3CUNA

Aminoacyl-trna synthetase ribozyme
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
91
structure length
91
Chain Sequence
RPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis of specific tRNA aminoacylation by a small in vitro selected ribozyme.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna/rna binding
molecule keywords RNA (92-MER)
total genus 16
structure length 91
sequence length 91
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3cunA00
2V94A 2MHNA 2DNOA 2DNPA 3V4MA 2CQ4A 4P6QA 5GVQA 2MKCA 1YTYA 2X1FA 1FJEB 3Q2TC 1FO1A 2LKZA 2OJ3A 1YJNS 3P5TL 5LJ5Y 1JJ2R 3H2UB 3BS9A 1WF1A 2QEXS 1WG1A 2CPDA 2DGSA 2KRBA 1RKJA 3CC7S 1SJFA 3K0JA 4FXWA 2RVJA 4Z2XA 4Y0FA 4V19X 2AYEA 3MOJB 2M0GB 1VQ7S 3CC2S 1L3KA 2QA4S 4ED5A 1O0PA 2DGUA 3LQVA 5DDOC 4W90B 1K8AT 3P3DA 1M90T 5IQQA 3UCGA 2YH1A 1OO0B 1R8HA 3VF0B 5D77A 1WF0A 3S01A 3BO2A 3CCVS 3TP2A 2MSSA 1Q81T 3NS6A 2VONA 3L3CA 1X4HA 4WFAQ 1P1TA 1ZZFA 3H2VE 1DRZA 2OTLS 3NNAA 1FNXH 3ZZYA 2GHPA 2M8HA 2E5JA 4WIIA 2A3JA 3CCUS 2LEBA 1CVJA 4UY8T 2OTJS 2YTCA 5DDRC 3UE2A 2MQPA 2LXUA 5GMKa 2CPEA 1NU4A 2DNNA 2EVZA 3B4DA 1KD1T 2XNRA 4IOAQ 2MSTA 5EN1A 3UCZP 2AD9A 1D9AA 4OZ0A 2ADCA 2FPHX 2ZJRQ 2LEAA 2MB0B 2XS7A 2DNZA 1OPIA 2MKIA 1X5SA 2CPFA 2M9KA 3CPWR 3CTRA 3G71S 5DM7Q 1U1LA 2DH9A 2DNGA 1U1MA 2KYXA 2RS8A 2OSQA 3Q2SC 4C7QA 2RRAA 1NJIT 2XS5A 4YUDA 2N3LA 1HL6A 2J8AA 1X4CA 5IFMA 2CQ2A 1X4FA 4F25A 2D3OR 3BEGB 3NNHA 2CQGA 2AYGA 2KN4A 2N82B 2DHGA 1H2UX 2DIVA 2MZJA 1VQ4S 3CMAS 1FT8A 1Q82T 1WEZA 2CQ0A 1FXLA 1U6BA 1W2BR 2MZQA 2KG0A 2DGXA 1U2FA 2B0GA 3MURP 2DNYA 3FEYB 5FJ4A 2I2YA 2LCWA 1KOHA 1U6FA 2BZ2A 2DK2A 2KHCA 3N9UC 2LYVA 1A9NB 2YKAA 1FHTA 1WEXA 3HHNB 1F9FA 2U1AA 3MUVP 2KM8C 1KQSR 2KG1A 1DZ5A 2KH9A 4OZ1A 3THTA 1JMTA 1RK8A 2MKKA 2F3JA 4PR6A 3VAKA 3UCUP 4CH0S 3SXLA 5HL7Q 3CCMS 2J0SD 1VQ8S 2DGQA 2MJUA 2DB1A 5LXYA 2N7CA 2MGZB 3MUTP 3CCLS 3RW6A 4WF9Q 2DH7A 2DNHA 2JWNA 4U67Q 2M7SA 1Q86T 1WI6A 4ZKAA 1S79A 2Q79A 1HD1A 5D78A 1VQOS 4QU7A 2EK1A 1H6KX 2JVOA 2M70A 3SMZA 2DGOA 2GO9A 4TLQA 2LQ5A 2PE8A 2G1DA 4F26A 3U1MA 3G9CA 5JVGQ 3CD6S 2LECA 1YJ9S 2DNRA 5LSOA 2X1GA 2DISA 2MQMA 1VC6A 5DDPC 1U1OA 2X1AA 4TU7A 4WKRA 1U1KA 1B7FA 2HGNA 3ULHA 2ZJPQ 3S6EA 3R1LA 1YHQS 2MQNA 3VAIA 1IQTA 2FY1A 1QVFR 2JRSA 2CPIA 5LXRA 5CXTA 5IM0B 1VQPS 1N88A 2M2BA 1JJ4A 1YJWS 2RQ4A 2CPJA 2L9WA 4PKDB 2D9OA 2RT3A 5BJRA 1AUDA 1ZZNA 1PO6A 1M5OC 1U1PA 5DDQC 2NLWA 5CYJA 1WHXA 2CPHA 2JVRA 4EGLA 2QFJA 1N52B 2E5GA 5DM6Q 3S8SA 1YWXA 2MKHA 5MLCV 3P6YC 4IOCQ 4IO9Q 4UQTA 4WFBQ 5H1SV 3TO8A 4ERDA 1FJ7A 1BY9A 3NS5A 3UWTA 2RU3A 3BO4A 1WTBA 2XNQA 1KOOA 1UW4A 2KXNB 1VBXA 2DNMA 3CC4S 2L08A 2CJKA 1X5TA 1K73T 1VBZA 3EGZA 4J5OA 3PIOQ 2FC9A 3MXHP 3NMRA 2MZ1A 3CCJS 2MKJA 2KM8B 5IM0A 2RRBA 1X4GA 1U1QA 3CCRS 3CCQS 2RS2A 2K3KA 2L41A 2BOPA 3MUMP 1VC0A 3NNCA 2HGLA 2M8DB 2CQIA 3RW7A 3FEXB 2K8GA 1YI2S 4TU8A 2CQHA 2DH8A 3G96A 1VBYA 1K9MT 1VQMS 2NZ4A 2RQCA 1Q7YT 2MMYA 2YH0A 2DO0A 4LJMA 3G4SS 3BO3A 2MY7A 5HO4A 2X1BA 1P27B 2MZRA 1X4DA 2LXIA 1X4AA 5CA5A 2XSFA 2N3OA 2MQOA 1U1NA 1VQ6S 4CQ1A 4LIRA 2KU7A 3CXCR 2KI2A 2CPZA 2DNKA 2DHXA 5LSLA 2MGZA 1WWHA 1HA1A 3SDEA 1U1RA 2AYBA 1WG5A 2ERRA 3EGNA 3R27A 2MXYA 2G0CA 3CUNA 2XS2A 5JVHQ 3CMES 2E44A 2LMIA 3MI7X 2FC8A 1X4BA 1X4EA 2DGTA 2F9JA 2SXLA 3MDFA 2J0QD 2JX2A 4QU6A 2PEHA 4RU2A 3UD3P 2DGWA 1S72S 2MQLA 3VAJA 2FHOB 4BS2A 2KXFA 2UP1A 1WHWA 2YWKA 2DGVA 1M1KT 4TU9A 3J7ZT 4WFNQ 4CIOA 2HVZA 2CQCA 3G6ES 3JB9k 1WHVA 1WHYA 2MZTA 2OSRA 3B4MA 1SJQA 2RNEA 1YIJS 4M5DB 1PGZA 2CQ1A 2DITA 1YITS 1UP1A 4QPTA 3S7RA 4WCEQ 1N54B 1WI8A 2EK6A 1OWXA 2D9PA 1JJHA 4C0OC 5DETA 3G8SA 4IUFA 3I55S 3VAHA 2DHAA 2AYMA 1VQ9S 1OIAA 2XB2D 2M4MA 4YOEA 3P49B 3HI9A 2DHSA 1M5KC 3IWNC 4FXVA 3J7YU 2MZSA 2KXHA 2RUGA 1X5OA 3ZZZA 1XN9A 3DLLQ 2CQPA 2LA4A 3G8TA 2MKSA 3D2WA 1N8RT 1FJCA 3R1HA 2DO4A 2MYFA 2O3DA 1QM9A 3EX7B 3MD3A 2E5HA 4PRFA 5GAGU 2CQDA 2VOPA 2F9DA 2HYIB 2G4BA 1UAWA 5GAEU 2DNQA 4QQBA 2DNLA 2MPUA 1DBDA 3UD4P 1A7GE 4W92B 3VAMA 1D8ZA 5LJ3Y 3SDEB 3PIPQ 1H2VZ 1WF2A 3VAFA 1G2EA 1NO8A 1WEYA 3CCSS 3VALA 4LMZA 1VQNS 2CQ3A 1SXLA 1SJ4P 2U2FA 5ITHA 3CULA 2E5IA 1HD0A 3THPA 4Y00A 4C4WA 3U1LA 2KT5A 3VAGA 1SJ3P 2VODA 4A8XA 2HZCA 4YB1P 3DXBA 1QVGR 1M5PC 1M5VC 3CF5Q 1DHMA 5GADU 2M88A 2MY8A 1SJRA 1WELA 1KC8T 4F02A 1UFWA 5GAHU 2CPYA 2ADBA 2OIHA 1VC5A 3MD1A 2KRRA 2J76E 1VQKS 1URNA 3CCES 1H2TZ 4CH1A 2CPXA 1X0FA 2ZJQQ 3US5A 2KVIA 3TYTA 2CQBA 3I56S 2MQQA 1X5PA 1R8PA 2WBRA 1VQLS 3IRWP 2VOOA 1VQ5S 1WG4A 2KFYA 3LPYA 2MJNA 2DIUA 2LA6A 2M52A 2HGMA 3OW2R 1ZH5A 2I38A
chains in the Genus database with same CATH superfamily
4OI3A 3IBWA 3W2VA 3V5RA 3KLVA 2V63A 3H90A 1HNWJ 3ENAA 2DNPA 4KV8A 3IGNA 2CQ4A 3MM8B 3W2WB 2BQUA 1AFIA 1YTYA 3OJSA 4DR1J 2K7JA 3Q2TC 2C2EA 4QPXA 1FK9B 2GMJA 5HROA 3QWPA 3TOQA 2COLA 4CLUA 5LJ5Y 1RT6B 1JJ2R 3O2IA 4X62J 2ZVSA 1S6PB 3H2UB 3VHQA 1OY6A 3QT8A 4OYOA 1RU2A 5HMYA 1UA1A 2QEXS 2DGSA 3DLKB 2WHOA 4PYAA 2AKWB 1RKJA 4C8OA 1NDLA 5HROB 2EWHA 4FXWA 3OHAA 4OFZA 5DQHA 2AYEA 3HVAA 3K59A 2XTJP 3CMQA 1J5EJ 1XK8A 1S6QA 2RMLA 2W9CB 1NPPA 2RDIA 1YJRA 1VQ7S 3M9NB 1GMWA 3OFFA 3W64A 4LF5F 4DR5J 3NOCA 3ONQA 4C48A 4ZLNA 4IH6A 4ED5A 2XYHB 2YNHA 3I0RB 3O5TB 2DGUA 3LQVA 3OR2B 1RHMB 3R7SB 1SQEA 2Z4PA 5KFDA 3I5AA 4PCQA 1V3ZA 5F3TA 4KE5A 1CJTB 1OO0B 1C0TB 2OP5A 3KFWX 3VF0B 3VGSA 3HT3A 4CH7A 2MSSA 1RA6A 4C3MA 3NS6A 2VONA 2DD8S 4PWUA 3VWSA 5CZXA 4K0KF 3H2VE 1ZZFA 1DRZA 3GQCA 5I3PA 5C42A 1KKHA 1MU2B 2BJ8A 2HVHA 1SUQB 4YB7A 4ER8A 2HQCA 1KDNA 4I7FB 4XDDA 5A8WA 1FNXH 3IXQA 4C8ZA 2ACYA 2DR7A 2G13A 4F4XA 2AJ2A 9RUBA 4ZVPB 1NDCA 1HW9A 3C8YA 3SV3A 4DF8A 3R9LA 1UA0A 4UY8T 3QFHA 4Y2IA 5L46A 3A8KA 4NCGB 2MQPA 5KTQA 5D8HB 3PG9A 2P5VA 2RF2A 3EVOA 5GMKa 3HHLB 4GO5X 3PVXA 4MKBA 1RHRB 4BDPA 1JLBB 1NU4A 1IKYB 3QT6A 2IM0A 2XNRA 1KLMA 3HHDA 3WX4A 4IOAQ 1HNVB 3SCJE 2BE2A 1BC6A 3QSIA 4DX6A 4DX8H 3CIMA 1Y9OA 3KWMA 4V19J 4NLXA 1BGXT 2QGFB 4ZVEA 1WC6A 2IC3A 3ELHA 3FRZA 3UN3A 2Z2ZA 3K2YA 1S1TA 1UL3A 3QIPB 4RW6B 3M8WA 1OPIA 4Q45A 2MKIA 1N36J 1X5SA 2P2CB 2VG6A 3RYLA 3DNCA 1XBWA 2ZDPA 3DM2B 4FN5A 1H7WA 2W4CA 2YNFA 2HQIA 3X3UA 2V4RA 1U1MA 3THVA 1S6OA 4ZPBA 4P72A 1TKTA 2HNDB 3GTYX 1NJIT 3HJVA 2BE7D 2EFNA 3NLCA 4K7QA 2B9YA 4OHWA 1DLOA 1FXDA 1HL6A 1PJ7A 5ETKA 4DDFA 2UU9J 4FXDA 3ZC4A 4ETXA 2JZ5A 5U47A 4F25A 3M8SA 4WTYA 4LR8A 2DRDA 4OIXA 4YB5A 3NS7B 5ETTA 2VQFJ 4ECQA 3EVWA 2D1CA 4M5MA 1VBKA 3SSQA 2R2TA 2AGQA 1FT8A 3BR9A 3D6HB 1Q82T 4NXNF 1TMMA 3IFEA 1FXLA 3K8WA 2Q43A 3M2RB 1CC7A 4OI4A 4A48A 3AT1B 4YN3B 3MR2A 1HPZB 2BJ1A 3KLEA 3FCWA 2FVPA 3K5PA 1L3SA 3MURP 4O4GB 4KGKA 4MTPA 1RAAB 5KT5A 2IRYA 3AJDA 1U6FA 2YY3A 5KFFA 4HHUA 5EWGA 2WVBA 1RTDB 1IKXA 1FDBA 1KHVA 5AXKA 2EXUA 2PMHA 5HP1A 2ZM6F 3HHNB 2NZCA 3M8PA 5B09A 5DS7A 3CDAA 3KMSA 3H5XA 3QGGA 4CLKA 2QA4G 2EFQA 3MUVP 2KM8C 4OI2A 4KO0A 2QSFA 1R0BG 1HW8A 1P8GA 1S1TB 2R7QA 3F44A 4P75A 3THTA 2Y8YA 1JMTA 3RRGA 1RK8A 2GHWA 3GP9A 2KO1A 2F3JA 5K20B 3UCUP 3AA8A 3VAKA 1Q7LB 2RSQA 4IKAA 4A8QA 1CG2A 1GNKA 3SXLA 3L09A 2J0SD 4XTTA 1JLGB 1RU1A 2HFOA 3TZXA 1H74A 3M2VB 3A4TA 1VQ8S 2V9KA 5ETPA 1NKBA 1T05A 2JEFA 3KJQB 3CCLS 3J81Y 3C14A 1A6LA 5HATA 1WJ9A 2AIRB 2DCLA 2DNHA 1BQMB 4ZJOA 2J7KA 3PXGa 4ECYA 4R5PA 4RBTA 2BANB 2K1RA 4J9UE 4USWA 4U67Q 1NK6A 2M7SA 2HG4A 1WI6A 5D78A 4LQ3A 3IS9B 4M5IA 5D15A 1VQOS 1XMQJ 3CT9A 5BXIA 2XO6A 1XMOF 2R8JA 4X4VA 5KFTA 2QX0A 1TR0A 4DXLA 3MOZA 5J1EA 2JDJA 4OZ3A 4F67A 3Q0AA 3RR7A 2KZZA 3C2PA 3W61A 3K58A 2NXUA 2GJ2A 5KFYA 4J9RA 3ILIA 3PYFA 3G9CA 3CD6S 3BM7A 5J1EB 4U95A 1UJ6A 5KFJA 1S1UA 1I51B 4WYWA 1RTDA 3MMBB 2FTRA 5ETVA 1YJ9S 1JB0C 5M2PA 4XIUA 1R3NA 3QQCD 2IA6A 5AE1A 2OH2A 2X1GA 2PDAA 2DISA 3ZTRA 4PWDB 5HSPA 3TA2A 2A10A 5HI7A 5DDPC 1S10A 2FLNA 2XG8A 1V3SA 3KLEB 4RWWA 3EZOA 3S6EA 1K44A 4CDIA 1S1VA 1TL5A 4U6PA 2V5HG 2XYGB 2R7UA 1J5OA 1QVFR 2JRSA 4DPTA 1WOSA 2VPZB 4DUZJ 4ZPDA 4P7TA 3PR5B 1YRTA 1Y10A 4O4GA 5KT7A 4XPCA 1TL3A 1N88A 5J2MA 2HBRB 1JJ4A 4EZ6A 2HBQB 2WW4A 3DOLA 4K2JA 4OLOA 2HHPA 3C14B 1U25A 2EFOA 1UTAA 2PEBA 4KO0B 1PG5B 2J7UA 1VRUB 2LFVA 3CCWA 1H38A 3I9ZA 1NSAA 5BJRA 2PA3A 1S59A 4PAAA 3LGMA 1U1PA 2BRKA 2NLWA 1EHWA 2CPHA 2DKOB 2HQFA 4LF7F 5DM6Q 2IAJB 4L72B 4USMA 5EWFA 2BX6A 4ED0A 5DQIA 5J2NA 4Y65A 5I3UB 5MLCV 4ES1A 1T95A 3P6YC 3KK2B 3R6GB 4NZ6A 2OMOA 4LBHA 4WFBQ 2XCAA 2IC3B 4TVAB 5H1SV 3JYTA 3R5AA 1FJ7A 1BY9A 3D54A 1ZBTA 1H72C 4JOUA 3BO4A 3Q8SB 2XO7A 1RAGB 1IR1A 2IDEA 3NMAA 1C0UA 2YNFB 2AQ4A 1SL2A 1HBOB 1OQ6A 3NCPA 2VC1A 1SB6A 2QL5B 3RUBL 4NEZA 2RE1A 3QZ8A 2CJKA 4DU7A 1SIZA 1CLFA 1U0HB 4F4ZA 4N5SA 2AJ1A 3KK1B 3MAHA 4KKOA 2W8LA 2R8HA 3MXHP 2FC9A 2ATLA 1H3DA 1BQXA 1F2HA 4QR0A 3ZZ0A 2MZ1A 2LQBA 4ELUA 3NMRA 2X7IA 3DGPA 1JLFB 3LP2A 3MR5A 2EG1A 3H5YA 2BOAA 2FYXA 4NMXA 1HWIA 4NASA 2YKMB 2BACA 4OX8A 3MUMP 1ROFA 4DV0F 1UVIA 1AW0A 1X0PA 2HGLA 3T6JA 3SFUA 4LSNA 3MAAA 4ZVSB 4A8KA 4NRTA 2L48A 2V69A 2B7BB 2HS3A 1YI2S 3LAMA 4LRCA 2VD3A 3GG0A 2XMTA 4TU8A 1DLOB 1RHUB 2DH8A 1Z2ZA 4DR1F 1VBYA 3MAAB 5A76A 1MW7A 2VQEJ 1RAOA 2IM1A 3OSPA 1Q16B 1IKWA 1RWMB 4HTIA 2ZHBA 2RQCA 3KLIA 4BLGA 3D7SB 3KLFB 1E6YA 4ENOA 1H7XA 3AOBA 2RF2B 2MY7A 3MR6A 1MLAA 1T9YA 1TAUA 3IGVA 3LUYA 4C0BA 1SQGA 3D6MB 5KFNA 3HJFA 5CA5A 5GADI 2XMAA 5A2QY 4KGZB 5A6WA 4ICLA 1O8BA 3FMBA 3R8YA 5KAKA 1EIYB 3HHLC 4YB6A 5BR8F 2XGPA 1VQ6S 1CQMA 5IC6B 4LRBA 4CQ1A 3I4PA 3ET6B 5E0OA 1RTIA 4K5SA 3J80U 2XZDB 1PYSB 4ELTA 1NM2A 1RP5A 2DNKA 4CO4A 2ZOGA 3NWGA 3EXYA 2BQRA 3JYTB 2NQPA 1HLWA 3DLBA 1SPBP 1L3VA 2GFFA 4JI0F 2YNGA 2OUGA 4HDGA 5ETRA 4EZ9A 3R27A 3TZWA 1T8EA 1NH8A 4LR7A 3FEZA 4I69A 4G3IA 3VVUA 3QATA 1CS4A 2AHOB 4U7CA 1VFJA 4Q8EA 5C2GA 2E44A 4ETZA 3CMES 4K50A 4ZJQA 5KFHA 1U7LA 3TUIC 4Q5VA 2XLKA 3BSOA 2BA9A 3O1LA 4JI6J 2F9JA 3EZUA 1KVKA 2WVCA 3VGVA 2XHWA 3IRXA 4ZLJA 4USVA 3KTQA 2GGPB 3DI6A 3TVYA 4NXMF 2HRTA 3UD3P 3G6XA 1RT6A 1AYEA 1UEUA 1HIYA 3K57A 1E6VB 3RAQA 2GZOA 4C8LA 3VAJA 2IVYA 4ANEA 2CUYA 1QAXA 3TJ9A 1E6YB 2AJ4A 2DGVA 4DG1B 4C3LA 3NG8A 1UWBB 2M3DA 5D0EA 1UMJA 3TA1A 5IV4A 4RNFA 4D3HA 3U7JA 1S9EB 5D4NA 1VRTA 2HNYA 4GC7A 4UZBA 2FIUA 2MZTA 1SH2A 2P9CA 3GJTB 3Q8YA 5C7PA 1SJQA 2H5JB 3UVJB 2ASLA 4UT4A 1FRKA 1JLQB 3GYGA 1S1UB 2CQ1A 4IG3A 2V8HA 1QE1B 5RUBA 5F8HA 3JSMA 1ULRA 2DITA 3M9OB 2HKEA 1T02A 4HT7A 1T03B 2X51A 4ZPVR 3WHIA 4GVLA 1NK9A 3C15A 3FCVA 2VJUA 4L3NA 2DR6A 1NH7A 3QZ7A 1WI8A 4DFPA 4PXBA 4B17A 4WIQA 4C0OC 1F1BB 3M05A 3O8WA 3NGDA 2B43A 2KVQE 2WBMA 4RNMA 1N36F 3G8SA 2G0JA 4IUFA 2W9BB 3MM6A 3VAHA 2DHAA 1NK8A 3M30B 4FPRA 4F2RA 4IRCA 4CLSA 2WONB 1M5KC 2DHSA 3C6UB 3PKYA 3IWNC 3GYNA 2IRUA 3FUYA 2CVEA 1OYEA 1SIWB 3BPDA 3J7YU 1Y5LB 4I2PB 4DQQA 3QT5A 3IR5B 3K5NA 2HIQA 2AMCB 4Y2KA 3NBPA 3ZTPA 5T14A 1NKEA 1ZPVA 2HQDA 2RUGA 3MF5A 4O23A 2EFVA 3BF4A 3JTOA 1FD8A 1XERA 1M5HA 4MFBA 1XN9A 4QWDA 4USTA 4DV4F 4BCAA 2KTQA 2L3MA 4PUOB 1NDPA 4YR2A 3EWGA 4UUXA 2CQPA 2LA4A 4DV1J 4EYIB 3DLLQ 4IRDA 3H5UA 4LSZB 2PA8D 4RW4B 1FJCA 2J9DE 4ID8A 1WOOA 3R1HA 4WTOB 2MYFA 3AOCA 5L1LA 2EC2A 3T5JA 2F9DA 1C1BB 3GE9A 3H42A 4DV7F 2HMIA 4A4JA 4IQMA 2YWEA 5DZ6A 1N5YA 3AXMA 1UAWA 2XZWA 1R31A 2W9CA 2FHMA 2DNQA 4ZOSA 6AT1B 3HSGA 1HQUA 1PILA 2DNLA 3T5LA 4H4KA 4NLGA 3RAMA 4WFYA 1DBDA 3QAEA 1OYDA 4DX7A 1A7GE 2HVDA 3DDIA 2F4FA 4GVBB 1QTMA 4W92B 4GKJF 3HZGA 2V0NA 4AL7A 2ZBQA 1SV5B 2HVIA 1S9EA 2A0FB 4UZCA 1YJUA 1X31C 2UV8A 4OX7A 3PIPQ 5J2QB 1RT3B 1H2VZ 3PJWA 4KBIA 1S57A 1WF2A 2UXCJ 4FF1A 5D0GA 1NBEB 2B5JB 3UW1A 2UUCF 2MKYA 1WEYA 3DRRA 2VDHA 4ZCIA 4LMZA 3CDBA 3OTBA 3KLFA 1SH3A 2JLEA 1MG7A 1SXLA 1MMNA 1SJ1A 2R3VA 3T1YJ 1BHNA 4EEYA 2E29A 4HLBA 1S9FA 1F60B 3UNYA 2LQ8A 2LQJA 3BQ2A 3THPA 3M1VA 2KJWA 2Y1RI 5LMUJ 5B0BA 1FWKA 4MKAA 4GMKA 4S0MA 4YB1P 1N5TA 2F8EX 2W4DA 4CT9A 2QLFB 3DU6A 3HMJG 4J9NA 1IBKJ 4N77A 4O3OA 1JLEB 1SBRA 3CF5Q 3TA0A 1DHMA 2EKNA 5GADU 5HBMA 4DR4J 1LFPA 1VRQC 1WC5A 3AA9A 4DSIA 4LF6F 5GAHU 2ADBA 1REGX 2JNJA 2ILYA 4OQJA 1VC5A 2NSBA 2AGOA 1NK5A 3OPKA 1U45A 2KL8A 4C8NA 3LANA 2XGQA 1TL1A 3GR0A 5BYRA 2J9EA 5JMNA 1RHJB 1RWKB 2CIMA 1VK3A 5HQLA 1HNVA 1P6TA 3NXZA 3PEHA 2AZ3A 2JLGA 2G9OA 1TQLA 3DM2A 3MPVA 5KFBA 5J2PA 1LK5A 1G6BA 5EX3A 4Q7AA 2PT0A 3E51A 3MTKA 3FBEA 2QLJB 1SKUB 2CXEA 3Q83A 4RW6A 4E2FB 1YJTA 3NRBA 5KG1A 1D9FA 5B0GA 1S4FA 4ZS6A 3TYTA 5A0YA 5I42A 2V8GA 2EI5A 1X9WA 4DUYF 3NGKA 2GMLA 4JI4F 1B99A 4ES2A 4ELVA 1VQLS 1ZPWX 1GT8A 2ZBIA 1L3TA 1DTTA 3WX8A 1XNQJ 1H73A 3UDCA 4QWBA 3C16A 1WG4A 2F1FA 3TEGA 1T9VA 3ZFVA 4Y2CA 4ZIWA 3GIRA 1K1SA 4D3GA 3BBBA 3KJVA 4DUZF 1VC6A 2HMIB 1X9SA 4WK3A 3TVKA 4F0MA 1SL1A 4J9SA 2LA6A 2ZE2A 4RW9B 2F4VJ 3SCLE 3CJQA 1R27B 2CJXB 1R89A 3KUHA 1B0PA 3QGIA 2ZH5A 1C0TA 2V94A 3IG1A 2C3OA 1R8BA 2QTWA 4TXSA 1LFWA 3GSIA 4P6QA 3T6BA 4DV7J 3QYYA 2B5JA 2HRUA 4JI2J 3KHLA 1RTJA 2C2MB 2OPQA 5KFUA 5CH7B 3R5DA 1YJNS 5JJBA 3FQKA 3GPAA 3IAM9 3AB2B 3NGUA 4N8OA 3BS9A 1YVFA 2CYYA 3PO5A 2E7VA 2CDRB 5FDLB 1LQ9A 3LP0A 3D67A 1IBLJ 4DN9A 1RTIB 2I9SA 5KT3A 3K0JA 3IAS9 5ETMA 4Y0FA 2VA3A 1Y4ZB 3GJQB 2GVZA 3JQKA 3AJ2A 2GVDA 2ALZA 3MECA 1S12A 3OT9A 4I64A 3G2XA 3MM6B 5B0AA 4LF9F 5LOQA 1L3KA 2WRMA 3KK3A 4UTGA 4NCAA 4OI1A 1Y5IB 3W2VB 2Q3PA 1G7CB 4U8VA 5KFRA 1O0PA 5DDOC 4F3QA 4W90B 1M90T 3ENQA 1Y11A 2DHHA 3NAIA 1HBUB 2DBBA 3PFOA 2WOMA 1FXRA 5F9LA 2W2MP 5ADZA 1DFDA 1C1CB 1WF0A 4NLVA 1Y7PA 4DQRA 3RB6A 3TP2A 2B6AA 1UWAA 3OJUA 3QRPA 3D68A 4EFAC 3DRYA 1X4HA 3DRSB 2VDIA 4QW9A 4EK2A 4BHQA 5LT5A 3NNAA 3HD1A 3LTOA 2W9AA 5H9FJ 3DN9A 2FLOA 4DCPB 4M8LA 3JSBA 1BD6A 1LW0A 2GW8A 2M8HA 2VFSA 3LWLA 2LEBA 4L74A 4DFKA 1AROP 2FJBB 1ZAWA 1U2CA 3OHBA 3IWXA 2OTJS 5I4MA 5DDRC 1XJWB 3AFGA 3DDKA 1APSA 3A3PB 3CJ0A 1GMVA 4CO1A 1LW0B 1N56A 4JYAJ 2DNNA 3KHGA 2VA2A 4I2QB 2R7WA 4ILLA 1FTCA 4NYOA 1FJGJ 3E2EA 1PJ5A 1R8AA 4KIAA 3UCZP 1D9AA 4FBTA 3IRXB 4OZ0A 2NSCA 4YFUA 2R7VA 5H9FK 2LEAA 2MB0B 2DNZA 4OZLA 4K4TA 2B9XA 2M9KA 3SZ2A 4DF4A 1U1LA 1YQHA 4O0NA 2NS1B 3L9ZA 4I7FA 2DNGA 1F3FA 2B3TB 4WBFA 1UCNA 2CJQA 2PGCA 4LSLA 2IBOA 4PYDA 4IH7A 4EU0A 2GV1A 4C7QA 5KG2A 1BXNA 1ZM3A 3GILA 2E9ZA 4OX6A 3LPEA 4YUDA 6FDRA 2XS5A 3KKFA 3KNGA 2N3LA 4NLYA 4Y34A 1RWXB 2Y1IA 2HWHA 2FB0A 2XMWA 3LAKA 5IFMA 4KB7A 4DPOA 3OVSA 2D3OR 3NNHA 1TL3B 1UFLA 3CJKA 2XMKA 1VCTA 4CLWA 3Q24A 4OZNA 4UW2A 4DQSA 2AYGA 3NEKA 3BV8A 1VQ4S 4G1IA 5HP1B 3C46A 3OVBA 1R0CB 3BGRA 1YRXA 3GJSB 4WXWA 1LWFA 2CQ0A 5F9NA 2FJDB 1LWCB 2UUWA 2YQ0A 2ZNZA 3R7BB 2GVZB 1U6BA 1HI8A 2MZQA 2Z0GA 4ZVRB 3W60A 2KG0A 4KR0B 3CJ8A 1VLYA 1U2FA 2J9DA 4QCLA 3V6DA 1QSYA 5C24B 2R9LA 3BH7B 2B0GA 3PHEA 4J9QA 3RBDA 1FFWB 1HWLA 2DK2A 2ZKUA 4HH0A 2JFKA 4ZN3A 3JTNA 3N9UC 1C0UB 4WXOA 3PX4A 3V81B 1FHTA 1G3OA 2ZOFA 3QFWA 1TFWA 2OMLA 4LF2A 4TYBA 3MM8A 4RWXA 1YJVA 4NE9C 1ELOA 4MKYA 1GTEA 3L95X 2KT2A 4Y3CA 4QWEA 3GFXA 1PYTA 5KOXA 4TYAA 4DL7A 1Q95G 2MQ8A 2HWIA 2HFSA 1FNMA 1RZMA 5EGYA 4K4SA 2B56A 4JI7J 1DTTB 1EJ7L 3TNVA 1LWXA 1TUWA 3IN5A 2EBEA 4ZA1A 4ZK7M 5HL7Q 2R2UA 1YSJA 2D3ZA 1D9DA 4ZVUB 2XC9A 1ZM4A 3DGPB 4WK1A 4QYZJ 1NHUA 1Q78A 2HURA 2MGZB 3WBZA 3DOMB 4USKA 4WF9Q 3C6TA 2YH1A 1VIOA 3FJ2A 4RBVA 3BREA 3EVMA 5J1NA 3PY8A 1Q86T 5KFVA 1VGYA 4IG0B 2Q79A 4QR2A 1QY7A 2CA9A 1DTQB 3O3LA 4QU7A 5IOLA 5D4PA 2DRAA 4ZP9A 1H6KX 3FGVA 1R0AA 2M70A 2QN6B 1Q53A 1SKRA 4BWJA 4AFFA 4UOGA 1B3TA 3OFHA 4YDXA 2PC6A 3I87A 4TLQA 1ZAXA 1M1GA 2LQ5A 4CO0A 1TV6A 3QO9A 1JIHA 2VICA 2PE8A 3EE3A 2V2ZA 4KC5A 4F26A 4TY8A 3R2CJ 1KHWA 3O6QA 1TVRA 4DR4F 3UO0A 5JVGQ 1NKCA 1VMBA 1JXEA 1OPZA 2HS0A 2HBYB 1IBLF 2B4UA 5IS2A 2VPWB 4XPEA 2LU2A 2C2OB 2ZH8A 4J37A 4ZVFA 3V6KA 5LM7E 5B0FA 4FF4A 2A18A 2X1AA 4DL4A 1ZA1B 1HNIA 3CD0A 3JSYA 4NYZA 4O3QA 3MWBA 2HGNA 3ULHA 2NXNA 3R1LA 4F0HA 3W65A 1Q1KA 3JQMA 3VAIA 1NAQA 3PZPA 1SKWA 3HLUA 4NLTA 2FVQA 1T05B 2V9WA 4Y6IA 4X65J 2KB2A 2OPPA 3EICA 3M2UB 3M8QB 2HBZB 3I9V9 1FKPB 1FK9A 5CABA 2J0WA 2CPIA 1HHQA 2IDLA 4IO1A 3S1TA 2GIRA 4W98A 3HSJA 3M4XA 3W62A 5CXTA 4Z7YA 2JEJA 2VFUA 4KV8B 4NOHA 1UWBA 4GKJJ 4MIAA 5M2UA 1KONA 2V6AA 4DQIA 2H1YA 3LOUA 1S0OA 3KNAA 4K0KJ 4I6WA 2KFZA 3FBCA 4NA1A 4UF4A 4CO3A 2QV6A 1AUDA 1MSWD 4N76A 4HKQA 2ZE2B 4AT1B 5DDQC 3NY0A 1NNDA 1NHKL 3CJ4A 1Z1ZA 4QJVA 3SBMA 4CWBA 4EGLA 5CYJA 3MM7B 4LFAF 2E5GA 2KZMA 2K06A 1KN6A 2J5AA 1NJXA 1YX2A 1IM4A 4RBUA 3FMWA 3JAMY 3S8SA 3KLGB 4DR7J 3M6XA 4LQ9A 3I31A 1GMWD 1N34J 2BVZA 2NUUG 1KVJA 4URGA 1CJTA 3AHPA 4UQTA 2OEKA 4EWTA 4ZCLA 4M63A 4UY85 4M5JA 3TO8A 3KLGA 4DL6A 4ERDA 4OZ5A 2AW0A 3IR6B 3M2RA 4IFYB 2AX0A 5GAGI 3JS9A 3UWTA 2RU3A 1WC1A 4WE1A 1WTBA 1Q8BA 1KOOA 1UW4A 2E7WA 2FGOA 2NCKL 2W4PA 4RZRA 1S99A 2KXNB 2R2SA 4JI3F 3J7AN 2H9ZA 4ZPCA 3CC4S 3I0SA 3UQSA 4I4BA 2WONA 4DMZA 3UN5A 2JLFA 4KHPF 1N32F 2Z8QA 5H9EJ 2V8DA 4X4NA 4DR7F 3K5MA 1LWEB 2XLJA 3C19A 3PIOQ 1RACB 1WOPA 4TQSA 1Z4UA 3NBPB 4DV3F 2GMHA 8AT1B 1X4GA 4NLWA 4CRJA 5F8LA 3D1OA 4LF9J 3CCQS 1RTJB 1DQAA 1WORA 1MN9A 2BJ7A 4X66J 3N5BA 1KSPA 2M8DB 3ZTQA 3CD7A 2CQIA 1TVRB 5KFZA 1JLEA 3TRGA 3WIVA 4X4QA 2IJFA 1VQSA 2YVSA 3PM9A 2W24A 3LH2S 2VIHA 1K9MT 3G96A 3LGHA 5IC4B 3RB3A 4USHA 3OTEA 4L6V3 1AT1B 5CYQB 4DHVA 1LXNA 4H4KC 4LF4F 3TR5A 5E41A 5F0UA 4K59A 2A1BA 1YJ7A 4LJMA 1RBOB 1YGYA 4X4UA 2X1BA 2BANA 4ED8A 4X66F 1X9MA 1RT2A 4KPYA 3B54A 3CWJA 3DRPA 3MAQA 1N0UA 1PC4A 4RUBA 4JI2F 2J6TA 3AD8C 1D3WA 1DJ0A 1TZ0A 1YDLA 3KJFB 4P52A 4LF5J 1IBCB 4B9TA 4JI1F 3QJJA 2AJQA 3VTIA 4AXIA 2VQEF 2ZUAA 2QZ8A 1U0HA 4AQYJ 3FK4A 3W5YA 4PG8A 1FRJA 2RJZA 3FSYA 4ZPAA 2HHWA 1OQ3A 2KU7A 3I0SB 2KI2A 1Y3KA 1RB0A 2CPZA 5D0HA 4C11A 4YEAA 5B0CA 2Y8WA 1S9GA 4CLTA 5B08A 1WWHA 2MGZA 2DR8A 3CO9A 4G1QB 2GGPA 2PN6A 2IFXA 3DI6B 2QL9B 2F40A 3NWRA 5LMNF 2EFPA 2ERRA 4WPAA 4FKYA 1S9GB 1KQFB 4J7CA 1LXJA 3ICLA 2HHHJ 2HSEB 1KP6A 2XY6A 4ZHRA 2RS2A 2YBVA 1KEKA 4YMEA 4RUCA 5JVHQ 2OO4A 1S7HA 1T11A 2QFIA 2FC8A 3MI7X 3MHYA 3MM5B 2W7PA 2BOPA 1YKWA 2JL9A 2DGTA 4H4MB 1X60A 2ZBPA 2F8MA 3B8HA 3D4JA 4RW8B 3CNQP 3MDFA 4ED4A 3AD7C 2J0QD 4KY3A 5J2MB 3BSCA 2WSEC 1EARA 4BC7A 1LWCA 2KYZA 1TP7A 2BE2B 4DPXA 2DGWA 4C2MA 3QJPA 4F0KA 1VQYA 2OKQA 2YQ3A 2Z57B 2BKOA 2MQLA 1U47A 4QIFA 2HVEA 3EPIA 1PAUB 1WHWA 2YWKA 3A13A 2NPIA 2VHGA 2IMOA 2XMJA 4PRFA 5KFPA 2HVZA 2CQCA 2ZC4A 1RQ0A 3JB9k 5C2CA 1WHYA 1Y3JA 1GXUA 2C2NA 3PW2A 3DOKA 1G1XA 1ZS6A 4Y28C 1UJ5A 2FJVA 4M5DB 2GJIA 2MLXA 3NKYA 5LMUF 1NSKL 3VCDA 1GMUA 2CJ9A 2ZZNA 2BQ3A 3IO1A 2BEFA 4HHJA 2EFGA 4QYZK 2R7TA 1ZETA 2HK2A 2DXDA 4GKKJ 3KYLA 1HKAA 1RAJA 1YK9A 4M5DA 4YQWA 2G2YA 5AE2A 1U09A 1UP1A 4QPTA 5DGBA 4K4XA 4ECUA 2UVUA 1K0TA 2EK6A 4ZVGA 4X2BA 2HHXA 3V6HA 2D9PA 1JJHA 3SYZA 1QUPA 4ANDA 2UVRA 4J90A 1N6QA 2NXJA 1RI7A 1FFGB 3A1YG 5E2QA 3T19A 5DETA 3I55S 1REVB 4MIBA 2HWTA 1OJ4A 1RADB 1VQ9S 4YOEA 2XB2D 2M4MA 4QIEA 2H3EB 2ZZMA 4FXVA 1RWPB 3LP2B 1KFDA 3PX0A 2ZD1B 2ZH6A 4OI0A 1GK8A 1J2VA 3OXGA 1RTZA 3M32B 1SUQA 1LV5A 4DG1A 4M1KA 1S0NA 4OJHA 4JI4J 1WC0A 1C2PA 2BM1A 2MKSA 3N6MA 2JHEA 1N8RT 2NXCA 3BGFA 3CGIA 3M6UA 1TUGB 1ICEB 2L9DA 2ZWPA 4URSA 1QM9A 4DV5J 4PPZA 1RT4A 2E5HA 2N4DA 3D66A 1FX2A 3OXLA 3OTOJ 3OLBA 1RWOB 2HQ3A 4LFCF 1TELA 2BXJA 3BKTA 2W7OA 1RCOB 5KT2A 3JQJA 2HYIB 3KJNB 1O5JA 2ZKTA 3ZZTA 3PYEA 3MPUB 2XWXA 3DOLB 1NLKL 4JI0J 2C3MA 5KFAA 5GAEU 3HCXA 3UN2A 1GH8A 1VRUA 5ETOA 4PXCA 5A8RA 3UD4P 3BGUA 1VIXA 3SSSA 4CI0B 2CZVC 2OPPB 3M8QA 2E7XA 1HNXF 2HNZA 5LJ3Y 1AFJA 5F0WA 4OHXA 1HQ2A 1S1WB 3GWCA 5SUHA 3F41A 3ZTOA 2VJVA 3VAFA 3V4IA 4ILRA 3FKBA 1NSQA 2RQKA 3P96A 1NO8A 5C24A 5E3CA 4G1PA 5GAHI 2XI2A 1S1WA 1JK9B 2LDYA 2DR5A 3D1HA 3KLHB 1N5YB 3CULA 4WFZA 2E5IA 1C4CA 1HD0A 1S6PA 1TL1B 2UZAA 3AJ1A 2X3GA 2KT5A 3ITHB 4HH1A 1SJ3P 1CC8A 4LF7J 3MPYA 3I5BA 2XMUA 3N79A 1GFWB 2DYAA 4FNIA 1BLUA 4IOBA 1GXTA 1MWYA 2F65A 2G0IA 3ZZUA 4K4YA 2M88A 4CM0A 1YBAA 1WELA 2J6SA 1L3UA 3TQEA 1VK8A 3KDNA 2LVWA 3B6BA 3T1AA 5F41A 3QPIA 2E9RX 3KOAA 4KYZA 4JUZA 1LW2B 3QGHA 2OLWA 4RNHA 4F3MA 4Y2MA 4F2SA 4DS4A 1JLAA 6FD1A 1NMEB 4WFXA 3VQSA 1IKVA 2IHR1 4RKUC 3W9HA 5F8MA 5KFQA 2ZH3A 3DOMA 2WTFA 4DR6F 1KVIA 4KFBA 1KQGB 1H2TZ 3BYRA 3C16B 3FFIA 3OFGA 3R5JB 4M5GA 5T7LA 3VZHA 4PXEA 4FVCA 5K9FA 1IKVB 1F0XA 1RT3A 4F4WA 2CWKA 2CQBA 3I56S 4JYAF 4DI6A 1JWWA 4DV2F 2JEGA 3K89A 5ETQA 4K4WA 3ADAC 4CLLA 2AF6A 4USIA 2PMWA 1JLGA 4L3KA 5IWAF 2PI4A 1NRKA 1TK8A 3RU0A 4ED2A 2IJNA 1XC9A 1T03A 3V2UC 1I94J 4O3SA 3DLJA 5E7OB 3W8PA 3Q23A 4CO5A 4B9MA 4DSKA 1PIEA 2AX1A 3X1LB 3RRHA 4KGXB 1UZDA 1YRUA 2CADA 4AYBD 2B9WA 2MJNA 4J9LA 3OTDA 4NRUA 1MROB 4H4MA 3OW2R 3LA0A 4EO6A 1XMOJ 4U7UK 2YX7A 1SQFA 1FD2A 2NREA 2MHNA 2Y3YA 4KAIA 3PNIA 1FFSB 3V4MA 2VBWA 2MKCA 5GVQA 4DV1F 2IAJA 2UUAJ 1FJEB 3Q8QB 1FO1A 2LKZA 3M6VA 2OJ3A 4X4RA 1QDUB 1EQMA 3BGOP 4ZIVA 2XBPA 3AD9C 1TUVA 4OLPA 4U7UD 4LRFA 3P45B 1WG1A 1NJYA 2CPDA 4FYYB 2GA7A 4OYWA 5CD4H 1SJFA 4A8FA 4PG4A 4NXNJ 1PYOB 1IXKA 1HR0F 4Z2XA 2EEYA 1RWVB 2GIFA 3U02A 2HFVA 3MOJB 1JKHB 3VGTA 4MJKA 1RLDA 2VH7A 1REVA 2M0GB 3QRQA 4F04B 1XR7A 2C42A 1Q0NA 3GSDA 4ZVOB 2VASA 2QA4S 3HHKA 2DR9A 3TJ8A 3VZIA 2DEIA 1HBMB 1DQ8A 3DXSX 3P3DA 5IQQA 3K8VA 4HVZA 4I0WA 2ZM6J 5KFOA 1RUSA 5K14A 4ED7A 3D0GE 5CHCB 2IYIA 4HDHA 4AUKA 4LSLB 1U2RA 2K7KA 2VG5B 4L73A 3BO2A 4FF3A 1S77D 1QAYA 1KTVA 3CJRA 4EBEA 2CVIA 4X4PA 4DSFA 2AEMA 4HHHA 4RW9A 1W2IA 2P9EA 1RDRA 3VR1A 1UJ4A 2B4VA 4J9PA 2W8KA 7AT1B 2OTLS 4DFMA 5HVHA 3PRDA 4JI1J 3PKMA 2HHQA 4ICLB 1PAEX 3GIJA 2POKA 3MCSA 3ZZYA 4QYRA 2FJEB 3TI0A 1RT4B 2E5JA 3CCUS 1TV6B 2A3JA 2LP4A 3QO9B 1HWUA 4NCGA 1HNZF 1CVJA 1F9HA 4RUHA 2I8EA 2YTCA 3ET6A 3R97A 4DSJA 2I0XA 2LXUA 3MMAA 5AT1B 3HVTB 5CQGA 4MK9A 5HK4A 3CSKA 4FYDA 4IR1A 4AXJA 3PEJA 2CPEA 2O5DA 3B4DA 4A8OA 1KD1T 1FKPA 1VHIA 2D41A 1N48A 1N4LA 1UVJA 2FGCA 1IKYA 2GC8A 3L7OA 3TUZC 3T1YF 2AT1B 5KG5A 1YG0A 2I5JB 1NZ8A 2CNLB 4RW8A 4MIWA 4J9KA 1RGVA 3HFKA 4Q0BB 1N33J 3MMJA 1CULB 1HNIB 2HEKA 5IT9U 5CYMB 4R8UB 1PBAA 5AXNA 2D74B 2JFDA 2EKYA 4PG6A 5IQ6A 2UXDF 1TTHB 2I6WA 2CPFA 2FUG9 5DM7Q 2DH9A 3H98A 2BKPA 3OQ2A 1HBNA 2E1RA 2V8PA 3QNWB 3ZZPA 1KTQA 1R6YA 1RCXB 3IR7B 1R43A 3AODA 4ZLLA 4HR2A 4UOHA 1IBMJ 4LF6J 4K4UA 1JLFA 5F8JA 3CD5A 1HBMA 3SV4A 4NZ0A 4B9UA 2RKIA 2J8AA 3KDOA 4NI2B 1VJQA 3MM9B 4PEOA 1NK7A 1HI1A 1EAYC 4RL1A 3BEGB 4PQUA 1U6ZA 5LMNJ 4FS1A 3QIDA 5KFKA 2KN4A 4P2SA 1UVNA 1H2UX 2DIVA 2MZJA 3PFEA 2WVFA 3HT0A 3CMAS 5KG3A 2LXFA 4UQGA 2ADCA 3WC2A 2ROGA 3L7PA 8RUCA 3UPFA 2C28A 1RT5B 4NLPA 4F3OA 1FI4A 2QLWA 1SV5A 2AP6A 1W2BR 1ITPA 1KRPA 2P8IA 3H20A 1J5EF 2UXBJ 2DGXA 4IR9A 2YQ1A 5HQMA 3TAQA 1KFSA 5T41A 3BJYA 2R42A 4UOCA 2C2ZB 5FJ4A 2I2YA 3VGUA 4ANCA 2ZUGA 1KOHA 2BZ2A 1FEHA 3CJTA 2VQFF 3CW2C 4ZDNA 1HYSA 2LYVA 2ACMA 3DMJB 5GMEA 4DWIA 4DS5A 1S76D 1A9NB 4ITSA 2DXEA 3QT7A 4ECTA 1F9FA 5L1KA 2HHSA 1NEEA 3PTWA 1TAQA 2U1AA 2NXEA 1HARA 1NZAA 2GO8A 3D9BA 4MT1A 1FE4A 5A8RB 1D8YA 3D0IE 4BBYA 4ZN1A 4LRDA 5A8KA 3LP1B 4ECRA 3K5OA 4P10A 2MKKA 5L1IA 4PR6A 4ZVQB 1TKDA 1S49A 4B3SJ 1K1QA 1KLMB 4Z37A 1FEEA 2DB1A 3CEDA 5LXYA 3RAXA 3RR8A 4DLGA 2B7CB 2AZ1A 1MWQA 3HF5A 3MPWA 3F56A 2N7CA 4I2PA 1FTRA 2AGPA 3SQGB 5KFGA 4JI5F 1QLNA 5IT9Y 4CLFA 3ILLA 5KG6A 1GQEA 1F9EB 4HTJA 4HACB 4MMOA 2ZHAA 3KUEA 3HVWA 5J2PB 5J1PA 1XR6A 2BW2A 4KPCA 1M1HA 2Z30B 5E3PA 1HD1A 5THWA 5KG0A 2VB6A 2O67A 2AV5A 1S6UA 2DY9A 5GMDA 4IRKA 2E9TA 2JVOA 2QA1A 3AH6A 3MCMA 2UXBF 4DL5A 1LOUA 4Q43A 2DGOA 3GFHA 2OPSB 2W01A 2GO9A 4MAKA 5HJYA 2HS4A 5HMXA 1FKAF 3NGRA 3ZXWA 2HZVA 2UUCJ 5EUHA 4DV5F 5DLFA 4NLOA 2G1DA 4WU3A 1TL7A 1V3RA 2ZITA 3G82A 4U9RA 5HAOA 1LW2A 1UKUA 1IQZA 2LQ9A 4ALZA 2APOA 4HI1A 3SEOA 3FBBA 3W9IA 3DMJA 4H54A 2LECA 1RABB 4E98A 1K0VA 2D7SA 2FHKA 3E01A 4M5KA 2UUBJ 1BMQB 2DNRA 4PQAA 2F63A 4CO2A 3QSYB 2H48B 2EBGA 2MQMA 3FZBA 1U1OA 1T3NA 3OTCA 1EETA 1WACA 4TU7A 3EDRB 1U1KA 3CJ2A 4B02A 1NB7A 2ZJPQ 4LFAJ 1YHQS 3KMQA 1FRMA 1B7FA 3J81U 3OL7A 2RHSB 3OR2A 2P6TA 1RT5A 5G0RA 5K8MA 3H5SA 1R0AB 5KT6A 1HR0J 1IQTA 4OL8A 1IKXB 4N56A 2FY1A 2BJ3A 3UFCX 2K2PA 1RJJA 1TKZB 2J0XA 4O44A 1AB8A 5LXRA 1VQPS 4IFVA 4F50A 1IR0A 1T9TA 4G6VB 1GX6A 1SC4B 4OYPA 3IBCB 4URQU 4QBUA 1YJWS 2C2KB 1VHFA 2MDAA 3SQGA 5J2QA 3SQOP 1Q5VA 2C1EB 4NYPA 4PKDB 4DV4J 5D3GB 4JI8J 4YDDB 4AL5A 1KWMA 1ZZNA 1PO6A 2QO3A 2KHDA 2QFJA 4ZP8A 1N52B 3OVAA 4OMFG 3EGVA 4NCBA 1YWXA 2DEJA 2MKHA 2O1PA 2VG6B 2ZBCA 4NLRA 4RO0A 3ZNUA 1IBMF 2Y9HA 3G8QA 3N0VA 4PUOA 4IO9Q 2QMUB 3KK2A 2XZTB 1ZA2B 2V67A 3ETMA 2NYHA 4Q44A 3W1YC 5A0YB 5I42B 2QLBB 2XNQA 1JQGA 2YNGB 3BN7A 4YHHJ 3QRRA 5AXMA 4P71A 3HO1A 2B4OA 2VBYA 2AEJA 3B78A 1CJKA 2MTLA 1VBZA 1K73T 1CSJA 3W66A 4U96A 4ATNA 2KKHA 3DRPB 3EGZA 1TMJA 3ILJA 4J5OA 4RPFA 1TFYA 2RKIB 3CCJS 2MKJA 1B4SA 3L7UA 2OPRB 2RRBA 5IM0A 5HQ8A 2KM8B 2BJDA 4DU8A 2H54B 2J8SA 4H4OB 4NPOA 1U1QA 2RRNA 1Q5YA 1RT7A 2VKRA 3DLEB 4KH1B 3FQLA 5C25A 2L41A 3K5LA 2J7WA 4LR9A 5IZHA 1VC0A 1WC4A 1I5OB 3AQPA 1S1VB 2QYGA 4J91A 5K8NA 2K8GA 2XY5A 2RAQA 3BBFA 2VV5A 3C15B 2OFHX 1H0HB 4LT6A 2BM0A 5AJ3F 3HP6A 4DSLA 1DARA 1O51A 2DY1A 3HHLD 5SZTA 3BGLA 3E01B 2FHJD 4HI2A 2GQQA 3I0RA 1S48A 1T0TV 3KLIB 5EDWA 2ZH7A 3N4WA 1Q8LA 4B3MJ 4NXMJ 3BDEA 1IKWB 2NZ4A 2HIYA 3CCTA 4OJ3A 1BUXA 1DURA 2MMYA 3MMCB 5HJXA 3TUPA 2DO0A 3G4SS 3QWUA 5HO4A 3TX8A 4KQZA 2D69A 4DV0J 5K8OA 5E3RA 3MEGA 2GNKA 4OJ1A 4IDKA 5K14B 3HXMA 2VG7B 4DZ6A 1K47A 1X4AA 3RGIA 4KGMA 3TANA 1HNWF 1XQIA 2XSFA 1V6HA 4NWBA 5A8WB 3SI8A 2DPJA 1UW9A 1PBUA 3Q86A 3CO0P 2N3OA 1Q79A 2IVFB 2QJ3A 4YR3A 2XYPB 1JLBA 1U1NA 2DPIA 3IBFB 4LF4J 4ES3A 5D4OA 3M8RA 2K1RB 3QBCA 4E8UA 3CXCR 4LVNP 4ZITA 2G1HA 1N5SA 2IVMA 3AXKA 3E3XA 3MM5A 3OFEA 4OI6A 5KT4A 2DHXA 5FDLA 2PO4A 1ZYQA 4B3SF 2IY5B 2WOMB 1U1RA 3D3CJ 2XY7A 2AYBA 1XMBA 4B9LA 2PFFB 3OD2A 3T9NA 3OV7A 2LDIA 2C3PA 1TL4A 4O0IA 3GIIA 4ZP6A 4EI2A 2MXYA 2VBZA 3PO4A 1P1LA 2G0CA 1CPZA 4OV6A 3V6JA 2XS2A 4DL0C 4RW4A 1GX5A 1EQ0A 1SC1B 4NX9A 4TN2A 2LMIA 3H0PA 1FRLA 3DYAB 3QLHB 4XK8C 4NLSA 5HVFA 1FDNA 1X4BA 1CULA 3GG1A 3PW0A 2NR0A 1AUSL 1HBUA 2UVWA 3HD2A 2SXLA 3ITHA 2JX2A 2VU5A 1RLCL 2VC0A 1D1UA 4QU6A 3A3NB 2PEHA 3P5BP 1YLXA 5AE3A 2H4WB 3KJVB 4FYWB 3KLHA 2FZGB 1VI7A 1BWVA 1XR5A 4ECVA 1S72S 2HHVA 2VKZG 1FA0A 2ZH2A 3NCQA 1QJHA 1H98A 2XULA 2E5LF 3U27A 4JV1A 1P9QC 3A8IA 3EXCX 4FPIA 2KXFA 5HVGA 4RX6A 3GB0A 1UFKA 2D3UA 2HLUA 3CJSA 3P4UB 1SC6A 1R8CA 4WP3A 4KGVB 4V1Ak 4KHRA 1M1KT 4TU9A 2CZ9A 1EKSA 4YP3A 2UUAF 2QA2A 1MWZA 4AD6A 4OZJA 3JAMU 2Z2YB 3FVYA 3GJRB 4X65F 5EWEA 2YKNA 3E8OA 3B4MA 2Q6CA 2VPYB 4EYHB 3BDPA 1JNZB 1XIQA 4B9VA 2RNEA 3R6LB 4GVBA 1YIJS 2EG2A 1PGZA 3TQ1A 3EM1A 4GO7X 3HPOA 1S97A 2FDNA 1QE1A 3MFIA 2BW7A 2HZAA 3Q8VA 1Y5NB 2YX4A 4WCEQ 1N54B 2GS8A 4CT8A 1MROA 4Q8FA 3IMQJ 1ACMB 2LU1A 3MEEA 1YZ6A 2R7XA 3EYZA 2UXDJ 2YNIB 2VZ9A 3HULA 3EJMA 4NLDA 4AE5A 4QW8A 5L1JA 2Q1LA 4OYAA 4M95A 1OY8A 1XTZA 2BE9B 4HACA 1S5ZA 2R8IA 2QIFA 2CG4A 4HL9A 3PYDA 2WAQD 3P49B 1QTNB 2C3UA 1U02A 1IVZA 4MK7A 2UUTA 4DL3A 1W25A 3BBCA 2RU9A 4KT0C 3ETOA 5GAEI 1IR2A 2KXHA 1NK4A 2GHVC 4CM2A 1VDHA 1X5OA 2W2NP 4JV5F 5G4DA 2AJ0A 4MKVA 3QJLA 2XSJB 4C98A 4B08A 1HNZJ 2E1CA 2IJRA 3MCOA 1CS4B 3D2WA 2BYCA 1HNXJ 1RTHA 3N6NA 2O3DA 3HDSA 2BJEA 5KFWA 3N01A 3UNGC 2OI2A 2WVDA 5KFXA 2E1PA 4USJC 4OYIA 3LGNA 2HNZB 4BC9A 2C2DA 1VOMA 3A12A 5GAGU 2VOPA 2XI3A 1AZSB 3G86A 3QLHA 4DX5A 4DFJA 1FNOA 2JJ4D 3Q8UA 3BQ0A 5HN0A 1HQEA 5B7WA 4FVMA 4QQBA 3EDQB 3W8GA 4I68A 2KJVA 4JP8A 3ZTSA 4WKYA 3VAMA 1PKUA 3M32A 5E3AA 1HYSB 2IM3A 1VYAA 4B3MF 2V4JB 3J7Z5 1F3VA 3SDEB 4O44B 2ASJA 1QSLA 1F2GA 5ETSA 1RKIA 3PR4A 4C11B 2V34A 2ZNYA 4JV0A 1TU0B 1LEOA 2BV3A 2RIJA 2O01C 4JI7F 1WUUA 3SFGA 4ZJLA 3DRRB 4RW7B 2GVDB 3FFIB 1IN0A 1P9YA 2CG8A 3KG0A 1XWLA 3VALA 2CJYB 1VQNS 2CQ3A 1SJ4P 1F6TA 1FVQA 3IG1B 4ZVHA 4B9SA 3SCIE 1JXVA 5ITHA 1OSCA 3GCWP 2B4PA 4Y00A 3FNNA 1S7IA 3TEHB 3PACA 4OYXA 3VAGA 4F4YA 3BGRB 3BN4A 4TY8B 5L9NA 2Y0SD 4A8XA 2OPQB 2HZCA 4I6YA 3DXBA 3PHTA 5JXSA 3I96A 3VQTA 4PG7A 5CAAA 3H40A 3G6YA 1M5PC 2Q6BA 4CTAA 4JBCA 1RHQB 3M30A 3C3LA 2R7SA 1SJRA 1CBKA 4DQPA 1YZ7A 3OTOF 2J6UA 1KC8T 1W7WA 3QIPA 2CPYA 1PJ6A 4ZPWR 5HANA 2QRRA 4A47A 4X64J 5CCLA 4GKKF 2QL7B 2WVEA 1WDTA 3NCRA 4CNZA 3CDEA 3GFZA 2KRRA 3MD1A 1VISA 1QVGR 1VR6A 2J76E 1IWAA 3H7HB 3HFVA 4HYKA 3I82A 1I3OB 2FLLA 1VQKS 2WZ1A 3MGJA 2OPSA 3D5MA 3BKFA 5CCMA 1HWJA 3CCES 1IBKF 2JSXA 4C8YA 4F4KA 4CH1A 2BABA 2UVVA 1HBOA 2CPXA 2ZJQQ 3D3BJ 2X3DA 3M2VA 5KG4A 4I2QA 1O6XA 3US5A 2GJFA 2KVIA 4ZLPA 3OL6A 1FWPA 2V2KA 2MQQA 1G4CA 2BJ9A 3NL0A 4L76A 1WSVA 2VF3A 2R7OA 1GAOA 3EGWB 4ZPTR 2IBKA 1UVLA 4R25A 1X5PA 3HM9A 2VFTA 2VFRA 2E5LJ 1RAHB 1ZM9A 3DKDA 1SI9A 1NPKA 1T3OA 4IYQA 3R5GA 2RQMA 2XMMA 4UOFA 4WJBA 3GONA 4LF8J 1F5CA 1V5VA 4LFCJ 3OXFA 5HLFA 4DCOB 4X62F 2KFYA 1S4EA 1V5IB 2EW9A 1N6QB 1ZTTA 3LPYA 2K3IA 1R7IA 1FDDA 3TWZA 2M52A 2HGMA 3AOAA 4OX9J 1URRA 1R6VA 3RG6A 4CNYA 3M8PB 2QE5A 3A3OB 2KT3A 4A8MP 5DG7A 4KJIA 3OUYB 2JC0A 2VG5A 2H51B 3F73A 2GAHC 1HWKA 2DNOA 3RBEA 2IMWP 2ASYA 2ZHOA 2UU9F 4DR3J 3I4HX 1T7PA 2X1FA 5HMZA 5L8RC 4QOTA 1M0SA 1B7YB 2GQCA 3M8YA 2OD6A 3H8YA 3P5TL 3TVZA 2PI5A 4CLYA 2ZH1A 1KNZA 1WF1A 3BPSP 4M5LA 7FDRA 3CC7S 2KRBA 3D6TB 5DG8A 5B0DA 3DC2A 4AQYF 1DY3A 2O66A 2QMXA 3C6UA 2LEPA 2RVJA 4A8YA 3MEDB 2A6OA 3DU5A 3FSXA 3MECB 3A8JA 4HT5A 2WB1D 3UD5A 4V19X 2CJBA 2YKOA 3MMCA 1TKXA 2RHQB 3CC2S 1Z2LA 3W7BA 1RAFB 2YWHA 5L38A 2C22A 3GR1A 4I1TA 2HK3A 2VG7A 4F7VA 1K8AT 2ZZTA 3UCGA 2YKPA 1KLNA 1N0VC 5L39A 3WQPA 2HHHF 2N4CA 4PPDA 2EC0A 4LIWA 4NLUA 1R8HA 2XQCA 1Y00A 3DYAA 5D77A 1KQKA 3JXOA 1F5AA 3S01A 1IWGA 3CCVS 4DV3J 1Q81T 4WKRA 3POTB 3L3CA 8ATCB 4WFAQ 1P1TA 4ED3A 1XNRJ 2XSJA 1U0SA 4CLZA 1YBUA 4TQRA 2YWGA 3RZAA 1WD6A 2FZKB 2MHEA 4TLRA 3J7YI 2R7RA 4B3RJ 1N33F 1I6JA 2WW8A 2QMWA 3Q89A 5AJ3J 3GU0A 2I5JA 4MYUA 1GXLA 2GHPA 3BR8A 2ZFHA 4CP5A 4WIIA 5E3QA 3GV8B 2Z58B 2HAFA 5IT4A 4DR3F 3UE2A 1NK0A 1CJKB 2V2QA 1QAIA 4EUVA 3R5BA 1GTHA 1QUVA 1FERA 2ZC3A 5M2RA 1N34F 2EVZA 1RAIB 2H5EA 4J9VA 2RDJA 3PX6A 1MU2A 1UVKA 2MSTA 3GLJA 4L75A 3TX0A 4YY3J 4LFBF 4WU2A 4IFYA 5EN1A 2AD9A 4ED1A 2V50A 2ZD1A 3N6LA 5CZVA 1CJUA 1B0TA 5ETLA 2FPHX 2HFUA 2VPXB 3BKUA 4KKOB 4NZ7A 3HHEA 3MEKA 2ZJRQ 3PW7A 3T41A 3DHXA 2XS7A 2KFNA 2OELA 3MCNA 4K8RA 4ZMMA 3BSNA 2PSZA 3CTRA 3G71S 1WDDA 3CPWR 4M5NA 1L5UA 4TNOA 2KYXA 4IG3B 2RS8A 1JLAB 2A6MA 2HFNA 2WK4A 1FDAA 3EMTA 4N8NA 2OSQA 3Q2SC 5C42B 3HFZB 2RRAA 2R8KA 2IA0A 3UVJA 3H2LA 2QYCA 3PJXA 1UZHA 4YY3F 1IM6A 2ILZA 1X4CA 3MTJA 1AXQA 3KK3B 4DR2F 2CQ2A 1OMSA 1X4FA 4DN0A 3G6VA 1U48A 2V2VA 5DG9A 2ZH4A 4WP9A 3ZZRA 1U8WA 2CQGA 4IQXA 1OS5A 3RJMB 2DHGA 4LF1A 3TAMB 2N82B 2FVRA 1LWFB 4WZQA 4PZVA 1A0OB 3H4BA 4AL6A 3DOKB 3FRYA 4J9OA 1WEZA 1N32J 4LBPA 1BQNB 1FKOB 1RT1B 4WP8A 3KG1A 4WWSA 4BWMA 3W2WA 1NXIA 2W7AA 4RJVA 4I6AA 5K8PA 3T9ZA 4WZMA 2RB7A 5IWAJ 3K17A 1AA1B 2DNYA 3FEYB 3NGSA 2LCWA 2YPYA 4KH0B 2CFXA 4DPWA 1ZM2A 2KHCA 3BQ1A 1RISA 4OYMA 4CYUA 2N7YA 3M2UA 2YKAA 5D0RA 2MEWA 1WEXA 3MM7A 5A6PA 1F5BA 1UEKA 4QWCA 4HEA9 5KFMA 4M94A 4P7VA 2UUBF 3K7RA 1NB2A 3KXDA 4DBQA 1KQSR 2FVCA 2KG1A 4I56A 2QLXA 2AU0A 2KH9A 1DZ5A 4OZ1A 4DUTA 3TW0A 1C1BA 3PRVA 1RWUA 4JI3J 2A2CA 4LSNB 2MLZA 2UV8G 3EUNA 3P8BB 1KBRA 3D1QA 4CH0S 2DXFA 2RDDA 1N5VA 3A8EA 3HSDA 2XM3A 3H25A 3CCMS 4DV2J 3OL9A 2B8PA 2DGQA 2B8QA 2MJUA 2XMVA 2AWZA 2Q66A 3CJ5A 3TAPA 3OLAA 1TK5A 4ID5A 5G0RB 3MUTP 3RW6A 2FLPA 2FY8A 4DCJB 1QAJA 2DH7A 1LWEA 4B9NA 3RBZA 1VLOA 1NCLA 2DTJA 3I5CA 1S0MA 2JWNA 3CDWA 5D4LA 1T94A 4ID5B 4IFVB 4ZVTB 5AXLA 4ZKAA 1S79A 1S1XB 4QZVB 4ECZA 3T1HF 1I1GA 4K2XA 3UDLA 4F8RA 2R4FA 4KRWA 2HW3A 1Q8IA 3GZ7A 2EK1A 3ENVA 2YWWA 5BYSA 2FVSA 1MMDA 4C9DA 3SMZA 1RE1B 5IXUA 4ECSA 3LP1A 3F0NA 4X64F 2W2QP 1GEHA 2DCUB 1UETA 3QMQA 4IDKB 4NA3A 1EETB 4O3NA 2XLIA 1CEZA 2L9NA 3U1MA 5I3UA 3ISND 3GIMA 4PABA 2PD1A 4A46A 3RTVA 4A8WA 4MK8A 4DV6F 4EBDA 1JLQA 3IM8A 4N7TA 1NSPA 3NOGA 2V8VA 3BSAA 3R5CA 4R0EA 4B3OA 4OYBA 1FX4A 5A8KB 5LSOA 2B6AB 2CAJA 2OFGX 3LO3A 1WSRA 2E1MC 1XMQF 2C3YA 2ROEA 4P2XA 5L9XA 1LNQA 3I32A 4JB8B 3V4IB 1SKSA 1BQMA 3Q22A 3RBXA 2VUGA 1SC3B 2W2PP 4W4MA 4J9MA 2MQNA 3FBFA 3HKZD 4NMLA 4X4OA 4X4SA 2Y1JA 1BQNA 1FKOA 1SVDA 2ATCB 2OGUA 1IUJA 3H59A 4FNHA 2CRLA 4QIGA 4EO8A 4CYUB 4LVOP 4DEZA 3TZYA 1DQ9A 3NAHA 2OPRA 5IM0B 2M2BA 2QC3A 3KHHA 1HQEB 2RQ4A 1EZZB 1Q8KA 1KS2A 1RXOB 2YWFA 2ZDOA 1JJCB 2CPJA 2L9WA 2Y0BB 2Z2LA 1I94F 4LF8F 1PSDA 2CDQA 2D9OA 2RT3A 2ZWOA 1RYSA 3BH6B 4B3TJ 1M5OC 2BRLA 1NDKA 5E5NA 5KFSA 4K5RA 2V4QA 1WHXA 2JC1A 2JVRA 4Q0BA 2CNOB 5CD4A 4MH8A 3C66A 1HQUB 4JI6F 3VVTA 4PQUB 4K4ZA 4ZHRB 3M8ZA 1TL7B 3DGVA 3G82B 5DRKA 4RNNA 3RB4A 1RBAA 2FJXA 5KFIA 2ALYB 3W9JA 2CNKB 4IOCQ 4DR6J 2G2OA 3H4DA 3D0HE 4FS2A 2ZBRA 4Q2MA 3HSZA 1LK7A 2QG9B 2W2OP 4NA2A 2YX1A 3NS5A 2GX8A 3RRKA 3T5KA 2YNHB 1OY9A 2W25A 3O44A 3FSIA 3QAUA 4FZVA 4XDCA 1DTQA 1W26A 1J5OB 4PWDA 1TK0A 1VBXA 2DNMA 1FRHA 3CDUA 2L08A 3KG4A 1RWWB 4G1QA 3VV2B 4FP9A 2IYGA 5KFCA 1X5TA 1LKZA 3CJKB 1NJWA 1BE4A 4K4VA 4MYTA 4CLPA 2F5GA 3DLGA 3SSRA 4ZCMA 1ZOTA 3MEGB 1FJGF 1HPZA 2R2RA 1CJUB 3FZ2A 3LP0B 4KHMA 4M5HA 2CNNB 2IIHA 2OHDA 1TKZA 1CQNA 4ZP7A 2XWYA 3AAWB 4NL5A 3CCRS 5C5JA 1UPPA 2K3KA 3U1NA 2VFVA 2DVIA 7FD1A 4KTQA 3TAMA 2Z56B 3DRSA 3NNCA 3J81j 3MEEB 1FRXA 3DDNA 3RW7A 3I6PA 4GC6A 4DPYA 2HLTA 3FEXB 4CTAB 2YNIA 4JV2A 2OEMA 3BZQA 3MFHA 4OHZA 5CYMA 1UPMB 4R8UA 5MAOA 2CQHA 1M5SA 5KFLA 2LLZA 5CYQA 4A8SA 1WC3A 2WSFC 4B3OB 1VQMS 1MN7A 4P2MA 5BR8J 3M9MB 3DFEA 3M6WA 2YKMA 1HBNB 1TKXB 2B51A 2H4YB 3IS9A 4X84A 2NPFA 4FDFA 4ECWA 1QD1A 1Q7YT 1S6QB 2W1BA 2CKWA 5B0EA 2YH0A 1FESA 2HAIA 3N28A 4C8MA 1DAXA 2VL1A 3BO3A 2F4VF 3UDVA 1P27B 2MZRA 2AEFA 3T3FA 3LW5C 2GIQA 1X4DA 2Z2MA 5C25B 5EHHA 3WZ0A 2HHTA 2LXIA 1B64A 2F7VA 4OHYA 2UXCF 2FD2A 4E0DA 5BYQA 1WTFA 3KK1A 1N5QA 2MQOA 1BWEA 5K5MA 2MLYA 2IRXA 4LIRA 3DCAA 2FJAB 1U4BA 4FF2A 1HHTP 1E6VA 1ZAVA 3B82A 3FCHA 2OD4A 5LSLA 3D28A 2YXLA 1WKKA 3OBIA 1HA1A 3SDEA 2CZ4A 3DHWC 3TZZA 1XEZA 4CZCA 5LSRA 4FBUA 4O4RA 2RH3A 4PXDA 3W3SA 3MZIA 1WG5A 2VBXA 1JXLA 4QR1A 3LWMA 2E1AA 2D3O1 4RUAA 3EGNA 4B3TF 4DUYJ 1C4AA 2ASDA 5ETNA 2EPIA 3CUNA 2HPUA 3OR1A 3LALA 4NLQA 3D6FB 2DT9A 3FDSA 4P9SA 3ZNJ1 1T9XA 1EX8A 4TKTA 4DR5F 4DJBA 5DGAA 2G2ZA 2BUNA 4LBIA 4USUA 3DRXA 1X4EA 5FLXU 4B3RF 4RU9A 4DV6J 4Y2AA 4FKXA 5J2NB 1MMLA 4C8KA 1RT1A 2NYIA 3GMGA 4RU2A 3TJAA 2BR0A 1T9UA 2ABYA 1VS3A 4PG5A 3FC9A 1T9WA 1PCAA 1UVMA 3HK2A 2FHOB 4BS2A 5E33A 3MEDA 2UP1A 5DO2A 1EP4A 2PMZD 2W9BA 1V9OA 3PV8A 2WB4A 5FIIA 3M7VA 3J7ZT 3DLKA 4P73A 2OAUA 4KSEB 4WFNQ 4LREA 4ZCKA 3IWLA 4CIOA 4OV1A 2I1RA 2AJFE 1WHVA 3HZEA 3G6ES 1WKLA 2OSRA 4O3PA 4WYLA 3HVRA 2R8GA 4ECXA 4OJGA 4OZ2A 4C6AA 1D0EA 1HHSA 2HQGA 5F3ZA 5KFEA 4DLEA 2JH3A 2GAGC 2NUHA 3GCXP 5HLFB 4R0JA 3IA0A 1RHKB 3MM9A 2ROPA 2RUSA 1HFEL 4QIVA 1AZSA 1Q4RA 1YITS 3S7RA 3AQOA 1SL0A 4QIWD 1OWXA 2RILA 1TKTB 2HNDA 3IC1A 5FLXY 2BKNA 2F8HA 4ED6A 2P6SA 3W63A 4GRSA 1CJVB 2BDPA 5IV3A 3SCKE 3JSMB 4G65A 4OYZA 2AYMA 1RSCA 1OIAA 4Z7CA 3HI9A 1NPRA 1FWLA 2M5YA 3DLEA 3KHRA 2QT7A 1VJWA 4YR0A 2MZSA 4H4OA 2XEXA 2V68A 1MNEA 3AB4B 1VRTB 2HNYB 1U24A 1OSDA 2V4JA 4U8YA 2YPZA 4F36A 3T1HJ 1QSSA 3WDOA 1EB0A 2XCPA 4RNOA 3JSRA 1RYRA 3ZZZA 2ZVIA 2YKQA 2PIIA 4Q2LA 3R7NB 5D6GA 2DRBA 4QWAA 4XO0A 3W5XA 4I67A 4ILMA 4RW7A 3G8TA 5T7LB 2RD5C 3OR1B 2DO4A 1FVSA 3HKWA 2IM2A 4FYVB 1UEVA 3EX7B 3MD3A 1D09B 3MR7A 3PRBA 3PJ9A 4WE1B 3UI3A 3BB5A 3TUJC 4X4TA 3MR3A 3R2DJ 1RA7A 3UR3C 1RBLA 2CQDA 4DL2A 1XNQF 2XHCA 4RLEA 2G4BA 3J7A1 3NP5A 3POTA 4C3KA 3CCZA 5A2QU 2JEIA 4C97A 3TARA 3GFYA 1RAEB 2PFDA 5FD1A 2KDOA 5D3GA 4XAKA 2MPUA 5I3QA 2A2DA 4N47A 1Y0HA 4DZDA 5DQGA 1HI0P 5H9EK 1D8ZA 2JOQA 3QGPA 3J80Y 2FZCB 3V81A 4O3RA 1YBTA 3WIUA 5IT0A 5F8IA 5DZ7A 1IJFB 4JI8F 3V6DB 1RTHB 4CCHA 9ATCB 1EP4B 1RT2B 1PC5A 4LRAA 2J9CA 3PCOB 4EMDA 5JUMA 1G2EA 3SIPB 1JKHA 5F8GA 1FCAA 3ILOA 4DR2J 4OHVA 2HRYA 3CCSS 5KOWA 1JNRB 2E66A 3EZ5A 1JX4A 2ZOMA 1NJZA 4NI2A 4MFBB 3MMBA 2C2RA 3CIZA 2U2FA 4EBCA 1WNEA 4LFBJ 2FHJA 3PYGA 3GV7B 3ZO7A 3GIKA 4LUBA 4YS2A 3GYXB 4C0HA 4N41A 4C4WA 3U1LA 1NUEA 2IPOB 3W5ZA 1X8DA 5F8NA 2VODA 5HMWA 1JLCB 5KG7A 1ZTWA 2DJWA 2CJAA 3OSNA 3GV5B 1M5VC 4UUWA 4JV5J 2MY8A 2H5IB 1RWNB 2BMBA 1CJVA 1SH0A 2HFZA 3WC0A 3EPGA 1IJEB 4KHPJ 1U49A 4F02A 1U26A 3ISZA 3ZZOA 1JLCA 1UFWA 2GCFA 3OUYA 2OIHA 1RT7B 2OEJA 3AY0A 1XNRF 3LF0A 4IG0A 2B9EA 1EKRA 3KUGA 3M1VB 3UR0A 2ZH9A 3R3TA 1J27A 4YHHF 3RB0A 2P9GA 3ISNC 4RR5A 3CVKA 3BYPA 3DLGB 1B0VA 3OL8A 1URNA 3MPDA 3PDNA 3HX9A 3HVTA 1FE0A 3G87A 3N5FA 2WCXA 3NGTA 4KFBB 1SCJB 3JTPA 2Y1LB 1X0FA 3DLHA 3IM9A 5EX0A 4OX9F 1HMVB 2CWXA 3CE8A 4JI5J 3ENWA 2BBEA 2YKNB 4NEYA 1S1XA 5LL6d 1X7VA 2HHUA 5DJBA 4TY9A 3Q8PB 2FQQB 4R5PB 1R8PA 3C6TB 3PW5A 1HMVA 2WBRA 1B70B 4DSEA 3IP0A 2H65B 3IRWP 2ZEJA 3HHLA 2VOOA 1NHVA 1WKJA 3CB4A 3CJ3A 3MMAB 4DOZA 1FF2A 5HBMB 3T5HA 4PWWA 3PW4A 1VQ5S 2FJWA 4FYXB 2QSWA 4DPUA 1S0VA 1C1CA 4P2FA 3L4BC 1U8SA 5DLGA 1KR4A 2WSCC 4F4AA 4P74A 2DIUA 3Q8RB 2GQ2A 3UDEA 4IH5A 1FRIA 1ZH5A 2I38A
chains in the Genus database with same CATH topology
4OI3A 3IBWA 3W2VA 3V5RA 3KLVA 2DNPA 4KV8A 3IGNA 2CQ4A 3MM8B 3W2WB 2BQUA 1AFIA 1YTYA 3OJSA 3Q2TC 2K7JA 2C2EA 4QPXA 1FK9B 2GMJA 5HROA 3QWPA 3TOQA 2COLA 5LJ5Y 1RT6B 1JJ2R 3O2IA 2ZVSA 1S6PB 3H2UB 1UA1A 5HMYA 2QEXS 2DGSA 3DLKB 2WHOA 1RKJA 4C8OA 5HROB 2EWHA 4FXWA 3OHAA 4OFZA 5DQHA 2AYEA 3HVAA 3K59A 1XK8A 1S6QA 2RMLA 2W9CB 2RDIA 1YJRA 1VQ7S 3M9NB 3OFFA 4LF5F 3ONQA 4IH6A 4ED5A 3I0RB 2YNHA 3O5TB 2DGUA 3LQVA 3OR2B 1SQEA 2Z4PA 3I5AA 4PCQA 1V3ZA 5F3TA 4KE5A 1OO0B 1C0TB 2OP5A 3KFWX 3VF0B 3HT3A 4CH7A 2MSSA 1RA6A 4C3MA 3NS6A 2VONA 2DD8S 4PWUA 3VWSA 5CZXA 4K0KF 3H2VE 1ZZFA 1DRZA 3GQCA 5I3PA 5C42A 1MU2B 2HVHA 1SUQB 4YB7A 5A8WA 4I7FB 4XDDA 1FNXH 3IXQA 2ACYA 2DR7A 2G13A 4F4XA 3SV3A 1HW9A 3C8YA 4DF8A 4UY8T 1UA0A 4Y2IA 2MQPA 4NCGB 5D8HB 5KTQA 2P5VA 2RF2A 5GMKa 3HHLB 4GO5X 3PVXA 4MKBA 4BDPA 1JLBB 1NU4A 1IKYB 2XNRA 2IM0A 1KLMA 3HHDA 3WX4A 4IOAQ 1HNVB 3SCJE 2BE2A 1BC6A 4DX8H 3CIMA 1Y9OA 3KWMA 4V19J 4NLXA 1BGXT 4ZVEA 2IC3A 3FRZA 3K2YA 1S1TA 1UL3A 3QIPB 4RW6B 1OPIA 4Q45A 2MKIA 1X5SA 2VG6A 3RYLA 3DNCA 1XBWA 2ZDPA 3DM2B 4FN5A 1H7WA 2W4CA 2YNFA 2HQIA 3X3UA 2V4RA 1U1MA 3THVA 1S6OA 4ZPBA 1TKTA 2HNDB 1NJIT 3NLCA 2EFNA 2B9YA 4OHWA 1DLOA 1FXDA 1HL6A 4DDFA 4FXDA 3ZC4A 4ETXA 2JZ5A 5U47A 4F25A 3M8SA 4WTYA 4OIXA 4YB5A 4ECQA 2D1CA 3SSQA 2R2TA 2AGQA 1FT8A 3BR9A 1Q82T 4NXNF 3IFEA 1FXLA 3K8WA 2Q43A 3M2RB 1CC7A 4OI4A 4A48A 3MR2A 1HPZB 3KLEA 2FVPA 3K5PA 1L3SA 3MURP 4O4GB 4KGKA 4MTPA 5KT5A 2IRYA 1U6FA 2YY3A 5KFFA 5EWGA 1RTDB 1FDBA 1IKXA 1KHVA 5AXKA 5HP1A 2PMHA 2ZM6F 3HHNB 3M8PA 5B09A 5DS7A 3CDAA 3KMSA 3H5XA 3QGGA 2QA4G 2EFQA 3MUVP 2KM8C 4OI2A 4KO0A 2QSFA 1HW8A 1P8GA 1S1TB 2R7QA 3F44A 3THTA 1JMTA 3RRGA 1RK8A 2GHWA 2KO1A 2F3JA 3UCUP 3AA8A 3VAKA 1Q7LB 2RSQA 4IKAA 4A8QA 1CG2A 1GNKA 3SXLA 3L09A 2J0SD 1JLGB 1VQ8S 2HFOA 3M2VB 2V9KA 1NKBA 1T05A 2JEFA 3CCLS 3J81Y 1A6LA 2DCLA 2DNHA 1BQMB 3PXGa 2J7KA 4ECYA 4R5PA 4RBTA 2BANB 2K1RA 4U67Q 1NK6A 2M7SA 2HG4A 1WI6A 5D78A 4LQ3A 3IS9B 1VQOS 2R8JA 3CT9A 1XMOF 4X4VA 5KFTA 1TR0A 3MOZA 5J1EA 2JDJA 4F67A 3Q0AA 3RR7A 2KZZA 3C2PA 3K58A 2NXUA 2GJ2A 5KFYA 4J9RA 3G9CA 3CD6S 3BM7A 5J1EB 1UJ6A 5KFJA 1S1UA 4WYWA 1RTDA 3MMBB 2FTRA 1YJ9S 1JB0C 5M2PA 4XIUA 1R3NA 2IA6A 5AE1A 2OH2A 2X1GA 2PDAA 2DISA 4PWDB 3TA2A 2A10A 5HI7A 5DDPC 1S10A 2FLNA 2XG8A 1V3SA 3KLEB 4RWWA 3S6EA 1S1VA 1TL5A 4U6PA 2V5HG 2R7UA 1J5OA 1QVFR 2JRSA 2VPZB 4ZPDA 4P7TA 3PR5B 1YRTA 5KT7A 4O4GA 5J2MA 1TL3A 1N88A 4EZ6A 1JJ4A 3DOLA 4OLOA 2HHPA 1U25A 2EFOA 4KO0B 2J7UA 1VRUB 3CCWA 1H38A 3I9ZA 5BJRA 2PA3A 3LGMA 1U1PA 2BRKA 2NLWA 2CPHA 4LF7F 5DM6Q 2IAJB 4L72B 5J2NA 5EWFA 4ED0A 5DQIA 4Y65A 5I3UB 5MLCV 4ES1A 1T95A 3P6YC 3KK2B 4NZ6A 2OMOA 4WFBQ 2XCAA 2IC3B 5H1SV 3JYTA 3R5AA 1FJ7A 1BY9A 3D54A 1ZBTA 4JOUA 3BO4A 3Q8SB 2XO7A 3NMAA 1C0UA 2YNFB 2AQ4A 1SL2A 1HBOB 1OQ6A 3NCPA 2VC1A 1SB6A 3QZ8A 2RE1A 2CJKA 1SIZA 1CLFA 4F4ZA 4N5SA 2AJ1A 3KK1B 3MAHA 4KKOA 2R8HA 3MXHP 2FC9A 2ATLA 1H3DA 1BQXA 4QR0A 2MZ1A 3ZZ0A 4ELUA 2LQBA 3NMRA 3DGPA 1JLFB 3LP2A 3MR5A 2EG1A 3H5YA 1HWIA 2YKMB 2BACA 4OX8A 3MUMP 1ROFA 4DV0F 1UVIA 1AW0A 1X0PA 2HGLA 3T6JA 3SFUA 4LSNA 4A8KA 4NRTA 2L48A 2B7BB 2HS3A 1YI2S 3LAMA 2VD3A 3GG0A 2XMTA 4TU8A 1DLOB 2DH8A 1Z2ZA 4DR1F 1VBYA 1MW7A 2IM1A 3OSPA 1Q16B 1IKWA 4HTIA 2ZHBA 2RQCA 3KLIA 3KLFB 1E6YA 1H7XA 3MR6A 2RF2B 2MY7A 1TAUA 3IGVA 3LUYA 4C0BA 5KFNA 3HJFA 5CA5A 5GADI 5A2QY 5A6WA 4ICLA 1O8BA 3FMBA 5KAKA 3HHLC 4YB6A 5BR8F 2XGPA 1VQ6S 1CQMA 4CQ1A 3I4PA 5E0OA 1RTIA 4K5SA 4ELTA 1RP5A 2DNKA 4CO4A 2ZOGA 3NWGA 3EXYA 2BQRA 3JYTB 2NQPA 3DLBA 1L3VA 2GFFA 4JI0F 2YNGA 4HDGA 3R27A 1T8EA 1NH8A 4G3IA 3FEZA 4I69A 4Q8EA 4U7CA 1VFJA 3CMES 2E44A 4ETZA 4K50A 5KFHA 1U7LA 3TUIC 4Q5VA 2XLKA 3BSOA 2BA9A 3O1LA 2F9JA 3EZUA 2XHWA 3IRXA 3KTQA 2GGPB 3DI6A 3TVYA 4NXMF 3UD3P 3G6XA 1RT6A 1UEUA 3K57A 1E6VB 4C8LA 3VAJA 2IVYA 1QAXA 1E6YB 2AJ4A 2DGVA 4DG1B 4C3LA 3NG8A 1UWBB 2M3DA 3TA1A 1UMJA 4RNFA 4D3HA 3U7JA 1S9EB 5D4NA 1VRTA 2HNYA 4GC7A 2FIUA 2MZTA 1SH2A 2P9CA 1SJQA 2ASLA 1FRKA 1JLQB 1S1UB 2CQ1A 4IG3A 2V8HA 1QE1B 5F8HA 3JSMA 1ULRA 2DITA 3M9OB 1T02A 4HT7A 1T03B 2X51A 4ZPVR 1NK9A 4L3NA 3QZ7A 1NH7A 1WI8A 4DFPA 4PXBA 4B17A 4C0OC 3M05A 3O8WA 3NGDA 2B43A 2WBMA 4RNMA 1N36F 3G8SA 4IUFA 2W9BB 3MM6A 3VAHA 2DHAA 1NK8A 3M30B 4FPRA 4F2RA 4IRCA 2WONB 1M5KC 2DHSA 3C6UB 3PKYA 3IWNC 3GYNA 2IRUA 2CVEA 1SIWB 3J7YU 1Y5LB 4I2PB 4DQQA 3K5NA 3IR5B 2HIQA 4Y2KA 3NBPA 4M95A 5T14A 1NKEA 1ZPVA 2RUGA 3MF5A 4O23A 4KTQA 2EFVA 3BF4A 3JTOA 1FD8A 1XERA 1M5HA 4MFBA 1XN9A 4QWDA 2KTQA 4DV4F 4BCAA 2L3MA 4PUOB 4YR2A 4UUXA 2CQPA 2LA4A 4EYIB 3DLLQ 4IRDA 3H5UA 2PA8D 4RW4B 1FJCA 2J9DE 4ID8A 3R1HA 2MYFA 5L1LA 3T5JA 2F9DA 1C1BB 3GE9A 2HMIA 4A4JA 4IQMA 2YWEA 1N5YA 1UAWA 2XZWA 1R31A 2W9CA 2FHMA 2DNQA 4ZOSA 4NLGA 1HQUA 1PILA 2DNLA 3T5LA 4H4KA 3RAMA 4WFYA 1DBDA 3QAEA 1A7GE 4W92B 4GKJF 1QTMA 3HZGA 2