4B3SJ

Crystal structure of the 30s ribosome in complex with compound 37
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
98
structure length
98
Chain Sequence
KIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGPFKHKDSREHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title 4'-O-Substitutions Determine Selectivity of Aminoglycoside Antibiotics
pubmed doi rcsb
molecule tags Ribosome
total genus 10
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2012-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00338 Ribosomal_S10 Ribosomal protein S10p/S20e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 4b3sJ00
4NXMJ 4DV5J 4DV2J 1J5EJ 3R2CJ 5A2QU 4RJVA 4DV7J 4PWWA 3D3BJ 4JI3J 4JI5J 3R2DJ 1HNZJ 1N34J 4HHUA 4DR5J 2E5LJ 5LMUJ 4NEZA 3T1YJ 2KVQE 3J81U 2VQEJ 3D3CJ 3JAMU 1HR0J 3IMQJ 1XNQJ 2ZM6J 4OX9J 4B3MJ 1FJGJ 5BR8J 5FLXU 2UUCJ 2VQFJ 2HHHJ 4B3SJ 4KYZA 2UXBJ 4DR4J 4LFBJ 4K0KJ 4LFCJ 4X66J 4DR7J 2UXDJ 3W1YC 5AJ3J 4DUYJ 4KHPJ 4JI6J 4JI2J 4DR3J 3J80U 1N32J 5IT9U 5LM7E 1IBLJ 4KY3A 1N36J 4JI8J 4X64J 1XMOJ 4DR2J 4JI0J 2UU9J 4DR6J 1HNWJ 4V1Ak 3OTOJ 3J7AN 1XMQJ 2UUAJ 2KL8A 2UXCJ 2MQ8A 4DV4J 5IWAJ 4JI7J 4NEYA 4LF5J 1HNXJ 4LF9J 4NXNJ 1N33J 4YY3J 5LMNJ 4LFAJ 4DV6J 1XNRJ 4LF4J 1IBKJ 2F4VJ 4DV1J 4LF6J 4JI4J 4DV0J 4B3RJ 4YHHJ 4DR1J 4JV5J 4DV3J 3T1HJ 4LF7J 2MEWA 4X65J 1I94J 4AQYJ 4GKJJ 4JI1J 2MTLA 4JYAJ 4DUZJ 1IBMJ 4GKKJ 4X62J 4B3TJ 2UUBJ 4LF8J
chains in the Genus database with same CATH superfamily
2IMOA 3FSXA 2NXEA 2W9CB 2EEYA 2JL9A 5HI7A 3OSPA 2JLFA 2QLJB 3QJLA 4ID8A 1JB0C 4DV2F 5L38A 1KOHA 4RBTA 2CNKB 2A18A 1VRTB 3CO0P 3Q8SB 2VQEJ 2W9BA 3WX4A 5F0WA 2NREA 1RDRA 1ZAWA 3MAAB 4MK7A 4TY8B 3GWCA 1HBUA 5C42A 1Q4RA 3HDSA 4O44B 1T9WA 4K8RA 1NJXA 1P9QC 4DFPA 2RU9A 2DNGA 4NOHA 1UKUA 4A8SA 1OY8A 1VQ6S 5J2QA 3UR0A 4I2PB 5EDWA 2IC3A 2RS2A 3DHWC 3ITHB 1HPZB 3QWUA 4QWCA 2PEHA 2WRMA 5DO2A 5ETLA 3BN7A 4URGA 1VRUA 1HA1A 4G65A 2F4VJ 3MMBB 3DNCA 4J9PA 4NCGB 4KFBB 4NCBA 4USKA 1KR4A 5KFZA 4YFUA 2I6WA 4MT1A 4JI1J 1F9FA 1R27B 4FXVA 5GAHI 1J2VA 5DDOC 1XK8A 1LW2B 2N4CA 3MDFA 1RAEB 4F4AA 1WTFA 1RU1A 1YITS 2W7PA 1TV6A 1CPZA 2DNHA 3E01A 4RUBA 5K9FA 3Q22A 2KN4A 3TAMB 3IR6B 3KLGA 2LFVA 4QR2A 2QYCA 3IG1A 4C8YA 5E3CA 5L39A 1H2VZ 5BR8F 4YB5A 3O1LA 1FF2A 4O3QA 5HMZA 2BX6A 4DPWA 2VBWA 4RBVA 1N32F 5E3RA 1TKXB 5DG9A 2H4YB 4LFAF 3DOLB 3R5JB 3OUYB 4YR2A 2RE1A 1HIYA 3MM5A 2RAQA 3HHDA 4NLPA 1EQMA 1VHIA 4OHVA 1KKHA 4LR9A 1MMDA 2C22A 1U1RA 4RR5A 2ZD1A 4JUZA 4HACB 2OUGA 3LTOA 4DX7A 2DR5A 3GB0A 3OVSA 2MZRA 3M6XA 2XY7A 1EP4A 1X4DA 2BA9A 2D1CA 4AL6A 4OYAA 4Y2KA 5CD4A 1N34J 2DCLA 2WW4A 3D67A 3PKMA 1DTQA 1RTJB 1RBAA 3CF5Q 1AUSL 1HQEA 1SKWA 3K0JA 3DRRB 3POTB 4RLEA 1VI7A 2Z0GA 3I5BA 2BJEA 2J9DA 3U7JA 1T03B 4K0KJ 2ZUGA 1HL6A 5D6GA 1WTBA 4DPTA 3GYNA 4KPCA 5CH7B 1OY6A 3B4MA 1R6VA 4USIA 2EFGA 3IRXA 3I0RB 4KO0A 5D4LA 4DBQA 1IKYB 2IM0A 3PRVA 3CMES 2RJZA 2GNKA 2CQGA 2PE8A 1ZTWA 2UUAF 2BUNA 1O51A 2VKZG 4DV1J 4QWAA 4PG6A 3UWTA 2R8IA 4HT7A 3AY0A 3IWXA 3EZUA 4MIAA 3TR5A 3T5HA 1R8AA 3N9UC 3C3LA 3CW2C 1PILA 2VKRA 3MPVA 1R8BA 2X7IA 2V2VA 3CJKB 3I4PA 2ZHBA 3MM8B 3OQ2A 4DSIA 2D3UA 2YNHA 3RR8A 3HHNB 2HK2A 4XAKA 4N7TA 5LT5A 3M9MB 1FD8A 1S0MA 3MURP 5HVHA 2MB0B 2KXHA 3ZC4A 2GC8A 2LKZA 4MFBB 5I42A 1RBLA 4ECUA 3MR3A 5BYRA 1GX5A 1QLNA 2YKNA 1F3FA 2DGWA 4UOCA 2RQCA 3KDNA 4PG7A 1K0TA 1ZM4A 1KP6A 4C8NA 2W24A 1AT1B 3AD8C 4UQTA 5A0YB 4X64F 2DNOA 3R7NB 2R7WA 3CE8A 3UE2A 2KKHA 1R0BG 5K5MA 2ZH6A 3JYTA 4ZPTR 1IBKJ 1QDUB 3RBDA 4Z7CA 1Y3KA 1NK8A 2X3DA 4FYWB 5KG5A 4NLYA 5DGAA 1AB8A 3QZ8A 1U26A 3M2VA 1QY7A 2V5HG 2M4MA 2QJ3A 2W2QP 2OEMA 1WSRA 2ROGA 3M30A 5FLXY 2DB1A 2IM1A 3MHYA 4KC5A 2CJYB 1B0TA 3OR1B 2C2MB 5M2RA 4MTPA 2HEKA 2D7SA 3HHKA 4Y34A 1RZMA 3S1TA 5F0UA 2VPZB 4IH6A 2OD6A 5EX3A 2VASA 1TL1A 1M5HA 4KGVB 3ZTSA 1C1CA 5B08A 2XO6A 5G0RA 4CWBA 1YJUA 2R7OA 1TKZA 1SCJB 2RRNA 3UO0A 1TKTB 4CO0A 2P9EA 4NXNJ 5JVGQ 4PYAA 2BM0A 2Z30B 3IS9B 4NLQA 2YH1A 2ZWPA 4JI7F 2VG5A 3D54A 1UW4A 2EK1A 2XZDB 2KTQA 3IM8A 1RAAB 3SSQA 2Z8QA 2GV1A 5J1EA 1EQ0A 4TLRA 1U8WA 1WEZA 2CKWA 4FF2A 3FK4A 1CJKA 4TNOA 3KK1B 3PR4A 2CQ1A 3HVTB 4BWJA 3F44A 1JJCB 1QSYA 1SXLA 5KFJA 1CJVA 1RYRA 2E7VA 2E5LJ 1KBRA 4IRCA 5J1PA 2B51A 3BBFA 3KJNB 3D6HB 3PW7A 3QFWA 4ERDA 3AJ1A 1B64A 4QIEA 2PMZD 3R1HA 1FRXA 4WTOB 1XR5A 1PJ5A 1CQMA 4ED4A 1QD1A 4MYTA 3T9ZA 5B0AA 1MMLA 1WUUA 1LEOA 2L9WA 4J90A 3W2WB 3OTOJ 1NZ8A 5B0CA 3R3TA 3RRHA 1YJNS 2HFNA 3BPDA 4RKUC 2UZAA 2AMCB 2WBRA 1Q53A 5T14A 1BQNA 4IQMA 4OHYA 4I0WA 5CYMA 1I5OB 2W7AA 1N0VC 1R8CA 5E3QA 4ZPBA 1F5AA 4ED2A 5HROA 3IFEA 2QSFA 3I31A 3J81Y 4IQXA 5BJRA 1Q8LA 3Q8VA 3AB4B 3ZZTA 5DETA 4OYWA 2EFOA 3ET6A 2P6TA 2YX4A 4ED0A 4J9MA 3ISNC 3CNQP 3TZYA 4I1TA 3US5A 3PW0A 3MUTP 5DQGA 2YQ3A 3OL8A 4O4RA 2HLTA 1FRHA 1WF1A 3S6EA 3LAMA 5B0DA 3RUBL 3DLKA 4YR3A 3J7YI 1HNWJ 2RILA 4DL0C 3G82B 2BKPA 4JI0F 5LSLA 5B0EA 1XWLA 2PSZA 4QIWD 4DOZA 1ZM3A 5KFWA 4IR1A 5HMWA 2ALZA 1XNRF 2I5JB 4AQYJ 5F41A 1DY3A 2G2ZA 2KJVA 2WB4A 2GS8A 1DURA 3EVMA 4XPCA 3M6WA 3R2CJ 2KHCA 4MK8A 4C11A 3KJFB 1VQNS 4ID5A 2AJ0A 4OYIA 2WOMA 3MFHA 3PW5A 4A8QA 2F63A 3M7VA 3CJTA 1UETA 3CTRA 3GIIA 1KVJA 3J80Y 4ELUA 1HNIB 1TFYA 2ZUAA 3FZ2A 3LWLA 2Z4PA 1DLOA 4HHJA 3CCLS 7FD1A 4RUCA 1F2GA 3SZ2A 2BJ3A 3BF4A 4ZVQB 1KS2A 3NY0A 3W2VB 3TQEA 1U1PA 3GIKA 2ASDA 3FZBA 3KNGA 1QE1B 5F8HA 3TVZA 2ZOMA 4PG4A 2FJBB 1Q86T 3EWGA 2R2UA 2DITA 3DDKA 3QMQA 2EW9A 5D15A 4QYZK 2ZHAA 1FXDA 2D9OA 2VBZA 2L9DA 4WPAA 4EMDA 4NLWA 2OPRA 5LMNF 4LF4F 4NI2B 4PWDA 4NLRA 3HO1A 3L7PA 2C2NA 3KK2A 3CJSA 2EFQA 4CH0S 2VG6A 1U0HA 4USJC 1BQMA 1U1QA 3H2LA 4RPFA 4DFJA 2GW8A 2YKPA 3L4BC 1GEHA 2ZC4A 2D69A 3KLHB 2R8HA 1Q81T 5DG7A 5E41A 5T7LB 5C2CA 4DR7J 2ZOGA 4KHPJ 2XWXA 4LBPA 2RUSA 3RW6A 3RGIA 4C97A 4ZPVR 4L72B 1HQ2A 4JB8B 2Y9HA 4DSKA 2V67A 1X0FA 3CD0A 1HYSA 1UVKA 2QSWA 3UDCA 2VF3A 3C46A 4M5MA 4HL9A 3SEOA 2Y3YA 4ILRA 4DV4F 1S6OA 4MKYA 1RWOB 1N5YB 2F8EX 2Y0SD 1UFWA 4DUZJ 4LIRA 4B3RF 1RAHB 1WACA 4MJKA 1F2HA 5F9LA 4GKJF 1SC6A 3OR2A 1R0AB 4ZPAA 3C16A 2B9XA 4RW8A 2A2CA 5CQGA 1HNVA 3AOCA 1SVDA 3QZ7A 2VFVA 4HR2A 3IP0A 3R5AA 3T1YJ 3I96A 4M5LA 3PV8A 2DH8A 4DR5F 1SI9A 1TVRB 3RBZA 4U95A 4F4YA 2J5AA 3M6UA 2HHTA 2QC3A 3WBZA 3QBCA 2ZEJA 5B7WA 1FNMA 1QSLA 2XMAA 4QR1A 1PCAA 5GAGU 2V9WA 1U6FA 1WHYA 2AW0A 3H8YA 1E6VB 2QEXS 1RCOB 4R8UA 2DNNA 3A8IA 2JFKA 3UD4P 4DEZA 2W4CA 4QWEA 4AUKA 2MKJA 3N5BA 2MMYA 1YX2A 4P7VA 1HKAA 4ZLLA 1YJ7A 1WC0A 3PXGa 4I7FA 3GCXP 1TAUA 2ZNZA 5C24B 2JDJA 5A2QY 3HHLB 4NYPA 2FUG9 3HVWA 4CM0A 2CQBA 1FKPA 4F4WA 2LXUA 4DQPA 3GJRB 1KHVA 1S6PB 4PQUA 3A4TA 4WF9Q 3M32A 2PFFB 1NSQA 2DK2A 2DGUA 1K8AT 2CJXB 3K2YA 1U2FA 4NCAA 2Z2ZA 1JLGA 4RNHA 2QG9B 2C3OA 2YQ1A 3G87A 2LXFA 2A6MA 4ETXA 2VQEF 3NCQA 2MXYA 2ZOFA 1C1BB 2ATCB 3K8WA 4WFYA 2FVPA 1SH2A 2HNZA 5IQQA 1NBEB 1S97A 4PUOB 3DLEA 2AJ1A 1VQ7S 4GRSA 1LWFA 2VIHA 4LMZA 1QTNB 3UVJA 3BO3A 3TUPA 4NA2A 2BANB 4DQSA 4ECVA 3AA8A 1YG0A 2E5HA 2NZ4A 3DU5A 1MMNA 3SI8A 3CC4S 2MZ1A 4FYYB 4DJBA 3D1HA 2ROEA 1IR2A 4KR0B 2UVUA 1FA0A 3MGJA 2YNFA 4JBCA 5K14B 4PWWA 4JI1F 3NS6A 2CPZA 3C14B 1YHQS 4JI3J 2XO7A 4DL4A 2APOA 1UL3A 1WI6A 2YKAA 3VAIA 5A8WA 2G1DA 5ITHA 3C66A 1HBMA 4JI2F 2AZ3A 1XERA 3HMJG 4EZ9A 1S1UA 2OPSB 3MM9A 3N6NA 3KJVA 4CYUA 3IRWP 4ALZA 2VOPA 2RIJA 3KLFB 3G9CA 5KT4A 2L41A 3MMJA 2B43A 1HD0A 4UUWA 1N0UA 1HHQA 2R7XA 4OX7A 4J9KA 1IKWA 3TUJC 1N33F 3ADAC 3PYEA 1H74A 1IQTA 3SBMA 2ZZMA 2MYFA 1LWEA 1VQSA 3PW4A 3FRYA 5CYJA 2E5GA 2G1HA 5A8KB 4X4SA 3ITHA 2O5DA 1VIXA 1WKLA 4RW7B 3CJ3A 3V4IB 2EFPA 3P8BB 2L08A 3N5FA 4Y00A 4ECZA 3L7OA 3RRGA 1JLAB 3H5UA 1PYSB 2R42A 5EWEA 4WZQA 2E7XA 1M90T 3G86A 2MKHA 4K4SA 2MKCA 1S9GB 5J1NA 5KFOA 4W92B 3CCUS 2ACMA 3N6LA 2DHAA 2ASJA 5FDLB 2AF6A 4OX9J 2I2YA 1TMJA 3SYZA 4FDFA 3PO5A 4CI0B 3DCAA 4LFBJ 4K2JA 3C6TB 4LFCJ 3O6QA 1VYAA 1QM9A 2KB2A 5D4OA 3RZAA 3TAMA 3JS9A 1S79A 2WCXA 3GIJA 2RDJA 2DHSA 2B4PA 3ZTQA 1X31C 3K8VA 2YPYA 2UV8G 3JXOA 3PCOB 2BBEA 3KMQA 4R25A 1JLCA 1U09A 2J76E 4CO2A 3TJAA 2QV6A 3TJ9A 3H0PA 1FI4A 4OZ5A 1G1XA 1S6QB 3GFYA 2YWHA 3ILOA 4ZLJA 4LRCA 2J7UA 5E5NA 4DV1F 1IR1A 4C4WA 2Q3PA 2RS8A 4ENOA 4DQIA 1WKJA 4DV7J 3Q24A 3MMCA 3THTA 5JVHQ 4NLTA 1Y7PA 4HACA 3VZIA 1F9HA 3H59A 3L9ZA 1R7IA 4K4VA 1S1WB 4ZVPB 3I87A 5KFAA 3GG0A 3CVKA 4I2QB 4OYMA 4MIWA 5HVFA 1UEVA 1Y5NB 3SQGB 1RB0A 2BQRA 2VBXA 4JV2A 1K1SA 3FBFA 4HHHA 2KG1A 3VHQA 4G1QA 2HIQA 1L3KA 1T9TA 2VA3A 4DR3J 1UZHA 3DRRA 5KOXA 4B08A 2C2KB 3ETMA 4ZN3A 2RNEA 2Z58B 3FBCA 5LSOA 1QAYA 3QQCD 1HARA 4DQQA 4K4WA 1DFDA 1N5QA 1LWCA 1RT6A 2HHUA 4HDGA 3D28A 4F67A 3FKBA 4DV0J 3M8QB 3T6JA 4AL5A 1IBKF 1NK4A 3VQSA 4O4GA 3WIUA 2QIFA 2E1PA 1VMBA 2AEFA 1VOMA 2QTWA 2XS5A 1FRJA 4KPYA 2XS2A 2CNLB 4RNOA 2CQ2A 4KT0C 1CULA 3I56S 4WE1B 4NEZA 3CJKA 2IVYA 1FK9B 5L1JA 1YRTA 3LP2A 2OMLA 2CQIA 2VICA 1LXNA 3JTNA 4M5HA 4ED8A 4DG1A 1N56A 3TX0A 3Q2SC 5EHHA 3QT8A 2V4RA 2VODA 3C6UA 5AE3A 2GGPB 5IT9U 3ZZ0A 4K4XA 3VGSA 1HQUB 4KE5A 1HWLA 2ADBA 1ZM9A 2F7VA 2NSBA 1X60A 3BR8A 3DOKA 3UI3A 5HQMA 1XMQJ 2C42A 3UCUP 3VAHA 4LRDA 4WXOA 2JEIA 4I64A 5KFRA 3I0SB 4O3OA 2V0NA 3KKFA 1N5TA 5E2QA 3BO2A 4NXNF 2F1FA 2XZWA 3ZZYA 4ETZA 2OEKA 2FHOB 1FTCA 4NZ7A 2FHKA 1ZAXA 4M5GA 3E8OA 3OLAA 1S0OA 4OJHA 4L73A 4LBIA 1JMTA 1Q1KA 3OFHA 3PKYA 1WSVA 4RU2A 4RU9A 1B4SA 2VFSA 3D7SB 2BMBA 2XCAA 5ETQA 1P27B 2JFDA 3CIMA 3LPYA 3BQ2A 2FGOA 4PXCA 2E5LF 1RHMB 2PDAA 4ZJOA 3NGTA 4KYZA 2CVEA 3QAUA 4FPIA 2VONA 3CCSS 1A6LA 3PYFA 3BBCA 5J2PB 5I3UA 3CJ2A 2VBYA 3E2EA 4DF8A 5D0EA 1WWHA 1K9MT 3LGHA 2JEFA 3CD7A 2C2OB 3FQLA 4WYLA 1U45A 3PIOQ 2W9BB 2WSEC 3TAPA 3MEGA 5ETNA 1TKTA 4I4BA 1VC5A 4WXWA 1HBUB 5C42B 1X5PA 4ANEA 1ZYQA 5KG4A 3EZOA 1R8PA 2CQ4A 4AT1B 4ZK7M 1PC4A 2HVHA 3NMAA 4K4ZA 1VC6A 3W65A 4N77A 2IBKA 3KK1A 5J2QB 2PEBA 3NAHA 5KT2A 1NEEA 1SKRA 2A10A 2FPHX 1U25A 1VRUB 3N4WA 2HPUA 1M1HA 3DN9A 4HH1A 2DVIA 5AJ3J 4IOAQ 5HQLA 1RADB 3PX0A 3HJFA 2B9EA 3GLJA 3M6VA 2JH3A 4RO0A 5H1SV 4FF3A 2WONA 2VOOA 4DR6J 2VH7A 2F5GA 3OXGA 2FGCA 1FJCA 3BDPA 1X9MA 1TV6B 1O8BA 3E01B 4A8YA 2Y1JA 1HNWF 1SIZA 3MFIA 3K5OA 3DYAB 4C6AA 2LDIA 2QA2A 3IR5B 3KLGB 3VV2B 3AXMA 2N4DA 1K1QA 2NXUA 4IDKA 4NZ6A 4X65J 2D74B 3PYGA 4ICLA 4OX6A 3X3UA 4K4UA 3A1YG 3WC2A 5D78A 2FZGB 4AQYF 1ZM2A 1HWJA 3DRYA 3GFHA 2LQBA 3CSKA 3LP1A 3QFHA 2R2TA 2PN6A 5KFDA 2XEXA 1U47A 4DS5A 2XHCA 3KG0A 5IQ6A 3C19A 2B56A 1L5UA 3MM5B 2M7SA 3M4XA 3Q8RB 4G1IA 3DMJA 3S8SA 3V6JA 2PD1A 3G6ES 5D3GB 1M5VC 1SUQA 2CVIA 4KH1B 5K8NA 4OV6A 3UW1A 2H5EA 3RBXA 1W7WA 4IO9Q 5KFTA 2RF2A 3LA0A 1RTDA 4EBDA 1EP4B 1NPRA 3NOCA 4QWDA 3OTEA 1FE4A 4KQZA 2X51A 2OHDA 1DTQB 4CTAA 3PJXA 1S9EA 1RT5A 1HQEB 2XMTA 2GAGC 3H25A 3W9IA 5CHCB 2R8JA 2HK3A 1APSA 3CCMS 2BR0A 2YWEA 3QRQA 2ASYA 3OL6A 1TL4A 2I8EA 3SSRA 4DUTA 2BJDA 3SCJE 5AXNA 2ZJRQ 1RP5A 1EJ7L 2I5JA 1NDPA 3IRXB 2VU5A 3NWGA 1JLBA 1FFWB 4KO0B 2QFJA 3LH2S 2JVOA 2DXEA 5CXTA 3UN5A 4K59A 2ZBCA 3H5SA 4EK2A 1VLOA 4Q44A 4ZJLA 4CNZA 3IWNC 1RCXB 2W9AA 2V8HA 4BCAA 4ECYA 4BBYA 1LNQA 3KMSA 4DR7F 1YBUA 4KHPF 1XTZA 3RU0A 3ZZUA 2QMXA 1VQ8S 1E6YA 2WHOA 1SJQA 2D41A 1TK8A 3G8QA 4ECWA 4F04B 8ATCB 3QSYB 2ASLA 4F3MA 4A4JA 4ZA1A 4FVMA 4ZITA 2MSSA 3CGIA 1C4AA 2CRLA 1F60B 3NNCA 1RU2A 1RT2A 2H5IB 5I42B 2EKNA 4QYRA 5HANA 3CJQA 3SV3A 1CBKA 4KV8A 4TXSA 4DUZF 3VR1A 5DQIA 2FIUA 1T0TV 4C3LA 2XY5A 4YB7A 4DU8A 3J7A1 2V68A 4FZVA 5CA5A 5HQ8A 4MYUA 1FRIA 1U02A 1YJRA 3TUIC 2FC8A 3ZFVA 1S1TA 2AKWB 3JYTB 3CCES 1YJWS 2JLEA 4CT8A 5EUHA 3TZXA 4Z2XA 1S77D 4OZ0A 4QQBA 1GTEA 4FXWA 1R3NA 4F50A 3M2VB 1TR0A 2FJWA 1CQNA 3M30B 2JEGA 5F8MA 2YKQA 5L46A 2FVSA 2DJWA 1BHNA 3CCTA 1L3SA 4B9NA 4L74A 4CO1A 2KYZA 4WJBA 2A1BA 4F2RA 2MQQA 2C2DA 2E44A 1F6TA 1TL1B 3MI7X 2IYGA 3KLEB 4H4MA 2EC2A 1T9UA 1C1CB 1IBCB 4F3QA 1HW9A 3DFEA 3SQOP 1RGVA 4X4UA 1BD6A 4WWSA 3A8KA 2CPFA 1TKZB 5KFFA 3EMTA 3TEHB 3UR3C 4C3KA 2XMWA 4KRWA 2LVWA 3BBBA 2VG5B 1V3SA 1ZBTA 1IUJA 3M8WA 3BYRA 1TVRA 5J1EB 1UVIA 2H54B 2PO4A 1KWMA 3M2UB 1CJKB 3M8YA 2R7VA 4M5JA 5KT3A 3HX9A 2MY8A 1T11A 1CJVB 2DBBA 2CXEA 3NCPA 3IA0A 1FEHA 5EGYA 1OY9A 1X9SA 2HBRB 1VCTA 2E9TA 2ACYA 4GMKA 1AFIA 2MQNA 2PGCA 3LUYA 1Q0NA 1FXRA 3GIRA 3C15B 4EU0A 2DGTA 3KYLA 3VAKA 4NMXA 3FJ2A 1J5OA 3RB3A 4OYOA 2YPZA 3OJUA 2IA0A 4YR0A 2GJFA 1NXIA 1WDDA 2Z2YB 1VK3A 3BB5A 4JI3F 2HBQB 3BN4A 4ZCMA 2OFGX 5GAEU 1S6PA 4S0MA 1P9YA 4B17A 5F8LA 3NAIA 1BY9A 3CC7S 1BQNB 3W1YC 1OO0B 4LUBA 3LP0B 5CYMB 1IBLJ 2ZFHA 2G4BA 1NB7A 3NNHA 4YOEA 4DPOA 1RAGB 1RJJA 4NASA 5HROB 4OZ3A 1XMOJ 1AA1B 5KOWA 4W90B 1G6BA 4P6QA 2VHGA 4LR8A 3H4BA 3TA0A 4PUOA 3NRBA 3PY8A 3LAKA 3ET6B 3ISZA 4KTQA 3I4HX 3S01A 1Y9OA 3AQPA 2R7TA 4LF2A 4CLKA 3I55S 1JJ2R 1PBUA 3R7SB 1HHTP 3EGZA 2Z2LA 4LF7J 3DU6A 4ANCA 1RSCA 3P45B 3TI0A 4L6V3 4X62J 2FLLA 2CNNB 4QPTA 5HSPA 1UTAA 3E51A 1S49A 3DLKB 2IRUA 2DGVA 4ILLA 2ILZA 2MKYA 2ZH4A 3VGUA 5K14A 1NHVA 1O5JA 4PXBA 3SCKE 1XBWA 3MWBA 2KZZA 2P8IA 2YH0A 1RT1A 1IKVA 5ETKA 1WOOA 2KO1A 1HWUA 2MLZA 2F8MA 1U0SA 2WK4A 4D3GA 2WVEA 4LFBF 4LFCF 4EFAC 2OPQB 2UU9J 3WZ0A 4YY3F 1ZA2B 5F8NA 2E9ZA 4C11B 3U1MA 3FUYA 4ID5B 4F25A 2H48B 2BJ9A 2WOMB 3JQKA 3EJMA 2IMWP 2HHWA 3FFIA 4TYAA 3NS7B 2BE9B 3P4UB 4PG5A 2CPDA 5H9FJ 3RW7A 4M95A 3FC9A 1DLOB 2Z57B 5A8KA 1SV5A 2RSQA 1BC6A 1Y0HA 5KFUA 2XQCA 3JTPA 3H2VE 4RW7A 5KFSA 2XWYA 3JAMY 5B0GA 4RUHA 4QW9A 4DV7F 3EPGA 2HS0A 1OPIA 2FLOA 4ILMA 2BXJA 4B9MA 1HBOA 2VPYB 2FVQA 3Q86A 1JK9B 3CDUA 4RWWA 3I82A 3N6MA 1DAXA 4RX6A 2W1BA 2Y1RI 3WHIA 3EGWB 3PVXA 4PWDB 4Q2MA 4MH8A 4OJ3A 3PM9A 2XNQA 2C2ZB 4K7QA 4DR3F 1SIWB 1Q95G 3V6HA 2QN6B 3KK2B 2GCFA 2CZ4A 4NPOA 2VG6B 2H65B 2E1CA 1Y11A 5C25A 1BQMB 4I56A 4K2XA 1IJEB 3MD1A 5DLGA 4DV6J 2E1MC 2YWWA 2GFFA 4ZVFA 3MM6B 3D1QA 4HVZA 3QPIA 1K44A 2DEJA 5GADU 4DV0F 2JSXA 4H4OA 3GTYX 2POKA 1Q8BA 1T3NA 4MKBA 3O8WA 2FTRA 2HRUA 2GX8A 4DX5A 3F0NA 3HJVA 3BV8A 4DHVA 4NRUA 1BLUA 2DRDA 1Y5LB 1DZ5A 1NAQA 1EKRA 3EDQB 3HVRA 4DCOB 2HAIA 4LREA 4J9VA 2G0JA 3IN5A 4EUVA 2UUTA 2ZH5A 3K5MA 1VFJA 2ZDOA 2DHGA 1VQMS 3CUNA 1FNOA 3EDRB 2IJNA 3K59A 4CLTA 1SJFA 3C16B 3KUHA 4RW8B 1YWXA 2M3DA 1HNVB 3CXCR 1VBKA 2NLWA 3J7Z5 1XMQF 3K5LA 3CCVS 3MECA 1TL7A 2MKSA 2CIMA 4JV5J 5F8JA 4TQSA 2I9SA 3ISND 4JV0A 2CADA 4OYBA 2UUBJ 2RRAA 5LSRA 1KOOA 3M8QA 4A8OA 4RJVA 1T05A 3W9HA 4LIWA 2AJ4A 1PSDA 4R8UB 3DLLQ 4M1KA 1NZAA 3HSGA 3T1AA 1EX8A 2LEPA 2NYIA 4URQU 4J9UE 2HVIA 1RACB 4ZCLA 1A9NB 2O67A 3LW5C 2DR6A 1FK9A 4TVAB 4ZVRB 4NMLA 4OQJA 4I7FB 2K7JA 2V8GA 2OFHX 3MUMP 2M88A 1TP7A 2I0XA 1XR7A 1DQ8A 2FVCA 2NYHA 3A12A 5J2NA 1JX4A 4PQUB 3M32B 4ZVOB 2BV3A 4ES1A 5GAGI 2E5IA 1PIEA 4I6AA 2O66A 3R5BA 1RA7A 2B8PA 2G9OA 1TFWA 4O23A 1IJFB 3FCVA 3GFXA 4XK8C 2M70A 1NHKL 2XMKA 2WVCA 2FJXA 3UD5A 2FJEB 3FQKA 1L3VA 3EVOA 1C0UB 2EK6A 3AOBA 2F40A 4WYWA 1YSJA 4TN2A 2HNZB 1S1VB 2BKOA 5B09A 4M5KA 2JEJA 2GAHC 1X5OA 1V3RA 5A76A 4C98A 1LWFB 2VPXB 3DLGA 3UVJB 4BDPA 2DY9A 2NSCA 4TU7A 3QATA 4WP3A 1MWZA 2GO9A 4GC6A 1VHFA 2BOPA 4BC9A 2XZTB 3MOZA 5AJ3F 1WF2A 3JSYA 1OYEA 2YNFB 4OL8A 4U6PA 2CPJA 5HL7Q 4V1Ak 2M9KA 1NMEB 2R4FA 3DC2A 3VGTA 3BH7B 1ZS6A 2PIIA 4HLBA 1QAJA 2XYPB 4E8UA 4DFMA 4DR6F 5E33A 2B7BB 3IXQA 4F0HA 5A8WB 2UUWA 1HBMB 4K4TA 1S1UB 2NPIA 3MM9B 3KJVB 2EBEA 4CYUB 2QE5A 1JLFA 2J8SA 4DSFA 1FNXH 1CJUA 2R9LA 2X1BA 1ICEB 2AEMA 4X65F 3AXKA 2B4UA 3D1OA 3R2DJ 1HNZJ 1IKWB 2KT2A 4U8VA 2XGQA 5SZTA 2PA8D 1SJ4P 4IFYA 1RWVB 1LWEB 3LPEA 4M94A 5AXKA 2OP5A 2DYAA 3R7BB 2K3IA 4RW6B 3R1LA 4I69A 2UXDJ 5HP1A 3THVA 1AFJA 4Q43A 2CWXA 2HVEA 1SQEA 3PO4A 4FKYA 4CT9A 1JQGA 3LALA 1U7LA 1XR6A 1BWEA 2L9NA 2DGSA 4DDFA 1S12A 2E29A 2IVMA 4LVNP 3H20A 1NJIT 2FC9A 5BXIA 3BGLA 4CP5A 4XIUA 1W2IA 1JLQA 2LXIA 3AQOA 1G4CA 1MWYA 4Y2CA 3DYAA 3FVYA 4KGKA 1IBMJ 2X1GA 1UVMA 2XSFA 4ITSA 3G6YA 1W2BR 1UZDA 1RWUA 1FWKA 3HT3A 4P73A 2G2OA 1RYSA 2W2MP 3BR9A 1PJ7A 4WFZA 3OLBA 2ABYA 3L3CA 3HM9A 3EX7B 2C3UA 1JLCB 5D0GA 3NL0A 1XMBA 4G1PA 2XB2D 1U1LA 2RVJA 5HJXA 4WFAQ 3AT1B 4Y65A 4FYVB 4DR2F 1S0VA 2LA4A 1ZA1B 1X4BA 4KIAA 2BW2A 2DPIA 2F65A 4HI2A 5MLCV 3MMCB 5D3GA 5KFCA 4C0HA 5SUHA 4J37A 3A3OB 5C2GA 1N5VA 1YI2S 4LFAJ 3DDIA 1HBNB 1NJWA 4I67A 2W7OA 4J9SA 3Q8YA 4L75A 5KFGA 4P2SA 4ZMMA 4G1QB 1RTHA 3ILLA 2D3O1 4P2XA 2ROPA 3D3BJ 1HI8A 4Z7YA 2GVDA 1FD2A 2ZKTA 1UJ6A 3TZZA 2HHHF 4FYDA 3DXBA 5KT7A 3SCIE 4ZP9A 2GQ2A 3NKYA 4Y0FA 1WKKA 3QT6A 1LWCB 1RT6B 1RT3A 3VAGA 1CC8A 1Y4ZB 1SQGA 1ELOA 4DMZA 3SIPB 5HN0A 4WK3A 4KY3A 4O4GB 2DNZA 5IOLA 4TU8A 1SC4B 4OI4A 4J5OA 2KDOA 2XLKA 3PTWA 3M8ZA 1CULB 2A2DA 4P52A 1S59A 1NK5A 4KKOA 5CAAA 3LP2B 2IM2A 5HLFA 1OIAA 1NK6A 4A48A 1XQIA 4DG1B 1CSJA 2HWTA 4ZCKA 4RUAA 1GFWB 1LV5A 3T9NA 3IR7B 3C6UB 2BE7D 1U6ZA 2QA4S 4DFKA 2FY1A 2R3VA 2OKQA 1LKZA 2AZ1A 1V5IB 4DN9A 1KONA 3NP5A 3Q23A 2HBYB 3DOKB 5CCLA 4WFNQ 2AP6A 4UZBA 1QJHA 3IBCB 4A8KA 4KH0B 2VJUA 3KDOA 2UXBJ 2YY3A 3QLHA 3W5YA 2B0GA 5KFHA 3SDEA 4MKAA 1VS3A 1T95A 3ZNJ1 1XIQA 2QL7B 1H3DA 4Z37A 2XMUA 2P2CB 1Q8IA 5HATA 1HNXJ 1X4CA 3U02A 1SPBP 3ONQA 2W4DA 3C2PA 2V63A 2FQQB 1GMUA 1NLKL 2NCKL 1ZZNA 3ENVA 3KWMA 5CZVA 3R5DA 1CC7A 3FNNA 1TK5A 1NUEA 5IC4B 2AX1A 2MJUA 5I3UB 4BHQA 1YKWA 1KQFB 2AX0A 8RUCA 1HR0F 2KFZA 1X4HA 4HHUA 2CJ9A 2EKYA 3KLEA 4ZLNA 3JSMB 2XGPA 1D9DA 4RWXA 1VBZA 3B6BA 4LT6A 2COLA 4RNNA 4NLUA 3UDEA 3N0VA 4X4OA 2I38A 3MEGB 1DHMA 1Z2ZA 3MZIA 4C3MA 2RMLA 1PKUA 1TELA 5IM0A 1G2EA 5AT1B 3TJ8A 3MEKA 1IBLF 4PKDB 3CC2S 1RBOB 2AQ4A 1VBYA 2QLXA 2EG2A 2M0GB 2RU3A 1XMOF 3M2UA 3PFEA 2AHOB 2VUGA 4Q2LA 3PNIA 5HMYA 3HKZD 4DPYA 2B9WA 2CFXA 5GVQA 3KHRA 3BSNA 5HVGA 3PEJA 4KBIA 3JQMA 4WKRA 1TK0A 3CCZA 4HTJA 2V8DA 4OYPA 4DPUA 4CIOA 3HT0A 3OXFA 1X5TA 1UAWA 3BREA 2ZVSA 3HI9A 4X62F 3H98A 4ZP7A 2WONB 3C15A 1Q79A 4ES2A 3UN3A 1N6QA 5CYQA 2IAJA 4CLPA 1FJGJ 2LEAA 1VQOS 4GC7A 4ZN1A 2GMLA 3O3LA 3HPOA 1D1UA 5ETMA 1REVA 3NGSA 4IDKB 2ZBIA 2ZZNA 2K8GA 2HQ3A 2HQCA 4ICLB 1NSPA 1NPPA 1EZZB 2AV5A 1LK5A 4PXDA 3LP0A 2AYMA 3K57A 2KL8A 3LP1B 3TO8A 1X9WA 2UU9F 1IM6A 1T94A 1IR0A 4DCJB 3PZPA 2DHXA 3OL7A 3HXMA 3DRPB 2YKMA 4B3TF 4E0DA 1N5SA 1RABB 2R7UA 1FKAF 3DMJB 2RKIA 3H5XA 4RW4B 4DQRA 1LFPA 4GVBA 1TL3A 1SUQB 1X4GA 1JWWA 4LF1A 3EUNA 3A8JA 2J9EA 3OD2A 3FDSA 3G96A 1VQ5S 1DRZA 1C0TA 2RF2B 1RTDB 1OYDA 2FD2A 3GG1A 3TARA 2WVDA 2YVSA 2HBZB 2PI4A 4CTAB 1S9EB 5B0BA 1RT5B 3MAQA 1UA1A 3RBEA 3BSAA 1B7FA 1D8ZA 4Q0BA 2BE2B 2B9YA 5KT6A 1D3WA 5ETRA 4H54A 2LYVA 2QZ8A 4E2FB 1LW0A 1Q16B 1RXOB 2DEIA 4OJ1A 3UCGA 2XM3A 4NEYA 2B3TB 2LLZA 1JLBB 2HHXA 2Y0BB 2OPQA 1FERA 5KFVA 4YS2A 1FCAA 2DRAA 3TW0A 2ZWOA 3LGMA 1SC1B 3A8EA 1FO1A 1XN9A 4N8OA 2MKIA 3M8PA 1RLCL 5L9NA 3X1LB 2N7YA 3H40A 3VVTA 2YNGB 4ZIVA 5F3TA 1KQSR 4V19X 1E6YB 1VGYA 3IBFB 2EG1A 1H2TZ 5F3ZA 5JUMA 2KI2A 3GIMA 2GIRA 1VBXA 5JXSA 3K5PA 2HAFA 1RT2B 1YGYA 5HO4A 4JOUA 1EAYC 1T02A 5HBMA 1U4BA 1KDNA 3TRGA 5A8RA 3AD7C 4KV8B 1JLEB 3CCRS 1V9OA 2CQCA 2FLNA 2GQQA 1SB6A 4YEAA 4RW9A 2XLJA 4OMFG 1XC9A 1WOSA 2UVVA 1YRXA 1RHRB 3HHLC 2F9JA 4E98A 4JI4J 1PAEX 3M2RA 4DR1J 1MG7A 1S1TB 2PMWA 2DT9A 2Q1LA 3HSZA 3MM6A 4JV5F 3P5BP 2V4JA 4XTTA 1U1KA 2V6AA 1YJ9S 1HW8A 1EETA 1HMVA 1RHKB 3M1VA 2V8VA 2UUBF 1W25A 2KG0A 3R9LA 4CM2A 4LSZB 2BRKA 4LJMA 4DSJA 1GMVA 2V69A 4HDHA 3QIDA 1D9FA 1KEKA 3HFZB 4B3OB 2NXJA 3BH6B 4LSNA 2EPIA 2J9DE 3R97A 4ZOSA 2KJWA 2AYGA 2E66A 2VZ9A 2GO8A 2FVRA 5LM7E 4KGMA 5GMEA 3H2UB 2ZE2A 3NLCA 4NYOA 1X0PA 4P9SA 3KK3A 4H4MB 1UPPA 2OIHA 2IBOA 2NXNA 4QYZJ 1CG2A 2ILYA 1VJWA 3V81A 2OGUA 4ED3A 2EFVA 2BJ8A 3ILIA 3MR5A 4CO5A 4D3HA 2HKEA 3OL9A 3FCWA 1I94J 2QGFB 3HKWA 3KLVA 1GMWD 4OYZA 2C3YA 3D68A 2R2RA 2ZBRA 5D0HA 1QAIA 1RWPB 3V2UC 4FYXB 3RB0A 4U7UD 3HULA 1X4AA 3UPFA 3DOMA 2V8PA 2XSJA 5E0OA 4WZMA 2N3OA 1UWBA 4K4YA 4R5PA 2F8HA 4WP8A 1HFEL 1XNQJ 3O44A 3B8HA 2A6OA 3RAQA 2VQFJ 1NCLA 2X3GA 3V5RA 4FF1A 4QW8A 2MY7A 5L1KA 2HQFA 2KRRA 2J7WA 4LQ9A 1TUGB 1KLMA 1J5OB 4FS1A 1Y3JA 2DNPA 5K20B 2ZBPA 2KZMA 1S1XA 4YDDB 2H51B 3F56A 1TQLA 1FHTA 1DTTA 4EZ6A 4DN0A 3DRXA 3PR5B 2U2FA 4DI6A 2B5JA 4LF6J 4FNHA 4IRDA 3T1HJ 5EN1A 2R2SA 2OTLS 2FZCB 3NGKA 4ZPCA 5DQHA 2Q79A 4MIBA 5KAKA 4ED1A 3A13A 1C0UA 4OI1A 2Q6BA 2O3DA 3AJ2A 2CYYA 1HLWA 2JC0A 2HHSA 1S1VA 3VGVA 1FWLA 1HNZF 2HMIB 3KLIA 1GNKA 4QU6A 5FLXU 2ZH1A 2CZVC 4RZRA 5HJYA 2CDQA 4P71A 3ENAA 5GAEI 1QUVA 1YVFA 2UXDF 3A3NB 1Z1ZA 3W61A 3RRKA 2HZVA 4USVA 1QTMA 3CDAA 1N52B 4J9LA 4ES3A 1U49A 5FIIA 2W8LA 5DZ6A 2F4VF 2OO4A 1PC5A 4PCQA 4LF9J 5KG7A 6AT1B 5KFNA 3MCOA 2B6AA 3HZEA 2LEBA 3U1LA 2AIRB 5FJ4A 4USUA 1RT1B 2HFZA 5K8OA 1IKVB 3VZHA 2FJAB 1RWWB 1IBMF 3G4SS 2YWGA 5E3AA 3QGPA 4RBUA 3W8PA 2ADCA 4UY85 3RYLA 2MGZB 1H72C 1TZ0A 4IKAA 4WCEQ 2BVZA 1FESA 1FDNA 3QYYA 3FFIB 2CPEA 4IUFA 4FBTA 4C7QA 2H3EB 4DLEA 2CG8A 4JI2J 1RWKB 2IPOB 1CEZA 2W8KA 3ILJA 2DD8S 4RW6A 1SV5B 5AE2A 1MU2A 4FP9A 2VFRA 2CPXA 2DNRA 3W63A 1MN7A 1G7CB 3EVWA 5LJ3Y 1L3UA 1R43A 1UFLA 4DWIA 3T41A 4M8LA 3PIPQ 4IG0A 1N33J 2HFVA 4CLFA 3KHHA 1OWXA 1JKHB 5KT5A 1I1GA 1HBOB 4Q5VA 2OEJA 3OTBA 3U27A 3BSCA 3CULA 1NK9A 3EPIA 2DNMA 4F8RA 2MPUA 3H5YA 5DS7A 5IZHA 4F4KA 1N34F 4GO5X 4DV5J 4PWUA 8AT1B 2E1AA 2WW8A 2KRBA 4OZ1A 5M2PA 1CLFA 2VL1A 1NK7A 3HLUA 1YJVA 3J81U 4K0KF 3MEDA 5C25B 2K1RA 2P9GA 1S5ZA 5DDPC 2KYXA 4USHA 4C9DA 3MCNA 3BKTA 4KGZB 3G8TA 1L3TA 5AXMA 5H9EK 2HNDB 1KFSA 1KRPA 1SL1A 4PXEA 2OD4A 1UFKA 4H4OB 3GCWP 3FBBA 1CS4A 4JI8J 1FKOA 4G3IA 4HYKA 1U1MA 3W64A 5BYQA 2F9DA 3GSIA 2QL5B 3D2WA 3TUZC 3CCWA 4F0KA 3MOJB 3MM7A 1FJ7A 1NJYA 2HSEB 1DQ9A 2HW3A 3MXHP 3BPSP 4M5DA 2HFSA 4ED7A 1EHWA 2HRTA 2ATLA 3FEXB 4ZVSB 4LRAA 3GR1A 2F3JA 5DGBA 1HBNA 1J5EJ 5IT0A 4Y3CA 3DDNA 5GADI 5ETTA 1GTHA 2WVBA 2GMJA 4LSLA 1N54B 4OHXA 2QLFB 3OFFA 3MECB 4X66J 2XYHB 1FJEB 3HP6A 1TL7B 4PPDA 2RH3A 3J80U 2UXBF 4R0EA 1S57A 2AWZA 2GQCA 2BM1A 5H9EJ 1RKIA 4WP9A 2CJKA 3QT7A 4QU7A 1T05B 3TYTA 1M0SA 3MTJA 2JLGA 3QAEA 1MNEA 1CJTA 3DM2A 2J6TA 3FMWA 3EYZA 3IBWA 2VC0A 4DCPB 4QIGA 1OJ4A 1HNXF 3W66A 4OLPA 1NDKA 1BUXA 1GMWA 2BKNA 3W9JA 3NGDA 3CJ5A 5L9XA 2MEWA 3TWZA 1SH3A 4O0NA 1S10A 3GV5B 1FVSA 2IVFB 3NGRA 4CQ1A 3MPDA 3BGRA 1KTVA 4LVOP 1F3VA 2R8KA 3CCQS 4YB1P 5J2NB 2VJVA 4PABA 3GZ7A 3NCRA 1BMQB 3VAMA 4ZCIA 2BZ2A 3BKUA 4DUYJ 4KAIA 5K8PA 3AB2B 1UVNA 3EGVA 2GIFA 4X2BA 1R31A 2P6SA 4PEOA 1WG4A 2VV5A 4IFVA 1NDCA 1YLXA 1B7YB 4KSEB 1GXUA 4ECSA 4HKQA 4XDCA 5IS2A 4IOBA 4TQRA 1R0CB 4AXIA 4OX8A 2GZOA 3DLGB 5KTQA 2Y1LB 1SQFA 1RHJB 2P5VA 1QVFR 3TAQA 3DI6A 3GV8B 4OHZA 2DO0A 3AH6A 4DV3J 1WD6A 1KVKA 1WHXA 3PX4A 1VR6A 4WFXA 2HHVA 3O5TB 4LF8J 3H7HB 4NXMJ 4MKVA 5I4MA 3CPWR 4YB6A 5EWGA 3KFWX 1RT4A 1GK8A 1RISA 3SV4A 1YIJS 4DSLA 4OFZA 4B02A 4N76A 1PJ6A 3Q8UA 4NLOA 3V6KA 5CABA 3BGOP 3GU0A 1YDLA 4M5NA 5U47A 1IWGA 3JSMA 1FJGF 2BACA 1WORA 1ROFA 3OTOF 3Q8PB 1JXVA 3P3DA 4AYBD 1JLFB 3Q2TC 1PBAA 1CJUB 1RHUB 3UFCX 4NLGA 5IV4A 3GR0A 3WIVA 2OPPA 1FE0A 1HI1A 5HAOA 3HZGA 4IFYB 5MAOA 2E1RA 2QT7A 2DR9A 1W26A 3CD5A 3ENWA 1RHQB 1UJ4A 2NXCA 2H1YA 1IN0A 1P1TA 2KFNA 1X5SA 2AJFE 3N79A 5HP1B 4CNYA 2MLYA 2O1PA 5A2QU 4UOFA 5A6WA 3F41A 4AFFA 4UTGA 2MLXA 4N8NA 4IYQA 2ZH7A 2HVZA 6FD1A 4KB7A 1JXEA 1N8RT 1LK7A 3NBPA 4PR6A 2BQUA 3AHPA 2MQOA 4NA3A 3GP9A 3QO9A 1YJTA 2BW7A 2DR7A 4JI6J 3T5LA 1JLQB 1S7HA 1UPMB 5F8IA 4W4MA 3DRSB 5F8GA 4NYZA 3KJQB 1RWMB 3CDBA 4RNMA 5C7PA 2QLBB 1HWKA 2ZITA 3OFEA 1AXQA 4C0BA 3BJYA 2CZ9A 1RUSA 1B70B 2HNYA 4WBFA 2HFUA 3B78A 4JYAJ 2B7CB 3W5ZA 3P6YC 4PQAA 3SCLE 2MSTA 3DRPA 2OELA 2XMMA 3L95X 2E5JA 4UT4A 2BEFA 3Q83A 4NLDA 2BABA 4ZP6A 3L7UA 4EYIB 4RW4A 1AZSB 3UN2A 1IKXA 2KVQE 1VQLS 1UJ5A 2HHPA 1KQGB 4DZ6A 1S7IA 2UUCJ 2XI2A 3UCZP 1KC8T 4XO0A 1P6TA 1PO6A 1EIYB 3QGIA 2NPFA 4PYDA 3DGPA 3PRBA 2I1RA 1RI7A 2JHEA 5ETSA 1D09B 2AEJA 1RTHB 1KHWA 5LJ5Y 3AOAA 1VRQC 3UDLA 2EC0A 1MROA 4DPXA 4BS2A 2CJQA 2UVWA 2BE2A 2GVDB 1X7VA 3QT5A 4NX9A 4LF5J 4AL7A 2CNOB 2XTJP 4WU2A 3V6DA 1KTQA 1OS5A 2XS7A 3RAMA 2QA4G 1VQ9S 4PPZA 4WIIA 2J0SD 1RT3B 4JI4F 3K89A 1K73T 4DR1F 1M1KT 5L1LA 1D8YA 2AGPA 3I9V9 2WB1D 2DGOA 2YNIB 2R7SA 2DPJA 5LMUJ 1YBAA 5KG1A 5LXYA 1T8EA 2DO4A 2JC1A 5GMDA 1FT8A 2AYEA 3IMQJ 2CQ0A 4KKOB 4F2SA 5IT9Y 2YNGA 4B3SJ 3SSSA 3QGGA 5HLFB 2HGLA 1RK8A 1QVGR 3BDEA 3PACA 2L48A 1Q8KA 1RT7B 2QMWA 4R0JA 5G4DA 5LOQA 2D3OR 4XPEA 1FFGB 2M2BA 2XLIA 1BWVA 1YQHA 2VFTA 3CDWA 3DLJA 3GPAA 2DIVA 1M5PC 4IO1A 4URSA 1N4LA 4CZCA 4A46A 1NM2A 5HMXA 2XY6A 1HWIA 1XJWB 3D0HE 1U1NA 4CCHA 3R6GB 1JLEA 2AYBA 1TMMA 3D0GE 1MLAA 1ZETA 9ATCB 1F0XA 1AYEA 4ZHRA 2MQMA 4CH7A 1ACMB 3MF5A 3QLHB 1Z2LA 3T1YF 1I94F 4WKYA 2HQDA 3SDEB 3ZZPA 2KU7A 3THPA 2J7KA 4OZLA 3WDOA 2J0WA 3TZWA 2J0XA 3MMAA 3MEEA 2BQ3A 4ECRA 1N48A 4NE9C 4DLGA 1S6UA 4USTA 5IV3A 4DR4J 1XNQF 2NZCA 1IVZA 3UNYA 3N28A 4M5IA 5F9NA 2VQFF 5KFXA 2OAUA 4B3OA 1TL5A 3M05A 4CLLA 2R7QA 2GIQA 3OJSA 3ZZOA 2LQ5A 3QIPA 1GXLA 3JB9k 1UWAA 2MQ8A 4OLOA 1JJ4A 2DIUA 3GV7B 4DL6A 4JP8A 2C2RA 2XBPA 2VC1A 1DARA 2XULA 2AJ2A 1U24A 2HG4A 3BS9A 4ELTA 5KFPA 4A8WA 2DXDA 4TYBA 2MQLA 2GJIA 4LF6F 1FDDA 4LQ3A 2GHPA 3KXDA 2UV8A 3T1HF 1OSCA 2FYXA 3OPKA 1VC0A 1I51B 2HS3A 5IM0B 5KFIA 3LWMA 4OIXA 3MPYA 2NS1B 1S72S 4J9OA 4ECQA 4HI1A 2HGMA 3BGFA 4TY9A 1SBRA 4G6VB 3T5JA 4BLGA 3G71S 3UD3P 3Q89A 2OLWA 4IH7A 2V34A 2PFDA 3KOAA 2ZH3A 1H73A 4UY8T 2MQPA 2ZJPQ 4B9TA 2DKOB 4USWA 1KNZA 3D9BA 4ELVA 1H6KX 2VB6A 1KN6A 5IFMA 1Q7YT 4C48A 2LA6A 5ETOA 1JXLA 1ZPVA 1T9YA 3R8YA 4I68A 4IH5A 1N6QB 1J27A 1LXJA 2LDYA 4LF9F 3I6PA 3SMZA 5CYQB 2IAJB 3D0IE 2QL9B 1B0PA 1FRKA 3DGVA 3KNAA 1F1BB 4C8OA 3PFOA 3M9OB 2MDAA 3PG9A 1FVQA 1REVB 3EE3A 4JI5J 3BSOA 1EB0A 1B3TA 1DJ0A 3AODA 4ANDA 2HFOA 2R7RA 2MZSA 3BKFA 2A3JA 2PA3A 5J2MA 3DKDA 1LQ9A 1IXKA 2CQDA 3RB4A 2LU1A 5B0FA 2YKMB 2HMIA 1H2UX 1LFWA 4NRTA 4F26A 4J9RA 3JSBA 3OVBA 2W9CA 3FSYA 4NL5A 3VCDA 2KT3A 2RKIB 1N36J 4GVBB 1TL3B 4CLWA 1JIHA 1VRTA 2K06A 2RDIA 4DXLA 2L3MA 2PT0A 3IGVA 1C0TB 3M8RA 2J8AA 5GAHU 2MJNA 1NDLA 4RNFA 5LXRA 3MAAA 4ZP8A 4TY8A 1Q5YA 4IG3B 4O44A 2ZBQA 1ZAVA 2RDDA 2DTJA 4CH1A 3VF0B 4CDIA 2DGXA 3QRPA 2DXFA 1NRKA 4CLUA 3IAM9 1WDTA 4Q0BB 3UDVA 2IYIA 3FEZA 1VQPS 4I2PA 4YMEA 2JX2A 2YWFA 5KG2A 4OJGA 3H42A 1LW0B 4OX9F 1HPZA 4DV5F 3N01A 3FRZA 4TU9A 2EWHA 5IT4A 3MMBA 2IA6A 4NCGA 3ZTOA 3QRRA 4KFBA 3G6VA 3GE9A 1JNRB 3B4DA 3CJ8A 2ZZTA 4HEA9 2MGZA 2G0IA 3HF5A 2FHJD 1RTIB 3TEGA 4Q8FA 4X84A 1LW2A 4UW2A 3T5KA 1H98A 1VQYA 2CA9A 2KM8C 3PDNA 4LRFA 1BE4A 4N56A 3M8PB 2RT3A 3DLBA 2DISA 4JI8F 3CMAS 4YY3J 4ER8A 4ZVHA 1P8GA 2Q43A 2WZ1A 1U1OA 4J91A 3PX6A 4XDDA 2G2YA 1IQZA 1JKHA 2XG8A 3D6MB 4Y2IA 1OPZA 1TKXA 4C2MA 3ZXWA 3DOLA 1TUWA 5HBMB 3OUYA 1J5EF 1DQAA 4QIFA 5A8RB 4OYXA 7FDRA 5M2UA 1NHUA 4ZPWR 3AA9A 5D77A 4RW9B 3QNWB 3IWLA 4FS2A 4P2FA 2G0CA 4X4RA 3VAJA 4P72A 2ZKUA 3M2RB 2PI5A 5E3PA 3HD1A 2JNJA 2RQ4A 4X66F 1NKEA 2V4JB 1UEKA 2CDRB 3K5NA 2HRYA 4GO7X 3OFGA 2HNDA 2XMJA 1EETB 1RTJA 1HMVB 3M1VB 3POTA 2BOAA 2VG7B 2W2OP 5KFKA 2RQMA 4GVLA 2J6SA 1T03A 3OHAA 1O0PA 1AROP 3MUVP 1HI0P 2HGNA 4ZPDA 2QYGA 5DM6Q 4YHHJ 5DDRC 4C8ZA 4U9RA 3OBIA 5EX0A 4DX8H 4LSNB 4GKKJ 4B9LA 1URRA 1MWQA 3T6BA 2DNQA 3I0RA 1NH8A 2ZE2B 2XI3A 1S76D 1IKYA 2P9CA 3KK3B 3EZ5A 2LCWA 3CIZA 4MK9A 3QJPA 4O0IA 1Y00A 4M63A 3ETOA 3MD3A 2C3MA 3EM1A 3SXLA 1SKUB 4EEYA 3ICLA 3V81B 3Q8QB 3GJQB 3GSDA 4ZJQA 1B99A 3BEGB 2GHVC 3MR7A 1A0OB 4HT5A 3MM8A 1RWNB 1VIOA 3MR2A 2DH9A 4DUYF 4NZ0A 1ZZFA 1NU4A 1WELA 2UXCJ 1I3OB 1T3OA 1OSDA 3DOMB 1FDBA 2XSJB 4Y2AA 4ZS6A 5KFBA 3WX8A 3OTDA 1UWBB 4R5PB 4MFBA 3LANA 1UVJA 3CWJA 1GH8A 2CJAA 3HK2A 4YUDA 1WG1A 3G2XA 3TANA 1ITPA 3AJDA 1Q82T 3AD9C 2VDHA 2GVZB 3VAFA 1EARA 2RHSB 1REGX 3UNGC 3MPWA 1ZOTA 1F5BA 1M5SA 4DV3F 3B82A 4K50A 1JJHA 3MR6A 5A0YA 3LOUA 4OI0A 2QO3A 1KLMB 2ZJQQ 4LF8F 3OT9A 3GYXB 4NXMF 1P1LA 3CT9A 2LU2A 1N88A 3K17A 1S1XB 1QAXA 3FCHA 5DDQC 1DTTB 2ZM6J 5KFLA 1T9XA 4B3MJ 2LMIA 2Z56B 1NJZA 4Q8EA 2YTCA 5AE1A 1PAUB 2ZH2A 4N5SA 2B5JB 1M5KC 3E3XA 4DZDA 4ZVGA 3GMGA 3ZO7A 2LECA 4ATNA 4YDXA 2Y8WA 2WVFA 2QX0A 4JV1A 3I5AA 2PC6A 2RRBA 3OR1A 4ECXA 5IWAJ 4YN3B 1B0VA 1FX4A 1T9VA 3D66A 2Q6CA 1WI8A 3IAS9 1FKPB 3KLIB 3IGNA 3OSNA 2CPIA 2YX1A 2JJ4D 3GJSB 2KVIA 4X4VA 3KUGA 1G3OA 3OTCA 4F02A 2AGQA 1RAOA 2CPHA 2XC9A 2LQJA 2B4VA 3IM9A 1WNEA 3IS9A 3KTQA 1UVLA 2DRBA 1IWAA 3ZZRA 4MAKA 4P10A 3A3PB 4FPRA 1S99A 3MCSA 2V4QA 2QA1A 4B9SA 3SFGA 2B6AB 2C2EA 2MZTA 2MZQA 3HHLD 2Y8YA 2IC3B 3H90A 3HVTA 1SJ1A 1YK9A 3B54A 5ETVA 3TNVA 4JI6F 1VISA 1NH7A 3G8SA 3CEDA 2HHQA 4U8YA 3PHTA 1S4FA 4EI2A 2N3LA 2VA2A 4IOCQ 3MAHA 1V5VA 2DHHA 4EGLA 3M8SA 3KHLA 2K7KA 2Y1IA 2FDNA 1R8HA 2SXLA 2MHNA 5CZXA 4DV2J 2KT5A 3FMBA 3W2WA 2N82B 4JYAF 3KG4A 2YX7A 4BC7A 1YBTA 1MU2B 1RAJA 3OHBA 3IG1B 4B9VA 5DJBA 2YKOA 4WU3A 1I6JA 2VPWB 3FBEA 4FN5A 1YZ7A 2WBMA 2CAJA 2FHJA 4BWMA 4IG0B 3GJTB 2CG4A 2HZAA 1WHWA 2NUHA 3J7YU 2NR0A 4QPXA 4YP3A 1SJ3P 2JVRA 3TOQA 2IM3A 2UUCF 4OZNA 5KFYA 3MPUB 3TQ1A 1D9AA 3QGHA 5A6PA 4C8KA 4K5SA 3TP2A 4DSEA 4B9UA 5THWA 3D5MA 4RL1A 4ZKAA 3R27A 3DRSA 3ENQA 1H7XA 1ZH5A 4DF4A 2ZD1B 5KFEA 4P7TA 3MEDB 4LF5F 2IDEA 4KHMA 2K1RB 2OH2A 3EGNA 3RJMB 5BYSA 4WFBQ 4NLSA 4H4KA 1VK8A 4C0OC 3QSIA 4ED5A 3RR7A 1FEEA 4N47A 1BGXT 1VDHA 9RUBA 3HD2A 2VD3A 2M8DB 1UEUA 2CPYA 2GMHA 3G82A 4MMOA 5D4PA 1OQ6A 1CS4B 1FKOB 5ADZA 1WEXA 5L1IA 3WQPA 2XYGB 1R6YA 3KG1A 3KUEA 4CRJA 5K8MA 2DH7A 2K3KA 4KGXB 5LMUF 1MN9A 1S0NA 5BR8J 1PGZA 3UQSA 1FX2A 3JQJA 5I3PA 1WEYA 1AZSA 2YBVA 3MM7B 2HYIB 2JZ5A 1KSPA 4M5DB 4B3SF 1NSKL 1N32J 2OTJS 2HIYA 3SFUA 4OHWA 2XCPA 2A0FB 2VDIA 4NLXA 1ZPWX 4IRKA 1Y5IB 3CCJS 3V4MA 1AW0A 4DR2J 1FXLA 2H9ZA 4I6YA 1GXTA 1WHVA 3BO4A 4PAAA 2MZJA 2K2PA 4W98A 1HNIA 1R89A 4LSLB 1VLYA 1X4FA 1MSWD 3EXCX 4AD6A 1FTRA 4EO8A 4Q45A 3FGVA 2KHDA 2QLWA 3W2VA 2W2NP 4CLSA 4DL5A 2V94A 2YNHB 1QE1A 2V50A 4IR9A 3HSJA 2O01C 2XHWA 1RAFB 3QWPA 4F36A 1X4EA 3P49B 1CVJA 2OI2A 3L09A 3D3CJ 3JAMU 3PRDA 2HS4A 1CJTB 3DM2B 2YKNB 2ZDPA 4UUXA 4NA1A 2HHHJ 2YNIA 1S4EA 3NXZA 3PYDA 1IM4A 4LRBA 4NI2A 2UVRA 2HVDA 2MHEA 1OQ3A 4QIVA 2OJ3A 3CDEA 4FNIA 2W25A 4FVCA 4DR4F 1U8SA 4DL3A 4Y2MA 1NO8A 4ZVUB 2CQHA 4DL7A 1TU0B 4V19J 2LQ8A 4OV1A 4EYHB 3J7AN 2UUAJ 1RT7A 2ZH8A 3BGRB 2BJ1A 1NKBA 1SJRA 2U1AA 3MTKA 3KLHA 5L8RC 1PYTA 2JWNA 1TUVA 2C3PA 2IIHA 5T7LA 3ZNUA 2G13A 2ZVIA 3GFZA 1QUPA 3I9ZA 2ALYB 3Q0AA 4EO6A 1M5OC 3TVKA 2WAQD 4OI6A 3P96A 2FJVA 4QWBA 1TTHB 3GILA 4IFVB 4DS4A 1VJQA 3ZZZA 2WTFA 2GJ2A 3W62A 1M1GA 2W01A 2YQ0A 4F3OA 3CJ0A 3JSRA 1N5YA 1NPKA 2IRXA 3I5CA 4KHRA 1LWXA 3MCMA 5G0RB 5LL6d 2CQPA 3LGNA 1NK0A 3BYPA 3DI6B 4C8LA 4CLYA 4FXDA 1RQ0A 2AD9A 4ZIWA 1R0AA 4F4XA 4YQWA 4X64J 3VTIA 3H4DA 2DGQA 2MKKA 4KJIA 1RT4B 2EXUA 1OMSA 4LBHA 1WC6A 2IDLA 2D9PA 1H0HB 2BRLA 2M52A 5AXLA 3F73A 2J9CA 2IJRA 1RLDA 3D4JA 2HWIA 3K7RA 2N7CA 3TA2A 1E6VA 1KD1T 1KVIA 4QOTA 4AXJA 3LO3A 2DNLA 4ZDNA 1FDAA 4H4KC 3GYGA 4UZCA 3C8YA 4JI5F 1S9FA 2RQKA 3NMRA 4OI3A 1HR0J 4Y6IA 1RTZA 2OPPB 1BQXA 5C24A 3CD6S 3HHLA 3OXLA 2ZC3A 1LOUA 3ZTRA 4QR0A 3RAXA 4NLVA 4Q7AA 4F7VA 2ZNYA 2EBGA 3ZTPA 4J9NA 4Y28C 4ED6A 3PHEA 2C28A 1URNA 3R6LB 2JRSA 4PZVA 3W60A 3W7BA 3NWRA 3S7RA 3TVYA 1RA6A 1WJ9A 4A47A 3AFGA 1AUDA 1N36F 3BQ0A 1FRLA 4F0MA 3CB4A 3FSIA 2ERRA 4JI7J 4LF7F 3NS5A 1S48A 2X1FA 3D6FB 2B4OA 1NB2A 5HK4A 2CQ3A 3NBPB 1C1BA 2IHR1 2EFNA 3QO9B 4P2MA 3CO9A 3OVAA 1UW9A 5JMNA 2FHMA 5H9FK 2V2KA 4DU7A 5JJBA 3EICA 3W8GA 3ULHA 3PW2A 2AT1B 1NKCA 1FRMA 2BANA 3EXYA 1C2PA 2OSQA 1WC3A 3K58A 4U96A 1PYOB 2KXFA 5I3QA 3HFVA 2HQGA 1D0EA 1SH0A 1NNDA 4UOGA 3TA1A 2CWKA 3VALA 3DLHA 4WK1A 4UOHA 4OZJA 2HNYB 3C14A 2FLPA 3ELHA 4DX6A 4CO3A 4OZ2A 1RE1B 4ECTA 3VQTA 2DR8A 1EKSA 4X4PA 2HURA 4USMA 3G6XA 2RUGA 2OPSA 3GONA 1IKXB 2BDPA 3P5TL 1TKDA 4A8FA 3KLFA 2RD5C 4A8XA 2J6UA 2H5JB 2MTLA 2DNYA 1Y10A 3VVUA 2IY5B 2CJBA 4B3TJ 1U2CA 3PEHA 4IG3A 3DGPB 3HHEA 1H7WA 3D6TB 1RKJA 3HVAA 1Q7LB 2V2ZA 4P74A 4EBEA 1U2RA 3IO1A 4WTYA 1KFDA 4QZVB 2RHQB 1MROB 2BJ7A 4CO4A 2CUYA 2HWHA 2DCUB 2J0QD 3CJ4A 2QMUB 2LP4A 1YTYA 2GA7A 1GQEA 2YWKA 3OV7A 3V4IA 3V6DB 3IC1A 1JLAA 1X8DA 1RWXB 4AE5A 2OSRA 4X4NA 1Z4UA 4CLZA 2KFYA 5DRKA 3R5CA 2E7WA 1U48A 1QSSA 2V2QA 1RTIA 2AU0A 1H38A 1S9GA 4JI0J 3NNAA 3HSDA 4DV6F 1K47A 1F9EB 3AAWB 3KHGA 1HHSA 5FDLA 2GHWA 1XEZA 4HH0A 2OPRB 4C8MA 4X4TA 4LR7A 4I6WA 1VQKS 5CD4H 4O3NA 1XNRJ 3J7ZT 1K0VA 3GQCA 3OW2R 2FY8A 2AGOA 3C6TA 1ZTTA 3NGUA 1WC4A 5T41A 3NEKA 1U0HB 2IRYA 4YHHF 1A7GE 4F4ZA 3VWSA 5D4NA 4TLQA 1SL0A 1U6BA 4EWTA 1GT8A 4QJVA 1ULRA 4GKKF 3BQ1A 2C1EB 4N41A 4PG8A 5DZ7A 3M9NB 4L3NA 2HZCA 5C5JA 1S6QA 2AJQA 3RG6A 3QJJA 2F4FA 4DL2A 7AT1B 4O3SA 4X4QA 5RUBA 4U7CA 3DXSX 1DBDA 4ZHRB 1HYSB 2LQ9A 1PG5B 4PRFA 3NG8A 4NWBA 1YZ6A 3O2IA 4QBUA 3BZQA 1S1WA 2KXNB 3T19A 4I2QA 5DLFA 2DY1A 3SQGA 2NQPA 1WC1A 5LMNJ 2W2PP 2UXCF 4A8MP 2QRRA 6FDRA 4LF4J 3MMAB 3CMQA 3MEEB 3OR2B 3RTVA 5KG6A 4HTIA 1UA0A 5IC6B 1WG5A 2VG7A 2KM8B 4ZVEA 1FFSB 2XMVA 4FF4A 2RB7A 2JOQA 3BGUA 2M8HA 5KFQA 2IJFA 3W5XA 2R8GA 1WOPA 2HQIA 5KG3A 4O3PA 3R5GA 3QIPB 2PMHA 1WF0A 5CCMA 1UMJA 4L76A 2WSFC 3HFKA 2KH9A 1GX6A 5IXUA 2BYCA 2ZH9A 1YRUA 4UQGA 5D0RA 2ZM6F 4B3MF 5D8HB 1RAIB 2IFXA 4FKXA 2B8QA 5DM7Q 3J81j 2YXLA 1TAQA 4WE1A 4ZVTB 2FZKB 3T3FA 4L3KA 2Z2MA 2H4WB 4DV4J 1Q5VA 4UF4A 2WSCC 1MW7A 3CJRA 1Q78A 2Q66A 2ZHOA 2X1AA 2D3ZA 3RB6A 1BXNA 2E9RX 1UCNA 5IWAF 3WC0A 2DNKA 1WC5A 1HD1A 4J9QA 4B3RJ 2VFUA 2GGPA 3HCXA 3PJ9A 4GKJJ 1T7PA 1HQUA 2UP1A 1V6HA 3PJWA 2NUUG 4K5RA 1FWPA 1JLGB 4EBCA 1NSAA 2GVZA 4O3RA 4DR5J 4J7CA 2FJDB 3I0SA 1GAOA 2W4PA 5KG0A 5DG8A 4WIQA 3JTOA 3U1NA 2FB0A 1O6XA 2EI5A 5EWFA 3FEYB 5GMKa 4FBUA 5FD1A 3BM7A 2EVZA 4QCLA 3DLEB 5KFMA 1SKSA 1UP1A 4U7UK 1KQKA 1SL2A 2QFIA 3I32A 4OI2A 3W3SA 2OMOA 4P75A 1KLNA 3DHXA 3NOGA 1C4CA 2M5YA 4TKTA 5E7OB 1V3ZA 4U67Q 3TX8A 2V9KA 5ETPA 5J2MB 4ZLPA 2XNRA 3LF0A 1F5CA 5J2PA 1JNZB 2HLUA 1SC3B 3LQVA 1VQ4S
chains in the Genus database with same CATH topology
4NXMJ 4DV5J 4DV2J 1J5EJ 3R2CJ 5A2QU 4RJVA 4DV7J 4PWWA 3D3BJ 4JI3J 4JI5J 3R2DJ 1HNZJ 1N34J 4HHUA 4DR5J 2E5LJ 5LMUJ 4NEZA 3T1YJ 2KVQE 3J81U 2VQEJ 3D3CJ 3JAMU 1HR0J 3IMQJ 1XNQJ 2ZM6J 4OX9J 4B3MJ 1FJGJ 5BR8J 5FLXU 2UUCJ 2VQFJ 2HHHJ 4B3SJ 4KYZA 2UXBJ 4DR4J 4LFBJ 4K0KJ 4LFCJ 4X66J 4DR7J 2UXDJ 3W1YC 5AJ3J 4DUYJ 4KHPJ 4JI6J 4JI2J 4DR3J 3J80U 1N32J 5IT9U 5LM7E 1IBLJ 4KY3A 1N36J 4JI8J 4X64J 1XMOJ 4DR2J 4JI0J 2UU9J 4DR6J 1HNWJ 4V1Ak 3OTOJ 3J7AN 1XMQJ 2UUAJ 2KL8A 2UXCJ 2MQ8A 4DV4J 5IWAJ 4JI7J 4NEYA 4LF5J 1HNXJ 4LF9J 4NXNJ 1N33J 4YY3J 5LMNJ 4LFAJ 4DV6J 1XNRJ 4LF4J 1IBKJ 2F4VJ 4DV1J 4LF6J 4JI4J 4DV0J 4B3RJ 4YHHJ 4DR1J 4JV5J 4DV3J 3T1HJ 4LF7J 2MEWA 4X65J 1I94J 4AQYJ 4GKJJ 4JI1J 2MTLA 4JYAJ 4DUZJ 1IBMJ 4GKKJ 4X62J 4B3TJ 2UUBJ 4LF8J
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NXM J;  4DV5 J;  4DV2 J;  1J5E J;  3R2C J;  5A2Q U;  4RJV A;  4DV7 J;  4PWW A;  3D3B J;  4JI3 J;  4JI5 J;  3R2D J;  1HNZ J;  1N34 J;  4HHU A;  4DR5 J;  2E5L J;  5LMU J;  4NEZ A;  3T1Y J;  2KVQ E;  3J81 U;  2VQE J;  3D3C J;  3JAM U;  1HR0 J;  3IMQ J;  1XNQ J;  2ZM6 J;  4OX9 J;  4B3M J;  1FJG J;  5BR8 J;  5FLX U;  2UUC J;  2VQF J;  2HHH J;  4B3S J;  4KYZ A;  2UXB J;  4DR4 J;  4LFB J;  4K0K J;  4LFC J;  4X66 J;  4DR7 J;  2UXD J;  3W1Y C;  5AJ3 J;  4DUY J;  4KHP J;  4JI6 J;  4JI2 J;  4DR3 J;  3J80 U;  1N32 J;  5IT9 U;  5LM7 E;  1IBL J;  4KY3 A;  1N36 J;  4JI8 J;  4X64 J;  1XMO J;  4DR2 J;  4JI0 J;  2UU9 J;  4DR6 J;  1HNW J;  4V1A k;  3OTO J;  3J7A N;  1XMQ J;  2UUA J;  2KL8 A;  2UXC J;  2MQ8 A;  4DV4 J;  5IWA J;  4JI7 J;  4NEY A;  4LF5 J;  1HNX J;  4LF9 J;  4NXN J;  1N33 J;  4YY3 J;  5LMN J;  4LFA J;  4DV6 J;  1XNR J;  4LF4 J;  1IBK J;  2F4V J;  4DV1 J;  4LF6 J;  4JI4 J;  4DV0 J;  4B3R J;  4YHH J;  4DR1 J;  4JV5 J;  4DV3 J;  3T1H J;  4LF7 J;  2MEW A;  4X65 J;  1I94 J;  4AQY J;  4GKJ J;  4JI1 J;  2MTL A;  4JYA J;  4DUZ J;  1IBM J;  4GKK J;  4X62 J;  4B3T J;  2UUB J;  4LF8 J; 
#chains in the Genus database with same CATH topology
 2IMO A;  3FSX A;  2NXE A;  2W9C B;  2EEY A;  2JL9 A;  5HI7 A;  3OSP A;  2JLF A;  2QLJ B;  3QJL A;  4ID8 A;  1JB0 C;  4DV2 F;  5L38 A;  1KOH A;  4RBT A;  2CNK B;  2A18 A;  1VRT B;  3CO0 P;  3Q8S B;  2VQE J;  2W9B A;  3WX4 A;  5F0W A;  2NRE A;  1RDR A;  1ZAW A;  3MAA B;  4MK7 A;  4TY8 B;  3GWC A;  1HBU A;  5C42 A;  1Q4R A;  3HDS A;  4O44 B;  1T9W A;  4K8R A;  1NJX A;  1P9Q C;  4DFP A;  2RU9 A;  2DNG A;  4NOH A;  1UKU A;  4A8S A;  1OY8 A;  1VQ6 S;  5J2Q A;  3UR0 A;  4I2P B;  5EDW A;  2IC3 A;  2RS2 A;  3DHW C;  3ITH B;  1HPZ B;  3QWU A;  4QWC A;  2PEH A;  2WRM A;  5DO2 A;  5ETL A;  3BN7 A;  4URG A;  1VRU A;  1HA1 A;  4G65 A;  2F4V J;  3MMB B;  3DNC A;  4J9P A;  4NCG B;  4KFB B;  4NCB A;  4USK A;  1KR4 A;  5KFZ A;  4YFU A;  2I6W A;  4MT1 A;  4JI1 J;  1F9F A;  1R27 B;  4FXV A;  5GAH I;  1J2V A;  5DDO C;  1XK8 A;  1LW2 B;  2N4C A;  3MDF A;  1RAE B;  4F4A A;  1WTF A;  1RU1 A;  1YIT S;  2W7P A;  1TV6 A;  1CPZ A;  2DNH A;  3E01 A;  4RUB A;  5K9F A;  3Q22 A;  2KN4 A;  3TAM B;  3IR6 B;  3KLG A;  2LFV A;  4QR2 A;  2QYC A;  3IG1 A;  4C8Y A;  5E3C A;  5L39 A;  1H2V Z;  5BR8 F;  4YB5 A;  3O1L A;  1FF2 A;  4O3Q A;  5HMZ A;  2BX6 A;  4DPW A;  2VBW A;  4RBV A;  1N32 F;  5E3R A;  1TKX B;  5DG9 A;  2H4Y B;  4LFA F;  3DOL B;  3R5J B;  3OUY B;  4YR2 A;  2RE1 A;  1HIY A;  3MM5 A;  2RAQ A;  3HHD A;  4NLP A;  1EQM A;  1VHI A;  4OHV A;  1KKH A;  4LR9 A;  1MMD A;  2C22 A;  1U1R A;  4RR5 A;  2ZD1 A;  4JUZ A;  4HAC B;  2OUG A;  3LTO A;  4DX7 A;  2DR5 A;  3GB0 A;  3OVS A;  2MZR A;  3M6X A;  2XY7 A;  1EP4 A;  1X4D A;  2BA9 A;  2D1C A;  4AL6 A;  4OYA A;  4Y2K A;  5CD4 A;  1N34 J;  2DCL A;  2WW4 A;  3D67 A;  3PKM A;  1DTQ A;  1RTJ B;  1RBA A;  3CF5 Q;  1AUS L;  1HQE A;  1SKW A;  3K0J A;  3DRR B;  3POT B;  4RLE A;  1VI7 A;  2Z0G A;  3I5B A;  2BJE A;  2J9D A;  3U7J A;  1T03 B;  4K0K J;  2ZUG A;  1HL6 A;  5D6G A;  1WTB A;  4DPT A;  3GYN A;  4KPC A;  5CH7 B;  1OY6 A;  3B4M A;  1R6V A;  4USI A;  2EFG A;  3IRX A;  3I0R B;  4KO0 A;  5D4L A;  4DBQ A;  1IKY B;  2IM0 A;  3PRV A;  3CME S;  2RJZ A;  2GNK A;  2CQG A;  2PE8 A;  1ZTW A;  2UUA F;  2BUN A;  1O51 A;  2VKZ G;  4DV1 J;  4QWA A;  4PG6 A;  3UWT A;  2R8I A;  4HT7 A;  3AY0 A;  3IWX A;  3EZU A;  4MIA A;  3TR5 A;  3T5H A;  1R8A A;  3N9U C;  3C3L A;  3CW2 C;  1PIL A;  2VKR A;  3MPV A;  1R8B A;  2X7I A;  2V2V A;  3CJK B;  3I4P A;  2ZHB A;  3MM8 B;  3OQ2 A;  4DSI A;  2D3U A;  2YNH A;  3RR8 A;  3HHN B;  2HK2 A;  4XAK A;  4N7T A;  5LT5 A;  3M9M B;  1FD8 A;  1S0M A;  3MUR P;  5HVH A;  2MB0 B;  2KXH A;  3ZC4 A;  2GC8 A;  2LKZ A;  4MFB B;  5I42 A;  1RBL A;  4ECU A;  3MR3 A;  5BYR A;  1GX5 A;  1QLN A;  2YKN A;  1F3F A;  2DGW A;  4UOC A;  2RQC A;  3KDN A;  4PG7 A;  1K0T A;  1ZM4 A;  1KP6 A;  4C8N A;  2W24 A;  1AT1 B;  3AD8 C;  4UQT A;  5A0Y B;  4X64 F;  2DNO A;  3R7N B;  2R7W A;  3CE8 A;  3UE2 A;  2KKH A;  1R0B G;  5K5M A;  2ZH6 A;  3JYT A;  4ZPT R;  1IBK J;  1QDU B;  3RBD A;  4Z7C A;  1Y3K A;  1NK8 A;  2X3D A;  4FYW B;  5KG5 A;  4NLY A;  5DGA A;  1AB8 A;  3QZ8 A;  1U26 A;  3M2V A;  1QY7 A;  2V5H G;  2M4M A;  2QJ3 A;  2W2Q P;  2OEM A;  1WSR A;  2ROG A;  3M30 A;  5FLX Y;  2DB1 A;  2IM1 A;  3MHY A;  4KC5 A;  2CJY B;  1B0T A;  3OR1 B;  2C2M B;  5M2R A;  4MTP A;  2HEK A;  2D7S A;  3HHK A;  4Y34 A;  1RZM A;  3S1T A;  5F0U A;  2VPZ B;  4IH6 A;  2OD6 A;  5EX3 A;  2VAS A;  1TL1 A;  1M5H A;  4KGV B;  3ZTS A;  1C1C A;  5B08 A;  2XO6 A;  5G0R A;  4CWB A;  1YJU A;  2R7O A;  1TKZ A;  1SCJ B;  2RRN A;  3UO0 A;  1TKT B;  4CO0 A;  2P9E A;  4NXN J;  5JVG Q;  4PYA A;  2BM0 A;  2Z30 B;  3IS9 B;  4NLQ A;  2YH1 A;  2ZWP A;  4JI7 F;  2VG5 A;  3D54 A;  1UW4 A;  2EK1 A;  2XZD B;  2KTQ A;  3IM8 A;  1RAA B;  3SSQ A;  2Z8Q A;  2GV1 A;  5J1E A;  1EQ0 A;  4TLR A;  1U8W A;  1WEZ A;  2CKW A;  4FF2 A;  3FK4 A;  1CJK A;  4TNO A;  3KK1 B;  3PR4 A;  2CQ1 A;  3HVT B;  4BWJ A;  3F44 A;  1JJC B;  1QSY A;  1SXL A;  5KFJ A;  1CJV A;  1RYR A;  2E7V A;  2E5L J;  1KBR A;  4IRC A;  5J1P A;  2B51 A;  3BBF A;  3KJN B;  3D6H B;  3PW7 A;  3QFW A;  4ERD A;  3AJ1 A;  1B64 A;  4QIE A;  2PMZ D;  3R1H A;  1FRX A;  4WTO B;  1XR5 A;  1PJ5 A;  1CQM A;  4ED4 A;  1QD1 A;  4MYT A;  3T9Z A;  5B0A A;  1MML A;  1WUU A;  1LEO A;  2L9W A;  4J90 A;  3W2W B;  3OTO J;  1NZ8 A;  5B0C A;  3R3T A;  3RRH A;  1YJN S;  2HFN A;  3BPD A;  4RKU C;  2UZA A;  2AMC B;  2WBR A;  1Q53 A;  5T14 A;  1BQN A;  4IQM A;  4OHY A;  4I0W A;  5CYM A;  1I5O B;  2W7A A;  1N0V C;  1R8C A;  5E3Q A;  4ZPB A;  1F5A A;  4ED2 A;  5HRO A;  3IFE A;  2QSF A;  3I31 A;  3J81 Y;  4IQX A;  5BJR A;  1Q8L A;  3Q8V A;  3AB4 B;  3ZZT A;  5DET A;  4OYW A;  2EFO A;  3ET6 A;  2P6T A;  2YX4 A;  4ED0 A;  4J9M A;  3ISN C;  3CNQ P;  3TZY A;  4I1T A;  3US5 A;  3PW0 A;  3MUT P;  5DQG A;  2YQ3 A;  3OL8 A;  4O4R A;  2HLT A;  1FRH A;  1WF1 A;  3S6E A;  3LAM A;  5B0D A;  3RUB L;  3DLK A;  4YR3 A;  3J7Y I;  1HNW J;  2RIL A;  4DL0 C;  3G82 B;  2BKP A;  4JI0 F;  5LSL A;  5B0E A;  1XWL A;  2PSZ A;  4QIW D;  4DOZ A;  1ZM3 A;  5KFW A;  4IR1 A;  5HMW A;  2ALZ A;  1XNR F;  2I5J B;  4AQY J;  5F41 A;  1DY3 A;  2G2Z A;  2KJV A;  2WB4 A;  2GS8 A;  1DUR A;  3EVM A;  4XPC A;  3M6W A;  3R2C J;  2KHC A;  4MK8 A;  4C11 A;  3KJF B;  1VQN S;  4ID5 A;  2AJ0 A;  4OYI A;  2WOM A;  3MFH A;  3PW5 A;  4A8Q A;  2F63 A;  3M7V A;  3CJT A;  1UET A;  3CTR A;  3GII A;  1KVJ A;  3J80 Y;  4ELU A;  1HNI B;  1TFY A;  2ZUA A;  3FZ2 A;  3LWL A;  2Z4P A;  1DLO A;  4HHJ A;  3CCL S;  7FD1 A;  4RUC A;  1F2G A;  3SZ2 A;  2BJ3 A;  3BF4 A;  4ZVQ B;  1KS2 A;  3NY0 A;  3W2V B;  3TQE A;  1U1P A;  3GIK A;  2ASD A;  3FZB A;  3KNG A;  1QE1 B;  5F8H A;  3TVZ A;  2ZOM A;  4PG4 A;  2FJB B;  1Q86 T;  3EWG A;  2R2U A;  2DIT A;  3DDK A;  3QMQ A;  2EW9 A;  5D15 A;  4QYZ K;  2ZHA A;  1FXD A;  2D9O A;  2VBZ A;  2L9D A;  4WPA A;  4EMD A;  4NLW A;  2OPR A;  5LMN F;  4LF4 F;  4NI2 B;  4PWD A;  4NLR A;  3HO1 A;  3L7P A;  2C2N A;  3KK2 A;  3CJS A;  2EFQ A;  4CH0 S;  2VG6 A;  1U0H A;  4USJ C;  1BQM A;  1U1Q A;  3H2L A;  4RPF A;  4DFJ A;  2GW8 A;  2YKP A;  3L4B C;  1GEH A;  2ZC4 A;  2D69 A;  3KLH B;  2R8H A;  1Q81 T;  5DG7 A;  5E41 A;  5T7L B;  5C2C A;  4DR7 J;  2ZOG A;  4KHP J;  2XWX A;  4LBP A;  2RUS A;  3RW6 A;  3RGI A;  4C97 A;  4ZPV R;  4L72 B;  1HQ2 A;  4JB8 B;  2Y9H A;  4DSK A;  2V67 A;  1X0F A;  3CD0 A;  1HYS A;  1UVK A;  2QSW A;  3UDC A;  2VF3 A;  3C46 A;  4M5M A;  4HL9 A;  3SEO A;  2Y3Y A;  4ILR A;  4DV4 F;  1S6O A;  4MKY A;  1RWO B;  1N5Y B;  2F8E X;  2Y0S D;  1UFW A;  4DUZ J;  4LIR A;  4B3R F;  1RAH B;  1WAC A;  4MJK A;  1F2H A;  5F9L A;  4GKJ F;  1SC6 A;  3OR2 A;  1R0A B;  4ZPA A;  3C16 A;  2B9X A;  4RW8 A;  2A2C A;  5CQG A;  1HNV A;  3AOC A;  1SVD A;  3QZ7 A;  2VFV A;  4HR2 A;  3IP0 A;  3R5A A;  3T1Y J;  3I96 A;  4M5L A;  3PV8 A;  2DH8 A;  4DR5 F;  1SI9 A;  1TVR B;  3RBZ A;  4U95 A;  4F4Y A;  2J5A A;  3M6U A;  2HHT A;  2QC3 A;  3WBZ A;  3QBC A;  2ZEJ A;  5B7W A;  1FNM A;  1QSL A;  2XMA A;  4QR1 A;  1PCA A;  5GAG U;  2V9W A;  1U6F A;  1WHY A;  2AW0 A;  3H8Y A;  1E6V B;  2QEX S;  1RCO B;  4R8U A;  2DNN A;  3A8I A;  2JFK A;  3UD4 P;  4DEZ A;  2W4C A;  4QWE A;  4AUK A;  2MKJ A;  3N5B A;  2MMY A;  1YX2 A;  4P7V A;  1HKA A;  4ZLL A;  1YJ7 A;  1WC0 A;  3PXG a;  4I7F A;  3GCX P;  1TAU A;  2ZNZ A;  5C24 B;  2JDJ A;  5A2Q Y;  3HHL B;  4NYP A;  2FUG 9;  3HVW A;  4CM0 A;  2CQB A;  1FKP A;  4F4W A;  2LXU A;  4DQP A;  3GJR B;  1KHV A;  1S6P B;  4PQU A;  3A4T A;  4WF9 Q;  3M32 A;  2PFF B;  1NSQ A;  2DK2 A;  2DGU A;  1K8A T;  2CJX B;  3K2Y A;  1U2F A;  4NCA A;  2Z2Z A;  1JLG A;  4RNH A;  2QG9 B;  2C3O A;  2YQ1 A;  3G87 A;  2LXF A;  2A6M A;  4ETX A;  2VQE F;  3NCQ A;  2MXY A;  2ZOF A;  1C1B B;  2ATC B;  3K8W A;  4WFY A;  2FVP A;  1SH2 A;  2HNZ A;  5IQQ A;  1NBE B;  1S97 A;  4PUO B;  3DLE A;  2AJ1 A;  1VQ7 S;  4GRS A;  1LWF A;  2VIH A;  4LMZ A;  1QTN B;  3UVJ A;  3BO3 A;  3TUP A;  4NA2 A;  2BAN B;  4DQS A;  4ECV A;  3AA8 A;  1YG0 A;  2E5H A;  2NZ4 A;  3DU5 A;  1MMN A;  3SI8 A;  3CC4 S;  2MZ1 A;  4FYY B;  4DJB A;  3D1H A;  2ROE A;  1IR2 A;  4KR0 B;  2UVU A;  1FA0 A;  3MGJ A;  2YNF A;  4JBC A;  5K14 B;  4PWW A;  4JI1 F;  3NS6 A;  2CPZ A;  3C14 B;  1YHQ S;  4JI3 J;  2XO7 A;  4DL4 A;  2APO A;  1UL3 A;  1WI6 A;  2YKA A;  3VAI A;  5A8W A;  2G1D A;  5ITH A;  3C66 A;  1HBM A;  4JI2 F;  2AZ3 A;  1XER A;  3HMJ G;  4EZ9 A;  1S1U A;  2OPS B;  3MM9 A;  3N6N A;  3KJV A;  4CYU A;  3IRW P;  4ALZ A;  2VOP A;  2RIJ A;  3KLF B;  3G9C A;  5KT4 A;  2L41 A;  3MMJ A;  2B43 A;  1HD0 A;  4UUW A;  1N0U A;  1HHQ A;  2R7X A;  4OX7 A;  4J9K A;  1IKW A;  3TUJ C;  1N33 F;  3ADA C;  3PYE A;  1H74 A;  1IQT A;  3SBM A;  2ZZM A;  2MYF A;  1LWE A;  1VQS A;  3PW4 A;  3FRY A;  5CYJ A;  2E5G A;  2G1H A;  5A8K B;  4X4S A;  3ITH A;  2O5D A;  1VIX A;  1WKL A;  4RW7 B;  3CJ3 A;  3V4I B;  2EFP A;  3P8B B;  2L08 A;  3N5F A;  4Y00 A;  4ECZ A;  3L7O A;  3RRG A;  1JLA B;  3H5U A;  1PYS B;  2R42 A;  5EWE A;  4WZQ A;  2E7X A;  1M90 T;  3G86 A;  2MKH A;  4K4S A;  2MKC A;  1S9G B;  5J1N A;  5KFO A;  4W92 B;  3CCU S;  2ACM A;  3N6L A;  2DHA A;  2ASJ A;  5FDL B;  2AF6 A;  4OX9 J;  2I2Y A;  1TMJ A;  3SYZ A;  4FDF A;  3PO5 A;  4CI0 B;  3DCA A;  4LFB J;  4K2J A;  3C6T B;  4LFC J;  3O6Q A;  1VYA A;  1QM9 A;  2KB2 A;  5D4O A;  3RZA A;  3TAM A;  3JS9 A;  1S79 A;  2WCX A;  3GIJ A;  2RDJ A;  2DHS A;  2B4P A;  3ZTQ A;  1X31 C;  3K8V A;  2YPY A;  2UV8 G;  3JXO A;  3PCO B;  2BBE A;  3KMQ A;  4R25 A;  1JLC A;  1U09 A;  2J76 E;  4CO2 A;  3TJA A;  2QV6 A;  3TJ9 A;  3H0P A;  1FI4 A;  4OZ5 A;  1G1X A;  1S6Q B;  3GFY A;  2YWH A;  3ILO A;  4ZLJ A;  4LRC A;  2J7U A;  5E5N A;  4DV1 F;  1IR1 A;  4C4W A;  2Q3P A;  2RS8 A;  4ENO A;  4DQI A;  1WKJ A;  4DV7 J;  3Q24 A;  3MMC A;  3THT A;  5JVH Q;  4NLT A;  1Y7P A;  4HAC A;  3VZI A;  1F9H A;  3H59 A;  3L9Z A;  1R7I A;  4K4V A;  1S1W B;  4ZVP B;  3I87 A;  5KFA A;  3GG0 A;  3CVK A;  4I2Q B;  4OYM A;  4MIW A;  5HVF A;  1UEV A;  1Y5N B;  3SQG B;  1RB0 A;  2BQR A;  2VBX A;  4JV2 A;  1K1S A;  3FBF A;  4HHH A;  2KG1 A;  3VHQ A;  4G1Q A;  2HIQ A;  1L3K A;  1T9T A;  2VA3 A;  4DR3 J;  1UZH A;  3DRR A;  5KOX A;  4B08 A;  2C2K B;  3ETM A;  4ZN3 A;  2RNE A;  2Z58 B;  3FBC A;  5LSO A;  1QAY A;  3QQC D;  1HAR A;  4DQQ A;  4K4W A;  1DFD A;  1N5Q A;  1LWC A;  1RT6 A;  2HHU A;  4HDG A;  3D28 A;  4F67 A;  3FKB A;  4DV0 J;  3M8Q B;  3T6J A;  4AL5 A;  1IBK F;  1NK4 A;  3VQS A;  4O4G A;  3WIU A;  2QIF A;  2E1P A;  1VMB A;  2AEF A;  1VOM A;  2QTW A;  2XS5 A;  1FRJ A;  4KPY A;  2XS2 A;  2CNL B;  4RNO A;  2CQ2 A;  4KT0 C;  1CUL A;  3I56 S;  4WE1 B;  4NEZ A;  3CJK A;  2IVY A;  1FK9 B;  5L1J A;  1YRT A;  3LP2 A;  2OML A;  2CQI A;  2VIC A;  1LXN A;  3JTN A;  4M5H A;  4ED8 A;  4DG1 A;  1N56 A;  3TX0 A;  3Q2S C;  5EHH A;  3QT8 A;  2V4R A;  2VOD A;  3C6U A;  5AE3 A;  2GGP B;  5IT9 U;  3ZZ0 A;  4K4X A;  3VGS A;  1HQU B;  4KE5 A;  1HWL A;  2ADB A;  1ZM9 A;  2F7V A;  2NSB A;  1X60 A;  3BR8 A;  3DOK A;  3UI3 A;  5HQM A;  1XMQ J;  2C42 A;  3UCU P;  3VAH A;  4LRD A;  4WXO A;  2JEI A;  4I64 A;  5KFR A;  3I0S B;  4O3O A;  2V0N A;  3KKF A;  1N5T A;  5E2Q A;  3BO2 A;  4NXN F;  2F1F A;  2XZW A;  3ZZY A;  4ETZ A;  2OEK A;  2FHO B;  1FTC A;  4NZ7 A;  2FHK A;  1ZAX A;  4M5G A;  3E8O A;  3OLA A;  1S0O A;  4OJH A;  4L73 A;  4LBI A;  1JMT A;  1Q1K A;  3OFH A;  3PKY A;  1WSV A;  4RU2 A;  4RU9 A;  1B4S A;  2VFS A;  3D7S B;  2BMB A;  2XCA A;  5ETQ A;  1P27 B;  2JFD A;  3CIM A;  3LPY A;  3BQ2 A;  2FGO A;  4PXC A;  2E5L F;  1RHM B;  2PDA A;  4ZJO A;  3NGT A;  4KYZ A;  2CVE A;  3QAU A;  4FPI A;  2VON A;  3CCS S;  1A6L A;  3PYF A;  3BBC A;  5J2P B;  5I3U A;  3CJ2 A;  2VBY A;  3E2E A;  4DF8 A;  5D0E A;  1WWH A;  1K9M T;  3LGH A;  2JEF A;  3CD7 A;  2C2O B;  3FQL A;  4WYL A;  1U45 A;  3PIO Q;  2W9B B;  2WSE C;  3TAP A;  3MEG A;  5ETN A;  1TKT A;  4I4B A;  1VC5 A;  4WXW A;  1HBU B;  5C42 B;  1X5P A;  4ANE A;  1ZYQ A;  5KG4 A;  3EZO A;  1R8P A;  2CQ4 A;  4AT1 B;  4ZK7 M;  1PC4 A;  2HVH A;  3NMA A;  4K4Z A;  1VC6 A;  3W65 A;  4N77 A;  2IBK A;  3KK1 A;  5J2Q B;  2PEB A;  3NAH A;  5KT2 A;  1NEE A;  1SKR A;  2A10 A;  2FPH X;  1U25 A;  1VRU B;  3N4W A;  2HPU A;  1M1H A;  3DN9 A;  4HH1 A;  2DVI A;  5AJ3 J;  4IOA Q;  5HQL A;  1RAD B;  3PX0 A;  3HJF A;  2B9E A;  3GLJ A;  3M6V A;  2JH3 A;  4RO0 A;  5H1S V;  4FF3 A;  2WON A;  2VOO A;  4DR6 J;  2VH7 A;  2F5G A;  3OXG A;  2FGC A;  1FJC A;  3BDP A;  1X9M A;  1TV6 B;  1O8B A;  3E01 B;  4A8Y A;  2Y1J A;  1HNW F;  1SIZ A;  3MFI A;  3K5O A;  3DYA B;  4C6A A;  2LDI A;  2QA2 A;  3IR5 B;  3KLG B;  3VV2 B;  3AXM A;  2N4D A;  1K1Q A;  2NXU A;  4IDK A;  4NZ6 A;  4X65 J;  2D74 B;  3PYG A;  4ICL A;  4OX6 A;  3X3U A;  4K4U A;  3A1Y G;  3WC2 A;  5D78 A;  2FZG B;  4AQY F;  1ZM2 A;  1HWJ A;  3DRY A;  3GFH A;  2LQB A;  3CSK A;  3LP1 A;  3QFH A;  2R2T A;  2PN6 A;  5KFD A;  2XEX A;  1U47 A;  4DS5 A;  2XHC A;  3KG0 A;  5IQ6 A;  3C19 A;  2B56 A;  1L5U A;  3MM5 B;  2M7S A;  3M4X A;  3Q8R B;  4G1I A;  3DMJ A;  3S8S A;  3V6J A;  2PD1 A;  3G6E S;  5D3G B;  1M5V C;  1SUQ A;  2CVI A;  4KH1 B;  5K8N A;  4OV6 A;  3UW1 A;  2H5E A;  3RBX A;  1W7W A;  4IO9 Q;  5KFT A;  2RF2 A;  3LA0 A;  1RTD A;  4EBD A;  1EP4 B;  1NPR A;  3NOC A;  4QWD A;  3OTE A;  1FE4 A;  4KQZ A;  2X51 A;  2OHD A;  1DTQ B;  4CTA A;  3PJX A;  1S9E A;  1RT5 A;  1HQE B;  2XMT A;  2GAG C;  3H25 A;  3W9I A;  5CHC B;  2R8J A;  2HK3 A;  1APS A;  3CCM S;  2BR0 A;  2YWE A;  3QRQ A;  2ASY A;  3OL6 A;  1TL4 A;  2I8E A;  3SSR A;  4DUT A;  2BJD A;  3SCJ E;  5AXN A;  2ZJR Q;  1RP5 A;  1EJ7 L;  2I5J A;  1NDP A;  3IRX B;  2VU5 A;  3NWG A;  1JLB A;  1FFW B;  4KO0 B;  2QFJ A;  3LH2 S;  2JVO A;  2DXE A;  5CXT A;  3UN5 A;  4K59 A;  2ZBC A;  3H5S A;  4EK2 A;  1VLO A;  4Q44 A;  4ZJL A;  4CNZ A;  3IWN C;  1RCX B;  2W9A A;  2V8H A;  4BCA A;  4ECY A;  4BBY A;  1LNQ A;  3KMS A;  4DR7 F;  1YBU A;  4KHP F;  1XTZ A;  3RU0 A;  3ZZU A;  2QMX A;  1VQ8 S;  1E6Y A;  2WHO A;  1SJQ A;  2D41 A;  1TK8 A;  3G8Q A;  4ECW A;  4F04 B;  8ATC B;  3QSY B;  2ASL A;  4F3M A;  4A4J A;  4ZA1 A;  4FVM A;  4ZIT A;  2MSS A;  3CGI A;  1C4A A;  2CRL A;  1F60 B;  3NNC A;  1RU2 A;  1RT2 A;  2H5I B;  5I42 B;  2EKN A;  4QYR A;  5HAN A;  3CJQ A;  3SV3 A;  1CBK A;  4KV8 A;  4TXS A;  4DUZ F;  3VR1 A;  5DQI A;  2FIU A;  1T0T V;  4C3L A;  2XY5 A;  4YB7 A;  4DU8 A;  3J7A 1;  2V68 A;  4FZV A;  5CA5 A;  5HQ8 A;  4MYU A;  1FRI A;  1U02 A;  1YJR A;  3TUI C;  2FC8 A;  3ZFV A;  1S1T A;  2AKW B;  3JYT B;  3CCE S;  1YJW S;  2JLE A;  4CT8 A;  5EUH A;  3TZX A;  4Z2X A;  1S77 D;  4OZ0 A;  4QQB A;  1GTE A;  4FXW A;  1R3N A;  4F50 A;  3M2V B;  1TR0 A;  2FJW A;  1CQN A;  3M30 B;  2JEG A;  5F8M A;  2YKQ A;  5L46 A;  2FVS A;  2DJW A;  1BHN A;  3CCT A;  1L3S A;  4B9N A;  4L74 A;  4CO1 A;  2KYZ A;  4WJB A;  2A1B A;  4F2R A;  2MQQ A;  2C2D A;  2E44 A;  1F6T A;  1TL1 B;  3MI7 X;  2IYG A;  3KLE B;  4H4M A;  2EC2 A;  1T9U A;  1C1C B;  1IBC B;  4F3Q A;  1HW9 A;  3DFE A;  3SQO P;  1RGV A;  4X4U A;  1BD6 A;  4WWS A;  3A8K A;  2CPF A;  1TKZ B;  5KFF A;  3EMT A;  3TEH B;  3UR3 C;  4C3K A;  2XMW A;  4KRW A;  2LVW A;  3BBB A;  2VG5 B;  1V3S A;  1ZBT A;  1IUJ A;  3M8W A;  3BYR A;  1TVR A;  5J1E B;  1UVI A;  2H54 B;  2PO4 A;  1KWM A;  3M2U B;  1CJK B;  3M8Y A;  2R7V A;  4M5J A;  5KT3 A;  3HX9 A;  2MY8 A;  1T11 A;  1CJV B;  2DBB A;  2CXE A;  3NCP A;  3IA0 A;  1FEH A;  5EGY A;  1OY9 A;  1X9S A;  2HBR B;  1VCT A;  2E9T A;  2ACY A;  4GMK A;  1AFI A;  2MQN A;  2PGC A;  3LUY A;  1Q0N A;  1FXR A;  3GIR A;  3C15 B;  4EU0 A;  2DGT A;  3KYL A;  3VAK A;  4NMX A;  3FJ2 A;  1J5O A;  3RB3 A;  4OYO A;  2YPZ A;  3OJU A;  2IA0 A;  4YR0 A;  2GJF A;  1NXI A;  1WDD A;  2Z2Y B;  1VK3 A;  3BB5 A;  4JI3 F;  2HBQ B;  3BN4 A;  4ZCM A;  2OFG X;  5GAE U;  1S6P A;  4S0M A;  1P9Y A;  4B17 A;  5F8L A;  3NAI A;  1BY9 A;  3CC7 S;  1BQN B;  3W1Y C;  1OO0 B;  4LUB A;  3LP0 B;  5CYM B;  1IBL J;  2ZFH A;  2G4B A;  1NB7 A;  3NNH A;  4YOE A;  4DPO A;  1RAG B;  1RJJ A;  4NAS A;  5HRO B;  4OZ3 A;  1XMO J;  1AA1 B;  5KOW A;  4W90 B;  1G6B A;  4P6Q A;  2VHG A;  4LR8 A;  3H4B A;  3TA0 A;  4PUO A;  3NRB A;  3PY8 A;  3LAK A;  3ET6 B;  3ISZ A;  4KTQ A;  3I4H X;  3S01 A;  1Y9O A;  3AQP A;  2R7T A;  4LF2 A;  4CLK A;  3I55 S;  1JJ2 R;  1PBU A;  3R7S B;  1HHT P;  3EGZ A;  2Z2L A;  4LF7 J;  3DU6 A;  4ANC A;  1RSC A;  3P45 B;  3TI0 A;  4L6V 3;  4X62 J;  2FLL A;  2CNN B;  4QPT A;  5HSP A;  1UTA A;  3E51 A;  1S49 A;  3DLK B;  2IRU A;  2DGV A;  4ILL A;  2ILZ A;  2MKY A;  2ZH4 A;  3VGU A;  5K14 A;  1NHV A;  1O5J A;  4PXB A;  3SCK E;  1XBW A;  3MWB A;  2KZZ A;  2P8I A;  2YH0 A;  1RT1 A;  1IKV A;  5ETK A;  1WOO A;  2KO1 A;  1HWU A;  2MLZ A;  2F8M A;  1U0S A;  2WK4 A;  4D3G A;  2WVE A;  4LFB F;  4LFC F;  4EFA C;  2OPQ B;  2UU9 J;  3WZ0 A;  4YY3 F;  1ZA2 B;  5F8N A;  2E9Z A;  4C11 B;  3U1M A;  3FUY A;  4ID5 B;  4F25 A;  2H48 B;  2BJ9 A;  2WOM B;  3JQK A;  3EJM A;  2IMW P;  2HHW A;  3FFI A;  4TYA A;  3NS7 B;  2BE9 B;  3P4U B;  4PG5 A;  2CPD A;  5H9F J;  3RW7 A;  4M95 A;  3FC9 A;  1DLO B;  2Z57 B;  5A8K A;  1SV5 A;  2RSQ A;  1BC6 A;  1Y0H A;  5KFU A;  2XQC A;  3JTP A;  3H2V E;  4RW7 A;  5KFS A;  2XWY A;  3JAM Y;  5B0G A;  4RUH A;  4QW9 A;  4DV7 F;  3EPG A;  2HS0 A;  1OPI A;  2FLO A;  4ILM A;  2BXJ A;  4B9M A;  1HBO A;  2VPY B;  2FVQ A;  3Q86 A;  1JK9 B;  3CDU A;  4RWW A;  3I82 A;  3N6M A;  1DAX A;  4RX6 A;  2W1B A;  2Y1R I;  3WHI A;  3EGW B;  3PVX A;  4PWD B;  4Q2M A;  4MH8 A;  4OJ3 A;  3PM9 A;  2XNQ A;  2C2Z B;  4K7Q A;  4DR3 F;  1SIW B;  1Q95 G;  3V6H A;  2QN6 B;  3KK2 B;  2GCF A;  2CZ4 A;  4NPO A;  2VG6 B;  2H65 B;  2E1C A;  1Y11 A;  5C25 A;  1BQM B;  4I56 A;  4K2X A;  1IJE B;  3MD1 A;  5DLG A;  4DV6 J;  2E1M C;  2YWW A;  2GFF A;  4ZVF A;  3MM6 B;  3D1Q A;  4HVZ A;  3QPI A;  1K44 A;  2DEJ A;  5GAD U;  4DV0 F;  2JSX A;  4H4O A;  3GTY X;  2POK A;  1Q8B A;  1T3N A;  4MKB A;  3O8W A;  2FTR A;  2HRU A;  2GX8 A;  4DX5 A;  3F0N A;  3HJV A;  3BV8 A;  4DHV A;  4NRU A;  1BLU A;  2DRD A;  1Y5L B;  1DZ5 A;  1NAQ A;  1EKR A;  3EDQ B;  3HVR A;  4DCO B;  2HAI A;  4LRE A;  4J9V A;  2G0J A;  3IN5 A;  4EUV A;  2UUT A;  2ZH5 A;  3K5M A;  1VFJ A;  2ZDO A;  2DHG A;  1VQM S;  3CUN A;  1FNO A;  3EDR B;  2IJN A;  3K59 A;  4CLT A;  1SJF A;  3C16 B;  3KUH A;  4RW8 B;  1YWX A;  2M3D A;  1HNV B;  3CXC R;  1VBK A;  2NLW A;  3J7Z 5;  1XMQ F;  3K5L A;  3CCV S;  3MEC A;  1TL7 A;  2MKS A;  2CIM A;  4JV5 J;  5F8J A;  4TQS A;  2I9S A;  3ISN D;  4JV0 A;  2CAD A;  4OYB A;  2UUB J;  2RRA A;  5LSR A;  1KOO A;  3M8Q A;  4A8O A;  4RJV A;  1T05 A;  3W9H A;  4LIW A;  2AJ4 A;  1PSD A;  4R8U B;  3DLL Q;  4M1K A;  1NZA A;  3HSG A;  3T1A A;  1EX8 A;  2LEP A;  2NYI A;  4URQ U;  4J9U E;  2HVI A;  1RAC B;  4ZCL A;  1A9N B;  2O67 A;  3LW5 C;  2DR6 A;  1FK9 A;  4TVA B;  4ZVR B;  4NML A;  4OQJ A;  4I7F B;  2K7J A;  2V8G A;  2OFH X;  3MUM P;  2M88 A;  1TP7 A;  2I0X A;  1XR7 A;  1DQ8 A;  2FVC A;  2NYH A;  3A12 A;  5J2N A;  1JX4 A;  4PQU B;  3M32 B;  4ZVO B;  2BV3 A;  4ES1 A;  5GAG I;  2E5I A;  1PIE A;  4I6A A;  2O66 A;  3R5B A;  1RA7 A;  2B8P A;  2G9O A;  1TFW A;  4O23 A;  1IJF B;  3FCV A;  3GFX A;  4XK8 C;  2M70 A;  1NHK L;  2XMK A;  2WVC A;  2FJX A;  3UD5 A;  2FJE B;  3FQK A;  1L3V A;  3EVO A;  1C0U B;  2EK6 A;  3AOB A;  2F40 A;  4WYW A;  1YSJ A;  4TN2 A;  2HNZ B;  1S1V B;  2BKO A;  5B09 A;  4M5K A;  2JEJ A;  2GAH C;  1X5O A;  1V3R A;  5A76 A;  4C98 A;  1LWF B;  2VPX B;  3DLG A;  3UVJ B;  4BDP A;  2DY9 A;  2NSC A;  4TU7 A;  3QAT A;  4WP3 A;  1MWZ A;  2GO9 A;  4GC6 A;  1VHF A;  2BOP A;  4BC9 A;  2XZT B;  3MOZ A;  5AJ3 F;  1WF2 A;  3JSY A;  1OYE A;  2YNF B;  4OL8 A;  4U6P A;  2CPJ A;  5HL7 Q;  4V1A k;  2M9K A;  1NME B;  2R4F A;  3DC2 A;  3VGT A;  3BH7 B;  1ZS6 A;  2PII A;  4HLB A;  1QAJ A;  2XYP B;  4E8U A;  4DFM A;  4DR6 F;  5E33 A;  2B7B B;  3IXQ A;  4F0H A;  5A8W B;  2UUW A;  1HBM B;  4K4T A;  1S1U B;  2NPI A;  3MM9 B;  3KJV B;  2EBE A;  4CYU B;  2QE5 A;  1JLF A;  2J8S A;  4DSF A;  1FNX H;  1CJU A;  2R9L A;  2X1B A;  1ICE B;  2AEM A;  4X65 F;  3AXK A;  2B4U A;  3D1O A;  3R2D J;  1HNZ J;  1IKW B;  2KT2 A;  4U8V A;  2XGQ A;  5SZT A;  2PA8 D;  1SJ4 P;  4IFY A;  1RWV B;  1LWE B;  3LPE A;  4M94 A;  5AXK A;  2OP5 A;  2DYA A;  3R7B B;  2K3I A;  4RW6 B;  3R1L A;  4I69 A;  2UXD J;  5HP1 A;  3THV A;  1AFJ A;  4Q43 A;  2CWX A;  2HVE A;  1SQE A;  3PO4 A;  4FKY A;  4CT9 A;  1JQG A;  3LAL A;  1U7L A;  1XR6 A;  1BWE A;  2L9N A;  2DGS A;  4DDF A;  1S12 A;  2E29 A;  2IVM A;  4LVN P;  3H20 A;  1NJI T;  2FC9 A;  5BXI A;  3BGL A;  4CP5 A;  4XIU A;  1W2I A;  1JLQ A;  2LXI A;  3AQO A;  1G4C A;  1MWY A;  4Y2C A;  3DYA A;  3FVY A;  4KGK A;  1IBM J;  2X1G A;  1UVM A;  2XSF A;  4ITS A;  3G6Y A;  1W2B R;  1UZD A;  1RWU A;  1FWK A;  3HT3 A;  4P73 A;  2G2O A;  1RYS A;  2W2M P;  3BR9 A;  1PJ7 A;  4WFZ A;  3OLB A;  2ABY A;  3L3C A;  3HM9 A;  3EX7 B;  2C3U A;  1JLC B;  5D0G A;  3NL0 A;  1XMB A;  4G1P A;  2XB2 D;  1U1L A;  2RVJ A;  5HJX A;  4WFA Q;  3AT1 B;  4Y65 A;  4FYV B;  4DR2 F;  1S0V A;  2LA4 A;  1ZA1 B;  1X4B A;  4KIA A;  2BW2 A;  2DPI A;  2F65 A;  4HI2 A;  5MLC V;  3MMC B;  5D3G A;  5KFC A;  4C0H A;  5SUH A;  4J37 A;  3A3O B;  5C2G A;  1N5V A;  1YI2 S;  4LFA J;  3DDI A;  1HBN B;  1NJW A;  4I67 A;  2W7O A;  4J9S A;  3Q8Y A;  4L75 A;  5KFG A;  4P2S A;  4ZMM A;  4G1Q B;  1RTH A;  3ILL A;  2D3O 1;  4P2X A;  2ROP A;  3D3B J;  1HI8 A;  4Z7Y A;  2GVD A;  1FD2 A;  2ZKT A;  1UJ6 A;  3TZZ A;  2HHH F;  4FYD A;  3DXB A;  5KT7 A;  3SCI E;  4ZP9 A;  2GQ2 A;  3NKY A;  4Y0F A;  1WKK A;  3QT6 A;  1LWC B;  1RT6 B;  1RT3 A;  3VAG A;  1CC8 A;  1Y4Z B;  1SQG A;  1ELO A;  4DMZ A;  3SIP B;  5HN0 A;  4WK3 A;  4KY3 A;  4O4G B;  2DNZ A;  5IOL A;  4TU8 A;  1SC4 B;  4OI4 A;  4J5O A;  2KDO A;  2XLK A;  3PTW A;  3M8Z A;  1CUL B;  2A2D A;  4P52 A;  1S59 A;  1NK5 A;  4KKO A;  5CAA A;  3LP2 B;  2IM2 A;  5HLF A;  1OIA A;  1NK6 A;  4A48 A;  1XQI A;  4DG1 B;  1CSJ A;  2HWT A;  4ZCK A;  4RUA A;  1GFW B;  1LV5 A;  3T9N A;  3IR7 B;  3C6U B;  2BE7 D;  1U6Z A;  2QA4 S;  4DFK A;  2FY1 A;  2R3V A;  2OKQ A;  1LKZ A;  2AZ1 A;  1V5I B;  4DN9 A;  1KON A;  3NP5 A;  3Q23 A;  2HBY B;  3DOK B;  5CCL A;  4WFN Q;  2AP6 A;  4UZB A;  1QJH A;  3IBC B;  4A8K A;  4KH0 B;  2VJU A;  3KDO A;  2UXB J;  2YY3 A;  3QLH A;  3W5Y A;  2B0G A;  5KFH A;  3SDE A;  4MKA A;  1VS3 A;  1T95 A;  3ZNJ 1;  1XIQ A;  2QL7 B;  1H3D A;  4Z37 A;  2XMU A;  2P2C B;  1Q8I A;  5HAT A;  1HNX J;  1X4C A;  3U02 A;  1SPB P;  3ONQ A;  2W4D A;  3C2P A;  2V63 A;  2FQQ B;  1GMU A;  1NLK L;  2NCK L;  1ZZN A;  3ENV A;  3KWM A;  5CZV A;  3R5D A;  1CC7 A;  3FNN A;  1TK5 A;  1NUE A;  5IC4 B;  2AX1 A;  2MJU A;  5I3U B;  4BHQ A;  1YKW A;  1KQF B;  2AX0 A;  8RUC A;  1HR0 F;  2KFZ A;  1X4H A;  4HHU A;  2CJ9 A;  2EKY A;  3KLE A;  4ZLN A;  3JSM B;  2XGP A;  1D9D A;  4RWX A;  1VBZ A;  3B6B A;  4LT6 A;  2COL A;  4RNN A;  4NLU A;  3UDE A;  3N0V A;  4X4O A;  2I38 A;  3MEG B;  1DHM A;  1Z2Z A;  3MZI A;  4C3M A;  2RML A;  1PKU A;  1TEL A;  5IM0 A;  1G2E A;  5AT1 B;  3TJ8 A;  3MEK A;  1IBL F;  4PKD B;  3CC2 S;  1RBO B;  2AQ4 A;  1VBY A;  2QLX A;  2EG2 A;  2M0G B;  2RU3 A;  1XMO F;  3M2U A;  3PFE A;  2AHO B;  2VUG A;  4Q2L A;  3PNI A;  5HMY A;  3HKZ D;  4DPY A;  2B9W A;  2CFX A;  5GVQ A;  3KHR A;  3BSN A;  5HVG A;  3PEJ A;  4KBI A;  3JQM A;  4WKR A;  1TK0 A;  3CCZ A;  4HTJ A;  2V8D A;  4OYP A;  4DPU A;  4CIO A;  3HT0 A;  3OXF A;  1X5T A;  1UAW A;  3BRE A;  2ZVS A;  3HI9 A;  4X62 F;  3H98 A;  4ZP7 A;  2WON B;  3C15 A;  1Q79 A;  4ES2 A;  3UN3 A;  1N6Q A;  5CYQ A;  2IAJ A;  4CLP A;  1FJG J;  2LEA A;  1VQO S;  4GC7 A;  4ZN1 A;  2GML A;  3O3L A;  3HPO A;  1D1U A;  5ETM A;  1REV A;  3NGS A;  4IDK B;  2ZBI A;  2ZZN A;  2K8G A;  2HQ3 A;  2HQC A;  4ICL B;  1NSP A;  1NPP A;  1EZZ B;  2AV5 A;  1LK5 A;  4PXD A;  3LP0 A;  2AYM A;  3K57 A;  2KL8 A;  3LP1 B;  3TO8 A;  1X9W A;  2UU9 F;  1IM6 A;  1T94 A;  1IR0 A;  4DCJ B;  3PZP A;  2DHX A;  3OL7 A;  3HXM A;  3DRP B;  2YKM A;  4B3T F;  4E0D A;  1N5S A;  1RAB B;  2R7U A;  1FKA F;  3DMJ B;  2RKI A;  3H5X A;  4RW4 B;  4DQR A;  1LFP A;  4GVB A;  1TL3 A;  1SUQ B;  1X4G A;  1JWW A;  4LF1 A;  3EUN A;  3A8J A;  2J9E A;  3OD2 A;  3FDS A;  3G96 A;  1VQ5 S;  1DRZ A;  1C0T A;  2RF2 B;  1RTD B;  1OYD A;  2FD2 A;  3GG1 A;  3TAR A;  2WVD A;  2YVS A;  2HBZ B;  2PI4 A;  4CTA B;  1S9E B;  5B0B A;  1RT5 B;  3MAQ A;  1UA1 A;  3RBE A;  3BSA A;  1B7F A;  1D8Z A;  4Q0B A;  2BE2 B;  2B9Y A;  5KT6 A;  1D3W A;  5ETR A;  4H54 A;  2LYV A;  2QZ8 A;  4E2F B;  1LW0 A;  1Q16 B;  1RXO B;  2DEI A;  4OJ1 A;  3UCG A;  2XM3 A;  4NEY A;  2B3T B;  2LLZ A;  1JLB B;  2HHX A;  2Y0B B;  2OPQ A;  1FER A;  5KFV A;  4YS2 A;  1FCA A;  2DRA A;  3TW0 A;  2ZWO A;  3LGM A;  1SC1 B;  3A8E A;  1FO1 A;  1XN9 A;  4N8O A;  2MKI A;  3M8P A;  1RLC L;  5L9N A;  3X1L B;  2N7Y A;  3H40 A;  3VVT A;  2YNG B;  4ZIV A;  5F3T A;  1KQS R;  4V19 X;  1E6Y B;  1VGY A;  3IBF B;  2EG1 A;  1H2T Z;  5F3Z A;  5JUM A;  2KI2 A;  3GIM A;  2GIR A;  1VBX A;  5JXS A;  3K5P A;  2HAF A;  1RT2 B;  1YGY A;  5HO4 A;  4JOU A;  1EAY C;  1T02 A;  5HBM A;  1U4B A;  1KDN A;  3TRG A;  5A8R A;  3AD7 C;  4KV8 B;  1JLE B;  3CCR S;  1V9O A;  2CQC A;  2FLN A;  2GQQ A;  1SB6 A;  4YEA A;  4RW9 A;  2XLJ A;  4OMF G;  1XC9 A;  1WOS A;  2UVV A;  1YRX A;  1RHR B;  3HHL C;  2F9J A;  4E98 A;  4JI4 J;  1PAE X;  3M2R A;  4DR1 J;  1MG7 A;  1S1T B;  2PMW A;  2DT9 A;  2Q1L A;  3HSZ A;  3MM6 A;  4JV5 F;  3P5B P;  2V4J A;  4XTT A;  1U1K A;  2V6A A;  1YJ9 S;  1HW8 A;  1EET A;  1HMV A;  1RHK B;  3M1V A;  2V8V A;  2UUB F;  1W25 A;  2KG0 A;  3R9L A;  4CM2 A;  4LSZ B;  2BRK A;  4LJM A;  4DSJ A;  1GMV A;  2V69 A;  4HDH A;  3QID A;  1D9F A;  1KEK A;  3HFZ B;  4B3O B;  2NXJ A;  3BH6 B;  4LSN A;  2EPI A;  2J9D E;  3R97 A;  4ZOS A;  2KJW A;  2AYG A;  2E66 A;  2VZ9 A;  2GO8 A;  2FVR A;  5LM7 E;  4KGM A;  5GME A;  3H2U B;  2ZE2 A;  3NLC A;  4NYO A;  1X0P A;  4P9S A;  3KK3 A;  4H4M B;  1UPP A;  2OIH A;  2IBO A;  2NXN A;  4QYZ J;  1CG2 A;  2ILY A;  1VJW A;  3V81 A;  2OGU A;  4ED3 A;  2EFV A;  2BJ8 A;  3ILI A;  3MR5 A;  4CO5 A;  4D3H A;  2HKE A;  3OL9 A;  3FCW A;  1I94 J;  2QGF B;  3HKW A;  3KLV A;  1GMW D;  4OYZ A;  2C3Y A;  3D68 A;  2R2R A;  2ZBR A;  5D0H A;  1QAI A;  1RWP B;  3V2U C;  4FYX B;  3RB0 A;  4U7U D;  3HUL A;  1X4A A;  3UPF A;  3DOM A;  2V8P A;  2XSJ A;  5E0O A;  4WZM A;  2N3O A;  1UWB A;  4K4Y A;  4R5P A;  2F8H A;  4WP8 A;  1HFE L;  1XNQ J;  3O44 A;  3B8H A;  2A6O A;  3RAQ A;  2VQF J;  1NCL A;  2X3G A;  3V5R A;  4FF1 A;  4QW8 A;  2MY7 A;  5L1K A;  2HQF A;  2KRR A;  2J7W A;  4LQ9 A;  1TUG B;  1KLM A;  1J5O B;  4FS1 A;  1Y3J A;  2DNP A;  5K20 B;  2ZBP A;  2KZM A;  1S1X A;  4YDD B;  2H51 B;  3F56 A;  1TQL A;  1FHT A;  1DTT A;  4EZ6 A;  4DN0 A;  3DRX A;  3PR5 B;  2U2F A;  4DI6 A;  2B5J A;  4LF6 J;  4FNH A;  4IRD A;  3T1H J;  5EN1 A;  2R2S A;  2OTL S;  2FZC B;  3NGK A;  4ZPC A;  5DQH A;  2Q79 A;  4MIB A;  5KAK A;  4ED1 A;  3A13 A;  1C0U A;  4OI1 A;  2Q6B A;  2O3D A;  3AJ2 A;  2CYY A;  1HLW A;  2JC0 A;  2HHS A;  1S1V A;  3VGV A;  1FWL A;  1HNZ F;  2HMI B;  3KLI A;  1GNK A;  4QU6 A;  5FLX U;  2ZH1 A;  2CZV C;  4RZR A;  5HJY A;  2CDQ A;  4P71 A;  3ENA A;  5GAE I;  1QUV A;  1YVF A;  2UXD F;  3A3N B;  1Z1Z A;  3W61 A;  3RRK A;  2HZV A;  4USV A;  1QTM A;  3CDA A;  1N52 B;  4J9L A;  4ES3 A;  1U49 A;  5FII A;  2W8L A;  5DZ6 A;  2F4V F;  2OO4 A;  1PC5 A;  4PCQ A;  4LF9 J;  5KG7 A;  6AT1 B;  5KFN A;  3MCO A;  2B6A A;  3HZE A;  2LEB A;  3U1L A;  2AIR B;  5FJ4 A;  4USU A;  1RT1 B;  2HFZ A;  5K8O A;  1IKV B;  3VZH A;  2FJA B;  1RWW B;  1IBM F;  3G4S S;  2YWG A;  5E3A A;  3QGP A;  4RBU A;  3W8P A;  2ADC A;  4UY8 5;  3RYL A;  2MGZ B;  1H72 C;  1TZ0 A;  4IKA A;  4WCE Q;  2BVZ A;  1FES A;  1FDN A;  3QYY A;  3FFI B;  2CPE A;  4IUF A;  4FBT A;  4C7Q A;  2H3E B;  4DLE A;  2CG8 A;  4JI2 J;  1RWK B;  2IPO B;  1CEZ A;  2W8K A;  3ILJ A;  2DD8 S;  4RW6 A;  1SV5 B;  5AE2 A;  1MU2 A;  4FP9 A;  2VFR A;  2CPX A;  2DNR A;  3W63 A;  1MN7 A;  1G7C B;  3EVW A;  5LJ3 Y;  1L3U A;  1R43 A;  1UFL A;  4DWI A;  3T41 A;  4M8L A;  3PIP Q;  4IG0 A;  1N33 J;  2HFV A;  4CLF A;  3KHH A;  1OWX A;  1JKH B;  5KT5 A;  1I1G A;  1HBO B;  4Q5V A;  2OEJ A;  3OTB A;  3U27 A;  3BSC A;  3CUL A;  1NK9 A;  3EPI A;  2DNM A;  4F8R A;  2MPU A;  3H5Y A;  5DS7 A;  5IZH A;  4F4K A;  1N34 F;  4GO5 X;  4DV5 J;  4PWU A;  8AT1 B;  2E1A A;  2WW8 A;  2KRB A;  4OZ1 A;  5M2P A;  1CLF A;  2VL1 A;  1NK7 A;  3HLU A;  1YJV A;  3J81 U;  4K0K F;  3MED A;  5C25 B;  2K1R A;  2P9G A;  1S5Z A;  5DDP C;  2KYX A;  4USH A;  4C9D A;  3MCN A;  3BKT A;  4KGZ B;  3G8T A;  1L3T A;  5AXM A;  5H9E K;  2HND B;  1KFS A;  1KRP A;  1SL1 A;  4PXE A;  2OD4 A;  1UFK A;  4H4O B;  3GCW P;  3FBB A;  1CS4 A;  4JI8 J;  1FKO A;  4G3I A;  4HYK A;  1U1M A;  3W64 A;  5BYQ A;  2F9D A;  3GSI A;  2QL5 B;  3D2W A;  3TUZ C;  3CCW A;  4F0K A;  3MOJ B;  3MM7 A;  1FJ7 A;  1NJY A;  2HSE B;  1DQ9 A;  2HW3 A;  3MXH P;  3BPS P;  4M5D A;  2HFS A;  4ED7 A;  1EHW A;  2HRT A;  2ATL A;  3FEX B;  4ZVS B;  4LRA A;  3GR1 A;  2F3J A;  5DGB A;  1HBN A;  1J5E J;  5IT0 A;  4Y3C A;  3DDN A;  5GAD I;  5ETT A;  1GTH A;  2WVB A;  2GMJ A;  4LSL A;  1N54 B;  4OHX A;  2QLF B;  3OFF A;  3MEC B;  4X66 J;  2XYH B;  1FJE B;  3HP6 A;  1TL7 B;  4PPD A;  2RH3 A;  3J80 U;  2UXB F;  4R0E A;  1S57 A;  2AWZ A;  2GQC A;  2BM1 A;  5H9E J;  1RKI A;  4WP9 A;  2CJK A;  3QT7 A;  4QU7 A;  1T05 B;  3TYT A;  1M0S A;  3MTJ A;  2JLG A;  3QAE A;  1MNE A;  1CJT A;  3DM2 A;  2J6T A;  3FMW A;  3EYZ A;  3IBW A;  2VC0 A;  4DCP B;  4QIG A;  1OJ4 A;  1HNX F;  3W66 A;  4OLP A;  1NDK A;  1BUX A;  1GMW A;  2BKN A;  3W9J A;  3NGD A;  3CJ5 A;  5L9X A;  2MEW A;  3TWZ A;  1SH3 A;  4O0N A;  1S10 A;  3GV5 B;  1FVS A;  2IVF B;  3NGR A;  4CQ1 A;  3MPD A;  3BGR A;  1KTV A;  4LVO P;  1F3V A;  2R8K A;  3CCQ S;  4YB1 P;  5J2N B;  2VJV A;  4PAB A;  3GZ7 A;  3NCR A;  1BMQ B;  3VAM A;  4ZCI A;  2BZ2 A;  3BKU A;  4DUY J;  4KAI A;  5K8P A;  3AB2 B;  1UVN A;  3EGV A;  2GIF A;  4X2B A;  1R31 A;  2P6S A;  4PEO A;  1WG4 A;  2VV5 A;  4IFV A;  1NDC A;  1YLX A;  1B7Y B;  4KSE B;  1GXU A;  4ECS A;  4HKQ A;  4XDC A;  5IS2 A;  4IOB A;  4TQR A;  1R0C B;  4AXI A;  4OX8 A;  2GZO A;  3DLG B;  5KTQ A;  2Y1L B;  1SQF A;  1RHJ B;  2P5V A;  1QVF R;  3TAQ A;  3DI6 A;  3GV8 B;  4OHZ A;  2DO0 A;  3AH6 A;  4DV3 J;  1WD6 A;  1KVK A;  1WHX A;  3PX4 A;  1VR6 A;  4WFX A;  2HHV A;  3O5T B;  4LF8 J;  3H7H B;  4NXM J;  4MKV A;  5I4M A;  3CPW R;  4YB6 A;  5EWG A;  3KFW X;  1RT4 A;  1GK8 A;  1RIS A;  3SV4 A;  1YIJ S;  4DSL A;  4OFZ A;  4B02 A;  4N76 A;  1PJ6 A;  3Q8U A;  4NLO A;  3V6K A;  5CAB A;  3BGO P;  3GU0 A;  1YDL A;  4M5N A;  5U47 A;  1IWG A;  3JSM A;  1FJG F;  2BAC A;  1WOR A;  1ROF A;  3OTO F;  3Q8P B;  1JXV A;  3P3D A;  4AYB D;  1JLF B;  3Q2T C;  1PBA A;  1CJU B;  1RHU B;  3UFC X;  4NLG A;  5IV4 A;  3GR0 A;  3WIV A;  2OPP A;  1FE0 A;  1HI1 A;  5HAO A;  3HZG A;  4IFY B;  5MAO A;  2E1R A;  2QT7 A;  2DR9 A;  1W26 A;  3CD5 A;  3ENW A;  1RHQ B;  1UJ4 A;  2NXC A;  2H1Y A;  1IN0 A;  1P1T A;  2KFN A;  1X5S A;  2AJF E;  3N79 A;  5HP1 B;  4CNY A;  2MLY A;  2O1P A;  5A2Q U;  4UOF A;  5A6W A;  3F41 A;  4AFF A;  4UTG A;  2MLX A;  4N8N A;  4IYQ A;  2ZH7 A;  2HVZ A;  6FD1 A;  4KB7 A;  1JXE A;  1N8R T;  1LK7 A;  3NBP A;  4PR6 A;  2BQU A;  3AHP A;  2MQO A;  4NA3 A;  3GP9 A;  3QO9 A;  1YJT A;  2BW7 A;  2DR7 A;  4JI6 J;  3T5L A;  1JLQ B;  1S7H A;  1UPM B;  5F8I A;  4W4M A;  3DRS B;  5F8G A;  4NYZ A;  3KJQ B;  1RWM B;  3CDB A;  4RNM A;  5C7P A;  2QLB B;  1HWK A;  2ZIT A;  3OFE A;  1AXQ A;  4C0B A;  3BJY A;  2CZ9 A;  1RUS A;  1B70 B;  2HNY A;  4WBF A;  2HFU A;  3B78 A;  4JYA J;  2B7C B;  3W5Z A;  3P6Y C;  4PQA A;  3SCL E;  2MST A;  3DRP A;  2OEL A;  2XMM A;  3L95 X;  2E5J A;  4UT4 A;  2BEF A;  3Q83 A;  4NLD A;  2BAB A;  4ZP6 A;  3L7U A;  4EYI B;  4RW4 A;  1AZS B;  3UN2 A;  1IKX A;  2KVQ E;  1VQL S;  1UJ5 A;  2HHP A;  1KQG B;  4DZ6 A;  1S7I A;  2UUC J;  2XI2 A;  3UCZ P;  1KC8 T;  4XO0 A;  1P6T A;  1PO6 A;  1EIY B;  3QGI A;  2NPF A;  4PYD A;  3DGP A;  3PRB A;  2I1R A;  1RI7 A;  2JHE A;  5ETS A;  1D09 B;  2AEJ A;  1RTH B;  1KHW A;  5LJ5 Y;  3AOA A;  1VRQ C;  3UDL A;  2EC0 A;  1MRO A;  4DPX A;  4BS2 A;  2CJQ A;  2UVW A;  2BE2 A;  2GVD B;  1X7V A;  3QT5 A;  4NX9 A;  4LF5 J;  4AL7 A;  2CNO B;  2XTJ P;  4WU2 A;  3V6D A;  1KTQ A;  1OS5 A;  2XS7 A;  3RAM A;  2QA4 G;  1VQ9 S;  4PPZ A;  4WII A;  2J0S D;  1RT3 B;  4JI4 F;  3K89 A;  1K73 T;  4DR1 F;  1M1K T;  5L1L A;  1D8Y A;  2AGP A;  3I9V 9;  2WB1 D;  2DGO A;  2YNI B;  2R7S A;  2DPJ A;  5LMU J;  1YBA A;  5KG1 A;  5LXY A;  1T8E A;  2DO4 A;  2JC1 A;  5GMD A;  1FT8 A;  2AYE A;  3IMQ J;  2CQ0 A;  4KKO B;  4F2S A;  5IT9 Y;  2YNG A;  4B3S J;  3SSS A;  3QGG A;  5HLF B;  2HGL A;  1RK8 A;  1QVG R;  3BDE A;  3PAC A;  2L48 A;  1Q8K A;  1RT7 B;  2QMW A;  4R0J A;  5G4D A;  5LOQ A;  2D3O R;  4XPE A;  1FFG B;  2M2B A;  2XLI A;  1BWV A;  1YQH A;  2VFT A;  3CDW A;  3DLJ A;  3GPA A;  2DIV A;  1M5P C;  4IO1 A;  4URS A;  1N4L A;  4CZC A;  4A46 A;  1NM2 A;  5HMX A;  2XY6 A;  1HWI A;  1XJW B;  3D0H E;  1U1N A;  4CCH A;  3R6G B;  1JLE A;  2AYB A;  1TMM A;  3D0G E;  1MLA A;  1ZET A;  9ATC B;  1F0X A;  1AYE A;  4ZHR A;  2MQM A;  4CH7 A;  1ACM B;  3MF5 A;  3QLH B;  1Z2L A;  3T1Y F;  1I94 F;  4WKY A;  2HQD A;  3SDE B;  3ZZP A;  2KU7 A;  3THP A;  2J7K A;  4OZL A;  3WDO A;  2J0W A;  3TZW A;  2J0X A;  3MMA A;  3MEE A;  2BQ3 A;  4ECR A;  1N48 A;  4NE9 C;  4DLG A;  1S6U A;  4UST A;  5IV3 A;  4DR4 J;  1XNQ F;  2NZC A;  1IVZ A;  3UNY A;  3N28 A;  4M5I A;  5F9N A;  2VQF F;  5KFX A;  2OAU A;  4B3O A;  1TL5 A;  3M05 A;  4CLL A;  2R7Q A;  2GIQ A;  3OJS A;  3ZZO A;  2LQ5 A;  3QIP A;  1GXL A;  3JB9 k;  1UWA A;  2MQ8 A;  4OLO A;  1JJ4 A;  2DIU A;  3GV7 B;  4DL6 A;  4JP8 A;  2C2R A;  2XBP A;  2VC1 A;  1DAR A;  2XUL A;  2AJ2 A;  1U24 A;  2HG4 A;  3BS9 A;  4ELT A;  5KFP A;  4A8W A;  2DXD A;  4TYB A;  2MQL A;  2GJI A;  4LF6 F;  1FDD A;  4LQ3 A;  2GHP A;  3KXD A;  2UV8 A;  3T1H F;  1OSC A;  2FYX A;  3OPK A;  1VC0 A;  1I51 B;  2HS3 A;  5IM0 B;  5KFI A;  3LWM A;  4OIX A;  3MPY A;  2NS1 B;  1S72 S;  4J9O A;  4ECQ A;  4HI1 A;  2HGM A;  3BGF A;  4TY9 A;  1SBR A;  4G6V B;  3T5J A;  4BLG A;  3G71 S;  3UD3 P;  3Q89 A;  2OLW A;  4IH7 A;  2V34 A;  2PFD A;  3KOA A;  2ZH3 A;  1H73 A;  4UY8 T;  2MQP A;  2ZJP Q;  4B9T A;  2DKO B;  4USW A;  1KNZ A;  3D9B A;  4ELV A;  1H6K X;  2VB6 A;  1KN6 A;  5IFM A;  1Q7Y T;  4C48 A;  2LA6 A;  5ETO A;  1JXL A;  1ZPV A;  1T9Y A;  3R8Y A;  4I68 A;  4IH5 A;  1N6Q B;  1J27 A;  1LXJ A;  2LDY A;  4LF9 F;  3I6P A;  3SMZ A;  5CYQ B;  2IAJ B;  3D0I E;  2QL9 B;  1B0P A;  1FRK A;  3DGV A;  3KNA A;  1F1B B;  4C8O A;  3PFO A;  3M9O B;  2MDA A;  3PG9 A;  1FVQ A;  1REV B;  3EE3 A;  4JI5 J;  3BSO A;  1EB0 A;  1B3T A;  1DJ0 A;  3AOD A;  4AND A;  2HFO A;  2R7R A;  2MZS A;  3BKF A;  2A3J A;  2PA3 A;  5J2M A;  3DKD A;  1LQ9 A;  1IXK A;  2CQD A;  3RB4 A;  2LU1 A;  5B0F A;  2YKM B;  2HMI A;  1H2U X;  1LFW A;  4NRT A;  4F26 A;  4J9R A;  3JSB A;  3OVB A;  2W9C A;  3FSY A;  4NL5 A;  3VCD A;  2KT3 A;  2RKI B;  1N36 J;  4GVB B;  1TL3 B;  4CLW A;  1JIH A;  1VRT A;  2K06 A;  2RDI A;  4DXL A;  2L3M A;  2PT0 A;  3IGV A;  1C0T B;  3M8R A;  2J8A A;  5GAH U;  2MJN A;  1NDL A;  4RNF A;  5LXR A;  3MAA A;  4ZP8 A;  4TY8 A;  1Q5Y A;  4IG3 B;  4O44 A;  2ZBQ A;  1ZAV A;  2RDD A;  2DTJ A;  4CH1 A;  3VF0 B;  4CDI A;  2DGX A;  3QRP A;  2DXF A;  1NRK A;  4CLU A;  3IAM 9;  1WDT A;  4Q0B B;  3UDV A;  2IYI A;  3FEZ A;  1VQP S;  4I2P A;  4YME A;  2JX2 A;  2YWF A;  5KG2 A;  4OJG A;  3H42 A;  1LW0 B;  4OX9 F;  1HPZ A;  4DV5 F;  3N01 A;  3FRZ A;  4TU9 A;  2EWH A;  5IT4 A;  3MMB A;  2IA6 A;  4NCG A;  3ZTO A;  3QRR A;  4KFB A;  3G6V A;  3GE9 A;  1JNR B;  3B4D A;  3CJ8 A;  2ZZT A;  4HEA 9;  2MGZ A;  2G0I A;  3HF5 A;  2FHJ D;  1RTI B;  3TEG A;  4Q8F A;  4X84 A;  1LW2 A;  4UW2 A;  3T5K A;  1H98 A;  1VQY A;  2CA9 A;  2KM8 C;  3PDN A;  4LRF A;  1BE4 A;  4N56 A;  3M8P B;  2RT3 A;  3DLB A;  2DIS A;  4JI8 F;  3CMA S;  4YY3 J;  4ER8 A;  4ZVH A;  1P8G A;  2Q43 A;  2WZ1 A;  1U1O A;  4J91 A;  3PX6 A;  4XDD A;  2G2Y A;  1IQZ A;  1JKH A;  2XG8 A;  3D6M B;  4Y2I A;  1OPZ A;  1TKX A;  4C2M A;  3ZXW A;  3DOL A;  1TUW A;  5HBM B;  3OUY A;  1J5E F;  1DQA A;  4QIF A;  5A8R B;  4OYX A;  7FDR A;  5M2U A;  1NHU A;  4ZPW R;  3AA9 A;  5D77 A;  4RW9 B;  3QNW B;  3IWL A;  4FS2 A;  4P2F A;  2G0C A;  4X4R A;  3VAJ A;  4P72 A;  2ZKU A;  3M2R B;  2PI5 A;  5E3P A;  3HD1 A;  2JNJ A;  2RQ4 A;  4X66 F;  1NKE A;  2V4J B;  1UEK A;  2CDR B;  3K5N A;  2HRY A;  4GO7 X;  3OFG A;  2HND A;  2XMJ A;  1EET B;  1RTJ A;  1HMV B;  3M1V B;  3POT A;  2BOA A;  2VG7 B;  2W2O P;  5KFK A;  2RQM A;  4GVL A;  2J6S A;  1T03 A;  3OHA A;  1O0P A;  1ARO P;  3MUV P;  1HI0 P;  2HGN A;  4ZPD A;  2QYG A;  5DM6 Q;  4YHH J;  5DDR C;  4C8Z A;  4U9R A;  3OBI A;  5EX0 A;  4DX8 H;  4LSN B;  4GKK J;  4B9L A;  1URR A;  1MWQ A;  3T6B A;  2DNQ A;  3I0R A;  1NH8 A;  2ZE2 B;  2XI3 A;  1S76 D;  1IKY A;  2P9C A;  3KK3 B;  3EZ5 A;  2LCW A;  3CIZ A;  4MK9 A;  3QJP A;  4O0I A;  1Y00 A;  4M63 A;  3ETO A;  3MD3 A;  2C3M A;  3EM1 A;  3SXL A;  1SKU B;  4EEY A;  3ICL A;  3V81 B;  3Q8Q B;  3GJQ B;  3GSD A;  4ZJQ A;  1B99 A;  3BEG B;  2GHV C;  3MR7 A;  1A0O B;  4HT5 A;  3MM8 A;  1RWN B;  1VIO A;  3MR2 A;  2DH9 A;  4DUY F;  4NZ0 A;  1ZZF A;  1NU4 A;  1WEL A;  2UXC J;  1I3O B;  1T3O A;  1OSD A;  3DOM B;  1FDB A;  2XSJ B;  4Y2A A;  4ZS6 A;  5KFB A;  3WX8 A;  3OTD A;  1UWB B;  4R5P B;  4MFB A;  3LAN A;  1UVJ A;  3CWJ A;  1GH8 A;  2CJA A;  3HK2 A;  4YUD A;  1WG1 A;  3G2X A;  3TAN A;  1ITP A;  3AJD A;  1Q82 T;  3AD9 C;  2VDH A;  2GVZ B;  3VAF A;  1EAR A;  2RHS B;  1REG X;  3UNG C;  3MPW A;  1ZOT A;  1F5B A;  1M5S A;  4DV3 F;  3B82 A;  4K50 A;  1JJH A;  3MR6 A;  5A0Y A;  3LOU A;  4OI0 A;  2QO3 A;  1KLM B;  2ZJQ Q;  4LF8 F;  3OT9 A;  3GYX B;  4NXM F;  1P1L A;  3CT9 A;  2LU2 A;  1N88 A;  3K17 A;  1S1X B;  1QAX A;  3FCH A;  5DDQ C;  1DTT B;  2ZM6 J;  5KFL A;  1T9X A;  4B3M J;  2LMI A;  2Z56 B;  1NJZ A;  4Q8E A;  2YTC A;  5AE1 A;  1PAU B;  2ZH2 A;  4N5S A;  2B5J B;  1M5K C;  3E3X A;  4DZD A;  4ZVG A;  3GMG A;  3ZO7 A;  2LEC A;  4ATN A;  4YDX A;  2Y8W A;  2WVF A;  2QX0 A;  4JV1 A;  3I5A A;  2PC6 A;  2RRB A;  3OR1 A;  4ECX A;  5IWA J;  4YN3 B;  1B0V A;  1FX4 A;  1T9V A;  3D66 A;  2Q6C A;  1WI8 A;  3IAS 9;  1FKP B;  3KLI B;  3IGN A;  3OSN A;  2CPI A;  2YX1 A;  2JJ4 D;  3GJS B;  2KVI A;  4X4V A;  3KUG A;  1G3O A;  3OTC A;  4F02 A;  2AGQ A;  1RAO A;  2CPH A;  2XC9 A;  2LQJ A;  2B4V A;  3IM9 A;  1WNE A;  3IS9 A;  3KTQ A;  1UVL A;  2DRB A;  1IWA A;  3ZZR A;  4MAK A;  4P10 A;  3A3P B;  4FPR A;  1S99 A;  3MCS A;  2V4Q A;  2QA1 A;  4B9S A;  3SFG A;  2B6A B;  2C2E A;  2MZT A;  2MZQ A;  3HHL D;  2Y8Y A;  2IC3 B;  3H90 A;  3HVT A;  1SJ1 A;  1YK9 A;  3B54 A;  5ETV A;  3TNV A;  4JI6 F;  1VIS A;  1NH7 A;  3G8S A;  3CED A;  2HHQ A;  4U8Y A;  3PHT A;  1S4F A;  4EI2 A;  2N3L A;  2VA2 A;  4IOC Q;  3MAH A;  1V5V A;  2DHH A;  4EGL A;  3M8S A;  3KHL A;  2K7K A;  2Y1I A;  2FDN A;  1R8H A;  2SXL A;  2MHN A;  5CZX A;  4DV2 J;  2KT5 A;  3FMB A;  3W2W A;  2N82 B;  4JYA F;  3KG4 A;  2YX7 A;  4BC7 A;  1YBT A;  1MU2 B;  1RAJ A;  3OHB A;  3IG1 B;  4B9V A;  5DJB A;  2YKO A;  4WU3 A;  1I6J A;  2VPW B;  3FBE A;  4FN5 A;  1YZ7 A;  2WBM A;  2CAJ A;  2FHJ A;  4BWM A;  4IG0 B;  3GJT B;  2CG4 A;  2HZA A;  1WHW A;  2NUH A;  3J7Y U;  2NR0 A;  4QPX A;  4YP3 A;  1SJ3 P;  2JVR A;  3TOQ A;  2IM3 A;  2UUC F;  4OZN A;  5KFY A;  3MPU B;  3TQ1 A;  1D9A A;  3QGH A;  5A6P A;  4C8K A;  4K5S A;  3TP2 A;  4DSE A;  4B9U A;  5THW A;  3D5M A;  4RL1 A;  4ZKA A;  3R27 A;  3DRS A;  3ENQ A;  1H7X A;  1ZH5 A;  4DF4 A;  2ZD1 B;  5KFE A;  4P7T A;  3MED B;  4LF5 F;  2IDE A;  4KHM A;  2K1R B;  2OH2 A;  3EGN A;  3RJM B;  5BYS A;  4WFB Q;  4NLS A;  4H4K A;  1VK8 A;  4C0O C;  3QSI A;  4ED5 A;  3RR7 A;  1FEE A;  4N47 A;  1BGX T;  1VDH A;  9RUB A;  3HD2 A;  2VD3 A;  2M8D B;  1UEU A;  2CPY A;  2GMH A;  3G82 A;  4MMO A;  5D4P A;  1OQ6 A;  1CS4 B;  1FKO B;  5ADZ A;  1WEX A;  5L1I A;  3WQP A;  2XYG B;  1R6Y A;  3KG1 A;  3KUE A;  4CRJ A;  5K8M A;  2DH7 A;  2K3K A;  4KGX B;  5LMU F;  1MN9 A;  1S0N A;  5BR8 J;  1PGZ A;  3UQS A;  1FX2 A;  3JQJ A;  5I3P A;  1WEY A;  1AZS A;  2YBV A;  3MM7 B;  2HYI B;  2JZ5 A;  1KSP A;  4M5D B;  4B3S F;  1NSK L;  1N32 J;  2OTJ S;  2HIY A;  3SFU A;  4OHW A;  2XCP A;  2A0F B;  2VDI A;  4NLX A;  1ZPW X;  4IRK A;  1Y5I B;  3CCJ S;  3V4M A;  1AW0 A;  4DR2 J;  1FXL A;  2H9Z A;  4I6Y A;  1GXT A;  1WHV A;  3BO4 A;  4PAA A;  2MZJ A;  2K2P A;  4W98 A;  1HNI A;  1R89 A;  4LSL B;  1VLY A;  1X4F A;  1MSW D;  3EXC X;  4AD6 A;  1FTR A;  4EO8 A;  4Q45 A;  3FGV A;  2KHD A;  2QLW A;  3W2V A;  2W2N P;  4CLS A;  4DL5 A;  2V94 A;  2YNH B;  1QE1 A;  2V50 A;  4IR9 A;  3HSJ A;  2O01 C;  2XHW A;  1RAF B;  3QWP A;  4F36 A;  1X4E A;  3P49 B;  1CVJ A;  2OI2 A;  3L09 A;  3D3C J;  3JAM U;  3PRD A;  2HS4 A;  1CJT B;  3DM2 B;  2YKN B;  2ZDP A;  4UUX A;  4NA1 A;  2HHH J;  2YNI A;  1S4E A;  3NXZ A;  3PYD A;  1IM4 A;  4LRB A;  4NI2 A;  2UVR A;  2HVD A;  2MHE A;  1OQ3 A;  4QIV A;  2OJ3 A;  3CDE A;  4FNI A;  2W25 A;  4FVC A;  4DR4 F;  1U8S A;  4DL3 A;  4Y2M A;  1NO8 A;  4ZVU B;  2CQH A;  4DL7 A;  1TU0 B;  4V19 J;  2LQ8 A;  4OV1 A;  4EYH B;  3J7A N;  2UUA J;  1RT7 A;  2ZH8 A;  3BGR B;  2BJ1 A;  1NKB A;  1SJR A;  2U1A A;  3MTK A;  3KLH A;  5L8R C;  1PYT A;  2JWN A;  1TUV A;  2C3P A;  2IIH A;  5T7L A;  3ZNU A;  2G13 A;  2ZVI A;  3GFZ A;  1QUP A;  3I9Z A;  2ALY B;  3Q0A A;  4EO6 A;  1M5O C;  3TVK A;  2WAQ D;  4OI6 A;  3P96 A;  2FJV A;  4QWB A;  1TTH B;  3GIL A;  4IFV B;  4DS4 A;  1VJQ A;  3ZZZ A;  2WTF A;  2GJ2 A;  3W62 A;  1M1G A;  2W01 A;  2YQ0 A;  4F3O A;  3CJ0 A;  3JSR A;  1N5Y A;  1NPK A;  2IRX A;  3I5C A;  4KHR A;  1LWX A;  3MCM A;  5G0R B;  5LL6 d;  2CQP A;  3LGN A;  1NK0 A;  3BYP A;  3DI6 B;  4C8L A;  4CLY A;  4FXD A;  1RQ0 A;  2AD9 A;  4ZIW A;  1R0A A;  4F4X A;  4YQW A;  4X64 J;  3VTI A;  3H4D A;  2DGQ A;  2MKK A;  4KJI A;  1RT4 B;  2EXU A;  1OMS A;  4LBH A;  1WC6 A;  2IDL A;  2D9P A;  1H0H B;  2BRL A;  2M52 A;  5AXL A;  3F73 A;  2J9C A;  2IJR A;  1RLD A;  3D4J A;  2HWI A;  3K7R A;  2N7C A;  3TA2 A;  1E6V A;  1KD1 T;  1KVI A;  4QOT A;  4AXJ A;  3LO3 A;  2DNL A;  4ZDN A;  1FDA A;  4H4K C;  3GYG A;  4UZC A;  3C8Y A;  4JI5 F;  1S9F A;  2RQK A;  3NMR A;  4OI3 A;  1HR0 J;  4Y6I A;  1RTZ A;  2OPP B;  1BQX A;  5C24 A;  3CD6 S;  3HHL A;  3OXL A;  2ZC3 A;  1LOU A;  3ZTR A;  4QR0 A;  3RAX A;  4NLV A;  4Q7A A;  4F7V A;  2ZNY A;  2EBG A;  3ZTP A;  4J9N A;  4Y28 C;  4ED6 A;  3PHE A;  2C28 A;  1URN A;  3R6L B;  2JRS A;  4PZV A;  3W60 A;  3W7B A;  3NWR A;  3S7R A;  3TVY A;  1RA6 A;  1WJ9 A;  4A47 A;  3AFG A;  1AUD A;  1N36 F;  3BQ0 A;  1FRL A;  4F0M A;  3CB4 A;  3FSI A;  2ERR A;  4JI7 J;  4LF7 F;  3NS5 A;  1S48 A;  2X1F A;  3D6F B;  2B4O A;  1NB2 A;  5HK4 A;  2CQ3 A;  3NBP B;  1C1B A;  2IHR 1;  2EFN A;  3QO9 B;  4P2M A;  3CO9 A;  3OVA A;  1UW9 A;  5JMN A;  2FHM A;  5H9F K;  2V2K A;  4DU7 A;  5JJB A;  3EIC A;  3W8G A;  3ULH A;  3PW2 A;  2AT1 B;  1NKC A;  1FRM A;  2BAN A;  3EXY A;  1C2P A;  2OSQ A;  1WC3 A;  3K58 A;  4U96 A;  1PYO B;  2KXF A;  5I3Q A;  3HFV A;  2HQG A;  1D0E A;  1SH0 A;  1NND A;  4UOG A;  3TA1 A;  2CWK A;  3VAL A;  3DLH A;  4WK1 A;  4UOH A;  4OZJ A;  2HNY B;  3C14 A;  2FLP A;  3ELH A;  4DX6 A;  4CO3 A;  4OZ2 A;  1RE1 B;  4ECT A;  3VQT A;  2DR8 A;  1EKS A;  4X4P A;  2HUR A;  4USM A;  3G6X A;  2RUG A;  2OPS A;  3GON A;  1IKX B;  2BDP A;  3P5T L;  1TKD A;  4A8F A;  3KLF A;  2RD5 C;  4A8X A;  2J6U A;  2H5J B;  2MTL A;  2DNY A;  1Y10 A;  3VVU A;  2IY5 B;  2CJB A;  4B3T J;  1U2C A;  3PEH A;  4IG3 A;  3DGP B;  3HHE A;  1H7W A;  3D6T B;  1RKJ A;  3HVA A;  1Q7L B;  2V2Z A;  4P74 A;  4EBE A;  1U2R A;  3IO1 A;  4WTY A;  1KFD A;  4QZV B;  2RHQ B;  1MRO B;  2BJ7 A;  4CO4 A;  2CUY A;  2HWH A;  2DCU B;  2J0Q D;  3CJ4 A;  2QMU B;  2LP4 A;  1YTY A;  2GA7 A;  1GQE A;  2YWK A;  3OV7 A;  3V4I A;  3V6D B;  3IC1 A;  1JLA A;  1X8D A;  1RWX B;  4AE5 A;  2OSR A;  4X4N A;  1Z4U A;  4CLZ A;  2KFY A;  5DRK A;  3R5C A;  2E7W A;  1U48 A;  1QSS A;  2V2Q A;  1RTI A;  2AU0 A;  1H38 A;  1S9G A;  4JI0 J;  3NNA A;  3HSD A;  4DV6 F;  1K47 A;  1F9E B;  3AAW B;  3KHG A;  1HHS A;  5FDL A;  2GHW A;  1XEZ A;  4HH0 A;  2OPR B;  4C8M A;  4X4T A;  4LR7 A;  4I6W A;  1VQK S;  5CD4 H;  4O3N A;  1XNR J;  3J7Z T;  1K0V A;  3GQC A;  3OW2 R;  2FY8 A;  2AGO A;  3C6T A;  1ZTT A;  3NGU A;  1WC4 A;  5T41 A;  3NEK A;  1U0H B;  2IRY A;  4YHH F;  1A7G E;  4F4Z A;  3VWS A;  5D4N A;  4TLQ A;  1SL0 A;  1U6B A;  4EWT A;  1GT8 A;  4QJV A;  1ULR A;  4GKK F;  3BQ1 A;  2C1E B;  4N41 A;  4PG8 A;  5DZ7 A;  3M9N B;  4L3N A;  2HZC A;  5C5J A;  1S6Q A;  2AJQ A;  3RG6 A;  3QJJ A;  2F4F A;  4DL2 A;  7AT1 B;  4O3S A;  4X4Q A;  5RUB A;  4U7C A;  3DXS X;  1DBD A;  4ZHR B;  1HYS B;  2LQ9 A;  1PG5 B;  4PRF A;  3NG8 A;  4NWB A;  1YZ6 A;  3O2I A;  4QBU A;  3BZQ A;  1S1W A;  2KXN B;  3T19 A;  4I2Q A;  5DLF A;  2DY1 A;  3SQG A;  2NQP A;  1WC1 A;  5LMN J;  2W2P P;  2UXC F;  4A8M P;  2QRR A;  6FDR A;  4LF4 J;  3MMA B;  3CMQ A;  3MEE B;  3OR2 B;  3RTV A;  5KG6 A;  4HTI A;  1UA0 A;  5IC6 B;  1WG5 A;  2VG7 A;  2KM8 B;  4ZVE A;  1FFS B;  2XMV A;  4FF4 A;  2RB7 A;  2JOQ A;  3BGU A;  2M8H A;  5KFQ A;  2IJF A;  3W5X A;  2R8G A;  1WOP A;  2HQI A;  5KG3 A;  4O3P A;  3R5G A;  3QIP B;  2PMH A;  1WF0 A;  5CCM A;  1UMJ A;  4L76 A;  2WSF C;  3HFK A;  2KH9 A;  1GX6 A;  5IXU A;  2BYC A;  2ZH9 A;  1YRU A;  4UQG A;  5D0R A;  2ZM6 F;  4B3M F;  5D8H B;  1RAI B;  2IFX A;  4FKX A;  2B8Q A;  5DM7 Q;  3J81 j;  2YXL A;  1TAQ A;  4WE1 A;  4ZVT B;  2FZK B;  3T3F A;  4L3K A;  2Z2M A;  2H4W B;  4DV4 J;  1Q5V A;  4UF4 A;  2WSC C;  1MW7 A;  3CJR A;  1Q78 A;  2Q66 A;  2ZHO A;  2X1A A;  2D3Z A;  3RB6 A;  1BXN A;  2E9R X;  1UCN A;  5IWA F;  3WC0 A;  2DNK A;  1WC5 A;  1HD1 A;  4J9Q A;  4B3R J;  2VFU A;  2GGP A;  3HCX A;  3PJ9 A;  4GKJ J;  1T7P A;  1HQU A;  2UP1 A;  1V6H A;  3PJW A;  2NUU G;  4K5R A;  1FWP A;  1JLG B;  4EBC A;  1NSA A;  2GVZ A;  4O3R A;  4DR5 J;  4J7C A;  2FJD B;  3I0S A;  1GAO A;  2W4P A;  5KG0 A;  5DG8 A;  4WIQ A;  3JTO A;  3U1N A;  2FB0 A;  1O6X A;  2EI5 A;  5EWF A;  3FEY B;  5GMK a;  4FBU A;  5FD1 A;  3BM7 A;  2EVZ A;  4QCL A;  3DLE B;  5KFM A;  1SKS A;  1UP1 A;  4U7U K;  1KQK A;  1SL2 A;  2QFI A;  3I32 A;  4OI2 A;  3W3S A;  2OMO A;  4P75 A;  1KLN A;  3DHX A;  3NOG A;  1C4C A;  2M5Y A;  4TKT A;  5E7O B;  1V3Z A;  4U67 Q;  3TX8 A;  2V9K A;  5ETP A;  5J2M B;  4ZLP A;  2XNR A;  3LF0 A;  1F5C A;  5J2P A;  1JNZ B;  2HLU A;  1SC3 B;  3LQV A;  1VQ4 S; 
#chains in the Genus database with same CATH homology
 4NXM J;  4DV5 J;  4DV2 J;  1J5E J;  3R2C J;  5A2Q U;  4RJV A;  4DV7 J;  4PWW A;  3D3B J;  4JI3 J;  4JI5 J;  3R2D J;  1HNZ J;  1N34 J;  4HHU A;  4DR5 J;  2E5L J;  5LMU J;  4NEZ A;  3T1Y J;  2KVQ E;  3J81 U;  2VQE J;  3D3C J;  3JAM U;  1HR0 J;  3IMQ J;  1XNQ J;  2ZM6 J;  4OX9 J;  4B3M J;  1FJG J;  5BR8 J;  5FLX U;  2UUC J;  2VQF J;  2HHH J;  4B3S J;  4KYZ A;  2UXB J;  4DR4 J;  4LFB J;  4K0K J;  4LFC J;  4X66 J;  4DR7 J;  2UXD J;  3W1Y C;  5AJ3 J;  4DUY J;  4KHP J;  4JI6 J;  4JI2 J;  4DR3 J;  3J80 U;  1N32 J;  5IT9 U;  5LM7 E;  1IBL J;  4KY3 A;  1N36 J;  4JI8 J;  4X64 J;  1XMO J;  4DR2 J;  4JI0 J;  2UU9 J;  4DR6 J;  1HNW J;  4V1A k;  3OTO J;  3J7A N;  1XMQ J;  2UUA J;  2KL8 A;  2UXC J;  2MQ8 A;  4DV4 J;  5IWA J;  4JI7 J;  4NEY A;  4LF5 J;  1HNX J;  4LF9 J;  4NXN J;  1N33 J;  4YY3 J;  5LMN J;  4LFA J;  4DV6 J;  1XNR J;  4LF4 J;  1IBK J;  2F4V J;  4DV1 J;  4LF6 J;  4JI4 J;  4DV0 J;  4B3R J;  4YHH J;  4DR1 J;  4JV5 J;  4DV3 J;  3T1H J;  4LF7 J;  2MEW A;  4X65 J;  1I94 J;  4AQY J;  4GKJ J;  4JI1 J;  2MTL A;  4JYA J;  4DUZ J;  1IBM J;  4GKK J;  4X62 J;  4B3T J;  2UUB J;  4LF8 J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...