2HURA

Escherichia coli nucleoside diphosphate kinase
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
142
structure length
142
Chain Sequence
AIERTFSIIKPNAVAKNVIGNIFARFEAAGFKIVGTKMLHLTVEQARGFYAEHDGKPFFDGLVEFMTSGPIVVSVLEGENAVQRHRDLLGATNPANALAGTLRADYADSLTENGTHGSDSVESAAREIAYFFGEGEVCPRTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NUCLEOSIDE DIPHOSPHATE KINASE
publication title The structure of the Escherichia coli nucleoside diphosphate kinase reveals a new quaternary architecture for this enzyme family
pubmed doi rcsb
source organism Escherichia coli
molecule tags Signaling protein,transferase
total genus 42
structure length 142
sequence length 142
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2006-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 2hurA00
3BBBA 1MN9A 2DXFA 1ZS6A 4DZ6A 1W7WA 3FCWA 1NLKL 1XIQA 3VGSA 2BX6A 3NGUA 1HLWA 1LEOA 4W98A 2DXEA 4C6AA 3NGSA 4UOFA 3EVOA 1WKLA 1NB2A 2HURA 3JS9A 1KDNA 1EHWA 1VYAA 1BHNA 1NDCA 3GP9A 5CABA 4HR2A 4ANDA 4UOGA 3NGRA 3ENAA 3BBFA 5BXIA 4F4AA 5CAAA 2B8PA 2DXDA 2HVDA 3EVWA 3EMTA 3R9LA 1HHQA 3PJ9A 4EK2A 3ELHA 1NSQA 2NCKL 3B6BA 3ZTQA 1NUEA 3ZTRA 4F36A 1WKKA 3B54A 3ZTOA 1MN7A 3FKBA 2BEFA 5IOLA 3FBCA 3Q89A 3DDIA 3NGTA 2DY9A 1NDKA 4ANCA 1LWXA 1NSKL 1BUXA 3Q8UA 3Q83A 3EJMA 3FCVA 3BBCA 4FKXA 3VGUA 3ZTSA 2B8QA 3VGTA 3VVTA 4CP5A 1NDPA 1WKJA 1NCLA 4WBFA 3G2XA 3L7UA 4DUTA 2DYAA 3VGVA 3FBFA 1NHKL 1PKUA 3Q8YA 1F6TA 3WX8A 1B99A 3EICA 3FBBA 3DKDA 1S59A 1NDLA 4S0MA 1PAEX 3EM1A 1JXVA 3Q86A 4ENOA 1B4SA 1HIYA 1S57A 1NPKA 5C7PA 4DI6A 1S5ZA 1NSPA 2ZUAA 3ETMA 3Q8VA 4FKYA 1K44A 2VU5A 1BE4A 1U8WA 3PRVA 2AZ1A 3GPAA 3FBEA 3BH6B 3EE3A 3FC9A 3BH7B 3ZTPA 1F3FA 2HVEA 1UCNA 2AZ3A 4KPCA 3MPDA 2CWKA 3VVUA 4UOHA 1XQIA 3EVMA 4ANEA 4O0NA
chains in the Genus database with same CATH superfamily
1YBTA 1UA1A 3VGSA 1R0BG 4CLTA 4CNZA 1S48A 1S6QB 1LW0A 3V6DA 2MKYA 1EIYB 2EFQA 2OPSA 4W4MA 2RAQA 3VAJA 3HD2A 1NDKA 1M1KT 1YBAA 4CO4A 2IYGA 2VA3A 3KUEA 1FI4A 2R7WA 2DD8S 2JC1A 5H9FJ 2DNHA 3PR5B 1VIXA 3CCQS 3VGVA 1S1TA 4K7QA 2QLXA 3VV2B 2CVIA 3KK2A 1SKSA 3SCJE 2VL1A 3CJ8A 4HHJA 4IRCA 4ED3A 1SPBP 1NM2A 4WF9Q 1VBZA 4Y65A 3P5TL 2HWTA 3RJMB 2W7OA 2HRTA 3BREA 3PIOQ 4BWJA 5DG7A 1DBDA 3H20A 3FMBA 4B17A 3LP0A 2B3TB 2ZH6A 3BN4A 1Y11A 1W2IA 4A8MP 2RE1A 1LWEA 3HM9A 4C3KA 1HWKA 4K2JA 4OHVA 4PXDA 2GIQA 4CM0A 3KOAA 5HO4A 4M5LA 4LSLA 3ZTOA 2DPIA 2FJEB 3CCLS 4YR2A 2D69A 2QGFB 3HXMA 2XYHB 3E3XA 4QPTA 2W1BA 1H72C 1IKXA 2YXLA 1T0TV 4KV8B 3NBPB 1FNXH 3PJWA 2V94A 2XMVA 3LP2A 1N34F 3UR3C 1FJEB 3UDEA 4O44A 4NYPA 4ECVA 5KFFA 4LREA 3PIPQ 4ZP8A 2ATCB 1RXOB 3EE3A 3NRBA 2GHPA 4DMZA 1RADB 3DGPB 1NJYA 5K9FA 3G96A 4KQZA 5LSOA 1WEYA 3KLEA 4YR3A 1JWWA 5GAEI 2YWWA 2MDAA 3FCWA 1BWVA 3SYZA 4Q44A 3HSJA 2G2ZA 2X1AA 2D3ZA 5DM7Q 2RF2B 1RWNB 4WFZA 3JS9A 9RUBA 3MMAA 3VALA 3LAKA 1E6VB 3ZXWA 4A8FA 2ZFHA 4QWEA 3GV5B 3JYTB 1NJZA 3DRPA 3US5A 2FYXA 4PQAA 1TMMA 3PJXA 1JK9B 1WEZA 5IXUA 2BKOA 3BBCA 1WC1A 2OD6A 6FD1A 2YKNA 4DV2F 4RW8A 4B3TJ 2R7RA 5LT5A 4O4GA 3EDRB 1R3NA 2CPHA 2VOPA 4CTAA 3FZ2A 4KO0A 3CJ0A 1QM9A 3BZQA 1FRKA 4F8RA 3W63A 5G0RA 1TL1B 3W8PA 2DNQA 3B78A 3H0PA 2NXCA 1CJVA 5CCLA 2O3DA 5DG9A 1CC7A 1RTJA 4L74A 1BXNA 5A6WA 2E1CA 2JZ5A 2N82B 3MEGB 3NP5A 1WTFA 3AT1B 4MT1A 5KFQA 4C6AA 3JSRA 4DN9A 1GXLA 3H25A 3DLGA 5AE1A 3KUHA 2ZHBA 3BGFA 1PCAA 1IBMF 4Z7CA 1KKHA 3D5MA 3NNCA 3MUVP 4MKBA 1MU2A 5I42A 1VR6A 1MROB 2IY5B 4DS5A 2FZKB 4U7UD 2BQRA 1QD1A 4HH0A 1YBUA 1BLUA 4P52A 4WPAA 2DHGA 1FE4A 2AGPA 1CJUA 1K1QA 3TEGA 5LJ5Y 2AJQA 3GQCA 1JXEA 4OI4A 3DKDA 4OJGA 1MG7A 2M3DA 3EM1A 3HSDA 2OPPA 2O1PA 5IC4B 4OZNA 1FHTA 3M8PB 3MR2A 3A4TA 4WE1B 1R8HA 3FQLA 2H54B 5B0BA 2KH9A 1EAYC 3DFEA 2J7KA 4DR5J 3QYYA 7AT1B 5FDLB 4JI8J 4IFVB 3TQEA 3TWZA 2FJDB 2JOQA 4A8QA 1VQ4S 3AODA 3SZ2A 3R5AA 2GVZA 5KFIA 1M1HA 4FVMA 5A8RB 3FEZA 2KL8A 5A2QY 2QV6A 3RB6A 2EK1A 3FJ2A 1TV6B 3NGUA 3EGNA 1KN6A 2IHR1 4CLWA 1DJ0A 3CJTA 2W9AA 1U8SA 4ED2A 4M5DA 1N6QB 1X4BA 5KFSA 2BW7A 2K7JA 1GXTA 1Q5YA 3M8RA 2HLTA 2M8DB 2HMIA 1S7HA 4W92B 1ZAWA 4NXNF 2C2RA 1BUXA 1S72S 2YNFA 2LQ5A 4E8UA 3MAAB 1OPIA 4R0JA 1S7IA 1XR7A 2CFXA 4CDIA 4B9MA 3OSPA 2HHTA 4Q0BB 3M05A 4DX6A 3QWUA 2HQIA 2WBRA 3A3PB 5C24A 2QMWA 2YWKA 4USHA 2QLWA 4AFFA 1RTHB 4Y34A 2QYCA 4QIWD 2JSXA 1ZETA 3C16B 1AA1B 4F2SA 2OLWA 2M88A 3AJDA 4EYIB 1VC5A 1HNZF 2H5JB 2NYIA 1SJFA 2HNYB 1QLNA 5ETTA 4OQJA 5HROA 4ZPTR 2YX7A 3CCES 1CBKA 2MKHA 4N8OA 3F44A 3EGWB 3G6ES 5ETSA 4EK2A 2WBMA 2V4QA 5HL7Q 3SQGA 3RBZA 2DPJA 1RHJB 4ECYA 2FJXA 3I9V9 3V6DB 2OPSB 3KFWX 2B4OA 1OYEA 2ATLA 3MR6A 3KJVA 2YWFA 5KFAA 3D9BA 1U0SA 4M5JA 3GONA 3H2VE 3D1HA 1U1QA 4WTYA 1S1TB 1XMOJ 2WW4A 4BC7A 3I5CA 3MFIA 1YITS 3KK2B 1AUDA 4QR0A 3GYXB 4FPIA 4GVLA 4I2QB 3CJ5A 3HX9A 4PG5A 3I6PA 3M9MB 1TUGB 3GJSB 5HJXA 3FFIA 5DLGA 4ZVTB 1YZ7A 4R0EA 2YKOA 4OX7A 2XO7A 4DR6J 3EX7B 1JLQB 1WWHA 4AQYF 3LP0B 3MMCB 4FYXB 1ZM9A 5HK4A 3CULA 4RNNA 3R2DJ 3H98A 2HRYA 5EHHA 1LWEB 3MPYA 5K14B 4TQSA 2J9DA 2JEIA 3ILIA 3RAMA 3N5BA 1IJEB 2CPZA 1X4DA 4LSLB 5I3UA 4OZLA 1RTIA 3MURP 4C4WA 3EXYA 1T02A 1IKXB 2IRYA 5KT6A 2I0XA 3DMJA 3OVBA 1Q1KA 4PEOA 3LP2B 1HPZA 1VRUB 4WFBQ 1XTZA 2MHNA 1VBXA 3DLLQ 2P6TA 3N6LA 3OBIA 4Y2AA 3CXCR 4IFYB 4AYBD 3HVWA 5LOQA 3QRQA 2MKSA 2YWHA 1APSA 4JI2F 4C98A 1JLFA 3C19A 1MN9A 3M9NB 4ZHRA 2KVQE 1RCXB 3KLEB 2RU9A 2RHQB 4K4XA 3CMQA 2VUGA 2BOPA 2YQ0A 4E98A 1U2RA 4OI2A 4DL4A 2ZWPA 4DV1F 2AIRB 1FDBA 4BBYA 3G6XA 3OD2A 1UZHA 3MMAB 3B6BA 4GC7A 1NBEB 2PT0A 2Q6BA 1NJWA 4DSJA 3UN3A 4ANCA 2BOAA 3W7BA 3UO0A 2LA4A 3IR5B 2KZZA 4C8LA 2XMWA 3DRPB 1AFIA 3CCWA 2JL9A 3UCZP 1TTHB 4X62J 1RAAB 2VBZA 3L7UA 3GU0A 1FRJA 1IXKA 1FTRA 1NH7A 1VS3A 2YKNB 5E0OA 4WFAQ 1ZM3A 2YBVA 4O4GB 1H98A 3EZOA 4H4KA 4CTAB 1VJWA 1QAIA 2ROGA 4KO0B 5I3PA 1BD6A 2WZ1A 2WVDA 5G0RB 4OJ1A 4LMZA 1RZMA 1DFDA 3QT6A 4DV6J 2CWKA 3H4DA 1S0NA 4F4ZA 1RTJB 3ET6B 1XIQA 4USUA 4H4KC 3KK1A 3UCUP 4FYVB 5KFWA 3HJVA 1AROP 4ZP7A 4Z37A 3R6LB 2P9GA 3DLGB 2VQFF 1XR5A 4LF5F 3ELHA 2RILA 3DLHA 3RG6A 1MU2B 3ZZZA 5I42B 3MM6A 3A8EA 3BQ1A 1VHFA 2XZWA 4L3KA 5DZ7A 3EJMA 3OFFA 4A46A 3PEHA 1T8EA 5MLCV 3GV7B 4P7TA 5KFBA 3KMSA 4DL2A 2LDIA 3RW6A 5DGBA 2EWHA 1JJ4A 2IC3B 3UW1A 4F50A 4G3IA 4KGXB 3GTYX 4ZVUB 1D9AA 2OPRA 3UDCA 4IO9Q 4PYAA 1IBMJ 4O3SA 5CYJA 2HAFA 1R89A 2QEXS 1R7IA 2YQ1A 4QWAA 3VAMA 3ITHB 4JBCA 2OPPB 3MEEA 1X9MA 2L08A 3P6YC 2CVEA 4RW6A 4RKUC 2POKA 3Q23A 5FIIA 2HEKA 1FA0A 2OTJS 1VBYA 2WHOA 3SEOA 3NG8A 4Y2MA 3KLHA 4KTQA 3C14B 1Y0HA 1NPRA 3TVZA 2NPIA 2B6AA 4ID5B 4NYZA 2BJ9A 2XHCA 3MTKA 2A6OA 4N47A 1KQKA 1N33F 2CJAA 1U09A 2DR6A 3OT9A 2AQ4A 5M2UA 2CQBA 1FXDA 3BDEA 1UWBA 5KFTA 2J9CA 1NK6A 4NXMF 2HMIB 2Q6CA 1Q81T 1QVFR 3H90A 3KHGA 2LLZA 2EBEA 3K58A 2ZDOA 5H9EK 2CPYA 1FNMA 3CCRS 2MYFA 5CZXA 3K0JA 2G2YA 5C24B 5C7PA 4IQXA 2DGUA 4UUWA 1AYEA 3MOZA 3FEXB 3PRVA 3WDOA 3GPAA 2FJBB 2CNOB 1EARA 1FE0A 4ZP9A 1FRXA 1X7VA 4DZ6A 1R43A 5F3ZA 1OY8A 3G82A 1CS4A 3VAHA 1HBOB 3N6MA 4NI2A 1REVA 5HMWA 4A8XA 1J5OA 2HQGA 1FWPA 3NLCA 3GP9A 4B3SJ 5HROB 1GEHA 3H5XA 3PM9A 5L1KA 2ZJQQ 5AE3A 4UF4A 1PBAA 2C3MA 2V50A 2MZQA 3ZZUA 5FD1A 3SQGB 1FCAA 2UVRA 3CJQA 1KEKA 4QWBA 2W7AA 3JSYA 3QGIA 4OFZA 3UN2A 3QRRA 1QSSA 5IWAF 4TLRA 3IG1A 3PW0A 2E1AA 1WELA 3C6TA 2L9DA 5JMNA 1P1LA 2N7CA 3MZIA 4GMKA 4HHHA 2B51A 4BWMA 5A8WA 4I6YA 3GMGA 4FXWA 4FNIA 4QQBA 1HD1A 4IRKA 4DCPB 1N54B 2UUWA 5DETA 2RJZA 3GFHA 2XMMA 3EVWA 2HHHJ 1SC3B 5L39A 4QWCA 3CUNA 3CJ4A 4YUDA 2AJ1A 3MPUB 4CLKA 5KFGA 3KYLA 2BKNA 4OV1A 2IAJA 4QYRA 3RR8A 3T5KA 2DY1A 3O1LA 3Q8SB 4OHXA 3R5DA 2SXLA 5E3AA 3U1MA 3MCNA 4EUVA 1FFGB 3PXGa 3WX4A 2BJEA 2OD4A 3N28A 1RTIB 3W61A 1H3DA 5AXKA 2UVUA 4OL8A 4CLUA 4NLQA 3PX6A 3GIJA 5KFPA 1OSCA 1X4FA 3DMJB 3HHLD 3T1HJ 4LF1A 4N41A 4ED7A 1Y00A 2KN4A 3NKYA 2ILZA 1W25A 1FWKA 2BE2A 3MI7X 2DHSA 1OY9A 4QJVA 1K47A 2UXBJ 2HQFA 4ZHRB 1E6YA 2OMOA 3D6HB 4USJC 2E5IA 3SQOP 3TZWA 2DNZA 2PSZA 2AJFE 1RT6A 4CIOA 2JEGA 1HMVA 2VIHA 2BR0A 5MAOA 4JI2J 3ZTSA 5JUMA 2CZ4A 3DYAA 1EP4B 5ETNA 1NHKL 4TNOA 2BKPA 5HQMA 2DRAA 2EI5A 1M0SA 4X66J 4M5NA 3E2EA 3QLHA 3S7RA 3NAIA 3NCPA 1TVRA 4U8YA 2PE8A 3QGGA 1T3NA 2FVSA 1UMJA 3MOJB 4ZPAA 4UZCA 1F60B 5SUHA 2VG6A 1EZZB 4K4TA 3DRXA 3A8IA 2WSEC 2IVMA 3RW7A 4X2BA 2XS7A 2CPJA 2O01C 3TAQA 1B7YB 5GAGI 4C97A 4LRFA 3GR0A 2JRSA 3A8JA 4IH6A 2ZOGA 2EKNA 4KE5A 3K5OA 3J81j 2ZBRA 1N5YB 2DEIA 4F36A 4DF4A 4WFXA 3Q89A 4YB5A 2ZH9A 2GW8A 2KT5A 1RT4A 2MKKA 1CJKA 3ZZPA 1Q78A 4QR1A 3FCVA 3MM6B 2NXUA 2YNGB 2GNKA 1DRZA 2F1FA 2XZTB 4Z2XA 1F9FA 3D54A 2BUNA 1TK5A 3RBXA 4L76A 5LXRA 4JUZA 1H2VZ 5IT9Y 4LF5J 2OPRB 2XB2D 1BE4A 4ELUA 1YJNS 2JVOA 2KG1A 4JI4J 1XWLA 2PDAA 5J1PA 3MM7A 3UCGA 4RW6B 5C2CA 4LFBF 5C25B 4RWXA 3W2WA 4DR2F 1RSCA 2J6TA 2HHXA 2C3OA 2CJQA 1V3SA 2VQEF 2HURA 3OTEA 2E9ZA 2G0JA 1QAXA 4J9LA 4ILRA 3KLHB 1SJQA 3UWTA 3W9IA 3CJSA 1S12A 4IO1A 1RWVB 4I67A 2B6AB 2KRRA 4B9TA 1FJ7A 1S0OA 2HZVA 5GADU 3SSSA 2CNLB 3T6JA 3THTA 2WONA 1QAJA 4MYTA 5HP1B 4ECZA 3KJQB 3LAMA 2GQCA 1F3VA 2ZM6J 3LA0A 2FZCB 5EGYA 2B8QA 4KH1B 4BDPA 1UWBB 2VASA 3PW7A 2F40A 1PKUA 1SB6A 4M1KA 1YIJS 1S1VA 5E3PA 2CPDA 4LIWA 2DHXA 2R2TA 2HK2A 2BANB 3UFCX 1BQNA 2FJAB 4WFYA 2G9OA 4FS2A 1AT1B 1N33J 2VU5A 3M6WA 2NPFA 4KGZB 3I9ZA 5CQGA 4KPCA 3EPGA 1GT8A 4ANEA 4EI2A 3OFHA 2GO8A 4AT1B 5H9EJ 3J81U 1SJ3P 1AW0A 2VC0A 5KG1A 4ECTA 2KYXA 3D67A 3G82B 3DLJA 2ZHOA 4NI2B 1REVB 4CZCA 3THVA 1OJ4A 1J5OB 3PJ9A 2ZZMA 3R1HA 4RBTA 2PEHA 1IJFB 4ZLLA 4V1Ak 4QU6A 2G0CA 3AAWB 4N5SA 5DDPC 1FVSA 1IKVA 5IZHA 1IVZA 3P3DA 2ZOMA 2FLOA 5L1JA 3VVTA 2OEKA 4OI3A 2HQCA 4NLRA 3MFHA 2DYAA 1F6TA 3IS9A 2DGOA 5HLFA 1T03B 2KB2A 2WTFA 4OYMA 1RB0A 2D1CA 2ERRA 4BS2A 1U0HA 4O0IA 2F8HA 3UE2A 2RQMA 2XYGB 2XHWA 3IG1B 2AZ1A 4RBVA 3C6TB 3I82A 1P8GA 4Q7AA 2LFVA 3C8YA 2OFGX 3QNWB 3CCMS 3WC2A 1V3RA 3OLAA 2DXFA 2VPZB 4CLZA 4YDDB 3BQ2A 1TFYA 3GIKA 3CDBA 4HHUA 1VMBA 1SJ1A 3T3FA 1T9TA 2F7VA 2GS8A 4NLPA 4EEYA 4DV3F 3TVKA 1ZBTA 2HG4A 4OHZA 4PABA 1FRIA 1SVDA 4R8UA 3ZZYA 1SKRA 3Q83A 1Y9OA 3DU5A 1R0AA 4N8NA 1IUJA 3QWPA 1VBKA 4WTOB 4BC9A 4Y0FA 4PKDB 3HSGA 2KHDA 5U47A 2R8HA 4QW8A 3M30A 1LQ9A 4S0MA 3MM8B 3I5BA 4KB7A 4PWDA 3AOAA 1SIWB 1X9WA 2AX1A 3OFEA 3D28A 3OTCA 1JKHA 4N56A 1Z1ZA 2MB0B 1FFWB 1U6BA 2WVCA 1S6PB 2RSQA 5L46A 3NY0A 5B7WA 1MMLA 2WAQD 1K0TA 3G8QA 4GKJF 1NDCA 3QFHA 2CQGA 3IM8A 3KLIB 4GRSA 1FD8A 4ZPDA 2B4PA 8RUCA 5ETVA 2G2OA 4DSFA 1E6YB 1WEXA 2OPQA 1WF0A 2RRBA 4CH1A 1KC8T 4JI1J 4DU8A 1DTQA 2OELA 4WWSA 5F8HA 2RD5C 2P2CB 3M6UA 3DCAA 1GFWB 2CQCA 1RT6B 3OXLA 3OL6A 2EXUA 3I31A 5LXYA 2G13A 2CJBA 1HI1A 2HSEB 1LK5A 2L48A 4LF6F 3RB4A 4IH7A 3C2PA 1YX2A 5HVFA 1UFKA 2JFDA 4J9SA 2B9YA 1FKPB 3DYAB 2PFDA 3OQ2A 2QL5B 4B3RF 2DNMA 3BSAA 1G6BA 1X4EA 2MQPA 1WUUA 1RWMB 1TKZA 1TVRB 2V8HA 3RB3A 3J7YI 4FS1A 3CJ2A 3LALA 3BSCA 1S77D 1VQMS 1W2BR 4DUZJ 5EWFA 3PX4A 4XPEA 1HARA 2DIUA 5ITHA 1RJJA 4W98A 2HFNA 4ZVEA 1WHWA 3G9CA 1WI6A 5K8PA 2Z58B 2GZOA 3IBCB 2XMAA 4ED4A 2C2ZB 4OZ3A 3BBFA 3C66A 1JLAA 1OY6A 4DEZA 3W60A 1RBOB 4DR1F 4EBCA 3PTWA 5AXLA 6AT1B 2C22A 1UAWA 4X65F 4MYUA 3HFVA 1TK8A 1CJKB 3AQOA 4ZPVR 2ZKUA 2AEMA 4DDFA 2V5HG 5D6GA 2F8EX 4J9MA 2AGOA 4ETXA 3TJAA 1VQLS 4JV2A 2FPHX 3R3TA 4RNMA 5GMKa 2MEWA 4HH1A 2ZZNA 3DLEA 3N01A 1Q79A 3AD9C 1RAOA 2CJYB 4WK1A 4Z7YA 1YJ7A 4CO2A 2K3IA 4MTPA 1FNOA 2XEXA 4X84A 2A1BA 5HBMB 2LDYA 5EN1A 2C3YA 4X4TA 4A8SA 2VODA 2W9CB 4UQGA 3PO5A 3MM7B 2IYIA 2C1EB 3NOCA 3TR5A 2BACA 1VYAA 3W2WB 3TO8A 2XULA 2ZBIA 1HHQA 4Q8EA 2B5JA 4P2SA 2D9PA 2XSJB 3PHTA 1DQ9A 5KFOA 1RE1B 4DFJA 1GMUA 2BEFA 2F4VJ 3Q8PB 2OSRA 4YHHF 4CWBA 1T05A 4TXSA 2GMJA 4L73A 2QA2A 4JYAF 2FVQA 4ZCKA 4ED8A 4OHYA 3JAMU 5CYMA 2I8EA 2GGPA 4WCEQ 4BCAA 2YWEA 2FQQB 2QTWA 4DL7A 1XMQF 3MMBA 4W90B 4EYHB 1S1VB 4C11A 3MM5A 1B0TA 1WNEA 3GLJA 3R8YA 4OJHA 4ZCLA 4OX9F 2PIIA 3L3CA 1VRTA 1H74A 2X1FA 3EVMA 3KDOA 5K5MA 1JNRB 4U95A 4AD6A 1WJ9A 1JXLA 4DQQA 5BXIA 5ETRA 4F0KA 4I64A 1D09B 4CLFA 2V0NA 2JHEA 3UPFA 5ETOA 1PJ5A 2ZE2A 1X4GA 1IM6A 1MSWD 3CD6S 4JI7J 1RWKB 1QY7A 4Y2IA 1IBLF 2H48B 1NB7A 1KQSR 1IKVB 1AZSA 1VQSA 1ZAVA 3EICA 4CLPA 3NNHA 3BJYA 4HI1A 1Q82T 4YB7A 4CRJA 1N4LA 3IS9B 4USIA 1GNKA 4IUFA 4KFBA 5HLFB 4OLPA 5GAEU 1KVJA 4LIRA 5E7OB 1HWLA 2CG8A 1M5OC 2DO4A 3HULA 2AJ2A 4O4RA 1WORA 4ES2A 3UVJA 4HTIA 3HKZD 1TR0A 3VAFA 3MMJA 2BQ3A 3PACA 2K2PA 5G4DA 3MDFA 1WKLA 3N9UC 5EX0A 1NB2A 3BSNA 2W4PA 4I7FB 3D6TB 4AL7A 3HT3A 1N5TA 4ICLA 5D15A 2ZITA 4I6WA 2UUCJ 2V2QA 4OV6A 4DU7A 4DQSA 1UVIA 3CCTA 2J76E 4KIAA 1ZZFA 2GJIA 2AV5A 1OO0B 4LF4F 5A8KA 5THWA 3KXDA 3C15A 1NCLA 2JVRA 2YH0A 4UOCA 1ITPA 1HHTP 1L3UA 1YTYA 2C42A 3PNIA 1XC9A 1S6UA 1XNQF 2HZAA 1AB8A 1FK9A 2WSFC 2FVPA 3M30B 2VH7A 1S6QA 1NXIA 4WP3A 4PWDB 1UZDA 4FPRA 3CCVS 1I94F 5L9NA 3TZYA 5ETMA 4RL1A 1N88A 3TJ8A 4FF1A 2VFRA 4PXBA 3BBBA 4CM2A 1WC6A 1JKHB 3RRHA 1BY9A 2YNHA 4DPTA 5D78A 4WKYA 3OV7A 2XLKA 1C0TA 4DPUA 4OJ3A 4X4VA 3FRZA 4YY3J 5F9NA 1FXRA 1U1RA 1HR0J 4WP9A 4UOGA 1S79A 2DXDA 5LMNF 2L41A 4IQMA 5D0GA 4XTTA 2GQ2A 3SXLA 3O44A 1JLGB 4QZVB 2QLJB 4RNFA 1SXLA 4AE5A 1JLBA 4LQ9A 2YKMB 2OPQB 4CLYA 1U6FA 1XBWA 5F8NA 1SL1A 4HEA9 4ERDA 1CLFA 3TQ1A 1DTQB 2GAGC 1NMEB 2V67A 3EPIA 2J9EA 2V68A 1KNZA 4GKJJ 2HHVA 5A0YA 4G1IA 2HBQB 4ECWA 8AT1B 1TK0A 4PWWA 4WZMA 2LEBA 4G1PA 3PCOB 3LP1A 4B9VA 3VZIA 3MR3A 2ZH8A 1TKZB 3PYEA 1VQNS 1K0VA 1NK5A 1PIEA 4LJMA 3MEKA 1HLWA 3P4UB 4LF6J 2M5YA 2CZVC 1RT2A 4JI6F 3UD4P 3MR5A 5KT3A 2KXHA 2VKZG 2QJ3A 3NGRA 3SCLE 2V63A 3TANA 4B3RJ 1Y7PA 3CB4A 5AJ3F 3W64A 1P1TA 1RHQB 2IVFB 1X0FA 3QO9A 1JLAB 3G4SS 3SBMA 2MJNA 3U7JA 3QJPA 4CO0A 3SI8A 2WW8A 3AY0A 5GAHU 3T1AA 2I2YA 2ZBPA 2VFUA 1WSRA 4F2RA 1WSVA 1H73A 3IWLA 5KFCA 5KG3A 3RBDA 2VONA 5B08A 5KFVA 3PR4A 4DUYF 4DV4F 3PVXA 2XC9A 3Q22A 5F0UA 1HWIA 3TYTA 1NKBA 3S6EA 3GSDA 2EFGA 2W01A 1NSPA 2E5LF 2HRUA 3PY8A 2GO9A 2RKIA 2LQJA 4DR1J 1ZPWX 3DI6B 4P71A 4C8MA 3NEKA 1HA1A 1TKTA 2GIFA 1N5SA 4LRDA 1J5EF 4UOFA 3M9OB 3ZFVA 3N0VA 4XIUA 4FYWB 2Y8WA 1PO6A 4J9QA 4EZ6A 1TL1A 1N0VC 1YG0A 2CAJA 1BGXT 2BE9B 1RWWB 1URNA 2B5JB 4ZLJA 2HKEA 4RNHA 3T5LA 2XY7A 2V34A 3V81A 3T9NA 4ED5A 4I1TA 5LMUJ 4ED6A 2H3EB 2UXCF 4FXDA 3CE8A 3EDQB 3GJTB 1QSYA 1KHVA 3GE9A 4DUTA 1T05B 1ZA1B 2FVRA 3MEGA 2GVDA 1G7CB 2GGPB 2HFSA 3KHHA 3ZC4A 3RBEA 3F56A 1VHIA 1RI7A 4LF7J 1Y3KA 2UP1A 3MMBB 4JI5F 1C1BA 4TN2A 3G8SA 2HWIA 4C11B 3MM5B 1A7GE 1MROA 3VVUA 2W4DA 2V9WA 4O3QA 2A3JA 4LF9J 3AA9A 3LTOA 4CO5A 1YJRA 2XM3A 1NLKL 5CCMA 4I6AA 5KFLA 1U26A 1RAHB 3KKFA 5CH7B 4IR9A 3O2IA 2J6UA 1CEZA 3HK2A 1I5OB 5CABA 2MKJA 3N6NA 3AHPA 3BGRB 4K8RA 2VJUA 3TW0A 4LBPA 2WB4A 4K0KF 3C6UA 2GCFA 3IP0A 4EO8A 1SQFA 2FHJA 2VFSA 3BKFA 3MD3A 5E41A 4ECSA 3CT9A 1FKOA 1UJ4A 4WE1A 1FO1A 4OX9J 4DSKA 3P8BB 1ZTTA 3KMQA 3DLKA 3JQKA 5IC6B 3LWMA 2EFPA 2CPEA 4PQUA 2IM0A 4LF8F 2R7SA 4A8YA 4J9PA 2ZE2B 4ZK7M 1SV5A 2NUUG 3I0RA 4NA3A 3D7SB 4TQRA 3FQKA 3V2UC 2CQDA 4J90A 3MR7A 5KFMA 4X4QA 1F5AA 4X4SA 5CD4H 4DX8H 3S8SA 4FYYB 2XMTA 2EFNA 4PUOB 1KFDA 2ZEJA 4KFBB 1U1KA 3MTJA 1LWCA 3BGOP 3Q24A 4RLEA 4MK7A 2Y0BB 4ZN1A 2UVVA 1B7FA 1DHMA 2QIFA 4NCAA 1IBLJ 3MHYA 3MAAA 1RAJA 2HBYB 2O67A 3UVJB 1RHMB 1JJCB 5EWGA 1R8BA 1KQFB 4HT5A 2CXEA 2Z8QA 4Q0BA 4WFNQ 4M8LA 4KHPJ 2WOMA 5LM7E 3NGKA 1RHUB 4J5OA 3CTRA 5L1IA 4ICLB 3OLBA 5J1EB 2BJ7A 1VI7A 2BZ2A 3W9JA 1G4CA 4M94A 2R7TA 1H0HB 3KG1A 1GX5A 1Q95G 3I87A 1SL2A 3RB0A 1IWAA 1IKWB 2HNYA 4JV0A 3D3BJ 3C15B 3OHBA 1NDLA 2RIJA 2X3DA 2KFYA 5F41A 2JH3A 1RT3A 3C3LA 1YJWS 1S5ZA 2NXJA 2XS2A 3CC2S 3X3UA 1FK9B 3FBEA 2DBBA 2HNZA 2Y1IA 3MPDA 3BV8A 4C7QA 2X3GA 3VF0B 1TL7A 2XNQA 2J7WA 2XGPA 2HW3A 2V4JA 2X1BA 2MQOA 4P75A 2A2DA 2YNHB 1QE1A 3ZO7A 2CADA 2AKWB 1X31C 1C0TB 4MKAA 3AB2B 1N5VA 1XNQJ 4F4WA 1S9GA 2ZD1A 2BMBA 1HI8A 2QRRA 3L09A 1KQGB 2J8SA 2ROEA 2M8HA 4O3PA 3T6BA 2DCUB 1WKKA 3LGNA 3FSIA 3V4IA 4K4WA 1SJRA 3E51A 3NCQA 2OH2A 4LQ3A 2R7VA 1JLBB 4CP5A 1L3TA 2ZH4A 1LOUA 1XERA 4I2QA 5B0FA 1HBUA 3D1QA 1UA0A 1HD0A 5DG8A 3HHEA 2GC8A 1F5CA 2ACMA 2IBOA 5CHCB 1S9FA 1UW9A 3GCXP 1JLQA 1KS2A 5A0YB 1U02A 1N48A 3OL7A 2RH3A 5GMDA 3MMCA 2H65B 2MTLA 1UVJA 2Y3YA 4IDKA 5K14A 2LXUA 2BYCA 3LP1B 4A48A 3R5GA 3A1YG 2QT7A 2EKYA 5GMEA 4C0HA 3OTDA 3CWJA 3T1YF 4OZ5A 4M63A 2LMIA 2LVWA 4ED1A 3EMTA 3J7AN 3BS9A 3I4HX 1RT2B 2EG2A 1NUEA 3I0SA 4P7VA 2RDDA 2F8MA 1VRUA 1K9MT 1H7XA 3I55S 3T19A 4ILMA 2IVYA 2Z0GA 5J2NA 1LK7A 4IFYA 1UWAA 3QO9B 2IA6A 1CQNA 2IJRA 2XYPB 2AYEA 1YJTA 4C8ZA 2HVHA 4OIXA 1V9OA 4WK3A 3M32A 5FLXY 4KGKA 4ZVSB 2XCPA 4TVAB 2Z2MA 4MIAA 1S57A 3CD0A 2E5JA 4ZVOB 1JLEB 5T14A 2LQ8A 2J0XA 3UDVA 5IQQA 2CWXA 3Q8QB 1UVNA 3MM9B 1GMWA 2RKIB 2RB7A 3MAQA 3HMJG 4I68A 5DRKA 4DS4A 5IV4A 2DO0A 2IM2A 2DNYA 1W7WA 5D0EA 3QATA 1S10A 4USMA 3OW2R 1Y5NB 1TKTB 1U1OA 2QL9B 3K2YA 4J7CA 1M5KC 2XNRA 3DGVA 2PC6A 4CH7A 2E5LJ 1DTTA 4C8NA 1S76D 2HLUA 1UTAA 3L7PA 3NAHA 2DR5A 4IR1A 3J80U 2CPFA 3SFUA 4UZBA 3QT8A 2DGSA 2OIHA 5KFHA 1UVLA 1RLDA 1T9VA 4IG3B 1BC6A 2E44A 2MZRA 4ZMMA 3V81B 2ACYA 2ROPA 4ILLA 1KTVA 3ET6A 3S01A 3HVRA 2GVDB 2U2FA 3VQSA 4DR7F 4WJBA 1T9UA 4XPCA 3L95X 4ZDNA 1M5PC 3FC9A 2V6AA 3EGVA 1VDHA 1S1UA 4X4NA 4NRUA 3V6JA 4H4OA 1C1BB 3QAUA 1NJIT 3UI3A 5L1LA 1TAUA 2UXCJ 2MLYA 1TP7A 2OUGA 5LSRA 4JV1A 3RRKA 2HVIA 1X5OA 1B0PA 2IC3A 4GKKF 1S9EB 1N36F 2Y1JA 5D3GA 2V2KA 2DNPA 4MFBA 1KTQA 3KDNA 4QOTA 2F9DA 4JI5J 2FLPA 2YWGA 1M90T 3C6UB 3ITHA 4LFAJ 1Q0NA 4U7UK 1S49A 1FKOB 1WHYA 3MPVA 2OMLA 2HK3A 2E7XA 1CPZA 4NZ6A 1CC8A 3DLKB 2W2OP 4IH5A 1MWYA 4ES3A 4KJIA 2CQPA 3GG1A 2EC2A 2XO6A 4CH0S 4PQUB 1URRA 1FEHA 3C14A 1ZA2B 2Q79A 2RRNA 1RACB 4AL6A 1P9QC 1SV5B 3BGLA 3I0RB 3IGNA 2QSFA 3D0GE 3QT5A 5F8JA 4ID5A 4FKYA 5ADZA 1I6JA 4LF2A 4L75A 3NL0A 1RQ0A 2CQHA 2XI2A 1IM4A 4AUKA 3BO2A 3CIMA 3UR0A 1LWCB 4B9NA 3I4PA 3C46A 2IPOB 5GVQA 3JTOA 1WHXA 4JV5J 3ISNC 2AWZA 3D6MB 1U4BA 2AW0A 3ONQA 4ZVRB 2UXDJ 1ZPVA 4P72A 1MN7A 1Z2ZA 2VB6A 2WOMB 2CPIA 2IFXA 5A6PA 3CDWA 4P2FA 4UT4A 1P27B 3QMQA 5KFXA 1S99A 4KKOB 2QC3A 2CPXA 4QPXA 3KG4A 3AD8C 2RQCA 3SDEA 4M5GA 5IFMA 1NPPA 2W8KA 3TAPA 3GYNA 1YJUA 1R8PA 1HBOA 3OL9A 4O23A 1SQEA 4XAKA 4ES1A 5CA5A 1S0VA 1L3SA 3GIMA 1RT3B 4DHVA 1HBNB 1Q8KA 2AYBA 2A2CA 2IJNA 2W9BA 4X4RA 2HNZB 5B0AA 1LKZA 3BQ0A 1TL7B 1SKUB 3TVYA 4Q8FA 2N3OA 4M5HA 2V4JB 3G71S 1KDNA 4F25A 3V6HA 3IC1A 3NS7B 2JC0A 3HO1A 2YX4A 1QE1B 2XQCA 4DXLA 2D3UA 2DEJA 3CCZA 1S9GB 3B54A 4QIFA 2ZD1B 5H9FK 1IR0A 2NREA 4PG6A 2J0WA 1PC4A 5IM0B 3V4IB 2GX8A 3RAXA 1RWPB 1LWFB 1CVJA 4NA1A 4NLSA 1UW4A 2IDEA 1FKAF 2F63A 2CNNB 3P5BP 4MK8A 3GCWP 5KOXA 2DR9A 2IIHA 2QMUB 1HBUB 2HHQA 3VHQA 1H2TZ 2JDJA 5GADI 4ZN3A 2FHOB 1KD1T 1XNRF 1YKWA 2OEMA 4OLOA 1KVIA 5F9LA 2WVFA 3PG9A 3GR1A 2HS4A 2XMUA 3CJRA 4IDKB 3QJJA 3IWXA 4DR4F 5KT2A 2OKQA 4RW7B 1CQMA 3GZ7A 2MSTA 4J9KA 5LL6d 3HCXA 4RUAA 4HR2A 3OUYA 1EKRA 1S97A 1U49A 2AD9A 2XY6A 1QSLA 1RWUA 1HBMA 3I0SB 2K3KA 2HYIB 2A10A 4ZVQB 4U96A 1BWEA 2VDHA 2B4VA 1L5UA 5J2NB 3PV8A 2I5JA 3IN5A 3P96A 2Y9HA 5KFUA 1JXVA 3B82A 4OZJA 4ZCIA 2KJVA 1Q16B 3KNGA 3M32B 1TELA 5EWEA 3HJFA 1QJHA 2HQDA 4ALZA 3ZTPA 1N34J 1F3FA 4RPFA 3J7ZT 3SCKE 3M6VA 4EMDA 1HNVA 5HMXA 1NK8A 2PI5A 1RK8A 2ZBCA 3NGSA 2VZ9A 1FDAA 2M2BA 1KLMA 5F0WA 1EP4A 1DQAA 5IT4A 2B43A 3EUNA 4RNOA 3CNQP 1Q86T 3K8VA 1DTTB 4FP9A 1T11A 3V5RA 1M5HA 1YDLA 3DRSA 4PG8A 2OEJA 4NASA 1DARA 2DHAA 2R9LA 2ZC4A 1S59A 1UVKA 4DCOB 1KOHA 2Y0SD 3DOKB 3RYLA 3FEYB 1FJCA 4K50A 4HKQA 4ENOA 2ZH2A 1D8ZA 5HMYA 2HPUA 4DV2J 3W2VA 3QBCA 1N5YA 1SJ4P 2YH1A 4HLBA 2VICA 3KHLA 2LU2A 2M0GB 4RUCA 4ZJLA 1S1UB 3QJLA 4H4OB 2UV8G 3EVOA 3MECA 1YK9A 4JI0F 1NO8A 2YNGA 3QFWA 1ICEB 3T5JA 4HDHA 2R2SA 8ATCB 3ZTQA 4EWTA 1U1PA 4NLWA 2J5AA 1QVGR 5D3GB 5D0RA 4MFBB 2N7YA 2CQ4A 1QTNB 4KAIA 2ZH7A 2CG4A 4HL9A 2DT9A 3PYFA 4GO5X 4DX5A 4WBFA 4B3MF 4PG4A 4DR5F 1N56A 1V5IB 2IA0A 3QAEA 1X9SA 5B0GA 5C25A 4C9DA 3PRDA 4A8OA 4AXIA 2ALYB 4GKKJ 2OAUA 1N36J 4DI6A 5HI7A 1QUVA 2XCAA 4QR2A 4F4YA 2F3JA 1HYSB 2HVEA 5E3RA 4E2FB 5BYSA 4USWA 1RAGB 3WC0A 1U1MA 3A13A 5HP1A 4XK8C 4YN3B 2BBEA 3DRRA 3R1LA 2BE7D 2RRAA 4CO1A 5ETLA 4DV7F 3R5BA 1RWXB 4FDFA 1NSQA 1T94A 1WOSA 4B08A 2BANA 4URGA 3RTVA 2FZGB 5J2PA 4FZVA 1RUSA 4TY8A 2GMLA 2DNRA 1GTHA 2MLXA 4NOHA 2B9XA 4DLEA 1GAOA 1KLNA 2HNDA 2PA3A 5F8LA 2HBZB 2DNOA 3U1NA 3WIVA 5KT7A 2PD1A 1FJGF 4MK9A 4NXNJ 3M8ZA 4RW4B 1IKYB 2GIRA 2ILYA 4A47A 3SDEB 2C2DA 3J7YU 1CG2A 4MMOA 4KGMA 1PYSB 5IV3A 2DNLA 5K8OA 2RQKA 3VQTA 2VF3A 2M7SA 5C42A 2O5DA 1ZS6A 9ATCB 2DNGA 1OS5A 2M4MA 2HWHA 1Q8LA 3O3LA 4NLXA 2EFVA 5KG7A 2W9BB 2HQ3A 2HS0A 1HNZJ 4UY8T 1FX2A 3WQPA 1YLXA 2UU9F 4NX9A 3NGDA 2R8GA 3OR1A 4EU0A 2VPWB 2FJWA 1T03A 4G65A 4PXCA 3KLFA 5EUHA 1NSAA 2OP5A 2QE5A 1GQEA 3OTOF 4ZITA 4OX8A 1PILA 4PAAA 1XMOF 5JVGQ 4MKVA 1KONA 2FHMA 4FN5A 2C3PA 1T9XA 2DCLA 4DJBA 3DC2A 1NK4A 1X5SA 4OZ0A 3PFOA 2ZHAA 2VBYA 1WC0A 3PW5A 3MCOA 2ASJA 1B3TA 2V9KA 4ZIWA 1YRTA 1D9DA 1AFJA 3Q8RB 2W2PP 5A76A 1PJ6A 4U6PA 1A0OB 3Q8VA 3F0NA 1IQZA 1HL6A 2LYVA 4NEYA 5DS7A 4L6V3 3TUPA 4DR6F 3ZZ0A 2F4FA 4WYWA 1OPZA 4NLUA 3VZHA 4J9RA 3CF5Q 3H4BA 5L38A 1WI8A 2CJXB 2KG0A 4RU9A 3OFGA 1Y5LB 3M4XA 2G1HA 2BJDA 5CAAA 2MZSA 3CJKA 1U1LA 3MM8A 5C5JA 4XDDA 1GXUA 1XNRJ 1PYOB 3OUYB 1HWUA 3FGVA 1V6HA 2BM1A 1HQEA 4LBIA 4M5IA 1C2PA 3ETOA 1KBRA 4AQYJ 1VQOS 2ZWOA 4FVCA 1H6KX 3DDNA 3IRXA 4C3LA 1HBMB 2VFTA 2XMKA 3IAM9 4DR4J 1S6PA 2CRLA 5JXSA 3R7SB 4I69A 2VD3A 4NLOA 3TUZC 2H4WB 2FLNA 2I5JB 2UVWA 1LFPA 3P49B 1RA7A 2AF6A 5KOWA 1FWLA 4P2XA 3KLIA 2K1RB 2P9CA 3DDKA 4I0WA 2HS3A 4P73A 3GSIA 4UOHA 2CDQA 3ILLA 5A2QU 2B7BB 1M1GA 5DQIA 3E8OA 3D6FB 3LWLA 3AFGA 1HNVB 4USVA 5E33A 3ZZOA 2LEPA 2NQPA 1O8BA 3POTA 1XR6A 4X62F 1KLMB 5CZVA 1FKPA 1YJ9S 2MQNA 2DGVA 3OR2A 2NCKL 4QCLA 1I3OB 1X4AA 2AEFA 2DGWA 2HGMA 5T41A 3G6YA 2UUBF 3D0IE 4DV1J 3JXOA 1X4CA 2YKPA 2RHSB 1LW2A 1WC4A 3IA0A 5IQ6A 3BF4A 3FBFA 1S1XA 2LQBA 3DRSB 1MNEA 3HSZA 1PBUA 2B4UA 4YDXA 4DV6F 5I4MA 3NMRA 1YVFA 4DPWA 2DRBA 2CQ0A 2DGXA 2E7WA 3K5MA 4ID8A 3PZPA 2MPUA 4UQTA 4WU2A 3W2VB 1SQGA 3BO3A 4N77A 4PPZA 3HDSA 2V2VA 1WG5A 1MWZA 1EETA 2QYGA 1FXLA 1JB0C 1RBAA 3T41A 1H38A 4X64F 2D9OA 4ANDA 4I2PA 3MECB 3ENAA 1CULB 4FXVA 3NXZA 1YGYA 4OYPA 2MXYA 5HN0A 2DNNA 3E01A 2B0GA 1PG5B 1H7WA 3H5UA 2I9SA 1N8RT 2N3LA 3S1TA 4CI0B 3IRWP 1CJTA 1NKCA 3AXKA 2ZZTA 2VQFJ 1BQMA 3K7RA 5B09A 3VGTA 3SIPB 2CKWA 3L7OA 5HBMA 3SSQA 2HBRB 4TYBA 5J1NA 1TKXB 4WXOA 3MEDB 1CSJA 2MKCA 4JI0J 4DQIA 2W9CA 2M52A 4OYBA 4DQPA 3CGIA 1FERA 4NLVA 2PFFB 3HZGA 1V3ZA 2HHSA 1QDUB 4USTA 3G87A 3GJRB 4NZ7A 2CZ9A 3BYPA 2NYHA 3R7BB 2DK2A 3M8SA 3GIIA 2XSJA 4OMFG 3KJNB 3VAIA 3AQPA 4NMXA 3EZUA 5HVGA 1JIHA 2L3MA 5EX3A 1HQUA 4B3MJ 2BJ1A 4M5KA 4DQRA 3OJSA 3DU6A 1VFJA 1KRPA 2GJ2A 2GQQA 5F8MA 4U8VA 3DRRB 2JLFA 3M1VA 2JEFA 1O6XA 3H5YA 3CO9A 2KXNB 2FHKA 2YVSA 4HI2A 2ZDPA 4F67A 4PYDA 3TZXA 2ZKTA 2LXFA 1GX6A 2D41A 2AYMA 2C3UA 3HFZB 3GFXA 5KFKA 3O8WA 5J2PB 2W8LA 4TY8B 2BQUA 2E7VA 5HAOA 1F9EB 2RU3A 5AT1B 3IAS9 5SZTA 4XO0A 2HNDB 4FF2A 2NR0A 4DSEA 2BV3A 4NXMJ 1TQLA 1HIYA 4DV7J 5H1SV 2FIUA 2Z2ZA 4C8YA 5HQ8A 4IKAA 4F0HA 1K44A 4YB6A 2JEJA 4OHWA 1UCNA 2AZ3A 4X4UA 4B3SF 1FF2A 5GAHI 3JTNA 2D3OR 3D3CJ 2W24A 2BX6A 4OI1A 1LEOA 1Y4ZB 2R7XA 5I3QA 2I1RA 5C42B 3M2UB 3LANA 2BJ3A 1FJGJ 1S0MA 2ALZA 3DHWC 2I6WA 2UUTA 4C0BA 4UTGA 4F4AA 1FT8A 3AH6A 3SFGA 4J91A 4TU7A 2HZCA 2QX0A 3CDAA 3CJ3A 2HAIA 2FTRA 3OR1B 3D66A 4F04B 3KLFB 4ZLNA 4ITSA 2NZCA 3M2RA 2V2ZA 2Z2LA 1LW0B 2HFVA 3BKUA 3K89A 2IJFA 1HHSA 2MHEA 4V19J 5E3CA 1HW8A 3MUMP 1EKSA 1T3OA 1SC1B 3BEGB 2UU9J 4Q2LA 1XJWB 3RU0A 2X1GA 4I7FA 2MQLA 4K4ZA 2ZVIA 4KR0B 1G2EA 3B8HA 5IWAJ 1EJ7L 3OTOJ 1FDDA 4RZRA 1NAQA 3NWGA 3VWSA 2LXIA 2HHHF 5K8MA 1TL4A 2ZOFA 1Y3JA 4M95A 3CC7S 3OSNA 4TKTA 4NMLA 1EHWA 4KRWA 1NRKA 2BRLA 3M2VA 4PXEA 4NPOA 1MW7A 1RKIA 4C8KA 1KOOA 2ZVSA 3LGMA 2V8PA 1WF1A 2VBXA 4DG1A 3FSXA 3CJKB 3Q8UA 3PFEA 3HLUA 2AEJA 1T9YA 1R27B 4N76A 2IMWP 1ACMB 4UW2A 5DQGA 1HQEB 5RUBA 2ADBA 1BMQB 3DOMA 3T1HF 3PKMA 3FBBA 3IR7B 3IRXB 3R5JB 3OTBA 2J0QD 3F41A 4DL6A 5D4NA 2V8DA 4OZ1A 4F3QA 2P8IA 4LSNA 2MY8A 2HHWA 2UXBF 2DH7A 1JLGA 2CIMA 2KHCA 3RUBL 3DXSX 1TFWA 3M7VA 2RUSA 2YKMA 4NE9C 3H42A 4PCQA 1N52B 2ABYA 3J81Y 1DLOA 3ZNUA 1UKUA 4O44B 1UVMA 1GK8A 3FRYA 5DDRC 3KK3A 1WDDA 3W5ZA 2VPXB 4F0MA 5E2QA 3O6QA 4FF3A 5KTQA 1FX4A 1U2CA 3POTB 4X66F 3OR2B 2R8KA 2YX1A 1JLCA 1DURA 1KVKA 2AHOB 1VQ5S 2C2NA 4B02A 4IOAQ 2XLJA 1YRXA 2E1MC 3H40A 1FVQA 1LW2B 1I51B 4DPOA 1D8YA 4N7TA 2DGQA 4C3MA 4KH0B 1S1XB 2AX0A 4GC6A 4CLLA 2OJ3A 4OYAA 2C2OB 4NLYA 2W2QP 5D0HA 2XLIA 3TX8A 4RW8B 1IR1A 2B56A 2UUBJ 5KG2A 1PGZA 5HSPA 4ZVHA 4A4JA 1SUQA 4LSZB 4QIVA 1RYRA 3PDNA 4NCBA 5KG5A 3A12A 1RHKB 1CJVB 3TUJC 3VAKA 3LO3A 3R5CA 1EETB 1FEEA 3ZTRA 4ATNA 3ICLA 3QGPA 1D3WA 5KG0A 2QA1A 4I2PB 3V4MA 4X4PA 4DF8A 3DLBA 2E66A 3E01B 3K5LA 4O3OA 4P74A 4C8OA 3THPA 3DI6A 2GAHC 4X4OA 4B3OA 2DJWA 1NH8A 2K8GA 3BYRA 1CJTB 2DNKA 1K8AT 2F9JA 5KFNA 3CPWR 1BQMB 2YNIA 3R7NB 1PAEX 5B0EA 4X64J 2XTJP 4JI4F 2XMJA 1VLYA 4HACA 4H54A 3TJ9A 1A9NB 1UP1A 4YQWA 2MQMA 1U25A 4F4KA 4ZVPB 1CJUB 4U67Q 1FRMA 3HZEA 1F1BB 3BO4A 3TP2A 2XWXA 4OYXA 3KTQA 1KWMA 2ASDA 2HIQA 4O3RA 3AD7C 1V5VA 4QIGA 5DQHA 3U02A 1R6YA 4ER8A 1TU0B 2MZ1A 1NZAA 3TEHB 2BA9A 1IBKF 2VG7A 3IM9A 1HQUB 1VC0A 4LT6A 2ZM6F 3JSBA 2A18A 4LFBJ 5J2MA 4DR2J 2IBKA 2GVZB 4DR3F 1WG4A 2VQEJ 3LGHA 3M1VB 2QFJA 1RLCL 1LWXA 2COLA 1U24A 2ZJPQ 1F0XA 5F8GA 2ZUGA 2RS8A 3OVSA 3CDUA 1F2GA 1M5VC 4R25A 3IMQJ 4M5DB 4K4UA 2KFZA 1U48A 3ILOA 1D0EA 3AJ2A 2NLWA 3MCMA 2DVIA 4NLGA 1Y10A 1B4SA 1NPKA 1VQ7S 4JI3F 3MGJA 1DQ8A 2YNFB 3BGRA 5KT5A 3GWCA 5KFRA 3M8WA 3GV8B 1SCJB 2PGCA 1R6VA 4DL3A 3LH2S 3HVAA 2PO4A 1L3VA 4QYZK 3QZ7A 1ROFA 4Q43A 3RGIA 1F9HA 5KFZA 2CJKA 1RABB 5JVHQ 3AOBA 1R31A 4ZS6A 1WOPA 2MSSA 4TU9A 2ZH1A 2CQIA 4OX6A 2QLBB 2J6SA 2H51B 4NCGA 2LECA 3SV3A 4ZPWR 2FJVA 3ILJA 2CQ1A 1PC5A 2DY9A 2VHGA 4OZ2A 2GMHA 2WVBA 2AP6A 2QA4S 4PUOA 4NRTA 4FKXA 2PN6A 3ADAC 1RA6A 4WU3A 4Y2CA 3Q8YA 2EVZA 4K5RA 3CCUS 3M2RB 1UEUA 1K1SA 3ZZTA 4KPYA 1OQ3A 5KG4A 3BM7A 1UPPA 3L4BC 4PZVA 4RWWA 1SH2A 1X4HA 4MAKA 2RDIA 3LUYA 4RR5A 3KJVB 3TAMA 4CO3A 2PMWA 5J1EA 4ZIVA 2AT1B 1GTEA 2A6MA 4B9SA 1UL3A 2XSFA 4EBEA 1HNWF 1DY3A 3AA8A 1U47A 3PYGA 2QO3A 4F3MA 5CD4A 3CMES 3RZAA 3NWRA 3EWGA 1IKWA 3UNYA 2B8PA 3R9LA 2P9EA 4F26A 3D68A 2J7UA 3M2VB 1Q7LB 1VQKS 3QT7A 1Z4UA 3MF5A 1C4AA 5KFEA 2KZMA 5KAKA 3PEJA 3FFIB 1PJ7A 4DBQA 4P9SA 3QSYB 2FD2A 4DV3J 4DG1B 1WOOA 2FVCA 3JAMY 1IQTA 5T7LA 3V6KA 3BB5A 4A8KA 2CDRB 4ZJQA 1KHWA 4NWBA 2GHWA 2IM3A 3LOUA 5IT9U 3DOMB 2RUGA 3F73A 1SC6A 3QRPA 4G1QA 1IWGA 1O0PA 1N0UA 2ZNYA 3CDEA 2B9EA 5I3UB 2BDPA 2YKAA 2DB1A 1JNZB 2VV5A 4LRBA 2QLFB 3ENQA 5L9XA 1MLAA 3GYGA 4LSNB 1U6ZA 3VTIA 4MJKA 3TX0A 2D74B 3UDLA 1ZM4A 3Q2SC 5E5NA 2QMXA 3OXFA 2FGOA 3KLGA 4JI1F 5K8NA 1HPZB 2E1RA 1DLOB 3JB9k 1QTMA 1RCOB 3K8WA 4B9UA 2V69A 4IOCQ 3KK3B 2V8GA 1JLFB 4ECRA 4IOBA 3UNGC 3DM2A 2OHDA 4Q45A 5L8RC 3LPYA 3W1YC 2DKOB 1WF2A 4LFCF 1F5BA 3UD3P 1YJVA 1JLCB 3GFZA 2OO4A 1X60A 1VRQC 2ZNZA 2R7OA 2VFVA 1FFSB 1T95A 3FMWA 2KT2A 3KWMA 1OQ6A 4LVNP 3TRGA 1JMTA 2BABA 5KFJA 4DUZF 3D4JA 4QW9A 2FHJD 4ECXA 2FB0A 2BM0A 1UETA 1U45A 2OSQA 1P9YA 4WIIA 2BVZA 3EYZA 4HYKA 1RHRB 3HD1A 1B64A 1Q8BA 2E5HA 2G4BA 3KJFB 3IBFB 3CW2C 3LF0A 2LKZA 3HPOA 4J9OA 1TZ0A 4MH8A 4DZDA 3FUYA 1HNXF 4ETZA 4WZQA 1VJQA 1O5JA 5LSLA 1NNDA 4DV5F 1ULRA 4FF4A 3KHRA 3IGVA 1SUQB 3BKTA 3SCIE 4XDCA 2FC8A 2HVDA 3H8YA 2R2UA 3RAQA 3MWBA 1EQ0A 2XS5A 2QA4G 3W62A 5KFYA 3FSYA 3HI9A 1JLEA 4QBUA 4NYOA 4EFAC 3KK1B 3MM9A 4ZA1A 2WCXA 3CIZA 4WYLA 4IYQA 4KHRA 4B3OB 3OXGA 4H4MA 2JLEA 1FESA 4X65J 4TYAA 3CC4S 2H5IB 2QFIA 2KRBA 4MKYA 2YNIB 4RUBA 4FBTA 3QPIA 5HQLA 2G1DA 1RAEB 3CEDA 4HACB 4C2MA 3MCSA 1JX4A 2I38A 2ZH3A 3I56S 1UJ6A 1RT1A 1Z2LA 1RT7A 1OIAA 4DL0C 5DJBA 3UQSA 3HFKA 3LW5C 1EB0A 4IG3A 1ZTWA 2F4VF 1KSPA 3M8YA 1IR2A 5F8IA 3MEEB 4OYOA 1RT5A 4GVBA 2VG7B 3GG0A 3HHLA 3FBCA 5J2MB 4DFKA 4F02A 2R42A 3JSMA 1J27A 4C0OC 4CNYA 3OPKA 2MGZA 3W8GA 2J8AA 2UV8A 4LR8A 2E5GA 4YHHJ 3HHLC 5D4LA 1IBKJ 3FDSA 4ZPBA 4JYAJ 1W26A 4ZJOA 3M6XA 4F7VA 2YPYA 4RO0A 5KT4A 1SBRA 3ETMA 2AYGA 3SMZA 1S9EA 4F3OA 4DR3J 1GMVA 5JJBA 3QSIA 2RQ4A 5HVHA 1D9FA 5DDOC 2X51A 3BH7B 3G86A 1YRUA 2KT3A 1XMQJ 2FY1A 5IS2A 3I5AA 2LEAA 2JNJA 2QG9B 1RAIB 1OMSA 3WBZA 2MQQA 3T5HA 1JQGA 2P5VA 1D1UA 5IT0A 2L9NA 4DSLA 4ECQA 1IN0A 4CT9A 2Y1LB 4BLGA 5J2QA 1VCTA 1U7LA 2Z4PA 4JI7F 4PG7A 4JI3J 2DISA 2JJ4D 1U2FA 2ASYA 1RISA 2WK4A 4RUHA 4UUXA 2UUAF 3IFEA 4NCGB 4ECUA 2W2MP 3HT0A 1S1WA 4WKRA 4QYZJ 4K4VA 1CS4B 3K5PA 3NOGA 2B9WA 2CQ2A 3X1LB 3VCDA 2DH8A 2NZ4A 3HHDA 2FGCA 1R8AA 3HF5A 2OI2A 1WC5A 2Y1RI 1RTZA 1L3KA 3AJ1A 2JWNA 4ELTA 5F3TA 3BH6B 2C2KB 2XBPA 4K4YA 5BR8F 2DH9A 2FDNA 5B0DA 2YQ3A 4J9NA 3DNCA 3TAMB 3HHKA 1SL0A 2UUCF 1T7PA 2HHUA 1VGYA 3R6GB 4KKOA 1TKDA 4Y00A 4Y28C 1OWXA 4DV0F 4KSEB 1FDNA 4PR6A 3PKYA 4BHQA 3BSOA 4CYUA 3H5SA 3D2WA 5A8WB 1NHVA 1S6OA 2GA7A 3BGUA 1GMWD 2PI4A 2W2NP 5M2PA 1PYTA 1ELOA 1HBNA 4DN0A 1LXJA 2Q3PA 2HIYA 4P10A 1HQ2A 3GJQB 2A0FB 2V4RA 2QN6B 4DL5A 1IBCB 2Z30B 1HNWJ 1RU1A 3SV4A 2R2RA 1NJXA 3J7A1 4OI6A 5D4OA 5T7LB 4NA2A 3R27A 4LF4J 1REGX 3UD5A 3JQMA 3GFYA 2JX2A 2N4CA 1R8CA 2IAJB 4EZ9A 3QIDA 2UZAA 2RNEA 3OHAA 4TY9A 2KXFA 2IM1A 4EBDA 4DCJB 4EO6A 4YY3F 4G1QB 1BQXA 2NSBA 1HR0F 2IRXA 4NLTA 1MWQA 2R8JA 5IM0A 2NUHA 1I94J 2GHVC 3JTPA 5BJRA 4YB1P 1LWFA 2XZDB 4Y6IA 4WP8A 1DZ5A 4CT8A 3KLGB 5EDWA 4Y3CA 3WZ0A 4YEAA 1YHQS 1UJ5A 3M8QA 2E29A 3IBWA 3TI0A 2GV1A 2KO1A 2PMZD 2H4YB 2BE2B 4NL5A 3FK4A 2EG1A 1ZM2A 2MZTA 1WG1A 2C2EA 3BDPA 1C1CA 5LMNJ 1RGVA 5ETQA 1XK8A 2WVEA 3DM2B 2MJUA 3MD1A 3H59A 1B70B 4P2MA 2QSWA 2RVJA 5M2RA 1DAXA 2RDJA 1FTCA 3Q86A 2KYZA 4RW7A 3BN7A 4FBUA 3TNVA 2G0IA 1HMVB 3A3OB 1HNIA 1VLOA 3DOLA 1YZ6A 5CYQA 4I56A 1XEZA 3I96A 3BR9A 3L9ZA 1ZAXA 2MKIA 3CCJS 2M70A 3ULHA 3QGHA 2VPYB 3HVTA 4O0NA 4WXWA 4DSIA 4LFCJ 3CO0P 3QLHB 4V19X 2RMLA 5KFDA 3NS5A 4C48A 4ZPCA 2MLZA 1YSJA 5DDQC 2VG6B 2ZJRQ 3LQVA 2RT3A 1VQ6S 2BW2A 2OGUA 1KP6A 3D1OA 1LXNA 3NNAA 1JJ2R 4LR7A 4ZOSA 1VQPS 3ISND 2IDLA 1TUVA 2Q43A 1NSKL 4LRAA 4PPDA 5DM6Q 4JI6J 3MUTP 2FY8A 6FDRA 4URSA 2E9RX 3IO1A 5AJ3J 1HNXJ 3U27A 4A8WA 2HFUA 2CQ3A 4DV5J 4ELVA 1B99A 4QIEA 3H2LA 4K2XA 4J9VA 2CJ9A 2E1PA 3SSRA 2VDIA 4H4MB 1RT4B 1OSDA 1XMBA 2KU7A 4DOZA 1U8WA 4TLQA 1X0PA 4R5PA 5KG6A 4DUYJ 4DV4J 4KY3A 3OVAA 1RTDA 4DFMA 2LU1A 4J37A 3K59A 3NCRA 4JB8B 4RX6A 1RKJA 1PSDA 1RT1B 1RT7B 3D0HE 2DRDA 2OFHX 4K5SA 4LBHA 1N32F 5LMUF 2XI3A 5D8HB 3DOKA 1J5EJ 1ZZNA 3H2UB 2EPIA 1RT5B 4GVBB 1TL3A 2MZJA 3HHLB 2PEBA 2F65A 3BPDA 5ETPA 2W25A 1O51A 4LF7F 1WKJA 1WDTA 3G2XA 4CCHA 3JSMB 2R7UA 3NMAA 1KFSA 2MGZB 4ED0A 4LVOP 2DHHA 3B4MA 2AJ4A 4LF9F 2DIVA 3FCHA 3IXQA 7FDRA 2WONB 1TUWA 1SKWA 1OYDA 1S4FA 4O3NA 2Z56B 3J7Z5 3W66A 3IR6B 4AL5A 1LNQA 4YP3A 1BQNB 2YTCA 1UFWA 1HWJA 1HW9A 2D7SA 2YKQA 4RW9A 5FJ4A 5AXMA 1HI0P 4KYZA 4U7CA 3N4WA 4Q2MA 5J2QB 4OYZA 1AUSL 3NS6A 3TZZA 4JOUA 3U1LA 4KHMA 1WD6A 2NXEA 4DPYA 3AOCA 4I4BA 1HYSA 3GB0A 1S1WB 4K0KJ 1HFEL 1MMDA 3BPSP 3VR1A 4MIWA 2MY7A 1VQ8S 3OL8A 3QIPA 3WIUA 4QU7A 4DFPA 3JQJA 2R3VA 4ZCMA 1UFLA 4LF8J 1C0UA 1Y5IB 2WSCC 3LPEA 1G1XA 2Q1LA 1Q53A 5K20B 1Q8IA 2UUAJ 1VQYA 3TARA 3TUIC 2H5EA 4IG0A 4ZLPA 3G6VA 2DTJA 4KHPF 3GILA 1Q7YT 4OI0A 3TA1A 2GFFA 5ETKA 2DXEA 1RBLA 1U0HB 2VA2A 3TOQA 5D4PA 3HP6A 2KM8C 4NZ0A 2VG5A 2Y8YA 4B9LA 1X5TA 4ZVGA 4RW4A 1IKYA 1C4CA 1WACA 1VIOA 2Z57B 3NGTA 2W4CA 3MXHP 3RRGA 4CYUB 1VISA 3J80Y 5BR8J 3MPWA 5B0CA 3K17A 1GH8A 2KKHA 1NDPA 3ENVA 4YOEA 3N5FA 1RDRA 2XY5A 2MMYA 5GAGU 1NZ8A 2EC0A 5BYQA 3DXBA 1LFWA 4DV0J 1ZOTA 2ZH5A 4R8UB 2AJ0A 5CXTA 1R0AB 1JJHA 4Y2KA 3PHEA 1XQIA 5D77A 3CMAS 3AXMA 5HMZA 1UPMB 4EGLA 4RU2A 3EXCX 5DO2A 1FD2A 4L3NA 2WRMA 3W5YA 4RJVA 2U1AA 1QAYA 4D3GA 3O5TB 3R97A 2K7KA 1VQ9S 5DZ6A 2KI2A 4CQ1A 4YFUA 2FC9A 3GIRA 2N4DA 1TAQA 5IOLA 2LQ9A 3M8QB 1FRLA 3N79A 1AXQA 4HTJA 3MAHA 3RR7A 1C1CB 1KR4A 2AMCB 1TL5A 2L9WA 5HANA 2LP4A 2ASLA 4WIQA 2ZUAA 4LUBA 2K06A 4YR0A 3FZBA 1HNIB 3DOLB 4DX7A 3W9HA 2O66A 2IMOA 4HT7A 5CYQB 2B7CB 2H1YA 2CYYA 3BR8A 3T9ZA 3CVKA 1WTBA 2LA6A 4YS2A 2R7QA 5C2GA 3HVTB 1Q4RA 1XN9A 3EGZA 3CCSS 3FVYA 4J9UE 2E9TA 4UY85 2YPZA 3CSKA 3PX0A 2X7IA 1YQHA 1ZYQA 3FKBA 3DDIA 2C28A 4OYIA 2Z2YB 1NKEA 3T1YJ 1TMJA 4KV8A 2K1RA 3NBPA 1RU2A 2KTQA 4AXJA 5HATA 1VOMA 1RYSA 2DGTA 2JLGA 1I1GA 3A8KA 4G6VB 3PW4A 1U1NA 1RP5A 1UEVA 2CUYA 4YMEA 2FLLA 3DGPA 3KUGA 2FUG9 3KNAA 3HHNB 4FYDA 1WC3A 2F5GA 1SH3A 1HKAA 3EZ5A 4CLSA 4R5PB 2RS2A 4GO7X 2RF2A 1RWOB 4B3TF 2KDOA 2MQ8A 1RTDB 1R0CB 3W3SA 4HVZA 1E6VA 2YY3A 1BHNA 3DLEB 3JYTA 2NSCA 5DGAA 3DHXA 1NK9A 4ZKAA 2AU0A 1Q5VA 3A3NB 4Q5VA 5AE2A 2EW9A 4NEZA 2P6SA 4PWUA 3K57A 2APOA 3ZZRA 4IRDA 1YWXA 5BYRA 2Q66A 1TL3B 2R8IA 1X5PA 2EBGA 1NEEA 4ZP6A 4K59A 4URQU 3TA0A 1VK8A 3IWNC 2NS1B 3HKWA 1NHUA 4OYWA 1ZH5A 3OJUA 1N32J 1H2UX 4KBIA 1CULA 4PRFA 1G3OA 2LCWA 3KLVA 5CYMB 2VJVA 2HHPA 2IRUA 4DPXA 2VBWA 2OTLS 4QWDA 4DR7J 4M5MA 3ZNJ1 3P45B 2DR7A 1J2VA 1T9WA 4LFAF 2CA9A 3I32A 1RAFB 2NXNA 2C2MB 4KC5A 1TKXA 3MEDA 3UN5A 3AB4B 1VK3A 1EX8A 2HFZA 1LV5A 2ZBQA 1VRTB 3CD7A 4JI8F 4RW9B 2HVZA 2VKRA 2QZ8A 2KJWA 2R4FA 4LR9A 1WHVA 5AXNA 4NLDA 2HGLA 1P6TA 2JFKA 5HJYA 4MIBA 3VGUA 2HGNA 1NK7A 3G8TA 2DITA 2H9ZA 1SC4B 3WX8A 2ZC3A 3M8PA 4L72B 3TA2A 3DN9A 4P6QA 3PW2A 4ZVFA 2BXJA 3R2CJ 5FDLA 1X8DA 4IFVA 4LRCA 1M5SA 1B0VA 3QIPB 2XG8A 2WB1D 5A8RA 3K5NA 1NK0A 1K73T 1N5QA 7FD1A 1SH0A 1TV6A 1C0UB 3QQCD 3PYDA 1UEKA 4JV5F 1SI9A 2BRKA 2KM8B 1AZSB 1VC6A 3ENWA 2PA8D 3B4DA 4IG0B 2UXDF 1S4EA 2EFOA 2HFOA 1N6QA 3DRYA 3QZ8A 2D3O1 1MMNA 2AGQA 2XWYA 3W5XA 1FRHA 5LJ3Y 1F2HA 4HDGA 4USKA 4K4SA 3W65A 2W7PA 2VG5B 2V8VA 4RBUA 2VC1A 3FNNA 5E3QA 4DWIA 4DLGA 1PAUB 2J9DE 4E0DA 2BJ8A 2M9KA 2DR8A 2J0SD 1RTHA 3CD5A 1A6LA 4U9RA 3ISZA 2PMHA 2XGQA 3PRBA 3C16A 4KT0C 5FLXU 1NU4A 4JP8A 3WHIA 4D3HA 4KGVB 3PO4A 4F4XA 1EQMA 3Q0AA 3M2UA 1SIZA 2GJFA 3H7HB 2EK6A 2ADCA 3KG0A 2KFNA 2EEYA 2KVIA 2CNKB 2VOOA 3VAGA 1QUPA 2QL7B 5A8KB 4TU8A 3Q2TC 4FNHA 1YI2S 5DLFA
chains in the Genus database with same CATH topology
3BBBA 1MN9A 2DXFA 1ZS6A 4DZ6A 1W7WA 3FCWA 1NLKL 1XIQA 3VGSA 2BX6A 3NGUA 1HLWA 1LEOA 4W98A 2DXEA 4C6AA 3NGSA 4UOFA 3EVOA 1WKLA 1NB2A 2HURA 3JS9A 1KDNA 1EHWA 1VYAA 1BHNA 1NDCA 3GP9A 5CABA 4HR2A 4ANDA 4UOGA 3NGRA 3ENAA 3BBFA 5BXIA 4F4AA 5CAAA 2B8PA 2DXDA 2HVDA 3EVWA 3EMTA 3R9LA 1HHQA 3PJ9A 4EK2A 3ELHA 1NSQA 2NCKL 3B6BA 3ZTQA 1NUEA 3ZTRA 4F36A 1WKKA 3B54A 3ZTOA 1MN7A 3FKBA 2BEFA 5IOLA 3FBCA 3Q89A 3DDIA 3NGTA 2DY9A 1NDKA 4ANCA 1LWXA 1NSKL 1BUXA 3Q8UA 3Q83A 3EJMA 3FCVA 3BBCA 4FKXA 3VGUA 3ZTSA 2B8QA 3VGTA 3VVTA 4CP5A 1NDPA 1WKJA 1NCLA 4WBFA 3G2XA 3L7UA 4DUTA 2DYAA 3VGVA 3FBFA 1NHKL 1PKUA 3Q8YA 1F6TA 3WX8A 1B99A 3EICA 3FBBA 3DKDA 1S59A 1NDLA 4S0MA 1PAEX 3EM1A 1JXVA 3Q86A 4ENOA 1B4SA 1HIYA 1S57A 1NPKA 5C7PA 4DI6A 1S5ZA 1NSPA 2ZUAA 3ETMA 3Q8VA 4FKYA 1K44A 2VU5A 1BE4A 1U8WA 3PRVA 2AZ1A 3GPAA 3FBEA 3BH6B 3EE3A 3FC9A 3BH7B 3ZTPA 1F3FA 2HVEA 1UCNA 2AZ3A 4KPCA 3MPDA 2CWKA 3VVUA 4UOHA 1XQIA 3EVMA 4ANEA 4O0NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BBB A;  1MN9 A;  2DXF A;  1ZS6 A;  4DZ6 A;  1W7W A;  3FCW A;  1NLK L;  1XIQ A;  3VGS A;  2BX6 A;  3NGU A;  1HLW A;  1LEO A;  4W98 A;  2DXE A;  4C6A A;  3NGS A;  4UOF A;  3EVO A;  1WKL A;  1NB2 A;  2HUR A;  3JS9 A;  1KDN A;  1EHW A;  1VYA A;  1BHN A;  1NDC A;  3GP9 A;  5CAB A;  4HR2 A;  4AND A;  4UOG A;  3NGR A;  3ENA A;  3BBF A;  5BXI A;  4F4A A;  5CAA A;  2B8P A;  2DXD A;  2HVD A;  3EVW A;  3EMT A;  3R9L A;  1HHQ A;  3PJ9 A;  4EK2 A;  3ELH A;  1NSQ A;  2NCK L;  3B6B A;  3ZTQ A;  1NUE A;  3ZTR A;  4F36 A;  1WKK A;  3B54 A;  3ZTO A;  1MN7 A;  3FKB A;  2BEF A;  5IOL A;  3FBC A;  3Q89 A;  3DDI A;  3NGT A;  2DY9 A;  1NDK A;  4ANC A;  1LWX A;  1NSK L;  1BUX A;  3Q8U A;  3Q83 A;  3EJM A;  3FCV A;  3BBC A;  4FKX A;  3VGU A;  3ZTS A;  2B8Q A;  3VGT A;  3VVT A;  4CP5 A;  1NDP A;  1WKJ A;  1NCL A;  4WBF A;  3G2X A;  3L7U A;  4DUT A;  2DYA A;  3VGV A;  3FBF A;  1NHK L;  1PKU A;  3Q8Y A;  1F6T A;  3WX8 A;  1B99 A;  3EIC A;  3FBB A;  3DKD A;  1S59 A;  1NDL A;  4S0M A;  1PAE X;  3EM1 A;  1JXV A;  3Q86 A;  4ENO A;  1B4S A;  1HIY A;  1S57 A;  1NPK A;  5C7P A;  4DI6 A;  1S5Z A;  1NSP A;  2ZUA A;  3ETM A;  3Q8V A;  4FKY A;  1K44 A;  2VU5 A;  1BE4 A;  1U8W A;  3PRV A;  2AZ1 A;  3GPA A;  3FBE A;  3BH6 B;  3EE3 A;  3FC9 A;  3BH7 B;  3ZTP A;  1F3F A;  2HVE A;  1UCN A;  2AZ3 A;  4KPC A;  3MPD A;  2CWK A;  3VVU A;  4UOH A;  1XQI A;  3EVM A;  4ANE A;  4O0N A; 
#chains in the Genus database with same CATH topology
 1YBT A;  1UA1 A;  3VGS A;  1R0B G;  4CLT A;  4CNZ A;  1S48 A;  1S6Q B;  1LW0 A;  3V6D A;  2MKY A;  1EIY B;  2EFQ A;  2OPS A;  4W4M A;  2RAQ A;  3VAJ A;  3HD2 A;  1NDK A;  1M1K T;  1YBA A;  4CO4 A;  2IYG A;  2VA3 A;  3KUE A;  1FI4 A;  2R7W A;  2DD8 S;  2JC1 A;  5H9F J;  2DNH A;  3PR5 B;  1VIX A;  3CCQ S;  3VGV A;  1S1T A;  4K7Q A;  2QLX A;  3VV2 B;  2CVI A;  3KK2 A;  1SKS A;  3SCJ E;  2VL1 A;  3CJ8 A;  4HHJ A;  4IRC A;  4ED3 A;  1SPB P;  1NM2 A;  4WF9 Q;  1VBZ A;  4Y65 A;  3P5T L;  2HWT A;  3RJM B;  2W7O A;  2HRT A;  3BRE A;  3PIO Q;  4BWJ A;  5DG7 A;  1DBD A;  3H20 A;  3FMB A;  4B17 A;  3LP0 A;  2B3T B;  2ZH6 A;  3BN4 A;  1Y11 A;  1W2I A;  4A8M P;  2RE1 A;  1LWE A;  3HM9 A;  4C3K A;  1HWK A;  4K2J A;  4OHV A;  4PXD A;  2GIQ A;  4CM0 A;  3KOA A;  5HO4 A;  4M5L A;  4LSL A;  3ZTO A;  2DPI A;  2FJE B;  3CCL S;  4YR2 A;  2D69 A;  2QGF B;  3HXM A;  2XYH B;  3E3X A;  4QPT A;  2W1B A;  1H72 C;  1IKX A;  2YXL A;  1T0T V;  4KV8 B;  3NBP B;  1FNX H;  3PJW A;  2V94 A;  2XMV A;  3LP2 A;  1N34 F;  3UR3 C;  1FJE B;  3UDE A;  4O44 A;  4NYP A;  4ECV A;  5KFF A;  4LRE A;  3PIP Q;  4ZP8 A;  2ATC B;  1RXO B;  3EE3 A;  3NRB A;  2GHP A;  4DMZ A;  1RAD B;  3DGP B;  1NJY A;  5K9F A;  3G96 A;  4KQZ A;  5LSO A;  1WEY A;  3KLE A;  4YR3 A;  1JWW A;  5GAE I;  2YWW A;  2MDA A;  3FCW A;  1BWV A;  3SYZ A;  4Q44 A;  3HSJ A;  2G2Z A;  2X1A A;  2D3Z A;  5DM7 Q;  2RF2 B;  1RWN B;  4WFZ A;  3JS9 A;  9RUB A;  3MMA A;  3VAL A;  3LAK A;  1E6V B;  3ZXW A;  4A8F A;  2ZFH A;  4QWE A;  3GV5 B;  3JYT B;  1NJZ A;  3DRP A;  3US5 A;  2FYX A;  4PQA A;  1TMM A;  3PJX A;  1JK9 B;  1WEZ A;  5IXU A;  2BKO A;  3BBC A;  1WC1 A;  2OD6 A;  6FD1 A;  2YKN A;  4DV2 F;  4RW8 A;  4B3T J;  2R7R A;  5LT5 A;  4O4G A;  3EDR B;  1R3N A;  2CPH A;  2VOP A;  4CTA A;  3FZ2 A;  4KO0 A;  3CJ0 A;  1QM9 A;  3BZQ A;  1FRK A;  4F8R A;  3W63 A;  5G0R A;  1TL1 B;  3W8P A;  2DNQ A;  3B78 A;  3H0P A;  2NXC A;  1CJV A;  5CCL A;  2O3D A;  5DG9 A;  1CC7 A;  1RTJ A;  4L74 A;  1BXN A;  5A6W A;  2E1C A;  2JZ5 A;  2N82 B;  3MEG B;  3NP5 A;  1WTF A;  3AT1 B;  4MT1 A;  5KFQ A;  4C6A A;  3JSR A;  4DN9 A;  1GXL A;  3H25 A;  3DLG A;  5AE1 A;  3KUH A;  2ZHB A;  3BGF A;  1PCA A;  1IBM F;  4Z7C A;  1KKH A;  3D5M A;  3NNC A;  3MUV P;  4MKB A;  1MU2 A;  5I42 A;  1VR6 A;  1MRO B;  2IY5 B;  4DS5 A;  2FZK B;  4U7U D;  2BQR A;  1QD1 A;  4HH0 A;  1YBU A;  1BLU A;  4P52 A;  4WPA A;  2DHG A;  1FE4 A;  2AGP A;  1CJU A;  1K1Q A;  3TEG A;  5LJ5 Y;  2AJQ A;  3GQC A;  1JXE A;  4OI4 A;  3DKD A;  4OJG A;  1MG7 A;  2M3D A;  3EM1 A;  3HSD A;  2OPP A;  2O1P A;  5IC4 B;  4OZN A;  1FHT A;  3M8P B;  3MR2 A;  3A4T A;  4WE1 B;  1R8H A;  3FQL A;  2H54 B;  5B0B A;  2KH9 A;  1EAY C;  3DFE A;  2J7K A;  4DR5 J;  3QYY A;  7AT1 B;  5FDL B;  4JI8 J;  4IFV B;  3TQE A;  3TWZ A;  2FJD B;  2JOQ A;  4A8Q A;  1VQ4 S;  3AOD A;  3SZ2 A;  3R5A A;  2GVZ A;  5KFI A;  1M1H A;  4FVM A;  5A8R B;  3FEZ A;  2KL8 A;  5A2Q Y;  2QV6 A;  3RB6 A;  2EK1 A;  3FJ2 A;  1TV6 B;  3NGU A;  3EGN A;  1KN6 A;  2IHR 1;  4CLW A;  1DJ0 A;  3CJT A;  2W9A A;  1U8S A;  4ED2 A;  4M5D A;  1N6Q B;  1X4B A;  5KFS A;  2BW7 A;  2K7J A;  1GXT A;  1Q5Y A;  3M8R A;  2HLT A;  2M8D B;  2HMI A;  1S7H A;  4W92 B;  1ZAW A;  4NXN F;  2C2R A;  1BUX A;  1S72 S;  2YNF A;  2LQ5 A;  4E8U A;  3MAA B;  1OPI A;  4R0J A;  1S7I A;  1XR7 A;  2CFX A;  4CDI A;  4B9M A;  3OSP A;  2HHT A;  4Q0B B;  3M05 A;  4DX6 A;  3QWU A;  2HQI A;  2WBR A;  3A3P B;  5C24 A;  2QMW A;  2YWK A;  4USH A;  2QLW A;  4AFF A;  1RTH B;  4Y34 A;  2QYC A;  4QIW D;  2JSX A;  1ZET A;  3C16 B;  1AA1 B;  4F2S A;  2OLW A;  2M88 A;  3AJD A;  4EYI B;  1VC5 A;  1HNZ F;  2H5J B;  2NYI A;  1SJF A;  2HNY B;  1QLN A;  5ETT A;  4OQJ A;  5HRO A;  4ZPT R;  2YX7 A;  3CCE S;  1CBK A;  2MKH A;  4N8O A;  3F44 A;  3EGW B;  3G6E S;  5ETS A;  4EK2 A;  2WBM A;  2V4Q A;  5HL7 Q;  3SQG A;  3RBZ A;  2DPJ A;  1RHJ B;  4ECY A;  2FJX A;  3I9V 9;  3V6D B;  2OPS B;  3KFW X;  2B4O A;  1OYE A;  2ATL A;  3MR6 A;  3KJV A;  2YWF A;  5KFA A;  3D9B A;  1U0S A;  4M5J A;  3GON A;  3H2V E;  3D1H A;  1U1Q A;  4WTY A;  1S1T B;  1XMO J;  2WW4 A;  4BC7 A;  3I5C A;  3MFI A;  1YIT S;  3KK2 B;  1AUD A;  4QR0 A;  3GYX B;  4FPI A;  4GVL A;  4I2Q B;  3CJ5 A;  3HX9 A;  4PG5 A;  3I6P A;  3M9M B;  1TUG B;  3GJS B;  5HJX A;  3FFI A;  5DLG A;  4ZVT B;  1YZ7 A;  4R0E A;  2YKO A;  4OX7 A;  2XO7 A;  4DR6 J;  3EX7 B;  1JLQ B;  1WWH A;  4AQY F;  3LP0 B;  3MMC B;  4FYX B;  1ZM9 A;  5HK4 A;  3CUL A;  4RNN A;  3R2D J;  3H98 A;  2HRY A;  5EHH A;  1LWE B;  3MPY A;  5K14 B;  4TQS A;  2J9D A;  2JEI A;  3ILI A;  3RAM A;  3N5B A;  1IJE B;  2CPZ A;  1X4D A;  4LSL B;  5I3U A;  4OZL A;  1RTI A;  3MUR P;  4C4W A;  3EXY A;  1T02 A;  1IKX B;  2IRY A;  5KT6 A;  2I0X A;  3DMJ A;  3OVB A;  1Q1K A;  4PEO A;  3LP2 B;  1HPZ A;  1VRU B;  4WFB Q;  1XTZ A;  2MHN A;  1VBX A;  3DLL Q;  2P6T A;  3N6L A;  3OBI A;  4Y2A A;  3CXC R;  4IFY B;  4AYB D;  3HVW A;  5LOQ A;  3QRQ A;  2MKS A;  2YWH A;  1APS A;  4JI2 F;  4C98 A;  1JLF A;  3C19 A;  1MN9 A;  3M9N B;  4ZHR A;  2KVQ E;  1RCX B;  3KLE B;  2RU9 A;  2RHQ B;  4K4X A;  3CMQ A;  2VUG A;  2BOP A;  2YQ0 A;  4E98 A;  1U2R A;  4OI2 A;  4DL4 A;  2ZWP A;  4DV1 F;  2AIR B;  1FDB A;  4BBY A;  3G6X A;  3OD2 A;  1UZH A;  3MMA B;  3B6B A;  4GC7 A;  1NBE B;  2PT0 A;  2Q6B A;  1NJW A;  4DSJ A;  3UN3 A;  4ANC A;  2BOA A;  3W7B A;  3UO0 A;  2LA4 A;  3IR5 B;  2KZZ A;  4C8L A;  2XMW A;  3DRP B;  1AFI A;  3CCW A;  2JL9 A;  3UCZ P;  1TTH B;  4X62 J;  1RAA B;  2VBZ A;  3L7U A;  3GU0 A;  1FRJ A;  1IXK A;  1FTR A;  1NH7 A;  1VS3 A;  2YKN B;  5E0O A;  4WFA Q;  1ZM3 A;  2YBV A;  4O4G B;  1H98 A;  3EZO A;  4H4K A;  4CTA B;  1VJW A;  1QAI A;  2ROG A;  4KO0 B;  5I3P A;  1BD6 A;  2WZ1 A;  2WVD A;  5G0R B;  4OJ1 A;  4LMZ A;  1RZM A;  1DFD A;  3QT6 A;  4DV6 J;  2CWK A;  3H4D A;  1S0N A;  4F4Z A;  1RTJ B;  3ET6 B;  1XIQ A;  4USU A;  4H4K C;  3KK1 A;  3UCU P;  4FYV B;  5KFW A;  3HJV A;  1ARO P;  4ZP7 A;  4Z37 A;  3R6L B;  2P9G A;  3DLG B;  2VQF F;  1XR5 A;  4LF5 F;  3ELH A;  2RIL A;  3DLH A;  3RG6 A;  1MU2 B;  3ZZZ A;  5I42 B;  3MM6 A;  3A8E A;  3BQ1 A;  1VHF A;  2XZW A;  4L3K A;  5DZ7 A;  3EJM A;  3OFF A;  4A46 A;  3PEH A;  1T8E A;  5MLC V;  3GV7 B;  4P7T A;  5KFB A;  3KMS A;  4DL2 A;  2LDI A;  3RW6 A;  5DGB A;  2EWH A;  1JJ4 A;  2IC3 B;  3UW1 A;  4F50 A;  4G3I A;  4KGX B;  3GTY X;  4ZVU B;  1D9A A;  2OPR A;  3UDC A;  4IO9 Q;  4PYA A;  1IBM J;  4O3S A;  5CYJ A;  2HAF A;  1R89 A;  2QEX S;  1R7I A;  2YQ1 A;  4QWA A;  3VAM A;  3ITH B;  4JBC A;  2OPP B;  3MEE A;  1X9M A;  2L08 A;  3P6Y C;  2CVE A;  4RW6 A;  4RKU C;  2POK A;  3Q23 A;  5FII A;  2HEK A;  1FA0 A;  2OTJ S;  1VBY A;  2WHO A;  3SEO A;  3NG8 A;  4Y2M A;  3KLH A;  4KTQ A;  3C14 B;  1Y0H A;  1NPR A;  3TVZ A;  2NPI A;  2B6A A;  4ID5 B;  4NYZ A;  2BJ9 A;  2XHC A;  3MTK A;  2A6O A;  4N47 A;  1KQK A;  1N33 F;  2CJA A;  1U09 A;  2DR6 A;  3OT9 A;  2AQ4 A;  5M2U A;  2CQB A;  1FXD A;  3BDE A;  1UWB A;  5KFT A;  2J9C A;  1NK6 A;  4NXM F;  2HMI B;  2Q6C A;  1Q81 T;  1QVF R;  3H90 A;  3KHG A;  2LLZ A;  2EBE A;  3K58 A;  2ZDO A;  5H9E K;  2CPY A;  1FNM A;  3CCR S;  2MYF A;  5CZX A;  3K0J A;  2G2Y A;  5C24 B;  5C7P A;  4IQX A;  2DGU A;  4UUW A;  1AYE A;  3MOZ A;  3FEX B;  3PRV A;  3WDO A;  3GPA A;  2FJB B;  2CNO B;  1EAR A;  1FE0 A;  4ZP9 A;  1FRX A;  1X7V A;  4DZ6 A;  1R43 A;  5F3Z A;  1OY8 A;  3G82 A;  1CS4 A;  3VAH A;  1HBO B;  3N6M A;  4NI2 A;  1REV A;  5HMW A;  4A8X A;  1J5O A;  2HQG A;  1FWP A;  3NLC A;  3GP9 A;  4B3S J;  5HRO B;  1GEH A;  3H5X A;  3PM9 A;  5L1K A;  2ZJQ Q;  5AE3 A;  4UF4 A;  1PBA A;  2C3M A;  2V50 A;  2MZQ A;  3ZZU A;  5FD1 A;  3SQG B;  1FCA A;  2UVR A;  3CJQ A;  1KEK A;  4QWB A;  2W7A A;  3JSY A;  3QGI A;  4OFZ A;  3UN2 A;  3QRR A;  1QSS A;  5IWA F;  4TLR A;  3IG1 A;  3PW0 A;  2E1A A;  1WEL A;  3C6T A;  2L9D A;  5JMN A;  1P1L A;  2N7C A;  3MZI A;  4GMK A;  4HHH A;  2B51 A;  4BWM A;  5A8W A;  4I6Y A;  3GMG A;  4FXW A;  4FNI A;  4QQB A;  1HD1 A;  4IRK A;  4DCP B;  1N54 B;  2UUW A;  5DET A;  2RJZ A;  3GFH A;  2XMM A;  3EVW A;  2HHH J;  1SC3 B;  5L39 A;  4QWC A;  3CUN A;  3CJ4 A;  4YUD A;  2AJ1 A;  3MPU B;  4CLK A;  5KFG A;  3KYL A;  2BKN A;  4OV1 A;  2IAJ A;  4QYR A;  3RR8 A;  3T5K A;  2DY1 A;  3O1L A;  3Q8S B;  4OHX A;  3R5D A;  2SXL A;  5E3A A;  3U1M A;  3MCN A;  4EUV A;  1FFG B;  3PXG a;  3WX4 A;  2BJE A;  2OD4 A;  3N28 A;  1RTI B;  3W61 A;  1H3D A;  5AXK A;  2UVU A;  4OL8 A;  4CLU A;  4NLQ A;  3PX6 A;  3GIJ A;  5KFP A;  1OSC A;  1X4F A;  3DMJ B;  3HHL D;  3T1H J;  4LF1 A;  4N41 A;  4ED7 A;  1Y00 A;  2KN4 A;  3NKY A;  2ILZ A;  1W25 A;  1FWK A;  2BE2 A;  3MI7 X;  2DHS A;  1OY9 A;  4QJV A;  1K47 A;  2UXB J;  2HQF A;  4ZHR B;  1E6Y A;  2OMO A;  3D6H B;  4USJ C;  2E5I A;  3SQO P;  3TZW A;  2DNZ A;  2PSZ A;  2AJF E;  1RT6 A;  4CIO A;  2JEG A;  1HMV A;  2VIH A;  2BR0 A;  5MAO A;  4JI2 J;  3ZTS A;  5JUM A;  2CZ4 A;  3DYA A;  1EP4 B;  5ETN A;  1NHK L;  4TNO A;  2BKP A;  5HQM A;  2DRA A;  2EI5 A;  1M0S A;  4X66 J;  4M5N A;  3E2E A;  3QLH A;  3S7R A;  3NAI A;  3NCP A;  1TVR A;  4U8Y A;  2PE8 A;  3QGG A;  1T3N A;  2FVS A;  1UMJ A;  3MOJ B;  4ZPA A;  4UZC A;  1F60 B;  5SUH A;  2VG6 A;  1EZZ B;  4K4T A;  3DRX A;  3A8I A;  2WSE C;  2IVM A;  3RW7 A;  4X2B A;  2XS7 A;  2CPJ A;  2O01 C;  3TAQ A;  1B7Y B;  5GAG I;  4C97 A;  4LRF A;  3GR0 A;  2JRS A;  3A8J A;  4IH6 A;  2ZOG A;  2EKN A;  4KE5 A;  3K5O A;  3J81 j;  2ZBR A;  1N5Y B;  2DEI A;  4F36 A;  4DF4 A;  4WFX A;  3Q89 A;  4YB5 A;  2ZH9 A;  2GW8 A;  2KT5 A;  1RT4 A;  2MKK A;  1CJK A;  3ZZP A;  1Q78 A;  4QR1 A;  3FCV A;  3MM6 B;  2NXU A;  2YNG B;  2GNK A;  1DRZ A;  2F1F A;  2XZT B;  4Z2X A;  1F9F A;  3D54 A;  2BUN A;  1TK5 A;  3RBX A;  4L76 A;  5LXR A;  4JUZ A;  1H2V Z;  5IT9 Y;  4LF5 J;  2OPR B;  2XB2 D;  1BE4 A;  4ELU A;  1YJN S;  2JVO A;  2KG1 A;  4JI4 J;  1XWL A;  2PDA A;  5J1P A;  3MM7 A;  3UCG A;  4RW6 B;  5C2C A;  4LFB F;  5C25 B;  4RWX A;  3W2W A;  4DR2 F;  1RSC A;  2J6T A;  2HHX A;  2C3O A;  2CJQ A;  1V3S A;  2VQE F;  2HUR A;  3OTE A;  2E9Z A;  2G0J A;  1QAX A;  4J9L A;  4ILR A;  3KLH B;  1SJQ A;  3UWT A;  3W9I A;  3CJS A;  1S12 A;  4IO1 A;  1RWV B;  4I67 A;  2B6A B;  2KRR A;  4B9T A;  1FJ7 A;  1S0O A;  2HZV A;  5GAD U;  3SSS A;  2CNL B;  3T6J A;  3THT A;  2WON A;  1QAJ A;  4MYT A;  5HP1 B;  4ECZ A;  3KJQ B;  3LAM A;  2GQC A;  1F3V A;  2ZM6 J;  3LA0 A;  2FZC B;  5EGY A;  2B8Q A;  4KH1 B;  4BDP A;  1UWB B;  2VAS A;  3PW7 A;  2F40 A;  1PKU A;  1SB6 A;  4M1K A;  1YIJ S;  1S1V A;  5E3P A;  2CPD A;  4LIW A;  2DHX A;  2R2T A;  2HK2 A;  2BAN B;  3UFC X;  1BQN A;  2FJA B;  4WFY A;  2G9O A;  4FS2 A;  1AT1 B;  1N33 J;  2VU5 A;  3M6W A;  2NPF A;  4KGZ B;  3I9Z A;  5CQG A;  4KPC A;  3EPG A;  1GT8 A;  4ANE A;  4EI2 A;  3OFH A;  2GO8 A;  4AT1 B;  5H9E J;  3J81 U;  1SJ3 P;  1AW0 A;  2VC0 A;  5KG1 A;  4ECT A;  2KYX A;  3D67 A;  3G82 B;  3DLJ A;  2ZHO A;  4NI2 B;  1REV B;  4CZC A;  3THV A;  1OJ4 A;  1J5O B;  3PJ9 A;  2ZZM A;  3R1H A;  4RBT A;  2PEH A;  1IJF B;  4ZLL A;  4V1A k;  4QU6 A;  2G0C A;  3AAW B;  4N5S A;  5DDP C;  1FVS A;  1IKV A;  5IZH A;  1IVZ A;  3P3D A;  2ZOM A;  2FLO A;  5L1J A;  3VVT A;  2OEK A;  4OI3 A;  2HQC A;  4NLR A;  3MFH A;  2DYA A;  1F6T A;  3IS9 A;  2DGO A;  5HLF A;  1T03 B;  2KB2 A;  2WTF A;  4OYM A;  1RB0 A;  2D1C A;  2ERR A;  4BS2 A;  1U0H A;  4O0I A;  2F8H A;  3UE2 A;  2RQM A;  2XYG B;  2XHW A;  3IG1 B;  2AZ1 A;  4RBV A;  3C6T B;  3I82 A;  1P8G A;  4Q7A A;  2LFV A;  3C8Y A;  2OFG X;  3QNW B;  3CCM S;  3WC2 A;  1V3R A;  3OLA A;  2DXF A;  2VPZ B;  4CLZ A;  4YDD B;  3BQ2 A;  1TFY A;  3GIK A;  3CDB A;  4HHU A;  1VMB A;  1SJ1 A;  3T3F A;  1T9T A;  2F7V A;  2GS8 A;  4NLP A;  4EEY A;  4DV3 F;  3TVK A;  1ZBT A;  2HG4 A;  4OHZ A;  4PAB A;  1FRI A;  1SVD A;  4R8U A;  3ZZY A;  1SKR A;  3Q83 A;  1Y9O A;  3DU5 A;  1R0A A;  4N8N A;  1IUJ A;  3QWP A;  1VBK A;  4WTO B;  4BC9 A;  4Y0F A;  4PKD B;  3HSG A;  2KHD A;  5U47 A;  2R8H A;  4QW8 A;  3M30 A;  1LQ9 A;  4S0M A;  3MM8 B;  3I5B A;  4KB7 A;  4PWD A;  3AOA A;  1SIW B;  1X9W A;  2AX1 A;  3OFE A;  3D28 A;  3OTC A;  1JKH A;  4N56 A;  1Z1Z A;  2MB0 B;  1FFW B;  1U6B A;  2WVC A;  1S6P B;  2RSQ A;  5L46 A;  3NY0 A;  5B7W A;  1MML A;  2WAQ D;  1K0T A;  3G8Q A;  4GKJ F;  1NDC A;  3QFH A;  2CQG A;  3IM8 A;  3KLI B;  4GRS A;  1FD8 A;  4ZPD A;  2B4P A;  8RUC A;  5ETV A;  2G2O A;  4DSF A;  1E6Y B;  1WEX A;  2OPQ A;  1WF0 A;  2RRB A;  4CH1 A;  1KC8 T;  4JI1 J;  4DU8 A;  1DTQ A;  2OEL A;  4WWS A;  5F8H A;  2RD5 C;  2P2C B;  3M6U A;  3DCA A;  1GFW B;  2CQC A;  1RT6 B;  3OXL A;  3OL6 A;  2EXU A;  3I31 A;  5LXY A;  2G13 A;  2CJB A;  1HI1 A;  2HSE B;  1LK5 A;  2L48 A;  4LF6 F;  3RB4 A;  4IH7 A;  3C2P A;  1YX2 A;  5HVF A;  1UFK A;  2JFD A;  4J9S A;  2B9Y A;  1FKP B;  3DYA B;  2PFD A;  3OQ2 A;  2QL5 B;  4B3R F;  2DNM A;  3BSA A;  1G6B A;  1X4E A;  2MQP A;  1WUU A;  1RWM B;  1TKZ A;  1TVR B;  2V8H A;  3RB3 A;  3J7Y I;  4FS1 A;  3CJ2 A;  3LAL A;  3BSC A;  1S77 D;  1VQM S;  1W2B R;  4DUZ J;  5EWF A;  3PX4 A;  4XPE A;  1HAR A;  2DIU A;  5ITH A;  1RJJ A;  4W98 A;  2HFN A;  4ZVE A;  1WHW A;  3G9C A;  1WI6 A;  5K8P A;  2Z58 B;  2GZO A;  3IBC B;  2XMA A;  4ED4 A;  2C2Z B;  4OZ3 A;  3BBF A;  3C66 A;  1JLA A;  1OY6 A;  4DEZ A;  3W60 A;  1RBO B;  4DR1 F;  4EBC A;  3PTW A;  5AXL A;  6AT1 B;  2C22 A;  1UAW A;  4X65 F;  4MYU A;  3HFV A;  1TK8 A;  1CJK B;  3AQO A;  4ZPV R;  2ZKU A;  2AEM A;  4DDF A;  2V5H G;  5D6G A;  2F8E X;  4J9M A;  2AGO A;  4ETX A;  3TJA A;  1VQL S;  4JV2 A;  2FPH X;  3R3T A;  4RNM A;  5GMK a;  2MEW A;  4HH1 A;  2ZZN A;  3DLE A;  3N01 A;  1Q79 A;  3AD9 C;  1RAO A;  2CJY B;  4WK1 A;  4Z7Y A;  1YJ7 A;  4CO2 A;  2K3I A;  4MTP A;  1FNO A;  2XEX A;  4X84 A;  2A1B A;  5HBM B;  2LDY A;  5EN1 A;  2C3Y A;  4X4T A;  4A8S A;  2VOD A;  2W9C B;  4UQG A;  3PO5 A;  3MM7 B;  2IYI A;  2C1E B;  3NOC A;  3TR5 A;  2BAC A;  1VYA A;  3W2W B;  3TO8 A;  2XUL A;  2ZBI A;  1HHQ A;  4Q8E A;  2B5J A;  4P2S A;  2D9P A;  2XSJ B;  3PHT A;  1DQ9 A;  5KFO A;  1RE1 B;  4DFJ A;  1GMU A;  2BEF A;  2F4V J;  3Q8P B;  2OSR A;  4YHH F;  4CWB A;  1T05 A;  4TXS A;  2GMJ A;  4L73 A;  2QA2 A;  4JYA F;  2FVQ A;  4ZCK A;  4ED8 A;  4OHY A;  3JAM U;  5CYM A;  2I8E A;  2GGP A;  4WCE Q;  4BCA A;  2YWE A;  2FQQ B;  2QTW A;  4DL7 A;  1XMQ F;  3MMB A;  4W90 B;  4EYH B;  1S1V B;  4C11 A;  3MM5 A;  1B0T A;  1WNE A;  3GLJ A;  3R8Y A;  4OJH A;  4ZCL A;  4OX9 F;  2PII A;  3L3C A;  1VRT A;  1H74 A;  2X1F A;  3EVM A;  3KDO A;  5K5M A;  1JNR B;  4U95 A;  4AD6 A;  1WJ9 A;  1JXL A;  4DQQ A;  5BXI A;  5ETR A;  4F0K A;  4I64 A;  1D09 B;  4CLF A;  2V0N A;  2JHE A;  3UPF A;  5ETO A;  1PJ5 A;  2ZE2 A;  1X4G A;  1IM6 A;  1MSW D;  3CD6 S;  4JI7 J;  1RWK B;  1QY7 A;  4Y2I A;  1IBL F;  2H48 B;  1NB7 A;  1KQS R;  1IKV B;  1AZS A;  1VQS A;  1ZAV A;  3EIC A;  4CLP A;  3NNH A;  3BJY A;  4HI1 A;  1Q82 T;  4YB7 A;  4CRJ A;  1N4L A;  3IS9 B;  4USI A;  1GNK A;  4IUF A;  4KFB A;  5HLF B;  4OLP A;  5GAE U;  1KVJ A;  4LIR A;  5E7O B;  1HWL A;  2CG8 A;  1M5O C;  2DO4 A;  3HUL A;  2AJ2 A;  4O4R A;  1WOR A;  4ES2 A;  3UVJ A;  4HTI A;  3HKZ D;  1TR0 A;  3VAF A;  3MMJ A;  2BQ3 A;  3PAC A;  2K2P A;  5G4D A;  3MDF A;  1WKL A;  3N9U C;  5EX0 A;  1NB2 A;  3BSN A;  2W4P A;  4I7F B;  3D6T B;  4AL7 A;  3HT3 A;  1N5T A;  4ICL A;  5D15 A;  2ZIT A;  4I6W A;  2UUC J;  2V2Q A;  4OV6 A;  4DU7 A;  4DQS A;  1UVI A;  3CCT A;  2J76 E;  4KIA A;  1ZZF A;  2GJI A;  2AV5 A;  1OO0 B;  4LF4 F;  5A8K A;  5THW A;  3KXD A;  3C15 A;  1NCL A;  2JVR A;  2YH0 A;  4UOC A;  1ITP A;  1HHT P;  1L3U A;  1YTY A;  2C42 A;  3PNI A;  1XC9 A;  1S6U A;  1XNQ F;  2HZA A;  1AB8 A;  1FK9 A;  2WSF C;  2FVP A;  3M30 B;  2VH7 A;  1S6Q A;  1NXI A;  4WP3 A;  4PWD B;  1UZD A;  4FPR A;  3CCV S;  1I94 F;  5L9N A;  3TZY A;  5ETM A;  4RL1 A;  1N88 A;  3TJ8 A;  4FF1 A;  2VFR A;  4PXB A;  3BBB A;  4CM2 A;  1WC6 A;  1JKH B;  3RRH A;  1BY9 A;  2YNH A;  4DPT A;  5D78 A;  4WKY A;  3OV7 A;  2XLK A;  1C0T A;  4DPU A;  4OJ3 A;  4X4V A;  3FRZ A;  4YY3 J;  5F9N A;  1FXR A;  1U1R A;  1HR0 J;  4WP9 A;  4UOG A;  1S79 A;  2DXD A;  5LMN F;  2L41 A;  4IQM A;  5D0G A;  4XTT A;  2GQ2 A;  3SXL A;  3O44 A;  1JLG B;  4QZV B;  2QLJ B;  4RNF A;  1SXL A;  4AE5 A;  1JLB A;  4LQ9 A;  2YKM B;  2OPQ B;  4CLY A;  1U6F A;  1XBW A;  5F8N A;  1SL1 A;  4HEA 9;  4ERD A;  1CLF A;  3TQ1 A;  1DTQ B;  2GAG C;  1NME B;  2V67 A;  3EPI A;  2J9E A;  2V68 A;  1KNZ A;  4GKJ J;  2HHV A;  5A0Y A;  4G1I A;  2HBQ B;  4ECW A;  8AT1 B;  1TK0 A;  4PWW A;  4WZM A;  2LEB A;  4G1P A;  3PCO B;  3LP1 A;  4B9V A;  3VZI A;  3MR3 A;  2ZH8 A;  1TKZ B;  3PYE A;  1VQN S;  1K0V A;  1NK5 A;  1PIE A;  4LJM A;  3MEK A;  1HLW A;  3P4U B;  4LF6 J;  2M5Y A;  2CZV C;  1RT2 A;  4JI6 F;  3UD4 P;  3MR5 A;  5KT3 A;  2KXH A;  2VKZ G;  2QJ3 A;  3NGR A;  3SCL E;  2V63 A;  3TAN A;  4B3R J;  1Y7P A;  3CB4 A;  5AJ3 F;  3W64 A;  1P1T A;  1RHQ B;  2IVF B;  1X0F A;  3QO9 A;  1JLA B;  3G4S S;  3SBM A;  2MJN A;  3U7J A;  3QJP A;  4CO0 A;  3SI8 A;  2WW8 A;  3AY0 A;  5GAH U;  3T1A A;  2I2Y A;  2ZBP A;  2VFU A;  1WSR A;  4F2R A;  1WSV A;  1H73 A;  3IWL A;  5KFC A;  5KG3 A;  3RBD A;  2VON A;  5B08 A;  5KFV A;  3PR4 A;  4DUY F;  4DV4 F;  3PVX A;  2XC9 A;  3Q22 A;  5F0U A;  1HWI A;  3TYT A;  1NKB A;  3S6E A;  3GSD A;  2EFG A;  2W01 A;  1NSP A;  2E5L F;  2HRU A;  3PY8 A;  2GO9 A;  2RKI A;  2LQJ A;  4DR1 J;  1ZPW X;  3DI6 B;  4P71 A;  4C8M A;  3NEK A;  1HA1 A;  1TKT A;  2GIF A;  1N5S A;  4LRD A;  1J5E F;  4UOF A;  3M9O B;  3ZFV A;  3N0V A;  4XIU A;  4FYW B;  2Y8W A;  1PO6 A;  4J9Q A;  4EZ6 A;  1TL1 A;  1N0V C;  1YG0 A;  2CAJ A;  1BGX T;  2BE9 B;  1RWW B;  1URN A;  2B5J B;  4ZLJ A;  2HKE A;  4RNH A;  3T5L A;  2XY7 A;  2V34 A;  3V81 A;  3T9N A;  4ED5 A;  4I1T A;  5LMU J;  4ED6 A;  2H3E B;  2UXC F;  4FXD A;  3CE8 A;  3EDQ B;  3GJT B;  1QSY A;  1KHV A;  3GE9 A;  4DUT A;  1T05 B;  1ZA1 B;  2FVR A;  3MEG A;  2GVD A;  1G7C B;  2GGP B;  2HFS A;  3KHH A;  3ZC4 A;  3RBE A;  3F56 A;  1VHI A;  1RI7 A;  4LF7 J;  1Y3K A;  2UP1 A;  3MMB B;  4JI5 F;  1C1B A;  4TN2 A;  3G8S A;  2HWI A;  4C11 B;  3MM5 B;  1A7G E;  1MRO A;  3VVU A;  2W4D A;  2V9W A;  4O3Q A;  2A3J A;  4LF9 J;  3AA9 A;  3LTO A;  4CO5 A;  1YJR A;  2XM3 A;  1NLK L;  5CCM A;  4I6A A;  5KFL A;  1U26 A;  1RAH B;  3KKF A;  5CH7 B;  4IR9 A;  3O2I A;  2J6U A;  1CEZ A;  3HK2 A;  1I5O B;  5CAB A;  2MKJ A;  3N6N A;  3AHP A;  3BGR B;  4K8R A;  2VJU A;  3TW0 A;  4LBP A;  2WB4 A;  4K0K F;  3C6U A;  2GCF A;  3IP0 A;  4EO8 A;  1SQF A;  2FHJ A;  2VFS A;  3BKF A;  3MD3 A;  5E41 A;  4ECS A;  3CT9 A;  1FKO A;  1UJ4 A;  4WE1 A;  1FO1 A;  4OX9 J;  4DSK A;  3P8B B;  1ZTT A;  3KMQ A;  3DLK A;  3JQK A;  5IC6 B;  3LWM A;  2EFP A;  2CPE A;  4PQU A;  2IM0 A;  4LF8 F;  2R7S A;  4A8Y A;  4J9P A;  2ZE2 B;  4ZK7 M;  1SV5 A;  2NUU G;  3I0R A;  4NA3 A;  3D7S B;  4TQR A;  3FQK A;  3V2U C;  2CQD A;  4J90 A;  3MR7 A;  5KFM A;  4X4Q A;  1F5A A;  4X4S A;  5CD4 H;  4DX8 H;  3S8S A;  4FYY B;  2XMT A;  2EFN A;  4PUO B;  1KFD A;  2ZEJ A;  4KFB B;  1U1K A;  3MTJ A;  1LWC A;  3BGO P;  3Q24 A;  4RLE A;  4MK7 A;  2Y0B B;  4ZN1 A;  2UVV A;  1B7F A;  1DHM A;  2QIF A;  4NCA A;  1IBL J;  3MHY A;  3MAA A;  1RAJ A;  2HBY B;  2O67 A;  3UVJ B;  1RHM B;  1JJC B;  5EWG A;  1R8B A;  1KQF B;  4HT5 A;  2CXE A;  2Z8Q A;  4Q0B A;  4WFN Q;  4M8L A;  4KHP J;  2WOM A;  5LM7 E;  3NGK A;  1RHU B;  4J5O A;  3CTR A;  5L1I A;  4ICL B;  3OLB A;  5J1E B;  2BJ7 A;  1VI7 A;  2BZ2 A;  3W9J A;  1G4C A;  4M94 A;  2R7T A;  1H0H B;  3KG1 A;  1GX5 A;  1Q95 G;  3I87 A;  1SL2 A;  3RB0 A;  1IWA A;  1IKW B;  2HNY A;  4JV0 A;  3D3B J;  3C15 B;  3OHB A;  1NDL A;  2RIJ A;  2X3D A;  2KFY A;  5F41 A;  2JH3 A;  1RT3 A;  3C3L A;  1YJW S;  1S5Z A;  2NXJ A;  2XS2 A;  3CC2 S;  3X3U A;  1FK9 B;  3FBE A;  2DBB A;  2HNZ A;  2Y1I A;  3MPD A;  3BV8 A;  4C7Q A;  2X3G A;  3VF0 B;  1TL7 A;  2XNQ A;  2J7W A;  2XGP A;  2HW3 A;  2V4J A;  2X1B A;  2MQO A;  4P75 A;  2A2D A;  2YNH B;  1QE1 A;  3ZO7 A;  2CAD A;  2AKW B;  1X31 C;  1C0T B;  4MKA A;  3AB2 B;  1N5V A;  1XNQ J;  4F4W A;  1S9G A;  2ZD1 A;  2BMB A;  1HI8 A;  2QRR A;  3L09 A;  1KQG B;  2J8S A;  2ROE A;  2M8H A;  4O3P A;  3T6B A;  2DCU B;  1WKK A;  3LGN A;  3FSI A;  3V4I A;  4K4W A;  1SJR A;  3E51 A;  3NCQ A;  2OH2 A;  4LQ3 A;  2R7V A;  1JLB B;  4CP5 A;  1L3T A;  2ZH4 A;  1LOU A;  1XER A;  4I2Q A;  5B0F A;  1HBU A;  3D1Q A;  1UA0 A;  1HD0 A;  5DG8 A;  3HHE A;  2GC8 A;  1F5C A;  2ACM A;  2IBO A;  5CHC B;  1S9F A;  1UW9 A;  3GCX P;  1JLQ A;  1KS2 A;  5A0Y B;  1U02 A;  1N48 A;  3OL7 A;  2RH3 A;  5GMD A;  3MMC A;  2H65 B;  2MTL A;  1UVJ A;  2Y3Y A;  4IDK A;  5K14 A;  2LXU A;  2BYC A;  3LP1 B;  4A48 A;  3R5G A;  3A1Y G;  2QT7 A;  2EKY A;  5GME A;  4C0H A;  3OTD A;  3CWJ A;  3T1Y F;  4OZ5 A;  4M63 A;  2LMI A;  2LVW A;  4ED1 A;  3EMT A;  3J7A N;  3BS9 A;  3I4H X;  1RT2 B;  2EG2 A;  1NUE A;  3I0S A;  4P7V A;  2RDD A;  2F8M A;  1VRU A;  1K9M T;  1H7X A;  3I55 S;  3T19 A;  4ILM A;  2IVY A;  2Z0G A;  5J2N A;  1LK7 A;  4IFY A;  1UWA A;  3QO9 B;  2IA6 A;  1CQN A;  2IJR A;  2XYP B;  2AYE A;  1YJT A;  4C8Z A;  2HVH A;  4OIX A;  1V9O A;  4WK3 A;  3M32 A;  5FLX Y;  4KGK A;  4ZVS B;  2XCP A;  4TVA B;  2Z2M A;  4MIA A;  1S57 A;  3CD0 A;  2E5J A;  4ZVO B;  1JLE B;  5T14 A;  2LQ8 A;  2J0X A;  3UDV A;  5IQQ A;  2CWX A;  3Q8Q B;  1UVN A;  3MM9 B;  1GMW A;  2RKI B;  2RB7 A;  3MAQ A;  3HMJ G;  4I68 A;  5DRK A;  4DS4 A;  5IV4 A;  2DO0 A;  2IM2 A;  2DNY A;  1W7W A;  5D0E A;  3QAT A;  1S10 A;  4USM A;  3OW2 R;  1Y5N B;  1TKT B;  1U1O A;  2QL9 B;  3K2Y A;  4J7C A;  1M5K C;  2XNR A;  3DGV A;  2PC6 A;  4CH7 A;  2E5L J;  1DTT A;  4C8N A;  1S76 D;  2HLU A;  1UTA A;  3L7P A;  3NAH A;  2DR5 A;  4IR1 A;  3J80 U;  2CPF A;  3SFU A;  4UZB A;  3QT8 A;  2DGS A;  2OIH A;  5KFH A;  1UVL A;  1RLD A;  1T9V A;  4IG3 B;  1BC6 A;  2E44 A;  2MZR A;  4ZMM A;  3V81 B;  2ACY A;  2ROP A;  4ILL A;  1KTV A;  3ET6 A;  3S01 A;  3HVR A;  2GVD B;  2U2F A;  3VQS A;  4DR7 F;  4WJB A;  1T9U A;  4XPC A;  3L95 X;  4ZDN A;  1M5P C;  3FC9 A;  2V6A A;  3EGV A;  1VDH A;  1S1U A;  4X4N A;  4NRU A;  3V6J A;  4H4O A;  1C1B B;  3QAU A;  1NJI T;  3UI3 A;  5L1L A;  1TAU A;  2UXC J;  2MLY A;  1TP7 A;  2OUG A;  5LSR A;  4JV1 A;  3RRK A;  2HVI A;  1X5O A;  1B0P A;  2IC3 A;  4GKK F;  1S9E B;  1N36 F;  2Y1J A;  5D3G A;  2V2K A;  2DNP A;  4MFB A;  1KTQ A;  3KDN A;  4QOT A;  2F9D A;  4JI5 J;  2FLP A;  2YWG A;  1M90 T;  3C6U B;  3ITH A;  4LFA J;  1Q0N A;  4U7U K;  1S49 A;  1FKO B;  1WHY A;  3MPV A;  2OML A;  2HK3 A;  2E7X A;  1CPZ A;  4NZ6 A;  1CC8 A;  3DLK B;  2W2O P;  4IH5 A;  1MWY A;  4ES3 A;  4KJI A;  2CQP A;  3GG1 A;  2EC2 A;  2XO6 A;  4CH0 S;  4PQU B;  1URR A;  1FEH A;  3C14 A;  1ZA2 B;  2Q79 A;  2RRN A;  1RAC B;  4AL6 A;  1P9Q C;  1SV5 B;  3BGL A;  3I0R B;  3IGN A;  2QSF A;  3D0G E;  3QT5 A;  5F8J A;  4ID5 A;  4FKY A;  5ADZ A;  1I6J A;  4LF2 A;  4L75 A;  3NL0 A;  1RQ0 A;  2CQH A;  2XI2 A;  1IM4 A;  4AUK A;  3BO2 A;  3CIM A;  3UR0 A;  1LWC B;  4B9N A;  3I4P A;  3C46 A;  2IPO B;  5GVQ A;  3JTO A;  1WHX A;  4JV5 J;  3ISN C;  2AWZ A;  3D6M B;  1U4B A;  2AW0 A;  3ONQ A;  4ZVR B;  2UXD J;  1ZPV A;  4P72 A;  1MN7 A;  1Z2Z A;  2VB6 A;  2WOM B;  2CPI A;  2IFX A;  5A6P A;  3CDW A;  4P2F A;  4UT4 A;  1P27 B;  3QMQ A;  5KFX A;  1S99 A;  4KKO B;  2QC3 A;  2CPX A;  4QPX A;  3KG4 A;  3AD8 C;  2RQC A;  3SDE A;  4M5G A;  5IFM A;  1NPP A;  2W8K A;  3TAP A;  3GYN A;  1YJU A;  1R8P A;  1HBO A;  3OL9 A;  4O23 A;  1SQE A;  4XAK A;  4ES1 A;  5CA5 A;  1S0V A;  1L3S A;  3GIM A;  1RT3 B;  4DHV A;  1HBN B;  1Q8K A;  2AYB A;  2A2C A;  2IJN A;  2W9B A;  4X4R A;  2HNZ B;  5B0A A;  1LKZ A;  3BQ0 A;  1TL7 B;  1SKU B;  3TVY A;  4Q8F A;  2N3O A;  4M5H A;  2V4J B;  3G71 S;  1KDN A;  4F25 A;  3V6H A;  3IC1 A;  3NS7 B;  2JC0 A;  3HO1 A;  2YX4 A;  1QE1 B;  2XQC A;  4DXL A;  2D3U A;  2DEJ A;  3CCZ A;  1S9G B;  3B54 A;  4QIF A;  2ZD1 B;  5H9F K;  1IR0 A;  2NRE A;  4PG6 A;  2J0W A;  1PC4 A;  5IM0 B;  3V4I B;  2GX8 A;  3RAX A;  1RWP B;  1LWF B;  1CVJ A;  4NA1 A;  4NLS A;  1UW4 A;  2IDE A;  1FKA F;  2F63 A;  2CNN B;  3P5B P;  4MK8 A;  3GCW P;  5KOX A;  2DR9 A;  2IIH A;  2QMU B;  1HBU B;  2HHQ A;  3VHQ A;  1H2T Z;  2JDJ A;  5GAD I;  4ZN3 A;  2FHO B;  1KD1 T;  1XNR F;  1YKW A;  2OEM A;  4OLO A;  1KVI A;  5F9L A;  2WVF A;  3PG9 A;  3GR1 A;  2HS4 A;  2XMU A;  3CJR A;  4IDK B;  3QJJ A;  3IWX A;  4DR4 F;  5KT2 A;  2OKQ A;  4RW7 B;  1CQM A;  3GZ7 A;  2MST A;  4J9K A;  5LL6 d;  3HCX A;  4RUA A;  4HR2 A;  3OUY A;  1EKR A;  1S97 A;  1U49 A;  2AD9 A;  2XY6 A;  1QSL A;  1RWU A;  1HBM A;  3I0S B;  2K3K A;  2HYI B;  2A10 A;  4ZVQ B;  4U96 A;  1BWE A;  2VDH A;  2B4V A;  1L5U A;  5J2N B;  3PV8 A;  2I5J A;  3IN5 A;  3P96 A;  2Y9H A;  5KFU A;  1JXV A;  3B82 A;  4OZJ A;  4ZCI A;  2KJV A;  1Q16 B;  3KNG A;  3M32 B;  1TEL A;  5EWE A;  3HJF A;  1QJH A;  2HQD A;  4ALZ A;  3ZTP A;  1N34 J;  1F3F A;  4RPF A;  3J7Z T;  3SCK E;  3M6V A;  4EMD A;  1HNV A;  5HMX A;  1NK8 A;  2PI5 A;  1RK8 A;  2ZBC A;  3NGS A;  2VZ9 A;  1FDA A;  2M2B A;  1KLM A;  5F0W A;  1EP4 A;  1DQA A;  5IT4 A;  2B43 A;  3EUN A;  4RNO A;  3CNQ P;  1Q86 T;  3K8V A;  1DTT B;  4FP9 A;  1T11 A;  3V5R A;  1M5H A;  1YDL A;  3DRS A;  4PG8 A;  2OEJ A;  4NAS A;  1DAR A;  2DHA A;  2R9L A;  2ZC4 A;  1S59 A;  1UVK A;  4DCO B;  1KOH A;  2Y0S D;  3DOK B;  3RYL A;  3FEY B;  1FJC A;  4K50 A;  4HKQ A;  4ENO A;  2ZH2 A;  1D8Z A;  5HMY A;  2HPU A;  4DV2 J;  3W2V A;  3QBC A;  1N5Y A;  1SJ4 P;  2YH1 A;  4HLB A;  2VIC A;  3KHL A;  2LU2 A;  2M0G B;  4RUC A;  4ZJL A;  1S1U B;  3QJL A;  4H4O B;  2UV8 G;  3EVO A;  3MEC A;  1YK9 A;  4JI0 F;  1NO8 A;  2YNG A;  3QFW A;  1ICE B;  3T5J A;  4HDH A;  2R2S A;  8ATC B;  3ZTQ A;  4EWT A;  1U1P A;  4NLW A;  2J5A A;  1QVG R;  5D3G B;  5D0R A;  4MFB B;  2N7Y A;  2CQ4 A;  1QTN B;  4KAI A;  2ZH7 A;  2CG4 A;  4HL9 A;  2DT9 A;  3PYF A;  4GO5 X;  4DX5 A;  4WBF A;  4B3M F;  4PG4 A;  4DR5 F;  1N56 A;  1V5I B;  2IA0 A;  3QAE A;  1X9S A;  5B0G A;  5C25 A;  4C9D A;  3PRD A;  4A8O A;  4AXI A;  2ALY B;  4GKK J;  2OAU A;  1N36 J;  4DI6 A;  5HI7 A;  1QUV A;  2XCA A;  4QR2 A;  4F4Y A;  2F3J A;  1HYS B;  2HVE A;  5E3R A;  4E2F B;  5BYS A;  4USW A;  1RAG B;  3WC0 A;  1U1M A;  3A13 A;  5HP1 A;  4XK8 C;  4YN3 B;  2BBE A;  3DRR A;  3R1L A;  2BE7 D;  2RRA A;  4CO1 A;  5ETL A;  4DV7 F;  3R5B A;  1RWX B;  4FDF A;  1NSQ A;  1T94 A;  1WOS A;  4B08 A;  2BAN A;  4URG A;  3RTV A;  2FZG B;  5J2P A;  4FZV A;  1RUS A;  4TY8 A;  2GML A;  2DNR A;  1GTH A;  2MLX A;  4NOH A;  2B9X A;  4DLE A;  1GAO A;  1KLN A;  2HND A;  2PA3 A;  5F8L A;  2HBZ B;  2DNO A;  3U1N A;  3WIV A;  5KT7 A;  2PD1 A;  1FJG F;  4MK9 A;  4NXN J;  3M8Z A;  4RW4 B;  1IKY B;  2GIR A;  2ILY A;  4A47 A;  3SDE B;  2C2D A;  3J7Y U;  1CG2 A;  4MMO A;  4KGM A;  1PYS B;  5IV3 A;  2DNL A;  5K8O A;  2RQK A;  3VQT A;  2VF3 A;  2M7S A;  5C42 A;  2O5D A;  1ZS6 A;  9ATC B;  2DNG A;  1OS5 A;  2M4M A;  2HWH A;  1Q8L A;  3O3L A;  4NLX A;  2EFV A;  5KG7 A;  2W9B B;  2HQ3 A;  2HS0 A;  1HNZ J;  4UY8 T;  1FX2 A;  3WQP A;  1YLX A;  2UU9 F;  4NX9 A;  3NGD A;  2R8G A;  3OR1 A;  4EU0 A;  2VPW B;  2FJW A;  1T03 A;  4G65 A;  4PXC A;  3KLF A;  5EUH A;  1NSA A;  2OP5 A;  2QE5 A;  1GQE A;  3OTO F;  4ZIT A;  4OX8 A;  1PIL A;  4PAA A;  1XMO F;  5JVG Q;  4MKV A;  1KON A;  2FHM A;  4FN5 A;  2C3P A;  1T9X A;  2DCL A;  4DJB A;  3DC2 A;  1NK4 A;  1X5S A;  4OZ0 A;  3PFO A;  2ZHA A;  2VBY A;  1WC0 A;  3PW5 A;  3MCO A;  2ASJ A;  1B3T A;  2V9K A;  4ZIW A;  1YRT A;  1D9D A;  1AFJ A;  3Q8R B;  2W2P P;  5A76 A;  1PJ6 A;  4U6P A;  1A0O B;  3Q8V A;  3F0N A;  1IQZ A;  1HL6 A;  2LYV A;  4NEY A;  5DS7 A;  4L6V 3;  3TUP A;  4DR6 F;  3ZZ0 A;  2F4F A;  4WYW A;  1OPZ A;  4NLU A;  3VZH A;  4J9R A;  3CF5 Q;  3H4B A;  5L38 A;  1WI8 A;  2CJX B;  2KG0 A;  4RU9 A;  3OFG A;  1Y5L B;  3M4X A;  2G1H A;  2BJD A;  5CAA A;  2MZS A;  3CJK A;  1U1L A;  3MM8 A;  5C5J A;  4XDD A;  1GXU A;  1XNR J;  1PYO B;  3OUY B;  1HWU A;  3FGV A;  1V6H A;  2BM1 A;  1HQE A;  4LBI A;  4M5I A;  1C2P A;  3ETO A;  1KBR A;  4AQY J;  1VQO S;  2ZWO A;  4FVC A;  1H6K X;  3DDN A;  3IRX A;  4C3L A;  1HBM B;  2VFT A;  2XMK A;  3IAM 9;  4DR4 J;  1S6P A;  2CRL A;  5JXS A;  3R7S B;  4I69 A;  2VD3 A;  4NLO A;  3TUZ C;  2H4W B;  2FLN A;  2I5J B;  2UVW A;  1LFP A;  3P49 B;  1RA7 A;  2AF6 A;  5KOW A;  1FWL A;  4P2X A;  3KLI A;  2K1R B;  2P9C A;  3DDK A;  4I0W A;  2HS3 A;  4P73 A;  3GSI A;  4UOH A;  2CDQ A;  3ILL A;  5A2Q U;  2B7B B;  1M1G A;  5DQI A;  3E8O A;  3D6F B;  3LWL A;  3AFG A;  1HNV B;  4USV A;  5E33 A;  3ZZO A;  2LEP A;  2NQP A;  1O8B A;  3POT A;  1XR6 A;  4X62 F;  1KLM B;  5CZV A;  1FKP A;  1YJ9 S;  2MQN A;  2DGV A;  3OR2 A;  2NCK L;  4QCL A;  1I3O B;  1X4A A;  2AEF A;  2DGW A;  2HGM A;  5T41 A;  3G6Y A;  2UUB F;  3D0I E;  4DV1 J;  3JXO A;  1X4C A;  2YKP A;  2RHS B;  1LW2 A;  1WC4 A;  3IA0 A;  5IQ6 A;  3BF4 A;  3FBF A;  1S1X A;  2LQB A;  3DRS B;  1MNE A;  3HSZ A;  1PBU A;  2B4U A;  4YDX A;  4DV6 F;  5I4M A;  3NMR A;  1YVF A;  4DPW A;  2DRB A;  2CQ0 A;  2DGX A;  2E7W A;  3K5M A;  4ID8 A;  3PZP A;  2MPU A;  4UQT A;  4WU2 A;  3W2V B;  1SQG A;  3BO3 A;  4N77 A;  4PPZ A;  3HDS A;  2V2V A;  1WG5 A;  1MWZ A;  1EET A;  2QYG A;  1FXL A;  1JB0 C;  1RBA A;  3T41 A;  1H38 A;  4X64 F;  2D9O A;  4AND A;  4I2P A;  3MEC B;  3ENA A;  1CUL B;  4FXV A;  3NXZ A;  1YGY A;  4OYP A;  2MXY A;  5HN0 A;  2DNN A;  3E01 A;  2B0G A;  1PG5 B;  1H7W A;  3H5U A;  2I9S A;  1N8R T;  2N3L A;  3S1T A;  4CI0 B;  3IRW P;  1CJT A;  1NKC A;  3AXK A;  2ZZT A;  2VQF J;  1BQM A;  3K7R A;  5B09 A;  3VGT A;  3SIP B;  2CKW A;  3L7O A;  5HBM A;  3SSQ A;  2HBR B;  4TYB A;  5J1N A;  1TKX B;  4WXO A;  3MED B;  1CSJ A;  2MKC A;  4JI0 J;  4DQI A;  2W9C A;  2M52 A;  4OYB A;  4DQP A;  3CGI A;  1FER A;  4NLV A;  2PFF B;  3HZG A;  1V3Z A;  2HHS A;  1QDU B;  4UST A;  3G87 A;  3GJR B;  4NZ7 A;  2CZ9 A;  3BYP A;  2NYH A;  3R7B B;  2DK2 A;  3M8S A;  3GII A;  2XSJ A;  4OMF G;  3KJN B;  3VAI A;  3AQP A;  4NMX A;  3EZU A;  5HVG A;  1JIH A;  2L3M A;  5EX3 A;  1HQU A;  4B3M J;  2BJ1 A;  4M5K A;  4DQR A;  3OJS A;  3DU6 A;  1VFJ A;  1KRP A;  2GJ2 A;  2GQQ A;  5F8M A;  4U8V A;  3DRR B;  2JLF A;  3M1V A;  2JEF A;  1O6X A;  3H5Y A;  3CO9 A;  2KXN B;  2FHK A;  2YVS A;  4HI2 A;  2ZDP A;  4F67 A;  4PYD A;  3TZX A;  2ZKT A;  2LXF A;  1GX6 A;  2D41 A;  2AYM A;  2C3U A;  3HFZ B;  3GFX A;  5KFK A;  3O8W A;  5J2P B;  2W8L A;  4TY8 B;  2BQU A;  2E7V A;  5HAO A;  1F9E B;  2RU3 A;  5AT1 B;  3IAS 9;  5SZT A;  4XO0 A;  2HND B;  4FF2 A;  2NR0 A;  4DSE A;  2BV3 A;  4NXM J;  1TQL A;  1HIY A;  4DV7 J;  5H1S V;  2FIU A;  2Z2Z A;  4C8Y A;  5HQ8 A;  4IKA A;  4F0H A;  1K44 A;  4YB6 A;  2JEJ A;  4OHW A;  1UCN A;  2AZ3 A;  4X4U A;  4B3S F;  1FF2 A;  5GAH I;  3JTN A;  2D3O R;  3D3C J;  2W24 A;  2BX6 A;  4OI1 A;  1LEO A;  1Y4Z B;  2R7X A;  5I3Q A;  2I1R A;  5C42 B;  3M2U B;  3LAN A;  2BJ3 A;  1FJG J;  1S0M A;  2ALZ A;  3DHW C;  2I6W A;  2UUT A;  4C0B A;  4UTG A;  4F4A A;  1FT8 A;  3AH6 A;  3SFG A;  4J91 A;  4TU7 A;  2HZC A;  2QX0 A;  3CDA A;  3CJ3 A;  2HAI A;  2FTR A;  3OR1 B;  3D66 A;  4F04 B;  3KLF B;  4ZLN A;  4ITS A;  2NZC A;  3M2R A;  2V2Z A;  2Z2L A;  1LW0 B;  2HFV A;  3BKU A;  3K89 A;  2IJF A;  1HHS A;  2MHE A;  4V19 J;  5E3C A;  1HW8 A;  3MUM P;  1EKS A;  1T3O A;  1SC1 B;  3BEG B;  2UU9 J;  4Q2L A;  1XJW B;  3RU0 A;  2X1G A;  4I7F A;  2MQL A;  4K4Z A;  2ZVI A;  4KR0 B;  1G2E A;  3B8H A;  5IWA J;  1EJ7 L;  3OTO J;  1FDD A;  4RZR A;  1NAQ A;  3NWG A;  3VWS A;  2LXI A;  2HHH F;  5K8M A;  1TL4 A;  2ZOF A;  1Y3J A;  4M95 A;  3CC7 S;  3OSN A;  4TKT A;  4NML A;  1EHW A;  4KRW A;  1NRK A;  2BRL A;  3M2V A;  4PXE A;  4NPO A;  1MW7 A;  1RKI A;  4C8K A;  1KOO A;  2ZVS A;  3LGM A;  2V8P A;  1WF1 A;  2VBX A;  4DG1 A;  3FSX A;  3CJK B;  3Q8U A;  3PFE A;  3HLU A;  2AEJ A;  1T9Y A;  1R27 B;  4N76 A;  2IMW P;  1ACM B;  4UW2 A;  5DQG A;  1HQE B;  5RUB A;  2ADB A;  1BMQ B;  3DOM A;  3T1H F;  3PKM A;  3FBB A;  3IR7 B;  3IRX B;  3R5J B;  3OTB A;  2J0Q D;  3F41 A;  4DL6 A;  5D4N A;  2V8D A;  4OZ1 A;  4F3Q A;  2P8I A;  4LSN A;  2MY8 A;  2HHW A;  2UXB F;  2DH7 A;  1JLG A;  2CIM A;  2KHC A;  3RUB L;  3DXS X;  1TFW A;  3M7V A;  2RUS A;  2YKM A;  4NE9 C;  3H42 A;  4PCQ A;  1N52 B;  2ABY A;  3J81 Y;  1DLO A;  3ZNU A;  1UKU A;  4O44 B;  1UVM A;  1GK8 A;  3FRY A;  5DDR C;  3KK3 A;  1WDD A;  3W5Z A;  2VPX B;  4F0M A;  5E2Q A;  3O6Q A;  4FF3 A;  5KTQ A;  1FX4 A;  1U2C A;  3POT B;  4X66 F;  3OR2 B;  2R8K A;  2YX1 A;  1JLC A;  1DUR A;  1KVK A;  2AHO B;  1VQ5 S;  2C2N A;  4B02 A;  4IOA Q;  2XLJ A;  1YRX A;  2E1M C;  3H40 A;  1FVQ A;  1LW2 B;  1I51 B;  4DPO A;  1D8Y A;  4N7T A;  2DGQ A;  4C3M A;  4KH0 B;  1S1X B;  2AX0 A;  4GC6 A;  4CLL A;  2OJ3 A;  4OYA A;  2C2O B;  4NLY A;  2W2Q P;  5D0H A;  2XLI A;  3TX8 A;  4RW8 B;  1IR1 A;  2B56 A;  2UUB J;  5KG2 A;  1PGZ A;  5HSP A;  4ZVH A;  4A4J A;  1SUQ A;  4LSZ B;  4QIV A;  1RYR A;  3PDN A;  4NCB A;  5KG5 A;  3A12 A;  1RHK B;  1CJV B;  3TUJ C;  3VAK A;  3LO3 A;  3R5C A;  1EET B;  1FEE A;  3ZTR A;  4ATN A;  3ICL A;  3QGP A;  1D3W A;  5KG0 A;  2QA1 A;  4I2P B;  3V4M A;  4X4P A;  4DF8 A;  3DLB A;  2E66 A;  3E01 B;  3K5L A;  4O3O A;  4P74 A;  4C8O A;  3THP A;  3DI6 A;  2GAH C;  4X4O A;  4B3O A;  2DJW A;  1NH8 A;  2K8G A;  3BYR A;  1CJT B;  2DNK A;  1K8A T;  2F9J A;  5KFN A;  3CPW R;  1BQM B;  2YNI A;  3R7N B;  1PAE X;  5B0E A;  4X64 J;  2XTJ P;  4JI4 F;  2XMJ A;  1VLY A;  4HAC A;  4H54 A;  3TJ9 A;  1A9N B;  1UP1 A;  4YQW A;  2MQM A;  1U25 A;  4F4K A;  4ZVP B;  1CJU B;  4U67 Q;  1FRM A;  3HZE A;  1F1B B;  3BO4 A;  3TP2 A;  2XWX A;  4OYX A;  3KTQ A;  1KWM A;  2ASD A;  2HIQ A;  4O3R A;  3AD7 C;  1V5V A;  4QIG A;  5DQH A;  3U02 A;  1R6Y A;  4ER8 A;  1TU0 B;  2MZ1 A;  1NZA A;  3TEH B;  2BA9 A;  1IBK F;  2VG7 A;  3IM9 A;  1HQU B;  1VC0 A;  4LT6 A;  2ZM6 F;  3JSB A;  2A18 A;  4LFB J;  5J2M A;  4DR2 J;  2IBK A;  2GVZ B;  4DR3 F;  1WG4 A;  2VQE J;  3LGH A;  3M1V B;  2QFJ A;  1RLC L;  1LWX A;  2COL A;  1U24 A;  2ZJP Q;  1F0X A;  5F8G A;  2ZUG A;  2RS8 A;  3OVS A;  3CDU A;  1F2G A;  1M5V C;  4R25 A;  3IMQ J;  4M5D B;  4K4U A;  2KFZ A;  1U48 A;  3ILO A;  1D0E A;  3AJ2 A;  2NLW A;  3MCM A;  2DVI A;  4NLG A;  1Y10 A;  1B4S A;  1NPK A;  1VQ7 S;  4JI3 F;  3MGJ A;  1DQ8 A;  2YNF B;  3BGR A;  5KT5 A;  3GWC A;  5KFR A;  3M8W A;  3GV8 B;  1SCJ B;  2PGC A;  1R6V A;  4DL3 A;  3LH2 S;  3HVA A;  2PO4 A;  1L3V A;  4QYZ K;  3QZ7 A;  1ROF A;  4Q43 A;  3RGI A;  1F9H A;  5KFZ A;  2CJK A;  1RAB B;  5JVH Q;  3AOB A;  1R31 A;  4ZS6 A;  1WOP A;  2MSS A;  4TU9 A;  2ZH1 A;  2CQI A;  4OX6 A;  2QLB B;  2J6S A;  2H51 B;  4NCG A;  2LEC A;  3SV3 A;  4ZPW R;  2FJV A;  3ILJ A;  2CQ1 A;  1PC5 A;  2DY9 A;  2VHG A;  4OZ2 A;  2GMH A;  2WVB A;  2AP6 A;  2QA4 S;  4PUO A;  4NRT A;  4FKX A;  2PN6 A;  3ADA C;  1RA6 A;  4WU3 A;  4Y2C A;  3Q8Y A;  2EVZ A;  4K5R A;  3CCU S;  3M2R B;  1UEU A;  1K1S A;  3ZZT A;  4KPY A;  1OQ3 A;  5KG4 A;  3BM7 A;  1UPP A;  3L4B C;  4PZV A;  4RWW A;  1SH2 A;  1X4H A;  4MAK A;  2RDI A;  3LUY A;  4RR5 A;  3KJV B;  3TAM A;  4CO3 A;  2PMW A;  5J1E A;  4ZIV A;  2AT1 B;  1GTE A;  2A6M A;  4B9S A;  1UL3 A;  2XSF A;  4EBE A;  1HNW F;  1DY3 A;  3AA8 A;  1U47 A;  3PYG A;  2QO3 A;  4F3M A;  5CD4 A;  3CME S;  3RZA A;  3NWR A;  3EWG A;  1IKW A;  3UNY A;  2B8P A;  3R9L A;  2P9E A;  4F26 A;  3D68 A;  2J7U A;  3M2V B;  1Q7L B;  1VQK S;  3QT7 A;  1Z4U A;  3MF5 A;  1C4A A;  5KFE A;  2KZM A;  5KAK A;  3PEJ A;  3FFI B;  1PJ7 A;  4DBQ A;  4P9S A;  3QSY B;  2FD2 A;  4DV3 J;  4DG1 B;  1WOO A;  2FVC A;  3JAM Y;  1IQT A;  5T7L A;  3V6K A;  3BB5 A;  4A8K A;  2CDR B;  4ZJQ A;  1KHW A;  4NWB A;  2GHW A;  2IM3 A;  3LOU A;  5IT9 U;  3DOM B;  2RUG A;  3F73 A;  1SC6 A;  3QRP A;  4G1Q A;  1IWG A;  1O0P A;  1N0U A;  2ZNY A;  3CDE A;  2B9E A;  5I3U B;  2BDP A;  2YKA A;  2DB1 A;  1JNZ B;  2VV5 A;  4LRB A;  2QLF B;  3ENQ A;  5L9X A;  1MLA A;  3GYG A;  4LSN B;  1U6Z A;  3VTI A;  4MJK A;  3TX0 A;  2D74 B;  3UDL A;  1ZM4 A;  3Q2S C;  5E5N A;  2QMX A;  3OXF A;  2FGO A;  3KLG A;  4JI1 F;  5K8N A;  1HPZ B;  2E1R A;  1DLO B;  3JB9 k;  1QTM A;  1RCO B;  3K8W A;  4B9U A;  2V69 A;  4IOC Q;  3KK3 B;  2V8G A;  1JLF B;  4ECR A;  4IOB A;  3UNG C;  3DM2 A;  2OHD A;  4Q45 A;  5L8R C;  3LPY A;  3W1Y C;  2DKO B;  1WF2 A;  4LFC F;  1F5B A;  3UD3 P;  1YJV A;  1JLC B;  3GFZ A;  2OO4 A;  1X60 A;  1VRQ C;  2ZNZ A;  2R7O A;  2VFV A;  1FFS B;  1T95 A;  3FMW A;  2KT2 A;  3KWM A;  1OQ6 A;  4LVN P;  3TRG A;  1JMT A;  2BAB A;  5KFJ A;  4DUZ F;  3D4J A;  4QW9 A;  2FHJ D;  4ECX A;  2FB0 A;  2BM0 A;  1UET A;  1U45 A;  2OSQ A;  1P9Y A;  4WII A;  2BVZ A;  3EYZ A;  4HYK A;  1RHR B;  3HD1 A;  1B64 A;  1Q8B A;  2E5H A;  2G4B A;  3KJF B;  3IBF B;  3CW2 C;  3LF0 A;  2LKZ A;  3HPO A;  4J9O A;  1TZ0 A;  4MH8 A;  4DZD A;  3FUY A;  1HNX F;  4ETZ A;  4WZQ A;  1VJQ A;  1O5J A;  5LSL A;  1NND A;  4DV5 F;  1ULR A;  4FF4 A;  3KHR A;  3IGV A;  1SUQ B;  3BKT A;  3SCI E;  4XDC A;  2FC8 A;  2HVD A;  3H8Y A;  2R2U A;  3RAQ A;  3MWB A;  1EQ0 A;  2XS5 A;  2QA4 G;  3W62 A;  5KFY A;  3FSY A;  3HI9 A;  1JLE A;  4QBU A;  4NYO A;  4EFA C;  3KK1 B;  3MM9 A;  4ZA1 A;  2WCX A;  3CIZ A;  4WYL A;  4IYQ A;  4KHR A;  4B3O B;  3OXG A;  4H4M A;  2JLE A;  1FES A;  4X65 J;  4TYA A;  3CC4 S;  2H5I B;  2QFI A;  2KRB A;  4MKY A;  2YNI B;  4RUB A;  4FBT A;  3QPI A;  5HQL A;  2G1D A;  1RAE B;  3CED A;  4HAC B;  4C2M A;  3MCS A;  1JX4 A;  2I38 A;  2ZH3 A;  3I56 S;  1UJ6 A;  1RT1 A;  1Z2L A;  1RT7 A;  1OIA A;  4DL0 C;  5DJB A;  3UQS A;  3HFK A;  3LW5 C;  1EB0 A;  4IG3 A;  1ZTW A;  2F4V F;  1KSP A;  3M8Y A;  1IR2 A;  5F8I A;  3MEE B;  4OYO A;  1RT5 A;  4GVB A;  2VG7 B;  3GG0 A;  3HHL A;  3FBC A;  5J2M B;  4DFK A;  4F02 A;  2R42 A;  3JSM A;  1J27 A;  4C0O C;  4CNY A;  3OPK A;  2MGZ A;  3W8G A;  2J8A A;  2UV8 A;  4LR8 A;  2E5G A;  4YHH J;  3HHL C;  5D4L A;  1IBK J;  3FDS A;  4ZPB A;  4JYA J;  1W26 A;  4ZJO A;  3M6X A;  4F7V A;  2YPY A;  4RO0 A;  5KT4 A;  1SBR A;  3ETM A;  2AYG A;  3SMZ A;  1S9E A;  4F3O A;  4DR3 J;  1GMV A;  5JJB A;  3QSI A;  2RQ4 A;  5HVH A;  1D9F A;  5DDO C;  2X51 A;  3BH7 B;  3G86 A;  1YRU A;  2KT3 A;  1XMQ J;  2FY1 A;  5IS2 A;  3I5A A;  2LEA A;  2JNJ A;  2QG9 B;  1RAI B;  1OMS A;  3WBZ A;  2MQQ A;  3T5H A;  1JQG A;  2P5V A;  1D1U A;  5IT0 A;  2L9N A;  4DSL A;  4ECQ A;  1IN0 A;  4CT9 A;  2Y1L B;  4BLG A;  5J2Q A;  1VCT A;  1U7L A;  2Z4P A;  4JI7 F;  4PG7 A;  4JI3 J;  2DIS A;  2JJ4 D;  1U2F A;  2ASY A;  1RIS A;  2WK4 A;  4RUH A;  4UUX A;  2UUA F;  3IFE A;  4NCG B;  4ECU A;  2W2M P;  3HT0 A;  1S1W A;  4WKR A;  4QYZ J;  4K4V A;  1CS4 B;  3K5P A;  3NOG A;  2B9W A;  2CQ2 A;  3X1L B;  3VCD A;  2DH8 A;  2NZ4 A;  3HHD A;  2FGC A;  1R8A A;  3HF5 A;  2OI2 A;  1WC5 A;  2Y1R I;  1RTZ A;  1L3K A;  3AJ1 A;  2JWN A;  4ELT A;  5F3T A;  3BH6 B;  2C2K B;  2XBP A;  4K4Y A;  5BR8 F;  2DH9 A;  2FDN A;  5B0D A;  2YQ3 A;  4J9N A;  3DNC A;  3TAM B;  3HHK A;  1SL0 A;  2UUC F;  1T7P A;  2HHU A;  1VGY A;  3R6G B;  4KKO A;  1TKD A;  4Y00 A;  4Y28 C;  1OWX A;  4DV0 F;  4KSE B;  1FDN A;  4PR6 A;  3PKY A;  4BHQ A;  3BSO A;  4CYU A;  3H5S A;  3D2W A;  5A8W B;  1NHV A;  1S6O A;  2GA7 A;  3BGU A;  1GMW D;  2PI4 A;  2W2N P;  5M2P A;  1PYT A;  1ELO A;  1HBN A;  4DN0 A;  1LXJ A;  2Q3P A;  2HIY A;  4P10 A;  1HQ2 A;  3GJQ B;  2A0F B;  2V4R A;  2QN6 B;  4DL5 A;  1IBC B;  2Z30 B;  1HNW J;  1RU1 A;  3SV4 A;  2R2R A;  1NJX A;  3J7A 1;  4OI6 A;  5D4O A;  5T7L B;  4NA2 A;  3R27 A;  4LF4 J;  1REG X;  3UD5 A;  3JQM A;  3GFY A;  2JX2 A;  2N4C A;  1R8C A;  2IAJ B;  4EZ9 A;  3QID A;  2UZA A;  2RNE A;  3OHA A;  4TY9 A;  2KXF A;  2IM1 A;  4EBD A;  4DCJ B;  4EO6 A;  4YY3 F;  4G1Q B;  1BQX A;  2NSB A;  1HR0 F;  2IRX A;  4NLT A;  1MWQ A;  2R8J A;  5IM0 A;  2NUH A;  1I94 J;  2GHV C;  3JTP A;  5BJR A;  4YB1 P;  1LWF A;  2XZD B;  4Y6I A;  4WP8 A;  1DZ5 A;  4CT8 A;  3KLG B;  5EDW A;  4Y3C A;  3WZ0 A;  4YEA A;  1YHQ S;  1UJ5 A;  3M8Q A;  2E29 A;  3IBW A;  3TI0 A;  2GV1 A;  2KO1 A;  2PMZ D;  2H4Y B;  2BE2 B;  4NL5 A;  3FK4 A;  2EG1 A;  1ZM2 A;  2MZT A;  1WG1 A;  2C2E A;  3BDP A;  1C1C A;  5LMN J;  1RGV A;  5ETQ A;  1XK8 A;  2WVE A;  3DM2 B;  2MJU A;  3MD1 A;  3H59 A;  1B70 B;  4P2M A;  2QSW A;  2RVJ A;  5M2R A;  1DAX A;  2RDJ A;  1FTC A;  3Q86 A;  2KYZ A;  4RW7 A;  3BN7 A;  4FBU A;  3TNV A;  2G0I A;  1HMV B;  3A3O B;  1HNI A;  1VLO A;  3DOL A;  1YZ6 A;  5CYQ A;  4I56 A;  1XEZ A;  3I96 A;  3BR9 A;  3L9Z A;  1ZAX A;  2MKI A;  3CCJ S;  2M70 A;  3ULH A;  3QGH A;  2VPY B;  3HVT A;  4O0N A;  4WXW A;  4DSI A;  4LFC J;  3CO0 P;  3QLH B;  4V19 X;  2RML A;  5KFD A;  3NS5 A;  4C48 A;  4ZPC A;  2MLZ A;  1YSJ A;  5DDQ C;  2VG6 B;  2ZJR Q;  3LQV A;  2RT3 A;  1VQ6 S;  2BW2 A;  2OGU A;  1KP6 A;  3D1O A;  1LXN A;  3NNA A;  1JJ2 R;  4LR7 A;  4ZOS A;  1VQP S;  3ISN D;  2IDL A;  1TUV A;  2Q43 A;  1NSK L;  4LRA A;  4PPD A;  5DM6 Q;  4JI6 J;  3MUT P;  2FY8 A;  6FDR A;  4URS A;  2E9R X;  3IO1 A;  5AJ3 J;  1HNX J;  3U27 A;  4A8W A;  2HFU A;  2CQ3 A;  4DV5 J;  4ELV A;  1B99 A;  4QIE A;  3H2L A;  4K2X A;  4J9V A;  2CJ9 A;  2E1P A;  3SSR A;  2VDI A;  4H4M B;  1RT4 B;  1OSD A;  1XMB A;  2KU7 A;  4DOZ A;  1U8W A;  4TLQ A;  1X0P A;  4R5P A;  5KG6 A;  4DUY J;  4DV4 J;  4KY3 A;  3OVA A;  1RTD A;  4DFM A;  2LU1 A;  4J37 A;  3K59 A;  3NCR A;  4JB8 B;  4RX6 A;  1RKJ A;  1PSD A;  1RT1 B;  1RT7 B;  3D0H E;  2DRD A;  2OFH X;  4K5S A;  4LBH A;  1N32 F;  5LMU F;  2XI3 A;  5D8H B;  3DOK A;  1J5E J;  1ZZN A;  3H2U B;  2EPI A;  1RT5 B;  4GVB B;  1TL3 A;  2MZJ A;  3HHL B;  2PEB A;  2F65 A;  3BPD A;  5ETP A;  2W25 A;  1O51 A;  4LF7 F;  1WKJ A;  1WDT A;  3G2X A;  4CCH A;  3JSM B;  2R7U A;  3NMA A;  1KFS A;  2MGZ B;  4ED0 A;  4LVO P;  2DHH A;  3B4M A;  2AJ4 A;  4LF9 F;  2DIV A;  3FCH A;  3IXQ A;  7FDR A;  2WON B;  1TUW A;  1SKW A;  1OYD A;  1S4F A;  4O3N A;  2Z56 B;  3J7Z 5;  3W66 A;  3IR6 B;  4AL5 A;  1LNQ A;  4YP3 A;  1BQN B;  2YTC A;  1UFW A;  1HWJ A;  1HW9 A;  2D7S A;  2YKQ A;  4RW9 A;  5FJ4 A;  5AXM A;  1HI0 P;  4KYZ A;  4U7C A;  3N4W A;  4Q2M A;  5J2Q B;  4OYZ A;  1AUS L;  3NS6 A;  3TZZ A;  4JOU A;  3U1L A;  4KHM A;  1WD6 A;  2NXE A;  4DPY A;  3AOC A;  4I4B A;  1HYS A;  3GB0 A;  1S1W B;  4K0K J;  1HFE L;  1MMD A;  3BPS P;  3VR1 A;  4MIW A;  2MY7 A;  1VQ8 S;  3OL8 A;  3QIP A;  3WIU A;  4QU7 A;  4DFP A;  3JQJ A;  2R3V A;  4ZCM A;  1UFL A;  4LF8 J;  1C0U A;  1Y5I B;  2WSC C;  3LPE A;  1G1X A;  2Q1L A;  1Q53 A;  5K20 B;  1Q8I A;  2UUA J;  1VQY A;  3TAR A;  3TUI C;  2H5E A;  4IG0 A;  4ZLP A;  3G6V A;  2DTJ A;  4KHP F;  3GIL A;  1Q7Y T;  4OI0 A;  3TA1 A;  2GFF A;  5ETK A;  2DXE A;  1RBL A;  1U0H B;  2VA2 A;  3TOQ A;  5D4P A;  3HP6 A;  2KM8 C;  4NZ0 A;  2VG5 A;  2Y8Y A;  4B9L A;  1X5T A;  4ZVG A;  4RW4 A;  1IKY A;  1C4C A;  1WAC A;  1VIO A;  2Z57 B;  3NGT A;  2W4C A;  3MXH P;  3RRG A;  4CYU B;  1VIS A;  3J80 Y;  5BR8 J;  3MPW A;  5B0C A;  3K17 A;  1GH8 A;  2KKH A;  1NDP A;  3ENV A;  4YOE A;  3N5F A;  1RDR A;  2XY5 A;  2MMY A;  5GAG U;  1NZ8 A;  2EC0 A;  5BYQ A;  3DXB A;  1LFW A;  4DV0 J;  1ZOT A;  2ZH5 A;  4R8U B;  2AJ0 A;  5CXT A;  1R0A B;  1JJH A;  4Y2K A;  3PHE A;  1XQI A;  5D77 A;  3CMA S;  3AXM A;  5HMZ A;  1UPM B;  4EGL A;  4RU2 A;  3EXC X;  5DO2 A;  1FD2 A;  4L3N A;  2WRM A;  3W5Y A;  4RJV A;  2U1A A;  1QAY A;  4D3G A;  3O5T B;  3R97 A;  2K7K A;  1VQ9 S;  5DZ6 A;  2KI2 A;  4CQ1 A;  4YFU A;  2FC9 A;  3GIR A;  2N4D A;  1TAQ A;  5IOL A;  2LQ9 A;  3M8Q B;  1FRL A;  3N79 A;  1AXQ A;  4HTJ A;  3MAH A;  3RR7 A;  1C1C B;  1KR4 A;  2AMC B;  1TL5 A;  2L9W A;  5HAN A;  2LP4 A;  2ASL A;  4WIQ A;  2ZUA A;  4LUB A;  2K06 A;  4YR0 A;  3FZB A;  1HNI B;  3DOL B;  4DX7 A;  3W9H A;  2O66 A;  2IMO A;  4HT7 A;  5CYQ B;  2B7C B;  2H1Y A;  2CYY A;  3BR8 A;  3T9Z A;  3CVK A;  1WTB A;  2LA6 A;  4YS2 A;  2R7Q A;  5C2G A;  3HVT B;  1Q4R A;  1XN9 A;  3EGZ A;  3CCS S;  3FVY A;  4J9U E;  2E9T A;  4UY8 5;  2YPZ A;  3CSK A;  3PX0 A;  2X7I A;  1YQH A;  1ZYQ A;  3FKB A;  3DDI A;  2C28 A;  4OYI A;  2Z2Y B;  1NKE A;  3T1Y J;  1TMJ A;  4KV8 A;  2K1R A;  3NBP A;  1RU2 A;  2KTQ A;  4AXJ A;  5HAT A;  1VOM A;  1RYS A;  2DGT A;  2JLG A;  1I1G A;  3A8K A;  4G6V B;  3PW4 A;  1U1N A;  1RP5 A;  1UEV A;  2CUY A;  4YME A;  2FLL A;  3DGP A;  3KUG A;  2FUG 9;  3KNA A;  3HHN B;  4FYD A;  1WC3 A;  2F5G A;  1SH3 A;  1HKA A;  3EZ5 A;  4CLS A;  4R5P B;  2RS2 A;  4GO7 X;  2RF2 A;  1RWO B;  4B3T F;  2KDO A;  2MQ8 A;  1RTD B;  1R0C B;  3W3S A;  4HVZ A;  1E6V A;  2YY3 A;  1BHN A;  3DLE B;  3JYT A;  2NSC A;  5DGA A;  3DHX A;  1NK9 A;  4ZKA A;  2AU0 A;  1Q5V A;  3A3N B;  4Q5V A;  5AE2 A;  2EW9 A;  4NEZ A;  2P6S A;  4PWU A;  3K57 A;  2APO A;  3ZZR A;  4IRD A;  1YWX A;  5BYR A;  2Q66 A;  1TL3 B;  2R8I A;  1X5P A;  2EBG A;  1NEE A;  4ZP6 A;  4K59 A;  4URQ U;  3TA0 A;  1VK8 A;  3IWN C;  2NS1 B;  3HKW A;  1NHU A;  4OYW A;  1ZH5 A;  3OJU A;  1N32 J;  1H2U X;  4KBI A;  1CUL A;  4PRF A;  1G3O A;  2LCW A;  3KLV A;  5CYM B;  2VJV A;  2HHP A;  2IRU A;  4DPX A;  2VBW A;  2OTL S;  4QWD A;  4DR7 J;  4M5M A;  3ZNJ 1;  3P45 B;  2DR7 A;  1J2V A;  1T9W A;  4LFA F;  2CA9 A;  3I32 A;  1RAF B;  2NXN A;  2C2M B;  4KC5 A;  1TKX A;  3MED A;  3UN5 A;  3AB4 B;  1VK3 A;  1EX8 A;  2HFZ A;  1LV5 A;  2ZBQ A;  1VRT B;  3CD7 A;  4JI8 F;  4RW9 B;  2HVZ A;  2VKR A;  2QZ8 A;  2KJW A;  2R4F A;  4LR9 A;  1WHV A;  5AXN A;  4NLD A;  2HGL A;  1P6T A;  2JFK A;  5HJY A;  4MIB A;  3VGU A;  2HGN A;  1NK7 A;  3G8T A;  2DIT A;  2H9Z A;  1SC4 B;  3WX8 A;  2ZC3 A;  3M8P A;  4L72 B;  3TA2 A;  3DN9 A;  4P6Q A;  3PW2 A;  4ZVF A;  2BXJ A;  3R2C J;  5FDL A;  1X8D A;  4IFV A;  4LRC A;  1M5S A;  1B0V A;  3QIP B;  2XG8 A;  2WB1 D;  5A8R A;  3K5N A;  1NK0 A;  1K73 T;  1N5Q A;  7FD1 A;  1SH0 A;  1TV6 A;  1C0U B;  3QQC D;  3PYD A;  1UEK A;  4JV5 F;  1SI9 A;  2BRK A;  2KM8 B;  1AZS B;  1VC6 A;  3ENW A;  2PA8 D;  3B4D A;  4IG0 B;  2UXD F;  1S4E A;  2EFO A;  2HFO A;  1N6Q A;  3DRY A;  3QZ8 A;  2D3O 1;  1MMN A;  2AGQ A;  2XWY A;  3W5X A;  1FRH A;  5LJ3 Y;  1F2H A;  4HDG A;  4USK A;  4K4S A;  3W65 A;  2W7P A;  2VG5 B;  2V8V A;  4RBU A;  2VC1 A;  3FNN A;  5E3Q A;  4DWI A;  4DLG A;  1PAU B;  2J9D E;  4E0D A;  2BJ8 A;  2M9K A;  2DR8 A;  2J0S D;  1RTH A;  3CD5 A;  1A6L A;  4U9R A;  3ISZ A;  2PMH A;  2XGQ A;  3PRB A;  3C16 A;  4KT0 C;  5FLX U;  1NU4 A;  4JP8 A;  3WHI A;  4D3H A;  4KGV B;  3PO4 A;  4F4X A;  1EQM A;  3Q0A A;  3M2U A;  1SIZ A;  2GJF A;  3H7H B;  2EK6 A;  2ADC A;  3KG0 A;  2KFN A;  2EEY A;  2KVI A;  2CNK B;  2VOO A;  3VAG A;  1QUP A;  2QL7 B;  5A8K B;  4TU8 A;  3Q2T C;  4FNH A;  1YI2 S;  5DLF A; 
#chains in the Genus database with same CATH homology
 3BBB A;  1MN9 A;  2DXF A;  1ZS6 A;  4DZ6 A;  1W7W A;  3FCW A;  1NLK L;  1XIQ A;  3VGS A;  2BX6 A;  3NGU A;  1HLW A;  1LEO A;  4W98 A;  2DXE A;  4C6A A;  3NGS A;  4UOF A;  3EVO A;  1WKL A;  1NB2 A;  2HUR A;  3JS9 A;  1KDN A;  1EHW A;  1VYA A;  1BHN A;  1NDC A;  3GP9 A;  5CAB A;  4HR2 A;  4AND A;  4UOG A;  3NGR A;  3ENA A;  3BBF A;  5BXI A;  4F4A A;  5CAA A;  2B8P A;  2DXD A;  2HVD A;  3EVW A;  3EMT A;  3R9L A;  1HHQ A;  3PJ9 A;  4EK2 A;  3ELH A;  1NSQ A;  2NCK L;  3B6B A;  3ZTQ A;  1NUE A;  3ZTR A;  4F36 A;  1WKK A;  3B54 A;  3ZTO A;  1MN7 A;  3FKB A;  2BEF A;  5IOL A;  3FBC A;  3Q89 A;  3DDI A;  3NGT A;  2DY9 A;  1NDK A;  4ANC A;  1LWX A;  1NSK L;  1BUX A;  3Q8U A;  3Q83 A;  3EJM A;  3FCV A;  3BBC A;  4FKX A;  3VGU A;  3ZTS A;  2B8Q A;  3VGT A;  3VVT A;  4CP5 A;  1NDP A;  1WKJ A;  1NCL A;  4WBF A;  3G2X A;  3L7U A;  4DUT A;  2DYA A;  3VGV A;  3FBF A;  1NHK L;  1PKU A;  3Q8Y A;  1F6T A;  3WX8 A;  1B99 A;  3EIC A;  3FBB A;  3DKD A;  1S59 A;  1NDL A;  4S0M A;  1PAE X;  3EM1 A;  1JXV A;  3Q86 A;  4ENO A;  1B4S A;  1HIY A;  1S57 A;  1NPK A;  5C7P A;  4DI6 A;  1S5Z A;  1NSP A;  2ZUA A;  3ETM A;  3Q8V A;  4FKY A;  1K44 A;  2VU5 A;  1BE4 A;  1U8W A;  3PRV A;  2AZ1 A;  3GPA A;  3FBE A;  3BH6 B;  3EE3 A;  3FC9 A;  3BH7 B;  3ZTP A;  1F3F A;  2HVE A;  1UCN A;  2AZ3 A;  4KPC A;  3MPD A;  2CWK A;  3VVU A;  4UOH A;  1XQI A;  3EVM A;  4ANE A;  4O0N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...