1NLKL

Crystal structure of myxococcus xanthus nucleoside diphosphate kinase and its interaction with a nucleotide substrate at 2.0 angstroms resolution
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
143
structure length
143
Chain Sequence
AIERTLSIIKPDGLEKGVIGKIISRFEEKGLKPVAIRLQHLSQAQAEGFYAVHKARPFFKDLVQFMISGPVVLMVLEGENAVLANRDIMGATNPAQAAEGTIRKDFATSIDKNTVHGSDSLENAKIEIAYFFRETEIHSYPYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Phosphotransferase(po4 as acceptor)
molecule keywords NUCLEOSIDE DIPHOSPHATE KINASE
publication title Crystal structure of Myxococcus xanthus nucleoside diphosphate kinase and its interaction with a nucleotide substrate at 2.0 A resolution.
pubmed doi rcsb
source organism Myxococcus xanthus
total genus 43
structure length 143
sequence length 143
chains with identical sequence R
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 1994-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 1nlkL00
4F36A 4HR2A 2CWKA 1NHKL 2DXDA 1MN7A 2B8PA 3VGUA 1LWXA 3B6BA 1NUEA 3ELHA 4FKYA 1F3FA 5IOLA 4DI6A 3GPAA 3L7UA 4ANEA 3MPDA 5BXIA 3EVMA 1EHWA 1S5ZA 1BHNA 4EK2A 3GP9A 3NGRA 1F6TA 1WKJA 4UOFA 3BH6B 2VU5A 3FBCA 3VGVA 1NSKL 4ANDA 5CAAA 3ENAA 4CP5A 3FCVA 4O0NA 1MN9A 3Q8YA 2HVDA 4DUTA 3R9LA 3VVUA 3EVOA 4S0MA 1HLWA 2NCKL 3NGSA 2AZ1A 3BH7B 3NGTA 2B8QA 3DDIA 3VGTA 1NSQA 2BEFA 4ANCA 3WX8A 3ZTOA 3DKDA 2AZ3A 3FCWA 1VYAA 1UCNA 1NSPA 1NDPA 1HIYA 4FKXA 1WKLA 2BX6A 3EE3A 3Q8VA 3NGUA 3EICA 3EM1A 3ZTPA 1XIQA 3ZTRA 3Q8UA 3EJMA 3ZTSA 5CABA 1NDLA 1BE4A 1S59A 3EMTA 2HURA 2DXFA 3PJ9A 1B99A 3FKBA 1KDNA 3VVTA 3Q86A 1PKUA 1U8WA 4W98A 4KPCA 2DYAA 1JXVA 3Q83A 1NB2A 1NCLA 3FBEA 3VGSA 1XQIA 3ZTQA 4C6AA 1K44A 5C7PA 1NDKA 1W7WA 2HVEA 2ZUAA 3FBFA 3Q89A 4DZ6A 4UOGA 2DY9A 3B54A 3ETMA 3FC9A 3BBFA 1LEOA 1B4SA 4UOHA 4F4AA 3G2XA 1WKKA 1PAEX 1S57A 1ZS6A 1NDCA 3BBBA 1NLKL 4ENOA 3EVWA 3PRVA 1NPKA 3FBBA 1HHQA 2DXEA 1BUXA 3BBCA 3JS9A 4WBFA
chains in the Genus database with same CATH superfamily
1FRIA 1KKHA 2ZM6F 4L3NA 1NHKL 3MM7A 2F7VA 2FLLA 4ZVSB 4UOCA 5GAHI 3KYLA 4ZVFA 3Q2TC 2YWGA 4LF5J 3W65A 4WK1A 1S79A 1N32F 2FY1A 1RWKB 3T1HF 2KXFA 1N36J 3NGTA 3HVAA 4KYZA 1OMSA 4DV0F 3GCWP 2LYVA 2E9ZA 4CO4A 1SL2A 1ZM9A 1P9QC 2F1FA 3GFXA 5ETSA 4I6YA 4DX8H 1EKRA 1GK8A 4OJ1A 1N54B 3BKTA 4QIVA 4O3OA 2IJFA 4WFBQ 3CJ0A 3K2YA 3BQ0A 1RT5B 1Q53A 1J5EF 3AODA 5KT6A 4K2XA 2VQEJ 3LF0A 3R6LB 2CNKB 4Y00A 1IVZA 2N4CA 1SKUB 4PEOA 4QYZK 3I5CA 4I6WA 2HVZA 2WB1D 2J9DE 1GH8A 4LSZB 2FHMA 2E5IA 3U7JA 1S99A 3QT8A 4FZVA 1DARA 2XULA 2P2CB 1MMLA 2FQQB 1F6TA 4BDPA 2HHQA 2L9WA 2A3JA 2NUUG 5L9XA 4NRTA 1RAAB 1RHJB 3MM8A 4ECTA 3OV7A 3O3LA 3OHAA 3CO9A 1YWXA 1QUPA 4K4UA 1AFIA 1N34F 1SJ4P 1HWKA 2E5LJ 2VBZA 5IM0B 2X7IA 4LQ3A 4CDIA 3PX4A 4NLXA 1URRA 1ZOTA 3MDFA 2CDRB 2VKRA 2FLOA 4IYQA 3UVJB 2WSEC 1RTZA 5D4NA 1DTTA 3MMCA 3M8RA 5DDRC 3J7YU 2DR6A 3NXZA 5RUBA 5KG5A 3ITHA 2PMWA 4HT7A 1D9DA 4A8WA 2E1CA 5L39A 3M2RB 5T7LB 4ER8A 2CRLA 3JQMA 3W9HA 3AOCA 3L7PA 1FE4A 2CQHA 1ACMB 2WRMA 1JLEB 2QLXA 2YPYA 5DRKA 2MGZB 3L3CA 4ZLLA 2WB4A 4OX9F 2BANA 2XSJB 2ZZMA 4OLOA 2N7YA 2RILA 1TL7A 1OYDA 1FJCA 5EUHA 3SCLE 5DZ6A 3IRXA 1YHQS 3IWLA 3OTBA 1Y11A 1QTNB 5E3CA 1TMMA 2CQ3A 2DCLA 3Q8VA 3IWNC 1PAUB 3ILOA 1K0VA 5AE1A 4HTIA 4RWWA 1OPZA 4DL5A 3PJ9A 5CYMA 2ADBA 1A9NB 4LF7J 1MSWD 3H4BA 4OV6A 1L3UA 1L5UA 5KG0A 2GS8A 5GAEI 2GVDA 2E1RA 3HHDA 1P1TA 2OFHX 2OPSA 2EK1A 3K8VA 4P2FA 1DJ0A 3OT9A 3THVA 2OEKA 3MD3A 2CQCA 3MM6B 1L3KA 2FZCB 2L08A 3TA0A 1RWPB 4DX6A 3Q8QB 4M5JA 4PQAA 2KB2A 1S0VA 1FE0A 4ED2A 4E2FB 2JDJA 3CCSS 2DNMA 1T3NA 5D77A 2ZC4A 2GW8A 2VQFJ 2KM8C 1IBLJ 6FD1A 4EMDA 3OLBA 1S0MA 2RRBA 2ZVIA 4AL7A 2HYIB 2WOMB 4CNZA 4RW8B 2YWHA 1TL1A 2XMTA 2FUG9 3MTKA 3UPFA 1VC0A 3DI6B 1WC6A 4JI5J 4TY8A 1HNIA 3HFZB 1OSDA 4ED4A 3HVWA 1CPZA 4LVOP 1UVMA 2DJWA 3PKYA 5F3ZA 3K5NA 3RBXA 1XNQF 2BJEA 2UV8G 1PG5B 2DBBA 1JK9B 2E7XA 1HW8A 5KFXA 2GIQA 4RW6A 2A0FB 2LECA 4URGA 3GPAA 2KXNB 3I5AA 3H25A 4C97A 1JLQB 2RUGA 2WHOA 3Q8PB 1HBNB 3RRKA 4RW4B 1T11A 2GVZA 1CJKA 3R5BA 1H2VZ 2GHWA 4MJKA 4OFZA 3EVOA 3OUYB 2KL8A 4DPTA 2XM3A 3FEYB 2MHNA 2IYGA 3K17A 1VQMS 3A4TA 5K8OA 2B5JA 3AB4B 2HZCA 4ZPBA 3EE3A 4OX6A 2YH0A 1S6QA 3W8GA 3N6LA 5C24A 4ZHRB 1XIQA 2R7SA 2LP4A 3J7YI 3KLEA 2MYFA 3BEGB 5LMUJ 1NZAA 1SL1A 3AXMA 2OTJS 2C2RA 2AMCB 1C1CB 4XAKA 2Q6CA 3WDOA 1RXOB 3PZPA 1W2IA 4LFCF 8ATCB 4GRSA 1SJRA 4ZVTB 3OFEA 2V2QA 1RT1A 1FRMA 5LMNF 4HHUA 2UU9J 3KJFB 4QCLA 2VH7A 2ASYA 1R43A 4K0KJ 1YIJS 4EWTA 4DSFA 2F9JA 4WCEQ 2UVUA 4A8YA 4ANEA 2XY6A 4LF8F 3KLGA 1S5ZA 4LR7A 2VU5A 5DLFA 2IA0A 2L41A 3WZ0A 4A48A 3ET6B 3EXCX 4K4WA 2C2ZB 3PW5A 3UCZP 3IM9A 1Q8KA 2XO7A 3I5BA 1S48A 3D1HA 3NS7B 2VZ9A 2YH1A 4RJVA 1FFSB 3M1VB 4NMLA 1QVFR 2M7SA 4USTA 5KG4A 2KVIA 2GA7A 1FDAA 1M5PC 2BJ7A 3CJTA 3UWTA 4RW9B 4KY3A 3MPVA 3ZXWA 3CIMA 1LWEB 3MZIA 3FZBA 1YZ7A 2XI3A 4HDHA 4LFBJ 4DPUA 5DG9A 1PILA 2RQCA 3DLKA 1NDKA 3LP1A 2H5JB 1RT3B 4JYAF 1D3WA 2H3EB 1DBDA 3OFGA 1XMQF 1E6YA 4Y34A 4MYTA 4I2QB 5B09A 5LJ5Y 4ZIVA 2DHGA 1M5HA 4Y2CA 3FSXA 3C66A 4DL7A 3L09A 5M2UA 4Y0FA 2FJAB 4U95A 2B6AA 1KOHA 2WW4A 4HHJA 4NWBA 4LRDA 3GONA 2D3ZA 3V6KA 3R7NB 1KQGB 3R27A 1YRTA 2GAGC 2OEJA 4DOZA 5F8JA 2F4VJ 1TUGB 4RW7A 2KRRA 2W2PP 1ZA2B 2IMWP 5J1PA 2B4VA 4UZBA 3WC0A 4ZVUB 3UD3P 2GCFA 2HGLA 2DNYA 5CCLA 3BQ2A 2YKMB 5KT3A 4HKQA 1G4CA 4HI1A 4DFPA 3PW2A 1FX4A 4LJMA 2A2DA 2DD8S 1UJ5A 3IXQA 2V69A 2M5YA 3R5AA 1REVB 2W1BA 1I94J 1N5VA 3M30B 2FHOB 3MEGB 4ZLJA 4KFBB 3M8ZA 1FI4A 2JEJA 3FBEA 1T95A 4PPDA 1WEYA 4PPZA 5DQGA 3DCAA 3GSIA 2ADCA 1C1BB 2FB0A 1NKCA 3VF0B 3GG0A 1RU1A 4ENOA 1UVJA 3D6TB 4OJHA 2B43A 3J81j 2ZH8A 1CJUB 2G2OA 2VFSA 3JYTA 4A8KA 3QLHA 1TV6B 5CQGA 1SI9A 2FPHX 2V2ZA 1X9MA 1N88A 1U0HB 3N28A 3VGVA 4L73A 4X65J 4PG8A 5HSPA 1FVQA 2AGPA 5E33A 3PRDA 1U1LA 1NSQA 2BA9A 4M5DB 2B0GA 4Y2AA 2XWYA 3IR5B 2CQDA 5F41A 5EX3A 4ZPTR 1XNRJ 1KHVA 1RK8A 4LIRA 2MZ1A 2J7KA 1NJWA 3JQJA 1GT8A 2RKIB 5CZXA 4F4KA 4G6VB 4I6AA 4EZ6A 1UFKA 4FF3A 1KVJA 1NPRA 2N3OA 3A3NB 3S01A 3RYLA 3U1NA 1K44A 1N56A 4DZ6A 1KR4A 4OX8A 4F4XA 3MFHA 3GYXB 4DPWA 1UP1A 3RB3A 4MTPA 5E3RA 4B9MA 4NA1A 3AXKA 3DLEB 4JV2A 3LP0A 3I96A 3GJRB 5L46A 2NXNA 3VQTA 1WOPA 5DDQC 2BE2B 1H74A 1BHNA 3J80U 3ULHA 3BH6B 2XTJP 5HI7A 2ATLA 4YOEA 4DDFA 2XMUA 3CT9A 1WF2A 1HQEB 3CC7S 3DM2B 1D09B 1JXLA 1CLFA 3DNCA 2YQ0A 3MF5A 3I9V9 2QA4S 3MUTP 3T1AA 2R7VA 3LO3A 1Q5YA 4DCJB 2IVYA 1TZ0A 4QBUA 4Z7YA 4ZKAA 2YXLA 3P45B 4MKAA 4LR9A 5D3GA 3JTOA 1S7IA 1XMOJ 4X4OA 3IAM9 3VZIA 2AJ4A 1KNZA 4GVBB 1X7VA 3W9IA 1HPZB 4USWA 4LBIA 1B7YB 2EKNA 3J80Y 4PCQA 1HR0F 4RNMA 1ZAWA 2SXLA 1KLMA 1M5VC 3IBFB 4LSNB 1U1RA 1CC7A 1YJ9S 3VZHA 2DK2A 1WHVA 3I31A 1Y5IB 1RWXB 3QGIA 4KH0B 1RBLA 5CYJA 4DLEA 2YY3A 3EZ5A 4A8MP 2YPZA 5L8RC 1R8BA 1JKHB 2M2BA 1CSJA 2FY8A 1ZM3A 1T03B 2F9DA 4ECXA 4ED0A 3AD9C 3AOAA 1IBKF 4Y2MA 3SQGA 2PI4A 2VPYB 2DEJA 1NKBA 4QWAA 2C2KB 1HNWF 3GLJA 3IA0A 1R27B 2ZE2A 4CI0B 1IKWA 1FXDA 3OJSA 4BC9A 4CZCA 2RHQB 2KN4A 1VQOS 1RACB 1HNXF 3TARA 2WBRA 5LSLA 3MM5B 4U67Q 2BXJA 1LW0A 4RO0A 4B9SA 3FQLA 2DCUB 4CO5A 5L1IA 1TL4A 1U2RA 1HHQA 2W9AA 2LU1A 3SSRA 1K1QA 4USKA 1T9YA 2VG5A 3W64A 2IC3B 5ETVA 1RAEB 3W2WB 1WDTA 1X0PA 2OHDA 1MNEA 3ENAA 2EVZA 1YI2S 3MFIA 2WW8A 5KFPA 4CYUA 9ATCB 3HMJG 2D3O1 1O0PA 1XR5A 4C11A 4DV0J 3CMAS 1FFWB 2J9DA 4IDKB 4U8VA 2PIIA 3CJRA 3KG4A 4AL5A 1EAYC 1WACA 3GFYA 3PHEA 4N8NA 5THWA 4DU7A 3HHLB 3D9BA 3HSZA 4F25A 4R8UB 3LAKA 2H54B 1X4FA 3X1LB 1J5EJ 3PEJA 3OD2A 5AE2A 1HQUA 4LRCA 2F65A 2BDPA 1RTHB 5GAGU 3NGDA 1KSPA 2MZRA 3H8YA 3W60A 3KJVB 4R5PB 2DVIA 1ZTWA 3TI0A 4LREA 2CJ9A 1LV5A 2EEYA 3JTNA 2B7CB 3GV8B 3C6TA 2AKWB 2MZTA 4Q44A 3UR3C 4OI6A 1N5YB 1R0BG 2ZJQQ 2QX0A 3DRSB 3BJYA 3I0RB 4QYZJ 2HHTA 2BE9B 2IJRA 3TEGA 1H72C 2XGQA 4Q8EA 2XY5A 3G6YA 1IXKA 2MJUA 1X0FA 4JI3J 1IJFB 1TKZA 2AEFA 1QLNA 5CH7B 3DOMA 3VTIA 1YKWA 1QY7A 5IC6B 2I38A 1M5OC 4ZPDA 3DDNA 3VHQA 1WTBA 3SCKE 1IKYA 2YKQA 1UETA 1SJ1A 2DNPA 5KFZA 4JV5J 2DXFA 4ES3A 4DLGA 4NLTA 4TLQA 4DQPA 3IG1A 2APOA 1QSSA 1VRTA 1VRUA 1EETB 5LT5A 1R0AB 5KFVA 1TL3A 4KGZB 2UUAF 1FEHA 3NY0A 2KT2A 3I32A 4X4TA 2QA1A 1NPKA 3BBCA 5J1NA 2CJXB 3HHNB 2C3UA 3CCZA 2JNJA 1KWMA 1ICEB 1LWXA 4OX9J 2ZH2A 4A8FA 4DG1B 3TAMB 2G0CA 1FRKA 1VHFA 2IBKA 2R8GA 4OIXA 4LF9J 3QRQA 3QGPA 3U1LA 1L3VA 4PQUA 1SKSA 2QSWA 5F8LA 3FSIA 2JSXA 2DNQA 3T6JA 2LXFA 5IQQA 4OHZA 2XNRA 1PJ6A 2ASLA 5SZTA 3KOAA 1RHKB 1WG5A 4NI2A 2VASA 4GO5X 3M8QB 5SUHA 3HM9A 3QPIA 4ES1A 2WSCC 4NCBA 1UVLA 1JQGA 4NRUA 1VQYA 4AQYF 1S12A 2AEMA 2R7UA 3QRRA 2RD5C 3ADAC 1DLOB 2ACMA 1KVKA 2AJ1A 1NCLA 1KFSA 1I51B 3AFGA 3OR1B 3RAQA 3W66A 1BQNA 1NDCA 4KT0C 2WZ1A 3BO2A 5KFCA 3CDUA 1M5SA 1SV5A 5F8MA 1HWUA 2VG7B 3ZNJ1 2NZ4A 5C25A 2MQPA 4QZVB 2J8SA 5KFIA 3HXMA 1B7FA 3VCDA 4C4WA 2FC8A 3OPKA 2R2TA 2G1HA 1ZAXA 2Q66A 4OMFG 2AZ1A 1IBMF 2CJAA 2AWZA 1UTAA 2DT9A 4NXNF 2HHXA 2ZH5A 3MAAB 1S1WA 3PX0A 1BQMB 3G8QA 1NH8A 4EBCA 3IM8A 4E8UA 4F4ZA 3BGFA 2NLWA 3H5YA 4ZCIA 2ZH7A 2DPJA 4FXVA 4HH1A 3DU5A 3DHWC 2R7QA 5GAGI 3DGPB 2VJVA 4FNIA 1XNQJ 1T94A 1FD2A 3D28A 5IV3A 1RWMB 1PSDA 4K4ZA 5ETLA 3JSBA 3G96A 1R0CB 4ELUA 3D7SB 4HHHA 4KO0A 5T14A 3HJVA 2UXBJ 2ROEA 2ACYA 5E3PA 2WONA 2OGUA 4IH7A 4UY85 2ZHOA 2R8HA 1JIHA 2BJ1A 1C0TA 1JXEA 2ZZNA 2GJ2A 3T5KA 1TKDA 3DLJA 5D0RA 2CQGA 1G1XA 2BM1A 1RT2A 4JI2J 4I4BA 3KLIB 3BZQA 3TAPA 3CMQA 1D9FA 4AE5A 3DDIA 4QR1A 2CYYA 4PR6A 6AT1B 3MR6A 2D3UA 2Y3YA 3SV4A 3KKFA 4YEAA 3ISZA 3OVBA 3MMCB 3PX6A 1VK3A 4K4YA 1X4CA 2M4MA 3ITHB 3R8YA 1LK5A 4PAAA 1S77D 4DV6F 3RG6A 1X5SA 4U6PA 1HI8A 1PBAA 1C0UB 4OI3A 4FYXB 4LFCJ 1SIWB 2XS2A 2RS8A 3CGIA 1X4BA 2DHXA 1NB2A 2KTQA 4WP8A 3ZTQA 2Y1RI 2HIYA 5IV4A 1Q79A 5DG8A 1WSRA 2JZ5A 2WVBA 1WELA 2HHPA 2V2KA 5IFMA 3ONQA 2NXUA 3IFEA 3J7ZT 4EI2A 3SCJE 4DN9A 3X3UA 1JWWA 4G1IA 4G1QB 5C5JA 2WVFA 3A8EA 2L48A 5B0FA 3TQEA 1SC3B 3JAMU 3UI3A 1FT8A 2M52A 3EWGA 1WORA 2ZWPA 2QO3A 3ZZZA 5HLFB 2H4YB 3Q8YA 1QE1B 4O23A 1UPMB 1RSCA 3O6QA 2DNRA 3ZNUA 2BQRA 1OYEA 4ZJLA 1MWYA 4K2JA 1RLCL 1PYTA 1IR2A 3WIUA 1R31A 5IM0A 5CYMB 2BJ9A 4YS2A 5M2PA 3PM9A 1ZZFA 3V81B 3ZTPA 4CLYA 1RISA 2V4QA 2ZNZA 3UVJA 2G1DA 1FKOA 4I67A 4HT5A 3Q86A 1WC3A 1N0UA 2JFDA 4ZPWR 4J9MA 2XBPA 3JAMY 2AX1A 4DR6F 2XLKA 4JV1A 3M2RA 3FCHA 1Q7YT 3C16A 5JMNA 3BBFA 1BMQB 1YRXA 1GTEA 1HMVB 4QU7A 1JLEA 4CLUA 2HRUA 4F26A 4O44B 1H73A 1WC1A 1VQSA 2XSJA 4LRAA 2QRRA 3FCVA 1SXLA 1HWJA 1FXLA 2W7PA 3QYYA 3SDEB 3HT0A 1IN0A 4K59A 3DHXA 2E9TA 2WCXA 1LFWA 4OZJA 2AQ4A 1VQKS 2EG1A 4ZVHA 2HVIA 4DSIA 3Q8UA 3D5MA 4ECUA 1LXJA 1YQHA 3L95X 4DV4F 3FRZA 4K4TA 3M9OB 3BR8A 5AXNA 1SJFA 4CLLA 4M5NA 4DV7F 3DLHA 4IFVB 1JXVA 4OHVA 4RW6B 4C8MA 2DGUA 4LSLA 5LJ3Y 2PMZD 2XC9A 3Q22A 2QFJA 4DU8A 3C15A 4KH1B 2E5HA 1WKKA 3S6EA 4DSKA 2J5AA 2U2FA 2CPXA 2DGVA 3QT6A 1BUXA 1LWFB 3MM6A 4C8ZA 3UDLA 1RYSA 3PYDA 1N36F 2GIRA 2MB0B 2JL9A 2VUGA 2VA3A 1ZETA 1NO8A 2WVCA 1F2HA 4DR2J 2KYXA 2YNGB 5GADU 4XK8C 3N6NA 1N52B 2YQ1A 2DIUA 4URSA 1NBEB 1VQ5S 2CQIA 2IM1A 2GMLA 1ITPA 1BQXA 2VONA 5LXYA 2JX2A 4BCAA 3KLEB 2F3JA 1TU0B 2WOMA 2LDYA 3MECB 4RW8A 2IMOA 4F7VA 4NASA 3DI6A 2VQEF 1RAOA 3A12A 1H98A 2YWWA 3GYGA 3TZWA 2EPIA 2D74B 2AYMA 1D8ZA 3VVTA 3NOGA 2HBYB 2C3OA 3O44A 4H4KA 3T9ZA 1FCAA 3C8YA 2L9DA 3IO1A 3GIJA 1Y9OA 2EC2A 3KHLA 1U1KA 1KQFB 4YB5A 1KN6A 2V50A 5F8NA 2HRTA 4P2MA 2V8PA 2EW9A 5DGBA 4C0OC 8AT1B 1ZPVA 1KRPA 1JLQA 2A1BA 3KWMA 1HBNA 3KUHA 2QL9B 4RW4A 4WPAA 4RUCA 1FNMA 5G4DA 1KTVA 1R8HA 4BLGA 5K8NA 1AUSL 2B56A 4FBUA 1N5TA 2O67A 5ETNA 3C14B 3ILLA 3BV8A 3U02A 4C8NA 1TK8A 3FVYA 5GVQA 3RW6A 2VDIA 5KFLA 3IS9B 2LEBA 1Z2ZA 4J9QA 2OPQB 1TL5A 2M9KA 2P8IA 3BSCA 5E41A 3T19A 1C1CA 1WHYA 2ZH6A 4ZOSA 4JUZA 3RGIA 2XY7A 5DM6Q 4RUAA 3BYPA 3MR3A 2NS1B 1WNEA 5B0DA 1ZTTA 4NCGB 1HR0J 3TX8A 5E3QA 2KI2A 3ZZTA 2HQFA 4C8OA 1W25A 3GZ7A 5AJ3F 4J9VA 4Z7CA 3DRRB 1UVIA 3KFWX 2GX8A 1BWEA 2AW0A 2GQ2A 4MK9A 3CDWA 3EDRB 3EDQB 1M5KC 1YBUA 3G8TA 4RW7B 4HYKA 3HHKA 4C2MA 4MK7A 3HHLD 3M8YA 1TUVA 3ET6A 5CAAA 3UCGA 4CLKA 2GQQA 2E7VA 4V19X 3P49B 1NSAA 3W9JA 3DRYA 2MZJA 1IBKJ 2Z4PA 3AA9A 3M1VA 3RUBL 2KFNA 2UZAA 3H40A 2W2MP 4NLOA 3OL7A 4JBCA 2CJKA 1NHUA 1LWEA 1UVKA 4X64J 2HHHJ 3LPYA 4DMZA 3HULA 2K7JA 2PA8D 2RAQA 4I0WA 2XZWA 5FLXU 5C7PA 4ED1A 3B54A 3JYTB 3FC9A 5B0BA 4ELTA 3FEXB 2QT7A 1WHWA 2GO9A 4I2QA 1VIOA 2RH3A 3D6HB 2ZBIA 4NEZA 1Y3JA 1T9TA 4DPYA 1UJ6A 3KNGA 5KFJA 1TR0A 3RU0A 5HP1B 3EGZA 2CQ2A 3AJ2A 5GADI 5HL7Q 2KZMA 2MKYA 3PCOB 1T9XA 4C98A 5CCMA 1R89A 4FYDA 1T3OA 3M6UA 1KTQA 4IO9Q 2IJNA 2YWKA 3M05A 2VC0A 4JI5F 2AZ3A 1GXUA 2J0SD 2YKMA 2JLFA 2ZDPA 5U47A 4OZ5A 3GE9A 3OJUA 2GZOA 1REVA 2P9EA 1UPPA 3M30A 3MEGA 5H9EK 4KFBA 4ZVEA 5KOXA 1WWHA 2M8DB 4L75A 2ZDOA 3ILJA 3LP0B 4X66J 2GIFA 4WIQA 2HFZA 2OJ3A 2H4WB 3QGGA 5A6WA 5KTQA 2F4FA 3BSAA 3BBBA 1XK8A 4DL4A 2HFUA 1CJUA 3OW2R 2HHSA 3FFIB 1RADB 4RLEA 3DOKB 1UZHA 2VA2A 1TV6A 2LA6A 1VHIA 5LOQA 1U0HA 3MEDB 1T9VA 2KG1A 4HTJA 2QGFB 3ENVA 3VAMA 2HZVA 3VVUA 2EBGA 3CMES 4M5DA 1HNZF 4MIAA 2GHVC 4N7TA 4AXJA 3B8HA 1WKLA 5IT9U 3THTA 4N56A 4DS4A 1HNVB 2E1PA 1JB0C 1JLFA 2H65B 2RKIA 3OL9A 3QJPA 4NXMF 3TVYA 2BRLA 2UU9F 4PRFA 2KJVA 4OHXA 4J9UE 2IRXA 5DGAA 4LBHA 3BR9A 2UUAJ 3GFHA 3TX0A 2K2PA 1OY8A 3T5JA 4LIWA 5EHHA 3ZZOA 2YKPA 1WEZA 4K4SA 3T6BA 4GC6A 4RNNA 3DLEA 4CLPA 3QBCA 4ZPAA 4LFAF 4OZNA 5IWAF 2BE2A 4NL5A 4M5LA 1ELOA 4KHRA 3JQKA 4LVNP 4KTQA 1GFWB 1KQKA 5K5MA 1HQEA 3O5TB 3DM2A 2LQ5A 1CQMA 4DWIA 2QL7B 2V6AA 2XLJA 2YWFA 1Z4UA 4LMZA 3NGSA 2CZ4A 2ZE2B 3E2EA 2B8QA 1V3RA 1K0TA 2V0NA 2JHEA 1KONA 4MFBA 2BOPA 3OR2B 3QFWA 1MG7A 3R7BB 3UN5A 3TUIC 1RAHB 2RDIA 4LFBF 1N33F 3HFVA 5ETPA 1LK7A 4CLZA 3Q24A 2MQOA 1IM4A 2CQ1A 1MROB 4B3OB 2YTCA 4IH6A 4GVBA 1DQAA 1HPZA 4YUDA 3OTOF 3VGSA 2LFVA 4C7QA 2R3VA 3PIOQ 2I0XA 2ZUGA 4ZITA 4OYPA 1CULB 1NM2A 4LSNA 3RB0A 3SSQA 3HZGA 4FF2A 1VCTA 5KFEA 3VAJA 2F40A 3PFOA 4HVZA 2HS4A 1NAQA 3MR7A 5HMXA 2DR7A 2ZBRA 4DFMA 2F4VF 2X1FA 2DNGA 2GGPB 3L7UA 2I6WA 1F5AA 1F9HA 3GV7B 2OPRB 2UVVA 1Y0HA 4LF4J 5F8GA 3F73A 3CCJS 1WI6A 2QN6B 3BPSP 3PR5B 3PYGA 4NEYA 4NXNJ 2DY1A 5HQLA 4TXSA 1FEEA 1WTFA 1I94F 2NXJA 2KHCA 4YR3A 4KPYA 1HYSB 3UQSA 3V6DB 2MKJA 2CXEA 1GMUA 8RUCA 1RQ0A 1VQLS 2X3DA 3GJSB 4QPXA 1G7CB 3MM5A 2CQ0A 2KZZA 1XQIA 1SC6A 4MKVA 4WU2A 3QT5A 3PO5A 5ETKA 4LF2A 3QWPA 1WC5A 4QIEA 4B3TJ 3RW7A 4X65F 5I42A 4F4YA 3G6XA 4CH1A 1MN7A 2RF2B 1KD1T 5T41A 2G2YA 2IC3A 3W2WA 2EBEA 4M5KA 1WF0A 4I2PA 4JI1J 4CO1A 1SL0A 3ISNC 1V9OA 1FA0A 2V68A 2LLZA 2HVDA 5JVGQ 2K1RA 2VHGA 3K57A 1IKYB 3C3LA 4V19J 2ASDA 3T9NA 3W3SA 4CH7A 3BDEA 2HAIA 2H51B 3SXLA 2QA4G 5D78A 2CKWA 3ZTRA 2VFUA 5FD1A 1TL3B 4R8UA 1ROFA 2CIMA 4HEA9 1IKXB 2G2ZA 4FS1A 1RHUB 4E98A 4NA3A 2PN6A 3Q83A 3RRHA 1SQGA 1FNOA 4R0JA 3KJVA 3E51A 2ZJPQ 1YLXA 4R5PA 3G2XA 1FDBA 3HVTA 2YBVA 2HS3A 2YKNB 4HACA 4FP9A 3HPOA 3NAIA 3PJWA 3IRWP 4FDFA 4L6V3 4LT6A 1U1OA 2R8JA 4B3MJ 3DRXA 5A2QY 2RDDA 1HL6A 3DRSA 1HD1A 2HWTA 3I0RA 3PRBA 2PSZA 4JI7F 1VR6A 2ILZA 3R5CA 2NUHA 4J9PA 1OY6A 4NI2B 2N3LA 2H9ZA 1SKRA 4KV8A 3DRPB 2KJWA 3MUVP 2QV6A 5J2QB 4DUYJ 3MTJA 3D0IE 3NGKA 1S10A 3NBPB 3FRYA 1PGZA 4DJBA 1IUJA 1RWVB 1Y5LB 2P9GA 4FXDA 3R5GA 5E3AA 1JX4A 2M3DA 3BS9A 3T5HA 1SCJB 5EX0A 1EP4B 3QNWB 1R0AA 1U26A 1GNKA 4YDDB 2BVZA 2ZH4A 4DFKA 3FDSA 5KG6A 3OXFA 1H2UX 5C25B 3MCOA 3CO0P 2PO4A 4DV5J 2HQCA 4IG0B 3FSYA 3D1QA 2XWXA 1S1VB 1NK7A 4AYBD 2CWKA 1HBOB 4DR4J 3MXHP 1U49A 2FIUA 4DG1A 1YVFA 4JOUA 1VBZA 2J0QD 3BSOA 3GCXP 1TQLA 2QE5A 4BC7A 4B9NA 3CUNA 4B3SF 1S1TB 4QW8A 2V8VA 1G2EA 1R8PA 3W2VB 3M2VA 3QAUA 2HNYA 1T9WA 3CJ4A 3I6PA 4PYDA 3MCNA 4DV4J 4JP8A 2EFNA 2LXUA 1U1NA 2KKHA 4LRFA 2EFOA 5KFGA 1ZAVA 2QYGA 3EPGA 3PIPQ 1RCXB 1DLOA 3NCPA 3QWUA 1OO0B 1NK4A 3OXGA 3OR1A 2MKKA 3NNHA 2WONB 1X5TA 4A8OA 4KQZA 3PYFA 5HQMA 2DRDA 1S0OA 4U8YA 4IRDA 1C0TB 4B9LA 4UQTA 5DZ7A 3SI8A 2VG7A 1RT2B 3A3OB 1FDDA 4EBDA 1F3FA 1FJ7A 2CPJA 3LWLA 2W4PA 4ZJQA 1AA1B 3M9NB 2CQBA 4Y28C 1RHRB 3A8KA 1JLCB 2C22A 4Y6IA 3HSDA 3G9CA 1T05A 1Q8IA 1YJRA 3TVKA 4TLRA 2GFFA 4X62F 2HWHA 4D3HA 3OTEA 4RX6A 2MY7A 3MAAA 4G3IA 1BQMA 1U4BA 5A8KA 4HDGA 5HMYA 2X1GA 2EFGA 2YQ3A 1PJ7A 2LXIA 2GMHA 3DGPA 4PZVA 2HW3A 3A8IA 2JFKA 1KQSR 4ZLPA 1UWAA 2LU2A 5K14B 1HI0P 2DGTA 3A13A 4WYLA 2VOOA 3J7AN 1WUUA 4WFAQ 1X4AA 2B9XA 1KP6A 4OL8A 2B8PA 4B3RJ 2F8HA 4FKYA 4NLYA 3K5OA 4JI3F 2HEKA 3MPYA 4DZDA 2LQBA 2VKZG 3KDNA 2LKZA 3KLIA 1UKUA 2LQ9A 2NREA 3MPUB 3HLUA 5FDLB 3MD1A 4PUOB 4JV5F 4K5SA 4IOCQ 3RAXA 2OELA 3SYZA 3CNQP 1FKOB 1RWNB 3CJSA 3UNGC 1SH2A 2Z57B 5DETA 4IQXA 3PW0A 4ILRA 1C0UA 5G0RB 3C16B 3LALA 2UUWA 2YNIB 1UZDA 1XMBA 1N6QB 2J6TA 2QLJB 2CADA 1U6BA 2KM8B 3MR2A 2R2SA 4OX7A 1JJ4A 5AJ3J 4X4UA 1NJZA 1UVNA 4LF9F 4G1QA 3SQOP 4P7TA 3DXBA 2V9WA 4GC7A 3QQCD 4B9VA 5HROB 3N4WA 1O8BA 3CCMS 5HLFA 1NK0A 2W8LA 1QE1A 5E7OB 3P3DA 2YWEA 1KFDA 2YKOA 4PWWA 4OZ1A 2NZCA 1PCAA 3MEEB 2LDIA 3EXYA 2RT3A 4JI8F 5J2NB 3FCWA 1U2CA 3TJ8A 3FZ2A 1VJQA 3V81A 3C46A 4PXEA 3MM9B 1X4EA 4M95A 4LSLB 4ATNA 3W7BA 2N7CA 2LQJA 3Q2SC 3R3TA 3AQPA 7FDRA 3C15B 2HGMA 3MWBA 3D6MB 4AD6A 1PKUA 2JVRA 4UUXA 2DYAA 3HFKA 1S9GA 2NXCA 2ZUAA 4UOGA 1HMVA 5KOWA 5E0OA 1EQ0A 3BYRA 2GQCA 2V94A 3TUPA 3SIPB 5BJRA 4I56A 1RAFB 4UT4A 5HMZA 2CG4A 2IVMA 4O44A 1FJGJ 5GMEA 1RTDB 2DGOA 1AB8A 4ALZA 2YVSA 4MH8A 3N9UC 3UCUP 3LUYA 1XEZA 1UA0A 2H5IB 3KHHA 4DPOA 3D0GE 2HHUA 5M2RA 3SDEA 4FXWA 3DMJB 1DFDA 2RMLA 1R6YA 1X4GA 3CIZA 4A4JA 1C4CA 3C2PA 3ENQA 3H2VE 4ID8A 3JSRA 1EARA 1JLBB 2RVJA 4N76A 3RBZA 4N77A 4L3KA 4CLSA 5CA5A 2IDEA 2DTJA 3FMBA 2AV5A 1MWZA 4DSEA 3TO8A 3IWXA 1U25A 4IFVA 1U47A 4N47A 3A1YG 4ZP9A 2OI2A 5BYQA 5LM7E 2UXBF 1SKWA 1MU2A 2ZZTA 3R2CJ 3V4IB 3MAQA 4A8SA 5D6GA 4F4AA 4WIIA 1FWLA 3VR1A 5F0UA 3LTOA 1LWFA 1I1GA 5H9EJ 4F36A 2DB1A 4ED6A 2GV1A 4NLDA 4JI2F 4YB1P 1TELA 3UNYA 4X4VA 2FJWA 2X1BA 3CF5Q 2FVCA 2DR8A 1CG2A 2UUBF 1RZMA 5A76A 1D8YA 2CPZA 3CD0A 1VK8A 2YNGA 3KLHB 2FHJA 4ILLA 3MI7X 5E5NA 5C42A 4OI2A 5I3UB 4O4RA 5FJ4A 1S0NA 4OYBA 1K47A 1HNZJ 2FJEB 4RBTA 1IKVB 3OVAA 3MECA 2AHOB 2JC0A 4WZMA 3DLGB 4ETXA 3QATA 4NMXA 2JH3A 2B4OA 1NPPA 2RIJA 4NXMJ 5KG2A 3TUZC 2Z2MA 2QSFA 2BJ3A 1X9WA 1S1XB 1OQ6A 2PEHA 4PG4A 4AXIA 3H5SA 2IAJB 4C48A 1KLNA 4F2SA 3K58A 2OPPB 1FDNA 3TZZA 1TFWA 4Y3CA 1K73T 4KB7A 4LFAJ 2Z2LA 3GILA 3FEZA 5IWAJ 1UA1A 2N82B 1R7IA 4WTOB 3B6BA 1L3TA 1Q86T 3QZ7A 2XYGB 4DCPB 2R7WA 4UOFA 2IDLA 2BOAA 2IBOA 5A8WB 3RR7A 3BPDA 1VQPS 3JXOA 2BEFA 2E29A 4OYMA 4WFYA 3C14A 5L1LA 2XHCA 1OJ4A 3H4DA 3GG1A 2ZC3A 3A3PB 1N33J 2NSCA 3IS9A 2OPQA 2MLYA 2CZ9A 5D0HA 3GV5B 1EKSA 1YJVA 3OTOJ 1DURA 4NCGA 1IWAA 1U1MA 3IP0A 1UW9A 1XTZA 4EYHB 4MKBA 4OYAA 1QSLA 1UL3A 3DRRA 2J76E 4ECSA 2MLZA 4IQMA 3ELHA 3POTB 4CLFA 4U96A 4DR3J 2B4UA 2UP1A 5C2CA 3OFFA 5KT4A 4XDDA 2M70A 4ZDNA 1S4FA 2DNKA 1NU4A 1BC6A 2I2YA 4OI1A 2LEPA 4F8RA 2PD1A 3IR6B 3M6WA 4X84A 3CTRA 3SCIE 2ZKUA 3UDEA 1BD6A 3MR5A 3J7Z5 3H42A 2OD4A 4PKDB 5IXUA 3CCLS 1JNZB 1TK0A 2CFXA 4OI4A 4X4NA 3HSJA 3TYTA 2ZOFA 2RRAA 1GMVA 4ZVGA 4EBEA 4M1KA 4PXCA 3N5BA 1UEKA 2V4JB 4W90B 1NH7A 3N0VA 3OL6A 3M2UB 4GKKJ 1FWPA 4DR2F 2BKOA 5HP1A 4X4RA 1S9FA 3P8BB 5F8HA 2W7OA 3LGMA 4C8KA 2D9OA 4W92B 2HK3A 3RAMA 4DSJA 3PACA 1W2BR 2MSTA 2J6UA 4I68A 2VODA 1AYEA 4B08A 1VI7A 3NMRA 4CCHA 1Q82T 5HAOA 3G82A 1VQ4S 1JLFB 3DKDA 5MLCV 2XB2D 1RA6A 1RT6A 3NGUA 4DR1F 3PHTA 3DGVA 1TFYA 2UXDF 1DTQB 3K89A 4O3SA 3AD7C 1O6XA 2LMIA 2OTLS 5HJYA 1ZA1B 4ERDA 4CO3A 1F2GA 5MAOA 3GR0A 3CJKA 5KFQA 1HHTP 4W98A 2XGPA 2P5VA 3VAHA 4R0EA 3DXSX 2UV8A 4JI0J 3H2LA 1FKAF 4CO0A 2MY8A 3G86A 1FXRA 2W7AA 4J9LA 3B4MA 3W5ZA 1OSCA 1B0PA 4P7VA 3NWGA 4JB8B 3FFIA 3L9ZA 3EX7B 3DOKA 2MTLA 2W9BB 1BWVA 2OD6A 3HCXA 2FHKA 3MEDA 4KHPF 1VGYA 4JI7J 1RLDA 1RWUA 2Z58B 3EZUA 4MFBB 4DV3F 1LWCB 1OY9A 2C2MB 1GX5A 4CP5A 4PWDB 2HPUA 2D9PA 4Q7AA 4JV0A 4MAKA 1LNQA 3SEOA 4FVCA 2W2QP 1U8SA 5IZHA 3P6YC 4FKXA 4WZQA 1HNVA 4DQIA 1NEEA 1HWLA 4I1TA 4ED8A 4C3KA 4BS2A 1EQMA 1FK9B 1NHVA 2HVHA 2QLWA 4ZP7A 3H98A 4WYWA 4D3GA 5D4LA 2YX7A 2WSFC 1A7GE 3D6FB 4ZVRB 4MYUA 2BW7A 2X3GA 1RJJA 4DR7J 2RNEA 1FHTA 1ZH5A 1RAJA 4RWXA 4UOHA 5D0EA 2OFGX 3LP2B 4MK8A 1QTMA 2BV3A 5HVFA 1UEUA 1PC4A 3AY0A 2PA3A 2PEBA 5GMKa 1T7PA 3US5A 2VPXB 3CB4A 4UW2A 5K20B 4B3SJ 2N4DA 4RPFA 5C2GA 2UUTA 4H54A 1VLOA 3TAQA 5HBMB 4QIGA 5HO4A 2UXCJ 2HKEA 3GIKA 4J9RA 3H0PA 2G9OA 3OR2A 4USHA 4X64F 3G6VA 2HHHF 2V4RA 3K5PA 3OBIA 4M5MA 5K8MA 1XJWB 4A46A 4KKOB 4F3MA 3MPWA 3KNAA 1NK9A 5KFSA 3JSYA 2HWIA 1MROA 4B3OA 2I5JA 2R8IA 3CCVS 1I3OB 5DS7A 4M63A 3BO4A 5I42B 3R1HA 1H38A 3CCRS 3UE2A 1CULA 4KAIA 1WC0A 3VWSA 1F9FA 3FUYA 4I2PB 1N48A 3P96A 4L72B 1UFLA 1H2TZ 3HKWA 1BY9A 2R2RA 2GGPA 2K1RB 3MMBA 2IIHA 1JLAB 5EWFA 1QM9A 2HBQB 2OPRA 5CXTA 4FVMA 1S1UA 1Q7LB 2HGNA 2COLA 2JOQA 2BMBA 3PFEA 4ZN1A 1YTYA 3HO1A 4JI4J 4WK3A 3RBEA 3VQSA 2XYPB 4X62J 1S9EB 4QWBA 1HYSA 2BABA 1FERA 4PYAA 3V6DA 1FRLA 4U7CA 3VAKA 3DU6A 2V8GA 4WFXA 1K1SA 5HVGA 3KK3A 4X66F 3TRGA 1RHQB 3GJQB 2ZHBA 4C8YA 4G65A 3LWMA 2KHDA 4Y2KA 3HVTB 1FKPB 4UF4A 4HACB 3OVSA 1SQFA 1EB0A 4PG7A 2K3KA 3FBFA 2LEAA 3BO3A 2V67A 3BGOP 2FDNA 3AD8C 2DEIA 3M6VA 1SC1B 2RF2A 4OV1A 4ICLA 3NP5A 1Q5VA 5L1JA 4KV8B 4MKYA 4DL6A 1B0VA 1WKJA 4RZRA 3HF5A 3HVRA 1YJWS 3CCWA 3N01A 3CJ5A 3ZZRA 2PFFB 1S97A 4RBUA 2ATCB 4NX9A 3ZO7A 4QR2A 4DUZF 5KFYA 4TU7A 3CC4S 4ZP8A 3ILIA 4Q5VA 2MJNA 1SB6A 2B9EA 3TR5A 5JUMA 1DZ5A 2KU7A 3M32B 1IKXA 2XZDB 1U6ZA 4AFFA 3FKBA 1XWLA 4ID5B 1RBAA 1YK9A 1RI7A 1FO1A 2YNFB 4ZVQB 3TWZA 1MWQA 4USJC 4U7UD 1T8EA 2AP6A 2HFOA 1LEOA 1PYSB 1B64A 2MLXA 2WBMA 2YKNA 1LW2A 1PBUA 4UZCA 2E9RX 4ZPVR 1BLUA 4J91A 4NLUA 2AJFE 1FF2A 2XQCA 3M2VB 2E7WA 2HNYB 5AXLA 2LVWA 2YX1A 3DRPA 2VDHA 2FTRA 2NCKL 5J2QA 4OZ0A 4Q0BA 4JI8J 3CDEA 2QYCA 3H90A 3M7VA 3NBPA 3ZTOA 4KJIA 4FN5A 2OLWA 4OZ2A 1RUSA 4HH0A 2O1PA 2QZ8A 2A10A 2C3MA 2C1EB 5HK4A 3R2DJ 5D8HB 2R4FA 3MMJA 1S59A 3BGRB 3TA1A 3QFHA 4PXDA 2WTFA 2QL5B 4DV1F 1WG4A 2DHHA 3OSNA 3KK2B 4O4GB 5CHCB 1EP4A 2JEGA 2XMKA 4IRCA 4NLPA 1JLGA 3OHBA 4ZK7M 1M1HA 1K9MT 1YZ6A 2BQUA 1QSYA 1KOOA 2RQKA 4F02A 4NA2A 1TKXB 5EWGA 3L4BC 2AD9A 3UDCA 5KFMA 4PXBA 1VQ9S 4IG0A 1S1VA 3FBBA 1HBOA 1X4HA 4QPTA 3HKZD 4LF4F 4ZCKA 3PVXA 1T05B 3RJMB 4J9SA 3G4SS 5IOLA 7FD1A 2ZFHA 5DDPC 5BXIA 1WDDA 1RABB 2MHEA 1VJWA 2JC1A 1S1TA 1CS4A 1J5OA 3UR0A 3T5LA 2FJDB 2H48B 3W2VA 5A8KB 4DUTA 3TANA 1RP5A 2WVEA 5DDOC 1GXLA 4C0BA 4O3QA 2DNHA 1NJXA 2Y1JA 3QIPA 3FQKA 3KJQB 4KIAA 2POKA 4K4XA 4B9UA 2ERRA 4WFNQ 1Z2LA 2MSSA 5DG7A 4P72A 2VICA 2JJ4D 4P74A 2HFVA 2QC3A 1RT7B 2KT5A 4B3TF 2C28A 2ZNYA 1CBKA 1Q1KA 3MCSA 4OZLA 3KG1A 1S6OA 1XBWA 3BDPA 4MIWA 4JI1F 1S72S 2NPIA 5BR8J 3FK4A 5F8IA 5B0EA 1RDRA 3KDOA 3WBZA 2VFRA 5HJXA 2UUBJ 3LQVA 3LGNA 4USIA 1V5IB 2GHPA 5BYSA 1YJNS 1EHWA 2W2OP 4NPOA 4KBIA 5AT1B 4EYIB 1JLCA 3FBCA 1S6PA 2XLIA 1X31C 5KFHA 3E8OA 1G3OA 1KHWA 1FD8A 1XC9A 4LUBA 1RCOB 5DJBA 4WXOA 1P6TA 2VJUA 3EGVA 2VBXA 3WX8A 2XZTB 2LQ8A 1U2FA 3VV2B 1DQ9A 2Y9HA 3DN9A 4WJBA 4M8LA 2JVOA 1NDLA 1RTJA 4P9SA 2R8KA 5LSOA 3WHIA 2AF6A 4I7FB 4X4QA 3NNCA 2ZBQA 1DQ8A 3J7A1 4IO1A 1SH3A 1N4LA 4USUA 1IJEB 1URNA 2C3PA 1PIEA 5I3PA 5K14A 4B9TA 4H4MB 4B3MF 1FTCA 3GWCA 2QA2A 2NYHA 3W8PA 3BREA 5ADZA 2XSFA 4WE1B 5AXKA 4WKRA 4K5RA 1RYRA 1H7XA 1VQ8S 3HDSA 2CVEA 3QO9B 3B4DA 2RB7A 4BWMA 1OIAA 4DUYF 1VIXA 1WEXA 4TU9A 3K5LA 4JI6F 1XR7A 2B9WA 2VIHA 3RB4A 4H4KC 5FDLA 2DIVA 4PUOA 1S4EA 1XN9A 2BRKA 3W61A 4DR5F 2GMJA 3AA8A 1DAXA 4RU9A 2ZH3A 2NQPA 4DQSA 4TYAA 2R42A 4TN2A 4QYRA 4DV2F 1IR1A 5JXSA 3B82A 2Y1LB 3E3XA 3QIDA 5G0RA 3TW0A 3M8PB 1S9GB 2YNIA 2HZAA 4P10A 1N6QA 3RRGA 3CD6S 4W4MA 4EU0A 4DV5F 3D4JA 3TOQA 4DR4F 2QJ3A 3GFZA 3QAEA 3Q89A 3G8SA 4ZMMA 2J9EA 2IRYA 1B4SA 2AYGA 2PT0A 5KFRA 3DOLB 4C3MA 5A0YB 4P2SA 2W4CA 4PG5A 2RUSA 4LBPA 5HROA 3TP2A 2AJQA 1NRKA 4EK2A 4OLPA 2UUCJ 1U24A 1YG0A 1RTIA 2W9CB 3MEEA 4WWSA 2CPFA 1TKTB 4ZIWA 3V5RA 4TQRA 5J2NA 4CH0S 3AHPA 4FYWB 4ECQA 4FNHA 3MM9A 1T0TV 4KGKA 3WQPA 4QOTA 5KFBA 1TVRA 3C6UB 3J81U 2KXHA 1MU2B 1QJHA 2Y8WA 1CJVB 1FJEB 2IM0A 3OLAA 2XS5A 4CQ1A 3H2UB 3EZOA 2BJDA 2QFIA 3F41A 1W7WA 2HNZA 2VL1A 3MAHA 2DGXA 1P1LA 3UN3A 1ZS6A 3PRVA 5KT5A 4HR2A 5C42B 1RTDA 4LF6J 4URQU 4XPCA 3CJ8A 4GVLA 1NB7A 2DR5A 1Y4ZB 4KR0B 1VLYA 4IFYB 5F0WA 4ECZA 1B3TA 1WD6A 3HHEA 3DMJA 4DN0A 3NS6A 3J81Y 3GQCA 3KXDA 2KFYA 3ICLA 4CRJA 1VRQC 1H7WA 1Y7PA 4LR8A 2G4BA 3M8SA 4J37A 3CJQA 2GJFA 4DR1J 1JLBA 2UXDJ 3BB5A 2YKAA 2MQ8A 3V4MA 4P6QA 4NOHA 2QIFA 5DQHA 3AB2B 3KTQA 4OYZA 4OYXA 5KAKA 3UDVA 3JSMA 5ITHA 1HBMB 2IY5B 1F5CA 3V4IA 2HVEA 3AOBA 1HBUB 4B3RF 1CVJA 1YBAA 2DY9A 4Q2MA 1PAEX 4YN3B 4F04B 3QRPA 2HHVA 4K4VA 3CULA 3HD2A 3N6MA 2OH2A 4B17A 2FD2A 4KHPJ 3UD4P 2HNDB 3KK1A 3T41A 4I69A 3WX4A 3NKYA 1NKEA 2IM2A 1NJYA 5HATA 4DV3J 3KLHA 1KBRA 2DH7A 5JVHQ 5I3UA 5GMDA 1IKVA 6FDRA 1ZPWX 1HLWA 4J90A 1U7LA 2J7WA 2J7UA 2HQIA 4CWBA 4BHQA 3DLGA 3NL0A 2V63A 1IBCB 4EFAC 2MQMA 4WKYA 4X4PA 4YY3F 4RNHA 1K8AT 4IG3B 2G13A 2UVRA 2MMYA 3D66A 4DF4A 4CTAB 2IRUA 2OSRA 1S1XA 3QSYB 1HKAA 2IAJA 2CNLB 3CSKA 1ZM4A 3BGLA 2OPPA 2HMIB 4FF4A 4O3NA 4NLGA 1NK6A 4NLSA 4Q2LA 4ZS6A 2FJXA 4A8XA 2V8HA 4QIFA 2CPEA 2NSBA 5A8WA 2ZOGA 4H4OB 1J27A 1S6UA 1X8DA 1UEVA 1LOUA 3SBMA 1E6VA 3TUJC 1S49A 4Z37A 4J7CA 1FTRA 2HSEB 3ETOA 5CYQA 3F44A 1CEZA 3Q23A 1J2VA 1F9EB 2DR9A 2DNLA 4O3RA 5ETRA 4USVA 4OI0A 4KGVB 4DS5A 4AL6A 3W5YA 3LANA 4K50A 2GAHC 2HLTA 4DX5A 2V5HG 2XHWA 3CDAA 1FJGF 2NPFA 2EK6A 4F50A 3GB0A 4P71A 4WU3A 2J9CA 3K0JA 2RU9A 1N8RT 5J2PB 3KLFA 5J1EB 2KT3A 4XPEA 4NZ6A 2AYBA 2BKPA 2E5GA 3POTA 1BXNA 2ZEJA 3MPDA 1JJHA 3G82B 3SMZA 4C3LA 2OUGA 2Y1IA 2XMMA 4E0DA 3SFGA 2ZM6J 1VS3A 1RT6B 1UWBB 1MN9A 4KSEB 3LA0A 3V2UC 2K7KA 4PABA 2Q6BA 1BGXT 1U48A 5HMWA 3W62A 4F4WA 3M4XA 3EYZA 3EM1A 1N32J 3CJKB 4U7UK 5IT0A 3T1HJ 3PG9A 2F63A 3EJMA 3D54A 5CABA 2MQNA 5B08A 5J2MA 2VFVA 1TTHB 2XEXA 3NMAA 2ABYA 2H1YA 2OMLA 1VBYA 1WSVA 1AT1B 4F0KA 3O8WA 2BACA 2HBRB 4B02A 4DL0C 2MQQA 2J8AA 2V4JA 1V3ZA 3SZ2A 3PDNA 3M2UA 1CJTB 5LXRA 3NG8A 3TVZA 1U45A 2DKOB 4ED7A 5DM7Q 1P8GA 4ZPCA 4TVAB 2DHSA 5IC4B 2CNOB 1Q81T 2KVQE 3OL8A 4DUZJ 4IR9A 1T02A 3I55S 3CVKA 3K8WA 4FBTA 1GAOA 1HIYA 5A6PA 3R1LA 1I6JA 3E01B 1DTQA 1QD1A 2DISA 2Q3PA 2XI2A 2XMVA 2HRYA 3VALA 5KG1A 1WC4A 1N34J 3PJXA 1MMDA 4MT1A 3S8SA 2GO8A 1W26A 2E1MC 5H9FK 2ASJA 2EFVA 3D3BJ 2XMAA 4RBVA 2VG6B 2ZD1A 3QSIA 4DXLA 2W9BA 4QW9A 3VGUA 5A8RB 3HHLC 3LPEA 3D0HE 3DYAA 4OJ3A 3SV3A 1PO6A 4ZLNA 1LWCA 2HAFA 1LFPA 4PWDA 1RBOB 3QJJA 1IWGA 1A0OB 7AT1B 5KFWA 4OYOA 4YR0A 4ZN3A 3MUMP 1S7HA 3BGUA 1NSPA 1NDPA 1VQNS 1AZSB 4Z2XA 2I5JB 3UN2A 3LAMA 2YX4A 1FK9A 1QAJA 3NNAA 2J0WA 4DV1J 5D15A 3IGVA 3CD7A 1M0SA 4PWUA 1CQNA 2W8KA 4KPCA 2DGSA 3I0SA 4RUHA 1SVDA 1RT4B 1MLAA 3MMBB 4NLQA 3LP2A 4DR3F 5D4PA 2KRBA 3UFCX 1S76D 4F67A 3K5MA 1S1UB 1GMWD 1IQTA 1ZM2A 4RUBA 2NR0A 1QVGR 3MM7B 3KMSA 2BM0A 2VPZB 4YHHF 1B70B 4GKJF 2C42A 2AEJA 2WK4A 4J9NA 1TP7A 4ILMA 2B51A 4WFZA 3MMAA 2QTWA 5B0AA 5L9NA 3EPIA 2YNHA 1XERA 5HBMA 3D3CJ 4C8LA 2QEXS 3KK3B 2HQDA 2DNNA 5HANA 2MDAA 5KG7A 4YDXA 4HI2A 4N8OA 4EUVA 4KKOA 3W63A 1X4DA 2QMWA 3QMQA 2HURA 2W24A 4YB7A 1RWOB 3FMWA 2FVPA 1SUQA 5CZVA 2QMXA 4F3OA 1GTHA 2ALZA 2HFNA 1UMJA 4GKKF 4N41A 3Q0AA 1NJIT 3NLCA 4ICLB 4FS2A 4Y65A 2Z8QA 1V5VA 2D69A 1SH0A 2FC9A 1H6KX 2PI5A 3T1YF 3GR1A 4YMEA 3SSSA 1LQ9A 5FIIA 1JLAA 2AJ2A 1U6FA 2XG8A 4ZA1A 1FRXA 1Q95G 1KC8T 4YB6A 3NGRA 5A2QU 3CJ2A 1SC4B 4QJVA 4ECVA 4TKTA 5L38A 4TYBA 4S0MA 1OS5A 4QQBA 1MMNA 1S9EA 3MM8B 1YDLA 2F8EX 3H5UA 4WXWA 1P9YA 5F9LA 3WC2A 2B7BB 1VBKA 4G1PA 3N5FA 2R7XA 3AJ1A 2PMHA 1HA1A 1V6HA 4JI0F 1VC6A 3MOZA 1NNDA 1L3SA 1FKPA 1N5QA 5I4MA 1LW2B 2I1RA 3RTVA 1DTTB 5LSRA 1JMTA 3RZAA 5KT7A 4ZJOA 2DPIA 4TNOA 1RWWB 1JJCB 1F1BB 4DL3A 3PR4A 3ETMA 5B0GA 2GNKA 1NXIA 2ZWOA 1RT5A 3KUGA 3M6XA 2RRNA 3QZ8A 1Y3KA 2IPOB 2ZH1A 3KHGA 2W25A 1T9UA 5LMNJ 4Q0BB 2R9LA 3GTYX 3V6JA 2MQLA 4JI6J 4TY9A 2BANB 4RNFA 2Z30B 2D3OR 5KFNA 2RE1A 3ZFVA 2AJ0A 4DR5J 1TL7B 2I9SA 2FJBB 2L3MA 2PDAA 3OSPA 2AT1B 4LF8J 3T3FA 3MOJB 1H3DA 2AGQA 2ILYA 4ES2A 3IRXB 1Q8BA 3HT3A 2FZKB 1FVSA 1JLGB 5F9NA 4ZVPB 4DV2J 3B78A 2ZITA 1PJ5A 4ZCLA 3MCMA 4K8RA 4DR7F 2ZJRQ 3M32A 3EGNA 2FHJD 4ID5A 3I56S 3GJTB 2A6OA 2YNFA 1CC8A 2AU0A 1EIYB 3VAGA 1QDUB 3D68A 2XS7A 2OKQA 4C6AA 1AW0A 1WF1A 2CPYA 3DDKA 2GVDB 1FRJA 3HP6A 5L1KA 1H0HB 2OPSB 2W2NP 2HFSA 3PTWA 4MIBA 1VDHA 3ZZUA 4V1Ak 3JS9A 1CS4B 1J5OB 1EX8A 1IR0A 1FWKA 4JYAJ 4WTYA 4DI6A 5T7LA 4ZVOB 2O3DA 4BWJA 2UXCF 1UJ4A 1XMQJ 1VMBA 4OHYA 3K7RA 4DEZA 3RR8A 2I8EA 4OZ3A 1FX2A 2RQ4A 3QIPB 2QG9B 2CUYA 2MGZA 1RAIB 4OHWA 4J9KA 2HLUA 1U1QA 3NEKA 3VGTA 3BKFA 3I4HX 4XDCA 1WJ9A 1DY3A 1FNXH 4X2BA 5IQ6A 1GEHA 2CJBA 1TMJA 3G87A 3BGRA 1TL1B 2E66A 3KK2A 4O4GA 3AJDA 3L7OA 2XCPA 4TY8B 2C2OB 4O0IA 3TEHB 1HNIB 3CCUS 1FFGB 2Z0GA 4NYOA 1TKXA 2VF3A 2FVSA 3P5BP 4OYIA 5KFUA 2D41A 5ETOA 3IC1A 2H5EA 2F5GA 1S6PB 3NAHA 2MKIA 1YJUA 2FYXA 3LOUA 2RU3A 4JI4F 3QGHA 5DLGA 5KFFA 2FGOA 2V8DA 4ELVA 1RA7A 3V6HA 2QMUB 4LF5F 2PFDA 1F60B 2GVZB 3I82A 1CJKB 1WOSA 2BBEA 3OXLA 1RTJB 3TJAA 1D1UA 2ZBPA 1KVIA 2BX6A 4TQSA 2B5JB 2FLPA 4N5SA 2AGOA 1RAGB 4QR0A 1R8CA 1S6QB 2O5DA 5C24B 3BKUA 2IM3A 3CJ3A 1PC5A 1HI1A 1GQEA 1VISA 2O01C 1KS2A 1KDNA 1RT7A 1C4AA 2OAUA 3WIVA 2M8HA 2K8GA 5D4OA 1UW4A 5JJBA 2AX0A 3IBWA 4UTGA 3GIRA 1RT1B 1ZYQA 4DQQA 4CM2A 1S57A 2Q43A 2R7OA 2C3YA 2DXEA 2EFPA 2MKSA 2KDOA 3O1LA 1OQ3A 2RS2A 1AROP 2HIQA 3OFHA 1M1GA 1PYOB 2K3IA 2EWHA 3GP9A 3O2IA 3KLGB 2QLBB 5I3QA 1U02A 5KFTA 2EFQA 1OWXA 4QWDA 3OQ2A 1C2PA 2ZH9A 1SJQA 4Q8FA 1GMWA 3R5DA 4DL2A 2DRAA 2OP5A 3K59A 4IUFA 2EG2A 3N79A 3BN7A 4YY3J 1IQZA 2E5LF 4LRBA 2HQ3A 3OUYA 1VBXA 3JTPA 4IOAQ 4I7FA 3VAIA 1B99A 2MKHA 3DLLQ 4ZHRA 2VV5A 1F5BA 3ENWA 1MW7A 4CO2A 2DH9A 4ETZA 2P6TA 1B0TA 4H4MA 4LF1A 1JJ2R 3DLKB 1DHMA 3PY8A 4EZ9A 3LP1B 5B0CA 2RJZA 2ROPA 5KT2A 2CDQA 2BUNA 3MURP 1EZZB 3CCES 2F8MA 4WE1A 4EO6A 1E6YB 2A18A 2M88A 1RTIB 1AUDA 2NXEA 4L76A 5KFDA 3QO9A 1VOMA 1HHSA 2HK2A 4U9RA 2B6AB 2DGQA 2FLNA 3W5XA 3PW7A 1QAXA 4OJGA 1RB0A 5F3TA 2XCAA 4O0NA 1APSA 1TVRB 3LW5C 3BH7B 2DRBA 1YBTA 2CPDA 4DHVA 2Y8YA 4FPIA 3EICA 4P2XA 2PE8A 4XTTA 3TNVA 4EGLA 1D0EA 4J5OA 1WHXA 4ECWA 1RKJA 4KRWA 2R2UA 3CE8A 3M8PA 5DO2A 4YQWA 2DGWA 2BE7D 2HNZB 1YX2A 3THPA 1NK5A 2OEMA 4CLTA 2J0XA 4FYVB 5EDWA 1GX6A 2IVFB 3FJ2A 1SJ3P 1HNWJ 4LF7F 3RBDA 3H7HB 2IA6A 2WAQD 2IHR1 5KFAA 1YSJA 2KO1A 4RW9A 2D7SA 3CCQS 3DOLA 4NCAA 4QU6A 2G0JA 1X5OA 1R8AA 5A0YA 1NLKL 1HNXJ 1RE1B 1A6LA 2DITA 1RT3A 2HS0A 4DFJA 4RR5A 3KG0A 2U1AA 3BQ1A 3QLHB 2UVWA 1U1PA 2OMOA 2MPUA 4F3QA 2JLEA 2W9CA 3HJFA 1G6BA 1TKTA 2J6SA 2VQFF 3D1OA 2Y0BB 5K8PA 3CD5A 1IBLF 3EUNA 1X5PA 4I64A 4WP9A 1N5SA 2VPWB 3C6UA 3S1TA 3U1MA 2E44A 5KFKA 4XIUA 3JSMB 2Z56B 5H1SV 1Q78A 3KJNB 1HFEL 3PXGa 1CJVA 1Y5NB 3H20A 1NMEB 1N0VC 3NCRA 1M90T 1HARA 1UFWA 2CQPA 4P73A 4CT8A 3H59A 1O5JA 3R6GB 5BR8F 1RHMB 5FLXY 3NCQA 5BYRA 4USMA 1TK5A 2P9CA 1QAIA 2C2EA 3KK1B 2IFXA 1JNRB 4XO0A 5ETTA 4KGXB 2Z2ZA 2A2CA 2V34A 2BR0A 1F3VA 3A8JA 4CIOA 4J9OA 3AH6A 1NUEA 4NLRA 4QWCA 1GXTA 1C1BA 4IFYA 2WVDA 2HHWA 2ZKTA 3R97A 2L9NA 4IOBA 2G0IA 4M5IA 2Z2YB 1O51A 2VFTA 1HW9A 2K06A 3KUEA 1XR6A 3M9MB 4MMOA 2FVQA 2E5JA 3RB6A 3ISND 1LXNA 4F0HA 2LCWA 1NZ8A 2GC8A 1TAQA 5EWEA 3TJ9A 4NZ0A 1YGYA 3QT7A 3GIIA 2ZOMA 4OQJA 4Q45A 1VC5A 1BE4A 3EMTA 4L74A 3QJLA 2KH9A 2IYIA 4ITSA 4K7QA 2KFZA 1ZZNA 3GMGA 2VD3A 5LMUF 5D3GB 1HBMA 1SQEA 1U8WA 4DCOB 3PO4A 2BJ8A 2RQMA 1HBUA 1V3SA 4R25A 4KHMA 4TU8A 1OPIA 2DHAA 4LQ9A 3DFEA 3ZZPA 5K9FA 2HBZB 2M0GB 2VOPA 4WBFA 1KLMB 2A6MA 2CQ4A 3PEHA 4NZ7A 4K0KF 2HNDA 5H9FJ 1E6VB 2W4DA 4ED3A 2CPHA 4CNYA 1P27B 3IAS9 4CT9A 2XO6A 3TQ1A 3I87A 5CYQB 2X1AA 3D67A 3KHRA 2MXYA 4RKUC 3W1YC 1WG1A 4DF8A 1Q8LA 2DO0A 4ANCA 4YP3A 4ECRA 4F0MA 1QUVA 2XMWA 5EN1A 3CXCR 5IT9Y 4NE9C 4NLWA 1QAYA 3GYNA 3SQGB 4DSLA 3BSNA 3MGJA 4IG3A 2FVRA 2BYCA 5KG3A 5DQIA 1IKWB 2CAJA 4UY8T 4CTAA 3OTCA 1SPBP 3CDBA 2LA4A 5HQ8A 3KLFB 1ZBTA 2HMIA 3FNNA 4ED5A 4NYZA 1LW0B 2CVIA 2XNQA 1SBRA 2QLFB 3GSDA 4AQYJ 3EVWA 3HSGA 1REGX 2UUCF 4FF1A 2R7RA 3TZYA 1FRHA 3LGHA 4QIWD 2DXDA 3PNIA 4YHHJ 4QWEA 4GKJJ 3NRBA 3PYEA 3IN5A 2DO4A 4GO7X 2VG5B 1F0XA 3G6ES 2EI5A 2CPIA 3I9ZA 4H4OA 4NLVA 4ANDA 1NSKL 1DRZA 3BN4A 3UW1A 2KYZA 3R5JB 2V2VA 2JEIA 1I5OB 4CYUB 3Q8RB 3ZZ0A 1SIZA 5J2MB 2EXUA 1VYAA 4C11B 3HK2A 3CC2S 1UCNA 2DNZA 3UD5A 1JKHA 2FJVA 1Q4RA 2CA9A 2P6SA 1T03A 2FZGB 5HVHA 2W01A 3KMQA 3TA2A 1IBMJ 4IKAA 4M5GA 4X4SA 1HD0A 2Q1LA 2OIHA 4KE5A 3DC2A 3UO0A 1VQ7S 2NYIA 2EC0A 2C2DA 3I4PA 2BKNA 4WF9Q 1TAUA 2CJYB 3HI9A 3NOCA 3CCTA 3PW4A 1HQUB 4LF6F 4ZCMA 5J2PA 1TUWA 1HWIA 5J1EA 2CNNB 2MZSA 1Z1ZA 4NYPA 1U09A 5HN0A 3T1YJ 2MKCA 1VFJA 2JLGA 3SFUA 1KEKA 3TZXA 3F56A 3EGWB 1X9SA 1RGVA 3Q8SB 3IBCB 1EJ7L 4Q43A 3BM7A 3C6TB 3MEKA 3ZZYA 1YJTA 5IT4A 1UWBA 4UQGA 5ETMA 3HD1A 2GJIA 5GAHU 5AXMA 4DBQA 3AAWB 4F2RA 2CWXA 3P5TL 3HX9A 4M94A 1TKZB 4YR2A 1VQ6S 5ETQA 3JB9k 2OSQA 3DOMB 4KGMA 3FGVA 3P4UB 1XNRF 5B7WA 3ZTSA 3KLVA 2Q79A 3VAFA 4CM0A 2V9KA 3S7RA 5IS2A 4HLBA 2MEWA 4IDKA 4AUKA 3LH2S 3PKMA 4HL9A 1WI8A 2BZ2A 3NWRA 1NK8A 3IG1B 2ZD1B 4ZP6A 2XMJA 2CJQA 3C19A 1VRTB 1VRUB 2BW2A 3OTDA 3G71S 1U0SA 3HHLA 4DV6J 4CLWA 3CPWR 2JEFA 5KFOA 3DYAB 3MHYA 2VBYA 1LKZA 1CJTA 2JWNA 4IRKA 4O3PA 4ECYA 5D0GA 3AT1B 4EO8A 3DLBA 2XYHB 2VBWA 1RTHA 2HG4A 1Q0NA 4RNOA 1Q16B 3ZC4A 2MZQA 3EVMA 1YJ7A 2RDJA 3U27A 3D2WA 2JRSA 3IMQJ 4DQRA 1ULRA 4A47A 2RSQA 4RU2A 1FESA 4RL1A 4AT1B 4PQUB 3R9LA 3NS5A 4FPRA 1AFJA 2E1AA 1N5YA 2CZVC 4GMKA 4IH5A 3E01A 2ZVSA 4UUWA 2CG8A 2AIRB 1YRUA 2VC1A 3I0SB 2X51A 3M8WA 4BBYA 3CW2C 5AE3A 5E2QA 2D1CA 4P75A 5CD4A 2O66A 4C0HA 3PV8A 2B4PA 1RKIA 3GU0A 1XMOF 2KG0A 3R7SB 1Y00A 4A8QA 2PC6A 1YITS 3AQOA 2B9YA 3F0NA 1HQ2A 4C9DA 1IM6A 4IR1A 2VG6A 1EETA 1BQNB 3MMAB 2YNHB 2C2NA 4DR6J 5A8RA 4P52A 3BF4A 3IGNA 1SV5B 2DNOA 4DX7A 2PGCA 2ZBCA 1UAWA 9RUBA 4FYYB 1R6VA 4WP3A 2ZHAA 2R7TA 5CD4H 3TAMA 3HZEA 1Y10A 2EKYA 4PG6A 2BQ3A 1AXQA 1AZSA 4KC5A 1SUQB 2ROGA 2FGCA 5LL6d 2Y0SD 2AYEA 1R3NA 1RU2A 2ALYB 1S1WB 2DH8A 4EEYA 4OYWA 2OO4A 1WOOA 1M1KT 2RHSB 4Y2IA 4DPXA 3CWJA 3GIMA 1X60A 3M8QA 4YFUA 1RT4A 5EGYA 2VB6A 5GAEU 2HQGA 2B3TB 4M5HA 3H5XA 3CEDA 1D9AA 4DV7J 4KO0B 3IR7B
chains in the Genus database with same CATH topology
4F36A 4HR2A 2CWKA 1NHKL 2DXDA 1MN7A 2B8PA 3VGUA 1LWXA 3B6BA 1NUEA 3ELHA 4FKYA 1F3FA 5IOLA 4DI6A 3GPAA 3L7UA 4ANEA 3MPDA 5BXIA 3EVMA 1EHWA 1S5ZA 1BHNA 4EK2A 3GP9A 3NGRA 1F6TA 1WKJA 4UOFA 3BH6B 2VU5A 3FBCA 3VGVA 1NSKL 4ANDA 5CAAA 3ENAA 4CP5A 3FCVA 4O0NA 1MN9A 3Q8YA 2HVDA 4DUTA 3R9LA 3VVUA 3EVOA 4S0MA 1HLWA 2NCKL 3NGSA 2AZ1A 3BH7B 3NGTA 2B8QA 3DDIA 3VGTA 1NSQA 2BEFA 4ANCA 3WX8A 3ZTOA 3DKDA 2AZ3A 3FCWA 1VYAA 1UCNA 1NSPA 1NDPA 1HIYA 4FKXA 1WKLA 2BX6A 3EE3A 3Q8VA 3NGUA 3EICA 3EM1A 3ZTPA 1XIQA 3ZTRA 3Q8UA 3EJMA 3ZTSA 5CABA 1NDLA 1BE4A 1S59A 3EMTA 2HURA 2DXFA 3PJ9A 1B99A 3FKBA 1KDNA 3VVTA 3Q86A 1PKUA 1U8WA 4W98A 4KPCA 2DYAA 1JXVA 3Q83A 1NB2A 1NCLA 3FBEA 3VGSA 1XQIA 3ZTQA 4C6AA 1K44A 5C7PA 1NDKA 1W7WA 2HVEA 2ZUAA 3FBFA 3Q89A 4DZ6A 4UOGA 2DY9A 3B54A 3ETMA 3FC9A 3BBFA 1LEOA 1B4SA 4UOHA 4F4AA 3G2XA 1WKKA 1PAEX 1S57A 1ZS6A 1NDCA 3BBBA 1NLKL 4ENOA 3EVWA 3PRVA 1NPKA 3FBBA 1HHQA 2DXEA 1BUXA 3BBCA 3JS9A 4WBFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F36 A;  4HR2 A;  2CWK A;  1NHK L;  2DXD A;  1MN7 A;  2B8P A;  3VGU A;  1LWX A;  3B6B A;  1NUE A;  3ELH A;  4FKY A;  1F3F A;  5IOL A;  4DI6 A;  3GPA A;  3L7U A;  4ANE A;  3MPD A;  5BXI A;  3EVM A;  1EHW A;  1S5Z A;  1BHN A;  4EK2 A;  3GP9 A;  3NGR A;  1F6T A;  1WKJ A;  4UOF A;  3BH6 B;  2VU5 A;  3FBC A;  3VGV A;  1NSK L;  4AND A;  5CAA A;  3ENA A;  4CP5 A;  3FCV A;  4O0N A;  1MN9 A;  3Q8Y A;  2HVD A;  4DUT A;  3R9L A;  3VVU A;  3EVO A;  4S0M A;  1HLW A;  2NCK L;  3NGS A;  2AZ1 A;  3BH7 B;  3NGT A;  2B8Q A;  3DDI A;  3VGT A;  1NSQ A;  2BEF A;  4ANC A;  3WX8 A;  3ZTO A;  3DKD A;  2AZ3 A;  3FCW A;  1VYA A;  1UCN A;  1NSP A;  1NDP A;  1HIY A;  4FKX A;  1WKL A;  2BX6 A;  3EE3 A;  3Q8V A;  3NGU A;  3EIC A;  3EM1 A;  3ZTP A;  1XIQ A;  3ZTR A;  3Q8U A;  3EJM A;  3ZTS A;  5CAB A;  1NDL A;  1BE4 A;  1S59 A;  3EMT A;  2HUR A;  2DXF A;  3PJ9 A;  1B99 A;  3FKB A;  1KDN A;  3VVT A;  3Q86 A;  1PKU A;  1U8W A;  4W98 A;  4KPC A;  2DYA A;  1JXV A;  3Q83 A;  1NB2 A;  1NCL A;  3FBE A;  3VGS A;  1XQI A;  3ZTQ A;  4C6A A;  1K44 A;  5C7P A;  1NDK A;  1W7W A;  2HVE A;  2ZUA A;  3FBF A;  3Q89 A;  4DZ6 A;  4UOG A;  2DY9 A;  3B54 A;  3ETM A;  3FC9 A;  3BBF A;  1LEO A;  1B4S A;  4UOH A;  4F4A A;  3G2X A;  1WKK A;  1PAE X;  1S57 A;  1ZS6 A;  1NDC A;  3BBB A;  1NLK L;  4ENO A;  3EVW A;  3PRV A;  1NPK A;  3FBB A;  1HHQ A;  2DXE A;  1BUX A;  3BBC A;  3JS9 A;  4WBF A; 
#chains in the Genus database with same CATH topology
 1FRI A;  1KKH A;  2ZM6 F;  4L3N A;  1NHK L;  3MM7 A;  2F7V A;  2FLL A;  4ZVS B;  4UOC A;  5GAH I;  3KYL A;  4ZVF A;  3Q2T C;  2YWG A;  4LF5 J;  3W65 A;  4WK1 A;  1S79 A;  1N32 F;  2FY1 A;  1RWK B;  3T1H F;  2KXF A;  1N36 J;  3NGT A;  3HVA A;  4KYZ A;  1OMS A;  4DV0 F;  3GCW P;  2LYV A;  2E9Z A;  4CO4 A;  1SL2 A;  1ZM9 A;  1P9Q C;  2F1F A;  3GFX A;  5ETS A;  4I6Y A;  4DX8 H;  1EKR A;  1GK8 A;  4OJ1 A;  1N54 B;  3BKT A;  4QIV A;  4O3O A;  2IJF A;  4WFB Q;  3CJ0 A;  3K2Y A;  3BQ0 A;  1RT5 B;  1Q53 A;  1J5E F;  3AOD A;  5KT6 A;  4K2X A;  2VQE J;  3LF0 A;  3R6L B;  2CNK B;  4Y00 A;  1IVZ A;  2N4C A;  1SKU B;  4PEO A;  4QYZ K;  3I5C A;  4I6W A;  2HVZ A;  2WB1 D;  2J9D E;  1GH8 A;  4LSZ B;  2FHM A;  2E5I A;  3U7J A;  1S99 A;  3QT8 A;  4FZV A;  1DAR A;  2XUL A;  2P2C B;  1MML A;  2FQQ B;  1F6T A;  4BDP A;  2HHQ A;  2L9W A;  2A3J A;  2NUU G;  5L9X A;  4NRT A;  1RAA B;  1RHJ B;  3MM8 A;  4ECT A;  3OV7 A;  3O3L A;  3OHA A;  3CO9 A;  1YWX A;  1QUP A;  4K4U A;  1AFI A;  1N34 F;  1SJ4 P;  1HWK A;  2E5L J;  2VBZ A;  5IM0 B;  2X7I A;  4LQ3 A;  4CDI A;  3PX4 A;  4NLX A;  1URR A;  1ZOT A;  3MDF A;  2CDR B;  2VKR A;  2FLO A;  4IYQ A;  3UVJ B;  2WSE C;  1RTZ A;  5D4N A;  1DTT A;  3MMC A;  3M8R A;  5DDR C;  3J7Y U;  2DR6 A;  3NXZ A;  5RUB A;  5KG5 A;  3ITH A;  2PMW A;  4HT7 A;  1D9D A;  4A8W A;  2E1C A;  5L39 A;  3M2R B;  5T7L B;  4ER8 A;  2CRL A;  3JQM A;  3W9H A;  3AOC A;  3L7P A;  1FE4 A;  2CQH A;  1ACM B;  2WRM A;  1JLE B;  2QLX A;  2YPY A;  5DRK A;  2MGZ B;  3L3C A;  4ZLL A;  2WB4 A;  4OX9 F;  2BAN A;  2XSJ B;  2ZZM A;  4OLO A;  2N7Y A;  2RIL A;  1TL7 A;  1OYD A;  1FJC A;  5EUH A;  3SCL E;  5DZ6 A;  3IRX A;  1YHQ S;  3IWL A;  3OTB A;  1Y11 A;  1QTN B;  5E3C A;  1TMM A;  2CQ3 A;  2DCL A;  3Q8V A;  3IWN C;  1PAU B;  3ILO A;  1K0V A;  5AE1 A;  4HTI A;  4RWW A;  1OPZ A;  4DL5 A;  3PJ9 A;  5CYM A;  2ADB A;  1A9N B;  4LF7 J;  1MSW D;  3H4B A;  4OV6 A;  1L3U A;  1L5U A;  5KG0 A;  2GS8 A;  5GAE I;  2GVD A;  2E1R A;  3HHD A;  1P1T A;  2OFH X;  2OPS A;  2EK1 A;  3K8V A;  4P2F A;  1DJ0 A;  3OT9 A;  3THV A;  2OEK A;  3MD3 A;  2CQC A;  3MM6 B;  1L3K A;  2FZC B;  2L08 A;  3TA0 A;  1RWP B;  4DX6 A;  3Q8Q B;  4M5J A;  4PQA A;  2KB2 A;  1S0V A;  1FE0 A;  4ED2 A;  4E2F B;  2JDJ A;  3CCS S;  2DNM A;  1T3N A;  5D77 A;  2ZC4 A;  2GW8 A;  2VQF J;  2KM8 C;  1IBL J;  6FD1 A;  4EMD A;  3OLB A;  1S0M A;  2RRB A;  2ZVI A;  4AL7 A;  2HYI B;  2WOM B;  4CNZ A;  4RW8 B;  2YWH A;  1TL1 A;  2XMT A;  2FUG 9;  3MTK A;  3UPF A;  1VC0 A;  3DI6 B;  1WC6 A;  4JI5 J;  4TY8 A;  1HNI A;  3HFZ B;  1OSD A;  4ED4 A;  3HVW A;  1CPZ A;  4LVO P;  1UVM A;  2DJW A;  3PKY A;  5F3Z A;  3K5N A;  3RBX A;  1XNQ F;  2BJE A;  2UV8 G;  1PG5 B;  2DBB A;  1JK9 B;  2E7X A;  1HW8 A;  5KFX A;  2GIQ A;  4RW6 A;  2A0F B;  2LEC A;  4URG A;  3GPA A;  2KXN B;  3I5A A;  3H25 A;  4C97 A;  1JLQ B;  2RUG A;  2WHO A;  3Q8P B;  1HBN B;  3RRK A;  4RW4 B;  1T11 A;  2GVZ A;  1CJK A;  3R5B A;  1H2V Z;  2GHW A;  4MJK A;  4OFZ A;  3EVO A;  3OUY B;  2KL8 A;  4DPT A;  2XM3 A;  3FEY B;  2MHN A;  2IYG A;  3K17 A;  1VQM S;  3A4T A;  5K8O A;  2B5J A;  3AB4 B;  2HZC A;  4ZPB A;  3EE3 A;  4OX6 A;  2YH0 A;  1S6Q A;  3W8G A;  3N6L A;  5C24 A;  4ZHR B;  1XIQ A;  2R7S A;  2LP4 A;  3J7Y I;  3KLE A;  2MYF A;  3BEG B;  5LMU J;  1NZA A;  1SL1 A;  3AXM A;  2OTJ S;  2C2R A;  2AMC B;  1C1C B;  4XAK A;  2Q6C A;  3WDO A;  1RXO B;  3PZP A;  1W2I A;  4LFC F;  8ATC B;  4GRS A;  1SJR A;  4ZVT B;  3OFE A;  2V2Q A;  1RT1 A;  1FRM A;  5LMN F;  4HHU A;  2UU9 J;  3KJF B;  4QCL A;  2VH7 A;  2ASY A;  1R43 A;  4K0K J;  1YIJ S;  4EWT A;  4DSF A;  2F9J A;  4WCE Q;  2UVU A;  4A8Y A;  4ANE A;  2XY6 A;  4LF8 F;  3KLG A;  1S5Z A;  4LR7 A;  2VU5 A;  5DLF A;  2IA0 A;  2L41 A;  3WZ0 A;  4A48 A;  3ET6 B;  3EXC X;  4K4W A;  2C2Z B;  3PW5 A;  3UCZ P;  3IM9 A;  1Q8K A;  2XO7 A;  3I5B A;  1S48 A;  3D1H A;  3NS7 B;  2VZ9 A;  2YH1 A;  4RJV A;  1FFS B;  3M1V B;  4NML A;  1QVF R;  2M7S A;  4UST A;  5KG4 A;  2KVI A;  2GA7 A;  1FDA A;  1M5P C;  2BJ7 A;  3CJT A;  3UWT A;  4RW9 B;  4KY3 A;  3MPV A;  3ZXW A;  3CIM A;  1LWE B;  3MZI A;  3FZB A;  1YZ7 A;  2XI3 A;  4HDH A;  4LFB J;  4DPU A;  5DG9 A;  1PIL A;  2RQC A;  3DLK A;  1NDK A;  3LP1 A;  2H5J B;  1RT3 B;  4JYA F;  1D3W A;  2H3E B;  1DBD A;  3OFG A;  1XMQ F;  1E6Y A;  4Y34 A;  4MYT A;  4I2Q B;  5B09 A;  5LJ5 Y;  4ZIV A;  2DHG A;  1M5H A;  4Y2C A;  3FSX A;  3C66 A;  4DL7 A;  3L09 A;  5M2U A;  4Y0F A;  2FJA B;  4U95 A;  2B6A A;  1KOH A;  2WW4 A;  4HHJ A;  4NWB A;  4LRD A;  3GON A;  2D3Z A;  3V6K A;  3R7N B;  1KQG B;  3R27 A;  1YRT A;  2GAG C;  2OEJ A;  4DOZ A;  5F8J A;  2F4V J;  1TUG B;  4RW7 A;  2KRR A;  2W2P P;  1ZA2 B;  2IMW P;  5J1P A;  2B4V A;  4UZB A;  3WC0 A;  4ZVU B;  3UD3 P;  2GCF A;  2HGL A;  2DNY A;  5CCL A;  3BQ2 A;  2YKM B;  5KT3 A;  4HKQ A;  1G4C A;  4HI1 A;  4DFP A;  3PW2 A;  1FX4 A;  4LJM A;  2A2D A;  2DD8 S;  1UJ5 A;  3IXQ A;  2V69 A;  2M5Y A;  3R5A A;  1REV B;  2W1B A;  1I94 J;  1N5V A;  3M30 B;  2FHO B;  3MEG B;  4ZLJ A;  4KFB B;  3M8Z A;  1FI4 A;  2JEJ A;  3FBE A;  1T95 A;  4PPD A;  1WEY A;  4PPZ A;  5DQG A;  3DCA A;  3GSI A;  2ADC A;  1C1B B;  2FB0 A;  1NKC A;  3VF0 B;  3GG0 A;  1RU1 A;  4ENO A;  1UVJ A;  3D6T B;  4OJH A;  2B43 A;  3J81 j;  2ZH8 A;  1CJU B;  2G2O A;  2VFS A;  3JYT A;  4A8K A;  3QLH A;  1TV6 B;  5CQG A;  1SI9 A;  2FPH X;  2V2Z A;  1X9M A;  1N88 A;  1U0H B;  3N28 A;  3VGV A;  4L73 A;  4X65 J;  4PG8 A;  5HSP A;  1FVQ A;  2AGP A;  5E33 A;  3PRD A;  1U1L A;  1NSQ A;  2BA9 A;  4M5D B;  2B0G A;  4Y2A A;  2XWY A;  3IR5 B;  2CQD A;  5F41 A;  5EX3 A;  4ZPT R;  1XNR J;  1KHV A;  1RK8 A;  4LIR A;  2MZ1 A;  2J7K A;  1NJW A;  3JQJ A;  1GT8 A;  2RKI B;  5CZX A;  4F4K A;  4G6V B;  4I6A A;  4EZ6 A;  1UFK A;  4FF3 A;  1KVJ A;  1NPR A;  2N3O A;  3A3N B;  3S01 A;  3RYL A;  3U1N A;  1K44 A;  1N56 A;  4DZ6 A;  1KR4 A;  4OX8 A;  4F4X A;  3MFH A;  3GYX B;  4DPW A;  1UP1 A;  3RB3 A;  4MTP A;  5E3R A;  4B9M A;  4NA1 A;  3AXK A;  3DLE B;  4JV2 A;  3LP0 A;  3I96 A;  3GJR B;  5L46 A;  2NXN A;  3VQT A;  1WOP A;  5DDQ C;  2BE2 B;  1H74 A;  1BHN A;  3J80 U;  3ULH A;  3BH6 B;  2XTJ P;  5HI7 A;  2ATL A;  4YOE A;  4DDF A;  2XMU A;  3CT9 A;  1WF2 A;  1HQE B;  3CC7 S;  3DM2 B;  1D09 B;  1JXL A;  1CLF A;  3DNC A;  2YQ0 A;  3MF5 A;  3I9V 9;  2QA4 S;  3MUT P;  3T1A A;  2R7V A;  3LO3 A;  1Q5Y A;  4DCJ B;  2IVY A;  1TZ0 A;  4QBU A;  4Z7Y A;  4ZKA A;  2YXL A;  3P45 B;  4MKA A;  4LR9 A;  5D3G A;  3JTO A;  1S7I A;  1XMO J;  4X4O A;  3IAM 9;  3VZI A;  2AJ4 A;  1KNZ A;  4GVB B;  1X7V A;  3W9I A;  1HPZ B;  4USW A;  4LBI A;  1B7Y B;  2EKN A;  3J80 Y;  4PCQ A;  1HR0 F;  4RNM A;  1ZAW A;  2SXL A;  1KLM A;  1M5V C;  3IBF B;  4LSN B;  1U1R A;  1CC7 A;  1YJ9 S;  3VZH A;  2DK2 A;  1WHV A;  3I31 A;  1Y5I B;  1RWX B;  3QGI A;  4KH0 B;  1RBL A;  5CYJ A;  4DLE A;  2YY3 A;  3EZ5 A;  4A8M P;  2YPZ A;  5L8R C;  1R8B A;  1JKH B;  2M2B A;  1CSJ A;  2FY8 A;  1ZM3 A;  1T03 B;  2F9D A;  4ECX A;  4ED0 A;  3AD9 C;  3AOA A;  1IBK F;  4Y2M A;  3SQG A;  2PI4 A;  2VPY B;  2DEJ A;  1NKB A;  4QWA A;  2C2K B;  1HNW F;  3GLJ A;  3IA0 A;  1R27 B;  2ZE2 A;  4CI0 B;  1IKW A;  1FXD A;  3OJS A;  4BC9 A;  4CZC A;  2RHQ B;  2KN4 A;  1VQO S;  1RAC B;  1HNX F;  3TAR A;  2WBR A;  5LSL A;  3MM5 B;  4U67 Q;  2BXJ A;  1LW0 A;  4RO0 A;  4B9S A;  3FQL A;  2DCU B;  4CO5 A;  5L1I A;  1TL4 A;  1U2R A;  1HHQ A;  2W9A A;  2LU1 A;  3SSR A;  1K1Q A;  4USK A;  1T9Y A;  2VG5 A;  3W64 A;  2IC3 B;  5ETV A;  1RAE B;  3W2W B;  1WDT A;  1X0P A;  2OHD A;  1MNE A;  3ENA A;  2EVZ A;  1YI2 S;  3MFI A;  2WW8 A;  5KFP A;  4CYU A;  9ATC B;  3HMJ G;  2D3O 1;  1O0P A;  1XR5 A;  4C11 A;  4DV0 J;  3CMA S;  1FFW B;  2J9D A;  4IDK B;  4U8V A;  2PII A;  3CJR A;  3KG4 A;  4AL5 A;  1EAY C;  1WAC A;  3GFY A;  3PHE A;  4N8N A;  5THW A;  4DU7 A;  3HHL B;  3D9B A;  3HSZ A;  4F25 A;  4R8U B;  3LAK A;  2H54 B;  1X4F A;  3X1L B;  1J5E J;  3PEJ A;  3OD2 A;  5AE2 A;  1HQU A;  4LRC A;  2F65 A;  2BDP A;  1RTH B;  5GAG U;  3NGD A;  1KSP A;  2MZR A;  3H8Y A;  3W60 A;  3KJV B;  4R5P B;  2DVI A;  1ZTW A;  3TI0 A;  4LRE A;  2CJ9 A;  1LV5 A;  2EEY A;  3JTN A;  2B7C B;  3GV8 B;  3C6T A;  2AKW B;  2MZT A;  4Q44 A;  3UR3 C;  4OI6 A;  1N5Y B;  1R0B G;  2ZJQ Q;  2QX0 A;  3DRS B;  3BJY A;  3I0R B;  4QYZ J;  2HHT A;  2BE9 B;  2IJR A;  3TEG A;  1H72 C;  2XGQ A;  4Q8E A;  2XY5 A;  3G6Y A;  1IXK A;  2MJU A;  1X0F A;  4JI3 J;  1IJF B;  1TKZ A;  2AEF A;  1QLN A;  5CH7 B;  3DOM A;  3VTI A;  1YKW A;  1QY7 A;  5IC6 B;  2I38 A;  1M5O C;  4ZPD A;  3DDN A;  3VHQ A;  1WTB A;  3SCK E;  1IKY A;  2YKQ A;  1UET A;  1SJ1 A;  2DNP A;  5KFZ A;  4JV5 J;  2DXF A;  4ES3 A;  4DLG A;  4NLT A;  4TLQ A;  4DQP A;  3IG1 A;  2APO A;  1QSS A;  1VRT A;  1VRU A;  1EET B;  5LT5 A;  1R0A B;  5KFV A;  1TL3 A;  4KGZ B;  2UUA F;  1FEH A;  3NY0 A;  2KT2 A;  3I32 A;  4X4T A;  2QA1 A;  1NPK A;  3BBC A;  5J1N A;  2CJX B;  3HHN B;  2C3U A;  3CCZ A;  2JNJ A;  1KWM A;  1ICE B;  1LWX A;  4OX9 J;  2ZH2 A;  4A8F A;  4DG1 B;  3TAM B;  2G0C A;  1FRK A;  1VHF A;  2IBK A;  2R8G A;  4OIX A;  4LF9 J;  3QRQ A;  3QGP A;  3U1L A;  1L3V A;  4PQU A;  1SKS A;  2QSW A;  5F8L A;  3FSI A;  2JSX A;  2DNQ A;  3T6J A;  2LXF A;  5IQQ A;  4OHZ A;  2XNR A;  1PJ6 A;  2ASL A;  5SZT A;  3KOA A;  1RHK B;  1WG5 A;  4NI2 A;  2VAS A;  4GO5 X;  3M8Q B;  5SUH A;  3HM9 A;  3QPI A;  4ES1 A;  2WSC C;  4NCB A;  1UVL A;  1JQG A;  4NRU A;  1VQY A;  4AQY F;  1S12 A;  2AEM A;  2R7U A;  3QRR A;  2RD5 C;  3ADA C;  1DLO B;  2ACM A;  1KVK A;  2AJ1 A;  1NCL A;  1KFS A;  1I51 B;  3AFG A;  3OR1 B;  3RAQ A;  3W66 A;  1BQN A;  1NDC A;  4KT0 C;  2WZ1 A;  3BO2 A;  5KFC A;  3CDU A;  1M5S A;  1SV5 A;  5F8M A;  1HWU A;  2VG7 B;  3ZNJ 1;  2NZ4 A;  5C25 A;  2MQP A;  4QZV B;  2J8S A;  5KFI A;  3HXM A;  1B7F A;  3VCD A;  4C4W A;  2FC8 A;  3OPK A;  2R2T A;  2G1H A;  1ZAX A;  2Q66 A;  4OMF G;  2AZ1 A;  1IBM F;  2CJA A;  2AWZ A;  1UTA A;  2DT9 A;  4NXN F;  2HHX A;  2ZH5 A;  3MAA B;  1S1W A;  3PX0 A;  1BQM B;  3G8Q A;  1NH8 A;  4EBC A;  3IM8 A;  4E8U A;  4F4Z A;  3BGF A;  2NLW A;  3H5Y A;  4ZCI A;  2ZH7 A;  2DPJ A;  4FXV A;  4HH1 A;  3DU5 A;  3DHW C;  2R7Q A;  5GAG I;  3DGP B;  2VJV A;  4FNI A;  1XNQ J;  1T94 A;  1FD2 A;  3D28 A;  5IV3 A;  1RWM B;  1PSD A;  4K4Z A;  5ETL A;  3JSB A;  3G96 A;  1R0C B;  4ELU A;  3D7S B;  4HHH A;  4KO0 A;  5T14 A;  3HJV A;  2UXB J;  2ROE A;  2ACY A;  5E3P A;  2WON A;  2OGU A;  4IH7 A;  4UY8 5;  2ZHO A;  2R8H A;  1JIH A;  2BJ1 A;  1C0T A;  1JXE A;  2ZZN A;  2GJ2 A;  3T5K A;  1TKD A;  3DLJ A;  5D0R A;  2CQG A;  1G1X A;  2BM1 A;  1RT2 A;  4JI2 J;  4I4B A;  3KLI B;  3BZQ A;  3TAP A;  3CMQ A;  1D9F A;  4AE5 A;  3DDI A;  4QR1 A;  2CYY A;  4PR6 A;  6AT1 B;  3MR6 A;  2D3U A;  2Y3Y A;  3SV4 A;  3KKF A;  4YEA A;  3ISZ A;  3OVB A;  3MMC B;  3PX6 A;  1VK3 A;  4K4Y A;  1X4C A;  2M4M A;  3ITH B;  3R8Y A;  1LK5 A;  4PAA A;  1S77 D;  4DV6 F;  3RG6 A;  1X5S A;  4U6P A;  1HI8 A;  1PBA A;  1C0U B;  4OI3 A;  4FYX B;  4LFC J;  1SIW B;  2XS2 A;  2RS8 A;  3CGI A;  1X4B A;  2DHX A;  1NB2 A;  2KTQ A;  4WP8 A;  3ZTQ A;  2Y1R I;  2HIY A;  5IV4 A;  1Q79 A;  5DG8 A;  1WSR A;  2JZ5 A;  2WVB A;  1WEL A;  2HHP A;  2V2K A;  5IFM A;  3ONQ A;  2NXU A;  3IFE A;  3J7Z T;  4EI2 A;  3SCJ E;  4DN9 A;  3X3U A;  1JWW A;  4G1I A;  4G1Q B;  5C5J A;  2WVF A;  3A8E A;  2L48 A;  5B0F A;  3TQE A;  1SC3 B;  3JAM U;  3UI3 A;  1FT8 A;  2M52 A;  3EWG A;  1WOR A;  2ZWP A;  2QO3 A;  3ZZZ A;  5HLF B;  2H4Y B;  3Q8Y A;  1QE1 B;  4O23 A;  1UPM B;  1RSC A;  3O6Q A;  2DNR A;  3ZNU A;  2BQR A;  1OYE A;  4ZJL A;  1MWY A;  4K2J A;  1RLC L;  1PYT A;  1IR2 A;  3WIU A;  1R31 A;  5IM0 A;  5CYM B;  2BJ9 A;  4YS2 A;  5M2P A;  3PM9 A;  1ZZF A;  3V81 B;  3ZTP A;  4CLY A;  1RIS A;  2V4Q A;  2ZNZ A;  3UVJ A;  2G1D A;  1FKO A;  4I67 A;  4HT5 A;  3Q86 A;  1WC3 A;  1N0U A;  2JFD A;  4ZPW R;  4J9M A;  2XBP A;  3JAM Y;  2AX1 A;  4DR6 F;  2XLK A;  4JV1 A;  3M2R A;  3FCH A;  1Q7Y T;  3C16 A;  5JMN A;  3BBF A;  1BMQ B;  1YRX A;  1GTE A;  1HMV B;  4QU7 A;  1JLE A;  4CLU A;  2HRU A;  4F26 A;  4O44 B;  1H73 A;  1WC1 A;  1VQS A;  2XSJ A;  4LRA A;  2QRR A;  3FCV A;  1SXL A;  1HWJ A;  1FXL A;  2W7P A;  3QYY A;  3SDE B;  3HT0 A;  1IN0 A;  4K59 A;  3DHX A;  2E9T A;  2WCX A;  1LFW A;  4OZJ A;  2AQ4 A;  1VQK S;  2EG1 A;  4ZVH A;  2HVI A;  4DSI A;  3Q8U A;  3D5M A;  4ECU A;  1LXJ A;  1YQH A;  3L95 X;  4DV4 F;  3FRZ A;  4K4T A;  3M9O B;  3BR8 A;  5AXN A;  1SJF A;  4CLL A;  4M5N A;  4DV7 F;  3DLH A;  4IFV B;  1JXV A;  4OHV A;  4RW6 B;  4C8M A;  2DGU A;  4LSL A;  5LJ3 Y;  2PMZ D;  2XC9 A;  3Q22 A;  2QFJ A;  4DU8 A;  3C15 A;  4KH1 B;  2E5H A;  1WKK A;  3S6E A;  4DSK A;  2J5A A;  2U2F A;  2CPX A;  2DGV A;  3QT6 A;  1BUX A;  1LWF B;  3MM6 A;  4C8Z A;  3UDL A;  1RYS A;  3PYD A;  1N36 F;  2GIR A;  2MB0 B;  2JL9 A;  2VUG A;  2VA3 A;  1ZET A;  1NO8 A;  2WVC A;  1F2H A;  4DR2 J;  2KYX A;  2YNG B;  5GAD U;  4XK8 C;  3N6N A;  1N52 B;  2YQ1 A;  2DIU A;  4URS A;  1NBE B;  1VQ5 S;  2CQI A;  2IM1 A;  2GML A;  1ITP A;  1BQX A;  2VON A;  5LXY A;  2JX2 A;  4BCA A;  3KLE B;  2F3J A;  1TU0 B;  2WOM A;  2LDY A;  3MEC B;  4RW8 A;  2IMO A;  4F7V A;  4NAS A;  3DI6 A;  2VQE F;  1RAO A;  3A12 A;  1H98 A;  2YWW A;  3GYG A;  3TZW A;  2EPI A;  2D74 B;  2AYM A;  1D8Z A;  3VVT A;  3NOG A;  2HBY B;  2C3O A;  3O44 A;  4H4K A;  3T9Z A;  1FCA A;  3C8Y A;  2L9D A;  3IO1 A;  3GIJ A;  1Y9O A;  2EC2 A;  3KHL A;  1U1K A;  1KQF B;  4YB5 A;  1KN6 A;  2V50 A;  5F8N A;  2HRT A;  4P2M A;  2V8P A;  2EW9 A;  5DGB A;  4C0O C;  8AT1 B;  1ZPV A;  1KRP A;  1JLQ A;  2A1B A;  3KWM A;  1HBN A;  3KUH A;  2QL9 B;  4RW4 A;  4WPA A;  4RUC A;  1FNM A;  5G4D A;  1KTV A;  1R8H A;  4BLG A;  5K8N A;  1AUS L;  2B56 A;  4FBU A;  1N5T A;  2O67 A;  5ETN A;  3C14 B;  3ILL A;  3BV8 A;  3U02 A;  4C8N A;  1TK8 A;  3FVY A;  5GVQ A;  3RW6 A;  2VDI A;  5KFL A;  3IS9 B;  2LEB A;  1Z2Z A;  4J9Q A;  2OPQ B;  1TL5 A;  2M9K A;  2P8I A;  3BSC A;  5E41 A;  3T19 A;  1C1C A;  1WHY A;  2ZH6 A;  4ZOS A;  4JUZ A;  3RGI A;  2XY7 A;  5DM6 Q;  4RUA A;  3BYP A;  3MR3 A;  2NS1 B;  1WNE A;  5B0D A;  1ZTT A;  4NCG B;  1HR0 J;  3TX8 A;  5E3Q A;  2KI2 A;  3ZZT A;  2HQF A;  4C8O A;  1W25 A;  3GZ7 A;  5AJ3 F;  4J9V A;  4Z7C A;  3DRR B;  1UVI A;  3KFW X;  2GX8 A;  1BWE A;  2AW0 A;  2GQ2 A;  4MK9 A;  3CDW A;  3EDR B;  3EDQ B;  1M5K C;  1YBU A;  3G8T A;  4RW7 B;  4HYK A;  3HHK A;  4C2M A;  4MK7 A;  3HHL D;  3M8Y A;  1TUV A;  3ET6 A;  5CAA A;  3UCG A;  4CLK A;  2GQQ A;  2E7V A;  4V19 X;  3P49 B;  1NSA A;  3W9J A;  3DRY A;  2MZJ A;  1IBK J;  2Z4P A;  3AA9 A;  3M1V A;  3RUB L;  2KFN A;  2UZA A;  3H40 A;  2W2M P;  4NLO A;  3OL7 A;  4JBC A;  2CJK A;  1NHU A;  1LWE A;  1UVK A;  4X64 J;  2HHH J;  3LPY A;  4DMZ A;  3HUL A;  2K7J A;  2PA8 D;  2RAQ A;  4I0W A;  2XZW A;  5FLX U;  5C7P A;  4ED1 A;  3B54 A;  3JYT B;  3FC9 A;  5B0B A;  4ELT A;  3FEX B;  2QT7 A;  1WHW A;  2GO9 A;  4I2Q A;  1VIO A;  2RH3 A;  3D6H B;  2ZBI A;  4NEZ A;  1Y3J A;  1T9T A;  4DPY A;  1UJ6 A;  3KNG A;  5KFJ A;  1TR0 A;  3RU0 A;  5HP1 B;  3EGZ A;  2CQ2 A;  3AJ2 A;  5GAD I;  5HL7 Q;  2KZM A;  2MKY A;  3PCO B;  1T9X A;  4C98 A;  5CCM A;  1R89 A;  4FYD A;  1T3O A;  3M6U A;  1KTQ A;  4IO9 Q;  2IJN A;  2YWK A;  3M05 A;  2VC0 A;  4JI5 F;  2AZ3 A;  1GXU A;  2J0S D;  2YKM A;  2JLF A;  2ZDP A;  5U47 A;  4OZ5 A;  3GE9 A;  3OJU A;  2GZO A;  1REV A;  2P9E A;  1UPP A;  3M30 A;  3MEG A;  5H9E K;  4KFB A;  4ZVE A;  5KOX A;  1WWH A;  2M8D B;  4L75 A;  2ZDO A;  3ILJ A;  3LP0 B;  4X66 J;  2GIF A;  4WIQ A;  2HFZ A;  2OJ3 A;  2H4W B;  3QGG A;  5A6W A;  5KTQ A;  2F4F A;  3BSA A;  3BBB A;  1XK8 A;  4DL4 A;  2HFU A;  1CJU A;  3OW2 R;  2HHS A;  3FFI B;  1RAD B;  4RLE A;  3DOK B;  1UZH A;  2VA2 A;  1TV6 A;  2LA6 A;  1VHI A;  5LOQ A;  1U0H A;  3MED B;  1T9V A;  2KG1 A;  4HTJ A;  2QGF B;  3ENV A;  3VAM A;  2HZV A;  3VVU A;  2EBG A;  3CME S;  4M5D A;  1HNZ F;  4MIA A;  2GHV C;  4N7T A;  4AXJ A;  3B8H A;  1WKL A;  5IT9 U;  3THT A;  4N56 A;  4DS4 A;  1HNV B;  2E1P A;  1JB0 C;  1JLF A;  2H65 B;  2RKI A;  3OL9 A;  3QJP A;  4NXM F;  3TVY A;  2BRL A;  2UU9 F;  4PRF A;  2KJV A;  4OHX A;  4J9U E;  2IRX A;  5DGA A;  4LBH A;  3BR9 A;  2UUA J;  3GFH A;  3TX0 A;  2K2P A;  1OY8 A;  3T5J A;  4LIW A;  5EHH A;  3ZZO A;  2YKP A;  1WEZ A;  4K4S A;  3T6B A;  4GC6 A;  4RNN A;  3DLE A;  4CLP A;  3QBC A;  4ZPA A;  4LFA F;  4OZN A;  5IWA F;  2BE2 A;  4NL5 A;  4M5L A;  1ELO A;  4KHR A;  3JQK A;  4LVN P;  4KTQ A;  1GFW B;  1KQK A;  5K5M A;  1HQE A;  3O5T B;  3DM2 A;  2LQ5 A;  1CQM A;  4DWI A;  2QL7 B;  2V6A A;  2XLJ A;  2YWF A;  1Z4U A;  4LMZ A;  3NGS A;  2CZ4 A;  2ZE2 B;  3E2E A;  2B8Q A;  1V3R A;  1K0T A;  2V0N A;  2JHE A;  1KON A;  4MFB A;  2BOP A;  3OR2 B;  3QFW A;  1MG7 A;  3R7B B;  3UN5 A;  3TUI C;  1RAH B;  2RDI A;  4LFB F;  1N33 F;  3HFV A;  5ETP A;  1LK7 A;  4CLZ A;  3Q24 A;  2MQO A;  1IM4 A;  2CQ1 A;  1MRO B;  4B3O B;  2YTC A;  4IH6 A;  4GVB A;  1DQA A;  1HPZ A;  4YUD A;  3OTO F;  3VGS A;  2LFV A;  4C7Q A;  2R3V A;  3PIO Q;  2I0X A;  2ZUG A;  4ZIT A;  4OYP A;  1CUL B;  1NM2 A;  4LSN A;  3RB0 A;  3SSQ A;  3HZG A;  4FF2 A;  1VCT A;  5KFE A;  3VAJ A;  2F40 A;  3PFO A;  4HVZ A;  2HS4 A;  1NAQ A;  3MR7 A;  5HMX A;  2DR7 A;  2ZBR A;  4DFM A;  2F4V F;  2X1F A;  2DNG A;  2GGP B;  3L7U A;  2I6W A;  1F5A A;  1F9H A;  3GV7 B;  2OPR B;  2UVV A;  1Y0H A;  4LF4 J;  5F8G A;  3F73 A;  3CCJ S;  1WI6 A;  2QN6 B;  3BPS P;  3PR5 B;  3PYG A;  4NEY A;  4NXN J;  2DY1 A;  5HQL A;  4TXS A;  1FEE A;  1WTF A;  1I94 F;  2NXJ A;  2KHC A;  4YR3 A;  4KPY A;  1HYS B;  3UQS A;  3V6D B;  2MKJ A;  2CXE A;  1GMU A;  8RUC A;  1RQ0 A;  1VQL S;  2X3D A;  3GJS B;  4QPX A;  1G7C B;  3MM5 A;  2CQ0 A;  2KZZ A;  1XQI A;  1SC6 A;  4MKV A;  4WU2 A;  3QT5 A;  3PO5 A;  5ETK A;  4LF2 A;  3QWP A;  1WC5 A;  4QIE A;  4B3T J;  3RW7 A;  4X65 F;  5I42 A;  4F4Y A;  3G6X A;  4CH1 A;  1MN7 A;  2RF2 B;  1KD1 T;  5T41 A;  2G2Y A;  2IC3 A;  3W2W A;  2EBE A;  4M5K A;  1WF0 A;  4I2P A;  4JI1 J;  4CO1 A;  1SL0 A;  3ISN C;  1V9O A;  1FA0 A;  2V68 A;  2LLZ A;  2HVD A;  5JVG Q;  2K1R A;  2VHG A;  3K57 A;  1IKY B;  3C3L A;  4V19 J;  2ASD A;  3T9N A;  3W3S A;  4CH7 A;  3BDE A;  2HAI A;  2H51 B;  3SXL A;  2QA4 G;  5D78 A;  2CKW A;  3ZTR A;  2VFU A;  5FD1 A;  1TL3 B;  4R8U A;  1ROF A;  2CIM A;  4HEA 9;  1IKX B;  2G2Z A;  4FS1 A;  1RHU B;  4E98 A;  4NA3 A;  2PN6 A;  3Q83 A;  3RRH A;  1SQG A;  1FNO A;  4R0J A;  3KJV A;  3E51 A;  2ZJP Q;  1YLX A;  4R5P A;  3G2X A;  1FDB A;  3HVT A;  2YBV A;  2HS3 A;  2YKN B;  4HAC A;  4FP9 A;  3HPO A;  3NAI A;  3PJW A;  3IRW P;  4FDF A;  4L6V 3;  4LT6 A;  1U1O A;  2R8J A;  4B3M J;  3DRX A;  5A2Q Y;  2RDD A;  1HL6 A;  3DRS A;  1HD1 A;  2HWT A;  3I0R A;  3PRB A;  2PSZ A;  4JI7 F;  1VR6 A;  2ILZ A;  3R5C A;  2NUH A;  4J9P A;  1OY6 A;  4NI2 B;  2N3L A;  2H9Z A;  1SKR A;  4KV8 A;  3DRP B;  2KJW A;  3MUV P;  2QV6 A;  5J2Q B;  4DUY J;  3MTJ A;  3D0I E;  3NGK A;  1S10 A;  3NBP B;  3FRY A;  1PGZ A;  4DJB A;  1IUJ A;  1RWV B;  1Y5L B;  2P9G A;  4FXD A;  3R5G A;  5E3A A;  1JX4 A;  2M3D A;  3BS9 A;  3T5H A;  1SCJ B;  5EX0 A;  1EP4 B;  3QNW B;  1R0A A;  1U26 A;  1GNK A;  4YDD B;  2BVZ A;  2ZH4 A;  4DFK A;  3FDS A;  5KG6 A;  3OXF A;  1H2U X;  5C25 B;  3MCO A;  3CO0 P;  2PO4 A;  4DV5 J;  2HQC A;  4IG0 B;  3FSY A;  3D1Q A;  2XWX A;  1S1V B;  1NK7 A;  4AYB D;  2CWK A;  1HBO B;  4DR4 J;  3MXH P;  1U49 A;  2FIU A;  4DG1 A;  1YVF A;  4JOU A;  1VBZ A;  2J0Q D;  3BSO A;  3GCX P;  1TQL A;  2QE5 A;  4BC7 A;  4B9N A;  3CUN A;  4B3S F;  1S1T B;  4QW8 A;  2V8V A;  1G2E A;  1R8P A;  3W2V B;  3M2V A;  3QAU A;  2HNY A;  1T9W A;  3CJ4 A;  3I6P A;  4PYD A;  3MCN A;  4DV4 J;  4JP8 A;  2EFN A;  2LXU A;  1U1N A;  2KKH A;  4LRF A;  2EFO A;  5KFG A;  1ZAV A;  2QYG A;  3EPG A;  3PIP Q;  1RCX B;  1DLO A;  3NCP A;  3QWU A;  1OO0 B;  1NK4 A;  3OXG A;  3OR1 A;  2MKK A;  3NNH A;  2WON B;  1X5T A;  4A8O A;  4KQZ A;  3PYF A;  5HQM A;  2DRD A;  1S0O A;  4U8Y A;  4IRD A;  1C0T B;  4B9L A;  4UQT A;  5DZ7 A;  3SI8 A;  2VG7 A;  1RT2 B;  3A3O B;  1FDD A;  4EBD A;  1F3F A;  1FJ7 A;  2CPJ A;  3LWL A;  2W4P A;  4ZJQ A;  1AA1 B;  3M9N B;  2CQB A;  4Y28 C;  1RHR B;  3A8K A;  1JLC B;  2C22 A;  4Y6I A;  3HSD A;  3G9C A;  1T05 A;  1Q8I A;  1YJR A;  3TVK A;  4TLR A;  2GFF A;  4X62 F;  2HWH A;  4D3H A;  3OTE A;  4RX6 A;  2MY7 A;  3MAA A;  4G3I A;  1BQM A;  1U4B A;  5A8K A;  4HDG A;  5HMY A;  2X1G A;  2EFG A;  2YQ3 A;  1PJ7 A;  2LXI A;  2GMH A;  3DGP A;  4PZV A;  2HW3 A;  3A8I A;  2JFK A;  1KQS R;  4ZLP A;  1UWA A;  2LU2 A;  5K14 B;  1HI0 P;  2DGT A;  3A13 A;  4WYL A;  2VOO A;  3J7A N;  1WUU A;  4WFA Q;  1X4A A;  2B9X A;  1KP6 A;  4OL8 A;  2B8P A;  4B3R J;  2F8H A;  4FKY A;  4NLY A;  3K5O A;  4JI3 F;  2HEK A;  3MPY A;  4DZD A;  2LQB A;  2VKZ G;  3KDN A;  2LKZ A;  3KLI A;  1UKU A;  2LQ9 A;  2NRE A;  3MPU B;  3HLU A;  5FDL B;  3MD1 A;  4PUO B;  4JV5 F;  4K5S A;  4IOC Q;  3RAX A;  2OEL A;  3SYZ A;  3CNQ P;  1FKO B;  1RWN B;  3CJS A;  3UNG C;  1SH2 A;  2Z57 B;  5DET A;  4IQX A;  3PW0 A;  4ILR A;  1C0U A;  5G0R B;  3C16 B;  3LAL A;  2UUW A;  2YNI B;  1UZD A;  1XMB A;  1N6Q B;  2J6T A;  2QLJ B;  2CAD A;  1U6B A;  2KM8 B;  3MR2 A;  2R2S A;  4OX7 A;  1JJ4 A;  5AJ3 J;  4X4U A;  1NJZ A;  1UVN A;  4LF9 F;  4G1Q A;  3SQO P;  4P7T A;  3DXB A;  2V9W A;  4GC7 A;  3QQC D;  4B9V A;  5HRO B;  3N4W A;  1O8B A;  3CCM S;  5HLF A;  1NK0 A;  2W8L A;  1QE1 A;  5E7O B;  3P3D A;  2YWE A;  1KFD A;  2YKO A;  4PWW A;  4OZ1 A;  2NZC A;  1PCA A;  3MEE B;  2LDI A;  3EXY A;  2RT3 A;  4JI8 F;  5J2N B;  3FCW A;  1U2C A;  3TJ8 A;  3FZ2 A;  1VJQ A;  3V81 A;  3C46 A;  4PXE A;  3MM9 B;  1X4E A;  4M95 A;  4LSL B;  4ATN A;  3W7B A;  2N7C A;  2LQJ A;  3Q2S C;  3R3T A;  3AQP A;  7FDR A;  3C15 B;  2HGM A;  3MWB A;  3D6M B;  4AD6 A;  1PKU A;  2JVR A;  4UUX A;  2DYA A;  3HFK A;  1S9G A;  2NXC A;  2ZUA A;  4UOG A;  1HMV A;  5KOW A;  5E0O A;  1EQ0 A;  3BYR A;  2GQC A;  2V94 A;  3TUP A;  3SIP B;  5BJR A;  4I56 A;  1RAF B;  4UT4 A;  5HMZ A;  2CG4 A;  2IVM A;  4O44 A;  1FJG J;  5GME A;  1RTD B;  2DGO A;  1AB8 A;  4ALZ A;  2YVS A;  4MH8 A;  3N9U C;  3UCU P;  3LUY A;  1XEZ A;  1UA0 A;  2H5I B;  3KHH A;  4DPO A;  3D0G E;  2HHU A;  5M2R A;  3SDE A;  4FXW A;  3DMJ B;  1DFD A;  2RML A;  1R6Y A;  1X4G A;  3CIZ A;  4A4J A;  1C4C A;  3C2P A;  3ENQ A;  3H2V E;  4ID8 A;  3JSR A;  1EAR A;  1JLB B;  2RVJ A;  4N76 A;  3RBZ A;  4N77 A;  4L3K A;  4CLS A;  5CA5 A;  2IDE A;  2DTJ A;  3FMB A;  2AV5 A;  1MWZ A;  4DSE A;  3TO8 A;  3IWX A;  1U25 A;  4IFV A;  1U47 A;  4N47 A;  3A1Y G;  4ZP9 A;  2OI2 A;  5BYQ A;  5LM7 E;  2UXB F;  1SKW A;  1MU2 A;  2ZZT A;  3R2C J;  3V4I B;  3MAQ A;  4A8S A;  5D6G A;  4F4A A;  4WII A;  1FWL A;  3VR1 A;  5F0U A;  3LTO A;  1LWF A;  1I1G A;  5H9E J;  4F36 A;  2DB1 A;  4ED6 A;  2GV1 A;  4NLD A;  4JI2 F;  4YB1 P;  1TEL A;  3UNY A;  4X4V A;  2FJW A;  2X1B A;  3CF5 Q;  2FVC A;  2DR8 A;  1CG2 A;  2UUB F;  1RZM A;  5A76 A;  1D8Y A;  2CPZ A;  3CD0 A;  1VK8 A;  2YNG A;  3KLH B;  2FHJ A;  4ILL A;  3MI7 X;  5E5N A;  5C42 A;  4OI2 A;  5I3U B;  4O4R A;  5FJ4 A;  1S0N A;  4OYB A;  1K47 A;  1HNZ J;  2FJE B;  4RBT A;  1IKV B;  3OVA A;  3MEC A;  2AHO B;  2JC0 A;  4WZM A;  3DLG B;  4ETX A;  3QAT A;  4NMX A;  2JH3 A;  2B4O A;  1NPP A;  2RIJ A;  4NXM J;  5KG2 A;  3TUZ C;  2Z2M A;  2QSF A;  2BJ3 A;  1X9W A;  1S1X B;  1OQ6 A;  2PEH A;  4PG4 A;  4AXI A;  3H5S A;  2IAJ B;  4C48 A;  1KLN A;  4F2S A;  3K58 A;  2OPP B;  1FDN A;  3TZZ A;  1TFW A;  4Y3C A;  1K73 T;  4KB7 A;  4LFA J;  2Z2L A;  3GIL A;  3FEZ A;  5IWA J;  1UA1 A;  2N82 B;  1R7I A;  4WTO B;  3B6B A;  1L3T A;  1Q86 T;  3QZ7 A;  2XYG B;  4DCP B;  2R7W A;  4UOF A;  2IDL A;  2BOA A;  2IBO A;  5A8W B;  3RR7 A;  3BPD A;  1VQP S;  3JXO A;  2BEF A;  2E29 A;  4OYM A;  4WFY A;  3C14 A;  5L1L A;  2XHC A;  1OJ4 A;  3H4D A;  3GG1 A;  2ZC3 A;  3A3P B;  1N33 J;  2NSC A;  3IS9 A;  2OPQ A;  2MLY A;  2CZ9 A;  5D0H A;  3GV5 B;  1EKS A;  1YJV A;  3OTO J;  1DUR A;  4NCG A;  1IWA A;  1U1M A;  3IP0 A;  1UW9 A;  1XTZ A;  4EYH B;  4MKB A;  4OYA A;  1QSL A;  1UL3 A;  3DRR A;  2J76 E;  4ECS A;  2MLZ A;  4IQM A;  3ELH A;  3POT B;  4CLF A;  4U96 A;  4DR3 J;  2B4U A;  2UP1 A;  5C2C A;  3OFF A;  5KT4 A;  4XDD A;  2M70 A;  4ZDN A;  1S4F A;  2DNK A;  1NU4 A;  1BC6 A;  2I2Y A;  4OI1 A;  2LEP A;  4F8R A;  2PD1 A;  3IR6 B;  3M6W A;  4X84 A;  3CTR A;  3SCI E;  2ZKU A;  3UDE A;  1BD6 A;  3MR5 A;  3J7Z 5;  3H42 A;  2OD4 A;  4PKD B;  5IXU A;  3CCL S;  1JNZ B;  1TK0 A;  2CFX A;  4OI4 A;  4X4N A;  3HSJ A;  3TYT A;  2ZOF A;  2RRA A;  1GMV A;  4ZVG A;  4EBE A;  4M1K A;  4PXC A;  3N5B A;  1UEK A;  2V4J B;  4W90 B;  1NH7 A;  3N0V A;  3OL6 A;  3M2U B;  4GKK J;  1FWP A;  4DR2 F;  2BKO A;  5HP1 A;  4X4R A;  1S9F A;  3P8B B;  5F8H A;  2W7O A;  3LGM A;  4C8K A;  2D9O A;  4W92 B;  2HK3 A;  3RAM A;  4DSJ A;  3PAC A;  1W2B R;  2MST A;  2J6U A;  4I68 A;  2VOD A;  1AYE A;  4B08 A;  1VI7 A;  3NMR A;  4CCH A;  1Q82 T;  5HAO A;  3G82 A;  1VQ4 S;  1JLF B;  3DKD A;  5MLC V;  2XB2 D;  1RA6 A;  1RT6 A;  3NGU A;  4DR1 F;  3PHT A;  3DGV A;  1TFY A;  2UXD F;  1DTQ B;  3K89 A;  4O3S A;  3AD7 C;  1O6X A;  2LMI A;  2OTL S;  5HJY A;  1ZA1 B;  4ERD A;  4CO3 A;  1F2G A;  5MAO A;  3GR0 A;  3CJK A;  5KFQ A;  1HHT P;  4W98 A;  2XGP A;  2P5V A;  3VAH A;  4R0E A;  3DXS X;  2UV8 A;  4JI0 J;  3H2L A;  1FKA F;  4CO0 A;  2MY8 A;  3G86 A;  1FXR A;  2W7A A;  4J9L A;  3B4M A;  3W5Z A;  1OSC A;  1B0P A;  4P7V A;  3NWG A;  4JB8 B;  3FFI A;  3L9Z A;  3EX7 B;  3DOK A;  2MTL A;  2W9B B;  1BWV A;  2OD6 A;  3HCX A;  2FHK A;  3MED A;  4KHP F;  1VGY A;  4JI7 J;  1RLD A;  1RWU A;  2Z58 B;  3EZU A;  4MFB B;  4DV3 F;  1LWC B;  1OY9 A;  2C2M B;  1GX5 A;  4CP5 A;  4PWD B;  2HPU A;  2D9P A;  4Q7A A;  4JV0 A;  4MAK A;  1LNQ A;  3SEO A;  4FVC A;  2W2Q P;  1U8S A;  5IZH A;  3P6Y C;  4FKX A;  4WZQ A;  1HNV A;  4DQI A;  1NEE A;  1HWL A;  4I1T A;  4ED8 A;  4C3K A;  4BS2 A;  1EQM A;  1FK9 B;  1NHV A;  2HVH A;  2QLW A;  4ZP7 A;  3H98 A;  4WYW A;  4D3G A;  5D4L A;  2YX7 A;  2WSF C;  1A7G E;  3D6F B;  4ZVR B;  4MYU A;  2BW7 A;  2X3G A;  1RJJ A;  4DR7 J;  2RNE A;  1FHT A;  1ZH5 A;  1RAJ A;  4RWX A;  4UOH A;  5D0E A;  2OFG X;  3LP2 B;  4MK8 A;  1QTM A;  2BV3 A;  5HVF A;  1UEU A;  1PC4 A;  3AY0 A;  2PA3 A;  2PEB A;  5GMK a;  1T7P A;  3US5 A;  2VPX B;  3CB4 A;  4UW2 A;  5K20 B;  4B3S J;  2N4D A;  4RPF A;  5C2G A;  2UUT A;  4H54 A;  1VLO A;  3TAQ A;  5HBM B;  4QIG A;  5HO4 A;  2UXC J;  2HKE A;  3GIK A;  4J9R A;  3H0P A;  2G9O A;  3OR2 A;  4USH A;  4X64 F;  3G6V A;  2HHH F;  2V4R A;  3K5P A;  3OBI A;  4M5M A;  5K8M A;  1XJW B;  4A46 A;  4KKO B;  4F3M A;  3MPW A;  3KNA A;  1NK9 A;  5KFS A;  3JSY A;  2HWI A;  1MRO A;  4B3O A;  2I5J A;  2R8I A;  3CCV S;  1I3O B;  5DS7 A;  4M63 A;  3BO4 A;  5I42 B;  3R1H A;  1H38 A;  3CCR S;  3UE2 A;  1CUL A;  4KAI A;  1WC0 A;  3VWS A;  1F9F A;  3FUY A;  4I2P B;  1N48 A;  3P96 A;  4L72 B;  1UFL A;  1H2T Z;  3HKW A;  1BY9 A;  2R2R A;  2GGP A;  2K1R B;  3MMB A;  2IIH A;  1JLA B;  5EWF A;  1QM9 A;  2HBQ B;  2OPR A;  5CXT A;  4FVM A;  1S1U A;  1Q7L B;  2HGN A;  2COL A;  2JOQ A;  2BMB A;  3PFE A;  4ZN1 A;  1YTY A;  3HO1 A;  4JI4 J;  4WK3 A;  3RBE A;  3VQS A;  2XYP B;  4X62 J;  1S9E B;  4QWB A;  1HYS A;  2BAB A;  1FER A;  4PYA A;  3V6D A;  1FRL A;  4U7C A;  3VAK A;  3DU6 A;  2V8G A;  4WFX A;  1K1S A;  5HVG A;  3KK3 A;  4X66 F;  3TRG A;  1RHQ B;  3GJQ B;  2ZHB A;  4C8Y A;  4G65 A;  3LWM A;  2KHD A;  4Y2K A;  3HVT B;  1FKP B;  4UF4 A;  4HAC B;  3OVS A;  1SQF A;  1EB0 A;  4PG7 A;  2K3K A;  3FBF A;  2LEA A;  3BO3 A;  2V67 A;  3BGO P;  2FDN A;  3AD8 C;  2DEI A;  3M6V A;  1SC1 B;  2RF2 A;  4OV1 A;  4ICL A;  3NP5 A;  1Q5V A;  5L1J A;  4KV8 B;  4MKY A;  4DL6 A;  1B0V A;  1WKJ A;  4RZR A;  3HF5 A;  3HVR A;  1YJW S;  3CCW A;  3N01 A;  3CJ5 A;  3ZZR A;  2PFF B;  1S97 A;  4RBU A;  2ATC B;  4NX9 A;  3ZO7 A;  4QR2 A;  4DUZ F;  5KFY A;  4TU7 A;  3CC4 S;  4ZP8 A;  3ILI A;  4Q5V A;  2MJN A;  1SB6 A;  2B9E A;  3TR5 A;  5JUM A;  1DZ5 A;  2KU7 A;  3M32 B;  1IKX A;  2XZD B;  1U6Z A;  4AFF A;  3FKB A;  1XWL A;  4ID5 B;  1RBA A;  1YK9 A;  1RI7 A;  1FO1 A;  2YNF B;  4ZVQ B;  3TWZ A;  1MWQ A;  4USJ C;  4U7U D;  1T8E A;  2AP6 A;  2HFO A;  1LEO A;  1PYS B;  1B64 A;  2MLX A;  2WBM A;  2YKN A;  1LW2 A;  1PBU A;  4UZC A;  2E9R X;  4ZPV R;  1BLU A;  4J91 A;  4NLU A;  2AJF E;  1FF2 A;  2XQC A;  3M2V B;  2E7W A;  2HNY B;  5AXL A;  2LVW A;  2YX1 A;  3DRP A;  2VDH A;  2FTR A;  2NCK L;  5J2Q A;  4OZ0 A;  4Q0B A;  4JI8 J;  3CDE A;  2QYC A;  3H90 A;  3M7V A;  3NBP A;  3ZTO A;  4KJI A;  4FN5 A;  2OLW A;  4OZ2 A;  1RUS A;  4HH0 A;  2O1P A;  2QZ8 A;  2A10 A;  2C3M A;  2C1E B;  5HK4 A;  3R2D J;  5D8H B;  2R4F A;  3MMJ A;  1S59 A;  3BGR B;  3TA1 A;  3QFH A;  4PXD A;  2WTF A;  2QL5 B;  4DV1 F;  1WG4 A;  2DHH A;  3OSN A;  3KK2 B;  4O4G B;  5CHC B;  1EP4 A;  2JEG A;  2XMK A;  4IRC A;  4NLP A;  1JLG A;  3OHB A;  4ZK7 M;  1M1H A;  1K9M T;  1YZ6 A;  2BQU A;  1QSY A;  1KOO A;  2RQK A;  4F02 A;  4NA2 A;  1TKX B;  5EWG A;  3L4B C;  2AD9 A;  3UDC A;  5KFM A;  4PXB A;  1VQ9 S;  4IG0 A;  1S1V A;  3FBB A;  1HBO A;  1X4H A;  4QPT A;  3HKZ D;  4LF4 F;  4ZCK A;  3PVX A;  1T05 B;  3RJM B;  4J9S A;  3G4S S;  5IOL A;  7FD1 A;  2ZFH A;  5DDP C;  5BXI A;  1WDD A;  1RAB B;  2MHE A;  1VJW A;  2JC1 A;  1S1T A;  1CS4 A;  1J5O A;  3UR0 A;  3T5L A;  2FJD B;  2H48 B;  3W2V A;  5A8K B;  4DUT A;  3TAN A;  1RP5 A;  2WVE A;  5DDO C;  1GXL A;  4C0B A;  4O3Q A;  2DNH A;  1NJX A;  2Y1J A;  3QIP A;  3FQK A;  3KJQ B;  4KIA A;  2POK A;  4K4X A;  4B9U A;  2ERR A;  4WFN Q;  1Z2L A;  2MSS A;  5DG7 A;  4P72 A;  2VIC A;  2JJ4 D;  4P74 A;  2HFV A;  2QC3 A;  1RT7 B;  2KT5 A;  4B3T F;  2C28 A;  2ZNY A;  1CBK A;  1Q1K A;  3MCS A;  4OZL A;  3KG1 A;  1S6O A;  1XBW A;  3BDP A;  4MIW A;  4JI1 F;  1S72 S;  2NPI A;  5BR8 J;  3FK4 A;  5F8I A;  5B0E A;  1RDR A;  3KDO A;  3WBZ A;  2VFR A;  5HJX A;  2UUB J;  3LQV A;  3LGN A;  4USI A;  1V5I B;  2GHP A;  5BYS A;  1YJN S;  1EHW A;  2W2O P;  4NPO A;  4KBI A;  5AT1 B;  4EYI B;  1JLC A;  3FBC A;  1S6P A;  2XLI A;  1X31 C;  5KFH A;  3E8O A;  1G3O A;  1KHW A;  1FD8 A;  1XC9 A;  4LUB A;  1RCO B;  5DJB A;  4WXO A;  1P6T A;  2VJU A;  3EGV A;  2VBX A;  3WX8 A;  2XZT B;  2LQ8 A;  1U2F A;  3VV2 B;  1DQ9 A;  2Y9H A;  3DN9 A;  4WJB A;  4M8L A;  2JVO A;  1NDL A;  1RTJ A;  4P9S A;  2R8K A;  5LSO A;  3WHI A;  2AF6 A;  4I7F B;  4X4Q A;  3NNC A;  2ZBQ A;  1DQ8 A;  3J7A 1;  4IO1 A;  1SH3 A;  1N4L A;  4USU A;  1IJE B;  1URN A;  2C3P A;  1PIE A;  5I3P A;  5K14 A;  4B9T A;  4H4M B;  4B3M F;  1FTC A;  3GWC A;  2QA2 A;  2NYH A;  3W8P A;  3BRE A;  5ADZ A;  2XSF A;  4WE1 B;  5AXK A;  4WKR A;  4K5R A;  1RYR A;  1H7X A;  1VQ8 S;  3HDS A;  2CVE A;  3QO9 B;  3B4D A;  2RB7 A;  4BWM A;  1OIA A;  4DUY F;  1VIX A;  1WEX A;  4TU9 A;  3K5L A;  4JI6 F;  1XR7 A;  2B9W A;  2VIH A;  3RB4 A;  4H4K C;  5FDL A;  2DIV A;  4PUO A;  1S4E A;  1XN9 A;  2BRK A;  3W61 A;  4DR5 F;  2GMJ A;  3AA8 A;  1DAX A;  4RU9 A;  2ZH3 A;  2NQP A;  4DQS A;  4TYA A;  2R42 A;  4TN2 A;  4QYR A;  4DV2 F;  1IR1 A;  5JXS A;  3B82 A;  2Y1L B;  3E3X A;  3QID A;  5G0R A;  3TW0 A;  3M8P B;  1S9G B;  2YNI A;  2HZA A;  4P10 A;  1N6Q A;  3RRG A;  3CD6 S;  4W4M A;  4EU0 A;  4DV5 F;  3D4J A;  3TOQ A;  4DR4 F;  2QJ3 A;  3GFZ A;  3QAE A;  3Q89 A;  3G8S A;  4ZMM A;  2J9E A;  2IRY A;  1B4S A;  2AYG A;  2PT0 A;  5KFR A;  3DOL B;  4C3M A;  5A0Y B;  4P2S A;  2W4C A;  4PG5 A;  2RUS A;  4LBP A;  5HRO A;  3TP2 A;  2AJQ A;  1NRK A;  4EK2 A;  4OLP A;  2UUC J;  1U24 A;  1YG0 A;  1RTI A;  2W9C B;  3MEE A;  4WWS A;  2CPF A;  1TKT B;  4ZIW A;  3V5R A;  4TQR A;  5J2N A;  4CH0 S;  3AHP A;  4FYW B;  4ECQ A;  4FNH A;  3MM9 A;  1T0T V;  4KGK A;  3WQP A;  4QOT A;  5KFB A;  1TVR A;  3C6U B;  3J81 U;  2KXH A;  1MU2 B;  1QJH A;  2Y8W A;  1CJV B;  1FJE B;  2IM0 A;  3OLA A;  2XS5 A;  4CQ1 A;  3H2U B;  3EZO A;  2BJD A;  2QFI A;  3F41 A;  1W7W A;  2HNZ A;  2VL1 A;  3MAH A;  2DGX A;  1P1L A;  3UN3 A;  1ZS6 A;  3PRV A;  5KT5 A;  4HR2 A;  5C42 B;  1RTD A;  4LF6 J;  4URQ U;  4XPC A;  3CJ8 A;  4GVL A;  1NB7 A;  2DR5 A;  1Y4Z B;  4KR0 B;  1VLY A;  4IFY B;  5F0W A;  4ECZ A;  1B3T A;  1WD6 A;  3HHE A;  3DMJ A;  4DN0 A;  3NS6 A;  3J81 Y;  3GQC A;  3KXD A;  2KFY A;  3ICL A;  4CRJ A;  1VRQ C;  1H7W A;  1Y7P A;  4LR8 A;  2G4B A;  3M8S A;  4J37 A;  3CJQ A;  2GJF A;  4DR1 J;  1JLB A;  2UXD J;  3BB5 A;  2YKA A;  2MQ8 A;  3V4M A;  4P6Q A;  4NOH A;  2QIF A;  5DQH A;  3AB2 B;  3KTQ A;  4OYZ A;  4OYX A;  5KAK A;  3UDV A;  3JSM A;  5ITH A;  1HBM B;  2IY5 B;  1F5C A;  3V4I A;  2HVE A;  3AOB A;  1HBU B;  4B3R F;  1CVJ A;  1YBA A;  2DY9 A;  4Q2M A;  1PAE X;  4YN3 B;  4F04 B;  3QRP A;  2HHV A;  4K4V A;  3CUL A;  3HD2 A;  3N6M A;  2OH2 A;  4B17 A;  2FD2 A;  4KHP J;  3UD4 P;  2HND B;  3KK1 A;  3T41 A;  4I69 A;  3WX4 A;  3NKY A;  1NKE A;  2IM2 A;  1NJY A;  5HAT A;  4DV3 J;  3KLH A;  1KBR A;  2DH7 A;  5JVH Q;  5I3U A;  5GMD A;  1IKV A;  6FDR A;  1ZPW X;  1HLW A;  4J90 A;  1U7L A;  2J7W A;  2J7U A;  2HQI A;  4CWB A;  4BHQ A;  3DLG A;  3NL0 A;  2V63 A;  1IBC B;  4EFA C;  2MQM A;  4WKY A;  4X4P A;  4YY3 F;  4RNH A;  1K8A T;  4IG3 B;  2G13 A;  2UVR A;  2MMY A;  3D66 A;  4DF4 A;  4CTA B;  2IRU A;  2OSR A;  1S1X A;  3QSY B;  1HKA A;  2IAJ A;  2CNL B;  3CSK A;  1ZM4 A;  3BGL A;  2OPP A;  2HMI B;  4FF4 A;  4O3N A;  4NLG A;  1NK6 A;  4NLS A;  4Q2L A;  4ZS6 A;  2FJX A;  4A8X A;  2V8H A;  4QIF A;  2CPE A;  2NSB A;  5A8W A;  2ZOG A;  4H4O B;  1J27 A;  1S6U A;  1X8D A;  1UEV A;  1LOU A;  3SBM A;  1E6V A;  3TUJ C;  1S49 A;  4Z37 A;  4J7C A;  1FTR A;  2HSE B;  3ETO A;  5CYQ A;  3F44 A;  1CEZ A;  3Q23 A;  1J2V A;  1F9E B;  2DR9 A;  2DNL A;  4O3R A;  5ETR A;  4USV A;  4OI0 A;  4KGV B;  4DS5 A;  4AL6 A;  3W5Y A;  3LAN A;  4K50 A;  2GAH C;  2HLT A;  4DX5 A;  2V5H G;  2XHW A;  3CDA A;  1FJG F;  2NPF A;  2EK6 A;  4F50 A;  3GB0 A;  4P71 A;  4WU3 A;  2J9C A;  3K0J A;  2RU9 A;  1N8R T;  5J2P B;  3KLF A;  5J1E B;  2KT3 A;  4XPE A;  4NZ6 A;  2AYB A;  2BKP A;  2E5G A;  3POT A;  1BXN A;  2ZEJ A;  3MPD A;  1JJH A;  3G82 B;  3SMZ A;  4C3L A;  2OUG A;  2Y1I A;  2XMM A;  4E0D A;  3SFG A;  2ZM6 J;  1VS3 A;  1RT6 B;  1UWB B;  1MN9 A;  4KSE B;  3LA0 A;  3V2U C;  2K7K A;  4PAB A;  2Q6B A;  1BGX T;  1U48 A;  5HMW A;  3W62 A;  4F4W A;  3M4X A;  3EYZ A;  3EM1 A;  1N32 J;  3CJK B;  4U7U K;  5IT0 A;  3T1H J;  3PG9 A;  2F63 A;  3EJM A;  3D54 A;  5CAB A;  2MQN A;  5B08 A;  5J2M A;  2VFV A;  1TTH B;  2XEX A;  3NMA A;  2ABY A;  2H1Y A;  2OML A;  1VBY A;  1WSV A;  1AT1 B;  4F0K A;  3O8W A;  2BAC A;  2HBR B;  4B02 A;  4DL0 C;  2MQQ A;  2J8A A;  2V4J A;  1V3Z A;  3SZ2 A;  3PDN A;  3M2U A;  1CJT B;  5LXR A;  3NG8 A;  3TVZ A;  1U45 A;  2DKO B;  4ED7 A;  5DM7 Q;  1P8G A;  4ZPC A;  4TVA B;  2DHS A;  5IC4 B;  2CNO B;  1Q81 T;  2KVQ E;  3OL8 A;  4DUZ J;  4IR9 A;  1T02 A;  3I55 S;  3CVK A;  3K8W A;  4FBT A;  1GAO A;  1HIY A;  5A6P A;  3R1L A;  1I6J A;  3E01 B;  1DTQ A;  1QD1 A;  2DIS A;  2Q3P A;  2XI2 A;  2XMV A;  2HRY A;  3VAL A;  5KG1 A;  1WC4 A;  1N34 J;  3PJX A;  1MMD A;  4MT1 A;  3S8S A;  2GO8 A;  1W26 A;  2E1M C;  5H9F K;  2ASJ A;  2EFV A;  3D3B J;  2XMA A;  4RBV A;  2VG6 B;  2ZD1 A;  3QSI A;  4DXL A;  2W9B A;  4QW9 A;  3VGU A;  5A8R B;  3HHL C;  3LPE A;  3D0H E;  3DYA A;  4OJ3 A;  3SV3 A;  1PO6 A;  4ZLN A;  1LWC A;  2HAF A;  1LFP A;  4PWD A;  1RBO B;  3QJJ A;  1IWG A;  1A0O B;  7AT1 B;  5KFW A;  4OYO A;  4YR0 A;  4ZN3 A;  3MUM P;  1S7H A;  3BGU A;  1NSP A;  1NDP A;  1VQN S;  1AZS B;  4Z2X A;  2I5J B;  3UN2 A;  3LAM A;  2YX4 A;  1FK9 A;  1QAJ A;  3NNA A;  2J0W A;  4DV1 J;  5D15 A;  3IGV A;  3CD7 A;  1M0S A;  4PWU A;  1CQN A;  2W8K A;  4KPC A;  2DGS A;  3I0S A;  4RUH A;  1SVD A;  1RT4 B;  1MLA A;  3MMB B;  4NLQ A;  3LP2 A;  4DR3 F;  5D4P A;  2KRB A;  3UFC X;  1S76 D;  4F67 A;  3K5M A;  1S1U B;  1GMW D;  1IQT A;  1ZM2 A;  4RUB A;  2NR0 A;  1QVG R;  3MM7 B;  3KMS A;  2BM0 A;  2VPZ B;  4YHH F;  1B70 B;  4GKJ F;  2C42 A;  2AEJ A;  2WK4 A;  4J9N A;  1TP7 A;  4ILM A;  2B51 A;  4WFZ A;  3MMA A;  2QTW A;  5B0A A;  5L9N A;  3EPI A;  2YNH A;  1XER A;  5HBM A;  3D3C J;  4C8L A;  2QEX S;  3KK3 B;  2HQD A;  2DNN A;  5HAN A;  2MDA A;  5KG7 A;  4YDX A;  4HI2 A;  4N8O A;  4EUV A;  4KKO A;  3W63 A;  1X4D A;  2QMW A;  3QMQ A;  2HUR A;  2W24 A;  4YB7 A;  1RWO B;  3FMW A;  2FVP A;  1SUQ A;  5CZV A;  2QMX A;  4F3O A;  1GTH A;  2ALZ A;  2HFN A;  1UMJ A;  4GKK F;  4N41 A;  3Q0A A;  1NJI T;  3NLC A;  4ICL B;  4FS2 A;  4Y65 A;  2Z8Q A;  1V5V A;  2D69 A;  1SH0 A;  2FC9 A;  1H6K X;  2PI5 A;  3T1Y F;  3GR1 A;  4YME A;  3SSS A;  1LQ9 A;  5FII A;  1JLA A;  2AJ2 A;  1U6F A;  2XG8 A;  4ZA1 A;  1FRX A;  1Q95 G;  1KC8 T;  4YB6 A;  3NGR A;  5A2Q U;  3CJ2 A;  1SC4 B;  4QJV A;  4ECV A;  4TKT A;  5L38 A;  4TYB A;  4S0M A;  1OS5 A;  4QQB A;  1MMN A;  1S9E A;  3MM8 B;  1YDL A;  2F8E X;  3H5U A;  4WXW A;  1P9Y A;  5F9L A;  3WC2 A;  2B7B B;  1VBK A;  4G1P A;  3N5F A;  2R7X A;  3AJ1 A;  2PMH A;  1HA1 A;  1V6H A;  4JI0 F;  1VC6 A;  3MOZ A;  1NND A;  1L3S A;  1FKP A;  1N5Q A;  5I4M A;  1LW2 B;  2I1R A;  3RTV A;  1DTT B;  5LSR A;  1JMT A;  3RZA A;  5KT7 A;  4ZJO A;  2DPI A;  4TNO A;  1RWW B;  1JJC B;  1F1B B;  4DL3 A;  3PR4 A;  3ETM A;  5B0G A;  2GNK A;  1NXI A;  2ZWO A;  1RT5 A;  3KUG A;  3M6X A;  2RRN A;  3QZ8 A;  1Y3K A;  2IPO B;  2ZH1 A;  3KHG A;  2W25 A;  1T9U A;  5LMN J;  4Q0B B;  2R9L A;  3GTY X;  3V6J A;  2MQL A;  4JI6 J;  4TY9 A;  2BAN B;  4RNF A;  2Z30 B;  2D3O R;  5KFN A;  2RE1 A;  3ZFV A;  2AJ0 A;  4DR5 J;  1TL7 B;  2I9S A;  2FJB B;  2L3M A;  2PDA A;  3OSP A;  2AT1 B;  4LF8 J;  3T3F A;  3MOJ B;  1H3D A;  2AGQ A;  2ILY A;  4ES2 A;  3IRX B;  1Q8B A;  3HT3 A;  2FZK B;  1FVS A;  1JLG B;  5F9N A;  4ZVP B;  4DV2 J;  3B78 A;  2ZIT A;  1PJ5 A;  4ZCL A;  3MCM A;  4K8R A;  4DR7 F;  2ZJR Q;  3M32 A;  3EGN A;  2FHJ D;  4ID5 A;  3I56 S;  3GJT B;  2A6O A;  2YNF A;  1CC8 A;  2AU0 A;  1EIY B;  3VAG A;  1QDU B;  3D68 A;  2XS7 A;  2OKQ A;  4C6A A;  1AW0 A;  1WF1 A;  2CPY A;  3DDK A;  2GVD B;  1FRJ A;  3HP6 A;  5L1K A;  1H0H B;  2OPS B;  2W2N P;  2HFS A;  3PTW A;  4MIB A;  1VDH A;  3ZZU A;  4V1A k;  3JS9 A;  1CS4 B;  1J5O B;  1EX8 A;  1IR0 A;  1FWK A;  4JYA J;  4WTY A;  4DI6 A;  5T7L A;  4ZVO B;  2O3D A;  4BWJ A;  2UXC F;  1UJ4 A;  1XMQ J;  1VMB A;  4OHY A;  3K7R A;  4DEZ A;  3RR8 A;  2I8E A;  4OZ3 A;  1FX2 A;  2RQ4 A;  3QIP B;  2QG9 B;  2CUY A;  2MGZ A;  1RAI B;  4OHW A;  4J9K A;  2HLU A;  1U1Q A;  3NEK A;  3VGT A;  3BKF A;  3I4H X;  4XDC A;  1WJ9 A;  1DY3 A;  1FNX H;  4X2B A;  5IQ6 A;  1GEH A;  2CJB A;  1TMJ A;  3G87 A;  3BGR A;  1TL1 B;  2E66 A;  3KK2 A;  4O4G A;  3AJD A;  3L7O A;  2XCP A;  4TY8 B;  2C2O B;  4O0I A;  3TEH B;  1HNI B;  3CCU S;  1FFG B;  2Z0G A;  4NYO A;  1TKX A;  2VF3 A;  2FVS A;  3P5B P;  4OYI A;  5KFU A;  2D41 A;  5ETO A;  3IC1 A;  2H5E A;  2F5G A;  1S6P B;  3NAH A;  2MKI A;  1YJU A;  2FYX A;  3LOU A;  2RU3 A;  4JI4 F;  3QGH A;  5DLG A;  5KFF A;  2FGO A;  2V8D A;  4ELV A;  1RA7 A;  3V6H A;  2QMU B;  4LF5 F;  2PFD A;  1F60 B;  2GVZ B;  3I82 A;  1CJK B;  1WOS A;  2BBE A;  3OXL A;  1RTJ B;  3TJA A;  1D1U A;  2ZBP A;  1KVI A;  2BX6 A;  4TQS A;  2B5J B;  2FLP A;  4N5S A;  2AGO A;  1RAG B;  4QR0 A;  1R8C A;  1S6Q B;  2O5D A;  5C24 B;  3BKU A;  2IM3 A;  3CJ3 A;  1PC5 A;  1HI1 A;  1GQE A;  1VIS A;  2O01 C;  1KS2 A;  1KDN A;  1RT7 A;  1C4A A;  2OAU A;  3WIV A;  2M8H A;  2K8G A;  5D4O A;  1UW4 A;  5JJB A;  2AX0 A;  3IBW A;  4UTG A;  3GIR A;  1RT1 B;  1ZYQ A;  4DQQ A;  4CM2 A;  1S57 A;  2Q43 A;  2R7O A;  2C3Y A;  2DXE A;  2EFP A;  2MKS A;  2KDO A;  3O1L A;  1OQ3 A;  2RS2 A;  1ARO P;  2HIQ A;  3OFH A;  1M1G A;  1PYO B;  2K3I A;  2EWH A;  3GP9 A;  3O2I A;  3KLG B;  2QLB B;  5I3Q A;  1U02 A;  5KFT A;  2EFQ A;  1OWX A;  4QWD A;  3OQ2 A;  1C2P A;  2ZH9 A;  1SJQ A;  4Q8F A;  1GMW A;  3R5D A;  4DL2 A;  2DRA A;  2OP5 A;  3K59 A;  4IUF A;  2EG2 A;  3N79 A;  3BN7 A;  4YY3 J;  1IQZ A;  2E5L F;  4LRB A;  2HQ3 A;  3OUY A;  1VBX A;  3JTP A;  4IOA Q;  4I7F A;  3VAI A;  1B99 A;  2MKH A;  3DLL Q;  4ZHR A;  2VV5 A;  1F5B A;  3ENW A;  1MW7 A;  4CO2 A;  2DH9 A;  4ETZ A;  2P6T A;  1B0T A;  4H4M A;  4LF1 A;  1JJ2 R;  3DLK B;  1DHM A;  3PY8 A;  4EZ9 A;  3LP1 B;  5B0C A;  2RJZ A;  2ROP A;  5KT2 A;  2CDQ A;  2BUN A;  3MUR P;  1EZZ B;  3CCE S;  2F8M A;  4WE1 A;  4EO6 A;  1E6Y B;  2A18 A;  2M88 A;  1RTI B;  1AUD A;  2NXE A;  4L76 A;  5KFD A;  3QO9 A;  1VOM A;  1HHS A;  2HK2 A;  4U9R A;  2B6A B;  2DGQ A;  2FLN A;  3W5X A;  3PW7 A;  1QAX A;  4OJG A;  1RB0 A;  5F3T A;  2XCA A;  4O0N A;  1APS A;  1TVR B;  3LW5 C;  3BH7 B;  2DRB A;  1YBT A;  2CPD A;  4DHV A;  2Y8Y A;  4FPI A;  3EIC A;  4P2X A;  2PE8 A;  4XTT A;  3TNV A;  4EGL A;  1D0E A;  4J5O A;  1WHX A;  4ECW A;  1RKJ A;  4KRW A;  2R2U A;  3CE8 A;  3M8P A;  5DO2 A;  4YQW A;  2DGW A;  2BE7 D;  2HNZ B;  1YX2 A;  3THP A;  1NK5 A;  2OEM A;  4CLT A;  2J0X A;  4FYV B;  5EDW A;  1GX6 A;  2IVF B;  3FJ2 A;  1SJ3 P;  1HNW J;  4LF7 F;  3RBD A;  3H7H B;  2IA6 A;  2WAQ D;  2IHR 1;  5KFA A;  1YSJ A;  2KO1 A;  4RW9 A;  2D7S A;  3CCQ S;  3DOL A;  4NCA A;  4QU6 A;  2G0J A;  1X5O A;  1R8A A;  5A0Y A;  1NLK L;  1HNX J;  1RE1 B;  1A6L A;  2DIT A;  1RT3 A;  2HS0 A;  4DFJ A;  4RR5 A;  3KG0 A;  2U1A A;  3BQ1 A;  3QLH B;  2UVW A;  1U1P A;  2OMO A;  2MPU A;  4F3Q A;  2JLE A;  2W9C A;  3HJF A;  1G6B A;  1TKT A;  2J6S A;  2VQF F;  3D1O A;  2Y0B B;  5K8P A;  3CD5 A;  1IBL F;  3EUN A;  1X5P A;  4I64 A;  4WP9 A;  1N5S A;  2VPW B;  3C6U A;  3S1T A;  3U1M A;  2E44 A;  5KFK A;  4XIU A;  3JSM B;  2Z56 B;  5H1S V;  1Q78 A;  3KJN B;  1HFE L;  3PXG a;  1CJV A;  1Y5N B;  3H20 A;  1NME B;  1N0V C;  3NCR A;  1M90 T;  1HAR A;  1UFW A;  2CQP A;  4P73 A;  4CT8 A;  3H59 A;  1O5J A;  3R6G B;  5BR8 F;  1RHM B;  5FLX Y;  3NCQ A;  5BYR A;  4USM A;  1TK5 A;  2P9C A;  1QAI A;  2C2E A;  3KK1 B;  2IFX A;  1JNR B;  4XO0 A;  5ETT A;  4KGX B;  2Z2Z A;  2A2C A;  2V34 A;  2BR0 A;  1F3V A;  3A8J A;  4CIO A;  4J9O A;  3AH6 A;  1NUE A;  4NLR A;  4QWC A;  1GXT A;  1C1B A;  4IFY A;  2WVD A;  2HHW A;  2ZKT A;  3R97 A;  2L9N A;  4IOB A;  2G0I A;  4M5I A;  2Z2Y B;  1O51 A;  2VFT A;  1HW9 A;  2K06 A;  3KUE A;  1XR6 A;  3M9M B;  4MMO A;  2FVQ A;  2E5J A;  3RB6 A;  3ISN D;  1LXN A;  4F0H A;  2LCW A;  1NZ8 A;  2GC8 A;  1TAQ A;  5EWE A;  3TJ9 A;  4NZ0 A;  1YGY A;  3QT7 A;  3GII A;  2ZOM A;  4OQJ A;  4Q45 A;  1VC5 A;  1BE4 A;  3EMT A;  4L74 A;  3QJL A;  2KH9 A;  2IYI A;  4ITS A;  4K7Q A;  2KFZ A;  1ZZN A;  3GMG A;  2VD3 A;  5LMU F;  5D3G B;  1HBM A;  1SQE A;  1U8W A;  4DCO B;  3PO4 A;  2BJ8 A;  2RQM A;  1HBU A;  1V3S A;  4R25 A;  4KHM A;  4TU8 A;  1OPI A;  2DHA A;  4LQ9 A;  3DFE A;  3ZZP A;  5K9F A;  2HBZ B;  2M0G B;  2VOP A;  4WBF A;  1KLM B;  2A6M A;  2CQ4 A;  3PEH A;  4NZ7 A;  4K0K F;  2HND A;  5H9F J;  1E6V B;  2W4D A;  4ED3 A;  2CPH A;  4CNY A;  1P27 B;  3IAS 9;  4CT9 A;  2XO6 A;  3TQ1 A;  3I87 A;  5CYQ B;  2X1A A;  3D67 A;  3KHR A;  2MXY A;  4RKU C;  3W1Y C;  1WG1 A;  4DF8 A;  1Q8L A;  2DO0 A;  4ANC A;  4YP3 A;  4ECR A;  4F0M A;  1QUV A;  2XMW A;  5EN1 A;  3CXC R;  5IT9 Y;  4NE9 C;  4NLW A;  1QAY A;  3GYN A;  3SQG B;  4DSL A;  3BSN A;  3MGJ A;  4IG3 A;  2FVR A;  2BYC A;  5KG3 A;  5DQI A;  1IKW B;  2CAJ A;  4UY8 T;  4CTA A;  3OTC A;  1SPB P;  3CDB A;  2LA4 A;  5HQ8 A;  3KLF B;  1ZBT A;  2HMI A;  3FNN A;  4ED5 A;  4NYZ A;  1LW0 B;  2CVI A;  2XNQ A;  1SBR A;  2QLF B;  3GSD A;  4AQY J;  3EVW A;  3HSG A;  1REG X;  2UUC F;  4FF1 A;  2R7R A;  3TZY A;  1FRH A;  3LGH A;  4QIW D;  2DXD A;  3PNI A;  4YHH J;  4QWE A;  4GKJ J;  3NRB A;  3PYE A;  3IN5 A;  2DO4 A;  4GO7 X;  2VG5 B;  1F0X A;  3G6E S;  2EI5 A;  2CPI A;  3I9Z A;  4H4O A;  4NLV A;  4AND A;  1NSK L;  1DRZ A;  3BN4 A;  3UW1 A;  2KYZ A;  3R5J B;  2V2V A;  2JEI A;  1I5O B;  4CYU B;  3Q8R B;  3ZZ0 A;  1SIZ A;  5J2M B;  2EXU A;  1VYA A;  4C11 B;  3HK2 A;  3CC2 S;  1UCN A;  2DNZ A;  3UD5 A;  1JKH A;  2FJV A;  1Q4R A;  2CA9 A;  2P6S A;  1T03 A;  2FZG B;  5HVH A;  2W01 A;  3KMQ A;  3TA2 A;  1IBM J;  4IKA A;  4M5G A;  4X4S A;  1HD0 A;  2Q1L A;  2OIH A;  4KE5 A;  3DC2 A;  3UO0 A;  1VQ7 S;  2NYI A;  2EC0 A;  2C2D A;  3I4P A;  2BKN A;  4WF9 Q;  1TAU A;  2CJY B;  3HI9 A;  3NOC A;  3CCT A;  3PW4 A;  1HQU B;  4LF6 F;  4ZCM A;  5J2P A;  1TUW A;  1HWI A;  5J1E A;  2CNN B;  2MZS A;  1Z1Z A;  4NYP A;  1U09 A;  5HN0 A;  3T1Y J;  2MKC A;  1VFJ A;  2JLG A;  3SFU A;  1KEK A;  3TZX A;  3F56 A;  3EGW B;  1X9S A;  1RGV A;  3Q8S B;  3IBC B;  1EJ7 L;  4Q43 A;  3BM7 A;  3C6T B;  3MEK A;  3ZZY A;  1YJT A;  5IT4 A;  1UWB A;  4UQG A;  5ETM A;  3HD1 A;  2GJI A;  5GAH U;  5AXM A;  4DBQ A;  3AAW B;  4F2R A;  2CWX A;  3P5T L;  3HX9 A;  4M94 A;  1TKZ B;  4YR2 A;  1VQ6 S;  5ETQ A;  3JB9 k;  2OSQ A;  3DOM B;  4KGM A;  3FGV A;  3P4U B;  1XNR F;  5B7W A;  3ZTS A;  3KLV A;  2Q79 A;  3VAF A;  4CM0 A;  2V9K A;  3S7R A;  5IS2 A;  4HLB A;  2MEW A;  4IDK A;  4AUK A;  3LH2 S;  3PKM A;  4HL9 A;  1WI8 A;  2BZ2 A;  3NWR A;  1NK8 A;  3IG1 B;  2ZD1 B;  4ZP6 A;  2XMJ A;  2CJQ A;  3C19 A;  1VRT B;  1VRU B;  2BW2 A;  3OTD A;  3G71 S;  1U0S A;  3HHL A;  4DV6 J;  4CLW A;  3CPW R;  2JEF A;  5KFO A;  3DYA B;  3MHY A;  2VBY A;  1LKZ A;  1CJT A;  2JWN A;  4IRK A;  4O3P A;  4ECY A;  5D0G A;  3AT1 B;  4EO8 A;  3DLB A;  2XYH B;  2VBW A;  1RTH A;  2HG4 A;  1Q0N A;  4RNO A;  1Q16 B;  3ZC4 A;  2MZQ A;  3EVM A;  1YJ7 A;  2RDJ A;  3U27 A;  3D2W A;  2JRS A;  3IMQ J;  4DQR A;  1ULR A;  4A47 A;  2RSQ A;  4RU2 A;  1FES A;  4RL1 A;  4AT1 B;  4PQU B;  3R9L A;  3NS5 A;  4FPR A;  1AFJ A;  2E1A A;  1N5Y A;  2CZV C;  4GMK A;  4IH5 A;  3E01 A;  2ZVS A;  4UUW A;  2CG8 A;  2AIR B;  1YRU A;  2VC1 A;  3I0S B;  2X51 A;  3M8W A;  4BBY A;  3CW2 C;  5AE3 A;  5E2Q A;  2D1C A;  4P75 A;  5CD4 A;  2O66 A;  4C0H A;  3PV8 A;  2B4P A;  1RKI A;  3GU0 A;  1XMO F;  2KG0 A;  3R7S B;  1Y00 A;  4A8Q A;  2PC6 A;  1YIT S;  3AQO A;  2B9Y A;  3F0N A;  1HQ2 A;  4C9D A;  1IM6 A;  4IR1 A;  2VG6 A;  1EET A;  1BQN B;  3MMA B;  2YNH B;  2C2N A;  4DR6 J;  5A8R A;  4P52 A;  3BF4 A;  3IGN A;  1SV5 B;  2DNO A;  4DX7 A;  2PGC A;  2ZBC A;  1UAW A;  9RUB A;  4FYY B;  1R6V A;  4WP3 A;  2ZHA A;  2R7T A;  5CD4 H;  3TAM A;  3HZE A;  1Y10 A;  2EKY A;  4PG6 A;  2BQ3 A;  1AXQ A;  1AZS A;  4KC5 A;  1SUQ B;  2ROG A;  2FGC A;  5LL6 d;  2Y0S D;  2AYE A;  1R3N A;  1RU2 A;  2ALY B;  1S1W B;  2DH8 A;  4EEY A;  4OYW A;  2OO4 A;  1WOO A;  1M1K T;  2RHS B;  4Y2I A;  4DPX A;  3CWJ A;  3GIM A;  1X60 A;  3M8Q A;  4YFU A;  1RT4 A;  5EGY A;  2VB6 A;  5GAE U;  2HQG A;  2B3T B;  4M5H A;  3H5X A;  3CED A;  1D9A A;  4DV7 J;  4KO0 B;  3IR7 B; 
#chains in the Genus database with same CATH homology
 4F36 A;  4HR2 A;  2CWK A;  1NHK L;  2DXD A;  1MN7 A;  2B8P A;  3VGU A;  1LWX A;  3B6B A;  1NUE A;  3ELH A;  4FKY A;  1F3F A;  5IOL A;  4DI6 A;  3GPA A;  3L7U A;  4ANE A;  3MPD A;  5BXI A;  3EVM A;  1EHW A;  1S5Z A;  1BHN A;  4EK2 A;  3GP9 A;  3NGR A;  1F6T A;  1WKJ A;  4UOF A;  3BH6 B;  2VU5 A;  3FBC A;  3VGV A;  1NSK L;  4AND A;  5CAA A;  3ENA A;  4CP5 A;  3FCV A;  4O0N A;  1MN9 A;  3Q8Y A;  2HVD A;  4DUT A;  3R9L A;  3VVU A;  3EVO A;  4S0M A;  1HLW A;  2NCK L;  3NGS A;  2AZ1 A;  3BH7 B;  3NGT A;  2B8Q A;  3DDI A;  3VGT A;  1NSQ A;  2BEF A;  4ANC A;  3WX8 A;  3ZTO A;  3DKD A;  2AZ3 A;  3FCW A;  1VYA A;  1UCN A;  1NSP A;  1NDP A;  1HIY A;  4FKX A;  1WKL A;  2BX6 A;  3EE3 A;  3Q8V A;  3NGU A;  3EIC A;  3EM1 A;  3ZTP A;  1XIQ A;  3ZTR A;  3Q8U A;  3EJM A;  3ZTS A;  5CAB A;  1NDL A;  1BE4 A;  1S59 A;  3EMT A;  2HUR A;  2DXF A;  3PJ9 A;  1B99 A;  3FKB A;  1KDN A;  3VVT A;  3Q86 A;  1PKU A;  1U8W A;  4W98 A;  4KPC A;  2DYA A;  1JXV A;  3Q83 A;  1NB2 A;  1NCL A;  3FBE A;  3VGS A;  1XQI A;  3ZTQ A;  4C6A A;  1K44 A;  5C7P A;  1NDK A;  1W7W A;  2HVE A;  2ZUA A;  3FBF A;  3Q89 A;  4DZ6 A;  4UOG A;  2DY9 A;  3B54 A;  3ETM A;  3FC9 A;  3BBF A;  1LEO A;  1B4S A;  4UOH A;  4F4A A;  3G2X A;  1WKK A;  1PAE X;  1S57 A;  1ZS6 A;  1NDC A;  3BBB A;  1NLK L;  4ENO A;  3EVW A;  3PRV A;  1NPK A;  3FBB A;  1HHQ A;  2DXE A;  1BUX A;  3BBC A;  3JS9 A;  4WBF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...