2ZC4A

Penicillin-binding protein 2x (pbp 2x) acyl-enzyme complex (tebipenem) from streptococcus pneumoniae
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
158
structure length
158
Chain Sequence
b'AKRGTIYDRNGVPIAEDATSYNVYAVIDENYKSATGKILYVEKTQFNKVAEVFHKYLDMEESYVREQLSQPNLKQVSFGAKGNGITYANMMSIKKELEAAEVKGIDFTTSPNRSYPNGQFASSFIGLAQLHENEDGSKSLLGTSGMESSLNSILAGTD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Penicillin-binding protein 2X
publication title Crystal Structures of Biapenem and Tebipenem Complexed with Penicillin-Binding Proteins 2X and 1A from Streptococcus pneumoniae
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Biosynthetic protein
total genus 32
structure length 158
sequence length 158
chains with identical sequence D
ec nomenclature
pdb deposition date 2007-11-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2110 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2zc4A02
3.90.1310.10 Alpha Beta Alpha-Beta Complex Penicillin-binding protein 2a (Domain 2) Penicillin-binding protein 2a (Domain 2) 2zc4A01
1MWRA 4MNRA 1MWSA 5M1AA 2Z2LA 3ZFZA 1QMEA 3VSLA 1MWUA 5KSHA 1K25A 3ZG5A 1RP5A 4BL3A 2ZC4A 3UN7A 3UE3A 4RA7A 3LO7A 1MWTA 2ZC3A 4JBFA 3EQVA 4OVDA 3UPOA 5M19A 3VSKA 3UPPA 4R0QA 1PYYA 4R1GA 4R23A 5U47A 3UPNA 2Z2MA 3EQUA 4R3JA 4BL2A 4DKIA 3ZG0A 4QJGA 4CPKA 1QMFA 4CJNA 1VQQA 5M18A 4N1XA
chains in the Genus database with same CATH superfamily
4WYWA 1XNRF 4KR0B 5A0YA 2BJ3A 3FFIB 5KSHA 1K25A 1T9WA 4ATNA 2DITA 4NL5A 4TU7A 1CULA 5ETNA 4HHUA 3UDCA 3LO3A 1CG2A 4B9SA 4CM0A 2LXFA 4J9LA 4K4TA 3US5A 2FZCB 3OXFA 1KVJA 3TUIC 3DLEB 4J9PA 2KYZA 4DU7A 1FFWB 2ZWPA 1HHTP 2RUSA 3KG0A 1JJHA 4ILLA 2HMIB 2RF2A 1GK8A 1RTJA 2IRXA 3T1YJ 1WC4A 1WOSA 1SC3B 5HP1B 4F3OA 3J7ZT 2UUBJ 2R8IA 2GC8A 1BQMA 2BYCA 4QIWD 4URSA 2HWTA 3FVYA 4LF5J 4JYAF 3HHLD 1GTHA 2Y8WA 2W2QP 1HNVA 2AJFE 1VC6A 2ZZTA 2VZ9A 1XQIA 4TN2A 2PT0A 4OLOA 1RT4A 1ZAWA 1ROFA 1X5PA 4RPFA 4O3PA 1RAFB 1R8HA 4JI5F 2FD2A 1TL3B 4A8FA 1REGX 2V6AA 3UDVA 2QLXA 1B4SA 2DH9A 4ZVFA 1TVRA 2HNDB 3OUYA 2F4VF 2GMJA 3JQJA 4ENOA 5DDOC 1Y10A 2HHWA 2VBWA 2VKZG 3DHXA 2ZZNA 1OY8A 4BLGA 4WK3A 2GJ2A 2QFIA 2ZFHA 4I7FB 4OI1A 1ZYQA 4TXSA 2IAJA 4PG7A 2YKMB 4C8MA 2RU3A 4YR3A 4F4YA 5HANA 1CJUA 5KFNA 3ZTSA 5DDRC 3UN5A 2DNPA 3M2RA 3AXMA 2B9XA 1IJEB 3SV3A 1O51A 1MMNA 3AB4B 3QBCA 4BCAA 4I69A 2B4VA 4NA3A 1BQXA 1IBMJ 1N36J 4FBUA 2DTJA 1DLOA 1NUEA 1A0OB 4K50A 5AE1A 1XMOJ 4W92B 1WF1A 3A13A 3V4MA 2VBXA 3R5BA 3C46A 1U1NA 3H90A 2F8EX 2UXCJ 1XJWB 3BBBA 4MH8A 3TP2A 4MKYA 5ETVA 2YKPA 4TQSA 5AT1B 1FNMA 4KY3A 4NPOA 4JV1A 2PEBA 3AQOA 1VQ5S 4NYPA 3OTEA 1F9EB 3FQLA 1GH8A 4WE1B 5F3ZA 5D0RA 5RUBA 4DSEA 5GVQA 1TV6A 1N54B 4J37A 2WW8A 4B3RF 2ZOFA 1VQ9S 1C0UA 2KRBA 4CYUA 3N01A 1N5TA 5GAHU 2CZ9A 3MD3A 2AHOB 5LSRA 4LRDA 4URGA 4F4ZA 2BEFA 4J7CA 3QO9B 2C2NA 1QD1A 4NI2B 3DGPB 4NLWA 1YJWS 4MIAA 1FA0A 2EC0A 3K8VA 2HVIA 4NYOA 3DGVA 1DTQB 3CD7A 2HQCA 1EETA 3PO4A 3H20A 2DT9A 1U45A 3KLGB 2F8HA 4K59A 3R6GB 1QE1B 3U27A 3ZTRA 2W01A 1MN9A 5KFRA 1NDKA 3Q2TC 4JI8J 1U6ZA 3TX8A 3B54A 5F9NA 3DM2A 1AUSL 2VG6B 1F3VA 4CO3A 1N4LA 3EWGA 4WIQA 2ACMA 2U1AA 5B0FA 2GGPB 2RKIB 2RRAA 3BPDA 3NWGA 2Y3YA 2B43A 1GFWB 3SIPB 1D8YA 3PVXA 2HWHA 2QEXS 4HT7A 5A8KB 3TAMA 1HBOB 4CQ1A 1Y5NB 2VFSA 2CPZA 3MPDA 1ICEB 4PYAA 5LOQA 1S1XB 5KG6A 3BH6B 3BYPA 4U7CA 2M70A 2ILZA 3A8EA 2XNQA 2OD6A 1GMWD 2V69A 3MECB 1HBMB 4M95A 4WIIA 4J5OA 4NLVA 1VFJA 3HSZA 1OWXA 3OTCA 2DPIA 3DOLA 4JV5F 2NZ4A 2OLVA 2UUCJ 2YNHA 1ACMB 3HI9A 3PRBA 1NDLA 2GCFA 1S1VB 4GC6A 3T5KA 2U2FA 2UXBJ 4O0NA 5I3PA 5KG5A 2OPPA 5E3QA 1YQHA 2YNIA 4FPIA 3T19A 1IQTA 3JSRA 2NYIA 4OI0A 4TLRA 3IS9A 5BR8F 1P1LA 1VQKS 4LF4J 1HBNB 2ZJPQ 1NDPA 2CQ0A 4PXCA 1T0TV 4IQXA 2XGPA 4DBQA 1S6PA 1ZZFA 3M05A 2NS1B 1RBOB 1JB0C 2OO4A 2AJ1A 4K7QA 1F1BB 2HFSA 3MEDA 3RBEA 5KFJA 1VBZA 2AYMA 2V63A 5C25B 5LXRA 4WFYA 1JJ2R 3G87A 3IG1A 2CKWA 4C8YA 4DV1J 4DZ6A 4USJC 1HMVA 3A4TA 2DGWA 3W60A 2XWXA 2J9DE 1WC1A 1KD1T 4DUZF 1SKRA 2DXFA 1AZSA 2XI3A 4LRFA 1X0FA 2ZNYA 4UQGA 2XCPA 4U96A 3ZNUA 3QWUA 4CI0B 4RU2A 2YNGA 3C3LA 1FKAF 2V0NA 4ED1A 3IA0A 3LP2B 3LP1A 2VL1A 3RAXA 5CCLA 4U9RA 2YWWA 3H4DA 1T05A 1CS4A 3QSIA 2W9CB 1SL0A 2GVDB 4Q45A 4LRAA 2Z4PA 4ES3A 2IM1A 5HI7A 2HHVA 2VDHA 4C8ZA 2WSEC 3AOAA 3TA0A 5H9EK 1F6TA 5C5JA 3V6HA 3B4DA 3CUNA 1RB0A 2Q66A 4FNIA 2H9ZA 1Q8KA 4NLYA 1H38A 1EB0A 2ALZA 1YJTA 3CC4S 2UU9F 2OJ3A 2I5JA 4IH5A 4QYZK 2GHWA 3N9UC 2DGSA 3E51A 3D3CJ 1C1CA 1SH2A 3I0SA 1FRKA 3D6FB 4ZPBA 4ZIVA 4KHPF 1N5YA 4OI3A 4JB8B 5HAOA 3L3CA 4ED0A 5GAEI 2XMTA 4CZCA 2H3EB 1HNWF 1R7IA 3C8YA 3BSOA 1Q78A 3V81B 3MR2A 2WB4A 3JXOA 5CYJA 3JQKA 1ULRA 3M30B 3H5YA 2XY7A 1KQKA 3NAHA 3JB9k 2HW3A 3JYTB 2LQBA 2YWEA 3MM6A 4PWDA 3D1OA 4DSLA 4DL2A 2BJEA 5G0RB 3VVTA 3QGGA 2GJFA 3G71S 2IJNA 5LL6d 2YQ3A 3ET6B 1JJCB 3PW5A 2APOA 2IRUA 3OT9A 1ZZNA 5KFFA 3C14B 5AJ3J 2UP1A 3UPNA 2CJBA 2BE9B 3L09A 4L6V3 3HJFA 2FJVA 4WXOA 1IBKJ 1NNDA 3POTA 2R7VA 1FRLA 1V3RA 4FYVB 1EZZB 4XK8C 2GHVC 4Y65A 2P6SA 4QIEA 3ITHB 2FJDB 3ZG0A 1REVA 1F9FA 4C0HA 2C28A 1T3NA 1O5JA 3CE8A 5KFEA 3HMJG 3MPYA 3A8IA 1SJQA 2ZVSA 5KFBA 2HWIA 1OJ4A 3E3XA 2MKIA 4OZ2A 3NS5A 2PD1A 1RHRB 2RQKA 4CO4A 2H51B 1S48A 3K5OA 3BGRB 1LEOA 2XO6A 4Q8FA 2RDDA 4PQUB 4ILRA 3T5HA 3TANA 5L38A 2F9DA 3VGUA 3HKWA 2WVEA 4ZHRA 3MMBB 1Y7PA 2NPIA 3JSMA 2HHHJ 3ZG5A 4JUZA 1HW8A 4YB1P 3SSRA 1IWAA 4WKYA 5DM7Q 3PR5B 1F9HA 4O4GA 2LMIA 4RBVA 5B0CA 5D4OA 3UPFA 3HVRA 1DY3A 4DX8H 4WZQA 2KKHA 4LBHA 2UVWA 3IM8A 4P2FA 2DHAA 2K8GA 3T5JA 5I3UA 1U47A 4QIGA 4GKKJ 2V9WA 2IC3A 1HA1A 3OFGA 2EK6A 5HN0A 5H9EJ 4FDFA 5A8WA 2BJ1A 3QIPA 2CUYA 4LR9A 3NWRA 5CABA 4A8QA 4M63A 1JLBB 2DXDA 4DN9A 1RK8A 5F0WA 3J80Y 2GIQA 2HNZA 1PSDA 4QYZJ 3M6VA 1S79A 5E7OB 1M5VC 2D41A 1JNRB 2OI2A 2H48B 3IWLA 3H98A 1D0EA 1NU4A 4RUAA 3GYNA 1NB2A 1JLFB 3VAKA 3DOMA 5BXIA 3HM9A 1KHWA 5GAHI 3CD6S 3D2WA 3AT1B 1ZM9A 2X3GA 3LUYA 4DV5J 1QAJA 4LFCJ 5IT0A 1LWCB 2DJWA 4X64J 3NXZA 3IBCB 3P45B 4NXNF 4KRWA 4RW7A 2ZWOA 3EX7B 1GMWA 2LQ9A 1SB6A 2GO9A 4BL3A 2ZC4A 3RRGA 4IFYA 1N6QA 2XZTB 1RT7A 2RILA 4NXMF 3K5LA 3E01B 3QT5A 1Q81T 4NX9A 4NLRA 1UPMB 1VK8A 1TKZA 3Q86A 1Z2LA 2Z0GA 4DDFA 4ED2A 4NLUA 3CJKA 2Y9HA 3TX0A 2YBVA 1IBLF 1RI7A 4JI1J 4V19J 3QRQA 1OSCA 3TUZC 1E6VA 2CIMA 2W1BA 1CQNA 4DR7J 1Q5VA 5J2QA 3BPSP 3D4JA 1DQ9A 2DISA 5CYMA 4YDXA 1LFPA 2HK3A 4URQU 3K89A 3H2LA 3NAIA 3NS6A 1D1UA 4C11A 1IQZA 3FEYB 3V5RA 2LFVA 2YKOA 1UVKA 2C2MB 5A6WA 3CTRA 1P27B 4WTOB 3AXKA 2BRLA 3OHBA 1YBTA 1VQYA 3GIJA 3K5MA 1I5OB 3HCXA 4EI2A 1FX2A 4U95A 2OPSB 2JEFA 3L9ZA 1U1OA 1Q7YT 3LAKA 1BQMB 3GJRB 4P71A 1MROB 4F4XA 4J9QA 4R5PA 1YVFA 8RUCA 3FMBA 3OSNA 1HNVB 3OR2B 5FDLB 2Z2YB 2OEKA 4B3OB 3JAMY 4N1XA 3CJ3A 5J2PA 2COLA 4UZBA 1RZMA 2PC6A 2EVZA 4O3OA 1PJ6A 2N7CA 4ECXA 1FI4A 4B9VA 1CJTB 4RLEA 5GMKa 4DQSA 3HHEA 3F0NA 2B56A 4MK8A 2VPWB 2L9DA 1RU1A 5D8HB 5AE3A 4EU0A 3RBXA 1LK5A 4MK9A 2B4OA 2IAJB 3J7YU 4BDPA 3C6UA 1CJUB 2DCUB 3QZ8A 4HDHA 3V2UC 3M2RB 1LW2A 3PKYA 1J27A 3W9HA 2RT3A 2E5HA 2XSFA 2MZRA 2CFXA 2HHXA 1DLOB 1KOHA 5EWGA 2FY1A 1NHVA 4ZITA 3SQOP 3FEXB 4N7TA 4LQ9A 3MM9A 4JI4F 4ECTA 4DV0J 2AIRB 4NLGA 5KG7A 3MM5A 3VSKA 5AXNA 2BM0A 3GZ7A 2RNEA 4DR5F 4ECSA 1T9YA 4A8YA 3N0VA 2C2EA 1FJ7A 1WC0A 2PFFB 2KFZA 3QGIA 3GV8B 2C3UA 4M8LA 2LA4A 3IWXA 4C97A 1JLGA 4FBTA 1BD6A 4HACA 5ADZA 3CNQP 4QW9A 1U1RA 4ZVTB 3M6WA 4K0KF 2CDRB 2EK1A 4YB7A 3PEJA 4RW9A 2CJQA 4OJGA 2D7SA 3W8GA 2YWKA 2VBYA 3W1YC 1QM9A 1L5UA 3CD0A 1IVZA 4OZNA 5U47A 3MAQA 3KKFA 1AFIA 1LV5A 1ELOA 1HNIA 2XC9A 5J1EB 2H4YB 4DUYF 1EETB 4ZCMA 3UFCX 1VHFA 2HGLA 1FJGJ 5IFMA 4F36A 3GIKA 3R6LB 1S72S 2K1RB 4HLBA 5HMXA 4WP3A 4UY85 1QSYA 4Y2KA 5K8NA 2LEBA 6AT1B 2YX7A 2JH3A 4YB5A 2JLFA 3CEDA 1NLKL 4NLTA 3ZC4A 4JI6F 4F3MA 1MWTA 3DM2B 3Q8YA 4YDDB 2O3DA 3A3PB 4CLFA 5F8NA 1LWEA 5KFOA 4Q8EA 3M2VA 2ZJRQ 2FGOA 2QLFB 2V9KA 3CIZA 2IBKA 3M6UA 3MCNA 1XEZA 5AXLA 2BANB 4TY9A 3FSXA 3ISZA 4DFMA 2V2ZA 4LIWA 3I87A 3A12A 2OUGA 5IC4B 1MU2A 2V2VA 3T1HJ 2NXJA 1S1WA 3LTOA 3TAMB 3A8KA 3MGJA 1RISA 2R7WA 4LF8F 1DAXA 1VQ6S 2GX8A 2NUUG 1NK9A 3P96A 1FHTA 2MJNA 3MMCA 1WI8A 3MOJB 3T41A 1K0VA 2BXJA 3NGUA 5E3PA 4DR3J 1WC5A 4YN3B 3CW2C 4JI3J 1HR0J 4EWTA 4HH0A 3R8YA 3H2VE 3NGKA 2XS5A 4PEOA 4W98A 3DOLB 2W24A 1QTMA 4TU9A 4CLSA 2L3MA 2VFUA 1MMLA 4AUKA 4DL0C 1IKYB 2NQPA 2WK4A 2YNIB 4LR7A 1HFEL 3RYLA 4KSEB 4DR2F 2GS8A 5HK4A 2SXLA 3R97A 5HQ8A 1H2VZ 2KG0A 2ZM6J 2J0XA 4I2QA 4CO5A 1TL7A 3BREA 2D9PA 4HI2A 4LBIA 1S6PB 2LDIA 1NHKL 3D0IE 3K59A 3MEDB 2GA7A 4OJ3A 3CCES 1HQUA 1C2PA 2V50A 3FCVA 5KT5A 4ECWA 1EQ0A 1AT1B 3IBWA 4LSNA 5E3AA 4B02A 4N8NA 2YKQA 4QR1A 3CJ4A 2A6MA 3ELHA 1NRKA 1NSPA 3THVA 1AZSB 1T9UA 1XR5A 3ZO7A 5LMUJ 1SKWA 4USVA 4ZN1A 4NLQA 4AQYF 1U1KA 3VALA 1T95A 4N41A 2ERRA 2XGQA 3TOQA 3B6BA 2QFJA 1SH3A 4HTJA 2MZJA 4XPCA 2W2PP 1JMTA 2ZOGA 3QIDA 2PA8D 1OS5A 2M7SA 2RDJA 3EM1A 3W65A 2YX4A 4UUWA 2HFNA 1RWPB 5LT5A 2D1CA 1T05B 1KOOA 1CS4B 5KFYA 2XMJA 1J2VA 3MFHA 1SUQB 2DXEA 1KLMA 4ZIWA 4UOCA 3OPKA 1M1KT 5KFLA 1MLAA 4RW8A 4PRFA 4CO2A 5HVFA 3VQTA 4DQQA 4MKAA 3AA8A 4DFPA 3D6MB 2FHOB 3IAS9 2I5JB 1BY9A 4M5NA 4C98A 1AROP 2RHSB 1RHUB 3MURP 4MFBA 4LF9F 4NRTA 2KXFA 3GE9A 2LQJA 3I0RA 4LRBA 4MIBA 3OL9A 1FKPB 3HHLB 3OD2A 5AXKA 4KO0B 4PZVA 4IQMA 1U09A 4Z37A 4YQWA 3HHKA 4OJHA 1NPRA 2MB0B 2FDNA 3W5ZA 2VC1A 2XMWA 3GSDA 2JC1A 3MM7A 1EP4A 3NL0A 2AEFA 3HVWA 5LM7E 2IDLA 5IT9U 1M5HA 3HVAA 5D3GA 1HIYA 4PWDB 1VK3A 5A6PA 4NEZA 2KFNA 2X7IA 3CMAS 4W4MA 2AGOA 1HARA 2VQEJ 3CO9A 1KTVA 1YLXA 3FSYA 2HFVA 3KJNB 2N3OA 2HRYA 3UR3C 1H72C 4ZKAA 4HI1A 4NEYA 3HULA 1S1UB 2B7CB 2A0FB 2E9TA 2V67A 2M8HA 2Y8YA 3POTB 2EBGA 1FO1A 1PAUB 1DARA 2B3TB 2ZH6A 2BE7D 3HD2A 5KT3A 2GAGC 2YTCA 1F5AA 4E8UA 4QU6A 4GMKA 2ZH8A 2KYXA 3MPUB 1TQLA 3HVTA 2DYAA 1VISA 4YMEA 1Q82T 1TP7A 4B3SF 3E2EA 2KO1A 4C7QA 1S1TA 1TL4A 2JVOA 4DWIA 4KHMA 2AQ4A 1XNRJ 4Q5VA 4I6YA 1RWMB 3MEGA 3LA0A 3IXQA 3IBFB 2R7UA 4RNNA 1QLNA 3PIOQ 1SQGA 3FUYA 4ZHRB 2YNFB 4I6AA 2ZNZA 1WG5A 4KTQA 3MPWA 3KWMA 3PY8A 1IKWA 2XLJA 3J7YI 3DKDA 5KFTA 3FFIA 4O4GB 3PW4A 1RTIB 2OGUA 1KP6A 4QWAA 4M5IA 5DG8A 3N4WA 4JYAJ 2AGQA 1UWAA 4ZA1A 4Q0BA 3UDLA 2BOAA 5I3UB 4OQJA 1YBUA 2Y0SD 1SH0A 4TNOA 9ATCB 3ETOA 3VCDA 2HMIA 4HR2A 1Q7LB 2VFVA 3FRYA 1YZ7A 5IWAF 4JI5J 1EQMA 3D6HB 2XLIA 2CPEA 3TNVA 3MR6A 4H54A 5A8WB 3QIPB 1YJVA 3G86A 4NCBA 3UCGA 5DGBA 2I9SA 1AW0A 3PG9A 2F4VJ 3CCUS 4R25A 4GO5X 2OFGX 1WC3A 4ECVA 1H7XA 1WC6A 1U02A 4OZ5A 3NMRA 4ZCIA 1SQFA 1TL3A 2QJ3A 1FJCA 1VC0A 2BQUA 4LVOP 4D3HA 1WKJA 3PYDA 3L95X 3W9JA 3OFEA 3V6DB 1YGYA 2HNDA 4ZP7A 1RSCA 3NCPA 3PXGa 4CLLA 1UWBB 1VC5A 3P49B 4PG6A 3MDFA 2ZDPA 1FRIA 4M5DB 4UOFA 1V5IB 2XTJP 4RW7B 1X9SA 2YKMA 1D9FA 1PBAA 1RP5A 3RW6A 2MQNA 3WX4A 3CT9A 1HYSB 1FNXH 3IR6B 3QGHA 1MN7A 4K5SA 4IFYB 1N6QB 3OTDA 1Q4RA 2R8JA 1Y00A 1L3TA 4USMA 3HPOA 1BWVA 2Z8QA 4A8SA 5C24B 1Q8IA 3OSPA 1VHIA 2QMWA 1XC9A 4X65F 4X62F 1RQ0A 1FD8A 2HLTA 1AXQA 4DV3F 4KKOA 4X4RA 2KT5A 1RWVB 3D9BA 3FSIA 1N5SA 4KPCA 2OIHA 2X1GA 4B3RJ 4K5RA 1E6VB 2DH8A 1NPPA 2HFOA 2XMVA 5JXSA 2WB1D 1VRQC 3GP9A 5J2QB 2CQ2A 4ETXA 2QV6A 3Q22A 1S99A 2AMCB 5IZHA 2KU7A 2DKOB 3VGSA 2W9BA 2BKOA 3PJXA 1B7FA 3UE3A 2DO4A 3BM7A 2VOPA 1X4AA 4ED3A 2CZ4A 3NNHA 3TI0A 2DRAA 3B82A 3UI3A 1YWXA 4ZVPB 4N56A 3ZNJ1 2AX1A 4EMDA 2EFOA 2RE1A 4IOBA 2CQBA 2FC8A 4PAAA 1R3NA 2QX0A 3OFHA 3GIMA 2M0GB 2BJ8A 3T9NA 1EAYC 4NI2A 3F73A 2BABA 4R5PB 4NYZA 5FD1A 5D77A 1TKXA 4DR6F 1WEZA 2EBEA 3MUVP 1WF2A 2HKEA 3GTYX 2ZOMA 1S10A 1PGZA 3EDRB 1DZ5A 2HVHA 1DTQA 5DQIA 3EJMA 4WFXA 3GFYA 3ADAC 3MM8A 2RHQB 4YOEA 2QL7B 1SI9A 4H4MA 4ZN3A 2WSFC 2VA2A 4ID8A 5J2PB 4ZLNA 1GX6A 3X1LB 3KJQB 2FJWA 1EARA 3GONA 4F8RA 3SCIE 4LBPA 2FTRA 8AT1B 2ZH2A 1R0BG 3R27A 2VG6A 2B9EA 2CPYA 1RYSA 3UN2A 3GJTB 2UUWA 2DVIA 2UV8G 2FQQB 2HNYB 3ZFVA 3R2CJ 3D6TB 2W2OP 5F8HA 4ED8A 3LPYA 2AKWB 2NXUA 2MKSA 2Y1LB 4FF4A 4PG8A 4Y2CA 4JV5J 3GIIA 1HBOA 1O8BA 4N47A 3HFKA 2VBZA 2CPDA 1NSAA 4BWJA 2PMZD 1RACB 4ZPCA 3HX9A 4C2MA 3G6YA 3MECA 3MM5B 4DL5A 1S7HA 1O6XA 1UPPA 3F56A 3BDPA 2FVRA 3PCOB 1CPZA 4J9MA 2MJUA 3H5UA 2AX0A 1HHSA 3BO4A 2W7PA 4KH1B 2CZVC 3NS7B 4FN5A 5I42B 1OIAA 1S1VA 1P9QC 1JLGB 1FEHA 3QGPA 3J81j 4HACB 3PR4A 1VCTA 1RWOB 3W2WA 3OXGA 2XS7A 1VRUA 3JSBA 2WTFA 3TZYA 3AQPA 4WFBQ 3HXMA 2M3DA 3PTWA 1H74A 4DUZJ 5LJ5Y 2J9CA 5ETKA 4MYUA 2GIRA 3DNCA 4Y2AA 2AJ2A 2CAJA 5C25A 1HNIB 1Y5IB 2XMKA 1KNZA 2C2ZB 1RE1B 4USWA 2IA0A 2AWZA 3FDSA 1MWUA 1UA1A 1YRTA 1UFKA 2VQFF 3RW7A 4IH7A 3NG8A 5SZTA 3PO5A 4LQ3A 1WNEA 3FCHA 3LH2S 4JBFA 5KFHA 4ELTA 3LGNA 2C2RA 4HVZA 4X4QA 1FERA 2XMAA 5JVGQ 3M32B 2WONB 8ATCB 3G9CA 2FYXA 1LWEB 1H98A 1NZ8A 1NAQA 2PGCA 3M2VB 1QMEA 3AD7C 3CIMA 2Y0BB 4CCHA 2VF3A 2KFYA 1NSKL 1WTBA 5E41A 2UU9J 4TY8A 2FGCA 2W9CA 1U6BA 4QYRA 1NJZA 2GVDA 3J7AN 1N56A 5LSOA 4E2FB 2KTQA 1MU2B 1HD0A 4KH0B 1X5TA 2BZ2A 1DTTB 2C2OB 4PXBA 2UVUA 3JTOA 3ZTPA 2ATCB 2F9JA 3N5BA 1S4EA 4RNOA 1HNWJ 2XMMA 4QR2A 4MJKA 2FUG9 1PC4A 3VGVA 3QQCD 1PAEX 1Z2ZA 1YX2A 2HVEA 2WSCC 4DX7A 2IY5B 4PKDB 4L3KA 3EXYA 1JLCA 1W2IA 2BV3A 2CJYB 2P9CA 2QLBB 4O44B 2CQCA 3HT3A 2WADA 4PWUA 2LU2A 2P9GA 1FNOA 3QT8A 1NSQA 3KUGA 2Y1JA 2PA3A 2AD9A 5KG3A 4LFBF 5CYQA 1SKUB 3V81A 1SL1A 2O67A 4ID5A 2K2PA 3M30A 2MKYA 4DF4A 1SIWB 4KJIA 3EPIA 1TFWA 1QSLA 2KHCA 3MOZA 2R2RA 3UQSA 1Z4UA 4IFVA 2E5IA 5KFZA 1VQOS 5F8JA 3GLJA 3RB4A 2BDPA 5A8RB 1QMFA 1FRXA 4G6VB 4CNYA 3MHYA 3R5AA 3C14A 4J9UE 3V6KA 4PXDA 4CLWA 3TAPA 4KV8A 1RT5B 1SBRA 3ZTQA 1XMQF 2C1EB 1R89A 5IXUA 4J9KA 4UQTA 4K4ZA 1KDNA 1Q86T 3Q8VA 2DNZA 2BX6A 2V8GA 4JOUA 1RT6A 4FXDA 5CCMA 3J7Z5 3ITHA 2FVPA 1DQ8A 3OFFA 4M5JA 3CCSS 1LFWA 2AYEA 3DRRB 2CNOB 1UA0A 5E5NA 4GKJF 1FEEA 1B70B 4GO7X 3MMJA 1KFSA 3BSCA 4LF7F 1N88A 4GRSA 1PYTA 1WDTA 2JLEA 2HAFA 4AYBD 3I5AA 2V68A 3BGUA 1ZS6A 2IYIA 3DDNA 1KLMB 4QWBA 1FXLA 1G2EA 3BGRA 1V3ZA 4EBDA 5EWEA 4CLZA 4PQUA 4GC7A 3FJ2A 1X0PA 5CQGA 3HHNB 3RB0A 1H7WA 4PYDA 4TVAB 2Z58B 1RWWB 3RTVA 3RBDA 4RW8B 1SIZA 4OZJA 1HW9A 2HIQA 3K5NA 2L48A 3TVYA 2PEHA 2G13A 4DV2F 5D4LA 3ENAA 2KJWA 3QAUA 1TL1A 4MFBB 2POKA 3ZTOA 5KAKA 3I0RB 2ZD1B 2DPJA 3ONQA 3BBCA 2KI2A 2E7WA 4LVNP 1URRA 3CC7S 3BGFA 1UW9A 5EGYA 3TQEA 1Y0HA 4PXEA 2YPZA 3MCMA 4WBFA 2XZDB 2AF6A 4OHVA 1ZH5A 1V3SA 1ZAXA 1PC5A 3KK2A 1U1PA 1EP4B 2XG8A 2HVDA 1KS2A 4Y2MA 1RGVA 4U7UK 3GYGA 5L9NA 1X9WA 1JLBA 2OTLS 5D3GB 2MLXA 2WRMA 3P5TL 3UVJA 3ILLA 2MKKA 1UVIA 1JLQA 3FNNA 4A8OA 1U26A 2AP6A 5KT4A 3UW1A 1R8PA 4NXNJ 2B51A 3BV8A 3NCQA 2FJEB 1N52B 4FPRA 3DLLQ 1JLFA 2OPQA 2UUAJ 1EX8A 4TU8A 1MG7A 4NXMJ 3G8QA 2J0SD 4QJGA 1LWCA 5IS2A 3SCJE 4AL5A 2IVYA 3RU0A 1FE0A 2W2NP 3CJSA 4R8UB 3HHDA 1IBLJ 3OL7A 2OP5A 4WJBA 1S1TB 1I94F 2DNRA 2JDJA 4CIOA 1KFDA 3K57A 1SJ3P 3CJQA 2Q43A 3MPVA 2FHJD 3E01A 4R0QA 2RQMA 1AB8A 2QL9B 3PYEA 4Z2XA 5DLFA 2NCKL 1EKSA 2B0GA 4OHZA 1LXNA 3SFUA 1Q5YA 3PYGA 3TO8A 3PIPQ 2BMBA 2N82B 2BRKA 2J76E 4L72B 1X4DA 2HEKA 2QIFA 3N5FA 4ETZA 1IKWB 2MDAA 1PO6A 2DEJA 1T9TA 2K7JA 1F5CA 2OHDA 2KM8C 4U8VA 2DY9A 5G4DA 1K8AT 1B3TA 4ELVA 4ZPWR 4F4AA 1R8AA 3SQGA 4MNRA 4Q0BB 3BN4A 4OIXA 4QZVB 4ZVEA 2BE2A 1KQFB 1T94A 1N5VA 3VAGA 3C19A 1FTCA 1G3OA 2VONA 4ZPAA 2F7VA 4OFZA 2B5JB 2W4PA 1GX5A 2OPSA 2GO8A 3KLFA 5F8IA 4OX9F 1MROA 2JFDA 2VIHA 4FVCA 1B99A 1RAIB 1F5BA 4RBUA 3DCAA 2XB2D 3WC0A 4CLPA 4NZ6A 1IXKA 3OR2A 4ECRA 3H4BA 5FDLA 5BYQA 3CC2S 4B3OA 1F2GA 1ZM2A 2Q6BA 1LOUA 2OSQA 1S7IA 4ED5A 3QATA 2MQPA 3PRVA 1CJTA 4LF6F 2AYBA 4OMFG 4AL6A 5HROA 3THPA 2CWKA 4ZVSB 4YUDA 4DSFA 1KRPA 4RR5A 3TRGA 1ZM3A 4JI4J 3ENWA 3SV4A 2FLOA 3QRPA 5I4MA 2GHPA 3DU5A 4DR5J 4EUVA 4RNHA 3N28A 1RAJA 5KFMA 2MHNA 3WHIA 4LSZB 3ETMA 4QBUA 3BR8A 4ZVQB 2CQIA 3Q24A 1NO8A 2QA4S 3R5GA 4KKOB 4EFAC 1TK5A 5KG0A 2DHGA 5KFAA 3OR1A 1GXUA 3BQ0A 1TAUA 3MEKA 4CT8A 3W63A 2HBQB 3OJSA 1N48A 2V2QA 6FD1A 4F2RA 1UZHA 2ILYA 4C6AA 4RU9A 3Q8RB 3RR8A 4C9DA 2W9BB 1VQNS 3LGHA 1XBWA 4JV0A 2AEJA 2XNRA 3M9OB 2QG9B 4X66F 2L08A 2J0WA 3G8TA 3KDOA 3IAM9 4DUYJ 4TYAA 3LP0B 4ECYA 2VJVA 3AODA 3DOKA 1R0AA 3OW2R 3HJVA 2UVVA 1J5OB 2DR7A 3N79A 2QZ8A 1HQ2A 3TUJC 5L8RC 1TKXB 5THWA 2DR8A 2UUTA 4JI6J 1KQGB 2HHTA 3IC1A 2B7BB 4DV6F 3HDSA 5J1EA 3GG0A 7FDRA 3FEZA 3MM8B 2E44A 2LEPA 3MUMP 4DQRA 3FC9A 2QMXA 1EHWA 2LXIA 4H4MB 1T3OA 5DQGA 2KB2A 2IHR1 2K1RA 3L7UA 5J2NB 3Q8PB 1U0HB 4DU8A 3RG6A 1VQQA 4WZMA 3MF5A 3ENVA 4KFBB 3M6XA 1VQLS 1TELA 2QMUB 1IR1A 1CSJA 1SC4B 3I5BA 4OJ1A 3KG1A 1CLFA 2VFRA 4M5KA 1VQ4S 1UP1A 2CVIA 2DNMA 3EICA 1B64A 4F50A 2DHXA 4F02A 4HHHA 2BANA 5DLGA 1OYDA 3ILJA 4IG0B 2MZ1A 4U8YA 2HS4A 4IR9A 1SV5B 3R1HA 5DM6Q 3Q83A 2W7AA 3VR1A 4RW6B 4P6QA 1QDUB 1B0PA 1TUWA 4ZVRB 2QYCA 2V8HA 1FCAA 5CH7B 3KNGA 4MYTA 2N4CA 2OPRB 4DR2J 5JJBA 2CQPA 2YVSA 5C2GA 3C6TB 1WI6A 1I51B 2HZAA 1V6HA 1NJYA 4WYLA 4QPTA 1NXIA 4O23A 4GVBB 1OY6A 3FBCA 2E5LF 2KH9A 3RJMB 3NLCA 1IKYA 2OAUA 4DV7F 1NK4A 4ZCLA 5IV4A 3BSNA 2A2DA 2HQGA 1RAOA 3W2WB 2E7VA 2R7OA 1VRUB 4I68A 3M8YA 1PYOB 5IT9Y 4A47A 3I82A 1VR6A 2CJ9A 4DR1F 5L1JA 3R7BB 4FS1A 1RUSA 3M8QB 2XYGB 2LA6A 4M5MA 2CPHA 3JTPA 2CPIA 3I9V9 1Y5LB 3I4PA 1HD1A 4YHHF 4AQYJ 3PX4A 4MMOA 4UT4A 3CCLS 1N8RT 1KSPA 3B78A 5BYSA 3AD8C 2CJAA 1NH8A 3TW0A 3TYTA 2JEJA 1FVQA 3PHEA 2GW8A 1RJJA 3QNWB 4ECQA 1X4BA 4L73A 3J7A1 2C3MA 3QYYA 1S6QB 1PJ7A 2HURA 3CCMS 2EPIA 3ZZZA 5KG4A 3HK2A 4FP9A 2FHJA 2BQRA 5CXTA 2EKYA 4OLPA 3I6PA 2NXCA 5BJRA 2DHHA 1WUUA 1S0OA 5HJYA 4NE9C 1IBCB 3VZIA 1N34F 4X4NA 4ES1A 2VKRA 1N0VC 2R3VA 1FXRA 2O1PA 1XNQF 3WDOA 4TY8B 1TAQA 1SUQA 4LF9J 2HK2A 2FZGB 3H59A 2EI5A 4DHVA 2F3JA 2PDAA 3CCZA 4V19X 1NKBA 1FK9B 4Y00A 3I96A 3F44A 3ENQA 3W7BA 1SQEA 1QJHA 3MFIA 1YDLA 3RR7A 3M4XA 3EGZA 4EYIB 3H5SA 3CULA 4J9RA 1Q8LA 1DQAA 2W8LA 2B9WA 4HEA9 3RB3A 4P75A 2PSZA 1T9VA 2MGZA 2EWHA 4QW8A 2QSWA 4Y0FA 5HMYA 4XAKA 3G96A 1QY7A 2RU9A 2ZH4A 1JLCB 1BWEA 2A18A 1FKPA 2VV5A 1K44A 2E1CA 3HHLA 2RJZA 4B9TA 4KO0A 2QSFA 4X4SA 1Y3KA 2J6TA 2MKHA 2L41A 7AT1B 1CC8A 4N5SA 3LANA 1WDDA 4DLEA 3VSLA 3G4SS 4X4VA 1L3SA 2XSJA 5CYQB 4ID5B 1OPIA 3W5YA 4IO9Q 4OYAA 1U24A 2VG7A 3T1AA 4I6WA 1N33F 4ANDA 2YQ0A 4C3KA 4AFFA 2FJXA 4ZPTR 4IFVB 2CPFA 4IOCQ 4R23A 3D0GE 5B09A 4ZVUB 3KOAA 4P52A 2NR0A 1A7GE 2V4JA 4DCPB 4PWWA 3PW7A 3WIVA 4ES2A 4O3QA 4F0HA 5CAAA 4ZP6A 3ZZRA 4DUTA 4B3SJ 1GQEA 4M94A 4KV8B 3QLHA 4F4KA 5EX3A 3GFXA 1S1UA 2QGFB 2AW0A 3HSGA 4WFZA 1IWGA 2R42A 3Q8SB 5H9FK 4Y6IA 2AZ1A 1RT6B 4J90A 1HHQA 4MKBA 1M5SA 2KJVA 3DLJA 2GVZB 1EJ7L 3EZUA 4RL1A 5C42A 1SJRA 1N32F 2GAHC 1HQEB 2LLZA 3AY0A 1AFJA 2JOQA 1CJKB 9RUBA 1BQNA 1FDDA 3PACA 2R2TA 1X4GA 3H8YA 3M7VA 2I2YA 3UCUP 4A8XA 2J5AA 2ZC3A 1WG1A 3TA2A 4V1Ak 1NZAA 2QN6B 3DXBA 2YXLA 2YNFA 3OL6A 5CD4H 3KLHA 3N6NA 3KTQA 1MWQA 3C16A 2CG4A 5L1LA 3W62A 5IWAJ 4USUA 1RT2A 1MW7A 1TL1B 2IM0A 2YH0A 1RTIA 3FRZA 1YJ9S 2VC0A 3DWKA 3AHPA 3CXCR 4EGLA 4DFJA 2BW7A 4DR4F 2ZUAA 2E1PA 5KFUA 3Q8UA 1KBRA 5IM0B 4B3MF 4IKAA 4WPAA 2CA9A 1HNXF 3ISND 2ZUGA 2AV5A 3PZPA 2BOPA 5ETMA 2MZSA 2NLWA 1FX4A 2DNOA 4U67Q 4YP3A 1JLEB 3KK2B 3IFEA 3KMSA 2XHWA 2LDYA 3WZ0A 2VG5B 4WWSA 3QWPA 2G1HA 4LR8A 4YY3F 3PM9A 3TJAA 2RAQA 1VYAA 1RWNB 2RRBA 3SSQA 3H40A 3O5TB 1NJWA 1OPZA 3UVJB 1VRTA 1SC1B 4PUOB 1JLQB 1FXDA 3IGVA 3KUHA 1RHQB 3EVWA 1H3DA 3F41A 4J9OA 4CWBA 1U2RA 4JI7J 2OPQB 2FJBB 3GILA 2BM1A 4CO1A 1Z1ZA 4KB7A 3V6DA 1RCXB 1X8DA 3IWNC 4DL4A 5J1PA 1JXVA 2Z2LA 5KOWA 5D4PA 3QAEA 1C1BA 4NMXA 4X65J 1UWBA 4X62J 4ZP8A 4DV3J 2WVBA 3SSSA 4M5DA 3Q0AA 1I1GA 1BXNA 5AE2A 2XQCA 4OYPA 4RWWA 4P9SA 5DETA 2CQ4A 1X4HA 2M4MA 4OYWA 2G4BA 1UAWA 2E66A 4G3IA 1HYSA 3FBEA 4DQIA 2LKZA 4DPXA 3MEEB 3RAQA 1VDHA 1PYSB 3UNYA 2LXUA 5C24A 4L76A 2QA4G 4UZCA 2WBMA 1WORA 1X31C 4KGKA 4ZVOB 4K4SA 1TU0B 5A76A 3GIRA 1PILA 2ZBCA 5K20B 2WVCA 1D9DA 2WAFA 5KFXA 3SCKE 2WOMA 3R5JB 2VD3A 5H9FJ 4P72A 2ZEJA 4JI2F 3W2VA 2IIHA 1WACA 5T41A 2JJ4D 4P2SA 5LJ3Y 5HVHA 2F63A 4Q2LA 2DR5A 1WSRA 4DR6J 2H5IB 5KTQA 3CMQA 4HH1A 5B0BA 4RX6A 3JTNA 3SQGB 3I56S 1U2FA 2BE2B 3X3UA 2ALYB 4X84A 4P2MA 3M8PA 4F0MA 3C15B 1YITS 3UE2A 3BYRA 4A48A 3KLFB 1JXLA 2HSEB 4ANCA 1VOMA 2A10A 3PX0A 3NEKA 2PI4A 4HKQA 4LUBA 3OVBA 2OMLA 4RNFA 2JHEA 1WWHA 3MR7A 5IC6B 2IM3A 4BS2A 5ETSA 2D3O1 3NOCA 4R0JA 1KQSR 4CTAB 3O8WA 3KNAA 1RTDA 2LVWA 2MQLA 3MD1A 2DR9A 2KG1A 1WHXA 1HBUB 3TVKA 1GXLA 2VPXB 1JWWA 3DLGB 2P8IA 3QZ7A 4IRKA 2ZH3A 4E98A 4HHJA 2WZ1A 5HROB 2HGNA 2RIJA 4C48A 1KHVA 1YRUA 4TQRA 4RO0A 4RW4A 1RTHB 5CZVA 3FMWA 2HNYA 1RABB 3KHRA 2RDIA 4M1KA 4DI6A 1Q0NA 2VODA 3K7RA 3E8OA 2R7QA 4IYQA 2B8QA 2G2ZA 3NNCA 2E5GA 3FCWA 4LF2A 4CH1A 1U1MA 1TKTB 2MZTA 3B4MA 3OR1B 4UOHA 2BVZA 1J5EF 3GPAA 4DZDA 1RBLA 1TR0A 5HSPA 4K4XA 1TMMA 4G1QB 2BJDA 1YSJA 2DBBA 1IKXA 2XO7A 4DSKA 1OY9A 3M8RA 1S12A 2KT3A 4OX6A 2JX2A 4DS5A 4O3SA 5I42A 2DGOA 2W7OA 4WU3A 4EO8A 3CJ2A 2V5HG 4K2JA 2V94A 3AOCA 1CEZA 3W9IA 2VQFJ 2FVQA 5K8OA 3UDEA 2EC2A 4WFAQ 3DOKB 3G6XA 1R0AB 2ASJA 1GNKA 3U7JA 1UVLA 2X51A 1S97A 4OZ3A 1E6YA 3ZZYA 2NREA 2MQ8A 3DMJB 2WW4A 1PCAA 4OV1A 1H73A 4OX7A 4LT6A 1PJ5A 1D3WA 4DX5A 3OC2A 2D3OR 4LFAF 2BJ9A 2ZKUA 1M5KC 2Q3PA 3UD4P 3IM9A 1QUVA 1RT1A 4CDIA 2ZHBA 1HLWA 3LGMA 3UD5A 3KJVA 3M32A 2WONA 2CQHA 3CCWA 2CQ1A 5M2RA 3CPWR 2C3YA 4DL3A 4I2PB 4PPZA 4XPEA 1KEKA 2DNQA 4LSLB 3OVAA 3GR0A 3EUNA 1G7CB 5D0HA 3EQUA 3M1VB 2DD8S 4PQAA 3U1NA 2ZH5A 1Y4ZB 2NXEA 1B7YB 1DTTA 2GV1A 3SDEA 2CQDA 3AD9C 3BKUA 4AD6A 3HZEA 1I6JA 4TLQA 4F25A 3VAMA 4ED7A 1IKVA 5C2CA 4LFBJ 3TARA 5IQ6A 1S0VA 5HLFB 2J9EA 2JWNA 1VS3A 4K4WA 3CDUA 1UZDA 2W8KA 1Q8BA 5DRKA 1HPZA 5DZ6A 2WVFA 3R1LA 4ZDNA 3UWTA 4O44A 1UFWA 5DDPC 3BR9A 4KHRA 5LMNF 1EKRA 3AJDA 1APSA 3DRSA 1VBKA 3GWCA 3SZ2A 2XY6A 2ZBIA 3CVKA 2CADA 3WIUA 4DMZA 2YY3A 2BACA 2A1BA 3OJUA 4Q7AA 5ETOA 3PFEA 3KLIA 1AUDA 1JLAB 2CPXA 1XMQJ 1LQ9A 5J1NA 1X5OA 3CCRS 5A2QU 4F4WA 1RLDA 3QRRA 5A8RA 3EVMA 4USIA 2MYFA 3R5DA 5T7LA 4CT9A 4GKJJ 2AYGA 1YKWA 4NA2A 3EGWB 4U7UD 4LF7J 3K5PA 1KLNA 1R8CA 2KZZA 1NBEB 1RT5A 1QTNB 2VFTA 4P2XA 1YBAA 4N8OA 4USKA 2M2BA 4KYZA 1JIHA 1G4CA 1K9MT 4Y28C 3ZFZA 3R9LA 2KRRA 5I3QA 3DRRA 2EFNA 1ZM4A 3KYLA 2YKNB 4X4OA 3MUTP 4WU2A 2HQFA 1XN9A 1S9EB 2QLWA 3I9ZA 4DV2J 4FF1A 4OYIA 4K8RA 1VQ8S 3BKFA 3EE3A 3CF5Q 2RMLA 2AEMA 3DFEA 4H4KC 1S76D 1NEEA 4PABA 1YG0A 1DRZA 3H25A 2E1RA 1I3OB 3D7SB 2NPFA 3DYAB 2VH7A 3T5LA 2HS3A 4DKIA 5L1KA 4DN0A 4K2XA 2ZH9A 4WP8A 2MGZB 2ZD1A 2X3DA 2UVRA 5ETTA 2DNLA 1FRJA 2IM2A 4RUHA 4YEAA 2I8EA 1NHUA 3EYZA 5J2MA 4DG1B 4BC7A 2J7KA 1GTEA 3UPPA 2XSJB 2KVIA 1WHYA 4DX6A 1CJVB 4P7TA 4RNMA 3SBMA 2VG7B 3ZZPA 4I0WA 4CLKA 1RYRA 1W7WA 4FVMA 2DIVA 2HRTA 2RH3A 2KN4A 1RHMB 3VV2B 2ZKTA 4I64A 3TZZA 5B7WA 5BYRA 2IYGA 2V4JB 2JRSA 1URNA 4N76A 2DNKA 2V34A 2AGPA 3ZXWA 1HWUA 2EKNA 2MMYA 1ZPWX 4J9SA 1RAAB 4H4OA 3W66A 3CJ5A 5D6GA 3S1TA 2FPHX 3QLHB 1I94J 3OVSA 1KKHA 4ICLA 1CC7A 3IRXB 1HWKA 2CPJA 4IRCA 2QLJB 4A46A 3EQVA 1N5QA 3BSAA 1PKUA 2EEYA 5F8GA 4BL2A 5L1IA 2CJXB 4E0DA 2D9OA 2L9WA 2G0IA 4R8UA 2ZBRA 1HL6A 1ZETA 5C42B 4DPWA 4A8WA 4AXIA 2WAEA 1U1LA 1BQNB 4ZS6A 4USTA 1R31A 2DGUA 3VAJA 4NWBA 3MI7X 3GMGA 4AE5A 3BEGB 1YK9A 3DDIA 2PN6A 1K0TA 2P9EA 2XWYA 2IRYA 4FYYB 1QAYA 4FF2A 2CWXA 1VBYA 5HO4A 3CJ8A 3KLHB 2X1AA 1KWMA 3LQVA 1JNZB 2HQ3A 3C16B 4OX8A 5KFCA 2O5DA 2E9ZA 1UEKA 2FY8A 3FK4A 3IR5B 2M8DB 1RT2B 1UTAA 1C0TB 7FD1A 1PIEA 2DGQA 2QT7A 1S9GB 3EXCX 4OX9J 2MEWA 2V8VA 3H5XA 1NJIT 3SXLA 3KLEA 4NCGA 3OXLA 3PYFA 3J81U 5D15A 1ZA2B 2OTJS 4DPTA 2QE5A 1W2BR 4CLTA 3AH6A 3QT6A 4B3TF 4BBYA 5EN1A 5EDWA 1RT3A 1TMJA 1UJ4A 2XCAA 2DK2A 3NCRA 5KT6A 1UJ6A 2B5JA 3GV7B 4LREA 1VIOA 2RS8A 2ZBPA 3DLBA 3RAMA 5M18A 4QWEA 3VHQA 1GMUA 1QAIA 4ER8A 3ZZUA 4LRCA 3G6ES 2JEIA 2E9RX 4LF6J 5CHCB 1BMQB 4ZP9A 1JKHA 1VRTB 2HYIB 3O44A 2B6AB 2JVRA 1U6FA 3DLKA 3KLVA 5GADU 2EFPA 4XO0A 1G1XA 1LWFA 2P5VA 3CDWA 2F40A 1FFSB 2HBYB 3L7PA 1BGXT 1JK9B 2YH1A 4OZLA 3VAFA 2Q79A 1NMEB 4DV4F 5CA5A 3BQ1A 3D1HA 2GIFA 3M8SA 1S4FA 5ETPA 1YHQS 3OTOF 3NGDA 1C1BB 5FLXU 2EG2A 1M5PC 4RJVA 3OQ2A 4R3JA 2FZKB 3IGNA 4JV2A 3N6LA 3HFVA 1TUVA 5C7PA 2K3IA 3VTIA 2N4DA 3DXSX 4MTPA 3VVUA 3K17A 2DNYA 3BO3A 1Y3JA 3QPIA 1F2HA 5EWFA 1JJ4A 1Y9OA 2DY1A 2XEXA 1XR7A 3FKBA 4WCEQ 3M9MB 3K0JA 1M1HA 4FZVA 2PMWA 3TZWA 2V4RA 4H4KA 5DDQC 2XZWA 4C3LA 4M5HA 3BKTA 4QIVA 4X66J 1ZAVA 2CQ3A 2MQOA 2WOMB 4PG4A 3MMAA 4NMLA 3PX6A 1WKKA 3W2VB 2H54B 4F7VA 5KFPA 4OL8A 4UF4A 1UCNA 2UV8A 1UL3A 2A3JA 2LQ8A 1FESA 5K14A 4NLOA 3HT0A 1SC6A 1XTZA 3TVZA 2UXDF 3S8SA 4QOTA 1NCLA 4BC9A 4DV6J 2R8HA 1IM4A 3O3LA 3M8PB 4ERDA 3S7RA 3GR1A 4WXWA 3DI6B 3LP0A 1F0XA 1AYEA 4RUCA 2XS2A 1RAHB 2UUAF 3LO7A 2XM3A 1YI2S 1NH7A 1J5OA 3LPEA 4ZVHA 2KXHA 2LEAA 1UETA 3DDKA 1SJ1A 4DCJB 5T14A 4O3RA 3RZAA 1W26A 3S01A 1RWUA 4JI0F 4CH0S 1W25A 2HQDA 1RTDB 1H0HB 2G0JA 3WQPA 2ACYA 1FRHA 3S6EA 3BF4A 2OH2A 4RZRA 2J8AA 2CVEA 1HNZF 5J2NA 2G1DA 2HRUA 3OTBA 5A0YB 1U0HA 1SL2A 2LCWA 2RB7A 4UOGA 2DGTA 2M52A 1CULB 3EGVA 4C0BA 5B0DA 3DN9A 1PG5B 1D09B 5ITHA 2R2UA 1B0VA 4KFBA 2EG1A 5KG2A 5M2PA 5F9LA 2PIIA 2XLKA 1U8WA 2D69A 1FFGB 2X1FA 4FS2A 4RW4B 1UEUA 1WJ9A 2IFXA 1FKOA 2RF2B 1RTJB 3LW5C 5AXMA 1RXOB 4IG0A 3MCOA 1CQMA 1SV5A 4ZLLA 2ZH1A 3W64A 4O3NA 3EPGA 1U48A 4X2BA 2I0XA 4RW6A 2E5LJ 2NXNA 3QJPA 3PW2A 2D3ZA 4B17A 4DV7J 4ZLJA 3DC2A 2OPRA 1LKZA 2O66A 1RT4B 1DJ0A 4F26A 3T1YF 5IQQA 5BR8J 3RRHA 5LSLA 1IKXB 3C6TA 5M1AA 2UUBF 3D3BJ 4DR1J 2DNGA 4NRUA 5IOLA 1K1QA 4GVBA 2GMLA 4LF5F 1TVRB 2HZVA 2M88A 3OUYB 4KGZB 3LWLA 2R4FA 4YHHJ 2NSBA 1T11A 1S0NA 3O2IA 1VMBA 4X4TA 4M5GA 3MR3A 1LK7A 1VGYA 3PW0A 2MY7A 4OVDA 2G2OA 5KT2A 2VB6A 1WSVA 4BHQA 4OV6A 1AA1B 1U49A 3G8SA 3MWBA 1UW4A 4PG5A 3M8QA 2I6WA 1MWZA 4ZCKA 3P3DA 2MHEA 2LQ5A 2C2KB 1YTYA 4WK1A 1E6YB 4UUXA 3QJJA 1FD2A 1GXTA 3DHWC 3P4UB 4DOZA 5HATA 5M19A 3SI8A 1N34J 2FB0A 2R2SA 2H5EA 5E33A 4EO6A 5CZXA 1XNQJ 1S6QA 2KVQE 2YQ1A 2GMHA 5DQHA 1XERA 3AJ1A 3QT7A 1CVJA 2DHSA 4P74A 2H1YA 4G65A 1IBMF 2MXYA 1N36F 1RHKB 1RT1B 2IJFA 4F3QA 1XMOF 3KJVB 1NM2A 3ILIA 1TV6B 2CNLB 1U0SA 4J91A 1BHNA 1M5OC 1L3KA 4RUBA 2A2CA 2UXCF 3UN3A 3VWSA 5KFGA 4M5LA 2XBPA 1C0UB 4IH6A 4CYUB 1KTQA 1X4FA 1VBXA 2OELA 4KE5A 1GAOA 4Z7CA 2R9LA 2N3LA 2J6SA 1R0CB 3WBZA 1U8SA 3H2UB 4ZMMA 2XYPB 1TK8A 3HP6A 3ICLA 1FE4A 2RRNA 1X60A 5KOXA 3O6QA 3KK1A 3GFHA 5K8PA 4OZ0A 4KHPJ 1T9XA 1XK8A 3PKMA 2ZBQA 2E29A 1S77D 1FK9A 4DL6A 2Z2MA 2WCXA 3HFZB 3SDEB 2LU1A 5L46A 4RWXA 3MAAA 4KT0C 3JQMA 2FIUA 3M8WA 3NBPA 1IKVB 2QA2A 3NGRA 2XI2A 2FHMA 5DGAA 1D8ZA 2G0CA 3LAMA 2VASA 4IDKA 3EZ5A 2FVSA 1N33J 1VLOA 2JC0A 2PI5A 1HWIA 1HPZB 5DG7A 5IT4A 2YKAA 2M5YA 1P6TA 1SXLA 4DLGA 4ZJQA 3GJQB 4Y2IA 3SEOA 3H0PA 3IN5A 4CPKA 3EGNA 4W90B 3EDQB 2K3KA 4MAKA 3DRSB 3GB0A 4ZLPA 1P1TA 2F4FA 4ZPVR 3QSYB 2CNNB 3D68A 3O1LA 3M2UA 4JI8F 3KLIB 2OSRA 3BGOP 4Q43A 2KT2A 4QIFA 1VIXA 4C4WA 2JZ5A 3P8BB 1YJRA 2VDIA 3NNAA 2Z30B 4QCLA 1F3FA 4CNZA 4ZK7M 4R0EA 1IJFB 1UEVA 1BC6A 3BO2A 2E1AA 4QU7A 5T7LB 4ZJLA 4NCAA 5F8MA 1RCOB 3CDAA 4IG3A 1RKIA 2KHDA 2MLYA 1N32J 5GAGU 1U1QA 3KXDA 3HKZD 2X1BA 2D74B 3CWJA 3BZQA 3GG1A 4D3GA 4MIWA 1T03A 1S6UA 4YFUA 4KQZA 2YNHB 2ASDA 4C8OA 1FRMA 2R7TA 1RAEB 1RU2A 2OPPB 2KM8B 3UD3P 2CDQA 1MSWD 1VLYA 3EMTA 4OZ1A 2JEGA 2GVZA 1YJ7A 1HQEA 2RS2A 4ED4A 2DRDA 2MPUA 3IS9B 4XDDA 5D0GA 1CJKA 5GADI 4DXLA 1TZ0A 3TEHB 1OYEA 4CLYA 3V4IA 2C3OA 4KBIA 2KXNB 4EBCA 2UUCF 4RKUC 1RWXB 3GCWP 1XR6A 2DRBA 3L4BC 1OQ3A 4KGXB 4HYKA 1IUJA 3NP5A 2UXBF 3H7HB 4DR4J 2E7XA 1S57A 1BE4A 2ZDOA 4B3MJ 1QAXA 2EFQA 4ZVGA 3IG1B 4FNHA 1HNXJ 1GEHA 3DRPA 4Y3CA 1QVGR 2HFUA 1Q95G 2HS0A 1HMVB 3M9NB 5D4NA 3HSDA 2BUNA 4LF4F 4FYDA 2J7UA 3TJ8A 2BKPA 3BQ2A 4R1GA 1NJXA 4G1IA 3IR7B 4OHWA 1S59A 4YY3J 1KN6A 3R2DJ 2E5JA 3KK3A 1RAGB 1FWKA 2Z56B 2IMOA 2K06A 1VQSA 3CJ0A 5IM0A 3A3NB 3I4HX 2JLGA 1S49A 2QL5B 2YNGB 5J2MB 4DV1F 4HL9A 2VUGA 1ZTWA 4WFNQ 4P10A 3LP1B 2K7KA 3G2XA 4KIAA 1BLUA 1JLEA 5JUMA 5EX0A 2HIYA 2HAIA 1FJEB 2VG5A 4QJVA 1P9YA 1BUXA 1X4CA 1YJUA 4HT5A 2QC3A 4I4BA 4AXJA 5SUHA 1R6YA 5E3RA 3D67A 1WELA 4PUOA 5HJXA 2CG8A 1VQ7S 2DNNA 2RSQA 1NKEA 3TA1A 3GFZA 1V9OA 3CDBA 5HVGA 1ZTTA 2OFHX 1PBUA 3CJTA 1LW0A 3G82A 3PV8A 5CD4A 4ILMA 4H4OB 4IRDA 4ICLB 2CXEA 4DSIA 1C1CB 5DJBA 3MZIA 3I5CA 2BQ3A 3I0SB 1O0PA 1M1GA 1N5YB 3MR5A 1IR2A 5M2UA 3UO0A 4FXWA 1RADB 4KGMA 4FKXA 1ITPA 4USHA 2F65A 4UY8T 1U25A 1PYYA 3GCXP 4YR2A 2IMWP 1IR0A 4MK7A 3U1LA 4DEZA 2IPOB 2R7RA 4YS2A 5ETQA 1DBDA 3MEEA 4JI2J 3MTJA 3B8HA 3CD5A 4AL7A 5HBMA 2WVDA 2DGXA 3MM6B 3R7NB 5HMWA 3T9ZA 2KZMA 1KR4A 4B9MA 1JQGA 2YX1A 1HI8A 1HWLA 4NZ0A 3GV5B 1S9FA 1ZOTA 2XHCA 2V2KA 3QJLA 3VGTA 5GMEA 1UVJA 5DO2A 2QYGA 1LXJA 2HLUA 1EIYB 2EW9A 4JP8A 1H2UX 3DRYA 1HI1A 3KLEB 4NCGB 4QWDA 1S6OA 2H65B 1REVB 1MNEA 4DPYA 5KFVA 4IR1A 1RT3B 2JL9A 4KPYA 4PPDA 3C15A 3G6VA 3AOBA 5AJ3F 2NUHA 2KDOA 3NKYA 2OMOA 2MKCA 1KVKA 3UNGC 2HG4A 2WAQD 1IBKF 1DURA 3VAHA 4QWCA 3UCZP 2YWHA 1L3UA 3K8WA 1XMBA 1ZBTA 1NK7A 1RWKB 1JKHB 2MLZA 4CTAA 4RBTA 3FGVA 2B4UA 3DLKB 2DCLA 2F5GA 2ZE2A 3N6MA 2H5JB 3JSMB 3UPOA 1LWFB 1WTFA 4FKYA 2FLPA 1VJQA 3OLAA 5K8MA 2VOOA 1HBUA 1B0TA 3DLGA 3AAWB 4OYMA 5LXYA 3MTKA 4LMZA 3CB4A 1GT8A 4NZ7A 5DS7A 2Y1RI 1H6KX 3UR0A 1X4EA 3DLEA 1JX4A 4TKTA 3VF0B 4F0KA 2YWGA 4NOHA 3Q8QB 4XDCA 2HHHF 4J9VA 1WHVA 1RTHA 1J5EJ 4Q2MA 2VHGA 2IC3B 2D3UA 3LALA 3K2YA 2IJRA 3IRWP 2UZAA 2AT1B 4FYXB 3BS9A 5HP1A 1VQPS 2QA1A 4B9UA 5D0EA 5EUHA 2MQMA 1GMVA 2OD4A 1K1SA 3PJWA 2W9AA 2GQCA 1WEYA 4PR6A 1SJ4P 3CJRA 3FZBA 3BB5A 2HNZB 5DG9A 1TKTA 3BJYA 2ROGA 4GKKF 2OLUA 3P6YC 4BWMA 2HHSA 4K0KJ 3KUEA 4G1QA 5FJ4A 3A1YG 3MMAB 2LECA 3DOMB 4CH7A 4LIRA 3D0HE 3HHLC 2B8PA 5K14B 2HBRB 1XIQA 1U4BA 5FIIA 2YWFA 3CCJS 1YRXA 5JVHQ 2CQGA 2FC9A 2GZOA 4QQBA 2J0QD 1RTZA 3PEHA 4OHYA 1NK6A 1NDCA 4I7FA 1U7LA 3ZZTA 4JI7F 4IUFA 2BR0A 5A2QY 4LFAJ 1IN0A 3IP0A 1T8EA 1RT7B 4LFCF 4Z7YA 3BBFA 4DV5F 5HQMA 4YR0A 5K5MA 2FLLA 1R6VA 1V5VA 2LYVA 4ZJOA 1TKZB 4X64F 4K4UA 2MY8A 4OI6A 1UFLA 4NA1A 2I38A 3CJKB 3DMJA 3HD1A 5KT7A 2M9KA 4OYBA 4P7VA 2QO3A 4L74A 2IDEA 3TJ9A 1M0SA 3HF5A 2NYHA 1MWYA 3Q23A 3MAHA 2FHKA 3TR5A 5E0OA 3W8PA 1A9NB 3SYZA 1Q53A 3PNIA 1X5SA 2LP4A 5CYMB 5KFQA 2F1FA 4ZPDA 4F04B 4KAIA 3IO1A 2P6TA 4WE1A 2GJIA 3QFWA 4LF8J 1KVIA 3QFHA 4C11B 4ANEA 3PFOA 4JI1F 1VI7A 1FDAA 4I2PA 1S0MA 1WKLA 4LSLA 1WHWA 2EFVA 4DR7F 2DR6A 1FKOB 3RB6A 4FXVA 3M1VA 3QO9A 1NPKA 2BKNA 1H2TZ 5GAGI 3CCTA 4MKVA 6FDRA 3HZGA 2XY5A 1TK0A 3DGPA 4CM2A 4JBCA 1R27B 2IVFB 4DCOB 4DS4A 1Y11A 4XTTA 2DIUA 2MTLA 3DRXA 3WC2A 1WF0A 1QSSA 4GVLA 2DGVA 3J80U 3CO0P 1YIJS 2CRLA 5F8LA 5LMNJ 3ZZ0A 3KLGA 2ADCA 5B0AA 1QE1A 5HLFA 2Q6CA 3THTA 4ECZA 3I55S 2JFKA 1SKSA 3ILOA 3I31A 3KHLA 2OKQA 1L3VA 4C3MA 3KMQA 3NMAA 4LJMA 3HSJA 1RLCL 1FT8A 2VA3A 4CLUA 1TL5A 3GSIA 3R5CA 2B4PA 1OMSA 3BDEA 3FBBA 3PRDA 3T6BA 4AT1B 3PJ9A 4OYXA 2GGPA 2RKIA 4A8MP 3CSKA 4KC5A 3LWMA 3C6UB 3GQCA 1JLAA 3D66A 3NRBA 1LW2B 1NK8A 4F67A 1XWLA 2PMHA 2OEMA 1ZPVA 5A8KA 4DSJA 4ZOSA 2ROPA 4XIUA 4OYOA 1FVSA 1S1XA 3WX8A 2W25A 1OSDA 2C3PA 1P8GA 4L3NA 2G9OA 1HKAA 3MM9B 3W5XA 4EBEA 1HBMA 3SMZA 2GFFA 4O4RA 4HTIA 1UKUA 4G1PA 3KDNA 2C22A 3HO1A 1F60B 3VQSA 2HBZB 2HVZA 4C0OC 1OQ6A 2AJ4A 1YJNS 2ATLA 1A6LA 1WD6A 3A3OB 2DH7A 3BH7B 1MMDA 4DV0F 2ZITA 2R7SA 3C2PA 1X9MA 2IA6A 2YKNA 5D78A 2DB1A 1TKDA 4OHXA 4RW9B 1S9EA 5E3CA 3SFGA 1RDRA 1HBNA 4QR0A 4EYHB 3UN7A 1KONA 3DLHA 3KK1B 2A6OA 2DNHA 4UTGA 2QTWA 4C8KA 1D9AA 3EVOA 2G2YA 3GYXB 1S5ZA 3NGTA 2P2CB 4WTYA 3AJ2A 1MWSA 3MAAB 5F3TA 2Z57B 3OBIA 3M8ZA 5B08A 3DYAA 2J6UA 3NBPB 2N7YA 3CMES 5KFIA 2PFDA 2KL8A 1SPBP 4L75A 4O0IA 3EZOA 3J81Y 3K58A 4IDKB 2W2MP 2ZJQQ 3D54A 3C66A 3JAMU 5KFDA 1QVFR 5DZ7A 4C8NA 3H42A 2HZCA 4WKRA 2QRRA 1NK0A 2Z2ZA 5KFSA 2BA9A 2MKJA 3T3FA 3KG4A 4DG1A 1SCJB 1RHJB 3KJFB 3LP2A 2VPYB 1FJGF 3OLBA 4WP9A 1UVNA 5H1SV 1CJVA 5F41A 3TQ1A 3I32A 2HHUA 2XULA 5B0EA 1CBKA 3M2UB 2BBEA 1R43A 5KG1A 3R3TA 2MZQA 2PE8A 1WEXA 2EXUA 1S1WB 4CP5A 2YPYA 2RUGA 4NLSA 3U1MA 4Y34A 1VJWA 1VQMS 3QMQA 3MMCB 2DO0A 4DFKA 4F2SA 4UW2A 2AU0A 4B08A 3V6JA 2V4QA 4IG3B 4ITSA 3Q89A 5MLCV 3D28A 4IO1A 3TEGA 3DU6A 4PCQA 4EK2A 1QUPA 2ZHAA 4IOAQ 5FLXY 2ZZMA 1T03B 3IRXA 2GQ2A 3T1HF 2VU5A 3TZXA 2BJ7A 2OEJA 3KFWX 4OI4A 3OHAA 1C4CA 2IVMA 2ZH7A 3BN7A 4CJNA 3MXHP 4DR3F 1WOPA 4WF9Q 1T7PA 2CNKB 4JI3F 1HR0F 4X4UA 5ETLA 1T02A 2PO4A 4OYZA 1K47A 3V4IB 4I2QB 1MWRA 1UMJA 3AA9A 1TL7B 2V8DA 1FTRA 3KHGA 3U02A 4EZ6A 3JYTA 1X7VA 3AFGA 3SCLE 5JMNA 4EEYA 5G0RA 2B9YA 1RBAA 2RQ4A 1HQUB 3RBZA 1WG4A 4DJBA 2H4WB 3ET6A 4B3TJ 3DRPB 2FLNA 1TTHB 2ABYA 4RA7A 2MSTA 4B9NA 1N0UA 3TUPA 4LSNB 5KFWA 2Q1LA 3FQKA 2ZM6F 4OI2A 1RKJA 1C0TA 2GNKA 5ETRA 2VPZB 2WBRA 1S9GA 4U6PA 2I1RA 5IV3A 4DF8A 2OLWA 3KK3B 4NLXA 3JSYA 3T6JA 4ELUA 1C4AA 2EFGA 5L9XA 1R8BA 3PHTA 5GMDA 1SVDA 2XYHB 2ADBA 3TWZA 4HDGA 1NK5A 3A8JA 4X4PA 3GJSB 2VJUA 1NKCA 1K73T 3L7OA 2ASYA 1LNQA 4I56A 4CO0A 5K9FA 5B0GA 1TFYA 5LMUF 4DV4J 1M90T 5EHHA 4NLDA 3PDNA 3R7SB 3OTOJ 2C42A 1UJ5A 3W61A 3NY0A 4MT1A 3GU0A 2B6AA 4NASA 3MMBA 1FWLA 2IBOA 3D1QA 2XMUA 1LW0B 1HI0P 2HPUA 2J8SA 3NGSA 3G82B 4ED6A 1DHMA 5L39A 5HMZA 3W3SA 4YB6A 2NSCA 1LWXA 2ZVIA 2FVCA 2O01C 1OO0B 4FYWB 2RD5C 1UVMA 2ASLA 3JS9A 5KFKA 4CRJA 2ROEA 3HLUA 3CGIA 2GQQA 4S0MA 1YZ6A 4Q44A 1NB7A 3VAIA 5HL7Q 2L9NA 4K4VA 4J9NA 2DEIA 3CCVS 1FDBA 1DFDA 3FZ2A 2AZ3A 3CCQS 3CDEA 2MSSA 2R8GA 2HGMA 2CJKA 3AB2B 2C2DA 1FDNA 1JXEA 3MM7B 3ULHA 5HBMB 3Q2SC 4QPXA 4I1TA 2V8PA 1RA6A 1KC8T 4DL7A 4DPOA 2HQIA 3ISNC 3LF0A 2ZHOA 3FBFA 4A4JA 4K4YA 2UXDJ 2RVJA 3RRKA 4TYBA 3RGIA 3LOUA 4N77A 2AJQA 3VZHA 1Q79A 4DPUA 2FJAB 1TUGB 2WHOA 4DQPA 1Q1KA 2E1MC 2MQQA 3MCSA 3NOGA 3ZZOA 3TAQA 2NZCA 5MAOA 3IMQJ 2HFZA 2R8KA 3RUBL 1IM6A 4B9LA 1U2CA 2AJ0A 2J9DA 2JSXA 2HHQA 4FF3A 2CYYA 4P73A 1WOOA 3OV7A 4EZ9A 2VQEF 3HVTB 4JI0J 5F0UA 3D5MA 3BGLA 3P5BP 3DI6A 4ALZA 2F8MA 2R7XA 4I67A 1HNZJ 2J7WA 3OL8A 1RA7A 2Y1IA 2RQCA 4NLPA 3MEGB 5GAEU 1ZA1B 2W4CA 4ECUA 1HWJA 2W4DA 1Q16B 1G6BA 1FF2A 5E2QA 2BW2A 4C8LA 3KHHA 1FWPA 2ZE2B 2JNJA 4KGVB 5HQLA 1SJFA 4A8KA 4LF1A 2VICA 2HHPA
chains in the Genus database with same CATH topology
3WDOA 4TY8B 1S0NA 4WYWA 1XNRF 4KR0B 3O2IA 1VMBA 2KFNA 5A0YA 1TAQA 3CMAS 4X4TA 3FFIB 3MR3A 2AGOA 1K25A 5KSHA 4ATNA 2DITA 4NL5A 1LK7A 1VGYA 1SUQA 4TU7A 1HARA 3UDCA 3CO9A 1KTVA 3FSYA 3LO3A 2MY7A 3PW0A 4OVDA 5KT2A 2VB6A 3H59A 2EI5A 1CG2A 4BHQA 4DHVA 4B9SA 2N3OA 2F3JA 2LXFA 2PDAA 4J9LA 2HRYA 3US5A 4K4TA 3CCZA 3UR3C 3OXFA 4V19X 1NKBA 1KVJA 4ZKAA 1FK9B 3TUIC 4HI1A 4Y00A 1U49A 3G8SA 3DLEB 3MWBA 3I96A 1UW4A 1S1UB 2B7CB 4J9PA 3F44A 3ENQA 4PG5A 1SQEA 2KYZA 3W7BA 3M8QA 2E9TA 1QJHA 1MWZA 4ZCKA 3MFIA 2M8HA 3RR7A 3M4XA 3POTB 1HHTP 3EGZA 3P3DA 2EBGA 2MHEA 1FO1A 3KG0A 2LQ5A 3H5SA 4EYIB 1JJHA 1YTYA 3CULA 4J9RA 1DARA 2B3TB 4WK1A 1Q8LA 5KT3A 2ZH6A 1DQAA 4ILLA 2W8LA 1E6YB 4UUXA 2B9WA 2HMIB 2RF2A 1RTJA 2IRXA 4HEA9 3QJJA 2YTCA 1F5AA 1FD2A 4E8UA 4QU6A 3RB3A 1GXTA 4GMKA 3DHWC 2PSZA 5HP1B 4F3OA 3J7ZT 2ZH8A 2KYXA 2MGZA 2EWHA 1TQLA 3HVTA 4QW8A 2QSWA 2GC8A 2R8IA 1BQMA 4Y0FA 5HMYA 4DOZA 4XAKA 3G96A 1QY7A 2BYCA 4QIWD 4YMEA 4URSA 2RU9A 2ZH4A 1Q82T 1JLCB 1BWEA 1TP7A 2A18A 2HWTA 1FKPA 3SI8A 5M19A 2VV5A 3FVYA 4B3SF 4JYAF 2FB0A 2R2SA 2H5EA 3E2EA 3HHLD 1GTHA 5E33A 2KO1A 4C7QA 3HHLA 4EO6A 2E1CA 1S1TA 1TL4A 2JVOA 2RJZA 2QSFA 4KO0A 5CZXA 4X4SA 4B9TA 1Y3KA 2J6TA 4DWIA 2MKHA 4KHMA 1S6QA 2AQ4A 2GMHA 5DQHA 2L41A 1HNVA 1XERA 3AJ1A 4Q5VA 1CC8A 4N5SA 1CVJA 2AJFE 2DHSA 2VZ9A 3LANA 1VC6A 4I6YA 4DLEA 3VSLA 4TN2A 3MEGA 3G4SS 4X4VA 2PT0A 1L3SA 1IBMF 4OLOA 1RT4A 3IXQA 2MXYA 1N36F 2XSJA 5CYQB 1ZAWA 1ROFA 1X5PA 4ID5B 4O3PA 1RT1B 2R7UA 1OPIA 2IJFA 4RNNA 1QLNA 4F3QA 1R8HA 4IO9Q 1XMOF 2FD2A 3PIOQ 4JI5F 3KJVB 1TL3B 1U24A 2VG7A 4A8FA 1TV6B 3T1AA 2QLXA 4I6WA 1N33F 4ZHRB 1D0EA 2DH9A 2YNFB 1M5OC 1L3KA 4C3KA 2A2CA 4ZVFA 2UXCF 4I6AA 1TVRA 3VWSA 4AFFA 2HNDB 5KFGA 2FJXA 2ZNZA 3OUYA 1WG5A 2XBPA 4ZPTR 4KTQA 1C0UB 4IFVB 2CPFA 2GMJA 4IH6A 1KTQA 1X4FA 5DDOC 4IOCQ 1VBXA 2F4VF 4R23A 3MPWA 3D0GE 1GAOA 3KWMA 4KE5A 2HHWA 3PY8A 5B09A 2R9LA 2VBWA 3KOAA 2N3LA 2J6SA 1IKWA 2VKZG 3J7YI 3WBZA 2XLJA 1U8SA 3DHXA 3H2UB 5KFTA 2ZZNA 3FFIA 4ZMMA 2NR0A 4WK3A 1A7GE 1TK8A 4O4GB 2GJ2A 3HP6A 3ICLA 1FE4A 2V4JA 3PW4A 2RRNA 1RTIB 5KOXA 3O6QA 3KK1A 3PW7A 2ZFHA 4I7FB 4ES2A 4OI1A 1ZYQA 4TXSA 3GFHA 2IAJA 4O3QA 4OZ0A 4PG7A 5K8PA 2YKMB 4ZP6A 4QWAA 1XK8A 4C8MA 2RU3A 4YR3A 3ZZRA 4F4YA 5DG8A 3PKMA 3N4WA 1GQEA 2E29A 5KFNA 5DDRC 1FK9A 2AGQA 4M94A 4DL6A 4ZA1A 2Z2MA 1S77D 4KV8B 3QLHA 2WCXA 4F4KA 4Q0BA 5EX3A 3SDEB 3UDLA 2DNPA 2LU1A 3GFXA 3M2RA 1S1UA 4RWXA 2B9XA 5I3UB 4OQJA 1IJEB 2AW0A 1O51A 3SV3A 2Y0SD 1MMNA 4KT0C 3AB4B 4WFZA 1SH0A 4TNOA 4BCAA 2FIUA 4I69A 3Q8SB 2B4VA 3NBPA 4Y6IA 1IKVB 4NA3A 1BQXA 4FBUA 2DTJA 2QA2A 3ETOA 3VCDA 2HMIA 1Q7LB 1RT6B 1DLOA 2VFVA 2XI2A 3FRYA 5IWAF 2FHMA 5AE1A 4MKBA 5DGAA 4K50A 1M5SA 2XLIA 1D8ZA 2KJVA 2CPEA 2G0CA 3LAMA 3TNVA 4W92B 2VASA 3MR6A 4H54A 4IDKA 5A8WB 1WF1A 3EZ5A 2FVSA 3QIPB 3DLJA 3V4MA 2VBXA 2JC0A 2PI5A 1HWIA 3R5BA 1YJVA 1HPZB 3G86A 4NCBA 3UCGA 5DG7A 3EZUA 3C46A 1U1NA 5C42A 1SJRA 2F8EX 5DGBA 1N32F 1HQEB 2LLZA 5IT4A 2I9SA 2YKAA 1AW0A 2M5YA 1P6TA 1SXLA 3AY0A 4DLGA 1AFJA 4MH8A 3TP2A 4MKYA 2YKPA 3CCUS 2JOQA 4TQSA 4Y2IA 4R25A 1BQNA 1FDDA 3PACA 1FNMA 4GO5X 3SEOA 2R2TA 3IN5A 2OFGX 4CPKA 1X4GA 4NPOA 3H8YA 4JV1A 3EGNA 4W90B 4ECVA 2I2YA 1H7XA 3AQOA 2K3KA 1VQ5S 4OZ5A 3UCUP 4NYPA 4A8XA 3OTEA 3FQLA 3NMRA 4MAKA 3DRSB 3GB0A 1GH8A 4ZCIA 4ZLPA 1P1TA 2J5AA 2ZC3A 1WG1A 4ZPVR 4WE1B 5F3ZA 4DSEA 1TL3A 5GVQA 3TA2A 1TV6A 1N54B 4J37A 1FJCA 1VC0A 2BQUA 3O1LA 1NZAA 3M2UA 4LVOP 3KLIB 4JI8F 2OSRA 3DXBA 2YNFA 2WW8A 4D3HA 3L95X 4B3RF 4Q43A 2KT2A 3OL6A 3OFEA 5CD4H 3KLHA 3V6DB 1YGYA 2HNDA 3N6NA 4ZP7A 2ZOFA 3KTQA 4QIFA 1VQ9S 1VIXA 3NCPA 1C0UA 4C4WA 2KRBA 3PXGa 2JZ5A 3N01A 1N5TA 2CG4A 5GAHU 3MD3A 5L1LA 1YJRA 5LSRA 1UWBB 3NNAA 1VC5A 4URGA 4F4ZA 3P49B 4PG6A 4QCLA 3MDFA 1RT2A 1MW7A 1TL1B 2IM0A 3QO9B 2ZDPA 1FRIA 4CNZA 4ZK7M 2YH0A 4R0EA 1IJFB 1UEVA 4M5DB 1BC6A 3BO2A 1RTIA 2E1AA 4QU7A 5T7LB 3FRZA 1YJ9S 4NCAA 4RW7B 1X9SA 2VC0A 5F8MA 3DWKA 2YKMA 3AHPA 4NLWA 3CXCR 3CDAA 1YJWS 1D9FA 4MIAA 4IG3A 1RP5A 1RKIA 4EGLA 1FA0A 2KHDA 2MQNA 5GAGU 4DFJA 2EC0A 3RW6A 3WX4A 3CT9A 1HYSB 1U1QA 4DR4F 1FNXH 3IR6B 3QGHA 5KFUA 3HKZD 4K5SA 3K8VA 2HVIA 4NYOA 2X1BA 2D74B 5IM0B 4B3MF 4IFYB 3CWJA 1N6QB 3OTDA 3BZQA 1Q4RA 3GG1A 4IKAA 1DTQB 4D3GA 2R8JA 1Y00A 1L3TA 3CD7A 3ISND 4MIWA 1T03A 2ZUGA 2AV5A 1HNXF 1S6UA 3PZPA 3HPOA 4YFUA 2BOPA 4KQZA 2MZSA 2YNHB 2NLWA 2Z8QA 1EETA 3PO4A 2DNOA 4A8SA 5C24B 2ASDA 3H20A 2DT9A 1Q8IA 1U45A 4C8OA 4U67Q 3OSPA 2QMWA 3KLGB 1XC9A 1FRMA 4X65F 2F8HA 4X62F 4K59A 1RQ0A 4YP3A 2R7TA 1FD8A 2HLTA 1QE1B 3U27A 1JLEB 3KK2B 1AXQA 3IFEA 3KMSA 4DV3F 4KKOA 5KFRA 4X4RA 2XHWA 2OPPB 2KM8B 2KT5A 2LDYA 3WZ0A 2VG5B 2CDQA 3QWPA 3UD3P 3Q2TC 1MSWD 1VLYA 4YY3F 3FSIA 4OZ1A 2JEGA 1N5SA 2OIHA 3PM9A 2X1GA 1U6ZA 3TX8A 2RRBA 1E6VB 1HQEA 4K5RA 3SSQA 2DH8A 2RS2A 5F9NA 3DM2A 2MPUA 3IS9B 4XDDA 3O5TB 3H40A 2HFOA 2XMVA 5JXSA 2WB1D 5GADI 1NJWA 1OPZA 2VG6B 1TZ0A 1VRTA 4PUOB 1JLQB 1FXDA 5J2QB 2CQ2A 4ETXA 3V4IA 2C3OA 3IGVA 4KBIA 2QV6A 2KXNB 3Q22A 4EBCA 1S99A 2UUCF 4RKUC 4CO3A 5IZHA 1N4LA 2U1AA 1XR6A 2KU7A 5B0FA 2DRBA 2GGPB 2RKIB 1H3DA 2W9BA 1OQ3A 2RRAA 4HYKA 3PJXA 3F41A 3NWGA 4J9OA 1IUJA 3NP5A 2B43A 2UXBF 1B7FA 1U2RA 3UE3A 2OPQB 2DO4A 3BM7A 2FJBB 2E7XA 3GILA 1D8YA 2VOPA 2BM1A 2ZDOA 4CO1A 3PVXA 1QAXA 2EFQA 4ZVGA 2HWHA 1X4AA 3IG1B 2CZ4A 4HT7A 4ED3A 2QEXS 1Z1ZA 4FNHA 4KB7A 3V6DA 5A8KB 3NNHA 1X8DA 3DRPA 4Y3CA 3TI0A 1QVGR 3B82A 3UI3A 2DRAA 1YWXA 2HS0A 3TAMA 1HBOB 4DL4A 3IWNC 5J1PA 4N56A 1HMVB 3M9NB 5D4NA 4PQUA 2Z2LA 2AX1A 4CQ1A 1Y5NB 2VFSA 3QAEA 2CPZA 5D4PA 2BUNA 1C1BA 5KOWA 1UWBA 2EFOA 2RE1A 4IOBA 1S1XB 2J7UA 4LF4F 4FYDA 2CQBA 5KG6A 3BQ2A 4ZP8A 2FC8A 1R3NA 4U7CA 2M70A 3SSSA 3OFHA 4M5DA 3GIMA 2ILZA 2M0GB 3A8EA 4R1GA 1NJXA 2XNQA 3T9NA 4G1IA 3IR7B 4OHWA 3Q0AA 1I1GA 2OD6A 3F73A 5AE2A 1KN6A 2BABA 4R5PB 4RWWA 4NYZA 2E5JA 5FD1A 3MECB 1TKXA 5D77A 2CQ4A 5DETA 1X4HA 3KK3A 2M4MA 4DR6F 1WEZA 2EBEA 1UAWA 2G4BA 2E66A 1HBMB 2IMOA 3MUVP 4M95A 4WIIA 1WF2A 4J5OA 4G3IA 1HYSA 4DQIA 2LKZA 1VQSA 4NLVA 2ZOMA 1VFJA 1S10A 1PGZA 3CJ0A 5IM0A 1DZ5A 2HVHA 1OWXA 1DTQA 3MEEB 3I4HX 5DQIA 1S49A 4WFXA 2JLGA 3GFYA 3OTCA 3RAQA 2YNGB 5J2MB 3MM8A 3DOLA 2DPIA 4JV5F 2NZ4A 4YOEA 2OLVA 4DV1F 4HL9A 2YNHA 2VUGA 1SI9A 1ZTWA 4H4MA 2LXUA 5C24A 4WFNQ 3HI9A 3PRBA 2WSFC 2QA4G 2VA2A 4ID8A 3LP1B 2GCFA 2K7KA 4KIAA 1BLUA 1S1VB 2WBMA 4GC6A 3T5KA 1JLEA 2U2FA 5JUMA 4KGKA 5J2PB 5I3PA 5KG5A 5EX0A 4K4SA 2OPPA 2HAIA 5E3QA 1YQHA 1FJEB 1GX6A 3X1LB 2YNIA 2FJWA 2VG5A 4QJVA 3T19A 1PILA 2ZBCA 2WAFA 1D9DA 5KFXA 1IQTA 3JSRA 1X4CA 1YJUA 4HT5A 4F8RA 3SCKE 4I4BA 3SCIE 2FTRA 4AXJA 2WOMA 5SUHA 1R6YA 2NYIA 2ZH2A 4OI0A 4TLRA 3IS9A 2VD3A 5H9FJ 5BR8F 3R27A 1P1LA 5E3RA 2VG6A 1VQKS 1WELA 4PUOA 2CPYA 1HBNB 4JI2F 3W2VA 2ZJPQ 1VQ7S 2CQ0A 2DNNA 1RYSA 4PXCA 2RSQA 1NKEA 1WACA 3TA1A 4IQXA 5T41A 2JJ4D 4P2SA 2XGPA 2UUWA 5LJ3Y 3GFZA 4Q2LA 1V9OA 3CDBA 2DVIA 4DBQA 2DR5A 1ZTTA 2OFHX 2UV8G 1S6PA 1ZZFA 3M05A 2NS1B 1LW0A 1JB0C 2OO4A 2AJ1A 2HNYB 3PV8A 5KTQA 4ILMA 4H4OB 3MEDA 4HH1A 3ZFVA 5B0BA 3RBEA 4RX6A 5KFJA 3JTNA 3SQGB 2AYMA 1VBZA 4IRDA 3I56S 5C25B 1U2FA 5LXRA 4ICLB 4WFYA 5F8HA 4ED8A 1JJ2R 2BE2B 3IG1A 3LPYA 4DSIA 2CKWA 2NXUA 2MKSA 4C8YA 3X3UA 1C1CB 5DJBA 4FF4A 4PG8A 4X84A 4Y2CA 3MZIA 3I5CA 2BQ3A 3GIIA 3M8PA 3I0SB 1HBOA 1O8BA 4N47A 4USJC 1HMVA 1O0PA 3HFKA 1N5YB 2VBZA 3MR5A 2DGWA 1YITS 2XWXA 3UE2A 2CPDA 2J9DE 4BWJA 2PMZD 4A48A 5M2UA 4FXWA 3KLFB 4ZPCA 1KD1T 1JXLA 3HX9A 4C2MA 4DUZF 1VOMA 4KGMA 1SKRA 2XI3A 2A10A 3PX0A 4USHA 2PI4A 4HKQA 4LUBA 4UY8T 3OVBA 1U25A 1PYYA 2OMLA 3MECA 4RNFA 3G6YA 1X0FA 3MM5B 4YR2A 2IMWP 2ZNYA 2JHEA 1IR0A 1S7HA 4DL5A 1WWHA 4MK7A 4UQGA 3U1LA 2XCPA 2IM3A 3F56A 3BDPA 4DEZA 4BS2A 2FVRA 1CPZA 2R7RA 3QWUA 4CI0B 4J9MA 1DBDA 1KQSR 4R0JA 2MJUA 3MEEA 3H5UA 4RU2A 4CTAB 3MTJA 3B8HA 3O8WA 2AX0A 1HHSA 2YNGA 3CD5A 3C3LA 4AL7A 1FKAF 3BO4A 5HBMA 2V0NA 2W7PA 4ED1A 3KNAA 3IA0A 1RTDA 3LP2B 2CZVC 2DGXA 4FN5A 3LP1A 2VL1A 5I42B 1OIAA 3MM6B 3RAXA 1S1VA 5CCLA 5HMWA 4U9RA 1P9QC 3H4DA 1T05A 2LVWA 3T9ZA 2KZMA 1KR4A 2W9CB 2MQLA 3MD1A 1JLGB 1FEHA 3QGPA 1SL0A 4B9MA 2DR9A 2YX1A 1WHXA 1HI8A 2KG1A 1HWLA 4NZ0A 1HBUB 3TVKA 3GV5B 1GXLA 2VPXB 4Q45A 1JWWA 1S9FA 2Z4PA 3DLGB 3PR4A 4ES3A 1ZOTA 2V2KA 2IM1A