1VJWA

Structure of oxidoreductase (nadp+(a),ferredoxin(a))
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
59
structure length
59
Chain Sequence
MKVRVDADACIGCGVCENLCPDVFQLGDDGKAKVLQPETDLPCAKDAADSCPTGAISVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Small structural changes account for the high thermostability of 1[4Fe-4S] ferredoxin from the hyperthermophilic bacterium Thermotoga maritima.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Oxidoreductase
molecule keywords FERREDOXIN(A)
total genus 14
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 1996-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00037 Fer4 4Fe-4S binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1vjwA00
1FXDA 2FDNA 5CH7B 5BYQA 4KT0C 2PA8D 1FERA 2VKRA 1ROFA 2PDAA 3MMCB 1BQXA 1FDNA 1FRIA 1FD2A 1FDAA 3MMCA 1F5CA 2VPYB 3MMAB 1FF2A 2C3MA 1DURA 1IQZA 1FRHA 4Y28C 1RGVA 1XERA 1D3WA 4RKUC 4L6V3 2V4JB 1BD6A 3OR1B 2FD2A 3LW5C 2GMHA 1KQGB 5L8RC 5CHCB 1KEKA 3MM9A 2GMJA 4XK8C 1G6BA 4ID8A 1R27B 1CLFA 2VPWB 1DFDA 1FDBA 3MM5A 1FRJA 5E7OB 1IR0A 1B0PA 2V2KA 1GAOA 1G3OA 2C3OA 5FD1A 1BWEA 3EUNA 1JB0C 1AXQA 1PC5A 2Y0SD 1BC6A 3MM8B 3MM7B 1FXRA 1Y5IB 2FJEB 3GYXB 2UZAA 3MM6B 4OMFG 1B0VA 3C8YA 6FD1A 2WB1D 1WTFA 1C4AA 1FEHA 1Y4ZB 3IR5B 2IVFB 1GT8A 2Z8QA 1HFEL 3OR2A 3EXYA 3OR2B 3MMBA 3EGWB 2XSJA 2ZVSA 1JNRB 2VPZB 2WSFC 1F2GA 2XSJB 3HKZD 3IR6B 3MMBB 1KQFB 1Y5NB 4AYBD 2C42A 2PMZD 1C4CA 4XDDA 1GTHA 3MM8A 4OV1A 7FD1A 2WSCC 2O01C 2VPXB 3MM6A 1GTEA 1Y5LB 3MM7A 1FRMA 5BYRA 1A6LA 2FJDB 1B0TA 7FDRA 1FRKA 1FRLA 1SJ1A 2FJBB 4CI0B 1H7XA 1FDDA 2FJAB 2C3PA 3MM5B 1H7WA 4XDCA 3IR7B 3PNIA 1H98A 1BLUA 2V4JA 2C3YA 1Q16B 1DAXA 1H0HB 2FGOA 1K0TA 1VJWA 1JNZB 2WSEC 1PC4A 2WAQD 1FCAA 1FRXA 2C3UA 1F5BA 1FTCA 3MM9B 4YDDB 4DHVA 6FDRA 3MMAA 5BYSA 1SIZA 3OR1A 1SIWB
chains in the Genus database with same CATH superfamily
1IKWA 2HWHA 5F3ZA 1IBLF 1WEZA 4DSKA 2IYIA 3TQEA 4QR0A 2RUSA 4AD6A 3JXOA 4OYWA 2DR8A 3NL0A 3J81Y 3CO9A 3JSMA 4OX6A 3L3CA 3GFZA 2IVMA 3SCJE 2R2SA 3KLVA 1UVNA 3UDVA 2FVRA 4JI8J 3VV2B 2EG1A 2MTLA 3E01B 2QFJA 1QAIA 2OPRA 1GEHA 2HGLA 5B09A 9RUBA 4ETZA 1S9EB 4NCGA 4CTAA 4AL5A 1S59A 2HMIA 2P9GA 3PM9A 2HRYA 2LQJA 1CBKA 4IYQA 3HHLB 4E8UA 2PA3A 4F3MA 2KFNA 1R0AA 2RE1A 4U6PA 2V4JB 1VRUA 1KOHA 3QGHA 2UUTA 3T5HA 4IOAQ 1KHWA 1ZOTA 2VC0A 2RAQA 3KLFA 4CLLA 2QV6A 3DRPB 4F0MA 4O0IA 1WF1A 2DGUA 3US5A 2R2UA 1CJUA 3BN7A 1R3NA 3QNWB 5HLFB 5C25B 1BHNA 3FZBA 3BGLA 4KV8B 1S1VA 4PCQA 2BE7D 3OL6A 2DR6A 1REGX 3Q8VA 3MR2A 1JLBB 3NCPA 4I67A 5D8HB 3CMQA 4J9SA 2K8GA 1VQPS 1NDKA 3OFGA 2ZFHA 4LVOP 4QIVA 2VONA 1GQEA 2PO4A 4DR3J 2XMJA 4EK2A 1NJIT 2CDRB 1XBWA 2HK2A 3M9OB 2LCWA 4ZCKA 1AXQA 3ENAA 1RBLA 2GVDA 5JVHQ 2ZHBA 1Q86T 3NWRA 4LFCJ 3KUHA 4I7FB 2WONA 4WF9Q 4MIBA 3SSQA 1S1TB 4M5MA 1HNWF 1RTHA 5CA5A 3M8SA 1U1KA 4FXDA 4OZ1A 3C8YA 3NAHA 1EARA 3I87A 4CCHA 2JEJA 3LAKA 4RX6A 4HYKA 3L4BC 2HURA 2HHQA 1QSSA 3CE8A 3I82A 2W25A 3KJQB 3CJ8A 4G1IA 4C4WA 2A1BA 1REVB 4MH8A 2ALZA 2BE2A 3FSYA 3EXYA 3CJKA 2MJNA 4G1QA 1YX2A 2VG5B 3C46A 4DR4J 1FKPA 3DLKA 4QYZK 4L73A 5KFXA 2BRLA 1UVMA 4YY3J 3SEOA 3HULA 1VBXA 3OFFA 2WSFC 5F8NA 1S6PB 2XSJB 3HSGA 3QAUA 1T03B 3TO8A 3FKBA 4PABA 9ATCB 5F8MA 2JC1A 2DO4A 2W4DA 4YR0A 2BVZA 3OJSA 3FVYA 3MPDA 2FJXA 3C6UB 3IG1B 4ZVFA 5KFNA 1IM6A 1FKOB 1Q95G 2CPDA 5A6WA 3EX7B 4ECTA 4FXWA 1RTHB 1JWWA 2DRDA 2CJAA 2O01C 4Y2KA 1PYOB 1U6BA 2BA9A 1S1TA 4QYZJ 2ASDA 2OELA 3R6GB 3AOBA 5J2MA 1SL2A 2E5IA 1RWWB 3L9ZA 4URSA 3PRDA 3IAM9 5BYRA 2H9ZA 2E7WA 1PJ7A 4CH0S 4X4NA 2CJ9A 7FDRA 1FRKA 2WVFA 1GFWB 2D3UA 1YKWA 1C2PA 2L9WA 4PZVA 4WBFA 5EUHA 1H7XA 3CD7A 4RBUA 4JI0J 5M2UA 1JK9B 3N01A 4NYPA 1UZDA 1S1VB 4NZ7A 5BR8J 4Q0BA 1WEXA 2MEWA 4RU9A 4F3OA 2OI2A 4A8KA 5HO4A 1Y7PA 1NUEA 2NSCA 3M1VB 3HHLC 3HT3A 3M30A 2C3UA 3W60A 2DHXA 4IOCQ 5E2QA 1VRTA 3DC2A 3EXCX 1TL7B 2VG7B 2B7BB 4USVA 4UY8T 5EN1A 3QWUA 1HWJA 2NXNA 2COLA 3DN9A 3SYZA 1YITS 4CWBA 5CCLA 3CCLS 1R0AB 2VFSA 3T3FA 4IRDA 1SH2A 4H4MB 5A8KB 1T9XA 4LF5F 2IFXA 2UXBJ 4LBPA 3N28A 5F8JA 2ZOMA 4LR9A 4X62J 4DX6A 4KPYA 1SKSA 4XPCA 4M94A 4KY3A 2C2ZB 5HROB 1NJZA 2BJ3A 2N4CA 4ZOSA 4C0OC 3F73A 5LSRA 3BBFA 2V67A 3HVWA 2RHQB 4QYRA 1Q8BA 3IM9A 3DDIA 3IGNA 4DDFA 2CQHA 2PMWA 3OFHA 4QIGA 3KLEB 4IRKA 3W64A 5H9EK 3KK3B 4NLUA 3KLHA 3VAGA 4KHMA 1B64A 4JYAJ 1YGYA 2PT0A 3NCRA 4DUZF 2KKHA 1DQ9A 3OR1B 4DL5A 2C22A 4LSNB 1AZSA 2DBBA 3T9ZA 4OZ5A 3MM9A 1RTDB 1Q5VA 1R31A 1TKZB 1HHSA 2IDEA 1U1PA 3H5XA 1VDHA 2X3DA 3VAJA 3O2IA 4LQ3A 1BY9A 1GMWA 5GAHI 4RNMA 3DYAB 4JUZA 1N36J 1O6XA 1FDBA 3OJUA 4USWA 1U1LA 3NOGA 1EQMA 1Y00A 2V6AA 1IKYA 1F3FA 1FRJA 2Z2LA 1FWPA 2XQCA 2W9CB 4A8WA 3QLHA 3CT9A 1ZM9A 3QJPA 2JX2A 3IS9A 3RBZA 1EETB 1LFPA 2JNJA 4P2FA 3H4DA 4GKKF 2PFFB 3IC1A 2MQOA 4OI6A 3C15A 2GHWA 2NYHA 2H51B 1FWKA 2MSTA 2PI4A 2FZKB 2W2PP 2J5AA 1HNVA 3QWPA 5IQQA 5KFHA 3Q8PB 1RYRA 1GXTA 4CDIA 4ED0A 5EGYA 4Q5VA 5AXKA 1E6YB 3UCZP 1NHVA 3AB2B 1NAQA 5CABA 4DV7J 4DR6F 1U02A 2IJRA 2YWFA 4ED1A 3PO5A 4PG4A 3HD1A 4DPOA 4G3IA 2L9NA 5J2QA 1U0SA 3D0HE 2OKQA 2IY5B 3PEHA 3QATA 5ADZA 2B9YA 2DEIA 4ID5A 1VQNS 1H2TZ 1HHQA 2B8QA 2DY9A 2H5EA 1U1RA 4F04B 2DGTA 2RT3A 3D67A 4KBIA 5IWAF 1ZTTA 4H54A 3GCWP 1UVLA 3T1AA 3VGUA 3Q8UA 3QT8A 1RT6B 4A4JA 3FBFA 2Y3YA 3LPYA 4DI6A 5LL6d 3ZZOA 1KLMA 3CPWR 3ILOA 3AFGA 2PI5A 4DN0A 3WC2A 4ED5A 4U95A 4WKRA 4NYZA 4O44B 2XO6A 4Y2IA 1RHJB 2IRUA 3BDEA 2ZDPA 4S0MA 1H2UX 3FQKA 3MR3A 2FHMA 4LF6J 1IUJA 2HQ3A 1ZPVA 1N0UA 3KFWX 2BKPA 2E1MC 4FKYA 2BE9B 1TKDA 1KONA 1YBTA 1JMTA 2FZCB 4DV0F 3F41A 2J8AA 2B6AB 2DISA 1WG4A 2ZEJA 5D15A 5DZ7A 2GX8A 2UUCF 4P7VA 3T6BA 4QBUA 3PV8A 3VR1A 3VAKA 2JEIA 3Q24A 3CB4A 3PNIA 2QN6B 2KDOA 4WP3A 3GIRA 1DAXA 3GP9A 2ZDOA 1RT5B 1ZA1B 1RB0A 1TR0A 2DGOA 1O51A 3MWBA 3AY0A 3OTBA 3R5CA 5I3PA 3NP5A 4ZJOA 4WU3A 4Y65A 3PYFA 4M5JA 5KT2A 3JQJA 4YDDB 2I8EA 2HVHA 2OLWA 6FDRA 5BYSA 4MMOA 2E7XA 1RAIB 3IWXA 3RRKA 1ZM3A 2KTQA 2OTLS 3IAS9 4NRUA 1HBMA 3O6QA 4A8MP 2F40A 3W65A 2JVRA 3JS9A 2CKWA 3NS7B 5KFSA 2R7WA 4NLPA 4USHA 1CJKA 3D54A 1C0UB 2AJQA 1P6TA 2PSZA 3MXHP 4ERDA 2LDYA 1RAHB 2YNFB 1FDNA 1RT2B 1SC6A 4EI2A 3R5JB 1C1CA 4C8ZA 1TL4A 1CLFA 3G6YA 1KRPA 1YJRA 1X4CA 3CMAS 4QR1A 4QWDA 3MFHA 1NDCA 3IBWA 3OXFA 4CIOA 2XY7A 4R0EA 2BRKA 4KFBB 2R2TA 2MB0B 4N5SA 1T8EA 3FZ2A 3UDLA 4ZJLA 3HPOA 3FEYB 1F2HA 1RJJA 2MYFA 5ITHA 2ZBIA 1XERA 2RVJA 3KJNB 2KZZA 2FLLA 1SPBP 2FD2A 1HI1A 5B7WA 3P5TL 4A8SA 4F02A 3EE3A 3SDEA 2EFPA 3P49B 1TAUA 2VD3A 2AV5A 3GU0A 4IFYB 4ZS6A 3TUJC 2XZWA 1S48A 4ID8A 4OHWA 2FHKA 3CJ4A 3IM8A 1A0OB 1F60B 2F4FA 2VFUA 2FQQB 2QLXA 1UFWA 2YWGA 2KXNB 4FYYB 4X64J 1NK9A 2HFSA 1H6KX 1T9TA 2IA6A 2HFZA 4DX8H 1MWQA 2G4BA 1ZM4A 4FP9A 2V2KA 4OIXA 3UWTA 2BV3A 2ZNZA 4CRJA 4C11A 4D3HA 3B6BA 2X7IA 2DGQA 3D1QA 2KRRA 2XNQA 3AQPA 2UUBF 3NMRA 5L9XA 4X62F 1XNQJ 1C0TA 1XR7A 1MWYA 4UUXA 3VAHA 1RT6A 5KFPA 1K0VA 1U8WA 2GCFA 1PGZA 3DI6B 1SXLA 1WC3A 1YRXA 2RD5C 3DGVA 4HVZA 4P75A 3BDPA 4DX5A 3OV7A 3AB4B 3HJVA 4TQSA 3KLGA 1PJ5A 2G1HA 2CAJA 2XMUA 4ID5B 4OZLA 3R7SB 1XMBA 5HMYA 1VC5A 1NJWA 1HW9A 1R8HA 4LF9F 3OVAA 4J9OA 1VQLS 4B9TA 1H72C 2CXEA 2HFOA 2DEJA 1KSPA 4PYDA 4CM0A 4DCPB 2OIHA 3W3SA 5CYMB 3ZC4A 1RZMA 1NU4A 4LF1A 2VBYA 3I4HX 4HDGA 5ETTA 2RF2A 2DPIA 2R8JA 2VPZB 4Y0FA 2R8GA 2VV5A 1NZAA 3DFEA 4M8LA 3MMBB 3W2VB 1Q1KA 1NM2A 1Y5NB 2A10A 4ZVQB 1QUVA 1J5EF 2OPPB 4DR5J 1X60A 3OVSA 3GILA 1KHVA 1GTHA 1JLFA 4ED6A 2AJFE 4L3NA 4LFBJ 1MU2B 4OV1A 2WVEA 3PYDA 4R25A 5GMDA 2FLOA 1TFWA 3IS9B 2BUNA 3A4TA 4WK3A 3FCVA 3DDNA 3QLHB 1IKXA 3IWLA 3I0RA 3NRBA 4X4QA 4WFBQ 1BXNA 3SV3A 3RAQA 1GTEA 1HBNB 2AW0A 3SBMA 3BGFA 3SFUA 4CO2A 2JSXA 3T1YJ 1QVFR 2AJ1A 1TV6B 1V3SA 2R4FA 2WCXA 3DYAA 2GJFA 3M32A 3PR4A 4QZVB 2BMBA 4ZHRB 2NYIA 1F1BB 3UO0A 2VQFJ 1U1QA 1S72S 2Y9HA 4WCEQ 5DLGA 2FVPA 3NNCA 1Q8KA 3I0SA 2HVIA 1LKZA 1XIQA 3C14A 3ZZRA 3B4MA 2UUAJ 1BQNA 1YK9A 3BSOA 4M1KA 1FHTA 1UW4A 1BQMB 2A3JA 3KK3A 2ROEA 2C2KB 4EWTA 5HP1B 4MK9A 4NLRA 4WK1A 5G4DA 5A0YA 5A8RA 4WJBA 4DPXA 1RISA 3MMAA 1B4SA 4ZPDA 5HMZA 3MMCB 2RRBA 4ECZA 4DQQA 1RTZA 3RW7A 1VQ9S 4ELTA 2HKEA 2G1DA 4L74A 4RLEA 2GO8A 1KFDA 2XLKA 2A2DA 1RT4B 5D3GB 2KN4A 3EPIA 3M2VA 4LR8A 2KYZA 4ZVHA 4NI2B 1R8AA 1KN6A 1NSKL 1P8GA 2EFQA 5DDPC 4DL3A 1UWAA 3ZO7A 3DDKA 3L95X 4OV6A 3IRWP 1N32F 1RU2A 3TZXA 4N41A 4LFAJ 4WKYA 4IKAA 4PQAA 1VQ7S 5D78A 4W90B 1RACB 1Q0NA 2ZBRA 3CJSA 2LQ9A 3WIVA 2DR7A 1P27B 3AD9C 3M30B 3V2UC 2JEFA 2UXDF 4NLOA 1M1GA 1WI8A 1MWZA 1RXOB 4KRWA 3K0JA 3Q2SC 4RKUC 4HTJA 4L6V3 4DR3F 3POTB 4K5SA 2OFGX 2W01A 4USKA 5L38A 2ZHAA 3BV8A 2W2OP 4P7TA 1KQGB 2AEMA 3C19A 3BH7B 1KQSR 2W24A 1R27B 2YX4A 3Q8SB 4I2QA 1IR2A 2GHPA 2DHGA 4ZLNA 4HT5A 1U1OA 4ED8A 3BJYA 3KK1B 5E7OB 4PPDA 3TVKA 1SVDA 1IR0A 3DM2B 2BANB 3KJVB 2Q79A 2BKOA 3CSKA 1YQHA 3MPYA 1MU2A 3RTVA 2E9TA 3MM7B 5GAEI 4ES1A 3AAWB 4D3GA 2OPPA 3GYXB 4N56A 1N33J 1ZZFA 2EC2A 2FYXA 4MKBA 3S7RA 3TI0A 8ATCB 3A3PB 5JVGQ 5IC4B 1ZPWX 3NXZA 2QG9B 2RF2B 4QCLA 1C4AA 2OP5A 3O8WA 3K5MA 2B9EA 5IT9Y 3ILLA 4B9NA 3Q0AA 2EBEA 5CYMA 1EP4B 1N8RT 1JX4A 2VG5A 4C8YA 1DHMA 4USUA 1FO1A 2BE2B 2IJFA 4KR0B 4LT6A 4LBHA 3PW7A 2AQ4A 2XMKA 2HZAA 1B3TA 4RNFA 1TL3A 2XS2A 2M0GB 3FBEA 1YJNS 4N8OA 2AHOB 5ETRA 3GIKA 2F1FA 3HFKA 2ZUAA 5M2PA 1TUWA 4LRAA 2VIHA 1NK8A 5F0UA 5DGBA 1DLOB 1IQTA 2BKNA 2A2CA 3QMQA 4FYXB 1TMJA 2QA4G 1N34F 4IR1A 4IRCA 3LP0B 3W62A 4HHHA 4I69A 3JB9k 5DM7Q 4RJVA 4I7FA 3Q2TC 2EVZA 2HFVA 3GR1A 4DQIA 1HWIA 3DHXA 3CJ5A 5DS7A 4DV5F 3C3LA 4KH1B 1X5PA 7FD1A 3GG1A 2MKJA 2ZC3A 4RUCA 2QEXS 2IJNA 2OD6A 1RT7A 3HK2A 2BQRA 1YI2S 3MM7A 4K2XA 1VJQA 1WTBA 5KG2A 4Q2LA 2DIVA 3CCWA 1PO6A 1TAQA 4P74A 1DTQB 1OMSA 3FBBA 1FFWB 2FY8A 2NR0A 1V3ZA 3QJLA 3ZTSA 3MD1A 3V4IB 2XLIA 5H9EJ 2P8IA 2N7YA 4GMKA 2NREA 1J5OA 3SDEB 2YVSA 2YY3A 4J9VA 4UTGA 3ZZPA 4ZJQA 1S7IA 1NKCA 3GIJA 4J37A 2IC3A 5FLXY 4TNOA 1EAYC 4OHZA 3UN5A 4Z2XA 5EHHA 1RTJA 1U25A 3A1YG 4ZVSB 3H4BA 3PW5A 4PUOA 1VQKS 1YG0A 1PC4A 4I4BA 1S12A 2GS8A 2BBEA 3AJDA 1FTCA 3N79A 3OXGA 3SSRA 2W8KA 2AEJA 3PKMA 1S9EA 3PXGa 4C7QA 5E3AA 5HAOA 4BS2A 4C8MA 3FK4A 2F4VJ 3L7PA 1C1CB 2E9RX 5K14B 1JXLA 2B4UA 1S1UB 3FMWA 2YNFA 1U26A 3DRRB 2AYBA 1OYEA 4W4MA 3OL9A 2N3OA 2VQEJ 1NB2A 3GFHA 2G0CA 1KBRA 2AX0A 3CJ2A 3Q23A 1FRIA 1JLGB 1HW8A 2LMIA 3PEJA 1S1XB 3ONQA 4QR2A 2PD1A 3IP0A 2ZJRQ 5LSOA 4NLDA 3MURP 4IH5A 3VALA 3H5YA 4F2SA 4RW9B 2CWKA 1F5AA 4UZCA 1N36F 4CNYA 1FVSA 4DCOB 1U47A 2WB4A 2CPJA 1S4FA 1HMVB 2CPFA 1CJTB 1YRUA 2GGPA 3C16B 3C66A 3HSZA 4I6WA 1TL5A 4PWWA 2XCPA 2QLBB 2J0SD 2FHJA 1DJ0A 4JOUA 4FYVB 4DL7A 2YQ1A 5IT0A 5A8RB 1KFSA 4U7CA 5A0YB 5AXMA 5LMNJ 3BS9A 4CO3A 2O3DA 2B6AA 2PEHA 4ZIVA 2VA2A 4DV4J 1BQMA 1M5KC 1Q5YA 1L3TA 4CLZA 2HG4A 3K7RA 4FXVA 2OAUA 4OX9J 1BQNB 4C6AA 1RHMB 2CPHA 1MW7A 3MM5A 4RW8B 3MEKA 3H40A 4NLQA 1JLEB 2KVIA 3A8KA 4UOHA 4GKJF 1U24A 3I0SB 2HNZB 5LXRA 2BR0A 4M5DA 4B3MF 2B7CB 4YUDA 4KIAA 2GHVC 4OLOA 4OYMA 1HNIA 2HYIB 1BWEA 2Y0SD 4YP3A 1VR6A 2ZKTA 3MCOA 3D2WA 2L48A 2C2DA 1P9QC 5AE3A 3HHLD 2NCKL 2MHEA 5KG5A 3CC4S 3SIPB 1CC8A 3VVTA 3QRQA 1FX2A 5I3QA 3TARA 4P71A 4F4ZA 4Q7AA 2RQMA 3B82A 4EEYA 3M6VA 1WTFA 2E5JA 4PQUB 2BJ8A 1FNOA 3PO4A 1PJ6A 2DYAA 5KFBA 3FEZA 1TK5A 4NZ6A 1P1TA 5B0DA 4GVBA 1HD1A 3M8RA 1OYDA 4PG7A 5KG4A 4DL4A 1SQEA 2HNYA 3MCNA 4OZJA 5KFAA 3W2VA 4N47A 1UFLA 3G4SS 4DF8A 2E5LF 3M2UA 4QIWD 2HBYB 1S97A 2OTJS 2VASA 2BACA 3MPWA 2J0QD 1Y3KA 4M5NA 1P9YA 1S6QA 2DRBA 1S76D 4NYOA 4TU9A 2GMLA 3IR6B 4KKOA 3HMJG 2R3VA 2HWIA 2YNIA 3SCIE 1IJFB 5L1IA 2XSFA 2KU7A 3EVMA 4JI6J 1WI6A 2LKZA 3M8YA 4ZCLA 4DUTA 4DV0J 4B9VA 1RUSA 2XWYA 3C15B 3MM8A 2R7XA 4PQUA 3KHGA 1ZAVA 1NPKA 3ZNUA 4F25A 2XS5A 2HZVA 4U8VA 2MQMA 3LWLA 4K4TA 2XMVA 2IBKA 4ZPCA 2OFHX 1RWKB 2HBRB 1P1LA 1DQAA 1T02A 1VHFA 1EKSA 2DGSA 3DRXA 4RW4B 3DOKA 3UQSA 3D6HB 4RL1A 2YX1A 2MSSA 3ENWA 4DF4A 2GVZB 1UA0A 3TYTA 3N4WA 3SQOP 3RAMA 2RQ4A 5K8MA 4ZLPA 1WOOA 2V9KA 4DLEA 4PWDA 1M5HA 1XR6A 4X65J 4QW8A 1SJRA 2FJAB 2AGQA 1RDRA 4IG3B 2DK2A 3G2XA 1LWCA 3JTPA 3R5GA 4OJHA 5DQGA 2ZH2A 4DS5A 1JJCB 3W2WB 2UXCF 2FGCA 1CS4A 3P96A 2HGMA 2QGFB 5M2RA 1NSPA 4J9UE 2FHJD 3TEHB 2KG1A 3R5DA 2V4QA 1K0TA 2DY1A 3MCSA 1G2EA 2R7VA 5J2NA 4CLPA 2VZ9A 4DHVA 2F7VA 1ZBTA 5DJBA 1FI4A 3FNNA 1FXDA 3H2VE 4IR9A 1RI7A 2V8DA 3G71S 2QIFA 4KT0C 5B0GA 5A2QY 2PA8D 4USTA 1CJTA 3C16A 5LJ5Y 2LECA 1UW9A 4HH0A 1JJ4A 2KXHA 2KXFA 3D1OA 3I96A 5L9NA 3SCLE 2WBRA 3CDBA 4P73A 3T41A 1FJCA 2JEGA 3FDSA 2V50A 4QIEA 4RW9A 3P3DA 2YBVA 4X4SA 4USMA 2CPXA 2DNMA 1YVFA 1DQ8A 2ROPA 1FXLA 1VIXA 3D0IE 4TXSA 1TL7A 2KHCA 4BWMA 1VQOS 4X64F 3DOLB 4DPTA 5IT9U 5BJRA 2OPQB 2AKWB 2R2RA 3J7A1 3LWMA 1RGVA 2BQ3A 3GJQB 4CH1A 1D3WA 3FCHA 2VJVA 1N5VA 2H48B 2W2MP 2Z2MA 4TN2A 5JUMA 3QJJA 1Q78A 3QPIA 5L8RC 2UUBJ 3H20A 5JMNA 5F8LA 1JLCB 1QM9A 1WWHA 2MPUA 5DDRC 1S6UA 4J9RA 4F4KA 1VYAA 1WKJA 2ZBPA 3HX9A 1RT5A 4XK8C 1LXNA 1RTJB 4PUOB 4CYUA 4DR2J 2VBXA 4URQU 1J5EJ 2DXFA 3DRSB 3PRBA 4O23A 4O3QA 2CPEA 4H4OB 2AF6A 4GO7X 1S49A 2CG8A 1QD1A 1ZS6A 2DNRA 3EGNA 2EFVA 4ELVA 2IPOB 2QMUB 3OD2A 4ATNA 3VAIA 1PC5A 5C42A 2E1PA 3E3XA 1DBDA 2ZH8A 2W9AA 1BC6A 3CJRA 4MJKA 2F9DA 1GX5A 2ROGA 1WC6A 4I0WA 1N5TA 4X84A 2HHTA 4HR2A 1KVKA 3GWCA 4YB7A 4DZDA 2FPHX 1VC0A 4LF8J 1S6PA 2JLEA 2QYGA 3JSBA 5B0AA 4OYXA 3W9JA 4CP5A 1KLMB 1FEHA 2ALYB 5F9LA 3LAMA 5F8HA 3DLKB 4JB8B 3N6MA 1U2RA 3FRZA 3KHRA 4G1QB 2K7KA 4TLQA 4F3QA 1SH3A 2Z8QA 4X66J 5LT5A 4K4WA 3OW2R 1NK0A 5KG1A 3JYTB 4HKQA 2I38A 2RKIA 2K06A 3M4XA 2RS8A 2IM0A 3AXMA 3CDEA 3V6KA 1NH7A 2IRXA 5K9FA 4BHQA 4OYZA 1YIJS 3AXKA 1T3OA 1TU0B 5B0EA 4HHJA 4QWCA 4JI2F 5B08A 2YQ3A 2ZH7A 3RGIA 2QRRA 1PG5B 1UMJA 1MSWD 1AW0A 4O3SA 2RRNA 3QFWA 3IRXB 1NMEB 3W63A 3PX4A 2CZ4A 3R9LA 2LU1A 4RWWA 4FNHA 4U9RA 2XHWA 3CDAA 4F4AA 5SZTA 1S6OA 5BR8F 1R7IA 3IXQA 3R1LA 3MR6A 3KMSA 1HNVB 1RSCA 1R8BA 2X1AA 3GSIA 3SZ2A 1SC1B 1N32J 2PFDA 5MLCV 1K1QA 2BOAA 5C25A 5KFJA 5LXYA 3DLLQ 2QLFB 1CQMA 1EETA 1CJUB 3MEEA 5C24A 2D3ZA 2ZBQA 4LIRA 5KT6A 1HWLA 3Q89A 1HBUB 2G2ZA 3T19A 5DDQC 1TK8A 2DR5A 1B7FA 3EYZA 3MEDA 1N6QA 2FY1A 1RT1B 3UN3A 5DQHA 1W26A 5CXTA 2V4JA 3GV8B 2HLTA 1G4CA 3WHIA 1N0VC 1R6YA 1KD1T 2IVYA 3QIPA 4WU2A 2HHSA 3MHYA 5FDLA 2UU9J 1VJWA 2QFIA 2CNLB 4PPZA 4WE1B 3A3OB 3BQ0A 3MM9B 4YEAA 1RTDA 2L9DA 3ETMA 3EICA 4KPCA 5L1LA 2H5IB 3OR1A 3H2UB 1U09A 3AA9A 3BYRA 1RWNB 5LMUF 3GZ7A 3E01A 3KLHB 3X1LB 3PACA 3BQ1A 3DXBA 4YB6A 1NLKL 2O5DA 2HBQB 4ZLJA 2L3MA 2W9BB 4DR1F 3KMQA 4FN5A 3HFVA 1WKKA 1OY8A 1NK5A 3I9V9 1WUUA 2F3JA 5T41A 4V19J 3V6JA 4ZP9A 1IKWB 3G96A 3RR8A 3CIZA 5I4MA 4ZPWR 1G1XA 3KXDA 1AFIA 2KVQE 4TY9A 1FF2A 1CEZA 1NCLA 1ELOA 4OX8A 2ASLA 2BJ9A 3TZWA 2CQPA 3LGMA 4FBTA 4DFMA 3QIPB 2HFNA 3KWMA 1F9FA 4WFZA 3ZZYA 5F41A 5KFMA 5I3UB 3PIPQ 2P9EA 1RT1A 4CH7A 1S9FA 2R42A 4X4OA 3VWSA 5HP1A 3M8WA 2BABA 2FVCA 1T0TV 1U8SA 1WDDA 3PDNA 1M5OC 1JIHA 2HNDA 3DCAA 3HVRA 3VGTA 4DWIA 2OEMA 3HD2A 4M5IA 4LF5J 2ZKUA 3TZYA 1N34J 2APOA 3BBBA 4DXLA 2MY7A 3HVAA 5KFFA 5G0RB 1X9MA 1RHUB 2EFGA 3E2EA 1RU1A 1B0PA 2FHOB 3NNHA 2ZVIA 2B43A 1O0PA 3CULA 4O4GB 2MJUA 1C1BA 2DD8S 4ILRA 3IA0A 4MT1A 3CC2S 2CWXA 3M2RB 1K8AT 5J2MB 2M8DB 2BM1A 2U2FA 2ZOFA 3IRXA 4Z37A 2IM1A 3FFIA 5D6GA 1TELA 2UZAA 1SL1A 4K4YA 1IKXB 1R8PA 2XZDB 3H7HB 4Y00A 2XLJA 5IWAJ 2VF3A 1X4EA 3BEGB 4XTTA 4FYDA 3ZZZA 1R0BG 4NMXA 4ECWA 4R5PA 1QTMA 4MKAA 3D68A 4L72B 2FJWA 1U2FA 3QBCA 3HT0A 2MHNA 2MKKA 2ZH4A 2CG4A 4DV5J 3T1HJ 1HFEL 1DTTA 1QAXA 1K47A 5HBMB 3B54A 2N4DA 2AWZA 2MZSA 3QZ7A 1AB8A 1EHWA 1WORA 2AIRB 4G65A 2WW8A 1IBCB 1X8DA 4B08A 2W2NP 2YWEA 5T7LA 1NNDA 3D0GE 2IA0A 2ZITA 1RLCL 2FIUA 2OPSB 4NXMJ 4MKVA 4IG0B 1REVA 4FZVA 3S01A 4AYBD 5A2QU 3PYGA 2HHPA 2WVDA 2XG8A 1U6FA 3UCGA 1TKTB 2DNPA 2V8VA 1Z2LA 4J90A 4C0BA 3OL7A 1X0PA 2BJ1A 1M0SA 2EFOA 2AEFA 1GXUA 1WJ9A 4ZVPB 3DI6A 2AJ2A 2F9JA 3MM6A 4L75A 4ZVGA 2I6WA 1OY9A 3QGIA 3ENQA 3ZTQA 1C0TB 3HHKA 2C2NA 1SJ4P 1A6LA 3OTOF 2R7QA 2YTCA 5E3RA 4C11B 1SJ1A 1FRLA 3CTRA 4AL6A 2C2RA 2KB2A 2B9XA 1OPIA 4P72A 2OEJA 1XR5A 3SXLA 3JAMU 3H5UA 2GQ2A 1YWXA 3DU6A 3HVTB 4XPEA 2Y8WA 1L3UA 1I94F 1NHKL 2VU5A 4WFNQ 4F4YA 1LXJA 1Q16B 8RUCA 2ILZA 4WFAQ 1NHUA 2FGOA 4ED7A 3MFIA 1OSDA 1VQ4S 1AROP 2HQCA 2Q3PA 1FJEB 1K1SA 1OY6A 4ELUA 4K0KJ 1GNKA 3I9ZA 1RKJA 5J1EA 1VK8A 1LQ9A 2J9DE 4NA2A 1YJVA 5ETKA 2IDLA 1FJGJ 3ET6A 1QLNA 3BH6B 1CSJA 3O1LA 4B9LA 1X4GA 1FERA 1UETA 3X3UA 3JTOA 4IFVA 3CVKA 1HARA 4KFBA 4PR6A 4CTAB 3OFEA 4ED2A 4ZA1A 2PDAA 3SCKE 3JQKA 2W4CA 3CCRS 1IWGA 1RT3A 4K4XA 1HD0A 1VS3A 1MROA 1BQXA 4M5GA 4CLFA 5LMNF 3B78A 3H8YA 1NKEA 1UWBA 2B5JA 3TP2A 4RZRA 3LA0A 3BGUA 4OYBA 5HVGA 5L46A 2XS7A 4KQZA 4J7CA 3HZEA 4E98A 3JSMB 1X9SA 2E1AA 5J2NB 1DURA 3CIMA 1K73T 2QJ3A 4GKJJ 3TA0A 3G8QA 3M9MB 5HQ8A 4I64A 2FC9A 1XNQF 2N3LA 3W2WA 2D9PA 3KUGA 4U67Q 3ILJA 1S4EA 5DG9A 3B8HA 1DY3A 4IG3A 3HVTA 1L5UA 3W7BA 2WW4A 4M63A 3ITHA 1J27A 3OHBA 2R8KA 2V0NA 2Z2ZA 1N52B 3LH2S 2EKYA 1YJTA 2JC0A 4KSEB 4LJMA 3GJSB 4ZLLA 3LP2B 2BZ2A 2V94A 2F4VF 2VG6A 3RZAA 3LP1A 2ASJA 4KTQA 4QU7A 1M1KT 1RWUA 2EI5A 3JSYA 4WXWA 2YKNB 5JJBA 1GAOA 1FK9A 2QZ8A 1OO0B 5FD1A 1YZ7A 4EO8A 1TZ0A 3M7VA 1WG5A 4O3NA 1N33F 5AXNA 1AA1B 2ABYA 3EVOA 2RILA 1Y5IB 2FJEB 2W2QP 5JXSA 2RQCA 2M7SA 1B0VA 1W2IA 3G86A 4IG0A 3GIMA 1DARA 5HK4A 4ECRA 2CQ2A 1SUQA 2LU2A 1YSJA 2BM0A 3NEKA 2XO7A 2ERRA 3MR5A 1KS2A 4YHHF 1FE4A 3KYLA 5L1KA 2L08A 2X1GA 4TQRA 1SI9A 3M2UB 1R43A 1GMUA 2DH8A 3ILIA 3W66A 4E2FB 2ZH5A 2GA7A 1UVJA 5D0HA 1CULB 2ZD1A 3LOUA 1LWFA 4LFCF 3DGPB 1S0VA 1AFJA 1KOOA 1SB6A 3WQPA 1VGYA 3TA2A 4WFXA 4OI1A 2QA2A 2KM8C 1K44A 2FZGB 3AOCA 3GV7B 2DNZA 3TVZA 1HIYA 4CZCA 3DMJB 1YJ7A 1BWVA 3N9UC 4HI2A 4ZPVR 4OX9F 2NZCA 5IS2A 3RYLA 4RNNA 2AYGA 4LF7J 2VQFF 1RBOB 3TUIC 3M8PA 2DXDA 2M88A 4QJVA 3B4DA 2ZE2A 3L7UA 2CVIA 5CD4H 1C1BB 3ISND 3BPSP 1SUQB 1HHTP 1EKRA 4YMEA 4JV5F 2GQCA 2DNYA 1VCTA 2CFXA 4OHVA 3SFGA 3P8BB 4YY3F 2RUGA 4YFUA 2RQKA 3OHAA 3G82A 4IOBA 4NLWA 3W9IA 2VDHA 5J1PA 3UDEA 3D6FB 2RIJA 5HATA 5F8GA 1FK9B 2LXUA 3I6PA 3TVYA 4Q8FA 5D77A 2FJBB 5C2GA 2P5VA 1FE0A 3R3TA 5D4OA 3ZTPA 2P6TA 4Z7YA 2HRUA 4P2SA 3W5ZA 4UQGA 2W9CA 4F4XA 4A8YA 2X3GA 4EBDA 1SJ3P 2ZWOA 1QSYA 1T94A 1U49A 4J9LA 1LW2B 3BGOP 4ZP8A 4YQWA 1H0HB 1RHQB 5HI7A 3BYPA 1TK0A 1SQGA 1HQEA 1S79A 2V8GA 4MYTA 3NY0A 1O5JA 2AT1B 3SQGA 3RJMB 1IBMJ 2G2YA 4LSNA 4B3SJ 2DNHA 2ACYA 2YNGB 1QE1A 1NH8A 1Q7LB 1VOMA 4LFAF 4EUVA 4NXMF 2HAIA 2OMOA 2RJZA 3CCUS 3ADAC 4ECSA 1HR0F 2QLWA 4HACB 5KAKA 1YJWS 1TQLA 2DR9A 3D3BJ 3J80Y 4OZ2A 1PYSB 2MLYA 1VQ8S 1ROFA 1GX6A 2NUHA 4WYWA 4IQMA 3HZGA 2W9BA 2D69A 3GFYA 1UA1A 1S1UA 2E66A 2RSQA 2CDQA 2D74B 4PXDA 2VBWA 5HN0A 1FD2A 3V5RA 5HROA 2G0IA 3HO1A 4DEZA 2VPYB 1R6VA 4G6VB 1NO8A 3TEGA 3QGPA 1E6VB 1FTRA 3RBDA 5RUBA 2A0FB 2RHSB 4IFVB 4WE1A 2M52A 4BLGA 2YH1A 2VKZG 3CCJS 1AUDA 2YH0A 2MKYA 3THPA 5IXUA 3K5PA 2LQ5A 4OX7A 1Y3JA 1BD6A 2IC3B 1I1GA 1M5PC 4YOEA 1I94J 1XMOF 1SKRA 2RDIA 2HQFA 1APSA 1KTVA 3BREA 1J5OB 5CQGA 7AT1B 5D4NA 5IC6B 1D9FA 2UP1A 1H38A 3M1VA 4DPWA 2RDJA 2VPWB 5F0WA 1PAUB 5IOLA 3TJ9A 3W8PA 4LMZA 3MEGA 3H0PA 2Y1JA 1UAWA 2RH3A 2DVIA 2KT2A 1RT7B 1T11A 5GAEU 1MLAA 1N54B 3NBPA 4JYAF 3UVJA 5K5MA 2DNQA 2P9CA 4Y2AA 3M6UA 2QTWA 1TL1B 2HK3A 5KFRA 4EYIB 3MM6B 4O3RA 1PAEX 4J9KA 1SCJB 4IO1A 5KFLA 2V63A 3N0VA 3PJWA 4QWEA 2K3IA 2ZM6J 2XULA 2WHOA 4NLVA 5HMWA 5ETLA 3K59A 4DV3F 4JI2J 1ZA2B 2YQ0A 3C6UA 3FEXB 4C3MA 1XQIA 3CDUA 3L7OA 3QYYA 3TJ8A 1D1UA 1TL3B 5DM6Q 5HJYA 4NLXA 2RKIB 4O0NA 2W7AA 1VC6A 4FS1A 3OR2B 1IBKJ 3MGJA 2BOPA 2RB7A 2XSJA 1EP4A 3EZOA 3RG6A 3KHLA 3V6DB 1T03A 2ZVSA 3PZPA 1D8YA 2EBGA 2F8HA 4DSJA 1GXLA 5LJ3Y 4KGXB 4WP8A 1F2GA 3VQTA 4CLUA 4B02A 1JJHA 4B3OA 3ZZ0A 4FBUA 2FC8A 2XI3A 3MUVP 1D0EA 4P52A 1YDLA 3JSRA 2XGPA 1G7CB 2PC6A 1VK3A 4DV7F 2V34A 4MK7A 3EMTA 1FD8A 2J9EA 2K3KA 5B0BA 1XC9A 1URRA 1YZ6A 2GJ2A 1NK6A 1LK7A 1SKUB 3W1YC 3AODA 4NE9C 1X5SA 4OZ0A 3O3LA 3VVUA 1KLNA 3BBCA 4TKTA 5EWFA 3FFIB 1WACA 4FDFA 1JKHA 2IMWP 3M2RA 3PFOA 1FRMA 3GE9A 4I2QB 4WZMA 4ED3A 3CC7S 2ZC4A 5F9NA 4P10A 4E0DA 3KG1A 3PTWA 5GAGU 1T3NA 4NLGA 2DHHA 4BWJA 2J8SA 5KFKA 4MIWA 1QUPA 2V68A 3IFEA 1UZHA 2FLNA 2QA4S 3CO0P 3OUYA 2EFNA 2AZ3A 5I42B 2UV8A 4TY8B 4EGLA 1TVRB 2VQEF 2KG0A 1WC0A 1KQKA 4OL8A 1U0HA 3DRPA 5HANA 1Q7YT 5HQMA 4LREA 1RYSA 2XZTB 5E41A 4DG1A 3GQCA 1VLYA 2UUCJ 1HNXJ 4J91A 2A6OA 1MN7A 4JP8A 2DNLA 2MKIA 1X4AA 1YJUA 4WPAA 2ZZMA 2CJYB 2VH7A 1X4FA 3KDOA 3M2VB 4NCGB 1RT4A 5H1SV 5D3GA 2Z4PA 1LW0A 2GV1A 3ULHA 1JLAA 2DGXA 2J0WA 3LO3A 3I55S 5E0OA 1L3VA 1IXKA 4OQJA 1NPRA 2OPRB 3L09A 2F8MA 4OZNA 4ZITA 1EQ0A 1UL3A 3GG0A 2Z0GA 4HL9A 1XNRF 4HLBA 2IIHA 3OT9A 5KT5A 4CLSA 3Q8RB 1IBMF 1TKXA 2CADA 2J9CA 3D3CJ 2DNKA 4GVLA 4F4WA 1HNZJ 4PYAA 3M05A 2MLXA 3DLGA 1UEVA 2MZ1A 3K57A 2UVWA 4HACA 3TAQA 1TFYA 4NCAA 4DU8A 2YKAA 1QE1B 5KTQA 2YNGA 4CT9A 3M8ZA 2Z56B 3C14B 3SQGB 3SI8A 1K9MT 1T7PA 5IM0B 4TYBA 4NL5A 1HQEB 4L76A 2D9OA 1T95A 2OMLA 3N5BA 5K8PA 3AH6A 5FDLB 4XIUA 1RAJA 2GC8A 2J6UA 5K8OA 1WHWA 3GJTB 5DETA 4B3SF 3MPVA 3VZHA 3V6HA 4WIQA 1PYTA 3MDFA 4UUWA 2HHVA 3WX8A 5B0CA 1Q81T 2C2MB 3HHNB 4A8XA 1YHQS 1RHRB 2GIRA 4DV2J 3U1NA 4DV6F 1HBOA 2BX6A 2OD4A 2BYCA 3OLBA 2AYMA 3BR9A 3BKFA 3FUYA 4MIAA 2HHHF 1X4BA 1ACMB 3KDNA 1RA7A 2KFYA 1S10A 4Q45A 1OIAA 1RBAA 4RBTA 1F0XA 3GLJA 3PCOB 5KG7A 1H2VZ 2CJQA 2LA4A 3A13A 3MOZA 2NXUA 2EEYA 1Y11A 5EWGA 2O67A 2NQPA 3BO4A 2ZE2B 5KFCA 4LF4J 5HSPA 1MNEA 2QO3A 3FRYA 4FVMA 4MKYA 2CJBA 2XCAA 1X0FA 1Q82T 4ZVEA 4P2MA 2HHUA 4LRDA 1NDLA 3V81A 2HSEB 3UDCA 1JQGA 1SJFA 3ZTRA 4PRFA 3QT5A 4HEA9 3OXLA 4KHRA 4PG8A 3QT6A 2BW7A 2B4OA 2NXJA 3CNQP 2PMZD 2QSWA 4EBEA 5SUHA 1LFWA 4AQYJ 3I5AA 4ZPAA 4I1TA 3BO2A 1X4HA 2IM2A 4NEZA 1RCXB 1AT1B 2ZH1A 2BEFA 1QDUB 3AD7C 3PFEA 3HP6A 1N88A 4HHUA 2IAJA 4F8RA 5A6PA 3J7YU 1N48A 1X5OA 2GZOA 3MR7A 4N8NA 4UQTA 1RWPB 4FYWB 5AE1A 3I5CA 5C42B 5KFWA 2ZH3A 2V9WA 4X4VA 2FJDB 3VGVA 4B3TJ 2DKOB 1YJ9S 3GPAA 4AXIA 2G0JA 2W7PA 1PSDA 1S9GB 2YNHB 4Y34A 4EFAC 4IFYA 2GNKA 2LQBA 2C1EB 1J2VA 4H4OA 4Q44A 2JWNA 3BN4A 4I2PA 1NK4A 3DRSA 5AT1B 3TR5A 3IR7B 3EZUA 2U1AA 1FT8A 2MMYA 2X51A 4KO0B 4KC5A 2HHXA 2I9SA 4MK8A 5GAGI 3T5KA 1HMVA 2GGPB 1SV5A 2K7JA 4RWXA 1VBKA 5J2PB 3THTA 3VCDA 2VODA 1HPZB 1RABB 3G8SA 1Q8IA 4KGMA 2CQ3A 3PW4A 1FEEA 4ECXA 2CNNB 2J0XA 2QL9B 3DOMA 1KVJA 2OPQA 4K4VA 2NLWA 3DOLA 5THWA 5LSLA 1GH8A 4ICLB 1C0UA 1WF2A 1UKUA 3K17A 1WHVA 4NEYA 2H5JB 1H73A 1I5OB 3PKYA 1UEKA 2MQQA 3DLEB 1Y10A 2HPUA 4RPFA 2CA9A 5ETPA 1VQYA 2HVDA 3KNAA 2O66A 5KFGA 2W8LA 2BXJA 2Q6BA 3DHWC 2NPFA 3K2YA 3SSSA 3EGVA 3N5FA 2JDJA 2MZJA 2KHDA 1TUVA 2K1RB 4KAIA 4PXBA 3PY8A 2AYEA 4A8OA 3CJTA 4K2JA 3AHPA 2ZJPQ 4LF2A 2B51A 2HFUA 3IMQJ 3N6LA 4EMDA 3CMES 2B0GA 4EO6A 1H74A 3D4JA 3MECA 2UUAF 2RMLA 4M5LA 3RR7A 1KEKA 3QSYB 3F44A 3OSPA 3HF5A 3HSJA 1CS4B 1S0MA 1WNEA 2QSFA 3S6EA 3OBIA 2ZBCA 4QWBA 4K0KF 3AJ2A 1SQFA 1JXVA 5GVQA 3PX6A 4LF8F 2UXDJ 4PWDB 3UCUP 3F56A 3OQ2A 3IN5A 1EZZB 1CJVB 2OEKA 2N82B 2XMMA 4C8OA 1FNMA 2XEXA 2Y8YA 2V4RA 4LIWA 4C8NA 2GAGC 4K4UA 4JI1F 4K8RA 1U1MA 2XGQA 3EPGA 1LOUA 4IH7A 1PKUA 2CZ9A 4RW4A 4DSEA 4LF6F 4IDKB 5CD4A 1HL6A 1RTIB 1UTAA 3CJ3A 4OFZA 4W92B 4ILLA 1JLQB 3HM9A 2LXIA 3ENVA 3GFXA 2ZUGA 2V8PA 4JV1A 4MFBA 4NLSA 4OJ3A 2E29A 3ZNJ1 2KYXA 3U7JA 1FFGB 1AUSL 4A46A 2HVEA 1N5SA 1TKTA 3S1TA 5L1JA 3UD3P 3PW0A 1HNZF 2EC0A 1A9NB 1I6JA 4FF4A 2GIFA 2HS0A 4FPRA 3FJ2A 4KKOB 1U4BA 3A3NB 1UJ5A 3ETOA 1LNQA 2MQ8A 3OTEA 3MUMP 2XYPB 2Y1LB 2NS1B 3HKWA 3WC0A 3EGZA 2DNNA 3O5TB 3PJXA 5HBMA 4UZBA 4JI3J 1SJQA 3ISZA 4J9PA 3NKYA 4G1PA 2VFTA 3MZIA 4UOFA 5DQIA 4XDDA 1T05B 5ETNA 4R5PB 3NMAA 4B9UA 4U96A 4IO9Q 4RO0A 1V9OA 4U8YA 1FX4A 2J7KA 3MF5A 5KG0A 4DLGA 4QU6A 2ZOGA 3GYGA 2O1PA 3DM2A 4LSZB 4KGZB 3WIUA 4QPTA 3ZTOA 3KOAA 3FMBA 3KK1A 3RUBL 1NEEA 4FPIA 2HVZA 2J9DA 2KL8A 4USIA 4DV1F 1BMQB 4CLTA 1OQ6A 1UEUA 1QAYA 4HDHA 2HEKA 1B0TA 3D6TB 4H4KA 3DNCA 2R7RA 2CNOB 4WTYA 5LMUJ 1EJ7L 1SC4B 1UCNA 4M5DB 1YRTA 4ZMMA 3J7YI 3KK2B 1X9WA 2H65B 5IM0A 5KT3A 1ZH5A 3BGRB 1GMWD 4FVCA 1T9UA 2OHDA 3MM5B 4OLPA 5LM7E 4DR1J 2C3YA 2CQDA 2HIYA 4KH0B 2WOMA 2RU9A 2WSEC 2WAQD 3DLGB 2SXLA 4AFFA 1NDPA 1EIYB 4OYIA 4IUFA 2F65A 4K4SA 2KFZA 1VIOA 2VOOA 2M8HA 2MZRA 2UV8G 3CD5A 3P45B 4ZK7M 5KT4A 3HXMA 5I3UA 2P6SA 3M8QB 1VRQC 2E1RA 4O3PA 1HWKA 1PIEA 4V19X 2DB1A 4NI2A 5CZXA 5E3CA 2DH7A 3HHEA 1RAAB 2BJEA 2VKRA 3NGSA 1JLAB 4CLYA 3CCES 4AQYF 4C8LA 1V3RA 3TRGA 1YBAA 4P6QA 1RWOB 3D6MB 2XI2A 4DFKA 3BKTA 1SL0A 2XMTA 2JL9A 2JVOA 1S1XA 3NGKA 2UVRA 4X4RA 3M8QA 1FDAA 1TMMA 4L3KA 4ZN3A 3MMCA 3PX0A 4UOGA 1VQ6S 3MMAB 2VG7A 4PG6A 3RAXA 5HQLA 1RA6A 1RADB 3MCMA 4HH1A 4RUHA 1U0HB 1IN0A 2WOMB 4O4RA 1FRHA 4Y28C 3HLUA 2M2BA 1UVIA 4V1Ak 5T14A 3A8EA 4TY8A 2FB0A 3TX8A 4Y3CA 2BQUA 1NK7A 3OUYB 3KLIB 3K5NA 3LW5C 3BGRA 3IGVA 3HFZB 3VQSA 1VFJA 2GMHA 2L41A 2VL1A 3TQ1A 5CHCB 3R6LB 3KK2A 2F5GA 3BR8A 3CGIA 2AGOA 2A18A 2ACMA 2MXYA 3Q86A 5BXIA 3M32B 5CCMA 3KNGA 4DFPA 2HRTA 5HL7Q 1DFDA 2C2EA 3K89A 3MEDB 2ASYA 3FBCA 1N6QB 3PRVA 3I0RB 1FWLA 4RW7B 4PWUA 2E5HA 2NXCA 3BM7A 2MLZA 2I0XA 3MEEB 5C24B 5D0GA 4LF9J 2XB2D 3P5BP 1JB0C 3IG1A 1F9EB 3CCVS 4K50A 2OSRA 2Y0BB 3T1YF 1XMQJ 3KTQA 3QQCD 4EU0A 4DV4F 2ATLA 2FLPA 5D4LA 3AT1B 2M5YA 2XWXA 2UVVA 1XEZA 2B9WA 5CYQB 4DQPA 4B3OB 2XTJP 5KFQA 1D09B 3TWZA 2I5JA 3P6YC 4MYUA 4B3RF 2F63A 2CJXB 4CM2A 3J81U 1SH0A 3JTNA 4DR5F 3V6DA 4R8UA 5KT7A 1FKPB 2Z57B 3H59A 1I3OB 3LP0A 3DU5A 3CJKB 1HI8A 2G2OA 3MTKA 3OR2A 4C0HA 3CXCR 2HZCA 1KC8T 2GW8A 1DLOA 4ZP7A 3R8YA 3W9HA 2C28A 1HNWJ 1D9DA 1OS5A 4C98A 4F50A 4MFBB 1W2BR 4WTOB 1LWEA 3JYTA 2Q43A 1JLQA 1IWAA 1U6ZA 1B7YB 2JOQA 2WK4A 3GTYX 4ILMA 3RB3A 3F0NA 4R8UB 3PG9A 3GIIA 1NJXA 2GO9A 4R0JA 4NCBA 3BZQA 4N7TA 5DDOC 1BUXA 5KFZA 2I2YA 2E5LJ 3MMJA 4JI4F 1U45A 1R0CB 2AMCB 3ZFVA 3UVJB 3G6XA 1RAEB 5GADU 1CG2A 3MAQA 1JLBA 1Y5LB 2JLGA 1RWMB 2CQIA 2OH2A 4KV8A 4LR7A 1LK5A 3DXSX 2HLUA 2HQIA 2WZ1A 3MEGB 4OJGA 4NXNJ 2PE8A 5HLFA 3K8WA 3AOAA 2H3EB 3LTOA 3H5SA 2BANA 3KJVA 2XNRA 3MI7X 3A8JA 1HI0P 3MAHA 1VRUB 2LQ8A 4WIIA 1QJHA 3S8SA 4C9DA 1JXEA 2DITA 2IM3A 3D28A 4OI2A 5E33A 2Z58B 4OI4A 2VJUA 2K1RA 4F0HA 2DIUA 2WTFA 5DLFA 2XY6A 1VQMS 2DPJA 3TANA 4UW2A 1NBEB 1SIWB 1WSVA 3I4PA 4KJIA 3DLHA 3PR5B 1MN9A 3CDWA 4N76A 1RT2A 4ZPBA 3DLEA 2DHAA 2WVBA 4XO0A 1ZAXA 3RRHA 2D3OR 2GFFA 2IYGA 2UXCJ 5KG3A 3U02A 1CJKB 5H9FJ 2M70A 1OJ4A 5A76A 3Q22A 1NRKA 1RE1B 3DLBA 4ES3A 4B9MA 2VBZA 3QIDA 1HBMB 4JI5J 2MKSA 2HWTA 2MQLA 2KJVA 4Q2MA 3R5BA 2MGZA 2I1RA 1WG1A 1S0OA 1R8CA 4WWSA 2XMAA 2C3MA 1S0NA 3OVBA 1IQZA 1SV5B 4KE5A 4OJ1A 5ETOA 3RRGA 2JHEA 3GR0A 1WD6A 2V5HG 3EM1A 2XM3A 2BJ7A 1LW2A 3Q83A 5DO2A 4DSFA 1HQUB 2G9OA 1VLOA 1XTZA 2HIQA 2XHCA 3WX4A 4I2PB 4F7VA 4FF2A 1KNZA 2YPZA 3LUYA 4Z7CA 4A8QA 3R97A 5KFOA 4U7UK 5EDWA 3V4MA 1S9GA 2V69A 2YNHA 5F3TA 2P2CB 3W8GA 3VTIA 8AT1B 3C2PA 2CJKA 5AJ3F 2MQPA 3CCZA 1LWCB 2QC3A 4JI7F 1FJ7A 1WDTA 2BJDA 2EG2A 4FS2A 2DH9A 1F6TA 3G87A 2PEBA 4TYAA 3U1LA 4YB5A 3KKFA 3R2DJ 2HW3A 3QT7A 2E5GA 2R9LA 4ECYA 4CO5A 4BDPA 5E3QA 5KG6A 3EUNA 2ZZNA 3FQLA 2GVZA 3QSIA 4I6AA 1TV6A 2E7VA 1GMVA 2LEAA 2POKA 2YWKA 3QO9B 1FXRA 2KT5A 4KGVB 1HBNA 4NLYA 4J9QA 1XN9A 3D66A 4RU2A 4ES2A 3MAAB 1IVZA 4ED4A 1ZM2A 2CNKB 3VAFA 6FD1A 2WB1D 3AQOA 4LQ9A 4ANCA 3GV5B 4FF1A 2YKQA 4PAAA 5K20B 1N5YB 2D1CA 4X2BA 1HA1A 3CCQS 1RQ0A 4TU7A 1LWFB 4N77A 3BQ2A 2CVEA 2YNIB 3FGVA 3H2LA 4DL0C 3MMBA 3T1HF 4NPOA 2RU3A 2Q6CA 3MUTP 3UD5A 2E44A 4DQSA 3WZ0A 3ICLA 2KM8B 4QQBA 1KVIA 4DX7A 3HKZD 4DU7A 4K4ZA 3NGUA 1YLXA 2X1BA 1VHIA 5FIIA 2F8EX 4GVBB 4KGKA 4F67A 2W7OA 5HVHA 2MKHA 4DR6J 2VOPA 1QVGR 3K5OA 1N5YA 1X7VA 1V5IB 3UPFA 3CWJA 4K59A 3PVXA 2DTJA 1S57A 4URGA 3UE2A 1RTIA 4IDKA 1WC4A 2VG6B 3FCWA 2JRSA 3FC9A 3CD6S 2VICA 3TX0A 3QO9A 4A8FA 1HNIB 5GADI 2CYYA 4CI0B 1TKZA 1CJVA 4LF4F 3K5LA 2HNZA 4BCAA 5MAOA 3IBCB 3OSNA 4B3RJ 3LQVA 1JLEA 2C3PA 4NA1A 4RW8A 3QFHA 4C3LA 4ENOA 1H98A 4X66F 2V8HA 4JV0A 2YX7A 2YPYA 3R5AA 3VHQA 1JNZB 1NSAA 2FTRA 1FCAA 1FRXA 4AL7A 3KLEA 2DT9A 3Q8YA 3MECB 2NZ4A 3IWNC 3OPKA 1HQUA 4P9SA 1WEYA 3M6WA 4B17A 2EW9A 1UWBB 2B5JB 2FDNA 2UVUA 4RR5A 1WKLA 1MROB 1NB7A 5FJ4A 3QZ8A 4CO0A 4KHPJ 1RT3B 3CJ0A 4DMZA 1BGXT 1KP6A 1LW0B 2PIIA 3T9NA 3FSIA 5EX0A 4C97A 3I32A 4JI1J 2M4MA 2MGZB 2YWWA 4H4MA 4DS4A 2UU9F 2JFKA 2UUWA 4OHXA 2PN6A 1JLGA 4AUKA 2WRMA 1I51B 3BB5A 3M6XA 3OL8A 5D0RA 1F5CA 2J76E 4RW6A 2Q66A 3MTJA 4DPYA 4NASA 4NZ0A 4PEOA 3J80U 1VRTB 4ALZA 3K58A 2BW2A 2RS2A 4ICLA 4B3TF 3DRRA 1O8BA 3HCXA 4C8KA 2YKPA 3CF5Q 2VB6A 1ZETA 3EJMA 4Y2MA 3GONA 3G9CA 1VISA 1KWMA 1NPPA 1NXIA 1VMBA 3DOMB 5K14A 4B3MJ 4FNIA 5I42A 4CLKA 1KKHA 5ETVA 1A7GE 4MTPA 4RBVA 1RK8A 5IV4A 2ADCA 4B9SA 3HJFA 5GMKa 2DRAA 4JI5F 1SBRA 3C6TA 5ETQA 3RU0A 2J7UA 4Q43A 1IR1A 4QIFA 4JI8F 2N7CA 4BC9A 1QY7A 3D9BA 3JAMY 5J2PA 1KTQA 2AX1A 3HHDA 6AT1B 1FESA 3ZXWA 2VC1A 3GMGA 5E5NA 3UNGC 2CQBA 4J9NA 3KUEA 4GRSA 3RBEA 3R7BB 3NAIA 4JI6F 5KFVA 1YTYA 4KYZA 5E3PA 2PMHA 3BO3A 2CQGA 3NG8A 4F26A 2A6MA 3V4IA 2H1YA 2MZTA 2ZZTA 4F36A 4I68A 1DTQA 3RB0A 1B99A 2DO0A 3CEDA 2MKCA 4NOHA 5HJXA 2ZNYA 2QLJB 4HI1A 3OTDA 5J1NA 4DN9A 1U48A 1IBKF 4F2RA 1EB0A 2CQ0A 1NJYA 1LWXA 1LEOA 4I6YA 3G8TA 3GB0A 3TW0A 2MZQA 3TUZC 4O44A 2HHWA 2OPSA 3TOQA 4YS2A 2D3O1 5DRKA 5GAHU 4NLTA 3NWGA 5T7LB 3OTCA 1ZTWA 1AYEA 3CW2C 3UFCX 1RKIA 2Y1IA 3IR5B 3W61A 2C2OB 4Y6IA 4J5OA 3W5XA 3U27A 4Q8EA 1DTTB 3P4UB 1GT8A 2LVWA 4DJBA 1LWEB 2DNGA 4LRCA 1Z1ZA 3J7ZT 3AD8C 1D9AA 2QMWA 2VDIA 3D1HA 4I56A 1FNXH 4YN3B 3OLAA 5ETMA 4A47A 1X5TA 3JQMA 1RP5A 2CPIA 4DV1J 5J2QB 2GJIA 1KQFB 3ISNC 1ZZNA 5CYJA 1JJ2R 1F9HA 2C42A 1XK8A 1C4CA 1TL1A 2LFVA 4YDXA 2WONB 1IJEB 3EVWA 3HI9A 5D4PA 1VI7A 4DBQA 4X65F 4YR2A 2J6TA 3TUPA 4O4GA 5DGAA 2I5JB 1UJ4A 2CPYA 3H25A 1FFSB 2QMXA 2DCLA 5CYQA 3THVA 1W25A 3NBPB 4M95A 1HLWA 3CUNA 2R8IA 5G0RA 1MMNA 1Y0HA 4PG5A 2EWHA 4WZQA 2D7SA 4UOCA 2KJWA 1FVQA 1Q4RA 2OJ3A 5IFMA 2LYVA 2XMWA 5IV3A 4H4KC 2CPZA 4ANEA 1HBOB 1N56A 2OSQA 3UR3C 4AT1B 4RW7A 2EKNA 3LGNA 3KLFB 1V5VA 1WELA 2H4YB 1FDDA 1IKYB 3KG4A 2W1BA 3J81j 1Q8LA 1U2CA 4LRBA 4ANDA 3KHHA 1IKVA 3E51A 1BLUA 3R27A 4ZKAA 1OSCA 3CD0A 3J7Z5 2AU0A 1S77D 3AJ1A 1UFKA 2JLFA 3HHLA 1EX8A 1RAFB 3GYNA 2KRBA 5C5JA 2CQ1A 5KFYA 4A48A 4DR2F 1XNRJ 1SC3B 1S99A 2YKMB 1F3VA 2ZJQQ 1AZSB 4ECUA 3KLIA 3MD3A 3POTA 4ZCMA 1PBAA 3H42A 4F0KA 1CC7A 3RB4A 2M3DA 5CH7B 4CLWA 1RWXB 2HS3A 2XC9A 1MG7A 5DG7A 2FVQA 1T9WA 1MMLA 2AD9A 4U7UD 1H3DA 1TTHB 1UJ6A 2KO1A 3QAEA 4NRTA 2V2QA 1CQNA 2RNEA 4EBCA 2LXFA 1WF0A 3LPEA 3NS6A 1TKXB 3KG0A 2NPIA 1HWUA 4OHYA 1XMQF 2EK1A 2VFRA 3UN2A 2HQGA 1WHYA 2Q1LA 5CZVA 3VZIA 2AJ4A 1QSLA 5KFEA 4DL2A 2YKMA 2CUYA 2XYHB 3GSDA 3OTOJ 2HGNA 1VBYA 4IH6A 2B4VA 4ZIWA 4KB7A 5A8KA 1V6HA 2QYCA 5KOXA 2HAFA 1DRZA 1ZAWA 1IM4A 1Z4UA 2VUGA 4JI0F 2IBOA 4DV2F 4DV6J 1IKVB 3ZZUA 4DG1B 1ZYQA 4NA3A 3DLJA 4LVNP 2E1CA 3DRYA 2HHHJ 5C7PA 1HBUA 2GMJA 2RDDA 2QX0A 2QL7B 1FA0A 1X4DA 1TVRA 5FLXU 4EZ6A 3BPDA 3W5YA 4MAKA 2AJ0A 4OYAA 1X31C 4Q0BB 3G82B 3EZ5A 2VA3A 1VBZA 3PYEA 4O3OA 3T5LA 4GO5X 4ITSA 2D41A 2DJWA 2C3OA 2NUUG 2G13A 4ZHRA 4JI4J 1S1WB 5ETSA 4DOZA 1TP7A 2JH3A 5B0FA 3CCMS 2JJ4D 1JKHB 1YBUA 2B8PA 4ETXA 1WC1A 4PXCA 4CO1A 5AE2A 5K8NA 4C48A 2DCUB 5IZHA 4OMFG 4ZVRB 4DCJB 4CQ1A 3DMJA 4WXOA 3VGSA 4QWAA 4NXNF 1B70B 4WYLA 4NX9A 1UVKA 1FKOA 4LUBA 4DUYJ 2WBMA 3R2CJ 2R7SA 3A12A 1JLFB 3CJQA 1Y4ZB 1Q79A 3HDSA 4ZPTR 2MQNA 1T05A 4TVAB 1OQ3A 2QT7A 1CULA 2ZD1B 3BF4A 3NLCA 2R7UA 1VQ5S 5HMXA 1N5QA 1PCAA 2XBPA 1WOSA 4LSLA 3MOJB 1GK8A 2QA1A 3T5JA 1RCOB 3CCSS 3BSAA 1CVJA 3M9NB 3A8IA 2OO4A 3FSXA 3PIOQ 2LEPA 3KJFB 5HVFA 1RHKB 4ZN1A 1HYSA 4M5HA 1IBLJ 2GQQA 2AP6A 2OGUA 5U47A 2FJVA 1KDNA 3NGRA 5KOWA 3RB6A 2HQDA 1M1HA 3HSDA 5CAAA 5A8WA 3NGTA 4CNZA 1NZ8A 4GKKJ 4OYOA 1M90T 2EPIA 2WSCC 4X4TA 2VHGA 4FF3A 2VPXB 4NMLA 4YR3A 2AGPA 4ZVOB 3LP2A 5LOQA 2ILYA 2GVDB 2FUG9 2ZH6A 2DGVA 4HT7A 3T6JA 4CYUB 5C2CA 2QL5B 4CT8A 2ATCB 2JZ5A 3EDQB 2CRLA 3ITHB 4YHHJ 1JLCA 3K8VA 1NKBA 3BSNA 2DNOA 3C6TB 1XWLA 2ZWPA 4K5RA 4M5KA 3QRRA 4TLRA 3Q8QB 1H7WA 4XDCA 2B4PA 2WVCA 4JV5J 2Z30B 2M9KA 2HS4A 2KH9A 1T9YA 5KFIA 3UR0A 3R1HA 1URNA 3BKUA 3U1MA 4BBYA 4JI7J 3G6ES 2LP4A 4RW6B 5EWEA 1HNXF 2FVSA 3UI3A 5KFTA 1QTNB 1U7LA 5BYQA 1OWXA 2YWHA 2Z2YB 4LRFA 1UP1A 4K7QA 4OI3A 3SMZA 3VAMA 2R8HA 2IHR1 2HMIB 1E6VA 1ULRA 4OYPA 4NWBA 3UNYA 2KZMA 3BSCA 1U1NA 4LF7F 1XJWB 1R89A 2YXLA 3MPUB 2K2PA 2CIMA 3D5MA 5AJ3J 2KT3A 4FKXA 2HBZB 1VQSA 3ET6B 3N6NA 4QPXA 3TAPA 4RNHA 2J7WA 1RAGB 5J1EB 4UY85 4X4UA 3LANA 3O44A 5F8IA 1UPPA 1ICEB 3GJRB 1UPMB 3H98A 3PHTA 3UD4P 4TU8A 1HQ2A 1WC5A 3GCXP 3I5BA 4OZ3A 1N4LA 2IRYA 5IT4A 3I31A 5IQ6A 2XY5A 1LV5A 3RW6A 2GAHC 1HPZA 1PILA 3NS5A 3VF0B 4LBIA 4HTIA 2NSBA 1G6BA 3IBFB 3TAMB 4XAKA 4KO0A 1PBUA 4WFYA 3DKDA 1BE4A 4RUBA 4AXJA 1M5VC 2VFVA 5D0EA 3DOKB 2MY8A 4EYHB 4GC6A 3E8OA 1HR0J 4DQRA 4LFBF 5EX3A 3QGGA 3PHEA 2DXEA 4PXEA 4OI0A 1G3OA 1S5ZA 4DSLA 2ZH9A 2DGWA 2Y1RI 4ZCIA 1RWVB 1D8ZA 2EXUA 2W4PA 2DHSA 5A8WB 1Y9OA 4YB1P 3MM8B 4W98A 2JFDA 2LEBA 4DR4F 2R7TA 3AA8A 3TNVA 2IMOA 2IAJB 4JBCA 4EZ9A 4X4PA 1KR4A 4USJC 2V2ZA 4ZVTB 2B56A 1NSQA 1RAOA 3LF0A 1FKAF 1HYSB 2LA6A 4GC7A 3NNAA 5H9FK 4QW9A 4JI3F 2CQCA 1S6QB 1Q53A 4DFJA 1CPZA 2J6SA 3TA1A 3CCTA 3M8PB 4PKDB 2IVFB 4LSLB 3J7AN 1S7HA 5KFDA 2HNYB 4RNOA 3ELHA 2MDAA 3KLGB 3D7SB 3NCQA 4DL6A 1WHXA 4ZDNA 2CQ4A 3EGWB 3LALA 2YKOA 3LGHA 3TJAA 2H54B 4ECQA 1XMOJ 2ADBA 1OPZA 3V81B 3RBXA 1JNRB 4RUAA 4BC7A 4Y2CA 2OUGA 2V2VA 3DGPA 1L3SA 1WSRA 2ZM6F 2R7OA 4ZP6A 4DV3J 2PGCA 4DZ6A 5KFUA 2GIQA 3MAAA 4DUYF 4ER8A 2BDPA 1FJGF 1RLDA 4J9MA 3I56S 5DG8A 4IQXA 1E6YA 3EDRB 2UXBF 2EK6A 4AE5A 4C3KA 4ECVA 1S1WA 1TUGB 3R7NB 3WDOA 4CO4A 2CZVC 1MMDA 1ITPA 3WBZA 2AZ1A 1HKAA 3IO1A 1L3KA 2QE5A 4DPUA 1DZ5A 2HNDB 1T9VA 3PW2A 2YKNA 1W7WA 5GMEA 4UT4A 3NGDA 2LDIA 3ZZTA 1SKWA 2E9ZA 4P2XA 5L39A 2LLZA 3LP1B 2H4WB 3UW1A 2XYGB 2ZHOA 4KHPF 1WOPA 4DUZJ 4UF4A 3NOCA 3QRPA 1M5SA 3SV4A 4DSIA 3TZZA 2KI2A 1QAJA 4C2MA 4DR7J 4QOTA 3TAMA 4DR7F 5DZ6A 2X1FA 3G6VA 3EWGA 5AXLA 1F5BA 1Z2ZA 2RRAA 4JV2A 3PJ9A 4WP9A 2NXEA 4ZVUB 1SIZA 2B3TB 3H90A
chains in the Genus database with same CATH topology
1IKWA 2HWHA 5F3ZA 1IBLF 1WEZA 4DSKA 2IYIA 4QR0A 2DR8A 3NL0A 3J81Y 3CO9A 3JSMA 4OX6A 3L3CA 3GFZA 2IVMA 3SCJE 2R2SA 3KLVA 1UVNA 2FVRA 2EG1A 3E01B 2QFJA 1QAIA 2OPRA 2HGLA 5B09A 4ETZA 1S9EB 4NCGA 4CTAA 4AL5A 2HMIA 2P9GA 3PM9A 2HRYA 2LQJA 4IYQA 4E8UA 3HHLB 2KFNA 2PA3A 4F3MA 1R0AA 2RE1A 4U6PA 2V4JB 1VRUA 1KOHA 3QGHA 2UUTA 3T5HA 4IOAQ 1KHWA 1ZOTA 2VC0A 3KLFA 2QV6A 3DRPB 4O0IA 1WF1A 2DGUA 3US5A 2R2UA 3BN7A 1R3NA 5HLFB 5C25B 3FZBA 3BGLA 4KV8B 1S1VA 4PCQA 3OL6A 4I67A 3MR2A 1JLBB 3NCPA 5D8HB 2VONA 4J9SA 2K8GA 1VQPS 3OFGA 2ZFHA 4LVOP 4QIVA 1GQEA 2PO4A 2XMJA 1NJIT 1XBWA 3M9OB 2LCWA 4ZCKA 1AXQA 5JVHQ 1Q86T 2ZHBA 4I7FB 2WONA 4WF9Q 4MIBA 3SSQA 1S1TB 1HNWF 1RTHA 5CA5A 3M8SA 1U1KA 4FXDA 4OZ1A 3C8YA 3NAHA 3I87A 4CCHA 2JEJA 3LAKA 4RX6A 4HYKA 2HHQA 1QSSA 3CE8A 3I82A 2W25A 4G1IA 4C4WA 2A1BA 1REVB 4MH8A 2ALZA 2BE2A 3FSYA 3EXYA 3CJKA 2MJNA 4G1QA 3C46A 2VG5B 1FKPA 3DLKA 5KFXA 2BRLA 1UVMA 3SEOA 1VBXA 3OFFA 2WSFC 5F8NA 1S6PB 2XSJB 3QAUA 1T03B 3TO8A 5F8MA 2JC1A 2DO4A 2W4DA 4YR0A 2BVZA 3OJSA 3FVYA 2FJXA 3C6UB 3IG1B 4ZVFA 5KFNA 1FKOB 2CPDA 5A6WA 3EX7B 4ECTA 4FXWA 1RTHB 1JWWA 2CJAA 2O01C 4Y2KA 1U6BA 2BA9A 1S1TA 2ASDA 5J2MA 1SL2A 2E5IA 4URSA 3PRDA 3IAM9 5BYRA 2H9ZA 2E7WA 4CH0S 4X4NA 2CJ9A 7FDRA 1FRKA 2D3UA 5EUHA 1C2PA 2L9WA 1H7XA 3CD7A 4RBUA 5M2UA 1JK9B 3N01A 4NYPA 4NZ7A 1S1VB 4Q0BA 1WEXA 4RU9A 4F3OA 4A8KA 5HO4A 1Y7PA 2NSCA 3M1VB 3HHLC 3HT3A 3M30A 2C3UA 2DHXA 4IOCQ 5E2QA 1VRTA 3DC2A 3EXCX 4UY8T 2VG7B 2B7BB 5EN1A 3QWUA 1HWJA 2COLA 3DN9A 3SYZA 1YITS 5CCLA 3CCLS 1R0AB 2VFSA 3T3FA 4IRDA 1SH2A 4H4MB 5A8KB 2IFXA 3N28A 2ZOMA 4DR7F 4M94A 4KPYA 1SKSA 4XPCA 5HROB 1NJZA 2N4CA 4ZOSA 4C0OC 3F73A 5LSRA 3HVWA 4QYRA 1Q8BA 3IGNA 4DDFA 2CQHA 3OFHA 4QIGA 3KLEB 4IRKA 3KK3B 4NLUA 3KLHA 4KHMA 1B64A 1YGYA 2PT0A 3NCRA 4DUZF 2KKHA 1DQ9A 3OR1B 4DL5A 2C22A 4LSNB 2DBBA 3T9ZA 4OZ5A 3MM9A 1RTDB 3H5XA 1R31A 1TKZB 1HHSA 1U1PA 3VAJA 3O2IA 4LQ3A 1BY9A 5GAHI 4RNMA 3DYAB 4JUZA 1FDBA 3OJUA 1U1LA 2QEXS 1Y00A 1IKYA 1FRJA 2Z2LA 2W9CB 4A8WA 3QLHA 3CT9A 1ZM9A 3QJPA 2JX2A 3IS9A 1EETB 1LFPA 3H4DA 4GKKF 2PFFB 3IC1A 2MQOA 4OI6A 2GHWA 2PI4A 2MSTA 2J5AA 1HNVA 3QWPA 5IQQA 5KFHA 3Q8PB 1RYRA 1GXTA 4ED0A 5EGYA 4Q5VA 5AXKA 1E6YB 3UCZP 1NHVA 3AB2B 1NAQA 4DR6F 4ED1A 2YWFA 3PO5A 4PG4A 4DPOA 4G3IA 2L9NA 5J2QA 3D0HE 2OKQA 3PEHA 5ADZA 2B9YA 4ID5A 1VQNS 1H2TZ 1U1RA 2H5EA 2DGTA 2RT3A 4KBIA 1ZTTA 5IWAF 4H54A 1UVLA 3T1AA 1RT6B 4A4JA 3LPYA 5LL6d 3ZZOA 1KLMA 3CPWR 2PI5A 4DN0A 3WC2A 4ED5A 4WKRA 4NYZA 4O44B 4Y2IA 2IRUA 3BDEA 2ZDPA 1H2UX 3FQKA 3MR3A 2FHMA 1IUJA 2HQ3A 1ZPVA 1N0UA 3KFWX 2E1MC 1TKDA 1KONA 1JMTA 4DV0F 3F41A 2J8AA 2B6AB 2DISA 1WG4A 2UUCF 2GX8A 4P7VA 3T6BA 4QBUA 3PV8A 3VR1A 3VAKA 2JEIA 3Q24A 3CB4A 3PNIA 2KDOA 1DAXA 1T8EA 2ZDOA 1RT5B 2DGOA 3MWBA 1TR0A 3OTBA 1O51A 3R5CA 3AY0A 5I3PA 3TAQA 3NP5A 5AJ3F 4WU3A 4Y65A 5KT2A 4YDDB 2I8EA 2HVHA 2OLWA 6FDRA 5BYSA 4MMOA 2E7XA 3IWXA 3RRKA 1ZM3A 2KTQA 2OTLS 3IAS9 4NRUA 1HBMA 3O6QA 4A8MP 2F40A 2JVRA 5KFSA 2CKWA 2R7WA 4NLPA 4USHA 3D54A 1C0UB 2AJQA 1P6TA 2PSZA 3MXHP 4ERDA 2LDYA 2YNFB 1FDNA 1RT2B 1SC6A 1C1CA 1TL4A 3G6YA 1KRPA 1YJRA 1X4CA 3CMAS 4QR1A 4QWDA 3MFHA 3IBWA 3OXFA 4CIOA 2XY7A 4R0EA 2BRKA 4KFBB 2R2TA 2MB0B 4N5SA 3FZ2A 3UDLA 3HPOA 3FEYB 1RJJA 2MYFA 5ITHA 2ZBIA 1XERA 2RVJA 2KZZA 2FLLA 2FD2A 1HI1A 5B7WA 3P5TL 4A8SA 4F02A 3SDEA 2EFPA 3P49B 1TAUA 2VD3A 2AV5A 4IFYB 4ZS6A 3TUJC 2XZWA 1S48A 4ID8A 4OHWA 2FHKA 3CJ4A 4EBCA 1F60B 2YWGA 1CLFA 2VFUA 2QLXA 1UFWA 2KXNB 1NK9A 1H6KX 2IA6A 2HFZA 4DX8H 2G4BA 1ZM4A 4FP9A 2V2KA 4OIXA 3UWTA 2BV3A 2ZNZA 4D3HA 4C11A 2DGQA 3D1QA 2KRRA 2XNQA 3AQPA 2UUBF 5L9XA 4X62F 1C0TA 1XR7A 1MWYA 4UUXA 3VAHA 1RT6A 5KFPA 1K0VA 2GCFA 1PGZA 3DI6B 1SXLA 1YRXA 2RD5C 4HVZA 3BDPA 3OV7A 3AB4B 4TQSA 2XMUA 4ID5B 4OZLA 1XMBA 5HMYA 1VC5A 1NJWA 1HW9A 1R8HA 4LF9F 3OVAA 4J9OA 1VQLS 4B9TA 2HFOA 1KSPA 3W3SA 2OIHA 5CYMB 3ZC4A 1NU4A 2VBYA 3I4HX 4HDGA 2DPIA 2RF2A 2R8JA 2VPZB 4Y0FA 2R8GA 2VV5A 1NZAA 3DFEA 4M8LA 3MMBB 3W2VB 1Q1KA 2A10A 1Y5NB 1QUVA 1J5EF 2OPPB 3OVSA 3GILA 1KHVA 1GTHA 1JLFA 4ED6A 2AJFE 4L3NA 1MU2B 4OV1A 1TFWA 4R25A 2FLOA 3IS9B 2BUNA 4WK3A 3DDNA 3QLHB 1IKXA 3IWLA 3I0RA 3NRBA 4X4QA 4WFBQ 3SV3A 3RAQA 1S0VA 1GTEA 1HBNB 2AW0A 3SFUA 3BGFA 4CO2A 1QVFR 2JSXA 2AJ1A 1TV6B 1V3SA 2R4FA 2WCXA 3DYAA 3M32A 3PR4A 4QZVB 4ZHRB 2NYIA 1U1QA 1S72S 4WCEQ 5DLGA 2FVPA 3NNCA 3I0SA 2HVIA 1LKZA 3ZZRA 3B4MA 1BQNA 3BSOA 4M1KA 1FHTA 1UW4A 1BQMB 2A3JA 3KK3A 2ROEA 4EWTA 5HP1B 4MK9A 4NLRA 4WK1A 5G4DA 5A0YA 5A8RA 4WJBA 3CCVS 1RISA 3MMAA 5HMZA 4ZPDA 3MMCB 2RRBA 4ECZA 4DQQA 1VQ9S 3RW7A 4ELTA 2G1DA 4RLEA 2GO8A 1KFDA 2XLKA 2A2DA 1RT4B 5D3GB 2KN4A 3EPIA 3M2VA 2KYZA 4ZVHA 1KN6A 1R8AA 1P8GA 2EFQA 5DDPC 4DL3A 3DDKA 3L95X 3IRWP 1N32F 4N41A 4WKYA 4IKAA 4PQAA 1VQ7S 5D78A 4W90B 2LQ9A 2DR7A 1P27B 3M30B 2JEFA 3V2UC 2UXDF 4NLOA 1WI8A 1MWZA 4KRWA 3K0JA 3Q2SC 4RKUC 4HTJA 4L6V3 4DR3F 3POTB 4K5SA 2OFGX 5L38A 2ZHAA 4P7TA 1KQGB 1KQSR 2W24A 1R27B 2YX4A 3Q8SB 4I2QA 2GHPA 2DHGA 4HT5A 1U1OA 4ED8A 3BJYA 3KK1B 5E7OB 4PPDA 3TVKA 1IR0A 3DM2B 2BANB 3KJVB 2Q79A 3CSKA 1YQHA 3MPYA 1MU2A 3RTVA 2E9TA 3MM7B 5GAEI 4ES1A 3AAWB 4D3GA 2OPPA 3GYXB 4N56A 1ZZFA 4MKBA 3S7RA 3TI0A 5JVGQ 1ZPWX 4QCLA 2RF2B 1C4AA 2OP5A 3O8WA 3K5MA 5IT9Y 4B9NA 3Q0AA 2EBEA 5CYMA 1EP4B 1N8RT 1JX4A 2VG5A 4C8YA 1DHMA 1FO1A 2BE2B 2IJFA 4KR0B 4LT6A 3PW7A 2AQ4A 2XMKA 2XS2A 4RNFA 1TL3A 2M0GB 1YJNS 4N8OA 3GIKA 2F1FA 3HFKA 5M2PA 1NK8A 5F0UA 5DGBA 1DLOB 2A2CA 3QMQA 2QA4G 1N34F 4IR1A 4IRCA 3LP0B 4I69A 3JB9k 5DM7Q 4I7FA 3Q2TC 2EVZA 3GR1A 4DQIA 1HWIA 3DHXA 3CJ5A 5DS7A 4DV5F 3C3LA 1X5PA 7FD1A 3GG1A 2MKJA 2ZC3A 4RUCA 2IJNA 2OD6A 1RT7A 3HK2A 2BQRA 1YI2S 3MM7A 4K2XA 1WTBA 5KG2A 4Q2LA 2DIVA 3CCWA 1PO6A 1TAQA 1DTQB 2NR0A 3QJLA 1V3ZA 3MD1A 3V4IB 2XLIA 5H9EJ 2N7YA 4GMKA 2NREA 1J5OA 3SDEB 2YVSA 2YY3A 3ZZPA 1NKCA 3GIJA 4J37A 2IC3A 5FLXY 4TNOA 4OHZA 5EHHA 4Z2XA 3PW5A 1RTJA 1U25A 3A1YG 3H4BA 4PUOA 1VQKS 1YG0A 1PC4A 4I4BA 2BBEA 3OXGA 1FTCA 3N79A 3SSRA 2W8KA 3PKMA 1S9EA 3PXGa 4C7QA 5E3AA 4BS2A 4C8MA 3L7PA 1C1CB 2E9RX 5K14B 1JXLA 2B4UA 1S1UB 3FMWA 2YNFA 1U26A 3DRRB 2AYBA 3OL9A 2N3OA 3GFHA 2G0CA 2AX0A 3CJ2A 3Q23A 1FRIA 1JLGB 1HW8A 2LMIA 3PEJA 1S1XB 3ONQA 4QR2A 2PD1A 2ZJRQ 3PY8A 5LSOA 4NLDA 3MURP 4IH5A 3VALA 3H5YA 4F2SA 4RW9B 1F5AA 1N36F 4CNYA 1FVSA 1U47A 2WB4A 2CPJA 1S4FA 1HMVB 2CPFA 2GGPA 1YRUA 3ULHA 3C66A 4K4XA 4I6WA 1TL5A 2XCPA 2J0SD 2FHJA 1DJ0A 4JOUA 4DL7A 5IT0A 5A8RB 1KFSA 4U7CA 5A0YB 5AXMA 3BS9A 4CO3A 2O3DA 2B6AA 2PEHA 2VA2A 1BQMA 1M5KC 1L3TA 2HG4A 3K7RA 4FXVA 2OAUA 1BQNB 2CPHA 4RW8B 1MW7A 3MM5A 4GKJF 3MEKA 3H40A 4NLQA 1JLEB 2KVIA 1U24A 3I0SB 2HNZB 5LXRA 2BR0A 4M5DA 4B3MF 2B7CB 4YUDA 4KIAA 2GHVC 4OLOA 1HNIA 2HYIB 1BWEA 2Y0SD 4YP3A 2ZKTA 3D2WA 2L48A 2C2DA 1P9QC 5AE3A 3HHLD 2MHEA 5KG5A 3CC4S 1CC8A 5I3QA 3TARA 4F4ZA 4Q7AA 2RQMA 3B82A 4EEYA 3M6VA 1WTFA 2E5JA 4PQUB 1FNOA 3PO4A 1TK5A 5KFBA 3FEZA 4NZ6A 1P1TA 5B0DA 1HD1A 3M8RA 4PG7A 5KG4A 4DL4A 1SQEA 2HNYA 4OZJA 5KFAA 4DF8A 3W2VA 4N47A 1UFLA 3G4SS 2E5LF 3M2UA 4QIWD 1S97A 2OTJS 2VASA 2BACA 3MPWA 2J0QD 1Y3KA 1S76D 1S6QA 2DRBA 4NYOA 4TU9A 2GMLA 3IR6B 4KKOA 3HMJG 2YNIA 2HWIA 3SCIE 5L1IA 1IJFB 2XSFA 2KU7A 1WI6A 2LKZA 4ZCLA 4B9VA 2XWYA 3MM8A 2R7XA 4PQUA 3KHGA 1ZAVA 4F25A 2XS5A 2MQMA 3LWLA 4K4TA 2XMVA 2IBKA 4ZPCA 2OFHX 1T02A 1P1LA 1VHFA 1DQAA 2DGSA 3DRXA 4RW4B 3UQSA 3DOKA 2YX1A 2MSSA 3ENWA 4DF4A 1UA0A 3TYTA 3N4WA 3RAMA 2RQ4A 5K8MA 4ZLPA 2V9KA 4DLEA 4PWDA 1M5HA 1XR6A 4QW8A 1SJRA 2FJAB 2AGQA 1RDRA 4IG3B 2DK2A 4OJHA 1LWCA 3JTPA 5DQGA 2ZH2A 4DS5A 2UXCF 3W2WB 2FGCA 3P96A 2HGMA 5M2RA 2KG1A 1K0TA 2FHJD 2V4QA 3R5DA 3MCSA 1G2EA 2R7VA 5J2NA 2VZ9A 4DHVA 2F7VA 1ZBTA 5DJBA 3FNNA 1FXDA 3H2VE 4IR9A 1RI7A 2V8DA 3G71S 2QIFA 4KT0C 5B0GA 5A2QY 2PA8D