2HURA

Escherichia coli nucleoside diphosphate kinase
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
142
structure length
142
Chain Sequence
b'AIERTFSIIKPNAVAKNVIGNIFARFEAAGFKIVGTKMLHLTVEQARGFYAEHDGKPFFDGLVEFMTSGPIVVSVLEGENAVQRHRDLLGATNPANALAGTLRADYADSLTENGTHGSDSVESAAREIAYFFGEGEVCPRTR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NUCLEOSIDE DIPHOSPHATE KINASE
publication title The structure of the Escherichia coli nucleoside diphosphate kinase reveals a new quaternary architecture for this enzyme family
pubmed doi rcsb
source organism Escherichia coli
molecule tags Signaling protein,transferase
total genus 42
structure length 142
sequence length 142
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2006-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 2hurA00
4UOHA 1HLWA 1XQIA 4ANDA 3Q83A 3VGVA 5CABA 3L7UA 1HIYA 3DDIA 1NCLA 3FBFA 3B54A 4C6AA 3Q8YA 3FCWA 3DKDA 1KDNA 3ENAA 1W7WA 3EJMA 3Q8VA 1MN9A 1XIQA 1NDPA 1MN7A 1NDLA 3ELHA 5CAAA 3VVTA 3EVOA 3FBBA 1HHQA 2CWKA 5IOLA 2HVEA 1VYAA 4UOFA 1NDKA 4W98A 2B8QA 3BBFA 3BBCA 1UCNA 3FC9A 2ZUAA 1ZS6A 3B6BA 3FBEA 1WKJA 3ZTOA 3Q8UA 4ANEA 2BX6A 3NGUA 1BUXA 3ETMA 4F36A 1NDCA 4FKYA 1F6TA 3VGSA 1NHKL 3G2XA 4DUTA 3ZTSA 1NPKA 3BH7B 1S59A 3EVWA 4CP5A 3EE3A 1S57A 2DXDA 4WBFA 2HURA 4ANCA 2HVDA 2DXEA 3GPAA 4EK2A 1K44A 1BE4A 3Q86A 3BBBA 1NSQA 1WKKA 1F3FA 2AZ3A 2AZ1A 3VGTA 3PRVA 1PAEX 1S5ZA 3GP9A 3PJ9A 3ZTQA 3R9LA 2BEFA 2DY9A 1NB2A 3ZTPA 4DI6A 4O0NA 5C7PA 1EHWA 2B8PA 4UOGA 3EVMA 3MPDA 4F4AA 5BXIA 3NGTA 1PKUA 3Q89A 3NGSA 1NUEA 2DYAA 3JS9A 3EMTA 3NGRA 4KPCA 1B99A 3WX8A 3VGUA 4ENOA 1BHNA 2VU5A 2DXFA 4S0MA 1U8WA 3ZTRA 4HR2A 3FKBA 1NLKL 1B4SA 3EICA 1JXVA 1LEOA 1NSPA 4FKXA 3FBCA 3VVUA 1WKLA 1NSKL 3EM1A 1LWXA 2NCKL 4DZ6A 3FCVA 3BH6B
chains in the Genus database with same CATH superfamily
5IT0A 3CSKA 1T3NA 3VAFA 4Q0BB 3A4TA 3EDRB 2GQCA 4GKKJ 1IJFB 3MUTP 1UMJA 1NK6A 1R43A 1XEZA 4IYQA 4NZ7A 4ZVUB 4ELUA 2ZC4A 2QT7A 2FD2A 1Q8KA 1IBCB 3TZZA 4DR1J 1OO0B 2HFZA 3NP5A 3SV4A 1U7LA 3BSOA 4DUYF 2AZ1A 4Q2LA 3W8GA 1S5ZA 3PJ9A 2BRLA 1P1TA 4FF2A 1UVKA 2Y8WA 2AMCB 2ASDA 4UOGA 4ZJQA 2KG1A 4ICLB 1C2PA 3MPDA 4CCHA 1QE1B 1U0HA 2AKWB 3HD1A 2BR0A 1KP6A 4DSJA 1NNDA 1KNZA 2FYXA 2DEJA 1N6QB 3RW7A 1XWLA 3DDIA 3V4IB 4FNHA 1FDAA 3D7SB 4NLTA 4L6V3 1FK9A 5KG6A 2MGZB 1ZBTA 1KLMA 3CMES 1F1BB 5CHCB 2UUAF 1V3RA 3HI9A 4ZP7A 1WJ9A 1F60B 3C14A 4FS2A 2ADCA 4CLLA 4ZLLA 1JQGA 4DF8A 1RK8A 4F4KA 4ZVFA 1NPKA 3D66A 2Z2ZA 2YWWA 2PDAA 2GC8A 3KLGA 1SV5A 3S6EA 3AFGA 2PMWA 3PHTA 2B9XA 3G6ES 4Y00A 1S0VA 1ZAVA 3JSMB 3P6YC 2VQEF 2RB7A 5FIIA 1EETA 2JVRA 5F8IA 1S6OA 2JFKA 3TAPA 3G8SA 4HH1A 1UWBA 3W7BA 3VAHA 5A6WA 4USMA 2FB0A 5LMUJ 2XNRA 4KKOA 2C3PA 1B99A 4URQU 1R8HA 1N48A 1WC4A 4HACB 2XI3A 4V1Ak 3Q24A 3W5ZA 2IJFA 2HHSA 2W2NP 4QOTA 2HWHA 2F3JA 3WX4A 1K73T 2DT9A 5HMXA 2M2BA 4FBTA 2LQ9A 2UU9J 1RTIA 3ISND 3FBBA 3SV3A 2A2CA 4RX6A 3T1YJ 3MM8B 4JI2F 2VFSA 1Q86T 3DYAB 4X4TA 3KLHA 2UUTA 2DH7A 2N4DA 1BQNA 1DJ0A 3MCSA 3M2UA 4LFBJ 1N56A 1HYSB 2XLJA 3BR9A 1RKIA 3C3LA 3H7HB 4AUKA 1HBNA 1ZM9A 4N76A 3JTPA 3B4DA 3CJKA 1HNVA 4JI3J 2EFNA 1X7VA 5EWEA 1MROA 1GX6A 1TP7A 1TL3A 2FJBB 3IR7B 3CJ4A 4H4MA 4LBIA 2GJFA 2XO7A 1HW8A 2EFQA 4J9OA 2XS7A 3CDBA 2X1BA 5KFBA 4Y2CA 4Q45A 1YBUA 1HQUB 1D3WA 2XHWA 5GAEI 2DNKA 3TQ1A 3MMBB 2ZVIA 4J7CA 4Q7AA 1AROP 1XIQA 4M5DA 3CD5A 4FYDA 1HHQA 1RWMB 3FEXB 2DGUA 2NZCA 3CDAA 3OXGA 5T41A 2FHJD 3ZZRA 2H51B 2PGCA 3K57A 2LU2A 1R7IA 3HULA 1R8BA 3AHPA 4OYXA 5ETPA 1S9GA 4JV5F 5D0EA 4G1QB 4DR3F 4TKTA 5G0RB 2Q6BA 3UD5A 3UCZP 4FF1A 3KMQA 1Q8BA 3DRSA 2QSFA 3RZAA 1R0BG 2V0NA 1RAFB 2AJFE 2HHQA 2WRMA 3CD7A 3Q89A 1S0OA 3KK3B 2WCXA 4Q8EA 2GMJA 2DIUA 2XBPA 1S12A 3NOCA 3I5AA 4ELTA 4KB7A 4DL4A 2FJXA 2R8KA 3GYNA 4LREA 4DR4F 4HT5A 3BGOP 2J0XA 4KY3A 1KQSR 2Q3PA 4DUZF 2XULA 4X62F 4NE9C 1M0SA 2HVZA 4TU7A 2E5GA 2GJIA 2W4PA 1UJ6A 1FE4A 3PYDA 3HZEA 3I5BA 2B6AB 2KXFA 3P5TL 5HQ8A 2MY7A 4CLFA 3ZNJ1 3QIPB 3LWMA 2HS4A 4DJBA 4KH0B 1I6JA 2CPIA 3AODA 1H98A 2HBQB 2KB2A 5KFYA 3LAMA 3MCNA 4CP5A 2MKSA 2QA1A 2CJQA 1K1QA 3EZUA 3DXSX 2CRLA 1K9MT 1BD6A 1VQSA 4KRWA 3J81j 4JI4F 2QYGA 3DLEA 1H74A 3AOCA 3ILJA 3QT6A 2Z2YB 4CNYA 1RCXB 4G6VB 3JAMY 1K0TA 4ZKAA 2RILA 4WE1B 1HMVB 3T5JA 2H1YA 1X5OA 3VGVA 5KG0A 5L38A 4ZLPA 2M3DA 3PDNA 3Q8YA 5CYQA 5EX0A 4U7UK 3NNCA 4FS1A 3POTB 2I6WA 4DSIA 1RTJA 5G4DA 2YNIA 2UXDF 3ZFVA 3R7SB 3H5SA 2APOA 3TJ8A 3A13A 3FQKA 4X4NA 4F0HA 1LNQA 3IM9A 2QJ3A 4BLGA 1DBDA 2YTCA 2UZAA 4LRDA 4A8XA 3FSXA 5DDPC 2MHNA 4DBQA 2JFDA 1XNQJ 4TYAA 2JL9A 2IFXA 4ZVHA 5AXNA 2GVDB 1S10A 4P75A 1JJCB 1A0OB 1HBOA 3TVYA 3PRVA 2UXBF 1YIJS 4K2XA 5DG7A 3IRXA 3WC0A 5KFNA 1LXNA 4DR2J 5J2QB 1KN6A 3H98A 3KNGA 3BO3A 2IDLA 2C2EA 4WU2A 4O4GB 2CJXB 4YR0A 1ZA1B 2E44A 1NPPA 4CO5A 3NS5A 1MMNA 1RU2A 2QE5A 3NXZA 4LMZA 3ZZPA 5ETNA 2AEFA 3DRYA 3R5GA 3QSIA 1R8PA 4KFBB 4QWDA 3Q0AA 4X66F 1FJ7A 2G2OA 1UW4A 3V81A 4DR5J 3OFGA 4D3GA 4C97A 1MN9A 2E5JA 3KJVA 3SSQA 1Q82T 2DIVA 3TI0A 1VFJA 3TAMB 2VASA 4XDDA 4I0WA 1UVNA 4QYZK 4ID5A 4OZ0A 3IBCB 3IWLA 3ONQA 2D3O1 2E9TA 4GKJJ 3ZZYA 2FY1A 2QSWA 5C2CA 3LW5C 1JIHA 1NH7A 2J7KA 3L09A 4B9MA 1NAQA 3QSYB 1GK8A 2ILZA 2IHR1 3M9OB 4QQBA 3RB6A 4DR7F 1RISA 1SL1A 1Y00A 2X7IA 1FKPA 3JSYA 1FESA 2VF3A 4JV1A 4C9DA 2R3VA 3D0IE 5HL7Q 1FFGB 3C6TA 3OTEA 4H4OB 4QWCA 2CADA 1ZAXA 5KFUA 3D0HE 1QE1A 1SKSA 4YR3A 3AOBA 2MZTA 4CLTA 3PV8A 3OL7A 2IM1A 3AY0A 5KFEA 1L3UA 3OV7A 4KE5A 1M5PC 2CPHA 2NSCA 4NA3A 2GMLA 1WELA 3CEDA 2LMIA 3BS9A 1QAYA 2HHTA 2DY1A 1SCJB 3DRXA 4C98A 4M8LA 4YB5A 5J1PA 2DNLA 4X4OA 1K47A 1S48A 2MGZA 2HMIB 4NCAA 4C11B 2GCFA 1HI0P 3BBBA 1H7XA 4R8UB 1ZOTA 4NLOA 3QRQA 1F9FA 2B9EA 1RSCA 4E98A 1RHRB 5KFIA 3AA9A 1PYOB 2C3MA 2BABA 1J5EF 2ZJRQ 1NZAA 4OX6A 2NUHA 5C25A 2HNYB 2KL8A 3BKFA 5J1NA 3KLEA 1T7PA 4DQQA 2Y8YA 3PO4A 1IM4A 2F8EX 4EYIB 2HBZB 4R0EA 2MKHA 5A6PA 3VHQA 1QUVA 3QMQA 2KTQA 5A0YB 1LV5A 4QYRA 4ITSA 1N0VC 4HACA 3GTYX 2HFUA 5E3PA 1YX2A 1E6YB 2LDIA 4TQSA 1PYSB 1VYAA 3SIPB 4OHVA 1N88A 4MT1A 3MM9A 4AQYF 2XYGB 5C24B 1RE1B 4P7VA 3ITHB 5AXKA 2OJ3A 1YWXA 3LO3A 2HGMA 3MM8A 3MUMP 1JWWA 4ZCLA 1NK4A 3U1MA 3FQLA 2YKNB 1TFWA 3LGNA 1G3OA 3B82A 2KDOA 1IBLF 2HRUA 2F4VJ 2ZVSA 2ZKTA 3R1LA 4AFFA 1S79A 3PIPQ 3Q2SC 1RA7A 1IN0A 4HH0A 4DG1A 1XMQJ 3TA0A 4NYOA 3PACA 4A4JA 3C15B 3V6KA 5M2PA 1KLNA 3GZ7A 5KG5A 2MZSA 4QIGA 1HWKA 2QGFB 2W9CA 3M05A 3MTKA 2E5LF 1IR2A 4MFBB 1UA1A 5E5NA 4IRDA 5D0RA 3GG1A 5DGBA 1HQUA 4QWAA 4OYOA 4C8YA 3P8BB 3GQCA 4B3TJ 3OVBA 4F3QA 4CO3A 1NO8A 3TYTA 3LGHA 2KRBA 2HQFA 3H5UA 1VQ8S 2PA3A 2XO6A 3THVA 3R97A 5GAGI 4XPCA 3H40A 2CWXA 3HM9A 2OTLS 3NNAA 3HSZA 5CD4H 1NUEA 4O4RA 4C8NA 4CO1A 4V19J 2NXEA 2A6MA 3BREA 3OVSA 4G1QA 4WPAA 3K7RA 1KWMA 2E29A 4OX9F 4LSZB 2RDJA 2CQ4A 1SIWB 2DHHA 4PG7A 2DGQA 1SJ4P 2OMLA 3RR7A 2A0FB 3HFKA 2OPRB 5IWAF 3RBXA 4NEYA 1WC1A 5F0UA 2R2RA 3NOGA 2KT5A 3NCRA 1W2BR 2OHDA 3M32A 2M88A 4QYZJ 1R27B 4ED5A 3EGZA 1GTHA 3M6UA 3N0VA 5EN1A 4QR1A 1TUVA 3BGRA 2Q66A 3MAHA 4JI5J 1S1TA 2VC1A 4G1IA 4OHZA 1CLFA 4WP8A 3A12A 4UF4A 1SC1B 4ECSA 1NSQA 4WKRA 4NASA 5ETKA 2CNOB 3QIPA 4P73A 1G4CA 1T9UA 3D1OA 4OI0A 1UP1A 3D9BA 1CC8A 5EWFA 4NI2A 3OSNA 4P71A 4NX9A 1ZH5A 2HWTA 4C8OA 4UZCA 2BDPA 2AV5A 2HVHA 2HZVA 3KDNA 2CPXA 4ID8A 3TZYA 3O2IA 2G2ZA 1JLBA 4DCOB 4TLRA 3R1HA 1H72C 5HO4A 5I3UA 3I55S 4YQWA 1CJTB 2QLJB 5KFVA 1NHUA 5EDWA 2CAJA 2HYIB 1JJ2R 2MLXA 1VQYA 4FNIA 2KHDA 2AD9A 1HQ2A 2B4OA 4IDKA 4RW8B 4NLXA 3U7JA 5C5JA 4I2PB 1A9NB 1TK8A 3QLHB 1RHQB 4QPXA 2HNZA 2CQDA 2KFZA 2MJNA 2DISA 1AXQA 3GSIA 5CZXA 4WFYA 3E51A 4DV5F 3KHRA 3SCJE 2E1RA 4RNHA 2RUGA 3GJSB 2IM3A 2Y1RI 1SC4B 2CNLB 2FVSA 3H2LA 1SXLA 1FKAF 3WZ0A 2XWXA 3A1YG 4C3KA 3M9MB 2D1CA 2DHSA 2O1PA 5J2QA 5HROB 3KJFB 3ILLA 5EWGA 2JZ5A 4O4GA 3SFGA 3I82A 2HPUA 3G71S 3D5MA 2IBOA 2F40A 1EP4B 1Y11A 2E5IA 5HMZA 2XMVA 2IAJB 3MEDB 1GNKA 1YBTA 5DQHA 4ECTA 2B4UA 3U02A 4RR5A 4OYMA 1U6BA 4YR2A 2F63A 2KH9A 4HDHA 2KN4A 4DHVA 1WORA 2JLGA 5HN0A 1MWQA 4PYDA 2ZNYA 3W9IA 1JLQA 4GMKA 2JH3A 5HBMB 1YZ6A 1YSJA 5KT5A 4RU9A 1NJIT 2KHCA 4NLUA 2H48B 4NCGB 2CIMA 4K4VA 4PKDB 4WKYA 5DZ7A 2WBRA 3QATA 1M1KT 3SCKE 3MFIA 1LOUA 1UVLA 3TA2A 4X2BA 3GIJA 3L9ZA 1WC0A 3NCQA 2CZ9A 1LW2A 1D09B 4O3OA 2XWYA 4PAAA 2UUAJ 3DM2B 2UV8G 2KZMA 4L3KA 4ZN1A 2HHHF 1T9TA 3NWGA 4GC7A 4DPUA 1U1PA 2QL7B 1JLCA 3KTQA 3CVKA 3GCWP 3CCRS 2W8LA 2VC0A 4H4OA 4LQ9A 2NSBA 2PI5A 3VAGA 3HK2A 1RCOB 3JQMA 4AE5A 2YX7A 3RGIA 2Q6CA 3IS9A 2ZH2A 1QVFR 3M2VB 3DRRB 4IG3B 2RH3A 4FBUA 4JBCA 3I87A 2V8DA 1SI9A 2CXEA 4K8RA 1N5YA 3CF5Q 1Q79A 6AT1B 3GV8B 4X4VA 3E3XA 1TL7B 2L9DA 2HMIA 1SJ3P 1HNZF 4DZDA 3K5LA 5GAGU 4R8UA 2ZHOA 1VQLS 5AE2A 2VODA 4USJC 2RJZA 2LLZA 3HHLB 3TVZA 2FHKA 2V4QA 5K14B 3AB2B 4KBIA 1EX8A 3PEHA 5IC6B 3DC2A 1OPZA 1QUPA 2HQDA 3K8VA 3MMCB 3KOAA 2ZZNA 4ECWA 1WC3A 1GAOA 1T03B 4YY3F 3L95X 1TV6B 4JI2J 2W24A 2PMHA 4USVA 2O01C 2EC2A 3EXCX 1HR0J 1OIAA 2FJVA 3KLVA 1OY8A 3N6NA 3OL9A 4CLKA 4DFMA 1ZM2A 2ACYA 2W01A 4PWUA 3F44A 1XMOF 4GVBB 3J7YI 4LBPA 3LAKA 2P6TA 2DJWA 2BQRA 2KT2A 3JTNA 2AJ0A 3I31A 1JLFB 3H42A 2HHUA 2BEFA 2CVEA 4F25A 2XYPB 2UXCF 1QM9A 4LRFA 4CM2A 2HS3A 3TUZC 3RB3A 4LF8F 1VRUB 3WIUA 3NGRA 3DOMA 4EFAC 2YVSA 5HSPA 2I9SA 5KFGA 3FEZA 5J2PB 3MMAA 1NLKL 2X51A 1LWFB 2VIHA 1IVZA 2HBRB 1JLGB 5JJBA 5ITHA 2YKMA 3HHEA 2CDRB 3BM7A 2KYXA 3IXQA 1A7GE 2IRXA 3BSAA 1XNRF 3R5DA 2MKYA 3BSNA 2GW8A 5IT4A 1RP5A 1UFWA 4G65A 3BN7A 3CCWA 4QIFA 2LEPA 5F8GA 3QJJA 1I94F 3US5A 3C15A 4Y34A 1F6TA 3DCAA 4JV5J 3O6QA 4DPTA 3IBWA 4DR3J 2LXIA 2WVCA 3IM8A 4DLEA 2V9WA 2ZD1B 2IRUA 1HWUA 1DHMA 1ROFA 1VQMS 4Q2MA 3D28A 3I96A 3NY0A 1PAEX 2VBZA 1JXEA 1WEYA 3UN3A 2OFGX 3TJ9A 2F9DA 4C8LA 4KC5A 3LH2S 2I38A 1HD0A 2QX0A 3SI8A 3JSBA 1UA0A 1YK9A 2EG1A 1IJEB 1F2GA 1TTHB 1FWPA 5KTQA 1O0PA 5SZTA 3H5YA 2YWHA 4DR4J 4S0MA 1NJZA 3PEJA 4NYZA 3T1HJ 3EICA 1NSKL 4BS2A 1OQ3A 4EO6A 2HEKA 1XQIA 5L1LA 1HIYA 1PC5A 1U26A 3KUGA 3G8QA 1O6XA 2WHOA 2OTJS 2YNHA 1TELA 3G6YA 3ZNUA 3C16B 1NDLA 1TVRB 4F0MA 3V6HA 1YJWS 1IUJA 4X65F 5IT9Y 3PIOQ 3HSDA 1WOSA 1Q0NA 2C28A 2R8HA 3H5XA 3AAWB 1CG2A 1HL6A 4LF6F 4ECXA 5M2RA 2OPRA 1U45A 4M1KA 1KC8T 1FFSB 1XR5A 1FKOB 3R7BB 5LMNF 2G1HA 4F04B 1FE0A 4QIEA 5CYJA 3MD3A 4P72A 3R9LA 4YB1P 5D4OA 4JI4J 1WC5A 1KKHA 4EU0A 1EJ7L 1W26A 2WVFA 4CWBA 2UVRA 5D6GA 3OUYB 4Q8FA 4OX7A 5GVQA 4B3OB 4ZVRB 3UNGC 2VBWA 1LWEA 1U1KA 1BQXA 7FD1A 4RW6A 1FWKA 3OTOJ 4YDXA 4LUBA 2BKPA 3DU5A 1YDLA 2NREA 3G82B 1C0UB 1S6UA 1RT3B 3MURP 3FCWA 3RJMB 2JHEA 2VKRA 1BQMA 1ZYQA 2YH1A 5H9FJ 1T9VA 4O3RA 2BANA 4CH7A 4I56A 5I42B 1YRXA 1HBMA 4Y2IA 1FWLA 4DS5A 3TOQA 3OLBA 3CCZA 3BF4A 2UXBJ 4ECUA 2VG7B 4FF4A 4RW8A 1X9MA 3Q23A 2CNNB 3HMJG 3TEGA 2F7VA 5K8PA 4CYUB 1ZTTA 4DI6A 4QR0A 4O3NA 3K0JA 2HHPA 2XLKA 2V68A 4KPCA 4BCAA 5K8OA 2G2YA 4IH5A 3QGHA 1WSRA 3HVWA 2PC6A 5KFAA 5EHHA 4DV7F 1HLWA 2QC3A 3TEHB 1SKRA 3MM5A 4WYLA 5GAHI 2EC0A 4PXBA 2V5HG 2F65A 3OHAA 1NBEB 1R3NA 2ZJPQ 1GX5A 1DRZA 2DCUB 2J7WA 4JUZA 3HX9A 2BJ8A 2KXNB 2OD6A 3GMGA 1RTZA 2VG6B 5HROA 4DX5A 1IKVA 3MPWA 4OFZA 4DL3A 2YBVA 1N36F 2BKNA 2BW2A 2QRRA 4ZA1A 3MXHP 3DOLA 4A8OA 3MEEB 4DN0A 3AQPA 2WOMA 2FPHX 1EP4A 3UR0A 1SJFA 4K4ZA 1SPBP 2Y0BB 4O0NA 2IAJA 3PRBA 2IY5B 2UUWA 3G87A 2DH8A 8RUCA 2XMMA 4DFKA 1EAYC 3CPWR 3J7YU 3J80U 1S6PB 1I51B 4OHWA 4JI8F 4XPEA 2H4WB 1TAQA 5E33A 5CXTA 4HVZA 2LA4A 3M2RA 3OR1A 1SJ1A 2XGQA 3FJ2A 2CQ0A 4ELVA 4RLEA 2C22A 2R7TA 2D7SA 2CQBA 2EPIA 1RWVB 4NCGA 1EQ0A 5CYMB 5CD4A 3HHLC 3W2WB 2IMWP 1WOOA 4URSA 1QAIA 2JOQA 2FC8A 1NHVA 1T9WA 4UQGA 1U47A 1VQPS 5KG4A 2B7BB 3TZWA 3FC9A 4ZPDA 2RKIB 3A3NB 3KK2B 3O8WA 5GMKa 1F0XA 1MNEA 2LFVA 2ZFHA 2B5JB 4J37A 5F8JA 2ROGA 2EWHA 1Q7LB 4PR6A 3SCLE 4OL8A 4WIIA 3MR2A 5HQMA 2NXCA 1RT4B 2L9WA 2HGLA 1RYRA 3TUPA 5A2QY 4ES3A 4DV3F 4C3MA 1UJ4A 3TA1A 3DRRA 4IG3A 4MKBA 3HHDA 2CJBA 4HR2A 3OJUA 1B0TA 3N9UC 2QMUB 1Y7PA 4J9MA 3Q83A 3D0GE 3M8ZA 3VAMA 2ZZMA 5GMDA 4NLGA 3RBEA 3U1NA 1J2VA 3IAS9 3KYLA 2ZH5A 2BACA 1ZETA 3HHLA 1N32J 5K14A 3FBEA 3TQEA 4EZ6A 2FZGB 2W2MP 1S7HA 3M4XA 1CC7A 4DUTA 3MMCA 5GADI 4HL9A 1C1CB 1GH8A 1EKRA 2AEJA 2DXEA 2AU0A 4LBHA 2PI4A 1T03A 1S0NA 5L1IA 5FDLA 2OELA 4YHHJ 1TV6A 4PQAA 1Q8LA 3HD2A 2U2FA 4DDFA 3DRPA 1APSA 4ALZA 1IBLJ 2QLBB 4N7TA 3KHLA 3LP0B 3B8HA 1VC0A 5IZHA 4GVBA 3WX8A 2B9YA 5M2UA 3UPFA 3W65A 1SKUB 5ETOA 4B3SF 3TVKA 1NU4A 3OL8A 2NQPA 2QO3A 1VRUA 1YITS 3H25A 2BJEA 2RS8A 1ZZNA 1XC9A 4NMXA 1U0HB 3P4UB 5C42B 2HVIA 2BMBA 2R7XA 1NDPA 1U09A 3GSDA 1M5VC 4P7TA 4Z2XA 1JLGA 2I5JB 1Y4ZB 1X9SA 2G0CA 1REVB 3OJSA 4M5LA 3RU0A 2QMWA 2VA2A 2DHXA 3Q8QB 1NB2A 2YKPA 3TUIC 3LP2B 1Z4UA 2QEXS 2P9CA 1BMQB 2O3DA 2G9OA 3C14B 4MIBA 2AJQA 1BY9A 2QIFA 1JB0C 3GE9A 1WWHA 3CJRA 4OX9J 2WBMA 2YX1A 1OSCA 3IG1A 5KG2A 2RQCA 4QR2A 2VDHA 1RWUA 1AFIA 2M7SA 4Y3CA 2R7VA 2DO4A 2RT3A 3T41A 2EXUA 1UWBB 1H7WA 4ZOSA 2AIRB 3CNQP 1VC6A 4KKOB 4PWDB 2EVZA 2AX1A 2R8JA 1AT1B 3CB4A 4HTJA 4JYAF 5GAHU 3GV5B 4U6PA 2FLOA 1RT7A 1T9XA 3JB9k 1QAXA 1TKXB 3EVWA 4M5HA 1KOOA 3L7PA 1WSVA 1F3FA 2ZWOA 2PD1A 1V3SA 5E7OB 1RTIB 5B0GA 1HNIA 3Q2TC 4KGXB 2DR8A 3SQOP 5HVGA 1U4BA 1RABB 2ASJA 5JUMA 3QPIA 4B3MF 2AW0A 4P2XA 3EMTA 1FKOA 1BQNB 4ZJLA 1RT1A 3NEKA 3ZTRA 1B4SA 2UVUA 3PFOA 4FKXA 4EWTA 2AEMA 2QA2A 3CDEA 3AOAA 2DKOB 1OSDA 1HBNB 3OUYA 3MECB 4ECZA 2ZOGA 1Q7YT 3O5TB 2MZQA 2DRBA 4B3OA 2CPYA 1P8GA 1HNVB 1N0UA 1RT2A 4IH7A 5K20B 2GGPA 1MROB 4H4MB 5L8RC 3K5NA 3G82A 2YWKA 1C0UA 2CG4A 2W2PP 1FRIA 1K1SA 3HF5A 1RT3A 1YRTA 4YB6A 2V50A 4ILMA 2L9NA 2GFFA 4ANCA 2AGQA 5F8MA 2Z58B 1TL5A 2UUCJ 1WEXA 4M5JA 1LKZA 1RWOB 2DR9A 1IKWB 4M5DB 3V6JA 3DNCA 4B17A 4PPZA 3QGIA 3JAMU 2MQ8A 3MCOA 1RI7A 4F0KA 8AT1B 1R6YA 3GB0A 3SSRA 1MWYA 4QWBA 5ETQA 2DGXA 5D4LA 5HMWA 2XY7A 4Q44A 2OEJA 2GZOA 3KUHA 1BLUA 4A8FA 4M95A 2GMHA 2XEXA 5D0GA 2YKOA 2RU3A 4LSNA 2HLUA 3H4DA 5LJ3Y 4DV2F 2RD5C 3NBPA 5DM7Q 1VK8A 4GC6A 3NG8A 1MMLA 2GHWA 3UDLA 4HLBA 3PY8A 1CJUB 3CJSA 2E9ZA 4XK8C 5IV4A 2XY6A 3I4PA 4DV6F 3NL0A 3MOZA 4ILLA 1UAWA 4WXWA 3NAIA 1NKBA 1RBLA 2IVYA 4QU6A 2N7CA 3GPAA 1U48A 1S1WA 2WW4A 1U8SA 3K8WA 3C46A 4LF9J 4OMFG 3AB4B 4DX8H 2B8PA 5AT1B 3G96A 4WFBQ 5GADU 3OBIA 2DRAA 4FDFA 1N5SA 3MEEA 2YNFB 3OFHA 4NLVA 4YB7A 2DXFA 3I6PA 4ZITA 5E0OA 1RAEB 3OTCA 3PR4A 4DQPA 4DLGA 3Q8RB 2K1RA 1O8BA 2HHHJ 4Q43A 1S6PA 2DK2A 3AD9C 2HBYB 4OHYA 1PG5B 5DQGA 3DLEB 1HNXF 4MH8A 5JVHQ 1NKCA 1UVIA 1MN7A 5KG3A 3TJAA 1VQKS 3I0RA 4KIAA 1UCNA 3GYGA 2B4PA 3K58A 3TP2A 1CBKA 1AB8A 2E1PA 3W2WA 4OZ5A 1WHWA 2VONA 2YWGA 4H54A 5CYQB 4JI7F 3T9ZA 2CQCA 1WKKA 2PMZD 2BJ7A 3IFEA 3H59A 4IQMA 5E3AA 1WI8A 3EZ5A 3LP1A 1YRUA 1RGVA 1RTJB 5ETRA 4PG6A 3KK2A 2YNIB 2KKHA 2VB6A 1HNZJ 1LXJA 3OT9A 2JJ4D 1N54B 2CQ1A 1H73A 3BGLA 4IOBA 4QIWD 1KR4A 4J9SA 3K59A 4V19X 5J1EA 3KLIA 3WC2A 2DR6A 1KFDA 4HTIA 2FQQB 3BPSP 3R5CA 1RTDB 5DLGA 1RT4A 3BH6B 2MLZA 4C8MA 1FA0A 4ECVA 4KGZB 4Y6IA 2UVWA 1FT8A 4YY3J 3MCMA 1FJGF 1N5QA 4NRUA 4KGKA 4R5PB 2EEYA 4DCPB 4QW9A 1QTMA 3MOJB 3PFEA 3NS7B 2RDIA 1X60A 5SUHA 1ZS6A 4YOEA 4WTOB 1XMOJ 2UP1A 1DQ9A 4USTA 1RQ0A 1V9OA 1PJ6A 2HURA 2EFVA 5HVHA 1JKHA 2HQ3A 3CCJS 1H6KX 4LJMA 1Q4RA 2UXCJ 4C3LA 2RRBA 4QU7A 2VFVA 3KJVB 4CLWA 4WF9Q 3LOUA 3W66A 4DX7A 2ZC3A 2WSEC 2HGNA 2NXNA 4MKAA 2J6UA 1C1CA 4DPWA 4QZVB 2CG8A 3RAXA 3IWXA 2LQBA 3EGNA 3RAQA 4HKQA 1KQKA 4CRJA 4EEYA 1XNRJ 2RVJA 4Y0FA 3LP0A 3M1VA 4J90A 1NPRA 1IWGA 2ZJQQ 3HZGA 1FCAA 2OGUA 1FKPB 1FRKA 4DQSA 3NAHA 1HFEL 2W2QP 3N79A 3CIZA 1I94J 4BWMA 3GFXA 4U7UD 1FF2A 3C6TB 2MZJA 1NK7A 2MQQA 5THWA 4LVNP 2V8HA 2OKQA 3HKWA 4OYWA 3ET6B 2RRNA 5C42A 1X4BA 2MY8A 4Z37A 5BYSA 1UEKA 1BC6A 2RNEA 2I5JA 2QZ8A 2J9EA 1WHXA 2W25A 4U9RA 2CPJA 3HFZB 4LFBF 4U67Q 1SB6A 1REVA 1N4LA 4CLYA 1YTYA 3DLKA 1IKYB 2DGOA 1YKWA 3LP2A 1Q5YA 2MXYA 4LRCA 4XO0A 5DDRC 2JWNA 4KGVB 3KFWX 4JI3F 3T5KA 2AWZA 4X65J 2MKJA 1N5TA 3Q8VA 3QYYA 3S8SA 4WFAQ 1IR1A 5C25B 2XSJA 4LF6J 3KLEB 1YVFA 2ZHAA 1PSDA 3BBCA 1RHJB 2VFTA 4A8YA 3MAAB 4FXWA 4HHUA 2HWIA 4LF5F 2KT3A 4MK7A 5K5MA 3ZTSA 4IOCQ 1LFPA 2JC1A 2IDEA 2UUBF 4PWDA 4KQZA 4RUHA 1RYSA 2AJ4A 4A47A 1WTFA 1UVMA 5KT4A 2DNQA 2V2ZA 2DNMA 2MPUA 5K8MA 2FY8A 3HJVA 3KG1A 3NGTA 3MM9B 2ALYB 1JJHA 2C2DA 3T5LA 1TKXA 3W61A 1IR0A 4I6WA 2RE1A 3MWBA 7AT1B 2IJNA 3VVUA 1HQEB 3VAKA 3CW2C 3GIMA 3MR7A 5DG9A 2M9KA 3VTIA 4LT6A 1YJRA 2NUUG 2MQOA 1JLEA 2J6SA 3PJWA 3RTVA 1RT5B 3BSCA 2AJ1A 2N3OA 1QAJA 4BHQA 2CWKA 2GX8A 2DHAA 2J8AA 4WZQA 3N4WA 1N33J 1FEHA 2OMOA 5KT3A 3NGKA 2JLEA 3UW1A 3R5JB 3MECA 3V6DA 2R7OA 2MLYA 4U8VA 1YJ7A 2DGWA 3I0SB 4C0HA 2XCPA 1B7YB 4DG1B 2J9CA 3MM7A 1G2EA 3H20A 1K44A 1FTRA 4CH1A 3AQOA 1NKEA 2ALZA 2W9CB 4NA2A 3EX7B 4ED7A 3UVJB 2R9LA 4I2QA 2DPIA 3GFHA 4LF7J 3GYXB 3BYPA 3MEGB 2WTFA 3L4BC 2W9BA 4GO5X 5D4NA 2BUNA 2VU5A 2YQ3A 2RF2B 1WF1A 3DOKB 1XMBA 1IKWA 1N5VA 1TZ0A 2NCKL 2OIHA 3HPOA 4UZBA 1NCLA 4KPYA 2WONB 4RZRA 3M6WA 3CDUA 2HKEA 5DG8A 1RAOA 4AT1B 4PG5A 1RACB 1FHTA 4UQTA 2PT0A 4PXDA 1AZSB 3PR5B 1N36J 5E41A 4A8MP 4USIA 3LQVA 4KR0B 2HNDA 3K2YA 3TZXA 5LSLA 5KFDA 3K5MA 1CJUA 4M5KA 4K59A 3B78A 2WVDA 3FEYB 1XR6A 1S76D 5DZ6A 1TQLA 2HG4A 3M32B 4JI8J 1N34J 4OI6A 2OAUA 4ERDA 4PRFA 2C3OA 1QD1A 3HP6A 3BGRB 3CE8A 1S1TB 2ASYA 4AXIA 1Y0HA 3KHGA 4ZCIA 5EX3A 3KHHA 4ZCMA 1NB7A 1EZZB 5F41A 4OHXA 4X64F 5MLCV 2K8GA 1RTHB 4FXVA 4IFVB 4NI2B 3HHKA 3W8PA 1HD1A 1O51A 2YNFA 1IBMF 3TNVA 2CQ2A 1S6QA 1J5OA 3BEGB 5LSRA 5J2MA 4PXCA 4ZN3A 3AH6A 3UN5A 2V8PA 1JLBB 1NDCA 5I3UB 2Y1LB 3OR2B 4HHJA 3K5PA 1S57A 3AA8A 4RU2A 2IYIA 4DR5F 2R42A 4NWBA 2IC3A 1IXKA 3GFZA 2W4DA 1DFDA 1F5CA 2CQIA 4DSKA 1SIZA 4IDKB 2ZM6F 4DV3J 3LA0A 3ZO7A 2LKZA 4GKJF 2V69A 2HNZB 4QBUA 3EWGA 1CVJA 1VRTB 5HJYA 2G0JA 2AT1B 1B64A 2OPSB 5B7WA 2ZH4A 1QVGR 4LSLA 3A8JA 2EFPA 4JI6J 5KOWA 3VQSA 5D3GA 2R7QA 3D3CJ 3PXGa 2RQKA 3G6XA 1FVQA 1Y5LB 1D9AA 4EMDA 1WI6A 3VVTA 1UWAA 2RQMA 5KFWA 2NXUA 2ADBA 1RTDA 4OX8A 5B0DA 2FGOA 5KT7A 1LFWA 1S1UA 2EKNA 4CTAB 2I1RA 2BJ3A 1RBAA 4URGA 1FVSA 2E66A 4LVOP 2HK3A 2ZE2A 4R5PA 2E1MC 3HT0A 1M90T 3IMQJ 5E3CA 1B70B 1H0HB 3BQ0A 4FYXB 1XJWB 1UETA 1R8CA 2HFOA 3QQCD 2AF6A 1U25A 3EVMA 4RPFA 4C8KA 2RDDA 4OZLA 2X1AA 3CCTA 1D9FA 1RHKB 2C2KB 4AXJA 2DNGA 3UO0A 2XMJA 1BHNA 5LJ5Y 4UY85 4DS4A 3R5BA 1YG0A 3VAJA 4B9NA 1DARA 5KFXA 3JQKA 1JLQB 4F4ZA 1FNMA 2FJAB 5DGAA 4NLWA 2U1AA 2VQFF 2GIQA 3A8KA 1SQEA 1F3VA 3PW7A 2Q79A 4X4SA 3ZZTA 1WD6A 3K17A 4FPIA 3P3DA 4MYTA 3M30A 2ZUAA 1WOPA 1VS3A 1RJJA 3DGPA 1X5PA 2KXHA 3CC2S 2JX2A 2BJDA 2C1EB 1LW2B 2V2VA 3QO9A 4DN9A 2V2KA 3PYEA 5FLXY 4DXLA 1C4CA 4RW7B 3FNNA 2K2PA 2R7WA 4B9VA 4TXSA 4OJGA 1YJ9S 3I9V9 5JVGQ 3OD2A 2BVZA 1EHWA 1JLCB 1RZMA 2RU9A 3ET6A 1XR7A 5BXIA 1H2UX 2FZKB 2BBEA 3HVAA 3UFCX 1CPZA 2BE7D 3QZ7A 2VG5A 4LFCJ 4WK1A 3IS9B 4ZMMA 4WP9A 2UVVA 2LP4A 1X4GA 5KFMA 4N56A 3LPEA 5GAEU 3MR5A 3GIRA 1DZ5A 4ZVSB 1N5YB 1TMMA 1XK8A 3IR6B 2BOAA 4USUA 4J9LA 3EZOA 1KDNA 3MZIA 1IQTA 1WC6A 2FHMA 2OI2A 3MR6A 2Z2MA 3D6HB 4JYAJ 2FZCB 2DNYA 5H1SV 4W98A 2EFGA 4FF3A 1DTQA 1IKYA 2BE2A 2BJ9A 3IA0A 1VRQC 2V9KA 5CQGA 2VUGA 3M9NB 4AL5A 1GT8A 4LRBA 1XMQF 3QAUA 5JMNA 1HNWF 5A76A 1R31A 1JK9B 4OI4A 3GJTB 2YKQA 1Y5IB 5ADZA 4JI0J 1TUGB 3MAAA 2D3ZA 1AUDA 1L3KA 1Q1KA 1PO6A 4PCQA 2E7VA 1CJKB 3FFIA 1DLOA 1J27A 2FVCA 2IRYA 3VGUA 5D4PA 3BKUA 4OZ1A 4MK8A 3VR1A 4B9TA 1TKTB 1RXOB 3H8YA 3DGVA 1KQFB 4AYBD 3DU6A 2GNKA 1OMSA 5KFQA 2JNJA 2Z56B 1A6LA 3SMZA 2FLLA 2DR5A 2B7CB 5IT9U 3LWLA 1V5VA 2BA9A 1FJCA 2N3LA 3DOMB 1K0VA 2VPXB 1HQEA 1F9HA 3MMAB 5F9LA 4EBEA 3HCXA 4O3QA 4EI2A 5HP1A 1YJVA 2ACMA 1R6VA 2YKMB 4WJBA 2OO4A 4IOAQ 5D77A 1S59A 2RMLA 1VC5A 1CS4B 4CLSA 1RT5A 2KG0A 1S0MA 2O67A 1X4HA 4GO7X 2W7AA 1RADB 3VAIA 2OLWA 4YN3B 4FVCA 3R2CJ 3A8IA 3I0SA 4XAKA 1KQGB 3NMRA 1DTTB 4JI5F 3JXOA 2AYBA 3E2EA 3G4SS 2J6TA 5DRKA 3TRGA 4TVAB 3UVJA 4LR9A 4LQ3A 4DV2J 3VV2B 3MEGA 2MZ1A 2YH0A 5HK4A 2H5IB 3AD7C 2JEFA 3R2DJ 3UCGA 5KFKA 2MZRA 2R2SA 2FVQA 4DV6J 2RF2A 4ED3A 3DOKA 3U1LA 4ILRA 4P2SA 4ZK7M 1C1BA 1T11A 2M52A 2RQ4A 1JXLA 2E5HA 3BQ2A 2WONA 4KHRA 3NMAA 3U27A 3BB5A 4A8QA 5DDOC 4N8NA 3BJYA 2HIYA 2YNHB 2XM3A 4HI2A 3L7OA 5I3PA 3PHEA 3PW4A 1AZSA 2DR7A 2YQ1A 3J7AN 3D68A 1QLNA 4DPYA 4OZJA 1GXUA 3EDQB 4KYZA 1U1RA 2MMYA 2D41A 3JQJA 4K0KJ 2LU1A 2F1FA 3CWJA 4KHMA 4X4PA 4ENOA 3HLUA 1AYEA 5GMEA 4J9NA 3FKBA 4JB8B 3BZQA 3RAMA 4ZLNA 4YP3A 1ZM3A 3HVTA 1OYEA 4FN5A 3UN2A 4Y2KA 1HNXJ 4DR6F 3PKYA 3PX4A 4F4WA 5I3QA 2ZZTA 1NJWA 2QLFB 3KDOA 3J81Y 5B0FA 4R25A 2AGPA 3BGUA 3ELHA 4E8UA 2V8VA 4W92B 1LWEB 2VH7A 2HSEB 1RDRA 1PGZA 3B6BA 1C0TB 4RW6B 3KG4A 3E01A 1I5OB 1KONA 3W2VA 4JI7J 4NZ0A 1SUQB 2RUSA 1RTHA 1ZM4A 4IFVA 2DXDA 5H9EK 5J2NA 1KHVA 2MKIA 2QL5B 1SQFA 2JLFA 4DWIA 1IWAA 3CJ0A 3VGTA 3F41A 3RB0A 1BQMB 3ZZUA 4L74A 2YNGA 1RT6A 2FIUA 3UD4P 1G6BA 2BANB 1RA6A 3H90A 4K50A 1HBMB 3OR2A 3TW0A 2HFSA 1ICEB 4HYKA 1HBUB 2BE9B 3D2WA 3D6TB 3FSYA 2LEBA 3SFUA 2DBBA 4W4MA 3ZXWA 1WF2A 3IGVA 3UWTA 1FNOA 1FD8A 1FJGJ 2KZZA 2YXLA 2VZ9A 4B08A 1YJTA 5HVFA 1NXIA 4DPXA 2ZH6A 1VRTA 1OYDA 4B9UA 1U02A 3QFHA 3PNIA 4ZLJA 3OFFA 2OPSA 1MSWD 2XC9A 3PTWA 1GFWB 2DGVA 3J7ZT 4EYHB 3ETMA 3UDEA 1Q16B 4FKYA 5B0EA 3S01A 4PWWA 1U2FA 4NXNJ 4MYUA 2JDJA 4ZP8A 3MM5B 2IMOA 1RB0A 2QYCA 4RL1A 2KFNA 4ZHRB 1DQAA 2WB1D 5C2GA 2M4MA 4IH6A 4DFPA 5F3TA 4JV0A 4YUDA 4TNOA 1KTQA 5A2QU 2C2OB 4K5RA 2RS2A 4N47A 3MMJA 4CTAA 4RW4B 2VL1A 4L75A 4F4YA 1IKVB 2DYAA 3KUEA 2LA6A 2WB4A 3LGMA 5A8KA 3DOLB 2WOMB 1BXNA 2HFVA 3R3TA 3CCMS 2HRYA 4ANDA 1FDDA 4IG0A 3A3OB 2D74B 2CJYB 4F8RA 4DUYJ 1QTNB 2ABYA 3PYFA 3OR1B 3M2RB 5FD1A 2J7UA 3TAQA 4DOZA 4M5MA 1QSYA 3PKMA 5KFZA 4TY9A 3G2XA 1VQ6S 3FRYA 2Y0SD 4UUWA 4L73A 4IFYA 4EK2A 4DV0F 4ZJOA 2CYYA 4GRSA 2V2QA 2CUYA 2JSXA 2AP6A 2ZH9A 3MI7X 3GU0A 2BV3A 2MTLA 4NLSA 4I69A 4A8WA 3D3BJ 2HAFA 1HR0F 5DJBA 2V63A 1S4FA 1RAAB 3RRGA 2HIQA 2DITA 2M70A 3NRBA 3CGIA 1TKDA 2GO9A 4RW7A 2XZWA 6FDRA 2DCLA 1NSPA 5BYQA 5H9FK 2CZ4A 2KI2A 4KHPF 3CUNA 1MU2B 2O5DA 5A8RA 5KG1A 5KFFA 3IR5B 4RUBA 5ETTA 1UEUA 1RWXB 3MF5A 3RRHA 1ULRA 1GMWA 1IBKF 4M94A 1KBRA 4NOHA 2POKA 2VICA 3ILIA 3IC1A 2FVPA 5B08A 3R8YA 2N82B 5L9XA 2HRTA 2VQEJ 4LF5J 4DV1F 4RKUC 2UUBJ 3C66A 2DPJA 1VDHA 2VJUA 2Q1LA 4ZP6A 4NLQA 2XCAA 2HVDA 2GO8A 1OY6A 3FMWA 3H4BA 1VBKA 5EUHA 2J76E 5D78A 3DI6B 1Y9OA 3QJPA 3RW6A 4ED4A 2QG9B 1CULB 1YHQS 3GILA 3PVXA 2ZUGA 4ES1A 1SJQA 4NZ6A 2KJVA 5FDLB 3M7VA 1KRPA 1RLCL 3KJNB 4K4WA 4X4QA 2G4BA 3DRPB 2IVMA 3BQ1A 1PJ5A 1CJKA 5ETLA 5L39A 2XGPA 4OI3A 3NKYA 3QFWA 4MJKA 3BN4A 4YDDB 1KFSA 1WNEA 3A8EA 1TKTA 2JEJA 2AYMA 4J9RA 3T1HF 1NDKA 1HW9A 2JRSA 2B8QA 5HQLA 3ZTOA 3IO1A 1U2CA 1VIOA 3SXLA 3DFEA 3MPUB 4FVMA 4IO1A 3C2PA 4N8OA 4FYWB 5T7LA 4YFUA 1Y5NB 2A1BA 4P10A 5HLFA 5KOXA 4C7QA 2VPZB 3I5CA 2C42A 5H9EJ 1SKWA 2OPPA 1EB0A 3F0NA 2FLPA 4KV8B 2K7KA 1TK5A 2FJEB 3X1LB 4J9UE 3MM6A 1FXLA 1X4AA 4ZIWA 2VA3A 3PW0A 2ROEA 4CO0A 2MKCA 4IR1A 1CS4A 3QT7A 2CA9A 2COLA 2LXFA 4EO8A 1RBOB 3DLJA 2KVQE 2ZBRA 2FHOB 1DQ8A 1UJ5A 1UZDA 4ZPWR 3BYRA 1M1GA 1DTTA 3HFVA 1XERA 1U1OA 3QT8A 5FJ4A 3LTOA 1URNA 2MHEA 1VQ4S 4F2RA 1HWJA 3OTOF 2ZWPA 3IG1B 3M8YA 2PA8D 2CPDA 2J8SA 3TARA 2LEAA 4NYPA 4K4XA 4O44A 3NLCA 3ISNC 3HVRA 5AJ3F 2XHCA 4RBTA 3THTA 1EQMA 3ZTPA 2XMKA 2DNZA 4DUZJ 4X62J 3C6UB 5LM7E 4F4AA 1B7FA 1YJUA 4CDIA 3S1TA 2V34A 2E9RX 3CJQA 4I1TA 1ZPWX 3HHLD 2VJVA 1RT7B 3FMBA 4ER8A 1RKJA 1X0PA 3TR5A 2OSRA 4X64J 2OPQA 3IP0A 4LF4F 1HNIB 2VOOA 3KG0A 3IRWP 1SH0A 1IBMJ 1FXDA 3HXMA 2CZVC 2GVZB 3IGNA 4K2JA 2PE8A 2CPZA 4QIVA 6FD1A 1X31C 3QGPA 3J7Z5 3GR1A 3EGWB 1RT1B 2A10A 4P6QA 5L1KA 2EI5A 1ACMB 3AT1B 3ETOA 2ZBCA 3M8PB 3BH7B 1Q78A 1X4EA 4TU9A 3CIMA 3OXLA 4AL7A 1RT2B 2GGPB 2ZM6J 1VLYA 2I0XA 3LUYA 1FTCA 4Q0BA 3CJTA 3G86A 3ZZZA 1C0TA 5K9FA 1PKUA 2LXUA 4UOCA 1SUQA 1GQEA 2EK6A 3CD0A 2CDQA 3OFEA 1HHTP 1B0VA 2UXDJ 4CO4A 3KLFB 2A2DA 4LFAF 4JI1F 4GVLA 2XMAA 1RU1A 5AXMA 4ATNA 4RNOA 4XDCA 4EBDA 4DL2A 5D15A 1CJVB 1HBUA 2BM1A 3Q22A 8ATCB 5KFJA 4YS2A 4ICLA 4M5NA 4ZPAA 3CCQS 2GAHC 3GR0A 3AD8C 3GG0A 4CH0S 4ZVTB 2XQCA 4LSNB 4ECYA 4L76A 3M8SA 1X4DA 1SH3A 4DSFA 1N6QA 2NR0A 2HS0A 1HI8A 1SBRA 2W7PA 3NBPB 1UZHA 1U1QA 1KVKA 2KM8B 4ZPTR 2BOPA 2OUGA 1AUSL 3ZZOA 3V4IA 5C7PA 3OL6A 4K5SA 4X66J 5DDQC 5HI7A 5BJRA 3EGVA 4RWWA 4I6AA 3SQGB 2YWFA 4NLPA 4DL7A 2FHJA 4ZHRA 2MKKA 2XS5A 5IQQA 3MPYA 3OW2R 4NXMF 2ZBIA 2IM0A 2VQFJ 1MWZA 1S1WB 2H9ZA 3S7RA 3CC7S 2J0QD 3FCVA 4ZPBA 3VZHA 3HKZD 4OZNA 4RW4A 3GV7B 1TU0B 1TMJA 3HJFA 1SJRA 2F5GA 1NK8A 3JSMA 5BYRA 4DR7J 2VFUA 1FJEB 1FNXH 3KJQB 4OIXA 3AJ2A 3UD3P 3BBFA 3QRRA 3E8OA 2K1RB 3CCLS 1UW9A 4RBUA 4ED2A 2J9DE 4Y28C 1RWNB 1LW0B 4RNMA 4DV4F 4IRKA 3A3PB 5LOQA 5JXSA 2E7WA 3GP9A 3TWZA 1VISA 2E1CA 1N32F 3I0RB 3ADAC 4C4WA 2DD8S 3VCDA 3CULA 1Q81T 2ATLA 3NGSA 1VJQA 4P2FA 2PIIA 1ITPA 4ECQA 4YHHF 1NRKA 3DYAA 2ZH3A 2WSFC 3EYZA 2A6OA 3LP1B 4MKYA 1HYSA 5LT5A 5KFRA 3JTOA 2QMXA 4FP9A 4D3HA 3W64A 5A8WB 1JLAB 1V3ZA 5IV3A 1FRJA 2J0SD 2H5JB 5B0CA 4B3RF 5J1EB 3KLIB 2GIRA 4X4UA 1H38A 1MU2A 1KEKA 4EUVA 3UI3A 1J5EJ 1HNWJ 4Z7YA 1TKZB 1OQ6A 1TR0A 2PEBA 3EE3A 1P9YA 3LALA 4I7FB 1NK9A 1RAIB 3BO2A 4O23A 4K4UA 3PO5A 3MMBA 2W9AA 1VQNS 1FRHA 1NEEA 2EW9A 5E3RA 2C2NA 4A46A 4CLUA 3PM9A 3CO0P 2G13A 1T94A 1JKHB 4PEOA 2QN6B 3DI6A 4NLYA 4EZ9A 4AQYJ 1X4CA 4M5IA 3I4HX 1L3VA 4OYBA 1CULA 1PIEA 3DKDA 2F8HA 1W7WA 3OQ2A 5G0RA 5EGYA 2ZKUA 3V4MA 1YJNS 3DLLQ 1QJHA 1YGYA 1AFJA 1HI1A 4CNZA 3KK3A 3D54A 2BQUA 1NHKL 3UNYA 1H2TZ 3M1VB 1P6TA 2VFRA 3WIVA 3CJ2A 2Y1JA 1VOMA 2R2UA 2WSCC 2M8DB 1VQOS 1U1NA 2AYGA 5HANA 2LECA 5AE1A 1ZPVA 2CJKA 1D8YA 5L46A 1HARA 4DL6A 4DL0C 1T05B 2P8IA 2B6AA 4Y65A 2FUG9 2XTJP 2E5LJ 4U8YA 3O1LA 2C3YA 4RJVA 4KV8A 2PSZA 1VHFA 1VLOA 2I8EA 2YQ0A 4DQRA 1HWLA 3F56A 1F2HA 5DO2A 4A8SA 4OYAA 5HAOA 4DPOA 1IQZA 2AJ2A 3AXKA 2HVEA 4LR8A 3ULHA 1DY3A 3IWNC 3V2UC 3DLKB 3MDFA 3Q8UA 2ZITA 2Z4PA 4WIQA 4F36A 2B56A 4OZ2A 2H65B 4LR7A 3RB4A 5KFCA 1T8EA 3MR3A 3DLHA 1YLXA 1RAJA 2QL9B 3G9CA 1UKUA 1FDNA 4WE1A 1WHYA 1HMVA 4KGMA 1U24A 3R6GB 3B4MA 2V4RA 1UVJA 4TQRA 1FD2A 4ZVGA 4WXOA 1VQ5S 2XSJB 1XN9A 4CO2A 2W7OA 1B0PA 5IWAJ 1FEEA 3POTA 2GA7A 2DGTA 5ETVA 4J9QA 1TL1B 2R7RA 3PX0A 3HHNB 1UFKA 3W1YC 1FERA 2CFXA 1VJWA 4I4BA 3M8QB 2B43A 2HZAA 7FDRA 4DR6J 2W2OP 2UUCF 4NPOA 2ROPA 2D9OA 3C6UA 4A8KA 2WW8A 5D8HB 4ZS6A 2YPZA 2IVFB 3BDEA 4C6AA 4KAIA 3I9ZA 5KT2A 4WFNQ 2GVDA 4F3MA 1WHVA 2JEIA 1NZ8A 1PBUA 3CT9A 3QGGA 2LVWA 4PPDA 3QAEA 4IR9A 2D9PA 3T1AA 2DNOA 4ED6A 3N28A 2BKOA 1X5SA 1E6VB 2V94A 2EK1A 3R6LB 4ANEA 1NH8A 2C2RA 4KJIA 3QZ8A 2MSTA 1IKXB 2EBEA 2GVZA 2RAQA 4X4RA 1U6ZA 2CJ9A 2XZTB 4KTQA 3GWCA 5KFHA 1JLEB 4XIUA 4KFBA 4HHHA 1YQHA 3G6VA 4C48A 2FDNA 1M1HA 2KM8C 3IAM9 1C4AA 3OXFA 2BRKA 3M8PA 1KTVA 1ZA2B 3KKFA 5IQ6A 3V6DB 3RG6A 2L08A 3N5FA 3TAMA 4DFJA 3ZC4A 4W90B 3M6VA 3MM7B 4OJHA 2WVBA 2B51A 3D67A 2XG8A 3PG9A 4LF9F 1QY7A 1O5JA 1ELOA 1S9FA 4I2QB 2QA4S 3THPA 3FBFA 1X8DA 4OJ3A 1MG7A 1JJ4A 5HATA 4ZVEA 4DV5J 4PG8A 2F4FA 2W9BB 2W1BA 1FX4A 5IM0B 3KLFA 1S1XB 4K7QA 3CO9A 4OYZA 2ASLA 2RHSB 3NCPA 3DHXA 3BV8A 2H54B 3T6BA 2X3GA 5BR8F 3FCHA 3ICLA 1CJVA 4ES2A 2OFHX 4YMEA 1SC6A 2C2MB 2R8IA 4C2MA 2E7XA 1XBWA 2ZOFA 2MQLA 5CZVA 2ZHBA 3M8RA 1S1VB 5LXRA 3OHBA 5CCMA 3TX8A 4IRCA 4USWA 3TX0A 2OD4A 4OJ1A 1UL3A 4JV2A 2DHGA 1OY9A 2HNDB 1HA1A 4KSEB 2IYGA 4HEA9 2EG2A 1FFWB 4J91A 4DZ6A 1KSPA 4PUOB 2NLWA 2BYCA 3GFYA 4O0IA 1PC4A 5KFOA 2ZBPA 4C11A 3SQGA 2HFNA 2VKZG 4MTPA 1R0AB 4OZ3A 1H2VZ 4DF4A 1TUWA 4TLQA 4OYPA 2B4VA 2HHWA 2OEMA 4HI1A 2FTRA 3TANA 4F2SA 1FX2A 4J9PA 1OWXA 5F8LA 4RBVA 1FRLA 2AX0A 4DV0J 2HNYA 2VD3A 5IXUA 2V67A 2J0WA 2NYHA 2BM0A 3W5XA 1GTEA 3MD1A 2AZ3A 3CJ5A 4HT7A 2Y9HA 2D3UA 1S6QB 3ENQA 1NJYA 1J5OB 5J2MB 1K8AT 5A0YA 4NRTA 3CJ3A 1HHSA 1RLDA 1MLAA 1VBZA 1VQ9S 3MPVA 1CQMA 3UE2A 1E6YA 2X1GA 1LW0A 2VPYB 2XZDB 3R5AA 4KHPJ 1JNRB 1U8WA 3CCVS 3GIIA 4J9KA 1LEOA 3MGJA 5D0HA 2IC3B 3PZPA 1F5AA 3R27A 5C24A 3ITHA 1NK5A 1IBKJ 2CPEA 1M5SA 3KNAA 2XMWA 1MW7A 1U6FA 1BGXT 3DMJB 4WP3A 5CAAA 3UDCA 4DV1J 4GKKF 4U96A 4OV6A 2LCWA 2YKNA 3AJ1A 2VOPA 2YPYA 3RBDA 4IO9Q 5FLXU 3QWPA 3UCUP 1NMEB 4DU7A 3IN5A 1KS2A 4LSLB 2GJ2A 2NPIA 4I68A 3FVYA 1SC3B 5D3GB 2GS8A 5A8WA 1JLAA 1EKSA 2LYVA 5B0BA 1M5OC 3CC4S 4EGLA 2V4JB 4DR1F 2DTJA 2NS1B 3DLBA 2QA4G 4FYYB 2N7YA 4BBYA 3JYTB 4IQXA 5IC4B 4CIOA 2K7JA 1TKZA 1S1UB 1Y3JA 2AYEA 2XSFA 4CT9A 2KU7A 2Y1IA 4I7FA 4MFBA 3OVAA 4RUCA 2RRAA 4OLOA 2ZE2B 4FXDA 3DDKA 2GAGC 3FK4A 3VF0B 1KVIA 1QSSA 4UTGA 2I2YA 3EUNA 2AGOA 2ZOMA 3QNWB 2VV5A 1Y10A 2DNPA 3LANA 2DNRA 3QWUA 1Z2LA 1W2IA 3M8WA 4ZVOB 3HDSA 4RNNA 1X9WA 1RHUB 4B9SA 4LF8J 4K4TA 2ZEJA 4TN2A 5DS7A 2MSSA 4E2FB 1VCTA 5F9NA 2DB1A 5KFPA 4P74A 4Y2AA 1VMBA 2A3JA 1WUUA 1T3OA 3V5RA 2CJAA 1RWPB 1GMVA 1KVJA 3M30B 1LK7A 4CZCA 2XS2A 2MDAA 1PBAA 1LWCB 1JMTA 3DGPB 2YX4A 2MQMA 3T5HA 3QO9B 4ZDNA 1R0CB 2K06A 5LMUF 1JXVA 3PYGA 3CCES 3CD6S 1CQNA 1WG1A 2BZ2A 1SL2A 2OP5A 1V6HA 4U95A 3FUYA 3HT3A 3L7UA 1T05A 4E0DA 2IJRA 4F26A 1WG4A 1WEZA 2DNNA 3BDPA 1TK0A 2ZDPA 1YI2S 4KT0C 2K3KA 3DXBA 2EFOA 1Z1ZA 3Q8PB 2CPFA 4MIAA 2UU9F 2VG5B 4BC9A 3T19A 2L48A 3NGUA 3T1YF 5LXYA 2DNHA 5AJ3J 5LSOA 1FRMA 1OPIA 3FSIA 3W9HA 3MEKA 2BW7A 1GMUA 5DQIA 3CCSS 1REGX 1P9QC 4R0JA 1CJTA 2CQHA 1AW0A 1N33F 4DMZA 1DTQB 3O3LA 2BE2B 2RSQA 3GJRB 1OJ4A 1TAUA 4KO0B 5ETSA 3W63A 2CKWA 4UY8T 1KD1T 4F50A 4AD6A 5AXLA 3X3UA 4I2PA 3RBZA 4LF4J 3QLHA 2DH9A 2P6SA 2DGSA 2MQPA 4A48A 4RW9B 4WK3A 3H2UB 4MKVA 4C0OC 4LF7F 1S99A 3GCXP 3QBCA 3PRDA 4TY8B 4PQUB 2HW3A 1TL1A 2PO4A 5LMNJ 2KJWA 3FFIB 3W62A 3M8QA 1WDDA 1DLOB 3W9JA 2RHQB 2EBGA 4USHA 1SH2A 2WAQD 4ZPCA 3PW5A 3OLAA 2FJWA 3CMQA 3DLGB 9ATCB 3QRPA 4F7VA 2XMUA 3KK1B 2OEKA 2XMTA 2Z2LA 4G3IA 3QT5A 4AL6A 1Q53A 1S9EB 4I6YA 2ERRA 3VQTA 5B09A 3D1HA 5IFMA 4H4KC 4NMLA 4CI0B 2UV8A 1X4FA 1E6VA 2R7SA 3N6LA 2E1AA 3I32A 3QIDA 3CCUS 2R7UA 4L72B 1M5KC 3C8YA 2VBXA 4ZP9A 1IKXA 1FRXA 5HP1B 3T6JA 4LFAJ 4JI1J 5LL6d 1FO1A 5K8NA 4WFXA 3RR8A 3MEDA 4DSLA 1VK3A 3J81U 3BR8A 1HPZB 1NK0A 1EIYB 4IKAA 1L5UA 1RAGB 1SL0A 1D0EA 1N34F 2HAIA 1B3TA 4MIWA 3D1QA 1FDBA 2M0GB 2P2CB 1G1XA 1N8RT 5HBMA 1P1LA 1NSAA 3FZBA 4ZCKA 1VIXA 3D6MB 2PFDA 1UEVA 4UUXA 2HK2A 2X3DA 1CEZA 2K3IA 2HQIA 2B0GA 2QV6A 2HHVA 2ZDOA 1GEHA 1Y3KA 4DEZA 2WZ1A 4WBFA 9RUBA 4PXEA 5E3QA 1S72S 1RUSA 2H3EB 5IM0A 1BE4A 1S1XA 1TL4A 4WU3A 4DV7J 2NXJA 2CQGA 2JC0A 5KFLA 3DM2A 3VZIA 1C1BB 2PN6A 1U1MA 1LQ9A 2BQ3A 2IA0A 4NXMJ 4WWSA 4H4KA 3N01A 1WACA 2XB2D 3K89A 1WF0A 2V8GA 3D6FB 2HLTA 2XI2A 2D3OR 1X0FA 2D69A 4XTTA 2LQJA 4U7CA 1S1VA 1VQ7S 1F5BA 3RUBL 2GQQA 5F8HA 3PCOB 2A18A 1W25A 1SVDA 2KRRA 3M2VA 4I67A 3NS6A 4BC7A 1Q95G 2IBKA 1D8ZA 2Z57B 4ED1A 2CNKB 1HWIA 5F0WA 4PUOA 1TL7A 1N52B 3HVTB 2XNQA 3T9NA 1PILA 3AJDA 3T3FA 1XTZA 4DV4J 4JI6F 2B9WA 3P96A 4NLRA 1PJ7A 5F3ZA 1R0AA 3HSJA 5RUBA 4J5OA 4OLPA 1D1UA 3BPDA 1XNQF 3ZTQA 3SDEB 1SQGA 4B02A 4N41A 2AHOB 2SXLA 3EXYA 4MK9A 4ZPVR 3MUVP 3K5OA 1GXTA 3E01B 4F67A 3OTBA 4DR2F 3W2VB 1I1GA 2XLIA 3HSGA 1ZTWA 3BO4A 4JP8A 5J2NB 4LF1A 1M5HA 1RWKB 3FGVA 4WZMA 4OYIA 2Y3YA 2Z0GA 1PCAA 3MTJA 2YNGB 4QW8A 3ZZ0A 1RT6B 4K4SA 1I3OB 4O3SA 1DURA 4B3RJ 4J9VA 5T14A 1JLFA 3EJMA 3DN9A 5KAKA 2L41A 1VGYA 5AE3A 2MJUA 1WTBA 4ETZA 2H4YB 4WTYA 3L3CA 1Z2ZA 4OV1A 2VHGA 2M5YA 2LQ8A 2J5AA 3NNHA 3DMJA 5J2PA 3J7A1 2CVIA 1LWFA 4ZVQB 5B0AA 3DDNA 1BWEA 1Q5VA 2W8KA 2YKAA 4CT8A 3H2VE 4NEZA 1D9DA 3OTDA 1NM2A 1X5TA 4LF2A 4Q5VA 4N5SA 3AXMA 2DO0A 2HZCA 1FK9B 2QTWA 3CJ8A 5E2QA 1KLMB 2Z8QA 1PYTA 4CLPA 2JVOA 3GLJA 2GHPA 4WFZA 4OQJA 2V4JA 3ISZA 4LRAA 1WKLA 1R89A 2BXJA 3HO1A 1S49A 5CA5A 1F9EB 4LIWA 2PEHA 3JYTA 1U1LA 2ZD1A 3B54A 2LDYA 3ENWA 3N5BA 1G7CB 3KLGB 3RRKA 1SV5B 5CH7B 1T0TV 4DSEA 4UT4A 1LK5A 3SBMA 4FYVB 1AA1B 3UR3C 4LFCF 5A8KB 2LQ5A 1WKJA 1EETB 2P9EA 4QJVA 1S77D 3WBZA 2G1DA 4IG0B 4RUAA 2N4CA 1VHIA 4DU8A 4B9LA 4M63A 4Z7CA 1WG5A 2JEGA 4B3SJ 1JX4A 2G0IA 3CXCR 3KWMA 4P9SA 1VBYA 1S97A 4Y2MA 5KT6A 2VBYA 4BWJA 3SZ2A 1ZAWA 3C16A 1TVRA 3CTRA 4EBCA 2IM2A 1OS5A 2ZNZA 2J9DA 1KHWA 4IFYB 2FC9A 3VALA 4YEAA 2F9JA 4C0BA 4F02A 2EKYA 3PX6A 4ED0A 2V6AA 3I56S 4UOHA 2CQPA 4JI0F 5DETA 3KLHB 2OH2A 1LWCA 3M2UB 2YWEA 3OPKA 5I4MA 2C2ZB 3ENAA 4PABA 1KOHA 5HMYA 4DQIA 4UW2A 3LF0A 2KFYA 3BGFA 5IOLA 2FJDB 4UOFA 3GONA 3FZ2A 2NPFA 4F3OA 3H0PA 1L3TA 2BX6A 1UTAA 3D4JA 4PYAA 3QJLA 3SSSA 3CJKB 2KVIA 3MFHA 5A8RB 3CMAS 4OI2A 1TL3B 5IS2A 5DLFA 1WDTA 1HKAA 3Q86A 1UPMB 4ETXA 3TO8A 3EPIA 3BKTA 5HJXA 3PW2A 3W3SA 4N77A 1T95A 1YZ7A 2ZH8A 4CLZA 2XY5A 1U2RA 4DL5A 4RWXA 4WYWA 4RO0A 4NA1A 3JS9A 2Z30B 1T9YA 4USKA 2GQ2A 2AQ4A 2OSQA 2MQNA 1S7IA 2FGCA 4K4YA 2F4VF 5I42A 2R8GA 4FZVA 2P5VA 4ED8A 4QWEA 1Q8IA 3SCIE 4KO0A 3ILOA 4M5GA 3GIKA 2BJ1A 4O3PA 2VG7A 4MMOA 3UQSA 4CYUA 1S9GB 3JSRA 2W4CA 4PG4A 1UFLA 2WK4A 5ETMA 2RIJA 3MAQA 4RW9A 2M8HA 3DRSB 4B3MJ 1PAUB 3VGSA 4TY8A 1MMDA 4PQUA 4F4XA 2HHXA 2GIFA 1FXRA 1TFYA 4B3TF 4WCEQ 4CQ1A 4P2MA 2DY9A 2IA6A 3RYLA 3VWSA 2DEIA 2ZH1A 3DLGA 5U47A 3M6XA 1FI4A 1U49A 3KK1A 3PJXA 4ECRA 4G1PA 1T02A 3W60A 1S9EA 5T7LB 2L3MA 5HLFB 4X84A 1V5IB 2PFFB 4C8ZA 3F73A 2C3UA 2KYZA 5KFSA 1EARA 2VG6A 2OPPB 4P52A 1LWXA 4QCLA 1VBXA 1S4EA 4RNFA 5CABA 2ILYA 4PZVA 2R4FA 3P49B 3MM6B 3P45B 2NYIA 3DHWC 4I64A 3Q8SB 3O44A 3C19A 3CDWA 4MAKA 4K0KF 3SYZA 4KH1B 4NLDA 5BR8J 3KXDA 5KFTA 1DAXA 2VPWB 4DCJB 2VDIA 3TUJC 1YBAA 1RAHB 1HPZA 1VR6A 2QLXA 2MEWA 3SEOA 1BUXA 2MB0B 5CCLA 4ZIVA 3WDOA 1CSJA 5F8NA 2B3TB 3NGDA 3OSPA 3P5BP 1VI7A 5CYMA 1JNZB 2HQGA 2Q43A 1GMWD 2ZH7A 2R2TA 1H3DA 3EPGA 3GJQB 3ENVA 4DX6A 4TU8A 3NWRA 3MHYA 2WVEA 3IBFB 2XYHB 2X1FA 1ZZFA 2ATCB 1L3SA 4O44B 2RKIA 3FBCA 2O66A 3N6MA 3EM1A 2B5JA 1QDUB 3FDSA 3R7NB 5KG7A 2DVIA 3LPYA 2FLNA 3FRZA 2MYFA 4NCBA 3EVOA 3G8TA 1IM6A 1HBOB 2NZ4A 3WQPA 2H5EA 4LIRA 1BWVA 4FPRA 5L1JA 2CQ3A 3IRXB 4JOUA 1UPPA 2OPQB 2KO1A 3UDVA 2GV1A 2HQCA 2QFIA 4ZVPB 1U0SA 3WHIA 1P27B 4BDPA 5DM6Q 2QFJA 1URRA 1GXLA 4HDGA 4TYBA 2F8MA 4QPTA 2DRDA 1RWWB 3W5YA 2QLWA 3KMSA 2ZBQA 2GHVC 2YY3A 3V81B 1QSLA 4NL5A 2FVRA 1NJXA 4NXNF 4CM0A 4IUFA 5L9NA 3J80Y 1R8AA 5MAOA 2IPOB 4OI1A 1RHMB 3SDEA 4L3NA 4ID5B 2P9GA 2IIHA
chains in the Genus database with same CATH topology
4UOHA 1HLWA 1XQIA 4ANDA 3Q83A 3VGVA 5CABA 3L7UA 1HIYA 3DDIA 1NCLA 3FBFA 3B54A 4C6AA 3Q8YA 3FCWA 3DKDA 1KDNA 3ENAA 1W7WA 3EJMA 3Q8VA 1MN9A 1XIQA 1NDPA 1MN7A 1NDLA 3ELHA 5CAAA 3VVTA 3EVOA 3FBBA 1HHQA 2CWKA 5IOLA 2HVEA 1VYAA 4UOFA 1NDKA 4W98A 2B8QA 3BBFA 3BBCA 1UCNA 3FC9A 2ZUAA 1ZS6A 3B6BA 3FBEA 1WKJA 3ZTOA 3Q8UA 4ANEA 2BX6A 3NGUA 1BUXA 3ETMA 4F36A 1NDCA 4FKYA 1F6TA 3VGSA 1NHKL 3G2XA 4DUTA 3ZTSA 1NPKA 3BH7B 1S59A 3EVWA 4CP5A 3EE3A 1S57A 2DXDA 4WBFA 2HURA 4ANCA 2HVDA 2DXEA 3GPAA 4EK2A 1K44A 1BE4A 3Q86A 3BBBA 1NSQA 1WKKA 1F3FA 2AZ3A 2AZ1A 3VGTA 3PRVA 1PAEX 1S5ZA 3GP9A 3PJ9A 3ZTQA 3R9LA 2BEFA 2DY9A 1NB2A 3ZTPA 4DI6A 4O0NA 5C7PA 1EHWA 2B8PA 4UOGA 3EVMA 3MPDA 4F4AA 5BXIA 3NGTA 1PKUA 3Q89A 3NGSA 1NUEA 2DYAA 3JS9A 3EMTA 3NGRA 4KPCA 1B99A 3WX8A 3VGUA 4ENOA 1BHNA 2VU5A 2DXFA 4S0MA 1U8WA 3ZTRA 4HR2A 3FKBA 1NLKL 1B4SA 3EICA 1JXVA 1LEOA 1NSPA 4FKXA 3FBCA 3VVUA 1WKLA 1NSKL 3EM1A 1LWXA 2NCKL 4DZ6A 3FCVA 3BH6B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UOH A;  1HLW A;  1XQI A;  4AND A;  3Q83 A;  3VGV A;  5CAB A;  3L7U A;  1HIY A;  3DDI A;  1NCL A;  3FBF A;  3B54 A;  4C6A A;  3Q8Y A;  3FCW A;  3DKD A;  1KDN A;  3ENA A;  1W7W A;  3EJM A;  3Q8V A;  1MN9 A;  1XIQ A;  1NDP A;  1MN7 A;  1NDL A;  3ELH A;  5CAA A;  3VVT A;  3EVO A;  3FBB A;  1HHQ A;  2CWK A;  5IOL A;  2HVE A;  1VYA A;  4UOF A;  1NDK A;  4W98 A;  2B8Q A;  3BBF A;  3BBC A;  1UCN A;  3FC9 A;  2ZUA A;  1ZS6 A;  3B6B A;  3FBE A;  1WKJ A;  3ZTO A;  3Q8U A;  4ANE A;  2BX6 A;  3NGU A;  1BUX A;  3ETM A;  4F36 A;  1NDC A;  4FKY A;  1F6T A;  3VGS A;  1NHK L;  3G2X A;  4DUT A;  3ZTS A;  1NPK A;  3BH7 B;  1S59 A;  3EVW A;  4CP5 A;  3EE3 A;  1S57 A;  2DXD A;  4WBF A;  2HUR A;  4ANC A;  2HVD A;  2DXE A;  3GPA A;  4EK2 A;  1K44 A;  1BE4 A;  3Q86 A;  3BBB A;  1NSQ A;  1WKK A;  1F3F A;  2AZ3 A;  2AZ1 A;  3VGT A;  3PRV A;  1PAE X;  1S5Z A;  3GP9 A;  3PJ9 A;  3ZTQ A;  3R9L A;  2BEF A;  2DY9 A;  1NB2 A;  3ZTP A;  4DI6 A;  4O0N A;  5C7P A;  1EHW A;  2B8P A;  4UOG A;  3EVM A;  3MPD A;  4F4A A;  5BXI A;  3NGT A;  1PKU A;  3Q89 A;  3NGS A;  1NUE A;  2DYA A;  3JS9 A;  3EMT A;  3NGR A;  4KPC A;  1B99 A;  3WX8 A;  3VGU A;  4ENO A;  1BHN A;  2VU5 A;  2DXF A;  4S0M A;  1U8W A;  3ZTR A;  4HR2 A;  3FKB A;  1NLK L;  1B4S A;  3EIC A;  1JXV A;  1LEO A;  1NSP A;  4FKX A;  3FBC A;  3VVU A;  1WKL A;  1NSK L;  3EM1 A;  1LWX A;  2NCK L;  4DZ6 A;  3FCV A;  3BH6 B; 
#chains in the Genus database with same CATH topology
 5IT0 A;  3CSK A;  1T3N A;  3VAF A;  4Q0B B;  3A4T A;  3EDR B;  2GQC A;  4GKK J;  1IJF B;  3MUT P;  1UMJ A;  1NK6 A;  1R43 A;  1XEZ A;  4IYQ A;  4NZ7 A;  4ZVU B;  4ELU A;  2ZC4 A;  2QT7 A;  2FD2 A;  1Q8K A;  1IBC B;  3TZZ A;  4DR1 J;  1OO0 B;  2HFZ A;  3NP5 A;  3SV4 A;  1U7L A;  3BSO A;  4DUY F;  2AZ1 A;  4Q2L A;  3W8G A;  1S5Z A;  3PJ9 A;  2BRL A;  1P1T A;  4FF2 A;  1UVK A;  2Y8W A;  2AMC B;  2ASD A;  4UOG A;  4ZJQ A;  2KG1 A;  4ICL B;  1C2P A;  3MPD A;  4CCH A;  1QE1 B;  1U0H A;  2AKW B;  3HD1 A;  2BR0 A;  1KP6 A;  4DSJ A;  1NND A;  1KNZ A;  2FYX A;  2DEJ A;  1N6Q B;  3RW7 A;  1XWL A;  3DDI A;  3V4I B;  4FNH A;  1FDA A;  3D7S B;  4NLT A;  4L6V 3;  1FK9 A;  5KG6 A;  2MGZ B;  1ZBT A;  1KLM A;  3CME S;  1F1B B;  5CHC B;  2UUA F;  1V3R A;  3HI9 A;  4ZP7 A;  1WJ9 A;  1F60 B;  3C14 A;  4FS2 A;  2ADC A;  4CLL A;  4ZLL A;  1JQG A;  4DF8 A;  1RK8 A;  4F4K A;  4ZVF A;  1NPK A;  3D66 A;  2Z2Z A;  2YWW A;  2PDA A;  2GC8 A;  3KLG A;  1SV5 A;  3S6E A;  3AFG A;  2PMW A;  3PHT A;  2B9X A;  3G6E S;  4Y00 A;  1S0V A;  1ZAV A;  3JSM B;  3P6Y C;  2VQE F;  2RB7 A;  5FII A;  1EET A;  2JVR A;  5F8I A;  1S6O A;  2JFK A;  3TAP A;  3G8S A;  4HH1 A;  1UWB A;  3W7B A;  3VAH A;  5A6W A;  4USM A;  2FB0 A;  5LMU J;  2XNR A;  4KKO A;  2C3P A;  1B99 A;  4URQ U;  1R8H A;  1N48 A;  1WC4 A;  4HAC B;  2XI3 A;  4V1A k;  3Q24 A;  3W5Z A;  2IJF A;  2HHS A;  2W2N P;  4QOT A;  2HWH A;  2F3J A;  3WX4 A;  1K73 T;  2DT9 A;  5HMX A;  2M2B A;  4FBT A;  2LQ9 A;  2UU9 J;  1RTI A;  3ISN D;  3FBB A;  3SV3 A;  2A2C A;  4RX6 A;  3T1Y J;  3MM8 B;  4JI2 F;  2VFS A;  1Q86 T;  3DYA B;  4X4T A;  3KLH A;  2UUT A;  2DH7 A;  2N4D A;  1BQN A;  1DJ0 A;  3MCS A;  3M2U A;  4LFB J;  1N56 A;  1HYS B;  2XLJ A;  3BR9 A;  1RKI A;  3C3L A;  3H7H B;  4AUK A;  1HBN A;  1ZM9 A;  4N76 A;  3JTP A;  3B4D A;  3CJK A;  1HNV A;  4JI3 J;  2EFN A;  1X7V A;  5EWE A;  1MRO A;  1GX6 A;  1TP7 A;  1TL3 A;  2FJB B;  3IR7 B;  3CJ4 A;  4H4M A;  4LBI A;  2GJF A;  2XO7 A;  1HW8 A;  2EFQ A;  4J9O A;  2XS7 A;  3CDB A;  2X1B A;  5KFB A;  4Y2C A;  4Q45 A;  1YBU A;  1HQU B;  1D3W A;  2XHW A;  5GAE I;  2DNK A;  3TQ1 A;  3MMB B;  2ZVI A;  4J7C A;  4Q7A A;  1ARO P;  1XIQ A;  4M5D A;  3CD5 A;  4FYD A;  1HHQ A;  1RWM B;  3FEX B;  2DGU A;  2NZC A;  3CDA A;  3OXG A;  5T41 A;  2FHJ D;  3ZZR A;  2H51 B;  2PGC A;  3K57 A;  2LU2 A;  1R7I A;  3HUL A;  1R8B A;  3AHP A;  4OYX A;  5ETP A;  1S9G A;  4JV5 F;  5D0E A;  4G1Q B;  4DR3 F;  4TKT A;  5G0R B;  2Q6B A;  3UD5 A;  3UCZ P;  4FF1 A;  3KMQ A;  1Q8B A;  3DRS A;  2QSF A;  3RZA A;  1R0B G;  2V0N A;  1RAF B;  2AJF E;  2HHQ A;  2WRM A;  3CD7 A;  3Q89 A;  1S0O A;  3KK3 B;  2WCX A;  4Q8E A;  2GMJ A;  2DIU A;  2XBP A;  1S12 A;  3NOC A;  3I5A A;  4ELT A;  4KB7 A;  4DL4 A;  2FJX A;  2R8K A;  3GYN A;  4LRE A;  4DR4 F;  4HT5 A;  3BGO P;  2J0X A;  4KY3 A;  1KQS R;  2Q3P A;  4DUZ F;  2XUL A;  4X62 F;  4NE9 C;  1M0S A;  2HVZ A;  4TU7 A;  2E5G A;  2GJI A;  2W4P A;  1UJ6 A;  1FE4 A;  3PYD A;  3HZE A;  3I5B A;  2B6A B;  2KXF A;  3P5T L;  5HQ8 A;  2MY7 A;  4CLF A;  3ZNJ 1;  3QIP B;  3LWM A;  2HS4 A;  4DJB A;  4KH0 B;  1I6J A;  2CPI A;  3AOD A;  1H98 A;  2HBQ B;  2KB2 A;  5KFY A;  3LAM A;  3MCN A;  4CP5 A;  2MKS A;  2QA1 A;  2CJQ A;  1K1Q A;  3EZU A;  3DXS X;  2CRL A;  1K9M T;  1BD6 A;  1VQS A;  4KRW A;  3J81 j;  4JI4 F;  2QYG A;  3DLE A;  1H74 A;  3AOC A;  3ILJ A;  3QT6 A;  2Z2Y B;  4CNY A;  1RCX B;  4G6V B;  3JAM Y;  1K0T A;  4ZKA A;  2RIL A;  4WE1 B;  1HMV B;  3T5J A;  2H1Y A;  1X5O A;  3VGV A;  5KG0 A;  5L38 A;  4ZLP A;  2M3D A;  3PDN A;  3Q8Y A;  5CYQ A;  5EX0 A;  4U7U K;  3NNC A;  4FS1 A;  3POT B;  2I6W A;  4DSI A;  1RTJ A;  5G4D A;  2YNI A;  2UXD F;  3ZFV A;  3R7S B;  3H5S A;  2APO A;  3TJ8 A;  3A13 A;  3FQK A;  4X4N A;  4F0H A;  1LNQ A;  3IM9 A;  2QJ3 A;  4BLG A;  1DBD A;  2YTC A;  2UZA A;  4LRD A;  4A8X A;  3FSX A;  5DDP C;  2MHN A;  4DBQ A;  2JFD A;  1XNQ J;  4TYA A;  2JL9 A;  2IFX A;  4ZVH A;  5AXN A;  2GVD B;  1S10 A;  4P75 A;  1JJC B;  1A0O B;  1HBO A;  3TVY A;  3PRV A;  2UXB F;  1YIJ S;  4K2X A;  5DG7 A;  3IRX A;  3WC0 A;  5KFN A;  1LXN A;  4DR2 J;  5J2Q B;  1KN6 A;  3H98 A;  3KNG A;  3BO3 A;  2IDL A;  2C2E A;  4WU2 A;  4O4G B;  2CJX B;  4YR0 A;  1ZA1 B;  2E44 A;  1NPP A;  4CO5 A;  3NS5 A;  1MMN A;  1RU2 A;  2QE5 A;  3NXZ A;  4LMZ A;  3ZZP A;  5ETN A;  2AEF A;  3DRY A;  3R5G A;  3QSI A;  1R8P A;  4KFB B;  4QWD A;  3Q0A A;  4X66 F;  1FJ7 A;  2G2O A;  1UW4 A;  3V81 A;  4DR5 J;  3OFG A;  4D3G A;  4C97 A;  1MN9 A;  2E5J A;  3KJV A;  3SSQ A;  1Q82 T;  2DIV A;  3TI0 A;  1VFJ A;  3TAM B;  2VAS A;  4XDD A;  4I0W A;  1UVN A;  4QYZ K;  4ID5 A;  4OZ0 A;  3IBC B;  3IWL A;  3ONQ A;  2D3O 1;  2E9T A;  4GKJ J;  3ZZY A;  2FY1 A;  2QSW A;  5C2C A;  3LW5 C;  1JIH A;  1NH7 A;  2J7K A;  3L09 A;  4B9M A;  1NAQ A;  3QSY B;  1GK8 A;  2ILZ A;  2IHR 1;  3M9O B;  4QQB A;  3RB6 A;  4DR7 F;  1RIS A;  1SL1 A;  1Y00 A;  2X7I A;  1FKP A;  3JSY A;  1FES A;  2VF3 A;  4JV1 A;  4C9D A;  2R3V A;  3D0I E;  5HL7 Q;  1FFG B;  3C6T A;  3OTE A;  4H4O B;  4QWC A;  2CAD A;  1ZAX A;  5KFU A;  3D0H E;  1QE1 A;  1SKS A;  4YR3 A;  3AOB A;  2MZT A;  4CLT A;  3PV8 A;  3OL7 A;  2IM1 A;  3AY0 A;  5KFE A;  1L3U A;  3OV7 A;  4KE5 A;  1M5P C;  2CPH A;  2NSC A;  4NA3 A;  2GML A;  1WEL A;  3CED A;  2LMI A;  3BS9 A;  1QAY A;  2HHT A;  2DY1 A;  1SCJ B;  3DRX A;  4C98 A;  4M8L A;  4YB5 A;  5J1P A;  2DNL A;  4X4O A;  1K47 A;  1S48 A;  2MGZ A;  2HMI B;  4NCA A;  4C11 B;  2GCF A;  1HI0 P;  3BBB A;  1H7X A;  4R8U B;  1ZOT A;  4NLO A;  3QRQ A;  1F9F A;  2B9E A;  1RSC A;  4E98 A;  1RHR B;  5KFI A;  3AA9 A;  1PYO B;  2C3M A;  2BAB A;  1J5E F;  2ZJR Q;  1NZA A;  4OX6 A;  2NUH A;  5C25 A;  2HNY B;  2KL8 A;  3BKF A;  5J1N A;  3KLE A;  1T7P A;  4DQQ A;  2Y8Y A;  3PO4 A;  1IM4 A;  2F8E X;  4EYI B;  2HBZ B;  4R0E A;  2MKH A;  5A6P A;  3VHQ A;  1QUV A;  3QMQ A;  2KTQ A;  5A0Y B;  1LV5 A;  4QYR A;  4ITS A;  1N0V C;  4HAC A;  3GTY X;  2HFU A;  5E3P A;  1YX2 A;  1E6Y B;  2LDI A;  4TQS A;  1PYS B;  1VYA A;  3SIP B;  4OHV A;  1N88 A;  4MT1 A;  3MM9 A;  4AQY F;  2XYG B;  5C24 B;  1RE1 B;  4P7V A;  3ITH B;  5AXK A;  2OJ3 A;  1YWX A;  3LO3 A;  2HGM A;  3MM8 A;  3MUM P;  1JWW A;  4ZCL A;  1NK4 A;  3U1M A;  3FQL A;  2YKN B;  1TFW A;  3LGN A;  1G3O A;  3B82 A;  2KDO A;  1IBL F;  2HRU A;  2F4V J;  2ZVS A;  2ZKT A;  3R1L A;  4AFF A;  1S79 A;  3PIP Q;  3Q2S C;  1RA7 A;  1IN0 A;  4HH0 A;  4DG1 A;  1XMQ J;  3TA0 A;  4NYO A;  3PAC A;  4A4J A;  3C15 B;  3V6K A;  5M2P A;  1KLN A;  3GZ7 A;  5KG5 A;  2MZS A;  4QIG A;  1HWK A;  2QGF B;  2W9C A;  3M05 A;  3MTK A;  2E5L F;  1IR2 A;  4MFB B;  1UA1 A;  5E5N A;  4IRD A;  5D0R A;  3GG1 A;  5DGB A;  1HQU A;  4QWA A;  4OYO A;  4C8Y A;  3P8B B;  3GQC A;  4B3T J;  3OVB A;  4F3Q A;  4CO3 A;  1NO8 A;  3TYT A;  3LGH A;  2KRB A;  2HQF A;  3H5U A;  1VQ8 S;  2PA3 A;  2XO6 A;  3THV A;  3R97 A;  5GAG I;  4XPC A;  3H40 A;  2CWX A;  3HM9 A;  2OTL S;  3NNA A;  3HSZ A;  5CD4 H;  1NUE A;  4O4R A;  4C8N A;  4CO1 A;  4V19 J;  2NXE A;  2A6M A;  3BRE A;  3OVS A;  4G1Q A;  4WPA A;  3K7R A;  1KWM A;  2E29 A;  4OX9 F;  4LSZ B;  2RDJ A;  2CQ4 A;  1SIW B;  2DHH A;  4PG7 A;  2DGQ A;  1SJ4 P;  2OML A;  3RR7 A;  2A0F B;  3HFK A;  2OPR B;  5IWA F;  3RBX A;  4NEY A;  1WC1 A;  5F0U A;  2R2R A;  3NOG A;  2KT5 A;  3NCR A;  1W2B R;  2OHD A;  3M32 A;  2M88 A;  4QYZ J;  1R27 B;  4ED5 A;  3EGZ A;  1GTH A;  3M6U A;  3N0V A;  5EN1 A;  4QR1 A;  1TUV A;  3BGR A;  2Q66 A;  3MAH A;  4JI5 J;  1S1T A;  2VC1 A;  4G1I A;  4OHZ A;  1CLF A;  4WP8 A;  3A12 A;  4UF4 A;  1SC1 B;  4ECS A;  1NSQ A;  4WKR A;  4NAS A;  5ETK A;  2CNO B;  3QIP A;  4P73 A;  1G4C A;  1T9U A;  3D1O A;  4OI0 A;  1UP1 A;  3D9B A;  1CC8 A;  5EWF A;  4NI2 A;  3OSN A;  4P71 A;  4NX9 A;  1ZH5 A;  2HWT A;  4C8O A;  4UZC A;  2BDP A;  2AV5 A;  2HVH A;  2HZV A;  3KDN A;  2CPX A;  4ID8 A;  3TZY A;  3O2I A;  2G2Z A;  1JLB A;  4DCO B;  4TLR A;  3R1H A;  1H72 C;  5HO4 A;  5I3U A;  3I55 S;  4YQW A;  1CJT B;  2QLJ B;  5KFV A;  1NHU A;  5EDW A;  2CAJ A;  2HYI B;  1JJ2 R;  2MLX A;  1VQY A;  4FNI A;  2KHD A;  2AD9 A;  1HQ2 A;  2B4O A;  4IDK A;  4RW8 B;  4NLX A;  3U7J A;  5C5J A;  4I2P B;  1A9N B;  1TK8 A;  3QLH B;  1RHQ B;  4QPX A;  2HNZ A;  2CQD A;  2KFZ A;  2MJN A;  2DIS A;  1AXQ A;  3GSI A;  5CZX A;  4WFY A;  3E51 A;  4DV5 F;  3KHR A;  3SCJ E;  2E1R A;  4RNH A;  2RUG A;  3GJS B;  2IM3 A;  2Y1R I;  1SC4 B;  2CNL B;  2FVS A;  3H2L A;  1SXL A;  1FKA F;  3WZ0 A;  2XWX A;  3A1Y G;  4C3K A;  3M9M B;  2D1C A;  2DHS A;  2O1P A;  5J2Q A;  5HRO B;  3KJF B;  3ILL A;  5EWG A;  2JZ5 A;  4O4G A;  3SFG A;  3I82 A;  2HPU A;  3G71 S;  3D5M A;  2IBO A;  2F40 A;  1EP4 B;  1Y11 A;  2E5I A;  5HMZ A;  2XMV A;  2IAJ B;  3MED B;  1GNK A;  1YBT A;  5DQH A;  4ECT A;  2B4U A;  3U02 A;  4RR5 A;  4OYM A;  1U6B A;  4YR2 A;  2F63 A;  2KH9 A;  4HDH A;  2KN4 A;  4DHV A;  1WOR A;  2JLG A;  5HN0 A;  1MWQ A;  4PYD A;  2ZNY A;  3W9I A;  1JLQ A;  4GMK A;  2JH3 A;  5HBM B;  1YZ6 A;  1YSJ A;  5KT5 A;  4RU9 A;  1NJI T;  2KHC A;  4NLU A;  2H48 B;  4NCG B;  2CIM A;  4K4V A;  4PKD B;  4WKY A;  5DZ7 A;  2WBR A;  3QAT A;  1M1K T;  3SCK E;  3MFI A;  1LOU A;  1UVL A;  3TA2 A;  4X2B A;  3GIJ A;  3L9Z A;  1WC0 A;  3NCQ A;  2CZ9 A;  1LW2 A;  1D09 B;  4O3O A;  2XWY A;  4PAA A;  2UUA J;  3DM2 B;  2UV8 G;  2KZM A;  4L3K A;  4ZN1 A;  2HHH F;  1T9T A;  3NWG A;  4GC7 A;  4DPU A;  1U1P A;  2QL7 B;  1JLC A;  3KTQ A;  3CVK A;  3GCW P;  3CCR S;  2W8L A;  2VC0 A;  4H4O A;  4LQ9 A;  2NSB A;  2PI5 A;  3VAG A;  3HK2 A;  1RCO B;  3JQM A;  4AE5 A;  2YX7 A;  3RGI A;  2Q6C A;  3IS9 A;  2ZH2 A;  1QVF R;  3M2V B;  3DRR B;  4IG3 B;  2RH3 A;  4FBU A;  4JBC A;  3I87 A;  2V8D A;  1SI9 A;  2CXE A;  4K8R A;  1N5Y A;  3CF5 Q;  1Q79 A;  6AT1 B;  3GV8 B;  4X4V A;  3E3X A;  1TL7 B;  2L9D A;  2HMI A;  1SJ3 P;  1HNZ F;  4DZD A;  3K5L A;  5GAG U;  4R8U A;  2ZHO A;  1VQL S;  5AE2 A;  2VOD A;  4USJ C;  2RJZ A;  2LLZ A;  3HHL B;  3TVZ A;  2FHK A;  2V4Q A;  5K14 B;  3AB2 B;  4KBI A;  1EX8 A;  3PEH A;  5IC6 B;  3DC2 A;  1OPZ A;  1QUP A;  2HQD A;  3K8V A;  3MMC B;  3KOA A;  2ZZN A;  4ECW A;  1WC3 A;  1GAO A;  1T03 B;  4YY3 F;  3L95 X;  1TV6 B;  4JI2 J;  2W24 A;  2PMH A;  4USV A;  2O01 C;  2EC2 A;  3EXC X;  1HR0 J;  1OIA A;  2FJV A;  3KLV A;  1OY8 A;  3N6N A;  3OL9 A;  4CLK A;  4DFM A;  1ZM2 A;  2ACY A;  2W01 A;  4PWU A;  3F44 A;  1XMO F;  4GVB B;  3J7Y I;  4LBP A;  3LAK A;  2P6T A;  2DJW A;  2BQR A;  2KT2 A;  3JTN A;  2AJ0 A;  3I31 A;  1JLF B;  3H42 A;  2HHU A;  2BEF A;  2CVE A;  4F25 A;  2XYP B;  2UXC F;  1QM9 A;  4LRF A;  4CM2 A;  2HS3 A;  3TUZ C;  3RB3 A;  4LF8 F;  1VRU B;  3WIU A;  3NGR A;  3DOM A;  4EFA C;  2YVS A;  5HSP A;  2I9S A;  5KFG A;  3FEZ A;  5J2P B;  3MMA A;  1NLK L;  2X51 A;  1LWF B;  2VIH A;  1IVZ A;  2HBR B;  1JLG B;  5JJB A;  5ITH A;  2YKM A;  3HHE A;  2CDR B;  3BM7 A;  2KYX A;  3IXQ A;  1A7G E;  2IRX A;  3BSA A;  1XNR F;  3R5D A;  2MKY A;  3BSN A;  2GW8 A;  5IT4 A;  1RP5 A;  1UFW A;  4G65 A;  3BN7 A;  3CCW A;  4QIF A;  2LEP A;  5F8G A;  3QJJ A;  1I94 F;  3US5 A;  3C15 A;  4Y34 A;  1F6T A;  3DCA A;  4JV5 J;  3O6Q A;  4DPT A;  3IBW A;  4DR3 J;  2LXI A;  2WVC A;  3IM8 A;  4DLE A;  2V9W A;  2ZD1 B;  2IRU A;  1HWU A;  1DHM A;  1ROF A;  1VQM S;  4Q2M A;  3D28 A;  3I96 A;  3NY0 A;  1PAE X;  2VBZ A;  1JXE A;  1WEY A;  3UN3 A;  2OFG X;  3TJ9 A;  2F9D A;  4C8L A;  4KC5 A;  3LH2 S;  2I38 A;  1HD0 A;  2QX0 A;  3SI8 A;  3JSB A;  1UA0 A;  1YK9 A;  2EG1 A;  1IJE B;  1F2G A;  1TTH B;  1FWP A;  5KTQ A;  1O0P A;  5SZT A;  3H5Y A;  2YWH A;  4DR4 J;  4S0M A;  1NJZ A;  3PEJ A;  4NYZ A;  3T1H J;  3EIC A;  1NSK L;  4BS2 A;  1OQ3 A;  4EO6 A;  2HEK A;  1XQI A;  5L1L A;  1HIY A;  1PC5 A;  1U26 A;  3KUG A;  3G8Q A;  1O6X A;  2WHO A;  2OTJ S;  2YNH A;  1TEL A;  3G6Y A;  3ZNU A;  3C16 B;  1NDL A;  1TVR B;  4F0M A;  3V6H A;  1YJW S;  1IUJ A;  4X65 F;  5IT9 Y;  3PIO Q;  3HSD A;  1WOS A;  1Q0N A;  2C28 A;  2R8H A;  3H5X A;  3AAW B;  1CG2 A;  1HL6 A;  4LF6 F;  4ECX A;  5M2R A;  2OPR A;  1U45 A;  4M1K A;  1KC8 T;  1FFS B;  1XR5 A;  1FKO B;  3R7B B;  5LMN F;  2G1H A;  4F04 B;  1FE0 A;  4QIE A;  5CYJ A;  3MD3 A;  4P72 A;  3R9L A;  4YB1 P;  5D4O A;  4JI4 J;  1WC5 A;  1KKH A;  4EU0 A;  1EJ7 L;  1W26 A;  2WVF A;  4CWB A;  2UVR A;  5D6G A;  3OUY B;  4Q8F A;  4OX7 A;  5GVQ A;  4B3O B;  4ZVR B;  3UNG C;  2VBW A;  1LWE A;  1U1K A;  1BQX A;  7FD1 A;  4RW6 A;  1FWK A;  3OTO J;  4YDX A;  4LUB A;  2BKP A;  3DU5 A;  1YDL A;  2NRE A;  3G82 B;  1C0U B;  1S6U A;  1RT3 B;  3MUR P;  3FCW A;  3RJM B;  2JHE A;  2VKR A;  1BQM A;  1ZYQ A;  2YH1 A;  5H9F J;  1T9V A;  4O3R A;  2BAN A;  4CH7 A;  4I56 A;  5I42 B;  1YRX A;  1HBM A;  4Y2I A;  1FWL A;  4DS5 A;  3TOQ A;  3OLB A;  3CCZ A;  3BF4 A;  2UXB J;  4ECU A;  2VG7 B;  4FF4 A;  4RW8 A;  1X9M A;  3Q23 A;  2CNN B;  3HMJ G;  3TEG A;  2F7V A;  5K8P A;  4CYU B;  1ZTT A;  4DI6 A;  4QR0 A;  4O3N A;  3K0J A;  2HHP A;  2XLK A;  2V68 A;  4KPC A;  4BCA A;  5K8O A;  2G2Y A;  4IH5 A;  3QGH A;  1WSR A;  3HVW A;  2PC6 A;  5KFA A;  5EHH A;  4DV7 F;  1HLW A;  2QC3 A;  3TEH B;  1SKR A;  3MM5 A;  4WYL A;  5GAH I;  2EC0 A;  4PXB A;  2V5H G;  2F65 A;  3OHA A;  1NBE B;  1R3N A;  2ZJP Q;  1GX5 A;  1DRZ A;  2DCU B;  2J7W A;  4JUZ A;  3HX9 A;  2BJ8 A;  2KXN B;  2OD6 A;  3GMG A;  1RTZ A;  2VG6 B;  5HRO A;  4DX5 A;  1IKV A;  3MPW A;  4OFZ A;  4DL3 A;  2YBV A;  1N36 F;  2BKN A;  2BW2 A;  2QRR A;  4ZA1 A;  3MXH P;  3DOL A;  4A8O A;  3MEE B;  4DN0 A;  3AQP A;  2WOM A;  2FPH X;  1EP4 A;  3UR0 A;  1SJF A;  4K4Z A;  1SPB P;  2Y0B B;  4O0N A;  2IAJ A;  3PRB A;  2IY5 B;  2UUW A;  3G87 A;  2DH8 A;  8RUC A;  2XMM A;  4DFK A;  1EAY C;  3CPW R;  3J7Y U;  3J80 U;  1S6P B;  1I51 B;  4OHW A;  4JI8 F;  4XPE A;  2H4W B;  1TAQ A;  5E33 A;  5CXT A;  4HVZ A;  2LA4 A;  3M2R A;  3OR1 A;  1SJ1 A;  2XGQ A;  3FJ2 A;  2CQ0 A;  4ELV A;  4RLE A;  2C22 A;  2R7T A;  2D7S A;  2CQB A;  2EPI A;  1RWV B;  4NCG A;  1EQ0 A;  5CYM B;  5CD4 A;  3HHL C;  3W2W B;  2IMW P;  1WOO A;  4URS A;  1QAI A;  2JOQ A;  2FC8 A;  1NHV A;  1T9W A;  4UQG A;  1U47 A;  1VQP S;  5KG4 A;  2B7B B;  3TZW A;  3FC9 A;  4ZPD A;  2RKI B;  3A3N B;  3KK2 B;  3O8W A;  5GMK a;  1F0X A;  1MNE A;  2LFV A;  2ZFH A;  2B5J B;  4J37 A;  5F8J A;  2ROG A;  2EWH A;  1Q7L B;  4PR6 A;  3SCL E;  4OL8 A;  4WII A;  3MR2 A;  5HQM A;  2NXC A;  1RT4 B;  2L9W A;  2HGL A;  1RYR A;  3TUP A;  5A2Q Y;  4ES3 A;  4DV3 F;  4C3M A;  1UJ4 A;  3TA1 A;  3DRR A;  4IG3 A;  4MKB A;  3HHD A;  2CJB A;  4HR2 A;  3OJU A;  1B0T A;  3N9U C;  2QMU B;  1Y7P A;  4J9M A;  3Q83 A;  3D0G E;  3M8Z A;  3VAM A;  2ZZM A;  5GMD A;  4NLG A;  3RBE A;  3U1N A;  1J2V A;  3IAS 9;  3KYL A;  2ZH5 A;  2BAC A;  1ZET A;  3HHL A;  1N32 J;  5K14 A;  3FBE A;  3TQE A;  4EZ6 A;  2FZG B;  2W2M P;  1S7H A;  3M4X A;  1CC7 A;  4DUT A;  3MMC A;  5GAD I;  4HL9 A;  1C1C B;  1GH8 A;  1EKR A;  2AEJ A;  2DXE A;  2AU0 A;  4LBH A;  2PI4 A;  1T03 A;  1S0N A;  5L1I A;  5FDL A;  2OEL A;  4YHH J;  1TV6 A;  4PQA A;  1Q8L A;  3HD2 A;  2U2F A;  4DDF A;  3DRP A;  1APS A;  4ALZ A;  1IBL J;  2QLB B;  4N7T A;  3KHL A;  3LP0 B;  3B8H A;  1VC0 A;  5IZH A;  4GVB A;  3WX8 A;  2B9Y A;  5M2U A;  3UPF A;  3W65 A;  1SKU B;  5ETO A;  4B3S F;  3TVK A;  1NU4 A;  3OL8 A;  2NQP A;  2QO3 A;  1VRU A;  1YIT S;  3H25 A;  2BJE A;  2RS8 A;  1ZZN A;  1XC9 A;  4NMX A;  1U0H B;  3P4U B;  5C42 B;  2HVI A;  2BMB A;  2R7X A;  1NDP A;  1U09 A;  3GSD A;  1M5V C;  4P7T A;  4Z2X A;  1JLG A;  2I5J B;  1Y4Z B;  1X9S A;  2G0C A;  1REV B;  3OJS A;  4M5L A;  3RU0 A;  2QMW A;  2VA2 A;  2DHX A;  3Q8Q B;  1NB2 A;  2YKP A;  3TUI C;  3LP2 B;  1Z4U A;  2QEX S;  2P9C A;  1BMQ B;  2O3D A;  2G9O A;  3C14 B;  4MIB A;  2AJQ A;  1BY9 A;  2QIF A;  1JB0 C;  3GE9 A;  1WWH A;  3CJR A;  4OX9 J;  2WBM A;  2YX1 A;  1OSC A;  3IG1 A;  5KG2 A;  2RQC A;  4QR2 A;  2VDH A;  1RWU A;  1AFI A;  2M7S A;  4Y3C A;  2R7V A;  2DO4 A;  2RT3 A;  3T41 A;  2EXU A;  1UWB B;  1H7W A;  4ZOS A;  2AIR B;  3CNQ P;  1VC6 A;  4KKO B;  4PWD B;  2EVZ A;  2AX1 A;  2R8J A;  1AT1 B;  3CB4 A;  4HTJ A;  4JYA F;  5GAH U;  3GV5 B;  4U6P A;  2FLO A;  1RT7 A;  1T9X A;  3JB9 k;  1QAX A;  1TKX B;  3EVW A;  4M5H A;  1KOO A;  3L7P A;  1WSV A;  1F3F A;  2ZWO A;  2PD1 A;  1V3S A;  5E7O B;  1RTI B;  5B0G A;  1HNI A;  3Q2T C;  4KGX B;  2DR8 A;  3SQO P;  5HVG A;  1U4B A;  1RAB B;  2ASJ A;  5JUM A;  3QPI A;  4B3M F;  2AW0 A;  4P2X A;  3EMT A;  1FKO A;  1BQN B;  4ZJL A;  1RT1 A;  3NEK A;  3ZTR A;  1B4S A;  2UVU A;  3PFO A;  4FKX A;  4EWT A;  2AEM A;  2QA2 A;  3CDE A;  3AOA A;  2DKO B;  1OSD A;  1HBN B;  3OUY A;  3MEC B;  4ECZ A;  2ZOG A;  1Q7Y T;  3O5T B;  2MZQ A;  2DRB A;  4B3O A;  2CPY A;  1P8G A;  1HNV B;  1N0U A;  1RT2 A;  4IH7 A;  5K20 B;  2GGP A;  1MRO B;  4H4M B;  5L8R C;  3K5N A;  3G82 A;  2YWK A;  1C0U A;  2CG4 A;  2W2P P;  1FRI A;  1K1S A;  3HF5 A;  1RT3 A;  1YRT A;  4YB6 A;  2V50 A;  4ILM A;  2L9N A;  2GFF A;  4ANC A;  2AGQ A;  5F8M A;  2Z58 B;  1TL5 A;  2UUC J;  1WEX A;  4M5J A;  1LKZ A;  1RWO B;  2DR9 A;  1IKW B;  4M5D B;  3V6J A;  3DNC A;  4B17 A;  4PPZ A;  3QGI A;  3JAM U;  2MQ8 A;  3MCO A;  1RI7 A;  4F0K A;  8AT1 B;  1R6Y A;  3GB0 A;  3SSR A;  1MWY A;  4QWB A;  5ETQ A;  2DGX A;  5D4L A;  5HMW A;  2XY7 A;  4Q44 A;  2OEJ A;  2GZO A;  3KUH A;  1BLU A;  4A8F A;  4M95 A;  2GMH A;  2XEX A;  5D0G A;  2YKO A;  2RU3 A;  4LSN A;  2HLU A;  3H4D A;  5LJ3 Y;  4DV2 F;  2RD5 C;  3NBP A;  5DM7 Q;  1VK8 A;  4GC6 A;  3NG8 A;  1MML A;  2GHW A;  3UDL A;  4HLB A;  3PY8 A;  1CJU B;  3CJS A;  2E9Z A;  4XK8 C;  5IV4 A;  2XY6 A;  3I4P A;  4DV6 F;  3NL0 A;  3MOZ A;  4ILL A;  1UAW A;  4WXW A;  3NAI A;  1NKB A;  1RBL A;  2IVY A;  4QU6 A;  2N7C A;  3GPA A;  1U48 A;  1S1W A;  2WW4 A;  1U8S A;  3K8W A;  3C46 A;  4LF9 J;  4OMF G;  3AB4 B;  4DX8 H;  2B8P A;  5AT1 B;  3G96 A;  4WFB Q;  5GAD U;  3OBI A;  2DRA A;  4FDF A;  1N5S A;  3MEE A;  2YNF B;  3OFH A;  4NLV A;  4YB7 A;  2DXF A;  3I6P A;  4ZIT A;  5E0O A;  1RAE B;  3OTC A;  3PR4 A;  4DQP A;  4DLG A;  3Q8R B;  2K1R A;  1O8B A;  2HHH J;  4Q43 A;  1S6P A;  2DK2 A;  3AD9 C;  2HBY B;  4OHY A;  1PG5 B;  5DQG A;  3DLE B;  1HNX F;  4MH8 A;  5JVH Q;  1NKC A;  1UVI A;  1MN7 A;  5KG3 A;  3TJA A;  1VQK S;  3I0R A;  4KIA A;  1UCN A;  3GYG A;  2B4P A;  3K58 A;  3TP2 A;  1CBK A;  1AB8 A;  2E1P A;  3W2W A;  4OZ5 A;  1WHW A;  2VON A;  2YWG A;  4H54 A;  5CYQ B;  4JI7 F;  3T9Z A;  2CQC A;  1WKK A;  2PMZ D;  2BJ7 A;  3IFE A;  3H59 A;  4IQM A;  5E3A A;  1WI8 A;  3EZ5 A;  3LP1 A;  1YRU A;  1RGV A;  1RTJ B;  5ETR A;  4PG6 A;  3KK2 A;  2YNI B;  2KKH A;  2VB6 A;  1HNZ J;  1LXJ A;  3OT9 A;  2JJ4 D;  1N54 B;  2CQ1 A;  1H73 A;  3BGL A;  4IOB A;  4QIW D;  1KR4 A;  4J9S A;  3K59 A;  4V19 X;  5J1E A;  3KLI A;  3WC2 A;  2DR6 A;  1KFD A;  4HTI A;  2FQQ B;  3BPS P;  3R5C A;  1RTD B;  5DLG A;  1RT4 A;  3BH6 B;  2MLZ A;  4C8M A;  1FA0 A;  4ECV A;  4KGZ B;  4Y6I A;  2UVW A;  1FT8 A;  4YY3 J;  3MCM A;  1FJG F;  1N5Q A;  4NRU A;  4KGK A;  4R5P B;  2EEY A;  4DCP B;  4QW9 A;  1QTM A;  3MOJ B;  3PFE A;  3NS7 B;  2RDI A;  1X60 A;  5SUH A;  1ZS6 A;  4YOE A;  4WTO B;  1XMO J;  2UP1 A;  1DQ9 A;  4UST A;  1RQ0 A;  1V9O A;  1PJ6 A;  2HUR A;  2EFV A;  5HVH A;  1JKH A;  2HQ3 A;  3CCJ S;  1H6K X;  4LJM A;  1Q4R A;  2UXC J;  4C3L A;  2RRB A;  4QU7 A;  2VFV A;  3KJV B;  4CLW A;  4WF9 Q;  3LOU A;  3W66 A;  4DX7 A;  2ZC3 A;  2WSE C;  2HGN A;  2NXN A;  4MKA A;  2J6U A;  1C1C A;  4DPW A;  4QZV B;  2CG8 A;  3RAX A;  3IWX A;  2LQB A;  3EGN A;  3RAQ A;  4HKQ A;  1KQK A;  4CRJ A;  4EEY A;  1XNR J;  2RVJ A;  4Y0F A;  3LP0 A;  3M1V A;  4J90 A;  1NPR A;  1IWG A;  2ZJQ Q;  3HZG A;  1FCA A;  2OGU A;  1FKP B;  1FRK A;  4DQS A;  3NAH A;  1HFE L;  2W2Q P;  3N79 A;  3CIZ A;  1I94 J;  4BWM A;  3GFX A;  4U7U D;  1FF2 A;  3C6T B;  2MZJ A;  1NK7 A;  2MQQ A;  5THW A;  4LVN P;  2V8H A;  2OKQ A;  3HKW A;  4OYW A;  3ET6 B;  2RRN A;  5C42 A;  1X4B A;  2MY8 A;  4Z37 A;  5BYS A;  1UEK A;  1BC6 A;  2RNE A;  2I5J A;  2QZ8 A;  2J9E A;  1WHX A;  2W25 A;  4U9R A;  2CPJ A;  3HFZ B;  4LFB F;  4U67 Q;  1SB6 A;  1REV A;  1N4L A;  4CLY A;  1YTY A;  3DLK A;  1IKY B;  2DGO A;  1YKW A;  3LP2 A;  1Q5Y A;  2MXY A;  4LRC A;  4XO0 A;  5DDR C;  2JWN A;  4KGV B;  3KFW X;  4JI3 F;  3T5K A;  2AWZ A;  4X65 J;  2MKJ A;  1N5T A;  3Q8V A;  3QYY A;  3S8S A;  4WFA Q;  1IR1 A;  5C25 B;  2XSJ A;  4LF6 J;  3KLE B;  1YVF A;  2ZHA A;  1PSD A;  3BBC A;  1RHJ B;  2VFT A;  4A8Y A;  3MAA B;  4FXW A;  4HHU A;  2HWI A;  4LF5 F;  2KT3 A;  4MK7 A;  5K5M A;  3ZTS A;  4IOC Q;  1LFP A;  2JC1 A;  2IDE A;  2UUB F;  4PWD A;  4KQZ A;  4RUH A;  1RYS A;  2AJ4 A;  4A47 A;  1WTF A;  1UVM A;  5KT4 A;  2DNQ A;  2V2Z A;  2DNM A;  2MPU A;  5K8M A;  2FY8 A;  3HJV A;  3KG1 A;  3NGT A;  3MM9 B;  2ALY B;  1JJH A;  2C2D A;  3T5L A;  1TKX A;  3W61 A;  1IR0 A;  4I6W A;  2RE1 A;  3MWB A;  7AT1 B;  2IJN A;  3VVU A;  1HQE B;  3VAK A;  3CW2 C;  3GIM A;  3MR7 A;  5DG9 A;  2M9K A;  3VTI A;  4LT6 A;  1YJR A;  2NUU G;  2MQO A;  1JLE A;  2J6S A;  3PJW A;  3RTV A;  1RT5 B;  3BSC A;  2AJ1 A;  2N3O A;  1QAJ A;  4BHQ A;  2CWK A;  2GX8 A;  2DHA A;  2J8A A;  4WZQ A;  3N4W A;  1N33 J;  1FEH A;  2OMO A;  5KT3 A;  3NGK A;  2JLE A;  3UW1 A;  3R5J B;  3MEC A;  3V6D A;  2R7O A;  2MLY A;  4U8V A;  1YJ7 A;  2DGW A;  3I0S B;  4C0H A;  2XCP A;  1B7Y B;  4DG1 B;  2J9C A;  3MM7 A;  1G2E A;  3H20 A;  1K44 A;  1FTR A;  4CH1 A;  3AQO A;  1NKE A;  2ALZ A;  2W9C B;  4NA2 A;  3EX7 B;  4ED7 A;  3UVJ B;  2R9L A;  4I2Q A;  2DPI A;  3GFH A;  4LF7 J;  3GYX B;  3BYP A;  3MEG B;  2WTF A;  3L4B C;  2W9B A;  4GO5 X;  5D4N A;  2BUN A;  2VU5 A;  2YQ3 A;  2RF2 B;  1WF1 A;  3DOK B;  1XMB A;  1IKW A;  1N5V A;  1TZ0 A;  2NCK L;  2OIH A;  3HPO A;  4UZB A;  1NCL A;  4KPY A;  2WON B;  4RZR A;  3M6W A;  3CDU A;  2HKE A;  5DG8 A;  1RAO A;  4AT1 B;  4PG5 A;  1RAC B;  1FHT A;  4UQT A;  2PT0 A;  4PXD A;  1AZS B;  3PR5 B;  1N36 J;  5E41 A;  4A8M P;  4USI A;  3LQV A;  4KR0 B;  2HND A;  3K2Y A;  3TZX A;  5LSL A;  5KFD A;  3K5M A;  1CJU A;  4M5K A;  4K59 A;  3B78 A;  2WVD A;  3FEY B;  1XR6 A;  1S76 D;  5DZ6 A;  1TQL A;  2HG4 A;  3M32 B;  4JI8 J;  1N34 J;  4OI6 A;  2OAU A;  4ERD A;  4PRF A;  2C3O A;  1QD1 A;  3HP6 A;  3BGR B;  3CE8 A;  1S1T B;  2ASY A;  4AXI A;  1Y0H A;  3KHG A;  4ZCI A;  5EX3 A;  3KHH A;  4ZCM A;  1NB7 A;  1EZZ B;  5F41 A;  4OHX A;  4X64 F;  5MLC V;  2K8G A;  1RTH B;  4FXV A;  4IFV B;  4NI2 B;  3HHK A;  3W8P A;  1HD1 A;  1O51 A;  2YNF A;  1IBM F;  3TNV A;  2CQ2 A;  1S6Q A;  1J5O A;  3BEG B;  5LSR A;  5J2M A;  4PXC A;  4ZN3 A;  3AH6 A;  3UN5 A;  2V8P A;  1JLB B;  1NDC A;  5I3U B;  2Y1L B;  3OR2 B;  4HHJ A;  3K5P A;  1S57 A;  3AA8 A;  4RU2 A;  2IYI A;  4DR5 F;  2R42 A;  4NWB A;  2IC3 A;  1IXK A;  3GFZ A;  2W4D A;  1DFD A;  1F5C A;  2CQI A;  4DSK A;  1SIZ A;  4IDK B;  2ZM6 F;  4DV3 J;  3LA0 A;  3ZO7 A;  2LKZ A;  4GKJ F;  2V69 A;  2HNZ B;  4QBU A;  3EWG A;  1CVJ A;  1VRT B;  5HJY A;  2G0J A;  2AT1 B;  1B64 A;  2OPS B;  5B7W A;  2ZH4 A;  1QVG R;  4LSL A;  3A8J A;  2EFP A;  4JI6 J;  5KOW A;  3VQS A;  5D3G A;  2R7Q A;  3D3C J;  3PXG a;  2RQK A;  3G6X A;  1FVQ A;  1Y5L B;  1D9A A;  4EMD A;  1WI6 A;  3VVT A;  1UWA A;  2RQM A;  5KFW A;  2NXU A;  2ADB A;  1RTD A;  4OX8 A;  5B0D A;  2FGO A;  5KT7 A;  1LFW A;  1S1U A;  2EKN A;  4CTA B;  2I1R A;  2BJ3 A;  1RBA A;  4URG A;  1FVS A;  2E66 A;  4LVO P;  2HK3 A;  2ZE2 A;  4R5P A;  2E1M C;  3HT0 A;  1M90 T;  3IMQ J;  5E3C A;  1B70 B;  1H0H B;  3BQ0 A;  4FYX B;  1XJW B;  1UET A;  1R8C A;  2HFO A;  3QQC D;  2AF6 A;  1U25 A;  3EVM A;  4RPF A;  4C8K A;  2RDD A;  4OZL A;  2X1A A;  3CCT A;  1D9F A;  1RHK B;  2C2K B;  4AXJ A;  2DNG A;  3UO0 A;  2XMJ A;  1BHN A;  5LJ5 Y;  4UY8 5;  4DS4 A;  3R5B A;  1YG0 A;  3VAJ A;  4B9N A;  1DAR A;  5KFX A;  3JQK A;  1JLQ B;  4F4Z A;  1FNM A;  2FJA B;  5DGA A;  4NLW A;  2U1A A;  2VQF F;  2GIQ A;  3A8K A;  1SQE A;  1F3V A;  3PW7 A;  2Q79 A;  4X4S A;  3ZZT A;  1WD6 A;  3K17 A;  4FPI A;  3P3D A;  4MYT A;  3M30 A;  2ZUA A;  1WOP A;  1VS3 A;  1RJJ A;  3DGP A;  1X5P A;  2KXH A;  3CC2 S;  2JX2 A;  2BJD A;  2C1E B;  1LW2 B;  2V2V A;  3QO9 A;  4DN9 A;  2V2K A;  3PYE A;  5FLX Y;  4DXL A;  1C4C A;  4RW7 B;  3FNN A;  2K2P A;  2R7W A;  4B9V A;  4TXS A;  4OJG A;  1YJ9 S;  3I9V 9;  5JVG Q;  3OD2 A;  2BVZ A;  1EHW A;  1JLC B;  1RZM A;  2RU9 A;  3ET6 A;  1XR7 A;  5BXI A;  1H2U X;  2FZK B;  2BBE A;  3HVA A;  3UFC X;  1CPZ A;  2BE7 D;  3QZ7 A;  2VG5 A;  4LFC J;  4WK1 A;  3IS9 B;  4ZMM A;  4WP9 A;  2UVV A;  2LP4 A;  1X4G A;  5KFM A;  4N56 A;  3LPE A;  5GAE U;  3MR5 A;  3GIR A;  1DZ5 A;  4ZVS B;  1N5Y B;  1TMM A;  1XK8 A;  3IR6 B;  2BOA A;  4USU A;  4J9L A;  3EZO A;  1KDN A;  3MZI A;  1IQT A;  1WC6 A;  2FHM A;  2OI2 A;  3MR6 A;  2Z2M A;  3D6H B;  4JYA J;  2FZC B;  2DNY A;  5H1S V;  4W98 A;  2EFG A;  4FF3 A;  1DTQ A;  1IKY A;  2BE2 A;  2BJ9 A;  3IA0 A;  1VRQ C;  2V9K A;  5CQG A;  2VUG A;  3M9N B;  4AL5 A;  1GT8 A;  4LRB A;  1XMQ F;  3QAU A;  5JMN A;  1HNW F;  5A76 A;  1R31 A;  1JK9 B;  4OI4 A;  3GJT B;  2YKQ A;  1Y5I B;  5ADZ A;  4JI0 J;  1TUG B;  3MAA A;  2D3Z A;  1AUD A;  1L3K A;  1Q1K A;  1PO6 A;  4PCQ A;  2E7V A;  1CJK B;  3FFI A;  1DLO A;  1J27 A;  2FVC A;  2IRY A;  3VGU A;  5D4P A;  3BKU A;  4OZ1 A;  4MK8 A;  3VR1 A;  4B9T A;  1TKT B;  1RXO B;  3H8Y A;  3DGV A;  1KQF B;  4AYB D;  3DU6 A;  2GNK A;  1OMS A;  5KFQ A;  2JNJ A;  2Z56 B;  1A6L A;  3SMZ A;  2FLL A;  2DR5 A;  2B7C B;  5IT9 U;  3LWL A;  1V5V A;  2BA9 A;  1FJC A;  2N3L A;  3DOM B;  1K0V A;  2VPX B;  1HQE A;  1F9H A;  3MMA B;  5F9L A;  4EBE A;  3HCX A;  4O3Q A;  4EI2 A;  5HP1 A;  1YJV A;  2ACM A;  1R6V A;  2YKM B;  4WJB A;  2OO4 A;  4IOA Q;  5D77 A;  1S59 A;  2RML A;  1VC5 A;  1CS4 B;  4CLS A;  1RT5 A;  2KG0 A;  1S0M A;  2O67 A;  1X4H A;  4GO7 X;  2W7A A;  1RAD B;  3VAI A;  2OLW A;  4YN3 B;  4FVC A;  3R2C J;  3A8I A;  3I0S A;  4XAK A;  1KQG B;  3NMR A;  1DTT B;  4JI5 F;  3JXO A;  2AYB A;  3E2E A;  3G4S S;  2J6T A;  5DRK A;  3TRG A;  4TVA B;  3UVJ A;  4LR9 A;  4LQ3 A;  4DV2 J;  3VV2 B;  3MEG A;  2MZ1 A;  2YH0 A;  5HK4 A;  2H5I B;  3AD7 C;  2JEF A;  3R2D J;  3UCG A;  5KFK A;  2MZR A;  2R2S A;  2FVQ A;  4DV6 J;  2RF2 A;  4ED3 A;  3DOK A;  3U1L A;  4ILR A;  4P2S A;  4ZK7 M;  1C1B A;  1T11 A;  2M52 A;  2RQ4 A;  1JXL A;  2E5H A;  3BQ2 A;  2WON A;  4KHR A;  3NMA A;  3U27 A;  3BB5 A;  4A8Q A;  5DDO C;  4N8N A;  3BJY A;  2HIY A;  2YNH B;  2XM3 A;  4HI2 A;  3L7O A;  5I3P A;  3PHE A;  3PW4 A;  1AZS A;  2DR7 A;  2YQ1 A;  3J7A N;  3D68 A;  1QLN A;  4DPY A;  4OZJ A;  1GXU A;  3EDQ B;  4KYZ A;  1U1R A;  2MMY A;  2D41 A;  3JQJ A;  4K0K J;  2LU1 A;  2F1F A;  3CWJ A;  4KHM A;  4X4P A;  4ENO A;  3HLU A;  1AYE A;  5GME A;  4J9N A;  3FKB A;  4JB8 B;  3BZQ A;  3RAM A;  4ZLN A;  4YP3 A;  1ZM3 A;  3HVT A;  1OYE A;  4FN5 A;  3UN2 A;  4Y2K A;  1HNX J;  4DR6 F;  3PKY A;  3PX4 A;  4F4W A;  5I3Q A;  2ZZT A;  1NJW A;  2QLF B;  3KDO A;  3J81 Y;  5B0F A;  4R25 A;  2AGP A;  3BGU A;  3ELH A;  4E8U A;  2V8V A;  4W92 B;  1LWE B;  2VH7 A;  2HSE B;  1RDR A;  1PGZ A;  3B6B A;  1C0T B;  4RW6 B;  3KG4 A;  3E01 A;  1I5O B;  1KON A;  3W2V A;  4JI7 J;  4NZ0 A;  1SUQ B;  2RUS A;  1RTH A;  1ZM4 A;  4IFV A;  2DXD A;  5H9E K;  5J2N A;  1KHV A;  2MKI A;  2QL5 B;  1SQF A;  2JLF A;  4DWI A;  1IWA A;  3CJ0 A;  3VGT A;  3F41 A;  3RB0 A;  1BQM B;  3ZZU A;  4L74 A;  2YNG A;  1RT6 A;  2FIU A;  3UD4 P;  1G6B A;  2BAN B;  1RA6 A;  3H90 A;  4K50 A;  1HBM B;  3OR2 A;  3TW0 A;  2HFS A;  1ICE B;  4HYK A;  1HBU B;  2BE9 B;  3D2W A;  3D6T B;  3FSY A;  2LEB A;  3SFU A;  2DBB A;  4W4M A;  3ZXW A;  1WF2 A;  3IGV A;  3UWT A;  1FNO A;  1FD8 A;  1FJG J;  2KZZ A;  2YXL A;  2VZ9 A;  4B08 A;  1YJT A;  5HVF A;  1NXI A;  4DPX A;  2ZH6 A;  1VRT A;  1OYD A;  4B9U A;  1U02 A;  3QFH A;  3PNI A;  4ZLJ A;  3OFF A;  2OPS A;  1MSW D;  2XC9 A;  3PTW A;  1GFW B;  2DGV A;  3J7Z T;  4EYH B;  3ETM A;  3UDE A;  1Q16 B;  4FKY A;  5B0E A;  3S01 A;  4PWW A;  1U2F A;  4NXN J;  4MYU A;  2JDJ A;  4ZP8 A;  3MM5 B;  2IMO A;  1RB0 A;  2QYC A;  4RL1 A;  2KFN A;  4ZHR B;  1DQA A;  2WB1 D;  5C2G A;  2M4M A;  4IH6 A;  4DFP A;  5F3T A;  4JV0 A;  4YUD A;  4TNO A;  1KTQ A;  5A2Q U;  2C2O B;  4K5R A;  2RS2 A;  4N47 A;  3MMJ A;  4CTA A;  4RW4 B;  2VL1 A;  4L75 A;  4F4Y A;  1IKV B;  2DYA A;  3KUE A;  2LA6 A;  2WB4 A;  3LGM A;  5A8K A;  3DOL B;  2WOM B;  1BXN A;  2HFV A;  3R3T A;  3CCM S;  2HRY A;  4AND A;  1FDD A;  4IG0 A;  3A3O B;  2D74 B;  2CJY B;  4F8R A;  4DUY J;  1QTN B;  2ABY A;  3PYF A;  3OR1 B;  3M2R B;  5FD1 A;  2J7U A;  3TAQ A;  4DOZ A;  4M5M A;  1QSY A;  3PKM A;  5KFZ A;  4TY9 A;  3G2X A;  1VQ6 S;  3FRY A;  2Y0S D;  4UUW A;  4L73 A;  4IFY A;  4EK2 A;  4DV0 F;  4ZJO A;  2CYY A;  4GRS A;  2V2Q A;  2CUY A;  2JSX A;  2AP6 A;  2ZH9 A;  3MI7 X;  3GU0 A;  2BV3 A;  2MTL A;  4NLS A;  4I69 A;  4A8W A;  3D3B J;  2HAF A;  1HR0 F;  5DJB A;  2V63 A;  1S4F A;  1RAA B;  3RRG A;  2HIQ A;  2DIT A;  2M70 A;  3NRB A;  3CGI A;  1TKD A;  2GO9 A;  4RW7 A;  2XZW A;  6FDR A;  2DCL A;  1NSP A;  5BYQ A;  5H9F K;  2CZ4 A;  2KI2 A;  4KHP F;  3CUN A;  1MU2 B;  2O5D A;  5A8R A;  5KG1 A;  5KFF A;  3IR5 B;  4RUB A;  5ETT A;  1UEU A;  1RWX B;  3MF5 A;  3RRH A;  1ULR A;  1GMW A;  1IBK F;  4M94 A;  1KBR A;  4NOH A;  2POK A;  2VIC A;  3ILI A;  3IC1 A;  2FVP A;  5B08 A;  3R8Y A;  2N82 B;  5L9X A;  2HRT A;  2VQE J;  4LF5 J;  4DV1 F;  4RKU C;  2UUB J;  3C66 A;  2DPJ A;  1VDH A;  2VJU A;  2Q1L A;  4ZP6 A;  4NLQ A;  2XCA A;  2HVD A;  2GO8 A;  1OY6 A;  3FMW A;  3H4B A;  1VBK A;  5EUH A;  2J76 E;  5D78 A;  3DI6 B;  1Y9O A;  3QJP A;  3RW6 A;  4ED4 A;  2QG9 B;  1CUL B;  1YHQ S;  3GIL A;  3PVX A;  2ZUG A;  4ES1 A;  1SJQ A;  4NZ6 A;  2KJV A;  5FDL B;  3M7V A;  1KRP A;  1RLC L;  3KJN B;  4K4W A;  4X4Q A;  2G4B A;  3DRP B;  2IVM A;  3BQ1 A;  1PJ5 A;  1CJK A;  5ETL A;  5L39 A;  2XGP A;  4OI3 A;  3NKY A;  3QFW A;  4MJK A;  3BN4 A;  4YDD B;  1KFS A;  1WNE A;  3A8E A;  1TKT A;  2JEJ A;  2AYM A;  4J9R A;  3T1H F;  1NDK A;  1HW9 A;  2JRS A;  2B8Q A;  5HQL A;  3ZTO A;  3IO1 A;  1U2C A;  1VIO A;  3SXL A;  3DFE A;  3MPU B;  4FVM A;  4IO1 A;  3C2P A;  4N8O A;  4FYW B;  5T7L A;  4YFU A;  1Y5N B;  2A1B A;  4P10 A;  5HLF A;  5KOX A;  4C7Q A;  2VPZ B;  3I5C A;  2C42 A;  5H9E J;  1SKW A;  2OPP A;  1EB0 A;  3F0N A;  2FLP A;  4KV8 B;  2K7K A;  1TK5 A;  2FJE B;  3X1L B;  4J9U E;  3MM6 A;  1FXL A;  1X4A A;  4ZIW A;  2VA3 A;  3PW0 A;  2ROE A;  4CO0 A;  2MKC A;  4IR1 A;  1CS4 A;  3QT7 A;  2CA9 A;  2COL A;  2LXF A;  4EO8 A;  1RBO B;  3DLJ A;  2KVQ E;  2ZBR A;  2FHO B;  1DQ8 A;  1UJ5 A;  1UZD A;  4ZPW R;  3BYR A;  1M1G A;  1DTT A;  3HFV A;  1XER A;  1U1O A;  3QT8 A;  5FJ4 A;  3LTO A;  1URN A;  2MHE A;  1VQ4 S;  4F2R A;  1HWJ A;  3OTO F;  2ZWP A;  3IG1 B;  3M8Y A;  2PA8 D;  2CPD A;  2J8S A;  3TAR A;  2LEA A;  4NYP A;  4K4X A;  4O44 A;  3NLC A;  3ISN C;  3HVR A;  5AJ3 F;  2XHC A;  4RBT A;  3THT A;  1EQM A;  3ZTP A;  2XMK A;  2DNZ A;  4DUZ J;  4X62 J;  3C6U B;  5LM7 E;  4F4A A;  1B7F A;  1YJU A;  4CDI A;  3S1T A;  2V34 A;  2E9R X;  3CJQ A;  4I1T A;  1ZPW X;  3HHL D;  2VJV A;  1RT7 B;  3FMB A;  4ER8 A;  1RKJ A;  1X0P A;  3TR5 A;  2OSR A;  4X64 J;  2OPQ A;  3IP0 A;  4LF4 F;  1HNI B;  2VOO A;  3KG0 A;  3IRW P;  1SH0 A;  1IBM J;  1FXD A;  3HXM A;  2CZV C;  2GVZ B;  3IGN A;  4K2J A;  2PE8 A;  2CPZ A;  4QIV A;  6FD1 A;  1X31 C;  3QGP A;  3J7Z 5;  3GR1 A;  3EGW B;  1RT1 B;  2A10 A;  4P6Q A;  5L1K A;  2EI5 A;  1ACM B;  3AT1 B;  3ETO A;  2ZBC A;  3M8P B;  3BH7 B;  1Q78 A;  1X4E A;  4TU9 A;  3CIM A;  3OXL A;  4AL7 A;  1RT2 B;  2GGP B;  2ZM6 J;  1VLY A;  2I0X A;  3LUY A;  1FTC A;  4Q0B A;  3CJT A;  3G86 A;  3ZZZ A;  1C0T A;  5K9F A;  1PKU A;  2LXU A;  4UOC A;  1SUQ A;  1GQE A;  2EK6 A;  3CD0 A;  2CDQ A;  3OFE A;  1HHT P;  1B0V A;  2UXD J;  4CO4 A;  3KLF B;  2A2D A;  4LFA F;  4JI1 F;  4GVL A;  2XMA A;  1RU1 A;  5AXM A;  4ATN A;  4RNO A;  4XDC A;  4EBD A;  4DL2 A;  5D15 A;  1CJV B;  1HBU A;  2BM1 A;  3Q22 A;  8ATC B;  5KFJ A;  4YS2 A;  4ICL A;  4M5N A;  4ZPA A;  3CCQ S;  2GAH C;  3GR0 A;  3AD8 C;  3GG0 A;  4CH0 S;  4ZVT B;  2XQC A;  4LSN B;  4ECY A;  4L76 A;  3M8S A;  1X4D A;  1SH3 A;  4DSF A;  1N6Q A;  2NR0 A;  2HS0 A;  1HI8 A;  1SBR A;  2W7P A;  3NBP B;  1UZH A;  1U1Q A;  1KVK A;  2KM8 B;  4ZPT R;  2BOP A;  2OUG A;  1AUS L;  3ZZO A;  3V4I A;  5C7P A;  3OL6 A;  4K5S A;  4X66 J;  5DDQ C;  5HI7 A;  5BJR A;  3EGV A;  4RWW A;  4I6A A;  3SQG B;  2YWF A;  4NLP A;  4DL7 A;  2FHJ A;  4ZHR A;  2MKK A;  2XS5 A;  5IQQ A;  3MPY A;  3OW2 R;  4NXM F;  2ZBI A;  2IM0 A;  2VQF J;  1MWZ A;  1S1W B;  2H9Z A;  3S7R A;  3CC7 S;  2J0Q D;  3FCV A;  4ZPB A;  3VZH A;  3HKZ D;  4OZN A;  4RW4 A;  3GV7 B;  1TU0 B;  1TMJ A;  3HJF A;  1SJR A;  2F5G A;  1NK8 A;  3JSM A;  5BYR A;  4DR7 J;  2VFU A;  1FJE B;  1FNX H;  3KJQ B;  4OIX A;  3AJ2 A;  3UD3 P;  3BBF A;  3QRR A;  3E8O A;  2K1R B;  3CCL S;  1UW9 A;  4RBU A;  4ED2 A;  2J9D E;  4Y28 C;  1RWN B;  1LW0 B;  4RNM A;  4DV4 F;  4IRK A;  3A3P B;  5LOQ A;  5JXS A;  2E7W A;  3GP9 A;  3TWZ A;  1VIS A;  2E1C A;  1N32 F;  3I0R B;  3ADA C;  4C4W A;  2DD8 S;  3VCD A;  3CUL A;  1Q81 T;  2ATL A;  3NGS A;  1VJQ A;  4P2F A;  2PII A;  1ITP A;  4ECQ A;  4YHH F;  1NRK A;  3DYA A;  2ZH3 A;  2WSF C;  3EYZ A;  2A6O A;  3LP1 B;  4MKY A;  1HYS A;  5LT5 A;  5KFR A;  3JTO A;  2QMX A;  4FP9 A;  4D3H A;  3W64 A;  5A8W B;  1JLA B;  1V3Z A;  5IV3 A;  1FRJ A;  2J0S D;  2H5J B;  5B0C A;  4B3R F;  5J1E B;  3KLI B;  2GIR A;  4X4U A;  1H38 A;  1MU2 A;  1KEK A;  4EUV A;  3UI3 A;  1J5E J;  1HNW J;  4Z7Y A;  1TKZ B;  1OQ6 A;  1TR0 A;  2PEB A;  3EE3 A;  1P9Y A;  3LAL A;  4I7F B;  1NK9 A;  1RAI B;  3BO2 A;  4O23 A;  4K4U A;  3PO5 A;  3MMB A;  2W9A A;  1VQN S;  1FRH A;  1NEE A;  2EW9 A;  5E3R A;  2C2N A;  4A46 A;  4CLU A;  3PM9 A;  3CO0 P;  2G13 A;  1T94 A;  1JKH B;  4PEO A;  2QN6 B;  3DI6 A;  4NLY A;  4EZ9 A;  4AQY J;  1X4C A;  4M5I A;  3I4H X;  1L3V A;  4OYB A;  1CUL A;  1PIE A;  3DKD A;  2F8H A;  1W7W A;  3OQ2 A;  5G0R A;  5EGY A;  2ZKU A;  3V4M A;  1YJN S;  3DLL Q;  1QJH A;  1YGY A;  1AFJ A;  1HI1 A;  4CNZ A;  3KK3 A;  3D54 A;  2BQU A;  1NHK L;  3UNY A;  1H2T Z;  3M1V B;  1P6T A;  2VFR A;  3WIV A;  3CJ2 A;  2Y1J A;  1VOM A;  2R2U A;  2WSC C;  2M8D B;  1VQO S;  1U1N A;  2AYG A;  5HAN A;  2LEC A;  5AE1 A;  1ZPV A;  2CJK A;  1D8Y A;  5L46 A;  1HAR A;  4DL6 A;  4DL0 C;  1T05 B;  2P8I A;  2B6A A;  4Y65 A;  2FUG 9;  2XTJ P;  2E5L J;  4U8Y A;  3O1L A;  2C3Y A;  4RJV A;  4KV8 A;  2PSZ A;  1VHF A;  1VLO A;  2I8E A;  2YQ0 A;  4DQR A;  1HWL A;  3F56 A;  1F2H A;  5DO2 A;  4A8S A;  4OYA A;  5HAO A;  4DPO A;  1IQZ A;  2AJ2 A;  3AXK A;  2HVE A;  4LR8 A;  3ULH A;  1DY3 A;  3IWN C;  3V2U C;  3DLK B;  3MDF A;  3Q8U A;  2ZIT A;  2Z4P A;  4WIQ A;  4F36 A;  2B56 A;  4OZ2 A;  2H65 B;  4LR7 A;  3RB4 A;  5KFC A;  1T8E A;  3MR3 A;  3DLH A;  1YLX A;  1RAJ A;  2QL9 B;  3G9C A;  1UKU A;  1FDN A;  4WE1 A;  1WHY A;  1HMV A;  4KGM A;  1U24 A;  3R6G B;  3B4M A;  2V4R A;  1UVJ A;  4TQR A;  1FD2 A;  4ZVG A;  4WXO A;  1VQ5 S;  2XSJ B;  1XN9 A;  4CO2 A;  2W7O A;  1B0P A;  5IWA J;  1FEE A;  3POT A;  2GA7 A;  2DGT A;  5ETV A;  4J9Q A;  1TL1 B;  2R7R A;  3PX0 A;  3HHN B;  1UFK A;  3W1Y C;  1FER A;  2CFX A;  1VJW A;  4I4B A;  3M8Q B;  2B43 A;  2HZA A;  7FDR A;  4DR6 J;  2W2O P;  2UUC F;  4NPO A;  2ROP A;  2D9O A;  3C6U A;  4A8K A;  2WW8 A;  5D8H B;  4ZS6 A;  2YPZ A;  2IVF B;  3BDE A;  4C6A A;  4KAI A;  3I9Z A;  5KT2 A;  4WFN Q;  2GVD A;  4F3M A;  1WHV A;  2JEI A;  1NZ8 A;  1PBU A;  3CT9 A;  3QGG A;  2LVW A;  4PPD A;  3QAE A;  4IR9 A;  2D9P A;  3T1A A;  2DNO A;  4ED6 A;  3N28 A;  2BKO A;  1X5S A;  1E6V B;  2V94 A;  2EK1 A;  3R6L B;  4ANE A;  1NH8 A;  2C2R A;  4KJI A;  3QZ8 A;  2MST A;  1IKX B;  2EBE A;  2GVZ A;  2RAQ A;  4X4R A;  1U6Z A;  2CJ9 A;  2XZT B;  4KTQ A;  3GWC A;  5KFH A;  1JLE B;  4XIU A;  4KFB A;  4HHH A;  1YQH A;  3G6V A;  4C48 A;  2FDN A;  1M1H A;  2KM8 C;  3IAM 9;  1C4A A;  3OXF A;  2BRK A;  3M8P A;  1KTV A;  1ZA2 B;  3KKF A;  5IQ6 A;  3V6D B;  3RG6 A;  2L08 A;  3N5F A;  3TAM A;  4DFJ A;  3ZC4 A;  4W90 B;  3M6V A;  3MM7 B;  4OJH A;  2WVB A;  2B51 A;  3D67 A;  2XG8 A;  3PG9 A;  4LF9 F;  1QY7 A;  1O5J A;  1ELO A;  1S9F A;  4I2Q B;  2QA4 S;  3THP A;  3FBF A;  1X8D A;  4OJ3 A;  1MG7 A;  1JJ4 A;  5HAT A;  4ZVE A;  4DV5 J;  4PG8 A;  2F4F A;  2W9B B;  2W1B A;  1FX4 A;  5IM0 B;  3KLF A;  1S1X B;  4K7Q A;  3CO9 A;  4OYZ A;  2ASL A;  2RHS B;  3NCP A;  3DHX A;  3BV8 A;  2H54 B;  3T6B A;  2X3G A;  5BR8 F;  3FCH A;  3ICL A;  1CJV A;  4ES2 A;  2OFH X;  4YME A;  1SC6 A;  2C2M B;  2R8I A;  4C2M A;  2E7X A;  1XBW A;  2ZOF A;  2MQL A;  5CZV A;  2ZHB A;  3M8R A;  1S1V B;  5LXR A;  3OHB A;  5CCM A;  3TX8 A;  4IRC A;  4USW A;  3TX0 A;  2OD4 A;  4OJ1 A;  1UL3 A;  4JV2 A;  2DHG A;  1OY9 A;  2HND B;  1HA1 A;  4KSE B;  2IYG A;  4HEA 9;  2EG2 A;  1FFW B;  4J91 A;  4DZ6 A;  1KSP A;  4PUO B;  2NLW A;  2BYC A;  3GFY A;  4O0I A;  1PC4 A;  5KFO A;  2ZBP A;  4C11 A;  3SQG A;  2HFN A;  2VKZ G;  4MTP A;  1R0A B;  4OZ3 A;  1H2V Z;  4DF4 A;  1TUW A;  4TLQ A;  4OYP A;  2B4V A;  2HHW A;  2OEM A;  4HI1 A;  2FTR A;  3TAN A;  4F2S A;  1FX2 A;  4J9P A;  1OWX A;  5F8L A;  4RBV A;  1FRL A;  2AX0 A;  4DV0 J;  2HNY A;  2VD3 A;  5IXU A;  2V67 A;  2J0W A;  2NYH A;  2BM0 A;  3W5X A;  1GTE A;  3MD1 A;  2AZ3 A;  3CJ5 A;  4HT7 A;  2Y9H A;  2D3U A;  1S6Q B;  3ENQ A;  1NJY A;  1J5O B;  5J2M B;  1K8A T;  5A0Y A;  4NRT A;  3CJ3 A;  1HHS A;  1RLD A;  1MLA A;  1VBZ A;  1VQ9 S;  3MPV A;  1CQM A;  3UE2 A;  1E6Y A;  2X1G A;  1LW0 A;  2VPY B;  2XZD B;  3R5A A;  4KHP J;  1JNR B;  1U8W A;  3CCV S;  3GII A;  4J9K A;  1LEO A;  3MGJ A;  5D0H A;  2IC3 B;  3PZP A;  1F5A A;  3R27 A;  5C24 A;  3ITH A;  1NK5 A;  1IBK J;  2CPE A;  1M5S A;  3KNA A;  2XMW A;  1MW7 A;  1U6F A;  1BGX T;  3DMJ B;  4WP3 A;  5CAA A;  3UDC A;  4DV1 J;  4GKK F;  4U96 A;  4OV6 A;  2LCW A;  2YKN A;  3AJ1 A;  2VOP A;  2YPY A;  3RBD A;  4IO9 Q;  5FLX U;  3QWP A;  3UCU P;  1NME B;  4DU7 A;  3IN5 A;  1KS2 A;  4LSL B;  2GJ2 A;  2NPI A;  4I68 A;  3FVY A;  1SC3 B;  5D3G B;  2GS8 A;  5A8W A;  1JLA A;  1EKS A;  2LYV A;  5B0B A;  1M5O C;  3CC4 S;  4EGL A;  2V4J B;  4DR1 F;  2DTJ A;  2NS1 B;  3DLB A;  2QA4 G;  4FYY B;  2N7Y A;  4BBY A;  3JYT B;  4IQX A;  5IC4 B;  4CIO A;  2K7J A;  1TKZ A;  1S1U B;  1Y3J A;  2AYE A;  2XSF A;  4CT9 A;  2KU7 A;  2Y1I A;  4I7F A;  4MFB A;  3OVA A;  4RUC A;  2RRA A;  4OLO A;  2ZE2 B;  4FXD A;  3DDK A;  2GAG C;  3FK4 A;  3VF0 B;  1KVI A;  1QSS A;  4UTG A;  2I2Y A;  3EUN A;  2AGO A;  2ZOM A;  3QNW B;  2VV5 A;  1Y10 A;  2DNP A;  3LAN A;  2DNR A;  3QWU A;  1Z2L A;  1W2I A;  3M8W A;  4ZVO B;  3HDS A;  4RNN A;  1X9W A;  1RHU B;  4B9S A;  4LF8 J;  4K4T A;  2ZEJ A;  4TN2 A;  5DS7 A;  2MSS A;  4E2F B;  1VCT A;  5F9N A;  2DB1 A;  5KFP A;  4P74 A;  4Y2A A;  1VMB A;  2A3J A;  1WUU A;  1T3O A;  3V5R A;  2CJA A;  1RWP B;  1GMV A;  1KVJ A;  3M30 B;  1LK7 A;  4CZC A;  2XS2 A;  2MDA A;  1PBA A;  1LWC B;  1JMT A;  3DGP B;  2YX4 A;  2MQM A;  3T5H A;  3QO9 B;  4ZDN A;  1R0C B;  2K06 A;  5LMU F;  1JXV A;  3PYG A;  3CCE S;  3CD6 S;  1CQN A;  1WG1 A;  2BZ2 A;  1SL2 A;  2OP5 A;  1V6H A;  4U95 A;  3FUY A;  3HT3 A;  3L7U A;  1T05 A;  4E0D A;  2IJR A;  4F26 A;  1WG4 A;  1WEZ A;  2DNN A;  3BDP A;  1TK0 A;  2ZDP A;  1YI2 S;  4KT0 C;  2K3K A;  3DXB A;  2EFO A;  1Z1Z A;  3Q8P B;  2CPF A;  4MIA A;  2UU9 F;  2VG5 B;  4BC9 A;  3T19 A;  2L48 A;  3NGU A;  3T1Y F;  5LXY A;  2DNH A;  5AJ3 J;  5LSO A;  1FRM A;  1OPI A;  3FSI A;  3W9H A;  3MEK A;  2BW7 A;  1GMU A;  5DQI A;  3CCS S;  1REG X;  1P9Q C;  4R0J A;  1CJT A;  2CQH A;  1AW0 A;  1N33 F;  4DMZ A;  1DTQ B;  3O3L A;  2BE2 B;  2RSQ A;  3GJR B;  1OJ4 A;  1TAU A;  4KO0 B;  5ETS A;  3W63 A;  2CKW A;  4UY8 T;  1KD1 T;  4F50 A;  4AD6 A;  5AXL A;  3X3U A;  4I2P A;  3RBZ A;  4LF4 J;  3QLH A;  2DH9 A;  2P6S A;  2DGS A;  2MQP A;  4A48 A;  4RW9 B;  4WK3 A;  3H2U B;  4MKV A;  4C0O C;  4LF7 F;  1S99 A;  3GCX P;  3QBC A;  3PRD A;  4TY8 B;  4PQU B;  2HW3 A;  1TL1 A;  2PO4 A;  5LMN J;  2KJW A;  3FFI B;  3W62 A;  3M8Q A;  1WDD A;  1DLO B;  3W9J A;  2RHQ B;  2EBG A;  4USH A;  1SH2 A;  2WAQ D;  4ZPC A;  3PW5 A;  3OLA A;  2FJW A;  3CMQ A;  3DLG B;  9ATC B;  3QRP A;  4F7V A;  2XMU A;  3KK1 B;  2OEK A;  2XMT A;  2Z2L A;  4G3I A;  3QT5 A;  4AL6 A;  1Q53 A;  1S9E B;  4I6Y A;  2ERR A;  3VQT A;  5B09 A;  3D1H A;  5IFM A;  4H4K C;  4NML A;  4CI0 B;  2UV8 A;  1X4F A;  1E6V A;  2R7S A;  3N6L A;  2E1A A;  3I32 A;  3QID A;  3CCU S;  2R7U A;  4L72 B;  1M5K C;  3C8Y A;  2VBX A;  4ZP9 A;  1IKX A;  1FRX A;  5HP1 B;  3T6J A;  4LFA J;  4JI1 J;  5LL6 d;  1FO1 A;  5K8N A;  4WFX A;  3RR8 A;  3MED A;  4DSL A;  1VK3 A;  3J81 U;  3BR8 A;  1HPZ B;  1NK0 A;  1EIY B;  4IKA A;  1L5U A;  1RAG B;  1SL0 A;  1D0E A;  1N34 F;  2HAI A;  1B3T A;  4MIW A;  3D1Q A;  1FDB A;  2M0G B;  2P2C B;  1G1X A;  1N8R T;  5HBM A;  1P1L A;  1NSA A;  3FZB A;  4ZCK A;  1VIX A;  3D6M B;  2PFD A;  1UEV A;  4UUX A;  2HK2 A;  2X3D A;  1CEZ A;  2K3I A;  2HQI A;  2B0G A;  2QV6 A;  2HHV A;  2ZDO A;  1GEH A;  1Y3K A;  4DEZ A;  2WZ1 A;  4WBF A;  9RUB A;  4PXE A;  5E3Q A;  1S72 S;  1RUS A;  2H3E B;  5IM0 A;  1BE4 A;  1S1X A;  1TL4 A;  4WU3 A;  4DV7 J;  2NXJ A;  2CQG A;  2JC0 A;  5KFL A;  3DM2 A;  3VZI A;  1C1B B;  2PN6 A;  1U1M A;  1LQ9 A;  2BQ3 A;  2IA0 A;  4NXM J;  4WWS A;  4H4K A;  3N01 A;  1WAC A;  2XB2 D;  3K89 A;  1WF0 A;  2V8G A;  3D6F B;  2HLT A;  2XI2 A;  2D3O R;  1X0F A;  2D69 A;  4XTT A;  2LQJ A;  4U7C A;  1S1V A;  1VQ7 S;  1F5B A;  3RUB L;  2GQQ A;  5F8H A;  3PCO B;  2A18 A;  1W25 A;  1SVD A;  2KRR A;  3M2V A;  4I67 A;  3NS6 A;  4BC7 A;  1Q95 G;  2IBK A;  1D8Z A;  2Z57 B;  4ED1 A;  2CNK B;  1HWI A;  5F0W A;  4PUO A;  1TL7 A;  1N52 B;  3HVT B;  2XNQ A;  3T9N A;  1PIL A;  3AJD A;  3T3F A;  1XTZ A;  4DV4 J;  4JI6 F;  2B9W A;  3P96 A;  4NLR A;  1PJ7 A;  5F3Z A;  1R0A A;  3HSJ A;  5RUB A;  4J5O A;  4OLP A;  1D1U A;  3BPD A;  1XNQ F;  3ZTQ A;  3SDE B;  1SQG A;  4B02 A;  4N41 A;  2AHO B;  2SXL A;  3EXY A;  4MK9 A;  4ZPV R;  3MUV P;  3K5O A;  1GXT A;  3E01 B;  4F67 A;  3OTB A;  4DR2 F;  3W2V B;  1I1G A;  2XLI A;  3HSG A;  1ZTW A;  3BO4 A;  4JP8 A;  5J2N B;  4LF1 A;  1M5H A;  1RWK B;  3FGV A;  4WZM A;  4OYI A;  2Y3Y A;  2Z0G A;  1PCA A;  3MTJ A;  2YNG B;  4QW8 A;  3ZZ0 A;  1RT6 B;  4K4S A;  1I3O B;  4O3S A;  1DUR A;  4B3R J;  4J9V A;  5T14 A;  1JLF A;  3EJM A;  3DN9 A;  5KAK A;  2L41 A;  1VGY A;  5AE3 A;  2MJU A;  1WTB A;  4ETZ A;  2H4Y B;  4WTY A;  3L3C A;  1Z2Z A;  4OV1 A;  2VHG A;  2M5Y A;  2LQ8 A;  2J5A A;  3NNH A;  3DMJ A;  5J2P A;  3J7A 1;  2CVI A;  1LWF A;  4ZVQ B;  5B0A A;  3DDN A;  1BWE A;  1Q5V A;  2W8K A;  2YKA A;  4CT8 A;  3H2V E;  4NEZ A;  1D9D A;  3OTD A;  1NM2 A;  1X5T A;  4LF2 A;  4Q5V A;  4N5S A;  3AXM A;  2DO0 A;  2HZC A;  1FK9 B;  2QTW A;  3CJ8 A;  5E2Q A;  1KLM B;  2Z8Q A;  1PYT A;  4CLP A;  2JVO A;  3GLJ A;  2GHP A;  4WFZ A;  4OQJ A;  2V4J A;  3ISZ A;  4LRA A;  1WKL A;  1R89 A;  2BXJ A;  3HO1 A;  1S49 A;  5CA5 A;  1F9E B;  4LIW A;  2PEH A;  3JYT A;  1U1L A;  2ZD1 A;  3B54 A;  2LDY A;  3ENW A;  3N5B A;  1G7C B;  3KLG B;  3RRK A;  1SV5 B;  5CH7 B;  1T0T V;  4DSE A;  4UT4 A;  1LK5 A;  3SBM A;  4FYV B;  1AA1 B;  3UR3 C;  4LFC F;  5A8K B;  2LQ5 A;  1WKJ A;  1EET B;  2P9E A;  4QJV A;  1S77 D;  3WBZ A;  2G1D A;  4IG0 B;  4RUA A;  2N4C A;  1VHI A;  4DU8 A;  4B9L A;  4M63 A;  4Z7C A;  1WG5 A;  2JEG A;  4B3S J;  1JX4 A;  2G0I A;  3CXC R;  3KWM A;  4P9S A;  1VBY A;  1S97 A;  4Y2M A;  5KT6 A;  2VBY A;  4BWJ A;  3SZ2 A;  1ZAW A;  3C16 A;  1TVR A;  3CTR A;  4EBC A;  2IM2 A;  1OS5 A;  2ZNZ A;  2J9D A;  1KHW A;  4IFY B;  2FC9 A;  3VAL A;  4YEA A;  2F9J A;  4C0B A;  4F02 A;  2EKY A;  3PX6 A;  4ED0 A;  2V6A A;  3I56 S;  4UOH A;  2CQP A;  4JI0 F;  5DET A;  3KLH B;  2OH2 A;  1LWC A;  3M2U B;  2YWE A;  3OPK A;  5I4M A;  2C2Z B;  3ENA A;  4PAB A;  1KOH A;  5HMY A;  4DQI A;  4UW2 A;  3LF0 A;  2KFY A;  3BGF A;  5IOL A;  2FJD B;  4UOF A;  3GON A;  3FZ2 A;  2NPF A;  4F3O A;  3H0P A;  1L3T A;  2BX6 A;  1UTA A;  3D4J A;  4PYA A;  3QJL A;  3SSS A;  3CJK B;  2KVI A;  3MFH A;  5A8R B;  3CMA S;  4OI2 A;  1TL3 B;  5IS2 A;  5DLF A;  1WDT A;  1HKA A;  3Q86 A;  1UPM B;  4ETX A;  3TO8 A;  3EPI A;  3BKT A;  5HJX A;  3PW2 A;  3W3S A;  4N77 A;  1T95 A;  1YZ7 A;  2ZH8 A;  4CLZ A;  2XY5 A;  1U2R A;  4DL5 A;  4RWX A;  4WYW A;  4RO0 A;  4NA1 A;  3JS9 A;  2Z30 B;  1T9Y A;  4USK A;  2GQ2 A;  2AQ4 A;  2OSQ A;  2MQN A;  1S7I A;  2FGC A;  4K4Y A;  2F4V F;  5I42 A;  2R8G A;  4FZV A;  2P5V A;  4ED8 A;  4QWE A;  1Q8I A;  3SCI E;  4KO0 A;  3ILO A;  4M5G A;  3GIK A;  2BJ1 A;  4O3P A;  2VG7 A;  4MMO A;  3UQS A;  4CYU A;  1S9G B;  3JSR A;  2W4C A;  4PG4 A;  1UFL A;  2WK4 A;  5ETM A;  2RIJ A;  3MAQ A;  4RW9 A;  2M8H A;  3DRS B;  4B3M J;  1PAU B;  3VGS A;  4TY8 A;  1MMD A;  4PQU A;  4F4X A;  2HHX A;  2GIF A;  1FXR A;  1TFY A;  4B3T F;  4WCE Q;  4CQ1 A;  4P2M A;  2DY9 A;  2IA6 A;  3RYL A;  3VWS A;  2DEI A;  2ZH1 A;  3DLG A;  5U47 A;  3M6X A;  1FI4 A;  1U49 A;  3KK1 A;  3PJX A;  4ECR A;  4G1P A;  1T02 A;  3W60 A;  1S9E A;  5T7L B;  2L3M A;  5HLF B;  4X84 A;  1V5I B;  2PFF B;  4C8Z A;  3F73 A;  2C3U A;  2KYZ A;  5KFS A;  1EAR A;  2VG6 A;  2OPP B;  4P52 A;  1LWX A;  4QCL A;  1VBX A;  1S4E A;  4RNF A;  5CAB A;  2ILY A;  4PZV A;  2R4F A;  3P49 B;  3MM6 B;  3P45 B;  2NYI A;  3DHW C;  4I64 A;  3Q8S B;  3O44 A;  3C19 A;  3CDW A;  4MAK A;  4K0K F;  3SYZ A;  4KH1 B;  4NLD A;  5BR8 J;  3KXD A;  5KFT A;  1DAX A;  2VPW B;  4DCJ B;  2VDI A;  3TUJ C;  1YBA A;  1RAH B;  1HPZ A;  1VR6 A;  2QLX A;  2MEW A;  3SEO A;  1BUX A;  2MB0 B;  5CCL A;  4ZIV A;  3WDO A;  1CSJ A;  5F8N A;  2B3T B;  3NGD A;  3OSP A;  3P5B P;  1VI7 A;  5CYM A;  1JNZ B;  2HQG A;  2Q43 A;  1GMW D;  2ZH7 A;  2R2T A;  1H3D A;  3EPG A;  3GJQ B;  3ENV A;  4DX6 A;  4TU8 A;  3NWR A;  3MHY A;  2WVE A;  3IBF B;  2XYH B;  2X1F A;  1ZZF A;  2ATC B;  1L3S A;  4O44 B;  2RKI A;  3FBC A;  2O66 A;  3N6M A;  3EM1 A;  2B5J A;  1QDU B;  3FDS A;  3R7N B;  5KG7 A;  2DVI A;  3LPY A;  2FLN A;  3FRZ A;  2MYF A;  4NCB A;  3EVO A;  3G8T A;  1IM6 A;  1HBO B;  2NZ4 A;  3WQP A;  2H5E A;  4LIR A;  1BWV A;  4FPR A;  5L1J A;  2CQ3 A;  3IRX B;  4JOU A;  1UPP A;  2OPQ B;  2KO1 A;  3UDV A;  2GV1 A;  2HQC A;  2QFI A;  4ZVP B;  1U0S A;  3WHI A;  1P27 B;  4BDP A;  5DM6 Q;  2QFJ A;  1URR A;  1GXL A;  4HDG A;  4TYB A;  2F8M A;  4QPT A;  2DRD A;  1RWW B;  3W5Y A;  2QLW A;  3KMS A;  2ZBQ A;  2GHV C;  2YY3 A;  3V81 B;  1QSL A;  4NL5 A;  2FVR A;  1NJX A;  4NXN F;  4CM0 A;  4IUF A;  5L9N A;  3J80 Y;  1R8A A;  5MAO A;  2IPO B;  4OI1 A;  1RHM B;  3SDE A;  4L3N A;  4ID5 B;  2P9G A;  2IIH A; 
#chains in the Genus database with same CATH homology
 4UOH A;  1HLW A;  1XQI A;  4AND A;  3Q83 A;  3VGV A;  5CAB A;  3L7U A;  1HIY A;  3DDI A;  1NCL A;  3FBF A;  3B54 A;  4C6A A;  3Q8Y A;  3FCW A;  3DKD A;  1KDN A;  3ENA A;  1W7W A;  3EJM A;  3Q8V A;  1MN9 A;  1XIQ A;  1NDP A;  1MN7 A;  1NDL A;  3ELH A;  5CAA A;  3VVT A;  3EVO A;  3FBB A;  1HHQ A;  2CWK A;  5IOL A;  2HVE A;  1VYA A;  4UOF A;  1NDK A;  4W98 A;  2B8Q A;  3BBF A;  3BBC A;  1UCN A;  3FC9 A;  2ZUA A;  1ZS6 A;  3B6B A;  3FBE A;  1WKJ A;  3ZTO A;  3Q8U A;  4ANE A;  2BX6 A;  3NGU A;  1BUX A;  3ETM A;  4F36 A;  1NDC A;  4FKY A;  1F6T A;  3VGS A;  1NHK L;  3G2X A;  4DUT A;  3ZTS A;  1NPK A;  3BH7 B;  1S59 A;  3EVW A;  4CP5 A;  3EE3 A;  1S57 A;  2DXD A;  4WBF A;  2HUR A;  4ANC A;  2HVD A;  2DXE A;  3GPA A;  4EK2 A;  1K44 A;  1BE4 A;  3Q86 A;  3BBB A;  1NSQ A;  1WKK A;  1F3F A;  2AZ3 A;  2AZ1 A;  3VGT A;  3PRV A;  1PAE X;  1S5Z A;  3GP9 A;  3PJ9 A;  3ZTQ A;  3R9L A;  2BEF A;  2DY9 A;  1NB2 A;  3ZTP A;  4DI6 A;  4O0N A;  5C7P A;  1EHW A;  2B8P A;  4UOG A;  3EVM A;  3MPD A;  4F4A A;  5BXI A;  3NGT A;  1PKU A;  3Q89 A;  3NGS A;  1NUE A;  2DYA A;  3JS9 A;  3EMT A;  3NGR A;  4KPC A;  1B99 A;  3WX8 A;  3VGU A;  4ENO A;  1BHN A;  2VU5 A;  2DXF A;  4S0M A;  1U8W A;  3ZTR A;  4HR2 A;  3FKB A;  1NLK L;  1B4S A;  3EIC A;  1JXV A;  1LEO A;  1NSP A;  4FKX A;  3FBC A;  3VVU A;  1WKL A;  1NSK L;  3EM1 A;  1LWX A;  2NCK L;  4DZ6 A;  3FCV A;  3BH6 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...