1I5OB 3EUNA 2WSEC 3I0SB 1BLUA 4FP9A 3ZO7A 3NMRA 4B3SF 1N32F 3TUJC 2YX1A 2ZKTA 3I5AA 2I6WA 2H51B 3GSDA 2R7RA 5DLFA 2ZD1A 5D4OA 3A8KA 2G2OA 2RAQA 3NGSA 1N33F 2VICA 1OPZA 1G7CB 4G6VB 1VQMS 2AGPA 1CJKA 4DR1J 2HIYA 3VVUA 3F73A 1QVGR 2HVIA 3QWPA 4OZLA 2YNIB 3L9ZA 1I6JA 1VJQA 2HHPA 3IRXB 3MAHA 3EMTA 3ETOA 2XGPA 2GQ2A 3QATA 2G2YA 4LBPA 1HW9A 2VDHA 4RJVA 3UE2A 3BQ2A 3KK3B 2CPZA 1WHXA 4DL5A 2AYEA 4RLEA 4U7UK 4DV0J 3D28A 3SYZA 4DL2A 1NJIT 4C4WA 4C8LA 2IYGA 1L3UA 3NXZA 3LO3A 4Z7CA 2I9SA 2BE7D 3QRPA 2HBYB 3X1LB 4D3GA 1WG1A 3CW2C 3N9UC 3WIUA 2B51A 5DDQC 4QBUA 5HQ8A 2VPYB 2KO1A 4JI0J 1PG5B 1Y5LB 1RI7A 1TUGB 4NYOA 4C8MA 3ZZZA 3GP9A 4LT6A 4OI1A 1M1HA 5HP1B 2BKOA 5IQQA 1Q79A 3IM8A 2CPIA 4WK1A 3OFGA 2ZH8A 1SCJB 2IY5B 2C3UA 4H4OB 4DZDA 5C24A 1QY7A 3BPSP 2B5JA 3RRHA 1IKWB 1S9FA 1WDDA 4LFBF 1WI8A 4Y2AA 5LM7E 2FVPA 4X4QA 2A10A 3W2VA 4L75A 1AXQA 3M8SA 1U1KA 1N6QA 1KONA 4S0MA 4J9RA 2OEKA 1NPPA 2QX0A 1DQAA 1DURA 2V4JB 2X51A 4WYLA 5E3CA 1ELOA 3W9IA 4ZVPB 4FZVA 3W5XA 4X62J 3CCRS 3HDSA 1RAJA 3PHTA 3U1NA 3C14A 1RTJA 1HI8A 2AEJA 2BJ3A 2GJ2A 2MEWA 3CCWA 1YGYA 3NGUA 4L74A 4LSNA 4NX9A 5F8LA 3ZTRA 2FD2A 2DO0A 4CO4A 1R3NA 5F8NA 2E1PA 2DCLA 4O3PA 1X4FA 5A8KA 4DFMA 3TWZA 4LFAJ 2YKMB 4MIAA 3GILA 2W8LA 2CWKA 2FHJD 3I4PA 5D0RA 4Q8FA 1S57A 1R0CB 2P6TA 1U09A 4JYAF 1ITPA 1JJ2R 2OP5A 2DO8A 2VASA 1CG2A 1SUQA 2DHSA 2VKRA 3PR5B 1SL0A 1HNVA 2QEXS 2OPQA 2HEKA 4RW6B 3NOCA 3LOUA 3B4MA 3KLIB 3QGPA 4G1QB 4KKOB 4DX8H 1VR6A 2W9CB 1U48A 1MSWD 2LQJA 2LEBA 4B02A 3RB4A 4HHJA 4LF8J 4HTIA 1UVJA 1NDPA 4F0MA 3MR2A 1KVJA 1RT6A 3LP0A 2GZOA 5DDRC 3D67A 5FLXY 4BDPA 4PRFA 3M8QA 1S9GB 4ZVFA 3T5KA 2OD6A 2UUWA 5FIIA 4CI0B 3LGHA 4MYTA 1M1KT 3SEOA 1TL7B 2JH3A 3TA1A 3WX8A 5KFZA 4A8FA 1JLGA 4KY3A 5T14A 3HFKA 4A8SA 3J7A1 3P5TL 3LQVA 4NLQA 4RW7B 3HT3A 2EKNA 4ZOSA 2E9RX 2XGQA 3R9LA 2P6SA 2A1BA 3DOMB 3UI3A 4N56A 2B4OA 3IAS9 4I67A 5J2QB 1YJ9S 2LMIA 1NHKL 2ABYA 3UCGA 4ES2A 4Q0BB 2O01C 2N7CA 3V81A 3ZTSA 3EXCX 4RW9A 1R0AB 4URSA 1NK4A 1EX8A 1NRKA 2JZ5A 2X1BA 2KG0A 1BWEA 1RWMB 1UVKA 5D6GA 1KHVA 1IKXA 1RISA 2OHDA 3CCTA 3CE8A 5FDLB 3G4SS 3DI6A 3C6TB 1HBOB 2GGPB 1WTFA 4X65F 3KLVA 2HLTA 3K5OA 4WXOA 5IT0A 3I9ZA 5AXNA 1FVSA 2KT5A 4UQTA 1IM4A 4DV3F 2DPJA 5GADI 2D41A 4F3QA 2F4VJ 2VB6A 2ZBQA 3OXLA 1MMLA 2FTRA 2NPFA 4TU7A 3PR4A 4AL7A 3ZZTA 5KFLA 1KLMA 4IFYA 5A6PA 2UUCJ 3AODA 1V9OA 3EGWB 3BQ1A 3OR2A 3AOBA 4QYRA 4NCGB 1QE1B 5J2NB 1NKCA 3QGHA 4OYIA 3CJKB 4EO8A 5AE1A 4QJVA 4CM2A 4DF8A 3IMQJ 3KKFA 4O23A 2FLOA 4TYAA 5HMYA 1RT1A 2N3OA 5DG8A 4F4XA 3ET6A 1SKRA 2FVQA 1DAXA 1F5CA 2Y0BB 2NZ4A 3CF5Q 5T7LB 2RRAA 4DF4A 1ACMB 1L5UA 1DTQA 4Y65A 4HYKA 2DGUA 1RB0A 4A46A 3KLFA 1D3WA 3A8EA 3JSRA 4USTA 3BV8A 1FNXH 3G8TA 1WOSA 5F0UA 2XYGB 3GG1A 3TA0A 3G71S 5L1LA 2H4WB 3X3UA 3N79A 4NCAA 5CCMA 3Q8RB 5IWAJ 2RE1A 5ETNA 5T41A 3MTKA 5KFTA 5C42B 3PTWA 2ASLA 4ILLA 4FYWB 2HVEA 5DQIA 4K2XA 4DN0A 2RIJA 2QA4G 1S6UA 1X0PA 4U95A 4G3IA 4P75A 4C11B 1FVQA 4WKYA 4FF4A 4IUFA 3G82A 2YH0A 5M2UA 3G9CA 1JWWA 2W1BA 3OUYA 4LMZA 4L3KA 3VF0B 2EG2A 2BXJA 1O0PA 1HBNB 1MLAA 5E3AA 3THPA 2VQEF 1RT3B 4DUZF 2Y9HA 2L41A 2KTQA 2EW9A 4CCHA 1U8WA 3DM2A 4IOBA 4UOCA 1F3FA 4NLXA 1T0TV 3QJPA 5B0AA 1WI6A 2XMMA 3QIPA 1QSLA 1GMWA 3GYGA 2HQCA 3BDEA 1ZAWA 3O1LA 5K9FA 1NK5A 1RTIB 2KKHA 3BS9A 4KH1B 4USVA 2KG1A 1RKIA 3T9ZA 2LCWA 3ZZUA 4JI7F 2OO4A 4K0KJ 4DR2F 2E9TA 1RCXB 4QWCA 3H5YA 2HK3A 2VG7A 3C15A 3B78A 2VOOA 4PYAA 1IN0A 2P8IA 2ZH6A 1IM6A 3CIMA 3DOKA 4TVAB 3G2XA 4C0OC 1HI0P 3EVOA 1BQMA 1RWWB 3PJ9A 2WB1D 3FEXB 4WBFA 4O0IA 1RT7B 2ZHBA 2FHOB 2ASDA 1VGYA 2GFFA 2PI4A 2UVVA 4UOHA 5KFQA 2DNPA 2RH3A 2GQCA 2YX4A 2R2RA 2BJ7A 4YN3B 3JQMA 5DG9A 1ZZNA 1IBKJ 2D1CA 2Y3YA 4B9MA 4P74A 1TKDA 1Q5VA 1S48A 2QA2A 4DR1F 2CJBA 4DR5F 1RKJA 4QU7A 2F5GA 3MEDA 5KFPA 3PX4A 2HAFA 4PR6A 2F8HA 4RPFA 2C2OB 2I8EA 1T3NA 1SL1A 1KD1T 1FKOB 1O6XA 1H7XA 2C2NA 3MR7A 4DOZA 2DVIA 5CCLA 2ATCB 4Q43A 2H4YB 5DRKA 2HZCA 2DNRA 4NPOA 3HXMA 2M7SA 3BB5A 2CJXB 3HHEA 4KSEB 5IC4B 3JSMA 1JMTA 3KHHA 4CRJA 3D0IE 4PKDB 5IWAF 1EB0A 3KHLA 5AXMA 2P9CA 3MFIA 1M0SA 5K20B 4KJIA 2AD9A 3UVJB 1TR0A 2ZJPQ 2GQQA 3BSCA 3J7YU 2KYXA 3I96A 2BJ8A 3RGIA 2NR0A 3HLUA 1IQTA 1WF0A 4DPWA 5D78A 1OS5A 2YWFA 3BBCA 1BUXA 4X4NA 3MM9A 1HPZA 4UT4A 4QIFA 4PUOB 1PJ5A 1YRTA 4ZS6A 2HFNA 1YZ6A 2HZAA 4DUZJ 1H3DA 2G2ZA 2D3OR 3OTOJ 1RTDB 2HGNA 2IM3A 3WC2A 1FTCA 5LSRA 4ER8A 2EEYA 4DG1A 3FDSA 2RDDA 3MWBA 3NS5A 3TAPA 4MFBB 4BBYA 5CH7B 2FC8A 2JEGA 4KV8B 3LP1B 3GIRA 1KWMA 4IO1A 5G0RB 1QSYA 3BM7A 3I5BA 4DPYA 3BYPA 1RT5B 1TL3B 4DX6A 1NK0A 1M5VC 1NZAA 1VOMA 4LSZB 1IKWA 2MQQA 2BA9A 1TP7A 3OT9A 3KLEA 4O4GA 1IBMF 1BD6A 3DLJA 5L9XA 2A6OA 3BDPA 4TN2A 1KS2A 1R6YA 2J7WA 3BGRA 4OZJA 2VBYA 4RUHA 1E6VB 4FXDA 4OZ2A 1U0HB 1X7VA 3GJRB 1J5EF 2AHOB 4CP5A 5HQMA 1X4GA 2IFXA 5K14A 4DXLA 5GVQA 1YJ7A 3EGZA 2RILA 1FRJA 2V8DA 2DT9A 3OXFA 3DLHA 3TUZC 1C0TB 3RRGA 1YJTA 3C14B 3WZ0A 2WOMA 1T03B 5DDPC 2MXYA 3IGVA 2H48B 1IKVA 2LXUA 2QSFA 2MKSA 4GRSA 4M95A 2AJQA 4Q0BA 5EUHA 2JEJA 4JI3F 2V9WA 4E0DA 2DH9A 2ZDOA 3BO3A 2ALZA 2OJ3A 2BRKA 2GVDB 2HKEA 4CNYA 2KN4A 3K8WA 4FF1A 4FF3A 4ZCMA 4O3RA 4KHMA 4C0BA 2KXHA 3K5LA 3H0PA 3RW7A 3KLHA 2UZAA 5KFKA 1U1LA 2J0XA 1XBWA 4I2QB 2YBVA 1NO8A 4ZCKA 5I4MA 2E7WA 3E3XA 3M6UA 2A2DA 3MR3A 1DTTB 4KYZA 2AQ4A 5KFFA 3MECA 3MURP 3CNQP 1WOPA 2MLXA 2HHHJ 1Y7PA 3KJVB 5I42A 1SL2A 2KH9A 3L95X 2XC9A 4FPIA 1OIAA 3W65A 1UWAA 1S59A 1UFLA 3TEHB 4U8YA 2R7UA 4E8UA 2MKCA 1RWNB 4CLLA 3KK3A 5F3TA 3LA0A 4EBCA 1RA6A 1V3ZA 3CD6S 2OEJA 1MW7A 2MLZA 2DXDA 2E5GA 2HBRB 3JAMY 3S8SA 2BJ1A 4RNOA 1KTVA 2YKNB 1SKUB 2J7KA 5ETLA 5BJRA 3CJKA 2FQQB 1WC3A 2BQRA 4P71A 3PW0A 2B4PA 3RR7A 2XZDB 4RW6A 2FB0A 2AW0A 4LF6J 5KFMA 5KFAA 3NWGA 3KMSA 4UUWA 2O3DA 2CRLA 4CLKA 3PRBA 5KT5A 4LVNP 1FD2A 4Y6IA 3SQOP 2R7SA 5D3GA 2E29A 2W2QP 4H4KC 4RUCA 4IH7A 3OSNA 4LF7F 4NI2B 1TQLA 2QZ8A 2V8PA 3IR7B 3LGNA 1WKJA 2XWYA 4HDHA 5L8RC 3SSSA 4ES3A 2XZTB 4JI4J 1CJUB 1L3KA 1FXRA 4ID5A 2AEFA 1X4CA 4YB6A 3UD3P 1RAHB 2JL9A 3C8YA 4XDDA 4ZVEA 2GO8A 2VBWA 3MM7B 4DCJB 2G1HA 4M5HA 4NZ6A 5BYRA 2DY1A 3VZHA 3PJXA 2HGMA 1FX4A 4AD6A 2HHQA 1IXKA 5K8NA 1T3OA 2Y1IA 3HK2A 4YR2A 1XIQA 4MK7A 5LSLA 3IO1A 3CO9A 2FZCB 2HWIA 1YZ7A 3OBIA 3R5JB 3ISND 3D1OA 1FRMA 1JXVA 3GB0A 3MUTP 3KK1B 3K57A 1RU2A 3LP2A 4DJBA 3CD7A 1I51B 4TU8A 4DSLA 3AD7C 1NB7A 4Q2MA 4BLGA 1K44A 1HMVB 2FLPA 4MTPA 3CC2S 4IRKA 1G6BA 4ZITA 5CHCB 4F26A 4C8KA 4XDCA 2BQ3A 4ECRA 4ZVTB 3NS7B 3D3CJ 4PPDA 3MCOA 2DRAA 3QO9B 2A2CA 3QJJA 4KC5A 2KB2A 2ZBPA 5E33A 2W24A 2WW8A 3FZBA 3GR1A 2XY6A 3CC7S 1U6BA 1HHQA 2FJXA 4DL4A 2RQ4A 4LREA 2BMBA 4C98A 1WTBA 2V5HG 3K2YA 1J5OA 4O3OA 1FWPA 3NY0A 3TZXA 2UVWA 1XQIA 4K4WA 2JLFA 8RUCA 1SC6A 5CYMB 4IDKA 1UZHA 3HI9A 3KUEA 3I32A 4LSLB 2OPRB 2CPYA 3PYDA 4OHWA 4UTGA 4JI0F 4LFCJ 1FT8A 2ZH5A 3NAIA 1FKPB 2EBEA 1JJCB 3SV3A 1QAIA 2QL5B 2BJ9A 4NL5A 4CM0A 4YOEA 4QYZK 4W90B 5I3UA 1BWVA 1FKOA 1G4CA 1UEVA 2DEJA 2NYIA 5ETVA 3Q83A 4LFBJ 2VONA 4FVCA 1IVZA 3A3OB 1DQ9A 3FQLA 3Q8SB 2BOPA 4KPYA 2HHVA 5IS2A 5KT3A 5IFMA 3OR1B 3PNIA 4RW9B 4P7VA 4QW9A 1R0AA 1OSCA 2BDPA 3PW4A 1HQUA 2CNOB 4DS4A 3QIPB 3CDUA 1GXTA 4IH6A 3SFGA 2FLLA 2E9ZA 4OZNA 1RTIA 1YLXA 2EKYA 2KRBA 3KWMA 4ID8A 1IR0A 1NB2A 2CXEA 1B64A 2JVOA 2VG5A 5HANA 3M32B 3QT5A 2QLWA 3DRYA 1U6FA 4CLFA 4KRWA 3NCPA 3RU0A 4OV1A 4C11A 5C7PA 2M88A 3H20A 1X4EA 2VU5A 2XQCA 3T5LA 2FC9A 4NMXA 4OX9F 4PUOA 3EPIA 4DV1J 2E5LJ 2EK1A 3GR0A 5H9EJ 1N36J 1HARA 5L1IA 3W9JA 4NCGA 4JI5J 3IWNC 4F7VA 4WTOB 2C3YA 2POKA 4ZA1A 5FD1A 2WSFC 1SXLA 4OHXA 3DMJB 5DGAA 2HPUA 3HHLB 3MEDB 5KFHA 3VALA 4K4SA 3UQSA 2DGXA 1RHJB 1X5TA 4N76A 4ZMMA 4PG8A 3DFEA 5IXUA 2ZZMA 2DR7A 1H74A 1RTHB 4YHHF 1SKSA 2MKIA 2W7OA 3P3DA 4H4MA 4J37A 3P6YC 4RBTA 2GVZA 2ACYA 2W2NP 4X64J 2OAUA 4GKJF 2Q43A 2E44A 1IQZA 5IZHA 4WFBQ 1S9EA 1UJ4A 2BRLA 2B9YA 1BY9A 2GIFA 3BN7A 3HJVA 3PACA 3UN2A 4F3MA 2V8HA 1JLEA 2OKQA 2QT7A 1UJ5A 2DISA 5EWEA 4RNNA 4P2FA 3UO0A 2C22A 3CJSA 2Y8WA 3UD4P 2LLZA 3IRWP 3NOGA 4DSJA 2K1RB 3UCUP 3OL7A 4OL8A 1RXOB 3POTA 4OYZA 5CZVA 2HMIA 3FSXA 4F3OA 2ZBIA 1TVRA 2ALYB 1YG0A 3TVZA 3MD3A 3AH6A 1S10A 2BM1A 4IRDA 3ZTPA 2R3VA 5LOQA 3M8RA 3OTCA 3JSYA 2EG1A 4IG0A 1OY8A 3KLHB 2WW4A 2ROPA 4ZDNA 1IBMJ 4ICLB 3A3PB 5B08A 3ILLA 1UKUA 2VQFF 4ED5A 2B8PA 1X8DA 2NXUA 4ZP7A 4BWMA 1W2BR 1KFSA 4JV5F 1K1QA 4MMOA 2DJWA 3KHGA 1NLKL 1WSVA 3BZQA 4F36A 3OXGA 3ZTQA 4X66J 4LIRA 5DG7A 1PKUA 3DRXA 2NXNA 2WRMA 1JIHA 4RW8A 1U2CA 3UVJA 4NE9C 2Z30B 3GPAA 1P1LA 3O5TB 2HVZA 2LQBA 3MTJA 4KO0A 5HLFA 3PHEA 1CULB 4QPTA 2M5YA 3GIJA 2HAIA 3RR8A 4F4ZA 3I4HX 1U24A 2DGOA 3HVTB 3LF0A 4V19J 1D1UA 7FDRA 1FF2A 1KHWA 4ED1A 1N33J 1PYOB 2MY8A 2IM0A 3GZ7A 3V6HA 3DHWC 2WOMB 4JI5F 3W64A 4ZVQB 5J1NA 3THTA 2IM1A 4ED6A 2ASJA 4FN5A 1X60A 3LP1A 2QO3A 2J7UA 1NHVA 1WF2A 4I7FA 1SQGA 3FFIA 4MJKA 5K5MA 4WXWA 2CQ0A 2F4FA 2QMWA 4U67Q 2K8GA 1VQKS 2CNLB 2R7XA 1PBUA 2G13A 4USUA 1RWOB 4O4GB 4EYHB 2K3IA 3G96A 3JQKA 4M5MA 4I56A 4X64F
chains in the Genus database with same CATH topology
2GZOA 2AJ2A 2GS5A 2EW0A 2HRXA 2DO8A 2MUIA 2HAFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GZO A;  2AJ2 A;  2GS5 A;  2EW0 A;  2HRX A;  2DO8 A;  2MUI A;  2HAF A; 
#chains in the Genus database with same CATH topology
 1Q8B A;  3FVY A;  2IBO A;  2LKZ A;  4ECQ A;  4F8R A;  2V50 A;  3GCW P;  1XMO F;  3H2V E;  2MKJ A;  1DHM A;  2AYB A;  3MEK A;  3KJV A;  4DV2 J;  4ED8 A;  4CDI A;  2B9X A;  1S1V A;  2ZWO A;  1KVK A;  2KI2 A;  1Q7Y T;  5JUM A;  5F8G A;  1ICE B;  2CJY B;  2V4Q A;  2NXC A;  2VFR A;  5KG7 A;  1UVN A;  4UUX A;  1B3T A;  2JLG A;  5I3Q A;  1W25 A;  3BRE A;  4Q45 A;  4F2R A;  4AL6 A;  4IH5 A;  2MYF A;  3R3T A;  2R8I A;  1XC9 A;  1WWH A;  1QLN A;  1S7H A;  1ZPV A;  4ITS A;  3HSG A;  3K5M A;  1NHU A;  4WKR A;  5M2R A;  4K4Y A;  2R7V A;  2QLX A;  3ULH A;  1RTD A;  4MYU A;  2VA2 A;  3A3N B;  2V2V A;  3I0R A;  4WFY A;  3KNA A;  2FJW A;  2W7A A;  1LWE B;  2PMW A;  3MCN A;  5GAG U;  1DFD A;  4DUT A;  4X66 F;  2IBK A;  3HZG A;  5B0F A;  1UW9 A;  1SIW B;  1WJ9 A;  1GFW B;  3HD1 A;  4OZ1 A;  3PEJ A;  2R4F A;  1HQE B;  2WB4 A;  3KJN B;  2CPD A;  4UOG A;  1DLO A;  5A76 A;  1PC4 A;  4TYB A;  2MGZ A;  3JTP A;  3J7Z 5;  5GMK a;  2LXI A;  3CJ4 A;  3D1Q A;  2IVM A;  1NCL A;  2XSF A;  4YUD A;  3HHD A;  1U7L A;  3M2R B;  2R8H A;  1PYT A;  2XMT A;  1V3R A;  1E6V A;  3PY8 A;  5KFJ A;  2UXB J;  4ILR A;  1B99 A;  3LAK A;  4HT5 A;  5K14 B;  4DR3 J;  4DR4 J;  3DDK A;  2EBG A;  5KFD A;  2DNM A;  3UR3 C;  2QL7 B;  4I64 A;  1FFS B;  2RB7 A;  2Z58 B;  2MKH A;  4I68 A;  4F50 A;  3WX4 A;  1R31 A;  2O66 A;  2C28 A;  4NLT A;  1WC6 A;  4I0W A;  2B9W A;  1IKV B;  1K73 T;  3FMB A;  1N34 J;  4NXN F;  2DTJ A;  2JOQ A;  2F9D A;  3BEG B;  1NZ8 A;  2B8Q A;  3DLB A;  1DJ0 A;  4F0K A;  1HL6 A;  3ENV A;  3PVX A;  2XWX A;  4EK2 A;  4KFB A;  1NSK L;  1CC7 A;  3DHX A;  4DL3 A;  2C2Z B;  4ZLN A;  3NNH A;  4LF2 A;  3PX6 A;  1FWL A;  4I2Q A;  2K2P A;  3NCR A;  1D9D A;  2MQL A;  3R7N B;  3TAM A;  5LMN J;  2CQ3 A;  2FUG 9;  5M2P A;  1LK5 A;  1S5Z A;  2OPP A;  5KFR A;  3T1H F;  1V5I B;  5A6W A;  3SCJ E;  5I42 B;  1GMV A;  4RWX A;  1XNQ F;  4JP8 A;  4CTA B;  2MUI A;  2F63 A;  2WVD A;  5DM6 Q;  3IA0 A;  1ZTW A;  4P6Q A;  1H73 A;  3I56 S;  1F2H A;  3CUN A;  1RWU A;  4Q5V A;  2W8K A;  2AIR B;  1AW0 A;  3W3S A;  1KFD A;  2NLW A;  2PA3 A;  2WVC A;  2PFD A;  4W98 A;  1HWU A;  4OQJ A;  4IDK B;  3DLE B;  5KTQ A;  2HQI A;  1ZM4 A;  4YME A;  5KAK A;  3TA2 A;  1JJ4 A;  1UA0 A;  3CT9 A;  2YXL A;  3OTE A;  3DLG A;  3Q8U A;  1ZM2 A;  3MMA B;  4NLU A;  4NEZ A;  2MJU A;  4GO7 X;  4X4U A;  2ZEJ A;  1SV5 A;  2C2M B;  2ZOG A;  1B7F A;  1MNE A;  3BGL A;  1HHT P;  2BQU A;  2N7Y A;  3BBF A;  1NND A;  3HP6 A;  3QZ8 A;  1NSP A;  3J80 Y;  4B9U A;  2K06 A;  2EC2 A;  1NKB A;  4WFA Q;  3NNC A;  1T8E A;  3OLA A;  1S9E B;  3T1A A;  2VPW B;  1BHN A;  1R8H A;  2OPS A;  4OX8 A;  4UF4 A;  2C3O A;  3PXG a;  2F65 A;  5HQL A;  2ZE2 A;  1S1W A;  3QT6 A;  5ETK A;  2E5L F;  2EXU A;  4EO6 A;  1TMJ A;  4LSL A;  3BYR A;  4RX6 A;  4DMZ A;  3Q8Y A;  3BSN A;  2MZS A;  4IQM A;  2HMI B;  1J27 A;  3EVW A;  3D6F B;  2QV6 A;  3OHA A;  1VBX A;  1C1C A;  3I0S A;  3BQ0 A;  3M2U B;  3TX0 A;  4B3T F;  1TL1 B;  2CQB A;  4JB8 B;  3O2I A;  3SMZ A;  1KOO A;  2CVE A;  2ZD1 B;  3DCA A;  3EZU A;  3UWT A;  3KK1 A;  4M94 A;  4X4V A;  1QM9 A;  1RHK B;  1YSJ A;  3FEZ A;  4HHU A;  1B70 B;  2UUA F;  4QCL A;  2EW0 A;  1HNI B;  1OYE A;  1GXU A;  1TL4 A;  3VCD A;  2WTF A;  3IRX A;  5H9F K;  4CYU B;  3QZ7 A;  1T94 A;  3NKY A;  1G3O A;  4RW8 B;  1Y4Z B;  4OFZ A;  3EGN A;  3K5N A;  2Z57 B;  1NDC A;  1NUE A;  1TKX B;  1X31 C;  2M2B A;  4R0E A;  3K89 A;  4ECT A;  1TTH B;  2K7J A;  2Y8Y A;  1S1X A;  4ZKA A;  2I1R A;  2GAH C;  3GYN A;  1U4B A;  4FPR A;  1OQ6 A;  2DNL A;  3TOQ A;  4DQR A;  3B82 A;  3EXY A;  1X9M A;  3J80 U;  1NK7 A;  2VQE J;  2MQP A;  2ZHA A;  3PRD A;  3NGK A;  3TQE A;  4BC9 A;  1NSQ A;  4LVO P;  4LRD A;  1OYD A;  2JVR A;  3D1H A;  1BQX A;  3VZI A;  1FEE A;  2JHE A;  3DNC A;  4A8X A;  3MUM P;  1HA1 A;  3CCU S;  1RAO A;  5DO2 A;  4ECW A;  1VJW A;  1Q1K A;  1RA7 A;  4WK3 A;  5GME A;  1FRI A;  4ETZ A;  1HR0 J;  1D8Y A;  2ZUG A;  4N47 A;  2GX8 A;  3GII A;  2GHP A;  2RD5 C;  2Y1L B;  3PEH A;  2J6T A;  3MM5 A;  4EWT A;  1S12 A;  2LU1 A;  2VFT A;  1P9Q C;  1UL3 A;  4ANE A;  2N4D A;  9RUB A;  3AQP A;  2AEM A;  2DH8 A;  2LDI A;  2JDJ A;  3AXK A;  3D54 A;  4HHH A;  1MRO B;  3DYA B;  2O67 A;  1RQ0 A;  5AE2 A;  4X62 F;  2ZM6 J;  4O3S A;  3VHQ A;  2AMC B;  4A8K A;  1RTJ B;  1CLF A;  4WZM A;  4Q44 A;  4I6A A;  1S79 A;  2EVZ A;  4DI6 A;  2QYC A;  1IR1 A;  4U6P A;  3T5J A;  4YR0 A;  4JI2 F;  4YR3 A;  1ZH5 A;  1Y3K A;  1T9X A;  1NDK A;  1S1T A;  1CQN A;  1X9S A;  5HJY A;  1RK8 A;  3TW0 A;  2B3T B;  2XCA A;  2RQC A;  3VAM A;  5LJ3 Y;  1R8A A;  2BAB A;  2HBQ B;  4U9R A;  4EMD A;  2IA6 A;  4EYI B;  4EBD A;  3KDO A;  2CQ1 A;  4USK A;  4USW A;  2JX2 A;  3OW2 R;  4ICL A;  1FKA F;  3NNA A;  4B9N A;  3GG0 A;  4ZN3 A;  2AF6 A;  3N5F A;  3V5R A;  3GTY X;  4DX5 A;  5L1J A;  4G1Q A;  1JQG A;  3DU6 A;  2W9C A;  4PQU A;  2G9O A;  2J0Q D;  1WD6 A;  3SCK E;  2MHE A;  2PEH A;  1B0P A;  2E5I A;  4LRB A;  2DR5 A;  4H4O A;  3BSO A;  4CNZ A;  1XNQ J;  4M1K A;  4RBU A;  1S6P B;  2JWN A;  2B5J B;  2LYV A;  2RUS A;  4X4R A;  3QJL A;  2MKY A;  3AQO A;  2LA6 A;  4NRU A;  4RO0 A;  4J9M A;  5HLF B;  3BH6 B;  1CUL A;  4LJM A;  3T3F A;  1AZS A;  3TVY A;  3VGS A;  1QVF R;  1REV A;  2L9W A;  3MUV P;  3AJ1 A;  2VOD A;  3H59 A;  3PM9 A;  3PRV A;  4G65 A;  4DV5 F;  2YTC A;  5B0G A;  3QRQ A;  2RRN A;  4AE5 A;  3KUH A;  4NCB A;  2XMJ A;  3CJ8 A;  1HBM A;  2B4V A;  3T1Y F;  3CDB A;  3QLH B;  1PSD A;  4ECU A;  2OH2 A;  5F41 A;  2YNH B;  3Q8P B;  1WF1 A;  2EPI A;  3GCX P;  3FSY A;  3QQC D;  4Y0F A;  1WG4 A;  1YK9 A;  2V9K A;  4OV6 A;  4AQY J;  3SDE A;  1N5Y B;  2M52 A;  4WFN Q;  1RHR B;  4IFV B;  2BE2 A;  1PO6 A;  3CWJ A;  1YJW S;  3F44 A;  1I1G A;  4TY9 A;  4FYD A;  1AA1 B;  3PV8 A;  1N6Q B;  4NLG A;  4CO3 A;  4P2S A;  1QAX A;  1RE1 B;  1RLD A;  3OTD A;  4OX6 A;  4JI1 J;  1APS A;  2DHA A;  4PAA A;  3W5Y A;  2XY5 A;  4OYW A;  1CEZ A;  1NME B;  3TI0 A;  1HI1 A;  3RB6 A;  4K4U A;  2H5I B;  2V67 A;  1RT6 B;  3LP0 B;  3VGT A;  2J0S D;  3SIP B;  2CQD A;  3O8W A;  1SH3 A;  5DS7 A;  3N6L A;  4L76 A;  1CJT A;  2MJN A;  3LH2 S;  5E3R A;  1SJF A;  1WHV A;  2CPX A;  3D68 A;  2BV3 A;  4C3K A;  2QLF B;  3D6T B;  1GX6 A;  3QT7 A;  3UN5 A;  2UXB F;  4RL1 A;  2GML A;  2CWX A;  2MQN A;  3QPI A;  5IT4 A;  2DNK A;  3R6G B;  1QTN B;  5KT4 A;  3KFW X;  2KJW A;  5E7O B;  4DUY J;  4NLS A;  1PCA A;  4OYB A;  2ERR A;  1AB8 A;  3ILJ A;  2VL1 A;  1FD8 A;  2IC3 B;  2V34 A;  1U02 A;  3AOC A;  1RT1 B;  3FBB A;  3GE9 A;  2XMW A;  3I0R B;  3MEE A;  4G1I A;  4A47 A;  2R2U A;  2VV5 A;  2MQM A;  1RYS A;  4C6A A;  3NG8 A;  3BO2 A;  3HKW A;  5GMD A;  5IOL A;  2V8V A;  2G0C A;  2FJB B;  1UW4 A;  1SQE A;  2YWG A;  3M6V A;  1XJW B;  2YNG B;  2KM8 C;  1S6O A;  2OMO A;  2WVB A;  1N5V A;  1U0S A;  1C1B A;  4K5S A;  2KFY A;  1FJE B;  4E2F B;  3VVT A;  4HH0 A;  2BM0 A;  3UR0 A;  4F04 B;  4B3S J;  3C16 B;  1N32 J;  1UZD A;  3M2R A;  1DAR A;  2VIH A;  1IUJ A;  3MPD A;  1Y3J A;  4WIQ A;  3EWG A;  1Q8K A;  3NWR A;  1JLA A;  3DN9 A;  4B3O A;  2K7K A;  4KGV B;  1KQG B;  3IBW A;  4FKX A;  4ZCL A;  1SQF A;  3HHL C;  1SKW A;  2YNF B;  3EE3 A;  5KFW A;  3DLK A;  3KK2 A;  1FDA A;  4NYZ A;  3EZ5 A;  2E1C A;  4CO5 A;  3OD2 A;  3MAQ A;  2BOA A;  3G82 B;  4ETX A;  5K8P A;  2KHC A;  2X3G A;  3W7B A;  3ZZP A;  3M8P A;  5CXT A;  4Y2I A;  3N4W A;  4ECS A;  1GTH A;  1QDU B;  3M8Y A;  3SQG B;  4B9V A;  3SZ2 A;  3KJF B;  3H5X A;  3DM2 B;  5EN1 A;  1QE1 A;  2DEI A;  3S7R A;  3V4I A;  3R2C J;  3VAI A;  3CCS S;  5EDW A;  1FK9 B;  3DRR B;  3B6B A;  3P8B B;  1LWC A;  1H72 C;  1IKY B;  1WC4 A;  4YP3 A;  3M6W A;  2AU0 A;  3DI6 B;  1F0X A;  3T41 A;  4DSF A;  2OI2 A;  4Y2C A;  4R5P A;  1U1M A;  2YVS A;  3IAM 9;  4V1A k;  1Y11 A;  2ZBR A;  4ED2 A;  1FTR A;  3T9N A;  1K9M T;  2JEF A;  1NJY A;  2BAN A;  1HQE A;  3FGV A;  1AUS L;  1GAO A;  1KC8 T;  1VBY A;  5C25 A;  4OJG A;  3CMA S;  3FMW A;  1BQM B;  5A0Y B;  4WFX A;  1VHF A;  4C2M A;  5F3Z A;  1S9G A;  4HH1 A;  4Y00 A;  2EWH A;  1RTZ A;  2V2Z A;  4DQP A;  2XBP A;  3V4M A;  2YPY A;  4DPX A;  2AX1 A;  2QJ3 A;  3CDE A;  1S1W B;  1Y5N B;  4GVL A;  4M5D B;  2A6M A;  4NLO A;  4AUK A;  1K47 A;  1UFK A;  3S1T A;  3BR9 A;  2UV8 G;  3DRS A;  4RNH A;  4O0N A;  5GAD U;  1VRU A;  3FZ2 A;  4F4K A;  3R27 A;  1TL1 A;  2GAG C;  3RBD A;  3PZP A;  3MM6 A;  5ETT A;  2UV8 A;  2XS5 A;  1TUV A;  2J5A A;  4DV6 J;  1DZ5 A;  1PYS B;  2DNN A;  1A7G E;  1GK8 A;  3W62 A;  2LP4 A;  3DDI A;  2HQD A;  3TZW A;  1XMB A;  2GCF A;  3PYF A;  3R7B B;  2ZOM A;  4CLY A;  3IM9 A;  1A6L A;  1XMO J;  4FNI A;  2ADB A;  1CS4 A;  3MMC A;  3E51 A;  1PIL A;  2ZE2 B;  1RJJ A;  3P45 B;  4FDF A;  1TKZ A;  3BO4 A;  3TJ9 A;  3PW5 A;  3I82 A;  2WBR A;  2OPP B;  2Q1L A;  2Q6C A;  1Z1Z A;  2CPH A;  2CQ2 A;  1NEE A;  3FQK A;  4KTQ A;  3FNN A;  4URQ U;  2C1E B;  3S6E A;  3M2U A;  4UZC A;  4UW2 A;  3H4D A;  1H0H B;  3KXD A;  2NPI A;  2ZH4 A;  4LF9 F;  2PC6 A;  3F41 A;  1XR5 A;  1VK8 A;  3H2L A;  1W2I A;  2IIH A;  4QIV A;  2E66 A;  1OPI A;  2FY8 A;  4YB7 A;  3MCM A;  4ECX A;  4OMF G;  4DZ6 A;  2MB0 B;  3FBE A;  3VQS A;  2QIF A;  1H2T Z;  3ZXW A;  1VFJ A;  2IM2 A;  2VHG A;  4ZPW R;  4X4P A;  2LDY A;  2GJF A;  3QNW B;  4EEY A;  1JLB B;  3F0N A;  2GV1 A;  2PE8 A;  3MMA A;  4PEO A;  4ZVO B;  5LMU F;  1VC5 A;  1FHT A;  2MHN A;  2DYA A;  3CGI A;  3WHI A;  3HPO A;  3GFY A;  3EGV A;  1TKX A;  2FPH X;  2Q79 A;  4DV4 F;  2DR6 A;  4FYY B;  5HBM A;  2GJI A;  3ETM A;  1LXN A;  2HQ3 A;  1K0V A;  3M7V A;  4Y28 C;  2CQ4 A;  5K8M A;  3Q8V A;  1UAW A;  5E0O A;  5DQH A;  1UVI A;  2VJU A;  2VZ9 A;  1RT7 A;  3FK4 A;  4KHP J;  2XS7 A;  2H3E B;  2C42 A;  1RSC A;  5K8O A;  4RUB A;  3M9N B;  1H2U X;  1EJ7 L;  4MAK A;  3MF5 A;  2IJR A;  1T7P A;  1G2E A;  4USJ C;  4XO0 A;  4JBC A;  1JNR B;  1GT8 A;  3FRY A;  4LBH A;  1NSA A;  5KOX A;  2R7W A;  1M5S A;  2DNY A;  3RJM B;  3TJA A;  1HBU B;  4WJB A;  4QIG A;  2DBB A;  3SDE B;  1WAC A;  2AJ2 A;  5KFC A;  1NJW A;  2BE2 B;  4M63 A;  4K2J A;  4HI1 A;  1PAU B;  3N01 A;  3D66 A;  1RT2 A;  1RT3 A;  2B6A A;  2R42 A;  3AJD A;  1RZM A;  3MEC B;  3H8Y A;  4C7Q A;  1SC4 B;  1LXJ A;  3KG1 A;  1GEH A;  1R7I A;  4MIW A;  4URG A;  1LWF B;  1V5V A;  2HBZ B;  2LEP A;  3BSA A;  4PZV A;  4QOT A;  2BKP A;  5KFX A;  5AE3 A;  2CJ9 A;  4KGM A;  3MR5 A;  4DV5 J;  2KFZ A;  1VQ9 S;  1Z2Z A;  2X1F A;  1T05 A;  4ED3 A;  2YQ1 A;  3OHB A;  3QWU A;  2VJV A;  2NCK L;  2ZKU A;  1VBK A;  2AX0 A;  3NGT A;  3GWC A;  4JV2 A;  2BJE A;  2OTL S;  5F8I A;  4M5I A;  5E41 A;  4DSI A;  1ZAX A;  2N4C A;  3TX8 A;  2BE9 B;  3K7R A;  4ZVG A;  4USM A;  2R7O A;  3K58 A;  2VQF J;  5D15 A;  1P6T A;  1WC0 A;  1X4D A;  3MEE B;  3ZZ0 A;  1Z4U A;  3QLH A;  4NOH A;  4UZB A;  3GV7 B;  1RBO B;  4KAI A;  5DDO C;  2HRU A;  1Y10 A;  2IHR 1;  4DG1 B;  4LF6 F;  5THW A;  1S99 A;  1HIY A;  4DS5 A;  3M2V A;  4B9S A;  2BYC A;  1KP6 A;  2HND B;  1LFW A;  4EU0 A;  2YNG A;  3QRR A;  4O3Q A;  2GHV C;  2UXC F;  3GIM A;  2OFG X;  3NAH A;  4F67 A;  2QLB B;  1U2R A;  2DNG A;  2E7V A;  2VPX B;  2YKA A;  3HFZ B;  4IFV A;  4DN9 A;  3W63 A;  3KLE B;  3R2D J;  1R8P A;  2BX6 A;  3MM8 B;  4J5O A;  1EQM A;  4K4X A;  1YHQ S;  4ERD A;  1UET A;  1RWK B;  1JLA B;  1VRQ C;  1A0O B;  2HNZ A;  2KVQ E;  3AHP A;  5F0W A;  5KG0 A;  3GV8 B;  2AJ0 A;  3SSR A;  4TY8 A;  1U26 A;  1YBT A;  2HLU A;  2KZZ A;  1B7Y B;  1Q16 B;  3N5B A;  4U8V A;  1HQ2 A;  2P9E A;  3BH7 B;  2F40 A;  3MPV A;  3BJY A;  1D9A A;  1FFW B;  3FBF A;  5B09 A;  4MIB A;  2GNK A;  2YNH A;  4DQI A;  3ITH A;  5J2P A;  4DQS A;  4DPT A;  3G6E S;  3R1H A;  2YKO A;  1M90 T;  3LP2 B;  2H65 B;  2JFK A;  3TZZ A;  3D9B A;  3H5S A;  3HM9 A;  1VQ8 S;  3KTQ A;  3V6D A;  5CD4 A;  2NS1 B;  4FYX B;  1U6Z A;  1EKS A;  4N8O A;  3KLG A;  3HSD A;  1VS3 A;  5HK4 A;  2NYH A;  1IKY A;  2JFD A;  4DSE A;  2CG8 A;  2XMU A;  2YX7 A;  4JI6 J;  3ZNJ 1;  5AXK A;  2QN6 B;  4B9L A;  1W26 A;  1RAE B;  2HS0 A;  2V63 A;  2BR0 A;  3OTB A;  4HT7 A;  5HI7 A;  5BXI A;  2GS8 A;  2HG4 A;  5G0R A;  1G1X A;  2HVH A;  5A8R A;  1U47 A;  1JXE A;  1ZM3 A;  3IG1 A;  1KKH A;  5L9N A;  3G6Y A;  3PO4 A;  1JNZ B;  2YKP A;  3CCV S;  5BYS A;  1R27 B;  4ZIV A;  3UNG C;  2RKI A;  3KG4 A;  4FXV A;  4YS2 A;  2PGC A;  1L3S A;  3BGR B;  4OZ3 A;  1TV6 B;  3MFH A;  2EFP A;  4F02 A;  4C3L A;  2V4R A;  1U0H A;  2HWH A;  1XR7 A;  1OSD A;  3NEK A;  4LRA A;  1I94 J;  4WYW A;  2OTJ S;  2L9N A;  3PDN A;  3ZNU A;  3IR6 B;  3TRG A;  3BR8 A;  4JI8 J;  3ONQ A;  2RS8 A;  2V68 A;  4RUA A;  4DR7 J;  1TAU A;  2RQK A;  1RAI B;  4DL0 C;  4J9P A;  2M8H A;  1JLF A;  1OY6 A;  1NPR A;  2G1D A;  3SQG A;  4K4Z A;  1UFW A;  4IR1 A;  2A0F B;  1QUV A;  2GVD A;  4Z7Y A;  2CZV C;  3L7P A;  4RU9 A;  2HWT A;  2R2T A;  1N4L A;  1RAC B;  2YQ0 A;  3D5M A;  1IJF B;  2YWE A;  4QR1 A;  5G4D A;  4XPE A;  2CIM A;  1EKR A;  1LWC B;  2GC8 A;  3IP0 A;  1LV5 A;  1YBU A;  1WEY A;  3C16 A;  1TKT A;  3O44 A;  2DXE A;  4QZV B;  4WE1 A;  3THV A;  1HFE L;  2KU7 A;  2PII A;  3QGI A;  6AT1 B;  1VQY A;  2UP1 A;  4YDX A;  4DR3 F;  3H90 A;  4Q8E A;  1UWB B;  1FJC A;  4B3O B;  4R8U B;  4MK9 A;  4KE5 A;  5HSP A;  3CCM S;  3OFF A;  3MM7 A;  1X5S A;  1OJ4 A;  2GO9 A;  2CPF A;  1IJE B;  1YVF A;  4ZVU B;  2L08 A;  5A0Y A;  2HNY B;  2PA8 D;  1N5S A;  2BEF A;  1SI9 A;  2MZJ A;  3HKZ D;  4DV1 F;  3OL9 A;  2KFN A;  4WTY A;  1C4A A;  3OFH A;  5J2M A;  3NGD A;  1HD0 A;  5IV3 A;  3FKB A;  1QSS A;  4ZHR B;  2WBM A;  2IDL A;  4M5D A;  3GYX B;  3LTO A;  4Y34 A;  3W2W B;  4QW8 A;  2CNK B;  3O3L A;  2KXN B;  2AYM A;  1AUD A;  1OMS A;  1A9N B;  3S01 A;  5HRO A;  4PYD A;  2OEM A;  4ZLL A;  3L09 A;  1FKP A;  2DGV A;  3P96 A;  1E6Y A;  2IC3 A;  2ILY A;  4KIA A;  3SCI E;  1EP4 B;  3MPU B;  1EET A;  1FE0 A;  4FNH A;  3TAR A;  2ROG A;  4R0J A;  4R5P B;  4FF2 A;  2XI3 A;  3J81 j;  2R7T A;  2B9E A;  1RLC L;  3TEG A;  1NH8 A;  1U2F A;  2ASY A;  2XEX A;  1PBA A;  4QPX A;  3FEY B;  3QO9 A;  4YB5 A;  2BAN B;  4GKJ J;  4C9D A;  1UJ6 A;  1HYS B;  1SB6 A;  4Y2K A;  1LW2 B;  2QG9 B;  2V69 A;  3HF5 A;  4RBV A;  3MAA B;  3MI7 X;  3P4U B;  5CD4 H;  5D3G B;  2KXF A;  1SJQ A;  4O44 A;  1F1B B;  5D0E A;  4ZVR B;  1H2V Z;  3FBC A;  1FES A;  1TKZ B;  5L39 A;  1VQ5 S;  4TU9 A;  1JLQ A;  3NP5 A;  1RYR A;  2H54 B;  3CPW R;  1Y9O A;  3QID A;  4WZQ A;  2CVI A;  3HFV A;  4EBE A;  3CME S;  2CA9 A;  3K5P A;  1GMW D;  1M5K C;  1T11 A;  2C3M A;  4USH A;  2W25 A;  3SCL E;  3TJ8 A;  3MM6 B;  5I3U B;  1UCN A;  1GXL A;  5L1K A;  4PXD A;  1MWZ A;  2VBZ A;  4OYX A;  3OSP A;  4JV5 J;  1GQE A;  5KT6 A;  1XNR J;  1CJK B;  2DD8 S;  5U47 A;  4DV4 J;  3UDL A;  1KQK A;  2ACM A;  1UMJ A;  4EUV A;  1HQU B;  2H5J B;  1FXL A;  5A2Q Y;  1S7I A;  3LPY A;  1CPZ A;  4KT0 C;  4LR9 A;  1CS4 B;  2MZ1 A;  2C2D A;  3AA8 A;  3NL0 A;  2R7Q A;  1UPM B;  1RHQ B;  2AZ3 A;  3BPD A;  1NXI A;  1R0B G;  2J9E A;  3AAW B;  2D3Z A;  4ZLJ A;  5H1S V;  2N82 B;  2AV5 A;  3CB4 A;  4FS2 A;  1UVM A;  2XY7 A;  2VD3 A;  3H25 A;  4QIW D;  4CLP A;  2HIQ A;  1JLC A;  2W2O P;  2OSR A;  4M5L A;  5C25 B;  2HRX A;  4ELT A;  1CVJ A;  5HMW A;  2RRB A;  4OHY A;  1HW8 A;  4DUY F;  1F6T A;  3O6Q A;  4A8O A;  1N56 A;  2WAQ D;  1WKL A;  1JLE B;  2KM8 B;  3D2W A;  1QAJ A;  2CZ4 A;  1VQ4 S;  1CQM A;  1MU2 B;  1FRX A;  1VRT A;  1F9H A;  1MMD A;  4OZ5 A;  1YKW A;  3D3B J;  5CYM A;  3UW1 A;  4Z2X A;  5CAA A;  2F3J A;  5KFO A;  2RT3 A;  4ENO A;  3T5H A;  5SZT A;  4FBU A;  1UPP A;  3DMJ A;  5MLC V;  3KMQ A;  1URR A;  2MST A;  3DRS B;  2Q3P A;  2ROE A;  3FFI B;  1JLB A;  3BF4 A;  1Q7L B;  1Z2L A;  3MMB B;  1RAA B;  1TL5 A;  1P9Y A;  1QAY A;  4RW4 A;  3RTV A;  2HQG A;  4BC7 A;  3MCS A;  4XK8 C;  2HVD A;  3UFC X;  1RWX B;  3SSQ A;  2OEL A;  3D7S B;  3OR1 A;  3PKM A;  3E8O A;  2GIQ A;  1HWJ A;  3FUY A;  4HEA 9;  2YNI A;  2DNZ A;  1WEL A;  1PJ7 A;  2IDE A;  4KGZ B;  2GHW A;  3Q89 A;  1FE4 A;  4C8N A;  1OWX A;  1X4H A;  2VBX A;  4QR2 A;  4I69 A;  3T6J A;  2N3L A;  4NZ0 A;  4LBI A;  5H9F J;  2HFO A;  2FY1 A;  4IRC A;  1U1Q A;  4LF8 F;  4K8R A;  1CJV A;  2FJE B;  2JC0 A;  5B0E A;  1FI4 A;  1ZZF A;  3L3C A;  2RQM A;  3OJS A;  3PG9 A;  1U49 A;  5HO4 A;  2OFH X;  4J7C A;  4DDF A;  2XHC A;  3W1Y C;  4RZR A;  4JUZ A;  2FDN A;  2M3D A;  3Q2T C;  1RT2 B;  2XYP B;  1P8G A;  3ZZO A;  2ZH9 A;  1C2P A;  4MT1 A;  1H98 A;  3EPG A;  4TLR A;  3D6H B;  5L38 A;  2W9B A;  3V6J A;  1XN9 A;  1NK8 A;  2XSJ B;  2UUB J;  3EVM A;  1X5O A;  3NRB A;  4PAB A;  2BUN A;  5AJ3 F;  1DLO B;  4C8Z A;  1FRK A;  5C24 B;  3KUG A;  3IFE A;  5CA5 A;  4IG3 B;  1T05 B;  2PI5 A;  3ZZY A;  3GLJ A;  3PCO B;  4KO0 B;  2ZVS A;  3MGJ A;  4BHQ A;  1FCA A;  1VLO A;  1MWQ A;  3ELH A;  4Q2L A;  5KG1 A;  5KG2 A;  4UY8 5;  1UVL A;  2EFV A;  3RB0 A;  3CJ5 A;  4H4M B;  3DRP A;  3VAK A;  1N36 F;  1S76 D;  2X1G A;  2NXJ A;  4KGX B;  4B3R J;  1K0T A;  3T19 A;  2HUR A;  3W61 A;  4X65 J;  3HT0 A;  3KOA A;  5A2Q U;  3JB9 k;  4NLV A;  2ZC4 A;  2DGQ A;  4MKB A;  4NXN J;  4MKV A;  1YRX A;  2MDA A;  4LIW A;  3CCQ S;  3CDW A;  2F8M A;  1T9W A;  1MWY A;  1SVD A;  2V2Q A;  5D4N A;  4OIX A;  3M2V B;  3R5D A;  5HMZ A;  3ENW A;  3POT B;  5AT1 B;  3V81 B;  2C2R A;  2R8K A;  1F60 B;  5DZ6 A;  4XIU A;  5D77 A;  3KJQ B;  1Q82 T;  2HYI B;  2IMW P;  3AOA A;  1WG5 A;  4NXM J;  2XCP A;  4Y2M A;  1IWG A;  1EZZ B;  3NLC A;  4NLR A;  8AT1 B;  3HZE A;  1R8B A;  3EYZ A;  1YIJ S;  1HNV B;  3R6L B;  4MH8 A;  1FJG J;  3ZTO A;  3TNV A;  1ZTT A;  2JRS A;  3LGM A;  2V4J A;  1VIX A;  2XB2 D;  1YWX A;  5ETQ A;  3TQ1 A;  4BS2 A;  2HQF A;  4A48 A;  4KHR A;  1R43 A;  2WK4 A;  1BC6 A;  1EIY B;  2RDJ A;  1NBE B;  1VQ6 S;  2WHO A;  3ZZR A;  4JI8 F;  4C97 A;  3PIO Q;  1UEU A;  3M8Q B;  1Y0H A;  3NBP A;  3HVR A;  1K8A T;  2L3M A;  4X2B A;  3QT8 A;  1FXD A;  3Q23 A;  2D3O 1;  1GH8 A;  3TUP A;  3ITH B;  5J2P B;  1TV6 A;  1RCO B;  5KFY A;  3DLE A;  3HVT A;  4DV0 F;  1VYA A;  9ATC B;  4ZJO A;  2J0W A;  2AZ1 A;  1JLG B;  2HRT A;  3HVW A;  4JV1 A;  3QAE A;  2HSE B;  4ZPT R;  5GAH I;  4QU6 A;  1D09 B;  2XUL A;  4J9N A;  3DLG B;  4KH0 B;  1FEH A;  1RBL A;  3PW7 A;  2GMH A;  2ZFH A;  2ZIT A;  4PXE A;  2IVF B;  2ZZN A;  1WOO A;  2P2C B;  5GAE I;  5J2Q A;  1LWE A;  4N7T A;  2OPQ B;  1R89 A;  2CNN B;  3N28 A;  1FWK A;  5L46 A;  1DTQ B;  3ENA A;  3TAQ A;  2J6S A;  3NMA A;  2E5J A;  3RYL A;  4K59 A;  1EQ0 A;  1XTZ A;  2XO6 A;  1Q78 A;  3EDR B;  4JOU A;  4CH1 A;  2JJ4 D;  2AKW B;  5EWF A;  7FD1 A;  2OGU A;  2UXD F;  3P49 B;  1X5P A;  2PD1 A;  4YB1 P;  1D8Z A;  4E98 A;  3CUL A;  3ADA C;  3IBC B;  3G8S A;  4N41 A;  2W01 A;  2IA0 A;  2VFV A;  5A8W B;  5C42 A;  1HNZ F;  3VTI A;  4ELV A;  4WP8 A;  5HVG A;  4DR5 J;  3I31 A;  1RAG B;  4DPU A;  2BAC A;  3CJ2 A;  1YJN S;  1S0M A;  3C46 A;  4ZPD A;  1FA0 A;  3L7U A;  4B3T J;  4DWI A;  2J8S A;  1ZYQ A;  1M5H A;  4OJ3 A;  4GKK F;  1LKZ A;  3CCZ A;  4DR2 J;  3M1V A;  1HNW J;  3CJQ A;  2YWK A;  3SBM A;  1BE4 A;  1Q0N A;  2UVR A;  4ZP6 A;  4O3N A;  1KR4 A;  1WUU A;  3QBC A;  3CCJ S;  4K4T A;  2W2P P;  4P10 A;  4P72 A;  3W2W A;  2DIU A;  5A8K B;  5KT7 A;  2H9Z A;  5CYQ A;  1TUW A;  5DJB A;  5CQG A;  4AYB D;  4J91 A;  5HRO B;  1GTE A;  4MKY A;  3Q22 A;  5D0G A;  4EZ6 A;  1TKT B;  4WE1 B;  2RU3 A;  1KLN A;  3CO0 P;  1H7W A;  2CQP A;  3RUB L;  3ET6 B;  3C2P A;  4CH0 S;  1REG X;  2RML A;  5KT2 A;  2FZG B;  3RZA A;  4B08 A;  1ZPW X;  3G86 A;  3KLI A;  4KKO A;  2KDO A;  4R8U A;  4YDD B;  5DQG A;  4DL7 A;  4DCO B;  2VG7 B;  3PO5 A;  1T9T A;  3AA9 A;  3IBF B;  3IGN A;  3W8P A;  4XPC A;  3OVA A;  2LA4 A;  1UTA A;  4OJH A;  4P73 A;  4O4R A;  3GSI A;  1N5Q A;  5DM7 Q;  1KLM B;  1JB0 C;  3PFE A;  3IXQ A;  4IFY B;  4X84 A;  1NH7 A;  1U25 A;  3OLB A;  5F9L A;  4HAC B;  5F8M A;  5HAT A;  2NUH A;  2Z0G A;  4ZK7 M;  3LAM A;  2J9C A;  2RNE A;  3BKT A;  2ZDP A;  1XNR F;  3M8W A;  1TL7 A;  4H4K A;  4P2M A;  1L3T A;  5IT9 U;  3DXB A;  1KOH A;  2KT2 A;  3BBB A;  3D6M B;  4PXC A;  5E2Q A;  2MY7 A;  1T9Y A;  4ATN A;  5B0C A;  4RW7 A;  1XK8 A;  2CPJ A;  2WCX A;  2PSZ A;  3FRZ A;  4YY3 F;  3HMJ G;  4TXS A;  2CJA A;  4N8N A;  1EET B;  3QAU A;  3RG6 A;  4TQS A;  2DO4 A;  2F7V A;  2ZHO A;  5T7L A;  5LSO A;  1HBN A;  3WQP A;  1RT4 B;  1RU1 A;  4HLB A;  4LR8 A;  4PPZ A;  2NZC A;  3TP2 A;  4EGL A;  1J5E J;  3UNY A;  4G1P A;  3TR5 A;  3W60 A;  3GFH A;  1HHS A;  2AT1 B;  2EFN A;  3JSM B;  2GMJ A;  1S72 S;  4RR5 A;  4ZJL A;  4P9S A;  2CPE A;  1KQS R;  4WU2 A;  2C2K B;  2QSW A;  4DX7 A;  1VDH A;  2C3P A;  4WII A;  5FDL A;  5KFI A;  4ECY A;  3FSI A;  2QFJ A;  2UVU A;  3UDC A;  5KG6 A;  1T9V A;  3U1M A;  3CCE S;  3CIZ A;  4DLG A;  4TNO A;  2HHT A;  3I6P A;  5SUH A;  2ADC A;  4GKK J;  3MEG A;  2W4P A;  1WC5 A;  4PG7 A;  5B7W A;  4DV3 J;  3DLL Q;  1TAQ A;  2MMY A;  1TFW A;  1PIE A;  4WF9 Q;  3NCQ A;  4J9O A;  1SC3 B;  5J2M B;  1F5B A;  3SFU A;  1TK5 A;  4GC6 A;  1MU2 A;  1VRT B;  5EGY A;  2XLI A;  1S1U A;  3A12 A;  5KG3 A;  4U7U D;  4I4B A;  2I0X A;  3IR5 B;  4NYP A;  2HHH F;  2RS2 A;  1KTQ A;  1T9U A;  3UPF A;  2XSJ A;  4F4Y A;  5LL6 d;  2AGO A;  1AT1 B;  2DNQ A;  1Q5Y A;  1WEZ A;  4AXJ A;  4KB7 A;  2MQO A;  3JAM U;  3OJU A;  2FVR A;  2L48 A;  3FCV A;  3UD5 A;  3RAQ A;  1WHW A;  4USI A;  1N34 F;  3CED A;  1LNQ A;  1KRP A;  1C0U A;  4OJ1 A;  4WCE Q;  5DZ7 A;  4ED7 A;  2Y1J A;  1NM2 A;  1WSR A;  3TO8 A;  3J7A N;  2HHX A;  2YWW A;  3D0G E;  2OSQ A;  1LW2 A;  2NSB A;  1ZBT A;  1VI7 A;  1SC1 B;  4CO0 A;  4DBQ A;  4FBT A;  2CQI A;  2OPS B;  3R5G A;  3RAM A;  2J9D E;  2HHS A;  2X7I A;  4XAK A;  5ETR A;  6FD1 A;  2LEC A;  5LXY A;  3HHK A;  4KR0 B;  2QC3 A;  4OLP A;  1YJR A;  1LEO A;  1BMQ B;  2NSC A;  4LRF A;  3QFH A;  5LMN F;  4DR7 F;  5E3P A;  2HFV A;  5E3Q A;  1ULR A;  2DIT A;  2OD4 A;  3CMQ A;  3N6N A;  1XMQ J;  2DRD A;  2PFF B;  1N5Y A;  1HPZ B;  4YQW A;  4B9T A;  2G4B A;  1NK6 A;  1EAY C;  2D9O A;  4ZN1 A;  3DC2 A;  2YPZ A;  3BKF A;  2ILZ A;  2ZUA A;  1TK8 A;  1U1P A;  1CBK A;  3OPK A;  4JI1 F;  4K5R A;  3VGU A;  2NRE A;  2ZBC A;  4W92 B;  1HD1 A;  3CD0 A;  4KBI A;  5B0B A;  1N48 A;  2HHW A;  1GX5 A;  4PQU B;  3CD5 A;  2I5J A;  3TZY A;  2ZWP A;  4DHV A;  1WNE A;  1D9F A;  3QGG A;  3OVB A;  4KHP F;  4PWD A;  4IOC Q;  2BW7 A;  1KDN A;  1BQN A;  2L9D A;  1HNX F;  3US5 A;  1OQ3 A;  4BWJ A;  1JJH A;  1S6P A;  1LQ9 A;  3NBP B;  3RRK A;  3PFO A;  3H42 A;  4DL6 A;  4IO9 Q;  1CJT B;  3RBE A;  5D8H B;  2E1R A;  3I55 S;  4N77 A;  4ZVH A;  3C15 B;  3DGV A;  1U1N A;  3HX9 A;  3HSJ A;  1JLC B;  3MM9 B;  2YKN A;  3U27 A;  2WSC C;  3VQT A;  3EX7 B;  3R8Y A;  4J9K A;  5HAO A;  4ZPB A;  1KBR A;  4RKU C;  5FLX U;  2QTW A;  1RAF B;  5JVG Q;  1S0O A;  3LWL A;  5FJ4 A;  3PW2 A;  2FYX A;  2DPI A;  3AB4 B;  2R8J A;  1O8B A;  2CQC A;  2B43 A;  2KJV A;  1IBK F;  1U1O A;  2XM3 A;  2VG6 A;  2V6A A;  2MQ8 A;  4MFB A;  4M5K A;  4QYZ J;  3HVA A;  2EI5 A;  3M30 B;  2W9B B;  4B17 A;  5LJ5 Y;  4ANC A;  2GW8 A;  2GA7 A;  3A4T A;  3MOJ B;  2KT3 A;  4IG3 A;  3N6M A;  2F1F A;  1YJV A;  3TYT A;  3U7J A;  4NI2 A;  4RW4 B;  2ZH1 A;  1EHW A;  3R1L A;  3P5B P;  1VC0 A;  1FJG F;  1KVI A;  2FIU A;  1WC1 A;  3PYE A;  1DTT A;  2PT0 A;  5KFV A;  1AZS B;  5KOW A;  1N5T A;  4ID5 B;  4CT8 A;  2BJD A;  1WEX A;  2YH1 A;  1FJ7 A;  2H5E A;  1MRO A;  3DYA A;  4KQZ A;  2R9L A;  4EZ9 A;  1C0T A;  1HWL A;  1YDL A;  4K4V A;  1HBM B;  1OY9 A;  1PJ6 A;  3R97 A;  4C3M A;  1VBZ A;  2QYG A;  1KQF B;  4C48 A;  4I2P A;  5KFG A;  3E2E A;  3L4B C;  2ZJR Q;  4DCP B;  4C8Y A;  1S1T B;  1AFI A;  1X4A A;  2KVI A;  2W4D A;  1AYE A;  3GJS B;  2DNH A;  5CYQ B;  5ITH A;  3KHR A;  2B7B B;  3DRR A;  3EDQ B;  3U1L A;  4ZIW A;  2IRY A;  3CTR A;  3ZC4 A;  5IV4 A;  2XI2 A;  1VLY A;  2ZM6 F;  3K0J A;  4CT9 A;  2IVY A;  1GMU A;  3OTO F;  1T95 A;  1HLW A;  2ZNZ A;  2OLW A;  3GIK A;  3SI8 A;  1Q86 T;  4ZVS B;  4LF1 A;  4DFJ A;  4LF4 J;  1F5A A;  1RAD B;  3ZFV A;  1NDL A;  3JSB A;  4OI4 A;  2Z4P A;  4TKT A;  1TFY A;  1UP1 A;  4ED0 A;  1YX2 A;  1UA1 A;  2HS3 A;  2HRY A;  4HR2 A;  1RDR A;  3UDE A;  5KFE A;  1VQ7 S;  1RHM B;  1IBL F;  1M5P C;  3MHY A;  2UU9 J;  5A8W A;  2Z56 B;  4M8L A;  2QL9 B;  4OI2 A;  4NZ7 A;  3MPY A;  4OLO A;  4DFK A;  5ETS A;  5CZX A;  1J2V A;  4HVZ A;  5CAB A;  4ECZ A;  2V0N A;  4DQQ A;  3CDA A;  4JI6 F;  1L3V A;  2XS2 A;  3DLK B;  3KK2 B;  2WON A;  3AD8 C;  4GVB B;  4ZP8 A;  2FVS A;  2AWZ A;  5KFN A;  1T03 A;  1URN A;  3I9V 9;  3M1V B;  2LQ9 A;  3PKY A;  3ISN C;  2LQ8 A;  3VR1 A;  4JI2 J;  1LW0 A;  5ETM A;  4JI3 J;  3SXL A;  2UUC F;  2MLY A;  3C6U A;  2IYI A;  1QD1 A;  1VMB A;  1FK9 A;  1QJH A;  3WIV A;  3MOZ A;  1HMV A;  1R8C A;  2RHQ B;  3R5B A;  2FJV A;  1CC8 A;  2NUU G;  3EJM A;  1SH2 A;  3BN4 A;  3M6X A;  2G0J A;  4F25 A;  1XER A;  5JMN A;  5J1P A;  2Q66 A;  1CJU A;  2W9A A;  4IR9 A;  1FFG B;  2IAJ A;  3LUY A;  1I94 F;  4ZP9 A;  2PEB A;  5GAE U;  2XLK A;  2QMX A;  3TAN A;  3AT1 B;  5B0D A;  3VV2 B;  3M32 A;  3FCH A;  4P2X A;  1WHY A;  5E5N A;  2YNF A;  3HHL D;  2E7X A;  2LFV A;  3LW5 C;  5EX3 A;  3V2U C;  1Y00 A;  2APO A;  3DOL A;  1VQL S;  4DR6 F;  2M0G B;  1KNZ A;  3C66 A;  2NQP A;  4AQY F;  4NEY A;  3B4D A;  3M8P B;  4WFZ A;  1JX4 A;  2RUG A;  3ILI A;  1J5O B;  4CLS A;  1JXL A;  1D0E A;  3AD9 C;  4HAC A;  1B0V A;  5RUB A;  1ZM9 A;  3V6K A;  2J6U A;  1S1U B;  2X1A A;  4U7C A;  3J7Y I;  1N52 B;  2QGF B;  2I38 A;  2CG4 A;  2M4M A;  3LPE A;  4M5N A;  3AB2 B;  4QR0 A;  1FNO A;  2DCU B;  2FZK B;  2IMO A;  2IRX A;  3HHL A;  2XNR A;  4J90 A;  3F56 A;  2UUB F;  2Z2L A;  5BR8 J;  1S6Q B;  5F8H A;  2MZT A;  5MAO A;  3MDF A;  2AP6 A;  2E5H A;  1O5J A;  4KPC A;  5HVF A;  1YBA A;  1PGZ A;  1PAE X;  2ZJQ Q;  4F0H A;  5HBM B;  1C1B B;  2ZH7 A;  5JJB A;  1Q8I A;  2CFX A;  2U1A A;  3G8Q A;  3KNG A;  5J1E A;  5KG5 A;  2UU9 F;  4NLW A;  2MZR A;  2XMV A;  2XG8 A;  3M4X A;  3MMC B;  5C2C A;  4LF7 J;  1VQP S;  3R7S B;  3DGP B;  3HUL A;  3R5A A;  4ZPV R;  4DFP A;  2ATL A;  1NK9 A;  1VHI A;  3A8I A;  3VAG A;  1IBC B;  2LEA A;  2VG5 B;  1YIT S;  1SJR A;  3KYL A;  1TVR B;  2VFS A;  2QRR A;  5EWG A;  2D3U A;  1HBU A;  2LQ5 A;  3PX0 A;  1VRU B;  4I1T A;  1SJ4 P;  2CDR B;  3ENQ A;  4ALZ A;  4DSK A;  2M9K A;  3VAJ A;  4TQR A;  2LVW A;  3JS9 A;  3W5Z A;  4OI0 A;  3GQC A;  3FJ2 A;  3MMJ A;  4QWA A;  2Z2Z A;  3QFW A;  1RT4 A;  2AYG A;  2IPO B;  1VCT A;  4NXM F;  4L3N A;  2D9P A;  1QTM A;  1NPK A;  4CO1 A;  2VKZ G;  3V4I B;  1V6H A;  4B3M J;  4ECV A;  3BGU A;  1ZA2 B;  2DHG A;  3QSY B;  3WDO A;  3E01 B;  1ARO P;  3VWS A;  2JEI A;  2RHS B;  4GC7 A;  1H38 A;  3MXH P;  3CJR A;  1W7W A;  4QIE A;  3D0H E;  4ELU A;  2BVZ A;  2RF2 B;  4LF5 F;  1N0V C;  1BXN A;  2X3D A;  5IT9 Y;  1F9F A;  4RU2 A;  1FO1 A;  2RSQ A;  2D74 B;  2DHH A;  2AJ4 A;  2LXF A;  1TK0 A;  4BCA A;  2Z2M A;  1FDB A;  3IS9 A;  3PYG A;  4J9L A;  4FVM A;  2MZQ A;  1N0U A;  3LAL A;  2D69 A;  3CSK A;  3IWX A;  3B8H A;  3C19 A;  4NA1 A;  4RWW A;  1M1G A;  3IC1 A;  4MKA A;  4OYP A;  2EK6 A;  1V3S A;  2OPR A;  3DXS X;  4WPA A;  3M30 A;  2EFG A;  2HND A;  2KL8 A;  4J9S A;  2FVC A;  4LQ3 A;  2XHW A;  3GJQ B;  4CZC A;  1KSP A;  2VC1 A;  2VUG A;  1DBD A;  4I7F B;  4A8W A;  3W9H A;  2M8D B;  1S0V A;  2HFU A;  4WP9 A;  1RGV A;  2VF3 A;  3I87 A;  1FDN A;  2KRR A;  2MSS A;  2OML A;  4HL9 A;  4IG0 B;  1FDD A;  1RWP B;  2FJD B;  3MM8 A;  4A4J A;  1C0U B;  4MK8 A;  4DV7 F;  2YQ3 A;  4A8M P;  1RTH A;  2IJN A;  3J7Z T;  4CO2 A;  2WVF A;  4OHZ A;  3A1Y G;  1XEZ A;  3GON A;  3BKU A;  2VFU A;  2A3J A;  1HNZ J;  4OHV A;  3IN5 A;  4XTT A;  4PWD B;  3BGF A;  1FER A;  3HD2 A;  3AFG A;  1X4B A;  3L7O A;  1Q95 G;  3NGR A;  1ROF A;  2J9D A;  4OI6 A;  4PWW A;  2ZVI A;  1MN9 A;  1BGX T;  3OFE A;  2FHK A;  3TUI C;  4PG6 A;  4AT1 B;  4QWD A;  3JYT B;  4J9Q A;  1S4E A;  2CJQ A;  2K1R A;  2PMH A;  4NA3 A;  2CQG A;  1K1S A;  4N5S A;  1RHU B;  2RDI A;  1HNW F;  3UN3 A;  1JKH B;  2J76 E;  3CJ0 A;  2K3K A;  2E1M C;  2MPU A;  2V8G A;  3B54 A;  2DGT A;  3KG0 A;  3MEG B;  2YKM A;  3G6X A;  1QUP A;  4DV6 F;  3OV7 A;  1YQH A;  3TVK A;  3Q24 A;  1NJX A;  1DQ8 A;  2CJK A;  1RP5 A;  2DB1 A;  5KFU A;  4P7T A;  4OX9 J;  1Q4R A;  1SUQ B;  4A8Q A;  3N0V A;  2Q6B A;  1B4S A;  4Z37 A;  4YHH J;  1LOU A;  2VG6 B;  3QYY A;  1DY3 A;  5HJX A;  5JVH Q;  4A8Y A;  4RNM A;  2M70 A;  4AND A;  1P27 B;  1WOR A;  2BZ2 A;  2H1Y A;  3KDN A;  1LWF A;  3OVS A;  2ZH3 A;  4K7Q A;  4WWS A;  5C5J A;  2DK2 A;  3IG1 B;  3JTN A;  4HI2 A;  2YKQ A;  1PC5 A;  2DKO B;  4UQG A;  3CJ3 A;  2MTL A;  1EAR A;  2RU9 A;  2YWH A;  5GAG I;  1IBL J;  2AJ1 A;  2A18 A;  3IWL A;  4CLZ A;  3EIC A;  2FHJ A;  4R25 A;  2XNQ A;  2EFO A;  1WDT A;  3I5C A;  1S0N A;  1VQS A;  1ZOT A;  3HSZ A;  3ICL A;  2FLN A;  4V19 X;  3H98 A;  2HNZ B;  2GVZ B;  3NS6 A;  5LT5 A;  3CXC R;  2O1P A;  2F9J A;  2RVJ A;  2I2Y A;  3HCX A;  2HZV A;  4M5G A;  2DY9 A;  2CAD A;  3EM1 A;  4OI3 A;  1X9W A;  2B7C B;  3RAX A;  2DGS A;  2VDI A;  2XYH B;  2HW3 A;  4YY3 J;  2CDQ A;  3QMQ A;  5IM0 A;  5C2G A;  3T1H J;  5KG4 A;  1ZAV A;  2HK2 A;  3RBX A;  5DLG A;  1LW0 B;  5AJ3 J;  4GO5 X;  4F2S A;  1P1T A;  5ETO A;  4AL5 A;  3Q0A A;  2HFZ A;  2QA1 A;  2XTJ P;  3FCW A;  3BGO P;  2O5D A;  2XMA A;  2U2F A;  3KLG B;  4LF9 J;  4W4M A;  1IKX B;  3JTO A;  4GMK A;  4CLT A;  2WVE A;  4ZPC A;  3W2V B;  1RBA A;  4YEA A;  2COL A;  3M8Z A;  2B6A B;  3CVK A;  3Q8Q B;  1UWB A;  2C2E A;  1U1R A;  2CUY A;  2I5J B;  2F8E X;  3Q2S C;  4NLP A;  1JK9 B;  4NWB A;  5A8R B;  4CIO A;  1BQN B;  1KEK A;  1S1V B;  3GJT B;  5LMU J;  5D0H A;  3VAF A;  1F3V A;  2XLJ A;  1X0F A;  3GFX A;  4X4O A;  2CKW A;  3W66 A;  1IR2 A;  4PWU A;  5D4L A;  3J81 Y;  4I2P B;  5DET A;  3MZI A;  4FYV B;  1XR6 A;  5LXR A;  5IC6 B;  4OZ0 A;  3GU0 A;  4QQB A;  1S49 A;  1OO0 B;  4LFA F;  2AJF E;  4LUB A;  3MR6 A;  2AGQ A;  2XZW A;  1TZ0 A;  4OYO A;  2P9G A;  1VIO A;  4JV0 A;  4JYA J;  2ZZT A;  4LR7 A;  5BYQ A;  1UEK A;  2D7S A;  3GV5 B;  5JXS A;  2HS4 A;  4DLE A;  5I3P A;  1JLF B;  2PDA A;  2JSX A;  3T6B A;  4B3M F;  3C3L A;  2IRU A;  5GAH U;  5HP1 A;  1NAQ A;  2HGL A;  2LU2 A;  3UDV A;  2OUG A;  2QE5 A;  4HDG A;  4L72 B;  4EI2 A;  3SV4 A;  2MGZ B;  2DR9 A;  4DR6 J;  2DRB A;  1HYS A;  2KZM A;  1Q53 A;  2VC0 A;  2SXL A;  2UUA J;  1RUS A;  4I6W A;  2QA4 S;  3C6T A;  1FNM A;  1FRL A;  3AY0 A;  2VH7 A;  4H54 A;  3TAM B;  2BBE A;  4ES1 A;  1MG7 A;  2EFQ A;  4YFU A;  1YRU A;  2IAJ B;  3M9O B;  1TEL A;  1ZET A;  2KYZ A;  2VA3 A;  4DU8 A;  2VPZ B;  4PG5 A;  1N88 A;  2KHD A;  2W2M P;  2R8G A;  2BW2 A;  4PG4 A;  4TY8 B;  1B0T A;  3CJT A;  2Z8Q A;  3U02 A;  5F8J A;  2IJF A;  2JLE A;  4J9V A;  4DV2 F;  1HWI A;  2DNO A;  4QWB A;  1SIZ A;  3GFZ A;  3OQ2 A;  1Q8L A;  3AJ2 A;  2HNY A;  3DOM A;  2CQH A;  4LSN B;  4AFF A;  5HVH A;  5BR8 F;  2W7P A;  2MKK A;  6FDR A;  4NML A;  2G0I A;  4F4A A;  2PN6 A;  4CH7 A;  2DH7 A;  1S77 D;  4CWB A;  4PCQ A;  4C8O A;  4ZCI A;  4CLW A;  1VC6 A;  3H7H B;  5HL7 Q;  2UXD J;  3V6D B;  3OL6 A;  4NLY A;  3E01 A;  4L6V 3;  1I3O B;  4X4T A;  2GIR A;  4Q7A A;  5EX0 A;  1XMQ F;  1NKE A;  4LFC F;  4M5J A;  1SPB P;  1XWL A;  4FKY A;  1YI2 S;  1VQN S;  1S6Q A;  1LFP A;  2ZH2 A;  1HNX J;  4HTJ A;  4ZPA A;  5AXL A;  2RF2 A;  1FX2 A;  3RBZ A;  1HR0 F;  4K50 A;  4IYQ A;  4ED4 A;  2CYY A;  5CYJ A;  3R5C A;  3A8J A;  1LK7 A;  1WKK A;  2DGW A;  4LQ9 A;  4KGK A;  1T02 A;  4DEZ A;  2EC0 A;  1TMM A;  3EZO A;  4CTA A;  1TU0 B;  3K17 A;  3DOL B;  1S4F A;  3IS9 B;  5ETP A;  2UXC J;  4OYA A;  3MAA A;  5HMX A;  1AFJ A;  2GS5 A;  2ZOF A;  4D3H A;  5J1E B;  2RKI B;  3HJF A;  7AT1 B;  3MPW A;  3H4B A;  2FGO A;  2DIV A;  4PQA A;  2B56 A;  5IQ6 A;  4O44 B;  3LAN A;  1DRZ A;  1R6V A;  3H40 A;  4ZHR A;  3VAH A;  3HHN B;  3H2U B;  2YY3 A;  3WBZ A;  2XMK A;  1JLQ B;  2VOP A;  1VK3 A;  5F9N A;  2P5V A;  4LRC A;  4TLQ A;  3DU5 A;  3K8V A;  2XO7 A;  3RB3 A;  5H9E K;  4U96 A;  3PJW A;  2F4V F;  2R2S A;  4DR4 F;  2WON B;  4GVB A;  1E6Y B;  1MN7 A;  2FHM A;  4I6Y A;  4IOA Q;  1EP4 A;  2QLJ B;  2E1A A;  1SJ1 A;  3OUY B;  1SV5 B;  5KFB A;  4PXB A;  2OIH A;  3DKD A;  3CCL S;  4LF5 J;  3J81 U;  1ZA1 B;  3MM5 B;  1F2G A;  2ZC3 A;  3ILO A;  4ZJQ A;  1H6K X;  3H5U A;  3C6U B;  4IKA A;  1FRH A;  1GNK A;  4KFB B;  4DPO A;  2CZ9 A;  4HKQ A;  2PO4 A;  3M9M B;  3K59 A;  1YJU A;  3RW6 A;  3G6V A;  5HN0 A;  4FS1 A;  1HBO A;  1SH0 A;  2GGP A;  3JYT A;  3A13 A;  1N54 B;  3DGP A;  2V2K A;  1IWA A;  3FC9 A;  1Y5I B;  5KFS A;  1LWX A;  2JNJ A;  2QMU B;  4AXI A;  4CLU A;  4X4S A;  1VIS A;  4RNF A;  1CSJ A;  2B0G A;  4WP3 A;  1S1X B;  3QSI A;  5ADZ A;  2WZ1 A;  3DOK B;  3VGV A;  2W4C A;  3JXO A;  2NXE A;  3HO1 A;  4IQX A;  1SBR A;  2UUT A;  2HHU A;  3PIP Q;  3WC0 A;  2QFI A;  2ZNY A;  3CC4 S;  3AXM A;  4DV7 J;  1HWK A;  3OR2 B;  2B4U A;  2CAJ A;  1NJZ A;  4DU7 A;  4EFA C;  2DXF A;  5EHH A;  1HNI A;  4WU3 A;  1VQO S;  5J2N A;  2FGC A;  4FXW A;  3M05 A;  4KV8 A;  4LF4 F;  1M5O C;  3T1Y J;  4CYU A;  3G87 A;  1SJ3 P;  1RT5 A;  1TL3 A;  4L73 A;  2V94 A;  3LWM A;  4UOF A;  3MMB A;  2FJA B;  4ILM A;  1YTY A;  1O51 A;  4ZLP A;  4QWE A;  4CQ1 A;  1U45 A;  4JI7 J;  1HKA A;  1Q81 T;  3UCZ P;  2PMZ D;  1KN6 A;  3KLF B;  1U8S A;  3ISZ A;  2DHX A;  2Y0S D;  3DRP B;  4OX7 A;  1REV B;  3W8G A;  1RAB B;  2HFS A;  3JQJ A;  4NA2 A;  3DDN A;  4B3R F;  4OYM A;  2RJZ A;  2Y1R I;  4NAS A;  1ZS6 A;  1NU4 A;  3GMG A;  4Y3C A;  1N8R T;  4UY8 T;  4NLD A;  4JI4 F;  4F4W A;  1MMN A;  8ATC B;  1F9E B;  2Z2Y B;  5DGB A;  4K0K F;  5IM0 B;  5D4P A;  2J8A A;  4J9U E;  4P52 A;  4NRT A;  2BKN A;  3OL8 A;  2DR8 A;  3D4J A;  1CJV B;  4C0H A;  1S97 A;  1JKH A;  3Q86 A;  1C4C A;  3MD1 A;  1RWV B;  2JC1 A;  1C1C B;  1I5O B;  3EUN A;  2WSE C;  3I0S B;  1BLU A;  4FP9 A;  3ZO7 A;  3NMR A;  4B3S F;  1N32 F;  3TUJ C;  2YX1 A;  2ZKT A;  3I5A A;  2I6W A;  2H51 B;  3GSD A;  2R7R A;  5DLF A;  2ZD1 A;  5D4O A;  3A8K A;  2G2O A;  2RAQ A;  3NGS A;  1N33 F;  2VIC A;  1OPZ A;  1G7C B;  4G6V B;  1VQM S;  2AGP A;  1CJK A;  4DR1 J;  2HIY A;  3VVU A;  3F73 A;  1QVG R;  2HVI A;  3QWP A;  4OZL A;  2YNI B;  3L9Z A;  1I6J A;  1VJQ A;  2HHP A;  3IRX B;  3MAH A;  3EMT A;  3ETO A;  2XGP A;  2GQ2 A;  3QAT A;  2G2Y A;  4LBP A;  1HW9 A;  2VDH A;  4RJV A;  3UE2 A;  3BQ2 A;  3KK3 B;  2CPZ A;  1WHX A;  4DL5 A;  2AYE A;  4RLE A;  4U7U K;  4DV0 J;  3D28 A;  3SYZ A;  4DL2 A;  1NJI T;  4C4W A;  4C8L A;  2IYG A;  1L3U A;  3NXZ A;  3LO3 A;  4Z7C A;  2I9S A;  2BE7 D;  3QRP A;  2HBY B;  3X1L B;  4D3G A;  1WG1 A;  3CW2 C;  3N9U C;  3WIU A;  2B51 A;  5DDQ C;  4QBU A;  5HQ8 A;  2VPY B;  2KO1 A;  4JI0 J;  1PG5 B;  1Y5L B;  1RI7 A;  1TUG B;  4NYO A;  4C8M A;  3ZZZ A;  3GP9 A;  4LT6 A;  4OI1 A;  1M1H A;  5HP1 B;  2BKO A;  5IQQ A;  1Q79 A;  3IM8 A;  2CPI A;  4WK1 A;  3OFG A;  2ZH8 A;  1SCJ B;  2IY5 B;  2C3U A;  4H4O B;  4DZD A;  5C24 A;  1QY7 A;  3BPS P;  2B5J A;  3RRH A;  1IKW B;  1S9F A;  1WDD A;  4LFB F;  1WI8 A;  4Y2A A;  5LM7 E;  2FVP A;  4X4Q A;  2A10 A;  3W2V A;  4L75 A;  1AXQ A;  3M8S A;  1U1K A;  1N6Q A;  1KON A;  4S0M A;  4J9R A;  2OEK A;  1NPP A;  2QX0 A;  1DQA A;  1DUR A;  2V4J B;  2X51 A;  4WYL A;  5E3C A;  1ELO A;  3W9I A;  4ZVP B;  4FZV A;  3W5X A;  4X62 J;  3CCR S;  3HDS A;  1RAJ A;  3PHT A;  3U1N A;  3C14 A;  1RTJ A;  1HI8 A;  2AEJ A;  2BJ3 A;  2GJ2 A;  2MEW A;  3CCW A;  1YGY A;  3NGU A;  4L74 A;  4LSN A;  4NX9 A;  5F8L A;  3ZTR A;  2FD2 A;  2DO0 A;  4CO4 A;  1R3N A;  5F8N A;  2E1P A;  2DCL A;  4O3P A;  1X4F A;  5A8K A;  4DFM A;  3TWZ A;  4LFA J;  2YKM B;  4MIA A;  3GIL A;  2W8L A;  2CWK A;  2FHJ D;  3I4P A;  5D0R A;  4Q8F A;  1S57 A;  1R0C B;  2P6T A;  1U09 A;  4JYA F;  1ITP A;  1JJ2 R;  2OP5 A;  2DO8 A;  2VAS A;  1CG2 A;  1SUQ A;  2DHS A;  2VKR A;  3PR5 B;  1SL0 A;  1HNV A;  2QEX S;  2OPQ A;  2HEK A;  4RW6 B;  3NOC A;  3LOU A;  3B4M A;  3KLI B;  3QGP A;  4G1Q B;  4KKO B;  4DX8 H;  1VR6 A;  2W9C B;  1U48 A;  1MSW D;  2LQJ A;  2LEB A;  4B02 A;  3RB4 A;  4HHJ A;  4LF8 J;  4HTI A;  1UVJ A;  1NDP A;  4F0M A;  3MR2 A;  1KVJ A;  1RT6 A;  3LP0 A;  2GZO A;  5DDR C;  3D67 A;  5FLX Y;  4BDP A;  4PRF A;  3M8Q A;  1S9G B;  4ZVF A;  3T5K A;  2OD6 A;  2UUW A;  5FII A;  4CI0 B;  3LGH A;  4MYT A;  1M1K T;  3SEO A;  1TL7 B;  2JH3 A;  3TA1 A;  3WX8 A;  5KFZ A;  4A8F A;  1JLG A;  4KY3 A;  5T14 A;  3HFK A;  4A8S A;  3J7A 1;  3P5T L;  3LQV A;  4NLQ A;  4RW7 B;  3HT3 A;  2EKN A;  4ZOS A;  2E9R X;  2XGQ A;  3R9L A;  2P6S A;  2A1B A;  3DOM B;  3UI3 A;  4N56 A;  2B4O A;  3IAS 9;  4I67 A;  5J2Q B;  1YJ9 S;  2LMI A;  1NHK L;  2ABY A;  3UCG A;  4ES2 A;  4Q0B B;  2O01 C;  2N7C A;  3V81 A;  3ZTS A;  3EXC X;  4RW9 A;  1R0A B;  4URS A;  1NK4 A;  1EX8 A;  1NRK A;  2JZ5 A;  2X1B A;  2KG0 A;  1BWE A;  1RWM B;  1UVK A;  5D6G A;  1KHV A;  1IKX A;  1RIS A;  2OHD A;  3CCT A;  3CE8 A;  5FDL B;  3G4S S;  3DI6 A;  3C6T B;  1HBO B;  2GGP B;  1WTF A;  4X65 F;  3KLV A;  2HLT A;  3K5O A;  4WXO A;  5IT0 A;  3I9Z A;  5AXN A;  1FVS A;  2KT5 A;  4UQT A;  1IM4 A;  4DV3 F;  2DPJ A;  5GAD I;  2D41 A;  4F3Q A;  2F4V J;  2VB6 A;  2ZBQ A;  3OXL A;  1MML A;  2FTR A;  2NPF A;  4TU7 A;  3PR4 A;  4AL7 A;  3ZZT A;  5KFL A;  1KLM A;  4IFY A;  5A6P A;  2UUC J;  3AOD A;  1V9O A;  3EGW B;  3BQ1 A;  3OR2 A;  3AOB A;  4QYR A;  4NCG B;  1QE1 B;  5J2N B;  1NKC A;  3QGH A;  4OYI A;  3CJK B;  4EO8 A;  5AE1 A;  4QJV A;  4CM2 A;  4DF8 A;  3IMQ J;  3KKF A;  4O23 A;  2FLO A;  4TYA A;  5HMY A;  1RT1 A;  2N3O A;  5DG8 A;  4F4X A;  3ET6 A;  1SKR A;  2FVQ A;  1DAX A;  1F5C A;  2Y0B B;  2NZ4 A;  3CF5 Q;  5T7L B;  2RRA A;  4DF4 A;  1ACM B;  1L5U A;  1DTQ A;  4Y65 A;  4HYK A;  2DGU A;  1RB0 A;  4A46 A;  3KLF A;  1D3W A;  3A8E A;  3JSR A;  4UST A;  3BV8 A;  1FNX H;  3G8T A;  1WOS A;  5F0U A;  2XYG B;  3GG1 A;  3TA0 A;  3G71 S;  5L1L A;  2H4W B;  3X3U A;  3N79 A;  4NCA A;  5CCM A;  3Q8R B;  5IWA J;  2RE1 A;  5ETN A;  5T41 A;  3MTK A;  5KFT A;  5C42 B;  3PTW A;  2ASL A;  4ILL A;  4FYW B;  2HVE A;  5DQI A;  4K2X A;  4DN0 A;  2RIJ A;  2QA4 G;  1S6U A;  1X0P A;  4U95 A;  4G3I A;  4P75 A;  4C11 B;  1FVQ A;  4WKY A;  4FF4 A;  4IUF A;  3G82 A;  2YH0 A;  5M2U A;  3G9C A;  1JWW A;  2W1B A;  3OUY A;  4LMZ A;  4L3K A;  3VF0 B;  2EG2 A;  2BXJ A;  1O0P A;  1HBN B;  1MLA A;  5E3A A;  3THP A;  2VQE F;  1RT3 B;  4DUZ F;  2Y9H A;  2L41 A;  2KTQ A;  2EW9 A;  4CCH A;  1U8W A;  3DM2 A;  4IOB A;  4UOC A;  1F3F A;  4NLX A;  1T0T V;  3QJP A;  5B0A A;  1WI6 A;  2XMM A;  3QIP A;  1QSL A;  1GMW A;  3GYG A;  2HQC A;  3BDE A;  1ZAW A;  3O1L A;  5K9F A;  1NK5 A;  1RTI B;  2KKH A;  3BS9 A;  4KH1 B;  4USV A;  2KG1 A;  1RKI A;  3T9Z A;  2LCW A;  3ZZU A;  4JI7 F;  2OO4 A;  4K0K J;  4DR2 F;  2E9T A;  1RCX B;  4QWC A;  3H5Y A;  2HK3 A;  2VG7 A;  3C15 A;  3B78 A;  2VOO A;  4PYA A;  1IN0 A;  2P8I A;  2ZH6 A;  1IM6 A;  3CIM A;  3DOK A;  4TVA B;  3G2X A;  4C0O C;  1HI0 P;  3EVO A;  1BQM A;  1RWW B;  3PJ9 A;  2WB1 D;  3FEX B;  4WBF A;  4O0I A;  1RT7 B;  2ZHB A;  2FHO B;  2ASD A;  1VGY A;  2GFF A;  2PI4 A;  2UVV A;  4UOH A;  5KFQ A;  2DNP A;  2RH3 A;  2GQC A;  2YX4 A;  2R2R A;  2BJ7 A;  4YN3 B;  3JQM A;  5DG9 A;  1ZZN A;  1IBK J;  2D1C A;  2Y3Y A;  4B9M A;  4P74 A;  1TKD A;  1Q5V A;  1S48 A;  2QA2 A;  4DR1 F;  2CJB A;  4DR5 F;  1RKJ A;  4QU7 A;  2F5G A;  3MED A;  5KFP A;  3PX4 A;  2HAF A;  4PR6 A;  2F8H A;  4RPF A;  2C2O B;  2I8E A;  1T3N A;  1SL1 A;  1KD1 T;  1FKO B;  1O6X A;  1H7X A;  2C2N A;  3MR7 A;  4DOZ A;  2DVI A;  5CCL A;  2ATC B;  4Q43 A;  2H4Y B;  5DRK A;  2HZC A;  2DNR A;  4NPO A;  3HXM A;  2M7S A;  3BB5 A;  2CJX B;  3HHE A;  4KSE B;  5IC4 B;  3JSM A;  1JMT A;  3KHH A;  4CRJ A;  3D0I E;  4PKD B;  5IWA F;  1EB0 A;  3KHL A;  5AXM A;  2P9C A;  3MFI A;  1M0S A;  5K20 B;  4KJI A;  2AD9 A;  3UVJ B;  1TR0 A;  2ZJP Q;  2GQQ A;  3BSC A;  3J7Y U;  2KYX A;  3I96 A;  2BJ8 A;  3RGI A;  2NR0 A;  3HLU A;  1IQT A;  1WF0 A;  4DPW A;  5D78 A;  1OS5 A;  2YWF A;  3BBC A;  1BUX A;  4X4N A;  3MM9 A;  1HPZ A;  4UT4 A;  4QIF A;  4PUO B;  1PJ5 A;  1YRT A;  4ZS6 A;  2HFN A;  1YZ6 A;  2HZA A;  4DUZ J;  1H3D A;  2G2Z A;  2D3O R;  3OTO J;  1RTD B;  2HGN A;  2IM3 A;  3WC2 A;  1FTC A;  5LSR A;  4ER8 A;  2EEY A;  4DG1 A;  3FDS A;  2RDD A;  3MWB A;  3NS5 A;  3TAP A;  4MFB B;  4BBY A;  5CH7 B;  2FC8 A;  2JEG A;  4KV8 B;  3LP1 B;  3GIR A;  1KWM A;  4IO1 A;  5G0R B;  1QSY A;  3BM7 A;  3I5B A;  4DPY A;  3BYP A;  1RT5 B;  1TL3 B;  4DX6 A;  1NK0 A;  1M5V C;  1NZA A;  1VOM A;  4LSZ B;  1IKW A;  2MQQ A;  2BA9 A;  1TP7 A;  3OT9 A;  3KLE A;  4O4G A;  1IBM F;  1BD6 A;  3DLJ A;  5L9X A;  2A6O A;  3BDP A;  4TN2 A;  1KS2 A;  1R6Y A;  2J7W A;  3BGR A;  4OZJ A;  2VBY A;  4RUH A;  1E6V B;  4FXD A;  4OZ2 A;  1U0H B;  1X7V A;  3GJR B;  1J5E F;  2AHO B;  4CP5 A;  5HQM A;  1X4G A;  2IFX A;  5K14 A;  4DXL A;  5GVQ A;  1YJ7 A;  3EGZ A;  2RIL A;  1FRJ A;  2V8D A;  2DT9 A;  3OXF A;  3DLH A;  3TUZ C;  1C0T B;  3RRG A;  1YJT A;  3C14 B;  3WZ0 A;  2WOM A;  1T03 B;  5DDP C;  2MXY A;  3IGV A;  2H48 B;  1IKV A;  2LXU A;  2QSF A;  2MKS A;  4GRS A;  4M95 A;  2AJQ A;  4Q0B A;  5EUH A;  2JEJ A;  4JI3 F;  2V9W A;  4E0D A;  2DH9 A;  2ZDO A;  3BO3 A;  2ALZ A;  2OJ3 A;  2BRK A;  2GVD B;  2HKE A;  4CNY A;  2KN4 A;  3K8W A;  4FF1 A;  4FF3 A;  4ZCM A;  4O3R A;  4KHM A;  4C0B A;  2KXH A;  3K5L A;  3H0P A;  3RW7 A;  3KLH A;  2UZA A;  5KFK A;  1U1L A;  2J0X A;  1XBW A;  4I2Q B;  2YBV A;  1NO8 A;  4ZCK A;  5I4M A;  2E7W A;  3E3X A;  3M6U A;  2A2D A;  3MR3 A;  1DTT B;  4KYZ A;  2AQ4 A;  5KFF A;  3MEC A;  3MUR P;  3CNQ P;  1WOP A;  2MLX A;  2HHH J;  1Y7P A;  3KJV B;  5I42 A;  1SL2 A;  2KH9 A;  3L95 X;  2XC9 A;  4FPI A;  1OIA A;  3W65 A;  1UWA A;  1S59 A;  1UFL A;  3TEH B;  4U8Y A;  2R7U A;  4E8U A;  2MKC A;  1RWN B;  4CLL A;  3KK3 A;  5F3T A;  3LA0 A;  4EBC A;  1RA6 A;  1V3Z A;  3CD6 S;  2OEJ A;  1MW7 A;  2MLZ A;  2DXD A;  2E5G A;  2HBR B;  3JAM Y;  3S8S A;  2BJ1 A;  4RNO A;  1KTV A;  2YKN B;  1SKU B;  2J7K A;  5ETL A;  5BJR A;  3CJK A;  2FQQ B;  1WC3 A;  2BQR A;  4P71 A;  3PW0 A;  2B4P A;  3RR7 A;  2XZD B;  4RW6 A;  2FB0 A;  2AW0 A;  4LF6 J;  5KFM A;  5KFA A;  3NWG A;  3KMS A;  4UUW A;  2O3D A;  2CRL A;  4CLK A;  3PRB A;  5KT5 A;  4LVN P;  1FD2 A;  4Y6I A;  3SQO P;  2R7S A;  5D3G A;  2E29 A;  2W2Q P;  4H4K C;  4RUC A;  4IH7 A;  3OSN A;  4LF7 F;  4NI2 B;  1TQL A;  2QZ8 A;  2V8P A;  3IR7 B;  3LGN A;  1WKJ A;  2XWY A;  4HDH A;  5L8R C;  3SSS A;  4ES3 A;  2XZT B;  4JI4 J;  1CJU B;  1L3K A;  1FXR A;  4ID5 A;  2AEF A;  1X4C A;  4YB6 A;  3UD3 P;  1RAH B;  2JL9 A;  3C8Y A;  4XDD A;  4ZVE A;  2GO8 A;  2VBW A;  3MM7 B;  4DCJ B;  2G1H A;  4M5H A;  4NZ6 A;  5BYR A;  2DY1 A;  3VZH A;  3PJX A;  2HGM A;  1FX4 A;  4AD6 A;  2HHQ A;  1IXK A;  5K8N A;  1T3O A;  2Y1I A;  3HK2 A;  4YR2 A;  1XIQ A;  4MK7 A;  5LSL A;  3IO1 A;  3CO9 A;  2FZC B;  2HWI A;  1YZ7 A;  3OBI A;  3R5J B;  3ISN D;  3D1O A;  1FRM A;  1JXV A;  3GB0 A;  3MUT P;  3KK1 B;  3K57 A;  1RU2 A;  3LP2 A;  4DJB A;  3CD7 A;  1I51 B;  4TU8 A;  4DSL A;  3AD7 C;  1NB7 A;  4Q2M A;  4BLG A;  1K44 A;  1HMV B;  2FLP A;  4MTP A;  3CC2 S;  4IRK A;  1G6B A;  4ZIT A;  5CHC B;  4F26 A;  4C8K A;  4XDC A;  2BQ3 A;  4ECR A;  4ZVT B;  3NS7 B;  3D3C J;  4PPD A;  3MCO A;  2DRA A;  3QO9 B;  2A2C A;  3QJJ A;  4KC5 A;  2KB2 A;  2ZBP A;  5E33 A;  2W24 A;  2WW8 A;  3FZB A;  3GR1 A;  2XY6 A;  3CC7 S;  1U6B A;  1HHQ A;  2FJX A;  4DL4 A;  2RQ4 A;  4LRE A;  2BMB A;  4C98 A;  1WTB A;  2V5H G;  3K2Y A;  1J5O A;  4O3O A;  1FWP A;  3NY0 A;  3TZX A;  2UVW A;  1XQI A;  4K4W A;  2JLF A;  8RUC A;  1SC6 A;  5CYM B;  4IDK A;  1UZH A;  3HI9 A;  3KUE A;  3I32 A;  4LSL B;  2OPR B;  2CPY A;  3PYD A;  4OHW A;  4UTG A;  4JI0 F;  4LFC J;  1FT8 A;  2ZH5 A;  3NAI A;  1FKP B;  2EBE A;  1JJC B;  3SV3 A;  1QAI A;  2QL5 B;  2BJ9 A;  4NL5 A;  4CM0 A;  4YOE A;  4QYZ K;  4W90 B;  5I3U A;  1BWV A;  1FKO A;  1G4C A;  1UEV A;  2DEJ A;  2NYI A;  5ETV A;  3Q83 A;  4LFB J;  2VON A;  4FVC A;  1IVZ A;  3A3O B;  1DQ9 A;  3FQL A;  3Q8S B;  2BOP A;  4KPY A;  2HHV A;  5IS2 A;  5KT3 A;  5IFM A;  3OR1 B;  3PNI A;  4RW9 B;  4P7V A;  4QW9 A;  1R0A A;  1OSC A;  2BDP A;  3PW4 A;  1HQU A;  2CNO B;  4DS4 A;  3QIP B;  3CDU A;  1GXT A;  4IH6 A;  3SFG A;  2FLL A;  2E9Z A;  4OZN A;  1RTI A;  1YLX A;  2EKY A;  2KRB A;  3KWM A;  4ID8 A;  1IR0 A;  1NB2 A;  2CXE A;  1B64 A;  2JVO A;  2VG5 A;  5HAN A;  3M32 B;  3QT5 A;  2QLW A;  3DRY A;  1U6F A;  4CLF A;  4KRW A;  3NCP A;  3RU0 A;  4OV1 A;  4C11 A;  5C7P A;  2M88 A;  3H20 A;  1X4E A;  2VU5 A;  2XQC A;  3T5L A;  2FC9 A;  4NMX A;  4OX9 F;  4PUO A;  3EPI A;  4DV1 J;  2E5L J;  2EK1 A;  3GR0 A;  5H9E J;  1N36 J;  1HAR A;  5L1I A;  3W9J A;  4NCG A;  4JI5 J;  3IWN C;  4F7V A;  4WTO B;  2C3Y A;  2POK A;  4ZA1 A;  5FD1 A;  2WSF C;  1SXL A;  4OHX A;  3DMJ B;  5DGA A;  2HPU A;  3HHL B;  3MED B;  5KFH A;  3VAL A;  4K4S A;  3UQS A;  2DGX A;  1RHJ B;  1X5T A;  4N76 A;  4ZMM A;  4PG8 A;  3DFE A;  5IXU A;  2ZZM A;  2DR7 A;  1H74 A;  1RTH B;  4YHH F;  1SKS A;  2MKI A;  2W7O A;  3P3D A;  4H4M A;  4J37 A;  3P6Y C;  4RBT A;  2GVZ A;  2ACY A;  2W2N P;  4X64 J;  2OAU A;  4GKJ F;  2Q43 A;  2E44 A;  1IQZ A;  5IZH A;  4WFB Q;  1S9E A;  1UJ4 A;  2BRL A;  2B9Y A;  1BY9 A;  2GIF A;  3BN7 A;  3HJV A;  3PAC A;  3UN2 A;  4F3M A;  2V8H A;  1JLE A;  2OKQ A;  2QT7 A;  1UJ5 A;  2DIS A;  5EWE A;  4RNN A;  4P2F A;  3UO0 A;  2C22 A;  3CJS A;  2Y8W A;  3UD4 P;  2LLZ A;  3IRW P;  3NOG A;  4DSJ A;  2K1R B;  3UCU P;  3OL7 A;  4OL8 A;  1RXO B;  3POT A;  4OYZ A;  5CZV A;  2HMI A;  3FSX A;  4F3O A;  2ZBI A;  1TVR A;  2ALY B;  1YG0 A;  3TVZ A;  3MD3 A;  3AH6 A;  1S10 A;  2BM1 A;  4IRD A;  3ZTP A;  2R3V A;  5LOQ A;  3M8R A;  3OTC A;  3JSY A;  2EG1 A;  4IG0 A;  1OY8 A;  3KLH B;  2WW4 A;  2ROP A;  4ZDN A;  1IBM J;  4ICL B;  3A3P B;  5B08 A;  3ILL A;  1UKU A;  2VQF F;  4ED5 A;  2B8P A;  1X8D A;  2NXU A;  4ZP7 A;  4BWM A;  1W2B R;  1KFS A;  4JV5 F;  1K1Q A;  4MMO A;  2DJW A;  3KHG A;  1NLK L;  1WSV A;  3BZQ A;  4F36 A;  3OXG A;  3ZTQ A;  4X66 J;  4LIR A;  5DG7 A;  1PKU A;  3DRX A;  2NXN A;  2WRM A;  1JIH A;  4RW8 A;  1U2C A;  3UVJ A;  4NE9 C;  2Z30 B;  3GPA A;  1P1L A;  3O5T B;  2HVZ A;  2LQB A;  3MTJ A;  4KO0 A;  5HLF A;  3PHE A;  1CUL B;  4QPT A;  2M5Y A;  3GIJ A;  2HAI A;  3RR8 A;  4F4Z A;  3I4H X;  1U24 A;  2DGO A;  3HVT B;  3LF0 A;  4V19 J;  1D1U A;  7FDR A;  1FF2 A;  1KHW A;  4ED1 A;  1N33 J;  1PYO B;  2MY8 A;  2IM0 A;  3GZ7 A;  3V6H A;  3DHW C;  2WOM B;  4JI5 F;  3W64 A;  4ZVQ B;  5J1N A;  3THT A;  2IM1 A;  4ED6 A;  2ASJ A;  4FN5 A;  1X60 A;  3LP1 A;  2QO3 A;  2J7U A;  1NHV A;  1WF2 A;  4I7F A;  1SQG A;  3FFI A;  4MJK A;  5K5M A;  4WXW A;  2CQ0 A;  2F4F A;  2QMW A;  4U67 Q;  2K8G A;  1VQK S;  2CNL B;  2R7X A;  1PBU A;  2G13 A;  4USU A;  1RWO B;  4O4G B;  4EYH B;  2K3I A;  3G96 A;  3JQK A;  4M5M A;  4I56 A;  4X64 F; 
#chains in the Genus database with same CATH homology
 2GZO A;  2AJ2 A;  2GS5 A;  2EW0 A;  2HRX A;  2DO8 A;  2MUI A;  2HAF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...