1NLKL

Crystal structure of myxococcus xanthus nucleoside diphosphate kinase and its interaction with a nucleotide substrate at 2.0 angstroms resolution
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
143
structure length
143
Chain Sequence
AIERTLSIIKPDGLEKGVIGKIISRFEEKGLKPVAIRLQHLSQAQAEGFYAVHKARPFFKDLVQFMISGPVVLMVLEGENAVLANRDIMGATNPAQAAEGTIRKDFATSIDKNTVHGSDSLENAKIEIAYFFRETEIHSYPYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NUCLEOSIDE DIPHOSPHATE KINASE
publication title Crystal structure of Myxococcus xanthus nucleoside diphosphate kinase and its interaction with a nucleotide substrate at 2.0 A resolution.
pubmed doi rcsb
source organism Myxococcus xanthus
molecule tags Phosphotransferase(po4 as acceptor)
total genus 43
structure length 143
sequence length 143
chains with identical sequence R
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 1994-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 1nlkL00
3ELHA 1S57A 1NHKL 5IOLA 1K44A 3Q8VA 3EM1A 1EHWA 3EE3A 1BE4A 2B8PA 1BUXA 3VGVA 3BBBA 1B4SA 3EVMA 1NSKL 3JS9A 3FCWA 3Q83A 3NGUA 4UOHA 1NLKL 2AZ1A 1KDNA 2BEFA 3VGTA 1XQIA 3ZTQA 4F4AA 4F36A 3Q86A 1U8WA 4FKXA 1HLWA 2BX6A 3MPDA 3G2XA 3GP9A 1W7WA 1NCLA 4FKYA 3Q8YA 1NDCA 1VYAA 2DY9A 4W98A 3ZTOA 3ZTRA 1NPKA 4WBFA 1HHQA 2DXFA 3FBCA 3FBFA 1S59A 1WKJA 4HR2A 3VVTA 4ANDA 1LEOA 2AZ3A 3DKDA 4O0NA 1LWXA 3Q8UA 1HIYA 1MN9A 2DYAA 3EJMA 4ANEA 3PRVA 3EVOA 4DUTA 3Q89A 1S5ZA 1ZS6A 5C7PA 3FKBA 3NGTA 4KPCA 4UOFA 1WKLA 5BXIA 3EVWA 2VU5A 1F6TA 2ZUAA 3NGSA 1BHNA 1JXVA 2HVEA 4UOGA 4EK2A 2NCKL 1PAEX 4DZ6A 1NSPA 4DI6A 1NSQA 3GPAA 3VGUA 3R9LA 3B6BA 5CABA 1NDLA 3B54A 2DXDA 3BH6B 1NDKA 3DDIA 5CAAA 3BBCA 1NB2A 3EMTA 3ENAA 4ANCA 1F3FA 3FBEA 1NUEA 3EICA 3ETMA 3PJ9A 2DXEA 2CWKA 2HURA 3FBBA 1UCNA 3VVUA 4C6AA 2B8QA 1NDPA 3ZTSA 4ENOA 3FC9A 4CP5A 3WX8A 2HVDA 3FCVA 3L7UA 3ZTPA 3VGSA 3BBFA 4S0MA 3BH7B 1WKKA 1B99A 1PKUA 1XIQA 1MN7A 3NGRA
chains in the Genus database with same CATH superfamily
1MMNA 3LPEA 2M0GB 3H5UA 1SBRA 3O3LA 3CO0P 5C42B 4PG5A 4WCEQ 1IBCB 2NUHA 2LLZA 3Q86A 1HNVA 4FVMA 2EG1A 1QSLA 3J80Y 2UU9J 2DHSA 2UZAA 4UT4A 4R0EA 5CHCB 4LR8A 2A3JA 2IPOB 4ZVUB 2CQBA 2K2PA 4WFNQ 3R1LA 1EJ7L 4HDGA 1TUVA 4KYZA 5JXSA 2CQ1A 4RBTA 1Y4ZB 5LOQA 3BGFA 4DFKA 2ATCB 1YSJA 5L9XA 4CLUA 4UOGA 4E8UA 2KZMA 3LP0B 3K57A 2JNJA 4O44B 4AT1B 2ASJA 3VAFA 3SDEA 2C42A 3EICA 4LBHA 2DNHA 3QBCA 4USTA 3LP2A 4DX7A 2Y8WA 2IVFB 1RBLA 3ZTPA 3SZ2A 1C0UB 4D3GA 3ZZYA 4OLPA 1BGXT 3PX0A 1I5OB 1U6ZA 1S57A 2Q6CA 3CD5A 1C0TA 1F3VA 4LF8F 4J9RA 2K1RB 2CQHA 3J81j 5FJ4A 4NLRA 2XWYA 2OKQA 5KFKA 4Q2MA 3MR5A 4Q43A 3PTWA 3I0RA 1FA0A 3I87A 2G0JA 2QLWA 4DV1F 1F9FA 3MD3A 1M5KC 2CG8A 4P10A 1PILA 4J9KA 4HL9A 2DIVA 3MMJA 3QSYB 2E7XA 4C3LA 3QMQA 5SZTA 3MM8B 5JMNA 1SKWA 3SEOA 3NP5A 1RAHB 2M7SA 3AFGA 2VPXB 3NRBA 1QSSA 4LVNP 2MGZA 3M4XA 3AQOA 2NXNA 1SL0A 1NNDA 5D3GA 1J27A 1EB0A 4K5RA 3MXHP 2NYHA 1BQMB 4CIOA 3L7OA 1CJTA 2XO6A 2DY1A 1YZ7A 1HYSB 4LF8J 1AFIA 2AJ0A 1C1BA 3HM9A 2W9BB 3D5MA 1G2EA 2FJVA 3GFYA 2Z2YB 3GG0A 1X4AA 4RL1A 2GMJA 2J0QD 3R5DA 4F8RA 1WSVA 4DV1J 4LRBA 2MLYA 2OTLS 1RHUB 2AEJA 3BS9A 5DDPC 2WW4A 3M05A 1SJFA 2R7SA 2G9OA 1VHIA 3HHEA 2VG5A 4W92B 4O4RA 2C2ZB 3LH2S 2CJ9A 4F3OA 2MSSA 5B09A 4OI1A 2ZD1B 4C11A 4RNHA 1WKLA 1UFLA 1LWCA 3CE8A 2EEYA 4QPXA 1VFJA 3GB0A 4I1TA 1M5SA 1URNA 2YWWA 4XDDA 1FNXH 3UWTA 1YWXA 2XMVA 3OVBA 3K59A 1OYEA 3UN5A 3QJLA 2C2NA 3BQ1A 3RBXA 4L3KA 2E29A 2WCXA 1NU4A 1IM4A 4PWUA 4DL3A 3EUNA 4PUOB 5CA5A 4YS2A 1OQ3A 4HACA 4ES3A 3QZ8A 2GAGC 4ILRA 2H4WB 3I82A 2QA4S 3C15B 1SH3A 3V6DA 1D8YA 3HZGA 2AQ4A 3GIRA 5KAKA 3HKZD 2DRAA 1FXRA 4IOBA 2ALYB 1NJIT 2UXCF 4X65F 3JQJA 1NK9A 5M2PA 3P5TL 4P6QA 3N6MA 4ZVOB 3TUPA 2DYAA 1S1XA 3RAMA 4DUTA 1KRPA 2UP1A 4CLSA 5KOXA 2VQEJ 2UXDF 1V6HA 1AUDA 2MY8A 4PXEA 1LFPA 2ZVIA 2EWHA 2IRYA 3IP0A 1ACMB 2G2OA 5H9FK 5KG6A 2FJXA 2YWGA 2CQ3A 1X60A 2PMZD 2CVIA 1FE4A 1VBKA 1SUQA 5I3UB 3T5HA 1MWYA 2XI2A 8ATCB 2YX7A 3AJDA 3LA0A 2POKA 3VAGA 2CQ4A 4U6PA 4XK8C 4ED3A 3DM2A 1TFYA 2GCFA 4HHJA 1HL6A 1N48A 2RS2A 5CYQB 4RNMA 5KFLA 1S6QB 4IO1A 4G1QA 1AZSA 1UJ5A 1P27B 1RWMB 1KTVA 2QLJB 4N77A 4RNFA 2OD6A 4NXMF 1DQAA 4UOHA 2MQQA 1P1LA 2BKPA 4RBVA 4DR5J 2FHMA 4EFAC 4OHWA 4WIIA 3ZNJ1 4TY8A 2UXCJ 1UEVA 1S97A 4X65J 3RBZA 4YEAA 2J9CA 1LWEB 4DL5A 4USIA 4LSNA 3TW0A 3NWRA 3T1YJ 1T7PA 2PIIA 2DNOA 2YPYA 3QO9B 2EC0A 3RB3A 4DSIA 3BKUA 2UXDJ 2HAFA 1WG1A 3V6KA 2R7OA 2C1EB 2XLJA 1RUSA 2WVCA 3EWGA 1IR2A 1PYOB 2FIUA 4UQGA 4YHHF 4ZPAA 1N32F 4PXDA 2FJDB 3A1YG 2GHPA 1KVIA 5IM0A 3TZYA 1Y9OA 1D9FA 2OO4A 3KMQA 1SJ1A 4KGXB 3HFZB 1UVKA 4IUFA 3MCOA 4AFFA 3LAMA 4UTGA 2HAIA 3PDNA 1YJUA 5IOLA 3SFUA 1AUSL 4IOAQ 4DPYA 4NXMJ 4F25A 1O0PA 3V4MA 5J2MA 4ZN3A 3D1HA 2Y0SD 3EXYA 4M63A 1WEZA 1Y3JA 1NK8A 4NASA 3ZZRA 4I0WA 3GYNA 1WG4A 4YP3A 3D28A 2XCPA 3HSDA 2BJ8A 2BKOA 4U96A 5KG5A 4LR7A 2YNGB 5LSLA 3KLFB 1XNQF 2PD1A 4P2SA 2OIHA 4CLTA 1NK5A 1O5JA 2BZ2A 5J1EB 4ZJQA 4ICLB 4YHHJ 4LIWA 3RW7A 2EFNA 5L39A 1N32J 1S6PA 1Y0HA 2L41A 4ED5A 2W8KA 2MQMA 1HBMB 3CXCR 4DSKA 4NI2A 4JI3F 2VJVA 4U8VA 1VRUB 2W7PA 1ZTWA 2F4VF 4ES2A 1TV6A 4HLBA 2OPPA 2DT9A 3T5LA 4WTYA 1RAGB 2BMBA 1W2BR 4DV2F 1XQIA 3TYTA 5MAOA 4WF9Q 1TUGB 3KOAA 4ZHRA 2DIUA 5H9EK 2ZH7A 3UO0A 1A7GE 1PYSB 4GVBA 2KVQE 2YKMB 3KLGA 1U47A 1TL3B 4ZVHA 1OS5A 3C46A 1TL5A 1WUUA 2HLUA 3AHPA 3VCDA 4H54A 3QJPA 4KAIA 3OL9A 3E01A 4OQJA 1N5YB 1N4LA 1HBOA 3OVAA 4WK3A 1NSQA 2AEMA 3LGNA 4CO3A 3DDIA 1GMVA 2ZBQA 2VIHA 4ZLLA 5HMYA 4JI3J 3IR5B 2Y3YA 3SCKE 3BO4A 1KNZA 4LBPA 2RUGA 4HHUA 1S0OA 3EGZA 2V6AA 2XSJA 4CO1A 2RT3A 1NRKA 3KG0A 5D6GA 3TQ1A 4X4OA 1RTHA 4PYDA 4JI7J 3BGUA 4ECUA 4MIWA 4DV2J 1C2PA 2Y1IA 3EXCX 4QWAA 2M3DA 1R0BG 3OR2B 4XTTA 5M2UA 1A9NB 2MPUA 2JC0A 2HQDA 3G8QA 1X9WA 2VF3A 2WK4A 1AROP 1QAYA 3PW7A 1IKVB 1LNQA 2P9GA 2IA0A 3QPIA 2MHNA 1HIYA 3J7Z5 2CNKB 1ZH5A 4A8MP 1T03A 4C0OC 2XQCA 2FLPA 3GQCA 5IT9U 3F0NA 2QLXA 5KG7A 2B5JB 4KFBB 4N47A 4RUAA 2Z2MA 3W61A 4MFBA 3BO2A 3ZZPA 1VQ8S 3NLCA 1N6QA 3LAKA 2KRBA 3I0SA 4LFBF 1LW0A 4MAKA 4C48A 1GX5A 2LYVA 1JLQA 3KK3B 4RBUA 4C8OA 2D7SA 1EX8A 3MAAB 4F04B 3H90A 1T3NA 3TVKA 2L3MA 1FRHA 5FLXY 1Q8BA 3MR7A 4I2PA 3GR0A 3ENVA 1Q8IA 2DR9A 4MT1A 1D09B 1APSA 3ADAC 2DNNA 5HK4A 2GIFA 2PEBA 1T9YA 2IYIA 4WFYA 1XMBA 3C6TA 4OZ3A 1S59A 1JNZB 3LO3A 4F3MA 4H4MA 3SCLE 5HJXA 1RWPB 3LALA 2DR8A 1W2IA 2AJQA 4CLLA 4O3NA 3GTYX 2H5JB 4ZPBA 1J2VA 3UD3P 5ETQA 5A0YB 4Q44A 1VI7A 1RHKB 2QT7A 2KTQA 4NLYA 2ZWPA 4R5PB 3GILA 3OD2A 3W2VA 3H4BA 2ZITA 4TVAB 1TL7B 2AX1A 4IFYA 4QQBA 4B9TA 1WSRA 4OYXA 1FD8A 1QAXA 3OW2R 4LF9F 3GV7B 2HGLA 4K4WA 4LFBJ 1R8CA 2VB6A 1PKUA 2M9KA 5DQHA 3CCWA 1D8ZA 5CZXA 2F8HA 5G0RA 4J91A 1YBTA 4UUWA 4PR6A 5KT2A 1T0TV 1NPRA 3CCTA 1F9HA 1KDNA 1KQSR 3ZTQA 1TKTB 1W25A 3EYZA 2BJ3A 1U1LA 4JP8A 1VS3A 4G1PA 2DGWA 2FJEB 4AL7A 4CQ1A 3FBCA 2MY7A 3N4WA 4DX8H 2DH7A 3Q8UA 4DPWA 5D78A 2HRUA 3LP0A 3LTOA 4WWSA 3ET6A 3KNGA 2W4CA 3DRRA 1F0XA 2KKHA 2NXCA 4J7CA 2LXFA 4U8YA 4PRFA 2LU2A 2P6TA 1FCAA 5DQIA 4PWDA 4LF9J 1RCXB 4NMLA 1C0UA 1HMVB 5BJRA 4PWWA 1AFJA 3PRDA 3BSAA 3PX4A 3BBFA 3GIIA 1ZM2A 1JIHA 2X3GA 4GC7A 4OI4A 1WG5A 5E2QA 1OY9A 2PSZA 5DM6Q 3KYLA 3UI3A 2RRBA 4J5OA 2E9ZA 1FNMA 3BBBA 1H98A 4DXLA 1FWLA 2RHSB 1ZPVA 4TQRA 5AE3A 3DXBA 3NBPB 2HHVA 4WE1A 3BGOP 3MM5B 4Q45A 2RD5C 5B0FA 3KG4A 1C4CA 4NZ7A 2VG7B 5JJBA 3M8PB 3VF0B 3CMQA 4DR1F 3OQ2A 2QEXS 1U0HA 3SBMA 1WHVA 1YJNS 3H42A 2QA1A 2HNDB 2J0SD 2X7IA 1FVSA 2VODA 4EZ9A 3CGIA 5KFDA 2I1RA 5KFBA 3MM8A 3G6VA 3D66A 1EIYB 2UUWA 2R7TA 4FPIA 2FPHX 3TJAA 4GMKA 1NK7A 4WIQA 4MMOA 1U2RA 3KJNB 3AXKA 4ZJLA 1MMDA 4OLOA 2VONA 2YVSA 1L5UA 2FJBB 1JLCB 4NZ6A 5LMUF 3WX8A 4PABA 2A0FB 3TZWA 2VG6B 4XAKA 2D3ZA 4DV5F 4F0KA 4FYWB 4DSFA 3K5PA 2EW9A 2I2YA 3K58A 5J2PA 2HZAA 3DLBA 1ZETA 3U1LA 2XMWA 2ZH1A 2O66A 3PJWA 4B9NA 5C25B 4PQAA 2BW2A 3TNVA 1FEEA 3PYDA 2E1PA 4OX9J 1IQTA 4F0MA 3MAHA 4I69A 2WVEA 1M0SA 3O1LA 3CSKA 2YKPA 3H25A 3HSZA 1NHUA 1SB6A 2WB1D 3O6QA 3E8OA 2P5VA 1T05B 4YDDB 2ADCA 3CB4A 2HW3A 1ELOA 3K8WA 3QT5A 4P7VA 4IR1A 5KFGA 1LXJA 4UW2A 4EGLA 4TU8A 5GMDA 3AH6A 1Q1KA 4FPRA 4PYAA 1HWJA 4BWJA 3M32A 5K14B 3EMTA 1MSWD 2HFUA 1K47A 3LGHA 5LMUJ 1ZYQA 2NXJA 3HHLD 1QD1A 1S77D 2MKIA 2OMLA 2MKYA 1B99A 4DV5J 4RUHA 1UZDA 5JUMA 1Q7YT 2NREA 2WTFA 2R7UA 2ZC3A 1FK9A 5KTQA 3MMAB 3SQOP 4IYQA 1RYSA 3J7YI 4V1Ak 2X1GA 1NKEA 1JLAA 1TQLA 1RKJA 4FKYA 2QYGA 2ZHOA 5HROB 4OZLA 4ANDA 4R25A 1REVB 5B0EA 3DKDA 2YX4A 5HQ8A 3MPYA 3NS6A 2O01C 2B4VA 4M5DB 3H0PA 4I67A 2GVDB 5E3PA 1M1HA 4A8SA 3T41A 2VU5A 3T5JA 3Q22A 1OQ6A 3KHGA 3ULHA 1PGZA 3U7JA 5GAGU 3HPOA 4ZA1A 4ZVRB 3Q8QB 2MZ1A 1UEKA 1Q5YA 2IIHA 2Q66A 5D77A 1MWQA 1KSPA 3H5YA 4C97A 2JHEA 4ZP8A 1FDBA 4ZPDA 1DLOB 4IDKB 5CYQA 2UV8G 2O3DA 4X4PA 3HHLA 5GVQA 2N82B 2Q1LA 5J1NA 4PG7A 2F9JA 3T19A 3GCWP 3R8YA 3H59A 4P7TA 2FC8A 2N3LA 2WHOA 2BJDA 2VKRA 2AYGA 3IGNA 4BDPA 3PYFA 3WHIA 4E98A 2ZDOA 2J7UA 3I4HX 1NDCA 4JI0J 2VOPA 4EU0A 3FEXB 5BYRA 2J5AA 3CCQS 3OTEA 2I5JB 2ILZA 1R43A 1J5EF 2PE8A 3DNCA 2HHSA 4K7QA 4A8FA 4NZ0A 3FKBA 2ZOGA 2UVRA 4KR0B 2VBWA 1FRMA 3A12A 4ECVA 1VBXA 2Y1RI 2DO4A 2M52A 2Y0BB 4Y0FA 3R2CJ 4FNIA 3MM7A 3VTIA 4QOTA 1DURA 4CYUA 5D0RA 4ZOSA 2E5LF 2W25A 1ZA1B 2JH3A 2OGUA 1KS2A 2AU0A 2FGCA 4EO6A 2YKOA 3W1YC 1UAWA 3TQEA 1NB7A 2EG2A 1NSKL 1TAUA 1PAUB 2UVWA 2KN4A 3IWNC 1HBUB 2RILA 3BM7A 3L95X 3UD4P 3EZUA 5A76A 3F44A 2OLWA 3D4JA 3HDSA 2HLTA 1S5ZA 4WKYA 3M30A 3TAPA 1GX6A 1NJYA 6FD1A 3G6YA 4ZN1A 3FQLA 2G0IA 3D68A 4IH7A 2F8EX 3UDCA 1VQLS 3AAWB 2C2RA 2YNFB 1WHWA 2P2CB 4C0HA 1CSJA 2N4CA 3IS9B 5KFZA 1BY9A 2B8QA 4F4ZA 1RT4B 2DHXA 1HWLA 2E5LJ 2XS2A 2V9KA 3FC9A 3M6UA 3CCJS 1X5OA 2JRSA 1JLFA 2B3TB 5L38A 2YNIB 3L3CA 3P45B 3DLHA 1Q7LB 3GYGA 3IM9A 3PACA 5KFPA 1Z2ZA 1EP4B 4WFAQ 3EE3A 2C2DA 1LFWA 1X4CA 1FRKA 2RKIB 2AZ1A 1YJVA 2XC9A 3MEEB 3AD9C 3TX8A 2YKMA 4URQU 3RUBL 4HT5A 2R9LA 5B7WA 3FQKA 4LRAA 2LU1A 4GO5X 5HMXA 4NA3A 2CNLB 4DBQA 1VQ6S 2HHQA 4N76A 4WU2A 1ITPA 1TMMA 3P3DA 4C4WA 4UOFA 1BLUA 2EK1A 4UQTA 3NGSA 1S1WA 4EK2A 2MLZA 1RU1A 3OSPA 1VRTA 3I5CA 4ZLJA 1RT5B 2I0XA 3D54A 2AWZA 1UW4A 4C8KA 3UW1A 3AOCA 5KT4A 4F7VA 1EKRA 1RYRA 2HPUA 3KLEB 4ZMMA 3NWGA 4H4OA 4GC6A 1WC3A 4GKJF 2BE2B 2XMAA 2GFFA 3GG1A 1CPZA 4RJVA 2RVJA 3KWMA 4PG4A 4LBIA 2MTLA 1P1TA 2VA3A 1IKXB 2FUG9 2HWIA 3SIPB 2G0CA 1BUXA 1UA1A 2P6SA 4ID5B 4KKOA 2UUCF 2J0XA 1C1CA 1VQPS 2IC3B 4F4AA 3D0HE 1RISA 3A3PB 3DU5A 1QAIA 1MROA 2RQKA 1IKVA 2HRYA 1GMWD 2D74B 2ZZNA 1HNIB 4QIGA 1IBKF 1JJHA 3C6UA 5EWGA 1HQUB 3P49B 3JYTB 2K3KA 3SSSA 3NEKA 4B9UA 2G1DA 3UN3A 2X1FA 4C8LA 1CJVA 4DI6A 2GX8A 3MEDA 1Y3KA 3OBIA 3R9LA 1WDDA 2V8HA 5A8WA 3CC2S 4ZVGA 2E1AA 4RZRA 1NUEA 2GA7A 2VUGA 4GKJJ 1Q0NA 3PX6A 1KEKA 4WZMA 5ETMA 2DNYA 1VR6A 4LSLA 2ADBA 1JJ4A 3MMCA 1TZ0A 5CXTA 2UUCJ 1B4SA 4OZNA 1IKYB 3HJVA 4DR2F 1YBUA 3CNQP 2V2ZA 1BQNA 3V4IA 4EBDA 2F65A 2J9DA 5A8KB 1YJWS 4JI2J 1KLMB 1K8AT 2V50A 4ZPVR 3S6EA 5KFOA 2G4BA 1S1UA 1IKWA 4F2SA 4DUZF 3E51A 3JAMU 4HR2A 5IT9Y 2WOMA 3AOBA 1IBKJ 4C0BA 1VQMS 3EJMA 2AJ1A 5T14A 2L9NA 3R6LB 2MZRA 1GMWA 1FX4A 1W26A 2CAJA 2NLWA 4R5PA 3CD7A 1SJRA 5J2QA 1PSDA 5LXYA 3A8JA 5H1SV 1NKBA 3H8YA 2CXEA 4C7QA 5HP1B 2WBRA 4YOEA 1RT7B 2ZH6A 4DCPB 3FDSA 4TYAA 1IBLF 2UV8A 3H20A 3DLGB 2D3OR 1HQEB 2VA2A 3LPYA 1J5OB 2X3DA 3KJVA 1UFKA 4DUZJ 4F4YA 1TU0B 4ED4A 3PO4A 7FDRA 3LANA 4PG8A 4RU2A 1X5TA 4JI5F 5KFJA 2XS7A 1CG2A 1CJKA 4EYIB 3ZZZA 2XZWA 3IWLA 2NZ4A 1RAIB 2OFGX 4PAAA 4B3OA 2BANB 3LP1A 3X1LB 3ZC4A 1N33J 2LP4A 2CPIA 4MK8A 3K17A 1SQFA 3D2WA 1TMJA 4DV7J 3RAQA 3R5JB 2N4DA 3ZZTA 3DMJA 3W8PA 2R4FA 1NAQA 3MTKA 1BWVA 4ETXA 3N28A 3IR6B 3I56S 1ZZFA 3KLHB 3AJ1A 1UMJA 4UUXA 4KJIA 1YGYA 1KHVA 2YWHA 2LXIA 1X0FA 4FF4A 2JVOA 5HAOA 4P2XA 1H7XA 4JI1F 1BD6A 3DGPA 2QMUB 1BQXA 4ZKAA 2EFQA 1XERA 3TAMA 4NEZA 2ZE2B 3I4PA 2JVRA 3A4TA 3H40A 2OJ3A 2E5JA 4JI5J 4DLGA 2IAJB 2E9TA 3G9CA 3MGJA 4WP8A 4O0NA 1MN9A 1FX2A 2BKNA 3RB6A 2YKNB 3KUEA 5K8PA 3MD1A 5HSPA 5G4DA 1U1MA 4CTAA 3DLEA 3C16A 3D6TB 2KXFA 2GIQA 4GO7X 2R8IA 1JLCA 1QJHA 1TUWA 2Y8YA 3EPIA 2CDQA 5EDWA 3MR3A 2H1YA 4NL5A 3GWCA 2VG6A 4UOCA 3GFZA 1N5QA 2CUYA 1TELA 1FNOA 1MN7A 5KFSA 3HVWA 4OYAA 1I94F 3DRPA 3QWUA 2XY6A 4DFPA 3KJFB 4GVLA 2QL5B 3D67A 4DSLA 4DR7J 4KPYA 4BHQA 5EWEA 2ZH3A 1R0AA 1Z1ZA 1YLXA 5FDLA 3O8WA 4FVCA 1W7WA 1CC8A 1VYAA 3ICLA 2HHWA 3BF4A 4U7UK 2OAUA 3CTRA 5HO4A 3DRSA 3LOUA 3M8SA 2NPIA 4NX9A 2V8GA 5DS7A 3PJXA 1ZAXA 1E6YA 3RTVA 2V94A 4F4XA 3CO9A 5BYSA 2GQQA 3GIJA 3GPAA 2NYIA 3SQGB 4DV3F 2HQCA 2R2UA 4RW4B 3QFHA 2HS0A 5D4LA 2YY3A 1YJ9S 3T9ZA 1SKRA 1SJ3P 2CA9A 2MZQA 3RRKA 5IS2A 2E5HA 2CJXB 4Q7AA 2Z2LA 5EHHA 3DOLA 1I94J 4OI0A 2ZH9A 2A6MA 9RUBA 3SCIE 1RWUA 3KTQA 3TVZA 3KKFA 1IJEB 4DX5A 3VAHA 1Q95G 4FYYB 3NNAA 2OPQB 5IWAF 4N5SA 3KK1A 1S76D 4X4NA 2DHAA 1RT1A 2CZ4A 1DTQB 3M6XA 4K4UA 1DBDA 1OWXA 1REVA 4PQUA 1R3NA 1YRUA 4KY3A 4H4KA 3NMAA 3UVJB 3OUYA 1HWIA 1K0TA 3PW2A 3GZ7A 5IC6B 1JLGB 2OPSA 3CMAS 3C2PA 2XZTB 2H48B 2OEJA 3MM6A 5DLFA 3PR4A 1RDRA 2PMHA 2Q79A 3VGUA 2B6AA 2FZCB 1KVKA 5A8RA 3JXOA 3CT9A 3LUYA 2VDIA 9ATCB 2HVDA 2ZEJA 2GIRA 1GMUA 2XMUA 3CCLS 4WFXA 2MZJA 2OPRB 1RCOB 1YIJS 1N0UA 3FFIB 3MECB 4CO4A 5K8MA 2VHGA 1N8RT 4BLGA 4WXWA 1RTZA 3PV8A 4IOCQ 4JUZA 5KG2A 1SC6A 2GHWA 5GMEA 3M1VA 3OSNA 5IWAJ 1RI7A 2ALZA 2MZTA 1DQ8A 2CJYB 2PO4A 2FVCA 4IH5A 1IBMF 2HVHA 3RG6A 3K7RA 2LQ9A 2HNYA 2J9DE 2I5JA 4ZIVA 2CPFA 5CCLA 1TKZB 4K4SA 1R8AA 1YKWA 1G4CA 4M5IA 1RTIA 1D9DA 2R2RA 1ZS6A 3CJKA 1UKUA 2F1FA 3RYLA 3N0VA 2QC3A 1FTRA 1R0CB 1MLAA 5I42A 5E41A 1RTJA 5E3CA 2HS4A 3TEGA 3MMBA 4JV1A 3TA1A 4P73A 4ECRA 3H2VE 2WSEC 3JSRA 4LF7F 3M2RB 2VD3A 4EZ6A 1NMEB 1HPZB 2RH3A 1Z2LA 3PFOA 4DV4F 2HWHA 3JTNA 2CNNB 4C2MA 4OHXA 4OX8A 2HFNA 1WORA 3IAM9 5E0OA 4KHRA 4ILLA 3M2VB 3J7A1 2HBYB 1KHWA 3M9OB 1FFGB 3BKFA 3KK2B 4L75A 1IVZA 4XO0A 4IG0A 1VGYA 1JWWA 1FJ7A 4I6WA 2XO7A 1S79A 3MEGA 5A2QU 4A8KA 2KB2A 1S9FA 3N6LA 1FRJA 3FSIA 1SH0A 3TAQA 2NS1B 2A2DA 2XY5A 2LKZA 4CO5A 4PKDB 2AW0A 2DRDA 2UUBF 1S4FA 2J6UA 2MMYA 3PYGA 4Y2MA 2CQPA 4Q0BA 5J2NA 4RW7A 4X4SA 3DOKB 4WXOA 4NYPA 1UL3A 3C3LA 4LF7J 2AMCB 1RT4A 2V2VA 4DV4J 1LXNA 4IQMA 5F8IA 5L1KA 1IXKA 4I56A 1X4BA 3OTBA 1VISA 5HVFA 2GC8A 2DNGA 4O4GA 1FDDA 4QIVA 3OJSA 2F7VA 1FKPB 2XHCA 3Q8VA 3QLHB 1ZTTA 5D15A 3OR1B 5L8RC 4B9LA 1HARA 4B9SA 4E0DA 3Q83A 5KG1A 4X64F 3RB0A 2E1RA 4Y2AA 2C3MA 1HWKA 4ZVQB 1HLWA 3C14A 2GJIA 3GFXA 1VQNS 2CJAA 3W65A 3CJ0A 1NPKA 3GONA 2UUBJ 1H7WA 4Y28C 2AZ3A 5KFNA 2RDIA 1XR5A 2EBEA 3IXQA 5IT4A 1CS4B 2W9CA 2BABA 4OHVA 2ASLA 3QGGA 3GIMA 1KQGB 1Q81T 4FBTA 3TZZA 4NRUA 4B9VA 3EDRB 2JEFA 3AB4B 3HD1A 2CQCA 3QGPA 2WVFA 2OMOA 3T6BA 4OL8A 2BQ3A 4YUDA 2CZVC 1JLBB 3CC7S 2BE2A 5LT5A 4FZVA 1VC5A 4RW6B 2CPHA 3M9NB 2CRLA 1H38A 1UJ6A 1IKXA 3DLKA 3PW4A 4O3QA 2XULA 3C8YA 1SL2A 2CPZA 1JJCB 2F3JA 4X64J 2ZM6F 3IFEA 5M2RA 1KFDA 2ZZMA 2IC3A 2KXNB 2WW8A 2AHOB 2BM1A 1UVJA 5T7LB 4DG1A 4RNOA 4Y3CA 1T94A 2AV5A 3J7ZT 1FWPA 1VQSA 5FD1A 1ZZNA 2C28A 3PM9A 4DQSA 3V2UC 4DPTA 2VPWB 4YY3J 2JFKA 2LDIA 5KFTA 2GQ2A 4JYAJ 5DQGA 2C3UA 2UXBF 3VAMA 2R7VA 3CCZA 3IR7B 3KXDA 4OJHA 4U7CA 1AA1B 2VFRA 1VBYA 1RXOB 5KFAA 3QATA 3KLIA 1KD1T 2ZM6J 1S12A 4NCGB 4OYZA 2UU9F 3MOZA 1JLEB 2UUAF 2VBXA 1KLMA 3EX7B 3BR8A 1SC3B 3ISND 4K4ZA 3QRPA 3WX4A 4QWCA 3CVKA 1KFSA 1R27B 2H51B 3FSYA 3QFWA 1YZ6A 4ZPWR 4W98A 4DX6A 4V19X 2QRRA 2HMIB 2BQUA 1R89A 1S6OA 4WPAA 3IG1A 5AXLA 1XN9A 4I4BA 2B7BB 3HD2A 5CYMA 4I7FA 5CZVA 2W9AA 5EX3A 1C4AA 1GH8A 1Z4UA 1S10A 3NCQA 2DITA 4ZIWA 1NDKA 3BYPA 2UXBJ 1YRXA 5HP1A 3FMWA 5DETA 4YR0A 3DGVA 4NLQA 5AXKA 3JSMA 3G82A 1RAJA 3W2WA 4I6YA 1V3ZA 4RNNA 1JMTA 4FS2A 2G1HA 4LF4J 3G6XA 1SV5B 5LMNF 1CJUB 2WONA 3FCHA 2UUAJ 1URRA 1YJRA 4LQ9A 2AIRB 3UFCX 1GXLA 4OZ5A 3QJJA 4AL5A 2BOAA 1V3SA 2LMIA 3DHXA 1S1TB 1N0VC 2IJNA 3UN2A 1PJ7A 2HNZB 2DGQA 2GV1A 2V2KA 1KOHA 4RW8B 4ED1A 2DNZA 5HLFB 4PCQA 2G13A 5B08A 1IN0A 1X4HA 1X31C 3MR2A 3OPKA 3CPWR 4CNYA 2F40A 1S1VA 1DTTA 3MFIA 1RAFB 2XY7A 1Q78A 3JTPA 2NUUG 5AXNA 2ZOFA 1UEUA 3ENAA 4Z2XA 4DLEA 3I31A 4IFVB 4DV6F 3J80U 4RW9B 1RU2A 2MDAA 4IO9Q 2NR0A 4HTIA 1WKKA 1RT6A 4WKRA 3OLBA 4CT9A 4CLFA 2GW8A 1O6XA 1FVQA 4HDHA 5LMNJ 1LW2B 3V81B 3IRXA 1RACB 1LOUA 2OSQA 4RWWA 1EHWA 4M5LA 3POTA 1TK8A 3HO1A 3M8QB 1VJWA 2CDRB 1CLFA 2E7WA 4L74A 4JB8B 3TJ9A 4FYDA 1NO8A 3PHTA 4XPCA 3P5BP 2BRLA 1UETA 4I2QA 4PEOA 2DEIA 3FBFA 2QGFB 4DF8A 2XWXA 5U47A 3E3XA 4FP9A 4DJBA 5HVHA 4KRWA 3NMRA 1HNVB 1U6BA 2YNHA 4ETZA 1S9EB 1TP7A 4DV6J 2N7YA 2D3UA 5GAHU 4L72B 3TUJC 3W5ZA 2PI4A 3R6GB 3C66A 4O0IA 4M94A 3WBZA 4A48A 3I9ZA 5LL6d 3IAS9 3KHRA 5IFMA 4C3MA 3SDEB 3K89A 4Y6IA 4ZK7M 2IM2A 3LP2B 2QMXA 4KTQA 4CLWA 2I6WA 2ROPA 1RWOB 5F0WA 3H2LA 3GCXP 2DHGA 4UY85 2RU9A 2VQEF 3TVYA 2A1BA 5KFMA 1C0TB 1SVDA 1HI0P 1ZA2B 1Y00A 1FRXA 2LA6A 1RADB 2ZZTA 2IM0A 3QAEA 3ONQA 3K0JA 3I0RB 5HBMA 3CDAA 3VAJA 5LSRA 3CCRS 4ZLPA 3HK2A 3BH6B 2KRRA 4OYPA 1NB2A 1VK8A 4R0JA 4MIBA 3G8SA 1L3TA 3H5SA 5GAEI 2VICA 1NDPA 3B4MA 2BDPA 4QWEA 3D6MB 5F9NA 2PMWA 3QT7A 3AODA 1XIQA 2MB0B 4CZCA 4I6AA 4DR5F 1UVMA 2QG9B 3EM1A 1MMLA 4LT6A 4ZVSB 1U25A 5LJ3Y 1FDNA 4LIRA 3T1YF 2ZVSA 5D3GB 1TAQA 3HSJA 2JEIA 3PVXA 2AT1B 3IRWP 2I9SA 2DB1A 4LMZA 2P8IA 1CJTB 4O3RA 4M5MA 2I38A 1JLGA 1C1BB 1IWGA 2Z4PA 3D6FB 4KC5A 3SYZA 1RQ0A 4KPCA 4KGMA 2W24A 4TLRA 5ETKA 2MKJA 3CCSS 1GTEA 2K3IA 3B6BA 3K5OA 2V4JA 2VG5B 1RHMB 1FJCA 3PJ9A 4DPUA 4FXVA 3GYXB 2CJQA 1RT2A 1YITS 1LWCB 3OTDA 3CDEA 1HWUA 2RDDA 2VFVA 4Y2CA 2EFVA 4CDIA 3TWZA 3BKTA 2KO1A 1OY8A 2CQDA 2EI5A 4NA1A 4OX6A 2NSCA 4CLKA 4DS4A 2XYGB 4QW9A 3MFHA 4ELUA 3CJ4A 2RJZA 2QJ3A 4F02A 5KG0A 1N52B 5AXMA 2M8HA 3EZOA 3DDKA 1HBNA 2XEXA 3GIKA 2D9PA 5DLGA 3GLJA 1H6KX 1X8DA 2PA8D 1HW9A 4HACB 4QJVA 1WTFA 4GRSA 5L1JA 1YVFA 3QQCD 3V6DB 5AT1B 4DR3J 5L46A 3CJ2A 3D3BJ 2BJ7A 3W9IA 4F2RA 2DGSA 4EMDA 2B9WA 2R8KA 1JXVA 1S6UA 2QE5A 4JI4F 4PXBA 1Y5IB 5KT5A 4O3OA 3H98A 1JKHA 1H74A 3W64A 1B70B 1YG0A 2D69A 2V5HG 1S1XB 4U9RA 2WVBA 4Y00A 4JI8J 2KH9A 1Q8KA 3VGSA 1RAOA 3PYEA 1FKOA 4Z37A 5DM7Q 4UZBA 3KK2A 1T3OA 1F1BB 1SUQB 2HBQB 1KR4A 1ZM4A 3HVTA 2HGNA 5AJ3J 2DGTA 1PJ6A 3NGUA 2B9XA 5L1LA 1X9MA 2B7CB 4JOUA 3Q8SB 4R8UA 4TY9A 3G2XA 4Y65A 1CEZA 2FZGB 2RUSA 4F4KA 3N01A 4M5KA 4G1QB 1AZSB 2DKOB 3GJTB 4QWBA 5GADI 1WC0A 4ID8A 1RWNB 2B56A 2JFDA 2CQIA 1RLDA 2JJ4D 4K0KF 4TY8B 4JI4J 4ZVEA 5EGYA 2FLNA 2AKWB 2YWFA 2WSCC 1UWBA 4L76A 4LSNB 2PT0A 1ZAVA 4QIFA 3I5BA 2HSEB 1TKXA 3HFVA 4DSJA 4NCAA 1P9QC 3WIVA 2KG1A 4JI7F 2LQJA 1TL1A 3NS7B 3CCUS 3VZHA 1RT3A 1XMOF 2FZKB 2LEAA 4LFAF 5A2QY 5ETVA 4N56A 2DEJA 5F8NA 1L3VA 2FYXA 1WC4A 4X2BA 4QIEA 5JVGQ 1YDLA 1QUPA 5B0GA 3EVMA 2R42A 4EUVA 4P71A 1KQKA 4M5GA 3TANA 1H2TZ 2DVIA 3HVRA 3M6WA 2O1PA 2Q6BA 1U8SA 4JBCA 1E6VA 5HL7Q 4FYVB 4KO0A 2AJFE 3PO5A 1F2HA 4IG3A 4KGKA 3GR1A 4HH1A 3Q2TC 2PA3A 4K0KJ 3R5GA 4ZCMA 5H9FJ 2ZKUA 2N3OA 1DY3A 4K4YA 1XK8A 4A47A 1UZHA 1JNRB 2ROEA 3M2UB 1F9EB 5HQMA 2MQ8A 2B9YA 1YK9A 5DG7A 1JLBA 3LWLA 4CH0S 1RGVA 1KQFB 4DPXA 2YWKA 3OT9A 2EBGA 1XMOJ 5D4OA 4LFAJ 1HI8A 4JV5F 4NLGA 1QE1A 1S6PB 2RQ4A 2KFZA 1EETA 3W66A 4RUCA 1BE4A 1CULA 1CBKA 4QU7A 2YX1A 1U1PA 1NKCA 4NI2B 3AD8C 2KFNA 2YKAA 2AF6A 3HP6A 4OJ3A 1AYEA 1I51B 1RA7A 4ECZA 3FJ2A 2HFZA 3J81U 1TV6B 3ZTRA 1TVRA 2ZNZA 3LF0A 2OPPB 4QZVB 3Q8PB 3NOGA 3PG9A 3BGRB 1S9GB 4AYBD 3T9NA 5B0CA 4PG6A 1LWFA 4OZ1A 4USUA 2JZ5A 1Q16B 2XB2D 4ECTA 4ZHRB 3R97A 1SQGA 1N88A 4GVBB 5CABA 2DCLA 2FVQA 2DXDA 4MYUA 2CPJA 3KLGB 3NOCA 4F50A 2IMWP 2VZ9A 4MKYA 5C24A 3GJRB 2GGPA 4NLTA 1MU2B 1P6TA 1FFSB 3FEZA 5F0UA 3SXLA 1K0VA 4JV5J 4A8WA 3J7YU 3E01B 1RTDB 2GAHC 4YR3A 1CQNA 1GFWB 1HBOB 1VLOA 1YBAA 2XMMA 4G1IA 3KHLA 2QL7B 1JLEA 2MEWA 5CH7B 3MM9A 2KL8A 1WD6A 4RWXA 3ETOA 4P75A 1OJ4A 3LWMA 1VK3A 4BS2A 4XPEA 3RBEA 2XSJB 4ALZA 3UPFA 2ZC4A 3ZTOA 4FF1A 5HANA 5DDQC 1RTHB 1NSAA 4CO2A 1L3SA 3N9UC 1OPZA 1XJWB 4LRFA 2YTCA 3ITHA 1ULRA 3QT8A 3OFFA 3W5YA 2DPIA 1NK4A 2IM1A 2Q3PA 3FZ2A 2KDOA 3M8RA 3DXSX 5C42A 4DL4A 3W63A 1SC1B 4NLPA 3NCRA 3B78A 4G6VB 4P2MA 4ENOA 3UDVA 4ZP6A 3O44A 4MKAA 1O51A 2ZFHA 4RU9A 2EK6A 3TO8A 4ERDA 1QTNB 2R7XA 3OLAA 2D1CA 2DNLA 3AT1B 4OYWA 4N8OA 3OL6A 2E44A 1OYDA 3V5RA 4EBCA 5H9EJ 2CNOB 3VGTA 2ACYA 3MI7X 1V3RA 5LSOA 5B0BA 1S1TA 1KC8T 3CCES 1N6QB 3KG1A 3KDNA 3I0SB 3C19A 3SMZA 2LECA 1NM2A 1LW0B 2Z56B 1VRQC 2HHHJ 4O44A 5LJ5Y 2XI3A 2DXFA 2Y1LB 4X4QA 2HBZB 1PBUA 1EQ0A 3PRVA 4I2PB 2RSQA 4IH6A 2CPEA 2A6OA 1HD0A 3JB9k 4CH1A 3AA9A 4DU7A 5DGBA 4FDFA 2W2NP 3C6TB 3R7SB 4RW9A 2AX0A 4HHHA 3FSXA 1UPMB 4H4MB 4IRDA 2K1RA 2CJBA 4RO0A 2C2KB 3FNNA 3NXZA 3ZFVA 3HLUA 1TR0A 2J7WA 1RHJB 4Y2KA 1PO6A 1LW2A 3QSIA 2E1MC 4OYMA 4NXNF 2X1AA 6AT1B 3QYYA 5I3QA 3GV5B 2OEMA 1Q53A 3W2VB 2IFXA 4OX9F 3ILJA 1Q86T 4IFYB 4ZLNA 4OZ0A 4LVOP 4BC7A 4X4VA 4YN3B 2H65B 3V6HA 1VC6A 1I3OB 3R5AA 1KKHA 1D0EA 4DN0A 4DF4A 2CQGA 4N8NA 1V9OA 3R2DJ 1CVJA 1DHMA 5A6WA 5G0RB 3QRQA 4ZDNA 5ETPA 2KT2A 2BBEA 2YPZA 4NA2A 2CKWA 3MWBA 1HI1A 1N54B 4KIAA 4K8RA 1NXIA 4M8LA 1BQMA 5KT7A 1NH8A 3K8VA 2NXEA 2C2EA 1S9EA 1WACA 5DG9A 1VC0A 1HYSA 1UJ4A 2W9BA 3A3OB 3DN9A 1FEHA 4YDXA 2JWNA 3TJ8A 2E1CA 4S0MA 4NXNJ 1FHTA 4MK7A 3CD0A 3NGRA 3OJUA 3VHQA 1PJ5A 3ET6B 1U0SA 3DRRB 4LUBA 1S7HA 3RB4A 3M7VA 1T11A 4OFZA 4PWDB 1WWHA 2VH7A 1XC9A 1RA6A 3QGIA 2LEPA 3R7BB 1RK8A 4HYKA 2ZD1A 1NPPA 2Z0GA 1WI8A 2GQCA 1VQKS 3IM8A 2QIFA 1K9MT 1U26A 2RQCA 1X7VA 1UWAA 4DEZA 4FBUA 4U95A 2ZWOA 2QA4G 4WE1B 3Q0AA 3HMJG 1GNKA 3RU0A 4PUOA 5KFEA 1WELA 2AYEA 1U0HB 5KG3A 2J7KA 1X4FA 2FC9A 3C15A 4I68A 2NSBA 1QTMA 2I8EA 2HFSA 2ZBCA 2BW7A 3JTOA 1H2VZ 3ZTSA 3RGIA 1FTCA 2HKEA 2HZVA 5D0EA 3TZXA 1K1QA 3UQSA 3HSGA 1WC5A 1O8BA 4HT7A 2XLKA 2XHWA 1XMQF 4CLZA 3FZBA 4JI0F 1V5VA 3VR1A 2XMJA 3DI6B 2BR0A 4MJKA 4X66F 1B0VA 1NCLA 2DJWA 2LEBA 2R8JA 2C3YA 5J2PB 3BPDA 3DRXA 3PNIA 1L3KA 5I3UA 5HMWA 4ER8A 2WBMA 4ZP9A 1TK0A 2K06A 3PIPQ 4F67A 4OJGA 3DLJA 1AT1B 4KSEB 5HJYA 4TLQA 4BWMA 1S6QA 1S48A 2CPYA 4M5HA 3QRRA 5EWFA 4EBEA 4C8YA 3HJFA 2ZJRQ 4OHZA 2AGOA 1U1OA 1KP6A 2DNMA 2ZHAA 1XMQJ 1LWEA 3MUTP 3M32B 3UNGC 3PXGa 5IQQA 3QO9A 4OI6A 4X66J 3FCWA 1NLKL 4ZPCA 3A8KA 3L4BC 1ZM9A 2HK2A 3CCVS 1F2GA 4N7TA 2BVZA 1Y11A 4P9SA 3JSBA 4TQSA 3HF5A 4HKQA 4KH0B 3UR0A 1FK9B 2FHKA 3UD5A 2PDAA 3W3SA 3CEDA 2JDJA 1Y5LB 4U67Q 2QFJA 1JLAB 1VCTA 2NCKL 3WZ0A 4PZVA 2ZDPA 4U7UD 1WEXA 3BBCA 2BJ1A 4MIAA 4NCBA 1K73T 2QV6A 1Q8LA 3TP2A 2DTJA 1LQ9A 1NK6A 4QR1A 3EGNA 4FXWA 1I6JA 2YQ3A 1NHKL 2F9DA 1K44A 5KFVA 2ZJPQ 2FGOA 2YNGA 3CDUA 3ZZ0A 3KLFA 4F36A 4QPTA 3HFKA 1LV5A 2BX6A 1WJ9A 2R7WA 1JK9B 1HFEL 5J1EA 1RWWB 1SJQA 4ICLA 5B0AA 4FN5A 5K8OA 5K9FA 3N5BA 1MWZA 2V8VA 1XEZA 3HHLB 2OEKA 4CCHA 1QY7A 1HBMA 4MKVA 2RRNA 4LF5F 4TNOA 1X5SA 1N56A 1BXNA 2RB7A 2VV5A 1GQEA 4C8MA 1VRUA 1HNXF 3CIMA 3G4SS 5LXRA 1WTBA 4C8NA 1SQEA 1T95A 1NZAA 4QBUA 2CWKA 5F3TA 5I4MA 4RUBA 2U1AA 4FS1A 1HQ2A 2HIYA 2AJ4A 3BGLA 3LGMA 1U6FA 3BN4A 4A8QA 1IWAA 1M5OC 2E66A 1BMQB 2DH9A 3IWXA 2DO0A 2GS8A 3TA2A 4LRDA 4QWDA 1F5AA 1TL3A 3WIUA 3MM7B 3Q23A 2FLOA 1XNRF 4CYUB 4YB7A 4A8XA 1N5YA 3Q8YA 2M70A 3MZIA 2KJVA 3BN7A 3W7BA 3B8HA 3D0GE 4LF5J 5THWA 1T9TA 3VQTA 3R3TA 5E3QA 3RBDA 2DR6A 2R7QA 3WC0A 2XM3A 2O67A 5CYJA 1HNXJ 3M2UA 1YJ7A 4CRJA 1HNZF 4DFJA 2FJWA 2EC2A 4QW8A 4DN9A 1GEHA 4USVA 2GO9A 3S8SA 1NDLA 2EFGA 3KUGA 1WEYA 2VPYB 3HHKA 2ASYA 4WK1A 4C8ZA 4NOHA 4Q5VA 3MPWA 1OIAA 1PIEA 3M30B 2EPIA 2RU3A 3OR2A 4DV0F 4J9NA 2XG8A 3I9V9 1KTQA 5CQGA 1VHFA 2Z8QA 1RWXB 2OH2A 3DLLQ 2FJAB 2QTWA 4JI2F 3HT0A 3AXMA 2IY5B 1PYTA 2OHDA 1XNRJ 3QIPB 1PC4A 2YQ1A 1B0TA 1SKUB 2HIQA 3H2UB 1WOPA 1JLFB 3CJQA 3MTJA 3MF5A 3D1QA 3KUHA 5GAHI 2R2SA 2IA6A 2BOPA 1H73A 1X4EA 3KJQB 2DY9A 1HHQA 2B5JA 4KFBA 3BGRA 1S9GA 2BRKA 2W1BA 5CCMA 4JV2A 4HEA9 3OVSA 3U02A 2BACA 2DRBA 3P6YC 3BQ2A 1HNZJ 2PFFB 1ZOTA 1KLNA 2M2BA 1DJ0A 3OFGA 1SCJB 5KOWA 4ZVTB 3U27A 4BBYA 3ZO7A 2C22A 3CDBA 3KK3A 1V5IB 2YKQA 3PEJA 3QGHA 2R2TA 1XNQJ 2ZOMA 2COLA 3MAAA 4AQYF 4NLVA 3G71S 2AD9A 3G86A 4HH0A 1U1QA 1MU2A 2DR5A 4HI2A 2SXLA 3PZPA 2VPZB 4DV0J 1T9XA 3DCAA 4ELTA 2FY8A 1M90T 2HHTA 1GXUA 2V34A 5DZ7A 1RTDA 2KJWA 3AA8A 1KOOA 3RZAA 1S1WB 5E5NA 2OI2A 1JJ2R 4XDCA 3CULA 1VRTB 2QFIA 1KN6A 1ICEB 5AE1A 4UZCA 1A0OB 1FDAA 5KT6A 4Q8EA 3J81Y 4H4OB 2QSFA 1VQ9S 3GMGA 4J37A 4K5SA 2F4VJ 2DHHA 2VC0A 1U8WA 5A0YA 3O2IA 2EFPA 1AW0A 1FERA 2PFDA 4HI1A 3WDOA 1TL7A 3HVAA 3D6HB 1NJZA 4TYBA 4KKOB 3CUNA 1C1CB 1N33F 2JOQA 3GFHA 4DV7F 3VAKA 2HVEA 1MROB 1X0PA 2H4YB 1VMBA 4AQYJ 2CPDA 3U1MA 3ZNUA 2XGQA 1U48A 5ETNA 2BJ9A 4C6AA 3DOMB 3C6UB 3RR7A 4CP5A 2HVIA 2XLIA 3W8GA 1TKTA 1FJGF 3NGKA 1UP1A 5F9LA 1CJVB 1X4DA 4RR5A 3MEDB 1NJWA 2XCAA 1QDUB 5A8WB 4KHPF 2FLLA 1S4EA 3OV7A 3PR5B 2DGXA 2E9RX 1G1XA 3HX9A 2CPXA 3BV8A 3MPDA 4KB7A 2D9OA 1RBAA 4YB5A 4K2JA 4LSLB 1WC1A 2DD8S 3MMCB 4P52A 4B9MA 2QX0A 1RKIA 2C3PA 1N36F 1DRZA 3NL0A 1HMVA 3K2YA 4J9SA 3EVOA 1BQNB 3V4IB 2CYYA 2EFOA 2FTRA 3BPSP 4L6V3 3PRBA 1UVLA 1ZPWX 2IVMA 1WDTA 1UA0A 1MG7A 3BSNA 1OSCA 2IJRA 1S1UB 1FD2A 2MJNA 1IKWB 3PW0A 3FRZA 1M5VC 4NWBA 1RJJA 2JEGA 4CT8A 2WOMB 2FD2A 2QA2A 4F0HA 4PPZA 2BE7D 4ED6A 3NBPA 5B0DA 4Y2IA 1FJGJ 4DSEA 3MM5A 2W7OA 3OHBA 1FT8A 4DR7F 1B7YB 2KG0A 1DZ5A 1X9SA 1XWLA 5J2QB 4URSA 2ASDA 2VG7A 3M8PA 2ABYA 3P96A 4KHPJ 1IR0A 4MKBA 4DQQA 2B8PA 2HNDA 1T02A 4LFCF 4ZP7A 1U45A 4X4RA 4USKA 1K1SA 2KYXA 3OTOF 2R8GA 3MDFA 1S49A 1EQMA 4K4XA 5HMZA 2UVUA 2J6SA 1XR6A 2RAQA 3HCXA 1N36J 1TFWA 2Z30B 3I5AA 4ECXA 3R1HA 2BUNA 2K7JA 2Y1JA 1N5TA 3MUVP 2P9CA 4DOZA 2XYHB 1VOMA 1F5BA 3KJVB 2LA4A 4O3SA 4EI2A 3W60A 1G6BA 4A8YA 1OPIA 4ITSA 2XBPA 2DISA 4YQWA 4ECWA 1CJKB 5C25A 1RHRB 3J7AN 5T41A 2FHJD 2EKYA 2FVPA 2QN6B 2CFXA 2V68A 4NMXA 3SCJE 4B3OB 1JXLA 3TEHB 3JQKA 1WF0A 1TK5A 3KNAA 4LFCJ 3F73A 3LP1B 3PEHA 1U2FA 1T05A 3OTOJ 3UCUP 1VQOS 3R5BA 4RPFA 3DMJB 1DQ9A 4NLWA 4L3NA 3IC1A 3PKMA 4UY8T 1FWKA 1DFDA 3M8WA 3ZZUA 3VAIA 2YH0A 2D3O1 2HQGA 3DGPB 5K14A 2LFVA 4MH8A 3US5A 2DR7A 5EN1A 1H0HB 1RP5A 3TAMB 5KFFA 2RF2B 3K5MA 4NE9C 1VJQA 1BHNA 2V0NA 2IM3A 4AXJA 2RIJA 2VL1A 4LQ3A 4A4JA 3NGDA 4YB1P 5IQ6A 4ECQA 4BC9A 1FO1A 3AJ2A 2NPFA 3BDEA 3MMAA 2DPJA 5DG8A 4OV1A 2MQLA 4KE5A 3X3UA 5DGAA 4M95A 1U24A 4QYZK 2OFHX 4CTAB 2L48A 5HROA 3DLEB 3BO3A 3C16B 1RZMA 5DDOC 2FHJA 2KYZA 4RX6A 3P8BB 2HZCA 2EVZA 1FXLA 3DI6A 1QVGR 4M5NA 1M5HA 2RHQB 2BEFA 4M5DA 4USWA 2GVDA 1FF2A 3MEKA 3FUYA 3DRPB 4DL6A 4NYZA 5D0GA 2BV3A 1OSDA 2KT3A 3T6JA 2NQPA 2DK2A 4DR4F 3DFEA 1OO0B 1R0AB 5FDLB 4ATNA 4DR1J 4IQXA 1DLOA 4IDKA 2VKZG 2AYBA 5E3AA 3THPA 3BDPA 1SKSA 3B54A 2JLFA 5KFIA 2J8AA 1T8EA 3DRSB 4ZVFA 4LF6F 1IM6A 3UDLA 2VQFF 4ED8A 3I6PA 1QAJA 1E6YB 3UNYA 5ITHA 3HHLC 3M8ZA 5KT3A 4A8OA 5KFCA 1D9AA 3SV3A 4NEYA 4C3KA 4B02A 2WRMA 2KM8B 2A10A 4NLDA 3CDWA 3DOLB 2ILYA 4MTPA 3RR8A 3CJSA 2LQBA 2W2QP 3CF5Q 1YX2A 5EX0A 3TX0A 3DC2A 1NJXA 2QO3A 5KFXA 4C9DA 4DR4J 1ZBTA 3GSIA 3UR3C 2IHR1 3VALA 2RMLA 3KK1B 1SL1A 3N6NA 3QAUA 1RT1B 1LK5A 4Z7CA 1YQHA 5FIIA 2CIMA 1U1RA 3T1HF 2LDYA 4PQUB 3A3NB 3W62A 1DAXA 4AL6A 5F8JA 3HT3A 4LF6J 2VQFJ 3OUYB 2WAQD 5CD4A 2OPSB 2QZ8A 4AXIA 2MKHA 5ETSA 3FCVA 3MM6B 4ILMA 2CVEA 1HBUA 4RLEA 4B3MF 1Q79A 3PIOQ 2B6AB 4LR9A 4K2XA 4QR2A 3TUIC 1WNEA 2O5DA 1RWVB 5A8RB 4DL7A 2JX2A 1BWEA 2B4OA 4WP9A 1PCAA 2XMTA 3FVYA 4FKXA 4J9MA 1AXQA 4ZJOA 2R8HA 2HEKA 4UF4A 1U49A 2J76E 2IYGA 3SFGA 2B9EA 2YNFA 4DFMA 3MCMA 3B82A 2LVWA 3R7NB 1HW8A 3IS9A 4E2FB 3M1VB 2W4DA 1VIOA 3P4UB 5C7PA 2HWTA 2YNIA 1QM9A 1HD1A 4B3SF 5K8NA 2APOA 3T1HJ 1H72C 3CJ5A 1S72S 3I96A 4DZDA 2AEFA 2HNYB 1EP4A 7AT1B 3CD6S 5ETTA 2HGMA 2B4PA 5HQLA 5MLCV 1RTIB 2HURA 1Q5VA 2RKIA 2UVVA 2HRTA 3CJKB 4B3MJ 2KFYA 3MEEA 3CJTA 3CIZA 2PN6A 3M9MB 2WZ1A 3BZQA 1XR7A 5I42B 1SPBP 1RTJB 3GE9A 2KVIA 3MMBB 2QLBB 4NLUA 1B7FA 4QYZJ 2GVZB 2VC1A 3M6VA 1RAEB 1U1KA 3FMBA 2KI2A 2HBRB 4KT0C 3TR5A 5KFYA 1RHQB 2RE1A 2V4QA 2Z2ZA 2X51A 1RT5A 1LK7A 1Y5NB 2ZBRA 4YY3F 1KONA 3KLEA 1SC4B 4DL0C 4CM2A 2YWEA 4IG0B 3HHNB 2FDNA 1VIXA 3CW2C 1RABB 4B3SJ 4JYAF 4ZCKA 4K50A 3MEGB 5AE2A 3L9ZA 4KHMA 3G96A 2QLFB 3I55S 4B3RF 5D0HA 3Q8RB 1J5EJ 3QNWB 2JC1A 3I32A 4CI0B 1U09A 4ED0A 1EZZB 3GJQB 1S7IA 4ID5A 4NRTA 3HXMA 1Y7PA 1FJEB 2HHXA 4FF3A 3W9HA 3BH7B 4F3QA 2W8LA 4Q0BB 5J2NB 3D1OA 4ES1A 3S1TA 4PPDA 1SIWB 4RW7B 1HNWF 2JL9A 2ZHBA 3QIPA 2GZOA 3MOJB 4TKTA 1FXDA 1HNIA 4TU9A 3MUMP 1HQUA 4Z7YA 3JYTA 2BYCA 2B0GA 4LSZB 4O4GB 3NCPA 1S0NA 2UUTA 2MKCA 1IQZA 3EPGA 2GMLA 2J9EA 1SIZA 1LWXA 1S0MA 1SH2A 4NLOA 2PC6A 4B3RJ 5GAEU 3C14B 3THVA 3OL8A 2HQFA 5HN0A 3Q24A 4Q8FA 5CAAA 4OIXA 4LF4F 1IKYA 1RAAB 4P2FA 4J9PA 5E33A 2IBOA 4K4VA 2W9CB 3S7RA 4DS5A 5A8KA 4KV8B 3Q2SC 5EUHA 1HNWJ 5F3ZA 1IR1A 2VFTA 1X4GA 2IRXA 1FE0A 4AE5A 3DHWC 4WYLA 3CJ8A 2IBKA 2DNQA 1KWMA 4X4TA 3NY0A 2GJFA 2ZNYA 1HHSA 4F26A 5HI7A 6FDRA 4DPOA 4TN2A 2HK3A 4L73A 3N5FA 3DLKB 2PEHA 4J9OA 5A6PA 5E7OB 3PCOB 2L08A 4W90B 1WOSA 5ETOA 4ZPTR 5K5MA 5K20B 4Y34A 4P74A 5HVGA 4CLPA 4QYRA 3MURP 1EKSA 2W4PA 1RT7A 4DDFA 2ACMA 2BE9B 3H7HB 1JXEA 5ETLA 5C5JA 4DG1B 3MHYA 1FRLA 1RLCL 3OFEA 4URGA 3CJRA 3MAQA 1ZAWA 2ROGA 2QMWA 3DOMA 5C2GA 3T5KA 3DLGA 1HQEA 1WI6A 3ILOA 1R7IA 4DHVA 1GAOA 4QCLA 1J5OA 3JAMY 2CG4A 4DR6F 4USMA 3UDEA 3G87A 4HTJA 5GAGI 2WVDA 3BREA 4WP3A 4B3TF 4OYBA 2HQ3A 1CC7A 4DQRA 1R31A 2DNRA 4X84A 3F56A 3BQ0A 1MW7A 3TUZC 2HG4A 2RQMA 1T9WA 4CH7A 1PG5B 1SI9A 1YI2S 1N34F 3EGWB 3WQPA 2LQ5A 3LW5C 2Y9HA 1U1NA 2Q43A 5F8MA 1G3OA 5C2CA 3KMSA 1TTHB 5DRKA 4CNZA 4OI2A 1EARA 2BANA 2L9DA 4DUYF 3KLIB 4FYXB 2V63A 2N7CA 1TL4A 3TI0A 4XIUA 1H2UX 4QR0A 3M8YA 2ZUAA 3KLHA 1FFWB 3NS5A 2A18A 1M1KT 1GTHA 2CQ2A 2YQ0A 4KGZB 2JLEA 2M88A 3A13A 2H9ZA 3IG1B 3QIDA 3FBBA 1A6LA 4TU7A 3PW5A 2XS5A 3UE2A 2BA9A 2VFSA 2YXLA 4DR6J 3IN5A 3T1AA 3L7UA 5CYMB 2ZE2A 4I7FB 1BC6A 3DYAB 3G8TA 4B3TJ 4OMFG 2ZH5A 3NAIA 2VBYA 2MZSA 5RUBA 4DQPA 4IR9A 3ELHA 1HR0F 5KFUA 3IMQJ 2IAJA 2C2MB 4K59A 2IDLA 1R6YA 1WF2A 2LXUA 2V67A 2MKSA 2ZH8A 4ZS6A 1N34J 3ZZOA 3JSMB 3EDQB 3H5XA 4CWBA 3G82B 4B17A 4LF2A 5GADU 3W2WB 3D0IE 2YKNA 4ZCIA 2MYFA 1QVFR 4DUYJ 2W01A 3GP9A 2KHCA 1RWKB 4DR2J 1JQGA 4CLYA 3BJYA 2AGPA 5DJBA 1WKJA 3VVTA 3CJ3A 2WONB 4OV6A 4USHA 3R5CA 5L9NA 2FQQB 2EKNA 2HFOA 1L3UA 2JEJA 2MKKA 3V6JA 2FY1A 1F6TA 1NK0A 1N5SA 2J0WA 3EGVA 5L1IA 2AP6A 3BSCA 4ANCA 4AUKA 2V9WA 2DXEA 5IV3A 3VVUA 3PY8A 1Y10A 2V2QA 2AYMA 2K7KA 2MQOA 3S01A 4QIWD 1HR0J 2MQPA 1S1VB 4EEYA 2F63A 1DTTB 3D7SB 3VWSA 3QWPA 1KBRA 3VQSA 3E2EA 3JS9A 1IBLJ 3NAHA 4OYOA 1RT6B 4DCOB 3SQGA 1D1UA 4FF2A 3IRXB 4YB6A 3HZEA 4WBFA 1P8GA 4RW4A 4OYIA 1HA1A 3POTB 1U2CA 1LEOA 1GT8A 1JX4A 2VFUA 4DMZA 2HYIB 4BCAA 8AT1B 3LQVA 2RF2A 4NLSA 5F41A 1UPPA 2G2YA 3EVWA 4ZVPB 3A8IA 2J8SA 4ECYA 4OZJA 2BM0A 2M4MA 1XBWA 4IKAA 4I2QB 4MK9A 4OX7A 4ED7A 1YJTA 1N5VA 3KDOA 2KM8C 2OPQA 2Z57B 1WHXA 4J9UE 2P9EA 2W7AA 4X4UA 3NNCA 2MGZB 3L09A 2QSWA 3FEYB 4NPOA 3RRHA 3A8EA 2MJUA 2ZKTA 1DTQA 2YNHB 2HVZA 1OMSA 5KFWA 1FI4A 2RDJA 8RUCA 4G65A 3UVJA 1GK8A 3RAXA 4OZ2A 1F5CA 2V8PA 2NZCA 4ED2A 4JI1J 4Q2LA 4DR3F 4H4KC 5IZHA 2OUGA 2RNEA 5I3PA 2J6TA 2KZZA 2DGUA 1REGX 5J1PA 2U2FA 3QT6A 1UTAA 4M1KA 3MCNA 4WFZA 3RJMB 1R8PA 4RKUC 2CJKA 4C11B 2OPRA 1PAEX 3FFIA 3MECA 3TOQA 4JI8F 3U1NA 2XZDB 2BJEA 2H3EB 3KHHA 1DARA 3ETMA 1VDHA 3ILIA 5F8HA 3RW6A 1NHVA 4OI3A 1FKAF 4O3PA 5HBMB 5AJ3F 2CWXA 1OY6A 1UVIA 1QLNA 3DRYA 1TKZA 3VGVA 3OL7A 1SXLA 2B51A 2DCUB 2C3OA 2ATLA 5JVHQ 2XSFA 4CM0A 3OXFA 2R7RA 2IDEA 2LCWA 4WZQA 2X1BA 4X62F 2MXYA 2VBZA 1R8HA 4J9QA 1WOOA 1IJFB 2DNPA 2IVYA 1VQ7S 3M2RA 1Q82T 2FHOB 4DL2A 1HPZA 2L9WA 2ZUGA 1S0VA 5IXUA 1UFWA 4KBIA 5HATA 3ENQA 1MNEA 3EZ5A 3OTCA 2W2PP 2OTJS 3M2VA 2LQ8A 2HS3A 1ZM3A 4J9LA 2CADA 3ENWA 1R8BA 3AQPA 1TKDA 1AB8A 3G6ES 3GU0A 3MCSA 5LM7E 3AY0A 2F8MA 1VQYA 4CO0A 3UCGA 4DV3J 3NG8A 2M8DB 2CZ9A 4FNHA 1P9YA 1G7CB 5ETRA 4W4MA 2XTJP 2KU7A 4OHYA 3AOAA 3DM2B 2V4JB 5CD4H 2RRAA 1NH7A 3MR6A 3HKWA 3IBFB 2JSXA 1RT2B 5KFQA 2HFVA 1M5PC 4USJC 4X62J 2KT5A 3K5NA 2XNRA 3D9BA 3DOKA 5F8GA 1YHQS 2H5EA 4KQZA 5GMKa 2YBVA 2MLXA 1B0PA 3ILLA 2HHUA 1NEEA 1IUJA 4TXSA 4ANEA 4J9VA 5ADZA 3OFHA 3TRGA 3QZ7A 3SSQA 1HBNB 1UVNA 1FKPA 1LKZA 4FXDA 2NXUA 5DDRC 1NBEB 2F5GA 3QLHA 3OR1A 2ZH4A 4YMEA 3SSRA 2ZJQQ 4M5JA 4ECSA 3DU6A 3NNHA 3THTA 4YFUA 4P72A 1XTZA 3PKYA 4PXCA 5IM0B 3TARA 1T9UA 2IMOA 2AGQA 1VQ4S 1WHYA 2GVZA 5BR8F 2GO8A 2HHPA 2FVRA 1JKHB 3UCZP 2MSTA 2QL9B 3T3FA 1RSCA 1NZ8A 1CS4A 3CC4S 3MPVA 4AD6A 2FVSA 5J2MB 1Q4RA 1S99A 1YRTA 1FKOB 3KLVA 4C98A 4LRCA 5D4PA 3BYRA 2H54B 4HVZA 3OHAA 1U02A 2BXJA 1KVJA 1RB0A 3HVTB 3BEGB 1UW9A 1GXTA 1IBMJ 2HQIA 3HI9A 1FESA 4R8UB 2A2CA 4RW6A 2QYCA 2XYPB 3H4DA 1NSPA 3JQMA 4JV0A 3IA0A 1CQMA 3L7PA 4N41A 3ZXWA 3BB5A 2OELA 4WU3A 3IO1A 5SUHA 1R6VA 4ELVA 3GV8B 5BR8J 5T7LA 5D4NA 4EO8A 1I1GA 5E3RA 1UWBB 4DU8A 2C2OB 2B4UA 1F60B 2VDHA 1TKXB 2FB0A 4LF1A 1VBZA 4V19J 2WSFC 2D41A 2H5IB 2DGOA 1TL1B 3N79A 1VLYA 4KGVB 1RT3B 3ISZA 4IRKA 3CCMS 1X5PA 2VJUA 3F41A 2OP5A 3D3CJ 2E5IA 2YH1A 3DDNA 5KG4A 3B4DA 2K8GA 5DZ6A 2V4RA 2E7VA 2GMHA 3NGTA 4WJBA 4NLXA 1PC5A 3VV2B 2IRUA 4JI6F 4GKKF 2V8DA 2XNQA 2VASA 1U7LA 4WTOB 1T9VA 1JB0C 1E6VB 4A46A 3OXGA 4KO0B 2KXHA 1WC6A 1B64A 3AB2B 4IG3B 2XMKA 3FK4A 4NCGA 2DNKA 3IGVA 1F3FA 3FBEA 2OD4A 2PI5A 3CMES 1WF1A 3MPUB 3KFWX 3RRGA 4KV8A 4EWTA 1HKAA 1RBOB 2WB4A 5IC4B 2ERRA 2RS8A 5DO2A 1YTYA 5BYQA 2VOOA 2HMIA 4ZITA 2HHHF 5KFHA 4YR2A 3BR9A 1SJ4P 4D3HA 3TA0A 4WYWA 3PHEA 1QE1B 3PFEA 1B3TA 3HULA 1EETB 5FLXU 1VQ5S 2ZBPA 1CULB 2DH8A 1U4BA 2GNKA 4O23A 3K5LA 3O5TB 4IRCA 3AD7C 4KH1B 4JI6J 4GKKJ 5BXIA 1QSYA 2M5YA 1T03B 4DZ6A 2PGCA 4EYHB 4WFBQ 2B43A 1RE1B 2W2OP 3OXLA 1SV5A 1CJUA 2MQNA 1TVRB 3VZIA 2KHDA 3IBWA 1PBAA 1M1GA 4K4TA 3BSOA 5F8LA 1LWFB 2IJFA 4MFBB 3W9JA 1H3DA 2MHEA 4OJ1A 3SI8A 4ZCLA 3GSDA 2HNZA 4MYTA 1QUVA 1FRIA 2W2MP 3W5XA 4RW8A 5C24B 4G3IA 1JLQB 5HLFA 3CWJA 2XGPA 2EXUA 2GGPB 3SV4A 5D8HB 2V69A 2E5GA 4NYOA 2JLGA 7FD1A 4LJMA 4DCJB 3ISNC 2CQ0A 2R3VA 2ZBIA 2Z58B 4IFVA 4DWIA 1EAYC 3MM9B 2DGVA 2G2ZA 4I64A 4QU6A 2BQRA 2GHVC 3Q89A 3IBCB 5KFRA 3WC2A 3GJSB 2F4FA 3V81A 4F4WA 4DQIA 3NKYA 2ZH2A 4J90A 4B08A 3R27A 3FGVA 1UCNA 2DBBA 1ROFA 1D3WA 3DYAA 3M8QA 3HHDA 2AJ2A 5IV4A 2GJ2A 3FRYA 2OSRA 3ITHB 3JSYA 1HHTP 4LREA 5IT0A
chains in the Genus database with same CATH topology
3ELHA 1S57A 1NHKL 5IOLA 1K44A 3Q8VA 3EM1A 1EHWA 3EE3A 1BE4A 2B8PA 1BUXA 3VGVA 3BBBA 1B4SA 3EVMA 1NSKL 3JS9A 3FCWA 3Q83A 3NGUA 4UOHA 1NLKL 2AZ1A 1KDNA 2BEFA 3VGTA 1XQIA 3ZTQA 4F4AA 4F36A 3Q86A 1U8WA 4FKXA 1HLWA 2BX6A 3MPDA 3G2XA 3GP9A 1W7WA 1NCLA 4FKYA 3Q8YA 1NDCA 1VYAA 2DY9A 4W98A 3ZTOA 3ZTRA 1NPKA 4WBFA 1HHQA 2DXFA 3FBCA 3FBFA 1S59A 1WKJA 4HR2A 3VVTA 4ANDA 1LEOA 2AZ3A 3DKDA 4O0NA 1LWXA 3Q8UA 1HIYA 1MN9A 2DYAA 3EJMA 4ANEA 3PRVA 3EVOA 4DUTA 3Q89A 1S5ZA 1ZS6A 5C7PA 3FKBA 3NGTA 4KPCA 4UOFA 1WKLA 5BXIA 3EVWA 2VU5A 1F6TA 2ZUAA 3NGSA 1BHNA 1JXVA 2HVEA 4UOGA 4EK2A 2NCKL 1PAEX 4DZ6A 1NSPA 4DI6A 1NSQA 3GPAA 3VGUA 3R9LA 3B6BA 5CABA 1NDLA 3B54A 2DXDA 3BH6B 1NDKA 3DDIA 5CAAA 3BBCA 1NB2A 3EMTA 3ENAA 4ANCA 1F3FA 3FBEA 1NUEA 3EICA 3ETMA 3PJ9A 2DXEA 2CWKA 2HURA 3FBBA 1UCNA 3VVUA 4C6AA 2B8QA 1NDPA 3ZTSA 4ENOA 3FC9A 4CP5A 3WX8A 2HVDA 3FCVA 3L7UA 3ZTPA 3VGSA 3BBFA 4S0MA 3BH7B 1WKKA 1B99A 1PKUA 1XIQA 1MN7A 3NGRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ELH A;  1S57 A;  1NHK L;  5IOL A;  1K44 A;  3Q8V A;  3EM1 A;  1EHW A;  3EE3 A;  1BE4 A;  2B8P A;  1BUX A;  3VGV A;  3BBB A;  1B4S A;  3EVM A;  1NSK L;  3JS9 A;  3FCW A;  3Q83 A;  3NGU A;  4UOH A;  1NLK L;  2AZ1 A;  1KDN A;  2BEF A;  3VGT A;  1XQI A;  3ZTQ A;  4F4A A;  4F36 A;  3Q86 A;  1U8W A;  4FKX A;  1HLW A;  2BX6 A;  3MPD A;  3G2X A;  3GP9 A;  1W7W A;  1NCL A;  4FKY A;  3Q8Y A;  1NDC A;  1VYA A;  2DY9 A;  4W98 A;  3ZTO A;  3ZTR A;  1NPK A;  4WBF A;  1HHQ A;  2DXF A;  3FBC A;  3FBF A;  1S59 A;  1WKJ A;  4HR2 A;  3VVT A;  4AND A;  1LEO A;  2AZ3 A;  3DKD A;  4O0N A;  1LWX A;  3Q8U A;  1HIY A;  1MN9 A;  2DYA A;  3EJM A;  4ANE A;  3PRV A;  3EVO A;  4DUT A;  3Q89 A;  1S5Z A;  1ZS6 A;  5C7P A;  3FKB A;  3NGT A;  4KPC A;  4UOF A;  1WKL A;  5BXI A;  3EVW A;  2VU5 A;  1F6T A;  2ZUA A;  3NGS A;  1BHN A;  1JXV A;  2HVE A;  4UOG A;  4EK2 A;  2NCK L;  1PAE X;  4DZ6 A;  1NSP A;  4DI6 A;  1NSQ A;  3GPA A;  3VGU A;  3R9L A;  3B6B A;  5CAB A;  1NDL A;  3B54 A;  2DXD A;  3BH6 B;  1NDK A;  3DDI A;  5CAA A;  3BBC A;  1NB2 A;  3EMT A;  3ENA A;  4ANC A;  1F3F A;  3FBE A;  1NUE A;  3EIC A;  3ETM A;  3PJ9 A;  2DXE A;  2CWK A;  2HUR A;  3FBB A;  1UCN A;  3VVU A;  4C6A A;  2B8Q A;  1NDP A;  3ZTS A;  4ENO A;  3FC9 A;  4CP5 A;  3WX8 A;  2HVD A;  3FCV A;  3L7U A;  3ZTP A;  3VGS A;  3BBF A;  4S0M A;  3BH7 B;  1WKK A;  1B99 A;  1PKU A;  1XIQ A;  1MN7 A;  3NGR A; 
#chains in the Genus database with same CATH topology
 1MMN A;  3LPE A;  2M0G B;  3H5U A;  1SBR A;  3O3L A;  3CO0 P;  5C42 B;  4PG5 A;  4WCE Q;  1IBC B;  2NUH A;  2LLZ A;  3Q86 A;  1HNV A;  4FVM A;  2EG1 A;  1QSL A;  3J80 Y;  2UU9 J;  2DHS A;  2UZA A;  4UT4 A;  4R0E A;  5CHC B;  4LR8 A;  2A3J A;  2IPO B;  4ZVU B;  2CQB A;  2K2P A;  4WFN Q;  3R1L A;  1EJ7 L;  4HDG A;  1TUV A;  4KYZ A;  5JXS A;  2CQ1 A;  4RBT A;  1Y4Z B;  5LOQ A;  3BGF A;  4DFK A;  2ATC B;  1YSJ A;  5L9X A;  4CLU A;  4UOG A;  4E8U A;  2KZM A;  3LP0 B;  3K57 A;  2JNJ A;  4O44 B;  4AT1 B;  2ASJ A;  3VAF A;  3SDE A;  2C42 A;  3EIC A;  4LBH A;  2DNH A;  3QBC A;  4UST A;  3LP2 A;  4DX7 A;  2Y8W A;  2IVF B;  1RBL A;  3ZTP A;  3SZ2 A;  1C0U B;  4D3G A;  3ZZY A;  4OLP A;  1BGX T;  3PX0 A;  1I5O B;  1U6Z A;  1S57 A;  2Q6C A;  3CD5 A;  1C0T A;  1F3V A;  4LF8 F;  4J9R A;  2K1R B;  2CQH A;  3J81 j;  5FJ4 A;  4NLR A;  2XWY A;  2OKQ A;  5KFK A;  4Q2M A;  3MR5 A;  4Q43 A;  3PTW A;  3I0R A;  1FA0 A;  3I87 A;  2G0J A;  2QLW A;  4DV1 F;  1F9F A;  3MD3 A;  1M5K C;  2CG8 A;  4P10 A;  1PIL A;  4J9K A;  4HL9 A;  2DIV A;  3MMJ A;  3QSY B;  2E7X A;  4C3L A;  3QMQ A;  5SZT A;  3MM8 B;  5JMN A;  1SKW A;  3SEO A;  3NP5 A;  1RAH B;  2M7S A;  3AFG A;  2VPX B;  3NRB A;  1QSS A;  4LVN P;  2MGZ A;  3M4X A;  3AQO A;  2NXN A;  1SL0 A;  1NND A;  5D3G A;  1J27 A;  1EB0 A;  4K5R A;  3MXH P;  2NYH A;  1BQM B;  4CIO A;  3L7O A;  1CJT A;  2XO6 A;  2DY1 A;  1YZ7 A;  1HYS B;  4LF8 J;  1AFI A;  2AJ0 A;  1C1B A;  3HM9 A;  2W9B B;  3D5M A;  1G2E A;  2FJV A;  3GFY A;  2Z2Y B;  3GG0 A;  1X4A A;  4RL1 A;  2GMJ A;  2J0Q D;  3R5D A;  4F8R A;  1WSV A;  4DV1 J;  4LRB A;  2MLY A;  2OTL S;  1RHU B;  2AEJ A;  3BS9 A;  5DDP C;  2WW4 A;  3M05 A;  1SJF A;  2R7S A;  2G9O A;  1VHI A;  3HHE A;  2VG5 A;  4W92 B;  4O4R A;  2C2Z B;  3LH2 S;  2CJ9 A;  4F3O A;  2MSS A;  5B09 A;  4OI1 A;  2ZD1 B;  4C11 A;  4RNH A;  1WKL A;  1UFL A;  1LWC A;  3CE8 A;  2EEY A;  4QPX A;  1VFJ A;  3GB0 A;  4I1T A;  1M5S A;  1URN A;  2YWW A;  4XDD A;  1FNX H;  3UWT A;  1YWX A;  2XMV A;  3OVB A;  3K59 A;  1OYE A;  3UN5 A;  3QJL A;  2C2N A;  3BQ1 A;  3RBX A;  4L3K A;  2E29 A;  2WCX A;  1NU4 A;  1IM4 A;  4PWU A;  4DL3 A;  3EUN A;  4PUO B;  5CA5 A;  4YS2 A;  1OQ3 A;  4HAC A;  4ES3 A;  3QZ8 A;  2GAG C;  4ILR A;  2H4W B;  3I82 A;  2QA4 S;  3C15 B;  1SH3 A;  3V6D A;  1D8Y A;  3HZG A;  2AQ4 A;  3GIR A;  5KAK A;  3HKZ D;  2DRA A;  1FXR A;  4IOB A;  2ALY B;  1NJI T;  2UXC F;  4X65 F;  3JQJ A;  1NK9 A;  5M2P A;  3P5T L;  4P6Q A;  3N6M A;  4ZVO B;  3TUP A;  2DYA A;  1S1X A;  3RAM A;  4DUT A;  1KRP A;  2UP1 A;  4CLS A;  5KOX A;  2VQE J;  2UXD F;  1V6H A;  1AUD A;  2MY8 A;  4PXE A;  1LFP A;  2ZVI A;  2EWH A;  2IRY A;  3IP0 A;  1ACM B;  2G2O A;  5H9F K;  5KG6 A;  2FJX A;  2YWG A;  2CQ3 A;  1X60 A;  2PMZ D;  2CVI A;  1FE4 A;  1VBK A;  1SUQ A;  5I3U B;  3T5H A;  1MWY A;  2XI2 A;  8ATC B;  2YX7 A;  3AJD A;  3LA0 A;  2POK A;  3VAG A;  2CQ4 A;  4U6P A;  4XK8 C;  4ED3 A;  3DM2 A;  1TFY A;  2GCF A;  4HHJ A;  1HL6 A;  1N48 A;  2RS2 A;  5CYQ B;  4RNM A;  5KFL A;  1S6Q B;  4IO1 A;  4G1Q A;  1AZS A;  1UJ5 A;  1P27 B;  1RWM B;  1KTV A;  2QLJ B;  4N77 A;  4RNF A;  2OD6 A;  4NXM F;  1DQA A;  4UOH A;  2MQQ A;  1P1L A;  2BKP A;  4RBV A;  4DR5 J;  2FHM A;  4EFA C;  4OHW A;  4WII A;  3ZNJ 1;  4TY8 A;  2UXC J;  1UEV A;  1S97 A;  4X65 J;  3RBZ A;  4YEA A;  2J9C A;  1LWE B;  4DL5 A;  4USI A;  4LSN A;  3TW0 A;  3NWR A;  3T1Y J;  1T7P A;  2PII A;  2DNO A;  2YPY A;  3QO9 B;  2EC0 A;  3RB3 A;  4DSI A;  3BKU A;  2UXD J;  2HAF A;  1WG1 A;  3V6K A;  2R7O A;  2C1E B;  2XLJ A;  1RUS A;  2WVC A;  3EWG A;  1IR2 A;  1PYO B;  2FIU A;  4UQG A;  4YHH F;  4ZPA A;  1N32 F;  4PXD A;  2FJD B;  3A1Y G;  2GHP A;  1KVI A;  5IM0 A;  3TZY A;  1Y9O A;  1D9F A;  2OO4 A;  3KMQ A;  1SJ1 A;  4KGX B;  3HFZ B;  1UVK A;  4IUF A;  3MCO A;  4AFF A;  3LAM A;  4UTG A;  2HAI A;  3PDN A;  1YJU A;  5IOL A;  3SFU A;  1AUS L;  4IOA Q;  4DPY A;  4NXM J;  4F25 A;  1O0P A;  3V4M A;  5J2M A;  4ZN3 A;  3D1H A;  2Y0S D;  3EXY A;  4M63 A;  1WEZ A;  1Y3J A;  1NK8 A;  4NAS A;  3ZZR A;  4I0W A;  3GYN A;  1WG4 A;  4YP3 A;  3D28 A;  2XCP A;  3HSD A;  2BJ8 A;  2BKO A;  4U96 A;  5KG5 A;  4LR7 A;  2YNG B;  5LSL A;  3KLF B;  1XNQ F;  2PD1 A;  4P2S A;  2OIH A;  4CLT A;  1NK5 A;  1O5J A;  2BZ2 A;  5J1E B;  4ZJQ A;  4ICL B;  4YHH J;  4LIW A;  3RW7 A;  2EFN A;  5L39 A;  1N32 J;  1S6P A;  1Y0H A;  2L41 A;  4ED5 A;  2W8K A;  2MQM A;  1HBM B;  3CXC R;  4DSK A;  4NI2 A;  4JI3 F;  2VJV A;  4U8V A;  1VRU B;  2W7P A;  1ZTW A;  2F4V F;  4ES2 A;  1TV6 A;  4HLB A;  2OPP A;  2DT9 A;  3T5L A;  4WTY A;  1RAG B;  2BMB A;  1W2B R;  4DV2 F;  1XQI A;  3TYT A;  5MAO A;  4WF9 Q;  1TUG B;  3KOA A;  4ZHR A;  2DIU A;  5H9E K;  2ZH7 A;  3UO0 A;  1A7G E;  1PYS B;  4GVB A;  2KVQ E;  2YKM B;  3KLG A;  1U47 A;  1TL3 B;  4ZVH A;  1OS5 A;  3C46 A;  1TL5 A;  1WUU A;  2HLU A;  3AHP A;  3VCD A;  4H54 A;  3QJP A;  4KAI A;  3OL9 A;  3E01 A;  4OQJ A;  1N5Y B;  1N4L A;  1HBO A;  3OVA A;  4WK3 A;  1NSQ A;  2AEM A;  3LGN A;  4CO3 A;  3DDI A;  1GMV A;  2ZBQ A;  2VIH A;  4ZLL A;  5HMY A;  4JI3 J;  3IR5 B;  2Y3Y A;  3SCK E;  3BO4 A;  1KNZ A;  4LBP A;  2RUG A;  4HHU A;  1S0O A;  3EGZ A;  2V6A A;  2XSJ A;  4CO1 A;  2RT3 A;  1NRK A;  3KG0 A;  5D6G A;  3TQ1 A;  4X4O A;  1RTH A;  4PYD A;  4JI7 J;  3BGU A;  4ECU A;  4MIW A;  4DV2 J;  1C2P A;  2Y1I A;  3EXC X;  4QWA A;  2M3D A;  1R0B G;  3OR2 B;  4XTT A;  5M2U A;  1A9N B;  2MPU A;  2JC0 A;  2HQD A;  3G8Q A;  1X9W A;  2VF3 A;  2WK4 A;  1ARO P;  1QAY A;  3PW7 A;  1IKV B;  1LNQ A;  2P9G A;  2IA0 A;  3QPI A;  2MHN A;  1HIY A;  3J7Z 5;  2CNK B;  1ZH5 A;  4A8M P;  1T03 A;  4C0O C;  2XQC A;  2FLP A;  3GQC A;  5IT9 U;  3F0N A;  2QLX A;  5KG7 A;  2B5J B;  4KFB B;  4N47 A;  4RUA A;  2Z2M A;  3W61 A;  4MFB A;  3BO2 A;  3ZZP A;  1VQ8 S;  3NLC A;  1N6Q A;  3LAK A;  2KRB A;  3I0S A;  4LFB F;  1LW0 A;  4MAK A;  4C48 A;  1GX5 A;  2LYV A;  1JLQ A;  3KK3 B;  4RBU A;  4C8O A;  2D7S A;  1EX8 A;  3MAA B;  4F04 B;  3H90 A;  1T3N A;  3TVK A;  2L3M A;  1FRH A;  5FLX Y;  1Q8B A;  3MR7 A;  4I2P A;  3GR0 A;  3ENV A;  1Q8I A;  2DR9 A;  4MT1 A;  1D09 B;  1APS A;  3ADA C;  2DNN A;  5HK4 A;  2GIF A;  2PEB A;  1T9Y A;  2IYI A;  4WFY A;  1XMB A;  3C6T A;  4OZ3 A;  1S59 A;  1JNZ B;  3LO3 A;  4F3M A;  4H4M A;  3SCL E;  5HJX A;  1RWP B;  3LAL A;  2DR8 A;  1W2I A;  2AJQ A;  4CLL A;  4O3N A;  3GTY X;  2H5J B;  4ZPB A;  1J2V A;  3UD3 P;  5ETQ A;  5A0Y B;  4Q44 A;  1VI7 A;  1RHK B;  2QT7 A;  2KTQ A;  4NLY A;  2ZWP A;  4R5P B;  3GIL A;  3OD2 A;  3W2V A;  3H4B A;  2ZIT A;  4TVA B;  1TL7 B;  2AX1 A;  4IFY A;  4QQB A;  4B9T A;  1WSR A;  4OYX A;  1FD8 A;  1QAX A;  3OW2 R;  4LF9 F;  3GV7 B;  2HGL A;  4K4W A;  4LFB J;  1R8C A;  2VB6 A;  1PKU A;  2M9K A;  5DQH A;  3CCW A;  1D8Z A;  5CZX A;  2F8H A;  5G0R A;  4J91 A;  1YBT A;  4UUW A;  4PR6 A;  5KT2 A;  1T0T V;  1NPR A;  3CCT A;  1F9H A;  1KDN A;  1KQS R;  3ZTQ A;  1TKT B;  1W25 A;  3EYZ A;  2BJ3 A;  1U1L A;  4JP8 A;  1VS3 A;  4G1P A;  2DGW A;  2FJE B;  4AL7 A;  4CQ1 A;  3FBC A;  2MY7 A;  3N4W A;  4DX8 H;  2DH7 A;  3Q8U A;  4DPW A;  5D78 A;  2HRU A;  3LP0 A;  3LTO A;  4WWS A;  3ET6 A;  3KNG A;  2W4C A;  3DRR A;  1F0X A;  2KKH A;  2NXC A;  4J7C A;  2LXF A;  4U8Y A;  4PRF A;  2LU2 A;  2P6T A;  1FCA A;  5DQI A;  4PWD A;  4LF9 J;  1RCX B;  4NML A;  1C0U A;  1HMV B;  5BJR A;  4PWW A;  1AFJ A;  3PRD A;  3BSA A;  3PX4 A;  3BBF A;  3GII A;  1ZM2 A;  1JIH A;  2X3G A;  4GC7 A;  4OI4 A;  1WG5 A;  5E2Q A;  1OY9 A;  2PSZ A;  5DM6 Q;  3KYL A;  3UI3 A;  2RRB A;  4J5O A;  2E9Z A;  1FNM A;  3BBB A;  1H98 A;  4DXL A;  1FWL A;  2RHS B;  1ZPV A;  4TQR A;  5AE3 A;  3DXB A;  3NBP B;  2HHV A;  4WE1 A;  3BGO P;  3MM5 B;  4Q45 A;  2RD5 C;  5B0F A;  3KG4 A;  1C4C A;  4NZ7 A;  2VG7 B;  5JJB A;  3M8P B;  3VF0 B;  3CMQ A;  4DR1 F;  3OQ2 A;  2QEX S;  1U0H A;  3SBM A;  1WHV A;  1YJN S;  3H42 A;  2QA1 A;  2HND B;  2J0S D;  2X7I A;  1FVS A;  2VOD A;  4EZ9 A;  3CGI A;  5KFD A;  2I1R A;  5KFB A;  3MM8 A;  3G6V A;  3D66 A;  1EIY B;  2UUW A;  2R7T A;  4FPI A;  2FPH X;  3TJA A;  4GMK A;  1NK7 A;  4WIQ A;  4MMO A;  1U2R A;  3KJN B;  3AXK A;  4ZJL A;  1MMD A;  4OLO A;  2VON A;  2YVS A;  1L5U A;  2FJB B;  1JLC B;  4NZ6 A;  5LMU F;  3WX8 A;  4PAB A;  2A0F B;  3TZW A;  2VG6 B;  4XAK A;  2D3Z A;  4DV5 F;  4F0K A;  4FYW B;  4DSF A;  3K5P A;  2EW9 A;  2I2Y A;  3K58 A;  5J2P A;  2HZA A;  3DLB A;  1ZET A;  3U1L A;  2XMW A;  2ZH1 A;  2O66 A;  3PJW A;  4B9N A;  5C25 B;  4PQA A;  2BW2 A;  3TNV A;  1FEE A;  3PYD A;  2E1P A;  4OX9 J;  1IQT A;  4F0M A;  3MAH A;  4I69 A;  2WVE A;  1M0S A;  3O1L A;  3CSK A;  2YKP A;  3H25 A;  3HSZ A;  1NHU A;  1SB6 A;  2WB1 D;  3O6Q A;  3E8O A;  2P5V A;  1T05 B;  4YDD B;  2ADC A;  3CB4 A;  2HW3 A;  1ELO A;  3K8W A;  3QT5 A;  4P7V A;  4IR1 A;  5KFG A;  1LXJ A;  4UW2 A;  4EGL A;  4TU8 A;  5GMD A;  3AH6 A;  1Q1K A;  4FPR A;  4PYA A;  1HWJ A;  4BWJ A;  3M32 A;  5K14 B;  3EMT A;  1MSW D;  2HFU A;  1K47 A;  3LGH A;  5LMU J;  1ZYQ A;  2NXJ A;  3HHL D;  1QD1 A;  1S77 D;  2MKI A;  2OML A;  2MKY A;  1B99 A;  4DV5 J;  4RUH A;  1UZD A;  5JUM A;  1Q7Y T;  2NRE A;  2WTF A;  2R7U A;  2ZC3 A;  1FK9 A;  5KTQ A;  3MMA B;  3SQO P;  4IYQ A;  1RYS A;  3J7Y I;  4V1A k;  2X1G A;  1NKE A;  1JLA A;  1TQL A;  1RKJ A;  4FKY A;  2QYG A;  2ZHO A;  5HRO B;  4OZL A;  4AND A;  4R25 A;  1REV B;  5B0E A;  3DKD A;  2YX4 A;  5HQ8 A;  3MPY A;  3NS6 A;  2O01 C;  2B4V A;  4M5D B;  3H0P A;  4I67 A;  2GVD B;  5E3P A;  1M1H A;  4A8S A;  3T41 A;  2VU5 A;  3T5J A;  3Q22 A;  1OQ6 A;  3KHG A;  3ULH A;  1PGZ A;  3U7J A;  5GAG U;  3HPO A;  4ZA1 A;  4ZVR B;  3Q8Q B;  2MZ1 A;  1UEK A;  1Q5Y A;  2IIH A;  2Q66 A;  5D77 A;  1MWQ A;  1KSP A;  3H5Y A;  4C97 A;  2JHE A;  4ZP8 A;  1FDB A;  4ZPD A;  1DLO B;  4IDK B;  5CYQ A;  2UV8 G;  2O3D A;  4X4P A;  3HHL A;  5GVQ A;  2N82 B;  2Q1L A;  5J1N A;  4PG7 A;  2F9J A;  3T19 A;  3GCW P;  3R8Y A;  3H59 A;  4P7T A;  2FC8 A;  2N3L A;  2WHO A;  2BJD A;  2VKR A;  2AYG A;  3IGN A;  4BDP A;  3PYF A;  3WHI A;  4E98 A;  2ZDO A;  2J7U A;  3I4H X;  1NDC A;  4JI0 J;  2VOP A;  4EU0 A;  3FEX B;  5BYR A;  2J5A A;  3CCQ S;  3OTE A;  2I5J B;  2ILZ A;  1R43 A;  1J5E F;  2PE8 A;  3DNC A;  2HHS A;  4K7Q A;  4A8F A;  4NZ0 A;  3FKB A;  2ZOG A;  2UVR A;  4KR0 B;  2VBW A;  1FRM A;  3A12 A;  4ECV A;  1VBX A;  2Y1R I;  2DO4 A;  2M52 A;  2Y0B B;  4Y0F A;  3R2C J;  4FNI A;  3MM7 A;  3VTI A;  4QOT A;  1DUR A;  4CYU A;  5D0R A;  4ZOS A;  2E5L F;  2W25 A;  1ZA1 B;  2JH3 A;  2OGU A;  1KS2 A;  2AU0 A;  2FGC A;  4EO6 A;  2YKO A;  3W1Y C;  1UAW A;  3TQE A;  1NB7 A;  2EG2 A;  1NSK L;  1TAU A;  1PAU B;  2UVW A;  2KN4 A;  3IWN C;  1HBU B;  2RIL A;  3BM7 A;  3L95 X;  3UD4 P;  3EZU A;  5A76 A;  3F44 A;  2OLW A;  3D4J A;  3HDS A;  2HLT A;  1S5Z A;  4WKY A;  3M30 A;  3TAP A;  1GX6 A;  1NJY A;  6FD1 A;  3G6Y A;  4ZN1 A;  3FQL A;  2G0I A;  3D68 A;  4IH7 A;  2F8E X;  3UDC A;  1VQL S;  3AAW B;  2C2R A;  2YNF B;  1WHW A;  2P2C B;  4C0H A;  1CSJ A;  2N4C A;  3IS9 B;  5KFZ A;  1BY9 A;  2B8Q A;  4F4Z A;  1RT4 B;  2DHX A;  1HWL A;  2E5L J;  2XS2 A;  2V9K A;  3FC9 A;  3M6U A;  3CCJ S;  1X5O A;  2JRS A;  1JLF A;  2B3T B;  5L38 A;  2YNI B;  3L3C A;  3P45 B;  3DLH A;  1Q7L B;  3GYG A;  3IM9 A;  3PAC A;  5KFP A;  1Z2Z A;  1EP4 B;  4WFA Q;  3EE3 A;  2C2D A;  1LFW A;  1X4C A;  1FRK A;  2RKI B;  2AZ1 A;  1YJV A;  2XC9 A;  3MEE B;  3AD9 C;  3TX8 A;  2YKM A;  4URQ U;  3RUB L;  4HT5 A;  2R9L A;  5B7W A;  3FQK A;  4LRA A;  2LU1 A;  4GO5 X;  5HMX A;  4NA3 A;  2CNL B;  4DBQ A;  1VQ6 S;  2HHQ A;  4N76 A;  4WU2 A;  1ITP A;  1TMM A;  3P3D A;  4C4W A;  4UOF A;  1BLU A;  2EK1 A;  4UQT A;  3NGS A;  1S1W A;  4EK2 A;  2MLZ A;  1RU1 A;  3OSP A;  1VRT A;  3I5C A;  4ZLJ A;  1RT5 B;  2I0X A;  3D54 A;  2AWZ A;  1UW4 A;  4C8K A;  3UW1 A;  3AOC A;  5KT4 A;  4F7V A;  1EKR A;  1RYR A;  2HPU A;  3KLE B;  4ZMM A;  3NWG A;  4H4O A;  4GC6 A;  1WC3 A;  4GKJ F;  2BE2 B;  2XMA A;  2GFF A;  3GG1 A;  1CPZ A;  4RJV A;  2RVJ A;  3KWM A;  4PG4 A;  4LBI A;  2MTL A;  1P1T A;  2VA3 A;  1IKX B;  2FUG 9;  2HWI A;  3SIP B;  2G0C A;  1BUX A;  1UA1 A;  2P6S A;  4ID5 B;  4KKO A;  2UUC F;  2J0X A;  1C1C A;  1VQP S;  2IC3 B;  4F4A A;  3D0H E;  1RIS A;  3A3P B;  3DU5 A;  1QAI A;  1MRO A;  2RQK A;  1IKV A;  2HRY A;  1GMW D;  2D74 B;  2ZZN A;  1HNI B;  4QIG A;  1IBK F;  1JJH A;  3C6U A;  5EWG A;  1HQU B;  3P49 B;  3JYT B;  2K3K A;  3SSS A;  3NEK A;  4B9U A;  2G1D A;  3UN3 A;  2X1F A;  4C8L A;  1CJV A;  4DI6 A;  2GX8 A;  3MED A;  1Y3K A;  3OBI A;  3R9L A;  1WDD A;  2V8H A;  5A8W A;  3CC2 S;  4ZVG A;  2E1A A;  4RZR A;  1NUE A;  2GA7 A;  2VUG A;  4GKJ J;  1Q0N A;  3PX6 A;  1KEK A;  4WZM A;  5ETM A;  2DNY A;  1VR6 A;  4LSL A;  2ADB A;  1JJ4 A;  3MMC A;  1TZ0 A;  5CXT A;  2UUC J;  1B4S A;  4OZN A;  1IKY B;  3HJV A;  4DR2 F;  1YBU A;  3CNQ P;  2V2Z A;  1BQN A;  3V4I A;  4EBD A;  2F65 A;  2J9D A;  5A8K B;  1YJW S;  4JI2 J;  1KLM B;  1K8A T;  2V50 A;  4ZPV R;  3S6E A;  5KFO A;  2G4B A;  1S1U A;  1IKW A;  4F2S A;  4DUZ F;  3E51 A;  3JAM U;  4HR2 A;  5IT9 Y;  2WOM A;  3AOB A;  1IBK J;  4C0B A;  1VQM S;  3EJM A;  2AJ1 A;  5T14 A;  2L9N A;  3R6L B;  2MZR A;  1GMW A;  1FX4 A;  1W26 A;  2CAJ A;  2NLW A;  4R5P A;  3CD7 A;  1SJR A;  5J2Q A;  1PSD A;  5LXY A;  3A8J A;  5H1S V;  1NKB A;  3H8Y A;  2CXE A;  4C7Q A;  5HP1 B;  2WBR A;  4YOE A;  1RT7 B;  2ZH6 A;  4DCP B;  3FDS A;  4TYA A;  1IBL F;  2UV8 A;  3H20 A;  3DLG B;  2D3O R;  1HQE B;  2VA2 A;  3LPY A;  1J5O B;  2X3D A;  3KJV A;  1UFK A;  4DUZ J;  4F4Y A;  1TU0 B;  4ED4 A;  3PO4 A;  7FDR A;  3LAN A;  4PG8 A;  4RU2 A;  1X5T A;  4JI5 F;  5KFJ A;  2XS7 A;  1CG2 A;  1CJK A;  4EYI B;  3ZZZ A;  2XZW A;  3IWL A;  2NZ4 A;  1RAI B;  2OFG X;  4PAA A;  4B3O A;  2BAN B;  3LP1 A;  3X1L B;  3ZC4 A;  1N33 J;  2LP4 A;  2CPI A;  4MK8 A;  3K17 A;  1SQF A;  3D2W A;  1TMJ A;  4DV7 J;  3RAQ A;  3R5J B;  2N4D A;  3ZZT A;  3DMJ A;  3W8P A;  2R4F A;  1NAQ A;  3MTK A;  1BWV A;  4ETX A;  3N28 A;  3IR6 B;  3I56 S;  1ZZF A;  3KLH B;  3AJ1 A;  1UMJ A;  4UUX A;  4KJI A;  1YGY A;  1KHV A;  2YWH A;  2LXI A;  1X0F A;  4FF4 A;  2JVO A;  5HAO A;  4P2X A;  1H7X A;  4JI1 F;  1BD6 A;  3DGP A;  2QMU B;  1BQX A;  4ZKA A;  2EFQ A;  1XER A;  3TAM A;  4NEZ A;  2ZE2 B;  3I4P A;  2JVR A;  3A4T A;  3H40 A;  2OJ3 A;  2E5J A;  4JI5 J;  4DLG A;  2IAJ B;  2E9T A;  3G9C A;  3MGJ A;  4WP8 A;  4O0N A;  1MN9 A;  1FX2 A;  2BKN A;  3RB6 A;  2YKN B;  3KUE A;  5K8P A;  3MD1 A;  5HSP A;  5G4D A;  1U1M A;  4CTA A;  3DLE A;  3C16 A;  3D6T B;  2KXF A;  2GIQ A;  4GO7 X;  2R8I A;  1JLC A;  1QJH A;  1TUW A;  2Y8Y A;  3EPI A;  2CDQ A;  5EDW A;  3MR3 A;  2H1Y A;  4NL5 A;  3GWC A;  2VG6 A;  4UOC A;  3GFZ A;  1N5Q A;  2CUY A;  1TEL A;  1FNO A;  1MN7 A;  5KFS A;  3HVW A;  4OYA A;  1I94 F;  3DRP A;  3QWU A;  2XY6 A;  4DFP A;  3KJF B;  4GVL A;  2QL5 B;  3D67 A;  4DSL A;  4DR7 J;  4KPY A;  4BHQ A;  5EWE A;  2ZH3 A;  1R0A A;  1Z1Z A;  1YLX A;  5FDL A;  3O8W A;  4FVC A;  1W7W A;  1CC8 A;  1VYA A;  3ICL A;  2HHW A;  3BF4 A;  4U7U K;  2OAU A;  3CTR A;  5HO4 A;  3DRS A;  3LOU A;  3M8S A;  2NPI A;  4NX9 A;  2V8G A;  5DS7 A;  3PJX A;  1ZAX A;  1E6Y A;  3RTV A;  2V94 A;  4F4X A;  3CO9 A;  5BYS A;  2GQQ A;  3GIJ A;  3GPA A;  2NYI A;  3SQG B;  4DV3 F;  2HQC A;  2R2U A;  4RW4 B;  3QFH A;  2HS0 A;  5D4L A;  2YY3 A;  1YJ9 S;  3T9Z A;  1SKR A;  1SJ3 P;  2CA9 A;  2MZQ A;  3RRK A;  5IS2 A;  2E5H A;  2CJX B;  4Q7A A;  2Z2L A;  5EHH A;  3DOL A;  1I94 J;  4OI0 A;  2ZH9 A;  2A6M A;  9RUB A;  3SCI E;  1RWU A;  3KTQ A;  3TVZ A;  3KKF A;  1IJE B;  4DX5 A;  3VAH A;  1Q95 G;  4FYY B;  3NNA A;  2OPQ B;  5IWA F;  4N5S A;  3KK1 A;  1S76 D;  4X4N A;  2DHA A;  1RT1 A;  2CZ4 A;  1DTQ B;  3M6X A;  4K4U A;  1DBD A;  1OWX A;  1REV A;  4PQU A;  1R3N A;  1YRU A;  4KY3 A;  4H4K A;  3NMA A;  3UVJ B;  3OUY A;  1HWI A;  1K0T A;  3PW2 A;  3GZ7 A;  5IC6 B;  1JLG B;  2OPS A;  3CMA S;  3C2P A;  2XZT B;  2H48 B;  2OEJ A;  3MM6 A;  5DLF A;  3PR4 A;  1RDR A;  2PMH A;  2Q79 A;  3VGU A;  2B6A A;  2FZC B;  1KVK A;  5A8R A;  3JXO A;  3CT9 A;  3LUY A;  2VDI A;  9ATC B;  2HVD A;  2ZEJ A;  2GIR A;  1GMU A;  2XMU A;  3CCL S;  4WFX A;  2MZJ A;  2OPR B;  1RCO B;  1YIJ S;  1N0U A;  3FFI B;  3MEC B;  4CO4 A;  5K8M A;  2VHG A;  1N8R T;  4BLG A;  4WXW A;  1RTZ A;  3PV8 A;  4IOC Q;  4JUZ A;  5KG2 A;  1SC6 A;  2GHW A;  5GME A;  3M1V A;  3OSN A;  5IWA J;  1RI7 A;  2ALZ A;  2MZT A;  1DQ8 A;  2CJY B;  2PO4 A;  2FVC A;  4IH5 A;  1IBM F;  2HVH A;  3RG6 A;  3K7R A;  2LQ9 A;  2HNY A;  2J9D E;  2I5J A;  4ZIV A;  2CPF A;  5CCL A;  1TKZ B;  4K4S A;  1R8A A;  1YKW A;  1G4C A;  4M5I A;  1RTI A;  1D9D A;  2R2R A;  1ZS6 A;  3CJK A;  1UKU A;  2F1F A;  3RYL A;  3N0V A;  2QC3 A;  1FTR A;  1R0C B;  1MLA A;  5I42 A;  5E41 A;  1RTJ A;  5E3C A;  2HS4 A;  3TEG A;  3MMB A;  4JV1 A;  3TA1 A;  4P73 A;  4ECR A;  3H2V E;  2WSE C;  3JSR A;  4LF7 F;  3M2R B;  2VD3 A;  4EZ6 A;  1NME B;  1HPZ B;  2RH3 A;  1Z2L A;  3PFO A;  4DV4 F;  2HWH A;  3JTN A;  2CNN B;  4C2M A;  4OHX A;  4OX8 A;  2HFN A;  1WOR A;  3IAM 9;  5E0O A;  4KHR A;  4ILL A;  3M2V B;  3J7A 1;  2HBY B;  1KHW A;  3M9O B;  1FFG B;  3BKF A;  3KK2 B;  4L75 A;  1IVZ A;  4XO0 A;  4IG0 A;  1VGY A;  1JWW A;  1FJ7 A;  4I6W A;  2XO7 A;  1S79 A;  3MEG A;  5A2Q U;  4A8K A;  2KB2 A;  1S9F A;  3N6L A;  1FRJ A;  3FSI A;  1SH0 A;  3TAQ A;  2NS1 B;  2A2D A;  2XY5 A;  2LKZ A;  4CO5 A;  4PKD B;  2AW0 A;  2DRD A;  2UUB F;  1S4F A;  2J6U A;  2MMY A;  3PYG A;  4Y2M A;  2CQP A;  4Q0B A;  5J2N A;  4RW7 A;  4X4S A;  3DOK B;  4WXO A;  4NYP A;  1UL3 A;  3C3L A;  4LF7 J;  2AMC B;  1RT4 A;  2V2V A;  4DV4 J;  1LXN A;  4IQM A;  5F8I A;  5L1K A;  1IXK A;  4I56 A;  1X4B A;  3OTB A;  1VIS A;  5HVF A;  2GC8 A;  2DNG A;  4O4G A;  1FDD A;  4QIV A;  3OJS A;  2F7V A;  1FKP B;  2XHC A;  3Q8V A;  3QLH B;  1ZTT A;  5D15 A;  3OR1 B;  5L8R C;  4B9L A;  1HAR A;  4B9S A;  4E0D A;  3Q83 A;  5KG1 A;  4X64 F;  3RB0 A;  2E1R A;  4Y2A A;  2C3M A;  1HWK A;  4ZVQ B;  1HLW A;  3C14 A;  2GJI A;  3GFX A;  1VQN S;  2CJA A;  3W65 A;  3CJ0 A;  1NPK A;  3GON A;  2UUB J;  1H7W A;  4Y28 C;  2AZ3 A;  5KFN A;  2RDI A;  1XR5 A;  2EBE A;  3IXQ A;  5IT4 A;  1CS4 B;  2W9C A;  2BAB A;  4OHV A;  2ASL A;  3QGG A;  3GIM A;  1KQG B;  1Q81 T;  4FBT A;  3TZZ A;  4NRU A;  4B9V A;  3EDR B;  2JEF A;  3AB4 B;  3HD1 A;  2CQC A;  3QGP A;  2WVF A;  2OMO A;  3T6B A;  4OL8 A;  2BQ3 A;  4YUD A;  2CZV C;  1JLB B;  3CC7 S;  2BE2 A;  5LT5 A;  4FZV A;  1VC5 A;  4RW6 B;  2CPH A;  3M9N B;  2CRL A;  1H38 A;  1UJ6 A;  1IKX A;  3DLK A;  3PW4 A;  4O3Q A;  2XUL A;  3C8Y A;  1SL2 A;  2CPZ A;  1JJC B;  2F3J A;  4X64 J;  2ZM6 F;  3IFE A;  5M2R A;  1KFD A;  2ZZM A;  2IC3 A;  2KXN B;  2WW8 A;  2AHO B;  2BM1 A;  1UVJ A;  5T7L B;  4DG1 A;  4RNO A;  4Y3C A;  1T94 A;  2AV5 A;  3J7Z T;  1FWP A;  1VQS A;  5FD1 A;  1ZZN A;  2C28 A;  3PM9 A;  4DQS A;  3V2U C;  4DPT A;  2VPW B;  4YY3 J;  2JFK A;  2LDI A;  5KFT A;  2GQ2 A;  4JYA J;  5DQG A;  2C3U A;  2UXB F;  3VAM A;  2R7V A;  3CCZ A;  3IR7 B;  3KXD A;  4OJH A;  4U7C A;  1AA1 B;  2VFR A;  1VBY A;  1RXO B;  5KFA A;  3QAT A;  3KLI A;  1KD1 T;  2ZM6 J;  1S12 A;  4NCG B;  4OYZ A;  2UU9 F;  3MOZ A;  1JLE B;  2UUA F;  2VBX A;  1KLM A;  3EX7 B;  3BR8 A;  1SC3 B;  3ISN D;  4K4Z A;  3QRP A;  3WX4 A;  4QWC A;  3CVK A;  1KFS A;  1R27 B;  2H51 B;  3FSY A;  3QFW A;  1YZ6 A;  4ZPW R;  4W98 A;  4DX6 A;  4V19 X;  2QRR A;  2HMI B;  2BQU A;  1R89 A;  1S6O A;  4WPA A;  3IG1 A;  5AXL A;  1XN9 A;  4I4B A;  2B7B B;  3HD2 A;  5CYM A;  4I7F A;  5CZV A;  2W9A A;  5EX3 A;  1C4A A;  1GH8 A;  1Z4U A;  1S10 A;  3NCQ A;  2DIT A;  4ZIW A;  1NDK A;  3BYP A;  2UXB J;  1YRX A;  5HP1 A;  3FMW A;  5DET A;  4YR0 A;  3DGV A;  4NLQ A;  5AXK A;  3JSM A;  3G82 A;  1RAJ A;  3W2W A;  4I6Y A;  1V3Z A;  4RNN A;  1JMT A;  4FS2 A;  2G1H A;  4LF4 J;  3G6X A;  1SV5 B;  5LMN F;  1CJU B;  2WON A;  3FCH A;  2UUA J;  1URR A;  1YJR A;  4LQ9 A;  2AIR B;  3UFC X;  1GXL A;  4OZ5 A;  3QJJ A;  4AL5 A;  2BOA A;  1V3S A;  2LMI A;  3DHX A;  1S1T B;  1N0V C;  2IJN A;  3UN2 A;  1PJ7 A;  2HNZ B;  2DGQ A;  2GV1 A;  2V2K A;  1KOH A;  4RW8 B;  4ED1 A;  2DNZ A;  5HLF B;  4PCQ A;  2G13 A;  5B08 A;  1IN0 A;  1X4H A;  1X31 C;  3MR2 A;  3OPK A;  3CPW R;  4CNY A;  2F40 A;  1S1V A;  1DTT A;  3MFI A;  1RAF B;  2XY7 A;  1Q78 A;  3JTP A;  2NUU G;  5AXN A;  2ZOF A;  1UEU A;  3ENA A;  4Z2X A;  4DLE A;  3I31 A;  4IFV B;  4DV6 F;  3J80 U;  4RW9 B;  1RU2 A;  2MDA A;  4IO9 Q;  2NR0 A;  4HTI A;  1WKK A;  1RT6 A;  4WKR A;  3OLB A;  4CT9 A;  4CLF A;  2GW8 A;  1O6X A;  1FVQ A;  4HDH A;  5LMN J;  1LW2 B;  3V81 B;  3IRX A;  1RAC B;  1LOU A;  2OSQ A;  4RWW A;  1EHW A;  4M5L A;  3POT A;  1TK8 A;  3HO1 A;  3M8Q B;  1VJW A;  2CDR B;  1CLF A;  2E7W A;  4L74 A;  4JB8 B;  3TJ9 A;  4FYD A;  1NO8 A;  3PHT A;  4XPC A;  3P5B P;  2BRL A;  1UET A;  4I2Q A;  4PEO A;  2DEI A;  3FBF A;  2QGF B;  4DF8 A;  2XWX A;  5U47 A;  3E3X A;  4FP9 A;  4DJB A;  5HVH A;  4KRW A;  3NMR A;  1HNV B;  1U6B A;  2YNH A;  4ETZ A;  1S9E B;  1TP7 A;  4DV6 J;  2N7Y A;  2D3U A;  5GAH U;  4L72 B;  3TUJ C;  3W5Z A;  2PI4 A;  3R6G B;  3C66 A;  4O0I A;  4M94 A;  3WBZ A;  4A48 A;  3I9Z A;  5LL6 d;  3IAS 9;  3KHR A;  5IFM A;  4C3M A;  3SDE B;  3K89 A;  4Y6I A;  4ZK7 M;  2IM2 A;  3LP2 B;  2QMX A;  4KTQ A;  4CLW A;  2I6W A;  2ROP A;  1RWO B;  5F0W A;  3H2L A;  3GCX P;  2DHG A;  4UY8 5;  2RU9 A;  2VQE F;  3TVY A;  2A1B A;  5KFM A;  1C0T B;  1SVD A;  1HI0 P;  1ZA2 B;  1Y00 A;  1FRX A;  2LA6 A;  1RAD B;  2ZZT A;  2IM0 A;  3QAE A;  3ONQ A;  3K0J A;  3I0R B;  5HBM A;  3CDA A;  3VAJ A;  5LSR A;  3CCR S;  4ZLP A;  3HK2 A;  3BH6 B;  2KRR A;  4OYP A;  1NB2 A;  1VK8 A;  4R0J A;  4MIB A;  3G8S A;  1L3T A;  3H5S A;  5GAE I;  2VIC A;  1NDP A;  3B4M A;  2BDP A;  4QWE A;  3D6M B;  5F9N A;  2PMW A;  3QT7 A;  3AOD A;  1XIQ A;  2MB0 B;  4CZC A;  4I6A A;  4DR5 F;  1UVM A;  2QG9 B;  3EM1 A;  1MML A;  4LT6 A;  4ZVS B;  1U25 A;  5LJ3 Y;  1FDN A;  4LIR A;  3T1Y F;  2ZVS A;  5D3G B;  1TAQ A;  3HSJ A;  2JEI A;  3PVX A;  2AT1 B;  3IRW P;  2I9S A;  2DB1 A;  4LMZ A;  2P8I A;  1CJT B;  4O3R A;  4M5M A;  2I38 A;  1JLG A;  1C1B B;  1IWG A;  2Z4P A;  3D6F B;  4KC5 A;  3SYZ A;  1RQ0 A;  4KPC A;  4KGM A;  2W24 A;  4TLR A;  5ETK A;  2MKJ A;  3CCS S;  1GTE A;  2K3I A;  3B6B A;  3K5O A;  2V4J A;  2VG5 B;  1RHM B;  1FJC A;  3PJ9 A;  4DPU A;  4FXV A;  3GYX B;  2CJQ A;  1RT2 A;  1YIT S;  1LWC B;  3OTD A;  3CDE A;  1HWU A;  2RDD A;  2VFV A;  4Y2C A;  2EFV A;  4CDI A;  3TWZ A;  3BKT A;  2KO1 A;  1OY8 A;  2CQD A;  2EI5 A;  4NA1 A;  4OX6 A;  2NSC A;  4CLK A;  4DS4 A;  2XYG B;  4QW9 A;  3MFH A;  4ELU A;  3CJ4 A;  2RJZ A;  2QJ3 A;  4F02 A;  5KG0 A;  1N52 B;  5AXM A;  2M8H A;  3EZO A;  3DDK A;  1HBN A;  2XEX A;  3GIK A;  2D9P A;  5DLG A;  3GLJ A;  1H6K X;  1X8D A;  2PA8 D;  1HW9 A;  4HAC B;  4QJV A;  1WTF A;  4GRS A;  5L1J A;  1YVF A;  3QQC D;  3V6D B;  5AT1 B;  4DR3 J;  5L46 A;  3CJ2 A;  3D3B J;  2BJ7 A;  3W9I A;  4F2R A;  2DGS A;  4EMD A;  2B9W A;  2R8K A;  1JXV A;  1S6U A;  2QE5 A;  4JI4 F;  4PXB A;  1Y5I B;  5KT5 A;  4O3O A;  3H98 A;  1JKH A;  1H74 A;  3W64 A;  1B70 B;  1YG0 A;  2D69 A;  2V5H G;  1S1X B;  4U9R A;  2WVB A;  4Y00 A;  4JI8 J;  2KH9 A;  1Q8K A;  3VGS A;  1RAO A;  3PYE A;  1FKO A;  4Z37 A;  5DM7 Q;  4UZB A;  3KK2 A;  1T3O A;  1F1B B;  1SUQ B;  2HBQ B;  1KR4 A;  1ZM4 A;  3HVT A;  2HGN A;  5AJ3 J;  2DGT A;  1PJ6 A;  3NGU A;  2B9X A;  5L1L A;  1X9M A;  2B7C B;  4JOU A;  3Q8S B;  4R8U A;  4TY9 A;  3G2X A;  4Y65 A;  1CEZ A;  2FZG B;  2RUS A;  4F4K A;  3N01 A;  4M5K A;  4G1Q B;  1AZS B;  2DKO B;  3GJT B;  4QWB A;  5GAD I;  1WC0 A;  4ID8 A;  1RWN B;  2B56 A;  2JFD A;  2CQI A;  1RLD A;  2JJ4 D;  4K0K F;  4TY8 B;  4JI4 J;  4ZVE A;  5EGY A;  2FLN A;  2AKW B;  2YWF A;  2WSC C;  1UWB A;  4L76 A;  4LSN B;  2PT0 A;  1ZAV A;  4QIF A;  3I5B A;  2HSE B;  1TKX A;  3HFV A;  4DSJ A;  4NCA A;  1P9Q C;  3WIV A;  2KG1 A;  4JI7 F;  2LQJ A;  1TL1 A;  3NS7 B;  3CCU S;  3VZH A;  1RT3 A;  1XMO F;  2FZK B;  2LEA A;  4LFA F;  5A2Q Y;  5ETV A;  4N56 A;  2DEJ A;  5F8N A;  1L3V A;  2FYX A;  1WC4 A;  4X2B A;  4QIE A;  5JVG Q;  1YDL A;  1QUP A;  5B0G A;  3EVM A;  2R42 A;  4EUV A;  4P71 A;  1KQK A;  4M5G A;  3TAN A;  1H2T Z;  2DVI A;  3HVR A;  3M6W A;  2O1P A;  2Q6B A;  1U8S A;  4JBC A;  1E6V A;  5HL7 Q;  4FYV B;  4KO0 A;  2AJF E;  3PO5 A;  1F2H A;  4IG3 A;  4KGK A;  3GR1 A;  4HH1 A;  3Q2T C;  2PA3 A;  4K0K J;  3R5G A;  4ZCM A;  5H9F J;  2ZKU A;  2N3O A;  1DY3 A;  4K4Y A;  1XK8 A;  4A47 A;  1UZH A;  1JNR B;  2ROE A;  3M2U B;  1F9E B;  5HQM A;  2MQ8 A;  2B9Y A;  1YK9 A;  5DG7 A;  1JLB A;  3LWL A;  4CH0 S;  1RGV A;  1KQF B;  4DPX A;  2YWK A;  3OT9 A;  2EBG A;  1XMO J;  5D4O A;  4LFA J;  1HI8 A;  4JV5 F;  4NLG A;  1QE1 A;  1S6P B;  2RQ4 A;  2KFZ A;  1EET A;  3W66 A;  4RUC A;  1BE4 A;  1CUL A;  1CBK A;  4QU7 A;  2YX1 A;  1U1P A;  1NKC A;  4NI2 B;  3AD8 C;  2KFN A;  2YKA A;  2AF6 A;  3HP6 A;  4OJ3 A;  1AYE A;  1I51 B;  1RA7 A;  4ECZ A;  3FJ2 A;  2HFZ A;  3J81 U;  1TV6 B;  3ZTR A;  1TVR A;  2ZNZ A;  3LF0 A;  2OPP B;  4QZV B;  3Q8P B;  3NOG A;  3PG9 A;  3BGR B;  1S9G B;  4AYB D;  3T9N A;  5B0C A;  4PG6 A;  1LWF A;  4OZ1 A;  4USU A;  2JZ5 A;  1Q16 B;  2XB2 D;  4ECT A;  4ZHR B;  3R97 A;  1SQG A;  1N88 A;  4GVB B;  5CAB A;  2DCL A;  2FVQ A;  2DXD A;  4MYU A;  2CPJ A;  3KLG B;  3NOC A;  4F50 A;  2IMW P;  2VZ9 A;  4MKY A;  5C24 A;  3GJR B;  2GGP A;  4NLT A;  1MU2 B;  1P6T A;  1FFS B;  3FEZ A;  5F0U A;  3SXL A;  1K0V A;  4JV5 J;  4A8W A;  3J7Y U;  3E01 B;  1RTD B;  2GAH C;  4YR3 A;  1CQN A;  1GFW B;  1HBO B;  1VLO A;  1YBA A;  2XMM A;  4G1I A;  3KHL A;  2QL7 B;  1JLE A;  2MEW A;  5CH7 B;  3MM9 A;  2KL8 A;  1WD6 A;  4RWX A;  3ETO A;  4P75 A;  1OJ4 A;  3LWM A;  1VK3 A;  4BS2 A;  4XPE A;  3RBE A;  2XSJ B;  4ALZ A;  3UPF A;  2ZC4 A;  3ZTO A;  4FF1 A;  5HAN A;  5DDQ C;  1RTH B;  1NSA A;  4CO2 A;  1L3S A;  3N9U C;  1OPZ A;  1XJW B;  4LRF A;  2YTC A;  3ITH A;  1ULR A;  3QT8 A;  3OFF A;  3W5Y A;  2DPI A;  1NK4 A;  2IM1 A;  2Q3P A;  3FZ2 A;  2KDO A;  3M8R A;  3DXS X;  5C42 A;  4DL4 A;  3W63 A;  1SC1 B;  4NLP A;  3NCR A;  3B78 A;  4G6V B;  4P2M A;  4ENO A;  3UDV A;  4ZP6 A;  3O44 A;  4MKA A;  1O51 A;  2ZFH A;  4RU9 A;  2EK6 A;  3TO8 A;  4ERD A;  1QTN B;  2R7X A;  3OLA A;  2D1C A;  2DNL A;  3AT1 B;  4OYW A;  4N8O A;  3OL6 A;  2E44 A;  1OYD A;  3V5R A;  4EBC A;  5H9E J;  2CNO B;  3VGT A;  2ACY A;  3MI7 X;  1V3R A;  5LSO A;  5B0B A;  1S1T A;  1KC8 T;  3CCE S;  1N6Q B;  3KG1 A;  3KDN A;  3I0S B;  3C19 A;  3SMZ A;  2LEC A;  1NM2 A;  1LW0 B;  2Z56 B;  1VRQ C;  2HHH J;  4O44 A;  5LJ5 Y;  2XI3 A;  2DXF A;  2Y1L B;  4X4Q A;  2HBZ B;  1PBU A;  1EQ0 A;  3PRV A;  4I2P B;  2RSQ A;  4IH6 A;  2CPE A;  2A6O A;  1HD0 A;  3JB9 k;  4CH1 A;  3AA9 A;  4DU7 A;  5DGB A;  4FDF A;  2W2N P;  3C6T B;  3R7S B;  4RW9 A;  2AX0 A;  4HHH A;  3FSX A;  1UPM B;  4H4M B;  4IRD A;  2K1R A;  2CJB A;  4RO0 A;  2C2K B;  3FNN A;  3NXZ A;  3ZFV A;  3HLU A;  1TR0 A;  2J7W A;  1RHJ B;  4Y2K A;  1PO6 A;  1LW2 A;  3QSI A;  2E1M C;  4OYM A;  4NXN F;  2X1A A;  6AT1 B;  3QYY A;  5I3Q A;  3GV5 B;  2OEM A;  1Q53 A;  3W2V B;  2IFX A;  4OX9 F;  3ILJ A;  1Q86 T;  4IFY B;  4ZLN A;  4OZ0 A;  4LVO P;  4BC7 A;  4X4V A;  4YN3 B;  2H65 B;  3V6H A;  1VC6 A;  1I3O B;  3R5A A;  1KKH A;  1D0E A;  4DN0 A;  4DF4 A;  2CQG A;  4N8N A;  1V9O A;  3R2D J;  1CVJ A;  1DHM A;  5A6W A;  5G0R B;  3QRQ A;  4ZDN A;  5ETP A;  2KT2 A;  2BBE A;  2YPZ A;  4NA2 A;  2CKW A;  3MWB A;  1HI1 A;  1N54 B;  4KIA A;  4K8R A;  1NXI A;  4M8L A;  1BQM A;  5KT7 A;  1NH8 A;  3K8V A;  2NXE A;  2C2E A;  1S9E A;  1WAC A;  5DG9 A;  1VC0 A;  1HYS A;  1UJ4 A;  2W9B A;  3A3O B;  3DN9 A;  1FEH A;  4YDX A;  2JWN A;  3TJ8 A;  2E1C A;  4S0M A;  4NXN J;  1FHT A;  4MK7 A;  3CD0 A;  3NGR A;  3OJU A;  3VHQ A;  1PJ5 A;  3ET6 B;  1U0S A;  3DRR B;  4LUB A;  1S7H A;  3RB4 A;  3M7V A;  1T11 A;  4OFZ A;  4PWD B;  1WWH A;  2VH7 A;  1XC9 A;  1RA6 A;  3QGI A;  2LEP A;  3R7B B;  1RK8 A;  4HYK A;  2ZD1 A;  1NPP A;  2Z0G A;  1WI8 A;  2GQC A;  1VQK S;  3IM8 A;  2QIF A;  1K9M T;  1U26 A;  2RQC A;  1X7V A;  1UWA A;  4DEZ A;  4FBU A;  4U95 A;  2ZWO A;  2QA4 G;  4WE1 B;  3Q0A A;  3HMJ G;  1GNK A;  3RU0 A;  4PUO A;  5KFE A;  1WEL A;  2AYE A;  1U0H B;  5KG3 A;  2J7K A;  1X4F A;  2FC9 A;  3C15 A;  4I68 A;  2NSB A;  1QTM A;  2I8E A;  2HFS A;  2ZBC A;  2BW7 A;  3JTO A;  1H2V Z;  3ZTS A;  3RGI A;  1FTC A;  2HKE A;  2HZV A;  5D0E A;  3TZX A;  1K1Q A;  3UQS A;  3HSG A;  1WC5 A;  1O8B A;  4HT7 A;  2XLK A;  2XHW A;  1XMQ F;  4CLZ A;  3FZB A;  4JI0 F;  1V5V A;  3VR1 A;  2XMJ A;  3DI6 B;  2BR0 A;  4MJK A;  4X66 F;  1B0V A;  1NCL A;  2DJW A;  2LEB A;  2R8J A;  2C3Y A;  5J2P B;  3BPD A;  3DRX A;  3PNI A;  1L3K A;  5I3U A;  5HMW A;  4ER8 A;  2WBM A;  4ZP9 A;  1TK0 A;  2K06 A;  3PIP Q;  4F67 A;  4OJG A;  3DLJ A;  1AT1 B;  4KSE B;  5HJY A;  4TLQ A;  4BWM A;  1S6Q A;  1S48 A;  2CPY A;  4M5H A;  3QRR A;  5EWF A;  4EBE A;  4C8Y A;  3HJF A;  2ZJR Q;  4OHZ A;  2AGO A;  1U1O A;  1KP6 A;  2DNM A;  2ZHA A;  1XMQ J;  1LWE A;  3MUT P;  3M32 B;  3UNG C;  3PXG a;  5IQQ A;  3QO9 A;  4OI6 A;  4X66 J;  3FCW A;  1NLK L;  4ZPC A;  3A8K A;  3L4B C;  1ZM9 A;  2HK2 A;  3CCV S;  1F2G A;  4N7T A;  2BVZ A;  1Y11 A;  4P9S A;  3JSB A;  4TQS A;  3HF5 A;  4HKQ A;  4KH0 B;  3UR0 A;  1FK9 B;  2FHK A;  3UD5 A;  2PDA A;  3W3S A;  3CED A;  2JDJ A;  1Y5L B;  4U67 Q;  2QFJ A;  1JLA B;  1VCT A;  2NCK L;  3WZ0 A;  4PZV A;  2ZDP A;  4U7U D;  1WEX A;  3BBC A;  2BJ1 A;  4MIA A;  4NCB A;  1K73 T;  2QV6 A;  1Q8L A;  3TP2 A;  2DTJ A;  1LQ9 A;  1NK6 A;  4QR1 A;  3EGN A;  4FXW A;  1I6J A;  2YQ3 A;  1NHK L;  2F9D A;  1K44 A;  5KFV A;  2ZJP Q;  2FGO A;  2YNG A;  3CDU A;  3ZZ0 A;  3KLF A;  4F36 A;  4QPT A;  3HFK A;  1LV5 A;  2BX6 A;  1WJ9 A;  2R7W A;  1JK9 B;  1HFE L;  5J1E A;  1RWW B;  1SJQ A;  4ICL A;  5B0A A;  4FN5 A;  5K8O A;  5K9F A;  3N5B A;  1MWZ A;  2V8V A;  1XEZ A;  3HHL B;  2OEK A;  4CCH A;  1QY7 A;  1HBM A;  4MKV A;  2RRN A;  4LF5 F;  4TNO A;  1X5S A;  1N56 A;  1BXN A;  2RB7 A;  2VV5 A;  1GQE A;  4C8M A;  1VRU A;  1HNX F;  3CIM A;  3G4S S;  5LXR A;  1WTB A;  4C8N A;  1SQE A;  1T95 A;  1NZA A;  4QBU A;  2CWK A;  5F3T A;  5I4M A;  4RUB A;  2U1A A;  4FS1 A;  1HQ2 A;  2HIY A;  2AJ4 A;  3BGL A;  3LGM A;  1U6F A;  3BN4 A;  4A8Q A;  1IWA A;  1M5O C;  2E66 A;  1BMQ B;  2DH9 A;  3IWX A;  2DO0 A;  2GS8 A;  3TA2 A;  4LRD A;  4QWD A;  1F5A A;  1TL3 A;  3WIU A;  3MM7 B;  3Q23 A;  2FLO A;  1XNR F;  4CYU B;  4YB7 A;  4A8X A;  1N5Y A;  3Q8Y A;  2M70 A;  3MZI A;  2KJV A;  3BN7 A;  3W7B A;  3B8H A;  3D0G E;  4LF5 J;  5THW A;  1T9T A;  3VQT A;  3R3T A;  5E3Q A;  3RBD A;  2DR6 A;  2R7Q A;  3WC0 A;  2XM3 A;  2O67 A;  5CYJ A;  1HNX J;  3M2U A;  1YJ7 A;  4CRJ A;  1HNZ F;  4DFJ A;  2FJW A;  2EC2 A;  4QW8 A;  4DN9 A;  1GEH A;  4USV A;  2GO9 A;  3S8S A;  1NDL A;  2EFG A;  3KUG A;  1WEY A;  2VPY B;  3HHK A;  2ASY A;  4WK1 A;  4C8Z A;  4NOH A;  4Q5V A;  3MPW A;  1OIA A;  1PIE A;  3M30 B;  2EPI A;  2RU3 A;  3OR2 A;  4DV0 F;  4J9N A;  2XG8 A;  3I9V 9;  1KTQ A;  5CQG A;  1VHF A;  2Z8Q A;  1RWX B;  2OH2 A;  3DLL Q;  2FJA B;  2QTW A;  4JI2 F;  3HT0 A;  3AXM A;  2IY5 B;  1PYT A;  2OHD A;  1XNR J;  3QIP B;  1PC4 A;  2YQ1 A;  1B0T A;  1SKU B;  2HIQ A;  3H2U B;  1WOP A;  1JLF B;  3CJQ A;  3MTJ A;  3MF5 A;  3D1Q A;  3KUH A;  5GAH I;  2R2S A;  2IA6 A;  2BOP A;  1H73 A;  1X4E A;  3KJQ B;  2DY9 A;  1HHQ A;  2B5J A;  4KFB A;  3BGR A;  1S9G A;  2BRK A;  2W1B A;  5CCM A;  4JV2 A;  4HEA 9;  3OVS A;  3U02 A;  2BAC A;  2DRB A;  3P6Y C;  3BQ2 A;  1HNZ J;  2PFF B;  1ZOT A;  1KLN A;  2M2B A;  1DJ0 A;  3OFG A;  1SCJ B;  5KOW A;  4ZVT B;  3U27 A;  4BBY A;  3ZO7 A;  2C22 A;  3CDB A;  3KK3 A;  1V5I B;  2YKQ A;  3PEJ A;  3QGH A;  2R2T A;  1XNQ J;  2ZOM A;  2COL A;  3MAA A;  4AQY F;  4NLV A;  3G71 S;  2AD9 A;  3G86 A;  4HH0 A;  1U1Q A;  1MU2 A;  2DR5 A;  4HI2 A;  2SXL A;  3PZP A;  2VPZ B;  4DV0 J;  1T9X A;  3DCA A;  4ELT A;  2FY8 A;  1M90 T;  2HHT A;  1GXU A;  2V34 A;  5DZ7 A;  1RTD A;  2KJW A;  3AA8 A;  1KOO A;  3RZA A;  1S1W B;  5E5N A;  2OI2 A;  1JJ2 R;  4XDC A;  3CUL A;  1VRT B;  2QFI A;  1KN6 A;  1ICE B;  5AE1 A;  4UZC A;  1A0O B;  1FDA A;  5KT6 A;  4Q8E A;  3J81 Y;  4H4O B;  2QSF A;  1VQ9 S;  3GMG A;  4J37 A;  4K5S A;  2F4V J;  2DHH A;  2VC0 A;  1U8W A;  5A0Y A;  3O2I A;  2EFP A;  1AW0 A;  1FER A;  2PFD A;  4HI1 A;  3WDO A;  1TL7 A;  3HVA A;  3D6H B;  1NJZ A;  4TYB A;  4KKO B;  3CUN A;  1C1C B;  1N33 F;  2JOQ A;  3GFH A;  4DV7 F;  3VAK A;  2HVE A;  1MRO B;  1X0P A;  2H4Y B;  1VMB A;  4AQY J;  2CPD A;  3U1M A;  3ZNU A;  2XGQ A;  1U48 A;  5ETN A;  2BJ9 A;  4C6A A;  3DOM B;  3C6U B;  3RR7 A;  4CP5 A;  2HVI A;  2XLI A;  3W8G A;  1TKT A;  1FJG F;  3NGK A;  1UP1 A;  5F9L A;  1CJV B;  1X4D A;  4RR5 A;  3MED B;  1NJW A;  2XCA A;  1QDU B;  5A8W B;  4KHP F;  2FLL A;  1S4E A;  3OV7 A;  3PR5 B;  2DGX A;  2E9R X;  1G1X A;  3HX9 A;  2CPX A;  3BV8 A;  3MPD A;  4KB7 A;  2D9O A;  1RBA A;  4YB5 A;  4K2J A;  4LSL B;  1WC1 A;  2DD8 S;  3MMC B;  4P52 A;  4B9M A;  2QX0 A;  1RKI A;  2C3P A;  1N36 F;  1DRZ A;  3NL0 A;  1HMV A;  3K2Y A;  4J9S A;  3EVO A;  1BQN B;  3V4I B;  2CYY A;  2EFO A;  2FTR A;  3BPS P;  4L6V 3;  3PRB A;  1UVL A;  1ZPW X;  2IVM A;  1WDT A;  1UA0 A;  1MG7 A;  3BSN A;  1OSC A;  2IJR A;  1S1U B;  1FD2 A;  2MJN A;  1IKW B;  3PW0 A;  3FRZ A;  1M5V C;  4NWB A;  1RJJ A;  2JEG A;  4CT8 A;  2WOM B;  2FD2 A;  2QA2 A;  4F0H A;  4PPZ A;  2BE7 D;  4ED6 A;  3NBP A;  5B0D A;  4Y2I A;  1FJG J;  4DSE A;  3MM5 A;  2W7O A;  3OHB A;  1FT8 A;  4DR7 F;  1B7Y B;  2KG0 A;  1DZ5 A;  1X9S A;  1XWL A;  5J2Q B;  4URS A;  2ASD A;  2VG7 A;  3M8P A;  2ABY A;  3P96 A;  4KHP J;  1IR0 A;  4MKB A;  4DQQ A;  2B8P A;  2HND A;  1T02 A;  4LFC F;  4ZP7 A;  1U45 A;  4X4R A;  4USK A;  1K1S A;  2KYX A;  3OTO F;  2R8G A;  3MDF A;  1S49 A;  1EQM A;  4K4X A;  5HMZ A;  2UVU A;  2J6S A;  1XR6 A;  2RAQ A;  3HCX A;  1N36 J;  1TFW A;  2Z30 B;  3I5A A;  4ECX A;  3R1H A;  2BUN A;  2K7J A;  2Y1J A;  1N5T A;  3MUV P;  2P9C A;  4DOZ A;  2XYH B;  1VOM A;  1F5B A;  3KJV B;  2LA4 A;  4O3S A;  4EI2 A;  3W60 A;  1G6B A;  4A8Y A;  1OPI A;  4ITS A;  2XBP A;  2DIS A;  4YQW A;  4ECW A;  1CJK B;  5C25 A;  1RHR B;  3J7A N;  5T41 A;  2FHJ D;  2EKY A;  2FVP A;  2QN6 B;  2CFX A;  2V68 A;  4NMX A;  3SCJ E;  4B3O B;  1JXL A;  3TEH B;  3JQK A;  1WF0 A;  1TK5 A;  3KNA A;  4LFC J;  3F73 A;  3LP1 B;  3PEH A;  1U2F A;  1T05 A;  3OTO J;  3UCU P;  1VQO S;  3R5B A;  4RPF A;  3DMJ B;  1DQ9 A;  4NLW A;  4L3N A;  3IC1 A;  3PKM A;  4UY8 T;  1FWK A;  1DFD A;  3M8W A;  3ZZU A;  3VAI A;  2YH0 A;  2D3O 1;  2HQG A;  3DGP B;  5K14 A;  2LFV A;  4MH8 A;  3US5 A;  2DR7 A;  5EN1 A;  1H0H B;  1RP5 A;  3TAM B;  5KFF A;  2RF2 B;  3K5M A;  4NE9 C;  1VJQ A;  1BHN A;  2V0N A;  2IM3 A;  4AXJ A;  2RIJ A;  2VL1 A;  4LQ3 A;  4A4J A;  3NGD A;  4YB1 P;  5IQ6 A;  4ECQ A;  4BC9 A;  1FO1 A;  3AJ2 A;  2NPF A;  3BDE A;  3MMA A;  2DPJ A;  5DG8 A;  4OV1 A;  2MQL A;  4KE5 A;  3X3U A;  5DGA A;  4M95 A;  1U24 A;  4QYZ K;  2OFH X;  4CTA B;  2L48 A;  5HRO A;  3DLE B;  3BO3 A;  3C16 B;  1RZM A;  5DDO C;  2FHJ A;  2KYZ A;  4RX6 A;  3P8B B;  2HZC A;  2EVZ A;  1FXL A;  3DI6 A;  1QVG R;  4M5N A;  1M5H A;  2RHQ B;  2BEF A;  4M5D A;  4USW A;  2GVD A;  1FF2 A;  3MEK A;  3FUY A;  3DRP B;  4DL6 A;  4NYZ A;  5D0G A;  2BV3 A;  1OSD A;  2KT3 A;  3T6J A;  2NQP A;  2DK2 A;  4DR4 F;  3DFE A;  1OO0 B;  1R0A B;  5FDL B;  4ATN A;  4DR1 J;  4IQX A;  1DLO A;  4IDK A;  2VKZ G;  2AYB A;  5E3A A;  3THP A;  3BDP A;  1SKS A;  3B54 A;  2JLF A;  5KFI A;  2J8A A;  1T8E A;  3DRS B;  4ZVF A;  4LF6 F;  1IM6 A;  3UDL A;  2VQF F;  4ED8 A;  3I6P A;  1QAJ A;  1E6Y B;  3UNY A;  5ITH A;  3HHL C;  3M8Z A;  5KT3 A;  4A8O A;  5KFC A;  1D9A A;  3SV3 A;  4NEY A;  4C3K A;  4B02 A;  2WRM A;  2KM8 B;  2A10 A;  4NLD A;  3CDW A;  3DOL B;  2ILY A;  4MTP A;  3RR8 A;  3CJS A;  2LQB A;  2W2Q P;  3CF5 Q;  1YX2 A;  5EX0 A;  3TX0 A;  3DC2 A;  1NJX A;  2QO3 A;  5KFX A;  4C9D A;  4DR4 J;  1ZBT A;  3GSI A;  3UR3 C;  2IHR 1;  3VAL A;  2RML A;  3KK1 B;  1SL1 A;  3N6N A;  3QAU A;  1RT1 B;  1LK5 A;  4Z7C A;  1YQH A;  5FII A;  2CIM A;  1U1R A;  3T1H F;  2LDY A;  4PQU B;  3A3N B;  3W62 A;  1DAX A;  4AL6 A;  5F8J A;  3HT3 A;  4LF6 J;  2VQF J;  3OUY B;  2WAQ D;  5CD4 A;  2OPS B;  2QZ8 A;  4AXI A;  2MKH A;  5ETS A;  3FCV A;  3MM6 B;  4ILM A;  2CVE A;  1HBU A;  4RLE A;  4B3M F;  1Q79 A;  3PIO Q;  2B6A B;  4LR9 A;  4K2X A;  4QR2 A;  3TUI C;  1WNE A;  2O5D A;  1RWV B;  5A8R B;  4DL7 A;  2JX2 A;  1BWE A;  2B4O A;  4WP9 A;  1PCA A;  2XMT A;  3FVY A;  4FKX A;  4J9M A;  1AXQ A;  4ZJO A;  2R8H A;  2HEK A;  4UF4 A;  1U49 A;  2J76 E;  2IYG A;  3SFG A;  2B9E A;  2YNF A;  4DFM A;  3MCM A;  3B82 A;  2LVW A;  3R7N B;  1HW8 A;  3IS9 A;  4E2F B;  3M1V B;  2W4D A;  1VIO A;  3P4U B;  5C7P A;  2HWT A;  2YNI A;  1QM9 A;  1HD1 A;  4B3S F;  5K8N A;  2APO A;  3T1H J;  1H72 C;  3CJ5 A;  1S72 S;  3I96 A;  4DZD A;  2AEF A;  2HNY B;  1EP4 A;  7AT1 B;  3CD6 S;  5ETT A;  2HGM A;  2B4P A;  5HQL A;  5MLC V;  1RTI B;  2HUR A;  1Q5V A;  2RKI A;  2UVV A;  2HRT A;  3CJK B;  4B3M J;  2KFY A;  3MEE A;  3CJT A;  3CIZ A;  2PN6 A;  3M9M B;  2WZ1 A;  3BZQ A;  1XR7 A;  5I42 B;  1SPB P;  1RTJ B;  3GE9 A;  2KVI A;  3MMB B;  2QLB B;  4NLU A;  1B7F A;  4QYZ J;  2GVZ B;  2VC1 A;  3M6V A;  1RAE B;  1U1K A;  3FMB A;  2KI2 A;  2HBR B;  4KT0 C;  3TR5 A;  5KFY A;  1RHQ B;  2RE1 A;  2V4Q A;  2Z2Z A;  2X51 A;  1RT5 A;  1LK7 A;  1Y5N B;  2ZBR A;  4YY3 F;  1KON A;  3KLE A;  1SC4 B;  4DL0 C;  4CM2 A;  2YWE A;  4IG0 B;  3HHN B;  2FDN A;  1VIX A;  3CW2 C;  1RAB B;  4B3S J;  4JYA F;  4ZCK A;  4K50 A;  3MEG B;  5AE2 A;  3L9Z A;  4KHM A;  3G96 A;  2QLF B;  3I55 S;  4B3R F;  5D0H A;  3Q8R B;  1J5E J;  3QNW B;  2JC1 A;  3I32 A;  4CI0 B;  1U09 A;  4ED0 A;  1EZZ B;  3GJQ B;  1S7I A;  4ID5 A;  4NRT A;  3HXM A;  1Y7P A;  1FJE B;  2HHX A;  4FF3 A;  3W9H A;  3BH7 B;  4F3Q A;  2W8L A;  4Q0B B;  5J2N B;  3D1O A;  4ES1 A;  3S1T A;  4PPD A;  1SIW B;  4RW7 B;  1HNW F;  2JL9 A;  2ZHB A;  3QIP A;  2GZO A;  3MOJ B;  4TKT A;  1FXD A;  1HNI A;  4TU9 A;  3MUM P;  1HQU A;  4Z7Y A;  3JYT A;  2BYC A;  2B0G A;  4LSZ B;  4O4G B;  3NCP A;  1S0N A;  2UUT A;  2MKC A;  1IQZ A;  3EPG A;  2GML A;  2J9E A;  1SIZ A;  1LWX A;  1S0M A;  1SH2 A;  4NLO A;  2PC6 A;  4B3R J;  5GAE U;  3C14 B;  3THV A;  3OL8 A;  2HQF A;  5HN0 A;  3Q24 A;  4Q8F A;  5CAA A;  4OIX A;  4LF4 F;  1IKY A;  1RAA B;  4P2F A;  4J9P A;  5E33 A;  2IBO A;  4K4V A;  2W9C B;  3S7R A;  4DS5 A;  5A8K A;  4KV8 B;  3Q2S C;  5EUH A;  1HNW J;  5F3Z A;  1IR1 A;  2VFT A;  1X4G A;  2IRX A;  1FE0 A;  4AE5 A;  3DHW C;  4WYL A;  3CJ8 A;  2IBK A;  2DNQ A;  1KWM A;  4X4T A;  3NY0 A;  2GJF A;  2ZNY A;  1HHS A;  4F26 A;  5HI7 A;  6FDR A;  4DPO A;  4TN2 A;  2HK3 A;  4L73 A;  3N5F A;  3DLK B;  2PEH A;  4J9O A;  5A6P A;  5E7O B;  3PCO B;  2L08 A;  4W90 B;  1WOS A;  5ETO A;  4ZPT R;  5K5M A;  5K20 B;  4Y34 A;  4P74 A;  5HVG A;  4CLP A;  4QYR A;  3MUR P;  1EKS A;  2W4P A;  1RT7 A;  4DDF A;  2ACM A;  2BE9 B;  3H7H B;  1JXE A;  5ETL A;  5C5J A;  4DG1 B;  3MHY A;  1FRL A;  1RLC L;  3OFE A;  4URG A;  3CJR A;  3MAQ A;  1ZAW A;  2ROG A;  2QMW A;  3DOM A;  5C2G A;  3T5K A;  3DLG A;  1HQE A;  1WI6 A;  3ILO A;  1R7I A;  4DHV A;  1GAO A;  4QCL A;  1J5O A;  3JAM Y;  2CG4 A;  4DR6 F;  4USM A;  3UDE A;  3G87 A;  4HTJ A;  5GAG I;  2WVD A;  3BRE A;  4WP3 A;  4B3T F;  4OYB A;  2HQ3 A;  1CC7 A;  4DQR A;  1R31 A;  2DNR A;  4X84 A;  3F56 A;  3BQ0 A;  1MW7 A;  3TUZ C;  2HG4 A;  2RQM A;  1T9W A;  4CH7 A;  1PG5 B;  1SI9 A;  1YI2 S;  1N34 F;  3EGW B;  3WQP A;  2LQ5 A;  3LW5 C;  2Y9H A;  1U1N A;  2Q43 A;  5F8M A;  1G3O A;  5C2C A;  3KMS A;  1TTH B;  5DRK A;  4CNZ A;  4OI2 A;  1EAR A;  2BAN A;  2L9D A;  4DUY F;  3KLI B;  4FYX B;  2V63 A;  2N7C A;  1TL4 A;  3TI0 A;  4XIU A;  1H2U X;  4QR0 A;  3M8Y A;  2ZUA A;  3KLH A;  1FFW B;  3NS5 A;  2A18 A;  1M1K T;  1GTH A;  2CQ2 A;  2YQ0 A;  4KGZ B;  2JLE A;  2M88 A;  3A13 A;  2H9Z A;  3IG1 B;  3QID A;  3FBB A;  1A6L A;  4TU7 A;  3PW5 A;  2XS5 A;  3UE2 A;  2BA9 A;  2VFS A;  2YXL A;  4DR6 J;  3IN5 A;  3T1A A;  3L7U A;  5CYM B;  2ZE2 A;  4I7F B;  1BC6 A;  3DYA B;  3G8T A;  4B3T J;  4OMF G;  2ZH5 A;  3NAI A;  2VBY A;  2MZS A;  5RUB A;  4DQP A;  4IR9 A;  3ELH A;  1HR0 F;  5KFU A;  3IMQ J;  2IAJ A;  2C2M B;  4K59 A;  2IDL A;  1R6Y A;  1WF2 A;  2LXU A;  2V67 A;  2MKS A;  2ZH8 A;  4ZS6 A;  1N34 J;  3ZZO A;  3JSM B;  3EDQ B;  3H5X A;  4CWB A;  3G82 B;  4B17 A;  4LF2 A;  5GAD U;  3W2W B;  3D0I E;  2YKN A;  4ZCI A;  2MYF A;  1QVF R;  4DUY J;  2W01 A;  3GP9 A;  2KHC A;  1RWK B;  4DR2 J;  1JQG A;  4CLY A;  3BJY A;  2AGP A;  5DJB A;  1WKJ A;  3VVT A;  3CJ3 A;  2WON B;  4OV6 A;  4USH A;  3R5C A;  5L9N A;  2FQQ B;  2EKN A;  2HFO A;  1L3U A;  2JEJ A;  2MKK A;  3V6J A;  2FY1 A;  1F6T A;  1NK0 A;  1N5S A;  2J0W A;  3EGV A;  5L1I A;  2AP6 A;  3BSC A;  4ANC A;  4AUK A;  2V9W A;  2DXE A;  5IV3 A;  3VVU A;  3PY8 A;  1Y10 A;  2V2Q A;  2AYM A;  2K7K A;  2MQO A;  3S01 A;  4QIW D;  1HR0 J;  2MQP A;  1S1V B;  4EEY A;  2F63 A;  1DTT B;  3D7S B;  3VWS A;  3QWP A;  1KBR A;  3VQS A;  3E2E A;  3JS9 A;  1IBL J;  3NAH A;  4OYO A;  1RT6 B;  4DCO B;  3SQG A;  1D1U A;  4FF2 A;  3IRX B;  4YB6 A;  3HZE A;  4WBF A;  1P8G A;  4RW4 A;  4OYI A;  1HA1 A;  3POT B;  1U2C A;  1LEO A;  1GT8 A;  1JX4 A;  2VFU A;  4DMZ A;  2HYI B;  4BCA A;  8AT1 B;  3LQV A;  2RF2 A;  4NLS A;  5F41 A;  1UPP A;  2G2Y A;  3EVW A;  4ZVP B;  3A8I A;  2J8S A;  4ECY A;  4OZJ A;  2BM0 A;  2M4M A;  1XBW A;  4IKA A;  4I2Q B;  4MK9 A;  4OX7 A;  4ED7 A;  1YJT A;  1N5V A;  3KDO A;  2KM8 C;  2OPQ A;  2Z57 B;  1WHX A;  4J9U E;  2P9E A;  2W7A A;  4X4U A;  3NNC A;  2MGZ B;  3L09 A;  2QSW A;  3FEY B;  4NPO A;  3RRH A;  3A8E A;  2MJU A;  2ZKT A;  1DTQ A;  2YNH B;  2HVZ A;  1OMS A;  5KFW A;  1FI4 A;  2RDJ A;  8RUC A;  4G65 A;  3UVJ A;  1GK8 A;  3RAX A;  4OZ2 A;  1F5C A;  2V8P A;  2NZC A;  4ED2 A;  4JI1 J;  4Q2L A;  4DR3 F;  4H4K C;  5IZH A;  2OUG A;  2RNE A;  5I3P A;  2J6T A;  2KZZ A;  2DGU A;  1REG X;  5J1P A;  2U2F A;  3QT6 A;  1UTA A;  4M1K A;  3MCN A;  4WFZ A;  3RJM B;  1R8P A;  4RKU C;  2CJK A;  4C11 B;  2OPR A;  1PAE X;  3FFI A;  3MEC A;  3TOQ A;  4JI8 F;  3U1N A;  2XZD B;  2BJE A;  2H3E B;  3KHH A;  1DAR A;  3ETM A;  1VDH A;  3ILI A;  5F8H A;  3RW6 A;  1NHV A;  4OI3 A;  1FKA F;  4O3P A;  5HBM B;  5AJ3 F;  2CWX A;  1OY6 A;  1UVI A;  1QLN A;  3DRY A;  1TKZ A;  3VGV A;  3OL7 A;  1SXL A;  2B51 A;  2DCU B;  2C3O A;  2ATL A;  5JVH Q;  2XSF A;  4CM0 A;  3OXF A;  2R7R A;  2IDE A;  2LCW A;  4WZQ A;  2X1B A;  4X62 F;  2MXY A;  2VBZ A;  1R8H A;  4J9Q A;  1WOO A;  1IJF B;  2DNP A;  2IVY A;  1VQ7 S;  3M2R A;  1Q82 T;  2FHO B;  4DL2 A;  1HPZ A;  2L9W A;  2ZUG A;  1S0V A;  5IXU A;  1UFW A;  4KBI A;  5HAT A;  3ENQ A;  1MNE A;  3EZ5 A;  3OTC A;  2W2P P;  2OTJ S;  3M2V A;  2LQ8 A;  2HS3 A;  1ZM3 A;  4J9L A;  2CAD A;  3ENW A;  1R8B A;  3AQP A;  1TKD A;  1AB8 A;  3G6E S;  3GU0 A;  3MCS A;  5LM7 E;  3AY0 A;  2F8M A;  1VQY A;  4CO0 A;  3UCG A;  4DV3 J;  3NG8 A;  2M8D B;  2CZ9 A;  4FNH A;  1P9Y A;  1G7C B;  5ETR A;  4W4M A;  2XTJ P;  2KU7 A;  4OHY A;  3AOA A;  3DM2 B;  2V4J B;  5CD4 H;  2RRA A;  1NH7 A;  3MR6 A;  3HKW A;  3IBF B;  2JSX A;  1RT2 B;  5KFQ A;  2HFV A;  1M5P C;  4USJ C;  4X62 J;  2KT5 A;  3K5N A;  2XNR A;  3D9B A;  3DOK A;  5F8G A;  1YHQ S;  2H5E A;  4KQZ A;  5GMK a;  2YBV A;  2MLX A;  1B0P A;  3ILL A;  2HHU A;  1NEE A;  1IUJ A;  4TXS A;  4ANE A;  4J9V A;  5ADZ A;  3OFH A;  3TRG A;  3QZ7 A;  3SSQ A;  1HBN B;  1UVN A;  1FKP A;  1LKZ A;  4FXD A;  2NXU A;  5DDR C;  1NBE B;  2F5G A;  3QLH A;  3OR1 A;  2ZH4 A;  4YME A;  3SSR A;  2ZJQ Q;  4M5J A;  4ECS A;  3DU6 A;  3NNH A;  3THT A;  4YFU A;  4P72 A;  1XTZ A;  3PKY A;  4PXC A;  5IM0 B;  3TAR A;  1T9U A;  2IMO A;  2AGQ A;  1VQ4 S;  1WHY A;  2GVZ A;  5BR8 F;  2GO8 A;  2HHP A;  2FVR A;  1JKH B;  3UCZ P;  2MST A;  2QL9 B;  3T3F A;  1RSC A;  1NZ8 A;  1CS4 A;  3CC4 S;  3MPV A;  4AD6 A;  2FVS A;  5J2M B;  1Q4R A;  1S99 A;  1YRT A;  1FKO B;  3KLV A;  4C98 A;  4LRC A;  5D4P A;  3BYR A;  2H54 B;  4HVZ A;  3OHA A;  1U02 A;  2BXJ A;  1KVJ A;  1RB0 A;  3HVT B;  3BEG B;  1UW9 A;  1GXT A;  1IBM J;  2HQI A;  3HI9 A;  1FES A;  4R8U B;  2A2C A;  4RW6 A;  2QYC A;  2XYP B;  3H4D A;  1NSP A;  3JQM A;  4JV0 A;  3IA0 A;  1CQM A;  3L7P A;  4N41 A;  3ZXW A;  3BB5 A;  2OEL A;  4WU3 A;  3IO1 A;  5SUH A;  1R6V A;  4ELV A;  3GV8 B;  5BR8 J;  5T7L A;  5D4N A;  4EO8 A;  1I1G A;  5E3R A;  1UWB B;  4DU8 A;  2C2O B;  2B4U A;  1F60 B;  2VDH A;  1TKX B;  2FB0 A;  4LF1 A;  1VBZ A;  4V19 J;  2WSF C;  2D41 A;  2H5I B;  2DGO A;  1TL1 B;  3N79 A;  1VLY A;  4KGV B;  1RT3 B;  3ISZ A;  4IRK A;  3CCM S;  1X5P A;  2VJU A;  3F41 A;  2OP5 A;  3D3C J;  2E5I A;  2YH1 A;  3DDN A;  5KG4 A;  3B4D A;  2K8G A;  5DZ6 A;  2V4R A;  2E7V A;  2GMH A;  3NGT A;  4WJB A;  4NLX A;  1PC5 A;  3VV2 B;  2IRU A;  4JI6 F;  4GKK F;  2V8D A;  2XNQ A;  2VAS A;  1U7L A;  4WTO B;  1T9V A;  1JB0 C;  1E6V B;  4A46 A;  3OXG A;  4KO0 B;  2KXH A;  1WC6 A;  1B64 A;  3AB2 B;  4IG3 B;  2XMK A;  3FK4 A;  4NCG A;  2DNK A;  3IGV A;  1F3F A;  3FBE A;  2OD4 A;  2PI5 A;  3CME S;  1WF1 A;  3MPU B;  3KFW X;  3RRG A;  4KV8 A;  4EWT A;  1HKA A;  1RBO B;  2WB4 A;  5IC4 B;  2ERR A;  2RS8 A;  5DO2 A;  1YTY A;  5BYQ A;  2VOO A;  2HMI A;  4ZIT A;  2HHH F;  5KFH A;  4YR2 A;  3BR9 A;  1SJ4 P;  4D3H A;  3TA0 A;  4WYW A;  3PHE A;  1QE1 B;  3PFE A;  1B3T A;  3HUL A;  1EET B;  5FLX U;  1VQ5 S;  2ZBP A;  1CUL B;  2DH8 A;  1U4B A;  2GNK A;  4O23 A;  3K5L A;  3O5T B;  4IRC A;  3AD7 C;  4KH1 B;  4JI6 J;  4GKK J;  5BXI A;  1QSY A;  2M5Y A;  1T03 B;  4DZ6 A;  2PGC A;  4EYH B;  4WFB Q;  2B43 A;  1RE1 B;  2W2O P;  3OXL A;  1SV5 A;  1CJU A;  2MQN A;  1TVR B;  3VZI A;  2KHD A;  3IBW A;  1PBA A;  1M1G A;  4K4T A;  3BSO A;  5F8L A;  1LWF B;  2IJF A;  4MFB B;  3W9J A;  1H3D A;  2MHE A;  4OJ1 A;  3SI8 A;  4ZCL A;  3GSD A;  2HNZ A;  4MYT A;  1QUV A;  1FRI A;  2W2M P;  3W5X A;  4RW8 A;  5C24 B;  4G3I A;  1JLQ B;  5HLF A;  3CWJ A;  2XGP A;  2EXU A;  2GGP B;  3SV4 A;  5D8H B;  2V69 A;  2E5G A;  4NYO A;  2JLG A;  7FD1 A;  4LJM A;  4DCJ B;  3ISN C;  2CQ0 A;  2R3V A;  2ZBI A;  2Z58 B;  4IFV A;  4DWI A;  1EAY C;  3MM9 B;  2DGV A;  2G2Z A;  4I64 A;  4QU6 A;  2BQR A;  2GHV C;  3Q89 A;  3IBC B;  5KFR A;  3WC2 A;  3GJS B;  2F4F A;  3V81 A;  4F4W A;  4DQI A;  3NKY A;  2ZH2 A;  4J90 A;  4B08 A;  3R27 A;  3FGV A;  1UCN A;  2DBB A;  1ROF A;  1D3W A;  3DYA A;  3M8Q A;  3HHD A;  2AJ2 A;  5IV4 A;  2GJ2 A;  3FRY A;  2OSR A;  3ITH B;  3JSY A;  1HHT P;  4LRE A;  5IT0 A; 
#chains in the Genus database with same CATH homology
 3ELH A;  1S57 A;  1NHK L;  5IOL A;  1K44 A;  3Q8V A;  3EM1 A;  1EHW A;  3EE3 A;  1BE4 A;  2B8P A;  1BUX A;  3VGV A;  3BBB A;  1B4S A;  3EVM A;  1NSK L;  3JS9 A;  3FCW A;  3Q83 A;  3NGU A;  4UOH A;  1NLK L;  2AZ1 A;  1KDN A;  2BEF A;  3VGT A;  1XQI A;  3ZTQ A;  4F4A A;  4F36 A;  3Q86 A;  1U8W A;  4FKX A;  1HLW A;  2BX6 A;  3MPD A;  3G2X A;  3GP9 A;  1W7W A;  1NCL A;  4FKY A;  3Q8Y A;  1NDC A;  1VYA A;  2DY9 A;  4W98 A;  3ZTO A;  3ZTR A;  1NPK A;  4WBF A;  1HHQ A;  2DXF A;  3FBC A;  3FBF A;  1S59 A;  1WKJ A;  4HR2 A;  3VVT A;  4AND A;  1LEO A;  2AZ3 A;  3DKD A;  4O0N A;  1LWX A;  3Q8U A;  1HIY A;  1MN9 A;  2DYA A;  3EJM A;  4ANE A;  3PRV A;  3EVO A;  4DUT A;  3Q89 A;  1S5Z A;  1ZS6 A;  5C7P A;  3FKB A;  3NGT A;  4KPC A;  4UOF A;  1WKL A;  5BXI A;  3EVW A;  2VU5 A;  1F6T A;  2ZUA A;  3NGS A;  1BHN A;  1JXV A;  2HVE A;  4UOG A;  4EK2 A;  2NCK L;  1PAE X;  4DZ6 A;  1NSP A;  4DI6 A;  1NSQ A;  3GPA A;  3VGU A;  3R9L A;  3B6B A;  5CAB A;  1NDL A;  3B54 A;  2DXD A;  3BH6 B;  1NDK A;  3DDI A;  5CAA A;  3BBC A;  1NB2 A;  3EMT A;  3ENA A;  4ANC A;  1F3F A;  3FBE A;  1NUE A;  3EIC A;  3ETM A;  3PJ9 A;  2DXE A;  2CWK A;  2HUR A;  3FBB A;  1UCN A;  3VVU A;  4C6A A;  2B8Q A;  1NDP A;  3ZTS A;  4ENO A;  3FC9 A;  4CP5 A;  3WX8 A;  2HVD A;  3FCV A;  3L7U A;  3ZTP A;  3VGS A;  3BBF A;  4S0M A;  3BH7 B;  1WKK A;  1B99 A;  1PKU A;  1XIQ A;  1MN7 A;  3NGR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...