2ZC4A

Penicillin-binding protein 2x (pbp 2x) acyl-enzyme complex (tebipenem) from streptococcus pneumoniae
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
158
structure length
158
Chain Sequence
AKRGTIYDRNGVPIAEDATSYNVYAVIDENYKSATGKILYVEKTQFNKVAEVFHKYLDMEESYVREQLSQPNLKQVSFGAKGNGITYANMMSIKKELEAAEVKGIDFTTSPNRSYPNGQFASSFIGLAQLHENEDGSKSLLGTSGMESSLNSILAGTD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Penicillin-binding protein 2X
publication title Crystal Structures of Biapenem and Tebipenem Complexed with Penicillin-Binding Proteins 2X and 1A from Streptococcus pneumoniae
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Biosynthetic protein
total genus 32
structure length 158
sequence length 158
chains with identical sequence D
ec nomenclature
pdb deposition date 2007-11-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2110 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2zc4A02
3.90.1310.10 Alpha Beta Alpha-Beta Complex Penicillin-binding protein 2a (Domain 2) Penicillin-binding protein 2a (Domain 2) 2zc4A01
1PYYA 4OVDA 4CJNA 1QMFA 4N1XA 3ZFZA 2ZC4A 1MWUA 3VSLA 3UE3A 3VSKA 2ZC3A 5M18A 5KSHA 3UN7A 1QMEA 1RP5A 3ZG0A 4DKIA 3UPPA 4BL2A 3UPNA 4BL3A 4CPKA 4R3JA 4JBFA 3UPOA 1MWTA 2Z2MA 1K25A 1VQQA 3ZG5A 4R1GA 5U47A 1MWRA 5M19A 5M1AA 4QJGA 4RA7A 2Z2LA 3EQVA 1MWSA 3LO7A 4MNRA 4R0QA 4R23A 3EQUA
chains in the Genus database with same CATH superfamily
1S12A 2ZZTA 2HZVA 1NLKL 4YB7A 4C8YA 4FF4A 4USWA 3J81j 3IG1B 1ZAXA 3WDOA 2CZ4A 2EFPA 1DBDA 3MAQA 3I5CA 5L1IA 3FNNA 2WW4A 4NLTA 2LVWA 2AYEA 1SKSA 5GAHU 2JEJA 4O3QA 3HHLC 2N3OA 4HT7A 3J80U 2MQQA 3JSBA 2Z30B 2I9SA 3Q8SB 1RLDA 2XMKA 2GFFA 3T9NA 2GMLA 2F5GA 2VG7A 1CG2A 5L8RC 5IT0A 1G3OA 2M4MA 2J6TA 4CO0A 1YRUA 2HIQA 1JNRB 2CNOB 1FDDA 1LXNA 1FVQA 4FS2A 1ZOTA 2OLVA 2IYGA 3U02A 1IXKA 1RP5A 2OUGA 4DI6A 3WBZA 2HHXA 2HBYB 3H20A 1RAOA 4XPEA 2PGCA 2FVCA 1Q5YA 2RU9A 4C8LA 3LP2A 1VLOA 2BBEA 3HZGA 4KO0A 5F3ZA 3L7PA 2C2ZB 5KFOA 1FKPB 2BXJA 2VIHA 1BQXA 3OQ2A 1TFYA 2OPRA 4OJ3A 2W2QP 1MWYA 2LA6A 5AE3A 3G71S 1KBRA 1UEVA 1YK9A 1YSJA 5CQGA 5KT7A 2WONA 3G86A 1HBUA 2H1YA 4OQJA 3EXYA 2UVWA 4QWBA 1UVLA 4XAKA 3MMAB 3CD6S 2QL5B 1XMQJ 1CPZA 4YQWA 5AXKA 4JP8A 1JLAA 2HLTA 3K59A 1HL6A 4L3KA 2ERRA 4C8NA 2CQGA 1CEZA 1N8RT 3ZTRA 4HLBA 3I82A 4DOZA 3VAGA 2HNDB 1D8YA 1B64A 2ZNYA 4DV7F 1OPIA 4LMZA 2EXUA 2ZBQA 5J1EB 1N32J 4CLLA 3KKFA 1D9AA 2EKNA 2XY5A 1QM9A 3QGGA 2XI2A 3BYRA 1SJFA 2JLEA 1YJRA 1RWMB 1EJ7L 2R2RA 4F3MA 5KFQA 2R7SA 1VQKS 4ZN1A 2LYVA 3NGTA 2VV5A 3JTOA 2B7BB 1JX4A 3E2EA 3MM6B 4NYOA 2BQ3A 2I2YA 2RAQA 1DURA 2MJNA 2XZWA 4JBCA 4M94A 3TJ9A 3VQTA 2BE2B 1UFKA 4B9UA 1HR0F 2RSQA 1WSRA 1UA0A 2ZH8A 2DEJA 1NNDA 1HQEA 2J7KA 2QMUB 2G0CA 2ZUAA 1F1BB 1IWGA 3ZTSA 1X5TA 4PWUA 2VBZA 4FKXA 3TAPA 2FVPA 4NXNJ 2XY7A 3MOZA 1HD0A 4Y3CA 3R3TA 2OO4A 4CT8A 1K8AT 4RUCA 2U2FA 3D0IE 3R5BA 2ZH4A 1VRUB 5HVGA 1S77D 5EWGA 4ENOA 3PDNA 4NRUA 5IZHA 7FDRA 4P2FA 1RHQB 3KHLA 2BW2A 2OPRB 3T6JA 2DITA 4F3QA 3PFOA 1R0BG 3PX0A 4KGXB 2V68A 2WZ1A 1RTHB 3OXGA 2AF6A 4JI2F 2HK3A 3KMSA 1NDPA 1WC5A 1TUGB 3ZZOA 3SCLE 3LO7A 5KTQA 3QAEA 1GEHA 1JLAB 2C22A 3CJ5A 3ONQA 2ALYB 4RNMA 1RYRA 2QLWA 2APOA 2ILYA 1SH0A 3R7BB 1H2TZ 2KRBA 3CCRS 2YNIB 3MMCA 5C25A 1Y5IB 4NZ6A 1VYAA 3IA0A 4UZCA 1NZAA 3WIUA 3K5OA 2I1RA 1ZAWA 4M95A 4DV3J 5IT9Y 3ZTPA 2GIQA 3FQLA 3TP2A 3QT6A 3P8BB 1Y5LB 1GK8A 4HHUA 2RILA 2ZD1A 4LF8J 4PXBA 3RU0A 2B6AB 1BLUA 4H4KC 4OYBA 2R7TA 5D8HB 3UW1A 3NBPA 2ASDA 3KLEB 4J9SA 3MZIA 1RCOB 2SXLA 2C2RA 3VGTA 4QWEA 2LDIA 4FS1A 3KDNA 2DGTA 2AYGA 1O0PA 2Z0GA 1HQEB 1VQYA 2KRRA 2XULA 3W7BA 3JSYA 4USUA 5LJ3Y 5J2MA 3T9ZA 3RUBL 5SZTA 3DCAA 3HSZA 4A8KA 1T9XA 4N77A 3MUMP 1I94F 2H65B 4ZPAA 5KFBA 1HBNB 2CQIA 1Q7YT 3IGNA 1X60A 5T7LA 2VQFF 1JQGA 3OUYA 3GJSB 2W25A 2VONA 3EQUA 4FYWB 5K8PA 2QL9B 2XMMA 2PA3A 1H2UX 2HHSA 2GC8A 1VBKA 2HNYA 2NXUA 3UCGA 2QGFB 1IKXA 4QR1A 4LJMA 1SH3A 3NGSA 4LFAJ 3KTQA 1LOUA 1HWIA 5H9EJ 3GU0A 4DV4F 1TQLA 2HGNA 3HVAA 2R42A 5IOLA 1VJQA 2CQ3A 3CEDA 2IMOA 2ATCB 4KTQA 3PYFA 1XMOF 3AH6A 3MMCB 5DDRC 1D09B 5C25B 1M90T 2OEKA 1TL5A 5GAGU 2DD8S 3M8ZA 3QO9B 4DCJB 4QJVA 1Y3JA 2QIFA 1TUVA 3A3PB 2AD9A 4ZP9A 1CC8A 5HN0A 3HMJG 3AB2B 5K14B 1WNEA 4QPXA 1U2RA 3FBBA 2FZKB 4YUDA 3E3XA 1FX2A 2R8IA 3RR8A 3DLGA 2VODA 2EG2A 3P96A 4CO3A 1T9VA 2HK2A 1YKWA 3KK1A 2DNZA 1IQTA 3PXGa 1T9WA 3JTPA 1LWCB 2ZVIA 4CLYA 3RZAA 1TL3A 3S01A 3JAMU 4JI3F 1RJJA 1M5OC 5M2UA 3I0RA 1VC0A 3OFGA 4O44A 3UFCX 1FDNA 4ZKAA 3JQMA 1LWEA 2VKRA 5KFFA 1AFIA 4N1XA 2PSZA 1A6LA 3TZWA 3BB5A 2DT9A 3FEYB 1Q0NA 4WU2A 5J2MB 4ED3A 2N3LA 1S49A 2YNGA 3BKFA 4PXEA 5KFIA 3PACA 4GKJF 1GMWD 4P52A 3MPWA 4QPTA 5GMEA 1OWXA 2DGUA 3H2UB 3OUYB 2XSFA 4ECUA 2ZH5A 2M88A 1RU1A 4ED2A 2NPIA 4M63A 1C2PA 2C3MA 2DY9A 2HNYB 4X65J 3VGUA 2X1GA 4DZ6A 3B4MA 3D1QA 1RGVA 4QIGA 2UUBF 2P8IA 3I87A 3UN2A 4NLVA 4AL7A 4A4JA 1LKZA 4RW8A 4LF6J 2HFNA 2FLOA 2W2NP 1LFWA 4DV5F 2WOMB 1VQQA 4OX6A 1IQZA 1NM2A 1UEKA 4OYZA 3PX6A 5K8OA 4HYKA 4WP9A 2MEWA 2AJFE 2NUHA 1QE1A 2I0XA 2YXLA 5FJ4A 2W7PA 3BBCA 2N7CA 4C0BA 4C8OA 1GMVA 1GT8A 5HI7A 3DC2A 1CJKB 1N5SA 4M5LA 4DF8A 1SC3B 2GZOA 4F36A 4USTA 3Q23A 3HKWA 3DLGB 3KK1B 3ADAC 2CRLA 1LWFA 2OAUA 3G6YA 1Q1KA 1EKRA 3D0HE 1WHXA 2UZAA 2YKAA 2OSRA 2YKPA 1S72S 2AJ4A 2LKZA 2O01C 4ZVPB 4U7UD 3I0RB 5KT6A 3KNAA 1OIAA 3TNVA 1PG5B 4O44B 4ZOSA 4NX9A 1LWEB 4K0KJ 3TYTA 1HW8A 4XIUA 2MPUA 1RCXB 2XCAA 5CABA 5JVGQ 3MPDA 2Y8WA 1NSAA 3BSCA 2MKCA 4BC7A 1RU2A 2OMLA 4Y34A 4EI2A 2DISA 2MKJA 5KG4A 2AX1A 3MWBA 4HACA 1ITPA 3G6VA 2XGPA 5I3PA 4DHVA 2FJVA 1N5YA 3HFKA 2HS4A 4ANDA 4PG6A 3DLHA 4OI2A 1A7GE 2X1BA 1KSPA 2ATLA 4O0NA 2JWNA 4DV7J 1N5TA 3BH7B 3RRGA 2WBMA 1GMWA 1RWKB 4F2RA 5CYQA 4ZITA 3B54A 4FXWA 2ADCA 3GILA 4DV0J 2CJYB 4Q2LA 3ZTOA 5KFXA 4CIOA 1WTFA 2LA4A 4USIA 3NS6A 4RW8B 2R7VA 4IG0A 2K3IA 4CH0S 2E44A 4IRCA 3M6VA 4EGLA 1QD1A 1UETA 5HQMA 2G13A 1CJVA 1TU0B 1N4LA 4FF2A 2KYZA 3CMES 1RXOB 4QYZK 1ZA1B 1QE1B 2ZITA 3W61A 1S0NA 2RRAA 1WHYA 1DRZA 1LEOA 2B7CB 4LVNP 3IBCB 3H5SA 4AXIA 4EFAC 2HIYA 2YQ1A 4B9NA 1OSCA 1X0PA 3W60A 2DO4A 2J6SA 5KFWA 1TUWA 3FBFA 4EU0A 4ED0A 1HR0J 4DZDA 2MKHA 2AJQA 4LFCF 1VHIA 2POKA 4AT1B 2O67A 4CLFA 1D1UA 3QT5A 2K1RA 1OPZA 2MZRA 1HKAA 1VQOS 1LWFB 4DPTA 3IR6B 3OW2R 2GQQA 2IYIA 2H5IB 3QRQA 1NJXA 1SCJB 1KQFB 2ZBPA 1F2GA 4DV2J 3DRSA 1T9TA 2M9KA 2MXYA 2R8KA 1RTDA 4Q44A 3M6WA 2BRLA 2HZAA 2NREA 3SDEB 2CQ2A 2YKQA 1IJFB 4GO5X 3NWRA 2DNHA 3EYZA 3TZZA 1AW0A 4MTPA 4NA1A 4JI2J 4AQYF 4OFZA 1Y7PA 1R6YA 1UP1A 3QYYA 1UFWA 3B6BA 3J7A1 3S8SA 4NLSA 2IAJA 1UVKA 3M30A 4H54A 1N5YB 1IBKJ 1B7FA 4DN0A 2F1FA 1M1HA 4KBIA 3MCMA 2K3KA 1T9UA 1C1CA 1XR7A 3QJLA 3WC0A 1N34F 2K7KA 1L5UA 5CYMA 5CYQB 2MQLA 3PKMA 1UL3A 4WKRA 2RRBA 2PA8D 1U2CA 3CSKA 3DOKB 1BWVA 2QA1A 1UEUA 1R8HA 4TYAA 2MZQA 4MK8A 4IG0B 2JFDA 2W2PP 1LK7A 4ZIWA 4LQ9A 2WVDA 1H2VZ 2YWEA 4OHXA 4ZPTR 4HH0A 4J91A 3A8KA 4TQRA 1KN6A 3MEKA 4ERDA 1PAEX 3R5CA 2AJ2A 6FD1A 1SC6A 4G1IA 1S5ZA 2YX7A 3G82A 2HNZB 5IC4B 2NXNA 3FZBA 3UD4P 3K5NA 4TVAB 1WHVA 5ETMA 2GW8A 2K1RB 5D4LA 1NJYA 3KJQB 3LW5C 4O4RA 4A8SA 1I94J 5D0EA 3H8YA 2IDEA 4OZ5A 2DY1A 1IBMF 3EGVA 2G2ZA 4FKYA 4U7CA 4QIEA 1RTDB 2DJWA 4C2MA 3MMBA 2H9ZA 4PCQA 3TA0A 3H2LA 3G8QA 4PG8A 4CO4A 4E0DA 3FCWA 1R89A 3R9LA 2V9WA 4Q7AA 3TEHB 3V81A 4BC9A 2C2OB 3RB4A 4WCEQ 2EK6A 3W2VA 1FE0A 3DLKA 3M2UA 5CD4H 2VQEF 5C42A 5GAEU 4DV4J 2OI2A 2IAJB 1LNQA 4U8VA 2AGPA 3M30B 2BJEA 2XCPA 5H1SV 3LP0A 1XMOJ 1C1CB 1MLAA 3HULA 3GZ7A 3O6QA 1V5VA 4O23A 1SKWA 3OTCA 5CYMB 3Q86A 1DZ5A 4KQZA 3ZNUA 3D28A 4MAKA 3PIPQ 4ZCLA 3CIMA 4RNHA 4LF5F 1WWHA 2V94A 3D6TB 2VOOA 1L3VA 2BOAA 4CNZA 3PTWA 2IRYA 1TAQA 1FX4A 3UDCA 4P2SA 3DOLA 2W01A 2VD3A 3I4PA 2GHPA 3I5AA 4DR6F 1WTBA 5AJ3F 3JSMA 4DLGA 4DUYJ 4CP5A 2KT3A 2FJEB 2Q66A 4HH1A 3HHEA 1KVIA 2QMXA 3G82B 4OZ2A 5B7WA 2OLUA 1SJ4P 1WSVA 1FDAA 2DVIA 4M5NA 4EUVA 3NP5A 4DV1J 4DBQA 2AV5A 4GKJJ 5KFJA 5ADZA 2J0WA 4LF4J 2FJXA 3V6DA 1WKJA 2AEJA 2ZKTA 4V19J 3GONA 4DFKA 3K7RA 4IO1A 2XSJB 3MMBB 2JEIA 2DR7A 2OEMA 5HAOA 2MZJA 2FLPA 3Q8QB 4DPOA 3S7RA 3V81B 3TX0A 5D6GA 3ILIA 4CLWA 4WZMA 2P2CB 4ANEA 2HWIA 3DLKB 2V4JA 3M2UB 4B9LA 4V19X 1NJZA 1X7VA 5C42B 1Z1ZA 4P72A 4ED6A 2W2OP 3P5BP 4MMOA 1R43A 4Y2KA 4DV5J 4L72B 5I3UA 3LP0B 2HSEB 1HBOA 1CS4A 3MR7A 1FTRA 4Q45A 2HHHJ 2XLKA 2YKOA 3Q8UA 2AWZA 4YEAA 2AJ0A 1UJ6A 5A6WA 4ZJLA 4JI6F 4ED7A 5IT9U 1HQ2A 5DQGA 1VMBA 4C6AA 2R4FA 4LF9J 2R7WA 2BEFA 3MR2A 4ZVUB 3MTKA 1KVJA 3FK4A 3DOLB 1P1LA 4X4OA 1WDTA 4LUBA 3POTA 4KB7A 1RWVB 2NXCA 1LW2A 4FVMA 3JSMB 3I32A 1D3WA 2IVMA 1RBAA 4AUKA 2XZDB 3A8EA 2PEBA 2DBBA 2VC0A 3I56S 4K2JA 1VC6A 5HMWA 4Y00A 2IBOA 4U96A 3P6YC 3OD2A 1CSJA 2J0QD 3PZPA 2GX8A 3NRBA 1HLWA 1IKWA 4AL6A 2CPDA 3CCVS 1FJGJ 3KHRA 3NL0A 2PIIA 4Z37A 2L9NA 2JLGA 1ZZFA 3V6DB 4MT1A 3CDAA 3P45B 4DLEA 2G0JA 2EKYA 3LTOA 5C5JA 1UPPA 1HARA 3QJJA 3DRPA 4F7VA 2PDAA 2ZH2A 4UTGA 3FZ2A 4OZJA 2ZH1A 3W9IA 2WVEA 3V6KA 2RU3A 4DUTA 2AIRB 3T1HJ 2BMBA 2LXIA 3VAJA 1NK4A 1ZS6A 2XEXA 2V4JB 2XGQA 2GHVC 2E1RA 1AZSB 1T94A 1NPRA 2G2OA 2DCLA 1LQ9A 3OSNA 3CJKA 2ZOFA 3D6HB 1EQ0A 1CVJA 4ECVA 4KFBA 2MKIA 1N36J 1WOPA 5I3UB 3ZFVA 1CS4B 1E6YA 4WTYA 3UDLA 4FVCA 3WQPA 4H4MA 4YS2A 2HYIB 3AY0A 2MY8A 1XNQF 2G2YA 3OJUA 2CG8A 2K7JA 1QSYA 2JC0A 1XQIA 3GIRA 4WF9Q 2BOPA 4LFCJ 1HYSA 1OYEA 4LIRA 5DS7A 1VGYA 1IN0A 2UXBJ 3FVYA 2C3UA 1S0MA 1T8EA 2UVVA 5KFUA 3RBEA 3POTB 1I5OB 2G1DA 3DLEA 1LW2B 4B3SJ 3CJ4A 4ES2A 1NXIA 4LSZB 2R2UA 3OTOF 3ZC4A 3OTBA 4NZ0A 3QT8A 4DPUA 2R9LA 2C2MB 4IFYA 4UQTA 1KQSR 3H98A 3PR5B 3UD5A 2OFGX 4I6YA 1X4FA 1VQSA 1WACA 5HO4A 5CHCB 1AUSL 2PC6A 3KWMA 1G4CA 2GO8A 1IKWB 1V9OA 3QATA 4Q8EA 4ED1A 1OY6A 3PHEA 4XDDA 2ZBRA 4KKOA 2L48A 2AZ1A 3HXMA 2CPEA 1YJTA 1HNXJ 2V67A 3BO4A 2K06A 2FJBB 1KQKA 3C6TA 3ZZYA 4K8RA 4I2PA 5F8IA 1HI0P 1TP7A 3U7JA 1TZ0A 4OJHA 2XNQA 2PI5A 4ID5A 4PG4A 5ETSA 1NKCA 4QIFA 3H2VE 2ZJPQ 4YR0A 5H9FJ 4FYYB 2CVIA 3BZQA 1RT4A 2NLWA 1IVZA 3KG0A 1YI2S 4IO9Q 4OZ3A 3DHWC 2XS7A 2N4CA 3CJKB 1RT5A 2E5HA 3TZXA 4KFBB 2BABA 2ZHBA 3QNWB 4OL8A 2ZH7A 4RNOA 1ROFA 5BYQA 2DHGA 3QMQA 1E6YB 3WX8A 2GQCA 1JWWA 3MAAA 3GYXB 5EWFA 4F02A 4YDDB 2ZWPA 1UTAA 2NXJA 2PFDA 2PO4A 3CC2S 1Q4RA 1SL0A 1PCAA 3J80Y 1K47A 4H4MB 1NDKA 1S10A 4H4OA 3HJVA 3G96A 2Q79A 3KLGB 2YQ3A 2F3JA 2GQ2A 5DG9A 4ILLA 2HAFA 2AYBA 3QGPA 1C1BA 4PR6A 3EPIA 2VPYB 1URNA 4ZVFA 5A6PA 2EC2A 3VAKA 1J5EJ 2P6SA 3OPKA 3LAKA 3HSDA 4J9UE 4QJGA 2FD2A 3KK3A 5KFZA 4PG5A 2ZBCA 4YP3A 4CTAB 2VH7A 3ISZA 1BWEA 1F60B 2VBYA 1D9FA 3RBXA 1XBWA 2C1EB 3GFHA 4C3KA 3PRDA 1S9GA 9RUBA 4B3MF 1LFPA 2CYYA 1WUUA 1M0SA 3CIZA 2MYFA 4I4BA 2CJQA 3O8WA 5EX0A 1U02A 3AXMA 3X1LB 4IDKA 4KKOB 2J9CA 5LSRA 1S59A 4USKA 2WVCA 4TY9A 4F4WA 4NI2A 4OHZA 4K7QA 3O2IA 3C6TB 1S48A 1UWAA 1CULA 1EAYC 2GIRA 4N8NA 4I2PB 4ZVEA 2FHKA 3UPOA 5DDPC 2EBEA 2IRXA 4ID5B 4OZLA 1U6BA 3BREA 3SYZA 1RT6B 5K5MA 2JLFA 4B9MA 4Y0FA 4TLRA 1EARA 2B4OA 3QLHB 2KVQE 4MK7A 2X7IA 2ALZA 1PILA 4I67A 4G3IA 4TU7A 4K4VA 2DIUA 1UAWA 4V1Ak 2J8SA 4LBIA 4DR6J 2FTRA 1MWZA 2GVZA 3MAAB 4TKTA 1QAYA 4UOFA 1KP6A 5KT2A 2Z2LA 2NZ4A 1SJ1A 4ZPBA 3V5RA 3OVBA 4A48A 3TQEA 4H4OB 1SUQA 2CPXA 5L9XA 2QYCA 5B08A 2IJNA 3R6GB 2PN6A 2ZDPA 3VF0B 4UUWA 5E0OA 1TKZA 4DR1F 3TA2A 5M1AA 3PX4A 1NRKA 3CJSA 3MCNA 1C4CA 4WU3A 2U1AA 4ATNA 1S9GB 1JLGB 2D3ZA 1X4EA 3NCRA 4IQMA 3MR6A 3N6LA 2KTQA 3UCZP 1VS3A 3PO4A 1VBXA 3CC7S 5HJYA 1FVSA 3RRKA 4IOCQ 5D0GA 1RT2A 1HI8A 4B3TF 4RA7A 4DQPA 1RK8A 4LIWA 4NI2B 1U0HA 1CULB 1N88A 3DI6A 1Q5VA 2YTCA 1HIYA 1SIZA 4MJKA 2WAFA 2XO6A 4B3RF 1O5JA 3VVTA 1WHWA 5DRKA 2OH2A 5HP1B 1JJ4A 2DGVA 3Q24A 1F5BA 3VGVA 3IRWP 3P49B 3AD8C 1XERA 4L76A 1PGZA 4NLOA 2UXCF 4FNHA 4DR7F 1Y00A 2HPUA 1H72C 3S1TA 2IM1A 3H0PA 4JB8B 2VC1A 2FY1A 2XMTA 3DOMA 1WEYA 3KUEA 4OYAA 1KTVA 1FFSB 4YHHF 2W7AA 1HHTP 1Q78A 1I3OB 1NK8A 1SUQB 5ETPA 4K4UA 4BS2A 4U67Q 2B56A 4A8YA 3IBFB 3M6XA 5ETTA 5HVFA 2KDOA 2JVOA 2XWYA 4ECTA 4NA2A 4RZRA 5IXUA 4PG7A 1S9EA 4W92B 3IXQA 2W4PA 3DHXA 3CCTA 3DU5A 1TKZB 5H9EK 1M1KT 3LQVA 4ER8A 1Y9OA 1NEEA 5F8JA 3LPEA 1TL4A 1NSKL 1X9MA 2MSTA 2WK4A 3CD5A 2DRDA 4WE1A 2A1BA 2KFZA 4HKQA 2DO0A 5HK4A 3OFEA 2EW9A 2HHUA 2HEKA 3KLHA 3CCMS 3JQKA 2MQOA 2RD5C 5K8MA 1P27B 2B0GA 4NLXA 3ILLA 4DCPB 4DX8H 1LXJA 2CDRB 4OV6A 1J5OB 3QIDA 2M3DA 1ZPVA 4DR2F 2FHMA 1XWLA 3CJ3A 3CDEA 4YR2A 3CJQA 4O3OA 1U0HB 3DNCA 3HK2A 2KFNA 3DI6B 3TUJC 1VQ7S 4KH0B 1S6OA 2JVRA 3G4SS 2E5LF 2VASA 3QBCA 3T19A 3CDBA 2LU1A 2DGOA 5CZVA 3L3CA 4FBUA 1FRHA 2CQPA 4XPCA 3R5GA 2R2TA 2IPOB 1S1UB 1XNQJ 2JH3A 1SV5B 3D66A 4ETZA 2VFUA 2RS8A 5M2PA 3BV8A 3IGVA 4FPRA 2V8PA 1U6ZA 1F3FA 1BUXA 1FNMA 2HRUA 4GVBA 3D1HA 2FJDB 1MW7A 1DARA 3PHTA 3OFHA 4OJGA 2ZHAA 2IRUA 1S1XB 3DOMB 3NGDA 3MUVP 1OO0B 1U48A 4RNFA 4C0HA 4OI1A 3D3BJ 2J7UA 4Z7CA 3G2XA 4ZVRB 4CLZA 4DL0C 3OTOJ 1U49A 3VCDA 3SEOA 3GSIA 2HVDA 2ZUGA 2FYXA 3T1YF 3RYLA 3EM1A 3JAMY 3FJ2A 2NYHA 3BGLA 4R1GA 5L39A 2IM2A 2CJKA 1N48A 4CLKA 2E1AA 3SXLA 3UDVA 4WFXA 1WC6A 2X3GA 4UOHA 4NLWA 1WC3A 1WG1A 1DQAA 1NDCA 1AXQA 4DX5A 3JSRA 4X62F 2H51B 4J9LA 3CDUA 3NMAA 4G65A 3UNGC 1N56A 1EB0A 4WE1B 4DL7A 2ZWOA 3J81U 3AQPA 3KLHB 3UNYA 3NGRA 3EGNA 4TN2A 3PV8A 2BACA 5AE2A 2FVRA 2KB2A 1FWLA 1P8GA 3RB6A 4RUAA 2L3MA 2XMJA 1S9FA 4CYUA 3AA9A 1ZA2B 3M7VA 5DO2A 2MZSA 2BW7A 4DR5F 5GAHI 4W98A 4MH8A 1SH2A 4DU8A 2VJUA 2KHDA 4AL5A 3QFWA 2E7WA 1TV6A 3M6UA 2ZE2A 3LGHA 1KLMB 1YBUA 2QO3A 3LOUA 1IBLF 1RTZA 3O1LA 1P9YA 4AE5A 1WOOA 1YDLA 5G0RB 2MLZA 1NZ8A 4HVZA 1KHVA 3WC2A 2B8QA 4QZVB 4XTTA 1S6PB 3GYGA 5A8RA 4YB5A 3LANA 2BDPA 3CCLS 4KHPJ 4GVBB 4I6AA 5E3QA 4X84A 1WC0A 5CH7B 4LRBA 3OLBA 4MKBA 3W63A 2FIUA 5B0AA 1EP4A 3OBIA 1S76D 4PXDA 3DGPB 5E3RA 3FUYA 2LLZA 3EJMA 4LQ3A 1IKYA 1GXLA 3DRRA 5M2RA 3EUNA 4LF2A 2RNEA 2PFFB 1Q81T 1K0VA 1RAGB 2DGWA 2Q6CA 4LVOP 1RWWB 2KM8B 2MQPA 3OL6A 2XHWA 1P1TA 1HFEL 3C66A 3Q89A 2N82B 3W62A 3GFYA 3BR8A 3FBCA 3HVWA 3MPYA 4RW7A 4C8ZA 2RRNA 2E7VA 3ZZUA 1PBAA 5KT4A 2E29A 4DPYA 2O3DA 3QZ7A 2B3TB 1SQFA 3GJRB 2ZM6F 2BVZA 2RKIA 2Y0BB 4ECWA 3R7NB 2ZC4A 3VAFA 1TAUA 1XNRJ 2VB6A 4CYUB 4EYIB 4DL4A 4IRDA 2HQFA 2VG6A 1U1NA 3K5PA 2Y8YA 5E5NA 2DXFA 4DSEA 5D0RA 2DKOB 2HHTA 4C4WA 1TV6B 2ZE2B 3G8SA 4P9SA 1FA0A 2D1CA 1K1SA 5LMUF 1AT1B 4WIQA 5KFPA 1DTQB 2YBVA 2OTJS 2BV3A 3UR3C 4ED5A 3E8OA 3G6ES 1RB0A 2LEBA 1MMLA 4TU8A 4ANCA 4LR7A 3QQCD 4JV5F 4R8UA 2W4DA 4LF1A 4F4AA 3UE2A 5I3QA 2RQKA 4MIAA 2DK2A 1NAQA 3NKYA 4KGZB 1U7LA 4ZVHA 4DR1J 1N0VC 2GAHC 4EO6A 3AQOA 3IWLA 3GMGA 4M8LA 3VQSA 3UVJB 3OC2A 2DHHA 2RUGA 1U1PA 1U8WA 5B0EA 1VHFA 4IYQA 4ES1A 1W7WA 2WCXA 2B9EA 4OYWA 3DRRB 4HT5A 1V3SA 1HI1A 3DMJA 1I1GA 4LR9A 2OD6A 2QA4G 2DR6A 4NYZA 1QAIA 3BGRA 4WWSA 1RAHB 1Q95G 1H7WA 3JB9k 2AT1B 4RW7B 3RB3A 1KFDA 1B0PA 1RHKB 1FNOA 4ALZA 3ICLA 1K44A 1G7CB 3VZHA 2ZZNA 4F04B 3PIOQ 5HBMA 1MWQA 1XC9A 4B3RJ 1MROA 2HQ3A 5JXSA 2HLUA 4MFBA 2RKIB 2DHXA 3CTRA 8ATCB 2NQPA 2C2KB 5LMNF 2OPPA 2AP6A 3I9V9 1WJ9A 2XWXA 4JBFA 3FGVA 3W9HA 2HRYA 2W24A 1NJIT 2QX0A 2M8DB 1BMQB 5KFLA 2O5DA 2MGZA 4OVDA 2MKSA 4GKKF 2QV6A 3SCIE 4RU9A 3DYAB 3RAQA 3HVTB 2Z56B 2AYMA 5DQHA 3HVRA 4B02A 5KFMA 3FDSA 3MMJA 5B09A 2BQUA 4K2XA 1T3OA 1U6FA 2WRMA 2F4VF 4DSIA 2FGCA 4C3MA 4X64F 3ET6B 1MNEA 1VI7A 4X4TA 1ZTWA 2VPWB 1R27B 4UW2A 5E3CA 5B0FA 3V4IA 1Q79A 4JI5F 2D74B 1YJNS 4R8UB 2MB0B 3HDSA 1RT1A 2AEFA 3S6EA 2CWKA 5HLFA 4K50A 4UF4A 1BD6A 2OPSA 3H5XA 3W8GA 4W90B 3ZZRA 4K5SA 2ZH6A 5L1LA 3W3SA 4L3NA 2C3PA 3MD3A 2Q6BA 1N33F 3I6PA 1UZDA 4P7TA 2MHNA 4FYDA 1Y0HA 5DZ7A 4R5PA 3TZYA 5T14A 1FEEA 2Z58B 1FXLA 3HSGA 4J9RA 1IR0A 4OI3A 5LXRA 2OSQA 4X4NA 5L46A 2DNKA 1W26A 4P75A 4CNYA 3BGRB 4RR5A 3SSRA 3EVOA 5KFHA 4LSLA 3C6UA 1WI8A 3W2WA 2E5GA 2WB4A 1G1XA 1DQ9A 1IM4A 3KUHA 1X4BA 2CJ9A 3IS9A 2IBKA 2E9RX 3NGUA 3OVSA 1YTYA 4HTJA 1HW9A 5GAGI 3C15A 2E5LJ 2V2ZA 1AROP 3EMTA 2MMYA 3DGVA 4ILRA 1LW0A 1NK0A 1GQEA 3MGJA 5A8WA 2RHSB 3OL7A 2GJFA 2RQ4A 3OXFA 2WHOA 4M5HA 1S6QA 2CZVC 1RABB 2XS5A 4NWBA 4XK8C 1U47A 2MGZB 1V3RA 3ITHA 4EO8A 4C11A 3OL9A 1VK8A 5AXLA 2L41A 3H4DA 2B9YA 2HS0A 4ELUA 1H98A 2R7UA 3ELHA 5KFNA 5A8KA 4OX9F 1PYSB 4M5IA 3U27A 4JI8F 2DNNA 4N7TA 4JI4F 1WG5A 2I38A 2HG4A 1XIQA 2VG7B 4F2SA 4WXWA 5CCMA 5L1JA 1NB7A 1RHRB 3HD2A 3T1YJ 4CO2A 4C97A 1OY8A 1ZAVA 2F9DA 4FZVA 5C24A 3N9UC 1T0TV 2MLYA 1WDDA 3M8YA 5B0CA 2AGQA 4OYOA 3AJ1A 4KIAA 5HQ8A 3PJXA 5HLFB 2Q3PA 3KG4A 2OPSB 1VRTA 3ENVA 1FRKA 1S57A 4PQAA 4A8XA 4ZCMA 3GWCA 5IV4A 1BQNA 2E9ZA 4X62J 1S7IA 4YB6A 3LP2B 1EX8A 1HD1A 1QMEA 3KHGA 1JLBA 4KO0B 4R5PB 4RNNA 2CKWA 3AA8A 2WSFC 5DDQC 2JZ5A 2YH0A 4DX7A 1HNZF 4ELVA 5HROA 1FE4A 1V5IB 1FRJA 3I55S 4ZLLA 1C0TA 2WONB 2OFHX 1HBUB 3FRYA 2Y1JA 3Q0AA 3C6UB 3W2WB 4EBCA 3O3LA 4DX6A 3SV4A 4E8UA 4ZVQB 3IS9B 1FI4A 4LBPA 4LFBJ 1C4AA 3R97A 3Q2SC 5E2QA 1C0UA 4O4GA 1GH8A 1QSLA 1JXEA 3C15B 1EQMA 2G4BA 5D3GA 5A8WB 3OVAA 2ZNZA 5D15A 3T5KA 3FMWA 3UCUP 3QAUA 3M05A 4JV0A 2KZZA 5IWAJ 1S6QB 2WTFA 3CULA 2LQBA 1SL1A 4NXMJ 1PIEA 2DRBA 4JI0J 2UU9F 4DSFA 4P2XA 4HR2A 4C11B 3R8YA 2DNMA 2BANA 2C2DA 4JI7F 3TARA 5LM7E 3LGMA 3G9CA 1NPPA 4B9TA 3FSYA 3N0VA 3SMZA 4WBFA 3D0GE 4DL3A 4HDHA 1KRPA 2OEJA 3SSSA 4AFFA 3VAIA 3MEDA 2OPQA 4DSLA 3TX8A 1S1TA 1RTJA 3HHNB 5F8HA 5L1KA 3G8TA 4LRFA 5DGAA 1HPZA 5CZXA 1VRTB 2HURA 3BGUA 1X4AA 1MWRA 1REVA 3AFGA 1S97A 5CD4A 3TA1A 5HMXA 3PJWA 1V6HA 2FLLA 4PWWA 1JLEA 3OHBA 1N0UA 2YQ0A 3HX9A 1JLBB 3C8YA 1R8AA 2OGUA 2GMJA 3SI8A 2ZM6J 4CDIA 1WKLA 5HROB 1OMSA 3HM9A 3D7SB 4EK2A 1C0TB 4I56A 4Q0BA 4KV8A 1RWUA 1XK8A 3V6JA 3GCXP 3MR5A 2V34A 3TJAA 1I51B 1OQ6A 3NGKA 3OL8A 3GIKA 3L9ZA 3NLCA 4DV6J 4PEOA 2DHSA 4O4GB 5CAAA 3IRXA 5KFGA 1N5QA 3ENQA 4KGVB 3CJ2A 3BKUA 5D3GB 5K20B 5SUHA 5LJ5Y 4OX7A 4LRAA 2GGPA 3L95X 2DRAA 5ITHA 4ZS6A 4J9KA 1U2FA 3P3DA 4ZVSB 1XMQF 3L09A 2BJ1A 1HNWJ 3VGSA 3HKZD 3UO0A 2ZD1B 2DGXA 1ZPWX 3W1YC 1U26A 3MR3A 3G6XA 4ZCKA 3IWXA 3KFWX 1HMVA 2CQDA 4Y6IA 4DR3J 4J9VA 5KT3A 4NL5A 3SIPB 4K4WA 2GAGC 3NBPB 3GSDA 4CLPA 2EI5A 2OPQB 1M5SA 3BPSP 2WSCC 1S1TB 3CPWR 1RTJB 4PXCA 4IR1A 3Q8YA 1VQ4S 3C19A 3AOBA 4OHWA 4F4XA 2QSWA 2RE1A 2DR9A 1HPZB 1VRQC 2PMZD 4J90A 2HZCA 2ABYA 1REVB 4A8FA 2BYCA 4X4VA 4RJVA 4M5DA 2BM0A 4LRCA 1RI7A 1JLEB 5T7LB 3N6NA 2MJUA 3VTIA 2UUAF 5KAKA 2RF2A 2M52A 1FNXH 3CGIA 4J5OA 1AUDA 2ROPA 3UI3A 4P2MA 2V4QA 2BE9B 1KOOA 3US5A 2XYPB 1IKXB 4KV8B 4UQGA 4NXNF 2AHOB 4PKDB 2R7OA 5ETKA 4ECQA 3W5YA 1VFJA 1WORA 1YJUA 2DIVA 2HWHA 5HMYA 3CCWA 4GKKJ 4TNOA 7AT1B 3UQSA 4CO1A 4QWDA 2YPZA 5IS2A 5KFCA 3GFXA 4I1TA 2OP5A 1SJ3P 2KZMA 5A0YA 1PC4A 3QFHA 2B9WA 3IC1A 3IMQJ 4B9SA 2W1BA 1PKUA 2NS1B 5D0HA 3KOAA 4RX6A 4JYAF 4Y2IA 4M5MA 1R0AA 2R8JA 3DLJA 2VPZB 3D68A 4ZA1A 4YFUA 1SKRA 1Q8KA 1RZMA 3DWKA 2B9XA 4QCLA 3K5LA 1ICEB 3RTVA 3LP1A 1VIXA 4HI2A 4WFZA 4P10A 1N33J 2R8HA 1TL3B 2KG1A 2OHDA 1RHJB 1REGX 2N7YA 5DGBA 3MPUB 2ACMA 3M1VA 1F9HA 4MNRA 1FKAF 4OV1A 4DV3F 1Y3KA 3TUPA 1R6VA 3CJRA 3LWLA 1BQMA 1RT3A 5GAEI 5F8MA 3MEEA 3THPA 3UPFA 3TAMA 2YNGB 4U8YA 4M5DB 1F0XA 3AODA 3BO3A 1DJ0A 3GV5B 2QE5A 1TMMA 2C2NA 1K73T 4UZBA 4USHA 2M0GB 4NCBA 5IQ6A 1ZETA 3K0JA 2CJXB 4YB1P 1Z2ZA 4QIVA 2AU0A 3KJVA 2HHQA 1X0FA 1TK5A 1JLQA 3KLIA 1OQ3A 3Q8VA 4HTIA 2LMIA 4DFJA 1FWPA 5GMKa 2UUTA 1S7HA 2Y1IA 5FD1A 2KXNB 2COLA 3AB4B 1KNZA 3D1OA 4RW4A 3GLJA 4QW8A 1QUVA 4JI4J 2CPHA 3KNGA 1ZZNA 3NWGA 1YLXA 4ZK7M 4N76A 1WF0A 5DJBA 3HCXA 4KT0C 1R0AB 2HBRB 2QMWA 1TTHB 2QYGA 1FHTA 4GC6A 3GB0A 4J9NA 1ULRA 5KG7A 2BE7D 5G4DA 4MYUA 3ZZZA 1T11A 2M5YA 3LP1B 1X5OA 1F6TA 3PNIA 2ZJRQ 2NYIA 3ZFZA 3BN7A 3TUZC 2FVQA 4FP9A 2G1HA 1N6QA 1O8BA 3I4HX 1VQ5S 4FBTA 5FLXU 2RIJA 1FFWB 1VCTA 4DFMA 1S6UA 1UVIA 1HNIA 2A3JA 2ZOGA 4A8OA 1RT3B 2GJIA 3MEEB 4BWJA 4X4UA 5EX3A 3TAMB 3SFUA 1RQ0A 4DDFA 4ECYA 2IC3A 4HACB 4LRDA 4PABA 1K9MT 5KFSA 3DRYA 4TXSA 1FKPA 1W2IA 2DR8A 2CG4A 3MUTP 4N41A 5HANA 3GP9A 2UV8G 2LFVA 3SCKE 2KJVA 3F41A 3M8RA 3KJVB 1ELOA 3MF5A 1BGXT 4Z7YA 1SI9A 1JLQB 3KLIB 3RBDA 5JJBA 1E6VA 2ILZA 3P4UB 4FYVB 3RW7A 4GMKA 5EUHA 1RLCL 2H4WB 2VF3A 3MD1A 5KG1A 1QSSA 1PYYA 1FO1A 5BJRA 1SQEA 1YG0A 2BZ2A 3K57A 1SKUB 3GIMA 1QAXA 4R3JA 4JI7J 1T02A 3ISNC 4RW4B 4RL1A 2HNDA 5DG7A 4KE5A 4ECRA 1CJVB 3FFIA 2OIHA 4NLPA 5J1EA 3NG8A 3ZZPA 2F40A 4F25A 5FIIA 4X65F 1VK3A 3PJ9A 3NAIA 3R1LA 1RWPB 4DL2A 3EZOA 1GXTA 1T7PA 3LF0A 4B9VA 3MCSA 3PEHA 2AMCB 4LF6F 1WEZA 3QWPA 3ZNJ1 3WZ0A 4U7UK 1AB8A 2XBPA 2R2SA 3AXKA 5MAOA 2BM1A 4G1QA 4EWTA 1ACMB 2LQ8A 3MXHP 3A8IA 3MM6A 1N6QB 2MZ1A 4NLDA 1NJWA 2VQFJ 3DRSB 3PRBA 1QVFR 4X4RA 3ENAA 3KXDA 4AXJA 2IJRA 2BE2A 3W66A 2HVZA 1YZ6A 1FRLA 1O6XA 1HNIB 3H5YA 2VICA 4X2BA 2YKNA 3PYGA 2QRRA 2D3O1 3H7HB 4RWXA 4JV2A 3VV2B 2YNHA 4PRFA 2GVDA 3AHPA 1YHQS 2M7SA 5GADU 2I5JA 2LU2A 2IC3B 2V69A 1VRUA 2ZH9A 4A8WA 5MLCV 3FCVA 4J9PA 1PYOB 2GHWA 2KG0A 1Z4UA 3HHLD 4BCAA 4L73A 4K0KF 4KPCA 2E5JA 2KKHA 5K8NA 2IVFB 4F0KA 1RTHA 4I2QA 3KLVA 4USVA 1E6VB 4DQIA 4NA3A 4ZVGA 3GG0A 1WF1A 3MM5A 4P73A 4OMFG 1CQMA 2V4RA 5J1NA 4KRWA 3ZG5A 3EVMA 2QT7A 2YNIA 3FBEA 2XM3A 3C46A 3FFIB 2QSFA 4PYDA 5EHHA 3U1MA 4FNIA 2E1MC 3B82A 4JI3J 3IR5B 9ATCB 3IR7B 4DV0F 4Y65A 5BYSA 1KDNA 1UZHA 3NOGA 4BBYA 3J7YU 2W8KA 4BLGA 8RUCA 2D7SA 4RWWA 3R5JB 4DR4F 3IM8A 1GFWB 3EPGA 2VDHA 2XI3A 3AD9C 1SVDA 2LEAA 2B6AA 4G1QB 1FXDA 1YQHA 4QQBA 2PE8A 1MMNA 2YWHA 3KLEA 3EQVA 2UUAJ 1NBEB 1GX6A 5KFKA 3NNAA 2UUWA 3E01A 3MPVA 5ETRA 3CJ0A 1B0VA 4FN5A 2YKNB 4NEYA 1RTIA 1VBYA 3J81Y 3W2VB 2NSBA 3OR1A 3EX7B 3BQ2A 2YNHB 2GVDB 1DQ8A 2UUBJ 1T9YA 2VDIA 3BEGB 4U95A 2I5JB 2M70A 3QRPA 2XYGB 2CPIA 4KYZA 2Z57B 4LF7F 4MK9A 1HBNA 3FEXB 5A2QY 4DV2F 2G9OA 2DNOA 4ZP8A 2OD4A 2OJ3A 2EC0A 4P74A 2VOPA 3OV7A 1ZM3A 3I96A 4KPYA 2Q1LA 4IH7A 3HF5A 1S4FA 4I2QB 3GCWP 2Y9HA 3OTEA 4JYAJ 3MCOA 4F4ZA 4KHMA 2MKKA 3FSXA 2P9CA 1G6BA 2IVYA 2WVBA 4OHVA 3HHLA 5CYJA 3MM5B 3NEKA 2CNKB 2CQBA 2L08A 3ZG0A 1NH8A 5KG0A 5DZ6A 4EBDA 1IBKF 2LXUA 4UOCA 1UMJA 2PEHA 1VQ9S 4FDFA 3J7AN 3EVWA 3VSKA 5M18A 3QO9A 2HVHA 3V4MA 1Y4ZB 5KG3A 2XMAA 1NHVA 1U8SA 1U4BA 4NMXA 2BJ9A 2FJWA 1A0OB 4AYBD 5K14A 3ZZ0A 3THVA 3KYLA 5I42A 5B0BA 2AZ3A 2WW8A 1UVMA 3CNQP 1K0TA 1VIOA 3FQKA 4KSEB 4C48A 4CCHA 2BJ8A 1U0SA 2JFKA 2R7QA 2E1PA 4DQSA 2XMWA 1XMBA 1O51A 3GJQB 1LWCA 3IP0A 2AX0A 3ETOA 4QW9A 5EWEA 3R7SB 2NSCA 5CCLA 1JMTA 3DM2A 2QLFB 2IIHA 4CRJA 1S99A 3E01B 4KJIA 4TYBA 2JSXA 1TKXA 2Y1RI 3CB4A 1PAUB 3VZIA 1U1RA 3OXLA 3B8HA 1RTIB 3VAMA 3F73A 3MM7A 1B70B 3OR1B 2BKOA 3QIPA 2KO1A 3IAM9 2UVRA 1TR0A 3SCJE 4RUHA 4IG3A 2RHQB 2HHWA 3EICA 2MSSA 2VU5A 1KLNA 4L75A 3BDPA 1HBOB 2CDQA 2DYAA 3D67A 3VSLA 2ZH3A 5BR8F 1EKSA 3PRVA 1RKIA 2DNYA 3BS9A 1K25A 1UJ5A 3PO5A 1RWOB 1RAIB 3PM9A 3W65A 3HHLB 2VZ9A 3T5LA 3CCZA 1YRXA 1YBAA 3PKYA 5IT4A 2WAQD 3MEGA 2WOMA 5ETOA 4YY3F 1KR4A 2A18A 4FXVA 5LXYA 2E1CA 3C3LA 2JOQA 2EEYA 3BN4A 1Y5NB 3PVXA 4P71A 4Q2MA 1LWXA 1KOHA 2DXEA 2QTWA 3CF5Q 2CQ0A 1NHUA 1CJKA 3LUYA 4O3SA 1UJ4A 2O66A 4YR3A 5I42B 3OTDA 4OI6A 1R31A 1IWAA 4HI1A 2QLJB 2XLJA 4RBUA 3ILJA 4AQYJ 2V2KA 2JEFA 4OZNA 2CNLB 1FFGB 2EG1A 3MOJB 3T3FA 5KSHA 3BPDA 1IKVA 3T5JA 3DFEA 5EGYA 2CWXA 5LSLA 4N56A 4DUYF 3DM2B 1QY7A 4BDPA 4DPWA 3DRPB 3BSNA 1Q8BA 3EGZA 4ZJQA 2MLXA 3D5MA 1B0TA 2XC9A 5C2GA 3MI7X 1N34J 1RACB 1TKXB 3UN7A 2EFOA 2VFRA 2CQCA 2HW3A 2QZ8A 1X5PA 2E5IA 4Z2XA 2A10A 3UWTA 2FVSA 1JB0C 5J2QA 1IBCB 3MM7B 3N5FA 4DV1F 4FF3A 5LOQA 1GTEA 2YKMA 3K5MA 3QIPB 4LF4F 4P7VA 2UVUA 4JUZA 2ZFHA 4WFBQ 1EZZB 4IG3B 2RB7A 4PQUA 2KT2A 4CM2A 1NK5A 1BE4A 3RJMB 3V2UC 3KLFA 1T95A 3R5AA 1IR2A 2QN6B 2HAIA 5AE1A 4IOAQ 4DKIA 3N79A 1T03A 2H48B 1NO8A 5D4PA 2DNRA 4I7FA 4WK1A 2FC9A 4DQRA 2MHEA 1VQ6S 2HFVA 1TVRA 3TW0A 1F3VA 2QEXS 3MEGB 1HYSB 2JRSA 4H4KA 1UW9A 5B0GA 4ITSA 3L7OA 1DLOA 3NS5A 4JOUA 1FRIA 2HHHF 3DLEB 4C7QA 4FF1A 4C8KA 5AT1B 1IBMJ 4EBEA 4J9MA 3T5HA 3DRXA 2XMUA 4LF9F 2W9AA 4PAAA 4IFYB 1QAJA 4KHRA 1X9WA 4RW6A 4EEYA 5ETNA 1VQMS 3BM7A 3NNHA 2XZTB 1SIWB 1FD8A 2VQEJ 2ROGA 1IKVB 4ED4A 3EDQB 1YVFA 3H5UA 3SDEA 4AD6A 4DU7A 1QLNA 5KG2A 1JIHA 1APSA 5HATA 4DJBA 1U09A 3DN9A 3BDEA 1Q8IA 5J2QB 3LGNA 3B78A 4BWMA 4CH7A 1HA1A 1OY9A 1T05A 5KFRA 4LF5J 1X4HA 1FJGF 2YKMB 1RT4B 5A76A 1JLFA 2KHCA 1RT5B 3BR9A 2RDIA 1VQNS 4OYMA 1F5AA 5IQQA 4PQUB 1GNKA 1H6KX 3AJDA 3GR1A 3KLFB 3TR5A 3F56A 4OHYA 1FERA 1G2EA 1U24A 4URSA 5AJ3J 1T03B 3MTJA 4HHHA 1FK9A 4QOTA 3Q83A 1VR6A 3T1HF 3DOKA 2YX4A 2HWTA 3HFZB 3H90A 4MIBA 4GC7A 4I7FB 5IM0A 2VL1A 5DM6Q 3CCES 5KFVA 3NCPA 1TVRB 2R8GA 3EE3A 1SXLA 2J6UA 2A2CA 2R7RA 1J27A 2DB1A 3I0SA 4DR4J 1N36F 1QUPA 1WC4A 2IHR1 1DLOB 2DTJA 1C1BB 5IV3A 4X4SA 2Y0SD 4K4XA 2B4UA 2WBRA 2DGSA 3UPPA 3CJ8A 5E41A 1ZBTA 2WADA 3FCHA 2FJAB 2V5HG 1GAOA 2CIMA 3KK3B 1VOMA 4M5GA 4P6QA 3E51A 4ZP6A 2VJVA 3QWUA 2HNZA 2ASJA 1M5KC 1KS2A 2DPJA 4RW6B 2A6MA 3CWJA 3Q2TC 4CI0B 3U1NA 5HSPA 4R25A 4S0MA 2UXBF 3SV3A 5B0DA 5F9LA 4C3LA 3H25A 1WG4A 2QG9B 2JEGA 1Z2LA 4UUXA 3DKDA 4JI1F 4NLGA 4FYXB 4B3SF 2KM8C 4LF7J 3G87A 4IDKB 2FZGB 2FHOB 3H59A 1NPKA 3OFFA 4CH1A 3A1YG 2GIFA 5HVHA 1UWBA 2RVJA 2ZEJA 3W5XA 2FB0A 2BKPA 2D3OR 2OLWA 1X4CA 2VFTA 1FRMA 4TY8A 1X4DA 4D3GA 2OKQA 1OS5A 5U47A 2DNPA 1R3NA 4JI6J 2MQMA 3D6FB 4NE9C 1H73A 3OT9A 5F8LA 1T05B 4DL5A 3ILOA 1UCNA 2CFXA 2EFVA 3HT0A 3CVKA 1JLFB 2XHCA 2J76E 1HNXF 1NSPA 1JKHA 4RBTA 3I9ZA 4DSKA 3OR2A 5L38A 3K17A 1FF2A 1UPMB 3QSYB 2BJDA 2GVZB 2KH9A 5E3AA 1SJQA 3DDIA 1BXNA 3FRZA 1NKBA 1FK9B 4WFYA 4MKAA 5IM0B 1RYSA 1MN7A 4XO0A 3MAHA 2W8LA 3WIVA 2CJAA 3VALA 2DXDA 1CJTA 1DAXA 1F5CA 2CJBA 1YRTA 1U1QA 1GMUA 3QJPA 1QTMA 3I0SB 4NCGA 4IRKA 2Z2YB 2XO7A 3DDKA 2YVSA 3GE9A 1NK7A 4DMZA 4ZDNA 4L6V3 3VR1A 4RO0A 4J9QA 1XTZA 1WOSA 3GTYX 3HT3A 2H4YB 4A8MP 1XEZA 2D9PA 1NH7A 1PYTA 2PMHA 3BSOA 2C2EA 1X9SA 3O44A 1RWXB 3FKBA 1YJVA 1J5EF 4WIIA 1UW4A 1RT2B 2BQRA 1XN9A 1RA7A 1UWBB 2V8VA 2C28A 3TEGA 2XSJA 3ISND 1LV5A 3HO1A 5BR8J 3HP6A 5DDOC 4DWIA 5AXNA 4O0IA 4TY8B 3Q8PB 2ASLA 3EDRB 4RKUC 3GR0A 1EIYB 1RADB 4DUZF 5HJXA 1OSDA 4DFPA 1R7IA 3HJFA 2OTLS 1FESA 4OZ1A 1PSDA 1I6JA 4WYWA 2UV8A 1SQGA 3MURP 4K4TA 2XY6A 3FEZA 4YOEA 1JKHB 3D2WA 1HWUA 2QLXA 5THWA 4C98A 3TANA 2IA6A 4YY3J 1TK0A 3DXSX 4JV1A 4WFAQ 3OR2B 4WJBA 1RHUB 1JXLA 4GRSA 2V0NA 1H74A 4QYRA 1F9EB 2NXEA 3IFEA 3A8JA 1EHWA 1MU2A 2Y1LB 4WPAA 1B3TA 2F9JA 2X51A 2DEIA 1EETA 2CVEA 2KL8A 2DNGA 1MN9A 2VPXB 1CJTB 3IN5A 3D3CJ 2KXFA 5F41A 4NCGB 1YITS 1S9EB 3M9OB 3GIIA 2J0XA 3HSJA 1U1LA 4MKVA 2DCUB 2BX6A 3W9JA 2EFQA 2HFUA 2V9KA 2B5JA 3I5BA 5CXTA 3DU6A 4DSJA 4J9OA 5KT5A 3UE3A 3VWSA 3NAHA 3IBWA 4MKYA 3AJ2A 3PR4A 3MDFA 2FLNA 4I68A 4QIWD 1H7XA 4KR0B 4R0JA 2Z4PA 3CCJS 2RDJA 1R8CA 3RG6A 2AQ4A 3KK2A 4ZPDA 3K8WA 4OX8A 5A2QU 2CADA 2MY7A 4KAIA 2CXEA 3C14A 1W2BR 1ZYQA 1KTQA 3M32A 2P5VA 1HHSA 2GCFA 2MKYA 4BHQA 3GYNA 2R7XA 1WELA 5AXMA 1HWKA 2HGLA 3QPIA 4YMEA 2H5JB 3Q8RB 1KFSA 3LO3A 3HHKA 6AT1B 5L9NA 3CCQS 3MECA 1VJWA 2KU7A 4FXDA 1AZSA 3CJTA 3CO0P 2RDDA 3ETMA 2GJ2A 1P9QC 2V50A 5D78A 3KJNB 4DCOB 4RU2A 2UUCF 3CDWA 1KD1T 1L3SA 2HFZA 2W9CA 1FEHA 1D0EA 5DQIA 2FZCB 3WX4A 1VC5A 1MWUA 3T6BA 3HHDA 1OYDA 1RBLA 1R8BA 3A13A 2Z2MA 4GO7X 4UY85 3EZUA 1KC8T 3GPAA 3HI9A 2L9WA 1MU2B 4ZHRA 1UVNA 3KG1A 1HNVA 4QU6A 2VA3A 3R6LB 1EETB 2X1AA 5DG8A 3TAQA 2ZHOA 1IR1A 1U1KA 2YWFA 1TFWA 2YWGA 4C8MA 2VG5A 2CUYA 2NUUG 3NOCA 3UDEA 4ECZA 4B3MJ 3RGIA 4I6WA 1R8PA 4Y2AA 2MZTA 1NKEA 4OYIA 4NMLA 4RW9A 2FGOA 4QWAA 3M8QA 4BL3A 2RS2A 1OJ4A 2B5JB 2Z8QA 2KXHA 3T41A 4TU9A 2HFSA 1B4SA 1NHKL 2H3EB 1CLFA 2XNRA 3CD0A 4CLSA 2IM0A 3A3OB 3N6MA 4I64A 5LSOA 1QVGR 1JNZB 2F7VA 2CPFA 1SC1B 3KK2B 4PYAA 2Q43A 2FUG9 2MQNA 3TOQA 3C14B 1S4EA 1NB2A 5M19A 4OYPA 3M32B 2ZKUA 2ZVSA 1Y10A 4NYPA 2N4DA 4ZLNA 1U25A 5ETVA 1MG7A 4CT9A 5BXIA 1U45A 1SPBP 4X66F 2AJ1A 2J7WA 4UY8T 1YZ7A 3MECB 2HVIA 2YH1A 2G0IA 4IQXA 4EZ6A 2X1FA 5A8RB 5C7PA 3PW5A 3EXCX 1UFLA 4J37A 4ECXA 4ID8A 2W9CB 1P6TA 3C16A 1CBKA 1VQLS 2C42A 4QWCA 1HWJA 1YGYA 1LK5A 1KKHA 2RH3A 2BA9A 4NLQA 1FWKA 3RB0A 1XJWB 2QLBB 1EP4B 4NLYA 3NNCA 2OMOA 2V8HA 4DN9A 4TLQA 3IO1A 3C2PA 3FC9A 4ZHRB 4A8QA 2GA7A 1D8ZA 2LQ5A 3OLAA 3IM9A 3SFGA 1HNVB 1NK9A 2B51A 1KONA 3QRRA 1RAJA 3D9BA 2LP4A 1IKYB 1TL7A 2KT5A 1YJ9S 3QSIA 4QR0A 3PYEA 3KLGA 2VG5B 4LREA 3RBZA 3HLUA 3K2YA 2W7OA 5FLXY 4M5JA 4ZP7A 2H5EA 5C2CA 2J9DA 4JI1J 4RW9B 3UPNA 3M8QB 3TRGA 3TUIC 8AT1B 1NCLA 4B3TJ 4W4MA 4IKAA 2J9DE 2EWHA 4D3HA 1B7YB 1L3KA 3EZ5A 1PC5A 2A6OA 2P9GA 1N52B 4CTAA 1ZTTA 3AOCA 5F0UA 4Y28C 5J1PA 5JVHQ 5KOXA 3NS7B 2W4CA 3GV7B 4CJNA 3N4WA 3AT1B 2OELA 2X3DA 3OSPA 4CM0A 4I0WA 2EFGA 4DQQA 2HRTA 2VG6B 1H38A 2UXCJ 4DR7J 1JLCA 2IFXA 2LXFA 4K59A 5D4OA 5KG5A 5F8GA 1F9FA 3AOAA 4F0HA 1JJ2R 2XTJP 3LAMA 2ZBIA 4G6VB 2E66A 2LECA 4NASA 1RT6A 4R23A 1FT8A 4YHHJ 4PWDA 1KHWA 2RJZA 3M9NB 2E7XA 1K1QA 2PT0A 3QT7A 3BJYA 3QLHA 1R0CB 4URQU 5K9FA 1X31C 3IWNC 2FHJD 1HQUA 3C16B 2NZCA 2VBWA 2FY8A 4WP3A 2VUGA 2YX1A 2F8HA 2BRKA 5LT5A 1S79A 2V6AA 4O3NA 2BR0A 5LL6d 3QGHA 2AKWB 4QR2A 2F65A 1FD2A 4NLUA 5KFTA 1IUJA 2FPHX 3M8PA 1FJ7A 3J7Z5 4Q5VA 3SQGA 4F0MA 3R2CJ 3SZ2A 3DDNA 1GTHA 1TL7B 4KHPF 2CQ1A 3ENWA 2V2QA 4ES3A 4WFNQ 5F0WA 3DMJB 3M9MB 5HQLA 2D3UA 4YDXA 5KFDA 1VBZA 3OJSA 4CWBA 2J5AA 2VA2A 4F50A 2HQIA 3CCUS 4ELTA 1RAAB 3L4BC 1PJ7A 2PI4A 1FDBA 1WEXA 4DR2J 2AW0A 4OLOA 5KG6A 4WTOB 4Y2CA 4CQ1A 2IJFA 5HL7Q 4PUOA 2DNLA 3QZ8A 4IH6A 2XG8A 4N47A 1QJHA 5E7OB 5HBMB 2LDYA 1JLGA 2QFIA 5J2PA 1MROB 3NCQA 3PG9A 2GS8A 1FJEB 2ADBA 4MFBB 2EK1A 1V3ZA 1WD6A 4DUZJ 1M1GA 3JTNA 1ZM9A 3PW2A 1N5VA 3GIJA 2OPPB 4K5RA 3BKTA 2F8MA 2L9DA 4IOBA 4LSNA 3PW0A 2KYXA 1JLCB 2EBGA 5RUBA 5D77A 1F2HA 4R0QA 1RHMB 1Y11A 3BYPA 2MTLA 4HEA9 4USMA 1Q53A 2NPFA 3CMAS 3PW7A 3K58A 4Y2MA 5KFAA 1UA1A 1VQPS 2VBXA 5HP1A 3CE8A 2R3VA 3BH6B 2KN4A 1XNRF 4B3OA 4PWDB 3CXCR 5DLGA 2EPIA 5DM7Q 2QL7B 3GJTB 3FMBA 3W5ZA 3J7ZT 4ZPVR 1PJ6A 2HQCA 4WKYA 4NLRA 2VHGA 2UXDF 3V4IB 3DLBA 5IFMA 1HQUB 3MM8A 4NRTA 4DL6A 2EVZA 1RDRA 5CA5A 4X4PA 1RT1B 1L3UA 2VFSA 3MM9A 4PPZA 2GO9A 1TL1A 1NU4A 3N28A 3KUGA 4R0EA 1DTTA 2FHJA 2JX2A 4F4KA 3M8PB 4ZN3A 2LEPA 1DY3A 2A0FB 1URRA 3SQGB 1X4GA 4CPKA 2DH8A 1HHQA 2V2VA 3D54A 1WF2A 2DR5A 1Q8LA 2H54B 4IFVA 2F8EX 4YN3B 3N5BA 4QYZJ 2ZZMA 1MWTA 5ETQA 3KJFB 3GQCA 1NSQA 1NK6A 4LSLB 3RRHA 2CPYA 3M2RA 4DR5J 5JMNA 4LR8A 1CJUA 3SSQA 5JUMA 3CD7A 3A4TA 3BBFA 1XR6A 4PUOB 4WK3A 3LWMA 1IBLJ 4F4YA 4LBHA 2QFJA 5J2PB 4CLUA 4XDCA 1VLYA 1LW0B 5I4MA 4U6PA 2HQGA 4DXLA 1J5OA 2F63A 4A47A 4CZCA 1X5SA 2UUCJ 3RAMA 3R27A 4LSNB 1YBTA 3EWGA 3KHHA 4KGMA 2K2PA 2J8AA 2I8EA 3PYDA 4C0OC 3ITHB 2WB1D 1CQNA 2I6WA 2GMHA 3MHYA 2JC1A 1RAFB 3THTA 2DPIA 2AGOA 5EN1A 2O1PA 3CO9A 5A8KB 1MMDA 1HBMA 3PEJA 2XYHB 3GG1A 1RA6A 1RISA 1S1UA 3TVYA 4B3OB 1SV5A 4KC5A 1FTCA 3MFHA 3O5TB 4O3PA 5KFEA 5C24B 2MDAA 3VVUA 4NOHA 3MM8B 5F8NA 4RBVA 4QBUA 3KDOA 1RSCA 2J9EA 4WZQA 1AFJA 1FRXA 2JL9A 3LALA 3MM9B 1RUSA 4NZ7A 1Q16B 1S1XA 3FSIA 3A12A 3TWZA 1TL1B 4MIWA 3VAHA 3DLLQ 2KFYA 1BQNB 1DTTB 2DH9A 3U1LA 1ZH5A 4J7CA 2GV1A 2NCKL 2ZC3A 4IH5A 3TVKA 4EYHB 2WAEA 4NEZA 4DG1A 2RUSA 1VQ8S 2GNKA 2CPZA 4L74A 5F3TA 4ZLJA 2IM3A 1X8DA 2V8DA 3ULHA 2RQMA 5EDWA 1TK8A 4IFVB 1S1WA 2NR0A 3H42A 1Q82T 3NY0A 4FPIA 3TJ8A 2JJ4D 5KOWA 2KI2A 4M5KA 3A3NB 2ZDOA 1IJEB 3M2RB 2LCWA 1CJUB 3TI0A 3W8PA 1DFDA 2KVIA 1J2VA 4PZVA 3SQOP 2QA2A 3B4DA 1SJRA 2CA9A 1C0UB 2XMVA 2Z2ZA 4X66J 1YJ7A 1YJWS 5LMUJ 3BQ1A 2MQ8A 3CC4S 3JYTA 2BJ3A 1TKDA 1S1VA 3H4BA 4ED8A 3R2DJ 3MFIA 4F26A 1ZM4A 2HMIA 3PFEA 2CNNB 4OIXA 3TO8A 4B08A 4RLEA 3W64A 4IUFA 1KEKA 5E3PA 4ZPCA 2V8GA 1WKKA 4JV5J 3F44A 3ZTQA 3ZXWA 2D69A 3BGFA 2IMWP 2BANB 1DHMA 1KLMA 1M5PC 3SBMA 2VKZG 1YWXA 1MSWD 1HBMB 3TQ1A 3DXBA 1RT7A 3CMQA 5G0RA 2B8PA 1N32F 2QJ3A 2LQ9A 1PJ5A 1RE1B 4LT6A 2CAJA 3JS9A 2C3YA 5GMDA 1S6PA 1JK9B 5FDLA 1TKTA 3MEDB 2RMLA 1JJCB 3JQJA 1U1MA 4HL9A 1S0VA 4ZIVA 1MWSA 2JNJA 1H0HB 1JXVA 3GV8B 3H40A 4N8OA 2P6TA 1SB6A 2B4VA 5H9FK 3DGPA 2V63A 2W9BA 3UR0A 2E9TA 3M2VA 3M4XA 4DG1B 3HD1A 5GVQA 4OI0A 1WI6A 4ICLA 4K4YA 1GXUA 4K4ZA 4OZ0A 4DS5A 2HBQB 1RKJA 2ZJQQ 3JXOA 2PD1A 1S1WB 5LMNJ 2ZOMA 2F4FA 1HWLA 1NDLA 4RUBA 4Q0BB 4RPFA 3R5DA 2BUNA 3RAXA 1S0OA 2YNFA 3Q22A 2A2DA 4DS4A 4NCAA 3BSAA 2D41A 2AEMA 4CO5A 2HHVA 4O3RA 3HFVA 4ETXA 4ZVOB 1YIJS 2HHPA 1H3DA 1QTNB 5IC6B 4WYLA 2FC8A 2WSEC 3IRXB 3WHIA 3T1AA 1FKOA 1L3TA 4E98A 3JYTB 4F8RA 1S1VB 2F4VJ 1QMFA 3D4JA 2BKNA 1B99A 1TMJA 2DNQA 2HBZB 4ZCIA 4X64J 2M8HA 3PY8A 1VISA 2GGPB 3VHQA 2XLIA 3CUNA 2HMIB 2XQCA 3P5TL 1FJCA 4OLPA 2PMWA 4JI5J 4KH1B 2UP1A 3F0NA 2JDJA 2FDNA 5F9NA 4LFBF 4HHJA 5T41A 2HVEA 5J2NA 4KGKA 4TQSA 3EGWB 3RR7A 1QDUB 4E2FB 4ECSA 1M5VC 1RT7B 3BGOP 1DTQA 1XR5A 1UVJA 1HMVB 3UD3P 4EZ9A 5FDLB 1TKTB 1KVKA 5IWAF 1WC1A 2HS3A 4NXMF 4JI0F 2XB2D 3X3UA 4EMDA 2IY5B 3CW2C 5HMZA 1BY9A 5GADI 4LF8F 2D9OA 4F3OA 1CC7A 2W9BB 2QA4S 3UVJA 3M2VB 4CLTA 2HFOA 4OJ1A 4Q43A 1IM6A 3PCOB 1AA1B 3D6MB 1TELA 3HZEA 4I69A 3NMRA 3K8VA 3RW6A 2RF2B 2YWWA 4ICLB 2ASYA 2IA0A 3KMQA 4URGA 3GFZA 2DGQA 4WXOA 2M2BA 4ZMMA 1AYEA 3OHAA 3I31A 3LH2S 2CQ4A 4QU7A 4U9RA 7FD1A 1A9NB 2DHAA 4USJC 3BF4A 5BYRA 3CT9A 2YNFB 4MYTA 2B43A 1T3NA 3LPYA 3L7UA 3TVZA 4K4SA 2ROEA 4M1KA 1UKUA 3UN5A 5A0YB 4OX9J 1PO6A 4UOGA 1FKOB 4JI8J 2YY3A 3IG1A 1YX2A 4WP8A 4OYXA 4UT4A 6FDRA 3J7YI 3BBBA 4LFAF 1FXRA 2UXDJ 4GVLA 2QC3A 2RQCA 3DYAA 3V6HA 3R1HA 2XS2A 3HVTA 5J2NB 4C9DA 4DV6F 2Y3YA 3IAS9 3QGIA 1U1OA 4HDGA 1KQGB 1RAEB 2DH7A 1SBRA 3LA0A 1BHNA 2CQHA 1GX5A 4B17A 3ET6A 5D4NA 3CCSS 4ZPWR 1BC6A 4IR9A 2EFNA 3M1VB 2CZ9A 2YPYA 1RBOB 1HNZJ 3UN3A 1HNWF 2ACYA 3AAWB 3ZZTA 2HQDA 4G1PA 5E33A 2BJ7A 2J0SD 1BQMB 3M8SA 4KY3A 1VDHA 2RT3A 4F67A 1N54B 1PBUA 4ZLPA 4N5SA 3BQ0A 4ZVTB 1W25A 1SC4B 2B4PA 2HGMA 2C3OA 5DLFA 1NMEB 2KJWA 1KWMA 5KFYA 4DR3F 2WVFA 4BL2A 5DETA 4DPXA 2YWKA 4OI4A 1FCAA 1JJHA 2W2MP 4A46A 1D9DA 3ZO7A 3AD7C 4DF4A 2FQQB 3PW4A 2IDLA 3HPOA 3BO2A 2VFVA 3K89A 2LQJA 1Q86T 1RWNB 2P9EA 3MMAA 1ZM2A 4Q8FA 2CPJA 4ZJOA 1SL2A 2UU9J 1M5HA 2K8GA 5ETLA 1NUEA 2JHEA 3NXZA 4NPOA 4X4QA 4ILMA 3N01A 1Q7LB 2HKEA 3M8WA 4PPDA 4DEZA
chains in the Genus database with same CATH topology
2R2UA 3ENQA 4YB7A 4C8YA 4FF4A 3OTOF 3ZC4A 3CJ2A 3IG1B 3OTBA 3HT3A 5D3GB 4NZ0A 2R9LA 4A8MP 1ZAXA 3WDOA 5SUHA 5LJ5Y 2CZ4A 4IFYA 1XEZA 2EFPA 2D9PA 1NH7A 4OX7A 4UQTA 2PMHA 1KQSR 2GGPA 3H98A 1DBDA 3PR5B 3L95X 2DRAA 5ITHA 3BSOA 2OFGX 2C2EA 3MAQA 1X9SA 4I6YA 1X4FA 4ZS6A 1VQSA 1WACA 1U2FA 4J9KA 3P3DA 3O44A 5HO4A 3I5CA 5L1IA 3FNNA 5CHCB 2PC6A 1XMQF 3KWMA 2GO8A 3L09A 1IKWB 1V9OA 4NLTA 4Q8EA 4ED1A 2LVWA 2AYEA 1YJVA 1SKSA 5GAHU 2JEJA 3PHEA 4O3QA 3HHLC 4XDDA 2N3OA 1J5EF 4KKOA 4WIIA 2L48A 1UW4A 4HT7A 3HKZD 2MQQA 2ZD1B 1RT2B 2CPEA 3HXMA 1YJTA 2BQRA 1XN9A 2DGXA 1ZPWX 1U26A 3BO4A 3JSBA 1RA7A 3MR3A 2I9SA 3G6XA 2FJBB 3Q8SB 1UWBB 4ZCKA 2XMKA 2V8VA 1KQKA 2C28A 3C6TA 3IWXA 2GFFA 2XSJA 3T9NA 3KFWX 1HMVA 2GMLA 3ZZYA 3ISND 2VG7A 1CG2A 2CQDA 5L8RC 4Y6IA 1LV5A 5IT0A 4I2PA 1G3OA 3HO1A 5F8IA 1HI0P 1TP7A 3U7JA 3HP6A 2M4MA 5DDOC 5AXNA 4O0IA 1TZ0A 4TY8B 3Q8PB 5KT3A 2ASLA 4CO0A 1YRUA 2XNQA 2HIQA 4OJHA 4RKUC 4NL5A 2J6TA 3GR0A 2PI5A 4ID5A 4K4WA 1JNRB 3NBPB 1FDDA 3GSDA 1LXNA 2EI5A 2OPQB 4PG4A 1M5SA 1NKCA 1FVQA 4QIFA 4DUZF 4FS2A 1OSDA 1ZOTA 2WSCC 3H2VE 2ZJPQ 1S1TB 4DFPA 3CPWR 1RTJB 4YR0A 5H9FJ 2CVIA 3BZQA 2OLVA 1R7IA 2IYGA 1RT4A 3HJFA 3U02A 2NLWA 4PXCA 2OTLS 1FESA 3KG0A 4IR1A 1IXKA 1VQ4S 4OHWA 4OZ1A 1PSDA 1YI2S 4F4XA 2QSWA 1RP5A 1I6JA 2RE1A 4IO9Q 4WYWA 3DHWC 2UV8A 3WBZA 2XS7A 2N4CA 2DR9A 2HHXA 1HPZB 3CJKB 1RT5A 3MURP 2E5HA 4K4TA 2PMZD 2XY6A 3H20A 2HZCA 3FEZA 4KFBB 2ABYA 4YOEA 1REVB 2BABA 1JKHB 2ZHBA 2BYCA 4A8FA 4OL8A 4X4VA 3D2WA 1HWUA 2QLXA 5THWA 4C98A 2ZH7A 3TANA 4RNOA 2IA6A 1ROFA 1TK0A 3DXSX 4M5DA 5BYQA 4WFAQ 4JV1A 4XPEA 2PGCA 3OR2B 2FVCA 2DHGA 2BM0A 2RU9A 3QMQA 4C8LA 1E6YB 4WJBA 3LP2A 2GQCA 1JXLA 2V0NA 1RI7A 2BBEA 1JWWA 1JLEB 3HZGA 4QYRA 3GYXB 4KO0A 5EWFA 5F3ZA 3L7PA 5T7LB 4YDDB 4F02A 5KFOA 3IFEA 3N6NA 1FKPB 2BXJA 2MJUA 3VTIA 2PO4A 3CC2S 1Q4RA 1SL0A 1MU2A 5KAKA 2UUAF 3J80Y 2RF2A 2M52A 1BQXA 1FNXH 3OQ2A 3CGIA 4H4MB 1TFYA 4J5OA 2F9JA 2X51A 2OPRA 4OJ3A 1S10A 1MWYA 2LA6A 4H4OA 5AE3A 1AUDA 3G71S 2ROPA 1EETA 3UI3A 2CVEA 1UEVA 2V4QA 3G96A 1KOOA 2DNGA 2VPXB 1YSJA 5CQGA 3US5A 5KT7A 3IN5A 2WONA 3G86A 1IKXB 1HBUA 2Q79A 4KV8B 4OQJA 4UQGA 4NXNF 3EXYA 4PKDB 2KXFA 2UVWA 2R7OA 4QWBA 4ECQA 3KLGB 2YQ3A 5F41A 2F3JA 1UVLA 2GQ2A 1VFJA 5DG9A 4ILLA 4NCGB 1YJUA 2DIVA 4XAKA 2HWHA 3MMAB 1YITS 2AYBA 5HMYA 3CD6S 1S9EB 3CCWA 1CPZA 3QGPA 4YQWA 3M9OB 3GIIA 5AXKA 2J0XA 1C1BA 1JLAA 4PR6A 4TNOA 1U1LA 2HLTA 3K59A 1HL6A 2DCUB 2VPYB 3EPIA 2ERRA 4ZVFA 4C8NA 1URNA 5A6PA 2EFQA 3UQSA 4CO1A 2CQGA 2V9KA 4QWDA 1CEZA 1N8RT 3VAKA 2P6SA 3OPKA 2B5JA 5IS2A 4HLBA 4B3OB 3LAKA 5KFCA 3GFXA 4I1TA 2OP5A 4QJGA 3I5BA 1SJ3P 3I82A 4DOZA 2KZMA 5A0YA 2FD2A 5CXTA 3VAGA 2HNDB 3KK3A 3DU6A 4DSJA 5KFZA 1PC4A 1D8YA 1B64A 2ZNYA 4DV7F 4PG5A 1OPIA 4LMZA 5J1EB 2ZBCA 4YP3A 2B9WA 4J9OA 4CTAB 2VH7A 3ISZA 5KT5A 3IC1A 1BWEA 3UE3A 4B9SA 3VWSA 2NS1B 1F60B 2VBYA 3NAHA 1D9FA 3KOAA 1XBWA 3KKFA 1D9AA 3GFHA 4C3KA 4RX6A 3IBWA 4JYAF 3PRDA 2XY5A 1QM9A 3AJ2A 4MKYA 4Y2IA 1S9GA 3PR4A 3MDFA 2FLNA 1R0AA 4B3MF 2R8JA 1LFPA 3QGGA 4I68A 3DLJA 2CYYA 4QIWD 1H7XA 4KR0B 4R0JA 2Z4PA 2VPZB 2XI2A 3CCJS 2RDJA 1SJFA 1R8CA 2AQ4A 4ZA1A 4YFUA 3KK2A 4ZPDA 3K8WA 4OX8A 1SKRA 1M0SA 2JLEA 3CIZA 2MYFA 4I4BA 2CJQA 3O8WA 2MY7A 3DWKA 5EX0A 1YJRA 4KAIA 3X1LB 1W2BR 4IDKA 4KKOB 1ZYQA 1KTQA 2B9XA 2J9CA 2R2RA 4F3MA 5LSRA 5KFQA 2R7SA 4QCLA 3K5LA 3RTVA 1VQKS 3LP1A 2P5VA 3M32A 1VIXA 1HHSA 2GCFA 4TY9A 4BHQA 3GYNA 2R7XA 1WELA 4OHZA 5AXMA 2LYVA 4HI2A 2VV5A 4F4WA 3O2IA 4WFZA 1HWKA 3C6TB 2R8HA 3JTOA 1S48A 2B7BB 1TL3B 2HGLA 2KG1A 1JX4A 3E2EA 3QPIA 4YMEA 2GIRA 3Q8RB 1KFSA 3MM6B 4N8NA 4NYOA 4I2PB 3LO3A 2BQ3A 3HHKA 4ZVEA 2FHKA 3UPOA 2I2YA 5DDPC 2N7YA 2EBEA 5DGBA 2IRXA 4ID5B 4OZLA 5L9NA 1U6BA 1DURA 3BREA 1RT6B 3M1VA 3SYZA 3CCQS 2MJNA 4MNRA 2XZWA 1FKAF 3MECA 4JBCA 5K5MA 1VJWA 2KU7A 2JLFA 4B9MA 4OV1A 4Y0FA 4DV3F 4M94A 3VQTA 2BE2B 4TLRA 4B9UA 1HR0F 4FXDA 2RSQA 1UA0A 1Y3KA 2ZH8A 1NNDA 2GJ2A 1P9QC 1HQEA 5D78A 2J7KA 2G0CA 2B4OA 3QLHB 4RU2A 3LWLA 2UUCF 1BQMA 1X5TA 4PWUA 2VBZA 4MK7A 3CDWA 1RT3A 3TAPA 1KD1T 2FVPA 4ED5A 5GAEI 2ALZA 1PILA 1L3SA 2HFZA 5F8MA 2W9CA 4I67A 3MEEA 3THPA 1FEHA 3UPFA 4TU7A 2DIUA 2XY7A 1D0EA 4G3IA 5DQIA 4K4VA 3MOZA 1HD0A 1UAWA 3TAMA 2YNGB 4Y3CA 3R3TA 2OO4A 4CT8A 4M5DB 3WX4A 1F0XA 1VC5A 1K8AT 4RUCA 2U2FA 3D0IE 3BO3A 1MWUA 3R5BA 3T6BA 3HHDA 1VRUB 2ZH4A 1S77D 5EWGA 1DJ0A 2FTRA 1MWZA 4TKTA 1R8BA 1QAYA 3GV5B 2QE5A 2Z2MA 3PDNA 4NRUA 5IZHA 4GO7X 4UY85 3EZUA 1KC8T 1K73T 4USHA 7FDRA 3HI9A 2L9WA 5KT2A 2M0GB 4NCBA 2Z2LA 1MU2B 4ZHRA 5IQ6A 2NZ4A 1UVNA 3KG1A 1ZETA 3KHLA 3K0JA 1SJ1A 4ZPBA 4YB1P 2BW2A 3V5RA 4A48A 3OVBA 2OPRB 3T6JA 1Z2ZA 4QIVA 1HNVA 4H4OB 4QU6A 1SUQA 2AU0A 2VA3A 3KJVA 2DITA 4F3QA 3PFOA 2HHQA 1EETB 3PX0A 1X0FA 2X1AA 5DG8A 1TK5A 3TAQA 1JLQA 3KLIA 1OQ3A 2ZHOA 2CPXA 1U1KA 1RTHB 3OXGA 2YWFA 2AF6A 5L9XA 4JI2F 2QYCA 1TFWA 2YWGA 4HTIA 3KMSA 2LMIA 5B08A 4C8MA 2VG5A 2IJNA 2NUUG 4DFJA 4ECZA 3ZZOA 3SCLE 3LO7A 4I6WA 5KTQA 2PN6A 2ZDPA 3QAEA 3VF0B 4UUWA 1R8PA 1JLAB 4Y2AA 5GMKa 2MZTA 5E0OA 2C22A 3CJ5A 1NKEA 2UUTA 3ONQA 1S7HA 4NMLA 4RW9A 2FGOA 2Y1IA 4QWAA 3M8QA 1TKZA 5FD1A 4BL3A 2KXNB 2COLA 2RS2A 3AB4B 4DR1F 4RNMA 1RYRA 1KNZA 3TA2A 2QLWA 2APOA 3D1OA 2B5JB 2ILYA 4RW4A 1SH0A 5M1AA 2Z8QA 1H2TZ 2KRBA 2KXHA 3CCRS 2YNIB 3MMCA 4TU9A 3PX4A 1NRKA 5C25A 1Y5IB 4NZ6A 4QW8A 1QUVA 2CPHA 3KNGA 1ZZNA 1CLFA 2XNRA 3NWGA 4ZK7M 3CD0A 4N76A 1WF0A 1C4CA 5DJBA 4WU3A 2U1AA 3IA0A 4KT0C 4ATNA 1NZAA 2IM0A 3K5OA 3N6MA 4I64A 1S9GB 2I1RA 5LSOA 1JLGB 1ZAWA 2D3ZA 4M95A 1QVGR 1R0AB 2QMWA 1JNZB 1FHTA 2F7VA 1X4EA 2CPFA 3NCRA 4IQMA 5IT9Y 4GC6A 3KK2B 3MR6A 3GB0A 2GIQA 3FQLA 4J9NA 2Q43A 3TP2A 2FUG9 1ULRA 3N6LA 2KTQA 3UCZP 1VS3A 3PO4A 1VBXA 5KG7A 3CC7S 1FVSA 2MQNA 3RRKA 4IOCQ 1Y5LB 3TOQA 5G4DA 4MYUA 3ZZZA 2RILA 1RT2A 1HI8A 2ZD1A 4B3TF 2M5YA 5M19A 4RA7A 4DQPA 3LP1B 3M32B 2ZKUA 4PXBA 1RK8A 1X5OA 2ZVSA 4LIWA 3PNIA 3RU0A 2ZJRQ 2NYIA 4NYPA 2B6AB 1BLUA 2N4DA 4H4KC 3ZFZA 3BN7A 3TUZC 2FVQA 1U25A 1N88A 3DI6A 4FP9A 1N6QA 4CT9A 2YTCA 1U45A 2R7TA 1O8BA 1SIZA 4MJKA 3I4HX 2WAFA 4B3RF 1VQ5S 5D8HB 4X66F 1O5JA 4FBTA 2AJ1A 3UW1A 3NBPA 2J7WA 1WHWA 2ASDA 3KLEB 5DRKA 4UY8T 4J9SA 3MZIA 2RIJA 3MECB 2OH2A 2SXLA 2YH1A 2C2RA 2HVIA 4QWEA 5HP1B 1JJ4A 2DGVA 3Q24A 2LDIA 4FS1A 1F5BA 2DGTA 3IRWP 2AYGA 4DFMA 3P49B 1O0PA 1S6UA 1UVIA 2Z0GA 4IQXA 1HQEB 1XERA 1HNIA 4EZ6A 1VQYA 2X1FA 5A8RB 1PGZA 2A3JA 2ZOGA 2KRRA 2XULA 4NLOA 3EXCX 3PW5A 4A8OA 1RT3B 1UFLA 4J37A 4ECXA 2GJIA 2UXCF 4FNHA 4ID8A 4DR7F 1Y00A 2W9CB 1P6TA 3MEEB 3W7BA 3JSYA 5LJ3Y 5J2MA 4BWJA 3T9ZA 4X4UA 1VQLS 2HPUA 5EX3A 2C42A 1RQ0A 3SFUA 3TAMB 5SZTA 4QWCA 1HWJA 4DDFA 1YGYA 3S1TA 4ECYA 1LK5A 3DCAA 2IM1A 4A8KA 2RH3A 2BA9A 2IC3A 4N77A 3MUMP 1I94F 2VC1A 4NLQA 1K9MT 5KFSA 3DRYA 4ZPAA 5KFBA 1HBNB 2CQIA 1Q7YT 3IGNA 2FY1A 2XMTA 5T7LA 3DOMA 2VQFF 3OUYA 1WEYA 4TXSA 3RB0A 1FKPA 1EP4B 1W2IA 4NLYA 3NNCA 2OMOA 2V8HA 4DN9A 1KTVA 2W25A 4TLQA 3IO1A 2DR8A 3C2PA 2VONA 4ZHRB 4A8QA 2CG4A 3MUTP 3EQUA 2GA7A 4YHHF 1D8ZA 2W7AA 2LQ5A 5K8PA 3OLAA 2XMMA 1HHTP 4N41A 3SFGA 1Q78A 2PA3A 1NK8A 1H2UX 2HHSA 1HNVB 2UV8G 3SCKE 1NK9A 2B51A 1SUQB 2KJVA 3F41A 2GC8A 3M8RA 1KONA 3KJVB 1ELOA 2HNYA 4K4UA 3MF5A 2NXUA 1RAJA 3UCGA 4BS2A 4U67Q 2B56A 1IKYB 4A8YA 1IKXA 1BGXT 1SI9A 1JLQB 3KLIB 3M6XA 4QR1A 4LJMA 5JJBA 1E6VA 2ILZA 3RBDA 1SH3A 2KDOA 2KT5A 3RW7A 4GMKA 2JVOA 4QR0A 1YJ9S 3KLGA 2XWYA 4ECTA 5EUHA 4NA2A 2VG5B 3KTQA 1LOUA 5IXUA 4RZRA 1HWIA 3HLUA 3K2YA 3MD1A 5KG1A 2W7OA 4PG7A 5H9EJ 1S9EA 1QSSA 1PYYA 5FLXY 4W92B 1FO1A 5BJRA 4DV4F 4ZP7A 1SQEA 1TQLA 1YG0A 2BZ2A 2HGNA 3K57A 3HVAA 2H5EA 3IXQA 2W4PA 2J9DA 3DHXA 2CQ3A 3CCTA 3DU5A 4RW9B 3GIMA 1QAXA 3UPNA 4R3JA 3M8QB 1TKZB 3CEDA 3TRGA 1T02A 3TUIC 1M1KT 2IMOA 3ISNC 4KTQA 3LQVA 4IKAA 1Y9OA 4RW4B 1NEEA 5F8JA 1XMOF 1TL4A 3AH6A 2HNDA 2J9DE 2EWHA 3MMCB 4KE5A 5DDRC 4D3HA 1L3KA 4ECRA 5DG7A 3FFIA 3EZ5A 1PC5A 5C25B 2P9GA 1X9MA 1M90T 2OIHA 1N52B 1TL5A 4NLPA 5J1EA 2MSTA 4CTAA 5GAGU 2DD8S 2WK4A 1ZTTA 3CD5A 3QO9B 2A1BA 3NG8A 4WE1A 2DO0A 5F0UA 4QJVA 2F40A 3ZZPA 4F25A 4HKQA 5FIIA 4X65F 1Y3JA 4Y28C 1VK3A 2QIFA 3OFEA 1TUVA 2EW9A 2HHUA 3NAIA 3KLHA 3R1LA 2AD9A 3CCMS 4ZP9A 5J1PA 1CC8A 2MQOA 5JVHQ 2RD5C 5HN0A 5K8MA 4DL2A 5KOXA 3HMJG 3AB2B