1NLKL

Crystal structure of myxococcus xanthus nucleoside diphosphate kinase and its interaction with a nucleotide substrate at 2.0 angstroms resolution
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
143
structure length
143
Chain Sequence
AIERTLSIIKPDGLEKGVIGKIISRFEEKGLKPVAIRLQHLSQAQAEGFYAVHKARPFFKDLVQFMISGPVVLMVLEGENAVLANRDIMGATNPAQAAEGTIRKDFATSIDKNTVHGSDSLENAKIEIAYFFRETEIHSYPYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NUCLEOSIDE DIPHOSPHATE KINASE
publication title Crystal structure of Myxococcus xanthus nucleoside diphosphate kinase and its interaction with a nucleotide substrate at 2.0 A resolution.
pubmed doi rcsb
source organism Myxococcus xanthus
molecule tags Phosphotransferase(po4 as acceptor)
total genus 43
structure length 143
sequence length 143
chains with identical sequence R
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 1994-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 1nlkL00
1NSQA 4W98A 3BBCA 3FBEA 2CWKA 1EHWA 1HLWA 3WX8A 3EVOA 3B6BA 3NGRA 4DUTA 3GPAA 1F6TA 4EK2A 3FCVA 3NGUA 4F36A 1XQIA 1B99A 1LWXA 1BUXA 1W7WA 3FKBA 4WBFA 3ELHA 1NSKL 1U8WA 3L7UA 4ANEA 5CABA 4KPCA 3Q86A 3MPDA 2BEFA 1MN9A 1NDLA 2DXDA 3Q89A 3VGSA 1S5ZA 5BXIA 2B8QA 3ENAA 4ENOA 1ZS6A 3EE3A 3Q83A 5CAAA 1KDNA 1S59A 4UOGA 4FKYA 1BE4A 3ZTSA 4O0NA 3G2XA 1NPKA 4C6AA 4FKXA 3DKDA 2BX6A 4UOFA 3Q8YA 4DI6A 2ZUAA 1NDCA 3GP9A 1F3FA 3EVWA 1NHKL 4UOHA 3VGUA 1JXVA 1NLKL 1NSPA 2DXEA 3EJMA 4CP5A 3NGSA 5IOLA 3BBBA 3EICA 1NDKA 1S57A 3FCWA 1XIQA 1NCLA 2HURA 1NDPA 3Q8VA 1VYAA 1K44A 3NGTA 3ZTPA 2DYAA 2NCKL 3FC9A 3PRVA 3VVUA 4F4AA 1PAEX 2AZ1A 3VGVA 3ZTRA 3BBFA 4ANDA 2DXFA 1UCNA 3DDIA 1NB2A 3VGTA 3B54A 4S0MA 4HR2A 3EMTA 3ETMA 3EM1A 4ANCA 2HVEA 4DZ6A 3BH6B 3FBFA 2AZ3A 1LEOA 1HIYA 3ZTQA 1WKLA 5C7PA 2VU5A 3EVMA 1MN7A 1WKJA 3VVTA 1BHNA 2DY9A 1PKUA 3ZTOA 1NUEA 1B4SA 3JS9A 1HHQA 3PJ9A 3Q8UA 2HVDA 3BH7B 3FBCA 2B8PA 3FBBA 1WKKA 3R9LA
chains in the Genus database with same CATH superfamily
4EZ6A 3KTQA 2V5HG 2MHEA 3B6BA 3NGRA 2KM8C 4OYBA 2R7XA 1RADB 3K7RA 3BO2A 2VPZB 4NLGA 3IR6B 4LFAJ 3L7UA 2DEJA 3I9ZA 1SIZA 4J9MA 4DL7A 2HHTA 4WXOA 3I6PA 2I1RA 2B9EA 1RAEB 4DS4A 4JV5F 4WKRA 4Y6IA 3MM7B 3LGNA 2Y3YA 1N5SA 1WDDA 5DS7A 5KT2A 3CJKA 1MWZA 3D54A 5L46A 1SV5A 2EFGA 1XEZA 4CO1A 3C6UA 2K8GA 2ROGA 5J1NA 4DV1J 3UDEA 1FJGF 2HBZB 2F8HA 3OTDA 1Q53A 4KE5A 5KG3A 2DITA 3HVTB 2R8HA 3ZTRA 1YZ7A 2MY8A 1DTQA 4ELVA 2GMHA 5KG7A 1RCOB 2KHDA 1FF2A 4MK7A 2EXUA 4NA2A 1GMWA 1S6UA 5IT0A 2C3OA 4QCLA 2XWXA 2I8EA 1RT1A 5SZTA 3ZZPA 5I42B 3POTA 2VQEJ 4JV1A 1H72C 1TVRA 2CYYA 1XERA 5EWGA 2A2CA 1WG4A 4BC7A 4NYZA 1EX8A 1U1OA 2RD5C 1DBDA 3K59A 3W3SA 3BGLA 5DG9A 1CJKA 2JX2A 4KGKA 1SBRA 4CWBA 5DQGA 4F04B 4LJMA 3DM2B 1TV6A 5C42A 2ZBIA 1QD1A 2CJAA 3PEJA 4AUKA 2M8HA 4ECYA 1Q86T 3PX4A 6FD1A 3UD3P 5HLFB 3BR9A 3P5BP 1AFIA 2UUBF 1UW9A 3M32A 1JJ4A 5GAHU 3IFEA 2DRDA 3BO4A 5CD4H 4EBDA 1JJCB 1IJEB 3EYZA 2GHPA 4ZIVA 1YDLA 1HBUA 5I3QA 5LXRA 4ZPCA 1U26A 2ZZMA 1R0AB 1WEYA 4YN3B 3MMBB 5CD4A 1PC4A 2VG7B 1U09A 1JLBB 3NOGA 1ZOTA 2Q43A 2YX4A 2XS7A 3NRBA 3TO8A 1TUGB 4LSZB 4HEA9 2DGQA 3MWBA 2KL8A 4DV4J 1PYSB 4LF9F 3CCJS 4OYPA 3BYRA 3NBPA 3RBZA 1P1TA 5HATA 2C22A 1HNXF 4B02A 4IO9Q 1NSAA 1SKUB 5KT6A 3OFHA 2UU9J 4USMA 2WHOA 4RW6B 2H5JB 5A2QY 3LP0A 3K57A 3H2VE 4WFYA 1TQLA 4MFBA 3PW5A 4WU3A 5CYJA 1FCAA 1RLCL 4F3MA 2HNZA 4NLWA 4RR5A 3PRVA 5HMYA 4NCBA 4HKQA 3ZNJ1 1MU2A 3FK4A 3M8YA 3G82B 2AGPA 3LA0A 2HG4A 1N32F 3CCTA 2MDAA 1H2UX 2RF2A 3HHEA 4USJC 1ZAXA 4NZ0A 4KQZA 1F3VA 3AOCA 1ZM2A 4GC6A 4QR1A 2V69A 3Q8RB 2PI5A 3S1TA 4ED7A 1FFSB 5KFGA 3I0RA 2HFSA 1NSQA 1VQ9S 5KFWA 4NWBA 1Q78A 3MECB 4Y2CA 2KG0A 4NXNJ 1XJWB 1VQLS 4ZS6A 4AD6A 3ELHA 5KAKA 3DLJA 4PPDA 2HGLA 5EX3A 2RMLA 4KAIA 1B64A 3TP2A 5F8NA 1OIAA 3TX0A 4PYDA 4PCQA 4FBUA 1N5YB 4E98A 5KG4A 5B0BA 2HQGA 3RTVA 2W2NP 4M5MA 4MT1A 2DPIA 1SI9A 3NGKA 4FYDA 1E6VB 1RKJA 3ENWA 2AYGA 1YJWS 5D78A 5L39A 2UXCJ 1NM2A 4GVLA 2RUGA 1NEEA 1JLCA 4R5PB 5A76A 1F60B 3SQGB 2VDHA 4QIGA 4E8UA 4PG7A 2R7SA 2IA0A 3QLHA 1HWUA 2QIFA 1Q8BA 3D28A 1W2BR 3QATA 4WZMA 1RAHB 1H6KX 3MEDA 4ED8A 1OYDA 1F5BA 5F8HA 1UP1A 4ZPBA 5F41A 4LBPA 3GJRB 3MR2A 1LV5A 1IBKF 1RP5A 1FDBA 3C6UB 3H5SA 3W5YA 1I1GA 2JL9A 1X4GA 2HS4A 1N5TA 1S7IA 4QYRA 7AT1B 3W61A 2MMYA 4OZLA 3L9ZA 4ILRA 3QGHA 4ZP7A 2H4YB 3VZHA 3E51A 5J2MA 1S79A 1YRXA 4JI4F 1S7HA 3KJVA 1Q8LA 2I9SA 2LKZA 4DFMA 4TU7A 4LIWA 1B7FA 2HMIB 3HZEA 1UPPA 2WB4A 4MK8A 1FKAF 3OLBA 4WP9A 5A2QU 3ULHA 3BBBA 1HR0F 1PBUA 2Y8YA 3R6GB 4HI2A 3H20A 1VJWA 3E8OA 3J81U 1QSYA 1HNWF 3DMJB 1VQ6S 1FJCA 1RA7A 4GRSA 1CJKB 1C0TA 4OZNA 1VBXA 4YY3J 2DR9A 1KS2A 4LR9A 5K9FA 2G9OA 1VK3A 3K0JA 3P6YC 3MPUB 4NXMF 2WSEC 3IP0A 2GW8A 2LYVA 1YJVA 3UD4P 2RSQA 2MSTA 1P27B 1WTBA 3M32B 1Y11A 1FVQA 3M8PA 1FERA 4I4BA 2HHWA 1R6YA 4CLZA 2CQDA 4LFBF 2NS1B 3IGVA 3M6WA 5LT5A 2XY7A 4B3TF 2QG9B 2YKMB 1LK5A 4K5SA 1YZ6A 3MM6A 1V5VA 3Q86A 1S49A 2ZD1B 2VG5A 3MM8B 1REVB 1DLOA 2PN6A 3FEXB 3KLHB 4F4ZA 1EP4A 3RB4A 4LBIA 3BO3A 4OFZA 2DRBA 1KRPA 2J5AA 4H4MA 5IC4B 4FPIA 5JUMA 3EX7B 2C3YA 3NGTA 1IVZA 3PEHA 2RKIB 1KFSA 1U1KA 3L7PA 3JTPA 3KK3B 3BKTA 4NYOA 2E5IA 4GKJJ 3WHIA 3EM1A 2CNLB 3BN4A 5IT9Y 3EZ5A 5KFTA 2XS5A 2B4OA 4EZ9A 3KUEA 4NLDA 3W9HA 3FFIA 1PYOB 4OI1A 3PJ9A 4DZDA 4C9DA 2ZH1A 3FBBA 2PEBA 1N5QA 2XSFA 2ILZA 4ED2A 2E1MC 2YNGA 1Q79A 4OX6A 1TKDA 3MOJB 1C4AA 4CT9A 2XY5A 3DRSB 4PAAA 3G6YA 4CM2A 4KHPF 5JMNA 5GVQA 3IG1A 4GMKA 1GK8A 1S59A 1XC9A 1FRJA 1T95A 3OL8A 3TAMA 3ZXWA 4RNFA 1X5TA 2RF2B 2PGCA 1VBYA 4DI6A 1WG5A 5IWAJ 2CQGA 2LQ9A 2W4PA 3V6DA 1HQEB 2CXEA 3FCWA 3D0IE 2XLIA 8RUCA 3T1HF 1C4CA 2GMJA 1D8YA 3GR1A 3IRWP 4DUZJ 1HYSB 2OFHX 2IVYA 1J27A 3SQOP 2NXJA 4IQXA 3K8WA 2D1CA 1HBMA 4OI6A 2DGWA 3W2WB 2CPXA 4NI2B 2HBRB 3GONA 4UUXA 3PW4A 4UZCA 2P6SA 3J7YI 2GX8A 2V8HA 4DCJB 1FTRA 1RAGB 2IBKA 3R3TA 2DNYA 4ED0A 3PIPQ 4ZVGA 3MPYA 1FEEA 3VAIA 1C1CA 4DEZA 5KFHA 2UVWA 2DBBA 4X66J 2HVHA 1S1VB 3BREA 2DTJA 4QWAA 3QWPA 3QO9B 1JXLA 4PXEA 1WD6A 1JLGB 3QJLA 1Y5LB 4U8VA 2JJ4D 3RZAA 1UVNA 2ZUGA 3C14A 2QSFA 1RWOB 1YWXA 3FEYB 1CEZA 4ZHRA 2FJWA 1NDPA 4DV1F 4B3RJ 2QZ8A 5KG2A 2IAJB 2R9LA 3PJXA 3EZOA 5KFRA 2VBZA 4QWEA 4K4SA 1YK9A 2SXLA 4WKYA 2FZKB 3GYNA 1DHMA 2R3VA 2ZKUA 3H59A 3LAMA 4C8ZA 4LF4J 1HIYA 2CPHA 4OMFG 4USVA 2XGPA 2CQ4A 3AA8A 2VQEF 5IT9U 2J9CA 3EPIA 2HRUA 3LP2A 2MQPA 2VHGA 3PRDA 3C16B 3R5JB 2CQ2A 1LW0A 1NB7A 4FYXB 5EWFA 1RB0A 2B3TB 1F6TA 3HHLD 4NL5A 1HQUB 3GTYX 3CD7A 1S6PB 1YQHA 4RW7B 1ELOA 2W4DA 2FQQB 5KG1A 2LQJA 2VFUA 3EPGA 2IM0A 4DQQA 3MPWA 3H4BA 4G6VB 2DGOA 2FY1A 1UJ5A 3H25A 1F3FA 1R43A 4N47A 4BHQA 3SDEA 2XI2A 3OBIA 2EK6A 3QFHA 4LF1A 2N7CA 4OQJA 4YUDA 2G0IA 1QAYA 5LXYA 3RUBL 3MM6B 3HHLB 3ITHB 3P3DA 2KB2A 2V2ZA 5BJRA 1VHIA 4U8YA 4DV0F 3FJ2A 1VQPS 4B9VA 3HF5A 4DF4A 3R6LB 3P5TL 1R8AA 2HNYA 4ATNA 2VJUA 4DL6A 2X1AA 2AJFE 1TELA 2RAQA 3N5FA 1WUUA 4YR2A 3FMWA 4DV4F 2ATCB 3KHRA 3CCSS 2DR5A 2D7SA 2GO8A 4OV6A 4ANEA 2MKJA 4OYMA 5IM0B 5B0CA 4DX6A 2UU9F 3NG8A 3CJTA 4E0DA 4K0KJ 1NPPA 4IR1A 3ETOA 1NLKL 4U6PA 1UL3A 1P9QC 1QAIA 2V63A 3RG6A 2XY6A 1P1LA 3T6BA 5DM6Q 1TKZA 3G6XA 4ZVOB 3NAHA 4X4OA 3NWGA 3NEKA 4ZJLA 5IT4A 3MMAA 2Y1RI 1WORA 2ZJRQ 2BZ2A 4U7CA 4I7FB 1LEOA 2CNOB 2XNQA 1FWLA 4PKDB 3V5RA 4PG6A 5KFAA 2CPFA 2Q79A 2OPSA 4U9RA 2ZITA 3D2WA 3B4DA 1U1QA 2XMMA 3OV7A 2W8KA 4KY3A 1UZHA 4DX5A 2HZVA 2NR0A 1B0TA 4DOZA 4A8KA 1QTMA 2E7WA 4QW9A 1NK5A 3DRRB 5D77A 4U96A 3VCDA 4C0BA 1K73T 4CYUA 2DXDA 3C6TB 4IG3A 4IG0A 2DO0A 1KR4A 2DRAA 1BD6A 4ZCLA 3PG9A 2MB0B 1CC8A 5GADI 2NSCA 4P73A 2CG4A 1DFDA 5K14A 1NDKA 2UXCF 3HDSA 1RWWB 2BQUA 2JFDA 1Q0NA 2P9EA 2BQRA 2J6SA 5A8RA 1FT8A 1MMLA 4IDKB 4DPTA 3PACA 4O44A 4DLGA 1M0SA 3GLJA 3TVKA 1R8BA 1S1XB 1YBAA 6AT1B 4CLFA 1AYEA 3C3LA 1S1WA 4HDHA 4M5JA 3PKYA 3THVA 2HHVA 2FYXA 5DQHA 1FRIA 4ZVSB 3R5AA 2Q6CA 5GMEA 3M9OB 3G9CA 3ILLA 4H4OB 4MKBA 1RT2A 4EBCA 4EO6A 5IS2A 1FHTA 5H9EJ 4Y34A 5A6PA 1R8HA 2LXFA 4DLEA 3RB6A 1X60A 1NDCA 4DU8A 2VF3A 4Y0FA 1VJQA 2COLA 2FLNA 1HA1A 3SMZA 2ASJA 2B43A 2XC9A 3UPFA 3GIKA 1LW0B 4ED3A 1TZ0A 2D69A 2H54B 4RBTA 4QU7A 4L3NA 2BJDA 2GJFA 2R7WA 5BYSA 4O4GA 1IKYB 4YY3F 2OELA 3GB0A 4EGLA 2CVEA 4IO1A 4KIAA 4PEOA 1ITPA 4F3OA 3TEGA 1UJ4A 2YXLA 3SFGA 2ROPA 2HFVA 4WFAQ 2L41A 3M2UA 3WX8A 2BOAA 2HAFA 3CE8A 4KKOA 3SDEB 3LTOA 2NPIA 2VPYB 1WTFA 1CS4A 4ECTA 4NRTA 1OY9A 3KLIA 2PD1A 2B7CB 1RT7A 3KHLA 3CIMA 5F9NA 1JJHA 2KXFA 2OSRA 3JSBA 5FIIA 4IRCA 4CNYA 3H8YA 1OQ3A 4DL4A 2Y1JA 1NSPA 3FRYA 1VK8A 4UZBA 3OR2A 1HI8A 4WP3A 3EGVA 3L4BC 1FEHA 5L1KA 2NREA 4GO7X 4X84A 4DBQA 2FB0A 4DR7J 8AT1B 2RILA 3DRXA 4ZK7M 2IYGA 1SC3B 2X3GA 2DIVA 1F5CA 4GKJF 3GCWP 2QJ3A 1H98A 2FGCA 4NRUA 3KLGA 5A8KA 4KO0A 2HLTA 1T0TV 1VC0A 2ZVSA 2YX1A 4DV2J 1WKLA 1FDNA 4OX9F 2Q3PA 2W9BA 3T19A 2BANB 1ZZFA 4DR6F 1R31A 4FDFA 1F9FA 2JLGA 2E1CA 4RWWA 1JKHB 3EUNA 2GJ2A 2F9JA 3EXYA 3UWTA 1U8WA 4AYBD 4EMDA 5H9FJ 1U6ZA 4WPAA 2IM3A 1HPZB 5DDOC 2GAHC 2LLZA 3G8QA 1MMDA 4CP5A 1RAIB 4J9PA 3GV7B 2VJVA 2AW0A 4B3SJ 2CJXB 1WC4A 4ZVEA 2NXCA 2HWTA 4R8UA 2BE2B 1N48A 5FJ4A 3KJNB 4ZPVR 4DUZF 4I64A 4Q7AA 2XMWA 2RNEA 4ANCA 4M5DA 4NLPA 1RE1B 1MWQA 3FSXA 1T05A 3TUPA 1MW7A 2OEMA 4DCOB 4KT0C 3MCOA 2A18A 1WKKA 2HIYA 3LGHA 5J2PA 4OX7A 4ECQA 1WI6A 2QX0A 3D0HE 3M4XA 4LQ9A 3VHQA 3HM9A 2M7SA 2R7QA 2XLKA 1BQMB 1F5AA 4X4TA 2FC9A 2OAUA 3B78A 5FDLA 5FLXY 1ZS6A 3QIDA 2CKWA 3NKYA 3BJYA 1VLYA 2D3ZA 1FK9A 2Q66A 4PUOB 2FZGB 4HI1A 3GIJA 4NPOA 4J9RA 5DDRC 1S1WB 4NX9A 1D9FA 3OD2A 4C0HA 4B9LA 4B3RF 4YS2A 3SEOA 2QTWA 1ZM4A 1KONA 2V4RA 2EG1A 1W2IA 1HHSA 2W9AA 4ZMMA 3DLGB 5C24A 5DZ7A 2YBVA 3AHPA 3R5GA 2AGOA 3UQSA 1RTDA 3N79A 4LF4F 2HRTA 3BQ2A 1V6HA 4B3OB 4W4MA 3MM5A 4HHJA 2N7YA 2VBYA 1F2HA 3M2VA 4I2PA 4YDDB 4KGVB 3AQPA 4ITSA 2B4PA 5J1EB 4OZ3A 5LSRA 3DDNA 4FP9A 2RU3A 4PQUA 4DL0C 2E29A 3H7HB 2CUYA 5J2QB 1SVDA 4O4GB 4C8YA 1VBKA 3O1LA 3DU6A 5ETRA 5KG0A 1QSSA 1R0BG 1SUQA 4IH6A 2XM3A 4JYAJ 3FRZA 2EWHA 2M70A 2QL9B 4OX8A 2OD4A 3FQLA 5DO2A 1PAUB 4QZVB 2ASDA 2ZVIA 4C8LA 3K2YA 2UVRA 1R7IA 3UR3C 4KRWA 4ZJQA 3VQSA 3BDEA 3FMBA 3CD0A 2DXFA 2ZE2B 1RBOB 1BQNA 2VV5A 2AV5A 2XGQA 2HVEA 2QA4S 1ZPWX 4JP8A 4M1KA 2Z57B 2ZH9A 3WIUA 4N8OA 3UN3A 5I3PA 4J5OA 1WC1A 1SC6A 4K59A 3OR2B 1Y9OA 2IMOA 2LXUA 2F40A 3C19A 3AD8C 1CJUB 2UUCJ 5D0EA 4Y2IA 4C97A 5D4PA 1VRTA 3ZZ0A 4CO4A 2HNDA 3BQ1A 2K7KA 4WYWA 3PTWA 3Q22A 3MEEB 5DG7A 1WSRA 1EKSA 1MMNA 2YKAA 4KO0B 1NKBA 4TY8A 5JJBA 1VQYA 5FLXU 1EAYC 2ZH6A 2Z8QA 1NHKL 4K0KF 1QTNB 1RI7A 2MTLA 4RBUA 4I0WA 1WJ9A 5LSLA 2QMXA 4NLTA 2CPIA 1IQZA 3DI6B 5F9LA 3Q8VA 1Q8KA 2N4DA 1ZH5A 3DLKA 3L95X 3UDCA 3D68A 1UWBA 1XMBA 1Q81T 1DAXA 2NXUA 3EMTA 4PYAA 2F5GA 3AQOA 3S7RA 4RWXA 2WBMA 4FXWA 3N6NA 1ZM9A 3JQKA 2BM0A 4YOEA 1U49A 4N77A 5D3GA 1VQ4S 5THWA 2B7BB 1E6YB 4JI1J 3PW2A 2X1GA 1M1GA 5D0HA 1A7GE 4DV7J 5B7WA 1RYSA 1HBNA 2DNOA 2OLWA 1OS5A 3HJVA 5IQQA 1T94A 2QYGA 4NCAA 2E1PA 2KVQE 4Q43A 3HXMA 1T05B 1Q5VA 2AWZA 2EKYA 2VBXA 3BSCA 1T03A 2DK2A 4OJHA 3GE9A 2CRLA 1S4FA 4X64J 2DPJA 2F1FA 3FDSA 3H40A 2JHEA 3W66A 2Y1LB 5J2PB 2ERRA 4KH0B 3FSIA 4B9TA 3W60A 5GAHI 3DDIA 3SSQA 2E5JA 1X4BA 1HD0A 1NK4A 2YX7A 1KVJA 2FHOB 3JTNA 3MXHP 1WOSA 1S1TB 4X2BA 3NCPA 2HFNA 1RISA 4ELTA 2QEXS 3TJAA 2NQPA 2FVCA 5B0FA 5BR8J 4YB1P 3PO5A 3M30A 1FK9B 1FRLA 3M9NB 3ET6A 2RU9A 1RU2A 2A6OA 3HSDA 4NEZA 3CMAS 5CYMA 1RT4A 2XI3A 4YQWA 5HAOA 2ZZTA 3TUZC 1GXLA 2GQ2A 4G3IA 2W01A 1WF2A 1XR5A 2B6AA 4X65J 3HT3A 4RW4A 1GQEA 3Q89A 3W7BA 2DNNA 4H4KC 4OZ0A 5GMDA 2M9KA 1BE4A 3W9IA 5AXLA 1GMVA 3CMQA 2X51A 5CHCB 3KHHA 3BGRA 1KHVA 2BKNA 3W1YC 3A8IA 2X3DA 3QGIA 4C0OC 3JSMA 4ANDA 3HI9A 3MMJA 2ZH2A 2OEKA 4NLQA 1N34J 2O5DA 1TL3B 3GIMA 5HQLA 4FVCA 4JI8J 4PWDB 4DL3A 5HBMB 2A6MA 3PFOA 3D66A 1LFWA 3JTOA 3MM9A 5KT3A 3FCHA 3E2EA 2D3UA 2ZNYA 2D3O1 1BLUA 4KFBA 3T41A 2B9YA 5T7LA 2QL7B 3GPAA 3PXGa 1DQAA 3FNNA 3T9ZA 3KOAA 2IVMA 3PIOQ 3IS9A 3OTBA 2F65A 1X9MA 1V3ZA 2C2RA 1BQNB 5HMXA 5KFEA 3ZZRA 1B3TA 1KFDA 4BS2A 4UOFA 3M9MB 3Q8YA 3GFYA 2LQBA 2Y1IA 2ZHBA 3Q24A 3K5OA 2JEFA 1KQFB 3DOMA 4IRKA 1F9EB 3BSNA 4IFYB 4WE1A 3G8SA 1XIQA 1RTJB 1FE0A 2QLFB 4YB7A 4M63A 4LF6J 3KNGA 4DR7F 1HNZJ 1JLEB 1AZSB 3FEZA 2HS0A 4B3MJ 3BKFA 2E9ZA 4JOUA 1OY6A 4FNHA 4USKA 2QMWA 1VRTB 5E3PA 4DV2F 3KWMA 3F0NA 3CGIA 3GJQB 2V4JA 4LR8A 3MHYA 2HPUA 2MZRA 2BA9A 3G4SS 1EZZB 2J8AA 2CJKA 4Q2MA 5F8MA 3NXZA 1X4EA 4NMXA 2HQFA 3IM9A 1S0MA 2DR8A 2MKKA 3I9V9 2ZC3A 2E1AA 4ILLA 3OFGA 1CJVA 3OVBA 5B08A 1M5OC 1W7WA 2YWGA 3MMCA 4RU9A 1J2VA 3B82A 5DG8A 2JH3A 1UWBB 2ZH4A 4FKYA 4GVBA 1N33J 3H0PA 4P2MA 3TVYA 1FXRA 3JQMA 4QR2A 1FKPB 1KLMA 4ES2A 1GTEA 3UDLA 4YP3A 1L5UA 3U02A 3N01A 4B3SF 1PG5B 2UXDJ 4Q0BA 1X8DA 4OJ3A 2XMJA 1Y00A 2CADA 4S0MA 4N7TA 1R3NA 1TTHB 3M05A 3CSKA 2BR0A 4NOHA 3ISZA 4DZ6A 1HBOB 1JLQB 4LSLA 3OFFA 3MGJA 1DTTA 1HMVB 3GG1A 3IRXA 4WIQA 4F25A 4OJ1A 4WXWA 1VBZA 2BDPA 1IR2A 2DNPA 2XTJP 2XO7A 1Q4RA 2M4MA 2FVRA 5HN0A 3R7BB 5EGYA 2J0XA 3J80U 1D8ZA 3MPVA 1RCXB 3NL0A 4KJIA 2DNKA 1TKXA 2V67A 3OXGA 2I5JA 4ER8A 3I0SB 4F0KA 1H73A 4G1QB 3A8EA 1NXIA 2MLXA 2C3PA 4TQSA 2B51A 2RRAA 2XZWA 3D0GE 3CD6S 2MZQA 2JFKA 1WWHA 2BXJA 1NHUA 2A2DA 1RXOB 1HWJA 5CYMB 1U1MA 2HBYB 5DLFA 1QY7A 1HI1A 1RUSA 2XQCA 2XCPA 1SKWA 2MQQA 3V4IB 3ZTQA 1KLNA 4AL7A 1Q7LB 1SC4B 3D67A 3N5BA 4EWTA 3ISND 4ZN1A 1TP7A 4UY8T 3MR7A 1M5VC 3TA1A 2PEHA 1RHKB 1NJYA 4NLVA 5G0RA 5B0AA 3ZZOA 3O8WA 1SH3A 4LBHA 5KFNA 2ZHOA 5HMZA 3BQ0A 3M8QB 3DYAA 1HW9A 1R8CA 5AXNA 2YKNA 2JEIA 3ENAA 2YKPA 4KGXB 3M6VA 4ELUA 4ZCMA 4P7TA 4HLBA 2XLJA 2E7XA 4FKXA 5KT7A 5LSOA 3QRRA 2CJYB 2RHSB 3MM9B 4KSEB 1RWMB 2M3DA 1S57A 3UW1A 2XO6A 1HARA 3T5JA 4KFBB 2E9RX 3PFEA 2J7KA 2J0WA 2HVIA 2X1BA 4C2MA 1NK0A 1IKXA 2U2FA 3GFZA 2BKPA 4TU8A 1TL1A 3GU0A 1RABB 2DY9A 3JB9k 4GKKJ 1UZDA 3Q8UA 2H51B 5C25A 4HHHA 4NCGB 3RRGA 2FJBB 2P9GA 2C3UA 3DOMB 3KXDA 3KG1A 1RT5A 4ZPWR 4R0EA 3Q23A 4F2SA 5C2GA 2UUCF 3RB0A 2XB2D 2QV6A 5KFQA 4DQPA 3OTOJ 1X5PA 4ES1A 1T9UA 1VQ5S 2LXIA 3LH2S 1Y5IB 1VRQC 4F26A 2AX1A 4KGZB 2KFZA 2H5IB 5AE1A 1UEKA 2PA3A 2YVSA 1TMMA 3MM7A 3EICA 2W7AA 1FO1A 4N5SA 2D3OR 2FVSA 1K44A 3QIPB 2HFUA 2HK3A 4F0MA 3ZC4A 5KOXA 2NCKL 2K7JA 2ZZNA 1MROB 1CJVB 3DHWC 5L9NA 2B56A 3LWMA 2CAJA 2ZH5A 2XMVA 1GTHA 5LJ5Y 4CH0S 2LDIA 2W2MP 3W2VA 2ZOMA 3HVTA 4CLSA 2E1RA 5DZ6A 1H2TZ 5E41A 2UZAA 1ZA2B 3D9BA 3UFCX 3WZ0A 2XMAA 2HFOA 4JB8B 2PMWA 2JNJA 3R27A 5I42A 4M5GA 4F7VA 4JI1F 1KLMB 4EK2A 2EK1A 4L72B 4Q0BB 1GT8A 2PFDA 4DV7F 2H9ZA 2JC1A 4J9NA 3W5ZA 1FDDA 4I2QA 5ETSA 3Q8SB 2ROEA 1S9GB 4AXIA 1OYEA 4O3QA 2QYCA 4C6AA 1NK8A 1HQ2A 3DKDA 4XAKA 1KBRA 3PNIA 2KTQA 1ACMB 4LREA 3DM2A 3NWRA 4OYXA 3RB3A 3LANA 3DLEA 3HHNB 4X64F 2PO4A 3HLUA 4GC7A 5F0WA 1AUSL 4MYTA 1UWAA 4UUWA 1HNIB 3AXKA 4FN5A 1TKXB 1K1QA 2Z0GA 3UN5A 3DOKB 3BSAA 1MN7A 1UVLA 1GH8A 1L3UA 1U02A 3JSYA 1R0AA 2WONB 2VG6B 1TU0B 3MMBA 1C0UB 3IBWA 5DDQC 1YX2A 5BR8F 2DNQA 2PMHA 4ZP6A 1T3NA 3C15B 2LEBA 2QGFB 4KR0B 3E01B 2XMUA 5EX0A 1IXKA 2ZDPA 1H7XA 1NNDA 4X65F 3VAJA 2BBEA 2UXBJ 2R8KA 4DS5A 5A8WB 2GGPB 1RT3B 3PYDA 1SKSA 1WF1A 1SJQA 3R5CA 8ATCB 4RZRA 1S0NA 4OI0A 3K5PA 4B17A 4RW6A 3BGFA 1NO8A 2YPZA 2XG8A 3QT8A 1S6QB 3BPSP 2GJIA 4H54A 4G65A 1PO6A 3FQKA 3ZZZA 4HR2A 1N34F 2OIHA 2A10A 4DSKA 3T1YJ 1ZA1B 2LMIA 4LF7J 4JI8F 4WFBQ 2YKNB 3CIZA 1PYTA 2GC8A 3MCSA 3G82A 4WFNQ 1JWWA 3CCLS 3RJMB 2HQDA 2PI4A 1PCAA 4MIWA 5MAOA 2R2RA 2BJEA 2AKWB 1RBLA 4Q45A 5AXMA 2R2TA 1U0SA 3D5MA 2BUNA 2PSZA 3MTKA 1CULB 3GSIA 4WYLA 3GFHA 4YDXA 4A8SA 5K5MA 4MH8A 3JYTB 1NJWA 1N5YA 4HTIA 4IOAQ 5C25B 3OLAA 2A1BA 2EFQA 4LF6F 1E6VA 1EQMA 1S4EA 5RUBA 1HNZF 2W1BA 2V8DA 2LA6A 3D1HA 4B3MF 5HVFA 2QT7A 3VALA 3R2DJ 4Z2XA 2R8GA 4R5PA 2M0GB 3SQGA 1PBAA 2EW9A 3VVTA 1LW2B 5CYQA 4BWMA 3CO0P 4P71A 2RIJA 3H5UA 4LR7A 2DHHA 2DGTA 4M8LA 4USUA 2B8PA 4UF4A 2AEMA 2IYIA 3PHTA 3AJ2A 4DN9A 3UNGC 3D6MB 1XMQF 2EEYA 1BGXT 2J8SA 2IM2A 4WBFA 5KFXA 5ETLA 2BEFA 2Y9HA 3SCIE 4F4WA 2AGQA 2P8IA 3W2VB 1N33F 3OJSA 4HT7A 2V6AA 2HGNA 4FVMA 1SC1B 4I6AA 1NK6A 2BMBA 2Y0SD 5IQ6A 1KQSR 4AE5A 2MZTA 2WRMA 2ZHAA 2HMIA 2NUHA 1LWFB 5J1PA 1QJHA 2KN4A 1YLXA 3C66A 5I4MA 2UXDF 3JSRA 4C8NA 3OVSA 3R1HA 4FBTA 3OHAA 5CZVA 2B9XA 1KVKA 1TAUA 1LXJA 3DMJA 4TLQA 3DOLB 4I2QB 4X4UA 2EG2A 3V6JA 3WQPA 3P8BB 4NLUA 3NGDA 1WOOA 5ETNA 1NK9A 2GCFA 2ZM6J 4ZN3A 1LWEB 2B4VA 3LOUA 4OHVA 2FJDB 1EB0A 3TJ8A 1EQ0A 5ITHA 4QWDA 2GS8A 3DLEB 4DFKA 2ZH7A 4XTTA 2QL5B 1BUXA 3IAS9 5CCMA 2KG1A 3PM9A 3VWSA 1Q7YT 1RJJA 3AB4B 2YKMA 2L08A 1XNQF 5HI7A 2ZD1A 4DV3J 1JXVA 1IBLJ 3MM8A 1REVA 5SUHA 5IZHA 3KLHA 2OGUA 2RHQB 4LRFA 4KYZA 3HMJG 4PWUA 4ZITA 2OD6A 4OZ5A 2RRBA 1NRKA 2HIQA 4ZLNA 1OMSA 1RACB 1KQGB 2AZ3A 2RKIA 4CO5A 4C4WA 3CW2C 3KK3A 3T5LA 3NOCA 1Q82T 1KN6A 1X7VA 3P45B 2XULA 3J81j 1V3RA 1Z2LA 5D15A 3DRPB 2W8LA 2P2CB 1TR0A 1IN0A 2DR7A 1SH2A 4RL1A 4ID5B 2WW4A 3SV3A 3VGSA 1NBEB 3IAM9 2BJ9A 5L38A 3A3NB 3DRSA 5DDPC 4WK3A 3IN5A 4NA1A 2ZJQQ 1J5EJ 3KNAA 2DGSA 4Q5VA 1CQMA 5HQMA 2GAGC 4JV2A 3N4WA 1NCLA 5DETA 1WC3A 4IKAA 1NKEA 3PV8A 3R1LA 1B70B 3TX8A 4DR5J 1U8SA 2APOA 3DGPB 4BDPA 1HQEA 3MAHA 2RQCA 1K0TA 2BOPA 4OHXA 2ACMA 2E5LJ 1HYSA 2N82B 2PDAA 4K4WA 1WI8A 4GKKF 4C11B 1UFLA 2E7VA 3CMES 3W2WA 4X4SA 4NI2A 1U25A 2YQ0A 4RW8B 2CWKA 3D1OA 1IWGA 2KZZA 2FVQA 3KKFA 4JI5J 2UV8A 4PQAA 2WZ1A 3I96A 1S5ZA 1VDHA 1CVJA 3OTOF 3CCWA 3SCKE 2NUUG 3UCUP 3K5NA 1S1VA 3PX0A 3N6LA 5CYQB 1RBAA 3QO9A 4DCPB 5B0DA 2J7WA 3NNCA 1JLGA 1I6JA 3V81B 3MEGB 4O23A 2I0XA 3KDOA 2DHAA 2EFVA 5D4LA 3F44A 2HWHA 1BC6A 3RR7A 4MIBA 3GCXP 2ZWPA 2YNFB 1S97A 2QLBB 2IAJA 2B4UA 3FBFA 1VQKS 3QBCA 1FNMA 1FJGJ 2C42A 3NY0A 5L1IA 3CNQP 2Y0BB 4QOTA 2HAIA 4J9KA 1YG0A 1G1XA 4JI3J 2GVDB 2W7OA 5BYQA 3BH7B 4RKUC 3IBCB 4CLWA 1RTHB 3T5KA 4MAKA 1LKZA 2KRBA 3C16A 4OJGA 2OSQA 3LQVA 1C2PA 1M5SA 1KDNA 4ETZA 1GEHA 1HQUA 3GSDA 3GV5B 4YB6A 2HVZA 1TUVA 3TA0A 4N8NA 1OWXA 1S6PA 4RW7A 2HBQB 3L09A 2Z4PA 4NZ6A 5LJ3Y 5HJYA 1GX5A 2KXNB 3IR5B 2ZOGA 2KYZA 3ADAC 3B54A 3L7OA 1Q5YA 1YHQS 2IY5B 2C2ZB 3CULA 2IPOB 4YHHJ 2FLOA 5KT5A 1V5IB 3HHLA 2AJ4A 3ITHA 3H42A 2Y8WA 1BWEA 2D9PA 4PRFA 2R7VA 5F3TA 2NYIA 1HLWA 4K4VA 2CJQA 3K8VA 3Q8QB 4OI4A 4IOCQ 4TYBA 1ZAWA 4I69A 2WVFA 2W2PP 4EYIB 2UXBF 2OMLA 1BMQB 2O67A 1WHWA 1FWKA 4K8RA 1AT1B 1YRUA 2MJUA 5EUHA 2NSBA 4QR0A 3LW5C 2ZUAA 3UVJB 1RA6A 3NMAA 5IM0A 3NGSA 1KP6A 1HNXJ 3WDOA 4Q8EA 4USTA 4KH1B 3CTRA 1S72S 2VQFJ 4F4AA 3OL9A 1QAJA 1FKOA 3WC0A 1S1UA 4F67A 2FY8A 3T1YF 2YWWA 1Q8IA 4NLRA 4LF7F 4LF5J 3KMSA 1W26A 2HQCA 5KFSA 3PDNA 3CC4S 2OP5A 2UUTA 3LO3A 3QGPA 2HHPA 4I7FA 1KHWA 3H2LA 1QVFR 1V9OA 2KRRA 3QJJA 2DNRA 4W92B 1KC8T 4DUTA 2P6TA 4I6WA 2O66A 3AOAA 2R2SA 3HHDA 3DC2A 3VF0B 2YWFA 3RW6A 5J2NB 2UP1A 3DRRA 2CWXA 2AJ1A 1X31C 4JV0A 4P6QA 1UEVA 1RWNB 1PJ7A 3C6TA 2O01C 4CNZA 2EC2A 2A0FB 2HYIB 2HGMA 3G6VA 3PZPA 2N4CA 1VYAA 3UN2A 1J5OB 1M5KC 4D3HA 2AYMA 2B9WA 2IBOA 5DGAA 3RGIA 4K4XA 4OZ1A 3CDEA 3ILOA 1SIWB 3EVMA 3JXOA 4IDKA 4E2FB 3TARA 2F63A 1ZBTA 2KDOA 1XMOJ 5GAGU 4BC9A 1QE1B 4LFAF 1T7PA 3ZO7A 4PXBA 4ICLA 1G4CA 2UVVA 2K3KA 4PG4A 4WF9Q 1S1XA 1WC0A 4OIXA 3MAQA 3PRBA 1VQ7S 2BE9B 4ECVA 4Y2MA 1U0HB 2XNRA 2WVCA 1UETA 4MMOA 4JUZA 2HWIA 3EZUA 4PG8A 1KEKA 4ZLJA 1YVFA 3OHBA 3K5LA 4L76A 2OTJS 4H4OA 3LF0A 5A0YB 3WX4A 1RHQB 1PGZA 4B9SA 4PXDA 1AFJA 4WWSA 5ETOA 4DG1B 1ICEB 2ZBRA 4DR1J 1FE4A 4JI4J 2XWYA 2KH9A 2H4WB 1TFWA 3MTJA 1H7WA 2U1AA 1O5JA 1Y3JA 4J7CA 4MK9A 2H48B 2YKQA 3CCZA 3BEGB 5D8HB 4XDCA 4J9UE 3D6HB 3MFHA 4ZKAA 2JRSA 1LQ9A 5IV4A 1IKYA 4LRBA 4M95A 2V9KA 4B9NA 4IYQA 2ZM6F 2VODA 2XCAA 1VQNS 3NMRA 2IA6A 2MEWA 3GIIA 2CQCA 4OZJA 4F2RA 4JI2J 3TZYA 1GXTA 2GVZB 3QAUA 1JLFB 1UA1A 2XYHB 1ZAVA 2OPRA 1FNOA 2B8QA 2PE8A 3UNYA 4XIUA 4IOBA 3ZTSA 1IM6A 3CJSA 1U1RA 3HX9A 3R8YA 2Z56B 4DV3F 5KT4A 1L3KA 1WC5A 5CCLA 4RNOA 2C2KB 3ICLA 5F3ZA 1SKRA 4ZVRB 1ZYQA 3DXSX 1X9SA 3KK1B 2YPYA 5E0OA 2DGVA 4YR3A 3WBZA 1NMEB 1RAOA 4LVNP 5AJ3J 1DQ8A 2VBWA 2EPIA 4J9VA 3KJQB 2F4FA 2YTCA 3AJDA 2DHXA 3O44A 1WHXA 5FD1A 3G6ES 2ZBCA 3PCOB 3V2UC 1UEUA 3M8SA 2DT9A 1KTVA 2H3EB 1BHNA 2FJAB 2CZ4A 4B9UA 4M5KA 2DGXA 3JS9A 2P9CA 4KC5A 1HWKA 2BJ7A 2ZFHA 3I5AA 4QYZJ 2BANA 3NGUA 2C2DA 3CDUA 3LGMA 4LSNB 2L9DA 2WOMB 4P72A 1NSKL 3EGZA 1R89A 1FESA 2MKCA 1HHTP 4ZVTB 1FKOB 3LAKA 1TL7B 1JKHA 2YY3A 3HKZD 3RAMA 1S1UB 1KD1T 2DHSA 3P49B 4LMZA 2Q6BA 2FHJA 2G0JA 4KHRA 1J5EF 2VC1A 3M8ZA 3OXLA 2XSJB 1XR7A 1O6XA 2VH7A 3TOQA 3KK2A 1HPZA 5T14A 4DR5F 2F3JA 1Y7PA 3VVUA 2LVWA 5KFBA 4A8OA 2CDQA 2AZ1A 4V19X 1JNZB 2IJRA 2Z2YB 1X4HA 1UCNA 2DB1A 2RVJA 5L9XA 3IM8A 3NNAA 3A12A 2BE2A 1SJ1A 4XPCA 1D3WA 1SCJB 2E5LF 1LFPA 5B0EA 3T1HJ 7FDRA 1V3SA 4NXNF 1H3DA 3D1QA 3PY8A 1IKWA 4RNHA 2H5EA 4WU2A 3OXFA 3MR6A 2VA3A 1FNXH 3I4PA 1GXUA 4DV6J 1JNRB 5KFKA 2WCXA 2V8PA 3OR1B 2VD3A 4L3KA 3SI8A 3W9JA 2CNKB 3TW0A 1VRUA 2XYGB 2OMOA 4CLPA 2MZJA 2DY1A 4EFAC 3FZBA 2KU7A 2MGZB 3KLFB 1BQMA 1S6OA 2AQ4A 1KVIA 1VOMA 2W2OP 3PVXA 1URNA 3UDVA 2G4BA 4ZLPA 3KG0A 2IJNA 2RUSA 3MUVP 4KV8B 2WSFC 3ZZTA 2ZNZA 3A3PB 2RS8A 4ICLB 3A3OB 1TKTB 3HFZB 1OPZA 3EDQB 3CJ8A 4A8WA 3FC9A 2CNNB 4PUOA 1JLAB 4QIWD 2FVPA 4KTQA 1LWCA 4HACB 3HSGA 3QZ8A 5M2PA 3GYXB 1UFKA 3DLGA 1RSCA 2ADBA 4HT5A 4JI3F 3MCMA 3UI3A 4DSJA 4ZPTR 4B3OA 3HKWA 1G7CB 3VAHA 1H0HB 1AB8A 1U2CA 3R5DA 4FYVB 4ZP8A 1WG1A 2BE7D 5HJXA 2NZ4A 3QT7A 5J1EA 1CSJA 2CPYA 5E33A 4LFCJ 1T9YA 4O3PA 4DX8H 2Z30B 4O3NA 3PR5B 4QPTA 4O0IA 2BJ8A 3OW2R 4F4KA 2MPUA 1WDTA 4CTAA 4UOHA 2QA2A 5J2QA 3CUNA 4P2SA 3SV4A 5F8JA 3THPA 1GMUA 3CC2S 1FRHA 4UTGA 4QBUA 3TQEA 3OSNA 2DYAA 5E7OB 4OHYA 4PWWA 3BBFA 3TANA 4X4QA 3N0VA 2OPRB 3MEKA 2N3LA 1X9WA 2VU5A 2C3MA 3M6UA 5H1SV 2DKOB 1RK8A 3CEDA 2ZE2A 4YHHF 4BCAA 3DCAA 3G86A 3MFIA 1Y10A 2E5HA 3X3UA 3HFVA 2KM8B 2J9DE 4DFPA 4L74A 2CG8A 4DV0J 3NP5A 2V34A 4K4TA 2L9NA 1U45A 3MURP 3E3XA 2PFFB 4HVZA 2C2OB 3K17A 3AY0A 4ECXA 5DLGA 1UVIA 2FHJD 2LA4A 1KOOA 4F8RA 5JXSA 1CJUA 4RLEA 2LQ8A 3BB5A 4A8QA 1FRKA 2JDJA 1NH8A 2JC0A 1WF0A 4GO5X 3VGUA 3PX6A 5IV3A 3MEEA 3B4MA 5BYRA 3CJRA 4ZLLA 2IC3B 4NZ7A 4JI7J 2GIFA 3H5XA 2VQFF 4ZVHA 3HD1A 3VGVA 3TEHB 1WNEA 3I4HX 1NJZA 1C1BB 3DI6A 3CCMS 1G3OA 3IBFB 4DFJA 2J6TA 3J81Y 3KUGA 2RH3A 2W7PA 4Z7YA 1TFYA 4LF5F 1T8EA 4LUBA 4AT1B 3W63A 1KSPA 3AD7C 1TK8A 3C46A 2RQKA 3MD1A 2NXEA 3MDFA 4WFXA 3TZXA 4DV5J 1WC6A 3FBEA 3H5YA 4OYWA 1B0VA 3KK2B 3I5CA 5G4DA 1XQIA 1FWPA 1SB6A 3ONQA 1REGX 2WVDA 2FJXA 1EIYB 1AA1B 5IWAF 1E6YA 2YNIB 3ZZYA 2DNHA 3FSYA 2VC0A 2QC3A 3W64A 2BV3A 5KFOA 3TZZA 2VASA 1UFWA 1IKWB 5EWEA 3OUYB 2DNGA 3T9NA 1VGYA 2P5VA 1AUDA 1OO0B 1JIHA 5CXTA 1HNVB 2DGUA 2JLEA 4ID8A 1NB2A 1VRUB 3AA9A 1S9FA 3KMQA 2C1EB 4YEAA 3EWGA 5HQ8A 4F0HA 5CQGA 1XMOF 1JMTA 3H2UB 3VR1A 2DD8S 4BWJA 4X66F 4WK1A 3CCRS 1GMWD 2KT5A 1RTZA 1S1TA 1UKUA 1U2RA 1R6VA 4CLTA 2NPFA 1RAFB 2XHCA 4X4RA 2OFGX 2VFRA 1B99A 2G1DA 2KVIA 2CPJA 1AW0A 1LWCB 3K58A 5F8LA 5HANA 3CJKB 3TQ1A 1SV5B 5D0RA 1RLDA 2ZDOA 2E9TA 5KFZA 5E3CA 5ADZA 2V8VA 2GV1A 5GAEU 2L48A 3AXMA 5CA5A 3S01A 4KPYA 4DR2J 3ENVA 1YIJS 2QA4G 5KFFA 1HFEL 3LALA 4USIA 1FI4A 3G87A 5K8OA 1DTQB 4PZVA 4UW2A 4DR1F 5KG5A 4IR9A 4FF2A 3CWJA 4HDGA 5KFLA 1PIEA 4J9LA 1H2VZ 1RT1B 2PT0A 3TJ9A 3POTB 1TVRB 1LXNA 4CLKA 4QIEA 3MZIA 2BJ1A 4DPYA 2CVIA 2C28A 2LU1A 4PR6A 2UUAJ 4ECSA 4J9OA 2B5JA 4QIVA 2R8JA 4MIAA 3HK2A 1TL3A 3T3FA 1WSVA 2VICA 4PWDA 3CXCR 2VOOA 4CTAB 5HBMA 3VV2B 2QLXA 5D0GA 1CBKA 4V1Ak 2A3JA 3VAGA 1TV6B 5C42B 1TUWA 4JI2F 4C8KA 3TRGA 4ERDA 1U4BA 3OTCA 1N6QA 3TR5A 5IXUA 1UVJA 2KT3A 2BVZA 2DNZA 2FTRA 2VKRA 3I32A 2ZJPQ 2V8GA 2OEJA 2QA1A 1BY9A 2DJWA 2OH2A 4M5NA 1CC7A 4A8FA 1HBUB 1EKRA 3EXCX 4DSLA 3DFEA 4MKAA 3BGUA 3CD5A 3HVAA 1YGYA 1IKVA 4Y2AA 4IFYA 3HT0A 5AJ3F 3VGTA 1RTJA 4OI2A 4WIIA 1TAQA 3MUMP 1EJ7L 2KFNA 5U47A 4DPXA 4RUHA 1JLEA 1AZSA 2YWHA 1SL2A 3N6MA 3FUYA 2IM1A 2IJFA 2V2QA 1T3OA 1U1PA 2QN6B 2M8DB 3PYEA 3HP6A 1RKIA 3NBPB 2CQ3A 4CO3A 4W98A 4DF8A 2WW8A 4OX9J 3DLLQ 4WZQA 3G96A 4FF4A 2DEIA 5L8RC 5ETVA 1URRA 2RJZA 2ZBQA 4RUBA 2WAQD 4DR6J 3LP0B 4U7UD 3I55S 3CPWR 2Z2LA 4MFBB 1IM4A 2ZH8A 2OTLS 1S77D 2HNZB 1HI0P 3Q0AA 4DQSA 1MU2B 4EI2A 2FIUA 2KHCA 2J0SD 4MJKA 4U7UK 3JQJA 1M5PC 1KOHA 2LEAA 1WELA 1FKPA 5K20B 2DNMA 4K7QA 3GJSB 2WVBA 3PKMA 4J91A 1FFGB 5HROA 3I0RB 1VQOS 1I5OB 4RNNA 1EETA 1U6FA 3BPDA 3J7A1 1VLOA 4NLYA 2LEPA 4TKTA 1HBOA 3QRPA 1JLQA 2YH0A 4A8MP 3G71S 5HL7Q 4DV6F 1HMVA 2VA2A 3LWLA 1RGVA 4RPFA 3GILA 3RRKA 3VAKA 4ECRA 2EFPA 5K8MA 1VQ8S 2CFXA 2DR6A 1VMBA 2BX6A 2VFVA 3MI7X 1BQXA 1X4CA 4CT8A 4QIFA 1JLCB 4FF3A 3I0SA 1Q1KA 4G1QA 4LF8J 1RWPB 2QE5A 3MD3A 4IH7A 3QLHB 1KWMA 5CZXA 3R2CJ 1F2GA 3AAWB 4NE9C 3GQCA 2EKNA 4ALZA 3MEDB 5B0GA 1A0OB 1APSA 3RBXA 4DX7A 1WEXA 3CVKA 2VFTA 2QO3A 3VAFA 4P2FA 2R7RA 1PJ5A 1RAAB 1UAWA 3KDNA 2H1YA 1S76D 2J76E 1NUEA 2YQ3A 1RAJA 2F4VJ 4G1PA 4DUYJ 2G0CA 3V4IA 3TVZA 4RX6A 2O1PA 2OI2A 3M6XA 5J2MB 1DY3A 4LRAA 4J9QA 4NMLA 2RDJA 1UPMB 3KJVB 3BYPA 1LWXA 2WB1D 1N4LA 2LFVA 2MLZA 1U1NA 5BXIA 4LFCF 3Q8PB 4ED4A 4QYZK 2ADCA 2DIUA 3M8QA 2XMKA 2B5JB 1DURA 1RHUB 4L73A 1O8BA 4KBIA 1C0TB 1JB0C 3QYYA 5B09A 1S9EA 2IMWP 3AT1B 2J0QD 1SQFA 1P8GA 1M90T 2MSSA 1PSDA 4WP8A 2DVIA 2XS2A 1N6QB 2AHOB 3ILJA 4A46A 3M8PB 4K2XA 1YITS 4DMZA 3S8SA 3R9LA 4RO0A 3D3CJ 3CJ3A 3IXQA 2VG5B 1DLOB 2AJ0A 2HEKA 4NCGA 1EP4B 1IKVB 4M5IA 1F1BB 2XBPA 4Y3CA 3NS6A 2IFXA 3ZZUA 4G1IA 1S0OA 4KB7A 1N0VC 4H4MB 4BBYA 4RUAA 3WIVA 2EBEA 2OHDA 4ECUA 2HHXA 1HWLA 5K8NA 4CO2A 2HURA 1XWLA 3BN7A 2LECA 4JI7F 2AMCB 2CJBA 1TK0A 2BJ3A 3NCQA 3TZWA 2OO4A 2IRUA 3TNVA 1R27B 3FFIB 3QIPA 4BLGA 3FVYA 3CJ5A 1MROA 2AIRB 4OHWA 2YNGB 3J7ZT 5KFVA 2I2YA 2YKOA 1TL5A 2AT1B 4DV5F 3BBCA 3U7JA 3IG1B 3HVRA 4TU9A 2QMUB 2AU0A 4DHVA 4D3GA 4WCEQ 3TAMB 5HSPA 3N9UC 3AOBA 2BQ3A 1RHRB 4PXCA 5ETTA 3P4UB 1NDLA 2ALYB 4A4JA 4CLYA 4FYYB 2GZOA 3TUJC 3MR3A 4C8OA 3V6DB 3MCNA 2C2EA 5E3AA 4CLUA 5HROB 2MKIA 3I31A 2EI5A 1EETB 2HHQA 2CQBA 4C7QA 2RE1A 1NPRA 1S9GA 3H4DA 3QT5A 2HHHJ 3ZTPA 1K1SA 4WTOB 3QSIA 1HBMB 1YBUA 2HHUA 1SH0A 3M8WA 3U1MA 3GWCA 3VAMA 3S6EA 2W9CA 2FLLA 3OJUA 3ISNC 2GQCA 2CQHA 1Z4UA 2ATLA 3ETMA 1M1KT 1RTIA 2NXNA 4X4NA 1D9DA 1JK9B 1RU1A 3GMGA 1HNIA 3DLBA 1QUVA 2CPZA 1P6TA 4QPXA 4J9SA 1IWAA 2V2VA 1C1CB 4CZCA 5KFPA 4QWBA 2WTFA 3DOKA 2HRYA 2WONA 2VG6A 4P10A 4TY9A 4DL5A 1FXLA 1C0UA 1RYRA 3R7SB 3D6TB 2XYPB 3HHKA 2ZOFA 1JJ2R 2EBGA 1U7LA 3C15A 1N54B 3E01A 1AROP 1I51B 3C14B 3BZQA 4DPOA 3CJ2A 4ZHRB 3G2XA 5AT1B 4OZ2A 4MKVA 1TK5A 4DR2F 4IQMA 2IHR1 1S10A 5A8WA 2V94A 2GGPA 1BXNA 5IOLA 1DARA 1Z1ZA 1RT3A 1QLNA 4HYKA 1T9TA 2KI2A 4LRCA 3LPEA 2NLWA 3BS9A 4EYHB 2Q1LA 4XO0A 3WC2A 4OYAA 2H65B 3B8HA 1UW4A 2C2MB 3DLHA 1VIOA 1SJRA 3LP2B 3W65A 2UUAF 1S6QA 2L3MA 4LVOP 1SL0A 1NHVA 1QM9A 2FHMA 3HULA 2V50A 2V2KA 3QMQA 2NYHA 1WEZA 2R4FA 1S9EB 4C48A 1NKCA 4JYAF 3QJPA 3UCGA 4FS1A 3FKBA 2ALZA 1LOUA 2GNKA 1EARA 3AJ1A 5E3QA 3X1LB 2RDIA 5EHHA 3IWLA 4UOGA 2ZWOA 2D9OA 1SJ4P 1CULA 1F0XA 1CJTA 2ZEJA 1ULRA 3EGNA 4F3QA 1TL4A 2OKQA 2O3DA 2FJEB 4Y2KA 3TA2A 4TN2A 2R2UA 3HCXA 3K89A 3JYTA 3CCUS 3HD2A 4X62J 1N36J 3UE2A 2HNYB 4EO8A 1YBTA 3IMQJ 2EC0A 5JVHQ 3PJWA 2DH8A 4TXSA 4A8YA 1YJTA 5AXKA 1FRXA 1X4DA 4M5LA 1N0UA 4ZOSA 2G2YA 1LW2A 5GAGI 3VTIA 1DRZA 3NNHA 4LRDA 2HHSA 1N56A 2GHWA 3SSSA 2VKZG 2MKYA 4KPCA 3TUIC 4ILMA 1Q95G 2FLPA 4DR3J 5KFDA 1D1UA 3LP1A 3RRHA 4DJBA 3BSOA 3CC7S 1Y4ZB 1TKZB 2MXYA 1RWXB 3L3CA 3J7Z5 1FA0A 4M5HA 3MMAB 4LQ3A 2BKOA 3I5BA 1NU4A 4EEYA 2J9EA 2Z2MA 3DGVA 3SIPB 1UMJA 3NS7B 4WJBA 2OPSB 2JZ5A 1LWFA 4ZPDA 4OYZA 2UUWA 3SCJE 5C7PA 4Y65A 1N8RT 3ZNUA 4ZVPB 4O4RA 4P2XA 4OLPA 1IBMJ 3DOLA 2QFJA 4DN0A 4YFUA 2LDYA 2BRLA 3V4MA 4CYUB 3V6HA 2G2OA 3CDBA 4IG3B 1H74A 4IG0B 4CLLA 2VB6A 4Y00A 3SXLA 5A6WA 4ZVQB 2MHNA 3GG0A 1LWEA 1X4FA 2HQ3A 4I68A 4QQBA 2W9CB 3IR7B 2HS3A 2AEFA 4CO0A 5HK4A 3M2RA 5D6GA 4C8MA 3DN9A 2KT2A 2YWEA 2FPHX 1RTIB 5K14B 1QSLA 2ILYA 4CRJA 4ZJOA 4EBEA 3PW0A 4A47A 1NK7A 5A8RB 4LF8F 3CT9A 3GV8B 1VC6A 3IO1A 3GZ7A 4O44B 2GIQA 1Y3KA 1NH7A 2YWKA 1U1LA 2IIHA 4B08A 2DO4A 2HK2A 1JXEA 3O5TB 3TI0A 1I94J 4RJVA 4NYPA 2XEXA 2VFSA 4QU6A 1KTQA 4RW9A 1IJFB 2AF6A 1T02A 3RAXA 5C2CA 1HW8A 5F0UA 2F4VF 3CJ4A 4DUYF 4N41A 3O2IA 1RT2B 1H38A 4IH5A 2OUGA 1OSCA 1RWUA 2DH7A 3F56A 3DRPA 4TNOA 3PHEA 2OPQA 4K5RA 1S12A 1IR1A 5DRKA 4OLOA 3ILIA 5I3UA 3IC1A 4ED6A 1VCTA 3C8YA 1VS3A 4UY85 1YJ9S 5KTQA 4OI3A 3C2PA 4ID5A 1XNRJ 5KFJA 3OSPA 3W5XA 3EDRB 1VI7A 1MNEA 3OL7A 3GIRA 3RBEA 2M52A 3KLVA 5DQIA 4RNMA 4O3SA 5LMUJ 1QAXA 4OYIA 2N3OA 1DQ9A 5KG6A 2LP4A 1A6LA 2BM1A 5IFMA 2WSCC 3ZFVA 1ZTTA 4OHZA 3UO0A 3MR5A 4AQYJ 3CO9A 2WK4A 3DGPA 4N76A 2W25A 1SPBP 3M2UB 4K4YA 2VPWB 4KKOB 2G13A 4IUFA 1CJTB 1RT6A 2Z2ZA 3SFUA 1CS4B 3UR0A 4X4PA 4DSFA 1WHYA 2VZ9A 1HD1A 1OJ4A 2EFNA 3KLIB 3KJFB 4K4UA 2RDDA 2CDRB 3SSRA 4C11A 1RT7B 2VIHA 1FX2A 2LQ5A 4RBVA 2GMLA 2M88A 1YJUA 3M1VA 1SQEA 5HO4A 4IFVA 4F02A 2JEGA 4RW8A 3MPDA 4F4YA 2E44A 3R7NB 3CCVS 4ENOA 3P96A 3Q83A 3CF5Q 4Q8FA 5IC6B 3US5A 3QWUA 1UVKA 4I6YA 3D7SB 2IVFB 2FZCB 1FFWB 2BW2A 2PMZD 3EVWA 2R8IA 2KFYA 5JVGQ 4UQGA 3A8KA 2HKEA 2LU2A 4K2JA 4DXLA 3KLGB 5A8KB 4H4KA 5E3RA 1GX6A 3EGWB 3F41A 2W9BB 4P7VA 3V81A 2MY7A 3MEGA 1Q16B 4QWCA 3HVWA 2VL1A 4U67Q 3FZ2A 4DQIA 4DWIA 1UTAA 3PW7A 2W2QP 1IBCB 4Z7CA 1PKUA 1N5VA 4PPZA 3ZTOA 1CLFA 5GMKa 2YNFA 3LP1B 4Z37A 2ZC4A 3I82A 2MZSA 5EN1A 5AE3A 2R7UA 2GFFA 3U1NA 3A8JA 3NLCA 2MZ1A 5HP1A 2GVDA 1JQGA 1U24A 1FJEB 4P52A 6FDRA 2UV8G 3CDAA 2GHVC 1RTHA 4ECZA 4FXDA 1QUPA 4FNIA 3M8RA 4ZCKA 4USWA 4TYAA 4CH7A 3O3LA 3GR0A 4R8UB 5M2UA 3R5BA 2FDNA 2BABA 1YJRA 4Y28C 4P74A 2HHHF 4M5DB 2C2NA 5LL6d 4I67A 2F8EX 1CQNA 1S99A 3J7YU 1KQKA 2V9WA 5HVHA 1VFJA 4NASA 5KOWA 1TMJA 3IWXA 3T6JA 5ETKA 2BRKA 1AXQA 2CQPA 3U27A 3M2RB 3RU0A 2CZVC 3A1YG 2M5YA 3DXBA 3KYLA 2V4QA 4JI0J 2CJ9A 2MQOA 4EUVA 4B9MA 2AEJA 3UCZP 3TAQA 1HKAA 5FDLB 4DPUA 1FRMA 1YTYA 1L3VA 3W62A 3AFGA 1S48A 1RHJB 2VOPA 1MN9A 2K1RA 4I56A 4JI6J 2MQ8A 2W4CA 2V0NA 3HFKA 3QGGA 1K0VA 4RW9B 4EU0A 3IWNC 3TWZA 5LMNJ 3O6QA 9RUBA 2JVRA 5C24B 4FF1A 3BV8A 3SYZA 3QZ7A 3A13A 5D4OA 1YJ7A 3UVJA 3GFXA 1RTDB 4HH0A 5HMWA 1U6BA 5DM7Q 3MM5B 1RWVB 2OPQB 1QVGR 1S0VA 4WFZA 4NA3A 5KFCA 1DZ5A 7FD1A 4DSEA 3M2VB 4I2PB 3DU5A 5I3UB 4J37A 4A48A 5MLCV 1OY8A 2MKHA 1MLAA 3D6FB 3FBCA 4PQUB 2VONA 3QT6A 1VISA 3I56S 1R8PA 1UVMA 2F9DA 4MTPA 3HPOA 4A8XA 1SUQB 2LCWA 2GQQA 2FGOA 4OV1A 3CDWA 1P9YA 3J80Y 4F50A 4J90A 4Q2LA 1FVSA 3GJTB 2RT3A 1RZMA 4QJVA 2R7TA 3HZGA 1NJIT 4DR4J 1FD8A 2J6UA 1RDRA 5J2NA 2CPEA 2M2BA 4ZPAA 4ETXA 1RT6B 4PABA 2HZCA 3DHXA 5KFMA 2WVEA 3OL6A 1FXDA 2JSXA 3UD5A 3RBDA 4X62F 3M1VB 1M5HA 1J5OA 1N36F 3KLEA 4IFVB 3NCRA 2X1FA 1Y5NB 1UA0A 3J7AN 2D41A 1MWYA 5ETPA 2MJNA 2ASLA 1SQGA 1X0FA 3SZ2A 4KGMA 2EFOA 4HHUA 1Z2ZA 5AE2A 2CQ1A 1ROFA 1O51A 3D4JA 2PIIA 2HNDB 3EVOA 1QE1A 3AH6A 3MAAA 2F7VA 1N52B 2G2ZA 4TY8B 1SXLA 2V68A 3T5HA 3JAMY 1I3OB 4FXVA 4JV5J 1U0HA 4DR3F 4ZIWA 1FJ7A 4ZCIA 1XMQJ 1YJNS 4W90B 3DLKB 3EJMA 3BGOP 2E66A 4O3OA 2KJVA 5K8PA 5A0YA 4ZVUB 5GAEI 2I6WA 2AJ2A 5CH7B 2QFIA 2POKA 1YSJA 3DNCA 4DG1A 2HW3A 5HP1B 1FD2A 2GIRA 5D3GB 1XR6A 1CG2A 5H9EK 2BACA 1Y0HA 3OT9A 1KKHA 2DISA 2RRNA 1B4SA 1HHQA 1T9XA 3PYGA 1ZETA 3OTEA 1IBMF 2OJ3A 2XZDB 4K50A 1HBNB 3K5MA 4ZVFA 5CABA 1MG7A 3HO1A 3ENQA 3AB2B 5GADU 2XMTA 1T03B 2GVZA 4P9SA 2KJWA 2XHWA 1JLFA 3RAQA 1IQTA 1IR0A 2YH1A 5HVGA 1YI2S 3TYTA 2UUBJ 1VC5A 3VZIA 3BR8A 1LK7A 2QSWA 2ASYA 3FGVA 2QRRA 1K8AT 2CZ9A 3CJQA 2VDIA 2DNLA 1O0PA 3CB4A 1B0PA 2G1HA 1XNQJ 4UOCA 1D09B 1I94F 1KNZA 2WBRA 5T41A 3M30B 3KK1A 2K1RB 3ET6B 2YQ1A 1U47A 2RQMA 1PC5A 4YMEA 5D4NA 3KHGA 3W8GA 1RT4B 5EDWA 1X5SA 2B6AB 2PC6A 3QNWB 4XDDA 4USHA 4RW4B 3HSJA 2AYEA 2B0GA 4LF9J 1U2FA 2XZTB 4NLXA 1GFWB 4K4ZA 1PJ6A 4ECWA 2IRYA 2CIMA 4TVAB 3BGRB 2JEJA 4LSNA 2WOMA 3CCES 3JAMU 3NS5A 4CH1A 2AP6A 4X4VA 3JSMB 1XNRF 1TL7A 3GP9A 2D74B 2K2PA 3TAPA 1PILA 3DDKA 4ZA1A 2HZAA 2DCUB 2R42A 2HSEB 4UQTA 3QQCD 5C5JA 2KO1A 2FC8A 5LMUF 3R97A 2KXHA 2OPPA 2XSJA 4TQRA 3OQ2A 3PYFA 1YKWA 1N32J 4I1TA 1GNKA 3OPKA 4LF2A 1XTZA 2AD9A 3PR4A 4AQYF 5H9FK 4JBCA 3M7VA 2MQLA 1T9WA 5T7LB 1R0CB 4CQ1A 3CCQS 4LIRA 4DDFA 4N56A 3V6KA 1X0PA 1T9VA 3BM7A 1W25A 2CA9A 3IS9B 1XK8A 3QRQA 4WTYA 3H90A 1ZTWA 2KKHA 4F36A 1NAQA 1M1HA 3KG4A 4CDIA 3D3BJ 2YNHA 3G8TA 1FDAA 1OSDA 2K3IA 2QLWA 2R7OA 3OR1A 5ETQA 2RB7A 4O0NA 3KLEB 4M94A 1NPKA 2J9DA 4WE1B 5E2QA 4URQU 4HL9A 1T11A 2MGZA 3KLFA 4IRDA 4CM0A 1ZPVA 3QFWA 4AL6A 2VUGA 2IDEA 4NLSA 2ZBPA 3LUYA 3HHLC 4KV8A 1U48A 4ED1A 3I87A 3QAEA 3MOZA 3MAAB 3GYGA 1XN9A 2V4JB 4L6V3 4F4XA 1TKTA 2GO9A 5DGBA 1SL1A 1QDUB 5DJBA 3SCLE 1JLAA 2RQ4A 4OL8A 4O3RA 4HACA 4C3LA 4U95A 1JX4A 4RU2A 4C3MA 3LPYA 2K06A 2JLFA 2X7IA 3IGNA 3MMCB 4R0JA 1IBKJ 2FUG9 3NAIA 2QLJB 1LNQA 3N28A 3RW7A 4RUCA 1NZ8A 2AYBA 4GVBB 9ATCB 4AFFA 3W8PA 2ABYA 1F9HA 2Z58B 5CAAA 4R25A 1OPIA 2HFZA 4Q44A 1WACA 3PO4A 5L1JA 4L75A 2FHKA 1N88A 1IUJA 3CJ0A 3U1LA 2W24A 3F73A 1HR0J 2JOQA 2UVUA 3MUTP 1VIXA 3RYLA 3Q2SC 4CI0B 3OVAA 2ZH3A 4HTJA 2GA7A 1SJ3P 1HNWJ 2AJQA 1D9AA 4C3KA 3DRYA 4URSA 2KYXA 4LSLB 1NJXA 1ZM3A 1DTTB 3IRXB 1CPZA 4DL2A 4ED5A 1WOPA 4MKYA 2AX0A 2F8MA 1XBWA 2FJVA 5HLFA 1WKJA 2MKSA 4NXMJ 2MLYA 4ES3A 2JVOA 4FYWB 1L3TA 4JI0F 2FD2A 3VQTA 2ZKTA 1YRTA 1EHWA 2I5JB 4LFBJ 2BW7A 2JWNA 1VQSA 1MSWD 3FCVA 2DCLA 4NEYA 3BDPA 2MYFA 4B3TJ 4PG5A 1IBLF 2VG7A 1VQMS 2ACYA 2PA8D 3Q2TC 1JLBA 4OYOA 1X5OA 4JI6F 1VR6A 4FZVA 5KFUA 4URGA 1A9NB 2MQNA 4DQRA 2DXEA 5LMNF 1FX4A 1VHFA 1SJFA 4UT4A 1ZZNA 2BYCA 4XK8C 4C98A 1D0EA 1PAEX 5E5NA 2CQIA 2CQ0A 4CIOA 4AXJA 2IC3A 2J7UA 3AODA 5LOQA 4DU7A 2EVZA 1RQ0A 3RR8A 3BH6B 2DHGA 1RWKB 2IDLA 1WHVA 2I38A 1NZAA 3HSZA 1C1BA 2NZCA 5KFYA 3SBMA 5G0RB 3OFEA 4FS2A 5F8IA 2HLUA 3BKUA 1X4AA 3DYAB 3H98A 4LT6A 4YB5A 3QSYB 5ETMA 1FTCA 1G2EA 3AD9C 2VPXB 4NLOA 2OPPB 4AL5A 4ZDNA 2CPDA 4KHPJ 2KZMA 1UJ6A 1RHMB 3THTA 2HQIA 4DSIA 5L1LA 1B7YB 3EE3A 5F8GA 2L9WA 1L3SA 1K47A 1HWIA 3IA0A 5M2RA 3HJFA 1OQ6A 1HL6A 2YNIA 4V19J 4DR4F 3KFWX 5KFIA 2MQMA 1BWVA 2E5GA 2RS2A 3T1AA 4FPRA 3A4TA 3MECA 1IKXB 4QW8A 3QPIA 1DJ0A 4XPEA 1GAOA 4YR0A 1TL1B 3OUYA 4KHMA 2DH9A 1G6BA 2IRXA 4P75A 2YNHB 4TLRA 3KUHA 1HNVA 5LM7E 4HH1A 3MF5A 4JI5F 4DPWA 4CCHA 1K9MT 4MYUA 1RT5B 2HVDA 3BF4A 4ZP9A
chains in the Genus database with same CATH topology
1NSQA 4W98A 3BBCA 3FBEA 2CWKA 1EHWA 1HLWA 3WX8A 3EVOA 3B6BA 3NGRA 4DUTA 3GPAA 1F6TA 4EK2A 3FCVA 3NGUA 4F36A 1XQIA 1B99A 1LWXA 1BUXA 1W7WA 3FKBA 4WBFA 3ELHA 1NSKL 1U8WA 3L7UA 4ANEA 5CABA 4KPCA 3Q86A 3MPDA 2BEFA 1MN9A 1NDLA 2DXDA 3Q89A 3VGSA 1S5ZA 5BXIA 2B8QA 3ENAA 4ENOA 1ZS6A 3EE3A 3Q83A 5CAAA 1KDNA 1S59A 4UOGA 4FKYA 1BE4A 3ZTSA 4O0NA 3G2XA 1NPKA 4C6AA 4FKXA 3DKDA 2BX6A 4UOFA 3Q8YA 4DI6A 2ZUAA 1NDCA 3GP9A 1F3FA 3EVWA 1NHKL 4UOHA 3VGUA 1JXVA 1NLKL 1NSPA 2DXEA 3EJMA 4CP5A 3NGSA 5IOLA 3BBBA 3EICA 1NDKA 1S57A 3FCWA 1XIQA 1NCLA 2HURA 1NDPA 3Q8VA 1VYAA 1K44A 3NGTA 3ZTPA 2DYAA 2NCKL 3FC9A 3PRVA 3VVUA 4F4AA 1PAEX 2AZ1A 3VGVA 3ZTRA 3BBFA 4ANDA 2DXFA 1UCNA 3DDIA 1NB2A 3VGTA 3B54A 4S0MA 4HR2A 3EMTA 3ETMA 3EM1A 4ANCA 2HVEA 4DZ6A 3BH6B 3FBFA 2AZ3A 1LEOA 1HIYA 3ZTQA 1WKLA 5C7PA 2VU5A 3EVMA 1MN7A 1WKJA 3VVTA 1BHNA 2DY9A 1PKUA 3ZTOA 1NUEA 1B4SA 3JS9A 1HHQA 3PJ9A 3Q8UA 2HVDA 3BH7B 3FBCA 2B8PA 3FBBA 1WKKA 3R9LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NSQ A;  4W98 A;  3BBC A;  3FBE A;  2CWK A;  1EHW A;  1HLW A;  3WX8 A;  3EVO A;  3B6B A;  3NGR A;  4DUT A;  3GPA A;  1F6T A;  4EK2 A;  3FCV A;  3NGU A;  4F36 A;  1XQI A;  1B99 A;  1LWX A;  1BUX A;  1W7W A;  3FKB A;  4WBF A;  3ELH A;  1NSK L;  1U8W A;  3L7U A;  4ANE A;  5CAB A;  4KPC A;  3Q86 A;  3MPD A;  2BEF A;  1MN9 A;  1NDL A;  2DXD A;  3Q89 A;  3VGS A;  1S5Z A;  5BXI A;  2B8Q A;  3ENA A;  4ENO A;  1ZS6 A;  3EE3 A;  3Q83 A;  5CAA A;  1KDN A;  1S59 A;  4UOG A;  4FKY A;  1BE4 A;  3ZTS A;  4O0N A;  3G2X A;  1NPK A;  4C6A A;  4FKX A;  3DKD A;  2BX6 A;  4UOF A;  3Q8Y A;  4DI6 A;  2ZUA A;  1NDC A;  3GP9 A;  1F3F A;  3EVW A;  1NHK L;  4UOH A;  3VGU A;  1JXV A;  1NLK L;  1NSP A;  2DXE A;  3EJM A;  4CP5 A;  3NGS A;  5IOL A;  3BBB A;  3EIC A;  1NDK A;  1S57 A;  3FCW A;  1XIQ A;  1NCL A;  2HUR A;  1NDP A;  3Q8V A;  1VYA A;  1K44 A;  3NGT A;  3ZTP A;  2DYA A;  2NCK L;  3FC9 A;  3PRV A;  3VVU A;  4F4A A;  1PAE X;  2AZ1 A;  3VGV A;  3ZTR A;  3BBF A;  4AND A;  2DXF A;  1UCN A;  3DDI A;  1NB2 A;  3VGT A;  3B54 A;  4S0M A;  4HR2 A;  3EMT A;  3ETM A;  3EM1 A;  4ANC A;  2HVE A;  4DZ6 A;  3BH6 B;  3FBF A;  2AZ3 A;  1LEO A;  1HIY A;  3ZTQ A;  1WKL A;  5C7P A;  2VU5 A;  3EVM A;  1MN7 A;  1WKJ A;  3VVT A;  1BHN A;  2DY9 A;  1PKU A;  3ZTO A;  1NUE A;  1B4S A;  3JS9 A;  1HHQ A;  3PJ9 A;  3Q8U A;  2HVD A;  3BH7 B;  3FBC A;  2B8P A;  3FBB A;  1WKK A;  3R9L A; 
#chains in the Genus database with same CATH topology
 4EZ6 A;  3KTQ A;  2V5H G;  2MHE A;  3B6B A;  3NGR A;  2KM8 C;  4OYB A;  2R7X A;  1RAD B;  3K7R A;  3BO2 A;  2VPZ B;  4NLG A;  3IR6 B;  4LFA J;  3L7U A;  2DEJ A;  3I9Z A;  1SIZ A;  4J9M A;  4DL7 A;  2HHT A;  4WXO A;  3I6P A;  2I1R A;  2B9E A;  1RAE B;  4DS4 A;  4JV5 F;  4WKR A;  4Y6I A;  3MM7 B;  3LGN A;  2Y3Y A;  1N5S A;  1WDD A;  5DS7 A;  5KT2 A;  3CJK A;  1MWZ A;  3D54 A;  5L46 A;  1SV5 A;  2EFG A;  1XEZ A;  4CO1 A;  3C6U A;  2K8G A;  2ROG A;  5J1N A;  4DV1 J;  3UDE A;  1FJG F;  2HBZ B;  2F8H A;  3OTD A;  1Q53 A;  4KE5 A;  5KG3 A;  2DIT A;  3HVT B;  2R8H A;  3ZTR A;  1YZ7 A;  2MY8 A;  1DTQ A;  4ELV A;  2GMH A;  5KG7 A;  1RCO B;  2KHD A;  1FF2 A;  4MK7 A;  2EXU A;  4NA2 A;  1GMW A;  1S6U A;  5IT0 A;  2C3O A;  4QCL A;  2XWX A;  2I8E A;  1RT1 A;  5SZT A;  3ZZP A;  5I42 B;  3POT A;  2VQE J;  4JV1 A;  1H72 C;  1TVR A;  2CYY A;  1XER A;  5EWG A;  2A2C A;  1WG4 A;  4BC7 A;  4NYZ A;  1EX8 A;  1U1O A;  2RD5 C;  1DBD A;  3K59 A;  3W3S A;  3BGL A;  5DG9 A;  1CJK A;  2JX2 A;  4KGK A;  1SBR A;  4CWB A;  5DQG A;  4F04 B;  4LJM A;  3DM2 B;  1TV6 A;  5C42 A;  2ZBI A;  1QD1 A;  2CJA A;  3PEJ A;  4AUK A;  2M8H A;  4ECY A;  1Q86 T;  3PX4 A;  6FD1 A;  3UD3 P;  5HLF B;  3BR9 A;  3P5B P;  1AFI A;  2UUB F;  1UW9 A;  3M32 A;  1JJ4 A;  5GAH U;  3IFE A;  2DRD A;  3BO4 A;  5CD4 H;  4EBD A;  1JJC B;  1IJE B;  3EYZ A;  2GHP A;  4ZIV A;  1YDL A;  1HBU A;  5I3Q A;  5LXR A;  4ZPC A;  1U26 A;  2ZZM A;  1R0A B;  1WEY A;  4YN3 B;  3MMB B;  5CD4 A;  1PC4 A;  2VG7 B;  1U09 A;  1JLB B;  3NOG A;  1ZOT A;  2Q43 A;  2YX4 A;  2XS7 A;  3NRB A;  3TO8 A;  1TUG B;  4LSZ B;  4HEA 9;  2DGQ A;  3MWB A;  2KL8 A;  4DV4 J;  1PYS B;  4LF9 F;  3CCJ S;  4OYP A;  3BYR A;  3NBP A;  3RBZ A;  1P1T A;  5HAT A;  2C22 A;  1HNX F;  4B02 A;  4IO9 Q;  1NSA A;  1SKU B;  5KT6 A;  3OFH A;  2UU9 J;  4USM A;  2WHO A;  4RW6 B;  2H5J B;  5A2Q Y;  3LP0 A;  3K57 A;  3H2V E;  4WFY A;  1TQL A;  4MFB A;  3PW5 A;  4WU3 A;  5CYJ A;  1FCA A;  1RLC L;  4F3M A;  2HNZ A;  4NLW A;  4RR5 A;  3PRV A;  5HMY A;  4NCB A;  4HKQ A;  3ZNJ 1;  1MU2 A;  3FK4 A;  3M8Y A;  3G82 B;  2AGP A;  3LA0 A;  2HG4 A;  1N32 F;  3CCT A;  2MDA A;  1H2U X;  2RF2 A;  3HHE A;  4USJ C;  1ZAX A;  4NZ0 A;  4KQZ A;  1F3V A;  3AOC A;  1ZM2 A;  4GC6 A;  4QR1 A;  2V69 A;  3Q8R B;  2PI5 A;  3S1T A;  4ED7 A;  1FFS B;  5KFG A;  3I0R A;  2HFS A;  1NSQ A;  1VQ9 S;  5KFW A;  4NWB A;  1Q78 A;  3MEC B;  4Y2C A;  2KG0 A;  4NXN J;  1XJW B;  1VQL S;  4ZS6 A;  4AD6 A;  3ELH A;  5KAK A;  3DLJ A;  4PPD A;  2HGL A;  5EX3 A;  2RML A;  4KAI A;  1B64 A;  3TP2 A;  5F8N A;  1OIA A;  3TX0 A;  4PYD A;  4PCQ A;  4FBU A;  1N5Y B;  4E98 A;  5KG4 A;  5B0B A;  2HQG A;  3RTV A;  2W2N P;  4M5M A;  4MT1 A;  2DPI A;  1SI9 A;  3NGK A;  4FYD A;  1E6V B;  1RKJ A;  3ENW A;  2AYG A;  1YJW S;  5D78 A;  5L39 A;  2UXC J;  1NM2 A;  4GVL A;  2RUG A;  1NEE A;  1JLC A;  4R5P B;  5A76 A;  1F60 B;  3SQG B;  2VDH A;  4QIG A;  4E8U A;  4PG7 A;  2R7S A;  2IA0 A;  3QLH A;  1HWU A;  2QIF A;  1Q8B A;  3D28 A;  1W2B R;  3QAT A;  4WZM A;  1RAH B;  1H6K X;  3MED A;  4ED8 A;  1OYD A;  1F5B A;  5F8H A;  1UP1 A;  4ZPB A;  5F41 A;  4LBP A;  3GJR B;  3MR2 A;  1LV5 A;  1IBK F;  1RP5 A;  1FDB A;  3C6U B;  3H5S A;  3W5Y A;  1I1G A;  2JL9 A;  1X4G A;  2HS4 A;  1N5T A;  1S7I A;  4QYR A;  7AT1 B;  3W61 A;  2MMY A;  4OZL A;  3L9Z A;  4ILR A;  3QGH A;  4ZP7 A;  2H4Y B;  3VZH A;  3E51 A;  5J2M A;  1S79 A;  1YRX A;  4JI4 F;  1S7H A;  3KJV A;  1Q8L A;  2I9S A;  2LKZ A;  4DFM A;  4TU7 A;  4LIW A;  1B7F A;  2HMI B;  3HZE A;  1UPP A;  2WB4 A;  4MK8 A;  1FKA F;  3OLB A;  4WP9 A;  5A2Q U;  3ULH A;  3BBB A;  1HR0 F;  1PBU A;  2Y8Y A;  3R6G B;  4HI2 A;  3H20 A;  1VJW A;  3E8O A;  3J81 U;  1QSY A;  1HNW F;  3DMJ B;  1VQ6 S;  1FJC A;  1RA7 A;  4GRS A;  1CJK B;  1C0T A;  4OZN A;  1VBX A;  4YY3 J;  2DR9 A;  1KS2 A;  4LR9 A;  5K9F A;  2G9O A;  1VK3 A;  3K0J A;  3P6Y C;  3MPU B;  4NXM F;  2WSE C;  3IP0 A;  2GW8 A;  2LYV A;  1YJV A;  3UD4 P;  2RSQ A;  2MST A;  1P27 B;  1WTB A;  3M32 B;  1Y11 A;  1FVQ A;  3M8P A;  1FER A;  4I4B A;  2HHW A;  1R6Y A;  4CLZ A;  2CQD A;  4LFB F;  2NS1 B;  3IGV A;  3M6W A;  5LT5 A;  2XY7 A;  4B3T F;  2QG9 B;  2YKM B;  1LK5 A;  4K5S A;  1YZ6 A;  3MM6 A;  1V5V A;  3Q86 A;  1S49 A;  2ZD1 B;  2VG5 A;  3MM8 B;  1REV B;  1DLO A;  2PN6 A;  3FEX B;  3KLH B;  4F4Z A;  1EP4 A;  3RB4 A;  4LBI A;  3BO3 A;  4OFZ A;  2DRB A;  1KRP A;  2J5A A;  4H4M A;  5IC4 B;  4FPI A;  5JUM A;  3EX7 B;  2C3Y A;  3NGT A;  1IVZ A;  3PEH A;  2RKI B;  1KFS A;  1U1K A;  3L7P A;  3JTP A;  3KK3 B;  3BKT A;  4NYO A;  2E5I A;  4GKJ J;  3WHI A;  3EM1 A;  2CNL B;  3BN4 A;  5IT9 Y;  3EZ5 A;  5KFT A;  2XS5 A;  2B4O A;  4EZ9 A;  3KUE A;  4NLD A;  3W9H A;  3FFI A;  1PYO B;  4OI1 A;  3PJ9 A;  4DZD A;  4C9D A;  2ZH1 A;  3FBB A;  2PEB A;  1N5Q A;  2XSF A;  2ILZ A;  4ED2 A;  2E1M C;  2YNG A;  1Q79 A;  4OX6 A;  1TKD A;  3MOJ B;  1C4A A;  4CT9 A;  2XY5 A;  3DRS B;  4PAA A;  3G6Y A;  4CM2 A;  4KHP F;  5JMN A;  5GVQ A;  3IG1 A;  4GMK A;  1GK8 A;  1S59 A;  1XC9 A;  1FRJ A;  1T95 A;  3OL8 A;  3TAM A;  3ZXW A;  4RNF A;  1X5T A;  2RF2 B;  2PGC A;  1VBY A;  4DI6 A;  1WG5 A;  5IWA J;  2CQG A;  2LQ9 A;  2W4P A;  3V6D A;  1HQE B;  2CXE A;  3FCW A;  3D0I E;  2XLI A;  8RUC A;  3T1H F;  1C4C A;  2GMJ A;  1D8Y A;  3GR1 A;  3IRW P;  4DUZ J;  1HYS B;  2OFH X;  2IVY A;  1J27 A;  3SQO P;  2NXJ A;  4IQX A;  3K8W A;  2D1C A;  1HBM A;  4OI6 A;  2DGW A;  3W2W B;  2CPX A;  4NI2 B;  2HBR B;  3GON A;  4UUX A;  3PW4 A;  4UZC A;  2P6S A;  3J7Y I;  2GX8 A;  2V8H A;  4DCJ B;  1FTR A;  1RAG B;  2IBK A;  3R3T A;  2DNY A;  4ED0 A;  3PIP Q;  4ZVG A;  3MPY A;  1FEE A;  3VAI A;  1C1C A;  4DEZ A;  5KFH A;  2UVW A;  2DBB A;  4X66 J;  2HVH A;  1S1V B;  3BRE A;  2DTJ A;  4QWA A;  3QWP A;  3QO9 B;  1JXL A;  4PXE A;  1WD6 A;  1JLG B;  3QJL A;  1Y5L B;  4U8V A;  2JJ4 D;  3RZA A;  1UVN A;  2ZUG A;  3C14 A;  2QSF A;  1RWO B;  1YWX A;  3FEY B;  1CEZ A;  4ZHR A;  2FJW A;  1NDP A;  4DV1 F;  4B3R J;  2QZ8 A;  5KG2 A;  2IAJ B;  2R9L A;  3PJX A;  3EZO A;  5KFR A;  2VBZ A;  4QWE A;  4K4S A;  1YK9 A;  2SXL A;  4WKY A;  2FZK B;  3GYN A;  1DHM A;  2R3V A;  2ZKU A;  3H59 A;  3LAM A;  4C8Z A;  4LF4 J;  1HIY A;  2CPH A;  4OMF G;  4USV A;  2XGP A;  2CQ4 A;  3AA8 A;  2VQE F;  5IT9 U;  2J9C A;  3EPI A;  2HRU A;  3LP2 A;  2MQP A;  2VHG A;  3PRD A;  3C16 B;  3R5J B;  2CQ2 A;  1LW0 A;  1NB7 A;  4FYX B;  5EWF A;  1RB0 A;  2B3T B;  1F6T A;  3HHL D;  4NL5 A;  1HQU B;  3GTY X;  3CD7 A;  1S6P B;  1YQH A;  4RW7 B;  1ELO A;  2W4D A;  2FQQ B;  5KG1 A;  2LQJ A;  2VFU A;  3EPG A;  2IM0 A;  4DQQ A;  3MPW A;  3H4B A;  4G6V B;  2DGO A;  2FY1 A;  1UJ5 A;  3H25 A;  1F3F A;  1R43 A;  4N47 A;  4BHQ A;  3SDE A;  2XI2 A;  3OBI A;  2EK6 A;  3QFH A;  4LF1 A;  2N7C A;  4OQJ A;  4YUD A;  2G0I A;  1QAY A;  5LXY A;  3RUB L;  3MM6 B;  3HHL B;  3ITH B;  3P3D A;  2KB2 A;  2V2Z A;  5BJR A;  1VHI A;  4U8Y A;  4DV0 F;  3FJ2 A;  1VQP S;  4B9V A;  3HF5 A;  4DF4 A;  3R6L B;  3P5T L;  1R8A A;  2HNY A;  4ATN A;  2VJU A;  4DL6 A;  2X1A A;  2AJF E;  1TEL A;  2RAQ A;  3N5F A;  1WUU A;  4YR2 A;  3FMW A;  4DV4 F;  2ATC B;  3KHR A;  3CCS S;  2DR5 A;  2D7S A;  2GO8 A;  4OV6 A;  4ANE A;  2MKJ A;  4OYM A;  5IM0 B;  5B0C A;  4DX6 A;  2UU9 F;  3NG8 A;  3CJT A;  4E0D A;  4K0K J;  1NPP A;  4IR1 A;  3ETO A;  1NLK L;  4U6P A;  1UL3 A;  1P9Q C;  1QAI A;  2V63 A;  3RG6 A;  2XY6 A;  1P1L A;  3T6B A;  5DM6 Q;  1TKZ A;  3G6X A;  4ZVO B;  3NAH A;  4X4O A;  3NWG A;  3NEK A;  4ZJL A;  5IT4 A;  3MMA A;  2Y1R I;  1WOR A;  2ZJR Q;  2BZ2 A;  4U7C A;  4I7F B;  1LEO A;  2CNO B;  2XNQ A;  1FWL A;  4PKD B;  3V5R A;  4PG6 A;  5KFA A;  2CPF A;  2Q79 A;  2OPS A;  4U9R A;  2ZIT A;  3D2W A;  3B4D A;  1U1Q A;  2XMM A;  3OV7 A;  2W8K A;  4KY3 A;  1UZH A;  4DX5 A;  2HZV A;  2NR0 A;  1B0T A;  4DOZ A;  4A8K A;  1QTM A;  2E7W A;  4QW9 A;  1NK5 A;  3DRR B;  5D77 A;  4U96 A;  3VCD A;  4C0B A;  1K73 T;  4CYU A;  2DXD A;  3C6T B;  4IG3 A;  4IG0 A;  2DO0 A;  1KR4 A;  2DRA A;  1BD6 A;  4ZCL A;  3PG9 A;  2MB0 B;  1CC8 A;  5GAD I;  2NSC A;  4P73 A;  2CG4 A;  1DFD A;  5K14 A;  1NDK A;  2UXC F;  3HDS A;  1RWW B;  2BQU A;  2JFD A;  1Q0N A;  2P9E A;  2BQR A;  2J6S A;  5A8R A;  1FT8 A;  1MML A;  4IDK B;  4DPT A;  3PAC A;  4O44 A;  4DLG A;  1M0S A;  3GLJ A;  3TVK A;  1R8B A;  1S1X B;  1YBA A;  6AT1 B;  4CLF A;  1AYE A;  3C3L A;  1S1W A;  4HDH A;  4M5J A;  3PKY A;  3THV A;  2HHV A;  2FYX A;  5DQH A;  1FRI A;  4ZVS B;  3R5A A;  2Q6C A;  5GME A;  3M9O B;  3G9C A;  3ILL A;  4H4O B;  4MKB A;  1RT2 A;  4EBC A;  4EO6 A;  5IS2 A;  1FHT A;  5H9E J;  4Y34 A;  5A6P A;  1R8H A;  2LXF A;  4DLE A;  3RB6 A;  1X60 A;  1NDC A;  4DU8 A;  2VF3 A;  4Y0F A;  1VJQ A;  2COL A;  2FLN A;  1HA1 A;  3SMZ A;  2ASJ A;  2B43 A;  2XC9 A;  3UPF A;  3GIK A;  1LW0 B;  4ED3 A;  1TZ0 A;  2D69 A;  2H54 B;  4RBT A;  4QU7 A;  4L3N A;  2BJD A;  2GJF A;  2R7W A;  5BYS A;  4O4G A;  1IKY B;  4YY3 F;  2OEL A;  3GB0 A;  4EGL A;  2CVE A;  4IO1 A;  4KIA A;  4PEO A;  1ITP A;  4F3O A;  3TEG A;  1UJ4 A;  2YXL A;  3SFG A;  2ROP A;  2HFV A;  4WFA Q;  2L41 A;  3M2U A;  3WX8 A;  2BOA A;  2HAF A;  3CE8 A;  4KKO A;  3SDE B;  3LTO A;  2NPI A;  2VPY B;  1WTF A;  1CS4 A;  4ECT A;  4NRT A;  1OY9 A;  3KLI A;  2PD1 A;  2B7C B;  1RT7 A;  3KHL A;  3CIM A;  5F9N A;  1JJH A;  2KXF A;  2OSR A;  3JSB A;  5FII A;  4IRC A;  4CNY A;  3H8Y A;  1OQ3 A;  4DL4 A;  2Y1J A;  1NSP A;  3FRY A;  1VK8 A;  4UZB A;  3OR2 A;  1HI8 A;  4WP3 A;  3EGV A;  3L4B C;  1FEH A;  5L1K A;  2NRE A;  4GO7 X;  4X84 A;  4DBQ A;  2FB0 A;  4DR7 J;  8AT1 B;  2RIL A;  3DRX A;  4ZK7 M;  2IYG A;  1SC3 B;  2X3G A;  2DIV A;  1F5C A;  4GKJ F;  3GCW P;  2QJ3 A;  1H98 A;  2FGC A;  4NRU A;  3KLG A;  5A8K A;  4KO0 A;  2HLT A;  1T0T V;  1VC0 A;  2ZVS A;  2YX1 A;  4DV2 J;  1WKL A;  1FDN A;  4OX9 F;  2Q3P A;  2W9B A;  3T19 A;  2BAN B;  1ZZF A;  4DR6 F;  1R31 A;  4FDF A;  1F9F A;  2JLG A;  2E1C A;  4RWW A;  1JKH B;  3EUN A;  2GJ2 A;  2F9J A;  3EXY A;  3UWT A;  1U8W A;  4AYB D;  4EMD A;  5H9F J;  1U6Z A;  4WPA A;  2IM3 A;  1HPZ B;  5DDO C;  2GAH C;  2LLZ A;  3G8Q A;  1MMD A;  4CP5 A;  1RAI B;  4J9P A;  3GV7 B;  2VJV A;  2AW0 A;  4B3S J;  2CJX B;  1WC4 A;  4ZVE A;  2NXC A;  2HWT A;  4R8U A;  2BE2 B;  1N48 A;  5FJ4 A;  3KJN B;  4ZPV R;  4DUZ F;  4I64 A;  4Q7A A;  2XMW A;  2RNE A;  4ANC A;  4M5D A;  4NLP A;  1RE1 B;  1MWQ A;  3FSX A;  1T05 A;  3TUP A;  1MW7 A;  2OEM A;  4DCO B;  4KT0 C;  3MCO A;  2A18 A;  1WKK A;  2HIY A;  3LGH A;  5J2P A;  4OX7 A;  4ECQ A;  1WI6 A;  2QX0 A;  3D0H E;  3M4X A;  4LQ9 A;  3VHQ A;  3HM9 A;  2M7S A;  2R7Q A;  2XLK A;  1BQM B;  1F5A A;  4X4T A;  2FC9 A;  2OAU A;  3B78 A;  5FDL A;  5FLX Y;  1ZS6 A;  3QID A;  2CKW A;  3NKY A;  3BJY A;  1VLY A;  2D3Z A;  1FK9 A;  2Q66 A;  4PUO B;  2FZG B;  4HI1 A;  3GIJ A;  4NPO A;  4J9R A;  5DDR C;  1S1W B;  4NX9 A;  1D9F A;  3OD2 A;  4C0H A;  4B9L A;  4B3R F;  4YS2 A;  3SEO A;  2QTW A;  1ZM4 A;  1KON A;  2V4R A;  2EG1 A;  1W2I A;  1HHS A;  2W9A A;  4ZMM A;  3DLG B;  5C24 A;  5DZ7 A;  2YBV A;  3AHP A;  3R5G A;  2AGO A;  3UQS A;  1RTD A;  3N79 A;  4LF4 F;  2HRT A;  3BQ2 A;  1V6H A;  4B3O B;  4W4M A;  3MM5 A;  4HHJ A;  2N7Y A;  2VBY A;  1F2H A;  3M2V A;  4I2P A;  4YDD B;  4KGV B;  3AQP A;  4ITS A;  2B4P A;  5J1E B;  4OZ3 A;  5LSR A;  3DDN A;  4FP9 A;  2RU3 A;  4PQU A;  4DL0 C;  2E29 A;  3H7H B;  2CUY A;  5J2Q B;  1SVD A;  4O4G B;  4C8Y A;  1VBK A;  3O1L A;  3DU6 A;  5ETR A;  5KG0 A;  1QSS A;  1R0B G;  1SUQ A;  4IH6 A;  2XM3 A;  4JYA J;  3FRZ A;  2EWH A;  2M70 A;  2QL9 B;  4OX8 A;  2OD4 A;  3FQL A;  5DO2 A;  1PAU B;  4QZV B;  2ASD A;  2ZVI A;  4C8L A;  3K2Y A;  2UVR A;  1R7I A;  3UR3 C;  4KRW A;  4ZJQ A;  3VQS A;  3BDE A;  3FMB A;  3CD0 A;  2DXF A;  2ZE2 B;  1RBO B;  1BQN A;  2VV5 A;  2AV5 A;  2XGQ A;  2HVE A;  2QA4 S;  1ZPW X;  4JP8 A;  4M1K A;  2Z57 B;  2ZH9 A;  3WIU A;  4N8O A;  3UN3 A;  5I3P A;  4J5O A;  1WC1 A;  1SC6 A;  4K59 A;  3OR2 B;  1Y9O A;  2IMO A;  2LXU A;  2F40 A;  3C19 A;  3AD8 C;  1CJU B;  2UUC J;  5D0E A;  4Y2I A;  4C97 A;  5D4P A;  1VRT A;  3ZZ0 A;  4CO4 A;  2HND A;  3BQ1 A;  2K7K A;  4WYW A;  3PTW A;  3Q22 A;  3MEE B;  5DG7 A;  1WSR A;  1EKS A;  1MMN A;  2YKA A;  4KO0 B;  1NKB A;  4TY8 A;  5JJB A;  1VQY A;  5FLX U;  1EAY C;  2ZH6 A;  2Z8Q A;  1NHK L;  4K0K F;  1QTN B;  1RI7 A;  2MTL A;  4RBU A;  4I0W A;  1WJ9 A;  5LSL A;  2QMX A;  4NLT A;  2CPI A;  1IQZ A;  3DI6 B;  5F9L A;  3Q8V A;  1Q8K A;  2N4D A;  1ZH5 A;  3DLK A;  3L95 X;  3UDC A;  3D68 A;  1UWB A;  1XMB A;  1Q81 T;  1DAX A;  2NXU A;  3EMT A;  4PYA A;  2F5G A;  3AQO A;  3S7R A;  4RWX A;  2WBM A;  4FXW A;  3N6N A;  1ZM9 A;  3JQK A;  2BM0 A;  4YOE A;  1U49 A;  4N77 A;  5D3G A;  1VQ4 S;  5THW A;  2B7B B;  1E6Y B;  4JI1 J;  3PW2 A;  2X1G A;  1M1G A;  5D0H A;  1A7G E;  4DV7 J;  5B7W A;  1RYS A;  1HBN A;  2DNO A;  2OLW A;  1OS5 A;  3HJV A;  5IQQ A;  1T94 A;  2QYG A;  4NCA A;  2E1P A;  2KVQ E;  4Q43 A;  3HXM A;  1T05 B;  1Q5V A;  2AWZ A;  2EKY A;  2VBX A;  3BSC A;  1T03 A;  2DK2 A;  4OJH A;  3GE9 A;  2CRL A;  1S4F A;  4X64 J;  2DPJ A;  2F1F A;  3FDS A;  3H40 A;  2JHE A;  3W66 A;  2Y1L B;  5J2P B;  2ERR A;  4KH0 B;  3FSI A;  4B9T A;  3W60 A;  5GAH I;  3DDI A;  3SSQ A;  2E5J A;  1X4B A;  1HD0 A;  1NK4 A;  2YX7 A;  1KVJ A;  2FHO B;  3JTN A;  3MXH P;  1WOS A;  1S1T B;  4X2B A;  3NCP A;  2HFN A;  1RIS A;  4ELT A;  2QEX S;  3TJA A;  2NQP A;  2FVC A;  5B0F A;  5BR8 J;  4YB1 P;  3PO5 A;  3M30 A;  1FK9 B;  1FRL A;  3M9N B;  3ET6 A;  2RU9 A;  1RU2 A;  2A6O A;  3HSD A;  4NEZ A;  3CMA S;  5CYM A;  1RT4 A;  2XI3 A;  4YQW A;  5HAO A;  2ZZT A;  3TUZ C;  1GXL A;  2GQ2 A;  4G3I A;  2W01 A;  1WF2 A;  1XR5 A;  2B6A A;  4X65 J;  3HT3 A;  4RW4 A;  1GQE A;  3Q89 A;  3W7B A;  2DNN A;  4H4K C;  4OZ0 A;  5GMD A;  2M9K A;  1BE4 A;  3W9I A;  5AXL A;  1GMV A;  3CMQ A;  2X51 A;  5CHC B;  3KHH A;  3BGR A;  1KHV A;  2BKN A;  3W1Y C;  3A8I A;  2X3D A;  3QGI A;  4C0O C;  3JSM A;  4AND A;  3HI9 A;  3MMJ A;  2ZH2 A;  2OEK A;  4NLQ A;  1N34 J;  2O5D A;  1TL3 B;  3GIM A;  5HQL A;  4FVC A;  4JI8 J;  4PWD B;  4DL3 A;  5HBM B;  2A6M A;  3PFO A;  3D66 A;  1LFW A;  3JTO A;  3MM9 A;  5KT3 A;  3FCH A;  3E2E A;  2D3U A;  2ZNY A;  2D3O 1;  1BLU A;  4KFB A;  3T41 A;  2B9Y A;  5T7L A;  2QL7 B;  3GPA A;  3PXG a;  1DQA A;  3FNN A;  3T9Z A;  3KOA A;  2IVM A;  3PIO Q;  3IS9 A;  3OTB A;  2F65 A;  1X9M A;  1V3Z A;  2C2R A;  1BQN B;  5HMX A;  5KFE A;  3ZZR A;  1B3T A;  1KFD A;  4BS2 A;  4UOF A;  3M9M B;  3Q8Y A;  3GFY A;  2LQB A;  2Y1I A;  2ZHB A;  3Q24 A;  3K5O A;  2JEF A;  1KQF B;  3DOM A;  4IRK A;  1F9E B;  3BSN A;  4IFY B;  4WE1 A;  3G8S A;  1XIQ A;  1RTJ B;  1FE0 A;  2QLF B;  4YB7 A;  4M63 A;  4LF6 J;  3KNG A;  4DR7 F;  1HNZ J;  1JLE B;  1AZS B;  3FEZ A;  2HS0 A;  4B3M J;  3BKF A;  2E9Z A;  4JOU A;  1OY6 A;  4FNH A;  4USK A;  2QMW A;  1VRT B;  5E3P A;  4DV2 F;  3KWM A;  3F0N A;  3CGI A;  3GJQ B;  2V4J A;  4LR8 A;  3MHY A;  2HPU A;  2MZR A;  2BA9 A;  3G4S S;  1EZZ B;  2J8A A;  2CJK A;  4Q2M A;  5F8M A;  3NXZ A;  1X4E A;  4NMX A;  2HQF A;  3IM9 A;  1S0M A;  2DR8 A;  2MKK A;  3I9V 9;  2ZC3 A;  2E1A A;  4ILL A;  3OFG A;  1CJV A;  3OVB A;  5B08 A;  1M5O C;  1W7W A;  2YWG A;  3MMC A;  4RU9 A;  1J2V A;  3B82 A;  5DG8 A;  2JH3 A;  1UWB B;  2ZH4 A;  4FKY A;  4GVB A;  1N33 J;  3H0P A;  4P2M A;  3TVY A;  1FXR A;  3JQM A;  4QR2 A;  1FKP B;  1KLM A;  4ES2 A;  1GTE A;  3UDL A;  4YP3 A;  1L5U A;  3U02 A;  3N01 A;  4B3S F;  1PG5 B;  2UXD J;  4Q0B A;  1X8D A;  4OJ3 A;  2XMJ A;  1Y00 A;  2CAD A;  4S0M A;  4N7T A;  1R3N A;  1TTH B;  3M05 A;  3CSK A;  2BR0 A;  4NOH A;  3ISZ A;  4DZ6 A;  1HBO B;  1JLQ B;  4LSL A;  3OFF A;  3MGJ A;  1DTT A;  1HMV B;  3GG1 A;  3IRX A;  4WIQ A;  4F25 A;  4OJ1 A;  4WXW A;  1VBZ A;  2BDP A;  1IR2 A;  2DNP A;  2XTJ P;  2XO7 A;  1Q4R A;  2M4M A;  2FVR A;  5HN0 A;  3R7B B;  5EGY A;  2J0X A;  3J80 U;  1D8Z A;  3MPV A;  1RCX B;  3NL0 A;  4KJI A;  2DNK A;  1TKX A;  2V67 A;  3OXG A;  2I5J A;  4ER8 A;  3I0S B;  4F0K A;  1H73 A;  4G1Q B;  3A8E A;  1NXI A;  2MLX A;  2C3P A;  4TQS A;  2B51 A;  2RRA A;  2XZW A;  3D0G E;  3CD6 S;  2MZQ A;  2JFK A;  1WWH A;  2BXJ A;  1NHU A;  2A2D A;  1RXO B;  1HWJ A;  5CYM B;  1U1M A;  2HBY B;  5DLF A;  1QY7 A;  1HI1 A;  1RUS A;  2XQC A;  2XCP A;  1SKW A;  2MQQ A;  3V4I B;  3ZTQ A;  1KLN A;  4AL7 A;  1Q7L B;  1SC4 B;  3D67 A;  3N5B A;  4EWT A;  3ISN D;  4ZN1 A;  1TP7 A;  4UY8 T;  3MR7 A;  1M5V C;  3TA1 A;  2PEH A;  1RHK B;  1NJY A;  4NLV A;  5G0R A;  5B0A A;  3ZZO A;  3O8W A;  1SH3 A;  4LBH A;  5KFN A;  2ZHO A;  5HMZ A;  3BQ0 A;  3M8Q B;  3DYA A;  1HW9 A;  1R8C A;  5AXN A;  2YKN A;  2JEI A;  3ENA A;  2YKP A;  4KGX B;  3M6V A;  4ELU A;  4ZCM A;  4P7T A;  4HLB A;  2XLJ A;  2E7X A;  4FKX A;  5KT7 A;  5LSO A;  3QRR A;  2CJY B;  2RHS B;  3MM9 B;  4KSE B;  1RWM B;  2M3D A;  1S57 A;  3UW1 A;  2XO6 A;  1HAR A;  3T5J A;  4KFB B;  2E9R X;  3PFE A;  2J7K A;  2J0W A;  2HVI A;  2X1B A;  4C2M A;  1NK0 A;  1IKX A;  2U2F A;  3GFZ A;  2BKP A;  4TU8 A;  1TL1 A;  3GU0 A;  1RAB B;  2DY9 A;  3JB9 k;  4GKK J;  1UZD A;  3Q8U A;  2H51 B;  5C25 A;  4HHH A;  4NCG B;  3RRG A;  2FJB B;  2P9G A;  2C3U A;  3DOM B;  3KXD A;  3KG1 A;  1RT5 A;  4ZPW R;  4R0E A;  3Q23 A;  4F2S A;  5C2G A;  2UUC F;  3RB0 A;  2XB2 D;  2QV6 A;  5KFQ A;  4DQP A;  3OTO J;  1X5P A;  4ES1 A;  1T9U A;  1VQ5 S;  2LXI A;  3LH2 S;  1Y5I B;  1VRQ C;  4F26 A;  2AX1 A;  4KGZ B;  2KFZ A;  2H5I B;  5AE1 A;  1UEK A;  2PA3 A;  2YVS A;  1TMM A;  3MM7 A;  3EIC A;  2W7A A;  1FO1 A;  4N5S A;  2D3O R;  2FVS A;  1K44 A;  3QIP B;  2HFU A;  2HK3 A;  4F0M A;  3ZC4 A;  5KOX A;  2NCK L;  2K7J A;  2ZZN A;  1MRO B;  1CJV B;  3DHW C;  5L9N A;  2B56 A;  3LWM A;  2CAJ A;  2ZH5 A;  2XMV A;  1GTH A;  5LJ5 Y;  4CH0 S;  2LDI A;  2W2M P;  3W2V A;  2ZOM A;  3HVT A;  4CLS A;  2E1R A;  5DZ6 A;  1H2T Z;  5E41 A;  2UZA A;  1ZA2 B;  3D9B A;  3UFC X;  3WZ0 A;  2XMA A;  2HFO A;  4JB8 B;  2PMW A;  2JNJ A;  3R27 A;  5I42 A;  4M5G A;  4F7V A;  4JI1 F;  1KLM B;  4EK2 A;  2EK1 A;  4L72 B;  4Q0B B;  1GT8 A;  2PFD A;  4DV7 F;  2H9Z A;  2JC1 A;  4J9N A;  3W5Z A;  1FDD A;  4I2Q A;  5ETS A;  3Q8S B;  2ROE A;  1S9G B;  4AXI A;  1OYE A;  4O3Q A;  2QYC A;  4C6A A;  1NK8 A;  1HQ2 A;  3DKD A;  4XAK A;  1KBR A;  3PNI A;  2KTQ A;  1ACM B;  4LRE A;  3DM2 A;  3NWR A;  4OYX A;  3RB3 A;  3LAN A;  3DLE A;  3HHN B;  4X64 F;  2PO4 A;  3HLU A;  4GC7 A;  5F0W A;  1AUS L;  4MYT A;  1UWA A;  4UUW A;  1HNI B;  3AXK A;  4FN5 A;  1TKX B;  1K1Q A;  2Z0G A;  3UN5 A;  3DOK B;  3BSA A;  1MN7 A;  1UVL A;  1GH8 A;  1L3U A;  1U02 A;  3JSY A;  1R0A A;  2WON B;  2VG6 B;  1TU0 B;  3MMB A;  1C0U B;  3IBW A;  5DDQ C;  1YX2 A;  5BR8 F;  2DNQ A;  2PMH A;  4ZP6 A;  1T3N A;  3C15 B;  2LEB A;  2QGF B;  4KR0 B;  3E01 B;  2XMU A;  5EX0 A;  1IXK A;  2ZDP A;  1H7X A;  1NND A;  4X65 F;  3VAJ A;  2BBE A;  2UXB J;  2R8K A;  4DS5 A;  5A8W B;  2GGP B;  1RT3 B;  3PYD A;  1SKS A;  1WF1 A;  1SJQ A;  3R5C A;  8ATC B;  4RZR A;  1S0N A;  4OI0 A;  3K5P A;  4B17 A;  4RW6 A;  3BGF A;  1NO8 A;  2YPZ A;  2XG8 A;  3QT8 A;  1S6Q B;  3BPS P;  2GJI A;  4H54 A;  4G65 A;  1PO6 A;  3FQK A;  3ZZZ A;  4HR2 A;  1N34 F;  2OIH A;  2A10 A;  4DSK A;  3T1Y J;  1ZA1 B;  2LMI A;  4LF7 J;  4JI8 F;  4WFB Q;  2YKN B;  3CIZ A;  1PYT A;  2GC8 A;  3MCS A;  3G82 A;  4WFN Q;  1JWW A;  3CCL S;  3RJM B;  2HQD A;  2PI4 A;  1PCA A;  4MIW A;  5MAO A;  2R2R A;  2BJE A;  2AKW B;  1RBL A;  4Q45 A;  5AXM A;  2R2T A;  1U0S A;  3D5M A;  2BUN A;  2PSZ A;  3MTK A;  1CUL B;  3GSI A;  4WYL A;  3GFH A;  4YDX A;  4A8S A;  5K5M A;  4MH8 A;  3JYT B;  1NJW A;  1N5Y A;  4HTI A;  4IOA Q;  5C25 B;  3OLA A;  2A1B A;  2EFQ A;  4LF6 F;  1E6V A;  1EQM A;  1S4E A;  5RUB A;  1HNZ F;  2W1B A;  2V8D A;  2LA6 A;  3D1H A;  4B3M F;  5HVF A;  2QT7 A;  3VAL A;  3R2D J;  4Z2X A;  2R8G A;  4R5P A;  2M0G B;  3SQG A;  1PBA A;  2EW9 A;  3VVT A;  1LW2 B;  5CYQ A;  4BWM A;  3CO0 P;  4P71 A;  2RIJ A;  3H5U A;  4LR7 A;  2DHH A;  2DGT A;  4M8L A;  4USU A;  2B8P A;  4UF4 A;  2AEM A;  2IYI A;  3PHT A;  3AJ2 A;  4DN9 A;  3UNG C;  3D6M B;  1XMQ F;  2EEY A;  1BGX T;  2J8S A;  2IM2 A;  4WBF A;  5KFX A;  5ETL A;  2BEF A;  2Y9H A;  3SCI E;  4F4W A;  2AGQ A;  2P8I A;  3W2V B;  1N33 F;  3OJS A;  4HT7 A;  2V6A A;  2HGN A;  4FVM A;  1SC1 B;  4I6A A;  1NK6 A;  2BMB A;  2Y0S D;  5IQ6 A;  1KQS R;  4AE5 A;  2MZT A;  2WRM A;  2ZHA A;  2HMI A;  2NUH A;  1LWF B;  5J1P A;  1QJH A;  2KN4 A;  1YLX A;  3C66 A;  5I4M A;  2UXD F;  3JSR A;  4C8N A;  3OVS A;  3R1H A;  4FBT A;  3OHA A;  5CZV A;  2B9X A;  1KVK A;  1TAU A;  1LXJ A;  3DMJ A;  4TLQ A;  3DOL B;  4I2Q B;  4X4U A;  2EG2 A;  3V6J A;  3WQP A;  3P8B B;  4NLU A;  3NGD A;  1WOO A;  5ETN A;  1NK9 A;  2GCF A;  2ZM6 J;  4ZN3 A;  1LWE B;  2B4V A;  3LOU A;  4OHV A;  2FJD B;  1EB0 A;  3TJ8 A;  1EQ0 A;  5ITH A;  4QWD A;  2GS8 A;  3DLE B;  4DFK A;  2ZH7 A;  4XTT A;  2QL5 B;  1BUX A;  3IAS 9;  5CCM A;  2KG1 A;  3PM9 A;  3VWS A;  1Q7Y T;  1RJJ A;  3AB4 B;  2YKM A;  2L08 A;  1XNQ F;  5HI7 A;  2ZD1 A;  4DV3 J;  1JXV A;  1IBL J;  3MM8 A;  1REV A;  5SUH A;  5IZH A;  3KLH A;  2OGU A;  2RHQ B;  4LRF A;  4KYZ A;  3HMJ G;  4PWU A;  4ZIT A;  2OD6 A;  4OZ5 A;  2RRB A;  1NRK A;  2HIQ A;  4ZLN A;  1OMS A;  1RAC B;  1KQG B;  2AZ3 A;  2RKI A;  4CO5 A;  4C4W A;  3CW2 C;  3KK3 A;  3T5L A;  3NOC A;  1Q82 T;  1KN6 A;  1X7V A;  3P45 B;  2XUL A;  3J81 j;  1V3R A;  1Z2L A;  5D15 A;  3DRP B;  2W8L A;  2P2C B;  1TR0 A;  1IN0 A;  2DR7 A;  1SH2 A;  4RL1 A;  4ID5 B;  2WW4 A;  3SV3 A;  3VGS A;  1NBE B;  3IAM 9;  2BJ9 A;  5L38 A;  3A3N B;  3DRS A;  5DDP C;  4WK3 A;  3IN5 A;  4NA1 A;  2ZJQ Q;  1J5E J;  3KNA A;  2DGS A;  4Q5V A;  1CQM A;  5HQM A;  2GAG C;  4JV2 A;  3N4W A;  1NCL A;  5DET A;  1WC3 A;  4IKA A;  1NKE A;  3PV8 A;  3R1L A;  1B70 B;  3TX8 A;  4DR5 J;  1U8S A;  2APO A;  3DGP B;  4BDP A;  1HQE A;  3MAH A;  2RQC A;  1K0T A;  2BOP A;  4OHX A;  2ACM A;  2E5L J;  1HYS A;  2N82 B;  2PDA A;  4K4W A;  1WI8 A;  4GKK F;  4C11 B;  1UFL A;  2E7V A;  3CME S;  3W2W A;  4X4S A;  4NI2 A;  1U25 A;  2YQ0 A;  4RW8 B;  2CWK A;  3D1O A;  1IWG A;  2KZZ A;  2FVQ A;  3KKF A;  4JI5 J;  2UV8 A;  4PQA A;  2WZ1 A;  3I96 A;  1S5Z A;  1VDH A;  1CVJ A;  3OTO F;  3CCW A;  3SCK E;  2NUU G;  3UCU P;  3K5N A;  1S1V A;  3PX0 A;  3N6L A;  5CYQ B;  1RBA A;  3QO9 A;  4DCP B;  5B0D A;  2J7W A;  3NNC A;  1JLG A;  1I6J A;  3V81 B;  3MEG B;  4O23 A;  2I0X A;  3KDO A;  2DHA A;  2EFV A;  5D4L A;  3F44 A;  2HWH A;  1BC6 A;  3RR7 A;  4MIB A;  3GCX P;  2ZWP A;  2YNF B;  1S97 A;  2QLB B;  2IAJ A;  2B4U A;  3FBF A;  1VQK S;  3QBC A;  1FNM A;  1FJG J;  2C42 A;  3NY0 A;  5L1I A;  3CNQ P;  2Y0B B;  4QOT A;  2HAI A;  4J9K A;  1YG0 A;  1G1X A;  4JI3 J;  2GVD B;  2W7O A;  5BYQ A;  3BH7 B;  4RKU C;  3IBC B;  4CLW A;  1RTH B;  3T5K A;  4MAK A;  1LKZ A;  2KRB A;  3C16 A;  4OJG A;  2OSQ A;  3LQV A;  1C2P A;  1M5S A;  1KDN A;  4ETZ A;  1GEH A;  1HQU A;  3GSD A;  3GV5 B;  4YB6 A;  2HVZ A;  1TUV A;  3TA0 A;  4N8N A;  1OWX A;  1S6P A;  4RW7 A;  2HBQ B;  3L09 A;  2Z4P A;  4NZ6 A;  5LJ3 Y;  5HJY A;  1GX5 A;  2KXN B;  3IR5 B;  2ZOG A;  2KYZ A;  3ADA C;  3B54 A;  3L7O A;  1Q5Y A;  1YHQ S;  2IY5 B;  2C2Z B;  3CUL A;  2IPO B;  4YHH J;  2FLO A;  5KT5 A;  1V5I B;  3HHL A;  2AJ4 A;  3ITH A;  3H42 A;  2Y8W A;  1BWE A;  2D9P A;  4PRF A;  2R7V A;  5F3T A;  2NYI A;  1HLW A;  4K4V A;  2CJQ A;  3K8V A;  3Q8Q B;  4OI4 A;  4IOC Q;  4TYB A;  1ZAW A;  4I69 A;  2WVF A;  2W2P P;  4EYI B;  2UXB F;  2OML A;  1BMQ B;  2O67 A;  1WHW A;  1FWK A;  4K8R A;  1AT1 B;  1YRU A;  2MJU A;  5EUH A;  2NSB A;  4QR0 A;  3LW5 C;  2ZUA A;  3UVJ B;  1RA6 A;  3NMA A;  5IM0 A;  3NGS A;  1KP6 A;  1HNX J;  3WDO A;  4Q8E A;  4UST A;  4KH1 B;  3CTR A;  1S72 S;  2VQF J;  4F4A A;  3OL9 A;  1QAJ A;  1FKO A;  3WC0 A;  1S1U A;  4F67 A;  2FY8 A;  3T1Y F;  2YWW A;  1Q8I A;  4NLR A;  4LF7 F;  4LF5 J;  3KMS A;  1W26 A;  2HQC A;  5KFS A;  3PDN A;  3CC4 S;  2OP5 A;  2UUT A;  3LO3 A;  3QGP A;  2HHP A;  4I7F A;  1KHW A;  3H2L A;  1QVF R;  1V9O A;  2KRR A;  3QJJ A;  2DNR A;  4W92 B;  1KC8 T;  4DUT A;  2P6T A;  4I6W A;  2O66 A;  3AOA A;  2R2S A;  3HHD A;  3DC2 A;  3VF0 B;  2YWF A;  3RW6 A;  5J2N B;  2UP1 A;  3DRR A;  2CWX A;  2AJ1 A;  1X31 C;  4JV0 A;  4P6Q A;  1UEV A;  1RWN B;  1PJ7 A;  3C6T A;  2O01 C;  4CNZ A;  2EC2 A;  2A0F B;  2HYI B;  2HGM A;  3G6V A;  3PZP A;  2N4C A;  1VYA A;  3UN2 A;  1J5O B;  1M5K C;  4D3H A;  2AYM A;  2B9W A;  2IBO A;  5DGA A;  3RGI A;  4K4X A;  4OZ1 A;  3CDE A;  3ILO A;  1SIW B;  3EVM A;  3JXO A;  4IDK A;  4E2F B;  3TAR A;  2F63 A;  1ZBT A;  2KDO A;  1XMO J;  5GAG U;  4BC9 A;  1QE1 B;  4LFA F;  1T7P A;  3ZO7 A;  4PXB A;  4ICL A;  1G4C A;  2UVV A;  2K3K A;  4PG4 A;  4WF9 Q;  1S1X A;  1WC0 A;  4OIX A;  3MAQ A;  3PRB A;  1VQ7 S;  2BE9 B;  4ECV A;  4Y2M A;  1U0H B;  2XNR A;  2WVC A;  1UET A;  4MMO A;  4JUZ A;  2HWI A;  3EZU A;  4PG8 A;  1KEK A;  4ZLJ A;  1YVF A;  3OHB A;  3K5L A;  4L76 A;  2OTJ S;  4H4O A;  3LF0 A;  5A0Y B;  3WX4 A;  1RHQ B;  1PGZ A;  4B9S A;  4PXD A;  1AFJ A;  4WWS A;  5ETO A;  4DG1 B;  1ICE B;  2ZBR A;  4DR1 J;  1FE4 A;  4JI4 J;  2XWY A;  2KH9 A;  2H4W B;  1TFW A;  3MTJ A;  1H7W A;  2U1A A;  1O5J A;  1Y3J A;  4J7C A;  4MK9 A;  2H48 B;  2YKQ A;  3CCZ A;  3BEG B;  5D8H B;  4XDC A;  4J9U E;  3D6H B;  3MFH A;  4ZKA A;  2JRS A;  1LQ9 A;  5IV4 A;  1IKY A;  4LRB A;  4M95 A;  2V9K A;  4B9N A;  4IYQ A;  2ZM6 F;  2VOD A;  2XCA A;  1VQN S;  3NMR A;  2IA6 A;  2MEW A;  3GII A;  2CQC A;  4OZJ A;  4F2R A;  4JI2 J;  3TZY A;  1GXT A;  2GVZ B;  3QAU A;  1JLF B;  1UA1 A;  2XYH B;  1ZAV A;  2OPR A;  1FNO A;  2B8Q A;  2PE8 A;  3UNY A;  4XIU A;  4IOB A;  3ZTS A;  1IM6 A;  3CJS A;  1U1R A;  3HX9 A;  3R8Y A;  2Z56 B;  4DV3 F;  5KT4 A;  1L3K A;  1WC5 A;  5CCL A;  4RNO A;  2C2K B;  3ICL A;  5F3Z A;  1SKR A;  4ZVR B;  1ZYQ A;  3DXS X;  1X9S A;  3KK1 B;  2YPY A;  5E0O A;  2DGV A;  4YR3 A;  3WBZ A;  1NME B;  1RAO A;  4LVN P;  5AJ3 J;  1DQ8 A;  2VBW A;  2EPI A;  4J9V A;  3KJQ B;  2F4F A;  2YTC A;  3AJD A;  2DHX A;  3O44 A;  1WHX A;  5FD1 A;  3G6E S;  2ZBC A;  3PCO B;  3V2U C;  1UEU A;  3M8S A;  2DT9 A;  1KTV A;  2H3E B;  1BHN A;  2FJA B;  2CZ4 A;  4B9U A;  4M5K A;  2DGX A;  3JS9 A;  2P9C A;  4KC5 A;  1HWK A;  2BJ7 A;  2ZFH A;  3I5A A;  4QYZ J;  2BAN A;  3NGU A;  2C2D A;  3CDU A;  3LGM A;  4LSN B;  2L9D A;  2WOM B;  4P72 A;  1NSK L;  3EGZ A;  1R89 A;  1FES A;  2MKC A;  1HHT P;  4ZVT B;  1FKO B;  3LAK A;  1TL7 B;  1JKH A;  2YY3 A;  3HKZ D;  3RAM A;  1S1U B;  1KD1 T;  2DHS A;  3P49 B;  4LMZ A;  2Q6B A;  2FHJ A;  2G0J A;  4KHR A;  1J5E F;  2VC1 A;  3M8Z A;  3OXL A;  2XSJ B;  1XR7 A;  1O6X A;  2VH7 A;  3TOQ A;  3KK2 A;  1HPZ A;  5T14 A;  4DR5 F;  2F3J A;  1Y7P A;  3VVU A;  2LVW A;  5KFB A;  4A8O A;  2CDQ A;  2AZ1 A;  4V19 X;  1JNZ B;  2IJR A;  2Z2Y B;  1X4H A;  1UCN A;  2DB1 A;  2RVJ A;  5L9X A;  3IM8 A;  3NNA A;  3A12 A;  2BE2 A;  1SJ1 A;  4XPC A;  1D3W A;  1SCJ B;  2E5L F;  1LFP A;  5B0E A;  3T1H J;  7FDR A;  1V3S A;  4NXN F;  1H3D A;  3D1Q A;  3PY8 A;  1IKW A;  4RNH A;  2H5E A;  4WU2 A;  3OXF A;  3MR6 A;  2VA3 A;  1FNX H;  3I4P A;  1GXU A;  4DV6 J;  1JNR B;  5KFK A;  2WCX A;  2V8P A;  3OR1 B;  2VD3 A;  4L3K A;  3SI8 A;  3W9J A;  2CNK B;  3TW0 A;  1VRU A;  2XYG B;  2OMO A;  4CLP A;  2MZJ A;  2DY1 A;  4EFA C;  3FZB A;  2KU7 A;  2MGZ B;  3KLF B;  1BQM A;  1S6O A;  2AQ4 A;  1KVI A;  1VOM A;  2W2O P;  3PVX A;  1URN A;  3UDV A;  2G4B A;  4ZLP A;  3KG0 A;  2IJN A;  2RUS A;  3MUV P;  4KV8 B;  2WSF C;  3ZZT A;  2ZNZ A;  3A3P B;  2RS8 A;  4ICL B;  3A3O B;  1TKT B;  3HFZ B;  1OPZ A;  3EDQ B;  3CJ8 A;  4A8W A;  3FC9 A;  2CNN B;  4PUO A;  1JLA B;  4QIW D;  2FVP A;  4KTQ A;  1LWC A;  4HAC B;  3HSG A;  3QZ8 A;  5M2P A;  3GYX B;  1UFK A;  3DLG A;  1RSC A;  2ADB A;  4HT5 A;  4JI3 F;  3MCM A;  3UI3 A;  4DSJ A;  4ZPT R;  4B3O A;  3HKW A;  1G7C B;  3VAH A;  1H0H B;  1AB8 A;  1U2C A;  3R5D A;  4FYV B;  4ZP8 A;  1WG1 A;  2BE7 D;  5HJX A;  2NZ4 A;  3QT7 A;  5J1E A;  1CSJ A;  2CPY A;  5E33 A;  4LFC J;  1T9Y A;  4O3P A;  4DX8 H;  2Z30 B;  4O3N A;  3PR5 B;  4QPT A;  4O0I A;  2BJ8 A;  3OW2 R;  4F4K A;  2MPU A;  1WDT A;  4CTA A;  4UOH A;  2QA2 A;  5J2Q A;  3CUN A;  4P2S A;  3SV4 A;  5F8J A;  3THP A;  1GMU A;  3CC2 S;  1FRH A;  4UTG A;  4QBU A;  3TQE A;  3OSN A;  2DYA A;  5E7O B;  4OHY A;  4PWW A;  3BBF A;  3TAN A;  4X4Q A;  3N0V A;  2OPR B;  3MEK A;  2N3L A;  1X9W A;  2VU5 A;  2C3M A;  3M6U A;  5H1S V;  2DKO B;  1RK8 A;  3CED A;  2ZE2 A;  4YHH F;  4BCA A;  3DCA A;  3G86 A;  3MFI A;  1Y10 A;  2E5H A;  3X3U A;  3HFV A;  2KM8 B;  2J9D E;  4DFP A;  4L74 A;  2CG8 A;  4DV0 J;  3NP5 A;  2V34 A;  4K4T A;  2L9N A;  1U45 A;  3MUR P;  3E3X A;  2PFF B;  4HVZ A;  2C2O B;  3K17 A;  3AY0 A;  4ECX A;  5DLG A;  1UVI A;  2FHJ D;  2LA4 A;  1KOO A;  4F8R A;  5JXS A;  1CJU A;  4RLE A;  2LQ8 A;  3BB5 A;  4A8Q A;  1FRK A;  2JDJ A;  1NH8 A;  2JC0 A;  1WF0 A;  4GO5 X;  3VGU A;  3PX6 A;  5IV3 A;  3MEE A;  3B4M A;  5BYR A;  3CJR A;  4ZLL A;  2IC3 B;  4NZ7 A;  4JI7 J;  2GIF A;  3H5X A;  2VQF F;  4ZVH A;  3HD1 A;  3VGV A;  3TEH B;  1WNE A;  3I4H X;  1NJZ A;  1C1B B;  3DI6 A;  3CCM S;  1G3O A;  3IBF B;  4DFJ A;  2J6T A;  3J81 Y;  3KUG A;  2RH3 A;  2W7P A;  4Z7Y A;  1TFY A;  4LF5 F;  1T8E A;  4LUB A;  4AT1 B;  3W63 A;  1KSP A;  3AD7 C;  1TK8 A;  3C46 A;  2RQK A;  3MD1 A;  2NXE A;  3MDF A;  4WFX A;  3TZX A;  4DV5 J;  1WC6 A;  3FBE A;  3H5Y A;  4OYW A;  1B0V A;  3KK2 B;  3I5C A;  5G4D A;  1XQI A;  1FWP A;  1SB6 A;  3ONQ A;  1REG X;  2WVD A;  2FJX A;  1EIY B;  1AA1 B;  5IWA F;  1E6Y A;  2YNI B;  3ZZY A;  2DNH A;  3FSY A;  2VC0 A;  2QC3 A;  3W64 A;  2BV3 A;  5KFO A;  3TZZ A;  2VAS A;  1UFW A;  1IKW B;  5EWE A;  3OUY B;  2DNG A;  3T9N A;  1VGY A;  2P5V A;  1AUD A;  1OO0 B;  1JIH A;  5CXT A;  1HNV B;  2DGU A;  2JLE A;  4ID8 A;  1NB2 A;  1VRU B;  3AA9 A;  1S9F A;  3KMQ A;  2C1E B;  4YEA A;  3EWG A;  5HQ8 A;  4F0H A;  5CQG A;  1XMO F;  1JMT A;  3H2U B;  3VR1 A;  2DD8 S;  4BWJ A;  4X66 F;  4WK1 A;  3CCR S;  1GMW D;  2KT5 A;  1RTZ A;  1S1T A;  1UKU A;  1U2R A;  1R6V A;  4CLT A;  2NPF A;  1RAF B;  2XHC A;  4X4R A;  2OFG X;  2VFR A;  1B99 A;  2G1D A;  2KVI A;  2CPJ A;  1AW0 A;  1LWC B;  3K58 A;  5F8L A;  5HAN A;  3CJK B;  3TQ1 A;  1SV5 B;  5D0R A;  1RLD A;  2ZDO A;  2E9T A;  5KFZ A;  5E3C A;  5ADZ A;  2V8V A;  2GV1 A;  5GAE U;  2L48 A;  3AXM A;  5CA5 A;  3S01 A;  4KPY A;  4DR2 J;  3ENV A;  1YIJ S;  2QA4 G;  5KFF A;  1HFE L;  3LAL A;  4USI A;  1FI4 A;  3G87 A;  5K8O A;  1DTQ B;  4PZV A;  4UW2 A;  4DR1 F;  5KG5 A;  4IR9 A;  4FF2 A;  3CWJ A;  4HDG A;  5KFL A;  1PIE A;  4J9L A;  1H2V Z;  1RT1 B;  2PT0 A;  3TJ9 A;  3POT B;  1TVR B;  1LXN A;  4CLK A;  4QIE A;  3MZI A;  2BJ1 A;  4DPY A;  2CVI A;  2C28 A;  2LU1 A;  4PR6 A;  2UUA J;  4ECS A;  4J9O A;  2B5J A;  4QIV A;  2R8J A;  4MIA A;  3HK2 A;  1TL3 A;  3T3F A;  1WSV A;  2VIC A;  4PWD A;  3CXC R;  2VOO A;  4CTA B;  5HBM A;  3VV2 B;  2QLX A;  5D0G A;  1CBK A;  4V1A k;  2A3J A;  3VAG A;  1TV6 B;  5C42 B;  1TUW A;  4JI2 F;  4C8K A;  3TRG A;  4ERD A;  1U4B A;  3OTC A;  1N6Q A;  3TR5 A;  5IXU A;  1UVJ A;  2KT3 A;  2BVZ A;  2DNZ A;  2FTR A;  2VKR A;  3I32 A;  2ZJP Q;  2V8G A;  2OEJ A;  2QA1 A;  1BY9 A;  2DJW A;  2OH2 A;  4M5N A;  1CC7 A;  4A8F A;  1HBU B;  1EKR A;  3EXC X;  4DSL A;  3DFE A;  4MKA A;  3BGU A;  3CD5 A;  3HVA A;  1YGY A;  1IKV A;  4Y2A A;  4IFY A;  3HT0 A;  5AJ3 F;  3VGT A;  1RTJ A;  4OI2 A;  4WII A;  1TAQ A;  3MUM P;  1EJ7 L;  2KFN A;  5U47 A;  4DPX A;  4RUH A;  1JLE A;  1AZS A;  2YWH A;  1SL2 A;  3N6M A;  3FUY A;  2IM1 A;  2IJF A;  2V2Q A;  1T3O A;  1U1P A;  2QN6 B;  2M8D B;  3PYE A;  3HP6 A;  1RKI A;  3NBP B;  2CQ3 A;  4CO3 A;  4W98 A;  4DF8 A;  2WW8 A;  4OX9 J;  3DLL Q;  4WZQ A;  3G96 A;  4FF4 A;  2DEI A;  5L8R C;  5ETV A;  1URR A;  2RJZ A;  2ZBQ A;  4RUB A;  2WAQ D;  4DR6 J;  3LP0 B;  4U7U D;  3I55 S;  3CPW R;  2Z2L A;  4MFB B;  1IM4 A;  2ZH8 A;  2OTL S;  1S77 D;  2HNZ B;  1HI0 P;  3Q0A A;  4DQS A;  1MU2 B;  4EI2 A;  2FIU A;  2KHC A;  2J0S D;  4MJK A;  4U7U K;  3JQJ A;  1M5P C;  1KOH A;  2LEA A;  1WEL A;  1FKP A;  5K20 B;  2DNM A;  4K7Q A;  3GJS B;  2WVB A;  3PKM A;  4J91 A;  1FFG B;  5HRO A;  3I0R B;  1VQO S;  1I5O B;  4RNN A;  1EET A;  1U6F A;  3BPD A;  3J7A 1;  1VLO A;  4NLY A;  2LEP A;  4TKT A;  1HBO A;  3QRP A;  1JLQ A;  2YH0 A;  4A8M P;  3G71 S;  5HL7 Q;  4DV6 F;  1HMV A;  2VA2 A;  3LWL A;  1RGV A;  4RPF A;  3GIL A;  3RRK A;  3VAK A;  4ECR A;  2EFP A;  5K8M A;  1VQ8 S;  2CFX A;  2DR6 A;  1VMB A;  2BX6 A;  2VFV A;  3MI7 X;  1BQX A;  1X4C A;  4CT8 A;  4QIF A;  1JLC B;  4FF3 A;  3I0S A;  1Q1K A;  4G1Q A;  4LF8 J;  1RWP B;  2QE5 A;  3MD3 A;  4IH7 A;  3QLH B;  1KWM A;  5CZX A;  3R2C J;  1F2G A;  3AAW B;  4NE9 C;  3GQC A;  2EKN A;  4ALZ A;  3MED B;  5B0G A;  1A0O B;  1APS A;  3RBX A;  4DX7 A;  1WEX A;  3CVK A;  2VFT A;  2QO3 A;  3VAF A;  4P2F A;  2R7R A;  1PJ5 A;  1RAA B;  1UAW A;  3KDN A;  2H1Y A;  1S76 D;  2J76 E;  1NUE A;  2YQ3 A;  1RAJ A;  2F4V J;  4G1P A;  4DUY J;  2G0C A;  3V4I A;  3TVZ A;  4RX6 A;  2O1P A;  2OI2 A;  3M6X A;  5J2M B;  1DY3 A;  4LRA A;  4J9Q A;  4NML A;  2RDJ A;  1UPM B;  3KJV B;  3BYP A;  1LWX A;  2WB1 D;  1N4L A;  2LFV A;  2MLZ A;  1U1N A;  5BXI A;  4LFC F;  3Q8P B;  4ED4 A;  4QYZ K;  2ADC A;  2DIU A;  3M8Q A;  2XMK A;  2B5J B;  1DUR A;  1RHU B;  4L73 A;  1O8B A;  4KBI A;  1C0T B;  1JB0 C;  3QYY A;  5B09 A;  1S9E A;  2IMW P;  3AT1 B;  2J0Q D;  1SQF A;  1P8G A;  1M90 T;  2MSS A;  1PSD A;  4WP8 A;  2DVI A;  2XS2 A;  1N6Q B;  2AHO B;  3ILJ A;  4A46 A;  3M8P B;  4K2X A;  1YIT S;  4DMZ A;  3S8S A;  3R9L A;  4RO0 A;  3D3C J;  3CJ3 A;  3IXQ A;  2VG5 B;  1DLO B;  2AJ0 A;  2HEK A;  4NCG A;  1EP4 B;  1IKV B;  4M5I A;  1F1B B;  2XBP A;  4Y3C A;  3NS6 A;  2IFX A;  3ZZU A;  4G1I A;  1S0O A;  4KB7 A;  1N0V C;  4H4M B;  4BBY A;  4RUA A;  3WIV A;  2EBE A;  2OHD A;  4ECU A;  2HHX A;  1HWL A;  5K8N A;  4CO2 A;  2HUR A;  1XWL A;  3BN7 A;  2LEC A;  4JI7 F;  2AMC B;  2CJB A;  1TK0 A;  2BJ3 A;  3NCQ A;  3TZW A;  2OO4 A;  2IRU A;  3TNV A;  1R27 B;  3FFI B;  3QIP A;  4BLG A;  3FVY A;  3CJ5 A;  1MRO A;  2AIR B;  4OHW A;  2YNG B;  3J7Z T;  5KFV A;  2I2Y A;  2YKO A;  1TL5 A;  2AT1 B;  4DV5 F;  3BBC A;  3U7J A;  3IG1 B;  3HVR A;  4TU9 A;  2QMU B;  2AU0 A;  4DHV A;  4D3G A;  4WCE Q;  3TAM B;  5HSP A;  3N9U C;  3AOB A;  2BQ3 A;  1RHR B;  4PXC A;  5ETT A;  3P4U B;  1NDL A;  2ALY B;  4A4J A;  4CLY A;  4FYY B;  2GZO A;  3TUJ C;  3MR3 A;  4C8O A;  3V6D B;  3MCN A;  2C2E A;  5E3A A;  4CLU A;  5HRO B;  2MKI A;  3I31 A;  2EI5 A;  1EET B;  2HHQ A;  2CQB A;  4C7Q A;  2RE1 A;  1NPR A;  1S9G A;  3H4D A;  3QT5 A;  2HHH J;  3ZTP A;  1K1S A;  4WTO B;  3QSI A;  1HBM B;  1YBU A;  2HHU A;  1SH0 A;  3M8W A;  3U1M A;  3GWC A;  3VAM A;  3S6E A;  2W9C A;  2FLL A;  3OJU A;  3ISN C;  2GQC A;  2CQH A;  1Z4U A;  2ATL A;  3ETM A;  1M1K T;  1RTI A;  2NXN A;  4X4N A;  1D9D A;  1JK9 B;  1RU1 A;  3GMG A;  1HNI A;  3DLB A;  1QUV A;  2CPZ A;  1P6T A;  4QPX A;  4J9S A;  1IWA A;  2V2V A;  1C1C B;  4CZC A;  5KFP A;  4QWB A;  2WTF A;  3DOK A;  2HRY A;  2WON A;  2VG6 A;  4P10 A;  4TY9 A;  4DL5 A;  1FXL A;  1C0U A;  1RYR A;  3R7S B;  3D6T B;  2XYP B;  3HHK A;  2ZOF A;  1JJ2 R;  2EBG A;  1U7L A;  3C15 A;  1N54 B;  3E01 A;  1ARO P;  1I51 B;  3C14 B;  3BZQ A;  4DPO A;  3CJ2 A;  4ZHR B;  3G2X A;  5AT1 B;  4OZ2 A;  4MKV A;  1TK5 A;  4DR2 F;  4IQM A;  2IHR 1;  1S10 A;  5A8W A;  2V94 A;  2GGP A;  1BXN A;  5IOL A;  1DAR A;  1Z1Z A;  1RT3 A;  1QLN A;  4HYK A;  1T9T A;  2KI2 A;  4LRC A;  3LPE A;  2NLW A;  3BS9 A;  4EYH B;  2Q1L A;  4XO0 A;  3WC2 A;  4OYA A;  2H65 B;  3B8H A;  1UW4 A;  2C2M B;  3DLH A;  1VIO A;  1SJR A;  3LP2 B;  3W65 A;  2UUA F;  1S6Q A;  2L3M A;  4LVO P;  1SL0 A;  1NHV A;  1QM9 A;  2FHM A;  3HUL A;  2V50 A;  2V2K A;  3QMQ A;  2NYH A;  1WEZ A;  2R4F A;  1S9E B;  4C48 A;  1NKC A;  4JYA F;  3QJP A;  3UCG A;  4FS1 A;  3FKB A;  2ALZ A;  1LOU A;  2GNK A;  1EAR A;  3AJ1 A;  5E3Q A;  3X1L B;  2RDI A;  5EHH A;  3IWL A;  4UOG A;  2ZWO A;  2D9O A;  1SJ4 P;  1CUL A;  1F0X A;  1CJT A;  2ZEJ A;  1ULR A;  3EGN A;  4F3Q A;  1TL4 A;  2OKQ A;  2O3D A;  2FJE B;  4Y2K A;  3TA2 A;  4TN2 A;  2R2U A;  3HCX A;  3K89 A;  3JYT A;  3CCU S;  3HD2 A;  4X62 J;  1N36 J;  3UE2 A;  2HNY B;  4EO8 A;  1YBT A;  3IMQ J;  2EC0 A;  5JVH Q;  3PJW A;  2DH8 A;  4TXS A;  4A8Y A;  1YJT A;  5AXK A;  1FRX A;  1X4D A;  4M5L A;  1N0U A;  4ZOS A;  2G2Y A;  1LW2 A;  5GAG I;  3VTI A;  1DRZ A;  3NNH A;  4LRD A;  2HHS A;  1N56 A;  2GHW A;  3SSS A;  2VKZ G;  2MKY A;  4KPC A;  3TUI C;  4ILM A;  1Q95 G;  2FLP A;  4DR3 J;  5KFD A;  1D1U A;  3LP1 A;  3RRH A;  4DJB A;  3BSO A;  3CC7 S;  1Y4Z B;  1TKZ B;  2MXY A;  1RWX B;  3L3C A;  3J7Z 5;  1FA0 A;  4M5H A;  3MMA B;  4LQ3 A;  2BKO A;  3I5B A;  1NU4 A;  4EEY A;  2J9E A;  2Z2M A;  3DGV A;  3SIP B;  1UMJ A;  3NS7 B;  4WJB A;  2OPS B;  2JZ5 A;  1LWF A;  4ZPD A;  4OYZ A;  2UUW A;  3SCJ E;  5C7P A;  4Y65 A;  1N8R T;  3ZNU A;  4ZVP B;  4O4R A;  4P2X A;  4OLP A;  1IBM J;  3DOL A;  2QFJ A;  4DN0 A;  4YFU A;  2LDY A;  2BRL A;  3V4M A;  4CYU B;  3V6H A;  2G2O A;  3CDB A;  4IG3 B;  1H74 A;  4IG0 B;  4CLL A;  2VB6 A;  4Y00 A;  3SXL A;  5A6W A;  4ZVQ B;  2MHN A;  3GG0 A;  1LWE A;  1X4F A;  2HQ3 A;  4I68 A;  4QQB A;  2W9C B;  3IR7 B;  2HS3 A;  2AEF A;  4CO0 A;  5HK4 A;  3M2R A;  5D6G A;  4C8M A;  3DN9 A;  2KT2 A;  2YWE A;  2FPH X;  1RTI B;  5K14 B;  1QSL A;  2ILY A;  4CRJ A;  4ZJO A;  4EBE A;  3PW0 A;  4A47 A;  1NK7 A;  5A8R B;  4LF8 F;  3CT9 A;  3GV8 B;  1VC6 A;  3IO1 A;  3GZ7 A;  4O44 B;  2GIQ A;  1Y3K A;  1NH7 A;  2YWK A;  1U1L A;  2IIH A;  4B08 A;  2DO4 A;  2HK2 A;  1JXE A;  3O5T B;  3TI0 A;  1I94 J;  4RJV A;  4NYP A;  2XEX A;  2VFS A;  4QU6 A;  1KTQ A;  4RW9 A;  1IJF B;  2AF6 A;  1T02 A;  3RAX A;  5C2C A;  1HW8 A;  5F0U A;  2F4V F;  3CJ4 A;  4DUY F;  4N41 A;  3O2I A;  1RT2 B;  1H38 A;  4IH5 A;  2OUG A;  1OSC A;  1RWU A;  2DH7 A;  3F56 A;  3DRP A;  4TNO A;  3PHE A;  2OPQ A;  4K5R A;  1S12 A;  1IR1 A;  5DRK A;  4OLO A;  3ILI A;  5I3U A;  3IC1 A;  4ED6 A;  1VCT A;  3C8Y A;  1VS3 A;  4UY8 5;  1YJ9 S;  5KTQ A;  4OI3 A;  3C2P A;  4ID5 A;  1XNR J;  5KFJ A;  3OSP A;  3W5X A;  3EDR B;  1VI7 A;  1MNE A;  3OL7 A;  3GIR A;  3RBE A;  2M52 A;  3KLV A;  5DQI A;  4RNM A;  4O3S A;  5LMU J;  1QAX A;  4OYI A;  2N3O A;  1DQ9 A;  5KG6 A;  2LP4 A;  1A6L A;  2BM1 A;  5IFM A;  2WSC C;  3ZFV A;  1ZTT A;  4OHZ A;  3UO0 A;  3MR5 A;  4AQY J;  3CO9 A;  2WK4 A;  3DGP A;  4N76 A;  2W25 A;  1SPB P;  3M2U B;  4K4Y A;  2VPW B;  4KKO B;  2G13 A;  4IUF A;  1CJT B;  1RT6 A;  2Z2Z A;  3SFU A;  1CS4 B;  3UR0 A;  4X4P A;  4DSF A;  1WHY A;  2VZ9 A;  1HD1 A;  1OJ4 A;  2EFN A;  3KLI B;  3KJF B;  4K4U A;  2RDD A;  2CDR B;  3SSR A;  4C11 A;  1RT7 B;  2VIH A;  1FX2 A;  2LQ5 A;  4RBV A;  2GML A;  2M88 A;  1YJU A;  3M1V A;  1SQE A;  5HO4 A;  4IFV A;  4F02 A;  2JEG A;  4RW8 A;  3MPD A;  4F4Y A;  2E44 A;  3R7N B;  3CCV S;  4ENO A;  3P96 A;  3Q83 A;  3CF5 Q;  4Q8F A;  5IC6 B;  3US5 A;  3QWU A;  1UVK A;  4I6Y A;  3D7S B;  2IVF B;  2FZC B;  1FFW B;  2BW2 A;  2PMZ D;  3EVW A;  2R8I A;  2KFY A;  5JVG Q;  4UQG A;  3A8K A;  2HKE A;  2LU2 A;  4K2J A;  4DXL A;  3KLG B;  5A8K B;  4H4K A;  5E3R A;  1GX6 A;  3EGW B;  3F41 A;  2W9B B;  4P7V A;  3V81 A;  2MY7 A;  3MEG A;  1Q16 B;  4QWC A;  3HVW A;  2VL1 A;  4U67 Q;  3FZ2 A;  4DQI A;  4DWI A;  1UTA A;  3PW7 A;  2W2Q P;  1IBC B;  4Z7C A;  1PKU A;  1N5V A;  4PPZ A;  3ZTO A;  1CLF A;  5GMK a;  2YNF A;  3LP1 B;  4Z37 A;  2ZC4 A;  3I82 A;  2MZS A;  5EN1 A;  5AE3 A;  2R7U A;  2GFF A;  3U1N A;  3A8J A;  3NLC A;  2MZ1 A;  5HP1 A;  2GVD A;  1JQG A;  1U24 A;  1FJE B;  4P52 A;  6FDR A;  2UV8 G;  3CDA A;  2GHV C;  1RTH A;  4ECZ A;  4FXD A;  1QUP A;  4FNI A;  3M8R A;  4ZCK A;  4USW A;  4TYA A;  4CH7 A;  3O3L A;  3GR0 A;  4R8U B;  5M2U A;  3R5B A;  2FDN A;  2BAB A;  1YJR A;  4Y28 C;  4P74 A;  2HHH F;  4M5D B;  2C2N A;  5LL6 d;  4I67 A;  2F8E X;  1CQN A;  1S99 A;  3J7Y U;  1KQK A;  2V9W A;  5HVH A;  1VFJ A;  4NAS A;  5KOW A;  1TMJ A;  3IWX A;  3T6J A;  5ETK A;  2BRK A;  1AXQ A;  2CQP A;  3U27 A;  3M2R B;  3RU0 A;  2CZV C;  3A1Y G;  2M5Y A;  3DXB A;  3KYL A;  2V4Q A;  4JI0 J;  2CJ9 A;  2MQO A;  4EUV A;  4B9M A;  2AEJ A;  3UCZ P;  3TAQ A;  1HKA A;  5FDL B;  4DPU A;  1FRM A;  1YTY A;  1L3V A;  3W62 A;  3AFG A;  1S48 A;  1RHJ B;  2VOP A;  1MN9 A;  2K1R A;  4I56 A;  4JI6 J;  2MQ8 A;  2W4C A;  2V0N A;  3HFK A;  3QGG A;  1K0V A;  4RW9 B;  4EU0 A;  3IWN C;  3TWZ A;  5LMN J;  3O6Q A;  9RUB A;  2JVR A;  5C24 B;  4FF1 A;  3BV8 A;  3SYZ A;  3QZ7 A;  3A13 A;  5D4O A;  1YJ7 A;  3UVJ A;  3GFX A;  1RTD B;  4HH0 A;  5HMW A;  1U6B A;  5DM7 Q;  3MM5 B;  1RWV B;  2OPQ B;  1QVG R;  1S0V A;  4WFZ A;  4NA3 A;  5KFC A;  1DZ5 A;  7FD1 A;  4DSE A;  3M2V B;  4I2P B;  3DU5 A;  5I3U B;  4J37 A;  4A48 A;  5MLC V;  1OY8 A;  2MKH A;  1MLA A;  3D6F B;  3FBC A;  4PQU B;  2VON A;  3QT6 A;  1VIS A;  3I56 S;  1R8P A;  1UVM A;  2F9D A;  4MTP A;  3HPO A;  4A8X A;  1SUQ B;  2LCW A;  2GQQ A;  2FGO A;  4OV1 A;  3CDW A;  1P9Y A;  3J80 Y;  4F50 A;  4J90 A;  4Q2L A;  1FVS A;  3GJT B;  2RT3 A;  1RZM A;  4QJV A;  2R7T A;  3HZG A;  1NJI T;  4DR4 J;  1FD8 A;  2J6U A;  1RDR A;  5J2N A;  2CPE A;  2M2B A;  4ZPA A;  4ETX A;  1RT6 B;  4PAB A;  2HZC A;  3DHX A;  5KFM A;  2WVE A;  3OL6 A;  1FXD A;  2JSX A;  3UD5 A;  3RBD A;  4X62 F;  3M1V B;  1M5H A;  1J5O A;  1N36 F;  3KLE A;  4IFV B;  3NCR A;  2X1F A;  1Y5N B;  1UA0 A;  3J7A N;  2D41 A;  1MWY A;  5ETP A;  2MJN A;  2ASL A;  1SQG A;  1X0F A;  3SZ2 A;  4KGM A;  2EFO A;  4HHU A;  1Z2Z A;  5AE2 A;  2CQ1 A;  1ROF A;  1O51 A;  3D4J A;  2PII A;  2HND B;  3EVO A;  1QE1 A;  3AH6 A;  3MAA A;  2F7V A;  1N52 B;  2G2Z A;  4TY8 B;  1SXL A;  2V68 A;  3T5H A;  3JAM Y;  1I3O B;  4FXV A;  4JV5 J;  1U0H A;  4DR3 F;  4ZIW A;  1FJ7 A;  4ZCI A;  1XMQ J;  1YJN S;  4W90 B;  3DLK B;  3EJM A;  3BGO P;  2E66 A;  4O3O A;  2KJV A;  5K8P A;  5A0Y A;  4ZVU B;  5GAE I;  2I6W A;  2AJ2 A;  5CH7 B;  2QFI A;  2POK A;  1YSJ A;  3DNC A;  4DG1 A;  2HW3 A;  5HP1 B;  1FD2 A;  2GIR A;  5D3G B;  1XR6 A;  1CG2 A;  5H9E K;  2BAC A;  1Y0H A;  3OT9 A;  1KKH A;  2DIS A;  2RRN A;  1B4S A;  1HHQ A;  1T9X A;  3PYG A;  1ZET A;  3OTE A;  1IBM F;  2OJ3 A;  2XZD B;  4K50 A;  1HBN B;  3K5M A;  4ZVF A;  5CAB A;  1MG7 A;  3HO1 A;  3ENQ A;  3AB2 B;  5GAD U;  2XMT A;  1T03 B;  2GVZ A;  4P9S A;  2KJW A;  2XHW A;  1JLF A;  3RAQ A;  1IQT A;  1IR0 A;  2YH1 A;  5HVG A;  1YI2 S;  3TYT A;  2UUB J;  1VC5 A;  3VZI A;  3BR8 A;  1LK7 A;  2QSW A;  2ASY A;  3FGV A;  2QRR A;  1K8A T;  2CZ9 A;  3CJQ A;  2VDI A;  2DNL A;  1O0P A;  3CB4 A;  1B0P A;  2G1H A;  1XNQ J;  4UOC A;  1D09 B;  1I94 F;  1KNZ A;  2WBR A;  5T41 A;  3M30 B;  3KK1 A;  2K1R B;  3ET6 B;  2YQ1 A;  1U47 A;  2RQM A;  1PC5 A;  4YME A;  5D4N A;  3KHG A;  3W8G A;  1RT4 B;  5EDW A;  1X5S A;  2B6A B;  2PC6 A;  3QNW B;  4XDD A;  4USH A;  4RW4 B;  3HSJ A;  2AYE A;  2B0G A;  4LF9 J;  1U2F A;  2XZT B;  4NLX A;  1GFW B;  4K4Z A;  1PJ6 A;  4ECW A;  2IRY A;  2CIM A;  4TVA B;  3BGR B;  2JEJ A;  4LSN A;  2WOM A;  3CCE S;  3JAM U;  3NS5 A;  4CH1 A;  2AP6 A;  4X4V A;  3JSM B;  1XNR F;  1TL7 A;  3GP9 A;  2D74 B;  2K2P A;  3TAP A;  1PIL A;  3DDK A;  4ZA1 A;  2HZA A;  2DCU B;  2R42 A;  2HSE B;  4UQT A;  3QQC D;  5C5J A;  2KO1 A;  2FC8 A;  5LMU F;  3R97 A;  2KXH A;  2OPP A;  2XSJ A;  4TQR A;  3OQ2 A;  3PYF A;  1YKW A;  1N32 J;  4I1T A;  1GNK A;  3OPK A;  4LF2 A;  1XTZ A;  2AD9 A;  3PR4 A;  4AQY F;  5H9F K;  4JBC A;  3M7V A;  2MQL A;  1T9W A;  5T7L B;  1R0C B;  4CQ1 A;  3CCQ S;  4LIR A;  4DDF A;  4N56 A;  3V6K A;  1X0P A;  1T9V A;  3BM7 A;  1W25 A;  2CA9 A;  3IS9 B;  1XK8 A;  3QRQ A;  4WTY A;  3H90 A;  1ZTW A;  2KKH A;  4F36 A;  1NAQ A;  1M1H A;  3KG4 A;  4CDI A;  3D3B J;  2YNH A;  3G8T A;  1FDA A;  1OSD A;  2K3I A;  2QLW A;  2R7O A;  3OR1 A;  5ETQ A;  2RB7 A;  4O0N A;  3KLE B;  4M94 A;  1NPK A;  2J9D A;  4WE1 B;  5E2Q A;  4URQ U;  4HL9 A;  1T11 A;  2MGZ A;  3KLF A;  4IRD A;  4CM0 A;  1ZPV A;  3QFW A;  4AL6 A;  2VUG A;  2IDE A;  4NLS A;  2ZBP A;  3LUY A;  3HHL C;  4KV8 A;  1U48 A;  4ED1 A;  3I87 A;  3QAE A;  3MOZ A;  3MAA B;  3GYG A;  1XN9 A;  2V4J B;  4L6V 3;  4F4X A;  1TKT A;  2GO9 A;  5DGB A;  1SL1 A;  1QDU B;  5DJB A;  3SCL E;  1JLA A;  2RQ4 A;  4OL8 A;  4O3R A;  4HAC A;  4C3L A;  4U95 A;  1JX4 A;  4RU2 A;  4C3M A;  3LPY A;  2K06 A;  2JLF A;  2X7I A;  3IGN A;  3MMC B;  4R0J A;  1IBK J;  2FUG 9;  3NAI A;  2QLJ B;  1LNQ A;  3N28 A;  3RW7 A;  4RUC A;  1NZ8 A;  2AYB A;  4GVB B;  9ATC B;  4AFF A;  3W8P A;  2ABY A;  1F9H A;  2Z58 B;  5CAA A;  4R25 A;  1OPI A;  2HFZ A;  4Q44 A;  1WAC A;  3PO4 A;  5L1J A;  4L75 A;  2FHK A;  1N88 A;  1IUJ A;  3CJ0 A;  3U1L A;  2W24 A;  3F73 A;  1HR0 J;  2JOQ A;  2UVU A;  3MUT P;  1VIX A;  3RYL A;  3Q2S C;  4CI0 B;  3OVA A;  2ZH3 A;  4HTJ A;  2GA7 A;  1SJ3 P;  1HNW J;  2AJQ A;  1D9A A;  4C3K A;  3DRY A;  4URS A;  2KYX A;  4LSL B;  1NJX A;  1ZM3 A;  1DTT B;  3IRX B;  1CPZ A;  4DL2 A;  4ED5 A;  1WOP A;  4MKY A;  2AX0 A;  2F8M A;  1XBW A;  2FJV A;  5HLF A;  1WKJ A;  2MKS A;  4NXM J;  2MLY A;  4ES3 A;  2JVO A;  4FYW B;  1L3T A;  4JI0 F;  2FD2 A;  3VQT A;  2ZKT A;  1YRT A;  1EHW A;  2I5J B;  4LFB J;  2BW7 A;  2JWN A;  1VQS A;  1MSW D;  3FCV A;  2DCL A;  4NEY A;  3BDP A;  2MYF A;  4B3T J;  4PG5 A;  1IBL F;  2VG7 A;  1VQM S;  2ACY A;  2PA8 D;  3Q2T C;  1JLB A;  4OYO A;  1X5O A;  4JI6 F;  1VR6 A;  4FZV A;  5KFU A;  4URG A;  1A9N B;  2MQN A;  4DQR A;  2DXE A;  5LMN F;  1FX4 A;  1VHF A;  1SJF A;  4UT4 A;  1ZZN A;  2BYC A;  4XK8 C;  4C98 A;  1D0E A;  1PAE X;  5E5N A;  2CQI A;  2CQ0 A;  4CIO A;  4AXJ A;  2IC3 A;  2J7U A;  3AOD A;  5LOQ A;  4DU7 A;  2EVZ A;  1RQ0 A;  3RR8 A;  3BH6 B;  2DHG A;  1RWK B;  2IDL A;  1WHV A;  2I38 A;  1NZA A;  3HSZ A;  1C1B A;  2NZC A;  5KFY A;  3SBM A;  5G0R B;  3OFE A;  4FS2 A;  5F8I A;  2HLU A;  3BKU A;  1X4A A;  3DYA B;  3H98 A;  4LT6 A;  4YB5 A;  3QSY B;  5ETM A;  1FTC A;  1G2E A;  3AD9 C;  2VPX B;  4NLO A;  2OPP B;  4AL5 A;  4ZDN A;  2CPD A;  4KHP J;  2KZM A;  1UJ6 A;  1RHM B;  3THT A;  2HQI A;  4DSI A;  5L1L A;  1B7Y B;  3EE3 A;  5F8G A;  2L9W A;  1L3S A;  1K47 A;  1HWI A;  3IA0 A;  5M2R A;  3HJF A;  1OQ6 A;  1HL6 A;  2YNI A;  4V19 J;  4DR4 F;  3KFW X;  5KFI A;  2MQM A;  1BWV A;  2E5G A;  2RS2 A;  3T1A A;  4FPR A;  3A4T A;  3MEC A;  1IKX B;  4QW8 A;  3QPI A;  1DJ0 A;  4XPE A;  1GAO A;  4YR0 A;  1TL1 B;  3OUY A;  4KHM A;  2DH9 A;  1G6B A;  2IRX A;  4P75 A;  2YNH B;  4TLR A;  3KUH A;  1HNV A;  5LM7 E;  4HH1 A;  3MF5 A;  4JI5 F;  4DPW A;  4CCH A;  1K9M T;  4MYU A;  1RT5 B;  2HVD A;  3BF4 A;  4ZP9 A; 
#chains in the Genus database with same CATH homology
 1NSQ A;  4W98 A;  3BBC A;  3FBE A;  2CWK A;  1EHW A;  1HLW A;  3WX8 A;  3EVO A;  3B6B A;  3NGR A;  4DUT A;  3GPA A;  1F6T A;  4EK2 A;  3FCV A;  3NGU A;  4F36 A;  1XQI A;  1B99 A;  1LWX A;  1BUX A;  1W7W A;  3FKB A;  4WBF A;  3ELH A;  1NSK L;  1U8W A;  3L7U A;  4ANE A;  5CAB A;  4KPC A;  3Q86 A;  3MPD A;  2BEF A;  1MN9 A;  1NDL A;  2DXD A;  3Q89 A;  3VGS A;  1S5Z A;  5BXI A;  2B8Q A;  3ENA A;  4ENO A;  1ZS6 A;  3EE3 A;  3Q83 A;  5CAA A;  1KDN A;  1S59 A;  4UOG A;  4FKY A;  1BE4 A;  3ZTS A;  4O0N A;  3G2X A;  1NPK A;  4C6A A;  4FKX A;  3DKD A;  2BX6 A;  4UOF A;  3Q8Y A;  4DI6 A;  2ZUA A;  1NDC A;  3GP9 A;  1F3F A;  3EVW A;  1NHK L;  4UOH A;  3VGU A;  1JXV A;  1NLK L;  1NSP A;  2DXE A;  3EJM A;  4CP5 A;  3NGS A;  5IOL A;  3BBB A;  3EIC A;  1NDK A;  1S57 A;  3FCW A;  1XIQ A;  1NCL A;  2HUR A;  1NDP A;  3Q8V A;  1VYA A;  1K44 A;  3NGT A;  3ZTP A;  2DYA A;  2NCK L;  3FC9 A;  3PRV A;  3VVU A;  4F4A A;  1PAE X;  2AZ1 A;  3VGV A;  3ZTR A;  3BBF A;  4AND A;  2DXF A;  1UCN A;  3DDI A;  1NB2 A;  3VGT A;  3B54 A;  4S0M A;  4HR2 A;  3EMT A;  3ETM A;  3EM1 A;  4ANC A;  2HVE A;  4DZ6 A;  3BH6 B;  3FBF A;  2AZ3 A;  1LEO A;  1HIY A;  3ZTQ A;  1WKL A;  5C7P A;  2VU5 A;  3EVM A;  1MN7 A;  1WKJ A;  3VVT A;  1BHN A;  2DY9 A;  1PKU A;  3ZTO A;  1NUE A;  1B4S A;  3JS9 A;  1HHQ A;  3PJ9 A;  3Q8U A;  2HVD A;  3BH7 B;  3FBC A;  2B8P A;  3FBB A;  1WKK A;  3R9L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...