2HURA

Escherichia coli nucleoside diphosphate kinase
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
142
structure length
142
Chain Sequence
AIERTFSIIKPNAVAKNVIGNIFARFEAAGFKIVGTKMLHLTVEQARGFYAEHDGKPFFDGLVEFMTSGPIVVSVLEGENAVQRHRDLLGATNPANALAGTLRADYADSLTENGTHGSDSVESAAREIAYFFGEGEVCPRTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of the Escherichia coli nucleoside diphosphate kinase reveals a new quaternary architecture for this enzyme family
pubmed doi rcsb
source organism Escherichia coli
molecule tags Signaling protein,transferase
molecule keywords NUCLEOSIDE DIPHOSPHATE KINASE
total genus 42
structure length 142
sequence length 142
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2006-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 2hurA00
2B8QA 2DY9A 1XQIA 4F36A 2NCKL 2CWKA 3R9LA 3MPDA 3EVMA 3BBCA 3ELHA 3FKBA 2DXEA 1NDKA 4F4AA 5BXIA 4UOHA 4WBFA 1PAEX 3Q8YA 1UCNA 3BH6B 3VVUA 1WKKA 4ANEA 1NDCA 3NGSA 3FBCA 1MN7A 5IOLA 3Q8VA 1XIQA 3FBBA 3EMTA 1ZS6A 1KDNA 3VVTA 4UOGA 3EICA 5CABA 1WKJA 3VGSA 1NSQA 4DZ6A 1F6TA 3WX8A 3PJ9A 2DYAA 1HLWA 2HVDA 2DXFA 3B6BA 2BX6A 3ZTRA 4S0MA 3Q89A 1F3FA 3DDIA 3BBBA 4DI6A 1S59A 3VGUA 3Q86A 1B4SA 1NLKL 3ZTQA 4FKYA 3BH7B 1HIYA 1NDLA 3ETMA 3NGUA 1WKLA 3VGVA 4KPCA 1S5ZA 3FC9A 4FKXA 3GPAA 4EK2A 4CP5A 2HVEA 1S57A 4ANCA 4O0NA 1BE4A 1NB2A 3FCWA 3Q8UA 2HURA 3L7UA 1NPKA 2BEFA 1NHKL 1BHNA 1B99A 3FBFA 4DUTA 2AZ3A 1BUXA 1LEOA 1K44A 3ZTPA 1NSPA 1MN9A 1LWXA 1NDPA 1U8WA 3FBEA 5C7PA 3BBFA 4ANDA 4W98A 2DXDA 3NGTA 1PKUA 3EM1A 3GP9A 1NSKL 3Q83A 3EJMA 1W7WA 3ENAA 2AZ1A 3DKDA 2ZUAA 1JXVA 1HHQA 3FCVA 3JS9A 1NCLA 4ENOA 2VU5A 3G2XA 3ZTSA 4C6AA 3PRVA 5CAAA 3NGRA 3B54A 1VYAA 1EHWA 3EE3A 2B8PA 4HR2A 4UOFA 3VGTA 3ZTOA 3EVOA 3EVWA 1NUEA
chains in the Genus database with same CATH superfamily
4Q5VA 3M8RA 1X4FA 5ETOA 4N76A 2Y1RI 1RDRA 3DRPB 4F36A 4DQRA 1ZA2B 1RCOB 1BY9A 2B4OA 4PPZA 5I42A 1HNWF 1FERA 3JTOA 3ZZRA 2VOPA 2B3TB 3D1OA 3MD1A 3OVAA 1PYOB 4CH1A 3M8PA 2YPZA 2HYIB 4FYYB 4RNFA 3NGKA 3AD9C 1S0NA 3NAIA 2V5HG 1HHSA 4RX6A 2YKAA 1RWKB 2AV5A 4WYWA 3UFCX 5HSPA 4M63A 4MFBB 5HP1A 3T9NA 2HFOA 2IBOA 2MB0B 1FNMA 2DGUA 1R31A 5L1KA 5AE1A 3H59A 4Q44A 5K8NA 5IOLA 3LUYA 4K4YA 1XIQA 2QMXA 1F5BA 2P9CA 1VBZA 4LSNA 1JLAB 2WHOA 2MGZA 1SKUB 1R27B 4IO1A 2AJ4A 2J8AA 5LXRA 5KG6A 2XY7A 2AMCB 2R4FA 5KFUA 5LMUF 4J9SA 2WSFC 4DU7A 2L08A 2R7RA 4ED6A 4L74A 4K4ZA 4DR1J 2BJDA 5BYQA 2HHSA 2YNFB 2C2EA 4IUFA 1U1RA 3CCRS 2OPSA 3HHLC 3M2RB 4K2JA 3V4IA 4JI4F 1CG2A 2DXFA 2VG7B 1LXNA 3QYYA 3BS9A 2WVCA 2QLFB 1S6OA 3ZTRA 4S0MA 5L1JA 4JV1A 4F67A 2VBXA 2WK4A 3HSGA 3BBBA 2IYIA 2IRUA 4MYUA 1VQLS 1B64A 3OR1B 5CYQA 3D4JA 2IFXA 1FXDA 1FTCA 2G9OA 1FJ7A 2OFHX 1JB0C 2FB0A 1B4SA 3A4TA 2UVVA 5EX0A 1ZTTA 2G4BA 3PJXA 4J9NA 1NDLA 1SC3B 1GXLA 1VLOA 1OPIA 2ZNYA 2F4FA 4X4NA 3FRZA 3R5CA 1LV5A 4X62F 3R6GB 5B0GA 3OHBA 4DCJB 3AT1B 3HVTB 4MT1A 1VRQC 4ZLJA 4J90A 1XMOF 3H5UA 4ZDNA 1KLMA 1GXUA 4WPAA 5AXNA 1D8ZA 1AA1B 1L5UA 2AQ4A 3CJ8A 2BV3A 4DV6F 4DPYA 4ILLA 5MAOA 2D9OA 1EETA 2PI5A 3FSIA 3TI0A 4NLXA 2Z58B 1YDLA 3IMQJ 2Z57B 3M6WA 3MEDA 3N5FA 3BV8A 4XDCA 4X4OA 4UQGA 1H0HB 3MM7B 2QE5A 4YB5A 5HBMA 1BHNA 4R25A 4CM0A 1O8BA 4JI7J 1Y5IB 3B8HA 3H42A 3G6VA 2W25A 2MKIA 5J2PB 4R0EA 3T6JA 1U49A 1YZ7A 3FBEA 2V67A 2MKCA 3I0RA 5C7PA 3OL6A 3VAMA 3J80Y 3PHTA 3SQGA 2BR0A 4DR6J 2NUUG 3DOMB 1KR4A 3HHLD 3K8WA 3ILJA 4RL1A 4FS1A 3ILLA 4OI2A 1HNXJ 2EC0A 1W7WA 1YSJA 4QR1A 3QZ7A 2LXIA 1C4CA 2VL1A 2V6AA 1MWYA 3PX4A 3KLFB 3UD4P 4JI3F 1IQZA 4HKQA 5JJBA 1WDDA 1PJ7A 2XHCA 3SSRA 4LFCF 1ZH5A 1VGYA 2V2ZA 1RHJB 3SCLE 1SBRA 5KG2A 1QTMA 4B3MJ 4LF5J 2KI2A 4NZ0A 1FKPB 3CCTA 4PXCA 5HVHA 5KFJA 4NCGB 2JVRA 3IG1A 3CCMS 1U1OA 3OTOJ 2XLKA 2RIJA 5D15A 2BMBA 2BRLA 2JEFA 5DG7A 4N47A 4JB8B 2KHCA 4HR2A 3KK2A 5IV3A 2NSCA 4TY9A 1KQGB 1T0TV 4ILMA 3M8ZA 3HLUA 1KTVA 1EP4B 4DV1F 2FVPA 1WORA 4O3QA 4DV3J 1S1UB 2FVCA 1XQIA 1TL4A 2CXEA 2BBEA 3ET6A 2XMAA 4USKA 1RAGB 4LFBF 1U0HA 1UJ5A 4EO8A 2JLGA 4XPCA 5HROA 4IRDA 1JLQA 2WOMA 4X4SA 2BJ1A 3FKBA 2CPJA 2HFUA 1RTZA 1SQFA 3KG0A 4NYOA 4DR1F 1VQ4S 1RSCA 4PXBA 3M2UB 4WF9Q 2CA9A 2Z2MA 2Q3PA 3VVUA 4IQXA 4Y2AA 3B78A 3V2UC 5KG5A 4NMXA 3IAM9 1Q95G 4CO4A 2KM8C 1YBAA 1A0OB 3LF0A 3ETOA 1Y10A 2WSEC 5KFWA 4FYVB 3QWUA 1RTJB 4DEZA 5IV4A 2E5HA 4J9MA 3K5PA 4PWWA 1YITS 3ITHB 3VCDA 3LGNA 4BLGA 4YS2A 2CQGA 1V3RA 4ZCIA 2PA8D 2R7XA 4DSIA 3CT9A 2YNFA 2ZH5A 4DPWA 1M5SA 1OQ3A 2OPSB 5HN0A 3OL7A 1UA0A 3IGVA 5JXSA 3FJ2A 1UFWA 3H98A 2YWGA 1S9GB 4OIXA 4WP9A 4ZPAA 2KHDA 2DYAA 3GFHA 2YNIA 4O0IA 5D4PA 2HHWA 2F8HA 4J7CA 5KFAA 2EKNA 4B3TF 2I5JA 2JLEA 2MEWA 4ZP7A 3M1VA 6AT1B 3PY8A 2DGXA 1RBLA 2ZJPQ 1KHVA 1PC4A 1F3FA 3Q24A 4RUAA 4P2MA 2BOPA 3L7OA 3MTKA 2V68A 4Y34A 3QJLA 1HBUB 3F56A 2CNKB 2ZZMA 3VGUA 1V5IB 2AJ2A 4O3PA 1FO1A 1GTHA 4OI0A 3QGGA 1X8DA 1FK9A 2OMOA 3PEJA 2HVHA 1HWKA 3B4DA 2EXUA 4WXWA 4WE1B 2UUCF 3D9BA 3AODA 3CCVS 3IWXA 3RG6A 4WIQA 2N3LA 5DLFA 3PTWA 2H48B 3MPYA 4YUDA 4DV0F 4M95A 3UR3C 1XN9A 3LA0A 3GE9A 2AEMA 4YOEA 4PWDB 2VIHA 3T1HF 1HNVA 4PCQA 2NUHA 3HDSA 1UW4A 3MM6A 1KLMB 2CG8A 3D54A 1HKAA 2EFOA 1YJTA 1FNOA 1YRXA 3U1NA 3GJSB 4I7FA 2VBZA 3OTCA 4MMOA 4M5KA 4ZKAA 3KHGA 1NKEA 3QRPA 1FJCA 3CD7A 1I1GA 1Q16B 4U8YA 2X1BA 1B0VA 3DXSX 2HQGA 2ZBQA 3PM9A 2ZE2A 3QFHA 4KH1B 4U96A 3NMRA 4LF5F 1K44A 3HFVA 3BREA 1TV6B 2GHPA 2QSWA 3GV8B 1VQ7S 1F60B 4K50A 3HD1A 3O3LA 4RW8B 4F50A 1KVJA 3THVA 1SI9A 4CO5A 2OEMA 1UA1A 2RDJA 1WHXA 3TNVA 2GVDA 1CJVA 4ZP9A 1YJNS 2A10A 4LF4J 3UDCA 4BHQA 4CTAA 5K20B 3MR2A 3Q83A 5KT5A 1R89A 2UUTA 3GYXB 3PW5A 1N52B 2RILA 2MZRA 4RUCA 3MMJA 2ASDA 2CJ9A 2G0IA 3CCES 4OHXA 3TWZA 2PFDA 3CNQP 2GHVC 1SQGA 3U27A 3DOLA 5KTQA 3GCXP 2IA0A 2RVJA 1F1BB 4RW9B 1XERA 2IRYA 3MAAB 3ENWA 4CO1A 3Q8RB 1VLYA 1XJWB 4IFYA 1S0OA 4CLUA 1A7GE 5IS2A 3S01A 4DQQA 1P9YA 4ZVOB 5B0DA 4MTPA 2KB2A 3M32B 4NLDA 1SC6A 3ZNJ1 1KFSA 3I9ZA 1HNXF 4XDDA 4URGA 4M94A 3HJVA 4Y28C 4NZ6A 4M5GA 1F9HA 2DT9A 2QZ8A 4IG0B 2CWKA 2YX1A 1KFDA 2XY6A 5LM7E 1FRIA 2BE2A 3MGJA 1WC5A 2CJYB 2PMWA 1VRTA 2QT7A 4TXSA 2KXNB 2ATLA 2GS8A 3K89A 5BXIA 1FJEB 2MQLA 1SIWB 4CDIA 2OFGX 3M4XA 3UVJB 4E2FB 4XK8C 1WHWA 2ZVIA 3I4PA 4DG1A 1YJWS 2HZVA 1R0CB 3A8JA 4NA3A 4QJVA 5IC4B 2R7WA 4UY85 3OTEA 2EPIA 3JQKA 3L09A 3IFEA 4RW6A 4DR7J 3EGNA 3JB9k 2BACA 3ISZA 2GJFA 1BD6A 4ETXA 1LWCB 3IRWP 2HWHA 4USTA 2MSSA 1HQUB 1RE1B 3GSIA 3MPUB 2GHWA 2FZCB 2J8SA 2BANA 3FDSA 3NNAA 3SYZA 5DDPC 3HT0A 5CABA 4DL7A 5JVGQ 2IDLA 1ZETA 3RRGA 3UN3A 4FXVA 4OI4A 3TZYA 2HWTA 1C1CA 4KT0C 3WX8A 2G1DA 1DRZA 1PYTA 4NPOA 4OI6A 3IP0A 5AE2A 4F0KA 2BE9B 4WU3A 4YY3J 4HI1A 4F3OA 2FHOB 1DLOA 3I4HX 3Q89A 5HI7A 3AQPA 3QRRA 3TYTA 1OJ4A 4MK8A 5B0CA 5HO4A 2HRYA 4ZVSB 2RDIA 1U1LA 1OWXA 3UN5A 1HA1A 3MM9A 2FY1A 1OY9A 4IH5A 3MCOA 4TU9A 5DM7Q 2W1BA 3I0RB 4P72A 2IMWP 4TQSA 2J7UA 3O8WA 4WK1A 3AOAA 3PRDA 3TAPA 4MIWA 4RNOA 3G8TA 2UU9F 1X5TA 2XYGB 2X1FA 3HK2A 3O6QA 2C3MA 2RU9A 2QA4S 2U1AA 2EI5A 4DR3F 3MURP 2DIUA 1H2VZ 1WTBA 2X1GA 3FFIA 3Q2TC 3CCZA 4FXDA 1URNA 1EAYC 5IM0A 2FDNA 2HIYA 2VPZB 3W9IA 4U8VA 4DR2J 3VR1A 1BLUA 1UTAA 1RI7A 2WVFA 3C6TB 4Y2MA 5D4LA 1OYDA 1IUJA 1JNZB 4FXWA 4RW8A 4Y2CA 2DHAA 3TA2A 5HVGA 5F9LA 1RJJA 1LEOA 3LANA 1I94J 4KIAA 1S72S 2HHXA 1NSAA 3PXGa 4ECWA 2ABYA 2CPYA 4ED0A 2CPHA 1U8WA 1HBMA 4J37A 1RK8A 3DRRB 4B3TJ 4USHA 1S99A 2VPYB 2CQPA 3WDOA 1T05A 2ZHBA 3CC2S 1N33J 5A0YB 4NI2B 3HJFA 2GIFA 3BYPA 1TKXA 3C14B 4KHMA 1NJZA 1VI7A 1AFIA 1DJ0A 4WXOA 2RHSB 1TL1B 1Y7PA 2QA1A 4MK9A 2FLPA 2MGZB 3G8QA 1SUQA 2M8HA 1AUSL 4WKRA 1NCLA 2MZQA 4TN2A 3G2XA 2DPJA 3PRVA 5KFRA 3K5LA 3KOAA 3G8SA 2V2VA 3A8IA 4X64F 3J7ZT 3MUVP 2UUWA 4RWWA 2E66A 3EE3A 4WZQA 4V19J 4X4TA 4DL6A 1RYSA 1HI0P 1WUUA 2GIQA 3BO4A 3MEEB 3JYTA 1OYEA 2UUBF 3LP2B 1YHQS 3G82B 1FVSA 4FBTA 2LEPA 1JQGA 1RT4A 5AE3A 3UE2A 3J7A1 1FKOA 5D6GA 2W2PP 4I7FB 5KT3A 2CVEA 3Q0AA 2HQDA 4EZ6A 3KTQA 2XCAA 1RT1A 3G6YA 3KK1A 2D69A 1MMDA 2ZWOA 2COLA 2ZE2B 4JI4J 1RP5A 1JLFB 3RB4A 3QFWA 4OJ3A 5EWGA 2VA3A 2WVBA 3CO0P 4MKBA 3RUBL 3K5OA 2FGCA 4LF4F 1S1TB 3POTB 1LWCA 1QAIA 4FF1A 4J9OA 3NGSA 3FBCA 1DTTB 2DNPA 4ZVGA 4LBHA 2IVFB 3R8YA 4GVBA 2DGTA 1PJ5A 2AYEA 1FK9B 5B08A 1IWGA 1S12A 5B0EA 4AQYF 2UV8A 4DS5A 2XI2A 3CCQS 3W2VB 4UOGA 4WKYA 3CJ5A 3UCUP 2BRKA 4NA1A 4I2QA 3IWLA 1NRKA 2VBWA 1IBMJ 4ZS6A 3TZXA 1Q0NA 2KVQE 1TP7A 3GIJA 1N34F 1TVRB 4TY8A 3IR5B 2D7SA 2BDPA 1SCJB 2KVIA 2CWXA 2L9NA 2PDAA 3DRYA 4DN9A 3EYZA 1K9MT 3QRQA 2HNDA 3IM9A 3CCWA 1U47A 1QSLA 1TQLA 1NZAA 1YQHA 2B5JB 4DV6J 3DC2A 2LEBA 5ITHA 2PN6A 4ZLPA 5A2QY 1Q78A 1RTJA 2E7VA 2FHKA 3MR6A 5KOXA 3UCZP 3D67A 3DDNA 2D41A 2MY8A 2B7CB 3TAMA 2V69A 1JLCB 3D0HE 4LREA 2FZKB 2OSRA 1TFYA 2QV6A 4NZ7A 2C3OA 1S6PA 3R2CJ 3HCXA 3QLHB 2KYZA 5CD4A 4WTYA 3DM2A 4JBCA 1R43A 1HHTP 4JI6J 1S49A 4KHRA 1VRTB 1WKLA 3QSIA 1V9OA 3VGVA 2C1EB 3C2PA 3GJQB 1LWEB 2B9XA 4MFBA 2E1MC 3EZ5A 2FLNA 2XWXA 4AT1B 1DQ9A 3MUMP 3AOBA 5FDLB 1WEXA 2JH3A 3DU5A 4CYUA 3S8SA 3GIIA 3VALA 1JLEA 1IQTA 1Q53A 1S4FA 2M5YA 2ILZA 4CNZA 4YR2A 4ED8A 5E5NA 3HPOA 4O0NA 1R0AB 3UDEA 2DH9A 4J9RA 2AEFA 1PC5A 4DL2A 2CADA 2XWYA 2AX0A 3TX0A 3IS9A 1RBOB 2V4JA 2MQQA 4F26A 4PQAA 1RHKB 3KLGB 5KFFA 2F9JA 2YWFA 2UUAJ 1NSPA 3N6MA 4QIWD 4Y2IA 5HATA 4V19X 2JC1A 5A0YA 2MTLA 3HHDA 2EFPA 3MMAA 5AJ3F 2UXDJ 1AXQA 2LECA 2ZJRQ 2J7KA 3H2VE 1CJUA 2IAJA 1TMMA 4MH8A 1SJFA 3JAMY 3EJMA 3M7VA 5G0RB 4WFAQ 2IA6A 3OT9A 2H4WB 3ENAA 1REVB 2YY3A 2XHWA 3CDEA 2R8JA 4MIBA 2L48A 1MMLA 4KFBB 3TUIC 1HI1A 2CQ4A 2DNRA 4WFNQ 2HMIA 4TVAB 1TKDA 4ZK7M 1TV6A 4W92B 1VHIA 2W2MP 1GEHA 3D6TB 3PO4A 1SB6A 1SH2A 2FJBB 3MEEA 4ZJQA 3PX6A 2LA4A 2W2NP 1SV5A 4LFAF 2CJBA 2F65A 2LVWA 3E51A 3LGMA 4QWCA 2B8PA 3MM5A 3H5SA 3E2EA 4IFVA 3I32A 3KJFB 3ZTOA 1X5OA 2PI4A 2L3MA 3AHPA 3P96A 4NL5A 1A9NB 1V3ZA 3EXYA 4HT5A 3ISNC 1FVQA 2HLTA 1PILA 1ZBTA 4K2XA 1PSDA 3P5TL 3PDNA 3SQOP 5J2MB 2AD9A 4NXNF 5D4NA 4N77A 2XEXA 2K7JA 2G13A 2VASA 1ROFA 3NEKA 3BO2A 2ZEJA 3AJ1A 3EDRB 4EEYA 3THPA 1MW7A 4WE1A 4A4JA 1DLOB 5FLXU 3CUNA 2XGPA 3R2DJ 1NAQA 2BM0A 4I2PA 3S7RA 2EG2A 2VG6B 2ZC4A 4LSLA 3MM9B 1UWBA 4NRUA 4B17A 1FJGF 1APSA 1KN6A 2EBGA 4OYAA 4DV2F 2IDEA 3W5YA 1K0VA 4DN0A 2QA4G 4ZVTB 3A8KA 4I2QB 4AXJA 1TKTA 3M6UA 1YBTA 1RAHB 2R7QA 1X0PA 2N3OA 4ECTA 4LUBA 4CNYA 4JI7F 4JV5J 1NU4A 4OZ5A 1TK0A 2HVIA 2GGPB 1IKYA 1J27A 1RT5A 3PYGA 4HLBA 1JJHA 3SCIE 5C2GA 2OGUA 4U67Q 5DGAA 4Q8FA 3CWJA 1YKWA 5KFDA 4NLRA 2AF6A 4DHVA 1Q82T 3L95X 1BQMB 3FUYA 3CW2C 3EUNA 3LP0A 4ZPWR 4BWJA 3SZ2A 1J5EF 3MEGB 2W9AA 2XGQA 1AUDA 1YWXA 5D8HB 1UFKA 4FNIA 4IOAQ 1TUVA 5LJ3Y 3CCSS 4JI1J 1EARA 1DBDA 1URRA 2VG5B 3K2YA 4U9RA 4CTAB 5C25A 2V34A 1FX4A 4DFPA 4JV2A 2B5JA 3TJ9A 9RUBA 3M8QB 2J9CA 2ZJQQ 2YNHA 1JJ4A 1D8YA 1U1KA 4M5IA 2VC0A 3FQLA 2M4MA 2ZD1B 3BDEA 3DRRA 3N01A 4DXLA 3HO1A 1M1GA 3J7YU 2RT3A 1U1NA 1F2GA 1X4CA 3D1HA 1JK9B 3W7BA 4A47A 1EKSA 1FE0A 5LSRA 3MXHP 3H40A 1RLCL 3OSNA 3CPWR 3ZZYA 4KSEB 5FDLA 5DZ6A 3NP5A 1JJCB 3D5MA 4KPCA 4C0HA 1DZ5A 1RT2A 5ADZA 4P74A 7FDRA 1RTHB 2ZITA 2VJVA 4ECRA 5KAKA 1R0BG 3HX9A 1CQMA 1T7PA 3UPFA 4N41A 3C6UB 1U48A 4EBCA 1S4EA 2VC1A 1LWFA 3BGRA 4C8MA 4D3GA 2KG0A 4NE9C 1VJQA 3GYNA 3U7JA 4CP5A 2AX1A 2HRTA 4TLQA 4X4QA 1J2VA 1X4BA 4YHHF 4TU7A 5ETNA 2BUNA 1UP1A 2G0JA 2VFSA 5SZTA 1PYSB 2K3IA 3ADAC 3HVWA 5CCMA 4DSEA 3BDPA 3M8PB 5DGBA 2GO8A 2ZBPA 4QYZJ 4RBVA 2IMOA 3G82A 5LT5A 1ZPVA 3GR1A 2BZ2A 2ZM6F 5J2NB 4R8UA 1YG0A 2CPZA 3VQSA 1YJUA 2K2PA 1XNQJ 3ZZ0A 4RZRA 3PX0A 2FJXA 4F2RA 2FD2A 1E6VB 2W8KA 1G6BA 2ZHOA 4JI2J 2HHTA 4DX5A 4K0KJ 4IH6A 3OBIA 2A2DA 2BKNA 2C2ZB 5H9FK 2XO6A 1H72C 3P3DA 2R8IA 5ETQA 2M8DB 3NCRA 1F9EB 2ZUAA 4B3SJ 3SV4A 2OLWA 2IM2A 5MLCV 2HWIA 2NQPA 2ILYA 1Z2ZA 2O01C 4G65A 1HNWJ 2C28A 4L73A 4NWBA 4GVLA 5HLFB 2R2UA 4DR4F 4PEOA 2CNOB 3M8WA 1RAJA 3VAIA 3H2LA 1BWEA 1BGXT 1NM2A 1DTTA 3BB5A 1VJWA 1FFSB 1S1WB 1ZAVA 3SQGB 3MR3A 4K4XA 2UUCJ 1QAYA 2IVMA 1OS5A 2V8PA 3P4UB 3FK4A 4I1TA 4YEAA 4OJHA 5DJBA 4TQRA 3L3CA 2MKHA 5GAGI 3DFEA 3M2VB 1GTEA 2XLIA 3HXMA 3PZPA 4CQ1A 3HVRA 3RAXA 3MF5A 1T03A 3GV7B 4GKKF 1N8RT 3WZ0A 2C2OB 1RT3B 2R2TA 5EWEA 3JXOA 3MMBA 3R9LA 4LF2A 1E6YA 2CPFA 2ZC3A 1JKHA 4DCPB 3R5AA 3AAWB 1U25A 2UXCJ 1RKIA 2NPIA 1AFJA 3PFOA 5AT1B 4WP8A 1SH0A 1P27B 1WG5A 2FIUA 3KKFA 3VF0B 4QYZK 1UWBB 4F4AA 4B02A 4WBFA 2W2OP 3BSCA 2JLFA 3ENQA 3QWPA 4NASA 1CEZA 2OUGA 4F04B 3HP6A 3D6MB 3OJSA 5HQMA 3L4BC 4ZIVA 1RZMA 2M2BA 5KFHA 2C2DA 3QO9B 4C8KA 3R7SB 2MXYA 1HPZB 1XNRF 3I96A 2QLWA 1FRLA 1GNKA 3BR9A 1ZM2A 3CDAA 3EPIA 3K7RA 2OAUA 4J9UE 1G7CB 1RAFB 1T9TA 2PMZD 2HHUA 2LQ9A 3VVTA 5DDQC 1KS2A 1H38A 2DY1A 2GC8A 3D2WA 4MKYA 1FRMA 4LQ9A 2HAFA 3TA1A 1R8HA 1HW8A 4RW9A 1Q7YT 1F6TA 2ZBRA 3GG0A 4URQU 4U7CA 3OFGA 3MR7A 3ZNUA 1HLWA 1IBKF 1UEVA 2VODA 2HBQB 2JHEA 4C4WA 1SV5B 1FJGJ 3SEOA 5IC6B 2AIRB 2BX6A 3GSDA 1WC4A 2DTJA 2H1YA 4M5DB 3W3SA 3OR2B 5KFKA 4GVBB 2DCUB 4OHVA 3GG1A 5IQQA 2QX0A 5CYMB 4YQWA 3K5MA 1Q8LA 4YB6A 2YQ3A 4BBYA 4X4PA 3QATA 1ZM3A 2K1RA 5F8NA 1BQNB 4IG0A 4M5HA 4OZ2A 1CS4A 5H9EJ 4WFXA 1NB7A 4Z2XA 2PT0A 2I2YA 3UQSA 2QGFB 1N36J 4JI6F 2AGQA 2Z8QA 4G1QB 5A8KA 4LT6A 1HNIA 4OV6A 4J9LA 3CC4S 1CJUB 4KGZB 2DPIA 1QVFR 1XR5A 3DMJA 2A18A 2K3KA 2Z4PA 5B0FA 4ZCMA 1Q86T 1S1VB 3V81B 2E7WA 2ZDPA 2VG6A 1CJKB 3PV8A 3KDNA 1G1XA 4LF1A 1M1KT 3NCPA 4HACB 3DYAB 5J2QB 1YJVA 2ZKTA 3AXMA 3J81Y 1D0EA 1HNZF 2DRAA 3UD5A 2D3UA 1DARA 1WG4A 2I0XA 3F0NA 4ED2A 1YJRA 2MHNA 1Y9OA 4UUWA 1FESA 1KQKA 3CCJS 2Y9HA 5DDRC 3BQ2A 3KJNB 2HNYB 1RHMB 2HFVA 2DNNA 2XMKA 4DUTA 4ECXA 2AYGA 4DR4J 1B0PA 2QTWA 1IKWB 4DFKA 1EX8A 1MN9A 4C8LA 1NXIA 3Q8QB 1IBLF 4LF9J 4OX9J 1JLQB 2WOMB 3KNGA 3NAHA 2YNGB 5KT2A 4MIAA 4KO0A 2DHSA 1WOSA 2DD8S 5CYQB 4PG7A 1FCAA 1GFWB 2MPUA 2FJEB 2PGCA 3M2UA 4F7VA 1WF0A 4YB7A 3EM1A 1JLEB 1NSKL 3VAKA 9ATCB 2A3JA 3FSYA 4ED1A 4C8OA 3BQ1A 1A6LA 2C22A 4I6AA 5C24B 2IJNA 1U1QA 2FVSA 4ID5B 1S1WA 3RYLA 4B08A 4ENOA 2CQDA 2D3O1 2HBRB 1S9GA 4CLTA 2CQ0A 5CAAA 4CLFA 1SJ4P 2YKMB 2Z2LA 1S6QB 2HZCA 4K5SA 8ATCB 1IM4A 4PABA 4YR0A 4DR3J 2FC8A 5HLFA 2LEAA 2AJQA 4Y2KA 3ZZZA 3ZFVA 1M5VC 2B9WA 2R7UA 1NK4A 4EBEA 4UOFA 3TOQA 4OYBA 4CT9A 3H20A 4DU8A 4DF8A 4CCHA 5GADU 3DLLQ 5J1EA 4ZLLA 4OX6A 3EWGA 2Q79A 4A8SA 3PW7A 2ZOMA 4K8RA 3P45B 2ZDOA 2QIFA 3LP1B 3TRGA 1YRUA 2B7BB 3GONA 3MPDA 3UI3A 1S1UA 2A2CA 1SC4B 2OTLS 3EVMA 3NBPA 1S0VA 3FGVA 1DY3A 2VH7A 5ETRA 5C25B 3PW0A 1IBKJ 1VR6A 4UOHA 2HQFA 1X4GA 4TKTA 3CDWA 1D3WA 3BGOP 1H7XA 4CLLA 1IR1A 3DLGA 2VFTA 2YX7A 3AXKA 3R5GA 1T11A 2B51A 3NCQA 3RU0A 3K5NA 2UXDF 4ZHRA 2R8KA 1ICEB 2JOQA 4EGLA 3GTYX 3JSMA 5A8RA 2AU0A 2FJAB 5L1LA 1LFWA 3EICA 5K8OA 4IDKB 4XPEA 3ITHA 1RACB 1U2RA 1VFJA 2N82B 4PYDA 4Z37A 2IJFA 1VQ9S 2OI2A 4OJGA 1WKJA 3C6UA 4P2XA 1PO6A 2DIVA 1RAOA 3W2WB 5I3UA 2OP5A 3T5JA 4UY8T 2KTQA 5KFBA 3GU0A 3DCAA 4LQ3A 4PXDA 5GAGU 2QO3A 5HAOA 1K1SA 3RTVA 1OIAA 1HNZJ 2EWHA 2UV8G 4N56A 4NOHA 2GAGC 3KJQB 1RWVB 4DL4A 1YGYA 3C46A 3CB4A 2BANB 2B6AA 2ROGA 3V4MA 4AUKA 4B9UA 1KKHA 5M2PA 3H4DA 3CE8A 4CH0S 4R8UB 3BSOA 1RT3A 1WELA 2IVYA 4GRSA 4USWA 5E3AA 1FDNA 1LFPA 3HHLB 4H4KC 4KV8B 4DWIA 4ZCLA 5GAHI 4DSJA 4QIEA 4USMA 5LSOA 4DSFA 1N6QA 1VBKA 2N4CA 1N0UA 2E29A 4PWUA 4BS2A 2FLOA 5EWFA 4JI1F 4LF7F 4YR3A 4WJBA 2BKOA 2GVZA 2H51B 2X51A 4OHZA 3K58A 1AZSB 3QO9A 2X1AA 2C3YA 2M52A 3UN2A 3ZZUA 3CJ4A 2IYGA 1RWNB 1BE4A 3QT5A 1MSWD 4PQUA 2ZH8A 3W2VA 5BR8J 1QSSA 3KLFA 2FGOA 1NHKL 2DGWA 3T1YF 1GMWA 1OPZA 2ZVSA 3KUGA 4X66J 2Q66A 5D3GB 2CPEA 3M1VB 4RLEA 1ULRA 3UCGA 1R7IA 4ZIWA 2H5IB 4ZPDA 2JSXA 2E7XA 1Y5LB 2WZ1A 2YVSA 3ILOA 2OO4A 3VAJA 3I5CA 2W7OA 3EGWB 5KFOA 1XMBA 1RWMB 4PXEA 2CKWA 2CUYA 4OYWA 4F3QA 2ADCA 2IY5B 2MZJA 2GVDB 3AJ2A 4AD6A 3LGHA 3PYDA 2BQUA 2ALYB 3LOUA 4I64A 1S48A 2OH2A 3O44A 1I51B 4XAKA 2KYXA 2WONB 1XNRJ 5K5MA 1SKWA 2RS2A 3TO8A 1RYRA 2CPDA 4NCAA 1EHWA 2N7CA 2FYXA 4OI3A 4QIFA 1JMTA 1H74A 2CRLA 1D9AA 4ZJOA 5CHCB 1LKZA 2J9DE 3E3XA 3RW7A 3TVZA 3LPEA 3D3BJ 3BO3A 2RH3A 3N0VA 5EUHA 3B82A 2E5IA 3JSBA 5IXUA 2GFFA 3H25A 4OZ1A 3DYAA 2QMUB 2OPQA 2CZ9A 4RNHA 2JRSA 1RT6A 4OLPA 4JI8F 3B4MA 1PGZA 1QAXA 3IGNA 4DX6A 1UAWA 2VKZG 4IKAA 2MDAA 4NLYA 3PO5A 1NK9A 3ICLA 2DXEA 4LSZB 2B9YA 5RUBA 2V8GA 3I82A 4J9VA 2HNZB 1QE1A 2W01A 3NOGA 3DLEB 1LW2A 3BN7A 1PAEX 3R6LB 5ETLA 3W1YC 3ILIA 2OTJS 1T3OA 3MMAB 2JWNA 1Y00A 5AJ3J 2K1RB 2J0WA 3NMAA 1W26A 5KFYA 1RGVA 2L41A 2ZH1A 3PEHA 3BGFA 2DO0A 1C2PA 3Q8VA 2CDQA 3DXBA 1WF2A 4G1QA 3TA0A 5A8KB 4KFBA 4Z7CA 3Q8SB 1S77D 2OELA 2C2NA 1HBUA 4LSNB 1SC1B 4LRFA 3W8GA 2PO4A 2P6SA 5ETMA 4C3MA 4B3RF 1LK7A 4P6QA 2DNOA 3OL8A 3BSAA 4DZ6A 3QT6A 3BPDA 5D4OA 1CQNA 3POTA 5KFZA 4Q0BA 2VUGA 5GMKa 3PKYA 2H5EA 3ENVA 2GA7A 2FQQB 4QQBA 2XG8A 3H5YA 4DV4J 1IKXA 4OX7A 4EYHB 1KSPA 3OUYA 4GKJF 4BC7A 1NK5A 1UMJA 3T19A 3DHWC 3CJTA 2XSJA 2Y0BB 1N5QA 3N79A 5K14B 1SQEA 1SUQB 1N0VC 3C19A 2CAJA 4GC7A 1JWWA 2LXUA 1NLKL 2B6AB 1BQXA 2CDRB 3AD8C 3IM8A 3OHAA 1UPMB 3TQEA 3HMJG 1OMSA 3DLBA 2HVZA 4B3MF 1X4HA 4B9TA 5L8RC 1DTQB 2IHR1 2CZ4A 1ITPA 4DV5J 2JVOA 1QY7A 4ZPTR 4ES1A 3K59A 1KEKA 4ED3A 3T5KA 2QLJB 1FDDA 5IQ6A 4OYMA 1CJVB 3W64A 4O23A 1L3KA 4KB7A 2P8IA 2N4DA 5A76A 1C0TB 1HYSB 2HQCA 3G87A 2G2ZA 1FDAA 3FCWA 3MWBA 3KJVA 2CJKA 4ELTA 3GCWP 2V0NA 2BEFA 2EG1A 1RTIA 1D9DA 4B9SA 1TL3A 5CZXA 2GQCA 2RDDA 2D3ZA 2E5JA 2Q6CA 3DDKA 3GFXA 3KDOA 3K8VA 2MKJA 3DOLB 4ICLB 4LR8A 3R5BA 1NDPA 2WVDA 5F8LA 2CPIA 3I31A 1TK8A 1PAUB 5BJRA 1WTFA 1T9WA 3V81A 2CZVC 4QBUA 1B3TA 1VQSA 3KYLA 2HFNA 4KYZA 3FMBA 4HTIA 2D9PA 1X9WA 3EZOA 3GP9A 2HZAA 1C4AA 5T41A 2DO4A 4I56A 4XTTA 1ELOA 1HBNA 1K47A 2ZWPA 3DKDA 4OJ1A 4UT4A 1RAAB 3M8YA 3QZ8A 2VJUA 3V6HA 3OVBA 4DJBA 2AHOB 4B3OA 4LJMA 4RJVA 3LTOA 3W8PA 3CULA 4CLPA 5KT4A 1J5OB 4U95A 2GNKA 2KT3A 3TZWA 1N54B 4PZVA 1MNEA 3WX4A 4F0HA 2MQ8A 5KFXA 3CC7S 3W5XA 3S1TA 4AFFA 4YDXA 4RUHA 3NS6A 3JSMB 4UTGA 5HP1B 2QL7B 4MYTA 3VGTA 3R5JB 5LXYA 1YJ7A 4ZA1A 4DUYF 1P1LA 2Y3YA 2I1RA 4X84A 2MKKA 1NK8A 3I9V9 4C8YA 2AWZA 3OSPA 1FF2A 1Q4RA 1IM6A 1LXJA 5H9EK 2NCKL 4DUZF 3M2RA 4M5MA 3V4IB 1C0UA 2HNZA 2MHEA 3I87A 4NYPA 5IT4A 1LW2B 3MFIA 1T95A 3M9NB 2QFIA 2XMJA 4I0WA 1FD2A 4CLKA 3J80U 4DX8H 1NDKA 1I94F 1M90T 3NXZA 4QU7A 1T8EA 1GT8A 1ZAWA 1BXNA 1QDUB 1S1VA 2ZBIA 2O3DA 4U6PA 3NNCA 3PYFA 1FXRA 2R7SA 1YRTA 2HGLA 1DQ8A 2VFUA 3QAEA 5D0EA 5KFTA 1OO0B 4QR0A 1F5CA 4NXMJ 1N32J 1IVZA 2WCXA 2DNQA 2HHVA 4G1PA 4WFZA 2ROPA 4ECVA 2XMUA 4Q8EA 1P9QC 3T41A 3WBZA 4BC9A 1Q1KA 2LCWA 2MSTA 2PD1A 2V9KA 4NLOA 1C1BA 2NPFA 2BYCA 1F9FA 4K4SA 1TTHB 3CSKA 2LP4A 2YKNA 3OQ2A 2V4JB 3GIMA 2FVQA 2Y1JA 2A6MA 2W8LA 3RBEA 1FDBA 1UW9A 2YNIB 4C8ZA 5JMNA 2XMMA 3T1HJ 1VQKS 2E9ZA 2DR7A 1VQMS 2HHPA 2M0GB 3TQ1A 4FF3A 4BDPA 2BOAA 2APOA 2DRDA 2NYHA 5LMNJ 3JQMA 2HAIA 4LR7A 5HJXA 5GAEU 4P75A 4ZMMA 4DSLA 4DCOB 1VMBA 2AEJA 2RUGA 5KFNA 2IM3A 2G2YA 2HGNA 3C6TA 3ISND 3FVYA 3NS5A 2KT5A 3X1LB 3PHEA 4PUOB 1KVIA 4MK7A 3UR0A 2EFVA 1H6KX 3KG1A 4DMZA 5KOWA 4TYAA 2DGSA 2MQOA 1S97A 4P73A 2L9DA 1JLBB 3ZZPA 4DV1J 3NKYA 1YBUA 4KH0B 4JI5J 2G1HA 1VHFA 2FC9A 3PACA 5J1NA 2KDOA 3TP2A 4YFUA 2SXLA 4JOUA 3GPAA 2J76E 3MECA 3G6XA 3AH6A 4MKVA 4DSKA 1TL7B 5M2RA 3AB4B 4AQYJ 2QSFA 4FPRA 4ZCKA 2K7KA 4DPUA 1FX2A 3L9ZA 2M7SA 4DFMA 3AA8A 1FA0A 1PJ6A 2KT2A 3KK3A 4C9DA 4NLSA 2AZ3A 2DK2A 5F0WA 4RNNA 4B9VA 3ZTPA 3QJPA 1TL3B 2K8GA 1LWXA 2J5AA 2CQHA 3CDBA 2DR9A 3UD3P 3W63A 2GMJA 2OPQB 1MROB 1T9VA 4NLGA 3E01B 2KFYA 4RU2A 1WACA 1HBNB 1VQYA 4CRJA 4OQJA 3HFKA 4M5DA 5KG4A 1U45A 4JI2F 3OR2A 5F3ZA 3JYTB 1FKAF 1HARA 2A0FB 3FEYB 3IXQA 3DN9A 2CPXA 3HVTA 2ZH3A 2DR8A 2R42A 1BQNA 1JXEA 2RJZA 4USIA 2VA2A 3AA9A 4WYLA 1M5KC 4FF4A 4F8RA 1CSJA 4IH7A 3ZTSA 2KG1A 2W9CA 2V2KA 3KK1B 1M5HA 2VDIA 1CC7A 1Y5NB 4HHJA 4NEYA 4QPXA 5A6PA 3D0IE 2EBEA 3MTJA 4DV5F 2RSQA 2IC3B 1VQPS 4X4RA 4IFYB 5KFQA 2YBVA 3GZ7A 4WZMA 5GVQA 3OL9A 4IYQA 1SL0A 2J7WA 4KC5A 4A46A 4CO2A 4X62J 2UVWA 3OD2A 2MZ1A 4CLWA 3G96A 1TZ0A 2XTJP 1QM9A 1X0FA 1X4AA 2XYHB 2GMLA 2J6UA 2VZ9A 1C0TA 1WD6A 1MWQA 2OD6A 2GCFA 3KJVB 2ATCB 4KY3A 1NKCA 3SFGA 2OPPA 4ID8A 4KKOA 3BZQA 4KBIA 2IIHA 4P9SA 2EVZA 2BE7D 1IKWA 5HQ8A 1KLNA 2LYVA 3I6PA 2J0QD 1S9FA 3I55S 5EHHA 2CJQA 1X5PA 2E44A 3Q8YA 4J91A 2XZTB 4OX9F 4I67A 4ECYA 4L72B 2HHHJ 2MKSA 2P5VA 1KOHA 3GIKA 1YJ9S 4M1KA 1KNZA 2XSFA 2KXFA 3DGPB 4N7TA 4Q2MA 2XM3A 2E9TA 5KFGA 4DV7F 2GX8A 3MMBB 3HM9A 5T7LB 1OY8A 2RU3A 3PJWA 1ZS6A 2FHJD 3IBFB 3QAUA 3PR4A 5F8GA 1XWLA 5HVFA 1HQUA 4Q45A 2W7PA 1FT8A 2YKNB 4DUZJ 3FCHA 3RGIA 1LW0A 1XMQJ 1DFDA 4QIVA 4HDHA 2FTRA 1NMEB 5IT0A 2CNNB 1KONA 2GGPA 1IBCB 4RW4B 4CI0B 3M6XA 4X66F 3TJAA 2HVDA 4LVOP 4U7UK 2R8HA 3B6BA 3HI9A 1GX5A 3GLJA 2V4RA 3LP0B 3HHNB 1R3NA 2KKHA 4FN5A 5IT9U 2AW0A 2QC3A 2DCLA 4OX8A 4ZITA 3LWMA 1N5VA 2FPHX 2Z2YB 4TU8A 5IWAF 2RUSA 1S59A 3OFHA 2FHMA 4HTJA 4QW8A 2KN4A 3DLHA 1TKZB 3T6BA 1VK8A 3DOKB 3NWGA 3Q86A 1T9UA 2W9BA 2J0XA 4I2PB 4DV3F 4ED7A 2ASLA 4IR9A 3SI8A 2Y8WA 2E1CA 1RHRB 4X64J 1QTNB 1U7LA 2Z56B 3G9CA 2V63A 2DJWA 4OV1A 4OZLA 1JNRB 4YP3A 1Y0HA 3CJKB 4CIOA 4UZCA 5E0OA 4WCEQ 2QL5B 3OFFA 1S5ZA 1HFEL 3L7PA 3OTOF 4FKXA 2AGOA 5A6WA 1TFWA 1T03B 4EU0A 4WIIA 2RQCA 4IRKA 3OUYB 3BKUA 5DLGA 1IKYB 4KGKA 3OXFA 1FWPA 2HHQA 4KHPJ 2XC9A 1GMWD 4JV5F 4USJC 4C8NA 3M6VA 3BKFA 1RABB 1WC6A 4WFBQ 4LBPA 3BM7A 4Q2LA 1MWZA 1PIEA 2B56A 2DGVA 1B0TA 4I6YA 3WIUA 3KHRA 3Q23A 2HLUA 1S9EB 1WC1A 3A3PB 4NYZA 3DOMA 4OZNA 4RO0A 3K0JA 2M3DA 2AKWB 2PFFB 1X31C 2DGQA 5T14A 4DR5J 5CQGA 4F4KA 1RUSA 2YNHB 4W98A 4UQTA 5KFPA 3UWTA 3IA0A 5KFSA 4EWTA 2RHQB 5L38A 1S10A 3AJDA 4I69A 1KC8T 3F44A 1ZAXA 2XB2D 5M2UA 3RAQA 2QG9B 3JQJA 5J2MA 3Q22A 4C7QA 2H65B 2MQPA 3C8YA 4NCGA 1UETA 2KJWA 4MJKA 4ICLA 4KE5A 4C6AA 3F73A 1QSYA 1FFWB 4K7QA 5IZHA 3BN4A 5B0BA 1ZZNA 1VQOS 1GXTA 1XBWA 3BKTA 3D66A 3JTPA 4DG1B 1VBXA 4Q0BB 5KG0A 3E8OA 4UW2A 3VV2B 3HT3A 1D1UA 2CQ3A 1Y3JA 2KJVA 1MU2A 1YVFA 3TUPA 2ZHAA 4ZPCA 2DY9A 4WU2A 4H4MA 2RKIA 5F0UA 1GH8A 1UVJA 5HROB 4B3OB 2ZNZA 1TKTB 2E1PA 4X4UA 1IN0A 1CJTB 2VFVA 3SDEB 1IBMF 1YK9A 3VTIA 3NY0A 1FRXA 1FEEA 4I6WA 4LVNP 1U24A 1R8BA 4OYIA 4QW9A 3MM8A 1XNQF 1HWJA 1UCNA 2NXNA 1N34J 1Q8IA 1TELA 4LBIA 1QD1A 1R8CA 2CVIA 7AT1B 2LFVA 4RW7A 2VQFJ 4BWMA 2MLXA 2HSEB 1RWOB 4P2FA 3MAAA 5KG7A 3ULHA 1O5JA 4KHPF 3CJQA 5KG1A 1U4BA 1FWKA 3Q2SC 2I6WA 1VC0A 4ERDA 1S7IA 4OZJA 2JNJA 3M05A 2MMYA 5T7LA 2NXEA 2JJ4D 3TJ8A 2VQEF 3FZ2A 3PW4A 2DISA 1S1XA 2OEJA 5DQGA 5LMUJ 1YI2S 2J0SD 1D09B 1S7HA 3VQTA 3PJ9A 4WWSA 3H90A 3CCUS 4ZVFA 3OW2R 3KLVA 1KQSR 1X5SA 3RZAA 3SSQA 3BJYA 2Y8YA 3I0SA 4A8QA 1T9YA 2PEBA 1VOMA 3CDUA 2GMHA 2GAHC 1FRKA 3UNGC 1KP6A 1T9XA 2RRNA 1ZYQA 3CMAS 2YWWA 4P7TA 4DI6A 3P6YC 3R97A 2XQCA 4A8FA 2DB1A 1UJ4A 2G0CA 4GC6A 3H8YA 4LRCA 3EZUA 1S6UA 3GMGA 5HANA 3HZEA 3QNWB 2LLZA 4R0JA 2ZH4A 3KLEB 1BMQB 5H1SV 4IRCA 3TAMB 1AB8A 4B9MA 4C0BA 3U02A 4KJIA 3BH7B 3KNAA 3ETMA 4NI2A 3ZO7A 3NGUA 3C14A 1NHUA 2VV5A 3A1YG 2FJWA 1TAUA 5IT9Y 1OSDA 2HIQA 2B4VA 3IR6B 3NG8A 3JTNA 4ZVEA 5HK4A 2EKYA 5GMDA 4PR6A 3CJKA 4ECZA 3IRXB 3DMJB 2LXFA 1HBOA 2AJ0A 2CIMA 5ETSA 2VHGA 4LF8J 2B9EA 1U0SA 4DF4A 3N9UC 1ZTWA 5L1IA 1M0SA 2WSCC 1M5OC 3UDVA 2HQ3A 3M8SA 2GJ2A 4B3RJ 2N7YA 5CD4H 2RB7A 2ZOGA 3T5HA 3S6EA 1SJRA 4E8UA 5C42B 4PG5A 5L46A 1LW0B 4FPIA 3T1YJ 1DURA 2OKQA 2V8HA 4WK3A 3KLIA 3G71S 3KHLA 4DPOA 2JL9A 3FEZA 2MKYA 3NOCA 1B7FA 2NR0A 4DV2J 3R7NB 4L3NA 5B0AA 1AZSA 2RNEA 3IO1A 1W2IA 1IKXB 3X3UA 4PRFA 1I6JA 2LQ5A 2BJ9A 3C15B 3MAHA 1FNXH 2F8EX 4Y0FA 4X65J 4CLZA 4A8MP 1H98A 2QN6B 1JXVA 2F9DA 3MCNA 4B9LA 2BW2A 3BR8A 4OYPA 3DI6B 4FDFA 2XCPA 3JS9A 2W4CA 2H5JB 1DQAA 1SL2A 1N36F 1T02A 4A8OA 2DNGA 4OYZA 1SIZA 2W4DA 2IBKA 1U26A 1RXOB 3DGPA 4ID5A 3RR8A 2MQNA 3HHEA 1Q7LB 5KFCA 3OXLA 1RLDA 4ZN3A 3FEXB 3MZIA 2IJRA 3R3TA 4RKUC 3JAMU 3VZIA 4H4MB 4CO3A 2YKPA 3W60A 3GB0A 2C3PA 3FZBA 3HSDA 4ZPVR 4ZVUB 4ES3A 1UZHA 5F8HA 1R6VA 4P52A 4F0MA 2HS3A 5E3PA 2UVUA 4Z7YA 2HNYA 2B8QA 1MLAA 2XNRA 2DH8A 5D77A 4QR2A 3EGZA 3M30B 1B7YB 2OD4A 3CJ2A 5LMNF 2ADBA 2JEJA 3MD3A 4L3KA 4ES2A 3WC0A 1X4DA 3PVXA 4GO7X 4NLPA 3CJ3A 4N8NA 2OIHA 2BW7A 5EN1A 4RW7B 2GIRA 3RBZA 1U8SA 2VPXB 4HL9A 4UOCA 3TR5A 4ALZA 1XMQF 1T3NA 1G2EA 2IC3A 2HNDB 1QJHA 2PEHA 2HS0A 3VAFA 1TAQA 2QRRA 1N6QB 2JX2A 4HYKA 4FYWB 2NSBA 2VB6A 2W7AA 4DV7J 2GZOA 1NJYA 3PIOQ 4O3RA 2RE1A 3DLGB 1HD0A 5K9FA 4UZBA 2LDYA 1IXKA 3FBBA 1AROP 1FXLA 1FKOB 5ETTA 5KG3A 5FLXY 3KHHA 1F2HA 2CQIA 3G86A 4DLGA 1RT4B 4HH0A 3DM2B 1IR2A 4CYUB 1NSQA 4XIUA 2FJDB 1RBAA 4IDKA 4PKDB 5HBMB 5HQLA 1L3SA 4ZOSA 5HMWA 1LWEA 4F02A 3V6JA 1XTZA 1JXLA 1U6FA 3DDIA 4NEZA 5AXMA 4YN3B 1HQ2A 4P10A 4EUVA 2VG5A 1OSCA 2M9KA 2DNKA 2KRRA 3QQCD 1LNQA 1S1TA 4NXNJ 4X4VA 1EJ7L 2RMLA 2LQJA 2YX4A 2CNLB 3HKZD 6FDRA 5HMXA 3DRPA 5IFMA 2ACYA 2WTFA 4QCLA 1EZZB 3QIPB 3KG4A 1O6XA 2JEIA 2W9CB 4XO0A 3GJRB 4P7VA 4GMKA 5KFEA 4ECSA 3CVKA 1NK6A 2NZ4A 3AD7C 2ZH7A 2V50A 1M1HA 3DLJA 1L3UA 1FE4A 4RR5A 3CD6S 2FHJA 3FC9A 2YNGA 3ZXWA 4K0KF 2VPWB 5CCLA 3KXDA 4L76A 3LAMA 3OLBA 4EK2A 4CT8A 2BXJA 3A3OB 2LA6A 3ZC4A 2HEKA 2I9SA 4FBUA 3IRXA 1U6BA 3NLCA 4DX7A 2ERRA 2JFKA 2GVZB 4K5RA 4ANCA 4M5JA 1JLCA 4RBTA 4DBQA 2DHXA 3BPSP 1NPKA 5B09A 3T9ZA 3NWRA 3PG9A 3ET6B 1DTQA 4LF9F 1KVKA 1UPPA 1X60A 2YWHA 3CTRA 2LKZA 3N4WA 4ZVQB 3SFUA 5F9NA 2KM8B 4HH1A 3QIDA 2PA3A 2WBRA 4O3NA 3IR7B 3MHYA 3KLIB 3DRSB 3OVSA 5HL7Q 1QE1B 4DDFA 1HQEB 3BF4A 2DXDA 4QU6A 2HHHF 1RA6A 3SMZA 1HR0F 1TK5A 4K4TA 1RAEB 2CQ2A 3NS7B 2HK2A 4K4WA 3HHLA 1SJ1A 1P8GA 2MLZA 4KV8A 4RPFA 4LF6F 1KWMA 1RWXB 5L39A 4O44B 3A12A 3RB6A 1PCAA 3IG1B 3FCVA 4C11A 4K4UA 1CVJA 3KLHA 3TUJC 2VU5A 1GK8A 1X7VA 4O4RA 1VISA 3B54A 2WONA 1RHQB 1N88A 1RT7B 2VD3A 3N28A 4LSLB 2Z0GA 2CQBA 3GV5B 4DQPA 2ZUGA 1IJEB 1SJ3P 3CGIA 4E98A 1EETB 2BJ8A 2DGOA 3IBWA 5D0GA 2IAJB 1RTDA 2A1BA 4PG6A 2F3JA 1H2UX 1XC9A 3MM7A 3U1MA 5H9FJ 3BGLA 2UU9J 3J7AN 4FYXB 1NKBA 1XR7A 2HW3A 2WVEA 4I4BA 5A2QU 1FI4A 3M9OB 2XSJB 4ER8A 1RAIB 1ZPWX 5F41A 2FUG9 3ELHA 4L6V3 4LFAJ 2BJ7A 1Q79A 3F41A 4ED4A 1U6ZA 1VDHA 4JV0A 2WRMA 4QZVB 2P9EA 3FSXA 4IOCQ 2I8EA 3D68A 4QIGA 1LK5A 5AXKA 1NPPA 1O51A 5DM6Q 1X9MA 3DU6A 1Y11A 1NDCA 1VIOA 1MU2B 2GV1A 2Q43A 3H7HB 4KPYA 3A3NB 5CH7B 2AGPA 1AYEA 1HD1A 5E3RA 5E7OB 5GMEA 4KTQA 3QGPA 2DVIA 1WDTA 2GQ2A 3AY0A 3DLKB 2O66A 2ZD1A 3RRKA 6FD1A 2KO1A 2HFZA 2XZDB 4FVCA 4NRTA 2QL9B 2DR5A 1FWLA 3RBXA 4F4ZA 1S0MA 5I4MA 2O1PA 1HBOB 3J7YI 1VCTA 4CLYA 1U1PA 1N33F 1ZZFA 3KK2B 1F5AA 3PKMA 2UUAF 4FF2A 3VAHA 3CIMA 4PAAA 5F8MA 1U2FA 4TLRA 3R7BB 3RB3A 2QMWA 1HL6A 3AFGA 1FD8A 2ACMA 1WHYA 4ECUA 4LIWA 4P71A 3N5BA 5DG8A 1GAOA 2VKRA 1VC5A 3HZGA 1FRHA 4J9PA 2KRBA 2DBBA 1NNDA 4A8YA 4DZDA 4AL5A 3AB2B 3M30A 5K8MA 4PQUB 2QYGA 3MUTP 1C1BB 2MZTA 4FKYA 3TVYA 1VQ8S 1C1CB 4DR6F 1NJWA 4YB1P 1NJXA 2ZH9A 1UZDA 2ROEA 2YXLA 1I3OB 2AJFE 1UFLA 2H9ZA 2LQ8A 2AJ1A 1NJIT 1L3VA 4DL5A 5U47A 4AE5A 4DR5F 3WC2A 4KAIA 2BABA 2NZCA 4J9KA 4B9NA 3CEDA 3UO0A 2VF3A 1HMVB 1QUPA 4NMLA 1Y3KA 4HACA 4NLTA 2YWEA 4OYXA 3QSYB 5J2QA 4C0OC 1U1MA 4QYRA 1KD1T 1H2TZ 2YKOA 2F5GA 1WG1A 4LRBA 4ETZA 1GMUA 2JZ5A 4PG8A 4FS2A 4X65F 2V94A 4QWAA 1WI8A 2OJ3A 1B99A 2VICA 2YH1A 2E5LJ 2D1CA 1TUWA 3N6LA 3D7SB 1WWHA 4ELUA 1C0UB 1RTIB 2RQKA 2LDIA 4I68A 2VOOA 2JFDA 1NBEB 1ZM9A 4OZ3A 1RT2B 4RU9A 4ZPBA 5CZVA 1SH3A 1TR0A 2CJAA 3QBCA 1WSRA 2R7VA 8AT1B 5THWA 1NPRA 1LWFB 3BGRB 1VRUB 2XLJA 3EX7B 1TU0B 4KR0B 1U09A 2QLBB 2EFNA 4M5LA 4C11B 5DQIA 2R8GA 4N5SA 3PR5B 4NXMF 4K4VA 1RTHA 3D6FB 1TKZA 2XY5A 3DOKA 3CJRA 1X9SA 1TL5A 4ZVPB 2GQQA 2NS1B 4D3HA 3MMCB 3PNIA 4ELVA 3RW6A 1IKVB 1Q8BA 1H7WA 4EFAC 2DNLA 1N5YB 2H4YB 3KLHB 2J9EA 3QIPA 1SPBP 3R27A 5F8IA 1YTYA 4PWDA 1OY6A 4Y00A 1I5OB 1MROA 2O5DA 3V6DA 2DR6A 2B4UA 5KFVA 1T05B 2FJVA 2VG7A 2F4VF 4FNHA 1D9FA 2OHDA 4LIRA 3GR0A 3JSRA 4JYAF 3NRBA 1VQ5S 3KUHA 4EYIB 5EX3A 3VZHA 3R1LA 1XMOJ 3D28A 4JI8J 1Q5VA 2BE2B 2FLLA 3MEKA 4HVZA 1HW9A 2EFGA 1GQEA 2FZGB 2Y1LB 3OFEA 4K59A 3KLEA 2NREA 1OQ6A 4DL0C 4IG3A 1UWAA 1U2CA 3US5A 3HFZB 3BBCA 2K06A 4DQIA 1HI8A 2MZSA 4Q43A 3GJTB 3NBPB 1IBLJ 4C48A 1CBKA 1S79A 2LQBA 4H4OB 4OI1A 4KGMA 4PUOA 1CC8A 4HHUA 1B70B 4PG4A 1PBUA 4ED5A 2V2QA 2DNMA 3SIPB 3RRHA 1REGX 4RWXA 1WOPA 2WB4A 3D0GE 1PG5B 3D1QA 1HR0J 3C16B 3IN5A 5CYJA 3FFIB 2R2RA 2HK3A 3O5TB 1Z2LA 4LRAA 4Q7AA 1K1QA 2ZZNA 3MEDB 4FYDA 2UXBJ 3R1HA 1CULB 1KDNA 4HDGA 5K14A 4CWBA 5A8RB 3TARA 3CMES 4UUXA 3FQKA 5D0RA 2BA9A 1VIXA 1FEHA 1BQMA 2DKOB 2UZAA 4HHHA 5C42A 4DL3A 1QAJA 2ZOFA 4F3MA 3CIZA 2C42A 4JI0F 3UNYA 2H54B 5C2CA 2WW4A 4C3LA 2IM1A 5A8WB 1NK0A 5CA5A 1JIHA 3KUEA 2BVZA 4JYAJ 1RCXB 2YTCA 5HJYA 2DNZA 3MCSA 2J9DA 3PYEA 4A8KA 4ZJLA 5B7WA 3DRXA 1HPZA 5D0HA 3BSNA 2NXCA 5KFLA 4DPXA 1RTDB 3E01A 1KOOA 3M9MB 1NHVA 2Z2ZA 2OEKA 1WF1A 3CD0A 7FD1A 2ZBCA 2KL8A 3ZTQA 4QWEA 3W65A 3ZZOA 4ZLNA 3SV3A 2JC0A 2RD5C 2MJNA 4JI3J 3H2UB 4NA2A 2MQMA 3QJJA 1N56A 3DHXA 1HQEA 2YQ1A 3UW1A 4GO5X 4WFYA 4J5OA 3CCLS 2VBYA 3G4SS 3V6KA 4FP9A 1N48A 1N4LA 1VS3A 2F1FA 5IM0B 3VWSA 1FRJA 4NLWA 5DRKA 5EDWA 2ALZA 2F4VJ 2XS5A 3TAQA 5SUHA 2MY7A 2V9WA 2IRXA 4M5NA 1AW0A 1V5VA 1TMJA 2BJEA 1QUVA 2I38A 1NH8A 2VFRA 3MI7X 2CQCA 1EB0A 2DHHA 1EP4A 2YH0A 5DDOC 5HMZA 4CH7A 2VQEJ 4O3OA 1MMNA 2WAQD 5D78A 5JUMA 3RB0A 3HHKA 3MECB 1GX6A 2KXHA 1EQMA 5CXTA 3ONQA 1LQ9A 2W9BB 3TEHB 5C24A 1CS4B 2QLXA 2YKQA 3QPIA 1RT7A 2E1RA 4TNOA 1TL7A 1U02A 3FBFA 2LMIA 1UJ6A 4CO0A 5CYMA 4JUZA 1S1XB 1HNIB 2DITA 1AT1B 2GJIA 1J5OA 1JJ2R 3GIRA 2F63A 1RISA 4CZCA 1UVLA 3EGVA 4KQZA 3I0SB 4ANDA 4JI5F 2XMVA 1TL1A 1SVDA 3NGTA 3MOZA 4HT7A 5DQHA 1PKUA 2HFSA 4A8WA 1RKJA 2QEXS 2KU7A 1N5TA 1FFGB 1ACMB 3H0PA 3M32A 4HEA9 4LFBJ 2F40A 3SXLA 1JLGB 4DR2F 5DS7A 2VONA 2PMHA 1SXLA 4ILRA 1Q8KA 2KFNA 3DGVA 4AXIA 1ZM4A 2XI3A 5E33A 4KGXB 2RS8A 2E5LF 1V6HA 1GMVA 1MG7A 1WC0A 5KT7A 3NGDA 2HPUA 3T3FA 3IWNC 2Q1LA 3TZZA 1VQNS 5E3QA 2HG4A 3WIVA 3RBDA 1V3SA 3UVJA 1N5SA 3V6DB 1TVRA 2CG4A 4TY8B 3WQPA 4DV4F 1K8AT 4MAKA 3GFYA 3W9HA 5K8PA 2KZZA 4WP3A 3VAGA 3TUZC 1KHWA 4NLUA 4ATNA 3MPVA 1SL1A 1WC3A 1HWIA 4IG3B 3C3LA 4KO0B 1JLAA 1JKHB 4KRWA 1YZ6A 2ZKUA 4ZVRB 4NLQA 2H3EB 5BYRA 1YLXA 1KBRA 2DEJA 2DRBA 1RQ0A 3CJ0A 4B3SF 4X2BA 3EXCX 4H4OA 1SKRA 1HWLA 2YPYA 5LJ5Y 2XMTA 3CJSA 2BM1A 2NXJA 4F25A 4MKAA 2IM0A 1S6PB 1X4EA 4USVA 3HULA 4A48A 4C2MA 5L9NA 3EPGA 2DH7A 2ZH6A 3BH6B 3DLEA 2PC6A 4V1Ak 4DQSA 3NNHA 3JSYA 1QVGR 1WKKA 2HBYB 2WBMA 4Y6IA 4DPTA 5KFMA 1IJFB 1S6QA 4YHHJ 1HNVB 1DHMA 2F8MA 5DZ7A 1MN7A 4QPTA 3R5DA 1TKXB 1CLFA 4KGVB 4P2SA 2KFZA 2R7TA 1IWAA 2C3UA 3J81U 3CMQA 2E5GA 1RWPB 4G6VB 4IQMA 3QGIA 2EK6A 2AYMA 3OPKA 3MMCA 2G2OA 3VGSA 1WEZA 1R8PA 2POKA 5KFIA 3LP1A 3MPWA 1ZA1B 5J1PA 2NXUA 3OV7A 3ZZTA 4LMZA 4R5PA 4CLSA 1XEZA 3HD2A 1YIJS 4LF7J 3HVAA 4PYAA 3KMQA 3CO9A 1G3OA 2ZZTA 4ZHRB 5EGYA 3LP2A 2R2SA 2C2RA 4EZ9A 2OPPB 4KKOB 2RF2B 3O2IA 3V5RA 2BQ3A 3H5XA 3GYGA 1FHTA 4ITSA 4BCAA 3PCOB 1U0HB 4O44A 4QWBA 4EO6A 3D6HB 2L9WA 5G0RA 1JLFA 2OMLA 2PSZA 5ETVA 3CF5Q 2A6OA 1HIYA 1G4CA 4A8XA 2D3OR 1VK3A 3KK3B 4E0DA 1RT1B 5DETA 3J81j 4F4XA 1CJKA 4WTOB 1SKSA 2XO7A 2MJUA 1Q81T 1HBMB 2HS4A 4AL7A 3C66A 4RUBA 1UL3A 2MYFA 1IR0A 3GWCA 3OTBA 1KQFB 3PIPQ 2J6TA 3J7Z5 2QYCA 1IKVA 1SJQA 2R3VA 1HWUA 1WHVA 3IS9B 2C2MB 2HVEA 1S57A 2OPRA 1P6TA 3DNCA 3MDFA 3MM5B 4G1IA 4O4GB 4OMFG 1NB2A 3SDEA 3Q8UA 2HURA 3W62A 1WJ9A 4OHWA 2DNHA 3TX8A 5GAHU 3IAS9 3TW0A 2QJ3A 4RW4A 5HMYA 2RKIB 2IPOB 2KH9A 4JI0J 2LU2A 2P6TA 3OR1A 3PRBA 2JDJA 1DAXA 5E3CA 3MR5A 2FVRA 4OHYA 2ZH2A 1CJTA 2X3DA 5F8JA 5LSLA 1T94A 1FTRA 4PPDA 2ZM6J 5L9XA 4DS4A 3BBFA 2Y1IA 3CXCR 2O67A 1UVKA 3W66A 1WI6A 2KZMA 2UP1A 4UF4A 5JVHQ 2ASYA 5ETPA 2J6SA 4DR7F 3Q8PB 2EFQA 2W4PA 1R6YA 1K73T 1RWWB 4FVMA 8RUCA 3IBCB 1UVNA 3OXGA 2XYPB 5AXLA 2R9LA 3WHIA 2ASJA 2AZ1A 2X7IA 3KFWX 2GO9A 2RQ4A 1RT6B 2EW9A 3DLKA 4ZP6A 4ZVHA 1JLGA 2Q6BA 3LW5C 1ZOTA 4USUA 2HRUA 5FD1A 2W2QP 3CD5A 4M8LA 1RWUA 2YKMA 3TVKA 4TYBA 2Y0SD 2W24A 3RR7A 2E9RX 4DFJA 4EI2A 3NGRA 1VQ6S 5D3GA 4DV0J 4YMEA 3C16A 3QGHA 1VYAA 1E6VA 3PFEA 1WEYA 5E2QA 2UUBJ 3K17A 2DNYA 1O0PA 1Y4ZB 3LO3A 3KMSA 1P1TA 4J9QA 4YDDB 2HQIA 5J1EB 3KWMA 1M5PC 3EVOA 1BC6A 1VRUA 3EVWA 3T1AA 1HYSA 2FY8A 4EMDA 4IO9Q 2V8DA 3I56S 3DI6A 3LWLA 2BKPA 4EBDA 1WNEA 3HSJA 4C98A 4F2SA 5A8WA 3SBMA 3W5ZA 5C5JA 4LF6J 2C2KB 2NYIA 3OLAA 3G6ES 4OL8A 1RADB 3MOJB 3LH2S 2CYYA 4QWDA 3KLGA 3I5BA 5I42B 3P49B 2GW8A 4Y65A 4JP8A 2EEYA 3MFHA 2B43A 2F7VA 4YY3F 3I5AA 3P8BB 5I3QA 1Z4UA 3MM8B 4L75A 4ANEA 3QT7A 5LOQA 3AQOA 1HMVA 1H73A 3OTDA 4LRDA 1UVMA 1PBAA 5BYSA 2HMIB 1RT5B 1WOOA 3A13A 4DLEA 3EMTA 3HF5A 1BWVA 3UDLA 4O3SA 1REVA 2AT1B 1NH7A 5ETKA 1WSVA 1LOUA 1YX2A 4OZ0A 1UVIA 2XS7A 4C97A 2YQ0A 1RB0A 3W2WA 5I3UB 2M88A 3THTA 3GQCA 5E41A 3QLHA 1RA7A 5FIIA 4R5PB 1RU1A 3OJUA 4W90B 1VBYA 3T5LA 1NK7A 1EQ0A 4ZN1A 2PIIA 5F3TA 5LL6d 2DEIA 2CFXA 2P9GA 2U2FA 3M8QA 2VQFF 5FJ4A 5J2NA 2NLWA 4NLVA 3MM6B 1KTQA 2MLYA 5KT6A 1RHUB 2HGMA 1W25A 1Z1ZA 3LQVA 3VHQA 2WB1D 4G3IA 3N6NA 4ECQA 3PW2A 2P2CB 2RAQA 1CULA 1EKRA 1UEUA 1R0AA 3SCJE 3TANA 1Q5YA 2B0GA 3C15A 4OLOA 4H54A 4QOTA 2XNQA 4C3KA 1N5YA 4LFCJ 2HKEA 1H3DA 5I3PA 2HBZB 3SSSA 2M70A 4IR1A 3RJMB 2XZWA 3A8EA 2XS2A 4DOZA 3D3CJ 1S9EA 3K57A 4F4YA 4W4MA 1JLBA 1VC6A 4GKJJ 2B4PA 3LALA 2QFJA 3BEGB 1N32F 1F3VA 3AOCA 2PE8A 2EC2A 3LPYA 3H4BA 2BQRA 2ZFHA 4OFZA 1JX4A 4NCBA 3LAKA 4CM2A 1F0XA 3FMWA 3M2VA 4URSA 3GFZA 4Y3CA 4F4WA 3GILA 2OPRB 2RQMA 3FRYA 3L7UA 2BJ3A 3BYRA 3IC1A 3HKWA 4H4KA 4O4GA 4RBUA 5DO2A 4RNMA 5J2PA 5G4DA 1BUXA 2YWKA 5GADI 2UXBF 2OSQA 4IOBA 4AYBD 1J5EJ 1E6YB 1XR6A 1TUGB 1NZ8A 1UEKA 3QT8A 4OYOA 2RRBA 3QMQA 4NX9A 5DG9A 2XBPA 3NL0A 2AYBA 3MCMA 3MEGA 4FZVA 2AP6A 2CJXB 1QLNA 2LU1A 2D74B 2R7OA 3BGUA 3MAQA 4IFVB 1W2BR 3BQ0A 3HSZA 2VDHA 3U1LA 4ZP8A 5GAEI 4AL6A 1XK8A 4DUYJ 1L3TA 4GKKJ 2EK1A 1NEEA 2Z30B 3RAMA 1KRPA 2JEGA 3W61A 1S76D 2RF2A 3FNNA 1HHQA 2UXCF 1FKPA 4N8OA 3SCKE 5BR8F 1UKUA 1RU2A 4LR9A 2V8VA 2V4QA 1EIYB 2I5JB 3P5BP 1NO8A 2XULA 2X3GA 2QA2A 3DRSA 3O1LA 3EDQB 2WW8A 1CPZA 2RRAA 2UVRA 2XMWA 2DHGA 3TEGA 1R8AA 3W9JA 2CQ1A 1K0TA 4HI2A 4RW6B 4LF8F 5IWAJ 2E1AA 4U7UD 1NUEA
chains in the Genus database with same CATH topology
2B8QA 2DY9A 1XQIA 4F36A 2NCKL 2CWKA 3R9LA 3MPDA 3EVMA 3BBCA 3ELHA 3FKBA 2DXEA 1NDKA 4F4AA 5BXIA 4UOHA 4WBFA 1PAEX 3Q8YA 1UCNA 3BH6B 3VVUA 1WKKA 4ANEA 1NDCA 3NGSA 3FBCA 1MN7A 5IOLA 3Q8VA 1XIQA 3FBBA 3EMTA 1ZS6A 1KDNA 3VVTA 4UOGA 3EICA 5CABA 1WKJA 3VGSA 1NSQA 4DZ6A 1F6TA 3WX8A 3PJ9A 2DYAA 1HLWA 2HVDA 2DXFA 3B6BA 2BX6A 3ZTRA 4S0MA 3Q89A 1F3FA 3DDIA 3BBBA 4DI6A 1S59A 3VGUA 3Q86A 1B4SA 1NLKL 3ZTQA 4FKYA 3BH7B 1HIYA 1NDLA 3ETMA 3NGUA 1WKLA 3VGVA 4KPCA 1S5ZA 3FC9A 4FKXA 3GPAA 4EK2A 4CP5A 2HVEA 1S57A 4ANCA 4O0NA 1BE4A 1NB2A 3FCWA 3Q8UA 2HURA 3L7UA 1NPKA 2BEFA 1NHKL 1BHNA 1B99A 3FBFA 4DUTA 2AZ3A 1BUXA 1LEOA 1K44A 3ZTPA 1NSPA 1MN9A 1LWXA 1NDPA 1U8WA 3FBEA 5C7PA 3BBFA 4ANDA 4W98A 2DXDA 3NGTA 1PKUA 3EM1A 3GP9A 1NSKL 3Q83A 3EJMA 1W7WA 3ENAA 2AZ1A 3DKDA 2ZUAA 1JXVA 1HHQA 3FCVA 3JS9A 1NCLA 4ENOA 2VU5A 3G2XA 3ZTSA 4C6AA 3PRVA 5CAAA 3NGRA 3B54A 1VYAA 1EHWA 3EE3A 2B8PA 4HR2A 4UOFA 3VGTA 3ZTOA 3EVOA 3EVWA 1NUEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B8Q A;  2DY9 A;  1XQI A;  4F36 A;  2NCK L;  2CWK A;  3R9L A;  3MPD A;  3EVM A;  3BBC A;  3ELH A;  3FKB A;  2DXE A;  1NDK A;  4F4A A;  5BXI A;  4UOH A;  4WBF A;  1PAE X;  3Q8Y A;  1UCN A;  3BH6 B;  3VVU A;  1WKK A;  4ANE A;  1NDC A;  3NGS A;  3FBC A;  1MN7 A;  5IOL A;  3Q8V A;  1XIQ A;  3FBB A;  3EMT A;  1ZS6 A;  1KDN A;  3VVT A;  4UOG A;  3EIC A;  5CAB A;  1WKJ A;  3VGS A;  1NSQ A;  4DZ6 A;  1F6T A;  3WX8 A;  3PJ9 A;  2DYA A;  1HLW A;  2HVD A;  2DXF A;  3B6B A;  2BX6 A;  3ZTR A;  4S0M A;  3Q89 A;  1F3F A;  3DDI A;  3BBB A;  4DI6 A;  1S59 A;  3VGU A;  3Q86 A;  1B4S A;  1NLK L;  3ZTQ A;  4FKY A;  3BH7 B;  1HIY A;  1NDL A;  3ETM A;  3NGU A;  1WKL A;  3VGV A;  4KPC A;  1S5Z A;  3FC9 A;  4FKX A;  3GPA A;  4EK2 A;  4CP5 A;  2HVE A;  1S57 A;  4ANC A;  4O0N A;  1BE4 A;  1NB2 A;  3FCW A;  3Q8U A;  2HUR A;  3L7U A;  1NPK A;  2BEF A;  1NHK L;  1BHN A;  1B99 A;  3FBF A;  4DUT A;  2AZ3 A;  1BUX A;  1LEO A;  1K44 A;  3ZTP A;  1NSP A;  1MN9 A;  1LWX A;  1NDP A;  1U8W A;  3FBE A;  5C7P A;  3BBF A;  4AND A;  4W98 A;  2DXD A;  3NGT A;  1PKU A;  3EM1 A;  3GP9 A;  1NSK L;  3Q83 A;  3EJM A;  1W7W A;  3ENA A;  2AZ1 A;  3DKD A;  2ZUA A;  1JXV A;  1HHQ A;  3FCV A;  3JS9 A;  1NCL A;  4ENO A;  2VU5 A;  3G2X A;  3ZTS A;  4C6A A;  3PRV A;  5CAA A;  3NGR A;  3B54 A;  1VYA A;  1EHW A;  3EE3 A;  2B8P A;  4HR2 A;  4UOF A;  3VGT A;  3ZTO A;  3EVO A;  3EVW A;  1NUE A; 
#chains in the Genus database with same CATH topology
 4Q5V A;  3M8R A;  1X4F A;  5ETO A;  4N76 A;  2Y1R I;  1RDR A;  3DRP B;  4F36 A;  4DQR A;  1ZA2 B;  1RCO B;  1BY9 A;  2B4O A;  4PPZ A;  5I42 A;  1HNW F;  1FER A;  3JTO A;  3ZZR A;  2VOP A;  2B3T B;  3D1O A;  3MD1 A;  3OVA A;  1PYO B;  4CH1 A;  3M8P A;  2YPZ A;  2HYI B;  4FYY B;  4RNF A;  3NGK A;  3AD9 C;  1S0N A;  3NAI A;  2V5H G;  1HHS A;  4RX6 A;  2YKA A;  1RWK B;  2AV5 A;  4WYW A;  3UFC X;  5HSP A;  4M63 A;  4MFB B;  5HP1 A;  3T9N A;  2HFO A;  2IBO A;  2MB0 B;  1FNM A;  2DGU A;  1R31 A;  5L1K A;  5AE1 A;  3H59 A;  4Q44 A;  5K8N A;  5IOL A;  3LUY A;  4K4Y A;  1XIQ A;  2QMX A;  1F5B A;  2P9C A;  1VBZ A;  4LSN A;  1JLA B;  2WHO A;  2MGZ A;  1SKU B;  1R27 B;  4IO1 A;  2AJ4 A;  2J8A A;  5LXR A;  5KG6 A;  2XY7 A;  2AMC B;  2R4F A;  5KFU A;  5LMU F;  4J9S A;  2WSF C;  4DU7 A;  2L08 A;  2R7R A;  4ED6 A;  4L74 A;  4K4Z A;  4DR1 J;  2BJD A;  5BYQ A;  2HHS A;  2YNF B;  2C2E A;  4IUF A;  1U1R A;  3CCR S;  2OPS A;  3HHL C;  3M2R B;  4K2J A;  3V4I A;  4JI4 F;  1CG2 A;  2DXF A;  2VG7 B;  1LXN A;  3QYY A;  3BS9 A;  2WVC A;  2QLF B;  1S6O A;  3ZTR A;  4S0M A;  5L1J A;  4JV1 A;  4F67 A;  2VBX A;  2WK4 A;  3HSG A;  3BBB A;  2IYI A;  2IRU A;  4MYU A;  1VQL S;  1B64 A;  3OR1 B;  5CYQ A;  3D4J A;  2IFX A;  1FXD A;  1FTC A;  2G9O A;  1FJ7 A;  2OFH X;  1JB0 C;  2FB0 A;  1B4S A;  3A4T A;  2UVV A;  5EX0 A;  1ZTT A;  2G4B A;  3PJX A;  4J9N A;  1NDL A;  1SC3 B;  1GXL A;  1VLO A;  1OPI A;  2ZNY A;  2F4F A;  4X4N A;  3FRZ A;  3R5C A;  1LV5 A;  4X62 F;  3R6G B;  5B0G A;  3OHB A;  4DCJ B;  3AT1 B;  3HVT B;  4MT1 A;  1VRQ C;  4ZLJ A;  4J90 A;  1XMO F;  3H5U A;  4ZDN A;  1KLM A;  1GXU A;  4WPA A;  5AXN A;  1D8Z A;  1AA1 B;  1L5U A;  2AQ4 A;  3CJ8 A;  2BV3 A;  4DV6 F;  4DPY A;  4ILL A;  5MAO A;  2D9O A;  1EET A;  2PI5 A;  3FSI A;  3TI0 A;  4NLX A;  2Z58 B;  1YDL A;  3IMQ J;  2Z57 B;  3M6W A;  3MED A;  3N5F A;  3BV8 A;  4XDC A;  4X4O A;  4UQG A;  1H0H B;  3MM7 B;  2QE5 A;  4YB5 A;  5HBM A;  1BHN A;  4R25 A;  4CM0 A;  1O8B A;  4JI7 J;  1Y5I B;  3B8H A;  3H42 A;  3G6V A;  2W25 A;  2MKI A;  5J2P B;  4R0E A;  3T6J A;  1U49 A;  1YZ7 A;  3FBE A;  2V67 A;  2MKC A;  3I0R A;  5C7P A;  3OL6 A;  3VAM A;  3J80 Y;  3PHT A;  3SQG A;  2BR0 A;  4DR6 J;  2NUU G;  3DOM B;  1KR4 A;  3HHL D;  3K8W A;  3ILJ A;  4RL1 A;  4FS1 A;  3ILL A;  4OI2 A;  1HNX J;  2EC0 A;  1W7W A;  1YSJ A;  4QR1 A;  3QZ7 A;  2LXI A;  1C4C A;  2VL1 A;  2V6A A;  1MWY A;  3PX4 A;  3KLF B;  3UD4 P;  4JI3 F;  1IQZ A;  4HKQ A;  5JJB A;  1WDD A;  1PJ7 A;  2XHC A;  3SSR A;  4LFC F;  1ZH5 A;  1VGY A;  2V2Z A;  1RHJ B;  3SCL E;  1SBR A;  5KG2 A;  1QTM A;  4B3M J;  4LF5 J;  2KI2 A;  4NZ0 A;  1FKP B;  3CCT A;  4PXC A;  5HVH A;  5KFJ A;  4NCG B;  2JVR A;  3IG1 A;  3CCM S;  1U1O A;  3OTO J;  2XLK A;  2RIJ A;  5D15 A;  2BMB A;  2BRL A;  2JEF A;  5DG7 A;  4N47 A;  4JB8 B;  2KHC A;  4HR2 A;  3KK2 A;  5IV3 A;  2NSC A;  4TY9 A;  1KQG B;  1T0T V;  4ILM A;  3M8Z A;  3HLU A;  1KTV A;  1EP4 B;  4DV1 F;  2FVP A;  1WOR A;  4O3Q A;  4DV3 J;  1S1U B;  2FVC A;  1XQI A;  1TL4 A;  2CXE A;  2BBE A;  3ET6 A;  2XMA A;  4USK A;  1RAG B;  4LFB F;  1U0H A;  1UJ5 A;  4EO8 A;  2JLG A;  4XPC A;  5HRO A;  4IRD A;  1JLQ A;  2WOM A;  4X4S A;  2BJ1 A;  3FKB A;  2CPJ A;  2HFU A;  1RTZ A;  1SQF A;  3KG0 A;  4NYO A;  4DR1 F;  1VQ4 S;  1RSC A;  4PXB A;  3M2U B;  4WF9 Q;  2CA9 A;  2Z2M A;  2Q3P A;  3VVU A;  4IQX A;  4Y2A A;  3B78 A;  3V2U C;  5KG5 A;  4NMX A;  3IAM 9;  1Q95 G;  4CO4 A;  2KM8 C;  1YBA A;  1A0O B;  3LF0 A;  3ETO A;  1Y10 A;  2WSE C;  5KFW A;  4FYV B;  3QWU A;  1RTJ B;  4DEZ A;  5IV4 A;  2E5H A;  4J9M A;  3K5P A;  4PWW A;  1YIT S;  3ITH B;  3VCD A;  3LGN A;  4BLG A;  4YS2 A;  2CQG A;  1V3R A;  4ZCI A;  2PA8 D;  2R7X A;  4DSI A;  3CT9 A;  2YNF A;  2ZH5 A;  4DPW A;  1M5S A;  1OQ3 A;  2OPS B;  5HN0 A;  3OL7 A;  1UA0 A;  3IGV A;  5JXS A;  3FJ2 A;  1UFW A;  3H98 A;  2YWG A;  1S9G B;  4OIX A;  4WP9 A;  4ZPA A;  2KHD A;  2DYA A;  3GFH A;  2YNI A;  4O0I A;  5D4P A;  2HHW A;  2F8H A;  4J7C A;  5KFA A;  2EKN A;  4B3T F;  2I5J A;  2JLE A;  2MEW A;  4ZP7 A;  3M1V A;  6AT1 B;  3PY8 A;  2DGX A;  1RBL A;  2ZJP Q;  1KHV A;  1PC4 A;  1F3F A;  3Q24 A;  4RUA A;  4P2M A;  2BOP A;  3L7O A;  3MTK A;  2V68 A;  4Y34 A;  3QJL A;  1HBU B;  3F56 A;  2CNK B;  2ZZM A;  3VGU A;  1V5I B;  2AJ2 A;  4O3P A;  1FO1 A;  1GTH A;  4OI0 A;  3QGG A;  1X8D A;  1FK9 A;  2OMO A;  3PEJ A;  2HVH A;  1HWK A;  3B4D A;  2EXU A;  4WXW A;  4WE1 B;  2UUC F;  3D9B A;  3AOD A;  3CCV S;  3IWX A;  3RG6 A;  4WIQ A;  2N3L A;  5DLF A;  3PTW A;  2H48 B;  3MPY A;  4YUD A;  4DV0 F;  4M95 A;  3UR3 C;  1XN9 A;  3LA0 A;  3GE9 A;  2AEM A;  4YOE A;  4PWD B;  2VIH A;  3T1H F;  1HNV A;  4PCQ A;  2NUH A;  3HDS A;  1UW4 A;  3MM6 A;  1KLM B;  2CG8 A;  3D54 A;  1HKA A;  2EFO A;  1YJT A;  1FNO A;  1YRX A;  3U1N A;  3GJS B;  4I7F A;  2VBZ A;  3OTC A;  4MMO A;  4M5K A;  4ZKA A;  3KHG A;  1NKE A;  3QRP A;  1FJC A;  3CD7 A;  1I1G A;  1Q16 B;  4U8Y A;  2X1B A;  1B0V A;  3DXS X;  2HQG A;  2ZBQ A;  3PM9 A;  2ZE2 A;  3QFH A;  4KH1 B;  4U96 A;  3NMR A;  4LF5 F;  1K44 A;  3HFV A;  3BRE A;  1TV6 B;  2GHP A;  2QSW A;  3GV8 B;  1VQ7 S;  1F60 B;  4K50 A;  3HD1 A;  3O3L A;  4RW8 B;  4F50 A;  1KVJ A;  3THV A;  1SI9 A;  4CO5 A;  2OEM A;  1UA1 A;  2RDJ A;  1WHX A;  3TNV A;  2GVD A;  1CJV A;  4ZP9 A;  1YJN S;  2A10 A;  4LF4 J;  3UDC A;  4BHQ A;  4CTA A;  5K20 B;  3MR2 A;  3Q83 A;  5KT5 A;  1R89 A;  2UUT A;  3GYX B;  3PW5 A;  1N52 B;  2RIL A;  2MZR A;  4RUC A;  3MMJ A;  2ASD A;  2CJ9 A;  2G0I A;  3CCE S;  4OHX A;  3TWZ A;  2PFD A;  3CNQ P;  2GHV C;  1SQG A;  3U27 A;  3DOL A;  5KTQ A;  3GCX P;  2IA0 A;  2RVJ A;  1F1B B;  4RW9 B;  1XER A;  2IRY A;  3MAA B;  3ENW A;  4CO1 A;  3Q8R B;  1VLY A;  1XJW B;  4IFY A;  1S0O A;  4CLU A;  1A7G E;  5IS2 A;  3S01 A;  4DQQ A;  1P9Y A;  4ZVO B;  5B0D A;  4MTP A;  2KB2 A;  3M32 B;  4NLD A;  1SC6 A;  3ZNJ 1;  1KFS A;  3I9Z A;  1HNX F;  4XDD A;  4URG A;  4M94 A;  3HJV A;  4Y28 C;  4NZ6 A;  4M5G A;  1F9H A;  2DT9 A;  2QZ8 A;  4IG0 B;  2CWK A;  2YX1 A;  1KFD A;  2XY6 A;  5LM7 E;  1FRI A;  2BE2 A;  3MGJ A;  1WC5 A;  2CJY B;  2PMW A;  1VRT A;  2QT7 A;  4TXS A;  2KXN B;  2ATL A;  2GS8 A;  3K89 A;  5BXI A;  1FJE B;  2MQL A;  1SIW B;  4CDI A;  2OFG X;  3M4X A;  3UVJ B;  4E2F B;  4XK8 C;  1WHW A;  2ZVI A;  3I4P A;  4DG1 A;  1YJW S;  2HZV A;  1R0C B;  3A8J A;  4NA3 A;  4QJV A;  5IC4 B;  2R7W A;  4UY8 5;  3OTE A;  2EPI A;  3JQK A;  3L09 A;  3IFE A;  4RW6 A;  4DR7 J;  3EGN A;  3JB9 k;  2BAC A;  3ISZ A;  2GJF A;  1BD6 A;  4ETX A;  1LWC B;  3IRW P;  2HWH A;  4UST A;  2MSS A;  1HQU B;  1RE1 B;  3GSI A;  3MPU B;  2GHW A;  2FZC B;  2J8S A;  2BAN A;  3FDS A;  3NNA A;  3SYZ A;  5DDP C;  3HT0 A;  5CAB A;  4DL7 A;  5JVG Q;  2IDL A;  1ZET A;  3RRG A;  3UN3 A;  4FXV A;  4OI4 A;  3TZY A;  2HWT A;  1C1C A;  4KT0 C;  3WX8 A;  2G1D A;  1DRZ A;  1PYT A;  4NPO A;  4OI6 A;  3IP0 A;  5AE2 A;  4F0K A;  2BE9 B;  4WU3 A;  4YY3 J;  4HI1 A;  4F3O A;  2FHO B;  1DLO A;  3I4H X;  3Q89 A;  5HI7 A;  3AQP A;  3QRR A;  3TYT A;  1OJ4 A;  4MK8 A;  5B0C A;  5HO4 A;  2HRY A;  4ZVS B;  2RDI A;  1U1L A;  1OWX A;  3UN5 A;  1HA1 A;  3MM9 A;  2FY1 A;  1OY9 A;  4IH5 A;  3MCO A;  4TU9 A;  5DM7 Q;  2W1B A;  3I0R B;  4P72 A;  2IMW P;  4TQS A;  2J7U A;  3O8W A;  4WK1 A;  3AOA A;  3PRD A;  3TAP A;  4MIW A;  4RNO A;  3G8T A;  2UU9 F;  1X5T A;  2XYG B;  2X1F A;  3HK2 A;  3O6Q A;  2C3M A;  2RU9 A;  2QA4 S;  2U1A A;  2EI5 A;  4DR3 F;  3MUR P;  2DIU A;  1H2V Z;  1WTB A;  2X1G A;  3FFI A;  3Q2T C;  3CCZ A;  4FXD A;  1URN A;  1EAY C;  5IM0 A;  2FDN A;  2HIY A;  2VPZ B;  3W9I A;  4U8V A;  4DR2 J;  3VR1 A;  1BLU A;  1UTA A;  1RI7 A;  2WVF A;  3C6T B;  4Y2M A;  5D4L A;  1OYD A;  1IUJ A;  1JNZ B;  4FXW A;  4RW8 A;  4Y2C A;  2DHA A;  3TA2 A;  5HVG A;  5F9L A;  1RJJ A;  1LEO A;  3LAN A;  1I94 J;  4KIA A;  1S72 S;  2HHX A;  1NSA A;  3PXG a;  4ECW A;  2ABY A;  2CPY A;  4ED0 A;  2CPH A;  1U8W A;  1HBM A;  4J37 A;  1RK8 A;  3DRR B;  4B3T J;  4USH A;  1S99 A;  2VPY B;  2CQP A;  3WDO A;  1T05 A;  2ZHB A;  3CC2 S;  1N33 J;  5A0Y B;  4NI2 B;  3HJF A;  2GIF A;  3BYP A;  1TKX A;  3C14 B;  4KHM A;  1NJZ A;  1VI7 A;  1AFI A;  1DJ0 A;  4WXO A;  2RHS B;  1TL1 B;  1Y7P A;  2QA1 A;  4MK9 A;  2FLP A;  2MGZ B;  3G8Q A;  1SUQ A;  2M8H A;  1AUS L;  4WKR A;  1NCL A;  2MZQ A;  4TN2 A;  3G2X A;  2DPJ A;  3PRV A;  5KFR A;  3K5L A;  3KOA A;  3G8S A;  2V2V A;  3A8I A;  4X64 F;  3J7Z T;  3MUV P;  2UUW A;  4RWW A;  2E66 A;  3EE3 A;  4WZQ A;  4V19 J;  4X4T A;  4DL6 A;  1RYS A;  1HI0 P;  1WUU A;  2GIQ A;  3BO4 A;  3MEE B;  3JYT A;  1OYE A;  2UUB F;  3LP2 B;  1YHQ S;  3G82 B;  1FVS A;  4FBT A;  2LEP A;  1JQG A;  1RT4 A;  5AE3 A;  3UE2 A;  3J7A 1;  1FKO A;  5D6G A;  2W2P P;  4I7F B;  5KT3 A;  2CVE A;  3Q0A A;  2HQD A;  4EZ6 A;  3KTQ A;  2XCA A;  1RT1 A;  3G6Y A;  3KK1 A;  2D69 A;  1MMD A;  2ZWO A;  2COL A;  2ZE2 B;  4JI4 J;  1RP5 A;  1JLF B;  3RB4 A;  3QFW A;  4OJ3 A;  5EWG A;  2VA3 A;  2WVB A;  3CO0 P;  4MKB A;  3RUB L;  3K5O A;  2FGC A;  4LF4 F;  1S1T B;  3POT B;  1LWC A;  1QAI A;  4FF1 A;  4J9O A;  3NGS A;  3FBC A;  1DTT B;  2DNP A;  4ZVG A;  4LBH A;  2IVF B;  3R8Y A;  4GVB A;  2DGT A;  1PJ5 A;  2AYE A;  1FK9 B;  5B08 A;  1IWG A;  1S12 A;  5B0E A;  4AQY F;  2UV8 A;  4DS5 A;  2XI2 A;  3CCQ S;  3W2V B;  4UOG A;  4WKY A;  3CJ5 A;  3UCU P;  2BRK A;  4NA1 A;  4I2Q A;  3IWL A;  1NRK A;  2VBW A;  1IBM J;  4ZS6 A;  3TZX A;  1Q0N A;  2KVQ E;  1TP7 A;  3GIJ A;  1N34 F;  1TVR B;  4TY8 A;  3IR5 B;  2D7S A;  2BDP A;  1SCJ B;  2KVI A;  2CWX A;  2L9N A;  2PDA A;  3DRY A;  4DN9 A;  3EYZ A;  1K9M T;  3QRQ A;  2HND A;  3IM9 A;  3CCW A;  1U47 A;  1QSL A;  1TQL A;  1NZA A;  1YQH A;  2B5J B;  4DV6 J;  3DC2 A;  2LEB A;  5ITH A;  2PN6 A;  4ZLP A;  5A2Q Y;  1Q78 A;  1RTJ A;  2E7V A;  2FHK A;  3MR6 A;  5KOX A;  3UCZ P;  3D67 A;  3DDN A;  2D41 A;  2MY8 A;  2B7C B;  3TAM A;  2V69 A;  1JLC B;  3D0H E;  4LRE A;  2FZK B;  2OSR A;  1TFY A;  2QV6 A;  4NZ7 A;  2C3O A;  1S6P A;  3R2C J;  3HCX A;  3QLH B;  2KYZ A;  5CD4 A;  4WTY A;  3DM2 A;  4JBC A;  1R43 A;  1HHT P;  4JI6 J;  1S49 A;  4KHR A;  1VRT B;  1WKL A;  3QSI A;  1V9O A;  3VGV A;  2C1E B;  3C2P A;  3GJQ B;  1LWE B;  2B9X A;  4MFB A;  2E1M C;  3EZ5 A;  2FLN A;  2XWX A;  4AT1 B;  1DQ9 A;  3MUM P;  3AOB A;  5FDL B;  1WEX A;  2JH3 A;  3DU5 A;  4CYU A;  3S8S A;  3GII A;  3VAL A;  1JLE A;  1IQT A;  1Q53 A;  1S4F A;  2M5Y A;  2ILZ A;  4CNZ A;  4YR2 A;  4ED8 A;  5E5N A;  3HPO A;  4O0N A;  1R0A B;  3UDE A;  2DH9 A;  4J9R A;  2AEF A;  1PC5 A;  4DL2 A;  2CAD A;  2XWY A;  2AX0 A;  3TX0 A;  3IS9 A;  1RBO B;  2V4J A;  2MQQ A;  4F26 A;  4PQA A;  1RHK B;  3KLG B;  5KFF A;  2F9J A;  2YWF A;  2UUA J;  1NSP A;  3N6M A;  4QIW D;  4Y2I A;  5HAT A;  4V19 X;  2JC1 A;  5A0Y A;  2MTL A;  3HHD A;  2EFP A;  3MMA A;  5AJ3 F;  2UXD J;  1AXQ A;  2LEC A;  2ZJR Q;  2J7K A;  3H2V E;  1CJU A;  2IAJ A;  1TMM A;  4MH8 A;  1SJF A;  3JAM Y;  3EJM A;  3M7V A;  5G0R B;  4WFA Q;  2IA6 A;  3OT9 A;  2H4W B;  3ENA A;  1REV B;  2YY3 A;  2XHW A;  3CDE A;  2R8J A;  4MIB A;  2L48 A;  1MML A;  4KFB B;  3TUI C;  1HI1 A;  2CQ4 A;  2DNR A;  4WFN Q;  2HMI A;  4TVA B;  1TKD A;  4ZK7 M;  1TV6 A;  4W92 B;  1VHI A;  2W2M P;  1GEH A;  3D6T B;  3PO4 A;  1SB6 A;  1SH2 A;  2FJB B;  3MEE A;  4ZJQ A;  3PX6 A;  2LA4 A;  2W2N P;  1SV5 A;  4LFA F;  2CJB A;  2F65 A;  2LVW A;  3E51 A;  3LGM A;  4QWC A;  2B8P A;  3MM5 A;  3H5S A;  3E2E A;  4IFV A;  3I32 A;  3KJF B;  3ZTO A;  1X5O A;  2PI4 A;  2L3M A;  3AHP A;  3P96 A;  4NL5 A;  1A9N B;  1V3Z A;  3EXY A;  4HT5 A;  3ISN C;  1FVQ A;  2HLT A;  1PIL A;  1ZBT A;  4K2X A;  1PSD A;  3P5T L;  3PDN A;  3SQO P;  5J2M B;  2AD9 A;  4NXN F;  5D4N A;  4N77 A;  2XEX A;  2K7J A;  2G13 A;  2VAS A;  1ROF A;  3NEK A;  3BO2 A;  2ZEJ A;  3AJ1 A;  3EDR B;  4EEY A;  3THP A;  1MW7 A;  4WE1 A;  4A4J A;  1DLO B;  5FLX U;  3CUN A;  2XGP A;  3R2D J;  1NAQ A;  2BM0 A;  4I2P A;  3S7R A;  2EG2 A;  2VG6 B;  2ZC4 A;  4LSL A;  3MM9 B;  1UWB A;  4NRU A;  4B17 A;  1FJG F;  1APS A;  1KN6 A;  2EBG A;  4OYA A;  4DV2 F;  2IDE A;  3W5Y A;  1K0V A;  4DN0 A;  2QA4 G;  4ZVT B;  3A8K A;  4I2Q B;  4AXJ A;  1TKT A;  3M6U A;  1YBT A;  1RAH B;  2R7Q A;  1X0P A;  2N3O A;  4ECT A;  4LUB A;  4CNY A;  4JI7 F;  4JV5 J;  1NU4 A;  4OZ5 A;  1TK0 A;  2HVI A;  2GGP B;  1IKY A;  1J27 A;  1RT5 A;  3PYG A;  4HLB A;  1JJH A;  3SCI E;  5C2G A;  2OGU A;  4U67 Q;  5DGA A;  4Q8F A;  3CWJ A;  1YKW A;  5KFD A;  4NLR A;  2AF6 A;  4DHV A;  1Q82 T;  3L95 X;  1BQM B;  3FUY A;  3CW2 C;  3EUN A;  3LP0 A;  4ZPW R;  4BWJ A;  3SZ2 A;  1J5E F;  3MEG B;  2W9A A;  2XGQ A;  1AUD A;  1YWX A;  5D8H B;  1UFK A;  4FNI A;  4IOA Q;  1TUV A;  5LJ3 Y;  3CCS S;  4JI1 J;  1EAR A;  1DBD A;  1URR A;  2VG5 B;  3K2Y A;  4U9R A;  4CTA B;  5C25 A;  2V34 A;  1FX4 A;  4DFP A;  4JV2 A;  2B5J A;  3TJ9 A;  9RUB A;  3M8Q B;  2J9C A;  2ZJQ Q;  2YNH A;  1JJ4 A;  1D8Y A;  1U1K A;  4M5I A;  2VC0 A;  3FQL A;  2M4M A;  2ZD1 B;  3BDE A;  3DRR A;  3N01 A;  4DXL A;  3HO1 A;  1M1G A;  3J7Y U;  2RT3 A;  1U1N A;  1F2G A;  1X4C A;  3D1H A;  1JK9 B;  3W7B A;  4A47 A;  1EKS A;  1FE0 A;  5LSR A;  3MXH P;  3H40 A;  1RLC L;  3OSN A;  3CPW R;  3ZZY A;  4KSE B;  5FDL A;  5DZ6 A;  3NP5 A;  1JJC B;  3D5M A;  4KPC A;  4C0H A;  1DZ5 A;  1RT2 A;  5ADZ A;  4P74 A;  7FDR A;  1RTH B;  2ZIT A;  2VJV A;  4ECR A;  5KAK A;  1R0B G;  3HX9 A;  1CQM A;  1T7P A;  3UPF A;  4N41 A;  3C6U B;  1U48 A;  4EBC A;  1S4E A;  2VC1 A;  1LWF A;  3BGR A;  4C8M A;  4D3G A;  2KG0 A;  4NE9 C;  1VJQ A;  3GYN A;  3U7J A;  4CP5 A;  2AX1 A;  2HRT A;  4TLQ A;  4X4Q A;  1J2V A;  1X4B A;  4YHH F;  4TU7 A;  5ETN A;  2BUN A;  1UP1 A;  2G0J A;  2VFS A;  5SZT A;  1PYS B;  2K3I A;  3ADA C;  3HVW A;  5CCM A;  4DSE A;  3BDP A;  3M8P B;  5DGB A;  2GO8 A;  2ZBP A;  4QYZ J;  4RBV A;  2IMO A;  3G82 A;  5LT5 A;  1ZPV A;  3GR1 A;  2BZ2 A;  2ZM6 F;  5J2N B;  4R8U A;  1YG0 A;  2CPZ A;  3VQS A;  1YJU A;  2K2P A;  1XNQ J;  3ZZ0 A;  4RZR A;  3PX0 A;  2FJX A;  4F2R A;  2FD2 A;  1E6V B;  2W8K A;  1G6B A;  2ZHO A;  4JI2 J;  2HHT A;  4DX5 A;  4K0K J;  4IH6 A;  3OBI A;  2A2D A;  2BKN A;  2C2Z B;  5H9F K;  2XO6 A;  1H72 C;  3P3D A;  2R8I A;  5ETQ A;  2M8D B;  3NCR A;  1F9E B;  2ZUA A;  4B3S J;  3SV4 A;  2OLW A;  2IM2 A;  5MLC V;  2HWI A;  2NQP A;  2ILY A;  1Z2Z A;  2O01 C;  4G65 A;  1HNW J;  2C28 A;  4L73 A;  4NWB A;  4GVL A;  5HLF B;  2R2U A;  4DR4 F;  4PEO A;  2CNO B;  3M8W A;  1RAJ A;  3VAI A;  3H2L A;  1BWE A;  1BGX T;  1NM2 A;  1DTT A;  3BB5 A;  1VJW A;  1FFS B;  1S1W B;  1ZAV A;  3SQG B;  3MR3 A;  4K4X A;  2UUC J;  1QAY A;  2IVM A;  1OS5 A;  2V8P A;  3P4U B;  3FK4 A;  4I1T A;  4YEA A;  4OJH A;  5DJB A;  4TQR A;  3L3C A;  2MKH A;  5GAG I;  3DFE A;  3M2V B;  1GTE A;  2XLI A;  3HXM A;  3PZP A;  4CQ1 A;  3HVR A;  3RAX A;  3MF5 A;  1T03 A;  3GV7 B;  4GKK F;  1N8R T;  3WZ0 A;  2C2O B;  1RT3 B;  2R2T A;  5EWE A;  3JXO A;  3MMB A;  3R9L A;  4LF2 A;  1E6Y A;  2CPF A;  2ZC3 A;  1JKH A;  4DCP B;  3R5A A;  3AAW B;  1U25 A;  2UXC J;  1RKI A;  2NPI A;  1AFJ A;  3PFO A;  5AT1 B;  4WP8 A;  1SH0 A;  1P27 B;  1WG5 A;  2FIU A;  3KKF A;  3VF0 B;  4QYZ K;  1UWB B;  4F4A A;  4B02 A;  4WBF A;  2W2O P;  3BSC A;  2JLF A;  3ENQ A;  3QWP A;  4NAS A;  1CEZ A;  2OUG A;  4F04 B;  3HP6 A;  3D6M B;  3OJS A;  5HQM A;  3L4B C;  4ZIV A;  1RZM A;  2M2B A;  5KFH A;  2C2D A;  3QO9 B;  4C8K A;  3R7S B;  2MXY A;  1HPZ B;  1XNR F;  3I96 A;  2QLW A;  1FRL A;  1GNK A;  3BR9 A;  1ZM2 A;  3CDA A;  3EPI A;  3K7R A;  2OAU A;  4J9U E;  1G7C B;  1RAF B;  1T9T A;  2PMZ D;  2HHU A;  2LQ9 A;  3VVT A;  5DDQ C;  1KS2 A;  1H38 A;  2DY1 A;  2GC8 A;  3D2W A;  4MKY A;  1FRM A;  4LQ9 A;  2HAF A;  3TA1 A;  1R8H A;  1HW8 A;  4RW9 A;  1Q7Y T;  1F6T A;  2ZBR A;  3GG0 A;  4URQ U;  4U7C A;  3OFG A;  3MR7 A;  3ZNU A;  1HLW A;  1IBK F;  1UEV A;  2VOD A;  2HBQ B;  2JHE A;  4C4W A;  1SV5 B;  1FJG J;  3SEO A;  5IC6 B;  2AIR B;  2BX6 A;  3GSD A;  1WC4 A;  2DTJ A;  2H1Y A;  4M5D B;  3W3S A;  3OR2 B;  5KFK A;  4GVB B;  2DCU B;  4OHV A;  3GG1 A;  5IQQ A;  2QX0 A;  5CYM B;  4YQW A;  3K5M A;  1Q8L A;  4YB6 A;  2YQ3 A;  4BBY A;  4X4P A;  3QAT A;  1ZM3 A;  2K1R A;  5F8N A;  1BQN B;  4IG0 A;  4M5H A;  4OZ2 A;  1CS4 A;  5H9E J;  4WFX A;  1NB7 A;  4Z2X A;  2PT0 A;  2I2Y A;  3UQS A;  2QGF B;  1N36 J;  4JI6 F;  2AGQ A;  2Z8Q A;  4G1Q B;  5A8K A;  4LT6 A;  1HNI A;  4OV6 A;  4J9L A;  3CC4 S;  1CJU B;  4KGZ B;  2DPI A;  1QVF R;  1XR5 A;  3DMJ A;  2A18 A;  2K3K A;  2Z4P A;  5B0F A;  4ZCM A;  1Q86 T;  1S1V B;  3V81 B;  2E7W A;  2ZDP A;  2VG6 A;  1CJK B;  3PV8 A;  3KDN A;  1G1X A;  4LF1 A;  1M1K T;  3NCP A;  4HAC B;  3DYA B;  5J2Q B;  1YJV A;  2ZKT A;  3AXM A;  3J81 Y;  1D0E A;  1HNZ F;  2DRA A;  3UD5 A;  2D3U A;  1DAR A;  1WG4 A;  2I0X A;  3F0N A;  4ED2 A;  1YJR A;  2MHN A;  1Y9O A;  4UUW A;  1FES A;  1KQK A;  3CCJ S;  2Y9H A;  5DDR C;  3BQ2 A;  3KJN B;  2HNY B;  1RHM B;  2HFV A;  2DNN A;  2XMK A;  4DUT A;  4ECX A;  2AYG A;  4DR4 J;  1B0P A;  2QTW A;  1IKW B;  4DFK A;  1EX8 A;  1MN9 A;  4C8L A;  1NXI A;  3Q8Q B;  1IBL F;  4LF9 J;  4OX9 J;  1JLQ B;  2WOM B;  3KNG A;  3NAH A;  2YNG B;  5KT2 A;  4MIA A;  4KO0 A;  2DHS A;  1WOS A;  2DD8 S;  5CYQ B;  4PG7 A;  1FCA A;  1GFW B;  2MPU A;  2FJE B;  2PGC A;  3M2U A;  4F7V A;  1WF0 A;  4YB7 A;  3EM1 A;  1JLE B;  1NSK L;  3VAK A;  9ATC B;  2A3J A;  3FSY A;  4ED1 A;  4C8O A;  3BQ1 A;  1A6L A;  2C22 A;  4I6A A;  5C24 B;  2IJN A;  1U1Q A;  2FVS A;  4ID5 B;  1S1W A;  3RYL A;  4B08 A;  4ENO A;  2CQD A;  2D3O 1;  2HBR B;  1S9G A;  4CLT A;  2CQ0 A;  5CAA A;  4CLF A;  1SJ4 P;  2YKM B;  2Z2L A;  1S6Q B;  2HZC A;  4K5S A;  8ATC B;  1IM4 A;  4PAB A;  4YR0 A;  4DR3 J;  2FC8 A;  5HLF A;  2LEA A;  2AJQ A;  4Y2K A;  3ZZZ A;  3ZFV A;  1M5V C;  2B9W A;  2R7U A;  1NK4 A;  4EBE A;  4UOF A;  3TOQ A;  4OYB A;  4CT9 A;  3H20 A;  4DU8 A;  4DF8 A;  4CCH A;  5GAD U;  3DLL Q;  5J1E A;  4ZLL A;  4OX6 A;  3EWG A;  2Q79 A;  4A8S A;  3PW7 A;  2ZOM A;  4K8R A;  3P45 B;  2ZDO A;  2QIF A;  3LP1 B;  3TRG A;  1YRU A;  2B7B B;  3GON A;  3MPD A;  3UI3 A;  1S1U A;  2A2C A;  1SC4 B;  2OTL S;  3EVM A;  3NBP A;  1S0V A;  3FGV A;  1DY3 A;  2VH7 A;  5ETR A;  5C25 B;  3PW0 A;  1IBK J;  1VR6 A;  4UOH A;  2HQF A;  1X4G A;  4TKT A;  3CDW A;  1D3W A;  3BGO P;  1H7X A;  4CLL A;  1IR1 A;  3DLG A;  2VFT A;  2YX7 A;  3AXK A;  3R5G A;  1T11 A;  2B51 A;  3NCQ A;  3RU0 A;  3K5N A;  2UXD F;  4ZHR A;  2R8K A;  1ICE B;  2JOQ A;  4EGL A;  3GTY X;  3JSM A;  5A8R A;  2AU0 A;  2FJA B;  5L1L A;  1LFW A;  3EIC A;  5K8O A;  4IDK B;  4XPE A;  3ITH A;  1RAC B;  1U2R A;  1VFJ A;  2N82 B;  4PYD A;  4Z37 A;  2IJF A;  1VQ9 S;  2OI2 A;  4OJG A;  1WKJ A;  3C6U A;  4P2X A;  1PO6 A;  2DIV A;  1RAO A;  3W2W B;  5I3U A;  2OP5 A;  3T5J A;  4UY8 T;  2KTQ A;  5KFB A;  3GU0 A;  3DCA A;  4LQ3 A;  4PXD A;  5GAG U;  2QO3 A;  5HAO A;  1K1S A;  3RTV A;  1OIA A;  1HNZ J;  2EWH A;  2UV8 G;  4N56 A;  4NOH A;  2GAG C;  3KJQ B;  1RWV B;  4DL4 A;  1YGY A;  3C46 A;  3CB4 A;  2BAN B;  2B6A A;  2ROG A;  3V4M A;  4AUK A;  4B9U A;  1KKH A;  5M2P A;  3H4D A;  3CE8 A;  4CH0 S;  4R8U B;  3BSO A;  1RT3 A;  1WEL A;  2IVY A;  4GRS A;  4USW A;  5E3A A;  1FDN A;  1LFP A;  3HHL B;  4H4K C;  4KV8 B;  4DWI A;  4ZCL A;  5GAH I;  4DSJ A;  4QIE A;  4USM A;  5LSO A;  4DSF A;  1N6Q A;  1VBK A;  2N4C A;  1N0U A;  2E29 A;  4PWU A;  4BS2 A;  2FLO A;  5EWF A;  4JI1 F;  4LF7 F;  4YR3 A;  4WJB A;  2BKO A;  2GVZ A;  2H51 B;  2X51 A;  4OHZ A;  3K58 A;  1AZS B;  3QO9 A;  2X1A A;  2C3Y A;  2M52 A;  3UN2 A;  3ZZU A;  3CJ4 A;  2IYG A;  1RWN B;  1BE4 A;  3QT5 A;  1MSW D;  4PQU A;  2ZH8 A;  3W2V A;  5BR8 J;  1QSS A;  3KLF A;  2FGO A;  1NHK L;  2DGW A;  3T1Y F;  1GMW A;  1OPZ A;  2ZVS A;  3KUG A;  4X66 J;  2Q66 A;  5D3G B;  2CPE A;  3M1V B;  4RLE A;  1ULR A;  3UCG A;  1R7I A;  4ZIW A;  2H5I B;  4ZPD A;  2JSX A;  2E7X A;  1Y5L B;  2WZ1 A;  2YVS A;  3ILO A;  2OO4 A;  3VAJ A;  3I5C A;  2W7O A;  3EGW B;  5KFO A;  1XMB A;  1RWM B;  4PXE A;  2CKW A;  2CUY A;  4OYW A;  4F3Q A;  2ADC A;  2IY5 B;  2MZJ A;  2GVD B;  3AJ2 A;  4AD6 A;  3LGH A;  3PYD A;  2BQU A;  2ALY B;  3LOU A;  4I64 A;  1S48 A;  2OH2 A;  3O44 A;  1I51 B;  4XAK A;  2KYX A;  2WON B;  1XNR J;  5K5M A;  1SKW A;  2RS2 A;  3TO8 A;  1RYR A;  2CPD A;  4NCA A;  1EHW A;  2N7C A;  2FYX A;  4OI3 A;  4QIF A;  1JMT A;  1H74 A;  2CRL A;  1D9A A;  4ZJO A;  5CHC B;  1LKZ A;  2J9D E;  3E3X A;  3RW7 A;  3TVZ A;  3LPE A;  3D3B J;  3BO3 A;  2RH3 A;  3N0V A;  5EUH A;  3B82 A;  2E5I A;  3JSB A;  5IXU A;  2GFF A;  3H25 A;  4OZ1 A;  3DYA A;  2QMU B;  2OPQ A;  2CZ9 A;  4RNH A;  2JRS A;  1RT6 A;  4OLP A;  4JI8 F;  3B4M A;  1PGZ A;  1QAX A;  3IGN A;  4DX6 A;  1UAW A;  2VKZ G;  4IKA A;  2MDA A;  4NLY A;  3PO5 A;  1NK9 A;  3ICL A;  2DXE A;  4LSZ B;  2B9Y A;  5RUB A;  2V8G A;  3I82 A;  4J9V A;  2HNZ B;  1QE1 A;  2W01 A;  3NOG A;  3DLE B;  1LW2 A;  3BN7 A;  1PAE X;  3R6L B;  5ETL A;  3W1Y C;  3ILI A;  2OTJ S;  1T3O A;  3MMA B;  2JWN A;  1Y00 A;  5AJ3 J;  2K1R B;  2J0W A;  3NMA A;  1W26 A;  5KFY A;  1RGV A;  2L41 A;  2ZH1 A;  3PEH A;  3BGF A;  2DO0 A;  1C2P A;  3Q8V A;  2CDQ A;  3DXB A;  1WF2 A;  4G1Q A;  3TA0 A;  5A8K B;  4KFB A;  4Z7C A;  3Q8S B;  1S77 D;  2OEL A;  2C2N A;  1HBU A;  4LSN B;  1SC1 B;  4LRF A;  3W8G A;  2PO4 A;  2P6S A;  5ETM A;  4C3M A;  4B3R F;  1LK7 A;  4P6Q A;  2DNO A;  3OL8 A;  3BSA A;  4DZ6 A;  3QT6 A;  3BPD A;  5D4O A;  1CQN A;  3POT A;  5KFZ A;  4Q0B A;  2VUG A;  5GMK a;  3PKY A;  2H5E A;  3ENV A;  2GA7 A;  2FQQ B;  4QQB A;  2XG8 A;  3H5Y A;  4DV4 J;  1IKX A;  4OX7 A;  4EYH B;  1KSP A;  3OUY A;  4GKJ F;  4BC7 A;  1NK5 A;  1UMJ A;  3T19 A;  3DHW C;  3CJT A;  2XSJ A;  2Y0B B;  1N5Q A;  3N79 A;  5K14 B;  1SQE A;  1SUQ B;  1N0V C;  3C19 A;  2CAJ A;  4GC7 A;  1JWW A;  2LXU A;  1NLK L;  2B6A B;  1BQX A;  2CDR B;  3AD8 C;  3IM8 A;  3OHA A;  1UPM B;  3TQE A;  3HMJ G;  1OMS A;  3DLB A;  2HVZ A;  4B3M F;  1X4H A;  4B9T A;  5L8R C;  1DTQ B;  2IHR 1;  2CZ4 A;  1ITP A;  4DV5 J;  2JVO A;  1QY7 A;  4ZPT R;  4ES1 A;  3K59 A;  1KEK A;  4ED3 A;  3T5K A;  2QLJ B;  1FDD A;  5IQ6 A;  4OYM A;  1CJV B;  3W64 A;  4O23 A;  1L3K A;  4KB7 A;  2P8I A;  2N4D A;  5A76 A;  1C0T B;  1HYS B;  2HQC A;  3G87 A;  2G2Z A;  1FDA A;  3FCW A;  3MWB A;  3KJV A;  2CJK A;  4ELT A;  3GCW P;  2V0N A;  2BEF A;  2EG1 A;  1RTI A;  1D9D A;  4B9S A;  1TL3 A;  5CZX A;  2GQC A;  2RDD A;  2D3Z A;  2E5J A;  2Q6C A;  3DDK A;  3GFX A;  3KDO A;  3K8V A;  2MKJ A;  3DOL B;  4ICL B;  4LR8 A;  3R5B A;  1NDP A;  2WVD A;  5F8L A;  2CPI A;  3I31 A;  1TK8 A;  1PAU B;  5BJR A;  1WTF A;  1T9W A;  3V81 A;  2CZV C;  4QBU A;  1B3T A;  1VQS A;  3KYL A;  2HFN A;  4KYZ A;  3FMB A;  4HTI A;  2D9P A;  1X9W A;  3EZO A;  3GP9 A;  2HZA A;  1C4A A;  5T41 A;  2DO4 A;  4I56 A;  4XTT A;  1ELO A;  1HBN A;  1K47 A;  2ZWP A;  3DKD A;  4OJ1 A;  4UT4 A;  1RAA B;  3M8Y A;  3QZ8 A;  2VJU A;  3V6H A;  3OVB A;  4DJB A;  2AHO B;  4B3O A;  4LJM A;  4RJV A;  3LTO A;  3W8P A;  3CUL A;  4CLP A;  5KT4 A;  1J5O B;  4U95 A;  2GNK A;  2KT3 A;  3TZW A;  1N54 B;  4PZV A;  1MNE A;  3WX4 A;  4F0H A;  2MQ8 A;  5KFX A;  3CC7 S;  3W5X A;  3S1T A;  4AFF A;  4YDX A;  4RUH A;  3NS6 A;  3JSM B;  4UTG A;  5HP1 B;  2QL7 B;  4MYT A;  3VGT A;  3R5J B;  5LXY A;  1YJ7 A;  4ZA1 A;  4DUY F;  1P1L A;  2Y3Y A;  2I1R A;  4X84 A;  2MKK A;  1NK8 A;  3I9V 9;  4C8Y A;  2AWZ A;  3OSP A;  1FF2 A;  1Q4R A;  1IM6 A;  1LXJ A;  5H9E K;  2NCK L;  4DUZ F;  3M2R A;  4M5M A;  3V4I B;  1C0U A;  2HNZ A;  2MHE A;  3I87 A;  4NYP A;  5IT4 A;  1LW2 B;  3MFI A;  1T95 A;  3M9N B;  2QFI A;  2XMJ A;  4I0W A;  1FD2 A;  4CLK A;  3J80 U;  4DX8 H;  1NDK A;  1I94 F;  1M90 T;  3NXZ A;  4QU7 A;  1T8E A;  1GT8 A;  1ZAW A;  1BXN A;  1QDU B;  1S1V A;  2ZBI A;  2O3D A;  4U6P A;  3NNC A;  3PYF A;  1FXR A;  2R7S A;  1YRT A;  2HGL A;  1DQ8 A;  2VFU A;  3QAE A;  5D0E A;  5KFT A;  1OO0 B;  4QR0 A;  1F5C A;  4NXM J;  1N32 J;  1IVZ A;  2WCX A;  2DNQ A;  2HHV A;  4G1P A;  4WFZ A;  2ROP A;  4ECV A;  2XMU A;  4Q8E A;  1P9Q C;  3T41 A;  3WBZ A;  4BC9 A;  1Q1K A;  2LCW A;  2MST A;  2PD1 A;  2V9K A;  4NLO A;  1C1B A;  2NPF A;  2BYC A;  1F9F A;  4K4S A;  1TTH B;  3CSK A;  2LP4 A;  2YKN A;  3OQ2 A;  2V4J B;  3GIM A;  2FVQ A;  2Y1J A;  2A6M A;  2W8L A;  3RBE A;  1FDB A;  1UW9 A;  2YNI B;  4C8Z A;  5JMN A;  2XMM A;  3T1H J;  1VQK S;  2E9Z A;  2DR7 A;  1VQM S;  2HHP A;  2M0G B;  3TQ1 A;  4FF3 A;  4BDP A;  2BOA A;  2APO A;  2DRD A;  2NYH A;  5LMN J;  3JQM A;  2HAI A;  4LR7 A;  5HJX A;  5GAE U;  4P75 A;  4ZMM A;  4DSL A;  4DCO B;  1VMB A;  2AEJ A;  2RUG A;  5KFN A;  2IM3 A;  2G2Y A;  2HGN A;  3C6T A;  3ISN D;  3FVY A;  3NS5 A;  2KT5 A;  3X1L B;  3PHE A;  4PUO B;  1KVI A;  4MK7 A;  3UR0 A;  2EFV A;  1H6K X;  3KG1 A;  4DMZ A;  5KOW A;  4TYA A;  2DGS A;  2MQO A;  1S97 A;  4P73 A;  2L9D A;  1JLB B;  3ZZP A;  4DV1 J;  3NKY A;  1YBU A;  4KH0 B;  4JI5 J;  2G1H A;  1VHF A;  2FC9 A;  3PAC A;  5J1N A;  2KDO A;  3TP2 A;  4YFU A;  2SXL A;  4JOU A;  3GPA A;  2J76 E;  3MEC A;  3G6X A;  3AH6 A;  4MKV A;  4DSK A;  1TL7 B;  5M2R A;  3AB4 B;  4AQY J;  2QSF A;  4FPR A;  4ZCK A;  2K7K A;  4DPU A;  1FX2 A;  3L9Z A;  2M7S A;  4DFM A;  3AA8 A;  1FA0 A;  1PJ6 A;  2KT2 A;  3KK3 A;  4C9D A;  4NLS A;  2AZ3 A;  2DK2 A;  5F0W A;  4RNN A;  4B9V A;  3ZTP A;  3QJP A;  1TL3 B;  2K8G A;  1LWX A;  2J5A A;  2CQH A;  3CDB A;  2DR9 A;  3UD3 P;  3W63 A;  2GMJ A;  2OPQ B;  1MRO B;  1T9V A;  4NLG A;  3E01 B;  2KFY A;  4RU2 A;  1WAC A;  1HBN B;  1VQY A;  4CRJ A;  4OQJ A;  3HFK A;  4M5D A;  5KG4 A;  1U45 A;  4JI2 F;  3OR2 A;  5F3Z A;  3JYT B;  1FKA F;  1HAR A;  2A0F B;  3FEY B;  3IXQ A;  3DN9 A;  2CPX A;  3HVT A;  2ZH3 A;  2DR8 A;  2R42 A;  1BQN A;  1JXE A;  2RJZ A;  4USI A;  2VA2 A;  3AA9 A;  4WYL A;  1M5K C;  4FF4 A;  4F8R A;  1CSJ A;  4IH7 A;  3ZTS A;  2KG1 A;  2W9C A;  2V2K A;  3KK1 B;  1M5H A;  2VDI A;  1CC7 A;  1Y5N B;  4HHJ A;  4NEY A;  4QPX A;  5A6P A;  3D0I E;  2EBE A;  3MTJ A;  4DV5 F;  2RSQ A;  2IC3 B;  1VQP S;  4X4R A;  4IFY B;  5KFQ A;  2YBV A;  3GZ7 A;  4WZM A;  5GVQ A;  3OL9 A;  4IYQ A;  1SL0 A;  2J7W A;  4KC5 A;  4A46 A;  4CO2 A;  4X62 J;  2UVW A;  3OD2 A;  2MZ1 A;  4CLW A;  3G96 A;  1TZ0 A;  2XTJ P;  1QM9 A;  1X0F A;  1X4A A;  2XYH B;  2GML A;  2J6U A;  2VZ9 A;  1C0T A;  1WD6 A;  1MWQ A;  2OD6 A;  2GCF A;  3KJV B;  2ATC B;  4KY3 A;  1NKC A;  3SFG A;  2OPP A;  4ID8 A;  4KKO A;  3BZQ A;  4KBI A;  2IIH A;  4P9S A;  2EVZ A;  2BE7 D;  1IKW A;  5HQ8 A;  1KLN A;  2LYV A;  3I6P A;  2J0Q D;  1S9F A;  3I55 S;  5EHH A;  2CJQ A;  1X5P A;  2E44 A;  3Q8Y A;  4J91 A;  2XZT B;  4OX9 F;  4I67 A;  4ECY A;  4L72 B;  2HHH J;  2MKS A;  2P5V A;  1KOH A;  3GIK A;  1YJ9 S;  4M1K A;  1KNZ A;  2XSF A;  2KXF A;  3DGP B;  4N7T A;  4Q2M A;  2XM3 A;  2E9T A;  5KFG A;  4DV7 F;  2GX8 A;  3MMB B;  3HM9 A;  5T7L B;  1OY8 A;  2RU3 A;  3PJW A;  1ZS6 A;  2FHJ D;  3IBF B;  3QAU A;  3PR4 A;  5F8G A;  1XWL A;  5HVF A;  1HQU A;  4Q45 A;  2W7P A;  1FT8 A;  2YKN B;  4DUZ J;  3FCH A;  3RGI A;  1LW0 A;  1XMQ J;  1DFD A;  4QIV A;  4HDH A;  2FTR A;  1NME B;  5IT0 A;  2CNN B;  1KON A;  2GGP A;  1IBC B;  4RW4 B;  4CI0 B;  3M6X A;  4X66 F;  3TJA A;  2HVD A;  4LVO P;  4U7U K;  2R8H A;  3B6B A;  3HI9 A;  1GX5 A;  3GLJ A;  2V4R A;  3LP0 B;  3HHN B;  1R3N A;  2KKH A;  4FN5 A;  5IT9 U;  2AW0 A;  2QC3 A;  2DCL A;  4OX8 A;  4ZIT A;  3LWM A;  1N5V A;  2FPH X;  2Z2Y B;  4TU8 A;  5IWA F;  2RUS A;  1S59 A;  3OFH A;  2FHM A;  4HTJ A;  4QW8 A;  2KN4 A;  3DLH A;  1TKZ B;  3T6B A;  1VK8 A;  3DOK B;  3NWG A;  3Q86 A;  1T9U A;  2W9B A;  2J0X A;  4I2P B;  4DV3 F;  4ED7 A;  2ASL A;  4IR9 A;  3SI8 A;  2Y8W A;  2E1C A;  1RHR B;  4X64 J;  1QTN B;  1U7L A;  2Z56 B;  3G9C A;  2V63 A;  2DJW A;  4OV1 A;  4OZL A;  1JNR B;  4YP3 A;  1Y0H A;  3CJK B;  4CIO A;  4UZC A;  5E0O A;  4WCE Q;  2QL5 B;  3OFF A;  1S5Z A;  1HFE L;  3L7P A;  3OTO F;  4FKX A;  2AGO A;  5A6W A;  1TFW A;  1T03 B;  4EU0 A;  4WII A;  2RQC A;  4IRK A;  3OUY B;  3BKU A;  5DLG A;  1IKY B;  4KGK A;  3OXF A;  1FWP A;  2HHQ A;  4KHP J;  2XC9 A;  1GMW D;  4JV5 F;  4USJ C;  4C8N A;  3M6V A;  3BKF A;  1RAB B;  1WC6 A;  4WFB Q;  4LBP A;  3BM7 A;  4Q2L A;  1MWZ A;  1PIE A;  2B56 A;  2DGV A;  1B0T A;  4I6Y A;  3WIU A;  3KHR A;  3Q23 A;  2HLU A;  1S9E B;  1WC1 A;  3A3P B;  4NYZ A;  3DOM A;  4OZN A;  4RO0 A;  3K0J A;  2M3D A;  2AKW B;  2PFF B;  1X31 C;  2DGQ A;  5T14 A;  4DR5 J;  5CQG A;  4F4K A;  1RUS A;  2YNH B;  4W98 A;  4UQT A;  5KFP A;  3UWT A;  3IA0 A;  5KFS A;  4EWT A;  2RHQ B;  5L38 A;  1S10 A;  3AJD A;  4I69 A;  1KC8 T;  3F44 A;  1ZAX A;  2XB2 D;  5M2U A;  3RAQ A;  2QG9 B;  3JQJ A;  5J2M A;  3Q22 A;  4C7Q A;  2H65 B;  2MQP A;  3C8Y A;  4NCG A;  1UET A;  2KJW A;  4MJK A;  4ICL A;  4KE5 A;  4C6A A;  3F73 A;  1QSY A;  1FFW B;  4K7Q A;  5IZH A;  3BN4 A;  5B0B A;  1ZZN A;  1VQO S;  1GXT A;  1XBW A;  3BKT A;  3D66 A;  3JTP A;  4DG1 B;  1VBX A;  4Q0B B;  5KG0 A;  3E8O A;  4UW2 A;  3VV2 B;  3HT3 A;  1D1U A;  2CQ3 A;  1Y3J A;  2KJV A;  1MU2 A;  1YVF A;  3TUP A;  2ZHA A;  4ZPC A;  2DY9 A;  4WU2 A;  4H4M A;  2RKI A;  5F0U A;  1GH8 A;  1UVJ A;  5HRO B;  4B3O B;  2ZNZ A;  1TKT B;  2E1P A;  4X4U A;  1IN0 A;  1CJT B;  2VFV A;  3SDE B;  1IBM F;  1YK9 A;  3VTI A;  3NY0 A;  1FRX A;  1FEE A;  4I6W A;  4LVN P;  1U24 A;  1R8B A;  4OYI A;  4QW9 A;  3MM8 A;  1XNQ F;  1HWJ A;  1UCN A;  2NXN A;  1N34 J;  1Q8I A;  1TEL A;  4LBI A;  1QD1 A;  1R8C A;  2CVI A;  7AT1 B;  2LFV A;  4RW7 A;  2VQF J;  4BWM A;  2MLX A;  2HSE B;  1RWO B;  4P2F A;  3MAA A;  5KG7 A;  3ULH A;  1O5J A;  4KHP F;  3CJQ A;  5KG1 A;  1U4B A;  1FWK A;  3Q2S C;  2I6W A;  1VC0 A;  4ERD A;  1S7I A;  4OZJ A;  2JNJ A;  3M05 A;  2MMY A;  5T7L A;  2NXE A;  2JJ4 D;  3TJ8 A;  2VQE F;  3FZ2 A;  3PW4 A;  2DIS A;  1S1X A;  2OEJ A;  5DQG A;  5LMU J;  1YI2 S;  2J0S D;  1D09 B;  1S7H A;  3VQT A;  3PJ9 A;  4WWS A;  3H90 A;  3CCU S;  4ZVF A;  3OW2 R;  3KLV A;  1KQS R;  1X5S A;  3RZA A;  3SSQ A;  3BJY A;  2Y8Y A;  3I0S A;  4A8Q A;  1T9Y A;  2PEB A;  1VOM A;  3CDU A;  2GMH A;  2GAH C;  1FRK A;  3UNG C;  1KP6 A;  1T9X A;  2RRN A;  1ZYQ A;  3CMA S;  2YWW A;  4P7T A;  4DI6 A;  3P6Y C;  3R97 A;  2XQC A;  4A8F A;  2DB1 A;  1UJ4 A;  2G0C A;  4GC6 A;  3H8Y A;  4LRC A;  3EZU A;  1S6U A;  3GMG A;  5HAN A;  3HZE A;  3QNW B;  2LLZ A;  4R0J A;  2ZH4 A;  3KLE B;  1BMQ B;  5H1S V;  4IRC A;  3TAM B;  1AB8 A;  4B9M A;  4C0B A;  3U02 A;  4KJI A;  3BH7 B;  3KNA A;  3ETM A;  4NI2 A;  3ZO7 A;  3NGU A;  3C14 A;  1NHU A;  2VV5 A;  3A1Y G;  2FJW A;  1TAU A;  5IT9 Y;  1OSD A;  2HIQ A;  2B4V A;  3IR6 B;  3NG8 A;  3JTN A;  4ZVE A;  5HK4 A;  2EKY A;  5GMD A;  4PR6 A;  3CJK A;  4ECZ A;  3IRX B;  3DMJ B;  2LXF A;  1HBO A;  2AJ0 A;  2CIM A;  5ETS A;  2VHG A;  4LF8 J;  2B9E A;  1U0S A;  4DF4 A;  3N9U C;  1ZTW A;  5L1I A;  1M0S A;  2WSC C;  1M5O C;  3UDV A;  2HQ3 A;  3M8S A;  2GJ2 A;  4B3R J;  2N7Y A;  5CD4 H;  2RB7 A;  2ZOG A;  3T5H A;  3S6E A;  1SJR A;  4E8U A;  5C42 B;  4PG5 A;  5L46 A;  1LW0 B;  4FPI A;  3T1Y J;  1DUR A;  2OKQ A;  2V8H A;  4WK3 A;  3KLI A;  3G71 S;  3KHL A;  4DPO A;  2JL9 A;  3FEZ A;  2MKY A;  3NOC A;  1B7F A;  2NR0 A;  4DV2 J;  3R7N B;  4L3N A;  5B0A A;  1AZS A;  2RNE A;  3IO1 A;  1W2I A;  1IKX B;  3X3U A;  4PRF A;  1I6J A;  2LQ5 A;  2BJ9 A;  3C15 B;  3MAH A;  1FNX H;  2F8E X;  4Y0F A;  4X65 J;  4CLZ A;  4A8M P;  1H98 A;  2QN6 B;  1JXV A;  2F9D A;  3MCN A;  4B9L A;  2BW2 A;  3BR8 A;  4OYP A;  3DI6 B;  4FDF A;  2XCP A;  3JS9 A;  2W4C A;  2H5J B;  1DQA A;  1SL2 A;  1N36 F;  1T02 A;  4A8O A;  2DNG A;  4OYZ A;  1SIZ A;  2W4D A;  2IBK A;  1U26 A;  1RXO B;  3DGP A;  4ID5 A;  3RR8 A;  2MQN A;  3HHE A;  1Q7L B;  5KFC A;  3OXL A;  1RLD A;  4ZN3 A;  3FEX B;  3MZI A;  2IJR A;  3R3T A;  4RKU C;  3JAM U;  3VZI A;  4H4M B;  4CO3 A;  2YKP A;  3W60 A;  3GB0 A;  2C3P A;  3FZB A;  3HSD A;  4ZPV R;  4ZVU B;  4ES3 A;  1UZH A;  5F8H A;  1R6V A;  4P52 A;  4F0M A;  2HS3 A;  5E3P A;  2UVU A;  4Z7Y A;  2HNY A;  2B8Q A;  1MLA A;  2XNR A;  2DH8 A;  5D77 A;  4QR2 A;  3EGZ A;  3M30 B;  1B7Y B;  2OD4 A;  3CJ2 A;  5LMN F;  2ADB A;  2JEJ A;  3MD3 A;  4L3K A;  4ES2 A;  3WC0 A;  1X4D A;  3PVX A;  4GO7 X;  4NLP A;  3CJ3 A;  4N8N A;  2OIH A;  2BW7 A;  5EN1 A;  4RW7 B;  2GIR A;  3RBZ A;  1U8S A;  2VPX B;  4HL9 A;  4UOC A;  3TR5 A;  4ALZ A;  1XMQ F;  1T3N A;  1G2E A;  2IC3 A;  2HND B;  1QJH A;  2PEH A;  2HS0 A;  3VAF A;  1TAQ A;  2QRR A;  1N6Q B;  2JX2 A;  4HYK A;  4FYW B;  2NSB A;  2VB6 A;  2W7A A;  4DV7 J;  2GZO A;  1NJY A;  3PIO Q;  4O3R A;  2RE1 A;  3DLG B;  1HD0 A;  5K9F A;  4UZB A;  2LDY A;  1IXK A;  3FBB A;  1ARO P;  1FXL A;  1FKO B;  5ETT A;  5KG3 A;  5FLX Y;  3KHH A;  1F2H A;  2CQI A;  3G86 A;  4DLG A;  1RT4 B;  4HH0 A;  3DM2 B;  1IR2 A;  4CYU B;  1NSQ A;  4XIU A;  2FJD B;  1RBA A;  4IDK A;  4PKD B;  5HBM B;  5HQL A;  1L3S A;  4ZOS A;  5HMW A;  1LWE A;  4F02 A;  3V6J A;  1XTZ A;  1JXL A;  1U6F A;  3DDI A;  4NEZ A;  5AXM A;  4YN3 B;  1HQ2 A;  4P10 A;  4EUV A;  2VG5 A;  1OSC A;  2M9K A;  2DNK A;  2KRR A;  3QQC D;  1LNQ A;  1S1T A;  4NXN J;  4X4V A;  1EJ7 L;  2RML A;  2LQJ A;  2YX4 A;  2CNL B;  3HKZ D;  6FDR A;  5HMX A;  3DRP A;  5IFM A;  2ACY A;  2WTF A;  4QCL A;  1EZZ B;  3QIP B;  3KG4 A;  1O6X A;  2JEI A;  2W9C B;  4XO0 A;  3GJR B;  4P7V A;  4GMK A;  5KFE A;  4ECS A;  3CVK A;  1NK6 A;  2NZ4 A;  3AD7 C;  2ZH7 A;  2V50 A;  1M1H A;  3DLJ A;  1L3U A;  1FE4 A;  4RR5 A;  3CD6 S;  2FHJ A;  3FC9 A;  2YNG A;  3ZXW A;  4K0K F;  2VPW B;  5CCL A;  3KXD A;  4L76 A;  3LAM A;  3OLB A;  4EK2 A;  4CT8 A;  2BXJ A;  3A3O B;  2LA6 A;  3ZC4 A;  2HEK A;  2I9S A;  4FBU A;  3IRX A;  1U6B A;  3NLC A;  4DX7 A;  2ERR A;  2JFK A;  2GVZ B;  4K5R A;  4ANC A;  4M5J A;  1JLC A;  4RBT A;  4DBQ A;  2DHX A;  3BPS P;  1NPK A;  5B09 A;  3T9Z A;  3NWR A;  3PG9 A;  3ET6 B;  1DTQ A;  4LF9 F;  1KVK A;  1UPP A;  1X60 A;  2YWH A;  3CTR A;  2LKZ A;  3N4W A;  4ZVQ B;  3SFU A;  5F9N A;  2KM8 B;  4HH1 A;  3QID A;  2PA3 A;  2WBR A;  4O3N A;  3IR7 B;  3MHY A;  3KLI B;  3DRS B;  3OVS A;  5HL7 Q;  1QE1 B;  4DDF A;  1HQE B;  3BF4 A;  2DXD A;  4QU6 A;  2HHH F;  1RA6 A;  3SMZ A;  1HR0 F;  1TK5 A;  4K4T A;  1RAE B;  2CQ2 A;  3NS7 B;  2HK2 A;  4K4W A;  3HHL A;  1SJ1 A;  1P8G A;  2MLZ A;  4KV8 A;  4RPF A;  4LF6 F;  1KWM A;  1RWX B;  5L39 A;  4O44 B;  3A12 A;  3RB6 A;  1PCA A;  3IG1 B;  3FCV A;  4C11 A;  4K4U A;  1CVJ A;  3KLH A;  3TUJ C;  2VU5 A;  1GK8 A;  1X7V A;  4O4R A;  1VIS A;  3B54 A;  2WON A;  1RHQ B;  1N88 A;  1RT7 B;  2VD3 A;  3N28 A;  4LSL B;  2Z0G A;  2CQB A;  3GV5 B;  4DQP A;  2ZUG A;  1IJE B;  1SJ3 P;  3CGI A;  4E98 A;  1EET B;  2BJ8 A;  2DGO A;  3IBW A;  5D0G A;  2IAJ B;  1RTD A;  2A1B A;  4PG6 A;  2F3J A;  1H2U X;  1XC9 A;  3MM7 A;  3U1M A;  5H9F J;  3BGL A;  2UU9 J;  3J7A N;  4FYX B;  1NKB A;  1XR7 A;  2HW3 A;  2WVE A;  4I4B A;  5A2Q U;  1FI4 A;  3M9O B;  2XSJ B;  4ER8 A;  1RAI B;  1ZPW X;  5F41 A;  2FUG 9;  3ELH A;  4L6V 3;  4LFA J;  2BJ7 A;  1Q79 A;  3F41 A;  4ED4 A;  1U6Z A;  1VDH A;  4JV0 A;  2WRM A;  4QZV B;  2P9E A;  3FSX A;  4IOC Q;  2I8E A;  3D68 A;  4QIG A;  1LK5 A;  5AXK A;  1NPP A;  1O51 A;  5DM6 Q;  1X9M A;  3DU6 A;  1Y11 A;  1NDC A;  1VIO A;  1MU2 B;  2GV1 A;  2Q43 A;  3H7H B;  4KPY A;  3A3N B;  5CH7 B;  2AGP A;  1AYE A;  1HD1 A;  5E3R A;  5E7O B;  5GME A;  4KTQ A;  3QGP A;  2DVI A;  1WDT A;  2GQ2 A;  3AY0 A;  3DLK B;  2O66 A;  2ZD1 A;  3RRK A;  6FD1 A;  2KO1 A;  2HFZ A;  2XZD B;  4FVC A;  4NRT A;  2QL9 B;  2DR5 A;  1FWL A;  3RBX A;  4F4Z A;  1S0M A;  5I4M A;  2O1P A;  1HBO B;  3J7Y I;  1VCT A;  4CLY A;  1U1P A;  1N33 F;  1ZZF A;  3KK2 B;  1F5A A;  3PKM A;  2UUA F;  4FF2 A;  3VAH A;  3CIM A;  4PAA A;  5F8M A;  1U2F A;  4TLR A;  3R7B B;  3RB3 A;  2QMW A;  1HL6 A;  3AFG A;  1FD8 A;  2ACM A;  1WHY A;  4ECU A;  4LIW A;  4P71 A;  3N5B A;  5DG8 A;  1GAO A;  2VKR A;  1VC5 A;  3HZG A;  1FRH A;  4J9P A;  2KRB A;  2DBB A;  1NND A;  4A8Y A;  4DZD A;  4AL5 A;  3AB2 B;  3M30 A;  5K8M A;  4PQU B;  2QYG A;  3MUT P;  1C1B B;  2MZT A;  4FKY A;  3TVY A;  1VQ8 S;  1C1C B;  4DR6 F;  1NJW A;  4YB1 P;  1NJX A;  2ZH9 A;  1UZD A;  2ROE A;  2YXL A;  1I3O B;  2AJF E;  1UFL A;  2H9Z A;  2LQ8 A;  2AJ1 A;  1NJI T;  1L3V A;  4DL5 A;  5U47 A;  4AE5 A;  4DR5 F;  3WC2 A;  4KAI A;  2BAB A;  2NZC A;  4J9K A;  4B9N A;  3CED A;  3UO0 A;  2VF3 A;  1HMV B;  1QUP A;  4NML A;  1Y3K A;  4HAC A;  4NLT A;  2YWE A;  4OYX A;  3QSY B;  5J2Q A;  4C0O C;  1U1M A;  4QYR A;  1KD1 T;  1H2T Z;  2YKO A;  2F5G A;  1WG1 A;  4LRB A;  4ETZ A;  1GMU A;  2JZ5 A;  4PG8 A;  4FS2 A;  4X65 F;  2V94 A;  4QWA A;  1WI8 A;  2OJ3 A;  1B99 A;  2VIC A;  2YH1 A;  2E5L J;  2D1C A;  1TUW A;  3N6L A;  3D7S B;  1WWH A;  4ELU A;  1C0U B;  1RTI B;  2RQK A;  2LDI A;  4I68 A;  2VOO A;  2JFD A;  1NBE B;  1ZM9 A;  4OZ3 A;  1RT2 B;  4RU9 A;  4ZPB A;  5CZV A;  1SH3 A;  1TR0 A;  2CJA A;  3QBC A;  1WSR A;  2R7V A;  8AT1 B;  5THW A;  1NPR A;  1LWF B;  3BGR B;  1VRU B;  2XLJ A;  3EX7 B;  1TU0 B;  4KR0 B;  1U09 A;  2QLB B;  2EFN A;  4M5L A;  4C11 B;  5DQI A;  2R8G A;  4N5S A;  3PR5 B;  4NXM F;  4K4V A;  1RTH A;  3D6F B;  1TKZ A;  2XY5 A;  3DOK A;  3CJR A;  1X9S A;  1TL5 A;  4ZVP B;  2GQQ A;  2NS1 B;  4D3H A;  3MMC B;  3PNI A;  4ELV A;  3RW6 A;  1IKV B;  1Q8B A;  1H7W A;  4EFA C;  2DNL A;  1N5Y B;  2H4Y B;  3KLH B;  2J9E A;  3QIP A;  1SPB P;  3R27 A;  5F8I A;  1YTY A;  4PWD A;  1OY6 A;  4Y00 A;  1I5O B;  1MRO A;  2O5D A;  3V6D A;  2DR6 A;  2B4U A;  5KFV A;  1T05 B;  2FJV A;  2VG7 A;  2F4V F;  4FNH A;  1D9F A;  2OHD A;  4LIR A;  3GR0 A;  3JSR A;  4JYA F;  3NRB A;  1VQ5 S;  3KUH A;  4EYI B;  5EX3 A;  3VZH A;  3R1L A;  1XMO J;  3D28 A;  4JI8 J;  1Q5V A;  2BE2 B;  2FLL A;  3MEK A;  4HVZ A;  1HW9 A;  2EFG A;  1GQE A;  2FZG B;  2Y1L B;  3OFE A;  4K59 A;  3KLE A;  2NRE A;  1OQ6 A;  4DL0 C;  4IG3 A;  1UWA A;  1U2C A;  3US5 A;  3HFZ B;  3BBC A;  2K06 A;  4DQI A;  1HI8 A;  2MZS A;  4Q43 A;  3GJT B;  3NBP B;  1IBL J;  4C48 A;  1CBK A;  1S79 A;  2LQB A;  4H4O B;  4OI1 A;  4KGM A;  4PUO A;  1CC8 A;  4HHU A;  1B70 B;  4PG4 A;  1PBU A;  4ED5 A;  2V2Q A;  2DNM A;  3SIP B;  3RRH A;  1REG X;  4RWX A;  1WOP A;  2WB4 A;  3D0G E;  1PG5 B;  3D1Q A;  1HR0 J;  3C16 B;  3IN5 A;  5CYJ A;  3FFI B;  2R2R A;  2HK3 A;  3O5T B;  1Z2L A;  4LRA A;  4Q7A A;  1K1Q A;  2ZZN A;  3MED B;  4FYD A;  2UXB J;  3R1H A;  1CUL B;  1KDN A;  4HDG A;  5K14 A;  4CWB A;  5A8R B;  3TAR A;  3CME S;  4UUX A;  3FQK A;  5D0R A;  2BA9 A;  1VIX A;  1FEH A;  1BQM A;  2DKO B;  2UZA A;  4HHH A;  5C42 A;  4DL3 A;  1QAJ A;  2ZOF A;  4F3M A;  3CIZ A;  2C42 A;  4JI0 F;  3UNY A;  2H54 B;  5C2C A;  2WW4 A;  4C3L A;  2IM1 A;  5A8W B;  1NK0 A;  5CA5 A;  1JIH A;  3KUE A;  2BVZ A;  4JYA J;  1RCX B;  2YTC A;  5HJY A;  2DNZ A;  3MCS A;  2J9D A;  3PYE A;  4A8K A;  4ZJL A;  5B7W A;  3DRX A;  1HPZ A;  5D0H A;  3BSN A;  2NXC A;  5KFL A;  4DPX A;  1RTD B;  3E01 A;  1KOO A;  3M9M B;  1NHV A;  2Z2Z A;  2OEK A;  1WF1 A;  3CD0 A;  7FD1 A;  2ZBC A;  2KL8 A;  3ZTQ A;  4QWE A;  3W65 A;  3ZZO A;  4ZLN A;  3SV3 A;  2JC0 A;  2RD5 C;  2MJN A;  4JI3 J;  3H2U B;  4NA2 A;  2MQM A;  3QJJ A;  1N56 A;  3DHX A;  1HQE A;  2YQ1 A;  3UW1 A;  4GO5 X;  4WFY A;  4J5O A;  3CCL S;  2VBY A;  3G4S S;  3V6K A;  4FP9 A;  1N48 A;  1N4L A;  1VS3 A;  2F1F A;  5IM0 B;  3VWS A;  1FRJ A;  4NLW A;  5DRK A;  5EDW A;  2ALZ A;  2F4V J;  2XS5 A;  3TAQ A;  5SUH A;  2MY7 A;  2V9W A;  2IRX A;  4M5N A;  1AW0 A;  1V5V A;  1TMJ A;  2BJE A;  1QUV A;  2I38 A;  1NH8 A;  2VFR A;  3MI7 X;  2CQC A;  1EB0 A;  2DHH A;  1EP4 A;  2YH0 A;  5DDO C;  5HMZ A;  4CH7 A;  2VQE J;  4O3O A;  1MMN A;  2WAQ D;  5D78 A;  5JUM A;  3RB0 A;  3HHK A;  3MEC B;  1GX6 A;  2KXH A;  1EQM A;  5CXT A;  3ONQ A;  1LQ9 A;  2W9B B;  3TEH B;  5C24 A;  1CS4 B;  2QLX A;  2YKQ A;  3QPI A;  1RT7 A;  2E1R A;  4TNO A;  1TL7 A;  1U02 A;  3FBF A;  2LMI A;  1UJ6 A;  4CO0 A;  5CYM A;  4JUZ A;  1S1X B;  1HNI B;  2DIT A;  1AT1 B;  2GJI A;  1J5O A;  1JJ2 R;  3GIR A;  2F63 A;  1RIS A;  4CZC A;  1UVL A;  3EGV A;  4KQZ A;  3I0S B;  4AND A;  4JI5 F;  2XMV A;  1TL1 A;  1SVD A;  3NGT A;  3MOZ A;  4HT7 A;  5DQH A;  1PKU A;  2HFS A;  4A8W A;  1RKJ A;  2QEX S;  2KU7 A;  1N5T A;  1FFG B;  1ACM B;  3H0P A;  3M32 A;  4HEA 9;  4LFB J;  2F40 A;  3SXL A;  1JLG B;  4DR2 F;  5DS7 A;  2VON A;  2PMH A;  1SXL A;  4ILR A;  1Q8K A;  2KFN A;  3DGV A;  4AXI A;  1ZM4 A;  2XI3 A;  5E33 A;  4KGX B;  2RS8 A;  2E5L F;  1V6H A;  1GMV A;  1MG7 A;  1WC0 A;  5KT7 A;  3NGD A;  2HPU A;  3T3F A;  3IWN C;  2Q1L A;  3TZZ A;  1VQN S;  5E3Q A;  2HG4 A;  3WIV A;  3RBD A;  1V3S A;  3UVJ A;  1N5S A;  3V6D B;  1TVR A;  2CG4 A;  4TY8 B;  3WQP A;  4DV4 F;  1K8A T;  4MAK A;  3GFY A;  3W9H A;  5K8P A;  2KZZ A;  4WP3 A;  3VAG A;  3TUZ C;  1KHW A;  4NLU A;  4ATN A;  3MPV A;  1SL1 A;  1WC3 A;  1HWI A;  4IG3 B;  3C3L A;  4KO0 B;  1JLA A;  1JKH B;  4KRW A;  1YZ6 A;  2ZKU A;  4ZVR B;  4NLQ A;  2H3E B;  5BYR A;  1YLX A;  1KBR A;  2DEJ A;  2DRB A;  1RQ0 A;  3CJ0 A;  4B3S F;  4X2B A;  3EXC X;  4H4O A;  1SKR A;  1HWL A;  2YPY A;  5LJ5 Y;  2XMT A;  3CJS A;  2BM1 A;  2NXJ A;  4F25 A;  4MKA A;  2IM0 A;  1S6P B;  1X4E A;  4USV A;  3HUL A;  4A48 A;  4C2M A;  5L9N A;  3EPG A;  2DH7 A;  2ZH6 A;  3BH6 B;  3DLE A;  2PC6 A;  4V1A k;  4DQS A;  3NNH A;  3JSY A;  1QVG R;  1WKK A;  2HBY B;  2WBM A;  4Y6I A;  4DPT A;  5KFM A;  1IJF B;  1S6Q A;  4YHH J;  1HNV B;  1DHM A;  2F8M A;  5DZ7 A;  1MN7 A;  4QPT A;  3R5D A;  1TKX B;  1CLF A;  4KGV B;  4P2S A;  2KFZ A;  2R7T A;  1IWA A;  2C3U A;  3J81 U;  3CMQ A;  2E5G A;  1RWP B;  4G6V B;  4IQM A;  3QGI A;  2EK6 A;  2AYM A;  3OPK A;  3MMC A;  2G2O A;  3VGS A;  1WEZ A;  1R8P A;  2POK A;  5KFI A;  3LP1 A;  3MPW A;  1ZA1 B;  5J1P A;  2NXU A;  3OV7 A;  3ZZT A;  4LMZ A;  4R5P A;  4CLS A;  1XEZ A;  3HD2 A;  1YIJ S;  4LF7 J;  3HVA A;  4PYA A;  3KMQ A;  3CO9 A;  1G3O A;  2ZZT A;  4ZHR B;  5EGY A;  3LP2 A;  2R2S A;  2C2R A;  4EZ9 A;  2OPP B;  4KKO B;  2RF2 B;  3O2I A;  3V5R A;  2BQ3 A;  3H5X A;  3GYG A;  1FHT A;  4ITS A;  4BCA A;  3PCO B;  1U0H B;  4O44 A;  4QWB A;  4EO6 A;  3D6H B;  2L9W A;  5G0R A;  1JLF A;  2OML A;  2PSZ A;  5ETV A;  3CF5 Q;  2A6O A;  1HIY A;  1G4C A;  4A8X A;  2D3O R;  1VK3 A;  3KK3 B;  4E0D A;  1RT1 B;  5DET A;  3J81 j;  4F4X A;  1CJK A;  4WTO B;  1SKS A;  2XO7 A;  2MJU A;  1Q81 T;  1HBM B;  2HS4 A;  4AL7 A;  3C66 A;  4RUB A;  1UL3 A;  2MYF A;  1IR0 A;  3GWC A;  3OTB A;  1KQF B;  3PIP Q;  2J6T A;  3J7Z 5;  2QYC A;  1IKV A;  1SJQ A;  2R3V A;  1HWU A;  1WHV A;  3IS9 B;  2C2M B;  2HVE A;  1S57 A;  2OPR A;  1P6T A;  3DNC A;  3MDF A;  3MM5 B;  4G1I A;  4O4G B;  4OMF G;  1NB2 A;  3SDE A;  3Q8U A;  2HUR A;  3W62 A;  1WJ9 A;  4OHW A;  2DNH A;  3TX8 A;  5GAH U;  3IAS 9;  3TW0 A;  2QJ3 A;  4RW4 A;  5HMY A;  2RKI B;  2IPO B;  2KH9 A;  4JI0 J;  2LU2 A;  2P6T A;  3OR1 A;  3PRB A;  2JDJ A;  1DAX A;  5E3C A;  3MR5 A;  2FVR A;  4OHY A;  2ZH2 A;  1CJT A;  2X3D A;  5F8J A;  5LSL A;  1T94 A;  1FTR A;  4PPD A;  2ZM6 J;  5L9X A;  4DS4 A;  3BBF A;  2Y1I A;  3CXC R;  2O67 A;  1UVK A;  3W66 A;  1WI6 A;  2KZM A;  2UP1 A;  4UF4 A;  5JVH Q;  2ASY A;  5ETP A;  2J6S A;  4DR7 F;  3Q8P B;  2EFQ A;  2W4P A;  1R6Y A;  1K73 T;  1RWW B;  4FVM A;  8RUC A;  3IBC B;  1UVN A;  3OXG A;  2XYP B;  5AXL A;  2R9L A;  3WHI A;  2ASJ A;  2AZ1 A;  2X7I A;  3KFW X;  2GO9 A;  2RQ4 A;  1RT6 B;  2EW9 A;  3DLK A;  4ZP6 A;  4ZVH A;  1JLG A;  2Q6B A;  3LW5 C;  1ZOT A;  4USU A;  2HRU A;  5FD1 A;  2W2Q P;  3CD5 A;  4M8L A;  1RWU A;  2YKM A;  3TVK A;  4TYB A;  2Y0S D;  2W24 A;  3RR7 A;  2E9R X;  4DFJ A;  4EI2 A;  3NGR A;  1VQ6 S;  5D3G A;  4DV0 J;  4YME A;  3C16 A;  3QGH A;  1VYA A;  1E6V A;  3PFE A;  1WEY A;  5E2Q A;  2UUB J;  3K17 A;  2DNY A;  1O0P A;  1Y4Z B;  3LO3 A;  3KMS A;  1P1T A;  4J9Q A;  4YDD B;  2HQI A;  5J1E B;  3KWM A;  1M5P C;  3EVO A;  1BC6 A;  1VRU A;  3EVW A;  3T1A A;  1HYS A;  2FY8 A;  4EMD A;  4IO9 Q;  2V8D A;  3I56 S;  3DI6 A;  3LWL A;  2BKP A;  4EBD A;  1WNE A;  3HSJ A;  4C98 A;  4F2S A;  5A8W A;  3SBM A;  3W5Z A;  5C5J A;  4LF6 J;  2C2K B;  2NYI A;  3OLA A;  3G6E S;  4OL8 A;  1RAD B;  3MOJ B;  3LH2 S;  2CYY A;  4QWD A;  3KLG A;  3I5B A;  5I42 B;  3P49 B;  2GW8 A;  4Y65 A;  4JP8 A;  2EEY A;  3MFH A;  2B43 A;  2F7V A;  4YY3 F;  3I5A A;  3P8B B;  5I3Q A;  1Z4U A;  3MM8 B;  4L75 A;  4ANE A;  3QT7 A;  5LOQ A;  3AQO A;  1HMV A;  1H73 A;  3OTD A;  4LRD A;  1UVM A;  1PBA A;  5BYS A;  2HMI B;  1RT5 B;  1WOO A;  3A13 A;  4DLE A;  3EMT A;  3HF5 A;  1BWV A;  3UDL A;  4O3S A;  1REV A;  2AT1 B;  1NH7 A;  5ETK A;  1WSV A;  1LOU A;  1YX2 A;  4OZ0 A;  1UVI A;  2XS7 A;  4C97 A;  2YQ0 A;  1RB0 A;  3W2W A;  5I3U B;  2M88 A;  3THT A;  3GQC A;  5E41 A;  3QLH A;  1RA7 A;  5FII A;  4R5P B;  1RU1 A;  3OJU A;  4W90 B;  1VBY A;  3T5L A;  1NK7 A;  1EQ0 A;  4ZN1 A;  2PII A;  5F3T A;  5LL6 d;  2DEI A;  2CFX A;  2P9G A;  2U2F A;  3M8Q A;  2VQF F;  5FJ4 A;  5J2N A;  2NLW A;  4NLV A;  3MM6 B;  1KTQ A;  2MLY A;  5KT6 A;  1RHU B;  2HGM A;  1W25 A;  1Z1Z A;  3LQV A;  3VHQ A;  2WB1 D;  4G3I A;  3N6N A;  4ECQ A;  3PW2 A;  2P2C B;  2RAQ A;  1CUL A;  1EKR A;  1UEU A;  1R0A A;  3SCJ E;  3TAN A;  1Q5Y A;  2B0G A;  3C15 A;  4OLO A;  4H54 A;  4QOT A;  2XNQ A;  4C3K A;  1N5Y A;  4LFC J;  2HKE A;  1H3D A;  5I3P A;  2HBZ B;  3SSS A;  2M70 A;  4IR1 A;  3RJM B;  2XZW A;  3A8E A;  2XS2 A;  4DOZ A;  3D3C J;  1S9E A;  3K57 A;  4F4Y A;  4W4M A;  1JLB A;  1VC6 A;  4GKJ J;  2B4P A;  3LAL A;  2QFJ A;  3BEG B;  1N32 F;  1F3V A;  3AOC A;  2PE8 A;  2EC2 A;  3LPY A;  3H4B A;  2BQR A;  2ZFH A;  4OFZ A;  1JX4 A;  4NCB A;  3LAK A;  4CM2 A;  1F0X A;  3FMW A;  3M2V A;  4URS A;  3GFZ A;  4Y3C A;  4F4W A;  3GIL A;  2OPR B;  2RQM A;  3FRY A;  3L7U A;  2BJ3 A;  3BYR A;  3IC1 A;  3HKW A;  4H4K A;  4O4G A;  4RBU A;  5DO2 A;  4RNM A;  5J2P A;  5G4D A;  1BUX A;  2YWK A;  5GAD I;  2UXB F;  2OSQ A;  4IOB A;  4AYB D;  1J5E J;  1E6Y B;  1XR6 A;  1TUG B;  1NZ8 A;  1UEK A;  3QT8 A;  4OYO A;  2RRB A;  3QMQ A;  4NX9 A;  5DG9 A;  2XBP A;  3NL0 A;  2AYB A;  3MCM A;  3MEG A;  4FZV A;  2AP6 A;  2CJX B;  1QLN A;  2LU1 A;  2D74 B;  2R7O A;  3BGU A;  3MAQ A;  4IFV B;  1W2B R;  3BQ0 A;  3HSZ A;  2VDH A;  3U1L A;  4ZP8 A;  5GAE I;  4AL6 A;  1XK8 A;  4DUY J;  1L3T A;  4GKK J;  2EK1 A;  1NEE A;  2Z30 B;  3RAM A;  1KRP A;  2JEG A;  3W61 A;  1S76 D;  2RF2 A;  3FNN A;  1HHQ A;  2UXC F;  1FKP A;  4N8O A;  3SCK E;  5BR8 F;  1UKU A;  1RU2 A;  4LR9 A;  2V8V A;  2V4Q A;  1EIY B;  2I5J B;  3P5B P;  1NO8 A;  2XUL A;  2X3G A;  2QA2 A;  3DRS A;  3O1L A;  3EDQ B;  2WW8 A;  1CPZ A;  2RRA A;  2UVR A;  2XMW A;  2DHG A;  3TEG A;  1R8A A;  3W9J A;  2CQ1 A;  1K0T A;  4HI2 A;  4RW6 B;  4LF8 F;  5IWA J;  2E1A A;  4U7U D;  1NUE A; 
#chains in the Genus database with same CATH homology
 2B8Q A;  2DY9 A;  1XQI A;  4F36 A;  2NCK L;  2CWK A;  3R9L A;  3MPD A;  3EVM A;  3BBC A;  3ELH A;  3FKB A;  2DXE A;  1NDK A;  4F4A A;  5BXI A;  4UOH A;  4WBF A;  1PAE X;  3Q8Y A;  1UCN A;  3BH6 B;  3VVU A;  1WKK A;  4ANE A;  1NDC A;  3NGS A;  3FBC A;  1MN7 A;  5IOL A;  3Q8V A;  1XIQ A;  3FBB A;  3EMT A;  1ZS6 A;  1KDN A;  3VVT A;  4UOG A;  3EIC A;  5CAB A;  1WKJ A;  3VGS A;  1NSQ A;  4DZ6 A;  1F6T A;  3WX8 A;  3PJ9 A;  2DYA A;  1HLW A;  2HVD A;  2DXF A;  3B6B A;  2BX6 A;  3ZTR A;  4S0M A;  3Q89 A;  1F3F A;  3DDI A;  3BBB A;  4DI6 A;  1S59 A;  3VGU A;  3Q86 A;  1B4S A;  1NLK L;  3ZTQ A;  4FKY A;  3BH7 B;  1HIY A;  1NDL A;  3ETM A;  3NGU A;  1WKL A;  3VGV A;  4KPC A;  1S5Z A;  3FC9 A;  4FKX A;  3GPA A;  4EK2 A;  4CP5 A;  2HVE A;  1S57 A;  4ANC A;  4O0N A;  1BE4 A;  1NB2 A;  3FCW A;  3Q8U A;  2HUR A;  3L7U A;  1NPK A;  2BEF A;  1NHK L;  1BHN A;  1B99 A;  3FBF A;  4DUT A;  2AZ3 A;  1BUX A;  1LEO A;  1K44 A;  3ZTP A;  1NSP A;  1MN9 A;  1LWX A;  1NDP A;  1U8W A;  3FBE A;  5C7P A;  3BBF A;  4AND A;  4W98 A;  2DXD A;  3NGT A;  1PKU A;  3EM1 A;  3GP9 A;  1NSK L;  3Q83 A;  3EJM A;  1W7W A;  3ENA A;  2AZ1 A;  3DKD A;  2ZUA A;  1JXV A;  1HHQ A;  3FCV A;  3JS9 A;  1NCL A;  4ENO A;  2VU5 A;  3G2X A;  3ZTS A;  4C6A A;  3PRV A;  5CAA A;  3NGR A;  3B54 A;  1VYA A;  1EHW A;  3EE3 A;  2B8P A;  4HR2 A;  4UOF A;  3VGT A;  3ZTO A;  3EVO A;  3EVW A;  1NUE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...