1JLQB

Crystal structure of hiv-1 reverse transcriptase in complex with 739w94
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
425
structure length
405
Chain Sequence
IETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 RT, A-CHAIN
publication title 2-Amino-6-arylsulfonylbenzonitriles as non-nucleoside reverse transcriptase inhibitors of HIV-1.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Transferase
total genus 111
structure length 405
sequence length 425
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2001-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1jlqB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jlqB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jlqB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jlqB03
5F8JA 3LANA 4Q8EA 1JLEA 1RTJA 3LP2B 5J2NA 1NHVA 1BQMA 4DL7A 2E9RX 1R0AA 1EP4B 3DRRB 3HKWA 4MK9A 4ZPAA 5C24B 3KK2A 4WFZA 5KFDA 1TKTA 3KLGA 1JIHA 1NNDA 1LW0B 5J1EB 3N6NA 1EETB 1FK9A 3LP1A 2F8EX 4ZPDA 1FKOB 3C6UA 1SV5A 4TYBA 4RW9A 4KKOB 5EWFA 4TQRA 4J9OA 2WK4A 1S0OA 4IG0B 1FKPA 4NCGA 3IS9A 3IG1B 4K4WA 4O3OA 3BGRB 5KFYA 3KLHB 3N6LA 1HMVB 2YNGA 2ZD1A 4QWDA 1RYRA 2HNYA 1VRUA 3OSPA 1JKHB 2V4QA 1REVA 1C0TA 5C42A 1TQLA 3N6MA 4Q0BA 4NLTA 3PW5A 3T5HA 4EO8A 5F8NA 2FJWA 2OPRA 1IKYB 1C1CA 1S1TA 4H4MB 4EYHB 3IN5A 4DL4A 4LSNB 2IJFA 2VG6A 4KO0B 3C6TA 4F4ZA 3V6JA 1XR6A 3T5LA 4J9QA 2D3ZA 2JEIA 3NMAA 4WXWA 3LP2A 5FDLB 3BR9A 5K14A 3LALA 3H5YA 3DRRA 5DQGA 3PR5B 4O44B 3I5BA 5KT2A 2OPQA 1LWEB 4KSEB 1JLCB 3QYYA 4IOBA 1S9FA 4QW9A 4Y34A 1LW0A 5J1EA 4Y2CA 4XPCA 1EETA 5KT6A 1NHUA 4MH8A 2R8JA 1FKOA 1GX5A 4K4VA 4KKOA 1RTDA 4R0EA 1HQUB 1TKXA 4GC6A 4DL2A 4IR1A 4IFVB 3T1AA 3MR2A 4RW7B 3H40A 4NLDA 3EZUA 3TAMA 2FJVA 4U6PA 1TP7A 1KHVA 3BQ0A 3BSCA 3KLHA 5F8LA 4M95A 2W9CB 1RT5B 3V81B 1ZETA 1S0NA 3CVKA 1K1QA 1JLQB 1N5YB 4ZPBA 3NAHA 4NLRA 3D5MA 4K4SA 3V6HA 2XWYA 2FJXA 2B6AA 3V4IA 4J9NA 4H4MA 2GIQA 3FRZA 3MFIA 4LSNA 4PQUB 3MEDA 1SH0A 4EYIB 3PW2A 4KO0A 4WZQA 5L1IA 4WYWA 4TLRA 2AQ4A 2W8LA 2ASDA 3KK1B 3GQCA 4TN2A 3KMSA 4ZHRB 3RAXA 3PVXA 4JV0A 1QAIA 4PUOA 1DTTB 1LWEA 4I2PA 4GC7A 3RB3A 2RF2A 1JLCA 3JYTB 3DI6A 2C28A 2VG7A 4IRDA 4ED1A 5CYQB 1T03A 3DLGB 4NLPA 2WONA 4Y2AA 2V4RA 2VG5A 3NL0A 5F9NA 3LP0A 4IG3A 4RW4B 3CWJA 2R2UA 4Y3CA 3FQLA 1S1VB 4K4UA 4WE1A 1RTIB 1DLOB 4NZ0A 4MIBA 4RW7A 2YKNA 3QO9B 2FLNA 3DLEA 4OL8A 5J2NB 3H2LA 3QGIA 3T5JA 1R0AB 2W9CA 1DTQA 1RT5A 5KFJA 4J9MA 1TKTB 4KHMA 5J2PA 3G6YA 4J9SA 1RT1B 4FBTA 1UWBB 2R2RA 3H59A 1FK9B 2AGQA 3C6UB 1JLAA 1JLGB 4RW9B 4IDKB 2IMWP 1K1SA 4R5PB 5KFFA 1LWCA 4Q44A 3DMJB 4ZP9A 2I1RA 4YMEA 4NLGA 3KK1A 3KLEA 3MECA 2XI2A 4WZMA 4ZHRA 1IM4A 3PR4A 3G86A 3QLHA 4NLQA 4URGA 2BE2B 2HNYB 1DTTA 2C2EA 3NGDA 2GIRA 2IC3A 3JYTA 4KFBB 3KHHA 4HYKA 2VA2A 1C0TB 5CYQA 5C42B 3DLGA 1T05A 4Q0BB 4QWBA 5KT5A 2AU0A 2OPRB 1KLMB 1S1TB 2BANA 2HAIA 1RTIA 2J6UA 3KHLA 5L1JA 1MMLA 3NBPA 2J6TA 3I0RB 2W9BA 1HNIA 2WHOA 3G6VA 4IH7A 5K14B 2UVRA 4EBDA 3RAQA 5L1KA 4RZRA 4NLSA 3BQ1A 3GYNA 2OPQB 2BQRA 3GILA 1RT1A 1W25A 3KHRA 1JXLA 2ATLA 1UWBA 5I3UA 4ED3A 4WFXA 5KFEA 3GIJA 3BJYA 1JLGA 3MEEA 1IKXB 2RKIA 4IDKA 1TKXB 1S9GB 5J2QB 4R5PA 1RTDB 5KFVA 5C5JA 2IM3A 3DMJA 1YVFA 4G1QA 4KV8B 3TAMB 5KT4A 1S1XA 2HNZB 1BQNB 5HROA 3D28A 4RNOA 2IM2A 1RT4B 5KFCA 2B43A 2BE2A 3M8PA 1RAJA 3KOAA 3KK3A 1S6PA 4QWCA 4KFBA 4B3OA 4ZPCA 5CYMA 4JUZA 1VRTA 5KG0A 4JV2A 4O4GA 2B6AB 5C25A 3V4IB 2OH2A 2IM1A 4ZVGA 1TL3A 1KLMA 3OHBA 4YR0A 3MEDB 4NLUA 3CO9A 5KFRA 5KG6A 3UDLA 3OL7A 2W9AA 4J9PA 4Q43A 2QV6A 4NLWA 2JEJA 3I0RA 4ZVFA 1TL1A 4MFBB 1S48A 5KFSA 5KFQA 5KFPA 3DOLB 1C0UA 5DG9A 1MU2B 1S6QB 3PHEA 4J9KA 2C2RA 2C22A 4U7CA 3DDKA 2JEGA 4PUOB 1LW2A 5F8IA 4I2PB 4MIAA 3CJ0A 2UUTA 2RF2B 2FLPA 3KLFB 3DI6B 2VG7B 1T03B 3CJ5A 2WONB 1JLBB 2VG5B 3Q8QB 2WTFA 3T19A 3LP0B 2OPPA 4IG3B 3HVTB 3I5AA 1IKXA 4WFYA 3Q8PB 3KNAA 1S9GA 5J2QA 4WE1B 4O4RA 2BQ3A 2YKNB 4F4WA 4NLOA 3DLEB 4KV8A 1QAJA 1Z4UA 2HNZA 1BQNA 1IKVA 3ISND 4I2QA 2FVPA 4NYZA 4ZMMA 5F8GA 3PZPA 3CIZA 3TQ1A 1RT4A 5KG5A 2ASLA 1DTQB 5HLFA 3RBEA 4M94A 4NLVA 5J2PB 3RB0A 4YQWA 4J9LA 2YKMA 3OL8A 4DL3A 5DGAA 5EWEA 3IRXA 5KG7A 4RUAA 3IGNA 1JLAB 4EEYA 1QE1B 5KFMA 4K4YA 2JC0A 1LWCB 3E01B 2XGQA 4NLXA 4MFBA 1HYSB 2OPSA 2UUWA 3DOLA 3MECB 3KLEB 1MU2A 1S6QA 1RT7B 3KLIB 1ZTTA 4KHRA 3GV7B 3KLVA 2R8HA 4EBCA 3QLHB 3KHGA 3FFIB 1S1UA 5KFXA 4LSLA 2IC3B 4IQXA 1S1WA 3KLFA 3Q8RB 2E9TA 2R2TA 1T05B 2D3UA 4ECSA 1JLBA 5HP1B 1JX4A 3HVTA 2XGPA 2FLLA 3M9MB 5JUMA 2IBKA 3MR3A 2BANB 4RW6A 1D1UA 3PW7A 3NBPB 3DLKA 5KFAA 4RNHA 3UPFA 2YNIB 1HNIB 4WYLA 2W9BB 4ED8A 2W7PA 3RB4A 5F8MA 3KJVA 2FVCA 1C2PA 1S49A 1ZTWA 1RT2A 4TXSA 4RNMA 4ECRA 4ED2A 4DG1A 4F50A 4IRKA 2ZE2B 3DRSB 1WNEA 4YP3A 3HVAA 2FVRA 1SH2A 5DG7A 3BSOA 1SUQA 5I3UB 1KHWA 4O3RA 3FSIA 4ZP8A 3DOKA 3H4BA 3MEEB 2RKIB 1QE1A 3E01A 1TV6B 3M8QB 2WOMA 4G1QB 1HYSA 4NRUA 1S1XB 1TVRA 5HROB 4K4XA 4KE5A 4Q45A 1RT7A 3KLIA 4ECYA 3V6KA 2ILYA 3JSMB 4QW8A 4QWEA 4H4OB 2W8KA 3FFIA 3M8PB 2ZKUA 3PJXA 3RB6A 2BR0A 3KK3B 1T3NA 1S6PB 3G6XA 1JLFA 3DM2B 4B3OB 5CYMB 2QE5A 1VRTB 3CDWA 1QUVA 2AGOA 4O4GB 5C25B 4MKBA 4ECVA 5HP1A 4TY8B 1TL3B 5J2MA 2BRKA 3DRPB 2WRMA 4ZVHA 2DPIA 2JLEA 3E51A 5KFOA 5DGBA 4F4YA 3I0SB 4ECQA 5KFBA 3GIIA 3QGHA 5KG1A 2YNFB 1TL1B 2YNIA 4ED6A 1C0UB 5KFWA 4RUCA 2ASJA 5L1LA 4IR9A 1LW2B 2ZE2A 3DRSA 4IKAA 2I5JA 3DYAA 5DLGA 3CJ3A 4YR3A 3EPGA 2AX1A 5KFIA 3GIKA 2VA3A 2OPPB 2R8IA 2AGPA 1N6QB 3OLAA 4RNFA 4NLYA 4RW8A 1TV6A 3M8QA 4NRTA 1IKVB 4I2QB 1HPZB 2GC8A 5KG2A 3JSMA 4H4OA 5HLFB 1T94A 1CSJA 5KG4A 5DG8A 2WCXA 3T5KA 3GV5B 4I7FB 3OSNA 4XPEA 3DM2A 2YKMB 1RTHB 2IJNA 4EO6A 4MK7A 4R8UB 4WXOA 3ITHB 4TY8A 3H4DA 3CJ4A 3IRXB 3DRPA 1RT3B 2HNDB 2CJQA 3H5UA 2BRLA 5L9XA 2IAJA 1N56A 2V9WA 3I0SA 2YNFA 1RDRA 2OPSB 3V6DA 4MK8A 1C1BB 3GIMA 4ICLA 4DEZA 3SI8A 5F9LA 1S9EA 3OHAA 4ECWA 4X2BA 1HNVB 1S1UB 1N4LA 4O3NA 1IKWA 3HVWA 3I5CA 3EPIA 4TY9A 3CDUA 4LSLB 5EWGA 1S1WB 3MFHA 4LQ3A 1TKZA 4HKQA 3H5XA 5KFGA 1HQEB 1N48A 1S0MA 2UVVA 4PWDB 5KFHA 4FBUA 3MF5A 1RT6A 4RW6B 5I42A 1N6QA 3H98A 4RU9A 3DLKB 1S4FA 3MR6A 1HPZA 4KAIA 1XR5A 2XCPA 4XO0A 3KJVB 2C2DA 4RNNA 3BSNA 1RT2B 1J5OB 4URQU 1EP4A 4DG1B 4ECXA 5C24A 4I7FA 4ECZA 3ISNC 3MEGB 4TQSA 4FS2A 1RTHA 4R8UA 4TYAA 3FDSA 4EBEA 3ITHA 1SUQB 2AX0A 1I6JA 5KT7A 1RT3A 2HNDA 3NAIA 3DOKB 2WB4A 2W7OA 2EC0A 2R8KA 2HWIA 3QZ7A 4ED7A 5F8HA 4JV1A 2WOMB 4IG0A 2R8GA 4URSA 1TVRB 1C1BA 4IFYB 2O5DA 2D41A 3IG1A 4O3QA 4K4ZA 2JEFA 3BGRA 1HNVA 5DLFA 4IRCA 1HMVA 3BSAA 1JLFB 1XR7A 1JKHA 1HQEA 2CKWA 5KFTA 5J2MB 2IM0A 3QGGA 4ECUA 4PWDA 3UR0A 5DQIA 1IKYA 2DPJA 2B5JB 3OL9A 4ID5B 5KFUA 2XC9A 3PW0A 2UVWA 5EDWA 4O3SA 3UQSA 5EUHA 1D0EA 5HBMB 4ZP7A 3RBDA 2HWHA 2V0NA 4DL5A 4YR2A 2AWZA 5FDLA 1J5OA 3VQSA 3TVKA 2XI3A 2HMIB 2YNHB 2D7SA 4H54A 2ALZA 5KG3A 3NKYA 5KFNA 2I5JB 1RA7A 2E9ZA 3DYAB 4O44A 2FVSA 3MEGA 5JXSA 3BQ2A 4ECTA 3QZ8A 5D3GB 2BQUA 1GX6A 3MTKA 2ILZA 4IH6A 4KB7A 3KMQA 3FQKA 3CJ2A 3OL6A 1LWFB 1HQUA 4RW8B 3QIPB 4LQ9A 3SFGA 5KT3A 4IFVA 4IFYA 1OS5A 4ZP6A 5T14A 3IGVA 4IH5A 3Q8SB 1JLEB 1RTJB 4DL6A 1BQMB 3LAMA 3H5SA 3V81A 3HHKA 3M9NB 4FS1A 3KK2B 3PW4A 1JLQA 1N5YA 4K50A 5KFLA 4J9RA 3KLGB 2RDIA 1U09A 3M9OB 2IA6A 1S10A 4ZVEA 2B5JA 2IAJB 1RA6A 3LP1B 4ID5A 3MR5A 3GV8B 4PQUA 1SV5B 1RYSA 2UVUA 4Q8FA 5HBMA 1FKPB 3V6DB 2RDJA 4NCGB 2J6SA 4O3PA 3BREA 3IS9B 4ICLB 4K4TA 1S9EB 2FVQA 2HMIA 2YNHA 1IKWB 2YNGB 2ZD1B 5DQHA 4QWAA 2JC1A 3CDEA 4KBIA 4G3IA 3OLBA 1VRUB 4MKAA 2XCAA 1TKZB 5D3GA 5KFZA 1REVB 3ICLA 4F4XA 1S97A 1HARA 3PJWA 5KFKA 2R2SA 3SFUA 4ED0A 1C1CB 1SH3A 1RT6B 4RW4A 5I42B 1LWFA 3LAKA 3QIPA 1S1VA 2VG6B 3C6TB 4QPXA 3QIDA 1DLOA 3QO9A
chains in the Genus database with same CATH superfamily
5F8JA 3HHLA 3EGWB 2OGUA 5KFDA 1UPPA 2VFTA 4F26A 2X1GA 1JQGA 2UXCJ 2GHWA 1RGVA 3RRHA 3LP1A 4TQRA 3N5BA 2CQCA 2ZDOA 2F3JA 1ZAVA 3BGRB 4M5JA 1F5BA 1M5VC 3L7PA 4DV6F 3MM5A 4KO0B 2RRNA 4GRSA 6FD1A 3CC7S 3RUBL 3QT5A 2C3PA 1Q16B 1Y10A 1S4EA 4LF5J 3NCPA 4K4VA 4KKOA 2N82B 2COLA 2Z56B 3U1LA 3F73A 4N7TA 4M95A 1K1QA 1FCAA 2O1PA 1ZZNA 2QLBB 1IWGA 3MWBA 3V4IA 2V2VA 2ZNYA 2AJ0A 4EYIB 2OKQA 3EZOA 1VBZA 3KK1B 3A8IA 3QJPA 2NXEA 2QL5B 1WI6A 4ZPVR 5ITHA 3CWJA 2HQ3A 1FFSB 3H2LA 3CSKA 3NS7B 3R97A 4AUKA 4FBTA 1UVKA 1Y5NB 4PWWA 4LVNP 4RW9B 2MKIA 4Q44A 3M8ZA 4B9NA 3MECA 2PMWA 1IM4A 4LRAA 4DPYA 2GMJA 4EBDA 4JI1F 2OSRA 7FDRA 1RT1A 3PX4A 1RAGB 1LXNA 1YDLA 4FF4A 1W2BR 1VYAA 4RBVA 2IM3A 4ZLNA 3OFFA 1BQNB 3TA2A 3DGPB 2PA8D 3W5XA 1X4DA 4J9PA 5KFRA 1T11A 5KFPA 3PHTA 1A6LA 2HAFA 2DYAA 2KJWA 3W8PA 5ETMA 2LVWA 5BXIA 2DITA 4NLOA 4G65A 1OPIA 3M32A 1FXDA 4FNIA 2MZTA 4YQWA 1VR6A 2C2OB 1QE1B 5KFMA 1WELA 2XGQA 4P10A 4DBQA 3HCXA 3ILIA 2QZ8A 1WHYA 1U0HB 2D3UA 1W2IA 3ZO7A 1NH8A 3NBPB 3DLKA 4B9LA 5KOWA 2WSEC 2O67A 2XULA 3POTB 1WNEA 5F0UA 1U0SA 2P2CB 4F0MA 2BYCA 2DNGA 1KHWA 3CF5Q 2GVDB 3E01A 1GMUA 3M8QB 4NRUA 2RU9A 3KJFB 2CQ3A 3A3PB 3JSMB 1QY7A 4H4OB 1UTAA 3CDWA 4CYUA 1UVNA 5C25B 2GMHA 5CA5A 3GIIA 3I87A 4CLUA 2Y0SD 4I67A 4RPFA 4P72A 3OTEA 1XNRF 3UNGC 5A8KA 4B3TF 3TZYA 3BB5A 1GH8A 3UN3A 3C16B 3B82A 2AJ2A 3EDRB 2QMUB 4ETXA 4WFBQ 3Q8YA 2VPXB 1RDRA 2RIJA 4QOTA 2JL9A 1ZAWA 2MPUA 2AW0A 5ETPA 2DNQA 1T3OA 2HZCA 3M6WA 2SXLA 2UVVA 1TMMA 4UTGA 5L46A 4C8LA 3RBXA 5I3PA 1XR5A 2CVIA 2UXDF 4LF1A 2W4DA 4ECZA 2B51A 2R7WA 4FS2A 3HLUA 4EBEA 2AF6A 4OYZA 3NAIA 4O0NA 2W7OA 5IWAJ 2R8GA 1T9WA 3R6GB 2CPDA 1HMVA 4CT9A 4BBYA 2E7VA 5AXKA 5J2MB 4PWDA 3VAHA 4CH7A 1D0EA 1IBCB 5A8RB 4ED4A 5KG3A 4ECTA 4F0KA 5LMUJ 2XMMA 4P2MA 4M1KA 3FQKA 3NGRA 3JAMU 1U2CA 1HHSA 4LQ9A 2MMYA 3C3LA 4DL6A 2Z57B 2MKYA 3UVJA 1W26A 3MR5A 3LP1B 2DNZA 4FPRA 1A9NB 2IRXA 4ICLB 4ES1A 5D15A 2FVQA 1PYTA 4Q2LA 1RWKB 4XK8C 3GE9A 4EGLA 3LPEA 5DDQC 3PJWA 4AL7A 3B54A 1DLOA 4MK9A 4ERDA 5KOXA 3CXCR 3L9ZA 2CNOB 1KONA 1CQMA 5M2RA 3FSXA 4CIOA 4JI2F 4KKOB 4J9OA 4IG0B 3WQPA 4DQRA 1R31A 3FEZA 1X0FA 2G4BA 4ZVPB 1P9YA 1E6YA 3GU0A 1L3SA 2UXCF 3N01A 5DO2A 1S7IA 3EE3A 2ZUAA 1R6YA 2G2OA 5E5NA 2AZ1A 3DRRA 1FNOA 1JNZB 3R9LA 2E1RA 4DUTA 3AB2B 4DL2A 4U9RA 1WKLA 4NLDA 2IYIA 3BSCA 3AD8C 5F8LA 2B4PA 4JI6J 2B9WA 3A3OB 3LWMA 3Q2SC 2YPYA 4LF5F 2HGLA 2A2DA 1NXIA 3X3UA 4WYWA 1OSDA 1A0OB 1FDNA 2M8HA 3PVXA 4FYYB 2FQQB 2RF2A 3IBFB 1RHJB 3LP0A 3FQLA 4L76A 4DFMA 4RW7A 2MY8A 3QO9B 4AL5A 4LREA 3HK2A 1RT1B 2J0WA 4V1Ak 3FMBA 2UZAA 1UW9A 1NZAA 1N52B 3MM8A 4LF4J 4YB1P 4WZMA 3QFHA 4NYOA 3R5BA 5DRKA 4NXMJ 3HDSA 4N5SA 1T05A 1G4CA 4PWUA 1P6TA 1H98A 2BZ2A 1N0UA 2VB6A 1RTIA 2RHSB 2OLWA 2DH9A 4PPZA 4C7QA 3BGUA 2Z2YB 2LEBA 4HTJA 2M70A 3MD1A 3PYGA 5KFVA 3TJAA 8ATCB 5LOQA 3TAMB 2RS8A 1L3KA 1H38A 1WOPA 5HAOA 3M32B 4FNHA 1YJTA 3M8RA 4DSFA 2Q66A 4LFCJ 4DS4A 1N5VA 5KFQA 2XWXA 2Q1LA 2EFVA 1Q82T 2DVIA 5HMYA 3DI6B 2BXJA 4ANCA 2UV8A 2YKNB 3SEOA 4E98A 3ISND 3S8SA 1FA0A 4N77A 1ZH5A 3FBEA 2A6MA 3MCOA 1AW0A 2KRRA 3IRXA 1R7IA 1NZ8A 4F4KA 4I1TA 3E01B 1F9EB 5I4MA 3EVWA 4MFBA 4P74A 1NPPA 3CC2S 4HR2A 3SSSA 4LSLA 5HVGA 2ZHBA 4TU9A 2MZQA 1FJGJ 3M9MB 5JUMA 1D1UA 1TFWA 3JS9A 3JSYA 4CLWA 3RB4A 1LEOA 1H2VZ 3E2EA 2DNMA 1IVZA 4F50A 1TL4A 3E8OA 1TZ0A 2CWXA 1Q86T 2LDYA 5A8KB 1QSLA 4GKJJ 1MLAA 4CLZA 4M63A 2BBEA 1CJVB 2BR0A 2G0IA 1YJUA 4OLPA 1VI7A 4ZVHA 1I3OB 4DJBA 5KFBA 2YNIA 2DNPA 2YWGA 3NEKA 3I82A 2OO4A 2Y0BB 4JV5J 1BD6A 3CJ3A 2AIRB 1HBUA 2R8IA 2WSFC 1NO8A 4Z2XA 3H0PA 1ZA1B 2PT0A 8AT1B 2YX1A 3GV5B 3OSNA 2E66A 5RUBA 4C97A 1GMVA 5U47A 5GMDA 4ELTA 2VFSA 1RISA 1JMTA 4TY9A 2F7VA 2HHHJ 4QIVA 1TKZA 2DHHA 1NDLA 1U1OA 4PWDB 3MUMP 3J7Z5 1YQHA 2E5IA 2GW8A 4OYBA 1SUQB 2VPZB 1X9SA 3TWZA 2AEJA 4YHHJ 1T95A 2HHQA 5T41A 3MCMA 2D3O1 4PG8A 4DUYJ 3AQPA 4JI3F 3PYEA 1AROP 2I8EA 3UR0A 3FZ2A 1Y4ZB 3KNGA 5IWAF 2JHEA 5DZ6A 4DR7J 2Q6CA 2C2NA 5FDLA 2M3DA 3IMQJ 4NMXA 4ZVRB 3D68A 2HSEB 3HJFA 2HVDA 3O3LA 3W5ZA 4FS1A 3G82A 4HDGA 2RDIA 1U09A 4CLTA 2KFNA 5LMUF 1IR2A 4PQUA 2CZ9A 4W90B 3R7NB 5B0AA 1YX2A 2E1CA 1FXRA 2YH0A 4KBIA 1E6YB 5E7OB 3QIPA 3CCTA 1VQPS 3LOUA 4B9MA 1HKAA 1EP4B 3DRRB 3J7YU 1H2TZ 3NLCA 3KLGA 3SCJE 1MMDA 1VQ4S 3M2RB 2XYHB 2JFDA 3SQGA 2CJXB 5L9NA 2R7VA 2CPFA 3TRGA 2ZD1A 4RO0A 4DS5A 3OSPA 4JP8A 1IBMJ 4F7VA 1TMJA 3DU6A 4PZVA 1F5CA 5GADI 2DHXA 2Y8WA 1IQTA 5H9EK 1QJHA 3DNCA 1S9FA 3GONA 4YOEA 1BMQB 4OI4A 2ERRA 4IR1A 4JI8J 2BA9A 1X9MA 2BKPA 4RW7B 2UV8G 3V81B 3GR1A 1AFJA 2Y8YA 4DSJA 3FRZA 4JYAJ 4TLRA 3MM8B 5DDOC 4DCJB 1LWEA 4GC7A 1JLCA 1M5OC 4LFBJ 1WSVA 1SVDA 2C2MB 4Y3CA 1RTIB 3P49B 3LWLA 2LLZA 3R3TA 3HX9A 1IR0A 5DETA 4HACB 1H74A 1B4SA 4ZP9A 4CO4A 2HBYB 3KLEA 5A0YB 1KN6A 1BLUA 3A4TA 4B3MF 4DZDA 3NCQA 1BC6A 3DOMA 2IC3A 3AD7C 2QLFB 3H8YA 1WJ9A 3LGNA 3N79A 2OJ3A 4LIWA 2YWHA 3GYNA 2RVJA 4NXMF 3GILA 2ATLA 3SBMA 2RS2A 3J7ZT 2Q3PA 5KT4A 1AB8A 4DF4A 1XWLA 3J7A1 3TAQA 2OH2A 5ETKA 2HVEA 2W9AA 4FVCA 2HZVA 4MFBB 3AXMA 2C22A 4P6QA 2JEGA 4MYTA 2VQEJ 2GMLA 4DR2F 4IG3B 4O4RA 1M1HA 3CT9A 6AT1B 1NK0A 4MAKA 4O3SA 3QRQA 4Y0FA 4ES2A 4FYDA 1S57A 4USVA 1SXLA 1JLAB 3UN5A 4EEYA 3F0NA 2VONA 2R8HA 3KLVA 2UU9J 3ADAC 4EBCA 1FHTA 2E9TA 4P71A 1TK8A 1XC9A 2IBKA 4WKRA 1R43A 3VZHA 2YNIB 1HNIB 4DCPB 2HVHA 2YWWA 4DG1A 1N8RT 2GHVC 1EZZB 1Q8BA 3HVAA 2KFYA 1HBUB 2PD1A 3GLJA 4LJMA 3PM9A 3FSIA 3MEEB 3KG1A 1N88A 1FJGF 2D9OA 3J81Y 4DV5J 3PKYA 3M30B 4QW8A 2W8KA 5BJRA 3PJXA 1T3NA 4OYXA 1N36F 2Q79A 2PA3A 2W25A 1WACA 4GKJF 4M5IA 1C0UB 3B8HA 4IR9A 4AT1B 1M90T 3DYAA 3THPA 4A8YA 2XS7A 3EYZA 3B4MA 4DR5J 4NOHA 2E1AA 1KVJA 3OLAA 3LA0A 4WIIA 2HK2A 3TYTA 3MMCB 1CSJA 1CG2A 4JV5F 1U1RA 2QEXS 2BRLA 3CJSA 3W61A 3SIPB 2XQCA 3FJ2A 4KQZA 1S9EA 3AXKA 3MAQA 3MFHA 3A1YG 1VK8A 4F36A 3GCXP 1TL5A 1P1TA 1TUGB 3KJVB 2OI2A 3M6UA 2NXUA 3ISNC 1HBMA 2AX0A 3MOZA 2J9CA 5DJBA 1M5KC 5I3QA 3QZ7A 5IT9U 3QFWA 2CPHA 1VHFA 4K4ZA 2RHQB 1G6BA 1SJQA 3K8VA 2OAUA 2RB7A 3QGGA 2QFJA 2EKYA 3K17A 1XEZA 3UQSA 4YHHF 3FKBA 1L5UA 2DGTA 3MGJA 2V8VA 4DUYF 3HFKA 2FVSA 2XMJA 4CM2A 2W2MP 4KT0C 2Y1JA 3QIPB 2JVOA 3CC4S 4YB6A 4ZP6A 3RU0A 3H20A 4DR7F 1E6VA 1RHMB 1RCXB 2MZJA 3KLGB 4WK3A 3UW1A 4QQBA 1HI0P 3G9CA 1XMBA 4DPWA 1XERA 3W64A 2ZD1B 4BLGA 1FF2A 2Q43A 4DQIA 3OQ2A 4DR4J 1S1VA 4K7QA 3C8YA 4LVOP 1EKRA 2XHWA 5E3QA 3KTQA 1S0OA 4X4QA 2CYYA 1WC5A 2DR9A 1EJ7L 2YKOA 4A8OA 2HNYA 5HJXA 4X4UA 3ETOA 5E2QA 2BJDA 4LUBA 1GXTA 3NMRA 3TZZA 3VGUA 5K14A 1LWEB 1JLCB 4QW9A 1IBMF 1LW0A 5DS7A 3DLJA 2EK6A 1NHUA 1TKXA 3WHIA 3FNNA 4IFVB 3H40A 2DHAA 3KLHA 1ZA2B 2N4DA 2ZUGA 3C14A 5ETTA 4N56A 1HD0A 1D8ZA 1O51A 1FX4A 2VD3A 3GFXA 2PI4A 4JI8F 3NG8A 1IQZA 4ID8A 1WKJA 2EBGA 3I56S 2HLTA 4RJVA 3DOMB 3NS5A 6FDRA 3EGZA 2ZBIA 2VG5A 1NJXA 4JYAF 1U8WA 3HZGA 3RJMB 5AJ3J 3R7SB 1UP1A 2OEJA 3G6YA 1FK9B 1UA0A 3K8WA 2LECA 2ZVIA 4C2MA 2QG9B 1J2VA 4BDPA 4LSZB 1OY6A 3JYTA 5C42B 1D9DA 2AU0A 2BANA 1UWAA 1S59A 3GSDA 4CO5A 4K2JA 1CLFA 2YQ3A 4M5GA 3BQ1A 1ROFA 3FZBA 2R7QA 1R8BA 1KFDA 3I9ZA 3AOCA 4DI6A 4JBCA 4K59A 4X4OA 2FJBB 2FYXA 2IFXA 3AB4B 3CCMS 3M8PA 3CCSS 4LR8A 2LXFA 3GSIA 2B6AB 5BYSA 4DPXA 2APOA 3S6EA 1CVJA 3PJ9A 2FLOA 1T03B 1UEVA 4A8MP 1NJYA 4F4WA 1MROB 4DR1J 1F6TA 1RU2A 1NK9A 2ZH8A 2EVZA 5CH7B 5HQ8A 3RB0A 4DL3A 2VQEF 1S0VA 3C46A 1YJ9S 1LWCB 2CQ0A 3Q23A 2A10A 4UOGA 2OPSA 3L3CA 1VQ9S 1ITPA 1S1UA 3UE2A 5KFXA 2YX4A 4GMKA 4J9VA 3Q8RB 1Z1ZA 3CULA 1EX8A 4LRDA 1VQKS 3D0GE 1S72S 3QGPA 4ECRA 3D3BJ 2UU9F 2XS5A 4ED2A 5LXYA 2DXEA 2ZH7A 3AQOA 1PC4A 4H4KA 2RKIB 5HMXA 3FBBA 1D9FA 2KTQA 1QUVA 4ZLJA 1TL3B 2JLEA 4ZCMA 1F60B 1R27B 4BCAA 4DV5F 1MWZA 1YZ6A 2JDJA 2XMUA 3ILLA 2ZH3A 1FJ7A 4IO1A 3GZ7A 3TQEA 3JTNA 1NUEA 4NLYA 1TV6A 1VC0A 3IR6B 2RILA 4NL5A 4NX9A 2FDNA 5KG4A 3HFZB 4KHPJ 2F4VJ 4YB7A 1HBMB 4TY8A 1XNQJ 2BJ1A 5L9XA 4DR5F 3I0SA 3RW6A 3L95X 3EPIA 4DSKA 2CIMA 2OMOA 2I0XA 1N6QA 3UDEA 2VKRA 3B6BA 4URQU 2DTJA 2DBBA 3OR2B 1RTHA 3K2YA 1SQGA 3GFZA 2WB4A 2HWIA 5GMKa 4C0OC 1OIAA 5L8RC 4DQSA 1TUVA 4J9UE 2EFQA 4ZP7A 2LU2A 4ZVQB 3TJ8A 4RUHA 2DCLA 4C98A 1UPMB 1PJ7A 3Q2TC 4RW8B 2WAQD 2QIFA 4KIAA 3LAMA 3OTCA 3E3XA 3MURP 3RZAA 3DHWC 3TUIC 3NOCA 4O3PA 2C3UA 2JC1A 1CC7A 4M5DA 3CW2C 2J0QD 5B7WA 2LQJA 2ZBCA 4NPOA 1Y11A 3ONQA 3PFEA 1TKTA 1TL7A 1Z2ZA 1LW0B 2DD8S 3HO1A 5EWFA 4DR4F 2BJ8A 3KLHB 2YNGA 1HIYA 1B3TA 2DH8A 4A8XA 1FWPA 1REVA 1IBKJ 5F8NA 4USJC 1X4AA 2CQDA 2DGQA 2VICA 1YWXA 3I6PA 2RJZA 2VG6A 2Y1RI 4CH0S 4DPUA 4MKYA 1C4AA 2UP1A 2HQIA 1TK0A 1HLWA 4QZVB 3BKFA 4MH8A 3UR3C 2ZC4A 3SCIE 2MDAA 4R0EA 3WC0A 4B17A 3QWPA 3W9HA 1U4BA 4F4AA 3HF5A 5LJ5Y 1CJUB 4OZLA 1RWMB 1JLQB 1N5YB 1FE0A 3LW5C 3BEGB 1CPZA 2GHPA 1H7XA 2GQQA 3MCNA 4QU6A 1WTBA 3U27A 4A8KA 1R8CA 1OQ6A 2NUHA 1O5JA 1YHQS 3D6MB 4PUOA 4NI2A 3JYTB 4ED1A 2IDLA 1CQNA 3D1OA 4U8YA 2R2UA 3MM9B 4K4UA 3M2VB 3MEKA 3T5JA 3ET6A 2DR8A 1REGX 1RAEB 2CJBA 2Y1LB 1RP5A 2NSCA 1K1SA 3TW0A 5AJ3F 2KXNB 3OR1A 2MEWA 5EGYA 1VDHA 2RSQA 1YJWS 1VQ7S 2IJRA 2JSXA 3PG9A 1UMJA 1CS4A 2V8GA 4ED3A 4WFXA 1HD1A 1SC4B 5C5JA 2CFXA 1NEEA 4OX6A 4FYXB 5KFCA 2BJ7A 4AFFA 3KDNA 5CYMA 4EWTA 1W7WA 1IBLF 4QIEA 5A2QY 3RTVA 2B8PA 2HVIA 4NLWA 3PACA 2NUUG 4W98A 3W65A 5F8IA 2C1EB 3EVOA 2UUTA 2FLPA 4ANEA 3TZWA 2QA1A 1NMEB 1H7WA 4HEA9 4WE1B 2ZVSA 4I2QA 1FRIA 2X7IA 3PTWA 1FEEA 1PSDA 2D9PA 3F41A 4C8ZA 1S12A 4KGMA 4RBUA 3CEDA 2ASYA 5KFWA 2CADA 4DR1F 4KGKA 5C2CA 3ZTQA 2AHOB 2KH9A 4FZVA 4ECSA 3MAAB 1PGZA 1JX4A 4IUFA 2XLJA 2AEMA 1YK9A 3PW7A 2OEMA 2FZKB 5KFAA 2W9BB 3VGSA 2W7PA 1F2GA 3ZZZA 4J7CA 5K5MA 1PBUA 4UUWA 4I0WA 1ZPWX 1SJ1A 5B09A 3VVTA 1VHIA 2K3KA 1X60A 2VF3A 2U2FA 3M6VA 1TV6B 2R7OA 4KPYA 4Q45A 5D0GA 5K8OA 2V34A 1KTQA 1UL3A 2PEHA 3HP6A 3GCWP 4CDIA 2AGOA 4TY8B 2J8AA 1VQ5S 4F4YA 3I0SB 3QGHA 4NXNJ 4PQAA 4XIUA 2GGPA 1LW2B 4CLKA 4QPTA 3EPGA 2DH7A 2AX1A 2VA3A 1GNKA 1N6QB 2MQMA 1RTHB 3PFOA 4ZA1A 1B7FA 3H5UA 3QSIA 3W9JA 3NGKA 4C8YA 1RBLA 2NREA 3I32A 3DCAA 1YBAA 4HH0A 2OIHA 4KHPF 2F4VF 1XNQF 4ZLLA 2B56A 4RU9A 4OI2A 4HDHA 3L7UA 3BSNA 1DBDA 2WW8A 2EKNA 1NKEA 1FEHA 1PIEA 2J76E 5FJ4A 3DOKB 2LKZA 3IM8A 4RKUC 4JV1A 3D6TB 3IG1A 4O3QA 2KXFA 4ZJLA 3ZZOA 1BWEA 2IVYA 5EDWA 4HI2A 2HWHA 4DL5A 1BQXA 3GFHA 3L4BC 5CD4H 2XI3A 2V8HA 4O44A 3VWSA 2GQ2A 4R25A 2Z2ZA 4KR0B 1VBYA 4M5DB 1Q7YT 3SQOP 3OL6A 1HQUA 2DGOA 3SFGA 2VFVA 3AJ2A 4IH5A 2KRBA 1TL7B 4ALZA 1RB0A 3CCVS 2RDJA 1FDBA 2YNGB 1Y5LB 3CDEA 1REVB 2XS2A 4W4MA 1SH3A 2FTRA 3FCWA 1VISA 1K0TA 2VG6B 1C4CA 3ENAA 2E9RX 2L9NA 3A8EA 1H72C 2V67A 4WFZA 4TU8A 5D4OA 1B0VA 4DU7A 3BBBA 2AYBA 5KFYA 2CNLB 4BWMA 2BV3A 4Q0BA 2FJWA 2ABYA 2CDRB 5D8HB 4WXWA 4U67Q 3I5BA 2OPQA 5IQQA 1RQ0A 1IBKF 1EETA 5KT6A 2IBOA 3PYFA 4GC6A 2DNHA 2B9XA 1S79A 2A1BA 5GAHU 1H73A 3ZTPA 4OZ0A 2W2OP 2W8LA 1WG1A 3AD9C 4TN2A 3OR1B 4KGXB 4PCQA 4RW4B 3J80Y 3PY8A 3NGUA 4X4NA 1G1XA 4Y6IA 2Z2MA 3GJQB 2BW7A 1CS4B 2GAGC 4CRJA 2V2QA 2K06A 2EWHA 3N4WA 5KAKA 3RRKA 2PMHA 3MMAA 3M8YA 3R6LB 3O44A 3W60A 5IC4B 3PRBA 1PO6A 1NDCA 2KM8C 5E0OA 4ZHRA 3IAM9 2C2EA 3NGDA 5CCMA 2VA2A 3A8JA 4ZIWA 2J6UA 3KHLA 1Q78A 4WTOB 4RZRA 1KOHA 4A8WA 2EW9A 1UWBA 3F56A 3IWLA 1RTDB 1DHMA 4R5PA 4P52A 1HR0J 5HROA 2IM2A 1FFWB 3UD5A 3AJ1A 1YIJS 2MY7A 4KFBA 5JMNA 5KG0A 1Q5YA 3MDFA 5E3RA 4ZVGA 3CCUS 4CO3A 2J5AA 2ZJPQ 2DHSA 1TL1A 4UOCA 5AXLA 2B0GA 1MNEA 4DN0A 1L3VA 2VG7B 2H5IB 4ZITA 2LA4A 1V3RA 1H2UX 1IKXA 1FERA 1RKIA 3IFEA 2ZH6A 3DLEB 1HWJA 5HLFA 3UCGA 1SJRA 4DU8A 3CCLS 4CH1A 1B7YB 3BO2A 2JC0A 2UUWA 2FIUA 3GV7B 4CO0A 4IQMA 2GS8A 4K8RA 4UF4A 3CJTA 4OZNA 1U1NA 2XNQA 3HVTA 3EVMA 2GGPB 1RUSA 2VQFF 2HFSA 1VQYA 2W4PA 3EXCX 2YKPA 1QTMA 2HVZA 2H4WB 1RLCL 1G7CB 2WOMA 1UA1A 3NNAA 2KI2A 4EFAC 3LF0A 1SJFA 5CHCB 3H42A 2YQ0A 3Q22A 4NA1A 1P8GA 3U1NA 3C15B 5AE1A 1HW9A 4O0IA 1OJ4A 3CD6S 3MM7B 2RU3A 2AGPA 4NXNF 4WBFA 4QR2A 4F2SA 4MK7A 4S0MA 3OVAA 2OSQA 7AT1B 4N41A 3MCSA 1G2EA 2LP4A 2IMOA 3H5XA 4ZVTB 4LF9F 5I42A 2MSTA 4GVBB 1L3UA 2XZWA 4R8UA 1BGXT 1WOOA 2R8KA 2RQMA 4URSA 1TVRB 2MYFA 3BGRA 1HNVA 3O1LA 3BO3A 1JLFB 5AT1B 2DR5A 3QWUA 4CNYA 5DM6Q 3PW0A 3TANA 1MG7A 2ADBA 1SJ3P 3VQTA 3CD5A 5K8NA 2ILZA 4KB7A 1OYEA 4USMA 4ZIVA 2FPHX 1FTRA 1KVIA 1T9YA 2C3OA 5D6GA 3HHKA 2FJAB 2IA6A 4ITSA 2B5JA 2ZBQA 5KTQA 1X31C 3V6DB 1O6XA 5IFMA 3PCOB 3NS6A 1U1MA 3ZNJ1 3BGLA 1QLNA 2RD5C 3ICLA 4WWSA 3SFUA 4CLPA 4HLBA 3TZXA 3KJNB 1JLEA 4DL7A 4CTAB 3R5GA 1N0VC 1JIHA 3ILOA 3N6NA 1EETB 3MM6B 4OYOA 1CJKB 4RW9A 1OSCA 1FKPA 5JVHQ 3OTOJ 2VH7A 1JKHB 1SC6A 3FVYA 4PKDB 3N6MA 4DLGA 2K8GA 3QT8A 1Q95G 4C8OA 3W7BA 2JLGA 2GNKA 2M8DB 2XZDB 3WX8A 2G9OA 2RE1A 1RXOB 2AP6A 4I4BA 1AUSL 1O8BA 5CYJA 2YWFA 3TEGA 2AZ3A 4USWA 3D5MA 4K4SA 4Q5VA 3G8QA 3CJ8A 3MMAB 3G96A 2HWTA 4ZHRB 3OT9A 1FWKA 1VFJA 1NB7A 2WW4A 3SSRA 3GP9A 3NCRA 4LR9A 1AUDA 2G13A 2W9CA 4A4JA 4OYAA 4J9MA 1UWBB 2C3YA 4R5PB 5F41A 5E3CA 2YX7A 4QBUA 2DNYA 1XTZA 4KFBB 4F3QA 1U0HA 3Q86A 1TKDA 4X64J 5G0RB 2OPRB 2H1YA 1K47A 2W01A 3NBPA 3W2WB 1VK3A 2XZTB 3POTA 2DY9A 2EC2A 4RBTA 1UCNA 4OJGA 1SL1A 2JLFA 1Q0NA 3BJYA 1IKXB 2GVDA 3DGVA 1YVFA 3D4JA 3OPKA 2NS1B 1X4HA 2DEIA 2R7TA 2K2PA 1RAJA 1S5ZA 3KOAA 3CJKA 1RSCA 4JV2A 5C25A 3QRRA 3EICA 5IZHA 1HR0F 5DG9A 3BS9A 1DARA 3OV7A 4I2PB 1HL6A 1XK8A 5D0EA 3HVTB 1RTZA 2CZ4A 2VBWA 4NWBA 3KUGA 2ASLA 1M5HA 1T9UA 1FKAF 4NLVA 1QAXA 1X4GA 4X65J 4AE5A 5EWEA 4P9SA 2BM1A 4DLEA 2MKKA 2P9EA 3K58A 4BC7A 2CQPA 1JK9B 3ENWA 3FGVA 3AA9A 3B78A 4MIWA 4BWJA 2C2KB 3GYXB 1QD1A 4N76A 4G1QB 1RT7A 3KLIA 1RWNB 1KQKA 3LGMA 1S6PB 2VZ9A 4O4GB 5J2MA 1NKCA 5AXMA 2X51A 4ED6A 4FKXA 3DRYA 1U1KA 4Z37A 3CDBA 3HHLC 2NCKL 3VHQA 4MYUA 3I31A 2X3DA 4RNFA 4NRTA 3H2VE 2MQNA 3RGIA 2YKMB 4R8UB 3CJ4A 2R7UA 3QJLA 1N56A 1Z2LA 4ICLA 1HNVB 1B0PA 4KH0B 3PKMA 3R5CA 1S1WB 3RG6A 4B9SA 4Y2KA 1TFYA 4V19X 2ZOMA 4PR6A 1ELOA 3ELHA 3HSZA 4C4WA 1WD6A 2Z8QA 2AT1B 3CTRA 1I6JA 4IG0A 1C1BA 2U1AA 5CAAA 4FXDA 4C48A 1HQEA 4CM0A 3R27A 1KQSR 3BYPA 1NU4A 2B5JB 1DFDA 3TX8A 1BUXA 5JXSA 3TUZC 3D54A 1GX6A 1KEKA 1D09B 4IFYA 2M7SA 2ZOGA 1LXJA 2M52A 1JLEB 4C11B 3M9NB 3R5JB 4WPAA 2VDHA 1S10A 3BN4A 2BVZA 1RA6A 2IAJB 1FKPB 1LWXA 3K59A 2J6SA 2KT2A 2QA4G 4A47A 2QSFA 2YNHA 3NNHA 2HPUA 3HMJG 3ZZ0A 4N8OA 1RT6B 4NYPA 3B4DA 3BGFA 3DFEA 1Q5VA 3QO9A 4L3KA 1RAFB 2GQCA 2DNOA 4ZPAA 4OHXA 1J5EJ 4IOCQ 1U6BA 4P75A 1NJWA 3BKTA 1SQEA 3IR5B 1YSJA 2H54B 3A12A 2VJVA 4YFUA 1VRUA 2NQPA 2VPYB 1C1CA 1ZAXA 5GAEU 3BR9A 3OTOF 4M5NA 1S77D 2V2KA 2R8JA 4P7TA 2PEBA 1SC3B 4FF1A 3TAMA 3RR7A 2HHVA 2W9CB 1ZETA 1S0NA 1N32J 1J27A 4DF8A 2CQHA 2O3DA 3PW2A 1NKBA 2ASDA 1ZPVA 2K7KA 3SSQA 2MQQA 3DI6A 5F9NA 2Y3YA 2CVEA 3HFVA 4X4PA 2YKNA 4OL8A 5J2NB 3PNIA 1XMQJ 4Q7AA 5LSOA 4WP8A 2R2RA 1YI2S 1U7LA 1NK7A 3RYLA 4QCLA 3PR4A 3N5FA 4M5KA 3HZEA 3CJKB 1V9OA 4QWBA 3THTA 1SJ4P 4DR3F 2HRYA 3NRBA 3OUYB 4RWXA 1GMWA 1U8SA 2B3TB 4X64F 2PI5A 4CLFA 5CD4A 3HSGA 1LK7A 4P7VA 1UJ4A 5SUHA 1CJVA 3I4PA 3EJMA 1RKJA 2XMWA 2KB2A 3OJSA 5DZ7A 3AJDA 1FRKA 4ZLPA 1HBNA 5KFSA 1ZM2A 2W7AA 2NYHA 3U02A 3MHYA 3CJ0A 2MSSA 3Q8QB 5C7PA 1QAJA 1IUJA 2HNZA 3TQ1A 4DSLA 2NXJA 4JI3J 4MKVA 4DQQA 4CQ1A 4K0KJ 4I69A 2VDIA 3DOLA 2A0FB 1RT7B 3KLIB 2DIVA 1M1KT 1KQFB 2ALYB 4G1IA 4X65F 2K3IA 3GG0A 3LPYA 1X7VA 1WHXA 3VGTA 4JI5J 2DNNA 1KNZA 3FEYB 9RUBA 2J7WA 1SH2A 4A48A 3BSOA 3IA0A 1SUQA 5I3UB 2GV1A 5A6WA 1FNXH 4ZP8A 2HRTA 2CPYA 4LT6A 1AXQA 1HYSA 5IS2A 5HL7Q 1ZYQA 2MZSA 2ZKUA 3RB6A 4A8SA 4B3OB 5HP1A 1K0VA 2RRBA 3R7BB 2XLIA 2HYIB 5DLGA 4YR3A 2OPPB 1NJZA 3JTOA 1IKVB 1SIZA 4J5OA 1FX2A 2XMVA 3G8SA 4EO6A 3H4DA 2OEKA 2KT5A 3G8TA 2EG2A 3H90A 5IQ6A 1C1BB 5CXTA 3SI8A 1F1BB 4ECWA 1LQ9A 4O3NA 1KQGB 4UW2A 1HQEB 1RHUB 5H9EJ 4RW6B 2DGWA 1URNA 4C9DA 1HPZA 3SCKE 1EP4A 5L39A 4ECXA 3ZZUA 4TQSA 1R8AA 4FDFA 2JVRA 4DUZF 2YH1A 3M2RA 5IC6B 1HHQA 2EC0A 3VGVA 4BHQA 4IFYB 2O5DA 3LH2S 5FLXY 4EI2A 4P73A 4OZ1A 2BW2A 3OL9A 2XC9A 2CNNB 4WK1A 5ETVA 2V0NA 3RAMA 3TVKA 2YNHB 2D7SA 4TKTA 4WKYA 1AYEA 3V4MA 2BKOA 4IH6A 2CQGA 1F3VA 4B3MJ 3V81A 1QDUB 1KP6A 5F0WA 2B7CB 4QYZK 1U02A 4TU7A 4EZ9A 1IKWB 1VRUB 5D3GA 2AJQA 3HHNB 5HK4A 5KFKA 1C1CB 2C42A 1G3OA 3IWXA 1GQEA 1LFPA 3N9UC 1HNZJ 2KG0A 4USUA 1NBEB 2ZWOA 3PIOQ 1FE4A 2F8EX 2HQGA 1TK5A 4HACA 2H51B 1F2HA 5A0YA 3N6LA 4F25A 1J5EF 4I68A 4WIQA 1HFEL 2WVBA 2XLKA 4DR2J 2FHKA 3V6JA 2DRBA 3T5LA 3VAGA 3SDEA 1N33J 1VJQA 4YUDA 1FKOA 3ENVA 3T1AA 4CO1A 1VQOS 2R7SA 3CJQA 5BR8J 2R9LA 4GVLA 5HMZA 2FJXA 2HIQA 2NPFA 3IXQA 3UN2A 4QIGA 4D3HA 3FBCA 4HI1A 1QUPA 5JVGQ 1U6ZA 1QAIA 2XSJA 3UI3A 1N32F 1FRMA 2C28A 1KBRA 2RT3A 1JWWA 4CCHA 4IG3A 1EB0A 1YRXA 1YRTA 2OUGA 1NSAA 4P2FA 2W4CA 2FLNA 2NXNA 3HSJA 3BYRA 3DHXA 4PRFA 1N36J 4Y2MA 3JB9k 2V8DA 3H59A 4AQYJ 3C6UB 1JLAA 4E0DA 2XHCA 4ZN3A 2A3JA 2Z0GA 5D4PA 1XMQF 3MZIA 4ZVSB 2F1FA 1EQ0A 1S1TB 3NGTA 1PG5B 1HNIA 1HBNB 2UVRA 5L1KA 3JSBA 2MKHA 2BQRA 1NJIT 1JXLA 3GYGA 1KS2A 5KFEA 2CJAA 3MEEA 3DMJA 5H9FJ 2HNZB 5G4DA 3M30A 4TLQA 2JH3A 5IV4A 4JUZA 2GO8A 3NY0A 3MEDB 3UDLA 1P9QC 4ZVFA 1YTYA 3DOLB 1C0UA 2DGUA 3DDKA 3FCVA 3TEHB 2WVCA 3MMBA 1UFWA 3T41A 3EMTA 1S9GA 5J2QA 4PYAA 3FMWA 1Z4UA 3WC2A 2QL9B 3MMCA 1T8EA 2ADCA 4W92B 5J2PB 1UAWA 4DOZA 4LF8J 4K4YA 2RQ4A 3NP5A 2XSFA 1HYSB 2N7CA 1L3TA 2AV5A 1VQSA 5HP1B 2ATCB 4K0KF 1HBOB 3QSYB 4ETZA 2HHSA 1AZSA 2FY1A 3KJVA 2ZZMA 4NZ7A 4IRKA 4JOUA 1VQLS 1QVGR 3H4BA 2DNRA 3DN9A 4KE5A 4JI5F 1VIXA 1R0BG 5DDPC 5GVQA 1VMBA 1VRTB 4J90A 3NOGA 2WRMA 2DPIA 4JI0J 3KXDA 2FJEB 4KPCA 1VQMS 3DRSA 4WJBA 2KG1A 4F02A 2MLYA 7FD1A 2ACMA 1RWVB 4WFAQ 1HPZB 1UVJA 2GC8A 3ZNUA 4LRFA 4X62J 3BF4A 1R8PA 5HQMA 1XQIA 3T5KA 4XPEA 2L9DA 1ZZFA 1FWLA 4WXOA 1Q8LA 2WZ1A 1QVFR 2YNFA 4PG6A 2YBVA 1WSRA 3IO1A 1X5OA 3HVWA 3I5CA 1NPRA 4DPOA 1S0MA 3R8YA 5KFHA 3VAFA 1U6FA 2DGVA 1S4FA 4PG7A 4LF2A 4XO0A 2C2DA 3GIRA 2J7UA 2DK2A 3VF0B 4C6AA 4DL0C 2MJUA 3PO4A 2P8IA 2HNDA 4YN3B 4JI7F 5AXNA 2HBRB 5AE3A 1D9AA 2PFFB 1VQNS 3FBFA 2ZH2A 4KJIA 2J7KA 2E5GA 3TOQA 1HWUA 3O2IA 2BDPA 4UUXA 2KM8B 1CEZA 2P6SA 3AY0A 2WBRA 1J5OA 3T6JA 2E9ZA 2I5JB 3MEGA 1UFKA 3QZ8A 5D3GB 2BQUA 5CQGA 1YBUA 3KMQA 4DWIA 4DZ6A 5KT3A 4IFVA 2BEFA 1AA1B 3Q8SB 4LR7A 4ENOA 4I56A 4J9RA 1PYSB 2L08A 3M9OB 4BS2A 4NEZA 3KG0A 3RRGA 3OVSA 2ZKTA 1I94J 1TUWA 2CPZA 2R2SA 2F63A 3UO0A 1X4EA 2H4YB 2MHEA 1RTJA 3SDEB 2V63A 5BYRA 2DIUA 1FK9A 2HHUA 1FKOB 2MQPA 2ZBPA 2BE9B 1HNZF 2ZHAA 4N47A 3MUTP 5C42A 1IKYB 1D3WA 4F4ZA 2D3ZA 4AD6A 1TAQA 5H1SV 2XSJB 2D74B 1BXNA 3GFYA 1GXLA 3AFGA 4ZPBA 1N33F 3V6HA 2B6AA 4ILLA 5IXUA 4DXLA 3VAJA 5MAOA 1Y0HA 4L6V3 4ILMA 5BR8F 2QGFB 1T03A 4Y2AA 1WF1A 4X66F 3MPDA 1MROA 1R0AB 1D8YA 1VGYA 2GCFA 1RT5A 2KT3A 2LEAA 1XBWA 2D3OR 1WHWA 1LWCA 3CB4A 3DMJB 2MQ8A 1U49A 1Y5IB 4XAKA 2FY8A 4URGA 3BKUA 2LMIA 2JJ4D 2BJ9A 4HYKA 1C0TB 2CA9A 1PAUB 2DNKA 1WUUA 1U1LA 4AQYF 3VR1A 3G6VA 2CRLA 3K7RA 4NLSA 3MMBB 1W25A 3BH6B 3GIJA 2RKIA 1S9GB 5J2QB 1UVLA 4J37A 5EHHA 2FHOB 2PSZA 1TL3A 2EFGA 8RUCA 1P27B 3OL7A 1S48A 3VAMA 3BR8A 1S6OA 4U7CA 2POKA 1BE4A 3OFGA 2PIIA 3GWCA 2WONB 3DRXA 2QJ3A 3I5AA 3OW2R 4ZMMA 4ZCKA 4QU7A 1AZSB 1DTQB 3TNVA 3D9BA 4ER8A 4J9LA 1WC0A 2AYMA 3OL8A 2V6AA 4KHRA 1S6QA 3QLHB 4F3MA 1PJ5A 4ED5A 1V5IB 1QSYA 4B9UA 2FLLA 3G2XA 4LF8F 3UPFA 5K8PA 2L48A 4P2XA 1ZM9A 1T9TA 3DRSB 5GMEA 3OR2A 4C8MA 2KU7A 3QBCA 3J81j 4X4SA 2W2PP 1Q81T 1S1XB 3QAEA 4ZJQA 3KK3B 2QMXA 3M6XA 2QE5A 3Q8UA 4Z7YA 2G0JA 1EKSA 3SXLA 4A46A 5DGBA 3EZ5A 4Y28C 5KG1A 2YNFB 4PXDA 4B3SJ 3BDEA 4RUCA 1ACMB 1WG4A 2ZE2A 4IKAA 1UVIA 5JJBA 2BABA 1T9XA 5A2QU 3IP0A 4JI0F 4RW8A 2KN4A 1DAXA 1V3SA 2H65B 2IJNA 2HNDB 4OHZA 3K0JA 3VAIA 3QJJA 3OHAA 2EK1A 4X62F 2F8MA 3UFCX 3CMQA 4DX6A 3SV4A 1WEYA 4DV0J 2MGZA 5IT4A 4Y2IA 3H98A 4C8NA 3UD4P 1RT2B 1J5OB 3MEGB 3IWNC 9ATCB 2P5VA 3CCZA 3HJVA 1HW8A 2BM0A 5ETSA 5F8HA 4L3NA 1N34J 2D41A 3JXOA 1GAOA 3DLHA 4PAAA 2NSBA 3CNQP 4NA3A 3ILJA 2W1BA 5KFTA 2DXDA 3W1YC 4ECUA 2QN6B 5D4NA 3OXFA 4B08A 5ETLA 3VQSA 4EZ6A 4LFAJ 5KFNA 4U95A 4ZDNA 2JNJA 2E29A 2E5JA 1KD1T 2NZ4A 2ROEA 2DGXA 2NXCA 3VZIA 2JOQA 5B0DA 3HT3A 1RTJB 1CJUA 3MXHP 3SZ2A 1JLQA 1N5YA 3SCLE 2F9DA 2GJ2A 4ID5A 3VVUA 1GTHA 1K8AT 4Q8FA 1SKSA 1BWVA 1Q53A 4M8LA 3D1HA 4G3IA 1RZMA 2ZM6J 1U24A 2XY6A 1WOSA 1HWLA 3MM9A 3LAKA 3M2VA 3LANA 3CIMA 5C24B 4MTPA 2OP5A 4IYQA 1I94F 1U1QA 2MB0B 1IBLJ 2IIHA 4TYBA 4NCGA 1RYRA 2V4QA 2CQ2A 3LTOA 3V2UC 3K5LA 3CMAS 4J9QA 5B0FA 1GXUA 4WP9A 1FI4A 4F67A 1SIWB 3LALA 1YJRA 3F44A 3UDVA 3W3SA 3QYYA 1APSA 3P4UB 5J1EA 4Y2CA 4FYVB 3I9V9 3MR2A 2FUG9 2YWKA 1RT5B 5LMNJ 4Q2MA 3C19A 4Y00A 3WZ0A 2HS4A 1SH0A 3AT1B 4WZQA 3DDNA 4ANDA 3GQCA 3RAXA 4LRBA 4JV0A 4PABA 2G0CA 4LBHA 5HO4A 2HK3A 4WE1A 2R42A 4NZ0A 4MIBA 1IJEB 1PBAA 4H4KC 3HHLB 2ZEJA 2OD4A 4KHMA 3M4XA 3P6YC 3MAHA 3ZC4A 3TVYA 4YEAA 1SCJB 3G71S 2BJ3A 2NLWA 4YMEA 1WORA 4PPDA 4L73A 1QTNB 1MN9A 2CNKB 2QYCA 2GIRA 3KHHA 2ZHOA 2RQKA 2EFOA 3MAAA 2QA2A 3D3CJ 5HN0A 3MM5B 1U2RA 5B0EA 2E1MC 5DM7Q 2W9BA 3RAQA 3ZZPA 3LUYA 3OJUA 4QIFA 1VC5A 2VFUA 2OTLS 1KWMA 2CWKA 3HSDA 2UUCJ 3V4IB 1KLMA 5E41A 4YR0A 4NLUA 3CO9A 1TELA 2HHTA 3I0RA 2C2RA 1S6QB 4OZJA 2HW3A 4HVZA 4DFPA 4CWBA 1LW2A 4MIAA 4HH1A 4F0HA 4JI4J 4MMOA 4FPIA 1TAUA 1RWOB 5CZVA 3PZPA 5D77A 3IGNA 3QT6A 4DCOB 3J80U 4NLXA 4EMDA 3MECB 1ZTTA 1NM2A 4AXJA 3KLFA 4RR5A 2B4UA 2VJUA 4OI0A 3MR3A 4XDCA 5J1PA 2V68A 5F8MA 3W5YA 4LBPA 3UD3P 2ZE2B 2XEXA 1JJHA 2FVRA 2IDEA 4USKA 5B0BA 3DOKA 1WC1A 4YB5A 1Q8KA 2XG8A 4ECYA 4PXBA 2Y9HA 2I9SA 3ZTOA 3MTJA 3D7SB 2BRKA 3EGNA 4ZKAA 5KFOA 4ECQA 5ADZA 2I6WA 1DZ5A 4M5HA 2MGZB 2IVFB 2M0GB 2P9GA 4RUBA 4B3SF 2HLUA 1T94A 4DPTA 2HFOA 5DG8A 3W9IA 3M8WA 2YKAA 1SQFA 4YS2A 3UWTA 5F9LA 3K5MA 4DV3J 3MF5A 3PEHA 3DLKB 2B8QA 4KAIA 1N54B 4U96A 4LBIA 3PXGa 4DV0F 3QRPA 2KYZA 3NGSA 1WTFA 4FP9A 4ELVA 1T0TV 1X5SA 5B0CA 1WI8A 4DR6J 1FD8A 4HHHA 2JEFA 2CPEA 4CYUB 4OI6A 1NK4A 1NCLA 3ISZA 2DPJA 4ID5B 3HULA 1IWAA 1N34F 1NDPA 4OJ1A 1NRKA 2Y1IA 1Q4RA 1KVKA 3CJ2A 4LFAF 3T1HJ 2MZRA 2GA7A 4K50A 2VOPA 4RU2A 2MKCA 5GAGI 2UXBJ 2UVUA 4OZ5A 1FDDA 1EAYC 1DQ8A 2V4JA 2DY1A 4NCGB 3BREA 1YZ7A 4K4TA 4QWAA 5KFZA 1GTEA 2X1FA 2I2YA 4DDFA 1S97A 3DKDA 2KZZA 4RW4A 2A6OA 1BY9A 3SV3A 3QIDA 4KYZA 1U25A 4Q8EA 1NHVA 2CPJA 1Y9OA 3KK2A 2ZM6F 3P96A 4IOAQ 2DHGA 1NNDA 5J1EB 4NASA 3GJSB 5GAHI 2GJFA 1WC4A 1IR1A 3FCHA 4PG4A 5A8WA 1HMVB 4C3MA 3KUEA 2HS3A 4N8NA 1QSSA 1RCOB 2B9YA 2JZ5A 1DURA 2VPWB 1RHKB 3TA1A 1AT1B 1MW7A 2IHR1 2W2QP 3VTIA 5E3PA 4AXIA 1JJ4A 3GG1A 4F8RA 1RTDA 2GFFA 3C66A 4WFNQ 1MMNA 2ZC3A 3NAHA 2Z30B 2M5YA 3UVJB 4A8FA 2XWYA 1FT8A 2EPIA 4ILRA 3TUPA 4H4MA 5M2UA 2GO9A 2AQ4A 2LQ5A 2VASA 4B3RJ 1QM9A 1VS3A 4U8VA 2VQFJ 4KGZB 5LMNF 3KJQB 2VG7A 4L75A 3PEJA 2LU1A 2V4RA 2F5GA 1S99A 3LO3A 2Z4PA 2NR0A 4Z7CA 1DLOB 5HI7A 1YJVA 1GT8A 3DLEA 3HD2A 2JFKA 2ROGA 1OMSA 2AGQA 3N0VA 2WBMA 5KFFA 1Y3KA 2B4OA 2I1RA 4KC5A 2M9KA 5CYQA 2DO4A 2Q6BA 1KLMB 3OVBA 3I0RB 4OX7A 3K5NA 1U2FA 2CG4A 3OFEA 2DT9A 4USIA 1WDDA 4WP3A 1VBXA 4YDDB 4K2XA 1JLGA 4FF3A 3D28A 1R3NA 4DX8H 2IA0A 1RBOB 4LF9J 2AJ1A 1NB2A 4Q43A 2QV6A 3CGIA 3S1TA 5T7LA 3C15A 3ENQA 1YBTA 2EFPA 2RF2B 2P9CA 3KLFB 3MM7A 2CPXA 2WTFA 2UUCF 3LP0B 1B99A 3D0IE 3BBCA 2HFUA 5B08A 3CIZA 1RT4A 5KG5A 2DRAA 4JI4F 4M5MA 4F3OA 2IRUA 1XJWB 4UQGA 3ETMA 5IT0A 4V19J 1MU2A 4OX8A 3KHGA 3CO0P 4JI6F 1T05B 1F3FA 1PCAA 2O66A 2DB1A 2E7XA 2RUSA 2J9EA 3W2VA 1U26A 3OFHA 2W2NP 4GVBA 5B0GA 2B4VA 3IAS9 4DHVA 4C3LA 2LXIA 2CJ9A 2H3EB 1YLXA 1TVRA 1MSWD 2WVFA 2FGOA 1I5OB 1PKUA 1JLFA 4B9VA 1VOMA 2KXHA 3JAMY 1LKZA 5HANA 1WC3A 4LF4F 4FVMA 2PGCA 2XNRA 2KHCA 5SZTA 3THVA 2ZH4A 2YXLA 1FJCA 3CDAA 5KFIA 4OX9J 3UDCA 1ZM3A 3M8SA 3MPUB 3D67A 1WG5A 3D6HB 3KG4A 5FD1A 1CULA 3DM2A 3AOAA 1VLOA 3IRXB 4HT5A 2V9WA 3V6DA 1HI1A 4R0JA 4TVAB 1F9HA 4LSLB 2AYGA 4WU3A 2CQ4A 2OHDA 1X4BA 1OPZA 4LFCF 3P3DA 2XCPA 3BZQA 4X4VA 4CTAA 2HURA 1XN9A 3CD0A 1RAHB 1OQ3A 3CE8A 3IBCB 1RT3A 2FZGB 4AYBD 3MM6A 4DV3F 1CJKA 2L41A 4ED7A 3PRDA 4USTA 2R4FA 2LFVA 4NA2A 2FC8A 4OIXA 3BSAA 2F4FA 1JKHA 2DXFA 2AMCB 2V4JB 4DR6F 1RHRB 1GFWB 1F9FA 1NSKL 3P45B 1RHQB 3L09A 4OZ3A 4I6AA 2V94A 3D66A 3WBZA 2G1DA 3PRVA 3R2CJ 1FJEB 1WF2A 2PC6A 3DC2A 3VAKA 2X1BA 1HNWJ 1NH7A 3KK2B 2EBEA 2A2CA 4ZVEA 1RADB 5A8WB 2XMTA 3T6BA 2QSWA 3PDNA 4ZN1A 3T1HF 1TKZB 1JB0C 2YTCA 4I6WA 3NWGA 2UXBF 1UZDA 2CXEA 2E7WA 2DJWA 5H9FK 4FXWA 2AD9A 1YJ7A 4K4WA 2KHDA 4O3OA 4NCAA 4QWDA 2HHWA 3QAUA 2YWEA 5HJYA 3PW5A 5G0RA 2OPRA 4H4MB 5LL6d 4FF2A 5FDLB 3QQCD 5CZXA 5K9FA 3W2WA 2R7XA 5KT2A 2HHHF 4CNZA 4XPCA 3H2UB 2XBPA 1GX5A 1TP7A 4GO5X 4OHYA 3ZZRA 3G82B 1UVMA 2Z58B 5LXRA 4LSNA 4PQUB 2HBZB 2JWNA 2F8HA 4ZCIA 3KMSA 4I2PA 5GADU 2O01C 5CYQB 2FHMA 3NL0A 4USHA 4F2RA 3BH7B 3CMES 4B3RF 1Q7LB 2MQLA 1SB6A 2RNEA 5KFJA 4B02A 2EG1A 1RWWB 4DMZA 4FYWB 2PO4A 3SQGB 1JLGB 1CBKA 2IMWP 3HPOA 2XI2A 4NLQA 4F04B 3MR7A 2GVZA 3QT7A 4A8QA 2FJDB 3P8BB 4RWWA 3T3FA 2X3GA 2HAIA 4DFJA 4WF9Q 5T7LB 2CUYA 2CJKA 4DQPA 5EX0A 3CCRS 3Q83A 1FTCA 4G1QA 1WEZA 2W24A 1KFSA 2LDIA 2ACYA 1RT4B 2B43A 1DY3A 1S6PA 2QO3A 3OTDA 1R8HA 4DSEA 4O4GA 4XTTA 3PX6A 2VKZG 4I64A 2HIYA 2RMLA 2XMKA 3ZZTA 3PW4A 3BM7A 1MU2B 1TTHB 1GK8A 1WDTA 2HGNA 2FGCA 4P2SA 3CJ5A 4OZ2A 3T19A 4RLEA 2KKHA 3W2VB 4OYIA 1KLNA 3BN7A 4UZBA 1N5SA 3SYZA 3RBEA 2QA4S 2DCUB 2QLWA 2YKMA 1AFIA 4RUAA 3KLEB 3TX0A 3EXYA 2IC3B 1S1WA 1JJCB 3QPIA 1JLBA 3OD2A 2P6TA 3MPWA 4ED8A 4WYLA 3HHEA 2ZDPA 4RNMA 2HFZA 2L3MA 4LFBF 2ZZTA 1HNXJ 3O6QA 2CQIA 4U7UD 3FFIA 4DFKA 3WDOA 1CULB 3DM2B 1NSPA 2J8SA 1RABB 2HGMA 3TUJC 3DXSX 5F3ZA 2ASJA 2LQ9A 4CP5A 5L1LA 3CD7A 2XY5A 1YITS 1FD2A 1GMWD 2V9KA 1GEHA 2J0XA 2V8PA 3WIVA 5KG2A 4C11A 4ZOSA 3OBIA 1Y3JA 3GB0A 1UFLA 4CLLA 1JJ2R 1RT3B 2IAJA 1H0HB 4OX9F 5CABA 2HBQB 2QMWA 3FK4A 2RDDA 4ZPWR 1CC8A 3IBWA 2N3OA 1WC6A 2KYXA 1RT6A 2NZCA 2DEJA 1FVQA 1NK6A 3MR6A 3GTYX 3UCZP 2C2ZB 3BPDA 1LFWA 4DG1B 3R5AA 2J0SD 4TYAA 4WU2A 4DX5A 1RWXB 2WSCC 4BC9A 2X1AA 1SKRA 2VOOA 3IC1A 5DLFA 3PO5A 2DNLA 1NAQA 4O23A 2V5HG 1PJ6A 2V69A 2AYEA 1X4FA 5CCLA 4FKYA 5KFUA 2M4MA 3MI7X 3JQJA 1RLDA 2BOAA 2VBXA 2F9JA 2ALZA 1RA7A 3DYAB 5AE2A 2LQ8A 4G1PA 4ZVUB 2ZWPA 2ZH9A 1Q1KA 3MPYA 2H48B 3IM9A 2YPZA 2OELA 5KFLA 1KSPA 4WTYA 1JNRB 5FIIA 1RYSA 1HQ2A 5HBMA 1R89A 4OFZA 4DR3J 1S9EB 1PILA 1X8DA 1QAYA 1HNWF 2XYPB 1SI9A 1KOOA 5GAEI 3CCJS 3US5A 1HARA 3Q8VA 1LWFA 3KWMA 1XIQA 4QPXA 5HQLA 2VV5A 1ZOTA 5J2NA 4DV1J 1BQMA 1K44A 1MWQA 3HKWA 2A18A 4KTQA 2RH3A 2ZITA 4HHJA 3EX7B 1DQAA 4WCEQ 1OY9A 4ATNA 1SV5A 5HVFA 3K57A 4CO2A 4OYMA 3P5BP 1X0PA 3GJTB 4ZK7M 3BPSP 1FRJA 1U1PA 2MLXA 4NZ6A 4NLTA 1EARA 3IN5A 4LSNB 2IJFA 4FXVA 3RW7A 2M88A 1XR6A 3HI9A 2KVIA 3M1VA 1JXEA 1SPBP 3H5YA 3EDQB 2HHXA 1B70B 2LEPA 5FLXU 3OUYA 1RAAB 3J7AN 3EZUA 2FJVA 4DV4J 4U6PA 1E6VB 1KHVA 2BUNA 2WVDA 1WF0A 1ZBTA 1HHTP 4DX7A 1S6UA 4CI0B 1TU0B 5E33A 4J9NA 2V50A 3MFIA 2YY3A 1Y00A 1UJ5A 3TO8A 3GJRB 2XB2D 2GVZB 4IRDA 3IR7B 2QLJB 4EK2A 1S1VB 4RL1A 4J9SA 1FESA 1T02A 2V2ZA 1RWUA 3N28A 1DRZA 1XMOJ 3G86A 3ULHA 2HNYB 1DTTA 2QL7B 2OMLA 3K5PA 2QFIA 1M5PC 2YQ1A 1MMLA 2HS0A 5K14B 2VBYA 4IH7A 3FUYA 4OLOA 2RRAA 3KHRA 4YY3J 3OXGA 2ZFHA 5I3UA 1SL2A 3IRWP 4PG5A 2BOPA 2RAQA 5EX3A 1TKXB 2LYVA 2VBZA 1Q8IA 4MT1A 3C14B 4U7UK 4B3OA 4ZPCA 2IM1A 2JEJA 2PMZD 4ZJOA 1VJWA 3OTBA 3W62A 4DUZJ 2KVQE 2XY7A 1JLBB 2VG5B 1HA1A 3KNAA 2OPPA 2BQ3A 1IKVA 2FVPA 5J1NA 3EUNA 5LM7E 5ETQA 5DGAA 3HHDA 3DDIA 2ZOFA 4UOHA 3FFIB 1SKUB 3HXMA 4IQXA 2BJEA 1NHKL 4E8UA 2D1CA 2HQFA 1YG0A 2DISA 2XGPA 2GAHC 2BANB 4RW6A 4X4TA 5IT9Y 2IPOB 4RNHA 4TXSA 4KRWA 1Y7PA 4E2FB 2ZH1A 2CDQA 2DRDA 2VU5A 4QWEA 3M8PB 3KUHA 4KGVB 3G6XA 4QYZJ 3MOJB 1VQ6S 3MUVP 5L38A 3E51A 4GKKJ 1HNXF 3S7RA 3D0HE 3UNYA 2HQDA 4KH1B 3GR0A 2FHJD 5MLCV 2KO1A 4JB8B 3JTPA 2VODA 2PE8A 4OHVA 5M2PA 3D2WA 3DRPA 2VUGA 2MZ1A 2OPSB 2QYGA 1RBAA 1S1UB 1N4LA 2UUBJ 1IKWA 1UW4A 3CDUA 5EWGA 2J9DA 4DN9A 4HKQA 1N48A 2WB1D 3AOBA 5HSPA 5C2GA 1U48A 1YJNS 5IM0A 4RNNA 2XYGB 4I7FA 3ITHA 4QJVA 5KT7A 2J9DE 3CUNA 4UZCA 3W8GA 3T1YJ 4IRCA 1F0XA 1WKKA 3CCWA 1XR7A 1RK8A 4LF7J 2HHPA 1KDNA 5HBMB 2HKEA 3RBDA 5D0HA 2XM3A 2MKJA 3NKYA 1UZHA 2XO6A 5K8MA 2FC9A 1HWKA 1LWFB 4OYWA 2Z2LA 4LRCA 2BX6A 4OHWA 2MKSA 1BQMB 2XTJP 3EWGA 3GV8B 1SV5B 4UOFA 1RAIB 1R0CB 2HMIA 3OXLA 2ZJQQ 2IVMA 3TP2A 3OLBA 3HT0A 4C8KA 3BBFA 2UUAJ 3QATA 3M1VB 2QLXA 2QRRA 3VALA 4OI3A 3H7HB 1CJTA 4ZPDA 3C6UA 4M5LA 4OV6A 2XO7A 1U45A 1U47A 4DV1F 3G87A 1VRQC 2HRUA 2L9WA 1VQ8S 3KKFA 3NNCA 4EO8A 1OYDA 1KTVA 1S1TA 4EYHB 3DU5A 1RWPB 3HKZD 3NMAA 3LP2A 2FD2A 2MTLA 5DQGA 1BHNA 3A3NB 5D0RA 1N5TA 5D78A 3QNWB 4Y34A 3ZTRA 1LV5A 2ZH5A 4NLRA 4EU0A 4OI1A 1RE1B 2GIQA 2H9ZA 1FVSA 3MEDA 1FRLA 2DGSA 4DV4F 2GJIA 1DTTB 3TI0A 4NLPA 3QMQA 2N4CA 3PIPQ 2MXYA 2HFVA 2IYGA 4NEYA 2N3LA 5DDRC 1TKTB 5J2PA 1X9WA 2EXUA 2E1PA 5E3AA 1B0TA 4NLGA 1ZM4A 3EGVA 1UJ6A 4L72B 3DLGA 1X4CA 5BYQA 2G2YA 5A6PA 1HBOA 1YRUA 3HVRA 1XMOF 2WVEA 1I51B 5ETOA 1JXVA 1V5VA 1O0PA 3NWRA 1NPKA 4IDKA 4K5RA 3S01A 4HTIA 4RNOA 3Q0AA 2CAJA 5GAGU 3O8WA 2BE2A 1X5PA 4QWCA 1VRTA 4YY3F 3UCUP 3OHBA 2B9EA 4X84A 1NDKA 2AJFE 3RR8A 3MMJA 4CLYA 4TNOA 4PUOB 4NI2B 3VV2B 2DKOB 2KJVA 3FSYA 1P1LA 4WFYA 4FN5A 4JI7J 3H25A 4PEOA 4KV8A 4UY85 3I96A 4NYZA 5F8GA 3AHPA 1LK5A 1NLKL 3ET6B 4M94A 4LF6J 1MN7A 3W63A 2LCWA 3G6ES 3CPWR 1S76D 2YVSA 2C3MA 5LSLA 4PXCA 1H3DA 2H5EA 2AEFA 3TARA 2CPIA 3U7JA 5D4LA 5IV3A 1R6VA 3K89A 3J81U 2FVCA 1ZTWA 3U1MA 2R7RA 4YP3A 5DG7A 1OO0B 2VC1A 5A76A 3J7YI 4ZPTR 5ETNA 3V5RA 1EHWA 5CYMB 4ECVA 3DRPB 2GZOA 3G4SS 2FZCB 2LXUA 3HHLD 2EFNA 1PC5A 4CZCA 2I5JA 4OQJA 1KRPA 3L7OA 3TA0A 4UT4A 3W66A 1RAOA 4AL6A 3GIKA 2RUGA 3PX0A 3M7VA 3AH6A 4GKKF 4GO7X 2KZMA 5IM0B 4I2QB 3A13A 2WCXA 1M1GA 2CQ1A 4I7FB 3FRYA 4C0HA 3LQVA 3PYDA 3ITHB 3CCES 4QR0A 2CJQA 1OY8A 1YGYA 4MK8A 3GIMA 2E5LJ 3T9ZA 4LQ3A 1UEUA 5KFGA 3EM1A 2HG4A 2ZJRQ 3BDPA 3O5TB 2ROPA 3LGHA 1NSQA 3R2DJ 2UUBF 1M0SA 3FDSA 2K1RA 2HQCA 3PV8A 4KY3A 1F5AA 1VC6A 1DJ0A 2NYIA 1ZS6A 2CZVC 4CT8A 1IKYA 4X66J 2FB0A 5EUHA 3KDOA 2ZBRA 4RX6A 4YR2A 3T1YF 2HMIB 3CCQS 4H54A 1HI8A 3BQ2A 3VCDA 1V3ZA 3KFWX 4LF7F 3MTKA 2AKWB 4DV2J 1RI7A 3JSRA 3IGVA 5ETRA 2PFDA 3A8KA 3H5SA 4PXEA 4DV7J 1EIYB 2MQOA 1T9VA 1CJTB 3DLBA 3D6FB 4OYPA 2F40A 5DQHA 4MKAA 2XCAA 1PAEX 2LQBA 4F4XA 4YDXA 1SKWA 4LIRA 4QYRA 1NK8A 1K9MT 3LP2B 1R0AA 4ZVOB 3R1HA 2BKNA 1WEXA 4J91A 4DV6J 1RJJA 2MHNA 2R3VA 4UY8T 1UKUA 1VBKA 2WK4A 2FHJA 2VHGA 1N5QA 1K73T 3IS9A 2NPIA 1VLYA 3IG1B 3TR5A 2UUAF 3BV8A 3D1QA 2CQBA 2QC3A 3M2UA 1A7GE 1C0TA 1TQLA 3T5HA 2HFNA 5HMWA 3Q89A 4DL4A 4NCBA 4C3KA 3C6TA 4CLSA 2MJNA 2JEIA 3TAPA 3PR5B 4O44B 4KSEB 4C0BA 3X1LB 4IOBA 1B64A 3WIUA 1HQUB 3ZXWA 3BQ0A 4PYDA 2EI5A 3CVKA 4MJKA 3HM9A 3RBZA 3M05A 2KFZA 4KO0A 2AJ4A 5L1IA 1ICEB 3WX4A 4OMFG 1VIOA 2OFGX 1WHVA 1YKWA 3GMGA 1MWYA 3RB3A 3DLLQ 4NE9C 3DLGB 2WONA 3TJ9A 2QTWA 2MLZA 1H6KX 4XDDA 4Y65A 2DO0A 2F65A 2QT7A 3QGIA 1VCTA 4ELUA 1DTQA 2G2ZA 3HD1A 1V6HA 2VL1A 1KR4A 2BE7D 2I38A 2VFRA 2ZNZA 4IDKB 1NK5A 3KK1A 1SC1B 4JI1J 3QLHA 2BE2B 3CJRA 5LJ3Y 5KT5A 4Q0BB 4OJHA 5L1JA 2J6TA 2WHOA 2HEKA 2XMAA 4ZCLA 1FXLA 2OPQB 2RQCA 2KL8A 1LNQA 2E44A 2JRSA 4DSIA 2H5JB 4QR1A 5EN1A 4KV8B 1S1XA 3KK3A 1FO1A 5LT5A 1FDAA 2PDAA 5KG6A 3ZZYA 4J9KA 2KDOA 3PHEA 3I4HX 3I55S 2N7YA 4NMLA 1S7HA 1WWHA 2VC0A 2ZZNA 2DR6A 3Q8PB 1HWIA 2VIHA 1BQNA 5F3TA 3DGPA 3Q24A 4IO9Q 1PYOB 4HL9A 3JQMA 2OFHX 1Q79A 3ZFVA 4G6VB 5KG7A 1KKHA 1OWXA 4D3GA 2R2TA 4LF6F 1FRXA 1URRA 4HT7A 3AAWB 2K7JA 1SL0A 1C2PA 1S49A 1RT2A 4QIWD 3C2PA 2CG8A 1FNMA 2B7BB 1LOUA 4O3RA 2G1HA 3FEXB 2BACA 1QE1A 4I6YA 4OV1A 5HROB 4K4XA 3V6KA 2ILYA 2IRYA 3SMZA 4X4RA 2BMBA 4MKBA 1XNRJ 4B9TA 3BGOP 1X5TA 3R5DA 4B3TJ 1IM6A 1FRHA 1TL1B 2D69A 2QX0A 3T9NA 1IXKA 4ZS6A 3P5TL 1FFGB 1ULRA 2LA6A 4ES3A 2CJYB 3M8QA 1RU1A 3BO4A 3JSMA 2DR7A 4H4OA 5HLFB 5HVHA 3MD3A 3ZTSA 5THWA 4OJ3A 2K1RB 1EQMA 2JX2A 3TVZA 2UXDJ 4DEZA 4X2BA 3AODA 3KYLA 3AA8A 4FBUA 2OD6A 2EEYA 5HATA 2GX8A 2IY5B 1KC8T 2YKQA 3C16A 2E5LF 1UEKA 5C24A 3FC9A 2WOMB 1SBRA 2E5HA 1DQ9A 2CKWA 1UETA 3NXZA 2IM0A 1IJFB 2M2BA 1IN0A 5DQIA 4K5SA 1I1GA 2UVWA 3R1LA 1T7PA 2AWZA 5IOLA 1RACB 3DXBA 1TR0A 1OS5A 3JQKA 5T14A 2HZAA 2GIFA 3K5OA 4UQTA 4LMZA 4DV2F 3IS9B 5A8RA 2PN6A 5LSRA 5K20B 3MPVA 4EUVA 3GPAA 3M2UB 4L74A 1M5SA 4DV7F 2OTJS 4HHUA 4ED0A 4JI2J 5I42B 3C6TB
chains in the Genus database with same CATH topology
5F8JA 2ZBCA 4NPOA 2E7WA 2DJWA 3HHLA 3ONQA 3EGWB 3PFEA 5KFDA 1TKTA 2VFTA 4FXWA 4F26A 2X1GA 3PIOQ 1Z2ZA 1LW0B 2DD8S 2GHWA 1RGVA 2AD9A 3RRHA 3LP1A 1FE4A 2F8EX 3HO1A 4TQRA 5EWFA 3N5BA 1TK5A 4DR4F 2CQCA 2ZDOA 2F3JA 5A0YA 4K4WA 1ZAVA 2KHDA 3BGRB 4O3OA 3KLHB 4NCAA 3N6LA 4F25A 2YNGA 1F5BA 4QWDA 2DH8A 2HHWA 3QAUA 1M5VC 4A8XA 3L7PA 1J5EF 2YWEA 1REVA 4DV6F 4I68A 3PW5A 5F8NA 1HFEL 4USJC 2XLKA 1X4AA 5G0RA 2OPRA 4H4MB 2CQDA 2DGQA 1YWXA 2FHKA 3MM5A 3I6PA 2RJZA 2VG6A 4KO0B 2Y1RI 5LL6d 3V6JA 2RRNA 4CH0S 2DRBA 3T5LA 4MKYA 1C4AA 4FF2A 3VAGA 6FD1A 2UP1A 3CC7S 5FDLB 2HQIA 5CZXA 5K9FA 3W2WA 1TK0A 3SDEA 2R7XA 2C3PA 1Q16B 5KT2A 2HHHF 4CNZA 4QZVB 4XPCA 3H2UB 2XBPA 4MH8A 3UR3C 1FKOA 1GX5A 3NCPA 4YUDA 2ZC4A 4KKOA 3SCIE 2MDAA 4R0EA 3WC0A 4B17A 4K4VA 2N82B 3QWPA 3ENVA 3T1AA 2COLA 1U4BA 3HF5A 4CO1A 3U1LA 1TP7A 4GO5X 1VQOS 3F73A 2R7SA 5LJ5Y 4OHYA 4M95A 4OZLA 3ZZRA 1K1QA 1JLQB 1N5YB 1FCAA 1UVMA 2O1PA 1ZZNA 1FE0A 3LW5C 3MWBA 2R9LA 3BEGB 5HMZA 2FJXA 3V4IA 2HIQA 5LXRA 1CPZA 2NPFA 2ZNYA 3IXQA 2GHPA 4LSNA 4PQUB 1H7XA 2AJ0A 4EYIB 4QIGA 4D3HA 2GQQA 2JWNA 4HI1A 4QU6A 2OKQA 1WTBA 1QUPA 2F8HA 3U27A 4A8KA 1R8CA 3KK1B 1VBZA 1OQ6A 2NUHA 4ZCIA 3KMSA 1O5JA 5JVGQ 1YHQS 1U6ZA 1QAIA 4PUOA 3QJPA 2XSJA 4I2PA 3UI3A 5GADU 1N32F 3JYTB 1FRMA 2C28A 2O01C 4ED1A 5CYQB 1WI6A 2RT3A 1JWWA 2FHMA 1CQNA 3NL0A 4USHA 4ZPVR 5ITHA 3D1OA 4IG3A 1YRXA 2HQ3A 3CWJA 2R2UA 4CCHA 1YRTA 3MM9B 4F2RA 4K4UA 2W4CA 2FLNA 3M2VB 3MEKA 3H2LA 3CMES 3CSKA 3T5JA 4B3RF 1Q7LB 3DHXA 2MQLA 1SB6A 4AUKA 2RNEA 5KFJA 2DR8A 4B02A 2CJBA 2EG1A 4DMZA 4PRFA 4Y2MA 3JB9k 4FBTA 1UVKA 1Y5NB 2V8DA 4LVNP 1RP5A 3H59A 2PO4A 3SQGB 3C6UB 1JLAA 1JLGB 4RW9B 2MKIA 2NSCA 2IMWP 1K1SA 4E0DA 3HPOA 4Q44A 4B9NA 3TW0A 2XI2A 3MECA 5AJ3F 1IM4A 2KXNB 4NLQA 3OR1A 2A3JA 2Z0GA 5D4PA 1XMQF 4A8QA 3MZIA 2FJDB 4RWWA 2F1FA 5EGYA 3T3FA 1S1TB 2X3GA 2RSQA 1YJWS 1VQ7S 2HAIA 1HNIA