3CUNA

Aminoacyl-trna synthetase ribozyme
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
91
structure length
91
Chain Sequence
RPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords RNA (92-MER)
publication title Structural basis of specific tRNA aminoacylation by a small in vitro selected ribozyme.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna/rna binding
total genus 16
structure length 91
sequence length 91
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3cunA00
3MI7X 2DK2A 4FXWA 5GADU 3G6ES 3CC4S 1VQ6S 3SDEB 3BO4A 2KVIA 4C0OC 1X4AA 1VQ5S 2M0GB 2XS7A 3TP2A 3US5A 1P1TA 1WTBA 2MQMA 1WHWA 2M8HA 2N3OA 3CCUS 2CQHA 2CQGA 2J8AA 3G96A 1UW4A 2AD9A 2KH9A 2MMYA 5JVHQ 1M1KT 4QU6A 2ERRA 2A3JA 3VAKA 5GVQA 2V94A 1FJ7A 5EN1A 1R8PA 1WF1A 2MQPA 3G8SA 1DZ5A 2DIUA 3J7ZT 2BZ2A 1X4HA 3S01A 2DHSA 2KFYA 2LA6A 4WIIA 3S8SA 1X4FA 2KG0A 3CD6S 1UFWA 1VQLS 1FJCA 2ADBA 3D2WA 2RVJA 4F26A 4TLQA 2E5HA 3MD1A 4FXVA 4ZKAA 2QFJA 2VODA 2DNHA 5D77A 3UWTA 2M52A 1U1QA 1WG1A 4LJMA 1X5SA 2CPDA 2KI2A 2RNEA 2KHCA 2SXLA 1H6KX 2DGVA 2X1GA 2XS5A 2GHPA 1WF0A 3CPWR 3B4MA 1L3KA 2KT5A 5DDQC 1M5OC 3CCES 1U1NA 4F02A 2DNLA 2LCWA 1U1RA 1WHYA 3CUNA 1DBDA 1SJRA 1SJ3P 2MZJA 2DHAA 4Y00A 3I55S 1AUDA 2HYIB 2MHNA 2WBRA 1PO6A 1KQSR 2CPXA 1OPIA 2MZSA 4F25A 1YITS 1A7GE 3IWNC 2G1DA 3FEYB 2CPZA 1OO0B 4OZ1A 3UCZP 1WELA 1G2EA 3CULA 1O0PA 1A9NB 4LMZA 3P3DA 2UP1A 1N52B 1X5OA 2DHXA 1ZH5A 1JMTA 3CCQS 2GO9A 3R1HA 5LXRA 3G8TA 2DNRA 2DGSA 1X4BA 2KU7A 2MB0B 2CPIA 1SXLA 2KXHA 1VC6A 1ZZFA 2MZRA 1WHVA 1M5PC 2DGXA 3EGNA 3G9CA 5ITHA 1S72S 1VBZA 1VQKS 2DIVA 2CQBA 3CCMS 2LKZA 3ULHA 2CPEA 2OTLS 2G0CA 3UD3P 2MSTA 3IRWP 2DNMA 3UE2A 2NZ4A 1FHTA 3VALA 3RW7A 1X4EA 2HGNA 1YHQS 5GAGU 4CIOA 4WFAQ 2LXIA 2MSSA 1U2FA 2E5JA 4BS2A 2F9JA 4P6QA 1RKJA 1SJ4P 4ED5A 3PIOQ 2JX2A 1DRZA 1R8HA 5MLCV 1D9AA 3N9UC 2YTCA 2LQ5A 5BJRA 2DHGA 1XN9A 5D78A 5GAEU 1UP1A 2MZTA 2N3LA 2RRAA 3V4MA 3CXCR 3MUVP 5DDPC 1X4GA 4EGLA 1DHMA 1YJNS 1FXLA 1VBYA 3CC2S 2J0SD 4IUFA 3CTRA 1B7FA 2KXNB 3FEXB 2MGZA 2RQ4A 4OZ0A 2AYMA 2RQCA 5LSLA 3CF5Q 4W92B 1OIAA 3BO2A 1N8RT 3K0JA 5IQQA 1SJQA 2MQOA 1KD1T 4U67Q 2MPUA 2DNQA 5HO4A 2XSFA 3NS6A 2RUGA 3MUMP 4WKRA 4IOCQ 1Q81T 1FNXH 1X4DA 3NS5A 1FT8A 3RW6A 4YOEA 2MZ1A 2X1AA 1H2TZ 3CMES 3Q2TC 2K8GA 2KYXA 3CCRS 3SDEA 2M7SA 1Q86T 1K9MT 1X0FA 3CCJS 4CH1A 4PKDB 1VQ9S 2KN4A 1K8AT 2LYVA 3ZZZA 2MQNA 3L3CA 3NNHA 1UAWA 2QEXS 1BY9A 2DH8A 2DGWA 1JJ2R 3MDFA 4UY8T 2DGUA 2G4BA 3VAMA 2NLWA 4A8XA 2DO4A 2DNKA 2M70A 3HI9A 3BO3A 3CC7S 3P5TL 1NJIT 1FJEB 5DETA 1M90T 2D3OR 3VF0B 2M8DB 3CCLS 3CCSS 2OSQA 4TU8A 2LA4A 1U1MA 3THTA 4LIRA 1WG5A 3H2VE 3R27A 2DNZA 1KOHA 2XNRA 4W90B 2JWNA 1N54B 1X5TA 2YWKA 1VC0A 3MOJB 1S79A 2FC9A 3MURP 1U1KA 1VQ8S 2DGQA 1U6BA 2YH1A 2MKCA 2DITA 1YJWS 4M5DB 2RRBA 2LXUA 2CPYA 2RS8A 2KM8B 2MQLA 3VAIA 2N82B 2CPFA 2MKSA 2OSRA 1WI8A 2HVZA 3NNAA 3NNCA 2RT3A 2ZJQQ 2MZQA 2CPJA 5IFMA 1W2BR 3PIPQ 1K73T 2CQ4A 1NO8A 2E5GA 3BEGB 2I38A 3G4SS 2E5IA 1U1OA 3U1MA 1CVJA 2MJNA 2DISA 3THPA 1WEZA 3MUTP 2AYGA 1X4CA 2CQPA 2HGLA 2Q79A 4Z2XA 2VONA 2YKAA 1JJ4A 2U2FA 3J7YU 4PR6A 1PGZA 2JVRA 2MJUA 3OW2R 2D9PA 1Q7YT 1KC8T 5IM0B 4CQ1A 2E44A 2MKIA 4J5OA 2KG1A 2CQ1A 2MKJA 2FPHX 2EVZA 1QVFR 2U1AA 2F3JA 2CQDA 2MQQA 5CXTA 2LECA 2X1BA 1KOOA 2QA4S 2DNNA 4RU2A 1FO1A 1WEXA 4TU9A 2AYEA 2EK1A 1HD0A 1H2VZ 1VC5A 1YWXA 4QQBA 4QPTA 2L41A 2HGMA 5H1SV 2DNYA 4WF9Q 3VAHA 1OWXA 2CPHA 3TYTA 1VQMS 2HZCA 1H2UX 2M4MA 5CYJA 2JRSA 1HD1A 2DH9A 2D9OA 3TO8A 1M5VC 1Q82T 3SMZA 4WFNQ 3S6EA 5DDOC 5LSOA 2OTJS 2KXFA 1N88A 4Y0FA 2DGTA 1VQ7S 2DNGA 2VOPA 4ERDA 2LMIA 2M88A 2M2BA 4UQTA 5DDRC 3ZZYA 3HHNB 1WHXA 5CA5A 2CQ0A 4YB1P 3CMAS 2XB2D 2MKKA 1M5KC 2PE8A 3H2UB 2LEAA 3G71S 3DLLQ 2VOOA 1ZZNA 1RK8A 1QVGR 2DB1A 2ZJRQ 2FC8A 5LJ3Y 3CCVS 5IM0A 1JJHA 2B0GA 1D8ZA 2PEHA 5GAHU 1VBXA 3LPYA 2CJKA 2I2YA 2L9WA 1WF2A 1YJ9S 3UCGA 4C7QA 4YUDA 5JVGQ 2K3KA 2X1FA 3VAJA 2O3DA 2RS2A 5LJ5Y 2LEBA 3UD4P 5DM7Q 1YIJS 1URNA 2ZJPQ 4V19X 2FHOB 3UCUP 5FJ4A 1YI2S 2J0QD 3B4DA 4WFBQ 1WEYA 2RU3A 1VQPS 4IOAQ 2CQ2A 3Q2SC 1YTYA 4TU7A 5LXYA 2J76E 2DNPA 3EGZA 3U1LA 1VQOS 1VQ4S 2JVOA 1F9FA 3LQVA 2CQ3A 1U1PA 5HL7Q 4IO9Q 4CH0S 2DH7A 4C4WA 3JB9k 3SXLA 2DO0A 3DXBA 3VAFA 2F9DA 2N7CA 2KRBA 4WCEQ 2MXYA 2DNOA 1P27B 1U1LA 4PRFA 1U6FA 3MXHP 3S7RA 3VAGA 2DGOA 3I56S 1NU4A 2EK6A 3R1LA 4QU7A 2AYBA 3NMRA 2M9KA 2KM8C 3P6YC 2MY8A 2L08A 5DM6Q 2BOPA 2MGZB 5GMKa 1WG4A 1QM9A 2YH0A 1VQNS 1SJFA 2FY1A 1IQTA 3EX7B 2XS2A 3BS9A 2MY7A 1HA1A 1HL6A 2CQIA 2XNQA 1X5PA 2OIHA 2ADCA 1WWHA 2KRRA 2CQCA 2MYFA 2OJ3A 1WI6A 2MKHA 3MD3A 3P49B
chains in the Genus database with same CATH superfamily
1KFDA 1WUUA 4C0OC 3ZZOA 1C4AA 3UVJB 2XS7A 2MLZA 2C42A 2N3OA 3FRZA 3C8YA 3K89A 3G6XA 4EWTA 2K7JA 2V94A 2FZCB 1Q8KA 4YEAA 1GXUA 4NYOA 2HHHJ 4C8OA 1UCNA 4BDPA 3AA8A 4DXLA 4I2PB 5KFIA 2FZKB 2E5HA 1EIYB 4JV0A 2YQ1A 4XO0A 1ZETA 2ZOGA 4I1TA 4HR2A 3SSQA 1SB6A 1RHQB 5A0YB 4DLEA 3NKYA 1WF0A 4MKYA 1LWXA 1JLCB 5LOQA 4Y2KA 4KV8B 4YDDB 3PV8A 3WIVA 4HEA9 2JFDA 4QIEA 3VGSA 1UVNA 3PDNA 5E3AA 2DCLA 2EBGA 3FEYB 2IPOB 4YQWA 4C8LA 3QT6A 2YNIA 1DLOA 4TLRA 2FJEB 1S97A 3BSCA 4I2QA 4LF7F 2GO9A 3DGVA 3K5MA 3LP2A 3CO9A 5CCMA 5J2NB 3RRGA 2JLFA 1NK4A 2Y1LB 1WHVA 2V50A 3ENWA 4EBCA 4A46A 1MN9A 1N5SA 1U09A 1NM2A 2QMXA 4Q8EA 4DSEA 3DGPB 4MT1A 2OEJA 1NSAA 3M05A 4O3PA 3R5BA 2C3PA 5E0OA 1AW0A 4UOGA 3IGVA 2H65B 4RX6A 4EGLA 1S1WA 1Q4RA 2HBRB 1VBYA 3CJ8A 2OD4A 4USMA 3NS7B 3EVMA 2O1PA 2CNLB 2ZKUA 3JAMU 5J2MA 1T11A 2IA0A 4FF2A 4QIGA 5HQLA 4J9VA 1VRUA 4M5MA 2KYXA 1FESA 4C6AA 4ED0A 3HKZD 1JK9B 3D68A 1RT6A 1UAWA 4I7FB 2XZWA 2ZH8A 3R5AA 2NLWA 1S1TB 2ASLA 3KDOA 2GC8A 3UR3C 1TP7A 1RBAA 2JFKA 5IV4A 1B7YB 1LWEB 2VL1A 2KFNA 2Y1RI 1UEVA 1MWQA 2DRBA 1TL1A 4FXDA 2HNYA 1T02A 2HPUA 1YJWS 3ZZUA 2CDQA 1V5IB 5J2QA 3TX0A 4NLVA 2EKYA 5L8RC 1NPRA 1W2BR 2HHPA 3K5PA 3BEGB 4J9MA 2AGQA 3KFWX 1VRTA 5L9NA 1EARA 5AXKA 1VQYA 4DQIA 3H5XA 1XR5A 3J7YU 1PGZA 2RSQA 1H7WA 2PFFB 3Q24A 4ZJLA 5HMXA 2U1AA 5E2QA 2JSXA 1RWKB 5CXTA 4CLPA 3OTCA 1MMLA 1R7IA 5D3GB 2G0JA 2V0NA 2WONB 3IP0A 3HD1A 5MAOA 3LGHA 3DC2A 1JLGA 2E1PA 1Y3JA 3FZBA 2YKMA 3QMQA 3I87A 2D9OA 4ECYA 1M5VC 5HMZA 3UNGC 2MLYA 3MCSA 3BBFA 2ZH4A 4NLXA 4G65A 3SI8A 3W62A 3WC0A 4JI6J 3OQ2A 4LFBF 1DQAA 3DLKA 3OV7A 2VOOA 4DR6J 2ZJRQ 1TKXB 3C15B 5LJ3Y 1S10A 2B56A 1TL5A 1QAYA 1WF2A 5LT5A 1R8BA 2ZUAA 2K3KA 1VOMA 5LJ5Y 4EBEA 1QAIA 3P96A 5ETMA 1H7XA 1J5OB 3EICA 3G86A 2CQ2A 5SUHA 6FD1A 4UZCA 1VQ4S 2PEBA 1SV5A 1VK8A 1ZYQA 3SXLA 4DR7J 1XJWB 3MCMA 2KFZA 1Z1ZA 4RW7A 3I56S 1T8EA 1MROB 1VRQC 5DM6Q 1RWWB 2RU9A 3NWRA 3DM2A 3SEOA 2OPRB 2BW2A 4C8NA 5T41A 4LSNA 2ALZA 1IJEB 2M3DA 4LF5F 3D66A 4BBYA 1RB0A 5A6WA 1RAEB 4DEZA 1RTHB 5KFGA 3M8QA 4F04B 4DUTA 2YKOA 1YJ7A 3FFIA 2FVCA 3RB4A 3MM5B 2MLXA 4ZVOB 4NRTA 3MCOA 1CJTB 3J80Y 4FKYA 2XMTA 1FJ7A 5GVQA 3M9OB 3A8KA 4JYAJ 2X7IA 2XCAA 1VQLS 4B9NA 1FX4A 1L3SA 7FD1A 1HNVB 4QWCA 1C1BB 5HP1B 1U2CA 3BJYA 5JXSA 2AKWB 1WACA 2DVIA 3CT9A 1RYRA 1HBNB 5F41A 1NSKL 3HHLC 3EVOA 1KKHA 2DJWA 3A3OB 1Q5YA 2HIQA 2UXCF 1NSPA 1HPZB 2BRLA 3HHDA 1ULRA 4ETXA 1WHYA 1RWMB 3W61A 4F7VA 3GFZA 4DPWA 3V81B 1AUDA 4RW8A 3NGUA 3M2VB 5KFEA 3CJ2A 3TQEA 2R7VA 1REVB 1CULA 1RCOB 4O3NA 4ALZA 4X84A 2V5HG 1KS2A 4XPCA 1Q0NA 5AJ3F 1UJ4A 4C97A 1FNMA 1OQ6A 1VQKS 4B3TJ 3D6TB 3CGIA 4WU2A 1HBOB 1EAYC 3I9ZA 3M9MB 2BVZA 3RW7A 3OR2A 4LF6J 5GAGU 4KSEB 4DSJA 2JDJA 3SCKE 1VK3A 3VVUA 2IFXA 2VD3A 4Z37A 4UF4A 2VPXB 4A47A 4LFCF 3QJPA 1T9VA 1IWAA 2CNKB 1U0SA 4ZPVR 2HHWA 3KLGB 2QT7A 1KTQA 2D7SA 1HQ2A 1TKDA 3CJRA 4B17A 4RNHA 1S0MA 1RTJA 3VVTA 3BO2A 1XEZA 4U8YA 2YKQA 4NWBA 2HBQB 3Q23A 3H7HB 5A8KA 1FNXH 5DGAA 3LGNA 5AE3A 2ROEA 1Q86T 1N36F 2BM1A 4OX9F 1FFGB 3NG8A 2LQJA 3AJ2A 4CLLA 1X9WA 3GJQB 2NUHA 2IIHA 3W2VA 1LW2A 1NJIT 1VFJA 1M90T 4ZCMA 1S5ZA 3ZC4A 1NJXA 4OI6A 4GC7A 3M2RB 4UTGA 2FC9A 2MKCA 3FSIA 1W25A 4ZDNA 4DV0J 3ZO7A 5RUBA 1BWVA 1OY9A 4QWAA 5H9EK 4IFVB 2C2RA 1HNZF 3N6LA 4HL9A 4WU3A 2DR7A 4YHHF 2OI2A 1YKWA 1SL2A 5GMDA 1CVJA 2XBPA 1ZAWA 3ENAA 4Z2XA 3CJ0A 3P5BP 3T41A 1KVJA 3M7VA 3OW2R 7AT1B 1SIZA 2QN6B 5HJXA 3R7SB 5D4OA 5FLXU 1W26A 2HWIA 5B0CA 3RB3A 2MKYA 1O51A 1NH8A 3MEKA 4WF9Q 1KFSA 1NPPA 1KTVA 4XPEA 2D74B 2JRSA 2DH9A 2IHR1 3CIZA 1N88A 3J7AN 4LF8J 2CQ0A 1TKZB 5C2GA 4BC9A 2ZH3A 3I4HX 4ZVHA 3JTNA 2HMIB 1RA6A 1JJHA 2GJ2A 1HWKA 3SZ2A 3OBIA 1YJ9S 4CO1A 3R5CA 1S49A 1URNA 5DM7Q 2UVUA 1YI2S 1X0PA 4IOAQ 1NRKA 1I94J 1IKVA 2LQ9A 3O2IA 4NLOA 3ZTQA 4DI6A 4DZDA 4HACA 3RR8A 1FXRA 3FVYA 1TR0A 3ET6B 2BJ3A 1FTCA 2C2OB 2YNGA 4R25A 1FKOA 4DPOA 3F41A 3TEGA 2PD1A 2EK6A 3FC9A 3R1LA 2J7KA 2KM8C 1Y0HA 2HHHF 2MGZB 3KK2B 4QYZK 2ZFHA 1VQNS 4XK8C 3E2EA 4R5PB 4LF9J 4AXJA 1T9UA 1TK8A 3BPSP 4QR1A 3SSSA 3QYYA 4MJKA 4R0EA 2ZOMA 4OYAA 4DR2J 4DSIA 1NK5A 1T03B 4UOFA 2C2ZB 2VDIA 1EETA 2NYHA 2BQUA 3CCUS 2WVFA 4K50A 2R8HA 3GG1A 3AD8C 2BX6A 4ZVFA 3EDQB 2PMZD 3VAKA 5EN1A 4DQQA 5J2PA 1QLNA 2LA6A 4HI1A 3D3CJ 2QFJA 1WG1A 4DR4J 4C8MA 2SXLA 3M9NB 1BC6A 1N0UA 3ILIA 4CH7A 4HT5A 3C6UA 1HMVB 1NXIA 3CCTA 1JQGA 4ELTA 3B4MA 3KG0A 1U1RA 1T7PA 4O0IA 1RADB 3BR9A 1RAOA 4AQYJ 4PWDB 2VV5A 2O5DA 1OY8A 4ZMMA 4FYYB 3BSAA 1TL7B 2UP1A 4FF1A 1RT3B 3MM8A 3ETMA 1YBAA 4CTAB 3KTQA 5J1NA 4RW9A 1ELOA 1VC6A 1ZZFA 1M5PC 1UFLA 2B6AB 5ITHA 1HNXJ 4OI2A 3TVKA 3FK4A 3PW2A 2CPEA 5DS7A 1WKJA 1OPZA 3OD2A 4WKYA 3IS9A 2GCFA 1GAOA 1KP6A 2ZH9A 4CIOA 4WFAQ 5I42A 4M1KA 1JX4A 4JV5J 2F9JA 1Z4UA 2QL5B 3K2YA 1KHVA 1XN9A 4BWJA 3CD5A 3DHWC 3CXCR 4PQUB 3EMTA 4KC5A 2GV1A 4OJHA 2A1BA 3DOKB 1B7FA 5HROA 4A8SA 1AA1B 1L3VA 4OX8A 4V1Ak 5IQQA 1XMOJ 3DYAA 3E01B 3FBEA 4RWXA 2ZNZA 2GAGC 3FNNA 1SQFA 1RA7A 1QUVA 1M0SA 3H98A 3C3LA 3V4IA 2HRUA 3L3CA 5CD4A 3HVWA 3VAMA 4LSLB 1ZM2A 2XMVA 1D9DA 4E0DA 1NBEB 4DPYA 1BQNA 3BN7A 5IXUA 4K4WA 1KOHA 5B0GA 4QWBA 1XNQJ 2HBYB 4PCQA 4KH0B 2XLJA 1VC0A 4JI3J 2YH1A 3DDIA 2E5LJ 1SKSA 1UEUA 5K8PA 1S77D 2W1BA 5IT9U 1FRLA 4FYWB 3ZNUA 1HFEL 4EI2A 3GV7B 3A8EA 3GTYX 1F5BA 2VQFJ 3BKFA 3G4SS 4UT4A 1FFSB 3Q83A 3U1MA 4EK2A 3ENVA 1EHWA 2VONA 4JI6F 4M5JA 5DZ6A 4NASA 1P9QC 2GJIA 2E66A 4ZLNA 2VFUA 3OR1B 3JQJA 3EYZA 1FO1A 1WEXA 1HNWJ 3VR1A 3KK1A 3NLCA 1HBUA 1GTHA 4LFAJ 3OXGA 4Y34A 2QGFB 1YLXA 4CO5A 2VIHA 3RBZA 2BJ1A 4LR9A 2VOPA 3IR5B 4ERDA 2EBEA 4UQTA 5F9LA 4LF2A 4DR7F 1RDRA 2LEPA 1K1SA 3HHLB 2FVRA 3M8WA 2PE8A 3GZ7A 3KJQB 3H2UB 4DX5A 4ED6A 4C9DA 3TWZA 1CJKB 3NBPA 4OFZA 4ZOSA 1D8ZA 4NRUA 4USIA 2H5EA 2QG9B 4LSZB 3WBZA 1LK7A 2V9WA 1DURA 2FHOB 2F8EX 3RZAA 4ZPAA 4WFBQ 3DRSB 2ASJA 3T1YJ 4G1IA 4EZ6A 2EC0A 4C3KA 3SQOP 2PIIA 2ZD1A 5T7LB 3KJVA 1ZPWX 3EGZA 4ECTA 1VHFA 1CS4A 3PX0A 2GMJA 3KHGA 5B0EA 4DUYJ 2IAJA 2DNOA 2KJVA 4UZBA 5KFWA 1YRXA 2W8KA 2M9KA 4FBUA 4JYAF 3QNWB 1AUSL 5GMKa 2R7WA 2FY8A 2FY1A 3CJKA 4A8FA 4NCGB 4USJC 1X5PA 4HH0A 3TA1A 2F4VJ 4ZLLA 4UY85 1WWHA 2EFGA 4P9SA 1RKIA 2E1RA 4B3OA 4U9RA 1VLOA 3Q8UA 5GADU 3RU0A 3TP2A 2BKNA 5ETSA 4CNYA 2J8AA 2P9CA 4K4ZA 2BDPA 2A3JA 3K59A 2YNFB 2MQPA 4YR2A 4TN2A 2POKA 1SQEA 2BJ8A 4DG1A 3KJFB 1X4FA 1CEZA 3B6BA 4CLZA 2B4UA 1V9OA 1GX5A 2HQ3A 3KKFA 4MAKA 3N5FA 2BUNA 2R2UA 3SSRA 1HI0P 5BYSA 3LF0A 1ACMB 2RNEA 2KHCA 5A2QY 4ZHRA 3LA0A 3CJTA 4MFBA 3HK2A 4B3TF 1N32F 3CPWR 3T6BA 2FQQB 3AQPA 4Q0BB 2HIYA 4F02A 2RDDA 5KFYA 2YVSA 4K5RA 1NLKL 4LF6F 2DHAA 4X4VA 3W5YA 1A7GE 1OY6A 4X4QA 2VA2A 5KG5A 1UPMB 1HR0J 3HDSA 1Y00A 2PFDA 2H3EB 5JMNA 4LMZA 2R7UA 4LBIA 1JMTA 2MDAA 2IVMA 3NXZA 3QO9B 2VBXA 2VC0A 3DI6B 4FYDA 2AJQA 1S72S 2GHVC 1VBZA 3AD9C 3FUYA 3PO5A 1ZM3A 2GS8A 2LKZA 2JJ4D 4NYPA 1GMWA 3PR5B 3BGOP 2HGNA 2CG4A 2BE9B 5FD1A 3ZTRA 3RJMB 1SJ4P 5CAAA 2R8GA 2YTCA 5AXMA 2H5IB 3J81j 3PW7A 1UP1A 5CYQB 3MM9B 4EUVA 2FUG9 2AX1A 2VICA 1CQMA 4DV4J 4NXNF 4WP9A 3WQPA 1D0EA 1LFPA 2KXNB 3P4UB 4Q8FA 3GFHA 4ZA1A 3PYDA 1U0HB 1U8SA 4USKA 4WPAA 2D3UA 2GFFA 5DLFA 3VGTA 3TZZA 1IKXA 1HKAA 1KLMB 4O4GA 3SV4A 3OL7A 3CCRS 3HVTA 3UVJA 4PPZA 2LYVA 2NREA 2HNZB 1IM4A 2MQNA 2NCKL 4N8NA 1BY9A 3P8BB 2DH8A 2RDIA 1H38A 1GH8A 4ATNA 3N0VA 4X4TA 2G1HA 1FI4A 2VJUA 1EQ0A 1AZSB 2CJ9A 3OLAA 4UOCA 4I2PA 3IRXA 4NLYA 4KHMA 2I6WA 2CPYA 5F0UA 2DXEA 2KM8B 1FA0A 4E2FB 4U8VA 1YJVA 4N56A 1H74A 5L1IA 3QRQA 4NLGA 2EEYA 5ETKA 1JKHA 2MZQA 3LAMA 2OPSB 1JLCA 4KFBA 4KV8A 3UQSA 3D54A 2C2MB 3T19A 1SIWB 2RE1A 4F4ZA 4OJ1A 3ISNC 2B9WA 2A18A 4PXBA 2A2DA 1SC1B 4JOUA 4RU9A 2VG5B 3KK3A 2XG8A 1KOOA 4CDIA 1WOOA 3MAQA 4M5NA 3UW1A 5J2NA 4GO5X 1OWXA 2NZCA 2HQGA 4L6V3 5IV3A 3EJMA 4M63A 1I94F 4DL3A 2HWHA 4DPTA 1WHXA 3NY0A 2IVYA 3BBBA 4YB1P 1FEHA 2WBMA 3GIJA 3HM9A 1DQ9A 1FKAF 2GA7A 3W60A 4ILRA 4P52A 4NCBA 3SYZA 2N4CA 2HAIA 5LMUJ 3PVXA 4LF9F 3UCUP 4DN0A 2RU3A 1B0PA 4TU7A 2W2QP 1R3NA 1AYEA 1V5VA 3R3TA 4LRFA 4J9SA 1JLBB 5KFVA 4A8MP 3C19A 4QU7A 4OLOA 1YRTA 3L09A 1IBMF 3MPVA 2W9BB 4I4BA 2I9SA 3VTIA 4I7FA 4ZVRB 3EX7B 3FSYA 1MMNA 1HA1A 1S1TA 1UZHA 5T14A 1NZ8A 3GIKA 3BN4A 3HXMA 2BE2B 4DR4F 1LWEA 2UXBJ 3D1HA 4ZPDA 4FXWA 1VQ6S 1FDDA 4TQRA 4RBVA 2BW7A 1KEKA 1WHWA 1S9GB 4N76A 5LMNJ 2NYIA 3KWMA 4AQYF 3OL6A 2F7VA 3J7ZT 4QCLA 5J1PA 2E29A 2DHSA 3S8SA 1S6OA 1JLEB 1UVMA 2F40A 5CQGA 5D77A 2WB1D 1OYDA 2WVCA 3MTJA 1ZA1B 3THVA 2XI3A 2B51A 2R7OA 4U7UK 4NI2B 2X1GA 3G8QA 3OVBA 4C0BA 4Y2IA 3ILJA 3JSMB 3GFYA 2ZBRA 4FDFA 2FJAB 3D0GE 1QSLA 1AT1B 3WIUA 5D3GA 5E41A 2WONA 3UPFA 1NK6A 3W3SA 2CPXA 3M8PB 1RJJA 3A1YG 4JV5F 2GVZA 5B0FA 5HI7A 2CPZA 1NSQA 1RU1A 3LP0A 3MR2A 3NGRA 1QUPA 2KU7A 2AZ3A 3OL9A 1PAEX 2KXHA 2GGPA 4DV7J 1NZAA 2GNKA 3GJTB 1TKXA 3C15A 1UVKA 4WZQA 2DIVA 1KLNA 1AB8A 2O67A 4QOTA 3PYEA 3BSOA 1UZDA 4KGMA 3BGLA 3C14B 5K8MA 5D4LA 3AJDA 4DL6A 5A8RB 3HHLD 1DRZA 1UJ6A 3VGVA 5ETPA 5ETVA 5GAEU 1VLYA 1RT1B 4OI1A 3VZIA 6AT1B 1YX2A 4LF4J 1MROA 3CC2S 2BM0A 3AQOA 2ABYA 2RQCA 3DRPB 4ZLJA 4DPUA 2VA3A 3PFEA 3DXSX 3M1VA 1XNQF 3BSNA 1B70B 4JI3F 2OPRA 2E5LF 1TV6B 3G6YA 2KT2A 1S12A 4RR5A 2G2OA 4K2XA 5KG1A 3W9HA 3LWLA 4G1QB 1RGVA 3CCJS 4WTOB 2VQFF 3W66A 4P10A 4V19J 5KT5A 5KFJA 3MM5A 4P2FA 1D09B 2DY9A 1CJTA 5DGBA 4KH1B 5DETA 2QSWA 3NP5A 3SCIE 2ROGA 1S1UB 1L5UA 3KUHA 3R27A 3GP9A 3DCAA 4LR7A 3GWCA 1S79A 2BJ9A 1C1BA 3UO0A 5HP1A 1NDLA 1HNWF 5KFCA 2HWTA 2LXUA 4R8UB 5GADI 2B4VA 1FNOA 3PZPA 3IM8A 2N82B 3MR5A 1HBNA 4LFAF 2CPFA 2MKSA 4LQ3A 1WI8A 2HFNA 1IBLJ 3AOCA 4OJ3A 5KFNA 3GCXP 1RAFB 3MAAB 2CRLA 4ECWA 2KZZA 1HPZA 3HO1A 2FJDB 1HI8A 2YPZA 3V81A 3IBFB 3Q22A 2XSJB 3M2VA 2R9LA 1MWZA 2JEIA 4USVA 1HNIB 1REVA 5KT6A 4JI7J 2C1EB 2K1RB 3AFGA 2R2TA 5IQ6A 4DHVA 4P2XA 1TVRB 2CPHA 4YR3A 4M5HA 2BR0A 2M4MA 2HEKA 2P9GA 4X64J 1C0TA 1HBOA 4PG4A 5KFQA 4K4VA 3KDNA 1RAGB 1D3WA 4S0MA 2KVQE 2M88A 1S6QB 2M2BA 4Y2MA 2QE5A 4DUYF 1FJGJ 2VHGA 1FWPA 1AROP 4AXIA 4IG0A 4O3SA 3LPYA 3VV2B 1FRHA 2PN6A 3Q8QB 2ILZA 4DMZA 5FJ4A 1WEYA 2YWFA 3MMAB 1UW9A 3GR0A 1CSJA 3FGVA 1NKCA 3RB6A 4F67A 3L4BC 2XMWA 2KRBA 2MXYA 2GVDA 2B8PA 3H5SA 2XMJA 3PRDA 3C6TB 4I6YA 1OQ3A 2RF2B 4ZVPB 4D3HA 1EP4B 3MR6A 3MPYA 4TY9A 3TZXA 5FLXY 4B3SJ 4KR0B 1HYSB 2MY7A 2IRYA 1NB2A 4YFUA 2RB7A 3KLHB 3CDUA 2ADCA 3L9ZA 2CQCA 1WC0A 1HWLA 3CDWA 5KTQA 4L72B 4ZVQB 3TUZC 3M2RA 3CJ4A 4DL4A 1YQHA 2F65A 2LP4A 2CQHA 3FZ2A 4OYZA 4MK7A 5EDWA 4WFXA 4IFVA 2FVQA 2DD8S 4KQZA 4IH5A 3S01A 1HR0F 1CG2A 2IRXA 5GMEA 3O5TB 3GPAA 3UWTA 1I51B 5I3PA 2M52A 2Z2MA 1K0TA 3QRRA 3K5OA 4A8QA 2HVHA 4OZLA 2VBYA 2PMHA 3IM9A 3DHXA 3QPIA 1I1GA 4M5GA 1K1QA 4DWIA 5L38A 4H4MA 4N7TA 5HSPA 2AJ0A 1N5TA 5U47A 2HYIB 2D3ZA 3MTKA 3GU0A 1KQKA 1OPIA 2N4DA 3QFWA 1WELA 4KO0A 1ZH5A 5E3PA 4KHPJ 4ED2A 2G0IA 3R1HA 5EWFA 4H4OB 2C3OA 4OX7A 2HMIA 3R2DJ 4ECXA 1QSSA 2H54B 2EFNA 1CC7A 3HKWA 4XDDA 5AT1B 2RHSB 4Q44A 2F63A 2MSSA 5F8HA 1RKJA 4ED5A 5K20B 1YG0A 1D9AA 1NDKA 2AEMA 3ET6A 4CP5A 4ZPCA 3RTVA 4GO7X 1RZMA 1YJNS 1FXLA 5KT7A 3IWXA 1FD2A 3N4WA 2MGZA 5LSLA 1KQGB 2Z8QA 3RAMA 3NOCA 4PAAA 1S1VB 4R5PA 4YMEA 2IM3A 1W2IA 2XSFA 4IR1A 2C28A 3SCLE 3KUGA 4DUZF 1T03A 1F60B 4DV3F 3C16B 4FPRA 5M2RA 1KWMA 3ZZRA 4ES1A 2JHEA 2XGQA 2M8DB 2YX1A 4LIRA 1YRUA 4P72A 3AXKA 1NEEA 4DQSA 2H4YB 2AJFE 1JXEA 2IDEA 4P7VA 3EVWA 2AMCB 1PG5B 4FF3A 1TAUA 1FEEA 2VBWA 3IG1B 4KPCA 2XO6A 1RACB 1RT4A 3OTOF 4DS4A 1T05A 2OUGA 5EHHA 1GFWB 2XQCA 1SUQB 4DX8H 4LFBJ 1HMVA 1K73T 2OLWA 3JQMA 2QLWA 3IXQA 4RBTA 2E5IA 5LM7E 2A6MA 1T9WA 4NMLA 3GSDA 3K5LA 1FK9B 3AXMA 2P8IA 2FVPA 3M30B 2AW0A 3RBXA 3KNAA 2FPHX 2HS0A 2XZTB 1QVFR 1TL7A 2AGPA 4DU8A 1FFWB 1QTNB 2I0XA 3VHQA 4QPTA 5H1SV 4CTAA 4IQMA 1Q16B 3DNCA 4YY3J 2CJQA 2B6AA 3QT7A 4DR5F 4OZ3A 1RTIB 3DLBA 3JTOA 4NX9A 1XC9A 3HHKA 5A6PA 1JLQB 1WTFA 4RW6B 4OHVA 4EU0A 4GMKA 5B0DA 2R8KA 3ELHA 3J7A1 3AT1B 3FMBA 4LF5J 4TNOA 2B0GA 4JI1J 2L9WA 2HQCA 1P9YA 1HQUB 4B9LA 2IYGA 3NGDA 4PQUA 5KFUA 2QA2A 2C3YA 1HHSA 5K14B 3QLHB 3DOKA 1YTYA 2UXBF 1FERA 2CA9A 1FRXA 2VJVA 2B7BB 2CQ3A 4CH0S 3V5RA 2L9DA 2F1FA 2ZZNA 1RTDB 2KKHA 2XYHB 2ZH5A 2HKEA 3E01A 4FF4A 4PRFA 5LMNF 5HBMB 3HPOA 1B0VA 2ZNYA 2YPYA 2BOPA 2EG2A 2OH2A 2Y1IA 3OHAA 4LSLA 2EFVA 5SZTA 4DL2A 4LVNP 3D9BA 4HHJA 2RRNA 1RXOB 1TZ0A 1VI7A 2FHMA 1BUXA 1VQ5S 5ETTA 3I0SB 2K06A 1UW4A 1M1KT 2BBEA 4DCOB 2X3DA 4XTTA 3RB0A 2YX7A 2Y0BB 1CJUB 1APSA 2CUYA 5GAHI 4PQAA 2YNIB 2KG0A 2QYCA 4DPXA 4WE1B 4JI8F 3MD1A 2DNHA 2FGOA 3HD2A 2KI2A 5KT2A 3GIMA 4DV7F 2E7XA 2H1YA 1H6KX 2RKIA 3OR1A 2WSFC 3VWSA 2YBVA 1TUVA 2KT5A 3PHEA 2OEMA 1U1NA 4WK1A 4ED1A 3ZFVA 4RWWA 4J9KA 3R97A 3TQ1A 3D3BJ 1NB7A 1IQZA 5A8WB 1NDCA 2HFZA 3R9LA 3HSJA 3HHLA 3CCQS 5LXRA 3G8TA 4DX7A 3HJFA 1X4BA 5IZHA 3LAKA 2XY6A 1CJKA 2XY5A 1REGX 2MZRA 4DV5F 2NQPA 3JQKA 4C48A 4ID8A 4DR1J 4TYBA 2NSBA 3I0RB 1TELA 2WSEC 2KT3A 3V6DB 4J9RA 5G4DA 3DRSA 2VBZA 1S59A 3RG6A 3BKTA 5T7LA 2FIUA 4NLSA 3PJ9A 4Y2CA 1C2PA 2OPQB 3KLVA 3CMQA 4KRWA 5BYQA 1S76D 4ECUA 1UVLA 3Q8YA 2PO4A 1A0OB 1X4GA 1DHMA 1FE4A 3M8YA 3LWMA 2J0SD 4IUFA 4UUXA 2FJXA 4YB6A 3O1LA 4NCGA 4YHHJ 5KFHA 1HBMA 2RUGA 1JIHA 5J2QB 3GYNA 3H59A 3T6JA 3BR8A 4HTJA 2W2OP 3GLJA 5KFFA 2M7SA 3U27A 1K9MT 1WJ9A 1IBLF 4C0HA 4CH1A 1VRTB 3PYFA 2K2PA 4O3RA 4X4PA 2ZKTA 1CJVA 5D15A 3BKUA 1SC3B 4MK9A 1NK8A 4IG3A 4A8XA 5F8MA 1ZBTA 2YNFA 2E9RX 2DNZA 2XNRA 3PRVA 3NGKA 5ETLA 4B3MJ 2I5JB 1T9XA 4JI7F 1U1KA 3KMSA 5DG7A 3BQ2A 2XHCA 2RRBA 2P9EA 2RS8A 4C11B 3MEEA 2B3TB 3MMBB 1S9EB 2OSRA 1IWGA 1Q95G 3NNCA 3T5HA 3KHLA 1UWAA 2CWKA 3IFEA 4Q0BA 5L46A 1WEZA 2AYGA 2CQPA 5C5JA 1FJGF 2VFSA 3UDCA 4Y3CA 3N5BA 3GIRA 4NMXA 4CQ1A 1JB0C 2KDOA 1R0CB 3HLUA 5H9FK 2D1CA 2LECA 2DR9A 1IR2A 4U7CA 5KG6A 1H2VZ 3KG4A 3H40A 3QO9A 3OT9A 3TYTA 2UVVA 1H2UX 3BPDA 3N79A 5B08A 4NA2A 2E9ZA 5LSOA 3MMCB 3MGJA 1F6TA 1RYSA 1MU2B 1ZTWA 2NSCA 4OYXA 2IYIA 2MKKA 3PX6A 3D1QA 1ZZNA 2COLA 1S99A 4USWA 1IM6A 2VG7A 3MFHA 5IM0A 3M32B 4J37A 4B3SF 4YUDA 3LP1B 4BCAA 5CYQA 3MM9A 3MM7B 3B78A 3ISND 3QJLA 1V6HA 3QSYB 2OO4A 3HFVA 5D8HB 3LO3A 3GB0A 2JL9A 1PC5A 3TX8A 1VQSA 3LQVA 2QFIA 4I67A 1RHUB 4HVZA 4RKUC 4OI4A 2V4RA 4ILLA 2IMWP 1KLMA 2DYAA 3W1YC 2R7QA 4EYHB 1N5YB 4YN3B 3DRYA 2BRKA 5BR8J 2ZE2B 3JSRA 2RUSA 1QM9A 2AF6A 2Y8YA 4Y6IA 1T0TV 1U8WA 1HL6A 3EXCX 4DSFA 3A12A 4ZS6A 2HHUA 1ZOTA 4BWMA 4QR2A 1D8YA 3CJ3A 4MTPA 3MR7A 2AEJA 3K8WA 1AZSA 5F9NA 2EFOA 1KHWA 3UN2A 2AIRB 3ZZPA 3US5A 3DLGB 3ISZA 1OSDA 2ERRA 3X1LB 2NUUG 3L7PA 3G8SA 2OPSA 2B9XA 1X4HA 2HBZB 1UFWA 1R8AA 4PXDA 3WDOA 2OKQA 4LF1A 1D9FA 1RT2B 1ZM9A 2DTJA 4F26A 3LPEA 3T1HJ 3J80U 4KHPF 2ROPA 4NLUA 4X66J 3PW5A 4OZNA 1UPPA 2J6TA 4PYAA 1V3SA 2DGVA 4J9LA 3PO4A 3C66A 2VG5A 4J7CA 5THWA 2JLGA 1Q78A 1MSWD 1DBDA 3HMJG 2BJDA 1TAQA 3QT5A 1KQSR 2MZSA 5LL6d 2KHDA 3IO1A 5CYMA 2W2NP 3QSIA 5F8LA 3CULA 1ZAVA 1Q8BA 1A9NB 2QJ3A 2F5GA 4ETZA 2WAQD 3TJ8A 2Q43A 3ITHB 1B4SA 3BM7A 3EGNA 2XMAA 4L73A 1LEOA 4X4OA 2OTLS 2G0CA 4FZVA 1URRA 1XR6A 1T3NA 1E6YB 4BS2A 2E5JA 1BXNA 4OV6A 3HT0A 2XMMA 5BJRA 4ANCA 1JLBA 5KFTA 3W2VB 4JI5J 1LW2B 3TZYA 4Z7YA 5ETNA 4ID5A 1WC5A 4IRCA 5F3TA 1I6JA 2W9BA 4QR0A 1RAHB 2YWGA 4ZJOA 5HVFA 2HFVA 4O4RA 2R2RA 3DOMA 2W7PA 4DX6A 4U67Q 5HO4A 3QIDA 4OX6A 3CB4A 2QSFA 2BE2A 3CSKA 3MPUB 1LWFB 4WYWA 1WOPA 2AZ1A 2X1AA 1X0FA 2CZ4A 2E7VA 4DV6J 3TZWA 5A76A 1S9GA 3MDFA 3KMQA 4B9TA 2F8MA 3AOBA 1J2VA 3BO3A 4ZVTB 3RR7A 1C0UA 1JLEA 2XY7A 3ZTPA 2ZHBA 1U6BA 2QMWA 2VC1A 1H0HB 2W7OA 1EJ7L 3B8HA 4CLWA 2BEFA 3VAIA 3W2WB 3RUBL 4YY3F 3I5CA 4G3IA 3BF4A 3NNAA 3A4TA 1Q1KA 4NI2A 4XIUA 5AXLA 5CCLA 3QATA 3JSMA 2CQ4A 1SKWA 4IYQA 5BXIA 2ZH1A 1ZA2B 4J91A 9RUBA 2P2CB 1SL1A 3MM6B 1EQMA 3ADAC 4ECVA 4NZ0A 3ETOA 3M8PA 4PR6A 2DPIA 3TA0A 1HQEB 2UV8A 2MKJA 1FDNA 4JI1F 3NAIA 2XLIA 1HHQA 4RU2A 1SC4B 1HD0A 2V8PA 3BREA 1WOSA 4F0MA 1HWIA 2ZUGA 4GKKF 1FDBA 2R7XA 3TR5A 4FKXA 4URQU 1G7CB 1PJ7A 3BZQA 2DGTA 4IOBA 1CBKA 1MG7A 2MTLA 1FKOB 3PNIA 4OMFG 1B64A 4PABA 4MYUA 3DDKA 2CJXB 4ILMA 3QIPB 3DLLQ 2F8HA 2XTJP 2CJKA 3A3NB 1RT1A 2RQMA 1I5OB 3CJSA 4KIAA 1IKWB 3Q2SC 2IJRA 5LXYA 3DRPA 4K4YA 4IDKA 1F9FA 4KPYA 4F4YA 2HQDA 2DH7A 5KAKA 1F5AA 1U1LA 2Z4PA 4G1QA 2FZGB 4PPDA 5KT4A 1SJ1A 1N32J 2XNQA 3MOZA 3PR4A 3W9JA 4ZP9A 2KRRA 4O4GB 1S1UA 2MKHA 3FBBA 1EX8A 2KL8A 3G6ES 4TVAB 3H8YA 1TK0A 1QE1B 4ED3A 2DR6A 1Q79A 4R8UA 2W8LA 5E5NA 5KG3A 2H5JB 3H25A 5HN0A 4QWEA 1Q5VA 2ZHOA 2QLJB 4NEZA 1DZ5A 3MAAA 2BZ2A 2KFYA 2VG6A 4CYUB 4JI0J 1FJCA 1B99A 1GQEA 4FN5A 2V4JB 3EZUA 2VODA 4NCAA 3NL0A 4RW9B 2XSJA 3GCWP 1R0AB 2K7KA 3OSPA 3V2UC 1N0VC 1RLCL 2K1RA 4DR1F 5HLFB 4I64A 3MEDB 4EO8A 4DL0C 5ETRA 1TVRA 4JV2A 1XNRJ 4NXNJ 1XR7A 2I8EA 4CLTA 4LBPA 1HIYA 1G2EA 1O0PA 1S6QA 1Q53A 4Q45A 2R42A 4ZP7A 2IJFA 3HF5A 1O6XA 2V2QA 4ANDA 2DNRA 3D4JA 2QL7B 3W63A 1NJZA 1F9HA 1XQIA 3UD5A 4ZJQA 2HVEA 3UD3P 2ILYA 2DNMA 2ASDA 3DU6A 4A48A 4RNNA 3IN5A 3MMAA 4MKBA 1X31C 2ZWPA 2ACYA 5IT4A 4IRDA 3M6UA 4QJVA 3S1TA 3C6TA 1BQNB 2RF2A 1TKTB 2HHTA 1EP4A 4YDXA 3M8RA 3PM9A 1K0VA 1XWLA 4J9QA 2WCXA 2OHDA 2RQ4A 2XYGB 4OZ0A 5ETQA 2VDHA 3DDNA 4P75A 4USTA 3Q8SB 4B3MF 4Q5VA 2HK3A 3KLHA 3NS6A 2BACA 3C2PA 1RT5B 1QY7A 1X4DA 1JXLA 1S0VA 1JLAB 1AXQA 5L1LA 2GMLA 1GXTA 4F3QA 4WXWA 2GZOA 1SQGA 4X4SA 3TANA 4IH6A 3LGMA 4J9UE 5HATA 3CCLS 2Z0GA 4OZJA 1WG5A 1FRMA 4GC6A 3MOJB 4AL6A 3W8PA 4QIFA 4M5DB 1U47A 2AX0A 3L95X 1U4BA 4WIQA 4TQSA 3HSDA 1RWUA 4K8RA 2QA4G 3FCHA 3G82A 4X2BA 4EMDA 3OTBA 8AT1B 2CPJA 5IFMA 4PEOA 1RT7B 1ICEB 3WX8A 4PG7A 4YB7A 2DISA 2DR8A 3BYPA 4PWUA 1VIXA 3PW4A 1RISA 5FDLA 1X8DA 2E44A 1H73A 1RAIB 4CLYA 1KN6A 2F3JA 3MZIA 1U24A 4ECSA 1F9EB 3GFXA 4CZCA 3QGIA 1VBKA 2JEFA 4H4OA 2ZD1B 4KGZB 1RAAB 1PBUA 3KJVB 3KG1A 4K4XA 1IBMJ 4RZRA 1VQ7S 2IAJB 2DNGA 4A8WA 2XWYA 4HKQA 2FB0A 4RW4B 2JEJA 4GVLA 4FVMA 3TNVA 4DFJA 2OPPB 1RBOB 1QVGR 4O23A 1DFDA 2CJAA 5BR8F 2PEHA 4IR9A 4IH7A 4PXCA 3SQGB 1LW0B 3UD4P 2O3DA 2RS2A 1N33J 3HX9A 5KFDA 2AEFA 3FEZA 3CVKA 3MWBA 3F0NA 3R7NB 2UU9J 1TMMA 4OYMA 1Y9OA 1S1VA 1U1PA 4IO9Q 3JB9k 2YY3A 3IMQJ 2UUAJ 1NJWA 3OPKA 3J7YI 4CRJA 4PG5A 3MXHP 2IA6A 4ZITA 3C16A 4I68A 1P1LA 4F36A 3T1HF 2ZDPA 4R0JA 3NGSA 1FRIA 2Z58B 4X66F 1UFKA 5I3UB 2DK2A 3SDEB 2CNOB 3BDPA 1P1TA 1GEHA 5KFAA 3W5XA 2AD9A 2MMYA 3IG1A 1G4CA 2V8GA 3H0PA 5DQGA 4NLRA 1SUQA 3CD6S 1D1UA 2FLOA 5C42B 2VZ9A 2VPYB 2YWWA 1SPBP 1PSDA 2K3IA 1FK9A 2H51B 4OI0A 2HZAA 1RUSA 3M30A 4MIBA 4CO4A 3VQTA 3PEJA 1LWCB 3HHEA 1U26A 2XS5A 1OSCA 3CCZA 1L3KA 1OYEA 1WDTA 2LU2A 2V9KA 3JTPA 3CUNA 3CJQA 5A2QU 2ZVIA 3L7OA 2MZJA 4X4NA 1PO6A 5CH7B 1JJCB 4B02A 4J9OA 3LUYA 4OZ1A 2LFVA 5KFLA 3D1OA 3MCNA 5J1EB 1JLQA 4DR3J 4JI5F 3TJ9A 3OL8A 2PMWA 2Z56B 4NXMJ 5EGYA 1HQUA 1KDNA 3M8SA 1IKXB 3IRWP 3AJ1A 2NZ4A 2G13A 2RQKA 2E1CA 3QLHA 4QWDA 3OSNA 3F73A 3HVTB 5KFOA 2ZEJA 2JX2A 1YZ7A 4USUA 4OZ2A 2V2VA 1NHUA 5D78A 1RTDA 3H20A 2N3LA 4I56A 4DV6F 2RRAA 5HBMA 5DDPC 5C25B 4TYAA 1BQMB 3D6FB 1HWJA 2AYMA 2RMLA 3CF5Q 2QL9B 3IRXB 2R8JA 3ZXWA 3K0JA 2XWXA 1FF2A 4DDFA 3LH2S 1KD1T 4AL5A 5H9FJ 3KOAA 3HULA 5IOLA 1Q81T 4ZP8A 1WD6A 2CKWA 1NHKL 2A6OA 2QIFA 1FT8A 1JKHB 2MZ1A 4FS1A 1T9YA 3EXYA 4ICLA 4DQRA 2DRAA 1TL3A 3ZZ0A 4KFBB 1VQ9S 3ZZZA 1X60A 2OFHX 3I0SA 1QSYA 4JV1A 1KQFB 2DT9A 3BYRA 1RWOB 3CC7S 1KVKA 5E7OB 1FJEB 1CJUA 2D3OR 5JJBA 4X4UA 5G0RA 3KK3B 1PAUB 1X5TA 1U7LA 1N6QB 4WE1A 2DITA 1S1XA 5GAGI 2DXFA 1MNEA 1RSCA 2OFGX 5HMWA 3AY0A 3TUIC 4CM2A 2VASA 3TUPA 3PIPQ 3TJAA 1QAJA 1WC6A 5IS2A 2GMHA 2MJNA 1GNKA 1JJ4A 2O66A 2YWEA 5A8WA 3TW0A 1SCJB 2CFXA 1PBAA 3JS9A 1KC8T 3Q8RB 1C1CB 2MKIA 4J5OA 2LVWA 2B5JB 4MH8A 2GAHC 2VFTA 4Y65A 1KNZA 4P74A 5KG7A 3FKBA 1WKLA 3PY8A 1ZPVA 2NXUA 4A8KA 3CD7A 2HSEB 3IGNA 3TO8A 3MEGB 3I0RA 3S6EA 1RTZA 3E3XA 2J7UA 3V6DA 3UI3A 5E3QA 3T5JA 4KKOB 1RK8A 4F8RA 2OPQA 4URSA 5E33A 2V8HA 4W4MA 3TAPA 3Q86A 2LDIA 4OHYA 1PCAA 3JSBA 4DF4A 4GVBB 5D4PA 5KOWA 1DTQB 4KHRA 2WOMB 2JVOA 1JLFA 2FYXA 3O8WA 5DLGA 1F2GA 4X62J 3VAFA 3DOLB 3FMWA 4WCEQ 2C2DA 4ZVUB 2DEIA 4TY8B 2HFSA 4OV1A 1XIQA 4PUOB 2DGOA 2AYBA 4WBFA 3SIPB 4B3RJ 5C24B 3D28A 2VB6A 4KAIA 4JI0F 4Y28C 2H48B 1IQTA 3BS9A 4ELUA 4AL7A 2OJ3A 3P45B 8ATCB 3MR3A 2I5JA 4P7TA 1RE1B 5IC6B 4C11A 4G1PA 3MMBA 4L76A 1DJ0A 1S9EA 4JI4J 2GVZB 3K5NA 4B9MA 3PW0A 4ZLPA 1XNRF 2UV8G 1NDPA 2KTQA 3LP0B 3OVAA 1XK8A 1P6TA 2GGPB 4URGA 1GTEA 4LJMA 4DQPA 1GK8A 4NLQA 3I5AA 2PA3A 3CDAA 2GIFA 5EUHA 2R7RA 2IY5B 1RWNB 1SJ3P 4X65J 4Y00A 1MW7A 2AHOB 3OFFA 5ADZA 3MMCA 1NNDA 2Z2LA 2FVSA 1DQ8A 5CABA 1MU2A 1NH7A 4H54A 4IFYB 2VQEJ 2MEWA 2CJBA 2EC2A 4WXOA 1YJTA 1TUGB 5M2PA 2VPWB 2HW3A 3I5BA 3M1VB 3M32A 4AUKA 1VJWA 4DUZJ 1RHJB 2Q3PA 1VCTA 5A0YA 2IM1A 3LP1A 4DV3J 3MM7A 6FDRA 2MSTA 1FVSA 2QTWA 3UE2A 1FHTA 5B0BA 2BABA 2LXIA 4ZIWA 2CXEA 4RLEA 2YKNB 2RD5C 5KG4A 2XCPA 2LQ5A 4LRAA 2A10A 1PILA 2ZM6F 2X51A 1RHKB 1B0TA 3HFKA 3JAMY 2OELA 2G2ZA 2XZDB 3MECB 2R7SA 1N5YA 1R8CA 1TK5A 4NL5A 3OTOJ 3FEXB 2ZE2A 9ATCB 2OD6A 4O3OA 1LFWA 2DNQA 4KGKA 2CZ9A 1E6VB 4WKRA 4HT7A 4YS2A 1HHTP 3HT3A 3EM1A 2WVEA 2WW8A 1AFIA 3RW6A 3CMES 3DGPA 4YB5A 4RUHA 4H4KA 3ONQA 4LRBA 4F4KA 3DLGA 1JJ2R 4UY8T 3K57A 4C3LA 2DO4A 4YR0A 2RAQA 3F56A 4DV2F 1NHVA 3WHIA 3NGTA 4W90B 5F0WA 1BMQB 5K8OA 1RWVB 4DR5J 1RT2A 1YK9A 2IMOA 1VQ8S 2DGQA 4HLBA 2KB2A 3TARA 4EEYA 4NA3A 3HFZB 3G87A 1C0TB 2RILA 3O3LA 1LKZA 2E5GA 4WFYA 3D0HE 3THPA 1RU2A 1WC1A 4IG0B 2MJUA 2QLBB 2HRTA 1ZS6A 2KG1A 2YQ0A 3I96A 2YQ3A 2ZHAA 2MQQA 4U96A 4ZCKA 1RAJA 2DNNA 2B8QA 4TU9A 1N33F 2AYEA 3ITHA 4QQBA 3KLEB 4JI2F 1BQXA 3V6JA 3VAHA 4O3QA 1GMWD 3GV5B 2ZVSA 1J27A 1IBKJ 3TAMB 2UU9F 4F0HA 3B82A 2J0XA 4RBUA 2IM2A 1RWXB 2LDYA 2L48A 3SMZA 2OTJS 3FBFA 1EKSA 4DFPA 2GVDB 4RO0A 3ILLA 2LMIA 5D0RA 2UUAF 2C22A 8RUCA 2XULA 2XLKA 1E6YA 2EW9A 4QZVB 1KSPA 1S48A 2B43A 3DU5A 4HHUA 4C7QA 4ZCIA 5JVGQ 2X1FA 2XC9A 3T5LA 1X7VA 3PJXA 2Q6CA 1IVZA 3GMGA 1BD6A 1YSJA 3TVYA 4MIWA 3QFHA 3Q8VA 2UXDJ 3U02A 2DNPA 2CNNB 2LQ8A 4BHQA 2CZVC 1SBRA 4NEYA 3IR7B 2W9CB 3M8ZA 4ZP6A 3OUYB 3OVSA 2J9EA 4MKVA 4JI8J 3DRRB 1R0BG 1LWFA 2NS1B 2N7YA 1TQLA 1TL4A 2MY8A 4WYLA 2YKPA 4Z7CA 3M6XA 4QPXA 1BWEA 4OHXA 1SH0A 2DHHA 2HVIA 2ATLA 3QT8A 1J5OA 3KHRA 4NLTA 2KVIA 1X4AA 2GQCA 2NXNA 3W5ZA 3R7BB 4JP8A 2MQMA 4H4MB 2M8HA 2BKOA 2HNDB 1S6PB 4O0NA 5D4NA 3W2WA 1F0XA 3H5UA 4RL1A 4B9UA 4DFKA 2DIUA 2QZ8A 3NMAA 2HHSA 3NCQA 4DV5J 3FCWA 4KO0B 3K17A 2RVJA 3MM6A 4ZKAA 1YBTA 3RRKA 4EYIB 4DR3F 3FQKA 2R2SA 2FJVA 1U1QA 5F8NA 1X5SA 3D7SB 1WSVA 1HQEA 1PYTA 2V67A 4NXMF 2W4CA 2QV6A 2XMKA 2VFRA 1RTHA 5IWAF 3PFOA 4BC7A 4IQXA 2B4PA 3EPGA 2FHJD 4F25A 2IBKA 3PG9A 2V68A 2BOAA 3QGPA 2YNHB 3FQLA 4AT1B 2W2PP 2BMBA 3ZTOA 4K4UA 1HNVA 3OFHA 2AGOA 1UWBB 2CPIA 3GIIA 1RP5A 3QIPA 3G2XA 2UVRA 3GSIA 2CQBA 5LSRA 3CCMS 2XGPA 1SKRA 2JC0A 2DBBA 4ECQA 5FIIA 1FVQA 2C2KB 1IKWA 4OHWA 5KFXA 4P6QA 3PIOQ 5DRKA 1R8HA 3N9UC 1IR1A 4LRDA 1IKYB 4LBHA 2J7WA 2ZBCA 3DMJB 1R6VA 5B0AA 2BANB 1NAQA 1TTHB 5K8NA 2KO1A 1VS3A 2Q1LA 2CYYA 2VFVA 1KVIA 3M2UB 1RT4B 1L3UA 1T05B 2HS3A 2HURA 5D6GA 3R5JB 2X3GA 3MPDA 3NS5A 3CO0P 5C2CA 4YOEA 4C2MA 2K8GA 1JXVA 3EWGA 4PKDB 1QE1A 5K5MA 2J9DE 1K8AT 2BKPA 3BH7B 2Z2YB 3W8GA 2FDNA 2G4BA 2I1RA 3Q0AA 4OHZA 3UR0A 4Q7AA 5DG9A 3KLGA 3BQ1A 2DR5A 2HLTA 4CYUA 2XO7A 5D0EA 5KFKA 5L1JA 2QC3A 2LXFA 3A8JA 5HAOA 2V4JA 2V69A 3N01A 1X9MA 4CT9A 2MQLA 2NXCA 1KBRA 3GJRB 2HVZA 1R0AA 2RJZA 2RT3A 3R5DA 5HLFA 4M94A 3RYLA 3POTB 3MEDA 2OEKA 3OFGA 4HDGA 3ZNJ1 4EZ9A 3EPIA 2HGLA 1UTAA 5DG8A 1SI9A 3PTWA 2J6UA 3GV8B 2U2FA 2ZBQA 2JVRA 3BDEA 5KFBA 3I31A 1HW8A 1UJ5A 2EFQA 4C3MA 1N4LA 4F50A 2CQDA 3CE8A 4TXSA 1M1HA 2WB4A 5DZ7A 2RDJA 4E8UA 4DCPB 4L75A 4Q2LA 2OP5A 4U95A 3BV8A 1HD1A 2EPIA 3CDEA 2C3MA 4WFNQ 1F1BB 4X62F 3V6KA 3ZZYA 4ZPBA 2CIMA 3AB4B 2DRDA 3JYTB 1VDHA 2QRRA 2HHQA 2OMLA 2GIQA 3DN9A 4DV1J 7FDRA 3G71S 3SFGA 4MIAA 1S6UA 4RUAA 2DB1A 4B3RF 2FC8A 3CCVS 3E8OA 1Q8IA 5L39A 4LIWA 1YDLA 1CPZA 2ZJPQ 1J5EJ 4KB7A 4C8ZA 2J0QD 2E1AA 4J9NA 1TKTA 3B4DA 1KRPA 3BH6B 4USHA 3TA2A 2ZWOA 2V34A 4AE5A 4WP3A 4RNMA 3H90A 1DY3A 5KG0A 1N5QA 2QYGA 2F9DA 2Q6BA 4ER8A 2N7CA 5KFZA 4ECRA 2RH3A 1RT5A 4J90A 3M6WA 2QMUB 4NE9C 1TKZA 4JI4F 2Q66A 2PSZA 1JLAA 4WFZA 3NMRA 3CJ5A 1VR6A 2HAFA 3PKMA 2ZH2A 3LOUA 2PGCA 4YP3A 4UW2A 2CVIA 2R8IA 2FJBB 1OMSA 2Y3YA 3KLFB 1RHRB 1BLUA 3CWJA 2RKIB 4DR6F 3MD3A 4D3GA 2WRMA 1JNZB 1TFYA 1DAXA 3KLIB 1UETA 2NXEA 2EKNA 4M5DA 1IN0A 4DSLA 4ED7A 3LW5C 2QX0A 3BGRB 5HANA 4X65F 1DTTB 3Q89A 1WF1A 1RT7A 2W7AA 1SC6A 4IKAA 3LALA 4AFFA 3KYLA 3KK2A 1FWLA 1H98A 1U6ZA 3GJSB 4UQGA 2LU1A 1F3VA 4UOHA 2VQEF 3UN3A 2BQ3A 2FD2A 2BA9A 3IAS9 1Y3KA 4KBIA 2GHPA 2B4OA 4OYPA 4CLKA 2FHKA 3NCPA 2DNLA 1YJRA 1F3FA 3TI0A 3W7BA 4N77A 1YITS 3D6MB 2ASYA 2Z2ZA 2W4DA 2VH7A 5EX3A 3CDBA 4RW4A 1N52B 4RUBA 1UL3A 1U2RA 5AXNA 5HK4A 2AJ4A 3T1AA 2OPPA 3FDSA 1SH3A 2MB0B 2BJ7A 4G6VB 5HVGA 2ALYB 3FCVA 1HW9A 2R4FA 3VCDA 1WORA 3SQGA 1LW0A 3QRPA 1MMDA 1HBMB 2HHVA 4I69A 1BE4A 4GRSA 2GJFA 1X4EA 2R7TA 2PDAA 4DU7A 3OXFA 4PWDA 5CD4H 1CJVB 2FGCA 4FPIA 3QAEA 1BHNA 4IG3B 3F44A 4PZVA 1RHMB 3V4MA 4N5SA 3B54A 4ANEA 4KJIA 1RT3A 3RBEA 4O44B 2QA1A 3RRHA 3CW2C 4NLWA 2WW4A 1FKPB 1OIAA 3W65A 3ZTSA 4P2SA 5JUMA 1TUWA 1SJQA 3OFEA 3MMJA 2IJNA 3MEEB 4FNIA 5HQMA 3K8VA 3GYGA 3EZOA 4QW9A 5I4MA 1VGYA 5I3UA 2ACMA 5EX0A 3SDEA 3DLEB 1V3ZA 3NNHA 3OTDA 3J81U 1XBWA 2IC3B 1JNRB 2M70A 3HI9A 2FJWA 1S57A 3VF0B 3TVZA 1QJHA 3MF5A 2D41A 3QGHA 4GKKJ 5IT9Y 4NA1A 2UVWA 5C42A 3J7Z5 2VF3A 2NR0A 2HQFA 2XI2A 1GX6A 1PYOB 4EO6A 4WTYA 2UUBJ 1IBKF 1LWCA 2J5AA 5KOXA 5GAEI 2L9NA 2I38A 2IBOA 3RAQA 4PWWA 2C2EA 1X4CA 2UUCJ 1Q7LB 5CZXA 2VG7B 2B7CB 5IM0B 3AB2B 5CHCB 1N48A 2CDRB 5AE2A 4I6AA 5J1EA 5DO2A 3GYXB 1VC5A 4P71A 1B3TA 2A0FB 1U45A 3G6VA 1UA0A 2UXDF 4ED8A 2DEJA 5DQIA 1DLOB 3KJNB 3CEDA 4DV0F 3CD0A 4QIWD 1VHIA 4I2QB 4CM0A 1S4FA 1M5KC 3LP2B 4PG6A 4DL7A 4FNHA 3EZ5A 2GQQA 4ZK7M 3HSZA 1VBXA 4WP8A 3OJSA 3LANA 3UCGA 4OL8A 3PXGa 1SH2A 4ECZA 4OIXA 4V19X 5C25A 4OI3A 4NPOA 1OJ4A 4KYZA 3RBDA 1BQMA 2KZMA 4FYXB 1O8BA 2A2CA 3A8IA 4HH1A 4NZ6A 4RNFA 2VUGA 3I82A 1VQOS 4DLGA 3PEHA 5HL7Q 4DJBA 4C4WA 2VPZB 1FE0A 2ATCB 4LVOP 2W2MP 4N8OA 1WDDA 1S1WB 3KNGA 2QO3A 1ZAXA 2UUTA 4ZCLA 3MHYA 1YZ6A 2AWZA 5AE1A 3BGUA 1RABB 1WG4A 4LF8F 1IR0A 2BJEA 1YBUA 2IDLA 3RAXA 2DXDA 4ES3A 2AJ2A 5J2MB 4ZVEA 2AQ4A 3QWUA 3DFEA 4EFAC 2ZH7A 1VRUB 1WI6A 3P49B 3CC4S 1UMJA 1N6QA 2M0GB 4IRKA 3AOAA 1LQ9A 1N34J 1XERA 1RT6B 4PYDA 3G96A 3AHPA 3VGUA 4QU6A 1YVFA 3TRGA 2ZDOA 2FLLA 1V3RA 4KTQA 1EZZB 1R8PA 5CYMB 2DCUB 1S7IA 2OGUA 4Y2AA 3CCWA 3D2WA 1TL1B 1N5VA 2FHJA 3PACA 4ZN3A 2HNYB 4TLQA 2E1MC 2F4FA 2CPDA 4K2JA 1XTZA 4ZIVA 4K0KJ 1C1CA 4B08A 2FTRA 4JUZA 2WTFA 3GG0A 1T94A 2JH3A 2YWHA 2B5JA 2RIJA 4F3MA 3UN5A 1M5OC 5EWGA 3CCES 1SVDA 3NAHA 2XEXA 1SJRA 4DR2F 2G2YA 3MPWA 3I55S 4XDCA 4DZ6A 4C98A 1OO0B 3MEGA 4P2MA 4NOHA 4C8YA 4CO2A 3U7JA 4CLSA 2HG4A 1R43A 4ID5B 2RHQB 2DY1A 3BGFA 4I0WA 1UA1A 4KKOA 1JLGB 3G9CA 2DGXA 4PXEA 2PA8D 2YKMB 2HFOA 2V8DA 4LUBA 3DOMB 1RWPB 5CZVA 3W64A 2JNJA 3VALA 4GVBA 1DTQA 1GXLA 1U2FA 3DLKB 4QBUA 2WOMA 4L3NA 1NCLA 1XMQJ 2PI4A 4F3OA 2DHGA 3DOLA 2MZTA 3H4BA 5HJYA 1MN7A 4ENOA 4TY8A 1C0UB 4PUOA 1Y4ZB 3VQSA 3EGWB 5C24A 5HQ8A 3DI6A 4W92B 5IT0A 1SV5B 1S7HA 2E7WA 3IAM9 1EB0A 2VU5A 4B9VA 2XMUA 4F4XA 2MPUA 1NK0A 4IOCQ 4U6PA 2Y1JA 4RW7B 2LQBA 1HNXF 3Q2TC 3K58A 3KXDA 2WK4A 2KN4A 1I3OB 2CVEA 4HHHA 2QEXS 3DM2B 5M2UA 1G6BA 4OYIA 2UZAA 4FS2A 4LSNB 4MYTA 5KFPA 1TU0B 4DL5A 5DJBA 1WC3A 3CCSS 4DOZA 3THTA 4CO0A 1N54B 5D0HA 3HVAA 1ITPA 3UDLA 3MURP 3M8QB 3FFIB 4U7UD 1U0HA 1Y11A 1SL0A 3QQCD 1PC4A 3KUEA 3FBCA 2J0WA 1MWYA 4HYKA 3BBCA 3EUNA 4CO3A 3DRXA 4LR8A 4X4RA 3H2LA 4QYRA 4LT6A 1XMOF 2HNZA 3MUTP 2Q79A 1QD1A 1NMEB 2GW8A 4W98A 4TKTA 2W9AA 2JLEA 4DV1F 2D3O1 3JXOA 4OLPA 4WJBA 5H9EJ 3AD7C 4PG8A 1MLAA 2CQ1A 2JOQA 1LV5A 4L74A 2C3UA 4IFYA 3NCRA 1YWXA 2L41A 1J5EF 3PJWA 1ROFA 2HGMA 1FCAA 1QTMA 3HP6A 2HZCA 4IDKB 4RW8B 2BE7D 5K9FA 1Y10A 3ENQA 2W01A 1Q82T 5DDOC 2O01C 1CULB 3HHNB 1CQNA 1M1GA 3MFIA 2YKNA 1UKUA 1C4CA 2B9EA 5GAHU 3QGGA 4RPFA 4JBCA 3PKYA 1YIJS 2YX4A 2MHEA 4BLGA 3I9V9 1Y5NB 4E98A 3OR2B 3MECA 1QDUB 1VQPS 4F2SA 4KGXB 2BXJA 2MQ8A 4J9PA 2DO0A 1E6VA 2WZ1A 1UVJA 3GR1A 1VYAA 1K47A 1NU4A 2VG6B 2QLXA 3R8YA 3SBMA 2NPFA 3P6YC 3I32A 1RI7A 2Y0SD 1RTJB 4K59A 4GKJJ 3W9IA 2CQIA 4NLDA 3MAHA 2J9CA 2NXJA 4F4AA 2XYPB 5A8KB 5DQHA 1IXKA 3BO4A 3M4XA 1F2HA 1H72C 4QYZJ 1LXJA 1R89A 2L3MA 1WTBA 2GHWA 2H9ZA 2APOA 4OQJA 3T1YF 2KH9A 1GMUA 5JVHQ 2VKRA 3M6VA 1LK5A 2PC6A 3QZ7A 3K7RA 2ADBA 5I3QA 2EFPA 4OJGA 2G9OA 1FTRA 3I4PA 4A8YA 1NK7A 5B7WA 3AODA 3H4DA 3UDEA 3UFCX 3E51A 1HLWA 4CT8A 4F0KA 2F4VF 3EE3A 3KLEA 4HTIA 2LCWA 4K7QA 3TUJC 2HRYA 3OLBA 4DN9A 2FLPA 3TAMA 2WBRA 3T9NA 4CLUA 3IWNC 3GE9A 2G1DA 1R31A 1X9SA 1PJ5A 3UCZP 2AP6A 4B9SA 2V2ZA 3R2CJ 3O6QA 4F4WA 1X5OA 1S0NA 2XHWA 4ED4A 3IA0A 5F3ZA 2CADA 1NJYA 2GX8A 5KFMA 4ZPWR 1S9FA 2HS4A 3ULHA 3IWLA 2OAUA 5KFRA 3X3UA 2JEGA 3OTEA 1QAXA 1HWUA 3EGVA 2XM3A 1VJQA 2W9CA 3OUYA 3AAWB 2Z30B 4LF7J 3DRRA 2AV5A 3D6HB 1VMBA 3PRBA 4DS5A 5B09A 1IKVB 2J6SA 4A8OA 1S4EA 4RNOA 4DBQA 1U49A 2R3VA 4HACB 1N8RT 2B9YA 2Y8WA 2MQOA 4WK3A 1FWKA 3V6HA 2WHOA 3DLJA 3FSXA 2J9DA 2YNGB 3PYGA 3MUMP 4KY3A 3G82B 1CLFA 4MKAA 1NPKA 3C14A 2UUBF 2KYZA 2W25A 5A8RA 4C8KA 3T5KA 1XMBA 2ZH6A 2DGWA 2HNDA 1S6PA 4NLPA 3RGIA 2V4QA 4NZ7A 2UUCF 5FDLB 1GMVA 2ZZTA 3P5TL 1U1MA 3H2VE 2JWNA 4HDHA 2W4PA 2YWKA 2ZITA 1IBCB 3QWPA 1EETB 3D67A 3SCJE 1WNEA 3Q8PB 4A4JA 4CNZA 4DV4F 4QIVA 2BV3A 1TV6A 2EG1A 4P73A 3SFUA 2ZJQQ 5J2PB 2EWHA 4KGVB 2V8VA 5BYRA 1FXDA 3PHTA 4DFMA 3ILOA 3ICLA 5IC4B 4CLFA 3AH6A 2ZBPA 5F8IA 3VZHA 3R6GB 2P5VA 1UEKA 1IUJA 5EWEA 1VIOA 5ETOA 2JZ5A 3H42A 2EVZA 4OZ5A 2YNHA 3C6UB 5C7PA 3AA9A 3UNYA 2X1BA 2QA4S 4H4KC 2EK1A 4WWSA 2HLUA 3HVRA 3N6MA 1UWBA 2DNYA 4RJVA 1LXNA 1U02A 2AT1B 5CYJA 2OMOA 2ZC3A 4ZVGA 1RCXB 5CA5A 4ZN1A 3JSYA 3T3FA 1NK9A 2XB2D 3FRYA 3MM8B 3QZ8A 5D0GA 4NYZA 2V63A 2I2YA 1M5HA 1IKYA 2IM0A 3KHHA 1TMJA 1HNIA 3DMJA 2KJWA 4N47A 3IS9B 2YXLA 3GQCA 2BANA 1CC8A 3WC2A 5I42B 4ZPTR 3U1LA 1SKUB 1N34F 1AFJA 3DXBA 3H5YA 4M5IA 3M2UA 4LREA 4K4SA 1WC4A 1R27B 4KE5A 1U6FA 3NRBA 1U48A 2BQRA 3S7RA 3VAGA 3IBWA 5E3RA 2IRUA 2HZVA 2L08A 2P6TA 5HROB 1N56A 4M8LA 1HI1A 3I6PA 2LLZA 3DYAB 2HK2A 4M5KA 3WX4A 1GT8A 3HJVA 4OYOA 4K0KF 3MI7X 4ITSA 3HSGA 1NUEA 5LMUF 3V4IB 3OJUA 1Z2ZA 2CQGA 4LQ9A 1WKKA 1M5SA 1KR4A 4QW8A 3UDVA 3U1NA 3FJ2A 1PYSB 3POTA 4WIIA 1O5JA 2CAJA 2J8SA 2Z57B 5L9XA 3DLHA 4FXVA 1HYSA 3TAQA 1A6LA 1VISA 1Z2LA 4M5LA 1FD8A 5DDQC 1ZM4A 1ZTTA 2DKOB 4DSKA 2ZM6J 3NOGA 2MHNA 1FRKA 3QBCA 1Y5LB 1YJUA 2QLFB 3BB5A 1XMQF 4OYWA 3D5MA 3O44A 3P3DA 3JYTA 1FDAA 2DHXA 4N41A 3KK1B 2JC1A 2DGSA 1SXLA 1HBUB 1HARA 1S0OA 2UXCJ 3N28A 2CG8A 3GILA 3DKDA 4AYBD 1Y7PA 1P8GA 1YHQS 2PT0A 1PKUA 4ICLB 3TOQA 1TL3B 3L7UA 2IVFB 2NPIA 2AJ1A 2HVDA 2CJYB 4ZVSB 3NBPB 4DV2J 3NEKA 5MLCV 4WZMA 1F5CA 3CIMA 3D0IE 5F8GA 2HHXA 3T9ZA 3WZ0A 2ZZMA 2ZOFA 4CCHA 3MUVP 3OXLA 5G0RB 5AJ3J 4Q43A 3CTRA 2HQIA 3QAUA 4CI0B 4M95A 1CS4B 1S1XB 4IO1A 4F2RA 3KLFA 2WVDA 1G3OA 4CWBA 1H2TZ 4Q2MA 3KLIA 1U25A 4ES2A 4UUWA 4ELVA 4L3KA 1R6YA 3CJKB 4LFCJ 2DGUA 5KG2A 1RBLA 3NWGA 3PCOB 3BGRA 2DNKA 3ZZTA 1DTTA 4JI2J 2OSQA 4TU8A 2LA4A 1EKRA 1WSRA 3EDRB 4K5SA 4DF8A 4B3OB 3QJJA 2EXUA 1TFWA 4MK8A 2WSCC 2BYCA 1T95A 1PIEA 4LF4F 3C46A 3OHBA 1N36J 3HCXA 4DG1B 1NO8A 4OX9J 2FLNA 2ZC4A 3R6LB 1U1OA 2YKAA 2HFUA 2W24A 1Q7YT 2D9PA 3HZEA 4MMOA 4ZHRB 4XAKA 5L1KA 2D69A 4MFBB 1T9TA 3TEHB 4FBTA 4JB8B 5KT3A 3A13A 3R5GA 3CNQP 4LRCA 3BQ0A 1T3OA 1JWWA 2EI5A 2V6AA 1VQMS 1OS5A 3GONA 3IBCB 2VKZG 4I6WA 1HNZJ 1JLFB 2WVBA 2GQ2A 4FVCA 3IC1A 3N6NA 2KXFA 4Y0FA 4OYBA 1K44A 3J81Y 5DDRC 1Y5IB 2C2NA 4FYVB 1LOUA 5F8JA 1NKEA 1BGXT 3CMAS 2Y9HA 5E3CA 2LEAA 2AU0A 1IJFB 2UUWA 1H3DA 1UVIA 1RLDA 4K4TA 2M5YA 1FX2A 1W7WA 2ZBIA 3SV3A 3VAJA 4GKJF 2LEBA 1RQ0A 2GO8A 5HMYA 4O44A 4EBDA 4DCJB 2V2KA 1FKPA 2J76E 1LNQA 3LTOA 2H4WB 1G1XA 1KONA 1RTIA 5KFSA 2P6SA 1Q8LA 1NKBA 1P27B 2E9TA 2PI5A 1FRJA 3IR6B 2CWXA 4RW6A 3A3PB 5HVHA 4X64F 4RUCA 1DARA 1PJ6A 3DLEA 2DPJA 2GIRA 2YH0A 1SJFA 2XS2A 2IC3A 4AD6A 3PX4A 3HZGA 1L3TA 1YGYA 4KT0C 2OIHA 5IWAJ 2MYFA 4HI2A 4FP9A 5K14A
chains in the Genus database with same CATH topology
3D1HA 4ZPDA 2WRMA 4FXWA 1KFDA 3G6ES 1VQ6S 1JNZB 1FDDA 1TFYA 3H8YA 1DAXA 4C0OC 3ZZOA 3KLIB 1TK0A 4TQRA 4RBVA 1C4AA 1QE1B 1UETA 1KEKA 2XS7A 4ED3A 2C42A 4M5DA 1WHWA 1IN0A 2N3OA 3FRZA 4DSLA 1Q79A 3C8YA 4ED7A 4R8UA 1S9GB 4N76A 2W8LA 3G6XA 5E5NA 5KG3A 4EWTA 3LW5C 3BGRB 3H25A 5HN0A 4QWEA 2K7JA 2NYIA 2V94A 4X65F 1DTTB 2ZHOA 3KWMA 1WF1A 4AQYF 3OL6A 1DZ5A 2F7VA 4YEAA 1GXUA 3J7ZT 1RT7A 2BZ2A 4NYOA 5J1PA 4C8OA 2KFYA 2E29A 2DHSA 2W7AA 1SC6A 2VG6A 3S8SA 4IKAA 1S6OA 4BDPA 1FJCA 3LALA 1JLEB 3AA8A 4AFFA 1GQEA 4FN5A 3KK2A 1H98A 3KYLA 1UVMA 4I2PB 5KFIA 1U6ZA 2F40A 2V4JB 2E5HA 3EZUA 5CQGA 2VODA 4UQGA 5D77A 2LU1A 4NCAA 4JV0A 3NL0A 4RW9B 2WB1D 2VQEF 2BQ3A 2XSJA 3MTJA 4XO0A 1ZETA 3THVA 2XI3A 2FD2A 2B51A 2ZOGA 4I1TA 2R7OA 3SSQA 1SB6A 4U7UK 2BA9A 1R0AB 5A0YB 4DLEA 2K7KA 2X1GA 1Y3KA 3IAS9 3G8QA 4KBIA 3OSPA 3V2UC 3NKYA 1N0VC 3OVBA 2K1RA 4C0BA 4DR1F 2GHPA 4Y2IA 3JSMB 5HLFB 3GFYA 1WF0A 4I64A 4MKYA 1JLCB 3MEDB 2FJAB 3D0GE 4Y2KA 4EO8A 2B4OA 4KV8B 1QSLA 4YDDB 3PV8A 2FHKA 4DL0C 3NCPA 2DNLA 5D3GA 1YJRA 5E41A 1TVRA 3TI0A 2WONA 4HEA9 3UPFA 2JFDA 4JV2A 4QIEA 1NK6A 1UVNA 3W7BA 3W3SA 3PDNA 5E3AA 2CPXA 3M8PB 4N77A 1RJJA 3A1YG 1YITS 4JV5F 2DCLA 2EBGA 5B0FA 3FEYB 5HI7A 1XR7A 2CPZA 2I8EA 2ASYA 4YQWA 2W4DA 4C8LA 1G2EA 1O0PA 2VH7A 2YNIA 1DLOA 4TLRA 2FJEB 5EX3A 1S97A 1S6QA 1Q53A 3CDBA 4RW4A 3BSCA 4Q45A 4I2QA 4ZP7A 1N52B 1UL3A 4LF7F 1U2RA 5AXNA 2IJFA 2GO9A 3HF5A 2AJ4A 3LP0A 3MR2A 3K5MA 3LP2A 3T1AA 1QUPA 2DNRA 2OPPA 3FDSA 1SH3A 3CO9A 2KU7A 5CCMA 2MB0B 5J2NB 3OL9A 2KXHA 2GGPA 4G6VB 3RRGA 2JLFA 1NK4A 1NJZA 1NZAA 2GNKA 1WHVA 1HW9A 1TKXA 2R4FA 1UVKA 4WZQA 2DIVA 3ENWA 1KLNA 3VCDA 4EBCA 2O67A 3SQGA 4A46A 1LW0A 4QOTA 1MMDA 1HBMB 1N5SA 3BSOA 2HHVA 3UD3P 4I69A 1U09A 2ILYA 3BGLA 4KGMA 2DNMA 2QMXA 2ASDA 1X4EA 3DU6A 4A48A 4RNNA 3IN5A 4Q8EA 2R7TA 4DSEA 3MMAA 5K8MA 5D4LA 2PDAA 1N33F 4DL6A 5A8RB 4MKBA 3HHLD 1DRZA 3M05A 3OXFA 4PWDA 1UJ6A 4O3PA 3R5BA 5CD4H 2ACYA 2C3PA 5E0OA 2FGCA 1AW0A 5IT4A 4IRDA 5GAEU 3QAEA 3M6UA 4IG3B 1VLYA 3IGVA 3F44A 1RT1B 3V4MA 4OI1A 4QJVA 3S1TA 4N5SA 4RX6A 3VZIA 4KJIA 3C6TA 4EGLA 1RT3A 1BQNB 1S1WA 1TKTB 1Q4RA 2RF2A 4O44B 3RBEA 2HHTA 2QA1A 1MROA 1VBYA 1EP4A 4YDXA 3CC2S 2BM0A 3M8RA 3PM9A 3RRHA 3AQOA 1XWLA 4NLWA 1K0VA 4J9QA 2ABYA 2OD4A 2WCXA 2RQ4A 4OZ0A 2RQCA 3DRPB 1FKPB 2VA3A 3PFEA 3DDNA 3DXSX 1OIAA 3M1VA 1XNQF 3Q8SB 2O1PA 4B3MF 4Q5VA 4P2SA 3BSNA 5JUMA 2ZKUA 4JI3F 1SJQA 2OPRA 3OFEA 3MMJA 2IJNA 3MEEB 5J2MA 3KLHA 3NS6A 2E5LF 2BACA 2IA0A 1TV6B 3G6YA 4FNIA 4FF2A 3K8VA 2KT2A 4QIGA 3C2PA 1RT5B 4QW9A 5I4MA 1VRUA 1QY7A 1X4DA 1JXLA 1VGYA 4K2XA 5KG1A 1S0VA 5I3UA 2KYXA 3LWLA 1JLAB 4G1QB 1RGVA 5EX0A 3SDEA 1FESA 1AXQA 3CCJS 5L1LA 3DLEB 2GMLA 4ED0A 3HKZD 1GXTA 4F3QA 2VQFF 1V3ZA 1JK9B 4V19J 3NNHA 3OTDA 4WXWA 5KT5A 1RT6A 1UAWA 5KFJA 1XBWA 4I7FB 2XZWA 2ZH8A 3MM5A 3R5AA 2IC3B 2NLWA 4X4SA 1S1TB 3TANA 2ASLA 2GC8A 1JNRB 2M70A 3HI9A 4IH6A 3UR3C 2FJWA 5DGBA 1TP7A 2JFKA 3LGMA 5DETA 2QSWA 3VF0B 3TVZA 3CCLS 1QJHA 3NP5A 3SCIE 2ROGA 2Z0GA 1S1UB 3MF5A 4OZJA 1L5UA 1LWEB 2VL1A 2D41A 1WG5A 3QGHA 3R27A 2KFNA 2Y1RI 5IT9Y 1FRMA 4NA1A 1UEVA 2UVWA 4GC6A 3DCAA 2DRBA 1TL1A 5C42A 3J7Z5 3MOJB 3GWCA 4AL6A 4FXDA 2HNYA 1T02A 1S79A 2HPUA 1C1BA 5HP1A 1YJWS 4QIFA 4M5DB 3ZZUA 1U47A 1HNWF 2AX0A 5KFCA 2HWTA 2LXUA 3L95X 1U4BA 4R8UB 5GADI 2NR0A 4TQSA 2CDQA 2B4VA 1RWUA 2XI2A 1FNOA 3PZPA 1GX6A 4EO6A 2N82B 3MR5A 1HBNA 2QA4G 3FCHA 5J2QA 4LFAF 2CPFA 2MKSA 4X2BA 4WTYA 4NLVA 4LQ3A 1IBKF 1WI8A 3OTBA 2HFNA 2EKYA 1LWCA 2J5AA 5L8RC 4OJ3A 5KFNA 5KOXA 2CPJA 5IFMA 1W2BR 2CRLA 1RT7B 5GAEI 4ECWA 2HHPA 3K5PA 2L9NA 2KZZA 3BEGB 1HPZA 4J9MA 2I38A 2AGQA 3KFWX 1VRTA 2IBOA 5L9NA 3HO1A 3RAQA 4PG7A 4YB7A 2FJDB 5AXKA 2DISA 2C2EA 2DR8A 1HI8A 1VQYA 1X4CA 3V81A 4DQIA 4PWUA 1VIXA 3H5XA 1XR5A 3PW4A 3J7YU 3Q22A 1Q7LB 2XSJB 1PGZA 1RISA 3M2VA 5CZXA 1X8DA 5FDLA 2VG7B 2RSQA 2B7CB 5IM0B 2R9LA 1MWZA 2E44A 2JEIA 1H7WA 2PFFB 1HNIB 3Q24A 3AB2B 1REVA 5HMXA 5KT6A 5CHCB 1N48A 1KN6A 2U1AA 5E2QA 2F3JA 2JSXA 2K1RB 3MZIA 5CXTA 5AE2A 2R2TA 4I6AA 5J1EA 1U24A 3OTCA 1MMLA 5DO2A 5IQ6A 3GYXB 4ECSA 1VC5A 1R7IA 3GFXA 4DHVA 4CZCA 3QGIA 5D3GB 2JEFA 1TVRB 4H4OA 2WONB 2V0NA 2ZD1B 2CPHA 4YR3A 5MAOA 3DC2A 1JLGA 3KJVB 1Y3JA 2BR0A 2M4MA 1U45A 3FZBA 2P9GA 3G6VA 2YKMA 3QMQA 3KG1A 1UA0A 3I87A 2UXDF 1C0TA 4ED8A 2D9OA 5DQIA 1HBOA 4K4XA 4ECYA 1M5VC 4PG4A 5KFQA 4K4VA 5HMZA 4RZRA 1DLOB 1D3WA 1VQ7S 2IAJB 3UNGC 2DNGA 3MCSA 4A8WA 2M88A 2XWYA 1S6QB 2M2BA 3CEDA 3CD0A 2FB0A 4QIWD 2QE5A 4RW4B 4Y2MA 2ZH4A 4DV0F 4I2QB 4NLXA 4DUYF 3SI8A 2JEJA 1S4FA 4FVMA 3TNVA 1M5KC 3LP2B 4DFJA 2OPPB 3WC0A 4PG6A 3OQ2A 4LFBF 1DQAA 3DLKA 1AROP 4AXIA 3OV7A 4DL7A 2VOOA 4FNHA 3EZ5A 1QVGR 2GQQA 4ZK7M 4IG0A 4O3SA 4O23A 2ZJRQ 1DFDA 2CJAA 1TKXB 5LJ3Y 5BR8F 2PEHA 1VBXA 3LPYA 1S10A 3OJSA 2B56A 1TL5A 1FRHA 1QAYA 2PN6A 3LANA 1WF2A 4IH7A