1VJWA

Structure of oxidoreductase (nadp+(a),ferredoxin(a))
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
59
structure length
59
Chain Sequence
b'MKVRVDADACIGCGVCENLCPDVFQLGDDGKAKVLQPETDLPCAKDAADSCPTGAISVE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FERREDOXIN(A)
publication title Small structural changes account for the high thermostability of 1[4Fe-4S] ferredoxin from the hyperthermophilic bacterium Thermotoga maritima.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Oxidoreductase
total genus 14
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 1996-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00037 Fer4 4Fe-4S binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1vjwA00
1Y5NB 1BQXA 1KQGB 3MM6B 1C4CA 5CHCB 1KEKA 1SIWB 3MM8A 2PDAA 2XSJB 1B0VA 2FDNA 3OR2B 1H98A 3MM8B 1Y5IB 3MMCA 2C3OA 4CI0B 1PC4A 1Q16B 2Y0SD 1H0HB 3IR5B 1F5CA 1FCAA 3GYXB 4ID8A 1FF2A 5CH7B 2FJEB 7FDRA 2ZVSA 1FRJA 3LW5C 1DAXA 1FRIA 2VPXB 1D3WA 3MM6A 1FRXA 2VPZB 3PNIA 2XSJA 4OV1A 4RKUC 2FJAB 2C42A 2V2KA 3OR2A 5E7OB 2FD2A 1FXRA 2C3YA 1DFDA 1FERA 1FRKA 2Z8QA 6FDRA 4XDCA 3OR1B 1K0TA 1Y4ZB 2VPYB 5BYRA 2GMJA 1BLUA 1G3OA 6FD1A 1GTEA 1FD2A 3MM7B 1H7WA 1BWEA 2PA8D 3MM5B 2FJDB 3EXYA 1H7XA 5BYQA 1B0PA 1RGVA 1F2GA 3EUNA 1C4AA 1DURA 2WSEC 1FRMA 1FDDA 1HFEL 1Y5LB 1GT8A 3OR1A 4DHVA 1SIZA 5BYSA 3MMBB 4L6V3 5FD1A 1A6LA 1JNRB 1WTFA 2WB1D 1XERA 3IR6B 4AYBD 1FRHA 3MM7A 1ROFA 2UZAA 3MMAB 3MM5A 2GMHA 1PC5A 1FDBA 2C3PA 1FRLA 1G6BA 1VJWA 3MM9B 2VKRA 2C3UA 7FD1A 1F5BA 2WAQD 1FEHA 3HKZD 1KQFB 1AXQA 2WSFC 1CLFA 4KT0C 1FDNA 1FXDA 2FJBB 4XDDA 2PMZD 1IR0A 3MMBA 2VPWB 3EGWB 1B0TA 4Y28C 2C3MA 5L8RC 1FDAA 1R27B 3MMCB 3MMAA 3IR7B 2FGOA 1BC6A 2V4JA 3C8YA 4XK8C 4OMFG 1JB0C 1SJ1A 2O01C 2V4JB 1BD6A 3MM9A 1JNZB 1GAOA 1GTHA 2IVFB 1IQZA 4YDDB 2WSCC 1FTCA
chains in the Genus database with same CATH superfamily
1RHQB 4PG7A 1RAEB 2UUBF 5IT9U 3PJ9A 2P5VA 3H20A 2WVBA 3IWNC 3AD9C 1MU2A 3J7YU 2NUUG 2BM1A 2ASDA 2MLXA 1S99A 2RVJA 1G4CA 4PXEA 4ETZA 3KJNB 2OPQB 5AE1A 3KLEA 5E2QA 2QSFA 2RUSA 1BLUA 2QEXS 1C2PA 3KLFB 4OYMA 4DFKA 3A8IA 3CCWA 3PW2A 2CNKB 2XMJA 2A18A 1VRUB 4PPZA 2AT1B 4LIRA 1GT8A 4NOHA 5KFEA 4CO0A 3KHLA 1ROFA 2FVQA 1MMLA 1CJTB 4DX7A 4PABA 2UVRA 4I0WA 1WF0A 1TKZA 2X1GA 2YKMA 3M2UA 1BQNB 2ILZA 1CJUB 3IRXB 4LR8A 5DLGA 4OJGA 4YHHF 3NEKA 1YBTA 4UOGA 4ZPBA 4M63A 1EIYB 3DOLB 2DNOA 5U47A 5KFWA 5CABA 1WC1A 2YPZA 2CNLB 4K4TA 2VPXB 5C42A 3CW2C 1FJGF 1TL1B 5AE3A 1GX5A 1LWFB 2VG7B 1U1OA 4KO0A 4IH5A 1XN9A 5D4LA 3HSJA 4ZCMA 4J9OA 4PQAA 1HMVA 2ACMA 1EB0A 3T6BA 3D4JA 1K8AT 3ZZOA 4B3SJ 4K4WA 3MM7A 3I0SA 2R8GA 5HBMB 2C3UA 7FD1A 1U1KA 3QATA 3OL8A 3T41A 2FJBB 2HIYA 4ICLA 3CULA 3LTOA 1F60B 5JJBA 1H2VZ 1CQMA 5H9EJ 2QGFB 3B78A 4ZP9A 5EUHA 2WSCC 4KKOB 2BM0A 4ZLPA 1DBDA 5H9FK 1OJ4A 1IM6A 5BR8J 1RTHB 4UF4A 2EI5A 4F2RA 4ZVUB 4C8NA 4DCJB 1NH8A 4ALZA 5J2PB 1K44A 3M6VA 1U09A 4CT9A 2UXDJ 3L7UA 3QRQA 5JVGQ 1RCXB 1H2UX 4EO8A 1RKJA 1XC9A 3NNCA 2Z8QA 5J1NA 1N48A 2W24A 3GCWP 4NLYA 3MUTP 4CYUA 2LXUA 1KP6A 2MKHA 4ZIVA 4ZVOB 1N36F 1WG4A 1NK5A 2K8GA 3M8QA 1XNQF 3R7NB 4ITSA 1FKPA 2QMUB 4JI7F 1U0HA 2XSFA 3DLEB 4I4BA 2YQ3A 2ZOGA 2YX7A 2ZKUA 2JC1A 3DOMB 4RW7A 3UDVA 1RT3A 3EGZA 2B3TB 1YJRA 4QWCA 4OI3A 3TJ9A 2P2CB 2PDAA 1LK5A 3D6FB 1CS4A 3OTEA 1P6TA 3TZYA 2GVDA 3G6YA 3VAKA 4O3PA 3UN2A 1D8ZA 1F5CA 4JOUA 4U67Q 4C8OA 1NMEB 3KJVB 2VPZB 3PNIA 2YX4A 1RTZA 3C15A 1OQ6A 4JI1J 2J6UA 2QSWA 4JI0F 2MY7A 4WTYA 3CCSS 1QTMA 3DRRA 2ZDPA 3RUBL 4QYRA 1QAJA 2U2FA 1NU4A 3QO9B 2MJUA 2GA7A 3DRSB 1S76D 3TZZA 4KHPF 1YZ6A 1X60A 2DXFA 2V4RA 2LMIA 5K8OA 4X64F 3HJFA 2C3PA 1RT5B 2L08A 1RBAA 2AJ1A 3FZBA 2E9TA 5FDLB 1T03B 4MKAA 5E5NA 5T7LB 1F9HA 3DI6A 5F8HA 3DCAA 3S1TA 4XTTA 3IAS9 4OX6A 1R27B 4LREA 2E7XA 4DFPA 2HNYA 2DGVA 2RDDA 4NZ6A 4DL3A 4KGMA 3ZZUA 5J2NB 1LW2B 4PZVA 4OX7A 5CHCB 3MEDB 1VLOA 2LYVA 2BKOA 1QUPA 2FDNA 1TUGB 2FC9A 3ENWA 1QAIA 4LFBF 2I0XA 1VC5A 1TUVA 1U1PA 1U8SA 3GJTB 1W26A 3TEHB 2BE9B 4WZQA 2FPHX 3NY0A 3M7VA 2H5IB 2M70A 1CQNA 1S1UB 3UPFA 2VOPA 1FXRA 3MCNA 4MYUA 1NHKL 4F2SA 1JLCA 4OLOA 3UN5A 3KDOA 3FBBA 4IO9Q 4KQZA 2XZDB 1IBLF 2MZSA 4M5LA 5KG7A 2CDQA 2AKWB 1HD1A 5MAOA 2J7WA 1QSLA 3JYTA 2VFTA 1HR0J 1S6QB 4F50A 4LBHA 2WTFA 3HHLC 4A8QA 2W9CA 1QTNB 2JJ4D 4KT0C 2V94A 3CDWA 1RTIA 4Q0BB 4F4AA 2HRYA 4RU9A 4FS1A 2RB7A 2Z30B 2ZH7A 1JX4A 3L4BC 1ZM4A 3TOQA 2HW3A 2BE7D 2VBYA 4ZVFA 3VCDA 3P6YC 4WFAQ 2JL9A 4OIXA 3B4DA 1QE1A 3AOAA 1PO6A 3NMRA 3RB4A 2ASLA 4ED4A 2OFHX 3MUVP 1IXKA 4NWBA 2B4UA 4HLBA 3PKYA 2VASA 1Y4ZB 4J9MA 4P72A 2JZ5A 3QWPA 3NAHA 2C1EB 1CG2A 4RW4B 2AW0A 1KNZA 3GR0A 5K20B 2VQFJ 1HD0A 5HVHA 1KOOA 1FNMA 3EDRB 1HFEL 3GFYA 1H2TZ 4DUTA 5GAHU 1UVKA 2BUNA 2YKPA 3PTWA 2MQLA 2DNMA 3UN3A 1Q8KA 5EN1A 2HRTA 4FZVA 4KE5A 2WVEA 1RT1B 4B3MJ 4KV8A 2OP5A 1VOMA 5DG7A 2D9PA 3M1VA 3T1YJ 2B4OA 4TLQA 3BPDA 4B3OA 3CDAA 4ERDA 1UVMA 1SBRA 3H7HB 1YJWS 3PX0A 2XSJB 3BBBA 1I94F 1IKVB 2H54B 4IQXA 2AX1A 3JSBA 4DPOA 4O4RA 4C11A 1FF2A 2R7OA 3LP0B 2D74B 5F3ZA 4LF4J 4OJHA 3EX7B 3LP2A 2HBQB 4LFCF 5A76A 2R3VA 4D3HA 4B9UA 1EETA 1H6KX 1QD1A 1IBKF 3QNWB 2DITA 5DQIA 2PA8D 3I0RB 3C6UB 2PIIA 4IG0A 3IFEA 4CLFA 4O3QA 1YJVA 2MZRA 3X3UA 4LSNA 5ETRA 1UW9A 4V19X 3R97A 1HYSA 4OYBA 2ZEJA 1WC6A 4NCGA 3FQKA 4QIWD 4LF7J 1UZDA 3DLGA 3DLBA 3I5AA 3C46A 2AGQA 2XULA 2FIUA 4RNHA 1BE4A 2E66A 1ZA1B 2BMBA 2Z2LA 3CD7A 4CH7A 1OQ3A 2MHNA 3U7JA 2UVUA 3QIPB 4MK9A 4V1Ak 1XNRJ 2HFOA 4U6PA 1X4GA 4A8XA 3F41A 2IJNA 3KK3A 4CH0S 5A8WA 5F8IA 4KH0B 4DV3J 4B9MA 1YVFA 4F0KA 2ZDOA 1UFWA 2QFJA 2HHWA 1RP5A 1MWYA 1HNVA 2ZHAA 2BR0A 3P96A 4LVOP 2OMLA 1H72C 3JQJA 4F67A 1O6XA 4DL0C 1DFDA 3RBEA 1N5TA 3RBXA 2W2OP 1ZS6A 1Q7LB 5C25A 3BYRA 4NLTA 5ETNA 3PVXA 3FRZA 4B3TJ 1JLGB 4Y00A 2QLWA 1MMDA 3EICA 3VQTA 1EP4A 1IVZA 4X65F 1JJHA 4AUKA 4X62J 1UPPA 2RHQB 1JJCB 2AV5A 1XWLA 5HVFA 4ES2A 1YHQS 2YWHA 1RDRA 1VQSA 4NXNF 5CAAA 5DGBA 3D5MA 2KHDA 4F02A 1NLKL 1LWEA 2EEYA 4ZK7M 2MQOA 1S6PB 2BEFA 5ETTA 4IDKB 2PGCA 5FJ4A 5CXTA 1UA1A 1VQ4S 2V4JB 4FBUA 5DQGA 1QSYA 5BXIA 1KVKA 1S9EB 3RBZA 1F3FA 3EZUA 2QMWA 3HZGA 3U02A 2F65A 5KFDA 1TQLA 1N8RT 1HWKA 3CCMS 1TK8A 4DR6J 3WC2A 4LVNP 2CA9A 2OPSB 5A8RB 5KFNA 3PR4A 1KKHA 4HHJA 3MPWA 5F8LA 2JX2A 2ZWOA 2Z2MA 3HVAA 2VA2A 1YG0A 5DDQC 2V63A 3AAWB 4KPCA 2CQGA 2DNNA 2BDPA 1KLMB 3QGHA 1HA1A 2EFQA 4MIAA 2H1YA 5B09A 3LP1A 3VAIA 1X5PA 5EHHA 1RT2B 1RWWB 1IKYB 1DRZA 4PG5A 3GPAA 2NCKL 1RU1A 3D3BJ 1X9SA 3W5YA 1NPPA 4K4ZA 2I9SA 5KFYA 4EYHB 1N0VC 1FFSB 2KXFA 2YNFA 5H9EK 1F0XA 3KG4A 2CJAA 1Q78A 4AT1B 3KMQA 3QLHA 1U02A 5KFJA 5AXKA 2WBRA 1AROP 4Q2MA 4TU7A 3TJ8A 5J2QA 3MFIA 3RAXA 2AGOA 4DPXA 4DR3F 2M7SA 3GV8B 3U1MA 1OPZA 4NASA 3RAMA 2Q66A 3IBWA 4W98A 3T19A 2FHMA 3BEGB 1REGX 5E41A 2XM3A 3BYPA 2ZH8A 3GZ7A 2ZH1A 3UVJB 1K0TA 5KG5A 1XMOF 2EW9A 4KFBA 2I5JA 4AQYJ 3DRPB 3CC7S 3TZXA 3RB3A 3HVRA 4DCOB 5B0DA 2JLFA 4JI6J 1M1GA 1GX6A 4B3RJ 1VRQC 2FY1A 2QC3A 4L6V3 4I7FB 3DLLQ 3TANA 1UVIA 3T6JA 2J0WA 4UY8T 2FHKA 3CCTA 2D9OA 4WFYA 3CJQA 4RBTA 4RO0A 4YFUA 2MHEA 4DR5F 3T5LA 3OLBA 4RPFA 1JNZB 2E5LF 2FZGB 3K2YA 1VJQA 4NA1A 3HT3A 2ZFHA 2ZOFA 3D1HA 3AB4B 2EVZA 4RW9A 2IIHA 1S1XA 1Y7PA 2ZE2A 2VZ9A 2QL9B 3HHLA 3H40A 4MYTA 2B5JB 3I5CA 4A8YA 1IKWB 1ACMB 3RAQA 2C42A 3EXCX 3IO1A 4NYOA 4WJBA 1AUSL 8RUCA 4CLSA 4EYIB 2E9RX 5L1IA 1ZOTA 4NA3A 1WOSA 3M8RA 4JI2J 4AXIA 1XEZA 4I68A 1Y00A 2BANA 3Q0AA 3EZOA 1GXTA 1OY6A 5D3GB 2ALYB 2UZAA 3OFGA 4FF4A 2R7SA 2UXCF 2LA6A 1FDNA 5I3UB 5DETA 4A46A 4OYWA 1DQ8A 3CSKA 4PXBA 4CM0A 3I5BA 2CQ1A 2MEWA 2P9CA 4C8ZA 3BKFA 2UXBF 2AJ4A 1UFLA 2DISA 2ROEA 2E1AA 2RDJA 1HL6A 1RAJA 4IFYA 4JBCA 2IDEA 4YQWA 4PRFA 4CI0B 3QFHA 3TEGA 4DV1F 1CEZA 5DG8A 3C19A 2J0XA 4DZDA 2MQPA 1QAXA 4QW9A 4NXMJ 3EZ5A 3HHDA 2NXEA 2PN6A 5HLFB 4C3LA 4DSEA 3R5CA 3V4IA 2IM0A 1NK7A 4DEZA 5IQQA 4O0NA 1WC5A 1N54B 2HHSA 1AZSA 2JEGA 2E1RA 1NRKA 1F9FA 4J7CA 4M94A 3QWUA 3ZZPA 1PCAA 1HBMB 3KK2A 4MK7A 1F5BA 4DR1J 4KPYA 4JI8J 1M1HA 2BQUA 1N34F 4O3RA 2FJWA 4QWEA 2OEJA 1LXJA 3MMCB 5DZ6A 5KFGA 1NZ8A 3ETMA 5D8HB 3P49B 3Q89A 3B54A 3KHGA 4OL8A 1VC6A 1N56A 1X4EA 2XLIA 1N88A 3MGJA 2O67A 3KLHB 4DWIA 4HDHA 3E2EA 3GIIA 1Q82T 2B8PA 4LFAF 2JWNA 4IOBA 2R7UA 1NDLA 4KSEB 1VI7A 5E7OB 2EBGA 4DFMA 3TVKA 4ZITA 2MKCA 1P8GA 1S9FA 3CD0A 4O4GB 2BOPA 1ZTWA 1DURA 4P74A 3BO3A 1B7YB 1XR6A 3L7OA 4M5IA 4PXDA 3MECB 3GV7B 2L9NA 3OPKA 1H3DA 1GXLA 3ULHA 2C2NA 3HKZD 2LQ9A 4NLOA 3R1HA 3OT9A 3SSQA 1B99A 1PKUA 4KGXB 1EX8A 5KFXA 4DF8A 2D3OR 1HNZJ 5L8RC 2HFSA 1J5OB 2FZCB 2Z0GA 2MKSA 3DLKA 3R27A 4DV2F 2HFZA 2IPOB 3M2VB 4OZLA 1KSPA 1DTQB 4ZPAA 3PW0A 4DU8A 4CLYA 1PIEA 2HNZB 3W2VB 5CCMA 3QGIA 2AP6A 3CJ0A 3KFWX 3RRGA 2FLOA 1KR4A 1KD1T 3V6DA 4ZVGA 4P71A 1VISA 2Y8YA 1Q81T 1ZZFA 2GHWA 3M4XA 2MQMA 2EC0A 3FSYA 3RRHA 5KFUA 1KVIA 2FYXA 4LF6F 1BGXT 3DOKB 1ZETA 2HLTA 3VR1A 3G8TA 2YWFA 1W2BR 1NK9A 5GAEU 3FC9A 2QO3A 2Y0BB 5KOXA 2HEKA 4HVZA 1M0SA 4FXVA 4FDFA 2BRKA 3H4DA 3MMBA 4RNFA 5KFLA 1WC3A 1UP1A 2O01C 2A3JA 3FFIA 3MM9A 1XR7A 3TX0A 2EG1A 3NNHA 1BQXA 1P1LA 3BF4A 2ROPA 3PYEA 1FJ7A 5B0GA 2UUBJ 3AXKA 2BJ8A 3MM8B 4GO7X 3TX8A 1IBMF 5DM6Q 2NYIA 2KRRA 4USVA 5HL7Q 5B7WA 3EVWA 4ZS6A 2EFGA 2MGZA 3G6XA 1Z2ZA 1ZH5A 2M0GB 4OYPA 1NBEB 5D0RA 3SSSA 1WKKA 5J1EB 1NPKA 5F0WA 2FJXA 2DGSA 4Q7AA 1U2RA 3RZAA 1B4SA 2KTQA 3JTNA 2M3DA 5A6WA 2BRLA 3TA0A 2HSEB 4EEYA 1TV6B 4AL6A 1P9QC 2RHSB 2WB1D 5DO2A 2OLWA 4DDFA 1MROB 1XR5A 4ED6A 1JLQA 2XHCA 2J6TA 2KT2A 1FXDA 3CO9A 1P27B 2VDHA 2R9LA 5AJ3F 3LGNA 2RS8A 1RK8A 3CC2S 4YHHJ 2HS3A 4IR9A 1RTJA 4C98A 1KQGB 2UP1A 2WVFA 1HARA 3ITHA 3GWCA 2X3DA 4DQPA 2J7KA 2B6AB 4W92B 2I1RA 1U25A 3SQGA 3EPIA 3MEGB 3BSNA 1D0EA 3WBZA 1KWMA 3J81Y 2E5HA 4DR2F 1BY9A 1TFYA 3NS6A 3X1LB 1FWKA 2CUYA 3ZC4A 3MM5B 1RQ0A 2PFDA 4M5DB 4OHZA 3M2RB 3PYFA 2V2VA 3ZZ0A 5KFKA 4DHVA 3M8PB 4KY3A 3GQCA 2RQMA 4MKBA 2GMHA 3TO8A 1RHUB 5C2CA 3ZTQA 2EWHA 2NQPA 3VV2B 2WHOA 1HPZA 1VIOA 1WSVA 3DGPB 3W66A 4RW8B 4X4RA 4O44B 2J6SA 2XQCA 1VFJA 3GCXP 5IC6B 4WIIA 4FYWB 3GFHA 3J7AN 5F3TA 2HHUA 3FNNA 1TP7A 1NM2A 3PKMA 3ET6A 2UV8G 5LMNF 4Z7CA 4KBIA 2VF3A 1AB8A 3IP0A 3VWSA 5KG6A 1T9YA 1LK7A 1SC6A 3PM9A 4DLGA 5DG9A 4YY3J 2PFFB 1GXUA 3V6KA 2M5YA 1F6TA 3DXSX 3CXCR 1FD2A 4J9PA 4LBPA 2FY8A 4JV5J 2B56A 2LEBA 1S7HA 4IRCA 4FYDA 1N36J 1N32J 3RG6A 1XNQJ 4CQ1A 1REVA 4JI7J 2KXNB 2GIQA 2W4PA 1YLXA 3G4SS 3PZPA 4USUA 1I1GA 4XDDA 4J9UE 2GS8A 1KRPA 3DLHA 2ZBQA 2HG4A 3GP9A 1NSAA 4OHXA 1S10A 4LQ9A 1X5SA 3CCZA 1V9OA 1BD6A 2IVFB 1V3SA 2DNGA 5D77A 1RA6A 4Q8EA 3GYGA 3HHEA 3POTB 2EG2A 2MSTA 1NK4A 3RB0A 4LRDA 4QR0A 1S97A 2OD6A 2AZ1A 5JMNA 3Q2TC 2G0IA 4KB7A 1FCAA 3FEXB 3LW5C 5J2MB 1BQMA 1D3WA 2HQ3A 3FCVA 2UUWA 2F3JA 4CO5A 4JI0J 2DPIA 3N6LA 1TL3B 1UJ4A 2IM2A 4JI4F 2YNIB 3M8SA 4UOHA 1DJ0A 5G4DA 4ELVA 5LM7E 3TI0A 3TAMA 3W2WA 1R43A 3A8JA 3EPGA 1RHRB 2C2RA 2JEIA 2RKIA 3I31A 3QBCA 4QYZJ 1LW0A 3R1LA 3SXLA 3G6VA 4X64J 2HBYB 5CYMA 1G6BA 1NO8A 1OIAA 1UEVA 3MAAB 1R0AB 4G3IA 1SQGA 4CO4A 1S1WA 4CLTA 2IFXA 3C14B 2IRXA 3NOCA 3N6NA 1QLNA 1JLBB 2L41A 2BJ7A 3DYAA 4J90A 1WC4A 3F56A 2AJQA 3HHNB 4A8WA 4ENOA 4ANDA 4HI2A 4C48A 2VONA 2M88A 4TU9A 5LJ5Y 4GMKA 2GGPB 1ZM3A 3U1LA 1TKXA 2OGUA 2CJKA 1TVRB 4DN0A 1HBNB 2HRUA 4KIAA 1RAGB 2BW7A 2CPXA 2CQPA 2RD5C 2J0SD 4IRDA 3KK1A 2J8SA 1VC0A 4ZPWR 4TNOA 2OPQA 4USMA 2UUCF 4FN5A 3FEYB 3MEKA 2CG4A 1PJ6A 1S0VA 3KLFA 1JK9B 2HGLA 3IM8A 3NL0A 2W9BB 4FKXA 3OL9A 3M8YA 3SCJE 3D7SB 2XG8A 1X5OA 2X1AA 4OI1A 2FHJA 4ELUA 3KHHA 4Q2LA 4OQJA 2GQCA 3ADAC 1E6VB 4K8RA 4ED2A 3CIZA 1PG5B 4DQIA 2YQ0A 4K4UA 2RU3A 2LKZA 3A8EA 5KT6A 1CJTA 1UAWA 3ILJA 2B9EA 4OZ2A 2ZZNA 3MZIA 3AOCA 2UUAF 1F2HA 4WKRA 1BQNA 3TQ1A 1IR2A 5K14B 1CJUA 3I55S 3IRXA 2F1FA 1YBUA 4ZP7A 2FB0A 2CPFA 1ZAWA 2ZNZA 3R2CJ 2YKNB 5ITHA 1WF1A 1CSJA 1KDNA 3CUNA 3BH7B 4NRTA 4BCAA 1CJVB 3NGDA 3DOLA 2ZHBA 4ETXA 3ZO7A 4YUDA 4ZCLA 5IC4B 3NP5A 2KFYA 2CWKA 1ELOA 1SUQB 3GJRB 1X4FA 5KG2A 3IBCB 1TL1A 4LSLB 1ZYQA 2CNOB 2WOMB 4E98A 1S57A 2IRYA 2B8QA 1CULB 3H42A 1KQFB 4DG1B 2CPJA 1L3VA 5AXNA 4IOAQ 4RZRA 3M9MB 2B9XA 4FXDA 5HBMA 5ADZA 4WFNQ 2MLYA 3MFHA 5HJXA 4W90B 4OI6A 1YZ7A 3TWZA 2DBBA 3DHXA 3HXMA 4OHYA 3HSZA 2D1CA 1HBOB 1AW0A 1TUWA 4ATNA 2P6SA 4DV7J 5L1LA 2H5EA 5KTQA 4EBCA 1FRJA 2BXJA 3H90A 2V9WA 4LFCJ 3R5GA 4C8KA 5C42B 2HS0A 2QYCA 1RTHA 4ZVSB 5CZXA 1LV5A 3AD8C 1U47A 2GAHC 1EKRA 1N5QA 4CM2A 2YBVA 5J2PA 1GTEA 1RCOB 1IBKJ 3FCHA 4DPWA 2HWIA 4C8MA 2B9YA 1M1KT 3O3LA 3VZIA 4WXOA 1NZAA 1SIZA 3JTOA 3EWGA 2C2KB 3LAKA 5KFRA 1UEUA 2DGQA 3P5TL 3QAEA 2VG5B 2LQ5A 3RGIA 3QSIA 5MLCV 4ZLNA 3A3PB 2Q79A 3PW5A 3SMZA 3WZ0A 3VF0B 3DLEA 4FYXB 5ETMA 3GIKA 5CD4A 4CNZA 3DOMA 3N5FA 3OR2B 3HD1A 2FVPA 2RQKA 3ILIA 4Y0FA 4MH8A 5D6GA 2MQ8A 4MJKA 2XO7A 4G65A 3ILLA 4XPCA 4WWSA 4PG8A 2MZTA 4TKTA 3NMAA 2CQ4A 3PYDA 1DQAA 4J9VA 2AF6A 1KONA 3QJPA 3IGVA 1R8BA 3GIJA 1S59A 4USTA 1R3NA 3FSIA 3KJVA 2W4CA 4XAKA 4CYUB 3CCVS 1M90T 4X65J 2JLGA 4F26A 3CJTA 1HWLA 5HP1B 4FXWA 2CZ9A 3M8QB 2AHOB 1TK5A 3QO9A 5F8GA 4NXNJ 3THPA 1RWNB 1OYDA 5H9FJ 1U0HB 2A1BA 2RIJA 2CPZA 1TL5A 2E5GA 3IGNA 4QR2A 2VBXA 1RT6B 3M9NB 2BX6A 3CIMA 1S0OA 1RT5A 5IM0B 3JSRA 1RU2A 3KLIB 3G96A 2HQGA 1T03A 4USIA 2L48A 1CS4B 1WG1A 3ENAA 1U0SA 4ZJOA 2HHVA 5GMEA 2YVSA 2BKNA 3OXGA 3AJ2A 2FUG9 5J2NA 3CC4S 1LEOA 5LSLA 3MEDA 4Y2KA 2VFUA 5JXSA 2ADBA 5L1KA 1OMSA 2YNHB 1FKAF 3ISNC 1TELA 1ZPVA 4ECQA 8AT1B 2ZM6F 1IKXA 3BPSP 4ZKAA 3I82A 1ZZNA 2CWXA 4DFJA 4F0HA 4K4SA 3I6PA 3H2LA 1S1UA 4DR4F 3SCLE 1X4HA 4Y65A 1QSSA 2DO0A 2QYGA 3H25A 4F4WA 4C8LA 2DHGA 3FQLA 4DL6A 3QJJA 2OJ3A 2HURA 4EZ6A 2JLEA 1VBXA 2PMZD 1B0TA 4CTAB 1S6QA 2CJQA 3OV7A 1XMQF 2IA0A 3AJ1A 5DS7A 1S79A 4GC6A 2HNYB 3AB2B 1MLAA 3D1QA 3R9LA 3JXOA 2VUGA 4PYAA 2I38A 5THWA 4EI2A 4K0KF 4Q0BA 2QLBB 1LOUA 2XYHB 4DR3J 1X4BA 5B0EA 2XMVA 3LUYA 1NH7A 4NYZA 3FBFA 2ZVSA 3PRDA 4OI2A 1HWUA 3MCMA 3H59A 3PHTA 4NI2B 1KHWA 3US5A 3FGVA 3D68A 2UVWA 3QSYB 1NHUA 6FDRA 1UVLA 1U6ZA 2OMOA 4N8NA 3K5MA 5A2QY 3D54A 4ED8A 2H65B 5K8MA 4NMLA 4EMDA 2DR6A 1NB2A 1HWJA 1RTDB 4P2FA 5JVHQ 1JWWA 2DHHA 3TVYA 3TRGA 4I6YA 4RW4A 1BWVA 4DJBA 5GADU 1LWCB 2PT0A 2QN6B 1U1RA 2VPWB 4J9NA 3HMJG 4DR5J 3HT0A 1S6OA 4DR7F 4ZHRB 1JB0C 3O1LA 1FO1A 1RXOB 2E5LJ 2XNQA 5KFMA 4A8OA 4C7QA 4A4JA 1RT1A 3EVOA 1C4CA 5CQGA 4LQ3A 3VGSA 2VODA 2HIQA 4F36A 3UI3A 3R8YA 4P2XA 4FF2A 2RRAA 3PX4A 5CD4H 2XSJA 2PSZA 2GV1A 3T3FA 2J9CA 4JP8A 1WEZA 1IKVA 2YH1A 2YY3A 2WB4A 1L5UA 3H5UA 1L3UA 3LP0A 3IA0A 1D1UA 2AGPA 1QAYA 3AQPA 2C2OB 1N5SA 4FP9A 1MW7A 2KT5A 3MOZA 4QYZK 2MYFA 3M6WA 3HFVA 2F4VF 2V8GA 4N77A 2HHXA 3J7ZT 1FNOA 2XS7A 3I0RA 4LT6A 4NYPA 4CP5A 3C6UA 1EHWA 2AJ2A 1UWBB 1XJWB 2UXCJ 2LDIA 3GSIA 3HVWA 1PYOB 4C9DA 3BR8A 2IYGA 4B3SF 1VR6A 2DCLA 2CPIA 5EX3A 4QCLA 4CO3A 3BJYA 2NSCA 1CC8A 2V5HG 2V8VA 1B3TA 2C3OA 4B08A 3QAUA 2GO9A 3QIPA 5I42B 1Q0NA 5F0UA 3NCPA 4DV1J 3AHPA 3OUYB 3S8SA 3SBMA 5BR8F 2VFRA 4PKDB 4CH1A 3ZZZA 2DGWA 3RW6A 1N33J 2QMXA 5G0RB 2EK1A 1RABB 3I9ZA 2NZ4A 2WSEC 2VQEF 2KB2A 2K1RB 3QT6A 1PYSB 5LMUJ 2CXEA 1WTFA 2R8JA 1RA7A 4LSNB 2JNJA 4ZA1A 4IFVB 5E3PA 3W64A 4NCGB 3O5TB 1PYTA 4YB5A 1SL2A 4HACB 1N34J 4ECXA 2CPHA 4PXCA 3QIDA 3W5ZA 3H4BA 5ETSA 3B6BA 2DNHA 4OHWA 3I4HX 4DPTA 2B9WA 3Q22A 2RILA 1S6PA 2RAQA 2XMWA 1S4FA 4IDKA 3FVYA 2AQ4A 1YBAA 3WDOA 4M5GA 4P6QA 3TARA 4JI5F 3LPYA 1OY9A 1S9EA 1R7IA 4Z37A 2LA4A 1Z4UA 3VGVA 3CJKB 2O1PA 2Y1RI 5C24B 2GX8A 4F4YA 2PI5A 2OPSA 1VQLS 4EBEA 3AA9A 1JIHA 4X4NA 2HBZB 3EE3A 4G1PA 4JI1F 4EFAC 2HVDA 2A2DA 3R7BB 4AYBD 3Q8UA 3H2UB 4DPUA 1HNWJ 1KLMA 5KFCA 3IC1A 2VKRA 4QQBA 3HVTB 3HHKA 2CJBA 1RUSA 4RNNA 3GE9A 1RT2A 1IKYA 5AE2A 4FS2A 4TLRA 1V3ZA 1XK8A 3AOBA 2W9AA 2NXNA 1D9DA 5KFIA 1FK9B 1N4LA 4DV0J 1M5OC 2QX0A 2W2NP 3C2PA 2LQ8A 5GADI 4JV1A 1JLAA 1V5IB 4X4PA 2A6OA 2GJIA 4R8UB 1Y9OA 1HI8A 1Z1ZA 3FK4A 1JKHB 4F4XA 3Q83A 3OR1B 1V5VA 2HAFA 2XEXA 2ALZA 3D28A 4DF4A 4USKA 4LRBA 1FESA 3J80Y 3EUNA 2BABA 2CJXB 4LR9A 1QY7A 4Y2AA 4LF6J 3UVJA 1JXEA 5BYSA 4U8VA 5C2GA 2ZBPA 3G9CA 4Q44A 1DLOB 1PAUB 2OI2A 5B08A 2WW8A 4YDXA 1FX2A 2XMAA 3WX8A 3E51A 1RT4B 4DSIA 5KFZA 1HR0F 1UVJA 4GKKF 4YDDB 1GH8A 1R8CA 5KOWA 2M9KA 1Y10A 1XMBA 2VB6A 4RNMA 1D09B 4TY8B 3AQOA 1NJYA 1IBMJ 2KJWA 3I87A 3L09A 3ZZYA 1T05B 3DU5A 3FJ2A 5A6PA 2FHOB 1RBOB 2J76E 1RHKB 4O3NA 3RW7A 3UNGC 1S5ZA 4OI4A 3QT7A 3KLVA 3Q8PB 2DEIA 2DR8A 2DKOB 2YXLA 4M8LA 1SPBP 2V2QA 2B5JA 2D41A 1IKWA 4CRJA 3GU0A 1HIYA 4UQTA 4C3KA 2RF2B 4UQGA 3LPEA 3LALA 3QGPA 2XO6A 2DR7A 3RR7A 1JNRB 1S1VA 3SDEB 2ZD1B 3ZTOA 1NEEA 3IAM9 4P52A 3W61A 1VJWA 1UEKA 4CWBA 5D0HA 2QIFA 2VQFF 3BDPA 5L1JA 3MTKA 2PI4A 3HM9A 3HJVA 5IWAF 1U45A 2UVVA 4LF2A 4BBYA 1FT8A 4ZN1A 1FE4A 2DY1A 5D4NA 3OHAA 5I3UA 3P8BB 2IMWP 4ZOSA 4DQRA 5GAGI 3MWBA 3G82B 3T1YF 1U24A 2ZOMA 1S1XB 4E0DA 3CTRA 1TKTA 2HMIB 2JRSA 1KOHA 2XWYA 1K9MT 3DC2A 3CJRA 1GFWB 1PSDA 2G0CA 1SKUB 2R7QA 2IHR1 3W9IA 2RE1A 3BB5A 5A0YB 2KFNA 2RUGA 2CRLA 4DMZA 4O0IA 5BYQA 2WRMA 4LF4F 2BOAA 4U7UD 5LL6d 4Y2IA 5HLFA 1H38A 2KZZA 3IS9B 4HHUA 5DZ7A 2XGQA 4OJ3A 3PJXA 3RJMB 3Q24A 2Y3YA 2Y1LB 1KFDA 4TQSA 3A12A 4G6VB 2OIHA 5B0AA 2X7IA 5IFMA 1DHMA 1SJ1A 1HBMA 1O5JA 3K57A 1SJFA 3CCQS 4H4OB 2G0JA 1T02A 4DZ6A 3BKUA 1SV5A 3MM6B 4Q45A 2V34A 3M30B 2HLUA 4PWDB 3CGIA 3MMCA 1FXLA 5LMNJ 4HR2A 5IQ6A 1U1QA 1B7FA 3W60A 4ECYA 5IS2A 3VAFA 1SC3B 3K8VA 3L3CA 2C2MB 3J7YI 4L73A 4A48A 3KLHA 4QZVB 4XDCA 3GIRA 2VL1A 1NKEA 5BYRA 3FCWA 4DPYA 2BJEA 4CCHA 1NKCA 4WP9A 3V4IB 3GJQB 2D3O1 3HSDA 3VZHA 4WFBQ 2EXUA 3MR6A 3CCES 2VBZA 3GR1A 3OFHA 4O4GA 2ZH5A 4TYBA 2WBMA 4QJVA 4XIUA 1HHSA 2OSRA 1TTHB 4RW6B 1M5SA 3HKWA 4PEOA 3MECA 4ILRA 2L9WA 3CDUA 4WFZA 2HZVA 3PY8A 2ZH2A 1C0UB 1UKUA 3BO4A 2BJ1A 3KJFB 2CDRB 1HI0P 4I2PB 1F9EB 1J5OA 3R6LB 3BO2A 1PC4A 2DJWA 4WU3A 2BACA 4KGVB 2MPUA 4U8YA 4IYQA 3AY0A 2C28A 4K59A 1DTQA 1MN7A 3ENVA 2I6WA 2HNZA 4JI4J 3W2VA 4DXLA 1AA1B 3IG1B 3V4MA 4H4KC 4KHMA 4ILLA 4CO1A 5FLXY 2FVRA 1T8EA 3PR5B 3J80U 1EARA 3K7RA 5KFBA 2N3LA 1KTQA 3K5LA 3CT9A 3JSYA 3MAHA 2VFSA 3EDQB 3HX9A 4GKJF 4FYYB 3GILA 2IMOA 3TA2A 3L7PA 5HROB 3DOKA 5LJ3Y 3CE8A 1FDAA 2VC0A 2A6MA 3DLKB 3KKFA 4BC9A 1FTCA 3PACA 1W25A 3M6XA 4OYIA 2DGXA 1B0VA 3Q8SB 1DY3A 2CYYA 2IJRA 2H9ZA 2ZH6A 1ZBTA 2RNEA 1SJRA 3OXLA 3G86A 3O2IA 4DV5J 1EZZB 1SJ3P 2JEFA 3T9ZA 1UW4A 2XWXA 1C0TB 4I6WA 3UE2A 3HZEA 2HWTA 2CQBA 4M5JA 1GMUA 3DRYA 1PJ7A 3TA1A 4K2JA 4D3GA 4KRWA 1F2GA 2DRAA 1C4AA 1L3TA 2VHGA 2UUCJ 4Y2MA 3I32A 4ER8A 5J1EA 3CMES 1A9NB 3JB9k 4NLVA 1APSA 2ROGA 3NCQA 2HHHF 4LRAA 1UETA 2BJ3A 4OX9J 1PAEX 1FEHA 4ZCKA 2KH9A 4HL9A 1TV6A 3MCOA 4TXSA 1FTRA 2YNGB 3EM1A 4B3RF 1BMQB 2FGOA 4J91A 2DNYA 4AD6A 2FLPA 1MROA 2BQRA 3FFIB 4HT7A 1YK9A 2FVCA 3PDNA 2IRUA 2DGOA 2NLWA 2UUAJ 1WKLA 4X66J 3MPYA 4CT8A 5DRKA 1UL3A 2XTJP 2QG9B 3I9V9 2A0FB 5IT9Y 1Q79A 1NHVA 2FJAB 3CD6S 1C1CB 2IBKA 1UA0A 1NJXA 4QU6A 1S0MA 3MDFA 2OAUA 4OLPA 3P4UB 4YEAA 2E7WA 3MEGA 4L3NA 3SFGA 2HZCA 1WEYA 2ADCA 5LOQA 2MQQA 1FWLA 1R8AA 4DL2A 1M5KC 4CLUA 5F41A 5KT4A 3H5SA 3RBDA 1NDPA 3AFGA 3CCUS 1S12A 2SXLA 4WCEQ 1A0OB 3MM5A 2XMKA 1VHIA 4M5DA 2HFVA 3M2RA 1VQ9S 1NJZA 1DTTA 3D6HB 3M8PA 1K0VA 3PYGA 1HQUB 3A3NB 4LF5J 2HGNA 1YGYA 3W5XA 4MKYA 5L9XA 3Q8YA 4IUFA 2F4FA 3VTIA 4DL5A 2JVOA 1T95A 1IJEB 1TL7B 2XCAA 3MCSA 3H5XA 3J7Z5 4B9NA 3HO1A 1R8HA 3DGPA 4RW8A 4O44A 4QPTA 1F3VA 3FUYA 1MG7A 2B7CB 1RWVB 4A47A 3DDNA 3OVBA 3TUZC 2QA1A 1UCNA 2DNPA 2OPRB 3C6TB 3SV3A 3VAJA 1T3OA 1G7CB 3PFEA 3OSPA 4QBUA 3N9UC 2KI2A 1HQ2A 5KAKA 4TYAA 4HDGA 4BLGA 4UOCA 4C3MA 3GYNA 2CQDA 3N6MA 2R7TA 1S48A 4X4VA 1IJFB 2KN4A 4Y2CA 2BE2A 4LR7A 1FX4A 1LXNA 1WOPA 3MR3A 1U8WA 2XGPA 4G1QB 3CJ4A 2N7CA 5J1PA 1X9MA 4NLRA 4ID5B 2E7VA 1JJ2R 4F0MA 1WHWA 3DN9A 4OFZA 1MWQA 2OHDA 3P45B 4N56A 4DV4J 3W9HA 3SSRA 4F04B 4NZ0A 1J5EJ 4DR1F 4ANCA 3N5BA 2YPYA 3KMSA 3DU6A 3WQPA 2JDJA 1X31C 2MQNA 1Y11A 5T41A 1RACB 2GFFA 1UTAA 4ED1A 3S6EA 5BJRA 5K8NA 3POTA 4WE1B 3OFFA 4NLXA 2ACYA 1PILA 2ZZMA 2N4DA 1H74A 5J2MA 4DS5A 1RGVA 2H4WB 2X3GA 3UDLA 2VFVA 2QLXA 1TL3A 2HYIB 5FD1A 2YNIA 2WK4A 3TUJC 5HN0A 4ZVTB 2M4MA 1D9FA 3RB6A 1FKOB 4RUAA 3RU0A 1UJ6A 5GAHI 3JSMB 3MOJB 3MD1A 3BH6B 2IYIA 4XK8C 2ZVIA 3Q8RB 2G13A 2Q3PA 4B9LA 3BSCA 3BGFA 3H98A 1VQ7S 3MAAA 4OZ3A 4XO0A 1RWXB 3NGSA 1R0AA 1L3KA 2RRNA 3N4WA 2XY7A 2XMUA 1HNZF 1SH0A 1RHJB 1RKIA 1VQNS 1KVJA 4RUCA 4ID8A 4ZPTR 4RWWA 3C14A 5KG3A 1JLBA 3QMQA 1Q95G 4WP8A 3HCXA 2WZ1A 1WKJA 2QE5A 1I6JA 3MEEB 2XLKA 4IOCQ 2UU9F 1WACA 3QRRA 3MF5A 4N5SA 1RI7A 4LF8F 2GGPA 4MT1A 3R5AA 1TVRA 4WZMA 1HBNA 3R5JB 4FPIA 1RWPB 2COLA 1IQTA 3QZ7A 2NXUA 3BREA 2NUHA 4LF9F 4ED3A 2XY6A 3PX6A 1WD6A 4P9SA 4HHHA 2KKHA 4YB1P 2OEKA 2PA3A 3K5OA 1XMQJ 4USJC 4EK2A 1S1TB 4O23A 5LSOA 3LH2S 4M5NA 3DMJB 3KOAA 4I2QA 2G2YA 3JAMY 2XZWA 4K0KJ 1E6VA 3DM2B 4YMEA 1Y5IB 2DK2A 3W63A 2AYMA 2KVQE 4IQMA 3IR5B 3ZTSA 2A10A 2DXEA 3BBFA 5KFTA 1WOOA 3Q2SC 1TKXB 5K14A 1ZA2B 3NOGA 2KFZA 2YKNA 3KK1B 2BJDA 3OTOF 1CJVA 4OYAA 4ZLLA 1TK0A 3HHLD 1GNKA 2ATLA 2KXHA 4NX9A 1FRHA 2BYCA 2CQ3A 3GFXA 3Q8QB 3VHQA 1FDBA 2YWWA 3T5KA 1SUQA 3T1HF 3NGRA 4LSLA 3KNGA 3IRWP 2WOMA 2ILYA 2QV6A 3I4PA 2GIRA 4N76A 1CULA 4DR7J 1NSQA 3Q86A 1CJKB 2V68A 3RRKA 4DG1A 1HQEB 1NCLA 2VG6B 3HDSA 2HFNA 4QU7A 2HQIA 2ZJQQ 1QJHA 2XC9A 3F73A 3OTDA 1ZAXA 1YJNS 4AL7A 3H0PA 3BDEA 1HKAA 1E6YB 4URGA 5D78A 3VAHA 3W1YC 2FQQB 2YTCA 3KLGB 4NLWA 4LRFA 4TN2A 2ZZTA 1HBOA 4OYXA 4R5PB 4JI3J 3FDSA 3BQ1A 5SZTA 1DZ5A 5KFFA 5EWGA 1WC0A 1S0NA 1T11A 3A1YG 1O8BA 2P9EA 1HNXF 2F4VJ 2GJ2A 2E5IA 2PEHA 1RE1B 4YR0A 4P2SA 2KYZA 4PUOB 1UZHA 1B64A 2ASYA 2NPIA 2N3OA 4MKVA 1IQZA 2VG5A 1RT7B 1VS3A 2DY9A 3D67A 2EFOA 3NKYA 1IWAA 4ZVEA 1KS2A 2GO8A 2CNNB 2FJEB 1KN6A 4MIBA 4J37A 4U9RA 1JLEB 4I56A 3OR2A 2J9EA 2QFIA 3FEZA 3GONA 2JFDA 1SL1A 3VVUA 3CJ8A 1HNIA 4QIGA 1KBRA 3CJ3A 3UD4P 4NMXA 3E01B 5IV3A 3LANA 2R2UA 2Y8WA 4YY3F 2DNZA 2VQEJ 4BWMA 2W2PP 5CZVA 4ILMA 2MKKA 4OX8A 1VMBA 2RJZA 3RR8A 4JV5F 4N7TA 2MSSA 2ZBIA 1N5YB 5HP1A 1FVQA 5ETQA 1MMNA 4I67A 1N32F 4F4ZA 2FLLA 3GLJA 5ETLA 2DR9A 4B02A 2VOOA 4ECRA 4MFBB 4CIOA 1RT6A 2DH8A 1VQKS 3KDNA 5F8JA 5E3QA 5EDWA 1S77D 5IM0A 9RUBA 2PO4A 4JI5J 4K2XA 3KLIA 4ZN3A 3TJAA 4PWWA 4CLPA 1U7LA 1AUDA 2DHSA 4NZ7A 1IM4A 1RISA 2F8HA 3PV8A 3UDEA 1MNEA 2KVIA 2IM1A 2CQ2A 4NPOA 5L38A 5EGYA 2LECA 3CCJS 2YNHA 3K5NA 4F8RA 1TL4A 2Y9HA 3HD2A 2VDIA 3MMAB 3FRYA 3CD5A 4KGZB 1FRLA 3U27A 2Q6CA 3NBPA 4CNYA 2Z2ZA 2ZHOA 3IN5A 1IR0A 2AZ3A 3UCGA 4Y28C 2F7VA 2XNRA 4WXWA 3W62A 3PIOQ 2E29A 1SIWB 5KFSA 1AFJA 4CTAA 3SFUA 4QWDA 2OPPB 1K1QA 3JAMU 1U1MA 3IMQJ 4GVBA 4A8KA 1RADB 1N52B 1RLDA 2X1FA 1SI9A 4F3OA 2W4DA 2WONB 3W3SA 2QJ3A 1IKXB 4QIVA 2HVIA 1JLFA 3MURP 1TKDA 5KG4A 3N28A 4NI2A 2Z57B 4U7UK 4RX6A 3OJUA 3ONQA 4C0BA 5L9NA 1X0PA 4K4XA 2CAJA 2GVZB 1OY8A 5CYQB 2WCXA 5DDPC 2WSFC 2RMLA 4PQUB 2ZH4A 2OD4A 1RTDA 2HHPA 3MXHP 4E2FB 5KT7A 4KR0B 4N8OA 4QOTA 1Q7YT 3AT1B 1T94A 2FJVA 3NS7B 3UDCA 1A7GE 1LWCA 2LU1A 1M5VC 4GKKJ 4KHRA 1YDLA 3G6ES 1FJGJ 4B9TA 4ECSA 3QT8A 3GB0A 4NCBA 1NUEA 4ZHRA 4X4TA 3BGRB 5D0GA 1DAXA 1BUXA 3M8WA 2XY5A 1FFGB 1P1TA 4RKUC 4RUBA 1YKWA 4N41A 4YN3B 2ZH9A 5HMXA 4U96A 4ED7A 2BVZA 2E1MC 2PD1A 3HFKA 4RJVA 4GO5X 4PG4A 2JEJA 3G87A 5CCLA 2ERRA 1SXLA 2DIVA 4WK3A 3QGGA 3TAQA 2V8HA 5HMWA 4P75A 3ZZRA 1SJ4P 4BHQA 1C1BA 3P3DA 1VRTA 4RLEA 1BXNA 3GSDA 4EWTA 5IWAJ 1FD8A 4QPXA 1GTHA 5LXYA 5RUBA 1UWBA 3G8SA 2NZCA 2D7SA 4H4MB 3D66A 1URRA 3OQ2A 2MZJA 4C0HA 2DH7A 1F5AA 2WW4A 2G4BA 2J0QD 2CZVC 1FRIA 1JMTA 2QT7A 1Z2LA 2IA6A 1HBUB 4WBFA 4FBTA 3TQEA 4R25A 5C7PA 4NRUA 5I42A 1K73T 2F8MA 3O6QA 4DV7F 2B43A 3OUYA 2DNQA 1U48A 3D1OA 4FKYA 2M8HA 3BSAA 1YITS 2HNDB 2VIHA 3UCUP 2IAJB 4JV0A 5G0RA 2G1DA 4K5SA 2MY8A 2PEBA 3QT5A 5DJBA 3PEJA 1D9AA 3GIMA 2K1RA 1OSCA 1S7IA 3GFZA 2MB0B 5HQLA 3PO5A 1N6QB 2D3ZA 5GAEI 2MJNA 4URQU 5K5MA 3AA8A 4Q8FA 4IFVA 3DDKA 5M2RA 3C66A 4M5HA 4A8FA 4WYLA 4J9SA 3R2DJ 4TY9A 4HACA 4IG3B 3CCRS 5DM7Q 1F1BB 3KWMA 3S7RA 2R7XA 4RBUA 3JQMA 1MN9A 4FF1A 1X8DA 2QLFB 1OSDA 1TAQA 2KHCA 2F5GA 1FEEA 2NREA 1TZ0A 4QW8A 4GC7A 5A8KB 4KHPJ 4M5MA 2XB2D 2ZUGA 2IBOA 1W2IA 4K4VA 3CDBA 2G2ZA 2ZWPA 4OV6A 3PRVA 2IC3A 2DPJA 1S9GB 3KG1A 3OHBA 3CJKA 3D3CJ 1OS5A 3OW2R 3K89A 2DCUB 2F63A 4K7QA 2YWGA 2VU5A 5C24A 4KAIA 5HQMA 1HW8A 1XBWA 4DV6F 2XLJA 4NEYA 4OZJA 2QRRA 1Q8IA 2RSQA 4ES3A 1X4CA 4U95A 2AYBA 1NDKA 2ZUAA 3F44A 2PMWA 4LFBJ 4DI6A 2VD3A 3QRPA 3A8KA 1Q8LA 2EFVA 3HVTA 2RU9A 2E9ZA 2EPIA 5B0BA 4HH1A 4M95A 1NKBA 5KT5A 1VQYA 2IY5B 3R5DA 1NAQA 2BV3A 3EGVA 2ZKTA 1IBLJ 1MSWD 2VC1A 3NWGA 4FYVB 3VAGA 1FK9A 4MIWA 3PJWA 3V81B 4YB6A 1ZM2A 4UZCA 3W9JA 1YQHA 3ZNUA 4YR2A 2AD9A 1H7WA 3KYLA 4R8UA 3OXFA 3ZTRA 1VRUA 1JKHA 4ZDNA 3HK2A 1Y5LB 3OR1A 4HTJA 3K17A 2GAGC 1YRXA 3MPDA 5B0CA 3M32B 3NG8A 3C16B 1RZMA 1RSCA 1KTVA 4WPAA 2LVWA 2CFXA 1RWOB 2LQJA 4GKJJ 1FVSA 4NE9C 5DDRC 4DSKA 3ILOA 1NB7A 4F25A 2C3MA 1TR0A 1SQEA 3THVA 1X4AA 1MU2B 1DLOA 4UUWA 3DNCA 1NXIA 1Y5NB 2RS2A 5D15A 4DSLA 2EFNA 2O66A 1VK3A 4USHA 4WU2A 3J81U 1RT4A 3KLEB 2FHJD 2E44A 1JLAB 3BQ2A 5HAOA 2CQ0A 2DB1A 2KM8B 1TU0B 1LWFA 4TY8A 1FERA 2VG7A 2YH0A 3PEHA 3OLAA 1T05A 3MR5A 3SIPB 1UFKA 4XPEA 1FJCA 3QQCD 1K47A 2CKWA 2HVEA 2LLZA 1VLYA 2YKOA 3NS5A 2DYAA 1R0CB 4C2MA 2GCFA 5EWEA 1A6LA 1TKZB 2HHHJ 2YKMB 3M2UB 2RQ4A 4ZIWA 2ZJPQ 2HS4A 2N4CA 2RF2A 2GQ2A 4G1IA 4R0JA 1YJ9S 1I94J 2YKQA 2W2QP 1WSRA 3SDEA 3DRXA 2ZD1A 2H51B 3OVSA 4KKOA 2JHEA 2GMLA 2X1BA 1N5VA 3P5BP 5C5JA 3FMBA 4C97A 4C8YA 3DGVA 2Y0SD 4KO0B 4UZBA 1QVGR 1FRXA 4OYOA 5CA5A 1HMVB 3UR0A 4ED0A 2HZAA 3BGLA 1Q4RA 2B0GA 3G82A 3PCOB 3LWMA 3IM9A 1Q8BA 3MM7B 3I0SB 4B17A 3MI7X 1YJUA 3EXYA 1U4BA 2HMIA 1DARA 4HH0A 2QL5B 2HHQA 4ICLB 4WP3A 4JV2A 1RWUA 5A0YA 1S1VB 3QFWA 2BW2A 4K4YA 3DHWC 2MTLA 5SUHA 3D6TB 1SKRA 4R0EA 5DQHA 2NR0A 2RRBA 3IS9A 2Q6BA 2KG1A 4ECUA 4O3SA 3W65A 2K2PA 3C8YA 3THTA 1VHFA 2E1CA 4K50A 2XYGB 3KG0A 5KFQA 5IV4A 4RUHA 2HK2A 5KFHA 4RBVA 2EFPA 2OKQA 1RBLA 1T9TA 3K8WA 5CH7B 1NK0A 2AJ0A 1XIQA 4H4OA 3OSNA 3I96A 4X84A 3KUHA 1DQ9A 1YSJA 4J9QA 3BM7A 3MM6A 1TKTB 4ES1A 3ELHA 3I56S 2HPUA 4MK8A 5IXUA 3MPUB 3M30A 4PWDA 1WDTA 4ECVA 5KG0A 2VPYB 1G3OA 2PE8A 1I3OB 3CVKA 1Y3JA 3UD3P 4ELTA 1FKPB 1NJIT 1I5OB 3W8GA 3DRSA 2ZBRA 4HEA9 5F8MA 2J5AA 2P8IA 1QUVA 3MAQA 1KQKA 2CJYB 1GMVA 4RW7B 1GMWA 4PR6A 1RT3B 1N33F 1PC5A 1VQMS 3PFOA 2V2ZA 3N79A 3UWTA 4X4SA 5FDLA 1S72S 5T7LA 4E8UA 3MD3A 2HQCA 5FIIA 4ZJLA 2ATCB 2H48B 4OZNA 5LMUF 1WEXA 2GVDB 4MMOA 4OMFG 4DUYF 1SL0A 2DIUA 1LW2A 3UO0A 5EX0A 1SKSA 4RW6A 4OZ0A 1SV5B 3C15B 4DUZF 5CYJA 2OFGX 2YWEA 1WWHA 3SI8A 1C0UA 3DRRB 3Q23A 4I2PA 3DDIA 1GMWD 4CLKA 5I4MA 3GV5B 2W2MP 3SQOP 1YI2S 1VQ5S 4LSZB 3ICLA 4PCQA 3PIPQ 1WHYA 4LJMA 3W8PA 2IDLA 1Q5YA 5EWFA 1FRMA 3LA0A 2AU0A 1XTZA 3DXBA 1YTYA 3DI6B 2EK6A 3LGMA 4WF9Q 1TFWA 4J5OA 2V69A 4IRKA 1M5HA 4CZCA 2B4PA 4WTOB 3IG1A 5HQ8A 1LFPA 4TU8A 5M2PA 1FFWB 4ZJQA 2MXYA 2J7UA 4I1TA 2V50A 3JS9A 3UR3C 4JYAF 1HNWF 1EQ0A 2VJUA 5HROA 4JUZA 3GG1A 1WG5A 1XMOJ 4L74A 1JLCB 1KC8T 1WHVA 3BGOP 3V6JA 1JXVA 3V5RA 1FWPA 2MKYA 3NGTA 4PYDA 1IBCB 4DV0F 1VK8A 2CVIA 1X0FA 3JYTB 3CJSA 4EZ9A 2UU9J 2GMJA 3QYYA 4I69A 4AXJA 3OL6A 2GW8A 3UFCX 2D69A 4LF8J 2HBRB 1WUUA 1C0TA 2W9CB 3FBCA 2G9OA 4BDPA 4ECZA 2Q1LA 1RTIB 1R89A 2VKZG 3D0GE 4DL7A 1GEHA 3VAMA 3OFEA 4NLDA 4F3QA 2M2BA 4LF9J 3NCRA 1AT1B 2ZNYA 3HPOA 4FVMA 1WDDA 4L76A 3AXMA 2F40A 3IR7B 2HHTA 3B82A 2POKA 2HVZA 1QE1B 4P7VA 2V67A 5M2UA 3D2WA 2QA4G 1CVJA 3E8OA 2YNGA 2J9DA 1JXLA 1O51A 2CG8A 1T9WA 4LUBA 2GJFA 3RYLA 3HP6A 1SJQA 3PHEA 1U6FA 3JQKA 3PXGa 3L95X 1EAYC 2U1AA 4RWXA 3O8WA 4OJ1A 1SVDA 4L3KA 5DGAA 2JFKA 6FD1A 4NLUA 1L3SA 3CEDA 3TVZA 1C1CA 3CCLS 3OTOJ 5IT0A 4HYKA 1RAFB 1SC4B 4RL1A 1LQ9A 2DH9A 3O44A 4KV8B 1GK8A 3M1VB 2X51A 4B3OB 2UXBJ 4KYZA 1SH3A 2GIFA 5HVGA 3HF5A 1YJTA 3HULA 3T1HJ 5IT4A 5K9FA 2V6AA 4M1KA 3TNVA 4EUVA 2DGTA 2NXJA 3LWLA 1MWZA 1SC1B 4C11B 3CMQA 3MR2A 2CPYA 3LP2B 3K58A 1YIJS 1SH2A 1UJ5A 1NSKL 4J9RA 5KFVA 1HQUA 2Z4PA 1EETB 1Q16B 1G2EA 4USWA 2KYXA 3WX4A 1Y3KA 1ZAVA 2UXDF 4B9SA 1TL7A 4B9VA 7AT1B 3PG9A 4IG0B 4NL5A 1X9WA 2FD2A 2R2TA 2CVEA 3WHIA 3W7BA 4MTPA 4MAKA 1JLGA 3TUPA 1YRTA 1HYSB 2F9JA 4CLZA 1B0PA 1TMJA 1NPRA 2OPRA 3C6TA 5AT1B 2JOQA 2R8KA 5I3PA 3DLGB 2HQFA 2K7KA 2KJVA 4ANEA 1IN0A 3J7A1 2R7VA 2W1BA 2KT3A 1XERA 4DSJA 1HNXJ 1TAUA 4OI0A 4LRCA 1URNA 2WAQD 4U7CA 4F4KA 1WI8A 4ZVHA 3OTBA 1R6YA 1DTTB 3KK3B 4NLGA 4FNHA 5A8WB 2P6TA 1RWKB 2V4JA 3DLJA 1RAIB 3K5PA 5T14A 1KLNA 2JVRA 4G1QA 4X4QA 4LFAJ 1TMMA 2KL8A 1HNVB 4ID5A 1IUJA 1I51B 3G2XA 2H3EB 3T5HA 5C25B 3R6GB 2R8IA 5A8RA 4X4UA 3NNAA 1IR1A 4OHVA 1EP4B 1FRKA 4BS2A 3UW1A 3CF5Q 2Y1JA 2QA2A 4WE1A 2RQCA 2XI2A 3DKDA 2W01A 2OO4A 1LWEB 1JJ4A 3F0NA 3M8ZA 2BE2B 3CJ2A 3IR6B 3ZTPA 1SB6A 2M8DB 1HHQA 4DV2J 2V8PA 3UCZP 3L9ZA 4O3OA 1U1NA 3ZXWA 3T5JA 4P2MA 1S4EA 4A8SA 1YWXA 1QDUB 2CQIA 2ZC3A 3A3OB 1S49A 4UW2A 3KJQB 2GNKA 4FPRA 2LU2A 2I8EA 4DX5A 1FKOA 1NK6A 3JSMA 1XQIA 1WORA 2F9DA 2AJFE 3EGNA 4EO6A 2FLNA 4KH1B 2C2EA 4DU7A 1GQEA 2LDYA 3FSXA 1RAAB 5ETPA 2VA3A 2K06A 2BBEA 5HO4A 2XI3A 5A2QU 1KHVA 3ZNJ1 4KC5A 4WKYA 2HVHA 4F3MA 5ETOA 5DLFA 3LP1B 4DL4A 2HAIA 3GMGA 1WNEA 3QZ8A 3DRPA 2FJDB 4LMZA 1H7XA 2C2DA 2B51A 4HTIA 4QWAA 2R2SA 3PO4A 3MEEA 4I7FA 4Q5VA 3K0JA 3EYZA 1HW9A 1D8YA 2YNFB 4NEZA 3M6UA 3QLHB 1AXQA 3OBIA 3BSOA 3LQVA 5J2QB 2IVYA 3RTVA 2CJ9A 4CLLA 2XS5A 2XS2A 5LSRA 2R8HA 6AT1B 3M9OB 1VCTA 4X2BA 2IM3A 4BC7A 1H98A 1T9VA 3PW4A 4AFFA 3UNYA 1H0HB 1S1TA 3N0VA 5DDOC 2R4FA 4KFBB 3ISND 5HI7A 1Y0HA 2L9DA 3KNAA 2I5JB 2ASJA 3DMJA 1WI6A 5LT5A 5AXLA 2KG0A 3DM2A 2MDAA 4I6AA 1LFWA 1HI1A 2W7AA 2YWKA 5IOLA 2VV5A 4DV5F 4DOZA 3EMTA 1RB0A 3G8QA 2EKYA 2NS1B 4K5RA 2BKPA 5D3GA 2ZH3A 1J27A 2GZOA 5AJ3J 3KUEA 4LIWA 3ETOA 2KDOA 3D0IE 5KG1A 2B4VA 4YP3A 3BGUA 1CLFA 1ICEB 4ZP8A 3LAMA 5KT3A 2XHWA 4B3MF 4C4WA 1VQ8S 3CJ5A 3OTCA 3NGUA 3SZ2A 4CO2A 4I64A 4RW9B 4OYZA 1R0BG 1RAOA 2ZE2B 4OX9F 2OH2A 3HHLB 3T9NA 1UVNA 4DR2J 3QJLA 2O3DA 3D6MB 1RWMB 1PGZA 1ZPWX 4I2QB 1R31A 3C3LA 1ZM9A 3OJSA 2DVIA 1EKSA 2IJFA 4GVLA 2O5DA 3K59A 3D0HE 4C6AA 1CJKA 4HT5A 4DX8H 2HK3A 5H1SV 1HQEA 2VG6A 5E33A 1CBKA 1Q86T 2KO1A 1U1LA 3NGKA 2BANB 1X7VA 4Z2XA 2QL7B 3UD5A 2YX1A 2AEMA 4UY85 4X66F 1CC7A 2C2ZB 4WK1A 1E6YA 3SCKE 4NLPA 2LXIA 1RJJA 5L39A 2BJ9A 3KLGA 2MZQA 2BZ2A 1LNQA 3CDEA 1VBZA 4R5PA 1HHTP 3VGUA 3CWJA 3SCIE 3BS9A 1VQ6S 3NAIA 3FBEA 3TAPA 3LGHA 2EBEA 4LF7F 3Q8VA 2QA4S 5HMYA 3R3TA 3A4TA 2FTRA 5HSPA 2OTLS 3EGWB 4IFYB 3IXQA 3CPWR 5KT2A 3WIVA 1IWGA 5E3RA 1XNRF 1RYSA 2HGMA 4PUOA 4LBIA 4DV3F 4N47A 3V2UC 3R5BA 4LF5F 4QIEA 1RT7A 2K3KA 4F7VA 3OL7A 2V0NA 4BWJA 3VGTA 8ATCB 4WFXA 5LXRA 4Q43A 2FC8A 3NWRA 2XMMA 4KGKA 2DXDA 3IBFB 3IWLA 1OWXA 4YOEA 1AZSB 2AX0A 4TVAB 4QWBA 5GVQA 5GMDA 4B3TF 1FHTA 1SKWA 1JLEA 3ZZTA 4IH7A 3KK2B 5F8NA 1G1XA 1K1SA 3AODA 2PMHA 3T1AA 4X62F 1VYAA 2QLJB 1SQFA 3TZWA 2EC2A 3E01A 4CLWA 4PAAA 3SEOA 4W4MA 3HI9A 3VVTA 3KUGA 3ISZA 4WIQA 3MR7A 4EU0A 4L75A 4J9LA 3KTQA 3N01A 4C0OC 5IZHA 3M2VA 1N5YA 1UMJA 4FNIA 4KJIA 2FGCA 2K3IA 5I3QA 2CADA 2L3MA 4NLQA 4DR6F 4DV4F 1T3NA 2XBPA 2HKEA 4UTGA 4MFBA 2NSBA 1KFSA 1J5EF 2MKJA 1M5PC 1V3RA 2V8DA 3WIUA 2Z2YB 3DFEA 3U1NA 2VH7A 1ZTTA 1HNIB 4NLSA 3J81j 5JUMA 3UQSA 4ZMMA 2W8LA 3B8HA 2RDIA 2DNRA 4DSFA 2DHXA 4DX6A 2XZTB 3SYZA 4DV6J 2AEJA 4DBQA 2VICA 1CPZA 1X5TA 3NLCA 4UUXA 5HJYA 3MMAA 2ZBCA 3JTPA 2KM8C 2AYGA 4NCAA 1T0TV 4ZPDA 1RHMB 4JB8B 1GAOA 2EKNA 2LFVA 3LO3A 2H4YB 4QIFA 5HATA 4PWUA 4YS2A 1FA0A 1NSPA 3MM8A 1S6UA 1EJ7L 4NA2A 4IKAA 2DEJA 4CDIA 3V6DB 5HANA 1U6BA 4ECTA 2MZ1A 2V4QA 5E3CA 2OSQA 7FDRA 1O0PA 2UUTA 3B4MA 3BN7A 1VQOS 4L72B 2Q43A 2I2YA 2PC6A 4P10A 4AE5A 2Z56B 1PBAA 2C3YA 4YB7A 1LWXA 2ABYA 2OPPA 5D4OA 2AEFA 4M5KA 5F9NA 4LF1A 1FE0A 3ENQA 4AQYF 5K8PA 2LEPA 4PG6A 1UPMB 2AYEA 5L46A 4JI6F 2LCWA 2R42A 2DRBA 1ITPA 4OZ5A 3MMBB 4ECWA 4OZ1A 2WONA 2JSXA 4AL5A 3HSGA 2AWZA 4ZLJA 2D3UA 3MM9B 1FJEB 3GJSB 1HLWA 1YRUA 1YX2A 9ATCB 3CNQP 3TYTA 1NNDA 4KTQA 3NBPB 1JQGA 2R2RA 3HLUA 1VBYA 1BC6A 2GVZA 3OVAA 5CYQA 3H8YA 2DRDA 2MGZB 4ZVQB 4DN9A 4Z7YA 4FF3A 3E3XA 4PQUA 2OELA 2WVDA 1HWIA 1WJ9A 5GMKa 2B6AA 4IO1A 4ZPVR 1VBKA 4Y3CA 2GQQA 1RAHB 1WHXA 4GVBB 3IWXA 2CIMA 3H2VE 2H5JB 4OV1A 3TUIC 3AJDA 1RYRA 2Z58B 3OD2A 1B70B 1PBUA 2CQHA 2CPEA 3TR5A 3D9BA 3BGRA 3GG0A 2VJVA 4JI2F 1JLFB 2B7BB 1JLQB 3MUMP 2HWHA 3FZ2A 2Y1IA 2QZ8A 2BA9A 1NDCA 2YKAA 2V9KA 3AH6A 2MLZA 4S0MA 5KFAA 2LXFA 2DR5A 2N82B 1RTJB 3HFZB 1P9YA 4DS4A 3R7SB 5F9LA 3ITHB 4DQQA 1SCJB 4ZCIA 2R7RA 3CB4A 3SQGB 1QVFR 1OO0B 4HI1A 4ZP6A 1KEKA 5AXMA 2DGUA 2OEMA 1VGYA 2XYPB 4IH6A 1R6VA 4TQRA 1AYEA 3CO0P 2J9DE 2DNLA 3GYXB 3BKTA 4H54A 3AD7C 2A2CA 4H4MA 4V19J 4NXMF 1W7WA 3KXDA 3MMJA 1R8PA 1AFIA 4RU2A 3MTJA 1YJ7A 5HK4A 2CPDA 3A13A 3WC0A 2P9GA 2LP4A 5KFPA 1Q5VA 1V6HA 1HBUA 1FNXH 2NXCA 1FDDA 4Y34A 3BZQA 1QM9A 1HPZB 3BR9A 2FZKB 2QTWA 4GRSA 4JI3F 3BQ0A 3QPIA 1X4DA 4YR3A 2KRBA 4JI8F 1C1BB 1Q1KA 1VRTB 2HNDA 3SV4A 4EGLA 2IAJA 3ET6B 3LF0A 4DQSA 2G1HA 4HKQA 2OUGA 1FI4A 2DO4A 2GC8A 2LEAA 1H73A 4FVCA 3V6HA 2LQBA 1N6QA 4ZVRB 2GHPA 3FKBA 1NK8A 4DCPB 5B0FA 1LKZA 1WTBA 5ETVA 3PW7A 1WF2A 2YQ1A 2DTJA 2CQCA 3TP2A 4IG3A 2DHAA 1U2CA 1OPIA 4ZVPB 4RNOA 2OTJS 2ZITA 2C22A 1BHNA 2KZMA 1T9UA 2W8KA 5FLXU 2JH3A 2M52A 1WELA 1BWEA 5D0EA 1REVB 2XMTA 4P73A 2IVMA 5A8KA 3LOUA 1PJ5A 4J9KA 4A8MP 4URSA 2ZJRQ 2HQDA 3PRBA 1T7PA 1VQPS 2MKIA 3NXZA 3TW0A 1S9GA 1VIXA 4IR1A 3FMWA 3EJMA 1UWAA 3BV8A 4DLEA 1U26A 4DUYJ 2J8AA 1U2FA 2APOA 3EVMA 5GAGU 5E0OA 1BQMB 4EBDA 2AMCB 2BQ3A 3G71S 4DUZJ 2FVSA 4ED5A 4UOFA 4X4OA 4WYWA 3S01A 2ZM6J 2KU7A 2F8EX 3MPVA 4Y6IA 2G2OA 4P7TA 3TAMB 4RR5A 3W2WB 2JC0A 3GTYX 1T9XA 1EQMA 2V2KA 2DD8S 2E5JA 3BBCA 4DR4J 2RKIB 2NPFA 2AIRB 2N7YA 2W7PA 1U49A 2MMYA 1LW0B 4UT4A 1N0UA 1VDHA 2W25A 3H5YA 2ZC4A 3VALA 2NYHA 2K7JA 3BN4A 5CYMB 2R7WA 1ULRA 5KFOA 5E3AA 2XCPA 2IC3B 3VQSA 3V81A 4ZPCA 2RT3A 2GHVC 2W7OA 4PPDA 1Q53A 1NJWA 2W9BA 1J2VA 1S1WB 3M05A 2UV8A 3CMAS 3ZFVA 1OYEA 5D4PA 3NRBA 3MHYA 1RLCL 2CZ4A 2HFUA 4H4KA 5HMZA 2E1PA 2WVCA 2VBWA 2DT9A 4QR1A 2RH3A 3DYAB 5ETKA 3M32A 1KQSR 2DNKA 3KHRA 3C16A 4JYAJ
chains in the Genus database with same CATH topology
3PACA 2E1CA 1W25A 3M6XA 4WIIA 4PG7A 4K50A 3GFHA 3KG0A 5KFQA 5F3TA 2DGXA 2UUBF 1B0VA 3Q8SB 2HHUA 4RUHA 3FNNA 2P5VA 3H20A 1TP7A 2CYYA 3PKMA 2H9ZA 2UV8G 2ZH6A 5KFHA 4RBVA 2EFPA 3IWNC 1MU2A 1ZBTA 5LMNF 2OKQA 4KBIA 3J7YU 2NUUG 2RNEA 1SJRA 3OXLA 3G86A 3VWSA 2BM1A 3K8WA 3O2IA 5CH7B 2ASDA 1NK0A 2AJ0A 1S99A 4H4OA 3OSNA 1SJ3P 3I96A 4X84A 5KG6A 2JEFA 1DQ9A 1LK7A 1UW4A 1YSJA 2RVJA 3T9ZA 1SC6A 3BM7A 4J9QA 3MM6A 3PM9A 1TKTB 4ES1A 2XWXA 3I56S 2HPUA 4MK8A 4PXEA 4ETZA 5IXUA 5DG9A 1C0TB 4DLGA 3M30A 4I6WA 2OPQB 4PWDA 2PFFB 3UE2A 3HZEA 5AE1A 1GXUA 3KLEA 5E2QA 2QSFA 4ECVA 3V6KA 2M5YA 2HWTA 5KG0A 3DXSX 2VPYB 3CXCR 2CQBA 1BLUA 2QEXS 1C2PA 1G3OA 3DRYA 3KLFB 1FD2A 2PE8A 4J9PA 3CVKA 1Y3JA 4DFKA 2B56A 3UD3P 3CCWA 4ELTA 1FKPB 3TA1A 1NJIT 4D3GA 3PW2A 4KRWA 3DRSA 1F2GA 2DRAA 1C4AA 2XMJA 2A18A 1L3TA 4Y2MA 3I32A 1VRUB 4PPZA 2LEBA 1S7HA 5J1EA 4IRCA 4LIRA 3CMES 1GT8A 4FYDA 3JB9k 1A9NB 4HEA9 4NOHA 5F8MA 2J5AA 4NLVA 1APSA 5KFEA 2ROGA 1QUVA 3NCQA 4CO0A 1KQKA 3KHLA 4RW7B 3MAQA 1ROFA 2HHHF 4PR6A 1RT3B 4CQ1A 1N33F 1REVA 1PC5A 1VQMS 3PFOA 2FVQA 1UETA 2KXNB 3N79A 2GIQA 2W4PA 3UWTA 4X4SA 1MMLA 1FEHA 5FDLA 3G4SS 3PZPA 1S72S 4ZCKA 2KH9A 5T7LA 4HL9A 4E8UA 1I1GA 3MD3A 1TV6A 4XDDA 5FIIA 1KRPA 2UVRA 4TXSA 3DLHA 2HG4A 4I0WA 4OZNA 1FTRA 2YNGB 4B3RF 5LMUF 1WF0A 1TKZA 2X1GA 4OHXA 2YKMA 1S10A 3M2UA 1BQNB 1WEXA 2FGOA 2ILZA 2DNYA 4LQ9A 4MMOA 1X5SA 4OMFG 3CCZA 1V9OA 4DUYF 1SL0A 2FLPA 2DIUA 1MROA 3IRXB 5DLGA 1BD6A 4OJGA 2IVFB 4YHHF 2BQRA 1LW2A 1V3SA 2DNGA 5D77A 1RA6A 3FFIB 4Q8EA 5EX0A 4HT7A 3HHEA 3POTB 2EG2A 1SKSA 2MSTA 1NK4A 4RW6A 3RB0A 2FVCA 3PDNA 4OZ0A 4ZPBA 4QR0A 1SV5B 1S97A 2OD6A 4DUZF 2IRUA 2DGOA 2NLWA 5CYJA 4M63A 3DOLB 2DNOA 3MPYA 5U47A 3Q2TC 2OFGX 4CT8A 4KB7A 5DRKA 5KFWA 1UL3A 2YWEA 3I9V9 1FCAA 1WWHA 3FEXB 3SI8A 1C0UA 3DRRB 5IT9Y 3LW5C 5J2MB 4K4TA 1BQMA 2VPXB 1D3WA 1Q79A 5C42A 3Q23A 4I2PA 1FJGF 1NHVA 2HQ3A 2FJAB 5I4MA 3GV5B 3CD6S 1C1CB 2IBKA 1UA0A 2UUWA 2F3JA 1TL1B 1YI2S 5AE3A 4CO5A 1NJXA 4QU6A 1GX5A 1S0MA 1VQ5S 1LWFB 3MDFA 2OAUA 3ICLA 3N6LA 2DPIA 4OLPA 2VG7B 1TL3B 1UJ4A 2IM2A 1U1OA 4JI4F 4YEAA 4KO0A 2YNIB 4IH5A 3M8SA 1XN9A 5D4LA 2E7WA 3MEGA 4PCQA 1DJ0A 3PIPQ 1WHYA 5G4DA 4L3NA 3SFGA 4ELVA 4ZCMA 2HZCA 3TI0A 3TAMA 4J9OA 4PQAA 3W2WA 1WEYA 4LJMA 1R43A 2ADCA 3EPGA 2MQQA 2C2RA 1HMVA 2JEIA 2RKIA 5EWFA 1FRMA 3I31A 1R8AA 4DL2A 2AU0A 1M5KC 3T6BA 1K8AT 1XTZA 3DXBA 5F41A 1YTYA 3DI6B 5KT4A 4QYZJ 3ZZOA 1LW0A 2EK6A 3H5SA 3RBDA 3LGMA 3R1LA 4WF9Q 3CCUS 1TFWA 4J5OA 4IRKA 1M5HA 2SXLA 4K4WA 3SXLA 4WCEQ 3MM7A 3I0SA 4CZCA 3G6VA 3MM5A 2XMKA 5CYMA 2R8GA 2B4PA 1G6BA 1NO8A 3IG1A 1OIAA 4M5DA 5HBMB 5HQ8A 2C3UA 7FD1A 1U1KA 3M2RA 3OL8A 1VQ9S 1NJZA 1UEVA 1DTTA 1LFPA 4TU8A 5M2PA 2FJBB 4ICLA 3CULA 3M8PA 1R0AB 1F60B 2MXYA 5JJBA 1H2VZ 1CQMA 2J7UA 4G3IA 1K0VA 5H9EJ 4I1TA 3B78A 4CO4A 1HQUB 1S1WA 2HGNA 1YGYA 4MKYA 3UR3C 5L9XA 4ZP9A 4JYAF 1HNWF 5EUHA 4IUFA 2IFXA 3VTIA 4DL5A 2JVOA 1T95A 2WSCC 4KKOB 2BM0A 2IRXA 4ZLPA 1DBDA 1IJEB 3N6NA 2XCAA 1QLNA 1JLBB 2L41A 3MCSA 3H5XA 5HROA 3J7Z5 3DYAA 4JUZA 4B9NA 3HO1A 1R8HA 3F56A 3DGPA 3GG1A 2AJQA 4RW8A 1RTHB 1WG5A 2EI5A 4F2RA 4O44A 4QPTA 3HHNB 1JLCB 4C8NA 4A8WA 1NH8A 2B7CB 4A47A 4ALZA 3DDNA 1KC8T 3OVBA 5J2PB 3M6VA 1U09A 4CT9A 1WHVA 3TUZC 2QA1A 4HI2A 3V6JA 2VONA 2M88A 3V5RA 4TU9A 5JVGQ 5LJ5Y 4GMKA 2DNPA 2GGPB 2OPRB 3C6TB 3SV3A 1ZM3A 1H2UX 3VAJA 4EO8A 1T3OA 3U1LA 1G7CB 1TKXA 4DV0F 1VK8A 3PFEA 2CVIA 1RKJA 1X0FA 1XC9A 2CJKA 3JYTB 3NNCA 1TVRB 2Z8QA 4DN0A 1HBNB 2HRUA 4EZ9A 4KIAA 5J1NA 3OSPA 1N48A 2W24A 4QBUA 3N9UC 2GMJA 3QYYA 2KI2A 4I69A 4AXJA 4NLYA 2CPXA 2CQPA 2RD5C 2J0SD 3MUTP 3OL6A 4IRDA 3KK1A 5KAKA 2LXUA 4HDGA 4TYAA 2GW8A 4UOCA 3UFCX 4C3MA 1VC0A 3GYNA 1C0TA 2CQDA 3N6MA 4TNOA 4ZPWR 2G9OA 2W9CB 2OPQA 2R7TA 2MKHA 2UUCF 4FN5A 4BDPA 1S48A 4ECZA 4X4VA 3FEYB 1IJFB 2Q1LA 2KN4A 1RTIB 1R89A 4Y2CA 1N36F 1WG4A 2VKZG 2BE2A 1NK5A 2K8GA 3MEKA 2CG4A 3M8QA 3D0GE 1XNQF 1S0VA 4DL7A 3KLFA 1JK9B 1LXNA 3MR3A 3VAMA 2XGPA 2HGLA 3OFEA 3NL0A 4ITSA 1FKPA 2W9BB 4NLDA 3OL9A 4G1QB 3CJ4A 3SCJE 4F3QA 4JI7F 2XSFA 2N7CA 2XG8A 3DLEB 1X5OA 2M2BA 2X1AA 4OI1A 2FHJA 5J1PA 4ELUA 4I4BA 2YQ3A 4NLRA 3NCRA 4ID5B 1X9MA 2ZOGA 3KHHA 2YX7A 4Q2LA 2ZNYA 4OQJA 3HPOA 2ZKUA 4FVMA 1JJ2R 2GQCA 2JC1A 1WHWA 1E6VB 2F40A 3DN9A 4OFZA 4RW7A 4ED2A 3CIZA 3IR7B 1RT3A 3EGZA 3B82A 4DQIA 2B3TB 2POKA 4N56A 2HHTA 1YJRA 2HVZA 4K4UA 4QWCA 1QE1B 4P7VA 2RU3A 2LKZA 3A8EA 4OI3A 3SSRA 4NZ0A 5M2UA 3D2WA 2QA4G 1CVJA 5KT6A 4DR1F 3E8OA 1UAWA 2PDAA 1LK5A 3N5BA 3OTEA 3KMSA 2YNGA 1P6TA 2ZZNA 2J9DA 3MZIA 3DU6A 1JXLA 2UUAF 4WKRA 1BQNA 2JDJA 1O51A 3TQ1A 3G6YA 5K14B 3VAKA 4O3PA 2MQNA 1D8ZA 3I55S 3IRXA 2F1FA 5T41A 4ZP7A 1F5CA 2FB0A 2CPFA 2GFFA 4JOUA 4ED1A 3S6EA 1ZAWA 4U67Q 5BJRA 4C8OA 2ZNZA 4LUBA 5K8NA 2YKNB 3POTA 5ITHA 1WF1A 3KJVB 3RYLA 3HP6A 2VPZB 1SJQA 1CSJA 3PNIA 3PHEA 4WE1B 2YX4A 3CUNA 1U6FA 4NRTA 1OQ6A 4BCAA 3PXGa 3L95X 3NGDA 3DOLA 2QSWA 2J6UA 3OFFA 4JI0F 2MY7A 2U1AA 4RWXA 4NLXA 4WTYA 3O8WA 4OJ1A 2ZHBA 2ACYA 3CCSS 5DGAA 1PILA 2JFKA 4ETXA 2ZZMA 2N4DA 4NLUA 6FD1A 1QTMA 4YUDA 3DRRA 2ZDPA 4ZCLA 4QYRA 1L3SA 3NP5A 2U2FA 2KFYA 4DS5A 5J2MA 1NU4A 3QO9B 1ELOA 1RGVA 1SUQB 3CEDA 3TVZA 2MJUA 1C1CA 3CCLS 2GA7A 1X4FA 2X3GA 3DRSB 3UDLA 5KG2A 1S76D 5IT0A 2VFVA 4HYKA 4KHPF 1TL1A 4LSLB 1ZYQA 1LQ9A 2DH9A 2QLXA 2WOMB 3O44A 4E98A 1TL3A 2HYIB 4KV8B 5FD1A 2V4RA 2LMIA 2YNIA 3M1VB 5K8OA 2IRYA 2X51A 4X64F 4B3OB 2WK4A 3HJFA 1SH3A 3TUJC 2C3PA 1RT5B 5HN0A 2M4MA 1D9FA 2L08A 2AJ1A 3HF5A 3RB6A 1FKOB 1YJTA 3FZBA 1KQFB 1UJ6A 2CPJA 3RU0A 4DG1B 4RUAA 5GAHI 1L3VA 2E9TA 5IT4A 5FDLB 1T03B 4MKAA 5E5NA 5AXNA 5T7LB 3JSMB 3DI6A 5F8HA 3MOJB 3MD1A 4IOAQ 4RZRA 5K9FA 3DCAA 3S1TA 3M9MB 4M1KA 3IAS9 4OX6A 3TNVA 2IYIA 1R27B 4EUVA 4XK8C 2DGTA 2E7XA 2G13A 3Q8RB 2HNYA 4DFPA 3LWLA 2B9XA 2DGVA 4FXDA 2Q3PA 1MWZA 5HBMA 5ADZA 4NZ6A 4WFNQ 4B9LA 4C11B 3BSCA 4KGMA 3ZZUA 3MR2A 4DL3A 3MFHA 3BGFA 2CPYA 3H98A 5J2NB 1LW2B 3LP2B 3K58A 1VQ7S 4OX7A 5CHCB 4XO0A 3MEDB 1YIJS 4W90B 1R0AA 2LYVA 4OI6A 1QUPA 2FDNA 1L3KA 1SH2A 2RRNA 1UJ5A 3N4WA 4J9RA 2DBBA 5KFVA 1HQUA 2FC9A 3DHXA 2Z4PA 3HXMA 2XY7A 2XMUA 1HNZF 1SH0A 3ENWA 1QAIA 4OHYA 2D1CA 2I0XA 1EETB 1VC5A 1HBOB 1Q16B 1TUVA 1RKIA 1U1PA 4LFBF 1VQNS 1G2EA 4RUCA 1AW0A 1KVJA 4ATNA 1U8SA 2KYXA 2P6SA 4ID8A 4ZPTR 4RWWA 3WX4A 1Y3KA 5KG3A 1ZAVA 5L1LA 2H5EA 4B9SA 2UXDF 5KTQA 4EBCA 1FRJA 2BXJA 4B9VA 2V9WA 1JLBA 4WZQA 3QMQA 2FPHX 4IG0B 2M70A 4C8KA 4NL5A 5C42B 1X9WA 1CQNA 2HS0A 1S1UB 3UPFA 2FD2A 2VOPA 1FXRA 2R2TA 2QE5A 2QYCA 1I6JA 2CVEA 4MYUA 1RTHA 3MEEB 4F2SA 2XLKA 5CZXA 1LV5A 4IOCQ 1U47A 1JLCA 4OLOA 2UU9F 1N5QA 1WACA 3W7BA 4IO9Q 4MTPA 4KQZA 4MAKA 1JLGA 5J2PA 3MF5A 1GTEA 1YRTA 1IBLF 3FCHA 1HYSB 2MZSA 2HWIA 5KG7A 4N5SA 2F9JA 1B0PA 1RI7A 2CDQA 2GGPA 4C8MA 4LF8F 2OPRA 3C6TA 3R5AA 2JOQA 2B9YA 1M1KT 2R8KA 5I3PA 3O3LA 3DLGB 3VZIA 1HD1A 5MAOA 4WXOA 2J7WA 2K7KA 1NZAA 1QSLA 2KJVA 3JYTA 1TVRA 4WZMA 1HBNA 1IN0A 2VFTA 3J7A1 2R7VA 1SIZA 3JTOA 2KT3A 1XERA 4DSJA 1S6QB 1TAUA 2COLA 4OI0A 4F50A 3LAKA 1URNA 5KFRA 2WTFA 1IQTA 1UEUA 3HHLC 3QZ7A 2DGQA 4A8QA 3P5TL 3QAEA 2VG5B 2W9CA 2LQ5A 2NXUA 2WAQD 3BREA 2NUHA 4U7CA 4F4KA 4LF9F 1WI8A 2JJ4D 4ZVHA 4ED3A 2XY6A 4KT0C 3PX6A 2V94A 1WD6A 1RTIA 1R6YA 3CDWA 3OTBA 1DTTB 3KK3B 5MLCV 4NLGA 4FNHA 5A8WB 2KKHA 2P6TA 4Q0BB 2Q79A 3PW5A 3SMZA 2V4JA 4YB1P 2HRYA 2PA3A 3DLJA 3K5OA 3WZ0A 3K5PA 4RU9A 4USJC 5T14A 1KLNA 3VF0B 2JVRA 4G1QA 4FS1A 2RB7A 4X4QA 2ZH7A 1JX4A 1S1TB 3DLEA 1ZM4A 4O23A 5LSOA 1HNVB 4ID5A 3GIKA 3LH2S 4CNZA 3DMJB 3TOQA 3KOAA 4I2QA 3JAMY 2XZWA 1IUJA 2HW3A 2VBYA 3DOMA 1E6VA 3N5FA 3OR2B 3DM2B 4YMEA 2FVPA 1Y5IB 2RQKA 4ZVFA 2DK2A 4Y0FA 4MH8A 3VCDA 5D6GA 3T5HA 3P6YC 4WFAQ 2AYMA 2JL9A 4OIXA 5C25B 3B4DA 4IQMA 3IR5B 1QE1A 2R8IA 4MJKA 2XO7A 1PO6A 5A8RA 3NMRA</