2HAFA

Crystal structure of a putative translation repressor from vibrio cholerae
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
185
structure length
185
Chain Sequence
SDIEVGHSMNLTNHFLVAMPSMKDPYFKRSVIYICEHNQDGAMGLMINAPIDITVGGMLKQVDIEPAYPQSHQENLKKPVFNGGPVSEDRGFILHRPRDHYESSMKMTDDIAVTTSKDILTVLGTEAEPEGYIVALGYSGWSAGQLEVELTENSWLTIEADPELIFNTPVHEKWQKAIQKLGISP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative translation repressor
publication title Crystal structure of a putative translation repressor from Vibrio cholerae
rcsb
source organism Vibrio cholerae
molecule tags Translation repressor
total genus 45
structure length 185
sequence length 185
ec nomenclature
pdb deposition date 2006-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02622 DUF179 Uncharacterized ACR, COG1678
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1300 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits VC0467-like domains 2hafA02
3.40.1740.10 Alpha Beta 3-Layer(aba) Sandwich VC0467-like VC0467-like 2hafA01
2MUIA 2DO8A 2EW0A 2HRXA 2HAFA 2AJ2A 2GS5A 2GZOA
chains in the Genus database with same CATH superfamily
2CQ4A 2UXCF 3DI6A 1LWXA 1Z1ZA 4HHJA 5H9FK 1ZH5A 3QATA 2V8GA 4CO0A 5AE1A 4K4ZA 5BR8F 3M8PB 4LBPA 1FRHA 2ZBCA 2GVZA 3DLKB 1NEEA 2RVJA 2YNIB 1B3TA 2HHVA 2YWWA 3GIMA 3NS5A 4PR6A 2MZRA 3CVKA 3GJSB 3VGSA 4A4JA 1HPZA 4LFBJ 1BQMA 1NK4A 2KFNA 2XZDB 1X5OA 2LMIA 1Z2LA 1N8RT 3U1NA 4DX8H 2VJVA 3SSSA 1RTDA 2V50A 3ZFVA 4DL7A 3CCTA 1WELA 2VF3A 1WC5A 2RS8A 1OYEA 2XMVA 3KDNA 4HVZA 3GIJA 2DGTA 3H25A 3MCSA 2HNDA 1AUDA 3MFIA 4F67A 2J0QD 2A18A 2VL1A 1T03A 2VPYB 4OX9J 4C8MA 3FEZA 3CO0P 2ZITA 2B9YA 2M0GB 1Y4ZB 1ZYQA 3G9CA 2HQGA 1D3WA 3P5BP 2EWHA 3TJAA 2QLWA 3OJSA 2CXEA 4RUCA 1S1VA 2GVZB 3KFWX 1OQ6A 3IN5A 1UWBA 2HNYA 4LF5F 3IG1B 1HPZB 3KLVA 3QZ7A 1BQMB 3DFEA 4KQZA 2J0XA 4IG3A 1UP1A 2Q79A 4J9SA 2JLGA 5HBMB 1W26A 3PIOQ 3JSBA 1KOHA 1RTDB 1U6BA 3R27A 2G0IA 4B3SJ 1X0FA 5KFEA 4GO7X 2P6TA 3OTOJ 4JI2F 4JP8A 2DR5A 4J9RA 5FIIA 2HNDB 2GS5A 2HVIA 2HFZA 3TAPA 3B78A 1T03B 3C3LA 5DQGA 4CLUA 4WXOA 4CTAA 3BBFA 5F8GA 4CO1A 4ZPDA 2ZM6J 1UA1A 2ABYA 4EUVA 2O1PA 1IKXA 5J1PA 5B0DA 2NPFA 1FHTA 3L4BC 1WG5A 3BF4A 1UVMA 1S1VB 2CIMA 4RR5A 3NEKA 2E7WA 5BYSA 2JZ5A 5IM0A 1UWBB 4DMZA 4ZVTB 2HMIA 3FZBA 5CYQA 1HR0J 1X9WA 2H5EA 3FBCA 2HNYB 5DJBA 3GZ7A 2MYFA 3MD3A 2HQ3A 3TX8A 3UQSA 1VDHA 1WF2A 2FLPA 3D0IE 4UUXA 3PW4A 2HLUA 1NNDA 3L7OA 3MXHP 4MIBA 2VBYA 2LFVA 4ED7A 4JV1A 2BQRA 5HVGA 1U6ZA 4WTOB 1WOSA 3W64A 2IJRA 3OQ2A 1TU0B 1FRMA 2Z2YB 4N8OA 4WK3A 5C2CA 2MZQA 4KGXB 1IKXB 4PG7A 4LF7F 2B6AB 4F2RA 2ZHOA 2YPYA 2AX1A 3M2RA 1I51B 2G0JA 3NBPA 1HBUA 2ZVIA 3N4WA 3M9OB 5IM0B 1OPIA 3CUNA 1H0HB 3GJTB 3E01A 1VGYA 2J6UA 4ZOSA 3EMTA 3A8IA 3GG1A 3FVYA 1OQ3A 1N5YB 1URRA 3CDAA 1FVSA 2BKNA 3I0SB 5FLXU 1SH3A 4GVLA 2W2NP 2KL8A 2JRSA 3FDSA 1M5VC 3KTQA 2IFXA 3KUGA 3WZ0A 2R8IA 2AJQA 2CQ3A 5J2QA 2XNQA 3QPIA 2J7KA 4NXMF 4NCBA 3GJRB 2V2KA 4FF4A 2ATLA 4M63A 1YI2S 1S99A 4HT5A 1RACB 1PO6A 1YJ7A 3IM9A 1JNRB 3D1QA 1F60B 2AYGA 3DXBA 4DEZA 1PAEX 3IR7B 4O3PA 1VHFA 3VV2B 3M2RB 1IBLJ 3NBPB 1HBUB 2ILYA 2M3DA 1VQ6S 3OLBA 1YIJS 2MB0B 1AB8A 1UFLA 1JIHA 3E01B 2J6TA 2W01A 1W2IA 5DETA 3HHDA 5KFZA 4PWUA 2AWZA 2IAJB 1LWCA 4CT9A 3M2VA 5E3RA 2KYZA 2NS1B 2ZWOA 1RWWB 2F8MA 2M7SA 3O1LA 1SKSA 2CFXA 3D3CJ 2BABA 4M5HA 1TK0A 1XC9A 4DV4J 5AXNA 2FHJA 3ZTRA 3T1HJ 2LQBA 4USTA 5DM6Q 4GO5X 2J9DA 1FDNA 3J7AN 2O5DA 1HWLA 4AUKA 4DN0A 4L3KA 1FRXA 3NMAA 2YQ1A 4ECXA 3QJLA 2ROEA 2QRRA 3MFHA 1QE1A 1E6YB 2PMZD 3ETMA 5DLGA 2XEXA 3RBEA 3O44A 3AH6A 3MR6A 3O8WA 1S5ZA 3CCES 4LRCA 3EZUA 1OWXA 4A8SA 2FB0A 2BKOA 2CNKB 2BACA 2UUCJ 3T9ZA 4F3MA 1FKPB 1LWCB 3KUHA 2PFFB 2XLKA 1RGVA 5JXSA 5C25A 2XNRA 1YHQS 1WSVA 5AXMA 3T5JA 4WFXA 3TA2A 1D1UA 4H4OA 2MZSA 3EE3A 2OFHX 3DLGB 2F65A 1C4AA 4RNFA 4ECRA 2WZ1A 1RLDA 1VQLS 1NDKA 4KGZB 5D6GA 2JH3A 3F44A 2RIJA 3Q83A 3MEDA 1UJ6A 2CWKA 1OYDA 4QIEA 3R5CA 1WC0A 4MTPA 3D0HE 4DR6J 2JVRA 3MR5A 5THWA 4A8YA 3TARA 2VJUA 3PNIA 3V5RA 4NASA 2K3IA 1KHVA 1HNXF 2E9TA 3DGPA 3AD8C 4IOCQ 2GMLA 3JTNA 1SL2A 1CQMA 3ELHA 1F3VA 4DS4A 4M95A 4OHVA 2CPXA 5D0EA 1X5SA 4RZRA 1HQ2A 2XB2D 3D2WA 5C25B 4N8NA 1P1TA 1QTMA 3OR1A 4B9TA 3TR5A 3TJ9A 4QIVA 2NXUA 4CWBA 1IQTA 4Z37A 1T05A 1SJFA 1C1CA 2HVHA 3H90A 3MEDB 4K2XA 1S12A 3OTEA 1YGYA 3N28A 1HKAA 4LIRA 1FX4A 3NGUA 4PUOA 4FNHA 3T19A 4CLFA 1JLCA 2C2RA 3FSXA 3D68A 1ZAWA 4C3KA 1NKEA 2DISA 2GCFA 3DGPB 2C28A 3RBXA 4USIA 1MSWD 5IT9Y 4MYTA 3W5YA 4AYBD 3J7A1 2ZZNA 4HTIA 1AW0A 4NXNF 2ZBIA 1REVB 4DFJA 2L9NA 2B8QA 5KFNA 2R7SA 1FDAA 3TA1A 3OR1B 1WORA 5FJ4A 2BX6A 2RSQA 4JI4J 4JB8B 2EFNA 3CIZA 3SV3A 2DH9A 2P6SA 3HVAA 3LWMA 1ZOTA 1TAQA 1T05B 3PKMA 1C1CB 2HQIA 4CYUA 2FHMA 3C6UA 5HVFA 4JUZA 2HGNA 1S72S 3H2LA 1F5BA 3AT1B 4ZVRB 1B7FA 1PGZA 3DXSX 1AFJA 3MR2A 5IFMA 2BJ8A 4PUOB 2H51B 2FZGB 3QLHB 2XGQA 4ZJOA 3PO5A 4MMOA 1JLCB 1N56A 3NL0A 2XGPA 1Q81T 1FESA 4DV7F 4ELVA 1NRKA 2R8GA 3HSGA 2IY5B 2E1PA 1VBKA 4NCAA 3QRPA 4C98A 1I5OB 2HK3A 1WTFA 2HRTA 1N36F 5IC4B 4YB5A 3HM9A 1YQHA 1GNKA 3CJ3A 1RHUB 2GVDA 2PE8A 1KBRA 1NPPA 4FS1A 2AX0A 5CZVA 4PCQA 3OL8A 2FJVA 2MKCA 3EVOA 2L3MA 2Q6CA 6AT1B 2CAJA 4H4MA 5GAHI 3WHIA 4JV5F 3EGVA 1VLOA 1W7WA 1X4AA 5KFYA 1TK5A 3VAMA 3EGNA 3I82A 4YR2A 4CYUB 2X7IA 4PABA 1XK8A 1K8AT 1RAOA 4DSLA 1JLAA 5IT0A 2MZJA 4DQQA 2RH3A 3RAMA 1FE4A 3KLFB 3P8BB 2KT5A 3J7ZT 1RT1A 4JI0F 3U7JA 2O3DA 5E7OB 1RTJB 4UF4A 4EU0A 4E8UA 1S7IA 9RUBA 3DDIA 1U1NA 1BWEA 4Q7AA 3BJYA 1QM9A 2OPPA 4USMA 3M6XA 1S49A 1XMQJ 2HFNA 2HVDA 4W4MA 3PHEA 4KC5A 1NH8A 3H0PA 2FQQB 3M8ZA 3EGZA 1DLOB 2GVDB 2E66A 4ICLA 2R42A 2VB6A 2KVQE 1CJUB 4U95A 3D1OA 3PW5A 3HZGA 4H4MB 4XDDA 4LF9F 3BH6B 4U8VA 3QFHA 2MKKA 5IWAJ 1VC0A 5G0RB 3TUPA 2FUG9 2GQQA 2JNJA 2M2BA 2GQCA 3CC4S 3HT3A 4I69A 1U25A 3E8OA 4P9SA 3OL7A 3S7RA 5KFIA 4LIWA 1YTYA 2AYBA 2DYAA 3QGPA 1ZBTA 3OV7A 3I55S 4F36A 4ZLJA 5FDLA 4Y0FA 3PX4A 4J7CA 2HHUA 2OPPB 4ECSA 1UPPA 1HQEA 2F9DA 4J91A 2J7WA 1XIQA 1XWLA 4ICLB 3W63A 4E2FB 5HQMA 4KBIA 1RHRB 2ZOGA 4XTTA 3W5XA 1NKCA 1M5KC 1X60A 1KFSA 4DV3F 5T14A 2CZ4A 1G2EA 4FKYA 3CSKA 4QU6A 2CPJA 2GIQA 1RTZA 2RDDA 1RHJB 2HHHJ 2WCXA 2H54B 1XMOJ 3HVRA 4X4TA 5T7LA 2CJBA 4ELUA 3ILOA 3MPYA 1EIYB 1GXUA 4IOAQ 3JSYA 1X8DA 1FF2A 5J2NA 2V2ZA 4C6AA 1YX2A 4CM2A 1H7XA 2N4CA 5T41A 4C0HA 3UVJA 4JI5F 5A8KA 2UUBJ 4DX5A 2IRYA 3Q8RB 1JLBA 4YDXA 2MQPA 3RR8A 5LT5A 2BKPA 2YH0A 1MWZA 3A8JA 4DR7J 2EFPA 1HNWJ 3Q8UA 1HQEB 3HULA 2W2PP 3UNGC 5HVHA 2ZOFA 3TEGA 2IM1A 1LFPA 1X4HA 2O66A 2COLA 3RGIA 3F41A 2F7VA 1RKJA 2FJDB 1EX8A 4K4YA 2LCWA 3IRWP 3THTA 5B0CA 1FRIA 2EBGA 2MQLA 2E1RA 4ENOA 3S8SA 9ATCB 5T7LB 3D7SB 2OLWA 3MOZA 1KRPA 4RLEA 2DXDA 5J2NB 3I56S 4DFPA 4DSKA 1IR2A 4ZS6A 4JI3F 1J27A 2IM0A 4TY9A 1QAXA 3UVJB 1WI6A 4F04B 3HI9A 4C11A 4NLUA 4XIUA 2NSBA 3GFXA 3M9MB 2QG9B 1JLBB 3LH2S 1PBUA 5KG5A 3ZZ0A 3HHLC 1WHWA 4CLPA 2ZH8A 4J5OA 2W9AA 3HHNB 3HZEA 3KNGA 5D78A 4OZ2A 1LXJA 4P72A 4X2BA 4F4YA 2E5HA 1O6XA 2RQ4A 1S9GB 2YXLA 2XYPB 2ZZMA 3IC1A 2ACYA 5BXIA 3TUIC 3CDBA 4LFBF 2CJXB 3DN9A 2DPIA 3FEYB 2APOA 2YKOA 1C2PA 2EPIA 4R25A 2ZH6A 3CCSS 5I3PA 2AV5A 4X4PA 5EX0A 3DU6A 1APSA 4DL0C 1GMWD 2CYYA 1NU4A 1WD6A 1L3UA 2P2CB 2JL9A 3LTOA 4CO2A 4FXVA 8ATCB 3DHWC 4C0OC 2OP5A 2DKOB 1CC7A 4RJVA 1OJ4A 1S77D 1S9EA 5KFQA 3FCVA 4C11B 3QWPA 2A2DA 1UMJA 2DNYA 4OX9F 1RYSA 2RQMA 2YWFA 4ED4A 3MAAA 4DR2F 4DV2F 1WF1A 1UFKA 3GONA 2KB2A 3W2VA 2FLLA 1RAFB 2Z58B 4O3SA 3NCQA 4RNHA 1N52B 4ECZA 3DM2A 2MKSA 4RBTA 4I7FB 3VVTA 2QIFA 5E3QA 1P8GA 4B9LA 1N88A 3PCOB 5CCLA 1ZETA 1NH7A 4TYAA 1WI8A 1IKWA 1RT4A 2XM3A 2C2MB 5HMYA 2LQ5A 3H2VE 4Y65A 4LF8F 4F4ZA 3OTCA 2MLXA 1KSPA 1UPMB 3O3LA 4B3SF 4DLGA 1JXEA 3I87A 3OTOF 2HG4A 1L3KA 1YJVA 3MUTP 3OL6A 2MJUA 5F0WA 3UR0A 1TUWA 2G2ZA 1U49A 2HBYB 4LFAJ 4BWJA 2K7JA 5KFBA 1U1LA 1HNVA 2NXNA 2WSFC 1R0BG 2KDOA 1LV5A 4NYPA 3MAAB 2I8EA 4B9NA 2VC1A 2ZM6F 4ZCMA 2UZAA 3W2VB 4WZMA 2K1RB 1CQNA 1F5CA 3PXGa 2ATCB 2PEBA 3DM2B 3D3BJ 2PN6A 1MNEA 2BM1A 3RJMB 3K5MA 2ROPA 4DV0J 2HS0A 1OIAA 3WX8A 2D3O1 1O51A 4U6PA 1RT4B 2DIVA 4ILMA 2DHHA 3KMSA 1IUJA 2DXFA 3QIPA 5F41A 4UZBA 4PYAA 3T6JA 3GIRA 1V6HA 4I64A 3PZPA 4HKQA 3CW2C 3N01A 4KSEB 2O67A 2BJDA 4GMKA 2CG8A 4ECTA 1TL4A 1S59A 1HNVB 4DZDA 2XQCA 4WFBQ 3TZYA 1Y5NB 2FD2A 2OHDA 2CJ9A 4UQGA 6FD1A 3BSNA 1HNZJ 2RJZA 1FT8A 4HYKA 5A8WA 1Y5LB 3G2XA 2B56A 3OL9A 4GC6A 5DS7A 4X62F 3QZ8A 2GJIA 2CA9A 2FVRA 1BD6A 3CB4A 4DL3A 2R7XA 1KONA 3ICLA 5HAOA 3QIPB 1GXTA 5KFFA 3CMAS 3BYRA 3MM9A 3Q89A 1YRUA 1IKYB 3BKUA 2G9OA 1FXDA 4M5MA 2IC3A 3D6TB 4PXEA 3VAHA 3OJUA 3J81U 1WOOA 1Y3KA 4NI2A 1L3TA 5HI7A 2DGQA 3P96A 1ROFA 3NGTA 2ZD1B 2MHEA 1FFWB 2AD9A 1IBLF 3MDFA 4NZ7A 2DY9A 1Z2ZA 5DGBA 3RR7A 2X3DA 3MEKA 1DARA 5LXYA 5A8WB 4OYMA 2AMCB 1NHVA 2DNMA 3CGIA 2CQPA 2XZWA 1HI0P 1PC5A 3ILIA 3N9UC 2YX1A 1NLKL 1XR6A 2H65B 1RAAB 4UW2A 3IAM9 3G6YA 2YKPA 3MM9B 3AJ1A 4EEYA 1QJHA 4MYUA 1IR1A 1DURA 5AJ3J 3T1HF 1U7LA 3G96A 4AL6A 2IC3B 4PG5A 4C3LA 2E44A 3K7RA 3WIVA 1UVJA 3CF5Q 2DHAA 2M5YA 2E1MC 4L72B 2YBVA 4NI2B 1X5PA 2DCLA 2YNGA 1U48A 4K5SA 2B7CB 3HP6A 3G4SS 3SDEA 1VYAA 4CP5A 3MMJA 2WVCA 3HD2A 3CXCR 1FD8A 4HEA9 3HJVA 4K4SA 2FIUA 2C2OB 2DT9A 2BJEA 3IWNC 4NZ0A 2UUCF 1VQNS 2QA1A 3ZTPA 3I9V9 2E5JA 2VBZA 1U1OA 4WP8A 3D54A 3M6WA 3S01A 3BB5A 4G65A 2VFVA 1GX5A 4LSNA 2KM8C 4I2QA 5CA5A 4AXJA 1PIEA 3U1LA 2DEJA 3PHTA 4HDGA 2ZE2A 1K44A 1AA1B 3H42A 1JLGA 1TKTA 4HH1A 3CDUA 3H40A 1C0UA 2YNGB 4X4QA 4EGLA 1UTAA 1OMSA 1NB2A 5LSOA 3J80Y 3FQLA 3SDEB 4DR6F 2XCPA 4MJKA 3VVUA 2W7PA 4FYWB 1VQ4S 2HHSA 5DG8A 1XNRJ 1YBAA 3ENAA 3MEEA 1URNA 1TL1A 4OJ3A 4Y2MA 2VA3A 1HIYA 3LUYA 1AUSL 5FD1A 2WVFA 3QT5A 4DF8A 3W61A 5HROA 3SBMA 4ZVQB 2DITA 3FBFA 4ZHRA 4AQYJ 3DC2A 3KMQA 5J1EA 1GQEA 1JLGB 3B4MA 1TKTB 4KHPF 4OI4A 3SYZA 1C0UB 1YVFA 2GQ2A 3EICA 3I5BA 3LP1A 1S97A 3GMGA 1NJIT 1QSYA 5LMNF 3L95X 4J90A 4QPTA 4H4KC 2Y1RI 3W65A 5B0EA 2VKRA 1RJJA 1QVFR 2C1EB 2IJFA 1PILA 1VOMA 3FCHA 1KD1T 4KIAA 1FFGB 3MEEB 2HZCA 1TL1B 2OEKA 3I5CA 2VG6A 2L48A 4DPUA 3ULHA 4F7VA 2MQQA 1F6TA 2V94A 2P9GA 5DRKA 4YHHJ 1PCAA 2AQ4A 1WTBA 3CJ0A 4WU2A 1T9UA 1S57A 1BXNA 4X4RA 2DR9A 4WTYA 3HVWA 1WEZA 5HROB 4AE5A 1SPBP 3KK1A 1YBUA 5KT4A 4ZHRB 2LXIA 2RRBA 3UD4P 4DPTA 1WACA 5J1EB 1UW4A 4EBCA 1VQ7S 3Q86A 3V6KA 1EHWA 2J5AA 4OQJA 5L38A 1S79A 4TXSA 4F0HA 2ZKTA 3LP1B 4RX6A 1RT2A 2OPSA 1ZAXA 2YNHA 3VF0B 3GILA 5GADU 2FGOA 5KFMA 1RT7A 3TWZA 3W9HA 4DSFA 1H3DA 3HLUA 1ZAVA 4I6YA 4I68A 3DGVA 2ZJPQ 3KJQB 2JHEA 4KJIA 3K8VA 1VS3A 4HTJA 4EBDA 2VG6B 4LQ3A 1N5VA 5L1JA 2HBQB 2V5HG 2MUIA 3Q23A 3KK1B 1LK5A 5HANA 4OYOA 4OI1A 2YTCA 2JVOA 5AXKA 4ED3A 3HXMA 3M6VA 5KFGA 1WUUA 3PYGA 4F2SA 3AQOA 5CD4A 3RAXA 3IA0A 3M7VA 4ECYA 1MN7A 5E3AA 1RT2B 1SXLA 2YNHB 3H7HB 5D0GA 3CJ5A 3BZQA 2M8DB 2KHCA 4USKA 3CD5A 4MIAA 3LPEA 3V4IA 4LT6A 4P71A 3CO9A 2XCAA 1VQ5S 1QTNB 1RHQB 4FS2A 2ASJA 3KXDA 4RW8A 1I3OB 1N54B 7FD1A 4AFFA 2VBWA 1NJYA 5DDRC 4JI8J 3UCUP 1IBCB 3KHRA 2PO4A 1UZHA 3M8QA 1XMQF 1LW0A 1G3OA 4KPCA 4ERDA 4PPDA 1DTTA 3IM8A 3AD9C 1A0OB 2IMWP 3MPUB 1WC3A 1FEEA 4DL4A 2RU9A 4IDKA 2X3GA 3QWUA 3SI8A 1RAHB 4NA3A 4B3TJ 1I94J 4IUFA 2JEIA 4KV8A 2L9WA 3MCMA 1GAOA 4N47A 4YDDB 3J7YU 2PSZA 1EJ7L 2H5IB 3BO4A 2XG8A 1TK8A 4RKUC 3V4IB 4K7QA 1FA0A 2CQBA 3LAMA 3VAFA 3SQGB 4GRSA 5ETVA 2DGSA 1EP4A 1UKUA 3ET6A 1SV5A 4DHVA 3GR0A 2HBRB 3PR4A 1Q82T 4M94A 2Y0BB 3IBWA 3M8QB 1F9EB 1LW0B 1HHSA 4M5NA 3EPIA 3HFKA 4JI6J 1DTTB 3OW2R 4I4BA 4NLQA 3QT7A 3K57A 1LWFA 2E29A 2DB1A 4IDKB 4QIGA 4A8WA 4CO3A 1N33J 4L6V3 3K5NA 1LXNA 1RAGB 3QAEA 5KFOA 2WAQD 2VQEJ 3FQKA 3UWTA 2QA4S 2ASYA 4LRBA 1ZZFA 4KV8B 3D6HB 2HHHF 1H2UX 2B4UA 1U0HA 1XMOF 4K4TA 3GYGA 2GHPA 3T3FA 3KHLA 1U2FA 1NK0A 4QR0A 1TL3B 2CADA 2LKZA 4JBCA 4NMXA 3ZXWA 3GTYX 3O2IA 2E5LJ 5EUHA 2OMLA 1S4FA 4P2FA 3M32A 1Y5IB 4NPOA 3T41A 3ET6B 1SV5B 4DL2A 2Y8YA 2C2DA 2CPZA 2HZAA 1P9QC 1VBYA 2Z2ZA 4DR7F 4OHZA 1HNWF 3JYTA 2KG1A 3HSZA 1U0SA 4MT1A 5KG1A 3OT9A 3OTDA 2BQUA 2FVCA 1OY8A 4DUZJ 1HWIA 2OPQA 2IYIA 3RRGA 2I5JA 2A1BA 3R5JB 2WOMB 3GLJA 3FMBA 1NSKL 3LAKA 2HHWA 2KO1A 3W2WA 4QW9A 3K59A 1TFYA 2YKMA 2PD1A 1S0VA 2RDJA 2J7UA 1NCLA 1U0HB 2F9JA 1H2TZ 4PWWA 1QAYA 3NLCA 2MKHA 1NK6A 2F3JA 4NRTA 1CEZA 1YG0A 4ZPAA 4P7VA 2O01C 3EXCX 2E5IA 4Q0BA 3IFEA 1KOOA 3OTBA 3FBBA 3M32B 1PSDA 1WDTA 1QAJA 2K06A 1IBMF 1Q78A 1NBEB 3Q22A 4LFCF 5SZTA 1N34J 3FJ2A 2GHWA 2AZ1A 4CNYA 2B4OA 3JYTB 4B3OA 5LM7E 1RKIA 5L9NA 5L1IA 5HSPA 5GMEA 4X4UA 2OPQB 2I5JB 1SC1B 3OXLA 3I31A 4KR0B 1JMTA 5HATA 2Q6BA 1KLMA 1GXLA 1S1XA 3W2WB 2D3ZA 3F0NA 1R0AB 3LP0A 2FHJD 3S6EA 2YKMB 3TO8A 2IA0A 3K17A 4R0JA 2CDQA 2CDRB 1KQGB 4BDPA 3IBFB 2CQIA 5C24A 3CCLS 2W2OP 4IH6A 3QNWB 1CJTA 4ZP8A 1VK8A 5KFLA 1MMLA 2XS7A 2VDHA 2Y1LB 4Q0BB 1B70B 3J81j 1F2GA 2FC8A 4RW7A 4J9PA 1CJVA 4MKYA 4HI2A 1RWNB 4IFYB 2RUGA 4QIWD 3LO3A 5A8RA 4B3OB 2RDIA 2RHQB 3BBCA 3IWLA 2AU0A 4J9LA 3C46A 2Q66A 4C8YA 3BEGB 3G8QA 4DL5A 3N5FA 3DDNA 3MM5A 4QW8A 1KLMB 2KZZA 3DLLQ 1CULA 1K1QA 5F3ZA 1S48A 3LP0B 2HIQA 4K8RA 4LRFA 1U1KA 4KPYA 1KKHA 4X84A 4R8UA 2B9EA 3FCWA 4F4KA 5C24B 1SKWA 4EK2A 5M2UA 2ZJQQ 1CJTB 2J0SD 5ETOA 5HQ8A 3RTVA 2W4PA 4OV6A 1ZM3A 3FZ2A 4KGKA 1HBOB 4ZVSB 4RW7B 4YB6A 4LFAF 2HVZA 3SZ2A 2ALYB 5F8LA 2MY8A 2HFVA 3DLHA 1B0VA 1VBXA 3L3CA 1VQKS 4HT7A 4IRDA 4TLQA 1VRUB 2XS2A 4BLGA 2YX4A 1S9FA 1X4GA 3P45B 2XO6A 3MM7A 4KAIA 5A0YA 2XLJA 2FJWA 4WIQA 2IM3A 2VHGA 1IVZA 2E7VA 3RB6A 1YRTA 3DLEA 3DOKA 3SFUA 4UOGA 1CULB 5I42A 4ED1A 2G0CA 2HWHA 4DQIA 5ETMA 4AL7A 1JJHA 1PG5B 4R8UB 4WPAA 3BPDA 5E3PA 2BE9B 4OIXA 3PYDA 4LREA 3PEJA 2E1CA 3AHPA 2CRLA 1V3ZA 2BVZA 4TVAB 4IO1A 4G3IA 2PMHA 4CIOA 3M8YA 4ZN1A 2HHPA 2DGVA 2XMWA 1VISA 3GWCA 4WF9Q 4PG4A 5EDWA 2CZ9A 4OI0A 2CJQA 3IXQA 3DRXA 2B4PA 1P1LA 2GC8A 3U02A 2ZFHA 3BR8A 2FVQA 2C3YA 3L9ZA 2F8EX 2VQFJ 4LF4J 3X3UA 3T5HA 2MTLA 2IVMA 2QA4G 1WHXA 2ZVSA 3MM7B 5KFVA 4O3NA 5A0YB 1IWAA 2CWXA 2OIHA 1Q1KA 2RQCA 3ISZA 3DLEB 2DNHA 3DOKB 2UUAJ 5I42B 4RW6A 4V19J 4RNOA 3OHBA 1TELA 1V9OA 1FCAA 1F2HA 5HK4A 1QUVA 2DIUA 4NLDA 1SKUB 4DV1J 3PY8A 2WRMA 3MURP 5K5MA 1NUEA 1F5AA 3RZAA 3OVSA 4FF2A 1HFEL 2FYXA 1ZA2B 2HS4A 1DBDA 3R2CJ 3NY0A 5ITHA 3JSRA 4USUA 4LMZA 1FK9A 5C7PA 4B3MJ 4DR3J 1TQLA 3NRBA 4WE1A 5HO4A 4PQUB 3BSCA 4LR7A 2GGPA 1NJZA 4RW6B 5ETSA 5F8HA 2B4VA 3W9IA 3WQPA 3T1AA 2DJWA 3TEHB 3TAMA 1MWQA 3PRDA 2BOAA 2NZCA 4BS2A 4DN9A 2E9ZA 1K73T 1Q8BA 3QGIA 1R8HA 5IV4A 2IA6A 3GJQB 2BJ9A 3W8GA 5IT9U 2UXCJ 1ZTTA 1DHMA 4NLSA 3K5LA 2DHGA 3UR3C 4DX6A 3P4UB 4RUHA 1X9SA 3EVMA 4CT8A 1RISA 3HFZB 5KG7A 1S76D 3ZO7A 1DQAA 4X4SA 3VAKA 2ADCA 3CCWA 5BR8J 4RNMA 2JC0A 3W60A 4G6VB 4PG6A 3K0JA 1FK9B 2WK4A 3HT0A 1U8SA 3I6PA 2KU7A 4WE1B 1Y0HA 1CVJA 1XMBA 3SFGA 2QL9B 4C48A 2GGPB 3EDQB 3M4XA 2JOQA 2PMWA 5F9LA 1QSLA 2GW8A 1WC6A 1QAIA 2H4WB 4Z7CA 3TAMB 4QWEA 4FXDA 2W9CB 5DDOC 3QYYA 1AT1B 4TKTA 1YITS 3CCRS 3OFHA 2KFYA 2Z2LA 4WU3A 3IG1A 2UXDJ 1Y10A 3KK3A 2MHNA 3C15A 5HBMA 2R8HA 1K0VA 4OFZA 2KVIA 3I4HX 4GC7A 1MW7A 5F8MA 4TN2A 4O3OA 1YWXA 2VV5A 3ZC4A 1HARA 1XNRF 3PYFA 5AT1B 2HAFA 4NOHA 1N32J 1PBAA 1R0CB 3OXFA 3N6MA 2B43A 2D7SA 5BYQA 4QR1A 3QSIA 5CH7B 1SVDA 1JWWA 4JI2J 5L9XA 3BR9A 2LU2A 2XWYA 4UZCA 2YWKA 4ECQA 2NZ4A 2MY7A 2DTJA 2J0WA 4AQYF 1RWOB 4A8KA 2QYGA 5GAEI 4Q2MA 3KK3B 3DRYA 3C15B 2CZVC 4ZJLA 2B8PA 3TRGA 3AY0A 1HQUA 2VOPA 3Q8SB 3HDSA 4A8QA 4OYXA 3MZIA 3AOBA 2B9XA 3OVAA 4J9OA 1JXVA 4M5DA 1LNQA 4ZPTR 5GMDA 3QRQA 4USJC 3CCUS 3Q2TC 2U1AA 4FKXA 2HIYA 3A4TA 3E51A 1VQ8S 2I9SA 4KB7A 2B6AA 5LMUF 3W5ZA 4YHHF 4IR9A 1RTIA 5L39A 2NYIA 2N7CA 2CQ2A 4U67Q 1MWYA 2HQFA 1MG7A 2V2QA 3PRVA 1D8YA 1N5YA 1BHNA 3CE8A 4K0KJ 1CPZA 5LL6d 3I0SA 4A8OA 3R3TA 1NDCA 1HQUB 3ZZOA 1DAXA 1N6QA 4IG0A 4NA2A 1VIOA 4IQMA 1KVKA 2DGWA 3BM7A 4URGA 5CYMA 4DOZA 4DSEA 4G1QA 3ONQA 4M5DB 2DPJA 4I1TA 1BQNB 2QLJB 4Q5VA 4XPEA 2JC1A 2M88A 1T9VA 2B5JB 3RB4A 2GO8A 4FP9A 3R5AA 3I96A 3HX9A 2E7XA 3KJFB 3GSIA 2XHWA 3A12A 1B7YB 3UD5A 4LF6J 3UCZP 4WFYA 1RTIB 3ILLA 2MQOA 3GV7B 3M2UB 2BE2A 4RWXA 4NXMJ 2OD4A 3C16A 1RB0A 4YUDA 4WCEQ 2JFDA 5IT4A 3AA9A 3FC9A 4HHUA 2LECA 1H98A 4HI1A 2IAJA 5I4MA 4QBUA 5HMWA 5LOQA 3M8RA 4RW9A 2W7OA 5KFKA 5IZHA 2ROGA 1T8EA 1N6QB 1DFDA 2AJ2A 4IG0B 3K5OA 4DU7A 2J8SA 3WBZA 4Y34A 1KFDA 5CYMB 5IV3A 2OD6A 4G1QB 4DQPA 5K8MA 4XDCA 1HMVA 3EXYA 3CD6S 4RPFA 3QIDA 2CQDA 4FDFA 4G1IA 3J7Z5 3FGVA 1CJKA 3B4DA 3K58A 4ZITA 5GAGI 5KFTA 1T94A 1IJEB 3GSDA 1R8PA 3QGHA 1HI1A 1TAUA 1HHTP 4LF2A 5KFXA 3FFIA 4JI8F 2X1AA 1E6YA 4U7UD 4ZN3A 4YQWA 5L1KA 2OELA 6FDRA 2IHR1 3DU5A 2ALZA 2BJ1A 2BE2B 3C16B 5ETLA 2KT2A 1ZM9A 2VU5A 1DJ0A 1M0SA 5GMKa 1OSCA 3PW2A 5HL7Q 4OZ3A 2GHVC 1UVKA 1FKPA 4RW9B 4B3TF 2DNPA 4DWIA 3P6YC 2XS5A 2LDIA 2Z0GA 1PAUB 2QEXS 2DHXA 4OYPA 3AJ2A 4ZCIA 1S7HA 4D3GA 3V4MA 4Q45A 4Z7YA 3PACA 2EXUA 4FN5A 3TZZA 2ZNZA 3ZZRA 3WIUA 1HMVB 3DLGA 4P2SA 2IYGA 1FJ7A 1EAYC 5D0HA 1CJKB 4DR4F 3LGNA 2F40A 1KS2A 4OL8A 1FWPA 3UN3A 1UZDA 4L75A 4V19X 1R7IA 3R1LA 3FFIB 2HKEA 1RE1B 5RUBA 2FY8A 3SXLA 4X65F 2FGCA 4F3OA 3D28A 4OJ1A 1U1MA 3H8YA 4DV5J 4UT4A 2F4VJ 1AFIA 1X7VA 4JI6F 3JXOA 3DYAA 3V6DA 2A0FB 1TP7A 3ITHB 1IN0A 2BA9A 5IQQA 1U4BA 1N33F 2VPZB 2RKIA 4MK9A 3KDOA 5ETQA 4YB7A 2MQ8A 2PA8D 3R6LB 2HLTA 1YJRA 2WBRA 1V3RA 2XTJP 3TZXA 1LKZA 3LQVA 1TMJA 2BW2A 1ZZNA 2FJXA 2K8GA 2PI4A 5F8NA 1D9AA 3ENWA 2W4DA 3OXGA 1SC3B 3Q0AA 3FUYA 5IQ6A 2K7KA 3RUBL 2XSJA 3THVA 1VK3A 3MMAA 1TKZA 3PV8A 4ECVA 1HNXJ 2HHTA 1Y9OA 4DFKA 4LR8A 3AB2B 4ZIVA 5CCMA 4QIFA 2EKYA 4TQRA 3J81Y 3GFHA 2OAUA 2AP6A 3PYEA 4WWSA 1G4CA 2IDEA 2ZUGA 2DH7A 3DYAB 4ZPBA 1UW9A 3V6DB 2OH2A 4LJMA 1CS4B 5KT6A 4CLLA 1DTQA 4LSLA 3CJSA 2RKIB 3W9JA 3DHXA 4KTQA 2YQ0A 1RT5B 2BV3A 4J9VA 2AEMA 3SSQA 1MROB 2HFUA 1REVA 2V8HA 3DDKA 2QE5A 1OPZA 4CO5A 2R9LA 2J8AA 1RT3A 5L46A 2UV8G 1OY6A 2AEJA 4NYOA 3HMJG 4F4WA 3KYLA 2NCKL 4JI1F 2XSJB 3R5BA 1H72C 4ES2A 3MMAB 1TKZB 1GT8A 4Q43A 1UA0A 5A2QY 4PAAA 4Z2XA 4WP3A 2E9RX 2WBMA 1ZM2A 2OI2A 3GU0A 4PG8A 3O5TB 2RD5C 1N34F 3MR7A 4CH1A 5L1LA 1C0TA 3U1MA 1S6UA 3GR1A 1R6VA 3C2PA 3QLHA 3CJ8A 3VR1A 3EUNA 2AYMA 3IR6B 4L73A 4H54A 4IR1A 1DTQB 4O0NA 2B0GA 2UU9J 4LSLB 4C7QA 3BSOA 1XQIA 4ED2A 2C3OA 4JV2A 2QL7B 1YJUA 1NDLA 5A6PA 4OYZA 1D9DA 2DR6A 3OSNA 1H74A 4C9DA 1RT3B 2LA4A 1J5EJ 3HHKA 5JJBA 3H5SA 3FRZA 1NAQA 4CO4A 3BN7A 5K14B 2WSEC 3V81A 1IBKJ 1RWPB 5BJRA 2FHOB 1EARA 2C3MA 3JAMY 4P6QA 1XR5A 4TNOA 1C0TB 4F02A 2RAQA 2VFTA 4KO0A 4D3HA 3KLFA 2F4FA 1Q7LB 4Y2AA 5HJXA 1EZZB 1RTJA 4NCGA 2M8HA 1KWMA 2X51A 3NAIA 2NSCA 4ATNA 2B3TB 1RCXB 4XK8C 2OUGA 2ERRA 1PJ6A 2NREA 1DLOA 3CJQA 1CJUA 4LVOP 5DM7Q 1KQSR 1WEXA 2QT7A 2KG0A 2XLIA 1NK5A 3V81B 5KFSA 1ULRA 1RTHA 4ANCA 1ZS6A 1K1SA 4ZVHA 4CLTA 3MPDA 4O4RA 3H5XA 5G0RA 4C8OA 1GEHA 4I6AA 3PO4A 3MM6A 4QYRA 3CULA 4IYQA 3VCDA 4ALZA 1G1XA 3P5TL 4KO0B 4J9UE 2DR7A 3GQCA 3MI7X 1EKSA 4WP9A 4NCGB 4YEAA 4LF9J 3LF0A 2OMOA 4KE5A 3AXKA 3BGOP 2OEJA 5HMXA 5LSLA 1GFWB 4IO9Q 3KLEB 3CCZA 3UFCX 5JMNA 2H5JB 3IR5B 2KZMA 4QQBA 3UW1A 3KHHA 2A6MA 3D4JA 2KT3A 4BCAA 3NNCA 3FBEA 4QWCA 2Z8QA 4K4XA 3A3NB 4BC7A 2FY1A 4P73A 2LEAA 5ETNA 4ZVFA 1F3FA 3RRHA 4QPXA 1RTHB 3LANA 3K2YA 4DPYA 3FNNA 4Y2CA 1F9FA 1FWLA 1Q8KA 3R8YA 3DKDA 1LFWA 3MM6B 1CBKA 2PC6A 4N77A 1G6BA 2LU1A 5F8JA 2VQFF 5ADZA 2RHSB 4WFZA 1OO0B 2KKHA 5KT7A 1Q7YT 1FKAF 2KYXA 2UUAF 4TYBA 2AF6A 2IJNA 3J80U 3FEXB 1NKBA 1SJ4P 3DRPB 5KFHA 5D3GA 2CQHA 4LRAA 1L3VA 3RB3A 3NXZA 4U7UK 3NOGA 4IH7A 4CH7A 2B51A 2LXUA 2P8IA 4ZMMA 1M5HA 1S1TA 2GV1A 3QRRA 1FJEB 1GMUA 1HYSA 4TU8A 3U27A 2V69A 2XMUA 3R6GB 5DLFA 2GAGC 4DPWA 3OSPA 1BLUA 3NGKA 3HHLA 5KG6A 4DR5F 2ZBRA 1WEYA 1F0XA 3FRYA 2K2PA 4DR1F 1UWAA 4B3MF 1Q5VA 2LLZA 3HD1A 1VJWA 4ZPWR 3CCQS 1P6TA 2QLBB 1KEKA 3T5LA 1EKRA 2R7VA 2X1BA 2CPEA 1WG1A 2I0XA 1VHIA 5D3GB 1RU2A 4ZP7A 2MMYA 2MSTA 2G1DA 3ZTOA 2BRKA 1VQPS 1RLCL 3QFWA 4FYXB 3HKWA 2LQJA 1W2BR 3K89A 4M5IA 1S9GA 3D0GE 3GB0A 2MJNA 4FPIA 4YMEA 4JI3J 2KHDA 1S1TB 1HYSB 2FJAB 3G87A 2DNQA 2WTFA 3C14A 2N3OA 3L7PA 3OLAA 3KKFA 2MLYA 3HHLB 4USHA 3MCNA 3NAHA 7AT1B 3H5UA 5EX3A 2DH8A 4I67A 3H4DA 1FTRA 2YH1A 3N79A 2CPDA 5IC6B 2ZBPA 4RBUA 3QAUA 3KOAA 3MF5A 5E41A 2VIHA 4MK7A 4C0BA 2XY5A 4LF1A 1FO1A 4IKAA 1RAIB 3VALA 5EHHA 3MWBA 2BM0A 2VFUA 5LXRA 1XBWA 4I7FA 5F3TA 2EFGA 5H9EJ 1JK9B 2RE1A 3TVZA 4I56A 1NSQA 3V2UC 4DF4A 1RUSA 2UXDF 4K50A 1VIXA 2ASLA 1LEOA 3DI6B 4DR2J 4DV2J 4NE9C 3C14B 1R8CA 4JYAJ 4KGMA 3K8WA 1C4CA 4USWA 4OZLA 5M2PA 2QZ8A 4ES3A 2LQ9A 2GJ2A 2MSSA 3GCXP 1FNOA 4ZP9A 3KNAA 2VONA 4ZVUB 3LWLA 1WC1A 4EZ9A 1RDRA 3ZZTA 2AJ1A 3BBBA 3NCPA 1N32F 3NWGA 4LF8J 2HWTA 3CJKA 4LSZB 1CC8A 4CQ1A 3EX7B 2K1RA 3PJWA 2NXEA 1Q0NA 3PDNA 1HNIA 4OZNA 5EWFA 1FFSB 2DRBA 1BE4A 2L41A 2GMHA 3ZZUA 3HVTA 2R4FA 3TJ8A 3TANA 3PFOA 1W25A 4P2XA 5CZXA 3EVWA 4PQAA 2PIIA 3FMWA 1UCNA 2RF2A 4HACA 2UUWA 3UE2A 2QMWA 2W7AA 1JKHA 2YNFA 2VICA 3R97A 1T9TA 3T1YJ 2M9KA 3W62A 2BZ2A 5JVHQ 3LPYA 4IG3B 2PDAA 1UEVA 4F8RA 4Q8EA 2CNOB 2EG1A 1IKVA 3CJKB 4C8ZA 4F25A 4B02A 3GV8B 3RAQA 4OYIA 1TUVA 1HNIB 2C2EA 1SQFA 3K5PA 1VRTA 1NK8A 2A6OA 2CKWA 4C3MA 3HVTB 2HVEA 1HR0F 3W3SA 4O44A 5B0GA 5HLFA 2RB7A 2HBZB 2DNNA 4Y2KA 4K0KF 3IGVA 4CTAB 3M8SA 1WOPA 2HRUA 3CCJS 4U96A 1Q8LA 2JEGA 2RF2B 2WB4A 4F4XA 4HACB 2PI5A 2U2FA 2MQMA 3V6JA 2QFJA 1BY9A 4OI3A 2F8HA 4O4GA 1T3OA 4HLBA 1IKYA 4NLYA 1TVRA 2HMIB 4FF3A 1JKHB 1NJXA 5CYQB 2HSEB 2YNFB 1VR6A 2BW7A 1XNQJ 4X62J 4L76A 2EK6A 3BN4A 1XERA 3LGHA 2DNGA 3TVYA 5KFCA 2IDLA 5GAHU 1IKVB 2F1FA 2ZD1A 4LF6F 3AXMA 3NWRA 1J5OA 2G13A 1B64A 4U7CA 1YJNS 4TQSA 1VRTB 1FVQA 4Q8FA 2XYGB 2H9ZA 1B0TA 3MPVA 2VA2A 5B09A 4O44B 3R5DA 2J9DE 5HLFB 5A6WA 2G2YA 1QDUB 4KH0B 1X4BA 2XMTA 3NNAA 1TL5A 4ANDA 3JTPA 2JLEA 1Q95G 4R5PA 2VC0A 5KFWA 3TQEA 4O4GB 3IBCB 4CI0B 5EN1A 4YS2A 1TVRB 2CPHA 4NLRA 1MU2A 1X9MA 1U2CA 1MN9A 2ZC4A 3UNYA 3G6XA 2VASA 3OPKA 2IMOA 3H4BA 4ZA1A 4YY3J 1CSJA 1RI7A 3BDPA 5DG9A 1J5OB 5K9FA 1WNEA 2R7RA 1JLQA 4B9SA 2V34A 2D3UA 1B0PA 4LUBA 2VOOA 5J2QB 2AIRB 4LBHA 2Q1LA 2CQCA 3AJDA 1OS5A 2X1FA 2Q3PA 1RA6A 1RA7A 1TFWA 2CPYA 2JX2A 2KJVA 3KLIA 2MPUA 2XBPA 2ZH5A 4P74A 5JUMA 4DSJA 2NLWA 4OLPA 3HJFA 4DFMA 2M4MA 1WHYA 2VG5A 4R5PB 1J2VA 2EFQA 2RRAA 2AGOA 3G71S 2CJAA 2QLXA 4S0MA 3Q24A 4DV4F 4ZPCA 3QJJA 1MU2B 1A6LA 3IP0A 4DZ6A 3TZWA 3D1HA 3W8PA 1VJQA 3M1VA 3ILJA 3OVBA 3M2VB 4QWAA 3BQ1A 2EKNA 3F56A 2ZH3A 4DV5F 4ZPVR 2F4VF 1JLQB 3NGDA 4ZP6A 3NNHA 3DNCA 4NX9A 1EQ0A 3RYLA 2XMAA 2OGUA 4GKKJ 2NUUG 4F0KA 1VQMS 2KM8B 4OX7A 3KLIB 4RUBA 3LP2A 5IXUA 4IH5A 3NG8A 1UEUA 1QE1B 3PEHA 3AAWB 3DOMA 3NCRA 2Y0SD 3GG0A 4EWTA 1Q86T 2V2VA 2VG5B 2ZBQA 5KT2A 2FDNA 4DCOB 1EETA 1Q16B 5KFUA 1BQXA 3AB4B 2I2YA 4CZCA 4H4KA 2HNZA 2BYCA 4UTGA 2RQKA 3C8YA 3VZIA 2N3LA 3CDEA 2H48B 2BQ3A 3TW0A 1KC8T 1QLNA 1LQ9A 1SBRA 5B0FA 3M1VB 3N6NA 2VODA 1PYSB 4NLTA 2R2SA 3ENQA 2DO4A 5D0RA 4NZ6A 2V4RA 4ZLPA 1XTZA 4HDHA 4WKRA 4H4OB 4B9MA 2VPWB 3AD7C 4ID8A 5E0OA 4KHPJ 3VWSA 1SH2A 2Y1IA 4PEOA 5DGAA 3US5A 1SQGA 2IIHA 4CCHA 2HEKA 3LP2B 1FDDA 1IJFB 3DOMB 4ILRA 2L9DA 3VGTA 4UY85 2OPRA 2R2UA 3ZZZA 3MTKA 1FWKA 5LMNJ 1TV6A 3M05A 1KVIA 2QMUB 1UVLA 1EETB 2DNRA 3SQOP 4FXWA 2HNZB 2BANA 2JLFA 1Z4UA 2M70A 5F8IA 3MM8A 5I3QA 2XYHB 4PXCA 2CJYB 2YWEA 3SCLE 1V5VA 2OSRA 1RAJA 1FDBA 5HP1A 4J9QA 2XC9A 3MUVP 1VBZA 4NYZA 2CQ1A 1N5TA 1DZ5A 3QSYB 5KFJA 4X64J 2FLNA 3KJVA 2D9PA 3POTA 4ELTA 3DMJA 2DK2A 2UU9F 1SIZA 1SC4B 5H9EK 3HPOA 4M1KA 1YRXA 1WKKA 1VCTA 1FD2A 2ZH2A 1S6QA 3VQTA 2OPRB 2BR0A 1TV6B 1FE0A 3BGRA 5LSRA 1RCOB 1J5EF 2QLFB 2MXYA 2PA3A 2DCUB 2UXBJ 2R2TA 1NB7A 3NOCA 2BANB 1TTHB 4AXIA 3WDOA 4JI4F 2NUHA 2DR8A 1IWGA 3HFVA 4I0WA 1IBKF 3MM8B 5C5JA 4BC9A 4NLWA 3QT6A 3GYNA 3SEOA 5HP1B 4UUWA 1YK9A 3MD1A 2G4BA 3GE9A 3GFYA 4X4VA 2V9WA 2BBEA 3X1LB 2Z2MA 4WFAQ 2MKJA 1MLAA 1M1GA 3KJVB 4N56A 1H73A 2GFFA 3POTB 1TKXA 3DMJB 5BYRA 5KFAA 1UFWA 4FBTA 4KRWA 2QSFA 3M8WA 4M5LA 3C6UB 1M1KT 2AYEA 2ZC3A 1S6QB 2WW4A 3GPAA 3UDLA 5K8OA 3N5BA 1HWKA 4CLKA 2FVSA 4WBFA 3BGRB 1AROP 2DVIA 2XI2A 4UOHA 3P49B 1KDNA 3LALA 4HR2A 1UETA 3VQSA 4URSA 2X1GA 4KHRA 3GYXB 3CTRA 4BWMA 2ZH9A 2LDYA 3PG9A 2NPIA 5D4OA 1SIWB 1HWUA 2HW3A 4YR3A 5KT5A 3IGNA 2VUGA 2JJ4D 4OYAA 1ZTWA 4FYDA 2C42A 1R8AA 2WVBA 3OFEA 3SV4A 3SQGA 4MIWA 4AD6A 5C42A 1TKXB 1QY7A 2W1BA 4DUTA 4P52A 3M9NB 4CRJA 2QO3A 4RNNA 2V6AA 3MAHA 1JLAB 1KHWA 2OKQA 4R0EA 3VZHA 4DL6A 4Y00A 1YJTA 1FERA 1BMQB 3SMZA 1RT1B 2K3KA 2ZDOA 2IRXA 5K8PA 2ZDPA 4P75A 1ZA1B 1K47A 2ZEJA 4OYBA 1HD0A 1U24A 3PJXA 5IWAF 2JWNA 4RUAA 2EFOA 3MEGA 3JQKA 2YX7A 3KLGA 4C4WA 1FJGJ 3SCJE 1RBOB 4ZDNA 4DQRA 2C3PA 1TL3A 2L08A 4UOFA 1RBLA 3CJTA 1KN6A 3H5YA 2PT0A 2V4QA 1RXOB 5C42B 2MDAA 3TUZC 1NMEB 2KRBA 3D67A 2Z57B 1FNMA 5D15A 2WHOA 2A10A 2IM2A 1ICEB 2HAIA 1SKRA 2N4DA 1U26A 2NYHA 2W9BA 2DO8A 4LVNP 2HURA 1RWMB 4NLOA 4ED0A 3M6UA 1IM4A 2WOMA 2YWHA 1T9XA 4ZCLA 1KVJA 3TVKA 1S10A 4OZJA 4C8LA 2LA6A 3MCOA 3B6BA 4N76A 3CT9A 1RK8A 5FDLB 2EEYA 3RU0A 3PX6A 3CD0A 1UVNA 3MEGB 5CHCB 5DDPC 3KLGB 1HWJA 5FLXY 4N5SA 3VGUA 3PIPQ 5KG4A 1SH0A 1FI4A 3IO1A 1S0OA 3R9LA 4YR0A 3R7BB 2ZWPA 1L5UA 2HFSA 2UUBF 3L09A 2GO9A 2PFDA 2W4CA 3R2DJ 3HO1A 3ISNC 2D3OR 3TP2A 2NR0A 1IQZA 4DU8A 3Q8YA 1FRKA 3NP5A 4V1Ak 1Q8IA 1IXKA 4OJHA 3G6ES 2HHQA 4DXLA 2IPOB 4ZCKA 2W9BB 1LWEA 2EW9A 2C2KB 1NPRA 3BH7B 3EYZA 5A8KB 4KKOA 2Y8WA 1R0AA 1GTEA 4B3RJ 3IS9A 3VAIA 1IBMJ 4TY8A 3TI0A 4LFCJ 3TA0A 4A8XA 4C97A 2CPFA 4UY8T 3GIIA 3ZTSA 4KH1B 1OY9A 1VC6A 5HJYA 1RWVB 2AZ3A 2RRNA 3MAQA 2QJ3A 3PFEA 2ILZA 1SL0A 4EO6A 4XAKA 4M5JA 3MMCA 1P9YA 2I1RA 5J2PA 2POKA 2CQGA 4IFYA 2HRYA 5DZ6A 1JLFA 2DO0A 4RBVA 2EVZA 4GKJJ 3UDEA 1D09B 1U6FA 1X4FA 4NEZA 2UVVA 4Q44A 5D77A 3MECA 3AFGA 3ZZPA 2BEFA 1SJQA 2XO7A 1RYRA 1LWEB 1R6YA 5F9NA 2GAHC 1NK9A 4X66J 3Q8QB 2VDIA 5AXLA 4I2PA 3JQJA 4KKOB 2WVDA 3PKYA 5HQLA 2YKAA 1FNXH 3IS9B 5K20B 4ZLNA 4TY8B 4ID5A 1R3NA 4JYAF 1JNZB 1RQ0A 2BDPA 5KG0A 3BGUA 2WB1D 2F63A 1FTCA 4DV6J 1HHQA 3EPGA 4NLPA 2KRRA 4L3NA 2HRXA 1HBOA 1SJ1A 1QVGR 3MMCB 3MPWA 5CXTA 2LEPA 5GADI 5AE2A 5J2PB 2SXLA 2QN6B 1JLFB 3KK2A 1M5OC 1S1UA 1UL3A 4LR9A 3MECB 1VRUA 4KHMA 2ZH4A 2V0NA 1VQOS 3AOCA 4DJBA 3QGGA 2FZCB 3MR3A 3KHGA 3UPFA 2FVPA 4F3QA 1L3SA 1S9EB 4ETXA 1H6KX 2WW8A 3TYTA 2R2RA 4I2PB 2ZHAA 2R8KA 4XO0A 2XWXA 2GS8A 4M8LA 1SQEA 3D66A 4B9UA 4C8NA 2Z56B 4ID5B 1TMMA 1LOUA 3RBDA 2P5VA 1YZ7A 4DI6A 1H38A 7FDRA 1HD1A 1RP5A 4OZ5A 1XJWB 1Q53A 4YB1P 2XMJA 2KI2A 1CG2A 4FVCA 5D4LA 2CG4A 2D74B 3T1YF 3ADAC 3KUEA 1ELOA 3SIPB 1IKWB 1U1PA 2EC2A 4O0IA 1JJ4A 2RU3A 3KK2B 1WHVA 2H4YB 2JDJA 1S1UB 1AYEA 1BWVA 3FKBA 2VBXA 3E3XA 1FKOA 2EI5A 3PRBA 4F50A 1MMNA 1I1GA 3QT8A 3MHYA 3WX4A 4DV0F 4MKVA 1PYOB 3AODA 3R1HA 3BPSP 2BMBA 2W8LA 1KR4A 1T7PA 1FX2A 3BGFA 1SC6A 4B9VA 4QJVA 1T95A 4UQTA 2BOPA 2HGLA 3A1YG 2JFKA 2EW0A 3G6VA 3HKZD 3AQPA 2E1AA 1H2VZ 1RSCA 1T3NA 2FTRA 2QYCA 4IFVA 2HHXA 2VFRA 4RU9A 4DUYJ 4Y2IA 3CPWR 1SJRA 1YZ6A 2KXFA 4CNZA 1XNQF 4ZLLA 3J7YI 2KFZA 1T02A 5KT3A 3UDVA 2NXCA 5ETPA 3LW5C 2FHKA 1BGXT 1SL1A 4ZK7M 1ZM4A 1WKJA 3DRSA 4CLWA 3E2EA 1U45A 1WC4A 2GNKA 1FKOB 3I4PA 4KT0C 5CQGA 1HNZF 1PC4A 3EZ5A 5CABA 2QX0A 3QQCD 4HHHA 4PQUA 2KTQA 1D8ZA 1C1BA 2Z30B 3W1YC 1RABB 4J9NA 4N41A 3SSRA 3H59A 3NMRA 2RMLA 1M90T 4J9MA 4DS5A 2QL5B 2HZVA 4IFVB 3CJRA 3PX0A 2LEBA 1RU1A 1JX4A 2P9CA 2W2MP 2UUTA 5E5NA 4KY3A 4LQ9A 2A2CA 2XZTB 3GIKA 3CJ2A 3BO2A 1Q4RA 4Q2LA 1JJ2R 4PYDA 4DDFA 3DRSB 5D4PA 4IQXA 4YY3F 1ITPA 3CJ4A 3JSMA 4W92B 4FBUA 1M5PC 1R8BA 4JI7J 4ETZA 2KXHA 2ZKUA 5A2QU 1U8WA 1NZAA 2KXNB 2EG2A 4IRKA 1HW9A 1C1BB 1X5TA 2DGOA 3DRRA 4DPXA 5DZ7A 2HPUA 3VAGA 2I6WA 2IRUA 5KOWA 2ZNYA 4WYLA 1E6VA 3D5MA 1D9FA 2MKIA 1A7GE 4B08A 2XI3A 3JQMA 2ACMA 2H1YA 2W9CA 2R3VA 1FRJA 4FYVB 4EZ6A 4KYZA 5AJ3F 3RRKA 4I6WA 3O6QA 3TOQA 3Q2SC 2DY1A 3MMBA 1SJ3P 2YKQA 1JB0C 3BREA 2MEWA 2FPHX 3FSYA 3A8EA 3PR5B 3BDEA 4OYWA 2XY7A 4WFNQ 3BQ0A 1U02A 3QBCA 4LBIA 4ER8A 3JSMB 2LQ8A 3NS7B 4ED5A 5B0BA 3CDWA 3RBZA 5LJ3Y 4M5GA 1S6PA 5EGYA 2VH7A 4GKKF 4OJGA 2XY6A 3H20A 4IOBA 1DQ9A 3PVXA 2UP1A 3RW7A 2GIRA 3JAMU 2IVFB 4U8YA 3QJPA 3DRRB 5ETTA 1NO8A 2BUNA 1Q5YA 1RWKB 4DCJB 4RW4A 4OI2A 3UI3A 2CPIA 2XSFA 1E6VB 4ZVOB 2CNNB 2HFOA 5JVGQ 3FK4A 1N5SA 4ZJQA 4A8MP 3IRXA 1VQ9S 4YN3B 1NXIA 1UJ5A 1G7CB 4NA1A 1YKWA 3AA8A 3TQ1A 4RL1A 1HI8A 3N6LA 2BXJA 5IOLA 2RILA 3MMBB 1NPKA 1F9HA 3HK2A 1Y7PA 1KQFB 2ZZTA 3HHEA 4DX7A 5MAOA 1T11A 8AT1B 1BUXA 2OFGX 4AL5A 4OHWA 1KNZA 1QSSA 1X4DA 3G86A 2QTWA 1FEHA 2YY3A 1RBAA 2ZOMA 2LP4A 3B82A 4OMFG 4LSNB 2ASDA 3ISND 1S6PB 4I2QB 4ZKAA 4LF5J 4CLYA 4PPZA 2ZE2B 4K4WA 3M30A 2YWGA 5K8NA 3A13A 3KG4A 1TZ0A 3HSJA 1ZPWX 5KAKA 5CYJA 1O8BA 3DLJA 1N4LA 4C8KA 4J9KA 4RW4B 4ZVEA 1NDPA 1A9NB 2GMJA 4PKDB 3BYPA 4QR2A 4EBEA 1NM2A 3D6MB 3IRXB 4FYYB 5DQIA 4LRDA 4Y28C 3H2UB 4K59A 4ZIWA 2R7UA 5KOXA 2OJ3A 3HHLD 3B54A 2UV8A 2N82B 5C2GA 3V6HA 2NXJA 3WC0A 3I32A 5LMUJ 2GIFA 3G8TA 2YKNA 2C2ZB 4W90B 1WJ9A 2ZH1A 2AJ4A 4X64F 2QV6A 1BQNA 5KFPA 2E5GA 2AGPA 4QCLA 2AEFA 2B5JA 2D9OA 3SCKE 4ED6A 1RZMA 2W25A 2MKYA 4EMDA 3BKFA 3M30B 3BQ2A 2XMMA 4OZ0A 2IBOA 3CWJA 2QMXA 3JS9A 4QZVB 2V4JA 3OBIA 4U9RA 3M2UA 2HK2A 4GVBA 5E2QA 4NLGA 2DGUA 2QC3A 3OFGA 2BJ3A 2UXBF 1NJWA 3BSAA 2MZ1A 2RS2A 3OUYA 1WSRA 1VI7A 5AE3A 2G1HA 4BBYA 4XPCA 1VQYA 4W98A 2QGFB 4LF7J 4HL9A 2YKNB 4K5RA 4C2MA 1N48A 2WONA 3THPA 4ECUA 1P27B 1I6JA 1RT6A 3NS6A 1WDDA 4L74A 1IR0A 4CM0A 3OFFA 3CMES 3ZZYA 3IWXA 3HSDA 2V4JB 2KJWA 3T9NA 2OPSB 1KTVA 3CC2S 3EWGA 3UCGA 2YVSA 3CD7A 4JV0A 5HN0A 1RT7B 4GVBB 4K4UA 1JLEA 3JB9k 4KGVB 4F26A 1DRZA 1LW2A 2Q43A 2J9CA 3OUYB 2D1CA 2HS3A 2XULA 1T0TV 3NKYA 3G82A 4WYWA 5I3UA 2UVWA 2HGMA 3MGJA 4A47A 1WWHA 1BC6A 1NK7A 2J76E 3D6FB 2CQ0A 4Y6IA 2A3JA 2HQCA 3G8SA 5J1NA 4TU9A 1ZPVA 4FNIA 5U47A 4BHQA 1AXQA 2WONB 3IMQJ 2UVRA 1V5IB 3D9BA 2R8JA 2WVEA 4P2MA 2JSXA 2VG7A 1RT6B 3TAQA 4QYZJ 2RT3A 2YPZA 4OZ1A 4WJBA 2N7YA 3VHQA 1R27B 1UVIA 1D0EA 2IVYA 4ECWA 3KWMA 1N0VC 2DRAA 2R7QA 4MAKA 1JLEB 4FF1A 4A48A 3ITHA 3CCVS 4DR4J 3PM9A 1HL6A 2XHCA 2GA7A 5B0AA 1GMWA 1NHKL 1LW2B 4JOUA 4RW8B 5IS2A 1FXRA 1UJ4A 4X65J 1U2RA 1U1QA 1I94F 3HF5A 2EFVA 4F0MA 4OHYA 1PJ5A 3G82B 1SUQA 5I3UB 1NHUA 1RAEB 4RWWA 1FJGF 4K4VA 5KFRA 2AW0A 3TUJC 3ZTQA 4WZQA 1LK7A 2DEIA 3W7BA 3C66A 2Y1JA 1GK8A 5D8HB 4OV1A 1PYTA 5H9FJ 3MOJB 3C6TA 1TUGB 3OR2A 3DCAA 3A3PB 1U1RA 3EM1A 2VG7B 2F5GA 2FC9A 4WXWA 1M5SA 3DLBA 1ACMB 3JTOA 2Z4PA 4MFBA 1TKDA 3ZNJ1 1TL7A 5HMZA 3OHAA 4NMLA 4O3QA 1CS4A 2C2NA 4QU7A 2R7TA 4ZVPB 1WF0A 3ETOA 2PGCA 2R7WA 2VZ9A 1DY3A 4O23A 3IAS9 1H7WA 5KFDA 1R31A 4G1PA 2CVEA 4OI6A 1EP4B 2QFIA 1Y11A 1X31C 3QMQA 1RT5A 2VQEF 1XR7A 2DD8S 1EB0A 2V67A 1VMBA 1S4EA 2W8KA 4ZVGA 1XEZA 1MROA 1SUQB 2DBBA 2GX8A 4PXBA 4WKYA 4P10A 3GV5B 4QWBA 2GJFA 3CEDA 3LGMA 3C19A 8RUCA 3B8HA 3R7SB 2DGXA 1LWFB 3C6TB 2E5LF 4ED8A 3DOLA 3OR2B 4WK1A 4DG1A 3MUMP 1NZ8A 4RO0A 3P3DA 4X4NA 4DPOA 1RHKB 1X0PA 2HQDA 4USVA 4MFBB 1YBTA 2ZH7A 1HBMA 1TL7B 3CCMS 5L8RC 1JQGA 1HLWA 1Y3JA 1R89A 4DUZF 3UD3P 4JI1J 1GTHA 1VRQC 2CNLB 2VPXB 2MZTA 1S1WA 3UN2A 2J6SA 1FJCA 4CDIA 5KG2A 2AT1B 1O0PA 1X4CA 3F73A 3I9ZA 2DXEA 2AKWB 2AJ0A 4IRCA 4B3RF 3BS9A 3NGSA 4EFAC 4YOEA 2DRDA 4A46A 2OTJS 3TX0A 1HBNA 2J9EA 1X4EA 3UDCA 2OEMA 1AZSA 2CJKA 3ENVA 1DQ8A 5M2RA 5K14A 3EDRB 1S0MA 3DOLB 2V68A 2BE7D 2HYIB 4DG1B 3EZOA 1QUPA 4MK8A 4DBQA 4FVMA 3A8KA 4MKAA 4GKJF 4EI2A 2BJ7A 4NXNJ 1HBMB 2YQ3A 1V3SA 5J2MA 1KP6A 1MMDA 2DNLA 5A76A 4DLEA 4O3RA 4NL5A 2EC0A 3ZNUA 1RHMB 1O5JA 4X66F 1S1WB 3RW6A 4NLVA 3PTWA 2CVIA 2FZKB 3I5AA 4URQU 2FJEB 3HCXA 4P7TA 1JXLA 3KLHA 3PW7A 1K0TA 3BV8A 1YJWS 2UVUA 1HBNB 2MGZA 2HWIA 4DV6F 4NRUA 1GH8A 3CIMA 1AZSB 3BO3A 1HW8A 1S6OA 4EO8A 2LYVA 4DV7J 1NSPA 2Y3YA 1T9WA 3MTJA 1S1XB 4OX8A 4CH0S 1IM6A 3GFZA 3GCWP 3VGVA 5CD4H 4MH8A 1WKLA 3LA0A 5GAEU 1N36J 2AGQA 4WIIA 1F1BB 5ETKA 2H3EB 5DDQC 2B7BB 5J2MB 2D41A 5DQHA 5EWGA 1R43A 1N5QA 4EYHB 3A3OB 3UN5A 1SI9A 4JV5J 2DNOA 1SCJB 2WSCC 1WG4A 1CJVB 1B99A 1T9YA 4DSIA 2AJFE 4ITSA 3H98A 3KLEA 2QA2A 2OSQA 2ZHBA 3UO0A 4PWDA 3KLHB 4OX6A 3LOUA 5A8RB 2C22A 5LJ5Y 2G2OA 1N0UA 1EQMA 1CLFA 3NGRA 1RWXB 2MGZB 1VFJA 4PRFA 4UOCA 1YJ9S 1UEKA 5G4DA 2V8DA 4MKBA 4JI0J 1TR0A 2W2QP 4OLOA 3MM5B 2VD3A 2ADBA 4TU7A 4YFUA 2PEHA 2FJBB 4PXDA 1S0NA 1FXLA 4F4AA 5E3CA 1VQSA 3RG6A 4HH0A 2Y9HA 2DNKA 1RWUA 4M5KA 3SCIE 3I0RA 4ILLA 3N0VA 4QOTA 3FSIA 2EBEA 2JEJA 2V63A 3AOAA 4FZVA 1U47A 5DO2A 4RU2A 5E33A 3Q8VA 2DHSA 2BRLA 4QWDA 1B4SA 5B08A 1VLYA 4PZVA 4KFBA 1GMVA 4NLXA 3DRPA 4PWDB 4TLRA 5B7WA 3BKTA 3L7UA 5SUHA 2NQPA 2LXFA 2V9KA 1KQKA 3PW0A 2KN4A 2IBKA 2RNEA 4DUYF 5D4NA 3QO9A 1OSDA 3Q8PB 2MQNA 4NEYA 4YP3A 2VKZG 2D69A 1RADB 5H1SV 4NWBA 3T6BA 1NSAA 1K9MT 2GZOA 2R7OA 3W66A 4J37A 2ZJRQ 4LF4F 1UAWA 4FPRA 3I0RB 4N7TA 3R7NB 2QSWA 4CLSA 4ANEA 4DQSA 3CNQP 2LVWA 2M52A 4DV3J 3VAJA 2V8VA 1HA1A 1Y00A 4CLZA 2MLZA 4EYIB 2V8PA 3VTIA 4DCPB 3CMQA 4KFBB 5GVQA 4X4OA 3PJ9A 2DNZA 1PJ7A 2XMKA 5GAGU 4AT1B 4OHXA 3OD2A 2EK1A 4DR5J 2JEFA 2P9EA 3T5KA 2KH9A 4E0DA 4DV1F 3QO9B 2FLOA 4DR1J 2C3UA 1YSJA 1QD1A 4JI5J 1JJCB 2B9WA 4ES1A 4E98A 1KTQA 4B17A 1SB6A 4Y3CA 1GX6A 2W24A 5ETRA 5KTQA 3M8PA 3EJMA 3R5GA 3DLKA 5CAAA 4JI7F 1KLNA 3BGLA 2YNIA 3TNVA 2CUYA 1U09A 4QYZK 3WC2A 4DR3F 5MLCV 3KG0A 1REGX 5KG3A 2VFSA 3RB0A 1XN9A 4K2JA 2AHOB 5F0UA 3CC7S 4A8FA 1FRLA 1PKUA 1YDLA 1M1HA 5EWEA 3EGWB 1YLXA 2RUSA 5DG7A 3S1TA 2OO4A 2I38A 3KG1A 1Q79A 2OTLS 1VC5A 3KJNB 2ZUAA 3GP9A
chains in the Genus database with same CATH topology
2MUIA 2DO8A 2EW0A 2HRXA 2HAFA 2AJ2A 2GS5A 2GZOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MUI A;  2DO8 A;  2EW0 A;  2HRX A;  2HAF A;  2AJ2 A;  2GS5 A;  2GZO A; 
#chains in the Genus database with same CATH topology
 2CQ4 A;  2UXC F;  3DI6 A;  1LWX A;  1Z1Z A;  4HHJ A;  5H9F K;  1ZH5 A;  3QAT A;  2V8G A;  4CO0 A;  5AE1 A;  4K4Z A;  5BR8 F;  3M8P B;  4LBP A;  1FRH A;  2ZBC A;  2GVZ A;  3DLK B;  1NEE A;  2RVJ A;  2YNI B;  1B3T A;  2HHV A;  2YWW A;  3GIM A;  3NS5 A;  4PR6 A;  2MZR A;  3CVK A;  3GJS B;  3VGS A;  4A4J A;  1HPZ A;  4LFB J;  1BQM A;  1NK4 A;  2KFN A;  2XZD B;  1X5O A;  2LMI A;  1Z2L A;  1N8R T;  3U1N A;  4DX8 H;  2VJV A;  3SSS A;  1RTD A;  2V50 A;  3ZFV A;  4DL7 A;  3CCT A;  1WEL A;  2VF3 A;  1WC5 A;  2RS8 A;  1OYE A;  2XMV A;  3KDN A;  4HVZ A;  3GIJ A;  2DGT A;  3H25 A;  3MCS A;  2HND A;  1AUD A;  3MFI A;  4F67 A;  2J0Q D;  2A18 A;  2VL1 A;  1T03 A;  2VPY B;  4OX9 J;  4C8M A;  3FEZ A;  3CO0 P;  2ZIT A;  2B9Y A;  2M0G B;  1Y4Z B;  1ZYQ A;  3G9C A;  2HQG A;  1D3W A;  3P5B P;  2EWH A;  3TJA A;  2QLW A;  3OJS A;  2CXE A;  4RUC A;  1S1V A;  2GVZ B;  3KFW X;  1OQ6 A;  3IN5 A;  1UWB A;  2HNY A;  4LF5 F;  3IG1 B;  1HPZ B;  3KLV A;  3QZ7 A;  1BQM B;  3DFE A;  4KQZ A;  2J0X A;  4IG3 A;  1UP1 A;  2Q79 A;  4J9S A;  2JLG A;  5HBM B;  1W26 A;  3PIO Q;  3JSB A;  1KOH A;  1RTD B;  1U6B A;  3R27 A;  2G0I A;  4B3S J;  1X0F A;  5KFE A;  4GO7 X;  2P6T A;  3OTO J;  4JI2 F;  4JP8 A;  2DR5 A;  4J9R A;  5FII A;  2HND B;  2GS5 A;  2HVI A;  2HFZ A;  3TAP A;  3B78 A;  1T03 B;  3C3L A;  5DQG A;  4CLU A;  4WXO A;  4CTA A;  3BBF A;  5F8G A;  4CO1 A;  4ZPD A;  2ZM6 J;  1UA1 A;  2ABY A;  4EUV A;  2O1P A;  1IKX A;  5J1P A;  5B0D A;  2NPF A;  1FHT A;  3L4B C;  1WG5 A;  3BF4 A;  1UVM A;  1S1V B;  2CIM A;  4RR5 A;  3NEK A;  2E7W A;  5BYS A;  2JZ5 A;  5IM0 A;  1UWB B;  4DMZ A;  4ZVT B;  2HMI A;  3FZB A;  5CYQ A;  1HR0 J;  1X9W A;  2H5E A;  3FBC A;  2HNY B;  5DJB A;  3GZ7 A;  2MYF A;  3MD3 A;  2HQ3 A;  3TX8 A;  3UQS A;  1VDH A;  1WF2 A;  2FLP A;  3D0I E;  4UUX A;  3PW4 A;  2HLU A;  1NND A;  3L7O A;  3MXH P;  4MIB A;  2VBY A;  2LFV A;  4ED7 A;  4JV1 A;  2BQR A;  5HVG A;  1U6Z A;  4WTO B;  1WOS A;  3W64 A;  2IJR A;  3OQ2 A;  1TU0 B;  1FRM A;  2Z2Y B;  4N8O A;  4WK3 A;  5C2C A;  2MZQ A;  4KGX B;  1IKX B;  4PG7 A;  4LF7 F;  2B6A B;  4F2R A;  2ZHO A;  2YPY A;  2AX1 A;  3M2R A;  1I51 B;  2G0J A;  3NBP A;  1HBU A;  2ZVI A;  3N4W A;  3M9O B;  5IM0 B;  1OPI A;  3CUN A;  1H0H B;  3GJT B;  3E01 A;  1VGY A;  2J6U A;  4ZOS A;  3EMT A;  3A8I A;  3GG1 A;  3FVY A;  1OQ3 A;  1N5Y B;  1URR A;  3CDA A;  1FVS A;  2BKN A;  3I0S B;  5FLX U;  1SH3 A;  4GVL A;  2W2N P;  2KL8 A;  2JRS A;  3FDS A;  1M5V C;  3KTQ A;  2IFX A;  3KUG A;  3WZ0 A;  2R8I A;  2AJQ A;  2CQ3 A;  5J2Q A;  2XNQ A;  3QPI A;  2J7K A;  4NXM F;  4NCB A;  3GJR B;  2V2K A;  4FF4 A;  2ATL A;  4M63 A;  1YI2 S;  1S99 A;  4HT5 A;  1RAC B;  1PO6 A;  1YJ7 A;  3IM9 A;  1JNR B;  3D1Q A;  1F60 B;  2AYG A;  3DXB A;  4DEZ A;  1PAE X;  3IR7 B;  4O3P A;  1VHF A;  3VV2 B;  3M2R B;  1IBL J;  3NBP B;  1HBU B;  2ILY A;  2M3D A;  1VQ6 S;  3OLB A;  1YIJ S;  2MB0 B;  1AB8 A;  1UFL A;  1JIH A;  3E01 B;  2J6T A;  2W01 A;  1W2I A;  5DET A;  3HHD A;  5KFZ A;  4PWU A;  2AWZ A;  2IAJ B;  1LWC A;  4CT9 A;  3M2V A;  5E3R A;  2KYZ A;  2NS1 B;  2ZWO A;  1RWW B;  2F8M A;  2M7S A;  3O1L A;  1SKS A;  2CFX A;  3D3C J;  2BAB A;  4M5H A;  1TK0 A;  1XC9 A;  4DV4 J;  5AXN A;  2FHJ A;  3ZTR A;  3T1H J;  2LQB A;  4UST A;  5DM6 Q;  4GO5 X;  2J9D A;  1FDN A;  3J7A N;  2O5D A;  1HWL A;  4AUK A;  4DN0 A;  4L3K A;  1FRX A;  3NMA A;  2YQ1 A;  4ECX A;  3QJL A;  2ROE A;  2QRR A;  3MFH A;  1QE1 A;  1E6Y B;  2PMZ D;  3ETM A;  5DLG A;  2XEX A;  3RBE A;  3O44 A;  3AH6 A;  3MR6 A;  3O8W A;  1S5Z A;  3CCE S;  4LRC A;  3EZU A;  1OWX A;  4A8S A;  2FB0 A;  2BKO A;  2CNK B;  2BAC A;  2UUC J;  3T9Z A;  4F3M A;  1FKP B;  1LWC B;  3KUH A;  2PFF B;  2XLK A;  1RGV A;  5JXS A;  5C25 A;  2XNR A;  1YHQ S;  1WSV A;  5AXM A;  3T5J A;  4WFX A;  3TA2 A;  1D1U A;  4H4O A;  2MZS A;  3EE3 A;  2OFH X;  3DLG B;  2F65 A;  1C4A A;  4RNF A;  4ECR A;  2WZ1 A;  1RLD A;  1VQL S;  1NDK A;  4KGZ B;  5D6G A;  2JH3 A;  3F44 A;  2RIJ A;  3Q83 A;  3MED A;  1UJ6 A;  2CWK A;  1OYD A;  4QIE A;  3R5C A;  1WC0 A;  4MTP A;  3D0H E;  4DR6 J;  2JVR A;  3MR5 A;  5THW A;  4A8Y A;  3TAR A;  2VJU A;  3PNI A;  3V5R A;  4NAS A;  2K3I A;  1KHV A;  1HNX F;  2E9T A;  3DGP A;  3AD8 C;  4IOC Q;  2GML A;  3JTN A;  1SL2 A;  1CQM A;  3ELH A;  1F3V A;  4DS4 A;  4M95 A;  4OHV A;  2CPX A;  5D0E A;  1X5S A;  4RZR A;  1HQ2 A;  2XB2 D;  3D2W A;  5C25 B;  4N8N A;  1P1T A;  1QTM A;  3OR1 A;  4B9T A;  3TR5 A;  3TJ9 A;  4QIV A;  2NXU A;  4CWB A;  1IQT A;  4Z37 A;  1T05 A;  1SJF A;  1C1C A;  2HVH A;  3H90 A;  3MED B;  4K2X A;  1S12 A;  3OTE A;  1YGY A;  3N28 A;  1HKA A;  4LIR A;  1FX4 A;  3NGU A;  4PUO A;  4FNH A;  3T19 A;  4CLF A;  1JLC A;  2C2R A;  3FSX A;  3D68 A;  1ZAW A;  4C3K A;  1NKE A;  2DIS A;  2GCF A;  3DGP B;  2C28 A;  3RBX A;  4USI A;  1MSW D;  5IT9 Y;  4MYT A;  3W5Y A;  4AYB D;  3J7A 1;  2ZZN A;  4HTI A;  1AW0 A;  4NXN F;  2ZBI A;  1REV B;  4DFJ A;  2L9N A;  2B8Q A;  5KFN A;  2R7S A;  1FDA A;  3TA1 A;  3OR1 B;  1WOR A;  5FJ4 A;  2BX6 A;  2RSQ A;  4JI4 J;  4JB8 B;  2EFN A;  3CIZ A;  3SV3 A;  2DH9 A;  2P6S A;  3HVA A;  3LWM A;  1ZOT A;  1TAQ A;  1T05 B;  3PKM A;  1C1C B;  2HQI A;  4CYU A;  2FHM A;  3C6U A;  5HVF A;  4JUZ A;  2HGN A;  1S72 S;  3H2L A;  1F5B A;  3AT1 B;  4ZVR B;  1B7F A;  1PGZ A;  3DXS X;  1AFJ A;  3MR2 A;  5IFM A;  2BJ8 A;  4PUO B;  2H51 B;  2FZG B;  3QLH B;  2XGQ A;  4ZJO A;  3PO5 A;  4MMO A;  1JLC B;  1N56 A;  3NL0 A;  2XGP A;  1Q81 T;  1FES A;  4DV7 F;  4ELV A;  1NRK A;  2R8G A;  3HSG A;  2IY5 B;  2E1P A;  1VBK A;  4NCA A;  3QRP A;  4C98 A;  1I5O B;  2HK3 A;  1WTF A;  2HRT A;  1N36 F;  5IC4 B;  4YB5 A;  3HM9 A;  1YQH A;  1GNK A;  3CJ3 A;  1RHU B;  2GVD A;  2PE8 A;  1KBR A;  1NPP A;  4FS1 A;  2AX0 A;  5CZV A;  4PCQ A;  3OL8 A;  2FJV A;  2MKC A;  3EVO A;  2L3M A;  2Q6C A;  6AT1 B;  2CAJ A;  4H4M A;  5GAH I;  3WHI A;  4JV5 F;  3EGV A;  1VLO A;  1W7W A;  1X4A A;  5KFY A;  1TK5 A;  3VAM A;  3EGN A;  3I82 A;  4YR2 A;  4CYU B;  2X7I A;  4PAB A;  1XK8 A;  1K8A T;  1RAO A;  4DSL A;  1JLA A;  5IT0 A;  2MZJ A;  4DQQ A;  2RH3 A;  3RAM A;  1FE4 A;  3KLF B;  3P8B B;  2KT5 A;  3J7Z T;  1RT1 A;  4JI0 F;  3U7J A;  2O3D A;  5E7O B;  1RTJ B;  4UF4 A;  4EU0 A;  4E8U A;  1S7I A;  9RUB A;  3DDI A;  1U1N A;  1BWE A;  4Q7A A;  3BJY A;  1QM9 A;  2OPP A;  4USM A;  3M6X A;  1S49 A;  1XMQ J;  2HFN A;  2HVD A;  4W4M A;  3PHE A;  4KC5 A;  1NH8 A;  3H0P A;  2FQQ B;  3M8Z A;  3EGZ A;  1DLO B;  2GVD B;  2E66 A;  4ICL A;  2R42 A;  2VB6 A;  2KVQ E;  1CJU B;  4U95 A;  3D1O A;  3PW5 A;  3HZG A;  4H4M B;  4XDD A;  4LF9 F;  3BH6 B;  4U8V A;  3QFH A;  2MKK A;  5IWA J;  1VC0 A;  5G0R B;  3TUP A;  2FUG 9;  2GQQ A;  2JNJ A;  2M2B A;  2GQC A;  3CC4 S;  3HT3 A;  4I69 A;  1U25 A;  3E8O A;  4P9S A;  3OL7 A;  3S7R A;  5KFI A;  4LIW A;  1YTY A;  2AYB A;  2DYA A;  3QGP A;  1ZBT A;  3OV7 A;  3I55 S;  4F36 A;  4ZLJ A;  5FDL A;  4Y0F A;  3PX4 A;  4J7C A;  2HHU A;  2OPP B;  4ECS A;  1UPP A;  1HQE A;  2F9D A;  4J91 A;  2J7W A;  1XIQ A;  1XWL A;  4ICL B;  3W63 A;  4E2F B;  5HQM A;  4KBI A;  1RHR B;  2ZOG A;  4XTT A;  3W5X A;  1NKC A;  1M5K C;  1X60 A;  1KFS A;  4DV3 F;  5T14 A;  2CZ4 A;  1G2E A;  4FKY A;  3CSK A;  4QU6 A;  2CPJ A;  2GIQ A;  1RTZ A;  2RDD A;  1RHJ B;  2HHH J;  2WCX A;  2H54 B;  1XMO J;  3HVR A;  4X4T A;  5T7L A;  2CJB A;  4ELU A;  3ILO A;  3MPY A;  1EIY B;  1GXU A;  4IOA Q;  3JSY A;  1X8D A;  1FF2 A;  5J2N A;  2V2Z A;  4C6A A;  1YX2 A;  4CM2 A;  1H7X A;  2N4C A;  5T41 A;  4C0H A;  3UVJ A;  4JI5 F;  5A8K A;  2UUB J;  4DX5 A;  2IRY A;  3Q8R B;  1JLB A;  4YDX A;  2MQP A;  3RR8 A;  5LT5 A;  2BKP A;  2YH0 A;  1MWZ A;  3A8J A;  4DR7 J;  2EFP A;  1HNW J;  3Q8U A;  1HQE B;  3HUL A;  2W2P P;  3UNG C;  5HVH A;  2ZOF A;  3TEG A;  2IM1 A;  1LFP A;  1X4H A;  2O66 A;  2COL A;  3RGI A;  3F41 A;  2F7V A;  1RKJ A;  2FJD B;  1EX8 A;  4K4Y A;  2LCW A;  3IRW P;  3THT A;  5B0C A;  1FRI A;  2EBG A;  2MQL A;  2E1R A;  4ENO A;  3S8S A;  9ATC B;  5T7L B;  3D7S B;  2OLW A;  3MOZ A;  1KRP A;  4RLE A;  2DXD A;  5J2N B;  3I56 S;  4DFP A;  4DSK A;  1IR2 A;  4ZS6 A;  4JI3 F;  1J27 A;  2IM0 A;  4TY9 A;  1QAX A;  3UVJ B;  1WI6 A;  4F04 B;  3HI9 A;  4C11 A;  4NLU A;  4XIU A;  2NSB A;  3GFX A;  3M9M B;  2QG9 B;  1JLB B;  3LH2 S;  1PBU A;  5KG5 A;  3ZZ0 A;  3HHL C;  1WHW A;  4CLP A;  2ZH8 A;  4J5O A;  2W9A A;  3HHN B;  3HZE A;  3KNG A;  5D78 A;  4OZ2 A;  1LXJ A;  4P72 A;  4X2B A;  4F4Y A;  2E5H A;  1O6X A;  2RQ4 A;  1S9G B;  2YXL A;  2XYP B;  2ZZM A;  3IC1 A;  2ACY A;  5BXI A;  3TUI C;  3CDB A;  4LFB F;  2CJX B;  3DN9 A;  2DPI A;  3FEY B;  2APO A;  2YKO A;  1C2P A;  2EPI A;  4R25 A;  2ZH6 A;  3CCS S;  5I3P A;  2AV5 A;  4X4P A;  5EX0 A;  3DU6 A;  1APS A;  4DL0 C;  1GMW D;  2CYY A;  1NU4 A;  1WD6 A;  1L3U A;  2P2C B;  2JL9 A;  3LTO A;  4CO2 A;  4FXV A;  8ATC B;  3DHW C;  4C0O C;  2OP5 A;  2DKO B;  1CC7 A;  4RJV A;  1OJ4 A;  1S77 D;  1S9E A;  5KFQ A;  3FCV A;  4C11 B;  3QWP A;  2A2D A;  1UMJ A;  2DNY A;  4OX9 F;  1RYS A;  2RQM A;  2YWF A;  4ED4 A;  3MAA A;  4DR2 F;  4DV2 F;  1WF1 A;  1UFK A;  3GON A;  2KB2 A;  3W2V A;  2FLL A;  1RAF B;  2Z58 B;  4O3S A;  3NCQ A;  4RNH A;  1N52 B;  4ECZ A;  3DM2 A;  2MKS A;  4RBT A;  4I7F B;  3VVT A;  2QIF A;  5E3Q A;  1P8G A;  4B9L A;  1N88 A;  3PCO B;  5CCL A;  1ZET A;  1NH7 A;  4TYA A;  1WI8 A;  1IKW A;  1RT4 A;  2XM3 A;  2C2M B;  5HMY A;  2LQ5 A;  3H2V E;  4Y65 A;  4LF8 F;  4F4Z A;  3OTC A;  2MLX A;  1KSP A;  1UPM B;  3O3L A;  4B3S F;  4DLG A;  1JXE A;  3I87 A;  3OTO F;  2HG4 A;  1L3K A;  1YJV A;  3MUT P;  3OL6 A;  2MJU A;  5F0W A;  3UR0 A;  1TUW A;  2G2Z A;  1U49 A;  2HBY B;  4LFA J;  4BWJ A;  2K7J A;  5KFB A;  1U1L A;  1HNV A;  2NXN A;  2WSF C;  1R0B G;  2KDO A;  1LV5 A;  4NYP A;  3MAA B;  2I8E A;  4B9N A;  2VC1 A;  2ZM6 F;  4ZCM A;  2UZA A;  3W2V B;  4WZM A;  2K1R B;  1CQN A;  1F5C A;  3PXG a;  2ATC B;  2PEB A;  3DM2 B;  3D3B J;  2PN6 A;  1MNE A;  2BM1 A;  3RJM B;  3K5M A;  2ROP A;  4DV0 J;  2HS0 A;  1OIA A;  3WX8 A;  2D3O 1;  1O51 A;  4U6P A;  1RT4 B;  2DIV A;  4ILM A;  2DHH A;  3KMS A;  1IUJ A;  2DXF A;  3QIP A;  5F41 A;  4UZB A;  4PYA A;  3T6J A;  3GIR A;  1V6H A;  4I64 A;  3PZP A;  4HKQ A;  3CW2 C;  3N01 A;  4KSE B;  2O67 A;  2BJD A;  4GMK A;  2CG8 A;  4ECT A;  1TL4 A;  1S59 A;  1HNV B;  4DZD A;  2XQC A;  4WFB Q;  3TZY A;  1Y5N B;  2FD2 A;  2OHD A;  2CJ9 A;  4UQG A;  6FD1 A;  3BSN A;  1HNZ J;  2RJZ A;  1FT8 A;  4HYK A;  5A8W A;  1Y5L B;  3G2X A;  2B56 A;  3OL9 A;  4GC6 A;  5DS7 A;  4X62 F;  3QZ8 A;  2GJI A;  2CA9 A;  2FVR A;  1BD6 A;  3CB4 A;  4DL3 A;  2R7X A;  1KON A;  3ICL A;  5HAO A;  3QIP B;  1GXT A;  5KFF A;  3CMA S;  3BYR A;  3MM9 A;  3Q89 A;  1YRU A;  1IKY B;  3BKU A;  2G9O A;  1FXD A;  4M5M A;  2IC3 A;  3D6T B;  4PXE A;  3VAH A;  3OJU A;  3J81 U;  1WOO A;  1Y3K A;  4NI2 A;  1L3T A;  5HI7 A;  2DGQ A;  3P96 A;  1ROF A;  3NGT A;  2ZD1 B;  2MHE A;  1FFW B;  2AD9 A;  1IBL F;  3MDF A;  4NZ7 A;  2DY9 A;  1Z2Z A;  5DGB A;  3RR7 A;  2X3D A;  3MEK A;  1DAR A;  5LXY A;  5A8W B;  4OYM A;  2AMC B;  1NHV A;  2DNM A;  3CGI A;  2CQP A;  2XZW A;  1HI0 P;  1PC5 A;  3ILI A;  3N9U C;  2YX1 A;  1NLK L;  1XR6 A;  2H65 B;  1RAA B;  4UW2 A;  3IAM 9;  3G6Y A;  2YKP A;  3MM9 B;  3AJ1 A;  4EEY A;  1QJH A;  4MYU A;  1IR1 A;  1DUR A;  5AJ3 J;  3T1H F;  1U7L A;  3G96 A;  4AL6 A;  2IC3 B;  4PG5 A;  4C3L A;  2E44 A;  3K7R A;  3WIV A;  1UVJ A;  3CF5 Q;  2DHA A;  2M5Y A;  2E1M C;  4L72 B;  2YBV A;  4NI2 B;  1X5P A;  2DCL A;  2YNG A;  1U48 A;  4K5S A;  2B7C B;  3HP6 A;  3G4S S;  3SDE A;  1VYA A;  4CP5 A;  3MMJ A;  2WVC A;  3HD2 A;  3CXC R;  1FD8 A;  4HEA 9;  3HJV A;  4K4S A;  2FIU A;  2C2O B;  2DT9 A;  2BJE A;  3IWN C;  4NZ0 A;  2UUC F;  1VQN S;  2QA1 A;  3ZTP A;  3I9V 9;  2E5J A;  2VBZ A;  1U1O A;  4WP8 A;  3D54 A;  3M6W A;  3S01 A;  3BB5 A;  4G65 A;  2VFV A;  1GX5 A;  4LSN A;  2KM8 C;  4I2Q A;  5CA5 A;  4AXJ A;  1PIE A;  3U1L A;  2DEJ A;  3PHT A;  4HDG A;  2ZE2 A;  1K44 A;  1AA1 B;  3H42 A;  1JLG A;  1TKT A;  4HH1 A;  3CDU A;  3H40 A;  1C0U A;  2YNG B;  4X4Q A;  4EGL A;  1UTA A;  1OMS A;  1NB2 A;  5LSO A;  3J80 Y;  3FQL A;  3SDE B;  4DR6 F;  2XCP A;  4MJK A;  3VVU A;  2W7P A;  4FYW B;  1VQ4 S;  2HHS A;  5DG8 A;  1XNR J;  1YBA A;  3ENA A;  3MEE A;  1URN A;  1TL1 A;  4OJ3 A;  4Y2M A;  2VA3 A;  1HIY A;  3LUY A;  1AUS L;  5FD1 A;  2WVF A;  3QT5 A;  4DF8 A;  3W61 A;  5HRO A;  3SBM A;  4ZVQ B;  2DIT A;  3FBF A;  4ZHR A;  4AQY J;  3DC2 A;  3KMQ A;  5J1E A;  1GQE A;  1JLG B;  3B4M A;  1TKT B;  4KHP F;  4OI4 A;  3SYZ A;  1C0U B;  1YVF A;  2GQ2 A;  3EIC A;  3I5B A;  3LP1 A;  1S97 A;  3GMG A;  1NJI T;  1QSY A;  5LMN F;  3L95 X;  4J90 A;  4QPT A;  4H4K C;  2Y1R I;  3W65 A;  5B0E A;  2VKR A;  1RJJ A;  1QVF R;  2C1E B;  2IJF A;  1PIL A;  1VOM A;  3FCH A;  1KD1 T;  4KIA A;  1FFG B;  3MEE B;  2HZC A;  1TL1 B;  2OEK A;  3I5C A;  2VG6 A;  2L48 A;  4DPU A;  3ULH A;  4F7V A;  2MQQ A;  1F6T A;  2V94 A;  2P9G A;  5DRK A;  4YHH J;  1PCA A;  2AQ4 A;  1WTB A;  3CJ0 A;  4WU2 A;  1T9U A;  1S57 A;  1BXN A;  4X4R A;  2DR9 A;  4WTY A;  3HVW A;  1WEZ A;  5HRO B;  4AE5 A;  1SPB P;  3KK1 A;  1YBU A;  5KT4 A;  4ZHR B;  2LXI A;  2RRB A;  3UD4 P;  4DPT A;  1WAC A;  5J1E B;  1UW4 A;  4EBC A;  1VQ7 S;  3Q86 A;  3V6K A;  1EHW A;  2J5A A;  4OQJ A;  5L38 A;  1S79 A;  4TXS A;  4F0H A;  2ZKT A;  3LP1 B;  4RX6 A;  1RT2 A;  2OPS A;  1ZAX A;  2YNH A;  3VF0 B;  3GIL A;  5GAD U;  2FGO A;  5KFM A;  1RT7 A;  3TWZ A;  3W9H A;  4DSF A;  1H3D A;  3HLU A;  1ZAV A;  4I6Y A;  4I68 A;  3DGV A;  2ZJP Q;  3KJQ B;  2JHE A;  4KJI A;  3K8V A;  1VS3 A;  4HTJ A;  4EBD A;  2VG6 B;  4LQ3 A;  1N5V A;  5L1J A;  2HBQ B;  2V5H G;  2MUI A;  3Q23 A;  3KK1 B;  1LK5 A;  5HAN A;  4OYO A;  4OI1 A;  2YTC A;  2JVO A;  5AXK A;  4ED3 A;  3HXM A;  3M6V A;  5KFG A;  1WUU A;  3PYG A;  4F2S A;  3AQO A;  5CD4 A;  3RAX A;  3IA0 A;  3M7V A;  4ECY A;  1MN7 A;  5E3A A;  1RT2 B;  1SXL A;  2YNH B;  3H7H B;  5D0G A;  3CJ5 A;  3BZQ A;  2M8D B;  2KHC A;  4USK A;  3CD5 A;  4MIA A;  3LPE A;  3V4I A;  4LT6 A;  4P71 A;  3CO9 A;  2XCA A;  1VQ5 S;  1QTN B;  1RHQ B;  4FS2 A;  2ASJ A;  3KXD A;  4RW8 A;  1I3O B;  1N54 B;  7FD1 A;  4AFF A;  2VBW A;  1NJY A;  5DDR C;  4JI8 J;  3UCU P;  1IBC B;  3KHR A;  2PO4 A;  1UZH A;  3M8Q A;  1XMQ F;  1LW0 A;  1G3O A;  4KPC A;  4ERD A;  4PPD A;  1DTT A;  3IM8 A;  3AD9 C;  1A0O B;  2IMW P;  3MPU B;  1WC3 A;  1FEE A;  4DL4 A;  2RU9 A;  4IDK A;  2X3G A;  3QWU A;  3SI8 A;  1RAH B;  4NA3 A;  4B3T J;  1I94 J;  4IUF A;  2JEI A;  4KV8 A;  2L9W A;  3MCM A;  1GAO A;  4N47 A;  4YDD B;  3J7Y U;  2PSZ A;  1EJ7 L;  2H5I B;  3BO4 A;  2XG8 A;  1TK8 A;  4RKU C;  3V4I B;  4K7Q A;  1FA0 A;  2CQB A;  3LAM A;  3VAF A;  3SQG B;  4GRS A;  5ETV A;  2DGS A;  1EP4 A;  1UKU A;  3ET6 A;  1SV5 A;  4DHV A;  3GR0 A;  2HBR B;  3PR4 A;  1Q82 T;  4M94 A;  2Y0B B;  3IBW A;  3M8Q B;  1F9E B;  1LW0 B;  1HHS A;  4M5N A;  3EPI A;  3HFK A;  4JI6 J;  1DTT B;  3OW2 R;  4I4B A;  4NLQ A;  3QT7 A;  3K57 A;  1LWF A;  2E29 A;  2DB1 A;  4IDK B;  4QIG A;  4A8W A;  4CO3 A;  1N33 J;  4L6V 3;  3K5N A;  1LXN A;  1RAG B;  3QAE A;  5KFO A;  2WAQ D;  2VQE J;  3FQK A;  3UWT A;  2QA4 S;  2ASY A;  4LRB A;  1ZZF A;  4KV8 B;  3D6H B;  2HHH F;  1H2U X;  2B4U A;  1U0H A;  1XMO F;  4K4T A;  3GYG A;  2GHP A;  3T3F A;  3KHL A;  1U2F A;  1NK0 A;  4QR0 A;  1TL3 B;  2CAD A;  2LKZ A;  4JBC A;  4NMX A;  3ZXW A;  3GTY X;  3O2I A;  2E5L J;  5EUH A;  2OML A;  1S4F A;  4P2F A;  3M32 A;  1Y5I B;  4NPO A;  3T41 A;  3ET6 B;  1SV5 B;  4DL2 A;  2Y8Y A;  2C2D A;  2CPZ A;  2HZA A;  1P9Q C;  1VBY A;  2Z2Z A;  4DR7 F;  4OHZ A;  1HNW F;  3JYT A;  2KG1 A;  3HSZ A;  1U0S A;  4MT1 A;  5KG1 A;  3OT9 A;  3OTD A;  2BQU A;  2FVC A;  1OY8 A;  4DUZ J;  1HWI A;  2OPQ A;  2IYI A;  3RRG A;  2I5J A;  2A1B A;  3R5J B;  2WOM B;  3GLJ A;  3FMB A;  1NSK L;  3LAK A;  2HHW A;  2KO1 A;  3W2W A;  4QW9 A;  3K59 A;  1TFY A;  2YKM A;  2PD1 A;  1S0V A;  2RDJ A;  2J7U A;  1NCL A;  1U0H B;  2F9J A;  1H2T Z;  4PWW A;  1QAY A;  3NLC A;  2MKH A;  1NK6 A;  2F3J A;  4NRT A;  1CEZ A;  1YG0 A;  4ZPA A;  4P7V A;  2O01 C;  3EXC X;  2E5I A;  4Q0B A;  3IFE A;  1KOO A;  3OTB A;  3FBB A;  3M32 B;  1PSD A;  1WDT A;  1QAJ A;  2K06 A;  1IBM F;  1Q78 A;  1NBE B;  3Q22 A;  4LFC F;  5SZT A;  1N34 J;  3FJ2 A;  2GHW A;  2AZ1 A;  4CNY A;  2B4O A;  3JYT B;  4B3O A;  5LM7 E;  1RKI A;  5L9N A;  5L1I A;  5HSP A;  5GME A;  4X4U A;  2OPQ B;  2I5J B;  1SC1 B;  3OXL A;  3I31 A;  4KR0 B;  1JMT A;  5HAT A;  2Q6B A;  1KLM A;  1GXL A;  1S1X A;  3W2W B;  2D3Z A;  3F0N A;  1R0A B;  3LP0 A;  2FHJ D;  3S6E A;  2YKM B;  3TO8 A;  2IA0 A;  3K17 A;  4R0J A;  2CDQ A;  2CDR B;  1KQG B;  4BDP A;  3IBF B;  2CQI A;  5C24 A;  3CCL S;  2W2O P;  4IH6 A;  3QNW B;  1CJT A;  4ZP8 A;  1VK8 A;  5KFL A;  1MML A;  2XS7 A;  2VDH A;  2Y1L B;  4Q0B B;  1B70 B;  3J81 j;  1F2G A;  2FC8 A;  4RW7 A;  4J9P A;  1CJV A;  4MKY A;  4HI2 A;  1RWN B;  4IFY B;  2RUG A;  4QIW D;  3LO3 A;  5A8R A;  4B3O B;  2RDI A;  2RHQ B;  3BBC A;  3IWL A;  2AU0 A;  4J9L A;  3C46 A;  2Q66 A;  4C8Y A;  3BEG B;  3G8Q A;  4DL5 A;  3N5F A;  3DDN A;  3MM5 A;  4QW8 A;  1KLM B;  2KZZ A;  3DLL Q;  1CUL A;  1K1Q A;  5F3Z A;  1S48 A;  3LP0 B;  2HIQ A;  4K8R A;  4LRF A;  1U1K A;  4KPY A;  1KKH A;  4X84 A;  4R8U A;  2B9E A;  3FCW A;  4F4K A;  5C24 B;  1SKW A;  4EK2 A;  5M2U A;  2ZJQ Q;  1CJT B;  2J0S D;  5ETO A;  5HQ8 A;  3RTV A;  2W4P A;  4OV6 A;  1ZM3 A;  3FZ2 A;  4KGK A;  1HBO B;  4ZVS B;  4RW7 B;  4YB6 A;  4LFA F;  2HVZ A;  3SZ2 A;  2ALY B;  5F8L A;  2MY8 A;  2HFV A;  3DLH A;  1B0V A;  1VBX A;  3L3C A;  1VQK S;  4HT7 A;  4IRD A;  4TLQ A;  1VRU B;  2XS2 A;  4BLG A;  2YX4 A;  1S9F A;  1X4G A;  3P45 B;  2XO6 A;  3MM7 A;  4KAI A;  5A0Y A;  2XLJ A;  2FJW A;  4WIQ A;  2IM3 A;  2VHG A;  1IVZ A;  2E7V A;  3RB6 A;  1YRT A;  3DLE A;  3DOK A;  3SFU A;  4UOG A;  1CUL B;  5I42 A;  4ED1 A;  2G0C A;  2HWH A;  4DQI A;  5ETM A;  4AL7 A;  1JJH A;  1PG5 B;  4R8U B;  4WPA A;  3BPD A;  5E3P A;  2BE9 B;  4OIX A;  3PYD A;  4LRE A;  3PEJ A;  2E1C A;  3AHP A;  2CRL A;  1V3Z A;  2BVZ A;  4TVA B;  4IO1 A;  4G3I A;  2PMH A;  4CIO A;  3M8Y A;  4ZN1 A;  2HHP A;  2DGV A;  2XMW A;  1VIS A;  3GWC A;  4WF9 Q;  4PG4 A;  5EDW A;  2CZ9 A;  4OI0 A;  2CJQ A;  3IXQ A;  3DRX A;  2B4P A;  1P1L A;  2GC8 A;  3U02 A;  2ZFH A;  3BR8 A;  2FVQ A;  2C3Y A;  3L9Z A;  2F8E X;  2VQF J;  4LF4 J;  3X3U A;  3T5H A;  2MTL A;  2IVM A;  2QA4 G;  1WHX A;  2ZVS A;  3MM7 B;  5KFV A;  4O3N A;  5A0Y B;  1IWA A;  2CWX A;  2OIH A;  1Q1K A;  2RQC A;  3ISZ A;  3DLE B;  2DNH A;  3DOK B;  2UUA J;  5I42 B;  4RW6 A;  4V19 J;  4RNO A;  3OHB A;  1TEL A;  1V9O A;  1FCA A;  1F2H A;  5HK4 A;  1QUV A;  2DIU A;  4NLD A;  1SKU B;  4DV1 J;  3PY8 A;  2WRM A;  3MUR P;  5K5M A;  1NUE A;  1F5A A;  3RZA A;  3OVS A;  4FF2 A;  1HFE L;  2FYX A;  1ZA2 B;  2HS4 A;  1DBD A;  3R2C J;  3NY0 A;  5ITH A;  3JSR A;  4USU A;  4LMZ A;  1FK9 A;  5C7P A;  4B3M J;  4DR3 J;  1TQL A;  3NRB A;  4WE1 A;  5HO4 A;  4PQU B;  3BSC A;  4LR7 A;  2GGP A;  1NJZ A;  4RW6 B;  5ETS A;  5F8H A;  2B4V A;  3W9I A;  3WQP A;  3T1A A;  2DJW A;  3TEH B;  3TAM A;  1MWQ A;  3PRD A;  2BOA A;  2NZC A;  4BS2 A;  4DN9 A;  2E9Z A;  1K73 T;  1Q8B A;  3QGI A;  1R8H A;  5IV4 A;  2IA6 A;  3GJQ B;  2BJ9 A;  3W8G A;  5IT9 U;  2UXC J;  1ZTT A;  1DHM A;  4NLS A;  3K5L A;  2DHG A;  3UR3 C;  4DX6 A;  3P4U B;  4RUH A;  1X9S A;  3EVM A;  4CT8 A;  1RIS A;  3HFZ B;  5KG7 A;  1S76 D;  3ZO7 A;  1DQA A;  4X4S A;  3VAK A;  2ADC A;  3CCW A;  5BR8 J;  4RNM A;  2JC0 A;  3W60 A;  4G6V B;  4PG6 A;  3K0J A;  1FK9 B;  2WK4 A;  3HT0 A;  1U8S A;  3I6P A;  2KU7 A;  4WE1 B;  1Y0H A;  1CVJ A;  1XMB A;  3SFG A;  2QL9 B;  4C48 A;  2GGP B;  3EDQ B;  3M4X A;  2JOQ A;  2PMW A;  5F9L A;  1QSL A;  2GW8 A;  1WC6 A;  1QAI A;  2H4W B;  4Z7C A;  3TAM B;  4QWE A;  4FXD A;  2W9C B;  5DDO C;  3QYY A;  1AT1 B;  4TKT A;  1YIT S;  3CCR S;  3OFH A;  2KFY A;  2Z2L A;  4WU3 A;  3IG1 A;  2UXD J;  1Y10 A;  3KK3 A;  2MHN A;  3C15 A;  5HBM A;  2R8H A;  1K0V A;  4OFZ A;  2KVI A;  3I4H X;  4GC7 A;  1MW7 A;  5F8M A;  4TN2 A;  4O3O A;  1YWX A;  2VV5 A;  3ZC4 A;  1HAR A;  1XNR F;  3PYF A;  5AT1 B;  2HAF A;  4NOH A;  1N32 J;  1PBA A;  1R0C B;  3OXF A;  3N6M A;  2B43 A;  2D7S A;  5BYQ A;  4QR1 A;  3QSI A;  5CH7 B;  1SVD A;  1JWW A;  4JI2 J;  5L9X A;  3BR9 A;  2LU2 A;  2XWY A;  4UZC A;  2YWK A;  4ECQ A;  2NZ4 A;  2MY7 A;  2DTJ A;  2J0W A;  4AQY F;  1RWO B;  4A8K A;  2QYG A;  5GAE I;  4Q2M A;  3KK3 B;  3DRY A;  3C15 B;  2CZV C;  4ZJL A;  2B8P A;  3TRG A;  3AY0 A;  1HQU A;  2VOP A;  3Q8S B;  3HDS A;  4A8Q A;  4OYX A;  3MZI A;  3AOB A;  2B9X A;  3OVA A;  4J9O A;  1JXV A;  4M5D A;  1LNQ A;  4ZPT R;  5GMD A;  3QRQ A;  4USJ C;  3CCU S;  3Q2T C;  2U1A A;  4FKX A;  2HIY A;  3A4T A;  3E51 A;  1VQ8 S;  2I9S A;  4KB7 A;  2B6A A;  5LMU F;  3W5Z A;  4YHH F;  4IR9 A;  1RTI A;  5L39 A;  2NYI A;  2N7C A;  2CQ2 A;  4U67 Q;  1MWY A;  2HQF A;  1MG7 A;  2V2Q A;  3PRV A;  1D8Y A;  1N5Y A;  1BHN A;  3CE8 A;  4K0K J;  1CPZ A;  5LL6 d;  3I0S A;  4A8O A;  3R3T A;  1NDC A;  1HQU B;  3ZZO A;  1DAX A;  1N6Q A;  4IG0 A;  4NA2 A;  1VIO A;  4IQM A;  1KVK A;  2DGW A;  3BM7 A;  4URG A;  5CYM A;  4DOZ A;  4DSE A;  4G1Q A;  3ONQ A;  4M5D B;  2DPJ A;  4I1T A;  1BQN B;  2QLJ B;  4Q5V A;  4XPE A;  2JC1 A;  2M88 A;  1T9V A;  2B5J B;  3RB4 A;  2GO8 A;  4FP9 A;  3R5A A;  3I96 A;  3HX9 A;  2E7X A;  3KJF B;  3GSI A;  2XHW A;  3A12 A;  1B7Y B;  3UD5 A;  4LF6 J;  3UCZ P;  4WFY A;  1RTI B;  3ILL A;  2MQO A;  3GV7 B;  3M2U B;  2BE2 A;  4RWX A;  4NXM J;  2OD4 A;  3C16 A;  1RB0 A;  4YUD A;  4WCE Q;  2JFD A;  5IT4 A;  3AA9 A;  3FC9 A;  4HHU A;  2LEC A;  1H98 A;  4HI1 A;  2IAJ A;  5I4M A;  4QBU A;  5HMW A;  5LOQ A;  3M8R A;  4RW9 A;  2W7O A;  5KFK A;  5IZH A;  2ROG A;  1T8E A;  1N6Q B;  1DFD A;  2AJ2 A;  4IG0 B;  3K5O A;  4DU7 A;  2J8S A;  3WBZ A;  4Y34 A;  1KFD A;  5CYM B;  5IV3 A;  2OD6 A;  4G1Q B;  4DQP A;  5K8M A;  4XDC A;  1HMV A;  3EXY A;  3CD6 S;  4RPF A;  3QID A;  2CQD A;  4FDF A;  4G1I A;  3J7Z 5;  3FGV A;  1CJK A;  3B4D A;  3K58 A;  4ZIT A;  5GAG I;  5KFT A;  1T94 A;  1IJE B;  3GSD A;  1R8P A;  3QGH A;  1HI1 A;  1TAU A;  1HHT P;  4LF2 A;  5KFX A;  3FFI A;  4JI8 F;  2X1A A;  1E6Y A;  4U7U D;  4ZN3 A;  4YQW A;  5L1K A;  2OEL A;  6FDR A;  2IHR 1;  3DU5 A;  2ALZ A;  2BJ1 A;  2BE2 B;  3C16 B;  5ETL A;  2KT2 A;  1ZM9 A;  2VU5 A;  1DJ0 A;  1M0S A;  5GMK a;  1OSC A;  3PW2 A;  5HL7 Q;  4OZ3 A;  2GHV C;  1UVK A;  1FKP A;  4RW9 B;  4B3T F;  2DNP A;  4DWI A;  3P6Y C;  2XS5 A;  2LDI A;  2Z0G A;  1PAU B;  2QEX S;  2DHX A;  4OYP A;  3AJ2 A;  4ZCI A;  1S7H A;  4D3G A;  3V4M A;  4Q45 A;  4Z7Y A;  3PAC A;  2EXU A;  4FN5 A;  3TZZ A;  2ZNZ A;  3ZZR A;  3WIU A;  1HMV B;  3DLG A;  4P2S A;  2IYG A;  1FJ7 A;  1EAY C;  5D0H A;  1CJK B;  4DR4 F;  3LGN A;  2F40 A;  1KS2 A;  4OL8 A;  1FWP A;  3UN3 A;  1UZD A;  4L75 A;  4V19 X;  1R7I A;  3R1L A;  3FFI B;  2HKE A;  1RE1 B;  5RUB A;  2FY8 A;  3SXL A;  4X65 F;  2FGC A;  4F3O A;  3D28 A;  4OJ1 A;  1U1M A;  3H8Y A;  4DV5 J;  4UT4 A;  2F4V J;  1AFI A;  1X7V A;  4JI6 F;  3JXO A;  3DYA A;  3V6D A;  2A0F B;  1TP7 A;  3ITH B;  1IN0 A;  2BA9 A;  5IQQ A;  1U4B A;  1N33 F;  2VPZ B;  2RKI A;  4MK9 A;  3KDO A;  5ETQ A;  4YB7 A;  2MQ8 A;  2PA8 D;  3R6L B;  2HLT A;  1YJR A;  2WBR A;  1V3R A;  2XTJ P;  3TZX A;  1LKZ A;  3LQV A;  1TMJ A;  2BW2 A;  1ZZN A;  2FJX A;  2K8G A;  2PI4 A;  5F8N A;  1D9A A;  3ENW A;  2W4D A;  3OXG A;  1SC3 B;  3Q0A A;  3FUY A;  5IQ6 A;  2K7K A;  3RUB L;  2XSJ A;  3THV A;  1VK3 A;  3MMA A;  1TKZ A;  3PV8 A;  4ECV A;  1HNX J;  2HHT A;  1Y9O A;  4DFK A;  4LR8 A;  3AB2 B;  4ZIV A;  5CCM A;  4QIF A;  2EKY A;  4TQR A;  3J81 Y;  3GFH A;  2OAU A;  2AP6 A;  3PYE A;  4WWS A;  1G4C A;  2IDE A;  2ZUG A;  2DH7 A;  3DYA B;  4ZPB A;  1UW9 A;  3V6D B;  2OH2 A;  4LJM A;  1CS4 B;  5KT6 A;  4CLL A;  1DTQ A;  4LSL A;  3CJS A;  2RKI B;  3W9J A;  3DHX A;  4KTQ A;  2YQ0 A;  1RT5 B;  2BV3 A;  4J9V A;  2AEM A;  3SSQ A;  1MRO B;  2HFU A;  1REV A;  2V8H A;  3DDK A;  2QE5 A;  1OPZ A;  4CO5 A;  2R9L A;  2J8A A;  1RT3 A;  5L46 A;  2UV8 G;  1OY6 A;  2AEJ A;  4NYO A;  3HMJ G;  4F4W A;  3KYL A;  2NCK L;  4JI1 F;  2XSJ B;  3R5B A;  1H72 C;  4ES2 A;  3MMA B;  1TKZ B;  1GT8 A;  4Q43 A;  1UA0 A;  5A2Q Y;  4PAA A;  4Z2X A;  4WP3 A;  2E9R X;  2WBM A;  1ZM2 A;  2OI2 A;  3GU0 A;  4PG8 A;  3O5T B;  2RD5 C;  1N34 F;  3MR7 A;  4CH1 A;  5L1L A;  1C0T A;  3U1M A;  1S6U A;  3GR1 A;  1R6V A;  3C2P A;  3QLH A;  3CJ8 A;  3VR1 A;  3EUN A;  2AYM A;  3IR6 B;  4L73 A;  4H54 A;  4IR1 A;  1DTQ B;  4O0N A;  2B0G A;  2UU9 J;  4LSL B;  4C7Q A;  3BSO A;  1XQI A;  4ED2 A;  2C3O A;  4JV2 A;  2QL7 B;  1YJU A;  1NDL A;  5A6P A;  4OYZ A;  1D9D A;  2DR6 A;  3OSN A;  1H74 A;  4C9D A;  1RT3 B;  2LA4 A;  1J5E J;  3HHK A;  5JJB A;  3H5S A;  3FRZ A;  1NAQ A;  4CO4 A;  3BN7 A;  5K14 B;  2WSE C;  3V81 A;  1IBK J;  1RWP B;  5BJR A;  2FHO B;  1EAR A;  2C3M A;  3JAM Y;  4P6Q A;  1XR5 A;  4TNO A;  1C0T B;  4F02 A;  2RAQ A;  2VFT A;  4KO0 A;  4D3H A;  3KLF A;  2F4F A;  1Q7L B;  4Y2A A;  5HJX A;  1EZZ B;  1RTJ A;  4NCG A;  2M8H A;  1KWM A;  2X51 A;  3NAI A;  2NSC A;  4ATN A;  2B3T B;  1RCX B;  4XK8 C;  2OUG A;  2ERR A;  1PJ6 A;  2NRE A;  1DLO A;  3CJQ A;  1CJU A;  4LVO P;  5DM7 Q;  1KQS R;  1WEX A;  2QT7 A;  2KG0 A;  2XLI A;  1NK5 A;  3V81 B;  5KFS A;  1ULR A;  1RTH A;  4ANC A;  1ZS6 A;  1K1S A;  4ZVH A;  4CLT A;  3MPD A;  4O4R A;  3H5X A;  5G0R A;  4C8O A;  1GEH A;  4I6A A;  3PO4 A;  3MM6 A;  4QYR A;  3CUL A;  4IYQ A;  3VCD A;  4ALZ A;  1G1X A;  3P5T L;  4KO0 B;  4J9U E;  2DR7 A;  3GQC A;  3MI7 X;  1EKS A;  4WP9 A;  4NCG B;  4YEA A;  4LF9 J;  3LF0 A;  2OMO A;  4KE5 A;  3AXK A;  3BGO P;  2OEJ A;  5HMX A;  5LSL A;  1GFW B;  4IO9 Q;  3KLE B;  3CCZ A;  3UFC X;  5JMN A;  2H5J B;  3IR5 B;  2KZM A;  4QQB A;  3UW1 A;  3KHH A;  2A6M A;  3D4J A;  2KT3 A;  4BCA A;  3NNC A;  3FBE A;  4QWC A;  2Z8Q A;  4K4X A;  3A3N B;  4BC7 A;  2FY1 A;  4P73 A;  2LEA A;  5ETN A;  4ZVF A;  1F3F A;  3RRH A;  4QPX A;  1RTH B;  3LAN A;  3K2Y A;  4DPY A;  3FNN A;  4Y2C A;  1F9F A;  1FWL A;  1Q8K A;  3R8Y A;  3DKD A;  1LFW A;  3MM6 B;  1CBK A;  2PC6 A;  4N77 A;  1G6B A;  2LU1 A;  5F8J A;  2VQF F;  5ADZ A;  2RHS B;  4WFZ A;  1OO0 B;  2KKH A;  5KT7 A;  1Q7Y T;  1FKA F;  2KYX A;  2UUA F;  4TYB A;  2AF6 A;  2IJN A;  3J80 U;  3FEX B;  1NKB A;  1SJ4 P;  3DRP B;  5KFH A;  5D3G A;  2CQH A;  4LRA A;  1L3V A;  3RB3 A;  3NXZ A;  4U7U K;  3NOG A;  4IH7 A;  4CH7 A;  2B51 A;  2LXU A;  2P8I A;  4ZMM A;  1M5H A;  1S1T A;  2GV1 A;  3QRR A;  1FJE B;  1GMU A;  1HYS A;  4TU8 A;  3U27 A;  2V69 A;  2XMU A;  3R6G B;  5DLF A;  2GAG C;  4DPW A;  3OSP A;  1BLU A;  3NGK A;  3HHL A;  5KG6 A;  4DR5 F;  2ZBR A;  1WEY A;  1F0X A;  3FRY A;  2K2P A;  4DR1 F;  1UWA A;  4B3M F;  1Q5V A;  2LLZ A;  3HD1 A;  1VJW A;  4ZPW R;  3CCQ S;  1P6T A;  2QLB B;  1KEK A;  3T5L A;  1EKR A;  2R7V A;  2X1B A;  2CPE A;  1WG1 A;  2I0X A;  1VHI A;  5D3G B;  1RU2 A;  4ZP7 A;  2MMY A;  2MST A;  2G1D A;  3ZTO A;  2BRK A;  1VQP S;  1RLC L;  3QFW A;  4FYX B;  3HKW A;  2LQJ A;  1W2B R;  3K89 A;  4M5I A;  1S9G A;  3D0G E;  3GB0 A;  2MJN A;  4FPI A;  4YME A;  4JI3 J;  2KHD A;  1S1T B;  1HYS B;  2FJA B;  3G87 A;  2DNQ A;  2WTF A;  3C14 A;  2N3O A;  3L7P A;  3OLA A;  3KKF A;  2MLY A;  3HHL B;  4USH A;  3MCN A;  3NAH A;  7AT1 B;  3H5U A;  5EX3 A;  2DH8 A;  4I67 A;  3H4D A;  1FTR A;  2YH1 A;  3N79 A;  2CPD A;  5IC6 B;  2ZBP A;  4RBU A;  3QAU A;  3KOA A;  3MF5 A;  5E41 A;  2VIH A;  4MK7 A;  4C0B A;  2XY5 A;  4LF1 A;  1FO1 A;  4IKA A;  1RAI B;  3VAL A;  5EHH A;  3MWB A;  2BM0 A;  2VFU A;  5LXR A;  1XBW A;  4I7F A;  5F3T A;  2EFG A;  5H9E J;  1JK9 B;  2RE1 A;  3TVZ A;  4I56 A;  1NSQ A;  3V2U C;  4DF4 A;  1RUS A;  2UXD F;  4K50 A;  1VIX A;  2ASL A;  1LEO A;  3DI6 B;  4DR2 J;  4DV2 J;  4NE9 C;  3C14 B;  1R8C A;  4JYA J;  4KGM A;  3K8W A;  1C4C A;  4USW A;  4OZL A;  5M2P A;  2QZ8 A;  4ES3 A;  2LQ9 A;  2GJ2 A;  2MSS A;  3GCX P;  1FNO A;  4ZP9 A;  3KNA A;  2VON A;  4ZVU B;  3LWL A;  1WC1 A;  4EZ9 A;  1RDR A;  3ZZT A;  2AJ1 A;  3BBB A;  3NCP A;  1N32 F;  3NWG A;  4LF8 J;  2HWT A;  3CJK A;  4LSZ B;  1CC8 A;  4CQ1 A;  3EX7 B;  2K1R A;  3PJW A;  2NXE A;  1Q0N A;  3PDN A;  1HNI A;  4OZN A;  5EWF A;  1FFS B;  2DRB A;  1BE4 A;  2L41 A;  2GMH A;  3ZZU A;  3HVT A;  2R4F A;  3TJ8 A;  3TAN A;  3PFO A;  1W25 A;  4P2X A;  5CZX A;  3EVW A;  4PQA A;  2PII A;  3FMW A;  1UCN A;  2RF2 A;  4HAC A;  2UUW A;  3UE2 A;  2QMW A;  2W7A A;  1JKH A;  2YNF A;  2VIC A;  3R97 A;  1T9T A;  3T1Y J;  2M9K A;  3W62 A;  2BZ2 A;  5JVH Q;  3LPY A;  4IG3 B;  2PDA A;  1UEV A;  4F8R A;  4Q8E A;  2CNO B;  2EG1 A;  1IKV A;  3CJK B;  4C8Z A;  4F25 A;  4B02 A;  3GV8 B;  3RAQ A;  4OYI A;  1TUV A;  1HNI B;  2C2E A;  1SQF A;  3K5P A;  1VRT A;  1NK8 A;  2A6O A;  2CKW A;  4C3M A;  3HVT B;  2HVE A;  1HR0 F;  3W3S A;  4O44 A;  5B0G A;  5HLF A;  2RB7 A;  2HBZ B;  2DNN A;  4Y2K A;  4K0K F;  3IGV A;  4CTA B;  3M8S A;  1WOP A;  2HRU A;  3CCJ S;  4U96 A;  1Q8L A;  2JEG A;  2RF2 B;  2WB4 A;  4F4X A;  4HAC B;  2PI5 A;  2U2F A;  2MQM A;  3V6J A;  2QFJ A;  1BY9 A;  4OI3 A;  2F8H A;  4O4G A;  1T3O A;  4HLB A;  1IKY A;  4NLY A;  1TVR A;  2HMI B;  4FF3 A;  1JKH B;  1NJX A;  5CYQ B;  2HSE B;  2YNF B;  1VR6 A;  2BW7 A;  1XNQ J;  4X62 J;  4L76 A;  2EK6 A;  3BN4 A;  1XER A;  3LGH A;  2DNG A;  3TVY A;  5KFC A;  2IDL A;  5GAH U;  1IKV B;  2F1F A;  2ZD1 A;  4LF6 F;  3AXM A;  3NWR A;  1J5O A;  2G13 A;  1B64 A;  4U7C A;  1YJN S;  4TQS A;  1VRT B;  1FVQ A;  4Q8F A;  2XYG B;  2H9Z A;  1B0T A;  3MPV A;  2VA2 A;  5B09 A;  4O44 B;  3R5D A;  2J9D E;  5HLF B;  5A6W A;  2G2Y A;  1QDU B;  4KH0 B;  1X4B A;  2XMT A;  3NNA A;  1TL5 A;  4AND A;  3JTP A;  2JLE A;  1Q95 G;  4R5P A;  2VC0 A;  5KFW A;  3TQE A;  4O4G B;  3IBC B;  4CI0 B;  5EN1 A;  4YS2 A;  1TVR B;  2CPH A;  4NLR A;  1MU2 A;  1X9M A;  1U2C A;  1MN9 A;  2ZC4 A;  3UNY A;  3G6X A;  2VAS A;  3OPK A;  2IMO A;  3H4B A;  4ZA1 A;  4YY3 J;  1CSJ A;  1RI7 A;  3BDP A;  5DG9 A;  1J5O B;  5K9F A;  1WNE A;  2R7R A;  1JLQ A;  4B9S A;  2V34 A;  2D3U A;  1B0P A;  4LUB A;  2VOO A;  5J2Q B;  2AIR B;  4LBH A;  2Q1L A;  2CQC A;  3AJD A;  1OS5 A;  2X1F A;  2Q3P A;  1RA6 A;  1RA7 A;  1TFW A;  2CPY A;  2JX2 A;  2KJV A;  3KLI A;  2MPU A;  2XBP A;  2ZH5 A;  4P74 A;  5JUM A;  4DSJ A;  2NLW A;  4OLP A;  3HJF A;  4DFM A;  2M4M A;  1WHY A;  2VG5 A;  4R5P B;  1J2V A;  2EFQ A;  2RRA A;  2AGO A;  3G71 S;  2CJA A;  2QLX A;  4S0M A;  3Q24 A;  4DV4 F;  4ZPC A;  3QJJ A;  1MU2 B;  1A6L A;  3IP0 A;  4DZ6 A;  3TZW A;  3D1H A;  3W8P A;  1VJQ A;  3M1V A;  3ILJ A;  3OVB A;  3M2V B;  4QWA A;  3BQ1 A;  2EKN A;  3F56 A;  2ZH3 A;  4DV5 F;  4ZPV R;  2F4V F;  1JLQ B;  3NGD A;  4ZP6 A;  3NNH A;  3DNC A;  4NX9 A;  1EQ0 A;  3RYL A;  2XMA A;  2OGU A;  4GKK J;  2NUU G;  4F0K A;  1VQM S;  2KM8 B;  4OX7 A;  3KLI B;  4RUB A;  3LP2 A;  5IXU A;  4IH5 A;  3NG8 A;  1UEU A;  1QE1 B;  3PEH A;  3AAW B;  3DOM A;  3NCR A;  2Y0S D;  3GG0 A;  4EWT A;  1Q86 T;  2V2V A;  2VG5 B;  2ZBQ A;  5KT2 A;  2FDN A;  4DCO B;  1EET A;  1Q16 B;  5KFU A;  1BQX A;  3AB4 B;  2I2Y A;  4CZC A;  4H4K A;  2HNZ A;  2BYC A;  4UTG A;  2RQK A;  3C8Y A;  3VZI A;  2N3L A;  3CDE A;  2H48 B;  2BQ3 A;  3TW0 A;  1KC8 T;  1QLN A;  1LQ9 A;  1SBR A;  5B0F A;  3M1V B;  3N6N A;  2VOD A;  1PYS B;  4NLT A;  2R2S A;  3ENQ A;  2DO4 A;  5D0R A;  4NZ6 A;  2V4R A;  4ZLP A;  1XTZ A;  4HDH A;  4WKR A;  4H4O B;  4B9M A;  2VPW B;  3AD7 C;  4ID8 A;  5E0O A;  4KHP J;  3VWS A;  1SH2 A;  2Y1I A;  4PEO A;  5DGA A;  3US5 A;  1SQG A;  2IIH A;  4CCH A;  2HEK A;  3LP2 B;  1FDD A;  1IJF B;  3DOM B;  4ILR A;  2L9D A;  3VGT A;  4UY8 5;  2OPR A;  2R2U A;  3ZZZ A;  3MTK A;  1FWK A;  5LMN J;  1TV6 A;  3M05 A;  1KVI A;  2QMU B;  1UVL A;  1EET B;  2DNR A;  3SQO P;  4FXW A;  2HNZ B;  2BAN A;  2JLF A;  1Z4U A;  2M70 A;  5F8I A;  3MM8 A;  5I3Q A;  2XYH B;  4PXC A;  2CJY B;  2YWE A;  3SCL E;  1V5V A;  2OSR A;  1RAJ A;  1FDB A;  5HP1 A;  4J9Q A;  2XC9 A;  3MUV P;  1VBZ A;  4NYZ A;  2CQ1 A;  1N5T A;  1DZ5 A;  3QSY B;  5KFJ A;  4X64 J;  2FLN A;  3KJV A;  2D9P A;  3POT A;  4ELT A;  3DMJ A;  2DK2 A;  2UU9 F;  1SIZ A;  1SC4 B;  5H9E K;  3HPO A;  4M1K A;  1YRX A;  1WKK A;  1VCT A;  1FD2 A;  2ZH2 A;  1S6Q A;  3VQT A;  2OPR B;  2BR0 A;  1TV6 B;  1FE0 A;  3BGR A;  5LSR A;  1RCO B;  1J5E F;  2QLF B;  2MXY A;  2PA3 A;  2DCU B;  2UXB J;  2R2T A;  1NB7 A;  3NOC A;  2BAN B;  1TTH B;  4AXI A;  3WDO A;  4JI4 F;  2NUH A;  2DR8 A;  1IWG A;  3HFV A;  4I0W A;  1IBK F;  3MM8 B;  5C5J A;  4BC9 A;  4NLW A;  3QT6 A;  3GYN A;  3SEO A;  5HP1 B;  4UUW A;  1YK9 A;  3MD1 A;  2G4B A;  3GE9 A;  3GFY A;  4X4V A;  2V9W A;  2BBE A;  3X1L B;  2Z2M A;  4WFA Q;  2MKJ A;  1MLA A;  1M1G A;  3KJV B;  4N56 A;  1H73 A;  2GFF A;  3POT B;  1TKX A;  3DMJ B;  5BYR A;  5KFA A;  1UFW A;  4FBT A;  4KRW A;  2QSF A;  3M8W A;  4M5L A;  3C6U B;  1M1K T;  2AYE A;  2ZC3 A;  1S6Q B;  2WW4 A;  3GPA A;  3UDL A;  5K8O A;  3N5B A;  1HWK A;  4CLK A;  2FVS A;  4WBF A;  3BGR B;  1ARO P;  2DVI A;  2XI2 A;  4UOH A;  3P49 B;  1KDN A;  3LAL A;  4HR2 A;  1UET A;  3VQS A;  4URS A;  2X1G A;  4KHR A;  3GYX B;  3CTR A;  4BWM A;  2ZH9 A;  2LDY A;  3PG9 A;  2NPI A;  5D4O A;  1SIW B;  1HWU A;  2HW3 A;  4YR3 A;  5KT5 A;  3IGN A;  2VUG A;  2JJ4 D;  4OYA A;  1ZTW A;  4FYD A;  2C42 A;  1R8A A;  2WVB A;  3OFE A;  3SV4 A;  3SQG A;  4MIW A;  4AD6 A;  5C42 A;  1TKX B;  1QY7 A;  2W1B A;  4DUT A;  4P52 A;  3M9N B;  4CRJ A;  2QO3 A;  4RNN A;  2V6A A;  3MAH A;  1JLA B;  1KHW A;  2OKQ A;  4R0E A;  3VZH A;  4DL6 A;  4Y00 A;  1YJT A;  1FER A;  1BMQ B;  3SMZ A;  1RT1 B;  2K3K A;  2ZDO A;  2IRX A;  5K8P A;  2ZDP A;  4P75 A;  1ZA1 B;  1K47 A;  2ZEJ A;  4OYB A;  1HD0 A;  1U24 A;  3PJX A;  5IWA F;  2JWN A;  4RUA A;  2EFO A;  3MEG A;  3JQK A;  2YX7 A;  3KLG A;  4C4W A;  1FJG J;  3SCJ E;  1RBO B;  4ZDN A;  4DQR A;  2C3P A;  1TL3 A;  2L08 A;  4UOF A;  1RBL A;  3CJT A;  1KN6 A;  3H5Y A;  2PT0 A;  2V4Q A;  1RXO B;  5C42 B;  2MDA A;  3TUZ C;  1NME B;  2KRB A;  3D67 A;  2Z57 B;  1FNM A;  5D15 A;  2WHO A;  2A10 A;  2IM2 A;  1ICE B;  2HAI A;  1SKR A;  2N4D A;  1U26 A;  2NYH A;  2W9B A;  2DO8 A;  4LVN P;  2HUR A;  1RWM B;  4NLO A;  4ED0 A;  3M6U A;  1IM4 A;  2WOM A;  2YWH A;  1T9X A;  4ZCL A;  1KVJ A;  3TVK A;  1S10 A;  4OZJ A;  4C8L A;  2LA6 A;  3MCO A;  3B6B A;  4N76 A;  3CT9 A;  1RK8 A;  5FDL B;  2EEY A;  3RU0 A;  3PX6 A;  3CD0 A;  1UVN A;  3MEG B;  5CHC B;  5DDP C;  3KLG B;  1HWJ A;  5FLX Y;  4N5S A;  3VGU A;  3PIP Q;  5KG4 A;  1SH0 A;  1FI4 A;  3IO1 A;  1S0O A;  3R9L A;  4YR0 A;  3R7B B;  2ZWP A;  1L5U A;  2HFS A;  2UUB F;  3L09 A;  2GO9 A;  2PFD A;  2W4C A;  3R2D J;  3HO1 A;  3ISN C;  2D3O R;  3TP2 A;  2NR0 A;  1IQZ A;  4DU8 A;  3Q8Y A;  1FRK A;  3NP5 A;  4V1A k;  1Q8I A;  1IXK A;  4OJH A;  3G6E S;  2HHQ A;  4DXL A;  2IPO B;  4ZCK A;  2W9B B;  1LWE A;  2EW9 A;  2C2K B;  1NPR A;  3BH7 B;  3EYZ A;  5A8K B;  4KKO A;  2Y8W A;  1R0A A;  1GTE A;  4B3R J;  3IS9 A;  3VAI A;  1IBM J;  4TY8 A;  3TI0 A;  4LFC J;  3TA0 A;  4A8X A;  4C97 A;  2CPF A;  4UY8 T;  3GII A;  3ZTS A;  4KH1 B;  1OY9 A;  1VC6 A;  5HJY A;  1RWV B;  2AZ3 A;  2RRN A;  3MAQ A;  2QJ3 A;  3PFE A;  2ILZ A;  1SL0 A;  4EO6 A;  4XAK A;  4M5J A;  3MMC A;  1P9Y A;  2I1R A;  5J2P A;  2POK A;  2CQG A;  4IFY A;  2HRY A;  5DZ6 A;  1JLF A;  2DO0 A;  4RBV A;  2EVZ A;  4GKJ J;  3UDE A;  1D09 B;  1U6F A;  1X4F A;  4NEZ A;  2UVV A;  4Q44 A;  5D77 A;  3MEC A;  3AFG A;  3ZZP A;  2BEF A;  1SJQ A;  2XO7 A;  1RYR A;  1LWE B;  1R6Y A;  5F9N A;  2GAH C;  1NK9 A;  4X66 J;  3Q8Q B;  2VDI A;  5AXL A;  4I2P A;  3JQJ A;  4KKO B;  2WVD A;  3PKY A;  5HQL A;  2YKA A;  1FNX H;  3IS9 B;  5K20 B;  4ZLN A;  4TY8 B;  4ID5 A;  1R3N A;  4JYA F;  1JNZ B;  1RQ0 A;  2BDP A;  5KG0 A;  3BGU A;  2WB1 D;  2F63 A;  1FTC A;  4DV6 J;  1HHQ A;  3EPG A;  4NLP A;  2KRR A;  4L3N A;  2HRX A;  1HBO A;  1SJ1 A;  1QVG R;  3MMC B;  3MPW A;  5CXT A;  2LEP A;  5GAD I;  5AE2 A;  5J2P B;  2SXL A;  2QN6 B;  1JLF B;  3KK2 A;  1M5O C;  1S1U A;  1UL3 A;  4LR9 A;  3MEC B;  1VRU A;  4KHM A;  2ZH4 A;  2V0N A;  1VQO S;  3AOC A;  4DJB A;  3QGG A;  2FZC B;  3MR3 A;  3KHG A;  3UPF A;  2FVP A;  4F3Q A;  1L3S A;  1S9E B;  4ETX A;  1H6K X;  2WW8 A;  3TYT A;  2R2R A;  4I2P B;  2ZHA A;  2R8K A;  4XO0 A;  2XWX A;  2GS8 A;  4M8L A;  1SQE A;  3D66 A;  4B9U A;  4C8N A;  2Z56 B;  4ID5 B;  1TMM A;  1LOU A;  3RBD A;  2P5V A;  1YZ7 A;  4DI6 A;  1H38 A;  7FDR A;  1HD1 A;  1RP5 A;  4OZ5 A;  1XJW B;  1Q53 A;  4YB1 P;  2XMJ A;  2KI2 A;  1CG2 A;  4FVC A;  5D4L A;  2CG4 A;  2D74 B;  3T1Y F;  3ADA C;  3KUE A;  1ELO A;  3SIP B;  1IKW B;  1U1P A;  2EC2 A;  4O0I A;  1JJ4 A;  2RU3 A;  3KK2 B;  1WHV A;  2H4Y B;  2JDJ A;  1S1U B;  1AYE A;  1BWV A;  3FKB A;  2VBX A;  3E3X A;  1FKO A;  2EI5 A;  3PRB A;  4F50 A;  1MMN A;  1I1G A;  3QT8 A;  3MHY A;  3WX4 A;  4DV0 F;  4MKV A;  1PYO B;  3AOD A;  3R1H A;  3BPS P;  2BMB A;  2W8L A;  1KR4 A;  1T7P A;  1FX2 A;  3BGF A;  1SC6 A;  4B9V A;  4QJV A;  1T95 A;  4UQT A;  2BOP A;  2HGL A;  3A1Y G;  2JFK A;  2EW0 A;  3G6V A;  3HKZ D;  3AQP A;  2E1A A;  1H2V Z;  1RSC A;  1T3N A;  2FTR A;  2QYC A;  4IFV A;  2HHX A;  2VFR A;  4RU9 A;  4DUY J;  4Y2I A;  3CPW R;  1SJR A;  1YZ6 A;  2KXF A;  4CNZ A;  1XNQ F;  4ZLL A;  3J7Y I;  2KFZ A;  1T02 A;  5KT3 A;  3UDV A;  2NXC A;  5ETP A;  3LW5 C;  2FHK A;  1BGX T;  1SL1 A;  4ZK7 M;  1ZM4 A;  1WKJ A;  3DRS A;  4CLW A;  3E2E A;  1U45 A;  1WC4 A;  2GNK A;  1FKO B;  3I4P A;  4KT0 C;  5CQG A;  1HNZ F;  1PC4 A;  3EZ5 A;  5CAB A;  2QX0 A;  3QQC D;  4HHH A;  4PQU A;  2KTQ A;  1D8Z A;  1C1B A;  2Z30 B;  3W1Y C;  1RAB B;  4J9N A;  4N41 A;  3SSR A;  3H59 A;  3NMR A;  2RML A;  1M90 T;  4J9M A;  4DS5 A;  2QL5 B;  2HZV A;  4IFV B;  3CJR A;  3PX0 A;  2LEB A;  1RU1 A;  1JX4 A;  2P9C A;  2W2M P;  2UUT A;  5E5N A;  4KY3 A;  4LQ9 A;  2A2C A;  2XZT B;  3GIK A;  3CJ2 A;  3BO2 A;  1Q4R A;  4Q2L A;  1JJ2 R;  4PYD A;  4DDF A;  3DRS B;  5D4P A;  4IQX A;  4YY3 F;  1ITP A;  3CJ4 A;  3JSM A;  4W92 B;  4FBU A;  1M5P C;  1R8B A;  4JI7 J;  4ETZ A;  2KXH A;  2ZKU A;  5A2Q U;  1U8W A;  1NZA A;  2KXN B;  2EG2 A;  4IRK A;  1HW9 A;  1C1B B;  1X5T A;  2DGO A;  3DRR A;  4DPX A;  5DZ7 A;  2HPU A;  3VAG A;  2I6W A;  2IRU A;  5KOW A;  2ZNY A;  4WYL A;  1E6V A;  3D5M A;  1D9F A;  2MKI A;  1A7G E;  4B08 A;  2XI3 A;  3JQM A;  2ACM A;  2H1Y A;  2W9C A;  2R3V A;  1FRJ A;  4FYV B;  4EZ6 A;  4KYZ A;  5AJ3 F;  3RRK A;  4I6W A;  3O6Q A;  3TOQ A;  3Q2S C;  2DY1 A;  3MMB A;  1SJ3 P;  2YKQ A;  1JB0 C;  3BRE A;  2MEW A;  2FPH X;  3FSY A;  3A8E A;  3PR5 B;  3BDE A;  4OYW A;  2XY7 A;  4WFN Q;  3BQ0 A;  1U02 A;  3QBC A;  4LBI A;  4ER8 A;  3JSM B;  2LQ8 A;  3NS7 B;  4ED5 A;  5B0B A;  3CDW A;  3RBZ A;  5LJ3 Y;  4M5G A;  1S6P A;  5EGY A;  2VH7 A;  4GKK F;  4OJG A;  2XY6 A;  3H20 A;  4IOB A;  1DQ9 A;  3PVX A;  2UP1 A;  3RW7 A;  2GIR A;  3JAM U;  2IVF B;  4U8Y A;  3QJP A;  3DRR B;  5ETT A;  1NO8 A;  2BUN A;  1Q5Y A;  1RWK B;  4DCJ B;  4RW4 A;  4OI2 A;  3UI3 A;  2CPI A;  2XSF A;  1E6V B;  4ZVO B;  2CNN B;  2HFO A;  5JVG Q;  3FK4 A;  1N5S A;  4ZJQ A;  4A8M P;  3IRX A;  1VQ9 S;  4YN3 B;  1NXI A;  1UJ5 A;  1G7C B;  4NA1 A;  1YKW A;  3AA8 A;  3TQ1 A;  4RL1 A;  1HI8 A;  3N6L A;  2BXJ A;  5IOL A;  2RIL A;  3MMB B;  1NPK A;  1F9H A;  3HK2 A;  1Y7P A;  1KQF B;  2ZZT A;  3HHE A;  4DX7 A;  5MAO A;  1T11 A;  8AT1 B;  1BUX A;  2OFG X;  4AL5 A;  4OHW A;  1KNZ A;  1QSS A;  1X4D A;  3G86 A;  2QTW A;  1FEH A;  2YY3 A;  1RBA A;  2ZOM A;  2LP4 A;  3B82 A;  4OMF G;  4LSN B;  2ASD A;  3ISN D;  1S6P B;  4I2Q B;  4ZKA A;  4LF5 J;  4CLY A;  4PPZ A;  2ZE2 B;  4K4W A;  3M30 A;  2YWG A;  5K8N A;  3A13 A;  3KG4 A;  1TZ0 A;  3HSJ A;  1ZPW X;  5KAK A;  5CYJ A;  1O8B A;  3DLJ A;  1N4L A;  4C8K A;  4J9K A;  4RW4 B;  4ZVE A;  1NDP A;  1A9N B;  2GMJ A;  4PKD B;  3BYP A;  4QR2 A;  4EBE A;  1NM2 A;  3D6M B;  3IRX B;  4FYY B;  5DQI A;  4LRD A;  4Y28 C;  3H2U B;  4K59 A;  4ZIW A;  2R7U A;  5KOX A;  2OJ3 A;  3HHL D;  3B54 A;  2UV8 A;  2N82 B;  5C2G A;  3V6H A;  2NXJ A;  3WC0 A;  3I32 A;  5LMU J;  2GIF A;  3G8T A;  2YKN A;  2C2Z B;  4W90 B;  1WJ9 A;  2ZH1 A;  2AJ4 A;  4X64 F;  2QV6 A;  1BQN A;  5KFP A;  2E5G A;  2AGP A;  4QCL A;  2AEF A;  2B5J A;  2D9O A;  3SCK E;  4ED6 A;  1RZM A;  2W25 A;  2MKY A;  4EMD A;  3BKF A;  3M30 B;  3BQ2 A;  2XMM A;  4OZ0 A;  2IBO A;  3CWJ A;  2QMX A;  3JS9 A;  4QZV B;  2V4J A;  3OBI A;  4U9R A;  3M2U A;  2HK2 A;  4GVB A;  5E2Q A;  4NLG A;  2DGU A;  2QC3 A;  3OFG A;  2BJ3 A;  2UXB F;  1NJW A;  3BSA A;  2MZ1 A;  2RS2 A;  3OUY A;  1WSR A;  1VI7 A;  5AE3 A;  2G1H A;  4BBY A;  4XPC A;  1VQY A;  4W98 A;  2QGF B;  4LF7 J;  4HL9 A;  2YKN B;  4K5R A;  4C2M A;  1N48 A;  2WON A;  3THP A;  4ECU A;  1P27 B;  1I6J A;  1RT6 A;  3NS6 A;  1WDD A;  4L74 A;  1IR0 A;  4CM0 A;  3OFF A;  3CME S;  3ZZY A;  3IWX A;  3HSD A;  2V4J B;  2KJW A;  3T9N A;  2OPS B;  1KTV A;  3CC2 S;  3EWG A;  3UCG A;  2YVS A;  3CD7 A;  4JV0 A;  5HN0 A;  1RT7 B;  4GVB B;  4K4U A;  1JLE A;  3JB9 k;  4KGV B;  4F26 A;  1DRZ A;  1LW2 A;  2Q43 A;  2J9C A;  3OUY B;  2D1C A;  2HS3 A;  2XUL A;  1T0T V;  3NKY A;  3G82 A;  4WYW A;  5I3U A;  2UVW A;  2HGM A;  3MGJ A;  4A47 A;  1WWH A;  1BC6 A;  1NK7 A;  2J76 E;  3D6F B;  2CQ0 A;  4Y6I A;  2A3J A;  2HQC A;  3G8S A;  5J1N A;  4TU9 A;  1ZPV A;  4FNI A;  5U47 A;  4BHQ A;  1AXQ A;  2WON B;  3IMQ J;  2UVR A;  1V5I B;  3D9B A;  2R8J A;  2WVE A;  4P2M A;  2JSX A;  2VG7 A;  1RT6 B;  3TAQ A;  4QYZ J;  2RT3 A;  2YPZ A;  4OZ1 A;  4WJB A;  2N7Y A;  3VHQ A;  1R27 B;  1UVI A;  1D0E A;  2IVY A;  4ECW A;  3KWM A;  1N0V C;  2DRA A;  2R7Q A;  4MAK A;  1JLE B;  4FF1 A;  4A48 A;  3ITH A;  3CCV S;  4DR4 J;  3PM9 A;  1HL6 A;  2XHC A;  2GA7 A;  5B0A A;  1GMW A;  1NHK L;  1LW2 B;  4JOU A;  4RW8 B;  5IS2 A;  1FXR A;  1UJ4 A;  4X65 J;  1U2R A;  1U1Q A;  1I94 F;  3HF5 A;  2EFV A;  4F0M A;  4OHY A;  1PJ5 A;  3G82 B;  1SUQ A;  5I3U B;  1NHU A;  1RAE B;  4RWW A;  1FJG F;  4K4V A;  5KFR A;  2AW0 A;  3TUJ C;  3ZTQ A;  4WZQ A;  1LK7 A;  2DEI A;  3W7B A;  3C66 A;  2Y1J A;  1GK8 A;  5D8H B;  4OV1 A;  1PYT A;  5H9F J;  3MOJ B;  3C6T A;  1TUG B;  3OR2 A;  3DCA A;  3A3P B;  1U1R A;  3EM1 A;  2VG7 B;  2F5G A;  2FC9 A;  4WXW A;  1M5S A;  3DLB A;  1ACM B;  3JTO A;  2Z4P A;  4MFB A;  1TKD A;  3ZNJ 1;  1TL7 A;  5HMZ A;  3OHA A;  4NML A;  4O3Q A;  1CS4 A;  2C2N A;  4QU7 A;  2R7T A;  4ZVP B;  1WF0 A;  3ETO A;  2PGC A;  2R7W A;  2VZ9 A;  1DY3 A;  4O23 A;  3IAS 9;  1H7W A;  5KFD A;  1R31 A;  4G1P A;  2CVE A;  4OI6 A;  1EP4 B;  2QFI A;  1Y11 A;  1X31 C;  3QMQ A;  1RT5 A;  2VQE F;  1XR7 A;  2DD8 S;  1EB0 A;  2V67 A;  1VMB A;  1S4E A;  2W8K A;  4ZVG A;  1XEZ A;  1MRO A;  1SUQ B;  2DBB A;  2GX8 A;  4PXB A;  4WKY A;  4P10 A;  3GV5 B;  4QWB A;  2GJF A;  3CED A;  3LGM A;  3C19 A;  8RUC A;  3B8H A;  3R7S B;  2DGX A;  1LWF B;  3C6T B;  2E5L F;  4ED8 A;  3DOL A;  3OR2 B;  4WK1 A;  4DG1 A;  3MUM P;  1NZ8 A;  4RO0 A;  3P3D A;  4X4N A;  4DPO A;  1RHK B;  1X0P A;  2HQD A;  4USV A;  4MFB B;  1YBT A;  2ZH7 A;  1HBM A;  1TL7 B;  3CCM S;  5L8R C;  1JQG A;  1HLW A;  1Y3J A;  1R89 A;  4DUZ F;  3UD3 P;  4JI1 J;  1GTH A;  1VRQ C;  2CNL B;  2VPX B;  2MZT A;  1S1W A;  3UN2 A;  2J6S A;  1FJC A;  4CDI A;  5KG2 A;  2AT1 B;  1O0P A;  1X4C A;  3F73 A;  3I9Z A;  2DXE A;  2AKW B;  2AJ0 A;  4IRC A;  4B3R F;  3BS9 A;  3NGS A;  4EFA C;  4YOE A;  2DRD A;  4A46 A;  2OTJ S;  3TX0 A;  1HBN A;  2J9E A;  1X4E A;  3UDC A;  2OEM A;  1AZS A;  2CJK A;  3ENV A;  1DQ8 A;  5M2R A;  5K14 A;  3EDR B;  1S0M A;  3DOL B;  2V68 A;  2BE7 D;  2HYI B;  4DG1 B;  3EZO A;  1QUP A;  4MK8 A;  4DBQ A;  4FVM A;  3A8K A;  4MKA A;  4GKJ F;  4EI2 A;  2BJ7 A;  4NXN J;  1HBM B;  2YQ3 A;  1V3S A;  5J2M A;  1KP6 A;  1MMD A;  2DNL A;  5A76 A;  4DLE A;  4O3R A;  4NL5 A;  2EC0 A;  3ZNU A;  1RHM B;  1O5J A;  4X66 F;  1S1W B;  3RW6 A;  4NLV A;  3PTW A;  2CVI A;  2FZK B;  3I5A A;  4URQ U;  2FJE B;  3HCX A;  4P7T A;  1JXL A;  3KLH A;  3PW7 A;  1K0T A;  3BV8 A;  1YJW S;  2UVU A;  1HBN B;  2MGZ A;  2HWI A;  4DV6 F;  4NRU A;  1GH8 A;  3CIM A;  1AZS B;  3BO3 A;  1HW8 A;  1S6O A;  4EO8 A;  2LYV A;  4DV7 J;  1NSP A;  2Y3Y A;  1T9W A;  3MTJ A;  1S1X B;  4OX8 A;  4CH0 S;  1IM6 A;  3GFZ A;  3GCW P;  3VGV A;  5CD4 H;  4MH8 A;  1WKL A;  3LA0 A;  5GAE U;  1N36 J;  2AGQ A;  4WII A;  1F1B B;  5ETK A;  2H3E B;  5DDQ C;  2B7B B;  5J2M B;  2D41 A;  5DQH A;  5EWG A;  1R43 A;  1N5Q A;  4EYH B;  3A3O B;  3UN5 A;  1SI9 A;  4JV5 J;  2DNO A;  1SCJ B;  2WSC C;  1WG4 A;  1CJV B;  1B99 A;  1T9Y A;  4DSI A;  2AJF E;  4ITS A;  3H98 A;  3KLE A;  2QA2 A;  2OSQ A;  2ZHB A;  3UO0 A;  4PWD A;  3KLH B;  4OX6 A;  3LOU A;  5A8R B;  2C22 A;  5LJ5 Y;  2G2O A;  1N0U A;  1EQM A;  1CLF A;  3NGR A;  1RWX B;  2MGZ B;  1VFJ A;  4PRF A;  4UOC A;  1YJ9 S;  1UEK A;  5G4D A;  2V8D A;  4MKB A;  4JI0 J;  1TR0 A;  2W2Q P;  4OLO A;  3MM5 B;  2VD3 A;  2ADB A;  4TU7 A;  4YFU A;  2PEH A;  2FJB B;  4PXD A;  1S0N A;  1FXL A;  4F4A A;  5E3C A;  1VQS A;  3RG6 A;  4HH0 A;  2Y9H A;  2DNK A;  1RWU A;  4M5K A;  3SCI E;  3I0R A;  4ILL A;  3N0V A;  4QOT A;  3FSI A;  2EBE A;  2JEJ A;  2V63 A;  3AOA A;  4FZV A;  1U47 A;  5DO2 A;  4RU2 A;  5E33 A;  3Q8V A;  2DHS A;  2BRL A;  4QWD A;  1B4S A;  5B08 A;  1VLY A;  4PZV A;  4KFB A;  1GMV A;  4NLX A;  3DRP A;  4PWD B;  4TLR A;  5B7W A;  3BKT A;  3L7U A;  5SUH A;  2NQP A;  2LXF A;  2V9K A;  1KQK A;  3PW0 A;  2KN4 A;  2IBK A;  2RNE A;  4DUY F;  5D4N A;  3QO9 A;  1OSD A;  3Q8P B;  2MQN A;  4NEY A;  4YP3 A;  2VKZ G;  2D69 A;  1RAD B;  5H1S V;  4NWB A;  3T6B A;  1NSA A;  1K9M T;  2GZO A;  2R7O A;  3W66 A;  4J37 A;  2ZJR Q;  4LF4 F;  1UAW A;  4FPR A;  3I0R B;  4N7T A;  3R7N B;  2QSW A;  4CLS A;  4ANE A;  4DQS A;  3CNQ P;  2LVW A;  2M52 A;  4DV3 J;  3VAJ A;  2V8V A;  1HA1 A;  1Y00 A;  4CLZ A;  2MLZ A;  4EYI B;  2V8P A;  3VTI A;  4DCP B;  3CMQ A;  4KFB B;  5GVQ A;  4X4O A;  3PJ9 A;  2DNZ A;  1PJ7 A;  2XMK A;  5GAG U;  4AT1 B;  4OHX A;  3OD2 A;  2EK1 A;  4DR5 J;  2JEF A;  2P9E A;  3T5K A;  2KH9 A;  4E0D A;  4DV1 F;  3QO9 B;  2FLO A;  4DR1 J;  2C3U A;  1YSJ A;  1QD1 A;  4JI5 J;  1JJC B;  2B9W A;  4ES1 A;  4E98 A;  1KTQ A;  4B17 A;  1SB6 A;  4Y3C A;  1GX6 A;  2W24 A;  5ETR A;  5KTQ A;  3M8P A;  3EJM A;  3R5G A;  3DLK A;  5CAA A;  4JI7 F;  1KLN A;  3BGL A;  2YNI A;  3TNV A;  2CUY A;  1U09 A;  4QYZ K;  3WC2 A;  4DR3 F;  5MLC V;  3KG0 A;  1REG X;  5KG3 A;  2VFS A;  3RB0 A;  1XN9 A;  4K2J A;  2AHO B;  5F0U A;  3CC7 S;  4A8F A;  1FRL A;  1PKU A;  1YDL A;  1M1H A;  5EWE A;  3EGW B;  1YLX A;  2RUS A;  5DG7 A;  3S1T A;  2OO4 A;  2I38 A;  3KG1 A;  1Q79 A;  2OTL S;  1VC5 A;  3KJN B;  2ZUA A;  3GP9 A; 
#chains in the Genus database with same CATH homology
 2MUI A;  2DO8 A;  2EW0 A;  2HRX A;  2HAF A;  2AJ2 A;  2GS5 A;  2GZO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...