2ZC4A

Penicillin-binding protein 2x (pbp 2x) acyl-enzyme complex (tebipenem) from streptococcus pneumoniae
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
158
structure length
158
Chain Sequence
AKRGTIYDRNGVPIAEDATSYNVYAVIDENYKSATGKILYVEKTQFNKVAEVFHKYLDMEESYVREQLSQPNLKQVSFGAKGNGITYANMMSIKKELEAAEVKGIDFTTSPNRSYPNGQFASSFIGLAQLHENEDGSKSLLGTSGMESSLNSILAGTD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Penicillin-binding protein 2X
publication title Crystal Structures of Biapenem and Tebipenem Complexed with Penicillin-Binding Proteins 2X and 1A from Streptococcus pneumoniae
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Biosynthetic protein
total genus 32
structure length 158
sequence length 158
chains with identical sequence D
ec nomenclature
pdb deposition date 2007-11-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2110 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2zc4A02
3.90.1310.10 Alpha Beta Alpha-Beta Complex Penicillin-binding protein 2a (Domain 2) Penicillin-binding protein 2a (Domain 2) 2zc4A01
5KSHA 5U47A 4N1XA 3ZFZA 1MWRA 5M18A 3UPOA 4BL2A 3UPNA 1K25A 3UN7A 1MWUA 4MNRA 3EQUA 4R1GA 2ZC3A 1VQQA 1QMEA 4BL3A 2ZC4A 4R0QA 3UE3A 1MWSA 4R23A 4RA7A 4R3JA 3VSLA 4QJGA 1RP5A 4DKIA 4OVDA 3LO7A 4JBFA 1QMFA 4CJNA 3VSKA 3ZG0A 1PYYA 5M19A 2Z2LA 3EQVA 3ZG5A 4CPKA 2Z2MA 1MWTA 3UPPA 5M1AA
chains in the Genus database with same CATH superfamily
3VQSA 2W1BA 4F0KA 1GTHA 4XPCA 1FWLA 2A3JA 5K8NA 4ZLLA 3HHEA 2E1PA 2R7UA 2PA8D 3ETOA 3DI6B 2MKJA 3NGKA 3HD1A 2WVFA 2MB0B 3QYYA 3FZ2A 1Q1KA 3SI8A 4Q8FA 1BQMB 3VGUA 1FF2A 2OIHA 2P6SA 1SJFA 2OMLA 4M5LA 5LJ3Y 2CVIA 1NSQA 7AT1B 4JI3J 4C8KA 8AT1B 1HNIB 1HD0A 1NPKA 2L9NA 1SV5A 5DDOC 2I8EA 1QY7A 1U25A 4WTYA 1XMQF 2IRXA 2E66A 1Y3KA 2WONB 2C2MB 4XTTA 2PN6A 1RQ0A 2BJ9A 1ZAWA 1DRZA 3TAPA 3CMAS 4JV1A 4EI2A 2CWXA 1T9VA 4BL2A 1K1SA 4ZCLA 4DU8A 3UCZP 2M9KA 4WWSA 4ZP6A 3MOZA 4YP3A 4QWCA 1M5SA 2IAJB 4KQZA 2WOMA 4ZMMA 3FSXA 2IM3A 3VAMA 4G65A 1Q53A 1Y3JA 2QV6A 3QAEA 4X4QA 2UXDF 3Q2TC 3IWLA 3T3FA 4B3TJ 2XGQA 3O6QA 1VQ5S 4AUKA 2AJFE 2MY8A 1CJVA 1PO6A 2E5LF 4OYPA 1FK9A 2DB1A 1RTHB 5HQMA 2MKYA 4DG1A 1UJ5A 2BW7A 4OZLA 4B9TA 1PGZA 2JLEA 4EBCA 3EDQB 2G2OA 2D7SA 2HHHF 3DDKA 2GIFA 4NRTA 2MZSA 3NG8A 4OZ5A 3AJ1A 1BQNA 4PQUB 1VLYA 2B9XA 3E01B 4K4YA 3D9BA 3PRVA 1N8RT 3TJAA 2QYCA 2ZJRQ 2K7KA 2F8HA 2EEYA 2BKPA 3DMJB 5HMWA 2B7CB 1WOSA 1HKAA 1SJ3P 5DDRC 3EZOA 1YQHA 4JB8B 1I51B 2XM3A 2G9OA 3PYFA 4YS2A 4XAKA 4DCOB 4DL4A 4YHHJ 4FKXA 2N4CA 3TUIC 4JI5J 1OQ3A 5D0HA 4OHYA 1RT2B 3G6XA 2OEMA 1XQIA 1X4HA 4HH1A 3C15B 4I68A 1WG1A 1N5VA 2N82B 3MEKA 2ZNZA 3DOLA 2ZOMA 3QRRA 4LVNP 3CJKA 1C4AA 2PA3A 4Y2MA 2AKWB 2ZBCA 1WTFA 2E9ZA 1XMOF 4YUDA 1TUGB 2XSJB 2P5VA 4J9VA 2CDQA 1RT1A 4CLPA 4K5RA 1Q8IA 4RW6B 3TX0A 2H4WB 2POKA 1XR7A 3WC2A 2HQDA 3POTB 1VFJA 3W61A 1KTQA 2UXBJ 4W90B 3SV3A 1U8WA 1X4CA 1FJEB 2LQBA 1WHYA 2KG1A 4NI2A 3W5XA 1K44A 4TU9A 2XYHB 1VCTA 1NK5A 1U4BA 2DJWA 1P1LA 2RU9A 4IH5A 5L46A 2BANA 1ZA2B 3IN5A 2LEPA 1VGYA 3NLCA 3A12A 1QLNA 3ITHB 2FLLA 3FC9A 3GR0A 4N7TA 4NYZA 1VQMS 2X51A 3V6JA 1HWLA 1BD6A 1NKCA 3TJ9A 3RAMA 2W9BA 4ZLNA 1KD1T 1S1VA 1ZTWA 3R5AA 4UOFA 1X4GA 1N5YA 4NXNF 4ILLA 2W01A 3RW6A 3C19A 3FNNA 3SDEB 3IR6B 4TQRA 3PX0A 3D3BJ 3G8TA 4H4OB 4DV1F 3CF5Q 5J2PA 2DH8A 4MIAA 4WJBA 4DUYF 5J2QB 1NNDA 2DGXA 1N34F 4GVBB 1OMSA 2DGUA 2HBZB 2KTQA 4K2JA 4J9MA 2KZMA 4M1KA 1FJGF 1XR6A 5J2NA 3RBZA 4DV7F 2B8QA 4PPDA 1S1XB 3F41A 5J1PA 1FKOA 3MAQA 2VZ9A 5D3GB 4QPXA 4ES3A 4K4TA 1WNEA 5C7PA 1SH0A 1NUEA 1MWQA 3BYPA 3JTOA 1HBUB 2ZHBA 2J7UA 2DNHA 1KVKA 3BKUA 4NLUA 3SQGB 2IPOB 1SJQA 3OXLA 2VFSA 5IM0B 3BGFA 4PG8A 1HPZA 2HAIA 1RAGB 1CULB 3FEXB 1N0UA 3PX4A 4LR7A 3CCQS 3RAQA 1AB8A 1TKZA 3H5UA 3P45B 2VG5A 2CIMA 4ETXA 3DLHA 1NSPA 2ALYB 3PEHA 3M32A 4PXBA 1LKZA 4DEZA 3H59A 1UWBB 1GEHA 5A8RB 1N6QB 5H9FK 5I42B 2RF2A 1OY6A 3OHAA 2GGPB 2C28A 1KP6A 2QMUB 2VL1A 3GV5B 1V9OA 2HHPA 4DJBA 1DAXA 2P9CA 2XWXA 4QCLA 1MW7A 5U47A 3U02A 1XMQJ 3P8BB 5D0EA 2HMIB 1D9AA 4HH0A 2C2KB 3CPWR 2RMLA 2VDIA 2XEXA 1IXKA 2CPJA 3DDIA 4NLOA 4PR6A 1AUDA 2H48B 4ZHRB 3MM9A 3DU6A 4WYWA 1KLMB 2IJRA 3MD1A 2BRKA 3OTOF 3BZQA 1FKPB 3VAFA 2HGNA 1B7FA 2KHCA 1W2IA 3UN2A 3MM6B 3JQJA 2EBEA 4M63A 4NYPA 4RJVA 3PYEA 1P9YA 3PW4A 3G82B 4NMXA 1N88A 2UUWA 3TARA 4L73A 3R3TA 4O3RA 4KGKA 5KAKA 3LA0A 4QIWD 3OPKA 4I2PA 2IHR1 4B3RJ 1F9FA 1PBUA 2HFSA 4F67A 1K0VA 4QR1A 4U95A 4NZ7A 2ASDA 4MNRA 4IDKB 2P9GA 1LEOA 4DFPA 1WTBA 4P72A 2FPHX 4ECWA 1I5OB 1YDLA 3HI9A 1J2VA 3WHIA 4ETZA 5B08A 3RRGA 2HHHJ 2PT0A 2LQ9A 2VPYB 5DRKA 3S01A 1U8SA 2H1YA 2Y1RI 2KYXA 2RE1A 5I3QA 1U1NA 1CPZA 1RE1B 2CDRB 1F9HA 3KK1B 4EMDA 1YKWA 1KOOA 4K50A 2YVSA 1KC8T 4U7UK 3CUNA 3ZNUA 4AE5A 2BOAA 2VU5A 1KOHA 2EFNA 4QWDA 1J5OB 5KFAA 4QU7A 3OXFA 3M6UA 5JJBA 1JLAA 4M5DA 2A1BA 3MEDA 5KT4A 2CQDA 3HPOA 1P1TA 3UDCA 2QA4G 3GZ7A 3QO9B 4Y2AA 2LLZA 2KVQE 3QGPA 4DPUA 4J5OA 3KLFB 1KQKA 1YIJS 2BQRA 3UQSA 2WW8A 1TQLA 4DWIA 4ECRA 1NPPA 2MTLA 2RNEA 3AOCA 1NHVA 5DM7Q 3PG9A 2EK1A 1VHIA 1T02A 2FJBB 3QWPA 3I96A 1C4CA 4H54A 3G86A 4K4VA 1RWVB 3EQVA 4F26A 4LQ9A 3MMCA 5J2MB 3W8PA 1IJFB 3ZTOA 1RTJB 3TZYA 2W9CA 4RW8A 2A18A 3ZC4A 5KOWA 3SYZA 4OL8A 1RT6B 3K0JA 5C24A 1TL1B 1B3TA 4ECYA 4DZDA 2XG8A 1BXNA 1DTQA 2B8PA 2OTJS 1QVGR 3HHLD 5E3CA 3EYZA 1FRIA 3IR5B 2ZH2A 4O44A 2B51A 5AXLA 2GJ2A 1CG2A 1HQUB 1O0PA 2FVSA 2UP1A 1FRJA 4JBFA 3ILIA 3OR1A 1Q82T 3KJVA 2AJQA 2RIJA 4ZCIA 2FVPA 1TL7B 2AX0A 2YWKA 6FD1A 4DUZJ 1UL3A 4Y00A 3KJFB 5GMDA 2LECA 2B5JB 3LP0B 1P8GA 2RDIA 3HULA 2VH7A 3KMSA 2CUYA 3HVTA 3MM5B 4NXNJ 1ZH5A 3G71S 1F2GA 4LF9F 1HBNA 1C0TA 4WK1A 4TLQA 4HVZA 3TAMB 3JYTB 1VIOA 4B9LA 1MWSA 4G3IA 4DV1J 1VLOA 1LWCA 2WVDA 3UNGC 2K2PA 4OZJA 4ANEA 2RUSA 2XULA 2DXEA 4RU9A 2JNJA 3NNHA 4F3OA 3JSYA 2QTWA 4Y34A 3FDSA 3KLIB 1N34J 2W8LA 2WW4A 3VTIA 2RHQB 3W9JA 3V4IB 3I4HX 2ALZA 3J80U 1DFDA 3FKBA 3OL6A 4USIA 1GT8A 1Q8BA 4E8UA 5HI7A 1WEXA 3IO1A 3KMQA 1TKDA 2J9DA 3N5FA 1C1BA 3AOBA 1R0AA 3JSBA 4B08A 2QFIA 1WHXA 3OVSA 4I0WA 5BYQA 3QT5A 1FDDA 4QWAA 4PUOB 3WZ0A 1VK3A 2V2VA 3IGNA 1S0MA 4Q8EA 1UVLA 1L3KA 2OKQA 3T6JA 5HAOA 4OZ3A 5KFPA 5ETVA 2VG6A 5IC6B 3QRPA 1FTRA 2AEFA 1EIYB 2WVEA 4I6AA 3GQCA 1DQ8A 1FRXA 2J9DE 2FQQB 4J9UE 4OFZA 1CC8A 2Z4PA 4IRDA 2VC0A 2HWTA 4OJ1A 3QT7A 3OFFA 1U2FA 3G96A 3BGUA 1VBZA 4TVAB 1S6OA 3MD3A 5E3AA 3DHWC 4C8YA 4LBHA 2VQEF 1VQQA 1L3VA 4X4NA 4JI6F 4OZNA 4AL6A 1HARA 4CO0A 1FXLA 4MFBA 1KHVA 3LGNA 2R2UA 1RHQB 2B4OA 4LFBJ 2KI2A 3BO4A 3VCDA 2YKPA 4DF4A 5IOLA 4J9OA 5L8RC 2OFGX 5EDWA 1GXUA 2BE9B 4ZVUB 5DG9A 1CJKB 4CO1A 3W60A 4DQIA 4A8MP 2C3YA 1FO1A 1WEYA 3H5SA 1OY9A 3MFIA 2BJ8A 3QNWB 2OMOA 3MUTP 4XK8C 3MM7B 4ED7A 3D2WA 5IQQA 2EK6A 2JRSA 4OVDA 1E6YA 3UW1A 2XYGB 2VD3A 1SBRA 2WZ1A 1MWYA 1S1UB 5F9LA 1SIWB 2XLIA 4LR9A 3GWCA 1XTZA 3LP2B 2MQOA 1F5AA 2BACA 2MQNA 1EP4B 1NKBA 1G6BA 5KFYA 2WB4A 1YTYA 3GYXB 3N28A 2VONA 4C3LA 4DSFA 1LFWA 4KT0C 4OI1A 1QSSA 2B9EA 3VHQA 4DXLA 4R0QA 4RA7A 4MKYA 1NH7A 3H2VE 3EZUA 1T05A 2WADA 4DR1F 2BZ2A 3BSCA 4DX6A 1M1GA 2J7KA 3C6UB 2IDLA 3T41A 3MWBA 1A6LA 3KTQA 1QDUB 2L3MA 1Q8LA 3TWZA 2HGLA 3P49B 3JQMA 2CRLA 4IFVB 1TKXB 2A2CA 2RU3A 3PM9A 4OYMA 3RBDA 4RL1A 1UFKA 1SQGA 3SXLA 1R7IA 2NZ4A 2F4FA 1SKRA 2Z2LA 1UEUA 2V8VA 3QSIA 2JZ5A 3R2CJ 2V8HA 1Y00A 2LA4A 4HI1A 4DPWA 3HO1A 4HKQA 4O0IA 1BWVA 3IG1A 4ZVTB 4LSLA 2FJXA 3M6XA 4PG4A 3LGMA 4ALZA 4LBPA 4NOHA 2HFNA 1RK8A 1GH8A 5HMXA 5FLXU 3TANA 4ZP9A 3LOUA 1JXEA 4WFYA 5CD4H 5DQIA 3C14B 3E3XA 3OLBA 4C6AA 5A2QY 3UPOA 4IQXA 3W5YA 1RISA 3K5LA 4M95A 5K8PA 2K3IA 2I9SA 3DFEA 1SL1A 4CJNA 1RT7A 1S9EB 1UEVA 3W64A 5IV3A 2IJNA 4WFNQ 1WORA 4Z37A 4K2XA 5L1KA 4CO5A 2DGTA 2DXDA 5HATA 1S6QB 2DEIA 4J91A 5LXRA 1KQSR 1TKTB 5CYJA 2QMXA 2CG4A 3AT1B 2CJ9A 1RB0A 2CJBA 1O8BA 2JEGA 2LKZA 1YJRA 3M2VB 4NL5A 3ZZOA 3ZZZA 2J6SA 2G1DA 4QJGA 3JSMA 2DHAA 3W5ZA 5D4OA 2YNIA 5BYRA 1FX2A 4LQ3A 2DO0A 2ZH5A 2RS8A 2OD4A 2B56A 1VC5A 4NX9A 4N76A 3CCUS 1F2HA 1JMTA 5ETOA 3MTJA 3Q23A 3M2RB 3EX7B 2B4VA 3ZTRA 2E7WA 2V8GA 3VWSA 1Q8KA 1YJVA 3X1LB 2GIQA 1S1WA 2YPYA 4KV8A 5CYQA 2ZVSA 4ILMA 4QIVA 4I56A 1X8DA 1HWKA 2UV8A 4HLBA 3FFIA 1FRHA 4RWWA 4NPOA 2L48A 3B78A 4USMA 1V5IB 3J81Y 4LF6F 4OJGA 3A1YG 5ETRA 4X64F 2P9EA 4JI7F 2GNKA 1GXTA 4RW9B 1KFDA 4UUXA 5RUBA 4AL7A 4B17A 3TUZC 2J0WA 1MWTA 1UFWA 4RNFA 2VUGA 1CC7A 2OGUA 2O3DA 1RAJA 3W62A 3HHLC 3NGTA 1Y5LB 4OYXA 3TVZA 4URGA 1C1CA 5IWAF 4WFXA 3VQTA 4OLPA 2MQ8A 1NAQA 3OSNA 3CJRA 4HHHA 1GX6A 2W7AA 2AZ3A 2CKWA 4P9SA 1RAOA 4Z7YA 3A3PB 1ZETA 4WZMA 1PAUB 2CPXA 4O4GA 1NU4A 1VBYA 2IM0A 3RJMB 2VQEJ 4JI6J 2FZCB 1DTTB 1TV6A 3ET6B 1H72C 2YQ0A 3RBXA 2KFZA 5KFIA 2UUCF 1FXRA 3FUYA 4CIOA 2CNKB 1KWMA 2ZVIA 2L9DA 2FTRA 1PG5B 3MM8A 3NNAA 5M19A 4QIEA 1PCAA 2D9PA 2COLA 2PIIA 5HL7Q 5M18A 2Y8YA 1RAAB 1Z4UA 4RUCA 4K4WA 1WC6A 3W2WA 1NSAA 1YGYA 4X4OA 4O3PA 1NHUA 3AD9C 1U48A 2LQJA 3HCXA 1JLEA 2HQCA 4NZ6A 2M3DA 3KLVA 3RTVA 1R8PA 2DTJA 2KJVA 3CIMA 2E1MC 3RB0A 1X9SA 3DU5A 1F0XA 2QLJB 5J2NB 2R7SA 4AFFA 2N7CA 2HS3A 2UUTA 4DSLA 1O51A 3OTBA 2VG7B 3RU0A 1GQEA 4JUZA 2DNKA 2FC9A 1LK7A 4L72B 3ZZTA 4LMZA 1QTNB 3VGSA 3N0VA 3UE2A 5T41A 3ZTSA 4DL7A 5CQGA 4UW2A 4WFAQ 7FDRA 2HK3A 1LW0B 1RT5B 1TR0A 4ECUA 3KHLA 3M8YA 4NLXA 3UVJB 4OHWA 4H4MA 4M5GA 2F9DA 4MK9A 3QQCD 2MKSA 4I64A 2LEAA 3V4MA 4NXMF 1AYEA 3OHBA 1TVRA 2JHEA 4IR9A 2BM1A 5E3PA 1H74A 4GC6A 4PXCA 4ECSA 2IRUA 1RWPB 3MDFA 3MAAA 4I7FA 2J5AA 3CVKA 4ZPBA 3BGRB 1U2CA 4URQU 4C48A 3EZ5A 3LANA 3KLEB 2M0GB 1E6VB 2WAFA 2ZDOA 4DR3J 2HHTA 2ZZMA 3IC1A 3GR1A 1B0TA 4MYUA 2K06A 1SJ1A 3CCWA 4NCGB 4O23A 4QZVB 2OI2A 5DG7A 3AD7C 4YB1P 3JB9k 3MM9B 5E3RA 4NASA 4P2XA 4RBUA 2ZH1A 2DNNA 2Z2YB 4EWTA 2DY1A 4FS2A 4FPIA 4F2SA 3DXBA 3OTCA 2D1CA 4H4KC 3DNCA 3M6VA 4KKOB 3PO5A 1U1PA 1TL3A 5HVFA 3NOCA 1HD1A 2VV5A 4IQMA 2FIUA 5IT4A 1Q86T 2N3OA 5G0RB 2GQ2A 1S7HA 1IKWA 3RRHA 3MR5A 1UW4A 2HEKA 1R43A 2OPPB 2G1HA 4FNHA 3VAKA 2H4YB 1S0NA 2CXEA 3Q86A 1NKEA 1JB0C 2ZEJA 2R2SA 4UQTA 4EEYA 4ELTA 4YR3A 3RR7A 2YXLA 2HVIA 3CCTA 4DV3F 4J9QA 3GYGA 4CYUB 2KT3A 1IBMF 4RW7B 3AHPA 4Y2CA 5LXYA 3NCRA 2Q6CA 1RXOB 2D3OR 1B0PA 3MR7A 2IMWP 1RWXB 3MCMA 2ROEA 3LPYA 4CLKA 3MHYA 4LF6J 3CC4S 1PBAA 1UJ4A 4JI1J 2IA0A 2PEBA 3PW7A 1UFLA 4JI7J 3THVA 3B54A 1QSLA 2LEBA 1RU1A 4Q5VA 2BX6A 1CSJA 2DHSA 2GMLA 2Y0SD 3OBIA 3PHTA 3P5TL 3DI6A 4J9SA 3NWGA 3V5RA 4UY85 2AT1B 5K20B 1BQMA 3KDNA 1T95A 1K25A 1J5EF 2HSEB 3CCMS 1QM9A 3MPWA 1QUPA 5IWAJ 1FRKA 3B6BA 2QEXS 3MMCB 2GAGC 1HNIA 1YJNS 4LF5J 3V6DB 1NSKL 2W9CB 1ULRA 5EN1A 2CZVC 4K0KF 3MECB 1K73T 5F8HA 3V2UC 3HSGA 3CT9A 4U67Q 1QAIA 2CJKA 2QL5B 3A4TA 3D28A 4ED5A 1PC4A 5KFTA 4RZRA 2LA6A 1EZZB 4O44B 5IT9Y 2H5EA 2CPYA 2QX0A 1S48A 5C2CA 2DH9A 3UDVA 2UUAJ 3D1QA 3GPAA 2GJIA 4IG3B 4F25A 2M70A 5B0CA 2RDDA 2UUCJ 2IAJA 4O3QA 2C3MA 4OX9F 2QYGA 1B64A 4TYBA 8ATCB 2Y1LB 4P71A 3T1HJ 5B0GA 2IRYA 5BXIA 4DOZA 3HVTB 4QIFA 4N5SA 5KFDA 2JOQA 4BC9A 3D54A 4G1PA 2WAEA 4DV6J 5C5JA 3T1AA 3EGVA 1RTHA 5K5MA 2EFGA 2Z0GA 4I2QB 3GSDA 1OIAA 4F7VA 2KFYA 3SSRA 2XMKA 2CWKA 5DGBA 2HRUA 4PWDA 4ZVEA 3LUYA 4OZ1A 1NMEB 3ZFZA 4PQUA 4R5PA 3OR2B 3E01A 4ENOA 4CNYA 2C2DA 2ZH9A 2UUBF 4USTA 2HKEA 3DMJA 3RZAA 4CLUA 5HLFB 4MMOA 3HSJA 3CCZA 4WYLA 4FS1A 2W2OP 2XWYA 2XMUA 4P52A 4OI3A 5F8GA 4NZ0A 1T03B 1IQZA 1RT2A 1HNVA 2W2PP 4K4UA 4YB6A 1REVB 3PVXA 3FRYA 3ZZRA 2NREA 3C15A 2ZHAA 3U27A 3HHLB 4KO0B 2GO8A 2PMWA 3HKWA 3BR9A 2G0CA 3GJTB 4G1IA 4MKBA 3F56A 2R8JA 2ROPA 1Q78A 3ENAA 2XSJA 3MPUB 5DGAA 2CQBA 3QSYB 4KRWA 5AT1B 4RW6A 3BQ2A 1I94F 3U1NA 3H90A 3NRBA 2NXCA 1U1KA 1IWGA 3EGWB 2B6AB 3POTA 4ZJQA 4UF4A 4CO3A 1RHUB 3GIRA 1RTDB 1IM4A 5JUMA 2DISA 4KH0B 4EU0A 1Z2LA 4X66F 6AT1B 4KJIA 4CTAA 2I1RA 4CLSA 2AHOB 1U02A 1NJYA 1KVIA 2R2RA 1VQPS 2YNHB 3K8VA 1CVJA 1Q95G 3G8QA 4DV0J 1CQMA 2DNMA 3QZ8A 2OLWA 3MAHA 3TQEA 1FDBA 2YWHA 1I1GA 1VDHA 2RS2A 4DN9A 2GW8A 4F3QA 3ITHA 2Z2MA 1N33F 1X5OA 5M1AA 1RYRA 2DO4A 1T3OA 3DXSX 3UWTA 1JLCB 2IFXA 1F60B 5K9FA 3J81U 2CQHA 4KPCA 2C3UA 3RGIA 1WG5A 1X4EA 4Z2XA 1FE0A 3SDEA 3DRPB 2LU1A 3VZIA 1FFSB 9ATCB 4H4OA 4ED8A 5KFMA 2M2BA 1S79A 5LL6d 4FF2A 1D8YA 2CQ2A 2XY6A 2UU9F 3L09A 4LF8F 1BGXT 5J2QA 2HHUA 1UEKA 3DOMB 4RX6A 4PYAA 2FHJA 4CZCA 1B7YB 1TELA 1T05B 2CVEA 1FE4A 4I6YA 4M8LA 4N1XA 2KG0A 3R8YA 1S1XA 4DV3J 5D3GA 3W8GA 5L9NA 1IBMJ 1QD1A 1M1KT 3OXGA 1HBUA 4W92B 4OYIA 1MWRA 2PI4A 5GAGI 2KXFA 4M5NA 1YRUA 3SQGA 2NXUA 5IM0A 5F0UA 2K7JA 1CULA 4YFUA 2R2TA 4YDDB 5BJRA 3MOJB 3N4WA 2IM1A 3SCJE 5KT7A 1DLOB 4KYZA 3IG1B 5DQHA 4UTGA 3HLUA 1U1RA 1UWBA 3OVAA 1J5EJ 1S0VA 2JDJA 4O4RA 5A8RA 5I42A 3CJQA 1JLBB 2V9KA 5CZXA 2AJ0A 2GGPA 1HR0F 2XZWA 3LO3A 5A8KB 2DYAA 3LO7A 4KGVB 4FYYB 1WSVA 2HHVA 2HWHA 1IKVB 2OH2A 2HMIA 1O5JA 3TA0A 2ZZTA 5ITHA 3G6ES 1PIEA 2CPDA 2DRDA 4ZHRA 4X4UA 2XLKA 4ZCKA 1KLMA 2XHCA 3AH6A 5B0AA 5AXMA 4A8XA 1KFSA 1KHWA 1AXQA 1T3NA 3FCHA 3EM1A 3AFGA 4ZPAA 5FDLB 3K17A 1AT1B 3KHHA 4YN3B 3VAIA 2XY5A 1FWPA 1HNZJ 4OX9J 1J27A 5GMEA 1VBKA 1HNWF 3OFGA 1R8HA 2HQIA 3BEGB 1VK8A 4YY3F 1KSPA 1IQTA 2YNIB 2F40A 2FZKB 3DKDA 1SC6A 3ENWA 4P73A 3A8KA 2WBRA 1U0HB 1RDRA 4IDKA 2IYGA 3JAMY 5BYSA 2ZHOA 4UZCA 2FHOB 2HVZA 3D4JA 2DCLA 2NLWA 1XN9A 4C98A 3PRDA 4ZP8A 4RW4A 2PO4A 1YJWS 2R9LA 4ER8A 4RNNA 4MTPA 3GFYA 1HIYA 1RLDA 2J8AA 2LVWA 1CEZA 1D8ZA 3KK1A 3FFIB 5FIIA 2VOPA 3MR6A 3QBCA 2DIVA 5KG0A 1FDAA 5M2PA 1RAFB 1U1LA 2XMTA 2ZBPA 4PZVA 1URRA 5T7LA 2YY3A 1HBOB 2QSWA 2J6UA 2E5GA 2DPIA 5DLGA 4R0EA 3CDWA 2GHPA 1FA0A 4B3OB 3M8QB 3ZO7A 3ONQA 5CAAA 3NBPB 3LALA 3TYTA 3K2YA 3KLFA 2QLBB 2AZ1A 3CEDA 3HVWA 3ZZ0A 5HSPA 4JI3F 3QJPA 1VJWA 4TLRA 4CO2A 4GKKJ 2SXLA 5L1IA 1TUWA 4NA3A 2FVQA 5L38A 1FKAF 4DS4A 5KFWA 4OLOA 2DNPA 1U49A 4KGXB 3GG0A 2KB2A 1EHWA 3CJ5A 4Y2IA 2HFZA 2CAJA 4KY3A 5J2MA 2PD1A 5DLFA 1RTJA 3BBFA 1TV6B 2X1AA 4AXJA 3SCIE 2FLOA 2MLZA 2CYYA 1TL1A 1EQ0A 4ZS6A 1NK6A 4DR4J 1T9TA 1RBAA 4F2RA 2JX2A 1MWZA 2GVDB 5KG7A 1QTMA 4ECTA 3K57A 2XNRA 1AFJA 3GB0A 1HQUA 1ZAXA 2J0SD 3MM8B 3BDEA 2WAQD 3PW5A 2DH7A 3H2LA 2Q79A 3TQ1A 3OTEA 1WI8A 3T9ZA 3R7NB 4IKAA 1FHTA 2JC0A 2CQ0A 1TL7A 1RWMB 4DUTA 3HZEA 3H5XA 2FB0A 4JI4F 1RAIB 2XB2D 2OP5A 2P2CB 1EQMA 4KIAA 4LF2A 1NK4A 4QBUA 1SC3B 2F3JA 3TAMA 3JYTA 4C11B 1RABB 2CG8A 4WU3A 2W2QP 3K5MA 4LVOP 3TP2A 3KLIA 2BXJA 4RU2A 4O3SA 2AU0A 4BL3A 4LFCJ 4ECQA 3V4IA 4B3MJ 1GTEA 2XMJA 1QAJA 4YHHF 1NK7A 4JI5F 2N4DA 3H7HB 4ZCMA 1N32F 4FPRA 1PSDA 2KYZA 4PABA 3OL7A 1D3WA 4USWA 5B7WA 1UPMB 4PUOA 3F44A 1TFWA 4NEZA 3PO4A 2RQCA 1VR6A 2J8SA 2YX4A 3HFKA 3FVYA 4OI2A 2W9AA 3BB5A 4QR2A 1S99A 4LRCA 3FSYA 2LDYA 3G8SA 1WHWA 1B0VA 4WP8A 1LV5A 3OC2A 4OHZA 2EKYA 3Q8VA 4FXVA 2VICA 4ANCA 2V34A 2DNOA 2UXBF 1U7LA 4ED6A 4MJKA 4OHXA 1SL0A 4JOUA 4K4XA 2GVZB 1XK8A 2E9RX 4C8ZA 2FYXA 2MQQA 3K5OA 3NS6A 5KSHA 1HR0J 3ADAC 4WBFA 1RCXB 3CDBA 3CJ8A 4KFBB 1WSRA 3EMTA 2HURA 3HT0A 2MKIA 3AQOA 1SXLA 1RZMA 4NLYA 1Q4RA 2B7BB 3ZTPA 1O6XA 1U26A 2J0XA 1NO8A 2C3PA 4WFBQ 1EETB 1WDDA 2BOPA 5D4PA 4DR7J 1CJKA 2W8KA 2VPWB 5IT0A 1LK5A 1TL3B 2AJ1A 1TTHB 3MM7A 2PMZD 4DSEA 2HBQB 4NLRA 1RP5A 4RBVA 4ZK7M 4Y0FA 3D1HA 4M94A 4DR2J 1TK5A 4AD6A 5F8MA 4DS5A 3M7VA 4L3NA 2MZRA 3LP2A 1G1XA 1YJTA 4YY3J 1EP4A 2HWIA 1H7XA 3DLGB 2BYCA 2HFVA 4X4RA 2JEFA 4ZPCA 4CRJA 5AE1A 5HQ8A 4DCPB 4EBEA 3V6HA 3TUPA 2E29A 2NR0A 3MMAB 4O3NA 3C6UA 5ETSA 4OIXA 1I6JA 2Q3PA 3FK4A 3I56S 4K4SA 3MUMP 4IFVA 3IRXA 5JVHQ 4HT7A 1TKXA 4Q45A 3G9CA 3T19A 3R2DJ 5DZ6A 3VR1A 4DQSA 1XMBA 4FF4A 1HA1A 5KG6A 3GFXA 2AEMA 3MUVP 1SKWA 4V19X 3NKYA 2VFUA 3WX4A 3PXGa 1L5UA 1Q81T 1D9FA 2FZGB 2DCUB 4M5HA 1ZZFA 3THTA 3C6TB 2YKQA 4JI2J 1FVQA 3CE8A 4ICLB 3J7YI 2FY1A 1F5BA 3K89A 2OPSB 1VQ9S 4TN2A 4TY8B 3PYDA 1GK8A 3VVTA 3Q24A 2HGMA 3I0SA 3SZ2A 2BQ3A 3I87A 3GCXP 4IFYB 1Y11A 4CT9A 3AXMA 1VS3A 3DDNA 3LQVA 1N36J 1N52B 3Q22A 2HLTA 3C14A 3FGVA 3IBFB 3CW2C 3UPPA 2A10A 2KHDA 4R25A 4QR0A 1ELOA 2ZH3A 2ZH8A 1LWXA 1S97A 4HHJA 4N41A 1FRLA 4BWJA 2ZJPQ 5KFGA 1S9EA 1IM6A 2JSXA 2R7VA 4U7CA 2E44A 2Y3YA 2DR6A 3A3OB 1S6QA 4DV4J 3NMAA 4J9NA 2W7OA 4F50A 1TKTA 4TY9A 3I31A 3CD0A 2UVWA 2BJDA 2Q43A 1NHKL 3C66A 3GJQB 1HW9A 3M2VA 4L74A 4B3RF 4JI4J 4FF1A 2GAHC 1RWOB 4JBCA 1IBKJ 4CM0A 1ACMB 2BKNA 4PWDB 2AGQA 1N4LA 2V67A 4CLFA 1QAXA 3EE3A 5E5NA 2VFRA 3A8EA 2YPZA 4R5PB 2XLJA 3BQ0A 2GA7A 2KM8C 2BEFA 2ATCB 3I6PA 5I3PA 3T5LA 2YTCA 2MKCA 3P96A 3M2RA 8RUCA 4B9SA 1WKKA 1VQKS 4DMZA 2FLPA 4ILRA 4YB5A 1A7GE 4F36A 3IWNC 3BN4A 1RWWB 1SUQB 3JSRA 4ID5B 3TRGA 3TW0A 2HBYB 3LWLA 3DYAB 4Q2LA 3B4MA 5LSOA 2GS8A 5ETQA 1SJRA 2GO9A 2QMWA 1N32J 1HNVB 1R8CA 5HN0A 1PJ5A 1IVZA 4YOEA 1JX4A 1JK9B 4P6QA 3GE9A 5CHCB 3E2EA 1WKJA 5KFRA 4RW9A 1WHVA 3MMBA 1MG7A 1MROA 3ETMA 3L3CA 1RT3B 1JJCB 2MJUA 2RQ4A 1LXNA 1WKLA 4XIUA 1H7WA 1B99A 2IBOA 3RB4A 3OJSA 2XS7A 4A8OA 4DPTA 2KZZA 2VJUA 3HDSA 1LWEA 4C8LA 1K0TA 1L3TA 1XBWA 2EFVA 4DKIA 4WPAA 2AD9A 4CTAB 4UOHA 2XGPA 3T1YJ 1U2RA 3IS9B 3F73A 1DTTA 2HNYA 1SKUB 3VAHA 3MPVA 5D8HB 2IVMA 1VRQC 3W65A 3ET6A 4AYBD 3KHRA 3PTWA 3PKMA 1RHRB 3GIJA 5LM7E 3B4DA 4C97A 2V69A 5HVHA 1YZ7A 3MCSA 1YBAA 3HT3A 1SC4B 4N77A 5I3UB 3M6WA 4DUZF 3CC2S 2CNOB 2KU7A 1KKHA 3R27A 3FJ2A 3J7ZT 3A3NB 3W66A 1S0OA 2G13A 3Q8RB 5C42A 3WIVA 2W4PA 3D0IE 2DRAA 4OYOA 2YNFB 1GAOA 1NDPA 4CLLA 1HL6A 5CH7B 5IV4A 1VQYA 4FVMA 3KK2B 2QRRA 4WTOB 3I32A 4DL3A 4FDFA 5DJBA 3V6KA 1N56A 1FNOA 4KC5A 1YJ9S 2BJ3A 1YLXA 2Y0BB 2DGQA 1WC4A 5HMZA 4WFZA 3L9ZA 3HFZB 4USUA 3P3DA 4DSJA 2E1CA 2V4QA 2OJ3A 2XBPA 2VG7A 5JXSA 4EO8A 3HSZA 2HQ3A 2X3GA 1U1MA 3RG6A 4XO0A 4LF4J 2DGSA 3R5BA 2RVJA 2ASJA 3FMBA 2QA2A 1WC3A 3E8OA 2MPUA 2XMWA 4J7CA 4D3HA 4X4PA 2RILA 1XJWB 4ZVPB 2YKAA 3KLHB 1JJ2R 4NA2A 2HRYA 1LW0A 1RT5A 3ILLA 4MAKA 5D4NA 3CD6S 4X4VA 1PYOB 3UVJA 2G4BA 5KFNA 4NLGA 1H2VZ 3H2UB 2BE7D 3KJNB 5HQLA 3Q8PB 5L1JA 2CZ4A 2FJEB 4RPFA 4OQJA 4EYHB 4RKUC 1NJZA 3SIPB 2IJFA 3RAXA 4GRSA 4QW8A 4A46A 4CP5A 1R8BA 4B9MA 3BGRA 3R9LA 2NSBA 3OJUA 3H25A 3CIZA 1A9NB 1VMBA 3KLEA 4DL2A 4KGZB 4QIGA 4MIWA 2XCAA 1E6VA 1F1BB 1IKXA 2HNZB 4LF7J 2WSCC 4LFBF 3O3LA 3BREA 4W4MA 1HI0P 2MEWA 4NCGA 4LIRA 3OQ2A 2H51B 2C1EB 3CD5A 4RLEA 1KONA 4KHPJ 2V8DA 1Q7LB 2MMYA 1KN6A 1R3NA 2MLXA 4IO9Q 2ZD1B 1IBLJ 1VISA 2DXFA 4JYAJ 2M88A 4FYDA 3PR4A 3AA8A 3R1LA 3QJLA 4FXWA 1VQ6S 3NAIA 2K1RB 4KKOA 4M5KA 1X0FA 3DLKA 3M4XA 4DX5A 3OUYB 3DCAA 1RBLA 4USKA 2KVIA 3SFUA 1ZPWX 4WCEQ 2EPIA 2C2NA 3L95X 2E7VA 4DPOA 4BBYA 5G0RA 3NWRA 3GIIA 1H0HB 2WHOA 5K14A 1NB7A 5LSLA 2VA2A 4U8YA 4ECZA 3HZGA 3C3LA 3IA0A 1RWKB 2OPPA 4KH1B 4IH7A 2DD8S 4RW4B 1B4SA 1X4AA 4C8OA 4DL0C 1X31C 2EI5A 3PHEA 4OJHA 1DQ9A 1DJ0A 3DRYA 4E2FB 3PV8A 2CPZA 1N5QA 3QAUA 2BJ1A 2F5GA 1SQFA 4CYUA 2D3O1 3KK3A 1K8AT 1T9XA 4RW7A 5T7LB 1Y5IB 1XNRF 5EWFA 2XZTB 1CS4B 3VALA 2ZOFA 1VQSA 2M7SA 4QU6A 1JLGB 3PJXA 4DSKA 5H9EJ 3AJ2A 1X0PA 4HACB 4IYQA 1WF0A 3A8IA 3W2VB 2AYEA 3GP9A 2ZH6A 5DQGA 3NGRA 4I6WA 4NLDA 1WD6A 3UN7A 1M5KC 3KUHA 1RSCA 2QIFA 4EZ9A 4P75A 4JV0A 3US5A 3CC7S 4F02A 2F8EX 3V6DA 2OSQA 2MZ1A 2C3OA 2BMBA 2HS0A 3MECA 3DLEB 5A0YA 1WOOA 2H5IB 3KYLA 5HROB 4PEOA 1EX8A 1NLKL 1YVFA 3OFHA 1S57A 4KR0B 3M2UA 1IR0A 3OL9A 3H20A 1TP7A 1BLUA 2RH3A 4WK3A 1G4CA 4IG3A 2AEJA 1D09B 4HHUA 4FNIA 4DQQA 2DGVA 3P4UB 1RWNB 3QPIA 3QIPB 1YI2S 2KO1A 3RYLA 2LP4A 2V2QA 3IMQJ 3Q8QB 2QL9B 1CLFA 2RRAA 2JC1A 2KJWA 5HO4A 1NEEA 4PPZA 1X5PA 2HHXA 2OTLS 5DDPC 4I2QA 2KM8B 1I3OB 1CJUB 3JQKA 2YKNB 1UAWA 2W25A 4DX8H 1V6HA 3FMWA 3GCWP 3CJ0A 1FESA 2X7IA 3OR2A 3QMQA 3PX6A 3QATA 2LU2A 2B0GA 2LMIA 1UZDA 4DX7A 3MI7X 1HNXJ 3F0NA 1NPRA 2UVVA 3NXZA 4Q2MA 2LXUA 4HTIA 1Y10A 2AF6A 5HLFA 2AYGA 2B4UA 1UKUA 1RI7A 3HVRA 1H98A 4BS2A 4MKVA 3MF5A 3ZNJ1 2R8IA 3NGSA 2NXNA 4DF8A 1NDCA 3BR8A 1T03A 5M2RA 2W7PA 1GXLA 2V8PA 1S4FA 1REVA 1RU2A 2G0JA 3PFEA 5MAOA 2HVHA 5D15A 4X62J 2X1GA 5EX0A 3HHLA 1UCNA 1FXDA 2EBGA 5DM6Q 4KO0A 3KG4A 4I69A 3AA9A 3GIMA 2PSZA 3CCES 1LOUA 1HWUA 1WF1A 2ZJQQ 1RTIB 1GMVA 4CPKA 3VZHA 5CCLA 2HIQA 4OYWA 2B6AA 1VQNS 5KG1A 2KRBA 4PXDA 3RB3A 2VASA 1RTDA 4FXDA 3R7SB 1UVJA 3PIPQ 4WKYA 2MKHA 3CCRS 3W1YC 5EX3A 1SQEA 1LXJA 3AD8C 1XEZA 2R8HA 2YNHA 2JH3A 3UR0A 1SVDA 2V9WA 4QJVA 4LRBA 1Q5YA 3EXCX 4AT1B 1F9EB 2V6AA 3SV4A 5CABA 5F8JA 1V3SA 3MURP 4AXIA 2R7WA 2YKMB 1JLCA 5AXNA 3Q8UA 4IUFA 3T6BA 5KT3A 4ED3A 2QGFB 3G87A 3CXCR 1H3DA 2VFVA 4A8SA 3N9UC 4EK2A 2Y1IA 3J81j 2QE5A 1W7WA 3DRPA 2DGOA 4CH0S 3PY8A 4C3MA 3CB4A 2UVUA 4LFAJ 1NH8A 5KFKA 4ZLPA 2V5HG 4LREA 2NUHA 3DOMA 1QE1B 1TMJA 1ROFA 2ZM6F 1OYDA 2CPEA 3N79A 3BQ1A 5IXUA 2XMAA 5HMYA 4YQWA 5D0RA 4ED4A 5AJ3J 2HZCA 2NZCA 2WB1D 3IRXB 4FYWB 4PXEA 5IFMA 2V63A 4OYBA 1BWEA 2W2NP 2QA4S 4LRDA 1XNRJ 3LAMA 5GADU 5A76A 1T8EA 4F4KA 1MN7A 3D6HB 4DQPA 4TQSA 1IKYB 5A6PA 3DOKB 1OSDA 4C2MA 2F4VJ 2QZ8A 2C2RA 2LCWA 2G0IA 1KQFB 4NMLA 4CM2A 4F4WA 4ZIWA 3EQUA 4DHVA 3DRRB 1TMMA 2MHNA 4QWBA 3R97A 7FD1A 1DLOA 4DQRA 1ZTTA 3I0SB 4OX7A 1ZM2A 3AOAA 4ED2A 1V5VA 3BH7B 3D3CJ 1DHMA 4DR3F 1JLBA 2CJAA 5KT2A 5A8KA 2FVRA 2AV5A 3OT9A 3W7BA 2KXHA 3QJJA 4N47A 3DC2A 3WBZA 2MZQA 2RD5C 1OWXA 5KFVA 3J80Y 2ZDPA 2DR7A 1IKVA 3P5BP 4HDHA 2FHKA 3UN5A 2ACMA 2GHVC 4MKAA 4BC7A 4B02A 1ZS6A 5FD1A 2BRLA 5J1NA 1K1QA 4ATNA 4CWBA 1HQEA 1YBTA 3OD2A 4H4KA 3ZZYA 1YWXA 2AIRB 3BGOP 3KKFA 4CQ1A 5LMUJ 4TKTA 5FDLA 2V4JB 1IR2A 2IC3B 1N0VC 3M9OB 2X3DA 2R4FA 3TR5A 2XCPA 5LJ5Y 1U24A 2WCXA 4DI6A 1HHTP 2V0NA 4ELVA 4NCBA 1U0HA 4DL5A 1UW9A 3R1HA 4QWEA 1WOPA 2DNQA 3LH2S 2I5JB 1LW2B 1S7IA 1X9MA 3KLGB 1N54B 3PCOB 1U47A 4U8VA 5KFUA 3TEHB 4U96A 2YNGB 2I2YA 2F9JA 2V4RA 4YEAA 1F6TA 5KFLA 4Q0BB 4ES2A 3R5JB 1X9WA 2DIUA 2D69A 1ZM3A 2A6OA 4JI1F 3KG0A 2RSQA 2DVIA 2FDNA 3R5GA 2CA9A 1T9UA 4X65J 1HBOA 3CWJA 1XNQF 2EFQA 3MMBB 2ROGA 4UUWA 5F3TA 4QW9A 1Y5NB 2J9CA 4ZVHA 5FJ4A 1MROB 2D74B 4QOTA 4B3OA 1LFPA 3M8QA 4UQGA 2B9YA 4PCQA 4Z7CA 4Y28C 3NBPA 3DN9A 5HBMB 5AXKA 2DR5A 1HBMB 1ZYQA 5BR8J 2KRRA 2R7TA 4LJMA 3ICLA 5LMNF 4RUHA 3ISZA 5EWEA 4LF5F 4DPXA 3U7JA 1LWEB 2VBZA 3DGPB 3QIDA 3SSQA 1S6PB 2JVRA 4C9DA 3ZFVA 4U9RA 3QLHB 3G6VA 5HJXA 1SH2A 2DHXA 2XZDB 2BJEA 5L39A 4C8NA 4LF1A 1ZA1B 2EG1A 3LGHA 2HNYB 3IM9A 4FVCA 2GHWA 3KNAA 2Z57B 1EAYC 2UUAF 1P27B 3UPFA 3CJ2A 2GVDA 4ZN3A 1JKHB 3THPA 4GO5X 1MU2B 2O1PA 1Q0NA 1W26A 1UMJA 3T1HF 4KSEB 1SC1B 1BUXA 2Q6BA 1YX2A 2EW9A 2C42A 3LWMA 5C42B 1YG0A 3BGLA 2KXNB 2WVBA 1WJ9A 5ADZA 3PW2A 4DV6F 3GV7B 3KNGA 2V2ZA 2Z30B 1NK0A 4C7QA 2XHWA 5EGYA 2NXEA 3TNVA 2AW0A 1QMEA 1S12A 3TZWA 4C11A 4OV6A 1GMUA 3PZPA 3K5PA 2RRNA 2WSFC 2XYPB 5FLXY 1Q16B 5IQ6A 6FDRA 4RNHA 4KE5A 3FSIA 2JLFA 4DFMA 4K8RA 4J9PA 1D0EA 1VRUB 3IAS9 2LDIA 5F0WA 2ZM6J 4NA1A 9RUBA 4NE9C 2KDOA 2BE2B 3UDLA 3CDAA 4WE1B 3D0HE 1T9YA 1NJXA 1NRKA 5E33A 4MT1A 3N5BA 3BF4A 5KG4A 3LPEA 3CMES 5L1LA 2DR9A 4ZP7A 3RB6A 3KDOA 2VIHA 5J1EA 3LAKA 3V81B 1WF2A 3ENQA 1FWKA 2ZC4A 5LT5A 1KVJA 1S9GB 1Z2ZA 2ZH7A 1TUVA 3TI0A 2W4DA 3CCJS 2LQ5A 3MCOA 4NEYA 2GZOA 2DEJA 4JV5F 2GVZA 1LWFB 3GJSB 2O5DA 1IKXB 4UY8T 2R8GA 5F9NA 1BE4A 3DLLQ 2DR8A 4NLQA 3HXMA 4P2FA 1AZSA 2ASLA 4LUBA 4YB7A 2E1RA 4KFBA 2BW2A 4DV0F 4ZA1A 2E5JA 1D9DA 1CJTB 5KFCA 4ZPVR 1PJ6A 3T5JA 2F65A 1EETA 1FT8A 2AJ4A 3BS9A 2R7QA 2WTFA 3J7Z5 3RBEA 2E5IA 3DLKB 4GVLA 3H42A 1TL4A 4R0JA 4AQYF 1Y4ZB 2CJQA 2UXCF 1FI4A 3IRWP 3UFCX 4HDGA 1SKSA 3FBFA 3ZG0A 2XY7A 5E41A 3GFHA 5DZ7A 5K14B 4LSNB 4ZVOB 2PFFB 1PKUA 2UXDJ 2V50A 3L7OA 2W24A 4EBDA 3H98A 3DLGA 5LOQA 2E5LJ 2QSFA 4A8KA 2OPQB 4KBIA 1RCOB 4CNZA 4WIIA 5DETA 2XMVA 4EUVA 3M9MB 2BM0A 4K59A 2HAFA 1VHFA 3MMAA 1Q5VA 2YWFA 2XMMA 3ILJA 4DN0A 3CJ3A 1ZOTA 2LFVA 1NK9A 3KK3B 4KB7A 2LYVA 1VC0A 1GFWB 2BBEA 3KUGA 2RJZA 5KT5A 2AYBA 2IMOA 1HMVB 4OYAA 4RUBA 1F5CA 2DK2A 1CQNA 4LBIA 2EG2A 2ADCA 4R8UA 2DITA 4G1QB 2H3EB 4OZ0A 2L08A 3D7SB 2CADA 3AODA 3IFEA 1XNQJ 4IRKA 1KBRA 2EC0A 3W63A 3DLJA 4ED0A 3WIUA 2QO3A 3C6TA 5D4LA 3IBWA 4ICLA 3DM2B 4NCAA 4E98A 2NUUG 3HD2A 2OPSA 2M8DB 3RR8A 2FJDB 1GNKA 1XIQA 1JWWA 3M1VB 3WDOA 4TY8A 3TA2A 5LMNJ 2DNGA 1PYTA 1PYYA 2XTJP 1MNEA 3ENVA 3OL8A 4RWXA 4IFYA 1XMOJ 1U6ZA 2CZ9A 5A0YB 2GCFA 2ZNYA 5KFEA 5HK4A 4NLWA 2DKOB 4F0HA 2EVZA 3NS5A 3AB4B 1PJ7A 1R31A 3R6LB 2VB6A 1KEKA 2YH0A 2C2ZB 4A8QA 2OAUA 1RBOB 4CLZA 1S49A 3M2UB 3HM9A 4BWMA 1JLQB 1DBDA 3LP1A 3GV8B 3M8WA 2C2EA 3QGHA 1V3RA 3WX8A 1W25A 1JJ4A 4OX8A 3CDEA 1C0UA 3GMGA 1HNZF 5CXTA 2E1AA 1FCAA 4RR5A 3M8PA 4J9RA 4RNMA 3B8HA 1DARA 3I9V9 3SCKE 5GADI 3TZZA 5GAEU 5CCMA 1UVNA 3LF0A 1RKIA 3O2IA 2I6WA 3SQOP 5A8WB 2R8KA 4UOCA 4ZN1A 2HNDB 3NL0A 2VPXB 2VQFF 1N5SA 2RB7A 3QWUA 4KHMA 2MGZB 2IM2A 3D6TB 2VPZB 2GV1A 4DR5F 1QAYA 2GMHA 1PYSB 4FBUA 1R6VA 2QC3A 3NGDA 2MQMA 2ZH4A 2QL7B 4TU7A 1JLFA 4DUYJ 3SEOA 1IN0A 1RAHB 2RKIA 1SUQA 5KG2A 2ZFHA 4ID5A 3MEGB 3H8YA 3FQKA 4B9NA 3DYAA 1LNQA 3C8YA 5A2QU 4V19J 1FJGJ 2H9ZA 4DV7J 2R3VA 4ZITA 5B0DA 3EDRB 2JFKA 2NPFA 1U1QA 2UVRA 1ZZNA 4ZVSB 3MR3A 5KFXA 5ETTA 5B09A 4QYZJ 2O66A 5EUHA 1RKJA 5ETMA 3AB2B 1NXIA 4ITSA 4CLYA 2G2ZA 5KFHA 4GKKF 2OPRB 1RT3A 4CLWA 2ZBIA 2ADBA 1SL2A 2O67A 2VKZG 5H9EK 1RACB 2AJ2A 1JXVA 3FCWA 4NLPA 2F63A 2FVCA 4HEA9 4P2MA 3GU0A 3MMJA 3KUEA 4KPYA 2QN6B 1RUSA 1WG4A 3QGGA 5KG5A 4JV5J 3MEEB 4C0HA 3S7RA 3M05A 1WACA 1HYSB 1UZHA 3NCQA 4L3KA 3IS9A 4ES1A 2PFDA 2PDAA 4DR4F 5HP1A 2ERRA 3Q0AA 4CH7A 2XS2A 4MIBA 3NMRA 2NPIA 2ZE2B 1ZAVA 1OS5A 4J9KA 1HI8A 2CQPA 1JNZB 4Q7AA 5E3QA 2J9EA 3R7BB 2GJFA 1U09A 4DDFA 5I3UA 1FTCA 2BDPA 2DY9A 4OX6A 4YR0A 4FP9A 2LQ8A 5M2UA 4AQYJ 3OTOJ 2RRBA 3B82A 2UXCJ 1AW0A 4GC7A 4L6V3 4X4TA 5F41A 3G2XA 4IG0B 4URSA 2YNFA 1UA1A 4B3SF 2ZBQA 2KFNA 2EXUA 2HYIB 1S59A 3KK2A 5THWA 3D6FB 2U1AA 3OV7A 4BCAA 3T9NA 5AE2A 4LFCF 1Y0HA 3BPSP 1TK8A 5I4MA 4B3MF 3EVMA 2APOA 4WP9A 1U6FA 5GAHU 1CBKA 3C16A 2FGCA 2IY5B 3I0RB 3TVYA 2HG4A 2NCKL 3BN7A 2CJXB 3OVBA 4USVA 2RDJA 2A2DA 1PC5A 1HWJA 3FRZA 3DGVA 3IBCB 1APSA 3I5CA 1RT4B 1QUVA 2FC8A 2GMJA 3A8JA 1KDNA 1S1TB 5B0BA 2DGWA 4I1TA 5KFJA 2KT2A 5IZHA 4F0MA 3N6LA 3KOAA 3M8ZA 2J0QD 1U1OA 1YBUA 2B43A 1QJHA 2Z8QA 2Q1LA 3OFEA 1TAUA 1RLCL 3KLHA 5C25B 3MCNA 4ED1A 3KWMA 1WI6A 3AQPA 2BV3A 4J90A 4DFJA 1ITPA 2WBMA 3TZXA 3BKTA 4PQAA 2MXYA 2IBKA 2VC1A 2IIHA 3PNIA 1TZ0A 1YRTA 4BLGA 3C2PA 5SZTA 2HHSA 4D3GA 4Y6IA 4WIQA 2A6MA 1SH3A 4XPEA 1SV5B 4P2SA 5IC4B 2HNZA 1F3FA 2LXIA 2HQGA 3CCLS 1YK9A 2YWGA 1H6KX 3BPDA 2KN4A 5L9XA 4YR2A 3PIOQ 3HVAA 3ZG5A 1OJ4A 1TL5A 3ULHA 3QGIA 4DR7F 2OLUA 2NYIA 1HQEB 1H73A 3R6GB 3DRSA 2ZD1A 2E9TA 2ZWPA 4LRAA 5KFFA 4O3OA 2XI3A 3QT8A 1KTVA 2WOMB 4DR2F 3WC0A 4ZIVA 2K1RA 1YJUA 1UWAA 3OUYA 4R3JA 4RO0A 3O5TB 1N48A 1FNXH 1NM2A 1GX5A 1CJVB 1K47A 2ILZA 3P6YC 4N8OA 5F8NA 3CMQA 2XC9A 3VVUA 1FK9B 2PMHA 2VQFJ 1KS2A 4ECVA 3M8SA 5DO2A 5F8IA 2OFHX 4DG1B 4DR5J 2DT9A 1T9WA 2KL8A 4LF9J 1BQNB 2MSSA 2MSTA 1IWAA 4OI4A 4R23A 3ISND 4ZJLA 4DU7A 4LT6A 2L9WA 2ZOGA 1YHQS 2YQ3A 2OLVA 3TA1A 4DV5F 1SI9A 1CS4A 1T94A 1JLGA 3SBMA 4GO7X 1RJJA 4NLSA 2Y1JA 3K7RA 5ETPA 4JI2F 3CCVS 1P6TA 4HACA 2IA6A 3W2VA 3MZIA 3BBCA 3EGZA 4YMEA 3DOLB 3CJKB 5E0OA 2AGOA 1R89A 1BY9A 2L41A 1NCLA 1FFGB 1HQ2A 4F4XA 1KR4A 2D41A 3SMZA 2MKKA 1RT1B 3IXQA 5F3ZA 2FGOA 1URNA 3JTPA 1N36F 3FEZA 3HSDA 3VGVA 1T7PA 3K59A 4EO6A 3Q8YA 2H54B 1FX4A 3FCVA 3DLEA 2Q66A 3PW0A 3H5YA 3D67A 4WF9Q 2AWZA 2UZAA 3CJTA 4NI2B 5HROA 3R5DA 3MFHA 2HLUA 1XC9A 4MK7A 4A48A 5KTQA 4NWBA 2HVDA 4M5JA 5KFSA 4DV2F 4PKDB 2CQGA 1S72S 2BANB 4WU2A 2VKRA 2MLYA 4DLGA 4PYDA 4DV4F 2A0FB 2HPUA 5GAGU 4MH8A 1AA1B 3S8SA 1IR1A 2GIRA 4FN5A 5EHHA 1VRTA 4DSIA 5CD4A 3OSPA 2ACYA 3AXKA 1UTAA 4TXSA 3QIPA 1IBKF 1MLAA 2W9BB 4ZDNA 4BDPA 1U0SA 3BDPA 1S1VB 2CPIA 1N5YB 4Y2KA 4IRCA 2QA1A 2YQ1A 1VIXA 1AROP 3MTKA 1NJWA 4B3SJ 1VQOS 2VF3A 1S77D 1QMFA 1HHQA 1NZAA 1CJUA 2RUGA 5J2PB 3L4BC 2DNRA 3FQLA 2YKNA 2JFDA 4JI0F 2ZBRA 3Q83A 4L75A 1ZBTA 1F3VA 2EWHA 2YWWA 3A13A 1DURA 2MQPA 4DL6A 1VQLS 1FNMA 3EICA 1L3SA 3IM8A 3S1TA 2JWNA 1FKOB 4DR1J 4LSZB 1REGX 3RUBL 3GG1A 3KG1A 1RHKB 5J1EB 1HLWA 5E7OB 5IT9U 2FY8A 5CYMA 4ELUA 4LR8A 1NB2A 3D5MA 2AYMA 2GQCA 2ZUGA 1OO0B 2JVOA 3QFHA 4CLTA 1FVSA 4C0OC 1NZ8A 1HPZB 1UP1A 1RHJB 4PRFA 2HIYA 3OW2R 1VBXA 4U6PA 1TKZB 4ZPWR 1R8AA 2VG5B 2XQCA 3MPYA 5GAEI 2HHQA 3NEKA 2D9OA 4M5IA 1RTIA 1QVFR 1S76D 3M32B 3PYGA 5KFQA 1ZPVA 2MYFA 3T1YF 2JEIA 2RF2B 3EVOA 4KAIA 1AZSB 2HHWA 1SB6A 1RA6A 3MGJA 3VAGA 3BJYA 3GIKA 1FERA 4FZVA 2DHHA 3BO2A 1BQXA 2YBVA 2I0XA 4ZVQB 3SCLE 2P8IA 2D3ZA 1IBCB 5ETKA 4PAAA 4KTQA 3SFGA 2CQCA 2X1BA 4DBQA 3NS7B 5CZVA 3M8RA 2MZTA 3FEYB 3IAM9 3IP0A 2U2FA 3HFVA 4Y65A 1FJCA 3Q8SB 2M8HA 3HX9A 2YKMA 2NSCA 5G4DA 5KFBA 3U1MA 2WK4A 3EPIA 2NYHA 2N3LA 3I4PA 2OD6A 1S4EA 3H4DA 3N01A 4F4AA 3K58A 5DG8A 4CDIA 3M30A 1JXLA 3X3UA 1G3OA 4I2PB 2BJ7A 2NXJA 3KFWX 3BSNA 2PGCA 1M1HA 2GC8A 1X5SA 1FEHA 4PG5A 5KFOA 1QE1A 4MK8A 3PEJA 3UD5A 5H1SV 4LF4F 1IUJA 1MMNA 1Y9OA 2VBXA 1IJEB 2BUNA 2OEJA 2AP6A 4C0BA 2VODA 3R5CA 4R8UB 2WVCA 2KT5A 1VI7A 1YZ6A 4DV5J 2UV8G 4IOBA 1S10A 1IKYA 1XWLA 1JLAB 4M5DB 3CJ4A 3DOKA 1B70B 4NYOA 3NGUA 3CGIA 1RTZA 3HKZD 3MEDB 2QLFB 2FD2A 5DDQC 2J76E 2KH9A 4X64J 4FBTA 2OEKA 3DRRA 1OPIA 4U7UD 2DRBA 5B0EA 1KQGB 4P7VA 1FDNA 3O44A 1V3ZA 2XI2A 3KJQB 2CJYB 1YITS 1KRPA 4LF7F 2PI5A 4ZVGA 2HVEA 3AAWB 5IS2A 1X4FA 4BHQA 1S5ZA 2DNYA 5GMKa 2MY7A 3TO8A 3CO0P 3GONA 1WEZA 4ZOSA 3HHNB 4RW8B 1XR5A 4KHPF 2CQ3A 1RYSA 5C24B 3LP1B 4FKYA 5GAHI 4C3KA 1WELA 1RWUA 1Q79A 4PWWA 1IBLF 2WONA 1C0UB 4JYAF 1A0OB 3DWKA 1DTQB 4DV2J 4IH6A 2HS4A 2BABA 3TEGA 2EC2A 3M8PB 3VF0B 4F04B 1FD8A 3GILA 5KT6A 1ICEB 3U1LA 3L7PA 3OR1B 3GSIA 5HJYA 2HRTA 3HHKA 2V4JA 2IC3A 3GYNA 3ISNC 1SPBP 2DNZA 3KJVB 1NJIT 4V1Ak 1MWUA 4C8MA 2BA9A 3J7A1 4IOCQ 2O01C 4EYIB 1RA7A 2CQ1A 1YJ7A 4FF3A 2X1FA 3ZTQA 4WXWA 5D77A 5GVQA 1TAQA 2GQQA 2J7WA 3KHGA 4CH1A 2XO6A 1HBNB 1C0TB 4IR1A 2CNNB 3WQPA 1KLNA 4JV2A 2W2MP 1LWCB 3GTYX 2I5JA 1RGVA 1JLFB 4JI0J 1LW2A 3HF5A 2OHDA 3KLGA 2RKIB 1JQGA 1K9MT 2P6TA 2YNGA 3CNQP 3UN3A 4WKRA 5MLCV 1OSCA 2B9WA 4Q0BA 2VDHA 3I9ZA 4X4SA 1AUSL 4N56A 4HL9A 1C1BB 1R0AB 3IWXA 3JS9A 2HW3A 4JP8A 3PJ9A 4DFKA 2BR0A 1N5TA 4KGMA 4GKJF 5T14A 1SCJB 4I67A 3IGVA 1W2BR 1S6UA 4A8YA 1EB0A 5HBMA 4E0DA 1HBMA 3H0PA 2VG6B 1VQ7S 2MQLA 3ILOA 2FHJD 1DZ5A 2HFOA 5H9FJ 3LW5C 4S0MA 2MJNA 1FJ7A 1RHMB 2YX7A 3DGPA 4NXMJ 3TJ8A 1NDLA 1S6PA 3NAHA 1UVIA 3QLHA 4ZLJA 1UVKA 1ZM9A 4MYTA 5HP1B 3JAMU 1H38A 3EPGA 2R7XA 3VAJA 4F4YA 4ZVFA 3DLBA 3EXYA 3PFOA 3DHXA 4MFBB 3Q89A 2FUG9 1VOMA 2NS1B 4ZJOA 4ID8A 4B9VA 2E5HA 2B3TB 1X4BA 1JKHA 4FYXB 3S6EA 1MU2A 3L7UA 2VA3A 2RQKA 3N6MA 3RRKA 1OY8A 3D68A 1DY3A 2RHSB 2Z58B 1E6YB 1M5VC 3J7YU 2V2KA 4KHRA 5DS7A 2VOOA 4HI2A 3AY0A 3TUJC 1G2EA 3EVWA 3W9HA 4ZPDA 3MR2A 4EFAC 2NQPA 2MZJA 1HNXF 2MHEA 1PAEX 4OMFG 3NOGA 4OI6A 4F4ZA 4ZKAA 2W4CA 3C16B 4DCJB 1PILA 2YWEA 2K3KA 1VQ4S 1VRUA 5HANA 2QJ3A 3FBBA 3HJFA 1DQAA 5SUHA 2LXFA 4GVBA 4CT8A 3BSOA 2BE2A 2BQUA 2AQ4A 4WE1A 4I4BA 2B4PA 4UZBA 4X2BA 4Q43A 3HP6A 4ERDA 1EKRA 2QG9B 4J9LA 1WWHA 3QZ7A 3I55S 5ETNA 3LTOA 1UA0A 2AMCB 4X62F 3OTDA 3TVKA 3JXOA 2ZKTA 3V81A 2M5YA 3NNCA 1VYAA 2PE8A 3K8WA 4UT4A 1WC5A 1WC1A 4O0NA 4ANDA 4HTJA 1S9GA 3VSKA 1UVMA 1BHNA 4DZ6A 4QYZK 1JJHA 3NY0A 5KOXA 3UD4P 4IO1A 4L76A 1TU0B 2V68A 3UDEA 2RQMA 5LSRA 2WSEC 4TNOA 2M52A 5E2QA 3G6YA 4JI8F 1LWFA 4LSLB 1R0CB 2R7RA 2CPHA 4FYVB 3ZZPA 2VHGA 4NLTA 1N6QA 2CQIA 3CDUA 4OJ3A 1SJ4P 1FRMA 3HHDA 4B9UA 2JL9A 2DBBA 2GX8A 2CFXA 1AFIA 4K0KJ 1HHSA 1CJTA 3FZBA 3BO3A 2OSRA 4Q44A 3DRSB 3N6NA 3QT6A 1OYEA 4M5MA 3NCPA 2OO4A 1RT7B 3CO9A 1HI1A 2EFOA 1MMLA 1YRXA 2AX1A 2ZWOA 3TAQA 3HK2A 1FKPA 4DR6F 5KG3A 3MM6A 3T5KA 3FBCA 1FFWB 3MPDA 2HK2A 3NP5A 3G82A 2XNQA 4LSNA 4LFAF 2EFPA 2GFFA 3JSMB 4LIWA 2HBRB 2ABYA 1X60A 3PJWA 3UO0A 2ZUAA 4HT5A 2ZZNA 5D78A 4NLVA 3VGTA 1WDTA 3BYRA 1T0TV 1VQ8S 2OPQA 1M5PC 2XSFA 1H2UX 2VBYA 1R0BG 5AJ3F 4P74A 2H65B 4G6VB 4OZ2A 3CCSS 1S1WB 4CO4A 4KV8B 4YDXA 4K4ZA 2HFUA 5CYQB 2FJVA 4C4WA 5D0GA 2F1FA 2QLXA 4QQBA 3BKFA 2UUBJ 1YSJA 3W9IA 1HMVA 4NRUA 1Y7PA 2MDAA 4K5SA 1Q7YT 2C2OB 3EWGA 2BKOA 5D6GA 1EARA 1VJQA 2F4VF 3O8WA 4G1QA 4USHA 3UCUP 4AL5A 1EJ7L 3PDNA 1X7VA 1H2TZ 2QFJA 1J5OA 1FD2A 4F3MA 1TK0A 4GKJJ 2FLNA 4F8RA 2IVYA 2FHMA 2IYIA 3BM7A 3PKYA 3DM2A 2WRMA 3QO9A 2CQ4A 5K8OA 1BC6A 3TOQA 1KNZA 4DPYA 3M1VA 2RT3A 1C2PA 3CSKA 1HFEL 2XO7A 3FBEA 3E51A 1C1CB 3H4BA 4TYAA 3EGNA 1X5TA 4RNOA 2FJAB 1I94J 3EJMA 4IOAQ 4J37A 4O4GB 3C46A 5ETLA 3KXDA 5K8MA 4PWUA 4X66J 2JEJA 1JLQA 1RT6A 1VC6A 3I5AA 3CTRA 2K8GA 2R42A 5LMUF 4OHVA 2HQFA 1VRTB 2ZKUA 4CI0B 4A47A 1U45A 3PACA 1JIHA 3BV8A 1OQ6A 2DNLA 2RAQA 2HZAA 1P9QC 3BBBA 3D1OA 3PR5B 3T5HA 1N33J 4UOGA 4WZQA 4B3TF 4PG6A 2F7VA 4X84A 5A8WA 3CULA 1NBEB 2HNDA 5HVGA 3W2WB 3H40A 2B5JA 3LP0A 2MGZA 4ZVRB 5A6WA 3HJVA 4P7TA 3HMJG 5KFZA 2YX1A 1WUUA 1HW8A 3MM5A 3PRBA 1JLEB 4EZ6A 3K5NA 3VV2B 2HZVA 1GMWD 5JVGQ 1R6YA 2UU9J 4LF8J 1HWIA 3OLAA 4P10A 3J7AN 5F8LA 4RUAA 1X4DA 3MEGA 1MSWD 2CNLB 4X65F 1T11A 2YKOA 3D66A 5CYMB 4EGLA 2JLGA 2D3UA 3EUNA 3UCGA 3UI3A 4N8NA 2OELA 5CA5A 3SSSA 5JMNA 3BH6B 4HR2A 5BR8F 1TFYA 1M5HA 2G2YA 2I38A 1M90T 3GLJA 4QYRA 2OPRA 1ZM4A 2IVFB 2KKHA 2CPFA 1UJ6A 2VBWA 3GJRB 4H4MB 4ZPTR 3UE3A 1QSYA 4DLEA 2PC6A 1TVRB 3DRXA 2VJVA 1RAEB 4QPTA 3MAAB 1FEEA 4TU8A 3MXHP 4HYKA 1NK8A 2N7YA 4I7FB 3O1LA 3UPNA 3QRQA 3MEEA 3G4SS 4JI8J 4USJC 2Y8WA 3CD7A 1WC0A 5AE3A 1HYSA 2DPJA 4OYZA 1S9FA 3D6MB 3AJDA 2H5JB 4CCHA 3I5BA 2OUGA 3TX8A 2JJ4D 2ZE2A 4XDCA 1NDKA 1UETA 2VFTA 4ECXA 3W3SA 4LRFA 4PG7A 2EKNA 2PEHA 1RADB 1GMWA 3UD3P 5EWGA 3RW7A 2M4MA 3VSLA 3GFZA 2DHGA 4K7QA 3QFWA 1MMDA 2YH1A 1XERA 3D0GE 4XDDA 1U6BA 3IR7B 1Z1ZA 2Z56B 4DR6J 4R1GA 1R27B 1M5OC 1BMQB 4IG0A 3M30B 2XS5A 2C22A 1MN9A 1S1UA 5C2GA 2ZITA 1HNWJ 1IKWB 2J6TA 4OV1A 2FJWA 3JTNA 2R7OA 4A4JA 1EKSA 3BSAA 2IDEA 1G7CB 4A8FA 1OPZA 3UR3C 4Y3CA 2Y9HA 4RBTA 2BVZA 3ZZUA 2ATLA 3ELHA 3I0RA 3CJSA 2QT7A 2ZC3A 1M0SA 1UPPA 2F8MA 3ZXWA 2QLWA 4WP3A 1RT4A 1D1UA 2ILYA 4A8WA 4W98A 1S1TA 3I82A 4GMKA 4OI0A 3M9NB 3Q2SC 2E7XA 4WXOA 1LQ9A 2ASYA 1JNRB 3UNYA 1SIZA 1L3UA 2Z2ZA 2AGPA 5C25A 2V94A 5B0FA
chains in the Genus database with same CATH topology
2LXIA 4KKOA 3VQSA 3CCLS 1X0FA 2YWGA 1H6KX 1JB0C 3DLKA 1GTHA 3M4XA 3OUYB 2R2SA 4UQTA 1NKEA 2KN4A 4EEYA 3DCAA 4ELTA 4XPCA 4YR3A 5L9XA 4YR2A 3RR7A 2A3JA 2KVIA 5K8NA 2HVIA 3SFUA 1ZPWX 3HHEA 3CCTA 4WCEQ 2EPIA 3PIOQ 2PA8D 2R7UA 3ETOA 3DI6B 3HVAA 2MKJA 3NGKA 3ZG5A 1TL5A 3L95X 3QYYA 3ULHA 4DV3F 3QGIA 2MB0B 4J9QA 3FZ2A 1Q1KA 4DPOA 4DR7F 2OLUA 2NYIA 3SI8A 4Q8FA 1BQMB 4BBYA 5G0RA 2KT3A 1IBMF 1HQEB 1FF2A 4RW7B 3AHPA 2OIHA 4Y2CA 3GIIA 5LXYA 1H0HB 2P6SA 1SJFA 2WHOA 5K14A 1NB7A 5LSLA 2OMLA 3NCRA 2Q6CA 2VA2A 2D3OR 3DRSA 2ZD1A 1B0PA 4ECZA 5LJ3Y 3HZGA 3C3LA 2IMWP 2E9TA 2CVIA 3IA0A 2ROEA 3LPYA 4C8KA 5KFFA 3MHYA 4O3OA 1HNIB 2XI3A 1KTVA 2OPPA 4IH7A 2DD8S 3CC4S 2WOMB 4RW4B 1HD0A 1UJ4A 2L9NA 1SV5A 2IA0A 4DR2F 5DDOC 1X4AA 3WC0A 3PW7A 1UFLA 1YJUA 2K1RA 4C8OA 2I8EA 4DL0C 1QY7A 2EI5A 1U25A 3PHEA 4OJHA 4WTYA 3OUYA 3THVA 1DQ9A 1DJ0A 1QSLA 1XMQF 3DRYA 2LEBA 4R3JA 2IRXA 2E66A 3PV8A 4Q5VA 2GMLA 1CSJA 2CPZA 2DHSA 3O5TB 1N5QA 2Y0SD 1Y3KA 1N48A 3OBIA 3QAUA 1FNXH 2WONB 3P5TL 3DI6A 1GX5A 2PN6A 4J9SA 1RQ0A 3NWGA 3V5RA 1ZAWA 4UY85 2ILZA 1DRZA 3TAPA 3P6YC 4N8OA 5F8NA 3CMAS 4JV1A 1BQMA 2XC9A 1FK9B 1T95A 2PMHA 3KK3A 1K8AT 4BL2A 1KS2A 4RW7A 1K25A 1J5EF 5T7LB 4ECVA 1K1SA 1Y5IB 4ZCLA 3M8SA 1XNRF 3CCMS 5DO2A 5EWFA 3UCZP 1QM9A 3MPWA 2M9KA 5F8IA 2OFHX 4DG1B 3VALA 1QUPA 2ZOFA 1VQSA 2DT9A 2M7SA 1JLGB 4QU6A 4ZP6A 1FRKA 3MOZA 2QEXS 3MMCB 4YP3A 4QWCA 1HNIA 1YJNS 1M5SA 2IAJB 3PJXA 4KQZA 3V6DB 4DSKA 2WOMA 2W9CB 4ZMMA 3FSXA 2IM3A 1ULRA 3VAMA 5EN1A 1BQNB 1Q53A 2CZVC 2MSSA 1Y3JA 5H9EJ 3MECB 4K0KF 1K73T 2QV6A 5F8HA 2MSTA 3AJ2A 3V2UC 1X0PA 3QAEA 4OI4A 4R23A 4IYQA 1WF0A 4X4QA 2UXDF 3W2VB 2AYEA 3Q2TC 3IWLA 3T3FA 3CT9A 2XGQA 3O6QA 1VQ5S 3ISND 4U67Q 1QAIA 2CJKA 4AUKA 2AJFE 2MY8A 2ZH6A 5DQGA 1PO6A 3D28A 4LT6A 4ED5A 1PC4A 2L9WA 2ZOGA 4I6WA 5KFTA 1YHQS 4RZRA 2E5LF 4NLDA 2LA6A 1FK9A 1WD6A 2YQ3A 2DB1A 2OLVA 3UN7A 4O44B 5IT9Y 2H5EA 3TA1A 1RTHB 2CPYA 1S48A 1M5KC 4DV5F 1SI9A 2QIFA 2DH9A 4DG1A 3D1QA 1UJ5A 1T94A 4OZLA 4EZ9A 4JV0A 1JLGA 4B9TA 2GJIA 3US5A 4GO7X 4IG3B 4F25A 1PGZA 3CC7S 2M70A 2JLEA 2F8EX 5B0CA 4EBCA 2IAJA 2OSQA 3V6DA 4F02A 2MZ1A 2C3OA 2D7SA 1RJJA 3DDKA 4NLSA 4NRTA 2MZSA 3NG8A 4OZ5A 3AJ1A 2Y1JA 2HHHF 1BQNA 4PQUB 2HS0A 4O3QA 3MECA 3K7RA 3DLEB 4JI2F 1VLYA 2B9XA 3E01B 5A0YA 3CCVS 1P6TA 4K4YA 2C3MA 4OX9F 2IA6A 1B64A 4TYBA 1N8RT 3W2VA 2QYCA 3MZIA 2ZJRQ 2K7KA 5B0GA 2F8HA 2IRYA 3KYLA 3EGZA 4DOZA 4YMEA 3DOLB 3DMJB 3HVTB 4QIFA 5HROB 5HMWA 4N5SA 2B7CB 3CJKB 5E0OA 2AGOA 5KFDA 2JOQA 1R89A 4BC9A 1SJ3P 5DDRC 1YVFA 1BY9A 2L41A 1YQHA 3OFHA 3D54A 4G1PA 2WAEA 2G9OA 4F4XA 5C5JA 3T1AA 4KR0B 1KR4A 2D41A 1RTHA 3M2UA 3SMZA 2MKKA 1IR0A 5K5MA 2EFGA 1RT1B 2Z0GA 3OL9A 4I2QB 3GSDA 1OIAA 3H20A 3IXQA 4XAKA 1TP7A 2KFYA 1BLUA 5F3ZA 3SSRA 2RH3A 2FGOA 2XMKA 5DGBA 1URNA 2HRUA 4DL4A 4WK3A 4PWDA 4ZVEA 2N4CA 3JTPA 3LUYA 3TUIC 4IG3A 1N36F 4OZ1A 1OQ3A 4OHYA 3FEZA 1RT2B 1T7PA 3K59A 4FNIA 4EO6A 4DQQA 3ZFZA 4PQUA 4R5PA 3G6XA 3OR2B 3DLEA 2DGVA 3E01A 4CNYA 2Q66A 1X4HA 2C2DA 3QPIA 4HH1A 2ZH9A 3QIPB 3PW0A 1YI2S 2KO1A 4I68A 1WG1A 3RYLA 3H5YA 4WF9Q 1N5VA 2UUBF 2N82B 3MEKA 2ZNZA 2AWZA 2UZAA 3DOLA 2ZOMA 3DMJA 3RZAA 3Q8QB 4LVNP 5HROA 3CJKA 3R5DA 3MFHA 2HLUA 1CLFA 2RRAA 2JC1A 1C4AA 5HLFB 2PA3A 1XC9A 2KJWA 4Y2MA 4MK7A 5HO4A 4A48A 3UPPA 1NEEA 4MMOA 5KTQA 4PPZA 3CCZA 4NWBA 4WYLA 1X5PA 4FS1A 2ZBCA 1WTFA 2HHXA 5KFSA 4DV2F 2E9ZA 2XWYA 4PKDB 1XMOF 4YUDA 2OTLS 2XSJB 2P5VA 5DDPC 2CQGA 1S72S 2BANB 4WU2A 2VKRA 2XMUA 2CDQA 4OI3A 5F8GA 1RT1A 4I2QA 4K5RA 2KM8B 1Q8IA 4NZ0A 4DLGA 4DV4F 4RW6B 1T03B 2HPUA 5GAGU 4MH8A 3S8SA 2POKA 1IQZA 1XR7A 2YKNB 2GIRA 1UAWA 2W25A 4FN5A 1RT2A 4DX8H 1V6HA 5EHHA 3WC2A 3POTB 1HNVA 1VRTA 1VFJA 3FMWA 4DSIA 3CJ0A 1FESA 3OSPA 4K4UA 3OR2A 4YB6A 3QMQA 1REVB 1KTQA 3PX6A 2ACYA 2LU2A 4W90B 2B0GA 2LMIA 3PVXA 3FRYA 3SV3A 3MI7X 3ZZRA 4TXSA 1X4CA 2NREA 3QIPA 1IBKF 2UVVA 2ZHAA 2W9BB 1FJEB 4ZDNA 3U27A 4BDPA 3HHLB 4Q2MA 2LXUA 2LQBA 1WHYA 4HTIA 2AF6A 2KG1A 3BDPA 4KO0B 1S1VB 2GO8A 4TU9A 5HLFA 2AYGA 3HKWA 2B4UA 2G0CA 3BR9A 1UKUA 2CPIA 4G1IA 4MKBA 1N5YB 1NK5A 4Y2KA 2DJWA 1RI7A 3F56A 1P1LA 3HVRA 1H98A 1U4BA 2QA1A 2R8JA 2RU9A 1VIXA 2ROPA 4BS2A 1AROP 4IH5A 1Q78A 3MF5A 3MTKA 2XSJA 1NJWA 1VQOS 2BANA 1S77D 2R8IA 5DGAA 2CQBA 1QMFA 3IN5A 2LEPA 1VGYA 4KRWA 4DF8A 1NZAA 3BR8A 3NLCA 4RW6A 1T03A 3BQ2A 5M2RA 3NAIA 2W7PA 1QLNA 2RUGA 5J2PB 3ITHB 2DNRA 3U1NA 3FQLA 1I94F 2FLLA 2YKNA 2JFDA 3GR0A 4NYZA 3NRBA 1U1KA 4JI0F 1GXLA 3EGWB 2B6AB 3POTA 1VQMS 2X51A 4CO3A 1RTDB 1S4FA 3V6JA 1HWLA 1ZBTA 1IM4A 1REVA 5JUMA 2DISA 1BD6A 2EWHA 4EU0A 1NKCA 1Z2LA 3RAMA 3PFEA 4X66F 5MAOA 4KJIA 2HVHA 1DURA 4CTAA 2I1RA 2MQPA 2W9BA 4DL6A 2X1GA 1VQLS 1FNMA 5EX0A 3HHLA 1NJYA 1FXDA 1L3SA 1KVIA 2EBGA 5DM6Q 2R2RA 1KD1T 4KO0A 1S1VA 1VQPS 2YNHB 3KG4A 1ZTWA 3R5AA 3S1TA 4I69A 1X4GA 3AA9A 3K8VA 3GIMA 1N5YA 1CVJA 2JWNA 2PSZA 3CCES 4NXNF 1LOUA 1HWUA 3G8QA 4ILLA 1WF1A 1CQMA 2DNMA 3QZ8A 1FKOB 2ZJQQ 2OLWA 3MAHA 3RW6A 1FDBA 2YWHA 3FNNA 3SDEB 1RTIB 1I1GA 3IR6B 4TQRA 2RS2A 3PX0A 3G8TA 4H4OB 3GG1A 4DN9A 4DV1F 3KG1A 4CPKA 3VZHA 5J1EB 5CCLA 3CF5Q 2GW8A 4F3QA 2HIQA 5J2PA 5E7OB 3ITHA 2DH8A 2Z2MA 1N33F 1X5OA 5CYMA 5M1AA 4MIAA 4WJBA 4DUYF 2B6AA 1VQNS 4ELUA 5KG1A 2KRBA 1RYRA 3D5MA 4PXDA 2DO4A 5J2QB 2VASA 3RB3A 1RTDA 1T3OA 4FXDA 2AYMA 2GQCA 2ZUGA 3DXSX 3UWTA 1OO0B 1JLCB 1UVJA 2JVOA 1NNDA 2IFXA 1F60B 2DGXA 1N34F 1FVSA 4C0OC 3PIPQ 4WKYA 1HPZB 2MKHA 2DGUA 3CCRS 5K9FA 2KTQA 1UP1A 5EX3A 2CQHA 1SQEA 1LXJA 4PRFA 3OW2R 2C3UA 4J9MA 2KZMA 4M1KA 1WG5A 1XEZA 2R8HA 1FJGF 1X4EA 1VBXA 1XR6A 2YNHA 2JH3A 3UR0A 5J2NA 4U6PA 1TKZB 2V9WA 4DV7F 4ZPWR 1R8AA 2JEGA 4Z2XA 2VG5B 3MPYA 4QJVA 5GAEI 4PPDA 1S1XB 2HHQA 3F41A 5J1PA 1FKOA 2D9OA 3EXCX 1FE0A 3SDEA 1RTIA 3DRPB 2VZ9A 3MAQA 5D3GB 1QVFR 2LU1A 1S76D 3VZIA 4QPXA 3M32B 4ES3A 4K4TA 1WNEA 4H4OA 4ED8A 5KFMA 5KFQA 2M2BA 1ZPVA 1SH0A 1S79A 5LL6d 3SV4A 4FF2A 2MYFA 3T1YF 3JTOA 2JEIA 1D8YA 5F8JA 1HBUB 2CQ2A 2ZHBA 2J7UA 2RF2B 2XY6A 2DNHA 2UU9F 3L09A 1V3SA 4KAIA 4LF8F 1BGXT 2HHWA 5J2QA 2HHUA 3MURP 1SB6A 4AXIA 2R7WA 1RA6A 2YKMB 4NLUA 4RX6A 1JLCA 3SQGB 2FHJA 4CZCA 3MGJA 1SJQA 5AXNA 3OXLA 2VFSA 5IM0B 1T05B 4IUFA 3T6BA 2CVEA 3BGFA 4PG8A 5KT3A 3VAGA 1HPZA 3BJYA 2HAIA 4ED3A 3GIKA 1FE4A 1FERA 4I6YA 1H3DA 4FZVA 3CXCR 3FEXB 1N0UA 3PX4A 4M8LA 2VFVA 4N1XA 3BO2A 2KG0A 3CCQS 4A8SA 3N9UC 3RAQA 1TKZA 3H5UA 1BQXA 2I0XA 2Y1IA 2VG5A 2CIMA 4ETXA 1S1XA 3DLHA 3SCLE 2QE5A 2D3ZA 3DRPA 2DGOA 3PEHA 5D3GA 4KTQA 3M32A 5L9NA 4PXBA 3SFGA 1LKZA 4CH0S 4DEZA 3PY8A 2CQCA 3H59A 1UWBB 2X1BA 4C3MA 4DBQA 1M1KT 3CB4A 5CZVA 3OXGA 3M8RA 2UVUA 2MZTA 3FEYB 5A8RB 3IAM9 1HBUA 1N6QB 2U2FA 4W92B 1NH8A 5I42B 2RF2A 5KFKA 4ZLPA 1MWRA 4Y65A 1FJCA 2PI4A 2V5HG 3Q8SB 2M8HA 3HX9A 3OHAA 5GAGI 2NUHA 3DOMA 2GGPB 2KXFA 2C28A 2YKMA 1YRUA 2NSCA 3SQGA 2NXUA 5G4DA 1QE1B 1ROFA 5IM0A 2VL1A 5KFBA 3GV5B 2ZM6F 3U1MA 2CPEA 3N79A 1V9OA 2WK4A 2HHPA 2K7JA 5F0UA 3EPIA 3BQ1A 2N3LA 4DJBA 4YFUA 1DAXA 2P9CA 2R2TA 3I4PA 2OD6A 5IXUA 2XWXA 5HMYA 4QCLA 1MW7A 5U47A 3U02A 4YQWA 4YDDB 2HMIB 5BJRA 1D9AA 3H4DA 3N01A 3MOJB 4HH0A 3N4WA 2IM1A 3SCJE 2HZCA 3CPWR 5KT7A 1DLOB 3K58A 2WB1D 3IRXB 2RMLA 3IG1B 2XEXA 5DQHA 4PXEA 1IXKA 5IFMA 5DG8A 2CPJA 4NLOA 3M30A 4PR6A 1AUDA 1JXLA 4ZHRB 3X3UA 3MM9A 1G3OA 3HLUA 1U1RA 1UWBA 3DU6A 4WYWA 4I2PB 3OVAA 1BWEA 1KLMB 2QA4S 1S0VA 2JDJA 3LAMA 4O4RA 5A8RA 3MD1A 5GADU 3KFWX 3BSNA 2PGCA 5I42A 2BRKA 1T8EA 2GC8A 4F4KA 1X5SA 1FEHA 1JLBB 2V9KA 4PG5A 3OTOF 3BZQA 4DQPA 5CZXA 1FKPB 2AJ0A 2GGPA 5KFOA 4TQSA 1HR0F 1IKYB 2XZWA 5A6PA 3VAFA 2HGNA 3LO3A 5A8KB 1B7FA 1QE1A 2KHCA 4MK8A 3LO7A 1W2IA 3MM6B 3DOKB 1OSDA 2EBEA 4M63A 4NYPA 2HHVA 4C2MA 3PEJA 5H1SV 2QZ8A 2HWHA 2C2RA 4LF4F 1IKVB 3PW4A 2OH2A 2LCWA 1N88A 1IUJA 2UUWA 4CO4A 1KQFB 1MMNA 1O5JA 4NMLA 3TARA 2HMIA 4F4WA 1Y9OA 3EQUA 4DHVA 3DRRB 3TA0A 2VBXA 2MHNA 3R3TA 4O3RA 1IJEB 4KGKA 2BUNA 4QWBA 2AP6A 7FD1A 1DLOA 4DQRA 5KAKA 4C0BA 1ZTTA 2VODA 5ITHA 3R5CA 4QIWD 3OPKA 3I0SB 4OX7A 3G6ES 1ZM2A 4ED2A 2CPDA 4ZHRA 4X4UA 2XLKA 4I2PA 4R8UB 4ZCKA 2IHR1 1KLMA 1F9FA 4F67A 2KT5A 3AH6A 1VI7A 4QR1A 5B0AA 1K0VA 5AXMA 1DHMA 4DR3F 4NZ7A 4A8XA 1KFSA 2ASDA 4MNRA 1KHWA 4IDKB 2P9GA 1AXQA 1JLBA 2UV8G 4IOBA 1S10A 1T3NA 4DFPA 2CJAA 5KT2A 1WTBA 1IKYA 1XWLA