1JLQB

Crystal structure of hiv-1 reverse transcriptase in complex with 739w94
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
425
structure length
405
Chain Sequence
IETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords HIV-1 RT, A-CHAIN
publication title 2-Amino-6-arylsulfonylbenzonitriles as non-nucleoside reverse transcriptase inhibitors of HIV-1.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
total genus 111
structure length 405
sequence length 425
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2001-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1jlqB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jlqB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jlqB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jlqB03
1EP4B 1IKWA 3C6UB 3KLVA 3SFUA 3C6TA 1D0EA 3NAIA 4R8UB 2J6UA 4KB7A 4TY8B 2ASDA 1HPZA 2IC3B 1HNIB 4YR0A 1SH3A 2FLLA 1S1XA 2OH2A 1IKVA 2W8KA 2WONA 4WE1A 3OHBA 3I5AA 2ALZA 3RAQA 2B6AA 1QAIA 4ZVGA 5D3GA 2R8GA 4EO8A 3N6LA 3EPGA 3PW4A 3KK1B 4ZMMA 1S48A 3SI8A 1HQUA 5KFHA 4ECWA 5KG0A 3BGRA 3QIPA 4Q8FA 3M8PA 4ED0A 2WOMB 1TKZA 1DLOA 1ZTTA 3TVKA 1S4FA 4ZP8A 3Q8RB 3DRRA 4PWDB 3N6NA 3IS9B 4DL3A 2YNGB 1RTDA 3KHGA 1QE1B 4H4MA 4O3SA 1JLBB 2IMWP 2VA3A 4IKAA 3DRSA 1MMLA 3CO9A 1JLGA 2D7SA 5KFLA 3H59A 4M95A 3KLGB 4X2BA 3KLIB 3QZ7A 3N6MA 2RF2A 4LSNB 2V4QA 2HNYA 1LW2A 4KHRA 2ZE2A 4FS1A 4Q45A 4O3OA 4B3OA 1HQEA 5I42A 1LWCB 4J9QA 4O4GA 3NBPA 3G86A 1EP4A 5KT2A 2J6SA 4M94A 1RT4A 4ZHRB 5JUMA 3QGHA 1RA6A 4KAIA 3H5SA 5EWFA 3BQ1A 3V6HA 3RB0A 4WYWA 2OPRB 4I2PB 3BSOA 2AGQA 2IC3A 1HNIA 3FFIB 2I1RA 3MTKA 3T19A 5KG7A 4QWDA 2IBKA 4PQUA 5C25B 3LAKA 1RTIA 1TL3A 4KE5A 1FKPA 4QWCA 5EWEA 4DL2A 1S9FA 5T14A 4IRDA 5J2PB 5KG4A 1DTTB 1N6QB 1J5OB 4TYAA 5KFMA 5KFOA 3H5YA 3KK1A 5KFRA 3T5LA 3LP2A 3H5XA 2FVRA 2CJQA 4ED3A 5KFZA 1RT2A 3LP0B 1C1BB 1SH0A 3MEEB 4TLRA 5C24A 3DDKA 1RT7B 2WOMA 3NGDA 3OLAA 2UUTA 1U09A 1JLEA 5DLGA 1TP7A 3PZPA 1S49A 3H4BA 4I2QB 4PWDA 4U6PA 3NAHA 4ZP6A 3IS9A 2YNGA 1IM4A 3DOKB 3OL9A 2W7PA 3DM2A 2BRKA 2XWYA 4Q0BB 2D3UA 3G6XA 3CVKA 1FK9B 1JLFA 4RUCA 5L1IA 4ECYA 1S1VA 3DRPB 3I0RB 5C42A 2YNFB 3IGVA 3UDLA 3NMAA 1UWBA 3FSIA 4GC6A 2YNIB 1C2PA 2R2UA 3RBEA 1FKOB 5DG8A 1RTHB 4HKQA 1HPZB 4ZHRA 5KT3A 4OL8A 4MIBA 5I3UB 4URQU 3GV8B 2OPSA 1S1XB 5CYMA 1IKVB 2VG5B 2IJNA 3BSAA 2OPRA 3PHEA 4TN2A 4I2PA 2RDIA 4IR1A 3FFIA 4IH6A 2B6AB 5KFAA 4F4YA 5L1LA 3DLEB 1RYRA 4RNHA 1KLMA 1T94A 2R8HA 5C25A 4DL6A 5KFWA 3MR2A 2IM1A 4MIAA 2FJVA 3QLHB 3VQSA 2W7OA 3GV7B 4NLOA 1DTQA 5J2PA 3KOAA 1DTTA 2W9CA 1J5OA 3RB6A 1SUQB 1D1UA 4IRCA 2IAJA 4NYZA 1TKZB 1RT5A 4NLUA 4Q8EA 1C1BA 3DRRB 2R2TA 1VRTA 5DQGA 1HYSA 1RT7A 1RTDB 4H4MB 4J9LA 4NZ0A 3V6JA 3DRSB 4PUOB 4I2QA 2UUWA 1JLGB 3GIKA 1JKHB 1C0TA 2V0NA 5F8GA 3RBDA 1C0UA 2RF2B 1RYSA 3BQ0A 4G3IA 4Q0BA 1LW2B 2J6TA 4K4UA 3GIMA 3HVTB 1JLCB 1FK9A 3CDUA 4RNNA 4B3OB 3GILA 1HQEB 4ID5A 2FJXA 3T5JA 1JX4A 1RT6A 2YNIA 5F8MA 1RT4B 3G6VA 2OPPB 1FKOA 3E01B 1RTHA 5EWGA 3V4IB 1HNVB 5HLFB 3ISND 3M9OB 4IFVB 4KHMA 5I3UA 3DOLA 3D28A 3NKYA 5KFTA 3G6YA 4KFBB 4PQUB 2VG5A 1RTIB 1TL3B 4WYLA 2ZKUA 1FKPB 5DQIA 4ECVA 2AU0A 3RB3A 4IH5A 1JXLA 3DLEA 4ICLB 4J9PA 3HKWA 5F9NA 5EDWA 4NLYA 4YQWA 3OL6A 3JSMA 3QLHA 3LP2B 4NCGA 2R2SA 2FLPA 1RT2B 3MR5A 4K4SA 2C28A 1SUQA 3NL0A 5C24B 3I0SB 2FVPA 4RW6A 2B5JB 3H2LA 2VG7A 1JLEB 5JXSA 5F8LA 4TQSA 1BQMA 4KV8A 4ED1A 5KFNA 1S1UB 1R0AB 2C22A 4WZQA 3MEDB 5HBMB 3CDWA 3QGIA 4PUOA 5KFUA 3DM2B 1JKHA 4ECZA 5KFKA 4Q43A 3T5HA 5HP1A 1JLFB 1LWFB 1T05A 4TYBA 1S1VB 5C42B 1Z4UA 4MK7A 4O3QA 3Q8QB 1UWBB 4IG3A 4R5PA 2W9BA 1MU2B 3HVTA 1JLCA 3CJ3A 4O3PA 5KFXA 2JLEA 5KFSA 3KK3B 4G1QA 4J9SA 4EYIB 2BRLA 2F8EX 1K1SA 2OPPA 3E01A 1C1CA 1RTJA 2OPSB 5KT4A 5CYMB 1HMVB 2VG6A 5L9XA 2RKIB 3V4IA 4J9KA 4DL4A 1HNVA 5HLFA 4ECQA 2FJWA 4IFVA 3TQ1A 1BQNB 3UPFA 2WHOA 4ZP7A 4RW8A 1KLMB 4KFBA 4EBEA 4IFYA 3T1AA 4ED6A 2C2RA 4Y2AA 2BQUA 1DTQB 4RW7B 4ICLA 2W9CB 4RW9B 3DLKB 1RT3A 3GIJA 2IAJB 2C2EA 4NLPA 3Q8SB 1LWEB 3MF5A 5KFPA 3OSNA 2W9AA 4EEYA 1RT5B 3H40A 3E51A 4K4YA 1S1WA 1VRUB 3KLHA 1VRTB 5J2QB 3I0SA 1HYSB 4NLVA 4GC7A 2B5JA 2WRMA 2BE2A 4NLDA 4RNFA 5K14B 4NRTA 5DG7A 1S1UA 1C0TB 1R0AA 2QE5A 1RT1A 3M8QA 4Q44A 3MEDA 1C0UB 5HBMA 1T03B 4K4XA 5J2MB 1I6JA 3V81A 2JEFA 1CSJA 3CJ2A 1LWFA 4RW4B 2E9TA 1HARA 3QGGA 2ASJA 4ID5B 3KLEB 4NLRA 3TAMA 3UQSA 4J9MA 1RT6B 4WZMA 1MU2A 3CJ0A 1SH2A 5KFEA 2XC9A 3H4DA 1EETA 2GC8A 4H4OB 4IOBA 1S6PB 4IQXA 3KJVB 3KK3A 4DEZA 3PJWA 4FBUA 3OSPA 2E9ZA 3LANA 2D3ZA 4O4RA 3KHRA 3DOLB 1XR7A 4ECSA 3CIZA 2CKWA 1HMVA 5KFCA 1TVRA 2RKIA 3JYTB 1TV6B 3DLGB 1S97A 4NLWA 4F50A 1BQNA 3BSCA 5KFGA 3BQ2A 1JLQA 2B43A 4JV0A 4ECTA 1REVA 5KT7A 2HAIA 4TQRA 2DPIA 3KK2B 3JSMB 5CYQB 4NCGB 4ZPBA 5KFQA 3MR6A 4KO0B 4RW7A 5KT5A 3IN5A 2ATLA 4QWBA 5KG3A 5KG2A 4RW9A 3ICLA 3DLKA 4MFBB 5KFDA 3LAMA 5DGBA 2ZD1B 4RU9A 3PR5B 3M9MB 1LWEA 1TKTB 4RW6B 3V6DA 5L1KA 2VG7B 2BQ3A 4RNMA 3KMQA 4R0EA 4ZVFA 1T3NA 3EPIA 3FQKA 1BQMB 1VRUA 4KV8B 5J2QA 5DGAA 3IG1B 4EYHB 2RDJA 1N4LA 3QO9B 3MEGA 4IDKA 5K14A 5KG6A 4EBCA 4FBTA 5KG5A 4H54A 1S6QA 1S1TB 4NRUA 4Y3CA 3BSNA 5HP1B 4ZPAA 1T05B 5KFJA 1T03A 2ASLA 2WTFA 5J2MA 4RUAA 3KHHA 4IG3B 4R5PB 2W9BB 1S9EB 4RW4A 3MECB 2GIQA 3H98A 3KLEA 4G1QB 4ECRA 2UVWA 1ZETA 5KFYA 4MH8A 5F8IA 5FDLA 2YNHB 3IRXB 3BREA 1C1CB 1RTJB 4H4OA 1S6PA 1KHVA 2VG6B 3KJVA 1N56A 3HVAA 3ITHA 3CWJA 3EZUA 4QWAA 1S0NA 1N48A 1IKXA 4RW8B 1KHWA 1SV5B 4IFYB 2HNZB 4DG1A 3JYTA 1TV6A 4RNOA 3DLGA 3LALA 2XCAA 5HROB 2FVCA 4NLTA 3PW5A 4JUZA 4WFYA 3KK2A 1RT3B 2AGOA 5CYQA 2WCXA 2R2RA 5DG9A 5F8JA 4KO0A 3MFIA 1IKYA 1S1WB 1N5YA 4MFBA 2ZD1A 3QZ8A 1TKTA 2YKNA 5KFIA 3CDEA 4LSLB 2BE2B 2D41A 4URSA 2JC1A 2BR0A 4YR3A 1RDRA 1LW0B 3OL7A 3IG1A 1RT1B 3M8QB 5DQHA 2R8IA 3FDSA 3QO9A 3PW0A 1TKXB 1JLAB 3V81B 4O44B 1S1TA 2AWZA 3IGNA 4NLXA 3MFHA 3T5KA 2UVVA 4QWEA 1S10A 1S0OA 1QAJA 4HYKA 3TAMB 3KMSA 1JIHA 5F8NA 3MR3A 4QPXA 3D5MA 1S9EA 3QIDA 2V4RA 2O5DA 4LQ9A 3I5CA 4IRKA 1EETB 3MECA 2R8JA 2EC0A 3GV5B 3V6KA 2XGPA 2JC0A 2XI3A 2IJFA 2AQ4A 4WFZA 5KFFA 2YNHA 1ZTWA 3IRXA 5KFVA 4J9NA 3HVWA 4ECUA 4O3RA 2HNDB 5KG1A 4J9OA 4IG0B 1TVRB 4KBIA 2HWHA 3KNAA 4KKOB 1GX6A 1TQLA 4ZPCA 4EO6A 4NLSA 3DYAB 1JLQB 1TL1B 1REVB 1SV5A 2AX1A 5C5JA 4ZPDA 2HNZA 3OHAA 2YKMB 2R8KA 1NHUA 5HROA 4ECXA 1W25A 4Y34A 3BJYA 2QV6A 4ED8A 4NLQA 4WXOA 1S0MA 4KSEB 2IM2A 4LQ3A 3V6DB 4RZRA 3DI6B 3KLFB 3H5UA 3M9NB 3DMJB 3C6UA 3GQCA 2W8LA 2HWIA 1WNEA 4Y2CA 4R8UA 4LSLA 4IDKB 3MEGB 1NHVA 4TY8A 4DL5A 2JEJA 1S6QB 5DLFA 1S9GB 4MK8A 1LW0A 3Q8PB 2OPQB 4J9RA 3QYYA 4NLGA 1QUVA 1TKXA 1JLAA 4O44A 4DL7A 4JV1A 1YVFA 4F4XA 4YMEA 4EBDA 4K4ZA 2FLNA 2HMIB 4IR9A 2DPJA 5FDLB 3GYNA 4QW8A 3RB4A 4MKAA 3LP1B 4K4TA 4JV2A 4K50A 2XCPA 2IM3A 3ITHB 2V9WA 4MKBA 3OL8A 3UR0A 2UVRA 1IKXB 2BANB 2HNDA 4XPCA 4IG0A 4DG1B 5J1EB 4TXSA 4KKOA 4XO0A 1QE1A 1GX5A 5F8HA 1JLBA 3DYAA 5J2NB 1XR6A 1TL1A 4ZVHA 5L1JA 3I5BA 3ISNC 2YKMA 4I7FB 3KLGA 3KLIA 1K1QA 2I5JB 4LSNA 1RA7A 2IM0A 3KLHB 3PW2A 1IKYB 3FQLA 3PW7A 4K4VA 1RAJA 1N5YB 3PJXA 5KT6A 1IKWB 3PVXA 2AX0A 2GIRA 4XPEA 3C6TB 2YKNB 4QW9A 4ED7A 3FRZA 1LWCA 3DI6A 3KLFA 3DMJA 2ILYA 2ILZA 4IH7A 4MK9A 4WFXA 4U7CA 4FS2A 3CJ5A 2WONB 4WE1B 2JEIA 4O3NA 2XGQA 1S9GA 4ZVEA 5D3GB 2OPQA 3BR9A 3PR4A 3RAXA 3KHLA 2FVSA 4ED2A 2FVQA 2WK4A 4WXWA 1HQUB 1N6QA 3BGRB 3QIPB 1NNDA 5EUHA 2BQRA 3HHKA 3M8PB 2HMIA 4F4ZA 1DLOB 2VA2A 3LP0A 3GIIA 3MEEA 5F9LA 4ZP9A 3LP1A 2E9RX 2IA6A 4TY9A 2XI2A 2UVUA 2BANA 3SFGA 4URGA 3OLBA 3CJ4A 2JEGA 5J1EA 4YR2A 2AGPA 3DOKA 5J2NA 1OS5A 4YP3A 2C2DA 2WB4A 2HNYB 5KFBA 4I7FA 4K4WA 2ZE2B 4F4WA 2I5JA 3DRPA 3I0RA 5I42B 2YNFA 1XR5A 4O4GB 3NBPB
chains in the Genus database with same CATH superfamily
4RR5A 3UCZP 3KLVA 4OZNA 3HZGA 4WTOB 1HWJA 4TY8B 1Q82T 2QJ3A 4CM0A 2WOMB 1VQPS 4ZIWA 4KQZA 4EWTA 2D9PA 3QZ7A 3IWLA 3M6UA 3EZ5A 1KQFB 2RMLA 2KU7A 3KJNB 1K0TA 1R43A 1YSJA 3QFWA 2L48A 5T14A 2ROEA 1RGVA 1J5OB 1VI7A 3MZIA 4ED3A 3ETOA 3VAIA 4CLSA 4PKDB 4LBHA 4C98A 4DCJB 2W2PP 4JI7F 1JLFA 4FYDA 2KM8C 1NKBA 2YH0A 4USMA 1VQ5S 1F9FA 2Z56B 3PM9A 2JLFA 4IH6A 1VJQA 3P4UB 3D67A 2Z2ZA 4MIAA 5FIIA 1KRPA 5J2PA 2F4FA 2CDQA 3DRRB 2XTJP 1IBKJ 2GVZA 4ZITA 4YFUA 4A8XA 4I2QA 1JLGB 4CYUB 2E7WA 4CO5A 3BQ0A 4DU7A 3TZYA 1FDAA 2FUG9 3R1HA 1TELA 5ITHA 2GHWA 2FHKA 3MM6B 4Q7AA 2FD2A 2W4CA 3MM8B 2W01A 1JXLA 4C8OA 3DLEA 3AB4B 2MZSA 3TVYA 1EX8A 2OMLA 4TKTA 4KGVB 2B5JB 1UMJA 4KV8A 1WF1A 3MHYA 4NI2A 1IUJA 5HBMB 2RH3A 2NQPA 1IR0A 3DM2B 1JKHA 1ZS6A 4WBFA 2D3OR 4KIAA 2AZ3A 4LRCA 3CJ3A 1IWGA 2B8PA 3E01A 1C1CA 5KT4A 3GG1A 5CYMB 2MY7A 3UPFA 2HHWA 4HL9A 4RW7B 1UPPA 3DLKB 1RUSA 2NXUA 2VASA 4M1KA 3OSNA 1TAUA 5ETNA 2EFNA 4P10A 3RUBL 1U1PA 3SCKE 2PC6A 4C8ZA 1WI8A 3M1VA 1WF0A 2BYCA 4Y6IA 2J8AA 1HR0J 3CCTA 2OTLS 4H4KC 4X4QA 1XR7A 3MMBB 1FFSB 1Z1ZA 2Z58B 3KK2B 4IOAQ 4TLQA 3RTVA 1BY9A 4ZVRB 5IT9U 2UV8G 4Q2LA 2BQ3A 1RHKB 3W8GA 2ZH9A 1KVJA 4ZPAA 1T05B 4N47A 4JI6F 4MH8A 2YNHB 5LMUF 4J91A 3EM1A 1NDPA 5BR8F 1KSPA 3E2EA 3HI9A 1U49A 3OTOJ 3ZZRA 5CYQA 2PMHA 3TOQA 3LF0A 2W1BA 2D41A 2Z0GA 2YQ1A 3W1YC 4QYRA 3BKTA 3TO8A 1S7IA 3HD1A 3LWLA 5LSLA 3QIDA 1EETB 3GV5B 4AE5A 3PV8A 2K1RB 1LK7A 3IRXA 2V68A 4ZLPA 1NMEB 2HNDB 3AOBA 1B64A 3FNNA 1IQZA 2XO6A 3ZZPA 4LSZB 3QFHA 2AW0A 4DN0A 4AQYJ 4WXOA 2C2MB 4U8VA 2XWXA 2J7WA 3BZQA 2HWIA 1MG7A 1QAXA 3AOCA 4JI2J 2JEJA 3ZZTA 3MM9A 1YDLA 4J9RA 2HQ3A 4YMEA 4YOEA 2HMIB 1GMWA 2EVZA 3BO3A 2MPUA 1UW4A 1KDNA 1ZAVA 3NS5A 4UZBA 3MPDA 3PX6A 4IH7A 4Q5VA 4FS2A 2VB6A 2JEIA 2XGQA 4KTQA 1VBZA 1EKSA 2X1FA 4WXWA 2J5AA 3PTWA 4DR7F 2RJZA 3GIIA 3UVJB 2IA6A 1CJTB 1NM2A 3BKFA 5KOWA 2EFOA 5GADU 2LXUA 2H4WB 2W2OP 3OXFA 1OPIA 4HHHA 2H51B 3T3FA 3ENAA 4DPWA 3OT9A 3TEGA 3C6UB 1RAAB 3ET6B 2FLLA 1RLCL 2ZJRQ 2E66A 4HHUA 3RJMB 3NGKA 1H72C 3AJ2A 3EPGA 2G1DA 3D66A 4PABA 5H9EK 2KH9A 5CD4A 5K5MA 1CJKA 1DARA 2MKJA 1SPBP 2HNYA 3G96A 4HTIA 3MOZA 5DETA 2FHJA 3QGHA 4LBPA 2IC3A 2I1RA 1S77D 1RAEB 2KKHA 1SL0A 2Z2YB 3D1HA 3P5BP 3G6ES 1WJ9A 3LP0B 1D8ZA 4JYAF 2BJ7A 5IWAJ 3G6XA 3CVKA 2ZNZA 4ECYA 2QLBB 4GC6A 1IVZA 4RWWA 1U1NA 2GHPA 3TUPA 5F3ZA 1I51B 1WTBA 5KT3A 4OI2A 1HWIA 1S1XB 2IJRA 2MKHA 1VQ8S 4I2PA 3TJ8A 2FHOB 5C25A 1X31C 2DY1A 3VQSA 4NLOA 2G0IA 2Q43A 3M8ZA 3ZZ0A 2CQHA 2KTQA 5IS2A 1CS4B 2AMCB 1I5OB 3G9CA 4HVZA 3GIKA 5ETSA 2HFVA 2OLWA 2CPDA 3RBDA 2KXHA 1X8DA 4DV0F 4G3IA 2J6TA 1LW2B 4QIWD 4XTTA 4W90B 2NXEA 3ISND 2QN6B 5I3UA 2U2FA 4ECVA 2VG5A 3CW2C 2CNNB 2ZHBA 3Q0AA 3OXGA 5D15A 1NDLA 2HRTA 2FLPA 3SMZA 3DXBA 1KWMA 2FVPA 2AEJA 2C22A 2VBZA 2RQMA 3ZTQA 2V50A 4OMFG 5AXNA 1ZH5A 3HVTA 2CQDA 4O3PA 2ZZNA 1EAYC 2F1FA 4J9SA 4EYIB 2JNJA 1M1GA 3P3DA 5HLFA 2WHOA 2DNZA 1JJCB 4ID8A 1N88A 3TA2A 4I56A 2E1RA 2ZBCA 4YB1P 3QAUA 1LWEB 5KFPA 3T1HJ 3CJKB 4YHHF 4NRTA 2F3JA 1S1UA 1I6JA 3QRQA 1XN9A 1RWPB 3Q8UA 5I3PA 2ZNYA 2QA2A 4FBUA 2VD3A 1YITS 3BQ2A 1JLQA 2BX6A 1YGYA 3IN5A 1BGXT 2CYYA 4XAKA 3LAMA 4ED5A 4RW6B 2CZVC 1T3NA 5DGAA 4G1PA 1RWUA 2RDJA 5IV3A 1S1TB 4CLTA 1FWLA 5G0RB 4R5PB 4O0IA 1CBKA 1HHSA 3WHIA 2GV1A 1UPMB 1RTJB 1U2RA 2DGQA 1PBAA 1KHWA 3CEDA 3M8WA 4USJC 4B3MF 2KJWA 3UD3P 4USKA 1N5YA 5D4LA 4URSA 3OQ2A 2R8IA 4XIUA 1Y3KA 2MKSA 3PW0A 4DUZF 2PEHA 3FRYA 3K5OA 3TAMB 5F8NA 5K8MA 4IRKA 5A8KA 2R8JA 1OQ3A 3V6KA 2JC0A 1F6TA 1WKLA 1D9FA 1ZTWA 4DXLA 3HSDA 1R89A 3W9IA 2VDIA 3OHAA 4DPUA 5GAHU 3K8WA 1QDUB 2UUBF 1GMVA 2DHAA 2IIHA 3DMJB 1NHVA 2HS0A 4DL7A 1XMQF 3HHDA 3MCSA 1FXRA 5D8HB 3R5AA 3H2UB 2HIYA 1VC0A 5F8HA 5J2NB 2YKMA 4A8SA 4LSNA 2AX0A 2YKPA 1RHUB 2DD8S 1UKUA 2QL9B 3PR4A 4WFBQ 5HAOA 2K3KA 2V2QA 3BO4A 4F4ZA 5GAGU 2DKOB 4DZ6A 1XMOJ 3LP1A 4ES1A 4LBIA 1A9NB 5EGYA 2UXDF 2C2ZB 2ADBA 3DOKA 2HWTA 1BWEA 3D0GE 1KKHA 3I6PA 3GB0A 1XR5A 4O4RA 5H9FK 4DI6A 4ZJQA 4QBUA 1S99A 3IBFB 2ZUGA 4YR0A 1YJVA 3T6BA 2H1YA 3NGRA 3RAQA 2B6AA 2HHTA 4RX6A 5D3GA 2IYGA 1N36F 1T8EA 3DN9A 4BLGA 1B7FA 3TVKA 3DOMB 3Q8RB 1FCAA 1FTRA 1RTDA 3PIOQ 2HHVA 3W7BA 1HQEA 2G9OA 5HO4A 3QGPA 3NBPA 4M94A 5GVQA 1GMWD 5E0OA 2MDAA 1RWVB 5GAEU 4DR1F 1R8CA 3W2WA 2XYHB 4DUYF 3NGDA 1JLEA 1UWAA 1W2BR 1IJEB 2DJWA 1U24A 1FFGB 3OVBA 1X4GA 1FK9B 4P71A 5A6WA 1CEZA 2WW8A 3NMAA 2BV3A 1S6UA 4DS4A 3AY0A 4ZHRA 3GV8B 4MIBA 2VONA 3Q2TC 2GW8A 4F4YA 3R7SB 3W62A 2MSTA 1DTQA 1VQLS 2COLA 2ROPA 4J9LA 5EHHA 1CG2A 2MJNA 3BGLA 2ZVSA 2OPPB 1HNVB 3DOLA 4DN9A 3CULA 4PQUB 4NZ7A 3QLHA 4NCGA 1PG5B 5A0YB 2UUAF 1AXQA 2ZEJA 1NJZA 3TP2A 5B0BA 3AAWB 4ZPVR 4HTJA 5F8LA 2JRSA 4L74A 1YZ7A 2BM1A 2Z8QA 3T5HA 4LIRA 1Z4UA 5DDQC 3Q8QB 3PACA 4ETXA 5HL7Q 2MQPA 4DL4A 2ZDOA 1RZMA 5D6GA 5HQ8A 4EBEA 3HDSA 1TL4A 5D0RA 2OIHA 3R6LB 3Q8SB 2YKOA 4UY85 4NLVA 2WRMA 1RHMB 1JK9B 4RNFA 4K4XA 5THWA 3V2UC 1CSJA 3CJ2A 3NS6A 2E9TA 3ZTPA 2OD4A 1OQ6A 4NZ6A 1HHQA 1U6ZA 3U1LA 4JV0A 4ECTA 2DPIA 3I96A 3OR1B 3T1YF 5B09A 1HBOB 1RU2A 1AUSL 3EPIA 4F3MA 4CTAB 2RE1A 2HHSA 3QO9B 2ALYB 1VC5A 1RLDA 2IHR1 4IG3B 2GHVC 3A4TA 2PEBA 4I68A 3C2PA 3BBBA 2Q3PA 3ZZYA 2QIFA 4RUHA 3G8TA 2HNZB 1KTVA 2XY6A 3QATA 1ZOTA 1RAHB 2DCUB 3A13A 2CWXA 1RAOA 2XEXA 2DISA 2CADA 1S1WB 2WAQD 2ZH8A 4NCAA 2BE2B 2DBBA 2DXDA 2B9XA 5JVHQ 1JLAB 2VFTA 2PE8A 1U8SA 2EI5A 3KMSA 3HM9A 2MKKA 4LF6J 3AB2B 2XGPA 2HW3A 4GKKJ 5GMKa 1WG5A 2CVEA 4Y34A 4DV4J 4LF8F 4TY8A 1Y00A 3Q8VA 3NEKA 4NLGA 1MROA 3SQGA 4F4XA 5CABA 1O6XA 1YI2S 5B08A 4C8YA 4P9SA 2IM3A 5LT5A 4IO1A 2CRLA 2DHGA 2EK6A 1PYOB 3W61A 3VAGA 3LGNA 2NCKL 1VQNS 4AL5A 6FD1A 4YDDB 2B4VA 4M5JA 2B4UA 3D7SB 2FVQA 1WHVA 1N32F 1IWAA 3M8PB 3M32B 2RVJA 2F40A 2VA2A 1T9VA 2OKQA 4PXDA 3S8SA 2QSWA 4KJIA 2H3EB 3GYGA 4YP3A 3UCGA 3ZNJ1 2LMIA 4K4WA 4JI7J 2N4CA 4B9UA 4MKVA 3SFUA 3MMAB 4FF2A 1NK9A 2OH2A 5LSOA 2MMYA 3I5AA 5ETTA 4EO8A 1C4AA 1Q78A 3CDAA 1NK6A 1NLKL 1HBUA 1WSRA 1D9DA 3W64A 4CWBA 3DRRA 4WU2A 1EIYB 1Q95G 2YNGB 4O3SA 4CLKA 4DLEA 1JLGA 3OTDA 2ZE2A 5KAKA 2AEMA 3NNAA 4FKXA 4K2XA 5EWFA 1MMNA 1UJ5A 3FK4A 3MPVA 2ZFHA 3MM8A 3S6EA 1OWXA 5BJRA 4BCAA 5KG4A 1HBMB 1N6QB 3C8YA 4TYAA 3ZFVA 2CQPA 1U1OA 2R7TA 2FVRA 2F7VA 1SVDA 3IR6B 3W2VB 1WHYA 1LFPA 2XQCA 2OFHX 5DLGA 3H7HB 1RWMB 4OFZA 3DM2A 2XWYA 5AE1A 1VQ9S 1NH8A 3O5TB 4CO4A 2VFUA 1RTHB 1HPZB 2MQNA 3C14B 2RRAA 5CYMA 3BSAA 1NPRA 1YKWA 5DZ7A 3AH6A 1F0XA 4PYDA 4QR1A 3HK2A 4NYZA 4E0DA 1TKZB 1LFWA 3TZZA 4DL0C 2RQKA 2UUWA 3UDVA 1UZDA 3TUZC 2YX1A 1RXOB 2UV8A 2C42A 3R8YA 2WSCC 3MMBA 4M5KA 4JI4F 3D6HB 3JTPA 5F9NA 1UETA 1SJ1A 5D0HA 3GFZA 2XSFA 4WZQA 3MEDB 3M6WA 2WSEC 3QGIA 4Z37A 1T05A 2DNRA 3N9UC 1PBUA 2VU5A 3B8HA 5E3RA 1R3NA 1TKDA 1KFDA 1YBTA 3VAMA 4JI6J 4C48A 1QUPA 3K5NA 5LMUJ 3TQ1A 3R7BB 1QAYA 4A47A 1RWWB 5BR8J 1L5UA 1K8AT 4MAKA 4GVBA 1R0AA 5E3AA 2HVHA 2E5LF 1BUXA 1C0UB 1KOHA 4DCPB 1TL7B 2CJKA 1YJUA 2GAHC 1HNWF 5CAAA 2P2CB 2XC9A 1EETA 3O1LA 4H4OB 4DSJA 1APSA 2DNHA 4JV5F 3CMQA 2DK2A 4USIA 2E29A 3BSCA 1ZZFA 1CVJA 2XLKA 4CM2A 5KFQA 3B4DA 4QWBA 3G71S 4RW9A 2V4JA 3AD9C 1VBYA 2LP4A 1UFLA 3FVYA 2XMVA 1Q7YT 4P52A 3EGWB 3NWGA 3IG1B 2MZQA 5HP1B 1V3RA 2XMJA 4ECRA 2FJDB 2CXEA 4FN5A 4PPZA 2M0GB 4LREA 4ZLLA 3R3TA 3H2VE 1KFSA 4OHWA 4QWAA 1SV5B 2FC8A 3LALA 4N56A 3F41A 1T9WA 2RILA 5DM7Q 4GKJF 3OW2R 2WCXA 2GJFA 3MAQA 1U1QA 2ZD1A 2PDAA 3JXOA 2HRYA 1VLYA 3M8QB 2GJIA 2AWZA 4FF3A 3V81B 1Q1KA 3OTBA 4QWEA 2VKRA 3CC2S 2MSSA 4WFZA 2DNGA 4DR7J 1TVRB 3KNAA 3ILIA 3QQCD 4P2SA 3UN5A 1W25A 2BKNA 1FRXA 4C8NA 2QV6A 4NLQA 3OFEA 3V6DB 1IQTA 2QMWA 4OI4A 4DQQA 2XY5A 3C6UA 3M6VA 5F3TA 2LQJA 1S6QB 5DLFA 2ZH3A 4PYAA 3SDEA 4EBDA 1AA1B 4UOGA 3OVSA 3D6TB 1VQ7S 1T9UA 3AFGA 4DCOB 2DGOA 5AJ3F 4DV5F 2MHNA 3KJFB 3CTRA 4OLPA 3I5BA 1A0OB 4DPOA 3KLHB 3PW7A 2MQMA 4R0JA 1QTNB 1WELA 4P7TA 3G87A 2P5VA 3W8PA 2OPQA 2WK4A 3UFCX 1S4EA 4DX6A 4KC5A 4LF2A 1SQFA 2H5IB 2AV5A 3LP0A 2KM8B 4JB8B 2ZH2A 4JYAJ 1X9WA 4BWMA 2PMWA 3K58A 4UT4A 5D77A 2UUCF 3TQEA 3I82A 3VVTA 3C6TA 4NEZA 3PFEA 1F5BA 1S1XA 2ALZA 4OX8A 1LNQA 3L7OA 2CPEA 3GIRA 4FXWA 1ZTTA 1DLOA 2HBQB 2QLXA 2QT7A 1BHNA 1CS4A 3C15A 2Y0BB 2HLTA 4EUVA 1LW2A 5L38A 5F41A 4DPTA 5I42A 4DV0J 1P6TA 2BKPA 3P8BB 3GE9A 4KAIA 3H5SA 3BSOA 2AGQA 3MTKA 2NREA 4QWCA 1HA1A 9ATCB 5J2PB 1N8RT 2XMKA 1Q8LA 5BYRA 4I69A 2GVZB 5SZTA 1RSCA 1TK5A 1FVQA 1S49A 4I2QB 4P73A 3NAHA 1M5PC 2R7VA 3W3SA 2AYBA 3BBFA 2YNFB 1KOOA 3HHNB 1C2PA 2RQCA 1YRXA 3SEOA 2AP6A 1WC3A 2XSJB 1ZBTA 4IR1A 4MYUA 1NB7A 3DLEB 2V34A 2RHSB 2W7OA 4F02A 3KOAA 4ZVSB 2LECA 3CJKA 1RT7A 3SIPB 5BYSA 2DNYA 4YHHJ 5HN0A 1JKHB 1H2VZ 1MWYA 1RYSA 3DKDA 3ENQA 2YNIA 3G6VA 1FKOA 3E01B 1JMTA 1FT8A 5HMZA 3M9OB 1Y11A 2WVBA 1RTIB 2V69A 3CMAS 3RB3A 3HKWA 5EDWA 1QD1A 2R2SA 3PCOB 4RW6A 2ZJQQ 2CNKB 1L3UA 2FJBB 4ZJOA 3M1VB 4CO3A 4QIGA 4WP3A 6AT1B 2DNQA 4R5PA 1JLCA 1C4CA 1NK5A 2DXFA 1RTJA 3EGNA 2KG1A 2XO7A 4IFVA 4USWA 2CQIA 3VAHA 3FBFA 4W98A 4U7UK 1P8GA 4B3MJ 2X1BA 4K4YA 1K9MT 1D09B 3CJ8A 4GC7A 3VR1A 3IA0A 4A8MP 1IBMF 1C0TB 4EFAC 4OYWA 1Q7LB 1GFWB 1X7VA 1LWFA 2ASJA 3TAMA 3PKYA 4ZOSA 4ANCA 4DUZJ 2I38A 5KFEA 1V3SA 1AFIA 3L3CA 3LANA 1HMVA 1ZA2B 2DCLA 2HAIA 3HVRA 5CYQB 4RU2A 2J9DA 2MKIA 3CB4A 5KFDA 1U6FA 1VRUA 2UUBJ 2RDDA 5K14A 3R6GB 4DWIA 1T03A 1HI1A 4RWXA 1UJ6A 5F0UA 1XMQJ 1N5QA 3UN2A 2VH7A 3IRXB 3J80Y 3BGOP 4DR4F 3KJVA 4FPRA 3AA9A 3PG9A 2MQQA 1YLXA 2H65B 4B02A 2BJ9A 1TUWA 2P6SA 5LJ3Y 2BJDA 1OO0B 3LA0A 5CH7B 2B9WA 3CDEA 4XDCA 1UFWA 3C66A 3OL7A 5DQHA 2YKQA 5LSRA 2OAUA 3LH2S 3RYLA 3M2RA 1PILA 5KFFA 3I31A 2MLXA 1N5SA 4GRSA 4J5OA 1CPZA 5JJBA 2DIVA 1HQ2A 3R5CA 1SBRA 3MD3A 2UXDJ 1X4AA 3PIPQ 2NSCA 3FCWA 1X4EA 1FTCA 3TI0A 4LSLA 4ANEA 4FDFA 1YJWS 2JDJA 2M70A 4JV1A 2ZBRA 1M5HA 3VVUA 2FLNA 1VQ6S 5B0CA 3GPAA 4DV2F 1N36J 4MKAA 4DSEA 1R8PA 3UR0A 2LCWA 1HD1A 2AJQA 2HHQA 2W7AA 2E5IA 4ZVHA 3MUMP 1B70B 1WHWA 4L3NA 3LWMA 2HURA 2PT0A 2AJ1A 4ELVA 1IKYB 3QRRA 3HHLA 1CQNA 1V9OA 4LF9F 3TZWA 4CCHA 4L73A 4KH0B 2FVSA 2R9LA 4DR1J 5AT1B 3KDNA 4YN3B 2XMMA 4F4KA 5E3PA 4G1IA 1N5VA 5A6PA 2XI2A 3SFGA 4DUYJ 3THPA 4WP8A 2HNYB 1OPZA 4F4WA 1Q4RA 2BXJA 3R7NB 2AHOB 1IKWA 4R8UB 1Y5NB 4A8KA 4I6YA 3BH6B 2IC3B 1XNQF 1TFYA 2W8KA 2WONA 2E7XA 3N6LA 1M1HA 3PW4A 2IMOA 2MY8A 3BPSP 4KGZB 3HHLC 4ED0A 4USTA 4HH1A 4U67Q 3KUHA 5L9NA 3CD7A 4ZN1A 2Y1LB 1YJNS 4B3TF 5KFLA 3H59A 4UW2A 4FS1A 5MLCV 3GU0A 4OHVA 4WU3A 1RA6A 1NSQA 4NXMF 4I2PB 4PQUA 5C25B 3QPIA 2LQ8A 4D3HA 2ROGA 1H0HB 5KFRA 5A0YA 5KFZA 2CFXA 3MEEB 1RHJB 2UUAJ 2UUTA 2OEMA 2V8PA 4QR2A 2ZH5A 4U6PA 2VBWA 1X0PA 2HHXA 4DMZA 3OL9A 4I6WA 2D3UA 2B0GA 3HMJG 5DG8A 3CCMS 5HVFA 5IC6B 2MKYA 5I3UB 2VG5B 4ENOA 2BE9B 3HSZA 2HG4A 2MZTA 1VCTA 1UZHA 3GFXA 2NPFA 3M8YA 3FKBA 1MW7A 2R2TA 1KQGB 2ZHOA 4H4MB 3WBZA 1ITPA 1D3WA 2PIIA 4FVMA 5M2RA 4HACA 4ZIVA 4M63A 3HVTB 2NSBA 3T5JA 2UU9F 2CG8A 4LJMA 3PO4A 1SCJB 3LUYA 1SC1B 3PRVA 5HLFB 2RS2A 2DNKA 2BOPA 2H54B 3OR1A 4DR6F 1HBOA 1GAOA 1RT2B 3T1YJ 1KVKA 4M5DA 3IMQJ 4CTAA 4ED1A 3D68A 1S1UB 3CCQS 2XULA 2WZ1A 1S6OA 3IXQA 4IG3A 1RACB 5KFXA 2DEJA 3W65A 2HFSA 5D0GA 3DHWC 1Q8BA 1P9QC 4UY8T 2BQUA 4EGLA 1RWKB 3VGVA 1YWXA 1S1WA 3MWBA 3F0NA 4E8UA 2GZOA 5IQQA 2BE2A 2W2QP 2EBEA 5AXLA 1QSYA 2Y8WA 3OPKA 2OTJS 3TAPA 2JEFA 4ID5B 3V5RA 4WZMA 2FHMA 3CJ0A 3LPYA 3I32A 3QMQA 3TANA 1SKUB 2B7BB 4CI0B 2RKIA 1TU0B 4I0WA 5KFGA 2CWKA 1ZYQA 4PG6A 4OJ1A 3ICLA 5ETPA 3O6QA 3KMQA 1UEVA 3U02A 1T11A 3MOJB 4LF8J 1NSPA 4FXDA 3KNGA 4H54A 5A2QU 1UVKA 1EZZB 3QJLA 1NPPA 5A8KB 2J0XA 4AXIA 4DX8H 1R0BG 2W2NP 4CRJA 3CWJA 3EZUA 5GMDA 1NZAA 2BJ3A 2OO4A 2IVYA 4DR2F 7AT1B 2BOAA 4JUZA 1X4DA 4NYPA 2YWGA 1TKTA 3UR3C 2AF6A 5EN1A 2YTCA 1WDDA 3E3XA 3AXKA 3CT9A 3MR3A 3D5MA 1MLAA 2QMXA 4LQ9A 2EC0A 3RRGA 4Y65A 1H7WA 1N32J 5AXMA 2XM3A 1TUVA 5C5JA 3GCWP 2YKMB 3WIVA 5HROA 3KKFA 2ZHAA 2IM2A 2O66A 4RZRA 2EFVA 2PN6A 2H9ZA 3GONA 2NUHA 3JS9A 2CPXA 2RNEA 1UVMA 1U48A 3MD1A 1TTHB 1K44A 3IFEA 4FYXB 3BO2A 2JJ4D 5IFMA 2I9SA 4A8OA 2DPJA 4O23A 5A8WA 1KONA 3LP1B 2HQFA 2XCPA 3ITHB 2J76E 3PRDA 1FEHA 4RBTA 4AL6A 1SI9A 2QSFA 1VR6A 1R27B 4F8RA 1TZ0A 3DI6A 1CQMA 2V2VA 3SCIE 1F5AA 2CZ9A 4MK9A 1MMDA 2IDEA 4ZVEA 5D3GB 1N6QA 4OYOA 1Q53A 3W2VA 4X4OA 1JXEA 4JI8F 4CLZA 1OS5A 2G4BA 1H98A 3NBPB 2HAFA 2QGFB 4QU7A 2V5HG 2KFNA 1HPZA 2FQQB 3C14A 1DJ0A 1X5SA 3W2WB 1S48A 2KO1A 3IP0A 1NHKL 2DR9A 5KG0A 4QIEA 1R6VA 2SXLA 3JSYA 1TKZA 4ZP8A 4GO7X 4QQBA 4WF9Q 2YY3A 3SYZA 1JLBB 1CJUA 2D7SA 2M4MA 5B7WA 1H2TZ 3U27A 3NP5A 3W5YA 3RR8A 4NXNF 3CF5Q 4ZHRB 3AOAA 2HSEB 2Z30B 3N01A 3BEGB 1HNIA 4AYBD 2VBXA 4DL2A 2W25A 2A10A 4JI4J 3H5XA 2NXCA 4KPYA 2M7SA 3DDKA 1WUUA 2AJ2A 1TP7A 3F56A 3ADAC 5IQ6A 4PCQA 2GQCA 3RBXA 4EU0A 1JJHA 8AT1B 2Y9HA 1KN6A 4F04B 2AZ1A 2VFVA 4FF1A 2QLFB 2Y1IA 3J7Z5 3FFIA 2BUNA 3RR7A 3Q24A 3QLHB 4X4NA 1DTTA 1D1UA 1NAQA 3A12A 2HZCA 1IBLF 3M8SA 4OZ2A 1U8WA 1C0UA 4LRFA 1H3DA 4F2SA 2E5LJ 2JH3A 1KTQA 1UEKA 2KRBA 1JX4A 2HQGA 1OSCA 1YIJS 1HNWJ 5DQIA 4IH5A 1FJCA 4JV5J 1NPKA 4J9PA 3LP2B 4K4SA 3I4PA 3GWCA 1JWWA 4TQSA 3PX0A 2CQ3A 3TARA 5KFKA 4HT5A 5HP1A 4C7QA 1SC6A 5ETOA 2OPSB 4F0KA 3DDIA 4LUBA 4HH0A 4UUXA 1JJ2R 4UUWA 4X84A 5E33A 4GKJJ 1U1KA 2XNRA 2FZGB 2HRUA 4NLDA 4KGXB 1GQEA 4Q44A 3M8QA 3IO1A 2WBRA 1Y10A 3SSQA 3V81A 2HIQA 3S7RA 1I1GA 1HW8A 3H4DA 2GC8A 3CNQP 1TVRA 4F50A 1U2FA 4TQRA 1X60A 4GO5X 4LR7A 1YG0A 1Y7PA 4C11B 3OFGA 1KEKA 3V6DA 3K2YA 2QEXS 2KYZA 3MAHA 4ZPTR 2K7KA 1S6QA 1M0SA 1X5PA 4WFAQ 4RW4A 4X62F 1XTZA 4G1QB 1U1MA 2PSZA 1SIWB 1VC6A 4DV3F 1F9EB 1HKAA 2FB0A 2RIJA 1F3VA 3EDQB 3HSGA 5AJ3J 4DV5J 4NLTA 5AE3A 2GNKA 2AGOA 2CIMA 1AZSB 3MFIA 4AUKA 3CXCR 1AUDA 3FMBA 2JC1A 5CQGA 2RAQA 4F7VA 4DQIA 1NO8A 3WC2A 1MROB 2ATCB 3SQGB 5D78A 2LQBA 4X4RA 3D9BA 4FP9A 1F60B 5LXRA 5EX0A 2XI3A 3IM8A 2AQ4A 2ZOGA 3R5DA 2VPYB 4OYPA 2DVIA 4J9OA 1REVB 3VAJA 3FBEA 3FZBA 3BPDA 1UW9A 2CVIA 7FD1A 4X65F 1S0MA 1GTHA 2LU1A 2UUCJ 1BD6A 1RQ0A 4C4WA 1B0PA 1T95A 2VPXB 3DLHA 2PA3A 4PWUA 4W92B 2O3DA 2L9WA 4JI1F 1OIAA 3RRKA 1F1BB 1GMUA 5FLXU 2UVRA 1X5OA 3TRGA 2DEIA 1XR6A 1TL1A 3ISNC 1OY8A 3CD5A 4K4VA 2AIRB 2YWWA 2JX2A 2LDYA 2J0WA 2ILZA 1SL2A 1U26A 3CJ5A 1HFEL 1S9GA 1HBUB 5EUHA 1NJYA 1ACMB 1GEHA 2J9DE 3BH7B 2XY7A 4F26A 2JEGA 4YR2A 3TUIC 4P72A 2DRBA 2ZE2B 3CIMA 2YNFA 4NMLA 1RBOB 5L39A 1U6BA 2XSJA 4ZVGA 1NDCA 1G6BA 5IOLA 2KXFA 4DV1F 3QWPA 2DGWA 4H4KA 2VA3A 3H0PA 3D0IE 2QMUB 1KLNA 2HGMA 4BWJA 2KT3A 1DURA 1LEOA 5K8OA 1XWLA 3BDPA 2CQ4A 1FJEB 4DHVA 1ELOA 1RTIA 1YBAA 4PXCA 1IR1A 1RADB 1X9MA 1NB2A 1UAWA 1U09A 3PZPA 2BW2A 3H4BA 4F2RA 2EEYA 2CJXB 2DO0A 2CNOB 3RU0A 4KH1B 1UEUA 4K0KF 1PCAA 3UWTA 2M2BA 3KDOA 1VBXA 3GYXB 2XMTA 1L3VA 4OHZA 4LF4F 4BBYA 2L3MA 3IR7B 2WBMA 3ZNUA 1O8BA 3BM7A 4Y00A 4QPTA 1VQSA 4LMZA 4UTGA 1FJGF 1C0TA 1IBMJ 2CG4A 1Z2LA 4RNNA 4AD6A 2OELA 3P6YC 1ZM9A 3FMWA 1FO1A 2HVZA 3NKYA 2N4DA 2IFXA 3EE3A 1R8AA 4X64F 3ELHA 4GVBB 4DR3F 1R0AB 2OEJA 3DU5A 5C42B 1R7IA 2XYPB 3EDRB 2PI5A 3ILLA 1UJ4A 1YTYA 2AKWB 3W66A 4Y2KA 1UA0A 4KFBA 1PJ5A 4ED6A 2ZZMA 5CA5A 3Q2SC 4RW9B 2V4JB 4N8OA 4EEYA 3H40A 4EMDA 1S59A 2I0XA 4I67A 1Y3JA 4OIXA 3BKUA 4I1TA 2XMAA 1AB8A 4IOBA 3KK3A 4B9NA 2JL9A 3DLBA 4K2JA 4CH0S 3K5MA 2XB2D 2VZ9A 2B43A 3AQPA 4HLBA 3ONQA 3R27A 5KG2A 2ZD1B 1BQXA 4DR5F 3NGUA 5J2QA 1OYEA 2MKCA 1P1TA 2W9BB 3CD6S 5E7OB 2VG6B 4DV2J 2GX8A 3BV8A 4ZVPB 3DLGA 4DQRA 2FVCA 4N76A 1QSLA 4DFJA 1RT3B 5DG9A 1XIQA 1IKYA 2YX7A 5IT4A 5D4NA 3OJUA 1RKJA 2IYIA 3SDEB 4LF9J 2MQLA 3CCLS 4QPXA 1S9EA 1JNZB 2P8IA 3L95X 2MJUA 5KG1A 1TQLA 2HHHF 2AX1A 1E6YB 3WIUA 2L08A 1SKRA 1F2GA 5E3QA 3OR2A 4R8UA 4DL5A 2B3TB 2DTJA 2OPQB 4O44A 2QL7B 2ZUAA 3PJ9A 2L41A 4PWWA 4K4ZA 2CQ1A 2CQCA 2NZCA 1YHQS 4IUFA 1PIEA 2LYVA 1IKXB 4LFAF 5CYJA 2K06A 4KY3A 4B3TJ 4G65A 4LRBA 3C6TB 3KLFA 4PG4A 1J5EF 2LXFA 4WFXA 2ZKTA 4NXMJ 3NNCA 4Y2MA 3J80U 2BE7D 1RWXB 2H5EA 4Z7CA 1NNDA 2YPZA 2G2OA 2RT3A 1DLOB 4MYTA 2KZMA 3MEEA 2LA6A 1BXNA 3C15B 2ZC4A 2EPIA 2BABA 3VZHA 2EFGA 4J9UE 4X4PA 4MKYA 2U1AA 2DGVA 5I42B 2IDLA 2FJAB 1D0EA 3PYDA 3NAIA 1CULB 3G82A 2JLGA 1P9YA 4FPIA 2KFYA 1ZA1B 2P9GA 2C3PA 2EFQA 4OV1A 3HCXA 4M5GA 2L9NA 4H4MA 1N5TA 1MMLA 3KLGB 3O2IA 4KYZA 4OX7A 2VL1A 4Q45A 1AFJA 2D1CA 4HDHA 2CQ2A 2UU9J 1GXUA 5D4PA 4OV6A 4F36A 4OQJA 4KE5A 1NK8A 2B9EA 2KRRA 5IM0A 3K8VA 3KG4A 3T5LA 1RT2A 1RT7B 2LFVA 4DR6J 2G1HA 2BKOA 4KHPF 1VIOA 1IM4A 3M7VA 4ZA1A 3DRPB 1YK9A 3ILJA 2YNIB 4WP9A 1FKOB 1HNXF 3I4HX 4URQU 2N7YA 3PXGa 3KUGA 5H1SV 1S7HA 4RNHA 2R8HA 3R2CJ 4UOHA 3MR2A 2F4VF 1Y4ZB 4ITSA 4PG5A 3GFHA 3RB6A 3HT0A 4UF4A 1MSWD 3HP6A 4M8LA 2QA4G 2V2KA 4NZ0A 3MXHP 2C2KB 3N4WA 3MPWA 3GIMA 1JLCB 1M90T 3LPEA 4ID5A 2Z57B 5F8MA 1RT4B 4ANDA 4IFVB 2B56A 2KVQE 1JNRB 2ZKUA 1FKPB 5LM7E 4JI5F 1G1XA 4CT9A 1D9AA 4OYBA 3AODA 3O44A 1GTEA 3GMGA 3ENWA 3QRPA 1URNA 1LWFB 1S1VB 4MK7A 2Y1RI 2G13A 3JSBA 1T0TV 2JLEA 3VALA 4DSIA 1HI0P 2V63A 1HMVB 4ATNA 1CLFA 1RB0A 1KLMB 4MT1A 4NPOA 4EK2A 2W9CB 3WQPA 3BBCA 2E1CA 1VRUB 2CPYA 3I0SA 2Z4PA 2OGUA 5K14B 5DG7A 2D9OA 1T03B 3GSDA 2Y1JA 1B99A 2ZOMA 1HARA 4E98A 2XZTB 3QGGA 4LF1A 3T9NA 2Z2MA 2AD9A 1WORA 3KJVB 1PJ6A 1H7XA 3PJWA 3OSPA 2ZC3A 3N28A 2DR6A 4DX7A 3JSMB 4ZPBA 3MR6A 1V6HA 1B7YB 4WK3A 3CMES 2C2OB 3A1YG 4RU9A 3PR5B 1RCXB 2KYXA 1N0VC 3SCJE 1AW0A 3MM5B 3MPUB 4EBCA 4CO1A 4A8QA 5J2MA 3UN3A 2M9KA 3M2RB 4LFCF 4DBQA 3ITHA 3BR8A 3JYTA 4U95A 1TV6A 3N0VA 1S0VA 1HWKA 2PD1A 4LVOP 5T7LA 4MFBA 2YBVA 1ULRA 4L6V3 4LSLB 2R7XA 2X7IA 2F5GA 1QTMA 1QAJA 1JQGA 2BBEA 2JFKA 3MECA 3GCXP 1A6LA 2IVFB 2P9EA 3EYZA 1DBDA 4QZVB 4NL5A 3AJDA 3JTNA 4JI8J 2QA4S 5D0EA 4CZCA 3HHLB 2ASYA 1UFKA 4J7CA 3UO0A 1LW0A 3EWGA 4MIWA 1SC4B 2ZH6A 1KC8T 3FEXB 3K5PA 4DF8A 1L3SA 3D1QA 4AT1B 1VMBA 1QLNA 4CLYA 3SV3A 4IG0A 1B3TA 3JSRA 1JLBA 2C3UA 2VJVA 5HMYA 3PW2A 5F0WA 1IKWB 4LRDA 3PVXA 4QW9A 2YKNB 5DS7A 1TMMA 4NXNJ 2WONB 2MLYA 2RRNA 3FCVA 3JAMY 3HHKA 2RSQA 3TNVA 1VDHA 8ATCB 4B9TA 2FY1A 2BANA 5J1EA 3D2WA 2DH9A 2XLJA 2PMZD 1P1LA 1VHFA 2G0JA 1FX2A 5A2QY 2HLUA 5AE2A 3OD2A 3IC1A 3X3UA 3MM7A 1F9HA 2X1AA 1U1RA 4JI3F 1EHWA 4F0HA 3V4MA 4X4TA 4B3SF 1NKCA 3B4MA 4DPYA 1S4FA 2IMWP 4NA1A 3CO9A 2GS8A 1IBLJ 4U9RA 3RW6A 4J9QA 1XMBA 5KT2A 3CCVS 4OJGA 3DCAA 5B0EA 3P96A 3T19A 2R7SA 1FF2A 1N54B 4IYQA 1Q8KA 3H5YA 4JOUA 3KK1A 3LP2A 1YRUA 3WZ0A 2E1PA 4P7VA 4TLRA 4HHJA 2EG1A 3PKMA 1J27A 3IS9A 1T9YA 1ZM4A 4DS5A 2YWFA 4HACB 4O0NA 1VS3A 3PEJA 4RUCA 3UDLA 2VV5A 3J7ZT 2CPZA 3RBEA 1NZ8A 3MURP 2OPSA 3PDNA 3R5JB 2OPRA 3HJVA 5KFWA 1SJ4P 4CT8A 1EQ0A 4LT6A 3IAS9 4IRCA 2FYXA 4M5DB 2CQ0A 2R3VA 1U7LA 1DFDA 4CDIA 4NCBA 3QSIA 5AXKA 3Q89A 2XG8A 2F65A 1HW9A 4M5LA 2DO4A 5DM6Q 1E6VB 4CO0A 5EWGA 4LIWA 2J7UA 2KDOA 3WX4A 3D28A 3D0HE 2FC9A 5HQMA 4NLYA 2ZZTA 2D3O1 1FRMA 4C11A 3KXDA 1G2EA 4WCEQ 2Q1LA 3VTIA 1LK5A 3QJJA 2OMOA 4K7QA 2AJFE 2HYIB 5HANA 5HATA 4P74A 4G1QA 2BRLA 2F8EX 4X62J 3VQTA 2RKIB 2FJWA 4DV3J 4Y2AA 4USHA 5HVGA 4LF7F 4MJKA 3GIJA 4NLPA 5EX3A 4P2XA 1AZSA 1YX2A 3ZZOA 5JVGQ 2AJ0A 2JZ5A 3R2DJ 4OZLA 4EZ6A 3HSJA 1NKEA 2KHDA 1MU2A 1V3ZA 3QWUA 4DEZA 1BQNA 5IC4B 1REVA 5KT7A 2QYGA 4PXEA 2LQ9A 4X66F 3J7YI 1UVLA 1EKRA 1TKTB 2C2NA 3UW1A 4X65J 2GMHA 3M2UB 5IT0A 4NRUA 4Y3CA 2RU3A 4P75A 1FXLA 3H98A 4OJHA 1G4CA 3HKZD 4BC9A 4J37A 3NLCA 4JI1J 2UXBF 1S0NA 4IFYB 5HROB 4LVNP 3PW5A 3A8JA 4KO0A 1TFWA 3O3LA 1TMJA 2ZITA 5KFIA 5DDPC 2CJYB 1H2UX 4WTYA 2HHPA 2KB2A 3M05A 5A8WB 2YQ3A 3GG0A 4QJVA 1LXNA 1VQOS 1MNEA 3AXMA 2EWHA 2O67A 4EO6A 4FYWB 3EX7B 2VFSA 3HF5A 4DU8A 3LGHA 1NHUA 2CPIA 2IVMA 1M5SA 3DI6B 1FESA 2VPWB 1WACA 1FHTA 2AJ4A 3MEGB 4MK8A 2OUGA 1MWQA 1WC6A 1KQKA 3VCDA 2MGZB 4M5NA 1YVFA 1R31A 4TU8A 3W9JA 2FDNA 1SQGA 5DDRC 2PFFB 3OL8A 2XS2A 4DV1J 4DG1B 4KKOA 1FVSA 2APOA 1RA7A 1SB6A 4FZVA 3FQLA 3K17A 2CQBA 1IR2A 5LMNF 4XPEA 4S0MA 4ED7A 2DITA 5J1NA 2E7VA 3H8YA 3GTYX 2OSQA 2WVCA 3AHPA 3A8EA 2EKNA 1FFWB 1WOPA 2KI2A 1Q16B 4NASA 3ULHA 5HK4A 1CJUB 2V94A 3H90A 3WDOA 4I7FA 2I5JA 4DV6F 3J81j 2DYAA 4TNOA 4K0KJ 1DQAA 1WC1A 1HNIB 5A8RA 1HL6A 1YJRA 1SKSA 4WE1A 3OHBA 2O1PA 3GJQB 3WX8A 1HQUA 4RLEA 4LF4J 2POKA 2LEAA 1RISA 3VF0B 4X4VA 2A6MA 2IRYA 2EFPA 2AYEA 1X4CA 1FJGJ 3HZEA 5IV4A 4N5SA 3HXMA 2UXCF 3FBBA 3BQ1A 1IJFB 4ER8A 1JJ4A 3FFIB 4LFBF 3K59A 5EWEA 4ZPWR 4OYMA 1DTTB 1W7WA 3I87A 4YEAA 2NS1B 2CJQA 1XERA 3DHXA 3NGTA 4C6AA 7FDRA 3C3LA 3HFVA 3OUYA 2ZJPQ 4YB7A 4PWDA 4F67A 3TJAA 4X64J 4DR3J 3A8IA 2HQIA 4YUDA 3VWSA 3EVWA 2VOPA 5L1IA 5C42A 3OXLA 2VJUA 2JVRA 4RJVA 4ZVUB 1WHXA 3HULA 1IKVB 3PHEA 2C1EB 2RDIA 5KFAA 5FLXY 4NX9A 3EVOA 5RUBA 2FJVA 3GV7B 4K59A 3DRXA 1FNXH 4TVAB 2NYHA 1NDKA 3MMJA 3RBZA 2RF2B 3C46A 4Q0BA 5ETKA 2FJXA 1Q79A 3RGIA 4OI3A 3B54A 2GJ2A 3FZ2A 4DQPA 4ZCIA 2JHEA 4WPAA 2C3MA 3MR5A 3UNYA 5C24B 2FGOA 3NOGA 1NJIT 3US5A 4DDFA 3OVAA 4DR5J 5FD1A 2V8DA 3PFOA 4KGMA 2D74B 4FF4A 5ETVA 2W9BA 1DRZA 1S79A 4ZCKA 2VG6A 5A76A 3V4IA 2CUYA 3GJTB 3W5ZA 4JP8A 2C2RA 1XK8A 2IA0A 4ICLA 1RT3A 2IAJB 3U7JA 1VIXA 2RD5C 4C8LA 4OI1A 1J2VA 2I2YA 1REGX 2HBRB 3MTJA 4FNIA 4L76A 4RW4B 3K89A 4W4MA 3C16A 2CJ9A 3L7UA 3F44A 5E41A 5ETLA 2DT9A 4OZ0A 1RTZA 5C2CA 1E6YA 3MMCB 2L9DA 2HHHJ 5KT5A 1AROP 3IR5B 5DGBA 5L1KA 2VG7B 2M8DB 3JB9k 1BQMB 1R0CB 2WB1D 3MCMA 3RRHA 1XJWB 4OLOA 1N4LA 4OHYA 2Y3YA 4C9DA 3Q22A 1VOMA 4FXVA 1EQMA 4PXBA 2IY5B 2UVWA 2MQOA 1KHVA 2J9CA 1P27B 2GIFA 1IKXA 4FYYB 4L75A 1RAIB 6FDRA 2KFZA 4LFAJ 4WFYA 4UQTA 3NY0A 2HK2A 1CJVA 3EMTA 2HKEA 3QT5A 4KGKA 4I6AA 1WDTA 1J5EJ 3L9ZA 1X4BA 1VFJA 1X4HA 4WK1A 2VKZG 3W63A 1JIHA 1VQ4S 4F4AA 3W9HA 2IJFA 4DSLA 5KFVA 1BWVA 3IBWA 4R25A 1TL1B 4C8KA 4ED8A 1WEYA 2BVZA 4KSEB 4Y2CA 4IDKB 3PRBA 2E1MC 1S9GB 3HFZB 1CULA 2F9DA 3U1NA 1TKXA 5CCMA 1JXVA 2VBYA 4JBCA 5FDLB 4K50A 1AT1B 4TU9A 4MKBA 4XPCA 4TXSA 3DYAA 3T6JA 2QC3A 3KLGA 4I64A 2IM0A 1FWPA 3TR5A 1RAJA 2ZH7A 3I56S 3ILOA 3MCOA 2ILYA 1RAFB 2BJEA 4U7CA 2MB0B 1VHIA 4O3NA 1PJ7A 4N41A 3A3NB 2FTRA 1Q86T 4NOHA 2MYFA 2Y8YA 2XMWA 2DIUA 2OSRA 2N3LA 1URRA 2E9RX 1CC8A 2W4PA 1TR0A 3CJ4A 1Z2ZA 4KHPJ 3QJPA 5KFBA 1XC9A 4B9VA 2X3DA 3DRPA 2EC2A 3P45B 4A8FA 1KBRA 1SH3A 1HNXJ 3ISZA 4V19J 2YWKA 4ZMMA 3R9LA 3SI8A 3RZAA 5KFHA 2DGSA 2F4VJ 1H74A 3BGRA 3QIPA 2XLIA 1VQYA 1WC0A 2RU9A 3N6NA 3HD2A 4B9LA 1VRQC 3KHGA 5HMXA 3KLIB 2C3YA 5CHCB 2VQFF 4DJBA 3G86A 3FCHA 1EP4A 2QFJA 1RT4A 2OP5A 3EXYA 3V6HA 3VV2B 1Y9OA 3LGMA 4NA2A 3LAKA 1FKPA 4M5MA 4IRDA 2MZRA 5KFMA 4JI5J 1DQ8A 2FLOA 4RPFA 1U25A 1FJ7A 1FA0A 4ED4A 1KP6A 3FUYA 2BRKA 3AD7C 5LJ5Y 1S1VA 3I0RB 4LR8A 4KPCA 2HVIA 3EXCX 4CQ1A 3P49B 1U02A 1AYEA 1ZAXA 1RYRA 1KLMA 4DL6A 1UVJA 2HEKA 5I3QA 2W9CA 3BYRA 4Q8EA 1C1BA 2VHGA 3MEKA 2HS3A 2RS8A 4A8YA 3M2VB 1WKJA 1HNZF 1PYTA 2Q79A 5F8GA 3N5BA 4YS2A 1QJHA 4NEYA 4X4SA 3R1LA 3IM9A 4HEA9 2B4PA 2BMBA 5KFTA 3G6YA 4KFBB 1TL3B 2AU0A 2Y0SD 4USUA 5DDOC 2DRDA 4BC7A 3JSMA 3FGVA 2LVWA 3DGVA 1SUQA 4KRWA 1FDNA 2XYGB 3W60A 1RHRB 2XBPA 3MM5A 3IBCB 1QM9A 1HWLA 3T9ZA 1T3OA 3CCZA 4PUOA 3DDNA 2HFZA 5FJ4A 2CZ4A 2V67A 3KK3B 1WKKA 4LFCJ 3T1AA 4CLWA 4DSKA 2CA9A 1TUGB 4ZVQB 3NCPA 5ETRA 1RT5B 3E51A 2XS5A 5J2QB 1HYSB 3QAEA 5HVHA 3IWNC 2E5HA 3KJQB 4M5HA 3HFKA 1DHMA 1I94F 2YWEA 1NBEB 1FRKA 1WC4A 1WF2A 2HQDA 1G7CB 4NLRA 1RT6B 1V5IB 3K7RA 1SH2A 3J81Y 4DFKA 3D1OA 4IQMA 2NXJA 1RKIA 2D3ZA 3KHRA 2BA9A 3DLGB 1S97A 3OFHA 2J9EA 3WC0A 2ATLA 5KG3A 4OYAA 1YJTA 2R7OA 2XZDB 1UP1A 2BACA 3FQKA 1K73T 1Q5VA 4I4BA 4J9VA 2CAJA 3BSNA 3LW5C 5IZHA 3U1MA 2WTFA 1HI8A 1S9EB 4Y2IA 3FJ2A 2HZVA 3KLEA 1ZETA 3P5TL 1DZ5A 1N56A 1S6PA 2W2MP 4C3KA 2R7RA 3DNCA 4GVLA 4ZLNA 2QLWA 2VPZB 2E5JA 5F8JA 3OR2B 2YKNA 1H38A 4YR3A 1VQMS 1D8YA 3HX9A 2FHJD 3MFHA 4O44B 2R4FA 3T5KA 4HYKA 2O5DA 1NJWA 4IOCQ 3NOCA 3FEYB 1Q8IA 3GR1A 5K8NA 3POTB 2CPHA 1YBUA 1GX6A 2RB7A 4RBUA 4NLSA 2BJ1A 4ECXA 3BJYA 3GR0A 2UZAA 3KLFB 1FE0A 2ACMA 3CJRA 4JI0F 2ZM6F 3QYYA 1WOSA 5MAOA 2I6WA 2QG9B 4JI3J 1K0VA 3RB4A 2XZWA 4B3SJ 3CCRS 1GX5A 1RP5A 2CDRB 3UD5A 1EJ7L 5L1JA 1K1QA 3KWMA 3PJXA 1NK7A 2YKAA 5K9FA 1WG4A 3ZC4A 3G82B 4CLUA 1PSDA 2GMJA 4ZP9A 1T7PA 2UVUA 4URGA 1PO6A 2C2DA 1HIYA 2WB4A 1ZPVA 1N33F 3MAAB 4OYIA 1RABB 3THTA 2V2ZA 2QTWA 1HBNB 1FNMA 2ASDA 1FKAF 2K2PA 3H42A 2GA7A 2AEFA 5D4OA 5IM0B 4DLGA 4X4UA 4ECWA 2N82B 3GP9A 4Q8FA 5C2GA 4WIIA 4BHQA 1SJRA 1QE1B 4N7TA 1FNOA 3Q83A 4ZS6A 3EZOA 4UZCA 3ETMA 4AFFA 4OX9F 1LWCB 3BN4A 4O4GA 1E6VA 4WWSA 4OYXA 1NXIA 5KTQA 5KG7A 4QWDA 1XQIA 3QSYB 5KFOA 3N5FA 4WKRA 2QZ8A 3NWRA 1M5KC 3HHEA 4ETZA 3GJRB 4ZKAA 2WOMA 3CE8A 4CLPA 2NR0A 3IGVA 2UP1A 1YQHA 2GQ2A 2R2UA 2JOQA 4FVCA 3F73A 2A1BA 4B3RF 3JAMU 1WSVA 2XNQA 4TN2A 3B6BA 4QIVA 4ALZA 2X1GA 3DRYA 1J5OA 3VGTA 5E5NA 1M5OC 4LF7J 4NLUA 1M5VC 4LF5F 1VK3A 1PC5A 3DRSB 4D3GA 4DV7F 2Z2LA 2FIUA 3GILA 4B3OB 1I3OB 1TK8A 4N77A 1YJ9S 3RG6A 3TX0A 2VOOA 2EBGA 3FBCA 1R8HA 4KHMA 5JMNA 2ZVIA 3MCNA 3MR7A 2QYCA 2ZH4A 2OEKA 1HD0A 3J7A1 3I0SB 5JXSA 4X66J 5CD4H 1UL3A 3M2UA 1ROFA 1U1LA 4EZ9A 2XS7A 4CYUA 2K3IA 2N3OA 1SIZA 3CCUS 4TYBA 1UWBB 3S1TA 3NS7B 5GADI 3ZTSA 2G0CA 3IWXA 4ECQA 3MM6A 4ZP7A 2VIHA 4IFYA 2UXBJ 1Y0HA 2XHCA 4OX6A 3MF5A 2W9AA 1T9XA 4CO2A 1VRTB 1NK0A 3N79A 2B5JA 4A46A 3LQVA 4ILLA 1EARA 5HBMA 5J2MB 1XNRF 3SCLE 3GFYA 4A8WA 1PGZA 1SQEA 3CCES 1VISA 4Z2XA 4ECSA 1QSSA 2HFUA 3CIZA 3JYTB 1TV6B 4NLWA 2KZZA 2KJVA 2JVOA 2CQGA 4RW7A 1RK8A 1L3KA 5T7LB 3ZO7A 1KVIA 3DLKA 2IBOA 4MFBB 2RRBA 4ZVFA 1WWHA 4EYHB 3BGFA 5KG6A 1KR4A 3MEGA 2VFRA 4FBTA 2QX0A 3IRWP 2MGZA 1FWKA 4RUAA 1UVNA 3G8SA 2YPYA 1N34F 3MECB 2KT2A 5F8IA 3DGPB 3O8WA 2PA8D 2ZDPA 5CZVA 3HVAA 3C19A 4RW8B 1U47A 2PFDA 4FNHA 4YB5A 4DG1A 2XCAA 2FY8A 3KK2A 1WD6A 1U0HB 2B9YA 2R2RA 2LKZA 3EJMA 2A3JA 2WSFC 3QZ8A 3UDEA 5LMNJ 3GZ7A 1LW0B 2DR7A 1RT1B 3DFEA 3VHQA 4DUTA 4OHXA 4ZK7M 3KTQA 3G4SS 2YNHA 1X4FA 2R42A 3PX4A 4IG0B 4ZPCA 1OYDA 3MUTP 2MTLA 4OZJA 3PYGA 3PEHA 3EGVA 1UTAA 4RO0A 2W8LA 2GCFA 3SBMA 3VZIA 1BC6A 4DV6J 3VGUA 3MI7X 3KG0A 2VQEF 3J7AN 4YY3F 4QW8A 4JV2A 2GVDB 1ZAWA 4BS2A 2V9WA 2K1RA 4B08A 5DZ6A 2BANB 2HNDA 2ADCA 5J1EB 4ZCLA 2P6TA 3UCUP 1GT8A 1SL1A 1TAQA 3FSXA 1IM6A 2J7KA 1CC7A 2QFIA 4MTPA 3MM7B 5HJYA 3CD0A 2UXCJ 2LA4A 2GO9A 2ZH1A 4LFBJ 3DU6A 1KQSR 2HMIA 4DFPA 4V1Ak 2GGPB 3K0JA 4ZDNA 3GSIA 2KN4A 4ZJLA 2RUSA 4KB7A 2ABYA 3JTOA 1IXKA 1IKVA 4C2MA 1EB0A 1QAIA 2R8GA 3B82A 4PQAA 2HBZB 3KK1B 1LXJA 4DOZA 3CJQA 4P6QA 5ETMA 4ZLJA 3UVJA 3M30B 3IS9B 1CJTA 3SZ2A 4USVA 4EI2A 2RF2A 2E1AA 1NEEA 3CCSS 1Q81T 2KL8A 1RJJA 3ET6A 3S01A 3RB0A 4WYWA 2OPRB 3A3OB 2IRXA 3PNIA 3IAM9 4F0MA 3PYFA 1SH0A 5C24A 4PRFA 1S57A 3CGIA 2KVIA 1NJXA 3RW7A 2HGNA 4ZCMA 3FSIA 2WVEA 4HKQA 4A48A 5GAHI 2IJNA 2V6AA 2W4DA 1FERA 4CLFA 3DLLQ 4UOCA 1DAXA 2IAJA 2CJBA 4XDDA 2ZBPA 4QYZJ 1T02A 3B78A 2N7CA 2LXIA 3V6JA 5IT9Y 2DB1A 2Q6BA 2XMUA 3UNGC 2V0NA 3TVZA 3UD4P 2HBYB 1TL5A 1ZM2A 2GFFA 1FXDA 3NCRA 5CZXA 1NSAA 2VF3A 3D6FB 2OFGX 4HI1A 3MMCA 2HFNA 3K57A 1GXTA 2C28A 4MMOA 1R6YA 2VG7A 1BQMA 4KR0B 5HMWA 4WFNQ 3CDWA 1MN7A 5GAGI 1IN0A 1JLFB 1WC5A 4ELUA 1JB0C 1MU2B 4M5IA 3OV7A 1SJ3P 5KFSA 5L46A 1BQNB 4NMXA 4AL7A 3KFWX 3L4BC 1S5ZA 4PG7A 2EKYA 1IBKF 1OMSA 2MLZA 2HQCA 3PHTA 2QE5A 4ES3A 3R5BA 3M8RA 2VODA 4OZ5A 1WEZA 3MUVP 2ERRA 3SXLA 2FZCB 4F3QA 4QR0A 5HJXA 1U45A 2R7WA 1GNKA 5B0GA 2QRRA 1FRHA 4WJBA 1S76D 2O01C 4C3MA 4RKUC 4KO0B 2RHQB 2MZJA 3M9MB 5GAEI 1LWEA 4R0EA 4RL1A 4KV8B 2NZ4A 4NI2B 4IDKA 4HI2A 1SJFA 2W24A 3NRBA 4AXJA 2EXUA 3Q86A 1RU1A 1LKZA 2BM0A 5FDLA 5SUHA 1C1CB 2LLZA 4XK8C 3D6MB 3NG8A 1Q5YA 1T9TA 2HPUA 4YB6A 1N52B 1U2CA 5C7PA 1LQ9A 4Y0FA 2CPJA 3BGUA 3M4XA 2M3DA 1X9SA 4OI6A 2DY9A 2DGXA 2PGCA 1RDRA 2FZKB 3FDSA 2LEPA 5K20B 3IGNA 1S1TA 1F2HA 3OTEA 1HR0F 5G0RA 2LEBA 2B4OA 2V4RA 4HR2A 4O3RA 4TU7A 4KKOB 3JQKA 3AD8C 2DHSA 4QOTA 2V8HA 4CNZA 4BDPA 3M9NB 4NA3A 4IO9Q 1G3OA 1WNEA 1VQKS 1MN9A 3Q8PB 1TK0A 3ZZUA 1RAGB 2I8EA 4CIOA 3Q23A 2DXEA 1RI7A 5B0FA 1FI4A 3OTOF 3OTCA 1PYSB 1NH7A 3QT7A 4I7FB 3KLIA 2I5JB 3G2XA 3Q8YA 5KT6A 3SSRA 3VGSA 1RHQB 3DMJA 2BJ8A 2VQFJ 1UVIA 1Q0NA 5A8RB 4ZN3A 3CDBA 3TAQA 2V8GA 4WE1B 3TUJC 2DHXA 3RAXA 2LQ5A 1HQUB 3E8OA 2J8SA 2KHCA 2HHUA 4OZ3A 3AT1B 2CNLB 4LRAA 3QNWB 4AQYF 3AA8A 3A8KA 4QIFA 2AGPA 5J2NA 1FDBA 4P2MA 3I0RA 2YX4A 4JI2F 3OJSA 3MM9B 2P9CA 1R8BA 3DLJA 2OJ3A 4OYZA 4PG8A 3TW0A 4DQSA 3OUYB 5ETQA 3BYPA 1FD8A 4PWDB 3DC2A 4DL3A 3L7PA 3M2VA 4IKAA 1FE4A 3N6MA 1UA1A 4QU6A 4PAAA 1HNZJ 4L3KA 2V4QA 2PI4A 4O3OA 2J6SA 1RCOB 5JUMA 2F9JA 4C0BA 2IBKA 3MDFA 3J7YU 4DR4J 2F8HA 1TL3A 1WI6A 1S9FA 2HGLA 1B4SA 2DNOA 2IPOB 3HJFA 3R5GA 2KG0A 3OLAA 3DOMA 4ZP6A 2HFOA 3GLJA 4OJ3A 3BDEA 4KT0C 4Q0BB 2A6OA 2OHDA 5U47A 4F3OA 2ACYA 1KD1T 5L1LA 2DRAA 2MZ1A 1S12A 4C3LA 1RT5A 5DQGA 1HYSA 3UDCA 3OBIA 5LOQA 1CJKB 3T41A 3CDUA 1FK9A 1I94J 3G8QA 1RT6A 1QY7A 3NNHA 2YXLA 3V4IB 2M8HA 1H6KX 2M88A 4WYLA 3TX8A 4ICLB 4YQWA 3OL6A 2KXNB 2BEFA 4RBVA 1SXLA 1ZPWX 5IWAF 1FDDA 4ILRA 2VUGA 4OZ1A 5BXIA 5KFUA 2JSXA 1GK8A 2QO3A 1O5JA 2R7QA 4O3QA 2AT1B 3EICA 1L3TA 2HS4A 3C16B 5B0DA 4Q2MA 2OPPA 1YZ6A 1HNVA 3VAKA 3NGSA 4CLLA 4FKYA 3A3PB 4PEOA 3TJ9A 2VICA 2B51A 1YRTA 3D3BJ 3OFFA 3QBCA 1B0TA 2X3GA 2DNPA 1XNQJ 3UE2A 1NK4A 3PYEA 4Y28C 3FC9A 2CKWA 3POTA 3TA0A 5KFCA 4UOFA 3RAMA 1VGYA 2GO8A 3EGZA 1CJVB 4RNMA 3H20A 2G2ZA 2NLWA 3D3CJ 4HT7A 4ZVTB 2EK1A 2DH7A 5KG5A 4JI0J 4B17A 3R97A 1NCLA 3AJ1A 2ZM6J 2E44A 3KHHA 4HDGA 1U0SA 4U7UD 4F25A 5B0AA 3BREA 3LOUA 2DNLA 1WTFA 4V19X 2DNMA 1N48A 5E2QA 1HWUA 4RNOA 1NSKL 1S72S 2D69A 1ZM3A 2BDPA 3T1HF 2JFDA 2VC0A 1XBWA 3LO3A 2HVEA 1DY3A 2MHEA 2RUGA 3NCQA 3QO9A 1TKXB 4L72B 1LOUA 2VDHA 2A2DA 2UVVA 1S0OA 1F3FA 4YDXA 1YJ7A 1UCNA 1WOOA 4J9NA 5IXUA 4KBIA 2HWHA 2EG2A 3DYAB 1JLQB 3AQOA 4PPDA 5CXTA 4ZPDA 2HNZA 2R8KA 2MXYA 4C97A 2BW7A 1RBAA 4LQ3A 3MAAA 3H5UA 5G4DA 1N33J 3GQCA 1MWZA 1HBNA 3EUNA 3L09A 4DFMA 3J81U 5L8RC 1JLAA 3D4JA 2F63A 3I55S 1O51A 4IR9A 5DJBA 4C8MA 3GJSB 2X51A 4XO0A 1QE1A 2J0QD 5HSPA 1N0UA 2DGUA 5LXYA 4B9MA 1N5YB 1LWCA 5ADZA 1K47A 4OX9J 3PY8A 1GH8A 2DGTA 3HO1A 3I9V9 3BR9A 4DPXA 3KHLA 3DXSX 4ED2A 4WIQA 1HLWA 1FRIA 3BGRB 3QIPB 2BQRA 3CC7S 1LWXA 2LDIA 4CH1A 5F9LA 2WVDA 9RUBA 2M5YA 3OLBA 2XHWA 3I9ZA 4DSFA 1VK8A 1EP4B 2HZAA 2QA1A 2J6UA 2F8MA 5HI7A 4J90A 3CUNA 2H5JB 1LV5A 5LL6d 1FRLA 4RUBA 1RWOB 3NXZA 4B3RJ 2VC1A 5H9EJ 1VBKA 4QCLA 4CH7A 4ELTA 3JQMA 3M8PA 3M32A 2QLJB 3MGJA 2FGCA 4A4JA 4LF5J 3DRSA 4X2BA 4M95A 2ZWPA 2MEWA 2DR5A 4LSNB 1RWNB 4KHRA 2A0FB 4B3OA 1W2IA 4DV7J 4OI0A 3MMAA 5M2UA 3CJTA 3TA1A 4DR2J 1XMOF 1B0VA 3BN7A 1WG1A 1ICEB 1C1BB 1GXLA 1OY9A 4Z7YA 4NYOA 1PAUB 2YNGA 2WW4A 3DOKB 2W7PA 1PC4A 1DQ9A 5DRKA 2EW9A 3CPWR 3ZXWA 1UWBA 1SJQA 4OL8A 2ZBQA 1FX4A 2B6AB 3FSYA 1T94A 2H4YB 2GQQA 2IM1A 3JQJA 1HBMA 4CP5A 5HQLA 1SUQB 1F5CA 1OSDA 3SSSA 1VRTA 1RTDB 4PUOB 4U96A 4K4UA 2YH1A 4QYZK 1HQEB 1Y5IB 1XNRJ 2FPHX 2WVFA 1RTHA 2ZOFA 2V8VA 3TWZA 2OI2A 3NMRA 2HVDA 1Y5LB 2FJEB 4G6VB 5KOXA 1VLOA 4ILMA 3NL0A 2RQ4A 3EVMA 2PO4A 3H2LA 4N8NA 1JLEB 3KG1A 1NUEA 2AYMA 2DNNA 5KFNA 1W26A 4E2FB 2C3OA 3H25A 4ECZA 4Q43A 2QL5B 1VJWA 3CJSA 1OY6A 3X1LB 3BS9A 2CPFA 1M1KT 1N34J 5I4MA 1K1SA 1SC3B 3DGPA 5L9XA 4J9KA 1RE1B 2ZBIA 3CCWA 1VYAA 4DX5A 3ENVA 4RW8A 4PR6A 1DTQB 4K5RA 3QT6A 1U0HA 3M6XA 2C2EA 2BZ2A 2E5GA 1IBCB 5BYQA 3UI3A 3MPYA 1RT1A 3MEDA 3HHLD 2R7UA 2GAGC 5E3CA 2Q6CA 3KLEB 3KUEA 3UQSA 5M2PA 1BMQB 2B7CB 4J9MA 2ZWOA 1S6PB 4IQXA 3W5XA 2Q66A 2E9ZA 3DOLB 3BB5A 4ZVOB 3D54A 2YVSA 4NCGB 3HPOA 3TYTA 3TZXA 4P2FA 4WKYA 4LR9A 4PZVA 2M52A 1BE4A 2A18A 4DZDA 1FRJA 5KFJA 2DH8A 2ASLA 2VQEJ 3K5LA 1TL7A 3THVA 8RUCA 2GIQA 5KFYA 2YQ0A 4YY3J 3VAFA 4U8YA 1QVGR 4H4OA 2NUUG 2GVDA 2AYGA 4ERDA 4C0HA 1WEXA 1FEEA 2K7JA 4K5SA 3LTOA 2GMLA 2B8QA 2J0SD 2BR0A 3IG1A 1HHTP 2LU2A 4NLXA 2YWHA 1V5VA 5K8PA 1A7GE 1S10A 2MQ8A 2NPIA 3I5CA 4FYVB 3BF4A 1O0PA 4ECUA 3HVWA 1PKUA 1ZZNA 3ZZZA 1SV5A 3ZTRA 1NU4A 2GGPA 3CC4S 3KYLA 3SQOP 2NXNA 3ZTOA 5CCLA 1FD2A 1PAEX 5T41A 1BLUA 2DHHA 2HK3A 4GMKA 3QT8A 4CNYA 2IRUA 4NWBA 4ES2A 2K8GA 1QUVA 2A2CA 2KT5A 3HLUA 2V9KA 3GYNA 4K4TA 2NYIA 2JWNA 3M30A 1X5TA 4K8RA 3CCJS 3TEHB 3SV4A 4NE9C 1XEZA 1RBLA 3HT3A 1KNZA 3FEZA 2GIRA 3PO5A 3FRZA 5J1PA 2OD6A 3CO0P 1NRKA 2H48B 4UQGA 5GMEA 1KS2A 4LF6F 2CJAA 1U4BA 4GKKF 4B9SA 1H73A 1QVFR 2DR8A 2G2YA 4DF4A 1OJ4A 5H9FJ 1X0FA 4TY9A 5DO2A 4DV4F 4C0OC 3KLHA 1SKWA 3CSKA 4O4GB
chains in the Genus database with same CATH topology
3I82A 3UCZP 3KLVA 3C6TA 1D0EA 1HBNB 3HZGA 3NAIA 4OZNA 3PFEA 1F5BA 1FNMA 1HWJA 4TY8B 2ASDA 1FKAF 1S1XA 2K2PA 2GA7A 2JLGA 2ALZA 5D4OA 5IM0B 4OX8A 4DLGA 2KFYA 1Q82T 3L7OA 4X4UA 2CPEA 4ECWA 2N82B 4FXWA 4Q8FA 2WOMB 2P9GA 4WIIA 1ZTTA 1DLOA 2QLXA 1VQPS 2C3PA 2EFQA 4OV1A 4BHQA 4KQZA 2QT7A 1SJRA 2L9NA 1QE1B 4H4MA 4EWTA 2D9PA 1N5TA 1MMLA 3KLGB 3O2IA 2HLTA 3QZ7A 4EUVA 1FNOA 4ZS6A 3IWLA 4OX7A 3M6UA 1LW2A 5L38A 2VL1A 4AFFA 5F41A 4OX9F 4Q45A 5I42A 1LWCB 1AFJA 3BN4A 4O4GA 2D1CA 4HDHA 3EZ5A 1KQFB 1P6TA 1E6VA 2CQ2A 3GE9A 4KAIA 3H5SA 1GXUA 2RMLA 2KU7A 1K0TA 1R43A 5D4PA 3BSOA 2AGQA 5KTQA 3MTKA 5KG7A 4QWDA 4OQJA 2NREA 4KE5A 1NK8A 1YSJA 4QWCA 1HA1A 2KRRA 2L48A 5T14A 5J2PB 5IM0A 3K8VA 1N8RT 2ROEA 3KG4A 1RGVA 1J5OB 3N5FA 5KFOA 4WKRA 1VI7A 2XMKA 3MZIA 2QZ8A 3T5LA 1Q8LA 1M5KC 3HHEA 4ETZA 4ED3A 1RT2A 5BYRA 3ETOA 3VAIA 1RT7B 4I69A 2WOMA 4ZKAA 5SZTA 4KHPF 1TK5A 1FVQA 1S49A 4PKDB 4I2QB 1VIOA 3NAHA 4C98A 1IM4A 1M5PC 2R7VA 3W3SA 2AYBA 3CE8A 4JI7F 2NR0A 4ZA1A 1JLFA 4FYDA 3DRPB 3IGVA 2YNFB 2UP1A 1KOOA 2YNIB 1YQHA 1C2PA 2R2UA 2GQ2A 2JOQA 2YH0A 2KM8C 1FKOB 2RQCA 1YRXA 1NKBA 1HNXF 1VQ5S 4FVCA 1F9FA 3F73A 3SEOA 2A1BA 2AP6A 4B3RF 3I4HX 4URQU 3PM9A 2XSJB 2N7YA 2XNQA 4TN2A 1ZBTA 3PXGa 2JLFA 5H1SV 4IR1A 4IH6A 4MYUA 4QIVA 1S7HA 1NB7A 3DLEB 4RNHA 2R8HA 3MR2A 2F4VF 4MIAA 2W7OA 5FIIA 1KRPA 4F02A 1Y4ZB 4ITSA 5J2PA 4PG5A 3KOAA 3GFHA 4ALZA 2X1GA 3DRYA 1J5OA 3RB6A 5E5NA 1M5OC 2LECA 2CDQA 1MSWD 4NLUA 1M5VC 3HP6A 3DRRB 4LF5F 3CJKA 1RT7A 4M8LA 2QA4G 1VK3A 5BYSA 2V2KA 4NZ0A 4YFUA 1PC5A 2DNYA 3DRSB 4A8XA 4I2QA 4D3GA 1JLGB 3MXHP 5HN0A 1JKHB 2E7WA 1H2VZ 1MWYA 1RYSA 4DV7F 2Z2LA 3N4WA 4CO5A 3MPWA 3BQ0A 2FIUA 3GIMA 3ENQA 1JLCB 3GILA 1M90T 4B3OB 1FDAA 4ID5A 2FUG9 3R1HA 2YNIA 5F8MA 1RT4B 3G6VA 1FKOA 3E01B 1JMTA 1FT8A 5HMZA 5ITHA 1TK8A 4N77A 1YJ9S 2GHWA 2VOOA 2EBGA 2FHKA 3M9OB 4IFVB 1R8HA 3MM6B 2B56A 4KHMA