2HURA

Escherichia coli nucleoside diphosphate kinase
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
142
structure length
142
Chain Sequence
AIERTFSIIKPNAVAKNVIGNIFARFEAAGFKIVGTKMLHLTVEQARGFYAEHDGKPFFDGLVEFMTSGPIVVSVLEGENAVQRHRDLLGATNPANALAGTLRADYADSLTENGTHGSDSVESAAREIAYFFGEGEVCPRTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of the Escherichia coli nucleoside diphosphate kinase reveals a new quaternary architecture for this enzyme family
pubmed doi rcsb
source organism Escherichia coli
molecule tags Signaling protein,transferase
molecule keywords NUCLEOSIDE DIPHOSPHATE KINASE
total genus 42
structure length 142
sequence length 142
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2006-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 2hurA00
4DI6A 3FCWA 3FBFA 1NDLA 1UCNA 3VGSA 4FKYA 3EJMA 3NGUA 3Q86A 2B8QA 1NSQA 3DKDA 1VYAA 5CABA 1U8WA 3FKBA 3ZTPA 4S0MA 2DXEA 1NSPA 3BBBA 3BBFA 2AZ1A 3GPAA 1BHNA 1NUEA 2DXFA 3ENAA 2CWKA 3VGVA 3G2XA 3FBCA 2DY9A 1K44A 2ZUAA 1MN9A 3VVUA 4ENOA 1F3FA 4O0NA 4DZ6A 3EICA 2HVDA 1W7WA 1XIQA 3VVTA 3ZTRA 1HLWA 1JXVA 1KDNA 2BEFA 3ETMA 3PRVA 4HR2A 4CP5A 3NGSA 1NPKA 4F36A 1LWXA 1NSKL 1F6TA 5C7PA 2HVEA 3Q8YA 3EMTA 3ZTSA 2DYAA 1BE4A 1LEOA 3ZTOA 1WKJA 3BH7B 3EM1A 3ZTQA 5IOLA 4WBFA 1EHWA 3FC9A 1WKLA 4ANCA 4EK2A 3EVMA 4UOGA 1B99A 3Q89A 4ANDA 2HURA 3R9LA 4ANEA 3GP9A 1NDCA 1MN7A 3B6BA 2AZ3A 3FBEA 3WX8A 2DXDA 1PKUA 1NLKL 1WKKA 4UOHA 3VGUA 3FCVA 4FKXA 1HIYA 3NGTA 3ELHA 4C6AA 2BX6A 2NCKL 3EE3A 3FBBA 4UOFA 3EVOA 4KPCA 1NDKA 1NB2A 3Q8VA 3Q8UA 3PJ9A 2B8PA 3VGTA 1S5ZA 1NDPA 3Q83A 1BUXA 4DUTA 1NHKL 3DDIA 3JS9A 2VU5A 1S59A 1S57A 1ZS6A 3B54A 3BBCA 1XQIA 5CAAA 3MPDA 4F4AA 4W98A 1B4SA 1PAEX 3NGRA 5BXIA 3EVWA 3L7UA 1NCLA 3BH6B 1HHQA
chains in the Genus database with same CATH superfamily
4L76A 4I7FB 2V50A 3BGFA 1DURA 2XMUA 2MYFA 4A48A 3CC4S 3NAIA 3TYTA 2I6WA 2PE8A 2P8IA 4KGZB 4IRKA 1WI8A 3KDNA 3GYGA 4WYWA 2LLZA 1VQ4S 1BY9A 1TP7A 1C0UB 2DNLA 3D0HE 2M88A 3C14B 4XDCA 2CRLA 2OUGA 3VAMA 3SZ2A 1SH0A 1FDAA 1S9GA 2HKEA 4RBTA 4WZMA 1IQTA 1NSAA 3D0IE 4KFBA 2M8DB 3MR5A 3ZTPA 2G2ZA 3VZIA 2IYIA 2MZQA 3OBIA 2ADCA 1U1QA 3N6LA 3NS5A 1UEKA 1HBOA 1RAOA 1RA7A 4L3KA 4ID5A 3QGHA 3AXMA 4UZBA 4XDDA 1CJVB 1X0PA 2QLWA 3V6DA 4RW8B 1VRUB 1JJ2R 4RNMA 2EXUA 1N33J 2XZDB 4AL7A 2QMWA 2XMJA 2HQGA 2CG8A 1RWNB 4X64F 4UQTA 3I55S 3KUHA 3A13A 4NPOA 5J2PA 3Q0AA 2HWHA 4O3PA 3QT8A 4LR7A 2BJ1A 1RTJA 4XPCA 3JYTB 2J9DE 5I3PA 2W8LA 2E5IA 4ILMA 3G96A 3DMJB 2C3OA 1NKCA 4ZLJA 1MROA 4WU2A 3PTWA 2OPSB 2VBXA 1FA0A 1NSKL 2FLOA 3T41A 4MTPA 1KOOA 3WC0A 4ATNA 4K0KJ 4BHQA 1S4EA 1RZMA 1LK5A 1IN0A 2DJWA 4LRFA 4CNZA 5KFNA 2W2OP 1RTDB 1OO0B 1O8BA 3BGRA 1FDDA 4IFYA 3J81j 2CQGA 1WKJA 1LFPA 4Q45A 3T1YF 1DZ5A 1XNRJ 2W7AA 4DS4A 4GKKF 2SXLA 1QAIA 3KLHA 4HLBA 1XR7A 2OELA 2IDEA 3QFWA 3SBMA 3HSGA 5SUHA 4DV3F 1N4LA 3PJWA 4RWWA 3EWGA 3CCTA 2GC8A 3GCXP 3L9ZA 5LOQA 2C2NA 1H7XA 5KTQA 1SJ4P 4J9RA 2IHR1 4DV1F 4HI2A 1NK0A 2IAJB 4RBVA 3QJJA 4JYAF 4FYVB 5C42A 2GIFA 4QPXA 2M4MA 2HRUA 3IP0A 2PSZA 3GP9A 1U48A 4G1IA 4DR7J 2R7UA 2GO8A 2JVRA 5AT1B 4GO7X 2NR0A 1SQGA 2CJXB 3CE8A 1U2CA 3PYFA 4DPYA 4ZCMA 4CT9A 4ZK7M 3I56S 3FSIA 1BGXT 2VH7A 3R6LB 4BWMA 4J9OA 5HAOA 4EEYA 4BC7A 2LYVA 2R8HA 1IR1A 2GHPA 5E3RA 1P1TA 4U67Q 1CJUA 5L1IA 2MZTA 4Q8EA 5AE2A 3IBCB 3QAEA 3R7BB 5M2RA 1YJNS 1RBAA 4WJBA 3PEJA 2VPWB 2X1GA 5CCMA 2RJZA 3L7OA 1RJJA 1DLOA 2KFYA 4O4GA 1UTAA 3KOAA 1QE1B 2YNHA 4RX6A 5LT5A 3H40A 3BGUA 4MIWA 2GQ2A 1TL1A 1S97A 2HW3A 3CNQP 4OYBA 4F0HA 3BQ1A 2MHNA 2PC6A 2BABA 3BZQA 3N5FA 1G6BA 1X8DA 3NCPA 4ZJQA 2EWHA 2N7YA 3M8PB 3KYLA 1VRUA 2KFNA 3SYZA 4LFBJ 3OR1B 4JV0A 1WDTA 1HNVA 3BSNA 2DHSA 1X4AA 2XY7A 4YB5A 5I3UA 5D78A 1ZM3A 2HNZA 3CO0P 4P2MA 4DEZA 3FRYA 3MM5B 1UFKA 4K7QA 2WONA 2ZOFA 3W9JA 4N77A 4DPTA 3L7UA 1N0UA 2DNNA 1KQFB 2ZC3A 5KG4A 1C1CB 3MR7A 3TA2A 2XGQA 1VIXA 3M8WA 3MHYA 2NZ4A 3CD5A 4ZS6A 4UQGA 2ZFHA 7FD1A 3VAGA 2WW4A 1C1BB 3D7SB 2QA4G 1GXUA 2DNPA 3HVAA 3G8QA 3ZZZA 2LA4A 4Q8FA 4ID5B 3ULHA 4CRJA 4LQ3A 1FRIA 2ASJA 1RTHB 5KFSA 3H20A 3WIUA 2OPPB 1F60B 2MY8A 4TNOA 1N8RT 4K4TA 1G2EA 3BGRB 4F4XA 4LF6F 4ZPBA 5DZ6A 3TW0A 2ZBQA 2KTQA 2KDOA 1J5OB 1U1LA 2DRDA 3OUYB 4FVCA 2DGUA 2KB2A 3AOCA 1Q1KA 1TKZB 3QT6A 2DT9A 2JL9A 2CA9A 3HSJA 1G4CA 2WB4A 5DG7A 1S10A 1FVQA 2QMXA 2V2ZA 3PR5B 2FVQA 2AYMA 4USKA 4RUHA 2YWGA 2UXCF 1F3FA 3MM7B 4OYAA 4IDKB 4B3RJ 4J9UE 4LQ9A 3IWXA 4Y2IA 3K89A 1WD6A 4UUWA 4O3QA 3W5XA 3NL0A 3M2VA 1BQNA 1XMBA 1HLWA 2JNJA 4OX8A 1B0PA 3OTDA 2E7VA 4Y2CA 2E7WA 2YBVA 3PW7A 4PUOB 1HNWJ 3CB4A 4ECYA 2E5LJ 4A8FA 5EX0A 3M2RB 1HL6A 3CCUS 2DPJA 1D3WA 2DHXA 4FVMA 3CJ5A 3PNIA 4ZMMA 3KNAA 3A8IA 3TAMB 1S9EB 4WF9Q 2LDIA 4MKYA 1H73A 3MMJA 2ZD1A 3CT9A 3EZ5A 1DJ0A 4DQPA 1IM4A 3EM1A 4YR3A 4WBFA 3D2WA 3VHQA 3FEZA 4KAIA 2XCPA 1S12A 3MTKA 3EVMA 3RAMA 3B4DA 1FNXH 1GH8A 4IO9Q 1B99A 1QAYA 1WC0A 2GAHC 4LRDA 2W24A 1GX6A 2G1DA 4JI5F 1HD1A 2V2VA 4RJVA 2OO4A 5A8RA 3CC2S 1LWFA 5BYQA 4OFZA 2YX4A 4HTIA 5KFVA 2EFOA 3B6BA 5B0BA 2ALYB 2EK6A 1XMQJ 3P4UB 1X4EA 4ZVHA 4GMKA 3D5MA 1NAQA 4DV4F 2QV6A 3FCVA 3BR9A 2DITA 4WE1A 3BN7A 2BUNA 2AIRB 3MTJA 3NGTA 3LWLA 1FI4A 3P3DA 2XG8A 1MWYA 4RU2A 3BB5A 2HHXA 4TXSA 2QFIA 1NEEA 1X4CA 5D4LA 3FBBA 4X4RA 4X62J 4I67A 3PIPQ 3DLEA 1WHYA 4I68A 4Q7AA 4WTYA 2VQFF 1SL2A 2VBWA 1SQFA 3Q8VA 3TAPA 3OVBA 1FFSB 3GMGA 4CNYA 4GVBB 3TEGA 2DNHA 1JLBB 3GG1A 3MEKA 2HS0A 4L74A 2XO6A 1ZZNA 2HHSA 3D1OA 1C1BA 1P1LA 2QX0A 1TL3B 3R3TA 4HHHA 1S6OA 4ZVRB 4CDIA 1HI0P 3WZ0A 3JSBA 1ACMB 1HFEL 2AJ4A 1XQIA 2W4DA 1U1KA 4DL5A 2FLLA 1F5AA 4JI4F 2EC0A 4CT8A 1Q8BA 1SC4B 2VC1A 3D6MB 5AE1A 5DDOC 4JI2J 1YRXA 2V0NA 3GYXB 2N4DA 2NSBA 3IXQA 4WU3A 2ZJPQ 4MKVA 4ECZA 1T03B 1V3SA 4K4VA 3TUPA 3M05A 3JXOA 3I9ZA 4ED6A 3IS9A 2YNIA 4TYAA 2FHOB 2ZH7A 2R7XA 3TJ8A 2EC2A 2BR0A 3R5CA 1LW2B 2RUSA 3H2LA 3LA0A 5I3QA 4IH5A 2V69A 3L3CA 3W60A 4DPWA 3NGUA 3R2CJ 2B8QA 2DHAA 3DKDA 4DV3J 1Y5NB 3OVAA 2IM3A 2J6UA 2VG5A 2XMKA 2ZD1B 3FQLA 1R89A 5CABA 3IAM9 2UXDJ 2KRRA 4YHHJ 1YJ7A 4IDKA 2R7WA 3BBFA 2ZH9A 3GPAA 4FYWB 2UXCJ 1S6PA 4KO0A 2D3UA 3KK3A 3K5OA 5LJ5Y 5KFAA 2VPYB 1DQ8A 2PEHA 3DHWC 2ZKUA 1B7YB 4RZRA 4A8MP 1CQNA 4MMOA 4C3LA 5DLGA 1TK8A 2GIQA 2EKYA 3NCQA 5DDPC 3AOAA 3M8QB 3U1NA 3KLGB 3DRRB 3P6YC 1RBLA 5B7WA 4BC9A 4KGKA 4PYDA 1CS4B 3DM2B 4C7QA 4DLGA 4LREA 1QDUB 5HQLA 3OL8A 3H0PA 4LSNA 1WC6A 3W9HA 2KXFA 2RDIA 3UR0A 2R7OA 4DZ6A 4FBTA 2WK4A 2P9CA 4DQRA 4B9TA 5E7OB 3POTB 1N6QA 2CQDA 6FD1A 1Q8LA 1B64A 4IRDA 3KHHA 3OT9A 3CCLS 1FVSA 2D1CA 3CC7S 2HQDA 3AA8A 3PYGA 3ONQA 2FUG9 3OJSA 1ZTTA 2RF2B 4NLQA 4B3SF 2H65B 1U2FA 1Q53A 2OPRA 1FX4A 3J80U 4DV6J 5HQ8A 1SL0A 2PT0A 3MAHA 2V68A 3UN2A 2V8HA 3UDEA 2FGCA 4RPFA 2AJ2A 4ECSA 1Q5VA 3HHLD 2DGTA 1U1RA 4LFBF 1RXOB 4M8LA 4F2RA 3THVA 1JXLA 1UEUA 2ROPA 3OL6A 2HPUA 5GAHI 2FJAB 4JI2F 2V9WA 1J5EF 1WG4A 3QRRA 3OTEA 5LSOA 3GR1A 1ITPA 3RRKA 1FFWB 4EU0A 5CYQA 1F2HA 4QR2A 4WXWA 4DPXA 3E01A 1YJTA 4GC7A 4NCGA 4QCLA 3MI7X 3DFEA 2RVJA 1T9VA 3UDVA 1R6YA 2HURA 5B0DA 4FDFA 1RTIA 4ANEA 4KGVB 1PG5B 2V63A 2ACMA 1JLEB 2G0CA 1K8AT 4DL6A 4JI1F 4ZP6A 3DRSA 4PQUB 1RGVA 1R3NA 3MXHP 2ZOGA 5U47A 2BMBA 4K2JA 3I82A 2LMIA 2V4RA 3FSXA 4PUOA 1XNQJ 1B0VA 5BJRA 4CZCA 1N5SA 2OLWA 4K8RA 5KG3A 3H5YA 1C2PA 4ZP7A 3MCNA 3ZZRA 1OWXA 1KKHA 2BRLA 3H4DA 3DLBA 2BX6A 4Y2MA 1Z2ZA 2VPZB 1LW0A 3PHEA 3W62A 3SEOA 1RT3A 4B3MF 2LECA 3Q22A 1FF2A 5F8JA 1WOSA 1WEXA 2HQFA 4UF4A 2MQPA 1IBLF 4KV8A 2E5HA 1HARA 3T1AA 2FVRA 3QO9A 1AFJA 1KVIA 1KOHA 3N6NA 4DFPA 1IKXA 1N52B 3TVYA 3RB3A 2GZOA 4W92B 1KD1T 1CSJA 1PBAA 1YRUA 2B4OA 4KHRA 2E1AA 3IM9A 3ISZA 5E3CA 2WRMA 2XULA 1FJCA 1SKWA 4OHXA 4TLQA 1KVKA 4C11A 2F4VF 2NXCA 3M32B 3NLCA 3L7PA 2OEMA 5KT3A 2IMWP 3NMRA 4LFAJ 2N3LA 4YR2A 3EVWA 4Z7YA 1TKTA 2NPFA 2P5VA 3W8PA 1S6QB 4X4SA 4LBHA 1HHQA 2HHPA 4ED5A 1AFIA 2VUGA 2ZH2A 2J6SA 2K3KA 3EXYA 3OHAA 1OSCA 4GO5X 5EWFA 1R8PA 2CPEA 3M7VA 3J80Y 1TL3A 1VQ5S 3CJ2A 1VQLS 1D8ZA 1RWPB 4R0EA 5K20B 2X1BA 2GHWA 4XPEA 1TK0A 1X9MA 4Q0BA 1CVJA 4OLPA 1JKHB 4G1PA 1K1SA 2RQCA 1FKPB 3KG4A 4AFFA 2KXNB 2WZ1A 1VMBA 4DZDA 1AA1B 3ZZYA 4C0BA 8ATCB 3H5SA 1UWBA 2HIYA 2R42A 5LMUJ 4B9UA 1QVFR 3PW5A 2NS1B 4S0MA 1BHNA 3RG6A 3RJMB 4NWBA 2KI2A 5IM0A 1R31A 3EGNA 1GT8A 2QSFA 3MF5A 1ZM4A 1FXLA 2H5EA 1Y11A 2ALZA 5A8WB 4FS1A 1RLDA 1FEHA 3G6YA 4ECUA 4IG0A 4PWDA 5T14A 1A7GE 2DNMA 4QQBA 4BWJA 4FPRA 4RW9B 2W9CB 4HL9A 2QYCA 2WSCC 4C8OA 4ZITA 2XGPA 3MMCA 3B78A 4G3IA 3AD7C 3CJ4A 1JMTA 1VIOA 3DYAA 3V6KA 3VVTA 3OLBA 3UVJA 5HP1A 3ZTRA 5F9LA 3MOZA 5GADU 2J0WA 1IXKA 2C42A 4JI7F 1UPMB 1R7IA 2ILYA 3BKFA 2UV8G 1K47A 1YK9A 4ECWA 2FVPA 1N0VC 2Y0BB 3O3LA 5B09A 3M8RA 4P2SA 3MM9B 4P71A 2E9TA 2U1AA 2BJ3A 3R1HA 4PCQA 1SVDA 4FBUA 4QWEA 2AX1A 1WACA 1RYSA 1U6ZA 2CXEA 1NKBA 1V5IB 4OYMA 4EFAC 4J9KA 3J7A1 2ZE2A 7AT1B 1X4GA 2CIMA 3I5CA 3VCDA 3ZNUA 2YPYA 1MWZA 3MM8B 4ZOSA 3BH7B 3QO9B 2RRNA 3SCIE 3QNWB 3SFGA 3TQ1A 1VBXA 4LF4F 4WFZA 5B0GA 1IVZA 4MAKA 2LEPA 3DGPA 3T1HJ 3S8SA 2VOPA 1N36J 2YKMB 4Q5VA 1RABB 1SPBP 1AB8A 2HBZB 1HNZF 3UCUP 2LXUA 4P74A 1YI2S 1CBKA 1CS4A 3DM2A 2V5HG 4G1QA 5KFLA 5IT0A 2MZRA 4DFKA 1HMVB 3M30A 3MEGB 2QJ3A 1N5YA 1DFDA 3ENQA 3D54A 2D41A 3MUMP 4EYIB 3PHTA 2X3GA 3MUVP 1PKUA 3U1MA 2QMUB 1RWWB 2ZBCA 1OPZA 1MMDA 1VHIA 4H4OB 4X4PA 1M90T 1N32F 1AT1B 2GV1A 3RAQA 3JQKA 1MROB 3H8YA 4DCOB 5BR8F 3N9UC 4DG1A 2OTLS 1R8HA 3GFXA 4WIIA 3VQSA 2KJWA 1NDKA 4YDXA 1ZPVA 1S48A 2MGZB 4AL5A 2RMLA 3AB4B 3ITHA 4DSEA 2CUYA 4QR0A 2L41A 2F5GA 4EMDA 2DR7A 3WHIA 4O3SA 1U25A 2QL7B 1VOMA 1TMMA 2J8SA 2K06A 3KHRA 1S0OA 5E3PA 4X84A 1ZOTA 1FRJA 3BYRA 2M7SA 1OY8A 4J9NA 2OFGX 3CGIA 1HPZA 2DEJA 3PJXA 1LWEA 1KEKA 3O44A 3RB4A 4ZVSB 3RRGA 5C2GA 1DY3A 4ZIWA 5KFGA 2NLWA 2RUGA 4O4GB 3QLHB 2XYGB 2E5GA 5ETNA 4YB1P 2RD5C 3KLFA 1L3TA 4KTQA 2CPHA 2GGPA 4ZA1A 5HJYA 2VBZA 3I0RB 4ZVGA 1NPRA 1IKXB 3BSCA 1UFWA 3KG0A 2XMTA 3FCWA 5IM0B 4QPTA 2JEGA 1FDBA 1PCAA 3R5AA 1SV5A 2A3JA 3C66A 3IC1A 2OP5A 3N6MA 4J5OA 1YBUA 4IQMA 4TVAB 4ES1A 5G0RA 3SQGB 3DLGB 3EJMA 4DUZF 5HO4A 3D1HA 1FKAF 3DOMA 1XR5A 4QIWD 3F44A 1NSQA 1HQ2A 1UEVA 2CPZA 4DSKA 3N4WA 1CJKA 4K4YA 2FVSA 1XERA 4I0WA 4LJMA 1P9YA 3DXBA 3TNVA 3OFGA 3W61A 4DL4A 1I5OB 3G6ES 1LFWA 4JI8J 2QG9B 4NZ0A 2KYZA 1TR0A 4PXCA 2KM8B 2HHWA 3C16B 3QT5A 1PAUB 2DGOA 1MW7A 2R2TA 3PX0A 1HD0A 4M5DA 4WPAA 5K8MA 3KK1B 3G2XA 1H98A 5B0AA 2EBEA 1JLQA 2OPQB 3HO1A 1OPIA 3N28A 4NI2B 1HNIB 2DY9A 2WTFA 2VQEJ 2HBQB 4JI7J 3D1QA 4C11B 4ZLLA 2LVWA 3MM5A 3KG1A 4ZJOA 1IBKF 4U7CA 1X4DA 2BJ7A 4N76A 1S1UA 3LOUA 1OY6A 2RNEA 4NRTA 4YHHF 1RCOB 5D0EA 5B0EA 4NXMF 3PG9A 3OUYA 1W2BR 2R8JA 1YHQS 3W2WB 3VAHA 1V9OA 1ZA2B 2J9EA 3HZEA 2EFQA 1H2TZ 1RAGB 4QR1A 3GCWP 1UVKA 2AD9A 3CMES 4ECTA 3EDQB 1NZ8A 2FYXA 2AEMA 2W9CA 2BM0A 2O5DA 2OPPA 3NAHA 1UA1A 1CJTA 3LALA 2MGZA 4DR4F 1RAAB 2HLUA 2HK2A 1Q78A 2PO4A 4CLZA 4ZN1A 1KC8T 1QAJA 2CNNB 4GC6A 4C0OC 5DM6Q 1LEOA 1WOOA 2HQIA 4FZVA 1F1BB 3GIKA 2W9BB 2V4JB 4WXOA 3GQCA 4LVOP 5IOLA 5A8KB 2EPIA 4AQYF 3SMZA 4EBEA 2JDJA 1UZHA 3CCRS 1UAWA 2BANA 5CH7B 4A8XA 1VC5A 3VF0B 2B9EA 4R25A 2FJDB 1WI6A 4NEYA 4TN2A 1N88A 2XYHB 2ZWOA 3R6GB 3Q89A 4PG4A 4ANDA 3MD3A 4Y3CA 2RHQB 5D0HA 5E3AA 5CYMB 3D68A 4DG1B 1KLNA 3UE2A 3HI9A 3ISND 1MLAA 4OZ2A 1X9WA 5ETLA 4FF1A 4IH6A 4DV1J 2QZ8A 2WSFC 2WVBA 4QIVA 5HATA 4D3GA 5KFCA 1W2IA 4IOBA 4LF8F 4DJBA 3W1YC 2GMLA 2VD3A 3W2VB 2AEFA 5AJ3F 2JFKA 5HLFA 1L3UA 2CJKA 3MPYA 5CCLA 2FTRA 1DARA 1HQUA 1X5PA 2F7VA 4FKXA 9RUBA 2QA4S 2HHHJ 1YG0A 1RT5A 1YIJS 1B7FA 3KHGA 1LWEB 1IBCB 1SC3B 3ET6B 4QZVB 1T8EA 3A3OB 3E3XA 4KFBB 1HNXF 3JSMB 3Q8RB 4DV0J 2HFOA 3C8YA 1EX8A 2D74B 3P8BB 4ZDNA 3VGTA 3NY0A 4IUFA 1WWHA 2H51B 3W65A 5KAKA 3NNHA 1BUXA 4DS5A 1VRTA 3DU5A 4ELVA 3IWLA 2MQLA 3MECB 3EZUA 3I4HX 5GMEA 3RBXA 3NKYA 4AYBD 1T9WA 3T5LA 2R8IA 3R1LA 2OEKA 4OZ0A 2ROEA 4F4AA 2F65A 4WZQA 4KR0B 1Y3KA 4NLUA 4OI2A 2DNKA 1X0FA 2B7BB 2O3DA 1XN9A 2D3ZA 2YKNA 3R5JB 2GNKA 4QU7A 1FKOA 2C2RA 1XJWB 2EI5A 2OMLA 3DC2A 4CH7A 1VHFA 4OLOA 2DY1A 4DHVA 2XSJA 2YX7A 4AUKA 2NXNA 4ETXA 5KFBA 5KFEA 4QIGA 3NNAA 2R7TA 4HHUA 1RU2A 3D6TB 1EAYC 3DOKA 3HF5A 3FBFA 3SCJE 4WK3A 2AX0A 1ZZFA 3IRWP 2HQ3A 3V81A 3TANA 2VDHA 4JYAJ 3Q86A 1HNIA 1U4BA 1PSDA 1RHKB 2HK3A 3CD7A 4KHPF 4CO5A 2P9GA 1XMOF 1T03A 1KNZA 4X62F 2ZVSA 4GKJJ 1FHTA 1SIWB 1U8WA 3SDEB 3CCMS 4WP3A 3LPEA 4Q43A 2UU9J 4PZVA 3VTIA 4YDDB 4ED7A 3V6HA 2AZ1A 2UUBJ 1ZM2A 2GA7A 2WVEA 3MMBA 3T5HA 4E2FB 3ILJA 4YOEA 2DRAA 5J1EA 4TU7A 4F50A 2IVYA 3D67A 3HLUA 2ZNZA 3M8ZA 3D0GE 3TOQA 1S1WB 3UW1A 4N5SA 4DQIA 3FRZA 4DR5J 3JB9k 1YSJA 1VFJA 5F8LA 5IQQA 1MU2A 2UVVA 1NRKA 2F8MA 2DPIA 4JI6J 2K7KA 3CO9A 3RZAA 1W7WA 2X3DA 2DEIA 3N01A 1S6PB 3KK2B 3VV2B 1N5TA 1SIZA 3BPSP 3FEXB 1PJ7A 4JV5F 4YUDA 2DHGA 5LSLA 4OZ3A 4NCGB 3S1TA 1KHVA 3THPA 4B02A 1XNQF 2W25A 5C42B 3OTBA 2MKHA 2DH9A 1F5BA 3K5MA 3SCLE 4A8QA 1I94F 2XI3A 4R5PB 4DV5F 3MAAB 2AGOA 2AP6A 4FPIA 4HDGA 2CPIA 4M5LA 1DTTA 8RUCA 3TA0A 2MKKA 2M3DA 3MECA 1FRMA 5KFUA 3LGHA 4FXDA 2Q43A 3GFZA 2CWXA 2DGXA 3UWTA 1U6FA 5D3GB 2CJAA 1IR2A 4B9LA 4LF8J 4CIOA 4ES2A 2BOPA 2DGVA 4ECXA 5E2QA 1TKDA 1E6VA 3H90A 4XO0A 3A3PB 3EDRB 2BKPA 1UVMA 1S7IA 2KKHA 3CDEA 3CIMA 3ZZPA 4OHWA 1NDCA 2EG1A 2JOQA 3C15B 3FMBA 2XSJB 4D3HA 2WOMB 1OQ3A 2LDYA 4KV8B 5I42A 1S76D 1TL1B 4Q2LA 1NH7A 2QLFB 5ETVA 2HHUA 3JAMY 3NBPA 4CLUA 5HN0A 2D3O1 2ZZMA 3G82A 2NYIA 2C3MA 4ED1A 4JI8F 2A18A 4NLYA 3KDOA 3EE3A 2JZ5A 4USJC 4DR3J 2CNOB 4DX5A 1FK9B 4DN9A 5C5JA 5IWAF 2ZM6J 2LU2A 4ZCIA 2K2PA 3DRSB 3W2VA 4DR7F 1OIAA 1WOPA 2GAGC 5L9XA 2A10A 3SSSA 2L3MA 2OSRA 2UUTA 5KFWA 3J7YU 5HBMA 1BQMB 3A8KA 1J5EJ 1HNZJ 1EB0A 3JSRA 2HFVA 3SSRA 3UNGC 1JLGB 3FDSA 3GV5B 1TAQA 2JLGA 1IJFB 3CCJS 4LFCF 1YQHA 1WDDA 2VASA 4BCAA 1I6JA 1Y0HA 2J0SD 4DR2F 3AODA 1RHQB 3SFUA 3U02A 3NGRA 1RAJA 1FKPA 1N48A 4UZCA 3TUIC 2KRBA 4FP9A 4I64A 4C8LA 2YWKA 1O6XA 1QSLA 3LANA 2CYYA 1X7VA 2OSQA 5GAGU 3GONA 2KO1A 3GZ7A 2XZTB 5HJXA 3ILIA 3C6UB 1YKWA 1JLFA 2FDNA 4W90B 2QGFB 4KKOA 5DDQC 2CJBA 3AJ2A 4KIAA 2F8HA 2DGSA 2OEJA 1Q0NA 2F1FA 2VB6A 3CJ3A 1P8GA 3DOLB 5GMDA 2DCUB 3KTQA 3H25A 3M32A 1Y5LB 4NMLA 5F8GA 2YKQA 4WCEQ 1HKAA 2WONB 3I32A 3PRDA 1SUQB 4QWAA 4H4MB 2DXEA 5T7LA 3KK2A 2FVCA 2HNYA 5HP1B 1DRZA 5LL6d 3BDPA 2KVQE 1JQGA 1O0PA 4ZKAA 3MUTP 4EYHB 4TY8B 2DXFA 3GJTB 2MEWA 1T11A 4A4JA 2VICA 4FYYB 3OPKA 3T5JA 3KLHB 2YH0A 3RB6A 2IC3A 7FDRA 5JXSA 2FQQB 4MIAA 4RUAA 1RK8A 2W2MP 1F9EB 1NM2A 3I5AA 2I9SA 4RUBA 2E5LF 2HNZB 4F0KA 2HNDB 5KT6A 1M5OC 2M2BA 3OR2A 3F73A 2KZMA 1HBMB 1N5VA 2LCWA 4BBYA 4YFUA 4ED4A 2ZHAA 2XS2A 2HGLA 2WVFA 3RW7A 1VRQC 1HW9A 5J1NA 4ZLNA 1H0HB 5JMNA 3RBEA 3QRQA 1FCAA 1GX5A 1KDNA 3R27A 4DX7A 2JRSA 2MB0B 4M5HA 1RU1A 3CJ8A 1U0HB 1YDLA 3KMQA 1YJRA 4K4SA 2E1PA 1KHWA 3QQCD 3PX6A 4I6AA 4NLDA 1GMWA 4MFBA 1RT2A 2M8HA 3M9NB 5IXUA 3AAWB 4DLEA 2Y1RI 5D77A 1FTCA 4CYUA 4JI3J 1Y3JA 5F8IA 3LP1A 3MMBB 3QIDA 1TU0B 2AGPA 2MKIA 4RR5A 1WKLA 3O1LA 4LSLB 4J9MA 1NNDA 1SJRA 2XLKA 3GR0A 3HJVA 3GIIA 3LAMA 5L1LA 1TKZA 3C6TA 4UOGA 2B4PA 2Q6BA 2ADBA 1WSRA 5KT7A 4KB7A 2DCLA 4X65J 3SCKE 4DUYJ 1FERA 4ZVEA 2OGUA 1N34F 2BJDA 1ELOA 2R7QA 4KC5A 5K9FA 1MN7A 1WELA 5HMWA 2R2UA 1Q7LB 2AZ3A 1FWPA 1I1GA 3MCSA 3CJKB 1KP6A 2IM1A 4IKAA 4DL2A 1FESA 2I2YA 4NASA 4RNFA 2YNIB 4B9VA 1NJXA 5IV4A 1WF0A 2AMCB 1EKSA 3FFIB 1LW2A 4WK1A 1XNRF 4N8OA 2CQ4A 1RWVB 3A8JA 4UW2A 5E5NA 2M5YA 2XO7A 3PO5A 3C2PA 1AUSL 4MKBA 3SXLA 2HS4A 5KT2A 5K14A 3DOMB 2CJYB 2MPUA 4LUBA 3QMQA 4QIEA 2GIRA 5EX3A 5JJBA 2AU0A 1Q7YT 4RLEA 2RU9A 3TR5A 4CLTA 1V3RA 3WIVA 5KFHA 1P6TA 3Q8UA 4H4MA 2AWZA 3H4BA 3MAAA 2GCFA 4MYTA 5DQHA 1JLAA 2F40A 4NOHA 2AV5A 3OV7A 2XB2D 4FYXB 4OV6A 4F04B 3D6FB 1LK7A 4XIUA 2EEYA 3B54A 6FDRA 4LF2A 5F3TA 3I9V9 2HFZA 3PEHA 4OQJA 1U49A 4R0JA 1UL3A 2F8EX 4OHVA 1T7PA 1K1QA 4K4ZA 2H9ZA 2VKZG 4NLXA 4DOZA 5DG8A 3ZNJ1 3M8SA 4MH8A 4CLFA 4PG5A 1GK8A 1REVB 4K59A 5A2QU 4Z37A 1U1NA 2ZH5A 4LFAF 3Q2TC 1RTJB 2BV3A 3JYTA 1HYSB 3KK3B 1RT4A 2R3VA 4J9PA 1X31C 2GQQA 2JJ4D 4WE1B 2UUBF 2GS8A 1JLCA 2H48B 1VQMS 4IH7A 4LFCJ 3R8YA 1VK8A 1Q4RA 2HQCA 1Z1ZA 3QPIA 3MOJB 4OJ1A 2OD4A 2RKIB 4LT6A 1H6KX 4OYXA 4QIFA 1D9AA 4KGMA 2W2PP 1LWCB 2CG4A 3V5RA 5JUMA 2FZKB 2W1BA 4C97A 3ILLA 1Q5YA 1EQ0A 4IG3B 1NSPA 5IS2A 1WF2A 3TI0A 4OYOA 2J8AA 2C3YA 4RWXA 2OHDA 3R97A 2AF6A 4LF4J 3A4TA 1KQKA 4EWTA 1R0BG 1NO8A 1HQEA 2CKWA 4B17A 1NJIT 1XMQF 4P72A 5CYMA 5KFXA 1S6UA 4MFBB 4B9NA 4ZIVA 1U8SA 2RF2A 4M5JA 1K44A 4NA3A 4F67A 4F25A 2F4VJ 3VVUA 4PR6A 1S1TA 1EZZB 4MK8A 5J2QB 2B3TB 4P6QA 2E9RX 2XNQA 2PFDA 3GU0A 1RTDA 3MMAB 4DDFA 5GAEI 1EETB 2M0GB 4C8ZA 1JNRB 2WVDA 2J9CA 5HLFB 2FHKA 1LNQA 2YWEA 1JXVA 3NP5A 4PEOA 4C8YA 3EPIA 4LRBA 2BEFA 1FRHA 4HR2A 5BYRA 3GILA 5SZTA 5HMZA 1QSYA 3DLHA 3LP2B 5DG9A 1U47A 2UXDF 1NPKA 1TL7A 2MLZA 3DLGA 5DLFA 1RT3B 1YGYA 2CDRB 2GO9A 2C2OB 3W5YA 2HVEA 4M1KA 4DPUA 3VWSA 1QVGR 3Q8YA 1M5SA 4R8UB 4DQSA 4HI1A 2YNGB 2E1RA 5D4OA 2Y9HA 4DR6F 1AW0A 2PA8D 1WTBA 4LF9F 2YKPA 3W7BA 2MLXA 3UDCA 2APOA 2LKZA 1FEEA 1DAXA 5IT9U 1YJWS 4UTGA 2OAUA 3OTOJ 4KHPJ 5DZ7A 1ZAWA 4JI1J 3MPWA 2W2NP 4LF5J 2KFZA 3KLVA 1VDHA 2EVZA 3E8OA 1FX2A 5E33A 4NLGA 2RT3A 2Y1LB 3OL7A 4P2FA 2VOOA 3DRRA 1FXRA 3F56A 1DHMA 3ET6A 4I2QB 2HRTA 1BWEA 4JOUA 2E66A 1FWLA 1U2RA 3AXKA 3Q24A 4CH0S 4K4UA 3GIJA 1YJ9S 5E0OA 4EBCA 4HHJA 3ZFVA 3FBEA 1VQ6S 3GJQB 2MKJA 4PWWA 4UY85 2FB0A 2J7UA 3IM8A 3PFEA 3TJAA 2FZCB 3HZGA 3O2IA 1W25A 2GJFA 2KXHA 1HR0J 3KXDA 3K8VA 5KOWA 2DR9A 4WFXA 3V4IB 4CLPA 1XTZA 1PILA 2YPZA 3NS7B 3W66A 4HTJA 5FLXY 5FIIA 4G6VB 2HSEB 4UOCA 2YWWA 2FJBB 4YN3B 1B70B 4HH1A 2XC9A 3VAKA 3G71S 2V8GA 3HJFA 3DRYA 5DETA 2HZCA 4A46A 3NGDA 3W63A 1XK8A 1NBEB 1NHKL 4WTOB 1A6LA 4TLRA 2R8GA 2NUHA 2RDDA 1HQEB 2B5JA 4NYPA 2CJQA 3BBCA 5ETRA 3NWRA 5KFRA 1FO1A 2CQCA 3BSAA 3HHDA 2YXLA 1JKHA 4K4WA 4NZ7A 5HMXA 5KFDA 1VC0A 1J27A 1RHMB 3FSYA 4IRCA 1B4SA 4AQYJ 3R5BA 1JJ4A 2ACYA 1R8CA 2C28A 3TQEA 1KONA 1X5OA 2IYGA 2BE7D 4PG6A 2FGOA 3DLLQ 2BW7A 3H5UA 2AYGA 5AXNA 3PKMA 1JLAB 3J81Y 3UQSA 3N79A 1TFYA 1PYSB 4DI6A 2ZC4A 2IJNA 3DCAA 4FNHA 5KFPA 2JEFA 3NXZA 3T9NA 1CULB 2EFVA 3DXSX 4CLLA 4ZLPA 1GTEA 3PW2A 1EARA 3OFHA 5ETSA 1DTQA 4CO4A 4F4ZA 4G65A 2ABYA 1KVJA 3PFOA 1KN6A 2XMAA 1BWVA 1UETA 4WKYA 4ZJLA 3LTOA 1UPPA 5H9FJ 3WDOA 5JVHQ 1HBUB 3Q8QB 1FKOB 3CPWR 5EWGA 2HAFA 2DTJA 3MMAA 4N7TA 4O3OA 1DTTB 1QE1A 2BOAA 2CZ9A 2V8PA 2YNHB 3NG8A 1GMVA 1H7WA 1BQNB 1Q95G 2NXUA 1RT1A 2VBYA 2P2CB 2ZDOA 3CD6S 5ETTA 1EQMA 2QIFA 3GE9A 3IMQJ 1RT7B 1JLCB 2PIIA 3OVSA 2XS5A 2CWKA 3UNYA 2C1EB 3RB0A 5C2CA 2MZSA 4RW4B 3HSZA 3IBWA 4DX6A 2MDAA 3OJUA 1NU4A 2VFUA 1O5JA 3MM9A 2IJFA 3I31A 3X1LB 2VG7B 2VJVA 2I5JB 2VFVA 3DDNA 2ASDA 5L39A 3GB0A 2ZBPA 3CDAA 3GSDA 5EWEA 4IG3A 2EK1A 2Z2ZA 2RIJA 3BKTA 5AE3A 2WOMA 2XQCA 5LMUF 1PBUA 4AE5A 3OD2A 1N56A 3HVWA 1OYDA 1M5KC 1FTRA 5CD4A 1ZH5A 4LF1A 3G8TA 2H4WB 3BQ0A 1L3SA 4B3MJ 4JI5J 2MQ8A 2BJ9A 4LBIA 4PKDB 1WEZA 4LF7F 1PYOB 4RW9A 3GV7B 1V6HA 5DM7Q 1F0XA 2IRUA 1CLFA 2V6AA 2CNKB 4KE5A 4XAKA 5J2NB 1FD8A 2MXYA 3CUNA 4ER8A 1LWCA 4ERDA 4URSA 4NYZA 4MT1A 3UVJB 4LF6J 1TELA 3UN3A 2KT5A 2WAQD 3ZTQA 1UZDA 4EZ6A 4IOCQ 3NWGA 5T41A 1WHVA 2YWHA 3G9CA 2B9YA 1RE1B 2VA2A 4NYOA 2F9DA 2CPXA 3OHBA 4DFJA 2J0QD 4PWDB 2W7OA 3J81U 3AT1B 2MLYA 3G86A 5DS7A 4BLGA 2OD6A 4ZVPB 4JI0J 3PR4A 1R0AA 5K5MA 2XEXA 5FJ4A 3IAS9 2MHEA 4CWBA 5C24A 1EIYB 3PYEA 5FLXU 4DR6J 1LV5A 1Y10A 3TRGA 3OSNA 1SKUB 2A2CA 2AJQA 1G1XA 2W4PA 1HIYA 4RL1A 4QOTA 5AJ3J 4FF3A 4YB6A 3T6BA 2B5JB 3KMSA 2DO4A 2OMOA 2XTJP 1NK5A 1NK9A 1HPZB 1RAIB 9ATCB 1IBMJ 4O44B 5DGBA 4AL6A 5GAHU 2Y8WA 5D6GA 4N41A 5A6WA 4HKQA 3SV4A 3KJNB 4RW6A 3QBCA 1Q81T 5L46A 2DKOB 3PJ9A 2PMHA 1OJ4A 3FEYB 1UW4A 2B43A 3CULA 2HNYB 2O01C 4KSEB 4L73A 3IS9B 3AQPA 3BO4A 3I0RA 1HBOB 1HWLA 2VU5A 1T9TA 2G2YA 3QWUA 3H2UB 3Q8SB 4QU6A 3KKFA 1U1OA 2RHSB 3DN9A 2FHJD 2B4VA 2G0IA 4NI2A 4P75A 1JIHA 2O67A 1A0OB 2X1AA 2X51A 2DB1A 4KPYA 4ILLA 3T5KA 2RH3A 4Y6IA 3HFVA 5KFIA 3GJSB 5KG5A 2KG0A 1L5UA 1HBMA 1X60A 1S1VB 4PG8A 4TQRA 3H7HB 1SUQA 1NCLA 2WVCA 2Z4PA 4I6YA 4DMZA 3L09A 3VR1A 4DL0C 1RWXB 2BJ8A 5EGYA 2EFGA 1IKYB 4F3MA 4I6WA 2R8KA 1HNWF 4K2XA 3TP2A 2PI5A 2HZAA 3MPUB 3B8HA 4KYZA 3VGSA 2Z2YB 5KG6A 2HHVA 1NHUA 4QYZK 1SJ3P 3PV8A 5GVQA 1VQOS 3M6UA 4QWDA 2PMWA 2LQJA 2HAIA 1I94J 2R9LA 4DR3F 3QWPA 4HACB 3KLFB 3HHKA 3Q23A 3FKBA 2FC8A 3MM6B 5FDLA 1X4BA 5EN1A 2GGPB 4P73A 2V4JA 4USTA 4F2SA 3PKYA 3LPYA 5D8HB 4H54A 2UUCJ 3OXLA 3CCWA 4P10A 2VFRA 1BXNA 1KFDA 5H1SV 4LIRA 3LW5C 2N3OA 1VJWA 1VK3A 1DTQB 3K5LA 3QZ7A 1SI9A 2G9OA 4HDHA 1JLGA 1UW9A 4L72B 1D1UA 3PCOB 1VLYA 2NXEA 1YZ7A 2OPSA 2OPRB 1HI1A 3IGNA 2L9WA 1TMJA 1MN9A 2VFSA 4X4QA 2GMJA 4KT0C 1SH2A 3TZXA 1YBAA 1RAHB 1RSCA 3AQOA 4FYDA 3NMAA 4L3NA 5H9EJ 2Z30B 2W9BA 4ELTA 4B3RF 1OS5A 2VDIA 4X66F 4OZLA 3MPVA 3PRVA 3KK1A 2MSSA 3ICLA 1SJFA 3C19A 1I51B 3E01B 1R8BA 2DR8A 4A47A 1RBOB 2IVMA 3C14A 4NE9C 4OV1A 2I5JA 3IRXA 1S1XB 3OLAA 3S01A 2LXFA 3OR2B 2C2EA 2NREA 2BBEA 2HFUA 3NRBA 4DWIA 1RAFB 1JLEA 1KWMA 1WG1A 2ZITA 3UFCX 3POTA 3W64A 4USVA 3HHEA 3H59A 2AQ4A 1L3VA 2V8VA 3FC9A 2CAJA 4WP9A 2VZ9A 4OJ3A 3PX4A 5KG7A 3ENVA 3LGNA 1T05A 1XR6A 4Y00A 4CLKA 2HLTA 1VI7A 3HM9A 2EW9A 3V4MA 2IC3B 3HT3A 1F9FA 1GNKA 2XSFA 4ZPAA 2YNFA 5ETKA 4O3NA 1LW0B 1XWLA 2K1RA 5B08A 1T94A 4HT5A 2I8EA 1Z2LA 2GMHA 1REVA 2XMVA 3GFHA 1HW8A 4NLRA 4PQAA 3R7SB 4A8YA 5CXTA 5M2UA 5L9NA 1NKEA 2UUAJ 1KTQA 5ETQA 2ZH1A 1N6QB 1HNXJ 3WQPA 2HYIB 1KS2A 1NLKL 2YKAA 3AD8C 3CEDA 1RT4B 3DI6B 3AOBA 3TWZA 1NPPA 2W8KA 5CZVA 1KFSA 5IV3A 4WP8A 4DV2J 1NK8A 5HK4A 2PN6A 4QW8A 5K8NA 3HXMA 2J9DA 3ELHA 4TU8A 4GKKJ 1PIEA 1BQXA 1UJ4A 4C6AA 3DU6A 4KJIA 1RTIB 4E0DA 3QIPA 3T6JA 3TEHB 2ZH4A 3KNGA 2XS7A 3M1VB 2N82B 3QJPA 1FRKA 1QTMA 1WSVA 3Q83A 2V67A 4JBCA 5D15A 4NA1A 4LSZB 2FHMA 2CQHA 3GTYX 3LO3A 1OQ6A 1TUWA 5HROA 4F26A 4CO1A 2PI4A 2M9KA 2DBBA 5ETPA 1ZS6A 1S1WA 2FJXA 1H38A 1FJ7A 2QLBB 1TL4A 2XMWA 2ZVIA 4OJGA 5HMYA 4Q0BB 3QGPA 2ZBIA 4JI3F 1YRTA 2B4UA 4OYIA 3CCES 2P6TA 2RDJA 5J2QA 1WC5A 2K7JA 1RKJA 2CQPA 1KSPA 4RW6B 3KLIB 3OXFA 5LXYA 1UVIA 2J5AA 1U02A 2UVWA 1EETA 2GQCA 2ATLA 4KQZA 4LF7J 1VRTB 3BYPA 4CQ1A 4UY8T 5IT4A 4K50A 4RW7A 4O3RA 4DN0A 4NLTA 1QM9A 3RW6A 4B3OB 3IBFB 2R7RA 2GFFA 1J5OA 5IC4B 1FNMA 2DNZA 3FFIA 2VIHA 1IQZA 2H5JB 1HQUB 3CJRA 4LR8A 2AEJA 5HVGA 1TL7B 1VQSA 5CHCB 1S79A 5GAEU 4OI0A 4EGLA 1S9EA 2DD8S 1OY9A 2MZ1A 2AW0A 2QA1A 5LMNF 4WKRA 3MWBA 2QN6B 1K0VA 4Z2XA 1EP4B 1KLMA 5A0YB 5KFJA 3J7YI 4R5PA 4NXMJ 1TKTB 3MR6A 1C1CA 3V6JA 2RQMA 2A2DA 5ITHA 3DRXA 4HEA9 5I4MA 1WF1A 4YY3F 4USMA 2GJ2A 1U24A 5F41A 3BSOA 3EXCX 1M5PC 2IMOA 2IRXA 3LP2A 4NL5A 3LF0A 3J7ZT 1ZPWX 2QSWA 2BE9B 3CTRA 2CFXA 5F8NA 4U95A 2YY3A 1HWKA 2G2OA 5KFMA 1MWQA 3TAMA 3RTVA 2ZHOA 3K7RA 5I3UB 1Q86T 3HK2A 2AJ1A 4O0NA 2XM3A 3MM6A 5FDLB 3SI8A 2HVIA 2YKNB 4ZPCA 4DU7A 4X65F 2Z58B 1UVNA 3EICA 4WFNQ 1JJCB 1U09A 2HBYB 5I42B 1JWWA 3LP0B 4ES3A 3EPGA 3MR2A 4LR9A 2RS2A 3E2EA 2RS8A 1Q8IA 3ETMA 5A8WA 1YBTA 2RAQA 3CD0A 1T05B 3HKZD 5EUHA 1T3NA 2IPOB 4ETZA 2BYCA 2J7WA 2WHOA 4L6V3 2V2QA 5D4PA 3X3UA 3GV8B 3M9MB 4X64J 4DF4A 1E6VB 3M2UA 2Z0GA 5KFFA 4HH0A 4F7VA 1JJHA 3D3CJ 3FCHA 4NLOA 5KFZA 2L48A 3UPFA 1VQ9S 1A9NB 2PFFB 3HCXA 2CVEA 2XCAA 2AJFE 3DDKA 4ZPWR 2FJWA 3M30B 3MGJA 3M2VB 3MEGA 4RO0A 4CO2A 1YITS 2WW8A 4OZJA 4U9RA 4C3MA 3QFHA 1EHWA 4E8UA 3CCSS 1SBRA 2YQ0A 2LQ8A 2CZVC 2WBMA 3JQMA 4X66J 1FRLA 5J1EB 2QEXS 2BQUA 2UXBF 2LEBA 2A6OA 2WCXA 1IWGA 2AT1B 3KLEA 3AB2B 5K8OA 1MMLA 5L38A 2ROGA 4F4YA 2CNLB 4ED2A 3D9BA 2BJEA 3IWNC 2KYXA 2AHOB 2DNGA 2C22A 1QUVA 1IBMF 4DCJB 5J1PA 2ZOMA 4QWBA 2IM2A 2Y1IA 1KQGB 1T9YA 1VGYA 1AZSA 3DHXA 3I0SB 4PXBA 1VBKA 4NRUA 2DGQA 1SV5B 1RHUB 2J7KA 2Q6CA 1BQMA 2B6AA 3CWJA 4ELUA 4F8RA 4NCBA 1S77D 4ILRA 2RILA 1VQ8S 1WTFA 3OFFA 2JLFA 4MKAA 2XHWA 2YQ3A 3LAKA 2OKQA 5A8RB 3S6EA 2C3UA 1P27B 4KPCA 1TZ0A 1R6VA 2HGMA 2KHCA 4MK7A 4URQU 2YTCA 5ETOA 1SJQA 4WWSA 1VQPS 2ZE2B 4LIWA 1VCTA 1NDPA 5T7LB 2U2FA 4DXLA 4RUCA 2DVIA 1NJYA 3C16A 1SH3A 3KJFB 1VQKS 2IBKA 1TVRB 4J90A 3DDIA 1F3VA 4M94A 3GLJA 1RT7A 2XYPB 1SCJB 4M5NA 2CPFA 2BKOA 4RW8A 2CPDA 5LXRA 3T1YJ 4PPDA 1NHVA 3MPDA 1N36F 2F3JA 4OX9J 3DOLA 4M95A 4XTTA 4Y0FA 1CG2A 1KLMB 4L75A 3M1VA 1RYRA 1FRXA 2XWXA 5AXKA 3C15A 4FF4A 2Q3PA 2JLEA 3CCVS 4DSIA 1C4CA 2HVZA 5A76A 5EHHA 4DV7J 1F9HA 2WSEC 5AXLA 4IOAQ 3CCQS 1SKRA 1UCNA 2C2KB 2Z2LA 3FZBA 4M5DB 1S72S 4PYAA 1YX2A 3M4XA 2GJIA 3VZHA 3W8GA 4CLWA 1M1GA 3Q8PB 3HVTB 1JK9B 5D0RA 2CADA 2J6TA 4F4WA 5AXMA 3QIPB 2B9WA 1FK9A 1KQSR 3AJDA 1X5TA 1UWAA 2WB1D 4CYUB 4ZP8A 5BYSA 4AXJA 1D09B 3WX4A 2E5JA 1JLBA 1LQ9A 3I6PA 3HD1A 3NNCA 3QGGA 2HBRB 1HBNA 1OMSA 1OYEA 1GXLA 3R7NB 4RKUC 3QSYB 1Q82T 1Y7PA 3L95X 2O66A 3CMAS 2XLIA 4LF9J 4C9DA 3G4SS 1M1HA 2J76E 3LQVA 5E41A 3OQ2A 5L1JA 4B3TJ 3EGVA 3FBCA 3Q2SC 1FJGF 1UVLA 2EFNA 3PRBA 3KUEA 3F0NA 3TO8A 3QRPA 2PMZD 3VQTA 3BO3A 4ZVUB 2CQ2A 2OFHX 1R0AB 3N5BA 4ZVFA 3LUYA 2AJ0A 2ZNYA 1PGZA 2HVDA 5KG1A 3ZZTA 1TQLA 3HFZB 3FZ2A 3OXGA 4J9VA 4LRCA 1URNA 4X4VA 2GVDA 2I0XA 3IFEA 2DH8A 1RB0A 3LGMA 3P45B 3G87A 4F02A 1RT5B 1JLFB 2MJNA 3HD2A 4RW4A 2ZH3A 1QUPA 4LBPA 2RRAA 3KLGA 1EKRA 5GAGI 2H4YB 5HQMA 4KH0B 1F6TA 2VG6A 2HNDA 3J7Z5 2K8GA 4J9QA 4B9MA 4GRSA 4DR5F 2HFSA 2VG5B 1M5HA 2QRRA 3PZPA 5THWA 3S7RA 2RSQA 1RWKB 5C24B 3EX7B 3MAQA 1M5VC 4Y65A 1CC7A 1ZETA 4DV4J 2P6SA 5F0UA 1O51A 2ZWPA 1DQAA 1UKUA 4OMFG 4ANCA 2DO0A 4A8KA 2UUAF 3WBZA 1R0CB 3DRPA 3ZZUA 2A1BA 1NJWA 3CSKA 1QSSA 1HI8A 1RT2B 2PA3A 2RRBA 1QJHA 1CJUB 2JFDA 3UR3C 2OPQA 2RE1A 2LFVA 4CCHA 3M8QA 2VQFJ 3MCMA 2XY6A 2MMYA 1M0SA 1NMEB 2IFXA 1UJ5A 3UN5A 8AT1B 1T02A 3K57A 5IWAJ 3WX8A 5DDRC 5K8PA 3HDSA 3ZZOA 1ZA1B 3DOKB 3VGUA 2UP1A 1FJEB 3UD5A 2MKCA 2ZKTA 4DQQA 4ECVA 4P7VA 5MLCV 1Y5IB 4DU8A 1R27B 1HNVB 5EDWA 1NB7A 4EO6A 4J7CA 4K5RA 1SC1B 2ATCB 3IGVA 3U1LA 4HACA 4ZPDA 3VALA 3SDEA 2HVHA 3CJKA 3TZZA 3M6XA 4LVNP 4JV5J 2FLPA 2HMIB 2BQ3A 2JH3A 4ZCKA 2CZ4A 4FXWA 2LEAA 4IR1A 2GVZA 2E1MC 4QWCA 3KJVB 2Z56B 1D9FA 2B6AB 3BDEA 1ZTWA 2G4BA 2VONA 4LF5F 1BLUA 1T95A 2EFPA 2DISA 2V94A 2LXIA 3C6TB 1FDNA 2V9KA 4N8NA 3B82A 4ZVOB 1S4FA 4J37A 3CXCR 3V81B 2QA2A 2KN4A 3DGVA 3NOGA 3M9OB 4IR9A 2JVOA 1U0SA 1P9QC 3H98A 4M5KA 3CJSA 4ICLA 2FC9A 3C3LA 3M8YA 3JTOA 1U7LA 2CDQA 1TV6B 1WEYA 1WORA 1HBNB 1Q79A 2G1HA 4C4WA 2MKSA 1IKWA 2HGNA 5DO2A 4FN5A 1VBYA 3QSIA 1X9SA 3SSQA 2DRBA 1S0MA 1TKXB 1U6BA 1KTVA 3CDWA 5D0GA 2BW2A 3M6WA 1NK7A 2POKA 4DUYF 3C46A 4EZ9A 3HVRA 3K59A 4R8UA 2Z57B 3CDBA 3DNCA 4OYPA 2BVZA 3AH6A 5A0YA 1PJ6A 1HWJA 4CM2A 3PXGa 4I56A 4KY3A 4TY9A 3R2DJ 4HT7A 3DGPB 1JXEA 3DRPB 4NLPA 3PACA 3IO1A 1ICEB 3RYLA 4ITSA 1RA6A 3HHLC 3TJ9A 5CYJA 1R8AA 2EKNA 3HX9A 4CM0A 4O0IA 4E98A 3IG1A 2ZZTA 1YTYA 4O4RA 2VKRA 2BE2A 5MAOA 2K1RB 2V34A 3ETOA 4ENOA 2MTLA 3AJ1A 1IR0A 4WFYA 3QZ8A 3DLJA 1G3OA 5J2MA 4Y2KA 2VFTA 5H9FK 2DNRA 1VR6A 3MM8A 4ZPVR 2KT3A 4QYZJ 3RGIA 2IJRA 2VC0A 2UV8A 3OSPA 2KHDA 2A6MA 2WBRA 3AHPA 3NGSA 2I1RA 4F36A 4KHMA 2LQ5A 2FIUA 3V4IA 1RHJB 3JQJA 4CTAA 5IQ6A 1RT6B 5HL7Q 5F8MA 1D9DA 5C25A 3P5TL 4C48A 2YNFB 3QT7A 2JWNA 3PIOQ 4ECQA 4V19J 3EMTA 2DYAA 3BGOP 4V1Ak 1VQ7S 1FE4A 1T0TV 2YX1A 1WJ9A 4PABA 3RU0A 3G8SA 2P9EA 2UU9F 3ADAC 3E51A 4OX6A 5DQGA 1RQ0A 1FWKA 3MEDA 1H72C 2XI2A 3KJVA 3PVXA 2BA9A 4CLYA 3HP6A 1H74A 1RTZA 2OTJS 3F41A 3NBPB 3GJRB 3NCRA 3BGLA 1KBRA 1MG7A 2CQ1A 3FK4A 4M5GA 4OI1A 4HYKA 3TUJC 3SV3A 4JV2A 4NXNJ 3EUNA 2XZWA 4X4TA 1S1XA 1T9UA 1S49A 3JAMU 4RNHA 4CO3A 1IM6A 1BMQB 2VV5A 6AT1B 2HWIA 2VODA 4U6PA 4F3OA 4V19X 2OI2A 2ILZA 2JC0A 3H42A 1C0TA 3R5GA 4F0MA 3DYAB 3QJLA 1DBDA 2RB7A 1YLXA 2Y3YA 3D6HB 2XBPA 5L1KA 1PO6A 5D4NA 1IKWB 2E1CA 3TVZA 2DGWA 2YKOA 2IA6A 4QYRA 4DR2J 1T3OA 4RU9A 1BC6A 2QL9B 1LKZA 1C0UA 4ZVQB 4KGXB 4H4KA 4OI4A 1QLNA 4C8NA 2HHQA 1J2VA 1VJQA 2KL8A 2NXJA 4UOFA 2VG6B 3EVOA 2W2QP 3QYYA 1XMOJ 4GKJF 3IRXB 1HMVA 1N5YB 4DCPB 1GMWD 1GFWB 3R5DA 3MEEB 4KO0B 3QAUA 4DUTA 4I7FA 4B3OA 3TAQA 1RWUA 2D9PA 4H4OA 4Y2AA 4MJKA 3IR6B 3VAFA 3EGWB 4EBDA 1EJ7L 2RQKA 1RISA 2UUWA 3NOCA 4PXEA 3H5XA 1RAEB 5G0RB 3SQGA 5HANA 2ZJRQ 3HSDA 1HR0F 4OX7A 1TFWA 2YVSA 3UDLA 2FPHX 3HPOA 4XK8C 2FY1A 3TARA 1NJZA 4FXVA 4G1QB 3PO4A 2DNQA 2JC1A 3FQKA 3SQOP 2ZUGA 2H1YA 2ASLA 1IKVA 1VC6A 3UCGA 3G6VA 5LM7E 3H2VE 3UO0A 5HBMB 3JSYA 3CF5Q 2DR6A 1NDLA 1RADB 3FJ2A 1HA1A 2B0GA 2QC3A 1XC9A 3KWMA 4FKYA 1E6YB 3MFIA 4FF2A 2BXJA 3PDNA 4AT1B 4PG7A 2DR5A 1V3ZA 1UMJA 3HULA 3LH2S 2F9JA 2MQMA 3D3BJ 3BJYA 3ISNC 1JNZB 2HS3A 5LMNJ 2GHVC 2C2MB 5G4DA 4OHZA 3A8EA 1S1UB 2FD2A 3UD3P 1TUVA 1N5QA 4HVZA 4B9SA 3LP0A 1PYTA 1KR4A 2B56A 4WFAQ 2ASYA 2GVZB 1CULA 1Y4ZB 2VQEF 4YEAA 5E3QA 2CVIA 3DMJA 1U0HA 1YJUA 2J0XA 2MKYA 4USUA 1SL1A 1CC8A 3OFEA 4W4MA 2NYHA 2PDAA 2IAJA 4OYZA 4Y28C 4OJHA 4CTAB 1EP4A 1S9GB 2CPYA 2EBGA 3K17A 1LXJA 3M2UB 4LRAA 4N47A 4DL7A 4OYWA 1GEHA 3BF4A 5CA5A 1N54B 1OSDA 5RUBA 3PY8A 2BRKA 2IM0A 3K8WA 1IBLJ 5CD4H 4I1TA 2DIUA 2QFJA 4JI6F 1RT1B 4TKTA 4ZPTR 3MZIA 4RW7B 3T1HF 3FVYA 3KUGA 3M6VA 4LMZA 2BANB 3FMWA 1I3OB 2B7CB 3I4PA 4KKOB 4CP5A 2PD1A 4DR1J 2HHTA 3KLEB 5F0WA 3OTOF 4DSJA 3V2UC 5IC6B 3TX8A 3W9IA 2R2SA 4ECRA 3TVKA 2C2ZB 2RQ4A 4LSNB 4IO1A 2MQQA 1FE0A 4MK9A 2X1FA 1HBUA 5DGAA 3J7AN 3K5PA 2L08A 3BR8A 1TVRA 2UZAA 2KG1A 2BM1A 1X4FA 3O5TB 2ERRA 1D0EA 2VA3A 4CH1A 4DV6F 1RACB 3K0JA 2XNRA 1PC4A 3JTNA 3OR1A 3L4BC 3RAXA 2IBOA 4DUZJ 4ED3A 4AD6A 2MQNA 2AYBA 4O44A 3R9LA 5B0CA 2IA0A 3RBDA 2VG7A 1U26A 1S1VA 2Y1JA 4DX8H 1CEZA 1B3TA 1VBZA 2AYEA 3D28A 3TX0A 1RCXB 3AA9A 4X4OA 3HHNB 4K5SA 4B08A 4B3TF 2DXDA 3MEEA 4Q44A 3K2YA 4LSLA 5ADZA 1U45A 4FS2A 5LSRA 4ID8A 1URRA 4U8YA 1S0NA 4M5MA 2JEJA 3RUBL 1VLOA 2H5IB 4JUZA 2KT2A 1IJEB 4N56A 3CJTA 1RTHA 2HG4A 2G13A 2PEBA 3SIPB 1H3DA 2VL1A 2C2DA 2YQ1A 4TQSA 5C25B 4A8WA 5J2NA 5KG2A 1NB2A 3FNNA 2ZZNA 4F3QA 1WUUA 4UT4A 3P5BP 2DIVA 2B8PA 2W9AA 1RI7A 2IIHA 1IUJA 3AD9C 3HT0A 5F9NA 1X4HA 5HI7A 4I2PA 4ZVTB 2LA6A 3BS9A 4JI0F 3CMQA 1IKVB 1AZSB 2K3IA 2O1PA 3I0SA 1S99A 3JS9A 1S59A 3LP1B 3MEDB 4O23A 1IKYA 3OW2R 1VQNS 4PAAA 1S57A 4OI6A 4RBUA 2V2KA 3GWCA 4USIA 1WNEA 1Y9OA 3CW2C 4IG0B 1UA0A 4ED0A 2NZCA 1E6YA 1VS3A 5F8HA 1S0VA 3OL9A 2ZJQQ 1X5SA 3I5BA 2RKIA 2XWYA 3NGKA 1JB0C 1TL5A 4NLVA 4DR1F 3T19A 2D7SA 1LXNA 3ZO7A 1C0TB 3TA1A 4YS2A 2MJUA 2BDPA 1RKIA 3D4JA 4C3KA 2GW8A 2XHCA 3BO2A 2HZVA 1RWMB 2JEIA 2E44A 2CPJA 4NLSA 4P9SA 1DQ9A 2DNYA 2CQBA 2ZEJA 3MR3A 1IBKJ 1ROFA 4IYQA 5IFMA 1VYAA 5L8RC 5GADI 4Q2MA 1FT8A 2COLA 2YNGA 2HRYA 4P2XA 2W7PA 2VHGA 2OJ3A 2GX8A 4NXNF 1S6QA 3O6QA 4IFVB 3DLKA 1FFGB 4PWUA 3RR7A 3GSIA 4ED8A 2Y8YA 3IR5B 1ZAVA 4X2BA 2AKWB 1GTHA 3CJQA 1HWIA 5IT9Y 2I38A 1KRPA 4Z7CA 1XEZA 3MCOA 4TU9A 5LJ3Y 3ENAA 3VGVA 1RWOB 1QAXA 2FLNA 1TUGB 3M8PA 2RU3A 3EZOA 1SB6A 1AXQA 4OX9F 1TK5A 4DR4J 4PPZA 5A6PA 2ZUAA 3UCZP 3U7JA 3B4MA 1VQYA 4X4UA 2MSTA 1RUSA 4WYLA 4DPOA 4OZ5A 1UVJA 1XBWA 3P49B 1G7CB 1UP1A 1WC3A 2MQOA 2Q79A 2HFNA 1HHTP 2M70A 2LQBA 3ZC4A 2FJEB 3O8WA 2W01A 4CO0A 2XLJA 4EUVA 2L9NA 1F5CA 4KBIA 3U27A 1U1MA 1H2VZ 1ZYQA 5D3GA 4ZHRA 4NEZA 2KU7A 1SQEA 4DV5J 5C7PA 1Y00A 4DV7F 3MM7A 3MMCB 3ZTSA 1TAUA 2H54B 1UWBB 1LOUA 2QLJB 1BE4A 2R4FA 4NZ6A 1BD6A 1REGX 4PXDA 4EI2A 1N32J 5HROB 2GVDB 1F2GA 3CJ0A 3FUYA 4DSFA 3NEKA 3EGZA 2QO3A 1GMUA 3DI6A 3I96A 3D66A 5KFOA 4DSLA 2NSCA 1QTNB 2VF3A 4QBUA 4DFMA 5DJBA 1AUDA 3QATA 2CQ3A 2KVIA 2UXBJ 4DV0F 2OIHA 1PC5A 1Q8KA 5GMKa 1S1TB 4C8MA 4YMEA 1MU2B 1W26A 2ZDPA 1SC6A 3ITHB 1YVFA 5HVHA 2OH2A 1APSA 5KFTA 3BPDA 4QJVA 3BREA 4BS2A 4AXIA 1WKKA 3MFHA 3MDFA 3C6UA 4M5IA 4UOHA 4RNNA 3VAJA 5KG0A 3G6XA 2YKMA 3M2RA 4I4BA 3KHLA 2NCKL 5HVFA 3HFKA 3FGVA 4I2QA 4OZNA 2X7IA 3WC2A 1NXIA 1ZM9A 5KFQA 4NX9A 3KLIA 3N0VA 3IR7B 3DLKB 3HHLB 2DNOA 1S5ZA 4P52A 4MIBA 4OI3A 2UVRA 2NQPA 3ENWA 2EG2A 4ICLB 3PW4A 4YP3A 3HKWA 4U96A 3EYZA 5KOXA 2VPXB 3K5NA 2NUUG 4GVLA 1RLCL 3T3FA 3PM9A 3G82B 5HSPA 1MSWD 1T9XA 5KFYA 5CAAA 4TYBA 2B9XA 3W3SA 5B0FA 1S9FA 2DHHA 1HHSA 4WIQA 4P7TA 1NK4A 3GIMA 5BXIA 2IVFB 5KFKA 1CJKB 2QYGA 1LWFB 1FJGJ 4I2PB 1WG5A 3BH6B 4IFVA 5DQIA 2ZH8A 1YZ6A 2FJVA 4C8KA 4PQUA 1TTHB 2DH7A 2R7VA 1YWXA 2L9DA 2M52A 3AY0A 4USHA 3GG0A 1K73T 4NLWA 1WHXA 2D9OA 3PYDA 4ALZA 4JV1A 4DBQA 2E9ZA 1CJVA 1RT6A 5IZHA 3BEGB 2MZJA 3A1YG 3RRHA 2ZHBA 2Q66A 2PGCA 2Y0SD 3RBZA 1Q16B 3K58A 3BV8A 2BE2B 3QLHA 1GAOA 1GXTA 2V8DA 2E7XA 3DLEB 5F3ZA 5A2QY 2Z8QA 1HWUA 2H3EB 2QE5A 2XMMA 3JTPA 2Q1LA 3BBBA 4ZCLA 3T9ZA 4YR0A 2HMIA 4GVBA 1NUEA 1ZAXA 2F4FA 2KZZA 4C98A 2E29A 4I69A 1PJ5A 2F63A 4ZP9A 2JX2A 4RNOA 2BQRA 4A8OA 4K0KF 1C4AA 1WC4A 1L3KA 2R2RA 3UI3A 4QW9A 5KT5A 4JI4J 1NH8A 4U8VA 2VJUA 1RHRB 2JHEA 3OTCA 1CJTB 1AYEA 1IWAA 3AFGA 1FXDA 1WC1A 3CVKA 1QY7A 4WFBQ 1WHWA 1XIQA 3ILOA 2FY8A 2FHJA 3I87A 3RR8A 2YWFA 3VAIA 1S7HA 1SJ1A 1ULRA 4NA2A 3LWMA 4USWA 2R7SA 1TV6A 4A8SA 3MD1A 1SKSA 1JLQB 2Z2MA 2BKNA 2LP4A 5ETMA 2LU1A 1LWXA 3IG1B 1TKXA 4OL8A 4YQWA 1CQMA 3THTA 1NK6A 1K9MT 2CQIA 2KJVA 1H2UX 4KH1B 3A12A 1YJVA 5M2PA 3PW0A 2KM8C 2G0JA 2IRYA 3ZTOA 2HHHF 4M63A 2QTWA 4J91A 4UUXA 3W2WA 4CLSA 4H4KC 3US5A 3TUZC 3HMJG 2KH9A 3BQ2A 4EK2A 3QGIA 4C2MA 2ZBRA 2YH1A 1N34J 4TY8A 1GQEA 2HIQA 4DF8A 1RDRA 1U1PA 2A0FB 2CQ0A 3CDUA 3W5ZA 3V6DB 4ZN3A 5K14B 1B0TA 1NZAA 1V5VA 4OZ1A 4KRWA 4MYUA 4JB8B 2LQ9A 4J9SA 1CPZA 2N7CA 3BN4A 4IFYB 3JSMA 2UVUA 1DLOB 1AROP 3CCZA 3CIZA 4Y34A 4BDPA 3HHLA 4NCAA 5J2MB 4J9LA 1FD2A 5J2PB 4C0HA 1SXLA 2D69A 2DK2A 2QLXA 3MURP 1R43A 1N33F 1Z4UA 5FD1A 5BR8J 2FZGB 1UJ6A 4OHYA 4U7UK 3IN5A 3ZXWA 3UD4P 2AGQA 1FNOA 2QT7A 1UFLA 4PRFA 4ZHRB 3HVTA 2BACA 4YB7A 3GFYA 2B51A 2QL5B 4YY3J 4CI0B 4EO8A 5CZXA 2XY5A 2D3OR 4OIXA 2N4CA 4U7UD 2HEKA 3BM7A 3BKUA 3TZYA 3GYNA 1QD1A 5H9EK 1D8YA 1RP5A 2W4CA 3KFWX 4JP8A 2V4QA 1M1KT 1MNEA 5DRKA 3P96A 5A8KA 1JX4A 2NPIA 1ZBTA 1HYSA 1MMNA 4NMXA 2BZ2A 3KJQB 4IQXA 4F4KA 3ZZ0A 4K4XA 3IA0A 5CYQB 5JVGQ 5KT4A 4FNIA 2ZM6F 4DV2F 3A3NB 4DL3A 4W98A 3GIRA 2MY7A 1PAEX 2IY5B 5CQGA 2JSXA 4X4NA 2CJ9A 2UUCF 2IDLA 2C3PA 4B3SJ 1K0TA 4URGA 1VISA 3NS6A 2HWTA 3TZWA 2ZH6A
chains in the Genus database with same CATH topology
4DI6A 3FCWA 3FBFA 1NDLA 1UCNA 3VGSA 4FKYA 3EJMA 3NGUA 3Q86A 2B8QA 1NSQA 3DKDA 1VYAA 5CABA 1U8WA 3FKBA 3ZTPA 4S0MA 2DXEA 1NSPA 3BBBA 3BBFA 2AZ1A 3GPAA 1BHNA 1NUEA 2DXFA 3ENAA 2CWKA 3VGVA 3G2XA 3FBCA 2DY9A 1K44A 2ZUAA 1MN9A 3VVUA 4ENOA 1F3FA 4O0NA 4DZ6A 3EICA 2HVDA 1W7WA 1XIQA 3VVTA 3ZTRA 1HLWA 1JXVA 1KDNA 2BEFA 3ETMA 3PRVA 4HR2A 4CP5A 3NGSA 1NPKA 4F36A 1LWXA 1NSKL 1F6TA 5C7PA 2HVEA 3Q8YA 3EMTA 3ZTSA 2DYAA 1BE4A 1LEOA 3ZTOA 1WKJA 3BH7B 3EM1A 3ZTQA 5IOLA 4WBFA 1EHWA 3FC9A 1WKLA 4ANCA 4EK2A 3EVMA 4UOGA 1B99A 3Q89A 4ANDA 2HURA 3R9LA 4ANEA 3GP9A 1NDCA 1MN7A 3B6BA 2AZ3A 3FBEA 3WX8A 2DXDA 1PKUA 1NLKL 1WKKA 4UOHA 3VGUA 3FCVA 4FKXA 1HIYA 3NGTA 3ELHA 4C6AA 2BX6A 2NCKL 3EE3A 3FBBA 4UOFA 3EVOA 4KPCA 1NDKA 1NB2A 3Q8VA 3Q8UA 3PJ9A 2B8PA 3VGTA 1S5ZA 1NDPA 3Q83A 1BUXA 4DUTA 1NHKL 3DDIA 3JS9A 2VU5A 1S59A 1S57A 1ZS6A 3B54A 3BBCA 1XQIA 5CAAA 3MPDA 4F4AA 4W98A 1B4SA 1PAEX 3NGRA 5BXIA 3EVWA 3L7UA 1NCLA 3BH6B 1HHQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DI6 A;  3FCW A;  3FBF A;  1NDL A;  1UCN A;  3VGS A;  4FKY A;  3EJM A;  3NGU A;  3Q86 A;  2B8Q A;  1NSQ A;  3DKD A;  1VYA A;  5CAB A;  1U8W A;  3FKB A;  3ZTP A;  4S0M A;  2DXE A;  1NSP A;  3BBB A;  3BBF A;  2AZ1 A;  3GPA A;  1BHN A;  1NUE A;  2DXF A;  3ENA A;  2CWK A;  3VGV A;  3G2X A;  3FBC A;  2DY9 A;  1K44 A;  2ZUA A;  1MN9 A;  3VVU A;  4ENO A;  1F3F A;  4O0N A;  4DZ6 A;  3EIC A;  2HVD A;  1W7W A;  1XIQ A;  3VVT A;  3ZTR A;  1HLW A;  1JXV A;  1KDN A;  2BEF A;  3ETM A;  3PRV A;  4HR2 A;  4CP5 A;  3NGS A;  1NPK A;  4F36 A;  1LWX A;  1NSK L;  1F6T A;  5C7P A;  2HVE A;  3Q8Y A;  3EMT A;  3ZTS A;  2DYA A;  1BE4 A;  1LEO A;  3ZTO A;  1WKJ A;  3BH7 B;  3EM1 A;  3ZTQ A;  5IOL A;  4WBF A;  1EHW A;  3FC9 A;  1WKL A;  4ANC A;  4EK2 A;  3EVM A;  4UOG A;  1B99 A;  3Q89 A;  4AND A;  2HUR A;  3R9L A;  4ANE A;  3GP9 A;  1NDC A;  1MN7 A;  3B6B A;  2AZ3 A;  3FBE A;  3WX8 A;  2DXD A;  1PKU A;  1NLK L;  1WKK A;  4UOH A;  3VGU A;  3FCV A;  4FKX A;  1HIY A;  3NGT A;  3ELH A;  4C6A A;  2BX6 A;  2NCK L;  3EE3 A;  3FBB A;  4UOF A;  3EVO A;  4KPC A;  1NDK A;  1NB2 A;  3Q8V A;  3Q8U A;  3PJ9 A;  2B8P A;  3VGT A;  1S5Z A;  1NDP A;  3Q83 A;  1BUX A;  4DUT A;  1NHK L;  3DDI A;  3JS9 A;  2VU5 A;  1S59 A;  1S57 A;  1ZS6 A;  3B54 A;  3BBC A;  1XQI A;  5CAA A;  3MPD A;  4F4A A;  4W98 A;  1B4S A;  1PAE X;  3NGR A;  5BXI A;  3EVW A;  3L7U A;  1NCL A;  3BH6 B;  1HHQ A; 
#chains in the Genus database with same CATH topology
 4L76 A;  4I7F B;  2V50 A;  3BGF A;  1DUR A;  2XMU A;  2MYF A;  4A48 A;  3CC4 S;  3NAI A;  3TYT A;  2I6W A;  2PE8 A;  2P8I A;  4KGZ B;  4IRK A;  1WI8 A;  3KDN A;  3GYG A;  4WYW A;  2LLZ A;  1VQ4 S;  1BY9 A;  1TP7 A;  1C0U B;  2DNL A;  3D0H E;  2M88 A;  3C14 B;  4XDC A;  2CRL A;  2OUG A;  3VAM A;  3SZ2 A;  1SH0 A;  1FDA A;  1S9G A;  2HKE A;  4RBT A;  4WZM A;  1IQT A;  1NSA A;  3D0I E;  4KFB A;  2M8D B;  3MR5 A;  3ZTP A;  2G2Z A;  3VZI A;  2IYI A;  2MZQ A;  3OBI A;  2ADC A;  1U1Q A;  3N6L A;  3NS5 A;  1UEK A;  1HBO A;  1RAO A;  1RA7 A;  4L3K A;  4ID5 A;  3QGH A;  3AXM A;  4UZB A;  4XDD A;  1CJV B;  1X0P A;  2QLW A;  3V6D A;  4RW8 B;  1VRU B;  1JJ2 R;  4RNM A;  2EXU A;  1N33 J;  2XZD B;  4AL7 A;  2QMW A;  2XMJ A;  2HQG A;  2CG8 A;  1RWN B;  4X64 F;  4UQT A;  3I55 S;  3KUH A;  3A13 A;  4NPO A;  5J2P A;  3Q0A A;  2HWH A;  4O3P A;  3QT8 A;  4LR7 A;  2BJ1 A;  1RTJ A;  4XPC A;  3JYT B;  2J9D E;  5I3P A;  2W8L A;  2E5I A;  4ILM A;  3G96 A;  3DMJ B;  2C3O A;  1NKC A;  4ZLJ A;  1MRO A;  4WU2 A;  3PTW A;  2OPS B;  2VBX A;  1FA0 A;  1NSK L;  2FLO A;  3T41 A;  4MTP A;  1KOO A;  3WC0 A;  4ATN A;  4K0K J;  4BHQ A;  1S4E A;  1RZM A;  1LK5 A;  1IN0 A;  2DJW A;  4LRF A;  4CNZ A;  5KFN A;  2W2O P;  1RTD B;  1OO0 B;  1O8B A;  3BGR A;  1FDD A;  4IFY A;  3J81 j;  2CQG A;  1WKJ A;  1LFP A;  4Q45 A;  3T1Y F;  1DZ5 A;  1XNR J;  2W7A A;  4DS4 A;  4GKK F;  2SXL A;  1QAI A;  3KLH A;  4HLB A;  1XR7 A;  2OEL A;  2IDE A;  3QFW A;  3SBM A;  3HSG A;  5SUH A;  4DV3 F;  1N4L A;  3PJW A;  4RWW A;  3EWG A;  3CCT A;  2GC8 A;  3GCX P;  3L9Z A;  5LOQ A;  2C2N A;  1H7X A;  5KTQ A;  1SJ4 P;  4J9R A;  2IHR 1;  4DV1 F;  4HI2 A;  1NK0 A;  2IAJ B;  4RBV A;  3QJJ A;  4JYA F;  4FYV B;  5C42 A;  2GIF A;  4QPX A;  2M4M A;  2HRU A;  3IP0 A;  2PSZ A;  3GP9 A;  1U48 A;  4G1I A;  4DR7 J;  2R7U A;  2GO8 A;  2JVR A;  5AT1 B;  4GO7 X;  2NR0 A;  1SQG A;  2CJX B;  3CE8 A;  1U2C A;  3PYF A;  4DPY A;  4ZCM A;  4CT9 A;  4ZK7 M;  3I56 S;  3FSI A;  1BGX T;  2VH7 A;  3R6L B;  4BWM A;  4J9O A;  5HAO A;  4EEY A;  4BC7 A;  2LYV A;  2R8H A;  1IR1 A;  2GHP A;  5E3R A;  1P1T A;  4U67 Q;  1CJU A;  5L1I A;  2MZT A;  4Q8E A;  5AE2 A;  3IBC B;  3QAE A;  3R7B B;  5M2R A;  1YJN S;  1RBA A;  4WJB A;  3PEJ A;  2VPW B;  2X1G A;  5CCM A;  2RJZ A;  3L7O A;  1RJJ A;  1DLO A;  2KFY A;  4O4G A;  1UTA A;  3KOA A;  1QE1 B;  2YNH A;  4RX6 A;  5LT5 A;  3H40 A;  3BGU A;  4MIW A;  2GQ2 A;  1TL1 A;  1S97 A;  2HW3 A;  3CNQ P;  4OYB A;  4F0H A;  3BQ1 A;  2MHN A;  2PC6 A;  2BAB A;  3BZQ A;  3N5F A;  1G6B A;  1X8D A;  3NCP A;  4ZJQ A;  2EWH A;  2N7Y A;  3M8P B;  3KYL A;  1VRU A;  2KFN A;  3SYZ A;  4LFB J;  3OR1 B;  4JV0 A;  1WDT A;  1HNV A;  3BSN A;  2DHS A;  1X4A A;  2XY7 A;  4YB5 A;  5I3U A;  5D78 A;  1ZM3 A;  2HNZ A;  3CO0 P;  4P2M A;  4DEZ A;  3FRY A;  3MM5 B;  1UFK A;  4K7Q A;  2WON A;  2ZOF A;  3W9J A;  4N77 A;  4DPT A;  3L7U A;  1N0U A;  2DNN A;  1KQF B;  2ZC3 A;  5KG4 A;  1C1C B;  3MR7 A;  3TA2 A;  2XGQ A;  1VIX A;  3M8W A;  3MHY A;  2NZ4 A;  3CD5 A;  4ZS6 A;  4UQG A;  2ZFH A;  7FD1 A;  3VAG A;  2WW4 A;  1C1B B;  3D7S B;  2QA4 G;  1GXU A;  2DNP A;  3HVA A;  3G8Q A;  3ZZZ A;  2LA4 A;  4Q8F A;  4ID5 B;  3ULH A;  4CRJ A;  4LQ3 A;  1FRI A;  2ASJ A;  1RTH B;  5KFS A;  3H20 A;  3WIU A;  2OPP B;  1F60 B;  2MY8 A;  4TNO A;  1N8R T;  4K4T A;  1G2E A;  3BGR B;  4F4X A;  4LF6 F;  4ZPB A;  5DZ6 A;  3TW0 A;  2ZBQ A;  2KTQ A;  2KDO A;  1J5O B;  1U1L A;  2DRD A;  3OUY B;  4FVC A;  2DGU A;  2KB2 A;  3AOC A;  1Q1K A;  1TKZ B;  3QT6 A;  2DT9 A;  2JL9 A;  2CA9 A;  3HSJ A;  1G4C A;  2WB4 A;  5DG7 A;  1S10 A;  1FVQ A;  2QMX A;  2V2Z A;  3PR5 B;  2FVQ A;  2AYM A;  4USK A;  4RUH A;  2YWG A;  2UXC F;  1F3F A;  3MM7 B;  4OYA A;  4IDK B;  4B3R J;  4J9U E;  4LQ9 A;  3IWX A;  4Y2I A;  3K89 A;  1WD6 A;  4UUW A;  4O3Q A;  3W5X A;  3NL0 A;  3M2V A;  1BQN A;  1XMB A;  1HLW A;  2JNJ A;  4OX8 A;  1B0P A;  3OTD A;  2E7V A;  4Y2C A;  2E7W A;  2YBV A;  3PW7 A;  4PUO B;  1HNW J;  3CB4 A;  4ECY A;  2E5L J;  4A8F A;  5EX0 A;  3M2R B;  1HL6 A;  3CCU S;  2DPJ A;  1D3W A;  2DHX A;  4FVM A;  3CJ5 A;  3PNI A;  4ZMM A;  3KNA A;  3A8I A;  3TAM B;  1S9E B;  4WF9 Q;  2LDI A;  4MKY A;  1H73 A;  3MMJ A;  2ZD1 A;  3CT9 A;  3EZ5 A;  1DJ0 A;  4DQP A;  1IM4 A;  3EM1 A;  4YR3 A;  4WBF A;  3D2W A;  3VHQ A;  3FEZ A;  4KAI A;  2XCP A;  1S12 A;  3MTK A;  3EVM A;  3RAM A;  3B4D A;  1FNX H;  1GH8 A;  4IO9 Q;  1B99 A;  1QAY A;  1WC0 A;  2GAH C;  4LRD A;  2W24 A;  1GX6 A;  2G1D A;  4JI5 F;  1HD1 A;  2V2V A;  4RJV A;  2OO4 A;  5A8R A;  3CC2 S;  1LWF A;  5BYQ A;  4OFZ A;  2YX4 A;  4HTI A;  5KFV A;  2EFO A;  3B6B A;  5B0B A;  2ALY B;  2EK6 A;  1XMQ J;  3P4U B;  1X4E A;  4ZVH A;  4GMK A;  3D5M A;  1NAQ A;  4DV4 F;  2QV6 A;  3FCV A;  3BR9 A;  2DIT A;  4WE1 A;  3BN7 A;  2BUN A;  2AIR B;  3MTJ A;  3NGT A;  3LWL A;  1FI4 A;  3P3D A;  2XG8 A;  1MWY A;  4RU2 A;  3BB5 A;  2HHX A;  4TXS A;  2QFI A;  1NEE A;  1X4C A;  5D4L A;  3FBB A;  4X4R A;  4X62 J;  4I67 A;  3PIP Q;  3DLE A;  1WHY A;  4I68 A;  4Q7A A;  4WTY A;  2VQF F;  1SL2 A;  2VBW A;  1SQF A;  3Q8V A;  3TAP A;  3OVB A;  1FFS B;  3GMG A;  4CNY A;  4GVB B;  3TEG A;  2DNH A;  1JLB B;  3GG1 A;  3MEK A;  2HS0 A;  4L74 A;  2XO6 A;  1ZZN A;  2HHS A;  3D1O A;  1C1B A;  1P1L A;  2QX0 A;  1TL3 B;  3R3T A;  4HHH A;  1S6O A;  4ZVR B;  4CDI A;  1HI0 P;  3WZ0 A;  3JSB A;  1ACM B;  1HFE L;  2AJ4 A;  1XQI A;  2W4D A;  1U1K A;  4DL5 A;  2FLL A;  1F5A A;  4JI4 F;  2EC0 A;  4CT8 A;  1Q8B A;  1SC4 B;  2VC1 A;  3D6M B;  5AE1 A;  5DDO C;  4JI2 J;  1YRX A;  2V0N A;  3GYX B;  2N4D A;  2NSB A;  3IXQ A;  4WU3 A;  2ZJP Q;  4MKV A;  4ECZ A;  1T03 B;  1V3S A;  4K4V A;  3TUP A;  3M05 A;  3JXO A;  3I9Z A;  4ED6 A;  3IS9 A;  2YNI A;  4TYA A;  2FHO B;  2ZH7 A;  2R7X A;  3TJ8 A;  2EC2 A;  2BR0 A;  3R5C A;  1LW2 B;  2RUS A;  3H2L A;  3LA0 A;  5I3Q A;  4IH5 A;  2V69 A;  3L3C A;  3W60 A;  4DPW A;  3NGU A;  3R2C J;  2B8Q A;  2DHA A;  3DKD A;  4DV3 J;  1Y5N B;  3OVA A;  2IM3 A;  2J6U A;  2VG5 A;  2XMK A;  2ZD1 B;  3FQL A;  1R89 A;  5CAB A;  3IAM 9;  2UXD J;  2KRR A;  4YHH J;  1YJ7 A;  4IDK A;  2R7W A;  3BBF A;  2ZH9 A;  3GPA A;  4FYW B;  2UXC J;  1S6P A;  4KO0 A;  2D3U A;  3KK3 A;  3K5O A;  5LJ5 Y;  5KFA A;  2VPY B;  1DQ8 A;  2PEH A;  3DHW C;  2ZKU A;  1B7Y B;  4RZR A;  4A8M P;  1CQN A;  4MMO A;  4C3L A;  5DLG A;  1TK8 A;  2GIQ A;  2EKY A;  3NCQ A;  5DDP C;  3AOA A;  3M8Q B;  3U1N A;  3KLG B;  3DRR B;  3P6Y C;  1RBL A;  5B7W A;  4BC9 A;  4KGK A;  4PYD A;  1CS4 B;  3DM2 B;  4C7Q A;  4DLG A;  4LRE A;  1QDU B;  5HQL A;  3OL8 A;  3H0P A;  4LSN A;  1WC6 A;  3W9H A;  2KXF A;  2RDI A;  3UR0 A;  2R7O A;  4DZ6 A;  4FBT A;  2WK4 A;  2P9C A;  4DQR A;  4B9T A;  5E7O B;  3POT B;  1N6Q A;  2CQD A;  6FD1 A;  1Q8L A;  1B64 A;  4IRD A;  3KHH A;  3OT9 A;  3CCL S;  1FVS A;  2D1C A;  3CC7 S;  2HQD A;  3AA8 A;  3PYG A;  3ONQ A;  2FUG 9;  3OJS A;  1ZTT A;  2RF2 B;  4NLQ A;  4B3S F;  2H65 B;  1U2F A;  1Q53 A;  2OPR A;  1FX4 A;  3J80 U;  4DV6 J;  5HQ8 A;  1SL0 A;  2PT0 A;  3MAH A;  2V68 A;  3UN2 A;  2V8H A;  3UDE A;  2FGC A;  4RPF A;  2AJ2 A;  4ECS A;  1Q5V A;  3HHL D;  2DGT A;  1U1R A;  4LFB F;  1RXO B;  4M8L A;  4F2R A;  3THV A;  1JXL A;  1UEU A;  2ROP A;  3OL6 A;  2HPU A;  5GAH I;  2FJA B;  4JI2 F;  2V9W A;  1J5E F;  1WG4 A;  3QRR A;  3OTE A;  5LSO A;  3GR1 A;  1ITP A;  3RRK A;  1FFW B;  4EU0 A;  5CYQ A;  1F2H A;  4QR2 A;  4WXW A;  4DPX A;  3E01 A;  1YJT A;  4GC7 A;  4NCG A;  4QCL A;  3MI7 X;  3DFE A;  2RVJ A;  1T9V A;  3UDV A;  1R6Y A;  2HUR A;  5B0D A;  4FDF A;  1RTI A;  4ANE A;  4KGV B;  1PG5 B;  2V63 A;  2ACM A;  1JLE B;  2G0C A;  1K8A T;  4DL6 A;  4JI1 F;  4ZP6 A;  3DRS A;  4PQU B;  1RGV A;  1R3N A;  3MXH P;  2ZOG A;  5U47 A;  2BMB A;  4K2J A;  3I82 A;  2LMI A;  2V4R A;  3FSX A;  4PUO A;  1XNQ J;  1B0V A;  5BJR A;  4CZC A;  1N5S A;  2OLW A;  4K8R A;  5KG3 A;  3H5Y A;  1C2P A;  4ZP7 A;  3MCN A;  3ZZR A;  1OWX A;  1KKH A;  2BRL A;  3H4D A;  3DLB A;  2BX6 A;  4Y2M A;  1Z2Z A;  2VPZ B;  1LW0 A;  3PHE A;  3W62 A;  3SEO A;  1RT3 A;  4B3M F;  2LEC A;  3Q22 A;  1FF2 A;  5F8J A;  1WOS A;  1WEX A;  2HQF A;  4UF4 A;  2MQP A;  1IBL F;  4KV8 A;  2E5H A;  1HAR A;  3T1A A;  2FVR A;  3QO9 A;  1AFJ A;  1KVI A;  1KOH A;  3N6N A;  4DFP A;  1IKX A;  1N52 B;  3TVY A;  3RB3 A;  2GZO A;  4W92 B;  1KD1 T;  1CSJ A;  1PBA A;  1YRU A;  2B4O A;  4KHR A;  2E1A A;  3IM9 A;  3ISZ A;  5E3C A;  2WRM A;  2XUL A;  1FJC A;  1SKW A;  4OHX A;  4TLQ A;  1KVK A;  4C11 A;  2F4V F;  2NXC A;  3M32 B;  3NLC A;  3L7P A;  2OEM A;  5KT3 A;  2IMW P;  3NMR A;  4LFA J;  2N3L A;  4YR2 A;  3EVW A;  4Z7Y A;  1TKT A;  2NPF A;  2P5V A;  3W8P A;  1S6Q B;  4X4S A;  4LBH A;  1HHQ A;  2HHP A;  4ED5 A;  1AFI A;  2VUG A;  2ZH2 A;  2J6S A;  2K3K A;  3EXY A;  3OHA A;  1OSC A;  4GO5 X;  5EWF A;  1R8P A;  2CPE A;  3M7V A;  3J80 Y;  1TL3 A;  1VQ5 S;  3CJ2 A;  1VQL S;  1D8Z A;  1RWP B;  4R0E A;  5K20 B;  2X1B A;  2GHW A;  4XPE A;  1TK0 A;  1X9M A;  4Q0B A;  1CVJ A;  4OLP A;  1JKH B;  4G1P A;  1K1S A;  2RQC A;  1FKP B;  3KG4 A;  4AFF A;  2KXN B;  2WZ1 A;  1VMB A;  4DZD A;  1AA1 B;  3ZZY A;  4C0B A;  8ATC B;  3H5S A;  1UWB A;  2HIY A;  2R42 A;  5LMU J;  4B9U A;  1QVF R;  3PW5 A;  2NS1 B;  4S0M A;  1BHN A;  3RG6 A;  3RJM B;  4NWB A;  2KI2 A;  5IM0 A;  1R31 A;  3EGN A;  1GT8 A;  2QSF A;  3MF5 A;  1ZM4 A;  1FXL A;  2H5E A;  1Y11 A;  2ALZ A;  5A8W B;  4FS1 A;  1RLD A;  1FEH A;  3G6Y A;  4ECU A;  4IG0 A;  4PWD A;  5T14 A;  1A7G E;  2DNM A;  4QQB A;  4BWJ A;  4FPR A;  4RW9 B;  2W9C B;  4HL9 A;  2QYC A;  2WSC C;  4C8O A;  4ZIT A;  2XGP A;  3MMC A;  3B78 A;  4G3I A;  3AD7 C;  3CJ4 A;  1JMT A;  1VIO A;  3DYA A;  3V6K A;  3VVT A;  3OLB A;  3UVJ A;  5HP1 A;  3ZTR A;  5F9L A;  3MOZ A;  5GAD U;  2J0W A;  1IXK A;  2C42 A;  4JI7 F;  1UPM B;  1R7I A;  2ILY A;  3BKF A;  2UV8 G;  1K47 A;  1YK9 A;  4ECW A;  2FVP A;  1N0V C;  2Y0B B;  3O3L A;  5B09 A;  3M8R A;  4P2S A;  3MM9 B;  4P71 A;  2E9T A;  2U1A A;  2BJ3 A;  3R1H A;  4PCQ A;  1SVD A;  4FBU A;  4QWE A;  2AX1 A;  1WAC A;  1RYS A;  1U6Z A;  2CXE A;  1NKB A;  1V5I B;  4OYM A;  4EFA C;  4J9K A;  3J7A 1;  2ZE2 A;  7AT1 B;  1X4G A;  2CIM A;  3I5C A;  3VCD A;  3ZNU A;  2YPY A;  1MWZ A;  3MM8 B;  4ZOS A;  3BH7 B;  3QO9 B;  2RRN A;  3SCI E;  3QNW B;  3SFG A;  3TQ1 A;  1VBX A;  4LF4 F;  4WFZ A;  5B0G A;  1IVZ A;  4MAK A;  2LEP A;  3DGP A;  3T1H J;  3S8S A;  2VOP A;  1N36 J;  2YKM B;  4Q5V A;  1RAB B;  1SPB P;  1AB8 A;  2HBZ B;  1HNZ F;  3UCU P;  2LXU A;  4P74 A;  1YI2 S;  1CBK A;  1CS4 A;  3DM2 A;  2V5H G;  4G1Q A;  5KFL A;  5IT0 A;  2MZR A;  4DFK A;  1HMV B;  3M30 A;  3MEG B;  2QJ3 A;  1N5Y A;  1DFD A;  3ENQ A;  3D54 A;  2D41 A;  3MUM P;  4EYI B;  3PHT A;  2X3G A;  3MUV P;  1PKU A;  3U1M A;  2QMU B;  1RWW B;  2ZBC A;  1OPZ A;  1MMD A;  1VHI A;  4H4O B;  4X4P A;  1M90 T;  1N32 F;  1AT1 B;  2GV1 A;  3RAQ A;  3JQK A;  1MRO B;  3H8Y A;  4DCO B;  5BR8 F;  3N9U C;  4DG1 A;  2OTL S;  1R8H A;  3GFX A;  4WII A;  3VQS A;  2KJW A;  1NDK A;  4YDX A;  1ZPV A;  1S48 A;  2MGZ B;  4AL5 A;  2RML A;  3AB4 B;  3ITH A;  4DSE A;  2CUY A;  4QR0 A;  2L41 A;  2F5G A;  4EMD A;  2DR7 A;  3WHI A;  4O3S A;  1U25 A;  2QL7 B;  1VOM A;  1TMM A;  2J8S A;  2K06 A;  3KHR A;  1S0O A;  5E3P A;  4X84 A;  1ZOT A;  1FRJ A;  3BYR A;  2M7S A;  1OY8 A;  4J9N A;  2OFG X;  3CGI A;  1HPZ A;  2DEJ A;  3PJX A;  1LWE A;  1KEK A;  3O44 A;  3RB4 A;  4ZVS B;  3RRG A;  5C2G A;  1DY3 A;  4ZIW A;  5KFG A;  2NLW A;  2RUG A;  4O4G B;  3QLH B;  2XYG B;  2E5G A;  5ETN A;  4YB1 P;  2RD5 C;  3KLF A;  1L3T A;  4KTQ A;  2CPH A;  2GGP A;  4ZA1 A;  5HJY A;  2VBZ A;  3I0R B;  4ZVG A;  1NPR A;  1IKX B;  3BSC A;  1UFW A;  3KG0 A;  2XMT A;  3FCW A;  5IM0 B;  4QPT A;  2JEG A;  1FDB A;  1PCA A;  3R5A A;  1SV5 A;  2A3J A;  3C66 A;  3IC1 A;  2OP5 A;  3N6M A;  4J5O A;  1YBU A;  4IQM A;  4TVA B;  4ES1 A;  5G0R A;  3SQG B;  3DLG B;  3EJM A;  4DUZ F;  5HO4 A;  3D1H A;  1FKA F;  3DOM A;  1XR5 A;  4QIW D;  3F44 A;  1NSQ A;  1HQ2 A;  1UEV A;  2CPZ A;  4DSK A;  3N4W A;  1CJK A;  4K4Y A;  2FVS A;  1XER A;  4I0W A;  4LJM A;  1P9Y A;  3DXB A;  3TNV A;  3OFG A;  3W61 A;  4DL4 A;  1I5O B;  3G6E S;  1LFW A;  4JI8 J;  2QG9 B;  4NZ0 A;  2KYZ A;  1TR0 A;  4PXC A;  2KM8 B;  2HHW A;  3C16 B;  3QT5 A;  1PAU B;  2DGO A;  1MW7 A;  2R2T A;  3PX0 A;  1HD0 A;  4M5D A;  4WPA A;  5K8M A;  3KK1 B;  3G2X A;  1H98 A;  5B0A A;  2EBE A;  1JLQ A;  2OPQ B;  3HO1 A;  1OPI A;  3N28 A;  4NI2 B;  1HNI B;  2DY9 A;  2WTF A;  2VQE J;  2HBQ B;  4JI7 J;  3D1Q A;  4C11 B;  4ZLL A;  2LVW A;  3MM5 A;  3KG1 A;  4ZJO A;  1IBK F;  4U7C A;  1X4D A;  2BJ7 A;  4N76 A;  1S1U A;  3LOU A;  1OY6 A;  2RNE A;  4NRT A;  4YHH F;  1RCO B;  5D0E A;  5B0E A;  4NXM F;  3PG9 A;  3OUY A;  1W2B R;  2R8J A;  1YHQ S;  3W2W B;  3VAH A;  1V9O A;  1ZA2 B;  2J9E A;  3HZE A;  2EFQ A;  1H2T Z;  1RAG B;  4QR1 A;  3GCW P;  1UVK A;  2AD9 A;  3CME S;  4ECT A;  3EDQ B;  1NZ8 A;  2FYX A;  2AEM A;  2W9C A;  2BM0 A;  2O5D A;  2OPP A;  3NAH A;  1UA1 A;  1CJT A;  3LAL A;  2MGZ A;  4DR4 F;  1RAA B;  2HLU A;  2HK2 A;  1Q78 A;  2PO4 A;  4CLZ A;  4ZN1 A;  1KC8 T;  1QAJ A;  2CNN B;  4GC6 A;  4C0O C;  5DM6 Q;  1LEO A;  1WOO A;  2HQI A;  4FZV A;  1F1B B;  3GIK A;  2W9B B;  2V4J B;  4WXO A;  3GQC A;  4LVO P;  5IOL A;  5A8K B;  2EPI A;  4AQY F;  3SMZ A;  4EBE A;  2JDJ A;  1UZH A;  3CCR S;  1UAW A;  2BAN A;  5CH7 B;  4A8X A;  1VC5 A;  3VF0 B;  2B9E A;  4R25 A;  2FJD B;  1WI6 A;  4NEY A;  4TN2 A;  1N88 A;  2XYH B;  2ZWO A;  3R6G B;  3Q89 A;  4PG4 A;  4AND A;  3MD3 A;  4Y3C A;  2RHQ B;  5D0H A;  5E3A A;  5CYM B;  3D68 A;  4DG1 B;  1KLN A;  3UE2 A;  3HI9 A;  3ISN D;  1MLA A;  4OZ2 A;  1X9W A;  5ETL A;  4FF1 A;  4IH6 A;  4DV1 J;  2QZ8 A;  2WSF C;  2WVB A;  4QIV A;  5HAT A;  4D3G A;  5KFC A;  1W2I A;  4IOB A;  4LF8 F;  4DJB A;  3W1Y C;  2GML A;  2VD3 A;  3W2V B;  2AEF A;  5AJ3 F;  2JFK A;  5HLF A;  1L3U A;  2CJK A;  3MPY A;  5CCL A;  2FTR A;  1DAR A;  1HQU A;  1X5P A;  2F7V A;  4FKX A;  9RUB A;  2QA4 S;  2HHH J;  1YG0 A;  1RT5 A;  1YIJ S;  1B7F A;  3KHG A;  1LWE B;  1IBC B;  1SC3 B;  3ET6 B;  4QZV B;  1T8E A;  3A3O B;  3E3X A;  4KFB B;  1HNX F;  3JSM B;  3Q8R B;  4DV0 J;  2HFO A;  3C8Y A;  1EX8 A;  2D74 B;  3P8B B;  4ZDN A;  3VGT A;  3NY0 A;  4IUF A;  1WWH A;  2H51 B;  3W65 A;  5KAK A;  3NNH A;  1BUX A;  4DS5 A;  1VRT A;  3DU5 A;  4ELV A;  3IWL A;  2MQL A;  3MEC B;  3EZU A;  3I4H X;  5GME A;  3RBX A;  3NKY A;  4AYB D;  1T9W A;  3T5L A;  2R8I A;  3R1L A;  2OEK A;  4OZ0 A;  2ROE A;  4F4A A;  2F65 A;  4WZQ A;  4KR0 B;  1Y3K A;  4NLU A;  4OI2 A;  2DNK A;  1X0F A;  2B7B B;  2O3D A;  1XN9 A;  2D3Z A;  2YKN A;  3R5J B;  2GNK A;  4QU7 A;  1FKO A;  2C2R A;  1XJW B;  2EI5 A;  2OML A;  3DC2 A;  4CH7 A;  1VHF A;  4OLO A;  2DY1 A;  4DHV A;  2XSJ A;  2YX7 A;  4AUK A;  2NXN A;  4ETX A;  5KFB A;  5KFE A;  4QIG A;  3NNA A;  2R7T A;  4HHU A;  1RU2 A;  3D6T B;  1EAY C;  3DOK A;  3HF5 A;  3FBF A;  3SCJ E;  4WK3 A;  2AX0 A;  1ZZF A;  3IRW P;  2HQ3 A;  3V81 A;  3TAN A;  2VDH A;  4JYA J;  3Q86 A;  1HNI A;  1U4B A;  1PSD A;  1RHK B;  2HK3 A;  3CD7 A;  4KHP F;  4CO5 A;  2P9G A;  1XMO F;  1T03 A;  1KNZ A;  4X62 F;  2ZVS A;  4GKJ J;  1FHT A;  1SIW B;  1U8W A;  3SDE B;  3CCM S;  4WP3 A;  3LPE A;  4Q43 A;  2UU9 J;  4PZV A;  3VTI A;  4YDD B;  4ED7 A;  3V6H A;  2AZ1 A;  2UUB J;  1ZM2 A;  2GA7 A;  2WVE A;  3MMB A;  3T5H A;  4E2F B;  3ILJ A;  4YOE A;  2DRA A;  5J1E A;  4TU7 A;  4F50 A;  2IVY A;  3D67 A;  3HLU A;  2ZNZ A;  3M8Z A;  3D0G E;  3TOQ A;  1S1W B;  3UW1 A;  4N5S A;  4DQI A;  3FRZ A;  4DR5 J;  3JB9 k;  1YSJ A;  1VFJ A;  5F8L A;  5IQQ A;  1MU2 A;  2UVV A;  1NRK A;  2F8M A;  2DPI A;  4JI6 J;  2K7K A;  3CO9 A;  3RZA A;  1W7W A;  2X3D A;  2DEI A;  3N01 A;  1S6P B;  3KK2 B;  3VV2 B;  1N5T A;  1SIZ A;  3BPS P;  3FEX B;  1PJ7 A;  4JV5 F;  4YUD A;  2DHG A;  5LSL A;  4OZ3 A;  4NCG B;  3S1T A;  1KHV A;  3THP A;  4B02 A;  1XNQ F;  2W25 A;  5C42 B;  3OTB A;  2MKH A;  2DH9 A;  1F5B A;  3K5M A;  3SCL E;  4A8Q A;  1I94 F;  2XI3 A;  4R5P B;  4DV5 F;  3MAA B;  2AGO A;  2AP6 A;  4FPI A;  4HDG A;  2CPI A;  4M5L A;  1DTT A;  8RUC A;  3TA0 A;  2MKK A;  2M3D A;  3MEC A;  1FRM A;  5KFU A;  3LGH A;  4FXD A;  2Q43 A;  3GFZ A;  2CWX A;  2DGX A;  3UWT A;  1U6F A;  5D3G B;  2CJA A;  1IR2 A;  4B9L A;  4LF8 J;  4CIO A;  4ES2 A;  2BOP A;  2DGV A;  4ECX A;  5E2Q A;  1TKD A;  1E6V A;  3H90 A;  4XO0 A;  3A3P B;  3EDR B;  2BKP A;  1UVM A;  1S7I A;  2KKH A;  3CDE A;  3CIM A;  3ZZP A;  4OHW A;  1NDC A;  2EG1 A;  2JOQ A;  3C15 B;  3FMB A;  2XSJ B;  4D3H A;  2WOM B;  1OQ3 A;  2LDY A;  4KV8 B;  5I42 A;  1S76 D;  1TL1 B;  4Q2L A;  1NH7 A;  2QLF B;  5ETV A;  2HHU A;  3JAM Y;  3NBP A;  4CLU A;  5HN0 A;  2D3O 1;  2ZZM A;  3G82 A;  2NYI A;  2C3M A;  4ED1 A;  4JI8 F;  2A18 A;  4NLY A;  3KDO A;  3EE3 A;  2JZ5 A;  4USJ C;  4DR3 J;  2CNO B;  4DX5 A;  1FK9 B;  4DN9 A;  5C5J A;  5IWA F;  2ZM6 J;  2LU2 A;  4ZCI A;  2K2P A;  3DRS B;  3W2V A;  4DR7 F;  1OIA A;  1WOP A;  2GAG C;  5L9X A;  2A10 A;  3SSS A;  2L3M A;  2OSR A;  2UUT A;  5KFW A;  3J7Y U;  5HBM A;  1BQM B;  3A8K A;  1J5E J;  1HNZ J;  1EB0 A;  3JSR A;  2HFV A;  3SSR A;  3UNG C;  1JLG B;  3FDS A;  3GV5 B;  1TAQ A;  2JLG A;  1IJF B;  3CCJ S;  4LFC F;  1YQH A;  1WDD A;  2VAS A;  4BCA A;  1I6J A;  1Y0H A;  2J0S D;  4DR2 F;  3AOD A;  1RHQ B;  3SFU A;  3U02 A;  3NGR A;  1RAJ A;  1FKP A;  1N48 A;  4UZC A;  3TUI C;  2KRB A;  4FP9 A;  4I64 A;  4C8L A;  2YWK A;  1O6X A;  1QSL A;  3LAN A;  2CYY A;  1X7V A;  2OSQ A;  5GAG U;  3GON A;  2KO1 A;  3GZ7 A;  2XZT B;  5HJX A;  3ILI A;  3C6U B;  1YKW A;  1JLF A;  2FDN A;  4W90 B;  2QGF B;  4KKO A;  5DDQ C;  2CJB A;  3AJ2 A;  4KIA A;  2F8H A;  2DGS A;  2OEJ A;  1Q0N A;  2F1F A;  2VB6 A;  3CJ3 A;  1P8G A;  3DOL B;  5GMD A;  2DCU B;  3KTQ A;  3H25 A;  3M32 A;  1Y5L B;  4NML A;  5F8G A;  2YKQ A;  4WCE Q;  1HKA A;  2WON B;  3I32 A;  3PRD A;  1SUQ B;  4QWA A;  4H4M B;  2DXE A;  5T7L A;  3KK2 A;  2FVC A;  2HNY A;  5HP1 B;  1DRZ A;  5LL6 d;  3BDP A;  2KVQ E;  1JQG A;  1O0P A;  4ZKA A;  3MUT P;  4EYH B;  4TY8 B;  2DXF A;  3GJT B;  2MEW A;  1T11 A;  4A4J A;  2VIC A;  4FYY B;  3OPK A;  3T5J A;  3KLH B;  2YH0 A;  3RB6 A;  2IC3 A;  7FDR A;  5JXS A;  2FQQ B;  4MIA A;  4RUA A;  1RK8 A;  2W2M P;  1F9E B;  1NM2 A;  3I5A A;  2I9S A;  4RUB A;  2E5L F;  2HNZ B;  4F0K A;  2HND B;  5KT6 A;  1M5O C;  2M2B A;  3OR2 A;  3F73 A;  2KZM A;  1HBM B;  1N5V A;  2LCW A;  4BBY A;  4YFU A;  4ED4 A;  2ZHA A;  2XS2 A;  2HGL A;  2WVF A;  3RW7 A;  1VRQ C;  1HW9 A;  5J1N A;  4ZLN A;  1H0H B;  5JMN A;  3RBE A;  3QRQ A;  1FCA A;  1GX5 A;  1KDN A;  3R27 A;  4DX7 A;  2JRS A;  2MB0 B;  4M5H A;  1RU1 A;  3CJ8 A;  1U0H B;  1YDL A;  3KMQ A;  1YJR A;  4K4S A;  2E1P A;  1KHW A;  3QQC D;  3PX6 A;  4I6A A;  4NLD A;  1GMW A;  4MFB A;  1RT2 A;  2M8H A;  3M9N B;  5IXU A;  3AAW B;  4DLE A;  2Y1R I;  5D77 A;  1FTC A;  4CYU A;  4JI3 J;  1Y3J A;  5F8I A;  3LP1 A;  3MMB B;  3QID A;  1TU0 B;  2AGP A;  2MKI A;  4RR5 A;  1WKL A;  3O1L A;  4LSL B;  4J9M A;  1NND A;  1SJR A;  2XLK A;  3GR0 A;  3HJV A;  3GII A;  3LAM A;  5L1L A;  1TKZ A;  3C6T A;  4UOG A;  2B4P A;  2Q6B A;  2ADB A;  1WSR A;  5KT7 A;  4KB7 A;  2DCL A;  4X65 J;  3SCK E;  4DUY J;  1FER A;  4ZVE A;  2OGU A;  1N34 F;  2BJD A;  1ELO A;  2R7Q A;  4KC5 A;  5K9F A;  1MN7 A;  1WEL A;  5HMW A;  2R2U A;  1Q7L B;  2AZ3 A;  1FWP A;  1I1G A;  3MCS A;  3CJK B;  1KP6 A;  2IM1 A;  4IKA A;  4DL2 A;  1FES A;  2I2Y A;  4NAS A;  4RNF A;  2YNI B;  4B9V A;  1NJX A;  5IV4 A;  1WF0 A;  2AMC B;  1EKS A;  3FFI B;  1LW2 A;  4WK1 A;  1XNR F;  4N8O A;  2CQ4 A;  1RWV B;  3A8J A;  4UW2 A;  5E5N A;  2M5Y A;  2XO7 A;  3PO5 A;  3C2P A;  1AUS L;  4MKB A;  3SXL A;  2HS4 A;  5KT2 A;  5K14 A;  3DOM B;  2CJY B;  2MPU A;  4LUB A;  3QMQ A;  4QIE A;  2GIR A;  5EX3 A;  5JJB A;  2AU0 A;  1Q7Y T;  4RLE A;  2RU9 A;  3TR5 A;  4CLT A;  1V3R A;  3WIV A;  5KFH A;  1P6T A;  3Q8U A;  4H4M A;  2AWZ A;  3H4B A;  3MAA A;  2GCF A;  4MYT A;  5DQH A;  1JLA A;  2F40 A;  4NOH A;  2AV5 A;  3OV7 A;  2XB2 D;  4FYX B;  4OV6 A;  4F04 B;  3D6F B;  1LK7 A;  4XIU A;  2EEY A;  3B54 A;  6FDR A;  4LF2 A;  5F3T A;  3I9V 9;  2HFZ A;  3PEH A;  4OQJ A;  1U49 A;  4R0J A;  1UL3 A;  2F8E X;  4OHV A;  1T7P A;  1K1Q A;  4K4Z A;  2H9Z A;  2VKZ G;  4NLX A;  4DOZ A;  5DG8 A;  3ZNJ 1;  3M8S A;  4MH8 A;  4CLF A;  4PG5 A;  1GK8 A;  1REV B;  4K59 A;  5A2Q U;  4Z37 A;  1U1N A;  2ZH5 A;  4LFA F;  3Q2T C;  1RTJ B;  2BV3 A;  3JYT A;  1HYS B;  3KK3 B;  1RT4 A;  2R3V A;  4J9P A;  1X31 C;  2GQQ A;  2JJ4 D;  4WE1 B;  2UUB F;  2GS8 A;  1JLC A;  2H48 B;  1VQM S;  4IH7 A;  4LFC J;  3R8Y A;  1VK8 A;  1Q4R A;  2HQC A;  1Z1Z A;  3QPI A;  3MOJ B;  4OJ1 A;  2OD4 A;  2RKI B;  4LT6 A;  1H6K X;  4OYX A;  4QIF A;  1D9A A;  4KGM A;  2W2P P;  1LWC B;  2CG4 A;  3V5R A;  5JUM A;  2FZK B;  2W1B A;  4C97 A;  3ILL A;  1Q5Y A;  1EQ0 A;  4IG3 B;  1NSP A;  5IS2 A;  1WF2 A;  3TI0 A;  4OYO A;  2J8A A;  2C3Y A;  4RWX A;  2OHD A;  3R97 A;  2AF6 A;  4LF4 J;  3A4T A;  1KQK A;  4EWT A;  1R0B G;  1NO8 A;  1HQE A;  2CKW A;  4B17 A;  1NJI T;  1XMQ F;  4P72 A;  5CYM A;  5KFX A;  1S6U A;  4MFB B;  4B9N A;  4ZIV A;  1U8S A;  2RF2 A;  4M5J A;  1K44 A;  4NA3 A;  4F67 A;  4F25 A;  2F4V J;  3VVU A;  4PR6 A;  1S1T A;  1EZZ B;  4MK8 A;  5J2Q B;  2B3T B;  4P6Q A;  2E9R X;  2XNQ A;  2PFD A;  3GU0 A;  1RTD A;  3MMA B;  4DDF A;  5GAE I;  1EET B;  2M0G B;  4C8Z A;  1JNR B;  2WVD A;  2J9C A;  5HLF B;  2FHK A;  1LNQ A;  2YWE A;  1JXV A;  3NP5 A;  4PEO A;  4C8Y A;  3EPI A;  4LRB A;  2BEF A;  1FRH A;  4HR2 A;  5BYR A;  3GIL A;  5SZT A;  5HMZ A;  1QSY A;  3DLH A;  3LP2 B;  5DG9 A;  1U47 A;  2UXD F;  1NPK A;  1TL7 A;  2MLZ A;  3DLG A;  5DLF A;  1RT3 B;  1YGY A;  2CDR B;  2GO9 A;  2C2O B;  3W5Y A;  2HVE A;  4M1K A;  4DPU A;  3VWS A;  1QVG R;  3Q8Y A;  1M5S A;  4R8U B;  4DQS A;  4HI1 A;  2YNG B;  2E1R A;  5D4O A;  2Y9H A;  4DR6 F;  1AW0 A;  2PA8 D;  1WTB A;  4LF9 F;  2YKP A;  3W7B A;  2MLX A;  3UDC A;  2APO A;  2LKZ A;  1FEE A;  1DAX A;  5IT9 U;  1YJW S;  4UTG A;  2OAU A;  3OTO J;  4KHP J;  5DZ7 A;  1ZAW A;  4JI1 J;  3MPW A;  2W2N P;  4LF5 J;  2KFZ A;  3KLV A;  1VDH A;  2EVZ A;  3E8O A;  1FX2 A;  5E33 A;  4NLG A;  2RT3 A;  2Y1L B;  3OL7 A;  4P2F A;  2VOO A;  3DRR A;  1FXR A;  3F56 A;  1DHM A;  3ET6 A;  4I2Q B;  2HRT A;  1BWE A;  4JOU A;  2E66 A;  1FWL A;  1U2R A;  3AXK A;  3Q24 A;  4CH0 S;  4K4U A;  3GIJ A;  1YJ9 S;  5E0O A;  4EBC A;  4HHJ A;  3ZFV A;  3FBE A;  1VQ6 S;  3GJQ B;  2MKJ A;  4PWW A;  4UY8 5;  2FB0 A;  2J7U A;  3IM8 A;  3PFE A;  3TJA A;  2FZC B;  3HZG A;  3O2I A;  1W25 A;  2GJF A;  2KXH A;  1HR0 J;  3KXD A;  3K8V A;  5KOW A;  2DR9 A;  4WFX A;  3V4I B;  4CLP A;  1XTZ A;  1PIL A;  2YPZ A;  3NS7 B;  3W66 A;  4HTJ A;  5FLX Y;  5FII A;  4G6V B;  2HSE B;  4UOC A;  2YWW A;  2FJB B;  4YN3 B;  1B70 B;  4HH1 A;  2XC9 A;  3VAK A;  3G71 S;  2V8G A;  3HJF A;  3DRY A;  5DET A;  2HZC A;  4A46 A;  3NGD A;  3W63 A;  1XK8 A;  1NBE B;  1NHK L;  4WTO B;  1A6L A;  4TLR A;  2R8G A;  2NUH A;  2RDD A;  1HQE B;  2B5J A;  4NYP A;  2CJQ A;  3BBC A;  5ETR A;  3NWR A;  5KFR A;  1FO1 A;  2CQC A;  3BSA A;  3HHD A;  2YXL A;  1JKH A;  4K4W A;  4NZ7 A;  5HMX A;  5KFD A;  1VC0 A;  1J27 A;  1RHM B;  3FSY A;  4IRC A;  1B4S A;  4AQY J;  3R5B A;  1JJ4 A;  2ACY A;  1R8C A;  2C28 A;  3TQE A;  1KON A;  1X5O A;  2IYG A;  2BE7 D;  4PG6 A;  2FGO A;  3DLL Q;  2BW7 A;  3H5U A;  2AYG A;  5AXN A;  3PKM A;  1JLA B;  3J81 Y;  3UQS A;  3N79 A;  1TFY A;  1PYS B;  4DI6 A;  2ZC4 A;  2IJN A;  3DCA A;  4FNH A;  5KFP A;  2JEF A;  3NXZ A;  3T9N A;  1CUL B;  2EFV A;  3DXS X;  4CLL A;  4ZLP A;  1GTE A;  3PW2 A;  1EAR A;  3OFH A;  5ETS A;  1DTQ A;  4CO4 A;  4F4Z A;  4G65 A;  2ABY A;  1KVJ A;  3PFO A;  1KN6 A;  2XMA A;  1BWV A;  1UET A;  4WKY A;  4ZJL A;  3LTO A;  1UPP A;  5H9F J;  3WDO A;  5JVH Q;  1HBU B;  3Q8Q B;  1FKO B;  3CPW R;  5EWG A;  2HAF A;  2DTJ A;  3MMA A;  4N7T A;  4O3O A;  1DTT B;  1QE1 A;  2BOA A;  2CZ9 A;  2V8P A;  2YNH B;  3NG8 A;  1GMV A;  1H7W A;  1BQN B;  1Q95 G;  2NXU A;  1RT1 A;  2VBY A;  2P2C B;  2ZDO A;  3CD6 S;  5ETT A;  1EQM A;  2QIF A;  3GE9 A;  3IMQ J;  1RT7 B;  1JLC B;  2PII A;  3OVS A;  2XS5 A;  2CWK A;  3UNY A;  2C1E B;  3RB0 A;  5C2C A;  2MZS A;  4RW4 B;  3HSZ A;  3IBW A;  4DX6 A;  2MDA A;  3OJU A;  1NU4 A;  2VFU A;  1O5J A;  3MM9 A;  2IJF A;  3I31 A;  3X1L B;  2VG7 B;  2VJV A;  2I5J B;  2VFV A;  3DDN A;  2ASD A;  5L39 A;  3GB0 A;  2ZBP A;  3CDA A;  3GSD A;  5EWE A;  4IG3 A;  2EK1 A;  2Z2Z A;  2RIJ A;  3BKT A;  5AE3 A;  2WOM A;  2XQC A;  5LMU F;  1PBU A;  4AE5 A;  3OD2 A;  1N56 A;  3HVW A;  1OYD A;  1M5K C;  1FTR A;  5CD4 A;  1ZH5 A;  4LF1 A;  3G8T A;  2H4W B;  3BQ0 A;  1L3S A;  4B3M J;  4JI5 J;  2MQ8 A;  2BJ9 A;  4LBI A;  4PKD B;  1WEZ A;  4LF7 F;  1PYO B;  4RW9 A;  3GV7 B;  1V6H A;  5DM7 Q;  1F0X A;  2IRU A;  1CLF A;  2V6A A;  2CNK B;  4KE5 A;  4XAK A;  5J2N B;  1FD8 A;  2MXY A;  3CUN A;  4ER8 A;  1LWC A;  4ERD A;  4URS A;  4NYZ A;  4MT1 A;  3UVJ B;  4LF6 J;  1TEL A;  3UN3 A;  2KT5 A;  2WAQ D;  3ZTQ A;  1UZD A;  4EZ6 A;  4IOC Q;  3NWG A;  5T41 A;  1WHV A;  2YWH A;  3G9C A;  2B9Y A;  1RE1 B;  2VA2 A;  4NYO A;  2F9D A;  2CPX A;  3OHB A;  4DFJ A;  2J0Q D;  4PWD B;  2W7O A;  3J81 U;  3AT1 B;  2MLY A;  3G86 A;  5DS7 A;  4BLG A;  2OD6 A;  4ZVP B;  4JI0 J;  3PR4 A;  1R0A A;  5K5M A;  2XEX A;  5FJ4 A;  3IAS 9;  2MHE A;  4CWB A;  5C24 A;  1EIY B;  3PYE A;  5FLX U;  4DR6 J;  1LV5 A;  1Y10 A;  3TRG A;  3OSN A;  1SKU B;  2A2C A;  2AJQ A;  1G1X A;  2W4P A;  1HIY A;  4RL1 A;  4QOT A;  5AJ3 J;  4FF3 A;  4YB6 A;  3T6B A;  2B5J B;  3KMS A;  2DO4 A;  2OMO A;  2XTJ P;  1NK5 A;  1NK9 A;  1HPZ B;  1RAI B;  9ATC B;  1IBM J;  4O44 B;  5DGB A;  4AL6 A;  5GAH U;  2Y8W A;  5D6G A;  4N41 A;  5A6W A;  4HKQ A;  3SV4 A;  3KJN B;  4RW6 A;  3QBC A;  1Q81 T;  5L46 A;  2DKO B;  3PJ9 A;  2PMH A;  1OJ4 A;  3FEY B;  1UW4 A;  2B43 A;  3CUL A;  2HNY B;  2O01 C;  4KSE B;  4L73 A;  3IS9 B;  3AQP A;  3BO4 A;  3I0R A;  1HBO B;  1HWL A;  2VU5 A;  1T9T A;  2G2Y A;  3QWU A;  3H2U B;  3Q8S B;  4QU6 A;  3KKF A;  1U1O A;  2RHS B;  3DN9 A;  2FHJ D;  2B4V A;  2G0I A;  4NI2 A;  4P75 A;  1JIH A;  2O67 A;  1A0O B;  2X1A A;  2X51 A;  2DB1 A;  4KPY A;  4ILL A;  3T5K A;  2RH3 A;  4Y6I A;  3HFV A;  5KFI A;  3GJS B;  5KG5 A;  2KG0 A;  1L5U A;  1HBM A;  1X60 A;  1S1V B;  4PG8 A;  4TQR A;  3H7H B;  1SUQ A;  1NCL A;  2WVC A;  2Z4P A;  4I6Y A;  4DMZ A;  3L09 A;  3VR1 A;  4DL0 C;  1RWX B;  2BJ8 A;  5EGY A;  2EFG A;  1IKY B;  4F3M A;  4I6W A;  2R8K A;  1HNW F;  4K2X A;  3TP2 A;  2PI5 A;  2HZA A;  3MPU B;  3B8H A;  4KYZ A;  3VGS A;  2Z2Y B;  5KG6 A;  2HHV A;  1NHU A;  4QYZ K;  1SJ3 P;  3PV8 A;  5GVQ A;  1VQO S;  3M6U A;  4QWD A;  2PMW A;  2LQJ A;  2HAI A;  1I94 J;  2R9L A;  4DR3 F;  3QWP A;  4HAC B;  3KLF B;  3HHK A;  3Q23 A;  3FKB A;  2FC8 A;  3MM6 B;  5FDL A;  1X4B A;  5EN1 A;  2GGP B;  4P73 A;  2V4J A;  4UST A;  4F2S A;  3PKY A;  3LPY A;  5D8H B;  4H54 A;  2UUC J;  3OXL A;  3CCW A;  4P10 A;  2VFR A;  1BXN A;  1KFD A;  5H1S V;  4LIR A;  3LW5 C;  2N3O A;  1VJW A;  1VK3 A;  1DTQ B;  3K5L A;  3QZ7 A;  1SI9 A;  2G9O A;  4HDH A;  1JLG A;  1UW9 A;  4L72 B;  1D1U A;  3PCO B;  1VLY A;  2NXE A;  1YZ7 A;  2OPS A;  2OPR B;  1HI1 A;  3IGN A;  2L9W A;  1TMJ A;  1MN9 A;  2VFS A;  4X4Q A;  2GMJ A;  4KT0 C;  1SH2 A;  3TZX A;  1YBA A;  1RAH B;  1RSC A;  3AQO A;  4FYD A;  3NMA A;  4L3N A;  5H9E J;  2Z30 B;  2W9B A;  4ELT A;  4B3R F;  1OS5 A;  2VDI A;  4X66 F;  4OZL A;  3MPV A;  3PRV A;  3KK1 A;  2MSS A;  3ICL A;  1SJF A;  3C19 A;  1I51 B;  3E01 B;  1R8B A;  2DR8 A;  4A47 A;  1RBO B;  2IVM A;  3C14 A;  4NE9 C;  4OV1 A;  2I5J A;  3IRX A;  1S1X B;  3OLA A;  3S01 A;  2LXF A;  3OR2 B;  2C2E A;  2NRE A;  2BBE A;  2HFU A;  3NRB A;  4DWI A;  1RAF B;  1JLE A;  1KWM A;  1WG1 A;  2ZIT A;  3UFC X;  3POT A;  3W64 A;  4USV A;  3HHE A;  3H59 A;  2AQ4 A;  1L3V A;  2V8V A;  3FC9 A;  2CAJ A;  4WP9 A;  2VZ9 A;  4OJ3 A;  3PX4 A;  5KG7 A;  3ENV A;  3LGN A;  1T05 A;  1XR6 A;  4Y00 A;  4CLK A;  2HLT A;  1VI7 A;  3HM9 A;  2EW9 A;  3V4M A;  2IC3 B;  3HT3 A;  1F9F A;  1GNK A;  2XSF A;  4ZPA A;  2YNF A;  5ETK A;  4O3N A;  1LW0 B;  1XWL A;  2K1R A;  5B08 A;  1T94 A;  4HT5 A;  2I8E A;  1Z2L A;  2GMH A;  1REV A;  2XMV A;  3GFH A;  1HW8 A;  4NLR A;  4PQA A;  3R7S B;  4A8Y A;  5CXT A;  5M2U A;  5L9N A;  1NKE A;  2UUA J;  1KTQ A;  5ETQ A;  2ZH1 A;  1N6Q B;  1HNX J;  3WQP A;  2HYI B;  1KS2 A;  1NLK L;  2YKA A;  3AD8 C;  3CED A;  1RT4 B;  3DI6 B;  3AOB A;  3TWZ A;  1NPP A;  2W8K A;  5CZV A;  1KFS A;  5IV3 A;  4WP8 A;  4DV2 J;  1NK8 A;  5HK4 A;  2PN6 A;  4QW8 A;  5K8N A;  3HXM A;  2J9D A;  3ELH A;  4TU8 A;  4GKK J;  1PIE A;  1BQX A;  1UJ4 A;  4C6A A;  3DU6 A;  4KJI A;  1RTI B;  4E0D A;  3QIP A;  3T6J A;  3TEH B;  2ZH4 A;  3KNG A;  2XS7 A;  3M1V B;  2N82 B;  3QJP A;  1FRK A;  1QTM A;  1WSV A;  3Q83 A;  2V67 A;  4JBC A;  5D15 A;  4NA1 A;  4LSZ B;  2FHM A;  2CQH A;  3GTY X;  3LO3 A;  1OQ6 A;  1TUW A;  5HRO A;  4F26 A;  4CO1 A;  2PI4 A;  2M9K A;  2DBB A;  5ETP A;  1ZS6 A;  1S1W A;  2FJX A;  1H38 A;  1FJ7 A;  2QLB B;  1TL4 A;  2XMW A;  2ZVI A;  4OJG A;  5HMY A;  4Q0B B;  3QGP A;  2ZBI A;  4JI3 F;  1YRT A;  2B4U A;  4OYI A;  3CCE S;  2P6T A;  2RDJ A;  5J2Q A;  1WC5 A;  2K7J A;  1RKJ A;  2CQP A;  1KSP A;  4RW6 B;  3KLI B;  3OXF A;  5LXY A;  1UVI A;  2J5A A;  1U02 A;  2UVW A;  1EET A;  2GQC A;  2ATL A;  4KQZ A;  4LF7 J;  1VRT B;  3BYP A;  4CQ1 A;  4UY8 T;  5IT4 A;  4K50 A;  4RW7 A;  4O3R A;  4DN0 A;  4NLT A;  1QM9 A;  3RW6 A;  4B3O B;  3IBF B;  2R7R A;  2GFF A;  1J5O A;  5IC4 B;  1FNM A;  2DNZ A;  3FFI A;  2VIH A;  1IQZ A;  2H5J B;  1HQU B;  3CJR A;  4LR8 A;  2AEJ A;  5HVG A;  1TL7 B;  1VQS A;  5CHC B;  1S79 A;  5GAE U;  4OI0 A;  4EGL A;  1S9E A;  2DD8 S;  1OY9 A;  2MZ1 A;  2AW0 A;  2QA1 A;  5LMN F;  4WKR A;  3MWB A;  2QN6 B;  1K0V A;  4Z2X A;  1EP4 B;  1KLM A;  5A0Y B;  5KFJ A;  3J7Y I;  4R5P A;  4NXM J;  1TKT B;  3MR6 A;  1C1C A;  3V6J A;  2RQM A;  2A2D A;  5ITH A;  3DRX A;  4HEA 9;  5I4M A;  1WF1 A;  4YY3 F;  4USM A;  2GJ2 A;  1U24 A;  5F41 A;  3BSO A;  3EXC X;  1M5P C;  2IMO A;  2IRX A;  3LP2 A;  4NL5 A;  3LF0 A;  3J7Z T;  1ZPW X;  2QSW A;  2BE9 B;  3CTR A;  2CFX A;  5F8N A;  4U95 A;  2YY3 A;  1HWK A;  2G2O A;  5KFM A;  1MWQ A;  3TAM A;  3RTV A;  2ZHO A;  3K7R A;  5I3U B;  1Q86 T;  3HK2 A;  2AJ1 A;  4O0N A;  2XM3 A;  3MM6 A;  5FDL B;  3SI8 A;  2HVI A;  2YKN B;  4ZPC A;  4DU7 A;  4X65 F;  2Z58 B;  1UVN A;  3EIC A;  4WFN Q;  1JJC B;  1U09 A;  2HBY B;  5I42 B;  1JWW A;  3LP0 B;  4ES3 A;  3EPG A;  3MR2 A;  4LR9 A;  2RS2 A;  3E2E A;  2RS8 A;  1Q8I A;  3ETM A;  5A8W A;  1YBT A;  2RAQ A;  3CD0 A;  1T05 B;  3HKZ D;  5EUH A;  1T3N A;  2IPO B;  4ETZ A;  2BYC A;  2J7W A;  2WHO A;  4L6V 3;  2V2Q A;  5D4P A;  3X3U A;  3GV8 B;  3M9M B;  4X64 J;  4DF4 A;  1E6V B;  3M2U A;  2Z0G A;  5KFF A;  4HH0 A;  4F7V A;  1JJH A;  3D3C J;  3FCH A;  4NLO A;  5KFZ A;  2L48 A;  3UPF A;  1VQ9 S;  1A9N B;  2PFF B;  3HCX A;  2CVE A;  2XCA A;  2AJF E;  3DDK A;  4ZPW R;  2FJW A;  3M30 B;  3MGJ A;  3M2V B;  3MEG A;  4RO0 A;  4CO2 A;  1YIT S;  2WW8 A;  4OZJ A;  4U9R A;  4C3M A;  3QFH A;  1EHW A;  4E8U A;  3CCS S;  1SBR A;  2YQ0 A;  2LQ8 A;  2CZV C;  2WBM A;  3JQM A;  4X66 J;  1FRL A;  5J1E B;  2QEX S;  2BQU A;  2UXB F;  2LEB A;  2A6O A;  2WCX A;  1IWG A;  2AT1 B;  3KLE A;  3AB2 B;  5K8O A;  1MML A;  5L38 A;  2ROG A;  4F4Y A;  2CNL B;  4ED2 A;  3D9B A;  2BJE A;  3IWN C;  2KYX A;  2AHO B;  2DNG A;  2C22 A;  1QUV A;  1IBM F;  4DCJ B;  5J1P A;  2ZOM A;  4QWB A;  2IM2 A;  2Y1I A;  1KQG B;  1T9Y A;  1VGY A;  1AZS A;  3DHX A;  3I0S B;  4PXB A;  1VBK A;  4NRU A;  2DGQ A;  1SV5 B;  1RHU B;  2J7K A;  2Q6C A;  1BQM A;  2B6A A;  3CWJ A;  4ELU A;  4F8R A;  4NCB A;  1S77 D;  4ILR A;  2RIL A;  1VQ8 S;  1WTF A;  3OFF A;  2JLF A;  4MKA A;  2XHW A;  2YQ3 A;  3LAK A;  2OKQ A;  5A8R B;  3S6E A;  2C3U A;  1P27 B;  4KPC A;  1TZ0 A;  1R6V A;  2HGM A;  2KHC A;  4MK7 A;  4URQ U;  2YTC A;  5ETO A;  1SJQ A;  4WWS A;  1VQP S;  2ZE2 B;  4LIW A;  1VCT A;  1NDP A;  5T7L B;  2U2F A;  4DXL A;  4RUC A;  2DVI A;  1NJY A;  3C16 A;  1SH3 A;  3KJF B;  1VQK S;  2IBK A;  1TVR B;  4J90 A;  3DDI A;  1F3V A;  4M94 A;  3GLJ A;  1RT7 A;  2XYP B;  1SCJ B;  4M5N A;  2CPF A;  2BKO A;  4RW8 A;  2CPD A;  5LXR A;  3T1Y J;  4PPD A;  1NHV A;  3MPD A;  1N36 F;  2F3J A;  4OX9 J;  3DOL A;  4M95 A;  4XTT A;  4Y0F A;  1CG2 A;  1KLM B;  4L75 A;  3M1V A;  1RYR A;  1FRX A;  2XWX A;  5AXK A;  3C15 A;  4FF4 A;  2Q3P A;  2JLE A;  3CCV S;  4DSI A;  1C4C A;  2HVZ A;  5A76 A;  5EHH A;  4DV7 J;  1F9H A;  2WSE C;  5AXL A;  4IOA Q;  3CCQ S;  1SKR A;  1UCN A;  2C2K B;  2Z2L A;  3FZB A;  4M5D B;  1S72 S;  4PYA A;  1YX2 A;  3M4X A;  2GJI A;  3VZH A;  3W8G A;  4CLW A;  1M1G A;  3Q8P B;  3HVT B;  1JK9 B;  5D0R A;  2CAD A;  2J6T A;  4F4W A;  5AXM A;  3QIP B;  2B9W A;  1FK9 A;  1KQS R;  3AJD A;  1X5T A;  1UWA A;  2WB1 D;  4CYU B;  4ZP8 A;  5BYS A;  4AXJ A;  1D09 B;  3WX4 A;  2E5J A;  1JLB A;  1LQ9 A;  3I6P A;  3HD1 A;  3NNC A;  3QGG A;  2HBR B;  1HBN A;  1OMS A;  1OYE A;  1GXL A;  3R7N B;  4RKU C;  3QSY B;  1Q82 T;  1Y7P A;  3L95 X;  2O66 A;  3CMA S;  2XLI A;  4LF9 J;  4C9D A;  3G4S S;  1M1H A;  2J76 E;  3LQV A;  5E41 A;  3OQ2 A;  5L1J A;  4B3T J;  3EGV A;  3FBC A;  3Q2S C;  1FJG F;  1UVL A;  2EFN A;  3PRB A;  3KUE A;  3F0N A;  3TO8 A;  3QRP A;  2PMZ D;  3VQT A;  3BO3 A;  4ZVU B;  2CQ2 A;  2OFH X;  1R0A B;  3N5B A;  4ZVF A;  3LUY A;  2AJ0 A;  2ZNY A;  1PGZ A;  2HVD A;  5KG1 A;  3ZZT A;  1TQL A;  3HFZ B;  3FZ2 A;  3OXG A;  4J9V A;  4LRC A;  1URN A;  4X4V A;  2GVD A;  2I0X A;  3IFE A;  2DH8 A;  1RB0 A;  3LGM A;  3P45 B;  3G87 A;  4F02 A;  1RT5 B;  1JLF B;  2MJN A;  3HD2 A;  4RW4 A;  2ZH3 A;  1QUP A;  4LBP A;  2RRA A;  3KLG A;  1EKR A;  5GAG I;  2H4Y B;  5HQM A;  4KH0 B;  1F6T A;  2VG6 A;  2HND A;  3J7Z 5;  2K8G A;  4J9Q A;  4B9M A;  4GRS A;  4DR5 F;  2HFS A;  2VG5 B;  1M5H A;  2QRR A;  3PZP A;  5THW A;  3S7R A;  2RSQ A;  1RWK B;  5C24 B;  3EX7 B;  3MAQ A;  1M5V C;  4Y65 A;  1CC7 A;  1ZET A;  4DV4 J;  2P6S A;  5F0U A;  1O51 A;  2ZWP A;  1DQA A;  1UKU A;  4OMF G;  4ANC A;  2DO0 A;  4A8K A;  2UUA F;  3WBZ A;  1R0C B;  3DRP A;  3ZZU A;  2A1B A;  1NJW A;  3CSK A;  1QSS A;  1HI8 A;  1RT2 B;  2PA3 A;  2RRB A;  1QJH A;  1CJU B;  2JFD A;  3UR3 C;  2OPQ A;  2RE1 A;  2LFV A;  4CCH A;  3M8Q A;  2VQF J;  3MCM A;  2XY6 A;  2MMY A;  1M0S A;  1NME B;  2IFX A;  1UJ5 A;  3UN5 A;  8AT1 B;  1T02 A;  3K57 A;  5IWA J;  3WX8 A;  5DDR C;  5K8P A;  3HDS A;  3ZZO A;  1ZA1 B;  3DOK B;  3VGU A;  2UP1 A;  1FJE B;  3UD5 A;  2MKC A;  2ZKT A;  4DQQ A;  4ECV A;  4P7V A;  5MLC V;  1Y5I B;  4DU8 A;  1R27 B;  1HNV B;  5EDW A;  1NB7 A;  4EO6 A;  4J7C A;  4K5R A;  1SC1 B;  2ATC B;  3IGV A;  3U1L A;  4HAC A;  4ZPD A;  3VAL A;  3SDE A;  2HVH A;  3CJK A;  3TZZ A;  3M6X A;  4LVN P;  4JV5 J;  2FLP A;  2HMI B;  2BQ3 A;  2JH3 A;  4ZCK A;  2CZ4 A;  4FXW A;  2LEA A;  4IR1 A;  2GVZ A;  2E1M C;  4QWC A;  3KJV B;  2Z56 B;  1D9F A;  2B6A B;  3BDE A;  1ZTW A;  2G4B A;  2VON A;  4LF5 F;  1BLU A;  1T95 A;  2EFP A;  2DIS A;  2V94 A;  2LXI A;  3C6T B;  1FDN A;  2V9K A;  4N8N A;  3B82 A;  4ZVO B;  1S4F A;  4J37 A;  3CXC R;  3V81 B;  2QA2 A;  2KN4 A;  3DGV A;  3NOG A;  3M9O B;  4IR9 A;  2JVO A;  1U0S A;  1P9Q C;  3H98 A;  4M5K A;  3CJS A;  4ICL A;  2FC9 A;  3C3L A;  3M8Y A;  3JTO A;  1U7L A;  2CDQ A;  1TV6 B;  1WEY A;  1WOR A;  1HBN B;  1Q79 A;  2G1H A;  4C4W A;  2MKS A;  1IKW A;  2HGN A;  5DO2 A;  4FN5 A;  1VBY A;  3QSI A;  1X9S A;  3SSQ A;  2DRB A;  1S0M A;  1TKX B;  1U6B A;  1KTV A;  3CDW A;  5D0G A;  2BW2 A;  3M6W A;  1NK7 A;  2POK A;  4DUY F;  3C46 A;  4EZ9 A;  3HVR A;  3K59 A;  4R8U A;  2Z57 B;  3CDB A;  3DNC A;  4OYP A;  2BVZ A;  3AH6 A;  5A0Y A;  1PJ6 A;  1HWJ A;  4CM2 A;  3PXG a;  4I56 A;  4KY3 A;  4TY9 A;  3R2D J;  4HT7 A;  3DGP B;  1JXE A;  3DRP B;  4NLP A;  3PAC A;  3IO1 A;  1ICE B;  3RYL A;  4ITS A;  1RA6 A;  3HHL C;  3TJ9 A;  5CYJ A;  1R8A A;  2EKN A;  3HX9 A;  4CM0 A;  4O0I A;  4E98 A;  3IG1 A;  2ZZT A;  1YTY A;  4O4R A;  2VKR A;  2BE2 A;  5MAO A;  2K1R B;  2V34 A;  3ETO A;  4ENO A;  2MTL A;  3AJ1 A;  1IR0 A;  4WFY A;  3QZ8 A;  3DLJ A;  1G3O A;  5J2M A;  4Y2K A;  2VFT A;  5H9F K;  2DNR A;  1VR6 A;  3MM8 A;  4ZPV R;  2KT3 A;  4QYZ J;  3RGI A;  2IJR A;  2VC0 A;  2UV8 A;  3OSP A;  2KHD A;  2A6M A;  2WBR A;  3AHP A;  3NGS A;  2I1R A;  4F36 A;  4KHM A;  2LQ5 A;  2FIU A;  3V4I A;  1RHJ B;  3JQJ A;  4CTA A;  5IQ6 A;  1RT6 B;  5HL7 Q;  5F8M A;  1D9D A;  5C25 A;  3P5T L;  4C48 A;  2YNF B;  3QT7 A;  2JWN A;  3PIO Q;  4ECQ A;  4V19 J;  3EMT A;  2DYA A;  3BGO P;  4V1A k;  1VQ7 S;  1FE4 A;  1T0T V;  2YX1 A;  1WJ9 A;  4PAB A;  3RU0 A;  3G8S A;  2P9E A;  2UU9 F;  3ADA C;  3E51 A;  4OX6 A;  5DQG A;  1RQ0 A;  1FWK A;  3MED A;  1H72 C;  2XI2 A;  3KJV A;  3PVX A;  2BA9 A;  4CLY A;  3HP6 A;  1H74 A;  1RTZ A;  2OTJ S;  3F41 A;  3NBP B;  3GJR B;  3NCR A;  3BGL A;  1KBR A;  1MG7 A;  2CQ1 A;  3FK4 A;  4M5G A;  4OI1 A;  4HYK A;  3TUJ C;  3SV3 A;  4JV2 A;  4NXN J;  3EUN A;  2XZW A;  4X4T A;  1S1X A;  1T9U A;  1S49 A;  3JAM U;  4RNH A;  4CO3 A;  1IM6 A;  1BMQ B;  2VV5 A;  6AT1 B;  2HWI A;  2VOD A;  4U6P A;  4F3O A;  4V19 X;  2OI2 A;  2ILZ A;  2JC0 A;  3H42 A;  1C0T A;  3R5G A;  4F0M A;  3DYA B;  3QJL A;  1DBD A;  2RB7 A;  1YLX A;  2Y3Y A;  3D6H B;  2XBP A;  5L1K A;  1PO6 A;  5D4N A;  1IKW B;  2E1C A;  3TVZ A;  2DGW A;  2YKO A;  2IA6 A;  4QYR A;  4DR2 J;  1T3O A;  4RU9 A;  1BC6 A;  2QL9 B;  1LKZ A;  1C0U A;  4ZVQ B;  4KGX B;  4H4K A;  4OI4 A;  1QLN A;  4C8N A;  2HHQ A;  1J2V A;  1VJQ A;  2KL8 A;  2NXJ A;  4UOF A;  2VG6 B;  3EVO A;  2W2Q P;  3QYY A;  1XMO J;  4GKJ F;  3IRX B;  1HMV A;  1N5Y B;  4DCP B;  1GMW D;  1GFW B;  3R5D A;  3MEE B;  4KO0 B;  3QAU A;  4DUT A;  4I7F A;  4B3O A;  3TAQ A;  1RWU A;  2D9P A;  4H4O A;  4Y2A A;  4MJK A;  3IR6 B;  3VAF A;  3EGW B;  4EBD A;  1EJ7 L;  2RQK A;  1RIS A;  2UUW A;  3NOC A;  4PXE A;  3H5X A;  1RAE B;  5G0R B;  3SQG A;  5HAN A;  2ZJR Q;  3HSD A;  1HR0 F;  4OX7 A;  1TFW A;  2YVS A;  3UDL A;  2FPH X;  3HPO A;  4XK8 C;  2FY1 A;  3TAR A;  1NJZ A;  4FXV A;  4G1Q B;  3PO4 A;  2DNQ A;  2JC1 A;  3FQK A;  3SQO P;  2ZUG A;  2H1Y A;  2ASL A;  1IKV A;  1VC6 A;  3UCG A;  3G6V A;  5LM7 E;  3H2V E;  3UO0 A;  5HBM B;  3JSY A;  3CF5 Q;  2DR6 A;  1NDL A;  1RAD B;  3FJ2 A;  1HA1 A;  2B0G A;  2QC3 A;  1XC9 A;  3KWM A;  4FKY A;  1E6Y B;  3MFI A;  4FF2 A;  2BXJ A;  3PDN A;  4AT1 B;  4PG7 A;  2DR5 A;  1V3Z A;  1UMJ A;  3HUL A;  3LH2 S;  2F9J A;  2MQM A;  3D3B J;  3BJY A;  3ISN C;  1JNZ B;  2HS3 A;  5LMN J;  2GHV C;  2C2M B;  5G4D A;  4OHZ A;  3A8E A;  1S1U B;  2FD2 A;  3UD3 P;  1TUV A;  1N5Q A;  4HVZ A;  4B9S A;  3LP0 A;  1PYT A;  1KR4 A;  2B56 A;  4WFA Q;  2ASY A;  2GVZ B;  1CUL A;  1Y4Z B;  2VQE F;  4YEA A;  5E3Q A;  2CVI A;  3DMJ A;  1U0H A;  1YJU A;  2J0X A;  2MKY A;  4USU A;  1SL1 A;  1CC8 A;  3OFE A;  4W4M A;  2NYH A;  2PDA A;  2IAJ A;  4OYZ A;  4Y28 C;  4OJH A;  4CTA B;  1EP4 A;  1S9G B;  2CPY A;  2EBG A;  3K17 A;  1LXJ A;  3M2U B;  4LRA A;  4N47 A;  4DL7 A;  4OYW A;  1GEH A;  3BF4 A;  5CA5 A;  1N54 B;  1OSD A;  5RUB A;  3PY8 A;  2BRK A;  2IM0 A;  3K8W A;  1IBL J;  5CD4 H;  4I1T A;  2DIU A;  2QFJ A;  4JI6 F;  1RT1 B;  4TKT A;  4ZPT R;  3MZI A;  4RW7 B;  3T1H F;  3FVY A;  3KUG A;  3M6V A;  4LMZ A;  2BAN B;  3FMW A;  1I3O B;  2B7C B;  3I4P A;  4KKO B;  4CP5 A;  2PD1 A;  4DR1 J;  2HHT A;  3KLE B;  5F0W A;  3OTO F;  4DSJ A;  3V2U C;  5IC6 B;  3TX8 A;  3W9I A;  2R2S A;  4ECR A;  3TVK A;  2C2Z B;  2RQ4 A;  4LSN B;  4IO1 A;  2MQQ A;  1FE0 A;  4MK9 A;  2X1F A;  1HBU A;  5DGA A;  3J7A N;  3K5P A;  2L08 A;  3BR8 A;  1TVR A;  2UZA A;  2KG1 A;  2BM1 A;  1X4F A;  3O5T B;  2ERR A;  1D0E A;  2VA3 A;  4CH1 A;  4DV6 F;  1RAC B;  3K0J A;  2XNR A;  1PC4 A;  3JTN A;  3OR1 A;  3L4B C;  3RAX A;  2IBO A;  4DUZ J;  4ED3 A;  4AD6 A;  2MQN A;  2AYB A;  4O44 A;  3R9L A;  5B0C A;  2IA0 A;  3RBD A;  2VG7 A;  1U26 A;  1S1V A;  2Y1J A;  4DX8 H;  1CEZ A;  1B3T A;  1VBZ A;  2AYE A;  3D28 A;  3TX0 A;  1RCX B;  3AA9 A;  4X4O A;  3HHN B;  4K5S A;  4B08 A;  4B3T F;  2DXD A;  3MEE A;  4Q44 A;  3K2Y A;  4LSL A;  5ADZ A;  1U45 A;  4FS2 A;  5LSR A;  4ID8 A;  1URR A;  4U8Y A;  1S0N A;  4M5M A;  2JEJ A;  3RUB L;  1VLO A;  2H5I B;  4JUZ A;  2KT2 A;  1IJE B;  4N56 A;  3CJT A;  1RTH A;  2HG4 A;  2G13 A;  2PEB A;  3SIP B;  1H3D A;  2VL1 A;  2C2D A;  2YQ1 A;  4TQS A;  5C25 B;  4A8W A;  5J2N A;  5KG2 A;  1NB2 A;  3FNN A;  2ZZN A;  4F3Q A;  1WUU A;  4UT4 A;  3P5B P;  2DIV A;  2B8P A;  2W9A A;  1RI7 A;  2IIH A;  1IUJ A;  3AD9 C;  3HT0 A;  5F9N A;  1X4H A;  5HI7 A;  4I2P A;  4ZVT B;  2LA6 A;  3BS9 A;  4JI0 F;  3CMQ A;  1IKV B;  1AZS B;  2K3I A;  2O1P A;  3I0S A;  1S99 A;  3JS9 A;  1S59 A;  3LP1 B;  3MED B;  4O23 A;  1IKY A;  3OW2 R;  1VQN S;  4PAA A;  1S57 A;  4OI6 A;  4RBU A;  2V2K A;  3GWC A;  4USI A;  1WNE A;  1Y9O A;  3CW2 C;  4IG0 B;  1UA0 A;  4ED0 A;  2NZC A;  1E6Y A;  1VS3 A;  5F8H A;  1S0V A;  3OL9 A;  2ZJQ Q;  1X5S A;  3I5B A;  2RKI A;  2XWY A;  3NGK A;  1JB0 C;  1TL5 A;  4NLV A;  4DR1 F;  3T19 A;  2D7S A;  1LXN A;  3ZO7 A;  1C0T B;  3TA1 A;  4YS2 A;  2MJU A;  2BDP A;  1RKI A;  3D4J A;  4C3K A;  2GW8 A;  2XHC A;  3BO2 A;  2HZV A;  1RWM B;  2JEI A;  2E44 A;  2CPJ A;  4NLS A;  4P9S A;  1DQ9 A;  2DNY A;  2CQB A;  2ZEJ A;  3MR3 A;  1IBK J;  1ROF A;  4IYQ A;  5IFM A;  1VYA A;  5L8R C;  5GAD I;  4Q2M A;  1FT8 A;  2COL A;  2YNG A;  2HRY A;  4P2X A;  2W7P A;  2VHG A;  2OJ3 A;  2GX8 A;  4NXN F;  1S6Q A;  3O6Q A;  4IFV B;  3DLK A;  1FFG B;  4PWU A;  3RR7 A;  3GSI A;  4ED8 A;  2Y8Y A;  3IR5 B;  1ZAV A;  4X2B A;  2AKW B;  1GTH A;  3CJQ A;  1HWI A;  5IT9 Y;  2I38 A;  1KRP A;  4Z7C A;  1XEZ A;  3MCO A;  4TU9 A;  5LJ3 Y;  3ENA A;  3VGV A;  1RWO B;  1QAX A;  2FLN A;  1TUG B;  3M8P A;  2RU3 A;  3EZO A;  1SB6 A;  1AXQ A;  4OX9 F;  1TK5 A;  4DR4 J;  4PPZ A;  5A6P A;  2ZUA A;  3UCZ P;  3U7J A;  3B4M A;  1VQY A;  4X4U A;  2MST A;  1RUS A;  4WYL A;  4DPO A;  4OZ5 A;  1UVJ A;  1XBW A;  3P49 B;  1G7C B;  1UP1 A;  1WC3 A;  2MQO A;  2Q79 A;  2HFN A;  1HHT P;  2M70 A;  2LQB A;  3ZC4 A;  2FJE B;  3O8W A;  2W01 A;  4CO0 A;  2XLJ A;  4EUV A;  2L9N A;  1F5C A;  4KBI A;  3U27 A;  1U1M A;  1H2V Z;  1ZYQ A;  5D3G A;  4ZHR A;  4NEZ A;  2KU7 A;  1SQE A;  4DV5 J;  5C7P A;  1Y00 A;  4DV7 F;  3MM7 A;  3MMC B;  3ZTS A;  1TAU A;  2H54 B;  1UWB B;  1LOU A;  2QLJ B;  1BE4 A;  2R4F A;  4NZ6 A;  1BD6 A;  1REG X;  4PXD A;  4EI2 A;  1N32 J;  5HRO B;  2GVD B;  1F2G A;  3CJ0 A;  3FUY A;  4DSF A;  3NEK A;  3EGZ A;  2QO3 A;  1GMU A;  3DI6 A;  3I96 A;  3D66 A;  5KFO A;  4DSL A;  2NSC A;  1QTN B;  2VF3 A;  4QBU A;  4DFM A;  5DJB A;  1AUD A;  3QAT A;  2CQ3 A;  2KVI A;  2UXB J;  4DV0 F;  2OIH A;  1PC5 A;  1Q8K A;  5GMK a;  1S1T B;  4C8M A;  4YME A;  1MU2 B;  1W26 A;  2ZDP A;  1SC6 A;  3ITH B;  1YVF A;  5HVH A;  2OH2 A;  1APS A;  5KFT A;  3BPD A;  4QJV A;  3BRE A;  4BS2 A;  4AXI A;  1WKK A;  3MFH A;  3MDF A;  3C6U A;  4M5I A;  4UOH A;  4RNN A;  3VAJ A;  5KG0 A;  3G6X A;  2YKM A;  3M2R A;  4I4B A;  3KHL A;  2NCK L;  5HVF A;  3HFK A;  3FGV A;  4I2Q A;  4OZN A;  2X7I A;  3WC2 A;  1NXI A;  1ZM9 A;  5KFQ A;  4NX9 A;  3KLI A;  3N0V A;  3IR7 B;  3DLK B;  3HHL B;  2DNO A;  1S5Z A;  4P52 A;  4MIB A;  4OI3 A;  2UVR A;  2NQP A;  3ENW A;  2EG2 A;  4ICL B;  3PW4 A;  4YP3 A;  3HKW A;  4U96 A;  3EYZ A;  5KOX A;  2VPX B;  3K5N A;  2NUU G;  4GVL A;  1RLC L;  3T3F A;  3PM9 A;  3G82 B;  5HSP A;  1MSW D;  1T9X A;  5KFY A;  5CAA A;  4TYB A;  2B9X A;  3W3S A;  5B0F A;  1S9F A;  2DHH A;  1HHS A;  4WIQ A;  4P7T A;  1NK4 A;  3GIM A;  5BXI A;  2IVF B;  5KFK A;  1CJK B;  2QYG A;  1LWF B;  1FJG J;  4I2P B;  1WG5 A;  3BH6 B;  4IFV A;  5DQI A;  2ZH8 A;  1YZ6 A;  2FJV A;  4C8K A;  4PQU A;  1TTH B;  2DH7 A;  2R7V A;  1YWX A;  2L9D A;  2M52 A;  3AY0 A;  4USH A;  3GG0 A;  1K73 T;  4NLW A;  1WHX A;  2D9O A;  3PYD A;  4ALZ A;  4JV1 A;  4DBQ A;  2E9Z A;  1CJV A;  1RT6 A;  5IZH A;  3BEG B;  2MZJ A;  3A1Y G;  3RRH A;  2ZHB A;  2Q66 A;  2PGC A;  2Y0S D;  3RBZ A;  1Q16 B;  3K58 A;  3BV8 A;  2BE2 B;  3QLH A;  1GAO A;  1GXT A;  2V8D A;  2E7X A;  3DLE B;  5F3Z A;  5A2Q Y;  2Z8Q A;  1HWU A;  2H3E B;  2QE5 A;  2XMM A;  3JTP A;  2Q1L A;  3BBB A;  4ZCL A;  3T9Z A;  4YR0 A;  2HMI A;  4GVB A;  1NUE A;  1ZAX A;  2F4F A;  2KZZ A;  4C98 A;  2E29 A;  4I69 A;  1PJ5 A;  2F63 A;  4ZP9 A;  2JX2 A;  4RNO A;  2BQR A;  4A8O A;  4K0K F;  1C4A A;  1WC4 A;  1L3K A;  2R2R A;  3UI3 A;  4QW9 A;  5KT5 A;  4JI4 J;  1NH8 A;  4U8V A;  2VJU A;  1RHR B;  2JHE A;  3OTC A;  1CJT B;  1AYE A;  1IWA A;  3AFG A;  1FXD A;  1WC1 A;  3CVK A;  1QY7 A;  4WFB Q;  1WHW A;  1XIQ A;  3ILO A;  2FY8 A;  2FHJ A;  3I87 A;  3RR8 A;  2YWF A;  3VAI A;  1S7H A;  1SJ1 A;  1ULR A;  4NA2 A;  3LWM A;  4USW A;  2R7S A;  1TV6 A;  4A8S A;  3MD1 A;  1SKS A;  1JLQ B;  2Z2M A;  2BKN A;  2LP4 A;  5ETM A;  2LU1 A;  1LWX A;  3IG1 B;  1TKX A;  4OL8 A;  4YQW A;  1CQM A;  3THT A;  1NK6 A;  1K9M T;  2CQI A;  2KJV A;  1H2U X;  4KH1 B;  3A12 A;  1YJV A;  5M2P A;  3PW0 A;  2KM8 C;  2G0J A;  2IRY A;  3ZTO A;  2HHH F;  4M63 A;  2QTW A;  4J91 A;  4UUX A;  3W2W A;  4CLS A;  4H4K C;  3US5 A;  3TUZ C;  3HMJ G;  2KH9 A;  3BQ2 A;  4EK2 A;  3QGI A;  4C2M A;  2ZBR A;  2YH1 A;  1N34 J;  4TY8 A;  1GQE A;  2HIQ A;  4DF8 A;  1RDR A;  1U1P A;  2A0F B;  2CQ0 A;  3CDU A;  3W5Z A;  3V6D B;  4ZN3 A;  5K14 B;  1B0T A;  1NZA A;  1V5V A;  4OZ1 A;  4KRW A;  4MYU A;  4JB8 B;  2LQ9 A;  4J9S A;  1CPZ A;  2N7C A;  3BN4 A;  4IFY B;  3JSM A;  2UVU A;  1DLO B;  1ARO P;  3CCZ A;  3CIZ A;  4Y34 A;  4BDP A;  3HHL A;  4NCA A;  5J2M B;  4J9L A;  1FD2 A;  5J2P B;  4C0H A;  1SXL A;  2D69 A;  2DK2 A;  2QLX A;  3MUR P;  1R43 A;  1N33 F;  1Z4U A;  5FD1 A;  5BR8 J;  2FZG B;  1UJ6 A;  4OHY A;  4U7U K;  3IN5 A;  3ZXW A;  3UD4 P;  2AGQ A;  1FNO A;  2QT7 A;  1UFL A;  4PRF A;  4ZHR B;  3HVT A;  2BAC A;  4YB7 A;  3GFY A;  2B51 A;  2QL5 B;  4YY3 J;  4CI0 B;  4EO8 A;  5CZX A;  2XY5 A;  2D3O R;  4OIX A;  2N4C A;  4U7U D;  2HEK A;  3BM7 A;  3BKU A;  3TZY A;  3GYN A;  1QD1 A;  5H9E K;  1D8Y A;  1RP5 A;  2W4C A;  3KFW X;  4JP8 A;  2V4Q A;  1M1K T;  1MNE A;  5DRK A;  3P96 A;  5A8K A;  1JX4 A;  2NPI A;  1ZBT A;  1HYS A;  1MMN A;  4NMX A;  2BZ2 A;  3KJQ B;  4IQX A;  4F4K A;  3ZZ0 A;  4K4X A;  3IA0 A;  5CYQ B;  5JVG Q;  5KT4 A;  4FNI A;  2ZM6 F;  4DV2 F;  3A3N B;  4DL3 A;  4W98 A;  3GIR A;  2MY7 A;  1PAE X;  2IY5 B;  5CQG A;  2JSX A;  4X4N A;  2CJ9 A;  2UUC F;  2IDL A;  2C3P A;  4B3S J;  1K0T A;  4URG A;  1VIS A;  3NS6 A;  2HWT A;  3TZW A;  2ZH6 A; 
#chains in the Genus database with same CATH homology
 4DI6 A;  3FCW A;  3FBF A;  1NDL A;  1UCN A;  3VGS A;  4FKY A;  3EJM A;  3NGU A;  3Q86 A;  2B8Q A;  1NSQ A;  3DKD A;  1VYA A;  5CAB A;  1U8W A;  3FKB A;  3ZTP A;  4S0M A;  2DXE A;  1NSP A;  3BBB A;  3BBF A;  2AZ1 A;  3GPA A;  1BHN A;  1NUE A;  2DXF A;  3ENA A;  2CWK A;  3VGV A;  3G2X A;  3FBC A;  2DY9 A;  1K44 A;  2ZUA A;  1MN9 A;  3VVU A;  4ENO A;  1F3F A;  4O0N A;  4DZ6 A;  3EIC A;  2HVD A;  1W7W A;  1XIQ A;  3VVT A;  3ZTR A;  1HLW A;  1JXV A;  1KDN A;  2BEF A;  3ETM A;  3PRV A;  4HR2 A;  4CP5 A;  3NGS A;  1NPK A;  4F36 A;  1LWX A;  1NSK L;  1F6T A;  5C7P A;  2HVE A;  3Q8Y A;  3EMT A;  3ZTS A;  2DYA A;  1BE4 A;  1LEO A;  3ZTO A;  1WKJ A;  3BH7 B;  3EM1 A;  3ZTQ A;  5IOL A;  4WBF A;  1EHW A;  3FC9 A;  1WKL A;  4ANC A;  4EK2 A;  3EVM A;  4UOG A;  1B99 A;  3Q89 A;  4AND A;  2HUR A;  3R9L A;  4ANE A;  3GP9 A;  1NDC A;  1MN7 A;  3B6B A;  2AZ3 A;  3FBE A;  3WX8 A;  2DXD A;  1PKU A;  1NLK L;  1WKK A;  4UOH A;  3VGU A;  3FCV A;  4FKX A;  1HIY A;  3NGT A;  3ELH A;  4C6A A;  2BX6 A;  2NCK L;  3EE3 A;  3FBB A;  4UOF A;  3EVO A;  4KPC A;  1NDK A;  1NB2 A;  3Q8V A;  3Q8U A;  3PJ9 A;  2B8P A;  3VGT A;  1S5Z A;  1NDP A;  3Q83 A;  1BUX A;  4DUT A;  1NHK L;  3DDI A;  3JS9 A;  2VU5 A;  1S59 A;  1S57 A;  1ZS6 A;  3B54 A;  3BBC A;  1XQI A;  5CAA A;  3MPD A;  4F4A A;  4W98 A;  1B4S A;  1PAE X;  3NGR A;  5BXI A;  3EVW A;  3L7U A;  1NCL A;  3BH6 B;  1HHQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...