2HURA

Escherichia coli nucleoside diphosphate kinase
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
142
structure length
142
Chain Sequence
AIERTFSIIKPNAVAKNVIGNIFARFEAAGFKIVGTKMLHLTVEQARGFYAEHDGKPFFDGLVEFMTSGPIVVSVLEGENAVQRHRDLLGATNPANALAGTLRADYADSLTENGTHGSDSVESAAREIAYFFGEGEVCPRTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of the Escherichia coli nucleoside diphosphate kinase reveals a new quaternary architecture for this enzyme family
pubmed doi rcsb
source organism Escherichia coli
molecule tags Signaling protein,transferase
molecule keywords NUCLEOSIDE DIPHOSPHATE KINASE
total genus 42
structure length 142
sequence length 142
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2006-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 2hurA00
1NPKA 1XIQA 3Q8YA 1W7WA 4ANEA 1NSQA 2DYAA 4CP5A 4F4AA 4KPCA 1K44A 3ZTPA 4DUTA 1UCNA 1HLWA 3R9LA 4UOGA 4ENOA 3DKDA 4UOHA 1WKJA 4W98A 3ZTOA 4FKXA 1NCLA 2DXFA 3EVWA 3FKBA 3GPAA 3VVTA 3EICA 4HR2A 1KDNA 1MN7A 1F3FA 1BE4A 2DXDA 1NDKA 3FCVA 4F36A 4DI6A 2HVDA 3BH6B 3ZTRA 1LEOA 2AZ3A 3EJMA 2AZ1A 4WBFA 1NDLA 1NUEA 1B4SA 3ZTSA 4C6AA 3FBEA 3JS9A 2DY9A 1NB2A 1S5ZA 3FC9A 4ANDA 3ETMA 2HVEA 3PJ9A 3BBFA 3BH7B 3DDIA 3G2XA 3FBFA 5IOLA 1XQIA 3Q8VA 4UOFA 1ZS6A 3B54A 1WKLA 1S59A 2CWKA 2HURA 2ZUAA 3EM1A 3VVUA 3WX8A 2BX6A 1U8WA 1MN9A 3ZTQA 2VU5A 1NLKL 2B8QA 1BHNA 3L7UA 4DZ6A 3GP9A 1S57A 3Q86A 5BXIA 5CAAA 1NHKL 2BEFA 1BUXA 1B99A 1JXVA 1NSPA 1WKKA 1LWXA 3NGUA 3VGUA 3Q8UA 3EE3A 3BBCA 3PRVA 3BBBA 1NDCA 3NGTA 3FBCA 3FCWA 3ELHA 3VGTA 1NSKL 4O0NA 1EHWA 2NCKL 1F6TA 3MPDA 3Q89A 3EMTA 3EVOA 1VYAA 3EVMA 3FBBA 3Q83A 1HIYA 4S0MA 1PKUA 3VGSA 4EK2A 4ANCA 3B6BA 1NDPA 2B8PA 3NGSA 5CABA 1PAEX 3VGVA 1HHQA 4FKYA 3ENAA 2DXEA 3NGRA 5C7PA
chains in the Genus database with same CATH superfamily
1NPKA 2W7PA 3W8PA 4F04B 1RT2B 2C2MB 4B3RJ 3M1VB 2DNYA 4RW9B 4XDCA 1CEZA 1P6TA 5I3QA 4X4UA 1FWPA 2D3ZA 2XMTA 3D3CJ 4KGVB 4KHRA 5K8NA 2MGZA 1O0PA 3H5XA 2QG9B 3K0JA 2BM1A 1K1QA 2CQ4A 3MR2A 4J9OA 3GIIA 5D3GB 2PSZA 4Y3CA 1Q81T 5HLFB 1QM9A 3C15A 4XPEA 5B0DA 2B9EA 2C2NA 5KFCA 2EFPA 3KLEB 4DXLA 3C16B 3CD7A 4J37A 2BJ9A 4CO0A 3P6YC 3KDOA 4BWJA 3J7ZT 1R3NA 1UJ4A 1EQMA 1RSCA 2H5EA 3B82A 3K5MA 1SKRA 4HHHA 2KFNA 4IDKB 1C1CB 3QIPB 1N33F 2A1BA 2HVDA 4CZCA 3IS9B 1LEOA 1KSPA 3PZPA 1FT8A 2CZ4A 4DU8A 5AE1A 1Y5NB 3HHLB 4HHJA 3HX9A 2CPYA 3V81B 4LF9J 4KHPJ 1AZSA 2GMHA 4DV1F 4O4GA 1B4SA 4U96A 5B0FA 1RLDA 4QYZK 1Z2ZA 3MM6A 1TFYA 1A7GE 1AA1B 5DZ6A 2IPOB 2LEAA 2ZOGA 3D6HB 1KOOA 5FIIA 4F3MA 5I3UB 4NASA 3EPIA 1KP6A 2W1BA 1FWKA 1RHUB 2IYIA 3DDIA 2OPSA 2QRRA 3H7HB 1X7VA 3CIMA 4JB8B 4CO5A 3GV7B 2GX8A 2MXYA 1C0TB 2RDIA 4P2SA 4OYXA 4ECVA 5G0RA 4WF9Q 2YVSA 4CO3A 4FDFA 5EWEA 3R3TA 3AODA 4G1PA 4YR0A 2A0FB 4FS1A 4KRWA 2L48A 4OZ3A 4QOTA 2QL9B 1NJWA 2MPUA 2BXJA 2IY5B 2E5IA 2E44A 4ILRA 4N77A 2FJXA 2H4YB 3T3FA 2CXEA 2J76E 1T05B 4JI8J 1LFWA 2CJ9A 4OZ1A 2PI5A 5L8RC 2BQ3A 4X2BA 5D4OA 2OEMA 1FTRA 1OIAA 1D8ZA 4X4SA 2DRDA 1K47A 3LP1A 1F9HA 2EPIA 4B9LA 1YBAA 3OFGA 2LLZA 5K14B 2OTJS 1S1UB 3TZXA 2HS0A 5KFKA 3E01B 2GQ2A 3LAKA 2KYZA 1Q7LB 3KKFA 3AQOA 3KK1B 1HPZB 2GAHC 1O6XA 4ED3A 3NRBA 4J9UE 2HFVA 1HNWJ 2LXIA 4NLVA 2Q3PA 3HCXA 2GQQA 4ZKAA 4PG5A 5C5JA 3VGTA 3V6DB 1JMTA 5KFHA 3M8ZA 1U4BA 1LWCA 3IR5B 4XTTA 1XNRF 2W2MP 3UDVA 3A1YG 2FY1A 1VYAA 1GXUA 1T94A 4WZMA 1GK8A 4U8VA 5IT9U 2RQCA 1J5OB 2R7TA 2KI2A 3QRQA 1YSJA 1F9FA 2IAJA 5A0YA 4PEOA 3UVJA 5J1EB 1KQSR 4DR1J 2BQRA 2UVRA 4GKKF 1NDPA 4TN2A 1ZPWX 2NSCA 2V2ZA 2FVPA 3KUHA 2I1RA 4RNOA 3ENVA 4J9KA 4EGLA 4MTPA 3Q2TC 1V3ZA 2OPQB 1WI8A 3IWXA 4RW8B 3M30A 4QQBA 5H1SV 2ZH6A 1M5PC 3NGSA 2W2OP 3GJRB 1ZPVA 4ID8A 1N6QB 3A8KA 1NPRA 3QJLA 3O5TB 3LUYA 2GJFA 1XIQA 1TVRA 4A8OA 4JI7J 2B9XA 1YJWS 2CFXA 4FYVB 3TEGA 2RU3A 3OV7A 2GZOA 4FYDA 4DR7J 1VBYA 1SH0A 1NB7A 4ELVA 2GVDA 1CBKA 2ILZA 2KFYA 2IA0A 1UFWA 2N4DA 2AYMA 4IG3B 1CJTA 4TY8B 4HLBA 2XQCA 4DV6J 1BWEA 3NCPA 3CTRA 2V6AA 4IFYB 3DU6A 3ET6A 2VQEF 2UUAJ 1SI9A 4L75A 4IR9A 3KHHA 1KD1T 2E5HA 4GC6A 3GYNA 3VVTA 1C1BB 5E33A 2EW9A 3C14B 2HS4A 1WACA 3O2IA 1RT4A 3FJ2A 1ULRA 3BGUA 2UV8A 1PC5A 1X5SA 2GVZB 2JJ4D 4H4KA 4OZJA 1PBUA 1IXKA 1VIXA 2KYXA 2VFSA 4RNHA 3VQTA 5B0BA 2VG6A 2VPXB 1QTMA 4NRTA 4DFMA 5ETPA 3UDEA 3D6MB 1X4FA 1IBKJ 3G71S 4EZ9A 2R7UA 2ZBRA 4JI6F 1RTIB 3DGPB 1S1UA 4C7QA 3EDRB 5HVHA 2VC1A 1FJGJ 1EETB 4ITSA 4CLFA 3TW0A 2V4RA 2DK2A 4ICLA 2MYFA 3JS9A 1QAIA 3D9BA 1TR0A 5L1KA 2QZ8A 3W5YA 1LK5A 4CI0B 3OVSA 2AJQA 2WRMA 1WDTA 3F44A 5C2GA 4AQYJ 5A2QU 1A6LA 3AD9C 3I5BA 2UXBF 4ATNA 1H38A 2XULA 2MZTA 4WK1A 3T5JA 4CLZA 1F3VA 5L1LA 3B54A 1SV5A 4IFVB 2Z4PA 2O67A 1S7IA 2BE2B 3M7VA 4A8SA 1SUQB 3UD3P 1FX4A 3UR3C 4NCBA 4TVAB 2R8KA 4F50A 4P9SA 2V8DA 3DRXA 2XY7A 1UVLA 4YHHJ 2C2OB 4DSKA 1S9GB 2J9CA 3FEYB 1QVGR 4JI1J 1UVNA 4LF7F 1ELOA 5BXIA 2RRNA 2IJFA 2OFGX 2J8SA 4QJVA 1VDHA 3NL0A 2BEFA 2O1PA 2D3OR 1D9AA 2RRBA 3QMQA 1VOMA 3CCRS 2VONA 3KHLA 2W25A 3C2PA 5DGAA 2VODA 2J9DA 2KKHA 4J91A 3WQPA 2HZVA 3EGZA 4ED1A 1B7FA 3IAM9 3BDPA 4LIRA 2YQ1A 4DL5A 4ECRA 2MKHA 2E1RA 1UW4A 3WIVA 3GFYA 4DR3J 2NZ4A 3CCLS 1LK7A 3IWNC 2H48B 3FBCA 2QGFB 3GIMA 2BOAA 2AX0A 9ATCB 1W25A 4EEYA 2RDDA 4LT6A 3AHPA 5M2UA 1FRKA 1BD6A 1RGVA 1SJQA 4CH7A 1YG0A 2WB1D 1ZTWA 4NA2A 1AYEA 2W9BB 2HHWA 3EVOA 3VAGA 1S1XB 3ZZOA 3TVZA 3EXCX 4X4RA 3WC2A 2HRUA 2XYPB 2G1HA 5LM7E 1E6YA 2HBQB 1X5TA 2XSFA 3N6LA 3PXGa 1A9NB 2PEHA 1HIYA 2EVZA 1U25A 1QTNB 2CG4A 2BACA 3B8HA 5HANA 3TYTA 4K7QA 2HBZB 3VAHA 1U1KA 1RWPB 5KFXA 2FLLA 3BV8A 2BRLA 4P72A 3CCJS 3CD0A 1VQPS 1RTDA 3M1VA 1U1QA 4QCLA 2GVZA 1U02A 1JX4A 2VBYA 2QLXA 3PW4A 3G87A 1X9SA 2HG4A 2ZM6J 1HNVA 3MM7B 1PAEX 2BM0A 2HEKA 5CZVA 4ED5A 2D9PA 1T11A 2FJDB 2N3OA 1FXLA 3NGKA 5KT4A 2BE9B 4OYPA 2RRAA 4C8OA 2FC9A 2AJ1A 1DQ8A 5CH7B 3Q8YA 2KFZA 2XHCA 3BQ2A 1VISA 4ICLB 1OJ4A 2ABYA 2LA6A 3M6WA 4RBTA 1BGXT 3SBMA 3SV3A 2HYIB 2BKPA 4K4WA 1S10A 1N5YB 4CP5A 5KOWA 3G8QA 4YUDA 3TANA 2E1MC 3KLGA 2CVIA 2KM8C 3HHNB 1F5BA 4DSIA 4WWSA 4ZPWR 3I32A 3MMAB 1SCJB 4QIFA 3TP2A 5F9LA 3A4TA 1DLOB 1XMBA 3JSMA 5I42B 3CC4S 3RW6A 2M88A 4J9VA 2KHCA 1O5JA 4DL4A 2ROEA 5J2NA 1JJ4A 2HWHA 4ZP6A 4Z7YA 5E3RA 2BE2A 4F67A 3ITHA 4L3NA 3ZZUA 3QFHA 2UXDJ 3H59A 4M5HA 2BKOA 1R27B 2B0GA 2QMUB 2FVRA 4WFNQ 1VQ4S 3G8SA 3HDSA 4I68A 3AXKA 2OAUA 4CO4A 4DPYA 3ZXWA 2KN4A 4URGA 3TUZC 3Q24A 2AU0A 1NJXA 1F3FA 2HVHA 3EZUA 2OD4A 1FDDA 3DOKA 4UF4A 4ZPVR 4EFAC 3LF0A 2HZCA 3CCTA 3CJQA 2JFDA 4ZPAA 5KFNA 1HMVB 5A8WB 1PC4A 2I8EA 3GJTB 3FFIB 3M05A 2IMWP 1NH8A 3IO1A 3CCES 1FKPB 3A8JA 4M5IA 4NX9A 4ETZA 2M2BA 2YH0A 4FNHA 2DNPA 4B9VA 5T41A 1FD2A 2YNHA 2H3EB 3DFEA 3I9ZA 3RAMA 1T03B 3N6NA 1QSSA 1VQKS 3RAQA 4N56A 5H9EJ 2HS3A 4F7VA 2B7BB 1N8RT 1T95A 2CJKA 2R7WA 1B0VA 1GMUA 1OQ6A 3DOLB 2NSBA 5F3ZA 2MKIA 2KM8B 4M5MA 5CYMA 2V4JA 5J2QA 4DF4A 2AQ4A 2JSXA 4C98A 1HA1A 3FSXA 3UCUP 2FHJA 2XY5A 1IBLF 2OGUA 1Z4UA 3EM1A 1E6YB 2IHR1 2P8IA 1Z2LA 3IFEA 3MCSA 3VTIA 1RA7A 1IWAA 3LAMA 5DDPC 1IBCB 3IRXB 2GHPA 5K14A 2J6SA 2FLPA 3ENQA 5DJBA 4X4OA 3W65A 4GMKA 4DF8A 1FJEB 3LO3A 5HVFA 3L4BC 4MJKA 2M8HA 4YB7A 5EUHA 3LPEA 2ZJRQ 2LQJA 1HPZA 2NYIA 1RAJA 3AD8C 1JLEB 3GB0A 3OTEA 4CM0A 1S48A 1OQ3A 2OD6A 4WJBA 5HLFA 2DVIA 1LW0A 4RW4A 4OI1A 4Z2XA 4DS4A 3T1YF 3J7A1 1RWWB 2JLGA 1XK8A 1I1GA 2XEXA 3JTOA 4K5SA 1IKWA 2F3JA 3AA9A 4NLQA 2XMWA 1JLFB 4IH5A 2CZVC 1URRA 2HWIA 1N5YA 1VR6A 5HL7Q 4DEZA 4ILLA 3TAQA 4QU6A 4L6V3 4E8UA 4KT0C 3MUTP 1EHWA 1YITS 2XZWA 3I4PA 2CQHA 3MM8A 2QE5A 1NAQA 2O3DA 4GO5X 3CCZA 1OO0B 4ECTA 1R8AA 3K8WA 4QW8A 1JLQA 2N7CA 1UEUA 2A2DA 3KYLA 4OX8A 2C3OA 1OPIA 2DNGA 4LSLA 1N6QA 4N7TA 1VRQC 3Q8QB 2F65A 3GV5B 2ZE2B 3PO4A 5E0OA 3EZOA 1W2IA 2ZH5A 3BO2A 1RT5B 4F26A 1H7XA 1X0FA 3HI9A 5KG0A 3IGNA 2BMBA 2GGPA 4H4MA 1YRUA 2F9DA 4L76A 4I6YA 5D0HA 3RBXA 3NMAA 2MSTA 5A8KA 3L3CA 3BKTA 1S6PB 2Z56B 3QBCA 4DCPB 3IM9A 5KTQA 3K5LA 3BN7A 5KFBA 1N88A 2QT7A 2SXLA 3FFIA 3FZ2A 3W7BA 3MEGB 4JYAF 4QIEA 4DV6F 3SDEA 3BO4A 1HI0P 4UY8T 1VCTA 1S1VA 3AB2B 3R2DJ 3TAPA 1SC3B 1SL1A 3MEEB 1KR4A 5L46A 4M5LA 5F8IA 4DUTA 5HVGA 2V2VA 5C25B 3TUPA 4NXNJ 4H54A 4ZS6A 2NXNA 1KEKA 3G6VA 4U95A 2V4JB 1TQLA 2WVCA 3DOMB 3M8QA 5DQHA 2DPJA 5K5MA 4P73A 1XC9A 4F0MA 2DIUA 4DV4J 4X66J 3ZTOA 3M2UB 2RSQA 2VPZB 4I2PB 4QW9A 4W90B 1JXLA 3OHBA 1M1KT 4OJ1A 1RTIA 1RHJB 3OJUA 1B0PA 2YTCA 4EYHB 5ETKA 4JV1A 4QWDA 2MLZA 2PI4A 5F8NA 5DRKA 3FSIA 3A12A 3RRKA 2JLEA 2FZKB 2HFSA 3D0GE 3W2WB 2F7VA 4PYAA 3AY0A 3W5XA 3G96A 1HR0J 2MJNA 1KVIA 1CULB 1RYRA 4Y2MA 4LR7A 4ZLNA 1VQNS 1NDLA 3KG0A 1NUEA 1IBMF 4YMEA 1NRKA 2UXBJ 4K4TA 4KY3A 5HJYA 1FRMA 5D6GA 4DS5A 1U49A 4ZVTB 3A8EA 4ETXA 2CDRB 1XR7A 2IVMA 5M2PA 1SH2A 3TVKA 2WVBA 2DGOA 4B3SJ 3I82A 1V5VA 4ZVUB 2YNIB 1S9EB 2R2SA 1ZYQA 3SMZA 3DGVA 4C9DA 4UUXA 4GRSA 3M2RA 2B6AB 2FJBB 2HKEA 4DLEA 1TL3A 2L3MA 1WC3A 3FSYA 4I7FB 3JSBA 2E7VA 4AL7A 1FNXH 4F3QA 1RI7A 1FE0A 1K8AT 4LF6J 2YNFB 4KC5A 4J9NA 2HURA 3BYPA 2WSCC 3KNAA 3RBDA 2MLXA 1OYEA 1WG1A 5CYQB 4CO1A 4B3TF 1FXDA 1MN9A 3GCXP 5D15A 1P8GA 3KK2A 1B64A 4W4MA 2HLUA 2GVDB 5GAEI 1X4HA 2LKZA 3L7PA 4LFAF 4KE5A 3IC1A 3TUIC 2IM0A 3PYDA 4I1TA 3NS7B 2GGPB 4FN5A 4H4MB 3W5ZA 2J8AA 5K8MA 2JEIA 3TWZA 2V8VA 4N76A 4JI3J 2AGPA 2FJEB 1HNIA 2B3TB 2E66A 1RAEB 1XERA 4ED2A 3CWJA 4C97A 3HM9A 3PRVA 3V5RA 3MEGA 3C14A 3ZNUA 1IJFB 1MWZA 4TYAA 4R0JA 1RDRA 4LF8J 5BYSA 2VG6B 2OEKA 4ES3A 2HNZA 1JLGA 3OTOF 2ZEJA 1VBZA 1RBOB 1VJWA 3GIKA 4EBDA 4ZDNA 4C11B 3HP6A 1W2BR 4URSA 1TK8A 4YY3F 2HHSA 4ANCA 2RH3A 1WOPA 2E5LJ 4JV5J 4ZN3A 2YWGA 3PFEA 1LV5A 2GNKA 4ALZA 4C0BA 2PMHA 4KGZB 1N36J 2UVUA 1MW7A 1JLAB 3CD6S 3QPIA 1VMBA 5E2QA 3M8RA 4AE5A 1XMOJ 5DDRC 3N9UC 4UW2A 3D5MA 5KT5A 4P75A 5A6WA 1HWIA 5CZXA 5DQIA 4FKYA 3UD4P 3PX0A 3RU0A 2DR6A 3CCSS 1VQ9S 4B9UA 4V19J 2XWYA 2EXUA 2X51A 1DLOA 1FK9A 4O23A 4DG1A 2XO6A 5DG7A 5U47A 2IBKA 4FBUA 2OELA 3IRWP 2V50A 4OI0A 2B4OA 2PFFB 1FX2A 3THPA 1KN6A 1LXJA 2I38A 1HD0A 1TAQA 2BKNA 4PKDB 1BXNA 3U7JA 1K44A 1NPPA 2XMUA 4HL9A 4AXIA 1KFSA 1Y4ZB 1FFSB 1UWBA 3PJXA 4FVCA 2EKYA 2UXDF 2HAIA 2W24A 3R7NB 2HHHJ 1HLWA 1IKYA 2DH9A 2Q6BA 2U1AA 5E41A 5KFJA 3G6XA 3W9JA 1NHUA 4DFPA 1HQUB 1PBAA 2YNFA 3D6FB 2Y0BB 4NZ0A 4RO0A 2X1AA 4KB7A 4NWBA 2Y1LB 1FFWB 3CCUS 4K4XA 5H9EK 1U1PA 1YJUA 2IIHA 1V9OA 3M8PB 2OH2A 4ECQA 1YK9A 5JVGQ 3PW2A 2AYGA 3CJSA 5F8LA 3KXDA 1TUWA 3HHLC 1KQKA 4JI2F 3T6BA 4Y34A 4WIIA 4ZPDA 4MK7A 4QZVB 4RW6A 4NYZA 2OEJA 1NXIA 3H25A 3NS5A 4RUAA 2NUUG 4RW9A 4DR2J 2RHQB 1YRTA 2VBWA 3SCJE 4NZ6A 1YX2A 3AOBA 3W3SA 3OLBA 4IOCQ 3UR0A 4LRCA 3ETMA 4BC7A 4HDHA 2XLJA 5J2PA 2ZJQQ 3DMJB 4DN0A 2L08A 4ZHRB 3KNGA 3PYGA 4CRJA 3ZNJ1 1JLGB 1NU4A 2EEYA 4UOFA 3KLEA 2JZ5A 4M94A 4NLDA 3Q8PB 3DDKA 2XMAA 3ENWA 3LWMA 2ACMA 4C11A 1VLOA 1VC0A 3NY0A 1REVB 2KRBA 2AJ2A 4NLWA 3T1HJ 1VIOA 2AYBA 1ZAXA 4IH7A 4ECSA 1FF2A 1YVFA 1JLCA 3AJ1A 4HI2A 4JOUA 4WU3A 2M70A 3BSNA 4DV5F 4IOAQ 4C8MA 3H2VE 2MMYA 3T1YJ 2XLIA 3QT7A 2YKMA 4WXWA 3GTYX 1AB8A 2CA9A 4TQRA 1ZM4A 2KL8A 4RBVA 3CDWA 3MM9B 1ZZFA 2HK2A 5T7LB 4PG7A 4ZPBA 2AWZA 2C3UA 5KG1A 4DCOB 2OJ3A 1LWXA 3PACA 1E6VB 2AD9A 2XLKA 5HJXA 3NAIA 2X3DA 3MM5B 3QJJA 1ZH5A 5HP1B 2VH7A 1U26A 1EQ0A 5IT9Y 1CJUB 3GFXA 2RUSA 4TXSA 3VAKA 3CJ0A 2JL9A 2QN6B 1IUJA 3TX0A 1IKVA 3EZ5A 2RAQA 3DHWC 2KRRA 5G0RB 2N3LA 5A6PA 3CF5Q 1S99A 1EZZB 3HHDA 1HYSA 2JFKA 2YPZA 2ZE2A 3CJ3A 2HZAA 2DNMA 4DX7A 2PO4A 1RYSA 1TMMA 4PR6A 4CO2A 4DV7F 4O0IA 1UVJA 2KO1A 3M8PA 1P9QC 3MOZA 2UU9F 4DV2J 3DU5A 2QLJB 3UNYA 2ATCB 4QR0A 4P7VA 4D3HA 2AX1A 2K7JA 4YOEA 2ACYA 2AYEA 2ZHAA 1RLCL 4LR9A 1NK4A 4K5RA 2AT1B 1RT4B 2DNLA 3CD5A 4Q0BB 1C0UA 1IWGA 1GMVA 4C48A 2QFIA 2FJVA 3GG1A 1SXLA 4JI5J 5C7PA 1IM6A 3MPWA 3HJVA 2MQNA 4LF4F 1RBLA 2W9CA 2K2PA 1OY9A 2FZCB 2ZKTA 2JWNA 4WKYA 4NXNF 3ZZ0A 2CPEA 2EG2A 1RJJA 1F9EB 1GX5A 3AD7C 1HBUB 2DNNA 2IRYA 5IFMA 3CW2C 3CPWR 5ETRA 2HQDA 5J2PB 3QWUA 2MZQA 2JVRA 4HH1A 2Z57B 2ASDA 5DGBA 2FHJD 2OFHX 2CNOB 2CPDA 2XG8A 5D0GA 4ED4A 1UCNA 1HI8A 2H51B 1I94J 1YBUA 1FFGB 2FLNA 5IV4A 3QLHA 4UOHA 2W9AA 1YIJS 4IOBA 1OPZA 1BWVA 4YQWA 3QWPA 3H4BA 4DL3A 4IRCA 1HARA 4UTGA 3J7YU 2DXFA 4GKJJ 2MY7A 3EVWA 1SKUB 2JRSA 2BW7A 3DRPB 3ILLA 3PCOB 4M5GA 3MR6A 2E5JA 4PZVA 1BMQB 2ALYB 5CQGA 3GIJA 3M30B 1IBMJ 2GIRA 4FPRA 4A47A 1XWLA 4E0DA 3PYFA 2V2KA 5KFPA 2VJVA 1N5SA 3PKYA 2QA4G 1XMQF 4LF5F 2XM3A 1IKXA 3CCWA 2AZ3A 3CMQA 3HK2A 3QNWB 1SIWB 2EK1A 2UP1A 4B3SF 5HK4A 4OMFG 2CQ0A 2DR9A 2FY8A 4USWA 1HBNB 3AT1B 5GAEU 2XCPA 4IG0B 5HP1A 4C6AA 2IC3A 3PVXA 3CUNA 2UUCJ 2IRUA 3HF5A 2CQDA 4ANDA 2OPPA 2LEPA 3GILA 1PYOB 2PEBA 3HHLD 1WC4A 1MSWD 1R6YA 2CPIA 4B3TJ 4ECUA 5FDLA 4DPOA 5CXTA 2JH3A 4AUKA 1OMSA 1C4CA 1RWNB 2BE7D 2RKIB 4R8UB 1S49A 3F0NA 2ZZNA 4ZIVA 3MAQA 4J9QA 1H0HB 4WP3A 3T5KA 4LFAJ 1YJTA 1PGZA 1F2GA 2POKA 1JJHA 1M5HA 2V9WA 4DL6A 3FRYA 2AIRB 1AT1B 4MKAA 4DV0F 1KC8T 1N0UA 3I31A 3ZTQA 2VU5A 2R3VA 2DNKA 1UFKA 2PFDA 1D1UA 2B8QA 5IS2A 4CLSA 3QQCD 2G2ZA 2V68A 2G2OA 4ZP7A 4QPXA 3FNNA 3A3NB 3ISZA 4WYWA 5F8HA 1TL5A 1HWLA 2P6SA 4NCGA 5K8PA 2Q66A 1DAXA 4KJIA 3I4HX 4F4YA 3E3XA 2WB4A 5DLGA 1FHTA 2KTQA 1F1BB 1NZAA 5AXKA 3GLJA 1TKTB 1RTJB 1FTCA 3MM7A 4AYBD 4B3MJ 4IRDA 4LF8F 4K0KF 5D8HB 1FCAA 3BGFA 3GU0A 4H4OA 5EWFA 3OTOJ 4DJBA 5I4MA 1U2RA 3KLVA 1XN9A 3PM9A 2EI5A 2Y0SD 3SSRA 4CH0S 3OW2R 4G3IA 2BJDA 2FHMA 2JNJA 3HHEA 1J5EJ 2PE8A 2YX4A 1RT6B 2PGCA 4L73A 4USHA 1SUQA 4RNNA 5BJRA 3KHRA 4LSZB 4CLLA 3J81U 3C8YA 3K57A 2X1GA 3TJ8A 5AE2A 1AZSB 1OYDA 2H65B 4S0MA 1JK9B 5F9NA 4WPAA 2J0XA 4K50A 2J7UA 1EP4A 3M2VB 2IDEA 3B6BA 2AV5A 1ZAWA 3KFWX 3N0VA 4DZDA 5E3PA 2DRBA 3M8SA 5GVQA 2GAGC 2HGNA 1R8BA 2GQCA 2LU2A 3OFEA 3MAHA 3M8YA 4RWWA 1C0TA 2RU9A 1PJ6A 3MGJA 1CVJA 2OLWA 4OHXA 1VC6A 3DLBA 4DR4F 2R4FA 5IV3A 1DFDA 3CEDA 4ED0A 4OHWA 2XMMA 2IVFB 2R8IA 3DLJA 2LFVA 4KAIA 2DYAA 2GO8A 1UPPA 2HWTA 4G1QB 2H9ZA 4ECWA 1LNQA 3MWBA 1RAGB 3H42A 4UOCA 5JXSA 2YNHB 3D1HA 3O6QA 4R5PA 1U6BA 3MPUB 2YQ3A 4Q7AA 1TTHB 1APSA 3IMQJ 4DFKA 5HN0A 2CPXA 2RKIA 1K9MT 3HJFA 4ZK7M 1T9XA 3MPVA 3RR8A 1L3VA 4JI2J 2YPYA 4NLSA 1YBTA 1WKJA 1VRUB 3G4SS 1UVMA 3JQJA 4WE1A 3FMBA 5KFOA 4ZPTR 1AUDA 3MECB 3OSNA 1WSRA 1V6HA 4CLKA 2P9CA 5AE3A 1S0MA 1KDNA 4DR2F 1RACB 3U02A 3DLEB 2EC2A 4B08A 4DWIA 1MU2A 4LFBJ 2DXDA 3FCVA 4X66F 1N34J 4NCGB 4YN3B 1KFDA 3HFKA 2YWKA 1PAUB 3A3OB 2XZDB 3C16A 3EJMA 1HW9A 1RK8A 4F0KA 2KT3A 5A76A 2XB2D 2E7WA 4QYRA 1M90T 3CSKA 3BO3A 1S6QA 3K5OA 1YJ9S 3SFUA 1AFIA 3FBEA 2RD5C 3TR5A 4YP3A 3MI7X 1WUUA 1MWQA 2MQ8A 5GMDA 3JTPA 5ETMA 1L3KA 1GX6A 1WOSA 1XQIA 5LMUF 1HBMA 2OPQA 5MLCV 5GAGU 3WIUA 1H7WA 1F0XA 2E1AA 4TU8A 3KWMA 1KHWA 1HWKA 2DD8S 3MM8B 3N28A 3J80U 3V4IA 3LP0A 3IBCB 7FD1A 4C8KA 3QJPA 1D8YA 2FYXA 1MMNA 2KJVA 3MD1A 2MZJA 1JNZB 3W64A 4RLEA 3QRPA 5J1NA 1P27B 1NK5A 4RWXA 2LEBA 1MNEA 3S7RA 3L7UA 1VK8A 2AEJA 1T7PA 1UWBB 2GHWA 3M6UA 3ULHA 1S79A 1DJ0A 1NHKL 1IKYB 2RQ4A 3FGVA 3IP0A 4ZJLA 3R2CJ 5HI7A 2FDNA 4TU7A 4N47A 2XTJP 1RKIA 4KIAA 4A8YA 4LFBF 2G0IA 3U1NA 2G13A 1TKZA 4IR1A 4Y28C 2XMKA 2V5HG 5A8RB 3MR7A 1KRPA 3BBCA 2VG5A 5C24B 2YKOA 8AT1B 3EPGA 2CQPA 1KHVA 1VQOS 4JBCA 1BY9A 3MAAB 3TAMB 4EI2A 2R8JA 3DOLA 2PIIA 3OL7A 3RUBL 1NEEA 1X9WA 5DO2A 3H8YA 3JTNA 2DNHA 1RT3A 2KT5A 3F56A 3ILIA 2A6MA 2QLFB 2MEWA 1LKZA 4OYOA 2WTFA 4WZQA 1S1TA 3MEKA 2ZH1A 2PT0A 1R6VA 3OVAA 1GEHA 4DQSA 4B9NA 4A8QA 2C28A 4KKOB 2RMLA 3FK4A 1B7YB 1H6KX 2FB0A 2ILYA 4Y0FA 4XIUA 3H4DA 1M1HA 4ZLLA 3VGSA 3MUMP 1NK8A 3QGIA 1FRJA 1XJWB 2HFOA 4OX9F 4DMZA 4C2MA 3V6DA 4NA3A 4PPDA 5D78A 2AGQA 1HNZF 4JI4F 3WX4A 2ZBPA 4ZHRA 3MHYA 2DO4A 2CQ1A 1AROP 3TJAA 1SKSA 1N5VA 4BS2A 1RP5A 2DO0A 2WK4A 4RW4B 1LXNA 3W8GA 1FD8A 3OJSA 1AW0A 1YDLA 1IN0A 1HQ2A 1BQXA 2DXEA 4OHZA 2QYGA 1CULA 5L39A 5KT3A 4B9MA 1REVA 3GZ7A 3R6GB 4ZVPB 1H98A 1GXLA 1U2FA 1FKOA 2F40A 2YKAA 1VQ6S 4X84A 2RHSB 1I94F 1NSQA 1CQNA 1G1XA 2VKRA 1S0OA 2HPUA 4ZVGA 1N33J 1XEZA 1RXOB 3BDEA 2CAJA 3DRPA 2HMIB 2YWEA 1HBMB 3G6YA 1NK7A 2VOPA 2XMVA 2VFVA 2ZC3A 2APOA 3FUYA 3GJQB 1BQNB 4PQAA 1KLMA 2H1YA 1HHSA 3BPDA 4I7FA 3V4IB 3V81A 2P9EA 5THWA 3C6UB 4WFXA 4QWBA 1Y9OA 3KLFB 4PUOA 1TMJA 2KZMA 1XMQJ 4LF5J 3QFWA 4MKBA 4N8NA 1Q79A 2OI2A 3CJ8A 3JYTA 4LUBA 4WFZA 1ZM2A 1QDUB 4IG0A 1D3WA 4U7UD 4DR5J 3SSSA 2ZH7A 1NDKA 1YKWA 4RBUA 1DTQA 4RX6A 1X4GA 3BR8A 2QIFA 1FRHA 2FIUA 3O3LA 4NLPA 4DI6A 4RUHA 5A2QY 3GG0A 1JJ2R 3GR0A 5ETQA 4OFZA 1S1XA 3V6KA 5F8GA 1QAXA 7AT1B 3N6MA 3ZTSA 5DG8A 2E7XA 5KFIA 3MEEA 2D41A 1S0NA 1K1SA 5AXNA 1KTVA 5HQMA 1WD6A 4JI8F 3PTWA 5KFSA 4L72B 1H72C 2K3KA 2KXHA 1D9FA 2D3UA 2XI2A 4OYWA 1DQAA 1FO1A 1U0HB 2KH9A 3HPOA 3CC7S 5IOLA 1PG5B 5C42A 3JSRA 2ZOMA 2ZZTA 2AP6A 2MKKA 4DV0J 4CM2A 3MMJA 3BKUA 5EHHA 4EUVA 1UA0A 1BC6A 3OQ2A 1PCAA 2L9DA 2EBEA 3GV8B 2X7IA 3VVUA 4AD6A 5JUMA 3NNCA 1N32F 2QTWA 2QV6A 1TL7A 1U6ZA 1TU0B 2OHDA 1TKXB 4Q8EA 3HO1A 1HI1A 2M8DB 3MF5A 2DGXA 1XTZA 1U2CA 2FD2A 1SV5B 4H4OB 4IFVA 1KLNA 2QX0A 4B3MF 2CG8A 4OV6A 3GONA 3ZZYA 3OSPA 3NMRA 1B99A 3CDEA 3W62A 3QLHB 4EBCA 4A8MP 2OUGA 1F60B 3IR7B 4KSEB 1WKKA 2VQFF 1NMEB 5I42A 3N4WA 1XBWA 3SCKE 2QFJA 3VGUA 1R43A 3W2VA 4DX6A 3GSIA 1TL4A 1SVDA 2AJFE 2IVYA 3HD1A 3OR2A 1M1GA 2YNIA 5SZTA 4DR6F 3MCNA 1RWKB 2RQMA 4UUWA 4ZJOA 3GR1A 1HKAA 1J5EF 6AT1B 5J2MA 1WEXA 1CG2A 3ILOA 4NLOA 1Q5VA 2HIYA 2YX1A 4LQ9A 3SQOP 1ACMB 1ZM3A 2DGTA 3DRYA 3AAWB 5K9FA 4B9SA 1C2PA 1NSKL 2MDAA 4B02A 2HMIA 2FGOA 5FLXU 2DKOB 1U1MA 3DN9A 3JSYA 2XS7A 1HBNA 2Z8QA 1K0VA 3BSOA 1AXQA 1FERA 3KUEA 3EVMA 5CA5A 2B43A 3GFHA 3LGHA 3M4XA 2D69A 3CE8A 3DRSB 5D4PA 4JI7F 1JKHB 1HQEB 1G6BA 1CJKB 3C6UA 3KLFA 4PUOB 1JQGA 3V4MA 3K2YA 4M1KA 3I96A 4YB5A 4B17A 2Z58B 2ERRA 1RAIB 4PRFA 2XBPA 2YWHA 5BYRA 4LRAA 4LBHA 4ZCIA 2WBRA 2IYGA 3RR7A 3TNVA 1M5VC 2HFUA 3KLHB 2VASA 2DHXA 3B78A 3ZFVA 5CYMB 5J2QB 1SJFA 3NGRA 2UUAF 2A10A 2GJIA 1SH3A 1FNOA 2WVFA 1X60A 1HBOB 3NCQA 4HT7A 3BZQA 3P96A 4Y65A 1FEHA 1I5OB 2D1CA 2ZUGA 3SXLA 5K20B 2DNQA 5JJBA 4B9TA 1VRUA 1HNVB 4USKA 2NREA 2CNLB 4ER8A 2L9WA 4KPCA 4WTYA 2X3GA 5D0EA 1HHTP 3SSQA 2QEXS 1CLFA 2ZITA 3LH2S 1Y00A 1KTQA 2IRXA 4DDFA 4KH0B 1FRLA 3ZC4A 1LWCB 4ENOA 2LXFA 2EFGA 3F73A 5HMZA 4XO0A 1TKDA 3DM2B 3IG1A 2M4MA 3CDUA 3CJTA 2WVDA 1R89A 2IM3A 1BLUA 1CC8A 3RB3A 1LWEA 4HKQA 2PMWA 2WCXA 3KLGB 1N34F 2Y1IA 2AW0A 5A0YB 4OIXA 4DSJA 5FD1A 3OD2A 2PC6A 4TLQA 1VLYA 3CMAS 3R27A 2QC3A 1S6QB 3OTCA 4IRKA 3CB4A 3OL6A 3MMBB 4X4NA 4FZVA 4V19X 1RB0A 2B7CB 2XS5A 3BF4A 2MQPA 2ZVSA 2AEFA 2O5DA 3GFZA 3OLAA 1VGYA 1WF1A 5D4NA 2VOOA 4MH8A 3Q23A 2YKMB 2G0CA 3CDBA 3OFHA 3FEXB 3HFZB 3R7BB 4DPUA 4CNYA 3VV2B 2J9EA 3IXQA 4RR5A 3U1LA 4DU7A 2KU7A 2P5VA 5DZ7A 5IM0A 2LA4A 1X4CA 2ZFHA 5HMXA 3J80Y 4WCEQ 2L41A 2K7KA 3BJYA 1WTBA 2BOPA 3TZWA 4H4KC 4NE9C 3AOCA 6FDRA 4LF7J 4IH6A 1PYSB 1RWUA 5T14A 1RT5A 3DXBA 4Y2IA 1VC5A 4IG3A 4TY8A 1M5OC 1IKVB 3NBPB 2EFOA 2VA3A 1TL1B 3H2UB 4Y6IA 3BPSP 4DN9A 5KG2A 3AJDA 2XZTB 3D68A 1Q8LA 5L38A 1T9WA 3CXCR 2VDIA 4M8LA 1R0AA 1RU1A 1HYSB 1RAHB 4F4KA 2CQ2A 2YY3A 4MK9A 3NNHA 1Y3KA 1U8WA 2JLFA 3MDFA 4TYBA 3RJMB 3UO0A 2ZH2A 1YZ6A 3BQ1A 2WSEC 4QIGA 4ZVRB 2MHNA 1Q8KA 1VQMS 1VRTA 2YXLA 3T6JA 3PW5A 3CCQS 4OQJA 1J27A 1QE1A 3HSDA 2HQFA 4OYZA 3DXSX 1BUXA 2YH1A 2Y1JA 1LWFB 2V8PA 3MAAA 3TAMA 3HVAA 3HT3A 3TO8A 1NZ8A 2OSRA 3BS9A 4P6QA 3MOJB 2R2RA 2HHVA 3NGUA 3PDNA 3R5BA 5E3QA 1NSAA 1HBOA 3TQEA 1FRXA 1S1TB 3R5DA 4USJC 1HWUA 3SCLE 2AEMA 1Y11A 3TA1A 1YI2S 3EX7B 3QGGA 4R0EA 4HYKA 1DARA 2CQIA 5IC6B 1JLEA 5KG7A 2CQCA 4HI1A 5KFMA 1VS3A 3GCWP 5CCLA 3NKYA 5F0UA 4QWEA 3KMSA 2EC0A 2LP4A 4FF1A 4OZ5A 4DPXA 2CZ9A 3KK3B 1K73T 4B3OB 1FDBA 2QL5B 3Q89A 3GWCA 2D3O1 1HNZJ 5HQLA 2HIQA 2CUYA 3GYXB 1JLFA 2X1BA 5GAGI 3DM2A 2O66A 4IQXA 5D0RA 3DI6B 5I3PA 2ZBQA 3TVYA 5B09A 2W8KA 1X4AA 2ZDOA 2R7OA 5ETNA 2K1RA 1S6OA 1PJ5A 2QSFA 2W2QP 3FDSA 3MCOA 3NLCA 4NZ7A 4MKYA 2OKQA 3QZ7A 1T9VA 3ZZPA 4O3OA 1ZAVA 4KFBB 5JMNA 3B4MA 2WZ1A 1C1CA 1G7CB 2HQCA 3QIPA 4CQ1A 2D7SA 4CCHA 2JEFA 2N82B 3UDCA 3D54A 2H54B 2JX2A 1TL3B 3N79A 3HHLA 1EB0A 2Q6CA 1HL6A 3ENAA 3NOCA 2E29A 2I6WA 2GHVC 4F4XA 1UVIA 1OY6A 5DLFA 2DBBA 2C3MA 3MMCB 3RW7A 4ZLJA 2G1DA 4PG6A 4MFBB 1VHFA 4TLRA 2RVJA 5I3UA 1WNEA 4XDDA 5LXYA 2WONB 3CIZA 3I87A 1P1TA 3UW1A 4F4AA 1TELA 1RADB 2W8LA 1Q78A 2V0NA 5LMNF 4KV8B 4DV3F 1S7HA 2M7SA 1TL1A 3I6PA 3P8BB 3R9LA 3H20A 4I4BA 2J0QD 3PY8A 2CJQA 3RG6A 3SDEB 4JI0F 1H73A 3PJWA 1RCXB 4USTA 4ZITA 4Q45A 3ETOA 3IGVA 2LVWA 4JV2A 2WHOA 4J9RA 4DLGA 4URQU 2X1FA 5EDWA 4XAKA 1TUGB 3GE9A 4KGKA 4AFFA 5L9XA 1IM4A 3LTOA 2QA1A 3MURP 1VI7A 1H2VZ 3LP2B 1UZHA 3HVRA 1X8DA 1UJ6A 2ZOFA 4Y2CA 3MEDB 3BN4A 3MFIA 4ZCKA 3LQVA 5HMWA 2W2PP 3GYGA 4I2PA 2HNZB 1R7IA 2AZ1A 2PD1A 2RDJA 3DHXA 3TA2A 3R6LB 4WBFA 4LBPA 5E7OB 4DX5A 1IBLJ 1Q8IA 3SQGA 3UDLA 3KG4A 1HBUA 5B7WA 6FD1A 4EU0A 2EWHA 4C0OC 2MZ1A 1DHMA 3OR1A 1NB2A 1RTJA 4MAKA 4BBYA 3FC9A 2XY6A 3NOGA 2YBVA 3HKZD 4OZ0A 3ILJA 2W01A 1OY8A 4PQUB 4ZVEA 4CLTA 1DBDA 1SPBP 4DPWA 2Z2LA 2DEIA 2A6OA 4LMZA 4QPTA 3CT9A 2LU1A 4HVZA 2WSFC 1VHIA 1ZS6A 2C2KB 2HNDB 1S59A 2XMJA 3D67A 5KFVA 4DOZA 1QLNA 1RT7B 2MQMA 2HW3A 4LSNB 4CIOA 3KJVB 2OSQA 3CJKA 2BA9A 4CLWA 3WX8A 3UFCX 2BX6A 4I2QA 4OLPA 4QWAA 2FJWA 2P9GA 4I64A 3VCDA 1G2EA 3W9HA 3G9CA 4WTOB 3TQ1A 3W2VB 4BDPA 2FLOA 3TA0A 5IZHA 1S57A 3OR2B 1YRXA 2EKNA 4RW8A 3C6TB 4JUZA 5LSOA 1R8HA 2ZC4A 5J2MB 3ICLA 4DSFA 2DEJA 3LANA 1TK5A 2HNYB 5DQGA 3KK2B 2XO7A 1XNQJ 2VF3A 2HQGA 3DLGB 1CS4A 2MJUA 2VFTA 1NH7A 1TVRB 4NPOA 1RTZA 4LJMA 2OPPB 3T5HA 4RW7A 3MR5A 3UN3A 2M9KA 2KJWA 3BBBA 2CPZA 4HEA9 4I0WA 1X9MA 2FUG9 3UD5A 3HZEA 3AFGA 3OXLA 5KG3A 2MB0B 3DRSA 3HULA 5FDLB 3MUVP 3OVBA 4K4SA 5H9FK 2ADCA 1DTQB 2CQBA 2C2ZB 2B5JA 4Q43A 3DNCA 4DSEA 4ID5B 3WHIA 3QAUA 3PIPQ 2HHTA 1UW9A 2JEGA 2C42A 2FPHX 1RKJA 1D09B 2NLWA 3DLLQ 3ET6B 5BR8J 1QUPA 2VPWB 3G82B 4KH1B 3C46A 3Q83A 4TQSA 1PKUA 3KLHA 3LWLA 2LYVA 3TI0A 1VQ5S 2MZRA 4WFAQ 1V3RA 1WELA 2YNGB 1M5KC 2XWXA 1FNMA 1HNWF 2UV8G 3HXMA 5LJ5Y 2N4CA 3JXOA 4J5OA 5ADZA 2FHKA 3IN5A 3O8WA 1UZDA 2LXUA 4O44A 2UUBF 4PWDB 3VGVA 1HW8A 4ZVHA 4PWWA 2CKWA 3WZ0A 3Q8SB 1I6JA 2F4VJ 2R7VA 4NA1A 1JWWA 1DY3A 1ZBTA 1WG5A 4X4QA 4J9MA 4FYWB 2C2DA 2AJ0A 4BHQA 4X4TA 3AJ2A 3SYZA 1S76D 1WC6A 2Q1LA 2RB7A 3DRRA 5IQ6A 4ED7A 1CPZA 4GC7A 3UN2A 2C2EA 3QATA 2KB2A 3ZTPA 5KFTA 1RT6A 4DPTA 3J7YI 3PV8A 1NJIT 2KVIA 1R0BG 1HR0F 5HROB 2DT9A 2HSEB 4OJHA 4HH0A 4OZ2A 2DISA 2BUNA 4WXOA 5T7LA 4Y00A 4K2XA 5C2CA 4WFYA 2GJ2A 3R1HA 2LCWA 3CJKB 3QT6A 2R2UA 2D9OA 4LSLB 2HK3A 2C1EB 2J0SD 1V3SA 2BW2A 3LP0B 2HFZA 4FVMA 4RNMA 1CJUA 2E9TA 3TEHB 2V34A 2V67A 1UVKA 4O4GB 5D77A 3FMWA 4DR7F 2V63A 2HVIA 2BR0A 1UAWA 3L95X 3PX4A 3PRDA 1UWAA 5HQ8A 2LQBA 4DL2A 1NJYA 2UVVA 4ES1A 5CD4H 3RB6A 3DYAB 2PA8D 4LF6F 1FEEA 3IR6B 3T9ZA 3CMES 2AMCB 4DQIA 1VBKA 2MZSA 4LIWA 4BWMA 1X5OA 1C4AA 1JKHA 1HQEA 3VHQA 4OYIA 2VQEJ 1SKWA 3WBZA 2UVWA 1Y5IB 4G1QA 2D74B 4U7UK 4EYIB 4FXVA 1KKHA 1S5ZA 1RWXB 4ILMA 1S1VB 1B0TA 3K5PA 4CWBA 2BRKA 1RABB 2DIVA 3DLKA 4RW6B 4ZP8A 4WP9A 4LR8A 4A8WA 4F3OA 1QD1A 4C8NA 1P9YA 3CJ5A 3GIRA 4FNIA 2IDLA 3R5AA 3R5GA 4FPIA 2K3IA 2V9KA 3ZZRA 2R8GA 3GJSB 4O4RA 2V8HA 1XR5A 3QRRA 4FXDA 4Q0BA 4JI6J 2CWKA 2NZCA 3IBFB 5L1IA 4M95A 1X0PA 2RJZA 3MZIA 3M2UA 1Y3JA 3DMJA 4NL5A 5E5NA 3Q22A 1HWJA 3JAMU 4USMA 2GC8A 3DLEA 3R8YA 4ZIWA 3VAIA 1T3NA 5DM6Q 4U8YA 4ZA1A 1P1LA 3I0SA 4CLYA 1RTDB 4DZ6A 4AQYF 3M6VA 4F2SA 2B9YA 2DR7A 5KFZA 2MQQA 1IVZA 1DTTA 1JXVA 3N5FA 4W92B 2HHXA 2GA7A 2EBGA 4DUZF 2GCFA 3V2UC 4G6VB 4P52A 4F02A 1FWLA 3HHKA 2ATLA 1Q53A 1MROB 1NKCA 2FQQB 2Y3YA 2L9NA 1KQGB 5HBMA 3K5NA 2CADA 4LRFA 4NRUA 2Y1RI 3R5CA 3J81j 1U7LA 4ECXA 4LFCF 1WF0A 3A13A 1I51B 4ZVQB 1RU2A 3KLIB 4HTJA 3I56S 1WC0A 4IDKA 3DI6A 2DH8A 3PHTA 4KR0B 4P71A 2IBOA 1CC7A 3CO9A 4CYUB 1X31C 4ZJQA 1J5OA 2CYYA 2HAFA 1NO8A 2MLYA 1SC6A 2IAJB 4FYYB 3MM5A 4KHMA 4PXBA 4JV0A 3MMAA 1N4LA 1F6TA 4P74A 3PX6A 4TY9A 5ETSA 4X65F 3TARA 1PILA 3EGNA 5HO4A 5EGYA 3A3PB 2ASJA 1FI4A 1T9TA 2Z0GA 1PO6A 4OYMA 3M9MB 1NNDA 3KG1A 4WYLA 1HFEL 1KLMB 3CULA 2CRLA 4DR3F 2V2QA 3H5UA 3W66A 2B9WA 1S9FA 3OXFA 4I6WA 1SC1B 2ZJPQ 3PW7A 2LMIA 4OZNA 1GTEA 3R7SB 1SJ1A 4Z37A 3TZYA 1VFJA 3NS6A 1UMJA 5DDOC 2NYHA 3BKFA 3QO9B 4KTQA 3IWLA 4RU2A 1U24A 5E3AA 3W9IA 1HNIB 1RWOB 2QA2A 2VG5B 1KWMA 2DCUB 3KUGA 1JLBB 4KV8A 5C24A 3NCRA 2VL1A 8RUCA 4NOHA 1A0OB 5LMNJ 3QT5A 4K4VA 3M9NB 4DV3J 2QO3A 3RB0A 4IFYA 4JI4J 3ISND 2CPFA 5B0AA 2FTRA 1OWXA 2A2CA 1RT3B 3ONQA 4IO1A 2GW8A 2W9CB 1U1OA 2HHUA 2MKSA 1S1WB 4YR2A 2PMZD 2P2CB 3D7SB 5ETTA 3HSJA 1KOHA 2ZM6F 2G9OA 3F41A 4E98A 5FJ4A 2AKWB 2KXNB 4MIWA 1QAYA 4X4PA 4ZLPA 1NM2A 2CIMA 3MEDA 4Q2LA 5KG4A 4IKAA 4DFJA 3N5BA 1SJ3P 2RIJA 4C0HA 2F63A 1S97A 5CHCB 3IRXA 2HFNA 3AH6A 3K17A 4PWUA 3TJ9A 1XR6A 4AT1B 1QSYA 2WAQD 3OL9A 2CPHA 4WK3A 5EX0A 1FJCA 2NS1B 2R2TA 3PYEA 4MT1A 4PQUA 2DHGA 4EO8A 2E5GA 3CCVS 1FKOB 2CVEA 2LQ9A 4MYUA 3E51A 2WOMB 3WC0A 1ZA1B 1VBXA 3JQMA 1CJVA 5J1EA 4LF2A 4NLUA 3BYRA 2RF2A 3BSAA 1Q1KA 2NQPA 2W7AA 2ZNZA 4DV5J 2P6TA 1IKXB 1JIHA 3FRZA 2XCAA 1PSDA 2DNRA 2RNEA 4YEAA 2DPIA 4I2QB 4O3RA 1B70B 3BH7B 1EX8A 2XNQA 3EGVA 3G6ES 4J9PA 5HROA 3FBFA 1DQ9A 3RGIA 3PFOA 4ZPCA 1AUSL 1S9GA 5KFWA 3GSDA 3MCMA 2KZZA 3NP5A 3AXMA 1WORA 2BJ3A 2ZWOA 2ZUAA 3MMCA 2VA2A 1NBEB 3BR9A 2NXCA 3CJRA 1RUSA 2IFXA 1NK9A 3LPYA 5AT1B 2DRAA 1NK6A 2VD3A 2GIFA 1PIEA 1NLKL 3PW0A 1WHYA 3THVA 1XNQF 3GP9A 2E9ZA 1SBRA 4R5PB 3KJFB 3D4JA 2DY1A 3C19A 2MSSA 3SV4A 3IAS9 3IBWA 3QO9A 2Y8WA 1YJ7A 2AF6A 1S6PA 1SB6A 3VAFA 1R0CB 3A8IA 4DV7J 1Q5YA 1SL2A 2NR0A 2QLWA 2PN6A 2XYGB 4MIBA 2XHWA 1TZ0A 5EWGA 2CJBA 4DV2F 2HHPA 4DCJB 3H5YA 1NJZA 1RTHA 2W4PA 1EIYB 2YQ0A 3LP2A 4K4ZA 3L7OA 5C42B 4J9LA 5BR8F 3M32A 4OZLA 2DGSA 2WW4A 1LW2B 5BYQA 4O0NA 4O3SA 2G4BA 4KYZA 2ZH3A 4DQPA 3NEKA 2HBRB 5ETVA 3D3BJ 3DOMA 3M8QB 3HLUA 4OI6A 3SCIE 1UA1A 4JI5F 4FS2A 3BGLA 4LF4J 2FGCA 4NLTA 1W26A 3AB4B 3LGMA 4P2XA 1L5UA 3K59A 4PWDA 1ROFA 3AA8A 1FVQA 3IG1B 3PEJA 2J0WA 5IT4A 2BV3A 3BQ0A 4E2FB 1JLCB 2UUBJ 5AXMA 4LF1A 2F4VF 3THTA 5IC4B 4KBIA 2NXEA 1NK0A 1FKAF 2AJ4A 4X4VA 3DRRB 4OLOA 2VPYB 4GVBA 7FDRA 2MTLA 4LSNA 3RZAA 4CLUA 5LSRA 2YX7A 2WOMA 4U67Q 2GFFA 2Y8YA 2VFRA 3H5SA 3R5JB 2IA6A 5G4DA 2KT2A 3MFHA 4GKJF 3AOAA 1DZ5A 1W7WA 4YFUA 4ANEA 1GNKA 2BJEA 2CNKB 1Q82T 5B0CA 1UEKA 2MKYA 5KFEA 3MM6B 5LT5A 3PR5B 1WF2A 5DG9A 1TP7A 2CDQA 4PXEA 1ZM9A 2VDHA 5ITHA 2IMOA 4YB1P 1SIZA 1UTAA 4UQTA 3T9NA 1OS5A 4FKXA 1NCLA 4QR1A 5GADI 3ZZTA 5AJ3F 1R0AB 2UUCF 3OPKA 4JYAJ 1S72S 2GIQA 1G3OA 3FKBA 4LRBA 4RNFA 2RE1A 3MR3A 4HR2A 3NWRA 1JJCB 3AQPA 3FQKA 4QWCA 5EN1A 3O44A 1TV6A 3FVYA 4AL5A 5GADU 2DTJA 3SFGA 1WHXA 3ZTRA 4Y2KA 3BEGB 1Y5LB 3O1LA 2R7XA 2LQ5A 2CQGA 2YKPA 3KDNA 4DV4F 1ICEB 1ZTTA 2AGOA 1YJRA 1QSLA 1FESA 3NNAA 1WDDA 3P4UB 3RRGA 3K89A 4M5NA 4P2FA 2XNRA 2R42A 2HVEA 2E1CA 4FF2A 4Y2AA 1IR2A 5D3GA 3VWSA 4I56A 3M32B 3E8OA 5F8MA 3HVTB 2YWWA 2EFQA 1RA6A 3C15B 4NMLA 2B4PA 2YKQA 4OI3A 2MKJA 4RKUC 2DNOA 4USVA 3IA0A 5F41A 1U1RA 2MQLA 2RS8A 3EGWB 4IUFA 4RU9A 3KJQB 4ZMMA 4RL1A 3D66A 4OI2A 1GXTA 1K0TA 4K0KJ 1YJNS 3OUYB 1YQHA 3RBEA 4TKTA 1LW0B 2FJAB 3VAJA 1YTYA 4DUZJ 3T1AA 5CD4A 5B08A 1U47A 1QVFR 4F8RA 1YWXA 3D28A 3VF0B 4NXMJ 1BHNA 2WW8A 5KFYA 4QIWD 5SUHA 4M5DA 4QYZJ 1FJ7A 2DB1A 1VJQA 1KQFB 1JLAA 1U6FA 3DC2A 4LFCJ 4LRDA 4KFBA 4UZCA 2IM1A 3PG9A 1KBRA 2VBZA 4L3KA 4P7TA 4FF4A 5KG6A 3B4DA 4DL7A 1KS2A 1KVJA 3X3UA 4ELUA 5IM0B 3S1TA 3CDAA 2IC3B 5LOQA 4HT5A 3NXZA 1G4CA 4NI2B 5LXRA 1Q7YT 1H74A 1NDCA 2OPSB 3NGTA 4X65J 2I5JB 2UUWA 3VAMA 2VBXA 1H2UX 2OIHA 3NBPA 4OX7A 2DJWA 1RISA 3ELHA 2CPJA 4C8YA 2ZH4A 2R7QA 2FHOB 3R97A 4UT4A 1URNA 1T02A 3MPDA 4CT8A 5A8RA 2CWXA 4MMOA 4R25A 4JI3F 2KG0A 5L1JA 4ERDA 1N0VC 1H3DA 2KG1A 1GFWB 4F4ZA 5CYJA 4DR4J 3HFVA 4K59A 3P49B 1ZOTA 4HTIA 4USUA 3DLKB 2QL7B 1WHWA 3UNGC 1QE1B 4EK2A 4CH1A 3OTBA 3RB4A 1LWFA 2B56A 2B8PA 2QMXA 4NEYA 3U1MA 4YDDB 1JB0C 4KHPF 1X4BA 2LDIA 3POTB 3Q0AA 2ROGA 1FVSA 1U0HA 4HDGA 2A18A 2DGWA 2YKNA 3SIPB 1D9DA 3T41A 1Q16B 1QY7A 2COLA 4CT9A 5C25A 1SC4B 1WTFA 2E1PA 1S1WA 3TX8A 3KK1A 1B3TA 2H5IB 2VG7B 4KO0A 5ETOA 3JAMY 4FP9A 2ZH9A 1GT8A 2B51A 3DGPA 4MKVA 3Q8RB 3QSIA 3KTQA 2UXCF 5K8OA 2BBEA 1EETA 4YY3J 1YZ7A 3MTKA 1N5QA 2C2RA 2E5LF 1LQ9A 1MWYA 2ZVIA 1VK3A 2J6UA 2CJAA 1N36F 3HVTA 4K4YA 1U1NA 3M8WA 1XMOF 1BQMB 2J9DE 5ETLA 3S8SA 1MROA 1T9UA 3W2WA 4C8LA 2OO4A 2N7YA 3CVKA 5HBMB 2JHEA 5IWAJ 4WFBQ 2K1RB 5KAKA 2DR8A 1KONA 3UVJB 2M0GB 4CTAB 2MKCA 5DETA 1H2TZ 4P2MA 1S77D 1RT7A 3HVWA 4ED8A 4DQRA 5LJ3Y 5DDQC 2BZ2A 3PKMA 3JB9k 3J7Z5 2B4UA 2B4VA 3W60A 3TZZA 2RILA 3LA0A 3RAXA 1MN7A 4A8KA 4M5DB 4BLGA 3LALA 1FA0A 2HQ3A 2XGPA 3DDNA 2FZGB 2JVOA 2K8GA 3CJ4A 4GVLA 4PABA 3SZ2A 4C3LA 2HHHF 2QLBB 3QAEA 1RBAA 5FLXY 1QJHA 3MD3A 1E6VA 1RCOB 1Q8BA 2HNYA 4KQZA 4EZ6A 1L3UA 1UEVA 5F0WA 2WONA 1RHKB 2HQIA 3OTDA 3VALA 2NPFA 5HMYA 4X64J 2Y9HA 4K8RA 4NLYA 3S01A 4TU9A 5DS7A 4NLRA 3R1LA 1X4EA 5D4LA 5KFDA 1RWVB 3D1OA 4LBIA 3P45B 5MAOA 3BSCA 3KOAA 4QU7A 2ZHOA 5A8KB 1F5CA 5KOXA 1Q4RA 4RUCA 2ZD1A 4ECZA 1JLBA 4ZVOB 3MXHP 2WVEA 1PYTA 1U8SA 4MK8A 4WE1B 2F5GA 3LW5C 4N5SA 1VQ8S 3QIDA 3VZHA 3DCAA 1RT2A 1RAFB 4DUYF 2ADBA 4NYOA 1S6UA 3HKWA 3D2WA 3I0RB 3FQLA 3K8VA 5B0GA 3UCGA 1KVKA 4OL8A 1JXEA 3Q86A 5IQQA 4OYBA 5CAAA 5DM7Q 2BJ1A 2MGZB 3POTA 1RTHB 2C3YA 1IQZA 1C0UB 4K2JA 2LDYA 4Q44A 1HNXF 3VZIA 2JEJA 1T0TV 1LFPA 1TL7B 4HACB 3NAHA 2RS2A 2ZZMA 3OR1B 2O01C 3L9ZA 1LW2A 3C3LA 4YS2A 2HRTA 4KO0B 2GMLA 1X5PA 2VG7A 4Z7CA 4YR3A 2W2NP 3EUNA 4RUBA 5B0EA 3T1HF 4OX9J 2W4CA 1CQMA 2NXUA 5KT7A 4PYDA 3X1LB 2I0XA 2DGVA 1IR0A 2HGMA 3P3DA 4ZVFA 1DURA 2ASLA 3HD2A 4EWTA 3OL8A 4OX6A 1U1LA 4KPYA 4LVOP 2WBMA 1S4EA 2H4WB 3G86A 4M63A 3LGNA 3MPYA 4LVNP 2QSWA 1CJVB 1FDNA 1N48A 3CO0P 1UFLA 3NWGA 3KMQA 3FZBA 4JV5F 1ZA2B 4DHVA 2YWFA 3RBZA 2Z30B 2DNZA 2JC1A 2BANB 5KT2A 3PEHA 4WU2A 5EX3A 1FK9B 4DG1B 2OPRA 3RRHA 2BDPA 2R7SA 4ELTA 4X62F 3D0HE 1FXRA 1UP1A 3BGRB 2JDJA 4ZOSA 4ZP9A 3TUJC 5CABA 1CJKA 4IQMA 4P10A 5HAOA 5GMEA 3EDQB 1GQEA 2F4FA 3DYAA 1N52B 1TKZB 1RAAB 4MYTA 1HMVA 2BJ8A 1UETA 2OMOA 2XI3A 2V8GA 3D0IE 3Q2SC 1NKBA 4UY85 2GMJA 4FBTA 1HQUA 2UU9J 2M5YA 1RE1B 3US5A 4DX8H 4EMDA 5KFAA 2OP5A 1KNZA 4PG4A 2V94A 4WIQA 2ZHBA 4DR5F 1RHQB 1Y10A 1WSVA 1R31A 2XSJB 2W9BA 2MQOA 4B3RF 5AJ3J 5HSPA 4OJ3A 4XPCA 4UOGA 4NLXA 3V6JA 1VQYA 1Y0HA 4Q2MA 4AXJA 4OHVA 3DKDA 3PRBA 2H5JB 1EKRA 1TV6B 4DSLA 4W98A 2R8HA 5JVHQ 4FF3A 1TFWA 2G2YA 4C4WA 2F8EX 2RQKA 3G8TA 1RT1B 3GPAA 3U27A 2VB6A 3IM8A 4BCAA 3EICA 3P5BP 3UN5A 3ISNC 2KVQE 3E2EA 2LECA 2HHQA 1VQSA 1BE4A 4I67A 1RHMB 4F36A 2VC0A 1Z1ZA 2QJ3A 3BH6B 3TRGA 2VIHA 4J9SA 4D3GA 1LWEB 4J7CA 2ROPA 3KHGA 4TNOA 1S12A 3SEOA 1GH8A 1DTTB 2CJYB 3MTJA 2VUGA 5IT0A 3UWTA 2ASYA 5GAHI 2V4QA 1QUVA 3MMBA 1N32J 2VZ9A 4ZVSB 1N54B 4N41A 2BVZA 2DY9A 1RWMB 2F1FA 4O3QA 1NHVA 3IS9A 4NMXA 1PJ7A 3PJ9A 2U2FA 3H40A 2QA4S 3BBFA 4LF9F 1EARA 3OUYA 4DV1J 4OV1A 3JSMB 3KLIA 5F8JA 3T5LA 1AFJA 2F8MA 3VQSA 2JOQA 4CYUA 2UUTA 1ZZNA 2PDAA 2UZAA 5KFRA 1MG7A 3OXGA 4CDIA 1S0VA 1WKLA 2VQFJ 1F2HA 3QYYA 1SQEA 4NXMF 1RAOA 1YHQS 3MM9A 4DR6J 2NXJA 1T3OA 3NG8A 3HSGA 3D6TB 4LREA 2F9JA 1JLQB 1EP4B 2V69A 3M2VA 3OHAA 3JYTB 2Q79A 1S4FA 4USIA 3UE2A 4A46A 1D0EA 3I55S 2HGLA 4ZCLA 1EKSA 4HHUA 3T19A 5KT6A 4OYAA 1WG4A 4A8XA 4PPZA 2I5JA 5A8WA 1NSPA 4A8FA 1UL3A 2QMWA 4C3KA 2FVCA 1Q95G 2DHAA 1MMLA 4I69A 3HZGA 1RZMA 1UJ5A 3OBIA 4L74A 2BJ7A 2W4DA 4O3NA 4F4WA 3N01A 1L3SA 3KJNB 2RT3A 4ES2A 4M5KA 4NYPA 1UPMB 5LL6d 5LSLA 2DH7A 5RUBA 2FC8A 1VQLS 1WI6A 2GS8A 2FVQA 4WKRA 4ED6A 1GAOA 1O8BA 3QGHA 2ZWPA 4U9RA 2ZKUA 1X4DA 3M6XA 3E01A 4UZBA 2VICA 3DLHA 1ITPA 1HD1A 2NCKL 3V6HA 5KFQA 2HBYB 1SL0A 4F2RA 1GMWD 4RPFA 2JC0A 2FVSA 4I6AA 2KDOA 3FBBA 1EJ7L 5M2RA 4NLGA 3K7RA 2YKNB 3MECA 3I0SB 4PAAA 1EAYC 3UCZP 1RT1A 2PA3A 2J7KA 1XNRJ 1TKXA 3D1QA 3FEZA 4MIAA 3KK3A 4B3OA 4QR2A 1N56A 1MMDA 3HMJG 1FRIA 1MU2B 3I9V9 4G65A 2DGUA 3EWGA 3PHEA 4O3PA 5KFLA 4DR1F 4GKKJ 2UXCJ 2KXFA 3J7AN 2CNNB 1WC5A 2BABA 4F0HA 1WHVA 1NKEA 1IKWB 2BQUA 3H2LA 3CC2S 2GO9A 3KJVA 1L3TA 4C8ZA 2QYCA 2J5AA 4C3MA 2HLTA 1YLXA 4CTAA 2ALZA 4ZN1A 2RF2B 4PXCA 3RYLA 5KFGA 1YGYA 3BB5A 5IWAF 4M5JA 1Q86T 4GO7X 2IM2A 4XK8C 1WWHA 3QGPA 1Y7PA 1LOUA 1S9EA 4RJVA 2DHHA 4PG8A 2ZDPA 3EXYA 1WEYA 3PNIA 3NGDA 4MFBA 4K4UA 2XYHB 3JQKA 5J1PA 3L09A 3LOUA 1WC1A 4NI2A 4OI4A 3BGOP 2XS2A 1GMWA 1T9YA 5KFFA 2DHSA 1CJTB 3ZZZA 3EYZA 5IXUA 1T8EA 1UKUA 3OT9A 2XC9A 2VHGA 1V5IB 4NEZA 4KGXB 4BC9A 1OSDA 1SJRA 2EK6A 4EBEA 2B5JB 2CQ3A 5L9NA 4ID5A 2F8HA 4X64F 2Z2ZA 3UPFA 1C1BA 2EG1A 2M52A 3BREA 1R8PA 3P5TL 2W7OA 3PO5A 4R8UA 2K06A 5F3TA 5HATA 3SI8A 2J6TA 1IR1A 3BM7A 4IYQA 1TUVA 4IO9Q 1IBKF 4PCQA 3TOQA 3S6EA 1VQ7S 2ZNYA 1M5SA 3CGIA 2E9RX 1FJGF 2YNGA 4FXWA 5E3CA 2CJXB 4FYXB 3H98A 3G2XA 5AXLA 3CJ2A 3HT0A 5CCMA 5GMKa 3C66A 3SQGB 1FE4A 8ATCB 2M3DA 1RHRB 3ADAC 4DUYJ 1N5TA 1CSJA 1R8CA 3I0RA 3Q8VA 4WP8A 2DGQA 2KHDA 2NPIA 4O44B 3UQSA 4KKOA 4Q5VA 4A48A 2HVZA 4UQGA 4QBUA 3QSYB 2Z2MA 4N8OA 3CCMS 1GTHA 5KFUA 4YB6A 1O51A 3W61A 3M9OB 4DQQA 4LQ3A 4HACA 1JNRB 2ZBCA 4A4JA 1HNXJ 2VJUA 1ZETA 4Q8FA 1Q0NA 1TKTA 3CNQP 9RUBA 2HNDA 4V1Ak 4OJGA 4J90A 4PXDA 1TK0A 2DR5A 3RTVA 1WEZA 3I5CA 1REGX 3I5AA 5KG5A 1BQMA 1MLAA 1IJEB 2Z2YB 2MY8A 4ZCMA 4U7CA 2IJNA 5LMUJ 1DRZA 4CNZA 4YHHF 4YDXA 1M0SA 2RUGA 3QZ8A 3FCHA 2EFVA 2A3JA 4JI1F 1U0SA 5J2NB 3Q8UA 1U48A 3W1YC 3QT8A 4GVBB 3UI3A 1TAUA 4NCAA 2C22A 2BYCA 3EE3A 3J81Y 3ITHB 3K58A 4ECYA 1WOOA 3C6TA 2VKZG 2GV1A 2VV5A 3M2RB 2B6AA 3OFFA 3FCWA 2LQ8A 4QIVA 4AL6A 2ZH8A 4CLPA 2I2YA 3DLGA 1CS4B 1OSCA 2IJRA 2G0JA 3GQCA 2VFUA 2I9SA 3H90A 2BANA 1J2VA 4JP8A 1SQGA 3DOKB 3EMTA 4KGMA 4RW7B 3VR1A 5CYQA 2XGQA 2OPRB 1U45A 4DBQA 1BQNA 2J7WA 2R9LA 4EO6A 4DL0C 4OHYA 3BGRA 3GMGA 2Q43A 4F25A 1SQFA 2HRYA 1IQTA 4X62J 3HSZA 2C3PA 4RZRA 1FKPA 1F5AA 1T05A 3PIOQ 5H9FJ 1WJ9A 2AHOB 2DITA 3PR4A 1FDAA 1SJ4P 2MHEA 4U6PA 1VRTB 1T03A 1QAJA 2ZBIA 2R7RA 1U09A 5GAHU 3W63A 3G82A 3ZO7A 2EFNA 3LP1B 2OMLA 2ZD1B 2OTLS 1YJVA 2NUHA 2DCLA 1HHQA 3H0PA 3WDOA 4JI0J 4G1IA 1I3OB 2XSJA 1RQ0A
chains in the Genus database with same CATH topology
1NPKA 1XIQA 3Q8YA 1W7WA 4ANEA 1NSQA 2DYAA 4CP5A 4F4AA 4KPCA 1K44A 3ZTPA 4DUTA 1UCNA 1HLWA 3R9LA 4UOGA 4ENOA 3DKDA 4UOHA 1WKJA 4W98A 3ZTOA 4FKXA 1NCLA 2DXFA 3EVWA 3FKBA 3GPAA 3VVTA 3EICA 4HR2A 1KDNA 1MN7A 1F3FA 1BE4A 2DXDA 1NDKA 3FCVA 4F36A 4DI6A 2HVDA 3BH6B 3ZTRA 1LEOA 2AZ3A 3EJMA 2AZ1A 4WBFA 1NDLA 1NUEA 1B4SA 3ZTSA 4C6AA 3FBEA 3JS9A 2DY9A 1NB2A 1S5ZA 3FC9A 4ANDA 3ETMA 2HVEA 3PJ9A 3BBFA 3BH7B 3DDIA 3G2XA 3FBFA 5IOLA 1XQIA 3Q8VA 4UOFA 1ZS6A 3B54A 1WKLA 1S59A 2CWKA 2HURA 2ZUAA 3EM1A 3VVUA 3WX8A 2BX6A 1U8WA 1MN9A 3ZTQA 2VU5A 1NLKL 2B8QA 1BHNA 3L7UA 4DZ6A 3GP9A 1S57A 3Q86A 5BXIA 5CAAA 1NHKL 2BEFA 1BUXA 1B99A 1JXVA 1NSPA 1WKKA 1LWXA 3NGUA 3VGUA 3Q8UA 3EE3A 3BBCA 3PRVA 3BBBA 1NDCA 3NGTA 3FBCA 3FCWA 3ELHA 3VGTA 1NSKL 4O0NA 1EHWA 2NCKL 1F6TA 3MPDA 3Q89A 3EMTA 3EVOA 1VYAA 3EVMA 3FBBA 3Q83A 1HIYA 4S0MA 1PKUA 3VGSA 4EK2A 4ANCA 3B6BA 1NDPA 2B8PA 3NGSA 5CABA 1PAEX 3VGVA 1HHQA 4FKYA 3ENAA 2DXEA 3NGRA 5C7PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NPK A;  1XIQ A;  3Q8Y A;  1W7W A;  4ANE A;  1NSQ A;  2DYA A;  4CP5 A;  4F4A A;  4KPC A;  1K44 A;  3ZTP A;  4DUT A;  1UCN A;  1HLW A;  3R9L A;  4UOG A;  4ENO A;  3DKD A;  4UOH A;  1WKJ A;  4W98 A;  3ZTO A;  4FKX A;  1NCL A;  2DXF A;  3EVW A;  3FKB A;  3GPA A;  3VVT A;  3EIC A;  4HR2 A;  1KDN A;  1MN7 A;  1F3F A;  1BE4 A;  2DXD A;  1NDK A;  3FCV A;  4F36 A;  4DI6 A;  2HVD A;  3BH6 B;  3ZTR A;  1LEO A;  2AZ3 A;  3EJM A;  2AZ1 A;  4WBF A;  1NDL A;  1NUE A;  1B4S A;  3ZTS A;  4C6A A;  3FBE A;  3JS9 A;  2DY9 A;  1NB2 A;  1S5Z A;  3FC9 A;  4AND A;  3ETM A;  2HVE A;  3PJ9 A;  3BBF A;  3BH7 B;  3DDI A;  3G2X A;  3FBF A;  5IOL A;  1XQI A;  3Q8V A;  4UOF A;  1ZS6 A;  3B54 A;  1WKL A;  1S59 A;  2CWK A;  2HUR A;  2ZUA A;  3EM1 A;  3VVU A;  3WX8 A;  2BX6 A;  1U8W A;  1MN9 A;  3ZTQ A;  2VU5 A;  1NLK L;  2B8Q A;  1BHN A;  3L7U A;  4DZ6 A;  3GP9 A;  1S57 A;  3Q86 A;  5BXI A;  5CAA A;  1NHK L;  2BEF A;  1BUX A;  1B99 A;  1JXV A;  1NSP A;  1WKK A;  1LWX A;  3NGU A;  3VGU A;  3Q8U A;  3EE3 A;  3BBC A;  3PRV A;  3BBB A;  1NDC A;  3NGT A;  3FBC A;  3FCW A;  3ELH A;  3VGT A;  1NSK L;  4O0N A;  1EHW A;  2NCK L;  1F6T A;  3MPD A;  3Q89 A;  3EMT A;  3EVO A;  1VYA A;  3EVM A;  3FBB A;  3Q83 A;  1HIY A;  4S0M A;  1PKU A;  3VGS A;  4EK2 A;  4ANC A;  3B6B A;  1NDP A;  2B8P A;  3NGS A;  5CAB A;  1PAE X;  3VGV A;  1HHQ A;  4FKY A;  3ENA A;  2DXE A;  3NGR A;  5C7P A; 
#chains in the Genus database with same CATH topology
 1NPK A;  2W7P A;  3W8P A;  4F04 B;  1RT2 B;  2C2M B;  4B3R J;  3M1V B;  2DNY A;  4RW9 B;  4XDC A;  1CEZ A;  1P6T A;  5I3Q A;  4X4U A;  1FWP A;  2D3Z A;  2XMT A;  3D3C J;  4KGV B;  4KHR A;  5K8N A;  2MGZ A;  1O0P A;  3H5X A;  2QG9 B;  3K0J A;  2BM1 A;  1K1Q A;  2CQ4 A;  3MR2 A;  4J9O A;  3GII A;  5D3G B;  2PSZ A;  4Y3C A;  1Q81 T;  5HLF B;  1QM9 A;  3C15 A;  4XPE A;  5B0D A;  2B9E A;  2C2N A;  5KFC A;  2EFP A;  3KLE B;  4DXL A;  3C16 B;  3CD7 A;  4J37 A;  2BJ9 A;  4CO0 A;  3P6Y C;  3KDO A;  4BWJ A;  3J7Z T;  1R3N A;  1UJ4 A;  1EQM A;  1RSC A;  2H5E A;  3B82 A;  3K5M A;  1SKR A;  4HHH A;  2KFN A;  4IDK B;  1C1C B;  3QIP B;  1N33 F;  2A1B A;  2HVD A;  4CZC A;  3IS9 B;  1LEO A;  1KSP A;  3PZP A;  1FT8 A;  2CZ4 A;  4DU8 A;  5AE1 A;  1Y5N B;  3HHL B;  4HHJ A;  3HX9 A;  2CPY A;  3V81 B;  4LF9 J;  4KHP J;  1AZS A;  2GMH A;  4DV1 F;  4O4G A;  1B4S A;  4U96 A;  5B0F A;  1RLD A;  4QYZ K;  1Z2Z A;  3MM6 A;  1TFY A;  1A7G E;  1AA1 B;  5DZ6 A;  2IPO B;  2LEA A;  2ZOG A;  3D6H B;  1KOO A;  5FII A;  4F3M A;  5I3U B;  4NAS A;  3EPI A;  1KP6 A;  2W1B A;  1FWK A;  1RHU B;  2IYI A;  3DDI A;  2OPS A;  2QRR A;  3H7H B;  1X7V A;  3CIM A;  4JB8 B;  4CO5 A;  3GV7 B;  2GX8 A;  2MXY A;  1C0T B;  2RDI A;  4P2S A;  4OYX A;  4ECV A;  5G0R A;  4WF9 Q;  2YVS A;  4CO3 A;  4FDF A;  5EWE A;  3R3T A;  3AOD A;  4G1P A;  4YR0 A;  2A0F B;  4FS1 A;  4KRW A;  2L48 A;  4OZ3 A;  4QOT A;  2QL9 B;  1NJW A;  2MPU A;  2BXJ A;  2IY5 B;  2E5I A;  2E44 A;  4ILR A;  4N77 A;  2FJX A;  2H4Y B;  3T3F A;  2CXE A;  2J76 E;  1T05 B;  4JI8 J;  1LFW A;  2CJ9 A;  4OZ1 A;  2PI5 A;  5L8R C;  2BQ3 A;  4X2B A;  5D4O A;  2OEM A;  1FTR A;  1OIA A;  1D8Z A;  4X4S A;  2DRD A;  1K47 A;  3LP1 A;  1F9H A;  2EPI A;  4B9L A;  1YBA A;  3OFG A;  2LLZ A;  5K14 B;  2OTJ S;  1S1U B;  3TZX A;  2HS0 A;  5KFK A;  3E01 B;  2GQ2 A;  3LAK A;  2KYZ A;  1Q7L B;  3KKF A;  3AQO A;  3KK1 B;  1HPZ B;  2GAH C;  1O6X A;  4ED3 A;  3NRB A;  4J9U E;  2HFV A;  1HNW J;  2LXI A;  4NLV A;  2Q3P A;  3HCX A;  2GQQ A;  4ZKA A;  4PG5 A;  5C5J A;  3VGT A;  3V6D B;  1JMT A;  5KFH A;  3M8Z A;  1U4B A;  1LWC A;  3IR5 B;  4XTT A;  1XNR F;  2W2M P;  3UDV A;  3A1Y G;  2FY1 A;  1VYA A;  1GXU A;  1T94 A;  4WZM A;  1GK8 A;  4U8V A;  5IT9 U;  2RQC A;  1J5O B;  2R7T A;  2KI2 A;  3QRQ A;  1YSJ A;  1F9F A;  2IAJ A;  5A0Y A;  4PEO A;  3UVJ A;  5J1E B;  1KQS R;  4DR1 J;  2BQR A;  2UVR A;  4GKK F;  1NDP A;  4TN2 A;  1ZPW X;  2NSC A;  2V2Z A;  2FVP A;  3KUH A;  2I1R A;  4RNO A;  3ENV A;  4J9K A;  4EGL A;  4MTP A;  3Q2T C;  1V3Z A;  2OPQ B;  1WI8 A;  3IWX A;  4RW8 B;  3M30 A;  4QQB A;  5H1S V;  2ZH6 A;  1M5P C;  3NGS A;  2W2O P;  3GJR B;  1ZPV A;  4ID8 A;  1N6Q B;  3A8K A;  1NPR A;  3QJL A;  3O5T B;  3LUY A;  2GJF A;  1XIQ A;  1TVR A;  4A8O A;  4JI7 J;  2B9X A;  1YJW S;  2CFX A;  4FYV B;  3TEG A;  2RU3 A;  3OV7 A;  2GZO A;  4FYD A;  4DR7 J;  1VBY A;  1SH0 A;  1NB7 A;  4ELV A;  2GVD A;  1CBK A;  2ILZ A;  2KFY A;  2IA0 A;  1UFW A;  2N4D A;  2AYM A;  4IG3 B;  1CJT A;  4TY8 B;  4HLB A;  2XQC A;  4DV6 J;  1BWE A;  3NCP A;  3CTR A;  2V6A A;  4IFY B;  3DU6 A;  3ET6 A;  2VQE F;  2UUA J;  1SI9 A;  4L75 A;  4IR9 A;  3KHH A;  1KD1 T;  2E5H A;  4GC6 A;  3GYN A;  3VVT A;  1C1B B;  5E33 A;  2EW9 A;  3C14 B;  2HS4 A;  1WAC A;  3O2I A;  1RT4 A;  3FJ2 A;  1ULR A;  3BGU A;  2UV8 A;  1PC5 A;  1X5S A;  2GVZ B;  2JJ4 D;  4H4K A;  4OZJ A;  1PBU A;  1IXK A;  1VIX A;  2KYX A;  2VFS A;  4RNH A;  3VQT A;  5B0B A;  2VG6 A;  2VPX B;  1QTM A;  4NRT A;  4DFM A;  5ETP A;  3UDE A;  3D6M B;  1X4F A;  1IBK J;  3G71 S;  4EZ9 A;  2R7U A;  2ZBR A;  4JI6 F;  1RTI B;  3DGP B;  1S1U A;  4C7Q A;  3EDR B;  5HVH A;  2VC1 A;  1FJG J;  1EET B;  4ITS A;  4CLF A;  3TW0 A;  2V4R A;  2DK2 A;  4ICL A;  2MYF A;  3JS9 A;  1QAI A;  3D9B A;  1TR0 A;  5L1K A;  2QZ8 A;  3W5Y A;  1LK5 A;  4CI0 B;  3OVS A;  2AJQ A;  2WRM A;  1WDT A;  3F44 A;  5C2G A;  4AQY J;  5A2Q U;  1A6L A;  3AD9 C;  3I5B A;  2UXB F;  4ATN A;  1H38 A;  2XUL A;  2MZT A;  4WK1 A;  3T5J A;  4CLZ A;  1F3V A;  5L1L A;  3B54 A;  1SV5 A;  4IFV B;  2Z4P A;  2O67 A;  1S7I A;  2BE2 B;  3M7V A;  4A8S A;  1SUQ B;  3UD3 P;  1FX4 A;  3UR3 C;  4NCB A;  4TVA B;  2R8K A;  4F50 A;  4P9S A;  2V8D A;  3DRX A;  2XY7 A;  1UVL A;  4YHH J;  2C2O B;  4DSK A;  1S9G B;  2J9C A;  3FEY B;  1QVG R;  4JI1 J;  1UVN A;  4LF7 F;  1ELO A;  5BXI A;  2RRN A;  2IJF A;  2OFG X;  2J8S A;  4QJV A;  1VDH A;  3NL0 A;  2BEF A;  2O1P A;  2D3O R;  1D9A A;  2RRB A;  3QMQ A;  1VOM A;  3CCR S;  2VON A;  3KHL A;  2W25 A;  3C2P A;  5DGA A;  2VOD A;  2J9D A;  2KKH A;  4J91 A;  3WQP A;  2HZV A;  3EGZ A;  4ED1 A;  1B7F A;  3IAM 9;  3BDP A;  4LIR A;  2YQ1 A;  4DL5 A;  4ECR A;  2MKH A;  2E1R A;  1UW4 A;  3WIV A;  3GFY A;  4DR3 J;  2NZ4 A;  3CCL S;  1LK7 A;  3IWN C;  2H48 B;  3FBC A;  2QGF B;  3GIM A;  2BOA A;  2AX0 A;  9ATC B;  1W25 A;  4EEY A;  2RDD A;  4LT6 A;  3AHP A;  5M2U A;  1FRK A;  1BD6 A;  1RGV A;  1SJQ A;  4CH7 A;  1YG0 A;  2WB1 D;  1ZTW A;  4NA2 A;  1AYE A;  2W9B B;  2HHW A;  3EVO A;  3VAG A;  1S1X B;  3ZZO A;  3TVZ A;  3EXC X;  4X4R A;  3WC2 A;  2HRU A;  2XYP B;  2G1H A;  5LM7 E;  1E6Y A;  2HBQ B;  1X5T A;  2XSF A;  3N6L A;  3PXG a;  1A9N B;  2PEH A;  1HIY A;  2EVZ A;  1U25 A;  1QTN B;  2CG4 A;  2BAC A;  3B8H A;  5HAN A;  3TYT A;  4K7Q A;  2HBZ B;  3VAH A;  1U1K A;  1RWP B;  5KFX A;  2FLL A;  3BV8 A;  2BRL A;  4P72 A;  3CCJ S;  3CD0 A;  1VQP S;  1RTD A;  3M1V A;  1U1Q A;  4QCL A;  2GVZ A;  1U02 A;  1JX4 A;  2VBY A;  2QLX A;  3PW4 A;  3G87 A;  1X9S A;  2HG4 A;  2ZM6 J;  1HNV A;  3MM7 B;  1PAE X;  2BM0 A;  2HEK A;  5CZV A;  4ED5 A;  2D9P A;  1T11 A;  2FJD B;  2N3O A;  1FXL A;  3NGK A;  5KT4 A;  2BE9 B;  4OYP A;  2RRA A;  4C8O A;  2FC9 A;  2AJ1 A;  1DQ8 A;  5CH7 B;  3Q8Y A;  2KFZ A;  2XHC A;  3BQ2 A;  1VIS A;  4ICL B;  1OJ4 A;  2ABY A;  2LA6 A;  3M6W A;  4RBT A;  1BGX T;  3SBM A;  3SV3 A;  2HYI B;  2BKP A;  4K4W A;  1S10 A;  1N5Y B;  4CP5 A;  5KOW A;  3G8Q A;  4YUD A;  3TAN A;  2E1M C;  3KLG A;  2CVI A;  2KM8 C;  3HHN B;  1F5B A;  4DSI A;  4WWS A;  4ZPW R;  3I32 A;  3MMA B;  1SCJ B;  4QIF A;  3TP2 A;  5F9L A;  3A4T A;  1DLO B;  1XMB A;  3JSM A;  5I42 B;  3CC4 S;  3RW6 A;  2M88 A;  4J9V A;  2KHC A;  1O5J A;  4DL4 A;  2ROE A;  5J2N A;  1JJ4 A;  2HWH A;  4ZP6 A;  4Z7Y A;  5E3R A;  2BE2 A;  4F67 A;  3ITH A;  4L3N A;  3ZZU A;  3QFH A;  2UXD J;  3H59 A;  4M5H A;  2BKO A;  1R27 B;  2B0G A;  2QMU B;  2FVR A;  4WFN Q;  1VQ4 S;  3G8S A;  3HDS A;  4I68 A;  3AXK A;  2OAU A;  4CO4 A;  4DPY A;  3ZXW A;  2KN4 A;  4URG A;  3TUZ C;  3Q24 A;  2AU0 A;  1NJX A;  1F3F A;  2HVH A;  3EZU A;  2OD4 A;  1FDD A;  3DOK A;  4UF4 A;  4ZPV R;  4EFA C;  3LF0 A;  2HZC A;  3CCT A;  3CJQ A;  2JFD A;  4ZPA A;  5KFN A;  1HMV B;  5A8W B;  1PC4 A;  2I8E A;  3GJT B;  3FFI B;  3M05 A;  2IMW P;  1NH8 A;  3IO1 A;  3CCE S;  1FKP B;  3A8J A;  4M5I A;  4NX9 A;  4ETZ A;  2M2B A;  2YH0 A;  4FNH A;  2DNP A;  4B9V A;  5T41 A;  1FD2 A;  2YNH A;  2H3E B;  3DFE A;  3I9Z A;  3RAM A;  1T03 B;  3N6N A;  1QSS A;  1VQK S;  3RAQ A;  4N56 A;  5H9E J;  2HS3 A;  4F7V A;  2B7B B;  1N8R T;  1T95 A;  2CJK A;  2R7W A;  1B0V A;  1GMU A;  1OQ6 A;  3DOL B;  2NSB A;  5F3Z A;  2MKI A;  2KM8 B;  4M5M A;  5CYM A;  2V4J A;  5J2Q A;  4DF4 A;  2AQ4 A;  2JSX A;  4C98 A;  1HA1 A;  3FSX A;  3UCU P;  2FHJ A;  2XY5 A;  1IBL F;  2OGU A;  1Z4U A;  3EM1 A;  1E6Y B;  2IHR 1;  2P8I A;  1Z2L A;  3IFE A;  3MCS A;  3VTI A;  1RA7 A;  1IWA A;  3LAM A;  5DDP C;  1IBC B;  3IRX B;  2GHP A;  5K14 A;  2J6S A;  2FLP A;  3ENQ A;  5DJB A;  4X4O A;  3W65 A;  4GMK A;  4DF8 A;  1FJE B;  3LO3 A;  5HVF A;  3L4B C;  4MJK A;  2M8H A;  4YB7 A;  5EUH A;  3LPE A;  2ZJR Q;  2LQJ A;  1HPZ A;  2NYI A;  1RAJ A;  3AD8 C;  1JLE B;  3GB0 A;  3OTE A;  4CM0 A;  1S48 A;  1OQ3 A;  2OD6 A;  4WJB A;  5HLF A;  2DVI A;  1LW0 A;  4RW4 A;  4OI1 A;  4Z2X A;  4DS4 A;  3T1Y F;  3J7A 1;  1RWW B;  2JLG A;  1XK8 A;  1I1G A;  2XEX A;  3JTO A;  4K5S A;  1IKW A;  2F3J A;  3AA9 A;  4NLQ A;  2XMW A;  1JLF B;  4IH5 A;  2CZV C;  1URR A;  2HWI A;  1N5Y A;  1VR6 A;  5HL7 Q;  4DEZ A;  4ILL A;  3TAQ A;  4QU6 A;  4L6V 3;  4E8U A;  4KT0 C;  3MUT P;  1EHW A;  1YIT S;  2XZW A;  3I4P A;  2CQH A;  3MM8 A;  2QE5 A;  1NAQ A;  2O3D A;  4GO5 X;  3CCZ A;  1OO0 B;  4ECT A;  1R8A A;  3K8W A;  4QW8 A;  1JLQ A;  2N7C A;  1UEU A;  2A2D A;  3KYL A;  4OX8 A;  2C3O A;  1OPI A;  2DNG A;  4LSL A;  1N6Q A;  4N7T A;  1VRQ C;  3Q8Q B;  2F65 A;  3GV5 B;  2ZE2 B;  3PO4 A;  5E0O A;  3EZO A;  1W2I A;  2ZH5 A;  3BO2 A;  1RT5 B;  4F26 A;  1H7X A;  1X0F A;  3HI9 A;  5KG0 A;  3IGN A;  2BMB A;  2GGP A;  4H4M A;  1YRU A;  2F9D A;  4L76 A;  4I6Y A;  5D0H A;  3RBX A;  3NMA A;  2MST A;  5A8K A;  3L3C A;  3BKT A;  1S6P B;  2Z56 B;  3QBC A;  4DCP B;  3IM9 A;  5KTQ A;  3K5L A;  3BN7 A;  5KFB A;  1N88 A;  2QT7 A;  2SXL A;  3FFI A;  3FZ2 A;  3W7B A;  3MEG B;  4JYA F;  4QIE A;  4DV6 F;  3SDE A;  3BO4 A;  1HI0 P;  4UY8 T;  1VCT A;  1S1V A;  3AB2 B;  3R2D J;  3TAP A;  1SC3 B;  1SL1 A;  3MEE B;  1KR4 A;  5L46 A;  4M5L A;  5F8I A;  4DUT A;  5HVG A;  2V2V A;  5C25 B;  3TUP A;  4NXN J;  4H54 A;  4ZS6 A;  2NXN A;  1KEK A;  3G6V A;  4U95 A;  2V4J B;  1TQL A;  2WVC A;  3DOM B;  3M8Q A;  5DQH A;  2DPJ A;  5K5M A;  4P73 A;  1XC9 A;  4F0M A;  2DIU A;  4DV4 J;  4X66 J;  3ZTO A;  3M2U B;  2RSQ A;  2VPZ B;  4I2P B;  4QW9 A;  4W90 B;  1JXL A;  3OHB A;  1M1K T;  4OJ1 A;  1RTI A;  1RHJ B;  3OJU A;  1B0P A;  2YTC A;  4EYH B;  5ETK A;  4JV1 A;  4QWD A;  2MLZ A;  2PI4 A;  5F8N A;  5DRK A;  3FSI A;  3A12 A;  3RRK A;  2JLE A;  2FZK B;  2HFS A;  3D0G E;  3W2W B;  2F7V A;  4PYA A;  3AY0 A;  3W5X A;  3G96 A;  1HR0 J;  2MJN A;  1KVI A;  1CUL B;  1RYR A;  4Y2M A;  4LR7 A;  4ZLN A;  1VQN S;  1NDL A;  3KG0 A;  1NUE A;  1IBM F;  4YME A;  1NRK A;  2UXB J;  4K4T A;  4KY3 A;  5HJY A;  1FRM A;  5D6G A;  4DS5 A;  1U49 A;  4ZVT B;  3A8E A;  4ETX A;  2CDR B;  1XR7 A;  2IVM A;  5M2P A;  1SH2 A;  3TVK A;  2WVB A;  2DGO A;  4B3S J;  3I82 A;  1V5V A;  4ZVU B;  2YNI B;  1S9E B;  2R2S A;  1ZYQ A;  3SMZ A;  3DGV A;  4C9D A;  4UUX A;  4GRS A;  3M2R A;  2B6A B;  2FJB B;  2HKE A;  4DLE A;  1TL3 A;  2L3M A;  1WC3 A;  3FSY A;  4I7F B;  3JSB A;  2E7V A;  4AL7 A;  1FNX H;  4F3Q A;  1RI7 A;  1FE0 A;  1K8A T;  4LF6 J;  2YNF B;  4KC5 A;  4J9N A;  2HUR A;  3BYP A;  2WSC C;  3KNA A;  3RBD A;  2MLX A;  1OYE A;  1WG1 A;  5CYQ B;  4CO1 A;  4B3T F;  1FXD A;  1MN9 A;  3GCX P;  5D15 A;  1P8G A;  3KK2 A;  1B64 A;  4W4M A;  2HLU A;  2GVD B;  5GAE I;  1X4H A;  2LKZ A;  3L7P A;  4LFA F;  4KE5 A;  3IC1 A;  3TUI C;  2IM0 A;  3PYD A;  4I1T A;  3NS7 B;  2GGP B;  4FN5 A;  4H4M B;  3W5Z A;  2J8A A;  5K8M A;  2JEI A;  3TWZ A;  2V8V A;  4N76 A;  4JI3 J;  2AGP A;  2FJE B;  1HNI A;  2B3T B;  2E66 A;  1RAE B;  1XER A;  4ED2 A;  3CWJ A;  4C97 A;  3HM9 A;  3PRV A;  3V5R A;  3MEG A;  3C14 A;  3ZNU A;  1IJF B;  1MWZ A;  4TYA A;  4R0J A;  1RDR A;  4LF8 J;  5BYS A;  2VG6 B;  2OEK A;  4ES3 A;  2HNZ A;  1JLG A;  3OTO F;  2ZEJ A;  1VBZ A;  1RBO B;  1VJW A;  3GIK A;  4EBD A;  4ZDN A;  4C11 B;  3HP6 A;  1W2B R;  4URS A;  1TK8 A;  4YY3 F;  2HHS A;  4ANC A;  2RH3 A;  1WOP A;  2E5L J;  4JV5 J;  4ZN3 A;  2YWG A;  3PFE A;  1LV5 A;  2GNK A;  4ALZ A;  4C0B A;  2PMH A;  4KGZ B;  1N36 J;  2UVU A;  1MW7 A;  1JLA B;  3CD6 S;  3QPI A;  1VMB A;  5E2Q A;  3M8R A;  4AE5 A;  1XMO J;  5DDR C;  3N9U C;  4UW2 A;  3D5M A;  5KT5 A;  4P75 A;  5A6W A;  1HWI A;  5CZX A;  5DQI A;  4FKY A;  3UD4 P;  3PX0 A;  3RU0 A;  2DR6 A;  3CCS S;  1VQ9 S;  4B9U A;  4V19 J;  2XWY A;  2EXU A;  2X51 A;  1DLO A;  1FK9 A;  4O23 A;  4DG1 A;  2XO6 A;  5DG7 A;  5U47 A;  2IBK A;  4FBU A;  2OEL A;  3IRW P;  2V50 A;  4OI0 A;  2B4O A;  2PFF B;  1FX2 A;  3THP A;  1KN6 A;  1LXJ A;  2I38 A;  1HD0 A;  1TAQ A;  2BKN A;  4PKD B;  1BXN A;  3U7J A;  1K44 A;  1NPP A;  2XMU A;  4HL9 A;  4AXI A;  1KFS A;  1Y4Z B;  1FFS B;  1UWB A;  3PJX A;  4FVC A;  2EKY A;  2UXD F;  2HAI A;  2W24 A;  3R7N B;  2HHH J;  1HLW A;  1IKY A;  2DH9 A;  2Q6B A;  2U1A A;  5E41 A;  5KFJ A;  3G6X A;  3W9J A;  1NHU A;  4DFP A;  1HQU B;  1PBA A;  2YNF A;  3D6F B;  2Y0B B;  4NZ0 A;  4RO0 A;  2X1A A;  4KB7 A;  4NWB A;  2Y1L B;  1FFW B;  3CCU S;  4K4X A;  5H9E K;  1U1P A;  1YJU A;  2IIH A;  1V9O A;  3M8P B;  2OH2 A;  4ECQ A;  1YK9 A;  5JVG Q;  3PW2 A;  2AYG A;  3CJS A;  5F8L A;  3KXD A;  1TUW A;  3HHL C;  1KQK A;  4JI2 F;  3T6B A;  4Y34 A;  4WII A;  4ZPD A;  4MK7 A;  4QZV B;  4RW6 A;  4NYZ A;  2OEJ A;  1NXI A;  3H25 A;  3NS5 A;  4RUA A;  2NUU G;  4RW9 A;  4DR2 J;  2RHQ B;  1YRT A;  2VBW A;  3SCJ E;  4NZ6 A;  1YX2 A;  3AOB A;  3W3S A;  3OLB A;  4IOC Q;  3UR0 A;  4LRC A;  3ETM A;  4BC7 A;  4HDH A;  2XLJ A;  5J2P A;  2ZJQ Q;  3DMJ B;  4DN0 A;  2L08 A;  4ZHR B;  3KNG A;  3PYG A;  4CRJ A;  3ZNJ 1;  1JLG B;  1NU4 A;  2EEY A;  4UOF A;  3KLE A;  2JZ5 A;  4M94 A;  4NLD A;  3Q8P B;  3DDK A;  2XMA A;  3ENW A;  3LWM A;  2ACM A;  4C11 A;  1VLO A;  1VC0 A;  3NY0 A;  1REV B;  2KRB A;  2AJ2 A;  4NLW A;  3T1H J;  1VIO A;  2AYB A;  1ZAX A;  4IH7 A;  4ECS A;  1FF2 A;  1YVF A;  1JLC A;  3AJ1 A;  4HI2 A;  4JOU A;  4WU3 A;  2M70 A;  3BSN A;  4DV5 F;  4IOA Q;  4C8M A;  3H2V E;  2MMY A;  3T1Y J;  2XLI A;  3QT7 A;  2YKM A;  4WXW A;  3GTY X;  1AB8 A;  2CA9 A;  4TQR A;  1ZM4 A;  2KL8 A;  4RBV A;  3CDW A;  3MM9 B;  1ZZF A;  2HK2 A;  5T7L B;  4PG7 A;  4ZPB A;  2AWZ A;  2C3U A;  5KG1 A;  4DCO B;  2OJ3 A;  1LWX A;  3PAC A;  1E6V B;  2AD9 A;  2XLK A;  5HJX A;  3NAI A;  2X3D A;  3MM5 B;  3QJJ A;  1ZH5 A;  5HP1 B;  2VH7 A;  1U26 A;  1EQ0 A;  5IT9 Y;  1CJU B;  3GFX A;  2RUS A;  4TXS A;  3VAK A;  3CJ0 A;  2JL9 A;  2QN6 B;  1IUJ A;  3TX0 A;  1IKV A;  3EZ5 A;  2RAQ A;  3DHW C;  2KRR A;  5G0R B;  2N3L A;  5A6P A;  3CF5 Q;  1S99 A;  1EZZ B;  3HHD A;  1HYS A;  2JFK A;  2YPZ A;  2ZE2 A;  3CJ3 A;  2HZA A;  2DNM A;  4DX7 A;  2PO4 A;  1RYS A;  1TMM A;  4PR6 A;  4CO2 A;  4DV7 F;  4O0I A;  1UVJ A;  2KO1 A;  3M8P A;  1P9Q C;  3MOZ A;  2UU9 F;  4DV2 J;  3DU5 A;  2QLJ B;  3UNY A;  2ATC B;  4QR0 A;  4P7V A;  4D3H A;  2AX1 A;  2K7J A;  4YOE A;  2ACY A;  2AYE A;  2ZHA A;  1RLC L;  4LR9 A;  1NK4 A;  4K5R A;  2AT1 B;  1RT4 B;  2DNL A;  3CD5 A;  4Q0B B;  1C0U A;  1IWG A;  1GMV A;  4C48 A;  2QFI A;  2FJV A;  3GG1 A;  1SXL A;  4JI5 J;  5C7P A;  1IM6 A;  3MPW A;  3HJV A;  2MQN A;  4LF4 F;  1RBL A;  2W9C A;  2K2P A;  1OY9 A;  2FZC B;  2ZKT A;  2JWN A;  4WKY A;  4NXN F;  3ZZ0 A;  2CPE A;  2EG2 A;  1RJJ A;  1F9E B;  1GX5 A;  3AD7 C;  1HBU B;  2DNN A;  2IRY A;  5IFM A;  3CW2 C;  3CPW R;  5ETR A;  2HQD A;  5J2P B;  3QWU A;  2MZQ A;  2JVR A;  4HH1 A;  2Z57 B;  2ASD A;  5DGB A;  2FHJ D;  2OFH X;  2CNO B;  2CPD A;  2XG8 A;  5D0G A;  4ED4 A;  1UCN A;  1HI8 A;  2H51 B;  1I94 J;  1YBU A;  1FFG B;  2FLN A;  5IV4 A;  3QLH A;  4UOH A;  2W9A A;  1YIJ S;  4IOB A;  1OPZ A;  1BWV A;  4YQW A;  3QWP A;  3H4B A;  4DL3 A;  4IRC A;  1HAR A;  4UTG A;  3J7Y U;  2DXF A;  4GKJ J;  2MY7 A;  3EVW A;  1SKU B;  2JRS A;  2BW7 A;  3DRP B;  3ILL A;  3PCO B;  4M5G A;  3MR6 A;  2E5J A;  4PZV A;  1BMQ B;  2ALY B;  5CQG A;  3GIJ A;  3M30 B;  1IBM J;  2GIR A;  4FPR A;  4A47 A;  1XWL A;  4E0D A;  3PYF A;  2V2K A;  5KFP A;  2VJV A;  1N5S A;  3PKY A;  2QA4 G;  1XMQ F;  4LF5 F;  2XM3 A;  1IKX A;  3CCW A;  2AZ3 A;  3CMQ A;  3HK2 A;  3QNW B;  1SIW B;  2EK1 A;  2UP1 A;  4B3S F;  5HK4 A;  4OMF G;  2CQ0 A;  2DR9 A;  2FY8 A;  4USW A;  1HBN B;  3AT1 B;  5GAE U;  2XCP A;  4IG0 B;  5HP1 A;  4C6A A;  2IC3 A;  3PVX A;  3CUN A;  2UUC J;  2IRU A;  3HF5 A;  2CQD A;  4AND A;  2OPP A;  2LEP A;  3GIL A;  1PYO B;  2PEB A;  3HHL D;  1WC4 A;  1MSW D;  1R6Y A;  2CPI A;  4B3T J;  4ECU A;  5FDL A;  4DPO A;  5CXT A;  2JH3 A;  4AUK A;  1OMS A;  1C4C A;  1RWN B;  2BE7 D;  2RKI B;  4R8U B;  1S49 A;  3F0N A;  2ZZN A;  4ZIV A;  3MAQ A;  4J9Q A;  1H0H B;  4WP3 A;  3T5K A;  4LFA J;  1YJT A;  1PGZ A;  1F2G A;  2POK A;  1JJH A;  1M5H A;  2V9W A;  4DL6 A;  3FRY A;  2AIR B;  1AT1 B;  4MKA A;  4DV0 F;  1KC8 T;  1N0U A;  3I31 A;  3ZTQ A;  2VU5 A;  2R3V A;  2DNK A;  1UFK A;  2PFD A;  1D1U A;  2B8Q A;  5IS2 A;  4CLS A;  3QQC D;  2G2Z A;  2V68 A;  2G2O A;  4ZP7 A;  4QPX A;  3FNN A;  3A3N B;  3ISZ A;  4WYW A;  5F8H A;  1TL5 A;  1HWL A;  2P6S A;  4NCG A;  5K8P A;  2Q66 A;  1DAX A;  4KJI A;  3I4H X;  4F4Y A;  3E3X A;  2WB4 A;  5DLG A;  1FHT A;  2KTQ A;  1F1B B;  1NZA A;  5AXK A;  3GLJ A;  1TKT B;  1RTJ B;  1FTC A;  3MM7 A;  4AYB D;  4B3M J;  4IRD A;  4LF8 F;  4K0K F;  5D8H B;  1FCA A;  3BGF A;  3GU0 A;  4H4O A;  5EWF A;  3OTO J;  4DJB A;  5I4M A;  1U2R A;  3KLV A;  1XN9 A;  3PM9 A;  2EI5 A;  2Y0S D;  3SSR A;  4CH0 S;  3OW2 R;  4G3I A;  2BJD A;  2FHM A;  2JNJ A;  3HHE A;  1J5E J;  2PE8 A;  2YX4 A;  1RT6 B;  2PGC A;  4L73 A;  4USH A;  1SUQ A;  4RNN A;  5BJR A;  3KHR A;  4LSZ B;  4CLL A;  3J81 U;  3C8Y A;  3K57 A;  2X1G A;  3TJ8 A;  5AE2 A;  1AZS B;  1OYD A;  2H65 B;  4S0M A;  1JK9 B;  5F9N A;  4WPA A;  2J0X A;  4K50 A;  2J7U A;  1EP4 A;  3M2V B;  2IDE A;  3B6B A;  2AV5 A;  1ZAW A;  3KFW X;  3N0V A;  4DZD A;  5E3P A;  2DRB A;  3M8S A;  5GVQ A;  2GAG C;  2HGN A;  1R8B A;  2GQC A;  2LU2 A;  3OFE A;  3MAH A;  3M8Y A;  4RWW A;  1C0T A;  2RU9 A;  1PJ6 A;  3MGJ A;  1CVJ A;  2OLW A;  4OHX A;  1VC6 A;  3DLB A;  4DR4 F;  2R4F A;  5IV3 A;  1DFD A;  3CED A;  4ED0 A;  4OHW A;  2XMM A;  2IVF B;  2R8I A;  3DLJ A;  2LFV A;  4KAI A;  2DYA A;  2GO8 A;  1UPP A;  2HWT A;  4G1Q B;  2H9Z A;  4ECW A;  1LNQ A;  3MWB A;  1RAG B;  3H42 A;  4UOC A;  5JXS A;  2YNH B;  3D1H A;  3O6Q A;  4R5P A;  1U6B A;  3MPU B;  2YQ3 A;  4Q7A A;  1TTH B;  1APS A;  3IMQ J;  4DFK A;  5HN0 A;  2CPX A;  2RKI A;  1K9M T;  3HJF A;  4ZK7 M;  1T9X A;  3MPV A;  3RR8 A;  1L3V A;  4JI2 J;  2YPY A;  4NLS A;  1YBT A;  1WKJ A;  1VRU B;  3G4S S;  1UVM A;  3JQJ A;  4WE1 A;  3FMB A;  5KFO A;  4ZPT R;  1AUD A;  3MEC B;  3OSN A;  1WSR A;  1V6H A;  4CLK A;  2P9C A;  5AE3 A;  1S0M A;  1KDN A;  4DR2 F;  1RAC B;  3U02 A;  3DLE B;  2EC2 A;  4B08 A;  4DWI A;  1MU2 A;  4LFB J;  2DXD A;  3FCV A;  4X66 F;  1N34 J;  4NCG B;  4YN3 B;  1KFD A;  3HFK A;  2YWK A;  1PAU B;  3A3O B;  2XZD B;  3C16 A;  3EJM A;  1HW9 A;  1RK8 A;  4F0K A;  2KT3 A;  5A76 A;  2XB2 D;  2E7W A;  4QYR A;  1M90 T;  3CSK A;  3BO3 A;  1S6Q A;  3K5O A;  1YJ9 S;  3SFU A;  1AFI A;  3FBE A;  2RD5 C;  3TR5 A;  4YP3 A;  3MI7 X;  1WUU A;  1MWQ A;  2MQ8 A;  5GMD A;  3JTP A;  5ETM A;  1L3K A;  1GX6 A;  1WOS A;  1XQI A;  5LMU F;  1HBM A;  2OPQ A;  5MLC V;  5GAG U;  3WIU A;  1H7W A;  1F0X A;  2E1A A;  4TU8 A;  3KWM A;  1KHW A;  1HWK A;  2DD8 S;  3MM8 B;  3N28 A;  3J80 U;  3V4I A;  3LP0 A;  3IBC B;  7FD1 A;  4C8K A;  3QJP A;  1D8Y A;  2FYX A;  1MMN A;  2KJV A;  3MD1 A;  2MZJ A;  1JNZ B;  3W64 A;  4RLE A;  3QRP A;  5J1N A;  1P27 B;  1NK5 A;  4RWX A;  2LEB A;  1MNE A;  3S7R A;  3L7U A;  1VK8 A;  2AEJ A;  1T7P A;  1UWB B;  2GHW A;  3M6U A;  3ULH A;  1S79 A;  1DJ0 A;  1NHK L;  1IKY B;  2RQ4 A;  3FGV A;  3IP0 A;  4ZJL A;  3R2C J;  5HI7 A;  2FDN A;  4TU7 A;  4N47 A;  2XTJ P;  1RKI A;  4KIA A;  4A8Y A;  4LFB F;  2G0I A;  3U1N A;  2G13 A;  1TKZ A;  4IR1 A;  4Y28 C;  2XMK A;  2V5H G;  5A8R B;  3MR7 A;  1KRP A;  3BBC A;  2VG5 A;  5C24 B;  2YKO A;  8AT1 B;  3EPG A;  2CQP A;  1KHV A;  1VQO S;  4JBC A;  1BY9 A;  3MAA B;  3TAM B;  4EI2 A;  2R8J A;  3DOL A;  2PII A;  3OL7 A;  3RUB L;  1NEE A;  1X9W A;  5DO2 A;  3H8Y A;  3JTN A;  2DNH A;  1RT3 A;  2KT5 A;  3F56 A;  3ILI A;  2A6M A;  2QLF B;  2MEW A;  1LKZ A;  4OYO A;  2WTF A;  4WZQ A;  1S1T A;  3MEK A;  2ZH1 A;  2PT0 A;  1R6V A;  3OVA A;  1GEH A;  4DQS A;  4B9N A;  4A8Q A;  2C28 A;  4KKO B;  2RML A;  3FK4 A;  1B7Y B;  1H6K X;  2FB0 A;  2ILY A;  4Y0F A;  4XIU A;  3H4D A;  1M1H A;  4ZLL A;  3VGS A;  3MUM P;  1NK8 A;  3QGI A;  1FRJ A;  1XJW B;  2HFO A;  4OX9 F;  4DMZ A;  4C2M A;  3V6D A;  4NA3 A;  4PPD A;  5D78 A;  2AGQ A;  1HNZ F;  4JI4 F;  3WX4 A;  2ZBP A;  4ZHR A;  3MHY A;  2DO4 A;  2CQ1 A;  1ARO P;  3TJA A;  1SKS A;  1N5V A;  4BS2 A;  1RP5 A;  2DO0 A;  2WK4 A;  4RW4 B;  1LXN A;  3W8G A;  1FD8 A;  3OJS A;  1AW0 A;  1YDL A;  1IN0 A;  1HQ2 A;  1BQX A;  2DXE A;  4OHZ A;  2QYG A;  1CUL A;  5L39 A;  5KT3 A;  4B9M A;  1REV A;  3GZ7 A;  3R6G B;  4ZVP B;  1H98 A;  1GXL A;  1U2F A;  1FKO A;  2F40 A;  2YKA A;  1VQ6 S;  4X84 A;  2RHS B;  1I94 F;  1NSQ A;  1CQN A;  1G1X A;  2VKR A;  1S0O A;  2HPU A;  4ZVG A;  1N33 J;  1XEZ A;  1RXO B;  3BDE A;  2CAJ A;  3DRP A;  2HMI B;  2YWE A;  1HBM B;  3G6Y A;  1NK7 A;  2VOP A;  2XMV A;  2VFV A;  2ZC3 A;  2APO A;  3FUY A;  3GJQ B;  1BQN B;  4PQA A;  1KLM A;  2H1Y A;  1HHS A;  3BPD A;  4I7F A;  3V4I B;  3V81 A;  2P9E A;  5THW A;  3C6U B;  4WFX A;  4QWB A;  1Y9O A;  3KLF B;  4PUO A;  1TMJ A;  2KZM A;  1XMQ J;  4LF5 J;  3QFW A;  4MKB A;  4N8N A;  1Q79 A;  2OI2 A;  3CJ8 A;  3JYT A;  4LUB A;  4WFZ A;  1ZM2 A;  1QDU B;  4IG0 A;  1D3W A;  4U7U D;  4DR5 J;  3SSS A;  2ZH7 A;  1NDK A;  1YKW A;  4RBU A;  1DTQ A;  4RX6 A;  1X4G A;  3BR8 A;  2QIF A;  1FRH A;  2FIU A;  3O3L A;  4NLP A;  4DI6 A;  4RUH A;  5A2Q Y;  3GG0 A;  1JJ2 R;  3GR0 A;  5ETQ A;  4OFZ A;  1S1X A;  3V6K A;  5F8G A;  1QAX A;  7AT1 B;  3N6M A;  3ZTS A;  5DG8 A;  2E7X A;  5KFI A;  3MEE A;  2D41 A;  1S0N A;  1K1S A;  5AXN A;  1KTV A;  5HQM A;  1WD6 A;  4JI8 F;  3PTW A;  5KFS A;  4L72 B;  1H72 C;  2K3K A;  2KXH A;  1D9F A;  2D3U A;  2XI2 A;  4OYW A;  1DQA A;  1FO1 A;  1U0H B;  2KH9 A;  3HPO A;  3CC7 S;  5IOL A;  1PG5 B;  5C42 A;  3JSR A;  2ZOM A;  2ZZT A;  2AP6 A;  2MKK A;  4DV0 J;  4CM2 A;  3MMJ A;  3BKU A;  5EHH A;  4EUV A;  1UA0 A;  1BC6 A;  3OQ2 A;  1PCA A;  2L9D A;  2EBE A;  3GV8 B;  2X7I A;  3VVU A;  4AD6 A;  5JUM A;  3NNC A;  1N32 F;  2QTW A;  2QV6 A;  1TL7 A;  1U6Z A;  1TU0 B;  2OHD A;  1TKX B;  4Q8E A;  3HO1 A;  1HI1 A;  2M8D B;  3MF5 A;  2DGX A;  1XTZ A;  1U2C A;  2FD2 A;  1SV5 B;  4H4O B;  4IFV A;  1KLN A;  2QX0 A;  4B3M F;  2CG8 A;  4OV6 A;  3GON A;  3ZZY A;  3OSP A;  3NMR A;  1B99 A;  3CDE A;  3W62 A;  3QLH B;  4EBC A;  4A8M P;  2OUG A;  1F60 B;  3IR7 B;  4KSE B;  1WKK A;  2VQF F;  1NME B;  5I42 A;  3N4W A;  1XBW A;  3SCK E;  2QFJ A;  3VGU A;  1R43 A;  3W2V A;  4DX6 A;  3GSI A;  1TL4 A;  1SVD A;  2AJF E;  2IVY A;  3HD1 A;  3OR2 A;  1M1G A;  2YNI A;  5SZT A;  4DR6 F;  3MCN A;  1RWK B;  2RQM A;  4UUW A;  4ZJO A;  3GR1 A;  1HKA A;  1J5E F;  6AT1 B;  5J2M A;  1WEX A;  1CG2 A;  3ILO A;  4NLO A;  1Q5V A;  2HIY A;  2YX1 A;  4LQ9 A;  3SQO P;  1ACM B;  1ZM3 A;  2DGT A;  3DRY A;  3AAW B;  5K9F A;  4B9S A;  1C2P A;  1NSK L;  2MDA A;  4B02 A;  2HMI A;  2FGO A;  5FLX U;  2DKO B;  1U1M A;  3DN9 A;  3JSY A;  2XS7 A;  1HBN A;  2Z8Q A;  1K0V A;  3BSO A;  1AXQ A;  1FER A;  3KUE A;  3EVM A;  5CA5 A;  2B43 A;  3GFH A;  3LGH A;  3M4X A;  2D69 A;  3CE8 A;  3DRS B;  5D4P A;  4JI7 F;  1JKH B;  1HQE B;  1G6B A;  1CJK B;  3C6U A;  3KLF A;  4PUO B;  1JQG A;  3V4M A;  3K2Y A;  4M1K A;  3I96 A;  4YB5 A;  4B17 A;  2Z58 B;  2ERR A;  1RAI B;  4PRF A;  2XBP A;  2YWH A;  5BYR A;  4LRA A;  4LBH A;  4ZCI A;  2WBR A;  2IYG A;  3RR7 A;  3TNV A;  1M5V C;  2HFU A;  3KLH B;  2VAS A;  2DHX A;  3B78 A;  3ZFV A;  5CYM B;  5J2Q B;  1SJF A;  3NGR A;  2UUA F;  2A10 A;  2GJI A;  1SH3 A;  1FNO A;  2WVF A;  1X60 A;  1HBO B;  3NCQ A;  4HT7 A;  3BZQ A;  3P96 A;  4Y65 A;  1FEH A;  1I5O B;  2D1C A;  2ZUG A;  3SXL A;  5K20 B;  2DNQ A;  5JJB A;  4B9T A;  1VRU A;  1HNV B;  4USK A;  2NRE A;  2CNL B;  4ER8 A;  2L9W A;  4KPC A;  4WTY A;  2X3G A;  5D0E A;  1HHT P;  3SSQ A;  2QEX S;  1CLF A;  2ZIT A;  3LH2 S;  1Y00 A;  1KTQ A;  2IRX A;  4DDF A;  4KH0 B;  1FRL A;  3ZC4 A;  1LWC B;  4ENO A;  2LXF A;  2EFG A;  3F73 A;  5HMZ A;  4XO0 A;  1TKD A;  3DM2 B;  3IG1 A;  2M4M A;  3CDU A;  3CJT A;  2WVD A;  1R89 A;  2IM3 A;  1BLU A;  1CC8 A;  3RB3 A;  1LWE A;  4HKQ A;  2PMW A;  2WCX A;  3KLG B;  1N34 F;  2Y1I A;  2AW0 A;  5A0Y B;  4OIX A;  4DSJ A;  5FD1 A;  3OD2 A;  2PC6 A;  4TLQ A;  1VLY A;  3CMA S;  3R27 A;  2QC3 A;  1S6Q B;  3OTC A;  4IRK A;  3CB4 A;  3OL6 A;  3MMB B;  4X4N A;  4FZV A;  4V19 X;  1RB0 A;  2B7C B;  2XS5 A;  3BF4 A;  2MQP A;  2ZVS A;  2AEF A;  2O5D A;  3GFZ A;  3OLA A;  1VGY A;  1WF1 A;  5D4N A;  2VOO A;  4MH8 A;  3Q23 A;  2YKM B;  2G0C A;  3CDB A;  3OFH A;  3FEX B;  3HFZ B;  3R7B B;  4DPU A;  4CNY A;  3VV2 B;  2J9E A;  3IXQ A;  4RR5 A;  3U1L A;  4DU7 A;  2KU7 A;  2P5V A;  5DZ7 A;  5IM0 A;  2LA4 A;  1X4C A;  2ZFH A;  5HMX A;  3J80 Y;  4WCE Q;  2L41 A;  2K7K A;  3BJY A;  1WTB A;  2BOP A;  3TZW A;  4H4K C;  4NE9 C;  3AOC A;  6FDR A;  4LF7 J;  4IH6 A;  1PYS B;  1RWU A;  5T14 A;  1RT5 A;  3DXB A;  4Y2I A;  1VC5 A;  4IG3 A;  4TY8 A;  1M5O C;  1IKV B;  3NBP B;  2EFO A;  2VA3 A;  1TL1 B;  3H2U B;  4Y6I A;  3BPS P;  4DN9 A;  5KG2 A;  3AJD A;  2XZT B;  3D68 A;  1Q8L A;  5L38 A;  1T9W A;  3CXC R;  2VDI A;  4M8L A;  1R0A A;  1RU1 A;  1HYS B;  1RAH B;  4F4K A;  2CQ2 A;  2YY3 A;  4MK9 A;  3NNH A;  1Y3K A;  1U8W A;  2JLF A;  3MDF A;  4TYB A;  3RJM B;  3UO0 A;  2ZH2 A;  1YZ6 A;  3BQ1 A;  2WSE C;  4QIG A;  4ZVR B;  2MHN A;  1Q8K A;  1VQM S;  1VRT A;  2YXL A;  3T6J A;  3PW5 A;  3CCQ S;  4OQJ A;  1J27 A;  1QE1 A;  3HSD A;  2HQF A;  4OYZ A;  3DXS X;  1BUX A;  2YH1 A;  2Y1J A;  1LWF B;  2V8P A;  3MAA A;  3TAM A;  3HVA A;  3HT3 A;  3TO8 A;  1NZ8 A;  2OSR A;  3BS9 A;  4P6Q A;  3MOJ B;  2R2R A;  2HHV A;  3NGU A;  3PDN A;  3R5B A;  5E3Q A;  1NSA A;  1HBO A;  3TQE A;  1FRX A;  1S1T B;  3R5D A;  4USJ C;  1HWU A;  3SCL E;  2AEM A;  1Y11 A;  3TA1 A;  1YI2 S;  3EX7 B;  3QGG A;  4R0E A;  4HYK A;  1DAR A;  2CQI A;  5IC6 B;  1JLE A;  5KG7 A;  2CQC A;  4HI1 A;  5KFM A;  1VS3 A;  3GCW P;  5CCL A;  3NKY A;  5F0U A;  4QWE A;  3KMS A;  2EC0 A;  2LP4 A;  4FF1 A;  4OZ5 A;  4DPX A;  2CZ9 A;  3KK3 B;  1K73 T;  4B3O B;  1FDB A;  2QL5 B;  3Q89 A;  3GWC A;  2D3O 1;  1HNZ J;  5HQL A;  2HIQ A;  2CUY A;  3GYX B;  1JLF A;  2X1B A;  5GAG I;  3DM2 A;  2O66 A;  4IQX A;  5D0R A;  3DI6 B;  5I3P A;  2ZBQ A;  3TVY A;  5B09 A;  2W8K A;  1X4A A;  2ZDO A;  2R7O A;  5ETN A;  2K1R A;  1S6O A;  1PJ5 A;  2QSF A;  2W2Q P;  3FDS A;  3MCO A;  3NLC A;  4NZ7 A;  4MKY A;  2OKQ A;  3QZ7 A;  1T9V A;  3ZZP A;  4O3O A;  1ZAV A;  4KFB B;  5JMN A;  3B4M A;  2WZ1 A;  1C1C A;  1G7C B;  2HQC A;  3QIP A;  4CQ1 A;  2D7S A;  4CCH A;  2JEF A;  2N82 B;  3UDC A;  3D54 A;  2H54 B;  2JX2 A;  1TL3 B;  3N79 A;  3HHL A;  1EB0 A;  2Q6C A;  1HL6 A;  3ENA A;  3NOC A;  2E29 A;  2I6W A;  2GHV C;  4F4X A;  1UVI A;  1OY6 A;  5DLF A;  2DBB A;  2C3M A;  3MMC B;  3RW7 A;  4ZLJ A;  2G1D A;  4PG6 A;  4MFB B;  1VHF A;  4TLR A;  2RVJ A;  5I3U A;  1WNE A;  4XDD A;  5LXY A;  2WON B;  3CIZ A;  3I87 A;  1P1T A;  3UW1 A;  4F4A A;  1TEL A;  1RAD B;  2W8L A;  1Q78 A;  2V0N A;  5LMN F;  4KV8 B;  4DV3 F;  1S7H A;  2M7S A;  1TL1 A;  3I6P A;  3P8B B;  3R9L A;  3H20 A;  4I4B A;  2J0Q D;  3PY8 A;  2CJQ A;  3RG6 A;  3SDE B;  4JI0 F;  1H73 A;  3PJW A;  1RCX B;  4UST A;  4ZIT A;  4Q45 A;  3ETO A;  3IGV A;  2LVW A;  4JV2 A;  2WHO A;  4J9R A;  4DLG A;  4URQ U;  2X1F A;  5EDW A;  4XAK A;  1TUG B;  3GE9 A;  4KGK A;  4AFF A;  5L9X A;  1IM4 A;  3LTO A;  2QA1 A;  3MUR P;  1VI7 A;  1H2V Z;  3LP2 B;  1UZH A;  3HVR A;  1X8D A;  1UJ6 A;  2ZOF A;  4Y2C A;  3MED B;  3BN4 A;  3MFI A;  4ZCK A;  3LQV A;  5HMW A;  2W2P P;  3GYG A;  4I2P A;  2HNZ B;  1R7I A;  2AZ1 A;  2PD1 A;  2RDJ A;  3DHX A;  3TA2 A;  3R6L B;  4WBF A;  4LBP A;  5E7O B;  4DX5 A;  1IBL J;  1Q8I A;  3SQG A;  3UDL A;  3KG4 A;  1HBU A;  5B7W A;  6FD1 A;  4EU0 A;  2EWH A;  4C0O C;  2MZ1 A;  1DHM A;  3OR1 A;  1NB2 A;  1RTJ A;  4MAK A;  4BBY A;  3FC9 A;  2XY6 A;  3NOG A;  2YBV A;  3HKZ D;  4OZ0 A;  3ILJ A;  2W01 A;  1OY8 A;  4PQU B;  4ZVE A;  4CLT A;  1DBD A;  1SPB P;  4DPW A;  2Z2L A;  2DEI A;  2A6O A;  4LMZ A;  4QPT A;  3CT9 A;  2LU1 A;  4HVZ A;  2WSF C;  1VHI A;  1ZS6 A;  2C2K B;  2HND B;  1S59 A;  2XMJ A;  3D67 A;  5KFV A;  4DOZ A;  1QLN A;  1RT7 B;  2MQM A;  2HW3 A;  4LSN B;  4CIO A;  3KJV B;  2OSQ A;  3CJK A;  2BA9 A;  4CLW A;  3WX8 A;  3UFC X;  2BX6 A;  4I2Q A;  4OLP A;  4QWA A;  2FJW A;  2P9G A;  4I64 A;  3VCD A;  1G2E A;  3W9H A;  3G9C A;  4WTO B;  3TQ1 A;  3W2V B;  4BDP A;  2FLO A;  3TA0 A;  5IZH A;  1S57 A;  3OR2 B;  1YRX A;  2EKN A;  4RW8 A;  3C6T B;  4JUZ A;  5LSO A;  1R8H A;  2ZC4 A;  5J2M B;  3ICL A;  4DSF A;  2DEJ A;  3LAN A;  1TK5 A;  2HNY B;  5DQG A;  3KK2 B;  2XO7 A;  1XNQ J;  2VF3 A;  2HQG A;  3DLG B;  1CS4 A;  2MJU A;  2VFT A;  1NH7 A;  1TVR B;  4NPO A;  1RTZ A;  4LJM A;  2OPP B;  3T5H A;  4RW7 A;  3MR5 A;  3UN3 A;  2M9K A;  2KJW A;  3BBB A;  2CPZ A;  4HEA 9;  4I0W A;  1X9M A;  2FUG 9;  3UD5 A;  3HZE A;  3AFG A;  3OXL A;  5KG3 A;  2MB0 B;  3DRS A;  3HUL A;  5FDL B;  3MUV P;  3OVB A;  4K4S A;  5H9F K;  2ADC A;  1DTQ B;  2CQB A;  2C2Z B;  2B5J A;  4Q43 A;  3DNC A;  4DSE A;  4ID5 B;  3WHI A;  3QAU A;  3PIP Q;  2HHT A;  1UW9 A;  2JEG A;  2C42 A;  2FPH X;  1RKJ A;  1D09 B;  2NLW A;  3DLL Q;  3ET6 B;  5BR8 J;  1QUP A;  2VPW B;  3G82 B;  4KH1 B;  3C46 A;  3Q83 A;  4TQS A;  1PKU A;  3KLH A;  3LWL A;  2LYV A;  3TI0 A;  1VQ5 S;  2MZR A;  4WFA Q;  1V3R A;  1WEL A;  2YNG B;  1M5K C;  2XWX A;  1FNM A;  1HNW F;  2UV8 G;  3HXM A;  5LJ5 Y;  2N4C A;  3JXO A;  4J5O A;  5ADZ A;  2FHK A;  3IN5 A;  3O8W A;  1UZD A;  2LXU A;  4O44 A;  2UUB F;  4PWD B;  3VGV A;  1HW8 A;  4ZVH A;  4PWW A;  2CKW A;  3WZ0 A;  3Q8S B;  1I6J A;  2F4V J;  2R7V A;  4NA1 A;  1JWW A;  1DY3 A;  1ZBT A;  1WG5 A;  4X4Q A;  4J9M A;  4FYW B;  2C2D A;  2AJ0 A;  4BHQ A;  4X4T A;  3AJ2 A;  3SYZ A;  1S76 D;  1WC6 A;  2Q1L A;  2RB7 A;  3DRR A;  5IQ6 A;  4ED7 A;  1CPZ A;  4GC7 A;  3UN2 A;  2C2E A;  3QAT A;  2KB2 A;  3ZTP A;  5KFT A;  1RT6 A;  4DPT A;  3J7Y I;  3PV8 A;  1NJI T;  2KVI A;  1R0B G;  1HR0 F;  5HRO B;  2DT9 A;  2HSE B;  4OJH A;  4HH0 A;  4OZ2 A;  2DIS A;  2BUN A;  4WXO A;  5T7L A;  4Y00 A;  4K2X A;  5C2C A;  4WFY A;  2GJ2 A;  3R1H A;  2LCW A;  3CJK B;  3QT6 A;  2R2U A;  2D9O A;  4LSL B;  2HK3 A;  2C1E B;  2J0S D;  1V3S A;  2BW2 A;  3LP0 B;  2HFZ A;  4FVM A;  4RNM A;  1CJU A;  2E9T A;  3TEH B;  2V34 A;  2V67 A;  1UVK A;  4O4G B;  5D77 A;  3FMW A;  4DR7 F;  2V63 A;  2HVI A;  2BR0 A;  1UAW A;  3L95 X;  3PX4 A;  3PRD A;  1UWA A;  5HQ8 A;  2LQB A;  4DL2 A;  1NJY A;  2UVV A;  4ES1 A;  5CD4 H;  3RB6 A;  3DYA B;  2PA8 D;  4LF6 F;  1FEE A;  3IR6 B;  3T9Z A;  3CME S;  2AMC B;  4DQI A;  1VBK A;  2MZS A;  4LIW A;  4BWM A;  1X5O A;  1C4A A;  1JKH A;  1HQE A;  3VHQ A;  4OYI A;  2VQE J;  1SKW A;  3WBZ A;  2UVW A;  1Y5I B;  4G1Q A;  2D74 B;  4U7U K;  4EYI B;  4FXV A;  1KKH A;  1S5Z A;  1RWX B;  4ILM A;  1S1V B;  1B0T A;  3K5P A;  4CWB A;  2BRK A;  1RAB B;  2DIV A;  3DLK A;  4RW6 B;  4ZP8 A;  4WP9 A;  4LR8 A;  4A8W A;  4F3O A;  1QD1 A;  4C8N A;  1P9Y A;  3CJ5 A;  3GIR A;  4FNI A;  2IDL A;  3R5A A;  3R5G A;  4FPI A;  2K3I A;  2V9K A;  3ZZR A;  2R8G A;  3GJS B;  4O4R A;  2V8H A;  1XR5 A;  3QRR A;  4FXD A;  4Q0B A;  4JI6 J;  2CWK A;  2NZC A;  3IBF B;  5L1I A;  4M95 A;  1X0P A;  2RJZ A;  3MZI A;  3M2U A;  1Y3J A;  3DMJ A;  4NL5 A;  5E5N A;  3Q22 A;  1HWJ A;  3JAM U;  4USM A;  2GC8 A;  3DLE A;  3R8Y A;  4ZIW A;  3VAI A;  1T3N A;  5DM6 Q;  4U8Y A;  4ZA1 A;  1P1L A;  3I0S A;  4CLY A;  1RTD B;  4DZ6 A;  4AQY F;  3M6V A;  4F2S A;  2B9Y A;  2DR7 A;  5KFZ A;  2MQQ A;  1IVZ A;  1DTT A;  1JXV A;  3N5F A;  4W92 B;  2HHX A;  2GA7 A;  2EBG A;  4DUZ F;  2GCF A;  3V2U C;  4G6V B;  4P52 A;  4F02 A;  1FWL A;  3HHK A;  2ATL A;  1Q53 A;  1MRO B;  1NKC A;  2FQQ B;  2Y3Y A;  2L9N A;  1KQG B;  5HBM A;  3K5N A;  2CAD A;  4LRF A;  4NRU A;  2Y1R I;  3R5C A;  3J81 j;  1U7L A;  4ECX A;  4LFC F;  1WF0 A;  3A13 A;  1I51 B;  4ZVQ B;  1RU2 A;  3KLI B;  4HTJ A;  3I56 S;  1WC0 A;  4IDK A;  3DI6 A;  2DH8 A;  3PHT A;  4KR0 B;  4P71 A;  2IBO A;  1CC7 A;  3CO9 A;  4CYU B;  1X31 C;  4ZJQ A;  1J5O A;  2CYY A;  2HAF A;  1NO8 A;  2MLY A;  1SC6 A;  2IAJ B;  4FYY B;  3MM5 A;  4KHM A;  4PXB A;  4JV0 A;  3MMA A;  1N4L A;  1F6T A;  4P74 A;  3PX6 A;  4TY9 A;  5ETS A;  4X65 F;  3TAR A;  1PIL A;  3EGN A;  5HO4 A;  5EGY A;  3A3P B;  2ASJ A;  1FI4 A;  1T9T A;  2Z0G A;  1PO6 A;  4OYM A;  3M9M B;  1NND A;  3KG1 A;  4WYL A;  1HFE L;  1KLM B;  3CUL A;  2CRL A;  4DR3 F;  2V2Q A;  3H5U A;  3W66 A;  2B9W A;  1S9F A;  3OXF A;  4I6W A;  1SC1 B;  2ZJP Q;  3PW7 A;  2LMI A;  4OZN A;  1GTE A;  3R7S B;  1SJ1 A;  4Z37 A;  3TZY A;  1VFJ A;  3NS6 A;  1UMJ A;  5DDO C;  2NYH A;  3BKF A;  3QO9 B;  4KTQ A;  3IWL A;  4RU2 A;  1U24 A;  5E3A A;  3W9I A;  1HNI B;  1RWO B;  2QA2 A;  2VG5 B;  1KWM A;  2DCU B;  3KUG A;  1JLB B;  4KV8 A;  5C24 A;  3NCR A;  2VL1 A;  8RUC A;  4NOH A;  1A0O B;  5LMN J;  3QT5 A;  4K4V A;  3M9N B;  4DV3 J;  2QO3 A;  3RB0 A;  4IFY A;  4JI4 J;  3ISN D;  2CPF A;  5B0A A;  2FTR A;  1OWX A;  2A2C A;  1RT3 B;  3ONQ A;  4IO1 A;  2GW8 A;  2W9C B;  1U1O A;  2HHU A;  2MKS A;  1S1W B;  4YR2 A;  2PMZ D;  2P2C B;  3D7S B;  5ETT A;  3HSJ A;  1KOH A;  2ZM6 F;  2G9O A;  3F41 A;  4E98 A;  5FJ4 A;  2AKW B;  2KXN B;  4MIW A;  1QAY A;  4X4P A;  4ZLP A;  1NM2 A;  2CIM A;  3MED A;  4Q2L A;  5KG4 A;  4IKA A;  4DFJ A;  3N5B A;  1SJ3 P;  2RIJ A;  4C0H A;  2F63 A;  1S97 A;  5CHC B;  3IRX A;  2HFN A;  3AH6 A;  3K17 A;  4PWU A;  3TJ9 A;  1XR6 A;  4AT1 B;  1QSY A;  2WAQ D;  3OL9 A;  2CPH A;  4WK3 A;  5EX0 A;  1FJC A;  2NS1 B;  2R2T A;  3PYE A;  4MT1 A;  4PQU A;  2DHG A;  4EO8 A;  2E5G A;  3CCV S;  1FKO B;  2CVE A;  2LQ9 A;  4MYU A;  3E51 A;  2WOM B;  3WC0 A;  1ZA1 B;  1VBX A;  3JQM A;  1CJV A;  5J1E A;  4LF2 A;  4NLU A;  3BYR A;  2RF2 A;  3BSA A;  1Q1K A;  2NQP A;  2W7A A;  2ZNZ A;  4DV5 J;  2P6T A;  1IKX B;  1JIH A;  3FRZ A;  2XCA A;  1PSD A;  2DNR A;  2RNE A;  4YEA A;  2DPI A;  4I2Q B;  4O3R A;  1B70 B;  3BH7 B;  1EX8 A;  2XNQ A;  3EGV A;  3G6E S;  4J9P A;  5HRO A;  3FBF A;  1DQ9 A;  3RGI A;  3PFO A;  4ZPC A;  1AUS L;  1S9G A;  5KFW A;  3GSD A;  3MCM A;  2KZZ A;  3NP5 A;  3AXM A;  1WOR A;  2BJ3 A;  2ZWO A;  2ZUA A;  3MMC A;  2VA2 A;  1NBE B;  3BR9 A;  2NXC A;  3CJR A;  1RUS A;  2IFX A;  1NK9 A;  3LPY A;  5AT1 B;  2DRA A;  1NK6 A;  2VD3 A;  2GIF A;  1PIE A;  1NLK L;  3PW0 A;  1WHY A;  3THV A;  1XNQ F;  3GP9 A;  2E9Z A;  1SBR A;  4R5P B;  3KJF B;  3D4J A;  2DY1 A;  3C19 A;  2MSS A;  3SV4 A;  3IAS 9;  3IBW A;  3QO9 A;  2Y8W A;  1YJ7 A;  2AF6 A;  1S6P A;  1SB6 A;  3VAF A;  1R0C B;  3A8I A;  4DV7 J;  1Q5Y A;  1SL2 A;  2NR0 A;  2QLW A;  2PN6 A;  2XYG B;  4MIB A;  2XHW A;  1TZ0 A;  5EWG A;  2CJB A;  4DV2 F;  2HHP A;  4DCJ B;  3H5Y A;  1NJZ A;  1RTH A;  2W4P A;  1EIY B;  2YQ0 A;  3LP2 A;  4K4Z A;  3L7O A;  5C42 B;  4J9L A;  5BR8 F;  3M32 A;  4OZL A;  2DGS A;  2WW4 A;  1LW2 B;  5BYQ A;  4O0N A;  4O3S A;  2G4B A;  4KYZ A;  2ZH3 A;  4DQP A;  3NEK A;  2HBR B;  5ETV A;  3D3B J;  3DOM A;  3M8Q B;  3HLU A;  4OI6 A;  3SCI E;  1UA1 A;  4JI5 F;  4FS2 A;  3BGL A;  4LF4 J;  2FGC A;  4NLT A;  1W26 A;  3AB4 B;  3LGM A;  4P2X A;  1L5U A;  3K59 A;  4PWD A;  1ROF A;  3AA8 A;  1FVQ A;  3IG1 B;  3PEJ A;  2J0W A;  5IT4 A;  2BV3 A;  3BQ0 A;  4E2F B;  1JLC B;  2UUB J;  5AXM A;  4LF1 A;  2F4V F;  3THT A;  5IC4 B;  4KBI A;  2NXE A;  1NK0 A;  1FKA F;  2AJ4 A;  4X4V A;  3DRR B;  4OLO A;  2VPY B;  4GVB A;  7FDR A;  2MTL A;  4LSN A;  3RZA A;  4CLU A;  5LSR A;  2YX7 A;  2WOM A;  4U67 Q;  2GFF A;  2Y8Y A;  2VFR A;  3H5S A;  3R5J B;  2IA6 A;  5G4D A;  2KT2 A;  3MFH A;  4GKJ F;  3AOA A;  1DZ5 A;  1W7W A;  4YFU A;  4ANE A;  1GNK A;  2BJE A;  2CNK B;  1Q82 T;  5B0C A;  1UEK A;  2MKY A;  5KFE A;  3MM6 B;  5LT5 A;  3PR5 B;  1WF2 A;  5DG9 A;  1TP7 A;  2CDQ A;  4PXE A;  1ZM9 A;  2VDH A;  5ITH A;  2IMO A;  4YB1 P;  1SIZ A;  1UTA A;  4UQT A;  3T9N A;  1OS5 A;  4FKX A;  1NCL A;  4QR1 A;  5GAD I;  3ZZT A;  5AJ3 F;  1R0A B;  2UUC F;  3OPK A;  4JYA J;  1S72 S;  2GIQ A;  1G3O A;  3FKB A;  4LRB A;  4RNF A;  2RE1 A;  3MR3 A;  4HR2 A;  3NWR A;  1JJC B;  3AQP A;  3FQK A;  4QWC A;  5EN1 A;  3O44 A;  1TV6 A;  3FVY A;  4AL5 A;  5GAD U;  2DTJ A;  3SFG A;  1WHX A;  3ZTR A;  4Y2K A;  3BEG B;  1Y5L B;  3O1L A;  2R7X A;  2LQ5 A;  2CQG A;  2YKP A;  3KDN A;  4DV4 F;  1ICE B;  1ZTT A;  2AGO A;  1YJR A;  1QSL A;  1FES A;  3NNA A;  1WDD A;  3P4U B;  3RRG A;  3K89 A;  4M5N A;  4P2F A;  2XNR A;  2R42 A;  2HVE A;  2E1C A;  4FF2 A;  4Y2A A;  1IR2 A;  5D3G A;  3VWS A;  4I56 A;  3M32 B;  3E8O A;  5F8M A;  3HVT B;  2YWW A;  2EFQ A;  1RA6 A;  3C15 B;  4NML A;  2B4P A;  2YKQ A;  4OI3 A;  2MKJ A;  4RKU C;  2DNO A;  4USV A;  3IA0 A;  5F41 A;  1U1R A;  2MQL A;  2RS8 A;  3EGW B;  4IUF A;  4RU9 A;  3KJQ B;  4ZMM A;  4RL1 A;  3D66 A;  4OI2 A;  1GXT A;  1K0T A;  4K0K J;  1YJN S;  3OUY B;  1YQH A;  3RBE A;  4TKT A;  1LW0 B;  2FJA B;  3VAJ A;  1YTY A;  4DUZ J;  3T1A A;  5CD4 A;  5B08 A;  1U47 A;  1QVF R;  4F8R A;  1YWX A;  3D28 A;  3VF0 B;  4NXM J;  1BHN A;  2WW8 A;  5KFY A;  4QIW D;  5SUH A;  4M5D A;  4QYZ J;  1FJ7 A;  2DB1 A;  1VJQ A;  1KQF B;  1JLA A;  1U6F A;  3DC2 A;  4LFC J;  4LRD A;  4KFB A;  4UZC A;  2IM1 A;  3PG9 A;  1KBR A;  2VBZ A;  4L3K A;  4P7T A;  4FF4 A;  5KG6 A;  3B4D A;  4DL7 A;  1KS2 A;  1KVJ A;  3X3U A;  4ELU A;  5IM0 B;  3S1T A;  3CDA A;  2IC3 B;  5LOQ A;  4HT5 A;  3NXZ A;  1G4C A;  4NI2 B;  5LXR A;  1Q7Y T;  1H74 A;  1NDC A;  2OPS B;  3NGT A;  4X65 J;  2I5J B;  2UUW A;  3VAM A;  2VBX A;  1H2U X;  2OIH A;  3NBP A;  4OX7 A;  2DJW A;  1RIS A;  3ELH A;  2CPJ A;  4C8Y A;  2ZH4 A;  2R7Q A;  2FHO B;  3R97 A;  4UT4 A;  1URN A;  1T02 A;  3MPD A;  4CT8 A;  5A8R A;  2CWX A;  4MMO A;  4R25 A;  4JI3 F;  2KG0 A;  5L1J A;  4ERD A;  1N0V C;  1H3D A;  2KG1 A;  1GFW B;  4F4Z A;  5CYJ A;  4DR4 J;  3HFV A;  4K59 A;  3P49 B;  1ZOT A;  4HTI A;  4USU A;  3DLK B;  2QL7 B;  1WHW A;  3UNG C;  1QE1 B;  4EK2 A;  4CH1 A;  3OTB A;  3RB4 A;  1LWF A;  2B56 A;  2B8P A;  2QMX A;  4NEY A;  3U1M A;  4YDD B;  1JB0 C;  4KHP F;  1X4B A;  2LDI A;  3POT B;  3Q0A A;  2ROG A;  1FVS A;  1U0H A;  4HDG A;  2A18 A;  2DGW A;  2YKN A;  3SIP B;  1D9D A;  3T41 A;  1Q16 B;  1QY7 A;  2COL A;  4CT9 A;  5C25 A;  1SC4 B;  1WTF A;  2E1P A;  1S1W A;  3TX8 A;  3KK1 A;  1B3T A;  2H5I B;  2VG7 B;  4KO0 A;  5ETO A;  3JAM Y;  4FP9 A;  2ZH9 A;  1GT8 A;  2B51 A;  3DGP A;  4MKV A;  3Q8R B;  3QSI A;  3KTQ A;  2UXC F;  5K8O A;  2BBE A;  1EET A;  4YY3 J;  1YZ7 A;  3MTK A;  1N5Q A;  2C2R A;  2E5L F;  1LQ9 A;  1MWY A;  2ZVI A;  1VK3 A;  2J6U A;  2CJA A;  1N36 F;  3HVT A;  4K4Y A;  1U1N A;  3M8W A;  1XMO F;  1BQM B;  2J9D E;  5ETL A;  3S8S A;  1MRO A;  1T9U A;  3W2W A;  4C8L A;  2OO4 A;  2N7Y A;  3CVK A;  5HBM B;  2JHE A;  5IWA J;  4WFB Q;  2K1R B;  5KAK A;  2DR8 A;  1KON A;  3UVJ B;  2M0G B;  4CTA B;  2MKC A;  5DET A;  1H2T Z;  4P2M A;  1S77 D;  1RT7 A;  3HVW A;  4ED8 A;  4DQR A;  5LJ3 Y;  5DDQ C;  2BZ2 A;  3PKM A;  3JB9 k;  3J7Z 5;  2B4U A;  2B4V A;  3W60 A;  3TZZ A;  2RIL A;  3LA0 A;  3RAX A;  1MN7 A;  4A8K A;  4M5D B;  4BLG A;  3LAL A;  1FA0 A;  2HQ3 A;  2XGP A;  3DDN A;  2FZG B;  2JVO A;  2K8G A;  3CJ4 A;  4GVL A;  4PAB A;  3SZ2 A;  4C3L A;  2HHH F;  2QLB B;  3QAE A;  1RBA A;  5FLX Y;  1QJH A;  3MD3 A;  1E6V A;  1RCO B;  1Q8B A;  2HNY A;  4KQZ A;  4EZ6 A;  1L3U A;  1UEV A;  5F0W A;  2WON A;  1RHK B;  2HQI A;  3OTD A;  3VAL A;  2NPF A;  5HMY A;  4X64 J;  2Y9H A;  4K8R A;  4NLY A;  3S01 A;  4TU9 A;  5DS7 A;  4NLR A;  3R1L A;  1X4E A;  5D4L A;  5KFD A;  1RWV B;  3D1O A;  4LBI A;  3P45 B;  5MAO A;  3BSC A;  3KOA A;  4QU7 A;  2ZHO A;  5A8K B;  1F5C A;  5KOX A;  1Q4R A;  4RUC A;  2ZD1 A;  4ECZ A;  1JLB A;  4ZVO B;  3MXH P;  2WVE A;  1PYT A;  1U8S A;  4MK8 A;  4WE1 B;  2F5G A;  3LW5 C;  4N5S A;  1VQ8 S;  3QID A;  3VZH A;  3DCA A;  1RT2 A;  1RAF B;  4DUY F;  2ADB A;  4NYO A;  1S6U A;  3HKW A;  3D2W A;  3I0R B;  3FQL A;  3K8V A;  5B0G A;  3UCG A;  1KVK A;  4OL8 A;  1JXE A;  3Q86 A;  5IQQ A;  4OYB A;  5CAA A;  5DM7 Q;  2BJ1 A;  2MGZ B;  3POT A;  1RTH B;  2C3Y A;  1IQZ A;  1C0U B;  4K2J A;  2LDY A;  4Q44 A;  1HNX F;  3VZI A;  2JEJ A;  1T0T V;  1LFP A;  1TL7 B;  4HAC B;  3NAH A;  2RS2 A;  2ZZM A;  3OR1 B;  2O01 C;  3L9Z A;  1LW2 A;  3C3L A;  4YS2 A;  2HRT A;  4KO0 B;  2GML A;  1X5P A;  2VG7 A;  4Z7C A;  4YR3 A;  2W2N P;  3EUN A;  4RUB A;  5B0E A;  3T1H F;  4OX9 J;  2W4C A;  1CQM A;  2NXU A;  5KT7 A;  4PYD A;  3X1L B;  2I0X A;  2DGV A;  1IR0 A;  2HGM A;  3P3D A;  4ZVF A;  1DUR A;  2ASL A;  3HD2 A;  4EWT A;  3OL8 A;  4OX6 A;  1U1L A;  4KPY A;  4LVO P;  2WBM A;  1S4E A;  2H4W B;  3G86 A;  4M63 A;  3LGN A;  3MPY A;  4LVN P;  2QSW A;  1CJV B;  1FDN A;  1N48 A;  3CO0 P;  1UFL A;  3NWG A;  3KMQ A;  3FZB A;  4JV5 F;  1ZA2 B;  4DHV A;  2YWF A;  3RBZ A;  2Z30 B;  2DNZ A;  2JC1 A;  2BAN B;  5KT2 A;  3PEH A;  4WU2 A;  5EX3 A;  1FK9 B;  4DG1 B;  2OPR A;  3RRH A;  2BDP A;  2R7S A;  4ELT A;  4X62 F;  3D0H E;  1FXR A;  1UP1 A;  3BGR B;  2JDJ A;  4ZOS A;  4ZP9 A;  3TUJ C;  5CAB A;  1CJK A;  4IQM A;  4P10 A;  5HAO A;  5GME A;  3EDQ B;  1GQE A;  2F4F A;  3DYA A;  1N52 B;  1TKZ B;  1RAA B;  4MYT A;  1HMV A;  2BJ8 A;  1UET A;  2OMO A;  2XI3 A;  2V8G A;  3D0I E;  3Q2S C;  1NKB A;  4UY8 5;  2GMJ A;  4FBT A;  1HQU A;  2UU9 J;  2M5Y A;  1RE1 B;  3US5 A;  4DX8 H;  4EMD A;  5KFA A;  2OP5 A;  1KNZ A;  4PG4 A;  2V94 A;  4WIQ A;  2ZHB A;  4DR5 F;  1RHQ B;  1Y10 A;  1WSV A;  1R31 A;  2XSJ B;  2W9B A;  2MQO A;  4B3R F;  5AJ3 J;  5HSP A;  4OJ3 A;  4XPC A;  4UOG A;  4NLX A;  3V6J A;  1VQY A;  1Y0H A;  4Q2M A;  4AXJ A;  4OHV A;  3DKD A;  3PRB A;  2H5J B;  1EKR A;  1TV6 B;  4DSL A;  4W98 A;  2R8H A;  5JVH Q;  4FF3 A;  1TFW A;  2G2Y A;  4C4W A;  2F8E X;  2RQK A;  3G8T A;  1RT1 B;  3GPA A;  3U27 A;  2VB6 A;  3IM8 A;  4BCA A;  3EIC A;  3P5B P;  3UN5 A;  3ISN C;  2KVQ E;  3E2E A;  2LEC A;  2HHQ A;  1VQS A;  1BE4 A;  4I67 A;  1RHM B;  4F36 A;  2VC0 A;  1Z1Z A;  2QJ3 A;  3BH6 B;  3TRG A;  2VIH A;  4J9S A;  4D3G A;  1LWE B;  4J7C A;  2ROP A;  3KHG A;  4TNO A;  1S12 A;  3SEO A;  1GH8 A;  1DTT B;  2CJY B;  3MTJ A;  2VUG A;  5IT0 A;  3UWT A;  2ASY A;  5GAH I;  2V4Q A;  1QUV A;  3MMB A;  1N32 J;  2VZ9 A;  4ZVS B;  1N54 B;  4N41 A;  2BVZ A;  2DY9 A;  1RWM B;  2F1F A;  4O3Q A;  1NHV A;  3IS9 A;  4NMX A;  1PJ7 A;  3PJ9 A;  2U2F A;  3H40 A;  2QA4 S;  3BBF A;  4LF9 F;  1EAR A;  3OUY A;  4DV1 J;  4OV1 A;  3JSM B;  3KLI A;  5F8J A;  3T5L A;  1AFJ A;  2F8M A;  3VQS A;  2JOQ A;  4CYU A;  2UUT A;  1ZZN A;  2PDA A;  2UZA A;  5KFR A;  1MG7 A;  3OXG A;  4CDI A;  1S0V A;  1WKL A;  2VQF J;  1F2H A;  3QYY A;  1SQE A;  4NXM F;  1RAO A;  1YHQ S;  3MM9 A;  4DR6 J;  2NXJ A;  1T3O A;  3NG8 A;  3HSG A;  3D6T B;  4LRE A;  2F9J A;  1JLQ B;  1EP4 B;  2V69 A;  3M2V A;  3OHA A;  3JYT B;  2Q79 A;  1S4F A;  4USI A;  3UE2 A;  4A46 A;  1D0E A;  3I55 S;  2HGL A;  4ZCL A;  1EKS A;  4HHU A;  3T19 A;  5KT6 A;  4OYA A;  1WG4 A;  4A8X A;  4PPZ A;  2I5J A;  5A8W A;  1NSP A;  4A8F A;  1UL3 A;  2QMW A;  4C3K A;  2FVC A;  1Q95 G;  2DHA A;  1MML A;  4I69 A;  3HZG A;  1RZM A;  1UJ5 A;  3OBI A;  4L74 A;  2BJ7 A;  2W4D A;  4O3N A;  4F4W A;  3N01 A;  1L3S A;  3KJN B;  2RT3 A;  4ES2 A;  4M5K A;  4NYP A;  1UPM B;  5LL6 d;  5LSL A;  2DH7 A;  5RUB A;  2FC8 A;  1VQL S;  1WI6 A;  2GS8 A;  2FVQ A;  4WKR A;  4ED6 A;  1GAO A;  1O8B A;  3QGH A;  2ZWP A;  4U9R A;  2ZKU A;  1X4D A;  3M6X A;  3E01 A;  4UZB A;  2VIC A;  3DLH A;  1ITP A;  1HD1 A;  2NCK L;  3V6H A;  5KFQ A;  2HBY B;  1SL0 A;  4F2R A;  1GMW D;  4RPF A;  2JC0 A;  2FVS A;  4I6A A;  2KDO A;  3FBB A;  1EJ7 L;  5M2R A;  4NLG A;  3K7R A;  2YKN B;  3MEC A;  3I0S B;  4PAA A;  1EAY C;  3UCZ P;  1RT1 A;  2PA3 A;  2J7K A;  1XNR J;  1TKX A;  3D1Q A;  3FEZ A;  4MIA A;  3KK3 A;  4B3O A;  4QR2 A;  1N56 A;  1MMD A;  3HMJ G;  1FRI A;  1MU2 B;  3I9V 9;  4G65 A;  2DGU A;  3EWG A;  3PHE A;  4O3P A;  5KFL A;  4DR1 F;  4GKK J;  2UXC J;  2KXF A;  3J7A N;  2CNN B;  1WC5 A;  2BAB A;  4F0H A;  1WHV A;  1NKE A;  1IKW B;  2BQU A;  3H2L A;  3CC2 S;  2GO9 A;  3KJV A;  1L3T A;  4C8Z A;  2QYC A;  2J5A A;  4C3M A;  2HLT A;  1YLX A;  4CTA A;  2ALZ A;  4ZN1 A;  2RF2 B;  4PXC A;  3RYL A;  5KFG A;  1YGY A;  3BB5 A;  5IWA F;  4M5J A;  1Q86 T;  4GO7 X;  2IM2 A;  4XK8 C;  1WWH A;  3QGP A;  1Y7P A;  1LOU A;  1S9E A;  4RJV A;  2DHH A;  4PG8 A;  2ZDP A;  3EXY A;  1WEY A;  3PNI A;  3NGD A;  4MFB A;  4K4U A;  2XYH B;  3JQK A;  5J1P A;  3L09 A;  3LOU A;  1WC1 A;  4NI2 A;  4OI4 A;  3BGO P;  2XS2 A;  1GMW A;  1T9Y A;  5KFF A;  2DHS A;  1CJT B;  3ZZZ A;  3EYZ A;  5IXU A;  1T8E A;  1UKU A;  3OT9 A;  2XC9 A;  2VHG A;  1V5I B;  4NEZ A;  4KGX B;  4BC9 A;  1OSD A;  1SJR A;  2EK6 A;  4EBE A;  2B5J B;  2CQ3 A;  5L9N A;  4ID5 A;  2F8H A;  4X64 F;  2Z2Z A;  3UPF A;  1C1B A;  2EG1 A;  2M52 A;  3BRE A;  1R8P A;  3P5T L;  2W7O A;  3PO5 A;  4R8U A;  2K06 A;  5F3T A;  5HAT A;  3SI8 A;  2J6T A;  1IR1 A;  3BM7 A;  4IYQ A;  1TUV A;  4IO9 Q;  1IBK F;  4PCQ A;  3TOQ A;  3S6E A;  1VQ7 S;  2ZNY A;  1M5S A;  3CGI A;  2E9R X;  1FJG F;  2YNG A;  4FXW A;  5E3C A;  2CJX B;  4FYX B;  3H98 A;  3G2X A;  5AXL A;  3CJ2 A;  3HT0 A;  5CCM A;  5GMK a;  3C66 A;  3SQG B;  1FE4 A;  8ATC B;  2M3D A;  1RHR B;  3ADA C;  4DUY J;  1N5T A;  1CSJ A;  1R8C A;  3I0R A;  3Q8V A;  4WP8 A;  2DGQ A;  2KHD A;  2NPI A;  4O44 B;  3UQS A;  4KKO A;  4Q5V A;  4A48 A;  2HVZ A;  4UQG A;  4QBU A;  3QSY B;  2Z2M A;  4N8O A;  3CCM S;  1GTH A;  5KFU A;  4YB6 A;  1O51 A;  3W61 A;  3M9O B;  4DQQ A;  4LQ3 A;  4HAC A;  1JNR B;  2ZBC A;  4A4J A;  1HNX J;  2VJU A;  1ZET A;  4Q8F A;  1Q0N A;  1TKT A;  3CNQ P;  9RUB A;  2HND A;  4V1A k;  4OJG A;  4J90 A;  4PXD A;  1TK0 A;  2DR5 A;  3RTV A;  1WEZ A;  3I5C A;  1REG X;  3I5A A;  5KG5 A;  1BQM A;  1MLA A;  1IJE B;  2Z2Y B;  2MY8 A;  4ZCM A;  4U7C A;  2IJN A;  5LMU J;  1DRZ A;  4CNZ A;  4YHH F;  4YDX A;  1M0S A;  2RUG A;  3QZ8 A;  3FCH A;  2EFV A;  2A3J A;  4JI1 F;  1U0S A;  5J2N B;  3Q8U A;  1U48 A;  3W1Y C;  3QT8 A;  4GVB B;  3UI3 A;  1TAU A;  4NCA A;  2C22 A;  2BYC A;  3EE3 A;  3J81 Y;  3ITH B;  3K58 A;  4ECY A;  1WOO A;  3C6T A;  2VKZ G;  2GV1 A;  2VV5 A;  3M2R B;  2B6A A;  3OFF A;  3FCW A;  2LQ8 A;  4QIV A;  4AL6 A;  2ZH8 A;  4CLP A;  2I2Y A;  3DLG A;  1CS4 B;  1OSC A;  2IJR A;  2G0J A;  3GQC A;  2VFU A;  2I9S A;  3H90 A;  2BAN A;  1J2V A;  4JP8 A;  1SQG A;  3DOK B;  3EMT A;  4KGM A;  4RW7 B;  3VR1 A;  5CYQ A;  2XGQ A;  2OPR B;  1U45 A;  4DBQ A;  1BQN A;  2J7W A;  2R9L A;  4EO6 A;  4DL0 C;  4OHY A;  3BGR A;  3GMG A;  2Q43 A;  4F25 A;  1SQF A;  2HRY A;  1IQT A;  4X62 J;  3HSZ A;  2C3P A;  4RZR A;  1FKP A;  1F5A A;  1T05 A;  3PIO Q;  5H9F J;  1WJ9 A;  2AHO B;  2DIT A;  3PR4 A;  1FDA A;  1SJ4 P;  2MHE A;  4U6P A;  1VRT B;  1T03 A;  1QAJ A;  2ZBI A;  2R7R A;  1U09 A;  5GAH U;  3W63 A;  3G82 A;  3ZO7 A;  2EFN A;  3LP1 B;  2OML A;  2ZD1 B;  2OTL S;  1YJV A;  2NUH A;  2DCL A;  1HHQ A;  3H0P A;  3WDO A;  4JI0 J;  4G1I A;  1I3O B;  2XSJ A;  1RQ0 A; 
#chains in the Genus database with same CATH homology
 1NPK A;  1XIQ A;  3Q8Y A;  1W7W A;  4ANE A;  1NSQ A;  2DYA A;  4CP5 A;  4F4A A;  4KPC A;  1K44 A;  3ZTP A;  4DUT A;  1UCN A;  1HLW A;  3R9L A;  4UOG A;  4ENO A;  3DKD A;  4UOH A;  1WKJ A;  4W98 A;  3ZTO A;  4FKX A;  1NCL A;  2DXF A;  3EVW A;  3FKB A;  3GPA A;  3VVT A;  3EIC A;  4HR2 A;  1KDN A;  1MN7 A;  1F3F A;  1BE4 A;  2DXD A;  1NDK A;  3FCV A;  4F36 A;  4DI6 A;  2HVD A;  3BH6 B;  3ZTR A;  1LEO A;  2AZ3 A;  3EJM A;  2AZ1 A;  4WBF A;  1NDL A;  1NUE A;  1B4S A;  3ZTS A;  4C6A A;  3FBE A;  3JS9 A;  2DY9 A;  1NB2 A;  1S5Z A;  3FC9 A;  4AND A;  3ETM A;  2HVE A;  3PJ9 A;  3BBF A;  3BH7 B;  3DDI A;  3G2X A;  3FBF A;  5IOL A;  1XQI A;  3Q8V A;  4UOF A;  1ZS6 A;  3B54 A;  1WKL A;  1S59 A;  2CWK A;  2HUR A;  2ZUA A;  3EM1 A;  3VVU A;  3WX8 A;  2BX6 A;  1U8W A;  1MN9 A;  3ZTQ A;  2VU5 A;  1NLK L;  2B8Q A;  1BHN A;  3L7U A;  4DZ6 A;  3GP9 A;  1S57 A;  3Q86 A;  5BXI A;  5CAA A;  1NHK L;  2BEF A;  1BUX A;  1B99 A;  1JXV A;  1NSP A;  1WKK A;  1LWX A;  3NGU A;  3VGU A;  3Q8U A;  3EE3 A;  3BBC A;  3PRV A;  3BBB A;  1NDC A;  3NGT A;  3FBC A;  3FCW A;  3ELH A;  3VGT A;  1NSK L;  4O0N A;  1EHW A;  2NCK L;  1F6T A;  3MPD A;  3Q89 A;  3EMT A;  3EVO A;  1VYA A;  3EVM A;  3FBB A;  3Q83 A;  1HIY A;  4S0M A;  1PKU A;  3VGS A;  4EK2 A;  4ANC A;  3B6B A;  1NDP A;  2B8P A;  3NGS A;  5CAB A;  1PAE X;  3VGV A;  1HHQ A;  4FKY A;  3ENA A;  2DXE A;  3NGR A;  5C7P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...