1JLQB

Crystal structure of hiv-1 reverse transcriptase in complex with 739w94
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
425
structure length
405
Chain Sequence
b'IETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 RT, A-CHAIN
publication title 2-Amino-6-arylsulfonylbenzonitriles as non-nucleoside reverse transcriptase inhibitors of HIV-1.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Transferase
total genus 111
structure length 405
sequence length 425
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2001-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1jlqB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jlqB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jlqB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jlqB03
4M94A 2ASLA 4NLXA 1S9GB 3PW5A 2JEIA 3UR0A 2DPIA 4EO8A 3MR6A 3GIKA 5KFMA 1FK9A 3FFIB 4KO0B 1RT3B 3I0RA 4DL5A 1RT3A 3ITHA 4QWBA 4QWEA 3RAXA 1RTJA 4EO6A 3JSMB 1SV5A 2VG6A 4ECYA 2RF2B 5KFPA 4KKOB 4RNOA 2WTFA 4LSNA 4JV1A 4K4UA 4TLRA 3H5UA 4U7CA 5DQIA 1TVRB 5HBMA 3IS9B 4IFVA 2QV6A 1TVRA 5C5JA 2AX1A 3FDSA 3CWJA 5KT5A 4QWCA 2JEGA 3N6MA 3TQ1A 2ATLA 2BANB 3SFUA 1S1VB 4RW6A 1LWCA 3G6YA 3LAMA 4DG1B 4DG1A 4R5PA 3E01B 4B3OB 4H4MB 5C25A 1LWFB 1K1SA 4HYKA 1YVFA 4IQXA 4U6PA 2B6AB 4NLOA 3PR5B 5J2MA 1TL3A 4YMEA 1S1UB 3DLGA 2W9CB 5JXSA 4TQRA 1S1UA 1R0AB 1RT7A 4MFBB 4NLYA 3NBPB 3FSIA 1S0MA 1S0OA 4IH5A 3NBPA 2IM1A 4WXOA 1HYSA 1TV6A 2W8LA 2R2UA 2XCAA 4ECUA 2HNZA 3T5KA 3QO9B 3V81B 2ZKUA 3BSAA 1EP4B 4WFYA 1EETB 2IBKA 1EP4A 3CO9A 3BSOA 5F8IA 1RT1A 3KK1A 4O4GB 3TAMA 4LSLA 3CDEA 4ED8A 2JEFA 3MECB 3QZ7A 3M9OB 2V4QA 2YKMA 4NLVA 3V6KA 5KFVA 4NLPA 1S6PB 3CIZA 1S6PA 5KG0A 4ECWA 1N48A 4MK8A 2E9ZA 3LP0A 4M95A 4I7FB 3IRXA 3QLHB 1JIHA 3GQCA 2E9RX 1BQMB 2W9BA 2BRKA 3PW4A 3CJ0A 4Q44A 5KFGA 4KSEB 2R8IA 2ZE2B 4MK9A 1SH2A 4ZVGA 3V6JA 4KB7A 5F8JA 5J1EA 4K4WA 1JLFA 2OPPA 1TKTB 3M9MB 2R2TA 1TKTA 4IG3B 4NLSA 3QZ8A 3KOAA 3BSCA 4IG3A 2WONA 3QIPA 4G1QB 4F4YA 3GV5B 2WCXA 2HMIA 4RUCA 4ZP6A 2RDIA 4NLUA 1C1BB 1T05A 2FJXA 4EYIB 4JV2A 1C1BA 1RDRA 1NHVA 5K14B 3UPFA 3PHEA 3DRSB 5HLFB 4IFYA 1MU2A 3DRSA 5HLFA 2IM2A 3BQ0A 2I5JB 2UVRA 2AGOA 4I2QB 3RAQA 4NLWA 5KFLA 1QE1A 2FJWA 4MKBA 5L1KA 3G6VA 2W7PA 1FKOA 5F8NA 2V0NA 3M8PA 2AX0A 3MEEA 5KFOA 4YQWA 1JLCA 3OHBA 4EBCA 3PW2A 3MEGB 4NCGA 5F9LA 2ZD1B 2W9AA 2R8KA 5HP1B 2YNGB 1K1QA 3QIDA 4ED3A 3KLHB 5HP1A 4PQUA 3KLIB 2RDJA 3KLHA 2C2EA 4GC7A 3DRRB 1JKHA 1JX4A 3DRRA 1HNVA 4RW9A 3I5BA 2WOMA 5C42B 1U09A 3BGRA 3EPIA 4O3SA 3E51A 3KJVB 3JYTB 3CJ3A 1DTTA 1KHWA 1JLQB 1XR5A 5EWEA 3GIMA 4J9OA 3RB6A 3RB0A 1S1XA 4TYAA 2UVVA 1S1WB 3GV8B 4NZ0A 4URGA 2BQUA 1KHVA 1RYRA 3IG1B 2RKIB 3CDUA 1Z4UA 3IG1A 4RNFA 3BREA 3KHHA 4LQ9A 1TKZA 4ED0A 2BR0A 4ECRA 3PR4A 1IKXB 3DI6B 4KE5A 5KFQA 3MFIA 1HQUB 3DI6A 4H4OA 2R8HA 3OSPA 3C6UB 5KG1A 4K4SA 3I0SB 4O44A 3HVTB 1FKPA 4KFBB 4J9LA 1N6QB 2AGQA 2C2DA 1N6QA 4Q8FA 4NLGA 3I5AA 3LP1A 1S6QA 4IR9A 1RTDA 1LWEA 5KFBA 3Q8QB 1FK9B 4MKAA 5KG5A 5I42A 3IGNA 2IMWP 3I0RB 5J2QA 3KLGB 2WRMA 3ITHB 3KLGA 3GIIA 1RTJB 3IN5A 1RYSA 5J2PA 1SV5B 2VG6B 4NLQA 2YNIA 3I5CA 1TQLA 2YNFB 3M8QA 4ZHRA 3H59A 2YNFA 4LSNB 3SFGA 1IM4A 2XGPA 3CVKA 5HBMB 4IFVB 3CJ5A 3OL9A 4WZQA 4KHRA 2V9WA 5HROA 2BQRA 4J9RA 4Q45A 1C2PA 3VQSA 4MIBA 1IKYA 4RW6B 1LWCB 4NYZA 5DQHA 4WFZA 2XC9A 2XCPA 3T5HA 3MR2A 5DG7A 4KV8B 5KT3A 2C2RA 2CJQA 4KV8A 4R5PB 2HWHA 2HAIA 4DL4A 5C25B 4OL8A 3PW7A 4XO0A 1JXLA 1BQNA 4ID5B 3CDWA 3H2LA 5J2NA 4ID5A 4O3PA 5J2MB 4IRCA 2FLNA 1TL3B 2IC3A 3DLGB 4TYBA 3KHGA 3EZUA 3QYYA 1RT7B 4RW7B 2UVUA 3MEDA 4RW7A 4ZMMA 2AWZA 2FVSA 2E9TA 3FRZA 2HNDA 1HYSB 4LQ3A 3Q8RB 1TV6B 4WE1A 4FBUA 2HNZB 3HVAA 2W7OA 1IKWB 1IKWA 4J9PA 1RT1B 3KK1B 5I3UA 4J9SA 3TAMB 5KFXA 4LSLB 1HARA 1SH3A 1S49A 5KFSA 4ED1A 1RT6A 5KT4A 3LAKA 5KFZA 3DLEA 4R8UA 3GV7B 3DOLA 3EPGA 3BSNA 2DPJA 2YKMB 5KT7A 1DTQA 4URSA 3KHLA 4DL3A 4O3RA 2VG5A 2UVWA 2B5JA 3RB3A 3LP0B 4ECQA 3IRXB 2EC0A 1MMLA 1VRTA 4ZPBA 4H54A 2W9BB 1QAJA 5CYMB 5CYMA 4RZRA 1JLBA 2YNHB 4DEZA 2YNHA 4PUOB 2FVQA 4PUOA 1GX6A 1C1CA 4ZP8A 4DL2A 2UUWA 1S1TA 5J1EB 5DGBA 1JLFB 3ISNC 3MFHA 2OPPB 4ED6A 3NAHA 4NLRA 3OSNA 1N5YA 5KFRA 2WONB 3QIPB 1HPZB 4Y2CA 2HMIB 4URQU 1HPZA 2F8EX 4K50A 5KFKA 1T05B 4HKQA 4TQSA 1IKVA 4FS2A 4RW8B 2FVCA 4RW8A 1C0TA 3MF5A 3ICLA 3D5MA 4IFYB 1MU2B 2D3ZA 3PZPA 3KMQA 4IDKA 4JV0A 2CKWA 4ZP9A 2VG7A 1XR6A 3DRPA 4ZPCA 3DM2B 4Q0BA 3QGGA 2WK4A 3DM2A 4JUZA 1QE1B 1RT5B 4RW4B 1RT5A 4RW4A 3MTKA 5KFEA 4Y2AA 4IKAA 1FKOB 5KFAA 3KLEB 3KLEA 3M8PB 3MEEB 1JLCB 1UWBA 1LW0A 4NCGB 4IH7A 5KFUA 3OLBA 3PW0A 1S0NA 3BQ2A 1TL1A 5FDLA 4PQUB 4F4WA 4DL6A 4ZP7A 4TY9A 4RU9A 1HMVA 5DG9A 1JLGA 4ECZA 2IA6A 1JKHB 4IG0A 4PWDA 1D1UA 1HNVB 3QGIA 4RW9B 1CSJA 1S48A 2BE2A 2WOMB 4Y34A 4ED2A 2JLEA 3BGRB 4GC6A 4G3IA 1T94A 3V6HA 2D3UA 3G6XA 3KLVA 1SUQA 5DG8A 1DTTB 3DDKA 1ZTTA 1JLAA 2YKNB 4YP3A 5KT6A 5L1JA 2ALZA 1S1XB 2YKNA 1QUVA 1J5OA 3H4DA 1S9FA 1S97A 4IR1A 2QE5A 2FVPA 4KAIA 3BJYA 4WZMA 4TY8B 3PJXA 1WNEA 4TY8A 2J6TA 4YR2A 2OPSA 1LW2A 4MH8A 1TKZB 3H5XA 1C0UA 3UDLA 1RT4A 4K4VA 1RTHA 4H4OB 1HQEA 4F50A 3LALA 4O44B 2OPQA 1FKPB 2JC0A 1GX5A 4ECTA 1HNIA 3DYAA 3NKYA 5L1IA 4NRTA 4NLTA 1RA7A 1RT2A 5T14A 3LP1B 1S6QB 2I1RA 1RTDB 1LWEB 5KFIA 5DQGA 5I42B 3C6TA 1S4FA 2J6SA 4ZVEA 5J2QB 1VRUB 5EWGA 1VRUA 2OPRA 2XWYA 4WXWA 1NHUA 1REVA 3OL8A 2IM3A 5J2PB 3TVKA 4QWAA 4O3QA 2YNIB 5F8MA 3M8QB 4ZHRB 2R2SA 4QW9A 4QWDA 3FQLA 4ZVFA 3BQ1A 4J9MA 3RBEA 1JLEA 1KLMB 3HKWA 3Q8SB 5HROB 1KLMA 5KG2A 3H40A 4I2PA 5KG7A 4EEYA 2FLPA 3KLFA 1IKYB 3KK2A 4K4ZA 3H5YA 1S9GA 4MIAA 4QW8A 4EBEA 3HHKA 3GILA 2VA2A 3V6DB 1BQNB 3GYNA 3V6DA 3FFIA 5J2NB 2IJFA 4KO0A 1I6JA 4Q43A 4RNHA 4TN2A 4F4XA 2IC3B 5KG3A 4K4XA 3DMJB 5KG6A 3MEDB 3JSMA 3DMJA 3N6LA 4NRUA 3LP2B 3GIJA 3DLKB 2RF2A 3LP2A 3DLKA 2HNDB 4KKOA 3NAIA 4WE1B 3IS9A 3PVXA 3T5LA 5F8GA 4YR3A 3KNAA 5KFJA 1T3NA 5I3UB 2BANA 2AGPA 1S1VA 2IAJB 2WHOA 1W25A 2IAJA 3HVWA 1RT6B 1QAIA 3RBDA 3DLEB 4R8UB 5DLFA 3DOLB 2J6UA 1DLOB 1DLOA 4B3OA 3E01A 1N4LA 4H4MA 2ASDA 2UUTA 1DTQB 1LWFA 2OH2A 3T19A 2W8KA 2B6AA 3MR5A 2VG5B 2B5JB 3T5JA 2W9CA 5KFHA 5KFNA 5KFCA 1R0AA 5KFYA 4MFBA 4ZPDA 1RTIB 4ED7A 1RTIA 1VRTB 1RAJA 5DLGA 3H5SA 4RUAA 2IM0A 1ZTWA 2B43A 1JLBB 4O3NA 4IH6A 3QO9A 3V81A 2ASJA 1EETA 3H98A 1N56A 4TXSA 1C1CB 4RNMA 2AQ4A 3N6NA 1RA6A 4YR0A 1S1TB 4O4GA 1T03B 3IGVA 3CJ4A 1T03A 2D7SA 3MECA 4R0EA 1N5YB 4X2BA 3V4IB 3V4IA 1TP7A 3H4BA 1ZETA 2XI3A 2FVRA 4ECVA 3D28A 2V4RA 4QPXA 1IKVB 1XR7A 4XPEA 2GC8A 1C0TB 4F4ZA 2BQ3A 4I7FA 4KHMA 4J9KA 4NLDA 3QLHA 4IDKB 5CYQB 2ILYA 4IRDA 1SH0A 1BQMA 2VG7B 5CYQA 3DRPB 5F9NA 4EBDA 2AU0A 4Q0BB 2JEJA 5KG4A 4Q8EA 3OHAA 4IRKA 2FJVA 2ZE2A 5KFWA 3QGHA 5KT2A 3NL0A 3KMSA 3NGDA 1UWBB 1LW0B 3KHRA 4J9NA 4Y3CA 3SI8A 3KK3B 2XI2A 3KK3A 2R2RA 2FLLA 1TL1B 2HNYB 5FDLB 4G1QA 2HNYA 2VA3A 1HMVB 1JLGB 4IG0B 4XPCA 4PWDB 3CJ2A 5K14A 5KFFA 2XGQA 2BE2B 4RNNA 4FBTA 3MR3A 4ZVHA 4J9QA 2GIRA 2WB4A 2I5JA 1SUQB 5L9XA 4I2QA 5DGAA 1JLAB 5F8HA 1J5OB 2R8JA 4O3OA 3M9NB 3OLAA 3PJWA 2OPSB 1OS5A 2R8GA 1LW2B 3OL7A 4K4TA 5EWFA 3MEGA 5C24B 4WYLA 1C0UB 5EDWA 5C24A 1RT4B 2ZD1A 1RTHB 4IOBA 2YNGA 1S10A 1HQEB 4K4YA 5L1LA 3KLIA 3UQSA 2OPQB 2C22A 4EYHB 4ECSA 4WYWA 5KFTA 1HNIB 3DYAB 3NMAA 3G86A 5C42A 2HWIA 1RT2B 2IJNA 2O5DA 2D41A 3KJVA 3FQKA 3JYTA 3C6TB 5EUHA 4ZPAA 1JLQA 4ICLB 2JC1A 3LANA 2OPRB 4ICLA 1NNDA 1REVB 2C28A 1S1WA 4FS1A 4DL7A 2ILZA 4KBIA 3ISND 1D0EA 3BR9A 2BRLA 2RKIA 3Q8PB 3DOKB 3OL6A 1S9EB 3DOKA 5F8LA 1JLEB 4ECXA 1S9EA 4O4RA 3RB4A 5KFDA 4MK7A 1IKXA 1HQUA 5D3GB 1TKXB 3T1AA 4I2PB 3C6UA 5D3GA 1TKXA 4WFXA 5JUMA 3I0SA 3KLFB 3HVTA 2GIQA 4KFBA 3KK2B
chains in the Genus database with same CATH superfamily
2ASLA 3JQJA 5H9EK 4JI2J 3NCQA 2AZ3A 2ROGA 2MXYA 1E6VB 2E1CA 2QA4S 1L3KA 2K8GA 4DFPA 2D1CA 4OZ5A 3SCJE 3R2CJ 3RJMB 2CFXA 3JXOA 1LWFB 1FESA 1R89A 4OYXA 2KN4A 1T9YA 3FSIA 1S4EA 4C8NA 3D0HE 4M63A 1RHKB 1GNKA 1WSRA 3KK1A 1R6YA 2CUYA 2YKMA 1VS3A 4NI2A 4QIWD 2YH1A 1WTFA 4UW2A 1U2RA 5KFGA 4ZIWA 1SH2A 3CTRA 1ICEB 1RAIB 1FX2A 3BSCA 3U1MA 2CQHA 2FGCA 2RDIA 1F0XA 1FWLA 2FJAB 5LMUF 1ROFA 5L1KA 4KPYA 2CPYA 2DXFA 1NU4A 1I51B 1LFPA 4ZJOA 3KLIB 3AJ1A 1IBKJ 1YJVA 3CC2S 1UVLA 2E1RA 4O3SA 1J2VA 5EWEA 2E1AA 5IV3A 5IXUA 4URGA 3R9LA 2BQUA 3IG1B 4RNFA 1Q86T 4ED0A 1SB6A 2AGQA 3CB4A 4HACA 4OI3A 4DUYF 3HSJA 3W5ZA 3IN5A 2A1BA 3ZZTA 3HMJG 3U7JA 1IM4A 1X31C 3U02A 4QIEA 4JV5F 4OFZA 3SMZA 1IKYA 2UXBJ 3IAS9 3PRBA 3SCKE 1KSPA 7FDRA 2IVFB 3SSRA 2W7OA 1EKRA 1BLUA 2M7SA 3KK1B 4FXVA 2DY9A 1FVQA 2DPJA 1U0HA 2YKMB 4URSA 3SV4A 2DHXA 1KKHA 2RNEA 3RB3A 1G3OA 4DMZA 3K57A 2HFSA 1WEYA 1PG5B 5B0FA 3WQPA 3IR7B 2DH7A 5CABA 3MFHA 4ED6A 1XEZA 5K8MA 8AT1B 2MTLA 4ZCIA 2M52A 4K50A 1HPZA 3JB9k 3DLJA 3MOZA 2HYIB 2LFVA 5IT0A 2HZCA 2VG7A 1XR6A 3QGGA 3HSGA 4K2XA 1RT5B 1HLWA 4M5LA 1Q8LA 2OO4A 2JVOA 1SCJB 3T9ZA 4UY8T 1FF2A 1ELOA 4OV6A 3MUVP 2XG8A 4ED2A 1PJ7A 1P1TA 4GC6A 2M9KA 2G9OA 1SUQA 3CEDA 5L1JA 1UETA 1J5OA 1WF0A 4A8YA 1WC0A 4CLWA 2IBOA 3AOAA 1KD1T 1RU1A 1M5HA 4HACB 4RBVA 4NLTA 1RP5A 2J6SA 4DQPA 4YHHJ 4DFKA 3G8QA 4EEYA 2MQ8A 1IKYB 2C3UA 5E7OB 2DB1A 4C8LA 4KO0A 4DR1J 1UJ5A 5KOXA 3QT6A 1SJ3P 3CD0A 1W25A 1U0HB 1SQEA 5E0OA 4QCLA 3UE2A 1M5KC 3CD7A 5KFYA 2C42A 4FYXB 5IS2A 4U8VA 3QO9A 5ETKA 4O4GA 5L8RC 3A8JA 1UW4A 1KVJA 4ZDNA 2UV8G 3UN3A 2F8MA 2ZJPQ 1PYSB 3IM8A 2VG7B 4QJVA 1AUDA 4G1QA 1HBUA 3TYTA 3QATA 2V2VA 3D67A 3J81Y 7FD1A 5IFMA 1SUQB 2J7WA 4OZ1A 1J5OB 3FZBA 1YDLA 2N4DA 2WW4A 3ZZOA 2JWNA 2AYEA 4QYZJ 1WC3A 5KFTA 1KDNA 3GLJA 4C9DA 3ZTOA 4HDGA 4RX6A 4Y28C 1DARA 2BA9A 3RB4A 4B3RF 2CQ2A 3JTNA 4ES1A 1X4HA 4KO0B 4G1IA 4DL5A 2XWXA 4LF7J 5C5JA 4ANEA 3BH6B 1S57A 4W4MA 1U1MA 2JEGA 3N6MA 1UFWA 3OTOJ 2V68A 3KG0A 2D3O1 4NX9A 1HBNA 1RBLA 2PSZA 3MPWA 1NEEA 2HVDA 4TQRA 2RHQB 4CI0B 3D1OA 2N7CA 2XCAA 1NDCA 3QO9B 3HXMA 5A8RA 2IBKA 1BC6A 4TU7A 4O4GB 2C2ZB 4LBIA 3KJNB 3CDEA 2HFZA 4RWXA 4F04B 3MMJA 3K5MA 1YJUA 2J7KA 4AL5A 3P8BB 1T9XA 3CCRS 1UTAA 2B4UA 2I38A 3PW4A 3O8WA 4FDFA 2ZUGA 1RADB 4ZVUB 2R7RA 4P52A 1HWKA 3NGSA 4Y0FA 1HL6A 3BBBA 2KXHA 1WOSA 4G1QB 2LA6A 2PEBA 1HKAA 4OYOA 3TANA 1U0SA 2CIMA 2MEWA 1Y3KA 3W66A 4OYZA 3M8PA 3OHBA 3PW2A 1NPKA 2XS2A 3MCOA 2P8IA 4PG8A 3KLHB 3HP6A 1N0VC 2RJZA 3C15A 2AD9A 3OJUA 4WWSA 3TEHB 3H0PA 3MCSA 1KQKA 3VR1A 3MFIA 4J9LA 2KZZA 2BZ2A 1WELA 2ZH1A 3HZEA 1DY3A 3D6FB 1HBMA 3KLGB 1WG1A 4YUDA 2MLZA 1HBOA 2YNFB 4RUBA 1FD8A 3AH6A 3R3TA 1QTNB 4KQZA 2EKYA 5A0YA 4HDHA 4X4RA 4NYZA 3T5HA 1VBZA 4B9SA 2LDIA 1HBNB 5B0AA 5FLXU 1TUWA 2CG4A 2DHAA 2EFQA 2DHHA 3VGVA 2HNDA 1UEKA 3Q8RB 5ETLA 4Q5VA 3DOMA 5LT5A 2NUUG 4ETZA 5FLXY 1YI2S 3Q2SC 2VG5A 2FC8A 3JSBA 4ZPBA 4X84A 1PC4A 2VBWA 1M1GA 4Z37A 2YVSA 1K9MT 2F4VJ 2DBBA 3ZTPA 1U2FA 2F8EX 1GTHA 4CT9A 1H38A 1C0TA 3MF5A 3D5MA 1FX4A 3CJQA 2GHWA 2MHEA 2LU1A 3MPUB 2PGCA 2LMIA 1NKBA 1F9FA 2GIFA 3M8PB 3DKDA 1UWBA 1CJUA 4LR9A 4OHWA 1TMMA 3I4HX 2ZH8A 4BC9A 4WFAQ 4DL6A 1GXLA 5T7LA 2JJ4D 1CSJA 3EWGA 1N33J 4ELUA 1WJ9A 5EX0A 1H98A 3ILLA 2UUAF 5KT6A 3O2IA 1DQ9A 3US5A 2LECA 3FMWA 1BUXA 1A6LA 4I6YA 4ZN3A 2JC0A 2KVIA 4L74A 1HNIA 5KFIA 3ZZZA 1HBMB 3GU0A 3HJVA 2MHNA 2KFYA 3OFEA 3MPYA 4ZVFA 4J9MA 4L73A 5A0YB 1KLMB 2HHUA 1RTZA 1T9TA 1MWYA 1X0FA 5ITHA 5KG7A 1DFDA 4MIAA 2JFDA 3VF0B 3EUNA 4UQGA 4K8RA 1I6JA 2HAFA 4RNHA 3LP2A 2HNDB 4PG4A 5D4LA 5K8PA 4YR3A 2XMUA 1WC6A 4XK8C 3T1YJ 2HBRB 2C2NA 2VG5B 4GVLA 1NM2A 4MFBA 1RTIA 3BO3A 2DJWA 1ZTWA 1VHFA 4ETXA 3V81A 4FNHA 2AP6A 1UAWA 2XI3A 4ECVA 3NG8A 2VFUA 2OTJS 1C0TB 4I0WA 4KHMA 4DV0J 2V2ZA 4I1TA 2IMOA 3LW5C 1NB7A 2DR9A 1UWBB 4J9NA 2DGQA 1CJUB 1ZM2A 2QX0A 5T7LB 2NSCA 2QYCA 5M2UA 5KFFA 3AA8A 5DDQC 1AFJA 4NZ6A 2EK6A 3G8SA 2R8GA 4K4TA 5EDWA 4P7VA 2G0IA 2LLZA 1HNIB 3NMAA 3PX4A 2FLOA 4ICLA 4DL7A 1TL4A 1Q8IA 3KDNA 1ZAWA 2A6OA 3OD2A 4GVBA 4DN0A 2XMMA 3BZQA 3C6UA 4M5JA 4N5SA 1SIWB 3R8YA 2WW8A 4OV1A 2QMUB 5H9FJ 4RW6A 1B0VA 5DDRC 2ZUAA 4O0IA 1CULB 5BR8F 5C25A 1N5VA 1R43A 3PR5B 4AXJA 3DLGA 1RT7A 4MFBB 2IM1A 4WXOA 3NS6A 1LOUA 4EU0A 3V81B 1EP4A 1GT8A 3H7HB 3ZTQA 2JEFA 4DL0C 4L3NA 2NXUA 1AFIA 4L75A 5J1EA 2R2TA 5IOLA 2WONA 1OO0B 2GQQA 5ETNA 4X64F 1NSAA 1C1BA 3GB0A 3N79A 1MU2A 4OX9F 1RBAA 1CC7A 4CH7A 3M30B 2CZVC 2ZHBA 1XNRJ 2FJEB 2AW0A 3QIDA 2WVEA 3BN7A 3MUMP 2CQCA 1WEZA 3FZ2A 2R9LA 3SSSA 2XY6A 4ELTA 2BM1A 3V2UC 3TW0A 2XZTB 3FJ2A 4OI0A 5IWAF 4U96A 3BREA 3DFEA 4LQ9A 1TKZA 2MKCA 3C6UB 1KS2A 2V8GA 2MGZB 1N6QB 4USIA 1BY9A 2EW9A 1RE1B 4MKVA 3BDPA 3TZYA 1KNZA 4DQQA 3GIIA 3M8QA 4ITSA 3IA0A 2LQ8A 2XGPA 2B4OA 1RSCA 4LF9J 2BW2A 3ILJA 4YB7A 3NY0A 3HI9A 3PV8A 4RW6B 4B3MF 4LSZB 1HI1A 2CJQA 3UDEA 4GKJJ 5C25B 4A8SA 4O3PA 3U27A 4CLTA 3F44A 3DLGB 2ZFHA 1RT7B 1HFEL 2X51A 1KP6A 2AJ4A 5B0EA 4QYRA 5GAHI 1APSA 2YQ0A 3R27A 1RISA 2N82B 2EBGA 1TL5A 2AV5A 2VFTA 3ZNUA 3PM9A 2JLFA 2YNHB 1DHMA 1GEHA 2RMLA 5J1EB 2CYYA 1EZZB 1N5YA 2AF6A 1H73A 2WONB 1J5EJ 2JDJA 3RR7A 4JI2F 1MU2B 3ENQA 3AOBA 3ISZA 5ETRA 2IYGA 3DM2B 1M5PC 1FDBA 1WWHA 3FK4A 2OKQA 3POTA 3BH7B 3W8GA 2M0GB 3FGVA 3VQTA 3LGMA 3NOGA 4ZCKA 1TKZB 2HPUA 3NGTA 2EEYA 3IR6B 4NRTA 5T14A 2I1RA 3BO4A 4KGMA 4USVA 2IM3A 3TVKA 2YWFA 1X5OA 3M8QB 2YBVA 2ZZTA 2GQCA 2DD8S 1Q8KA 2QTWA 5GAHU 2XHWA 1CJVA 1R8AA 2PE8A 3RYLA 1UJ6A 5DRKA 3D6TB 2PMHA 2EK1A 3DLKB 1TMJA 3NAIA 4JBCA 2WSEC 2BANA 1Q95G 1U1QA 1T8EA 1I94J 4CIOA 1IBKF 4H4MA 3T19A 1YBAA 3EXCX 3T5JA 4Z7YA 3NNAA 2QLJB 3H5SA 2DIVA 3CUNA 4DV7J 1V6HA 2AQ4A 3J7ZT 3P5BP 1N5YB 4DR4J 4F4ZA 1UFLA 3P4UB 3QLHA 5KG4A 4WKRA 4J9VA 3OHAA 1UEVA 2O67A 3C19A 2DCUB 4WU3A 3NGDA 2PI5A 2LEAA 3LQVA 2HNYA 4U9RA 2UXBF 3FUYA 3POTB 2QO3A 2GIRA 4KIAA 4K0KJ 5IQ6A 2ZOMA 5C24A 2XYHB 2W2NP 1X4BA 2C22A 4WYWA 2POKA 5HQMA 3NGKA 4OYWA 5JJBA 1F2GA 1UKUA 2V94A 3D4JA 1S1WA 2MY8A 2YWKA 3DOKB 2BABA 2J8AA 1OY9A 5D3GA 3C2PA 1J27A 1S97A 2ZC4A 2QJ3A 1CJVB 1FRKA 1S7IA 3N9UC 3RBZA 1HWIA 5KFPA 4AXIA 1QAYA 4HHUA 4DS4A 3CC4S 3TQ1A 3MOJB 2N7YA 2BANB 2MKHA 4V1Ak 4H4MB 1DAXA 2Z58B 4IQXA 3RAMA 4TU9A 3TX8A 4B3TJ 1HYSA 6AT1B 4CLPA 2MJUA 1FDAA 3CT9A 3GJTB 1VHIA 3GG1A 2V63A 1VQ5S 2V4QA 2M88A 3V6KA 4LF8J 3T1HJ 4XDCA 3CCWA 2MQOA 3QLHB 3LWMA 2KKHA 5HVGA 3BGLA 4M5HA 4YHHF 2DXDA 3OR2B 1UL3A 4BDPA 4KB7A 4FNIA 1PBAA 2E1PA 2J9CA 2OPPA 2CQPA 3MEKA 3QIPA 3T6JA 2WCXA 4ZP6A 4GO7X 3O1LA 3UR3C 2KT2A 2LXIA 4Y00A 2B7CB 5HP1B 2C2EA 1HHQA 3I32A 1JKHA 1XJWB 1JX4A 3EPIA 1F5AA 5AXNA 2LQ9A 4FVMA 1S1WB 3B54A 3PFEA 4JI8J 5AT1B 3FVYA 3PR4A 2COLA 3H2UB 1ZOTA 2RQ4A 2WVDA 1U6FA 4MKAA 1FEHA 2IMWP 1U1PA 2BW7A 4LF4J 1YZ6A 4RPFA 2D9PA 2AMCB 3BKTA 1UFKA 4CO5A 5DQHA 9ATCB 4I64A 3Q24A 3D66A 4Q2LA 1HYSB 2A18A 4LQ3A 4FXDA 5HATA 2WB1D 3RBXA 2RU3A 5I3UA 4J9SA 1S49A 1I3OB 4MIWA 4DX5A 5EX3A 2DIUA 4HI1A 4HTJA 1RU2A 4EUVA 1SC1B 2V8PA 1V5VA 1S7HA 3AHPA 2K3IA 4PYAA 2OPPB 2PO4A 3ZZRA 3QIPB 2QLWA 4E0DA 1JJCB 3TJ9A 3ICLA 4C3MA 1B7FA 4QYZK 3KMQA 3FBFA 1NJZA 2J8SA 4JUZA 4LF7F 3MTKA 1Q8BA 1DBDA 5KFAA 1K0VA 1ACMB 1JMTA 1RAAB 3OTOF 3Q8VA 2E5LJ 5ETTA 1JKHB 4HR2A 4USMA 4UUWA 2DR7A 1Y3JA 1JXEA 3KLVA 3F0NA 4RR5A 2FVPA 2P9CA 3PYFA 2WZ1A 4YB6A 3UDLA 4ALZA 1NJYA 2CPZA 5HMWA 1PAEX 2VQEJ 1YJNS 1CJKA 4N47A 5AE1A 3BQ1A 1VLYA 4Y2KA 1JLEA 5IC6B 2B56A 4ES2A 2QL5B 4EFAC 4OX8A 3I96A 5KG3A 2OFHX 4HVZA 5BYQA 2RE1A 4C8YA 5CQGA 5I3UB 2F7VA 1GXUA 4DSKA 2HVIA 2IAJA 5ETPA 5DLFA 5E5NA 2NZ4A 4B3OA 3E01A 2ZNYA 1LKZA 2DY1A 3NP5A 4OZJA 1SIZA 5MLCV 2HQIA 3GSDA 4TXSA 3LPYA 2E5HA 3B82A 3H4BA 4QPXA 1WORA 2W4PA 4P10A 3MCMA 4ES3A 5F9NA 2F40A 3A8KA 1VK3A 2VASA 1IUJA 4WIQA 1WTBA 3QRRA 1Y00A 2XO7A 2A3JA 4XPCA 3IRWP 2VFVA 4NA1A 4R25A 4C8ZA 4PYDA 5DZ6A 2HS0A 3LH2S 2KJVA 4DF4A 1NO8A 1P9QC 3QPIA 2ZM6J 3HFVA 3MEGA 1X9MA 1CBKA 2UXDJ 1CVJA 5L38A 2HZAA 5FIIA 2XMTA 1S59A 2QLXA 1CJKB 4FXWA 3H90A 3G87A 3Q8PB 3RG6A 4ECXA 1JLEB 3CJRA 3DU5A 2F4VF 3BF4A 2KG1A 3CC7S 2JEIA 2KTQA 2DPIA 3A3OB 2MQQA 2GQ2A 3TUJC 3W2VA 3CWJA 4Z7CA 1JJ4A 1LQ9A 1UPMB 2PIIA 2DK2A 3SFUA 2DRAA 2VC0A 4DN9A 4B3OB 3E01B 3QJLA 4MT1A 1V9OA 3TA1A 1N33F 3L3CA 5GADI 3TNVA 2CA9A 3OFGA 4N7TA 2RSQA 4ED8A 3K5LA 1IXKA 1CEZA 1FRXA 3ZNJ1 1VQPS 2KHCA 4CO1A 3GQCA 2M3DA 4F2SA 3MM7B 2PC6A 4Q44A 2ADCA 4OLOA 1TFWA 1MG7A 4NYPA 2V34A 4NZ7A 4N8NA 4PXCA 1YITS 3BQ0A 4X65J 3WX8A 3RAQA 4CZCA 5CXTA 2QA1A 5HJXA 3UD3P 3MEGB 1X4AA 1SBRA 3T1YF 1M90T 3R5AA 2DGOA 2KJWA 1FRIA 2HHWA 1L3TA 3GIMA 1XR5A 3RB6A 2NXNA 3PO4A 3RGIA 1VOMA 3EJMA 5B09A 2AJFE 3CDUA 3KHHA 3G4SS 3DI6B 1FT8A 5KFQA 4JI4J 3KKFA 3M8ZA 1RHRB 4IR9A 1RTDA 2BKNA 5KFBA 1LFWA 4PRFA 5D8HB 2HK3A 2WRMA 4DV0F 1S6UA 2FYXA 5GADU 3BGFA 2L08A 4KHRA 2LEBA 3W1YC 5IT4A 3GZ7A 2MKKA 2A10A 1NK8A 2IHR1 3PYDA 3BB5A 3BYPA 1BQNA 3H2LA 2FLNA 2H51B 4M5NA 3KHGA 2P5VA 5HMZA 4ZMMA 1F2HA 5K5MA 5BYRA 4LR8A 5L39A 3EZOA 4KGKA 4WFBQ 2MZ1A 3PEJA 3HZGA 2FY8A 3BSNA 1V3SA 1DTQA 2RS8A 2F63A 2WVFA 3OTCA 5C7PA 3ILOA 2IIHA 4RZRA 1JLBA 4P6QA 1D9DA 3NAHA 3OSNA 2VFRA 2EC2A 4HKQA 4RW8B 2VPXB 5CHCB 2XNRA 2EI5A 2WK4A 2M2BA 4RW4B 2Z0GA 3W63A 2CDQA 2W2QP 5GVQA 3KLEA 5KFUA 4RUHA 1ZM4A 4Q2MA 1YTYA 1DQ8A 3ET6A 1CQNA 1X4FA 4YP3A 5D78A 4X66J 2BOAA 2QLBB 4TY8A 2BJ9A 2XNQA 4K4VA 2HEKA 1OSDA 5H9FK 4DPYA 1RTDB 2ZITA 5BJRA 1X7VA 1S4FA 2B9EA 3KUHA 5C2CA 1NRKA 2C2MB 4CH0S 4HH0A 4C97A 1Y11A 4U7UK 5GMKa 3UN5A 2NXJA 1FD2A 4OQJA 3VGTA 2LQ5A 1BQNB 4Q43A 4UOHA 3OVBA 4K4XA 3DMJB 3JSMA 3Q86A 2AYBA 5AJ3J 3AOCA 3TR5A 1XNRF 4LVOP 1R8CA 1T0TV 1XWLA 3QMQA 5LJ5Y 1DLOA 1G1XA 3OQ2A 2UUTA 1DTQB 1RAOA 1WOOA 4MMOA 1SJQA 3LGHA 3DN9A 3TAPA 1JLBB 4O3NA 3KUGA 4NASA 4PQAA 1EETA 2CNKB 3LTOA 1Y10A 1FJGJ 1WHXA 2OHDA 1DZ5A 5ETMA 1EJ7L 4OMFG 5CYQA 3HO1A 3HJFA 4LF9F 4B3SJ 2Y9HA 5A6WA 2XMAA 4GKJF 3ET6B 4F3QA 2QSWA 4ZVHA 2WB4A 3A1YG 4P75A 2R8JA 2BXJA 3HHLA 3PJWA 3OL7A 2BV3A 3VAJA 2XEXA 1Q53A 2OEKA 3A12A 1UVNA 4N41A 5MAOA 4FF1A 2MMYA 1NNDA 1MWZA 4ID8A 1Z2LA 1IR1A 1CQMA 1KTQA 2MZRA 1S9EA 3UNYA 4C0HA 1F60B 2WSFC 4JOUA 3W60A 1T11A 4M94A 1UCNA 3H2VE 2BJEA 1U25A 1J5EF 2R7VA 2Y3YA 4UUXA 3KWMA 1RT3A 2VPYB 3JSMB 5DS7A 2QZ8A 1B0TA 5ETOA 2HRUA 1NK9A 2HBQB 3G6YA 1M5SA 3MUTP 2Z2ZA 4K5RA 1S1UA 2XMKA 4ANDA 2AJ0A 3AB2B 4XTTA 4CLKA 1EETB 3K59A 2FJDB 5A8KB 1S6PB 3QGPA 4E98A 4DCPB 1B7YB 4RKUC 1KR4A 1LWXA 3V6JA 3PACA 4PR6A 1TKTB 5CZXA 2YWHA 4YOEA 4JI1J 2ERRA 3TJAA 3M8WA 3EGNA 3CPWR 2VL1A 4NLWA 1ZAXA 3M8YA 2ZH2A 1N5SA 3HHLB 2AX0A 3MEEA 1K73T 4V19X 4NCGA 4IOCQ 1I94F 4M5KA 1AXQA 4FPRA 1B0PA 3ZZ0A 5F0WA 1VR6A 3DLHA 3FSXA 4DV7F 2VFSA 4NA2A 3EDRB 3LA0A 4QIFA 3MMAA 3I5AA 4DR4F 2KYXA 4W92B 2VODA 3SCIE 2OGUA 1IM6A 3HSZA 3CMAS 4WZQA 3LPEA 2BQRA 3IMQJ 2VKRA 1QTMA 3MR2A 1G6BA 1TR0A 3EZ5A 1XNQF 3TWZA 1JXLA 3QSYB 4QZVB 2CVEA 4ID5A 2KYZA 4TYBA 3BKUA 2CQDA 1SJFA 4K0KF 2RT3A 1O8BA 2QGFB 3GPAA 1IKWB 3X1LB 4DXLA 1SH3A 1T9UA 2XBPA 5KT4A 4R8UA 5KT7A 4DV5J 3KHLA 4DL3A 5LOQA 3KJQB 4ECQA 4OYBA 2RQMA 1Q7YT 2KI2A 2ZOGA 2AJQA 2FVQA 1OMSA 1C1CA 1TFYA 1S1TA 3I56S 4F26A 2C3OA 2BJ3A 5F41A 4F8RA 4HEA9 1YX2A 4LF5J 4WP8A 3W62A 4IDKA 2I2YA 1UVIA 3G82A 4ZP9A 3UDCA 5KFEA 1AYEA 2GAHC 3MEEB 4NCGB 3M4XA 2UXCJ 4Y34A 2ALYB 4G3IA 2L9WA 2YKNA 3MGJA 3NRBA 4B3TF 2I0XA 3OW2R 5HVHA 1UVKA 1KWMA 2J6TA 1YKWA 2K2PA 2HHTA 4PXDA 2GJIA 3JSYA 4PPZA 3MMAB 4X4QA 3DYAA 1JWWA 4LF8F 3T1HF 1XTZA 4DX8H 2XWYA 2FY1A 5JMNA 4UZCA 3O3LA 2CPFA 3FQLA 1HR0J 2O3DA 3Q8SB 2KXFA 2F65A 3KLFA 3CDAA 3GCXP 2HURA 2O66A 3V6DB 3FFIA 1YK9A 3GJRB 3W8PA 1RHMB 5M2PA 3T5LA 1NPRA 1D9FA 2MSSA 4CO0A 2NUHA 4R8UB 4KGZB 2ASDA 1IWAA 1Y9OA 4ZVQB 3OVSA 1R0AA 1UA0A 3CJTA 1RAJA 1PBUA 1ZA2B 1P1LA 1UWAA 1C1CB 4JI8F 3GFXA 3U1LA 1S1TB 2BDPA 1QSYA 1T03A 1RAFB 2V8HA 1L3SA 3V4IB 2C3PA 4C0BA 4U95A 2F1FA 4C0OC 3V4MA 4IDKB 3I55S 3G82B 1OIAA 2EVZA 1U7LA 1WG4A 4LF4F 3QGHA 5EGYA 2EFPA 3QWPA 4W90B 4HHJA 2LVWA 3JQMA 4WYLA 2J9EA 2CZ4A 2L48A 3UQSA 4EYHB 3C46A 3DYAB 4DR5J 3M6VA 4GRSA 2GW8A 1KN6A 2PFFB 4TKTA 4KTQA 2GO9A 4G6VB 3VGSA 3KLFB 4L3KA 3DRYA 2DGTA 4DOZA 3FFIB 4A8WA 4USJC 2LXUA 2CPDA 2WTFA 4FZVA 2E7WA 1TVRB 5KT5A 1M0SA 1GFWB 1BMQB 2E5LF 4DG1A 1YVFA 4U6PA 1SVDA 5BYSA 1R0AB 2QLFB 3NBPA 2P6SA 4M1KA 2ZJQQ 3BSAA 5AXMA 3D0GE 2VPZB 2GNKA 2H5EA 1C4CA 4DSJA 1QVGR 3ULHA 3ZTSA 1U6BA 2VQEF 2BEFA 2HQFA 4CO2A 3DRXA 3J7Z5 2CQ3A 2R8IA 3QBCA 2DNKA 2BOPA 4KPCA 3M8RA 4LF1A 2DXEA 3HCXA 3DC2A 1XMQF 3DRSB 3CIMA 2IM2A 4ZPTR 1KFDA 1P9YA 4ED5A 2QC3A 3G6VA 3VAKA 3JQKA 4M5DA 3RRGA 3GWCA 2RDJA 4DLEA 4GC7A 1O5JA 3VAMA 1FFGB 1VFJA 3W9HA 2Z4PA 4CCHA 3FCHA 2UVVA 1AA1B 2MZQA 4CO3A 3EGWB 2EXUA 2G0CA 2JNJA 3UW1A 2BMBA 4ZJLA 4UOFA 2V2QA 2C2DA 1WKJA 3UFCX 1W2BR 3G9CA 3EGVA 5J2PA 4QIVA 4KH1B 4I69A 3CMQA 2PEHA 5GAGI 5HROA 1YLXA 1NMEB 1XMOJ 3TZXA 1TAUA 1KQGB 2B4VA 2C1EB 4KV8B 1ZA1B 1FXRA 3PW7A 3IWNC 4C11B 4AE5A 2EG2A 3IO1A 2YX4A 4DU7A 3HVAA 3AODA 4ATNA 2ZM6F 3UCZP 1NK6A 2UXDF 3DOLA 1IJFB 2HLUA 2EC0A 1MMLA 1VRTA 1GX6A 2UUWA 3AFGA 3PDNA 3FCWA 1REGX 1F1BB 4RO0A 5KFKA 3AXMA 3ZFVA 1X9WA 4ZS6A 3PZPA 1JK9B 2CZ9A 2DT9A 3TUPA 4JI5J 3M6XA 4Y2AA 4USUA 1QD1A 4ER8A 4M5DB 2KHDA 9RUBA 1FO1A 4KRWA 4FF2A 3D6HB 5LM7E 4YN3B 3G6XA 2HVEA 1QUVA 3R7BB 5DETA 3R5JB 2J9DA 1RCXB 5GAGU 1GX5A 4EK2A 3WX4A 4QIGA 1RUSA 4WXWA 3HT3A 5J2PB 3UN2A 4QW9A 3EDQB 1YG0A 3FNNA 5HROB 4WCEQ 3H40A 3LUYA 2FLPA 2W1BA 2B4PA 5A76A 2Y1RI 2MZJA 2QG9B 3GYNA 4LFAJ 2ZC3A 4KC5A 2KZMA 2X7IA 4PG5A 4X65F 3DLLQ 5F8GA 3SQOP 4LBHA 2AGPA 4R0JA 3DOLB 4NEYA 4LRCA 1VRTB 1GQEA 1MW7A 1U6ZA 2RU9A 2B7BB 4DS5A 1DQAA 3N6NA 3L95X 1S72S 2IJRA 2DVIA 4JI4F 4X2BA 3W65A 4CNYA 3GG0A 4ZVTB 2MQMA 3ZZPA 2C2OB 2IVYA 1ZAVA 1FRJA 4USKA 3KMSA 1UZDA 3C66A 3KK3A 2R2RA 2VA3A 2H1YA 2IDEA 2DNYA 4RJVA 1X4EA 5AXKA 1G4CA 4M8LA 1YJ7A 2NQPA 1VMBA 1SKRA 2NYHA 3R6LB 3ONQA 2IJNA 2JLGA 1F9HA 3FC9A 4AL6A 2YKQA 4NWBA 1FRLA 3VZIA 1UVJA 1OJ4A 1DRZA 4O0NA 3I0SA 2GIQA 4JI3J 4P74A 5HN0A 4Y2MA 2QMWA 2ZBRA 4PXBA 4ECYA 4BLGA 2CQGA 1U47A 3H5UA 3S1TA 4ZVRB 2ATLA 4USWA 4RLEA 5GAEU 3MD3A 4OYAA 1HA1A 5AE3A 2OSQA 4R5PA 2KFNA 3E3XA 1S0MA 4WK3A 3NNCA 4X66F 4P2MA 2DNOA 3PX0A 2K1RA 2R7UA 5K8OA 1R31A 3Q89A 2GA7A 4NI2B 1SC6A 2ATCB 2E44A 2DGUA 2OIHA 4P2XA 3VAGA 1RWXB 1U48A 4DR3J 1JIHA 1RKIA 2YH0A 4N77A 3CJ8A 2KVQE 4ZVGA 1N52B 2VZ9A 2G0JA 3GV5B 4FP9A 2CQ0A 3PRDA 1T05A 3TEGA 2U2FA 5HMXA 3UPFA 2XULA 1RKJA 1TK8A 2UVRA 3MMCA 2FJWA 4L76A 4ZCMA 2VU5A 2LA4A 4LJMA 1NAQA 2KM8C 5AJ3F 1I1GA 1UPPA 3N28A 1RXOB 1M1KT 3GV8B 3RRKA 4DSEA 1NDKA 3L7UA 1O51A 3C8YA 4KE5A 1FJGF 4FKXA 4OX7A 2DYAA 4K4SA 3I0SB 4K5SA 4NLGA 3L9ZA 2QT7A 1T95A 4DSLA 3SZ2A 2W2OP 3AD7C 5DZ7A 3OL9A 2HBZB 3HK2A 5A6PA 3L4BC 1VQ4S 2XCPA 2W25A 4OHZA 4B3SF 4R5PB 2HWHA 2OFGX 2MB0B 1A0OB 3EZUA 3GP9A 4RW7A 1U1RA 1U8WA 3TX0A 2HIYA 4USHA 2K1RB 3AXKA 5KFXA 4KGVB 3EYZA 1WC1A 3RU0A 4B9LA 2H48B 3NLCA 2B5JA 1RWVB 1U24A 4WBFA 1NH7A 4K7QA 4PUOA 3W9JA 1U2CA 1F3VA 3IWXA 1FJEB 1HPZB 3Q83A 2E1MC 1T05B 4FPIA 1RAHB 4OJ3A 3VAIA 2ZHAA 2D3ZA 1FVSA 3J81U 4C48A 2V4JA 3MMCB 2OUGA 2M8HA 5IC4B 1LW0A 4IH7A 3PW0A 1EB0A 1R8PA 2JHEA 5KAKA 1XMBA 4DFJA 3OTEA 1VBYA 1IVZA 4LRFA 3DDKA 3GYXB 1RHUB 2QE5A 2HQ3A 4ILLA 1MSWD 4HT7A 3CMES 1RA7A 2AEJA 5EWGA 1VRUA 1NHUA 3D6MB 2HFUA 2K7KA 1XQIA 4A48A 1WHYA 2DO0A 4JI1F 3DNCA 2RHSB 2DNPA 5BXIA 2BVZA 4KY3A 3OTBA 4BCAA 3GIJA 1F6TA 4C3KA 4F2RA 1MMNA 4NXNJ 3R7NB 3PXGa 2CNNB 2G1DA 2KO1A 2MLXA 1O6XA 4LFBJ 1N4LA 4OYMA 2B6AA 2B5JB 3VTIA 2L3MA 1IJEB 5T41A 1B64A 4TNOA 2CWKA 3D1QA 4YR0A 2L41A 3CJ4A 4LMZA 1C4AA 3P96A 2BX6A 1H2UX 3R5DA 3CCLS 2ILYA 1NK0A 3GJSB 5CAAA 1LW0B 5F3TA 1H7XA 3SQGA 2FLLA 2RVJA 1HBUB 1QM9A 4OZLA 2P9GA 2XY7A 3MM5A 1B99A 1VQSA 4OIXA 1Q79A 4QOTA 2W01A 3BR8A 4IOBA 4X4UA 4NPOA 4K4YA 3LOUA 4QR0A 1CPZA 2IRUA 3H8YA 1CG2A 4DDFA 2NPIA 4DV5F 3K5NA 3FQKA 4ZVSB 4WK1A 1PO6A 4KBIA 2BRLA 2BBEA 4DJBA 5F8LA 4EMDA 1WUUA 5GMDA 3HVTA 4LF5F 3UWTA 3I0RA 3RAXA 2CQ1A 1ZH5A 4CLZA 4JV1A 3TA2A 4FN5A 1HW9A 2Y8YA 3GONA 2B51A 3G8TA 2B6AB 3K8VA 3QWUA 2UXCF 3NWRA 1GTEA 3WC0A 5A8RB 2AYMA 3TAMA 1G2EA 1IN0A 2MDAA 2RILA 3KFWX 5LMNJ 2VJVA 3G71S 3VZHA 2E9RX 3FRYA 2GHPA 2BRKA 3SYZA 3MAHA 1RWUA 3M32A 1HR0F 1S12A 1ZZNA 1FCAA 4NLSA 4IG3A 3SQGB 3C14A 2F9JA 2G2OA 1OSCA 1SL0A 1NHVA 5JVGQ 4IFYA 3P49B 5HLFA 4NCAA 3K17A 2H4WB 3NXZA 1FNXH 3MM5B 2W7PA 1JLCA 3D1HA 1F5CA 4ED3A 2ASYA 4C98A 3O44A 3PJ9A 1WSVA 2VD3A 3C15B 3DRRA 3I5BA 3MM9A 2GV1A 3ETMA 4B9VA 2OSRA 1PILA 3J7A1 2FHJA 1AB8A 3X3UA 1RYRA 3E8OA 2HFNA 2LCWA 3HVTB 3K5PA 4PKDB 1URRA 2J0WA 3TO8A 2JH3A 5KG5A 3I0RB 1N0UA 2OJ3A 1MNEA 1HBOB 5IV4A 2YNIA 5HQ8A 1FEEA 3HHLC 1OWXA 2V9WA 4Q45A 2HK2A 4WFZA 4D3GA 3MURP 3PKYA 4OL8A 1SKSA 3CCES 3EVWA 1L3UA 3M1VA 4ZIVA 3DOMB 3TAMB 2JSXA 1HARA 1R0BG 5KFSA 1YHQS 3GV7B 4C8OA 3GJQB 1U26A 3KTQA 4KH0B 2FIUA 2DR5A 4DR5F 1QAJA 5CYMA 1OQ3A 1VQ9S 1PAUB 4ZKAA 1YQHA 4ILMA 5B08A 3O5TB 4JI6J 4Y2CA 3C14B 1IKVA 3GSIA 2E5IA 4IFYB 2OEMA 1UJ4A 4DQSA 4DX6A 4B9MA 5D0EA 1VC5A 2P9EA 2RRNA 3TUZC 1JLCB 1NH8A 5FDLA 5G0RA 4ZP7A 3NGUA 3VCDA 2DGXA 3MM9B 3MPDA 1Q81T 3V6HA 4DX7A 2OP5A 2VBZA 2M70A 4F3OA 3EE3A 2XMVA 3GFYA 1LW2A 2H65B 2C2KB 1KQFB 2XZDB 4LREA 2NXCA 2W4CA 1X5TA 2Q79A 5CYJA 2YNIB 3WDOA 4PWUA 1IQTA 1YJWS 2CVIA 2FDNA 4DCOB 1P27B 3ILIA 1NJXA 3KUEA 1NPPA 2W2PP 5KG6A 4NRUA 3LP2B 1SC3B 3W5XA 3M1VB 3KXDA 2VBYA 2WVCA 3GR1A 3HVWA 1CJTA 1GK8A 3HFKA 2MKJA 4CLUA 3SV3A 2IPOB 2DNMA 4UOGA 1RTIB 1A7GE 5DLGA 5DM7Q 2IM0A 1GMWD 2Z2MA 4WTOB 1N54B 2O01C 2Y1IA 1K0TA 3MECA 5A8WA 3AD9C 4Y65A 1IKVB 4BBYA 3MCNA 2A2DA 4USTA 3UCGA 2GMJA 3HHEA 1RGVA 2ZE2A 5LXRA 2EFGA 4P2FA 2MPUA 3KHRA 4OI1A 5EHHA 3SI8A 3D3BJ 1XMOF 5FDLB 4X62J 3CJ2A 4MAKA 2AYGA 2I6WA 4QR1A 2CJKA 2CJ9A 1LW2B 5EWFA 2YNGA 3IWLA 3MWBA 2DNLA 1VGYA 3G86A 5C42A 2PDAA 2YWGA 2V2KA 3JYTA 1KRPA 1RWPB 4ZPAA 4ICLB 1A9NB 2C28A 2V6AA 2RKIA 5U47A 4GVBB 2NLWA 2U1AA 1TKXA 5JUMA 1UEUA 3BEGB 4WJBA 5IM0A 3SDEA 3P3DA 2XY5A 1Y5NB 4QWEA 1L5UA 1VQYA 2FUG9 2EKNA 3TOQA 3MM8A 4JI5F 3FDSA 3Q2TC 2IRYA 1YZ7A 3N01A 3JS9A 1CJTB 4DV6J 2ZWPA 2DNGA 1GH8A 3OTDA 1EP4B 3IBFB 4B17A 1MLAA 3RUBL 4DU8A 3MECB 3HT0A 3FMBA 5A8WB 3WZ0A 3CIZA 4WKYA 1WACA 3SIPB 2AJ1A 2VOPA 2FD2A 2AHOB 2ZE2B 1JLFA 4C2MA 2EFNA 5D0RA 4F3MA 4NLUA 1C1BB 8RUCA 4UT4A 4EYIB 4TVAB 2FHJD 5LXYA 4HHHA 3I87A 2QMXA 4LFAF 1NZ8A 1MWQA 2MSTA 3W64A 3H42A 2Z2YB 2PI4A 4YQWA 1YJRA 3N4WA 2W9AA 4DR6F 2YNGB 4PQUA 3RTVA 3V5RA 5C42B 1RZMA 2LU2A 3E51A 1IBCB 3JYTB 4M5MA 1VQ8S 2RKIB 1Z4UA 3IG1A 1M5OC 2UUCJ 4YDDB 3OSPA 5KG1A 1RJJA 1Y0HA 3CCZA 3DCAA 5IM0B 3SDEB 3EX7B 1VQ6S 5SZTA 4BS2A 2VPWB 3MR7A 5I4MA 4NLQA 4ZHRA 3H59A 3MM8B 1UMJA 3OR1A 4NXMJ 1GMUA 2XC9A 5KT3A 4OYIA 4DV1J 5J2NA 2IYIA 2UVUA 3MEDA 2XSFA 3OV7A 2FVSA 2VDIA 1X4GA 1NB2A 3MM6A 2CRLA 3L7PA 4ED1A 1ZPVA 2CQIA 1SJ4P 4ERDA 3I6PA 4ZP8A 2DNRA 2OMOA 3UDVA 4WP3A 3VVTA 1JLFB 1U4BA 4X4TA 2UU9J 3BGOP 3SXLA 3QT5A 1JB0C 4FS2A 4JI3F 2QL7B 1NLKL 2NR0A 2CKWA 4ZPCA 3GIRA 1RT5A 4J7CA 1NDLA 3OLBA 5E3QA 3HD1A 4KR0B 4PQUB 1IBLJ 1XNQJ 2IA6A 3QGIA 1PCAA 4DQIA 1VQNS 4WPAA 1VLOA 2ZDOA 1T3NA 1KOOA 1S9FA 3BJYA 4KAIA 4WZMA 3PJXA 3K0JA 1WNEA 3N5FA 2LXFA 4BWMA 4MH8A 3H5XA 1KTVA 3BV8A 4F50A 3Q8UA 4N76A 2LQJA 5D77A 1RLCL 3TVZA 1H3DA 4LUBA 4DR3F 2OPRA 3OL8A 4ZHRB 2R2SA 1FJCA 2NYIA 3OR1B 5KG2A 1RI7A 4JYAJ 3M6WA 3M7VA 3I9V9 1SQFA 4NA3A 1S9GA 5J2NB 1FI4A 3GE9A 3MEDB 6FD1A 4F0MA 2VUGA 3GFHA 2ZVSA 3MM6B 3QT8A 2GMHA 1S1VA 3QNWB 1QAIA 3RBDA 1XN9A 3HLUA 3CJKA 2DNNA 3FEZA 2DNZA 5KFHA 4JI7J 3PTWA 2R42A 5D4NA 4IUFA 2B0GA 3H98A 3FBEA 2D7SA 1TP7A 3UCUP 4PCQA 4FYVB 3BPDA 2DISA 4I7FA 3AD8C 4P7TA 1SH0A 3HM9A 2JEJA 2Q3PA 5AE2A 4FF3A 5KT2A 2DHGA 2DEJA 2CPXA 1YRXA 1KONA 2HNYB 3KYLA 2FPHX 2K7JA 1H7WA 4FBTA 3MR3A 2I5JA 3BPSP 4O3OA 2MQLA 3CCVS 2ZBPA 5C24B 4X4VA 2AIRB 4DR7J 3QSIA 2RH3A 1QLNA 3T41A 2HWIA 2MKIA 1HI8A 4DV3J 4N8OA 2OPRB 4I4BA 1OQ6A 2ILZA 2HGMA 2OD6A 3CULA 5D3GB 3T1AA 1WI6A 3THVA 2CPJA 1S9GB 1ZM3A 4ILRA 3FBBA 4LSNA 4QU6A 1HQ2A 5DQIA 2HG4A 1IBMJ 1S1VB 5E3AA 2FQQB 3CJKB 3M2VA 2ADBA 3K89A 4A46A 4EZ6A 3MTJA 3VWSA 3T5KA 4WFYA 2ZKUA 1K8AT 3BSOA 4LSLA 4K2JA 3QZ7A 4MJKA 5G4DA 4ZJQA 1EARA 1QAXA 4I7FB 1PYOB 2D3OR 2MZSA 2DNHA 1NJWA 4OLPA 4MYUA 3G2XA 2HMIA 1N36J 4JV2A 2L9NA 3AAWB 1X9SA 1E6YA 2HFVA 2F5GA 1IR2A 2I5JB 1X8DA 3S8SA 4FYWB 1SL2A 2DGWA 4NXNF 3DGVA 5F9LA 3NCPA 3KLHA 4OZ2A 1H74A 4LFBF 3BGRA 2HS3A 4ENOA 2HHQA 2QSFA 1KHWA 4CM0A 3R7SB 4CRJA 3CCTA 1BQXA 4WU2A 3B4MA 4QBUA 3P6YC 3AT1B 4E8UA 1FKPA 1DURA 4FYYB 4IQMA 5E41A 1FNOA 3KLGA 1RYSA 2FC9A 1WDDA 2YNFA 4LSNB 3ZTRA 4J9RA 2ZHOA 1C2PA 4MIBA 4DSIA 1TUGB 1KVIA 1XMQJ 1XBWA 2G1HA 2Z2LA 2HAIA 3M2VB 4V19J 2IC3A 3D9BA 1YRUA 2X1BA 1UP1A 4XDDA 4LSLB 2E7VA 4C4WA 5DDOC 3EPGA 3LGNA 2X1FA 3M6UA 2H5IB 1NSPA 1BWEA 2GCFA 4H4KA 5F3ZA 4KJIA 4DEZA 4GKKJ 2GGPA 1YWXA 2HMIB 4PXEA 3FEXB 4LR7A 1NDPA 1VQ7S 1E6YB 4DBQA 4Q0BA 1V5IB 1FWPA 2C3MA 4YB1P 3HF5A 4WP9A 2CJXB 5DG9A 4IG0A 3QFHA 3BGRB 2AZ1A 1U1NA 1WKKA 2QA4G 4UY85 3R5CA 3EXYA 4U8YA 2J76E 1FKPB 5LMNF 3NKYA 2YX7A 4DCJB 4L72B 1P8GA 1UA1A 5F8MA 3IAM9 3RBEA 2PMZD 1KLMA 2FJBB 2R7XA 2XLKA 4A4JA 4K4ZA 2CJBA 3R2DJ 3PKMA 4TN2A 2IC3B 1S77D 1ZZFA 1VQOS 3D68A 5B0BA 5KFJA 1XERA 2IAJB 3ZXWA 1U1KA 2VF3A 3ZZYA 5D0GA 1T9VA 4ED7A 1N32J 3OXLA 2GVDA 4IH6A 3JAMU 2KM8B 3OPKA 2GMLA 2GGPB 3FBCA 2ZBCA 1N5QA 3ZC4A 1TKDA 3K58A 2RQKA 2VC1A 4XPEA 1NCLA 1RHQB 2CJAA 4NLDA 3TQEA 4EBDA 2AU0A 4Q0BB 4F4AA 1AT1B 1YGYA 3JAMY 4IRKA 5D4PA 3AJDA 3TARA 3NL0A 2Q1LA 3HPOA 1I5OB 5J1PA 4IG0B 5K14A 5KOWA 2YX1A 3O6QA 2BYCA 3CCUS 1JNRB 2HZVA 5DGAA 5DJBA 3OLAA 1Y5LB 1KOHA 3NNHA 2QRRA 2XSJA 1LK7A 3K8WA 5LJ3Y 3KG4A 4CQ1A 3KJVA 1TU0B 2PMWA 2YY3A 4MK7A 2WVBA 1K44A 2F8HA 4GMKA 1HNWJ 4KFBA 4JI6F 1H72C 4AQYJ 2B9YA 4UTGA 1Q16B 3W2VB 4QWBA 2DCLA 2DGVA 4EO6A 2VH7A 1SJ1A 2X3GA 4RNOA 1HD0A 1VYAA 3GFZA 2H5JB 4UQTA 4CNZA 2Q6BA 1KFSA 4OX6A 1CULA 2XZWA 3D54A 2BKPA 4JP8A 4NLOA 3JSRA 1OPIA 4CLSA 1S0OA 3B78A 2OI2A 1PGZA 4JB8B 2HNZA 2GVDB 3FEYB 4JI0J 3TZZA 4P71A 1RHJB 2YPZA 4NLVA 3VVUA 4MK8A 2NZCA 1B3TA 4ZPWR 4BC7A 5GMEA 2ZH7A 3G96A 2VV5A 2CADA 2LQBA 4Z2XA 4MTPA 3HHDA 1VRQC 4ZCLA 3IBWA 5K14B 2HHSA 3PHEA 4ZVPB 2EG1A 2MKSA 1ITPA 2AGOA 1HIYA 4YY3J 1EIYB 3GTYX 4EZ9A 3S01A 2O1PA 4DZDA 3M30A 4WFNQ 1NK5A 2XSJB 4AYBD 3UI3A 2G13A 3QAUA 2PD1A 3VV2B 5D6GA 3KJVB 3C3LA 1DTTA 2J7UA 1WHWA 2KDOA 2HBYB 1PYTA 4Y6IA 4ECRA 4B9NA 4CLLA 2GS8A 3N5BA 3QQCD 4KFBB 4KHPJ 2MGZA 1N6QA 5E3PA 1SKUB 2VIHA 3IGNA 4O23A 1LNQA 1QSLA 3I5CA 1QY7A 2XS7A 2ROEA 1EX8A 4X62F 3BO2A 2YKAA 3CDWA 2YQ3A 2YQ1A 3M2RA 2E66A 2AWZA 2FHMA 2HNZB 2SXLA 2MZTA 1NUEA 2YTCA 4DPXA 2AT1B 2RS2A 3LAKA 3DLEA 2HQCA 3PIOQ 2NCKL 5ADZA 3A3PB 1H0HB 2YNHA 5ETSA 4AD6A 4KYZA 3MAQA 4NLRA 1X60A 4URQU 2B9XA 3RW6A 4EWTA 4DLGA 1GXTA 2GO8A 3DRPA 2CAJA 2Z8QA 3DM2A 5C2GA 4IKAA 3KLEB 3R1HA 3CGIA 3AQPA 2XO6A 1TL1A 2QYGA 4LT6A 2YPYA 4ECZA 4PWDA 2ACYA 3WC2A 1T94A 2R7WA 1FDNA 1N56A 1DTTB 3QT7A 4DV6F 1TELA 4TY8B 3QRPA 1M1HA 2X1GA 2XMJA 4B08A 5HL7Q 4ZLJA 3BKFA 1JNZB 4HLBA 4P9SA 4QWAA 3MI7X 3MPVA 4O3QA 4OHXA 5SUHA 2DRDA 2UUBJ 1TZ0A 4I2PA 4OZ3A 2R7SA 4WIIA 3KK2A 1Q78A 2DKOB 2APOA 2I8EA 2M4MA 3M2RB 2GAGC 2JL9A 2RF2A 3DLKA 4KKOA 2NS1B 4F36A 2N4CA 4CT8A 1S99A 3KNAA 5F0UA 3PCOB 1QVFR 2VICA 2KT3A 3DLEB 4F7VA 4DPTA 1DLOB 4YS2A 4DHVA 2HHHJ 1YJ9S 2B43A 3QJPA 2XMWA 4RNMA 4HH1A 2UUCF 4CLFA 2G2ZA 3EM1A 1XR7A 4HL9A 5AXLA 2HRYA 4MYTA 5CYQB 3FCVA 1RWMB 4IRDA 3DRPB 1S6OA 4ED4A 3VGUA 1FTRA 3CO0P 1MN9A 4LBPA 2ZH3A 3F73A 3OFHA 1X0PA 2XI2A 2N3OA 1NSQA 4NXMF 4M5GA 7AT1B 1TL1B 1S0VA 4UF4A 4PWDB 3DHWC 4DV1F 1K47A 2W7AA 4J9QA 1R7IA 4IO9Q 5F8HA 2BJ7A 3M9NB 4F0KA 1P6TA 1T7PA 2PT0A 5L1LA 1X5PA 3CSKA 2V5HG 4DUZJ 3MMBA 3CXCR 3I82A 2JC1A 1SC4B 2A6MA 1RWNB 3P45B 1D0EA 3ENAA 2ZZNA 1S9EB 3DOKA 2XQCA 4ZN1A 3CD5A 4A8XA 4NOHA 4I2PB 2UU9F 2DEIA 3KK2B 2E7XA 3PW5A 1R3NA 3HD2A 2Q43A 5E3RA 1BD6A 1FK9A 2Y1JA 4LFCJ 1RT3B 2RQCA 3ITHA 3W5YA 1VJWA 4OYPA 2BJ8A 2RF2B 4KKOB 1HNXJ 4IFVA 2QV6A 1XC9A 1VCTA 3LAMA 2LYVA 1IBLF 2VJUA 3UVJA 4A8FA 1YBUA 1NSKL 1BE4A 5J2MA 2HSEB 1S1UB 5JXSA 4B9UA 1O0PA 1KLNA 2W8LA 2W4DA 5LSRA 4DR2J 1URNA 2CPEA 2E9ZA 3VAHA 4P72A 2IY5B 3R1LA 4C8KA 4KSEB 1X5SA 2Z56B 3OR2A 4OHVA 2C3YA 2JFKA 3TZWA 3DGPA 1TUVA 2Y8WA 4JYAF 2ABYA 3S7RA 1KBRA 2XYPB 1FKAF 2JRSA 4QR2A 3L7OA 2KRBA 2IRXA 1F3FA 2EFVA 2HHPA 2D74B 3IM9A 5HP1A 4YDXA 3CJSA 2DO4A 1JQGA 1U09A 3MMBB 3TJ8A 2AEMA 2LEPA 3RB0A 4JI7F 2ZH9A 2VHGA 1R27B 1TAQA 2M5YA 4O44A 2HLTA 3W61A 1FK9B 2CQ4A 3ITHB 2G4BA 1W26A 3A13A 2Y0SD 2ZH4A 4IFVB 3GYGA 4DV2J 4A47A 3UVJB 4Q8FA 4ID5B 2GZOA 3ZO7A 5J2MB 1WC5A 1VDHA 4ANCA 4DPWA 3AY0A 2ACMA 3T6BA 4J9PA 1NKEA 2VQFJ 1R8BA 3NS5A 2BE9B 3MHYA 2GFFA 4CP5A 4DR7F 3P5TL 2CPHA 3J7YI 2XB2D 1B4SA 2UVWA 1NHKL 3K2YA 4DV3F 3H25A 4H54A 1VBXA 1V3RA 2YKPA 3NS7B 3K5OA 4DL2A 3Q8YA 4B9TA 3DGPB 1N8RT 3GR0A 2V69A 2FVCA 1YIJS 4PG7A 2K06A 2KL8A 3NMRA 3AJ2A 4DR1F 1IBMF 3NGRA 2RAQA 1EQ0A 4TY9A 1HMVA 2B8PA 1DJ0A 2FZCB 1D3WA 2DR6A 5DG8A 1RACB 2YKNB 4IR1A 1TTHB 4OJGA 4Q7AA 1C0UA 1RTHA 3UNGC 1VQLS 1B70B 2V67A 1MROA 1N34J 4O44B 2YWEA 5HK4A 3WIVA 3J81j 2QFIA 5D4OA 4QWDA 4DV4J 4NEZA 1WKLA 1RK8A 1HHSA 3WHIA 3H5YA 4YEAA 1F9EB 4QW8A 1N36F 3J7YU 2H3EB 1WOPA 3GILA 4RBTA 1TK0A 4ELVA 3HFZB 1VQMS 3N6LA 2M8DB 3IS9A 2MLYA 2DH9A 3BN4A 2RB7A 2FZGB 1RQ0A 1HD1A 3MR5A 4CM2A 2P2CB 3TAQA 4ZPDA 1T03B 3IGVA 5LSOA 1FXDA 2HS4A 3F56A 2FVRA 2V4RA 1NXIA 5L46A 2GC8A 2F3JA 4OJHA 2BQ3A 1AROP 3OXFA 1TL7A 3FKBA 2PFDA 2OMLA 1BQMA 2IFXA 1Q0NA 3C16A 2FJVA 1VIOA 3NWGA 4X4NA 4Y3CA 2EWHA 3M2UA 4IYQA 4OI4A 5HSPA 3TUIC 5HJYA 1HMVB 2ZDPA 2XGQA 2JZ5A 4ZPVR 1C0UB 2OELA 3AQOA 2ZD1A 1RTHB 1S10A 1MROB 2VKZG 3H20A 3NCRA 4OZ0A 3PY8A 4PPDA 2AJ2A 4DPOA 1WG5A 1JLQA 2VB6A 3EGZA 4FS1A 4QQBA 3ISND 4DF8A 1D09B 4GKKF 3OL6A 1YBTA 4O4RA 5KFDA 3IC1A 1HQUA 5KTQA 2V50A 1U45A 3CNQP 4OZNA 4EO8A 3MR6A 5CH7B 5KFMA 1HNZJ 3J7AN 1FERA 1RTJA 3EMTA 2WAQD 4LF6J 2VG6A 2KH9A 3NEKA 3IS9B 3PHTA 2UV8A 4J91A 1LWCA 1HWUA 1NBEB 4N56A 3ZZUA 4DG1B 1Y7PA 3PYEA 2MQNA 1OYDA 2QN6B 1U8SA 2P6TA 4NLYA 3NBPB 4IH5A 4FKYA 1TV6A 3A8EA 4ZITA 3CO9A 4F67A 1RT1A 2B3TB 3A8IA 1FNMA 1Y5IB 5ETVA 2BUNA 4HI2A 1W2IA 3PRVA 4OJ1A 5KFVA 2D9OA 4M95A 1TL7B 1IR0A 2EPIA 1BQMB 3HDSA 4CH1A 2CNOB 3C16B 3CJ0A 3MM7A 4MK9A 4C3LA 2NXEA 3PIPQ 4E2FB 2XLJA 4RBUA 3QZ8A 3M2UB 3KOAA 4F4YA 3D7SB 4I6WA 4A8QA 1RDRA 3CCMS 1IQZA 4P2SA 4FVCA 3BS9A 1VC6A 1QE1A 3ENWA 1FKOA 5F8NA 3DU6A 4RWWA 4LIWA 4EBCA 4S0MA 1YJTA 1FRMA 3EICA 2B9WA 4I68A 2ZD1B 2ZBIA 4ZOSA 1HI0P 3R5BA 3DXSX 4RW9A 1T3OA 3JTOA 1JLQB 5B0CA 1S1XA 4TYAA 1N32F 4NMLA 1ZPWX 2ZVIA 1HQUB 3DI6A 4H4OA 3M05A 4A8MP 1WI8A 2A0FB 3TP2A 3LP1A 1LWEA 2ROPA 2RRBA 1RTJB 2VG6B 4HTIA 1TQLA 3SFGA 1KC8T 5CCMA 2RIJA 5E33A 1SPBP 1Y4ZB 1LWCB 2FGOA 3OT9A 2G2YA 2E5JA 3HX9A 4UZBA 1SJRA 3SCLE 2H9ZA 2E9TA 2R7TA 3A4TA 1TV6B 4FBUA 4PEOA 1X4CA 4DR6J 3DDIA 5H9EJ 1RT1B 2CNLB 2L9DA 4LVNP 1PC5A 4FF4A 3I9ZA 2NSBA 2ZJRQ 1V3ZA 1U49A 1RBOB 5IQQA 2JOQA 2B8QA 3B8HA 5K20B 2KRRA 2MQPA 3HHNB 2EFOA 2IA0A 3VAFA 5DGBA 3EVOA 5GAEI 2BJDA 2XHCA 3B4DA 2Z30B 1WEXA 1HNWF 4XIUA 4AQYF 4RW8A 1BGXT 2Z57B 5J1NA 5I3PA 1QE1B 4RW4A 3IXQA 1FKOB 1AUSL 2OD4A 3CE8A 1S0NA 2OAUA 3BQ2A 4RU9A 2RRAA 1JLGA 1D1UA 4X4PA 4RW9B 2QL9B 2D3UA 1JLAA 2ALZA 3WBZA 1S1XB 4QPTA 1G7CB 5CCLA 4Y2IA 5HO4A 1PSDA 4YR2A 2ZNZA 4JI0F 1RT4A 3K7RA 4H4OB 1HQEA 3LALA 3BYRA 2CXEA 4LF2A 3TVYA 8ATCB 3LP1B 1LWEB 5DQGA 3QAEA 5L9NA 3C6TA 1S5ZA 3RZAA 5DDPC 4EI2A 3RW7A 3MDFA 3BBFA 3DLBA 5LSLA 1PJ5A 2DNQA 1S79A 5RUBA 2HQDA 4PABA 2J0XA 5LMUJ 3DMJA 3ELHA 1NK7A 1WC4A 4YY3F 2BE7D 1ZM9A 5HAOA 1W7WA 3PYGA 1LK5A 2RDDA 2WHOA 3R5GA 3CW2C 2OH2A 3LO3A 2RD5C 1FE0A 2W8KA 4AL7A 2GVZA 2AEFA 2XLIA 2UZAA 1AZSA 4OHYA 2J0SD 2R4FA 1RA6A 1CS4A 6FDRA 2DHSA 4G1PA 1ZETA 4AT1B 3D28A 4KHPF 3SSQA 1WF1A 2W24A 1D8YA 4DUYJ 3SEOA 2PA8D 4J9KA 1T02A 3D2WA 4F4KA 1PJ6A 3AA9A 1M5VC 4JV5J 5HANA 2J5AA 3KK3B 1UZHA 5D15A 1VK8A 4ZA1A 1JLGB 2ZZMA 4LRBA 2CWXA 2W2MP 3DXBA 4H4KC 1JLAB 4J37A 3QJJA 3KG1A 1KQSR 1RAEB 1RT4B 1FHTA 1HQEB 3EVMA 2DTJA 2VOOA 3C6TB 3BM7A 3PO5A 3UD5A 3S6EA 2J9DE 3BR9A 1ZYQA 4K59A 2OLWA 1FWKA 4J9UE 1IKXA 1HHTP 4KT0C 3GIKA 4OI2A 3W7BA 2F4FA 1U02A 4K4UA 4U7CA 2AX1A 5K9FA 3ETOA 4ZK7M 5FD1A 5IT9U 1UW9A 1K1SA 2HVZA 4YMEA 2QEXS 2GVZB 2LKZA 1AZSB 1WDTA 2ZWOA 4ECUA 4RU2A 1VQKS 5F8IA 2VDHA 1CS4B 1L3VA 5A8KA 5CZVA 3M9OB 5IT9Y 3MXHP 2MJNA 4NLPA 1S6PA 5KG0A 1N48A 3BDEA 3OVAA 3JTPA 3LF0A 4I67A 5F8JA 1TKTA 2UUBF 1U1OA 4ZLLA 4RUCA 2FJXA 4F02A 1SXLA 4A8OA 2R7OA 1Z1ZA 1NZAA 1LEOA 2WBRA 4MKBA 3UO0A 4DWIA 2V0NA 2HGLA 5KFOA 2R3VA 5HVFA 1OY8A 2CPIA 2R8KA 2KFZA 2HRTA 1HWJA 3OUYA 2HHHF 1KVKA 3CJ3A 2Q66A 4NZ0A 2V9KA 4I56A 4TU8A 1KHVA 5K8NA 1JXVA 2BR0A 1IKXB 2DGSA 3I31A 2HFOA 2HHVA 3DHXA 2H4YB 1FA0A 1R8HA 5J2QA 2OTLS 3PNIA 2KU7A 5ETQA 3KNGA 1BHNA 1D8ZA 2X3DA 1HWLA 2YWWA 2C2RA 3RR8A 5D0HA 4DL4A 3IBCB 4D3HA 3QYYA 4RW7B 4C7QA 1VI7A 1X4DA 1EAYC 4WE1A 3CD6S 4CTAA 1IKWA 1RT6A 5KFZA 2F9DA 2X1AA 4DUZF 2FHKA 2DH8A 4PUOB 4B3RJ 4BHQA 3KJFB 4YFUA 4WF9Q 3THPA 1N5TA 2N3LA 2K3KA 3E2EA 1PIEA 1UVMA 4JV0A 3I4PA 4LFCF 5HMYA 2V4JB 1FFWB 3HVRA 1RB0A 1HNXF 1GMWA 4UOCA 3QRQA 3MAAA 4F4WA 1H2VZ 2J0QD 3OUYB 1S48A 2JLEA 4IO1A 2WSCC 4CLYA 4FYDA 5CD4A 1XK8A 2V8VA 1ZTTA 3H4DA 1KEKA 3IR5B 2OPSA 4DR2F 4IOAQ 4ECTA 2LDYA 5L1IA 2BM0A 1CC8A 4LRDA 5J2QB 1VRUB 4XAKA 4C6AA 2GX8A 3HKWA 4DFMA 1NK4A 2HHXA 4EBEA 1AW0A 2XS5A 3V6DA 2IJFA 3A3NB 1SI9A 1U1LA 1Z2ZA 2E29A 3THTA 4WE1B 4CTAB 2KXNB 1NJIT 4QU7A 2KT5A 1RT6B 2Q6CA 2R7QA 5A2QU 2W9CA 1N88A 5KFNA 5KFCA 3CCQS 4DZ6A 4RUAA 1OYEA 1LXJA 2ASJA 3RRHA 1FJ7A 2RUGA 4R0EA 3MD1A 3V4IA 5A2QY 3LWLA 4KGXB 2YKOA 5DM6Q 1YRTA 1Q82T 2CJYB 5HQLA 4Q8EA 2FB0A 5KFWA 1D9AA 1NKCA 4DV2F 3MAAB 1RLDA 1BXNA 1FTCA 2MKYA 3OBIA 4YB5A 5THWA 3B6BA 1RABB 1MN7A 2GJFA 4I2QA 4MKYA 2OPSB 2VQFF 5H1SV 1RWKB 1LXNA 4ECSA 3PX6A 2O5DA 2H54B 1EQMA 2VONA 3CF5Q 2YXLA 2ZBQA 1QDUB 2HQGA 2DITA 1FFSB 3IFEA 4W98A 2A2CA 3HKZD 2UP1A 4WFXA 4G65A 2KB2A 2HWTA 2CDRB 4NLXA 1QSSA 3UR0A 3OFFA 3TA0A 3ADAC 1SV5A 4TLRA 5HBMA 2IVMA 1TVRA 4QWCA 4NL5A 1XIQA 3OJSA 4M5IA 1OPZA 1FE4A 4P73A 4U7UD 4HYKA 2BJ1A 1TL3A 2W9CB 3HSDA 3PG9A 4X4SA 2UUAJ 1Q1KA 3D0IE 4EGLA 2R2UA 1R6VA 4CO4A 5I3QA 1N34F 1EHWA 4ECWA 3U1NA 3LP0A 3IRXA 4L6V3 3GMGA 2W9BA 3HHLD 4PWWA 4ZLPA 3M32B 5HI7A 4DV4F 4K4WA 1FXLA 3TRGA 4DPUA 3M9MB 3VALA 4IG3B 1RWWB 4CDIA 3CDBA 5E3CA 1FRHA 2CG8A 2ZEJA 3DDNA 2JX2A 5HLFB 3M8SA 3DRSA 4I2QB 3N0VA 4DUTA 5KFLA 4U67Q 4DI6A 3W2WA 1VIXA 3Q23A 1FDDA 2D69A 3T9NA 4J90A 1K1QA 1TK5A 5M2RA 3DRRB 4HT5A 1HNVA 3R6GB 1ZBTA 2WOMA 4CYUA 4J9OA 3PFOA 2QFJA 3VHQA 1RCOB 2DRBA 4BWJA 5EN1A 4ZVOB 2R8HA 4NYOA 2MYFA 1S6QA 3Q8QB 5I42A 1RAGB 4PZVA 2BKOA 1VISA 1SV5B 2GJ2A 2IDLA 3CVKA 3AB4B 5HBMB 3WIUA 1OY6A 3CJ5A 1HW8A 5B7WA 1MMDA 3VQSA 2I9SA 3W9IA 5DG7A 1EKSA 4KV8A 4XO0A 2EBEA 4IRCA 1JJ2R 1TL3B 4C11A 3MZIA 5DO2A 3FRZA 5FJ4A 4DQRA 1QJHA 5LL6d 3TI0A 4GO5X 5B0DA 1PKUA 1Q7LB 4WTYA 1WF2A 1Q5VA 4J5OA 3SBMA 4O3RA 2NREA 3BGUA 3LP0B 3IRXB 3J80U 2W9BB 2PN6A 5CYMB 1IWGA 2HVHA 1RWOB 4AUKA 3ISNC 2MY7A 3HULA 5KFRA 3Q22A 2KG0A 4TQSA 2AKWB 1HNZF 3J80Y 1ULRA 4A8KA 1WD6A 4LF6F 1YSJA 2HGNA 5CA5A 3CCJS 3W2WB 5G0RB 3Q0AA 1T9WA 5BR8J 5CD4H 3G6ES 1R0CB 1HNVB 3QFWA 2BE2A 2WOMB 4C8MA 4CYUB 2XM3A 2Y0BB 2VBXA 3NOCA 4PAAA 3GCWP 2WBMA 2OPQA 1SL1A 1RT2A 1S6QB 2HIQA 1ZS6A 5I42B 4ZVEA 1REVA 3UD4P 3L09A 2FHOB 3D3CJ 3KDOA 3OXGA 4X64J 2RUSA 1SKWA 2CQBA 3HHKA 1VJQA 2VA2A 4PG6A 4F4XA 4NCBA 4NE9C 4LIRA 2V8DA 4OX9J 2XTJP 2ZKTA 1E6VA 2BACA 3PVXA 4F0HA 4DSFA 2GHVC 2E5GA 3ENVA 2DR8A 1VBKA 5IZHA 1LV5A 2J6UA 3T3FA 2ZH6A 1LWFA 2FTRA 5B0GA 1H6KX 5IWAJ 2HW3A 3W3SA 4X4OA 2HKEA 1WHVA 1BWVA 2ZH5A 3R97A 2QIFA 4CWBA 1Q4RA 1JJHA 4LRAA 4NMXA 3PEHA 1QUPA 4I6AA 2ZOFA 3F41A 1S76D 2XYGB 2OEJA 3CCSS 4TLQA 1GMVA 1Q5YA 1VC0A 4B3MJ 2PA3A 2JVRA 3IP0A 2LP4A 2BE2B 4RNNA 3BBCA 1H2TZ 5L9XA 4OI6A 1F5BA 2Y1LB 4ZLNA 5E2QA 4B02A 1GAOA 1SQGA 1OS5A 4RL1A 1CLFA 4F25A 2QA2A 3KLIA 2OPQB 5JVHQ 1RT2B 2D41A 2NPFA 3LANA 1REVB 2FZKB 3FSYA 1TKXB 4AFFA 5EUHA
chains in the Genus database with same CATH topology
3BF4A 2ASLA 2E7XA 2KG1A 3PW5A 1R3NA 3CC7S 2JEIA 2DPIA 4LF5F 2KTQA 3NCQA 2Q43A 5E3RA 1BD6A 1FK9A 2Y1JA 3UWTA 2ROGA 2MQQA 1RT3B 3I0RA 2GQ2A 2RQCA 3ITHA 3TUJC 2CQ1A 3RAXA 3W2VA 1ZH5A 1VJWA 2MXYA 2RF2B 4KKOB 4JV1A 1E6VB 3TA2A 2E1CA 4IFVA 2QV6A 1L3KA 4FN5A 2QA4S 1XC9A 1HW9A 2K8GA 3CWJA 1JJ4A 4DFPA 1LQ9A 2PIIA 2D1CA 2DK2A 3SFUA 4OZ5A 2DRAA 3SCJE 2VC0A 4DN9A 3LAMA 2CFXA 2LYVA 1IBLF 4B3OB 3E01B 4A8FA 3QJLA 2B51A 1LWFB 1FESA 3G8TA 2B6AB 3K8VA 1V9OA 5J2MA 1R89A 3QWUA 2UXCF 3TA1A 1S1UB 5JXSA 2KN4A 1N33F 3FSIA 4B9UA 1GTEA 1O0PA 3L3CA 5GADI 1KLNA 2W8LA 3TNVA 4C8NA 3WC0A 3D0HE 5A8RB 4M63A 3OFGA 2W4DA 5LSRA 1GNKA 2AYMA 2RSQA 3KK1A 3TAMA 4ED8A 1R6YA 1G2EA 1IN0A 2MDAA 2RILA 3KFWX 5DQGA 3K5LA 1URNA 2YKMA 1IXKA 1VS3A 3G71S 2CPEA 3VZHA 1CEZA 1FRXA 2E9ZA 3VAHA 1VQPS 2KHCA 4CO1A 3GQCA 2E9RX 2M3DA 4QIWD 3R1LA 3FRYA 2GHPA 2YH1A 2BRKA 4F2SA 1WTFA 3MM7B 2PC6A 4Q44A 4UW2A 1U2RA 3MAHA 4KSEB 1X5SA 5KFGA 3OR2A 3SYZA 1SH2A 4C8KA 3CTRA 1RWUA 3M32A 4OHVA 2ADCA 2C3YA 1HR0F 4OLOA 1ZZNA 1TFWA 2JFKA 1FCAA 4NLSA 3BSCA 4IG3A 3DGPA 3SQGB 1TUVA 4JYAF 3U1MA 4NYPA 2ABYA 3S7RA 2CQHA 2FGCA 2RDIA 2F9JA 1OSCA 1SL0A 1NHVA 1FKAF 5JVGQ 2JRSA 4NZ7A 4QR2A 4IFYA 1F0XA 3L7OA 4N8NA 5HLFA 4PXCA 1YITS 3P49B 4NCAA 3BQ0A 2KRBA 2IRXA 3RAQA 2FJAB 4CZCA 1FNXH 5LMUF 5CXTA 3MM5B 1ROFA 2EFVA 5L1KA 2HHPA 4KPYA 2W7PA 2QA1A 2D74B 2CPYA 3UD3P 1JLCA 1NU4A 3MEGB 3D1HA 1X4AA 1F5CA 4ED3A 2ASYA 4C98A 5HP1A 1LFPA 3KLIB 3O44A 3AJ1A 1SBRA 1YJVA 2VD3A 3CC2S 4YDXA 3DRRA 1UVLA 3T1YF 2DO4A 2E1RA 3I5BA 1M90T 1U09A 3R5AA 3MM9A 2DGOA 2KJWA 3MMBB 4O3SA 1FRIA 1J2VA 2GV1A 2HHWA 4B9VA 2OSRA 1PILA 1L3TA 3J7A1 5EWEA 1XR5A 2FHJA 2LEPA 3GIMA 3RB6A 3RB0A 3X3UA 4JI7F 3PO4A 2E1AA 2ZH9A 5IXUA 1VOMA 5B09A 4URGA 2BQUA 1RYRA 2AJFE 1R27B 3IG1B 3CDUA 4RNFA 1Q86T 4ED0A 3KHHA 1SB6A 3E8OA 3G4SS 1TAQA 3DI6B 1FT8A 5KFQA 2M5YA 2HFNA 3KKFA 2LCWA 4O44A