3CUNA

Aminoacyl-trna synthetase ribozyme
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
91
structure length
91
Chain Sequence
RPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Rna/rna binding
molecule keywords RNA (92-MER)
publication title Structural basis of specific tRNA aminoacylation by a small in vitro selected ribozyme.
pubmed doi rcsb
source organism Homo sapiens
total genus 16
structure length 91
sequence length 91
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3cunA00
1KOHA 2MY7A 1PGZA 1WF0A 3UD4P 3G71S 3MOJB 2MZTA 4IOCQ 2AYMA 4TU9A 2GHPA 2M52A 1KC8T 2MJUA 3TO8A 4BS2A 2CPHA 5LJ3Y 2MZQA 3CD6S 2ADCA 2MZJA 1DBDA 4FXVA 2MB0B 3MUMP 1ZZFA 2HGMA 2KRRA 5DETA 2M9KA 1KD1T 1FJEB 3I56S 2ZJQQ 2GO9A 1U1MA 1N54B 4W92B 2MXYA 3MXHP 1D8ZA 3H2UB 1WELA 3DXBA 5IM0B 1U6FA 4A8XA 1DHMA 1JJ4A 1K73T 2D3OR 2DO4A 5ITHA 3VALA 1QM9A 1X5SA 4UQTA 4TLQA 4IO9Q 3U1MA 2CQ2A 4ED5A 3OW2R 2AYBA 3CC7S 1WG5A 2DNMA 2XNQA 2DHXA 1OIAA 4Z2XA 1S79A 2MKIA 4Y00A 2KM8B 1M5PC 4TU8A 5GADU 3G8SA 1Q86T 3CCQS 2MGZA 2X1AA 1M1KT 4WKRA 3UWTA 2DGSA 3VAMA 2OTJS 2KXFA 2O3DA 4C4WA 4WFAQ 2AYGA 5DM6Q 1WEYA 1YTYA 3G4SS 2DNRA 2FC9A 1X4BA 2RS8A 1WI8A 3SMZA 1VC5A 1U6BA 2CQIA 2XB2D 3D2WA 3R27A 1VBZA 1M5VC 5GAHU 3P5TL 2ERRA 2VOOA 4OZ1A 2LMIA 2LEAA 2DGOA 1M5KC 1A9NB 2RU3A 2B0GA 4QU7A 2MJNA 5GAEU 3EGZA 2DHAA 2PE8A 2DNYA 4PKDB 1WF1A 3MUTP 2KT5A 1U2FA 2MY8A 2CQ3A 3FEXB 3Q2SC 2E44A 1U1KA 3HI9A 2CPEA 3EX7B 2RVJA 1KOOA 3CCLS 1NO8A 2OIHA 1X5OA 2CPDA 1WHXA 1WG4A 3MI7X 1M90T 4QU6A 3V4MA 1WG1A 2DNQA 1UW4A 2RT3A 3CCUS 4CQ1A 2DK2A 2HGNA 2JWNA 3TP2A 2QFJA 2KI2A 3BO2A 1WEZA 2K3KA 5GVQA 1R8PA 1X4EA 4LMZA 1SJRA 1X4DA 2MMYA 4CH0S 1WEXA 4U67Q 3G8TA 3G96A 2M4MA 2LXUA 1YIJS 1OO0B 2WBRA 4YUDA 2L08A 2KXNB 3VAJA 3VAGA 1S72S 2DNPA 3LPYA 2DH8A 2M70A 3CCJS 2JVOA 2DISA 4C0OC 2CPXA 2A3JA 1WHYA 1VQ7S 5D78A 2HYIB 2CQ4A 1U1NA 1NJIT 3CPWR 1WF2A 2DITA 1AUDA 2K8GA 3LQVA 5LXYA 4C7QA 1SJ4P 1U1OA 3CUNA 2U1AA 1JMTA 4YB1P 1X5PA 3UCZP 3S6EA 5IFMA 2U2FA 2KXHA 2DGWA 1K9MT 5JVHQ 3JB9k 1VQPS 2J0SD 1VBXA 1JJ2R 3CCRS 4YOEA 3CCVS 3K0JA 2KU7A 2JX2A 3J7ZT 1SXLA 2DNZA 1M5OC 3CMES 1VQ4S 3B4MA 1D9AA 1X0FA 3MD1A 1WWHA 3MURP 1H2VZ 2M8HA 2JRSA 2CQHA 4WIIA 2OTLS 1YJ9S 2E5JA 1HD0A 1X4GA 5DDPC 1U1RA 1H2TZ 3ULHA 3THTA 2J0QD 1L3KA 2DNLA 1OPIA 2ZJRQ 1UFWA 2EK1A 5IM0A 2NZ4A 2EVZA 1N8RT 3MDFA 3CULA 2M2BA 1R8HA 1FO1A 4F26A 2XSFA 1FXLA 2KN4A 2CQPA 1YHQS 2HVZA 3VAKA 2MPUA 3P6YC 2DNNA 2CPYA 5HL7Q 1RK8A 2CQCA 3THPA 1O0PA 2RRBA 2YH0A 1VQKS 2LCWA 2MZ1A 4OZ0A 5LXRA 4J5OA 1U1LA 2MHNA 3J7YU 5CYJA 3G9CA 3ZZZA 1HD1A 2KVIA 2MYFA 3UCUP 1H6KX 2J76E 2MSSA 2DNHA 2MQQA 2RRAA 2QEXS 3HHNB 3RW6A 2M88A 2DIUA 1B7FA 2V94A 3RW7A 2YWKA 3VAIA 3P3DA 4IUFA 2DGQA 5GAGU 2X1FA 2CPJA 3SDEB 3CXCR 2KHCA 2BOPA 2Q79A 5IQQA 3P49B 3MUVP 3CCMS 1FNXH 4WFBQ 1X5TA 1YJNS 1P1TA 2E5IA 3PIOQ 2BZ2A 1UAWA 3BEGB 2XS7A 2ADBA 4M5DB 2KM8C 4F25A 3UCGA 2YH1A 2FC8A 5DDOC 2LA4A 2AD9A 1QVGR 3TYTA 1VQNS 2KH9A 2DNGA 5JVGQ 2M8DB 2RUGA 3EGNA 4LIRA 2LA6A 1X4HA 1YI2S 2EK6A 2DNKA 1VQ8S 2MZSA 3S01A 2VODA 2YTCA 2F9DA 5LJ5Y 3MD3A 2MZRA 3BO4A 4UY8T 2HZCA 2DH7A 2M7SA 2MSTA 4EGLA 2QA4S 1ZZNA 2XS5A 2CQBA 5D77A 1N88A 2SXLA 1VQ6S 1DRZA 2D9OA 3BO3A 2MQMA 2G4BA 3IWNC 3U1LA 4QQBA 1VC6A 1IQTA 1P27B 4P6QA 5HO4A 2N7CA 3DLLQ 2NLWA 1F9FA 5LSOA 3PIPQ 1VQMS 1FT8A 2CPZA 3S7RA 3R1LA 5LSLA 2OSQA 2DGVA 4IOAQ 5EN1A 3H2VE 2RQCA 2MQLA 5DM7Q 1SJFA 5DDQC 1RKJA 2PEHA 3I55S 2DHGA 2RNEA 1URNA 2I38A 2VOPA 1UP1A 1VQLS 2RS2A 4WCEQ 1U1PA 3NS6A 2XNRA 2OSRA 3FEYB 1WI6A 2G1DA 1VQOS 3BS9A 2LYVA 3US5A 5MLCV 4LJMA 2MQOA 1XN9A 2MGZB 4RU2A 2M0GB 3CCSS 2MKSA 2DO0A 2FPHX 3VAHA 1YWXA 4W90B 2LQ5A 3CMAS 2I2YA 2OJ3A 2MKCA 1VC0A 2HGLA 2N3LA 3IRWP 4ERDA 2DB1A 3NS5A 2CPIA 2G0CA 3CCES 2JVRA 2ZJPQ 3Q2TC 3N9UC 1VQ9S 2MKJA 4CIOA 1K8AT 1PO6A 1WHWA 2D9PA 2MQNA 5GMKa 2CQ1A 2CPFA 2L41A 1SJ3P 1HA1A 5BJRA 2FY1A 4ZKAA 1X4FA 3G6ES 2CQDA 2KRBA 4FXWA 3L3CA 2KG1A 3R1HA 3UE2A 5DDRC 1QVFR 2MQPA 3NNCA 2X1BA 2LKZA 3UD3P 3SXLA 5H1SV 4CH1A 2KYXA 3CC2S 2CJKA 3S8SA 4WF9Q 1W2BR 1OWXA 3NNAA 3VF0B 3NNHA 1FHTA 2F3JA 3CF5Q 2CQGA 2UP1A 1X4CA 1NU4A 1X4AA 1G2EA 1VQ5S 1YITS 1WTBA 1HL6A 2DGTA 2YKAA 1BY9A 4F02A 2XS2A 2E5HA 1FJCA 4PR6A 4V19X 2E5GA 2DH9A 2DGXA 2DGUA 2LECA 1Q81T 1KQSR 4WFNQ 1ZH5A 2N3OA 5CA5A 2KG0A 2LXIA 4TU7A 3B4DA 5CXTA 2J8AA 1A7GE 1WHVA 2KFYA 1DZ5A 1JJHA 1YJWS 1U1QA 3VAFA 4PRFA 2LEBA 1FJ7A 2L9WA 3SDEA 2F9JA 2DIVA 2CQ0A 1SJQA 2DNOA 4Y0FA 1N52B 1CVJA 3CTRA 5FJ4A 1Q82T 2DHSA 2MKHA 3ZZYA 2N82B 4QPTA 2RQ4A 1H2UX 2X1GA 2VONA 1VBYA 3CC4S 2AYEA 2MKKA 1Q7YT 2FHOB 3NMRA
chains in the Genus database with same CATH superfamily
4F4KA 4JV1A 4QR2A 3LP1B 3DOKA 5B0GA 3TZYA 2GZOA 4DU8A 2HGMA 1TR0A 2M9KA 5HMWA 5HI7A 4F3QA 5A2QU 1PBAA 4DPYA 3MR7A 1Z2ZA 1RU2A 1HHTP 4DSIA 3CC7S 2R8KA 4B3MF 1O51A 2ZH2A 4ECXA 1GTEA 3M8YA 1Y4ZB 1HFEL 4ZP7A 1LKZA 3KK1A 2DNRA 1X4BA 3TJAA 1NPPA 3I31A 3LGNA 1MN9A 3QGHA 3OVAA 2DVIA 3SCIE 3JYTA 2HMIB 3I87A 2HS0A 3IGVA 4K2XA 4F3MA 5FDLB 5K8PA 4OI1A 5L8RC 4JI5J 2L3MA 1EQ0A 5IT0A 2MY8A 1TL7B 4X65J 3HVTA 1RTIA 3EE3A 5ETKA 1B7YB 1Y5IB 5BR8F 2IC3A 1HBMA 1BGXT 3JQMA 2MMYA 4WYWA 2FHJA 2KDOA 5M2UA 2R7TA 4NWBA 4DS4A 5C25B 3BM7A 2FYXA 4LF4F 4YUDA 2XCAA 2M70A 2V4JB 2DISA 3MM6B 2A3JA 3C6UB 2Y8YA 4AUKA 3VQTA 2DITA 1RTDA 1ELOA 3OVSA 1N56A 1CJKA 2OAUA 2B8QA 1TELA 3S6EA 1KFDA 2CA9A 3VCDA 4C0BA 1Q8LA 2XSJB 1IKYB 3V2UC 1TV6A 3PO5A 2C2ZB 1U2CA 2AJ1A 2C3PA 3OHAA 2XY7A 4DLEA 1T02A 4F4YA 4WIIA 5DLGA 5D15A 2E5JA 5KFJA 2Y1JA 2OO4A 4DN9A 2YBVA 2HVEA 4IFVA 3MDFA 4PXDA 3UR3C 1VK8A 4PWDB 1T94A 2LLZA 2ZOFA 1O0PA 4KBIA 2AX1A 1SQFA 4OZ0A 3KMSA 1HD1A 1H6KX 3GV8B 1NSKL 3OR1B 3NOCA 1URRA 3QGGA 4NCBA 4G1PA 1U47A 3QMQA 2ZE2A 3BEGB 4PUOA 2EBGA 1QSSA 2LVWA 4NCGB 3VGVA 5AXMA 2MHEA 3TYTA 3W60A 3LA0A 2IYGA 3BBCA 3LP2B 4FYDA 3QSIA 2PDAA 2I1RA 2V68A 3PFOA 2F9DA 3ZNUA 2PMHA 1F60B 5HQ8A 5E2QA 2DKOB 2XS5A 5DLFA 2GJIA 3TAPA 3ISNC 4R25A 2FVQA 3DLLQ 2IHR1 3JSMB 5T41A 2EWHA 2QN6B 4JP8A 3IG1A 3CCWA 3R5BA 2YX7A 2RNEA 1QTNB 4I6WA 1LOUA 2VASA 1Y3JA 4LF7F 4GO5X 1SH0A 1DURA 4JI7J 3BGOP 4DR7J 4BWMA 1L3TA 3T9ZA 2IJNA 4IFYB 3H25A 3DDIA 1NJXA 4OFZA 4RKUC 2DCUB 2B6AA 2I9SA 4LFAF 2E1CA 3HFVA 2FVPA 4V1Ak 2A6MA 5HANA 5DDRC 3QRQA 3NNCA 2QO3A 3AAWB 1H74A 1ZETA 2BANA 1FHTA 1QY7A 2Q3PA 3SV3A 2F3JA 2HRYA 2DGTA 4F02A 3KK2A 3ZTPA 4OI6A 2JZ5A 4ED8A 4M5IA 1D1UA 3R7SB 4XDDA 5J2MB 2J9EA 1K44A 4TU7A 3K89A 1O5JA 1DZ5A 3VVTA 2VA2A 4NLRA 3FEZA 3CJTA 2HQFA 1D0EA 5FJ4A 3FRYA 3QIPA 2F65A 4I2PA 4FF3A 2WONB 2ILZA 4CLPA 4LSZB 3W9HA 2AJ4A 2MZTA 1LW0B 1TL3B 1ZA2B 4M5MA 4TU9A 2MJUA 2B8PA 4O3NA 3ZFVA 1JNZB 2ADCA 3M9MB 1HNIA 1DBDA 2JC1A 2GQ2A 2KRRA 3KLEB 2AIRB 3CGIA 3I56S 3FBCA 1KSPA 4OJ3A 3DXBA 4OX9F 3AH6A 1JJ4A 3BGLA 2H9ZA 1BQNA 1FKOA 5ETQA 5EDWA 5GADU 5K5MA 1MW7A 4M5NA 4RUBA 2V6AA 3AJDA 1P9QC 4E98A 1R0AB 3GSDA 1M5VC 2C3UA 3EVOA 1RAIB 2EKYA 4JI6F 3TW0A 1G4CA 3I5BA 5GAEU 3QJPA 2R8HA 3MR2A 4RBTA 1U0SA 3JTPA 2DCLA 2HVHA 4PPZA 2HZVA 4MIBA 5KFKA 2IIHA 1CQMA 4IDKA 3U02A 4ZA1A 4ZLNA 4NX9A 4WYLA 2ZKUA 4H4MA 4OHVA 2W4DA 2V8DA 1NAQA 1X4DA 2LXUA 4X64J 2BQRA 1S72S 5LMUF 1RT3A 2DNPA 1Q7LB 4P2MA 2DEJA 2KB2A 3CIMA 2QC3A 4KO0B 2CPXA 4P74A 2CQ4A 5DGBA 5K8OA 4HDHA 4TY8B 3PR5B 2VU5A 2F8EX 1MMLA 1YBTA 3CO9A 1JMTA 3RJMB 1RKIA 2K3IA 3W5YA 1KQGB 5E0OA 4QCLA 1IR0A 2ZEJA 4O3PA 3D5MA 2YWFA 3DHXA 2AU0A 3M8SA 2IRXA 5AXLA 4J90A 1OYEA 4QOTA 4HKQA 5EHHA 1YJTA 5E33A 1OPIA 5IM0A 4X4TA 4TYBA 2UUAF 2WTFA 2WAQD 3KWMA 1HQUB 2R7SA 3GIJA 3ETMA 4I68A 4LQ3A 1VCTA 2OEMA 1WOOA 5J1EB 3FSIA 4ZCMA 1E6VA 1U24A 4NI2A 1U1LA 1CLFA 2BE2B 2V63A 2QEXS 2GMLA 4DFMA 1RABB 2DR9A 3AY0A 2NUUG 3CJQA 2OPQA 1U0HB 2BOPA 3Q8UA 5F3TA 7AT1B 4OX7A 3KHGA 4M5DB 1S0MA 5E41A 1NK8A 5I3UB 2ZOGA 2XMTA 4Y34A 5CCLA 5A2QY 4DL6A 1VQ8S 1Q53A 4PCQA 3RAMA 3PEJA 3FMWA 5L1IA 4Q8FA 2AV5A 2G1HA 5D77A 1RT2A 1T03A 3ZO7A 4CNYA 3M2UA 4RPFA 2NLWA 2OPSA 5LSOA 2RSQA 3R1LA 2OSQA 1FWKA 4HH1A 4HHJA 1UP1A 3PJXA 1JLGA 2BJ1A 5F8IA 2AJ0A 1H7WA 3D0IE 1VQOS 2ZD1B 4IG0B 5KT7A 1KHWA 1N48A 4PABA 2HBYB 4F0HA 4K4XA 1NLKL 1TP7A 3M6XA 2YNIB 1HI0P 3GZ7A 1HBUA 2MKJA 2DR5A 3VHQA 2V2VA 4L3NA 5LT5A 5BJRA 1UVMA 4ED2A 2IM3A 1AZSA 3M2VB 1SL2A 1H98A 2HBZB 1ULRA 4DR5F 4DCOB 3KJVB 1U2RA 2FD2A 2CQGA 2JEFA 4F0MA 3G86A 2XHCA 1IBKJ 3NXZA 1EQMA 2CNLB 3DC2A 5E7OB 2KT2A 3GU0A 5J2NB 2AEMA 2GHWA 5KFFA 2CIMA 2MDAA 4OLPA 1B64A 4FXDA 1RT6B 2OMOA 2K06A 3MEGB 5G0RB 3BSOA 4WJBA 2QA4G 2MKKA 1NPKA 3A4TA 4ANCA 1PGZA 5H9EK 4X66F 1NK7A 5KFRA 3AFGA 4YR2A 1XMBA 1ICEB 1HWIA 5HROB 5KFLA 2XMJA 4LUBA 3KJNB 2MZJA 2EKNA 5KFHA 1RTHB 3G6YA 2ZJQQ 2ZBCA 2DPIA 5LOQA 1RAJA 4A8XA 2RDDA 2D3OR 1WORA 2DEIA 1N32F 1NDKA 4GC6A 4ETZA 3AXKA 2WSFC 2QMWA 5A8RA 2BJ8A 1S4FA 1YG0A 1QAJA 4TKTA 2DD8S 4FN5A 1P9YA 2W9BA 3KYLA 4TU8A 1IBMJ 4WKRA 2YX4A 3CO0P 4DEZA 2O3DA 4P7TA 1R0BG 1UWBA 2CWKA 1VC5A 4JV2A 1NB7A 3WZ0A 4F0KA 4DV0J 1GEHA 2HPUA 4E2FB 2YQ0A 3MM7A 4HLBA 4XO0A 1AT1B 2B0GA 3FCVA 2QE5A 3DRRA 2AW0A 3QNWB 2NXUA 4RL1A 3O5TB 1RHJB 4A4JA 4DV3J 1S7IA 4RNFA 2R7QA 3MFHA 1TKZB 5ADZA 2G2ZA 2OIHA 2WCXA 2YKMA 3MEDA 1EETB 2IVFB 5HATA 2IAJA 4J9OA 3P5BP 4B3RJ 4CQ1A 2FHMA 4CO1A 1EJ7L 4JI5F 4LRBA 4IH6A 4X65F 3KG4A 4R5PA 2M4MA 2QRRA 4P2XA 1NH8A 3VAGA 3F44A 1B70B 2RDJA 4G1QB 4B02A 4C8NA 4E0DA 4NLGA 2H4YB 2K8GA 5CZVA 1QAXA 4LFCF 3PYDA 3PX4A 3CW2C 4NLPA 2HFZA 3CMES 2HHQA 4A8YA 1CJUA 5KFQA 2CQHA 2P5VA 2OTLS 4M5GA 3AQPA 2J0QD 2DNLA 4DFKA 2A1BA 2F4FA 4YN3B 3U7JA 2AZ1A 1UEVA 4KHRA 1X0PA 2JNJA 4LRDA 2V8VA 3GFZA 4L76A 1Y00A 4J5OA 2MHNA 4A8KA 3MMAB 2QG9B 2KHDA 1UL3A 2EG2A 2V94A 3HF5A 5KFCA 5EWGA 3BSCA 5J2PA 2V34A 2VG6B 3AOAA 5F8LA 3DM2A 2IC3B 3TVKA 4U7UK 3JAMU 5KG5A 2P9CA 2LQ8A 1PAEX 4DR2F 1D8YA 2IMOA 5DQIA 4Q0BA 1UEKA 2AD9A 4ZPTR 1IWAA 2DYAA 3EXYA 3ZC4A 3DOMB 2RUGA 1F5BA 2EK6A 3K17A 1RWOB 1N36F 2DNKA 3A13A 3SIPB 3S01A 5LJ5Y 4UY8T 1YRUA 1RWUA 4E8UA 3F0NA 1PIEA 3KFWX 4NEYA 3EUNA 4B9UA 4WWSA 3CJKB 1P27B 3QLHA 2EFNA 1TV6B 2W9AA 4NLDA 5LSLA 2DGVA 4A8SA 1JWWA 2VOPA 1VQLS 1TK8A 1FXRA 1VR6A 3MCNA 1GH8A 2RAQA 2QJ3A 4XTTA 4OZJA 5HVFA 1XN9A 1UJ5A 3N6MA 5D4OA 5JMNA 3CMAS 2HFUA 1VC0A 4FNHA 3Q8SB 1RISA 3NS5A 2CPIA 1M1HA 2Z2ZA 3M4XA 2MKYA 2W1BA 2IM0A 3CDAA 3HP6A 4JV5J 4WFZA 2MQNA 5BYSA 3H2LA 3HHLB 5C24B 4TN2A 4J9NA 3G6ES 4DV6F 2EW9A 4OHWA 3L7UA 3R1HA 1X9SA 1RAOA 4DR7F 2XZWA 3AJ1A 3OR2A 1UCNA 2A10A 2E9RX 2QL5B 1X4CA 2EBEA 2KL8A 1DY3A 2P2CB 1WTBA 4CO0A 4X4VA 4HR2A 3TANA 2BE9B 4KGXB 2DGUA 4K8RA 5KT6A 4UUWA 4PRFA 4JI8F 1KHVA 3KG0A 2DRAA 2L9WA 4OYAA 5L39A 1CVJA 2FZGB 2ZZMA 1FVSA 3VZIA 4RUAA 3J80Y 1VOMA 5DZ6A 3A8JA 2GMJA 2MLYA 4ZVFA 2VJVA 3NCRA 3G71S 2V2ZA 3IG1B 2IBKA 5K14A 4LF9J 2AYMA 3PV8A 2MEWA 3C14A 4X84A 4B08A 3KHLA 4ED0A 4BS2A 3UN5A 4RW9A 2MB0B 1ZZFA 3MM8A 5AJ3J 3A8EA 1JKHB 2CZ4A 3DYAA 3TX8A 4RWXA 2W4CA 1N5TA 2AHOB 1T9YA 1UPMB 5B0FA 3VALA 1QM9A 2FLNA 4ZPDA 2BQ3A 1REVA 1LWCA 1C0TB 1KTQA 2B9WA 1NZ8A 4WFYA 4F4XA 2HNYA 2EFOA 4P52A 4R0JA 4C4WA 4WFAQ 1N5VA 4ZLLA 2E9TA 4TXSA 1LWFA 1HW8A 5RUBA 4DV5J 1PYTA 1ROFA 3RAQA 2G0JA 1S6QB 3OL7A 2F63A 5D0HA 2YNFA 4ZPCA 5THWA 4F4ZA 1CS4B 2R3VA 2B56A 3EICA 1BXNA 1FERA 1UETA 1VYAA 1KR4A 2OFHX 2CPEA 5L38A 5CD4H 4AXIA 3MR5A 3GIKA 3CNQP 4D3GA 4GRSA 3MI7X 5D4NA 3EYZA 1EZZB 4P72A 4I6YA 3QIPB 4I2PB 4G3IA 4NZ0A 2CJBA 3ZZPA 4LMZA 1GNKA 2E1AA 4A47A 1AA1B 2FZCB 3POTA 2KXNB 2POKA 1DLOB 2OD6A 4OZ2A 3LALA 5L46A 1FTRA 3GP9A 3G82A 1MU2B 2E9ZA 1FWPA 4B3TJ 2DGWA 3HD1A 5HMYA 4X64F 4ZVUB 5IXUA 3WDOA 3W62A 2WW4A 2XC9A 3R2CJ 1EIYB 3CCVS 3CT9A 1JXEA 3GJRB 3M8QA 5B0CA 1E6YA 1GX5A 1EHWA 1S4EA 3BGRB 2A2CA 2H51B 4OX6A 5DDPC 3DRSA 3H0PA 2NQPA 3HPOA 4J37A 1UFWA 2APOA 2LU1A 4HH0A 3ITHA 3RB0A 5HQMA 1I1GA 3SQGA 3ZTRA 2HHHJ 4AL5A 5D0RA 4DSFA 3ZZUA 4RX6A 2MZ1A 2X3GA 1Q95G 2W7AA 4LSNB 1V3RA 3KLGA 2MSSA 5H9FK 2FJAB 4RNOA 3SDEB 3M6UA 1JNRB 1RBOB 1P1TA 2W4PA 1F9HA 3KUGA 1W7WA 2AWZA 2VBWA 1X60A 4Y3CA 2XG8A 1S1TB 4FS1A 4LIRA 1Y11A 2HEKA 4FS2A 1IXKA 1ZZNA 1GTHA 4EBEA 1FCAA 1UEUA 2IA0A 2BJDA 2D9OA 3RBEA 3NLCA 4X4OA 1K47A 4QQBA 3ZZ0A 3HHKA 3PIPQ 3T5HA 4LT6A 4O44B 2ZWPA 3R7NB 1SJFA 1RKJA 3N6LA 3OTOJ 4KPYA 3NS6A 3D7SB 4YDXA 1S9FA 5FIIA 1GMWD 3CCSS 4YB5A 1LWEA 2MKCA 2HFVA 2N3LA 3I82A 4CLKA 3FCHA 1NM2A 1B99A 1RGVA 2HHUA 3QZ7A 1G7CB 4KRWA 2CRLA 3MWBA 5E3QA 1C2PA 1MWYA 4FXWA 2BRLA 5H1SV 2CJKA 4MFBB 3NBPB 3AB2B 3EVMA 4DFPA 2ILYA 4EMDA 1L3SA 2RQKA 4L75A 3EZOA 1Z2LA 1RWKB 3T1AA 1QUVA 2ZH9A 2AGQA 1DTTA 4CI0B 4USIA 1FJCA 4NRTA 1F5AA 3D1OA 3GQCA 4ES2A 4ANEA 1HYSB 4KSEB 3NY0A 1D9FA 2QYCA 4J9VA 1V5IB 1U1QA 1NSAA 2LDIA 5KG3A 4ZCIA 1N6QB 3C2PA 3O3LA 3CTRA 4WE1B 3M2UB 5ETOA 2EFQA 1MN7A 3NMRA 2CDRB 1TKXA 3UD4P 2RILA 3TAMB 4JB8B 3G8QA 2J6TA 2YXLA 4J9KA 5KG6A 2XLJA 1RAAB 3VZHA 3CJ5A 1S0OA 2V9WA 4MAKA 1IKVB 3V4IB 2D3O1 4HYKA 2HFOA 4HT5A 1KQFB 5KFNA 4ECRA 3H2UB 2NUHA 1PG5B 1DHMA 3PHEA 3BN4A 5ITHA 5KFYA 3Q8YA 2VDHA 4O23A 4OI0A 5CAAA 9RUBA 5BYRA 4Z2XA 1FRMA 4QJVA 3C15B 2IRUA 3JAMY 1U7LA 3QZ8A 2WHOA 3JQKA 1MMDA 2QX0A 2UUCF 1KVKA 4Y2CA 4DI6A 5HVGA 1HWLA 2KXFA 5IC6B 4RW6A 1NDCA 2VQEF 3G4SS 4OZNA 3I0RB 4MTPA 3R3TA 1VHIA 4QWAA 3D6HB 4TVAB 4M5JA 4USJC 1A9NB 2W9CA 2FJXA 4DG1A 3PHTA 3PDNA 2BKOA 2FDNA 2BKPA 2KT5A 2B4UA 3GPAA 1R7IA 1S1VA 1SKWA 5M2PA 3EX7B 2VQFF 2LQ9A 4B9LA 1TVRB 2YKNA 3HJVA 2FVCA 1I94J 1WG4A 4DV0F 4B9NA 4N7TA 2E1RA 2O1PA 4C3LA 1SV5B 1PBUA 4PG7A 1FI4A 4EEYA 4C3MA 1HNXJ 2ASJA 1CSJA 4K0KF 4JI3J 2L08A 4EFAC 1KRPA 4A8OA 2VC0A 4CLWA 5L1KA 4AQYF 4C0OC 1SB6A 3EGWB 4FKYA 2YNHA 4C97A 5LXYA 1YK9A 4DV4J 2V4QA 3R97A 3LP1A 3ISND 3W1YC 2Z2YB 1UTAA 3W8PA 2GC8A 3J7ZT 2DNZA 4MKAA 3I96A 1WC5A 3ZZTA 4FNIA 4UW2A 2B7BB 2CG4A 1GXUA 4K50A 2XLKA 1L5UA 3AHPA 2ZBPA 3LWMA 1L3KA 2HVIA 1OSCA 2CNNB 3UDLA 1YJVA 2M3DA 4IQXA 3HZGA 1FF2A 3D0HE 3GG0A 4YP3A 3DOLB 4O3SA 4K4VA 3KNAA 3AXMA 3UR0A 1GQEA 5CYJA 3KUHA 4CLUA 2JL9A 2C28A 3WQPA 2CJ9A 3VAIA 4K4ZA 3H5YA 3MEDB 4C0HA 3NGTA 1REGX 1C1CB 2PI5A 4LSLA 2Q79A 3X1LB 3CCMS 1EAYC 1HR0F 4MKYA 1T95A 2UXCJ 5I3QA 2G2OA 4ZPAA 5DDOC 1TUWA 1VMBA 1TL7A 3RBDA 1X4HA 3DMJB 2VODA 3A3PB 4EGLA 3GJQB 2YWGA 4KFBB 1IR2A 1NBEB 3IWNC 1B0VA 2PMWA 3CIZA 1ZM9A 3RRGA 5DQGA 1S9GA 2A6OA 3MOZA 5C25A 3WHIA 2RQCA 1Y0HA 1VRUB 2V4JA 2ZBQA 3ZTOA 5B09A 1ZYQA 4CNZA 3MM6A 2UV8G 3L9ZA 3M7VA 1U49A 2HLTA 1WI6A 3C6UA 2RQMA 4OJ1A 2IDEA 4RU2A 2OKQA 3DN9A 5GAHI 4H4KA 2B4PA 4ILRA 2XSJA 1IKYA 2LDYA 2PEBA 2OEKA 2HLUA 3LP0B 4FYWB 1N5QA 2OFGX 5KFEA 3DHWC 3TA0A 2Z4PA 3CJRA 4I7FB 2W24A 4OV6A 4O0IA 1BUXA 5J2PB 4CO5A 1OWXA 1NSPA 3BH6B 4PXBA 1FDBA 4PWDA 2C3OA 4C98A 1BY9A 4ZP6A 5C42B 2IY5B 4EBCA 4ZPBA 2B4OA 3OR1A 1NJYA 1JJHA 4LIWA 1FD2A 3VAFA 3RG6A 2NR0A 2VHGA 2BRKA 4FPRA 4WP3A 2R7WA 2QTWA 2QLWA 2RQ4A 2IVMA 4NCGA 3MM9B 3SSQA 2XWXA 2DRDA 2J9DA 3TO8A 2VBXA 3O8WA 3PRDA 2O66A 2H3EB 1HNWJ 2GGPB 4NZ7A 3MHYA 3MECA 2ASDA 1N54B 3JSMA 1U6FA 1FTCA 3GV5B 3NWRA 1WG5A 2R2SA 4NL5A 1QE1B 3C6TB 3DI6B 2CJYB 3R9LA 4PPDA 2UU9J 3NWGA 3RBXA 3L95X 1NK5A 1YTYA 5F0WA 1HQEB 4N76A 3K58A 1EP4A 4IFYA 4CO3A 4DSLA 4ZMMA 3ZZRA 2L9DA 3CDWA 3DGVA 3CD5A 4FPIA 2C2RA 3RR7A 3D1HA 2H1YA 1M90T 4MT1A 2BXJA 1VLYA 1UVKA 2QFJA 2I0XA 2KI2A 2Q6BA 3JTNA 5DO2A 2JFKA 2O5DA 3BB5A 5J2MA 3H20A 3TR5A 1HHQA 4DSEA 1BWVA 4F3OA 1AW0A 1YGYA 3HHDA 5A0YB 4N77A 3OJSA 4CLTA 4WTOB 2CJQA 3PZPA 1PJ7A 1FRXA 2C2KB 2FVSA 3IBFB 4P9SA 1R0CB 2R2UA 1SJ4P 3DLHA 3AD8C 1F0XA 1IUJA 1ZM3A 3DCAA 3K5PA 1SC6A 1OSDA 2WONA 3T1YJ 3QT6A 5K8NA 1LW0A 1TL3A 2HURA 2CG8A 2Y0BB 3N6NA 3UDEA 5F41A 2JRSA 1RLDA 2ZDOA 1JLCB 3PJWA 2R42A 2HQDA 1WTFA 1WACA 3KLEA 2E5LJ 2ZC4A 3HMJG 3GJTB 3G6VA 3MAAB 2NZ4A 5KFUA 3CJ0A 2FJDB 4OI4A 2BA9A 3GSIA 2YNFB 2CPYA 4Q2MA 3ILIA 5HQLA 3QWUA 2EC2A 2JDJA 2XULA 3FMBA 4DJBA 3W61A 7FDRA 3HHNB 3OL9A 2DIUA 1RBAA 5F8NA 5DG7A 2X1FA 5E5NA 3OTEA 3IMQJ 1R0AA 2GHVC 4GO7X 2OD4A 1X5TA 2HHHF 1WC1A 4GC7A 3NOGA 3PIOQ 5L1LA 3F56A 5HJYA 2KM8C 4MYTA 3FBEA 3FZ2A 3TVZA 1QVGR 2VFUA 5HJXA 5ETSA 4OQJA 5CYMB 3M32B 5JUMA 1BQMB 3Q8PB 4TLRA 2GS8A 2M7SA 2MSTA 5B0DA 1N88A 4M5KA 5KFBA 4DL2A 2HK2A 4EI2A 2ZM6F 2WVDA 1IQTA 1NK6A 2V9KA 1J5OB 1WUUA 4IOAQ 1ZTWA 4PYDA 3X3UA 3M8QB 2XCPA 1E6YB 3T6JA 4KO0A 1S97A 8AT1B 3FEYB 1NK4A 4YY3J 2PT0A 1Z1ZA 4OYOA 3E3XA 1X7VA 3DRSB 4TY8A 2DO0A 5KFTA 2LQ5A 2JJ4D 1VJQA 1XR6A 1OQ3A 1UJ4A 3I32A 5KFZA 1S10A 2FUG9 2YWHA 2B51A 4LREA 4U8VA 2RF2B 4URSA 3OTOF 4DUYF 2GIFA 3SQGB 3NGKA 4NMLA 1F2GA 2AT1B 5DQHA 4J9PA 3W2VB 1VDHA 4RNMA 1T7PA 2J6SA 3KLGB 4AXJA 5KOXA 4ENOA 4I67A 2JEGA 5KFIA 3N0VA 2MQ8A 2X1BA 1LEOA 4RW4A 4F36A 4PG8A 3CDBA 2YY3A 3CF5Q 4I69A 4Q5VA 4MIWA 1F2HA 5KFSA 4F8RA 5J1EA 1G1XA 2YKAA 4ZJLA 1IKWB 4NLQA 4AYBD 1HI1A 1PAUB 2DH9A 3H59A 3PRVA 1C4CA 2BE2A 1KQSR 1Q81T 1ZH5A 2KFYA 2LQBA 1YJWS 4KH1B 1HPZB 1U0HA 3FRZA 3DNCA 3V6DB 3ZZYA 3KLFA 4M5DA 1VBYA 2FY8A 1NEEA 2VF3A 2VB6A 1KC8T 2UZAA 3C3LA 2DXFA 4OYMA 3G87A 2V8HA 3J7Z5 3M30B 1C0UB 1LWEB 1MWZA 5J1NA 2E66A 4IOBA 5D3GB 3IFEA 1PC5A 4A46A 4LF8J 4A8WA 2R7UA 1TAQA 2Z0GA 2DRBA 1CJTB 1KTVA 4MK7A 3I9V9 3H40A 3N79A 4ID5B 1Q8KA 1RZMA 2W2NP 2DHXA 3NP5A 2OPRA 1ZAXA 2BACA 1Y3KA 4M95A 1MSWD 2ZD1A 1YBAA 4IG0A 4RWWA 3HFKA 2V2QA 4F67A 4RBUA 3R5DA 2VG5B 1XMOF 2YNIA 4CO2A 1DFDA 3FVYA 4URGA 2CJXB 2XY6A 1P6TA 2ERRA 4OZ1A 2LQJA 3AOCA 1M5KC 2IRYA 2MJNA 4IH7A 4AL7A 5KFGA 1XR7A 5K20B 3J7AN 2C2NA 3M2VA 2VZ9A 1Y9OA 2E44A 4U7CA 4L74A 4Q43A 3FFIA 5CZXA 1IKXB 3H98A 3KJVA 1UVJA 4ZJOA 3OXFA 4KHPJ 1T05B 3L7OA 3MF5A 1JK9B 4JI4F 4QIGA 1TKXB 4UF4A 4YMEA 4XK8C 4NA3A 3IS9B 5J2NA 2UVUA 3LWLA 1I94F 3HHLD 1PJ6A 3SSSA 4YDDB 3CCJS 2JVOA 3SZ2A 1NJIT 4ES3A 3O2IA 4UZCA 1YSJA 3MEGA 5G0RA 2FLLA 3DRXA 1HNXF 2U2FA 1HMVB 4JI3F 3EDQB 1JJ2R 4OL8A 3CCRS 5HROA 3ZTSA 3K0JA 1IN0A 4CYUB 4ELVA 3JSRA 3RAXA 3W64A 3MURP 3OVBA 3WBZA 1C1BB 1RTHA 2ZH5A 2AF6A 2BJ9A 3AT1B 3DU6A 4Q44A 4NE9C 5D6GA 3CEDA 4DX8H 2ZC3A 3MMBB 3BDPA 1U6ZA 3G6XA 1FO1A 2GQCA 4DV2F 1RHMB 3D3BJ 3TUIC 5FD1A 1FJGJ 1SUQB 3A1YG 5AT1B 5E3RA 2VG7B 2CNOB 3Q24A 3E51A 1TMMA 3H7HB 1MROA 3P3DA 4I4BA 3M9OB 3IRXB 4ZVGA 3CXCR 2KHCA 2XZTB 1FNXH 2XS7A 1S57A 4A8MP 4ZCLA 3UCGA 4ZLJA 3T3FA 3VWSA 3AQOA 2DNGA 2D7SA 5LM7E 2JEIA 1TKZA 3M8RA 3ADAC 2BMBA 2IYIA 1FESA 3D54A 3K57A 4YFUA 3Q23A 1EETA 5KG0A 4CH7A 3MR6A 4WU2A 2CZ9A 2G2YA 3GILA 1BMQB 2I5JB 3M2RB 4DQSA 5A76A 1RXOB 3MEEA 3VQSA 1R6VA 4G1QA 4RNHA 1N34F 4LJMA 1W25A 2IVYA 2M0GB 4WP8A 3OTBA 2OJ3A 1RWWB 3IRWP 2DB1A 3H5XA 4ZVPB 2G0CA 3CCES 1PCAA 2NXEA 2CQ1A 4CLLA 3GIMA 4EYHB 1SJ3P 1T9VA 2QZ8A 4H4KC 4UOFA 1QVFR 2R9LA 1KN6A 4G6VB 2E29A 2JEJA 2PGCA 4LSLB 4ECWA 1G2EA 1X4AA 2UVRA 1S48A 3R6GB 4DU7A 1TKTB 4V19X 3VTIA 3MMAA 3W2WB 4ICLB 3RUBL 1V5VA 4Y6IA 1RAFB 1IM6A 2HHPA 1HI8A 2C2MB 4JYAJ 3B4DA 2ATCB 3DGPB 3RB3A 1RT4B 3KDNA 2PI4A 2VG6A 4YS2A 3RB4A 4GVBB 5D4PA 4L73A 4MKBA 3TZZA 2X1GA 4QYZK 2W2PP 2CKWA 4KYZA 1RAHB 1S9GB 2GA7A 2Z8QA 4ZCKA 1MNEA 4Q2LA 1YRTA 3DOMA 4C8MA 3IAS9 3NKYA 3NGDA 4NXNJ 2BUNA 1L3VA 3LGMA 5DETA 1GMUA 4PQUB 4GKKJ 1ZM4A 2EFGA 3CJKA 2X3DA 2OI2A 1D8ZA 5ETMA 5IZHA 3H5SA 3LOUA 1HWUA 3T1HJ 4WP9A 5KFWA 3DKDA 5J1PA 1HNWF 1CPZA 1F9EB 4RW7B 4NA2A 4KGKA 1T9TA 3SYZA 2NXJA 1M5PC 3CCQS 1G6BA 3WC0A 3GYNA 5K9FA 1WC3A 2BV3A 4F2SA 1FDAA 3SMZA 2FZKB 3OXLA 3I4HX 2CQIA 3R27A 2XYGB 3M6WA 4C9DA 3BBFA 1CBKA 2RU3A 1NCLA 3TWZA 3I5AA 1NNDA 1PILA 3HHLA 5C24A 4DL7A 1X9MA 4UQGA 2J0XA 3Q2SC 1KOOA 4Y2MA 3Q8QB 2CPDA 4XAKA 4F04B 2ZH4A 1FNMA 2ZHBA 1XC9A 3BO2A 5GVQA 1S1XB 4EU0A 4DX5A 2Y0SD 1LXNA 1YIJS 1S1UB 1OO0B 3LPYA 3FZBA 3DDNA 4KGZB 3MECB 4N8OA 4N8NA 2ZH8A 4LFBF 3DXSX 2U1AA 3FKBA 1NHKL 1K9MT 2B5JB 1UVNA 2CADA 3VVUA 4ED1A 3JSYA 2BM1A 2G13A 1JKHA 1Q79A 3OFFA 3OBIA 3IR5B 1FDDA 1YJ9S 1X4GA 1U1RA 1XMQJ 2VC1A 4ILLA 1CC8A 2ZKTA 1S0NA 1UFKA 4DR1J 1EP4B 1HIYA 4DF8A 2FGOA 3I5CA 1YX2A 1C0TA 2VPWB 4DQIA 2VV5A 4N56A 3E2EA 5BR8J 1VQKS 2J5AA 3G9CA 3LH2S 1ZPVA 4J9QA 2QSWA 2W7OA 2EC0A 3UQSA 7FD1A 4DQQA 5H9FJ 1S6QA 2QMUB 4WFBQ 1IWGA 3O44A 3PYEA 2GV1A 3PR4A 2HSEB 1HKAA 4F25A 2D74B 3BGUA 4F50A 2OELA 1CS4A 2E1PA 2FC8A 2JH3A 3N01A 2ROEA 3HCXA 4K7QA 5KFAA 5JVGQ 1DTQB 5G4DA 3PNIA 4MJKA 5CYQB 2HFNA 2B43A 1VISA 2CAJA 3TZXA 1J5EF 1IM4A 2XI3A 4CDIA 3EPIA 5U47A 4KV8A 2MQMA 4DV1J 1CEZA 5HO4A 3IR7B 2CPZA 1FXDA 3H2VE 2LU2A 2PEHA 1DLOA 3QT8A 2DHGA 3BSAA 1JLBB 3CJ8A 2OSRA 4OHYA 3RRHA 2HIYA 2N4DA 1MU2A 2HGLA 3GFXA 4UOHA 3BKUA 3PKYA 2JVRA 4TYAA 1UKUA 3N9UC 4M8LA 2VICA 1K8AT 3OFEA 1WKKA 5JXSA 1FK9B 1RU1A 3BGRA 2W2OP 3Q8RB 5ETPA 2VUGA 4BC7A 2CQDA 2ZWOA 2VA3A 3OJUA 2OGUA 2V0NA 4DSKA 4CH1A 5LSRA 4DV7J 3K5LA 3LTOA 1YQHA 4X62J 3CVKA 2F4VJ 4PG5A 2KJVA 3UVJB 4DPTA 2IFXA 4FKXA 4KH0B 2BBEA 4NXMF 3PYFA 2DGXA 5KFXA 4P7VA 4LSNA 1OY6A 1ZOTA 2J8AA 5B0AA 4DXLA 4X2BA 3L7PA 1YKWA 3SDEA 1NH7A 3C16B 2QIFA 1XQIA 2DHSA 2MKHA 2XI2A 2YKOA 2FHOB 4EK2A 1NMEB 1KOHA 2IJFA 2B3TB 4YR0A 4IOCQ 3NAHA 1S1TA 1LW2A 2JSXA 1UPPA 2XMWA 1XERA 2RIJA 2CDQA 3NL0A 1S99A 2DJWA 1UVLA 1XR5A 1HARA 5BXIA 4LFAJ 4YHHF 2MXYA 4OYPA 1WELA 2UXBJ 4CLZA 4TLQA 2VKRA 3TJ9A 4O44A 4ED5A 4HI2A 4U6PA 1JLEA 2ROPA 5LMNF 1ZTTA 4DUZJ 2JC0A 1BE4A 4ZK7M 3G8SA 4J9UE 1M1KT 4LF8F 3JQJA 4DDFA 3K2YA 1HBOB 3OTDA 3T41A 1WEYA 4QR1A 4RW4B 4ITSA 2FC9A 4N41A 4ANDA 1U6BA 3K8WA 2WB1D 1RTJB 1NKBA 1TL1B 2LEAA 3GB0A 3IM8A 2DHAA 2DNYA 4M1KA 4IRKA 3DLKA 3OSPA 4HVZA 1RHUB 1HW9A 3FEXB 2HNZB 3NGUA 3FUYA 3KLVA 4QWDA 3MAQA 3IBWA 3CCLS 4MFBA 3NBPA 1X5OA 3OTCA 3N5BA 1WHXA 1U26A 3M8PB 2DNQA 5F8GA 1SJ1A 4LF6J 3KLFB 2HGNA 3W7BA 3GYXB 1PC4A 4DR4J 3D28A 4U95A 2ZNYA 3LPEA 1HYSA 4OYXA 1WOPA 2HHWA 1B3TA 4LBPA 1H0HB 1N6QA 3EVWA 4NLSA 1RWMB 3CPWR 3QRRA 4DLGA 4WE1A 3LQVA 4B9MA 4NCAA 4C48A 1MLAA 2Z2MA 2P9EA 1XNQJ 1U8SA 3PJ9A 4OJHA 3QBCA 3W3SA 3TAMA 3TA2A 2DY9A 3H42A 2OPRB 1HWJA 1WWHA 5CQGA 4ZHRA 4QPXA 1HD0A 1IKVA 3V4IA 4HEA9 1TK0A 2BQUA 2DR7A 2F7VA 2H5IB 1UA1A 5F8MA 1XJWB 1N8RT 3B78A 3ZNJ1 5CCMA 4F26A 2BABA 1D3WA 5HL7Q 2CQCA 1SPBP 1TMJA 3C15A 3CDEA 1IBCB 2XLIA 4ZN1A 3MR3A 4WBFA 3FFIB 3I0RA 2DGQA 4DL0C 2Q6CA 3FBBA 1I51B 1Z4UA 5LMUJ 5LL6d 4W4MA 5IQQA 2L48A 3SCLE 3PCOB 1TFWA 3ILLA 1FJGF 1KWMA 3TUJC 1LK5A 3R8YA 3EGNA 4AT1B 1YI2S 1TVRA 1N33J 4KB7A 2XGPA 3VV2B 4RR5A 2PA3A 4HT7A 2HZCA 2VBYA 2VIHA 5IC4B 3FSYA 4AD6A 1SV5A 3AA9A 2Z56B 4ZITA 4UOGA 3MEKA 1X9WA 1CJVA 3LW5C 4IKAA 3KLIB 3RU0A 1KONA 2R2RA 5MAOA 2I38A 2UUAJ 1U1PA 2XNRA 2G1DA 1YBUA 1XBWA 2QSFA 4USUA 2X7IA 5HLFB 3QAEA 4I6AA 1SL1A 3CJSA 2ZJPQ 3Q2TC 1M0SA 4CIOA 2F5GA 1CG2A 2D9PA 5GAGI 3K5MA 2MTLA 3BR9A 5B7WA 4WXWA 2G9OA 1MROB 3CC2S 1FDNA 3S8SA 3LUYA 3CCZA 3VF0B 5KG1A 5C2GA 4KE5A 3MTJA 1U09A 3UNYA 2NZCA 3G2XA 4ZVQB 1RADB 4EWTA 2XS2A 3DOLA 2E5HA 4PR6A 2WVFA 3TJ8A 1R89A 3PW7A 1HNVB 4BHQA 2LXIA 2PFDA 1UZHA 4K4WA 2YKQA 1C1CA 4N5SA 3A8IA 1SJQA 4I1TA 5J2QB 3D67A 2W2MP 1W26A 4KKOB 5HBMB 4R8UA 1WF0A 4RNNA 4JYAF 2E7WA 3MEEB 1VS3A 3RR8A 2J7KA 3HJFA 3DLJA 3DMJA 3BPDA 2XGQA 2YQ1A 2MZQA 1NJZA 1HWKA 4EZ9A 3MUMP 2BE7D 4C11A 4KFBA 4V19J 3OXGA 4ECYA 2D69A 5CHCB 3OPKA 4P75A 2NYIA 4ZIVA 1SVDA 1VRUA 2UUWA 1S79A 4Y00A 4EZ6A 1SIZA 3AJ2A 1Q86T 1YJUA 4C8KA 2AYGA 5DM6Q 4WZMA 3UNGC 3RTVA 1MMNA 3Q89A 4K4SA 3H90A 3T1HF 2L9NA 2CVIA 1OY9A 3IWXA 4O3OA 5KG4A 2RKIB 2Y1IA 3LP0A 2A18A 2LMIA 3ONQA 1YJRA 1RDRA 1HLWA 5B0BA 3RRKA 4I7FA 3EJMA 4AFFA 1U25A 1NKCA 1LK7A 1EB0A 3Q0AA 5ETLA 1B0PA 3UN2A 1VQYA 3ET6B 1YDLA 2YWEA 1OYDA 4TQSA 2AQ4A 3V4MA 3PM9A 2V50A 2RT3A 1JXVA 4U7UD 4DX6A 2DK2A 2YPZA 1IBLJ 2RHSB 3PX6A 1QJHA 1JQGA 4ALZA 5C42A 3HHLC 1R8PA 3R5AA 2K1RA 1FKAF 1FVQA 4J9RA 4DX7A 5I42A 2ACMA 1N32J 3QRPA 1VQ7S 2RMLA 4CT8A 1PSDA 4YB1P 2BDPA 3MM9A 3UD5A 3BYRA 1R31A 1S0VA 3TUZC 3UDCA 3A12A 3OL6A 5KOWA 4B9SA 1F1BB 4X4RA 1T9WA 4X4UA 3EPGA 3KK3B 2GVDB 2GGPA 1BD6A 1LWXA 2XEXA 4WU3A 3THTA 4ATNA 2OMLA 4LRFA 1RWNB 4Y2IA 3CULA 5DGAA 3GIRA 4LVNP 1RWPB 2IM1A 3VAKA 3BDEA 1QE1A 3C6TA 2DNNA 5DJBA 3WX8A 2QT7A 3DI6A 1RK8A 2YQ3A 5KT3A 2RRBA 1XMQF 2R8IA 3CSKA 5LXRA 4JI7F 3D68A 2KVIA 3K7RA 4DR1F 3H8YA 2H54B 4IUFA 5GAGU 1HQEA 2QL7B 3BPSP 3CDUA 1FEEA 3PW4A 3P49B 3MUVP 2E5IA 4PZVA 4I2QB 2NPFA 4BLGA 1F3FA 2V8PA 1Q8IA 4CCHA 1R8AA 1CULB 3W9IA 4LFCJ 3GCXP 4BWJA 1I5OB 2MZSA 2DH7A 2QA4S 2XHWA 5ETVA 2SXLA 5HP1A 3LGHA 2N4CA 3BO3A 4CT9A 3SCKE 4TNOA 3W65A 4WFXA 4PWUA 2F8MA 2I6WA 1FT8A 3BSNA 5GADI 1ZM2A 2MQLA 5A8KA 1URNA 5A0YA 4ED6A 5SUHA 3QFWA 3L09A 3MMCB 4NA1A 4CO4A 3US5A 2R2TA 2MGZB 3M1VB 4DV1F 5IV4A 4RLEA 5GAEI 1ITPA 4CLSA 1LXJA 1YRXA 1WHWA 3BZQA 3EGVA 1JLCA 1MG7A 4O4RA 2VJUA 4IG3B 1HBNB 3N28A 4DR2J 3OQ2A 3MAAA 4USHA 2KYXA 4LF2A 3NNAA 2XZDB 1N5YB 5HVHA 1N36J 5T7LB 1YITS 2DTJA 1PYSB 1XK8A 3DLEB 4CLFA 4ZVRB 4MK8A 3ZXWA 4UTGA 2VPZB 4DV7F 3SV4A 4X62F 4Y28C 1RB0A 2GQQA 2F4VF 2OPPA 4MYUA 1XWLA 4KV8B 5HSPA 2DBBA 3PY8A 4QPTA 2E7VA 2C3YA 3QSYB 1HNZJ 2NSCA 3MOJB 3M8WA 5CYMA 2M52A 2G0IA 3M32A 3J81U 1NXIA 4DR6J 3CD6S 1BQMA 1V6HA 4DBQA 1S1WB 4ED3A 3ICLA 2BKNA 3KHRA 4USKA 3M05A 3OL8A 2I8EA 4J9SA 4DV6J 3GTYX 2PIIA 1J5OA 1Q4RA 1X5SA 5ETNA 3I0SB 5F9NA 2ZDPA 2KT3A 2C1EB 1OIAA 3UDVA 1K0TA 3I4PA 4B9VA 5KFVA 2OUGA 2YNGA 5E3AA 1RSCA 2DGSA 2UXBF 3BJYA 2AEJA 3ENVA 4GVLA 5AE2A 2RF2A 2DT9A 3HKZD 3P5TL 3AD7C 2VOOA 4JI8J 2CXEA 3PFEA 2DGOA 4RBVA 4DUZF 1P1LA 5C5JA 3W2VA 2KO1A 2WBMA 3MUTP 3HD2A 1U2FA 3V81B 2GO8A 3IC1A 2RVJA 2CVEA 1SQEA 2PO4A 4QU6A 2AJ2A 3IBCB 1GX6A 3TP2A 2M5YA 3BQ0A 1IKWA 2H5EA 1U4BA 4LVOP 5L9XA 1LW2B 2PC6A 4K4UA 3BKFA 1KKHA 4DR3J 1HPZA 4LF6F 3BQ2A 5D0EA 3V6DA 2NREA 4C7QA 4DR4F 1NB2A 3CUNA 5IT9U 1X5PA 4OX8A 4USWA 3OLAA 2GJFA 4W98A 3SCJE 3DRPB 2J0SD 4OYBA 4YOEA 2KU7A 1VRTB 2KKHA 4DQPA 3OLBA 2KVQE 1JLEB 1OQ6A 1VQ4S 1VLOA 1D9AA 4QIFA 4EO6A 1RTZA 2ZNZA 3ZZOA 1RUSA 1S77D 2JLEA 3M30A 1C0UA 4A8FA 5D3GA 4ELTA 1XNQF 3TEGA 2N7YA 3BYPA 3DLBA 4PG4A 2HS4A 1CJTA 1R8HA 1RYSA 2XQCA 4PAAA 4ID5A 2ALZA 3P6YC 3DLKB 4CTAB 2KTQA 3P96A 1TU0B 3AOBA 9ATCB 1S76D 3KDOA 2VG5A 2YWKA 3HSJA 2W8KA 3P8BB 4J9LA 1TK5A 2IA6A 3L4BC 4ZS6A 1TFYA 3T6BA 4URQU 2ZFHA 3W66A 3QATA 1JIHA 1JLAA 2F40A 4NYZA 2Q43A 2V4RA 4OIXA 2LA6A 2OEJA 4KC5A 1WSRA 1IKXA 1IBKF 3RZAA 1T05A 1QTMA 1GAOA 2G4BA 2IBOA 3VGTA 3HFZB 4L72B 4J9MA 3IS9A 4DPXA 2N7CA 1FRHA 3S7RA 2RHQB 1DJ0A 1N33F 3KLHA 2NS1B 5E3CA 1NDLA 3BBBA 4ZHRB 1GXLA 3GYGA 3WC2A 3FNNA 4C3KA 4YEAA 3J80U 3EZ5A 1R43A 4WTYA 2FPHX 5IQ6A 3VAHA 2XYPB 3AD9C 1HMVA 3DLGB 3K5NA 3E01B 5HMZA 3IGNA 3JS9A 2FJVA 1KBRA 3QGPA 4CYUA 3ILJA 3TVYA 1PO6A 5GMKa 2E7XA 5KFMA 1HHSA 2GNKA 1C1BA 5T14A 4OYWA 4HHHA 3PTWA 4YB7A 3M9NB 3L3CA 1JLQB 1Q16B 3SXLA 4Q8EA 3HSZA 4ZPVR 2AEFA 3MMBA 1NPRA 2UP1A 1IBMF 5D4LA 5B0EA 2F8HA 2HQGA 4YB6A 2KJWA 1Q5YA 4KQZA 1N0UA 1SUQA 4FF4A 1Q8BA 1WD6A 1ZA1B 4K5RA 1FRLA 2VG7A 2B9EA 4WFNQ 2KG0A 5CXTA 4MK9A 3A3NB 3IRXA 1CC7A 2CZVC 3H4BA 2F9JA 2RJZA 2ZUGA 4DV3F 2VFRA 2DPJA 3EWGA 2NXNA 1Q7YT 4ZLPA 2MY7A 1S7HA 4HL9A 1UA0A 4FYXB 2FVRA 2UXDJ 1CJVB 2EPIA 3KG1A 4FVCA 3QO9B 3GIIA 4NLTA 2C2OB 3IR6B 4QYZJ 2QLJB 2GHPA 4B3RF 4J91A 5LJ3Y 5IWAJ 3FSXA 2FQQB 4QWBA 2ZH7A 4P71A 4FZVA 2AMCB 2JLFA 3T5KA 5AE1A 2GO9A 3O1LA 1GK8A 1U1MA 3MM5B 1GT8A 3TUPA 3MXHP 3PRBA 4OI3A 3J7A1 2I5JA 1QAYA 3M2RA 2ZVSA 3B82A 3FJ2A 2BYCA 2Y1RI 2XO6A 4EYIB 4KR0B 2OLWA 3QQCD 3TI0A 1OY8A 2EEYA 4C8ZA 1VIOA 4NEZA 2ALYB 1WI8A 4O4GB 1FFWB 1R6YA 1Y5NB 2AGPA 3D6FB 3LAKA 4RW8A 1FKPB 4K4YA 3QJJA 1RT5B 2VL1A 4MKVA 1KLMB 2H5JB 4ER8A 5KTQA 3VGSA 2D1CA 2WOMB 1KLNA 1V3ZA 3SBMA 1WG1A 3OV7A 1UW4A 2DXDA 3GE9A 3LF0A 4ECTA 3GJSB 5A8WB 1JLFB 3QAUA 1TKTA 4R8UB 2FJWA 4X4PA 1SJRA 1Q1KA 3W2WA 4ICLA 4A48A 5KG2A 1TL5A 1S49A 3NAIA 3DGPA 3THVA 1RT4A 2AZ3A 1S12A 3DDKA 3MPYA 4C8LA 4C11B 1WHYA 1IBLF 5D78A 2HYIB 1U1NA 4GVBA 4H4OB 1AUDA 2V67A 4ZVSB 3MZIA 2KXHA 1S9EB 2UUCJ 2FHKA 3OHBA 1VBXA 3OT9A 2VQEJ 2BX6A 3HK2A 1A6LA 4HACB 1DQAA 5CH7B 4PQUA 3PW5A 4LRAA 2GVZA 2RDIA 3Q86A 2EK1A 2AJQA 3GFYA 4PWWA 4EO8A 2R8JA 2XSFA 2IJRA 2VQFJ 4S0MA 2KN4A 1FWLA 2HVZA 1SIWB 4RW7A 4FYYB 5F8JA 4CLYA 2Y9HA 2AP6A 3UCUP 2RRAA 3GCWP 3IA0A 4HHUA 4CZCA 3NS7B 2C2DA 4JV5F 2CPJA 4K0KJ 3D6TB 4NRUA 1AFIA 3J81Y 1YJNS 3RB6A 4AQYJ 1PYOB 1X8DA 2YH1A 2K1RB 3QJLA 3TRGA 2LA4A 1N5SA 3ILOA 3PKMA 1ZS6A 2VFSA 3DOKB 4GMKA 5I42B 2YX1A 5DG9A 1N4LA 3C66A 3MD3A 1JX4A 2GMHA 1VQ6S 5F9LA 1DRZA 2HRUA 3QYYA 5KG7A 1S1XA 4P6QA 1F9FA 1VQMS 3Q22A 1S1UA 4DZ6A 4EBDA 5EX3A 1PJ5A 2B7CB 3UO0A 3P45B 4WCEQ 1B4SA 3GMGA 2O01C 4IYQA 3BS9A 5MLCV 5CABA 2HAIA 4P73A 4LF9F 4NLWA 4USMA 2RB7A 5L9NA 2B5JA 4ERDA 2GFFA 3AODA 3KK1B 1RHRB 2DY1A 2FTRA 4KTQA 5AJ3F 3QT7A 3PX0A 2UV8A 2BVZA 2CPFA 3JYTB 2R8GA 1G3OA 2FY1A 1HR0J 2HNDA 3LO3A 1F6TA 1RLCL 3UE2A 3KJFB 3HVTB 1RTIB 4ECVA 2J8SA 4WF9Q 1FA0A 4FDFA 1HBMB 3OFGA 1RE1B 4GKJJ 2E5GA 3PEHA 1TL4A 1BLUA 4DV5F 5IT9Y 5EWEA 1Q5VA 3M6VA 1A7GE 2PN6A 1FRIA 4DUTA 2IDLA 1I3OB 4ED7A 4ECSA 2DIVA 2DNOA 1N52B 5HP1B 1RTDB 4IR9A 1H2UX 2VONA 1IVZA 1CJKB 1UWAA 3ENAA 5KT4A 5A8KB 1DTQA 3BV8A 3JTOA 4PG6A 1WOSA 5CYQA 2CPHA 4B17A 2GX8A 3NG8A 4OYIA 2VH7A 2CWXA 1HNZF 2VDIA 3RGIA 1C4AA 4I56A 1IJEB 1QDUB 4WXOA 2ZITA 4C8OA 1U8WA 1DQ8A 4IFVB 2JFDA 2CQ2A 4DR6F 1JLBA 3HLUA 4M5HA 2DNMA 3V5RA 2C2EA 4B3TF 1SL0A 1RQ0A 4QW9A 3OUYA 3BREA 1SC1B 2O67A 4NLUA 2W25A 4OHXA 2RU9A 2QA2A 2GCFA 5GAHU 3IXQA 1BC6A 3KMQA 2ZE2B 1FK9A 4TQRA 4ZIWA 3EGZA 4PUOB 4WPAA 4PKDB 1H72C 1WF1A 3NGRA 1XNRJ 3ELHA 4NMXA 4DWIA 4OLOA 3D4JA 2OPPB 2VFTA 4DPWA 1F5CA 2V2KA 2ZVIA 4QWCA 3IAM9 4CM2A 3UVJA 5GMEA 3SEOA 1VRQC 1OPZA 2FJEB 4B3OA 1BWEA 2QYGA 1WEZA 5L1JA 5E3PA 4K2JA 2JLGA 4DHVA 4F4AA 4U67Q 2KYZA 2NXCA 4LR8A 3EM1A 3VAJA 2CUYA 2DH8A 4DL4A 3HO1A 4KAIA 1QUPA 3TZWA 3C16A 1RHKB 1YZ7A 1TTHB 2XMAA 1T9XA 2EG1A 4DPOA 3UCZP 4X4NA 5HMXA 4DZDA 2ZZTA 3MPWA 4RJVA 2Z2LA 3NEKA 2NSBA 2XMKA 4DR3F 3V6KA 1WKJA 3HVRA 2YNGB 1KS2A 4UT4A 4ZVHA 2M8HA 2B6AB 2FLPA 1M1GA 2XY5A 2KFNA 1S6PA 4OZLA 4R0EA 4LBIA 1RA7A 4OI2A 5DS7A 2WSCC 2BANB 2NYHA 3IWLA 1SC4B 4G65A 1IR1A 3KK2B 4JBCA 1F3VA 4NPOA 2LCWA 1ZAWA 1WC0A 1R3NA 3GLJA 3ZZZA 2BW2A 1PKUA 1HBOA 2RE1A 1B7FA 4PYAA 2UUBJ 3BH7B 4NLXA 3T19A 3PG9A 2LEPA 4WK3A 2AKWB 1R27B 3HSDA 1RTJA 4Y2KA 3AB4B 1TL1A 5CD4A 4KJIA 1VIXA 1FX4A 2HNZA 3C46A 4O0NA 4IO1A 3FC9A 4B3SJ 4HTIA 2YTCA 3M8PA 1HNIB 2MZRA 3BGFA 1TZ0A 1SKUB 4FF2A 4IR1A 3WX4A 2AJFE 3MPDA 4FVMA 1GFWB 4N47A 2BM0A 2GIRA 3NMAA 3BR8A 1AFJA 5EN1A 1T0TV 1VFJA 1RT7A 3J81j 5H9EJ 3I55S 4JOUA 1BQNB 2YVSA 4HI1A 2RS2A 1FKOB 3DU5A 1XEZA 4JI1J 2Y3YA 1FFGB 1YZ6A 1OJ4A 4UZBA 5IOLA 2H48B 4P2FA 5KFPA 1WDTA 4LF5J 3EMTA 2F1FA 1H38A 3TQ1A 1BHNA 2VFVA 3PXGa 1HA1A 4PQAA 1LV5A 1X4FA 1AUSL 1LFWA 1T9UA 4JI2J 1NKEA 2ATLA 6FD1A 3HHEA 4DF4A 2WB4A 4IDKB 2QMXA 2JHEA 2BW7A 1VQ5S 1JLAB 2BOAA 4PEOA 4H4MB 3TA1A 1AXQA 2PSZA 1FRJA 1SC3B 2ZM6J 4OZ3A 4DCJB 1RT3B 1K1QA 1J27A 4RUCA 3GFHA 3A8KA 5I3PA 4Y0FA 3A3OB 3QGIA 4XIUA 2K7KA 2WK4A 2ZH6A 1NHVA 4L3KA 4KIAA 1RACB 3KLHB 1RWXB 1EARA 2IPOB 2UVVA 3AA8A 3B8HA 4DUYJ 4WKYA 1AROP 3FBFA 4MMOA 3RBZA 3EXCX 2UXDF 2ABYA 2HG4A 1CQNA 2QLBB 5IM0B 3TARA 1XTZA 4UQTA 1XIQA 2HVDA 3U1MA 3KLIA 4ZN3A 5IWAF 3OW2R 2AYBA 4NYPA 2H4WB 3QT5A 4DV4F 1E6VB 4NI2B 3GV7B 3UWTA 3CE8A 8RUCA 5FLXU 2OTJS 5HLFA 3TAQA 2UUTA 3R7BB 3F73A 1SKRA 1ACMB 1RYRA 1GXTA 2OPQB 1D09B 1WKLA 5DZ7A 2WVCA 1UZDA 2PE8A 1IQZA 3KXDA 4JI0J 3MCSA 1U1KA 5KFDA 4I64A 4EUVA 1R8CA 1NO8A 3KNGA 4KGMA 1RAEB 1KQKA 4RO0A 1DQ9A 3CCUS 3TQEA 2JWNA 1RT2B 1T03B 1S6OA 1KNZA 3OFHA 4M5LA 2WRMA 4ED4A 4CH0S 3HKWA 1WEXA 2QA1A 2OPSB 3TOQA 1HNVA 3MFIA 3G96A 1SCJB 4LR9A 1X31C 2P6TA 1FRKA 3NCPA 1JLGB 2WSEC 2UXCF 2C22A 1GMVA 5J2QA 2WW8A 2VPXB 1NSQA 1NUEA 2QL9B 4KKOA 1ZBTA 5HBMA 5JVHQ 4WIQA 1VQPS 4XDCA 3LANA 1S6UA 3HT0A 1XMOJ 3U1NA 1HBUB 5F3ZA 2DHHA 1X0FA 1RBLA 4QWEA 1H2TZ 1AZSB 4OV1A 1B0TA 4DPUA 4NLOA 2D41A 2ZJRQ 3SQOP 4ZPWR 1FXLA 1V9OA 3E8OA 2LP4A 1RAGB 4RW8B 2HHSA 3THPA 4UUXA 3HULA 2YH0A 1RT1A 3D3CJ 2RD5C 3OD2A 2A2DA 1FD8A 2R7VA 3MCMA 2MYFA 4JI4J 2DNHA 3RW7A 3EDRB 3UW1A 3D0GE 1BQXA 2RKIA 4L6V3 3R6LB 1QLNA 5ETTA 2BJ7A 4NASA 2HQIA 2XBPA 1WDDA 1T8EA 2H65B 2QV6A 4OHZA 4UY85 1VQNS 2OHDA 2ZUAA 2FB0A 2M8DB 1H7XA 1NDPA 3ET6A 5KAKA 5HN0A 4RZRA 1H73A 3QPIA 1A0OB 3IO1A 3I6PA 8ATCB 3S1TA 2NPIA 3KUEA 1D9DA 1VC6A 5AXNA 1NK9A 3PACA 1YLXA 2HS3A 3SFGA 5DM7Q 5EUHA 4RU9A 2XMMA 1S5ZA 2VD3A 5A8RB 1UVIA 4MIAA 4DV2J 2W9BB 4X4QA 3HVAA 4RUHA 2LYVA 4Z7CA 3R5GA 3B6BA 2MQOA 3O6QA 2GVZB 1W2IA 1YWXA 2D3ZA 3Q83A 1SH3A 4PXCA 4KGVB 3HXMA 3I9ZA 5DRKA 3TX0A 1UWBB 3J7YI 2ZH1A 2P6SA 2Q66A 4XPCA 3MM7B 3CJ2A 3R5CA 3HX9A 3ETOA 2FGCA 3FGVA 3DFEA 3KK3A 1YJ7A 3DRRB 2GVDA 5BYQA 4FYVB 2WVEA 3ZTQA 3CJ4A 5M2RA 1KDNA 1KP6A 2J0WA 2YKPA 2YKMB 1W2BR 4UOCA 3KHHA 2IAJB 3U27A 2UU9F 1I6JA 3TEHB 1NU4A 4NZ6A 4U8YA 6FDRA 2HMIA 4CWBA 2HKEA 4R5PB 5FDLA 3RYLA 3NRBA 4QZVB 4F4WA 4B9TA 2N3OA 5CA5A 1K1SA 2XYHB 3CJ3A 1FJ7A 1Q78A 1GMWA 3QFHA 2XTJP 1N34J 2MLZA 1IJFB 4GKJF 4I2QA 2Z57B 2HWHA 1JXLA 1QAIA 1KEKA 2ZZNA 2J9CA 1CULA 4ZOSA 4C2MA 4BBYA 4DN0A 3PW2A 1QSYA 4XPEA 1CJUB 4FXVA 4B3MJ 2WVBA 3ISZA 3BKTA 4FP9A 2P9GA 3CCTA 1FJEB 5C2CA 4DCPB 3W9JA 4OYZA 2HHVA 4IQMA 1VJWA 2QFIA 4W92B 2Y1LB 1LNQA 2P8IA 4ZVOB 1YVFA 2DO4A 2VPYB 5A6PA 4CRJA 2XNQA 4IRCA 3MMCA 2B9XA 2MKIA 2HNDB 3CWJA 2MGZA 2X1AA 3M1VA 3T1YF 3VAMA 2PMZD 1WC4A 1NRKA 4FBUA 4Z37A 2CYYA 4ZVTB 1RHQB 3CMQA 3DM2B 2XMUA 3KTQA 3IN5A 2EFVA 3WIUA 2E5LF 2OP5A 1EKSA 1HQ2A 2E1MC 2HK3A 1Y7PA 4Q0BB 2KZZA 4IG3A 1HBNA 4OMFG 4D3HA 4MH8A 2CQ3A 1U48A 3HI9A 3ENQA 3BF4A 1U02A 4LF4J 4ECQA 1UJ6A 1N5YA 3KOAA 4KHMA 4DFJA 1S59A 5T7LA 4M63A 1RA6A 3DLEA 4BC9A 1XNRF 3QLHB 3G8TA 1AB8A 2WBRA 1TAUA 5SZTA 3V6HA 1L3UA 3LP2A 1DARA 2AX0A 2YPYA 3HT3A 3GG1A 5HAOA 2A0FB 3W5XA 1TUVA 2D3UA 2WZ1A 3GONA 5IFMA 1T11A 1SKSA 2W2QP 4JUZA 3JB9k 3EZUA 2AGOA 1M5HA 1SXLA 4KPCA 1M5OC 3B4MA 4ES1A 1S1WA 4P2SA 2CNKB 1ZAVA 4QIEA 3OUYB 3ULHA 5IT4A 4U96A 2QGFB 2PD1A 3FCWA 3OR2B 2GAHC 4BDPA 2EVZA 2Z30B 3SI8A 3SSRA 2EI5A 2M2BA 3I0SA 4ZJQA 1KVJA 4YY3F 5ETRA 1YHQS 3N5FA 1NJWA 2MPUA 4C8YA 5AE3A 2XO7A 1APSA 4U9RA 2FIUA 2KFZA 2R4FA 3J7YU 1FE0A 3QIDA 3WIVA 3MTKA 2J76E 2MQQA 3PO4A 3IM9A 3VGUA 3FK4A 4LQ9A 4G1IA 4FBTA 5I4MA 4AL6A 1Q0NA 4B3OB 3H5UA 2BZ2A 2RRNA 3FQLA 3R5JB 2VKZG 2ADBA 3V81A 2UUBF 4LFBJ 2GAGC 5K14B 1MWQA 3LAMA 4YQWA 4J7CA 3CB4A 3C14B 4DMZA 2BR0A 5EWFA 1R8BA 4ECUA 4RW9B 3MM8B 4CP5A 1QSLA 3DYAB 2EFPA 4WK1A 3PVXA 2Z58B 2CQBA 4K59A 1TKDA 4JV0A 6AT1B 3C8YA 4WZQA 2IM2A 3MAHA 4LF7J 3MPUB 2W7PA 5FLXY 2LXFA 2RH3A 3JXOA 5A6WA 4B3SF 1REVB 3NCQA 1LWCB 4Q7AA 3F41A 1SQGA 1FX2A 4CM0A 2HNYB 1S6PB 3QWPA 1RJJA 2MKSA 2FJBB 4W90B 4USTA 2I2YA 4ZP8A 1UFLA 5D8HB 1LWFB 2GIQA 3T5JA 3DRPA 3FDSA 4BCAA 1VRTA 4JI1F 1DAXA 1U45A 2HBQB 3BQ1A 5DG8A 4DSJA 3HVWA 2L41A 1SH2A 1RCOB 1UMJA 3MPVA 2ASYA 4TY9A 3GR0A 2ROGA 3TNVA 4LR7A 4LF5F 2MQPA 3UD3P 1OS5A 2C42A 2R7RA 2OH2A 2ZBIA 4H54A 3Q8VA 1AYEA 2VBZA 1T3OA 2HQ3A 4ILMA 3GR1A 2R7OA 1HL6A 1FEHA 3D6MB 4CTAA 1VQSA 1J5EJ 4QBUA 4JI2F 2HAFA 1FFSB 1N0VC 2LECA 2HFSA 4FF1A 3POTB 2YWWA 5EX0A 1SBRA 1WHVA 4ECZA 4DOZA 2J7WA 2CQ0A 4LRCA 2HW3A 4AE5A 2CFXA 2N82B 4OZ5A 2MLXA 3G82B 4ID8A 4USVA 2HQCA 2Q1LA 2BJEA 3SFUA 1RT7B 4OX9J 3UPFA 1EX8A 2J6UA 4KHPF 3R2DJ 2KZMA 4ETXA 1KVIA 1KD1T 1KFSA 4A8QA 4IH5A 4NLYA 1FE4A 1K73T 4Z7YA 3T5LA 4IO9Q 3ITHB 3W63A 4F2RA 2COLA 2B9YA 3MCOA 4JI6J 2KM8B 4QYRA 2HIQA 2W8LA 3VR1A 2HWTA 4NXMJ 1NK0A 3T9NA 3DLGA 3E01A 2RS8A 5AXKA 1NHUA 2XB2D 1QD1A 2UVWA 3D2WA 2HHXA 1VBZA 4ZDNA 5F0UA 1HQUA 5IS2A 5HK4A 4QU7A 2ZH3A 3K59A 2IMWP 2BJ3A 1WC6A 1JLQA 3K8VA 1WJ9A 3HSGA 3PW0A 2HWIA 2J9DE 3B54A 1RP5A 2DXEA 2Y8WA 3C19A 2HHTA 2K3KA 4JI0F 2DR8A 1X4EA 3D1QA 2EXUA 2C3MA 2K2PA 3CD0A 2J7UA 1VI7A 5I3UA 4YHHJ 4P10A 1OMSA 5IV3A 2ZHAA 1WSVA 1JB0C 3KJQB 1VGYA 1WF2A 1TUGB 2ASLA 3CD7A 5LMNJ 4DQRA 1U1OA 4QIVA 2FLOA 2PA8D 1M5SA 3QO9A 4O3RA 1LQ9A 3HDSA 5KT5A 2JX2A 4YR3A 2FHJD 2XMVA 1V3SA 3W5ZA 3MD1A 1H2VZ 3PYGA 4Y2AA 5JJBA 4F7VA 3KKFA 1VK3A 1LFPA 2ZOMA 1TQLA 3UI3A 3MM5A 3BN7A 2ACYA 1FNOA 4QW8A 1SI9A 2ZHOA 4OJGA 3HZEA 3M8ZA 4NOHA 3D9BA 4KY3A 3W8GA 2CQPA 4O3QA 5EGYA 4QIWD 3H4DA 1DTTB 1Y10A 2BEFA 3D66A 2DR6A 3FQKA 4K5SA 3RW6A 2ZBRA 2M88A 3K5OA 2X51A 5B08A 2V5HG 4DS5A 4LF1A 2R7XA 5KFOA 4O4GA 1UAWA 1FKPA 4QR0A 4NLVA 5C7PA 3MGJA 1RT5A 1Y5LB 1KLMA 2KH9A 1VHFA 1O6XA 2WOMA 2HBRB 4DL3A 1WNEA 4X4SA 3BO4A 2GJ2A 4M94A 5A8WA 1RT6A 2HZAA 3U1LA 4IRDA 1JLFA 2W01A 2CJAA 5D0GA 1UW9A 1VBKA 5DDQC 4NYOA 5GMDA 3DRYA 4KT0C 2LFVA 1P8GA 1J2VA 3JSBA 4H4OA 2XM3A 1RCXB 4Y65A 2QLXA 4RW6B 1S9EA 2RUSA 3ENWA 1H3DA 2V8GA 5K8MA 4NXNF 3N4WA 2K7JA 2HRTA 4DR5J 1VQ9S 1T3NA 2JOQA 1RT1B 4GKKF 2W9CB 4HACA 4DG1B 3OSNA 3MMJA 1O8BA 4ZKAA 2XWYA 2KRBA 4ZVEA 1ZPWX 2KG1A 1S1VB 2LKZA 4DL5A 4Q45A 4C6AA 2YKNB 1JJCB 1RI7A 3NNHA 2GW8A 2NCKL 4ZP9A 5F8HA 3V6JA 3HM9A 4HTJA 1EKRA 3GWCA 1K0VA 3P4UB 3UN3A 5KT2A 4X66J 3NGSA 4HDGA 4ELUA 3UFCX 2LEBA 2V69A 3IP0A 2YNHB 4K4TA 2PFFB 4LBHA 1NZAA 1Q82T 4I0WA 1RWVB 3CC4S 2AYEA 4PXEA 2QLFB 2B4VA
chains in the Genus database with same CATH topology
4F4KA 1KOHA 4QR2A 4JV1A 1TKXA 3UD4P 2IJFA 3LP1B 2B3TB 4YR0A 4IOCQ 3NAHA 1S1TA 5KT4A 2RILA 3TAMB 5A8KB 3DOKA 1DTQA 5B0GA 3JTOA 4PG6A 1LW2A 2JSXA 3G8QA 2J6TA 2XMWA 5CYQA 1XERA 2CPHA 2RIJA 2CDQA 3NL0A 4B17A 4J9KA 2GX8A 5KG6A 3NG8A 2HGMA 1TR0A 2XLJA 1S99A 2VH7A 2M9KA 2DJWA 3VZHA 3CJ5A 5HMWA 1S0OA 2V9WA 1UVLA 4MAKA 1HNZF 5HI7A 1XR5A 4F3QA 1C4AA 1IKVB 3V4IB 4I56A 4HYKA 2HFOA 1IJEB 4HT5A 1KQFB 1HARA 5KFNA 4WXOA 2ZITA 4ECRA 4C8OA 4YHHF 2MXYA 3H2UB 1WELA 2NUHA 1DQ8A 4IFVB 1DHMA 3PHEA 1Z2ZA 3BN4A 5ITHA 2JFDA 5KFYA 4TLQA 2VKRA 1HHTP 4O44A 2CQ2A 4O23A 4DR6F 4ED5A 4HI2A 4DSIA 4OI0A 4U6PA 3CC7S 1JLBA 3HLUA 2R8KA 4B3MF 1JLEA 2DNMA 2ROPA 5BYRA 5LMNF 4Z2XA 1FRMA 3V5RA 4QJVA 1ZTTA 2IRUA 1O51A 3JAMY 1U7LA 2ZH2A 2JC0A 4ZK7M 3G8SA 3QZ8A 2WHOA 2C2EA 1MMDA 4B3TF 1M1KT 1SL0A 4ECXA 2UUCF 1GTEA 4Y2CA 1Y4ZB 4LF8F 1RQ0A 4QW9A 1HWLA 2KXFA 1HFEL 3K2YA 4RW6A 4DDFA 1HBOB 3OUYA 3OTDA 3BREA 1WEYA 4QR1A 2O67A 4RW4B 4ZP7A 2VQEF 3G4SS 4ITSA 4OZNA 3I0RB 1LKZA 3KK1A 2DNRA 2FC9A 3R3TA 4MTPA 1X4BA 4QWAA 4NLUA 4N41A 2W25A 3I31A 1U6BA 3K8WA 4OHXA 2RU9A 2WB1D 1RTJB 2QA2A 3LGNA 2GCFA 5GAHU 1NKBA 3IXQA 1BC6A 3KMQA 3QGHA 4USJC 2ZE2B 1TL1B 3OVAA 2LEAA 1FK9A 2DVIA 1A9NB 3GB0A 3SCIE 4TQRA 3JYTA 2W9CA 2HMIB 3EGZA 3I87A 4DG1A 2FJXA 2HS0A 2DHAA 3IGVA 4K2XA 4F3MA 4PUOB 5FDLB 2DNYA 4M1KA 5K8PA 3DLKA 4OI1A 4IRKA 3OSPA 3PDNA 5L8RC 4PKDB 1WF1A 4HVZA 2FDNA 2KT5A 2L3MA 2B4UA 5IT0A 2MY8A 1HW9A 3FEXB 2HNZB 3KLVA 1R7IA 4QWDA 1S1VA 1SKWA 3HVTA 4DWIA 1RTIA 5M2PA 4OLOA 3EX7B 2VQFF 2LQ9A 3MAQA 4B9LA 3IBWA 3CCLS 1TVRB 2OPPB 2YKNA 4MFBA 3NBPA 2VFTA 1X5OA 1F5CA 3OTCA 2FVCA 3N5BA 1WHXA 1U26A 1WG4A 1Y5IB 3M8PB 2V2KA 4DV0F 5BR8F 2DNQA 5F8GA 4QWCA 1SJ1A 2IC3A 4B9NA 3KLFB 3IAM9 2HGNA 3SEOA 1HBMA 2E1RA 1OPZA 2FJEB 4B3OA 1BWEA 2O1PA 1BGXT 4C3LA 3W7BA 3GYXB 1PC4A 1WEZA 5L1JA 5E3PA 2JLGA 4DHVA 1SV5B 3D28A 4PG7A 2MMYA 2ZNYA 4WYWA 4U67Q 4EEYA 2FHJA 2KDOA 4C3MA 5M2UA 1HYSA 2R7TA 2KYZA 2ASJA 4NWBA 1CSJA 4DS4A 5C25B 3BM7A 4K0KF 4LF4F 4YUDA 2L08A 4EFAC 3VAJA 1KRPA 2DH8A 4A8OA 2XCAA 2VC0A 2HHWA 2M70A 2V4JB 5L1KA 2DISA 4AQYF 4DL4A 3HO1A 3MM6B 4KAIA 1SB6A 4C0OC 3EGWB 2A3JA 1H0HB 2YNHA 1N6QA 1QUPA 4NLSA 3CPWR 3C6UB 4AUKA 4DLGA 3VQTA 2DITA 4C97A 4WE1A 1RTDA 3LQVA 5LXYA 4B9MA 4NCAA 1ELOA 2V4QA 3OVSA 1N56A 2EG1A 2OAUA 4DPOA 3UCZP 3S6EA 1KFDA 4X4NA 2Z2MA 3VCDA 4C0BA 1Q8LA 2XSJB 1IKYB 2P9EA 3V2UC 1U8SA 4OJHA 5HMXA 3LP1A 1TV6A 3ISND 3W3SA 3MPWA 3TAMA 2Z2LA 3PO5A 2NSBA 2XMKA 3TA2A 4DR3F 3J7ZT 3V6KA 2GC8A 2AJ1A 2C3PA 2DNZA 2OPRB 3HVRA 4MKAA 2YNGB 3I96A 1KS2A 3OHAA 1HWJA 1WWHA 5CQGA 4ZVHA 4FNIA 4UW2A 3ZZTA 2M8HA 4ZHRA 2B7BB 1T02A 4F4YA 2CG4A 4DLEA 2B6AB 4WIIA 1GXUA 5DLGA 4K50A 2XLKA 2FLPA 4QPXA 2E5JA 1HD0A 5KFJA 1L5UA 3AHPA 2XY5A 2Y1JA 2KFNA 1IKVA 1S6PA 4HEA9 3V4IA 1TK0A 2BQUA 2DR7A 3LWMA 2F7VA 1UA1A 2OO4A 4OZLA 4DN9A 5F8MA 1L3KA 4R0EA 2HVIA 1OSCA 4IFVA 1N8RT 3UDLA 3MDFA 1YJVA 2M3DA 4IQXA 4PXDA 1RA7A 4OI2A 5DS7A 2WSCC 3B78A 3HZGA 2BANB 5CCMA 4F26A 3IWLA 3UR3C 1VK8A 2BABA 1FF2A 3D0HE 4PWDB 1D3WA 5HL7Q 1T94A 2LLZA 2ZOFA 2CQCA 3KK2B 3GG0A 4JBCA 4YP3A 1O0PA 4NPOA 3CDEA 2LCWA 3DOLB 4KBIA 2AX1A 2XLIA 4O3SA 4K4VA 4OZ0A 3KNAA 1ZAWA 3UR0A 1GQEA 1R3NA 5CYJA 3KMSA 3ZZZA 1HD1A 2BW2A 2JL9A 1H6KX 3MR3A 2C28A 3GV8B 1HBOA 2RE1A 1B7FA 3OR1B 2CJ9A 4NLXA 3FFIB 3T19A 3VAIA 1URRA 3I0RA 3H5YA 4K4ZA 2LEPA 3QGGA 2DGQA 4NCBA 4WK3A 3MEDB 4DL0C 4G1PA 2Q6CA 1R27B 4C0HA 1C1CB 1Z4UA 1RTJA 4Y2KA 2PI5A 5LL6d 4LSLA 1U47A 2Q79A 2L48A 5IQQA 3SCLE 3X1LB 3CCMS 1TFWA 3QMQA 2ZE2A 3AB4B 1FJGF 1TL1A 1HR0F 4MKYA 3BEGB 1T95A 4PUOA 2EBGA 5I3QA 4KJIA 1QSSA 2LVWA 4ZPAA 5DDOC 3TUJC 4NCGB 1VIXA 5AXMA 2MHEA 3TYTA 1LK5A 1VMBA 2HNZA 3C46A 4IO1A 3RBDA 3EGNA 2IYGA 1X4HA 3LP2B 1YI2S 4FYDA 1TVRA 2PDAA 3DMJB 2I1RA 4KB7A 3PFOA 2VODA 4HTIA 2YTCA 2F9DA 2XGPA 2PMHA 3M8PA 1HNIB 2PA3A 4HT7A 2MZRA 3BGFA 1F60B 2HZCA 4EGLA 1TZ0A 5E2QA 2VBYA 5HQ8A 2YWGA 4FF2A 2XS5A 4KFBB 5DLFA 4IR1A 3WX4A 2AJFE 2GJIA 3IWNC 3TAPA 1B0VA 3ISNC 3CIZA 4FVMA 1ZM9A 4R25A 3FSYA 4N47A 2BM0A 1SV5A 3AA9A 2FVQA 3DLLQ 2IHR1 3JSMB 3RRGA 2GIRA 3NMAA 3BR8A 5T41A 5DQGA 1S9GA 2EWHA 3MEKA 3MOZA 1AFJA 5C25A 1X9WA 5EN1A 2RQCA 3LW5C 1VFJA 4IKAA 1Y0HA 1RT7A 3KLIB 3RU0A 3IG1A 5H9EJ 3CCWA 3R5BA 1KONA 3I55S 2YX7A 2RNEA 5MAOA 2I38A 4JOUA 2R2RA 1BQNB 1VRUB 2V4JA 5B09A 2YVSA 1ZYQA 4HI1A 2RS2A 1FKOB 4CNZA 3MM6A 3DU5A 1U1PA 1XEZA 2UV8G 4I6WA 1LOUA 2VASA 2XNRA 1U49A 2HLTA 1Y3JA 1WI6A 2G1DA 3C6UA 2RQMA 4OJ1A 1XBWA 4RU2A 2OKQA 2QSFA 4LF7F 3DN9A 5GAHI 4GO5X 4H4KA 2B4PA 1SH0A 1DURA 5HLFB 3QAEA 4I6AA 4ILRA 1SL1A 5KFPA 2XSJA 1IKYA 2LDYA 2HLUA 4BWMA 2F1FA 2ZJPQ 3TQ1A 1L3TA 1H38A 3T9ZA 3Q2TC 1M0SA 2IJNA 4IFYB 3LP0B 4CIOA 3H25A 1CG2A 2VFVA 2D9PA 1NJXA 1N5QA 5GAGI 2OFGX 3PXGa 4OFZA 5KFEA 3DHWC 3K5MA 1HA1A 2DCUB 2B6AA 2I9SA 4RKUC 4PQAA 4LFAF 1LV5A 2E1CA