2ZC4A

Penicillin-binding protein 2x (pbp 2x) acyl-enzyme complex (tebipenem) from streptococcus pneumoniae
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
158
structure length
158
Chain Sequence
AKRGTIYDRNGVPIAEDATSYNVYAVIDENYKSATGKILYVEKTQFNKVAEVFHKYLDMEESYVREQLSQPNLKQVSFGAKGNGITYANMMSIKKELEAAEVKGIDFTTSPNRSYPNGQFASSFIGLAQLHENEDGSKSLLGTSGMESSLNSILAGTD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Biosynthetic protein
molecule keywords Penicillin-binding protein 2X
publication title Crystal Structures of Biapenem and Tebipenem Complexed with Penicillin-Binding Proteins 2X and 1A from Streptococcus pneumoniae
pubmed doi rcsb
source organism Streptococcus pneumoniae
total genus 32
structure length 158
sequence length 158
chains with identical sequence D
ec nomenclature
pdb deposition date 2007-11-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2110 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2zc4A02
3.90.1310.10 Alpha Beta Alpha-Beta Complex Penicillin-binding protein 2a (Domain 2) Penicillin-binding protein 2a (Domain 2) 2zc4A01
3VSLA 5M19A 4CJNA 3UPNA 5U47A 1MWTA 4CPKA 3UE3A 4N1XA 3EQUA 3ZG5A 4MNRA 5M1AA 1MWSA 1QMFA 4RA7A 1PYYA 4BL3A 1QMEA 5KSHA 4OVDA 1MWUA 3UN7A 4JBFA 3ZFZA 3UPPA 3UPOA 3ZG0A 4R0QA 4R23A 2ZC4A 4QJGA 3LO7A 1MWRA 2Z2LA 1RP5A 2Z2MA 1VQQA 4DKIA 5M18A 4R3JA 4BL2A 1K25A 3VSKA 4R1GA 2ZC3A 3EQVA
chains in the Genus database with same CATH superfamily
2Z0GA 2KYXA 1ZAWA 3FQLA 3BBBA 3KLHA 2CPZA 3ZTSA 3MEGA 1M1GA 4U7UK 4ED0A 5D77A 2KYZA 4N76A 1BWEA 3SCKE 3UPOA 4C7QA 4KO0A 4M5HA 1RDRA 1ACMB 5KFMA 2MY8A 2F40A 2AIRB 2V34A 2UXBF 3HK2A 1GXUA 2VPZB 2QLXA 5EUHA 1GAOA 4CWBA 3OTOF 4RU2A 4F4KA 1FJEB 2F65A 2ZD1B 4UY85 2JEIA 4OI6A 5KFYA 1N52B 5IC4B 2NUHA 4ZVGA 2PA3A 2FHJD 1VISA 3VSKA 2QJ3A 2FGCA 1TP7A 1R43A 2R8KA 3VAGA 2OPQB 3C8YA 5A6PA 2GHPA 2GNKA 3DHWC 1G6BA 2EFGA 5B0FA 2CXEA 3D6HB 1VQ4S 1NAQA 1PYSB 3QRQA 2JVOA 2UXBJ 2YKMA 5I3QA 2OTLS 1YJTA 3OTOJ 3NY0A 1F6TA 2OEKA 2QG9B 3ILIA 5H9FK 2OEMA 2GJFA 4F2SA 4O3NA 2DY1A 3E51A 3ISNC 1LOUA 3TANA 1LXNA 2V9WA 2HIYA 1CJKA 5GAEI 4DX7A 1RZMA 2LVWA 4OMFG 2HK2A 1T9YA 4A8SA 4I69A 2CQ1A 2IM2A 2BANB 1N32F 1RWKB 1B64A 1RTJA 1B7FA 4FP9A 4USHA 1RHUB 2CJYB 1HQEA 3TVZA 3JSMA 3BGLA 2F3JA 1YG0A 2BBEA 1TKTB 4ZVQB 1WKJA 5J2MB 2UXCF 2AZ1A 3MZIA 3CGIA 4IO9Q 2ZKUA 2XZTB 4HI1A 4GO5X 4WFXA 1Q7YT 1TV6B 5CZXA 3OTDA 1S1WA 4B3OB 5F8LA 3HD2A 4R1GA 1RLDA 2XMMA 4HR2A 3RBXA 1UMJA 1N32J 1GMWD 2CZ9A 1GMWA 3Q8SB 3CE8A 4NASA 2E7XA 2DH9A 3HXMA 1HNZF 1RWOB 4PCQA 3DOLA 4ECWA 1JLAB 3QFHA 1VMBA 4RNFA 1SB6A 4ALZA 4IG3A 4NEZA 2C3PA 4CCHA 1JLQA 2YNGA 2UXCJ 3VGTA 1U1RA 2UVRA 3EGZA 2LEAA 4HDHA 3C6TB 3W9JA 2DD8S 1TZ0A 1U7LA 4Y00A 3MDFA 1JLGB 2XY7A 1C2PA 3PR5B 4USMA 2AEFA 2JRSA 3BBFA 3QSYB 3CMAS 1SKUB 1J5EJ 2W25A 1U0HA 3DGPA 3AT1B 3HVWA 4ID8A 3LH2S 4CI0B 2IVYA 3DLEB 1RACB 3DN9A 1LFPA 1Z2ZA 1HNZJ 3DLGB 2OUGA 4C8NA 1DFDA 4YB5A 4HTIA 1VC6A 2J0WA 2QEXS 4Z7YA 1N8RT 5M19A 3KLEB 1U1MA 1C4AA 4WIQA 3WX4A 2E66A 3H5YA 3DMJA 1LNQA 3MUTP 3GFZA 3OTCA 1AZSA 2FZGB 4GVBA 5KFNA 2DGWA 4QQBA 4F4XA 2FGOA 4UOFA 5ITHA 4U9RA 3NOCA 1R8PA 4WP3A 3VALA 5L8RC 4EGLA 2KKHA 2LDIA 5F0WA 2EK1A 2JJ4D 2XULA 1IBKJ 2IM1A 2VA3A 4MNRA 2A2DA 4TY9A 3AXKA 2EI5A 4FZVA 3MFIA 3CPWR 2B43A 4UZBA 1C1BA 3VTIA 3M05A 1MWQA 2VFRA 2Z2ZA 2VBYA 2ZZMA 3MXHP 4HACB 2M70A 4OYIA 2R7QA 4WJBA 2FTRA 3IR6B 1FT8A 4N8OA 2I38A 5DM7Q 4V19J 3UQSA 1Q8KA 4PG5A 1H7XA 3GJRB 5L39A 2GGPB 2JX2A 2CDQA 5IT9U 5GAGU 3D1HA 4YB1P 2B0GA 4Q0BB 3QZ7A 1RWMB 3KYLA 1FJGF 5M18A 4LR9A 4JOUA 3UPFA 1VHFA 3IG1B 3F0NA 2HGNA 4RW4B 3T9ZA 3EICA 2J9DE 2HHHF 1ZOTA 3NXZA 3M30A 4K4UA 1OQ3A 4NYZA 3PX0A 2E5GA 5KT6A 3IBCB 5C5JA 2CFXA 4WTYA 1XBWA 2HHPA 1FEEA 4C0HA 2YQ3A 4JI4F 3QLHB 4NLTA 2CNNB 2MQMA 4IFYA 5A8RB 3BSCA 3M6VA 1C1CA 4R23A 4PQUA 1KLMB 5LXRA 2P2CB 2JLFA 3J7YI 4O3PA 1X4DA 2Z56B 2ZH7A 3UVJB 4LJMA 4I7FA 5G4DA 3J80U 5ETTA 3SYZA 3OL6A 2DPIA 2ZZTA 2ZWPA 5DZ7A 2HHHJ 4HHUA 2MMYA 3JTOA 2VOPA 3MF5A 1FRIA 1P9QC 2WBMA 4BC7A 3NGDA 1REVB 2IJRA 4ZP8A 2W4DA 4X4TA 4OVDA 4LR8A 1DHMA 3GIIA 3TEGA 5IT4A 2MQNA 2ERRA 4M5MA 2I6WA 3AOBA 2JEFA 3ISZA 2YWHA 1ZAXA 2B4VA 3KJVB 3OXGA 1Y3KA 1BQNA 2W9CA 2UVWA 4KSEB 1FE0A 4FF4A 3H2VE 3VCDA 2NPFA 1BWVA 3MMCB 1QUVA 1ZBTA 1UJ5A 3NAIA 2BA9A 2AKWB 4IH7A 3OC2A 1RHKB 1VBKA 5F8JA 3BEGB 3EX7B 2OLUA 2YNHA 2RIJA 3DI6A 4Q44A 5D4OA 2K3IA 5AE2A 1IJFB 3LQVA 4P2SA 4L3KA 2BW2A 4KB7A 1UCNA 3TW0A 1TL3B 3CJKB 1NCLA 3GG1A 5H9EJ 4DS4A 2H48B 1N5QA 3SMZA 1NHKL 3FJ2A 1NNDA 4KGXB 1LW2B 1IKYA 3TI0A 4WFAQ 2MGZB 1M5SA 2HIQA 1IR2A 4DL6A 2B6AB 4RUCA 1RBLA 3KDOA 1V6HA 5RUBA 3E2EA 5J1EB 1RT5B 1YRTA 1NHVA 4MIAA 1QM9A 3SQOP 4ES3A 3UR0A 1VK8A 3CJ0A 4I2PA 5L9XA 5JVGQ 1S1UB 2M8DB 2RUSA 1BLUA 2J6SA 3M2VB 4YEAA 3NWRA 3CTRA 4LSNA 3M6UA 1VLOA 4MKVA 3IAS9 5D4NA 3PYDA 1S1TA 1UWAA 2CQCA 4Y6IA 1JLCB 2I0XA 1RA6A 3EJMA 5GMKa 3G82A 2VFTA 3THVA 4MAKA 4CH7A 1PBUA 2LYVA 3IXQA 1Q5VA 5KT2A 4DKIA 3CC2S 2UV8G 4WE1B 4K0KF 4OZ1A 2QC3A 2C1EB 5B09A 2PMHA 2NQPA 4LFAF 4LF1A 2JFDA 5D4LA 4DG1A 2ZOGA 3VHQA 3GFXA 2B56A 4ZLLA 4FN5A 3SXLA 3SIPB 3AFGA 3K2YA 4E8UA 3DLKB 3DRXA 4BC9A 4DF8A 2YXLA 2FVRA 1YTYA 2MZRA 1S48A 3MM5A 1S59A 3I31A 3M8PA 5KFHA 3DCAA 3NWGA 4F4YA 4YFUA 4LSZB 1F2HA 3CO0P 4RX6A 2GO9A 3RR7A 1NBEB 5FDLA 2QTWA 3BPSP 1FERA 3BM7A 4K0KJ 1JKHB 4P72A 2E5HA 2N82B 4LFAJ 1NEEA 3H4DA 3N01A 2DIVA 1RWWB 1WEYA 1Y5IB 1VCTA 1JLBA 3TAMA 5KT3A 1UFWA 2HFOA 3AH6A 2X51A 2W2OP 4GVLA 1ICEB 4IR1A 2RHSB 3NCRA 3MOZA 5T14A 2P9EA 4CQ1A 3Q22A 3C15B 2BMBA 4K4XA 2ZDPA 1OYEA 2VJVA 3PEHA 3K5OA 2IA0A 3KLIB 1Q0NA 1Q7LB 3H90A 1BGXT 1YSJA 3IRXA 3ZZTA 3HI9A 5E7OB 5DDRC 3MMBA 1WKKA 4OX9F 2V63A 2UUBF 2V94A 2CADA 3NCPA 4CLTA 4JI6F 4ZJQA 1VQMS 1J27A 3I0RB 3R5CA 4F02A 4B9MA 2R9LA 4DV5F 4A8QA 3R2DJ 4ETZA 2NXJA 4FF3A 2XLKA 4DN9A 1HR0F 4M5GA 1HNVA 1EQMA 3FFIA 1G2EA 3M9MB 4R0QA 1PKUA 5L1KA 2ZH6A 4HI2A 3BS9A 1QVFR 3BQ1A 2ZKTA 4Y3CA 2GVZA 4ZVFA 4DCOB 2XMKA 4G1PA 3T6JA 1K0VA 2VG6B 2LEBA 2D3ZA 5IV4A 1U24A 2QRRA 2YPYA 1SC6A 3B4DA 4OX9J 2UUBJ 3FC9A 4IDKB 1QSYA 2OPSA 2DISA 3FBFA 4K4SA 4AT1B 2EK6A 4JI6J 1UFLA 3FUYA 4ZP7A 1BC6A 2W7AA 1CJVB 4P2XA 4N77A 4DV5J 1T9UA 1EHWA 3N6NA 3D9BA 4IO1A 4ETXA 4E98A 3KWMA 2F8HA 1NU4A 1HR0J 2Y9HA 4O44B 3AD7C 2FZKB 2FLLA 4FYDA 2C28A 2MQOA 3MD1A 4YY3F 2Z2YB 3JQKA 4DMZA 5D0GA 3KK3B 3FMWA 4LRCA 2BJ1A 3VAKA 5HVGA 5D3GB 1I1GA 5GAHU 3ONQA 2B9YA 2RDJA 1S1VB 2AGQA 1SQEA 3AB4B 2OFGX 1WC0A 2J9CA 2HVIA 2Y1LB 1X9WA 3J80Y 1BQMA 1UP1A 3SDEA 3G2XA 2IPOB 2N7CA 4TU7A 3R7NB 2XLIA 2VBXA 4ECRA 2XI2A 3GPAA 1G1XA 1UWBB 4GC6A 1VRUB 2RVJA 4KBIA 4LMZA 2HW3A 3W5XA 4R5PB 1TUGB 4Y34A 4XIUA 4I6WA 1R89A 4YY3J 1UZHA 1MG7A 4R0JA 2BQ3A 3OL7A 1RHQB 3HVTA 3MGJA 4CTAA 2N7YA 1NH7A 3FGVA 1RWPB 2M8HA 2ZDOA 1QE1A 5LSOA 2DGXA 2C3MA 2DTJA 4ECZA 2RQ4A 3MM8B 4DSFA 1WEXA 2VU5A 2AGPA 3I32A 1XMBA 1GH8A 3FZ2A 2BKNA 3GFHA 3G4SS 5LJ3Y 3BGUA 3KLFB 1DLOA 2DH7A 1TL7A 4WFZA 2W2MP 1ZM9A 1VQOS 3VWSA 1FX4A 2VPXB 1F5BA 3QAUA 1EQ0A 3HHNB 5E0OA 2ZEJA 2GW8A 2I8EA 3VQSA 4B9UA 1MNEA 3TWZA 5HANA 1UW4A 2DY9A 2ASJA 4ID5B 1M5KC 2YWEA 5ETVA 3V6DA 3OQ2A 3P4UB 1YZ7A 3NBPB 2N3LA 1X4HA 5DG8A 2ZH1A 4X65J 3DLJA 1GX6A 2R2SA 1AT1B 1XR7A 3F41A 3KG1A 4DV1J 1F0XA 2EBEA 2ATCB 3DM2B 4ZPVR 2J8AA 2HWHA 2IFXA 2RDDA 2ZH3A 4NYOA 1R8CA 1WD6A 2A18A 5DG7A 2HWIA 2OPPA 1OIAA 1Y11A 4MMOA 1SC4B 4LT6A 1MMNA 3M32B 4NWBA 2C3YA 5DDOC 4ITSA 3ZXWA 5IM0B 4G65A 5A0YB 1NK7A 3UCGA 2KRBA 2B9EA 3W60A 3NGTA 2F4FA 2Q6CA 3DGVA 1JIHA 2R42A 4FXWA 2R3VA 2AJ0A 4DEZA 2D3O1 1R8HA 3I5CA 2YKNA 4ZPTR 3HM9A 1TK8A 1FDAA 4WF9Q 1KNZA 1UVJA 2ZH4A 1UZDA 2HZAA 1O5JA 1A0OB 1X60A 3L95X 3P5TL 2MJNA 3THPA 3PIPQ 1ZA1B 4RBTA 1B7YB 2XMUA 3M2UB 4FDFA 1FKOB 3TVYA 1WF2A 3HCXA 4XK8C 4F0KA 4X2BA 1Q79A 2CQBA 3H5XA 1C0UB 2H65B 4DUYJ 4JV1A 1FA0A 2Q79A 4PG8A 1RT6B 2NXNA 1S0VA 1XIQA 1OSCA 2KB2A 1X7VA 3OR2A 1Y3JA 1P6TA 2CQ2A 1MROA 4WFNQ 2KJVA 4QR0A 3OR1A 1CJTA 4F4ZA 2E1PA 3H40A 1YJ9S 2M0GB 3PRVA 4QW9A 2VDHA 1WHWA 2ZH8A 4G1QA 4ANDA 1VRTB 4G6VB 3HP6A 2HSEB 3T19A 5KT4A 2GX8A 3JAMU 2DNHA 2P8IA 4XDCA 3FEXB 4OZNA 3HSDA 4B9LA 4LIRA 3A8JA 3OFEA 2P9GA 4ZDNA 5GADI 3M4XA 2HZCA 3P49B 4QPTA 2XBPA 4P7TA 1F5CA 2MEWA 1IKXB 1F60B 1X5OA 2HHTA 2HRYA 1BXNA 3QRPA 3PO4A 3NEKA 3UPNA 4ZS6A 2EWHA 4NI2A 2CDRB 2AYGA 4QYZK 1CQMA 4EBCA 2QT7A 1ROFA 3ILOA 1U4BA 3ZZOA 2EW9A 2VG7A 3G86A 3MFHA 2ZHOA 3AQPA 3VQTA 1F3FA 3ENWA 2HQCA 5HI7A 4PXBA 4LRFA 4XPCA 4M5DA 5LSLA 5B0AA 3CJ8A 1S6QB 2P6TA 3H5UA 3GJQB 1VR6A 2BJ3A 3OVSA 3KLEA 3J7ZT 2CJ9A 3CULA 4OV6A 3VR1A 1FE4A 3EPGA 4QWEA 1HI8A 2KFNA 4C97A 3FEZA 5I42A 3TVKA 5MAOA 4AUKA 4OI3A 1T3OA 1TMJA 1QSLA 2MZJA 4YR0A 1HW8A 1U1LA 3HZGA 3QO9B 4TXSA 2LDYA 2ZUAA 4FBTA 1RXOB 4QR1A 1CEZA 4CDIA 3TUIC 4FPIA 1U1QA 5KFZA 3V6KA 2CNKB 1RTZA 2MQLA 2OSRA 2NXUA 2B8PA 2DVIA 3KNGA 4QIEA 1OY6A 2WCXA 3GTYX 2CVIA 2MLXA 4UQGA 3B4MA 4NCGB 3GCWP 2K1RA 2KU7A 5J1NA 4U7CA 2QX0A 4OHVA 3LP0B 3NGRA 2MKHA 3K57A 3GJTB 4QIGA 2YX7A 2QL5B 4NRTA 4URQU 4J5OA 1SJQA 1WWHA 1F5AA 4ILLA 1WF0A 4Y2IA 4MIWA 1QY7A 4K8RA 3J81j 1NSKL 1GEHA 3QPIA 3ET6B 1O51A 4TNOA 1GXLA 5IZHA 5IT0A 1S99A 4RW8A 2E5JA 1SJ1A 2HHQA 2HAFA 1EP4B 2MSTA 5BJRA 1NJYA 3ETOA 4O3SA 1EETB 3OHBA 5EDWA 3CNQP 2CNOB 1RTHA 3TZYA 2DKOB 5KFLA 1ZZFA 3GR1A 1TU0B 1IBMF 2YWGA 1EX8A 2IBOA 5A8RA 2BUNA 2UU9F 4P74A 4QIFA 2FJWA 2J0QD 2F1FA 3NMAA 1V3SA 2IM3A 4PG4A 3MEDA 1KFSA 3OTBA 3AB2B 5F0UA 2MHEA 1RAEB 4H4OA 2HQIA 2DGQA 1WG1A 5D0HA 3HVRA 4A8XA 2V4JA 4HH0A 3CDAA 1DQ8A 2EKNA 3BKUA 4CM0A 3OUYB 1P1LA 3JB9k 2PA8D 4WIIA 3PNIA 4UTGA 4B3TF 3T1HF 4X62F 2P5VA 3LWMA 5H9FJ 1RAJA 5DJBA 1NO8A 2KFZA 1WI6A 5KT5A 1VI7A 2VOOA 2OELA 1IBMJ 1KS2A 1UA1A 1UETA 2MKKA 5K8NA 5CD4H 4F25A 2C3UA 3TUZC 2XSFA 3FEYB 4DPXA 1ZM3A 2WW4A 1GT8A 4CLSA 1M1KT 2H1YA 1LK7A 3H2LA 1IUJA 5KG4A 3KUEA 1NK6A 4ZHRB 1EB0A 1IWAA 1T11A 4NLPA 1N5YB 4I2QA 2FVQA 3JQJA 1CS4A 4Z37A 4EU0A 2ZWOA 4M5KA 1HA1A 2VFUA 3ADAC 4A48A 3T1HJ 4X62J 1N54B 2RHQB 3DRRB 2OSQA 3T5HA 3R1LA 4ED1A 4U8YA 2F9JA 4IR9A 5HMWA 4R8UB 3DYAB 5CXTA 2ZJPQ 2OPRA 4MJKA 2O1PA 4IQMA 3IS9B 2QGFB 3TZXA 3TA0A 5M2PA 4MKBA 3BKFA 1NK9A 3TNVA 1QDUB 3ITHB 4JI5F 1RBOB 3GG0A 3QIPA 1N48A 3AJDA 2OKQA 4OZ0A 2UUWA 1RAHB 1U2CA 2W9BA 3LP1B 2J76E 3IRWP 4DWIA 1X0PA 4OHWA 3LOUA 2ROGA 3C66A 1HWIA 2NYHA 3W5YA 2VG5B 3ZO7A 3FSYA 1UVNA 2J5AA 2B8QA 2XGPA 2ZH9A 3EWGA 1KC8T 1T7PA 3HHEA 3HLUA 2VASA 3CCZA 2V9KA 2IC3B 3R9LA 4KRWA 2ZBRA 2GHVC 2ZE2A 4KY3A 1VK3A 2WVFA 3P5BP 2ZVSA 4DSKA 5IWAF 4IKAA 5FJ4A 3JSRA 1X5PA 4JI5J 2BVZA 4PKDB 3POTA 2HAIA 4QBUA 1JLFA 2DBBA 3AD8C 4MK8A 3CD0A 3KJNB 2VDIA 3I56S 4CLFA 3MR2A 3MM6A 3IR5B 4FXDA 1URRA 3QT5A 4FVCA 3IM8A 3NGSA 4LF7F 3MTJA 3FDSA 3BYRA 3CC4S 1RE1B 1G7CB 1IKWB 1WJ9A 4M95A 3MUVP 4W4MA 2NXCA 2DHAA 2D74B 1SL2A 4F8RA 3ENVA 4NLYA 4DR5F 1KVIA 3RW6A 4AQYF 2DRBA 4N47A 5KFKA 5IWAJ 4OJ3A 1SL1A 3CT9A 2WB1D 4NMXA 1S57A 1WI8A 1S9GB 1TL1A 5T7LA 3RB6A 2XSJB 3GIJA 2R4FA 3OFGA 3TEHB 2VBZA 2UXDJ 3ULHA 3GIRA 4PUOA 1FDBA 1RT2A 1R6VA 2DXFA 2UV8A 3I0SB 3RYLA 3I6PA 4CLPA 1ZS6A 2PT0A 1K8AT 3PRDA 2DHXA 4WP9A 4JV2A 1YGYA 3BH7B 4JB8B 4LBPA 1OO0B 2LQ8A 1OPIA 2QLWA 1Q8BA 4V1Ak 5EWEA 5C24A 3L7PA 4DR5J 4UT4A 3NNCA 2WOMB 4AQYJ 2WAQD 4AXIA 2AJ4A 3KK1A 4P6QA 2ATLA 2KZMA 3GLJA 1EAYC 3HHLB 1YZ6A 4DXLA 1FKPA 2H4YB 2HFVA 3BO3A 2YNIB 3HULA 2DNZA 2OP5A 5GAGI 4TN2A 2AYMA 4IH5A 4C0OC 1KP6A 3SCLE 7FDRA 2ZBIA 3UDVA 3C14A 3TAPA 4CO4A 4RL1A 1NKEA 5KTQA 3MTKA 3W65A 3DDNA 1I3OB 3T5KA 3MURP 3IN5A 6AT1B 2XYHB 4F3OA 7AT1B 5MLCV 2B9XA 1R27B 2B5JA 5HL7Q 4FVMA 4DR2J 1XK8A 4J9RA 5D6GA 2X1BA 2RNEA 2DR9A 3U1LA 3C6UB 1XR5A 4NLRA 2W4CA 2N4DA 3T3FA 3G6VA 1C0TA 1EIYB 3UWTA 3KHHA 1IKVB 3CJQA 1HBOA 1CC8A 3HHKA 1S97A 4I64A 2DNNA 4RNNA 4QYRA 4LRBA 1NK0A 3CO9A 1FRXA 1UFKA 1LWEB 5ETKA 1SJ4P 4YN3B 5HLFB 3BR8A 5EX0A 3O6QA 3IA0A 1TMMA 5KFOA 1E6YA 2CJBA 4OX7A 4UOHA 5LL6d 1VIOA 5A8WB 2RD5C 2ILZA 1OWXA 2CPJA 5KFWA 2CJXB 1T9TA 1D8YA 2VHGA 3UCZP 3KK2A 1HKAA 4RW9A 1MSWD 1ZM4A 2BR0A 4QU7A 3HF5A 4DPWA 5KG0A 4OZ5A 1MU2A 2XB2D 2VJUA 3Q8UA 2RT3A 5F8HA 4ES2A 2AMCB 2RQMA 3HHDA 4CO3A 4HHJA 2BJ9A 2B4PA 1RTIA 1XTZA 3A1YG 4Q5VA 4M5NA 4CRJA 2VKZG 1N0UA 2DH8A 2UVVA 5EX3A 3Q8RB 2W24A 1HBMB 2Y3YA 2IMWP 4KH0B 2CQ4A 5E3CA 1TFWA 4XAKA 1Q16B 1Q95G 3N6MA 4ZIWA 2ROEA 4MFBA 2MQQA 1T03B 3IWLA 4YR3A 5F9NA 1FFSB 1WTBA 4C0BA 1LWFA 2R2RA 1R0CB 1YX2A 2PI5A 1WDDA 2PFFB 4A46A 3D1OA 3KKFA 4ZK7M 2CYYA 1SH0A 1Q82T 1KQFB 5GMEA 1EARA 4F04B 1TKXB 2PO4A 4C2MA 4B9NA 1HMVB 3EDRB 2HMIA 1RP5A 2WBRA 2XMWA 2L9WA 4IOCQ 2CPXA 3FSIA 2FHMA 3PW0A 2BE7D 4KV8A 1YI2S 3VV2B 1J5OB 1NUEA 3BF4A 2XS5A 4KHPJ 2PE8A 1H73A 1H2UX 3A8KA 2LLZA 2ZBPA 3SI8A 2Q1LA 3C2PA 2IVFB 1TL5A 2GV1A 3TUJC 4ECSA 3CD7A 1FXDA 1NDCA 3UN7A 2XG8A 3SBMA 4DSEA 3ELHA 3QIDA 1ZZNA 3TJAA 3MEEA 1RQ0A 1ZAVA 2FLOA 1JLEA 3KOAA 4OV1A 4RNOA 3MD3A 3TP2A 1BY9A 3EXYA 2GMHA 5CCMA 1KOOA 4UUXA 1X4CA 2LCWA 2E7VA 3W9HA 1L3VA 3DRSA 5CYMB 4ZPWR 5J2PB 4DCPB 1HNIB 3HJFA 3DXSX 1M5VC 4PABA 4CLWA 5HP1A 2ZNZA 3V4IB 4UF4A 2IMOA 3R7SB 1PIEA 2ZH5A 1D9FA 1Y5LB 2FJAB 3IP0A 1IXKA 4WCEQ 4ZA1A 3U27A 3PKYA 1FFGB 3I87A 2DNLA 2XWXA 2EG2A 3MECB 3GSIA 1RT1A 3CWJA 4MK7A 2HHVA 2ASYA 4N56A 5DGAA 3GU0A 1YLXA 4WK1A 2E5LF 1DTTA 1NSAA 2WONB 3UNGC 3W9IA 2VBWA 1FK9B 2C2KB 4DLEA 4F3MA 3O2IA 1W2BR 5IQQA 3RTVA 4OZ2A 3HO1A 1JQGA 4OYBA 4RU9A 2XZWA 2YKAA 2MZTA 1HI1A 1AFJA 4TVAB 3BSOA 5DDPC 4O0IA 3V81A 2ILYA 3MM9A 2IJFA 3GMGA 1T05A 5B0EA 3D2WA 1I94J 1X8DA 2V8PA 3M8QA 3MEKA 3VVUA 1U49A 1KHWA 1T9XA 4YB7A 1X5TA 1WHYA 2RU9A 4NA2A 5AXLA 2E5LJ 5ETSA 2RQCA 4TKTA 3D7SB 4X4SA 3D3CJ 1RWNB 4ELUA 2RAQA 2R8JA 3W63A 2C3OA 4EMDA 1HQUA 2G13A 5DO2A 5I3UB 1H2VZ 3PHEA 4K5RA 1RCXB 3PJXA 2DJWA 3Q23A 3NL0A 4M94A 3BGOP 3BV8A 1HPZA 4GRSA 4UQTA 2F4VF 1RTDB 2IA6A 4PR6A 1IM4A 1OPZA 4DPTA 4B3RF 3ZTOA 1B0VA 1R31A 4B3MF 3QJPA 3MOJB 1X4GA 3CCWA 1Q53A 4ILRA 2RKIA 4PWDA 5GAHI 2UUAF 3VSLA 2FHOB 3HKWA 3TAQA 3LPYA 1JJ2R 4BLGA 2XO6A 1EJ7L 2ZH2A 3UD4P 1KTQA 4O4GA 4K7QA 4OJ1A 5D8HB 4DSLA 3MHYA 3U1NA 3OXLA 2F4VJ 2BEFA 3IWNC 2RDIA 4Y2AA 4DSJA 1S6PA 2HYIB 2P6SA 5KG2A 2XQCA 2ABYA 3NG8A 5G0RB 1FNXH 4F67A 5ETNA 4IG0A 2NSCA 2BE2A 4ZVPB 2IM0A 2JLGA 2VUGA 3CW2C 4KPCA 1PJ5A 1HNXF 4EYIB 1HI0P 2QA1A 2OFHX 1TAQA 1X0FA 2D9OA 4X84A 1NPPA 2O3DA 1S9EA 2UUAJ 4RW6A 4PAAA 1AROP 4TY8B 1U8SA 4LFCF 5DZ6A 2VA2A 2V2ZA 4ED6A 3RB4A 3MM7B 1M1HA 1REGX 1N33J 1VS3A 1T94A 5KG7A 1VLYA 2Z58B 1JJHA 2Q43A 1LWCA 3UD3P 2I5JB 4CLLA 1HBUA 4RWWA 4C8ZA 3TO8A 3JS9A 3PFEA 3EVMA 4WZMA 1DTQB 4RUBA 3HT0A 2QL9B 1A6LA 1HNXJ 4USKA 3N6LA 3FVYA 2HHXA 4ECVA 3LP2A 2DITA 2GVDA 2PEHA 2XHWA 2NYIA 1FRKA 1WF1A 3UCUP 4L72B 4OLOA 5C42A 1SKRA 4LFCJ 1TVRA 3KLGB 3W2WA 3SCIE 3THTA 1RT7A 2E44A 3WC0A 1TFYA 1HWLA 3ZG5A 3RB3A 4Q2LA 3OUYA 2YKOA 3LTOA 3PW4A 5C25B 2V67A 3GE9A 3Q2TC 4FYVB 3AOCA 3BR9A 3OD2A 5HMYA 4WK3A 4JV0A 1CQNA 3MPWA 2A2CA 1I51B 3IC1A 1L3TA 2QSFA 4ERDA 5BYRA 1RABB 5CH7B 1U09A 5H1SV 2KVIA 3UDEA 1RKIA 2E9ZA 3D54A 4C8YA 3ILJA 1SQGA 3PACA 1FDDA 2DR5A 1RAFB 1WOPA 4P52A 3RRHA 1JMTA 1N5YA 1JNRB 4HEA9 1HWJA 1KWMA 1G3OA 4HTJA 4IFVA 2Y8WA 5K14B 5IS2A 1WC5A 1AA1B 1ZETA 1MWYA 2BOPA 2EEYA 2CPYA 2LMIA 2HGLA 4QOTA 4OFZA 3KMQA 3G87A 3CJ5A 2NXEA 2HNDA 1HBNA 4DR4F 4MYUA 3QT7A 2XEXA 5A2QU 3SEOA 4J9SA 5E3QA 2GA7A 2XTJP 3H98A 5AXNA 3CC7S 4ILMA 1S4FA 1LWXA 3FQKA 2DEIA 4KTQA 4NX9A 1RT4A 3M2RB 1UEUA 1FHTA 3QT6A 3HZEA 3W2VB 1PYYA 5KSHA 4ANEA 2LP4A 3AD9C 1FX2A 2DB1A 2RS8A 2HFUA 1TKZB 2K7JA 4NL5A 3PTWA 4QYZJ 2AYEA 4DR4J 3KLHB 3PV8A 5F9LA 1D1UA 3MEGB 4K59A 4KO0B 5AXMA 5DQGA 3ZTQA 3BGRA 2WSFC 2H51B 4DU8A 2DRDA 2DHGA 3BZQA 1VQNS 1SQFA 3ZZYA 3GV5B 3EGNA 4LF2A 2DRAA 1CG2A 2VV5A 4CYUB 1IM6A 3WIVA 1BQXA 4FF1A 2YVSA 3WC2A 4WKRA 1P9YA 3M8SA 4JI2F 2CIMA 1VQYA 4RUHA 1DQ9A 4ANCA 3UDCA 3RU0A 4AL6A 4C48A 2D41A 2MLZA 4F3QA 3LW5C 1VQKS 2F63A 3ZNUA 2VPYB 1M5OC 2HQDA 1PO6A 1FTRA 4FPRA 2GHWA 3KDNA 3P45B 1HWUA 2YKMB 4DDFA 4ZLPA 2XSJA 2OH2A 2DGOA 3ZC4A 5J2NA 2DR8A 2F7VA 8AT1B 3AXMA 6FDRA 5HJXA 3M6XA 1CJKB 4Z2XA 4A8MP 1LW0A 4JI2J 5DQHA 5CYQA 1UVKA 5EHHA 1FRLA 3CMES 2I2YA 3LALA 2QZ8A 3CJ2A 3OHAA 5KFSA 1FEHA 2G1HA 1RTJB 2D3UA 4N8NA 2KXFA 2BE9B 2DNKA 3B82A 3OJSA 1TK0A 1HQEB 2XCPA 3JSMB 3FBBA 2R7WA 3MAAA 2VB6A 1UAWA 1J5EF 4C8OA 4CLKA 4FS1A 4JI0F 4L3NA 3RGIA 4EEYA 1N6QA 3Q8VA 4JP8A 5L1JA 3TR5A 4CO5A 4CZCA 4O4RA 4DSIA 1YJUA 4K4VA 1V9OA 1DARA 1PAUB 4DI6A 2GJ2A 1S1WB 2G0IA 5E3RA 3T1YF 5KFGA 1B0PA 2AZ3A 4RBUA 3V2UC 1NXIA 1OJ4A 3PR4A 2FD2A 1N5SA 4ECXA 2A6OA 3QJJA 2LA6A 3DOLB 1RJJA 3K8VA 2JC1A 4IG3B 3UR3C 1JLQB 1Y10A 4JI0J 2YNGB 4GC7A 4JI3F 4FYYB 3ENAA 2RUGA 3GB0A 3F56A 3MAQA 3ZNJ1 1U1KA 1U2FA 3M9NB 2WAFA 1IBKF 2B7BB 3PXGa 2MQ8A 1S79A 1NHUA 3EYZA 2GO8A 2PMZD 3T1YJ 3MMAB 1LK5A 2V2QA 1X5SA 1U0HB 3DGPB 4X4VA 4F0HA 3KTQA 2ZBQA 3FCHA 3J81U 1Q86T 1D9DA 2AP6A 2XWYA 5CQGA 3BN4A 3VAIA 4C8LA 2V8VA 4A8YA 4DL7A 5LMUF 3KMSA 3ZZ0A 1SUQA 3CXCR 4ELTA 2M52A 4M5LA 2ZOMA 3DRPB 4FF2A 1H7WA 3IBWA 3FRZA 2XC9A 5HBMA 1CJUA 4JI3J 2A6MA 3SSSA 2IAJA 3DMJB 1Q8LA 3QT8A 2V8DA 1VBYA 1AZSB 4USIA 4GVBB 3D6MB 2H4WB 3ISND 3SQGA 4B08A 2ZUGA 3R6GB 2PEBA 1WOSA 3VGUA 2KG0A 1VC0A 3MMJA 4LR7A 1T95A 4DZDA 1X9MA 2CWXA 2CG8A 2MXYA 2ZJRQ 1U2RA 3OFFA 2FJBB 3OV7A 2YNFA 2RF2A 3RB0A 5LMUJ 4L73A 3TZWA 1UEKA 4DV4F 3DOKA 2P9CA 4FNIA 1C1BB 3QRRA 3EZUA 3E01A 4Z7CA 1FRJA 3JTPA 3BN7A 1T03A 1CULA 4CT8A 2A10A 5C7PA 4ZVRB 3FRYA 5KOWA 4F36A 3LF0A 5A2QY 1WELA 3W8GA 2XZDB 5EGYA 2J6TA 1FFWB 4MKYA 2VL1A 4PZVA 5C2GA 4LSLA 3TRGA 4X66J 7FD1A 1S9FA 4RW7A 1AFIA 3EUNA 4OYAA 5CD4A 2LQBA 2PIIA 1X4BA 2WB4A 3SSQA 4XPEA 4DV4J 1S1XA 2VFSA 3M30B 1ITPA 2M3DA 2WADA 1JXEA 2A0FB 4MYTA 4IOAQ 2GIQA 3N4WA 1P27B 1QSSA 1WHXA 4A8WA 3CCES 4LF9F 2DO0A 1HD1A 3K58A 5AE1A 1RISA 4IFYB 5ETPA 1C1CB 4NE9C 1YRUA 4PQUB 1SJFA 1JWWA 3PY8A 2AV5A 1SI9A 2DNRA 2QFJA 2QV6A 3WHIA 4I7FB 1YBAA 2W2PP 4H54A 3C46A 3R2CJ 1RU1A 4DFKA 2J7WA 3OXFA 4F26A 4JI1F 3MI7X 4OYZA 1NPRA 3U1MA 4J9PA 1WKLA 5KFUA 3W7BA 3T6BA 2HLTA 3K89A 5F3TA 3EGVA 1S0OA 1NZ8A 4LF9J 3PYGA 2CKWA 3D5MA 1F9EB 3DLHA 1FNOA 1BQNB 1K0TA 3BYPA 2W9CB 5KFQA 1Y0HA 2KL8A 2QSWA 3R7BB 4WKYA 1FK9A 3TARA 3RR8A 2E1RA 1FCAA 2R7OA 2RRNA 1XMOF 1X4EA 1E6VA 4LBHA 2FVPA 4ZJLA 4OZLA 4JI1J 2XMJA 1Z4UA 3CDUA 3KG4A 4PG6A 2YNHB 4IYQA 4N41A 3J7A1 3VZIA 3DI6B 2VD3A 1UVIA 1HWKA 2Q6BA 1FDNA 2YQ1A 3A12A 2IYGA 2D3OR 4KJIA 3CCMS 5HMXA 3AJ2A 1IKYB 2LECA 3D6FB 3HD1A 3EZ5A 1K73T 1VYAA 2FPHX 2VF3A 4YR2A 1XMOJ 3NRBA 4WP8A 5FIIA 4HT5A 4Y2KA 1S12A 4I2PB 3VGSA 1DBDA 5AT1B 4O3RA 4LSNB 5BXIA 5DLGA 2C2DA 1T9VA 1TL4A 1S1TB 3RAMA 1RT3A 4U6PA 1QMEA 1NJWA 3G82B 1FI4A 2ROPA 2C2RA 1YVFA 4F2RA 2QA4G 4OQJA 3JYTA 4J9LA 1L3UA 1MMDA 3QZ8A 2CUYA 5HJYA 2HK3A 3BDEA 2FJVA 4DG1B 4I6AA 4TU9A 3CDBA 1Q78A 4HYKA 2WZ1A 3O44A 3UFCX 2DNOA 2HKEA 1U1NA 4ZIVA 2ALYB 1C4CA 4E2FB 5HO4A 1YJRA 1RAIB 1PAEX 3MM5B 1X4FA 1VIXA 3QATA 3M8PB 2E1CA 3DWKA 2XYPB 4ZVSB 2UUTA 1VBZA 1B99A 3GJSB 1YRXA 4Q2MA 3J7Z5 1XQIA 4DPUA 1FJ7A 2M7SA 1HYSA 3KXDA 3N79A 1TTHB 4PPZA 1JLBB 3FNNA 1RCOB 3BO2A 2MB0B 3C3LA 3W3SA 3EGWB 2Y0BB 4H4KC 5ADZA 2JHEA 2AF6A 4H4MA 1R0AA 2HS0A 3V4MA 1YK9A 3MPUB 1PYOB 3OVBA 1HLWA 2MKYA 3RAQA 1MWRA 1S77D 1U6BA 2X1GA 4OYXA 3CJ3A 4DV0F 4KYZA 2IDLA 3IRXB 4USTA 4USWA 3MMBB 5HQ8A 2H3EB 3K17A 4ECTA 1XNRF 3B8HA 4TLRA 2KT5A 3DDIA 3RJMB 2FLPA 3C16A 4NLOA 1KKHA 3OJUA 4QCLA 4DUZF 2HNZA 3I5BA 3EVOA 2BKPA 1VC5A 3H8YA 2KDOA 5IT9Y 4JI8F 4C4WA 1HNVB 2DEJA 3FFIB 3H20A 1CSJA 4ZLJA 2L9NA 1GFWB 1NKBA 4C11A 4DPYA 5KFTA 2GVZB 5SZTA 1NM2A 1GQEA 4KFBA 2CQIA 1NJZA 4DV0J 1TQLA 1ZPWX 1R7IA 2OPSB 2QLBB 1XNRJ 3W8PA 2G2OA 4DV7F 3QJLA 1YDLA 2RSQA 1WDTA 2QE5A 1RU2A 4DUZJ 3R5BA 2GJIA 4QR2A 3US5A 4PWUA 3K5MA 4A8KA 5J2QA 3IGVA 1RUSA 4JI8J 3NS6A 2J0XA 5GMDA 4CT9A 2MSSA 4KGZB 2E1MC 3AQOA 5HROA 1S4EA 4E0DA 2R7RA 2MZQA 3AHPA 3NGUA 1A9NB 1NPKA 4OJHA 3CCTA 2HVDA 5F41A 2LEPA 1M90T 4DR3F 1ZM2A 4M5IA 3D66A 3MCOA 1KQGB 3IO1A 4FKYA 2V50A 1BQMB 4YDDB 4N5SA 1QVGR 3ZZRA 2C22A 5FD1A 4KGKA 3SDEB 2FB0A 4DV7J 2R8GA 4NXNF 3IGNA 2EKYA 4J9VA 1S6OA 4Y0FA 4GMKA 2JWNA 5KOXA 1XNQF 2HNYA 4ICLA 3NNAA 4L75A 3BJYA 5KT7A 4OHYA 3AY0A 4DV3F 2PGCA 2K06A 3PYEA 3HVTB 4NA3A 2HHSA 2EC2A 1KLNA 4X65F 2BKOA 1SV5A 2AGOA 4CTAB 2BXJA 3KJFB 4CLUA 3SFUA 1QE1B 4DV1F 2AD9A 4DR3J 4K2XA 2V8HA 5SUHA 4ZPCA 4C8KA 5M1AA 2HG4A 1KD1T 2EC0A 3GQCA 3L7UA 4H4KA 4N7TA 3KHLA 4F50A 2ALZA 4LRAA 4NXNJ 3D67A 5KG3A 3GYGA 3CD6S 3DU6A 3T9NA 5LMNF 5HQLA 2V0NA 4DQIA 1RK8A 1FXRA 1DLOB 1YWXA 1TL7B 1RA7A 3OBIA 1XNQJ 3M8YA 2ZD1A 4KQZA 3DFEA 1H0HB 5IXUA 2UUCJ 1GNKA 4QWCA 1ZPVA 5KFPA 4DV3J 4U8VA 1HHQA 4F0MA 1NDKA 4OI0A 5LT5A 5L46A 4RUAA 4ED8A 4LF4F 4TYAA 4CYUA 4DFPA 3PX4A 1FD8A 3W1YC 2QN6B 3CCSS 2OPQA 2CPHA 4QWDA 3V6DB 2C2MB 2FIUA 4F4WA 4OZJA 3EMTA 3K8WA 3OT9A 1B3TA 2DNMA 3NS7B 1Y9OA 5LMNJ 4RWXA 4ER8A 3NAHA 2FHJA 2CNLB 2CQDA 2VIHA 4EFAC 4LVOP 3SCJE 2G4BA 5E33A 1KR4A 4DUYF 1HD0A 4B9TA 3LAKA 2OPPB 4DJBA 2E29A 1WSVA 2H54B 4EUVA 1B4SA 3Q8PB 4WPAA 2A1BA 5EWFA 1EKSA 1FRMA 2OGUA 1VQLS 3QBCA 4ZOSA 4LF4J 3OFHA 2BANA 4DOZA 1JJ4A 2HURA 1VQ7S 1FWLA 1KQSR 2KHCA 3RBDA 1ZYQA 4BWMA 3MWBA 4ZPBA 2UP1A 2YKNB 1IBCB 3OW2R 1X31C 3D0GE 1TKTA 1XWLA 4C3LA 1OSDA 2Y1RI 3PEJA 2H5EA 3TX8A 5J2MA 2DCLA 1F2GA 3G6YA 2KXHA 1YJNS 1RB0A 1NZAA 3BH6B 4ATNA 2XS7A 5IQ6A 3K0JA 2XMAA 4P73A 4FYWB 1TV6A 4B3OA 1KVJA 2WAEA 2ZHAA 3RBEA 2OMLA 3R1HA 5KFDA 2WVCA 2V2KA 2RRBA 4ECUA 5KFIA 4ED2A 1KEKA 2A3JA 2M88A 3OR2B 1MROB 1RHJB 5KFAA 3AODA 3OR1B 1CJTB 1JLAA 3A3PB 3QYYA 2GFFA 2FVCA 5CZVA 3DKDA 1OS5A 1W7WA 2V69A 3UPPA 4G1QB 2VODA 2NZCA 2KVQE 3C6TA 4WFBQ 4K2JA 1SKWA 3KNAA 1LEOA 2JDJA 4AFFA 1JLGA 1VFJA 2ZITA 2ASDA 1WSRA 4FXVA 4Q43A 3MPVA 2XY6A 4JBFA 4KGVB 2C2NA 5M2UA 3RRGA 1WUUA 4P2FA 2HHWA 1HQ2A 3DLEA 4CLZA 2ZVIA 4QIVA 1WC3A 1UVMA 5JJBA 2PDAA 5D0EA 3SSRA 3DLGA 3BGFA 1AB8A 2ACYA 4NI2B 1SCJB 4WBFA 4J37A 3W66A 3MMAA 4OJGA 1CBKA 4C3MA 2VG7B 4FNHA 2U2FA 4HHHA 2K2PA 2Y1IA 2FY1A 2OJ3A 1OMSA 1QTNB 2HVZA 3GIKA 4M5DB 8ATCB 3QGIA 2ZHBA 3I55S 4TU8A 2AJFE 1Y4ZB 5K9FA 1VJWA 4YB6A 2IHR1 4DR1F 3GR0A 4C6AA 5KG1A 2HBZB 3DRPA 2OHDA 3BREA 2W01A 4LUBA 4DU7A 4WTOB 2XM3A 1VJQA 3D68A 1VHIA 4PPDA 5I42B 4P9SA 2DHHA 4OX6A 2X3DA 3BQ2A 1PILA 2YWWA 2GIRA 1M5PC 1WC4A 2ZC4A 2EFOA 3P96A 4A47A 2R2TA 5LSRA 2DGVA 4HACA 3PW2A 3JSBA 1APSA 1R8AA 5D78A 2LU2A 4DR1J 3DC2A 3P6YC 2JEJA 3EPIA 2K1RB 3R27A 1N88A 2GGPA 2JEGA 1OY8A 4DN0A 3BO4A 2KZZA 4Q0BA 1Y00A 2BQUA 4CO1A 1RYSA 3IG1A 2RRAA 2QLJB 4RW4A 4P7VA 1NJXA 1VQ8S 2YKPA 2FQQB 2IRUA 3H7HB 2VC1A 2WVEA 3BSAA 1JB0C 1KOHA 4RW8B 1RADB 1O6XA 3OLBA 2AEJA 1HARA 3QLHA 2AHOB 4NCBA 1QLNA 1KLMA 3NLCA 5F8GA 1RTHB 1NK5A 1PCAA 2PI4A 2B3TB 3UVJA 4J9KA 5I4MA 2DNYA 2RILA 1I6JA 1P1TA 1BHNA 2MYFA 2JLEA 1NKCA 4S0MA 4GKJF 2GMLA 1REVA 3MEDB 4DL3A 2F8EX 5JXSA 4B9VA 1CPZA 4H4OB 1SIZA 5BYQA 1FJGJ 2V4JB 2JFKA 4LVNP 5DS7A 4MT1A 2MTLA 3CCQS 1U47A 3NP5A 1KFDA 2CQGA 2MJUA 1ULRA 3KJVA 3OLAA 2JH3A 1URNA 5K20B 3G96A 2PFDA 4EO6A 2PMWA 3MMCA 1P8GA 4JI4J 2AYBA 2V2VA 3A3OB 1U8WA 2Z8QA 2GAHC 1JJCB 4ED3A 2CWKA 3T5JA 4GKJJ 1SVDA 3MR7A 5A76A 3M6WA 2NZ4A 1YQHA 3W5ZA 4WYWA 1YKWA 3MCSA 2OLWA 3BQ0A 4NEYA 2CZVC 3QGHA 1TL3A 2D69A 4DCJB 2J9EA 2BABA 3CJKA 4I2QB 1CS4B 1VRQC 2EXUA 1FESA 4CH1A 4A4JA 1LW2A 1T9WA 2KH9A 4M8LA 2HZVA 2MGZA 2R8HA 2BRLA 3CF5Q 2B6AA 2F5GA 1BD6A 4RJVA 1DRZA 3D4JA 4ZVTB 2JC0A 3MAHA 4ZCMA 5J1EA 1RT5A 2OPRB 5THWA 2NSBA 4O3QA 4CO0A 2HFNA 3I4HX 2LKZA 2ASLA 3H25A 1LV5A 2AWZA 4UY8T 1S1UA 1WG4A 2BRKA 2FYXA 4QIWD 3Q83A 2EPIA 3M2VA 5A6WA 5LJ5Y 2W7PA 4DL2A 3FK4A 1UPPA 3U02A 1SC3B 4C3KA 2HFZA 3AJ1A 3RRKA 2HQFA 3QIPB 1VQ6S 1JLCA 3LPEA 5K5MA 2V8GA 5CCLA 3IAM9 4HVZA 2W9BB 2QLFB 5E3AA 2KO1A 4WE1A 2GMJA 3O1LA 2B7CB 3GV7B 3JAMY 3D0IE 2EVZA 2RE1A 3NS5A 4LREA 2MY7A 1FRHA 2YY3A 1WORA 3FSXA 3L3CA 1KTVA 2MZSA 1PBAA 2MPUA 3DLKA 4DF4A 1UKUA 3PW7A 3IWXA 2ZM6F 4HL9A 4KE5A 3UN2A 2ZE2B 2UXDF 1FD2A 4KR0B 2AEMA 1MWTA 1S76D 3BBCA 4ZITA 2ACMA 5HQMA 3CDWA 2Z2MA 3POTB 4KAIA 3TYTA 1JLFB 4DQRA 2GS8A 4B3SF 4O0NA 1W2IA 4ZPAA 4ZP9A 2BV3A 1JKHA 3MM6B 1NB2A 2HBQB 2CJQA 2IIHA 1XR6A 3PYFA 2BW7A 3MR6A 4IQXA 4CP5A 3GP9A 2DPJA 4DS5A 3GIMA 4NZ6A 3PJWA 3UE3A 2E5IA 4Y2MA 4RBVA 3K5PA 1X9SA 3S8SA 2DNPA 1IJEB 8RUCA 2ZM6J 2PD1A 2NPIA 2IJNA 3RBZA 2RQKA 3C15A 1XJWB 4LF8F 4NZ0A 2VQEF 3K5NA 4PG7A 3VAHA 3KLIA 1TL1B 2J9DA 5T7LB 1N4LA 4XDDA 2ZFHA 2VICA 4ZPDA 5D0RA 5IFMA 4B3SJ 4IUFA 2AU0A 2YWFA 2W2NP 3WBZA 4PUOB 3S01A 2E9RX 2QO3A 1RT2B 2KN4A 3MCMA 3I0RA 1JX4A 4U67Q 4OI4A 4I56A 1OY9A 3LO7A 2C2EA 2V6AA 3FMBA 1N5TA 4AE5A 4DR2F 1KBRA 1R8BA 2OD6A 3TX0A 4ZCIA 1RAGB 2HLUA 5HSPA 5AE3A 3MUMP 3GYXB 3S6EA 3CCVS 5C24B 5GVQA 3PZPA 4LF8J 3L7OA 1MLAA 1U0SA 3CCLS 3KK1B 4BCAA 2VQEJ 1U1PA 2BACA 1AUDA 1V3RA 1FKPB 4ECYA 2VG6A 1X4AA 2Z4PA 4YDXA 1VQPS 2OIHA 4DQSA 4Q8FA 1Z1ZA 3M1VB 4IDKA 1KN6A 1GTHA 3CJRA 5E41A 3T1AA 1CJVA 3NKYA 4YMEA 2BM1A 5DLFA 5L9NA 1HFEL 1L3SA 2YH0A 3C14B 1QUPA 1RWXB 1WG5A 4O44A 4USVA 4YP3A 2HGMA 4KH1B 1QD1A 2B4UA 5E2QA 2VFVA 2J6UA 2HQ3A 2JVRA 4Y28C 1BE4A 2B5JB 3KK3A 2QA4S 5D3GA 1S1VA 4ZP6A 2R7XA 4W92B 1Q8IA 2W4PA 1AUSL 2J7UA 4ES1A 2Q3PA 4IRDA 1RHRB 2RH3A 4PEOA 1BMQB 2B51A 1L5UA 1C0TB 3WZ0A 4EBEA 1FWKA 2M2BA 1H3DA 2G1DA 4J9QA 1K47A 1HBOB 2BX6A 2QYCA 4MK9A 3AA9A 3GZ7A 1UWBA 3X3UA 2FJXA 1T3NA 2CG4A 4ZJOA 1VRUA 2HVHA 4RR5A 3N5FA 2B9WA 1QJHA 1J2VA 3O5TB 2XCAA 4P75A 4R5PA 1UEVA 2VONA 1E6YB 2BOAA 2LA4A 2UVUA 2PC6A 3H0PA 3P3DA 3ZTPA 1ZH5A 2XY5A 3KK2B 1M5HA 4DL0C 4RW9B 2OMOA 5F8NA 2UZAA 3MM8A 5AJ3F 2CQHA 1MU2B 4RZRA 1AW0A 1SJRA 3B78A 4QJGA 4EBDA 3KLFA 2OTJS 1U48A 3I82A 2O66A 4KHPF 4WU3A 3M8WA 2V5HG 1RTIB 4OI1A 1OYDA 2VH7A 5HN0A 3R97A 1FVQA 3BB5A 5HMZA 3QMQA 3W62A 2FC9A 3DLLQ 4G1IA 4CM2A 2CVEA 4KKOB 1QMFA 5JVHQ 1YJ7A 3GSDA 4ID5A 3EZOA 5KFRA 4MFBB 2DR6A 3P8BB 2RB7A 2HQGA 1FO1A 1MN9A 2HPUA 1K25A 3ICLA 1LWFB 2WSCC 2BJEA 3NBPA 1B0TA 5AJ3J 1VQ5S 1RKJA 2N4CA 5KFJA 1YBUA 3DM2A 2DXEA 2XNRA 3LA0A 2HMIB 5D4PA 1BUXA 4AYBD 1IWGA 1WOOA 3H42A 1NK8A 1XERA 2DGSA 1WNEA 3TA2A 4KV8B 2JZ5A 3M32A 2DHSA 3VGVA 3I9V9 2WVBA 1KVKA 3M8ZA 3E8OA 5A8KB 5IM0A 5IV3A 5A0YA 1VBXA 4DZ6A 3IFEA 4X4PA 3PCOB 1HHSA 1F3VA 3QWUA 3R3TA 4OL8A 2L08A 1YITS 2NREA 4NLDA 1D8ZA 4AL7A 4QW8A 4DR6F 1WEZA 2M4MA 4X4OA 3MEEB 3DU5A 1TR0A 3VVTA 1V5VA 1PSDA 2L3MA 3DOMB 1IN0A 1JLEB 3NCQA 5F3ZA 1MWSA 1TUVA 1G4CA 1TKDA 1CC7A 2R7VA 3LANA 3QQCD 3M2UA 1I94F 3PIOQ 3DRSB 1FKOA 1FTCA 2ZOFA 5HP1B 3F73A 2GCFA 1HNWF 3IBFB 2HRTA 1C0UA 3PJ9A 3LGHA 4CO2A 1RLCL 1RT6A 2XHCA 2AX1A 4Y65A 4R0EA 1UTAA 4XO0A 2G0JA 4DR6J 3ZFVA 4R25A 1RT1B 4PXCA 1NB7A 2BJ7A 5B0CA 1SBRA 1W26A 3QFWA 1DTTB 1JXVA 2QA2A 2BZ2A 3CDEA 4J7CA 1VRTA 5B7WA 1SIWB 3B6BA 3Q8QB 1RGVA 4EI2A 1DZ5A 2HHUA 3GV8B 4X4RA 3VF0B 4OYWA 2LQJA 1HNWJ 3AA8A 4NA1A 4OI2A 3V81B 2RU3A 1LFWA 3MM9B 1IKXA 2KHDA 2CPIA 4QZVB 1T05B 2Z57B 2V4QA 2JNJA 4OYPA 4JYAF 4WZQA 3M8QB 4DX8H 2KM8B 4JV5F 3VZHA 4NPOA 1R3NA 2H9ZA 3L9ZA 3DRYA 4OLPA 1RYRA 3CJTA 1H6KX 2EFNA 3WQPA 3WIUA 3VAMA 3LGMA 2R7TA 1S6QA 2VPWB 1H74A 2KT3A 2ZZNA 1HQUB 1GK8A 4D3HA 2E7WA 4RNMA 1QAXA 3CUNA 1VQSA 3SV4A 3HFVA 4RKUC 3PG9A 2XGQA 1CVJA 2IVMA 4FS2A 1U25A 1HPZB 2DYAA 3QNWB 5HK4A 1D09B 1S6UA 4JYAJ 2CRLA 3NGKA 4KHRA 4JV5J 4LIWA 2DNQA 4DUTA 3QO9A 4EZ9A 2FUG9 1NSQA 3TQ1A 3G9CA 4WWSA 1H98A 4HKQA 2FJDB 1YJVA 1N33F 1YBTA 2RKIB 5DG9A 3UW1A 4DV2F 2HRUA 2X7IA 4PWDB 2C2OB 3FZBA 2HS3A 2AX0A 2IBKA 5GAEU 3TOQA 1QAIA 4TLQA 5T41A 2EG1A 2WVDA 4NCGA 4O4GB 2W9AA 4NOHA 4Q8EA 5AXKA 2CAJA 2FJEB 5LM7E 3LP0A 1S5ZA 9RUBA 2YH1A 4LFBF 3PDNA 1S6PB 5IC6B 3EDQB 2ADBA 3NMRA 2GQQA 3CMQA 2COLA 2H5IB 3HVAA 4IG0B 2BE2B 3LO3A 2K7KA 2RMLA 3ET6A 3G8SA 2KFYA 1KSPA 5B08A 4DV2J 1EP4A 2FHKA 1S9EB 2KXNB 3OVAA 4V19X 3PW5A 1EETA 4RW6B 1YHQS 4W90B 3CJSA 4I6YA 3A4TA 5EWGA 1QTMA 4PYDA 1ZA2B 3CEDA 1B70B 3LWLA 2DIUA 1PJ7A 4LBIA 4CH0S 2O67A 4RNHA 3S1TA 1F9FA 4C98A 3PVXA 1KQKA 3N9UC 2QIFA 4LFBJ 3JSYA 1LWCB 2L41A 4ZMMA 2PSZA 4DV6F 2AJQA 3FBEA 4UUWA 1HBUB 4W98A 1F1BB 4ZKAA 1M0SA 3QWPA 4U7UD 4NLWA 1S0MA 3LP2B 2DXDA 2GVDB 2WTFA 4F7VA 3MCNA 3Q2SC 3CIZA 4MIBA 4DL5A 4MTPA 4CNYA 3MPDA 5DGBA 5KFEA 5C42B 5KG5A 2G0CA 2LFVA 4DFMA 1TVRB 3W2WB 1RT7B 2O5DA 3B54A 5E3PA 1VGYA 2FVSA 4BDPA 2ZJQQ 3UN3A 4DV6J 3J7AN 4WU2A 3HSJA 2J0SD 3AAWB 2ADCA 3UI3A 1PG5B 1EKRA 3PX6A 2R8IA 2IY5B 4ZHRA 1RAOA 3T5LA 5DDQC 2UU9J 4QJVA 1N36F 2KT2A 2FDNA 3R5AA 4TQSA 4LF6F 4BS2A 4JUZA 2O01C 2OD4A 2MKIA 3SV3A 2CPDA 5JMNA 1MWZA 1CLFA 1VQQA 5IOLA 3DRRA 1Q81T 3EQVA 1SXLA 2N3OA 2CJKA 3HHLC 3KFWX 3DYAA 4R8UA 2OLVA 9ATCB 1H2TZ 4K5SA 4UW2A 2V68A 1TUWA 4B3TJ 4IFVB 3KLVA 5ETQA 2YKQA 3IS9A 4BL2A 1QAYA 2JOQA 1FWPA 5CA5A 3HKZD 3TJ8A 4MH8A 3QGPA 5F8MA 2GZOA 1NLKL 2W2QP 2CPEA 5F8IA 3ITHA 3UE2A 1FJCA 2HNDB 1N36J 3V6HA 1T8EA 1HBNB 1U6FA 4NXMF 4EYHB 4LF6J 4RLEA 2HBRB 4Q7AA 3HJVA 3G8QA 3LP1A 4ED7A 3ZZZA 2X1AA 2EBGA 5BYSA 3GCXP 2VG5A 3M8RA 4F4AA 5HVHA 4P10A 5DRKA 3VAFA 2G9OA 4KPYA 2E1AA 2CA9A 4KGMA 2DT9A 1RT4B 4ED5A 2HVEA 2JSXA 3Q8YA 2IC3A 3UD5A 2YTCA 2DR7A 4OHXA 1R0BG 3K7RA 2L48A 2DNGA 3DHXA 1UJ6A 1DQAA 5ETRA 4O23A 2M9KA 3EM1A 1UA0A 4LRDA 2EFQA 4Q45A 1IR0A 1NSPA 1NRKA 4NRUA 4NXMJ 4QPXA 3CSKA 5KFXA 3BPDA 3HPOA 1SH2A 3J7YU 4AXJA 4NLXA 3GYNA 4ELVA 3BGRB 1MW7A 1U02A 5ETLA 3HFKA 1LXJA 1RI7A 2I1RA 1WC6A 2BDPA 5I3PA 1IKWA 1T0TV 1NH8A 4URSA 5ETOA 1GX5A 3D0HE 4J9OA 2YX1A 4JI7F 2W8KA 5KFVA 4A8FA 1XN9A 1PGZA 2CPFA 3CIMA 2Y1JA 4FKXA 1K9MT 1EZZB 1S9GA 1U45A 4EK2A 4B02A 5B0BA 1N0VC 2X1FA 1DURA 4YUDA 3A3NB 2OAUA 1V5IB 3FBCA 3I0SA 1FF2A 2LXFA 5DETA 1GMUA 1MWUA 4QU6A 4DFJA 2L9DA 4DQQA 5J2NB 2MKSA 3A13A 4JI7J 2PN6A 2W7OA 4CPKA 4PQAA 4HDGA 3CCJS 2WOMA 1LW0B 1SL0A 3MR3A 1NDPA 4LF7J 3RUBL 3HHLD 5CYQB 2YBVA 3HHLA 4O3OA 3PFOA 2YNIA 2V4RA 1JNZB 2XO7A 2OEJA 1PC5A 4X4QA 3IMQJ 2W8LA 2XYGB 2CZ4A 3H5SA 2RJZA 3F44A 3MAAB 1UPMB 5H9EK 1XC9A 4C8MA 1NMEB 1U6ZA 4KHMA 3OSPA 1L3KA 2IYIA 4I1TA 1RBAA 4G3IA 1N56A 2Z30B 2SXLA 3OTEA 4J9NA 1NJIT 1N6QB 3M1VA 2EFVA 3FCVA 1JK9B 4CIOA 2U1AA 4ENOA 2AW0A 2ZBCA 3D3BJ 1KONA 3ENQA 4DPOA 3LAMA 1FKAF 4A8OA 3OSNA 6FD1A 3G71S 4K4ZA 5K8MA 3JXOA 2YX4A 3C6UA 3UDLA 1PJ6A 2J8SA 1TAUA 1DY3A 3IM9A 2APOA 1IKVA 4J9MA 2ZNYA 2FC8A 4IOBA 2OO4A 3R5JB 2LQ5A 4B17A 1RAAB 3KUGA 4OHZA 1Q1KA 1LWEA 3HSZA 5HLFA 2HBYB 4EZ6A 5L1IA 4NYPA 1S7IA 3GONA 5ETMA 2GQCA 5B0GA 4IRKA 1DAXA 3N28A 5A8WA 2HFSA 2BQRA 2H5JB 4ZLNA 3G8TA 5HVFA 5KG6A 1Y7PA 3UO0A 3FCWA 4ZCKA 4K4TA 5CHCB 3BKTA 2JL9A 2AT1B 4NLVA 2YWKA 1HHTP 1A7GE 2QMWA 1I5OB 4J91A 1SUQB 2AJ2A 5FLXU 3IR7B 4UOGA 1WACA 2GQ2A 2MQPA 5HBMB 1CJUB 2IAJB 2Y0SD 1ZTWA 4X66F 3W61A 1H72C 2QMUB 4BHQA 2KG1A 3EVWA 3X1LB 3MPYA 1WC1A 3SQGB 4C9DA 4ZN1A 2GIFA 5K8OA 1HBMA 3ILLA 4KIAA 4DX6A 3KHRA 3Q24A 2WSEC 4WYLA 2I9SA 2KM8C 3DXBA 3PHTA 4ED4A 4AL5A 3A8EA 2YNFB 2RF2B 4NLUA 2VQFF 4X4UA 2B4OA 5LOQA 4RO0A 2M5YA 1YIJS 3DOKB 1IBLF 3CVKA 5D15A 4KKOA 4K4WA 1GXTA 3H4BA 4N1XA 1TKXA 3GILA 5KFBA 3E01B 1FXLA 4QWAA 1HMVA 4NCAA 2WRMA 3ETMA 4USJC 1CULB 1GMVA 4OX8A 1UW9A 1SKSA 1RWVB 1S49A 3K5LA 4NLSA 3EQUA 1J5OA 4DL4A 4RPFA 3CD5A 3TA1A 2KJWA 2XMTA 3HX9A 1D0EA 4LSLB 3N5BA 1IVZA 4RW7B 1KDNA 3T41A 3V5RA 1S0NA 2VQFJ 5DQIA 1S1XB 1IBLJ 5M2RA 1S7HA 3EE3A 1PYTA 5A8KA 2ZC3A 2VKRA 2R7UA 1KRPA 2CQPA 5L1LA 2Y8YA 2VC0A 1SPBP 3PRBA 3S7RA 4DBQA 4D3GA 4IRCA 2HS4A 2XMVA 1K1SA 3L09A 1Q4RA 2R7SA 1MN7A 4PRFA 5CYMA 5J2PA 1AYEA 1HNIA 5HAOA 3N0VA 1QAJA 3V4IA 4BBYA 3DOMA 1HL6A 4U95A 1UL3A 4DX5A 1N34F 3OPKA 2QL7B 4UZCA 4OYMA 4ZN3A 2DCUB 3CCRS 1K44A 4TYBA 3U7JA 4QWBA 4HLBA 5LXYA 4L74A 3FKBA 3A8IA 3MECA 3NOGA 2BJDA 4M63A 2WONA 4DQPA 5JUMA 3BSNA 1W25A 2IRXA 4PYAA 4NMLA 4OZ3A 3R5DA 2FY8A 4R3JA 2C42A 4IH6A 5KFCA 4PXDA 1N34J 4EWTA 3Q86A 1E6VB 4NLQA 1O8BA 4Y2CA 3OL8A 1PC4A 2YQ0A 3RG6A 4I67A 3TZZA 1XEZA 2NS1B 3VAJA 5KFFA 4ZCLA 1WTFA 3ZZPA 3MR5A 2LQ9A 3D28A 4U96A 3TUPA 2C2ZB 2MHNA 4P71A 3CB4A 4FBUA 1U1OA 2CJAA 1R6YA 1Q5YA 3KHGA 5I3UA 1OQ6A 4J9UE 2DGUA 2GC8A 3KJQB 1HW9A 5CAAA 3W64A 2QMXA 2EFPA 4EO8A 4J90A 3H59A 4NLGA 3I9ZA 1HIYA 1VOMA 3K59A 2POKA 1RTDA 3TJ9A 3G6ES 2LXUA 4WFYA 1N5VA 4M5JA 3HMJG 4KC5A 3M7VA 1U26A 3GWCA 2QFIA 3HSGA 4HT7A 2G2ZA 2KTQA 3NNHA 3ZFZA 1RT3B 2X3GA 1RWUA 4AD6A 1SC1B 2FZCB 2AQ4A 2LXIA 4YOEA 5L38A 2K8GA 1SH3A 2RS2A 2NCKL 1Z2LA 3UN5A 4GKKF 3RAXA 4ZVHA 3JYTB 3Q0AA 2G2YA 1IR1A 4RA7A 1IQZA 2D1CA 3JTNA 1YJWS 3O3LA 2DO4A 1XMQF 1VQ9S 2KRRA 4I4BA 4JBCA 4YHHF 2XLJA 4K50A 5HATA 4CLYA 3E3XA 5FDLB 1IQTA 5G0RA 3J81Y 3R8YA 2HWTA 1O0PA 3DNCA 3CJ4A 3UNYA 2F8MA 3CCUS 4ZVUB 5C2CA 2NLWA 2E9TA 1GTEA 4YQWA 2WHOA 4GO7X 2CQ0A 3TAMB 4BL3A 3OL9A 1T02A 3R6LB 4I0WA 1S10A 4GKKJ 4I68A 4B3RJ 4TY8A 5BR8F 4B3MJ 3HDSA 1D3WA 3MM7A 3RZAA 3DDKA 3Q89A 1HYSB 4DR7F 4LF5F 2IDEA 5FLXY 1XMQJ 4YS2A 1NDLA 4ECQA 4OIXA 4YHHJ 2FLNA 1D9AA 2I5JA 1H38A 3RW7A 4L6V3 4H4MB 2Q66A 1DTQA 2YPZA 3SFGA 4URGA 1R0AB 2MZ1A 4UOCA 3QSIA 1UVLA 1FVSA 3H2UB 4X64F 3KG0A 4P2MA 2Z2LA 2BM0A 4X4NA 1ZTTA 2GAGC 2WW8A 2XI3A 3QGGA 3LGNA 2F9DA 5DM6Q 3R5GA 5GADU 5BR8J 4WXOA 3JQMA 3C16B 2R2UA 3KLGA 3L4BC 3EXCX 4PXEA 2BYCA 4DR7J 3ZTRA 4LF5J 3D1QA 5E5NA 4LQ9A 3M9OB 1RHMB 4CJNA 2HNZB 4MKAA 4PWWA 2W1BA 3G6XA 4DHVA 4NZ7A 4USUA 5CYJA 2KI2A 4ZVOB 1SJ3P 2OI2A 3LUYA 5C25A 3C19A 5B0DA 4BWJA 3ZZUA 5KAKA 2LU1A 2D9PA 1RSCA 4C11B 4X64J 5K8PA 3DLBA 3SZ2A 2NUUG 3GFYA 3PKMA 3QAEA 3WDOA 4KFBB 4KT0C 5J1PA 1S72S 1FNMA 3I4PA 4M1KA 3BDPA 3D6TB 3V6JA 3AOAA 2D7SA 2WK4A 3WX8A 4K4YA 2QYGA 1TELA 1TK5A 1K1QA 3ZG0A 2J7KA 4DLGA 4OYOA 1JXLA 3PM9A 1MMLA 1V3ZA 2CQ3A 5U47A 5J2QB 2XS2A 2MLYA 2IRYA 1WHVA 5K14A 2K3KA 2VZ9A 2XNQA 4B9SA 2DK2A 5HROB 4ZVEA 4HH1A 4XTTA 1ELOA 1LQ9A 2MKJA 1KHVA 4TQRA 1F9HA 3I5AA 3I96A 1AXQA 3HT3A 1NK4A 4FYXB 2UUCF 4LQ3A 2AJ1A 4CNZA 3TQEA 1VDHA 1LKZA 4L76A 2NR0A 3M2RA 3KUHA 5CABA 1UJ4A 3O8WA 1DJ0A 3PO5A 2HNYB 4ICLB 3W2VA 4WXWA 2BJ8A 3HFZB 5EN1A 2HEKA 2DGTA 1Y5NB 2MDAA 1TKZA 2MKCA 1SV5B
chains in the Genus database with same CATH topology
3DRRB 3U1MA 4J9PA 2OSQA 4AYBD 3T5HA 3R1LA 2Z0GA 2KYXA 4ED1A 1ZAWA 3FQLA 2F9JA 4IR9A 5HMWA 4R8UB 3DYAB 3KLHA 2CPZA 1NK8A 5KFUA 3MEGA 5CXTA 3W7BA 4U7UK 3T6BA 1XERA 2DGSA 4ED0A 2HLTA 5D77A 1WNEA 2ZJPQ 2KYZA 3TA2A 4KV8B 2OPRA 3SCKE 2JZ5A 4N76A 1BWEA 3UPOA 4C7QA 3M32A 2DHSA 4KO0A 4MJKA 5F3TA 3I9V9 1S0OA 4E0DA 1RDRA 2O1PA 5KFMA 4IQMA 2MY8A 3E8OA 5A8KB 5IM0A 1VBXA 3IS9B 5A0YA 2F40A 3IFEA 4X4PA 2CKWA 1HHSA 3QWUA 3D5MA 3R3TA 2UXBF 3HK2A 3TA0A 5M2PA 4OL8A 1GXUA 2L08A 3DLHA 1YITS 2VPZB 2QLXA 4MKBA 5EUHA 1GAOA 3OTOF 4RU2A 1FNOA 2NREA 1BQNB 1NK9A 1K0TA 4NLDA 1D8ZA 2W9CB 3TNVA 4AL7A 4F4KA 1FJEB 4QW8A 5KFQA 1Y0HA 3ITHB 4DR6F 2ZD1B 4JI5F 1WEZA 2QSWA 4UY85 3GG0A 3QIPA 2JEIA 1N48A 2M4MA 4OI6A 4X4OA 3MEEB 3DU5A 5KFYA 4WKYA 1TR0A 1FK9A 2OKQA 3TARA 4OZ0A 2UUWA 3RR8A 1PSDA 2E1RA 1N52B 1FCAA 2L3MA 2R7OA 1IN0A 1JLEB 2RRNA 3NCQA 5F3ZA 1XMOF 1X4EA 1E6VA 2NUHA 2W9BA 3LP1B 1MWSA 2FVPA 4OZLA 4ZVGA 2J76E 1TUVA 1TKDA 3IRWP 1CC7A 2R7VA 2PA3A 4DWIA 1X0PA 2XMJA 2FHJD 4OHWA 3LOUA 2ROGA 1Z4UA 3C66A 1HWIA 3CDUA 3KG4A 2VG5B 4PG6A 3VSKA 3LANA 2YNHB 3M2UA 2FGCA 4IYQA 1I94F 4N41A 3FSYA 3J7A1 3VZIA 1TP7A 1UVNA 3DI6B 3PIOQ 1R43A 2J5AA 3DRSB 1FKOA 2VD3A 2R8KA 3VAGA 2OPQB 3C8YA 1FTCA 5A6PA 2ZOFA 2XGPA 2GHPA 5HP1B 2ZH9A 1UVIA 1HWKA 2GNKA 2Q6BA 3DHWC 1KC8T 1FDNA 1T7PA 3F73A 3HHEA 1G6BA 2EFGA 2GCFA 3HLUA 2VASA 3CCZA 5B0FA 1HNWF 2V9KA 2IYGA 2IC3B 2D3OR 1C0UA 1VQ4S 4KRWA 1NAQA 2JVOA 4KJIA 2GHVC 2YKMA 3CCMS 4CO2A 2ZE2A 5I3QA 1RT6A 5HMXA 2OTLS 1YJTA 2AX1A 3AJ2A 4Y65A 1VK3A 4R0EA 2ZVSA 1IKYB 2LECA 4XO0A 4DSKA 3ZFZA 4F2SA 5IWAF 4O3NA 4IKAA 3ZFVA 3JSRA 1X5PA 5FJ4A 4R25A 3E51A 2BVZA 3ISNC 4PKDB 3POTA 1LOUA 3EZ5A 2HAIA 4QBUA 1JLFA 2DBBA 4MK8A 1RT1B 3TANA 4PXCA 1NB7A 1LXNA 1K73T 2FPHX 2V9WA 4YR2A 5B0CA 1SBRA 3NRBA 5GAEI 3CD0A 1DTTB 2QA2A 4OMFG 2LVWA 5FIIA 4HT5A 3I56S 2BZ2A 3CDEA 4Y2KA 4A8SA 1VRTA 3MR2A 4I69A 3MM6A 3IR5B 4FXDA 2CQ1A 5B7WA 1URRA 2IM2A 4I2PB 2BANB 4FVCA 1N32F 1SIWB 3Q8QB 1B64A 1RGVA 1DBDA 4LF7F 1RTJA 1DZ5A 3MTJA 3FDSA 1B7FA 4FP9A 2HHUA 4USHA 3CC4S 3GV8B 4O3RA 4X4RA 1G7CB 4LSNB 1IKWB 3VF0B 5DLGA 2LQJA 1HQEA 3TVZA 2C2DA 4M95A 3MUVP 3JSMA 3AA8A 1TL4A 3BGLA 4NA1A 1S1TB 2DHAA 2F3JA 3RAMA 2D74B 1RT3A 4U6PA 1SL2A 1QMEA 1YG0A 4F8RA 4OI2A 3V81B 2RU3A 1LFWA 3ENVA 3MM9B 1NJWA 4NLYA 2BBEA 1TKTB 1IKXA 2KHDA 2ROPA 2C2RA 2CPIA 4QZVB 1YVFA 1T05B 4DR5F 1KVIA 4F2RA 5J2MB 2QA4G 3RW6A 4OQJA 4AQYF 2DRBA 4N47A 2V4QA 2UXCF 5KFKA 3JYTA 4J9LA 4JYAF 3MZIA 1L3UA 4OJ3A 3M8QB 1MMDA 4WZQA 1SL1A 3CT9A 2WB1D 3CGIA 4IO9Q 4DX8H 2ZKUA 3QZ8A 2KM8B 4JV5F 3VZHA 1WI8A 1S9GB 1TL1A 4NPOA 1R3NA 2H9ZA 5T7LA 4HI1A 3RB6A 3DRYA 2XSJB 4GO5X 4OLPA 3GIJA 2R4FA 3BDEA 1RYRA 2FJVA 4DG1B 4I6AA 4TU9A 3OFGA 3CDBA 4WFXA 1Q78A 1H6KX 4HYKA 1Q7YT 2EFNA 1TV6B 5CZXA 2VBZA 3OTDA 1S1WA 3O44A 4B3OB 3UFCX 2DNOA 5F8LA 3VAMA 3ULHA 1U1NA 4R1GA 2XMMA 4PUOA 1FDBA 1RT2A 1UMJA 3LGMA 2R7TA 2UV8A 1C4CA 1S6QA 2VPWB 3I0SB 3RYLA 3I6PA 5HO4A 3Q8SB 2PT0A 1K8AT 3CE8A 1YJRA 2KT3A 2ZZNA 1HQUB 3MM5B 2E7XA 4D3HA 1X4FA 3PRDA 1VIXA 2DH9A 2DHXA 2E7WA 4JV2A 4RNMA 1QAXA 1YGYA 3HXMA 3CUNA 3M8PB 1HNZF 2E1CA 4PCQA 1VQSA 1OO0B 3SV4A 3DOLA 1OPIA 2QLWA 1Q8BA 4ECWA 3DWKA 1JLAB 4RKUC 1VMBA 4RNFA 1SB6A 2XGQA 2UUTA 1CVJA 5EWEA 5C24A 4ALZA 3L7PA 4IG3A 2IVMA 4FS2A 2C3PA 1VBZA 4CCHA 1U25A 1HPZB 1JLQA 3NNCA 2WOMB 1YRXA 2WAQD 2AJ4A 2YNGA 4AXIA 1S6UA 4Q2MA 3J7Z5 4P6QA 3KK1A 1U1RA 2ATLA 2KZMA 2UVRA 3EGZA 2CRLA 3NGKA 3HHLB 2LEAA 4HDHA 3C6TB 4KHRA 1FKPA 4LIWA 2DNQA 1FJ7A 2M7SA 2DD8S 1HYSA 1TZ0A 3BO3A 1U7LA 4Y00A 2YNIB 3QO9A 2DNZA 2OP5A 4EZ9A 2FUG9 3MDFA 3N79A 5GAGI 3TQ1A 4TN2A 1JLGB 4PPZA 2XY7A 1JLBB 1C2PA 3FNNA 3PR5B 3G9CA 2AYMA 2JRSA 1H98A 4IH5A 4HKQA 2FJDB 3CMAS 3BO2A 2W25A 2MB0B 1YJVA 3C3LA 3W3SA 1N33F 3DGPA 3HVWA 2RKIB 5DG9A 3UW1A 4DV2F 2HRUA 3EGWB 4ID8A 4C0OC 4H4KC 3LH2S 4PWDB 4CI0B 3SCLE 5ADZA 2IVYA 3DLEB 3FZBA 2JHEA 2AF6A 4H4MA 2HS3A 2AX0A 2IBKA 3DN9A 1LFPA 5GAEU 1R0AA 3TOQA 1QAIA 4TLQA 5T41A 1Z2ZA 7FDRA 2HS0A 3V4MA 2EG1A 3OVBA 2ZBIA 3DLGB 4NCGA 4C8NA 4O4GB 4CO4A 2W9AA 3TAPA 4NOHA 3RAQA 4Q8EA 1DFDA 1NKEA 5AXKA 5KTQA 1MWRA 4YB5A 3MTKA 4HTIA 1VC6A 1S77D 1U6BA 2X1GA 2FJEB 3DDNA 3T5KA 3MURP 3LP0A 2J0WA 3CJ3A 3IN5A 4DV0F 2QEXS 1N8RT 3IRXB 4F3OA 5MLCV 3MMBB 5HQ8A 3KLEB 5M19A 2YH1A 1U1MA 4LFBF 1C4AA 2B9XA 3WX4A 4ECTA 1XNRF 1R27B 3B8HA 1S6PB 3PDNA 2B5JA 4TLRA 2KT5A 2E66A 2FLPA 3H5YA 5HL7Q 3DMJA 4FVMA 2ADBA 3NMRA 4NLOA 2GQQA 1XK8A 2COLA 3MUTP 3GFZA 4J9RA 5D6GA 3HVAA 3OJUA 2X1BA 3OTCA 4QCLA 2RNEA 2DR9A 3U1LA 4IG0B 4DUZF 5KFNA 2BE2B 2HNZA 3LO3A 2K7KA 2DGWA 4QQBA 4F4XA 2FGOA 3C6UB 1XR5A 2RMLA 3I5BA 4NLRA 2W4CA 2N4DA 5ITHA 3G8SA 3T3FA 1VC5A 4U9RA 2KFYA 3H8YA 1R8PA 2KDOA 1KSPA 5B08A 5IT9Y 3G6VA 1C0TA 4JI8F 4C4WA 3VALA 1EP4A 1HNVB 5L8RC 3UWTA 3FFIB 3KHHA 3H20A 1CSJA 4EGLA 2KKHA 2L9NA 2FHKA 1S9EB 2LDIA 5F0WA 1IKVB 2KXNB 3OVAA 4V19X 1CC8A 1HBOA 3PW5A 2EK1A 1EETA 3HHKA 4RW6B 1S97A 1YHQS 2JJ4D 4I64A 1NKBA 4C11A 4W90B 2XULA 2DNNA 5KFTA 4I6YA 4QYRA 4RNNA 5EWGA 2IM1A 1QTMA 1NK0A 5SZTA 3CO9A 2VA3A 1FRXA 4MNRA 1LWEB 1GQEA 3CEDA 4KFBA 2A2DA 4TY9A 1SJ4P 2CQIA 3LWLA 5HLFB 3BR8A 5EX0A 2DIUA 1NJZA 2EI5A 3O6QA 4FZVA 4CH0S 3MFIA 3CPWR 2O67A 3IA0A 2B43A 4RNHA 3S1TA 1F9FA 1TQLA 4C98A 3PVXA 1ZPWX 5KFOA 1KQKA 1E6YA 1C1BA 2QIFA 3N9UC 2CJBA 4OX7A 3VTIA 5LL6d 1R7IA 3JSYA 1LWCB 2OPSB 1VIOA 2L41A 5A8WB 3M05A 2RD5C 4ZMMA 2ILZA 2PSZA 2VFRA 1OWXA 2CPJA 5KFWA 2VBYA 4DV6F 2ZZMA 3MXHP 2AJQA 4UUWA 2M70A 1HBUB 1D8YA 4DV7F 3QJLA 2RSQA 2R7QA 4WJBA 3UCZP 3KK2A 2FTRA 2QE5A 3IR6B 1FT8A 4N8OA 4ZKAA 1M0SA 3R5BA 3QWPA 2I38A 2GJIA 4RW9A 5DM7Q 4NLWA 4V19J 3UQSA 4QR2A 3US5A 1MSWD 4PWUA 3K5MA 4A8KA 1S0MA 1ZM4A 2BR0A 4QU7A 4PG5A 3HF5A 5J2QA 1H7XA 3IGVA 3LP2B 2WTFA 5L39A 2GGPB 5KG0A 4OZ5A 3NS6A 1MU2A 2J0XA 2JX2A 2CDQA 3Q2SC 2XB2D 3CIZA 5GAGU 4CT9A 3D1HA 2MSSA 4YB1P 2B0GA 4Q0BB 2RT3A 3QZ7A 5F8HA 4ES2A 4MIBA 3KYLA 2E1MC 2RQMA 3AQOA 5HROA 1FJGF 4DL5A 4MTPA 5M18A 4CNYA 5DGBA 3HHDA 4JOUA 4CO3A 5KFEA 5C42B 4HHJA 3UPFA 5KG5A 1VHFA 3IG1B 2B4PA 2R7RA 2MZQA 2G0CA 3AHPA 2HGNA 4RW4B 3T9ZA 1TVRB 4DFMA 2J9DE 2HHHF 1RTIA 3W2WB 1A9NB 1RT7B 1ZOTA 2O5DA 3M30A 4OJHA 4K4UA 3CCTA 1OQ3A 5E3PA 1VGYA 1XTZA 5F41A 3A1YG 2LEPA 4Q5VA 4DR3F 1M90T 1ZM2A 4NYZA 2FVSA 2VKZG 3PX0A 4BDPA 1N0UA 2E5GA 1KQGB 5KT6A 3IO1A 2ZJQQ 1BQMB 4YDDB 2DH8A 4N5SA 2UVVA 5C5JA 1QVGR 5EX3A 2CFXA 4WTYA 3ZZRA 2C22A 5FD1A 1XBWA 3Q8RB 2HHPA 1FEEA 4KGKA 4WU2A 4C0HA 3SDEB 2YQ3A 2FB0A 2W24A 2R8GA 4NXNF 4JI4F 1HBMB 3QLHB 4NLTA 2IMWP 2MQMA 3IGNA 2CQ4A 2J0SD 5E3CA 3AAWB 1TFWA 2ADCA 4IFYA 4XAKA 5A8RB 3UI3A 1Q16B 3PX6A 2EKYA 3N6MA 1S6OA 3BSCA 4Y0FA 2ROEA 3M6VA 1C1CA 4MFBA 2MQQA 1T03B 3IWLA 4GMKA 4YR3A 2JWNA 5F9NA 4R23A 5KOXA 4PQUA 1WTBA 1KLMB 4C0BA 1LWFA 5LXRA 2R8IA 2JLFA 3J7YI 4O3PA 2R2RA 4ZHRA 1XNQF 2PI5A 3T5LA 1X4DA 2HNYA 4ICLA 2PFFB 5DDQC 4QJVA 3NNAA 4A46A 2ZH7A 1N36F 2KT2A 3D1OA 3KKFA 3BJYA 4ZK7M 5KT7A 2CYYA 4LJMA 2FDNA 4I7FA 4OHYA 1SH0A 3R5AA 3AY0A 4TQSA 1Q82T 4LF6F 5G4DA 1KQFB 4BS2A 4DV3F 4JUZA 2O01C 2OD4A 2PGCA 1TKXB 2PO4A 2MKIA 3HVTB 2CPDA 4NA3A 4C2MA 3SV3A 3OL6A 3SYZA 2HHSA 4B9NA 1HMVB 2DPIA 1KLNA 4X65F 2HMIA 1SV5A 1MWZA 1RP5A 2AGOA 2WBRA 1CLFA 4CTAB 1VQQA 2BXJA 3DRRA 2XMWA 2MMYA 3JTOA 1Q81T 1SXLA 2N3OA 3MF5A 2L9WA 3SFUA 1QE1B 2CJKA 3HHLC 1FRIA 4DV1F 1P9QC 2AD9A 4IOCQ 2CPXA 3DYAA 3KFWX 2V8HA 2WBMA 4K2XA 4R8UA 4BC7A 1REVB 3NGDA 3FSIA 4ZP8A 2OLVA 2FHMA 3PW0A 1H2TZ 2W4DA 4ZPCA 5SUHA 4C8KA 4K5SA 4KV8A 4X4TA 5M1AA 1YI2S 4UW2A 2HG4A 4OVDA 1J5OB 1DHMA 1KD1T 3GIIA 2EC0A 3GQCA 4H4KA 3BF4A 3KHLA 5IT4A 4F50A 2ALZA 4IFVB 2XS5A 2MQNA 2ERRA 2PE8A 3KLVA 5KG3A 1H2UX 3CD6S 3DU6A 2YKQA 3IS9A 3T9NA 5LMNF 3ISZA 2JEFA 4BL2A 1QAYA 2LLZA 2V0NA 4DQIA 2YWHA 1RK8A 2JOQA 1FXRA 3SI8A 2Q1LA 1DLOB 3C2PA 5CA5A 2IVFB 3HKZD 1ZAXA 1TL5A 1YWXA 2B4VA 4MH8A 3QGPA 5F8MA 3KJVB 3OXGA 1RA7A 1Y3KA 2GV1A 1BQNA 3TUJC 4ECSA 3CD7A 1FXDA 2CPEA 3OBIA 4KSEB 2W9CA 2UVWA 1FE0A 4FF4A 5F8IA 3UN7A 2XG8A 3ITHA 3H2VE 3UE2A 3VCDA 4DSEA 2ZD1A 1FJCA 2NPFA 2HNDB 4KQZA 3DFEA 1H0HB 3QIDA 5IXUA 1ZZNA 3V6HA 1T8EA 3MEEA 1HBNB 3MMCB 1U6FA 1QUVA 4NXMF 1RQ0A 1ZBTA 1GNKA 1UJ5A 4QWCA 4EYHB 1ZPVA 3NAIA 5KFPA 1ZAVA 2BA9A 4RLEA 4Q7AA 2FLOA 1JLEA 3G8QA 4IH7A