1NLKL

Crystal structure of myxococcus xanthus nucleoside diphosphate kinase and its interaction with a nucleotide substrate at 2.0 angstroms resolution
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
143
structure length
143
Chain Sequence
AIERTLSIIKPDGLEKGVIGKIISRFEEKGLKPVAIRLQHLSQAQAEGFYAVHKARPFFKDLVQFMISGPVVLMVLEGENAVLANRDIMGATNPAQAAEGTIRKDFATSIDKNTVHGSDSLENAKIEIAYFFRETEIHSYPYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Myxococcus xanthus nucleoside diphosphate kinase and its interaction with a nucleotide substrate at 2.0 A resolution.
pubmed doi rcsb
source organism Myxococcus xanthus
molecule tags Phosphotransferase(po4 as acceptor)
molecule keywords NUCLEOSIDE DIPHOSPHATE KINASE
total genus 43
structure length 143
sequence length 143
chains with identical sequence R
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 1994-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 1nlkL00
3VGVA 4UOHA 3ZTPA 3BBCA 1NCLA 2HVDA 3PJ9A 4C6AA 2BEFA 2NCKL 3EVMA 3FCWA 3NGTA 1NDLA 1VYAA 4CP5A 2CWKA 5IOLA 3ZTRA 2BX6A 5CABA 1WKJA 3B54A 1KDNA 2B8PA 1HIYA 4ANEA 1NDKA 1NSPA 1PAEX 4O0NA 1LWXA 1MN9A 4FKYA 3VGTA 4HR2A 1F3FA 4DZ6A 3FKBA 1ZS6A 3G2XA 3Q89A 1BHNA 2HVEA 1K44A 3FBEA 1NSQA 4ANCA 3ENAA 4ANDA 1WKLA 3Q8YA 4DUTA 1W7WA 2DXDA 1BE4A 3ELHA 1U8WA 3L7UA 4F4AA 2DXFA 1S59A 3BH6B 3NGUA 2B8QA 3DKDA 3EVOA 3VVUA 2ZUAA 3JS9A 2DY9A 1B99A 2VU5A 2DYAA 3ZTQA 3VVTA 1NB2A 3Q8UA 3ETMA 1NPKA 2AZ3A 5CAAA 1NDCA 5BXIA 4S0MA 3Q86A 1MN7A 3BH7B 3EJMA 4EK2A 3DDIA 3VGUA 1NUEA 2HURA 4F36A 3FBCA 3B6BA 3GPAA 1S57A 1HLWA 1XQIA 3FBBA 3FC9A 1XIQA 1NLKL 3EM1A 4KPCA 1HHQA 1WKKA 4WBFA 3ZTSA 4ENOA 3MPDA 4FKXA 3BBFA 2AZ1A 1NHKL 3EMTA 1NDPA 1S5ZA 3WX8A 3FBFA 4DI6A 2DXEA 3EICA 1LEOA 1PKUA 3Q8VA 1EHWA 1JXVA 1BUXA 4W98A 3EE3A 3FCVA 3NGRA 1F6TA 3BBBA 5C7PA 3EVWA 4UOGA 3Q83A 3NGSA 3VGSA 4UOFA 3PRVA 1UCNA 3R9LA 3GP9A 3ZTOA 1NSKL 1B4SA
chains in the Genus database with same CATH superfamily
5DZ6A 1XTZA 4ZVSB 4I6YA 2ASDA 4LFCJ 2KVIA 5F3TA 4BC9A 4ES3A 3FQKA 2X1GA 2DNPA 3DDKA 2HVDA 4ELTA 2BEFA 4NRUA 1NJIT 1AA1B 3GTYX 1R8HA 3MM9B 2RU9A 3NY0A 5B0CA 3JAMY 2Y1RI 3F44A 2EFGA 4M5KA 3PJXA 2KXNB 2OFGX 4ER8A 2NZ4A 3BYRA 1F5CA 2MZSA 2E1AA 2E5JA 4Y34A 2Z58B 3CXCR 1EQ0A 4LF5F 4PPZA 5GMKa 1Q16B 1YHQS 1S6PA 2MGZB 3M6UA 3P6YC 1TMMA 1BQMA 1ZAWA 2X3GA 3B82A 2A2DA 1DY3A 3GSIA 4O0NA 3CCJS 4DQQA 1GK8A 3S01A 3VGTA 1XNRJ 2VONA 3OR1B 4D3GA 1N52B 2DBBA 3IXQA 1DQAA 1ZS6A 4X4QA 1H7XA 4DL7A 2B4OA 2VPZB 3DGPB 3DI6B 3GWCA 4UF4A 1J5EJ 2PN6A 2B4VA 1XWLA 2Q6CA 2K2PA 4DX6A 8RUCA 1DBDA 2AWZA 4PR6A 1T9XA 2GJ2A 2QA2A 3Q8YA 3M8PA 3W9IA 4Q8EA 1FDAA 1RA6A 4EMDA 3BS9A 2MTLA 5E41A 3Q8RB 1KC8T 4LRFA 2DPJA 5IV3A 1GEHA 4E8UA 1Q8LA 3CW2C 3NGKA 3O5TB 2CVEA 3WHIA 5CYJA 3CCQS 5HLFB 2QFIA 1Q53A 2CYYA 4OV6A 4ED5A 2EG1A 4FDFA 3DCAA 1JLQB 3V4IB 2QL5B 4J9UE 4H4MA 4JI7F 1YJVA 1OO0B 4O4RA 4OJHA 2WVBA 2QA4S 2ZUAA 2Q66A 2Y8WA 1K1SA 1T11A 4B9VA 2GO9A 2V8HA 3I4PA 1S0NA 1E6YA 3AT1B 1JLQA 5IXUA 4CM0A 4IQMA 5AXKA 5HBMB 1CS4A 2QLBB 5FLXU 4J9NA 4U6PA 1U6ZA 1NDCA 1RT3A 1U0HB 2M52A 2VL1A 1RHKB 4IDKB 4ID5B 4ZJQA 4GKKF 4QZVB 4I56A 1RT7A 1WI8A 1KFSA 2XSFA 3AQOA 2RT3A 3UD5A 1KQGB 1CS4B 2KM8B 2PFFB 2G0CA 5KFNA 4QR1A 1SL2A 2VC1A 3D0IE 2DT9A 1KONA 4IFVA 1QAIA 4JI5F 2CNLB 3FBCA 3CCZA 4RUBA 3BR9A 3E2EA 2FGOA 4UZCA 1YWXA 2OTJS 4JI0F 4ZLJA 2K1RA 2CPFA 2V8DA 1Y3JA 3HVTA 1N48A 1YJTA 4TKTA 2XCPA 2ZH1A 4HYKA 4R8UA 2VJVA 2Z2MA 1NM2A 3CJRA 3VZIA 2HWHA 2ASYA 4FBUA 4KYZA 2XNQA 3PR4A 1ACMB 2RRNA 1ZTWA 1VC0A 5AE2A 5EWEA 5FJ4A 4WIQA 1IVZA 5HROA 5KG0A 4X4SA 4DSKA 2HWIA 3EZOA 3GFZA 3D6HB 4TXSA 1PC5A 4P71A 1N6QB 2UU9F 4QR0A 3CF5Q 2DXEA 4A8FA 4AL5A 3FK4A 3BSOA 2XS2A 4DCJB 4LQ9A 2LDYA 2DB1A 4KSEB 1SJ1A 2P9GA 4KQZA 1N6QA 4LRAA 1F6TA 2DHXA 5SUHA 2Z2LA 3R5AA 2VBZA 5A8KA 3EVWA 4WFZA 4KO0B 1FRKA 4HT7A 4NRTA 4EZ6A 3ZZUA 3MOJB 2J9EA 1UP1A 3M4XA 3QQCD 1YTYA 2YTCA 6AT1B 4C97A 3IP0A 1S79A 2KVQE 5CZXA 4EFAC 1ZOTA 2VQEF 1CULB 1XMQF 1VRTB 4QWAA 4DUZJ 2F4VF 4PYAA 2XI2A 3K57A 1REVA 4RW8B 2I5JA 3QLHA 5A6PA 3ZTPA 3FMBA 2CQCA 5F0WA 1OYDA 1FXDA 4DUYJ 2AF6A 4USWA 2MZ1A 2HFOA 4F02A 2YKQA 3MDFA 3H4DA 3RAXA 4CZCA 5KOWA 4X2BA 2QLXA 3A8KA 4PG8A 4LFBJ 1M5SA 1X9WA 1N5QA 1VBZA 3R97A 1KDNA 1HBNB 1NU4A 2VA3A 2FY1A 1TVRA 5F9LA 3KK2B 4RKUC 1FKOA 2XQCA 3TO8A 3QIPB 4X64J 4YN3B 4OX7A 4CLPA 1Z2ZA 4ZCMA 3Q24A 1O8BA 4P6QA 3TQ1A 2NREA 3AOBA 1HI1A 1IBKF 2BBEA 1WEXA 2FHJA 2GVZA 3R1HA 5DRKA 3P3DA 1DZ5A 1IBLJ 4ILMA 1T94A 4HTIA 3CT9A 3M2VA 1O0PA 1SVDA 2B4PA 3M2UB 2AGOA 3M9OB 1NK8A 3CCRS 4XDCA 1SQFA 2HNZA 1WKLA 3C6UB 5FIIA 3QO9B 1YRXA 2LMIA 3H90A 4P52A 3OL8A 2X3DA 4A8QA 3UCUP 1YJ9S 3J7A1 4B3MF 4EI2A 2DNHA 2E7WA 3VR1A 4CLTA 4WFNQ 3BQ2A 2AD9A 1U48A 2FC9A 2HG4A 3CB4A 4Q2MA 5JXSA 4HT5A 1HNZJ 2OD6A 4NEYA 4WFYA 3RRGA 2CWXA 2RSQA 2G13A 2XMJA 3AD9C 3N4WA 3KLHB 3TUJC 4PWDA 4LF9J 5LMUF 3VTIA 2LQ9A 3CCWA 1X8DA 2B56A 3IO1A 3KG4A 3BQ0A 5BYQA 4KIAA 2AIRB 2DHGA 1VQYA 1BMQB 2CJAA 2KYZA 3JQJA 5RUBA 3EPIA 1LWFA 3A8EA 3TA0A 3BYPA 2IJRA 1DURA 2YNHA 3HF5A 3WX4A 4ZHRB 3KJFB 4HACB 2ZHAA 2ZNYA 2C2KB 3AFGA 4YMEA 1KWMA 4G1QA 3PIPQ 3QWPA 4JI1J 3C16A 4ZPTR 5HANA 1D9FA 1A6LA 1U24A 2DHHA 2MLYA 1KHWA 2HQFA 1PYTA 3CEDA 3CUNA 2V63A 5IT4A 3EJMA 3QRQA 2V4RA 1SJ4P 2ALYB 1TUVA 2FLOA 2VD3A 3DOMA 3T1HF 1JLEB 1RT2B 2ZBRA 3E01B 3BGRA 3TP2A 4ED2A 3W8GA 3ZNUA 1UJ4A 2CJKA 3A13A 2JX2A 4NASA 1TFYA 2ZHOA 1U2CA 2ZE2B 4JB8B 1RLCL 1NLKL 2DCUB 3FRYA 4WZQA 1RWWB 4ZVHA 3A1YG 2EFPA 3GMGA 2ZJQQ 1VQNS 1GMUA 2OMOA 4ZP6A 2W25A 3M8QA 3IWNC 3CJSA 2DD8S 4ZVTB 4ZN1A 1RHUB 1W2BR 3PRDA 3NAIA 2AGQA 2ZEJA 2D9PA 4KGKA 2V4JB 1MG7A 1RQ0A 4J9OA 1FE4A 4KKOA 4B02A 4NXMF 1TAUA 5JUMA 3D6FB 3BEGB 5DG9A 4WFAQ 2OI2A 1RAGB 2V4JA 4WYWA 3CPWR 2P9CA 3FDSA 2WVFA 4ZVGA 4ZPWR 4RW9B 1NXIA 3J7YI 2EFOA 5ETPA 3T5LA 4WWSA 2Z2YB 1RTHB 4K7QA 5JJBA 1T02A 2H51B 2DHAA 2NLWA 2KYXA 2ZNZA 4CM2A 3N6MA 5BJRA 1G4CA 3UDLA 1TL3A 2KG1A 1G7CB 3SI8A 1P9YA 2AEMA 2JEIA 1BC6A 2IHR1 2YNGB 1RAAB 2BW7A 4LREA 4PQUA 3POTB 2MJUA 4ZPBA 4F25A 4NLRA 1EIYB 3D7SB 3FJ2A 3PRBA 2JHEA 2XI3A 1H2TZ 1VYAA 4QIEA 5D0RA 3MR2A 2QMWA 3S7RA 4HHJA 1Y9OA 2OPPB 3H42A 3GIJA 4USJC 2B8PA 2N7YA 1AB8A 4ZN3A 3KWMA 1FDBA 5HVGA 2E66A 2W1BA 5J1NA 1X9MA 5I3UA 2L9WA 3VALA 3KDNA 3ENQA 2YNIB 3CDAA 2B51A 2Q43A 2H4WB 1N36J 3WDOA 2RS2A 2ZH8A 1VJQA 4DX7A 1D3WA 4Y00A 4ZCKA 1YG0A 2Z0GA 2PI4A 4OHZA 2YWEA 4NPOA 1BHNA 4MFBB 3EPGA 1XBWA 5L9XA 4WKYA 4ANCA 3EYZA 4JI6F 1U2RA 2Y1JA 2AGPA 3NL0A 3ZC4A 3G6YA 1FX2A 1RACB 2DGTA 3P96A 4CT9A 3HHNB 2DNGA 4USIA 2KFYA 3CGIA 4DV5J 4NWBA 1F9EB 3ZO7A 4OZ0A 2NS1B 1U8WA 4MFBA 2EI5A 1N36F 2E29A 2CZVC 3BH6B 1LQ9A 1RLDA 2IAJB 4FS1A 1LWEA 2BMBA 4D3HA 2VBXA 2RRBA 4WP3A 1H38A 4B3SF 2DITA 2ZOMA 1FTCA 1RWOB 1F1BB 1VQ4S 3M30A 1RHQB 1SC4B 3I9ZA 3IS9B 5A8RA 3KK1A 2CQPA 4OJ1A 5LMNJ 3OUYB 3KLFA 2K8GA 3DLJA 1PO6A 4PUOA 4J9QA 4ZPDA 1IQZA 3DNCA 2W2MP 2FJXA 4OYXA 2UP1A 4YUDA 2EFQA 5K20B 3FZBA 1NZAA 3IS9A 3SDEA 3A3NB 3DOLB 2G2OA 3ETMA 1Y5LB 4KE5A 4LFAF 4CH1A 5KFRA 5E2QA 4DU8A 2XYHB 4TYBA 5D6GA 3AQPA 3VZHA 5DGAA 1DQ9A 4I67A 5G0RB 1HMVA 5GAHI 3KJNB 5KFQA 2IIHA 3LGMA 3MEGA 1HNIA 4U9RA 1XK8A 5ITHA 4DV6F 5FDLB 1T9UA 2DR6A 1FXRA 1O6XA 2DGXA 3MAAB 3OSNA 1DQ8A 3HFVA 1L3KA 3KHGA 1M5KC 4GC6A 3MECA 1Y0HA 1RU2A 1QM9A 2HNDB 2QMUB 2XS5A 1IUJA 3PNIA 2RIJA 4Y2AA 3UN3A 3W5YA 3KHRA 3W2WA 3OTOJ 1SPBP 4L76A 2W2PP 5AXMA 3MTJA 4WBFA 2GV1A 2AW0A 4M5JA 4QIVA 4ZLNA 1VQ6S 2M2BA 5CHCB 4ZCIA 5J2PB 5IZHA 2KRBA 1RP5A 3NWRA 1KVIA 2AX0A 2XMKA 2RDIA 4DV3J 3QYYA 3KHHA 1QE1B 2ERRA 1U1QA 3IN5A 3AH6A 4NCBA 2LU1A 2W9AA 1EHWA 3P49B 4YFUA 3MURP 5IC6B 1E6VA 2XBPA 3NNHA 4DOZA 1NBEB 3W65A 1PIEA 5ETKA 1URRA 3CMQA 4ECRA 2GGPA 1WF2A 4RWWA 3N9UC 3RTVA 3MPYA 2GNKA 2W4PA 4K2JA 2KM8C 3CCSS 1FWKA 3GJQB 3MEEA 3VAMA 1JJHA 1H2UX 2EG2A 4FPRA 1WG5A 5J1EA 4X4OA 4NI2B 2QV6A 3O2IA 1S9EB 3OTEA 2ASJA 2HHHF 4LRDA 2X1FA 2HVHA 1HWJA 4JP8A 4OJ3A 3MWBA 2J8SA 1CJTB 2HQCA 3J81Y 5EN1A 4X66F 2XMTA 4RUCA 4Q43A 3U1NA 3Q2TC 1MU2B 3IR6B 1EARA 2W7AA 5K5MA 3PJ9A 4O44A 4DR3J 2BANB 4LMZA 3CIZA 5DO2A 3EVMA 3SCIE 1XMOF 1NDLA 2XSJA 3CO9A 2HS3A 5D8HB 4R25A 1X31C 4FXWA 2YPYA 2CJYB 2DR9A 1KKHA 2BX6A 2LQ5A 2D69A 3FSYA 1I6JA 4C11B 3K5NA 3SIPB 4M63A 2CFXA 1OPIA 3GCXP 2LFVA 3H0PA 2DNNA 4M5HA 4KT0C 3NG8A 4OFZA 1Y3KA 3MPUB 4YQWA 1RA7A 4Q8FA 1N32J 1S1VA 1JJCB 2FQQB 4EYIB 4U7UD 2HW3A 2JVOA 2JZ5A 3BB5A 4IH6A 3KLVA 4ED6A 1VHIA 1SUQA 4B9UA 3GQCA 3MUTP 1GMVA 2M5YA 4LFBF 5DM6Q 1S48A 4DV2J 1NJYA 2GC8A 2PD1A 4YR0A 4H4KC 4V19X 4ECTA 1FXLA 1MMLA 3IWXA 1WNEA 4ZP9A 1S12A 2HVEA 1K44A 5AE3A 1QTNB 2MZJA 2EC2A 3GYGA 4J7CA 2GAHC 2QL9B 4RNHA 5AJ3J 1CQNA 1JMTA 1KVKA 3AODA 1HQEA 1Q8KA 4PABA 2JEFA 3G4SS 2EEYA 5G4DA 1Q8IA 1RT5B 2HGLA 3DGPA 3DI6A 3JSBA 3PX4A 5IWAJ 3PV8A 1AUDA 4DQPA 4FYVB 3ISNC 4CQ1A 4EEYA 2HHWA 4K4WA 3NP5A 4HI1A 4MIWA 1FO1A 3SFGA 5J2MA 2FJVA 4LF7F 4ZJOA 5KG1A 4PZVA 3RAMA 3HT3A 1YRTA 4KO0A 4OI6A 3DLKA 3RBXA 1DRZA 3QGPA 3LWLA 4DR1F 2B6AB 3ZNJ1 2EKNA 2F9DA 3KLIA 3OR2A 1TP7A 2VFSA 4KB7A 4K4ZA 3VVTA 4CH0S 2VASA 2EWHA 2RVJA 1M90T 1TK0A 3J7AN 4AXJA 2BABA 4DMZA 2DHSA 1PYOB 1FDDA 1FRLA 4IOBA 3W66A 3OD2A 5KFCA 1HWUA 2J7KA 2KFZA 2ZJRQ 4M1KA 2PE8A 5LJ5Y 5I3PA 4ATNA 5SZTA 2W7PA 4OYMA 4ECYA 2HS0A 2HFNA 2I8EA 1VDHA 4ZKAA 4OJGA 3GV8B 1S72S 1KLNA 2HHUA 1YQHA 3WC0A 2X51A 7AT1B 4DSEA 2ASLA 3K7RA 2DPIA 1S77D 4RBTA 2OH2A 3W61A 2VH7A 2KG0A 4URGA 3QATA 4ETZA 3D66A 3GFHA 2IDLA 2AYGA 2UVVA 3P8BB 2WSCC 1XR5A 1U6BA 4NLGA 4K4YA 4KGMA 2EK1A 1XIQA 4ZVQB 2DO0A 1H73A 1SJRA 3QJPA 5DGBA 1QY7A 3DRRA 1NSAA 1Z2LA 3R1LA 2DIUA 2LEBA 2R7TA 2OAUA 3PCOB 3R7NB 3W64A 1YKWA 2V8PA 3HZEA 2O3DA 2N7CA 3ET6A 3FBFA 2A10A 3EICA 4U8VA 3THVA 2NZCA 3QAEA 4W98A 3VAIA 3CJ3A 1VK8A 3KJVA 2DR8A 4ZIVA 1AYEA 2F9JA 3BDEA 3ET6B 3O1LA 1M0SA 2BE9B 3MAHA 2FHOB 3P5TL 4DUYF 1RAIB 1OQ3A 1CJUB 4CO4A 2O5DA 1DTTA 2QE5A 3IM8A 2AYEA 4DR7F 2IY5B 4M8LA 3R9LA 2KKHA 2W24A 3OXFA 3KXDA 4BS2A 1GMWA 3TWZA 5B0BA 5CCLA 5DDRC 2XY5A 2BJ1A 2HHPA 3S1TA 4TQRA 1RTDA 1JKHB 2DRDA 2HRTA 3GJRB 3LP1B 3SV3A 4HLBA 2CPJA 2BW2A 4C98A 4QYZJ 3NGTA 4DR4J 2GIFA 3CVKA 4MJKA 4I64A 1BQNA 1REVB 4RW8A 4TNOA 4DL6A 3R7SB 1ZA1B 2DEIA 2H1YA 3DRYA 4OZ5A 2R8GA 4NXNF 1FCAA 1MLAA 1WKJA 1ZA2B 3NOCA 2GX8A 1UFKA 4M5NA 3OBIA 4EU0A 3DOMB 1BQNB 4HHUA 2YWHA 4UZBA 2XB2D 1RDRA 4IKAA 2B7BB 3UFCX 2MKHA 1WORA 1GMWD 1X4CA 3US5A 1H2VZ 3BO2A 3E51A 4TLQA 2HHXA 4N8OA 1JLAA 3DM2A 1KQKA 3VWSA 1C2PA 3MM8A 1URNA 2LVWA 4NZ0A 4TLRA 2Z8QA 4DV7F 1RWNB 5K8OA 1ZZFA 2W9BB 5D4PA 3TA1A 1GT8A 2F3JA 3GR0A 4ZP8A 2ZH2A 3FGVA 3M8QB 5D78A 4E98A 3OTDA 1MWQA 3W7BA 4I2QB 5A76A 4FP9A 4M5MA 4JI7J 4JV2A 3D5MA 3OQ2A 4IFVB 4DCPB 3R5GA 4DN0A 1UVKA 1IKXB 2QGFB 1FT8A 1U6FA 3THPA 4IRDA 2H65B 2VQEJ 1XMQJ 2D9OA 3AA9A 2W2NP 2JFKA 3HSZA 1KLMA 2HNZB 4L74A 4RX6A 5IT0A 4K4UA 3TZZA 1S9GB 1FK9B 2HQGA 2WSFC 3EXYA 3FFIB 3I5CA 3MM5A 1U1NA 4FNIA 1FRHA 2R7XA 4WJBA 1PAUB 2V8VA 4LSLA 2Y3YA 5A0YB 3JTNA 3L7OA 5KFIA 5HROB 1RAJA 1DTQA 4ECWA 4DQSA 3RBEA 5GADU 2XLKA 1NHVA 3UR0A 2V67A 4DV1F 4KPYA 2CRLA 1HWLA 3DMJB 1KSPA 2WHOA 2K7KA 2M9KA 2Q3PA 3LTOA 4ZK7M 3KDOA 2W9CB 3BGUA 1GX6A 1LV5A 1ELOA 3BH7B 3UI3A 1KP6A 3FZ2A 2IJFA 3A8IA 2IFXA 2OEKA 4GO7X 1U1KA 2GIRA 1HBMA 3EGNA 4K59A 4OI1A 1IBKJ 3MCMA 3MI7X 4I2PB 3RRKA 2W4CA 3MM6B 1UETA 5KFOA 3ITHB 3QSYB 1U2FA 3KTQA 1S57A 3N5BA 4OZJA 3HHEA 1C1CA 2IVYA 2MQNA 2RILA 2BYCA 3B78A 4P7VA 4DLEA 5HATA 2BOAA 1HBMB 2ZC3A 2WBMA 4OLOA 3HHLD 4TVAB 4C0HA 2X1AA 2R2RA 4DL3A 1WG4A 1JLEA 1RT2A 4HI2A 1WC1A 3IMQJ 3MMBB 3V4MA 3FSIA 5L1IA 2FJEB 4AT1B 1JQGA 2J7WA 2A0FB 4UW2A 5BYRA 4Y0FA 2ZE2A 3GIKA 1ZTTA 5L8RC 4W90B 2OKQA 3C15B 3AXKA 4ZJLA 5MAOA 3AB4B 1WSVA 3W2VB 5KFKA 1NK4A 2VG5A 3OTCA 2VC0A 2BE7D 4LF9F 1NDPA 5C7PA 1FHTA 2CZ4A 2CJQA 1NJXA 3GV5B 4O3QA 4IG3A 4DL0C 5GADI 4DV1J 4EBDA 1YIJS 4OV1A 4BC7A 2HAIA 2CNNB 4ECXA 4KTQA 1TR0A 3SQGA 1K47A 3NGRA 1K0VA 5A2QY 4IO1A 2M0GB 3I0RB 4DSLA 2IAJA 3G6VA 2YX1A 4NCGA 3T1AA 2LCWA 2P6SA 3NGSA 5CH7B 4OZNA 4ZVPB 2R2SA 2GVZB 3J7YU 1HHTP 4KGVB 4B3OA 3HHDA 1C0TA 1TMJA 5E3QA 1N5TA 1S1WB 3OUYA 3I0RA 4XIUA 3KLFB 4M94A 4FYXB 3FCHA 3BREA 4Z7CA 2XEXA 2V9KA 4ZCLA 2NPFA 4QPTA 3D0GE 4RU2A 3MPWA 3IBCB 4WFXA 1FRXA 3I82A 3VCDA 5DLGA 3EX7B 1VQOS 3OTBA 3OPKA 4MKBA 5ETTA 1N5SA 5AT1B 4USMA 5DLFA 1J5EF 3HHLA 3D6TB 3M32B 4PQAA 4F7VA 3KYLA 3RW6A 2CWKA 2WSEC 1R0AB 1I94J 2DH7A 2GS8A 5CABA 3I0SB 5EX3A 3OFEA 4OZLA 3H5YA 3VAHA 2C28A 4WZMA 5DDOC 3ADAC 3CSKA 3NLCA 1NDKA 4RJVA 4U67Q 4LF6J 4JOUA 4PWWA 5D4OA 4DUZF 3A8JA 4O4GA 2XLJA 3GG0A 2YX7A 2UUTA 5F8IA 4FKYA 3CD7A 2BA9A 3TI0A 2JJ4D 2E1MC 5A6WA 2Q1LA 4O3PA 5LT5A 1QJHA 2HQ3A 3DU5A 3K2YA 2RE1A 3A3PB 3QGGA 1XMBA 5KG5A 4IR9A 3C16B 1FESA 3I31A 5I3UB 2ZM6F 5L39A 3MGJA 1I51B 1ICEB 2LXUA 3DN9A 5HN0A 1QAXA 2CZ9A 5C5JA 3M9NB 1U8SA 1YRUA 5DQIA 1NJWA 1VLYA 2C2MB 2YH0A 1FA0A 3RB4A 4B3TJ 1H6KX 1RBAA 3GCWP 3GB0A 1WEZA 1R8PA 4ED0A 3C3LA 2VJUA 1U7LA 4KHMA 4YDXA 3BDPA 4O3SA 3IAS9 2YPZA 3MXHP 5DJBA 4PG7A 4DFPA 1UVMA 3NGUA 2LYVA 4L6V3 3CTRA 4WTOB 3N01A 4Y2CA 2PA8D 1VK3A 2IA0A 4YOEA 1WDDA 1DLOA 4RW4B 4C8NA 3UVJB 4LIWA 1FFSB 5B0GA 1S10A 1G6BA 3DC2A 5K14A 2B43A 1R8BA 1HA1A 2R4FA 4NLSA 5KFHA 3MEEB 3PW4A 1N33F 1UZHA 4G1PA 2C3PA 5THWA 4R5PB 5J1EB 4PPDA 4WCEQ 4IR1A 1R6VA 4QWDA 2AYBA 3CC7S 3LH2S 5F8HA 1RHRB 5I42A 1AUSL 2CJXB 2FJAB 4FXDA 2XHWA 4FN5A 2VICA 3JSYA 4I7FA 1MMNA 3M6XA 3M7VA 1FNMA 4ED7A 2HVIA 1HNVA 1KVJA 3HPOA 3BJYA 3GG1A 4J9RA 3TA2A 4O0IA 5KFMA 3HHLC 3P5BP 1GNKA 1X0PA 1ZAVA 5EX0A 3SV4A 2PC6A 4X4UA 5J2QB 1VQSA 3P4UB 5HK4A 3PW7A 1MWYA 2LQJA 1RTHA 2QA1A 3NAHA 3R8YA 5KG2A 5EDWA 2U1AA 2MKYA 3OW2R 2C2DA 2MZTA 3PY8A 4QQBA 2YWKA 2PA3A 3TNVA 1VQ8S 1HHQA 4YR2A 3Q22A 3IRWP 1WOSA 2NPIA 4PQUB 4DX8H 4J9VA 2F8MA 3I55S 3KG0A 4C3MA 4CCHA 1HQ2A 5IC4B 2IM1A 3G6XA 1UZDA 3V6DB 3EZUA 3M2RB 3TJ8A 1T05A 3W2WB 2MY7A 4K4XA 3AHPA 3IR7B 1FKPA 1S5ZA 3R7BB 4L73A 2CQIA 4DI6A 4EWTA 1C0UB 1S1TB 1X9SA 1K73T 3UCGA 4PRFA 1S0MA 3MR7A 4WP9A 5AXNA 2AU0A 2M8DB 3BM7A 3K5PA 1N8RT 4TY9A 2GMJA 1HARA 1LXJA 2ZH4A 2IRXA 1HYSA 2WVEA 2A1BA 3D6MB 4HDHA 5DDPC 3M8YA 1RHMB 4JV5J 4UOGA 3QT7A 5HP1B 3DOKB 2POKA 1MWZA 1FDNA 1RADB 1IR0A 1TL1B 2C3MA 2OSRA 2C3UA 2ROEA 1UCNA 2VBYA 3PM9A 3V4IA 1FJEB 3DLKB 3MMAB 3PKMA 3LUYA 2PEBA 3TZWA 2B6AA 2HLTA 2JC1A 1V6HA 1D9DA 1HPZA 2MMYA 3JYTA 1WF0A 2HS4A 3M8WA 2YVSA 4H4OB 1T9YA 1EP4B 5LOQA 4JV5F 5DS7A 3FCWA 1UVLA 2B9YA 1XC9A 2CPDA 3QGIA 4ID5A 4BLGA 2EK6A 1Q79A 2GO8A 4OI4A 5IOLA 2J0QD 3CNQP 3VQTA 4PXBA 2IDEA 2HZAA 5BR8J 4DL5A 3UNYA 1EP4A 3SEOA 3TX8A 1NK9A 3MEDB 2VV5A 1WSRA 3G71S 3K17A 5E3AA 2GHPA 2F65A 4AD6A 4L3NA 4YY3J 3R5BA 2DNLA 4HL9A 4KGXB 1YBTA 4IH7A 1PJ6A 2DR5A 1HNXJ 1TV6A 4FNHA 1YZ7A 2IC3B 2MSTA 5A8WA 3CC2S 3EUNA 1V3SA 4AUKA 2HYIB 2BE2A 3PYFA 3NCPA 3VQSA 2WCXA 3CULA 5EUHA 3MR3A 5DETA 3VAJA 2IBOA 2FY8A 3C46A 2HHHJ 4K2XA 2HBYB 1BXNA 1HBOB 4RW7A 5GAEU 3RBZA 4ES2A 3MUMP 2YKOA 1BQMB 2DXDA 3I5BA 4N7TA 3HJFA 1BE4A 3W1YC 2QEXS 1EKSA 4F4ZA 2XZTB 1TKXB 3CDBA 4WXWA 5CYMA 1NKBA 3BO4A 3KK3B 3EDRB 3QIDA 1SKSA 2OMLA 2KXHA 4WIIA 1XMOJ 4P73A 1ZM9A 2QT7A 1KN6A 2VZ9A 1T8EA 1U1RA 2A3JA 2I0XA 1DHMA 4FYWB 4P72A 4W4MA 1QVFR 2FJBB 1G1XA 3FMWA 1T03B 3JTOA 3D1QA 4YB5A 3TRGA 4ED1A 1HR0F 2F8HA 3MCSA 3PG9A 4O3OA 2JLFA 4A48A 2FVSA 4B3RF 1CLFA 3PTWA 1RBOB 4LRCA 4F4XA 3K5OA 2HFVA 2HIYA 2QC3A 1VRUA 2YQ0A 4MYUA 4ZS6A 4NLDA 2PDAA 2Z56B 5CA5A 3GILA 3HVRA 3F56A 2UVRA 4TU7A 1OY6A 5BYSA 1NKCA 1HFEL 2NSBA 1F60B 4DL2A 4KJIA 4NLYA 1E6YB 3H2LA 3LA0A 4M5GA 1HNXF 2GHWA 4PWDB 4Z7YA 2G1DA 1OMSA 1TVRB 2BM0A 3HDSA 2HWTA 2GA7A 4C0BA 4KPCA 2FJWA 3JSRA 2HRUA 1QSLA 1JLAB 5LXYA 3MM8B 2F40A 3JQMA 3MPDA 5CZVA 4F3QA 5LXRA 1TK8A 1H74A 5LSOA 2OPRB 3IG1A 1S1UA 1TZ0A 2AZ1A 2HBRB 2ZWPA 2VA2A 1NHKL 4EBCA 1KFDA 2N3LA 5KFWA 3WX8A 4ECSA 4Q5VA 2C2EA 2KXFA 2AJ2A 1VR6A 4GKJJ 2FYXA 3HVTB 3R5JB 1NRKA 2AP6A 3Q8SB 3GJTB 1QTMA 5KT7A 5C42B 2OTLS 3ZZTA 4U95A 4ZPVR 1SKWA 4GKKJ 1C1BB 4F4WA 2D74B 2PO4A 2KFNA 1KLMB 1RAOA 2FLLA 1U45A 3OT9A 1TKTA 1UTAA 5CCMA 1OSCA 2OEJA 4UOFA 2E7XA 3V6HA 1IN0A 1LW2B 5LJ3Y 4V19J 5DG8A 1FTRA 3ZTOA 1A0OB 2ZH9A 3TUPA 1HHSA 1B4SA 1X0FA 3J81j 2MKIA 2D3UA 4U7CA 1M5HA 1HI8A 4LSLB 5A0YA 2OD4A 3AY0A 1Z4UA 1FKAF 2VKZG 4NLUA 5H9EK 2C2RA 4NLTA 4CLFA 3FQLA 4CYUA 2VFRA 4EO6A 2CQ0A 2GVDA 2VFTA 2YWWA 2XLIA 4DPOA 2C2NA 3K5MA 5HLFA 1ROFA 3L7PA 2ATCB 1LW0A 5J2MB 3DLHA 3TZYA 3CMAS 2U2FA 9ATCB 2G1HA 3OXLA 5JMNA 1JLFA 3AD7C 2C2ZB 4IYQA 2GVDB 5D0HA 2R8KA 2FJDB 1PAEX 3E01A 3T1YJ 1ULRA 5A2QU 1B7YB 1SH0A 3ZZYA 3OR2B 3PX0A 3V81B 3QAUA 3IBFB 1JLFB 1AT1B 1U25A 5HBMA 1BGXT 3T6JA 4F67A 5C25B 2BQ3A 3UPFA 4DR6J 4YB7A 2KZZA 3F0NA 4K0KJ 2UUCF 3CJ5A 3MZIA 3M8RA 2IA6A 3FBEA 3MUVP 2DR7A 4FF3A 1UEVA 5KFZA 5C25A 3W9HA 4DX5A 3HKZD 2CQHA 2ZJPQ 2OPQB 3T41A 2WVCA 1W7WA 2HGMA 2DNQA 3QIPA 4URSA 2X1BA 3A12A 4MAKA 4N8NA 4ED3A 4DF4A 1ZETA 1I5OB 3L7UA 1TTHB 3PVXA 2IBKA 2V2QA 4YP3A 3RBDA 3H20A 4H4KA 3SQOP 1FF2A 2D41A 3M1VB 2XMWA 5DDQC 3BN7A 2LECA 2OEMA 3JQKA 3DKDA 4KH1B 2ILYA 4WYLA 5J2NB 3THTA 5KOXA 4USUA 1HR0J 3TJAA 3ETOA 2H5JB 2XGPA 4CO2A 2J6TA 1REGX 2QTWA 5CD4A 3OJUA 3G9CA 2RF2B 2ROPA 1SJ3P 1H3DA 2ZUGA 3HKWA 1RT6B 1TKDA 1T0TV 2RU3A 3HCXA 1HBUB 2K1RB 2WOMA 1AXQA 4NYOA 2AZ3A 4WPAA 3TAMA 4MH8A 1UKUA 4LR9A 2ZHBA 3QWUA 4NLWA 3AB2B 3POTA 2GQ2A 5KFSA 4LVOP 3VV2B 5M2PA 1HBUA 2WOMB 1FNOA 1HQUB 1TAQA 2YKMB 2MKCA 3DLGB 3HHLB 3MTKA 4NYZA 3TAMB 4Z37A 9RUBA 1M5PC 4LQ3A 1Y5NB 2CNKB 2FB0A 2ZBIA 4XPCA 2L9DA 1R3NA 1LWFB 3IFEA 4RNMA 4OHXA 3BQ1A 1U02A 1VIXA 1V5IB 2YKMA 3DLGA 4UUWA 1SQGA 3RR7A 6FD1A 1VRTA 1F9HA 1LFPA 2DNMA 2NUUG 2VFUA 4G1IA 2H9ZA 2RDDA 4I2PA 4Y28C 2R7QA 3OJSA 4O23A 4NXMJ 4UOCA 3PW2A 2HHSA 4JI4J 2CQ1A 1GAOA 4Y6IA 4RUAA 2KHCA 4F0HA 3DLEA 3HM9A 4LR7A 3BSAA 1CJVB 3NKYA 2H5IB 4JBCA 4C0OC 8ATCB 3GIMA 4JI0J 3NNCA 3BGRB 4IFYA 1QAYA 2YX4A 2BJ7A 1OS5A 3PHEA 4OIXA 1RT1A 4PKDB 2CA9A 1WHWA 2BJDA 4TY8B 3R2CJ 2V6AA 2I6WA 4DFKA 3C6TB 4HDGA 1VC5A 1LK5A 4RNOA 4ITSA 3R5CA 3OVSA 1FJ7A 4TYAA 2PMZD 4CRJA 2HIQA 1CC7A 4L3KA 4TY8A 1S6UA 2DGWA 2OLWA 2ZWOA 2J0XA 2C2OB 2HGNA 2RQ4A 4QJVA 5ETVA 2R7WA 3UD3P 1CSJA 3TOQA 1P1LA 2BR0A 3GYNA 4EBEA 2CDQA 2CXEA 2KT5A 4E2FB 4KV8A 3CDEA 4ZDNA 2NXUA 3M2VB 1AW0A 3EZ5A 1UVJA 2YQ1A 3F41A 1WF1A 2WZ1A 2DGUA 3UQSA 1N0VC 2I9SA 4Q2LA 3IAM9 1NB7A 5I42B 2W2QP 4Q45A 3M9MB 4WP8A 2BJ9A 4I7FB 2CDRB 3PHTA 1RWMB 3MD3A 2FZGB 4F8RA 4CT8A 1TFWA 2F1FA 3D9BA 3KNAA 5KG3A 3TANA 2R7SA 1KQSR 1FK9A 1Q95G 4HKQA 3F73A 1FX4A 2Z2ZA 3GIIA 3QJJA 3M2UA 2KTQA 1F9FA 4ANEA 1G3OA 3GFYA 4J37A 4USHA 3MEGB 4LF1A 3C6UA 4R0JA 4ZP7A 2VPXB 3NBPB 1M5VC 2HQDA 2C42A 4PWUA 1WG1A 4A4JA 4X4TA 3SYZA 3HZGA 2YNHB 4TU9A 3G6ES 4QOTA 1L3TA 2P5VA 2LLZA 4HACA 4JV0A 4USVA 2HNDA 3G8QA 3HSGA 1K8AT 1D0EA 4O4GB 4MK8A 3KK3A 2XY7A 2CQBA 2PEHA 2OPPA 1LWCA 1OY8A 3ENWA 3O44A 2LEAA 4K5SA 4KH0B 1UW9A 3CIMA 5CYQB 2FLPA 3LALA 3WQPA 2XMAA 1NO8A 2W7OA 2B5JB 3RB6A 1SC1B 4JI5J 1S4EA 2UXDF 2P2CB 5T14A 1C4AA 3D54A 2GQCA 1S1TA 2JOQA 4N77A 2NYIA 1SBRA 2L08A 2MY8A 3ENVA 1JNRB 2X7IA 2DVIA 4BDPA 1FERA 1R6YA 2B8QA 2RS8A 2ZOGA 3D4JA 2EW9A 5D4NA 3VVUA 2DGSA 4A8SA 4P10A 2HLUA 4DBQA 3DOKA 4RBUA 4CLLA 4P7TA 1HW9A 2HSEB 4CO0A 2QLWA 2AHOB 1IKYA 3NNAA 2BVZA 5KG4A 3HX9A 3G87A 2WB1D 2ZBPA 1EB0A 1ZAXA 2YY3A 4N41A 1NH7A 1WHYA 4B9NA 1IWAA 1TL4A 3TEHB 1MU2A 4F4KA 3Q86A 3G86A 2QLFB 4OX6A 2NSCA 3TVKA 1D09B 4URQU 1ZPVA 3EGVA 5IT9Y 4PUOB 2HNYA 3KMSA 3AOCA 1LOUA 3CJ2A 2CQ3A 3LP0A 3M8SA 2BRLA 4C11A 3PJWA 2UXDJ 5E0OA 4DV3F 5J1PA 3H2UB 1XQIA 4YB6A 3UCZP 5DZ7A 3PKYA 1UA0A 4DQIA 1YJUA 1DFDA 1R27B 1U1OA 1Q8BA 3HK2A 3FNNA 2D3OR 3V6JA 1WC0A 3H40A 2HKEA 3BPDA 2E44A 4ENOA 4YEAA 3B4MA 4OYOA 2IC3A 4XO0A 2QFJA 1FD8A 4OYIA 3JSMA 2A2CA 3O6QA 3HP6A 2XYGB 1N4LA 3KMQA 4IG0B 4P2XA 4P75A 4CNZA 3DRPB 1TK5A 4DU7A 2CPIA 2V8GA 4ILRA 2G2YA 4K8RA 4YB1P 4OX9J 3OLAA 5H9FK 2GAGC 2WK4A 2HK3A 5C2GA 1LEOA 2XZWA 5KT2A 3KK2A 1JXLA 4F3OA 1JWWA 5JVGQ 2BOPA 4MYTA 4C8OA 1P8GA 2VQFF 1R89A 2DGVA 2B9XA 5B0DA 5L1KA 2YNIA 3M6WA 2IVFB 1NKEA 1N5YB 2XCAA 2FVRA 4QCLA 1MNEA 4X84A 2YKPA 1JB0C 2HK2A 5HVHA 1RBLA 2B3TB 4ELVA 2ZD1A 1R0CB 3FEZA 2J0SD 1RISA 4IRCA 2VODA 4KBIA 1OSDA 2R42A 5F3ZA 4QWEA 3X1LB 1FJCA 1VBXA 2LDIA 3NOGA 3W8PA 4DR2F 2HZVA 2UXCJ 1SV5A 5M2RA 2H4YB 5KFGA 3NMAA 3MF5A 1NPPA 3KHLA 2CG4A 4AQYF 2O67A 2RB7A 1DARA 4KAIA 3V2UC 1B7FA 4OHWA 2IVMA 2CQ4A 2WONB 3QT8A 2OSQA 3PX6A 4C8KA 3H5XA 3MOZA 4NX9A 1VLOA 3TVZA 2E5GA 3PFEA 2GCFA 3I9V9 3TUIC 3E8OA 5F9NA 3V6KA 1OQ6A 1TKZA 2LKZA 1NNDA 1S76D 1YK9A 3C14A 1S6QA 2QSFA 7FD1A 5IQ6A 2APOA 1X4EA 1FWLA 4GKJF 3SCLE 3I87A 5LL6d 5AJ3F 1JJ4A 4F2RA 4A8YA 3ZZRA 2BM1A 1CVJA 3I5AA 4Q0BB 3M8ZA 1LWXA 4O44B 1MN9A 4NLOA 1F5BA 4KFBB 3MM9A 1P6TA 3L3CA 4EYHB 3QFHA 1WC6A 2VDIA 2MQOA 4ECVA 3NEKA 1MROA 2ZZTA 1L3SA 2UUAJ 2V9WA 2O1PA 3G82B 4PG5A 5ETRA 4Q0BA 4LR8A 3NRBA 8AT1B 2H3EB 4ZMMA 2EPIA 3OFGA 5EWFA 3HFZB 4ANDA 1A7GE 2J6SA 4B3SJ 4U96A 2VG6B 2YKNB 3HD2A 3KG1A 2D3O1 2UV8G 2SXLA 2G4BA 4DR6F 4C9DA 2KH9A 4F2SA 2JRSA 3GSDA 3MAAA 3OR1A 4GVLA 3X3UA 2EC0A 2HPUA 1HBOA 4NZ7A 2GQQA 1TELA 2QRRA 3CD6S 4BHQA 1U1LA 1NH8A 2YWFA 4RWXA 5KFDA 4RNNA 1OJ4A 1X7VA 3W63A 1RWXB 2VHGA 4X66J 2KRRA 1U1PA 4K4SA 2Q79A 4AQYJ 3KFWX 1IR1A 2DH8A 2RKIB 3M2RA 2K3KA 4P2MA 4J9KA 1T05B 1OWXA 1VQ9S 3D1HA 3Q8UA 3PO5A 4DSJA 2RHQB 2WW4A 3BKUA 4CI0B 3WZ0A 4AL7A 2R3VA 2MHEA 3UN5A 3NWGA 5L46A 2FPHX 2MDAA 1ITPA 3LP1A 2NR0A 4LFCF 4IH5A 4M5DB 2DJWA 4H4MB 3MAQA 5GVQA 3GYXB 5CXTA 4AYBD 1IM4A 1T3OA 1WOOA 4USTA 1Q7YT 1L3VA 4J9MA 1RWUA 3LQVA 3GIRA 4F0MA 2XC9A 1HD1A 1WJ9A 3DGVA 4OQJA 4QWBA 3EM1A 4OX8A 2RUSA 1UAWA 1WKKA 3MFHA 3D67A 2LXFA 4J90A 5DG7A 2HFUA 4UQTA 4JI8J 1BWVA 2VIHA 4DN9A 3BBFA 3PR5B 4IUFA 2CKWA 2PIIA 4WTYA 4U8YA 1IR2A 5KFVA 2J9DA 2NYHA 1FFWB 2ZDPA 3VAGA 2BUNA 4RL1A 5CQGA 1FEEA 3FUYA 5IQQA 1U0HA 2CIMA 4DG1B 5ETOA 1S1UB 2RH3A 5HAOA 1IKXA 4KRWA 4ELUA 5KT5A 3FCVA 3J81U 5I4MA 2EFVA 1HWIA 4RW6A 2BANA 2XWYA 2EXUA 2UZAA 5C24B 1SUQB 1MMDA 4ZVFA 2XSJB 2YNFA 4DEZA 2FZKB 4CIOA 1KTVA 3SFUA 3VGSA 2DCLA 2KL8A 3MM5B 4OZ1A 2DNOA 3K89A 3PRVA 5ETLA 5A8WB 2FVPA 4FF2A 4WK1A 2FDNA 4RNFA 1C1BA 2R7RA 1YBAA 1B0VA 2IJNA 5IWAF 4DS4A 2HAFA 3IC1A 1PBUA 1TKTB 4DF8A 1TL7A 2OUGA 2ZH7A 4OLPA 2E5HA 2MGZA 1K9MT 3KJVB 2PT0A 4IQXA 4K50A 1LW2A 1HD0A 1NCLA 2UUBJ 4DR5F 2Y8YA 1F0XA 1AROP 1S1XA 4NOHA 2N4DA 4OMFG 2P6TA 1K0TA 5CYMB 5DQGA 4J9SA 4JI8F 1JK9B 3SZ2A 2JEGA 3FRZA 5K8MA 4DSFA 1IJEB 1BLUA 2MKJA 5B08A 5F0UA 1WTBA 4HH1A 3LPYA 5LM7E 1S49A 1YBUA 1S1XB 1HQUA 2XULA 1TQLA 4LF2A 3VF0B 1ZYQA 1UL3A 4HEA9 1T7PA 4FBTA 2MJNA 3RUBL 2VG7A 3OXGA 4IRKA 1IBLF 1JKHA 1WD6A 5E7OB 1LW0B 1WOPA 3VHQA 2L41A 3BGOP 4NMLA 4JI3F 2FHMA 2QG9B 3LP2B 1F3FA 2PMHA 1AFIA 4KC5A 4QYZK 3RAQA 4NZ6A 5L9NA 2XZDB 3BKTA 3Q89A 3T9NA 4X64F 1FJGJ 1CULA 3CJ4A 1HBNA 1VBYA 4RUHA 1SI9A 4JYAF 1F2GA 2OGUA 3D0HE 4ED4A 3DLBA 2UUBF 1U49A 2OJ3A 1RWVB 1TUWA 3HO1A 3PEHA 4DV6J 3DHWC 1S7HA 5HO4A 1Q82T 2IM2A 1HKAA 3CCMS 3J7Z5 1RT3B 2PFDA 2W8KA 1OYEA 4FPIA 4IDKA 4F0KA 2R2UA 4DR1J 4DR4F 3SQGB 1RT7B 2Z57B 4G6VB 1GX5A 4Y2MA 4KR0B 1Q5YA 1X5PA 1FI4A 4JYAJ 2E1PA 3SXLA 1X4GA 4J9PA 5K8NA 3IBWA 3RZAA 3AOAA 4QYRA 5KFYA 4WK3A 5KFXA 5EGYA 4ZVOB 5D0EA 1VISA 2IRYA 3Q23A 2V50A 2RRAA 2CVIA 2AKWB 1F5AA 4F3MA 4JI3J 3IRXA 5BXIA 4KHPF 1LNQA 4P9SA 1SH2A 3N28A 1S0VA 3RW7A 4R8UB 1YITS 2DISA 2JEJA 4ICLB 5MLCV 4X4RA 1FJGF 4C8ZA 2AV5A 3K58A 4K0KF 2XY6A 1MSWD 1S6PB 3LAMA 2HZCA 1IKWA 2RQMA 1DTQB 1HWKA 2AJ0A 1PYSB 1HLWA 1WHVA 2ADBA 1DAXA 2CPYA 1WHXA 1Y11A 4ICLA 1HI0P 1QUVA 1RE1B 2BDPA 1SB6A 2C3OA 4UY8T 4UY85 3NBPA 3R6GB 2RQKA 3OVAA 1RAFB 2J76E 5GAHU 5GAGU 3QT5A 2Y0BB 2UXBJ 2LQ8A 3IR5B 2V69A 5H9EJ 3G8TA 1B70B 1SC6A 1RT4A 3MM6A 2MEWA 1IWGA 1KOHA 2G0JA 3OL7A 5CYQA 3EMTA 1Q1KA 3MM7A 4OYAA 1C1CB 1NK7A 3IGNA 2R9LA 2XTJP 3LWMA 2N4CA 4G1QB 4C8LA 4ZITA 4K4TA 4DJBA 1JLCA 1JLBA 2FTRA 5IV4A 1CJKB 5KT4A 2ADCA 2XNRA 3MMBA 2IMOA 5ETQA 4O3RA 4FYYB 2YQ3A 3MM7B 4KY3A 3D3CJ 4FS2A 4ZPCA 3BBBA 3K8VA 2AX1A 1NK0A 3L09A 3C66A 4QU7A 4OX9F 4MT1A 2HHTA 2CJ9A 3CJ0A 3W2VA 4CO5A 3UVJA 1HNZF 1C4CA 5K14B 4N56A 1I94F 3MPVA 3W5XA 3K0JA 4ECUA 1UJ5A 4GC7A 4R5PA 1DJ0A 3VGVA 4UOHA 2K7JA 4B3MJ 2AMCB 2OPQA 3UE2A 4CTAB 1RWPB 1S97A 4ES1A 2MQPA 4LSNA 4DQRA 3DFEA 4UQGA 3CDWA 3DM2B 4LT6A 3GE9A 3ULHA 1WEYA 3OL9A 1YLXA 1ZM2A 2Q6BA 2KZMA 3DXSX 3PXGa 1M1KT 1KTQA 2DK2A 3CC4S 4YS2A 2ZM6J 1KNZA 1KR4A 2L48A 1S7IA 1HW8A 2ZITA 1U4BA 2E5IA 1RJJA 2KJVA 5F8LA 2J9CA 1TL3B 4QWCA 2VOOA 4J9LA 5KG7A 3DXBA 2N3OA 4NA2A 3LO3A 5J2QA 1L3UA 4Y3CA 2LA6A 2M4MA 2FHKA 3H2VE 1YJNS 4PG6A 3CCLS 3N6NA 2IMWP 2QJ3A 5HMZA 1CEZA 4HR2A 1FRJA 1XEZA 1WELA 3RG6A 1XN9A 2D3ZA 1XJWB 4DV5F 4GO5X 3GU0A 2HFSA 3IWLA 1QUPA 1VCTA 2Z30B 4XPEA 1R0AA 1SKUB 1IBMF 2J8AA 5T7LB 2J0WA 4CWBA 4QU6A 1PJ7A 3UDEA 1KHVA 1NSQA 2DNKA 4FXVA 4LJMA 1N34J 4L75A 2IM3A 4PCQA 5D0GA 4ECZA 5D3GB 1N33J 2NXJA 5HVFA 5KFJA 3CE8A 3QJLA 2VKRA 1LWCB 3AA8A 3ELHA 4MKVA 1RTZA 4L72B 2H5EA 1SQEA 1GQEA 1P27B 4HH0A 4CLKA 3OFHA 5KT3A 2XG8A 1JJ2R 1AZSA 4RO0A 5KT6A 4IOAQ 5IS2A 4F50A 1HYSB 3A3OB 2IRUA 2F7VA 2PSZA 1XERA 2RHSB 2B9EA 3EVOA 2QL7B 1PGZA 3HHKA 4JUZA 3MR5A 4JV1A 1O51A 4I68A 3H4BA 1FD2A 2KT3A 2ZD1B 3QZ7A 3OHAA 4MIBA 1EETA 3AJ1A 4G3IA 2E9ZA 4NL5A 3HMJG 1B99A 1HNWF 3MHYA 1YX2A 1SCJB 3BN4A 4CNYA 4ED8A 1Q5VA 1JXEA 3SSQA 4X4PA 5LMNF 5F8NA 3TYTA 3BKFA 1SV5B 1QSSA 2WRMA 3BZQA 1G2EA 2JFDA 4M95A 3H5UA 2BQRA 4N47A 1VQKS 3CMES 1RXOB 1Q7LB 1UWBB 2BXJA 3JYTB 1DLOB 2E1RA 4RW4A 1RGVA 2XO7A 1IM6A 1IBMJ 4C8MA 4EUVA 2BV3A 1FWPA 2AT1B 3DHXA 3ICLA 2MXYA 1RTIB 2HURA 2RMLA 1KOOA 3R6LB 4F36A 4RZRA 4ZVEA 5AXLA 2MKKA 2VG5B 3PW5A 1TUGB 2DNZA 5EWGA 5GAEI 3LPEA 1M1HA 2JH3A 3DRXA 3SDEB 3T5JA 4P74A 1XNQJ 3DOLA 4BWJA 4A46A 1H0HB 3FBBA 3SSSA 1QD1A 4NCAA 3WBZA 2G9OA 2HHQA 1CQMA 1HNVB 2KB2A 1VBKA 4X62F 1B0TA 3H25A 3QFWA 2R8JA 3CJKA 4KFBA 3CCTA 1KS2A 1ZM4A 3KK1B 2ZZNA 3J80Y 5L1LA 2AJQA 2MQQA 2RQCA 1HMVB 4UT4A 2W4DA 4RW9A 2ZH3A 5U47A 4LF6F 2IPOB 3QO9A 1GXLA 2UVUA 5FDLA 2GFFA 3MD1A 3CJKB 3G96A 1S1WA 1UWAA 2P9EA 5IT9U 1PKUA 1X5OA 3LF0A 3D3BJ 4DPWA 3NMRA 4WU2A 2I38A 1RTJA 2FZCB 2YNGA 3GFXA 1B0PA 1Q4RA 2VFVA 5GMDA 4DR2J 2GMHA 4ZIWA 2ZFHA 4WF9Q 1R8CA 1H7WA 2CUYA 3EGWB 3R27A 3E3XA 3N0VA 2K3IA 5ETMA 4X65F 1WI6A 3CWJA 2EBEA 3PYEA 5KFUA 4ECQA 2E9RX 4K4VA 1GFWB 1VHFA 1RTDB 1FKPB 2XMVA 1N5YA 4DHVA 4ZHRA 5AE1A 5KG6A 2E1CA 3B4DA 1LKZA 3MECB 4OYPA 2XWXA 4I4BA 3TW0A 2CPXA 4CLSA 3D2WA 1T03A 2CNOB 3DU6A 1CG2A 3TR5A 1CC8A 1U47A 2NCKL 3N5FA 3GLJA 1JLGA 5LSLA 3W9JA 2WAQD 2YBVA 1WACA 1YI2S 4I1TA 3CCES 1TL1A 4LF7J 3AD8C 1VOMA 3H98A 3OFFA 3ZTRA 3BGLA 4CP5A 2FC8A 3OL6A 1NK6A 4LF8F 1QE1A 4XDDA 4DV2F 2JC0A 1QDUB 3H8YA 1RWKB 1NSPA 2NQPA 7FDRA 2AEJA 2CPZA 1TKZB 1HPZB 2OHDA 4NA1A 5D4LA 2I2YA 2BJ8A 3TX0A 5HQMA 4H4OA 2GGPB 1W25A 2FLNA 4A8MP 3R5DA 2QYGA 3PIOQ 3OVBA 1U09A 5B09A 1N56A 4ILLA 4ZLLA 1X4HA 4G65A 1FEHA 4ZVRB 2NUHA 4LF8J 4HTJA 4ZLPA 2V2KA 1PSDA 3LANA 1X5TA 3ILJA 3NGDA 1S1VB 2RNEA 2HNYB 4KKOB 3SCKE 2R7UA 1RABB 2D7SA 3LP0B 3UW1A 1NJZA 1IQTA 1UMJA 2UXCF 3V5RA 2DXFA 4F4AA 2J5AA 2ZVSA 1S59A 2MPUA 1GTEA 4DG1A 5B0AA 4DZDA 3N6LA 5JVHQ 4WKRA 1X4FA 4R0EA 2MB0B 2LQBA 2BE2B 4DR3F 2JNJA 2L9NA 3MCNA 3PFOA 1TL5A 3CDUA 3FVYA 1T95A 3H59A 2YNFB 1VRQC 1RKIA 3RB0A 1F3VA 4OYBA 1SJFA 3DYAB 3O3LA 2DGQA 2DY9A 1HNIB 2DYAA 3DRPA 4OZ3A 1SXLA 4PEOA 1RT5A 2AEFA 2DH9A 3QGHA 4I6WA 4EGLA 3U02A 1NB2A 2JWNA 2VF3A 2UU9J 2M7SA 1Z1ZA 1NHUA 1VC6A 1FVSA 1YJ7A 4DPUA 5DQHA 2LA4A 2WVDA 2RKIA 2R2TA 3AAWB 3PO4A 2UUWA 2CQGA 2AYMA 4U7UK 4CYUB 1IKVB 4NLPA 4PAAA 4DV0F 1RK8A 1RYSA 1RCXB 5B0FA 3BGFA 4B3TF 3VGUA 2BKOA 5ETSA 3M8PB 1TU0B 4X62J 2HBZB 1V5VA 3KLGA 3TUZC 3PZPA 3O8WA 4CLUA 4WU3A 3DRSA 2FIUA 1UFLA 2XHCA 2XYPB 3FC9A 1UEKA 4MMOA 1QSYA 5FLXY 4QIFA 3CCUS 1SL0A 3H7HB 3LP2A 2R7VA 2IYGA 5BR8F 1YJRA 1AFJA 1J5OA 2BJEA 4FKXA 1FE0A 3QBCA 4FVMA 1PJ5A 1RZMA 4LRBA 4NI2A 3KOAA 1V3ZA 2LU2A 4DXLA 1S99A 1D9AA 4PYDA 4QIWD 4QR2A 3I56S 4X4VA 3Q8VA 1CJTA 2W2OP 3CD0A 1UEUA 3MFIA 1S9FA 3FSXA 3EE3A 1V3RA 4J91A 2QLJB 4LBHA 4PG4A 1VQLS 2J6UA 3ILOA 1FRIA 5IM0A 3UD4P 4MK7A 1M5OC 2DEJA 2MYFA 2ZBCA 1X4BA 2OPRA 3IG1B 5B0EA 4LSZB 5J2NA 1X4AA 1YSJA 3TAQA 1VJWA 3SCJE 2ZH5A 3L4BC 1R31A 3UO0A 3HSJA 2BACA 1EX8A 4RW6B 3I32A 5C24A 1R0BG 3MEDA 4F26A 5IM0B 4ZOSA 2OIHA 1M1GA 3HJVA 2PGCA 1Q0NA 2JLEA 4DR7J 2VG6A 3PEJA 3DRRB 4NE9C 1Y00A 3EDQB 4DFMA 2HMIB 5ETNA 3PW0A 3IRXB 2OPSB 1TL7B 2KJWA 5G0RA 4DPXA 1ZZNA 1BD6A 3GONA 3KNGA 3D28A 2C22A 3RR8A 2AJ4A 3I96A 1N0UA 1I1GA 2MQLA 3UNGC 5IFMA 2HMIA 1N54B 2CPEA 3HVAA 2RJZA 1HIYA 3QNWB 4GVBA 5L1JA 2LP4A 4RW7B 3TARA 1Q81T 2JVRA 5KFFA 1R8AA 2HQIA 1R7IA 2FGCA 1N5VA 3UR3C 1I3OB 3HULA 2XMMA 2VB6A 3CO0P 4GVBB 4C2MA 5ADZA 5HJXA 4DV4F 2PI5A 1SC3B 1YDLA 2COLA 3U7JA 5GAGI 1VRUB 3WIVA 3ZZZA 2DRBA 5E3PA 1A9NB 2F8EX 4Q7AA 1N88A 2DNYA 2DIVA 2J9DE 2YKAA 3QT6A 1VQMS 2G2ZA 2DRAA 3ENAA 5EHHA 1N32F 4A8OA 4DUTA 1NZ8A 4IFYB 1L5UA 4OI0A 5HSPA 1MW7A 1W2IA 1Y7PA 4WXOA 4BCAA 3T6BA 4WE1A 3UDCA 3LAKA 1XR6A 1JLBB 1JLCB 3Q8PB 2ZKTA 2RDJA 3RGIA 3ZFVA 4JI6J 4X4NA 2B7CB 2ZBQA 1EAYC 3CJQA 4DR5J 4C3KA 1S9EA 4OYZA 2ALZA 4WE1B 3K59A 3D1OA 2ILZA 4I69A 3LGNA 1PCAA 1VGYA 1X60A 2KI2A 2AJ1A 4BWMA 3IGVA 5KFTA 4B3RJ 1FKOB 2K06A 2VBWA 4NXNJ 2M3DA 2VU5A 2B0GA 2VPYB 4MK9A 2YH1A 2MKSA 3KUHA 4KV8B 4OYWA 2DGOA 4YDDB 4M5LA 1QLNA 4NYPA 2Y9HA 1BY9A 1NPKA 5CAAA 5F8GA 2ROGA 3M1VA 2HRYA 1VS3A 3IM9A 4S0MA 2FVQA 1RKJA 2W9BA 1BQXA 5C42A 1VIOA 2VOPA 2HFZA 1UPMB 4B9TA 3HXMA 4EK2A 4E0DA 4DCOB 2MQ8A 5T41A 4DV7J 2RF2A 2ZC4A 4OHYA 4O3NA 2ABYA 4HHHA 2J7UA 3SMZA 4N5SA 3OSPA 5C2CA 1VFJA 4MIAA 1VQPS 2I1RA 4QPXA 3ZZOA 2KHDA 2UUCJ 4F4YA 2A6MA 1S0OA 1RU1A 3D68A 4QW8A 3B8HA 3ZTSA 3T1HJ 4Z2XA 4QW9A 5K8PA 3RYLA 1GTHA 1PBAA 1IXKA 2CQDA 4PXEA 2ZKUA 1DTTB 3EWGA 4B08A 2M8HA 4CO1A 4RU9A 4Y65A 3QZ8A 2V0NA 5DM7Q 3CJ8A 2E9TA 2MLXA 1T9VA 5KFPA 2Z4PA 4A8XA 4TQSA 5D3GA 3ISND 4Y2KA 3WIUA 3ILLA 3TQEA 2VG7B 1F2HA 2MZRA 3AJDA 2LEPA 3BR8A 3GZ7A 5GMEA 5KAKA 4HVZA 1Y4ZB 4P2SA 3V81A 2A6OA 2LXIA 1T3NA 1AZSB 3PYGA 1SIZA 4LBIA 4USKA 3CD5A 1CJKA 2GIQA 2I5JB 3QLHB 3C2PA 2GJIA 5M2UA 5HMYA 2QA4G 3EXCX 3W60A 1NSKL 1EQMA 2BRKA 1KQFB 3C6TA 4C4WA 2OELA 5F8MA 1V9OA 2V2VA 2UV8A 3BBCA 4B9LA 4OL8A 1VQ7S 2OO4A 4AFFA 3MMCB 1WC5A 3T1YF 2G0IA 4OHVA 2F4VJ 3R2DJ 5KFLA 4ALZA 1KEKA 1OIAA 3CCVS 2EKYA 4XK8C 3MMCA 4IG3B 5HL7Q 4DV4J 4I2QA 1RTIA 3I6PA 4DWIA 2M70A 4OZ2A 3GR1A 5F41A 1WC3A 5HJYA 1N34F 3RJMB 1NPRA 1RT6A 3ZXWA 2XS7A 5HI7A 1NMEB 2JL9A 4NCGB 3AXMA 4DZ6A 4LBPA 3W62A 4PXCA 2OP5A 3P45B 3FKBA 1LFWA 4AXIA 1EKRA 2MHNA 3ILIA 1KBRA 3G2XA 3EGZA 2PMWA 4DLGA 5I3QA 4DL4A 2Y1IA 3M6VA 3JXOA 2D1CA 4IG0A 5D77A 3MCOA 1SL1A 2FUG9 1YGYA 3RU0A 2A18A 3K5LA 2EVZA 4FZVA 1UVIA 1IKWB 5T7LA 3KLHA 2C3YA 1UPPA 4F04B 2RUGA 2B9WA 2F4FA 4WFBQ 3BPSP 1WTFA 1KD1T 3I4HX 5A8KB 2ACYA 1HNWJ 3C19A 1NAQA 2ZDOA 4LUBA 1CJUA 2QYCA 3I0SA 3IA0A 4KHPJ 4MKAA 4EO8A 3TZXA 3DLEB 2CAJA 3U1LA 6FDRA 3JS9A 2NXNA 4C7QA 4J5OA 1Y5IB 3SSRA 3HD1A 1RT4B 4TU8A 2V2ZA 3ITHA 3KUEA 4I0WA 2JLGA 1UA1A 4DS5A 1B3TA 2O66A 2P8IA 4LF4J 1RT1B 2QZ8A 3LOUA 1X5SA 4UUXA 2H54B 3UWTA 3JB9k 2HHVA 1B64A 3HI9A 2R7OA 5LMUJ 5K9FA 4DDFA 2V34A 2NXEA 1P1TA 1XNQF 1RCOB 2FD2A 1WC4A 1FVQA 2DKOB 4LF4F 5KFBA 1Q78A 3T9ZA 1CJVA 2UXBF 4GRSA 1UWBA 2MSSA 3M05A 3GPAA 1IKYB 3B6BA 1T9TA 4PXDA 4QBUA 3R3TA 2OFHX 3NS6A 1EJ7L 2FVCA 1WWHA 2O01C 4LFAJ 4V1Ak 2QSWA 2KO1A 3U1MA 1LWEB 4OI2A 3G8SA 2KDOA 3DLLQ 2MLZA 1NEEA 4CTAA 4RBVA 4GMKA 1VI7A 1PC4A 1H98A 1RSCA 3UDVA 4LSNB 3MR6A 1Y10A 4A47A 4DFJA 4JI2J 2E5LJ 4OI3A 5E3CA 4C48A 3G82A 1VMBA 2NXCA 2XM3A 4IO9Q 1C0TB 1ZBTA 4UTGA 2CQ2A 1IBCB 2WBRA 3NCRA 3TAPA 1H72C 3TEGA 4ETXA 2HVZA 1SH3A 3FEXB 4FF4A 3OTOF 1QVGR 3SBMA 1OPZA 2IYIA 3RB3A 1UVNA 2YKNA 3HVWA 4Y2IA 3S8SA 1NK5A 1GXUA 4DV0J 2WTFA 1S9GA 3FFIA 3UN2A 3OHBA 2FHJD 5F8JA 2MZQA 2QN6B 2V5HG 3RRHA 3Q83A 3WC2A 1LK7A 5HQ8A 1RTJB 3M32A 1VQ5S 5HQLA 5KFAA 3KKFA 3T3FA 2BZ2A 4NLQA 4AL6A 1LXNA 3GV7B 1J27A 4I6AA 2YWGA 4LIRA 2ATLA 1WUUA 2F5GA 4NA3A 4NEZA 2V94A 1D1UA 3DMJA 1CPZA 4AE5A 4C3LA 3TVYA 3Q0AA 3K8WA 3QMQA 2W01A 3N79A 3Q2SC 2W9CA 4C6AA 2AJFE 4KGZB 4CH7A 1O5JA 2ZZMA 4RPFA 4CDIA 4YY3F 5J2PA 1W26A 1FNXH 2HEKA 4MTPA 3OV7A 1HL6A 3V6DA 3MMJA 5KFEA 1JNZB 2IM0A 2XO6A 4M5DA 2E5LF 2UUAF 1SIWB 5HMWA 3B54A 4ID8A 1C0UA 1EZZB 1S6OA 4K5RA 1JIHA 3FEYB 2CG8A 3MMAA 4KHRA 3W5ZA 2GZOA 3PYDA 4CLZA 1D8YA 1E6VB 2B5JA 1D8ZA 1EETB 1P9QC 3BV8A 1S4FA 2F63A 3LGHA 2JDJA 3KLGB 2WONA 1T9WA 4JI2F 2ZVIA 2R8IA 3VAKA 1ZPWX 2XMUA 2MQMA 5HP1A 2L3MA 1U1MA 1APSA 1RUSA 2QO3A 3C15A 2EFNA 2W8LA 5E33A 3C8YA 3C14B 2Y1LB 1Q86T 1KRPA 3QPIA 2QMXA 1J5OB 3KJQB 2VPWB 4B9SA 5E5NA 3CJTA 3QRRA 2EBGA 4JI4F 1IJFB 2JSXA 3ZZ0A 2KU7A 3NXZA 1BWEA 5E3RA 2DNRA 1RYRA 4W92B 4YHHJ 3A4TA 3J7ZT 1YVFA 1MROB 4TN2A 3ONQA 4M5IA 2ACMA 5L38A 4JI1F 5B7WA 3KLEA 3OLBA 4B3OB 2V4QA 4ZPAA 3VAFA 1YZ6A 2C1EB 2UVWA 1GH8A 4DPTA 3JSMB 4P2FA 3HFKA 3KUGA 1RAHB 2DY1A 4IOCQ 2KN4A 3ZZPA 3ZTQA 1JX4A 2VQFJ 3L9ZA 4CO3A 2GHVC 3LW5C 2Y0SD 3KLEB 1WDTA 4A8WA 1TV6B 2YXLA 1TKXA 2WB4A 1XR7A 2QIFA 3H5SA 3HT0A 4CLYA 1QAJA 1ZH5A 3W3SA 1SJQA 1K1QA 3DYAA 2DO4A 1GXTA 4NMXA 4MKYA 4YR3A 4NLVA 1MN7A 1PILA 1ZM3A 2BQUA 1UJ6A 2DTJA 1FRMA 2CPHA 2OPSA 3DDIA 1NUEA 3JTPA 4ZA1A 5H1SV 1HQEB 2BJ3A 4ZVUB 1RI7A 3JAMU 1YJWS 2GMLA 3AJ2A 1CBKA 4H54A 2R8HA 4NLXA 5CD4H 4A8KA 4RR5A 3TJ9A 1IKVA 5LSRA 5KTQA 1J2VA 2E7VA 1UFWA 3PDNA 5HMXA 3QRPA 3L95X 2VDHA 4CLWA 2HBQB 3PACA 4FYDA 4DSIA 2RD5C 3S6EA 4YHHF 4LVNP 2V68A 2ZH6A 3T5HA 3HLUA 3T19A 4ERDA 3U27A 2XGQA 3HSDA 3Q8QB 1U0SA 3T5KA 1SKRA 4QIGA 1PG5B 3DDNA 3DRSB 3ISZA 1JLGB 1RAEB 4XTTA 1UW4A 2QX0A 1RHJB 2B4UA 2VUGA 3KLIB 3BSNA 2BKNA 2CADA 4X65J 4LF5J 2M88A 2GW8A 1FFGB 3GJSB 4RLEA 4BBYA 4FF1A 3BO3A 3NS7B 1JXVA 1BUXA 2N82B 2RAQA 3NS5A 2H48B 1XNRF 1U26A 4FVCA 1R43A 2KT2A 5D15A 4C8YA 2BKPA 3BF4A 3M30B 5A8RB 3QSIA 5FD1A 3MEKA 3BSCA 4B17A 4N76A 1RB0A 3NCQA 4Q44A 2AQ4A 3J80U 4DPYA 2ZOFA 2WW8A 3GP9A 4XAKA 1OY9A 1S6QB 2GJFA 4B9MA 4EZ9A 2CJBA 1X4DA 5H9FJ
chains in the Genus database with same CATH topology
3VGVA 4UOHA 3ZTPA 3BBCA 1NCLA 2HVDA 3PJ9A 4C6AA 2BEFA 2NCKL 3EVMA 3FCWA 3NGTA 1NDLA 1VYAA 4CP5A 2CWKA 5IOLA 3ZTRA 2BX6A 5CABA 1WKJA 3B54A 1KDNA 2B8PA 1HIYA 4ANEA 1NDKA 1NSPA 1PAEX 4O0NA 1LWXA 1MN9A 4FKYA 3VGTA 4HR2A 1F3FA 4DZ6A 3FKBA 1ZS6A 3G2XA 3Q89A 1BHNA 2HVEA 1K44A 3FBEA 1NSQA 4ANCA 3ENAA 4ANDA 1WKLA 3Q8YA 4DUTA 1W7WA 2DXDA 1BE4A 3ELHA 1U8WA 3L7UA 4F4AA 2DXFA 1S59A 3BH6B 3NGUA 2B8QA 3DKDA 3EVOA 3VVUA 2ZUAA 3JS9A 2DY9A 1B99A 2VU5A 2DYAA 3ZTQA 3VVTA 1NB2A 3Q8UA 3ETMA 1NPKA 2AZ3A 5CAAA 1NDCA 5BXIA 4S0MA 3Q86A 1MN7A 3BH7B 3EJMA 4EK2A 3DDIA 3VGUA 1NUEA 2HURA 4F36A 3FBCA 3B6BA 3GPAA 1S57A 1HLWA 1XQIA 3FBBA 3FC9A 1XIQA 1NLKL 3EM1A 4KPCA 1HHQA 1WKKA 4WBFA 3ZTSA 4ENOA 3MPDA 4FKXA 3BBFA 2AZ1A 1NHKL 3EMTA 1NDPA 1S5ZA 3WX8A 3FBFA 4DI6A 2DXEA 3EICA 1LEOA 1PKUA 3Q8VA 1EHWA 1JXVA 1BUXA 4W98A 3EE3A 3FCVA 3NGRA 1F6TA 3BBBA 5C7PA 3EVWA 4UOGA 3Q83A 3NGSA 3VGSA 4UOFA 3PRVA 1UCNA 3R9LA 3GP9A 3ZTOA 1NSKL 1B4SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VGV A;  4UOH A;  3ZTP A;  3BBC A;  1NCL A;  2HVD A;  3PJ9 A;  4C6A A;  2BEF A;  2NCK L;  3EVM A;  3FCW A;  3NGT A;  1NDL A;  1VYA A;  4CP5 A;  2CWK A;  5IOL A;  3ZTR A;  2BX6 A;  5CAB A;  1WKJ A;  3B54 A;  1KDN A;  2B8P A;  1HIY A;  4ANE A;  1NDK A;  1NSP A;  1PAE X;  4O0N A;  1LWX A;  1MN9 A;  4FKY A;  3VGT A;  4HR2 A;  1F3F A;  4DZ6 A;  3FKB A;  1ZS6 A;  3G2X A;  3Q89 A;  1BHN A;  2HVE A;  1K44 A;  3FBE A;  1NSQ A;  4ANC A;  3ENA A;  4AND A;  1WKL A;  3Q8Y A;  4DUT A;  1W7W A;  2DXD A;  1BE4 A;  3ELH A;  1U8W A;  3L7U A;  4F4A A;  2DXF A;  1S59 A;  3BH6 B;  3NGU A;  2B8Q A;  3DKD A;  3EVO A;  3VVU A;  2ZUA A;  3JS9 A;  2DY9 A;  1B99 A;  2VU5 A;  2DYA A;  3ZTQ A;  3VVT A;  1NB2 A;  3Q8U A;  3ETM A;  1NPK A;  2AZ3 A;  5CAA A;  1NDC A;  5BXI A;  4S0M A;  3Q86 A;  1MN7 A;  3BH7 B;  3EJM A;  4EK2 A;  3DDI A;  3VGU A;  1NUE A;  2HUR A;  4F36 A;  3FBC A;  3B6B A;  3GPA A;  1S57 A;  1HLW A;  1XQI A;  3FBB A;  3FC9 A;  1XIQ A;  1NLK L;  3EM1 A;  4KPC A;  1HHQ A;  1WKK A;  4WBF A;  3ZTS A;  4ENO A;  3MPD A;  4FKX A;  3BBF A;  2AZ1 A;  1NHK L;  3EMT A;  1NDP A;  1S5Z A;  3WX8 A;  3FBF A;  4DI6 A;  2DXE A;  3EIC A;  1LEO A;  1PKU A;  3Q8V A;  1EHW A;  1JXV A;  1BUX A;  4W98 A;  3EE3 A;  3FCV A;  3NGR A;  1F6T A;  3BBB A;  5C7P A;  3EVW A;  4UOG A;  3Q83 A;  3NGS A;  3VGS A;  4UOF A;  3PRV A;  1UCN A;  3R9L A;  3GP9 A;  3ZTO A;  1NSK L;  1B4S A; 
#chains in the Genus database with same CATH topology
 5DZ6 A;  1XTZ A;  4ZVS B;  4I6Y A;  2ASD A;  4LFC J;  2KVI A;  5F3T A;  4BC9 A;  4ES3 A;  3FQK A;  2X1G A;  2DNP A;  3DDK A;  2HVD A;  4ELT A;  2BEF A;  4NRU A;  1NJI T;  1AA1 B;  3GTY X;  1R8H A;  3MM9 B;  2RU9 A;  3NY0 A;  5B0C A;  3JAM Y;  2Y1R I;  3F44 A;  2EFG A;  4M5K A;  3PJX A;  2KXN B;  2OFG X;  4ER8 A;  2NZ4 A;  3BYR A;  1F5C A;  2MZS A;  2E1A A;  2E5J A;  4Y34 A;  2Z58 B;  3CXC R;  1EQ0 A;  4LF5 F;  4PPZ A;  5GMK a;  1Q16 B;  1YHQ S;  1S6P A;  2MGZ B;  3M6U A;  3P6Y C;  1TMM A;  1BQM A;  1ZAW A;  2X3G A;  3B82 A;  2A2D A;  1DY3 A;  3GSI A;  4O0N A;  3CCJ S;  4DQQ A;  1GK8 A;  3S01 A;  3VGT A;  1XNR J;  2VON A;  3OR1 B;  4D3G A;  1N52 B;  2DBB A;  3IXQ A;  1DQA A;  1ZS6 A;  4X4Q A;  1H7X A;  4DL7 A;  2B4O A;  2VPZ B;  3DGP B;  3DI6 B;  3GWC A;  4UF4 A;  1J5E J;  2PN6 A;  2B4V A;  1XWL A;  2Q6C A;  2K2P A;  4DX6 A;  8RUC A;  1DBD A;  2AWZ A;  4PR6 A;  1T9X A;  2GJ2 A;  2QA2 A;  3Q8Y A;  3M8P A;  3W9I A;  4Q8E A;  1FDA A;  1RA6 A;  4EMD A;  3BS9 A;  2MTL A;  5E41 A;  3Q8R B;  1KC8 T;  4LRF A;  2DPJ A;  5IV3 A;  1GEH A;  4E8U A;  1Q8L A;  3CW2 C;  3NGK A;  3O5T B;  2CVE A;  3WHI A;  5CYJ A;  3CCQ S;  5HLF B;  2QFI A;  1Q53 A;  2CYY A;  4OV6 A;  4ED5 A;  2EG1 A;  4FDF A;  3DCA A;  1JLQ B;  3V4I B;  2QL5 B;  4J9U E;  4H4M A;  4JI7 F;  1YJV A;  1OO0 B;  4O4R A;  4OJH A;  2WVB A;  2QA4 S;  2ZUA A;  2Q66 A;  2Y8W A;  1K1S A;  1T11 A;  4B9V A;  2GO9 A;  2V8H A;  3I4P A;  1S0N A;  1E6Y A;  3AT1 B;  1JLQ A;  5IXU A;  4CM0 A;  4IQM A;  5AXK A;  5HBM B;  1CS4 A;  2QLB B;  5FLX U;  4J9N A;  4U6P A;  1U6Z A;  1NDC A;  1RT3 A;  1U0H B;  2M52 A;  2VL1 A;  1RHK B;  4IDK B;  4ID5 B;  4ZJQ A;  4GKK F;  4QZV B;  4I56 A;  1RT7 A;  1WI8 A;  1KFS A;  2XSF A;  3AQO A;  2RT3 A;  3UD5 A;  1KQG B;  1CS4 B;  2KM8 B;  2PFF B;  2G0C A;  5KFN A;  4QR1 A;  1SL2 A;  2VC1 A;  3D0I E;  2DT9 A;  1KON A;  4IFV A;  1QAI A;  4JI5 F;  2CNL B;  3FBC A;  3CCZ A;  4RUB A;  3BR9 A;  3E2E A;  2FGO A;  4UZC A;  1YWX A;  2OTJ S;  4JI0 F;  4ZLJ A;  2K1R A;  2CPF A;  2V8D A;  1Y3J A;  3HVT A;  1N48 A;  1YJT A;  4TKT A;  2XCP A;  2ZH1 A;  4HYK A;  4R8U A;  2VJV A;  2Z2M A;  1NM2 A;  3CJR A;  3VZI A;  2HWH A;  2ASY A;  4FBU A;  4KYZ A;  2XNQ A;  3PR4 A;  1ACM B;  2RRN A;  1ZTW A;  1VC0 A;  5AE2 A;  5EWE A;  5FJ4 A;  4WIQ A;  1IVZ A;  5HRO A;  5KG0 A;  4X4S A;  4DSK A;  2HWI A;  3EZO A;  3GFZ A;  3D6H B;  4TXS A;  1PC5 A;  4P71 A;  1N6Q B;  2UU9 F;  4QR0 A;  3CF5 Q;  2DXE A;  4A8F A;  4AL5 A;  3FK4 A;  3BSO A;  2XS2 A;  4DCJ B;  4LQ9 A;  2LDY A;  2DB1 A;  4KSE B;  1SJ1 A;  2P9G A;  4KQZ A;  1N6Q A;  4LRA A;  1F6T A;  2DHX A;  5SUH A;  2Z2L A;  3R5A A;  2VBZ A;  5A8K A;  3EVW A;  4WFZ A;  4KO0 B;  1FRK A;  4HT7 A;  4NRT A;  4EZ6 A;  3ZZU A;  3MOJ B;  2J9E A;  1UP1 A;  3M4X A;  3QQC D;  1YTY A;  2YTC A;  6AT1 B;  4C97 A;  3IP0 A;  1S79 A;  2KVQ E;  5CZX A;  4EFA C;  1ZOT A;  2VQE F;  1CUL B;  1XMQ F;  1VRT B;  4QWA A;  4DUZ J;  2F4V F;  4PYA A;  2XI2 A;  3K57 A;  1REV A;  4RW8 B;  2I5J A;  3QLH A;  5A6P A;  3ZTP A;  3FMB A;  2CQC A;  5F0W A;  1OYD A;  1FXD A;  4DUY J;  2AF6 A;  4USW A;  2MZ1 A;  2HFO A;  4F02 A;  2YKQ A;  3MDF A;  3H4D A;  3RAX A;  4CZC A;  5KOW A;  4X2B A;  2QLX A;  3A8K A;  4PG8 A;  4LFB J;  1M5S A;  1X9W A;  1N5Q A;  1VBZ A;  3R97 A;  1KDN A;  1HBN B;  1NU4 A;  2VA3 A;  2FY1 A;  1TVR A;  5F9L A;  3KK2 B;  4RKU C;  1FKO A;  2XQC A;  3TO8 A;  3QIP B;  4X64 J;  4YN3 B;  4OX7 A;  4CLP A;  1Z2Z A;  4ZCM A;  3Q24 A;  1O8B A;  4P6Q A;  3TQ1 A;  2NRE A;  3AOB A;  1HI1 A;  1IBK F;  2BBE A;  1WEX A;  2FHJ A;  2GVZ A;  3R1H A;  5DRK A;  3P3D A;  1DZ5 A;  1IBL J;  4ILM A;  1T94 A;  4HTI A;  3CT9 A;  3M2V A;  1O0P A;  1SVD A;  2B4P A;  3M2U B;  2AGO A;  3M9O B;  1NK8 A;  3CCR S;  4XDC A;  1SQF A;  2HNZ A;  1WKL A;  3C6U B;  5FII A;  3QO9 B;  1YRX A;  2LMI A;  3H90 A;  4P52 A;  3OL8 A;  2X3D A;  4A8Q A;  3UCU P;  1YJ9 S;  3J7A 1;  4B3M F;  4EI2 A;  2DNH A;  2E7W A;  3VR1 A;  4CLT A;  4WFN Q;  3BQ2 A;  2AD9 A;  1U48 A;  2FC9 A;  2HG4 A;  3CB4 A;  4Q2M A;  5JXS A;  4HT5 A;  1HNZ J;  2OD6 A;  4NEY A;  4WFY A;  3RRG A;  2CWX A;  2RSQ A;  2G13 A;  2XMJ A;  3AD9 C;  3N4W A;  3KLH B;  3TUJ C;  4PWD A;  4LF9 J;  5LMU F;  3VTI A;  2LQ9 A;  3CCW A;  1X8D A;  2B56 A;  3IO1 A;  3KG4 A;  3BQ0 A;  5BYQ A;  4KIA A;  2AIR B;  2DHG A;  1VQY A;  1BMQ B;  2CJA A;  2KYZ A;  3JQJ A;  5RUB A;  3EPI A;  1LWF A;  3A8E A;  3TA0 A;  3BYP A;  2IJR A;  1DUR A;  2YNH A;  3HF5 A;  3WX4 A;  4ZHR B;  3KJF B;  4HAC B;  2ZHA A;  2ZNY A;  2C2K B;  3AFG A;  4YME A;  1KWM A;  4G1Q A;  3PIP Q;  3QWP A;  4JI1 J;  3C16 A;  4ZPT R;  5HAN A;  1D9F A;  1A6L A;  1U24 A;  2DHH A;  2MLY A;  1KHW A;  2HQF A;  1PYT A;  3CED A;  3CUN A;  2V63 A;  5IT4 A;  3EJM A;  3QRQ A;  2V4R A;  1SJ4 P;  2ALY B;  1TUV A;  2FLO A;  2VD3 A;  3DOM A;  3T1H F;  1JLE B;  1RT2 B;  2ZBR A;  3E01 B;  3BGR A;  3TP2 A;  4ED2 A;  3W8G A;  3ZNU A;  1UJ4 A;  2CJK A;  3A13 A;  2JX2 A;  4NAS A;  1TFY A;  2ZHO A;  1U2C A;  2ZE2 B;  4JB8 B;  1RLC L;  1NLK L;  2DCU B;  3FRY A;  4WZQ A;  1RWW B;  4ZVH A;  3A1Y G;  2EFP A;  3GMG A;  2ZJQ Q;  1VQN S;  1GMU A;  2OMO A;  4ZP6 A;  2W25 A;  3M8Q A;  3IWN C;  3CJS A;  2DD8 S;  4ZVT B;  4ZN1 A;  1RHU B;  1W2B R;  3PRD A;  3NAI A;  2AGQ A;  2ZEJ A;  2D9P A;  4KGK A;  2V4J B;  1MG7 A;  1RQ0 A;  4J9O A;  1FE4 A;  4KKO A;  4B02 A;  4NXM F;  1TAU A;  5JUM A;  3D6F B;  3BEG B;  5DG9 A;  4WFA Q;  2OI2 A;  1RAG B;  2V4J A;  4WYW A;  3CPW R;  2P9C A;  3FDS A;  2WVF A;  4ZVG A;  4ZPW R;  4RW9 B;  1NXI A;  3J7Y I;  2EFO A;  5ETP A;  3T5L A;  4WWS A;  2Z2Y B;  1RTH B;  4K7Q A;  5JJB A;  1T02 A;  2H51 B;  2DHA A;  2NLW A;  2KYX A;  2ZNZ A;  4CM2 A;  3N6M A;  5BJR A;  1G4C A;  3UDL A;  1TL3 A;  2KG1 A;  1G7C B;  3SI8 A;  1P9Y A;  2AEM A;  2JEI A;  1BC6 A;  2IHR 1;  2YNG B;  1RAA B;  2BW7 A;  4LRE A;  4PQU A;  3POT B;  2MJU A;  4ZPB A;  4F25 A;  4NLR A;  1EIY B;  3D7S B;  3FJ2 A;  3PRB A;  2JHE A;  2XI3 A;  1H2T Z;  1VYA A;  4QIE A;  5D0R A;  3MR2 A;  2QMW A;  3S7R A;  4HHJ A;  1Y9O A;  2OPP B;  3H42 A;  3GIJ A;  4USJ C;  2B8P A;  2N7Y A;  1AB8 A;  4ZN3 A;  3KWM A;  1FDB A;  5HVG A;  2E66 A;  2W1B A;  5J1N A;  1X9M A;  5I3U A;  2L9W A;  3VAL A;  3KDN A;  3ENQ A;  2YNI B;  3CDA A;  2B51 A;  2Q43 A;  2H4W B;  1N36 J;  3WDO A;  2RS2 A;  2ZH8 A;  1VJQ A;  4DX7 A;  1D3W A;  4Y00 A;  4ZCK A;  1YG0 A;  2Z0G A;  2PI4 A;  4OHZ A;  2YWE A;  4NPO A;  1BHN A;  4MFB B;  3EPG A;  1XBW A;  5L9X A;  4WKY A;  4ANC A;  3EYZ A;  4JI6 F;  1U2R A;  2Y1J A;  2AGP A;  3NL0 A;  3ZC4 A;  3G6Y A;  1FX2 A;  1RAC B;  2DGT A;  3P96 A;  4CT9 A;  3HHN B;  2DNG A;  4USI A;  2KFY A;  3CGI A;  4DV5 J;  4NWB A;  1F9E B;  3ZO7 A;  4OZ0 A;  2NS1 B;  1U8W A;  4MFB A;  2EI5 A;  1N36 F;  2E29 A;  2CZV C;  3BH6 B;  1LQ9 A;  1RLD A;  2IAJ B;  4FS1 A;  1LWE A;  2BMB A;  4D3H A;  2VBX A;  2RRB A;  4WP3 A;  1H38 A;  4B3S F;  2DIT A;  2ZOM A;  1FTC A;  1RWO B;  1F1B B;  1VQ4 S;  3M30 A;  1RHQ B;  1SC4 B;  3I9Z A;  3IS9 B;  5A8R A;  3KK1 A;  2CQP A;  4OJ1 A;  5LMN J;  3OUY B;  3KLF A;  2K8G A;  3DLJ A;  1PO6 A;  4PUO A;  4J9Q A;  4ZPD A;  1IQZ A;  3DNC A;  2W2M P;  2FJX A;  4OYX A;  2UP1 A;  4YUD A;  2EFQ A;  5K20 B;  3FZB A;  1NZA A;  3IS9 A;  3SDE A;  3A3N B;  3DOL B;  2G2O A;  3ETM A;  1Y5L B;  4KE5 A;  4LFA F;  4CH1 A;  5KFR A;  5E2Q A;  4DU8 A;  2XYH B;  4TYB A;  5D6G A;  3AQP A;  3VZH A;  5DGA A;  1DQ9 A;  4I67 A;  5G0R B;  1HMV A;  5GAH I;  3KJN B;  5KFQ A;  2IIH A;  3LGM A;  3MEG A;  1HNI A;  4U9R A;  1XK8 A;  5ITH A;  4DV6 F;  5FDL B;  1T9U A;  2DR6 A;  1FXR A;  1O6X A;  2DGX A;  3MAA B;  3OSN A;  1DQ8 A;  3HFV A;  1L3K A;  3KHG A;  1M5K C;  4GC6 A;  3MEC A;  1Y0H A;  1RU2 A;  1QM9 A;  2HND B;  2QMU B;  2XS5 A;  1IUJ A;  3PNI A;  2RIJ A;  4Y2A A;  3UN3 A;  3W5Y A;  3KHR A;  3W2W A;  3OTO J;  1SPB P;  4L76 A;  2W2P P;  5AXM A;  3MTJ A;  4WBF A;  2GV1 A;  2AW0 A;  4M5J A;  4QIV A;  4ZLN A;  1VQ6 S;  2M2B A;  5CHC B;  4ZCI A;  5J2P B;  5IZH A;  2KRB A;  1RP5 A;  3NWR A;  1KVI A;  2AX0 A;  2XMK A;  2RDI A;  4DV3 J;  3QYY A;  3KHH A;  1QE1 B;  2ERR A;  1U1Q A;  3IN5 A;  3AH6 A;  4NCB A;  2LU1 A;  2W9A A;  1EHW A;  3P49 B;  4YFU A;  3MUR P;  5IC6 B;  1E6V A;  2XBP A;  3NNH A;  4DOZ A;  1NBE B;  3W65 A;  1PIE A;  5ETK A;  1URR A;  3CMQ A;  4ECR A;  2GGP A;  1WF2 A;  4RWW A;  3N9U C;  3RTV A;  3MPY A;  2GNK A;  2W4P A;  4K2J A;  2KM8 C;  3CCS S;  1FWK A;  3GJQ B;  3MEE A;  3VAM A;  1JJH A;  1H2U X;  2EG2 A;  4FPR A;  1WG5 A;  5J1E A;  4X4O A;  4NI2 B;  2QV6 A;  3O2I A;  1S9E B;  3OTE A;  2ASJ A;  2HHH F;  4LRD A;  2X1F A;  2HVH A;  1HWJ A;  4JP8 A;  4OJ3 A;  3MWB A;  2J8S A;  1CJT B;  2HQC A;  3J81 Y;  5EN1 A;  4X66 F;  2XMT A;  4RUC A;  4Q43 A;  3U1N A;  3Q2T C;  1MU2 B;  3IR6 B;  1EAR A;  2W7A A;  5K5M A;  3PJ9 A;  4O44 A;  4DR3 J;  2BAN B;  4LMZ A;  3CIZ A;  5DO2 A;  3EVM A;  3SCI E;  1XMO F;  1NDL A;  2XSJ A;  3CO9 A;  2HS3 A;  5D8H B;  4R25 A;  1X31 C;  4FXW A;  2YPY A;  2CJY B;  2DR9 A;  1KKH A;  2BX6 A;  2LQ5 A;  2D69 A;  3FSY A;  1I6J A;  4C11 B;  3K5N A;  3SIP B;  4M63 A;  2CFX A;  1OPI A;  3GCX P;  2LFV A;  3H0P A;  2DNN A;  4M5H A;  4KT0 C;  3NG8 A;  4OFZ A;  1Y3K A;  3MPU B;  4YQW A;  1RA7 A;  4Q8F A;  1N32 J;  1S1V A;  1JJC B;  2FQQ B;  4EYI B;  4U7U D;  2HW3 A;  2JVO A;  2JZ5 A;  3BB5 A;  4IH6 A;  3KLV A;  4ED6 A;  1VHI A;  1SUQ A;  4B9U A;  3GQC A;  3MUT P;  1GMV A;  2M5Y A;  4LFB F;  5DM6 Q;  1S48 A;  4DV2 J;  1NJY A;  2GC8 A;  2PD1 A;  4YR0 A;  4H4K C;  4V19 X;  4ECT A;  1FXL A;  1MML A;  3IWX A;  1WNE A;  4ZP9 A;  1S12 A;  2HVE A;  1K44 A;  5AE3 A;  1QTN B;  2MZJ A;  2EC2 A;  3GYG A;  4J7C A;  2GAH C;  2QL9 B;  4RNH A;  5AJ3 J;  1CQN A;  1JMT A;  1KVK A;  3AOD A;  1HQE A;  1Q8K A;  4PAB A;  2JEF A;  3G4S S;  2EEY A;  5G4D A;  1Q8I A;  1RT5 B;  2HGL A;  3DGP A;  3DI6 A;  3JSB A;  3PX4 A;  5IWA J;  3PV8 A;  1AUD A;  4DQP A;  4FYV B;  3ISN C;  4CQ1 A;  4EEY A;  2HHW A;  4K4W A;  3NP5 A;  4HI1 A;  4MIW A;  1FO1 A;  3SFG A;  5J2M A;  2FJV A;  4LF7 F;  4ZJO A;  5KG1 A;  4PZV A;  3RAM A;  3HT3 A;  1YRT A;  4KO0 A;  4OI6 A;  3DLK A;  3RBX A;  1DRZ A;  3QGP A;  3LWL A;  4DR1 F;  2B6A B;  3ZNJ 1;  2EKN A;  2F9D A;  3KLI A;  3OR2 A;  1TP7 A;  2VFS A;  4KB7 A;  4K4Z A;  3VVT A;  4CH0 S;  2VAS A;  2EWH A;  2RVJ A;  1M90 T;  1TK0 A;  3J7A N;  4AXJ A;  2BAB A;  4DMZ A;  2DHS A;  1PYO B;  1FDD A;  1FRL A;  4IOB A;  3W66 A;  3OD2 A;  5KFC A;  1HWU A;  2J7K A;  2KFZ A;  2ZJR Q;  4M1K A;  2PE8 A;  5LJ5 Y;  5I3P A;  4ATN A;  5SZT A;  2W7P A;  4OYM A;  4ECY A;  2HS0 A;  2HFN A;  2I8E A;  1VDH A;  4ZKA A;  4OJG A;  3GV8 B;  1S72 S;  1KLN A;  2HHU A;  1YQH A;  3WC0 A;  2X51 A;  7AT1 B;  4DSE A;  2ASL A;  3K7R A;  2DPI A;  1S77 D;  4RBT A;  2OH2 A;  3W61 A;  2VH7 A;  2KG0 A;  4URG A;  3QAT A;  4ETZ A;  3D66 A;  3GFH A;  2IDL A;  2AYG A;  2UVV A;  3P8B B;  2WSC C;  1XR5 A;  1U6B A;  4NLG A;  4K4Y A;  4KGM A;  2EK1 A;  1XIQ A;  4ZVQ B;  2DO0 A;  1H73 A;  1SJR A;  3QJP A;  5DGB A;  1QY7 A;  3DRR A;  1NSA A;  1Z2L A;  3R1L A;  2DIU A;  2LEB A;  2R7T A;  2OAU A;  3PCO B;  3R7N B;  3W64 A;  1YKW A;  2V8P A;  3HZE A;  2O3D A;  2N7C A;  3ET6 A;  3FBF A;  2A10 A;  3EIC A;  4U8V A;  3THV A;  2NZC A;  3QAE A;  4W98 A;  3VAI A;  3CJ3 A;  1VK8 A;  3KJV A;  2DR8 A;  4ZIV A;  1AYE A;  2F9J A;  3BDE A;  3ET6 B;  3O1L A;  1M0S A;  2BE9 B;  3MAH A;  2FHO B;  3P5T L;  4DUY F;  1RAI B;  1OQ3 A;  1CJU B;  4CO4 A;  2O5D A;  1DTT A;  2QE5 A;  3IM8 A;  2AYE A;  4DR7 F;  2IY5 B;  4M8L A;  3R9L A;  2KKH A;  2W24 A;  3OXF A;  3KXD A;  4BS2 A;  1GMW A;  3TWZ A;  5B0B A;  5CCL A;  5DDR C;  2XY5 A;  2BJ1 A;  2HHP A;  3S1T A;  4TQR A;  1RTD A;  1JKH B;  2DRD A;  2HRT A;  3GJR B;  3LP1 B;  3SV3 A;  4HLB A;  2CPJ A;  2BW2 A;  4C98 A;  4QYZ J;  3NGT A;  4DR4 J;  2GIF A;  3CVK A;  4MJK A;  4I64 A;  1BQN A;  1REV B;  4RW8 A;  4TNO A;  4DL6 A;  3R7S B;  1ZA1 B;  2DEI A;  2H1Y A;  3DRY A;  4OZ5 A;  2R8G A;  4NXN F;  1FCA A;  1MLA A;  1WKJ A;  1ZA2 B;  3NOC A;  2GX8 A;  1UFK A;  4M5N A;  3OBI A;  4EU0 A;  3DOM B;  1BQN B;  4HHU A;  2YWH A;  4UZB A;  2XB2 D;  1RDR A;  4IKA A;  2B7B B;  3UFC X;  2MKH A;  1WOR A;  1GMW D;  1X4C A;  3US5 A;  1H2V Z;  3BO2 A;  3E51 A;  4TLQ A;  2HHX A;  4N8O A;  1JLA A;  3DM2 A;  1KQK A;  3VWS A;  1C2P A;  3MM8 A;  1URN A;  2LVW A;  4NZ0 A;  4TLR A;  2Z8Q A;  4DV7 F;  1RWN B;  5K8O A;  1ZZF A;  2W9B B;  5D4P A;  3TA1 A;  1GT8 A;  2F3J A;  3GR0 A;  4ZP8 A;  2ZH2 A;  3FGV A;  3M8Q B;  5D78 A;  4E98 A;  3OTD A;  1MWQ A;  3W7B A;  4I2Q B;  5A76 A;  4FP9 A;  4M5M A;  4JI7 J;  4JV2 A;  3D5M A;  3OQ2 A;  4IFV B;  4DCP B;  3R5G A;  4DN0 A;  1UVK A;  1IKX B;  2QGF B;  1FT8 A;  1U6F A;  3THP A;  4IRD A;  2H65 B;  2VQE J;  1XMQ J;  2D9O A;  3AA9 A;  2W2N P;  2JFK A;  3HSZ A;  1KLM A;  2HNZ B;  4L74 A;  4RX6 A;  5IT0 A;  4K4U A;  3TZZ A;  1S9G B;  1FK9 B;  2HQG A;  2WSF C;  3EXY A;  3FFI B;  3I5C A;  3MM5 A;  1U1N A;  4FNI A;  1FRH A;  2R7X A;  4WJB A;  1PAU B;  2V8V A;  4LSL A;  2Y3Y A;  5A0Y B;  3JTN A;  3L7O A;  5KFI A;  5HRO B;  1RAJ A;  1DTQ A;  4ECW A;  4DQS A;  3RBE A;  5GAD U;  2XLK A;  1NHV A;  3UR0 A;  2V67 A;  4DV1 F;  4KPY A;  2CRL A;  1HWL A;  3DMJ B;  1KSP A;  2WHO A;  2K7K A;  2M9K A;  2Q3P A;  3LTO A;  4ZK7 M;  3KDO A;  2W9C B;  3BGU A;  1GX6 A;  1LV5 A;  1ELO A;  3BH7 B;  3UI3 A;  1KP6 A;  3FZ2 A;  2IJF A;  3A8I A;  2IFX A;  2OEK A;  4GO7 X;  1U1K A;  2GIR A;  1HBM A;  3EGN A;  4K59 A;  4OI1 A;  1IBK J;  3MCM A;  3MI7 X;  4I2P B;  3RRK A;  2W4C A;  3MM6 B;  1UET A;  5KFO A;  3ITH B;  3QSY B;  1U2F A;  3KTQ A;  1S57 A;  3N5B A;  4OZJ A;  3HHE A;  1C1C A;  2IVY A;  2MQN A;  2RIL A;  2BYC A;  3B78 A;  4P7V A;  4DLE A;  5HAT A;  2BOA A;  1HBM B;  2ZC3 A;  2WBM A;  4OLO A;  3HHL D;  4TVA B;  4C0H A;  2X1A A;  2R2R A;  4DL3 A;  1WG4 A;  1JLE A;  1RT2 A;  4HI2 A;  1WC1 A;  3IMQ J;  3MMB B;  3V4M A;  3FSI A;  5L1I A;  2FJE B;  4AT1 B;  1JQG A;  2J7W A;  2A0F B;  4UW2 A;  5BYR A;  4Y0F A;  2ZE2 A;  3GIK A;  1ZTT A;  5L8R C;  4W90 B;  2OKQ A;  3C15 B;  3AXK A;  4ZJL A;  5MAO A;  3AB4 B;  1WSV A;  3W2V B;  5KFK A;  1NK4 A;  2VG5 A;  3OTC A;  2VC0 A;  2BE7 D;  4LF9 F;  1NDP A;  5C7P A;  1FHT A;  2CZ4 A;  2CJQ A;  1NJX A;  3GV5 B;  4O3Q A;  4IG3 A;  4DL0 C;  5GAD I;  4DV1 J;  4EBD A;  1YIJ S;  4OV1 A;  4BC7 A;  2HAI A;  2CNN B;  4ECX A;  4KTQ A;  1TR0 A;  3SQG A;  1K47 A;  3NGR A;  1K0V A;  5A2Q Y;  4IO1 A;  2M0G B;  3I0R B;  4DSL A;  2IAJ A;  3G6V A;  2YX1 A;  4NCG A;  3T1A A;  2LCW A;  2P6S A;  3NGS A;  5CH7 B;  4OZN A;  4ZVP B;  2R2S A;  2GVZ B;  3J7Y U;  1HHT P;  4KGV B;  4B3O A;  3HHD A;  1C0T A;  1TMJ A;  5E3Q A;  1N5T A;  1S1W B;  3OUY A;  3I0R A;  4XIU A;  3KLF B;  4M94 A;  4FYX B;  3FCH A;  3BRE A;  4Z7C A;  2XEX A;  2V9K A;  4ZCL A;  2NPF A;  4QPT A;  3D0G E;  4RU2 A;  3MPW A;  3IBC B;  4WFX A;  1FRX A;  3I82 A;  3VCD A;  5DLG A;  3EX7 B;  1VQO S;  3OTB A;  3OPK A;  4MKB A;  5ETT A;  1N5S A;  5AT1 B;  4USM A;  5DLF A;  1J5E F;  3HHL A;  3D6T B;  3M32 B;  4PQA A;  4F7V A;  3KYL A;  3RW6 A;  2CWK A;  2WSE C;  1R0A B;  1I94 J;  2DH7 A;  2GS8 A;  5CAB A;  3I0S B;  5EX3 A;  3OFE A;  4OZL A;  3H5Y A;  3VAH A;  2C28 A;  4WZM A;  5DDO C;  3ADA C;  3CSK A;  3NLC A;  1NDK A;  4RJV A;  4U67 Q;  4LF6 J;  4JOU A;  4PWW A;  5D4O A;  4DUZ F;  3A8J A;  4O4G A;  2XLJ A;  3GG0 A;  2YX7 A;  2UUT A;  5F8I A;  4FKY A;  3CD7 A;  2BA9 A;  3TI0 A;  2JJ4 D;  2E1M C;  5A6W A;  2Q1L A;  4O3P A;  5LT5 A;  1QJH A;  2HQ3 A;  3DU5 A;  3K2Y A;  2RE1 A;  3A3P B;  3QGG A;  1XMB A;  5KG5 A;  4IR9 A;  3C16 B;  1FES A;  3I31 A;  5I3U B;  2ZM6 F;  5L39 A;  3MGJ A;  1I51 B;  1ICE B;  2LXU A;  3DN9 A;  5HN0 A;  1QAX A;  2CZ9 A;  5C5J A;  3M9N B;  1U8S A;  1YRU A;  5DQI A;  1NJW A;  1VLY A;  2C2M B;  2YH0 A;  1FA0 A;  3RB4 A;  4B3T J;  1H6K X;  1RBA A;  3GCW P;  3GB0 A;  1WEZ A;  1R8P A;  4ED0 A;  3C3L A;  2VJU A;  1U7L A;  4KHM A;  4YDX A;  3BDP A;  4O3S A;  3IAS 9;  2YPZ A;  3MXH P;  5DJB A;  4PG7 A;  4DFP A;  1UVM A;  3NGU A;  2LYV A;  4L6V 3;  3CTR A;  4WTO B;  3N01 A;  4Y2C A;  2PA8 D;  1VK3 A;  2IA0 A;  4YOE A;  1WDD A;  1DLO A;  4RW4 B;  4C8N A;  3UVJ B;  4LIW A;  1FFS B;  5B0G A;  1S10 A;  1G6B A;  3DC2 A;  5K14 A;  2B43 A;  1R8B A;  1HA1 A;  2R4F A;  4NLS A;  5KFH A;  3MEE B;  3PW4 A;  1N33 F;  1UZH A;  4G1P A;  2C3P A;  5THW A;  4R5P B;  5J1E B;  4PPD A;  4WCE Q;  4IR1 A;  1R6V A;  4QWD A;  2AYB A;  3CC7 S;  3LH2 S;  5F8H A;  1RHR B;  5I42 A;  1AUS L;  2CJX B;  2FJA B;  4FXD A;  2XHW A;  4FN5 A;  2VIC A;  3JSY A;  4I7F A;  1MMN A;  3M6X A;  3M7V A;  1FNM A;  4ED7 A;  2HVI A;  1HNV A;  1KVJ A;  3HPO A;  3BJY A;  3GG1 A;  4J9R A;  3TA2 A;  4O0I A;  5KFM A;  3HHL C;  3P5B P;  1GNK A;  1X0P A;  1ZAV A;  5EX0 A;  3SV4 A;  2PC6 A;  4X4U A;  5J2Q B;  1VQS A;  3P4U B;  5HK4 A;  3PW7 A;  1MWY A;  2LQJ A;  1RTH A;  2QA1 A;  3NAH A;  3R8Y A;  5KG2 A;  5EDW A;  2U1A A;  2MKY A;  3OW2 R;  2C2D A;  2MZT A;  3PY8 A;  4QQB A;  2YWK A;  2PA3 A;  3TNV A;  1VQ8 S;  1HHQ A;  4YR2 A;  3Q22 A;  3IRW P;  1WOS A;  2NPI A;  4PQU B;  4DX8 H;  4J9V A;  2F8M A;  3I55 S;  3KG0 A;  4C3M A;  4CCH A;  1HQ2 A;  5IC4 B;  2IM1 A;  3G6X A;  1UZD A;  3V6D B;  3EZU A;  3M2R B;  3TJ8 A;  1T05 A;  3W2W B;  2MY7 A;  4K4X A;  3AHP A;  3IR7 B;  1FKP A;  1S5Z A;  3R7B B;  4L73 A;  2CQI A;  4DI6 A;  4EWT A;  1C0U B;  1S1T B;  1X9S A;  1K73 T;  3UCG A;  4PRF A;  1S0M A;  3MR7 A;  4WP9 A;  5AXN A;  2AU0 A;  2M8D B;  3BM7 A;  3K5P A;  1N8R T;  4TY9 A;  2GMJ A;  1HAR A;  1LXJ A;  2ZH4 A;  2IRX A;  1HYS A;  2WVE A;  2A1B A;  3D6M B;  4HDH A;  5DDP C;  3M8Y A;  1RHM B;  4JV5 J;  4UOG A;  3QT7 A;  5HP1 B;  3DOK B;  2POK A;  1MWZ A;  1FDN A;  1RAD B;  1IR0 A;  1TL1 B;  2C3M A;  2OSR A;  2C3U A;  2ROE A;  1UCN A;  2VBY A;  3PM9 A;  3V4I A;  1FJE B;  3DLK B;  3MMA B;  3PKM A;  3LUY A;  2PEB A;  3TZW A;  2B6A A;  2HLT A;  2JC1 A;  1V6H A;  1D9D A;  1HPZ A;  2MMY A;  3JYT A;  1WF0 A;  2HS4 A;  3M8W A;  2YVS A;  4H4O B;  1T9Y A;  1EP4 B;  5LOQ A;  4JV5 F;  5DS7 A;  3FCW A;  1UVL A;  2B9Y A;  1XC9 A;  2CPD A;  3QGI A;  4ID5 A;  4BLG A;  2EK6 A;  1Q79 A;  2GO8 A;  4OI4 A;  5IOL A;  2J0Q D;  3CNQ P;  3VQT A;  4PXB A;  2IDE A;  2HZA A;  5BR8 J;  4DL5 A;  3UNY A;  1EP4 A;  3SEO A;  3TX8 A;  1NK9 A;  3MED B;  2VV5 A;  1WSR A;  3G71 S;  3K17 A;  5E3A A;  2GHP A;  2F65 A;  4AD6 A;  4L3N A;  4YY3 J;  3R5B A;  2DNL A;  4HL9 A;  4KGX B;  1YBT A;  4IH7 A;  1PJ6 A;  2DR5 A;  1HNX J;  1TV6 A;  4FNH A;  1YZ7 A;  2IC3 B;  2MST A;  5A8W A;  3CC2 S;  3EUN A;  1V3S A;  4AUK A;  2HYI B;  2BE2 A;  3PYF A;  3NCP A;  3VQS A;  2WCX A;  3CUL A;  5EUH A;  3MR3 A;  5DET A;  3VAJ A;  2IBO A;  2FY8 A;  3C46 A;  2HHH J;  4K2X A;  2HBY B;  1BXN A;  1HBO B;  4RW7 A;  5GAE U;  3RBZ A;  4ES2 A;  3MUM P;  2YKO A;  1BQM B;  2DXD A;  3I5B A;  4N7T A;  3HJF A;  1BE4 A;  3W1Y C;  2QEX S;  1EKS A;  4F4Z A;  2XZT B;  1TKX B;  3CDB A;  4WXW A;  5CYM A;  1NKB A;  3BO4 A;  3KK3 B;  3EDR B;  3QID A;  1SKS A;  2OML A;  2KXH A;  4WII A;  1XMO J;  4P73 A;  1ZM9 A;  2QT7 A;  1KN6 A;  2VZ9 A;  1T8E A;  1U1R A;  2A3J A;  2I0X A;  1DHM A;  4FYW B;  4P72 A;  4W4M A;  1QVF R;  2FJB B;  1G1X A;  3FMW A;  1T03 B;  3JTO A;  3D1Q A;  4YB5 A;  3TRG A;  4ED1 A;  1HR0 F;  2F8H A;  3MCS A;  3PG9 A;  4O3O A;  2JLF A;  4A48 A;  2FVS A;  4B3R F;  1CLF A;  3PTW A;  1RBO B;  4LRC A;  4F4X A;  3K5O A;  2HFV A;  2HIY A;  2QC3 A;  1VRU A;  2YQ0 A;  4MYU A;  4ZS6 A;  4NLD A;  2PDA A;  2Z56 B;  5CA5 A;  3GIL A;  3HVR A;  3F56 A;  2UVR A;  4TU7 A;  1OY6 A;  5BYS A;  1NKC A;  1HFE L;  2NSB A;  1F60 B;  4DL2 A;  4KJI A;  4NLY A;  1E6Y B;  3H2L A;  3LA0 A;  4M5G A;  1HNX F;  2GHW A;  4PWD B;  4Z7Y A;  2G1D A;  1OMS A;  1TVR B;  2BM0 A;  3HDS A;  2HWT A;  2GA7 A;  4C0B A;  4KPC A;  2FJW A;  3JSR A;  2HRU A;  1QSL A;  1JLA B;  5LXY A;  3MM8 B;  2F40 A;  3JQM A;  3MPD A;  5CZV A;  4F3Q A;  5LXR A;  1TK8 A;  1H74 A;  5LSO A;  2OPR B;  3IG1 A;  1S1U A;  1TZ0 A;  2AZ1 A;  2HBR B;  2ZWP A;  2VA2 A;  1NHK L;  4EBC A;  1KFD A;  2N3L A;  5KFW A;  3WX8 A;  4ECS A;  4Q5V A;  2C2E A;  2KXF A;  2AJ2 A;  1VR6 A;  4GKJ J;  2FYX A;  3HVT B;  3R5J B;  1NRK A;  2AP6 A;  3Q8S B;  3GJT B;  1QTM A;  5KT7 A;  5C42 B;  2OTL S;  3ZZT A;  4U95 A;  4ZPV R;  1SKW A;  4GKK J;  1C1B B;  4F4W A;  2D74 B;  2PO4 A;  2KFN A;  1KLM B;  1RAO A;  2FLL A;  1U45 A;  3OT9 A;  1TKT A;  1UTA A;  5CCM A;  1OSC A;  2OEJ A;  4UOF A;  2E7X A;  3V6H A;  1IN0 A;  1LW2 B;  5LJ3 Y;  4V19 J;  5DG8 A;  1FTR A;  3ZTO A;  1A0O B;  2ZH9 A;  3TUP A;  1HHS A;  1B4S A;  1X0F A;  3J81 j;  2MKI A;  2D3U A;  4U7C A;  1M5H A;  1HI8 A;  4LSL B;  5A0Y A;  2OD4 A;  3AY0 A;  1Z4U A;  1FKA F;  2VKZ G;  4NLU A;  5H9E K;  2C2R A;  4NLT A;  4CLF A;  3FQL A;  4CYU A;  2VFR A;  4EO6 A;  2CQ0 A;  2GVD A;  2VFT A;  2YWW A;  2XLI A;  4DPO A;  2C2N A;  3K5M A;  5HLF A;  1ROF A;  3L7P A;  2ATC B;  1LW0 A;  5J2M B;  3DLH A;  3TZY A;  3CMA S;  2U2F A;  9ATC B;  2G1H A;  3OXL A;  5JMN A;  1JLF A;  3AD7 C;  2C2Z B;  4IYQ A;  2GVD B;  5D0H A;  2R8K A;  2FJD B;  1PAE X;  3E01 A;  3T1Y J;  1ULR A;  5A2Q U;  1B7Y B;  1SH0 A;  3ZZY A;  3OR2 B;  3PX0 A;  3V81 B;  3QAU A;  3IBF B;  1JLF B;  1AT1 B;  1U25 A;  5HBM A;  1BGX T;  3T6J A;  4F67 A;  5C25 B;  2BQ3 A;  3UPF A;  4DR6 J;  4YB7 A;  2KZZ A;  3F0N A;  4K0K J;  2UUC F;  3CJ5 A;  3MZI A;  3M8R A;  2IA6 A;  3FBE A;  3MUV P;  2DR7 A;  4FF3 A;  1UEV A;  5KFZ A;  5C25 A;  3W9H A;  4DX5 A;  3HKZ D;  2CQH A;  2ZJP Q;  2OPQ B;  3T41 A;  2WVC A;  1W7W A;  2HGM A;  2DNQ A;  3QIP A;  4URS A;  2X1B A;  3A12 A;  4MAK A;  4N8N A;  4ED3 A;  4DF4 A;  1ZET A;  1I5O B;  3L7U A;  1TTH B;  3PVX A;  2IBK A;  2V2Q A;  4YP3 A;  3RBD A;  3H20 A;  4H4K A;  3SQO P;  1FF2 A;  2D41 A;  3M1V B;  2XMW A;  5DDQ C;  3BN7 A;  2LEC A;  2OEM A;  3JQK A;  3DKD A;  4KH1 B;  2ILY A;  4WYL A;  5J2N B;  3THT A;  5KOX A;  4USU A;  1HR0 J;  3TJA A;  3ETO A;  2H5J B;  2XGP A;  4CO2 A;  2J6T A;  1REG X;  2QTW A;  5CD4 A;  3OJU A;  3G9C A;  2RF2 B;  2ROP A;  1SJ3 P;  1H3D A;  2ZUG A;  3HKW A;  1RT6 B;  1TKD A;  1T0T V;  2RU3 A;  3HCX A;  1HBU B;  2K1R B;  2WOM A;  1AXQ A;  4NYO A;  2AZ3 A;  4WPA A;  3TAM A;  4MH8 A;  1UKU A;  4LR9 A;  2ZHB A;  3QWU A;  4NLW A;  3AB2 B;  3POT A;  2GQ2 A;  5KFS A;  4LVO P;  3VV2 B;  5M2P A;  1HBU A;  2WOM B;  1FNO A;  1HQU B;  1TAQ A;  2YKM B;  2MKC A;  3DLG B;  3HHL B;  3MTK A;  4NYZ A;  3TAM B;  4Z37 A;  9RUB A;  1M5P C;  4LQ3 A;  1Y5N B;  2CNK B;  2FB0 A;  2ZBI A;  4XPC A;  2L9D A;  1R3N A;  1LWF B;  3IFE A;  4RNM A;  4OHX A;  3BQ1 A;  1U02 A;  1VIX A;  1V5I B;  2YKM A;  3DLG A;  4UUW A;  1SQG A;  3RR7 A;  6FD1 A;  1VRT A;  1F9H A;  1LFP A;  2DNM A;  2NUU G;  2VFU A;  4G1I A;  2H9Z A;  2RDD A;  4I2P A;  4Y28 C;  2R7Q A;  3OJS A;  4O23 A;  4NXM J;  4UOC A;  3PW2 A;  2HHS A;  4JI4 J;  2CQ1 A;  1GAO A;  4Y6I A;  4RUA A;  2KHC A;  4F0H A;  3DLE A;  3HM9 A;  4LR7 A;  3BSA A;  1CJV B;  3NKY A;  2H5I B;  4JBC A;  4C0O C;  8ATC B;  3GIM A;  4JI0 J;  3NNC A;  3BGR B;  4IFY A;  1QAY A;  2YX4 A;  2BJ7 A;  1OS5 A;  3PHE A;  4OIX A;  1RT1 A;  4PKD B;  2CA9 A;  1WHW A;  2BJD A;  4TY8 B;  3R2C J;  2V6A A;  2I6W A;  4DFK A;  3C6T B;  4HDG A;  1VC5 A;  1LK5 A;  4RNO A;  4ITS A;  3R5C A;  3OVS A;  1FJ7 A;  4TYA A;  2PMZ D;  4CRJ A;  2HIQ A;  1CC7 A;  4L3K A;  4TY8 A;  1S6U A;  2DGW A;  2OLW A;  2ZWO A;  2J0X A;  2C2O B;  2HGN A;  2RQ4 A;  4QJV A;  5ETV A;  2R7W A;  3UD3 P;  1CSJ A;  3TOQ A;  1P1L A;  2BR0 A;  3GYN A;  4EBE A;  2CDQ A;  2CXE A;  2KT5 A;  4E2F B;  4KV8 A;  3CDE A;  4ZDN A;  2NXU A;  3M2V B;  1AW0 A;  3EZ5 A;  1UVJ A;  2YQ1 A;  3F41 A;  1WF1 A;  2WZ1 A;  2DGU A;  3UQS A;  1N0V C;  2I9S A;  4Q2L A;  3IAM 9;  1NB7 A;  5I42 B;  2W2Q P;  4Q45 A;  3M9M B;  4WP8 A;  2BJ9 A;  4I7F B;  2CDR B;  3PHT A;  1RWM B;  3MD3 A;  2FZG B;  4F8R A;  4CT8 A;  1TFW A;  2F1F A;  3D9B A;  3KNA A;  5KG3 A;  3TAN A;  2R7S A;  1KQS R;  1FK9 A;  1Q95 G;  4HKQ A;  3F73 A;  1FX4 A;  2Z2Z A;  3GII A;  3QJJ A;  3M2U A;  2KTQ A;  1F9F A;  4ANE A;  1G3O A;  3GFY A;  4J37 A;  4USH A;  3MEG B;  4LF1 A;  3C6U A;  4R0J A;  4ZP7 A;  2VPX B;  3NBP B;  1M5V C;  2HQD A;  2C42 A;  4PWU A;  1WG1 A;  4A4J A;  4X4T A;  3SYZ A;  3HZG A;  2YNH B;  4TU9 A;  3G6E S;  4QOT A;  1L3T A;  2P5V A;  2LLZ A;  4HAC A;  4JV0 A;  4USV A;  2HND A;  3G8Q A;  3HSG A;  1K8A T;  1D0E A;  4O4G B;  4MK8 A;  3KK3 A;  2XY7 A;  2CQB A;  2PEH A;  2OPP A;  1LWC A;  1OY8 A;  3ENW A;  3O44 A;  2LEA A;  4K5S A;  4KH0 B;  1UW9 A;  3CIM A;  5CYQ B;  2FLP A;  3LAL A;  3WQP A;  2XMA A;  1NO8 A;  2W7O A;  2B5J B;  3RB6 A;  1SC1 B;  4JI5 J;  1S4E A;  2UXD F;  2P2C B;  5T14 A;  1C4A A;  3D54 A;  2GQC A;  1S1T A;  2JOQ A;  4N77 A;  2NYI A;  1SBR A;  2L08 A;  2MY8 A;  3ENV A;  1JNR B;  2X7I A;  2DVI A;  4BDP A;  1FER A;  1R6Y A;  2B8Q A;  2RS8 A;  2ZOG A;  3D4J A;  2EW9 A;  5D4N A;  3VVU A;  2DGS A;  4A8S A;  4P10 A;  2HLU A;  4DBQ A;  3DOK A;  4RBU A;  4CLL A;  4P7T A;  1HW9 A;  2HSE B;  4CO0 A;  2QLW A;  2AHO B;  1IKY A;  3NNA A;  2BVZ A;  5KG4 A;  3HX9 A;  3G87 A;  2WB1 D;  2ZBP A;  1EB0 A;  1ZAX A;  2YY3 A;  4N41 A;  1NH7 A;  1WHY A;  4B9N A;  1IWA A;  1TL4 A;  3TEH B;  1MU2 A;  4F4K A;  3Q86 A;  3G86 A;  2QLF B;  4OX6 A;  2NSC A;  3TVK A;  1D09 B;  4URQ U;  1ZPV A;  3EGV A;  5IT9 Y;  4PUO B;  2HNY A;  3KMS A;  3AOC A;  1LOU A;  3CJ2 A;  2CQ3 A;  3LP0 A;  3M8S A;  2BRL A;  4C11 A;  3PJW A;  2UXD J;  5E0O A;  4DV3 F;  5J1P A;  3H2U B;  1XQI A;  4YB6 A;  3UCZ P;  5DZ7 A;  3PKY A;  1UA0 A;  4DQI A;  1YJU A;  1DFD A;  1R27 B;  1U1O A;  1Q8B A;  3HK2 A;  3FNN A;  2D3O R;  3V6J A;  1WC0 A;  3H40 A;  2HKE A;  3BPD A;  2E44 A;  4ENO A;  4YEA A;  3B4M A;  4OYO A;  2IC3 A;  4XO0 A;  2QFJ A;  1FD8 A;  4OYI A;  3JSM A;  2A2C A;  3O6Q A;  3HP6 A;  2XYG B;  1N4L A;  3KMQ A;  4IG0 B;  4P2X A;  4P75 A;  4CNZ A;  3DRP B;  1TK5 A;  4DU7 A;  2CPI A;  2V8G A;  4ILR A;  2G2Y A;  4K8R A;  4YB1 P;  4OX9 J;  3OLA A;  5H9F K;  2GAG C;  2WK4 A;  2HK3 A;  5C2G A;  1LEO A;  2XZW A;  5KT2 A;  3KK2 A;  1JXL A;  4F3O A;  1JWW A;  5JVG Q;  2BOP A;  4MYT A;  4C8O A;  1P8G A;  2VQF F;  1R89 A;  2DGV A;  2B9X A;  5B0D A;  5L1K A;  2YNI A;  3M6W A;  2IVF B;  1NKE A;  1N5Y B;  2XCA A;  2FVR A;  4QCL A;  1MNE A;  4X84 A;  2YKP A;  1JB0 C;  2HK2 A;  5HVH A;  1RBL A;  2B3T B;  4ELV A;  2ZD1 A;  1R0C B;  3FEZ A;  2J0S D;  1RIS A;  4IRC A;  2VOD A;  4KBI A;  1OSD A;  2R42 A;  5F3Z A;  4QWE A;  3X1L B;  1FJC A;  1VBX A;  2LDI A;  3NOG A;  3W8P A;  4DR2 F;  2HZV A;  2UXC J;  1SV5 A;  5M2R A;  2H4Y B;  5KFG A;  3NMA A;  3MF5 A;  1NPP A;  3KHL A;  2CG4 A;  4AQY F;  2O67 A;  2RB7 A;  1DAR A;  4KAI A;  3V2U C;  1B7F A;  4OHW A;  2IVM A;  2CQ4 A;  2WON B;  3QT8 A;  2OSQ A;  3PX6 A;  4C8K A;  3H5X A;  3MOZ A;  4NX9 A;  1VLO A;  3TVZ A;  2E5G A;  3PFE A;  2GCF A;  3I9V 9;  3TUI C;  3E8O A;  5F9N A;  3V6K A;  1OQ6 A;  1TKZ A;  2LKZ A;  1NND A;  1S76 D;  1YK9 A;  3C14 A;  1S6Q A;  2QSF A;  7FD1 A;  5IQ6 A;  2APO A;  1X4E A;  1FWL A;  4GKJ F;  3SCL E;  3I87 A;  5LL6 d;  5AJ3 F;  1JJ4 A;  4F2R A;  4A8Y A;  3ZZR A;  2BM1 A;  1CVJ A;  3I5A A;  4Q0B B;  3M8Z A;  1LWX A;  4O44 B;  1MN9 A;  4NLO A;  1F5B A;  4KFB B;  3MM9 A;  1P6T A;  3L3C A;  4EYH B;  3QFH A;  1WC6 A;  2VDI A;  2MQO A;  4ECV A;  3NEK A;  1MRO A;  2ZZT A;  1L3S A;  2UUA J;  2V9W A;  2O1P A;  3G82 B;  4PG5 A;  5ETR A;  4Q0B A;  4LR8 A;  3NRB A;  8AT1 B;  2H3E B;  4ZMM A;  2EPI A;  3OFG A;  5EWF A;  3HFZ B;  4AND A;  1A7G E;  2J6S A;  4B3S J;  4U96 A;  2VG6 B;  2YKN B;  3HD2 A;  3KG1 A;  2D3O 1;  2UV8 G;  2SXL A;  2G4B A;  4DR6 F;  4C9D A;  2KH9 A;  4F2S A;  2JRS A;  3GSD A;  3MAA A;  3OR1 A;  4GVL A;  3X3U A;  2EC0 A;  2HPU A;  1HBO A;  4NZ7 A;  2GQQ A;  1TEL A;  2QRR A;  3CD6 S;  4BHQ A;  1U1L A;  1NH8 A;  2YWF A;  4RWX A;  5KFD A;  4RNN A;  1OJ4 A;  1X7V A;  3W63 A;  1RWX B;  2VHG A;  4X66 J;  2KRR A;  1U1P A;  4K4S A;  2Q79 A;  4AQY J;  3KFW X;  1IR1 A;  2DH8 A;  2RKI B;  3M2R A;  2K3K A;  4P2M A;  4J9K A;  1T05 B;  1OWX A;  1VQ9 S;  3D1H A;  3Q8U A;  3PO5 A;  4DSJ A;  2RHQ B;  2WW4 A;  3BKU A;  4CI0 B;  3WZ0 A;  4AL7 A;  2R3V A;  2MHE A;  3UN5 A;  3NWG A;  5L46 A;  2FPH X;  2MDA A;  1ITP A;  3LP1 A;  2NR0 A;  4LFC F;  4IH5 A;  4M5D B;  2DJW A;  4H4M B;  3MAQ A;  5GVQ A;  3GYX B;  5CXT A;  4AYB D;  1IM4 A;  1T3O A;  1WOO A;  4UST A;  1Q7Y T;  1L3V A;  4J9M A;  1RWU A;  3LQV A;  3GIR A;  4F0M A;  2XC9 A;  1HD1 A;  1WJ9 A;  3DGV A;  4OQJ A;  4QWB A;  3EM1 A;  4OX8 A;  2RUS A;  1UAW A;  1WKK A;  3MFH A;  3D67 A;  2LXF A;  4J90 A;  5DG7 A;  2HFU A;  4UQT A;  4JI8 J;  1BWV A;  2VIH A;  4DN9 A;  3BBF A;  3PR5 B;  4IUF A;  2CKW A;  2PII A;  4WTY A;  4U8Y A;  1IR2 A;  5KFV A;  2J9D A;  2NYH A;  1FFW B;  2ZDP A;  3VAG A;  2BUN A;  4RL1 A;  5CQG A;  1FEE A;  3FUY A;  5IQQ A;  1U0H A;  2CIM A;  4DG1 B;  5ETO A;  1S1U B;  2RH3 A;  5HAO A;  1IKX A;  4KRW A;  4ELU A;  5KT5 A;  3FCV A;  3J81 U;  5I4M A;  2EFV A;  1HWI A;  4RW6 A;  2BAN A;  2XWY A;  2EXU A;  2UZA A;  5C24 B;  1SUQ B;  1MMD A;  4ZVF A;  2XSJ B;  2YNF A;  4DEZ A;  2FZK B;  4CIO A;  1KTV A;  3SFU A;  3VGS A;  2DCL A;  2KL8 A;  3MM5 B;  4OZ1 A;  2DNO A;  3K89 A;  3PRV A;  5ETL A;  5A8W B;  2FVP A;  4FF2 A;  4WK1 A;  2FDN A;  4RNF A;  1C1B A;  2R7R A;  1YBA A;  1B0V A;  2IJN A;  5IWA F;  4DS4 A;  2HAF A;  3IC1 A;  1PBU A;  1TKT B;  4DF8 A;  1TL7 A;  2OUG A;  2ZH7 A;  4OLP A;  2E5H A;  2MGZ A;  1K9M T;  3KJV B;  2PT0 A;  4IQX A;  4K50 A;  1LW2 A;  1HD0 A;  1NCL A;  2UUB J;  4DR5 F;  2Y8Y A;  1F0X A;  1ARO P;  1S1X A;  4NOH A;  2N4D A;  4OMF G;  2P6T A;  1K0T A;  5CYM B;  5DQG A;  4J9S A;  4JI8 F;  1JK9 B;  3SZ2 A;  2JEG A;  3FRZ A;  5K8M A;  4DSF A;  1IJE B;  1BLU A;  2MKJ A;  5B08 A;  5F0U A;  1WTB A;  4HH1 A;  3LPY A;  5LM7 E;  1S49 A;  1YBU A;  1S1X B;  1HQU A;  2XUL A;  1TQL A;  4LF2 A;  3VF0 B;  1ZYQ A;  1UL3 A;  4HEA 9;  1T7P A;  4FBT A;  2MJN A;  3RUB L;  2VG7 A;  3OXG A;  4IRK A;  1IBL F;  1JKH A;  1WD6 A;  5E7O B;  1LW0 B;  1WOP A;  3VHQ A;  2L41 A;  3BGO P;  4NML A;  4JI3 F;  2FHM A;  2QG9 B;  3LP2 B;  1F3F A;  2PMH A;  1AFI A;  4KC5 A;  4QYZ K;  3RAQ A;  4NZ6 A;  5L9N A;  2XZD B;  3BKT A;  3Q89 A;  3T9N A;  4X64 F;  1FJG J;  1CUL A;  3CJ4 A;  1HBN A;  1VBY A;  4RUH A;  1SI9 A;  4JYA F;  1F2G A;  2OGU A;  3D0H E;  4ED4 A;  3DLB A;  2UUB F;  1U49 A;  2OJ3 A;  1RWV B;  1TUW A;  3HO1 A;  3PEH A;  4DV6 J;  3DHW C;  1S7H A;  5HO4 A;  1Q82 T;  2IM2 A;  1HKA A;  3CCM S;  3J7Z 5;  1RT3 B;  2PFD A;  2W8K A;  1OYE A;  4FPI A;  4IDK A;  4F0K A;  2R2U A;  4DR1 J;  4DR4 F;  3SQG B;  1RT7 B;  2Z57 B;  4G6V B;  1GX5 A;  4Y2M A;  4KR0 B;  1Q5Y A;  1X5P A;  1FI4 A;  4JYA J;  2E1P A;  3SXL A;  1X4G A;  4J9P A;  5K8N A;  3IBW A;  3RZA A;  3AOA A;  4QYR A;  5KFY A;  4WK3 A;  5KFX A;  5EGY A;  4ZVO B;  5D0E A;  1VIS A;  2IRY A;  3Q23 A;  2V50 A;  2RRA A;  2CVI A;  2AKW B;  1F5A A;  4F3M A;  4JI3 J;  3IRX A;  5BXI A;  4KHP F;  1LNQ A;  4P9S A;  1SH2 A;  3N28 A;  1S0V A;  3RW7 A;  4R8U B;  1YIT S;  2DIS A;  2JEJ A;  4ICL B;  5MLC V;  4X4R A;  1FJG F;  4C8Z A;  2AV5 A;  3K58 A;  4K0K F;  2XY6 A;  1MSW D;  1S6P B;  3LAM A;  2HZC A;  1IKW A;  2RQM A;  1DTQ B;  1HWK A;  2AJ0 A;  1PYS B;  1HLW A;  1WHV A;  2ADB A;  1DAX A;  2CPY A;  1WHX A;  1Y11 A;  4ICL A;  1HI0 P;  1QUV A;  1RE1 B;  2BDP A;  1SB6 A;  2C3O A;  4UY8 T;  4UY8 5;  3NBP A;  3R6G B;  2RQK A;  3OVA A;  1RAF B;  2J76 E;  5GAH U;  5GAG U;  3QT5 A;  2Y0B B;  2UXB J;  2LQ8 A;  3IR5 B;  2V69 A;  5H9E J;  3G8T A;  1B70 B;  1SC6 A;  1RT4 A;  3MM6 A;  2MEW A;  1IWG A;  1KOH A;  2G0J A;  3OL7 A;  5CYQ A;  3EMT A;  1Q1K A;  3MM7 A;  4OYA A;  1C1C B;  1NK7 A;  3IGN A;  2R9L A;  2XTJ P;  3LWM A;  2N4C A;  4G1Q B;  4C8L A;  4ZIT A;  4K4T A;  4DJB A;  1JLC A;  1JLB A;  2FTR A;  5IV4 A;  1CJK B;  5KT4 A;  2ADC A;  2XNR A;  3MMB A;  2IMO A;  5ETQ A;  4O3R A;  4FYY B;  2YQ3 A;  3MM7 B;  4KY3 A;  3D3C J;  4FS2 A;  4ZPC A;  3BBB A;  3K8V A;  2AX1 A;  1NK0 A;  3L09 A;  3C66 A;  4QU7 A;  4OX9 F;  4MT1 A;  2HHT A;  2CJ9 A;  3CJ0 A;  3W2V A;  4CO5 A;  3UVJ A;  1HNZ F;  1C4C A;  5K14 B;  4N56 A;  1I94 F;  3MPV A;  3W5X A;  3K0J A;  4ECU A;  1UJ5 A;  4GC7 A;  4R5P A;  1DJ0 A;  3VGV A;  4UOH A;  2K7J A;  4B3M J;  2AMC B;  2OPQ A;  3UE2 A;  4CTA B;  1RWP B;  1S97 A;  4ES1 A;  2MQP A;  4LSN A;  4DQR A;  3DFE A;  4UQG A;  3CDW A;  3DM2 B;  4LT6 A;  3GE9 A;  3ULH A;  1WEY A;  3OL9 A;  1YLX A;  1ZM2 A;  2Q6B A;  2KZM A;  3DXS X;  3PXG a;  1M1K T;  1KTQ A;  2DK2 A;  3CC4 S;  4YS2 A;  2ZM6 J;  1KNZ A;  1KR4 A;  2L48 A;  1S7I A;  1HW8 A;  2ZIT A;  1U4B A;  2E5I A;  1RJJ A;  2KJV A;  5F8L A;  2J9C A;  1TL3 B;  4QWC A;  2VOO A;  4J9L A;  5KG7 A;  3DXB A;  2N3O A;  4NA2 A;  3LO3 A;  5J2Q A;  1L3U A;  4Y3C A;  2LA6 A;  2M4M A;  2FHK A;  3H2V E;  1YJN S;  4PG6 A;  3CCL S;  3N6N A;  2IMW P;  2QJ3 A;  5HMZ A;  1CEZ A;  4HR2 A;  1FRJ A;  1XEZ A;  1WEL A;  3RG6 A;  1XN9 A;  2D3Z A;  1XJW B;  4DV5 F;  4GO5 X;  3GU0 A;  2HFS A;  3IWL A;  1QUP A;  1VCT A;  2Z30 B;  4XPE A;  1R0A A;  1SKU B;  1IBM F;  2J8A A;  5T7L B;  2J0W A;  4CWB A;  4QU6 A;  1PJ7 A;  3UDE A;  1KHV A;  1NSQ A;  2DNK A;  4FXV A;  4LJM A;  1N34 J;  4L75 A;  2IM3 A;  4PCQ A;  5D0G A;  4ECZ A;  5D3G B;  1N33 J;  2NXJ A;  5HVF A;  5KFJ A;  3CE8 A;  3QJL A;  2VKR A;  1LWC B;  3AA8 A;  3ELH A;  4MKV A;  1RTZ A;  4L72 B;  2H5E A;  1SQE A;  1GQE A;  1P27 B;  4HH0 A;  4CLK A;  3OFH A;  5KT3 A;  2XG8 A;  1JJ2 R;  1AZS A;  4RO0 A;  5KT6 A;  4IOA Q;  5IS2 A;  4F50 A;  1HYS B;  3A3O B;  2IRU A;  2F7V A;  2PSZ A;  1XER A;  2RHS B;  2B9E A;  3EVO A;  2QL7 B;  1PGZ A;  3HHK A;  4JUZ A;  3MR5 A;  4JV1 A;  1O51 A;  4I68 A;  3H4B A;  1FD2 A;  2KT3 A;  2ZD1 B;  3QZ7 A;  3OHA A;  4MIB A;  1EET A;  3AJ1 A;  4G3I A;  2E9Z A;  4NL5 A;  3HMJ G;  1B99 A;  1HNW F;  3MHY A;  1YX2 A;  1SCJ B;  3BN4 A;  4CNY A;  4ED8 A;  1Q5V A;  1JXE A;  3SSQ A;  4X4P A;  5LMN F;  5F8N A;  3TYT A;  3BKF A;  1SV5 B;  1QSS A;  2WRM A;  3BZQ A;  1G2E A;  2JFD A;  4M95 A;  3H5U A;  2BQR A;  4N47 A;  1VQK S;  3CME S;  1RXO B;  1Q7L B;  1UWB B;  2BXJ A;  3JYT B;  1DLO B;  2E1R A;  4RW4 A;  1RGV A;  2XO7 A;  1IM6 A;  1IBM J;  4C8M A;  4EUV A;  2BV3 A;  1FWP A;  2AT1 B;  3DHX A;  3ICL A;  2MXY A;  1RTI B;  2HUR A;  2RML A;  1KOO A;  3R6L B;  4F36 A;  4RZR A;  4ZVE A;  5AXL A;  2MKK A;  2VG5 B;  3PW5 A;  1TUG B;  2DNZ A;  5EWG A;  5GAE I;  3LPE A;  1M1H A;  2JH3 A;  3DRX A;  3SDE B;  3T5J A;  4P74 A;  1XNQ J;  3DOL A;  4BWJ A;  4A46 A;  1H0H B;  3FBB A;  3SSS A;  1QD1 A;  4NCA A;  3WBZ A;  2G9O A;  2HHQ A;  1CQM A;  1HNV B;  2KB2 A;  1VBK A;  4X62 F;  1B0T A;  3H25 A;  3QFW A;  2R8J A;  3CJK A;  4KFB A;  3CCT A;  1KS2 A;  1ZM4 A;  3KK1 B;  2ZZN A;  3J80 Y;  5L1L A;  2AJQ A;  2MQQ A;  2RQC A;  1HMV B;  4UT4 A;  2W4D A;  4RW9 A;  2ZH3 A;  5U47 A;  4LF6 F;  2IPO B;  3QO9 A;  1GXL A;  2UVU A;  5FDL A;  2GFF A;  3MD1 A;  3CJK B;  3G96 A;  1S1W A;  1UWA A;  2P9E A;  5IT9 U;  1PKU A;  1X5O A;  3LF0 A;  3D3B J;  4DPW A;  3NMR A;  4WU2 A;  2I38 A;  1RTJ A;  2FZC B;  2YNG A;  3GFX A;  1B0P A;  1Q4R A;  2VFV A;  5GMD A;  4DR2 J;  2GMH A;  4ZIW A;  2ZFH A;  4WF9 Q;  1R8C A;  1H7W A;  2CUY A;  3EGW B;  3R27 A;  3E3X A;  3N0V A;  2K3I A;  5ETM A;  4X65 F;  1WI6 A;  3CWJ A;  2EBE A;  3PYE A;  5KFU A;  4ECQ A;  2E9R X;  4K4V A;  1GFW B;  1VHF A;  1RTD B;  1FKP B;  2XMV A;  1N5Y A;  4DHV A;  4ZHR A;  5AE1 A;  5KG6 A;  2E1C A;  3B4D A;  1LKZ A;  3MEC B;  4OYP A;  2XWX A;  4I4B A;  3TW0 A;  2CPX A;  4CLS A;  3D2W A;  1T03 A;  2CNO B;  3DU6 A;  1CG2 A;  3TR5 A;  1CC8 A;  1U47 A;  2NCK L;  3N5F A;  3GLJ A;  1JLG A;  5LSL A;  3W9J A;  2WAQ D;  2YBV A;  1WAC A;  1YI2 S;  4I1T A;  3CCE S;  1TL1 A;  4LF7 J;  3AD8 C;  1VOM A;  3H98 A;  3OFF A;  3ZTR A;  3BGL A;  4CP5 A;  2FC8 A;  3OL6 A;  1NK6 A;  4LF8 F;  1QE1 A;  4XDD A;  4DV2 F;  2JC0 A;  1QDU B;  3H8Y A;  1RWK B;  1NSP A;  2NQP A;  7FDR A;  2AEJ A;  2CPZ A;  1TKZ B;  1HPZ B;  2OHD A;  4NA1 A;  5D4L A;  2I2Y A;  2BJ8 A;  3TX0 A;  5HQM A;  4H4O A;  2GGP B;  1W25 A;  2FLN A;  4A8M P;  3R5D A;  2QYG A;  3PIO Q;  3OVB A;  1U09 A;  5B09 A;  1N56 A;  4ILL A;  4ZLL A;  1X4H A;  4G65 A;  1FEH A;  4ZVR B;  2NUH A;  4LF8 J;  4HTJ A;  4ZLP A;  2V2K A;  1PSD A;  3LAN A;  1X5T A;  3ILJ A;  3NGD A;  1S1V B;  2RNE A;  2HNY B;  4KKO B;  3SCK E;  2R7U A;  1RAB B;  2D7S A;  3LP0 B;  3UW1 A;  1NJZ A;  1IQT A;  1UMJ A;  2UXC F;  3V5R A;  2DXF A;  4F4A A;  2J5A A;  2ZVS A;  1S59 A;  2MPU A;  1GTE A;  4DG1 A;  5B0A A;  4DZD A;  3N6L A;  5JVH Q;  4WKR A;  1X4F A;  4R0E A;  2MB0 B;  2LQB A;  2BE2 B;  4DR3 F;  2JNJ A;  2L9N A;  3MCN A;  3PFO A;  1TL5 A;  3CDU A;  3FVY A;  1T95 A;  3H59 A;  2YNF B;  1VRQ C;  1RKI A;  3RB0 A;  1F3V A;  4OYB A;  1SJF A;  3DYA B;  3O3L A;  2DGQ A;  2DY9 A;  1HNI B;  2DYA A;  3DRP A;  4OZ3 A;  1SXL A;  4PEO A;  1RT5 A;  2AEF A;  2DH9 A;  3QGH A;  4I6W A;  4EGL A;  3U02 A;  1NB2 A;  2JWN A;  2VF3 A;  2UU9 J;  2M7S A;  1Z1Z A;  1NHU A;  1VC6 A;  1FVS A;  1YJ7 A;  4DPU A;  5DQH A;  2LA4 A;  2WVD A;  2RKI A;  2R2T A;  3AAW B;  3PO4 A;  2UUW A;  2CQG A;  2AYM A;  4U7U K;  4CYU B;  1IKV B;  4NLP A;  4PAA A;  4DV0 F;  1RK8 A;  1RYS A;  1RCX B;  5B0F A;  3BGF A;  4B3T F;  3VGU A;  2BKO A;  5ETS A;  3M8P B;  1TU0 B;  4X62 J;  2HBZ B;  1V5V A;  3KLG A;  3TUZ C;  3PZP A;  3O8W A;  4CLU A;  4WU3 A;  3DRS A;  2FIU A;  1UFL A;  2XHC A;  2XYP B;  3FC9 A;  1UEK A;  4MMO A;  1QSY A;  5FLX Y;  4QIF A;  3CCU S;  1SL0 A;  3H7H B;  3LP2 A;  2R7V A;  2IYG A;  5BR8 F;  1YJR A;  1AFJ A;  1J5O A;  2BJE A;  4FKX A;  1FE0 A;  3QBC A;  4FVM A;  1PJ5 A;  1RZM A;  4LRB A;  4NI2 A;  3KOA A;  1V3Z A;  2LU2 A;  4DXL A;  1S99 A;  1D9A A;  4PYD A;  4QIW D;  4QR2 A;  3I56 S;  4X4V A;  3Q8V A;  1CJT A;  2W2O P;  3CD0 A;  1UEU A;  3MFI A;  1S9F A;  3FSX A;  3EE3 A;  1V3R A;  4J91 A;  2QLJ B;  4LBH A;  4PG4 A;  1VQL S;  2J6U A;  3ILO A;  1FRI A;  5IM0 A;  3UD4 P;  4MK7 A;  1M5O C;  2DEJ A;  2MYF A;  2ZBC A;  1X4B A;  2OPR A;  3IG1 B;  5B0E A;  4LSZ B;  5J2N A;  1X4A A;  1YSJ A;  3TAQ A;  1VJW A;  3SCJ E;  2ZH5 A;  3L4B C;  1R31 A;  3UO0 A;  3HSJ A;  2BAC A;  1EX8 A;  4RW6 B;  3I32 A;  5C24 A;  1R0B G;  3MED A;  4F26 A;  5IM0 B;  4ZOS A;  2OIH A;  1M1G A;  3HJV A;  2PGC A;  1Q0N A;  2JLE A;  4DR7 J;  2VG6 A;  3PEJ A;  3DRR B;  4NE9 C;  1Y00 A;  3EDQ B;  4DFM A;  2HMI B;  5ETN A;  3PW0 A;  3IRX B;  2OPS B;  1TL7 B;  2KJW A;  5G0R A;  4DPX A;  1ZZN A;  1BD6 A;  3GON A;  3KNG A;  3D28 A;  2C22 A;  3RR8 A;  2AJ4 A;  3I96 A;  1N0U A;  1I1G A;  2MQL A;  3UNG C;  5IFM A;  2HMI A;  1N54 B;  2CPE A;  3HVA A;  2RJZ A;  1HIY A;  3QNW B;  4GVB A;  5L1J A;  2LP4 A;  4RW7 B;  3TAR A;  1Q81 T;  2JVR A;  5KFF A;  1R8A A;  2HQI A;  1R7I A;  2FGC A;  1N5V A;  3UR3 C;  1I3O B;  3HUL A;  2XMM A;  2VB6 A;  3CO0 P;  4GVB B;  4C2M A;  5ADZ A;  5HJX A;  4DV4 F;  2PI5 A;  1SC3 B;  1YDL A;  2COL A;  3U7J A;  5GAG I;  1VRU B;  3WIV A;  3ZZZ A;  2DRB A;  5E3P A;  1A9N B;  2F8E X;  4Q7A A;  1N88 A;  2DNY A;  2DIV A;  2J9D E;  2YKA A;  3QT6 A;  1VQM S;  2G2Z A;  2DRA A;  3ENA A;  5EHH A;  1N32 F;  4A8O A;  4DUT A;  1NZ8 A;  4IFY B;  1L5U A;  4OI0 A;  5HSP A;  1MW7 A;  1W2I A;  1Y7P A;  4WXO A;  4BCA A;  3T6B A;  4WE1 A;  3UDC A;  3LAK A;  1XR6 A;  1JLB B;  1JLC B;  3Q8P B;  2ZKT A;  2RDJ A;  3RGI A;  3ZFV A;  4JI6 J;  4X4N A;  2B7C B;  2ZBQ A;  1EAY C;  3CJQ A;  4DR5 J;  4C3K A;  1S9E A;  4OYZ A;  2ALZ A;  4WE1 B;  3K59 A;  3D1O A;  2ILZ A;  4I69 A;  3LGN A;  1PCA A;  1VGY A;  1X60 A;  2KI2 A;  2AJ1 A;  4BWM A;  3IGV A;  5KFT A;  4B3R J;  1FKO B;  2K06 A;  2VBW A;  4NXN J;  2M3D A;  2VU5 A;  2B0G A;  2VPY B;  4MK9 A;  2YH1 A;  2MKS A;  3KUH A;  4KV8 B;  4OYW A;  2DGO A;  4YDD B;  4M5L A;  1QLN A;  4NYP A;  2Y9H A;  1BY9 A;  1NPK A;  5CAA A;  5F8G A;  2ROG A;  3M1V A;  2HRY A;  1VS3 A;  3IM9 A;  4S0M A;  2FVQ A;  1RKJ A;  2W9B A;  1BQX A;  5C42 A;  1VIO A;  2VOP A;  2HFZ A;  1UPM B;  4B9T A;  3HXM A;  4EK2 A;  4E0D A;  4DCO B;  2MQ8 A;  5T41 A;  4DV7 J;  2RF2 A;  2ZC4 A;  4OHY A;  4O3N A;  2ABY A;  4HHH A;  2J7U A;  3SMZ A;  4N5S A;  3OSP A;  5C2C A;  1VFJ A;  4MIA A;  1VQP S;  2I1R A;  4QPX A;  3ZZO A;  2KHD A;  2UUC J;  4F4Y A;  2A6M A;  1S0O A;  1RU1 A;  3D68 A;  4QW8 A;  3B8H A;  3ZTS A;  3T1H J;  4Z2X A;  4QW9 A;  5K8P A;  3RYL A;  1GTH A;  1PBA A;  1IXK A;  2CQD A;  4PXE A;  2ZKU A;  1DTT B;  3EWG A;  4B08 A;  2M8H A;  4CO1 A;  4RU9 A;  4Y65 A;  3QZ8 A;  2V0N A;  5DM7 Q;  3CJ8 A;  2E9T A;  2MLX A;  1T9V A;  5KFP A;  2Z4P A;  4A8X A;  4TQS A;  5D3G A;  3ISN D;  4Y2K A;  3WIU A;  3ILL A;  3TQE A;  2VG7 B;  1F2H A;  2MZR A;  3AJD A;  2LEP A;  3BR8 A;  3GZ7 A;  5GME A;  5KAK A;  4HVZ A;  1Y4Z B;  4P2S A;  3V81 A;  2A6O A;  2LXI A;  1T3N A;  1AZS B;  3PYG A;  1SIZ A;  4LBI A;  4USK A;  3CD5 A;  1CJK A;  2GIQ A;  2I5J B;  3QLH B;  3C2P A;  2GJI A;  5M2U A;  5HMY A;  2QA4 G;  3EXC X;  3W60 A;  1NSK L;  1EQM A;  2BRK A;  1KQF B;  3C6T A;  4C4W A;  2OEL A;  5F8M A;  1V9O A;  2V2V A;  2UV8 A;  3BBC A;  4B9L A;  4OL8 A;  1VQ7 S;  2OO4 A;  4AFF A;  3MMC B;  1WC5 A;  3T1Y F;  2G0I A;  4OHV A;  2F4V J;  3R2D J;  5KFL A;  4ALZ A;  1KEK A;  1OIA A;  3CCV S;  2EKY A;  4XK8 C;  3MMC A;  4IG3 B;  5HL7 Q;  4DV4 J;  4I2Q A;  1RTI A;  3I6P A;  4DWI A;  2M70 A;  4OZ2 A;  3GR1 A;  5F41 A;  1WC3 A;  5HJY A;  1N34 F;  3RJM B;  1NPR A;  1RT6 A;  3ZXW A;  2XS7 A;  5HI7 A;  1NME B;  2JL9 A;  4NCG B;  3AXM A;  4DZ6 A;  4LBP A;  3W62 A;  4PXC A;  2OP5 A;  3P45 B;  3FKB A;  1LFW A;  4AXI A;  1EKR A;  2MHN A;  3ILI A;  1KBR A;  3G2X A;  3EGZ A;  2PMW A;  4DLG A;  5I3Q A;  4DL4 A;  2Y1I A;  3M6V A;  3JXO A;  2D1C A;  4IG0 A;  5D77 A;  3MCO A;  1SL1 A;  2FUG 9;  1YGY A;  3RU0 A;  2A18 A;  3K5L A;  2EVZ A;  4FZV A;  1UVI A;  1IKW B;  5T7L A;  3KLH A;  2C3Y A;  1UPP A;  4F04 B;  2RUG A;  2B9W A;  2F4F A;  4WFB Q;  3BPS P;  1WTF A;  1KD1 T;  3I4H X;  5A8K B;  2ACY A;  1HNW J;  3C19 A;  1NAQ A;  2ZDO A;  4LUB A;  1CJU A;  2QYC A;  3I0S A;  3IA0 A;  4KHP J;  4MKA A;  4EO8 A;  3TZX A;  3DLE B;  2CAJ A;  3U1L A;  6FDR A;  3JS9 A;  2NXN A;  4C7Q A;  4J5O A;  1Y5I B;  3SSR A;  3HD1 A;  1RT4 B;  4TU8 A;  2V2Z A;  3ITH A;  3KUE A;  4I0W A;  2JLG A;  1UA1 A;  4DS5 A;  1B3T A;  2O66 A;  2P8I A;  4LF4 J;  1RT1 B;  2QZ8 A;  3LOU A;  1X5S A;  4UUX A;  2H54 B;  3UWT A;  3JB9 k;  2HHV A;  1B64 A;  3HI9 A;  2R7O A;  5LMU J;  5K9F A;  4DDF A;  2V34 A;  2NXE A;  1P1T A;  1XNQ F;  1RCO B;  2FD2 A;  1WC4 A;  1FVQ A;  2DKO B;  4LF4 F;  5KFB A;  1Q78 A;  3T9Z A;  1CJV A;  2UXB F;  4GRS A;  1UWB A;  2MSS A;  3M05 A;  3GPA A;  1IKY B;  3B6B A;  1T9T A;  4PXD A;  4QBU A;  3R3T A;  2OFH X;  3NS6 A;  1EJ7 L;  2FVC A;  1WWH A;  2O01 C;  4LFA J;  4V1A k;  2QSW A;  2KO1 A;  3U1M A;  1LWE B;  4OI2 A;  3G8S A;  2KDO A;  3DLL Q;  2MLZ A;  1NEE A;  4CTA A;  4RBV A;  4GMK A;  1VI7 A;  1PC4 A;  1H98 A;  1RSC A;  3UDV A;  4LSN B;  3MR6 A;  1Y10 A;  4A47 A;  4DFJ A;  4JI2 J;  2E5L J;  4OI3 A;  5E3C A;  4C48 A;  3G82 A;  1VMB A;  2NXC A;  2XM3 A;  4IO9 Q;  1C0T B;  1ZBT A;  4UTG A;  2CQ2 A;  1IBC B;  2WBR A;  3NCR A;  3TAP A;  1H72 C;  3TEG A;  4ETX A;  2HVZ A;  1SH3 A;  3FEX B;  4FF4 A;  3OTO F;  1QVG R;  3SBM A;  1OPZ A;  2IYI A;  3RB3 A;  1UVN A;  2YKN A;  3HVW A;  4Y2I A;  3S8S A;  1NK5 A;  1GXU A;  4DV0 J;  2WTF A;  1S9G A;  3FFI A;  3UN2 A;  3OHB A;  2FHJ D;  5F8J A;  2MZQ A;  2QN6 B;  2V5H G;  3RRH A;  3Q83 A;  3WC2 A;  1LK7 A;  5HQ8 A;  1RTJ B;  3M32 A;  1VQ5 S;  5HQL A;  5KFA A;  3KKF A;  3T3F A;  2BZ2 A;  4NLQ A;  4AL6 A;  1LXN A;  3GV7 B;  1J27 A;  4I6A A;  2YWG A;  4LIR A;  2ATL A;  1WUU A;  2F5G A;  4NA3 A;  4NEZ A;  2V94 A;  1D1U A;  3DMJ A;  1CPZ A;  4AE5 A;  4C3L A;  3TVY A;  3Q0A A;  3K8W A;  3QMQ A;  2W01 A;  3N79 A;  3Q2S C;  2W9C A;  4C6A A;  2AJF E;  4KGZ B;  4CH7 A;  1O5J A;  2ZZM A;  4RPF A;  4CDI A;  4YY3 F;  5J2P A;  1W26 A;  1FNX H;  2HEK A;  4MTP A;  3OV7 A;  1HL6 A;  3V6D A;  3MMJ A;  5KFE A;  1JNZ B;  2IM0 A;  2XO6 A;  4M5D A;  2E5L F;  2UUA F;  1SIW B;  5HMW A;  3B54 A;  4ID8 A;  1C0U A;  1EZZ B;  1S6O A;  4K5R A;  1JIH A;  3FEY B;  2CG8 A;  3MMA A;  4KHR A;  3W5Z A;  2GZO A;  3PYD A;  4CLZ A;  1D8Y A;  1E6V B;  2B5J A;  1D8Z A;  1EET B;  1P9Q C;  3BV8 A;  1S4F A;  2F63 A;  3LGH A;  2JDJ A;  3KLG B;  2WON A;  1T9W A;  4JI2 F;  2ZVI A;  2R8I A;  3VAK A;  1ZPW X;  2XMU A;  2MQM A;  5HP1 A;  2L3M A;  1U1M A;  1APS A;  1RUS A;  2QO3 A;  3C15 A;  2EFN A;  2W8L A;  5E33 A;  3C8Y A;  3C14 B;  2Y1L B;  1Q86 T;  1KRP A;  3QPI A;  2QMX A;  1J5O B;  3KJQ B;  2VPW B;  4B9S A;  5E5N A;  3CJT A;  3QRR A;  2EBG A;  4JI4 F;  1IJF B;  2JSX A;  3ZZ0 A;  2KU7 A;  3NXZ A;  1BWE A;  5E3R A;  2DNR A;  1RYR A;  4W92 B;  4YHH J;  3A4T A;  3J7Z T;  1YVF A;  1MRO B;  4TN2 A;  3ONQ A;  4M5I A;  2ACM A;  5L38 A;  4JI1 F;  5B7W A;  3KLE A;  3OLB A;  4B3O B;  2V4Q A;  4ZPA A;  3VAF A;  1YZ6 A;  2C1E B;  2UVW A;  1GH8 A;  4DPT A;  3JSM B;  4P2F A;  3HFK A;  3KUG A;  1RAH B;  2DY1 A;  4IOC Q;  2KN4 A;  3ZZP A;  3ZTQ A;  1JX4 A;  2VQF J;  3L9Z A;  4CO3 A;  2GHV C;  3LW5 C;  2Y0S D;  3KLE B;  1WDT A;  4A8W A;  1TV6 B;  2YXL A;  1TKX A;  2WB4 A;  1XR7 A;  2QIF A;  3H5S A;  3HT0 A;  4CLY A;  1QAJ A;  1ZH5 A;  3W3S A;  1SJQ A;  1K1Q A;  3DYA A;  2DO4 A;  1GXT A;  4NMX A;  4MKY A;  4YR3 A;  4NLV A;  1MN7 A;  1PIL A;  1ZM3 A;  2BQU A;  1UJ6 A;  2DTJ A;  1FRM A;  2CPH A;  2OPS A;  3DDI A;  1NUE A;  3JTP A;  4ZA1 A;  5H1S V;  1HQE B;  2BJ3 A;  4ZVU B;  1RI7 A;  3JAM U;  1YJW S;  2GML A;  3AJ2 A;  1CBK A;  4H54 A;  2R8H A;  4NLX A;  5CD4 H;  4A8K A;  4RR5 A;  3TJ9 A;  1IKV A;  5LSR A;  5KTQ A;  1J2V A;  2E7V A;  1UFW A;  3PDN A;  5HMX A;  3QRP A;  3L95 X;  2VDH A;  4CLW A;  2HBQ B;  3PAC A;  4FYD A;  4DSI A;  2RD5 C;  3S6E A;  4YHH F;  4LVN P;  2V68 A;  2ZH6 A;  3T5H A;  3HLU A;  3T19 A;  4ERD A;  3U27 A;  2XGQ A;  3HSD A;  3Q8Q B;  1U0S A;  3T5K A;  1SKR A;  4QIG A;  1PG5 B;  3DDN A;  3DRS B;  3ISZ A;  1JLG B;  1RAE B;  4XTT A;  1UW4 A;  2QX0 A;  1RHJ B;  2B4U A;  2VUG A;  3KLI B;  3BSN A;  2BKN A;  2CAD A;  4X65 J;  4LF5 J;  2M88 A;  2GW8 A;  1FFG B;  3GJS B;  4RLE A;  4BBY A;  4FF1 A;  3BO3 A;  3NS7 B;  1JXV A;  1BUX A;  2N82 B;  2RAQ A;  3NS5 A;  2H48 B;  1XNR F;  1U26 A;  4FVC A;  1R43 A;  2KT2 A;  5D15 A;  4C8Y A;  2BKP A;  3BF4 A;  3M30 B;  5A8R B;  3QSI A;  5FD1 A;  3MEK A;  3BSC A;  4B17 A;  4N76 A;  1RB0 A;  3NCQ A;  4Q44 A;  2AQ4 A;  3J80 U;  4DPY A;  2ZOF A;  2WW8 A;  3GP9 A;  4XAK A;  1OY9 A;  1S6Q B;  2GJF A;  4B9M A;  4EZ9 A;  2CJB A;  1X4D A;  5H9F J; 
#chains in the Genus database with same CATH homology
 3VGV A;  4UOH A;  3ZTP A;  3BBC A;  1NCL A;  2HVD A;  3PJ9 A;  4C6A A;  2BEF A;  2NCK L;  3EVM A;  3FCW A;  3NGT A;  1NDL A;  1VYA A;  4CP5 A;  2CWK A;  5IOL A;  3ZTR A;  2BX6 A;  5CAB A;  1WKJ A;  3B54 A;  1KDN A;  2B8P A;  1HIY A;  4ANE A;  1NDK A;  1NSP A;  1PAE X;  4O0N A;  1LWX A;  1MN9 A;  4FKY A;  3VGT A;  4HR2 A;  1F3F A;  4DZ6 A;  3FKB A;  1ZS6 A;  3G2X A;  3Q89 A;  1BHN A;  2HVE A;  1K44 A;  3FBE A;  1NSQ A;  4ANC A;  3ENA A;  4AND A;  1WKL A;  3Q8Y A;  4DUT A;  1W7W A;  2DXD A;  1BE4 A;  3ELH A;  1U8W A;  3L7U A;  4F4A A;  2DXF A;  1S59 A;  3BH6 B;  3NGU A;  2B8Q A;  3DKD A;  3EVO A;  3VVU A;  2ZUA A;  3JS9 A;  2DY9 A;  1B99 A;  2VU5 A;  2DYA A;  3ZTQ A;  3VVT A;  1NB2 A;  3Q8U A;  3ETM A;  1NPK A;  2AZ3 A;  5CAA A;  1NDC A;  5BXI A;  4S0M A;  3Q86 A;  1MN7 A;  3BH7 B;  3EJM A;  4EK2 A;  3DDI A;  3VGU A;  1NUE A;  2HUR A;  4F36 A;  3FBC A;  3B6B A;  3GPA A;  1S57 A;  1HLW A;  1XQI A;  3FBB A;  3FC9 A;  1XIQ A;  1NLK L;  3EM1 A;  4KPC A;  1HHQ A;  1WKK A;  4WBF A;  3ZTS A;  4ENO A;  3MPD A;  4FKX A;  3BBF A;  2AZ1 A;  1NHK L;  3EMT A;  1NDP A;  1S5Z A;  3WX8 A;  3FBF A;  4DI6 A;  2DXE A;  3EIC A;  1LEO A;  1PKU A;  3Q8V A;  1EHW A;  1JXV A;  1BUX A;  4W98 A;  3EE3 A;  3FCV A;  3NGR A;  1F6T A;  3BBB A;  5C7P A;  3EVW A;  4UOG A;  3Q83 A;  3NGS A;  3VGS A;  4UOF A;  3PRV A;  1UCN A;  3R9L A;  3GP9 A;  3ZTO A;  1NSK L;  1B4S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...