2HURA

Escherichia coli nucleoside diphosphate kinase
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
142
structure length
142
Chain Sequence
AIERTFSIIKPNAVAKNVIGNIFARFEAAGFKIVGTKMLHLTVEQARGFYAEHDGKPFFDGLVEFMTSGPIVVSVLEGENAVQRHRDLLGATNPANALAGTLRADYADSLTENGTHGSDSVESAAREIAYFFGEGEVCPRTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein,transferase
molecule keywords NUCLEOSIDE DIPHOSPHATE KINASE
publication title The structure of the Escherichia coli nucleoside diphosphate kinase reveals a new quaternary architecture for this enzyme family
pubmed doi rcsb
source organism Escherichia coli
total genus 42
structure length 142
sequence length 142
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2006-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 2hurA00
1XQIA 2VU5A 3BBFA 3Q83A 2AZ3A 3BH6B 2B8PA 2BX6A 2NCKL 1KDNA 3FCVA 1MN9A 4ENOA 3B6BA 3EM1A 3VVTA 4DI6A 2DYAA 3Q86A 3GPAA 3EVOA 3EVMA 2DXDA 3MPDA 3NGRA 1NDKA 1F3FA 1S59A 2AZ1A 3BBBA 3VGTA 4S0MA 1MN7A 1LWXA 1S5ZA 1UCNA 4DUTA 1NDPA 1HLWA 4UOFA 2DY9A 3Q8UA 1NSPA 1NDCA 2B8QA 1PKUA 3Q8VA 3JS9A 1VYAA 3EE3A 3B54A 3WX8A 4CP5A 1NPKA 1NSKL 3EICA 3PJ9A 3ZTQA 3FKBA 1BUXA 1NCLA 1W7WA 3FCWA 4UOHA 3BBCA 4F36A 3EMTA 1WKJA 3PRVA 3DDIA 1LEOA 1WKKA 4KPCA 1S57A 2DXEA 2ZUAA 3VGUA 1F6TA 1WKLA 3VGVA 2CWKA 1JXVA 1PAEX 3ZTOA 1NSQA 3VVUA 2HVDA 1NDLA 4F4AA 1NHKL 3EJMA 3FBCA 3ETMA 3G2XA 3NGUA 3NGTA 4UOGA 1B4SA 4W98A 1XIQA 5CAAA 3ELHA 3EVWA 3FC9A 2HVEA 1HIYA 3ENAA 5C7PA 4ANEA 3L7UA 2DXFA 3VGSA 3ZTSA 3ZTRA 2BEFA 3R9LA 4WBFA 1K44A 3DKDA 5BXIA 3ZTPA 1NB2A 3BH7B 3Q8YA 4DZ6A 5IOLA 1BHNA 4O0NA 4EK2A 4ANCA 1HHQA 1B99A 3FBBA 1ZS6A 1NLKL 1U8WA 3FBFA 5CABA 1EHWA 3NGSA 4ANDA 4C6AA 3FBEA 4HR2A 2HURA 1NUEA 1BE4A 3Q89A 4FKYA 3GP9A 4FKXA
chains in the Genus database with same CATH superfamily
2PSZA 1H74A 3OTDA 1IBLF 2BE2B 3V6JA 4HDHA 4OZLA 2OLWA 2IIHA 2NPIA 3PX4A 2MQLA 3RJMB 2W9AA 1U1NA 4DBQA 3RG6A 4EEYA 2D9PA 4RW4A 1ROFA 2IJRA 4IOCQ 3ZZTA 3TAPA 5B08A 1ZA2B 1AROP 3BBCA 2OFHX 4QWBA 4HLBA 4LF1A 4UUXA 2XNRA 2O5DA 4P2MA 4CLZA 3UPFA 2HVDA 5JVHQ 4U7UD 3W9IA 1FJ7A 4WYLA 2Z56B 3A8KA 3PIOQ 2M2BA 1HIYA 5AXKA 3LP1B 3TAMA 5F9NA 4TU9A 2MSSA 4GVLA 1FNOA 2D41A 2WAQD 2YWGA 2PO4A 2YQ0A 1BHNA 5FDLB 1V6HA 1GFWB 1D3WA 2AGOA 1VFJA 1TL3B 3L3CA 3AD8C 2GVZA 2E29A 2GCFA 2HIYA 1M1KT 6AT1B 3FQKA 1K0VA 3DHXA 3C6TB 4QWAA 1VGYA 1MW7A 2G0CA 2V68A 3LW5C 2UZAA 3R1LA 5KG2A 2CPDA 1QAJA 5CYMA 2HAIA 5ETPA 2C2NA 2CJBA 3MECB 2GVDA 1U6FA 4TQSA 2AD9A 3HHNB 3GG0A 4GMKA 4DN9A 3MCMA 2CNLB 4USJC 3W60A 2GFFA 4DQIA 2QL9B 1VIXA 1B7FA 1S7HA 5J2QB 3G6ES 4OL8A 5CA5A 2HFSA 5DDRC 4LREA 1WC5A 4FYYB 1FJCA 2OPRB 1H2TZ 4JI6J 4CLTA 4QIFA 2H65B 1KD1T 4ZLLA 3DHWC 3GYGA 3LWLA 4OQJA 1FEHA 1BQNA 4JV5F 1RCOB 2OKQA 3H20A 4C98A 1NZ8A 1RADB 2IDEA 5LSOA 2MGZB 3GP9A 4TKTA 4AUKA 2J6TA 1Y0HA 1P1TA 4DV4J 2QT7A 3HZEA 2DTJA 3RR7A 1VK3A 4TU7A 4B3SJ 3WBZA 2M7SA 2VDHA 1MU2B 2IFXA 4ECUA 1AZSB 2W2QP 3T1HJ 4F4XA 2ZC4A 1TR0A 3LP0B 4ZCIA 3MEEB 3GONA 4X65J 2HHSA 3QT8A 3TI0A 3I55S 3EDRB 3OHAA 1E6YB 3U27A 2ZH3A 1NKCA 1LEOA 2YTCA 5J2NA 3MI7X 4F67A 1M5HA 1LWEB 1DLOA 2CPJA 5C42B 2MZQA 2FTRA 2Q79A 3OQ2A 4DL4A 4FDFA 1RAEB 2KFYA 2BOAA 3FZBA 2DGSA 3RBZA 2VD3A 3MD3A 3KDOA 1RT6A 4NLRA 1ZS6A 4OHXA 2XMMA 3NG8A 2YKNB 1PYSB 2ZITA 5L38A 5KOXA 3IBCB 4NLPA 2NLWA 4O44A 2N7CA 2QLFB 3RUBL 3FNNA 2KO1A 4LFBF 4A4JA 2X1GA 3G6YA 2HNDA 3RAQA 2LQ8A 4DI6A 3DRSA 4DSLA 2RU9A 4I56A 4WP3A 3R97A 3TARA 1HMVB 4DXLA 3MR5A 2EXUA 4FXDA 2GHWA 2NYIA 5GMEA 2ASLA 4DV2J 1S9GB 4J9QA 3PKYA 4JB8B 3PEHA 3MTJA 1TZ0A 3E8OA 5L8RC 2IM2A 3HVTB 4F4WA 2IM0A 2IAJA 4OJGA 1QAYA 3Q2TC 5DLFA 4G1PA 5HN0A 2D3OR 4WKYA 2L9NA 1S1VA 3HLUA 3CJSA 4DUYJ 3FC9A 2Q3PA 2B6AB 3MM6A 2CJQA 3UNYA 3W66A 2HHHF 1XBWA 3L7OA 1Q8IA 1HQUA 2JNJA 2MXYA 1Y5NB 5DM7Q 1VJWA 3TVKA 1RT4B 4O4GB 4A8XA 2CPZA 3MPYA 3CJ2A 1WF1A 4RW8B 2FLPA 4HR2A 4NRTA 2CJAA 2WB4A 2N7YA 4P7VA 2M5YA 2EW9A 4LIRA 2W25A 1S1UB 2HBYB 3R3TA 3A12A 1QVFR 3GPAA 1UW4A 1NDKA 2QMXA 1HNIA 2HRUA 5A8RB 2M4MA 2V34A 1DQAA 2A0FB 4OX9F 3OTCA 2WONB 1CJKA 5I3QA 1GK8A 4O3RA 2W2NP 3TR5A 2UUAF 3JS9A 4Y34A 1PCAA 5E41A 3R7SB 4C2MA 2J9CA 2JC1A 5B0EA 4HVZA 1RT2B 4I64A 4DV3F 1WG5A 3JQMA 3KKFA 1RAIB 4ZJLA 1VQ7S 4WFAQ 1R8HA 2RE1A 5IWAF 2MPUA 3IBWA 2OMOA 3C14A 3MMBA 2MKIA 2GMLA 1KHVA 4LRCA 1W25A 1FE4A 1S10A 2PE8A 3DOLB 3G9CA 4CO2A 3KJNB 3D67A 2RDDA 4KR0B 4Y2AA 3CMES 1RHRB 4Q43A 1KEKA 4X62J 2W1BA 2M8HA 4URQU 1WDTA 2BM1A 1S1WA 1MWYA 2OTLS 4ZHRA 1U45A 3BSNA 1H2UX 3EVOA 2K1RA 5HVFA 2HHUA 3MAAB 2C2EA 1KVJA 5HAOA 1N5VA 2N3LA 4ED3A 4AQYF 5MLCV 2A1BA 2ZC3A 3B54A 2WBMA 4OYIA 3MMAB 4CLUA 3PHEA 5E3QA 1WC4A 2Y1LB 2DR5A 2V8HA 4F36A 1F9FA 1WACA 3TJAA 4JI1J 3FQLA 3NAIA 3H4DA 1AUDA 1NJXA 3MMCA 1PJ5A 2O3DA 5KT2A 2NSCA 4ELTA 1T02A 3I0RA 3QGHA 3PYEA 4X4UA 3KXDA 2V8DA 1T7PA 9RUBA 2CQCA 2J7UA 5CCLA 4JI7J 3B82A 1FFWB 2GO8A 4C8ZA 1UVLA 2I0XA 3HSJA 4LF9J 4QWDA 4X4QA 2KT3A 2YNFA 5J2MA 3KNGA 1SXLA 3BB5A 4KGMA 2D74B 2JVOA 3QGPA 5HK4A 4YDXA 4KQZA 1H38A 2KB2A 1X5PA 2CJ9A 2X1FA 2DIUA 4ZVOB 1NK7A 2DY9A 4OJ3A 2XMAA 4YDDB 3PHTA 4FF3A 4LF7J 1N34F 1VQSA 1YQHA 1Z2ZA 2FY1A 4WYWA 1HBOB 3HHDA 5KFWA 2CQ4A 1M5VC 3HX9A 3M8QA 3W5YA 4MFBA 3HD1A 5IXUA 3N9UC 4YB5A 3AJDA 3H2LA 4C48A 2CWXA 5A8WA 1U7LA 2IMWP 4LFAF 4L3NA 1YRXA 2VDIA 2Y0BB 1TL7A 3BF4A 2ILYA 2R7OA 4JUZA 1WWHA 4W92B 1S99A 2DGXA 1JLBA 2CQ2A 4MKVA 2I5JA 2ZD1A 4RUHA 5IT9U 1RKJA 3ZZUA 5GAHU 3S7RA 3TX0A 3V5RA 1Z4UA 2RVJA 2MDAA 5KG5A 2W7PA 2GW8A 3MR6A 1WTBA 4Q0BA 2AJ0A 5D4OA 1KTVA 1RHUB 4UOFA 2LEAA 4R0JA 3TAMB 4X2BA 4RL1A 3OJSA 1W2IA 4ES1A 3BR9A 3GILA 5G0RA 4OYWA 4Y65A 2VKRA 4GKKF 1GTHA 2W2MP 1UPPA 4DV5F 1O6XA 3UR0A 2MZ1A 2RDIA 3BYPA 1AT1B 2GVZB 4M5HA 2OPPB 3R5CA 4PUOA 3DU6A 2CJKA 2L41A 3PR5B 3B4MA 4BHQA 4RWXA 4DL6A 3NMAA 1QDUB 4I0WA 3GR0A 1FXDA 3WQPA 2ZM6F 4ECZA 3G71S 1VQPS 3R5JB 1FK9A 5D77A 2W2PP 2MKSA 3I6PA 5CYMB 1HYSB 2GVDB 7FDRA 2V2ZA 2GHPA 2YWEA 3C19A 5EX3A 2CPEA 2J9DA 5A8KA 2IRXA 2MZSA 4DWIA 3KDNA 2FD2A 2V6AA 1XNQJ 4FNHA 1TUWA 3MCOA 1T9VA 3M8PA 1RT1A 4DV6J 5IM0A 1P9YA 1HR0J 4LF8F 2ASJA 3A3NB 3M05A 4WFBQ 3IAM9 4BWMA 1BQNB 1X5OA 5AE2A 5GAHI 3CCWA 3JSYA 2VL1A 1F2GA 1ZPWX 1RTDA 1H72C 1NHKL 3EGVA 4JI8J 2KM8C 5BYSA 1TP7A 4YB7A 1R0AA 3OFGA 4K2JA 1YITS 3KLIA 4DV7J 5HVHA 2R2SA 4I6WA 2I38A 4DEZA 4ED6A 3TUPA 2C22A 5KFVA 2H51B 1HNXJ 1FRJA 4ECVA 1R6VA 1U4BA 3KK1A 1U0HA 1DLOB 2QLWA 6FDRA 1N5SA 2PIIA 3DYAA 5GMDA 3CE8A 2AYBA 3QIPA 4GC7A 4P6QA 1QUVA 2JX2A 1N48A 1FO1A 1YBAA 2BE7D 2QLBB 4M5NA 1RT6B 3BGUA 2BVZA 2GJ2A 3OL8A 3QFWA 3WX4A 4WFNQ 1RJJA 2R3VA 3NWRA 4WKRA 4O44B 2FHJD 4PABA 1JLQA 2WW8A 1CC7A 1GT8A 2HNDB 4I1TA 2YWHA 3DRSB 4IRKA 1FERA 3I87A 3IM9A 4USTA 4N76A 1NBEB 1XNRJ 3B4DA 1VRTA 2J7KA 3SV3A 3VAMA 4G6VB 4RBUA 3EPGA 4HACA 1XQIA 4OI3A 4LRAA 5KFPA 1PGZA 4CLPA 4LSLB 2ASDA 1KKHA 2IAJB 4ZLPA 2A10A 5D4PA 1FWKA 2XLJA 5D15A 4LIWA 3S1TA 2HVZA 5IQQA 4LRBA 1S1VB 1S1TA 5DJBA 4M8LA 1Y3KA 2RD5C 3N79A 3MM6B 1T9TA 3DRXA 1HQUB 2DKOB 2WVBA 4NLUA 2E7WA 3BGLA 1NKEA 1SH3A 3ILIA 3BGRA 3VQSA 2XLIA 3KOAA 2DGUA 5ETSA 5KFKA 2RUGA 1NH7A 5CAAA 2BJEA 4HT5A 4ZMMA 3ENAA 3Q8SB 1VQ9S 3WC0A 1HWLA 5C7PA 5DZ6A 2HQCA 3JB9k 4J9KA 1YJUA 3EXCX 2F8HA 4JI0F 4DOZA 2E1RA 3R5AA 1HNIB 2IJFA 1NKBA 2EK6A 3FVYA 1NB2A 1E6VA 3P6YC 4LRDA 1CJKB 3QT5A 3W2WA 3CDEA 2ACMA 4B3RJ 3LUYA 3PO4A 3CF5Q 4QIWD 2QSFA 5B0FA 5IT4A 5LM7E 1RZMA 2OEJA 2UV8G 3IWLA 1S0NA 2RQ4A 5ETMA 2QLJB 4DLGA 3VTIA 3JAMU 2KI2A 4KYZA 5KFBA 1S12A 5DM6Q 3PW0A 3C14B 1RDRA 1EQMA 4B3OA 4LMZA 5F8HA 2EWHA 2ZHOA 4HHJA 3AB4B 3R6LB 1DRZA 1HBUA 3Q2SC 3M6VA 4LT6A 5E2QA 3CCVS 1RYSA 1WI8A 4ZPBA 4USWA 1UWBB 3VHQA 1YIJS 4LSNA 4DR4J 1B4SA 1UJ6A 1S1WB 4ZHRB 5LJ5Y 2K1RB 4KV8A 2H4WB 4NEYA 4NCBA 1D8ZA 1K44A 4CIOA 2FJXA 4IG0A 2EC0A 3IRWP 3K57A 3BJYA 5JUMA 1NJIT 4B9UA 3PO5A 3OXLA 2JSXA 4DL3A 3HXMA 5FLXY 4BC9A 3JAMY 2NXJA 2BJ7A 5KFTA 3MMCB 1ZAWA 1TUGB 3G4SS 1PAUB 4H4KC 3KHLA 1FKAF 3U02A 2HW3A 4PPZA 2XYHB 1RYRA 3I0RB 1N33F 2LA4A 4KT0C 1JQGA 2NXEA 1RAAB 4YHHF 2XWYA 1ZETA 3KNAA 3AT1B 1N6QA 4BS2A 3TQ1A 2V2VA 3THVA 1S79A 2B4VA 1VIOA 2KHDA 1LXNA 3Q24A 4J37A 4ZP6A 2R8JA 1RGVA 4QU6A 4G3IA 3S8SA 1SL1A 1X4DA 2YNFB 5J2MB 2OSRA 3VAKA 4IQXA 1HHSA 3VZIA 1U26A 2MY7A 2GQQA 2F9DA 2H3EB 1C2PA 4F26A 5HO4A 3SFUA 4HYKA 3QJJA 1UW9A 2EBEA 4USVA 5HI7A 2FC9A 3PYGA 1YJVA 4CQ1A 3FEZA 1MSWD 3BKUA 3VVTA 3M8QB 1VK8A 1MMDA 2DYAA 3ZFVA 4MFBB 3QRQA 1WSRA 1SPBP 1QAIA 4WJBA 1N4LA 2B51A 5A8WB 1S77D 3PFOA 1TL7B 1ZYQA 3V6KA 4DV4F 2KVQE 5F0WA 1JLBB 2FC8A 3H5SA 1SI9A 2I5JB 3SQOP 4J9NA 5IC6B 4IYQA 1LFPA 4B3SF 1TK5A 2ZD1B 3DMJA 2XO7A 3HVWA 3KHGA 2FHMA 4HTIA 4KHPJ 5KT7A 2RKIA 2Y1IA 4E0DA 3PYDA 4X65F 2COLA 2DBBA 4DFMA 1ZTTA 4PG7A 3H59A 2VC0A 3K7RA 1CQNA 2BA9A 4Q0BB 3RBEA 3GU0A 5AXLA 1WEZA 4DPWA 3G6VA 2O01C 1KN6A 3H0PA 1HWKA 1S49A 1GX6A 2LLZA 2YNIB 2EBGA 3UDLA 2PGCA 2CAJA 3RW7A 3CDBA 5G0RB 1FTRA 1RA6A 2IVMA 1JLFA 3M9OB 1FFSB 2R7SA 1Q78A 4XDDA 5B7WA 4PUOB 5K9FA 4RW6A 3J7ZT 1K1QA 3PR4A 3QNWB 2BJ1A 2ZKTA 2FDNA 4R5PA 1NCLA 4DHVA 2GIRA 2KL8A 2HK2A 3EZ5A 3PIPQ 2CKWA 1FK9B 5CYJA 2GMHA 5DG7A 1RAGB 1RWPB 3UNGC 2HQDA 3PX0A 1NHUA 3MHYA 1DTTA 3WIUA 4BBYA 3FMBA 4L72B 4JI3J 3VZHA 1N8RT 3SCJE 4B3TJ 2A2CA 1RAOA 4USUA 1UPMB 3MF5A 3HCXA 3TP2A 3M8PB 1RT1B 2LFVA 5IM0B 2NREA 1LWCA 2HFNA 5SZTA 4GO5X 4RKUC 3X3UA 4C8OA 4CLKA 4DUYF 1MWZA 2ZVIA 3P5TL 2BW7A 4QYRA 3R8YA 3BBFA 2R7QA 1K47A 5L9NA 4DFPA 1DQ9A 2LP4A 1OQ6A 3HHLA 2FZGB 4NL5A 5L39A 4KGVB 1RLDA 2QGFB 3UR3C 1RTDB 5K8PA 2BKPA 2QFJA 2GIQA 2OO4A 1R0AB 1X9WA 3GG1A 3KLIB 4WFYA 2EKYA 1Y7PA 4DLEA 1RAFB 2GQCA 1VS3A 3OVBA 1TV6A 1IBLJ 1U2FA 1P8GA 4IR9A 2WVEA 5L1LA 4BDPA 3J7Z5 1EKSA 3CCRS 4NLQA 1WOSA 2HZCA 3GMGA 4G1QA 4CI0B 2HVEA 2MKYA 3NL0A 3L7UA 2QC3A 4JBCA 3W5XA 1QM9A 1S48A 1NHVA 3V2UC 3F0NA 4NX9A 3TA1A 1Y3JA 4Y6IA 1U0HB 2PD1A 3DYAB 2BJ3A 2VOOA 4OX8A 3QIPB 1WHYA 3D5MA 1LK5A 4WZQA 4YR2A 2XC9A 5KG6A 2CNOB 1WG4A 2VQEJ 2VASA 3TYTA 2E5JA 2NSBA 1J5OA 1VRQC 1YX2A 2G1HA 5EX0A 3A4TA 1C0TA 3TW0A 3PM9A 2GGPA 1JLQB 1TKZA 4E8UA 2BE9B 4WK1A 1OY8A 5F3TA 3BGOP 4QIGA 4CWBA 3ZTQA 3HHKA 2ZVSA 4IR1A 4H4OA 4IRCA 5HROA 1FDDA 4X4TA 3GTYX 4OX7A 1VRTB 4RJVA 1NMEB 2QE5A 3EGWB 4GRSA 3FBCA 5IC4B 4HACB 1BQMB 4QBUA 3ET6A 3I31A 3NCRA 2BQ3A 2ZH7A 4ITSA 1YJNS 3VQTA 2OHDA 1LWFA 2DCLA 3RB0A 2CG8A 4F8RA 2G13A 1KHWA 3DLEA 2LQ9A 4F02A 4P71A 3QSIA 1B0VA 1UKUA 2DNGA 4NRUA 1MLAA 2N82B 4R25A 3QJPA 1T94A 2PA8D 5E3RA 2YWFA 2DISA 3IS9B 1X4CA 2XS2A 3BGRB 3RU0A 1FXRA 4FPRA 4F0MA 2Q6BA 1I51B 3N6LA 2CQPA 5F8NA 1B70B 2XGPA 2QFIA 4LBIA 2B43A 5LJ3Y 1E6VB 2E1MC 2MKJA 3CMQA 1JJ4A 1DARA 2UXDF 1A0OB 4Z2XA 4O0IA 5D78A 2E7XA 2DGVA 4ECSA 4LF7F 1TKXB 3SCLE 4LF5J 3MM9A 2Y8YA 1EJ7L 2DNKA 3BEGB 3CCTA 2KJVA 3LH2S 1U1LA 1WF2A 3C16A 2R7WA 2YQ1A 3LALA 3KG4A 3CEDA 3UDCA 4B3OB 1FNXH 5CABA 4UW2A 2VG6A 3I0SA 3ENQA 3NBPA 3Q8PB 4H4MA 1LKZA 4NEZA 1HBUB 2WW4A 2MKCA 2XMWA 3H4BA 3OL7A 3FCVA 1D1UA 3F41A 4MJKA 5M2UA 4LSNB 1NK4A 1PC4A 2I1RA 2BRLA 3DOMA 1UEUA 3J7YU 1HNVA 5E7OB 4KV8B 4ZVPB 1ZAXA 2CPFA 5E0OA 1RWVB 3VAJA 4IG0B 1OYDA 2CJYB 1UL3A 4JYAJ 5CD4A 1RI7A 3VGVA 1M1GA 5EWEA 3D6FB 3EGNA 3W65A 4L74A 1ZM9A 1X9MA 4ZA1A 2VH7A 3NY0A 5D3GA 2GS8A 4LR9A 3QO9A 1HQEA 1PJ6A 5KFUA 4LUBA 3TEGA 3WZ0A 3KMSA 1WI6A 4F4YA 3R5DA 4DU8A 1SL2A 4HH0A 3IWNC 2XNQA 2PI5A 4NLYA 4CO5A 1N6QB 3DOKA 3Q8RB 2ZE2A 3ETOA 2GO9A 2VG7A 2E9RX 1RHJB 2F1FA 2XULA 1RSCA 4CNZA 1MN9A 3W5ZA 3E2EA 3NGRA 1K73T 2CA9A 2ZUGA 3W9HA 3LPEA 1S9EA 1GTEA 1Q81T 2Y1RI 3TOQA 2QYGA 4FVMA 5KFXA 1GMWA 4B9TA 2R4FA 4DS5A 3W2VA 1SUQA 1N56A 3EICA 2M8DB 3FKBA 4WIIA 1RBLA 3PNIA 1OMSA 3DDIA 4RBVA 3E01A 1NDLA 2CNNB 4DV6F 3GYXB 1HR0F 2PMZD 1O5JA 1WD6A 5EHHA 3K8WA 3NXZA 2IM3A 3NGDA 3WC2A 2OPQA 1ZH5A 1JK9B 2FJAB 4CLYA 2BUNA 1GQEA 2PFFB 2DVIA 3D1HA 1KFDA 3WDOA 4IOAQ 1VQKS 3CDWA 4DQPA 3D1OA 2DK2A 3TWZA 2XBPA 2JEFA 3VWSA 2NCKL 1HI0P 3ICLA 2IY5B 1ZBTA 5KG3A 2BM0A 2HHWA 3NWGA 1F3FA 2AWZA 1QE1B 3DMJB 1YKWA 3CD6S 3K17A 1M0SA 3J80U 4FNIA 4W90B 2RKIB 2VFTA 3IXQA 2R9LA 1L5UA 4J5OA 4OI6A 1FF2A 4J9SA 3SV4A 4M5DA 3FCWA 4NLOA 1HNXF 1RBAA 4RUCA 1FRIA 5LMUJ 4XK8C 9ATCB 3OL6A 2LDYA 1VBZA 4KHMA 5KFMA 5IV3A 1RAJA 3QSYB 2AU0A 5HVGA 3CD7A 3CXCR 3M6XA 3IFEA 4V19X 1JLFB 3QPIA 3C15A 5LSRA 1Q82T 1Q79A 2BYCA 4I2PA 4C4WA 4KKOA 3PRBA 2ROEA 5DG9A 2DJWA 2YXLA 4A46A 2APOA 4RW6B 1PILA 4IG3A 2CDQA 1JLEB 4R5PB 4DCPB 4LF4F 2DT9A 3BH6B 5D0RA 1UEVA 2MJNA 1FT8A 2GJIA 2ZFHA 4PQAA 4P75A 2LXIA 3ZXWA 4EFAC 2G4BA 2DCUB 2E1CA 2XYPB 4KGKA 3TAQA 4I6AA 2JC0A 1N0UA 1XNRF 1PBUA 1X7VA 4WE1A 2VB6A 2I6WA 2DGWA 2ZJRQ 5KT4A 2AJFE 4NI2A 5A2QU 3JSRA 2HRYA 1QSSA 2MJUA 1LWCB 3V6HA 2CWKA 1HA1A 2AMCB 3BV8A 5HQ8A 4DG1A 1C4CA 2DR9A 1CJTA 3CC7S 4QPXA 1ZZFA 4EUVA 1M5SA 4EYIB 3HHLB 2VFRA 2JEGA 1Y00A 5BR8F 3G8TA 1IQTA 4FPIA 4UUWA 3GIRA 1TL4A 2FPHX 3NGSA 5CHCB 4CM2A 3R2CJ 4ED0A 1AUSL 4DS4A 2OMLA 2VFVA 3A13A 4FBUA 4LFCF 4FZVA 4CH7A 2V8VA 1TV6B 4WWSA 3HPOA 1P6TA 1H98A 1J2VA 1SQFA 4ZIWA 2B9WA 2HQFA 4G1QB 4B3RF 5IV4A 3A3OB 2GC8A 2XCPA 3ITHA 1U49A 4ZPCA 3UCGA 4PWUA 1R6YA 4MAKA 2Y3YA 3CCLS 1WDDA 3ZC4A 3H8YA 4ETZA 1UVJA 4ECQA 4M94A 3AOAA 4C8YA 1VQOS 2VUGA 2R7XA 2FLLA 2DR6A 4JV0A 4RO0A 4A8SA 2BQUA 2KYXA 2HGMA 1J5OB 2F4VJ 1HWIA 4ECRA 1VMBA 5D0HA 2MQ8A 2ZWPA 4KPYA 1C0TB 4BCAA 2GGPB 2M88A 2RILA 1TKZB 2KFNA 1SVDA 4ANDA 4RW7B 2CPXA 1S0OA 4PKDB 3KJFB 4Q7AA 2L08A 3S01A 4YR3A 1CG2A 1R8BA 4GKJJ 1XERA 4OI2A 4H4OB 2HFZA 4KFBB 1D9DA 5HROB 3FSIA 2V67A 2PMHA 4JOUA 3MR3A 3CT9A 1NPRA 1UZHA 2LMIA 1YRUA 2WSCC 4PXDA 3ET6B 1UEKA 2M3DA 1F1BB 2QL7B 3D6MB 1HW8A 1LWFB 2EFVA 4ZN3A 4CTAA 1BXNA 2G2OA 3T6BA 2DNLA 1HBNA 3DLEB 1VQ4S 4OYAA 5EUHA 1HPZA 2ZBRA 4CDIA 1R31A 2CNKB 5GAEI 2DEIA 3F44A 1RB0A 2HRTA 4LF8J 4UTGA 2NQPA 3N5FA 3KK3A 2AGQA 2MZRA 3D9BA 3CC2S 2ACYA 5FJ4A 1NLKL 4DX7A 1WG1A 3DRPA 1H73A 3U7JA 3ULHA 5DGBA 4ZPWR 3KMQA 2K7KA 2V4JA 4A8YA 3TZXA 2HNZA 3K5LA 2XY7A 4ECTA 4P74A 2W9CA 3DLBA 2DH7A 3EDQB 2CQIA 5KFFA 1SKUB 3TJ8A 3MM9B 4WCEQ 2OI2A 3IGNA 3ZNJ1 1TMMA 1JLCA 1WC0A 4DR6J 1RWMB 2BACA 2C28A 1JLGA 3C16B 3CTRA 2B7CB 2B3TB 3BSAA 3PEJA 3HKWA 1FEEA 1RP5A 2VG6B 4PYAA 3I0SB 5HMXA 2JJ4D 4PG4A 1NSQA 4OYZA 4PAAA 3TO8A 4H4MB 2YNGA 1KWMA 4F4AA 5H1SV 2HBRB 4IO9Q 1H6KX 3DI6B 2RDJA 3CCJS 3DLHA 3Q0AA 3JTOA 3KUGA 3NCQA 3ZTRA 2LEBA 2AYGA 4KTQA 1P9QC 2H1YA 2VOPA 4K4VA 2H4YB 2XMJA 3M2VA 1JWWA 2HFVA 2FGCA 2R2UA 3K5PA 2PDAA 3DOMB 1HNVB 2VICA 3HVRA 2DRAA 4KHPF 4RUAA 1DTQA 1UWAA 3UCUP 2J7WA 8ATCB 2Y0SD 1TMJA 2WOMA 2V8PA 3VAHA 4PG6A 4M5MA 4P73A 5T7LA 5D3GB 4ES2A 1R43A 1WEXA 3NMRA 1HQEB 4I68A 2MSTA 3SFGA 1DQ8A 3NS6A 2QA4S 4A8KA 1SKWA 1KSPA 2XZTB 3A1YG 2YKQA 3N28A 2A3JA 1SC3B 4YMEA 1YJRA 3KTQA 4OLPA 4J9VA 4DL0C 3PY8A 4P2SA 3DOKB 2ADCA 2ZE2B 2VG7B 2QO3A 1G4CA 2O66A 4ZP7A 3GYNA 5HJYA 4WP9A 2HQGA 1WC3A 1S9EB 1G3OA 1Y11A 3I32A 4U6PA 3W2VB 2KXFA 4L76A 1SUQB 2H5IB 4B3MF 1I5OB 4B3TF 3C66A 4CH0S 2KDOA 5A6WA 3OXFA 1YSJA 4CRJA 2VJVA 4ELUA 4GO7X 4FF4A 3QGIA 4DR5F 1FTCA 2YWKA 3ZZRA 3E01B 3L9ZA 1OJ4A 4ILLA 3H42A 3QLHA 2EVZA 3OUYB 4NZ0A 2OPQB 5B0CA 3QAUA 3BO4A 1XTZA 3TEHB 3IR7B 5T41A 4NXNF 4NLTA 3QRPA 3BGFA 3ENWA 3N01A 2VKZG 1G6BA 2FZCB 3AOCA 1VRUA 3MOZA 5BYQA 1IQZA 4WK3A 2P9EA 2DNRA 3EWGA 1B3TA 1BWEA 4MKYA 1NK9A 4Q2MA 2IJNA 1SV5A 3MURP 2GZOA 2E5HA 1AB8A 4TYAA 1AFJA 1PO6A 2Z2YB 2BKNA 4MK7A 4M5DB 4H4KA 4F0KA 2DNPA 2ROGA 2BX6A 3MUTP 3KLEA 3SCKE 4TLQA 4UOCA 4NMLA 2D7SA 3SSSA 2H54B 2E9ZA 2J6UA 4Q8EA 1FRKA 2YPYA 2OUGA 2E5LJ 4QZVB 2VQEF 3BN4A 3C15B 3M1VA 4I2PB 3AH6A 4KKOB 4TY8A 1NM2A 3DGVA 3O5TB 2YKAA 1DZ5A 1F6TA 3C6UA 1QLNA 3C8YA 2W7OA 4IG3B 4CO4A 2IYIA 2XMKA 1N36J 3FK4A 1XIQA 1SH0A 4DFJA 1VHIA 2UVUA 2IM1A 2XHWA 1N33J 2KHCA 1DY3A 1T95A 4YHHJ 4O23A 2ZNZA 1IWGA 4CNYA 2G2YA 3KJVA 3DM2A 4KO0A 5E33A 4WE1B 3TZYA 1IKYB 4C6AA 1BMQB 4JV1A 2GMJA 4NI2B 4QJVA 1GMUA 3JTNA 3TVZA 4ZJOA 4Q2LA 2BKOA 2B8PA 1U09A 3ISND 3D6TB 4RZRA 2MQMA 1HNZJ 2C2DA 3DLJA 1XWLA 2RS8A 1U6ZA 4DG1B 3IN5A 2H9ZA 3SCIE 1CJTB 3HKZD 2UUCJ 3KUEA 2CQHA 3T1YF 2UXCF 1N5YB 5DETA 1CEZA 5LMNF 1KQSR 2HFUA 3I9ZA 5HSPA 5C5JA 2UU9F 2XMTA 4P2XA 1FCAA 2ZUAA 3NOCA 4HTJA 2AJQA 4OI0A 2HWHA 1U6BA 2CPYA 1IN0A 4K7QA 3OLBA 1YRTA 3GFHA 4PRFA 2XMUA 3PKMA 3HSGA 3OVSA 1WC6A 4YP3A 4M5JA 1PSDA 2QN6B 4QYZJ 2W4DA 3CDAA 1S72S 4N47A 3OTEA 3UN2A 4DMZA 4DX6A 5GAGU 2VPWB 3TJ9A 4IUFA 3ITHB 4CO0A 3FRZA 3T3FA 4LF5F 1HD0A 2LXFA 3GV5B 5EWGA 4PR6A 4AT1B 3GJTB 3B6BA 4ZOSA 3ZZPA 2AKWB 3ZZ0A 3CJ5A 4QYZK 5CZXA 1LWXA 2LQJA 1QTNB 3M8WA 3QZ7A 3H5UA 1RWKB 4NLWA 3BSOA 4F3OA 1FDBA 1VYAA 4X4OA 2JL9A 4NLGA 1NSKL 4TY9A 2CUYA 3A8JA 2BJ9A 2AV5A 4DR1J 2FLNA 1SJ3P 4OI4A 4NLXA 5KFCA 1UZDA 1ZPVA 3GCXP 1J5EF 3BQ0A 4URSA 4ZJQA 2LA6A 2P6SA 2XSJA 3GJRB 2W01A 1URNA 2G0JA 1K9MT 1YBUA 1RA7A 2K7JA 3K8VA 1F5CA 1YVFA 4JYAF 7AT1B 2V2KA 4U96A 4ATNA 1RABB 2KN4A 4KB7A 3OTOJ 1XMOJ 1JJCB 2LQBA 4TLRA 3FSYA 4CTAB 1LXJA 5DG8A 2L9DA 3D28A 3MCSA 3NP5A 3GSDA 1IR1A 1HPZB 1HBMA 1RWXB 4NYOA 1EP4A 2WRMA 4ZLJA 3CW2C 2V9WA 4NZ7A 4ZVSB 4OMFG 3UFCX 1MROA 3W64A 5B0AA 1CULB 3KK3B 4L73A 1PYOB 3M9NB 4K59A 2BOPA 1CLFA 2C3UA 1S6OA 1RTIB 1KTQA 3DRPB 1VCTA 4IFYB 4NCGA 3WIVA 1PG5B 3G2XA 2ERRA 4WPAA 3EX7B 3JTPA 4P7TA 2V4JB 2QMWA 2DNOA 2Z8QA 1TL5A 3H5YA 4UQTA 2KXHA 2HNZB 2P6TA 4N8NA 2OFGX 1X4AA 2BE2A 5DQHA 3BPSP 2W9CB 3M2RA 5KFRA 1CJVA 1Y5IB 3ZNUA 3GIJA 1EAYC 2EKNA 5IZHA 1JLGB 1WNEA 2QA4G 4GVBA 3HT3A 4G1IA 4GC6A 4LJMA 4ZPTR 3CD0A 4HEA9 3BKFA 3R1HA 3CJ0A 3TA0A 1XK8A 1VQ6S 4V1Ak 2HGNA 4FF1A 3D1QA 4DSIA 3ISZA 4DR2J 1I94J 2ZEJA 2L48A 2MLYA 2IHR1 4IFVB 4J7CA 5T14A 5ETVA 2PT0A 2WTFA 3MAQA 3VV2B 2Y9HA 1G1XA 2V94A 2AHOB 3BZQA 5KFGA 3SYZA 1BD6A 3M2VB 3BREA 3FUYA 3A3PB 2RJZA 1IUJA 3I5BA 3GLJA 2H48B 4W4MA 5FD1A 2J6SA 1DTQB 4JP8A 2DH8A 1VQLS 4K5RA 2W4PA 4ZK7M 3RRGA 2MQQA 5LMUF 2WOMB 3DDKA 3KWMA 3PYFA 3AA8A 3NS7B 3QIDA 5J1EA 5T7LB 3FBFA 3HM9A 2KU7A 3MECA 4RR5A 4M63A 3F73A 4PXBA 1XN9A 2F7VA 4CCHA 1KDNA 1ZM3A 3UD4P 1Q53A 2WSFC 5HMZA 3TX8A 2LEPA 4WFXA 1KVKA 1S5ZA 4JI2F 5E3AA 2J8AA 2FVRA 1B7YB 3TANA 5E3PA 4FS2A 4QU7A 3J81Y 1NH8A 1TKTA 4I2QA 2NUHA 2WVDA 2V69A 1KONA 2LVWA 3E51A 3NCPA 2MGZA 3HULA 3BO3A 4DJBA 1H7XA 2VBWA 1AFIA 1KVIA 2HAFA 3GE9A 1GXLA 3QJLA 4J9OA 1UVIA 4ZCLA 4NASA 5THWA 3KHHA 2CVIA 3VF0B 1OQ3A 3M6WA 4EK2A 3IO1A 1T05A 3QLHB 2UXDJ 5MAOA 4N56A 2XS7A 1KQKA 1RKIA 1JXLA 4O4RA 2CRLA 5IS2A 3G96A 2VV5A 3GWCA 3SMZA 1HKAA 3PDNA 1S6QA 4F4KA 2PEHA 2XZDB 3VCDA 4FP9A 3G82A 4F3QA 1HL6A 1VRUB 1LWEA 4OV1A 5KG0A 3VALA 4M5KA 1NPKA 1SV5B 3O3LA 5SUHA 3W9JA 4O3QA 1GXUA 2HG4A 1RTZA 2N4DA 2CADA 3T5KA 1EZZB 1Q4RA 2QIFA 1AA1B 1S9FA 3SSRA 4X84A 1UFWA 2ZH4A 3AA9A 3P49B 4CYUA 3R7NB 3L95X 2XB2D 4RW4B 3KLEB 4TXSA 2OPSA 3MR7A 3MM8A 2ZDOA 4KSEB 4WBFA 5C25A 1HMVA 2MY8A 4TQRA 2NZ4A 4U7UK 2R8HA 2AEJA 3P4UB 2C3PA 4TN2A 4BLGA 4IKAA 2PC6A 3M1VB 4QWCA 3HK2A 2AZ3A 4TY8B 2F4VF 1KNZA 5GADU 3MPDA 3C6UB 2B0GA 4KJIA 1VISA 1LW0A 1KR4A 4ELVA 4AYBD 2XHCA 4JI4J 3TZWA 1OWXA 3TA2A 1MMLA 1FESA 3MEDA 4I67A 3DU5A 2VBXA 3RR8A 2ZBQA 3CNQP 4GKJF 4XTTA 2W8LA 3S6EA 2Z2MA 2C2ZB 3KJVB 3CJTA 3DM2B 4KO0B 1N54B 2DXEA 1YGYA 3DNCA 4KGZB 2J8SA 4NLDA 4L75A 1TK8A 4C8NA 1ZA1B 3M6UA 3WHIA 1R7IA 4CM0A 4HHUA 4K50A 2JFDA 1IBKJ 1U1QA 1C1BA 2K2PA 3V4IA 3LGMA 1U47A 2EK1A 3FEXB 1NJYA 2RH3A 4AFFA 2IBKA 2VFUA 3US5A 3ZZZA 1GXTA 3G8SA 2Y1JA 4K4YA 4ED1A 3EVMA 1RHMB 2NR0A 2FHOB 3MM7A 4USHA 4F7VA 4BWJA 4ZITA 1NSPA 1SBRA 1X31C 3OW2R 2JOQA 1RISA 3D2WA 2QJ3A 3W7BA 3BR8A 5D0EA 2VQFJ 5EN1A 3NAHA 3IP0A 4HT7A 1TU0B 3PRVA 1V3ZA 1PIEA 3AB2B 5F9LA 3IGVA 5GADI 4XIUA 1UVNA 1JIHA 4YY3F 3V81A 1FD2A 4EMDA 4DR6F 4OHZA 2FJEB 3POTA 2HQIA 5K8NA 2YPZA 4MK8A 3THPA 3OR1A 2K06A 4URGA 3EUNA 5J2NB 3GCWP 3MPWA 1N52B 1Q95G 1SQGA 1RT7A 4ZVQB 5D4LA 4CLFA 1NZAA 2D3UA 2QSWA 1T0TV 3R5BA 3GJSB 2MQOA 4NCAA 4LR8A 1SKSA 1MN7A 4OHVA 5DS7A 3FDSA 3PTWA 2E7VA 1RTHA 1Z2LA 2DR8A 2POKA 4C3KA 1D9FA 3QYYA 1CS4A 2QMUB 2F63A 5DQIA 4LF4J 2B5JA 2DGOA 2J0SD 3R7BB 2B9YA 2CQGA 4NYPA 2WB1D 3MEGA 1NAQA 4LBHA 4OZ5A 2LQ5A 2LXUA 4ZS6A 2BW2A 1CJUA 3KK2A 2R7UA 4EU0A 3HHLD 3ZZYA 5EWFA 2FJWA 1I6JA 1QD1A 1QSLA 2BANA 2P9GA 4D3HA 2B4OA 5F8IA 4DR7J 1VJQA 1HBMB 5DQGA 1EP4B 2RAQA 2VPYB 3NKYA 1F5AA 1VBYA 2DRDA 2HURA 3AY0A 5KFJA 2J76E 2LU2A 1MROB 1RWWB 1IKVA 2F3JA 1K1SA 1KFSA 4YEAA 5F3ZA 3AQPA 1NK6A 4O3SA 3UCZP 1KC8T 2W9BA 1RT5A 1A6LA 1FJEB 1S6UA 5BR8J 4NCGB 5GMKa 1ZM2A 2N3OA 2G2ZA 3M8RA 1NDPA 4FN5A 4DQQA 1IBCB 5ETOA 1XMQJ 2FQQB 3HF5A 2X3DA 3CJKA 2KKHA 2BR0A 1IR2A 4UOHA 1RT3A 3M2RB 4LFCJ 1CJVB 4NMXA 1C1CA 2GA7A 3DDNA 4E98A 1TFWA 4MTPA 3OFEA 1FWLA 1UA0A 1DFDA 3ENVA 3HHLC 1H3DA 4R8UA 4ZCMA 2DITA 3EXYA 5AE1A 1S1XA 4GVBB 1Q7LB 4X64J 3FEYB 1WEYA 1KRPA 1HI8A 2EC2A 5A76A 1OIAA 2F5GA 3R9LA 4TNOA 2H5EA 4NE9C 3FMWA 3KG0A 1CSJA 3R5GA 4O0NA 4QOTA 4MYTA 3EYZA 5FLXU 2R7VA 1HWJA 2ATLA 3MMBB 1RQ0A 4NA1A 1FKOA 2XG8A 2ASYA 4TVAB 5LSLA 4OX6A 2MMYA 3CJ8A 4C97A 2Q66A 2QG9B 3FCHA 1KLMA 1RWNB 2GAGC 4WF9Q 1A7GE 3BN7A 2YQ3A 4S0MA 2BMBA 4OZ1A 3EPIA 2XTJP 2ZOMA 2OPPA 3MAHA 2ALYB 3SIPB 2QTWA 2E5GA 4EYHB 4LVOP 3HSDA 3MGJA 3H98A 2PMWA 2YX7A 2CPIA 1WKJA 5J1EB 4USMA 5LL6d 3FSXA 1HYSA 1ZTWA 3GFYA 4NYZA 2QYCA 4DCOB 5KFLA 2E5LF 3I4HX 2FY8A 1NB7A 1YBTA 4WZMA 3H25A 4YS2A 2DHSA 4K2XA 4RWWA 4ES3A 4MIBA 4EZ6A 1M5PC 2R2RA 1N36F 2OSQA 5KFNA 1TK0A 2HLTA 3PW4A 2HHQA 4CLWA 3ILLA 1TKTB 2BZ2A 4I2QB 1U1RA 4PXCA 3UE2A 3BBBA 2CG4A 8RUCA 3NEKA 1KS2A 3CO9A 4UZCA 4UF4A 2EFOA 1UCNA 3BQ2A 4ZCKA 1IKXA 2FB0A 3SZ2A 4J9PA 4J9LA 3D3BJ 5F8LA 2Z57B 2YWWA 4X66J 4DUZJ 3JYTA 3BPDA 1HNZF 4ECXA 4HHHA 1SCJB 3T41A 2F40A 4PEOA 2AYEA 1T05B 1HFEL 3DRYA 3CIZA 1WORA 2J0QD 3GIKA 2UUTA 3I82A 1TELA 3ELHA 2UUCF 3Q8QB 2ZJPQ 2DXFA 2AT1B 3GZ7A 3ZTSA 3FZ2A 2NXNA 1S6QB 1S97A 3NNAA 4NA2A 2NYHA 3G82B 4Q8FA 5ETKA 2D3O1 5DLGA 3KG1A 4OYOA 2BQRA 2XSFA 3R6GB 5KOWA 1ELOA 5KT5A 1R8AA 4MKAA 5KT3A 2EI5A 3DN9A 4LBPA 5HQLA 4QR1A 2FYXA 2YNHA 3PW5A 4UT4A 2DH9A 1U1MA 3M4XA 2MB0B 4WU2A 1JLAA 3GR1A 4QWEA 5L1JA 4OYBA 3M8SA 5JVGQ 2W8KA 4CYUB 3Q22A 4XO0A 2R7TA 2NXCA 4CT8A 2JEJA 1G2EA 5E3CA 5CZVA 2HPUA 2OPSB 4ID8A 1RLCL 3MM8B 1NK0A 4U8YA 3OR2A 2I9SA 5AXNA 1Y10A 3GV8B 5C25B 6FD1A 1S0VA 3RRHA 3L4BC 3DLKA 1LQ9A 2RU3A 1B0PA 1QUPA 1WELA 2UXBJ 1ZM4A 1X5TA 1RAHB 2YY3A 1R0CB 1WC1A 2ZH9A 4DF8A 2VF3A 3CJRA 2HBQB 3AOBA 4LSLA 2AW0A 3SSQA 2F65A 2OD4A 1LW0B 3Q8YA 4ID5A 4P2FA 4B17A 4DR1F 1GMWD 3C2PA 1EHWA 3MEDB 1LNQA 4KC5A 5DZ7A 4OJHA 3CDUA 3QBCA 4QQBA 2W24A 3W3SA 3NLCA 2DHXA 3MXHP 3AD9C 2BRKA 3SEOA 1FDNA 1T9UA 3RBDA 3GV7B 3N6NA 3V6DA 1UA1A 3CJ3A 5L1IA 3U1MA 2B8QA 3OTOF 1XMOF 3FJ2A 1ZAVA 4PG5A 2KJWA 5A8KB 1NXIA 1WUUA 3T6JA 4LF6J 4B3MJ 1C1BB 2X51A 3V4IB 4PQUA 3NOGA 5C24A 2FJVA 4DR5J 1FE0A 3VVUA 4KHRA 1QTMA 2B9XA 4C3LA 4O3OA 3AQOA 2ZH6A 5ETNA 3GFZA 2GIFA 4UY8T 5DO2A 2DD8S 1OPIA 2D9OA 4DSJA 2KZZA 3BH7B 5I42A 4AL7A 3MM7B 3HZGA 1SKRA 4J9MA 4NXNJ 5HBMA 2QRRA 4EO8A 4EI2A 3I5AA 1X4BA 3DGPA 1KQGB 3QZ8A 3UD3P 2ZH5A 3FFIA 2IPOB 3ONQA 1IR0A 1OPZA 1UWBA 3T1AA 1LK7A 4CO3A 3V81B 3PRDA 4PG8A 2HWIA 4DL7A 2YH1A 4ZN1A 3POTB 4ED7A 1NRKA 2XQCA 3OR1B 1FD8A 4DPUA 4LRFA 3KK1B 2N4CA 2XCAA 2J9EA 2BJ8A 2XI2A 1SJ4P 1RT7B 1JX4A 3MCNA 4DR2F 1I94F 4ZVGA 1BC6A 5KAKA 4EO6A 4DV0F 1RTJA 3LTOA 3G6XA 4X4VA 2HVHA 5CCMA 4NA3A 2ZZNA 2QLXA 1F5BA 1RACB 3FBBA 1FJGJ 4I7FA 1RTHB 2RQKA 4ERDA 4UY85 1T9WA 3SDEA 2DEJA 1U1OA 1CS4B 1YK9A 3DLGA 2C2RA 1VDHA 2B5JB 1RK8A 1VBXA 3LAKA 2DRBA 3MEGB 3HFVA 5KFOA 3RRKA 5L9XA 2CZ9A 1CJUB 3KK2B 5I4MA 5D0GA 1GH8A 4NWBA 4Z7YA 3CCSS 2BANB 3TUJC 1Q8BA 1V9OA 4V19J 1SC1B 3LGHA 3M7VA 3PFEA 1PC5A 3HJVA 1IBMJ 1EKRA 5ADZA 4Q5VA 1IKVB 1S1TB 4RNMA 1Q8LA 5K14A 3G87A 3KLVA 3N6MA 3OT9A 2W9BB 1H7WA 3G86A 1HHTP 4FYDA 1YDLA 1RT5B 3T1YJ 2UXCJ 1TTHB 1NK5A 5LMNJ 2UU9J 4Y00A 4FYWB 4M5IA 3CJKB 5KFZA 4ZP8A 4OZ0A 4QW8A 3RB3A 2VU5A 1SJ1A 2UP1A 1U48A 1RT3B 2X3GA 3MEKA 1C1CB 4ZVTB 2ROPA 2HS3A 4R8UB 3W2WB 3GQCA 3MPVA 1S1XB 1VI7A 1V3SA 3TRGA 4OYMA 1F9HA 4CLLA 1TFYA 3HMJG 4DR3F 5K8OA 4MMOA 3RYLA 1L3KA 4J9RA 4Y2MA 1RUSA 2EG2A 1Y9OA 4H54A 2YNIA 1FKOB 2KTQA 4AE5A 1RWUA 1L3SA 4ICLA 5KFYA 5L1KA 2RUSA 5HJXA 3M30A 4PWWA 1RU1A 1KLMB 3SQGA 1T03A 1XJWB 1WOPA 4B9NA 1Z1ZA 3W8PA 5LOQA 2U1AA 1M5KC 2JLEA 1X9SA 2YH0A 4ZIVA 2VA3A 2AQ4A 4K5SA 1UVKA 1NPPA 3GJQB 1S7IA 4EWTA 2M0GB 3QT6A 3IR5B 4OZNA 4YQWA 1OS5A 1J5EJ 4I6YA 3O6QA 2O1PA 2GNKA 2NZCA 1FFGB 2CXEA 4KRWA 5IT9Y 4C9DA 1XR6A 1S59A 2AZ1A 3JQJA 1OSDA 1YJ7A 1XR7A 3LWMA 5I3PA 3AHPA 1RU2A 4PZVA 3QWPA 5C2GA 3TQEA 4IH6A 2WZ1A 4G65A 4EBEA 4K8RA 1AXQA 1VLOA 2EG1A 2GJFA 5KG4A 1WKLA 2AJ4A 5H9EJ 1CC8A 5L46A 2DGQA 4JI4F 2CDRB 2V5HG 2YKMA 3D7SB 1URRA 2CQBA 5KTQA 3LPYA 5FIIA 4N5SA 3CJ4A 2VJUA 1KP6A 3MPUB 2ZBIA 5KG7A 3CIMA 1U0SA 3ZZOA 3TZZA 3QAEA 2KG1A 1SQEA 4OYXA 1W2BR 1IKXB 4ZDNA 4J90A 3MUVP 1X4GA 1HW9A 2F9JA 1OO0B 2MTLA 4U7CA 5H9EK 2ZOGA 5J1PA 4FKXA 1IJFB 3JYTB 2RHQB 3UQSA 3B78A 1Q1KA 5EDWA 1T11A 1IBKF 5AJ3F 4M5LA 2UV8A 2BABA 4OFZA 3C3LA 3D54A 3CMAS 4P9SA 1BWVA 4ZPAA 2WCXA 3KLFA 2HLUA 3RW6A 1FNMA 4XPCA 1NDCA 2R8IA 2L9WA 3WX8A 8AT1B 3KJQB 1V5IB 1MNEA 4C0HA 1R8CA 2E1AA 3H2UB 2HSEB 3J7YI 1O0PA 4WU3A 2VZ9A 1CVJA 3PX6A 2OAUA 5GVQA 3T9NA 2EFPA 3RBXA 2DHGA 3JSMA 3QWUA 3HHEA 2YNHB 2VQFF 1I1GA 3LO3A 2DIVA 1JLAB 4RUBA 2ILZA 4DZ6A 4U9RA 2FVQA 2AP6A 3A8EA 5IQ6A 4A8FA 4DPOA 2UUBJ 3K0JA 2CYYA 4ALZA 3Q89A 3OR2B 1KBRA 2HNYA 3Q83A 3I56S 1SJRA 3DLKB 4OYPA 4Y28C 3Q86A 2ZWOA 4DSEA 2MLXA 5J1NA 1UVMA 1TVRA 1JNRB 2VONA 2ZZMA 2AGPA 4M1KA 1BQMA 3D6HB 2ZHBA 4CO1A 1L3UA 3PJ9A 5JXSA 3UDEA 3LF0A 5CH7B 3H90A 4ID5B 1OSCA 5CD4H 3D66A 3UD5A 2MHEA 1U1PA 3IMQJ 4I69A 1JXVA 1VOMA 4AL6A 2XWXA 4DU7A 3D4JA 2A6MA 4JI2J 2DNQA 2YKPA 3GIMA 4HI2A 1W26A 3GSIA 1UETA 1R27B 3IS9A 4F25A 4F4ZA 4X4NA 1RHKB 4QIVA 3V6DB 2VPZB 3EZOA 4U8VA 1NUEA 1DTTB 1UJ5A 2Q1LA 2ZOFA 3BO2A 4RPFA 1SL0A 4PQUB 1U2CA 5C24B 4IDKA 3HJFA 4DR7F 3QGGA 3UVJA 1D9AA 2Q6CA 1HQ2A 2GX8A 2QX0A 1U1KA 4OZJA 1DJ0A 1HLWA 3OBIA 5A6PA 3Q8VA 1TKXA 1N32F 4M5GA 4OHWA 1SJQA 2XMVA 2J0XA 1TL1A 1UFKA 5I42B 2C42A 3IWXA 2GV1A 4OLOA 5HBMB 2JEIA 2XI3A 4K4UA 4N8OA 1RE1B 2FZKB 3OSPA 3ETMA 1Q16B 2WVFA 4UOGA 1XMQF 3DGPB 1GAOA 3RGIA 2J5AA 3EVWA 4RU2A 3FFIB 1FKPA 2YX1A 2ZHAA 2OTJS 4JI5J 2RIJA 2V2QA 1PYTA 4HI1A 3K5NA 1DBDA 3L7PA 4ZLNA 2VIHA 4DN0A 4DX8H 2FHKA 2Q43A 2HGLA 2V63A 3KFWX 2FIUA 4X64F 3IBFB 1Q5VA 2HBZB 1KQFB 3R27A 4K0KJ 2QA1A 1XEZA 3LANA 3P45B 4IQMA 3MM5A 2BXJA 1Q0NA 2BBEA 2EFNA 1NK8A 4DFKA 3NGKA 4AL5A 1RTJB 2AYMA 4C11A 4RX6A 4YOEA 1GX5A 1S0MA 3VAFA 4AXIA 4KE5A 2VFSA 4IO1A 2Y8WA 3OFFA 3CCMS 2KXNB 1RHQB 2B4PA 4WFZA 1EETA 3I4PA 4I7FB 3HD2A 4A8WA 1VR6A 3SDEB 3BM7A 4UQGA 5KFAA 1NJZA 3EJMA 4NLVA 3DLGB 2YVSA 1HD1A 1ACMB 4NXMJ 4ED2A 2UVRA 2Z0GA 5B0GA 3FGVA 3T19A 3CWJA 4ZPDA 3P5BP 2IRUA 3PZPA 4CT9A 2UVVA 3H40A 2MKKA 2DB1A 2HZAA 4EBCA 4XPEA 1UMJA 3P8BB 4ECYA 4WTOB 3K2YA 2V4RA 4ETXA 2DY1A 3T5JA 2MYFA 1VQMS 4RLEA 3UI3A 5B0DA 4JI6F 1FRMA 2KRBA 5CYQA 1YHQS 5F8GA 4ZPVR 5K14B 1IM4A 3OXGA 2MLZA 4RNFA 3IRXA 4Y0FA 2EFGA 3W61A 3PCOB 3MZIA 2WSEC 4TYBA 1NJWA 2R42A 3KLGA 1APSA 1PAEX 2OEMA 3BQ1A 1O8BA 5G4DA 1NO8A 3LOUA 2M52A 2WBRA 2R2TA 2LKZA 1JNZB 4X66F 4DUZF 2F8MA 3MOJB 2IYGA 1QE1A 1NEEA 2HMIA 4FYVB 5A0YA 1T8EA 2KH9A 2RF2A 3T1HF 3NRBA 3T9ZA 2JZ5A 2LDIA 3CULA 2AX1A 4YY3J 3UN5A 1UP1A 4MT1A 4ZKAA 3MWBA 2MHNA 1A9NB 2C3MA 5LXRA 1UTAA 2MQPA 2JDJA 3HFZB 1ZOTA 1CQMA 1D09B 4MK9A 2KYZA 4DUTA 3IG1A 3NBPB 4DV1J 2WVCA 4ICLB 1U02A 1X8DA 4ILRA 1X0PA 2OJ3A 3UO0A 2MQNA 2RB7A 2I2YA 3M30B 3SQGB 4PPDA 2M9KA 2K3KA 4DL5A 1T03B 3K58A 4EZ9A 3PJWA 1P1LA 4C8MA 4C7QA 3OL9A 3TUIC 2J9DE 4A47A 2KFZA 5KFDA 3C46A 2PI4A 3ILOA 1H0HB 2YBVA 3PACA 1JLEA 3ILJA 2X1AA 1IXKA 5AT1B 4KH0B 4R0EA 3J81j 2B56A 4FXVA 3BKTA 3A8IA 2DNZA 1HNWJ 4LQ3A 2DPJA 2DNNA 2RRAA 1BGXT 2DNMA 1QY7A 3OFHA 2SXLA 2DR7A 1D0EA 1GNKA 2UXBF 1FHTA 3O2IA 1U8WA 4K4ZA 1OY9A 3OJUA 4DV2F 4B9MA 3OVAA 3G8QA 3O8WA 1ICEB 2P5VA 5AE3A 3DCAA 5ETRA 4OJ1A 3OTBA 4ER8A 2FHJA 3OD2A 5HATA 3M32A 3UDVA 3QO9B 2VHGA 4B9VA 5DDOC 2IC3A 4U95A 4F2SA 2CQ1A 4ZVFA 2YKMB 3LA0A 1S6PA 4AXJA 2IVYA 2FVSA 1DAXA 4F3MA 2RNEA 1JB0C 4ECWA 3PW7A 3W1YC 4RW9A 1QSYA 2RRBA 4OHYA 4QPTA 2PEBA 2HS0A 5JJBA 4IOBA 1FX4A 4LSZB 4O3NA 2XY5A 5ITHA 5HP1A 1U25A 3HP6A 1X0FA 2JHEA 4LF6F 2BEFA 3DXBA 1SC6A 4YR0A 1VBKA 2CQ0A 3ZO7A 1KLNA 2CQDA 2VA2A 4N7TA 5HMWA 4P10A 3KYLA 1FVQA 3W8GA 3KLFB 1HHQA 3DFEA 2VG5A 2G9OA 3NNCA 1HI1A 1C0UA 3HVAA 3CO0P 3HI9A 3CGIA 2C2OB 5F8JA 1WF0A 4F2RA 4ENOA 2R7RA 2ZJQQ 3H5XA 1WHWA 3AXMA 3KLHA 3VGTA 1D8YA 1SJFA 4B9LA 3E3XA 2HHTA 2AF6A 5EGYA 3IC1A 3JSMB 4Q44A 1PKUA 2B9EA 4OV6A 1EX8A 3RAXA 2K8GA 3OV7A 4PWDA 4ZVRB 2HHXA 3P3DA 3I9V9 1RXOB 4ZP9A 2KRRA 2E1PA 1SIWB 1S57A 4Z37A 1F0XA 3BDEA 5ETQA 4RW7A 4X62F 1T3NA 4KBIA 2C3YA 3BSCA 2HNYB 1R8PA 2A18A 2RQCA 1LV5A 4Y2IA 4J9UE 1QJHA 4KFBA 4CZCA 1V5VA 4K4XA 1N5TA 4DSKA 1TVRB 3M9MB 3M2UA 4YN3B 1SB6A 2P9CA 2GQ2A 4WP8A 3RAMA 3KUHA 2QL5B 2HK3A 5KFSA 3CVKA 5J2PA 1YG0A 4CH1A 4B08A 4JI1F 1REGX 1BQXA 3Q23A 5KFQA 1FJGF 1B0TA 1T9YA 3D3CJ 2ZH2A 3F56A 2G1DA 4C0BA 3FRYA 3HSZA 4RNNA 2X7IA 1S76D 4QR2A 2EEYA 4Z7CA 4DPTA 3MD1A 1AYEA 3QATA 2AEMA 2XY6A 3GIIA 4JV5J 4JI7F 3CJQA 4KPCA 5IT0A 2RSQA 4X4PA 1MMNA 2JVRA 4LF9F 1L3VA 4W98A 1DHMA 1QAXA 4QR0A 4IDKB 1GEHA 4KGXB 4OZ2A 4JV2A 1F3VA 4BC7A 3UVJB 1XMBA 3DKDA 2X1BA 2HFOA 2E66A 2K3IA 1IBMF 2DHAA 5F0UA 1F9EB 2HIQA 1JKHA 1RBOB 5CQGA 4FS1A 1TL1B 5CXTA 3CCUS 3RTVA 3BDPA 1FRHA 3T5LA 3I96A 1R89A 4RNHA 3MFIA 1Y5LB 4M95A 4U67Q 1CPZA 2VBYA 1IVZA 1P27B 2I8EA 3DI6A 1FKPB 5K8MA 3W63A 4HH1A 2D3ZA 4FF2A 5JMNA 1IKWA 4LF2A 2CQ3A 3IM8A 5I3UA 2AX0A 3CD5A 1U24A 2C1EB 5U47A 2DPIA 4XAKA 2G0IA 2FJBB 2RRNA 3HO1A 3N0VA 3J7AN 3IA0A 3NGTA 3PG9A 2XZWA 1M90T 3RB6A 1VQYA 4LFBJ 5HLFA 3ISNC 2DNHA 3LP2A 4NPOA 4P72A 3MM5B 3R2DJ 3MR2A 3QMQA 2RQMA 5IOLA 3DC2A 4Q45A 4DQSA 4ZVEA 4K4TA 4KIAA 2OD6A 3QRRA 3PVXA 1FWPA 2ABYA 2H5JB 4C11B 3OLAA 2F8EX 2A6OA 3DRRA 2GHVC 1YJ9S 4DCJB 1I3OB 2R8KA 2OH2A 1EETB 5LXYA 2QZ8A 2AJ1A 2ZH1A 1FX2A 1QVGR 2NPFA 1WSVA 3PJXA 3Q8UA 4A48A 5F8MA 3CCQS 2QV6A 2LYVA 3B8HA 3VAGA 2IDLA 2UVWA 2IBOA 4B02A 1FXLA 4C8KA 2HHHJ 7FD1A 4FVCA 1V3RA 4MKBA 2E9TA 1NU4A 4F50A 1REVA 1EB0A 4X4RA 2Z30B 2EPIA 3EGZA 3M8ZA 4ANEA 3THTA 4K4SA 2R8GA 2W2OP 1XNQF 2OP5A 2L3MA 1X4EA 3AFGA 4YB1P 2Z4PA 2KM8B 2JH3A 5CYQB 4RNOA 1HBNB 3P96A 1B99A 1AW0A 1EARA 4OX9J 1YI2S 1TUVA 3IRXB 3OUYA 4FKYA 1UAWA 2UUAJ 1SIZA 2C2MB 4WXWA 1GMVA 2RT3A 1LW2A 3LQVA 1IJEB 4DV3J 5GAGI 3EM1A 1JMTA 4QW9A 3KLGB 1TQLA 3L09A 2E5IA 5IWAJ 4MIWA 2NXUA 4JI8F 1Q8KA 2HYIB 2F4FA 1N5QA 3CSKA 3D0IE 3NS5A 3CUNA 2IRYA 4YFUA 3KHRA 3JSBA 3U1NA 4DV7F 1YTYA 1VC5A 2HMIB 2JFKA 4PCQA 5A0YB 3QT7A 4C0OC 1R3NA 2RF2B 2LECA 1YJTA 3AJ1A 2HKEA 2ZDPA 2W4CA 5K20B 1FDAA 3D0GE 2AIRB 1N0VC 3AXKA 1JLCB 1J27A 5M2RA 2ZNYA 2MZJA 4DPXA 1ITPA 3IAS9 4ILMA 3UWTA 4ANCA 3IG1B 2JLFA 4NOHA 1IWAA 3FBEA 2IA0A 2YNGB 4AQYJ 2XM3A 1XR5A 2NS1B 3AAWB 3AODA 5DDQC 3AD7C 3MDFA 2QA2A 5HL7Q 3LP1A 2GAHC 3UW1A 4DV0J 2V8GA 2V50A 4Y2KA 4USIA 1N88A 2UUBF 4USKA 5FDLA 3AJ2A 3MFHA 2DO4A 3J81U 1TL3A 2CZVC 2AEFA 3K5OA 1RCXB 2HWTA 3J80Y 1HARA 1BUXA 1FVSA 1W7WA 4DQRA 4DPYA 2HHVA 1LOUA 2FVCA 3C6TA 3ZTOA 5C2CA 2FGOA 1IKYA 1G7CB 3VR1A 1WHVA 3JXOA 1WOOA 1U2RA 3MTKA 3O44A 3N5BA 2P8IA 3M32B 4PYDA 4ZVUB 2DHHA 1Q86T 2IC3B 1RWOB 5DRKA 2XYGB 1M5OC 5DGAA 5J2QA 3CCES 3NNHA 5F41A 1PBAA 1S6PB 4QCLA 4HL9A 2JLGA 3DXSX 1X60A 2OPRA 2BDPA 4C8LA 2B7BB 1XC9A 4RW9B 1N34J 1VHFA 1N5YA 3JQKA 2V4QA 5M2PA 2CFXA 1KOOA 1VLYA 1FRXA 3K89A 3QFHA 4DDFA 4F0HA 2IA6A 3LGNA 1M1HA 1JXEA 3PV8A 1EIYB 1JJ2R 3SBMA 2RMLA 3HDSA 4HKQA 5HP1B 2MKHA 5ETLA 3BYRA 3MUMP 1UFLA 1YZ7A 4LFAJ 1SH2A 4FBTA 2KT5A 3TUZC 3SXLA 4ED8A 1X5SA 1PJ7A 3O1LA 3EMTA 3EZUA 5E5NA 4MYUA 4FYXB 2ZBCA 5GAEU 2VG5B 4I4BA 5AXMA 5A2QY 1C0UB 3PXGa 4YUDA 1KOHA 4Y2CA 1R0BG 2NUUG 2RS2A 1MU2A 2A2DA 1JJHA 4HDGA 1AZSA 1Q5YA 1VC6A 2OGUA 1C4AA 4B9SA 4FXWA 3LP0A 5HMYA 3CPWR 5D4NA 2C3OA 3MEEA 3KLHB 2M70A 2WHOA 1E6YA 3RB4A 1TAQA 1T3OA 4KAIA 1EQ0A 4DR3J 4WTYA 4N77A 3IR6B 2DGTA 2YKOA 4J91A 1Y4ZB 1VQ8S 2U2FA 4ED5A 3BS9A 1MG7A 5C42A 4PWDB 2V9KA 2Z2LA 2XS5A 4JI5F 2OELA 3N4WA 5D6GA 5B0BA 2ZBPA 4GKKJ 3UN3A 4CLSA 4LVNP 1UJ4A 4DR4F 4XDCA 2DNYA 4DV5J 2VODA 3W62A 2YKNA 5KFEA 3OSNA 3CCZA 1WTFA 1X4FA 1FI4A 1YZ6A 1S4EA 5ETTA 4PXEA 4K0KF 2J0WA 4OIXA 2CVEA 1K8AT 2ZM6J 3M2UB 2KZMA 1YWXA 3VGUA 3ADAC 2FJDB 3NGUA 2D1CA 5J2PB 4EGLA 4LR7A 1S4FA 3LAMA 2VBZA 5DDPC 3OPKA 1OY6A 4DF4A 2FUG9 1S9GA 5B09A 5KG1A 2D69A 3ZTPA 4MH8A 4KH1B 3HVTA 5H9FJ 2MEWA 4TU8A 3D68A 3I5CA 4K4WA 4RBTA 2PN6A 4NXMF 4L6V3 1CULA 4E2FB 2B6AA 4MIAA 3K59A 1RTIA 2QEXS 1FA0A 2ADBA 4OZ3A 3OHBA 1NNDA 4KY3A 1VC0A 1RT4A 4O4GA 4IFYA 2LCWA 5D8HB 2ATCB 2JRSA 4RW8A 5H9FK 3RZAA 3EE3A 4CP5A 4F04B 4RU9A 1IM6A 2ZH8A 2BJDA 1S1UA 1SC4B 4DSFA 4P52A 5AJ3J 5HANA 3X1LB 1JKHB 2WK4A 5A8RA 4L3KA 1F60B 3GB0A 2WONA 3HFKA 3VGSA 3HT0A 2XLKA 1VQNS 1VQ5S 5IFMA 1RT2A 4DL2A 3TNVA 1DURA 4O3PA 3V4MA 3H7HB 4LQ9A 4OI1A 1IKWB 1F2HA 4IFVA 2E44A 3CB4A 1FRLA 5I3UB 4WIQA 1YJWS 5K5MA 2CZ4A 4EBDA 4UZBA 1U8SA 2HVIA 1O51A 2BV3A 4A8MP 2HHPA 2MZTA 2HEKA 2DXDA 4C3MA 5RUBA 2AJ2A 3DOLA 2V0NA 1CBKA 1BY9A 2VC1A 3PW2A 2ALZA 1ULRA 1WJ9A 2Z58B 3VAIA 2UUWA 1X4HA 2KT2A 5HLFB 4WXOA 3LP2B 2KVIA 4D3GA 2PFDA 1TKDA 1BLUA 4ED4A 4DX5A 2RHSB 1ZZNA 1OYEA 1WKKA 4QIEA 4DZDA 3MAAA 1WHXA 4NLSA 3GFXA 4A8QA 3DRRB 4AD6A 4Y3CA 4DV1F 3M8YA 2XEXA 2XGQA 5LT5A 1MWQA 1B64A 3MMJA 5KT6A 4YB6A 3MMAA 2PA3A 5BXIA 1LFWA 3J7A1 1K0TA 2B4UA 1T9XA 2ZZTA 2C2KB 2FVPA 2IVFB 1TAUA 2XSJB 1H2VZ 3CC4S 3DLLQ 2CJXB 2P2CB 1HNWF 5BJRA 3SI8A 2LU1A 5BYRA 2OEKA 2EFQA 1NSAA 1REVB 2FLOA 3T5HA 2OIHA 2ZKUA 4JI3F 2VPXB 5HQMA 4NZ6A 2HZVA 1Q7YT 3U1LA 4IH7A 4IH5A 4JI0J 5KFHA 4IRDA 4N41A 2HS4A 1HWUA 2IMOA 2DO0A 3K5MA 2JWNA 2HQ3A 4A8OA 3QQCD 2YX4A 5KFIA 1LW2B 4X4SA 2W7AA 4ZVHA 2O67A 1L3TA 1N32J 2Z2ZA 1YLXA 2KG0A 3H2VE 1HBOA 2CIMA 2XO6A 3D0HE 1BE4A 2CPHA 3TVYA
chains in the Genus database with same CATH topology
1XQIA 2VU5A 3BBFA 3Q83A 2AZ3A 3BH6B 2B8PA 2BX6A 2NCKL 1KDNA 3FCVA 1MN9A 4ENOA 3B6BA 3EM1A 3VVTA 4DI6A 2DYAA 3Q86A 3GPAA 3EVOA 3EVMA 2DXDA 3MPDA 3NGRA 1NDKA 1F3FA 1S59A 2AZ1A 3BBBA 3VGTA 4S0MA 1MN7A 1LWXA 1S5ZA 1UCNA 4DUTA 1NDPA 1HLWA 4UOFA 2DY9A 3Q8UA 1NSPA 1NDCA 2B8QA 1PKUA 3Q8VA 3JS9A 1VYAA 3EE3A 3B54A 3WX8A 4CP5A 1NPKA 1NSKL 3EICA 3PJ9A 3ZTQA 3FKBA 1BUXA 1NCLA 1W7WA 3FCWA 4UOHA 3BBCA 4F36A 3EMTA 1WKJA 3PRVA 3DDIA 1LEOA 1WKKA 4KPCA 1S57A 2DXEA 2ZUAA 3VGUA 1F6TA 1WKLA 3VGVA 2CWKA 1JXVA 1PAEX 3ZTOA 1NSQA 3VVUA 2HVDA 1NDLA 4F4AA 1NHKL 3EJMA 3FBCA 3ETMA 3G2XA 3NGUA 3NGTA 4UOGA 1B4SA 4W98A 1XIQA 5CAAA 3ELHA 3EVWA 3FC9A 2HVEA 1HIYA 3ENAA 5C7PA 4ANEA 3L7UA 2DXFA 3VGSA 3ZTSA 3ZTRA 2BEFA 3R9LA 4WBFA 1K44A 3DKDA 5BXIA 3ZTPA 1NB2A 3BH7B 3Q8YA 4DZ6A 5IOLA 1BHNA 4O0NA 4EK2A 4ANCA 1HHQA 1B99A 3FBBA 1ZS6A 1NLKL 1U8WA 3FBFA 5CABA 1EHWA 3NGSA 4ANDA 4C6AA 3FBEA 4HR2A 2HURA 1NUEA 1BE4A 3Q89A 4FKYA 3GP9A 4FKXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XQI A;  2VU5 A;  3BBF A;  3Q83 A;  2AZ3 A;  3BH6 B;  2B8P A;  2BX6 A;  2NCK L;  1KDN A;  3FCV A;  1MN9 A;  4ENO A;  3B6B A;  3EM1 A;  3VVT A;  4DI6 A;  2DYA A;  3Q86 A;  3GPA A;  3EVO A;  3EVM A;  2DXD A;  3MPD A;  3NGR A;  1NDK A;  1F3F A;  1S59 A;  2AZ1 A;  3BBB A;  3VGT A;  4S0M A;  1MN7 A;  1LWX A;  1S5Z A;  1UCN A;  4DUT A;  1NDP A;  1HLW A;  4UOF A;  2DY9 A;  3Q8U A;  1NSP A;  1NDC A;  2B8Q A;  1PKU A;  3Q8V A;  3JS9 A;  1VYA A;  3EE3 A;  3B54 A;  3WX8 A;  4CP5 A;  1NPK A;  1NSK L;  3EIC A;  3PJ9 A;  3ZTQ A;  3FKB A;  1BUX A;  1NCL A;  1W7W A;  3FCW A;  4UOH A;  3BBC A;  4F36 A;  3EMT A;  1WKJ A;  3PRV A;  3DDI A;  1LEO A;  1WKK A;  4KPC A;  1S57 A;  2DXE A;  2ZUA A;  3VGU A;  1F6T A;  1WKL A;  3VGV A;  2CWK A;  1JXV A;  1PAE X;  3ZTO A;  1NSQ A;  3VVU A;  2HVD A;  1NDL A;  4F4A A;  1NHK L;  3EJM A;  3FBC A;  3ETM A;  3G2X A;  3NGU A;  3NGT A;  4UOG A;  1B4S A;  4W98 A;  1XIQ A;  5CAA A;  3ELH A;  3EVW A;  3FC9 A;  2HVE A;  1HIY A;  3ENA A;  5C7P A;  4ANE A;  3L7U A;  2DXF A;  3VGS A;  3ZTS A;  3ZTR A;  2BEF A;  3R9L A;  4WBF A;  1K44 A;  3DKD A;  5BXI A;  3ZTP A;  1NB2 A;  3BH7 B;  3Q8Y A;  4DZ6 A;  5IOL A;  1BHN A;  4O0N A;  4EK2 A;  4ANC A;  1HHQ A;  1B99 A;  3FBB A;  1ZS6 A;  1NLK L;  1U8W A;  3FBF A;  5CAB A;  1EHW A;  3NGS A;  4AND A;  4C6A A;  3FBE A;  4HR2 A;  2HUR A;  1NUE A;  1BE4 A;  3Q89 A;  4FKY A;  3GP9 A;  4FKX A; 
#chains in the Genus database with same CATH topology
 2PSZ A;  1H74 A;  3OTD A;  1IBL F;  2BE2 B;  3V6J A;  4HDH A;  4OZL A;  2OLW A;  2IIH A;  2NPI A;  3PX4 A;  2MQL A;  3RJM B;  2W9A A;  1U1N A;  4DBQ A;  3RG6 A;  4EEY A;  2D9P A;  4RW4 A;  1ROF A;  2IJR A;  4IOC Q;  3ZZT A;  3TAP A;  5B08 A;  1ZA2 B;  1ARO P;  3BBC A;  2OFH X;  4QWB A;  4HLB A;  4LF1 A;  4UUX A;  2XNR A;  2O5D A;  4P2M A;  4CLZ A;  3UPF A;  2HVD A;  5JVH Q;  4U7U D;  3W9I A;  1FJ7 A;  4WYL A;  2Z56 B;  3A8K A;  3PIO Q;  2M2B A;  1HIY A;  5AXK A;  3LP1 B;  3TAM A;  5F9N A;  4TU9 A;  2MSS A;  4GVL A;  1FNO A;  2D41 A;  2WAQ D;  2YWG A;  2PO4 A;  2YQ0 A;  1BHN A;  5FDL B;  1V6H A;  1GFW B;  1D3W A;  2AGO A;  1VFJ A;  1TL3 B;  3L3C A;  3AD8 C;  2GVZ A;  2E29 A;  2GCF A;  2HIY A;  1M1K T;  6AT1 B;  3FQK A;  1K0V A;  3DHX A;  3C6T B;  4QWA A;  1VGY A;  1MW7 A;  2G0C A;  2V68 A;  3LW5 C;  2UZA A;  3R1L A;  5KG2 A;  2CPD A;  1QAJ A;  5CYM A;  2HAI A;  5ETP A;  2C2N A;  2CJB A;  3MEC B;  2GVD A;  1U6F A;  4TQS A;  2AD9 A;  3HHN B;  3GG0 A;  4GMK A;  4DN9 A;  3MCM A;  2CNL B;  4USJ C;  3W60 A;  2GFF A;  4DQI A;  2QL9 B;  1VIX A;  1B7F A;  1S7H A;  5J2Q B;  3G6E S;  4OL8 A;  5CA5 A;  2HFS A;  5DDR C;  4LRE A;  1WC5 A;  4FYY B;  1FJC A;  2OPR B;  1H2T Z;  4JI6 J;  4CLT A;  4QIF A;  2H65 B;  1KD1 T;  4ZLL A;  3DHW C;  3GYG A;  3LWL A;  4OQJ A;  1FEH A;  1BQN A;  4JV5 F;  1RCO B;  2OKQ A;  3H20 A;  4C98 A;  1NZ8 A;  1RAD B;  2IDE A;  5LSO A;  2MGZ B;  3GP9 A;  4TKT A;  4AUK A;  2J6T A;  1Y0H A;  1P1T A;  4DV4 J;  2QT7 A;  3HZE A;  2DTJ A;  3RR7 A;  1VK3 A;  4TU7 A;  4B3S J;  3WBZ A;  2M7S A;  2VDH A;  1MU2 B;  2IFX A;  4ECU A;  1AZS B;  2W2Q P;  3T1H J;  4F4X A;  2ZC4 A;  1TR0 A;  3LP0 B;  4ZCI A;  3MEE B;  3GON A;  4X65 J;  2HHS A;  3QT8 A;  3TI0 A;  3I55 S;  3EDR B;  3OHA A;  1E6Y B;  3U27 A;  2ZH3 A;  1NKC A;  1LEO A;  2YTC A;  5J2N A;  3MI7 X;  4F67 A;  1M5H A;  1LWE B;  1DLO A;  2CPJ A;  5C42 B;  2MZQ A;  2FTR A;  2Q79 A;  3OQ2 A;  4DL4 A;  4FDF A;  1RAE B;  2KFY A;  2BOA A;  3FZB A;  2DGS A;  3RBZ A;  2VD3 A;  3MD3 A;  3KDO A;  1RT6 A;  4NLR A;  1ZS6 A;  4OHX A;  2XMM A;  3NG8 A;  2YKN B;  1PYS B;  2ZIT A;  5L38 A;  5KOX A;  3IBC B;  4NLP A;  2NLW A;  4O44 A;  2N7C A;  2QLF B;  3RUB L;  3FNN A;  2KO1 A;  4LFB F;  4A4J A;  2X1G A;  3G6Y A;  2HND A;  3RAQ A;  2LQ8 A;  4DI6 A;  3DRS A;  4DSL A;  2RU9 A;  4I56 A;  4WP3 A;  3R97 A;  3TAR A;  1HMV B;  4DXL A;  3MR5 A;  2EXU A;  4FXD A;  2GHW A;  2NYI A;  5GME A;  2ASL A;  4DV2 J;  1S9G B;  4J9Q A;  3PKY A;  4JB8 B;  3PEH A;  3MTJ A;  1TZ0 A;  3E8O A;  5L8R C;  2IM2 A;  3HVT B;  4F4W A;  2IM0 A;  2IAJ A;  4OJG A;  1QAY A;  3Q2T C;  5DLF A;  4G1P A;  5HN0 A;  2D3O R;  4WKY A;  2L9N A;  1S1V A;  3HLU A;  3CJS A;  4DUY J;  3FC9 A;  2Q3P A;  2B6A B;  3MM6 A;  2CJQ A;  3UNY A;  3W66 A;  2HHH F;  1XBW A;  3L7O A;  1Q8I A;  1HQU A;  2JNJ A;  2MXY A;  1Y5N B;  5DM7 Q;  1VJW A;  3TVK A;  1RT4 B;  4O4G B;  4A8X A;  2CPZ A;  3MPY A;  3CJ2 A;  1WF1 A;  4RW8 B;  2FLP A;  4HR2 A;  4NRT A;  2CJA A;  2WB4 A;  2N7Y A;  4P7V A;  2M5Y A;  2EW9 A;  4LIR A;  2W25 A;  1S1U B;  2HBY B;  3R3T A;  3A12 A;  1QVF R;  3GPA A;  1UW4 A;  1NDK A;  2QMX A;  1HNI A;  2HRU A;  5A8R B;  2M4M A;  2V34 A;  1DQA A;  2A0F B;  4OX9 F;  3OTC A;  2WON B;  1CJK A;  5I3Q A;  1GK8 A;  4O3R A;  2W2N P;  3TR5 A;  2UUA F;  3JS9 A;  4Y34 A;  1PCA A;  5E41 A;  3R7S B;  4C2M A;  2J9C A;  2JC1 A;  5B0E A;  4HVZ A;  1RT2 B;  4I64 A;  4DV3 F;  1WG5 A;  3JQM A;  3KKF A;  1RAI B;  4ZJL A;  1VQ7 S;  4WFA Q;  1R8H A;  2RE1 A;  5IWA F;  2MPU A;  3IBW A;  2OMO A;  3C14 A;  3MMB A;  2MKI A;  2GML A;  1KHV A;  4LRC A;  1W25 A;  1FE4 A;  1S10 A;  2PE8 A;  3DOL B;  3G9C A;  4CO2 A;  3KJN B;  3D67 A;  2RDD A;  4KR0 B;  4Y2A A;  3CME S;  1RHR B;  4Q43 A;  1KEK A;  4X62 J;  2W1B A;  2M8H A;  4URQ U;  1WDT A;  2BM1 A;  1S1W A;  1MWY A;  2OTL S;  4ZHR A;  1U45 A;  3BSN A;  1H2U X;  3EVO A;  2K1R A;  5HVF A;  2HHU A;  3MAA B;  2C2E A;  1KVJ A;  5HAO A;  1N5V A;  2N3L A;  4ED3 A;  4AQY F;  5MLC V;  2A1B A;  2ZC3 A;  3B54 A;  2WBM A;  4OYI A;  3MMA B;  4CLU A;  3PHE A;  5E3Q A;  1WC4 A;  2Y1L B;  2DR5 A;  2V8H A;  4F36 A;  1F9F A;  1WAC A;  3TJA A;  4JI1 J;  3FQL A;  3NAI A;  3H4D A;  1AUD A;  1NJX A;  3MMC A;  1PJ5 A;  2O3D A;  5KT2 A;  2NSC A;  4ELT A;  1T02 A;  3I0R A;  3QGH A;  3PYE A;  4X4U A;  3KXD A;  2V8D A;  1T7P A;  9RUB A;  2CQC A;  2J7U A;  5CCL A;  4JI7 J;  3B82 A;  1FFW B;  2GO8 A;  4C8Z A;  1UVL A;  2I0X A;  3HSJ A;  4LF9 J;  4QWD A;  4X4Q A;  2KT3 A;  2YNF A;  5J2M A;  3KNG A;  1SXL A;  3BB5 A;  4KGM A;  2D74 B;  2JVO A;  3QGP A;  5HK4 A;  4YDX A;  4KQZ A;  1H38 A;  2KB2 A;  1X5P A;  2CJ9 A;  2X1F A;  2DIU A;  4ZVO B;  1NK7 A;  2DY9 A;  4OJ3 A;  2XMA A;  4YDD B;  3PHT A;  4FF3 A;  4LF7 J;  1N34 F;  1VQS A;  1YQH A;  1Z2Z A;  2FY1 A;  4WYW A;  1HBO B;  3HHD A;  5KFW A;  2CQ4 A;  1M5V C;  3HX9 A;  3M8Q A;  3W5Y A;  4MFB A;  3HD1 A;  5IXU A;  3N9U C;  4YB5 A;  3AJD A;  3H2L A;  4C48 A;  2CWX A;  5A8W A;  1U7L A;  2IMW P;  4LFA F;  4L3N A;  1YRX A;  2VDI A;  2Y0B B;  1TL7 A;  3BF4 A;  2ILY A;  2R7O A;  4JUZ A;  1WWH A;  4W92 B;  1S99 A;  2DGX A;  1JLB A;  2CQ2 A;  4MKV A;  2I5J A;  2ZD1 A;  4RUH A;  5IT9 U;  1RKJ A;  3ZZU A;  5GAH U;  3S7R A;  3TX0 A;  3V5R A;  1Z4U A;  2RVJ A;  2MDA A;  5KG5 A;  2W7P A;  2GW8 A;  3MR6 A;  1WTB A;  4Q0B A;  2AJ0 A;  5D4O A;  1KTV A;  1RHU B;  4UOF A;  2LEA A;  4R0J A;  3TAM B;  4X2B A;  4RL1 A;  3OJS A;  1W2I A;  4ES1 A;  3BR9 A;  3GIL A;  5G0R A;  4OYW A;  4Y65 A;  2VKR A;  4GKK F;  1GTH A;  2W2M P;  1UPP A;  4DV5 F;  1O6X A;  3UR0 A;  2MZ1 A;  2RDI A;  3BYP A;  1AT1 B;  2GVZ B;  4M5H A;  2OPP B;  3R5C A;  4PUO A;  3DU6 A;  2CJK A;  2L41 A;  3PR5 B;  3B4M A;  4BHQ A;  4RWX A;  4DL6 A;  3NMA A;  1QDU B;  4I0W A;  3GR0 A;  1FXD A;  3WQP A;  2ZM6 F;  4ECZ A;  3G71 S;  1VQP S;  3R5J B;  1FK9 A;  5D77 A;  2W2P P;  2MKS A;  3I6P A;  5CYM B;  1HYS B;  2GVD B;  7FDR A;  2V2Z A;  2GHP A;  2YWE A;  3C19 A;  5EX3 A;  2CPE A;  2J9D A;  5A8K A;  2IRX A;  2MZS A;  4DWI A;  3KDN A;  2FD2 A;  2V6A A;  1XNQ J;  4FNH A;  1TUW A;  3MCO A;  1T9V A;  3M8P A;  1RT1 A;  4DV6 J;  5IM0 A;  1P9Y A;  1HR0 J;  4LF8 F;  2ASJ A;  3A3N B;  3M05 A;  4WFB Q;  3IAM 9;  4BWM A;  1BQN B;  1X5O A;  5AE2 A;  5GAH I;  3CCW A;  3JSY A;  2VL1 A;  1F2G A;  1ZPW X;  1RTD A;  1H72 C;  1NHK L;  3EGV A;  4JI8 J;  2KM8 C;  5BYS A;  1TP7 A;  4YB7 A;  1R0A A;  3OFG A;  4K2J A;  1YIT S;  3KLI A;  4DV7 J;  5HVH A;  2R2S A;  4I6W A;  2I38 A;  4DEZ A;  4ED6 A;  3TUP A;  2C22 A;  5KFV A;  2H51 B;  1HNX J;  1FRJ A;  4ECV A;  1R6V A;  1U4B A;  3KK1 A;  1U0H A;  1DLO B;  2QLW A;  6FDR A;  1N5S A;  2PII A;  3DYA A;  5GMD A;  3CE8 A;  2AYB A;  3QIP A;  4GC7 A;  4P6Q A;  1QUV A;  2JX2 A;  1N48 A;  1FO1 A;  1YBA A;  2BE7 D;  2QLB B;  4M5N A;  1RT6 B;  3BGU A;  2BVZ A;  2GJ2 A;  3OL8 A;  3QFW A;  3WX4 A;  4WFN Q;  1RJJ A;  2R3V A;  3NWR A;  4WKR A;  4O44 B;  2FHJ D;  4PAB A;  1JLQ A;  2WW8 A;  1CC7 A;  1GT8 A;  2HND B;  4I1T A;  2YWH A;  3DRS B;  4IRK A;  1FER A;  3I87 A;  3IM9 A;  4UST A;  4N76 A;  1NBE B;  1XNR J;  3B4D A;  1VRT A;  2J7K A;  3SV3 A;  3VAM A;  4G6V B;  4RBU A;  3EPG A;  4HAC A;  1XQI A;  4OI3 A;  4LRA A;  5KFP A;  1PGZ A;  4CLP A;  4LSL B;  2ASD A;  1KKH A;  2IAJ B;  4ZLP A;  2A10 A;  5D4P A;  1FWK A;  2XLJ A;  5D15 A;  4LIW A;  3S1T A;  2HVZ A;  5IQQ A;  4LRB A;  1S1V B;  1S1T A;  5DJB A;  4M8L A;  1Y3K A;  2RD5 C;  3N79 A;  3MM6 B;  1T9T A;  3DRX A;  1HQU B;  2DKO B;  2WVB A;  4NLU A;  2E7W A;  3BGL A;  1NKE A;  1SH3 A;  3ILI A;  3BGR A;  3VQS A;  2XLI A;  3KOA A;  2DGU A;  5ETS A;  5KFK A;  2RUG A;  1NH7 A;  5CAA A;  2BJE A;  4HT5 A;  4ZMM A;  3ENA A;  3Q8S B;  1VQ9 S;  3WC0 A;  1HWL A;  5C7P A;  5DZ6 A;  2HQC A;  3JB9 k;  4J9K A;  1YJU A;  3EXC X;  2F8H A;  4JI0 F;  4DOZ A;  2E1R A;  3R5A A;  1HNI B;  2IJF A;  1NKB A;  2EK6 A;  3FVY A;  1NB2 A;  1E6V A;  3P6Y C;  4LRD A;  1CJK B;  3QT5 A;  3W2W A;  3CDE A;  2ACM A;  4B3R J;  3LUY A;  3PO4 A;  3CF5 Q;  4QIW D;  2QSF A;  5B0F A;  5IT4 A;  5LM7 E;  1RZM A;  2OEJ A;  2UV8 G;  3IWL A;  1S0N A;  2RQ4 A;  5ETM A;  2QLJ B;  4DLG A;  3VTI A;  3JAM U;  2KI2 A;  4KYZ A;  5KFB A;  1S12 A;  5DM6 Q;  3PW0 A;  3C14 B;  1RDR A;  1EQM A;  4B3O A;  4LMZ A;  5F8H A;  2EWH A;  2ZHO A;  4HHJ A;  3AB4 B;  3R6L B;  1DRZ A;  1HBU A;  3Q2S C;  3M6V A;  4LT6 A;  5E2Q A;  3CCV S;  1RYS A;  1WI8 A;  4ZPB A;  4USW A;  1UWB B;  3VHQ A;  1YIJ S;  4LSN A;  4DR4 J;  1B4S A;  1UJ6 A;  1S1W B;  4ZHR B;  5LJ5 Y;  2K1R B;  4KV8 A;  2H4W B;  4NEY A;  4NCB A;  1D8Z A;  1K44 A;  4CIO A;  2FJX A;  4IG0 A;  2EC0 A;  3IRW P;  3K57 A;  3BJY A;  5JUM A;  1NJI T;  4B9U A;  3PO5 A;  3OXL A;  2JSX A;  4DL3 A;  3HXM A;  5FLX Y;  4BC9 A;  3JAM Y;  2NXJ A;  2BJ7 A;  5KFT A;  3MMC B;  1ZAW A;  1TUG B;  3G4S S;  1PAU B;  4H4K C;  3KHL A;  1FKA F;  3U02 A;  2HW3 A;  4PPZ A;  2XYH B;  1RYR A;  3I0R B;  1N33 F;  2LA4 A;  4KT0 C;  1JQG A;  2NXE A;  1RAA B;  4YHH F;  2XWY A;  1ZET A;  3KNA A;  3AT1 B;  1N6Q A;  4BS2 A;  3TQ1 A;  2V2V A;  3THV A;  1S79 A;  2B4V A;  1VIO A;  2KHD A;  1LXN A;  3Q24 A;  4J37 A;  4ZP6 A;  2R8J A;  1RGV A;  4QU6 A;  4G3I A;  3S8S A;  1SL1 A;  1X4D A;  2YNF B;  5J2M B;  2OSR A;  3VAK A;  4IQX A;  1HHS A;  3VZI A;  1U26 A;  2MY7 A;  2GQQ A;  2F9D A;  2H3E B;  1C2P A;  4F26 A;  5HO4 A;  3SFU A;  4HYK A;  3QJJ A;  1UW9 A;  2EBE A;  4USV A;  5HI7 A;  2FC9 A;  3PYG A;  1YJV A;  4CQ1 A;  3FEZ A;  1MSW D;  3BKU A;  3VVT A;  3M8Q B;  1VK8 A;  1MMD A;  2DYA A;  3ZFV A;  4MFB B;  3QRQ A;  1WSR A;  1SPB P;  1QAI A;  4WJB A;  1N4L A;  2B51 A;  5A8W B;  1S77 D;  3PFO A;  1TL7 B;  1ZYQ A;  3V6K A;  4DV4 F;  2KVQ E;  5F0W A;  1JLB B;  2FC8 A;  3H5S A;  1SI9 A;  2I5J B;  3SQO P;  4J9N A;  5IC6 B;  4IYQ A;  1LFP A;  4B3S F;  1TK5 A;  2ZD1 B;  3DMJ A;  2XO7 A;  3HVW A;  3KHG A;  2FHM A;  4HTI A;  4KHP J;  5KT7 A;  2RKI A;  2Y1I A;  4E0D A;  3PYD A;  4X65 F;  2COL A;  2DBB A;  4DFM A;  1ZTT A;  4PG7 A;  3H59 A;  2VC0 A;  3K7R A;  1CQN A;  2BA9 A;  4Q0B B;  3RBE A;  3GU0 A;  5AXL A;  1WEZ A;  4DPW A;  3G6V A;  2O01 C;  1KN6 A;  3H0P A;  1HWK A;  1S49 A;  1GX6 A;  2LLZ A;  2YNI B;  2EBG A;  3UDL A;  2PGC A;  2CAJ A;  3RW7 A;  3CDB A;  5G0R B;  1FTR A;  1RA6 A;  2IVM A;  1JLF A;  3M9O B;  1FFS B;  2R7S A;  1Q78 A;  4XDD A;  5B7W A;  4PUO B;  5K9F A;  4RW6 A;  3J7Z T;  1K1Q A;  3PR4 A;  3QNW B;  2BJ1 A;  2ZKT A;  2FDN A;  4R5P A;  1NCL A;  4DHV A;  2GIR A;  2KL8 A;  2HK2 A;  3EZ5 A;  3PIP Q;  2CKW A;  1FK9 B;  5CYJ A;  2GMH A;  5DG7 A;  1RAG B;  1RWP B;  3UNG C;  2HQD A;  3PX0 A;  1NHU A;  3MHY A;  1DTT A;  3WIU A;  4BBY A;  3FMB A;  4L72 B;  4JI3 J;  3VZH A;  1N8R T;  3SCJ E;  4B3T J;  2A2C A;  1RAO A;  4USU A;  1UPM B;  3MF5 A;  3HCX A;  3TP2 A;  3M8P B;  1RT1 B;  2LFV A;  5IM0 B;  2NRE A;  1LWC A;  2HFN A;  5SZT A;  4GO5 X;  4RKU C;  3X3U A;  4C8O A;  4CLK A;  4DUY F;  1MWZ A;  2ZVI A;  3P5T L;  2BW7 A;  4QYR A;  3R8Y A;  3BBF A;  2R7Q A;  1K47 A;  5L9N A;  4DFP A;  1DQ9 A;  2LP4 A;  1OQ6 A;  3HHL A;  2FZG B;  4NL5 A;  5L39 A;  4KGV B;  1RLD A;  2QGF B;  3UR3 C;  1RTD B;  5K8P A;  2BKP A;  2QFJ A;  2GIQ A;  2OO4 A;  1R0A B;  1X9W A;  3GG1 A;  3KLI B;  4WFY A;  2EKY A;  1Y7P A;  4DLE A;  1RAF B;  2GQC A;  1VS3 A;  3OVB A;  1TV6 A;  1IBL J;  1U2F A;  1P8G A;  4IR9 A;  2WVE A;  5L1L A;  4BDP A;  3J7Z 5;  1EKS A;  3CCR S;  4NLQ A;  1WOS A;  2HZC A;  3GMG A;  4G1Q A;  4CI0 B;  2HVE A;  2MKY A;  3NL0 A;  3L7U A;  2QC3 A;  4JBC A;  3W5X A;  1QM9 A;  1S48 A;  1NHV A;  3V2U C;  3F0N A;  4NX9 A;  3TA1 A;  1Y3J A;  4Y6I A;  1U0H B;  2PD1 A;  3DYA B;  2BJ3 A;  2VOO A;  4OX8 A;  3QIP B;  1WHY A;  3D5M A;  1LK5 A;  4WZQ A;  4YR2 A;  2XC9 A;  5KG6 A;  2CNO B;  1WG4 A;  2VQE J;  2VAS A;  3TYT A;  2E5J A;  2NSB A;  1J5O A;  1VRQ C;  1YX2 A;  2G1H A;  5EX0 A;  3A4T A;  1C0T A;  3TW0 A;  3PM9 A;  2GGP A;  1JLQ B;  1TKZ A;  4E8U A;  2BE9 B;  4WK1 A;  1OY8 A;  5F3T A;  3BGO P;  4QIG A;  4CWB A;  3ZTQ A;  3HHK A;  2ZVS A;  4IR1 A;  4H4O A;  4IRC A;  5HRO A;  1FDD A;  4X4T A;  3GTY X;  4OX7 A;  1VRT B;  4RJV A;  1NME B;  2QE5 A;  3EGW B;  4GRS A;  3FBC A;  5IC4 B;  4HAC B;  1BQM B;  4QBU A;  3ET6 A;  3I31 A;  3NCR A;  2BQ3 A;  2ZH7 A;  4ITS A;  1YJN S;  3VQT A;  2OHD A;  1LWF A;  2DCL A;  3RB0 A;  2CG8 A;  4F8R A;  2G13 A;  1KHW A;  3DLE A;  2LQ9 A;  4F02 A;  4P71 A;  3QSI A;  1B0V A;  1UKU A;  2DNG A;  4NRU A;  1MLA A;  2N82 B;  4R25 A;  3QJP A;  1T94 A;  2PA8 D;  5E3R A;  2YWF A;  2DIS A;  3IS9 B;  1X4C A;  2XS2 A;  3BGR B;  3RU0 A;  1FXR A;  4FPR A;  4F0M A;  2Q6B A;  1I51 B;  3N6L A;  2CQP A;  5F8N A;  1B70 B;  2XGP A;  2QFI A;  4LBI A;  2B43 A;  5LJ3 Y;  1E6V B;  2E1M C;  2MKJ A;  3CMQ A;  1JJ4 A;  1DAR A;  2UXD F;  1A0O B;  4Z2X A;  4O0I A;  5D78 A;  2E7X A;  2DGV A;  4ECS A;  4LF7 F;  1TKX B;  3SCL E;  4LF5 J;  3MM9 A;  2Y8Y A;  1EJ7 L;  2DNK A;  3BEG B;  3CCT A;  2KJV A;  3LH2 S;  1U1L A;  1WF2 A;  3C16 A;  2R7W A;  2YQ1 A;  3LAL A;  3KG4 A;  3CED A;  3UDC A;  4B3O B;  1FNX H;  5CAB A;  4UW2 A;  2VG6 A;  3I0S A;  3ENQ A;  3NBP A;  3Q8P B;  4H4M A;  1LKZ A;  4NEZ A;  1HBU B;  2WW4 A;  2MKC A;  2XMW A;  3H4B A;  3OL7 A;  3FCV A;  1D1U A;  3F41 A;  4MJK A;  5M2U A;  4LSN B;  1NK4 A;  1PC4 A;  2I1R A;  2BRL A;  3DOM A;  1UEU A;  3J7Y U;  1HNV A;  5E7O B;  4KV8 B;  4ZVP B;  1ZAX A;  2CPF A;  5E0O A;  1RWV B;  3VAJ A;  4IG0 B;  1OYD A;  2CJY B;  1UL3 A;  4JYA J;  5CD4 A;  1RI7 A;  3VGV A;  1M1G A;  5EWE A;  3D6F B;  3EGN A;  3W65 A;  4L74 A;  1ZM9 A;  1X9M A;  4ZA1 A;  2VH7 A;  3NY0 A;  5D3G A;  2GS8 A;  4LR9 A;  3QO9 A;  1HQE A;  1PJ6 A;  5KFU A;  4LUB A;  3TEG A;  3WZ0 A;  3KMS A;  1WI6 A;  4F4Y A;  3R5D A;  4DU8 A;  1SL2 A;  4HH0 A;  3IWN C;  2XNQ A;  2PI5 A;  4NLY A;  4CO5 A;  1N6Q B;  3DOK A;  3Q8R B;  2ZE2 A;  3ETO A;  2GO9 A;  2VG7 A;  2E9R X;  1RHJ B;  2F1F A;  2XUL A;  1RSC A;  4CNZ A;  1MN9 A;  3W5Z A;  3E2E A;  3NGR A;  1K73 T;  2CA9 A;  2ZUG A;  3W9H A;  3LPE A;  1S9E A;  1GTE A;  1Q81 T;  2Y1R I;  3TOQ A;  2QYG A;  4FVM A;  5KFX A;  1GMW A;  4B9T A;  2R4F A;  4DS5 A;  3W2V A;  1SUQ A;  1N56 A;  3EIC A;  2M8D B;  3FKB A;  4WII A;  1RBL A;  3PNI A;  1OMS A;  3DDI A;  4RBV A;  3E01 A;  1NDL A;  2CNN B;  4DV6 F;  3GYX B;  1HR0 F;  2PMZ D;  1O5J A;  1WD6 A;  5EHH A;  3K8W A;  3NXZ A;  2IM3 A;  3NGD A;  3WC2 A;  2OPQ A;  1ZH5 A;  1JK9 B;  2FJA B;  4CLY A;  2BUN A;  1GQE A;  2PFF B;  2DVI A;  3D1H A;  1KFD A;  3WDO A;  4IOA Q;  1VQK S;  3CDW A;  4DQP A;  3D1O A;  2DK2 A;  3TWZ A;  2XBP A;  2JEF A;  3VWS A;  2NCK L;  1HI0 P;  3ICL A;  2IY5 B;  1ZBT A;  5KG3 A;  2BM0 A;  2HHW A;  3NWG A;  1F3F A;  2AWZ A;  1QE1 B;  3DMJ B;  1YKW A;  3CD6 S;  3K17 A;  1M0S A;  3J80 U;  4FNI A;  4W90 B;  2RKI B;  2VFT A;  3IXQ A;  2R9L A;  1L5U A;  4J5O A;  4OI6 A;  1FF2 A;  4J9S A;  3SV4 A;  4M5D A;  3FCW A;  4NLO A;  1HNX F;  1RBA A;  4RUC A;  1FRI A;  5LMU J;  4XK8 C;  9ATC B;  3OL6 A;  2LDY A;  1VBZ A;  4KHM A;  5KFM A;  5IV3 A;  1RAJ A;  3QSY B;  2AU0 A;  5HVG A;  3CD7 A;  3CXC R;  3M6X A;  3IFE A;  4V19 X;  1JLF B;  3QPI A;  3C15 A;  5LSR A;  1Q82 T;  1Q79 A;  2BYC A;  4I2P A;  4C4W A;  4KKO A;  3PRB A;  2ROE A;  5DG9 A;  2DJW A;  2YXL A;  4A46 A;  2APO A;  4RW6 B;  1PIL A;  4IG3 A;  2CDQ A;  1JLE B;  4R5P B;  4DCP B;  4LF4 F;  2DT9 A;  3BH6 B;  5D0R A;  1UEV A;  2MJN A;  1FT8 A;  2GJI A;  2ZFH A;  4PQA A;  4P75 A;  2LXI A;  3ZXW A;  4EFA C;  2G4B A;  2DCU B;  2E1C A;  2XYP B;  4KGK A;  3TAQ A;  4I6A A;  2JC0 A;  1N0U A;  1XNR F;  1PBU A;  1X7V A;  4WE1 A;  2VB6 A;  2I6W A;  2DGW A;  2ZJR Q;  5KT4 A;  2AJF E;  4NI2 A;  5A2Q U;  3JSR A;  2HRY A;  1QSS A;  2MJU A;  1LWC B;  3V6H A;  2CWK A;  1HA1 A;  2AMC B;  3BV8 A;  5HQ8 A;  4DG1 A;  1C4C A;  2DR9 A;  1CJT A;  3CC7 S;  4QPX A;  1ZZF A;  4EUV A;  1M5S A;  4EYI B;  3HHL B;  2VFR A;  2JEG A;  1Y00 A;  5BR8 F;  3G8T A;  1IQT A;  4FPI A;  4UUW A;  3GIR A;  1TL4 A;  2FPH X;  3NGS A;  5CHC B;  4CM2 A;  3R2C J;  4ED0 A;  1AUS L;  4DS4 A;  2OML A;  2VFV A;  3A13 A;  4FBU A;  4LFC F;  4FZV A;  4CH7 A;  2V8V A;  1TV6 B;  4WWS A;  3HPO A;  1P6T A;  1H98 A;  1J2V A;  1SQF A;  4ZIW A;  2B9W A;  2HQF A;  4G1Q B;  4B3R F;  5IV4 A;  3A3O B;  2GC8 A;  2XCP A;  3ITH A;  1U49 A;  4ZPC A;  3UCG A;  4PWU A;  1R6Y A;  4MAK A;  2Y3Y A;  3CCL S;  1WDD A;  3ZC4 A;  3H8Y A;  4ETZ A;  1UVJ A;  4ECQ A;  4M94 A;  3AOA A;  4C8Y A;  1VQO S;  2VUG A;  2R7X A;  2FLL A;  2DR6 A;  4JV0 A;  4RO0 A;  4A8S A;  2BQU A;  2KYX A;  2HGM A;  1J5O B;  2F4V J;  1HWI A;  4ECR A;  1VMB A;  5D0H A;  2MQ8 A;  2ZWP A;  4KPY A;  1C0T B;  4BCA A;  2GGP B;  2M88 A;  2RIL A;  1TKZ B;  2KFN A;  1SVD A;  4AND A;  4RW7 B;  2CPX A;  1S0O A;  4PKD B;  3KJF B;  4Q7A A;  2L08 A;  3S01 A;  4YR3 A;  1CG2 A;  1R8B A;  4GKJ J;  1XER A;  4OI2 A;  4H4O B;  2HFZ A;  4KFB B;  1D9D A;  5HRO B;  3FSI A;  2V67 A;  2PMH A;  4JOU A;  3MR3 A;  3CT9 A;  1NPR A;  1UZH A;  2LMI A;  1YRU A;  2WSC C;  4PXD A;  3ET6 B;  1UEK A;  2M3D A;  1F1B B;  2QL7 B;  3D6M B;  1HW8 A;  1LWF B;  2EFV A;  4ZN3 A;  4CTA A;  1BXN A;  2G2O A;  3T6B A;  2DNL A;  1HBN A;  3DLE B;  1VQ4 S;  4OYA A;  5EUH A;  1HPZ A;  2ZBR A;  4CDI A;  1R31 A;  2CNK B;  5GAE I;  2DEI A;  3F44 A;  1RB0 A;  2HRT A;  4LF8 J;  4UTG A;  2NQP A;  3N5F A;  3KK3 A;  2AGQ A;  2MZR A;  3D9B A;  3CC2 S;  2ACY A;  5FJ4 A;  1NLK L;  4DX7 A;  1WG1 A;  3DRP A;  1H73 A;  3U7J A;  3ULH A;  5DGB A;  4ZPW R;  3KMQ A;  2K7K A;  2V4J A;  4A8Y A;  3TZX A;  2HNZ A;  3K5L A;  2XY7 A;  4ECT A;  4P74 A;  2W9C A;  3DLB A;  2DH7 A;  3EDQ B;  2CQI A;  5KFF A;  1SKU B;  3TJ8 A;  3MM9 B;  4WCE Q;  2OI2 A;  3IGN A;  3ZNJ 1;  1TMM A;  1JLC A;  1WC0 A;  4DR6 J;  1RWM B;  2BAC A;  2C28 A;  1JLG A;  3C16 B;  3CTR A;  2B7C B;  2B3T B;  3BSA A;  3PEJ A;  3HKW A;  1FEE A;  1RP5 A;  2VG6 B;  4PYA A;  3I0S B;  5HMX A;  2JJ4 D;  4PG4 A;  1NSQ A;  4OYZ A;  4PAA A;  3TO8 A;  4H4M B;  2YNG A;  1KWM A;  4F4A A;  5H1S V;  2HBR B;  4IO9 Q;  1H6K X;  3DI6 B;  2RDJ A;  3CCJ S;  3DLH A;  3Q0A A;  3JTO A;  3KUG A;  3NCQ A;  3ZTR A;  2LEB A;  2AYG A;  4KTQ A;  1P9Q C;  2H1Y A;  2VOP A;  4K4V A;  2H4Y B;  2XMJ A;  3M2V A;  1JWW A;  2HFV A;  2FGC A;  2R2U A;  3K5P A;  2PDA A;  3DOM B;  1HNV B;  2VIC A;  3HVR A;  2DRA A;  4KHP F;  4RUA A;  1DTQ A;  1UWA A;  3UCU P;  2J7W A;  8ATC B;  2Y0S D;  1TMJ A;  2WOM A;  2V8P A;  3VAH A;  4PG6 A;  4M5M A;  4P73 A;  5T7L A;  5D3G B;  4ES2 A;  1R43 A;  1WEX A;  3NMR A;  1HQE B;  4I68 A;  2MST A;  3SFG A;  1DQ8 A;  3NS6 A;  2QA4 S;  4A8K A;  1SKW A;  1KSP A;  2XZT B;  3A1Y G;  2YKQ A;  3N28 A;  2A3J A;  1SC3 B;  4YME A;  1YJR A;  3KTQ A;  4OLP A;  4J9V A;  4DL0 C;  3PY8 A;  4P2S A;  3DOK B;  2ADC A;  2ZE2 B;  2VG7 B;  2QO3 A;  1G4C A;  2O66 A;  4ZP7 A;  3GYN A;  5HJY A;  4WP9 A;  2HQG A;  1WC3 A;  1S9E B;  1G3O A;  1Y11 A;  3I32 A;  4U6P A;  3W2V B;  2KXF A;  4L76 A;  1SUQ B;  2H5I B;  4B3M F;  1I5O B;  4B3T F;  3C66 A;  4CH0 S;  2KDO A;  5A6W A;  3OXF A;  1YSJ A;  4CRJ A;  2VJV A;  4ELU A;  4GO7 X;  4FF4 A;  3QGI A;  4DR5 F;  1FTC A;  2YWK A;  3ZZR A;  3E01 B;  3L9Z A;  1OJ4 A;  4ILL A;  3H42 A;  3QLH A;  2EVZ A;  3OUY B;  4NZ0 A;  2OPQ B;  5B0C A;  3QAU A;  3BO4 A;  1XTZ A;  3TEH B;  3IR7 B;  5T41 A;  4NXN F;  4NLT A;  3QRP A;  3BGF A;  3ENW A;  3N01 A;  2VKZ G;  1G6B A;  2FZC B;  3AOC A;  1VRU A;  3MOZ A;  5BYQ A;  1IQZ A;  4WK3 A;  2P9E A;  2DNR A;  3EWG A;  1B3T A;  1BWE A;  4MKY A;  1NK9 A;  4Q2M A;  2IJN A;  1SV5 A;  3MUR P;  2GZO A;  2E5H A;  1AB8 A;  4TYA A;  1AFJ A;  1PO6 A;  2Z2Y B;  2BKN A;  4MK7 A;  4M5D B;  4H4K A;  4F0K A;  2DNP A;  2ROG A;  2BX6 A;  3MUT P;  3KLE A;  3SCK E;  4TLQ A;  4UOC A;  4NML A;  2D7S A;  3SSS A;  2H54 B;  2E9Z A;  2J6U A;  4Q8E A;  1FRK A;  2YPY A;  2OUG A;  2E5L J;  4QZV B;  2VQE F;  3BN4 A;  3C15 B;  3M1V A;  4I2P B;  3AH6 A;  4KKO B;  4TY8 A;  1NM2 A;  3DGV A;  3O5T B;  2YKA A;  1DZ5 A;  1F6T A;  3C6U A;  1QLN A;  3C8Y A;  2W7O A;  4IG3 B;  4CO4 A;  2IYI A;  2XMK A;  1N36 J;  3FK4 A;  1XIQ A;  1SH0 A;  4DFJ A;  1VHI A;  2UVU A;  2IM1 A;  2XHW A;  1N33 J;  2KHC A;  1DY3 A;  1T95 A;  4YHH J;  4O23 A;  2ZNZ A;  1IWG A;  4CNY A;  2G2Y A;  3KJV A;  3DM2 A;  4KO0 A;  5E33 A;  4WE1 B;  3TZY A;  1IKY B;  4C6A A;  1BMQ B;  4JV1 A;  2GMJ A;  4NI2 B;  4QJV A;  1GMU A;  3JTN A;  3TVZ A;  4ZJO A;  4Q2L A;  2BKO A;  2B8P A;  1U09 A;  3ISN D;  3D6T B;  4RZR A;  2MQM A;  1HNZ J;  2C2D A;  3DLJ A;  1XWL A;  2RS8 A;  1U6Z A;  4DG1 B;  3IN5 A;  2H9Z A;  3SCI E;  1CJT B;  3HKZ D;  2UUC J;  3KUE A;  2CQH A;  3T1Y F;  2UXC F;  1N5Y B;  5DET A;  1CEZ A;  5LMN F;  1KQS R;  2HFU A;  3I9Z A;  5HSP A;  5C5J A;  2UU9 F;  2XMT A;  4P2X A;  1FCA A;  2ZUA A;  3NOC A;  4HTJ A;  2AJQ A;  4OI0 A;  2HWH A;  1U6B A;  2CPY A;  1IN0 A;  4K7Q A;  3OLB A;  1YRT A;  3GFH A;  4PRF A;  2XMU A;  3PKM A;  3HSG A;  3OVS A;  1WC6 A;  4YP3 A;  4M5J A;  1PSD A;  2QN6 B;  4QYZ J;  2W4D A;  3CDA A;  1S72 S;  4N47 A;  3OTE A;  3UN2 A;  4DMZ A;  4DX6 A;  5GAG U;  2VPW B;  3TJ9 A;  4IUF A;  3ITH B;  4CO0 A;  3FRZ A;  3T3F A;  4LF5 F;  1HD0 A;  2LXF A;  3GV5 B;  5EWG A;  4PR6 A;  4AT1 B;  3GJT B;  3B6B A;  4ZOS A;  3ZZP A;  2AKW B;  3ZZ0 A;  3CJ5 A;  4QYZ K;  5CZX A;  1LWX A;  2LQJ A;  1QTN B;  3M8W A;  3QZ7 A;  3H5U A;  1RWK B;  4NLW A;  3BSO A;  4F3O A;  1FDB A;  1VYA A;  4X4O A;  2JL9 A;  4NLG A;  1NSK L;  4TY9 A;  2CUY A;  3A8J A;  2BJ9 A;  2AV5 A;  4DR1 J;  2FLN A;  1SJ3 P;  4OI4 A;  4NLX A;  5KFC A;  1UZD A;  1ZPV A;  3GCX P;  1J5E F;  3BQ0 A;  4URS A;  4ZJQ A;  2LA6 A;  2P6S A;  2XSJ A;  3GJR B;  2W01 A;  1URN A;  2G0J A;  1K9M T;  1YBU A;  1RA7 A;  2K7J A;  3K8V A;  1F5C A;  1YVF A;  4JYA F;  7AT1 B;  2V2K A;  4U96 A;  4ATN A;  1RAB B;  2KN4 A;  4KB7 A;  3OTO J;  1XMO J;  1JJC B;  2LQB A;  4TLR A;  3FSY A;  4CTA B;  1LXJ A;  5DG8 A;  2L9D A;  3D28 A;  3MCS A;  3NP5 A;  3GSD A;  1IR1 A;  1HPZ B;  1HBM A;  1RWX B;  4NYO A;  1EP4 A;  2WRM A;  4ZLJ A;  3CW2 C;  2V9W A;  4NZ7 A;  4ZVS B;  4OMF G;  3UFC X;  1MRO A;  3W64 A;  5B0A A;  1CUL B;  3KK3 B;  4L73 A;  1PYO B;  3M9N B;  4K59 A;  2BOP A;  1CLF A;  2C3U A;  1S6O A;  1RTI B;  1KTQ A;  3DRP B;  1VCT A;  4IFY B;  4NCG A;  3WIV A;  1PG5 B;  3G2X A;  2ERR A;  4WPA A;  3EX7 B;  3JTP A;  4P7T A;  2V4J B;  2QMW A;  2DNO A;  2Z8Q A;  1TL5 A;  3H5Y A;  4UQT A;  2KXH A;  2HNZ B;  2P6T A;  4N8N A;  2OFG X;  1X4A A;  2BE2 A;  5DQH A;  3BPS P;  2W9C B;  3M2R A;  5KFR A;  1CJV A;  1Y5I B;  3ZNU A;  3GIJ A;  1EAY C;  2EKN A;  5IZH A;  1JLG B;  1WNE A;  2QA4 G;  4GVB A;  3HT3 A;  4G1I A;  4GC6 A;  4LJM A;  4ZPT R;  3CD0 A;  4HEA 9;  3BKF A;  3R1H A;  3CJ0 A;  3TA0 A;  1XK8 A;  1VQ6 S;  4V1A k;  2HGN A;  4FF1 A;  3D1Q A;  4DSI A;  3ISZ A;  4DR2 J;  1I94 J;  2ZEJ A;  2L48 A;  2MLY A;  2IHR 1;  4IFV B;  4J7C A;  5T14 A;  5ETV A;  2PT0 A;  2WTF A;  3MAQ A;  3VV2 B;  2Y9H A;  1G1X A;  2V94 A;  2AHO B;  3BZQ A;  5KFG A;  3SYZ A;  1BD6 A;  3M2V B;  3BRE A;  3FUY A;  3A3P B;  2RJZ A;  1IUJ A;  3I5B A;  3GLJ A;  2H48 B;  4W4M A;  5FD1 A;  2J6S A;  1DTQ B;  4JP8 A;  2DH8 A;  1VQL S;  4K5R A;  2W4P A;  4ZK7 M;  3RRG A;  2MQQ A;  5LMU F;  2WOM B;  3DDK A;  3KWM A;  3PYF A;  3AA8 A;  3NS7 B;  3QID A;  5J1E A;  5T7L B;  3FBF A;  3HM9 A;  2KU7 A;  3MEC A;  4RR5 A;  4M63 A;  3F73 A;  4PXB A;  1XN9 A;  2F7V A;  4CCH A;  1KDN A;  1ZM3 A;  3UD4 P;  1Q53 A;  2WSF C;  5HMZ A;  3TX8 A;  2LEP A;  4WFX A;  1KVK A;  1S5Z A;  4JI2 F;  5E3A A;  2J8A A;  2FVR A;  1B7Y B;  3TAN A;  5E3P A;  4FS2 A;  4QU7 A;  3J81 Y;  1NH8 A;  1TKT A;  4I2Q A;  2NUH A;  2WVD A;  2V69 A;  1KON A;  2LVW A;  3E51 A;  3NCP A;  2MGZ A;  3HUL A;  3BO3 A;  4DJB A;  1H7X A;  2VBW A;  1AFI A;  1KVI A;  2HAF A;  3GE9 A;  1GXL A;  3QJL A;  4J9O A;  1UVI A;  4ZCL A;  4NAS A;  5THW A;  3KHH A;  2CVI A;  3VF0 B;  1OQ3 A;  3M6W A;  4EK2 A;  3IO1 A;  1T05 A;  3QLH B;  2UXD J;  5MAO A;  4N56 A;  2XS7 A;  1KQK A;  1RKI A;  1JXL A;  4O4R A;  2CRL A;  5IS2 A;  3G96 A;  2VV5 A;  3GWC A;  3SMZ A;  1HKA A;  3PDN A;  1S6Q A;  4F4K A;  2PEH A;  2XZD B;  3VCD A;  4FP9 A;  3G82 A;  4F3Q A;  1HL6 A;  1VRU B;  1LWE A;  4OV1 A;  5KG0 A;  3VAL A;  4M5K A;  1NPK A;  1SV5 B;  3O3L A;  5SUH A;  3W9J A;  4O3Q A;  1GXU A;  2HG4 A;  1RTZ A;  2N4D A;  2CAD A;  3T5K A;  1EZZ B;  1Q4R A;  2QIF A;  1AA1 B;  1S9F A;  3SSR A;  4X84 A;  1UFW A;  2ZH4 A;  3AA9 A;  3P49 B;  4CYU A;  3R7N B;  3L95 X;  2XB2 D;  4RW4 B;  3KLE B;  4TXS A;  2OPS A;  3MR7 A;  3MM8 A;  2ZDO A;  4KSE B;  4WBF A;  5C25 A;  1HMV A;  2MY8 A;  4TQR A;  2NZ4 A;  4U7U K;  2R8H A;  2AEJ A;  3P4U B;  2C3P A;  4TN2 A;  4BLG A;  4IKA A;  2PC6 A;  3M1V B;  4QWC A;  3HK2 A;  2AZ3 A;  4TY8 B;  2F4V F;  1KNZ A;  5GAD U;  3MPD A;  3C6U B;  2B0G A;  4KJI A;  1VIS A;  1LW0 A;  1KR4 A;  4ELV A;  4AYB D;  2XHC A;  4JI4 J;  3TZW A;  1OWX A;  3TA2 A;  1MML A;  1FES A;  3MED A;  4I67 A;  3DU5 A;  2VBX A;  3RR8 A;  2ZBQ A;  3CNQ P;  4GKJ F;  4XTT A;  2W8L A;  3S6E A;  2Z2M A;  2C2Z B;  3KJV B;  3CJT A;  3DM2 B;  4KO0 B;  1N54 B;  2DXE A;  1YGY A;  3DNC A;  4KGZ B;  2J8S A;  4NLD A;  4L75 A;  1TK8 A;  4C8N A;  1ZA1 B;  3M6U A;  3WHI A;  1R7I A;  4CM0 A;  4HHU A;  4K50 A;  2JFD A;  1IBK J;  1U1Q A;  1C1B A;  2K2P A;  3V4I A;  3LGM A;  1U47 A;  2EK1 A;  3FEX B;  1NJY A;  2RH3 A;  4AFF A;  2IBK A;  2VFU A;  3US5 A;  3ZZZ A;  1GXT A;  3G8S A;  2Y1J A;  4K4Y A;  4ED1 A;  3EVM A;  1RHM B;  2NR0 A;  2FHO B;  3MM7 A;  4USH A;  4F7V A;  4BWJ A;  4ZIT A;  1NSP A;  1SBR A;  1X31 C;  3OW2 R;  2JOQ A;  1RIS A;  3D2W A;  2QJ3 A;  3W7B A;  3BR8 A;  5D0E A;  2VQF J;  5EN1 A;  3NAH A;  3IP0 A;  4HT7 A;  1TU0 B;  3PRV A;  1V3Z A;  1PIE A;  3AB2 B;  5F9L A;  3IGV A;  5GAD I;  4XIU A;  1UVN A;  1JIH A;  4YY3 F;  3V81 A;  1FD2 A;  4EMD A;  4DR6 F;  4OHZ A;  2FJE B;  3POT A;  2HQI A;  5K8N A;  2YPZ A;  4MK8 A;  3THP A;  3OR1 A;  2K06 A;  4URG A;  3EUN A;  5J2N B;  3GCW P;  3MPW A;  1N52 B;  1Q95 G;  1SQG A;  1RT7 A;  4ZVQ B;  5D4L A;  4CLF A;  1NZA A;  2D3U A;  2QSW A;  1T0T V;  3R5B A;  3GJS B;  2MQO A;  4NCA A;  4LR8 A;  1SKS A;  1MN7 A;  4OHV A;  5DS7 A;  3FDS A;  3PTW A;  2E7V A;  1RTH A;  1Z2L A;  2DR8 A;  2POK A;  4C3K A;  1D9F A;  3QYY A;  1CS4 A;  2QMU B;  2F63 A;  5DQI A;  4LF4 J;  2B5J A;  2DGO A;  2J0S D;  3R7B B;  2B9Y A;  2CQG A;  4NYP A;  2WB1 D;  3MEG A;  1NAQ A;  4LBH A;  4OZ5 A;  2LQ5 A;  2LXU A;  4ZS6 A;  2BW2 A;  1CJU A;  3KK2 A;  2R7U A;  4EU0 A;  3HHL D;  3ZZY A;  5EWF A;  2FJW A;  1I6J A;  1QD1 A;  1QSL A;  2BAN A;  2P9G A;  4D3H A;  2B4O A;  5F8I A;  4DR7 J;  1VJQ A;  1HBM B;  5DQG A;  1EP4 B;  2RAQ A;  2VPY B;  3NKY A;  1F5A A;  1VBY A;  2DRD A;  2HUR A;  3AY0 A;  5KFJ A;  2J76 E;  2LU2 A;  1MRO B;  1RWW B;  1IKV A;  2F3J A;  1K1S A;  1KFS A;  4YEA A;  5F3Z A;  3AQP A;  1NK6 A;  4O3S A;  3UCZ P;  1KC8 T;  2W9B A;  1RT5 A;  1A6L A;  1FJE B;  1S6U A;  5BR8 J;  4NCG B;  5GMK a;  1ZM2 A;  2N3O A;  2G2Z A;  3M8R A;  1NDP A;  4FN5 A;  4DQQ A;  1IBC B;  5ETO A;  1XMQ J;  2FQQ B;  3HF5 A;  2X3D A;  3CJK A;  2KKH A;  2BR0 A;  1IR2 A;  4UOH A;  1RT3 A;  3M2R B;  4LFC J;  1CJV B;  4NMX A;  1C1C A;  2GA7 A;  3DDN A;  4E98 A;  1TFW A;  4MTP A;  3OFE A;  1FWL A;  1UA0 A;  1DFD A;  3ENV A;  3HHL C;  1H3D A;  4R8U A;  4ZCM A;  2DIT A;  3EXY A;  5AE1 A;  1S1X A;  4GVB B;  1Q7L B;  4X64 J;  3FEY B;  1WEY A;  1KRP A;  1HI8 A;  2EC2 A;  5A76 A;  1OIA A;  2F5G A;  3R9L A;  4TNO A;  2H5E A;  4NE9 C;  3FMW A;  3KG0 A;  1CSJ A;  3R5G A;  4O0N A;  4QOT A;  4MYT A;  3EYZ A;  5FLX U;  2R7V A;  1HWJ A;  2ATL A;  3MMB B;  1RQ0 A;  4NA1 A;  1FKO A;  2XG8 A;  2ASY A;  4TVA B;  5LSL A;  4OX6 A;  2MMY A;  3CJ8 A;  4C97 A;  2Q66 A;  2QG9 B;  3FCH A;  1KLM A;  1RWN B;  2GAG C;  4WF9 Q;  1A7G E;  3BN7 A;  2YQ3 A;  4S0M A;  2BMB A;  4OZ1 A;  3EPI A;  2XTJ P;  2ZOM A;  2OPP A;  3MAH A;  2ALY B;  3SIP B;  2QTW A;  2E5G A;  4EYH B;  4LVO P;  3HSD A;  3MGJ A;  3H98 A;  2PMW A;  2YX7 A;  2CPI A;  1WKJ A;  5J1E B;  4USM A;  5LL6 d;  3FSX A;  1HYS A;  1ZTW A;  3GFY A;  4NYZ A;  2QYC A;  4DCO B;  5KFL A;  2E5L F;  3I4H X;  2FY8 A;  1NB7 A;  1YBT A;  4WZM A;  3H25 A;  4YS2 A;  2DHS A;  4K2X A;  4RWW A;  4ES3 A;  4MIB A;  4EZ6 A;  1M5P C;  2R2R A;  1N36 F;  2OSQ A;  5KFN A;  1TK0 A;  2HLT A;  3PW4 A;  2HHQ A;  4CLW A;  3ILL A;  1TKT B;  2BZ2 A;  4I2Q B;  1U1R A;  4PXC A;  3UE2 A;  3BBB A;  2CG4 A;  8RUC A;  3NEK A;  1KS2 A;  3CO9 A;  4UZC A;  4UF4 A;  2EFO A;  1UCN A;  3BQ2 A;  4ZCK A;  1IKX A;  2FB0 A;  3SZ2 A;  4J9P A;  4J9L A;  3D3B J;  5F8L A;  2Z57 B;  2YWW A;  4X66 J;  4DUZ J;  3JYT A;  3BPD A;  1HNZ F;  4ECX A;  4HHH A;  1SCJ B;  3T41 A;  2F40 A;  4PEO A;  2AYE A;  1T05 B;  1HFE L;  3DRY A;  3CIZ A;  1WOR A;  2J0Q D;  3GIK A;  2UUT A;  3I82 A;  1TEL A;  3ELH A;  2UUC F;  3Q8Q B;  2ZJP Q;  2DXF A;  2AT1 B;  3GZ7 A;  3ZTS A;  3FZ2 A;  2NXN A;  1S6Q B;  1S97 A;  3NNA A;  4NA2 A;  2NYH A;  3G82 B;  4Q8F A;  5ETK A;  2D3O 1;  5DLG A;  3KG1 A;  4OYO A;  2BQR A;  2XSF A;  3R6G B;  5KOW A;  1ELO A;  5KT5 A;  1R8A A;  4MKA A;  5KT3 A;  2EI5 A;  3DN9 A;  4LBP A;  5HQL A;  4QR1 A;  2FYX A;  2YNH A;  3PW5 A;  4UT4 A;  2DH9 A;  1U1M A;  3M4X A;  2MB0 B;  4WU2 A;  1JLA A;  3GR1 A;  4QWE A;  5L1J A;  4OYB A;  3M8S A;  5JVG Q;  2W8K A;  4CYU B;  3Q22 A;  4XO0 A;  2R7T A;  2NXC A;  4CT8 A;  2JEJ A;  1G2E A;  5E3C A;  5CZV A;  2HPU A;  2OPS B;  4ID8 A;  1RLC L;  3MM8 B;  1NK0 A;  4U8Y A;  3OR2 A;  2I9S A;  5AXN A;  1Y10 A;  3GV8 B;  5C25 B;  6FD1 A;  1S0V A;  3RRH A;  3L4B C;  3DLK A;  1LQ9 A;  2RU3 A;  1B0P A;  1QUP A;  1WEL A;  2UXB J;  1ZM4 A;  1X5T A;  1RAH B;  2YY3 A;  1R0C B;  1WC1 A;  2ZH9 A;  4DF8 A;  2VF3 A;  3CJR A;  2HBQ B;  3AOB A;  4LSL A;  2AW0 A;  3SSQ A;  2F65 A;  2OD4 A;  1LW0 B;  3Q8Y A;  4ID5 A;  4P2F A;  4B17 A;  4DR1 F;  1GMW D;  3C2P A;  1EHW A;  3MED B;  1LNQ A;  4KC5 A;  5DZ7 A;  4OJH A;  3CDU A;  3QBC A;  4QQB A;  2W24 A;  3W3S A;  3NLC A;  2DHX A;  3MXH P;  3AD9 C;  2BRK A;  3SEO A;  1FDN A;  1T9U A;  3RBD A;  3GV7 B;  3N6N A;  3V6D A;  1UA1 A;  3CJ3 A;  5L1I A;  3U1M A;  2B8Q A;  3OTO F;  1XMO F;  3FJ2 A;  1ZAV A;  4PG5 A;  2KJW A;  5A8K B;  1NXI A;  1WUU A;  3T6J A;  4LF6 J;  4B3M J;  1C1B B;  2X51 A;  3V4I B;  4PQU A;  3NOG A;  5C24 A;  2FJV A;  4DR5 J;  1FE0 A;  3VVU A;  4KHR A;  1QTM A;  2B9X A;  4C3L A;  4O3O A;  3AQO A;  2ZH6 A;  5ETN A;  3GFZ A;  2GIF A;  4UY8 T;  5DO2 A;  2DD8 S;  1OPI A;  2D9O A;  4DSJ A;  2KZZ A;  3BH7 B;  5I42 A;  4AL7 A;  3MM7 B;  3HZG A;  1SKR A;  4J9M A;  4NXN J;  5HBM A;  2QRR A;  4EO8 A;  4EI2 A;  3I5A A;  1X4B A;  3DGP A;  1KQG B;  3QZ8 A;  3UD3 P;  2ZH5 A;  3FFI A;  2IPO B;  3ONQ A;  1IR0 A;  1OPZ A;  1UWB A;  3T1A A;  1LK7 A;  4CO3 A;  3V81 B;  3PRD A;  4PG8 A;  2HWI A;  4DL7 A;  2YH1 A;  4ZN1 A;  3POT B;  4ED7 A;  1NRK A;  2XQC A;  3OR1 B;  1FD8 A;  4DPU A;  4LRF A;  3KK1 B;  2N4C A;  2XCA A;  2J9E A;  2BJ8 A;  2XI2 A;  1SJ4 P;  1RT7 B;  1JX4 A;  3MCN A;  4DR2 F;  1I94 F;  4ZVG A;  1BC6 A;  5KAK A;  4EO6 A;  4DV0 F;  1RTJ A;  3LTO A;  3G6X A;  4X4V A;  2HVH A;  5CCM A;  4NA3 A;  2ZZN A;  2QLX A;  1F5B A;  1RAC B;  3FBB A;  1FJG J;  4I7F A;  1RTH B;  2RQK A;  4ERD A;  4UY8 5;  1T9W A;  3SDE A;  2DEJ A;  1U1O A;  1CS4 B;  1YK9 A;  3DLG A;  2C2R A;  1VDH A;  2B5J B;  1RK8 A;  1VBX A;  3LAK A;  2DRB A;  3MEG B;  3HFV A;  5KFO A;  3RRK A;  5L9X A;  2CZ9 A;  1CJU B;  3KK2 B;  5I4M A;  5D0G A;  1GH8 A;  4NWB A;  4Z7Y A;  3CCS S;  2BAN B;  3TUJ C;  1Q8B A;  1V9O A;  4V19 J;  1SC1 B;  3LGH A;  3M7V A;  3PFE A;  1PC5 A;  3HJV A;  1IBM J;  1EKR A;  5ADZ A;  4Q5V A;  1IKV B;  1S1T B;  4RNM A;  1Q8L A;  5K14 A;  3G87 A;  3KLV A;  3N6M A;  3OT9 A;  2W9B B;  1H7W A;  3G86 A;  1HHT P;  4FYD A;  1YDL A;  1RT5 B;  3T1Y J;  2UXC J;  1TTH B;  1NK5 A;  5LMN J;  2UU9 J;  4Y00 A;  4FYW B;  4M5I A;  3CJK B;  5KFZ A;  4ZP8 A;  4OZ0 A;  4QW8 A;  3RB3 A;  2VU5 A;  1SJ1 A;  2UP1 A;  1U48 A;  1RT3 B;  2X3G A;  3MEK A;  1C1C B;  4ZVT B;  2ROP A;  2HS3 A;  4R8U B;  3W2W B;  3GQC A;  3MPV A;  1S1X B;  1VI7 A;  1V3S A;  3TRG A;  4OYM A;  1F9H A;  4CLL A;  1TFY A;  3HMJ G;  4DR3 F;  5K8O A;  4MMO A;  3RYL A;  1L3K A;  4J9R A;  4Y2M A;  1RUS A;  2EG2 A;  1Y9O A;  4H54 A;  2YNI A;  1FKO B;  2KTQ A;  4AE5 A;  1RWU A;  1L3S A;  4ICL A;  5KFY A;  5L1K A;  2RUS A;  5HJX A;  3M30 A;  4PWW A;  1RU1 A;  1KLM B;  3SQG A;  1T03 A;  1XJW B;  1WOP A;  4B9N A;  1Z1Z A;  3W8P A;  5LOQ A;  2U1A A;  1M5K C;  2JLE A;  1X9S A;  2YH0 A;  4ZIV A;  2VA3 A;  2AQ4 A;  4K5S A;  1UVK A;  1NPP A;  3GJQ B;  1S7I A;  4EWT A;  2M0G B;  3QT6 A;  3IR5 B;  4OZN A;  4YQW A;  1OS5 A;  1J5E J;  4I6Y A;  3O6Q A;  2O1P A;  2GNK A;  2NZC A;  1FFG B;  2CXE A;  4KRW A;  5IT9 Y;  4C9D A;  1XR6 A;  1S59 A;  2AZ1 A;  3JQJ A;  1OSD A;  1YJ7 A;  1XR7 A;  3LWM A;  5I3P A;  3AHP A;  1RU2 A;  4PZV A;  3QWP A;  5C2G A;  3TQE A;  4IH6 A;  2WZ1 A;  4G65 A;  4EBE A;  4K8R A;  1AXQ A;  1VLO A;  2EG1 A;  2GJF A;  5KG4 A;  1WKL A;  2AJ4 A;  5H9E J;  1CC8 A;  5L46 A;  2DGQ A;  4JI4 F;  2CDR B;  2V5H G;  2YKM A;  3D7S B;  1URR A;  2CQB A;  5KTQ A;  3LPY A;  5FII A;  4N5S A;  3CJ4 A;  2VJU A;  1KP6 A;  3MPU B;  2ZBI A;  5KG7 A;  3CIM A;  1U0S A;  3ZZO A;  3TZZ A;  3QAE A;  2KG1 A;  1SQE A;  4OYX A;  1W2B R;  1IKX B;  4ZDN A;  4J90 A;  3MUV P;  1X4G A;  1HW9 A;  2F9J A;  1OO0 B;  2MTL A;  4U7C A;  5H9E K;  2ZOG A;  5J1P A;  4FKX A;  1IJF B;  3JYT B;  2RHQ B;  3UQS A;  3B78 A;  1Q1K A;  5EDW A;  1T11 A;  1IBK F;  5AJ3 F;  4M5L A;  2UV8 A;  2BAB A;  4OFZ A;  3C3L A;  3D54 A;  3CMA S;  4P9S A;  1BWV A;  4ZPA A;  2WCX A;  3KLF A;  2HLU A;  3RW6 A;  1FNM A;  4XPC A;  1NDC A;  2R8I A;  2L9W A;  3WX8 A;  8AT1 B;  3KJQ B;  1V5I B;  1MNE A;  4C0H A;  1R8C A;  2E1A A;  3H2U B;  2HSE B;  3J7Y I;  1O0P A;  4WU3 A;  2VZ9 A;  1CVJ A;  3PX6 A;  2OAU A;  5GVQ A;  3T9N A;  2EFP A;  3RBX A;  2DHG A;  3JSM A;  3QWU A;  3HHE A;  2YNH B;  2VQF F;  1I1G A;  3LO3 A;  2DIV A;  1JLA B;  4RUB A;  2ILZ A;  4DZ6 A;  4U9R A;  2FVQ A;  2AP6 A;  3A8E A;  5IQ6 A;  4A8F A;  4DPO A;  2UUB J;  3K0J A;  2CYY A;  4ALZ A;  3Q89 A;  3OR2 B;  1KBR A;  2HNY A;  3Q83 A;  3I56 S;  1SJR A;  3DLK B;  4OYP A;  4Y28 C;  3Q86 A;  2ZWO A;  4DSE A;  2MLX A;  5J1N A;  1UVM A;  1TVR A;  1JNR B;  2VON A;  2ZZM A;  2AGP A;  4M1K A;  1BQM A;  3D6H B;  2ZHB A;  4CO1 A;  1L3U A;  3PJ9 A;  5JXS A;  3UDE A;  3LF0 A;  5CH7 B;  3H90 A;  4ID5 B;  1OSC A;  5CD4 H;  3D66 A;  3UD5 A;  2MHE A;  1U1P A;  3IMQ J;  4I69 A;  1JXV A;  1VOM A;  4AL6 A;  2XWX A;  4DU7 A;  3D4J A;  2A6M A;  4JI2 J;  2DNQ A;  2YKP A;  3GIM A;  4HI2 A;  1W26 A;  3GSI A;  1UET A;  1R27 B;  3IS9 A;  4F25 A;  4F4Z A;  4X4N A;  1RHK B;  4QIV A;  3V6D B;  2VPZ B;  3EZO A;  4U8V A;  1NUE A;  1DTT B;  1UJ5 A;  2Q1L A;  2ZOF A;  3BO2 A;  4RPF A;  1SL0 A;  4PQU B;  1U2C A;  5C24 B;  4IDK A;  3HJF A;  4DR7 F;  3QGG A;  3UVJ A;  1D9A A;  2Q6C A;  1HQ2 A;  2GX8 A;  2QX0 A;  1U1K A;  4OZJ A;  1DJ0 A;  1HLW A;  3OBI A;  5A6P A;  3Q8V A;  1TKX A;  1N32 F;  4M5G A;  4OHW A;  1SJQ A;  2XMV A;  2J0X A;  1TL1 A;  1UFK A;  5I42 B;  2C42 A;  3IWX A;  2GV1 A;  4OLO A;  5HBM B;  2JEI A;  2XI3 A;  4K4U A;  4N8O A;  1RE1 B;  2FZK B;  3OSP A;  3ETM A;  1Q16 B;  2WVF A;  4UOG A;  1XMQ F;  3DGP B;  1GAO A;  3RGI A;  2J5A A;  3EVW A;  4RU2 A;  3FFI B;  1FKP A;  2YX1 A;  2ZHA A;  2OTJ S;  4JI5 J;  2RIJ A;  2V2Q A;  1PYT A;  4HI1 A;  3K5N A;  1DBD A;  3L7P A;  4ZLN A;  2VIH A;  4DN0 A;  4DX8 H;  2FHK A;  2Q43 A;  2HGL A;  2V63 A;  3KFW X;  2FIU A;  4X64 F;  3IBF B;  1Q5V A;  2HBZ B;  1KQF B;  3R27 A;  4K0K J;  2QA1 A;  1XEZ A;  3LAN A;  3P45 B;  4IQM A;  3MM5 A;  2BXJ A;  1Q0N A;  2BBE A;  2EFN A;  1NK8 A;  4DFK A;  3NGK A;  4AL5 A;  1RTJ B;  2AYM A;  4C11 A;  4RX6 A;  4YOE A;  1GX5 A;  1S0M A;  3VAF A;  4AXI A;  4KE5 A;  2VFS A;  4IO1 A;  2Y8W A;  3OFF A;  3CCM S;  2KXN B;  1RHQ B;  2B4P A;  4WFZ A;  1EET A;  3I4P A;  4I7F B;  3HD2 A;  4A8W A;  1VR6 A;  3SDE B;  3BM7 A;  4UQG A;  5KFA A;  1NJZ A;  3EJM A;  4NLV A;  3DLG B;  2YVS A;  1HD1 A;  1ACM B;  4NXM J;  4ED2 A;  2UVR A;  2Z0G A;  5B0G A;  3FGV A;  3T19 A;  3CWJ A;  4ZPD A;  3P5B P;  2IRU A;  3PZP A;  4CT9 A;  2UVV A;  3H40 A;  2MKK A;  2DB1 A;  2HZA A;  4EBC A;  4XPE A;  1UMJ A;  3P8B B;  4ECY A;  4WTO B;  3K2Y A;  2V4R A;  4ETX A;  2DY1 A;  3T5J A;  2MYF A;  1VQM S;  4RLE A;  3UI3 A;  5B0D A;  4JI6 F;  1FRM A;  2KRB A;  5CYQ A;  1YHQ S;  5F8G A;  4ZPV R;  5K14 B;  1IM4 A;  3OXG A;  2MLZ A;  4RNF A;  3IRX A;  4Y0F A;  2EFG A;  3W61 A;  3PCO B;  3MZI A;  2WSE C;  4TYB A;  1NJW A;  2R42 A;  3KLG A;  1APS A;  1PAE X;  2OEM A;  3BQ1 A;  1O8B A;  5G4D A;  1NO8 A;  3LOU A;  2M52 A;  2WBR A;  2R2T A;  2LKZ A;  1JNZ B;  4X66 F;  4DUZ F;  2F8M A;  3MOJ B;  2IYG A;  1QE1 A;  1NEE A;  2HMI A;  4FYV B;  5A0Y A;  1T8E A;  2KH9 A;  2RF2 A;  3T1H F;  3NRB A;  3T9Z A;  2JZ5 A;  2LDI A;  3CUL A;  2AX1 A;  4YY3 J;  3UN5 A;  1UP1 A;  4MT1 A;  4ZKA A;  3MWB A;  2MHN A;  1A9N B;  2C3M A;  5LXR A;  1UTA A;  2MQP A;  2JDJ A;  3HFZ B;  1ZOT A;  1CQM A;  1D09 B;  4MK9 A;  2KYZ A;  4DUT A;  3IG1 A;  3NBP B;  4DV1 J;  2WVC A;  4ICL B;  1U02 A;  1X8D A;  4ILR A;  1X0P A;  2OJ3 A;  3UO0 A;  2MQN A;  2RB7 A;  2I2Y A;  3M30 B;  3SQG B;  4PPD A;  2M9K A;  2K3K A;  4DL5 A;  1T03 B;  3K58 A;  4EZ9 A;  3PJW A;  1P1L A;  4C8M A;  4C7Q A;  3OL9 A;  3TUI C;  2J9D E;  4A47 A;  2KFZ A;  5KFD A;  3C46 A;  2PI4 A;  3ILO A;  1H0H B;  2YBV A;  3PAC A;  1JLE A;  3ILJ A;  2X1A A;  1IXK A;  5AT1 B;  4KH0 B;  4R0E A;  3J81 j;  2B56 A;  4FXV A;  3BKT A;  3A8I A;  2DNZ A;  1HNW J;  4LQ3 A;  2DPJ A;  2DNN A;  2RRA A;  1BGX T;  2DNM A;  1QY7 A;  3OFH A;  2SXL A;  2DR7 A;  1D0E A;  1GNK A;  2UXB F;  1FHT A;  3O2I A;  1U8W A;  4K4Z A;  1OY9 A;  3OJU A;  4DV2 F;  4B9M A;  3OVA A;  3G8Q A;  3O8W A;  1ICE B;  2P5V A;  5AE3 A;  3DCA A;  5ETR A;  4OJ1 A;  3OTB A;  4ER8 A;  2FHJ A;  3OD2 A;  5HAT A;  3M32 A;  3UDV A;  3QO9 B;  2VHG A;  4B9V A;  5DDO C;  2IC3 A;  4U95 A;  4F2S A;  2CQ1 A;  4ZVF A;  2YKM B;  3LA0 A;  1S6P A;  4AXJ A;  2IVY A;  2FVS A;  1DAX A;  4F3M A;  2RNE A;  1JB0 C;  4ECW A;  3PW7 A;  3W1Y C;  4RW9 A;  1QSY A;  2RRB A;  4OHY A;  4QPT A;  2PEB A;  2HS0 A;  5JJB A;  4IOB A;  1FX4 A;  4LSZ B;  4O3N A;  2XY5 A;  5ITH A;  5HP1 A;  1U25 A;  3HP6 A;  1X0F A;  2JHE A;  4LF6 F;  2BEF A;  3DXB A;  1SC6 A;  4YR0 A;  1VBK A;  2CQ0 A;  3ZO7 A;  1KLN A;  2CQD A;  2VA2 A;  4N7T A;  5HMW A;  4P10 A;  3KYL A;  1FVQ A;  3W8G A;  3KLF B;  1HHQ A;  3DFE A;  2VG5 A;  2G9O A;  3NNC A;  1HI1 A;  1C0U A;  3HVA A;  3CO0 P;  3HI9 A;  3CGI A;  2C2O B;  5F8J A;  1WF0 A;  4F2R A;  4ENO A;  2R7R A;  2ZJQ Q;  3H5X A;  1WHW A;  3AXM A;  3KLH A;  3VGT A;  1D8Y A;  1SJF A;  4B9L A;  3E3X A;  2HHT A;  2AF6 A;  5EGY A;  3IC1 A;  3JSM B;  4Q44 A;  1PKU A;  2B9E A;  4OV6 A;  1EX8 A;  3RAX A;  2K8G A;  3OV7 A;  4PWD A;  4ZVR B;  2HHX A;  3P3D A;  3I9V 9;  1RXO B;  4ZP9 A;  2KRR A;  2E1P A;  1SIW B;  1S57 A;  4Z37 A;  1F0X A;  3BDE A;  5ETQ A;  4RW7 A;  4X62 F;  1T3N A;  4KBI A;  2C3Y A;  3BSC A;  2HNY B;  1R8P A;  2A18 A;  2RQC A;  1LV5 A;  4Y2I A;  4J9U E;  1QJH A;  4KFB A;  4CZC A;  1V5V A;  4K4X A;  1N5T A;  4DSK A;  1TVR B;  3M9M B;  3M2U A;  4YN3 B;  1SB6 A;  2P9C A;  2GQ2 A;  4WP8 A;  3RAM A;  3KUH A;  2QL5 B;  2HK3 A;  5KFS A;  3CVK A;  5J2P A;  1YG0 A;  4CH1 A;  4B08 A;  4JI1 F;  1REG X;  1BQX A;  3Q23 A;  5KFQ A;  1FJG F;  1B0T A;  1T9Y A;  3D3C J;  2ZH2 A;  3F56 A;  2G1D A;  4C0B A;  3FRY A;  3HSZ A;  4RNN A;  2X7I A;  1S76 D;  4QR2 A;  2EEY A;  4Z7C A;  4DPT A;  3MD1 A;  1AYE A;  3QAT A;  2AEM A;  2XY6 A;  3GII A;  4JV5 J;  4JI7 F;  3CJQ A;  4KPC A;  5IT0 A;  2RSQ A;  4X4P A;  1MMN A;  2JVR A;  4LF9 F;  1L3V A;  4W98 A;  1DHM A;  1QAX A;  4QR0 A;  4IDK B;  1GEH A;  4KGX B;  4OZ2 A;  4JV2 A;  1F3V A;  4BC7 A;  3UVJ B;  1XMB A;  3DKD A;  2X1B A;  2HFO A;  2E66 A;  2K3I A;  1IBM F;  2DHA A;  5F0U A;  1F9E B;  2HIQ A;  1JKH A;  1RBO B;  5CQG A;  4FS1 A;  1TL1 B;  5CXT A;  3CCU S;  3RTV A;  3BDP A;  1FRH A;  3T5L A;  3I96 A;  1R89 A;  4RNH A;  3MFI A;  1Y5L B;  4M95 A;  4U67 Q;  1CPZ A;  2VBY A;  1IVZ A;  1P27 B;  2I8E A;  3DI6 A;  1FKP B;  5K8M A;  3W63 A;  4HH1 A;  2D3Z A;  4FF2 A;  5JMN A;  1IKW A;  4LF2 A;  2CQ3 A;  3IM8 A;  5I3U A;  2AX0 A;  3CD5 A;  1U24 A;  2C1E B;  5U47 A;  2DPI A;  4XAK A;  2G0I A;  2FJB B;  2RRN A;  3HO1 A;  3N0V A;  3J7A N;  3IA0 A;  3NGT A;  3PG9 A;  2XZW A;  1M90 T;  3RB6 A;  1VQY A;  4LFB J;  5HLF A;  3ISN C;  2DNH A;  3LP2 A;  4NPO A;  4P72 A;  3MM5 B;  3R2D J;  3MR2 A;  3QMQ A;  2RQM A;  5IOL A;  3DC2 A;  4Q45 A;  4DQS A;  4ZVE A;  4K4T A;  4KIA A;  2OD6 A;  3QRR A;  3PVX A;  1FWP A;  2ABY A;  2H5J B;  4C11 B;  3OLA A;  2F8E X;  2A6O A;  3DRR A;  2GHV C;  1YJ9 S;  4DCJ B;  1I3O B;  2R8K A;  2OH2 A;  1EET B;  5LXY A;  2QZ8 A;  2AJ1 A;  2ZH1 A;  1FX2 A;  1QVG R;  2NPF A;  1WSV A;  3PJX A;  3Q8U A;  4A48 A;  5F8M A;  3CCQ S;  2QV6 A;  2LYV A;  3B8H A;  3VAG A;  2IDL A;  2UVW A;  2IBO A;  4B02 A;  1FXL A;  4C8K A;  2HHH J;  7FD1 A;  4FVC A;  1V3R A;  4MKB A;  2E9T A;  1NU4 A;  4F50 A;  1REV A;  1EB0 A;  4X4R A;  2Z30 B;  2EPI A;  3EGZ A;  3M8Z A;  4ANE A;  3THT A;  4K4S A;  2R8G A;  2W2O P;  1XNQ F;  2OP5 A;  2L3M A;  1X4E A;  3AFG A;  4YB1 P;  2Z4P A;  2KM8 B;  2JH3 A;  5CYQ B;  4RNO A;  1HBN B;  3P96 A;  1B99 A;  1AW0 A;  1EAR A;  4OX9 J;  1YI2 S;  1TUV A;  3IRX B;  3OUY A;  4FKY A;  1UAW A;  2UUA J;  1SIZ A;  2C2M B;  4WXW A;  1GMV A;  2RT3 A;  1LW2 A;  3LQV A;  1IJE B;  4DV3 J;  5GAG I;  3EM1 A;  1JMT A;  4QW9 A;  3KLG B;  1TQL A;  3L09 A;  2E5I A;  5IWA J;  4MIW A;  2NXU A;  4JI8 F;  1Q8K A;  2HYI B;  2F4F A;  1N5Q A;  3CSK A;  3D0I E;  3NS5 A;  3CUN A;  2IRY A;  4YFU A;  3KHR A;  3JSB A;  3U1N A;  4DV7 F;  1YTY A;  1VC5 A;  2HMI B;  2JFK A;  4PCQ A;  5A0Y B;  3QT7 A;  4C0O C;  1R3N A;  2RF2 B;  2LEC A;  1YJT A;  3AJ1 A;  2HKE A;  2ZDP A;  2W4C A;  5K20 B;  1FDA A;  3D0G E;  2AIR B;  1N0V C;  3AXK A;  1JLC B;  1J27 A;  5M2R A;  2ZNY A;  2MZJ A;  4DPX A;  1ITP A;  3IAS 9;  4ILM A;  3UWT A;  4ANC A;  3IG1 B;  2JLF A;  4NOH A;  1IWA A;  3FBE A;  2IA0 A;  2YNG B;  4AQY J;  2XM3 A;  1XR5 A;  2NS1 B;  3AAW B;  3AOD A;  5DDQ C;  3AD7 C;  3MDF A;  2QA2 A;  5HL7 Q;  3LP1 A;  2GAH C;  3UW1 A;  4DV0 J;  2V8G A;  2V50 A;  4Y2K A;  4USI A;  1N88 A;  2UUB F;  4USK A;  5FDL A;  3AJ2 A;  3MFH A;  2DO4 A;  3J81 U;  1TL3 A;  2CZV C;  2AEF A;  3K5O A;  1RCX B;  2HWT A;  3J80 Y;  1HAR A;  1BUX A;  1FVS A;  1W7W A;  4DQR A;  4DPY A;  2HHV A;  1LOU A;  2FVC A;  3C6T A;  3ZTO A;  5C2C A;  2FGO A;  1IKY A;  1G7C B;  3VR1 A;  1WHV A;  3JXO A;  1WOO A;  1U2R A;  3MTK A;  3O44 A;  3N5B A;  2P8I A;  3M32 B;  4PYD A;  4ZVU B;  2DHH A;  1Q86 T;  2IC3 B;  1RWO B;  5DRK A;  2XYG B;  1M5O C;  5DGA A;  5J2Q A;  3CCE S;  3NNH A;  5F41 A;  1PBA A;  1S6P B;  4QCL A;  4HL9 A;  2JLG A;  3DXS X;  1X60 A;  2OPR A;  2BDP A;  4C8L A;  2B7B B;  1XC9 A;  4RW9 B;  1N34 J;  1VHF A;  1N5Y A;  3JQK A;  2V4Q A;  5M2P A;  2CFX A;  1KOO A;  1VLY A;  1FRX A;  3K89 A;  3QFH A;  4DDF A;  4F0H A;  2IA6 A;  3LGN A;  1M1H A;  1JXE A;  3PV8 A;  1EIY B;  1JJ2 R;  3SBM A;  2RML A;  3HDS A;  4HKQ A;  5HP1 B;  2MKH A;  5ETL A;  3BYR A;  3MUM P;  1UFL A;  1YZ7 A;  4LFA J;  1SH2 A;  4FBT A;  2KT5 A;  3TUZ C;  3SXL A;  4ED8 A;  1X5S A;  1PJ7 A;  3O1L A;  3EMT A;  3EZU A;  5E5N A;  4MYU A;  4FYX B;  2ZBC A;  5GAE U;  2VG5 B;  4I4B A;  5AXM A;  5A2Q Y;  1C0U B;  3PXG a;  4YUD A;  1KOH A;  4Y2C A;  1R0B G;  2NUU G;  2RS2 A;  1MU2 A;  2A2D A;  1JJH A;  4HDG A;  1AZS A;  1Q5Y A;  1VC6 A;  2OGU A;  1C4A A;  4B9S A;  4FXW A;  3LP0 A;  5HMY A;  3CPW R;  5D4N A;  2C3O A;  3MEE A;  3KLH B;  2M70 A;  2WHO A;  1E6Y A;  3RB4 A;  1TAQ A;  1T3O A;  4KAI A;  1EQ0 A;  4DR3 J;  4WTY A;  4N77 A;  3IR6 B;  2DGT A;  2YKO A;  4J91 A;  1Y4Z B;  1VQ8 S;  2U2F A;  4ED5 A;  3BS9 A;  1MG7 A;  5C42 A;  4PWD B;  2V9K A;  2Z2L A;  2XS5 A;  4JI5 F;  2OEL A;  3N4W A;  5D6G A;  5B0B A;  2ZBP A;  4GKK J;  3UN3 A;  4CLS A;  4LVN P;  1UJ4 A;  4DR4 F;  4XDC A;  2DNY A;  4DV5 J;  2VOD A;  3W62 A;  2YKN A;  5KFE A;  3OSN A;  3CCZ A;  1WTF A;  1X4F A;  1FI4 A;  1YZ6 A;  1S4E A;  5ETT A;  4PXE A;  4K0K F;  2J0W A;  4OIX A;  2CVE A;  1K8A T;  2ZM6 J;  3M2U B;  2KZM A;  1YWX A;  3VGU A;  3ADA C;  2FJD B;  3NGU A;  2D1C A;  5J2P B;  4EGL A;  4LR7 A;  1S4F A;  3LAM A;  2VBZ A;  5DDP C;  3OPK A;  1OY6 A;  4DF4 A;  2FUG 9;  1S9G A;  5B09 A;  5KG1 A;  2D69 A;  3ZTP A;  4MH8 A;  4KH1 B;  3HVT A;  5H9F J;  2MEW A;  4TU8 A;  3D68 A;  3I5C A;  4K4W A;  4RBT A;  2PN6 A;  4NXM F;  4L6V 3;  1CUL A;  4E2F B;  2B6A A;  4MIA A;  3K59 A;  1RTI A;  2QEX S;  1FA0 A;  2ADB A;  4OZ3 A;  3OHB A;  1NND A;  4KY3 A;  1VC0 A;  1RT4 A;  4O4G A;  4IFY A;  2LCW A;  5D8H B;  2ATC B;  2JRS A;  4RW8 A;  5H9F K;  3RZA A;  3EE3 A;  4CP5 A;  4F04 B;  4RU9 A;  1IM6 A;  2ZH8 A;  2BJD A;  1S1U A;  1SC4 B;  4DSF A;  4P52 A;  5AJ3 J;  5HAN A;  3X1L B;  1JKH B;  2WK4 A;  5A8R A;  4L3K A;  1F60 B;  3GB0 A;  2WON A;  3HFK A;  3VGS A;  3HT0 A;  2XLK A;  1VQN S;  1VQ5 S;  5IFM A;  1RT2 A;  4DL2 A;  3TNV A;  1DUR A;  4O3P A;  3V4M A;  3H7H B;  4LQ9 A;  4OI1 A;  1IKW B;  1F2H A;  4IFV A;  2E44 A;  3CB4 A;  1FRL A;  5I3U B;  4WIQ A;  1YJW S;  5K5M A;  2CZ4 A;  4EBD A;  4UZB A;  1U8S A;  2HVI A;  1O51 A;  2BV3 A;  4A8M P;  2HHP A;  2MZT A;  2HEK A;  2DXD A;  4C3M A;  5RUB A;  2AJ2 A;  3DOL A;  2V0N A;  1CBK A;  1BY9 A;  2VC1 A;  3PW2 A;  2ALZ A;  1ULR A;  1WJ9 A;  2Z58 B;  3VAI A;  2UUW A;  1X4H A;  2KT2 A;  5HLF B;  4WXO A;  3LP2 B;  2KVI A;  4D3G A;  2PFD A;  1TKD A;  1BLU A;  4ED4 A;  4DX5 A;  2RHS B;  1ZZN A;  1OYE A;  1WKK A;  4QIE A;  4DZD A;  3MAA A;  1WHX A;  4NLS A;  3GFX A;  4A8Q A;  3DRR B;  4AD6 A;  4Y3C A;  4DV1 F;  3M8Y A;  2XEX A;  2XGQ A;  5LT5 A;  1MWQ A;  1B64 A;  3MMJ A;  5KT6 A;  4YB6 A;  3MMA A;  2PA3 A;  5BXI A;  1LFW A;  3J7A 1;  1K0T A;  2B4U A;  1T9X A;  2ZZT A;  2C2K B;  2FVP A;  2IVF B;  1TAU A;  2XSJ B;  1H2V Z;  3CC4 S;  3DLL Q;  2CJX B;  2P2C B;  1HNW F;  5BJR A;  3SI8 A;  2LU1 A;  5BYR A;  2OEK A;  2EFQ A;  1NSA A;  1REV B;  2FLO A;  3T5H A;  2OIH A;  2ZKU A;  4JI3 F;  2VPX B;  5HQM A;  4NZ6 A;  2HZV A;  1Q7Y T;  3U1L A;  4IH7 A;  4IH5 A;  4JI0 J;  5KFH A;  4IRD A;  4N41 A;  2HS4 A;  1HWU A;  2IMO A;  2DO0 A;  3K5M A;  2JWN A;  2HQ3 A;  4A8O A;  3QQC D;  2YX4 A;  5KFI A;  1LW2 B;  4X4S A;  2W7A A;  4ZVH A;  2O67 A;  1L3T A;  1N32 J;  2Z2Z A;  1YLX A;  2KG0 A;  3H2V E;  1HBO A;  2CIM A;  2XO6 A;  3D0H E;  1BE4 A;  2CPH A;  3TVY A; 
#chains in the Genus database with same CATH homology
 1XQI A;  2VU5 A;  3BBF A;  3Q83 A;  2AZ3 A;  3BH6 B;  2B8P A;  2BX6 A;  2NCK L;  1KDN A;  3FCV A;  1MN9 A;  4ENO A;  3B6B A;  3EM1 A;  3VVT A;  4DI6 A;  2DYA A;  3Q86 A;  3GPA A;  3EVO A;  3EVM A;  2DXD A;  3MPD A;  3NGR A;  1NDK A;  1F3F A;  1S59 A;  2AZ1 A;  3BBB A;  3VGT A;  4S0M A;  1MN7 A;  1LWX A;  1S5Z A;  1UCN A;  4DUT A;  1NDP A;  1HLW A;  4UOF A;  2DY9 A;  3Q8U A;  1NSP A;  1NDC A;  2B8Q A;  1PKU A;  3Q8V A;  3JS9 A;  1VYA A;  3EE3 A;  3B54 A;  3WX8 A;  4CP5 A;  1NPK A;  1NSK L;  3EIC A;  3PJ9 A;  3ZTQ A;  3FKB A;  1BUX A;  1NCL A;  1W7W A;  3FCW A;  4UOH A;  3BBC A;  4F36 A;  3EMT A;  1WKJ A;  3PRV A;  3DDI A;  1LEO A;  1WKK A;  4KPC A;  1S57 A;  2DXE A;  2ZUA A;  3VGU A;  1F6T A;  1WKL A;  3VGV A;  2CWK A;  1JXV A;  1PAE X;  3ZTO A;  1NSQ A;  3VVU A;  2HVD A;  1NDL A;  4F4A A;  1NHK L;  3EJM A;  3FBC A;  3ETM A;  3G2X A;  3NGU A;  3NGT A;  4UOG A;  1B4S A;  4W98 A;  1XIQ A;  5CAA A;  3ELH A;  3EVW A;  3FC9 A;  2HVE A;  1HIY A;  3ENA A;  5C7P A;  4ANE A;  3L7U A;  2DXF A;  3VGS A;  3ZTS A;  3ZTR A;  2BEF A;  3R9L A;  4WBF A;  1K44 A;  3DKD A;  5BXI A;  3ZTP A;  1NB2 A;  3BH7 B;  3Q8Y A;  4DZ6 A;  5IOL A;  1BHN A;  4O0N A;  4EK2 A;  4ANC A;  1HHQ A;  1B99 A;  3FBB A;  1ZS6 A;  1NLK L;  1U8W A;  3FBF A;  5CAB A;  1EHW A;  3NGS A;  4AND A;  4C6A A;  3FBE A;  4HR2 A;  2HUR A;  1NUE A;  1BE4 A;  3Q89 A;  4FKY A;  3GP9 A;  4FKX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...