3CUNA

Aminoacyl-trna synthetase ribozyme
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
91
structure length
91
Chain Sequence
RPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis of specific tRNA aminoacylation by a small in vitro selected ribozyme.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna/rna binding
molecule keywords RNA (92-MER)
total genus 16
structure length 91
sequence length 91
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3cunA00
1D8ZA 1VQMS 2CPYA 2FC9A 2E5IA 2J76E 2AYBA 2DGWA 3FEYB 5ITHA 4FXVA 2MQNA 2D9PA 5IFMA 5H1SV 1NJIT 2MY7A 2OJ3A 1QM9A 2ERRA 3PIOQ 5HL7Q 2M8DB 2V94A 1WHWA 3CCSS 3VAKA 1UFWA 1N54B 1UW4A 1X4AA 2M70A 3ZZYA 3EGNA 2MB0B 3VAHA 4C0OC 3G6ES 3THTA 2DNPA 2LMIA 1WI6A 1WEXA 3CD6S 1W2BR 1HL6A 3BO3A 2OIHA 1FJ7A 1NU4A 2DGSA 2YTCA 4ERDA 2QA4S 3CF5Q 3UCZP 1VC5A 4PR6A 2GO9A 5GMKa 2DNYA 3V4MA 3CCLS 3THPA 2DO4A 4FXWA 2DGQA 2MZSA 1HD1A 2M4MA 2MYFA 4WCEQ 2MQPA 1F9FA 2N82B 5LJ3Y 3G9CA 3LQVA 1FT8A 4UQTA 2DB1A 3CPWR 2D3OR 3JB9k 2DH7A 2KXHA 1X4HA 4P6QA 2YH1A 2RUGA 1KOOA 2MKKA 4F02A 2JVOA 1VQPS 3G8SA 4V19X 1ZH5A 2MJUA 3BO2A 2DNOA 3BEGB 2DNNA 3HHNB 1X5TA 2OTJS 3MD3A 2DNMA 3R27A 3NS5A 2A3JA 3PIPQ 1M5PC 2DGOA 2VONA 2MKIA 2EK6A 3RW7A 2E5JA 5DDPC 2KM8B 2BOPA 5JVGQ 2XB2D 2WBRA 1FO1A 2J0SD 3CCMS 2MXYA 1OIAA 3IRWP 5CA5A 2LA6A 3HI9A 3NS6A 2CPEA 2L08A 3SDEB 3CUNA 1VBYA 1VQOS 5BJRA 2MPUA 3L3CA 1M1KT 2ADCA 1AUDA 2ZJPQ 2CQPA 2MJNA 4TU9A 1UP1A 5DDRC 3UCUP 1U1MA 1YJ9S 1X4GA 3G71S 1YJNS 3CCES 1FJCA 2E5GA 3P5TL 2CPDA 2XSFA 3CC4S 1JJ4A 4YOEA 1YJWS 3RW6A 5DDQC 4Y00A 2CPZA 1SJ3P 1U6BA 1KOHA 3VAIA 3VF0B 1YTYA 4WF9Q 3H2VE 5IQQA 1WTBA 3VAFA 2RT3A 2N3LA 2EVZA 2KVIA 1U1PA 3B4MA 2DH9A 1WHYA 2DGUA 3P3DA 2LQ5A 2ADBA 1U1LA 5DETA 1QVGR 1BY9A 4ED5A 2RVJA 4OZ0A 1X0FA 1M5OC 3CMAS 2G4BA 1U1KA 3MXHP 4WKRA 2N7CA 3S01A 3VAMA 1URNA 2J8AA 1JJHA 1X5OA 2MZ1A 1S79A 2E5HA 3CCRS 2KXNB 2K3KA 5CXTA 2MQOA 1B7FA 2G0CA 4Z2XA 2AD9A 1VQKS 2VOPA 2CPJA 3TO8A 1PGZA 5LSOA 1N52B 2X1FA 2M9KA 1Q82T 2L9WA 4RU2A 2CQIA 1X5SA 1A9NB 4WFNQ 2DNRA 3MUMP 2XNQA 3MUVP 5EN1A 1YIJS 3S7RA 3MI7X 3SMZA 3DLLQ 1SXLA 1FHTA 3I55S 4WFAQ 1VQ7S 2CQGA 1Q86T 2MSSA 1KD1T 1SJFA 4LIRA 1HA1A 2CPHA 1DRZA 1OPIA 1VQNS 1A7GE 3UWTA 2ZJQQ 2I2YA 1WWHA 2MZQA 4IUFA 2CQDA 3R1LA 2F9DA 2RS2A 3DXBA 2MKHA 1X5PA 2E44A 2DGVA 3UD3P 2CQBA 1KQSR 1H2VZ 2M2BA 4WIIA 1M90T 2OTLS 2KYXA 4QU6A 5LJ5Y 2JRSA 1S72S 2LA4A 1DBDA 3S6EA 1N88A 2LXIA 4BS2A 3TP2A 2BZ2A 1VQLS 2YWKA 1VQ9S 3LPYA 2MY8A 4PKDB 1Q7YT 4QQBA 4YUDA 3S8SA 2MQQA 4TU8A 2I38A 1D9AA 1X4EA 3CCVS 1PO6A 2DITA 2QEXS 4PRFA 2KRRA 1NO8A 2MKJA 4CIOA 1U1NA 4LMZA 2MGZA 3SDEA 3EGZA 3D2WA 5IM0A 2DNQA 2XS5A 1H6KX 2DK2A 2FY1A 2CPXA 2KXFA 2M8HA 1G2EA 1U1RA 4LJMA 5DM7Q 2DGTA 1X4BA 3K0JA 2DIUA 1WG4A 3ULHA 3SXLA 4TU7A 2HYIB 4EGLA 1K73T 2CQ3A 4WFBQ 2FC8A 2M7SA 2N3OA 3Q2TC 5LXRA 1WF1A 2RRBA 2J0QD 2CJKA 3J7YU 4CH1A 1YI2S 1WF0A 1FNXH 3U1LA 2HZCA 1XN9A 4UY8T 1Q81T 2NZ4A 2MKCA 1N8RT 1U6FA 2RS8A 2CPIA 2F9JA 2KT5A 2MGZB 1OO0B 2OSRA 3TYTA 1WI8A 1KC8T 2U1AA 4TLQA 5D78A 3CCUS 3Q2SC 1WEZA 1VC6A 2CQ0A 1X4CA 2RU3A 1SJRA 1ZZNA 3VAJA 1IQTA 4CH0S 3VALA 3MDFA 5GAGU 3VAGA 2MZTA 4A8XA 2M52A 1HD0A 5GAHU 3CCJS 3G4SS 1VBXA 1M5VC 1ZZFA 2AYMA 3CXCR 2LXUA 3OW2R 1RKJA 2DNGA 2KU7A 2KN4A 2M0GB 2KI2A 2X1GA 1K8AT 4IO9Q 3NNCA 2JVRA 2PE8A 4OZ1A 2VOOA 3U1MA 4F26A 2DNKA 2NLWA 2XS2A 2UP1A 2DIVA 2O3DA 1VQ8S 2KG1A 3G96A 1O0PA 2CQ4A 2FHOB 2X1AA 5JVHQ 5CYJA 2LEBA 3BS9A 3N9UC 1H2TZ 2CQHA 4QPTA 3MUTP 2DNZA 1X4DA 4C7QA 5HO4A 1JMTA 1YITS 2MSTA 2KRBA 1WG1A 2RRAA 1H2UX 2CQCA 3J7ZT 2KM8C 2DHSA 3CC7S 3G8TA 2F3JA 2MKSA 1UAWA 2MZJA 5LSLA 1DHMA 2DNHA 1SJQA 2Q79A 3CC2S 1VC0A 2AYEA 2SXLA 2ZJRQ 1WHVA 3BO4A 4IOAQ 4QU7A 2D9OA 2GHPA 2EK1A 4W92B 3IWNC 2KH9A 1VBZA 4YB1P 3UCGA 3MOJB 2CQ1A 2B0GA 2HGMA 4J5OA 2DHGA 1CVJA 1WELA 1RK8A 2M88A 2MMYA 1JJ2R 2FPHX 3R1HA 2CPFA 2U2FA 2DNLA 2K8GA 2LCWA 2OSQA 2LYVA 1VQ6S 4Y0FA 1R8HA 2CQ2A 1YHQS 4C4WA 3NNAA 2JX2A 3I56S 4CQ1A 5D77A 1VQ4S 3NNHA 2LEAA 5GVQA 1R8PA 4F25A 2XS7A 3CCQS 4IOCQ 1WHXA 3MD1A 3US5A 1WF2A 2KHCA 4M5DB 1K9MT 2HVZA 2VODA 2HGNA 1WG5A 1P1TA 5GAEU 2XNRA 1P27B 1U2FA 4ZKAA 2MHNA 2DHXA 5LXYA 5DDOC 1DZ5A 4U67Q 3P49B 3UE2A 1M5KC 5DM6Q 2YKAA 3FEXB 2LECA 2RNEA 4W90B 1U1OA 3CTRA 1OWXA 3H2UB 5MLCV 3B4DA 2G1DA 1VQ5S 5FJ4A 3CMES 2MZRA 2HGLA 1X4FA 1QVFR 1WEYA 2DISA 2DO0A 1FXLA 2QFJA 2YH0A 1YWXA 2PEHA 1SJ4P 2L41A 3P6YC 5GADU 1L3KA 3EX7B 2DGXA 2LKZA 3UD4P 2KG0A 3CULA 2JWNA 2DH8A 2MQMA 2DHAA 3NMRA 2RQCA 3MURP 2X1BA 2KFYA 2AYGA 2MQLA 1U1QA 2RQ4A 5IM0B 3ZZZA 1FJEB
chains in the Genus database with same CATH superfamily
4U9RA 1VQMS 1JKHA 2CPYA 3IMQJ 4KSEB 3PFEA 1K44A 2J76E 4M5NA 4E0DA 3M9OB 4K2XA 1HWIA 3FEYB 4FXVA 4QW8A 1YJRA 4K2JA 3SSSA 5LMNF 5L46A 2D9PA 2DRAA 3LGMA 1HBNA 2ZH3A 2BJ8A 3HHDA 4DPTA 2V9WA 5GAGI 3M8QB 4CO2A 3D9BA 2EEYA 3H5SA 2QYGA 4MIBA 3AQOA 3VQTA 1NK0A 2NQPA 1EJ7L 2V2VA 1WHWA 2V94A 5B09A 1ZS6A 1RTIB 1PYSB 2VFUA 3N01A 5B0AA 4RUBA 3CW2C 4F7VA 2D69A 3VAKA 1AB8A 1TL4A 4F4KA 3PW4A 3ZZYA 4KKOA 4R5PA 4QCLA 4NA2A 2VHGA 2J9DA 4C0OC 3G6ES 2ZH9A 5IWAF 3THTA 2XYHB 2DNPA 2LMIA 4WBFA 2XLJA 3W9HA 4C97A 2YPZA 1HL6A 4ZPDA 4C2MA 3HJFA 1FA0A 2DEIA 3AB4B 2HG4A 2CADA 3IS9B 5KFAA 1TZ0A 3VWSA 1HBOB 5AE1A 4ERDA 3I0SB 3QT7A 2RH3A 3GG0A 2PMHA 4P74A 4DZDA 3LPEA 3GSDA 4C8NA 5IWAJ 1VC5A 4JYAF 3D68A 4PR6A 2CVIA 1BE4A 1C0UA 5IV4A 1YRUA 1EKSA 2ZD1A 1VRQC 1RAHB 4CTAA 5J1EB 1SH0A 2YXLA 3F41A 1T05A 2FUG9 2OPRA 1DARA 3OR1B 4OX8A 3PTWA 3AY0A 4PXEA 4RX6A 4ZCLA 1R8CA 3S1TA 3CULA 2GIFA 2DPJA 1Q1KA 4FXWA 5CZVA 4CRJA 4DSFA 2BKOA 3Q86A 4OHVA 3PYFA 1HYSA 3BKFA 5F41A 5M2RA 2VBYA 4N8OA 1CJUB 2LDYA 3WQPA 3AJ1A 1F9FA 4ZVUB 1ELOA 3DOLB 3JTOA 5E33A 3R7SB 5LJ3Y 3G9CA 4CLTA 3DGPA 3AOCA 3EXYA 3SSQA 4A48A 3KLGA 1DTTA 5HMXA 3R5CA 4CM0A 1L3VA 4QYZJ 2Z0GA 3FUYA 2FHKA 3R5AA 2PT0A 4UTGA 3W60A 3TZZA 2KT2A 1NAQA 4ICLA 2YH1A 3Q22A 2YWGA 3A4TA 5D0GA 1SQEA 2XI3A 3QJLA 3T5HA 1VQPS 1T95A 3MEGB 3QIDA 3G8SA 1SL1A 1Q0NA 2IRXA 2MJUA 2RILA 1VBKA 1OSDA 3LWLA 3BEGB 1TVRB 3SCJE 4EWTA 1I6JA 4DV7J 1N56A 3R27A 3FFIA 1FRLA 1NUEA 4QWAA 2HKEA 3AH6A 1KR4A 4QZVB 2XMJA 2A3JA 5K14A 2JEGA 3MEDA 2BANB 1MU2B 4OYPA 2AJ1A 4JI6J 3N0VA 1CJTA 1RTZA 3BN4A 2HAFA 5E3AA 2ZC3A 3RW7A 3ZC4A 4YS2A 4DV7F 3PW2A 2AJ2A 4RW6A 4DV5F 4CH7A 2HFOA 2QMWA 3D6MB 5IT9U 2E5JA 3N79A 3GP9A 1GMVA 1JLGA 3OD2A 1CS4A 4ES1A 3ITHA 2ZFHA 4UY85 4C48A 2NYHA 3Q89A 2XB2D 3I5CA 1FO1A 5KFVA 3DOLA 1GMWA 1RHQB 1PCAA 4HTJA 2E9ZA 1NK8A 3IRWP 4TLRA 5CA5A 1RT4A 4B3TJ 5LOQA 4X2BA 2AJ4A 1S7HA 2W24A 2DD8S 3C66A 3SDEB 5M2PA 3AB2B 5RUBA 3D0GE 3DLKA 2R7SA 5BJRA 2D74B 3SBMA 3OUYA 4NLSA 1IKXB 1U24A 2LVWA 3M05A 2OPRB 5DLGA 3TAQA 1T05B 1M1HA 2W1BA 4B3TF 3M2UA 1ZETA 1FE0A 4YR3A 2DYAA 1WC0A 3OTEA 1NJZA 2IDLA 5A0YB 4ZLLA 3CJ8A 2AX1A 3ETMA 1HW9A 1U1MA 1X4GA 1ZBTA 3G71S 4K4XA 4FF3A 3IG1B 5F0WA 2RHQB 5BYRA 3EM1A 2JLGA 4F4AA 1HWKA 2EFNA 3M30B 3K8VA 2HZVA 4YMEA 2L3MA 4TYBA 1IR0A 2XGPA 4X4TA 4ILMA 2R7VA 2OD4A 3KK1B 5DG9A 1RU1A 1RWUA 5ETMA 2OPQA 2XWXA 2F4FA 3K8WA 1PC5A 2RRNA 4NYZA 3DRXA 4Y00A 1PKUA 1BWVA 2PEBA 2Q6CA 2CPZA 4BLGA 1C4CA 1W7WA 1KOHA 3FCVA 3ZO7A 5F8MA 3OXFA 3VAIA 1S6PA 2JL9A 3OJUA 4LBHA 4RUCA 2JH3A 2V2ZA 1E6YA 1RTJA 4CO5A 4Q2MA 4E8UA 3MFIA 1JLAA 1FXRA 1WTBA 2C3UA 2RT3A 2N3LA 2RD5C 1OPZA 1R31A 2EVZA 2KVIA 3GIKA 9RUBA 2GW8A 2BBEA 1CBKA 5E7OB 1U1PA 4J9UE 2VQFJ 2H3EB 2HS3A 1TUVA 2X3DA 4CLKA 5K20B 2EC0A 2ILYA 3W1YC 3V4IA 1QVGR 5DGBA 1IN0A 1OY9A 2QTWA 4UT4A 2FD2A 4ED5A 1X0FA 2ZOGA 1L3SA 5KT2A 2W4PA 2DVIA 4OZ2A 1LKZA 4OI3A 5EUHA 2BM1A 2CFXA 4EYIB 2G4BA 2G0IA 5L38A 4GKJJ 1K0VA 1QDUB 4KH1B 1HNWJ 3D6TB 2P9EA 1WC4A 3RR8A 1LQ9A 3KFWX 2H4YB 3M8QA 2XYPB 4ED7A 2E5LJ 3OSNA 1S79A 2C3PA 2ZNZA 2F8HA 4QIVA 2FVRA 3TVYA 5HLFB 1B7FA 2VDIA 3IWXA 1HNWF 4ATNA 3DI6B 1LWXA 1RWMB 3HSGA 3TO8A 5C2CA 2K7KA 4ECYA 4BWMA 1SH2A 4RW8A 3MCMA 4C0BA 3BDPA 2IA6A 1HQ2A 1S6PB 5C24A 3ZTPA 5E41A 1C1BA 5HANA 2ACMA 2GNKA 1G3OA 3H0PA 4AE5A 2CQIA 1A9NB 5KT6A 3HM9A 3RRKA 1WD6A 1S59A 4ALZA 2DNRA 2XNQA 3MPDA 2YQ0A 5EN1A 1NDKA 3OFHA 1JLGB 1GFWB 5T7LB 4PQUB 5KFEA 3S7RA 2B8PA 3DLLQ 1SXLA 4UUXA 2XEXA 1T03A 3QRPA 1OY8A 3QQCD 4A8OA 1Q4RA 4DSLA 1FHTA 1B0VA 3D1OA 3SIPB 3TOQA 3GZ7A 4LF9F 4JI5F 2HHQA 2ZKTA 4NXNF 3X1LB 5CABA 2XULA 1DTQA 5L1JA 5DQGA 3H98A 4UOHA 2XGQA 1UZDA 1R8BA 2BJ9A 3GTYX 4HYKA 3KJFB 3HXMA 2HHSA 5I4MA 1A7GE 3UWTA 4LF9J 1WWHA 3CJTA 4N56A 2YX1A 2CYYA 1RHRB 3W2VA 2JLFA 4NA3A 2W01A 2CQDA 3R5GA 1ZPVA 5L1LA 2ZBPA 1N5TA 1C0TB 2F9DA 3FBEA 3MEGA 3UDCA 1WORA 4CYUA 5C25B 2YKNA 4X4PA 2MKHA 5KFPA 2RS2A 4CYUB 5C25A 3HPOA 4USTA 2W9CA 3UW1A 5KG0A 4FBUA 2OEMA 2M2BA 2OH2A 3OL9A 2MKYA 4DU8A 4QU6A 1NRKA 1S72S 2BJ7A 1DBDA 5HSPA 2C2ZB 1W25A 3M2VA 2EWHA 4LUBA 4I7FB 4WIQA 5FLXU 3LALA 4DZ6A 3FEZA 2BZ2A 2BE9B 3GPAA 3FNNA 4I7FA 3R2DJ 4DV1J 4RKUC 4RW6B 3LPYA 4CDIA 2VF3A 1WSVA 5AXLA 1UEUA 4YUDA 3S8SA 1TKZB 2ALYB 1S4EA 4F04B 2MQQA 3K5MA 1XIQA 3CGIA 2OLWA 2CWKA 5GAHI 5K14B 1HPZB 2I38A 5D6GA 3ZZ0A 4X4QA 1QAIA 2ZHOA 3M8SA 4MK8A 3T41A 5A8KA 1JLFB 3VV2B 4CIOA 1GX6A 4F4WA 4NLXA 2CZ9A 4NRTA 5CAAA 4JI1F 2VPWB 1S57A 5AE2A 2XMWA 3J81Y 3H5YA 5KFXA 3PO5A 4RW8B 3D28A 1RT1A 3J80U 1WOPA 5GAEI 2H51B 1S9GA 2Z56B 1A0OB 3AQPA 5HATA 5A8RB 2FY1A 3CD7A 4B3RJ 3O6QA 1RHMB 3GYNA 1H72C 5HLFA 1L3TA 4JI1J 4M5HA 1Q8LA 3NCQA 3O2IA 1YJUA 5FLXY 1G2EA 1U1RA 5I3QA 4LJMA 1NK7A 3ZNUA 4PQUA 5DM7Q 2DGTA 2BJ3A 3ZTRA 5J2PA 3K0JA 4LFCJ 1SV5A 5F8GA 3CSKA 2DIUA 3R2CJ 4B3RF 3X3UA 1SC3B 1PJ7A 4WU2A 3WX8A 4EGLA 4EBEA 2F1FA 4ED2A 3KMQA 3GFZA 2F7VA 2FC8A 4JOUA 3TJ8A 3DRRA 3MPUB 3W66A 1GT8A 1O5JA 4F0KA 2J0QD 4B9SA 2RKIB 4F0MA 1JNRB 2JEIA 1YI2S 2FVQA 3QMQA 4Y6IA 4KFBB 1NK6A 4MYTA 5J1EA 3R6LB 4KHMA 3PKMA 2HZCA 4ITSA 2NZ4A 1U6FA 4DS5A 2UV8A 1YZ6A 2F9JA 1LW0B 3PXGa 2MGZB 2B6AA 1X31C 2FGCA 3CDEA 5KFIA 2XG8A 4OJ3A 4C0HA 3A8EA 5KFNA 3CCUS 2DY9A 4PG5A 3IGNA 4ZP9A 3WDOA 3WIVA 2C1EB 1EAYC 3C6UA 2UVRA 4FKXA 2EW9A 3IC1A 2CQ0A 3TUZC 3SQGA 4OYAA 2I5JA 3QGPA 1SJRA 3CDUA 2MEWA 4PEOA 1IQTA 5HMZA 2Q1LA 1FD8A 2YWFA 2IPOB 5G0RA 1MSWD 2ZZMA 4KY3A 3A13A 4A8XA 5GAHU 4KT0C 2YNIB 3G4SS 3P8BB 3QFWA 1ZZFA 3Q8VA 2XY7A 4DL7A 4OHZA 2HNZB 3WX4A 2KU7A 1YZ7A 2KN4A 2WVCA 4ZJLA 4QYZK 3M2UB 4IFYA 1HI8A 3CE8A 4EBCA 2FVSA 3M6VA 4ZHRB 3UPFA 2B7CB 3RRGA 4LRCA 3RBDA 2HVHA 1JIHA 2IJFA 4IO9Q 2JVRA 2ZBQA 3PRBA 4PAAA 4F26A 1ZPWX 2H1YA 4BDPA 3KXDA 2DNKA 4L74A 1CJVB 1EKRA 3DU5A 4IFVA 4U96A 3OVBA 2JDJA 2V67A 5DZ6A 4CO4A 1VS3A 2KG1A 1FK9B 2FHOB 2X1AA 4I6YA 2VUGA 1CQNA 4FYXB 2AX0A 1LWFB 3ILOA 1H2TZ 1CJTB 4OHXA 4QPTA 2C2DA 2W2NP 4Y2MA 2ZBRA 3GCXP 2HBQB 4C7QA 1D1UA 3OXLA 1UFLA 3IXQA 1CSJA 4DCOB 3L9ZA 3SV3A 4DV3J 2CJQA 3IR5B 3FJ2A 5HROB 2L9NA 4OX6A 1H2UX 1U4BA 2WCXA 2LQJA 2I6WA 2B51A 5IT4A 2RJZA 4YFUA 2F8EX 4LF4J 1U7LA 4ZDNA 1JLFA 1UAWA 2MZJA 5A8KB 3M6WA 4DV3F 1NB2A 2V5HG 4RW7A 1LWEA 4U6PA 2ZH7A 1VC0A 4AXIA 2SXLA 2ZJRQ 1T9TA 4R0EA 4CO1A 4BCAA 1TKZA 4DL0C 3D0HE 1HNVA 1LWFA 4GVBB 1Y5LB 1U6ZA 3SCIE 5A76A 2G2ZA 2D9OA 3HVAA 2YVSA 2HVIA 2ZVIA 4HH1A 4P2MA 2KH9A 2RQMA 2NUHA 3SQOP 4YB1P 3UCGA 2CQ1A 3RG6A 3MOZA 3PYEA 1D0EA 1QTNB 1FF2A 1V3ZA 2UVVA 4DS4A 1F6TA 1N5QA 2HK3A 4A8KA 2XSJB 2ZE2B 5HAOA 2Z30B 3LWMA 1UW9A 1JJ2R 3CD0A 3R1HA 2CPFA 3T3FA 3BBFA 2K8GA 1YBTA 2DNLA 1QTMA 7FDRA 1R8HA 2P9CA 2UZAA 2HS4A 4PABA 2CIMA 2CQ2A 3FMBA 1PILA 1BXNA 1R0BG 4FXDA 1TL1B 2VG6A 2NSBA 2UV8G 3NNAA 1NEEA 2Z4PA 2V8HA 3AFGA 4ZVSB 4CP5A 3I56S 3DLGA 4A8YA 1LWCB 1HBMA 4G1PA 3CT9A 4LRAA 5KOXA 1JJCB 5KFOA 4K4SA 2LEAA 2WSFC 2VU5A 3HSJA 1QAYA 8AT1B 5LMUJ 1C1CB 1Y00A 1R27B 3TX0A 3P4UB 3IN5A 1TKXB 5KFWA 3MD1A 3US5A 1WF2A 2RF2A 3BQ1A 5DGAA 4RUAA 1PSDA 4LSLB 2HGNA 1WG5A 1P1TA 4KIAA 4USVA 4LQ9A 2XNRA 1P27B 3T1AA 4PPDA 5JMNA 1WUUA 4ZVQB 3RRHA 5LMUF 3W62A 3C6UB 5LXYA 3QSIA 3OLBA 5K8MA 3PKYA 3OVSA 3MR3A 3P49B 4A4JA 2WVEA 5DM6Q 3GSIA 1WACA 1M1GA 3NGKA 4ZLPA 4AXJA 4DR4J 2B6AB 2D1CA 1U25A 3FEXB 3ILIA 4W90B 4WE1B 1U1OA 4I2PB 3G2XA 5MLCV 3UN2A 3SYZA 2YNHB 4ZCIA 2Y9HA 4KV8B 4PCQA 4M5MA 5HP1A 3CMES 2WZ1A 1UVIA 5J2QB 1M5SA 3E8OA 4DR4F 2Z58B 2XMTA 3BV8A 3N6NA 3DRRB 1GNKA 2RIJA 2GVDA 2DO0A 3D3BJ 2X7IA 1NHVA 4IG0B 1YBUA 4M5LA 4NEYA 3DRYA 1S6QB 3UDVA 3VGUA 3PW5A 3NLCA 1U09A 1N5VA 2AHOB 5HMYA 1S6QA 2B4OA 3EX7B 4U7UD 1IJEB 4MKBA 3UD4P 3M8PA 2BRKA 4DX6A 2H5EA 1F9EB 2VICA 4XTTA 4DFJA 4EZ6A 4LF8F 2MQMA 3GJRB 2OFHX 3HKZD 1JB0C 2APOA 3NMRA 1Q16B 2IC3A 2EFGA 2IAJB 4R8UB 3OQ2A 3KLFB 2LU2A 2XZTB 1TL3B 5FDLA 1FRIA 1FDDA 3ZZZA 1P8GA 1FJEB 4V19J 1JKHB 3MR6A 3B82A 4LF8J 2BE7D 2CZVC 3AT1B 1JLAB 2QV6A 4O4RA 1HQUB 1JLQA 1I1GA 3WC0A 1KFSA 4B3OA 2UXCJ 3QIPA 2DEJA 1WC6A 3QWUA 1EQ0A 4RR5A 4C98A 4ZIWA 5H1SV 1NJIT 1HARA 2W9BB 2IBKA 4DV4J 2HBYB 2HVDA 2VL1A 1CG2A 4DPYA 1TP7A 2ATLA 2M8DB 4NLWA 1TL5A 4C8YA 4X4NA 4LFAF 3FKBA 3HHLA 4RU9A 3MCSA 1UFWA 5B7WA 2HQFA 1UW4A 2M70A 3DOMA 5IC4B 3EGNA 2IYGA 2GA7A 3I9ZA 4JUZA 3EDRB 5K8OA 2MB0B 4DFMA 3DLEA 3V6DA 3G86A 2MLXA 1WI6A 1WEXA 2C3MA 4E2FB 4LFAJ 4GMKA 3CJ5A 2PC6A 5BYQA 2DBBA 3W5ZA 2VA3A 4IR1A 1LWCA 1KWMA 1N0UA 1V3RA 5A0YA 3VGTA 3OL8A 2RE1A 5KFUA 2ZHAA 4AQYJ 1RTHA 3E3XA 4J9MA 2AZ3A 1HFEL 2HIYA 3C16A 1VLYA 4IDKB 4PQAA 3TAMA 2FDNA 3HT3A 4Q8FA 1APSA 4WKYA 3BZQA 5F8NA 5E3PA 2ZH5A 2Q66A 3IBCB 3GIRA 3R7NB 1TFYA 2L9DA 1XMQJ 3PRVA 2GIRA 2HWIA 3HVRA 4AQYF 4DFPA 4ZPWR 3ILLA 2EG2A 3T9ZA 1N32J 1RXOB 1YG0A 1C4AA 5KFBA 4ILRA 4YQWA 3W2WA 1PC4A 2VG7A 4NYOA 1RTHB 2F5GA 1RZMA 1CQMA 4ZVGA 3TJAA 2IYIA 2M4MA 1F5AA 2EC2A 4DCJB 4FYWB 1YSJA 3OXGA 1AT1B 4KE5A 1CS4B 2J0XA 5E3QA 4Q43A 1FKOB 2BYCA 2FHMA 2P5VA 2V8GA 3HULA 2D3ZA 3PM9A 3LQVA 3W61A 4RNFA 5A2QU 1N32F 3C8YA 1FT8A 2YKOA 3A3OB 4UQTA 4QWDA 2ZM6F 1RYRA 2HSEB 2DRBA 1FJGF 2DB1A 3BGLA 1EARA 5AJ3J 3CPWR 5BR8F 3DLHA 3D67A 5B0EA 2FJWA 4JV2A 3HHLB 2QRRA 1SVDA 5B0DA 5HQMA 3EZ5A 3RBXA 2KXHA 1RDRA 2GJ2A 2V63A 1FD2A 4NA1A 5ETPA 4XIUA 4KC5A 3MM8A 3QO9A 3KLVA 1S0NA 3F44A 4Q7AA 4HHHA 4U95A 2RUGA 2ZM6J 4V1Ak 2MKKA 1R3NA 1C1BB 5C24B 1JLBB 4OX9F 2WRMA 2CXEA 1MWYA 3MAHA 2FJVA 4OLOA 4V19X 1ZH5A 3BO2A 2YKPA 2DNOA 2ZEJA 3MM9B 2QMUB 3N5FA 4LSNB 3TVKA 1Y5IB 4YHHJ 2ZKUA 3V5RA 3HHNB 2OTJS 1TELA 3IA0A 2IAJA 4R8UA 3ZZRA 3KLFA 4E98A 4NE9C 1VIXA 2IMOA 3B8HA 1FI4A 3FCWA 3N5BA 4FYVB 1M5PC 2KZMA 2FZKB 5EDWA 3KLGB 1IKYA 3MECA 1JQGA 2UU9J 3M1VB 5A2QY 2EBEA 2GJIA 4N41A 1OJ4A 4NLVA 1WTFA 5DDPC 4I64A 1O8BA 2BOPA 1CJUA 2C42A 2G2OA 4IR9A 5CCLA 2CNOB 5KG6A 2J0SD 4DR5F 2BM0A 3KHHA 1D09B 1JK9B 1AUSL 2AGQA 2MXYA 2UXBJ 1OIAA 2HHPA 4USKA 4ZP7A 3UVJB 4Q5VA 2KKHA 1R6VA 1RAIB 1Q8KA 3FMWA 2VC1A 2K2PA 1G7CB 3HHLD 1V6HA 3NS6A 2CPEA 2L08A 1VDHA 1R43A 2QL7B 2ZD1B 1MNEA 1PJ6A 2ABYA 4DR5J 4C8LA 2PFDA 2DHHA 3T1HJ 3PW0A 3V81A 2WOMB 3PY8A 2XMUA 2HNZA 2ADCA 1SC4B 1T11A 2V9KA 1M1KT 1E6YB 1RTJB 2A6MA 1AXQA 5F8LA 2GFFA 2YNGA 1S76D 4TU9A 1XJWB 5J1PA 3DDNA 3HVTB 3ZTQA 1SL0A 1JX4A 1IVZA 3MPWA 5B0BA 2EFVA 1YJ9S 1FRKA 1SUQA 2C2RA 1RACB 1RTDB 3CCES 1FJCA 2CPDA 4N8NA 3M30A 5CYQA 3PCOB 3HO1A 4QIGA 2FTRA 4DR1F 2HURA 2F4VJ 3FBFA 4J9KA 1JJ4A 2G0JA 4B3MF 2O1PA 3NGUA 1X8DA 2YNGB 1PAEX 1RBAA 5F8HA 4YOEA 1YJWS 5KFYA 1JWWA 2I8EA 2C2KB 1KQGB 1U6BA 1HBUB 2WOMA 3V81B 4MKYA 1UVLA 3VF0B 1F5CA 1Z4UA 1QJHA 5GADI 4FF4A 2WTFA 4B3SJ 1IKVA 1E6VA 1GEHA 3MTJA 3VAFA 1U48A 2GQQA 3UDEA 3VZHA 3M7VA 2QGFB 3GFXA 4UZCA 3JYTA 3MF5A 2AZ1A 1R89A 5E5NA 2CNNB 3UN5A 4K59A 2HQGA 2HHXA 4GRSA 4QIWD 1X0PA 1KN6A 2YNFB 4G6VB 5ETQA 1F9HA 1L3UA 2CG4A 4F3MA 3P3DA 4KPYA 2LQ5A 1S1WB 1D8YA 4B3SF 1RQ0A 1VGYA 1S49A 3I32A 1H3DA 1Y10A 1I3OB 2EFQA 3IFEA 4Y65A 2H65B 1NZ8A 3M8YA 4ES3A 2Y1IA 3T5JA 4HR2A 3QT5A 1XERA 3BYPA 3CMAS 2BQUA 2R8KA 2LFVA 3NGTA 4K4YA 4WXOA 1VJQA 4XDDA 3TAPA 1Z2LA 2GQCA 1HNVB 1J5EJ 4WKRA 2N7CA 1C2PA 3VAMA 2J8AA 2JFKA 3RYLA 3MEDB 2E5HA 1N4LA 2K3KA 2DXFA 3J81U 4DR3J 3D6FB 3IR6B 4RW7B 1NCLA 5B0GA 4NI2B 3J80Y 8ATCB 2ZZTA 2NPFA 3AXKA 3IBFB 5IQ6A 2HW3A 2O01C 1PGZA 3TZYA 4ES2A 1BGXT 1NHUA 4MT1A 4F8RA 5JXSA 1K47A 2X1FA 3C46A 2DR9A 1B64A 5U47A 2M9KA 4DR3F 4PRFA 2FLOA 3ZTOA 4KGMA 3C15B 4RLEA 1NLKL 2DRDA 1KFDA 3M8ZA 4DF4A 5DJBA 4YP3A 2ZBIA 1LFWA 1KTVA 3D1QA 4HDGA 3R9LA 4WFNQ 3HMJG 3MUVP 1VJWA 2DTJA 2HRYA 4DPWA 2VC0A 2ATCB 1NNDA 2A2CA 3Q8SB 4WFZA 2VDHA 3F0NA 4NZ6A 4O4GA 1KLMA 4JI8F 1Q95G 4DUYF 1WKKA 1V9OA 4DL4A 1TK5A 4WFAQ 1VQ7S 1S9FA 3E2EA 3M2VB 2QG9B 3C19A 3VQSA 2H54B 3D5MA 5KT7A 2HNDB 3HZEA 3HFVA 1VK8A 2VG7B 4IFVB 4X62F 3W2WB 1KD1T 4P2XA 3DFEA 4A8SA 1SJFA 5KFKA 3VVUA 4LIRA 1JXLA 1BMQB 1S9EA 2CPHA 3OR2A 4JI7F 1UA0A 1VQNS 1UVJA 2ZJQQ 5FIIA 1ZAXA 3KJVB 4OI1A 2UUWA 4M5KA 4GC6A 3KOAA 1RU2A 1NDPA 4TNOA 1E6VB 4PXCA 3JSBA 3THVA 3GCWP 2VG5A 1U02A 2AMCB 2E44A 2IRUA 3P5BP 4D3GA 3TNVA 1KQSR 3DLJA 3CCTA 4WIIA 2R7OA 3DHWC 3CJKB 1M90T 2KYXA 2VQEF 2OTLS 4JI7J 1SJ1A 5LJ5Y 3J81j 2JRSA 4DX7A 3PHEA 3RR7A 2YNIA 4FBTA 4PG6A 5DRKA 5EHHA 4GKKJ 4UUWA 2LXIA 4DHVA 1ZAWA 3DOKB 1W2IA 4A47A 4L6V3 2UXDF 1KONA 1FWLA 2R9LA 4WWSA 2R7QA 1VQLS 2YWKA 4DG1B 3JS9A 1QSLA 3DHXA 3BGUA 4DL5A 2MY8A 3R7BB 1X9MA 2EFPA 2DCLA 4O44A 4U7UK 2Y1JA 4P72A 5T7LA 3TA2A 1Q7YT 1SC1B 1UMJA 1SUQB 2JFDA 2J8SA 3I4HX 2DR7A 3LOUA 3C6TA 4ZVHA 2IJRA 3MR5A 4DL2A 3OFGA 2KYZA 3CCVS 2CJBA 2ASYA 4DU7A 5LMNJ 2HEKA 2NSCA 1IKWB 3HZGA 4LMZA 3IO1A 1LW0A 3HCXA 1GK8A 2MGZA 2XY5A 1ZTTA 4UOCA 4QWCA 4OI0A 1V5IB 2PGCA 2DR8A 2UUBF 3EGZA 5K9FA 2E1MC 4ZP8A 1RT3B 2V4QA 3GLJA 1GAOA 3NWGA 1MN9A 4RWXA 4ZOSA 3DRPA 4J90A 2XS5A 1WOSA 3H8YA 2DT9A 4ED8A 3HVWA 4DR6J 1S1VA 1U0HA 3AOAA 4CLYA 1ULRA 4ID5A 1N34J 4ZA1A 3DYAA 3UQSA 2KXFA 2M8HA 4ZVFA 2F8MA 1SI9A 3ONQA 4I2QB 3ISNC 4FS2A 2FZCB 7AT1B 2C28A 2UUAJ 1CEZA 2WVBA 4MJKA 1SV5B 1FWKA 3O3LA 1WG4A 3ULHA 5J2PB 1UJ6A 3QYYA 3V4IB 4TU7A 3PVXA 2ZH1A 2HYIB 1NZAA 1ZOTA 5HQLA 2CQ3A 2IRYA 2XHWA 3FRYA 2P8IA 4DL3A 1LV5A 4JYAJ 5F3TA 5KFMA 5F0UA 1RBOB 3PJWA 3LGNA 2RMLA 2CJXB 4M63A 1MWZA 4CH1A 1ZYQA 2G1HA 1WF0A 2FYXA 4I2PA 4RW9B 4R25A 4ZPBA 1VOMA 4UY8T 1TAUA 5DZ7A 3G8QA 4ZJOA 5JUMA 5KT5A 3M8RA 5J2MA 1N8RT 2RS8A 3GR0A 4USWA 2XLIA 4O3SA 3L7UA 3TYTA 3MAAA 3EDQB 2VPYB 3QO9B 1KC8T 2W7AA 2U1AA 4C11A 4DLGA 4YB6A 4TLQA 4KPCA 3DNCA 2WBMA 4OZJA 2H4WB 2MTLA 4H4MB 3CJSA 2OO4A 1UPMB 2ZOMA 3T1YF 4JI0J 3MFHA 3KLHB 4PG4A 2AV5A 1NH7A 4PWDB 4FF1A 5D4OA 1ZZNA 1HMVB 3RZAA 4EZ9A 5F8JA 2PA8D 2Y1LB 4KYZA 3UD5A 3VALA 3BGOP 1FERA 5GAGU 1G6BA 4OJGA 3DLGB 3VAGA 4OL8A 2B4UA 3JQMA 2M52A 3CCJS 1VBXA 2BKNA 2IVMA 1S1XB 1M5VC 4NXMJ 1PYOB 4NLTA 5A8WB 4ZVPB 4O3PA 1N36J 2FLLA 2AEFA 2O66A 3B78A 3N4WA 2XO7A 3WZ0A 2M0GB 5CYMA 2GCFA 3LP0A 2EI5A 3NEKA 5CYMB 1KS2A 2X1GA 4UOGA 1CJKA 5AT1B 4NXMF 2BW7A 3W2VB 1HKAA 3DMJB 3LH2S 3NAIA 2WONA 1N6QA 4X4VA 3SCLE 4JI6F 3DDKA 3PJ9A 3FSYA 3VHQA 4OZ1A 2VOOA 3U1MA 4EK2A 4RNHA 1KVKA 4DSKA 2BE2B 4OFZA 2Q43A 3A1YG 4WK1A 1FWPA 3DC2A 1A6LA 4LREA 2KTQA 3BQ2A 4I68A 3KLEB 2FJXA 2O3DA 2XMVA 2D41A 3KMSA 3G96A 4EI2A 1DLOB 1O0PA 2BXJA 3HFKA 4ZVRB 5JVHQ 1SKUB 3A12A 5CYJA 4ZN1A 4RNOA 3CWJA 1MU2A 1MROB 4H4MA 3N9UC 5DQIA 1KTQA 3KJNB 3GILA 4IO1A 4JI2J 3VR1A 2R42A 1YK9A 4LF5J 4X4OA 5HO4A 1NDLA 5BXIA 4CLUA 1YITS 1TVRA 3FK4A 1S0VA 1MW7A 4KTQA 2RSQA 1WG1A 4OJHA 2OPPB 2BJ1A 5EX3A 4QWBA 9ATCB 1LXNA 3J7ZT 2B4VA 3NWRA 1T9YA 2F3JA 2XMMA 3PJXA 4YR0A 3PO4A 1F3VA 4PXBA 3KHRA 2DNHA 3HP6A 1HHQA 3EVMA 2YY3A 3PEHA 1TQLA 3HF5A 4DV6J 4OI4A 2DXDA 2LXFA 2P6TA 4EO8A 3GV8B 2Y8YA 3KJQB 4P9SA 2HHUA 2XO6A 1FTCA 1WHVA 2E1CA 1UVNA 3MMJA 3DGPB 2CWXA 2ZUGA 4OX7A 2GHPA 4DUTA 2EK1A 2IBOA 2IFXA 2ZC4A 4URGA 3M2RA 2HQDA 1BUXA 3KG1A 4U8VA 2CA9A 4DV6F 5DLFA 1Q78A 3QFHA 3MOJB 2HGMA 5L1KA 3HX9A 1MMLA 1WELA 2M88A 2W2OP 2QT7A 4WFXA 1GTEA 3R97A 2H5JB 1FDBA 2VZ9A 4ECWA 4ECQA 2HWHA 5KFSA 1I5OB 4Y34A 3KYLA 4OHYA 1SIZA 2U2FA 2PSZA 4KHRA 4X64F 5HP1B 1IQZA 1ZA2B 1CC7A 2LCWA 2LYVA 2OSQA 3U7JA 1N5YB 2ZITA 4HI2A 1BC6A 1YHQS 3E01B 2FVCA 4L3NA 4JI3J 1ZAVA 1RTDA 1F0XA 5D0EA 5CCMA 2G9OA 1QLNA 4B9MA 3QSYB 1U49A 1AZSB 1D9DA 2K7JA 3MGJA 1KQKA 1VQ4S 2QA4G 1YRXA 3RBEA 2CNLB 3GQCA 2JEJA 3I31A 1K0TA 2KVQE 1RT7B 3DRSB 4GKJF 4JI3F 3MMBA 2XS7A 4KBIA 3KK1A 3H59A 1PBAA 3CCQS 4Z7YA 3LP2A 1SH3A 4DSEA 2QLJB 3JSRA 4LSLA 3W7BA 3O8WA 2HVZA 3A3PB 2E5LF 1HNIB 4CNYA 2VODA 2HLTA 1BQXA 4ZKAA 3ISZA 2MHNA 4HTIA 4AFFA 2DHXA 2K3IA 1AZSA 2E7XA 4C8OA 2J9EA 3TA1A 2BQ3A 2QMXA 1BD6A 5ETKA 3LANA 2F65A 3L7PA 1M5KC 1FNOA 2YWWA 2YKAA 3CMQA 4CNZA 4WJBA 1REVA 4ZCMA 4RBTA 4QOTA 3HKWA 4X4SA 1RWXB 4X4UA 1OWXA 3BF4A 2IJNA 3KDNA 3B4DA 4O0IA 4USIA 3KG0A 1IKXA 2LQBA 4NMLA 4W4MA 1NM2A 4WP9A 4WTOB 2R8IA 1VQ5S 3D66A 4JV5F 4KGZB 1XTZA 3CJRA 2X3GA 5D8HB 4NPOA 4K50A 3PYGA 1X4FA 1NKBA 3AD7C 2NCKL 1SBRA 2LLZA 3B54A 3POTB 1O51A 1VYAA 4LBIA 3AHPA 1BQNB 1SJ4P 1QE1A 1U8SA 3V2UC 3VGSA 3ITHB 1FTRA 2RDDA 4CO3A 4K4WA 2J6SA 4JI5J 4NXNJ 4J9SA 1MWQA 1RWOB 3AD9C 2HBRB 1URRA 1S6OA 2KG0A 3QAEA 4L76A 4RNMA 4O3QA 1GX5A 1NPRA 2RQCA 4DR2J 4X4RA 3JSMA 3FQKA 1RT6B 2X1BA 1RP5A 2KFYA 3K59A 2MQLA 2QL5B 1U1QA 1KKHA 2ZDOA 3W5XA 4OHWA 4MFBB 1WSRA 4LF7J 2DJWA 2BX6A 2FC9A 2QA2A 4X65J 2XZWA 2E5IA 3LF0A 4N47A 2AYBA 5I3PA 2DGWA 3GMGA 1T7PA 3ICLA 5ITHA 1KP6A 1S4FA 2E9RX 4LFBF 3QWPA 4BWJA 5IOLA 3WHIA 5IFMA 3QJPA 1QM9A 4HI1A 3CJ0A 2IM2A 3D6HB 2BMBA 4LF7F 1H38A 2MHEA 2KT3A 3PIOQ 4P71A 1J27A 1O6XA 3OTBA 5HL7Q 4W98A 4DV1F 2P6SA 5IV3A 2HFUA 1U47A 4U8YA 3UR0A 3CCSS 1UFKA 4L75A 4LFBJ 3DKDA 3KLEA 2IDEA 1X4AA 8RUCA 3NRBA 2GVZA 3VAHA 3CO0P 1IR2A 3AODA 1HNZJ 4CCHA 4MYUA 5LM7E 2IM1A 3IR7B 1QUPA 2HFNA 3CD6S 1VRUA 1W2BR 2RUSA 3BO3A 2ZDPA 5H9EK 1U2CA 2OIHA 3H25A 1RCXB 2DGSA 2PI4A 1KNZA 4ETZA 3OBIA 5EWFA 1YQHA 2M5YA 4OZNA 1UWBA 2W9CB 2A6OA 1RGVA 2VBZA 2QA4S 3MMAA 5D4NA 4AYBD 3CF5Q 1HNZF 3BR9A 3MPVA 1HQEB 1NJXA 2R8HA 3T5LA 2GO9A 2IHR1 4C8MA 1HW8A 1R0AB 4CTAB 2QSFA 3Q8PB 4DQSA 1X9SA 5BYSA 4ZK7M 3THPA 5E3CA 4F4ZA 2YWEA 2J7WA 2BQRA 3GYXB 1RHJB 4OYBA 2VBXA 2MZSA 1YJTA 4UF4A 2GHVC 2WK4A 3R8YA 2F63A 4FS1A 4LFCF 2KFNA 2CVEA 1HD1A 1FX4A 1NDCA 4WCEQ 3J7Z5 4G1QA 1TUGB 4MK7A 2XYGB 4FPIA 2N82B 3BBCA 4Q0BA 1AA1B 1JLEA 3BYRA 4N7TA 3BREA 5CYQB 3ETOA 1VRTA 2WHOA 2HMIB 2UUCJ 1RT7A 2HQIA 3IWLA 3SV4A 2D3OR 3Q83A 3MAAB 1RTIA 4DV2F 1X7VA 4EUVA 2DH7A 3T6BA 1RT2A 1RT5B 4KO0B 1WC1A 1X4HA 3IP0A 3NY0A 4B9LA 1KOOA 3C2PA 3BQ0A 4F02A 2B7BB 4FNIA 2JVOA 3KUHA 2ASDA 3JXOA 3I0RB 3QGHA 1XNQF 2RAQA 4OYOA 1RJJA 3D3CJ 3Q0AA 4ED0A 4JV5J 2FJDB 4ED3A 2YKQA 4RW4B 1R6YA 2RKIA 1FKPB 1X5TA 3MD3A 2PMZD 3RTVA 1XNQJ 1S99A 2GX8A 2AP6A 3NS5A 1TK8A 4ZCKA 3PIPQ 2GQ2A 2CG8A 1TFWA 4HEA9 3GFYA 3M8PB 3QGIA 1JXVA 2KJWA 5KFCA 1UPPA 1RADB 1SQFA 2EK6A 2ZOFA 4ZLJA 3TUPA 3IRXB 1VMBA 1OQ3A 2ZUAA 4L73A 5F8IA 2KM8B 3TX8A 3TANA 2GVDB 4IG0A 4Y28C 3ILJA 3VGVA 1ACMB 2QLWA 3BGRB 3U1NA 1U2RA 3A8KA 5JVGQ 2QSWA 5CQGA 3CCMS 1LW2A 2N7YA 3HHKA 1G4CA 2FB0A 3ENQA 4CM2A 4HVZA 4EYHB 1FJ7A 2YX7A 3BH6B 3DGVA 4KV8A 1WNEA 2LA6A 3ELHA 3AAWB 3AXMA 3HI9A 4NCGA 4HLBA 3UFCX 4WPAA 3GJTB 5KAKA 3QZ8A 2RB7A 4WE1A 3CUNA 1VBYA 3QLHB 4CLSA 3CDAA 4NMXA 1T9UA 2JHEA 3BSAA 3TRGA 1AUDA 1IWGA 4YY3F 4DQQA 3D54A 2O5DA 3QAUA 3TQEA 2ZH2A 4ENOA 2MJNA 3OFEA 2OPQB 3M32B 3ZZPA 2WB1D 5I42B 1UP1A 3K89A 1TV6B 3N28A 4ZVTB 4DL6A 4DR7F 3UCUP 3CO9A 2BOAA 2FQQB 4DV0J 1ZTWA 2GGPB 3R5JB 4MK9A 4G1QB 2JEFA 1VRUB 3MCNA 3IG1A 1CULB 3CC4S 2QFIA 3TARA 4DR7J 4IRDA 3MEEB 4C6AA 2J7KA 3EZOA 4ZITA 1XK8A 3GV5B 3LP1A 4DV0F 3UR3C 4DI6A 4Y2KA 4TXSA 4P7VA 3N6MA 1JLCB 1K1QA 1TL1A 1UL3A 1XR5A 1DAXA 2VG6B 1Y0HA 3DMJA 2NXEA 3R3TA 4EFAC 1CJKB 3RB0A 1N6QB 2UXBF 4LF4F 1PYTA 3C3LA 3H2VE 4KHPF 5IQQA 5SZTA 1GXUA 2M3DA 3KJVA 1XC9A 1RKIA 4TY8A 1UWBB 1C0TA 4I6AA 1NKCA 1CPZA 2OGUA 1RT4B 2Y3YA 3K58A 3TAMB 3Q8UA 3B4MA 2DH9A 4M1KA 4ANCA 4EU0A 1WHYA 2DGUA 2RDIA 3M9NB 4A8QA 4JI4F 5ETSA 1B0TA 3PX0A 1LNQA 3PX6A 4KHPJ 1QY7A 2BW2A 1MG7A 1S1UB 2WB4A 3LGHA 1WJ9A 1BY9A 2W2MP 3GONA 2R3VA 4YB7A 4PWUA 1M5OC 4K5RA 2JOQA 5ETLA 4JI4J 3RGIA 4CLPA 5HMWA 3DOMB 1RWWB 1U1KA 4LVNP 5IT0A 3RB3A 4J9OA 3EGVA 4G3IA 3MM6B 1R8AA 2J0WA 3S01A 5HJYA 5HN0A 1URNA 5DO2A 2OD6A 1X5OA 2MZ1A 2HFVA 2OEJA 3CCRS 1VQYA 2D7SA 4GO7X 2KXNB 5CXTA 4WZMA 2G0CA 4Z2XA 1Y11A 1M5HA 2VOPA 3L95X 3R5BA 2CPJA 3TZWA 4P52A 4K4TA 3QRRA 4MTPA 1SQGA 2Q6BA 5LSOA 4WYLA 4ECRA 3JSYA 4H4OA 2BJDA 2PIIA 4ICLB 2IM3A 3TEGA 1V3SA 3I87A 3ADAC 2L9WA 1TL3A 3LO3A 2J7UA 4FPRA 4P7TA 4QJVA 3KKFA 5HK4A 3W63A 4FKYA 1AFIA 2VFSA 4J7CA 4K0KF 3MUMP 2FJAB 2IIHA 4KGXB 1S77D 2CRLA 3EE3A 2A1BA 2LDIA 2OMOA 3MI7X 1RAEB 4F0HA 1QE1B 4DPUA 1QD1A 3I55S 4NLGA 1XMOF 1H74A 3M8WA 2KZZA 3B6BA 3M4XA 1S1WA 1OYDA 2CQGA 3UO0A 2MSSA 1EQMA 3FC9A 3PR4A 3IM9A 4DF8A 4KB7A 1TV6A 2ZNYA 5ETNA 3W9IA 3BDEA 3CDBA 1HA1A 1TU0B 3I5BA 1XMOJ 1DRZA 3EVOA 2C3OA 1RT3A 2VIHA 4QPXA 4F4YA 4ANEA 2FHJD 1SKSA 2G13A 3ENVA 1FVQA 3R1LA 2YNHA 4FNHA 1EP4B 4KRWA 1RBLA 3IBWA 2DGVA 4NCGB 3I0SA 2CQBA 5M2UA 5HVFA 5D0HA 2W9AA 3SEOA 4IH5A 5IZHA 4B9VA 1HNXJ 2WVFA 4USUA 2LA4A 3CIZA 1HNIA 4DDFA 4ID8A 3KUEA 2AKWB 4NWBA 4BS2A 3TP2A 3GB0A 5C42B 3D4JA 1RYSA 2GIQA 4LF2A 4DG1A 2ZHBA 1VQ9S 2QIFA 3IRXA 3PZPA 4Q45A 1HNXF 3M2RB 4PKDB 2UVUA 4FYDA 2YBVA 2C3YA 3HVTA 3NAHA 4BC9A 3K5PA 4NASA 1RHUB 4YB5A 1RUSA 4P75A 4ZS6A 5L9NA 5C5JA 1D9AA 1HBMB 1X4EA 2F40A 2XBPA 3PHTA 4JP8A 4K5SA 2HFZA 4RBUA 4LRBA 2DITA 1PO6A 4ZVEA 3PG9A 2KRRA 2AEJA 1NO8A 2HRTA 2MKJA 4I6WA 1U1NA 2K1RB 1WDTA 1N5YA 2IMWP 1RAAB 2XTJP 3BKTA 3GIIA 3KNGA 3OUYB 4KGKA 1AW0A 4H4OB 2IA0A 3UN3A 3NGRA 1HIYA 3KK2B 1NK9A 4HDHA 2Z2YB 2DNQA 2IM0A 3A3NB 3OV7A 2AW0A 2GV1A 1H6KX 4YDDB 1QSYA 3HJVA 4GC7A 3AJ2A 1BLUA 3JQKA 2AGPA 2JC1A 2V6AA 4ECZA 3RB4A 2FGOA 4OYWA 4NLPA 4QR2A 1SKRA 1T9WA 2XWYA 4OYXA 2AJFE 4QWEA 2XMAA 4NCAA 4BBYA 4DN9A 2PD1A 3H42A 1JLEB 4YR2A 3EPIA 4AL7A 5AE3A 1EIYB 3SXLA 3NBPA 2GMJA 3SFUA 3NMAA 1WKLA 1Z1ZA 5A8RA 1RB0A 4M94A 1XQIA 5KFTA 4WFBQ 2VA2A 4KAIA 3G82A 2N3OA 1KVJA 3HDSA 5LXRA 1WF1A 3FBBA 2CJKA 3KLIB 2XCAA 1NJWA 1VISA 2OPPA 4NLRA 4OQJA 3W64A 1KVIA 4B17A 2HPUA 3VZIA 4IRCA 2HHTA 2LP4A 1FEEA 1N0VC 3TA0A 1XN9A 1Q81T 3OLAA 1DQ9A 3FSXA 2CPIA 5KFQA 3TUIC 2ROPA 2B56A 2KL8A 1TL7B 2AGOA 4J91A 2FLNA 3CJ4A 5D78A 4P2SA 1WEZA 3SCKE 1VC6A 1FJGJ 2X51A 5BR8J 5AXKA 2VD3A 4UQGA 2C2OB 1MMNA 2RU3A 2CNKB 3EGWB 4HHUA 4L3KA 3H4BA 2BE2A 2CZ4A 4DFKA 3HT0A 3RBZA 3L7OA 2B4PA 2CAJA 2JNJA 2Z2MA 3MDFA 4Z37A 2VFRA 2WONB 2GGPA 2MZTA 5JJBA 4DV5J 2D3O1 2HHWA 3G6YA 1HD0A 4OX9J 3KNAA 1UETA 3MR2A 3CXCR 1RI7A 2LXUA 1RLCL 2DNGA 1FVSA 4OI6A 3OW2R 1FEHA 2GZOA 2E29A 2V50A 2KI2A 5H9FJ 1OMSA 2IVFB 1JLCA 2E9TA 1Q8BA 2WSEC 1DFDA 4B08A 3TQ1A 2MDAA 3PDNA 1Q79A 4RBVA 2IY5B 1HBUA 1TR0A 1EB0A 4MFBA 2HNYA 1K8AT 1KSPA 3AA8A 3OSPA 1BWEA 1HBOA 2I9SA 1TK0A 3A8IA 3HHLC 3IS9A 3KWMA 3QATA 1TAQA 2BDPA 4M5JA 5B0FA 2NXJA 2WW8A 2DIVA 2CJ9A 2UP1A 4EMDA 2E1PA 1FRHA 5GMDA 3RJMB 3OL7A 4NLYA 1IR1A 1S1TB 2CQHA 1N33F 1X4DA 1J5EF 1KHVA 3HFZB 4NYPA 3DYAB 4FN5A 4URSA 4ID5B 2MSTA 3FVYA 4QIEA 3I6PA 2BR0A 3BB5A 3KK2A 3J7YI 2A0FB 3OTOF 1HBNB 1NSPA 2RRAA 3L09A 2MLZA 2VASA 3NXZA 1P9YA 4FF2A 2KM8C 1UA1A 1N33J 1VFJA 2DHSA 3UI3A 3PACA 4CLLA 3J7AN 2K1RA 2PDAA 3O1LA 2V2KA 1IBMJ 5LSLA 1DHMA 3CB4A 4TN2A 3OTOJ 4OJ1A 2AU0A 3MTKA 3CC2S 2AYEA 2J5AA 3M6XA 3CD5A 4LVOP 2ACYA 1RT5A 1S7IA 4KO0A 5CHCB 4ILLA 4LR7A 1RA6A 2GO8A 4LF1A 2VQFF 4DR1J 1S1TA 2XCPA 1IBMF 4IOAQ 4B3MJ 4QU7A 1YGYA 5CD4A 4W92B 1EETB 5KFRA 2DCUB 3MWBA 1UJ4A 4O44B 2D3UA 2EFOA 2OHDA 2KB2A 1FKPA 3MMBB 4C3MA 2XC9A 4O23A 4NRUA 2ZWOA 2PI5A 1CVJA 4C9DA 2NR0A 1VK3A 4DX8H 3D0IE 2V34A 2YQ3A 2BRLA 1NPPA 2VBWA 1JXEA 2XMKA 2CJYB 4OLPA 1H0HB 2OPSB 1T0TV 5AXMA 1GMUA 3W9JA 5DQHA 2ROEA 2HQCA 3KK3B 4Y0FA 5D4PA 1U45A 5E2QA 1L5UA 4DPXA 5KG7A 4C4WA 1RT2B 2QX0A 3WBZA 6FD1A 1S5ZA 3RU0A 3NOCA 2HRUA 1LFPA 1FRXA 1ZM4A 5HQ8A 3BGFA 1FDNA 1RWVB 1MN7A 1SPBP 2B9XA 5KG2A 2YKMA 5D77A 1HPZA 1GMWD 1TUWA 2L48A 3NNHA 5DG7A 2FLPA 1WC3A 5GVQA 4KH0B 1T8EA 4F25A 3K17A 1D3WA 2V68A 2POKA 1YBAA 3DXSX 1N5SA 2AWZA 4M5DA 3QGGA 3U02A 1K9MT 2UUTA 3N6LA 1F3FA 1IBKF 4QR1A 5GAEU 4CO0A 5KFDA 3VTIA 2GMLA 4U67Q 3ZZOA 2OI2A 3UE2A 4P73A 5ETTA 4BHQA 7FD1A 2NS1B 3OHAA 1QAJA 4ECXA 3MM5B 4JBCA 1IBKJ 1HQEA 2VPZB 3OJSA 3DLKB 3FBCA 4IH7A 1OSCA 2MLYA 3CTRA 5A6PA 3LAMA 3AD8C 3TR5A 2G1DA 4KR0B 4DSJA 2KFZA 5A8WA 4I67A 5FJ4A 4H4KC 3EJMA 2J6TA 2MZRA 4KQZA 1J5OB 4IRKA 2HGLA 4J9NA 2HNDA 4UW2A 4C3LA 3MAQA 2AJQA 3GFHA 2GVZB 3K2YA 2GC8A 4DUYJ 1HMVA 3MEKA 2NPIA 1Q5YA 4PG7A 1FXLA 2YH0A 4J9RA 1YWXA 1SIWB 1MROA 4O4GB 4HT7A 3P6YC 1RE1B 1XWLA 4IQXA 3KLHA 6AT1B 2DGXA 2BANA 1IUJA 4LRFA 1YLXA 4IQMA 5C2GA 4OYMA 3K5NA 3V6KA 4DSIA 2DH8A 1RAJA 1XMBA 2WVDA 2HVEA 1ZA1B 5T14A 1H7XA 2FJBB 2GMHA 1NSKL 2OUGA 3GJSB 5E0OA 2W7OA 3LTOA 4B9UA 2B8QA 2RQ4A 4Y2IA 5IM0B 3BM7A 3H20A 1B3TA 4XAKA 2HBZB 1XR7A 1D8ZA 4ED4A 4DEZA 2FVPA 4PPZA 4NLUA 5DETA 1NKEA 1JLQB 1PG5B 5LT5A 1KLNA 4DQPA 2VQEJ 3CDWA 3JTNA 1EX8A 1P1LA 3LP0B 5D4LA 3JYTB 1T9XA 2COLA 2MQNA 3MM5A 4ZPVR 4O3NA 1HWLA 5MAOA 1TKTA 3W8GA 2DY1A 2ASLA 2MY7A 4FDFA 5EWEA 4CLZA 3BSNA 4F4XA 2OJ3A 2E66A 2Y8WA 2ERRA 1DQAA 2J9DE 2NZCA 4M5GA 2UXDJ 2R7TA 1WDDA 1VHFA 4ANDA 2GJFA 3TI0A 1S0OA 1T02A 3MEEA 4Q44A 4Y2AA 4YN3B 5G4DA 4AT1B 4ED1A 4ELTA 2NYIA 2OAUA 2YPYA 2E7WA 2QZ8A 4ZJQA 5KFHA 4UZBA 1N54B 5CD4H 4I2QA 2VH7A 3K5OA 3POTA 3ENAA 5KTQA 3QNWB 2CJAA 1QSSA 2ZZNA 2B9WA 3H2LA 3OL6A 3CVKA 1U8WA 1BHNA 2YWHA 5C7PA 3F56A 5C42A 1S1VB 1U0HB 2V69A 2YKMB 3KDOA 1F2GA 5E3RA 1NU4A 3M32A 5I42A 2EBGA 2YTCA 1FX2A 3MM7B 2E7VA 3EZUA 5I3UB 2UUBJ 5CZXA 1IBLF 4J37A 3UCZP 4J9VA 4PZVA 2B9EA 5J1NA 3ISND 1REVB 1C0UB 5GMKa 5LSRA 3QLHA 1NXIA 4NOHA 4RW9A 3FRZA 3OFFA 4AL5A 2FJEB 4LIWA 4DR6F 1H7WA 3GR1A 3GWCA 4CLFA 2R7WA 1KBRA 1N34F 5CH7B 2DNYA 4YDXA 3V4MA 4DCPB 4ZMMA 2DO4A 5HVGA 3CCLS 1IBLJ 2FIUA 1FDAA 2DGQA 2ZVSA 4QW9A 2R8GA 1RA7A 1DURA 1F5BA 4ELVA 4D3HA 2UUAF 3W8PA 3BGRA 1PAUB 1IBCB 2MYFA 1NSQA 4X66J 4CZCA 2MQPA 2YQ1A 1U26A 4HHJA 4RUHA 1GTHA 2W8KA 2V8VA 1RSCA 1OYEA 5K5MA 2BA9A 1UVMA 4I56A 1AROP 4TQRA 4DXLA 1NSAA 3GV7B 4X66F 5IXUA 5EWGA 1ICEB 3H40A 4K7QA 2CDQA 1RISA 2KDOA 4P6QA 3CJ3A 1UEVA 3EMTA 1DJ0A 1EZZB 1ZM3A 3FGVA 2E1RA 3CEDA 2A2DA 3DRPB 1KDNA 4IH6A 2NUUG 3ZFVA 4PYAA 3EVWA 3FSIA 5H9FK 3NS7B 4O3RA 4LSNA 3MM9A 1ITPA 2DNNA 1S9EB 5KT4A 2A18A 4WZQA 4GVLA 1UZHA 2DNMA 3T1YJ 4JI0F 2PFFB 4OYIA 2RQKA 3K57A 3C6TB 1Y4ZB 4TQSA 2EKYA 4HACA 5HJXA 2R4FA 2DGOA 1VRTB 3M1VA 2HMIA 2VONA 1YX2A 2MKIA 4PWWA 4O0NA 5K8PA 2QLBB 3ZNJ1 4ECVA 3PX4A 1HI1A 4LSZB 4NZ7A 2AJ0A 2QN6B 4K4UA 2JJ4D 1OQ6A 3NCRA 2JZ5A 3JQJA 4RL1A 4RO0A 1D9FA 1N36F 2WBRA 4N77A 2R7XA 1FKOA 1S9GB 3NGDA 1RCOB 3C14A 2FHJA 2HIQA 4PXDA 2ZH4A 4LQ3A 4DLEA 3NKYA 2FZGB 3CJKA 2OP5A 4F2RA 2BUNA 2KHDA 3SSRA 2W4CA 3IAS9 3BBBA 3NGSA 2BJEA 5KFLA 4B02A 4Z7CA 1XEZA 1UEKA 1VQOS 1R0AA 4ZPTR 1AYEA 1DQ8A 5D3GB 2C2EA 2MPUA 5KFFA 3L3CA 1W26A 3MM8B 4K8RA 4LRDA 4LR8A 3W65A 1NBEB 1Q5VA 4CI0B 3PFOA 4CWBA 2ZJPQ 4IG3B 3ZXWA 2CQPA 4FYYB 3BSOA 2B3TB 4ER8A 3BJYA 5DDRC 3UNGC 3DU6A 1RLDA 4IDKA 2XQCA 3TW0A 3QRQA 4LT6A 2EKNA 1DY3A 4NEZA 4P10A 1S48A 4JI2F 4ED6A 1YJNS 4C8KA 2E5GA 3P5TL 4LF5F 2IVYA 3HSDA 4H54A 1FNMA 4NLDA 3QT8A 4HH0A 1CULA 2XSFA 3A8JA 3DN9A 2Z2ZA 4S0MA 2QLFB 3W3SA 2HHVA 2QE5A 4EEYA 4NCBA 1HYSB 1TL7A 5F9LA 2G2YA 3FDSA 5DDQC 2R2TA 1LXJA 4J9LA 1XNRJ 3RW6A 2XZDB 1SJ3P 1NH8A 2Y1RI 3TJ9A 3ZTSA 1FFGB 2HZAA 2RHSB 1YTYA 4WF9Q 2C2NA 4F2SA 3D7SB 1IKVB 1NK5A 2Z8QA 4WYWA 2W8LA 3RAXA 3C16B 4EBDA 2GAGC 2ZH8A 3QIPB 4RWWA 4UOFA 5IC6B 1XNRF 1CLFA 4NI2A 3RAMA 3T19A 3PNIA 1KRPA 1RAOA 2B5JA 4XDCA 3BSCA 4N5SA 4WFYA 2KO1A 1RT6A 2DPIA 2P2CB 3H7HB 4PUOA 3NL0A 2JC0A 5FDLB 5L8RC 1FE4A 4RZRA 2ADBA 3H5XA 1XBWA 3NBPB 4HKQA 2NXCA 1IWAA 1REGX 2RVJA 2V4JB 4MAKA 3IAM9 2B43A 4OZ0A 4P2FA 4RJVA 5ETOA 3SQGB 4KKOB 4R5PB 3EUNA 4NLQA 2NXUA 1I51B 4C11B 4DPOA 3GJQB 1ROFA 4LBPA 5HI7A 4A46A 3DM2A 1BQNA 3MXHP 2H5IB 4X64J 4F3QA 1JJHA 1FRJA 1X60A 5IT9Y 1HHSA 2CUYA 3MCOA 3TUJC 1PBUA 5ADZA 1Q7LB 2MQOA 1UWAA 4I4BA 4MMOA 4WP8A 3MR7A 1IM4A 2AD9A 1T3OA 1VQSA 3OVAA 4A8WA 1VQKS 2NREA 4DWIA 4M95A 1H98A 2I1RA 3DI6A 3RUBL 2BACA 4DOZA 1S0MA 1FESA 1GXTA 2W7PA 4FVCA 4MKVA 1N52B 3SI8A 3I5AA 1Q82T 3I0RA 1HHTP 4ZN3A 2Z2LA 2LU1A 1YJ7A 3GIMA 2ZH6A 4DMZA 4RU2A 1X5SA 2JSXA 1S12A 4H4KA 1OY6A 2XI2A 4DJBA 1RHKB 3FCHA 2WW4A 1WC5A 4MIWA 3DM2B 1YIJS 1OS5A 3SMZA 4OZLA 3FZ2A 5FD1A 4FVMA 4ETXA 3PEJA 3O44A 3KHLA 1Q86T 4B9NA 3EWGA 2CKWA 3DRSA 2LQ8A 3K5LA 3DDIA 2WSCC 1TKXA 5D15A 2LEPA 1Y3JA 3LW5C 3SZ2A 3HHEA 2HFSA 3HSZA 3BR8A 2R2UA 1N48A 1LEOA 5B0CA 5F3ZA 1T3NA 1OPIA 2I2YA 1RT1B 3BN7A 2DKOB 3I96A 2HNYB 4Y3CA 3EPGA 1Z2ZA 3H4DA 2MZQA 4IUFA 2GAHC 3AOBA 1EP4A 3UNYA 4F3OA 1G1XA 1JLBA 2R2SA 2V8DA 3GYGA 2RU9A 5IS2A 2MQ8A 2VG5B 3CJ2A 3DXBA 1X5PA 5HBMB 2R7UA 3UD3P 1S6UA 2DXEA 3MM7A 4DBQA 5I3UA 2HLUA 3BH7B 1H2VZ 2VKRA 5KT3A 2BEFA 1UCNA 4TYAA 2ALZA 2UXCF 4AL6A 1RWNB 1Y5NB 3OR2B 4DQIA 3S6EA 3LA0A 2XSJA 2ZE2A 1N88A 4A8MP 1X9WA 4XPEA 2DR5A 5EGYA 2BKPA 4I1TA 2VJUA 4DV4F 4F50A 1U1LA 3DOKA 1LK7A 2R8JA 1FFWB 4DR2F 1R7IA 3PV8A 4ZVOB 3EYZA 4QQBA 1S10A 5GMEA 2V4RA 3PR5B 4C3KA 4GVBA 3U27A 2BVZA 4TU8A 4RPFA 4X65F 4DQRA 3PW7A 1ZM9A 1S97A 1R0CB 1Y9OA 2QEXS 1P6TA 4C8ZA 1QUVA 4M5IA 1HR0F 1QAXA 2NXNA 3MMCA 2VKZG 3ZZTA 4WTYA 3ZZUA 4ECTA 1LWEB 5T41A 5DS7A 4AUKA 1VHIA 1YDLA 3SDEA 5KG3A 4DX5A 3JAMY 2A10A 2R7RA 4OV1A 5D3GA 2Q3PA 4KJIA 2HWTA 3D2WA 5IM0A 1VIOA 3OT9A 4ZPAA 5KFZA 3ET6A 3KLIA 2XM3A 5J2NA 1HR0J 1ZM2A 2DK2A 3OTDA 5THWA 4XPCA 1B0PA 1U0SA 3M6UA 3QZ7A 1XMQF 2CPXA 1KQFB 3C14B 1MMDA 2OKQA 3G82B 2W2PP 3T9NA 1BQMA 2QC3A 4F67A 4PYDA 4QBUA 1DLOA 1WKJA 1VR6A 1X4BA 3TWZA 1T03B 1B4SA 1FRMA 4EO6A 1YJVA 3C15A 2N4CA 2RDJA 4HACB 3MPYA 2BV3A 1K73T 5L9XA 1NHKL 4ZIVA 2M7SA 3Q2TC 1RAFB 3NG8A 1KHWA 5AXNA 5AJ3F 2RRBA 3D1HA 4USJC 2ROGA 3LAKA 4CLWA 3J7YU 4HL9A 3JB9k 4JV1A 5HROA 3AJDA 3P45B 3Q23A 3NP5A 4TY8B 1YKWA 2W2QP 5KG5A 3JAMU 3U1LA 3IGVA 1FNXH 2ZWPA 4NLOA 3KUGA 3MMCB 4IYQA 2MKCA 3W5YA 5L1IA 2VJVA 1UVKA 2OEKA 5B08A 3TZXA 2KT5A 3GG1A 3KHGA 1OO0B 3QPIA 2HAIA 2OSRA 2IC3B 1WI8A 2V8PA 1UKUA 2H9ZA 4U7CA 3EXCX 1FK9A 4YHHF 3Q2SC 4OMFG 3SFGA 3OHBA 2C22A 3PRDA 1FCAA 2EXUA 1RWPB 2UUCF 2W4DA 2BABA 4DV2J 4PWDA 3Q24A 1X4CA 2Y0BB 3RAQA 1Y3KA 5HVHA 2I5JB 1K1SA 1T9VA 3VAJA 2UU9F 3LP2B 4CH0S 5EX0A 2K06A 2CDRB 1P9QC 2AIRB 2J9CA 1RAGB 4L72B 2PA3A 4LR9A 3TVZA 3RB6A 4N76A 4K4VA 1MLAA 5LL6d 5KFJA 3KTQA 3OR1A 5HBMA 2AYMA 1RKJA 2V0NA 3WC2A 5J2MB 4IFYB 3ENWA 1GXLA 2VFTA 3K7RA 3QJJA 4TKTA 1F60B 1HQUA 2XY6A 3E01A 4B3OB 1HLWA 3H5UA 1NK4A 1TKDA 4HT5A 1SC6A 3KG4A 2QYCA 4NZ0A 1T94A 1YVFA 2YX4A 5G0RB 3JTPA 3L4BC 4KFBA 1LW2B 2C2MB 3V6JA 3T1HF 2PE8A 3MZIA 3NNCA 5ETRA 1M0SA 1F2HA 2AF6A 1B99A 3DCAA 4J9QA 3UVJA 2NLWA 2QO3A 2EG1A 3EICA 3OTCA 2HHHJ 2Z57B 3E51A 1HWJA 3H90A 2XS2A 1AFJA 4JV0A 1HWUA 3G6VA 1I94J 2RF2B 1VQ8S 1FFSB 2ILZA 1B7YB 4WP3A 1H73A 1KEKA 1XR6A 2CQ4A 2VV5A 4IKAA 3HD2A 5SUHA 5KG4A 1Q8IA 3BS9A 2LEBA 2QLXA 3HD1A 1FXDA 4URQU 2HHHF 1IKYB 3MECB 2DNZA 3MUTP 2E1AA 4USMA 1UTAA 1I94F 3IM8A 3LUYA 2F4VF 1JMTA 3G87A 3NCPA 4RW4A 3BPDA 4MH8A 2KRBA 4FZVA 1NMEB 2PO4A 1TKTB 2CQCA 4O3OA 1TMMA 1LOUA 2Y0SD 1SKWA 4Q8EA 2VPXB 3CC7S 3G8TA 2HQ3A 2HK2A 1IKWA 4X84A 2MKSA 2P9GA 3HK2A 1SJQA 2Q79A 1Q53A 4XK8C 4OZ3A 4K4ZA 2OMLA 4ZLNA 3MM6A 4OZ5A 3FZBA 3BO4A 1IJFB 1Y7PA 4DUZJ 2V4JA 4Q0BB 3QBCA 4OV6A 4YY3J 1PJ5A 1GH8A 5KG1A 3IWNC 1VI7A 1SB6A 1VBZA 1F1BB 3I82A 4JB8B 1C1CA 1BQMB 1CC8A 2B0GA 1B70B 2OFGX 4J5OA 2DHGA 2H48B 4ZP6A 2B5JB 3T5KA 3V6HA 4PUOB 4Q2LA 1RK8A 1S1UA 3FFIB 4DUZF 2MMYA 4WXWA 4CT8A 3M9MB 3CNQP 4Y2CA 4F36A 4NL5A 2FPHX 2ZBCA 3CCZA 3ET6B 4USHA 5J2NB 5KFGA 1VCTA 5KOWA 1SL2A 1J5OA 1GQEA 2O67A 3OPKA 3NOGA 1VQ6S 2AQ4A 4XO0A 2B9YA 3R6GB 2VFVA 3MMAB 4GO5X 1JNZB 3DLBA 4OYZA 3BPSP 4PG8A 1NPKA 2W25A 3O5TB 4WK3A 2JX2A 3F73A 2OELA 1RWKB 5D0RA 4DN0A 4CQ1A 4MKAA 2QL9B 4B9TA 2PN6A 1S1XA 3P96A 3BKUA 3R5DA 4FP9A 1V5VA 1HI0P 2J6UA 2UVWA 1DTTB 1R8PA 3GU0A 3LP1B 4G65A 2N4DA 4IOCQ 1DTQB 1WHXA 4OI2A 1NJYA 4ELUA 1TTHB 1KLMB 2KHCA 2VB6A 3DLEB 4M5DB 4TVAB 4AD6A 2R2RA 1UJ5A 4ECUA 3V6DB 1TMJA 4R0JA 2QJ3A 1U2FA 3HLUA 4QR0A 4TY9A 4JI8J 1EHWA 3I9V9 1WOOA 4IG3A 4I0WA 1LK5A 1VLOA 5DDOC 4M8LA 1DZ5A 2GS8A 2YKNB 4A8FA 3Q8YA 3Q8RB 4WU3A 4X62J 4ZHRA 2LQ9A 4MIAA 4ECSA 1NB7A 4BC7A 2AT1B 2RNEA 2W9BA 2LECA 4ZPCA 4GKKF 3TEHB 3H2UB 2V2QA 6FDRA 3QT6A 1IXKA 3CJQA 5A6WA 4K0KJ 2OPSA 4QYRA 3KK3A 4J9PA 5J2QA 4CT9A 3T6JA 3VVTA 5K8NA 1PIEA 4YEAA 4OIXA 3AA9A 1QVFR 3JSMB 1YRTA 2I0XA 5ETVA 1WEYA 3I4PA 1RABB 4LF6J 4RNNA 2XHCA 2DISA 4I69A 4NX9A 5F9NA 3CIMA 3WIUA 3PYDA 2QFJA 4IOBA 1FKAF 2PEHA 3FQLA 2PMWA 2L41A 3UDLA 5GADU 3VCDA 1L3KA 4KGVB 1EETA 2FY8A 1SCJB 2JLEA 2QA1A 2WAQD 2LKZA 3CCWA 3GE9A 3MHYA 4G1IA 5L39A 3J7A1 4LF6F 1IM6A 2JWNA 4QIFA 3G6XA 5H9EJ 2XLKA 2ASJA 1CJVA 2DHAA 3GIJA 2HS0A 3MURP 5DG8A 3Q8QB 2YNFA 2AYGA 1J2VA 2GHWA 2EPIA 2DR6A 2KJVA 2AEMA
chains in the Genus database with same CATH topology
4U9RA 1VQMS 1JKHA 2CPYA 4KSEB 3PFEA 2J76E 4E0DA 3M9OB 4K2XA 1HWIA 3FEYB 4FXVA 4QW8A 1YJRA 3SSSA 5LMNF 2DRAA 2D9PA 3LGMA 1HBNA 2ZH3A 2V9WA 3HHDA 5GAGI 3M8QB 4CO2A 3H5SA 4MIBA 3AQOA 3VQTA 2NQPA 2V94A 1WHWA 5B09A 1RTIB 2VFUA 3N01A 5B0AA 3VAKA 4F4KA 1TL4A 3PW4A 3ZZYA 4KKOA 4R5PA 4QCLA 4NA2A 2J9DA 4C0OC 3G6ES 2ZH9A 5IWAF 3THTA 2DNPA 2LMIA 2XLJA 4C97A 1HL6A 4ZPDA 4C2MA 3HJFA 1FA0A 3AB4B 5KFAA 2HG4A 3IS9B 5AE1A 3VWSA 1TZ0A 1HBOB 4ERDA 3I0SB 2RH3A 3GG0A 2PMHA 4C8NA 3GSDA 1VC5A 4JYAF 4PR6A 2CVIA 1C0UA 1YRUA 2ZD1A 4CTAA 5J1EB 1SH0A 3F41A 1T05A 2FUG9 2OPRA 1DARA 3OR1B 4OX8A 4PXEA 3AY0A 4RX6A 4ZCLA 3S1TA 1R8CA 2DPJA 1Q1KA 4FXWA 5CZVA 4DSFA 4OHVA 1HYSA 5F41A 5M2RA 2VBYA 4N8OA 2LDYA 3AJ1A 1F9FA 1ELOA 3DOLB 3JTOA 5E33A 5LJ3Y 3G9CA 3DGPA 3EXYA 3SSQA 4A48A 3KLGA 1DTTA 5HMXA 3R5CA 1L3VA 4QYZJ 2Z0GA 2FHKA 3R5AA 2PT0A 2KT2A 1NAQA 4ICLA 2YH1A 3Q22A 2YWGA 1SQEA 2XI3A 3QJLA 3T5HA 1VQPS 1T95A 3MEGB 3QIDA 3G8SA 1SL1A 2IRXA 2MJUA 2RILA 1OSDA 3LWLA 3BEGB 1TVRB 3SCJE 4EWTA 1I6JA 1N56A 3R27A 3FFIA 1FRLA 4QWAA 4QZVB 3AH6A 1KR4A 2XMJA 2A3JA 5K14A 2JEGA 3MEDA 2BANB 1MU2B 2AJ1A 3N0VA 3BN4A 3RW7A 5E3AA 2ZC3A 3ZC4A 4DV7F 3PW2A 4RW6A 4DV5F 4CH7A 2HFOA 2QMWA 2E5JA 3N79A 1JLGA 4ES1A 3ITHA 2ZFHA 4UY85 2XB2D 3I5CA 1FO1A 5KFVA 3DOLA 4HTJA 2E9ZA 1NK8A 3IRWP 4TLRA 5CA5A 1RT4A 4X2BA 2AJ4A 1S7HA 2W24A 2DD8S 3C66A 3SDEB 5M2PA 3AB2B 3D0GE 3DLKA 2R7SA 5BJRA 2D74B 3OUYA 4NLSA 1IKXB 1U24A 2LVWA 3M05A 2OPRB 5DLGA 3TAQA 1T05B 4B3TF 3M2UA 1ZETA 1FE0A 4YR3A 3OTEA 1NJZA 5A0YB 2AX1A 1HW9A 1U1MA 1X4GA 1ZBTA 3G71S 4K4XA 4FF3A 3IG1B 5F0WA 5BYRA 2JLGA 1HWKA 2EFNA 3M30B 3K8VA 4ILMA 4YMEA 2L3MA 4TYBA 1IR0A 2XGPA 4X4TA 2R7VA 2OD4A 3KK1B 5DG9A 1RWUA 2OPQA 2XWXA 3K8WA 1PC5A 2RRNA 4NYZA 3DRXA 4Y00A 2Q6CA 2CPZA 1C4CA 1KOHA 5F8MA 3OXFA 3VAIA 1S6PA 2JL9A 3OJUA 4RUCA 1UVLA 2JH3A 4CO5A 1E6YA 1RTJA 4E8UA 4Q2MA 3MFIA 1JLAA 1FXRA 1WTBA 2C3UA 2RT3A 2N3LA 2RD5C 1OPZA 1R31A 2EVZA 2KVIA 3GIKA 2GW8A 2BBEA 5E7OB 1U1PA 1TUVA 2HS3A 2ILYA 3V4IA 1QVGR 5DGBA 1IN0A 2FD2A 4ED5A 1X0FA 2ZOGA 1L3SA 5KT2A 2W4PA 2DVIA 5EUHA 1LKZA 4OI3A 2G4BA 2BM1A 2CFXA 4EYIB 1K0VA 5L38A 2P9EA 3RR8A 1LQ9A 3KFWX 3M8QA 4ED7A 3OSNA 1S79A 2C3PA 2ZNZA 2F8HA 4QIVA 2FVRA 3TVYA 5HLFB 1B7FA 3IWXA 1HNWF 4ATNA 3DI6B 4ECYA 3TO8A 2K7KA 4BWMA 1SH2A 4RW8A 4C0BA 3BDPA 2IA6A 1S6PB 5C24A 5E41A 1C1BA 4AE5A 2GNKA 1G3OA 2CQIA 1A9NB 5KT6A 3HM9A 3RRKA 1WD6A 4ALZA 2DNRA 2XNQA 5EN1A 3OFHA 5T7LB 1JLGB 4PQUB 5KFEA 3S7RA 3DLLQ 1SXLA 4UUXA 2XEXA 1T03A 1FHTA 4A8OA 4DSLA 1Q4RA 1B0VA 3D1OA 3TOQA 3GZ7A 4LF9F 4JI5F 2HHQA 2ZKTA 4NXNF 3X1LB 2XULA 1DTQA 5L1JA 5DQGA 3H98A 2XGQA 1R8BA 4HYKA 3HXMA 2HHSA 5I4MA 1A7GE 3UWTA 1WWHA 4N56A 2YX1A 2CYYA 3W2VA 2JLFA 4NA3A 5L1LA 2CQDA 1ZPVA 1N5TA 1C0TB 2F9DA 3MEGA 3UDCA 5C25B 2RS2A 4X4PA 2YKNA 2MKHA 5KFPA 5C25A 3HPOA 4FBUA 2W9CA 3UW1A 5KG0A 2M2BA 2OH2A 3OL9A 4QU6A 1NRKA 1S72S 1DBDA 1W25A 3M2VA 2EWHA 4LUBA 4I7FB 3LALA 3FEZA 2BZ2A 4I7FA 3FNNA 4RKUC 4RW6B 3LPYA 5AXLA 1UEUA 4YUDA 3S8SA 1TKZB 3K5MA 2MQQA 3CGIA 2OLWA 5GAHI 5K14B 1HPZB 2I38A 5D6GA 3ZZ0A 4X4QA 1QAIA 2ZHOA 3M8SA 4MK8A 5A8KA 1JLFB 4CIOA 1GX6A 4F4WA 4NLXA 4NRTA 4JI1F 2VPWB 5AE2A 2XMWA 3J81Y 3H5YA 5KFXA 3PO5A 4RW8B 3D28A 1RT1A 5GAEI 1S9GA 3AQPA 5A8RB 2FY1A 3CD7A 3O6QA 3GYNA 5HLFA 1L3TA 1Q8LA 3NCQA 3O2IA 1YJUA 5FLXY 1G2EA 1U1RA 5I3QA 4LJMA 1NK7A 4PQUA 5DM7Q 2DGTA 5J2PA 3K0JA 1SV5A 5F8GA 3CSKA 2DIUA 4B3RF 3X3UA 4WU2A 4EGLA 4EBEA 2F1FA 4ED2A 3KMQA 3GFZA 2F7VA 2FC8A 4JOUA 3DRRA 1GT8A 1O5JA 2J0QD 4B9SA 2RKIB 1JNRB 2JEIA 1YI2S 2FVQA 3QMQA 4Y6IA 4KFBB 1NK6A 4MYTA 5J1EA 4KHMA 2HZCA 4ITSA 2NZ4A 1U6FA 4DS5A 2UV8A 2F9JA 1LW0B 3PXGa 2MGZB 2B6AA 3CDEA 2FGCA 5KFIA 2XG8A 4OJ3A 4C0HA 3A8EA 5KFNA 3CCUS 4PG5A 3WDOA 3IGNA 4ZP9A 3C6UA 2UVRA 2EW9A 3IC1A 2CQ0A 3TUZC 3SQGA 2I5JA 3QGPA 1SJRA 3CDUA 1IQTA 5HMZA 2Q1LA 1FD8A 2YWFA 5G0RA 1MSWD 2ZZMA 4A8XA 5GAHU 4KT0C 2YNIB 3G4SS 1ZZFA 2XY7A 4DL7A 4OHZA 2HNZB 3WX4A 2KU7A 2KN4A 3M2UB 4IFYA 1HI8A 3CE8A 4EBCA 2FVSA 3M6VA 4ZHRB 3UPFA 2B7CB 3RRGA 3RBDA 2HVHA 1JIHA 2IJFA 4IO9Q 2JVRA 3PRBA 4F26A 1ZPWX 4BDPA 2DNKA 3DU5A 4IFVA 3OVBA 2JDJA 4CO4A 1VS3A 2KG1A 1FK9B 2FHOB 2X1AA 4I6YA 2VUGA 1CQNA 2AX0A 1LWFB 4OHXA 1H2TZ 4QPTA 2C2DA 2HHVA 4Y2MA 1D1UA 4C7QA 3OXLA 1UFLA 3IXQA 1CSJA 3SV3A 2CJQA 3IR5B 3FJ2A 5HROB 2L9NA 4OX6A 1H2UX 1U4BA 2WCXA 2LQJA 2B51A 5IT4A 2RJZA 4YFUA 2F8EX 1U7LA 4ZDNA 1JLFA 1UAWA 2MZJA 5A8KB 3M6WA 4DV3F 2V5HG 4RW7A 1LWEA 4U6PA 2ZH7A 1VC0A 4AXIA 2SXLA 2ZJRQ 4R0EA 4CO1A 4BCAA 1TKZA 4DL0C 3D0HE 1HNVA 1LWFA 1Y5LB 1U6ZA 3SCIE 2D9OA 3HVAA 2YVSA 2HVIA 4HH1A 2KH9A 2RQMA 2NUHA 4YB1P 3UCGA 2CQ1A 3MOZA 1D0EA 1V3ZA 1FF2A 2UVVA 4DS4A 4A8KA 1N5QA 2XSJB 2ZE2B 3LWMA 1JJ2R 3CD0A 3R1HA 2CPFA 3T3FA 2DNLA 2K8GA 1QTMA 7FDRA 1R8HA 2P9CA 2UZAA 2HS4A 2CIMA 2CQ2A 3FMBA 1PILA 4FXDA 1TL1B 2