1VJWA

Structure of oxidoreductase (nadp+(a),ferredoxin(a))
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
59
structure length
59
Chain Sequence
MKVRVDADACIGCGVCENLCPDVFQLGDDGKAKVLQPETDLPCAKDAADSCPTGAISVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Small structural changes account for the high thermostability of 1[4Fe-4S] ferredoxin from the hyperthermophilic bacterium Thermotoga maritima.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Oxidoreductase
molecule keywords FERREDOXIN(A)
total genus 14
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 1996-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00037 Fer4 4Fe-4S binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1vjwA00
2WAQD 3MMBB 2FJBB 4ID8A 1BQXA 1FXDA 2UZAA 4CI0B 2VPWB 1AXQA 1A6LA 1BC6A 2VPYB 3LW5C 1ROFA 3MMBA 3MM7B 1Q16B 1BD6A 1C4AA 1BWEA 1FCAA 2GMHA 1FEHA 1IQZA 3MM7A 1G3OA 2V2KA 3MM5B 2WSFC 5CHCB 2PA8D 1HFEL 1DFDA 7FD1A 3GYXB 2PDAA 2XSJB 1FTCA 1RGVA 1F2GA 1BLUA 2VPXB 3IR7B 1SIWB 3MM5A 1H7WA 4XDCA 2VKRA 2FJAB 3MM8B 4XDDA 2C3UA 1FRKA 1XERA 2XSJA 2VPZB 1FRJA 3MMAB 2WSCC 1GTEA 1JNZB 1KQGB 5FD1A 1GTHA 3MM6A 1F5CA 1FRXA 4OMFG 1C4CA 5L8RC 1D3WA 3EXYA 1FRMA 1PC5A 3C8YA 1JB0C 3MMAA 2FGOA 1FRHA 3MMCB 1VJWA 1FRLA 2GMJA 1IR0A 1GT8A 3IR5B 1FRIA 1Y4ZB 4KT0C 3MM9A 5BYRA 2Y0SD 4RKUC 4YDDB 2C3YA 2FD2A 1F5BA 2PMZD 5BYSA 2C42A 3MM8A 4DHVA 1R27B 5CH7B 6FDRA 1B0TA 3OR1B 1SJ1A 7FDRA 3MM9B 1B0PA 1SIZA 5E7OB 1KEKA 1CLFA 2V4JA 2C3PA 4OV1A 1B0VA 1JNRB 1FF2A 1Y5NB 3EGWB 3HKZD 3MM6B 4XK8C 1G6BA 1FERA 1FD2A 1H7XA 3IR6B 3OR2B 4Y28C 1WTFA 3OR1A 1PC4A 1FDBA 2WB1D 4L6V3 1Y5LB 1KQFB 2FJEB 3EUNA 1Y5IB 3MMCA 3OR2A 1GAOA 2C3OA 2ZVSA 4AYBD 2IVFB 5BYQA 1FDNA 3PNIA 6FD1A 1H98A 2WSEC 2C3MA 1DAXA 1K0TA 1FDAA 1DURA 2FJDB 2Z8QA 1FXRA 1H0HB 1FDDA 2FDNA 2O01C 2V4JB
chains in the Genus database with same CATH superfamily
2WAQD 3BGLA 3MEEB 5I42A 5KFLA 4Q7AA 1PJ6A 2VF3A 2F4VF 3MCMA 1YJVA 2B8QA 2HRUA 2JOQA 1JLEA 2FLOA 2YX4A 1NSKL 3BSCA 2XGPA 1B7YB 2HURA 2Z2MA 2NQPA 4ZHRA 2XMAA 1IWAA 2QEXS 1ZOTA 2RSQA 3KKFA 1UA1A 3MM7B 4ANEA 5IT0A 2HS3A 1AYEA 2CQ1A 2CJXB 2HNZB 1JLCB 2HQGA 3HSGA 3MEDA 4I2PB 4C7QA 2IC3B 3VALA 3R1LA 3SCLE 3KK2B 4DUTA 1FCAA 2GMHA 3UR3C 1RCOB 3G96A 1S6PA 4F3MA 4YB7A 3R9LA 5LSLA 2BYCA 4Y34A 4M63A 1FXLA 3QT7A 3K5PA 2BQRA 4F4XA 2ILYA 4CO0A 4HTJA 2AP6A 1VISA 1EX8A 2QGFB 1O5JA 2LXUA 2BACA 3G87A 4ECQA 4PUOB 3VR1A 1BE4A 4ERDA 4DLEA 2UUCF 3UVJA 5F3TA 4MT1A 4OJGA 2VOPA 1HBUB 1BLUA 5FDLA 4DSKA 1WI8A 4L3KA 2B5JB 2Q1LA 4PQUA 1F6TA 2FGCA 1WEYA 2XLJA 1RYSA 4JOUA 5KT6A 5CQGA 1JLBA 4DSIA 3QIPB 3R1HA 3CDWA 4JI5J 3D6HB 5JXSA 4KQZA 1SKSA 4B9TA 2VB6A 1JNZB 2A2DA 4GKJJ 2GIRA 2NREA 4I67A 1KVJA 4RW6A 3CO9A 3AOAA 4JBCA 2VODA 1WF0A 4ILLA 5HJYA 3KHGA 3S8SA 2OPRB 3W63A 4DBQA 2VJUA 2CADA 2HS4A 2KT2A 3N01A 4TY9A 3WC0A 4F26A 2D3ZA 2RAQA 3VAKA 1TKZA 4ZVPB 2LXIA 4OL8A 4EI2A 4A8YA 2HKEA 3H4DA 1UEVA 3PKYA 1RI7A 2FJWA 1RSCA 3IR5B 1U2FA 1Y4ZB 2VA2A 1IM6A 2IM3A 1TL7A 4CP5A 1T8EA 5L38A 2P9EA 3UDEA 5K8MA 4ECSA 5BYSA 3EJMA 1DZ5A 1OSDA 1RT5B 3CTRA 4LVNP 3GSDA 4QWCA 7FDRA 1HPZB 2FTRA 2ZBIA 2OP5A 2L9WA 4MIAA 4OZ1A 4LFBF 2NXJA 5ETPA 3CC2S 4K4UA 5A8WA 1B0VA 3HI9A 1ZTWA 2QG9B 1FJGJ 2NPIA 2BA9A 2CJBA 3QYYA 1C1CB 3PW0A 1VQ7S 4RUHA 3PY8A 4UY85 5KFKA 4MKYA 3DM2A 3ZTOA 4W92B 3W2VB 1RWOB 1V6HA 2CJ9A 1IR2A 1KFDA 1Y3JA 2GIFA 3AA8A 3ET6B 3IMQJ 4MIWA 4Y2IA 2EVZA 4HACA 4EZ9A 3HHDA 2QZ8A 4RO0A 3CD0A 4GO7X 4KBIA 4XTTA 3SFUA 4LUBA 3PR5B 3QQCD 2UUBF 3ILJA 2GC8A 3HP6A 2WHOA 3IWXA 2Z56B 4WFBQ 3IM9A 3C2PA 4C11B 3BO3A 1U1MA 2AJ4A 1RWUA 3BKTA 5ADZA 5GAGU 1T9XA 5LJ3Y 2OGUA 1DURA 3R5CA 4DSLA 3W9HA 1G7CB 2ZC3A 3JB9k 1VOMA 1PJ5A 4NASA 3PG9A 1VR6A 4DV3J 5HATA 2D3OR 4JI5F 3NCRA 4ZPAA 3JTNA 3MUMP 3M6UA 4EEYA 2DISA 2DNOA 3QAEA 2GHWA 4USVA 5KFBA 1MN9A 3QJLA 2NZ4A 1D9AA 4EK2A 4C8MA 2HGLA 2AJFE 2LU2A 4FYWB 3ZTPA 3HKWA 5KOWA 1HHTP 2KU7A 2UUWA 2AGPA 1ELOA 3BN7A 1Q86T 2GS8A 4GVLA 2UUCJ 2H4WB 2ZKUA 3T6BA 5IV3A 4C8LA 1M90T 3EX7B 2WRMA 3BBFA 4OV6A 4DN9A 4LQ9A 4DQPA 1Q78A 1HMVB 5KAKA 1R8CA 2CPDA 5HBMB 4WWSA 2VQFF 5L9XA 5DM7Q 3C19A 2FZGB 2R7WA 2B9EA 1GXLA 4QIVA 1RU1A 4Z7YA 3VZIA 4DCJB 4DPYA 3J80U 3VAMA 4Y2AA 3RRKA 2UUAJ 4ZN3A 3DRYA 1D9DA 1H2UX 2R2RA 2ZJQQ 2BJEA 2M9KA 3BDPA 1M5HA 1XEZA 2KN4A 2A6MA 1YBAA 3LGNA 2CQIA 2ADCA 1OPZA 1H3DA 4JI4F 2RH3A 5KFFA 3K59A 3W3SA 2RD5C 2VH7A 3SBMA 3PJ9A 1SIWB 5HAOA 4K4VA 1H7WA 3GTYX 2ZWPA 4ELUA 4I7FA 4KKOA 5B0FA 2BQ3A 4BDPA 5JVHQ 5ETOA 4ZVGA 1XERA 1LW2B 3CXCR 5M2UA 4DQRA 1S7HA 4KAIA 4ZHRB 1C1BB 1O6XA 3BQ0A 1N0UA 2DPJA 1FWKA 2DNPA 3BKUA 3O44A 2CXEA 2AYGA 3HVRA 5J2NB 2HLTA 5CCMA 4QZVB 2IC3A 1IUJA 4ED4A 4ECUA 2M88A 1L3VA 4OI1A 3QWUA 1NNDA 3KK3A 1ICEB 1YJUA 3BQ1A 3W8GA 4OMFG 1WACA 3AA9A 2HPUA 3DMJA 4QR1A 2MKKA 1RISA 5KFVA 3KLEB 2XO6A 3GV8B 4DV3F 4A8WA 5CZVA 4FS1A 4P72A 3TQ1A 2X3DA 4RWWA 4WE1B 1NK9A 1V5IB 2MZRA 3TA0A 3ZTSA 3JSMA 4ED7A 1DBDA 5G0RA 4DV2F 1RHRB 4OIXA 2KVIA 2VQEF 1RT4A 3PXGa 1FJCA 2R42A 3DLBA 2POKA 4YDDB 4ZOSA 1F60B 2FD2A 3BS9A 3PW5A 3A8KA 1S79A 3TRGA 4W90B 2OEJA 4O44B 2UUBJ 3UDCA 6FDRA 1NO8A 1Y7PA 2HQDA 1CJTB 3MOZA 2QLFB 2CYYA 1KEKA 4LF8F 5KTQA 1X60A 2BW2A 1ZA2B 3D6MB 5J2NA 3OUYB 2DIUA 3MAAA 2I9SA 1IBKJ 2W4DA 1AFJA 2MKYA 3B4MA 1NH8A 2HVDA 2NYHA 3T6JA 4OHYA 1FD2A 1U1NA 3DFEA 1T03A 2IYIA 5K9FA 1WTFA 1UCNA 4K59A 1JMTA 2FHJA 2IRUA 2LEBA 1JK9B 2Y8YA 3FEYB 1Z2LA 3W65A 2R2UA 2FZCB 1Q81T 2MZSA 2PFFB 5GADU 3ISZA 5KFHA 1VC6A 1RK8A 1RU2A 2VU5A 2F7VA 1E6VB 1WG5A 2ZNZA 4J9UE 4CO4A 2B7CB 4JI7J 1N6QB 4DOZA 1YSJA 2JFKA 2E9ZA 2DNHA 1QUPA 1RKJA 4B08A 4HYKA 1HI0P 3P49B 1L3KA 1UZDA 2V67A 5KG6A 5BYQA 2PC6A 3CJ8A 4ZIWA 1H98A 2BJ8A 2ZC4A 3I0RA 1U24A 2H48B 2JVRA 2OPQB 4LJMA 3H2LA 4FYXB 4DV4F 5FLXU 1LEOA 5FIIA 1YG0A 2E1CA 2R8JA 1FNOA 5KFYA 1HPZA 2O01C 5KG0A 4JI3F 1PG5B 5DO2A 1N88A 4DR4F 4LRDA 3NBPA 4PWDB 2JHEA 2XLKA 4K50A 2V8DA 5M2PA 4H4MA 4KGVB 3CW2C 3N4WA 2AZ1A 3H42A 2VONA 2VDHA 3TVZA 3U27A 5DG9A 4BWMA 5HP1B 4K8RA 4DL4A 2HW3A 1N48A 1OJ4A 3QRPA 2RB7A 5H9EK 4A47A 5B0BA 4DSEA 4FDFA 1JJCB 3DDKA 3DOKB 4F8RA 4PG7A 2DRDA 3RAMA 3R5JB 1RABB 3PYFA 1Q16B 5DRKA 4U7UK 3G6ES 1VQKS 5I3QA 1WHXA 4ZPDA 1QAJA 4ALZA 2ASLA 2BVZA 3NNHA 2C2KB 2AYBA 2FVRA 1HWUA 1FE4A 3V4MA 4AXIA 1NPPA 2IJNA 3RGIA 1H6KX 1KQKA 2IPOB 4DN0A 4RNMA 3BO4A 3OFHA 2YNIA 1L3SA 2WK4A 3T9ZA 2AGOA 2EK1A 3L3CA 4RNNA 1WF2A 4RWXA 3G6VA 2DTJA 3V6DA 1K73T 7FD1A 1J5OB 3CCTA 2Y9HA 2QLWA 2KT5A 3IBWA 4FPRA 1YQHA 3GYXB 5SZTA 4QR0A 3CULA 1N5VA 1MMDA 3BGOP 3DYAB 3FDSA 4F3QA 2G13A 2ZOFA 5HO4A 3LP1B 3VAGA 2XO7A 1U7LA 1H2VZ 4LF7F 2E29A 2EI5A 2C3UA 3HHLB 7AT1B 1KN6A 4Q2MA 5BR8J 2N4CA 1JKHA 2FC8A 4MIBA 3KTQA 2VPZB 3UI3A 1S77D 1JWWA 2FUG9 2VG5B 1Y3KA 2RRBA 3DHWC 2FB0A 4RLEA 3CJKA 3QZ8A 3T5KA 5FDLB 1EJ7L 1T95A 4UTGA 4CIOA 4B3RF 4YR2A 1A7GE 3DU6A 1GTHA 3L4BC 3OTEA 4MKBA 2J8SA 3I56S 4IO9Q 8RUCA 4DFMA 1YHQS 1UVJA 3FMBA 2EC0A 2ASDA 4IQXA 1CBKA 1Y9OA 1NSAA 1VRTB 3NGKA 3ZZTA 1KSPA 1K0VA 2DNYA 4ZVFA 3WBZA 2AYEA 4NE9C 3OPKA 4HACB 4UOFA 3V6DB 4C0BA 1BQMA 1RT3B 2GVDA 3E3XA 4OZ3A 4ZPTR 1FHTA 1RDRA 3H0PA 1QY7A 4A8MP 1IR0A 3ENQA 3DLKB 3FBEA 4OYMA 4RW7A 3TOQA 3LAMA 1R31A 2KM8C 2HK2A 5LMUF 1AUDA 1RAIB 5DGAA 2KZZA 1TL5A 2AX1A 2OFGX 2JRSA 1NZ8A 2Y0SD 3AB4B 4H4OA 2OEMA 2H1YA 4MKAA 4N8NA 2DGTA 2KG1A 1QM9A 2R7XA 1ZBTA 2CJYB 1WG1A 2M4MA 1R89A 4EYIB 2I5JA 5J1EA 1UFLA 4L72B 4TU7A 3QZ7A 1X9WA 1MNEA 2MQNA 5SUHA 2B4OA 2YKMB 4DPWA 1IBLF 3IGVA 4F2RA 1XJWB 3V4IB 2AIRB 2VZ9A 4MH8A 3OL8A 1LWCB 3EE3A 2C2EA 1NK0A 2VFTA 1R0BG 2MKSA 4P2SA 4DR6F 4QJVA 5LMNJ 1B4SA 3DI6A 1Y00A 1NB7A 2HHSA 2VQFJ 1QDUB 1RA7A 2XYGB 2C2DA 3OD2A 4OX7A 4KPYA 2A6OA 2ZH5A 1YK9A 2W4CA 3UN5A 2QL5B 3RTVA 2MQLA 1R8AA 2ZFHA 1JJ4A 2ZVSA 5G4DA 1TUGB 2V2QA 4L3NA 4MKVA 2E9TA 2W2OP 2GIQA 2E5IA 5CYMA 4AE5A 3T5JA 2F65A 2K7KA 2K3KA 1FXRA 4TU8A 5D4PA 5I3UB 3G8QA 4IH6A 3W9JA 1IWGA 2R4FA 5L1KA 2P6TA 2ZVIA 4M5MA 3P4UB 1N33F 3A8JA 1VQ5S 4E0DA 4ZLPA 3HHLC 2L48A 3L7OA 1VQNS 2AYMA 3SQOP 2MZJA 3M1VA 3IC1A 3PO5A 3RW6A 1LV5A 4ED5A 1HNIA 5CXTA 2BOAA 1F0XA 1UW4A 5GAHU 3KMSA 1AXQA 4OX6A 4QIWD 3FCHA 3BGRB 4O0NA 2YWGA 4QCLA 4RNFA 1FTRA 1RWWB 3LUYA 2HK3A 2FYXA 2RQ4A 4DMZA 4DR1J 2YX1A 2E1RA 3LTOA 4MAKA 4QU7A 3I0SA 1JLEB 5HANA 3J81Y 1B7FA 1BMQB 4NLUA 4F25A 1AROP 2NS1B 1BY9A 1U26A 2C2ZB 1Q5VA 3H7HB 2FQQB 3I0RB 1UWBB 4FXWA 2QRRA 2CNNB 1G3OA 1ZAWA 4KO0A 5E3RA 5B0EA 4DQSA 2V2KA 1KLNA 2NCKL 3PIPQ 5HMYA 1FA0A 4K7QA 3B6BA 4LFAJ 1LW0B 2VBXA 2IRXA 1NAQA 4GVBA 1NKBA 2JFDA 1B70B 4K0KF 3KYLA 5D78A 4DSJA 3H25A 1SC4B 2CQ4A 3R5GA 3PYDA 2N82B 2OAUA 5HP1A 3R6GB 5HVHA 5F9LA 3QT5A 2G2ZA 3HPOA 3W2WB 4QU6A 3HSDA 5KG2A 2MXYA 2XGQA 4ILMA 2M3DA 1R7IA 4BC7A 5D0HA 1JLCA 5D6GA 3CCVS 2J9DE 4Y00A 5LXYA 3KK2A 2J0XA 3V6KA 3G2XA 4WXWA 3PX6A 2BBEA 1T05A 4CCHA 4ELTA 5ETNA 4DQQA 3I32A 1C4CA 4YB6A 2J9EA 1D3WA 2CPXA 3KDNA 1J2VA 3TJ9A 1PC5A 5K8OA 3J7YU 2ZH8A 2Q6CA 3MR6A 4P52A 2EG2A 1HHSA 5B09A 2WW8A 3O6QA 4ID5A 3TJAA 1HBOA 1N5SA 2GMJA 3ITHB 1QAIA 2J6SA 1NKCA 4Q8EA 1SH3A 2CDQA 2YTCA 5GAGI 1I94J 3MD1A 3GR0A 4WP8A 4TN2A 5DDPC 2V5HG 5B08A 3PW4A 2CQ3A 3M8ZA 2W8KA 1EETA 1EZZB 5DDRC 1RADB 3SCIE 1HIYA 2VBZA 2H4YB 1I5OB 3O2IA 3B8HA 2VV5A 3QGIA 5H9FK 2QX0A 3IG1A 3RB0A 4A8FA 1TL7B 5B0AA 3HZEA 2V4JA 5IM0B 1S76D 3QRQA 4OLOA 3BPSP 5BXIA 4HT7A 3W5ZA 1T05B 1VK3A 1XBWA 1MU2A 1OPIA 3AD8C 5F8IA 3KLFA 4Y28C 1U2RA 2AEMA 4FZVA 3KK1A 4DF8A 4K2XA 1X0FA 4C3LA 3EVOA 3IS9A 2Z2YB 3OFGA 3RB3A 1RAOA 4R5PA 5CD4H 2ZWOA 4X4RA 4PXCA 4PRFA 4NEZA 2ZH9A 3ZZYA 4K4SA 1ZZFA 1UJ6A 1Y10A 2U1AA 2L08A 4CRJA 1HBOB 3ITHA 3B54A 3ZO7A 1C1CA 1GK8A 4DZ6A 4A8SA 2CJAA 2LQBA 1PCAA 1I1GA 2DNNA 3C15B 4M5KA 1IBMF 4O3QA 1EARA 1RJJA 2E1MC 2XBPA 2MGZA 4UZCA 1XMQF 4DR4J 2P9CA 1PYSB 3M8SA 1AB8A 3GMGA 4NLWA 5KFNA 2Y1RI 2WONA 3F0NA 3Q89A 9ATCB 4QWBA 1S0VA 1FDDA 2E9RX 4JV5J 3CF5Q 1TKTA 2QFJA 3C15A 2YXLA 2ZHOA 1SC1B 1TMJA 2YKPA 1B99A 3A1YG 2NUUG 2ROGA 2IYGA 2IDLA 4IG0A 5EUHA 5LT5A 4Y65A 3LGHA 4DU8A 1F5AA 3HVTA 4QWEA 4LF1A 1WHVA 1R8PA 2DGQA 3RG6A 2MLXA 3P3DA 2BJ7A 2FIUA 5KG3A 2WCXA 5HROB 4YR0A 1YI2S 1N34F 4USMA 2XG8A 3H20A 4ZVHA 1XNRJ 1SC6A 4JI0F 2V50A 5AE2A 2VPYB 1LK7A 1RHQB 4B3OB 4CO5A 4N76A 2OSQA 3TUJC 4C0HA 1SJFA 1TK5A 1K1SA 3UFCX 4LVOP 5KOXA 1HBMA 1S9EA 1YJ7A 3W61A 2MPUA 4ATNA 4N8OA 3AFGA 4NEYA 1VRTA 3ZNUA 2OKQA 2Y0BB 3O8WA 1OY6A 2MEWA 5GMDA 1J5EJ 4ICLB 1AZSB 4I68A 4IDKA 2JC1A 4J91A 4NXMJ 1LWXA 2WOMA 3NEKA 3OFFA 4L76A 3CCWA 4QIGA 2PSZA 1FFWB 3MR3A 3OV7A 1FKOB 3LQVA 1XR5A 3ONQA 4PWWA 1M5PC 1RTDA 2MHEA 2BKOA 5KFXA 2V68A 4RJVA 8ATCB 2XI3A 2XY6A 1FFGB 2YWEA 2LFVA 4UOCA 3I4HX 2RDJA 1RAFB 1RBLA 2HHVA 1IBCB 4IG3B 2GGPA 3ENWA 2KYXA 3BEGB 3OVSA 4J9QA 1DJ0A 2IAJB 4TLRA 3KJNB 4I2QA 3W60A 3CMES 1NUEA 1RT6B 5CCLA 3EGZA 3Q0AA 2QL9B 3HK2A 1NU4A 4G1IA 2DB1A 5C7PA 2GVZB 4QW8A 4RW4B 4DR3F 1YITS 2HQFA 2IVMA 4NMXA 4DV6J 2A1BA 4I7FB 1UVKA 3OTBA 2W1BA 3LP0B 3R3TA 3RBXA 3UWTA 4YHHJ 4G1QB 1S72S 3MUVP 5D3GB 3BYPA 3AJDA 2A2CA 1L3UA 3KHHA 1GX5A 4J9RA 2G0IA 4HHUA 4QYRA 1JJ2R 4I64A 3HD1A 2WBMA 3AOCA 1IJFB 1WC5A 3SIPB 4WFNQ 2DVIA 3BF4A 4F4KA 2QA4G 2DR8A 1F3FA 2KI2A 2GCFA 2CG8A 2HBQB 1LFPA 5KG5A 3KG0A 4WBFA 5C24A 2ALYB 2LP4A 5D3GA 2IBOA 1U8WA 2MZQA 4GVBB 5F0WA 1VQOS 4U95A 2KZMA 4JI2F 2VIHA 2QMUB 2HWTA 5LMNF 1IJEB 1T02A 2C3YA 2YPYA 4KYZA 1TAQA 2C42A 4LIRA 2ZDOA 4UUXA 2HFZA 2K1RB 3KNAA 4KH1B 1SB6A 4IH5A 1VBZA 4I2QB 3EVWA 3R2DJ 3UCGA 2V6AA 4RW8B 4P7TA 5A8RB 3I82A 4F50A 2MSTA 2M0GB 3MEKA 2C3PA 1GMUA 2QC3A 3AD9C 3MI7X 2RMLA 5I3PA 3CJ4A 1X4DA 1G6BA 3IR6B 4NZ6A 1HI8A 4P7VA 2H51B 4IFVA 1CJVA 4X66J 5B7WA 4RU2A 2XHCA 4AUKA 4CTAA 1VK8A 3BBCA 4TNOA 2ZUAA 1KQFB 4K4YA 2A3JA 1ZPWX 1KBRA 2CQ2A 1KDNA 2IFXA 2OPQA 2XYPB 3EUNA 3NXZA 4C0OC 4DFJA 1T9VA 4WIIA 3OR2A 3C3LA 4DFKA 2WW4A 4I1TA 2BE2A 4E2FB 5J1PA 4X4NA 3AOBA 4X4QA 4K4ZA 4OI6A 3T41A 2E1AA 2VC1A 2W9BB 3IWNC 1RACB 2KH9A 4AQYJ 2C3MA 3MEEA 5ETLA 4OYAA 9RUBA 5KFPA 1FDAA 4KGXB 3UQSA 2W9AA 2LDIA 2V2ZA 2CPEA 3R6LB 4ZJLA 1N4LA 3KHLA 3Q8RB 1LWFA 1RHUB 4NLYA 3OSPA 3VAIA 2F40A 2BX6A 2PMHA 5DETA 5EWFA 2UXCF 3QFHA 3QT8A 2W9BA 3QPIA 3JSRA 2FHOB 4F0MA 2ATLA 1U1OA 5DLFA 3HXMA 3VAHA 3H90A 2LEPA 4E8UA 1EB0A 2IJFA 2QL7B 1X4HA 4FN5A 3MR5A 2HHHF 5JUMA 1WC6A 2CZ9A 3MECB 1JLBB 1A6LA 1S7IA 1WHYA 3MTKA 4KIAA 4NZ0A 4C48A 3MMBA 1OYEA 4PXEA 1S5ZA 4TU9A 3K2YA 3JSYA 3DXSX 3MD3A 2BANB 1F9FA 4HHHA 2BKNA 1X4CA 1C4AA 4TXSA 4YDXA 3PEHA 1Y11A 2CPIA 3ZZRA 4DF4A 1SJ4P 1SKUB 2KXHA 3D66A 1S9FA 2MGZB 2OPRA 3IA0A 1X4EA 3MUTP 4LFBJ 1HD1A 1QAXA 3VWSA 1X9SA 2EEYA 2SXLA 1HNXJ 4UUWA 1Q8IA 1X4BA 4QIEA 5CHCB 4DL0C 4ZJQA 3PRDA 1HFEL 3IN5A 3A12A 4EMDA 1LWFB 1VQMS 3D54A 4WZQA 1F9EB 4WZMA 4ED2A 2D41A 1NDKA 1S1UB 4W98A 1S6PB 5LJ5Y 3MF5A 2QLBB 1T0TV 3U02A 3CJ2A 5HVFA 2BRKA 5KT4A 3I6PA 3PM9A 4YS2A 3SV4A 1TTHB 1NDLA 3PVXA 1RTHA 3THVA 4ES3A 2UVRA 3MM8B 3HFKA 4RW6B 5CYJA 2XQCA 4ZVRB 3H8YA 4DUZF 4A8KA 4N56A 5LMUJ 1S97A 2VFSA 1DTTA 3FMWA 4F67A 2HVIA 4LFCF 3CJTA 3NS7B 1PGZA 1FFSB 2HNYB 5ETKA 3DRXA 2CJKA 2P5VA 2V0NA 4Q8FA 1TU0B 1WDTA 1QSLA 2BANA 4YP3A 2BM1A 2YH0A 4PQUB 2W25A 5IQ6A 2F4VJ 2W8LA 2OO4A 5L8RC 4K5SA 1AT1B 3DM2B 1D9FA 3WC2A 3CJKB 2Y1JA 3BGUA 1R0AB 5LSRA 2DNRA 1CEZA 5F8JA 1H38A 1U49A 4OZ5A 1N0VC 2XMJA 1MWQA 3AJ1A 5JMNA 3L7UA 4C2MA 4DUYF 4X64J 4LQ3A 4PG8A 5CA5A 1M5OC 1XTZA 1N36J 1RTIB 5IOLA 3FEZA 1HARA 1JXEA 3IO1A 1CJUB 3QO9B 4IG3A 1NXIA 1P1LA 2B9YA 4O3OA 1FWPA 2JX2A 4C8NA 3NGUA 1A0OB 1JLFA 4LF8J 4OX9J 4UT4A 2LQ5A 2MKHA 3P5TL 3UN3A 4ZKAA 1UL3A 5DDOC 5LOQA 1S1TB 1GXTA 2FHJD 1VBKA 5F9NA 3JYTA 4KH0B 1KC8T 3TNVA 4LT6A 1QTMA 2F63A 2XC9A 3OR1A 4DR1F 2FJXA 3HHLD 3CB4A 1WI6A 1JLFB 4AL5A 2WVCA 4IYQA 5ETRA 3FC9A 3LP2B 3C6UA 3OFEA 4X4TA 2H5IB 3OJUA 3GSIA 3V4IA 3PR4A 4P9SA 4RU9A 1SL1A 4ZN1A 2C3OA 3IP0A 1UVMA 1LWEA 1X7VA 3Q8SB 3CT9A 2DYAA 2A0FB 3GJQB 2KYZA 3UW1A 1OY8A 2MJUA 3JQKA 4LF2A 1GX6A 2QE5A 2VDIA 1RTZA 5HBMA 3KLHA 4FVMA 3BBBA 3EMTA 1K0TA 2QMXA 1VC0A 2KXNB 1V3SA 5KFCA 1NB2A 2D74B 2BW7A 2KJVA 5HMZA 1FX2A 1HI1A 2LCWA 2VL1A 3MFHA 1S0OA 2XMUA 5HI7A 4ZK7M 5DG8A 4OYBA 1QSSA 2YWHA 4DX6A 4J9PA 1DLOB 4TQRA 3G82B 3GYGA 3ZC4A 1CJKB 4CWBA 1NDPA 2CKWA 2A10A 3NCPA 5E0OA 3RJMB 1QVFR 1VQYA 2MQMA 3QGHA 4OI2A 2KJWA 3BB5A 3LW5C 2P2CB 3JAMU 5T7LA 1WSVA 3DOLB 3Q86A 4M5NA 5A0YB 2FVQA 4DV5F 4DR6J 1UMJA 3QMQA 1D8ZA 1KWMA 4WIQA 4DR5J 5HROA 3G4SS 1LKZA 3VGVA 1URNA 1PJ7A 2B6AA 1X4GA 2BEFA 1GMWD 2F9DA 2JH3A 4DX8H 3V81A 1DQAA 3BSOA 2RDIA 2MTLA 2CQDA 2ZBRA 3G86A 3R97A 1WOSA 2IA6A 2PIIA 3EM1A 2BUNA 4C8OA 1REVA 4ZVOB 1U6ZA 2BABA 2NXCA 3KXDA 3I0SB 1PILA 3KHRA 1REGX 2WVBA 4M1KA 3G8TA 4EYHB 2CZ4A 3HCXA 2OPSB 1TQLA 5G0RB 1HW9A 2QIFA 1H72C 4Q0BA 3GP9A 4KO0B 2KXFA 3I5CA 2Z58B 1REVB 2JL9A 1VQ4S 1AZSA 2HBYB 4MTPA 2WZ1A 2R7SA 2QFIA 2CFXA 1WWHA 1TMMA 4WP3A 2AKWB 4FNHA 4RR5A 1FKOA 4I69A 1RQ0A 3NGSA 3W5YA 3DLLQ 2E5JA 2WB4A 4X4VA 2YKOA 4LFCJ 2HRTA 2MQPA 3ENAA 4OZJA 3QRRA 1NK4A 4FP9A 4ID5B 5F8HA 3MM6A 1FRXA 1RT2A 3OQ2A 3S7RA 3BJYA 4IKAA 3HMJG 1Q5YA 4FF3A 5KFTA 3MPVA 4YY3F 3ENVA 3PW2A 2N3LA 4X84A 2HRYA 4YHHF 5B0CA 4ECWA 1I6JA 1APSA 4HL9A 1NJXA 1S49A 4R25A 2M70A 1KFSA 3MM9A 1R0CB 1N54B 3JS9A 1RWNB 4FPIA 4X4OA 1N5YA 1JLAA 2B4PA 1EHWA 3D2WA 3MM8A 1P6TA 1VQSA 4DHVA 1N56A 3NG8A 5KFMA 4CH0S 4JP8A 3T1AA 2W9CA 1CVJA 2RT3A 3NL0A 4FXDA 1S99A 2MJNA 1Q8LA 2CRLA 2PE8A 1AW0A 4DG1B 2UXDJ 4ANCA 3X1LB 4CH7A 2R2SA 2BOPA 1P8GA 4NA3A 3ZFVA 1EETB 1FF2A 1X5TA 2OUGA 1QE1A 4S0MA 4CLPA 3M8PA 5DQIA 1K9MT 3NNCA 3R2CJ 1VDHA 1G1XA 1XMOF 3J7AN 1Q1KA 1Z1ZA 2WB1D 1QD1A 4X65F 5GAHI 2QA1A 4ZCKA 4U67Q 2YBVA 3DOKA 1Y5IB 4ECTA 5DG7A 4IFYB 2AQ4A 2HNZA 2RF2A 4O4GB 3H2UB 1NK5A 2CDRB 2G0CA 5J2QA 2XMMA 3PNIA 3EYZA 3N6LA 4ED0A 5L46A 2XNRA 5EN1A 3E8OA 4KGKA 4H4MB 5EWEA 3QO9A 1NJIT 3PKMA 1F3VA 1Q53A 2HMIA 5AXMA 3TA1A 1UA0A 4ELVA 4F3OA 1RAJA 5J2QB 2CPZA 2XEXA 3CMQA 2J5AA 2V4JB 1RAAB 1OS5A 4LF6J 4EGLA 4LF6F 5IT9U 3CDUA 2DNMA 1M1GA 3K5NA 3ZZUA 1DTQB 3NS6A 1TVRB 3AODA 3D3BJ 4L75A 3TQEA 3UDLA 3VHQA 2B5JA 2XY7A 2N7CA 2YKQA 5ITHA 3P6YC 1WC0A 5EWGA 1T11A 1PO6A 1GNKA 4LR9A 2BM0A 4O23A 1TUVA 5DQGA 2XY5A 1WDDA 3Q22A 1M5VC 1QTNB 1TVRA 3P5BP 1W7WA 3KOAA 3MHYA 4P10A 3PTWA 1F9HA 2C1EB 1IKXA 1FEHA 4LRFA 1I94F 1RTDB 3DGPA 4FBUA 1IQZA 3LP1A 4P2MA 4I56A 3LANA 3ZTQA 3MTJA 2ZUGA 2HMIB 2NUHA 4MK9A 1SV5A 2ZZNA 5H9FJ 3MMJA 1FT8A 2ZD1B 5KFDA 3F73A 3DLKA 3NCQA 3PEJA 2I38A 4RW7B 2EPIA 3C14A 2MLYA 2VA3A 5KFRA 5L9NA 4W4MA 4P2FA 1RZMA 3HSJA 1EP4A 4XDCA 2W7PA 1YJNS 3NMAA 4DI6A 3CO0P 4ECVA 2DY9A 1FJEB 3C14B 4K4WA 4DR7F 4NCGB 4PPZA 3DKDA 3JTPA 4HI2A 3MAHA 5T7LB 5JJBA 3RB6A 2CPFA 3FBBA 3RB4A 5A76A 1FNMA 4PAAA 5A2QY 3CNQP 5AE1A 4C8KA 2RRAA 1KP6A 1S57A 1Q95G 1S12A 1VS3A 3WX8A 4M94A 2OELA 2K06A 4DCOB 2CWXA 2GJIA 3JSMB 2XCAA 4LSLA 4RPFA 4OI4A 3CIMA 2LMIA 3AH6A 4L74A 4A46A 5C2CA 3J81j 4M5LA 2OPPA 4X2BA 3VGSA 2M8HA 4CT8A 4ZLLA 3CWJA 4HI1A 2VHGA 3T1HJ 2HHQA 2KHDA 4ZVQB 5HQMA 2V4RA 1T9YA 4RZRA 3OJSA 1N5TA 1U45A 1U6FA 2W2MP 5ETMA 2VG6B 1NCLA 2IM2A 4WKYA 2OTLS 2DBBA 3FFIA 1X4AA 3VQSA 4C6AA 1TR0A 1K47A 2YNGA 5J2PB 4P6QA 5CYMB 1YX2A 4DEZA 4YFUA 4JYAJ 2AT1B 4FXVA 3I5AA 4IFVB 4K5RA 4M5HA 4RBTA 3UE2A 1B0PA 1BGXT 3EGVA 5IWAJ 3PIOQ 4KPCA 3CJQA 3IAM9 3OL7A 4KHPJ 1M5KC 2HHPA 2B0GA 1QJHA 3LP0A 3MCOA 4CYUA 3SSRA 3UPFA 3QGPA 3D4JA 3SDEB 4OHWA 3I5BA 4O0IA 2E1PA 1IQTA 3MOJB 3D1OA 1KKHA 2ZH3A 3MCSA 4ZVEA 2WBRA 4B3MJ 4B9NA 3SXLA 3HX9A 3MMCA 4V19X 2HBRB 3OT9A 1LWCA 1HNVA 5CAAA 3A8EA 3SV3A 2QV6A 3CSKA 1HWIA 5IS2A 1UFKA 1SKWA 3M2VA 1HMVA 4YB1P 3DI6B 4EO8A 2XNQA 1U0HB 2NSCA 4DL3A 1NEEA 4J9OA 2O3DA 3O3LA 2LECA 2RNEA 3ILLA 4LF9F 3FBCA 4J9KA 2OMOA 5HVGA 2HS0A 2BE2B 3H5YA 3CMAS 3BKFA 1LWEB 3IAS9 3M8WA 2FHMA 3EXCX 4H4KC 2JEGA 3FEXB 3TP2A 3P8BB 3UNYA 1MMLA 3SMZA 2QJ3A 5K14A 5A8KA 3PCOB 4F4ZA 2GMLA 3E2EA 4J9SA 3GFYA 5E5NA 2MMYA 3SI8A 2KFYA 4JV0A 1NK6A 3UCUP 4CI0B 2V8HA 1UVNA 1JX4A 1S59A 1KONA 1S6OA 2CPJA 1WOOA 3FCWA 4QR2A 2LYVA 3POTB 5EGYA 2DRBA 1HNZJ 2BJ3A 4TY8B 2FZKB 2LVWA 5CZXA 4CLSA 4UQTA 3H5XA 1BC6A 1ZM3A 5D4OA 4GC7A 2YNIB 3UD4P 2Y1LB 3QNWB 3D0GE 2ZDPA 3HULA 3KUEA 2R7OA 4KR0B 2KB2A 4TVAB 5L1JA 2J0SD 1N6QA 1AA1B 3GIMA 2HHXA 1HL6A 1FJGF 2HVHA 2GNKA 2LKZA 1RT2B 2AMCB 2ZOGA 2XTJP 4IO1A 1ZH5A 4DWIA 3ZZPA 1U1QA 3SFGA 3GYNA 2J9CA 3LGMA 4M8LA 4OX8A 5AXNA 3PHEA 2WSFC 1U6BA 2J9DA 1PYTA 2AJ2A 4M5DA 4QW9A 1ZS6A 3Q8YA 4OJ1A 1VI7A 2GFFA 4PYAA 5KG4A 4OZNA 4WK3A 5KFJA 2VG5A 2F4FA 1LQ9A 2FVCA 1YRXA 5A2QU 4JI1J 3DDNA 2KKHA 2QTWA 4G1PA 4EBEA 1CG2A 1WKJA 3DLGB 2YKNA 4XDDA 4MYTA 5DS7A 1VHFA 4A8XA 1K8AT 1HYSB 3CC4S 2VOOA 3QFWA 1JLGA 4YOEA 4USHA 2MQOA 4HDGA 3THPA 2UP1A 1UTAA 4CNZA 2W24A 2X51A 1FRJA 3ISNC 1EIYB 2J8AA 3VAFA 1HQUA 1HBUA 4OYWA 3E01B 1GMWA 3DHXA 3ETOA 1R0AA 4I2PA 4JI3J 1U1KA 3SZ2A 1RXOB 1JJHA 3PW7A 4A48A 2OH2A 5E33A 3EDRB 3W1YC 3CCSS 1RB0A 3IRXB 3US5A 1RBOB 4DV7F 1YLXA 4LBPA 4DV7J 1FRMA 4UW2A 3G9CA 2MLZA 3MMAA 3D68A 5DLGA 2LQJA 4RX6A 4JV1A 2ZD1A 3I96A 4OLPA 4PUOA 1S1UA 4USTA 2O66A 5T41A 3HDSA 4PPDA 4WYLA 3TZXA 3K8WA 4CLFA 4M5JA 4IH7A 5C25A 2DHAA 5IM0A 3OLAA 2PEHA 1NJZA 1KVKA 2N3OA 4FS2A 2KRBA 3QATA 1YJ9S 2EFGA 1OQ3A 5F3ZA 1RT7A 2CIMA 4OYPA 3LAKA 4J9LA 3QJPA 1CLFA 3FGVA 3SSQA 3IXQA 1RAHB 4KV8A 4PYDA 3K5MA 3CCJS 3NBPB 3D6TB 2NXUA 3OHAA 1Q8KA 4OV1A 3JTOA 3I9V9 4TQSA 2DY1A 4R8UA 2RRNA 3H5SA 3IM8A 3OXLA 4KB7A 4MK8A 3GIIA 1TP7A 5L1IA 4CLWA 3HF5A 3ETMA 3KLHB 3JQJA 5KFWA 3RU0A 1R8BA 2VC0A 2HFOA 4ZCMA 4LSNA 3TZZA 1VJQA 2ASYA 3M8PB 4NRUA 2AHOB 3TEHB 5BJRA 1KHWA 4DCPB 1RWKB 4I4BA 1X8DA 3IS9B 2LA6A 3SQGA 1UEUA 1FDNA 2XI2A 3W2VA 5GAEU 4XO0A 4KSEB 4DJBA 3RAXA 1VLOA 1T3OA 3HT0A 1TL1B 4F0KA 2HHHJ 1G2EA 3CCRS 2BR0A 1RYRA 4ED8A 3KDOA 8AT1B 1FI4A 2J7WA 4WFZA 1SQFA 4X4SA 2RKIB 3VQTA 1OWXA 1KHVA 1P27B 5GAEI 2VKZG 5HSPA 3HT3A 2UXCJ 4C4WA 1NBEB 5K20B 1N32J 4J5OA 3I31A 1KLMA 3W66A 1XNQF 2Q43A 5IT4A 2EBGA 1MW7A 1TL3B 2RQKA 4OHZA 2KVQE 4DV1F 4B9SA 2YPZA 2UV8G 3NWRA 2VFUA 4LF4J 4PEOA 1FX4A 3TUIC 2V94A 2MZTA 3T9NA 2ERRA 1NPKA 3M6XA 1UWAA 3RW7A 3MWBA 4LIWA 3GFHA 1SUQB 3EPIA 4HDHA 3AQOA 1P9YA 2Y3YA 4B17A 3EGNA 3MCNA 3SQGB 1U25A 4B3MF 3ZXWA 3CCLS 2DCUB 1T9WA 4LSLB 5F0UA 4HEA9 5KFUA 4AFFA 3DMJB 3NS5A 2CG4A 5A6WA 3W64A 2XZDB 4USIA 3RBDA 2F8MA 3VGUA 1KRPA 1ULRA 3Q8UA 3DN9A 2V34A 3T1YF 2PMWA 4DL6A 1RTJA 4OZ0A 2Q66A 4QIFA 1Y0HA 4ILRA 4RUAA 2VPXB 4NWBA 1SL2A 3FSXA 2YKAA 4Q2LA 1RA6A 2NR0A 1VC5A 3BSAA 3MM5A 3KJVB 2K1RA 3TW0A 3FSIA 2CJQA 2XZWA 2QMWA 4TY8A 5HMXA 3CCQS 3CJSA 2V8GA 3H59A 2Z0GA 1X4FA 4OI3A 4U8VA 2QSFA 2VQEJ 4WXOA 4C3KA 4XPCA 4DS5A 4LF5J 1CC7A 1KQGB 3C16A 2LXFA 4DV1J 3SCKE 1SKRA 2XMKA 4IRDA 5HLFA 2ATCB 1YKWA 4FBTA 4J9MA 2HLUA 4NLGA 3HJFA 2ZBQA 5IC4B 3DDIA 4AT1B 2EWHA 2B8PA 1YIJS 5HK4A 2IM0A 4FYDA 1NZAA 1RHKB 4AD6A 3OXFA 3C16B 4C8YA 4M5DB 5KFEA 2LQ8A 4OFZA 1E6VA 1LW0A 4IRCA 1CC8A 1NM2A 1WF1A 2B56A 2HEKA 4GMKA 5ETVA 4CLYA 4F7VA 4OJHA 3M2VB 4HTIA 1RT1A 3B82A 4DG1A 3RR8A 4XAKA 2HQIA 3I55S 2UXBJ 2F5GA 2H5JB 3DLGA 2PMZD 3GIKA 4DL7A 3OW2R 4NLQA 3T1YJ 1R27B 2M8DB 1OMSA 1RAGB 2OHDA 3ICLA 3L95X 5H9EJ 5F8NA 2EC2A 1Q82T 2KM8B 4Y6IA 1NKEA 1MLAA 3BM7A 1N5YB 2ZZMA 1FE0A 1ZA1B 5IWAF 4F4AA 3M2UB 1JNRB 4USWA 4XK8C 1Y5NB 2HZCA 2IVYA 3HKZD 3OXGA 2DR5A 1S4FA 4Z2XA 3VGTA 1M1HA 4BLGA 1HLWA 5LXRA 2E5LF 1VQ6S 1TAUA 2R7VA 2HFNA 3EZ5A 1FDBA 2E5GA 3LPYA 5AE3A 4IOCQ 1FVSA 1HWLA 4Y2KA 4GKKJ 3N79A 2BJ1A 2JJ4D 1IVZA 2ADBA 1GAOA 3M30B 1KQSR 1IKVA 3BR8A 1EKSA 3GFZA 5T14A 5D0EA 2W7AA 4O3SA 4O3RA 2AX0A 4PWDA 1X5OA 1WHWA 4DR2F 3CDEA 3CCES 4J37A 1DY3A 1EQ0A 2WSEC 2K2PA 2HFSA 2XWXA 5MAOA 3PV8A 4IFYA 1R3NA 4CT9A 2X1GA 1S0NA 1HNVB 3C46A 3A13A 1IKVB 2VUGA 2YNHA 3TX8A 4R0JA 3ZZ0A 2OFHX 2FHKA 2PD1A 3C6TB 2JLGA 4DSFA 1LFWA 3QSYB 3BYRA 3OUYA 1EKRA 3MMBB 1BHNA 2ACYA 1HBNA 5KG1A 3RRHA 3LF0A 4O3NA 3QAUA 4MFBA 2V9KA 3KNGA 4TKTA 4DPTA 4QPXA 5KFQA 1VQLS 4B3TJ 5DZ6A 1MG7A 4NI2A 3TJ8A 3NOGA 3I9ZA 1CULB 5E3AA 3CJRA 2DNGA 2FC9A 4DU7A 2ABYA 4PR6A 2JWNA 3W2WA 1XMQJ 2DR7A 2AF6A 4M5IA 2R8HA 4YR3A 1PYOB 1NMEB 2ILZA 2LEAA 2XM3A 2ZH6A 1NSPA 2OD4A 2MKJA 3GIRA 1JLQB 2YY3A 2RDDA 3U7JA 4GKKF 2JC0A 4D3HA 2ASJA 2I2YA 4B9UA 3GZ7A 2X1BA 3MM7A 4Y2MA 2M7SA 3GB0A 2WTFA 3W9IA 3MR2A 3J81U 1KOHA 1YVFA 3GONA 2KHCA 4URGA 3BQ2A 5IV4A 2DJWA 4Y3CA 1ZTTA 1PBAA 3C6TA 2P9GA 2IAJA 2R7UA 1NJYA 2XS7A 5C2GA 1S48A 1FTCA 4LSZB 3PO4A 2DH8A 4ITSA 2E7XA 1VMBA 2J7UA 4QQBA 3M6WA 4IR9A 2ZEJA 2DHHA 3E51A 3M7VA 3K0JA 2Z30B 3GFXA 2FJAB 1CJUA 3J7ZT 3OTOF 4ED3A 2M5YA 1N52B 2CWKA 4DX7A 4DL5A 4FF2A 3FRYA 1Q0NA 1OIAA 2GAHC 1HWKA 4R0EA 4OYOA 2M2BA 2VJVA 4EU0A 1RCXB 1GTEA 1RAEB 1SUQA 2JVOA 4P73A 2DGSA 4CZCA 1HQEA 4Q44A 2UVVA 5A8WB 3GJRB 1S1TA 3OL6A 2XMTA 1HKAA 1WJ9A 1IN0A 1F2HA 3BREA 2F8EX 2W7OA 2LDYA 3N28A 4LRCA 2YQ1A 4QPTA 4X62F 4DV0F 1PBUA 2JEJA 2EXUA 2PA3A 4ER8A 4U7UD 4CO1A 5J2PA 1VJWA 4EUVA 1NK7A 1FRLA 5HN0A 1NK8A 4DV4J 1VGYA 3RAQA 3N0VA 1LNQA 3PHTA 2X1AA 1HNWJ 2AJ1A 4MYUA 3JXOA 1FD8A 4NLPA 5HJXA 3QJJA 4C11A 4PQAA 1EP4B 3FUYA 2OSRA 3DRPB 2L3MA 3M05A 5CABA 5DDQC 2ZM6J 1FKAF 3HO1A 4NA1A 4KC5A 1M0SA 2QT7A 3B4DA 3RUBL 5CH7B 3D0HE 3FK4A 1JKHB 2V63A 3OR1B 1SJ1A 1IKWA 4TYAA 5GADI 2M52A 3BDEA 3KWMA 4RBVA 2G4BA 1OSCA 2AZ3A 2NXNA 2QA4S 2R9LA 1J27A 3R27A 5CYQB 3KK3B 1CJKA 3F44A 4CLLA 1FESA 3OR2B 3G71S 2NPFA 2B51A 2RQCA 4IRKA 3NP5A 1TL3A 1MMNA 3KG4A 2DXFA 2OPPB 4IUFA 2YKMA 3HD2A 2GO8A 3JSBA 3OVBA 3NAIA 2V8PA 4HH1A 2L9DA 2DKOB 4C97A 4JYAF 3CJ0A 3FZBA 5K8PA 2DGVA 3PJWA 3HHEA 4PKDB 3TX0A 3P45B 4RUBA 2ZM6F 1MROB 3H5UA 3VVUA 4EWTA 3BN4A 3QGGA 4DPOA 1RBAA 1D8YA 2GAGC 2YQ0A 2Z2ZA 3L9ZA 2MZ1A 4DV2J 1QAYA 3PX0A 5EX3A 1WORA 2GA7A 3DLHA 5LSOA 4ETZA 4HKQA 4UF4A 4N5SA 1HNIB 2Z8QA 4HLBA 1H0HB 2DCLA 4LF9J 2BDPA 3RZAA 4X62J 1VLYA 1UW9A 2B3TB 4PG6A 1UPPA 2HFUA 3G8SA 4DV0J 4OHVA 1WOPA 2F1FA 4ID8A 4OYZA 4USJC 3AQPA 3NMRA 5IT9Y 1HW8A 1NPRA 3MEDB 4KGZB 4YMEA 2MQQA 3TUZC 2PT0A 2W2NP 2NXEA 5HQ8A 4DR3J 3F41A 3T5LA 2JSXA 1WG4A 1XR7A 2COLA 1UWBA 2ACMA 3NGDA 3G82A 4LMZA 3DLEA 1U8SA 2DO4A 4BWJA 3RRGA 3MEGA 5J2MB 4ZVSB 3SYZA 3LALA 4LR8A 3K7RA 1PKUA 1ZM4A 2OPSA 3AXKA 4RNOA 5KFAA 1U0HA 2K3IA 1GFWB 2D69A 1IR1A 2NZCA 3DLEB 3B78A 1C2PA 2GHVC 2UUAF 1MWYA 3WX4A 2DR6A 2GZOA 1IBLJ 5DZ7A 3TAPA 1PSDA 2AEFA 3M32B 2XS2A 2ZBCA 2VG7B 4ZP9A 3KLIB 3CCMS 1RWMB 3T1HF 4J90A 1OYDA 1O0PA 2OI2A 4KHMA 5ETSA 1UVIA 2CNKB 3NY0A 1LOUA 3OTDA 2HWHA 4BCAA 1KTVA 1SH0A 3FRZA 3MECA 2BQUA 1UPMB 3AHPA 3CD6S 1T9UA 3GCXP 4F0HA 4KHRA 2R7TA 4NRTA 2XB2D 1HR0J 1ACMB 4D3GA 3MMAB 3MAAB 1C0UB 1TKZB 2ZZTA 5IFMA 3CD7A 4Y0FA 4ED6A 3KMQA 5D4NA 3VF0B 1JLGB 2V9WA 3PZPA 2KFZA 4YUDA 2HIQA 1C0TA 1FKPA 4IOAQ 5JVGQ 3Q8VA 3QIPA 5MLCV 1ITPA 3C66A 4RL1A 2QYCA 2C2NA 1RLDA 1EQMA 1HQUB 2IDEA 4A4JA 4CTAB 1OY9A 1U2CA 2N7YA 3H4BA 1C0UA 1UAWA 5KFZA 1RT5A 2ROPA 1YJWS 4P2XA 3OTOJ 3K8VA 3M30A 4O4GA 4CM0A 2E5HA 4KT0C 3CDBA 5ETTA 3UVJB 4I0WA 1SQEA 4KV8B 3N6MA 2FVSA 1KS2A 1B3TA 2J0QD 4U6PA 3EWGA 3T5HA 3Q8QB 1Q79A 1QLNA 1F5BA 1YZ6A 4I6YA 3J7A1 1CPZA 2VFRA 3DOMA 2J0WA 3HHLA 3IFEA 3UN2A 4LF7J 1S6UA 1JXVA 5AJ3J 2CQHA 1NRKA 3MM9B 1SIZA 2RHQB 2HNYA 2DGXA 5C25B 4R5PB 5H1SV 3RR7A 2XMVA 1N5QA 2G2YA 2QA2A 2VFVA 3CD5A 3EZUA 3HLUA 4J9VA 4HH0A 4CLUA 4OZ2A 3J7Z5 2BMBA 1DRZA 1TFWA 2W9CB 3IRXA 1HNXF 2OTJS 1PC4A 4C98A 4YN3B 1N36F 2EG1A 4ZPWR 4Q45A 2YX7A 2P6SA 3SSSA 1B64A 3U1LA 2GO9A 4FF4A 4NMLA 4KGMA 4NXNJ 4M5GA 2XZTB 2EK6A 4ZITA 1TUWA 3D3CJ 3H2VE 1NSQA 1NLKL 3QLHB 4B3TF 1TELA 1H73A 5KG7A 1IKXB 2BJDA 3BSNA 3OLBA 3ELHA 2DHXA 2D7SA 3FQLA 4HVZA 5L1LA 2V4QA 3DGPB 1DAXA 3DU5A 4WKRA 2EBEA 1P9QC 1L3TA 2RHSB 4JV5F 4ECYA 1ZZNA 2C2MB 1SJQA 3V2UC 3HHKA 4U7CA 3LWLA 4ZLJA 1WC1A 2GQQA 4ZPBA 3ILOA 4K4XA 3HVWA 2W01A 1HR0F 2UU9J 3WZ0A 4KE5A 4WFYA 2B4UA 3PRVA 3PX4A 1VIOA 2G9OA 5A0YA 3JYTB 1UP1A 2UZAA 2RE1A 3X3UA 1U4BA 4QOTA 1V3RA 5EX0A 4PCQA 2FVPA 1TFYA 3LPEA 3QWPA 4LR7A 4GKJF 1TKDA 2R8IA 3KFWX 4WTOB 1S9GB 1SJRA 2DH9A 4EBCA 2FJVA 2VASA 2CQBA 4LSNB 3C6UB 3D0IE 1R43A 4V1Ak 1TK8A 2MKCA 1BD6A 4ZCLA 1HQEB 3ZZOA 3MPDA 3AXMA 5E41A 3VV2B 4WFXA 1RE1B 1WC4A 1RTJB 3MPYA 5D0RA 3OVAA 2OJ3A 3I87A 5U47A 4USUA 2ALZA 3NAHA 2LA4A 2JZ5A 1T94A 2X3GA 2AJ0A 3FCVA 4OHXA 4LFAF 4FF1A 1GQEA 2WONB 2PA8D 1VFJA 4BBYA 4GRSA 2J76E 2RIJA 3LH2S 5GVQA 4EFAC 1YTYA 1DARA 1X5PA 1RT6A 2E7VA 2PDAA 4U9RA 4B02A 2PI4A 3TVYA 4KHPF 3V6JA 1DLOA 2UXBF 4H54A 5M2RA 1VRUB 4KY3A 3IR7B 3FFIB 4ENOA 3A3NB 1FK9A 1RTIA 3VTIA 1SV5B 2CAJA 1RHJB 2B7BB 3QSIA 2C22A 2Z57B 1GMVA 1TV6A 1QSYA 3R5AA 4BS2A 2X7IA 2IMWP 5D4LA 2R7RA 4JI6J 1WTBA 1IKWB 3AJ2A 4JI2J 3ILIA 3GILA 1U48A 1VRUA 1SJ3P 4OI0A 3K5OA 3BV8A 2DGUA 2NYIA 3TZWA 2EFVA 2HZAA 5EDWA 4AXJA 3KJVA 5E2QA 1XNQJ 1TV6B 2B6AB 1LW2A 2YNFA 2NSBA 2G2OA 2VICA 1H2TZ 2QLXA 5KFGA 5IXUA 4YB5A 1D0EA 2J6UA 1TZ0A 3EXYA 1OO0B 4URSA 4JI6F 2HVEA 4WU3A 3R7NB 5HMWA 2RQMA 2DR9A 2B9XA 2FGOA 1VRQC 4ICLA 1FVQA 1E6YA 1Q7LB 3M8QA 3ZZZA 4XPEA 2FY1A 4ECRA 3GQCA 4DV6F 2YVSA 3W8PA 1OQ6A 2YNFB 1LK5A 1FRIA 4L73A 3M32A 4ZVUB 3KLIA 3W62A 3TAQA 3BO2A 1FK9B 1ZM9A 3DRRA 2NLWA 1RWPB 3Q23A 1WELA 3DRSA 4CNYA 3KLGA 1UFWA 2IRYA 3FZ2A 2AW0A 4O4RA 4PG5A 3MXHP 5IQQA 3BH6B 2AD9A 4QWDA 3K58A 2GVZA 5CD4A 4F02A 4OZLA 1XN9A 2HNDB 1I51B 1RWXB 2RU3A 1IKYB 1RWVB 2RILA 4ZS6A 3VCDA 1IXKA 3AD7C 4P75A 1UJ5A 1FERA 2RF2B 1H7XA 1VBXA 3GV5B 3THTA 4ZMMA 4TLQA 1A9NB 3PFOA 4YEAA 2MQ8A 2ZJRQ 2KTQA 5A8RA 4RUCA 1S1WA 2IA0A 1VIXA 2U2FA 4ZPVR 1MSWD 2DD8S 4L6V3 1O8BA 2KL8A 3NGRA 3BGRA 3I4PA 4A8OA 3IBFB 4WPAA 4ZP8A 2BJ9A 2HQCA 3DOLA 3WIUA 2BRLA 1VYAA 1HD0A 4I6AA 4N47A 4FYVB 3EDQB 3TVKA 2CNOB 2OD6A 3GLJA 3WQPA 2XLIA 1WEZA 1S1WB 1WKKA 2LLZA 4USKA 1Q7YT 3CDAA 1U02A 3DRRB 2IM1A 1UJ4A 2GJ2A 3NGTA 3TARA 2IIHA 3DOMB 1QVGR 4MFBB 1KTQA 3UR0A 5DQHA 1U1LA 4G3IA 4NA2A 3D1HA 5D8HB 2FDNA 2Z2LA 3BPDA 2R3VA 3SEOA 1YDLA 2HWIA 3IG1B 4NLOA 5DGBA 2XS5A 2KG0A 1GH8A 3GWCA 2Y1IA 3TA2A 2J6TA 4DR7J 2N4DA 1LXNA 2C2OB 3M2UA 1Q4RA 1BQXA 2LU1A 1MU2B 3KK1B 3V6HA 1XC9A 4B3SJ 2W2QP 3CEDA 2ZH2A 1S1VA 2BZ2A 4CM2A 1CJVB 3L09A 5I4MA 3MFIA 4UQGA 1TKXB 2XHWA 5F8MA 2MY8A 2XYHB 1AFIA 1SCJB 2OEKA 5A8KB 1ROFA 2V2VA 1YBUA 1CQNA 1H74A 3MDFA 5I42B 2ZH7A 3HHNB 2AJQA 4WTYA 2HVZA 2K8GA 3T3FA 1FWLA 2ZH4A 4NXMF 2G1HA 4DUZJ 1GXUA 5E3QA 1S1VB 3NRBA 3QLHA 1MN7A 3D5MA 4HR2A 3UO0A 3UDVA 1J5EF 3AT1B 2ZNYA 4ANDA 4ZVTB 3NNAA 3DYAA 3A8IA 5C42A 5D77A 4DXLA 4DLGA 1BQNB 3R5BA 3J7YI 4IOBA 4NLSA 3R5DA 4U96A 1XMOJ 1VQ8S 2FPHX 2RUGA 2YKNB 2OMLA 1URRA 4CLTA 4PWUA 1DFDA 2Q79A 3AB2B 2AU0A 4DQIA 1DTTB 3MGJA 3MURP 3TI0A 4CO2A 2JNJA 2MY7A 1RGVA 2YWWA 5DJBA 2A18A 3R8YA 4JI0J 4TYBA 4CLKA 1F2GA 1P1TA 1N34J 4X64F 1XNRF 3M4XA 4QBUA 1R6VA 2DITA 2GHPA 2VKRA 2LQ9A 2ZITA 1J5OA 2EFOA 4A8QA 2UVWA 3M2RA 4NYPA 2GV1A 4NXNF 3P96A 3T19A 2V69A 1HNZF 2VG7A 5KFOA 2PGCA 2WSCC 5KFSA 1DQ9A 1T9TA 3L7PA 3LA0A 5LL6d 2L41A 1BQMB 1RT3A 1XR6A 2GVDB 2IJRA 1WD6A 1FNXH 4B9LA 3A3OB 1DQ8A 2I0XA 4PABA 4RW9A 2KO1A 4ECXA 2CUYA 2K7JA 5C42B 4C3MA 2DNLA 4DR2J 3CE8A 1JB0C 1IBMJ 1VCTA 2DXDA 3OSNA 1FRHA 5J1NA 1RLCL 3AAWB 2R2TA 2DNKA 1HA1A 1U09A 2ZKTA 1YRTA 2ZJPQ 4RW9B 4JI4J 2WOMB 2CPYA 1YRUA 2UV8A 4CLZA 2GW8A 3GJTB 1YZ7A 2G1DA 2DEJA 2C28A 2PN6A 2KRRA 4RKUC 2IMOA 4EBDA 2HBZB 3GU0A 3ISND 2H5EA 4KRWA 1S1XB 4ZLNA 2D3O1 1W2BR 1VBYA 2J7KA 3K5LA 4UY8T 2DHGA 3SDEA 1KOOA 2ROEA 3DGVA 3PYEA 1X5SA 3TUPA 5RUBA 3NKYA 4NCGA 2DHSA 2UXDF 3BR9A 2HYIB 1X0PA 4UOGA 4C9DA 3DRPA 1XQIA 4LRBA 4Q5VA 3Q83A 1M1KT 1DTQA 3FSYA 3ZTRA 2R8KA 3JAMY 3OTCA 2UVUA 4FKXA 4KFBA 2I5JB 5J1EB 3J80Y 3M9NB 4JV2A 3LO3A 4V19J 4F36A 1V3ZA 3VZHA 3KUHA 1S9GA 2DGWA 4OJ3A 5D15A 1TL1A 2FY8A 1NHKL 5CYQA 3OL9A 4LBIA 3KLFB 3TANA 4DS4A 3Q2TC 1RUSA 2DRAA 1FJ7A 1WEXA 5C24B 1MWZA 1QUVA 1ZM2A 3CJ3A 3TAMA 4YQWA 4AYBD 1HBMB 2AEJA 2IVFB 2GX8A 1WC3A 2RS8A 4YY3J 3RBZA 4UZBA 5FLXY 1S1XA 1NHUA 1KNZA 3D9BA 5ETQA 2FJDB 3DXBA 1I3OB 2HZVA 2V8VA 3CCUS 2WVDA 4NLRA 4NYZA 4HHJA 4CH1A 3D7SB 4B3SF 2BXJA 4LF5F 3FNNA 3IWLA 2ZOMA 2HNDA 1N33J 2R7QA 2GQCA 2VBYA 1F1BB 2FJBB 3WIVA 1T3NA 2XCPA 4FVCA 4ETXA 2MYFA 3FBFA 5GMEA 1FXDA 2ZHBA 3KLVA 6AT1B 4JI7F 1CS4A 1TL4A 2VPWB 4ZCIA 1TKTB 2E5LJ 4K0KJ 3M9OB 1BXNA 1U47A 2RKIA 1RHMB 4P74A 3IRWP 5EHHA 3LP2A 3KJQB 4LREA 5KT2A 3M1VB 4FYYB 3EICA 2KDOA 3HVTB 4AL7A 4NL5A 5L39A 2EFNA 3GG0A 1MROA 5F41A 1SL0A 4KJIA 1ZPVA 2RU9A 4G1QA 3TO8A 3D28A 4OYIA 3S01A 3WHIA 3KLEA 1YJRA 3D67A 4NLTA 1UKUA 3TWZA 4WFAQ 1D09B 4KKOB 4B9VA 4MMOA 4DV5J 2IY5B 4F4YA 1XIQA 2Z4PA 3F56A 3PJXA 5KFIA 5IC6B 3MR7A 2F3JA 2XSJB 3UD5A 2L9NA 3FQKA 3ZNJ1 2DPIA 1SVDA 4N41A 3D1QA 1K1QA 1XK8A 2KT3A 1JLAB 1FEEA 2ZE2A 1HNWF 1T7PA 2OLWA 4LRAA 4RNHA 2DGOA 4URQU 5HL7Q 1FRKA 2RS2A 2DH7A 1C0TB 1FKPB 3KUGA 2D9OA 1N32F 2XSJA 2I6WA 1W25A 2UUTA 4RW8A 2E7WA 3GV7B 4I6WA 5HQLA 1W26A 4Q43A 2JEIA 1ZETA 4QYZK 1N8RT 2HSEB 2XMWA 4HT5A 4ZJOA 3ULHA 5KT5A 3JQMA 1UZHA 2D9PA 3R7BB 4PZVA 5FD1A 4X4PA 3K57A 3D6FB 1QE1B 1U1PA 3TZYA 2EKNA 1X9MA 5F8GA 2HG4A 5LM7E 5E3PA 1BQNA 1WNEA 2WVEA 3C8YA 4ZPCA 4MJKA 4O3PA 3RYLA 2EFPA 2APOA 4DL2A 2QSWA 3CVKA 2FLNA 2MB0B 1R8HA 4J7CA 4LBHA 4OYXA 3SCJE 2DO0A 3MMCB 3UCZP 1K44A 3U1MA 1WSRA 5AXKA 1RT7B 1L5UA 4NCBA 2DEIA 4B3RJ 1GT8A 4NLDA 2WVFA 3EZOA 2JDJA 2YQ3A 2DIVA 1CQMA 4WJBA 4U8YA 4GC6A 1S4EA 2FLPA 1JIHA 3GPAA 3QIDA 2VBWA 2DNQA 4JB8B 4N77A 5BR8F 1HYSA 4XIUA 1UEKA 2ZH1A 4WE1A 4CQ1A 4R8UB 2Q3PA 2ZBPA 3KG1A 1D1UA 2Y8WA 4X65J 4OX9F 3M9MB 5E7OB 2IHR1 1NJWA 1RT4B 1U0SA 1LXJA 2B43A 1FO1A 2MDAA 4DX5A 3OHBA 1NDCA 2MHNA 2KFNA 4Y2CA 4WYWA 5BYRA 1SQGA 2O5DA 3EGWB 3MM6B 3CIZA 4ES1A 4JI8J 3GE9A 1Z2ZA 4NI2B 1CJTA 3TEGA 2CVIA 1V9OA 3OBIA 2JEFA 1TKXA 2DXEA 2RVJA 1S0MA 3O1LA 1UETA 1IM4A 1Y5LB 3EPGA 4DUYJ 1IKYA 2XWYA 2FJEB 1HWJA 4F4WA 2ZHAA 1YWXA 1SC3B 3DC2A 4WU2A 4ZA1A 2H65B 3VVTA 1SH2A 1PAUB 2YNHB 1T03B 1S6QA 2PFDA 3LWMA 1JLQA 5D0GA 4WCEQ 2D1CA 2XULA 2I8EA 2CQ0A 3N5FA 1HBNB 2W4PA 3A4TA 4NZ7A 5K5MA 2X1FA 3PYGA 3K17A 3UD3P 4WK1A 3CUNA 3AY0A 4EZ6A 1W2IA 3A3PB 4FKYA 4Z7CA 1S6QB 1CULA 1HHQA 3GR1A 3HJVA 4G6VB 4CO3A 2AWZA 4ZIVA 5B0DA 4K4TA 4WF9Q 4CDIA 4FNIA 2UU9F 1YJTA 3Q2SC 3N5BA 2JLFA 3PRBA 3TYTA 4B3OA 4QWAA 1VQ9S 2EW9A 5AT1B 3G6XA 3CPWR 4B9MA 4Z37A 5K8NA 2EKYA 4F2SA 2EFQA 4KFBB 4ZDNA 3NOCA 4PXDA 1EAYC 3M2RB 4AQYF 1JQGA 2CNLB 4JI1F 1G4CA 3R7SB 2B4VA 1SI9A 4IG0B 1PIEA 3NWGA 3E01A 4PG4A 2CVEA 2XSFA 4WP9A 5AXLA 4F04B 3VAJA 2OIHA 2E44A 2P8IA 3G6YA 2HIYA 2AV5A 1BWEA 3CJ5A 3N9UC 3N6NA 1SPBP 1GEHA 3ADAC 2FLLA 2HGMA 3FJ2A 4NOHA 2CQCA 3LOUA 4X66F 3QT6A 2HHUA 1X31C 4K2JA 1NH7A 3MM5B 2QLJB 4JI8F 4X4UA 3FVYA 3HZGA 3PFEA 1XMBA 2QYGA 1S9EB 4N7TA 2DK2A 3GJSB 2F9JA 1C1BA 3MPWA 4DDFA 3DLJA 4NPOA 2HHTA 2JLEA 2DNZA 2BV3A 2QN6B 3BZQA 1XWLA 5AJ3F 1KLMB 1KVIA 3PDNA 1ZYQA 2Q6BA 4AL6A 4ECZA 3M8YA 4IDKB 5KT3A 4IR1A 2HAFA 4UOHA 2F8HA 2RUSA 4EO6A 1HQ2A 4DPXA 3Q8PB 1WUUA 3W7BA 1ZAVA 2I1RA 4G65A 5IZHA 3HVAA 4DPUA 5A6PA 2PI5A 4BC9A 5F8LA 1RTHB 1E6YB 1RP5A 3BGFA 1YBTA 1KR4A 3M8QB 2R8GA 2HAIA 3HM9A 2YH1A 2GGPB 1F5CA 5KT7A 2C2RA 2BE9B 3V81B 1AUSL 4RBUA 4ZP6A 5B0GA 2CQGA 1RT1B 2HFVA 3S6EA 5DM6Q 3H40A 4ED1A 2O67A 2GQ2A 3DNCA 3ET6A 3IGNA 4RW4A 3WDOA 4NLVA 1UVLA 3HFVA 2E66A 3KJFB 3MAQA 1V5VA 2DT9A 3CGIA 4IQMA 3DCAA 3O5TB 4ZP7A 1JXLA 2YWKA 1BWVA 2CA9A 4Q0BB 2PO4A 3M8RA 4QYZJ 2BKPA 4NX9A 5C5JA 5GMKa 2ZE2B 3EVMA 1DHMA 1Q8BA 3U1NA 2HGNA 2H3EB 4CYUB 1S10A 4DZDA 4PXBA 1M5SA 4P71A 4JUZA 2CZVC 1B0TA 2H54B 3RBEA 5I3UA 1IBKF 4NYOA 3HSZA 4C8ZA 2W2PP 4H4OB 1NHVA 1R6YA 2MKIA 2QO3A 2HQ3A 2VD3A 2MSSA 2YWFA 3GG1A 4DR5F 5HLFB 2CQPA 3K89A 3MZIA 3Q24A 1KD1T 1CS4B 4ES2A 1SBRA 2GJFA 1ZAXA 3POTA 3QBCA 4J9NA 5THWA 1VQPS 3CC7S 2B9WA 3PACA 2D3UA 3UNGC 4DFPA 2CPHA 5FJ4A 4LF4F 1YGYA 4OQJA 1O51A 4NCAA 2VG6A 3MEGB 5J2MA 2HHWA 2BE7D 2O1PA 5E3CA 1TK0A 1WKLA 3H98A 4MK7A 4H4KA 3MPUB 6FD1A 2AGQA 2G0JA 5K14B 3W5XA 3TR5A 2RJZA 4GO5X 2YNGB 1RKIA 3BH7B 2PEBA 3DRSB 4O44A 1PAEX 1SXLA 4E98A 3GCWP 3S1TA 3KLGB 3HFZB 1U1RA 3M6VA 1VHIA 3NLCA 3GIJA 3V5RA 4BHQA 2IBKA 3TAMB 3FKBA 2H9ZA 3IBCB 4NLXA 1BUXA 3CCZA 1CSJA 4M95A 1Z4UA 4KTQA
chains in the Genus database with same CATH topology
2WAQD 3BGLA 3MEEB 5I42A 5KFLA 4Q7AA 2F4VF 1YJVA 2JOQA 2HRUA 1JLEA 2FLOA 2YX4A 3BSCA 2XGPA 2NQPA 2Z2MA 4ZHRA 2QEXS 1ZOTA 2RSQA 3KKFA 1UA1A 3MM7B 5IT0A 2HS3A 2CQ1A 2HNZB 2R8IA 5LMUF 1JLCB 2VA2A 4C7QA 3MEDA 4I2PB 2IC3B 3VALA 3R1LA 3SCLE 3KK2B 1FCAA 2GMHA 3UR3C 3G96A 1S6PA 4F3MA 4YB7A 5LSLA 2BYCA 4Y34A 4M63A 1FXLA 3K5PA 2BQRA 4F4XA 2ILYA 4CO0A 4HTJA 2AP6A 1O5JA 2LXUA 2BACA 4ECQA 4PUOB 4ERDA 3VR1A 2UUCF 5F3TA 4OJGA 2VOPA 1HBUB 1BLUA 5FDLA 4DSKA 1WI8A 2B5JB 2Q1LA 4PQUA 2FGCA 1WEYA 2XLJA 1RYSA 4JOUA 5KT6A 5CQGA 1JLBA 4DSIA 3QIPB 3R1HA 3CDWA 5JXSA 4KQZA 1SKSA 4B9TA 2VB6A 1JNZB 2A2DA 2GIRA 2NREA 4I67A 1KVJA 4RW6A 3CO9A 4JBCA 2VODA 1WF0A 4ILLA 3KHGA 3S8SA 2OPRB 4DBQA 2HS4A 2KT2A 3N01A 4TY9A 3WC0A 4F26A 2D3ZA 3VAKA 1TKZA 4OL8A 2LXIA 4A8YA 3H4DA 2FJWA 1UEVA 3PKYA 1RI7A 3IR5B 1U2FA 1Y4ZB 2IM3A 1T8EA 5L38A 2P9EA 5K8MA 4ECSA 5BYSA 1DZ5A 1OSDA 1RT5B 3CTRA 4LVNP 3GSDA 4QWCA 7FDRA 1HPZB 2FTRA 2ZBIA 2OP5A 2L9WA 4MIAA 4OZ1A 4LFBF 3CC2S 4K4UA 5A8WA 1B0VA 3HI9A 1ZTWA 2NPIA 2BA9A 2CJBA 3QYYA 1C1CB 1VQ7S 3PY8A 4RUHA 5KFKA 4MKYA 3DM2A 3W2VB 2CJ9A 1V6HA 4A48A 2V9WA 1KFDA 1Y3JA 3AA8A 4Y2IA 4G3IA 4MIWA 2EVZA 4EZ9A 3HHDA 2QZ8A 3SFUA 3CD0A 4GO7X 4KBIA 3PR5B 2UUBF 4LUBA 3HP6A 2GC8A 2WHOA 3IWXA 4WFBQ 3C2PA 4C11B 3BO3A 1U1MA 2AJ4A 1RWUA 5ADZA 5GAGU 5LJ3Y 1DURA 3R5CA 4DSLA 1G7CB 2ZC3A 3JB9k 1VOMA 2D3OR 4JI5F 3NCRA 4ZPAA 3JTNA 3MUMP 3M6UA 4EEYA 2DISA 2DNOA 3QAEA 2GHWA 5KFBA 3QJLA 1D9AA 4C8MA 2HGLA 2AJFE 2LU2A 3HKWA 5KOWA 1HHTP 2KU7A 2UUWA 2AGPA 1ELOA 3BN7A 1Q86T 2ZKUA 3T6BA 4C8LA 1M90T 3EX7B 2WRMA 4DN9A 4LQ9A 4DQPA 1Q78A 1HMVB 5KAKA 1R8CA 2CPDA 5HBMB 2VQFF 5L9XA 5DM7Q 2R7WA 1GXLA 4QIVA 3VAMA 3VZIA 4Y2AA 3RRKA 3DRYA 1D9DA 1H2UX 2R2RA 2ZJQQ 2BJEA 2M9KA 1M5HA 1XEZA 2KN4A 1YBAA 3LGNA 2CQIA 2ADCA 1OPZA 1H3DA 2RH3A 5KFFA 3K59A 3W3SA 2RD5C 2VH7A 4K4VA 1SIWB 1H7WA 4I7FA 4KKOA 5B0FA 2BQ3A 4BDPA 5JVHQ 3CXCR 4ZVGA 1XERA 1LW2B 4DQRA 5M2UA 3T1HF 1S7HA 4KAIA 4ZHRB 1C1BB 3BQ0A 2DPJA 1N0UA 2R7TA 2DNPA 3O44A 2AYGA 3HVRA 5J2NB 2HLTA 5CCMA 4QZVB 2IC3A 1IUJA 4ECUA 2M88A 1L3VA 4OI1A 3QWUA 1NNDA 3KK3A 1YJUA 3BQ1A 4OMFG 1WACA 3AA9A 2HPUA 3DMJA 4QR1A 2MKKA 1RISA 5KFVA 3KLEB 3GV8B 4DV3F 4A8WA 5CZVA 4FS1A 3TQ1A 4RWWA 4WE1B 1NK9A 2MZRA 3TA0A 4ED7A 3JSMA 1DBDA 5G0RA 4DV2F 4OIXA 2KVIA 2VQEF 1RT4A 3PXGa 1FJCA 3DLBA 2POKA 4YDDB 4ZOSA 1F60B 2FD2A 3BS9A 3PW5A 1S79A 3TRGA 4W90B 4O44B 3UDCA 6FDRA 1NO8A 1Y7PA 3MOZA 2CYYA 1KEKA 4LF8F 5KTQA 2BW2A 5J2NA 3OUYB 2DIUA 2I9SA 2W4DA 1AFJA 3B4MA 1NH8A 3T6JA 4OHYA 1FD2A 1U1NA 3DFEA 1T03A 2IYIA 5K9FA 1WTFA 4K59A 1JMTA 2FHJA 2IRUA 2LEBA 1JK9B 3FEYB 1Z2LA 2R2UA 1Q81T 2PFFB 2MZSA 5GADU 3ISZA 5KFHA 1VC6A 1RK8A 2ZNZA 2F7VA 1E6VB 1WG5A 4CO4A 2B7CB 1N6QB 4DOZA 1YSJA 2JFKA 2E9ZA 2DNHA 1QUPA 1RKJA 4B08A 4HYKA 1HI0P 3P49B 1L3KA 5KG6A 5BYQA 2PC6A 1H98A 2ZC4A 3I0RA 1U24A 2JVRA 2OPQB 4LJMA 3H2LA 4DV4F 5FIIA 1YG0A 2E1CA 2R8JA 1FNOA 5KFYA 1HPZA 2O01C 5KG0A 4JI3F 5DO2A 4DR4F 1N88A 4PWDB 3NBPA 2JHEA 2XLKA 4K50A 2V8DA 5M2PA 4H4MA 3N4WA 2VONA 3TVZA 3U27A 5DG9A 5HP1B 4BWMA 2HW3A 4DL4A 1N48A 2RB7A 4A47A 5B0BA 4DSEA 2NZ4A 3DDKA 3DOKB 4PG7A 3RAMA 1Q16B 5DRKA 4U7UK 3G6ES 1VQKS 5I3QA 1WHXA 4ZPDA 1QAJA 4ALZA 2ASLA 2BVZA 3NNHA 2AYBA 2FVRA 1HWUA 1FE4A 3V4MA 4AXIA 2IJNA 1H6KX 1KQKA 4DN0A 4RNMA 1L3SA 3BO4A 3OFHA 2YNIA 2WK4A 3T9ZA 2AGOA 2EK1A 3L3CA 4RNNA 1WF2A 4RWXA 3G6VA 2DTJA 3V6DA 1K73T 7FD1A 1J5OB 3CCTA 2QLWA 2KT5A 3IBWA 4FPRA 1YQHA 3GYXB 5SZTA 4QR0A 3CULA 1N5VA 1MMDA 3FDSA 3DYAB 4F3QA 5HO4A 2G13A 2ZOFA 3LP1B 3VAGA 2XO7A 1U7LA 1H2VZ 4LF7F 2E29A 2EI5A 2C3UA 3HHLB 1KN6A 4Q2MA 2N4CA 1JKHA 2FC8A 4MIBA 3KTQA 2VPZB 3UI3A 1S77D 1JWWA 2FUG9 2VG5B 1Y3KA 2RRBA 3DHWC 2FB0A 4RLEA 3CJKA 3QZ8A 3T5KA 5FDLB 1T95A 4CIOA 4B3RF 4YR2A 1A7GE 3DU6A 1GTHA 3OTEA 4MKBA 3I56S 4IO9Q 4DFMA 1YHQS 1UVJA 3FMBA 2EC0A 2ASDA 4IQXA 1Y9OA 1VRTB 3NGKA 3ZZTA 1KSPA 1K0VA 2DNYA 4ZVFA 3WBZA 2AYEA 3OPKA 3V6DB 4C0BA 1BQMA 1RT3B 3E3XA 4ZPTR 1FHTA 1RDRA 1QY7A 4A8MP 1IR0A 3ENQA 3DLKB 4RW7A 3TOQA 3LAMA 1R31A 2KM8C 1AUDA 5DGAA 2KZZA 3AB4B 1TL5A 2AX1A 2OFGX 2JRSA 2Y0SD 4H4OA 4N8NA 4MKAA 2DGTA 2KG1A 1QM9A 2R7XA 1ZBTA 1WG1A 2M4MA 1R89A 4EYIB 2I5JA 5J1EA 1UFLA 4L72B 4TU7A 3QZ7A 1X9WA 1MNEA 2MQNA 5SUHA 2B4OA 2YKMB 1IBLF 3IGVA 4F2RA 3V4IB 3OL8A 2VZ9A 4MH8A 2C2EA 1LWCB 1NK0A 2VFTA 4DR6F 2MKSA 4P2SA 4QJVA 1NB7A 3DI6A 1Y00A 2HHSA 1RA7A 2C2DA 4OX7A 4KPYA 2ZH5A 2W4CA 3RTVA 2MQLA 1R8AA 2ZFHA 2ZVSA 5G4DA 4L3NA 2E9TA 2GIQA 2E5IA 5CYMA 4AE5A 3T5JA 2K7KA 2K3KA 1FXRA 4TU8A 5D4PA 5I3UB 3G8QA 4IH6A 2R4FA 5L1KA 2P6TA 1N33F 1VQ5S 4E0DA 4ZLPA 3HHLC 2L48A 3L7OA 1VQNS 2AYMA 3PO5A 2MZJA 3M1VA 3IC1A 3RW6A 1LV5A 4ED5A 1HNIA 5CXTA 1F0XA 1UW4A 5GAHU 3KMSA 1AXQA 4OX6A 4QIWD 3FCHA 3BGRB 2YWGA 4QCLA 4RNFA 1FTRA 3LUYA 4DMZA 2RQ4A 2YX1A 2E1RA 4QU7A 4MAKA 3I0SA 1JLEB 3J81Y 1B7FA 4NLUA 4F25A 1AROP 2NS1B 1BY9A 1U26A 3I0RB 4FXWA 3U1MA 5E3RA 5B0EA 1UWBB 4KO0A 2QRRA 4DQSA 1G3OA 1ZAWA 2V2KA 1KLNA 3PIPQ 5HMYA 1FA0A 1LW0B 2VBXA 2IRXA 1NAQA 1NKBA 2JFDA 4K0KF 3KYLA 5D78A 4DSJA 3H25A 2CQ4A 2N82B 2OAUA 5HP1A 5F9LA 4QU6A 3HPOA 3W2WB 5KG2A 2XGQA 2MXYA 4ILMA 2M3DA 1R7IA 4BC7A 1JLCA 5D6GA 3CCVS 2J9DE 4Y00A 5LXYA 3KK2A 2J0XA 3V6KA 4WXWA 3PX6A 1T05A 2BBEA 4CCHA 4ELTA 4DQQA 3I32A 1C4CA 4YB6A 2J9EA 1D3WA 2CPXA 1J2VA 5K8OA 1PC5A 3J7YU 2ZH8A 2Q6CA 3MR6A 2EG2A 1HHSA 5B09A 2WW8A 3O6QA 4ID5A 1HBOA 1N5SA 2GMJA 3ITHB 1QAIA 2J6SA 1NKCA 4Q8EA 1SH3A 2CDQA 2YTCA 5GAGI 3MD1A 3GR0A 4TN2A 5DDPC 2V5HG 5B08A 3PW4A 2CQ3A 2W8KA 1EETA 5DDRC 3SCIE 2VBZA 3O2IA 3B8HA 2VV5A 3QGIA 3IG1A 3RB0A 4A8FA 5B0AA 1S76D 3HZEA 2V4JA 5IM0B 4OLOA 4HT7A 1T05B 1VK3A 1XBWA 1MU2A 1OPIA 3KLFA 5F8IA 3KK1A 4Y28C 1U2RA 4FZVA 4DF8A 1VQPS 4K2XA 1X0FA 4C3LA 3IS9A 3OFGA 3RB3A 4R5PA 5CD4H 4X4RA 4PXCA 2ZH9A 3ZZYA 4K4SA 1ZZFA 1UJ6A 2U1AA 2L08A 1HBOB 3ITHA 1C1CA 4A8SA 2CJAA 2LQBA 1I1GA 2DNNA 1IBMF 4O3QA 1RJJA 2XBPA 2E1MC 2MGZA 1XMQF 2P9CA 3M8SA 3GMGA 4NLWA 5KFNA 2Y1RI 2WONA 2E9RX 1S0VA 1KVIA 4QWBA 1FDDA 3CF5Q 1TKTA 2QFJA 2ZHOA 2YKPA 3A1YG 2NUUG 2ROGA 2IYGA 4IG0A 5EUHA 5LT5A 4Y65A 1F5AA 3HVTA 4QWEA 1WHVA 1R8PA 2DGQA 5HROB 3P3DA 4NXNF 4YR0A 2FIUA 5KG3A 2WCXA 1YI2S 1N34F 2XG8A 3H20A 4ZVHA 1SC6A 4JI0F 5AE2A 2VPYB 1LK7A 4B3OB 4CO5A 4N76A 2OSQA 3TUJC 4C0HA 1SJFA 1TK5A 1K1SA 3UFCX 4LVOP 5KOXA 1HBMA 1S9EA 4ATNA 2MPUA 4N8OA 1VRTA 2OKQA 3O8WA 4ICLB 4I68A 4IDKA 2JC1A 2WOMA 3OFFA 4QIGA 3MR3A 3CCWA 2PSZA 3OV7A 1FKOB 3LQVA 1XR5A 3ONQA 1M5PC 1RTDA 4F8RA 2MHEA 5KFXA 3QJJA 2XI3A 2XY6A 2YWEA 4UOCA 3I4HX 2RDJA 2HHVA 4IG3B 2GGPA 3ENWA 2KYXA 3BEGB 3OVSA 4J9QA 1DJ0A 2IAJB 4TLRA 4ED0A 4I2QA 3CMES 1RT6B 5CCLA 3EGZA 3Q0AA 3HK2A 1NU4A 4G1IA 2DB1A 1YITS 4QW8A 4RW4B 4DR3F 2IVMA 2A1BA 4I7FB 1UVKA 3OTBA 3LP0B 3R3TA 3UWTA 4G1QB 1S72S 3MUVP 5D3GB 1L3UA 2A2CA 1JJ2R 3KHHA 1GX5A 4J9RA 4QYRA 2DR9A 4I64A 2WBMA 1IJFB 4WFNQ 2DVIA 3BF4A 4F4KA 2QA4G 2DR8A 2KI2A 2GCFA 5KG5A 1LFPA 3KG0A 5C24A 5D3GA 2IBOA 2MZQA 5F0WA 1VQOS 2KZMA 4JI2F 2HWTA 5LMNF 1IJEB 1T02A 2C3YA 4UUXA 4LIRA 1TAQA 2C42A 2ZDOA 2HFZA 2K1RB 3KNAA 1SB6A 4IH5A 1VBZA 4I2QB 3UCGA 4RW8B 5A8RB 4P7TA 4F50A 3I82A 2MSTA 2M0GB 3MEKA 2C3PA 3MI7X 2RMLA 5I3PA 3CJ4A 1X4DA 1G6BA 3IR6B 4NZ6A 1HI8A 4P7VA 4IFVA 5B7WA 4RU2A 4AUKA 4CTAA 1VK8A 4TNOA 4K4YA 1KQFB 2A3JA 1ZPWX 2CQ2A 2IFXA 2OPQA 3EUNA 4C0OC 2E5LF 4DFJA 4WIIA 3OR2A 4DFKA 4I1TA 2BE2A 5J1PA 4X4NA 4X4QA 4K4ZA 4OI6A 2E1AA 2VC1A 2W9BB 3IWNC 2KH9A 2C3MA 3MEEA 5KFPA 1FDAA 3UQSA 2W9AA 2LDIA 2CPEA 1N4LA 3KHLA 3Q8RB 1LWFA 4NLYA 3OSPA 3VAIA 2F40A 2PMHA 5DETA 5EWFA 2UXCF 2W9BA 3QPIA 3JSRA 2FHOB 2ATLA 1U1OA 5DLFA 3HXMA 3VAHA 2LEPA 4E8UA 2IJFA 4FN5A 1X4HA 3MR5A 2HHHF 5JUMA 3MECB 1JLBB 1A6LA 3MTKA 1WHYA 4KIAA 4NZ0A 3MMBA 4PXEA 4TU9A 3K2YA 3JSYA 3DXSX 3MD3A 2BANB