2ZC4A

Penicillin-binding protein 2x (pbp 2x) acyl-enzyme complex (tebipenem) from streptococcus pneumoniae
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
158
structure length
158
Chain Sequence
AKRGTIYDRNGVPIAEDATSYNVYAVIDENYKSATGKILYVEKTQFNKVAEVFHKYLDMEESYVREQLSQPNLKQVSFGAKGNGITYANMMSIKKELEAAEVKGIDFTTSPNRSYPNGQFASSFIGLAQLHENEDGSKSLLGTSGMESSLNSILAGTD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of Biapenem and Tebipenem Complexed with Penicillin-Binding Proteins 2X and 1A from Streptococcus pneumoniae
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Biosynthetic protein
molecule keywords Penicillin-binding protein 2X
total genus 32
structure length 158
sequence length 158
chains with identical sequence D
ec nomenclature
pdb deposition date 2007-11-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2110 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2zc4A02
3.90.1310.10 Alpha Beta Alpha-Beta Complex Penicillin-binding protein 2a (Domain 2) Penicillin-binding protein 2a (Domain 2) 2zc4A01
4R1GA 5M1AA 3UE3A 5M18A 3ZG5A 4MNRA 3LO7A 4CJNA 4DKIA 1QMFA 1RP5A 2Z2MA 3UPOA 4OVDA 1MWUA 3VSLA 1MWTA 1QMEA 2ZC4A 2Z2LA 4R23A 3ZG0A 4CPKA 4BL3A 2ZC3A 4BL2A 3UN7A 1MWRA 3VSKA 3UPPA 4RA7A 1PYYA 3EQVA 5M19A 4N1XA 1K25A 4JBFA 3UPNA 1MWSA 5KSHA 4R0QA 4R3JA 1VQQA 4QJGA 3ZFZA 3EQUA 5U47A
chains in the Genus database with same CATH superfamily
2CQ1A 3BKUA 4FPRA 4C8NA 5IWAJ 4RWWA 3M30A 3DRSA 1VQ5S 4TQSA 2NXNA 1ZPWX 2BRLA 1JLAA 3UW1A 5HL7Q 3R5AA 3CT9A 4Y28C 3V81A 3VQTA 3G71S 4IRCA 3J7ZT 4M5DB 4NCGB 3M8RA 2AZ3A 4X4OA 2JWNA 4NASA 2RQCA 2W1BA 5HQ8A 1NKBA 1Q8IA 3BBFA 2V94A 2ZBCA 4NLQA 3T1YJ 2DR5A 3PJWA 4LRFA 4ZHRA 5K8OA 4GKJJ 2E7XA 2C3UA 2E5IA 4RW7B 2CPZA 3RYLA 3TUJC 4F3MA 3GYNA 3AJ1A 4RNNA 3MURP 5LMUF 4ZP7A 2CA9A 2DEIA 1WHYA 2FJVA 2Z4PA 2IBOA 2PFDA 2JEJA 3AOBA 2M8DB 1HHTP 3C46A 3MR7A 2VG5A 3NS6A 2IVFB 2V8GA 4I2QB 4DN0A 5DGAA 1DTTA 2ZZTA 1JNZB 3LAMA 3ONQA 3KLGB 4LRCA 3NL0A 2K06A 4DUTA 2D3ZA 3HFVA 1S0MA 3EXYA 2U2FA 4M5NA 1UPPA 2OPSB 3E2EA 4YOEA 1HNIB 4WZQA 4N8NA 2BANB 2C3PA 1RUSA 3Q86A 5E3AA 2N4DA 2YVSA 2ZUAA 3N6LA 1XNRJ 4K4VA 2OI2A 3M1VA 4Z7YA 1Y5IB 2IM0A 1H3DA 2PIIA 7FDRA 3CE8A 3Q8UA 6AT1B 3L3CA 3GE9A 4R0EA 3TZZA 3O1LA 2XS7A 5D0RA 3BH7B 2DT9A 2DIUA 1SJFA 4ECYA 3FMWA 5F0WA 4CYUB 4ZVSB 2GFFA 2X1FA 1U1MA 2EW9A 4L6V3 2YBVA 2GA7A 2DXEA 5K8MA 1FNOA 4AT1B 1VYAA 3JXOA 2K7KA 1BUXA 4WP9A 1AA1B 4B9MA 4J9RA 1HMVB 2ATCB 5DLGA 3MD3A 3OXLA 2J9CA 3M9NB 2FHJA 4KR0B 1FTRA 3DKDA 5EWGA 2CPYA 3UCGA 4ES3A 1CS4A 3EUNA 2W9CA 5HMWA 1S1TB 2AGPA 2MKHA 3GCWP 3QGIA 2LU1A 2ACYA 3Q2SC 1ZPVA 2M52A 3IBWA 3V4MA 3ENAA 1H38A 2Y8WA 3PRBA 4LMZA 1TL7A 4M5HA 1RYSA 3K0JA 1EB0A 3S01A 2GHWA 4CO0A 5IZHA 2R7VA 1MWYA 1HWKA 4IDKB 2P2CB 3U1MA 4I4BA 3EPIA 4LR8A 3R9LA 1Z2ZA 1WD6A 1WC6A 2DEJA 3M9MB 3AA8A 2Z8QA 1FD2A 2OPPB 4RJVA 2HVIA 1NEEA 4H4MB 3GCXP 2DNRA 1XTZA 1FDAA 1Q16B 1VQSA 2CUYA 2RDJA 1RISA 1YQHA 2HSEB 1IKYA 3C8YA 4U8VA 2IVYA 2F8EX 4KO0A 4LIWA 4D3HA 2YKMB 4DFPA 1JLFB 3HM9A 5L1KA 1T7PA 1OMSA 1WF1A 2EC2A 3PRDA 3AODA 3M6XA 1N5TA 3FFIA 4J9VA 3UVJA 4OVDA 5FD1A 2YNHB 2A18A 2N4CA 3B82A 2GC8A 4C3MA 4DQPA 4Q8FA 1MWTA 3A3NB 4YDXA 4B3RF 4WKRA 3FSXA 1LWFB 4MK9A 2V9KA 4LJMA 1MN7A 1HD1A 2CDRB 3AOAA 2JEIA 1BQMB 4G1IA 2KT2A 2LXUA 5DM6Q 4NL5A 3BR8A 3LP0A 1BHNA 3OXFA 5LSOA 1EP4B 4FF3A 2BJEA 2YNIA 4GO5X 4LBIA 1QSSA 2ZBPA 2FLPA 2QSWA 3BBCA 3PW4A 1QAJA 4RW4B 1M5SA 4F04B 2R42A 5CYQB 4R1GA 1RACB 1XEZA 4K7QA 4U96A 5AT1B 3TR5A 3CXCR 1VHFA 4I6WA 3PW2A 3CF5Q 1JKHA 1IWGA 5F8NA 3CDAA 2F63A 3FSIA 2AEJA 2XZTB 4PQUA 2UUCF 5KFUA 3WZ0A 2N3LA 4MIWA 1RAGB 1H74A 4PR6A 1FXLA 4XDCA 2NXJA 2DNNA 4CH0S 4USIA 4ZN3A 1I6JA 2A1BA 1G7CB 4BBYA 2IA6A 4E8UA 1UEUA 5D4OA 2HHTA 4JV0A 1JJHA 1F0XA 1U1RA 3EGVA 1FRXA 2DH8A 3R2CJ 4FBUA 5A8KB 3IA0A 3H90A 2C2DA 3A8JA 1T02A 3DU5A 4ED4A 3BO3A 2VG6A 3JS9A 2QO3A 3FJ2A 4EO6A 5M1AA 2KTQA 4WP8A 3DLGA 2VFVA 3L9ZA 1JLFA 3QAEA 2HVEA 3FEZA 4PXBA 3MFIA 4R5PA 1Y7PA 2LLZA 3P5BP 4LF9F 2HNYA 4P52A 2BVZA 4W98A 2K7JA 4IG0B 4QW8A 1UZHA 3I82A 2A2CA 1TMJA 2ASDA 1RDRA 3CJ0A 2MHNA 1BMQB 3NKYA 1FXRA 3DDKA 4KKOB 2ALZA 4P2SA 2RH3A 1BE4A 1FRHA 2WAQD 3B4MA 1BQMA 3GYGA 4AD6A 1L3VA 5ETKA 1V6HA 1LXJA 2OD6A 3NCQA 4RBUA 4LF8F 2W9AA 3U7JA 9RUBA 1CQMA 1RKJA 2YNIB 4L72B 4UT4A 3DOKB 1N5QA 1PJ5A 4EI2A 4Z2XA 4KAIA 2ZH3A 1WSVA 3MECA 1V3ZA 3C6UB 4DL7A 4RW4A 2QC3A 1VDHA 4DPXA 3KJVB 2QA2A 3SDEB 1HHQA 1JLCB 1HR0J 4M95A 2H5JB 1X4HA 2G4BA 4NX9A 1S9FA 4C97A 1U09A 3MMAA 4IFVB 3TOQA 1EJ7L 3H5UA 3KYLA 3OBIA 4CWBA 1AUSL 4DUYJ 4NXMJ 3J80U 4JV5F 1UA0A 3OD2A 5DZ7A 4B08A 2VOPA 4FVCA 1NRKA 1MWUA 3DHWC 2ZC4A 4W90B 4PQUB 2FJEB 2JC0A 2GQQA 5AJ3F 2BV3A 1RU2A 3MM8A 4O3PA 1ROFA 4H4OB 2HFNA 1VISA 2WW4A 1RWVB 2F8MA 3CD5A 3R5BA 4R8UA 2RHQB 3TUZC 2XM3A 1U48A 4KQZA 3DWKA 1LW0B 2Q6BA 2VICA 1RXOB 2FHOB 3PV8A 4ELUA 3MAAA 2YKQA 5AJ3J 3DLBA 4NYZA 4FXDA 1F9FA 3B6BA 1VRUB 2BR0A 4DR5J 4KFBA 1KOHA 5K8NA 4WJBA 2G0JA 2ROGA 5KT5A 4AL6A 1JMTA 2GJIA 2R3VA 4PZVA 4ZDNA 5H1SV 1IBCB 1HI8A 1WI6A 3UI3A 3I55S 2F1FA 4LR7A 2WOMB 4YB7A 4ZLLA 4R5PB 3J80Y 3CEDA 2WSCC 2K1RA 2D9OA 4MKAA 4URSA 3V2UC 3CCRS 2FJDB 4ECVA 3W66A 1R0AB 1PKUA 4IG0A 1B64A 3OR2A 1WJ9A 4KV8A 1U26A 3N6NA 3PR4A 3R1LA 1N34J 3DMJB 2B8PA 2DNQA 1P9QC 1BQXA 1F1BB 2VONA 3ZZZA 5LMUJ 2DGUA 1J5OA 3G2XA 2O01C 3WIUA 1YJNS 2KI2A 5GAHI 2W9BA 3T1YF 1KOOA 1AXQA 2BJ9A 2ZVSA 1Q81T 3PDNA 2GJ2A 1PC5A 1TV6A 1HQ2A 3L09A 3LANA 2HS4A 3KK2A 1ZM4A 2BQUA 4W4MA 3IS9B 4LREA 2N7CA 4IQXA 4B9NA 2C2KB 4WK1A 2FZCB 2GNKA 3C19A 2HFUA 4KSEB 3KJVA 2AW0A 2VBYA 5HMXA 4CO4A 1X8DA 4O0NA 3SSQA 2V8HA 3AD9C 1MMLA 3MMAB 5CYMA 4DU7A 4W92B 1MG7A 1C0TA 1EQMA 1R6YA 1JLBA 1TP7A 2CZVC 2GCFA 2B6AB 4V1Ak 2OUGA 2VG7A 4C11A 1PG5B 2R7OA 3HD2A 5IC6B 1NZAA 2OAUA 3TUIC 1N88A 4C8YA 5HSPA 1LK7A 3F73A 1QM9A 1U8SA 2V2KA 3CMAS 4KC5A 1X5OA 4ZCLA 5A6PA 2GVZA 2EVZA 3LA0A 3SMZA 5KFJA 4DR1J 2DD8S 3GFZA 4RUBA 1LFWA 3OHAA 1VQ4S 3R6GB 2PO4A 1X5PA 2HLTA 1VRUA 2VU5A 3VGTA 1U24A 4ZVHA 4V19X 3CCMS 5KFXA 1QLNA 4KT0C 3WQPA 1PILA 3QRPA 3MMJA 2BKPA 3EGNA 5BR8F 1DTQA 2C2NA 4KIAA 3PXGa 4K4WA 5KFWA 5AE1A 5GAGI 2YX1A 3M8QA 2MQQA 4F4WA 1JK9B 2XZWA 4CLSA 4QR0A 2WZ1A 1UWBA 5J2MA 3TARA 2QG9B 2QSFA 1QSLA 2VA2A 3C16A 2BKNA 3QIPA 5KFOA 1G6BA 3PVXA 4A4JA 3THTA 3DDIA 3TEHB 5DG9A 4FXWA 4UOHA 3IR7B 2E44A 1IKXA 2ASLA 3RW7A 1LWXA 4OLPA 1FJ7A 2QLXA 1HQUB 2RE1A 5G0RA 5A6WA 3TX8A 5KFEA 2RDIA 2QMWA 3Q0AA 3BSNA 3OVBA 4I2PA 4NLPA 1NDPA 3ZZTA 5LJ5Y 3MM5A 4UZBA 3SV4A 1P8GA 4A47A 2WTFA 4DQIA 4HHJA 3A3OB 4TXSA 3EZUA 1WEYA 4FXVA 2OMOA 3AHPA 1VGYA 3CCSS 3NGTA 2IMWP 2JL9A 2MSTA 4M63A 1YI2S 4X4UA 4HR2A 3T5HA 1JLEB 1T8EA 1CEZA 4DKIA 4F26A 3P6YC 4WIQA 1F5AA 2O66A 4C11B 3QZ8A 2V6AA 4B9TA 4BWJA 3ZXWA 5L1LA 1XMOF 3I4HX 1EZZB 1K73T 4HEA9 4YB5A 4KGXB 2OIHA 3D6TB 5KFMA 1MW7A 2CPFA 1U4BA 3T5LA 3H5SA 1FJGJ 2DK2A 5IV3A 1UVNA 2XMAA 4PPDA 3BN4A 3GFXA 2ERRA 2ASJA 2PFFB 3EQVA 2HWTA 1KONA 3DYAB 4ZP9A 1DZ5A 2VA3A 5ETLA 2MY8A 1N0VC 3PYGA 1XJWB 2Y3YA 4WFAQ 5L1IA 2KFNA 2OPRA 1BLUA 2YKNB 2I8EA 3VV2B 1IJFB 5F41A 2EK6A 3GFHA 2PE8A 3N01A 4ITSA 4Y6IA 2EFVA 3GIIA 4C8MA 3DOLA 3RZAA 1YVFA 2W2PP 3M8QB 3BQ1A 4A8YA 2CPIA 3G87A 2OLUA 1PJ7A 2J0WA 1GXLA 1LNQA 1VIOA 3OUYB 1FNMA 5F9NA 5FJ4A 2BOAA 1DHMA 3MI7X 4USHA 4ANDA 4LF5F 4WE1A 3FBEA 1SQFA 1RT1B 3H4BA 1YIJS 4NLSA 4MTPA 2CG8A 4OFZA 3N0VA 1FKOA 4DCJB 5AXNA 4IQMA 3UFCX 1E6YB 2YWEA 3QAUA 4OYAA 5BR8J 3Q8QB 2UVRA 2FZKB 2YNFA 5HK4A 4M5KA 3TAMA 3JSBA 4NA2A 4CLKA 1YTYA 4YP3A 5KFLA 5MLCV 4IOCQ 4USMA 3KK1B 3X1LB 2VASA 4XAKA 2L9WA 5HN0A 4DFKA 1B0TA 4TU7A 1YGYA 2P9EA 2ADCA 2HURA 2PEBA 3I87A 4QIEA 4U8YA 5FDLA 3K57A 1RT3A 2VKRA 2NUHA 5A76A 4QYZK 5KOXA 2V2QA 4PYDA 2A6MA 2MZJA 5KG5A 2RILA 4GKJF 1ZAXA 5IOLA 3ZTSA 3TANA 3J7AN 1RHQB 3KLHA 2ZOGA 3IAS9 5K14B 4CI0B 1T9VA 1Q0NA 3GU0A 2KB2A 1HIYA 4WXOA 5F0UA 3KHLA 1WC3A 2K2PA 1RE1B 2W25A 1CJVB 2CQ2A 3DM2A 4G1PA 1NHKL 1X4GA 4DV7F 2D3O1 1RABB 3DRRA 3NNAA 2GQ2A 5CQGA 2AWZA 4EK2A 4CDIA 4RNMA 3VAKA 2AYGA 3UNGC 1XR7A 4WBFA 2NZCA 3RUBL 4P74A 5C25A 4ES2A 5T14A 4QIVA 4XIUA 4B3OA 4LF6J 4WU2A 2HFSA 3Q83A 4WCEQ 2VV5A 1N52B 3D28A 2KHCA 3FQKA 4QU7A 1NLKL 1U8WA 3ZZRA 3W3SA 4ETZA 1FKPA 5L39A 4TQRA 2MJUA 2FY8A 3KLVA 3BSOA 3W9HA 1NJYA 3CC4S 2GAGC 3PX4A 4XTTA 3FUYA 5KFKA 4Q43A 3LPYA 2JZ5A 4MFBB 1BQNA 1RWNB 1SIZA 2QX0A 2DISA 2Z57B 4MYTA 3HPOA 5J2QB 1N6QA 3NGRA 2VBWA 2AJFE 3K5OA 4ECZA 2DR6A 3NGSA 3SXLA 2B4VA 2JHEA 2ZHOA 2C1EB 2HQCA 4I0WA 3K89A 1NSKL 2UZAA 2HRUA 2B4UA 4M5LA 5F3TA 5ITHA 3OTOJ 2FHJD 5HLFA 4A8FA 2LQ8A 1I94J 2CJYB 3KUGA 4LF4F 2R8HA 1NK9A 1OIAA 3ISNC 2M3DA 4PG4A 1NK4A 3Q2TC 3KLFA 4IR1A 4CLZA 3V81B 2RDDA 2J5AA 4ZCMA 3F0NA 1F3FA 2BE2B 3KJFB 4NCGA 4M5DA 5IM0A 4QWAA 4J9MA 1JLQB 1OS5A 1KHVA 3EXCX 4ID5A 4RKUC 2QA1A 2Z2YB 4KYZA 4UOFA 4K59A 1NKCA 4NZ7A 1B0PA 3KLIB 3T9ZA 1SKRA 2VHGA 5F8IA 3CO0P 4RNHA 5A2QY 3K59A 1NK8A 5K5MA 1IR1A 1OQ3A 2FQQB 1FHTA 5EGYA 3SEOA 3H20A 1O8BA 2YTCA 3V6HA 1UZDA 4I1TA 1GMWA 3HHLD 4JBCA 3S8SA 4ECRA 5FIIA 5KFZA 3L4BC 4JYAF 3BGFA 4MH8A 2K8GA 5GVQA 1Q53A 3RBDA 2ZH1A 1TL1A 4ECXA 4MJKA 1KC8T 1DTTB 1RTJB 5H9FJ 1PGZA 3BSCA 2HS3A 3BQ2A 2DCLA 1X4AA 5HJXA 4B3SF 4DV2J 5LJ3Y 1B7YB 2OO4A 4UY85 1HNIA 4GVBB 1YDLA 2ALYB 4HLBA 1RBOB 1PO6A 4PG6A 1JLGB 4R23A 1WG5A 3ILLA 5I3QA 2APOA 1FKPB 4RLEA 2BEFA 5SZTA 2HGNA 2RF2A 2ZE2B 2GGPB 3GILA 4U67Q 1M0SA 3GJQB 3N5FA 4J7CA 3CC7S 3UD3P 3UN7A 2A0FB 3PX0A 3BBBA 3NOCA 1DBDA 2QMUB 4A48A 1IBLF 4IH6A 5CXTA 4X2BA 3CJ2A 1FE4A 5J2QA 2B5JA 2Y0SD 2A10A 1RA6A 4OYBA 2D41A 1H72C 3M8PA 2ZUGA 1WWHA 3WHIA 4CLLA 4ETXA 2XGQA 1U6BA 2Z30B 3IWXA 2IJNA 2FJXA 4K4ZA 2Y9HA 1M5HA 1WDTA 2XHWA 3FBCA 4OHXA 1IM4A 2QGFB 3CCJS 1S97A 1M1HA 2F4VJ 3OQ2A 5L8RC 1CJUB 1N56A 4F2SA 3NY0A 4ED1A 2LQBA 2F3JA 3C66A 4O23A 2ILZA 1IVZA 4ZA1A 1S0VA 2DO4A 2QL9B 3X3UA 3KLFB 3H0PA 2HNZA 1IR0A 4GO7X 1CS4B 2BE2A 1EAYC 1YWXA 1JLQA 3NBPA 3PM9A 3WC0A 1TTHB 2LEPA 4I67A 2DRDA 3QIDA 1HPZA 3T41A 3KLIA 3QZ7A 3SCKE 4DDFA 1Q5VA 3VR1A 2G1DA 1RB0A 2V50A 3ETMA 2XWYA 1R8BA 1RI7A 3MAHA 3O8WA 4U6PA 3NLCA 2GO8A 1VQ9S 2HGLA 3EVOA 4X4QA 1K25A 3KMSA 3R7BB 2BXJA 4C7QA 3HD1A 3MF5A 5KSHA 1CC7A 2BMBA 2OPPA 5HI7A 2CQCA 2VPXB 2W7OA 3V6DB 2C2EA 2KFYA 5E2QA 4R3JA 4NCBA 4O44A 3HVTA 3ITHA 1IKYB 1FWLA 3KHRA 2DY1A 4DSFA 4F25A 5DO2A 4ZLNA 3QFHA 3DU6A 3AXKA 4FKXA 1RCXB 1XR5A 4CJNA 1ZA2B 5J1NA 2CPDA 4HT7A 3FFIB 4JI0F 4WZMA 1Y5NB 1KFDA 1TKTB 4FYYB 5D3GB 1P6TA 5A0YA 4XPCA 4EUVA 1ZETA 2DYAA 1VQYA 1XMOJ 3CDWA 2MQ8A 2GGPA 2DGQA 2MQPA 3M32B 2DHGA 1FWPA 4QQBA 1R31A 4ZP6A 1CG2A 4OZLA 2XI2A 2F8HA 4ZPVR 4ANEA 4U9RA 1U25A 3M4XA 2M9KA 4KB7A 4USUA 4YMEA 5KFHA 4XDDA 4QR2A 1HBMA 2V69A 3OV7A 1SV5A 2HVDA 1T9TA 5CYQA 4DCOB 1Y10A 1FO1A 1W2IA 3DRSB 2F5GA 5DLFA 3PHEA 2HIQA 3TX0A 4Y0FA 1X4DA 2EFQA 1S48A 3CCVS 1X7VA 3ILOA 4B3TF 1L5UA 3KJNB 3D2WA 1YKWA 1U2CA 3DFEA 2AD9A 3SQGB 2EG1A 1FXDA 2LVWA 3NBPB 1RHKB 1BD6A 4M8LA 4EU0A 3TI0A 2OLVA 1SJRA 1TFYA 4PXDA 3LOUA 5B0GA 4MIBA 3JQJA 5DS7A 3TA0A 4V19J 2NXUA 3AD8C 5M2PA 4UTGA 3DC2A 1AZSA 2FVRA 4N56A 1S6QA 1RHUB 3BF4A 4ZVTB 1TK5A 4N76A 1FK9A 4FN5A 1HWUA 1SIWB 4LRDA 4PCQA 2CKWA 4WYLA 2JRSA 3MZIA 4WTYA 3D0IE 3M2RA 3AXMA 2ZBIA 1T05B 2I1RA 1OY6A 3KLEA 5B0FA 3I96A 4NEYA 4QR1A 4A8XA 5KT2A 1I51B 2WHOA 3DRPB 2RJZA 3FDSA 3TW0A 2R7WA 5A0YB 3RJMB 3ZTQA 2RVJA 3OR1A 5I3UB 2JLGA 1UETA 1H7WA 4C8ZA 3MEDB 3K2YA 1UVKA 1X4EA 4CLWA 1YJWS 1Z2LA 2DNPA 1YJRA 3OTOF 2H3EB 1XN9A 2VOOA 2YWFA 2FGCA 3BS9A 3OTBA 4FP9A 4LVOP 4M94A 3QYYA 4DV1F 4A8SA 1T9WA 3HI9A 5L38A 1O51A 4LFAF 3EWGA 1IWAA 3CMES 2AP6A 4HH1A 2E66A 2NR0A 4CM0A 3V5RA 4K0KJ 2XY6A 2AX1A 1X5TA 5KG7A 4OI2A 2QLWA 3SSRA 2LEBA 2KJWA 3PYFA 1U2FA 3GG1A 3OLBA 3I9ZA 5HANA 2WVBA 4ZIWA 1GMVA 1S7IA 3THPA 1CULA 2ZC3A 3CW2C 4QWEA 3S7RA 4ED8A 3IC1A 3QJLA 4HHUA 3D6FB 1N0UA 1PAEX 4WFXA 3LWMA 2CJ9A 2RD5C 3VAGA 4IDKA 3I6PA 1PBAA 2UVWA 1AZSB 2MXYA 1KLMB 2HZVA 2G9OA 3A4TA 4KHMA 2H4YB 4NMLA 4ECQA 4P9SA 2MGZA 2AMCB 5BYSA 1RWMB 2FYXA 1NJZA 1A9NB 3TA1A 2W8LA 5D4LA 3H98A 3D1OA 4ZVQB 3VGVA 1FRKA 4AYBD 4RU9A 3D66A 1FDBA 1UEKA 3MCNA 1RTIB 4DSJA 3VQSA 4EZ9A 1FWKA 1NDCA 3VVUA 1WG1A 4ILRA 4JB8B 1VHIA 4L73A 2C3MA 4L3KA 1HBUA 2KFZA 1SXLA 4HL9A 5F8MA 5KT6A 3RRHA 2W2MP 2OTLS 1S10A 3T1HJ 4K50A 1LWFA 1RTHA 5LM7E 1GAOA 3MEEB 1WC0A 1IUJA 1WC1A 4IG3A 5JJBA 3AB4B 4A8WA 2WCXA 3KFWX 2YXLA 2W7PA 3MM9B 4OZ1A 3HULA 5B0CA 5LOQA 2XYPB 2IFXA 4QW9A 2KXHA 1WELA 1YZ6A 3T1HF 1EP4A 2IIHA 4P2XA 5KG0A 4NXNJ 1GFWB 2AEFA 1Q8LA 2HBQB 1KN6A 2C42A 4L76A 4RW9A 2B7BB 2MQMA 2QRRA 5D0HA 4ZS6A 4F4ZA 4B3SJ 2R7XA 3W5ZA 1KTVA 2PN6A 4LF6F 5ETTA 3EMTA 4F36A 7FD1A 2FD2A 3P45B 2N82B 3IG1B 4DR4F 3TP2A 4B3RJ 1JKHB 2LP4A 1U1NA 3QT7A 3PTWA 1JLBB 2BBEA 2Z2MA 1MMDA 4QJVA 5JUMA 3NNCA 1RT6A 4F02A 2HKEA 3UPOA 2D69A 4DV4F 4DV7J 4CH7A 4KHPJ 4X66F 2GZOA 2UUAJ 4BL3A 4OX9F 1LOUA 4OYWA 2AGQA 1R0BG 1S9EB 1SJ1A 1R6VA 2C2MB 1LXNA 2VB6A 1FRJA 1DURA 3NRBA 1FA0A 1KP6A 5A8RA 1NO8A 4J37A 4MKYA 1UFKA 3K5PA 2X1BA 1VBXA 3MPWA 1JXLA 1AW0A 7AT1B 4ALZA 2KYZA 1NK5A 1WUUA 5ADZA 2OEMA 2MGZB 4UQTA 1JJCB 2VDHA 4RZRA 1YRUA 2PA3A 4RL1A 4DWIA 1RWUA 2IRUA 3MD1A 2CVEA 3BR9A 3I5AA 4I69A 3TJAA 3OVAA 5KT7A 4HKQA 2VBXA 2VL1A 3VZIA 2GMHA 4UF4A 2HMIB 1F3VA 2DGXA 5E0OA 4DHVA 4LFBJ 3ET6B 4CLFA 2QJ3A 2XY5A 3MM6A 5RUBA 2KG0A 5EN1A 1DFDA 3R5CA 2UUCJ 2CADA 4J9KA 5D15A 2DHXA 2HBYB 5KT4A 2E1CA 1MMNA 1OPZA 3G86A 1TVRA 3KG4A 4ID8A 5KG6A 4G6VB 4DX6A 4M5IA 1Q95G 2FZGB 4TY9A 4B9UA 3VCDA 1RT7A 1HLWA 4K2XA 3P4UB 4NZ0A 1NH7A 1RU1A 1S9GB 1UMJA 2DH9A 3CWJA 3D6HB 3D68A 2AHOB 4QIGA 3DOKA 4URQU 3G8SA 2AYBA 1GNKA 3FBBA 2O5DA 4Q44A 1ZH5A 3D67A 4E2FB 2CNNB 2DITA 3H2UB 4C2MA 1REGX 2W01A 3M6VA 2IRYA 1H73A 4CNYA 3KTQA 4ZPTR 4HHHA 1SC4B 3NNHA 3R2DJ 5HMYA 2EKNA 2W4PA 2XC9A 3PKMA 4ED5A 3DRYA 5HVGA 4ZLPA 1S59A 1YSJA 4TN2A 2UU9J 3SFUA 3GMGA 1WOPA 4ZPWR 3Q23A 3O44A 2XMKA 3OXGA 2D1CA 1T9YA 4J5OA 4DV0J 4FS1A 1LWEA 3HDSA 2C22A 2DIVA 3ILIA 2V4JA 2C3YA 5GAEU 5CZVA 4PUOA 4R8UB 4OI0A 2J8SA 4DQRA 4B9VA 3G8TA 2MZRA 3A8EA 4HYKA 5J2NA 5A8RB 1M90T 4WFYA 1K8AT 4YDDB 3KOAA 2J9EA 1WTFA 1ICEB 3I31A 4ECSA 3TAPA 1UL3A 1D1UA 3LH2S 2M4MA 2RU9A 3KDOA 2UP1A 2F7VA 3A8IA 3OFHA 3KMQA 4YN3B 2MQLA 4KHRA 4LF2A 3VTIA 1VJWA 3FCVA 3MAQA 1HNVA 5DGBA 2WOMA 5LSLA 1N32F 4ZITA 1IKWA 4J90A 5KFVA 5HO4A 2M8HA 2CQ3A 2HMIA 1HW8A 1NHUA 2Q79A 1OYEA 1HNWF 2XNRA 3OUYA 1RP5A 2JVOA 1EIYB 1D0EA 2BABA 2XYHB 4KV8B 2BUNA 2GMJA 4ZPAA 4EBCA 4KJIA 2CPJA 1JWWA 4DPUA 4JUZA 1RT1A 3PG9A 4ANCA 1GK8A 4BL2A 4WTOB 3E01B 2BQRA 1K9MT 2BW7A 1RWXB 2DKOB 3LGNA 5B7WA 5BXIA 3D4JA 4TLQA 4DL3A 3QRQA 1TV6B 2IDLA 1PCAA 3LUYA 4KE5A 1SL1A 4JOUA 2YNGA 5AXMA 3TAMB 1QAYA 5E5NA 2KM8B 1VQQA 4FS2A 2ZH2A 2WW8A 5D4NA 4Q5VA 2YX7A 3HKZD 2VF3A 3PYEA 5J1EA 4EZ6A 4JI4F 5CYMB 4YR2A 3LO7A 4NLGA 3F41A 1BGXT 2VG7B 1RT2B 3FVYA 3GR0A 1IR2A 4MKBA 5KAKA 2XEXA 4QPXA 1T0TV 4WFZA 3SFGA 4EYIB 4DF4A 1KVIA 3C3LA 1GEHA 1WDDA 3CDUA 4KGMA 3T6JA 1D9FA 2ZM6J 2R7TA 2X51A 1MWRA 1UW4A 2B9WA 1RWPB 4RW6B 2BZ2A 2MMYA 4C48A 1DAXA 1ZZFA 2JDJA 4X4SA 2K3IA 2AGOA 2QZ8A 1XQIA 5IQQA 5KFGA 3UWTA 5C2CA 1WG4A 3MR3A 2YX4A 2NYHA 2BE7D 2HW3A 2E7WA 4QWDA 3BSAA 3HSDA 1X0PA 5KOWA 1KQKA 5AXLA 2DPIA 2VQEJ 1KD1T 1FX4A 3NWGA 4ERDA 2J0QD 3FQLA 3M8SA 4YHHJ 5C25B 1CJTB 4C0HA 2B51A 1IKWB 2L9NA 1TL5A 3OFGA 4BDPA 1U6ZA 3TRGA 1GMUA 2YPZA 3CO9A 3W63A 4J9QA 4CPKA 5LXYA 1Q5YA 2AF6A 5KG1A 1RWWB 5GAGU 4DV0F 2QIFA 4F0MA 4OX6A 4ZK7M 1FF2A 2JH3A 1TR0A 2IM2A 2OPQB 5KFRA 3FGVA 4AL7A 2KO1A 2LU2A 2FTRA 3POTB 1HNZJ 2IRXA 3QO9B 3NOGA 2G2YA 4JI8F 1NU4A 2UVUA 2VPYB 2A2DA 3RU0A 4I2PB 3AAWB 4EO8A 2AJ2A 2KU7A 3R5DA 2ZDPA 5BYQA 3ISZA 4TKTA 2HHHF 2DR7A 3EQUA 3QT6A 4LF7F 4ED3A 1R7IA 1Q4RA 2DHHA 3G82A 2UXBJ 5J1EB 4OX7A 4BC9A 1PYTA 3HVWA 3VGSA 3ZTOA 4WWSA 2FUG9 4KRWA 3IN5A 1RAJA 4KGVB 4MK7A 3MPUB 4UOCA 1SI9A 1IXKA 3BN7A 5KFAA 3C15B 2MSSA 1Y11A 1TK8A 2UXDJ 2BJ8A 1HA1A 2FIUA 1DQ8A 2XBPA 4NLWA 4ZVUB 4J9OA 3CD6S 2DGOA 3LO3A 1CLFA 3TZXA 2FLOA 1O5JA 5DJBA 2DRBA 1U7LA 1LWCA 2L3MA 4LF7J 4Q8EA 4EBDA 4K4TA 3GPAA 3BGLA 1URNA 3UPNA 1VI7A 1MWSA 5E3QA 5CAAA 2DNKA 5IQ6A 4NA1A 1YJ7A 3EE3A 4NLDA 1HNXJ 2V2VA 3J81j 1SCJB 4L74A 3FKBA 3IGVA 3UNYA 2QA4G 1FTCA 3DOLB 3IAM9 1RYRA 2F4VF 4C3LA 1ZTTA 3ZG5A 4OI3A 3CCQS 4IO1A 4KH0B 3ADAC 3W61A 2QFIA 3ELHA 3D1QA 2ZHBA 2MQOA 2Z2LA 1EQ0A 8ATCB 1KRPA 4X64F 2YWWA 3EDRB 4X66J 3T6BA 2ZE2A 2OPQA 2DGSA 2YWKA 1CSJA 2MKCA 3SCJE 2J9DA 3H2LA 3MMCB 3MPYA 1E6VA 2IM1A 3PEHA 5IC4B 3ZFVA 3EZOA 2LMIA 1E6YA 4BHQA 5GADI 4RA7A 3MR2A 2VQEF 1FDNA 2XZDB 2AKWB 4RUHA 4X62J 3M8PB 5C42B 4QWCA 1RT5A 5E3PA 3AQPA 4K5SA 3TEGA 3R5JB 3W8PA 4DG1B 4NLTA 2MKKA 2YKAA 3FC9A 4MKVA 3OSNA 2FY1A 4LFBF 3KK1A 2HQIA 2FGOA 3HVAA 3BJYA 2HAIA 2CIMA 3QSYB 4ZLJA 1NJXA 1D8ZA 1RLCL 3GP9A 1CBKA 2E1AA 3TQ1A 4TVAB 3JSRA 1RT3B 2NXEA 5ETVA 5EWFA 1HHSA 2CRLA 2VFTA 3OJSA 2V2ZA 5H9EJ 3A1YG 4X4TA 3I4PA 2V68A 2BM1A 4NI2A 4LSNB 3K8WA 3G6YA 1IKVB 2PT0A 3R6LB 1S77D 3SZ2A 1KWMA 2VFSA 4YUDA 2GO9A 2VC0A 3MTKA 1PBUA 2H5IB 4K4UA 2DCUB 1RHMB 3P8BB 1UFLA 3M2VB 3THVA 1U47A 3L7PA 3OL6A 3G4SS 3NS5A 2QLJB 4OZ0A 1IBKJ 1FVQA 1P9YA 2HNDB 1HBNB 1ZA1B 1P1LA 3KUEA 4MAKA 2DH7A 3UD4P 3P5TL 1HR0F 2KZZA 2WAEA 1B3TA 2ZVIA 2E9TA 2OGUA 5C7PA 1S79A 1TL3B 3V4IB 3GTYX 1NHVA 1OSCA 1U6FA 1UFWA 2O67A 2HLUA 3AT1B 3FSYA 4C98A 2R7SA 2E5LJ 3M05A 4EBEA 2BANA 1X9WA 3ETOA 2KJVA 4P73A 4CO5A 4Q7AA 5DQGA 1NK0A 3MR5A 2DPJA 3H59A 2E9ZA 5KFDA 2FPHX 2WVCA 2B0GA 2QL7B 5IFMA 4LF1A 1KVKA 5BYRA 1NUEA 2JFDA 5C24B 3MPVA 3K58A 2AEMA 4RWXA 1NJIT 3DI6A 5CYJA 2XI3A 3T5KA 2J7UA 1RT5B 5CH7B 4FBTA 4LF5J 4ZCKA 3KK3B 2CAJA 4X4RA 4I68A 1T03A 3TWZA 2HRYA 1SV5B 3RG6A 1VJQA 3CJSA 3M2UA 3QGGA 1WORA 1X60A 1MWZA 1FE0A 3M9OB 3GSIA 1RJJA 1H2TZ 2EI5A 4P7TA 3N9UC 1WF0A 3EGZA 2MZ1A 4QYZJ 3ZZOA 5LSRA 1QMFA 1IM6A 3PRVA 4X4PA 3D3BJ 4KPCA 1EETB 1EKRA 3SQGA 4YR3A 2W24A 3D0HE 2W4CA 3VAJA 3H7HB 3PZPA 3H5YA 2G1HA 4NI2B 3WX4A 3LW5C 1TL7B 4F3QA 4DL2A 3BDEA 4CLTA 5EDWA 4DZ6A 4OL8A 2UXCJ 4PABA 2NS1B 2IVMA 1Z1ZA 1YJUA 2AJ4A 3JQMA 5LXRA 4Y3CA 5DQHA 3D3CJ 1W26A 1NBEB 4IOBA 4CO1A 5IV4A 1J2VA 5J1PA 3UCUP 3M2VA 1KR4A 4WU3A 3CB4A 3TAQA 3Q8YA 4F8RA 4DV1J 3EVWA 1SH3A 2J9DE 2XULA 2M7SA 4JI0J 2VDIA 1MU2B 1HBNA 1KQSR 2IAJA 2A3JA 3WDOA 2IMOA 1RAOA 2ZWOA 2G2OA 2KHDA 2YKMA 2RU3A 1XMQF 3KLEB 2N3OA 2RIJA 3CJQA 3N28A 1KBRA 5D0EA 1QD1A 3D7SB 3FRZA 4GC6A 2ROPA 4NPOA 5DDOC 4DR5F 2YNHA 1YLXA 2RMLA 3PW5A 1JJ4A 1K47A 1MSWD 1QMEA 5EX0A 4OZNA 1C1BB 3RR8A 3I56S 1DARA 2DY9A 1QVFR 1ZOTA 1SB6A 4OYOA 2FDNA 5I4MA 1FEHA 1PSDA 2MHEA 1R43A 3W5XA 3TZWA 2M88A 3UO0A 1P27B 2DNOA 2UV8G 5C24A 5KFNA 3LP0B 5HATA 4DR2F 1R8AA 2ZOFA 1RAHB 5CABA 1WTBA 1C2PA 3PJ9A 1ZM3A 3MPDA 1RBLA 3MUVP 3I9V9 4PEOA 4USJC 2HFZA 4NWBA 4NXMF 4DS5A 4DPWA 1QAIA 3HHDA 1SC3B 3QLHA 2KYXA 4LSLB 4RW8B 3K8VA 1RWOB 4ZVPB 3M30B 4ZJQA 2NREA 3BB5A 3QFWA 4DV5J 5DQIA 2V63A 5DDRC 1A0OB 3EICA 3VAMA 4QPTA 2GV1A 2LA6A 3BPSP 3CC2S 2ZNZA 3AOCA 2P5VA 3BH6B 2PC6A 2HZAA 4FNHA 4Q2MA 4WK3A 2PMZD 4AUKA 3DOMB 1IBMJ 4HTJA 4IRDA 4KH1B 1XWLA 1RHRB 2LQ9A 4JI7J 1FFGB 1TU0B 3MCSA 2Y1LB 1TK0A 1G4CA 3O3LA 2LXIA 4Y2CA 4ZHRB 2HHHJ 2KN4A 3P3DA 1C1CA 1WOSA 4M5GA 1KLMA 2EBGA 4RW7A 4WPAA 1MROB 5L9NA 3EYZA 4DV6F 1N4LA 3J7A1 4CLYA 2B56A 5IXUA 2HQFA 3NAIA 1DQAA 2POKA 3V6JA 4GMKA 1TAQA 2ASYA 1MU2A 1WOOA 3ITHB 3MFHA 2VJVA 3F56A 2JC1A 3DLGB 1J5EF 2MKJA 3KLGA 2PI5A 3OTEA 4G65A 2D9PA 2CQGA 4NLUA 4WP3A 4BLGA 1SKUB 1PAUB 2JSXA 3I0SA 3IGNA 3CCLS 1SKSA 1DRZA 3HK2A 3MXHP 2B9YA 3DLHA 3PR5B 1H98A 2XLKA 3NGDA 3MGJA 4ZJLA 3SV3A 2RKIA 1VQNS 5I42A 3FCWA 3MEEA 2RUSA 3PW7A 2ILYA 3M32A 3ULHA 2V4QA 4AQYJ 3TVZA 3RAXA 1U1QA 3H2VE 4C0OC 4LF4J 5B0EA 3AJ2A 1FJCA 2IYGA 3OTDA 4A8OA 3AA9A 3AQOA 2CDQA 1FFWB 3PIPQ 1NK7A 2J7WA 4JI3J 1Q8BA 4QIWD 3PO4A 3C6UA 1WF2A 1A6LA 3E3XA 3VAHA 3V6KA 1NMEB 4RW8A 4LSLA 1JLCA 3JQKA 5EUHA 1NSQA 4ES1A 5AE2A 1HMVA 1R27B 1IBLJ 4C8KA 4TY8B 1PYSB 2M70A 3D9BA 3W5YA 1UVMA 4Z37A 2RB7A 5I3PA 3KG0A 2IA0A 3HT3A 3VSLA 2I6WA 3Q89A 2NSCA 4ZKAA 3I5CA 2U1AA 2WBRA 2R9LA 1D3WA 2OEJA 2HHUA 1HARA 2WONB 4I7FB 4H4OA 1H2UX 2KKHA 3MWBA 4TYAA 2ZJRQ 1V5IB 1LW0A 3I0RB 1KTQA 3D0GE 3MAAB 2L9DA 1VQ7S 1WNEA 1KKHA 4N1XA 1C1CB 3UD5A 2CWXA 1S6QB 4YEAA 5GAEI 3QWUA 2DHSA 3KNGA 4A8KA 2VODA 2R8JA 5E3CA 1VRQC 3HT0A 2F9JA 3T1AA 4H4MA 4RNOA 2E5HA 1S6PB 1WHWA 1U2RA 1UPMB 1I5OB 2BYCA 4C3KA 4JI8J 3CVKA 3AY0A 4KO0B 2NPFA 2MTLA 1HNZF 1AUDA 4WF9Q 3OW2R 1VCTA 5HVFA 2ZH9A 2WADA 2KT5A 2FHMA 4X65J 3HO1A 2LXFA 2G0IA 3DRPA 4N41A 4GRSA 3MM6B 3W65A 3I5BA 3OR1B 2ZHAA 2DHAA 2PI4A 2MZSA 3FBFA 3DXSX 3UDCA 3MEDA 1UJ4A 3R7NB 2DR8A 4C9DA 2J76E 4JI7F 3GLJA 2AYEA 3JTPA 5B0DA 3HX9A 5HQMA 2W9BB 4DR4J 3LGHA 1UW9A 5AE3A 4YQWA 2XY7A 4PYAA 1NPPA 5DETA 2CQPA 1HBOB 3NG8A 1RAEB 4IFYB 3IS9A 2X3DA 4HTIA 4WYWA 2OP5A 1IQTA 1RCOB 1DLOA 1LV5A 1TUGB 1T3NA 2E1RA 3UE3A 1FT8A 2BJDA 5E33A 4UZCA 1VQPS 4HT5A 1ZYQA 4KBIA 1SH0A 2QMXA 4MNRA 2HHSA 1Y0HA 2CFXA 1HNXF 3CCES 3HJVA 1SC6A 4YFUA 3PO5A 4X64J 3M8ZA 5J2PB 2VD3A 2VFRA 3MR6A 3LP1A 1CULB 1RTZA 2W2NP 2HQ3A 3IMQJ 2V4JB 4OI4A 3K5MA 3RAQA 2KL8A 1Y4ZB 4P2FA 4PUOB 1WSRA 4ICLB 3TJ8A 4OX8A 5F8LA 2HVZA 3NGKA 2R2TA 1H0HB 2PDAA 2OSQA 1S1VA 2F40A 2VKZG 1R8HA 4P6QA 4WIIA 2FJWA 1RK8A 2D74B 2NSBA 4N77A 4ZIVA 1TKXA 4PWWA 3HF5A 4UQGA 1S6PA 4J9SA 1XNRF 1Q7LB 3JYTA 2VG6B 4DFJA 1AFIA 4OHVA 1I1GA 3BO4A 4U7CA 3PW0A 2QEXS 1KHWA 1PC4A 1YJ9S 2ZD1B 1V9OA 1I3OB 2HFVA 3LGMA 1DJ0A 5CD4A 4B3MJ 1UWBB 1WHXA 2WVDA 2H54B 5T7LB 5CCLA 3ENQA 1H6KX 1HBUB 3ENVA 3OFEA 3ZZ0A 4CTAA 2H1YA 2UUBF 4FYXB 4R0JA 1T9UA 2W2QP 2V0NA 3AB2B 4NRUA 2EC0A 3H8YA 1RTHB 4KKOA 2DB1A 4H4KA 4Y2AA 1CVJA 4PRFA 2DNYA 2PMHA 2MYFA 3DGPB 2UXCF 3E01A 1IKXB 1NNDA 4MK8A 3TUPA 1KQFB 1N33F 1BWEA 1QTNB 3CGIA 4JBFA 2F65A 3M8YA 5F8HA 2P9CA 5F3ZA 3NXZA 3SSSA 4ED2A 3C6TB 3GB0A 4JYAJ 1DLOB 1X4BA 3SDEA 5FLXY 3PY8A 5GADU 4NRTA 2EEYA 1J27A 4N47A 1Q1KA 1RAAB 2EXUA 3CSKA 2QL5B 5IS2A 4Q0BB 4OX9J 1FRMA 1U0HB 3CCZA 3VHQA 2KRBA 2FC8A 4NYOA 2ADBA 5HROB 2BJ3A 1T3OA 2I9SA 1FFSB 2IM3A 4O3NA 2RAQA 3GJRB 5D6GA 1NKEA 5M2RA 3PFOA 1M5PC 2IPOB 3UCZP 1I94F 3QATA 5CA5A 4A8MP 3BKFA 4USVA 4K0KF 1N36F 3IFEA 3N4WA 3HJFA 5JMNA 3HCXA 4LT6A 1HWIA 4RBVA 4U7UK 2PA8D 2DXDA 4ZCIA 3NS7B 4DR7F 4KFBB 4NXNF 2XCAA 3Q24A 1QVGR 2IC3A 1TKXB 4QJGA 2OPRB 2YKNA 1N5SA 2GHPA 1JXVA 4OLOA 3IM9A 4X4NA 1FD8A 3LAKA 3PACA 1REVB 2H9ZA 3HZGA 4HVZA 1NCLA 1TUVA 4ZVGA 2D3OR 3L95X 4U7UD 3KHGA 2ZJQQ 2DGVA 5T7LA 4OHWA 1BY9A 4J9LA 4DUZF 4FYVB 4WE1B 5ETOA 2ZWPA 3DMJA 4K5RA 1XC9A 4JI2J 4LFCF 4J91A 1VMBA 2R7QA 1J5OB 2JJ4D 4QYRA 2HK3A 5G4DA 3Q8VA 1F2HA 1RT7B 3BZQA 5E3RA 4G1QA 3TO8A 2CG4A 1YK9A 4P2MA 4DEZA 1JB0C 2MDAA 2OLWA 2WK4A 3PYDA 1N33J 4M5MA 2YNFB 3CJ5A 4IH5A 4E98A 4O0IA 3KK2B 3OL8A 4JI1J 3O2IA 2FJAB 2HGMA 1Q78A 1QJHA 2GIRA 4ILMA 2IY5B 3DXBA 1S99A 1SQGA 2PSZA 1B0VA 2FVCA 1Y00A 3BKTA 4RPFA 2HQDA 3T19A 3G6VA 1J5EJ 4Q0BA 1YRTA 2Q6CA 3W60A 5E7OB 3GYXB 3B4DA 5HROA 1W7WA 2W8KA 4DV3J 1LFPA 2GS8A 2Q43A 2RUGA 3K5NA 2DNHA 1VRTB 1KSPA 2LQJA 4ED0A 4K4SA 4B3MF 3R27A 4Y2MA 4X62F 2GVZB 4DPOA 1T11A 4F0HA 2QV6A 3LF0A 5J2NB 2R2SA 4OHZA 2ATLA 1YJTA 3G6ES 2QLBB 3CJKB 1LWCB 2XB2D 1CJVA 4ZPDA 3A8KA 1S0OA 2XSJA 4NMXA 3EX7B 2IC3B 3DRRB 1XNQF 1NM2A 3HHEA 4H54A 3VALA 1SQEA 2JX2A 2VQFF 2XWXA 1DTQB 1OWXA 2RSQA 3FEXB 1REVA 4HACB 4DL4A 2EBEA 2Y1IA 1Q7YT 1FJEB 3H5XA 1V5VA 2IJRA 3DLJA 3RB4A 3ISND 1RLDA 1Y3KA 2B7CB 4NYPA 4EEYA 2VBZA 1HI0P 4DPTA 3EZ5A 2P9GA 2YY3A 3KHHA 3EPGA 1TUWA 4DS4A 2FLLA 3UQSA 1XK8A 2UU9F 1S5ZA 4ZVRB 3ZC4A 2H48B 1O6XA 3W9IA 2WRMA 4USWA 3B78A 3FNNA 3GONA 4OZ2A 3OLAA 1X4CA 1XNQJ 4G1QB 1BQNB 2YPYA 1HQUA 2GJFA 5G0RB 3RB6A 4DN9A 2PEHA 2C3OA 2KRRA 2HBRB 3ILJA 4TYBA 5D78A 4GKKF 3IO1A 2O3DA 4LQ9A 3DLLQ 5DRKA 3ZZPA 4CP5A 3HSGA 1KDNA 4DSLA 2COLA 1VS3A 1YZ7A 2JVRA 5HJYA 4LF8J 4UOGA 1Y5LB 1JLEA 3NCRA 2VFUA 1N32J 1YBUA 3HZEA 1RADB 2CNOB 3MMBA 8RUCA 5IM0B 4NCAA 3IRXB 1L3UA 4F2RA 3IR5B 2HWHA 3CDEA 1CJKB 3LP2A 1ELOA 1VRTA 4O4GA 4OV1A 4LSNA 2BJ7A 2K3KA 1U02A 1NDLA 1H2VZ 3VSKA 3BPDA 1U1OA 1NB7A 1ZTWA 3FZ2A 2Q3PA 4K8RA 3K5LA 3MEGB 4ECUA 2J6UA 3BM7A 4BWMA 2GHVC 5ETNA 5EHHA 2DO0A 5ETMA 1NAQA 4FKYA 4GVLA 3QGPA 4HACA 1VR6A 2Z58B 1QUPA 4ZN1A 1N5YB 2GQCA 4RNFA 4LRAA 4P7VA 1NZ8A 1LEOA 1TL3A 2E5JA 2KT3A 2HYIB 2OTJS 1NH8A 5B0AA 1BXNA 5JVHQ 5IWAF 4FF4A 2MZQA 4UUWA 1VIXA 2XYGB 4KPYA 1SH2A 5GMDA 2BQ3A 1HNWJ 1X4FA 5H9EK 1L3SA 3WC2A 2RF2B 1SKWA 4DV2F 3PX6A 1TZ0A 3T9NA 4QZVB 3K7RA 4X84A 4FVMA 4CLUA 3DDNA 5A8WA 2CZ4A 2H51B 3PFEA 3TJ9A 5HBMB 2V8DA 1S76D 2VQFJ 4PG8A 1YX2A 4DLEA 2GVDA 1X0FA 1B4SA 1ULRA 4AE5A 3GIKA 3KK3A 2ZEJA 5AXKA 1K0VA 2RRAA 2XS5A 5D8HB 5CD4H 1KQGB 1VLYA 3J7Z5 3W2WB 4EGLA 3GIJA 1GX6A 2X1AA 1CJUA 5HVHA 4ILLA 2N7YA 4DI6A 5M18A 1SPBP 2NZ4A 2RS8A 1QDUB 2XSFA 1M5OC 2GMLA 1IBKF 1VQ6S 3HP6A 1NPKA 4ZVEA 1GMWD 3HHLA 2DNGA 2HNZB 4ZP8A 4ZOSA 2OEKA 4F50A 2IBKA 2C2ZB 3IRXA 3A12A 5D4PA 4S0MA 1Q82T 3LP2B 1CJKA 3ENWA 4O4GB 4LVNP 4O3QA 3U1LA 3TVYA 2Y1RI 5GAHU 3GZ7A 4DR2J 2Q1LA 2UUTA 5KFQA 4P75A 5T41A 2Y8YA 4MIAA 1KVJA 4JI5J 2FHKA 3HMJG 3DM2B 1MLAA 3QWPA 5KFYA 3CJTA 4C8OA 1PJ6A 1X9MA 4NLYA 2HVHA 5ETPA 4ED6A 3QRRA 4YB6A 2L48A 3S1TA 1RHJB 3RRGA 5B09A 4DF8A 3BO2A 4I2QA 2XMMA 2CQDA 2CQHA 2CJQA 2FC9A 1FJGF 4FPIA 2PGCA 3CUNA 3KNAA 1GXTA 3CDBA 3QMQA 4R25A 2LCWA 3BGRB 2ABYA 2FJBB 3HHKA 4DLGA 1CQNA 5C2GA 1S0NA 5D3GA 4YR0A 4PWDB 1O0PA 1PIEA 2XHCA 2AQ4A 2I5JB 2DGWA 3JSYA 4B9SA 3M1VB 1ACMB 3JTNA 3OL7A 1WKLA 3S6EA 4NLVA 2E7VA 4P10A 2XNQA 2OHDA 3GR1A 4MFBA 5GMEA 4PKDB 2EPIA 4F7VA 3CCUS 2HK2A 1VC0A 2B9EA 2WSEC 1JXEA 3IBFB 3P49B 2FB0A 2V67A 1Q86T 1RT4B 4FZVA 3US5A 2RS2A 1S6OA 4R0QA 1Q79A 2KVQE 1QAXA 3C14A 3GV7B 2J0SD 2NUUG 1ZAVA 4IH7A 1M5VC 3QLHB 1YRXA 3BEGB 1OO0B 4HI1A 4J9NA 1NSAA 3PJXA 2ZH5A 4TNOA 1F60B 3DNCA 3PNIA 1S1UA 3R7SB 4OQJA 2RNEA 3ZTRA 3PIOQ 1N54B 3A13A 1S1XA 4UW2A 3BGUA 5KG4A 2ZJPQ 4QBUA 4PWUA 5L1JA 1S1TA 3TYTA 2QTWA 3UN5A 1SUQA 3AJDA 2P8IA 3FEYB 4ENOA 2E5GA 2CXEA 2CVIA 3NEKA 2CPHA 2I38A 2QE5A 3CULA 3CCTA 2HFOA 4QWBA 3NGUA 1IKVA 3JAMU 1H7XA 3GV8B 2HHPA 1P1TA 3HFZB 1XMQJ 4L3NA 5F8JA 1SL0A 2HHQA 2KM8C 1UVJA 2CZ9A 4PXEA 3LWLA 2M5YA 3Q8SB 4Q2LA 5KFFA 1FK9B 1S4FA 3PEJA 2J6SA 2ZNYA 1WACA 2CJKA 3NMRA 1GTHA 4WXWA 1IQZA 2GIQA 4DQQA 1UJ5A 4X4VA 1T05A 1RTJA 2EFOA 3RAMA 1XIQA 3B8HA 3V4IA 3FCHA 3CD7A 2AJ1A 1YHQS 1FNXH 3Q8RB 2LDYA 3MM7A 1R0CB 3RBEA 4DX7A 4OJGA 4OV6A 4L75A 5DG8A 5I3UA 4PWDA 2YQ0A 4I56A 2I5JA 2D3UA 4IRKA 1S57A 4QCLA 1AYEA 4OJ1A 1C0UB 3VAFA 5I42B 3HVRA 4CLPA 2LEAA 4UY8T 3AFGA 2MLYA 3LQVA 2QN6B 3KJQB 3NAHA 2CQ0A 4WFBQ 4RR5A 2VIHA 3QPIA 1MWQA 4DV5F 3E8OA 5ETQA 1X31C 1AB8A 4RO0A 1B7FA 2MKYA 3HHLC 1F9HA 3R97A 5HMZA 3W8GA 1D9AA 3KUHA 4DV4J 1NJWA 1NXIA 3SCLE 1GQEA 2UUAF 3C14B 3RR7A 2ROEA 2CQIA 1V3SA 1VQKS 1U1PA 1UEVA 3H40A 1AT1B 1C4CA 1HQEB 2YH1A 2FVPA 1RSCA 3QSIA 3QT5A 2E29A 4PG5A 3EM1A 2I0XA 1JLAB 3P96A 3FZBA 2LKZA 1VBZA 1EETA 3WX8A 4JI2F 4DBQA 3HXMA 4A8QA 3T3FA 2E5LF 2HHXA 3ZG0A 2CPEA 1K0TA 1RQ0A 4DV6J 2VC1A 1S12A 3UR3C 2ZZNA 1YBTA 5KG2A 3OTCA 1VQ8S 2OH2A 4H4KC 1QE1B 2IHR1 3CJ3A 3KXDA 2UV8A 4DCPB 1RWKB 4IO9Q 2EG2A 3T5JA 4CO2A 1UKUA 3DHXA 4JI1F 4K2JA 5A8KA 2V9WA 4QU6A 1SVDA 2F4FA 3HVTB 2VG5B 4O44B 4NA3A 2IAJB 1UTAA 2E1MC 3I32A 4LBPA 4OIXA 5KFPA 3GQCA 2XLJA 3J7YU 1X5SA 3M7VA 3MHYA 1GT8A 4DR1F 1BC6A 3IBCB 1RTIA 3NP5A 1C4AA 2O1PA 4OYXA 3MM7B 2KZMA 2XO6A 3VZHA 4JP8A 4EWTA 2CJAA 3BYRA 3N6MA 3TVKA 5F8GA 4OJ3A 3G9CA 1FKAF 1NPRA 1C1BA 1ZBTA 3QJPA 2X3GA 5K8PA 2B43A 1WKJA 2B4OA 3HLUA 8AT1B 3G6XA 4JV5J 3H42A 2NLWA 4TLRA 1LKZA 4ATNA 3CNQP 4DJBA 3MM9A 2XO7A 3VWSA 3CIMA 2QA4S 2RT3A 3AH6A 3PCOB 5M2UA 4CYUA 2C2OB 1URRA 3AD7C 1HBOA 3IXQA 4IFYA 3IM8A 2Z56B 3MECB 6FDRA 4DOZA 6FD1A 1F9EB 4CH1A 4DSEA 2CQBA 4RW9B 1K1SA 2DNZA 2V4RA 3HHNB 3QJJA 2MEWA 4O3SA 4D3GA 3JTOA 5E41A 1VC6A 2ZBQA 1HQEA 3BGOP 1VOMA 1UP1A 4JI6F 3VVTA 4GC7A 2VJUA 1YITS 3BDPA 2HHVA 1FX2A 1GTEA 3IG1A 2ZKUA 1IBMF 2XMWA 2FLNA 1Q8KA 4O4RA 1RT6B 2EWHA 4B02A 4HDHA 4M5JA 1JIHA 2W9CB 5LL6d 5J2PA 1CPZA 4OI1A 3DOMA 4O3OA 2UUBJ 2V5HG 3KWMA 4X65F 2UVVA 1S9EA 3L7UA 1TAUA 3EGWB 2XCPA 2ZKTA 2YQ1A 4OYZA 2MY7A 2JEGA 1TL4A 2MLZA 5BJRA 3R3TA 1QE1A 1K1QA 5JVGQ 3SQOP 4DFMA 2AT1B 1G3OA 1HW9A 4EYHB 1MROA 3ZTPA 4GKKJ 2DRAA 1DY3A 2KDOA 3LTOA 3QGHA 4YB1P 4LIRA 2LFVA 1IJEB 2RQ4A 4DX5A 2XMUA 3M2RB 2XQCA 3D1HA 3EJMA 3PHTA 5K9FA 5KFIA 2DBBA 1U45A 2ZD1A 2SXLA 1VBYA 4NE9C 1HD0A 5LMNJ 4DL6A 3IWLA 1VC5A 3DRXA 1RKIA 3I0SB 4IKAA 3PKYA 1QY7A 3UDEA 3UVJB 3J81Y 1ZZNA 3HKWA 3OR2B 4CTAB 4RUAA 1B99A 3DLEA 4BC7A 5H9FK 2RKIB 2RRBA 2B4PA 4IYQA 3TA2A 5C5JA 1TVRB 2YH0A 4DX8H 4USTA 3DGPA 1KNZA 1N5VA 2B3TB 3JAMY 4AL5A 1DQ9A 3QT8A 4ER8A 4Q45A 1RA7A 3J81U 1WI8A 2NCKL 2EFGA 1B70B 2AU0A 1NB2A 2KG1A 4TU9A 2NQPA 3QQCD 3MOZA 3IWNC 2WB1D 3GG0A 2BW2A 1VFJA 5KFBA 3GJSB 2R8IA 4ECTA 4E0DA 4WFNQ 4U95A 3R5GA 5DG7A 1U0HA 2DXFA 4MYUA 4TY8A 4ZPBA 1VQLS 1C0TB 2IDEA 2B6AA 4RX6A 1OSDA 2BX6A 2JFKA 4LQ3A 4QOTA 2Y0BB 2AZ1A 2HRTA 1T94A 3F44A 1ZS6A 2WONA 4I7FA 5CHCB 3VF0B 1TKZA 4WKYA 2IYIA 4NLOA 4CNZA 2W2OP 3I0RA 1FEEA 1HYSB 1EHWA 4BS2A 2GIFA 2QT7A 4N7TA 2R2UA 4LRBA 3Q22A 2RQMA 5ETRA 1SJQA 3U27A 2B9XA 4FNIA 3Q8PB 4B17A 2OELA 1JX4A 3GSDA 4C8LA 2GX8A 5DZ6A 3EVMA 2OFHX 3SYZA 4KHPF 1R3NA 1T9XA 1D9DA 2WAFA 4PQAA 2CNKB 1U0SA 2HEKA 1HNVB 2KXFA 4JI6J 2X1GA 4BCAA 2OKQA 2C28A 2HNYB 4ZVOB 3C16B 2ZOMA 3QIPB 3DLEB 3HFKA 3G8QA 1FRIA 4N8OA 1FDDA 1W25A 2XMVA 4NEZA 1SJ3P 2HAFA 2HG4A 3GWCA 4IG3B 5A2QU 3OSPA 1UJ6A 3BV8A 1V3RA 4F4KA 4OYIA 2XS2A 1VK8A 4YY3F 2RHSB 4DSKA 4CZCA 2OJ3A 4KY3A 2YWHA 2J0XA 3LPEA 3ZZYA 2ZH6A 1NK6A 2UXBF 5EX3A 1S7HA 4OZJA 2ZBRA 2YNGB 4OJHA 3MM5B 5DDQC 4DL0C 1N8RT 2DR9A 2G13A 2VPZB 2UXDF 4IUFA 2MQNA 4C0BA 1F5BA 4DR7J 2HHWA 4DR3F 1TMMA 2AIRB 1NSPA 1EKSA 3ICLA 4IFVA 1XBWA 5LMNF 4F4XA 1N36J 3N79A 1JJ2R 1FCAA 3CJ8A 3MCOA 1D09B 2LECA 2Z2ZA 2DNLA 3BYPA 4CT9A 2H5EA 3TNVA 2RQKA 1KFSA 2J6TA 1RT2A 4DSIA 1D8YA 5F9LA 2Y1JA 4TU8A 3LP1B 3OC2A 3DCAA 2JLEA 1S1WB 3W2VA 3MM8B 4AXIA 1TKZB 4CQ1A 3VGUA 2AJQA 3ZNUA 2EFPA 3E51A 1SL2A 2WVEA 2J7KA 2V34A 3MDFA 3MTJA 5KFCA 4ICLA 4RW6A 4Y2KA 3W9JA 1HYSA 2WVFA 3RB0A 4FF1A 1M1KT 4ELVA 1M1GA 2BKOA 3CJKA 1S1VB 4P72A 4CCHA 1WKKA 1LW2A 2CQ4A 1YBAA 2NXCA 2OD4A 2V8PA 2YQ3A 2XGPA 2W7AA 3D6MB 1MN9A 3OVSA 3JYTB 3DLKB 1NDKA 4LBHA 4OYPA 1UWAA 3RBZA 3CJ4A 3W7BA 1GH8A 1RBAA 2K1RB 2R8KA 4AXJA 4ELTA 2NPIA 3ET6A 1R0AA 2IJFA 1OY9A 2H4WB 1FI4A 2E1PA 3OL9A 2M2BA 1KLNA 2DVIA 1SBRA 1YJVA 4A46A 2C2RA 2HZCA 2WSFC 1FKOB 2G2ZA 1IN0A 2WBMA 4HI2A 4F0KA 4ED7A 3BQ0A 1OQ6A 3D5MA 1OYDA 3G96A 1PYYA 3UPPA 2VPWB 4OMFG 2R2RA 1S9GA 3CCWA 3KG1A 1RTDB 3GIRA 5ETSA 5HAOA 1F6TA 3O5TB 3C6TA 3IR6B 3UPFA 5HQLA 2VUGA 2G0CA 5MAOA 2ZDOA 3H25A 4OZ5A 2JNJA 2F9DA 3VAIA 2DTJA 4FYWB 5THWA 3SI8A 1A7GE 1S72S 4I6AA 2ZH7A 1HI1A 5FDLB 2MLXA 3MMBB 1N34F 1TQLA 3QBCA 3RGIA 3OHBA 1U49A 1VLOA 5D0GA 2LYVA 1Y9OA 1EARA 5K20B 1S1WA 3W2VB 1WEXA 4FDFA 1LWEB 4URGA 3IRWP 4JV2A 2JOQA 1MNEA 5IT4A 3MOJB 5IT9Y 2J8AA 3KLHB 3ZZUA 4MT1A 3K17A 4YY3J 4LSZB 4JI4J 4O3RA 1VQOS 4PG7A 2PMWA 3RB3A 3MEGA 5EWEA 3MEKA 1WC5A 1LW2B 1G2EA 2EFNA 2OMLA 2CJXB 4DU8A 4IR9A 4NLRA 1TKDA 1JQGA 2P6SA 1W2BR 2XLIA 1HWJA 2M0GB 3W62A 4CM2A 2CYYA 1ZAWA 4CIOA 1M5KC 3DLKA 3HSZA 3M6WA 1R8PA 1OJ4A 2EKYA 4KGKA 4OYMA 5L46A 3OJUA 3SCIE 1KS2A 1AROP 5FLXU 4B3OB 1VK3A 5CCMA 4PPZA 1S6UA 1KEKA 5IT0A 2BA9A 2AV5A 3GV5B 4J9UE 3CIZA 3CMQA 4XK8C 5J2MB 3CD0A 1ITPA 1N48A 3OFFA 5LT5A 4I6YA 3MCMA 5KFTA 3DN9A 4PXCA 2WB4A 4YHHF 3UR0A 1FERA 4Y2IA 1E6VB 1L3TA 3UE2A 2MKSA 1TFWA 2MPUA 1XMBA 5HBMA 1LQ9A 5A8WB 2MJNA 5HP1A 3CTRA 1RTDA 1R89A 3TZYA 1UVLA 2D7SA 1UCNA 3UDLA 3ZO7A 3GIMA 2GVDB 1FESA 3OPKA 3WIVA 2BDPA 1CC8A 2XG8A 2MKIA 2OFGX 2Q66A 5L9XA 3ZFZA 1HWLA 3W2WA 1WEZA 5IT9U 3R8YA 4IOAQ 4C4WA 4Z7CA 4ECWA 2AX0A 3WBZA 2XTJP 2YKPA 3HHLB 1OPIA 2RRNA 1S49A 3UDVA 4F4YA 1ZM9A 2DNMA 2ZFHA 4HDGA 1LK5A 2BM0A 4HH0A 4YS2A 3NCPA 4ID5B 1RGVA 1EX8A 2XMTA 5KTQA 2VH7A 2H65B 3FMBA 2R7RA 3R1HA 1F5CA 3CJRA 4DZDA 5DDPC 2L41A 5KG3A 4KTQA 3NMAA 5M19A 4M1KA 3DYAA 2L08A 1S4EA 4NZ6A 2XSJB 2MZTA 1QTMA 1PYOB 1GXUA 2QLFB 2BJ1A 1FVSA 1GX5A 2YWGA 3BREA 2E9RX 4XO0A 5U47A 2HNDA 1TL1B 4FF2A 1WC4A 2UUWA 3EDQB 3L7OA 1UVIA 2P6TA 2ZZMA 2KXNB 1CJTA 4Y34A 3JSMA 3OT9A 4KGZB 4Y00A 4DR6J 2HS0A 3BGRA 5D77A 3RBXA 4GVBA 2HWIA 4G3IA 3GFYA 4J9PA 1JLGA 4CO3A 3H4DA 2X7IA 3DGVA 4CRJA 4OZ3A 2R4FA 3RTVA 2HIYA 1VQMS 4NLXA 3ZNJ1 3QNWB 4I64A 4RUCA 3POTA 4MMOA 3SBMA 4P71A 4LR9A 3QO9A 3FK4A 2R8GA 5HP1B 3U02A 2B5JB 4DPYA 2MB0B 2PD1A 1RAIB 2LA4A 3DI6B 3J7YI 1VBKA 2ACMA 2QYGA 1RT4A 4FYDA 1QUVA 2YKOA 4Y65A 1Z4UA 2OSRA 1OY8A 3SIPB 4QIFA 3W64A 4F4AA 2LQ5A 2QYCA 2VZ9A 3JB9k 1T03B 4ZMMA 3D54A 3M2UB 2HQGA 2BE9B 3RRKA 3G82B 4EFAC 4AQYF 1QSYA 1WHVA 1R8CA 1UA1A 1S1UB 3B54A 3LALA 4NOHA 4C6AA 1YG0A 4CT8A 1RAFB 1S1XB 2DGTA 2NYIA 3MUMP 4DXLA 1K44A 4DL5A 2DJWA 1F2GA 1APSA 4LFAJ 5B08A 1SUQB 4ZJOA 2ZH8A 3N5BA 4JI5F 3C15A 5JXSA 4RBTA 1HPZB 1HFEL 4DMZA 4LF9J 1G1XA 4DR6F 2BACA 2ZH4A 1JNRB 2Z0GA 4UUXA 5K14A 4AFFA 2FVSA 1XR6A 2W4DA 1T95A 3UN3A 2I2YA 1XERA 1X9SA 4K4YA 3C2PA 3HSJA 3IP0A 1ZM2A 2KVIA 2GAHC 9ATCB 2JEFA 4DR3J 4N5SA 2CJBA 3UN2A 4DUZJ 5SUHA 3V6DA 2A6OA 3M6UA 4LFCJ 4OI6A 2R7UA 2BRKA 2KH9A 4EMDA 4USKA 5CZXA 1L3KA 1RZMA 5KFSA 2ZM6F 1TELA 3FRYA 3CPWR 2HPUA 1N5YA 2BOPA 3JSMB 2ZITA 2QFJA 3KKFA 4XPEA 2CNLB 4PAAA 4K4XA 4DUYF 1U1LA 4B9LA 1SJ4P 2JLFA 2OPSA 2XMJA 4F67A 3MUTP 2B8QA 3KDNA 4OHYA 1HKAA 1TKTA 2CPXA 4ZVFA 3RW6A 4JI3F 1UAWA 4F3OA 5B0BA 1BWVA 3TQEA 1AFJA 1C0UA 4B3TJ 4LUBA 3A3PB 2AYMA 3W1YC 1HL6A 2FVQA 3MMCA 5DM7Q 1U1KA 3M8WA 3GJTB 5GMKa 4JV1A 2AJ0A 4ZPCA 3O6QA 2V8VA 4RU2A 2CWKA 2LDIA 1N6QB 4DQSA 1SC1B 2EK1A 5C42A 1Y3JA 3U1NA 2HBZB 5KT3A 4DV3F 2GW8A 1HBMB 4DG1A 5HLFB 3NWRA 1FRLA
chains in the Genus database with same CATH topology
2CQ1A 4FPRA 4C8NA 4RWWA 3M30A 3DRSA 1VQ5S 4TQSA 1ZPWX 2BRLA 1JLAA 3UW1A 5HL7Q 3R5AA 3CT9A 4Y28C 3V81A 3VQTA 3G71S 4IRCA 3J7ZT 4M5DB 4NCGB 3M8RA 4X4OA 2JWNA 2RQCA 5HQ8A 1NKBA 1Q8IA 2V94A 2ZBCA 4NLQA 2DR5A 3PJWA 4ZHRA 5K8OA 2E7XA 2C3UA 2E5IA 4RW7B 2CPZA 3RYLA 3TUJC 4F3MA 3GYNA 3AJ1A 4RNNA 3MURP 5LMUF 4ZP7A 1WHYA 2FJVA 2Z4PA 2IBOA 2JEJA 2M8DB 1HHTP 2VG5A 3NS6A 2IVFB 2V8GA 4I2QB 4DN0A 5DGAA 1DTTA 3LAMA 1JNZB 3ONQA 3KLGB 3NL0A 2D3ZA 1S0MA 3EXYA 2U2FA 2OPSB 3E2EA 4YOEA 1HNIB 4WZQA 4N8NA 2BANB 2C3PA 5E3AA 2N4DA 2YVSA 3N6LA 4K4VA 3M1VA 1Y5IB 2IM0A 1H3DA 2PIIA 7FDRA 3CE8A 3L3CA 3GE9A 4R0EA 3O1LA 2XS7A 2DT9A 2DIUA 1SJFA 4ECYA 3FMWA 5F0WA 2GFFA 2X1FA 1U1MA 2EW9A 4L6V3 2GA7A 5K8MA 1FNOA 2K7KA 4B9MA 4J9RA 1HMVB 5DLGA 3MD3A 3OXLA 2J9CA 3M9NB 2FHJA 4KR0B 1FTRA 5EWGA 2CPYA 3UCGA 4ES3A 3EUNA 2AGPA 2W9CA 5HMWA 1S1TB 2MKHA 3QGIA 2LU1A 2ACYA 3Q2SC 1ZPVA 2M52A 3IBWA 3V4MA 1H38A 4LMZA 3PRBA 1RYSA 3K0JA 3S01A 2GHWA 4CO0A 5IZHA 2R7VA 1MWYA 1HWKA 4IDKB 3U1MA 4I4BA 3EPIA 3M9MB 1Z2ZA 1WD6A 3AA8A 2Z8QA 1FD2A 2OPPB 2HVIA 1NEEA 4H4MB 2RDJA 2DNRA 1XTZA 1Q16B 1FDAA 1VQSA 1T05B 1RISA 1YQHA 3C8YA 1IKYA 2IVYA 2F8EX 4KO0A 4LIWA 4D3HA 2YKMB 4DFPA 1JLFB 3HM9A 5L1KA 1T7PA 1WF1A 3PRDA 3M6XA 1N5TA 3FFIA 4OVDA 5FD1A 2YNHB 2A18A 2N4CA 3B82A 2GC8A 4C3MA 4DQPA 4Q8FA 1MWTA 4YDXA 4B3RF 4WKRA 3FSXA 1LWFB 4MK9A 2V9KA 4LJMA 1HD1A 2JEIA 1BQMB 4G1IA 2KT2A 2LXUA 5DM6Q 4NL5A 3BR8A 3LP0A 4FF3A 3OXFA 5LSOA 1EP4B 2BJEA 2YNIA 4GO5X 1QSSA 2FLPA 2QSWA 3PW4A 1QAJA 4RW4B 1M5SA 5CYQB 4R1GA 1XEZA 3TR5A 3CXCR 1VHFA 4I6WA 3PW2A 3CF5Q 1JKHA 5F8NA 3CDAA 3FSIA 4PQUA 2UUCF 5KFUA 3WZ0A 2N3LA 4MIWA 4PR6A 1FXLA 4XDCA 2DNNA 4CH0S 4USIA 1I6JA 2A1BA 1G7CB 4BBYA 2IA6A 4E8UA 1UEUA 5D4OA 2HHTA 4JV0A 1JJHA 1F0XA 1U1RA 1FRXA 2DH8A 4FBUA 5A8KB 3IA0A 2C2DA 1T02A 3DU5A 3BO3A 2VG6A 2QO3A 3FJ2A 4EO6A 5M1AA 3DLGA 2VFVA 4PXBA 1JLFA 3QAEA 3MFIA 3FEZA 4R5PA 1Y7PA 2LLZA 4LF9F 2HNYA 2BVZA 2K7JA 4IG0B 4QW8A 3I82A 2A2CA 2ASDA 1RDRA 3CJ0A 2MHNA 3NKYA 1FXRA 3DDKA 4KKOB 2ALZA 4P2SA 2RH3A 1FRHA 2WAQD 3B4MA 1L3VA 1BQMA 1V6HA 1LXJA 2OD6A 3NCQA 4RBUA 4LF8F 2W9AA 3U7JA 1CQMA 1RKJA 2YNIB 4L72B 3DOKB 1N5QA 2ZH3A 4Z2XA 4KAIA 3MECA 1V3ZA 3C6UB 4DL7A 4RW4A 3KJVB 2QA2A 3SDEB 1JLCB 4M95A 2G4BA 1X4HA 4DR6F 4NX9A 1S9FA 4C97A 1U09A 3MMAA 4IFVB 3TOQA 4DFMA 3H5UA 3KYLA 3OBIA 4JV5F 1UA0A 4B08A 2VOPA 4FVCA 1NRKA 1MWUA 3DHWC 2ZC4A 4W90B 4PQUB 2FJEB 2JC0A 2GQQA 5AJ3F 2BV3A 3MM8A 4O3PA 1ROFA 4H4OB 2HFNA 3R5BA 2F8MA 4R8UA 3CD5A 3TUZC 1U48A 3DWKA 4KQZA 1LW0B 2Q6BA 3PV8A 2FHOB 4ELUA 2YKQA 3DLBA 4NYZA 4FXDA 1F9FA 2BR0A 1VRUB 4KFBA 1KOHA 5K8NA 4WJBA 2ROGA 5KT5A 4AL6A 1JMTA 2GJIA 3I55S 5H1SV 4ZDNA 1WI6A 1HI8A 3UI3A 2F1FA 2WOMB 4YB7A 4R5PB 3J80Y 3CEDA 2WSCC 2K1RA 2D9OA 4MKAA 4URSA 3V2UC 3CCRS 2FJDB 4ECVA 1R0AB 4IG0A 1B64A 3OR2A 4KV8A 3PR4A 1U26A 3N6NA 3R1LA 3DMJB 2DNQA 1P9QC 1BQXA 2VONA 3ZZZA 1J5OA 2DGUA 2O01C 1YJNS 2KI2A 5GAHI 2W9BA 3T1YF 1KOOA 1AXQA 2ZVSA 1Q81T 3PDNA 2GJ2A 1PC5A 1TV6A 3L09A 3LANA 2HS4A 3KK2A 1ZM4A 2BQUA 3IS9B 2N7CA 4IQXA 4B9NA 4WK1A 2GNKA 3KJVA 4KSEB 2AW0A 2VBYA 5HMXA 4CO4A 1X8DA 3SSQA 2V8HA 1MMLA 3MMAB 5CYMA 4W92B 1C0TA 1R6YA 1TP7A 1JLBA 2CZVC 2GCFA 2B6AB 2VG7A 4C11A 2R7OA 1NZAA 2OAUA 3TUIC 1N88A 4C8YA 1LK7A 3F73A 1QM9A 1U8SA 2V2KA 3CMAS 4KC5A 1X5OA 4ZCLA 5A6PA 2EVZA 5KFJA 3SMZA 1VQ4S 2DD8S 3GFZA 3OHAA 1LFWA 2PO4A 1X5PA 1VRUA 2HLTA 1U24A 4ZVHA 4V19X 3CCMS 5KFXA 1QLNA 4KT0C 1PILA 3MMJA 3EGNA 5BR8F 1DTQA 3PXGa 4KIAA 4K4WA 5KFWA 5AE1A 5GAGI 2YX1A 3M8QA 2MQQA 4F4WA 1JK9B 2XZWA 4QR0A 1UWBA 5J2MA 3TARA 2QSFA 1QSLA 2VA2A 3QIPA 5KFOA 1G6BA 3PVXA 4A4JA 3THTA 5DG9A 4FXWA 3IR7B 2E44A 1IKXA 2ASLA 3RW7A 4OLPA 1FJ7A 2QLXA 1HQUB 2RE1A 5G0RA 5A6WA 3TX8A 5KFEA 2RDIA 2QMWA 3Q0AA 3BSNA 3OVBA 4I2PA 4NLPA 3ZZTA 5LJ5Y 3SV4A 3MM5A 4DQIA 4AL5A 1P8GA 4A47A 2WTFA 4HHJA 4TXSA 3EZUA 1WEYA 4FXVA 2OMOA 3AHPA 1VGYA 3CCSS 2IMWP 2JL9A 2MSTA 4M63A 1YI2S 4X4UA 3T5HA 1JLEB 1T8EA 1CEZA 4DKIA 4F26A 3P6YC 1F5AA 2O66A 4C11B 3QZ8A 4B9TA 4BWJA 1XMOF 5L1LA 3I4HX 1K73T 4HEA9 4YB5A 2OIHA 5KFMA 1MW7A 2CPFA 1U4BA 3T5LA 3H5SA 2DK2A 1UVNA 2PFFB 4PPDA 3BN4A 3GFXA 2ERRA 2ASJA 3EQVA 2HWTA 1KONA 3DYAB 4ZP9A 1DZ5A 2VA3A 2MY8A 1N0VC 4WFAQ 5L1IA 2KFNA 2OPRA 1BLUA 2YKNB 2I8EA 1IJFB 5F41A 2EK6A 3GFHA 2PE8A 3N01A 4ITSA 4Y6IA 2EFVA 3GIIA 4C8MA 3DOLA 3RZAA 1YVFA 3BQ1A 3M8QB 4A8YA 2CPIA 2OLUA 2J0WA 1GXLA 1VIOA 3OUYB 1FNMA 5F9NA 3MI7X 1DHMA 4USHA 4LF5F 4WE1A 1RT1B 3H4BA 1YIJS 4NLSA 4MTPA 4OFZA 3N0VA 1FKOA 5AXNA 4IQMA 3UFCX 1E6YB 2YWEA 3QAUA 3Q8QB 2UVRA 2YNFA 3TAMA 3JSBA 4NA2A 1YTYA 4YP3A 5MLCV 4IOCQ 3KK1B 3X1LB 2VASA 4XAKA 2L9WA 5HN0A 4DFKA 1B0TA 4TU7A 1YGYA 2P9EA 2ADCA 3I87A 4QIEA 5FDLA 3K57A 1RT3A 2VKRA 2NUHA 5KOXA 2MZJA 5KG5A 2RILA 4GKJF 1ZAXA 3TANA 3KLHA 2ZOGA 3IAS9 5K14B 4CI0B 2KB2A 4WXOA 5F0UA 3KHLA 2W25A 2K2PA 3DM2A 4G1PA 2CQ2A 1X4GA 4DV7F 3DRRA 3NNAA 2GQ2A 5CQGA 2AWZA 4RNMA 3VAKA 2AYGA 3UNGC 1XR7A 5C25A 4ES2A 5T14A 4QIVA 4XIUA 4B3OA 4WU2A 4WCEQ 2VV5A 1N52B 3D28A 2KHCA 3FQKA 4QU7A 3ZZRA 3W3SA 4ETZA 1FKPA 4TQRA 2MJUA 3KLVA 3BSOA 1NJYA 3CC4S 3PX4A 4Q43A 5KFKA 3LPYA 2JZ5A 4MFBB 1BQNA 1SIZA 4MYTA 3HPOA 2DISA 5J2QB 1N6QA 2VBWA 2AJFE 3K5OA 4ECZA 3SXLA 2B4VA 2JHEA 2ZHOA 5F3TA 5KFLA 4I0WA 5ITHA 2UZAA 2HRUA 2B4UA 5HLFA 4A8FA 2FHJD 4LF4F 2R8HA 1NK9A 1OIAA 3ISNC 2M3DA 4PG4A 1NK4A 3Q2TC 3KLFA 4IR1A 3V81B 2J5AA 4ZCMA 5IM0A 2BE2B 4NCGA 4M5DA 4QWAA 4J9MA 1JLQB 1OS5A 1KHVA 3EXCX 4ID5A 4RKUC 2QA1A 4K59A 1NKCA 4NZ7A 1B0PA 3KLIB 3T9ZA 1SKRA 5F8IA 1NK8A 4RNHA 5A2QY 3K59A 5K5MA 1OQ3A 5EGYA 3SEOA 3H20A 1O8BA 2YTCA 3V6HA 4I1TA 3HHLD 4JBCA 3S8SA 4ECRA 5FIIA 5KFZA 4JYAF 3BGFA 4MH8A 2K8GA 5GVQA 1Q53A 3RBDA 2ZH1A 1TL1A 4ECXA 4MJKA 1KC8T 1DTTB 1RTJB 5H9FJ 1PGZA 3BSCA 2HS3A 3BQ2A 2DCLA 1X4AA 4B3SF 5LJ3Y 4UY85 2OO4A 1HNIA 4HLBA 1PO6A 4R23A 4PG6A 1JLGB 1WG5A 5I3QA 2APOA 1FKPB 4RLEA 5SZTA 2HGNA 2RF2A 2ZE2B 2GGPB 3GILA 4U67Q 1M0SA 3N5FA 3CC7S 3UD3P 3UN7A 3PX0A 1DBDA 4A48A 1IBLF 4IH6A 5CXTA 4X2BA 3CJ2A 1FE4A 5J2QA 2B5JA 2Y0SD 2A10A 1RA6A 2ZH9A 2D41A 3M8PA 4ETXA 2ZUGA 1WWHA 2XGQA 1U6BA 3IWXA 2FJXA 2IJNA 4K4ZA 1M5HA 2XHWA 4OHXA 1IM4A 3CCJS 1S97A 3OQ2A 5L8RC 1N56A 4F2SA 4ED1A 2LQBA 2F3JA 3C66A 4O23A 2ILZA 4ZA1A 1S0VA 2DO4A 3KLFB 3X3UA 2HNZA 1IR0A 4GO7X 2BE2A 3NBPA 1YWXA 1JLQA 3PM9A 3WC0A 4I67A 2LEPA 3QIDA 1HPZA 3KLIA 3QZ7A 3SCKE 4DDFA 3VR1A 2G1DA 2XWYA 1R8BA 1RI7A 3MAHA 3O8WA 4U6PA 3NLCA 2GO8A 1VQ9S 2HGLA 4X4QA 1K25A 3KMSA 2BXJA 4C7QA 3MF5A 5KSHA 1CC7A 2OPPA 5HI7A 2CQCA 2VPXB 2W7OA 3V6DB 2C2EA 2KFYA 5E2QA 4R3JA 4NCBA 4O44A 3HVTA 3ITHA 1IKYB 3KHRA 4DSFA 4F25A 5DO2A 3DU6A 1XR5A 4CJNA 5J1NA 2CPDA 4HT7A 3FFIB 4JI0F 4WZMA 1Y5NB 1KFDA 1TKTB 5D3GB 1P6TA 5A0YA 4XPCA 4EUVA 1ZETA 1VQYA 3CDWA 2GGPA 2DGQA 2MQPA 3M32B 2DHGA 4QQBA 1R31A 4ZP6A 1CG2A 4OZLA 2XI2A 2F8HA 4ZPVR 4U9RA 1U25A 3M4XA 2M9KA 4KB7A 4YMEA 5KFHA 4XDDA 4QR2A 1HBMA 3OV7A 1SV5A 5CYQA 1FO1A 1W2IA 3DRSB 5DLFA 3PHEA 2HIQA 4Y0FA 1X4DA 2EFQA 1S48A 3CCVS 1X7VA 4B3TF 1L5UA 3D2WA 3DFEA 2AD9A 3SQGB 2EG1A 1FXDA 2LVWA 3NBPB 4EU0A 1BD6A 4M8LA 3TI0A 2OLVA 1SJRA 1TFYA 4PXDA 3LOUA 5B0GA 4MIBA 5DS7A 3TA0A 4V19J 2NXUA 5M2PA 3DC2A 2FVRA 4N56A 1S6QA 3BF4A 1TK5A 1FK9A 4FN5A 1HWUA 1SIWB 4PCQA 2CKWA 4WYLA 2JRSA 3MZIA 4WTYA 3D0IE 3M2RA 2ZBIA 2I1RA 3KLEA 5B0FA 3I96A 4A8XA 4QR1A 5KT2A 2WHOA 3DRPB 2RJZA 3FDSA 3TW0A 2R7WA 5A0YB 1Q7YT 2RVJA 3OR1A 5I3UB 2JLGA 1UETA 1H7WA 4C8ZA 3MEDB 3K2YA 1UVKA 1X4EA 1YJWS 1Z2LA 2DNPA 1YJRA 3OTOF 1XN9A 2VOOA 2YWFA 2FGCA 3BS9A 3OTBA 4FP9A 4LVOP 4M94A 3QYYA 4DV1F 4A8SA 3HI9A 5L38A 1O51A 4LFAF 3CMES 2AP6A 4HH1A 2E66A 2NR0A 3V5RA 2XY6A 2AX1A 1X5TA 5KG7A 4OI2A 2QLWA 3SSRA 2LEBA 2KJWA 1U2FA 3GG1A 3OLBA 3I9ZA 3THPA 4QWEA 2ZC3A 3S7RA 4ED8A 3IC1A 3QJLA 4WFXA 1N0UA 3VAGA 3LWMA 2CJ9A 2RD5C 4IDKA 3I6PA 2UVWA 2MXYA 1KLMB 2G9OA 4KHMA 4NMLA 4ECQA 2MGZA 5BYSA 1NJZA 1A9NB 3TA1A 2W8LA 5D4LA 3H98A 3D1OA 1FRKA 4AYBD 4RU9A 1FDBA 1RTIB 4DSJA 3VQSA 4EZ9A 1WG1A 4ILRA 2C3MA 1HBUA 1SXLA 4HL9A 5F8MA 5KT6A 3RRHA 2OTLS 4K50A 1S10A 1LWFA 1RTHA 1GAOA 3MEEB 1IUJA 5JJBA 4IG3A 4A8WA 3AB4B 2WCXA 3KFWX 2W7PA 3MM9B 4OZ1A 5B0CA 2IFXA 4QW9A 2KXHA 1WELA 3T1HF 1EP4A 5KG0A 1Q8LA 1KN6A 2C42A 4F4ZA 4RW9A 2B7BB