1VJWA

Structure of oxidoreductase (nadp+(a),ferredoxin(a))
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
59
structure length
59
Chain Sequence
MKVRVDADACIGCGVCENLCPDVFQLGDDGKAKVLQPETDLPCAKDAADSCPTGAISVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords FERREDOXIN(A)
publication title Small structural changes account for the high thermostability of 1[4Fe-4S] ferredoxin from the hyperthermophilic bacterium Thermotoga maritima.
pubmed doi rcsb
source organism Thermotoga maritima
total genus 14
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 1996-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00037 Fer4 4Fe-4S binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1vjwA00
2C3PA 2PA8D 5CH7B 1DAXA 1F5BA 1Y4ZB 1KQGB 2WSEC 2C3UA 1FEHA 7FDRA 1JNZB 1FCAA 2VPZB 1F5CA 1H0HB 1FDBA 1FTCA 7FD1A 1BLUA 1G3OA 1VJWA 2XSJB 1GTEA 3EGWB 1KEKA 1FRJA 1HFEL 3OR1B 1FDNA 3OR2B 2FJBB 2FJAB 4XDCA 2WB1D 2XSJA 1B0VA 4L6V3 3OR1A 4AYBD 1DFDA 2O01C 1AXQA 3OR2A 5BYSA 1A6LA 3MM9B 2WAQD 1BWEA 3MM9A 4XK8C 2ZVSA 2C3YA 2IVFB 2WSFC 3IR5B 3EXYA 3PNIA 4Y28C 5CHCB 1FRKA 1RGVA 2FJEB 5BYQA 5L8RC 1H7WA 1FRIA 2PDAA 2FGOA 4OMFG 3MM7B 3EUNA 1FERA 1BD6A 1XERA 1Q16B 1FRLA 4KT0C 1C4CA 3MM7A 1SIZA 1C4AA 2VPXB 2VPYB 3MM8B 4YDDB 2Y0SD 1FDDA 2UZAA 3MMAB 1G6BA 1FD2A 1ROFA 3MM5B 1KQFB 3C8YA 4DHVA 2GMHA 1WTFA 3MM8A 2VKRA 1Y5LB 3MMAA 4CI0B 3MM5A 3GYXB 1FF2A 3HKZD 2FD2A 2FDNA 5E7OB 1Y5NB 2C42A 5BYRA 4XDDA 1F2GA 2C3OA 2FJDB 1FXRA 3LW5C 1R27B 2V4JB 2Z8QA 1IR0A 1FXDA 2VPWB 3MMBB 1GAOA 1D3WA 1SIWB 2V4JA 1DURA 1GT8A 1PC4A 3IR7B 5FD1A 2V2KA 3MMBA 4ID8A 1FRMA 6FD1A 1FRHA 1SJ1A 1PC5A 1FDAA 3IR6B 4OV1A 1B0TA 3MMCB 1IQZA 4RKUC 1GTHA 3MM6B 1CLFA 2PMZD 1BQXA 1JNRB 3MMCA 1H7XA 1H98A 1BC6A 3MM6A 1JB0C 1K0TA 6FDRA 1Y5IB 1FRXA 1B0PA 2WSCC 2GMJA 2C3MA
chains in the Genus database with same CATH superfamily
5FLXU 1GXLA 1YWXA 4O44A 2BBEA 1RYSA 1CQNA 1NU4A 4C8ZA 1YIJS 2XG8A 2K1RA 2DHGA 4AUKA 1E6YA 4QWDA 1S77D 4JI4J 3C15B 1SC4B 4K4WA 2JH3A 4LBIA 1GK8A 5HROB 2DNMA 4IG3A 3OTCA 2ALYB 3HT3A 2JEFA 3IRXB 2HS4A 2FUG9 3MEEA 3VHQA 5C42B 3ZZRA 1QSLA 1RT5A 3CXCR 2C42A 2G2OA 4UT4A 3BM7A 1EJ7L 4R0JA 2E44A 4YB5A 5LSRA 4EYIB 2VA2A 1HNVA 3VAMA 4MKVA 2A0FB 4P72A 3QT5A 3KG1A 4Z7YA 1HD0A 4U95A 4OZ2A 1S1XA 2OD4A 4CO0A 2RUSA 3G6XA 4JI4F 1TV6A 3RBEA 1VBXA 4ZVPB 1QAXA 3CEDA 4I6YA 2WVEA 3CCVS 5B08A 3W2WA 2ZWOA 4NPOA 1TKZB 3TAQA 1AYEA 2PN6A 4U96A 3VF0B 4C9DA 2A2DA 1WKJA 4QIWD 2D3ZA 3FCVA 2BJ1A 2BMBA 2RS2A 1JLBB 2HVIA 5EUHA 4NEYA 4YR0A 1NO8A 3TUJC 3U1LA 3L95X 2JOQA 3KLGB 2X1AA 1UKUA 1MMLA 2YX7A 5LOQA 4YR3A 1XJWB 3SI8A 1R8BA 4DR5J 4P7TA 4KO0B 3BO3A 2GGPA 2DIVA 4LBPA 4RL1A 1U45A 2W01A 2KG1A 1S48A 3D6FB 1AZSB 4MYTA 4RWWA 5DZ6A 5DGBA 4N56A 1ZM3A 3BJYA 2KRBA 1Y4ZB 3QGHA 2Z2LA 2QMUB 3IP0A 4WTOB 3J80U 4HI2A 3CDAA 4FXVA 3CJ8A 2VL1A 5DZ7A 1F9HA 2V8DA 3NG8A 4QR1A 4BS2A 2DEJA 1UA1A 2OHDA 5KFDA 3O5TB 3PACA 3QO9A 1SKWA 3ILLA 3SCLE 2OIHA 4WE1B 5KFNA 2IM2A 4XAKA 3EZUA 4B3MJ 1N48A 2H3EB 1D8YA 4DR5F 4GKJJ 4PYAA 2ZH5A 2DGUA 4K4SA 3TARA 4DZ6A 3UN2A 3IBWA 1ZETA 1K9MT 1IR0A 3W7BA 1S1TB 3BKUA 1GT8A 3EPIA 3JXOA 3UDLA 3VAFA 2ZC4A 1UWAA 1TELA 5A2QY 1ZYQA 2WSCC 5KFKA 2QA1A 2WTFA 4PG6A 3UCGA 1MROA 4GVBB 4IFVB 2XLJA 4NOHA 2GVDA 4DQIA 3I4HX 2VF3A 2HNDB 4MJKA 4Q2LA 4KGMA 1TUWA 4EFAC 4B3MF 3JTOA 5KFUA 4I1TA 3CMQA 4LSNB 4GKJF 2IVFB 3EMTA 1P9QC 1RT6A 4B3TF 2Q1LA 3BZQA 3W2VB 4OJ1A 3MEDB 3IGNA 2B6AB 3E01B 1DTTA 5KAKA 4UY8T 4DPXA 1S4EA 2IRXA 3PW5A 4KFBA 2LKZA 1S99A 1TL3B 3DHXA 2V4JB 1YJ9S 3MUMP 2LA6A 3ZO7A 1WF2A 4ZN1A 3Q8SB 2DGVA 2YBVA 1N52B 3D66A 4ED7A 1UETA 3TAMA 1IBKJ 1VRUB 3A3PB 1LFPA 2P6SA 2VIHA 3TYTA 1FEHA 2E1PA 3MPVA 1NZ8A 1GMWD 3CB4A 1SQEA 2XZTB 5HJYA 4KV8A 1TZ0A 3V6HA 3N5FA 3QRRA 1VQLS 1NSQA 3IFEA 5C24A 3GFXA 4FVMA 1SKUB 4RU2A 2GCFA 1IBCB 2ZOMA 4F25A 1RT1B 2CPDA 4OI4A 3BH7B 4YDXA 5F9NA 2ZBIA 3ENQA 5D4NA 5A6WA 1FEEA 1VQNS 1C0TA 1IVZA 2CZ4A 3WIUA 3G8QA 1IBKF 4C8MA 3DNCA 3PX6A 4EO6A 1M5SA 2E29A 2MGZB 2ACYA 1JLFB 3AXKA 5U47A 2A3JA 2J6UA 2CQ4A 4L72B 2X1FA 1F3FA 1WKKA 2YNGA 2DD8S 4DPTA 4EMDA 2F8EX 3QSYB 3CCZA 2WSEC 5GMKa 2QYCA 4YFUA 2XS7A 3B54A 4WU3A 3D9BA 1KEKA 2I0XA 2WZ1A 1KP6A 3W5ZA 2G1DA 5M2UA 3EDQB 4BC9A 3FBEA 2VJUA 1YJVA 2F8HA 2KT5A 4IKAA 4QU6A 3EXYA 4ZCIA 4IOBA 4OJHA 4KGVB 4W4MA 4LF2A 1VISA 3DU6A 2EI5A 4AFFA 1Q16B 1T03A 5GAHI 1FK9B 3GONA 2YKNB 3MEGA 3LAMA 1DY3A 1QAYA 2LXUA 5CYQA 2FVRA 3PW2A 2R7XA 1KSPA 4P2XA 2NSBA 3HMJG 4JV2A 3T3FA 1YJRA 3AD8C 1TMJA 3FBFA 3JS9A 5B0FA 4RW6B 1AUSL 4C3MA 3NOGA 1NK9A 2KM8B 2M70A 2B4OA 1HQUB 3E8OA 2L41A 2HBRB 3KK3B 5DDRC 2HNZA 2GNKA 3K5LA 4I4BA 5A0YA 1E6VA 2GIFA 2ZH9A 1QY7A 4ZVEA 4K4XA 2EC0A 5MLCV 1VC6A 4NASA 3V81A 2YTCA 4P2MA 3DLBA 2ILZA 5J1EA 2QZ8A 4NLGA 5HLFA 2Q3PA 3D1OA 2MB0B 3IGVA 4Y28C 1NK4A 2O5DA 4RNFA 2L9WA 2W9BA 3R7SB 4OYPA 3EGNA 3M8ZA 3FJ2A 1YK9A 1ZZFA 3RJMB 2G2ZA 3K5MA 3HT0A 5KT6A 1ITPA 4YDDB 2XM3A 1R31A 3KLHB 2UVWA 1FD8A 3GWCA 4OYXA 4FYVB 2POKA 5J2MA 3DRRA 1L3UA 3ZFVA 3A4TA 2GS8A 2KFNA 1FO1A 5HVGA 2K3IA 2YPZA 4OYMA 1TU0B 2C2EA 2HVHA 4MT1A 4Q8EA 1SJ4P 3CCMS 4JOUA 1HHSA 5EX0A 2ERRA 2CJQA 4ZLJA 3D1QA 1L5UA 3ENAA 3GB0A 2ROGA 2B7BB 3DGPB 7FD1A 3FRYA 4AXJA 5EDWA 2P5VA 1V9OA 3NGRA 3PFEA 2H1YA 5M2PA 5L38A 4AL7A 1NK5A 5BYQA 2D74B 1U2FA 4DCJB 3W66A 5ETOA 2AIRB 1VK3A 2HZAA 2RILA 2ZJPQ 1KNZA 4OHYA 1T11A 4ZVQB 2CWKA 3SSQA 3M1VB 1XNQJ 2QTWA 4ETXA 1EIYB 4NLQA 5DM6Q 4IYQA 3GSIA 2W2QP 4W98A 1X4CA 2I9SA 4ILMA 4USHA 3JAMU 1GFWB 4DZDA 1YLXA 4IO1A 1L3VA 4RLEA 1PYSB 2HHSA 5ETTA 5HJXA 4J9MA 1JLCB 4NLXA 5D3GA 8AT1B 1RCOB 2Y1JA 2VPZB 2RRNA 3M32A 3CD6S 2IMOA 3CMAS 3JQJA 1BQNB 3G4SS 3GU0A 1H74A 1NKEA 3M8PA 4DL3A 3GCXP 4A8YA 2ZKUA 1N5YA 3CGIA 4EUVA 4H4OB 2R7WA 4FZVA 1XNQF 2OAUA 1UVLA 3PRVA 3OXLA 1J5OB 2DTJA 2DHHA 5BJRA 1NH7A 1D09B 2MKHA 3VQTA 1KD1T 5IT9Y 4CRJA 1Z2ZA 2HEKA 3I96A 3ITHA 2YNIA 4QIFA 2C3OA 2CPIA 1WUUA 3MHYA 4CM0A 3RB6A 3ZTPA 3THPA 5KG0A 4CLLA 1XNRJ 4JUZA 1U26A 2OEMA 2OH2A 2A2CA 2HYIB 4A8WA 2UXBJ 1IBMJ 1T3NA 1D0EA 4YEAA 4ZIVA 3LGNA 3CD0A 1CULA 2AU0A 3TUPA 4PG4A 1N32J 2QN6B 1C1CB 1QE1A 3IM9A 1ZAXA 2LU2A 3EVWA 1RJJA 3G6ES 1MLAA 2BACA 2EK1A 2FY1A 1NPPA 2JFDA 2DJWA 3J81U 2A6MA 2IVMA 3OSNA 1HD1A 3KDOA 4DN9A 4M95A 4DBQA 4R5PB 1X7VA 3UCUP 4QIEA 1BD6A 2WBRA 2DNGA 4KH0B 1BY9A 1RACB 1Q82T 4ED1A 2BDPA 1VC5A 3OV7A 1XNRF 2MZTA 3IN5A 3OW2R 1FFGB 1TUVA 2ZOFA 2UXBF 2DBBA 1IBMF 3GILA 2OUGA 1R43A 4RUHA 1D3WA 3BDPA 2DO0A 2XEXA 2V8PA 2COLA 2YXLA 4CLFA 4CTAB 2CUYA 5K14A 1N32F 3BGLA 1H2TZ 3SBMA 2CXEA 1OJ4A 4CH0S 1S1WA 3B4DA 3G9CA 3R1HA 2EC2A 4EWTA 1KVKA 4OYAA 4KIAA 4PQUB 4K4YA 4PUOA 2V67A 1R0AB 2J9EA 3LP2A 1DFDA 3PW0A 1W26A 2U1AA 3ZTRA 1FFSB 4DFKA 5IOLA 4BHQA 1KC8T 1JJCB 2FLOA 1X0PA 1HBUB 2UUAJ 3OHBA 2B7CB 3BYPA 5L8RC 4NEZA 2B9WA 1BGXT 3Q83A 2AJ2A 4LVOP 1RHMB 3PY8A 1LKZA 1QVFR 2V94A 1V5VA 2RDDA 3DXBA 1HQEB 3C8YA 5J2QA 3CJKB 4G1PA 4LSLA 1NHVA 3PM9A 5HK4A 1H2UX 3L7PA 3AOAA 2OO4A 4RPFA 2DGTA 1JLEB 2QLBB 4J9RA 3GIRA 3QMQA 2EKYA 4CT9A 1NPKA 2KTQA 4NRTA 3MR6A 1IKXA 1VOMA 1U47A 2DCUB 2Y8WA 1TUGB 2OPRA 1B70B 3D0IE 5KFBA 2DXEA 1FESA 1JLGB 4BBYA 2GZOA 3EGVA 2R2UA 4G6VB 4CO2A 4Q8FA 3T1AA 4NI2A 1RBOB 2C3UA 3CDUA 2UUAF 4DL0C 5EHHA 3EYZA 1HFEL 1Y00A 4ZCMA 3T5LA 1X5TA 2CPFA 2E9TA 2AV5A 5A6PA 2NYIA 2HRYA 4KH1B 2R2TA 5EWEA 3MCSA 3E3XA 3BGRA 1RAHB 2V8GA 3OQ2A 3UN5A 2C2NA 1FRKA 3W9IA 1NJYA 2KT3A 4DPUA 3DMJA 1RWXB 2EPIA 1LWXA 1SBRA 3AQOA 4EZ9A 3MM7A 3J81j 3NXZA 4D3HA 1OO0B 3EVOA 2RRAA 1R3NA 3KOAA 1RT7B 1RTJB 1FF2A 2MPUA 3QLHA 2GO8A 4FYWB 2LEAA 5I3PA 3R2CJ 4DSIA 2FJDB 1FXRA 5KT7A 1KHWA 3UO0A 1W2IA 1KVIA 2I5JA 4TXSA 2NUHA 2HHXA 3NMAA 1H73A 3DLGB 3T9ZA 5DQGA 2K1RB 1UPPA 3RB0A 1E6YB 3M30A 4B9MA 2MLYA 4P74A 2XSFA 4NX9A 1LWCB 2DITA 7FDRA 3T5KA 4GVLA 5G4DA 4I56A 4L73A 2AGPA 4B3OB 4K0KJ 4PG5A 4AYBD 5ADZA 2L08A 3C6TA 1NEEA 2CRLA 4F2RA 2AX0A 1FKOB 2CQGA 2UXCJ 3TVKA 5GAGU 2Y0BB 3H2VE 1U24A 2HK3A 1U6FA 2RQ4A 4PRFA 1RU1A 2CG8A 3DOMA 3EM1A 4CT8A 2OPSB 4ANEA 1WC0A 4G1QB 2AHOB 4USTA 1YI2S 5LM7E 4J9KA 3DLKA 2ATLA 2V2KA 4K4UA 1KS2A 2B9XA 4EZ6A 1FWKA 4HDGA 1MG7A 2K7KA 2Z0GA 1JWWA 2DR6A 2VHGA 1RT3B 2UUBJ 2J0XA 1NHKL 1REVA 2I8EA 1S6PB 3P4UB 5DDOC 2NS1B 4K0KF 3J7ZT 3RBDA 3DKDA 1U8WA 4HH0A 4QIVA 3GLJA 3QIDA 1S10A 1FJ7A 1RA7A 2UXCF 1SCJB 1S9FA 3UN3A 3HZGA 4JI6J 4MK9A 4GC7A 5LT5A 5ETLA 4ER8A 4HHHA 5HBMA 4AQYJ 3KWMA 2CIMA 3ILIA 4LRDA 4PWUA 4FKXA 4WK3A 5KT3A 4KTQA 3DOLB 2LFVA 1KLNA 2LEPA 1N6QA 2BV3A 4WIIA 3GP9A 3V4IB 3PW4A 1N88A 1SUQB 2QO3A 2KJVA 1NK7A 2GGPB 3MGJA 3OXGA 2VPYB 2GIRA 3NGDA 1S6QB 3JYTB 2DKOB 3THTA 2UUBF 1F2GA 4YHHJ 3T9NA 5KG1A 4HACB 2VKZG 2HRUA 5CQGA 1T9TA 1GAOA 3MPUB 3V6JA 3PZPA 3B4MA 4ID5B 4RW9A 1SKRA 3T6BA 3NOCA 1NRKA 5CYMA 2PA3A 3C6UA 2LQBA 4WKYA 2F1FA 3I9ZA 4CCHA 4NLYA 4JI6F 1YBTA 3IWNC 4MYUA 2YNFB 2CJBA 2ZFHA 4AQYF 4L74A 1KQGB 3D6HB 5EGYA 2B3TB 3CIZA 2GHWA 2LDIA 4LUBA 4ZLLA 2EFPA 5H9EJ 1GXTA 3CNQP 1DLOA 5BYSA 2QT7A 3D2WA 2C2ZB 3X3UA 1XC9A 4NLRA 1PAUB 3UVJB 3VAIA 3IR5B 4DV0J 3SZ2A 2ZZMA 4ECWA 1RWUA 1KRPA 2E5HA 4TKTA 5HL7Q 4F04B 3GIJA 4YHHF 2BANA 4M5KA 3I0RA 3JSYA 3DRPA 1X4DA 3H20A 3NBPA 2W2MP 3HLUA 4A8KA 4DV2F 4Q5VA 4MIBA 3VAJA 4OJGA 4ECUA 4LR8A 1WHYA 3MF5A 1UL3A 4X4SA 1UMJA 4XIUA 4IG0B 1MW7A 4PQAA 2HHVA 3FEXB 3QT8A 2ILYA 1MSWD 3IA0A 1JLQA 5D0EA 1WACA 2GMJA 2NXUA 1RT6B 2A18A 3G2XA 4DV0F 2EK6A 1LXNA 1RI7A 2JLFA 2BVZA 4DF8A 1M1HA 3EJMA 3BDEA 2IVYA 2NQPA 2XMTA 4ZP7A 2M88A 1YJUA 3NGTA 4HLBA 1K44A 3KLFB 2WSFC 3RRGA 4JI0J 3V5RA 3C15A 3HHLB 4A8FA 1J27A 5HROA 1Y11A 2KXFA 2P6TA 2D9OA 2Y8YA 2HGLA 1U0SA 3IRXA 1ZAVA 4K4ZA 4ZVRB 3W8GA 3D3BJ 1NCLA 1U2RA 5C42A 3HXMA 2B56A 2G4BA 3RR7A 2B8PA 4K4VA 3ZZ0A 3LALA 5DQIA 1OIAA 4L76A 2KYZA 2OFHX 1V3SA 4DPOA 4OX9F 4WF9Q 4UQTA 2RHQB 4MKYA 2JWNA 2Z57B 3GIIA 2ZE2B 5HVHA 4C8KA 1NDKA 2ZH8A 2AF6A 3SIPB 2CQ3A 1WEXA 2BABA 4LRCA 4YR2A 4O0IA 2Y1LB 3UDCA 1GNKA 2F3JA 4JI0F 4J9QA 2MHEA 2M7SA 3ZNJ1 1T9UA 2XCPA 2CVEA 7AT1B 4NYOA 5K8OA 2ZZNA 3Q8PB 2B4VA 3DHWC 4IRDA 1V5IB 4RR5A 1TKZA 4U7UD 4K50A 3OFHA 2ZZTA 2BR0A 2I2YA 4ITSA 2XNQA 4KHMA 3HVTB 5AE3A 3GTYX 2FY8A 5ETRA 4PWWA 4CM2A 5KFCA 2P9EA 3AA9A 4QR0A 1K73T 1ZA2B 1NUEA 3GJSB 1F3VA 3DLHA 1JLBA 5CYJA 3OFEA 1YQHA 2PD1A 5GADU 4V19J 4P2FA 2H4YB 3FFIB 2FLLA 2UVVA 2YQ3A 3KLGA 4FPRA 2G9OA 1VQ9S 1G2EA 4BWMA 4LFCJ 4PPZA 1ZTWA 2W2PP 4KO0A 1LQ9A 4P52A 3UPFA 4XO0A 1CJTB 3LAKA 3WC0A 1WELA 3WC2A 2XMJA 1W25A 4HT7A 1AZSA 2R7UA 1IXKA 1WKLA 5D4PA 1B64A 4IR1A 2UUWA 3D67A 2KVIA 2IM0A 4A46A 3DYAB 3KTQA 1PJ5A 5I4MA 2HAIA 5HMXA 3PNIA 2LLZA 3AB2B 1JJHA 2KDOA 3K8VA 1H7WA 4ZN3A 2X3DA 1VDHA 4QR2A 4F4XA 4JP8A 4LF8J 4R25A 1U7LA 5CXTA 1AT1B 2FHJA 4GO5X 4WE1A 4LFCF 2DH9A 2XY5A 4DU8A 2VKRA 3T1YJ 4DU7A 4DSFA 3QRPA 1LWFB 5KFOA 2R7OA 2YY3A 5KFMA 2IFXA 2QL5B 1HPZA 4X62F 5HI7A 1OQ6A 1S1TA 1NJZA 2WONB 3N4WA 3MXHP 2B9YA 2MKYA 1UCNA 1SB6A 5DM7Q 3NCPA 4WK1A 2BXJA 4DV6J 2ZC3A 2PA8D 1EKRA 2UU9J 2P2CB 3SSRA 2CQ1A 5G0RB 3MD1A 4DV7J 2FGCA 4GVBA 2DB1A 4NYZA 4IFVA 4HTJA 4LRFA 1LOUA 3IBCB 4LF8F 3G71S 5KG2A 3TAPA 1A6LA 2MY7A 2HNDA 2ZITA 1XR7A 4CH1A 2EFGA 5J2MB 4ZP8A 3T1YF 4LSNA 1QJHA 2H4WB 2QLWA 4URQU 3W2VA 4A8XA 3MEDA 3BV8A 5IT0A 4J9OA 2RQKA 2GMHA 4NYPA 1Q86T 1UJ6A 3CCQS 2B6AA 1NDLA 3E01A 3C14B 4USKA 1S9GB 4WFYA 3KFWX 4OHWA 1PJ6A 5E3RA 1ZA1B 3ZXWA 4CLTA 5FIIA 1WHVA 4KHRA 4KAIA 2LMIA 4DV6F 2EXUA 3FEZA 1XTZA 1TL3A 4ED0A 5IC6B 2V4JA 2UU9F 2A1BA 1HI8A 2A10A 1RTIB 3BGFA 4DN0A 1F9FA 1B7YB 3O3LA 4DV7F 2GX8A 4E2FB 1YJTA 4IFYB 4E98A 3CD5A 4JBCA 4A8MP 1U8SA 3GYNA 2V8HA 3R6LB 2ASLA 5JMNA 2IIHA 1VRUA 1UZDA 5A8KB 3IM8A 3Q86A 2N3LA 4YS2A 3IRWP 4WYLA 4CYUB 4K8RA 2VBXA 1VQYA 4J5OA 1LNQA 2HWTA 3HM9A 4ECRA 1M90T 4Q0BB 2V4QA 2IA6A 3ULHA 1RE1B 2KB2A 3I31A 2XQCA 2DRDA 1JQGA 1WEYA 3IG1A 1RT1A 2VONA 1QAIA 2HQIA 3UDEA 4DHVA 2LQJA 1CBKA 2AGQA 5IFMA 3Q8VA 3F56A 2HVEA 1RTZA 4TY9A 3KLVA 1NDPA 2RU9A 1APSA 5D3GB 4EBCA 2J9DE 3EE3A 3M6VA 2MGZA 3OD2A 1JLFA 5KOWA 2MMYA 4X84A 2J7UA 2HHPA 4NCAA 5T7LB 1RTDB 3CCUS 4ZIWA 4QJVA 3GG0A 3QAUA 4PZVA 1N5YB 1PAEX 4YB7A 2CADA 4ECQA 4I2PB 2QSWA 2H9ZA 1LW2B 1BLUA 4O3NA 2LDYA 2HHUA 3VVUA 2HG4A 4DSJA 5E3PA 4M8LA 2HFVA 1RT4B 4UUXA 4V1Ak 2R7SA 3M05A 2H5EA 4UQGA 1H6KX 3D68A 3R6GB 1V3RA 2ZUGA 1NK0A 1YRUA 5EWGA 3MM8B 1Q8IA 1FK9A 2DPIA 2YKNA 3F0NA 1YITS 4OZ1A 2ZBQA 4HHJA 1NLKL 2PO4A 4X66F 4GKKJ 3BO2A 2MKSA 1CJUB 3P5BP 3LW5C 5F41A 2OPPB 4CIOA 4PCQA 1TMMA 3IR7B 5T14A 5F8HA 2YQ0A 4RW6A 5ETVA 5A8RA 4L75A 4DUTA 2MKKA 4Y3CA 2ZDPA 2DVIA 1HQUA 1T0TV 2IM3A 3H59A 3KK3A 2CQBA 2PSZA 2V6AA 3N0VA 1HQ2A 1NNDA 2CPYA 1XN9A 2F9DA 2DR9A 1U49A 4RX6A 3DCAA 2DR5A 3ET6B 2F8MA 1KQKA 1Q81T 1U02A 2GV1A 2XWYA 2QA4G 2EWHA 4V19X 4F4WA 1JJ4A 4GKKF 1AW0A 3SFUA 2VU5A 4DF4A 4M5IA 2C2RA 1SQGA 5DDQC 3H5SA 2HKEA 2MTLA 2ASDA 1Q7LB 1B99A 2W8KA 1B3TA 2DK2A 3VGUA 3KLHA 1I51B 4ECXA 4BCAA 1VQ8S 2D3UA 5IXUA 2DHSA 3UR0A 1AB8A 2BOAA 4FXDA 4PUOB 4F3OA 4C97A 4NLSA 6FD1A 5L1KA 4Y2MA 3GFZA 4ES3A 1KTQA 3PIPQ 3QZ7A 3AJ1A 1Y5IB 2Z56B 1DHMA 1NDCA 1CS4B 1KONA 3GYGA 4DPYA 1NXIA 2OGUA 4MIAA 2JNJA 3DGPA 3FMBA 1R0CB 1MMNA 5AXLA 2RUGA 3CC7S 4YY3J 2ZVSA 4WCEQ 3VR1A 1BMQB 4RZRA 3S01A 1S7HA 1XQIA 2CAJA 1JX4A 1X8DA 4JI8J 1DQ9A 2XHWA 3BQ1A 2DY9A 5A8WB 5IV4A 2I6WA 2FVQA 5E5NA 2VPXB 3ELHA 2YNHB 4X65J 4NE9C 1YG0A 4CLYA 3CJTA 1P27B 4KQZA 3KNGA 4M5NA 4O3RA 3M1VA 3PCOB 1ZOTA 4OZ5A 1YRXA 3EVMA 5D77A 4HEA9 1R89A 3OJUA 3MAAB 2R7QA 1VYAA 2PMWA 3T1HJ 1IWGA 2XS5A 4NXNJ 3S1TA 5KFHA 2LVWA 1XMQJ 3T41A 4YY3F 2CKWA 1JLCA 3MOZA 4NLTA 2MQMA 1UWBB 4DCOB 1FWPA 1UVKA 1NJWA 5D4OA 4P6QA 4G3IA 5HMZA 4TN2A 1IBLJ 2I38A 1B0VA 1S6OA 2VG7B 4C0HA 1QVGR 1X9MA 4NXMJ 5DLFA 2Q6BA 4X65F 4YB6A 1BQNA 1VLOA 1T02A 1SJ3P 1O51A 1FRIA 2DH7A 2VC0A 4J9PA 4J7CA 1FKAF 3FVYA 2W4CA 4Y6IA 1K8AT 2CDRB 3FNNA 3I4PA 4LREA 5B0EA 3G86A 1FT8A 4QQBA 3PXGa 2XI2A 2YQ1A 1FVQA 2XS2A 3T1HF 4NXNF 2GA7A 3BB5A 2DNHA 1XMQF 2F63A 4N8OA 3U02A 1N34F 4EYHB 1FDAA 3M2VB 4IDKB 1HNXJ 1W7WA 3C6TB 4C8LA 1IBLF 1J5EJ 4X4NA 3A8JA 2AZ3A 3NWGA 5CH7B 2O67A 3VALA 5D15A 3BBFA 1UW4A 4NXMF 1TKXB 4ZVGA 3VQSA 5HANA 1RLDA 2NCKL 1C1CA 3NGUA 3THVA 3KUHA 2CDQA 1SH3A 5B0DA 4ED6A 3R5AA 3K0JA 2V34A 3TJ8A 4FP9A 4NA1A 1FTRA 1XR5A 3OVAA 4QWEA 4R5PA 1CC7A 3HSJA 1HWLA 1G4CA 3CCSS 2YKPA 3CJ0A 5I3UB 5C2CA 2CPEA 4DJBA 5KFTA 1X4EA 1HNXF 3J7AN 4UW2A 2DGXA 1VQ6S 3C2PA 1J5EF 1NPRA 3OUYB 3OVBA 3I56S 4ZKAA 4ZJOA 1PC4A 3BKFA 4KSEB 3R7BB 3BEGB 3VZHA 4U7CA 2WW4A 3QT6A 2FVPA 3P45B 1S0NA 2R42A 2BRLA 5DLGA 1RWKB 2FZGB 2D41A 3TQEA 4PQUA 3BKTA 1R0AA 2YKQA 3MUTP 2ZHOA 3CCJS 2R8GA 2PI5A 1LEOA 4ILRA 1HBUA 2FPHX 4ZPBA 1HNIB 5IQQA 3EUNA 2AEJA 3KLEA 4KT0C 1CJVB 4RW9B 1NBEB 3ISND 1FFWB 3QGPA 4KC5A 2DCLA 4Q44A 1HQEA 3DDNA 2FC8A 4YP3A 2EFQA 4RW7B 4DQSA 1T05B 2E66A 1JLEA 1QTMA 3ETMA 1TR0A 4H4KA 3KNAA 5FD1A 2DH8A 3LO3A 2V8VA 3EDRB 3G8TA 2MZ1A 4J9LA 3M6UA 2BJDA 3H5XA 4ZJQA 1JLGA 4MMOA 1T94A 2YWGA 1GH8A 4C8NA 2HQ3A 2C3MA 2W4PA 1X4AA 1U1NA 1HNZJ 3E2EA 2PT0A 2XMUA 2FB0A 2AD9A 4CLWA 2DNKA 2BANB 1VBZA 3LTOA 5J1PA 3F73A 4Y34A 5B0BA 2N7YA 5JVGQ 2ASYA 3BSCA 1PSDA 4GC6A 1T8EA 3ISNC 1RHQB 4TY8B 2GHVC 4WYWA 5GAEU 4I7FB 3US5A 1IM6A 2KHDA 1Z4UA 4WPAA 4ZLPA 3MECB 4F2SA 1RT7A 1RTJA 4I0WA 4CNYA 3AODA 5GMEA 2KL8A 4J9VA 2DRAA 1HNZF 2IC3B 1V6HA 2GJFA 1N5QA 5ETKA 3PEJA 2L9NA 5DO2A 1N54B 2EBGA 3DLGA 2J8AA 3N6MA 2BW7A 3HSDA 2D7SA 2QL9B 2J6SA 1LWCA 3V6DB 1HNWJ 1UZHA 1VQ5S 2MQOA 2X1GA 1WORA 3IS9A 3QPIA 3H42A 5LMUJ 3R7NB 5HQMA 3R5DA 4B3OA 2ACMA 5KG4A 2VICA 4ZK7M 2OEJA 2B4UA 1UTAA 2ZM6J 1PIEA 1XMOJ 3GV7B 1FKOA 5FLXY 3R8YA 4DX5A 3PR4A 2IYIA 2RT3A 1M5PC 4HR2A 2HNYB 2YH1A 3LF0A 3R2DJ 1HBMA 1KQFB 1MNEA 3T5JA 1PJ7A 2KYXA 3DLJA 3HFVA 2OPSA 1LW0B 1EHWA 2QE5A 4G1QA 3PX4A 3A8KA 3RU0A 5H9FJ 1DURA 1KWMA 3MDFA 2W8LA 1TTHB 1HNWF 3AHPA 2E7XA 2G13A 4ZMMA 1RT3A 5LMUF 4Z37A 4GMKA 4MIWA 3D0GE 1S6PA 4ZPAA 2OSQA 2FYXA 3JQMA 5LSLA 1RAFB 5IWAJ 2ZH4A 2ZM6F 4ZITA 1XMOF 3VGTA 5THWA 3PVXA 4UY85 1OQ3A 4KY3A 3HFZB 3SFGA 2YX1A 3M6XA 2F4VJ 2AYEA 2MLXA 4DCPB 1BWVA 3CSKA 4G65A 1IQTA 4EGLA 4A47A 2AJQA 3DOLA 3PTWA 3WBZA 1M5KC 3DI6B 1X60A 3V4IA 4DDFA 1SUQA 4UZCA 3ZC4A 1WTBA 1WG1A 4U9RA 4IO9Q 2LEBA 2H65B 2FD2A 4F4KA 3AJDA 2DHXA 1S6QA 3JYTA 4R0EA 5ITHA 4BDPA 1D9AA 2RB7A 4OX8A 4HACA 2XB2D 3GPAA 2V9KA 2EFVA 2QLFB 5F0WA 3AT1B 4ID5A 2MKJA 2WHOA 1FJEB 2G2YA 2CVIA 1RTHB 1KVJA 2ROEA 1IKVB 2FVCA 3UFCX 2KI2A 2F4VF 3FK4A 4DOZA 2YNFA 3MFHA 2Y1IA 3BBCA 2VG6B 1NHUA 2KU7A 3H2LA 4TU8A 3OFFA 3AH6A 3UVJA 2WB4A 4PEOA 4O3OA 3EX7B 1HPZB 1ICEB 3J80Y 1C4AA 2EBEA 4FBTA 4RW8B 1PO6A 3GQCA 1WD6A 4YN3B 1SVDA 3MPYA 1R8AA 3UWTA 3JB9k 2BE2B 1DQ8A 2XMKA 3KG4A 3W9HA 4ED5A 3Q2TC 1RAJA 2CNNB 3MMCB 4IG0A 1U48A 3TA2A 4Y00A 4RNOA 2MHNA 3FSYA 3TOQA 2ATCB 1VK8A 4U8VA 2HWIA 5IC4B 3UD4P 4XTTA 1U0HB 2IJNA 4LT6A 2YKMB 4O3QA 1FX4A 3M2UB 1FDNA 3BBBA 2FJAB 1UVIA 2E9ZA 4FPIA 2RE1A 4ANCA 1ELOA 3NGKA 3AAWB 1BWEA 2ZBCA 2VODA 3BPDA 1TKTB 3O2IA 4LR7A 5C7PA 4X4UA 1RB0A 2ZDOA 3OTEA 3KLFA 3VAGA 3OL6A 1D9DA 2DY1A 1GXUA 3HHLA 4EO8A 5J1NA 1EB0A 2K8GA 4EK2A 1H38A 2CQPA 5E33A 2B0GA 1VI7A 2HGNA 4UOGA 4X4PA 5K20B 4DG1B 3DC2A 1UJ5A 1C1BB 1Y5LB 3KK1B 1HHQA 3QT7A 5HQ8A 2EG2A 2XULA 4ICLB 4DFPA 1UPMB 4XDDA 4R8UB 2R9LA 2IHR1 2JEGA 1X5PA 1SIWB 3R3TA 3NGSA 1RQ0A 4DUYJ 4NWBA 1IR2A 3DXSX 2DEIA 2ZE2A 5F8LA 4JV5J 1A7GE 4WKRA 2XMAA 2ZEJA 3K58A 3Q0AA 1VJWA 3PEHA 2AJ4A 4PPDA 3IG1B 4M63A 1HARA 5I42B 2HIYA 3CW2C 3NS7B 1KKHA 4HVZA 4YQWA 4WBFA 1NH8A 3AA8A 4ES1A 2OI2A 1ZPVA 2Z30B 1KFSA 1C0UB 3DRYA 2MQQA 2B8QA 4ED2A 4MFBB 3HVTA 1YVFA 1LK7A 1KFDA 3HHEA 1ROFA 1MWZA 4DUYF 2VG5B 2NUUG 2AJ1A 1Y7PA 5GMDA 3TX0A 2FDNA 4RNHA 3Q2SC 1FWLA 2AJ0A 1OYDA 1NK6A 4JV5F 2VQFJ 3FBCA 3FFIA 4ZVOB 3VAKA 1RADB 4AD6A 3CWJA 1DZ5A 3JSBA 4DV5J 1NB7A 3VCDA 2LQ8A 1Q4RA 2RVJA 4USMA 2XHCA 5E41A 2E1AA 1K0TA 1CJTA 3MEKA 3TJAA 5HQLA 4N5SA 4RO0A 2QC3A 4JI3J 1L3TA 2CJYB 2D9PA 2HFUA 2M8DB 4ZJLA 5E3CA 1HBNB 3G82B 3DYAA 3AB4B 2Q66A 2LYVA 2WAQD 3LOUA 4DS5A 3KJVB 3RB4A 3C46A 2QSFA 3N79A 4OJ3A 2CNOB 3M2RB 4Z7CA 1BXNA 3O1LA 3QYYA 3CIMA 2L48A 3ENWA 4LF6J 2VQFF 2HHHJ 4TNOA 5AJ3J 1WDDA 1ZM9A 3K5OA 3CJ2A 4G1IA 5A8RB 2VDHA 2AKWB 1ZPWX 4OYIA 4DV5F 4WTYA 4NL5A 5K8NA 5CAAA 4JI5J 1VQ7S 1LWFA 2QA2A 3BQ0A 1N0VC 2BQUA 2K06A 3Q24A 2CNLB 5KFXA 3HJFA 8RUCA 1FRMA 2QFJA 4OV1A 3TVYA 2UVUA 2WONA 1WJ9A 2K2PA 2BM1A 2Z2MA 3PO4A 2M8HA 2RRBA 3W5XA 1S57A 2BEFA 4NLDA 1QDUB 1RHRB 3NAHA 2CQHA 2H48B 1BUXA 3BREA 2RF2B 2DNLA 1HA1A 3ZTSA 5G0RA 3MOJB 2FJBB 2NR0A 3MCOA 5KT4A 2XGQA 3U7JA 3KUEA 4LF6F 3KK2B 2HHHF 2AYMA 3NCRA 2VOPA 4Y0FA 1GX6A 1Z2LA 2DXDA 1WG5A 1JIHA 1DTQB 2OEKA 2IA0A 3F41A 2DYAA 2JFKA 3DN9A 3FGVA 1UA0A 4JI5F 3RRHA 1S97A 5D8HB 1VRTB 1TAQA 3M8WA 3J7YU 4FKYA 1RAGB 4KYZA 2M3DA 2CJKA 2UP1A 4F36A 4F4AA 3TEGA 2VOOA 2JDJA 4I69A 1IM4A 3C14A 4C3KA 1S9GA 5L1LA 2M0GB 3HHDA 3HX9A 2J0WA 1S1UB 3QATA 2RHSB 2JEJA 4ZOSA 3POTB 1F2HA 1WF0A 4ENOA 1IQZA 1RTIA 4OZLA 2XCAA 4PWDB 5EN1A 3UDVA 4IFYA 1GTEA 4PXCA 2L3MA 1JLAB 2JVRA 3OLAA 5DDPC 5AXKA 3LGHA 2CA9A 4OQJA 2C1EB 2EG1A 5A8KA 3C16B 1EX8A 2Y1RI 4USVA 1RT2B 3K2YA 1T9WA 2OELA 2GO9A 4DMZA 4CLPA 1TFWA 3PDNA 4CYUA 4TYAA 2DPJA 2KH9A 1Z1ZA 3JQKA 4Q0BA 1F9EB 4ILLA 1Q8LA 4M5GA 3SQOP 3KHGA 1NZAA 1VR6A 5HO4A 3GMGA 3HULA 4ATNA 2E1CA 1N36J 2Z58B 2H5IB 4A8QA 3B82A 1Q0NA 1MU2B 4LF1A 3DM2B 3MI7X 2VPWB 4C2MA 1WOPA 1PYTA 2EKNA 4QWBA 3WZ0A 3H40A 2OSRA 3ZTQA 2OPQB 3MM6B 1VGYA 1BC6A 4U6PA 3GIKA 5HAOA 1NMEB 2WVFA 5FDLB 3OTOJ 5T7LA 1RTDA 4I2PA 4ZVUB 1LW2A 3H7HB 3DOKB 4N47A 3QJJA 1KLMB 3JAMY 4WXOA 4ZS6A 4C48A 2DGWA 2DGQA 1X4FA 5J2PB 1N36F 2WOMB 2DR8A 4OMFG 1RT4A 2LCWA 3RBZA 5GVQA 4DV1J 3KJFB 1T3OA 3UD5A 2V2ZA 4C11B 4MTPA 3TQ1A 4WIQA 1PKUA 3MM8A 4KRWA 5I3QA 5KG6A 2XMWA 4HI1A 2IPOB 1N8RT 2VFUA 3LH2S 1HWKA 1CJUA 5KFIA 3VGVA 2OPPA 4LFBJ 3LP1B 3Q23A 3KLIB 2FC9A 1TFYA 5DG8A 5F8MA 2YWWA 3CO0P 4LFAJ 4JI2J 1MN7A 4USUA 4KPCA 5ETMA 2KXNB 1SPBP 2Q6CA 4P71A 1DQAA 4X64J 1XIQA 2MY8A 4DR2J 2KG0A 1J2VA 4DV1F 1AXQA 4IRCA 5KFYA 2X51A 3ZZPA 3CJSA 2NYHA 3ET6A 3ZZYA 1S59A 2VBWA 3TUIC 5E2QA 3PX0A 1P1LA 3HF5A 4KBIA 1YJWS 3MD3A 1ZM2A 1YZ6A 3RZAA 1WSRA 3GV8B 3EPGA 5BR8J 5LMNJ 4LFBF 1T9VA 2O1PA 3QFHA 3W8PA 2VZ9A 3UNYA 1DBDA 4W90B 1N56A 2GQ2A 1RBAA 1UVMA 4LFAF 3KHLA 4JI2F 3J81Y 3K89A 4KE5A 1UFLA 1WDTA 1UFKA 3HK2A 1FKPB 4P10A 3OL8A 4IQMA 2MQLA 1LXJA 2J6TA 1WWHA 5CA5A 4X64F 1PCAA 2M4MA 2AGOA 1OY9A 2VBYA 1R8PA 3CULA 2CPZA 1M5OC 1CS4A 2J5AA 2VC1A 3OFGA 4C0BA 2XSJB 2VD3A 4LF9J 3KLEB 2GFFA 4XDCA 2CWXA 1GMWA 2VQEJ 2JC1A 4F02A 2CPHA 5BR8F 5LMNF 2EEYA 1QSSA 2LQ5A 2VA3A 5AXNA 2BQ3A 3RUBL 3HFKA 1RLCL 3QWUA 2X7IA 4RW4B 1FVSA 2JVOA 2OFGX 2MSSA 3TNVA 5KFGA 1BE4A 4DS4A 4UZBA 3PYGA 2HS3A 1U1QA 3LA0A 5A8WA 3J7Z5 5ETPA 2AYGA 2YNHA 2IBKA 2E5LJ 1Y5NB 3HJVA 1IKYB 1OYEA 3OVSA 4OX7A 1WHWA 3EZ5A 1KTVA 4LJMA 1U1LA 2ZD1B 4ECVA 1KN6A 1VMBA 4LF9F 3IC1A 3MAAA 1JXEA 4DL7A 3CD7A 2ALZA 3BF4A 2VQEF 5CZXA 2F5GA 4LSZB 2MDAA 4KB7A 2IRYA 1T9XA 2ZHAA 3WQPA 1HWUA 1UWBA 2HQDA 2BJ8A 2HURA 3FC9A 2V2VA 2VG7A 2CFXA 4DV4J 4ANDA 3MURP 2HFNA 3EZOA 2Q43A 2E5LF 2VFRA 4PXBA 1X9WA 5CABA 3ZZTA 2MEWA 2XLIA 3K8WA 5AE1A 4J9UE 3RYLA 2ABYA 3MUVP 5GAGI 2E1MC 3K5PA 3T6JA 4EI2A 3K59A 2PC6A 2C2DA 4OHVA 4NA2A 4Z2XA 2RNEA 4EEYA 1TL7B 3IS9B 1SI9A 2RU3A 4PXDA 2WK4A 2CZVC 1RHJB 2WRMA 3M2VA 5L9NA 5H9FK 3M6WA 2AP6A 2W7AA 4IDKA 5JJBA 3CC4S 5EX3A 3ZTOA 2YKAA 4DV4F 4KKOB 3R97A 5KFEA 2QLJB 1TKXA 1H0HB 4RUCA 3CCLS 4RNNA 2VFTA 4USIA 4UOFA 1HBMB 3CJRA 2J7WA 4WFZA 3QZ8A 2JJ4D 3M8QB 4B9TA 5KG5A 2RDJA 3Q8RB 3UE2A 2J0QD 4DL6A 2GHPA 1Q53A 3OTBA 5A2QU 4CI0B 1EZZB 3PJWA 1YZ7A 1Q95G 5I3UA 2AMCB 2BJ3A 2O66A 1VQSA 1FXDA 3CDEA 3HCXA 5A76A 3OUYA 4WP3A 4MKBA 3DU5A 3JSMA 4DL4A 4FVCA 4B3TJ 4CZCA 3I0SB 1CG2A 2YKOA 5KFZA 3MAHA 2HVZA 1N5VA 3D54A 1BQMB 5L39A 2RD5C 2XZWA 3BGUA 1IR1A 1FRJA 1P6TA 3OR1B 4F8RA 2QLXA 5IQ6A 2WB1D 4ELTA 1FA0A 5H1SV 3HVWA 3CCWA 2NLWA 2FHOB 1CJKB 5CHCB 3N28A 1RWOB 2FJEB 3I55S 3AQPA 2HK2A 2BYCA 3C19A 1HNIA 1HBOB 3QQCD 3HD2A 2ZJQQ 3PV8A 2V63A 3SCIE 3SEOA 4U7UK 1CJVA 1H3DA 1HL6A 1S49A 2CJXB 1TAUA 2FLPA 5F9LA 2HQCA 3KJQB 3JTNA 4NMXA 4RW7A 3QFWA 4B02A 1T05A 3CO9A 1IJEB 1WEZA 2RMLA 2CQ2A 2UXDJ 4OIXA 2RKIB 2PMZD 4OZNA 3TA0A 2XWXA 3I5AA 4DPWA 1FXLA 2H51B 2JC0A 5D78A 4DFJA 1A0OB 1SJFA 4C0OC 5K8MA 3FEYB 4FS2A 2XTJP 4LBHA 4CLZA 3FZ2A 3EGZA 2O01C 1TL1B 4RUAA 3NS5A 1SL2A 4C8YA 1WI8A 3IAS9 4IUFA 2YX4A 4Y2IA 3RW7A 4QYZJ 1JXVA 5E0OA 4TY8A 1SC3B 4PABA 3GR1A 4I7FA 4RBUA 5FJ4A 2UXDF 5E7OB 2XGPA 3MECA 3MMJA 3OLBA 1R8HA 3KMSA 4L3KA 1JKHB 3TZXA 4J91A 3P96A 1RAAB 3HHNB 3H5UA 2IC3A 3LANA 2MZRA 4HTIA 2ZHBA 2RIJA 3HKWA 1UAWA 4S0MA 1EP4B 4YB1P 3ENVA 2BM0A 4RJVA 5KFVA 3HZEA 2DNNA 2XYGB 2V9WA 2MJUA 4ZVFA 1RSCA 3V6DA 1OS5A 3UNGC 3L4BC 3X1LB 3M9MB 2W2NP 2W25A 3TA1A 5KFPA 1RGVA 1D9FA 3D5MA 1S0MA 3B6BA 4TVAB 2U2FA 5DQHA 5K9FA 2OJ3A 2K3KA 1FRLA 1SIZA 1EQ0A 3BR8A 2ROPA 2HNYA 2XY7A 4DR1J 2AEFA 2UUTA 1IUJA 4TU9A 5BYRA 2W9CB 4F3QA 4CLUA 4CO4A 1DARA 3G6YA 1LW0A 1VQ4S 3CCES 2V5HG 1RK8A 4H4MB 3FCWA 2ADBA 2O3DA 3PYFA 4P73A 1B0TA 4I67A 3SYZA 3PFOA 2AT1B 2CNKB 4ZPTR 3IWXA 5GADI 4I2QB 1Y3JA 1X0FA 1OPZA 4NCGB 3CCTA 2JL9A 1YBAA 2XZDB 1FDBA 4TQSA 3FDSA 5GAHU 3N01A 3FCHA 3OR2B 4ZA1A 5K8PA 4DLEA 3G6VA 2PEBA 3L7OA 1WC3A 4WP8A 5D4LA 3NRBA 5F8JA 3W5YA 3DLLQ 4I6AA 4DSKA 2KZMA 1RU2A 2YWKA 4K59A 4DR1F 2HSEB 2X1BA 1U1KA 3PHTA 4LRBA 1N5TA 4CNZA 3P5TL 2V68A 4IR9A 3DI6A 1NJXA 3MM5B 3O44A 4CO3A 5E3QA 1S6UA 1GQEA 1F60B 1YJNS 3CMES 4DR6J 1Q7YT 5KFFA 2BJ9A 2UUCJ 1OY6A 3SV4A 3I5BA 1L3SA 3M7VA 4DR7J 5L1IA 2APOA 4I64A 1RA6A 3BYRA 2BOPA 5CD4H 2OP5A 2IAJA 4ZVTB 1S1VB 3MTJA 3ZZOA 2HMIB 1H7XA 3QGIA 1VQMS 2HWHA 3UI3A 1SC1B 1S5ZA 1RTHA 1Y9OA 3ETOA 2BKOA 2FHMA 3I82A 2A6OA 1RWNB 1IKVA 2NXNA 2W4DA 2IJFA 5BXIA 2R8HA 3SMZA 2FQQB 3EGWB 2G0IA 2F4FA 1QLNA 2HIQA 1NK8A 2VG6A 4F4ZA 1HMVB 2CQCA 3VZIA 2BE7D 3MCMA 5B0GA 3LP0B 4DR6F 3WDOA 2UVRA 2UUCF 1RAIB 3A13A 1C4CA 3UD3P 3G96A 4DR7F 4N76A 2NXCA 2W9AA 2KJWA 3QIPB 4RW8A 5KFAA 1S0OA 2KXHA 4M5LA 1ACMB 1FHTA 3UW1A 2XMMA 2XBPA 4QU7A 3HPOA 1R27B 2GMLA 2BE2A 1SV5B 2R2RA 1WC6A 3CJQA 3FBBA 2BE9B 4ELVA 3W9JA 3CPWR 1ZM4A 2BJ7A 3SDEB 3NLCA 4NLPA 1K0VA 3MMCA 4DX7A 2L9DA 1Y3KA 2DNYA 4KPYA 2D3O1 1ZS6A 4M5HA 1JXLA 1WHXA 2GAGC 4B3RJ 3D1HA 3BS9A 4O0NA 4O4RA 3LGMA 1U0HA 2PMHA 2Z2ZA 4OFZA 2IYGA 2YKMA 4B9UA 1HWJA 4A8SA 3M2UA 4UUWA 5IT9U 3PIOQ 1TK5A 3KG0A 2NPFA 3O6QA 4OI3A 1TKTA 5DG7A 2UV8A 3KKFA 2E1RA 4URSA 3D3CJ 3M8YA 1F6TA 1SC6A 4URGA 4OI0A 3FSXA 4B3SJ 4WZQA 3MMAB 5L9XA 3H90A 4AL6A 2B51A 3ZNUA 4MH8A 4DG1A 2CQIA 4MKAA 1C1BA 1OWXA 3KK1A 3T19A 2JHEA 4NZ0A 4B9LA 4ICLA 4DR4J 1XBWA 4R8UA 2KFZA 3A8IA 2MXYA 1SJ1A 4LF7J 4B3RF 3JTPA 1AROP 4C7QA 2G0JA 2W24A 1TK8A 1VCTA 3T5HA 4FF4A 3FKBA 5J2NB 3DLEB 1F5BA 3DDKA 2CQDA 1U2CA 5B7WA 4CDIA 3HP6A 1XR6A 1HIYA 4I6WA 2QMWA 4KGZB 1IN0A 3PKYA 2RQMA 5B0AA 3MM9B 2MQPA 2M2BA 3DRSB 4E8UA 5I42A 3OBIA 4B3SF 3P3DA 2RS8A 4WP9A 1Y10A 3VAHA 4J37A 2OMLA 4NMLA 5CZVA 1C0UA 2MYFA 3W65A 4DR4F 4FNHA 4MFBA 3A12A 1HHTP 1RWVB 3D28A 1NSPA 4LF7F 1I5OB 4DL5A 3FQKA 3VWSA 2N82B 1RZMA 2C22A 4ZPCA 2VG5A 3H2UB 3N6NA 4N77A 5L46A 1YJ7A 4JI7J 1RISA 4ZHRB 3MMBB 2NPIA 4DL2A 4ZP6A 2WVBA 2DO4A 1UJ4A 4DFMA 4F3MA 4BC7A 1EETB 2BQRA 4DUZJ 1U6BA 1VRQC 1IKWB 6FDRA 3D0HE 2BX6A 2CJ9A 2VFSA 2HRTA 3OXFA 2C2OB 2OTLS 4C4WA 4OLOA 2IM1A 4WFAQ 4ZDNA 4M5JA 1U1RA 1HW9A 4P9SA 2GQCA 2M52A 3SQGB 1G1XA 1HBNA 3RAMA 3G82A 5F0UA 2QX0A 3MR7A 3MFIA 3KJVA 3K17A 2R2SA 1YDLA 5B0CA 3M2RA 1PILA 5C25B 4TQRA 4RNMA 4JI7F 2B4PA 1VBKA 1YTYA 1SKSA 2NREA 1F5AA 1REGX 2HZCA 1DRZA 1RKJA 1S9EB 4CLKA 3EXCX 4DUZF 2QV6A 4TYBA 2CPXA 4M5DB 2E9RX 2H54B 3WIVA 1KBRA 1WC5A 1LWEB 1TVRB 5DGAA 5KFQA 2LXFA 3A1YG 1RBLA 5IT4A 3R5BA 3GIMA 1VC0A 1X4HA 1AA1B 1WOOA 1WNEA 2RF2A 2GVZB 3W63A 3ONQA 1NB2A 1XEZA 3KK2A 1HYSB 2N7CA 3VV2B 2DNRA 6AT1B 5KOXA 2NXEA 1GMVA 3WX4A 4QWAA 3PKMA 3RAQA 2FGOA 2M5YA 2XC9A 3BPSP 4EU0A 2FHJD 3RW6A 1DTQA 5F3TA 2QMXA 1KQSR 3QJLA 2ZNZA 1XWLA 3ILJA 1O5JA 1MMDA 2UV8G 2QA4S 1FD2A 1VFJA 3CT9A 1OSDA 1VRTA 1X9SA 4NLVA 2B5JB 4ZCLA 5IZHA 4OYZA 2FTRA 1VQKS 1GX5A 4ECZA 4PXEA 3KYLA 9RUBA 4ZCKA 4M94A 4RBVA 5JXSA 1EARA 3Q89A 1AFJA 4PKDB 5HP1B 4DQRA 2CQ0A 1S1UA 2R7TA 4O4GB 3POTA 2HBQB 4DV3J 1EAYC 1H98A 4QBUA 4PWDA 2QG9B 2OTJS 1KOOA 4O44B 5M2RA 1NAQA 4WFNQ 3BN7A 2QGFB 1M0SA 1JLAA 1TL5A 4KJIA 3C16A 1JJ2R 1RT2A 1GMUA 3W60A 2C28A 1S12A 4IG3B 1CEZA 4GO7X 4F26A 2NZ4A 1X4BA 2QRRA 5SUHA 1M5VC 3QRQA 3FMWA 4USJC 1FJGJ 1CVJA 1I1GA 4FF3A 3TUZC 1XMBA 3MEEB 4OZ3A 3OSPA 1Y0HA 1KR4A 4WWSA 1PG5B 3RR8A 1RT5B 2HVDA 2AWZA 4WFXA 3DFEA 1SL1A 3HKZD 1FNMA 1HWIA 5LSOA 5AE2A 4DV3F 2VV5A 1HNVB 3Q22A 1MU2A 1MWYA 3A3NB 3DM2A 4ETZA 3H4DA 2E5IA 3UQSA 3SCKE 4FYYB 1BQXA 4JI8F 2OPQA 1S1XB 3MM6A 1TV6B 5FDLA 4IQXA 4D3GA 4OL8A 3EICA 1JNZB 5KFJA 4YOEA 3W2WB 4FYDA 1FJGF 5HMWA 4OZ0A 2W7OA 1VQOS 1WC1A 3DDIA 3BSAA 3DOKA 3F44A 3RGIA 2IMWP 1KLMA 5J2PA 2WOMA 3W64A 1NSAA 2D69A 4C8OA 5F8NA 4ZVHA 2VB6A 2IJRA 1FDDA 1HKAA 4ZPVR 2FZCB 4DR3J 2ZUAA 4C11A 5HSPA 1Q8BA 3TRGA 2AYBA 3BSNA 4NZ6A 4AT1B 2PIIA 2KFYA 3MR3A 4HH1A 2R3VA 5JVHQ 4OV6A 4X4RA 2FIUA 3LP1A 1HI0P 3KLIA 2P8IA 2G0CA 4JB8B 3R5CA 4RBTA 4LF5J 2PGCA 3O8WA 2KN4A 1VS3A 1ZAWA 3P8BB 2ZH1A 2SXLA 1SH2A 1O0PA 2J76E 1SL0A 2F7VA 4DV2J 2BZ2A 3TI0A 2JLEA 4Q2MA 1YKWA 3QO9B 4DR3F 5IM0A 1ZH5A 4ED8A 2E5JA 3SSSA 4HYKA 2R8IA 5D0HA 3JSMB 1FNOA 2LXIA 4HHUA 3D6MB 4OHXA 3PJ9A 4CO5A 1R8CA 3OJSA 4P75A 4LF5F 2Y3YA 4Q7AA 2HZVA 2R7VA 3AFGA 4ELUA 2HGMA 2MKIA 1FKPA 2ZJRQ 3SXLA 4QW8A 1X31C 2J8SA 4OX6A 4XPCA 2BJEA 5LJ3Y 2GIQA 2J0SD 1MROB 1KOHA 5DETA 3R27A 5H9EK 4AL5A 4WJBA 1H2VZ 1H72C 2GVDB 5HVFA 3SV3A 2VH7A 4YMEA 1YHQS 2XSJA 4PG8A 2KVQE 4USWA 3FUYA 4UF4A 1F0XA 1R6YA 2BKPA 2QJ3A 2ZH2A 1Q5YA 2C3YA 4OX9J 1DJ0A 1A9NB 3M8SA 1TP7A 4LQ3A 1RHUB 2X3GA 1AFIA 4RW4A 4X2BA 4ED4A 1DTTB 2DT9A 2MQ8A 1NKCA 3L9ZA 4KFBB 4QYZK 1LV5A 4RU9A 3TO8A 3KDNA 3CCRS 4QZVB 2WCXA 5ETSA 1IKYA 2KM8C 2HFOA 5KTQA 5GAEI 1U1OA 3ADAC 3QSIA 2IDLA 3B78A 1NKBA 2MQNA 4HDHA 1CLFA 1S79A 3HSGA 2ZD1A 3TAMB 1RP5A 1WSVA 3A3OB 1DAXA 2K7JA 3ZZUA 4FF1A 1OSCA 1I94J 3CTRA 2LU1A 2N3OA 1JK9B 4KV8B 3R5JB 3BQ2A 4Q45A 4FN5A 5C24B 1RKIA 5KFRA 1P8GA 4I68A 3BH6B 2VUGA 2W2OP 5DS7A 1VQPS 3KMQA 2JSXA 4WU2A 4GRSA 3MAQA 1WI6A 4Y2KA 3P49B 3TWZA 1SJRA 1UEVA 1IWAA 1C0TB 4FDFA 1VHFA 3G8SA 2LECA 2AJFE 5JUMA 1Q8KA 4LQ9A 1FE0A 3CF5Q 4K2JA 2ZH3A 4LIRA 4QCLA 2HW3A 5C5JA 4KGKA 2YNGB 1D8ZA 1I94F 1TL7A 3NS6A 2DNQA 3I5CA 4O3PA 4IRKA 4NZ7A 1UEKA 4O3SA 5F3ZA 1U6ZA 4IH6A 3IMQJ 1FCAA 4KKOA 4IH5A 1YBUA 3HD1A 4FNIA 2PFDA 4E0DA 3MCNA 4X62J 5KT5A 2CJAA 4B08A 3LPYA 2KRRA 3QGGA 2ASJA 1RABB 4UOHA 2PDAA 1T03B 3S8SA 3MEGB 2VFVA 3M8QA 1Q78A 3D6TB 3NWRA 5CYQB 3HSZA 3SCJE 1TQLA 3AD9C 2J9CA 3TZYA 2XYHB 4KR0B 4ECTA 2OD6A 4EBEA 3JSRA 4IH7A 4ZPDA 4L3NA 3RB3A 3GG1A 4A8OA 4OHZA 4QOTA 4XPEA 3DGVA 4F50A 4JI1J 2DNOA 3TANA 3LWMA 4DQQA 3U1MA 3IXQA 2IBOA 3H25A 2DGSA 3I0SA 2HNZB 5T41A 3PHEA 2W7PA 5A0YB 2QYGA 3Q8YA 2W1BA 1E6VB 5E3AA 4NLOA 1YRTA 3GR0A 4X4OA 2ZBRA 2DRBA 8ATCB 3R5GA 3GJTB 4FS1A 1BQMA 3PJXA 3V81B 4WFBQ 3OR1A 4CO1A 3VGSA 5J1EB 4OLPA 5HLFB 3K57A 4Y2AA 1OMSA 2W9BB 2HQGA 3RBXA 1VJQA 1CJKA 4AXIA 4YUDA 2AW0A 3ISZA 3H0PA 2B43A 2M9KA 2FJVA 4QPTA 3LWLA 4B9NA 4K7QA 1HBOA 4AE5A 2IAJB 1G6BA 3FSIA 4JI1F 1FNXH 5IWAF 1OPIA 3NEKA 4F0KA 5KG7A 1RAEB 3DRRB 2HLUA 1SXLA 2QIFA 2ZH7A 1QD1A 2E5GA 2CYYA 3W62A 3K7RA 3PRBA 1CPZA 4B9VA 4FBUA 3OTDA 2Y9HA 2F40A 4HT5A 1EQMA 1I6JA 5D6GA 1ZTTA 3W3SA 1GTHA 2WW8A 3VVTA 2RKIA 2MJNA 1ULRA 1VBYA 1P9YA 1B4SA 1T9YA 2MKCA 4X4VA 1LFWA 1T7PA 2HLTA 3I87A 3H98A 1QTNB 3M4XA 1D1UA 3HHKA 2V69A 4W92B 2BUNA 2IRUA 3N6LA 4CH7A 4QPXA 3MWBA 3ILOA 5L1JA 1TL1A 3AD7C 3L7UA 1UP1A 3I32A 3AY0A 1SH0A 1S7IA 1QAJA 4DLGA 3OHAA 4OI6A 3NNCA 4P7VA 4MK7A 2UZAA 3TW0A 2BW2A 4RWXA 3V2UC 3RAXA 3CVKA 2R8KA 2EW9A 1U1MA 4K5SA 4X4QA 4CP5A 2ZOGA 4ZP9A 3LUYA 4N8NA 2AQ4A 3GSDA 2MZSA 3D7SB 1HR0J 3PYDA 2GJIA 4DXLA 1N0UA 4K2XA 1JKHA 4DQPA 4Y2CA 2GC8A 2HFZA 3PRDA 3MTKA 4F7VA 4X4TA 1JB0C 2GAHC 2OKQA 5KFLA 1T95A 2CPJA 2FZKB 1EP4A 3BR9A 1WG4A 3ZZZA 2Z4PA 3FZBA 1RXOB 3M32B 1U25A 2DR7A 4LMZA 1QUVA 1F5CA 3I9V9 3B8HA 2VBZA 4X66J 2MLZA 1JMTA 1G3OA 5DG9A 5LJ5Y 1SQFA 4LF4J 1VIOA 3AJ2A 1NSKL 4WZMA 4KGXB 3M8PB 4XK8C 2AEMA 2KZZA 1S72S 1P1TA 2HPUA 2CZ9A 1RWWB 3U1NA 5HATA 2PE8A 2HS0A 1NJIT 2PI4A 4JV1A 1HR0F 3BSOA 3NY0A 3RG6A 1VLYA 3BN4A 5D0RA 1BHNA 4CQ1A 1B7FA 4U8YA 3G87A 4H4KC 2N4CA 3ITHB 3QBCA 2YNIB 4O23A 1QM9A 4KHPJ 2BA9A 2JZ5A 2GW8A 4C98A 1KDNA 4FXWA 1RWMB 3H4BA 2PFFB 2W9CA 5CCMA 3HVRA 3QNWB 4ALZA 1KHVA 1S4FA 3ICLA 4H4MA 4PAAA 1S0VA 1HW8A 3WHIA 2ZNYA 4RKUC 2DXFA 3MR5A 1TKDA 4DSLA 3M9OB 1UVNA 5LXYA 4LF4F 1CULB 2E7WA 1Q5VA 2ZH6A 4I2QA 3IAM9 3NP5A 2F9JA 5D0GA 4DWIA 1URRA 3TR5A 1R7IA 1K1SA 4NCGA 5KFSA 1NM2A 1QE1B 3UCZP 1IJFB 4L6V3 3OR2A 3MPDA 1GEHA 3FRZA 4NLWA 3AOCA 3TEHB 2FLNA 4KHPF 2JX2A 2YWFA 2ADCA 2XNRA 1RHKB 2E7VA 3CDBA 4TLRA 4ZLNA 4ECSA 2V0NA 1TK0A 1LK5A 5C2GA 3MM5A 3R1LA 4QIGA 2FHKA 4OI1A 3QJPA 2ZVIA 1Q79A 2MSTA 3CUNA 2DNPA 3GJQB 5K14B 2HBZB 2IY5B 1S1WB 2J9DA 3CJ4A 1JNRB 1RWPB 3NAIA 1S1VA 2DHAA 3CDWA 2HMIA 3P6YC 3K5NA 1X5OA 3LP2B 3V6KA 5DJBA 4UTGA 4ZPWR 4IOCQ 2NSCA 1K1QA 1U4BA 2GQQA 4DI6A 1V3ZA 3OL7A 3TX8A 2V4RA 4C3LA 5SZTA 1HMVA 1PBUA 3PW7A 4DSEA 5AT1B 2OLWA 2I1RA 3L09A 1UVJA 2V50A 1FX2A 3LP0A 3A8EA 4JV0A 3D4JA 3NNAA 1SJQA 2R4FA 2HHTA 5J2QB 1WF1A 1X4GA 4LSLB 3RRKA 3QWPA 1WTFA 2PEHA 2QFIA 2P9CA 3QIPA 3CJ3A 4JI3F 3HDSA 1M5HA 3VTIA 1IKXB 3BGOP 3TVZA 3H5YA 3I6PA 4PG7A 2OPRB 1PBAA 5KG3A 1WOSA 1MWQA 1SV5A 1PC5A 3J7YI 4IOAQ 1L3KA 3U27A 2WBMA 3SDEA 1B0PA 2XYPB 3FQLA 2JEIA 3PYEA 4NI2B 5ETQA 1M1KT 5AJ3F 3M9NB 2KT2A 3GCWP 5HN0A 4RUBA 2YWEA 1XK8A 2JRSA 3GZ7A 5CCLA 1FTCA 4TLQA 4NA3A 5RUBA 4OYWA 2MZQA 2P9GA 3BGRB 3CC2S 2HFSA 4FYXB 5KT2A 1N34J 4BLGA 3MR2A 4TU7A 3DMJB 2XLKA 1N4LA 2CG4A 1S76D 4P2SA 2EFNA 3MM7B 4LIWA 1OY8A 4UOCA 5K5MA 4F67A 1R6VA 3Q8QB 1RDRA 4MK8A 1RUSA 3GJRB 3QLHB 4CLSA 1O8BA 1YSJA 3MMAA 4ERDA 4EBDA 4J9SA 2I5JB 4H4OA 4OI2A 2OMOA 4ZVSB 2DGOA 5LL6d 1M1GA 1PGZA 4HKQA 1TL4A 2HBYB 3TJ9A 2DISA 1J5OA 1G7CB 1Q1KA 3IBFB 2BKNA 2ZKTA 2C2KB 4J9NA 3M30B 2DNZA 2XY6A 3IO1A 4LR9A 3NKYA 1W2BR 4OYOA 2RDIA 4M5MA 1QUPA 3GFHA 1VIXA 4MAKA 5J2NA 3DLEA 2RQCA 4LVNP 3LPEA 4DEZA 3HI9A 2ZBPA 4CWBA 2LP4A 1YGYA 3BO4A 2D1CA 4JYAJ 3NCQA 2MZJA 3NNHA 2RJZA 3PG9A 3TZZA 3MM9A 1ZZNA 3DRSA 4QWCA 1QSYA 5IV3A 3TP2A 3HHLD 5EWFA 3RTVA 3DRXA 2RAQA 4J90A 3DOMB 2KKHA 1FERA 1XERA 2DIUA 2HHWA 2Z2YB 4A48A 1RCXB 1O6XA 2Y0SD 2XO6A 4C6AA 1K47A 2F65A 2VASA 1ZBTA 4N41A 1R0BG 2FVSA 5CD4A 5IS2A 2WVCA 1U1PA 1CSJA 3DLKB 2QEXS 4LRAA 3H8YA 3OT9A 3PR5B 4WXWA 4ZHRA 3MMBA 3GE9A 3NL0A 3KXDA 4K4TA 3IR6B 2YH0A 1REVB 1UFWA 3GV5B 1AUDA 5ETNA 3W61A 1EETA 1RAOA 2XI3A 4JYAF 1FRXA 5HMYA 3CE8A 1IKWA 1HLWA 2NZCA 3UR3C 3IWLA 4NRUA 4OYBA 1N5SA 4CTAA 3W1YC 4B9SA 2EFOA 4QW9A 4DX6A 3M8RA 3KHRA 3C66A 5HBMB 3L3CA 3HHLC 1RYRA 1YX2A 2XMVA 2YVSA 3LQVA 4NLUA 2H5JB 3SQGA 5F8GA 1U09A 1N6QB 4B17A 5B09A 1CC8A 4K5RA 1VHIA 4PR6A 3E51A 4F4YA 2ZWPA 4OZJA 3OTOF 2KHCA 3OPKA 5C25A 4F0MA 2FJXA 4ES2A 1UEUA 5AXMA 2Q79A 3QAEA 3N5BA 2R7RA 2LA4A 3Q8UA 2R8JA 1N33J 3MZIA 3V4MA 4M1KA 5MAOA 2IDEA 2YWHA 3EWGA 1S9EA 4M5DA 2AZ1A 3MPWA 3N9UC 5CYMB 3C6UB 4A4JA 3GFYA 3CJKA 5F8IA 1WC4A 1PYOB 2B9EA 1LWEA 1TVRA 3KUGA 2C3PA 1F1BB 2WVDA 5IM0B 3KHHA 2JLGA 2RSQA 2VJVA 2HQFA 3NMRA 4Q43A 3OL9A 1C2PA 4NCBA 1DLOB 2D3OR 1FJCA 5DRKA 2N4DA 3AXMA 2VDIA 4F0HA 2FJWA 1FE4A 2AX1A 2GVZA 2HHQA 1UW9A 9ATCB 2V2QA 3C3LA 2J7KA 2C2MB 3R9LA 2RH3A 1HYSA 2HAFA 5LXRA 1MN9A 3PO5A 2G1HA 3I0RB 1N33F 2KO1A 1HI1A 3DRPB 4DX8H 1I3OB 4FF2A 2EVZA 2GJ2A 1CQMA 3AOBA 2NXJA 2LQ9A 3NBPB 4QYRA 2BRKA 4PYDA 3GYXB 2QL7B 1X5SA 2YPYA 2B5JA 4DR2F 3J7A1 3HVAA 3WX8A 3S7RA 2Z8QA 3S6EA 4HL9A 4ED3A 3HO1A 3CJ5A 3TZWA 4ID8A 1FRHA 4ECYA 1EKSA 4H54A 4BWJA 4U67Q 5HP1A 1JLQB 5KFWA 1URNA 4O4GA 4N7TA 3KJNB 2XO7A 1FI4A 4Y65A
chains in the Genus database with same CATH topology
3A1YG 5IT4A 3R5BA 3MEKA 3GIMA 4O0IA 1VC0A 1GXLA 1X4HA 1YWXA 4O44A 3UDCA 4N5SA 1GNKA 2F3JA 2BBEA 4JI0F 2MHEA 4J9QA 1RYSA 2M7SA 1CQNA 2XCPA 1WNEA 1NU4A 1L3TA 4C8ZA 2D9PA 2CVEA 2RF2A 4NYOA 5K8OA 1YIJS 2ZZNA 2XG8A 2M8DB 5E3CA 2K1RA 3Q8PB 1HBNB 3ONQA 2DHGA 3DYAA 2B4VA 3AB4B 4AUKA 1E6YA 2LYVA 3DHWC 2Q66A 1XEZA 4QWDA 1S77D 2WAQD 3LOUA 4DS5A 3KK2A 4IRDA 3KJVB 3RB4A 1HYSB 4K4WA 2N7CA 1TKZA 2DNRA 2JH3A 3C46A 4K50A 5KOXA 2QSFA 3N79A 4OJ3A 3OFHA 5HROB 2DNMA 3M2RB 4IG3A 2BR0A 2I2YA 3WX4A 4QWAA 3OTCA 3O1LA 3QYYA 2FGOA 2M5YA 2XNQA 3CIMA 2L48A 4ITSA 3HVTB 4KHMA 4EU0A 5AE3A 2XC9A 2FHJD 3HT3A 3RW6A 1DTQA 3ENWA 5F3TA 2JEFA 2QMXA 5KFCA 3IRXB 2VQFF 1KQSR 3QJLA 2HS4A 2ZNZA 1XWLA 2FUG9 4TNOA 2P9EA 1O5JA 1MMDA 3AA9A 4QR0A 1ZM9A 3K5OA 2UV8G 2QA4S 1K73T 1FD2A 1VFJA 3CT9A 1OSDA 3MEEA 5C42B 1VRTA 3CJ2A 3DLHA 4G1IA 1JLBA 3ZZRA 5A8RB 5CYJA 1X9SA 1ZPWX 4NLVA 1QSLA 2B5JB 3OFEA 4ZCLA 1RT5A 4WTYA 4NL5A 2FTRA 5IZHA 1YQHA 4DV5F 5K8NA 3CXCR 2PD1A 5GADU 4V19J 1VQKS 2C42A 1GX5A 1VQ7S 3BM7A 4ECZA 1LWFA 4PXEA 3FFIB 2QA2A 3KYLA 3BQ0A 2FLLA 2UVVA 2YQ3A 3KLGA 1N0VC 4R0JA 4ZCKA 2E44A 2BQUA 4FPRA 4M94A 4YB5A 4RBVA 5JXSA 2G9OA 5LSRA 3Q24A 4EYIB 1VQ9S 1G2EA 5KFXA 3HJFA 2VA2A 1AFJA 1HNVA 4PKDB 4BWMA 3VAMA 5HP1B 4DQRA 4PPZA 2CQ0A 1FRMA 1S1UA 1ZTWA 3KG1A 2R7TA 2QFJA 4OV1A 4KO0A 4O4GB 1LQ9A 3UPFA 3TVYA 2UVUA 3POTA 2WONA 2K2PA 2BM1A 4XO0A 2Z2MA 3PO4A 1HD0A 1H98A 2M8HA 3LAKA 4QBUA 2RRBA 4PWDA 3WC0A 2OTJS 4NLDA 1WELA 1S1XA 3WC2A 1KOOA 2XMJA 1W25A 4HT7A 4O44B 5M2RA 2OD4A 4CO0A 1IXKA 2R7UA 1NAQA 5D4PA 3G6XA 3NAHA 4JI4F 2CQHA 1TV6A 4WFNQ 3RBEA 3BN7A 1B64A 1VBXA 1M0SA 1JLAA 3BREA 4IR1A 2RF2B 2UUWA 1TL5A 4KJIA 2DNLA 1HA1A 1QAXA 3CEDA 5G0RA 2KVIA 4I6YA 2IM0A 4A46A 3DYAB 2FJBB 3MOJB 2NR0A 3CCVS 5B08A 3KTQA 5KT4A 2XGQA 3W2WA 1JJ2R 3U7JA 1RT2A 4LF6F 3KK2B 4NPOA 2C28A 2HHHF 1TKZB 2AYMA 3NCRA 3TAQA 2VOPA 5I4MA 2HAIA 4Y0FA 2PN6A 3VF0B 4C9DA 1GX6A 5HMXA 4IG3B 1CEZA 4GO7X 2A2DA 3PNIA 4F26A 2NZ4A 1X4BA 1Z2LA 2LLZA 1WG5A 3AB2B 1JJHA 4QIWD 2KDOA 3K8VA 1JIHA 1DTQB 1H7WA 2D3ZA 2IA0A 2QRRA 5SUHA 1M5VC 3F41A 3FMWA 4QR2A 4USJC 2JFKA 1I1GA 3DN9A 3FGVA 4F4XA 1UA0A 4JI5F 1CVJA 3RRHA 1S97A 4FF3A 2RS2A 3TUZC 4R25A 1U7LA 1XMBA 5CXTA 3MEEB 2FHJA 5D8HB 4GO5X 1VRTB 4WE1A 3OSPA 1JLBB 1TAQA 1Y0HA 1KR4A 2HVIA 5EUHA 3J7YU 3RR8A 4LFCF 1RT5B 4YR0A 2DH9A 2XY5A 2M3DA 1NO8A 2AWZA 2CJKA 2UP1A 2VKRA 4WFXA 3TUJC 3DFEA 1SL1A 3HKZD 4DSFA 3U1LA 1FNMA 2VOOA 1LWFB 2JDJA 1HWIA 3L95X 4I69A 5KFOA 2JOQA 5LSOA 5AE2A 3KLGB 2R7OA 2YY3A 1IM4A 5KFMA 2X1AA 1UKUA 1S9GA 4C3KA 4DV3F 1MMLA 2YX7A 2VV5A 5L1LA 2IFXA 2M0GB 1HNVB 4YR3A 3Q22A 3HHDA 1MU2A 3HX9A 1HPZA 2J0WA 1MWYA 1S1UB 4X62F 5HI7A 3SI8A 1R8BA 3DM2A 4P7TA 4KO0B 2JEJA 1OQ6A 1S1TA 4ZOSA 2GGPA 3POTB 4ETZA 3BO3A 1NJZA 2WONB 3N4WA 3H4DA 1WF0A 2DIVA 3MXHP 1IQZA 1RTIA 2E5IA 3SCKE 2B9YA 3UQSA 1U45A 2KG1A 4OZLA 1BQXA 1SB6A 4JI8F 5DM7Q 2XCAA 4PWDB 2OPQA 3NCPA 1S48A 1S1XB 4WK1A 3MM6A 5EN1A 2BXJA 4IFYA 4MYTA 4RWWA 5DGBA 1GTEA 2ZC3A 4PXCA 2PA8D 4N56A 1TV6B 2L3MA 1ZM3A 3BJYA 2KRBA 1Y4ZB 5FDLA 3QGHA 1JLAB 4IQXA 3SSRA 2CQ1A 2JVRA 2Z2LA 4D3GA 4OL8A 1JNZB 3OLAA 5G0RB 5KFJA 3MD1A 5DDPC 5AXKA 4YOEA 2FGCA 4OQJA 2EG1A 5A8KA 2DB1A 4HI2A 3W2WB 2Y1RI 4NYZA 3CDAA 4IFVA 1RT2B 4FYDA 3K2YA 4HTJA 1FJGF 4FXVA 5HMWA 1LOUA 4OZ0A 2W7OA 1VQOS 2GO9A 2VL1A 4LF8F 3G71S 4DMZA 5KG2A 3TAPA 1A6LA 2MY7A 1TFWA 2HNDA 3PDNA 2V8DA 3BSAA 3DOKA 3F44A 4TYAA 2IMWP 2ZITA 1KLMA 2DPJA 3NG8A 1XR7A 4CH1A 4QR1A 4BS2A 2EFGA 2KH9A 1UA1A 5J2MB 1Z1ZA 5KFDA 4Q0BA 4ZP8A 3T1YF 4LSNA 3O5TB 1QJHA 3PACA 3QO9A 1SKWA 2QLWA 4URQU 5J2PA 3SCLE 4ILLA 2OIHA 1Q8LA 2WOMA 4WE1B 3KHGA 1NZAA 3W2VA 5KFNA 5HO4A 2IM2A 4XAKA 4A8XA 3EZUA 4C8OA 5F8NA 3GMGA 3MEDA 4ZVHA 1N48A 5IT0A 2VB6A 1FDDA 4J9OA 1D8YA 2RQKA 4DR5F 2GMHA 4NYPA 1Q86T 4ZPVR 1UJ6A 2ZH5A 3CCQS 2B6AA 2DGUA 4ATNA 4C11A 4K4SA 2E1CA 3E01A 1S9GB 4WFYA 3KFWX 4OHWA 3TARA 5E3RA 4A8QA 1Q8BA 3B82A 3TRGA 2AYBA 1MU2B 5FIIA 1WHVA 4NZ6A 3BSNA 4KHRA 3IBWA 4KAIA 2PIIA 2KFYA 1ZETA 2LMIA 4DV6F 1K9MT 1IR0A 3FEZA 3MR3A 3DM2B 3MI7X 2VPWB 4C2MA 3W7BA 1S1TB 1XTZA 1TL3A 4ED0A 2V4JA 1GT8A 4HH1A 2UU9F 2A1BA 3EPIA 4QWBA 3UDLA 5JVHQ 1HI8A 2A10A 1RTIB 3BGFA 3WZ0A 4X4RA 3VAFA 2ZC4A 4DN0A 1F9FA 2FIUA 2OSRA 3H40A 3LP1A 3O3LA 1HI0P 3KLIA 2OPQB 4DV7F 2GX8A 2G0CA 3MM6B 1VGYA 1YJTA 4IFYB 4E98A 3CD5A 3R5CA 4U6PA 3GIKA 1BC6A 4RBTA 4JBCA 4A8MP 2PGCA 5A2QY 3O8WA 2KN4A 1U8SA 1ZYQA 5FDLB 2WSCC 3GYNA 1VS3A 2V8HA 5T7LA 5KFKA 1RTDA 2QA1A 2WTFA 2ASLA 1ZAWA 4PG6A 1VRUA 3UCGA 1MROA 5A8KB 2ZH1A 2SXLA 1SH2A 4IFVB 1O0PA 2J76E 1SL0A 2F7VA 2XLJA 4NOHA 4I2PA 2N3LA 4DQIA 1LW2A 3I4HX 3IRWP 2HNDB 4MJKA 2BZ2A 4WYLA 3TI0A 4Q2LA 4KGMA 2JLEA 3DOKB 4N47A 3QJJA 1KLMB 2VBXA 1VQYA 3JAMY 4WXOA 4EFAC 4ZS6A 4B3MF 4J5OA 2HWTA 3HM9A 4ECRA 3JTOA 1M90T 4Q0BB 5KFUA 4Q2MA 4I1TA 4LSNB 2V4QA 4GKJF 2IVFB 3QO9B 2DGWA 2DGQA 4DR3F 2IA6A 1P9QC 1X4FA 3ULHA 1RT6A 5IM0A 5J2PB 1ZH5A 1N36F 4B3TF 2Q1LA 2WOMB 2KB2A 3BZQA 2DR8A 4OMFG 1RT4A 4ED8A 3W2VB 2LCWA 3I31A 5GVQA 4OJ1A 2E5JA 3MEDB 3SSSA 3IGNA 4HYKA 1T3OA 1WEYA 3IG1A 1RT1A 2R8IA 2B6AB 2VONA 3PKMA 4C11B 4MTPA 3TQ1A 1QAIA 2HQIA 3JSMB 1FNOA 3E01B 1DTTA 4DHVA 2LXIA 5KAKA 3MM8A 2LQJA 4KRWA 2AGQA 4UY8T 5I3QA 5KG6A 2XMWA 5IFMA 4HI1A 1N8RT 3F56A 2IRXA 3PW5A 4KFBA 2LKZA 4TY9A 4OHXA 4CO5A 3KLVA 1R8CA 3OJSA 2VFUA 2RU9A 1APSA 1S99A 4LF5F 1TL3B 3DHXA 3LH2S 4Q7AA 5D3GB 1HWKA 2V4JB 4EBCA 1YJ9S 5KFIA 2J9DE 3MUMP 2LA6A 2R7VA 1WF2A 2OPPA 4ELUA 3LP1B 3Q23A 3KLIB 2HGMA 3M6VA 2FC9A 2MGZA 3Q8SB 2DGVA 1JLFA 2MKIA 1FKPA 1N52B 1TFYA 5DG8A 5KOWA 2ZJRQ 5F8MA 2MMYA 4X84A 3SXLA 4QW8A 2J7UA 2HHPA 4NCAA 4OX6A 5T7LB 1RTDB 3CCUS 4XPCA 1UETA 3TAMA 2BJEA 4ED7A 4QJVA 1VRUB 5LJ3Y 2GIQA 2J0SD 3GG0A 3QAUA 1MROB 1KOHA 1LFPA 5DETA 2P6SA 3R27A 1N5YB 4YB7A 2KXNB 4AL5A 3TYTA 1FEHA 4WJBA 1H2VZ 4ECQA 4I2PB 2QSWA 2Q6CA 2H9ZA 3MPVA 1DQAA 1LW2B 3SV3A 1BLUA 3CB4A 4O3NA 2MY8A 2VH7A 2LDYA 1SQEA 2KG0A 4YMEA 1YHQS 1J2VA 2XSJA 4DV1F 4PG8A 2HHUA 1AXQA 4IRCA 5KFYA 4KV8A 2X51A 1TZ0A 3ZZPA 1F0XA 1R6YA 3V6HA 3N5FA 2ZH2A 3ZZYA 1VQLS 2VBWA 3IFEA 5C24A 2C3YA 2HG4A 3GFXA 5E2QA 3TUIC 4DSJA 5E3PA 1DJ0A 1A9NB 3PX0A 4M8LA 1RT4B 1P1LA 4FVMA 3M8SA 4UUXA 1TP7A 3HF5A 2R7SA 4RU2A 4LQ3A 2X3GA 4KBIA 2GCFA 3M05A 2H5EA 2ZOMA 3MD3A 1YJWS 1ZM2A 1H6KX 4UQGA 1V3RA 4F25A 1AFIA 3RZAA 1RT1B 4RW4A 2ZUGA 1NK0A 4X2BA 1YRUA 2CPDA 5EWGA 1DTTB 4OI4A 3GV8B 3EPGA 3MM8B 2DT9A 4YDXA 1Q8IA 1FK9A 2DPIA 4LFBF 5F9NA 2YKNA 1NKCA 1YITS 2ZBIA 4OZ1A 4HHJA 3ENQA 4KFBB 2O1PA 5D4NA 2PO4A 1LV5A 5A6WA 1FEEA 4X66F 4RU9A 2VZ9A 1VQNS 3TO8A 1C0TA 1DBDA 4W90B 3BO2A 2MKSA 1N56A 2CZ4A 3CCRS 2GQ2A 3G8QA 3LW5C 1UVMA 4LFAF 4QZVB 2WCXA 3KHLA 1IKYA 5F41A 2OPPB 4JI2F 1IBKF 3J81Y 4CIOA 4C8MA 4KE5A 3DNCA 1UFLA 2KM8C 2HFOA 5KTQA 3PX6A 4EO6A 5GAEI 1M5SA 2E29A 4PCQA 2MGZB 3HK2A 3IR7B 1U1OA 2ACYA 1JLFB 1FKPB 5U47A 3OL8A 4IQMA 2MQLA 1LXJA 5T14A 3B78A 2A3JA 1NKBA 2J6TA 5F8HA 2J6UA 4RW6A 1WWHA 2CQ4A 2MQNA 5CA5A 4HDHA 4X64F 5A8RA 1CLFA 1S79A 2M4MA 4L72B 2ZD1A 2X1FA 3TAMB 2YNGA 2AGOA 2DD8S 1RP5A 2VBYA 2MKKA 4Y3CA 1R8PA 2ZDPA 2DVIA 2F8EX 1HQUA 1DAXA 2K7JA 3CCZA 3CULA 2WSEC 2IM3A 2CPZA 1M5OC 3H59A 5GMKa 3KK3A 2CQBA 2J5AA 2VC1A 2QYCA 2PSZA 4YFUA 2XS7A 3ZZUA 4FF1A 3N0VA 4WU3A 3OFGA 1OSCA 3CTRA 1NNDA 2CPYA 1XN9A 2XSJB 4C0BA 1KEKA 2I0XA 2F9DA 2VD3A 3KLEB 2DR9A 1U49A 2GFFA 2LU1A 4RX6A 2N3OA 1JK9B 4XDCA 2G1DA 4KV8B 5M2UA 3DCAA 4BC9A 2DR5A 3BQ2A 4Q45A 2JC1A 2F8MA 4F02A 2CPHA 4FN5A 1KQKA 5C24B 1RKIA 1YJVA 1Q81T 5KFRA 5BR8F 5LMNF 2GV1A 2F8HA 2KT5A 2XWYA 2QA4G 2EWHA 4V19X 1P8GA 1QSSA 2LQ5A 4I68A 2VA3A 5AXNA 4IKAA 4F4WA 3EXYA 4QU6A 2BQ3A 3HFKA 4ZCIA 3QWUA 4IOBA 4OJHA 2VUGA 1JJ4A 4GKKF 1AW0A 4RW4B 5DS7A 1FVSA 3SFUA 1VQPS 2JVOA 3DU6A 3KMQA 4DF4A 2JSXA