1NLKL

Crystal structure of myxococcus xanthus nucleoside diphosphate kinase and its interaction with a nucleotide substrate at 2.0 angstroms resolution
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
143
structure length
143
Chain Sequence
b'AIERTLSIIKPDGLEKGVIGKIISRFEEKGLKPVAIRLQHLSQAQAEGFYAVHKARPFFKDLVQFMISGPVVLMVLEGENAVLANRDIMGATNPAQAAEGTIRKDFATSIDKNTVHGSDSLENAKIEIAYFFRETEIHSYPYQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NUCLEOSIDE DIPHOSPHATE KINASE
publication title Crystal structure of Myxococcus xanthus nucleoside diphosphate kinase and its interaction with a nucleotide substrate at 2.0 A resolution.
pubmed doi rcsb
source organism Myxococcus xanthus
molecule tags Phosphotransferase(po4 as acceptor)
total genus 43
structure length 143
sequence length 143
chains with identical sequence R
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 1994-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 1nlkL00
3NGSA 3VVUA 1NDPA 3Q8VA 1LEOA 2AZ3A 3EVMA 3ZTRA 5CABA 3EVWA 4DI6A 3NGTA 4UOHA 1NCLA 3ZTSA 1MN7A 3ZTQA 3EJMA 3WX8A 3EVOA 1NUEA 2ZUAA 3VGSA 1WKKA 2DXEA 3DDIA 1B4SA 3NGUA 2DYAA 3BBBA 1NHKL 1UCNA 3ZTPA 3ENAA 3ELHA 3BH7B 5BXIA 1MN9A 1KDNA 4F36A 1LWXA 4S0MA 2HVDA 1BUXA 1EHWA 1S57A 1NPKA 3PRVA 4WBFA 2DXDA 3FC9A 4F4AA 5IOLA 1NDKA 3B54A 2HVEA 1B99A 3Q8UA 3R9LA 2B8QA 3BBCA 4CP5A 3ETMA 3Q83A 5CAAA 4FKXA 1NSPA 3FCVA 4ANCA 2B8PA 3BBFA 2DY9A 1NDLA 4DUTA 2NCKL 1NLKL 1JXVA 1HHQA 1XQIA 3FBCA 1W7WA 3MPDA 4HR2A 1BE4A 3Q8YA 3DKDA 3ZTOA 4UOFA 4W98A 1F6TA 1WKJA 3VGVA 4FKYA 3G2XA 3FBFA 1NDCA 3BH6B 3L7UA 1NSQA 4ANEA 2CWKA 3JS9A 3GPAA 1VYAA 1XIQA 3EM1A 3VVTA 3Q86A 2VU5A 3FBBA 3FCWA 1BHNA 2BEFA 3Q89A 2AZ1A 3VGUA 3EMTA 1K44A 3FKBA 1ZS6A 1WKLA 3B6BA 4EK2A 4ANDA 1NSKL 3FBEA 3VGTA 5C7PA 1PAEX 4UOGA 1HIYA 1S59A 4C6AA 4DZ6A 1PKUA 3GP9A 1U8WA 4O0NA 2DXFA 4KPCA 3EE3A 2HURA 1NB2A 3NGRA 3PJ9A 4ENOA 1S5ZA 1HLWA 3EICA 2BX6A 1F3FA
chains in the Genus database with same CATH superfamily
2VONA 2QJ3A 4JV5F 4TQRA 3G8QA 3C15B 3ZTQA 1FVQA 3CMES 4K4TA 3D1HA 5HANA 5LXRA 3OTOJ 2IYIA 2NXEA 3IR7B 2R8JA 1D9DA 4JI1F 3FQLA 1AUSL 1PBUA 5JMNA 1HD1A 5DM7Q 2OEKA 3FCVA 4LSNA 5IT9Y 1FRKA 4QU6A 4ZVSB 2ASLA 2AGPA 3KFWX 2FJDB 2E9ZA 4C11B 2HMIA 1FKPA 1F2GA 1UFWA 1KOOA 3KK3A 2YKNA 3GR1A 3JB9k 4IRCA 2RKIA 3GONA 3CCES 3TUZC 5C7PA 1ITPA 2FGCA 5KFYA 3ENVA 3NWRA 1XMOJ 5A8RA 1MG7A 2MEWA 1VRTB 4OV6A 1RTJB 3POTA 1S5ZA 1MMNA 2JC0A 2YWKA 1FRJA 5KT5A 1OSDA 3LOUA 3Q8SB 1VC6A 2PEHA 2VUGA 1C1BB 1SCJB 4IFVB 4RW6B 2PC6A 2CQBA 2DXEA 5T7LA 5ETPA 2LDYA 2BJ9A 2RT3A 1JKHA 1MWYA 2ZM6J 1KS2A 4R5PB 3QWUA 2BJ7A 3SZ2A 4J9OA 3BV8A 4HHHA 2BBEA 2GO9A 2DEJA 1M90T 4DL3A 1ROFA 1RAFB 4YS2A 1S97A 5K9FA 2B3TB 3CCVS 4FP9A 4OYMA 2AWZA 2E5HA 1NJIT 2JVOA 1OIAA 2MQ8A 2N3LA 2XNRA 5DZ7A 3MECA 3BS9A 4KYZA 4I7FB 1S6QB 2LEAA 1BMQB 5CD4H 2VFRA 1W2IA 2GJIA 4JOUA 4XIUA 3QO9B 4DLEA 3EXYA 1OYEA 1R8PA 2DEIA 3CC2S 2CQ1A 2C2DA 3KK2A 5I3UB 4J9VA 3L7PA 5AXMA 4QIEA 1P1TA 1JLEA 3BGFA 2XQCA 4RW8A 6FDRA 2R8KA 3M8PA 3HP6A 2LKZA 5AXKA 4WXOA 1EJ7L 2IVMA 3WHIA 1RHKB 1UEKA 3PTWA 2YWHA 2ZEJA 3D1QA 2BZ2A 2VL1A 4LFAF 5B09A 3TX8A 4ZVUB 3EZ5A 2CPFA 3QYYA 5HATA 1RUSA 1AUDA 4WWSA 2CADA 2DNPA 1WC6A 4RNNA 2JH3A 1NJWA 3E01B 3SQGA 4IDKB 1S12A 3M8RA 1BQXA 2RS8A 1KLMB 4DOZA 4J37A 3H2VE 2RQ4A 1UKUA 2YNGB 4IG3B 1GEHA 3M2VB 4ECZA 2ZFHA 1WHXA 2C1EB 5ETMA 4LF7J 2UXDJ 4WYWA 2XSJB 2ZZNA 2K2PA 4JBCA 2ZH9A 1VRUA 2E7WA 1NDPA 3RAQA 1RTIB 4R0JA 4FPIA 2RILA 2QLBB 5HMWA 3IRXB 2OEJA 3T5HA 1IM6A 2X1GA 4L75A 1L3TA 2EXUA 4PAAA 1G7CB 4N41A 4H4MB 4OL8A 2HHTA 5GMEA 4LF5J 2JFKA 3U1NA 4G1IA 1VQ4S 2MKIA 3EWGA 1HYSB 4I6WA 2OPQA 2XS2A 2CQIA 4NA3A 4HI1A 4RUBA 2CPJA 1BE4A 2LCWA 4W98A 2CNOB 1NKBA 1WSRA 4ED4A 3R7BB 4PXDA 3QZ8A 3CSKA 4C0OC 4WU3A 1LW0B 4CO5A 4B3SJ 3SEOA 4HEA9 2WZ1A 2ZE2A 3A3OB 2KFZA 4G1PA 4AQYF 3Q0AA 4CO0A 1PAEX 4HTJA 2D1CA 3CC7S 2BVZA 4ES1A 3KDOA 4NWBA 2G0JA 4OLPA 1OO0B 1CG2A 4TVAB 2R2UA 4F4ZA 3EVWA 1SKWA 4YN3B 1H2TZ 2MSSA 3QJPA 1X4BA 3G6ES 2L48A 2NLWA 2ZZMA 2HQGA 4XTTA 2XY5A 2J6UA 2B56A 3FFIB 3KJVA 1UFKA 3GYNA 5ETTA 4PWDA 3PVXA 4JI3J 4JI6F 1AW0A 2PD1A 3KOAA 4F8RA 3WBZA 5A8KB 4JYAJ 4HHUA 2DNRA 1YI2S 1X8DA 2Q6BA 2KJWA 5IV4A 1OWXA 5EN1A 1GK8A 2DHSA 5HAOA 4ES3A 3MPDA 4CO1A 4ZCMA 3IS9B 2Q43A 1UPMB 5HSPA 5KFNA 3LP2A 2C2OB 1PILA 2EEYA 3C6UA 2CA9A 1V5IB 3D1OA 3ZNJ1 1SJRA 3JSRA 2DNKA 1BWVA 3UO0A 2LQJA 1BQNA 1LW2A 1U1OA 1RQ0A 1O8BA 2ZBQA 3IBCB 1L3KA 2GGPB 3QSYB 1N52B 4YR2A 3FMBA 2LEPA 3ZTSA 5IT4A 4DN0A 2CQ4A 4U67Q 3OT9A 2NXCA 3J80Y 1OMSA 3OSNA 1ULRA 2DIVA 1QSLA 1N5YB 2MLYA 1VQLS 2FIUA 4AD6A 4DFKA 2JZ5A 3I96A 1GT8A 1HBMB 2M88A 5HROA 3OR2B 2DXDA 2BOPA 5CHCB 2P9EA 3RR7A 1EKSA 2FZKB 4NYPA 4CWBA 4FF1A 4DBQA 2DGQA 4MIWA 5M2PA 4M5MA 4CNZA 1Y11A 4ZS6A 2V9KA 1YJNS 2CZ9A 1WC5A 5THWA 3M6WA 4DFPA 3I4HX 2BM0A 2QA4S 4IRKA 4DV6J 4BS2A 2GIQA 5KOWA 4DWIA 1WF2A 3TAPA 2J9DE 3KLIA 3F41A 1JLFB 3H5SA 4DR6F 1CJKA 4F4YA 4QPTA 1S0MA 2ZH2A 4LVNP 3O1LA 4HKQA 2VG5B 2RDIA 1U26A 4WFXA 1S10A 3ZTRA 1JLAB 1ZZFA 4DV1J 1TK8A 8ATCB 2AJFE 1WKKA 2JLFA 3K0JA 5B0CA 4NASA 4LR7A 4NA2A 5K8MA 2HGMA 1REVB 1PCAA 3PR4A 5FDLA 4RNFA 1GTHA 4LJMA 4IUFA 1TUVA 3FNNA 1N36J 1SXLA 1OY9A 1TU0B 4LF1A 1D9FA 4UQTA 1J27A 1FHTA 2IRXA 1RT3A 4USMA 3IGVA 1X4CA 1ZBTA 2RQKA 3DOKB 1IN0A 1YBUA 2E44A 1VI7A 3W5ZA 4B17A 4X66J 3UR0A 1GNKA 3NNAA 3OTEA 2B5JB 2B9YA 3AFGA 5C25A 1HNZJ 4J7CA 4NLRA 1QE1A 2XSFA 1TL7B 2MZSA 5A6PA 3N28A 2HFVA 4NLYA 2QSFA 2XZDB 3OW2R 3TVKA 1R8BA 2UVUA 2LA4A 1UVIA 1GXLA 1B4SA 1EARA 2ZJPQ 2MY7A 2F40A 2WBMA 4MJKA 1HWIA 1TZ0A 4F36A 1S48A 1VQSA 4M5JA 3MM6B 2ALYB 3OUYB 3NS6A 1JIHA 3CJ8A 4M5HA 3AJDA 4TU9A 4DEZA 1H74A 1LWEB 2CPYA 4LFCJ 1FRXA 1JB0C 4HACB 4QR2A 3OFFA 2VQFF 2M8HA 1JJCB 3SQOP 1KP6A 4DV5J 4QR1A 4OJGA 4MIAA 4NLOA 1CJUA 1C1CA 4A8YA 1X7VA 2CNLB 4OYAA 4Z2XA 3G71S 3VGTA 1X5TA 3M30B 2OUGA 3HKWA 1RT7A 2NZCA 3IWNC 3LAMA 1HBUA 5E3PA 2B4VA 4M5IA 3MR6A 1CS4A 2FJXA 4UT4A 4DUYF 1FRIA 4ICLB 2ZHBA 4UOHA 1UWAA 2RB7A 4QZVB 1UZHA 1C0TA 3T3FA 2E66A 3KUHA 4UUXA 1VC5A 3NGUA 4ED0A 3ELHA 1ZM4A 3DFEA 1RBLA 3AD9C 1RLCL 5K8OA 4NCBA 4GKJJ 3FGVA 4X65F 2XLJA 2E5IA 4DHVA 2RJZA 4MFBA 1FNMA 4OI0A 3GFZA 1KTQA 1TFYA 3BDEA 1HNXF 3I87A 3OVSA 3QMQA 4YOEA 3D0IE 1PGZA 4OX9J 4USTA 2OKQA 2BACA 4KPYA 4OX8A 2XMJA 3H5YA 4Z37A 2EKNA 2VIHA 3G6VA 5ETRA 2AZ1A 3PX6A 4USVA 4NZ6A 4C97A 5HJXA 2KM8B 1G1XA 3QIPB 4DS4A 3PX0A 3MR2A 1M5SA 3LH2S 4YHHF 3T1HF 4K5SA 4EBEA 4DV0F 3R2CJ 2PI5A 5LMNF 1EKRA 1LV5A 4CLYA 5DQHA 1F3FA 1WEYA 3RAXA 2MMYA 1HBNB 4J9LA 3US5A 1NJYA 2ILYA 2BJ1A 3CDEA 4NXNF 1RAJA 2OFHX 1U48A 2H5EA 1P9QC 1TL1B 4Y00A 4JI5J 2Y3YA 4GO5X 2BRLA 2FVCA 5E3QA 4F02A 5E2QA 1X4DA 4ZVFA 1K73T 4B3OA 1UMJA 2FZCB 4JV0A 4U8YA 1Z4UA 2XM3A 2UXCJ 2V4JA 1RAOA 2MDAA 4DUTA 6AT1B 5C2GA 3TVYA 2OD4A 2AYEA 5CYQB 3BJYA 3W63A 2GFFA 5B0FA 3IA0A 2NSBA 3GIRA 1J5OB 2CQPA 1VLYA 1ZA1B 2K7JA 2DGXA 4UUWA 5LJ3Y 3PHEA 3PJWA 4HL9A 5DLFA 4LREA 2K1RA 1N56A 3LALA 1FX4A 1X4HA 2CPIA 1SIZA 4OYXA 2YH0A 4KGMA 4KGKA 4FXDA 3I5BA 2EW9A 4LUBA 4HHJA 1R31A 2MQPA 4E98A 3SCKE 5K8NA 4P71A 2C3MA 1HI1A 4X62J 1KHWA 2VFTA 3PR5B 3KMSA 1FKPB 1KQFB 1BUXA 1SKUB 3UCZP 4WTOB 2W2MP 1VRQC 3KK3B 2YKNB 3VF0B 1X60A 2EWHA 3LANA 2KXHA 2RKIB 1PIEA 1S9GB 4LIRA 3MD1A 5KG1A 3TEHB 4OZ0A 5C24A 2RH3A 4KGVB 1BD6A 5A8RB 5KFHA 3I0RA 2QT7A 3POTB 3JTNA 2A18A 5GMDA 3LP1B 3OQ2A 2DHHA 3QLHA 2DTJA 3HDSA 4P72A 2X3GA 2ZH3A 4JUZA 4FNIA 1UFLA 4DCOB 3MCOA 1V3ZA 4PXCA 2XHCA 2MKYA 2DPIA 1HARA 4Y2CA 5HQ8A 3JTPA 5T7LB 5H9FK 1S4FA 2JEJA 1UTAA 2D69A 2Y0SD 1FJGJ 3KLFA 1JKHB 2BMBA 1DQ8A 2ZD1A 2GVDA 4RNHA 4CDIA 1OQ3A 2QLFB 5IQQA 3DMJA 1KRPA 4N8NA 2A6MA 2E7XA 3NOGA 1CC8A 3P4UB 3MPVA 1N54B 2UVRA 4RJVA 2YXLA 4R0EA 4ZVOB 2J76E 1N32J 2CJYB 2MJNA 3ITHB 3Q83A 4YY3F 4MYTA 4C8LA 2V8VA 1LNQA 4DMZA 5JUMA 4CM0A 1JJ4A 3HSGA 2HFUA 3FBFA 3BH6B 3NCRA 1U2RA 2YKMA 2V8GA 4V19J 1WI8A 1RHRB 2HSEB 1U45A 1E6VB 3KK2B 2FYXA 3ISNC 3EMTA 1S72S 1S76D 4B3MF 1K1SA 1Q82T 2W7AA 4BHQA 4RW8B 2C3OA 4USKA 3NRBA 1S1WA 1N5QA 2LMIA 1Q95G 4P2SA 1SQGA 4LBIA 2Y0BB 5KT7A 1RADB 1RAAB 1UVNA 4LBHA 4HH0A 5GAHI 1HFEL 2BUNA 4FYWB 1QTNB 1Q8LA 5C5JA 5D3GB 1P9YA 1QTMA 2HRUA 3B8HA 3E2EA 2XMWA 2W9CA 3CCRS 3SQGB 3TI0A 1KBRA 5E5NA 4DLGA 3OL8A 5DG8A 4M5NA 1UVKA 3GILA 2KZZA 2CQDA 2QC3A 1CQMA 3CDAA 3FMWA 3GFXA 2BR0A 3EX7B 3N9UC 2GMLA 4Y65A 1AA1B 3R5DA 1Q8KA 2IJRA 4FKXA 3QJJA 1YJVA 5A8WB 2M5YA 4CLZA 4PPDA 3NMAA 3NWGA 5DZ6A 1IBMF 2FZGB 4QYZJ 3NLCA 4CT8A 3V4IA 1UAWA 3ZC4A 1GMWD 4OV1A 2UUAF 4LF4J 3HT3A 3D6HB 1VRUB 5DS7A 3IM8A 1RXOB 2V9WA 1ZTWA 2F9JA 2KHCA 1NJXA 1R3NA 2OFGX 3QATA 3C8YA 2XGPA 3GSIA 2GX8A 4RU9A 2ALZA 2VJUA 3PY8A 4KAIA 4I56A 4Y28C 2DH8A 2K3IA 3VVUA 3T1AA 2Y1LB 4ZCLA 2QL7B 1WUUA 3M6XA 2ROPA 1YG0A 3ZZRA 2OPQB 1ZTTA 2B51A 4DR4F 4A8XA 4KSEB 3EDQB 3QT8A 4U9RA 1IKVA 4ECYA 3VTIA 1OSCA 1PJ6A 4B02A 3CCMS 1W2BR 2UXBJ 5KFIA 3M9MB 4F7VA 2VC0A 2FY1A 3ETMA 1C0UB 2ZE2B 2OGUA 2RUSA 5D0GA 4WFZA 3HHDA 3QGIA 3CWJA 4FKYA 1HWLA 4DR5F 4ZN3A 3KHLA 3L9ZA 3QT7A 1TKDA 4K0KJ 2HNDB 2N4CA 1F0XA 2L3MA 1RT1B 5GADI 3E51A 2JLGA 4NRUA 1NRKA 5LJ5Y 2GJFA 3HVWA 4JI2F 1WEXA 1FK9A 1WDTA 3KJVB 3BGUA 4DV3F 2IA6A 2PFDA 2BDPA 4PWDB 1FDBA 3BO4A 2DJWA 3DDKA 3NGSA 2D3UA 1AROP 1JLGA 3QNWB 4XPEA 5KG5A 2V50A 3D3CJ 3EJMA 4I68A 1DTQA 4TYAA 3W2VA 3T5KA 3OVBA 2K06A 2N3OA 1TELA 3M9OB 4ECSA 4M5DA 3LW5C 2V2VA 5C2CA 2ATCB 4YDXA 1OPIA 4NEYA 5DO2A 1NK4A 3WZ0A 3LP2B 3AAWB 3PW7A 3N0VA 4CLLA 1DQAA 3BKUA 2YNFA 2C28A 4F25A 5IT9U 5J1EA 4E2FB 3FSIA 1UJ6A 3C6UB 5I3PA 2DITA 1DFDA 3J7YI 4UY8T 3H8YA 1IUJA 2CG8A 3L7UA 2NYIA 1B7YB 1CJVB 3LGNA 1BQNB 1LW2B 2I5JB 4KFBB 3DYAA 3WX4A 2EC0A 1S1TB 1SUQA 5AXNA 4U7UK 2XYGB 3FRYA 2E5JA 5CZVA 3MCSA 4DV2J 5LXYA 2C2NA 4JV2A 3NKYA 3UE2A 5KFWA 4NLSA 4NPOA 1TKXA 4Q7AA 1RU2A 2AZ3A 1RTHA 3OXLA 2KI2A 4P2FA 1SBRA 5HROB 4I69A 3TVZA 2VBWA 5IM0B 1WNEA 2VG6A 3FSXA 3MUTP 4JI8F 3G6XA 1S1XA 2O67A 4XO0A 2PA8D 5KFFA 2DO4A 3SFGA 2J6SA 3AOBA 4RNOA 2C2EA 4P6QA 1MMLA 4DZDA 2YX4A 2RQCA 3SIPB 2XCAA 4RW4A 2BM1A 2Z2ZA 5RUBA 1RACB 4M1KA 2RS2A 1Y0HA 4JI0F 4MTPA 2IHR1 4LF6J 3W8GA 2IMOA 1CJKB 4I2PA 2IMWP 1RA6A 2H4WB 5KFAA 3V6DB 4OI6A 4FXWA 2AIRB 5KFEA 2LYVA 3LO3A 3V5RA 3B4MA 3H7HB 3IAS9 3MFHA 2F5GA 4D3GA 3KDNA 3W8PA 1H72C 5F9LA 1RLDA 2WVEA 1RKIA 2LDIA 3NGRA 3T5LA 4A8OA 3A4TA 2OI2A 1H38A 1ZZNA 4DF4A 1FDAA 2ERRA 1ZM9A 3CDUA 5HMYA 4LSLA 4OIXA 1Q8BA 2LQ8A 2PE8A 5CXTA 3MM5A 4BWMA 2RD5C 2VV5A 2YTCA 4CO2A 1RT3B 2HQFA 4MIBA 2F8HA 5DDRC 4NCAA 3D2WA 4RW7B 2C2RA 2M2BA 5J2MB 1A6LA 2UUBJ 5C25B 2RRAA 4KB7A 3DOLA 2CPXA 1FFSB 1XN9A 3S7RA 2G0CA 4HDGA 2H65B 2HHHF 3HI9A 2CNNB 3R7NB 3W1YC 1F3VA 4CZCA 1UVMA 5DGBA 5ETKA 3SCJE 2QIFA 3FUYA 1TKTA 3DN9A 4A8QA 4X4NA 4LFBF 4K4YA 3Q8PB 3AD8C 2HK2A 1F9FA 2FQQB 2J7UA 2ADBA 1N5SA 1UWBA 3OVAA 2DD8S 2IJNA 1JXEA 1YWXA 2WVDA 4GMKA 5GAGU 2E5LJ 1RE1B 4H4KC 4KR0B 1N33J 4CO4A 2XO7A 3IG1A 1CJUB 1C1CB 1DQ9A 4DV4J 1VBYA 4CCHA 4ID5A 5KG0A 1VC0A 4P74A 2VPZB 4ZHRA 5H9FJ 4FZVA 3BQ0A 3ZTOA 2E9TA 4C11A 1FVSA 2GQ2A 2DHGA 1HBUB 3W5YA 3FRZA 3U1MA 5F3ZA 1NK6A 1NMEB 5LMUJ 4OLOA 1CS4B 4ATNA 4C8KA 3GYGA 3MM7A 2QZ8A 2AQ4A 1GX6A 1JWWA 1DARA 2CQCA 1WKLA 3FVYA 4EGLA 4OJ3A 3PW2A 4ED3A 2D9OA 1FKAF 4ERDA 1VRTA 1RTJA 4FBTA 4PWUA 4B3TJ 3AA8A 1KONA 3I32A 2XB2D 1I1GA 1NJZA 4MFBB 4EWTA 4RPFA 3ZZZA 5CA5A 5B0GA 2BRKA 1X0FA 1MROB 2X1FA 3HM9A 2P6TA 4NA1A 3BH7B 2R7XA 3QRRA 2N7YA 4PCQA 2ABYA 4P75A 4RL1A 2J7WA 3EZUA 1X5OA 3S01A 1FERA 4U96A 4EFAC 3Q8QB 2G4BA 1YRUA 4GKKJ 1EQMA 3GCWP 4NZ0A 3VHQA 1G3OA 3CJKA 3KLVA 2CVIA 3MPUB 2D41A 3D68A 4K50A 4B9LA 2ROGA 1R43A 2IM1A 1CVJA 1R8CA 2V69A 4DX6A 4LF9J 2RAQA 3FBEA 2CQ3A 4F3MA 4IFYA 2PA3A 4IH5A 5CQGA 3HD2A 1D3WA 3SYZA 2UUCJ 3CMAS 1KR4A 1X0PA 5K8PA 1WG1A 2FJAB 5J2NA 2WSFC 2LXFA 3IWXA 5I3UA 1V3RA 2HFSA 1LEOA 5ETVA 1CSJA 1HW8A 1I3OB 4KH0B 4B3OB 3ZFVA 1MWQA 3J80U 2W2NP 1I94J 2VICA 3ADAC 2I8EA 2UVVA 2V4JB 5GAEI 1FWLA 1PO6A 1LWCA 5KFCA 2LECA 4XK8C 4DFJA 1GXTA 1EZZB 4QYRA 3BBCA 3E01A 1NEEA 4ANCA 2OIHA 3GB0A 4OHVA 4C8OA 4IDKA 5L1IA 4EYHB 1IBKJ 2XY7A 2OJ3A 2ZHAA 3JS9A 2FJBB 1UW9A 2X1BA 2QLWA 5F0WA 2FDNA 2F4VJ 4F26A 2YNGA 3IFEA 4QBUA 4ZLNA 1VOMA 4QIWD 1URNA 1XR6A 4H4KA 4LIWA 1LFWA 3PJ9A 2RRBA 4CT9A 2XSJA 1VJQA 4ZKAA 2OPSA 3KJNB 5D77A 4PR6A 3CIZA 1JXLA 3W9HA 4USHA 2R2RA 3D54A 3N01A 2ZUGA 1Y3KA 3VGSA 1RISA 2U2FA 2L9NA 3ISZA 3BBBA 4IOBA 4IH6A 5C24B 3VALA 1RCXB 2DH7A 3AOCA 3RBZA 3Q8UA 3RBDA 5FIIA 3KMQA 4A47A 1HYSA 3IXQA 3QLHB 3CC4S 2HVZA 1YRTA 1JJHA 4NLQA 2G2OA 2C3UA 3MAAA 1YJRA 2PEBA 2MZ1A 3V6KA 3H40A 1OJ4A 3P45B 3N4WA 2YKPA 1LW0A 2VU5A 3KLFB 1PYSB 2VFSA 3GIMA 3BM7A 2ZD1B 1X5SA 4WFYA 1J5EJ 5J2QB 3DMJB 5E0OA 2CUYA 1PG5B 3D0GE 3QWPA 3V81A 1UEUA 2W24A 5ADZA 1SL2A 1OPZA 4DI6A 4C8ZA 1AB8A 3GIKA 4ES2A 4DSIA 3FEXB 2XI2A 1D9AA 4MK9A 1FA0A 4H4OB 4CLWA 1WC0A 3VAFA 4ZDNA 2UV8A 4DR3J 4DDFA 2MQNA 2NXUA 3ISND 1FO1A 2YKMB 3K2YA 5HMXA 1K0TA 3BQ1A 2R7TA 2W2OP 3PRBA 4A46A 5L9NA 2D3O1 1HNWF 3G6YA 1RT6A 4X4RA 3VWSA 1QAYA 3CIMA 2MPUA 2Z57B 3FCHA 4AUKA 4NI2A 3N6MA 3J81Y 3OJUA 3MD3A 4GC7A 2Q3PA 1SJ4P 1PAUB 3DLLQ 4YDDB 5L9XA 4PQAA 5F8LA 2W9CB 4OMFG 2VQEJ 3MAQA 1Q86T 1LK7A 1FD8A 2GJ2A 1RHMB 3JTOA 4O0IA 2DNNA 3MEEA 2GGPA 3UI3A 3QGPA 1YBAA 4FVMA 4FS2A 4DL6A 1U47A 2Z0GA 1TL4A 3MCMA 1IJEB 2BW7A 4W90B 3OTDA 1WOSA 2WB4A 1N5YA 2L9DA 1HBMA 2MHNA 1SV5B 3I6PA 4CI0B 3OR2A 1T0TV 2BJDA 5L38A 2WVFA 2EK1A 3UN3A 4F3OA 5JXSA 4J9KA 3PEJA 2W8LA 1VHIA 3P8BB 5CYJA 3PG9A 1ZPWX 4NEZA 3FJ2A 3JSMA 1DJ0A 4L3NA 5ITHA 4DJBA 2GMHA 2QG9B 4CO3A 5IZHA 4CNYA 2R2SA 2EK6A 3QZ7A 3H2UB 3QAUA 1N34F 3TZYA 2VA2A 3SXLA 2YVSA 2AHOB 2MZQA 3GYXB 3NGKA 4I6YA 3EICA 5DGAA 2ZOGA 3Q8VA 1IKVB 4AT1B 1VK3A 4KC5A 3IO1A 2HIQA 3HXMA 2LA6A 5D78A 3DXBA 1KQKA 2XO6A 4P2XA 2KRBA 3P6YC 2A2DA 3MM8B 4ZPVR 1RBAA 2KM8C 2WTFA 3CF5Q 2MZJA 4PPZA 4WFAQ 2IRUA 3MTKA 2M7SA 3R7SB 1O6XA 4JI7J 1XC9A 3R1LA 2IM0A 4B9VA 4RUCA 4DPUA 3VZHA 3R3TA 4BLGA 4D3HA 4NXMF 3NY0A 1IBLJ 3IAM9 2XMMA 2E9RX 2VOPA 3J7ZT 3ENWA 1M5HA 3PFOA 3RB6A 5KFMA 1WF0A 1JLGB 1DURA 4C0HA 4WXWA 5E41A 1RKJA 4OX6A 4PKDB 3MCNA 1DTQB 2BOAA 2MXYA 1S0NA 2R7VA 4OYOA 2ZNZA 3KTQA 3NCQA 4M5DB 1TUGB 5DQIA 1Z2LA 1TL7A 4DQRA 3TQ1A 1IM4A 3MMJA 2ASDA 2BXJA 4KE5A 4ILMA 5AE1A 2OH2A 2CJAA 1TFWA 3R5AA 2YNFB 4P7TA 5J1EB 4EMDA 5EUHA 1XTZA 2QA1A 3OXFA 3BREA 2B6AA 1QVGR 1PJ7A 1CEZA 2RHQB 3OUYA 4FDFA 4F4XA 1SUQB 1LWEA 2DR8A 4ZLLA 2O1PA 4HACA 3AB2B 2VJVA 2ZWOA 4WKYA 4ED5A 3CCJS 2CWKA 3HHLD 1VYAA 3RB4A 1Q81T 5CH7B 5HQLA 1TKXB 4KRWA 1HD0A 2UU9F 4X4PA 4DQPA 3CMQA 1RTHB 3UPFA 4K4VA 5H9EK 3R97A 3R6GB 3SV4A 2HBRB 3HMJG 3L95X 3FEZA 3J7Z5 4A48A 1JLQA 4ICLA 1R0CB 3CDBA 4LF8J 5ETQA 1L3SA 1RBOB 3M2UB 3A12A 4RW4B 4CLPA 3I5AA 3AY0A 4ED8A 3KXDA 2J9EA 2ZOFA 1X9MA 5DDOC 3VCDA 2YNIA 4BDPA 5F8JA 3W62A 3DLGA 5HBMB 3SSRA 3M8ZA 2ZJRQ 5KG3A 1SQEA 4IQXA 2Z2YB 1KFDA 1RYRA 2A2CA 4NLUA 2DR5A 3BKTA 4ZPTR 3I4PA 2GNKA 3GIIA 3B4DA 1JJ2R 3O3LA 5CCMA 3ILJA 4DR7F 2IDLA 1PYOB 5KFTA 3MEGA 2V2QA 5L1LA 2YWFA 3OBIA 1T9TA 4XPCA 4ZVTB 2V2ZA 4IR9A 4LSLB 2FVSA 2X51A 4QW9A 4EK2A 1KHVA 3OTOF 1AZSB 5DG7A 2KG1A 1HQEB 5JVGQ 1T95A 4UQGA 4NL5A 4DX7A 2VG7A 3IN5A 2IFXA 3BGRB 2V8PA 3UW1A 1MN9A 2DKOB 5L1KA 4DR2J 2CRLA 2OPRA 2F63A 2YQ1A 3ZNUA 1Q4RA 3CUNA 1NK5A 3JYTB 3UD4P 2DY9A 1JXVA 3HULA 2ZH1A 4A8WA 3BN7A 5CYQA 5HVHA 2RHSB 3AA9A 1GMVA 5AE3A 2HQDA 4HT7A 1XMOF 5KFZA 2IYGA 1TKTB 3G82A 1X31C 3HJVA 1IKYB 4KQZA 2GW8A 3L7OA 4OZLA 1WG4A 1X4AA 4Y2IA 1VQ7S 1UWBB 2W4PA 2FLPA 3BSAA 4EYIB 5IC6B 3O6QA 4OYWA 3P5TL 4YFUA 3GJSB 4M5LA 2AX0A 3R6LB 2ZM6F 1Y4ZB 1RABB 1VMBA 4HLBA 1FTRA 3OFEA 3IG1B 2OEMA 4RKUC 5A6WA 3C16A 4ZVHA 3R2DJ 4ID5B 2XLIA 3H0PA 4ZHRB 1S7IA 1RWWB 3TP2A 2BE7D 3R5GA 2HZAA 2EFPA 5EX0A 4K5RA 2NREA 3BEGB 2MJUA 4M63A 1DZ5A 1XMQJ 1NM2A 3CD0A 2MKCA 2KB2A 3MM7B 3T5JA 1S9GA 2HWTA 2P8IA 4F2SA 2R7SA 4NRTA 1R89A 2JVRA 1TV6A 4TY9A 1Q0NA 2KFNA 2HK3A 2RIJA 2CJQA 4CTAA 3M05A 3T41A 4DSEA 1PBAA 3LP1A 2QN6B 1EP4B 2A10A 1TK0A 5B0DA 2DRBA 1AXQA 3K89A 2DR7A 3VAIA 1VHFA 1MSWD 3PEHA 3VQSA 1KLNA 1R7IA 3DLBA 3CDWA 4K7QA 4QCLA 3OJSA 3MOZA 1MMDA 1D8YA 1NPPA 4FXVA 3TEGA 5KFVA 1YVFA 1QAJA 1RHJB 4UTGA 4RBTA 4WKRA 2C2MB 1A0OB 3D6FB 2CVEA 3RAMA 4M8LA 2HHHJ 1VQOS 4IG0A 4DCPB 3K58A 4PEOA 4X4UA 4KGXB 2HQ3A 3CJKB 4X4TA 1H0HB 4U95A 2A6OA 1RTZA 1NDKA 5KFUA 4TY8B 1WC3A 1NKEA 5F8GA 3ITHA 3C66A 2OLWA 3TJ8A 2PIIA 2B8PA 4RW9A 3KK1B 3D9BA 2HNZA 3RRGA 2LQ9A 2QE5A 4IFYB 4OZ2A 1YZ7A 4B9MA 3PFEA 4NLPA 2J6TA 3QPIA 1VQ8S 4LF7F 3PW4A 5J2NB 1E6VA 1RWNB 2CPDA 2UXDF 3CVKA 3T19A 4RLEA 4HH1A 4WK1A 4O4RA 2VKZG 2DBBA 2HBYB 1NH7A 3A3PB 3BYRA 3P96A 2QV6A 1QM9A 5BYQA 1LWCB 2JJ4D 7AT1B 5D0EA 4N77A 3H42A 2H3EB 5D3GA 3FZ2A 4KHPJ 3UCUP 2IDEA 4LF5F 4WZQA 1CJTB 1BLUA 4YB7A 1S6PA 5D4OA 1U2CA 2R7QA 5BR8J 3SSQA 4X4OA 3SDEA 2QYGA 3GFHA 1FJ7A 1IQZA 2Q66A 4P9SA 3OLBA 2QL9B 3LGHA 4Z7YA 4ZK7M 3WIVA 1XK8A 2XMKA 5A8WA 4WE1A 2XY6A 4B3SF 2R8GA 3W2WA 2HIYA 4MT1A 3DI6B 1C2PA 1R0BG 3HCXA 2VC1A 4R8UB 1QLNA 2FB0A 2OPSB 4FNHA 1T11A 4QWDA 1KVIA 2F7VA 4OJHA 3JQMA 2IC3B 1S99A 1IR1A 1K1QA 2QA4G 2V4RA 1RA7A 1DLOA 5IWAJ 4DPWA 3MHYA 1UPPA 3DXSX 1RAHB 3MUMP 1WOPA 3F44A 2FC9A 2EG1A 1RI7A 4MH8A 2FVQA 1HQUB 2J7KA 2CXEA 3IBWA 3NMRA 4ID8A 2LXUA 1FI4A 3KG4A 4JYAF 2Y1IA 5H1SV 1N8RT 4HT5A 1O5JA 1X4EA 3CXCR 3GLJA 3MAAB 1AFIA 1XEZA 4BC9A 2W7OA 2AEMA 3C14B 1EQ0A 3CJ5A 4A8SA 3C3LA 2AJ2A 2FJVA 1FEHA 2QEXS 3MUVP 1C0UA 4ELVA 2YPZA 1NLKL 3M1VA 2COLA 3T6BA 3QAEA 4LQ3A 1SH2A 3UVJA 1XNQJ 2KL8A 1NAQA 4A8KA 3CD7A 4CYUA 1IKWA 1VQMS 4AL5A 3I9ZA 4IOCQ 1BHNA 2HNDA 3V81B 3D66A 1TL5A 1T9VA 3AODA 1A7GE 1RT1A 4C2MA 2KO1A 1L3UA 4KTQA 3B82A 2EFNA 3A8EA 1QJHA 2DCUB 3WIUA 1U8WA 4N47A 3C19A 2FPHX 1PJ5A 5KG7A 4LRAA 1QSYA 4I4BA 3A8KA 4ZCKA 2H9ZA 2OSQA 1FE0A 4HTIA 3DDNA 4ZJQA 1KSPA 1NKCA 3K5NA 3RBEA 3PRDA 3HHEA 5BXIA 1RT6B 2I2YA 4FYVB 4YR3A 5BJRA 1U8SA 4NI2B 5AJ3J 3L09A 3W65A 3C6TB 4CH7A 4G65A 2W9BA 2AGQA 4DV6F 2CKWA 3ILIA 3BDPA 1KOHA 4Q43A 3NAHA 3DRRB 2OTJS 2V8HA 1CJVA 2I5JA 4KFBA 4CM2A 4C8YA 1S1TA 3MEEB 4F67A 1LFPA 1UW4A 1NSKL 3GR0A 3KLGB 1Y5IB 3OFGA 3U02A 1PKUA 1W25A 1BC6A 2CJ9A 4IOAQ 2NR0A 1KVJA 4ZN1A 1WI6A 4H54A 3RRKA 1FRLA 3TNVA 2CJKA 4MYUA 2QO3A 1UZDA 5IM0A 1FRMA 1VFJA 2KG0A 2XEXA 3QQCD 3A1YG 4LRCA 2UUTA 1Q1KA 2G2ZA 1N36F 2IRYA 1HI8A 2XTJP 4Y0FA 5I3QA 2B43A 3FQKA 3JSMB 2CFXA 3N79A 1OYDA 3CE8A 3AB4B 3BBFA 3UWTA 2V8DA 1G6BA 1TL3B 3SI8A 2IY5B 4DUZJ 4X66F 3V6DA 4B9SA 2UZAA 2RF2A 1SQFA 3CW2C 3C46A 4TNOA 1HNZF 2DH9A 2V2KA 3KJFB 1NH8A 3PIPQ 3GQCA 2IVYA 2M0GB 3DGVA 2ZH4A 2ZITA 2BE2A 5U47A 1HIYA 4OYBA 4A4JA 3CJQA 4WP9A 3UDVA 2ROEA 2KH9A 1SI9A 3CULA 1FJCA 1XR7A 4BCAA 1GAOA 4QPXA 3KLHB 3TWZA 1EETA 4DFMA 4EZ9A 2G9OA 3LF0A 1VDHA 2KYXA 5DRKA 1S1VA 2B4OA 3J7A1 3KHRA 2YBVA 2B9EA 3T6JA 2GA7A 1T3OA 3BB5A 1ZOTA 4MKBA 2FHJD 3RYLA 1GXUA 4LFCF 1XR5A 4DL5A 1IR2A 5K5MA 1MW7A 2B8QA 4DV5F 4Q8EA 2H48B 2XMTA 4DV7J 4RW7A 2B9WA 2R8HA 2QRRA 2XWYA 3D0HE 3VV2B 1NBEB 1G2EA 1SB6A 4B3RJ 2UP1A 4X64J 5J2MA 1TTHB 4C4WA 3GG1A 4PG8A 3KYLA 3TARA 1F1BB 2DHXA 1ZS6A 4J9PA 4QIFA 4PUOB 1RDRA 4TYBA 3THVA 4J5OA 4HI2A 5D6GA 2JEIA 2HFOA 4XAKA 2W01A 2UV8G 5CCLA 4Y34A 2C2KB 3I31A 2B6AB 2BE9B 3HT0A 1WD6A 2KYZA 1WC4A 3R1HA 4GKJF 4DSKA 3W64A 1Y5NB 3U7JA 5FD1A 1FESA 5FLXY 3CNQP 4LRFA 3HLUA 2GC8A 2MQQA 1S79A 2M4MA 1P6TA 1OY6A 2I6WA 1S57A 2HHXA 1KD1T 4KJIA 1FT8A 4OX9F 3J81j 4WFBQ 3M2RA 1SJQA 4KHRA 5D15A 3N5FA 1FFGB 1NK7A 1NDLA 1Q5VA 3M8QA 2ILZA 3ZZTA 3PIOQ 3NS5A 2Y8YA 3ZO7A 2CG4A 2FLLA 1YSJA 1X9WA 1FE4A 1F5BA 3Q86A 1NU4A 1JLQB 2DCLA 2DY1A 3DLEA 3GZ7A 4NCGA 2BKPA 2DGUA 3GSDA 2HG4A 5EX3A 3G8SA 3R5CA 2WOMB 4L74A 4JI5F 1IVZA 4LT6A 4RZRA 2IAJA 4IR1A 2YNIB 2HAFA 3M8YA 3DLGB 2ZC4A 3PHTA 1ZM3A 4ZVQB 3PXGa 3ZZOA 3TYTA 1NUEA 1YJWS 1MROA 4DSJA 1P27B 4I0WA 1PC4A 3IGNA 5HQMA 1RU1A 3ENAA 3DHWC 1KFSA 2HEKA 2UXCF 2XULA 1FXDA 5CD4A 2DRDA 2UVWA 2E1PA 1FNOA 4K4XA 1RT4A 2WRMA 2M52A 3MEGB 4LMZA 4CH1A 4FYDA 5KT6A 3D6MB 4NLDA 4O3SA 4ECWA 3J81U 5E33A 3UDEA 3LTOA 4J9SA 1IXKA 1B7FA 3THTA 2WAQD 2VDIA 4JI4J 4UOGA 2GHVC 2MYFA 1TVRA 2IJFA 4W4MA 2VG7B 2MKSA 2AKWB 4K4ZA 3DRSA 1L3VA 3GU0A 4PYAA 4X62F 3DM2B 3NNHA 5D4LA 2RUGA 4FPRA 7FDRA 2OPRB 3TX0A 2JC1A 1UA0A 1HI0P 3W9JA 1NPRA 3G96A 2ADCA 2I0XA 1FJEB 2YNHB 2IIHA 4ZIWA 1U1PA 4OYPA 3NBPA 4ALZA 5L1JA 1Q5YA 1B99A 2AX1A 3S6EA 3Q24A 3G82B 3DOMB 2LLZA 1ZYQA 1AT1B 4PYDA 1WTFA 4HR2A 2FJWA 4ELTA 3RG6A 1NSQA 3M6UA 4JP8A 4ILRA 3GIJA 3EM1A 2AMCB 3VVTA 1F5CA 5KAKA 4ED7A 2ZDPA 4J9UE 4DPOA 4NZ7A 3O8WA 1FJGF 3MEDA 1WACA 1FTCA 3UDLA 4YQWA 4AL7A 3C16B 2EFVA 4DZ6A 3U1LA 5E3AA 1VCTA 5EWFA 4ZPBA 2D9PA 2F3JA 4DR1J 4J91A 3MF5A 2ZVSA 5KTQA 1TK5A 3R5JB 3QT6A 4ZJOA 5KFQA 1YBTA 2XG8A 4AXJA 3NL0A 2J0WA 1NK9A 1N32F 3W5XA 3T9NA 3TO8A 2DISA 3QRQA 2KKHA 1TV6B 3QGHA 2WHOA 1AFJA 1TMJA 1O51A 3Q2SC 3MMBA 4CTAB 2QFJA 4CP5A 1U2FA 3AT1B 2CQHA 2DNZA 4E0DA 4P10A 2B9XA 4YB6A 3UD3P 1U0HB 1YJTA 1CQNA 5LSRA 2DIUA 3CD6S 3WQPA 3VGVA 2VBXA 4ANEA 4I2QB 1VQ6S 2HPUA 1U6ZA 3CCWA 2HVHA 3BSNA 1D8ZA 3M6VA 1JLBA 2OELA 2HLUA 3ZZUA 5LT5A 4ER8A 1DRZA 3PKMA 4ZVEA 5J2QA 2XHWA 2NS1B 1A9NB 4F4WA 2WSCC 3HHLB 1YQHA 2FY8A 1HW9A 4ZOSA 1HR0J 4MKAA 3T1YJ 4KGZB 4IG0B 4L72B 4N5SA 5A0YB 1ZPVA 1M5OC 2V63A 2D3ZA 1S6UA 2GVZA 4WIIA 5IT0A 3KKFA 2NQPA 2BJ3A 1XNRJ 4WU2A 1MU2B 2BANB 1N4LA 3IMQJ 4XDDA 4H4OA 5EWEA 2QA2A 2XBPA 4JV5J 4RW9B 2DR9A 3ZZ0A 4OHYA 2HNZB 2B4PA 1BXNA 4BC7A 3Q2TC 5E3CA 2AYGA 3A8JA 4OYIA 3EGNA 1JX4A 4LF4F 2GQCA 4JI1J 3BSOA 3WDOA 2B7BB 1T03A 2EFGA 5F41A 3RU0A 2XNQA 2MKHA 1S9EA 3KNGA 1YIJS 1YGYA 1U1QA 1CC7A 4WP3A 1CPZA 5J2PA 1VISA 2AT1B 4IH7A 4M5KA 3DC2A 1S0VA 1UL3A 4C6AA 1NSAA 4O4GB 3I82A 2KRRA 1S6PB 1Y00A 4M95A 5HP1B 3DLKA 3SDEB 2Z2LA 4USWA 4QU7A 4QOTA 2H1YA 5KG4A 2GCFA 3BPDA 2UXBF 1U1MA 3K8WA 4GVLA 4WE1B 5HL7Q 2HBQB 2XI3A 3W2WB 3TW0A 3SSSA 1SV5A 4J9MA 1NPKA 2LP4A 5IS2A 5HI7A 4B9UA 3HF5A 5KFXA 1YRXA 2LU2A 1XBWA 1ZAVA 4K0KF 4DCJB 1ZETA 4OHXA 2OPPA 1ACMB 3NG8A 4CLSA 1DLOB 2YWEA 1IJFB 3CCQS 4FF4A 1Q8IA 3MWBA 3DLHA 4OZ3A 3VZIA 2DRAA 2KXFA 1GX5A 3MURP 4ELUA 4X84A 4KPCA 3W7BA 4O44B 2HURA 1DTTB 3M8WA 2JHEA 1X4FA 2I9SA 3TUPA 1Q79A 4DN9A 4QW8A 1CULB 3MM8A 4DX5A 1U24A 3W3SA 2ZHOA 1U7LA 3M1VB 2OAUA 4Q8FA 4KY3A 1KDNA 4S0MA 3UVJB 5C42A 1EHWA 4CYUB 1IKWB 4WYLA 3BR9A 4Q2MA 1GQEA 2VPXB 4OHZA 1HNVA 3TUJC 4LBPA 4LFAJ 4LRBA 2RNEA 2GS8A 1WDDA 2V67A 2VHGA 3UR3C 1UJ4A 4UW2A 3TAMB 5KFPA 4DV2F 1YHQS 1HMVB 2AJ0A 2O5DA 3R27A 1BQMB 3RJMB 5F8NA 2VFVA 1NZAA 1WF1A 3B6BA 2F8EX 3CJTA 2O66A 2JL9A 1KN6A 3BO2A 2GV1A 3QGGA 3M9NB 2A3JA 2ZBPA 4NOHA 4IO9Q 2XGQA 3JAMY 2C22A 1HLWA 2BX6A 4URSA 2VPYB 2M3DA 2R4FA 2ZBCA 3KUEA 2YY3A 2ZH8A 1LWFA 1IQTA 1CBKA 4UF4A 2PT0A 1M5PC 2W9BB 3ET6B 2CPHA 2R9LA 3M4XA 3IBFB 4LF6F 2ZKTA 5LM7E 1M1HA 4X4QA 4F4AA 4N7TA 4RNMA 5LSOA 1VQPS 4IYQA 2E1AA 1SH0A 2U1AA 3MMAB 2MLXA 1E6YA 1HHTP 2F9DA 4O3PA 4EBDA 3N6NA 3LWLA 2XWXA 2LU1A 1EIYB 1Q7YT 2CAJA 4CH0S 4K2JA 1PYTA 3DRPA 4ZJLA 2CJBA 2QSWA 3GP9A 3CO0P 1IKXB 4AQYJ 3F56A 1GFWB 1S77D 3UFCX 5B0BA 1T9YA 2J5AA 2VKRA 3M2UA 4USIA 2VBZA 4RO0A 1SL0A 4X4VA 3KHHA 4WP8A 2XC9A 4L76A 4PG4A 4RR5A 1S4EA 1SC1B 5ETOA 2J0SD 3NXZA 5T41A 5HBMA 4ZLJA 3PCOB 2RF2B 3M32B 3H98A 1TAQA 3K57A 3TQEA 1F60B 2UUBF 4JI6J 4ZPAA 3K8VA 3CCSS 2HS0A 3DKDA 2L08A 2BE2B 1HHSA 1UJ5A 2QX0A 4OQJA 5DM6Q 1D1UA 4UY85 4OJ1A 1VLOA 4O3NA 1R8AA 1HPZB 3HO1A 2W4CA 4ECUA 2ZBIA 4Y6IA 5HLFA 3GG0A 4A8FA 4LSZB 1RP5A 2CWXA 1EETB 4I1TA 6FD1A 4ZPCA 1M1GA 2WW8A 1U09A 4QQBA 2CZ4A 1GMWA 4C3LA 3K59A 1S1VB 1YTYA 4OZNA 3GMGA 1HNIA 4K4WA 2GMJA 4G1QB 2HLTA 5MAOA 5G0RA 2E5LF 1RYSA 1AZSA 1HQEA 2MSTA 1N33F 4K59A 3ZZYA 3EPIA 4QYZK 3DLJA 4DV4F 5DETA 3DNCA 3D67A 3BGRA 1C4CA 2AJ1A 2HHQA 2AEJA 4F0KA 5IOLA 2YPYA 2EI5A 2L9WA 3PM9A 2Y1JA 2IBKA 1H73A 3JYTA 1QAIA 3CJ2A 3HD1A 1KQGB 5LMUF 2BYCA 4FVCA 3LUYA 2VPWB 4FF3A 3NS7B 2MLZA 5EDWA 2G1DA 4X4SA 4PG7A 4DL0C 1ELOA 3MR3A 4ECVA 1XIQA 3F0NA 2ZBRA 2DVIA 4KKOA 1DAXA 1GTEA 1IKYA 3KHGA 5J1NA 1R6YA 4B3TF 1LOUA 4CLTA 3OL6A 2D74B 3CCZA 3OHAA 5CZXA 4OHWA 4IRDA 1TAUA 3FEYB 2VOOA 1UVJA 4QR0A 4DR6J 3CO9A 2HVIA 3TJ9A 2Q79A 4YR0A 5B08A 3VR1A 3M2RB 4CLKA 8RUCA 2X3DA 5A2QY 2ZC3A 1ZH5A 2HKEA 3M8QB 5LOQA 4GKKF 1N48A 2CQ0A 2C3PA 2I38A 3AJ2A 2F1FA 2K7KA 3R9LA 4PRFA 4KBIA 3QIDA 1NHUA 4EU0A 2FVPA 4DX8H 1WSVA 3M7VA 1OS5A 1T05A 3DLEB 4NCGB 1RT2A 3GV8B 2AV5A 4LF9F 1APSA 1FKOB 4HVZA 2IBOA 1QD1A 1U1RA 4PXEA 2JEFA 3AXMA 2YX7A 3EYZA 5GAHU 2GIRA 2UUCF 2IAJB 2DGWA 3TA2A 2DPJA 1EP4A 2HAIA 2FHMA 4DQIA 4M5GA 1S59A 3QSIA 1I94F 2JRSA 2CZVC 1HBOA 2G13A 3IWLA 4ZA1A 4UZCA 1RAIB 1NK8A 1PC5A 3D6TB 1RT4B 3AXKA 4F50A 3ZTPA 3K7RA 3BQ2A 1KKHA 3QJLA 1VQ9S 1F5AA 1M1KT 2YWWA 4DL2A 2HHUA 3O2IA 5F0UA 4ZCIA 1I5OB 2HVEA 1IBKF 4TY8A 4P73A 3OR1A 2KVIA 2Z58B 1YX2A 1JK9B 3KK1A 2J9DA 2W2QP 2F4VF 3CJ4A 3TZXA 1B3TA 2DNLA 3KJQB 4YUDA 5F8IA 5B0AA 4U7UD 1TVRB 1PSDA 3BGLA 4EEYA 4O3QA 1VQNS 3IR5B 2ZJQQ 4I67A 2BEFA 5DDPC 3D4JA 3MOJB 3DRSB 2HQCA 1U49A 3BZQA 2J8SA 2VQFJ 5BYRA 4EBCA 2MGZB 4C3KA 2Y8WA 1L5UA 2I1RA 1VBKA 3BF4A 1T3NA 1BY9A 1SKSA 3QRPA 4V19X 3NBPB 4K4UA 2P9CA 3PW0A 1T7PA 5AXLA 3PYGA 3EVOA 1CJTA 2MKKA 3DU6A 1WJ9A 3GWCA 1FD2A 4DUYJ 3MZIA 3NAIA 4CQ1A 3OV7A 1F2HA 2AD9A 4QWCA 1FNXH 3W9IA 2DGTA 3TR5A 4Q44A 2XZWA 3TOQA 3P5BP 1FWKA 5GADU 2DNMA 3R5BA 1RT5A 1WG5A 1Z1ZA 3MEDB 3UQSA 2ZWPA 1WOOA 4X65J 3KG0A 4ZP6A 1I51B 3DI6A 1WKJA 1J5EF 1HNXJ 4OZJA 5GVQA 3NNCA 1R0AB 1N5VA 1VIXA 4FBUA 4R8UA 3PJXA 1EB0A 2FHOB 3E8OA 1B64A 2FHKA 2GO8A 1K44A 2IC3A 3V2UC 2W1BA 4DG1A 2WBRA 5IQ6A 5KFSA 4ZIVA 2QMXA 2AP6A 4R25A 1U25A 3OD2A 2MB0B 2YKOA 3GV5B 4U7CA 4N76A 3OSPA 3PNIA 4KHMA 3H2LA 1HQUA 4DR3F 4YHHJ 3T1HJ 3V4MA 3KLEA 1MN7A 4MK8A 3LGMA 4DV0J 3I9V9 2R7WA 3MMBB 4F04B 3K5LA 2FVRA 5LMNJ 3FDSA 4O23A 2HBZB 2MZRA 2ZZTA 2DYAA 2EVZA 3HSJA 4V1Ak 1N6QA 1JQGA 3J7YU 1QVFR 5KT4A 7FD1A 4NXNJ 3GV7B 1HWJA 3C14A 4U6PA 1FWPA 2KXNB 2FTRA 1LXJA 1JLBB 2DNGA 4LSNB 3UD5A 1TR0A 3UNGC 2HMIB 2CQ2A 1F6TA 5HJYA 4KO0A 4DPXA 4B08A 2XMAA 5JJBA 2WVBA 2VQEF 1RGVA 3LAKA 3SFUA 3MEKA 2W9AA 5ETLA 2GVZB 2IPOB 3H59A 3OTBA 2ZNYA 2QYCA 3EE3A 3OTCA 2DB1A 1MNEA 1XMBA 2QL5B 1S49A 3CD5A 2J8AA 2PFFB 4MMOA 4DQQA 4Q45A 3H5XA 2M8DB 5L46A 1TKZA 2BKOA 3NEKA 3MM9A 1H7WA 5FLXU 5D0HA 1B0PA 2MQMA 3LP0A 3D28A 4FN5A 1Y5LB 1T03B 5KFRA 3ONQA 3ZZPA 2LQ5A 4WF9Q 3PV8A 1S6OA 1S9EB 4ITSA 5CAAA 1NXIA 3C6TA 1VR6A 2E1CA 1NSPA 4CIOA 3JSYA 5J2PB 2WCXA 5GAGI 3TZWA 4I64A 3F73A 2D7SA 2V34A 3PYDA 3QT5A 3SCLE 3DRRA 2CPZA 3GPAA 5KFOA 5KT3A 2V94A 2LVWA 3OLAA 3DLKB 5KFLA 3MECB 3HSDA 2XMVA 3KLGA 3AOAA 2HW3A 3HVRA 2AJQA 3KG1A 1SC4B 1TUWA 3OFHA 2V0NA 1JLEB 3CCUS 2HHVA 3M8PB 3TA0A 4KH1B 4JI7F 2YQ3A 2ZUAA 3PO5A 1IR0A 2V68A 2HZVA 2OPPB 1U1LA 1OY8A 3EZOA 1IBLF 1SC6A 3HFKA 3NP5A 2NZ4A 3VQTA 3EUNA 4TQSA 1T94A 5HO4A 2PN6A 2RDDA 3LPEA 5DG9A 3PDNA 3CJRA 2OD6A 5DDQC 1OQ6A 1X4GA 3H5UA 1TL3A 1FXLA 4G6VB 1BGXT 5E7OB 2OMOA 1NO8A 4TU7A 1WORA 1JNRB 4YY3J 3X3UA 1BWEA 4PZVA 4Q0BA 4DSFA 1C4AA 4HYKA 1YJUA 3THPA 4ECTA 1H2VZ 2EG2A 3JXOA 4WIQA 1RTDA 2Y1RI 3TAQA 3LA0A 4JB8B 3CCTA 2SXLA 4WFNQ 4WCEQ 2AU0A 4URGA 4WPAA 1SJFA 4B3MJ 3SCIE 1ZM2A 1DY3A 2EBEA 3TRGA 3DGPA 3KLHA 3SBMA 5C42B 5M2UA 3DRYA 4AYBD 4NLGA 3H25A 5FJ4A 1HNVB 4ZMMA 2NYHA 1R27B 2GQQA 4QWAA 2GHWA 3WC2A 5J1PA 3G86A 4YB5A 2HVDA 1JLCA 2NSCA 3SMZA 3BSCA 3HHKA 3EGWB 3CTRA 3MPYA 1SVDA 2R2TA 1HHQA 4C8MA 2H54B 1NHVA 1U1NA 5KFGA 5IFMA 3I56S 2CQGA 3I0SA 2XYHB 2XLKA 3UN2A 5IXUA 2YQ0A 4O3OA 2OTLS 1RK8A 2HHSA 3BGOP 4C98A 1IBMJ 2E1RA 3ENQA 3L3CA 4PUOA 2F8MA 3RZAA 3MR5A 2OMLA 5HVGA 1LWFB 4LF8F 2UUAJ 1MWZA 2L41A 3RRHA 4Z7CA 1RJJA 2JOQA 4ENOA 2CNKB 3H90A 1F9EB 2O3DA 2WONA 3RBXA 5CYMA 3AHPA 2N82B 3HSZA 3CJ0A 2KT2A 2R7UA 1T8EA 2VH7A 1MLAA 1H3DA 4DSLA 2G2YA 4GC6A 1LWXA 5ETNA 1E6YB 3UDCA 1WTBA 4LRDA 3FC9A 2K3KA 5D4PA 4DR4J 1YKWA 2JEGA 5K14A 4FS1A 2HYIB 1HWKA 3E3XA 1GMUA 2BQ3A 4ZVRB 3HHNB 4F0HA 4EI2A 3BKFA 1R8HA 4CLFA 4RUAA 1NB7A 4URQU 2ASJA 1VBXA 3DRPB 2KHDA 1HQ2A 3PYEA 2JWNA 1SH3A 4Q2LA 4B9NA 4CLUA 1W26A 3GFYA 2R3VA 3HVTA 4YEAA 4DR5J 2PMWA 1VGYA 3AQOA 2RE1A 4LQ9A 2DK2A 5GAEU 2QLXA 1V5VA 4J9NA 4ZVPB 2WOMA 1FX2A 2HGLA 4OI4A 5I42A 2C2ZB 3TJAA 4JI2J 4OZ1A 2BQUA 3T9ZA 1KWMA 5K20B 4GVBA 1S1UA 4DV3J 3TZZA 4DR2F 3Q23A 4RWWA 2BJEA 4WZMA 2PMHA 3GE9A 1D09B 1QY7A 4NLWA 3NGDA 1JNZB 2RVJA 1YDLA 4FYXB 4MAKA 4RU2A 2J0QD 3HHLC 3B78A 3UNYA 3NOCA 1QDUB 3FK4A 3PRVA 1G4CA 4OI2A 3CCLS 3G8TA 1N0VC 5HLFB 4W92B 3MI7X 2POKA 3PW5A 1FDDA 4NYOA 4L3KA 3O5TB 3TANA 5AE2A 2GHPA 3ILLA 2IA0A 3TUIC 1GH8A 1X9SA 2KT5A 3QFWA 1HNIB 3VGUA 4GO7X 3EDRB 3HX9A 3FKBA 3Q8RB 5G0RB 3UCGA 3BN4A 3KLIB 2RSQA 4NLTA 3QFHA 3P49B 3VAJA 1LXNA 2OP5A 1QAXA 5AT1B 1VK8A 3BR8A 1URRA 2H5JB 1QSSA 1ZA2B 4PQUA 4J9RA 4FF2A 3EGZA 3DM2A 2B4UA 1SC3B 3W61A 5JVHQ 4P52A 1RHQB 2APOA 1U6BA 3MMCA 4F2RA 1XERA 1XMQF 2HRYA 2YNHA 1B0TA 1RWXB 5FDLB 5I4MA 2YH1A 2W2PP 3MGJA 4JI8J 3RW6A 1VQKS 2AYBA 1RWKB 4KKOB 2NXNA 4Q5VA 2W25A 3DOMA 1XQIA 3M8SA 4AE5A 2Z30B 4WK3A 1NDCA 5KFJA 3K5MA 4GRSA 2WVCA 4JI0J 3FCWA 1WHWA 1Z2ZA 3HPOA 4QIGA 4ANDA 3JSBA 1UETA 2W8KA 3OL7A 1FF2A 2DR6A 2DNOA 2DO0A 4MKYA 3FSYA 3RW7A 5KG6A 1N88A 1QE1B 3PO4A 1U6FA 4OX7A 3EGVA 3G9CA 3GCXP 2HNYA 2AEFA 1IBCB 2KZMA 4ZP7A 1N0UA 3H4BA 2MHEA 3LWMA 4RWXA 2NUHA 4KV8A 2AJ4A 1NHKL 2QMWA 3V6JA 2GZOA 2ZH7A 1T05B 3G87A 1RT2B 4DL7A 1N5TA 3I5CA 5IC4B 2MTLA 3C15A 2VASA 1RHUB 2ASYA 3PKYA 2FLOA 2BABA 1I6JA 4EO6A 2HS4A 2C42A 1U0HA 2F65A 2OO4A 1H7XA 2W7PA 1SJ1A 2CJXB 2IM2A 4I2QA 3NCPA 1YK9A 3CJSA 1HL6A 3N5BA 3RB0A 1D0EA 3VAMA 1HBOB 3RTVA 2CDQA 2ZVIA 1REGX 2VBYA 1RT7B 4ZP9A 3HHLA 1S0OA 4KHPF 3H20A 3JAMU 4F0MA 2G0IA 1EAYC 5A0YA 2A1BA 5BR8F 1UVLA 5KG2A 2DGSA 4C48A 2FLNA 1T9WA 3PYFA 1MU2A 2BANA 1C0TB 2HFNA 4Y2MA 3OR1B 5HN0A 4ECXA 3HK2A 4LFBJ 1FEEA 2HZCA 4M94A 4WJBA 1YJ9S 1RWVB 2V5HG 3TA1A 1VQYA 2NUUG 5F9NA 1V6HA 1C1BA 3OL9A 4IFVA 4RW6A 2J0XA 2QFIA 2YX1A 5DQGA 2P5VA 1F9HA 4P7VA 1CLFA 3ULHA 3GJQB 4R5PA 1P1LA 2ZH6A 3CEDA 3ETOA 1M0SA 2Q6CA 3AJ1A 1NK0A 2XS5A 5IWAF 2KU7A 1U4BA 5KT2A 2HWHA 4AXIA 2X7IA 1UP1A 2FJEB 2JSXA 2ZKUA 2JX2A 4OYZA 1VIOA 4O4GA 4YB1P 2DXFA 1Y10A 3QBCA 2ZOMA 4QWEA 1VQ5S 5HP1A 1U0SA 4ZLPA 3KNAA 4C0BA 2LEBA 1Y9OA 4I7FA 1S6QA 2QTWA 2AF6A 1SPBP 5BYSA 4F3QA 4RBVA 4Y2AA 2BA9A 2XZTB 4Y3CA 3QO9A 4LR9A 3MR7A 4DU7A 3RUBL 1HA1A 3DDIA 2A0FB 2VB6A 2YWGA 2KJVA 3DU5A 1RWMB 2AGOA 1UCNA 1RT5B 3LPYA 4IKAA 1FDNA 3HZGA 5KFDA 4X2BA 4DL4A 2N4DA 4EUVA 3AH6A 4BBYA 5DLGA 1HWUA 1XNQF 5ETSA 1X5PA 1RAGB 1QUPA 2RMLA 2ZDOA 1Q53A 3MXHP 3HZEA 3FBCA 2ACMA 1W7WA 2JLEA 4DG1B 1WHYA 1UA1A 3HVAA 1IWGA 2D3OR 4YMEA 1FCAA 1DBDA 2WW4A 4N56A 1H98A 2FGOA 1Q7LB 2MQLA 4OI1A 4WTYA 2B7CB 2UUWA 2EC2A 3BPSP 2Z2MA 3Q22A 2OHDA 4JI3F 2JNJA 2HWIA 3KLEB 3I55S 1KLMA 3RGIA 2R7OA 4JV1A 2HHPA 3S1TA 2K1RB 4O44A 1DTTA 3JQJA 2B0GA 3HJFA 3X1LB 1N6QB 2X1AA 4IG3A 1P8GA 4NE9C 4TKTA 3M2VA 2P9GA 5HVFA 2R8IA 4PG5A 4OFZA 3WX8A 1ICEB 2BQRA 1CULA 5AJ3F 3PACA 4J90A 1RTIA 1O0PA 4KO0B 2DNQA 4WBFA 4U8VA 3BYPA 1WEZA 3IRXA 5KFKA 2QGFB 4TLRA 2EFQA 5M2RA 3PX4A 1AYEA 4H4MA 3KWMA 3I0RB 2RU9A 1KEKA 4ZPWR 5D4NA 3W66A 3TAMA 4HDHA 1HMVA 3CPWR 1BQMA 3GJTB 1RWUA 2JDJA 3OHBA 2MKJA 1KVKA 1TKZB 4DF8A 2WSEC 3MM9B 1Y7PA 5D0RA 3PZPA 2FD2A 2O01C 2LFVA 2DGVA 3WC0A 1HKAA 3LP0B 1ZAXA 5L39A 3U27A 2LQBA 3D3BJ 1RSCA 3GTYX 2GVDB 4TLQA 3EVMA 5KOXA 5EGYA 2GAGC 3SV3A 3BO3A 4C9DA 3L4BC 5H9EJ 2NXJA 5A2QU 1XWLA 3VAKA 1KNZA 1WC1A 1RCOB 4UOCA 2Q1LA 1FFWB 1KQSR 3ET6A 2BJ8A 3MFIA 1VS3A 1M5VC 3VAGA 3MDFA 3DHXA 4DUZF 1Q78A 2KDOA 5G4DA 4RX6A 5A76A 3AD7C 2VA3A 2AW0A 3FFIA 1YITS 2HHWA 4RBUA 4AFFA 2QLJB 3FZBA 3MMAA 4DV1F 4DXLA 5A8KA 2VDHA 2DNHA 5EHHA 2CYYA 3RR8A 2PO4A 1RWOB 1V9OA 1QUVA 2KFYA 4YP3A 1J2VA 2HS3A 3A8IA 3IM9A 4UZBA 3IS9A 2MY8A 1S1WB 5MLCV 2RRNA 1U1KA 2EPIA 4ETXA 1IKXA 2RDJA 2Z56B 4FYYB 2PSZA 4NMLA 5F8HA 3A13A 5L8RC 1M5KC 3UN5A 3OXGA 3MAHA 3IR6B 3A3NB 2MZTA 1YLXA 2NPIA 4DQSA 3HKZD 4ECQA 2DNYA 2M9KA 4DV7F 3V6HA 3K5OA 3K5PA 4KIAA 1JMTA 2HQIA 3CB4A 1WELA 2GIFA 4ETZA 2XYPB 4B3RF 4X64F 3M32A 2V4QA 3C2PA 4Q0BB 2P6SA 4KT0C 2CPEA 3EXCX 5D8HB 4PG6A 1S9FA 4ZVGA 4UOFA 1RTDB 4C8NA 4ILLA 3V4IB 4DS5A 2H4YB 1HPZA 1FRHA 4I6AA 2CDRB 2IM3A 1HNWJ 4XDCA 3DGPB 4OZ5A 2HGNA 1WHVA 4LF2A 1LK5A 2NPFA 3IC1A 3MPWA 3IP0A 5B7WA 4TU8A 1RAEB 4O0NA 3VAHA 2XCPA 4G1QA 1RWPB 1SIWB 1JLFA 1JLCB 1VBZA 4G3IA 4IQMA 4OI3A 2KTQA 8AT1B 2EBGA 5LL6d 4L6V3 1U02A 2VG5A 1EX8A 4LVOP 1JLAA 1UEVA 2GAHC 2E29A 3I0SB 2BW2A 2YKQA 4C3MA 2VF3A 2IVFB 4MKVA 4NLXA 2AYMA 5E3RA 1REVA 4LR8A 4DPTA 1LQ9A 2BKNA 5LSLA 1RB0A 4IO1A 2EKYA 3Q89A 4ED6A 3K17A 4QWBA 1T9XA 2R42A 3HFZB 2MQOA 2WONB 3KUGA 3DRXA 3HFVA 2ZH5A 5CYMB 1FK9B 2RQMA 3DOKA 1ZAWA 2DHAA 3CGIA 4K4SA 4K8RA 1N34J 4EZ6A 4F4KA 3G4SS 5HMZA 3W2VB 2VD3A 2B5JA 3AQPA 5F8MA 5K14B 2DT9A 5B0EA 4AL6A 4E8UA 5F3TA 3CT9A 3J7AN 1KTVA 2CIMA 4P2MA 3LQVA 1K9MT 4TN2A 2V6AA 1YZ6A 2BV3A 4NLVA 2EFOA 2W4DA 2NCKL 1LKZA 4N8OA 3HVTB 3O44A 4ECRA 1FKOA 3MM6A 1SJ3P 4JI4F 2ACYA 4K2XA 1TP7A 4NXMJ 4PABA 1WWHA 3DYAB 4RUHA 5I42B 1K8AT 2FC8A 2VODA 2JFDA 1K47A 5T14A 1SL1A 4GVBB 5IV3A 4PWWA 1S1UB 1B0VA 3N6LA 2YKAA 4DPYA 3D5MA 4ZPDA 1NB2A 1VJWA 2HRTA 4EO8A 4USUA 5EWGA 4NX9A 2K8GA 2KN4A 4L73A 2PI4A 4J9QA 5SZTA 5DJBA 3NGTA 1NCLA 3M30A 3W60A 2VG6B 3RB3A 1Y3JA 4QJVA 1S1XB 2FUG9 4PXBA 3MTJA 1SKRA 2VFUA 4MK7A 3S8SA 2F4FA 2H5IB 4Y2KA 3P3DA 4NMXA 2E1MC 1RZMA 1TQLA 4QIVA 1Q16B 3B54A 1KC8T 2M70A 2C3YA 2J9CA 4USJC 2Z4PA 3JQKA 1NZ8A 1T02A 2XS7A 2LXIA 2OSRA 4ED1A 4I2PB 1FXRA 2Y9HA 1IWAA 2P2CB 5KFBA 1TMMA 2XMUA 4CRJA 4PQUB 5GMKa 2MGZA 4DR1F 1NNDA 1H2UX 4B9TA 2WB1D 4O3RA 4ZP8A 2E5GA 2HFZA 2WK4A 1S7HA 9RUBA 2PMZD 2UU9J 3MMCB 3D7SB 2KT3A 2G1HA 4A8MP 2PGCA 5CABA 5SUHA 3IRWP 4C7QA 3QIPA 3ICLA 1R6VA 2R7RA 4ZITA 3MM5B 3ZXWA 2H51B 3R8YA 1HBNA 2PDAA 3DCAA 1H6KX 3ILOA 4BWJA 3H4DA 1TL1A 2RU3A 2FHJA 1XJWB 1YJ7A 9ATCB 2VZ9A 3Q8YA 2QMUB 3G2XA 4TXSA 2Z8QA 4ED2A 1R0AA 4DU8A 3FBBA 3OPKA 1HR0F 3DOLB 2N7CA 3CJ3A 2KVQE 1K0VA 3T1YF 2HNYB 1B70B 5HK4A 2ATLA 3GJRB 4DR7J 4NYZA 2E7VA 1XNRF 1V3SA 4KV8B 1T9UA 3EPGA 1DHMA 2DGOA 1J5OA
chains in the Genus database with same CATH topology
3NGSA 3VVUA 1NDPA 3Q8VA 1LEOA 2AZ3A 3EVMA 3ZTRA 5CABA 3EVWA 4DI6A 3NGTA 4UOHA 1NCLA 3ZTSA 1MN7A 3ZTQA 3EJMA 3WX8A 3EVOA 1NUEA 2ZUAA 3VGSA 1WKKA 2DXEA 3DDIA 1B4SA 3NGUA 2DYAA 3BBBA 1NHKL 1UCNA 3ZTPA 3ENAA 3ELHA 3BH7B 5BXIA 1MN9A 1KDNA 4F36A 1LWXA 4S0MA 2HVDA 1BUXA 1EHWA 1S57A 1NPKA 3PRVA 4WBFA 2DXDA 3FC9A 4F4AA 5IOLA 1NDKA 3B54A 2HVEA 1B99A 3Q8UA 3R9LA 2B8QA 3BBCA 4CP5A 3ETMA 3Q83A 5CAAA 4FKXA 1NSPA 3FCVA 4ANCA 2B8PA 3BBFA 2DY9A 1NDLA 4DUTA 2NCKL 1NLKL 1JXVA 1HHQA 1XQIA 3FBCA 1W7WA 3MPDA 4HR2A 1BE4A 3Q8YA 3DKDA 3ZTOA 4UOFA 4W98A 1F6TA 1WKJA 3VGVA 4FKYA 3G2XA 3FBFA 1NDCA 3BH6B 3L7UA 1NSQA 4ANEA 2CWKA 3JS9A 3GPAA 1VYAA 1XIQA 3EM1A 3VVTA 3Q86A 2VU5A 3FBBA 3FCWA 1BHNA 2BEFA 3Q89A 2AZ1A 3VGUA 3EMTA 1K44A 3FKBA 1ZS6A 1WKLA 3B6BA 4EK2A 4ANDA 1NSKL 3FBEA 3VGTA 5C7PA 1PAEX 4UOGA 1HIYA 1S59A 4C6AA 4DZ6A 1PKUA 3GP9A 1U8WA 4O0NA 2DXFA 4KPCA 3EE3A 2HURA 1NB2A 3NGRA 3PJ9A 4ENOA 1S5ZA 1HLWA 3EICA 2BX6A 1F3FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NGS A;  3VVU A;  1NDP A;  3Q8V A;  1LEO A;  2AZ3 A;  3EVM A;  3ZTR A;  5CAB A;  3EVW A;  4DI6 A;  3NGT A;  4UOH A;  1NCL A;  3ZTS A;  1MN7 A;  3ZTQ A;  3EJM A;  3WX8 A;  3EVO A;  1NUE A;  2ZUA A;  3VGS A;  1WKK A;  2DXE A;  3DDI A;  1B4S A;  3NGU A;  2DYA A;  3BBB A;  1NHK L;  1UCN A;  3ZTP A;  3ENA A;  3ELH A;  3BH7 B;  5BXI A;  1MN9 A;  1KDN A;  4F36 A;  1LWX A;  4S0M A;  2HVD A;  1BUX A;  1EHW A;  1S57 A;  1NPK A;  3PRV A;  4WBF A;  2DXD A;  3FC9 A;  4F4A A;  5IOL A;  1NDK A;  3B54 A;  2HVE A;  1B99 A;  3Q8U A;  3R9L A;  2B8Q A;  3BBC A;  4CP5 A;  3ETM A;  3Q83 A;  5CAA A;  4FKX A;  1NSP A;  3FCV A;  4ANC A;  2B8P A;  3BBF A;  2DY9 A;  1NDL A;  4DUT A;  2NCK L;  1NLK L;  1JXV A;  1HHQ A;  1XQI A;  3FBC A;  1W7W A;  3MPD A;  4HR2 A;  1BE4 A;  3Q8Y A;  3DKD A;  3ZTO A;  4UOF A;  4W98 A;  1F6T A;  1WKJ A;  3VGV A;  4FKY A;  3G2X A;  3FBF A;  1NDC A;  3BH6 B;  3L7U A;  1NSQ A;  4ANE A;  2CWK A;  3JS9 A;  3GPA A;  1VYA A;  1XIQ A;  3EM1 A;  3VVT A;  3Q86 A;  2VU5 A;  3FBB A;  3FCW A;  1BHN A;  2BEF A;  3Q89 A;  2AZ1 A;  3VGU A;  3EMT A;  1K44 A;  3FKB A;  1ZS6 A;  1WKL A;  3B6B A;  4EK2 A;  4AND A;  1NSK L;  3FBE A;  3VGT A;  5C7P A;  1PAE X;  4UOG A;  1HIY A;  1S59 A;  4C6A A;  4DZ6 A;  1PKU A;  3GP9 A;  1U8W A;  4O0N A;  2DXF A;  4KPC A;  3EE3 A;  2HUR A;  1NB2 A;  3NGR A;  3PJ9 A;  4ENO A;  1S5Z A;  1HLW A;  3EIC A;  2BX6 A;  1F3F A; 
#chains in the Genus database with same CATH topology
 2VON A;  2QJ3 A;  4JV5 F;  4TQR A;  3G8Q A;  3C15 B;  3ZTQ A;  1FVQ A;  3CME S;  4K4T A;  3D1H A;  5HAN A;  5LXR A;  3OTO J;  2IYI A;  2NXE A;  3IR7 B;  2R8J A;  1D9D A;  4JI1 F;  3FQL A;  1AUS L;  1PBU A;  5JMN A;  1HD1 A;  5DM7 Q;  2OEK A;  3FCV A;  4LSN A;  5IT9 Y;  1FRK A;  4QU6 A;  4ZVS B;  2ASL A;  2AGP A;  3KFW X;  2FJD B;  2E9Z A;  4C11 B;  2HMI A;  1FKP A;  1F2G A;  1UFW A;  1KOO A;  3KK3 A;  2YKN A;  3GR1 A;  3JB9 k;  4IRC A;  2RKI A;  3GON A;  3CCE S;  3TUZ C;  5C7P A;  1ITP A;  2FGC A;  5KFY A;  3ENV A;  3NWR A;  1XMO J;  5A8R A;  1MG7 A;  2MEW A;  1VRT B;  4OV6 A;  1RTJ B;  3POT A;  1S5Z A;  1MMN A;  2JC0 A;  2YWK A;  1FRJ A;  5KT5 A;  1OSD A;  3LOU A;  3Q8S B;  1VC6 A;  2PEH A;  2VUG A;  1C1B B;  1SCJ B;  4IFV B;  4RW6 B;  2PC6 A;  2CQB A;  2DXE A;  5T7L A;  5ETP A;  2LDY A;  2BJ9 A;  2RT3 A;  1JKH A;  1MWY A;  2ZM6 J;  1KS2 A;  4R5P B;  3QWU A;  2BJ7 A;  3SZ2 A;  4J9O A;  3BV8 A;  4HHH A;  2BBE A;  2GO9 A;  2DEJ A;  1M90 T;  4DL3 A;  1ROF A;  1RAF B;  4YS2 A;  1S97 A;  5K9F A;  2B3T B;  3CCV S;  4FP9 A;  4OYM A;  2AWZ A;  2E5H A;  1NJI T;  2JVO A;  1OIA A;  2MQ8 A;  2N3L A;  2XNR A;  5DZ7 A;  3MEC A;  3BS9 A;  4KYZ A;  4I7F B;  1S6Q B;  2LEA A;  1BMQ B;  5CD4 H;  2VFR A;  1W2I A;  2GJI A;  4JOU A;  4XIU A;  3QO9 B;  4DLE A;  3EXY A;  1OYE A;  1R8P A;  2DEI A;  3CC2 S;  2CQ1 A;  2C2D A;  3KK2 A;  5I3U B;  4J9V A;  3L7P A;  5AXM A;  4QIE A;  1P1T A;  1JLE A;  3BGF A;  2XQC A;  4RW8 A;  6FDR A;  2R8K A;  3M8P A;  3HP6 A;  2LKZ A;  5AXK A;  4WXO A;  1EJ7 L;  2IVM A;  3WHI A;  1RHK B;  1UEK A;  3PTW A;  2YWH A;  2ZEJ A;  3D1Q A;  2BZ2 A;  2VL1 A;  4LFA F;  5B09 A;  3TX8 A;  4ZVU B;  3EZ5 A;  2CPF A;  3QYY A;  5HAT A;  1RUS A;  1AUD A;  4WWS A;  2CAD A;  2DNP A;  1WC6 A;  4RNN A;  2JH3 A;  1NJW A;  3E01 B;  3SQG A;  4IDK B;  1S12 A;  3M8R A;  1BQX A;  2RS8 A;  1KLM B;  4DOZ A;  4J37 A;  3H2V E;  2RQ4 A;  1UKU A;  2YNG B;  4IG3 B;  1GEH A;  3M2V B;  4ECZ A;  2ZFH A;  1WHX A;  2C1E B;  5ETM A;  4LF7 J;  2UXD J;  4WYW A;  2XSJ B;  2ZZN A;  2K2P A;  4JBC A;  2ZH9 A;  1VRU A;  2E7W A;  1NDP A;  3RAQ A;  1RTI B;  4R0J A;  4FPI A;  2RIL A;  2QLB B;  5HMW A;  3IRX B;  2OEJ A;  3T5H A;  1IM6 A;  2X1G A;  4L75 A;  1L3T A;  2EXU A;  4PAA A;  1G7C B;  4N41 A;  4H4M B;  4OL8 A;  2HHT A;  5GME A;  4LF5 J;  2JFK A;  3U1N A;  4G1I A;  1VQ4 S;  2MKI A;  3EWG A;  1HYS B;  4I6W A;  2OPQ A;  2XS2 A;  2CQI A;  4NA3 A;  4HI1 A;  4RUB A;  2CPJ A;  1BE4 A;  2LCW A;  4W98 A;  2CNO B;  1NKB A;  1WSR A;  4ED4 A;  3R7B B;  4PXD A;  3QZ8 A;  3CSK A;  4C0O C;  4WU3 A;  1LW0 B;  4CO5 A;  4B3S J;  3SEO A;  4HEA 9;  2WZ1 A;  2ZE2 A;  3A3O B;  2KFZ A;  4G1P A;  4AQY F;  3Q0A A;  4CO0 A;  1PAE X;  4HTJ A;  2D1C A;  3CC7 S;  2BVZ A;  4ES1 A;  3KDO A;  4NWB A;  2G0J A;  4OLP A;  1OO0 B;  1CG2 A;  4TVA B;  2R2U A;  4F4Z A;  3EVW A;  1SKW A;  4YN3 B;  1H2T Z;  2MSS A;  3QJP A;  1X4B A;  3G6E S;  2L48 A;  2NLW A;  2ZZM A;  2HQG A;  4XTT A;  2XY5 A;  2J6U A;  2B56 A;  3FFI B;  3KJV A;  1UFK A;  3GYN A;  5ETT A;  4PWD A;  3PVX A;  4JI3 J;  4JI6 F;  1AW0 A;  2PD1 A;  3KOA A;  4F8R A;  3WBZ A;  5A8K B;  4JYA J;  4HHU A;  2DNR A;  1YI2 S;  1X8D A;  2Q6B A;  2KJW A;  5IV4 A;  1OWX A;  5EN1 A;  1GK8 A;  2DHS A;  5HAO A;  4ES3 A;  3MPD A;  4CO1 A;  4ZCM A;  3IS9 B;  2Q43 A;  1UPM B;  5HSP A;  5KFN A;  3LP2 A;  2C2O B;  1PIL A;  2EEY A;  3C6U A;  2CA9 A;  1V5I B;  3D1O A;  3ZNJ 1;  1SJR A;  3JSR A;  2DNK A;  1BWV A;  3UO0 A;  2LQJ A;  1BQN A;  1LW2 A;  1U1O A;  1RQ0 A;  1O8B A;  2ZBQ A;  3IBC B;  1L3K A;  2GGP B;  3QSY B;  1N52 B;  4YR2 A;  3FMB A;  2LEP A;  3ZTS A;  5IT4 A;  4DN0 A;  2CQ4 A;  4U67 Q;  3OT9 A;  2NXC A;  3J80 Y;  1OMS A;  3OSN A;  1ULR A;  2DIV A;  1QSL A;  1N5Y B;  2MLY A;  1VQL S;  2FIU A;  4AD6 A;  4DFK A;  2JZ5 A;  3I96 A;  1GT8 A;  1HBM B;  2M88 A;  5HRO A;  3OR2 B;  2DXD A;  2BOP A;  5CHC B;  2P9E A;  3RR7 A;  1EKS A;  2FZK B;  4NYP A;  4CWB A;  4FF1 A;  4DBQ A;  2DGQ A;  4MIW A;  5M2P A;  4M5M A;  4CNZ A;  1Y11 A;  4ZS6 A;  2V9K A;  1YJN S;  2CZ9 A;  1WC5 A;  5THW A;  3M6W A;  4DFP A;  3I4H X;  2BM0 A;  2QA4 S;  4IRK A;  4DV6 J;  4BS2 A;  2GIQ A;  5KOW A;  4DWI A;  1WF2 A;  3TAP A;  2J9D E;  3KLI A;  3F41 A;  1JLF B;  3H5S A;  4DR6 F;  1CJK A;  4F4Y A;  4QPT A;  1S0M A;  2ZH2 A;  4LVN P;  3O1L A;  4HKQ A;  2VG5 B;  2RDI A;  1U26 A;  4WFX A;  1S10 A;  3ZTR A;  1JLA B;  1ZZF A;  4DV1 J;  1TK8 A;  8ATC B;  2AJF E;  1WKK A;  2JLF A;  3K0J A;  5B0C A;  4NAS A;  4LR7 A;  4NA2 A;  5K8M A;  2HGM A;  1REV B;  1PCA A;  3PR4 A;  5FDL A;  4RNF A;  1GTH A;  4LJM A;  4IUF A;  1TUV A;  3FNN A;  1N36 J;  1SXL A;  1OY9 A;  1TU0 B;  4LF1 A;  1D9F A;  4UQT A;  1J27 A;  1FHT A;  2IRX A;  1RT3 A;  4USM A;  3IGV A;  1X4C A;  1ZBT A;  2RQK A;  3DOK B;  1IN0 A;  1YBU A;  2E44 A;  1VI7 A;  3W5Z A;  4B17 A;  4X66 J;  3UR0 A;  1GNK A;  3NNA A;  3OTE A;  2B5J B;  2B9Y A;  3AFG A;  5C25 A;  1HNZ J;  4J7C A;  4NLR A;  1QE1 A;  2XSF A;  1TL7 B;  2MZS A;  5A6P A;  3N28 A;  2HFV A;  4NLY A;  2QSF A;  2XZD B;  3OW2 R;  3TVK A;  1R8B A;  2UVU A;  2LA4 A;  1UVI A;  1GXL A;  1B4S A;  1EAR A;  2ZJP Q;  2MY7 A;  2F40 A;  2WBM A;  4MJK A;  1HWI A;  1TZ0 A;  4F36 A;  1S48 A;  1VQS A;  4M5J A;  3MM6 B;  2ALY B;  3OUY B;  3NS6 A;  1JIH A;  3CJ8 A;  4M5H A;  3AJD A;  4TU9 A;  4DEZ A;  1H74 A;  1LWE B;  2CPY A;  4LFC J;  1FRX A;  1JB0 C;  4HAC B;  4QR2 A;  3OFF A;  2VQF F;  2M8H A;  1JJC B;  3SQO P;  1KP6 A;  4DV5 J;  4QR1 A;  4OJG A;  4MIA A;  4NLO A;  1CJU A;  1C1C A;  4A8Y A;  1X7V A;  2CNL B;  4OYA A;  4Z2X A;  3G71 S;  3VGT A;  1X5T A;  3M30 B;  2OUG A;  3HKW A;  1RT7 A;  2NZC A;  3IWN C;  3LAM A;  1HBU A;  5E3P A;  2B4V A;  4M5I A;  3MR6 A;  1CS4 A;  2FJX A;  4UT4 A;  4DUY F;  1FRI A;  4ICL B;  2ZHB A;  4UOH A;  1UWA A;  2RB7 A;  4QZV B;  1UZH A;  1C0T A;  3T3F A;  2E66 A;  3KUH A;  4UUX A;  1VC5 A;  3NGU A;  4ED0 A;  3ELH A;  1ZM4 A;  3DFE A;  1RBL A;  3AD9 C;  1RLC L;  5K8O A;  4NCB A;  4GKJ J;  3FGV A;  4X65 F;  2XLJ A;  2E5I A;  4DHV A;  2RJZ A;  4MFB A;  1FNM A;  4OI0 A;  3GFZ A;  1KTQ A;  1TFY A;  3BDE A;  1HNX F;  3I87 A;  3OVS A;  3QMQ A;  4YOE A;  3D0I E;  1PGZ A;  4OX9 J;  4UST A;  2OKQ A;  2BAC A;  4KPY A;  4OX8 A;  2XMJ A;  3H5Y A;  4Z37 A;  2EKN A;  2VIH A;  3G6V A;  5ETR A;  2AZ1 A;  3PX6 A;  4USV A;  4NZ6 A;  4C97 A;  5HJX A;  2KM8 B;  1G1X A;  3QIP B;  4DS4 A;  3PX0 A;  3MR2 A;  1M5S A;  3LH2 S;  4YHH F;  3T1H F;  4K5S A;  4EBE A;  4DV0 F;  3R2C J;  2PI5 A;  5LMN F;  1EKR A;  1LV5 A;  4CLY A;  5DQH A;  1F3F A;  1WEY A;  3RAX A;  2MMY A;  1HBN B;  4J9L A;  3US5 A;  1NJY A;  2ILY A;  2BJ1 A;  3CDE A;  4NXN F;  1RAJ A;  2OFH X;  1U48 A;  2H5E A;  1P9Q C;  1TL1 B;  4Y00 A;  4JI5 J;  2Y3Y A;  4GO5 X;  2BRL A;  2FVC A;  5E3Q A;  4F02 A;  5E2Q A;  1X4D A;  4ZVF A;  1K73 T;  4B3O A;  1UMJ A;  2FZC B;  4JV0 A;  4U8Y A;  1Z4U A;  2XM3 A;  2UXC J;  2V4J A;  1RAO A;  2MDA A;  4DUT A;  6AT1 B;  5C2G A;  3TVY A;  2OD4 A;  2AYE A;  5CYQ B;  3BJY A;  3W63 A;  2GFF A;  5B0F A;  3IA0 A;  2NSB A;  3GIR A;  1J5O B;  2CQP A;  1VLY A;  1ZA1 B;  2K7J A;  2DGX A;  4UUW A;  5LJ3 Y;  3PHE A;  3PJW A;  4HL9 A;  5DLF A;  4LRE A;  2K1R A;  1N56 A;  3LAL A;  1FX4 A;  1X4H A;  2CPI A;  1SIZ A;  4OYX A;  2YH0 A;  4KGM A;  4KGK A;  4FXD A;  3I5B A;  2EW9 A;  4LUB A;  4HHJ A;  1R31 A;  2MQP A;  4E98 A;  3SCK E;  5K8N A;  4P71 A;  2C3M A;  1HI1 A;  4X62 J;  1KHW A;  2VFT A;  3PR5 B;  3KMS A;  1FKP B;  1KQF B;  1BUX A;  1SKU B;  3UCZ P;  4WTO B;  2W2M P;  1VRQ C;  3KK3 B;  2YKN B;  3VF0 B;  1X60 A;  2EWH A;  3LAN A;  2KXH A;  2RKI B;  1PIE A;  1S9G B;  4LIR A;  3MD1 A;  5KG1 A;  3TEH B;  4OZ0 A;  5C24 A;  2RH3 A;  4KGV B;  1BD6 A;  5A8R B;  5KFH A;  3I0R A;  2QT7 A;  3POT B;  3JTN A;  2A18 A;  5GMD A;  3LP1 B;  3OQ2 A;  2DHH A;  3QLH A;  2DTJ A;  3HDS A;  4P72 A;  2X3G A;  2ZH3 A;  4JUZ A;  4FNI A;  1UFL A;  4DCO B;  3MCO A;  1V3Z A;  4PXC A;  2XHC A;  2MKY A;  2DPI A;  1HAR A;  4Y2C A;  5HQ8 A;  3JTP A;  5T7L B;  5H9F K;  1S4F A;  2JEJ A;  1UTA A;  2D69 A;  2Y0S D;  1FJG J;  3KLF A;  1JKH B;  2BMB A;  1DQ8 A;  2ZD1 A;  2GVD A;  4RNH A;  4CDI A;  1OQ3 A;  2QLF B;  5IQQ A;  3DMJ A;  1KRP A;  4N8N A;  2A6M A;  2E7X A;  3NOG A;  1CC8 A;  3P4U B;  3MPV A;  1N54 B;  2UVR A;  4RJV A;  2YXL A;  4R0E A;  4ZVO B;  2J76 E;  1N32 J;  2CJY B;  2MJN A;  3ITH B;  3Q83 A;  4YY3 F;  4MYT A;  4C8L A;  2V8V A;  1LNQ A;  4DMZ A;  5JUM A;  4CM0 A;  1JJ4 A;  3HSG A;  2HFU A;  3FBF A;  3BH6 B;  3NCR A;  1U2R A;  2YKM A;  2V8G A;  4V19 J;  1WI8 A;  1RHR B;  2HSE B;  1U45 A;  1E6V B;  3KK2 B;  2FYX A;  3ISN C;  3EMT A;  1S72 S;  1S76 D;  4B3M F;  1K1S A;  1Q82 T;  2W7A A;  4BHQ A;  4RW8 B;  2C3O A;  4USK A;  3NRB A;  1S1W A;  1N5Q A;  2LMI A;  1Q95 G;  4P2S A;  1SQG A;  4LBI A;  2Y0B B;  5KT7 A;  1RAD B;  1RAA B;  1UVN A;  4LBH A;  4HH0 A;  5GAH I;  1HFE L;  2BUN A;  4FYW B;  1QTN B;  1Q8L A;  5C5J A;  5D3G B;  1P9Y A;  1QTM A;  2HRU A;  3B8H A;  3E2E A;  2XMW A;  2W9C A;  3CCR S;  3SQG B;  3TI0 A;  1KBR A;  5E5N A;  4DLG A;  3OL8 A;  5DG8 A;  4M5N A;  1UVK A;  3GIL A;  2KZZ A;  2CQD A;  2QC3 A;  1CQM A;  3CDA A;  3FMW A;  3GFX A;  2BR0 A;  3EX7 B;  3N9U C;  2GML A;  4Y65 A;  1AA1 B;  3R5D A;  1Q8K A;  2IJR A;  4FKX A;  3QJJ A;  1YJV A;  5A8W B;  2M5Y A;  4CLZ A;  4PPD A;  3NMA A;  3NWG A;  5DZ6 A;  1IBM F;  2FZG B;  4QYZ J;  3NLC A;  4CT8 A;  3V4I A;  1UAW A;  3ZC4 A;  1GMW D;  4OV1 A;  2UUA F;  4LF4 J;  3HT3 A;  3D6H B;  1VRU B;  5DS7 A;  3IM8 A;  1RXO B;  2V9W A;  1ZTW A;  2F9J A;  2KHC A;  1NJX A;  1R3N A;  2OFG X;  3QAT A;  3C8Y A;  2XGP A;  3GSI A;  2GX8 A;  4RU9 A;  2ALZ A;  2VJU A;  3PY8 A;  4KAI A;  4I56 A;  4Y28 C;  2DH8 A;  2K3I A;  3VVU A;  3T1A A;  2Y1L B;  4ZCL A;  2QL7 B;  1WUU A;  3M6X A;  2ROP A;  1YG0 A;  3ZZR A;  2OPQ B;  1ZTT A;  2B51 A;  4DR4 F;  4A8X A;  4KSE B;  3EDQ B;  3QT8 A;  4U9R A;  1IKV A;  4ECY A;  3VTI A;  1OSC A;  1PJ6 A;  4B02 A;  3CCM S;  1W2B R;  2UXB J;  5KFI A;  3M9M B;  4F7V A;  2VC0 A;  2FY1 A;  3ETM A;  1C0U B;  2ZE2 B;  2OGU A;  2RUS A;  5D0G A;  4WFZ A;  3HHD A;  3QGI A;  3CWJ A;  4FKY A;  1HWL A;  4DR5 F;  4ZN3 A;  3KHL A;  3L9Z A;  3QT7 A;  1TKD A;  4K0K J;  2HND B;  2N4C A;  1F0X A;  2L3M A;  1RT1 B;  5GAD I;  3E51 A;  2JLG A;  4NRU A;  1NRK A;  5LJ5 Y;  2GJF A;  3HVW A;  4JI2 F;  1WEX A;  1FK9 A;  1WDT A;  3KJV B;  3BGU A;  4DV3 F;  2IA6 A;  2PFD A;  2BDP A;  4PWD B;  1FDB A;  3BO4 A;  2DJW A;  3DDK A;  3NGS A;  2D3U A;  1ARO P;  1JLG A;  3QNW B;  4XPE A;  5KG5 A;  2V50 A;  3D3C J;  3EJM A;  4I68 A;  1DTQ A;  4TYA A;  3W2V A;  3T5K A;  3OVB A;  2K06 A;  2N3O A;  1TEL A;  3M9O B;  4ECS A;  4M5D A;  3LW5 C;  2V2V A;  5C2C A;  2ATC B;  4YDX A;  1OPI A;  4NEY A;  5DO2 A;  1NK4 A;  3WZ0 A;  3LP2 B;  3AAW B;  3PW7 A;  3N0V A;  4CLL A;  1DQA A;  3BKU A;  2YNF A;  2C28 A;  4F25 A;  5IT9 U;  5J1E A;  4E2F B;  3FSI A;  1UJ6 A;  3C6U B;  5I3P A;  2DIT A;  1DFD A;  3J7Y I;  4UY8 T;  3H8Y A;  1IUJ A;  2CG8 A;  3L7U A;  2NYI A;  1B7Y B;  1CJV B;  3LGN A;  1BQN B;  1LW2 B;  2I5J B;  4KFB B;  3DYA A;  3WX4 A;  2EC0 A;  1S1T B;  1SUQ A;  5AXN A;  4U7U K;  2XYG B;  3FRY A;  2E5J A;  5CZV A;  3MCS A;  4DV2 J;  5LXY A;  2C2N A;  4JV2 A;  3NKY A;  3UE2 A;  5KFW A;  4NLS A;  4NPO A;  1TKX A;  4Q7A A;  1RU2 A;  2AZ3 A;  1RTH A;  3OXL A;  2KI2 A;  4P2F A;  1SBR A;  5HRO B;  4I69 A;  3TVZ A;  2VBW A;  5IM0 B;  1WNE A;  2VG6 A;  3FSX A;  3MUT P;  4JI8 F;  3G6X A;  1S1X A;  2O67 A;  4XO0 A;  2PA8 D;  5KFF A;  2DO4 A;  3SFG A;  2J6S A;  3AOB A;  4RNO A;  2C2E A;  4P6Q A;  1MML A;  4DZD A;  2YX4 A;  2RQC A;  3SIP B;  2XCA A;  4RW4 A;  2BM1 A;  2Z2Z A;  5RUB A;  1RAC B;  4M1K A;  2RS2 A;  1Y0H A;  4JI0 F;  4MTP A;  2IHR 1;  4LF6 J;  3W8G A;  2IMO A;  1CJK B;  4I2P A;  2IMW P;  1RA6 A;  2H4W B;  5KFA A;  3V6D B;  4OI6 A;  4FXW A;  2AIR B;  5KFE A;  2LYV A;  3LO3 A;  3V5R A;  3B4M A;  3H7H B;  3IAS 9;  3MFH A;  2F5G A;  4D3G A;  3KDN A;  3W8P A;  1H72 C;  5F9L A;  1RLD A;  2WVE A;  1RKI A;  2LDI A;  3NGR A;  3T5L A;  4A8O A;  3A4T A;  2OI2 A;  1H38 A;  1ZZN A;  4DF4 A;  1FDA A;  2ERR A;  1ZM9 A;  3CDU A;  5HMY A;  4LSL A;  4OIX A;  1Q8B A;  2LQ8 A;  2PE8 A;  5CXT A;  3MM5 A;  4BWM A;  2RD5 C;  2VV5 A;  2YTC A;  4CO2 A;  1RT3 B;  2HQF A;  4MIB A;  2F8H A;  5DDR C;  4NCA A;  3D2W A;  4RW7 B;  2C2R A;  2M2B A;  5J2M B;  1A6L A;  2UUB J;  5C25 B;  2RRA A;  4KB7 A;  3DOL A;  2CPX A;  1FFS B;  1XN9 A;  3S7R A;  2G0C A;  4HDG A;  2H65 B;  2HHH F;  3HI9 A;  2CNN B;  3R7N B;  3W1Y C;  1F3V A;  4CZC A;  1UVM A;  5DGB A;  5ETK A;  3SCJ E;  2QIF A;  3FUY A;  1TKT A;  3DN9 A;  4A8Q A;  4X4N A;  4LFB F;  4K4Y A;  3Q8P B;  3AD8 C;  2HK2 A;  1F9F A;  2FQQ B;  2J7U A;  2ADB A;  1N5S A;  1UWB A;  3OVA A;  2DD8 S;  2IJN A;  1JXE A;  1YWX A;  2WVD A;  4GMK A;  5GAG U;  2E5L J;  1RE1 B;  4H4K C;  4KR0 B;  1N33 J;  4CO4 A;  2XO7 A;  3IG1 A;  1CJU B;  1C1C B;  1DQ9 A;  4DV4 J;  1VBY A;  4CCH A;  4ID5 A;  5KG0 A;  1VC0 A;  4P74 A;  2VPZ B;  4ZHR A;  5H9F J;  4FZV A;  3BQ0 A;  3ZTO A;  2E9T A;  4C11 A;  1FVS A;  2GQ2 A;  2DHG A;  1HBU B;  3W5Y A;  3FRZ A;  3U1M A;  5F3Z A;  1NK6 A;  1NME B;  5LMU J;  4OLO A;  1CS4 B;  4ATN A;  4C8K A;  3GYG A;  3MM7 A;  2QZ8 A;  2AQ4 A;  1GX6 A;  1JWW A;  1DAR A;  2CQC A;  1WKL A;  3FVY A;  4EGL A;  4OJ3 A;  3PW2 A;  4ED3 A;  2D9O A;  1FKA F;  4ERD A;  1VRT A;  1RTJ A;  4FBT A;  4PWU A;  4B3T J;  3AA8 A;  1KON A;  3I32 A;  2XB2 D;  1I1G A;  1NJZ A;  4MFB B;  4EWT A;  4RPF A;  3ZZZ A;  5CA5 A;  5B0G A;  2BRK A;  1X0F A;  1MRO B;  2X1F A;  3HM9 A;  2P6T A;  4NA1 A;  3BH7 B;  2R7X A;  3QRR A;  2N7Y A;  4PCQ A;  2ABY A;  4P75 A;  4RL1 A;  2J7W A;  3EZU A;  1X5O A;  3S01 A;  1FER A;  4U96 A;  4EFA C;  3Q8Q B;  2G4B A;  1YRU A;  4GKK J;  1EQM A;  3GCW P;  4NZ0 A;  3VHQ A;  1G3O A;  3CJK A;  3KLV A;  2CVI A;  3MPU B;  2D41 A;  3D68 A;  4K50 A;  4B9L A;  2ROG A;  1R43 A;  2IM1 A;  1CVJ A;  1R8C A;  2V69 A;  4DX6 A;  4LF9 J;  2RAQ A;  3FBE A;  2CQ3 A;  4F3M A;  4IFY A;  2PA3 A;  4IH5 A;  5CQG A;  3HD2 A;  1D3W A;  3SYZ A;  2UUC J;  3CMA S;  1KR4 A;  1X0P A;  5K8P A;  1WG1 A;  2FJA B;  5J2N A;  2WSF C;  2LXF A;  3IWX A;  5I3U A;  1V3R A;  2HFS A;  1LEO A;  5ETV A;  1CSJ A;  1HW8 A;  1I3O B;  4KH0 B;  4B3O B;  3ZFV A;  1MWQ A;  3J80 U;  2W2N P;  1I94 J;  2VIC A;  3ADA C;  2I8E A;  2UVV A;  2V4J B;  5GAE I;  1FWL A;  1PO6 A;  1LWC A;  5KFC A;  2LEC A;  4XK8 C;  4DFJ A;  1GXT A;  1EZZ B;  4QYR A;  3BBC A;  3E01 A;  1NEE A;  4ANC A;  2OIH A;  3GB0 A;  4OHV A;  4C8O A;  4IDK A;  5L1I A;  4EYH B;  1IBK J;  2XY7 A;  2OJ3 A;  2ZHA A;  3JS9 A;  2FJB B;  1UW9 A;  2X1B A;  2QLW A;  5F0W A;  2FDN A;  2F4V J;  4F26 A;  2YNG A;  3IFE A;  4QBU A;  4ZLN A;  1VOM A;  4QIW D;  1URN A;  1XR6 A;  4H4K A;  4LIW A;  1LFW A;  3PJ9 A;  2RRB A;  4CT9 A;  2XSJ A;  1VJQ A;  4ZKA A;  2OPS A;  3KJN B;  5D77 A;  4PR6 A;  3CIZ A;  1JXL A;  3W9H A;  4USH A;  2R2R A;  3D54 A;  3N01 A;  2ZUG A;  1Y3K A;  3VGS A;  1RIS A;  2U2F A;  2L9N A;  3ISZ A;  3BBB A;  4IOB A;  4IH6 A;  5C24 B;  3VAL A;  1RCX B;  2DH7 A;  3AOC A;  3RBZ A;  3Q8U A;  3RBD A;  5FII A;  3KMQ A;  4A47 A;  1HYS A;  3IXQ A;  3QLH B;  3CC4 S;  2HVZ A;  1YRT A;  1JJH A;  4NLQ A;  2G2O A;  2C3U A;  3MAA A;  1YJR A;  2PEB A;  2MZ1 A;  3V6K A;  3H40 A;  1OJ4 A;  3P45 B;  3N4W A;  2YKP A;  1LW0 A;  2VU5 A;  3KLF B;  1PYS B;  2VFS A;  3GIM A;  3BM7 A;  2ZD1 B;  1X5S A;  4WFY A;  1J5E J;  5J2Q B;  3DMJ B;  5E0O A;  2CUY A;  1PG5 B;  3D0G E;  3QWP A;  3V81 A;  1UEU A;  2W24 A;  5ADZ A;  1SL2 A;  1OPZ A;  4DI6 A;  4C8Z A;  1AB8 A;  3GIK A;  4ES2 A;  4DSI A;  3FEX B;  2XI2 A;  1D9A A;  4MK9 A;  1FA0 A;  4H4O B;  4CLW A;  1WC0 A;  3VAF A;  4ZDN A;  2UV8 A;  4DR3 J;  4DDF A;  2MQN A;  2NXU A;  3ISN D;  1FO1 A;  2YKM B;  3K2Y A;  5HMX A;  1K0T A;  3BQ1 A;  2R7T A;  2W2O P;  3PRB A;  4A46 A;  5L9N A;  2D3O 1;  1HNW F;  3G6Y A;  1RT6 A;  4X4R A;  3VWS A;  1QAY A;  3CIM A;  2MPU A;  2Z57 B;  3FCH A;  4AUK A;  4NI2 A;  3N6M A;  3J81 Y;  3OJU A;  3MD3 A;  4GC7 A;  2Q3P A;  1SJ4 P;  1PAU B;  3DLL Q;  4YDD B;  5L9X A;  4PQA A;  5F8L A;  2W9C B;  4OMF G;  2VQE J;  3MAQ A;  1Q86 T;  1LK7 A;  1FD8 A;  2GJ2 A;  1RHM B;  3JTO A;  4O0I A;  2DNN A;  3MEE A;  2GGP A;  3UI3 A;  3QGP A;  1YBA A;  4FVM A;  4FS2 A;  4DL6 A;  1U47 A;  2Z0G A;  1TL4 A;  3MCM A;  1IJE B;  2BW7 A;  4W90 B;  3OTD A;  1WOS A;  2WB4 A;  1N5Y A;  2L9D A;  1HBM A;  2MHN A;  1SV5 B;  3I6P A;  4CI0 B;  3OR2 A;  1T0T V;  2BJD A;  5L38 A;  2WVF A;  2EK1 A;  3UN3 A;  4F3O A;  5JXS A;  4J9K A;  3PEJ A;  2W8L A;  1VHI A;  3P8B B;  5CYJ A;  3PG9 A;  1ZPW X;  4NEZ A;  3FJ2 A;  3JSM A;  1DJ0 A;  4L3N A;  5ITH A;  4DJB A;  2GMH A;  2QG9 B;  4CO3 A;  5IZH A;  4CNY A;  2R2S A;  2EK6 A;  3QZ7 A;  3H2U B;  3QAU A;  1N34 F;  3TZY A;  2VA2 A;  3SXL A;  2YVS A;  2AHO B;  2MZQ A;  3GYX B;  3NGK A;  4I6Y A;  3EIC A;  5DGA A;  2ZOG A;  3Q8V A;  1IKV B;  4AT1 B;  1VK3 A;  4KC5 A;  3IO1 A;  2HIQ A;  3HXM A;  2LA6 A;  5D78 A;  3DXB A;  1KQK A;  2XO6 A;  4P2X A;  2KRB A;  3P6Y C;  2A2D A;  3MM8 B;  4ZPV R;  1RBA A;  2KM8 C;  2WTF A;  3CF5 Q;  2MZJ A;  4PPZ A;  4WFA Q;  2IRU A;  3MTK A;  2M7S A;  3R7S B;  1O6X A;  4JI7 J;  1XC9 A;  3R1L A;  2IM0 A;  4B9V A;  4RUC A;  4DPU A;  3VZH A;  3R3T A;  4BLG A;  4D3H A;  4NXM F;  3NY0 A;  1IBL J;  3IAM 9;  2XMM A;  2E9R X;  2VOP A;  3J7Z T;  3ENW A;  1M5H A;  3PFO A;  3RB6 A;  5KFM A;  1WF0 A;  1JLG B;  1DUR A;  4C0H A;  4WXW A;  5E41 A;  1RKJ A;  4OX6 A;  4PKD B;  3MCN A;  1DTQ B;  2BOA A;  2MXY A;  1S0N A;  2R7V A;  4OYO A;  2ZNZ A;  3KTQ A;  3NCQ A;  4M5D B;  1TUG B;  5DQI A;  1Z2L A;  1TL7 A;  4DQR A;  3TQ1 A;  1IM4 A;  3MMJ A;  2ASD A;  2BXJ A;  4KE5 A;  4ILM A;  5AE1 A;  2OH2 A;  2CJA A;  1TFW A;  3R5A A;  2YNF B;  4P7T A;  5J1E B;  4EMD A;  5EUH A;  1XTZ A;  2QA1 A;  3OXF A;  3BRE A;  2B6A A;  1QVG R;  1PJ7 A;  1CEZ A;  2RHQ B;  3OUY A;  4FDF A;  4F4X A;  1SUQ B;  1LWE A;  2DR8 A;  4ZLL A;  2O1P A;  4HAC A;  3AB2 B;  2VJV A;  2ZWO A;  4WKY A;  4ED5 A;  3CCJ S;  2CWK A;  3HHL D;  1VYA A;  3RB4 A;  1Q81 T;  5CH7 B;  5HQL A;  1TKX B;  4KRW A;  1HD0 A;  2UU9 F;  4X4P A;  4DQP A;  3CMQ A;  1RTH B;  3UPF A;  4K4V A;  5H9E K;  3R97 A;  3R6G B;  3SV4 A;  2HBR B;  3HMJ G;  3L95 X;  3FEZ A;  3J7Z 5;  4A48 A;  1JLQ A;  4ICL A;  1R0C B;  3CDB A;  4LF8 J;  5ETQ A;  1L3S A;  1RBO B;  3M2U B;  3A12 A;  4RW4 B;  4CLP A;  3I5A A;  3AY0 A;  4ED8 A;  3KXD A;  2J9E A;  2ZOF A;  1X9M A;  5DDO C;  3VCD A;  2YNI A;  4BDP A;  5F8J A;  3W62 A;  3DLG A;  5HBM B;  3SSR A;  3M8Z A;  2ZJR Q;  5KG3 A;  1SQE A;  4IQX A;  2Z2Y B;  1KFD A;  1RYR A;  2A2C A;  4NLU A;  2DR5 A;  3BKT A;  4ZPT R;  3I4P A;  2GNK A;  3GII A;  3B4D A;  1JJ2 R;  3O3L A;  5CCM A;  3ILJ A;  4DR7 F;  2IDL A;  1PYO B;  5KFT A;  3MEG A;  2V2Q A;  5L1L A;  2YWF A;  3OBI A;  1T9T A;  4XPC A;  4ZVT B;  2V2Z A;  4IR9 A;  4LSL B;  2FVS A;  2X51 A;  4QW9 A;  4EK2 A;  1KHV A;  3OTO F;  1AZS B;  5DG7 A;  2KG1 A;  1HQE B;  5JVG Q;  1T95 A;  4UQG A;  4NL5 A;  4DX7 A;  2VG7 A;  3IN5 A;  2IFX A;  3BGR B;  2V8P A;  3UW1 A;  1MN9 A;  2DKO B;  5L1K A;  4DR2 J;  2CRL A;  2OPR A;  2F63 A;  2YQ1 A;  3ZNU A;  1Q4R A;  3CUN A;  1NK5 A;  3JYT B;  3UD4 P;  2DY9 A;  1JXV A;  3HUL A;  2ZH1 A;  4A8W A;  3BN7 A;  5CYQ A;  5HVH A;  2RHS B;  3AA9 A;  1GMV A;  5AE3 A;  2HQD A;  4HT7 A;  1XMO F;  5KFZ A;  2IYG A;  1TKT B;  3G82 A;  1X31 C;  3HJV A;  1IKY B;  4KQZ A;  2GW8 A;  3L7O A;  4OZL A;  1WG4 A;  1X4A A;  4Y2I A;  1VQ7 S;  1UWB B;  2W4P A;  2FLP A;  3BSA A;  4EYI B;  5IC6 B;  3O6Q A;  4OYW A;  3P5T L;  4YFU A;  3GJS B;  4M5L A;  2AX0 A;  3R6L B;  2ZM6 F;  1Y4Z B;  1RAB B;  1VMB A;  4HLB A;  1FTR A;  3OFE A;  3IG1 B;  2OEM A;  4RKU C;  5A6W A;  3C16 A;  4ZVH A;  3R2D J;  4ID5 B;  2XLI A;  3H0P A;  4ZHR B;  1S7I A;  1RWW B;  3TP2 A;  2BE7 D;  3R5G A;  2HZA A;  2EFP A;  5EX0 A;  4K5R A;  2NRE A;  3BEG B;  2MJU A;  4M63 A;  1DZ5 A;  1XMQ J;  1NM2 A;  3CD0 A;  2MKC A;  2KB2 A;  3MM7 B;  3T5J A;  1S9G A;  2HWT A;  2P8I A;  4F2S A;  2R7S A;  4NRT A;  1R89 A;  2JVR A;  1TV6 A;  4TY9 A;  1Q0N A;  2KFN A;  2HK3 A;  2RIJ A;  2CJQ A;  4CTA A;  3M05 A;  3T41 A;  4DSE A;  1PBA A;  3LP1 A;  2QN6 B;  1EP4 B;  2A10 A;  1TK0 A;  5B0D A;  2DRB A;  1AXQ A;  3K89 A;  2DR7 A;  3VAI A;  1VHF A;  1MSW D;  3PEH A;  3VQS A;  1KLN A;  1R7I A;  3DLB A;  3CDW A;  4K7Q A;  4QCL A;  3OJS A;  3MOZ A;  1MMD A;  1D8Y A;  1NPP A;  4FXV A;  3TEG A;  5KFV A;  1YVF A;  1QAJ A;  1RHJ B;  4UTG A;  4RBT A;  4WKR A;  2C2M B;  1A0O B;  3D6F B;  2CVE A;  3RAM A;  4M8L A;  2HHH J;  1VQO S;  4IG0 A;  4DCP B;  3K58 A;  4PEO A;  4X4U A;  4KGX B;  2HQ3 A;  3CJK B;  4X4T A;  1H0H B;  4U95 A;  2A6O A;  1RTZ A;  1NDK A;  5KFU A;  4TY8 B;  1WC3 A;  1NKE A;  5F8G A;  3ITH A;  3C66 A;  2OLW A;  3TJ8 A;  2PII A;  2B8P A;  4RW9 A;  3KK1 B;  3D9B A;  2HNZ A;  3RRG A;  2LQ9 A;  2QE5 A;  4IFY B;  4OZ2 A;  1YZ7 A;  4B9M A;  3PFE A;  4NLP A;  2J6T A;  3QPI A;  1VQ8 S;  4LF7 F;  3PW4 A;  5J2N B;  1E6V A;  1RWN B;  2CPD A;  2UXD F;  3CVK A;  3T19 A;  4RLE A;  4HH1 A;  4WK1 A;  4O4R A;  2VKZ G;  2DBB A;  2HBY B;  1NH7 A;  3A3P B;  3BYR A;  3P96 A;  2QV6 A;  1QM9 A;  5BYQ A;  1LWC B;  2JJ4 D;  7AT1 B;  5D0E A;  4N77 A;  3H42 A;  2H3E B;  5D3G A;  3FZ2 A;  4KHP J;  3UCU P;  2IDE A;  4LF5 F;  4WZQ A;  1CJT B;  1BLU A;  4YB7 A;  1S6P A;  5D4O A;  1U2C A;  2R7Q A;  5BR8 J;  3SSQ A;  4X4O A;  3SDE A;  2QYG A;  3GFH A;  1FJ7 A;  1IQZ A;  2Q66 A;  4P9S A;  3OLB A;  2QL9 B;  3LGH A;  4Z7Y A;  4ZK7 M;  3WIV A;  1XK8 A;  2XMK A;  5A8W A;  4WE1 A;  2XY6 A;  4B3S F;  2R8G A;  3W2W A;  2HIY A;  4MT1 A;  3DI6 B;  1C2P A;  1R0B G;  3HCX A;  2VC1 A;  4R8U B;  1QLN A;  2FB0 A;  2OPS B;  4FNH A;  1T11 A;  4QWD A;  1KVI A;  2F7V A;  4OJH A;  3JQM A;  2IC3 B;  1S99 A;  1IR1 A;  1K1Q A;  2QA4 G;  2V4R A;  1RA7 A;  1DLO A;  5IWA J;  4DPW A;  3MHY A;  1UPP A;  3DXS X;  1RAH B;  3MUM P;  1WOP A;  3F44 A;  2FC9 A;  2EG1 A;  1RI7 A;  4MH8 A;  2FVQ A;  1HQU B;  2J7K A;  2CXE A;  3IBW A;  3NMR A;  4ID8 A;  2LXU A;  1FI4 A;  3KG4 A;  4JYA F;  2Y1I A;  5H1S V;  1N8R T;  4HT5 A;  1O5J A;  1X4E A;  3CXC R;  3GLJ A;  3MAA B;  1AFI A;  1XEZ A;  4BC9 A;  2W7O A;  2AEM A;  3C14 B;  1EQ0 A;  3CJ5 A;  4A8S A;  3C3L A;  2AJ2 A;  2FJV A;  1FEH A;  2QEX S;  3MUV P;  1C0U A;  4ELV A;  2YPZ A;  1NLK L;  3M1V A;  2COL A;  3T6B A;  3QAE A;  4LQ3 A;  1SH2 A;  3UVJ A;  1XNQ J;  2KL8 A;  1NAQ A;  4A8K A;  3CD7 A;  4CYU A;  1IKW A;  1VQM S;  4AL5 A;  3I9Z A;  4IOC Q;  1BHN A;  2HND A;  3V81 B;  3D66 A;  1TL5 A;  1T9V A;  3AOD A;  1A7G E;  1RT1 A;  4C2M A;  2KO1 A;  1L3U A;  4KTQ A;  3B82 A;  2EFN A;  3A8E A;  1QJH A;  2DCU B;  3WIU A;  1U8W A;  4N47 A;  3C19 A;  2FPH X;  1PJ5 A;  5KG7 A;  4LRA A;  1QSY A;  4I4B A;  3A8K A;  4ZCK A;  2H9Z A;  2OSQ A;  1FE0 A;  4HTI A;  3DDN A;  4ZJQ A;  1KSP A;  1NKC A;  3K5N A;  3RBE A;  3PRD A;  3HHE A;  5BXI A;  1RT6 B;  2I2Y A;  4FYV B;  4YR3 A;  5BJR A;  1U8S A;  4NI2 B;  5AJ3 J;  3L09 A;  3W65 A;  3C6T B;  4CH7 A;  4G65 A;  2W9B A;  2AGQ A;  4DV6 F;  2CKW A;  3ILI A;  3BDP A;  1KOH A;  4Q43 A;  3NAH A;  3DRR B;  2OTJ S;  2V8H A;  1CJV A;  2I5J A;  4KFB A;  4CM2 A;  4C8Y A;  1S1T A;  3MEE B;  4F67 A;  1LFP A;  1UW4 A;  1NSK L;  3GR0 A;  3KLG B;  1Y5I B;  3OFG A;  3U02 A;  1PKU A;  1W25 A;  1BC6 A;  2CJ9 A;  4IOA Q;  2NR0 A;  1KVJ A;  4ZN1 A;  1WI6 A;  4H54 A;  3RRK A;  1FRL A;  3TNV A;  2CJK A;  4MYU A;  2QO3 A;  1UZD A;  5IM0 A;  1FRM A;  1VFJ A;  2KG0 A;  2XEX A;  3QQC D;  3A1Y G;  4LRC A;  2UUT A;  1Q1K A;  2G2Z A;  1N36 F;  2IRY A;  1HI8 A;  2XTJ P;  4Y0F A;  5I3Q A;  2B43 A;  3FQK A;  3JSM B;  2CFX A;  3N79 A;  1OYD A;  3CE8 A;  3AB4 B;  3BBF A;  3UWT A;  2V8D A;  1G6B A;  1TL3 B;  3SI8 A;  2IY5 B;  4DUZ J;  4X66 F;  3V6D A;  4B9S A;  2UZA A;  2RF2 A;  1SQF A;  3CW2 C;  3C46 A;  4TNO A;  1HNZ F;  2DH9 A;  2V2K A;  3KJF B;  1NH8 A;  3PIP Q;  3GQC A;  2IVY A;  2M0G B;  3DGV A;  2ZH4 A;  2ZIT A;  2BE2 A;  5U47 A;  1HIY A;  4OYB A;  4A4J A;  3CJQ A;  4WP9 A;  3UDV A;  2ROE A;  2KH9 A;  1SI9 A;  3CUL A;  1FJC A;  1XR7 A;  4BCA A;  1GAO A;  4QPX A;  3KLH B;  3TWZ A;  1EET A;  4DFM A;  4EZ9 A;  2G9O A;  3LF0 A;  1VDH A;  2KYX A;  5DRK A;  1S1V A;  2B4O A;  3J7A 1;  3KHR A;  2YBV A;  2B9E A;  3T6J A;  2GA7 A;  1T3O A;  3BB5 A;  1ZOT A;  4MKB A;  2FHJ D;  3RYL A;  1GXU A;  4LFC F;  1XR5 A;  4DL5 A;  1IR2 A;  5K5M A;  1MW7 A;  2B8Q A;  4DV5 F;  4Q8E A;  2H48 B;  2XMT A;  4DV7 J;  4RW7 A;  2B9W A;  2R8H A;  2QRR A;  2XWY A;  3D0H E;  3VV2 B;  1NBE B;  1G2E A;  1SB6 A;  4B3R J;  2UP1 A;  4X64 J;  5J2M A;  1TTH B;  4C4W A;  3GG1 A;  4PG8 A;  3KYL A;  3TAR A;  1F1B B;  2DHX A;  1ZS6 A;  4J9P A;  4QIF A;  4PUO B;  1RDR A;  4TYB A;  3THV A;  4J5O A;  4HI2 A;  5D6G A;  2JEI A;  2HFO A;  4XAK A;  2W01 A;  2UV8 G;  5CCL A;  4Y34 A;  2C2K B;  3I31 A;  2B6A B;  2BE9 B;  3HT0 A;  1WD6 A;  2KYZ A;  1WC4 A;  3R1H A;  4GKJ F;  4DSK A;  3W64 A;  1Y5N B;  3U7J A;  5FD1 A;  1FES A;  5FLX Y;  3CNQ P;  4LRF A;  3HLU A;  2GC8 A;  2MQQ A;  1S79 A;  2M4M A;  1P6T A;  1OY6 A;  2I6W A;  1S57 A;  2HHX A;  1KD1 T;  4KJI A;  1FT8 A;  4OX9 F;  3J81 j;  4WFB Q;  3M2R A;  1SJQ A;  4KHR A;  5D15 A;  3N5F A;  1FFG B;  1NK7 A;  1NDL A;  1Q5V A;  3M8Q A;  2ILZ A;  3ZZT A;  3PIO Q;  3NS5 A;  2Y8Y A;  3ZO7 A;  2CG4 A;  2FLL A;  1YSJ A;  1X9W A;  1FE4 A;  1F5B A;  3Q86 A;  1NU4 A;  1JLQ B;  2DCL A;  2DY1 A;  3DLE A;  3GZ7 A;  4NCG A;  2BKP A;  2DGU A;  3GSD A;  2HG4 A;  5EX3 A;  3G8S A;  3R5C A;  2WOM B;  4L74 A;  4JI5 F;  1IVZ A;  4LT6 A;  4RZR A;  2IAJ A;  4IR1 A;  2YNI B;  2HAF A;  3M8Y A;  3DLG B;  2ZC4 A;  3PHT A;  1ZM3 A;  4ZVQ B;  3PXG a;  3ZZO A;  3TYT A;  1NUE A;  1YJW S;  1MRO A;  4DSJ A;  1P27 B;  4I0W A;  1PC4 A;  3IGN A;  5HQM A;  1RU1 A;  3ENA A;  3DHW C;  1KFS A;  2HEK A;  2UXC F;  2XUL A;  1FXD A;  5CD4 A;  2DRD A;  2UVW A;  2E1P A;  1FNO A;  4K4X A;  1RT4 A;  2WRM A;  2M52 A;  3MEG B;  4LMZ A;  4CH1 A;  4FYD A;  5KT6 A;  3D6M B;  4NLD A;  4O3S A;  4ECW A;  3J81 U;  5E33 A;  3UDE A;  3LTO A;  4J9S A;  1IXK A;  1B7F A;  3THT A;  2WAQ D;  2VDI A;  4JI4 J;  4UOG A;  2GHV C;  2MYF A;  1TVR A;  2IJF A;  4W4M A;  2VG7 B;  2MKS A;  2AKW B;  4K4Z A;  3DRS A;  1L3V A;  3GU0 A;  4PYA A;  4X62 F;  3DM2 B;  3NNH A;  5D4L A;  2RUG A;  4FPR A;  7FDR A;  2OPR B;  3TX0 A;  2JC1 A;  1UA0 A;  1HI0 P;  3W9J A;  1NPR A;  3G96 A;  2ADC A;  2I0X A;  1FJE B;  2YNH B;  2IIH A;  4ZIW A;  1U1P A;  4OYP A;  3NBP A;  4ALZ A;  5L1J A;  1Q5Y A;  1B99 A;  2AX1 A;  3S6E A;  3Q24 A;  3G82 B;  3DOM B;  2LLZ A;  1ZYQ A;  1AT1 B;  4PYD A;  1WTF A;  4HR2 A;  2FJW A;  4ELT A;  3RG6 A;  1NSQ A;  3M6U A;  4JP8 A;  4ILR A;  3GIJ A;  3EM1 A;  2AMC B;  3VVT A;  1F5C A;  5KAK A;  4ED7 A;  2ZDP A;  4J9U E;  4DPO A;  4NZ7 A;  3O8W A;  1FJG F;  3MED A;  1WAC A;  1FTC A;  3UDL A;  4YQW A;  4AL7 A;  3C16 B;  2EFV A;  4DZ6 A;  3U1L A;  5E3A A;  1VCT A;  5EWF A;  4ZPB A;  2D9P A;  2F3J A;  4DR1 J;  4J91 A;  3MF5 A;  2ZVS A;  5KTQ A;  1TK5 A;  3R5J B;  3QT6 A;  4ZJO A;  5KFQ A;  1YBT A;  2XG8 A;  4AXJ A;  3NL0 A;  2J0W A;  1NK9 A;  1N32 F;  3W5X A;  3T9N A;  3TO8 A;  2DIS A;  3QRQ A;  2KKH A;  1TV6 B;  3QGH A;  2WHO A;  1AFJ A;  1TMJ A;  1O51 A;  3Q2S C;  3MMB A;  4CTA B;  2QFJ A;  4CP5 A;  1U2F A;  3AT1 B;  2CQH A;  2DNZ A;  4E0D A;  4P10 A;  2B9X A;  4YB6 A;  3UD3 P;  1U0H B;  1YJT A;  1CQN A;  5LSR A;  2DIU A;  3CD6 S;  3WQP A;  3VGV A;  2VBX A;  4ANE A;  4I2Q B;  1VQ6 S;  2HPU A;  1U6Z A;  3CCW A;  2HVH A;  3BSN A;  1D8Z A;  3M6V A;  1JLB A;  2OEL A;  2HLU A;  3ZZU A;  5LT5 A;  4ER8 A;  1DRZ A;  3PKM A;  4ZVE A;  5J2Q A;  2XHW A;  2NS1 B;  1A9N B;  4F4W A;  2WSC C;  3HHL B;  1YQH A;  2FY8 A;  1HW9 A;  4ZOS A;  1HR0 J;  4MKA A;  3T1Y J;  4KGZ B;  4IG0 B;  4L72 B;  4N5S A;  5A0Y B;  1ZPV A;  1M5O C;  2V63 A;  2D3Z A;  1S6U A;  2GVZ A;  4WII A;  5IT0 A;  3KKF A;  2NQP A;  2BJ3 A;  1XNR J;  4WU2 A;  1MU2 B;  2BAN B;  1N4L A;  3IMQ J;  4XDD A;  4H4O A;  5EWE A;  2QA2 A;  2XBP A;  4JV5 J;  4RW9 B;  2DR9 A;  3ZZ0 A;  4OHY A;  2HNZ B;  2B4P A;  1BXN A;  4BC7 A;  3Q2T C;  5E3C A;  2AYG A;  3A8J A;  4OYI A;  3EGN A;  1JX4 A;  4LF4 F;  2GQC A;  4JI1 J;  3BSO A;  3WDO A;  2B7B B;  1T03 A;  2EFG A;  5F41 A;  3RU0 A;  2XNQ A;  2MKH A;  1S9E A;  3KNG A;  1YIJ S;  1YGY A;  1U1Q A;  1CC7 A;  4WP3 A;  1CPZ A;  5J2P A;  1VIS A;  2AT1 B;  4IH7 A;  4M5K A;  3DC2 A;  1S0V A;  1UL3 A;  4C6A A;  1NSA A;  4O4G B;  3I82 A;  2KRR A;  1S6P B;  1Y00 A;  4M95 A;  5HP1 B;  3DLK A;  3SDE B;  2Z2L A;  4USW A;  4QU7 A;  4QOT A;  2H1Y A;  5KG4 A;  2GCF A;  3BPD A;  2UXB F;  1U1M A;  3K8W A;  4GVL A;  4WE1 B;  5HL7 Q;  2HBQ B;  2XI3 A;  3W2W B;  3TW0 A;  3SSS A;  1SV5 A;  4J9M A;  1NPK A;  2LP4 A;  5IS2 A;  5HI7 A;  4B9U A;  3HF5 A;  5KFX A;  1YRX A;  2LU2 A;  1XBW A;  1ZAV A;  4K0K F;  4DCJ B;  1ZET A;  4OHX A;  2OPP A;  1ACM B;  3NG8 A;  4CLS A;  1DLO B;  2YWE A;  1IJF B;  3CCQ S;  4FF4 A;  1Q8I A;  3MWB A;  3DLH A;  4OZ3 A;  3VZI A;  2DRA A;  2KXF A;  1GX5 A;  3MUR P;  4ELU A;  4X84 A;  4KPC A;  3W7B A;  4O44 B;  2HUR A;  1DTT B;  3M8W A;  2JHE A;  1X4F A;  2I9S A;  3TUP A;  1Q79 A;  4DN9 A;  4QW8 A;  1CUL B;  3MM8 A;  4DX5 A;  1U24 A;  3W3S A;  2ZHO A;  1U7L A;  3M1V B;  2OAU A;  4Q8F A;  4KY3 A;  1KDN A;  4S0M A;  3UVJ B;  5C42 A;  1EHW A;  4CYU B;  1IKW B;  4WYL A;  3BR9 A;  4Q2M A;  1GQE A;  2VPX B;  4OHZ A;  1HNV A;  3TUJ C;  4LBP A;  4LFA J;  4LRB A;  2RNE A;  2GS8 A;  1WDD A;  2V67 A;  2VHG A;  3UR3 C;  1UJ4 A;  4UW2 A;  3TAM B;  5KFP A;  4DV2 F;  1YHQ S;  1HMV B;  2AJ0 A;  2O5D A;  3R27 A;  1BQM B;  3RJM B;  5F8N A;  2VFV A;  1NZA A;  1WF1 A;  3B6B A;  2F8E X;  3CJT A;  2O66 A;  2JL9 A;  1KN6 A;  3BO2 A;  2GV1 A;  3QGG A;  3M9N B;  2A3J A;  2ZBP A;  4NOH A;  4IO9 Q;  2XGQ A;  3JAM Y;  2C22 A;  1HLW A;  2BX6 A;  4URS A;  2VPY B;  2M3D A;  2R4F A;  2ZBC A;  3KUE A;  2YY3 A;  2ZH8 A;  1LWF A;  1IQT A;  1CBK A;  4UF4 A;  2PT0 A;  1M5P C;  2W9B B;  3ET6 B;  2CPH A;  2R9L A;  3M4X A;  3IBF B;  4LF6 F;  2ZKT A;  5LM7 E;  1M1H A;  4X4Q A;  4F4A A;  4N7T A;  4RNM A;  5LSO A;  1VQP S;  4IYQ A;  2E1A A;  1SH0 A;  2U1A A;  3MMA B;  2MLX A;  1E6Y A;  1HHT P;  2F9D A;  4O3P A;  4EBD A;  3N6N A;  3LWL A;  2XWX A;  2LU1 A;  1EIY B;  1Q7Y T;  2CAJ A;  4CH0 S;  4K2J A;  1PYT A;  3DRP A;  4ZJL A;  2CJB A;  2QSW A;  3GP9 A;  3CO0 P;  1IKX B;  4AQY J;  3F56 A;  1GFW B;  1S77 D;  3UFC X;  5B0B A;  1T9Y A;  2J5A A;  2VKR A;  3M2U A;  4USI A;  2VBZ A;  4RO0 A;  1SL0 A;  4X4V A;  3KHH A;  4WP8 A;  2XC9 A;  4L76 A;  4PG4 A;  4RR5 A;  1S4E A;  1SC1 B;  5ETO A;  2J0S D;  3NXZ A;  5T41 A;  5HBM A;  4ZLJ A;  3PCO B;  2RF2 B;  3M32 B;  3H98 A;  1TAQ A;  3K57 A;  3TQE A;  1F60 B;  2UUB F;  4JI6 J;  4ZPA A;  3K8V A;  3CCS S;  2HS0 A;  3DKD A;  2L08 A;  2BE2 B;  1HHS A;  1UJ5 A;  2QX0 A;  4OQJ A;  5DM6 Q;  1D1U A;  4UY8 5;  4OJ1 A;  1VLO A;  4O3N A;  1R8A A;  1HPZ B;  3HO1 A;  2W4C A;  4ECU A;  2ZBI A;  4Y6I A;  5HLF A;  3GG0 A;  4A8F A;  4LSZ B;  1RP5 A;  2CWX A;  1EET B;  4I1T A;  6FD1 A;  4ZPC A;  1M1G A;  2WW8 A;  1U09 A;  4QQB A;  2CZ4 A;  1GMW A;  4C3L A;  3K59 A;  1S1V B;  1YTY A;  4OZN A;  3GMG A;  1HNI A;  4K4W A;  2GMJ A;  4G1Q B;  2HLT A;  5MAO A;  5G0R A;  2E5L F;  1RYS A;  1AZS A;  1HQE A;  2MST A;  1N33 F;  4K59 A;  3ZZY A;  3EPI A;  4QYZ K;  3DLJ A;  4DV4 F;  5DET A;  3DNC A;  3D67 A;  3BGR A;  1C4C A;  2AJ1 A;  2HHQ A;  2AEJ A;  4F0K A;  5IOL A;  2YPY A;  2EI5 A;  2L9W A;  3PM9 A;  2Y1J A;  2IBK A;  1H73 A;  3JYT A;  1QAI A;  3CJ2 A;  3HD1 A;  1KQG B;  5LMU F;  2BYC A;  4FVC A;  3LUY A;  2VPW B;  4FF3 A;  3NS7 B;  2MLZ A;  5EDW A;  2G1D A;  4X4S A;  4PG7 A;  4DL0 C;  1ELO A;  3MR3 A;  4ECV A;  1XIQ A;  3F0N A;  2ZBR A;  2DVI A;  4KKO A;  1DAX A;  1GTE A;  1IKY A;  3KHG A;  5J1N A;  1R6Y A;  4B3T F;  1LOU A;  4CLT A;  3OL6 A;  2D74 B;  3CCZ A;  3OHA A;  5CZX A;  4OHW A;  4IRD A;  1TAU A;  3FEY B;  2VOO A;  1UVJ A;  4QR0 A;  4DR6 J;  3CO9 A;  2HVI A;  3TJ9 A;  2Q79 A;  4YR0 A;  5B08 A;  3VR1 A;  3M2R B;  4CLK A;  8RUC A;  2X3D A;  5A2Q Y;  2ZC3 A;  1ZH5 A;  2HKE A;  3M8Q B;  5LOQ A;  4GKK F;  1N48 A;  2CQ0 A;  2C3P A;  2I38 A;  3AJ2 A;  2F1F A;  2K7K A;  3R9L A;  4PRF A;  4KBI A;  3QID A;  1NHU A;  4EU0 A;  2FVP A;  4DX8 H;  1WSV A;  3M7V A;  1OS5 A;  1T05 A;  3DLE B;  4NCG B;  1RT2 A;  3GV8 B;  2AV5 A;  4LF9 F;  1APS A;  1FKO B;  4HVZ A;  2IBO A;  1QD1 A;  1U1R A;  4PXE A;  2JEF A;  3AXM A;  2YX7 A;  3EYZ A;  5GAH U;  2GIR A;  2UUC F;  2IAJ B;  2DGW A;  3TA2 A;  2DPJ A;  1EP4 A;  2HAI A;  2FHM A;  4DQI A;  4M5G A;  1S59 A;  3QSI A;  1I94 F;  2JRS A;  2CZV C;  1HBO A;  2G13 A;  3IWL A;  4ZA1 A;  4UZC A;  1RAI B;  1NK8 A;  1PC5 A;  3D6T B;  1RT4 B;  3AXK A;  4F50 A;  3ZTP A;  3K7R A;  3BQ2 A;  1KKH A;  3QJL A;  1VQ9 S;  1F5A A;  1M1K T;  2YWW A;  4DL2 A;  2HHU A;  3O2I A;  5F0U A;  4ZCI A;  1I5O B;  2HVE A;  1IBK F;  4TY8 A;  4P73 A;  3OR1 A;  2KVI A;  2Z58 B;  1YX2 A;  1JK9 B;  3KK1 A;  2J9D A;  2W2Q P;  2F4V F;  3CJ4 A;  3TZX A;  1B3T A;  2DNL A;  3KJQ B;  4YUD A;  5F8I A;  5B0A A;  4U7U D;  1TVR B;  1PSD A;  3BGL A;  4EEY A;  4O3Q A;  1VQN S;  3IR5 B;  2ZJQ Q;  4I67 A;  2BEF A;  5DDP C;  3D4J A;  3MOJ B;  3DRS B;  2HQC A;  1U49 A;  3BZQ A;  2J8S A;  2VQF J;  5BYR A;  4EBC A;  2MGZ B;  4C3K A;  2Y8W A;  1L5U A;  2I1R A;  1VBK A;  3BF4 A;  1T3N A;  1BY9 A;  1SKS A;  3QRP A;  4V19 X;  3NBP B;  4K4U A;  2P9C A;  3PW0 A;  1T7P A;  5AXL A;  3PYG A;  3EVO A;  1CJT A;  2MKK A;  3DU6 A;  1WJ9 A;  3GWC A;  1FD2 A;  4DUY J;  3MZI A;  3NAI A;  4CQ1 A;  3OV7 A;  1F2H A;  2AD9 A;  4QWC A;  1FNX H;  3W9I A;  2DGT A;  3TR5 A;  4Q44 A;  2XZW A;  3TOQ A;  3P5B P;  1FWK A;  5GAD U;  2DNM A;  3R5B A;  1RT5 A;  1WG5 A;  1Z1Z A;  3MED B;  3UQS A;  2ZWP A;  1WOO A;  4X65 J;  3KG0 A;  4ZP6 A;  1I51 B;  3DI6 A;  1WKJ A;  1J5E F;  1HNX J;  4OZJ A;  5GVQ A;  3NNC A;  1R0A B;  1N5V A;  1VIX A;  4FBU A;  4R8U A;  3PJX A;  1EB0 A;  2FHO B;  3E8O A;  1B64 A;  2FHK A;  2GO8 A;  1K44 A;  2IC3 A;  3V2U C;  2W1B A;  4DG1 A;  2WBR A;  5IQ6 A;  5KFS A;  4ZIV A;  2QMX A;  2AP6 A;  4R25 A;  1U25 A;  3OD2 A;  2MB0 B;  2YKO A;  3GV5 B;  4U7C A;  4N76 A;  3OSP A;  3PNI A;  4KHM A;  3H2L A;  1HQU A;  4DR3 F;  4YHH J;  3T1H J;  3V4M A;  3KLE A;  1MN7 A;  4MK8 A;  3LGM A;  4DV0 J;  3I9V 9;  2R7W A;  3MMB B;  4F04 B;  3K5L A;  2FVR A;  5LMN J;  3FDS A;  4O23 A;  2HBZ B;  2MZR A;  2ZZT A;  2DYA A;  2EVZ A;  3HSJ A;  4V1A k;  1N6Q A;  1JQG A;  3J7Y U;  1QVF R;  5KT4 A;  7FD1 A;  4NXN J;  3GV7 B;  1HWJ A;  3C14 A;  4U6P A;  1FWP A;  2KXN B;  2FTR A;  1LXJ A;  1JLB B;  2DNG A;  4LSN B;  3UD5 A;  1TR0 A;  3UNG C;  2HMI B;  2CQ2 A;  1F6T A;  5HJY A;  4KO0 A;  4DPX A;  4B08 A;  2XMA A;  5JJB A;  2WVB A;  2VQE F;  1RGV A;  3LAK A;  3SFU A;  3MEK A;  2W9A A;  5ETL A;  2GVZ B;  2IPO B;  3H59 A;  3OTB A;  2ZNY A;  2QYC A;  3EE3 A;  3OTC A;  2DB1 A;  1MNE A;  1XMB A;  2QL5 B;  1S49 A;  3CD5 A;  2J8A A;  2PFF B;  4MMO A;  4DQQ A;  4Q45 A;  3H5X A;  2M8D B;  5L46 A;  1TKZ A;  2BKO A;  3NEK A;  3MM9 A;  1H7W A;  5FLX U;  5D0H A;  1B0P A;  2MQM A;  3LP0 A;  3D28 A;  4FN5 A;  1Y5L B;  1T03 B;  5KFR A;  3ONQ A;  3ZZP A;  2LQ5 A;  4WF9 Q;  3PV8 A;  1S6O A;  1S9E B;  4ITS A;  5CAA A;  1NXI A;  3C6T A;  1VR6 A;  2E1C A;  1NSP A;  4CIO A;  3JSY A;  5J2P B;  2WCX A;  5GAG I;  3TZW A;  4I64 A;  3F73 A;  2D7S A;  2V34 A;  3PYD A;  3QT5 A;  3SCL E;  3DRR A;  2CPZ A;  3GPA A;  5KFO A;  5KT3 A;  2V94 A;  2LVW A;  3OLA A;  3DLK B;  5KFL A;  3MEC B;  3HSD A;  2XMV A;  3KLG A;  3AOA A;  2HW3 A;  3HVR A;  2AJQ A;  3KG1 A;  1SC4 B;  1TUW A;  3OFH A;  2V0N A;  1JLE B;  3CCU S;  2HHV A;  3M8P B;  3TA0 A;  4KH1 B;  4JI7 F;  2YQ3 A;  2ZUA A;  3PO5 A;  1IR0 A;  2V68 A;  2HZV A;  2OPP B;  1U1L A;  1OY8 A;  3EZO A;  1IBL F;  1SC6 A;  3HFK A;  3NP5 A;  2NZ4 A;  3VQT A;  3EUN A;  4TQS A;  1T94 A;  5HO4 A;  2PN6 A;  2RDD A;  3LPE A;  5DG9 A;  3PDN A;  3CJR A;  2OD6 A;  5DDQ C;  1OQ6 A;  1X4G A;  3H5U A;  1TL3 A;  1FXL A;  4G6V B;  1BGX T;  5E7O B;  2OMO A;  1NO8 A;  4TU7 A;  1WOR A;  1JNR B;  4YY3 J;  3X3U A;  1BWE A;  4PZV A;  4Q0B A;  4DSF A;  1C4A A;  4HYK A;  1YJU A;  3THP A;  4ECT A;  1H2V Z;  2EG2 A;  3JXO A;  4WIQ A;  1RTD A;  2Y1R I;  3TAQ A;  3LA0 A;  4JB8 B;  3CCT A;  2SXL A;  4WFN Q;  4WCE Q;  2AU0 A;  4URG A;  4WPA A;  1SJF A;  4B3M J;  3SCI E;  1ZM2 A;  1DY3 A;  2EBE A;  3TRG A;  3DGP A;  3KLH A;  3SBM A;  5C42 B;  5M2U A;  3DRY A;  4AYB D;  4NLG A;  3H25 A;  5FJ4 A;  1HNV B;  4ZMM A;  2NYH A;  1R27 B;  2GQQ A;  4QWA A;  2GHW A;  3WC2 A;  5J1P A;  3G86 A;  4YB5 A;  2HVD A;  1JLC A;  2NSC A;  3SMZ A;  3BSC A;  3HHK A;  3EGW B;  3CTR A;  3MPY A;  1SVD A;  2R2T A;  1HHQ A;  4C8M A;  2H54 B;  1NHV A;  1U1N A;  5KFG A;  5IFM A;  3I56 S;  2CQG A;  3I0S A;  2XYH B;  2XLK A;  3UN2 A;  5IXU A;  2YQ0 A;  4O3O A;  2OTL S;  1RK8 A;  2HHS A;  3BGO P;  4C98 A;  1IBM J;  2E1R A;  3ENQ A;  3L3C A;  4PUO A;  2F8M A;  3RZA A;  3MR5 A;  2OML A;  5HVG A;  1LWF B;  4LF8 F;  2UUA J;  1MWZ A;  2L41 A;  3RRH A;  4Z7C A;  1RJJ A;  2JOQ A;  4ENO A;  2CNK B;  3H90 A;  1F9E B;  2O3D A;  2WON A;  3RBX A;  5CYM A;  3AHP A;  2N82 B;  3HSZ A;  3CJ0 A;  2KT2 A;  2R7U A;  1T8E A;  2VH7 A;  1MLA A;  1H3D A;  4DSL A;  2G2Y A;  4GC6 A;  1LWX A;  5ETN A;  1E6Y B;  3UDC A;  1WTB A;  4LRD A;  3FC9 A;  2K3K A;  5D4P A;  4DR4 J;  1YKW A;  2JEG A;  5K14 A;  4FS1 A;  2HYI B;  1HWK A;  3E3X A;  1GMU A;  2BQ3 A;  4ZVR B;  3HHN B;  4F0H A;  4EI2 A;  3BKF A;  1R8H A;  4CLF A;  4RUA A;  1NB7 A;  4URQ U;  2ASJ A;  1VBX A;  3DRP B;  2KHD A;  1HQ2 A;  3PYE A;  2JWN A;  1SH3 A;  4Q2L A;  4B9N A;  4CLU A;  1W26 A;  3GFY A;  2R3V A;  3HVT A;  4YEA A;  4DR5 J;  2PMW A;  1VGY A;  3AQO A;  2RE1 A;  4LQ9 A;  2DK2 A;  5GAE U;  2QLX A;  1V5V A;  4J9N A;  4ZVP B;  2WOM A;  1FX2 A;  2HGL A;  4OI4 A;  5I42 A;  2C2Z B;  3TJA A;  4JI2 J;  4OZ1 A;  2BQU A;  3T9Z A;  1KWM A;  5K20 B;  4GVB A;  1S1U A;  4DV3 J;  3TZZ A;  4DR2 F;  3Q23 A;  4RWW A;  2BJE A;  4WZM A;  2PMH A;  3GE9 A;  1D09 B;  1QY7 A;  4NLW A;  3NGD A;  1JNZ B;  2RVJ A;  1YDL A;  4FYX B;  4MAK A;  4RU2 A;  2J0Q D;  3HHL C;  3B78 A;  3UNY A;  3NOC A;  1QDU B;  3FK4 A;  3PRV A;  1G4C A;  4OI2 A;  3CCL S;  3G8T A;  1N0V C;  5HLF B;  4W92 B;  3MI7 X;  2POK A;  3PW5 A;  1FDD A;  4NYO A;  4L3K A;  3O5T B;  3TAN A;  5AE2 A;  2GHP A;  3ILL A;  2IA0 A;  3TUI C;  1GH8 A;  1X9S A;  2KT5 A;  3QFW A;  1HNI B;  3VGU A;  4GO7 X;  3EDR B;  3HX9 A;  3FKB A;  3Q8R B;  5G0R B;  3UCG A;  3BN4 A;  3KLI B;  2RSQ A;  4NLT A;  3QFH A;  3P49 B;  3VAJ A;  1LXN A;  2OP5 A;  1QAX A;  5AT1 B;  1VK8 A;  3BR8 A;  1URR A;  2H5J B;  1QSS A;  1ZA2 B;  4PQU A;  4J9R A;  4FF2 A;  3EGZ A;  3DM2 A;  2B4U A;  1SC3 B;  3W61 A;  5JVH Q;  4P52 A;  1RHQ B;  2APO A;  1U6B A;  3MMC A;  4F2R A;  1XER A;  1XMQ F;  2HRY A;  2YNH A;  1B0T A;  1RWX B;  5FDL B;  5I4M A;  2YH1 A;  2W2P P;  3MGJ A;  4JI8 J;  3RW6 A;  1VQK S;  2AYB A;  1RWK B;  4KKO B;  2NXN A;  4Q5V A;  2W25 A;  3DOM A;  1XQI A;  3M8S A;  4AE5 A;  2Z30 B;  4WK3 A;  1NDC A;  5KFJ A;  3K5M A;  4GRS A;  2WVC A;  4JI0 J;  3FCW A;  1WHW A;  1Z2Z A;  3HPO A;  4QIG A;  4AND A;  3JSB A;  1UET A;  2W8K A;  3OL7 A;  1FF2 A;  2DR6 A;  2DNO A;  2DO0 A;  4MKY A;  3FSY A;  3RW7 A;  5KG6 A;  1N88 A;  1QE1 B;  3PO4 A;  1U6F A;  4OX7 A;  3EGV A;  3G9C A;  3GCX P;  2HNY A;  2AEF A;  1IBC B;  2KZM A;  4ZP7 A;  1N0U A;  3H4B A;  2MHE A;  3LWM A;  4RWX A;  2NUH A;  4KV8 A;  2AJ4 A;  1NHK L;  2QMW A;  3V6J A;  2GZO A;  2ZH7 A;  1T05 B;  3G87 A;  1RT2 B;  4DL7 A;  1N5T A;  3I5C A;  5IC4 B;  2MTL A;  3C15 A;  2VAS A;  1RHU B;  2ASY A;  3PKY A;  2FLO A;  2BAB A;  1I6J A;  4EO6 A;  2HS4 A;  2C42 A;  1U0H A;  2F65 A;  2OO4 A;  1H7X A;  2W7P A;  1SJ1 A;  2CJX B;  2IM2 A;  4I2Q A;  3NCP A;  1YK9 A;  3CJS A;  1HL6 A;  3N5B A;  3RB0 A;  1D0E A;  3VAM A;  1HBO B;  3RTV A;  2CDQ A;  2ZVI A;  1REG X;  2VBY A;  1RT7 B;  4ZP9 A;  3HHL A;  1S0O A;  4KHP F;  3H20 A;  3JAM U;  4F0M A;  2G0I A;  1EAY C;  5A0Y A;  2A1B A;  5BR8 F;  1UVL A;  5KG2 A;  2DGS A;  4C48 A;  2FLN A;  1T9W A;  3PYF A;  1MU2 A;  2BAN A;  1C0T B;  2HFN A;  4Y2M A;  3OR1 B;  5HN0 A;  4ECX A;  3HK2 A;  4LFB J;  1FEE A;  2HZC A;  4M94 A;  4WJB A;  1YJ9 S;  1RWV B;  2V5H G;  3TA1 A;  1VQY A;  2NUU G;  5F9N A;  1V6H A;  1C1B A;  3OL9 A;  4IFV A;  4RW6 A;  2J0X A;  2QFI A;  2YX1 A;  5DQG A;  2P5V A;  1F9H A;  4P7V A;  1CLF A;  3ULH A;  3GJQ B;  4R5P A;  1P1L A;  2ZH6 A;  3CED A;  3ETO A;  1M0S A;  2Q6C A;  3AJ1 A;  1NK0 A;  2XS5 A;  5IWA F;  2KU7 A;  1U4B A;  5KT2 A;  2HWH A;  4AXI A;  2X7I A;  1UP1 A;  2FJE B;  2JSX A;  2ZKU A;  2JX2 A;  4OYZ A;  1VIO A;  4O4G A;  4YB1 P;  2DXF A;  1Y10 A;  3QBC A;  2ZOM A;  4QWE A;  1VQ5 S;  5HP1 A;  1U0S A;  4ZLP A;  3KNA A;  4C0B A;  2LEB A;  1Y9O A;  4I7F A;  1S6Q A;  2QTW A;  2AF6 A;  1SPB P;  5BYS A;  4F3Q A;  4RBV A;  4Y2A A;  2BA9 A;  2XZT B;  4Y3C A;  3QO9 A;  4LR9 A;  3MR7 A;  4DU7 A;  3RUB L;  1HA1 A;  3DDI A;  2A0F B;  2VB6 A;  2YWG A;  2KJV A;  3DU5 A;  1RWM B;  2AGO A;  1UCN A;  1RT5 B;  3LPY A;  4IKA A;  1FDN A;  3HZG A;  5KFD A;  4X2B A;  4DL4 A;  2N4D A;  4EUV A;  3AH6 A;  4BBY A;  5DLG A;  1HWU A;  1XNQ F;  5ETS A;  1X5P A;  1RAG B;  1QUP A;  2RML A;  2ZDO A;  1Q53 A;  3MXH P;  3HZE A;  3FBC A;  2ACM A;  1W7W A;  2JLE A;  4DG1 B;  1WHY A;  1UA1 A;  3HVA A;  1IWG A;  2D3O R;  4YME A;  1FCA A;  1DBD A;  2WW4 A;  4N56 A;  1H98 A;  2FGO A;  1Q7L B;  2MQL A;  4OI1 A;  4WTY A;  2B7C B;  2UUW A;  2EC2 A;  3BPS P;  2Z2M A;  3Q22 A;  2OHD A;  4JI3 F;  2JNJ A;  2HWI A;  3KLE B;  3I55 S;  1KLM A;  3RGI A;  2R7O A;  4JV1 A;  2HHP A;  3S1T A;  2K1R B;  4O44 A;  1DTT A;  3JQJ A;  2B0G A;  3HJF A;  3X1L B;  1N6Q B;  2X1A A;  4IG3 A;  1P8G A;  4NE9 C;  4TKT A;  3M2V A;  2P9G A;  5HVF A;  2R8I A;  4PG5 A;  4OFZ A;  3WX8 A;  1ICE B;  2BQR A;  1CUL A;  5AJ3 F;  3PAC A;  4J90 A;  1RTI A;  1O0P A;  4KO0 B;  2DNQ A;  4WBF A;  4U8V A;  3BYP A;  1WEZ A;  3IRX A;  5KFK A;  2QGF B;  4TLR A;  2EFQ A;  5M2R A;  3PX4 A;  1AYE A;  4H4M A;  3KWM A;  3I0R B;  2RU9 A;  1KEK A;  4ZPW R;  5D4N A;  3W66 A;  3TAM A;  4HDH A;  1HMV A;  3CPW R;  1BQM A;  3GJT B;  1RWU A;  2JDJ A;  3OHB A;  2MKJ A;  1KVK A;  1TKZ B;  4DF8 A;  2WSE C;  3MM9 B;  1Y7P A;  5D0R A;  3PZP A;  2FD2 A;  2O01 C;  2LFV A;  2DGV A;  3WC0 A;  1HKA A;  3LP0 B;  1ZAX A;  5L39 A;  3U27 A;  2LQB A;  3D3B J;  1RSC A;  3GTY X;  2GVD B;  4TLQ A;  3EVM A;  5KOX A;  5EGY A;  2GAG C;  3SV3 A;  3BO3 A;  4C9D A;  3L4B C;  5H9E J;  2NXJ A;  5A2Q U;  1XWL A;  3VAK A;  1KNZ A;  1WC1 A;  1RCO B;  4UOC A;  2Q1L A;  1FFW B;  1KQS R;  3ET6 A;  2BJ8 A;  3MFI A;  1VS3 A;  1M5V C;  3VAG A;  3MDF A;  3DHX A;  4DUZ F;  1Q78 A;  2KDO A;  5G4D A;  4RX6 A;  5A76 A;  3AD7 C;  2VA3 A;  2AW0 A;  3FFI A;  1YIT S;  2HHW A;  4RBU A;  4AFF A;  2QLJ B;  3FZB A;  3MMA A;  4DV1 F;  4DXL A;  5A8K A;  2VDH A;  2DNH A;  5EHH A;  2CYY A;  3RR8 A;  2PO4 A;  1RWO B;  1V9O A;  1QUV A;  2KFY A;  4YP3 A;  1J2V A;  2HS3 A;  3A8I A;  3IM9 A;  4UZB A;  3IS9 A;  2MY8 A;  1S1W B;  5MLC V;  2RRN A;  1U1K A;  2EPI A;  4ETX A;  1IKX A;  2RDJ A;  2Z56 B;  4FYY B;  2PSZ A;  4NML A;  5F8H A;  3A13 A;  5L8R C;  1M5K C;  3UN5 A;  3OXG A;  3MAH A;  3IR6 B;  3A3N B;  2MZT A;  1YLX A;  2NPI A;  4DQS A;  3HKZ D;  4ECQ A;  2DNY A;  2M9K A;  4DV7 F;  3V6H A;  3K5O A;  3K5P A;  4KIA A;  1JMT A;  2HQI A;  3CB4 A;  1WEL A;  2GIF A;  4ETZ A;  2XYP B;  4B3R F;  4X64 F;  3M32 A;  2V4Q A;  3C2P A;  4Q0B B;  2P6S A;  4KT0 C;  2CPE A;  3EXC X;  5D8H B;  4PG6 A;  1S9F A;  4ZVG A;  4UOF A;  1RTD B;  4C8N A;  4ILL A;  3V4I B;  4DS5 A;  2H4Y B;  1HPZ A;  1FRH A;  4I6A A;  2CDR B;  2IM3 A;  1HNW J;  4XDC A;  3DGP B;  4OZ5 A;  2HGN A;  1WHV A;  4LF2 A;  1LK5 A;  2NPF A;  3IC1 A;  3MPW A;  3IP0 A;  5B7W A;  4TU8 A;  1RAE B;  4O0N A;  3VAH A;  2XCP A;  4G1Q A;  1RWP B;  1SIW B;  1JLF A;  1JLC B;  1VBZ A;  4G3I A;  4IQM A;  4OI3 A;  2KTQ A;  8AT1 B;  2EBG A;  5LL6 d;  4L6V 3;  1U02 A;  2VG5 A;  1EX8 A;  4LVO P;  1JLA A;  1UEV A;  2GAH C;  2E29 A;  3I0S B;  2BW2 A;  2YKQ A;  4C3M A;  2VF3 A;  2IVF B;  4MKV A;  4NLX A;  2AYM A;  5E3R A;  1REV A;  4LR8 A;  4DPT A;  1LQ9 A;  2BKN A;  5LSL A;  1RB0 A;  4IO1 A;  2EKY A;  3Q89 A;  4ED6 A;  3K17 A;  4QWB A;  1T9X A;  2R42 A;  3HFZ B;  2MQO A;  2WON B;  3KUG A;  3DRX A;  3HFV A;  2ZH5 A;  5CYM B;  1FK9 B;  2RQM A;  3DOK A;  1ZAW A;  2DHA A;  3CGI A;  4K4S A;  4K8R A;  1N34 J;  4EZ6 A;  4F4K A;  3G4S S;  5HMZ A;  3W2V B;  2VD3 A;  2B5J A;  3AQP A;  5F8M A;  5K14 B;  2DT9 A;  5B0E A;  4AL6 A;  4E8U A;  5F3T A;  3CT9 A;  3J7A N;  1KTV A;  2CIM A;  4P2M A;  3LQV A;  1K9M T;  4TN2 A;  2V6A A;  1YZ6 A;  2BV3 A;  4NLV A;  2EFO A;  2W4D A;  2NCK L;  1LKZ A;  4N8O A;  3HVT B;  3O44 A;  4ECR A;  1FKO A;  3MM6 A;  1SJ3 P;  4JI4 F;  2ACY A;  4K2X A;  1TP7 A;  4NXM J;  4PAB A;  1WWH A;  3DYA B;  4RUH A;  5I42 B;  1K8A T;  2FC8 A;  2VOD A;  2JFD A;  1K47 A;  5T14 A;  1SL1 A;  4GVB B;  5IV3 A;  4PWW A;  1S1U B;  1B0V A;  3N6L A;  2YKA A;  4DPY A;  3D5M A;  4ZPD A;  1NB2 A;  1VJW A;  2HRT A;  4EO8 A;  4USU A;  5EWG A;  4NX9 A;  2K8G A;  2KN4 A;  4L73 A;  2PI4 A;  4J9Q A;  5SZT A;  5DJB A;  3NGT A;  1NCL A;  3M30 A;  3W60 A;  2VG6 B;  3RB3 A;  1Y3J A;  4QJV A;  1S1X B;  2FUG 9;  4PXB A;  3MTJ A;  1SKR A;  2VFU A;  4MK7 A;  3S8S A;  2F4F A;  2H5I B;  4Y2K A;  3P3D A;  4NMX A;  2E1M C;  1RZM A;  1TQL A;  4QIV A;  1Q16 B;  3B54 A;  1KC8 T;  2M70 A;  2C3Y A;  2J9C A;  4USJ C;  2Z4P A;  3JQK A;  1NZ8 A;  1T02 A;  2XS7 A;  2LXI A;  2OSR A;  4ED1 A;  4I2P B;  1FXR A;  2Y9H A;  1IWA A;  2P2C B;  5KFB A;  1TMM A;  2XMU A;  4CRJ A;  4PQU B;  5GMK a;  2MGZ A;  4DR1 F;  1NND A;  1H2U X;  4B9T A;  2WB1 D;  4O3R A;  4ZP8 A;  2E5G A;  2HFZ A;  2WK4 A;  1S7H A;  9RUB A;  2PMZ D;  2UU9 J;  3MMC B;  3D7S B;  2KT3 A;  2G1H A;  4A8M P;  2PGC A;  5CAB A;  5SUH A;  3IRW P;  4C7Q A;  3QIP A;  3ICL A;  1R6V A;  2R7R A;  4ZIT A;  3MM5 B;  3ZXW A;  2H51 B;  3R8Y A;  1HBN A;  2PDA A;  3DCA A;  1H6K X;  3ILO A;  4BWJ A;  3H4D A;  1TL1 A;  2RU3 A;  2FHJ A;  1XJW B;  1YJ7 A;  9ATC B;  2VZ9 A;  3Q8Y A;  2QMU B;  3G2X A;  4TXS A;  2Z8Q A;  4ED2 A;  1R0A A;  4DU8 A;  3FBB A;  3OPK A;  1HR0 F;  3DOL B;  2N7C A;  3CJ3 A;  2KVQ E;  1K0V A;  3T1Y F;  2HNY B;  1B70 B;  5HK4 A;  2ATL A;  3GJR B;  4DR7 J;  4NYZ A;  2E7V A;  1XNR F;  1V3S A;  4KV8 B;  1T9U A;  3EPG A;  1DHM A;  2DGO A;  1J5O A; 
#chains in the Genus database with same CATH homology
 3NGS A;  3VVU A;  1NDP A;  3Q8V A;  1LEO A;  2AZ3 A;  3EVM A;  3ZTR A;  5CAB A;  3EVW A;  4DI6 A;  3NGT A;  4UOH A;  1NCL A;  3ZTS A;  1MN7 A;  3ZTQ A;  3EJM A;  3WX8 A;  3EVO A;  1NUE A;  2ZUA A;  3VGS A;  1WKK A;  2DXE A;  3DDI A;  1B4S A;  3NGU A;  2DYA A;  3BBB A;  1NHK L;  1UCN A;  3ZTP A;  3ENA A;  3ELH A;  3BH7 B;  5BXI A;  1MN9 A;  1KDN A;  4F36 A;  1LWX A;  4S0M A;  2HVD A;  1BUX A;  1EHW A;  1S57 A;  1NPK A;  3PRV A;  4WBF A;  2DXD A;  3FC9 A;  4F4A A;  5IOL A;  1NDK A;  3B54 A;  2HVE A;  1B99 A;  3Q8U A;  3R9L A;  2B8Q A;  3BBC A;  4CP5 A;  3ETM A;  3Q83 A;  5CAA A;  4FKX A;  1NSP A;  3FCV A;  4ANC A;  2B8P A;  3BBF A;  2DY9 A;  1NDL A;  4DUT A;  2NCK L;  1NLK L;  1JXV A;  1HHQ A;  1XQI A;  3FBC A;  1W7W A;  3MPD A;  4HR2 A;  1BE4 A;  3Q8Y A;  3DKD A;  3ZTO A;  4UOF A;  4W98 A;  1F6T A;  1WKJ A;  3VGV A;  4FKY A;  3G2X A;  3FBF A;  1NDC A;  3BH6 B;  3L7U A;  1NSQ A;  4ANE A;  2CWK A;  3JS9 A;  3GPA A;  1VYA A;  1XIQ A;  3EM1 A;  3VVT A;  3Q86 A;  2VU5 A;  3FBB A;  3FCW A;  1BHN A;  2BEF A;  3Q89 A;  2AZ1 A;  3VGU A;  3EMT A;  1K44 A;  3FKB A;  1ZS6 A;  1WKL A;  3B6B A;  4EK2 A;  4AND A;  1NSK L;  3FBE A;  3VGT A;  5C7P A;  1PAE X;  4UOG A;  1HIY A;  1S59 A;  4C6A A;  4DZ6 A;  1PKU A;  3GP9 A;  1U8W A;  4O0N A;  2DXF A;  4KPC A;  3EE3 A;  2HUR A;  1NB2 A;  3NGR A;  3PJ9 A;  4ENO A;  1S5Z A;  1HLW A;  3EIC A;  2BX6 A;  1F3F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...