1JLQB

Crystal structure of hiv-1 reverse transcriptase in complex with 739w94
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
425
structure length
405
Chain Sequence
IETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 RT, A-CHAIN
publication title 2-Amino-6-arylsulfonylbenzonitriles as non-nucleoside reverse transcriptase inhibitors of HIV-1.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Transferase
total genus 111
structure length 405
sequence length 425
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2001-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1jlqB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jlqB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jlqB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jlqB03
4YQWA 5K14B 4XPCA 2AGQA 3KLGB 3N6LA 2IAJA 1JLBA 3DLGA 1SH0A 4I2PA 3KHGA 4J9KA 1C1BA 5KG4A 5KG1A 2E9ZA 1RT3B 2RKIA 2R2TA 5J2QA 3PW4A 3CDUA 3EPGA 5T14A 3H59A 2W9BB 2W7OA 1C2PA 2W9CA 5DQGA 3RAXA 3T5KA 4Q44A 1R0AA 3PW0A 4IFYB 3UR0A 3Q8PB 1JKHA 3RB4A 3PJXA 4RUCA 4KKOB 1JIHA 1S10A 5J1EB 2XCAA 2V9WA 1IKVB 5KFUA 2HWIA 3HVTB 5EUHA 4O3PA 5DGAA 4IG0B 4TYAA 4X2BA 2IM3A 5KG3A 1SV5A 2YKMA 3DRRB 5J2MB 3QYYA 5KT2A 4YR2A 3OL7A 3ISND 3GQCA 3V6KA 4R0EA 4RW7B 3T5HA 1EP4A 4IG3B 1LWFB 4RW4B 3DOLB 2IC3A 1S4FA 2WRMA 3LP2A 3I0RA 4KO0A 3IG1A 1FKOA 3ITHA 4LSNA 2IAJB 5L9XA 1JLBB 3OSPA 4DEZA 3DLGB 4I2PB 2E9RX 1LWEA 3RBEA 1VRUA 2RKIB 2HNZA 5J2QB 1C0TA 5F8HA 4ECYA 3C6UA 3HHKA 4O44A 2W9CB 1HNIA 2J6SA 4URQU 4IDKA 1R0AB 4RNNA 3BSNA 1VRTA 1RT7A 3I0SA 1JKHB 4ICLA 2J6TA 3T19A 2V4QA 1WNEA 2YNIA 3MEGB 5JXSA 3RB3A 3DDKA 4H54A 1IKWA 2WOMA 1D1UA 1S9EA 1U09A 4J9NA 2AX1A 4ECWA 4ED6A 1S1UA 3M8PA 3TAMA 3FRZA 4IH6A 4O4RA 4J9MA 3D5MA 3KLHA 1SV5B 2YKMB 3CIZA 3SFGA 5KFXA 2FVRA 4ZVGA 2YNHA 3LAKA 1N5YA 4RNMA 4MK8A 3IRXA 3G6XA 3BREA 1EP4B 4EYHB 4ZVEA 2R2SA 3I5BA 3MR6A 1RTIA 2YNFA 2IC3B 5CYQA 3LP2B 3I0RB 5HP1A 4KO0B 2R8JA 3IG1B 4JUZA 1FKOB 3ITHB 1IKXA 2ASDA 2C2EA 4LSNB 3BQ0A 3GILA 1TKZA 5KG7A 2JEJA 5F8JA 2YKNB 4ECTA 1HYSA 3PW5A 5KFMA 3KK2A 1LWEB 3KOAA 1VRUB 2HNZB 3MEEA 1C0TB 2UVWA 2B5JA 4Y2AA 3C6UB 1HNVA 2FJXA 4U7CA 4O44B 4YP3A 3LAMA 4H4MA 1HNIB 5HBMA 3SFUA 4FBTA 3PHEA 1N48A 2FLNA 4IDKB 5C25A 1VRTB 4G3IA 1RT7B 3I0SB 4ICLB 4LQ3A 3QIDA 2XC9A 4R5PA 2YNIB 3KLFA 2R2UA 4JV1A 3HVWA 2HAIA 3H4BA 1IKWB 2WOMB 1S9EB 2RF2A 1S1UB 3M8PB 3TAMB 4O3SA 3KLHB 3H5UA 3SI8A 2YNHB 3QIPA 3LP0A 1N5YB 3BSCA 3IRXB 4Y3CA 4TY9A 2AQ4A 2WB4A 4XPEA 4URGA 4EO6A 4ECXA 2OH2A 5CYQB 2YNFB 4NLPA 3KHHA 2OPPA 4O3QA 4F4WA 5HP1B 4ECUA 4ED2A 3NBPA 5L1LA 1IKXB 3JSMA 4DL3A 1TKZB 1ZTWA 2ZKUA 1HYSB 3NGDA 1QE1A 3M8QA 3KK2B 3EZUA 4NLUA 3MEEB 4K4UA 2B5JB 1W25A 4Q8EA 5KT6A 4RW6A 3MF5A 1HNVB 3UDLA 2BQ3A 3H2LA 3QGHA 4H4MB 5HBMB 4DL2A 4Q8FA 2JLEA 4QPXA 1K1SA 5C25B 4WZQA 4MK9A 4WE1A 4J9LA 3N6MA 4G1QA 4R5PB 1TP7A 5KFHA 2UVUA 2CJQA 3RBDA 3BR9A 3KLFB 4IR9A 3GIJA 3KLEA 4IRKA 2RF2B 2QV6A 3PJWA 3EPIA 1RYRA 4DL4A 5KFRA 1LW2A 1T03A 3KLIA 1T3NA 3QIPB 3LP0B 3JYTA 1KLMA 1YVFA 3KMQA 4NYZA 3H40A 3CO9A 2OPPB 3NBPB 3H5XA 2C28A 3T1AA 3JSMB 4K4XA 4ZVFA 1HPZA 4O3RA 4MFBA 4MH8A 3H98A 1S0OA 1QE1B 4ZHRA 3M8QB 4U6PA 2UVRA 1HMVA 3KNAA 4RW6B 4GC7A 1SUQA 5KT7A 5L1JA 1REVA 1N56A 5DG8A 2VG5A 3Q8SB 4WE1B 4ED8A 4G1QB 4RNFA 1RDRA 3KLEB 5EWGA 1S1TB 4XO0A 4QWBA 5C5JA 2I1RA 5KFWA 4NLVA 1LW2B 1T03B 3KLIB 4ZMMA 1ZETA 3JYTB 1KLMB 1S1VA 2FLPA 4OL8A 1LWCA 1TKXA 4RNHA 3V6JA 2DPJA 4TQSA 4ED0A 2QE5A 1JX4A 3V6HA 5FDLA 3FDSA 3V81A 2D3UA 3BJYA 3DRSA 4PUOA 3FSIA 1HPZB 2FVCA 4MFBB 3M9OB 1UWBA 2ZE2A 4ZHRB 4R8UA 1HMVB 3GYNA 1C1BB 4NZ0A 4Y2CA 4EYIB 3CWJA 1SUQB 4ECRA 1QUVA 4TYBA 3OHAA 1REVB 5L1IA 2FLLA 3KHLA 5KFPA 3CJ3A 2VG5B 3M9NB 3Q8RB 1KHVA 1RT6A 3CVKA 3MR5A 2FJWA 5KFBA 4PQUA 1MU2A 4RW9A 4K4VA 3TQ1A 1RT4A 5EWFA 1NNDA 3UPFA 3NAIA 5C42A 2XI3A 5KFEA 5D3GA 1XR5A 2XI2A 1TKXB 1JLAA 2OPQA 3RB0A 3G86A 2WHOA 5FDLB 4TQRA 3V81B 1N6QA 1QAJA 4KHRA 3DRSB 5J2PA 4PUOB 1N4LA 4WFYA 3OLBA 4RUAA 1UWBB 2ZE2B 4R8UB 5KFCA 4ECQA 5KFNA 1FKPA 4YMEA 4J9RA 3MECA 3DOKA 5KT4A 1SH2A 3UQSA 1JLFA 5F9LA 2VG6A 5KFOA 1JLEA 3H5SA 4IQXA 4LSLA 4H4OA 1RA6A 5KFZA 2ZD1A 1RT6B 4PQUB 1MU2B 2WONA 4RW9B 5DLGA 5I42A 1RT4B 5F8MA 3BQ2A 3PW2A 1XR6A 5C42B 1T05A 4NLWA 2VG7A 5D3GB 2D41A 2XGQA 2HNDA 2YNGA 2FVQA 2XGPA 3D28A 1RTDA 3G6YA 2FVSA 1JLAB 2OPQB 4K4WA 2IM1A 4Q45A 3DM2A 1RTIB 4KE5A 3QO9A 3KMSA 2BR0A 1N6QB 1TL1A 4DL7A 3LANA 1J5OA 5J2PB 4TLRA 1MMLA 3T5LA 5KG6A 5KFFA 4KAIA 4F4ZA 4FS2A 3QLHA 1FKPB 1RT2A 2HNYA 3DOKB 3MECB 3PW7A 4EBCA 3RB6A 4NRUA 1D0EA 5F8GA 1C1CA 1JLFB 2ATLA 2VG6B 1TV6A 1JLEB 4LQ9A 3KK1A 4F4YA 4EBDA 2I5JA 2GC8A 4LSLB 3OSNA 3NMAA 4H4OB 3H4DA 3GV7B 3RAQA 1S6QA 3LP1A 2ZD1B 1JLCA 3IGVA 1BQMA 1LW0A 4JV2A 2WONB 1DLOA 5I42B 3T5JA 1TVRA 3GV8B 1T05B 5KFJA 1HQEA 2VG7B 4J9SA 2UVVA 3GIIA 2HNDB 2YNGB 4NCGA 5KFTA 3HVAA 1RTDB 5KFKA 2O5DA 2EC0A 3GIMA 4NLYA 3GIKA 3DM2B 2XWYA 2RDJA 3QO9B 3NKYA 1TL1B 3BGRA 1J5OB 3BQ1A 2C2DA 5L1KA 5KG0A 3HKWA 5KFDA 3KHRA 2BQUA 2BANA 4FBUA 3QLHB 5KFQA 3FFIA 1FK9A 1RT2B 3FQKA 5DQIA 5F8IA 2HNYB 4DG1A 3QGGA 4ID5A 3MFIA 4MKAA 1C1CB 5KFLA 4GC6A 1TV6B 4JV0A 2FVPA 2F8EX 3KK1B 2I5JB 4K50A 3LALA 1RAJA 4ZPBA 3DI6A 3TVKA 2C2RA 1S6QB 5EDWA 3LP1B 4K4TA 4EEYA 5J2NA 1JLCB 4TY8A 5KT5A 1LW0B 3MEDA 5DQHA 2AU0A 5KFVA 3Q8QB 3C6TA 4YR3A 1DLOB 5F9NA 3E01A 1TVRB 3DLKA 1S1XA 1CSJA 1S0NA 1T94A 5EWEA 4K4SA 4MKBA 4NCGB 4YR0A 5KFYA 4MIBA 5I3UA 5KFAA 1DTQA 2V0NA 5KFIA 1Z4UA 4ZPDA 2D3ZA 4MK7A 4HYKA 3BGRB 4IH7A 2FJVA 2R8IA 3QZ7A 1C0UA 2ASLA 2BANB 3KK3A 3BSOA 4J9QA 3FFIB 1FK9B 1S49A 3N6NA 5KFGA 2ASJA 2ILYA 2JEIA 4O3OA 4DG1B 4ID5B 3KJVA 5HLFA 2B43A 2VA2A 2IJNA 4NLOA 2BRKA 2UUTA 1NHVA 5HROA 5C24A 3MEGA 4WFXA 4RNOA 3H5YA 2JC0A 4ZVHA 2VA3A 3DI6B 4RU9A 2AGOA 4NLGA 2ILZA 4J9OA 3GV5B 5J2NB 3V4IA 4PWDA 4TY8B 3MEDB 1DTTA 3C6TB 1S9FA 1RT5A 3DLEA 3IS9A 4I7FA 4HKQA 1S97A 3E01B 4J9PA 3DLKB 4NLXA 5JUMA 1S1XB 2B6AA 4MIAA 4URSA 2XCPA 2E9TA 1RTJA 2HWHA 4ED7A 1S1VB 1S6PA 1RTHA 5I3UB 3MFHA 4DL6A 1DTQB 1LWCB 2YKNA 1S0MA 3CJ5A 3PR5B 4KSEB 3MR3A 3M9MB 5CYMA 3VQSA 1ZTTA 1K1QA 4O3NA 1TL3A 4I2QA 3CJ0A 3MR2A 4IOBA 3E51A 4QWAA 1C0UB 1S9GA 3KK3B 2IA6A 1RT1A 2OPSA 3OL6A 2BQRA 4K4YA 4NLSA 4NLDA 2UUWA 2BRLA 3KJVB 4ZP8A 3OL8A 1EETA 4FS1A 5HLFB 1TKTA 2AX0A 3KLVA 4ECZA 1JXLA 5HROB 5C24B 3I5CA 5KG5A 2GIQA 4B3OA 3ISNC 5DGBA 1JLGA 2HMIA 3NL0A 3OL9A 3CJ2A 3V4IB 2AWZA 3DYAA 4PWDB 1S48A 1DTTB 1HQUA 3DRPA 2IMWP 1IM4A 4Q43A 1RT5B 3DLEB 3IS9B 4I7FB 3CDWA 5DLFA 2B6AB 4KFBA 2ALZA 4TN2A 4QWEA 1RTJB 4ED3A 1QAIA 4WFZA 2C22A 2IJFA 3CJ4A 1S6PB 1RTHB 4IFVA 4WYLA 3FQLA 1S1WA 1I6JA 2W8LA 2AGPA 1BQNA 5CYMB 4WZMA 1TL3B 4KBIA 4I2QB 4KV8A 4KB7A 2J6UA 4IRDA 3MTKA 2GIRA 4ED1A 1S9GB 3IN5A 4Y34A 1IKYA 4O4GA 1RT1B 2OPSB 1NHUA 2OPRA 4ZP9A 2W9AA 2IM2A 4DL5A 3ICLA 1EETB 4M94A 1TKTB 3DMJA 3IGNA 2WTFA 4ECSA 2RDIA 2WCXA 4B3OB 1GX6A 1JLGB 2HMIB 5DG7A 2W8KA 1RA7A 4TXSA 2R2RA 2BE2A 1TQLA 3DYAB 1XR7A 4K4ZA 4Q0BA 4RW8A 1HQUB 2WK4A 3DRPB 2JC1A 5DG9A 5KT3A 3V6DA 5KFSA 3I5AA 1HARA 4KFBB 2IBKA 4IH5A 2IM0A 2W7PA 1JLQA 2V4RA 2DPIA 2JEGA 1RYSA 4NLRA 5K14A 3CDEA 4IFVB 3KLGA 4WXWA 3OLAA 1S1WB 3NAHA 4QWDA 1BQNB 4RZRA 4ZP6A 4KV8B 4QW8A 3PVXA 1RT3A 3OHBA 2JEFA 4IR1A 5F8NA 1IKYB 4O4GB 4F50A 4ZPAA 2OPRB 3PZPA 2W9BA 4WYWA 1KHWA 4M95A 4F4XA 2R8HA 3DMJB 4QW9A 4ZP7A 4IFYA 5F8LA 4KKOA 3PR4A 5J1EA 1SH3A 1S1TA 2BE2B 1IKVA 1GX5A 3HVTA 4IKAA 4Q0BB 4RW8B 2CKWA 4KHMA 4IG0A 4NLTA 4WXOA 5KG2A 2D7SA 4EBEA 4QWCA 2R8GA 1BQMB 4ECVA 3DRRA 5J2MA 3V6DB 3QGIA 1OS5A 4NRTA 3QZ8A 4RW7A 4IRCA 3BSAA 4IG3A 4EO8A 4ZPCA 1HQEB 2R8KA 1LWFA 1JLQB 4RW4A 3DOLA 4NLQA 3G6VA
chains in the Genus database with same CATH superfamily
1AXQA 4Y6IA 3M6UA 2EPIA 1RADB 1LKZA 1FRXA 1WDDA 1KVKA 2XULA 2DT9A 2HLUA 5A8KB 1T7PA 2ZVSA 3QYYA 4WJBA 1RP5A 4BLGA 1K73T 4I2PB 1UPPA 2E9RX 3EE3A 1B0TA 2LMIA 1PC5A 3TO8A 1RWWB 4C11B 3DU6A 4CTAA 3KLHA 3CIZA 1N5YA 2IRUA 2H51B 4WTOB 2FYXA 3Q86A 2C2EA 1UVKA 1XJWB 1CQMA 1FA0A 3U1NA 8AT1B 2V69A 2RMLA 1PJ5A 2HQ3A 2VC1A 1HIYA 3M4XA 2YNIB 2P5VA 2M7SA 2XYGB 5JVHQ 1Q0NA 2GHPA 2Z2LA 2VICA 3O44A 2ZKUA 3U7JA 1O0PA 4BCAA 2ZH4A 2OSQA 1WTBA 3BH7B 3LW5C 4LF4J 3JB9k 1WKKA 1H2UX 4DFPA 3GIJA 5HQLA 2CADA 3OXFA 1D8ZA 4CH7A 1U1KA 1YVFA 2M2BA 1FJ7A 4DCJB 1X9WA 1IBLJ 2HPUA 4RW6B 1UVLA 1REVA 4OHXA 3BBCA 3OUYA 3US5A 3ZNJ1 3OVSA 5ETLA 3CCSS 5CZVA 1NPPA 1P9QC 4PUOA 4MFBB 4ZHRB 4X4TA 1C1BB 2GJ2A 1SUQB 3VZHA 1NB7A 1XERA 3CW2C 2P6SA 3KKFA 2DR7A 4U95A 4F36A 2I38A 3EXYA 3NGUA 3NAIA 5HVGA 3MURP 2A6OA 4TLQA 2EFOA 2BE7D 4DR7J 1FJGF 1WTFA 3AAWB 5DETA 2AIRB 1N4LA 2DCLA 4DFKA 1WHXA 1IM6A 3FBCA 4HTJA 5LSRA 4R25A 3D28A 1HD0A 3G6YA 4HH1A 1T9UA 3R5AA 2X1BA 1J5OA 4WWSA 3SCJE 5KFFA 5EHHA 2V67A 4L73A 2B9WA 2DNNA 5E5NA 3PXGa 3HPOA 5A6WA 2LA4A 2EFPA 3DRYA 1TMMA 4JP8A 1RTDB 3U1LA 4DR5F 1TL1B 1FNXH 1SQEA 3POTA 4RPFA 1PBUA 2QLXA 1NSKL 2UXBJ 3LGMA 1XBWA 1ZZFA 3TUIC 2GMJA 2FHMA 4B9TA 4RJVA 4LF2A 4DHVA 4NCGB 2J9DE 3UCZP 4ZPDA 2DIUA 3EZ5A 1HFEL 2H1YA 3MD3A 4C3MA 2R8IA 3TUZC 2RDDA 3DI6B 3C6TB 1RT5A 1GXLA 1V5IB 5ITHA 2EFQA 1U0HA 3PNIA 1JK9B 3ZZUA 2Q6BA 4YDXA 5F41A 1MMNA 2POKA 4LBHA 2OPSA 5BYQA 4IO9Q 4FS1A 4F0KA 1RSCA 2DGXA 1FERA 4LSZB 3V4IB 3NXZA 4DU7A 1PCAA 2B6AB 4QZVB 1EB0A 2ZH5A 3IN5A 1RT1B 2RNEA 3HHLB 1EETB 3IGNA 4DF4A 2WTFA 1QVFR 2AYBA 2W8KA 4DQIA 1WI6A 4K4ZA 2D3O1 4ELUA 1IN0A 2BABA 2Y1RI 1CJTA 2DPIA 3CMES 2XYPB 3W2WB 3CCUS 4ANCA 4ZVTB 1PAUB 2MQNA 4DSIA 4USUA 4ILRA 1X4CA 1LXNA 1SH3A 3QMQA 1FT8A 3HVTA 2DY1A 1ZA1B 1UZHA 1VLYA 3THPA 1K8AT 2R2TA 2OI2A 3CPWR 2XY6A 3Q2SC 1FESA 1U45A 3QAEA 1G4CA 3OR1A 4C8OA 1X5PA 3H59A 2M70A 8ATCB 3GFXA 1S10A 2XCAA 2F3JA 4M5MA 5KG3A 5HSPA 3V6KA 4RW7B 3T5HA 2BJ8A 2C3MA 1LWFB 2HZVA 3LP2A 1ZBTA 3HJFA 1WHWA 5H9FK 4F3MA 3RBEA 4OYWA 4FF2A 1FX4A 2E5LJ 3HHKA 5H1SV 4DWIA 3M30B 4C0OC 3MOJB 3MEKA 1QAXA 2MHNA 3IRXA 1NJXA 1CVJA 2XHCA 3MUVP 1H74A 4DPUA 2YWFA 2DRBA 3BQ0A 1VBKA 4NOHA 4OX9F 1HYSA 2PI5A 2AJ2A 1U7LA 4WK3A 2FJXA 4YP3A 3NWRA 2C42A 4B3RJ 2R2UA 4QR0A 4NEZA 3OTCA 2CG4A 3SI8A 5A8WA 4Y3CA 5U47A 2WB4A 4F4WA 2VKZG 3HHLD 1RK8A 4DL3A 1ZTWA 2J76E 4L3KA 5KT6A 4H4MB 4UY8T 4DCOB 1NXIA 2RUGA 4WZQA 2LXFA 4G1QA 1N0VC 5KFHA 1VQ6S 2ASYA 2VB6A 5KFRA 1RWMB 1XMQJ 3KMQA 3H40A 4KIAA 3A12A 3OFHA 3C14B 1QE1B 3BO4A 3AJDA 4U7UD 3JAMU 2Y1LB 3AXKA 1EJ7L 3RR8A 3K57A 4L74A 4F4AA 4MYTA 1JXVA 2MKSA 3NS7B 2VFSA 2RU3A 1OO0B 3MM7A 2VF3A 1FE4A 4DQRA 3TZZA 2BZ2A 3I4HX 1UWBA 2HVIA 1SBRA 1M90T 2GQCA 2HK3A 4K4VA 1DURA 1FRLA 1QVGR 4HHHA 3OLBA 5A76A 2L08A 4WKRA 4YB5A 4ED4A 1JLFA 2VG6A 4IQXA 3MOZA 1WKLA 5C2CA 4LFBJ 3KG4A 3ZZYA 2MSTA 2UXDJ 2IJRA 2KXNB 3BB5A 2DKOB 2RSQA 2YNGA 5BR8J 4JB8B 4DR4F 4QU6A 1RGVA 2IYGA 2J8SA 4NRUA 4NMLA 1C1CA 1JLEB 4EBDA 3KK1A 2KHCA 3H4DA 4W98A 3SSRA 3OTOJ 5I42B 1ZA2B 1A7GE 4ZLLA 3GIIA 2HNDB 5KFTA 3OQ2A 3K5OA 1Q79A 5DQIA 2HNYB 1HBNB 2MDAA 3I9V9 4K50A 2OJ3A 1U1NA 5IQQA 4NZ6A 2IY5B 2YQ1A 2UUAF 3Q8QB 5T7LA 4ZLJA 2WAQD 4UW2A 3B4MA 4AE5A 1WC6A 1EKSA 2MLZA 4MK7A 3FFIB 1FRJA 2VFVA 2BOPA 3M05A 4BBYA 2ILZA 5KOXA 3KJNB 4F2RA 4DX5A 3GCXP 1S1XB 3IC1A 1E6YA 1S0MA 2B3TB 1ZTTA 3CJRA 4OI2A 4HHUA 1ZYQA 1MSWD 1JLGA 4Y28C 3TVZA 3LUYA 4Q43A 4G65A 2FHJA 3QNWB 2QA1A 1RTHB 4O4GA 4Z7CA 4M94A 1TKTB 4WF9Q 1NM2A 1GX6A 3C16A 1M5PC 3I5AA 1VYAA 4LMZA 2BJ1A 2I2YA 3IXQA 2DXFA 4CO1A 1V3RA 2P9EA 3UDVA 1IKYB 2JJ4D 4DR1F 2CAJA 2BM0A 4DZDA 4ZP7A 3K59A 3CGIA 1RBOB 5KG2A 3HHLC 3DKDA 1KP6A 2PDAA 2K3KA 4ZPCA 5I3PA 2XWXA 1VQOS 1R8CA 1W26A 1YZ6A 2VPWB 1WELA 3LPEA 2CPDA 3T5KA 5AE1A 1RUSA 3PJXA 3BN4A 4IG0B 1VC6A 1HBMB 5L9NA 1EP4A 3DOLB 1WJ9A 2CQ0A 2DEJA 4ES1A 2R4FA 1PYOB 1FD2A 1B0VA 2XLIA 1LWEA 4KH0B 2X3GA 1FXRA 1OY8A 4IDKA 4CQ1A 1RT7A 5JXSA 4C7QA 4YB7A 4H54A 1S9EA 3P6YC 2AX1A 2IA0A 2BW2A 5LOQA 3S1TA 1FJGJ 5D6GA 2V63A 2G4BA 2ZNYA 3C6UB 3NGSA 5HBMA 1CS4B 3SSSA 4CO5A 1GXTA 2OTJS 3ZTPA 3O8WA 1WC4A 4JV1A 1TUVA 2RD5C 3TAMB 4O3SA 4UUWA 4ZKAA 4ECXA 4EO6A 2MKKA 1IBCB 1KSPA 4LF5F 3M1VB 4K4UA 1H73A 2J7WA 4OYOA 4Q8FA 4JI5F 1K1SA 2Q79A 3DLHA 2XY7A 3MMCB 1RE1B 3IR7B 1S12A 4QIFA 1KR4A 4IRKA 2RF2B 1IR2A 4ETZA 1VQ8S 1IXKA 2QG9B 4DR5J 2YWGA 2F4VF 3CO9A 2A0FB 2C28A 4FF1A 3AD7C 3T1AA 1HWUA 1FNMA 2HQGA 3BN7A 1WG4A 3Q83A 4DV6F 2CNOB 5KT7A 4JI6F 2VG5A 2R7RA 1RISA 4ITSA 5B0CA 1YGYA 4HL9A 4NYPA 4YB1P 1RWXB 1SB6A 3M9OB 3JQKA 2ZM6F 1RHUB 2DGTA 1H6KX 3FCWA 1J5EF 1SC1B 4M5HA 1RCOB 2Z56B 2OPQA 3P96A 4PPZA 2CPYA 3BO3A 2AHOB 4JV5J 5LJ5Y 1X31C 3UQSA 4H4KC 3IR5B 1RA6A 3EDRB 3S01A 2ZD1A 2IYIA 4IYQA 2WONA 4J7CA 2UV8A 4F3OA 2UZAA 3A3PB 3GG1A 2MB0B 2JHEA 1XN9A 1X4AA 2GV1A 4Q45A 2ROGA 1Y0HA 3M2VA 5J2PB 4KAIA 3R1LA 1RT2A 3PW7A 3K8WA 1TV6A 4LQ9A 1WHYA 2XZTB 2HRTA 4H4OB 3GV7B 2QFJA 3HXMA 1S6QA 2YTCA 1NH8A 1O51A 3QFWA 4JV2A 2PMWA 5M2RA 9ATCB 3HX9A 2WW4A 2NXUA 2L9NA 1Q5YA 3KG1A 3FBFA 2EWHA 1RAJA 5HI7A 2XSJA 2QLBB 2XZWA 5IM0A 1CSJA 2XG8A 2ZC4A 4P52A 2XMUA 3D2WA 4X64F 1FK9B 4O3OA 4FN5A 2VA2A 1XQIA 3OW2R 3DC2A 4WFXA 4CLSA 4OX7A 4U8YA 3Q0AA 4PWDA 4OV1A 1BMQB 3PM9A 3SMZA 4N77A 2XM3A 1CLFA 1KONA 3TUJC 3MR3A 3AQOA 2X3DA 3AQPA 3MR2A 1UEUA 1A9NB 3KJQB 4ZVQB 2DO0A 2AMCB 2HMIA 2HS0A 2M8HA 2WSFC 2IMWP 4P74A 2LA6A 3KWMA 1R27B 4ED3A 3RW7A 5K9FA 4OX9J 1DQ9A 4KYZA 2W8LA 2AT1B 3P8BB 1NKBA 5MAOA 4LRFA 1ZAXA 2LLZA 3CJKA 1T9XA 3CCMS 2R3VA 3VAIA 4DV5F 4ZN1A 1X5OA 1GNKA 4ANEA 5DG7A 2CXEA 1X9SA 2CPFA 4FPIA 2IHR1 2W4DA 2VIHA 2WBRA 4KFBB 1U6FA 5HK4A 3H90A 2JVRA 4JBCA 2CJAA 2BOAA 1FDBA 4X4QA 2AYMA 2NLWA 4F4XA 5IC6B 1N32F 1VQKS 4CM2A 4NLTA 4J9UE 3R27A 3KXDA 4ZA1A 2J0SD 3EM1A 2DO4A 2MYFA 4ZCIA 4PR6A 5J2QA 3PW4A 4C0HA 4ZPTR 2W9CA 3CC4S 4KGVB 2Q6CA 4M5DA 4KKOB 1RHRB 2HWIA 4DF8A 3J81Y 2CZ4A 2GJIA 4MKYA 4IG3B 2G0CA 3R97A 2IAJB 3OSPA 3DLGB 4PYAA 3ZZZA 3JS9A 1QLNA 2RILA 3G6ES 5GAEI 1VRTA 2A10A 2V4QA 1HQ2A 1T95A 1U09A 1S1UA 4ED7A 2ALYB 2EFNA 3V2UC 3D5MA 2PEHA 1Q8IA 1S7HA 4MK8A 2L48A 1FTCA 3P4UB 3N5FA 4CWBA 1RU2A 1IKXA 4J9VA 4L3NA 5CCLA 3W64A 2M52A 1TTHB 2B5JA 1FD8A 3UCUP 3A3NB 1ICEB 5C25A 5M2PA 4ICLB 3DOMA 3CT9A 4L6V3 1F60B 2YPZA 1IKWB 4AUKA 3LTOA 3T3FA 3M8PB 4OI6A 4FDFA 2V8HA 4DR4J 4NLPA 1RWKB 4DR2J 1Y5IB 3CD6S 4LFCF 2HBRB 1U8WA 3IRWP 3PYEA 3LPYA 2N3OA 1FEHA 5G0RB 5IC4B 1TK0A 1SXLA 3DCAA 2E44A 3KLFB 2YVSA 1YRUA 2O66A 3KLIA 2E5GA 4OFZA 1KTQA 3MCOA 3ELHA 4OYAA 2DR8A 3NBPB 2V8VA 3MCMA 3OBIA 1PJ6A 1HR0J 1RAEB 2K3IA 2WVFA 2UUAJ 1RI7A 5BXIA 1FTRA 3HSGA 2COLA 2B4OA 2BW7A 2MJNA 3SQOP 3VAGA 3FZBA 3BJYA 3DRSA 1HPZB 2ZE2A 2MKCA 3K0JA 4EYIB 4AXIA 1FCAA 3W63A 4KPYA 1MU2A 2CNLB 1RT4A 4YFUA 1TZ0A 3VHQA 5D3GA 2CQGA 3SDEA 1AFJA 3RB0A 4C3KA 4DR6F 1RWNB 2HHHF 4HI2A 4J9RA 3DOKA 4QIEA 1HI8A 1Z2ZA 4QIVA 3FEXB 4P2FA 2D41A 4USVA 3KJFB 4K4WA 1VHFA 4UUXA 4DL7A 2C3YA 3GJQB 3JSRA 5C2GA 4LRBA 3CJ8A 3LP1A 2XEXA 2HFOA 3C15A 1YBTA 2BA9A 1UW9A 2RU9A 5CCMA 1S76D 1GQEA 2RDJA 5AE2A 3QO9B 2C2DA 4DR1J 1HWLA 2A3JA 3HKWA 4DG1A 2O1PA 4RL1A 3MPYA 1PBAA 2F8EX 3FEYB 3FK4A 5EX3A 4J37A 4F0MA 1PSDA 2ZNZA 1LK7A 4KGKA 1RBLA 1NJWA 4X4VA 1IJFB 3EGWB 4EK2A 3J7YI 3QRRA 2UUTA 5HROA 1CJUB 1WACA 3MEDB 1S9FA 5GAHU 3QBCA 3IMQJ 2ZUAA 1WEXA 4I2QA 3I82A 3PRVA 2IA6A 5AE3A 3OL8A 5HLFB 2GGPB 2GIQA 3GFHA 3DLEB 3IS9B 5CH7B 2ALZA 1HBUA 3MMJA 1MG7A 2V4JA 5D77A 1XNRF 1KBRA 3GP9A 3PTWA 4OQJA 1WOPA 2GIRA 1S9GB 4Y34A 2E7XA 4DX6A 3EICA 2K8GA 3G82A 3VAFA 2WCXA 4ZIWA 3Q8VA 4OYIA 4G1PA 4F2SA 3FMWA 4CO0A 4LF5J 3MPWA 2W2PP 2BE9B 4JI5J 3R5CA 1C4CA 4P75A 1U1RA 5IWAF 2RS8A 5A8KA 4NA1A 3NGRA 2D7SA 2R8GA 2G2YA 2F4VJ 1FDAA 1HKAA 1P1TA 3BSAA 1YIJS 1QAYA 1JLQB 1Z1ZA 4I2PA 4A8QA 4DV6J 2N7YA 4JI6J 3TRGA 4Q44A 4X65F 1H2VZ 2IDEA 3M6XA 1JWWA 4C11A 3L4BC 3PYDA 1RAIB 4O3PA 1H98A 2HG4A 2IM3A 4YR2A 3OL7A 2QMWA 3NLCA 2XMAA 2FD2A 2A6MA 1S4EA 3WX8A 2ZM6J 4USKA 4USJC 3HHDA 4ZCMA 1J5EJ 2KXFA 2PGCA 3IM8A 3THVA 5IQ6A 2YNIA 3RB3A 2HHXA 4J9NA 1OQ6A 4CH1A 3EGVA 4EYHB 3OPKA 1M1GA 1RTIA 2HZCA 1H72C 4C8MA 4K5RA 4W90B 3CD7A 2UUCF 1L3VA 2H3EB 4KHPF 2KFYA 2ZHOA 3HMJG 2YNHB 2J7UA 3BSCA 4URGA 2YNFB 1AZSB 3G8SA 4GKKF 4LRCA 3LOUA 1GT8A 2HGMA 3NGDA 3MEEB 4Q8EA 4RW6A 3QGHA 4AT1B 2NQPA 4RLEA 4R5PB 2UVUA 3OXLA 2CJQA 3VR1A 2JFKA 4FVMA 1UA0A 3QFHA 1K0VA 1M5KC 4NYZA 2QX0A 4A8YA 4MFBA 1XMBA 4ZHRA 1SUQA 5GAGI 5DG8A 3D1HA 4BWMA 5ETKA 4LBIA 2VC0A 3SV3A 4WK1A 5HAOA 4BHQA 5K8MA 3V6JA 2CJKA 5BYRA 2BKPA 1SQFA 4X64J 1BY9A 2CPIA 1E6VB 4PABA 4B9UA 1U48A 2MKJA 4CLFA 3CWJA 4QR2A 4I67A 3JSBA 1NEEA 3W8GA 2FJWA 5CHCB 2RS2A 4QIWD 3BBBA 1TKXB 2MTLA 3V81B 2SXLA 4WFYA 4RUAA 1B0PA 1FDDA 1H7WA 6AT1B 5F9LA 3ENVA 3GFYA 3U27A 3I32A 5IT0A 3PX6A 4RW9B 2VPXB 3BQ2A 2Y1JA 2WVCA 5GVQA 1RTDA 3NRBA 2B4PA 4ALZA 1X60A 1TL1A 2BJDA 4DV5J 3MECB 5F8GA 1HWKA 5F0WA 5KFJA 4J9SA 4NCGA 1FRKA 4NLYA 1AUSL 2XWYA 1YJRA 3KHRA 4O0IA 1N32J 3QGGA 3MFIA 2IFXA 2ZC3A 2N4DA 2Z57B 3DI6A 5EDWA 4OZNA 4K4TA 4RX6A 3C6TA 4C8YA 4K2JA 3KNGA 1T94A 2BXJA 5DZ7A 2ACYA 2NCKL 1NKEA 5T41A 5KFIA 4ENOA 4DS5A 3CB4A 3N6NA 3GONA 5KFGA 3TAQA 2ZH6A 5E0OA 2GCFA 5GMKa 4CLYA 3H5YA 3J81U 2CRLA 4NLGA 4J9OA 3QWPA 5J2NB 3V4IA 2KG1A 4Y2MA 2JVOA 2MKHA 1ZPWX 2B6AA 5B09A 2OUGA 4ZK7M 3AJ1A 5I3UB 1GK8A 2B7CB 1RT1A 1GMWA 1RQ0A 2BRLA 3KJVB 3HHLA 1EETA 2KH9A 1BE4A 1IUJA 2YWKA 5C24B 2FUG9 3CXCR 3CE8A 1Q78A 3MAQA 3QJPA 4I68A 2X7IA 1WF0A 4OHZA 3W2WA 1W7WA 2AGPA 2AJ0A 1TL3B 2VJVA 5A8RB 4UT4A 2IRXA 4ECSA 2RDIA 4FF3A 5GADU 1CJVB 2M8DB 2LU2A 3O5TB 2APOA 5KT3A 1Q8KA 2HK2A 4ZVPB 1LOUA 3K7RA 4LFCJ 4EMDA 4B02A 3ZTRA 4PWWA 2QGFB 3PVXA 1X4EA 3H7HB 4CH0S 2U1AA 1FVSA 3HFZB 2ZBIA 2CQ2A 4QW9A 5A2QY 2LDYA 3LQVA 2RUSA 5RUBA 2XSFA 4F25A 4IKAA 2G0JA 4RW8B 4WXOA 4FPRA 2GNKA 1NO8A 4X4UA 3QZ8A 4RW7A 1JXEA 1LWFA 3FQKA 1KKHA 3HHNB 3Q89A 1KQKA 1RABB 1F3FA 1NJYA 4J9KA 2E9ZA 3OTBA 2W9BB 4CDIA 2YQ3A 2KVIA 2JH3A 4IFYB 3UDCA 3M30A 2GVDB 4PG4A 4DV0F 4JI0F 1IKVB 4LVNP 3GQCA 5K8PA 4CNZA 2DNZA 3TZWA 1YTYA 3OTEA 2CJ9A 4AFFA 4DEZA 3NP5A 1SJ1A 5FJ4A 1R31A 1R0AB 5AXNA 4RNNA 3CCWA 3KFWX 2AJQA 2GHVC 4A48A 4PXCA 4ZCKA 4YY3F 3BR8A 2XNQA 2OLWA 1JJ4A 4DR6J 3IG1B 3ITHB 1URNA 2HHHJ 2V2QA 2V2ZA 3PW5A 4FYVB 3IWNC 4F04B 2HNZB 3NGKA 1VC5A 4H4MA 2W4CA 4X4RA 2GX8A 2QT7A 1LK5A 1NK0A 3ENAA 1FXLA 4L76A 4TY9A 3K5PA 2EK6A 3C14A 1TKZB 3DU5A 4OHWA 1QE1A 4NLUA 3EZUA 1LXJA 3PJ9A 3MM8B 4ES2A 2ROPA 1NKCA 1WEYA 4UOFA 3Q2TC 1WOSA 3PO5A 1NLKL 3QIPB 2HQFA 4OZJA 3GJTB 4DCPB 4A8MP 2NUHA 3JSMB 2DHSA 1TL7B 5B0BA 1U6BA 5M2UA 4N76A 1WG1A 3Q8SB 4Q7AA 1UEKA 4M8LA 3QPIA 4KTQA 1R8PA 3FDSA 3M2RB 4P71A 1YITS 1T9WA 4WIIA 4UOHA 1RAAB 3MCSA 4KGMA 1RJJA 3DHXA 3O2IA 3HSJA 3M9NB 1G3OA 1WG5A 3RRGA 5KAKA 3HT0A 1AYEA 2A18A 5K8NA 4ES3A 1UA1A 4ZOSA 2IIHA 3BGLA 1SKWA 4TQRA 2EBEA 2VKRA 1RCXB 1BXNA 2V68A 2C2ZB 3KUGA 2PFFB 4A8FA 4NMXA 1JLEA 4XDDA 3T6BA 3Q8YA 3SXLA 5I42A 4ZLNA 4X4PA 3N0VA 4LF6F 1MMDA 1XNRJ 2HNDA 8RUCA 3K8VA 5KG6A 3W9HA 2PEBA 1TKDA 1JNRB 2LVWA 2HNYA 1SJFA 1HBNA 1Q7YT 3IR6B 4LSLB 3AHPA 3RAQA 2CVIA 3P3DA 1DFDA 5HVFA 3DLLQ 3GV8B 1BHNA 4PQAA 4C48A 3GIKA 1RKIA 2XO7A 3BQ1A 2WSCC 5KFDA 3FFIA 2IVFB 4JV0A 4F4KA 5DO2A 4JI7F 3EGZA 3LALA 5IWAJ 4ZPBA 2BBEA 3SV4A 2CNNB 1JLCB 2KRBA 3FZ2A 1DLOB 1S1XA 2DB1A 4CLWA 3OD2A 1UL3A 3AH6A 4HYKA 2PI4A 1VBXA 5CXTA 2CUYA 1WEZA 2FB0A 2W2OP 4X65J 2CPEA 3HSDA 2V8PA 3GSIA 2BRKA 3G96A 3MEGA 3J7A1 2LQ5A 2HFVA 1T9VA 3E01B 3DLKB 3J7ZT 2HWHA 1ZM2A 3CO0P 4DX7A 1RTHA 3Q23A 4O3NA 4OHYA 4LR9A 1IQZA 1TKTA 3H8YA 2JFDA 4XDCA 1YJTA 3W5ZA 1UVIA 1L3UA 3W61A 1FWLA 1KTVA 3CDWA 2PIIA 3Q8UA 4TN2A 2G2OA 3VGUA 2QYGA 1QJHA 1IKYA 1MWYA 4KHPJ 2EFVA 2GO9A 4LF9F 2OMOA 3RUBL 2EK1A 4GKKJ 2V4RA 1X0PA 4Y65A 1DHMA 3CDEA 1TL4A 1BQNB 3CCZA 1YJUA 3GLJA 3MZIA 2DK2A 2M4MA 5IT9Y 4ZPAA 2OPRB 4F02A 5LMNF 2AYGA 3SEOA 4CM0A 3M8WA 5BYSA 2Y3YA 1OYEA 3ZZRA 4IG0A 1FRMA 1HBMA 5ETOA 2DGWA 4IRCA 4Y2KA 5DZ6A 3DOLA 4NLQA 5K14B 4XPCA 3RRKA 4A8XA 4CLLA 2XMJA 3EPGA 1SC4B 2W2MP 1S6UA 2W7OA 3RAXA 4ZVOB 2W01A 4P10A 5J1EB 3EWGA 3IFEA 2HFSA 2BUNA 3KYLA 2CQPA 1CC7A 2J0QD 3CJSA 2H9ZA 2B56A 2LQJA 4K2XA 5DS7A 2KTQA 1JLBB 1CPZA 4OLOA 1IJEB 4NPOA 3NGTA 2E1AA 5F8HA 3C6UA 3OV7A 3R2CJ 2J6SA 1CS4A 5ETNA 3T19A 3IAS9 3A8JA 1LWXA 4ED6A 1S59A 3TAMA 1SV5B 2HFUA 2EVZA 4ZVEA 3J7AN 3MR6A 1UWAA 2GA7A 5KG7A 2OKQA 1TMJA 3VGVA 3M1VA 1YWXA 3N01A 3CMQA 2F7VA 4FBTA 2MZSA 2DD8S 1RZMA 3QIDA 3MMCA 2HIQA 1NDCA 2HAIA 2CQIA 2RF2A 5LT5A 1J27A 1UAWA 3QSIA 1VOMA 4KH1B 1HW9A 1NK8A 3X1LB 4MAKA 1RACB 4OZ1A 4CP5A 4MK9A 1CBKA 2CFXA 1IQTA 3C66A 1O8BA 3EPIA 3MM6B 1RYRA 4DL4A 1NK4A 2HBQB 4AL7A 2ZJPQ 4DV4F 1HD1A 3MDFA 3KG0A 3PEHA 5L8RC 4XK8C 2CQBA 2KZZA 2RRNA 3H98A 4MIWA 4WE1B 3WX4A 3QRPA 3RU0A 1IR0A 3R1HA 4PZVA 3TEGA 1XTZA 1B7YB 4RNHA 4ZITA 1YBAA 3VCDA 3R5BA 4IO1A 1YRXA 5H9EJ 2QLWA 3A8IA 3ZZTA 3W3SA 2E5HA 2FLLA 4LF7F 3VGSA 4NA3A 3TA0A 1EQ0A 3FMBA 4OI0A 2YH0A 3UPFA 1HHTP 3QT6A 2XI2A 3WQPA 2DNPA 5FDLB 3MMAB 1PIEA 5J2PA 3PKYA 4LVOP 4X84A 5KFNA 5KT4A 3NCRA 3GG0A 5EGYA 3UE2A 4H4OA 1ZZNA 4F0HA 1XEZA 3W66A 2V34A 3ZZOA 1JLAB 2XY5A 3BF4A 3T5LA 4RBVA 4E8UA 4A8WA 3ET6B 3ZXWA 1D0EA 3ZTOA 1V5VA 3IAM9 2PFDA 3VVTA 4IOCQ 2LP4A 1QSLA 1X9MA 4B3MF 1Y00A 5A2QU 4EGLA 2HRYA 1FK9A 1LQ9A 2KYZA 3HULA 5B0FA 2C2RA 1KFSA 3TR5A 3HHEA 1S0NA 5EWEA 3UVJB 1MROB 5KFYA 1RBAA 2LEPA 4RUBA 1D9FA 3BGRB 2N4CA 2BM1A 1YI2S 4PXDA 4DV0J 1TU0B 4JI0J 3DGPB 4NI2B 2JC0A 1T0TV 2OEJA 3G4SS 3V4MA 3ZO7A 3KK3B 1OSDA 2GFFA 2UUWA 4FYYB 3W9JA 5DGBA 4KPCA 4YY3J 1WC5A 2YX4A 4B9VA 2HHUA 1NMEB 1ZAWA 2QN6B 4KFBA 4N47A 2ZH7A 4DPWA 4DSJA 4ED1A 2DH8A 1N36F 4LR8A 2NXNA 4HDGA 4B3OB 2DVIA 2HVDA 1RA7A 1JQGA 2FY1A 2VV5A 4DFMA 3OLAA 1S1WB 2HYIB 3SCLE 2K7KA 2LU1A 4ZP6A 1G2EA 4WU2A 3PZPA 4CRJA 2Z4PA 4KKOA 1NDPA 1DZ5A 1S1TA 2BE2B 3UW1A 1NBEB 3TZYA 2QA2A 4IG3A 1S6OA 2AGQA 3N6LA 2IAJA 3DLGA 1RT3B 2VUGA 4X62F 1C2PA 3A8EA 3CCJS 4BDPA 2V9WA 3LWLA 3PX0A 5ETPA 2C3UA 1FX2A 2DEIA 2WRMA 3H25A 1RLCL 2ZOFA 4URQU 1OPIA 4ICLA 2J6TA 4C2MA 1IKWA 1WSVA 1WWHA 3M8PA 4IH6A 4EZ9A 2YKMB 4ZVGA 1Q16B 1TUGB 4KO0B 1FKOB 2J9CA 2RH3A 3TJAA 1RLDA 4C8ZA 2NXJA 3KOAA 1VRUB 3T9ZA 3LAMA 1HNIB 2GJFA 5G0RA 1JJ2R 3VAKA 2ZBCA 3KLFA 3H4BA 4LF6J 2YWWA 3L95X 1KQSR 2H5JB 2AQ4A 3NBPA 3MAAB 4B9NA 1BGXT 4DX8H 3CD5A 4LIWA 2BACA 3BGUA 2BQ3A 1KWMA 3BO2A 3W9IA 4EUVA 3D6FB 2VFTA 2GAHC 2Z30B 4MJKA 4RWXA 1R8HA 1UFKA 3N5BA 4GVBB 1AUDA 4FXDA 1U0SA 4K4XA 1HPZA 2VZ9A 4PEOA 1X8DA 1AW0A 4JI7J 3TUPA 5L1JA 4GRSA 2ZUGA 4RNFA 2M3DA 4OX6A 4JI3F 1IBKF 3D0GE 2JX2A 4K5SA 4ED0A 1WC0A 2MQQA 3VAJA 2RQMA 1FFSB 5L1IA 2HHQA 5KFPA 1WF2A 5HL7Q 4OYMA 2GQQA 1NH7A 3MR5A 3EVMA 1TAUA 5KTQA 5KFEA 2KT2A 1Y3KA 2U2FA 1I1GA 3GU0A 3BKFA 3MR7A 1ULRA 3CF5Q 4JV5F 4YMEA 1B3TA 2I8EA 1Y5LB 4DLGA 4HTIA 3NNAA 1VDHA 4ILLA 2B9EA 4USHA 4NCAA 5E7OB 5C7PA 4CCHA 5DLGA 1HI0P 1AFIA 2BJ3A 3MI7X 1FWPA 3FCHA 5HMXA 3MXHP 2BR0A 3QO9A 4KE5A 5L46A 1N6QB 4F4ZA 3W60A 4WU3A 2JLFA 4N8OA 4FZVA 2OFHX 2V2VA 4LF9J 2A2CA 3M32B 4DSKA 3WC0A 1BQMA 3MUTP 3LA0A 4I56A 2B0GA 3OTDA 4CZCA 1T05B 2LCWA 4LF8F 2EI5A 2YBVA 4QQBA 3GIMA 3W5XA 1C4AA 5LMNJ 3O6QA 1L3TA 3CTRA 1M0SA 5F8IA 4DV2F 3L9ZA 1UW4A 2AEJA 1CJUA 1R89A 2QO3A 2F65A 3MEDA 2P6TA 3KTQA 3H42A 2WB1D 5E3CA 1Z4UA 1A6LA 1RWUA 2FJVA 4ZPWR 3QZ7A 4KRWA 1T3NA 2EKYA 4QR1A 4ID5B 5HLFA 1NHVA 3ULHA 1XMOF 2GGPA 2QA4S 4C0BA 4TY8B 3DLEA 3IS9A 1NUEA 3R5DA 4B17A 5GMDA 1J2VA 3ETMA 3CJ5A 3A13A 3L7PA 3GE9A 2MLXA 4IOBA 1C0UB 1S9GA 4JI8F 2F1FA 2VHGA 3JTOA 3D0IE 3D6HB 3DDIA 3RYLA 2OELA 4CO4A 5B0AA 3NNHA 3L7UA 2NSBA 2MKYA 1VK3A 2XTJP 2R7VA 2F4FA 4E0DA 3SCKE 4KBIA 1Q1KA 1NHUA 3JSYA 5DJBA 2DCUB 3FRYA 4QPTA 1HHSA 4P7TA 1DY3A 3DYAB 3DRXA 4DQPA 3EGNA 1DARA 2M0GB 2DISA 1JLQA 4IFVB 4QWDA 1ZH5A 4KV8B 2NYIA 3CJQA 4F67A 4F50A 1SKSA 3H20A 2XMWA 5DDQC 4D3GA 3DMJB 2GW8A 2GZOA 2HIYA 1HLWA 1T3OA 3SZ2A 1H7XA 4DV4J 3PV8A 2QLJB 3V6DB 1OS5A 2JWNA 2R8KA 1EARA 2KL8A 3KLGB 5EX0A 2DY9A 2NXCA 3CDUA 2KHDA 3B82A 1ZM4A 3CCTA 3JTNA 2GVZB 2Y9HA 5IM0B 4R0EA 4P72A 2E7WA 3J7YU 5D0GA 5L9XA 2OEKA 3ZTQA 2W25A 2UXCF 4C8LA 4LF7J 1ZS6A 3J81j 3NY0A 1R6VA 3IBWA 1R0CB 1JKHB 4FXVA 2QL7B 1S5ZA 3D66A 4PCQA 4AYBD 2YNHA 2YNFA 1AZSA 1CJKB 2ZWOA 3I0RB 2ZH9A 2F9JA 2X51A 1KNZA 3MEEA 2J0XA 1N34F 2FLNA 2XC9A 4R5PA 2MGZB 3HVWA 2NZ4A 2ABYA 1XIQA 2B9XA 3D6TB 3FSXA 1FEEA 3CEDA 1S7IA 4ED2A 3ILIA 4PRFA 2HURA 4DR2F 5D0RA 3GJRB 1M1HA 4S0MA 1W25A 2DGSA 1QY7A 1RB0A 3MPVA 4IR9A 3BR9A 3O1LA 2QV6A 1SI9A 2QRRA 1ZM3A 1VFJA 4B3MJ 4A46A 1VQLS 5IS2A 1E6VA 1DRZA 1PC4A 1KRPA 1JJCB 1HR0F 4UZCA 1RHKB 1Y10A 4QYZJ 3AODA 3EXCX 1IWGA 2E5IA 1LW2B 1S1VA 2CDRB 1TKXA 4TQSA 3UFCX 3I31A 4DV1J 3DN9A 3V6HA 2VBXA 4WIQA 2G0IA 3V81A 3RGIA 4KQZA 3AOAA 3ISZA 3AB2B 2FY8A 3CJ3A 4I6AA 5G4DA 4FKYA 5JVGQ 2F8HA 2FDNA 2ZHBA 4RW9A 3CDBA 4FP9A 4HI1A 1N5SA 5EN1A 3PEJA 5K5MA 1FKAF 5CQGA 3MECA 3JTPA 2DTJA 2D1CA 4U9RA 5H9FJ 4PQUB 1UCNA 1K0TA 5E3AA 2XGQA 4NYOA 2EFGA 1N36J 4ED5A 5FLXY 4O23A 2KXHA 4EBCA 3WZ0A 4WP8A 2ERRA 3C2PA 2IVYA 2ZH1A 1FFWB 3N9UC 2MLYA 3C8YA 1P27B 1YJVA 5KFKA 2O5DA 4LF1A 4N8NA 2BQUA 3QLHB 5KFQA 2HWTA 2FVPA 1WKJA 2HZAA 4DL0C 5J2NA 5KT5A 3M8ZA 3BBFA 1TVRB 2ZITA 2K1RA 4ZCLA 1N88A 2B4VA 5I3UA 3G8TA 5GAGU 3OR2A 3BKTA 4X62J 4U67Q 3BSOA 3GZ7A 5GAHI 2I9SA 4JI1F 3KJVA 4AXJA 1GXUA 1JNZB 2QYCA 2C2OB 2DHXA 5C24A 1Q4RA 4ANDA 1FRHA 3U1MA 1UTAA 2DRDA 3UCGA 1WORA 4A8KA 2YX1A 4NLXA 2EEYA 4MIAA 4URSA 4J91A 2YKNA 3PR5B 1U2RA 1TL5A 1TL3A 3P5TL 3LGHA 5A8RA 1Y5NB 3T1YF 1CJVA 3OL9A 1YSJA 4LBPA 4I69A 3G2XA 1DTTB 2B51A 2V2KA 4P2SA 4C3LA 1Z2LA 5DLFA 1TFYA 2BVZA 2B8PA 2E1RA 2PO4A 3EVWA 1CULB 1VI7A 3E2EA 2KN4A 2O01C 4Q2MA 1FWKA 1OQ3A 3HI9A 2ZWPA 4YHHF 3WDOA 3LGNA 4UF4A 4DOZA 4RW8A 2QMXA 3DRPB 7AT1B 1F2GA 2VU5A 2VBZA 1HARA 3CCES 4NLRA 4DI6A 2F8MA 2W9BA 4RR5A 4IFYA 2HHWA 2GVDA 5F8LA 1N8RT 1IKVA 3CCRS 2RVJA 2Z2MA 2CNKB 2F9DA 4ECVA 1X0FA 3VALA 4NRTA 4UTGA 1SL2A 4PWUA 4PAAA 1KVIA 2C3PA 4WFBQ 1RU1A 5DQGA 2KFZA 1OSCA 3K5MA 1R0AA 4LRAA 3UR0A 3CD0A 1YJ7A 4JI3J 1IBKJ 3AOCA 3PFOA 4X2BA 5KT2A 1VR6A 1X4FA 4KGXB 4NE9C 4FYWB 3M6VA 2KRRA 4QIGA 5HO4A 3IG1A 3ITHA 1YDLA 2DJWA 1FFGB 2OTLS 2JDJA 2RT3A 2RKIB 2HNZA 4ECYA 2XYHB 3QGPA 1SC6A 2LQBA 1UVNA 2H5EA 2YY3A 1WNEA 1UMJA 2LQ8A 5FD1A 4XIUA 1REGX 4DUTA 5K8OA 2VASA 2IC3B 2R8JA 2RQKA 3R7NB 4LSNB 1TKZA 4I1TA 2MSSA 4OZ5A 2JEJA 3TI0A 4E2FB 1QM9A 2G2ZA 2LKZA 3S8SA 4O44B 1NDLA 1P9YA 2XMVA 3I0SB 3MM8A 4LQ3A 4WBFA 3UN2A 1NK5A 2WOMB 3NS5A 3K5LA 2XLJA 3QIPA 4XPEA 4B3SF 5CYQB 5L1LA 1N5QA 3JSMA 1TL7A 1U49A 5ETRA 6FD1A 3FEZA 2VFRA 1UJ6A 3DFEA 4F3QA 1VQNS 1B64A 4OHVA 3RAMA 4OZ0A 3W7BA 5IT4A 2GIFA 4LF8J 4M5IA 2KJVA 2XMKA 3H5XA 2IRYA 2WVDA 3M2RA 4ZVFA 2E1MC 4DV2J 3M8QB 1LEOA 4V19J 2NS1B 1WF1A 3KLEB 2FIUA 3FSYA 1NAQA 4ZMMA 2J0WA 1KLMB 3F0NA 2QC3A 2NUUG 3OJUA 2RQ4A 2UU9F 2GMLA 3JXOA 1YK9A 3GYNA 4PG8A 1XMOJ 2VL1A 3KHLA 2RAQA 3TVYA 2PC6A 1KC8T 4LFAF 2EC2A 2HVZA 1FDNA 1Q8BA 3TA2A 3RG6A 2XMMA 4JI8J 2QEXS 4RO0A 5KFCA 4Z7YA 1KVJA 2PMZD 4LSLA 3NOGA 1XR6A 3MWBA 2RRAA 2VDHA 1RTIB 4DUZF 4G6VB 4WP3A 2FHKA 4FS2A 3W2VB 1EX8A 7FD1A 3ILOA 3C19A 3HLUA 1D9DA 3NMAA 4CT9A 1JLCA 1DLOA 4DN9A 5LSLA 1HQEA 3BYRA 1U24A 4OJHA 2EC0A 4EFAC 3DM2B 3D6MB 4WFNQ 4A8OA 1B99A 3N28A 3AY0A 1VCTA 1Q5VA 2XMTA 3S6EA 3HP6A 2QIFA 1LW0B 4DV7F 5KFVA 4YR3A 3CCVS 3E01A 3DLKA 1MLAA 1LNQA 4MKBA 2AEFA 2R7UA 1RXOB 4MIBA 2XS5A 1VLOA 3P49B 2D3ZA 1OJ4A 3TJ8A 2K06A 1RHMB 1Q53A 1X5SA 4ZVHA 4RU9A 2AGOA 1X5TA 3IO1A 4KR0B 3GV5B 4HKQA 2QMUB 5HMZA 4PXEA 2K2PA 3EDQB 4KSEB 2UXCJ 2BMBA 4ECZA 3PY8A 2WVEA 2V6AA 5D78A 3K5NA 2HBYB 2AJ4A 4I7FB 2ZFHA 2P2CB 3F44A 3GMGA 1FVQA 1QAIA 5GADI 1S6PB 1NDKA 3G71S 1BQNA 2O67A 2DNKA 2JRSA 2MZRA 1N34J 4ZP9A 2OPRA 5D0HA 3OJSA 3R7SB 3CSKA 3GFZA 2QJ3A 1PAEX 2HFZA 1XR7A 2BKOA 4U8VA 4N41A 4LT6A 4LR7A 4DN0A 5K14A 2E7VA 3NAHA 3VF0B 3ENQA 1WHVA 1EKRA 2E1CA 2NR0A 1VJQA 1KHWA 5D4OA 3HZGA 5J1EA 1D8YA 4Q0BB 4KHMA 3P45B 5LXYA 2CQHA 5CD4H 3RRHA 4LJMA 4ZP8A 1JXLA 1PO6A 1JLBA 1SH0A 5KG1A 3K58A 3T6JA 2O3DA 5KFUA 3HCXA 1HI1A 1SV5A 5J2MB 3DLBA 1ELOA 2Y1IA 2PT0A 3FUYA 7FDRA 1XC9A 4RW4B 2YQ0A 1L5UA 2VH7A 3E8OA 1D3WA 1F1BB 3M7VA 2VQEF 2C2MB 3AJ2A 3HK2A 1PYTA 4PG6A 1HNWF 2W2QP 3TNVA 1UETA 3G9CA 1YLXA 2WZ1A 1M5HA 3DDKA 4ZPVR 3FRZA 2V50A 1B7FA 2R7OA 3FJ2A 1KS2A 4JUZA 4DPXA 2V8DA 3HJVA 4ECTA 1FJEB 1C0TB 4UOGA 4U7CA 1WOOA 1U25A 1S99A 4OYBA 2DYAA 4OJ3A 2RIJA 3MM6A 5HN0A 3FGVA 5IOLA 5FLXU 5HP1B 4ECUA 3EYZA 4QYZK 3KK2B 3D68A 1VK8A 1HNVB 2ROEA 4QPXA 3CULA 4WE1A 4DUYF 4X4SA 3PJWA 1M5OC 4ZS6A 1CC8A 3LP0B 3HFVA 4J5OA 3VWSA 4EWTA 2ADBA 3KNAA 3PYGA 1U6ZA 2DNRA 3PO4A 3ADAC 3VZIA 2I1RA 3MCNA 3JYTB 2DPJA 4OL8A 1LWCA 2HBZB 2HQIA 4OYXA 3Q24A 2CPJA 5FDLA 3MMAA 4N7TA 4JI1J 1RTZA 2IPOB 1HMVB 2R7TA 4TYBA 2V5HG 2BX6A 2NREA 2ZOMA 4DLEA 4P2MA 5IV4A 3HF5A 2QLFB 1NNDA 4DJBA 2Z2ZA 2LYVA 2XI3A 3HDSA 4B3TF 1JLAA 3I4PA 5AJ3F 3G86A 2XNRA 4ECQA 3ET6A 3T1YJ 2E1PA 1R3NA 2KDOA 3MD1A 4HT5A 3R9LA 3N4WA 5F8MA 3PW2A 4AQYJ 4M63A 2PD1A 2L41A 4NASA 2QSFA 2XZDB 4ELVA 1H3DA 3SSQA 2IBOA 1GMWD 3B54A 2OP5A 2MJUA 1MMLA 4WKYA 4UY85 1FKPB 3RB6A 4YHHJ 2B7BB 1UKUA 2HQCA 2HS3A 4NWBA 1NJZA 2G13A 1CG2A 4LREA 3M2UB 2VG7B 3V5RA 3UVJA 1MROA 4BC9A 4JYAJ 1IBMF 3BGRA 2CJYB 3ILLA 5KG0A 1BD6A 1Y9OA 3DGPA 3NWGA 4NI2A 1U1OA 4DXLA 4RUHA 4EEYA 2AU0A 5SUHA 5F0UA 3GPAA 3M8SA 1DAXA 4IH7A 3KK3A 2MY8A 2B43A 1AROP 2PSZA 1P8GA 4RNOA 2DIVA 5LJ3Y 1K9MT 1S79A 1UFLA 2KFNA 1HWJA 3M9MB 1NCLA 1OPZA 4HLBA 4NLDA 3QJLA 2FJEB 2UUBF 1NZAA 1FI4A 2AX0A 3ZC4A 3KLVA 2F63A 1L3SA 1YBUA 2CJXB 5KG5A 4B3OA 1JB0C 3CJ2A 1S77D 2AWZA 2Y8YA 4RWWA 5D4PA 3FKBA 1HHQA 1RTJB 3OVBA 3W1YC 5IFMA 1S1WA 5CYMB 3BDEA 1UVJA 4DV3J 3LO3A 4IRDA 2KB2A 4F26A 5CD4A 2IM2A 4NXNF 2R7QA 3D67A 4YUDA 1X4GA 2BE2A 1FF2A 5HQ8A 1HQUB 2KG0A 2DNMA 4B3SJ 4IH5A 2C2KB 4PYDA 2AJFE 1HBOB 2HHSA 2JEGA 4DS4A 1LFWA 4RZRA 1VQ5S 1RT3A 4IR1A 4RBUA 1F5BA 1YKWA 2DXEA 4JOUA 2L9WA 2CKWA 1WC3A 2DHHA 1H2TZ 3QGIA 1K44A 3LH2S 2ZBPA 2DR9A 1C1BA 3AD8C 4OYZA 1QDUB 1D9AA 3W5YA 4U7UK 3TQEA 2FGCA 1FE0A 3PCOB 2XHWA 1Y4ZB 3J80Y 3Q8PB 1JIHA 5A0YB 6FDRA 5EUHA 3D4JA 1MW7A 2BYCA 2YKMA 3ISND 1ITPA 3O3LA 4UOCA 2UU9J 2IMOA 4KO0A 1FKOA 3P5BP 4BC7A 3QQCD 4ERDA 3JQMA 2YPYA 1VRUA 1WSRA 4HACB 2LEAA 3NCQA 2AW0A 5IV3A 1HNIA 2Q43A 5DRKA 1QTNB 4WCEQ 4LFAJ 3MEGB 3BH6B 2ZKTA 4J9MA 1SJ4P 3SFGA 4NL5A 2BJ9A 3IA0A 3MAAA 1F6TA 3L3CA 3TWZA 2JLGA 4V1Ak 4Y2AA 4EI2A 1QSYA 3TOQA 3SFUA 3GSDA 5E41A 3DNCA 3OXGA 2AP6A 2FJAB 3L09A 1OIAA 4DUZJ 3C46A 2JSXA 2X1AA 4O3QA 1T9TA 2YWEA 4GVBA 2NXEA 3HT3A 1I94F 2R7SA 1VHIA 2OD6A 4ID8A 4N56A 2XS2A 5CA5A 1W2BR 3NG8A 3WBZA 2H48B 3A4TA 1YZ7A 3A3OB 1S0VA 2OPPB 3GWCA 3BM7A 3GYGA 1WD6A 2ZEJA 4O3RA 2DR6A 4U6PA 2UVRA 4GC7A 1Q7LB 2NSCA 3E3XA 1N56A 1GTHA 4DV7J 2B8QA 2M88A 1KDNA 4KJIA 2CQ4A 1EQMA 4IQMA 1MWQA 5EWGA 4CYUB 2CWXA 1T03B 2N7CA 1MN7A 3FSIA 1GFWB 1Y7PA 2CG8A 1P1LA 4K7QA 3K17A 3TX8A 3DXBA 3Q8RB 1VQ4S 3ILJA 2J5AA 1SJRA 1N6QA 2PA3A 2CDQA 3ZZPA 4R8UB 3L7OA 4GVLA 2HGNA 4TNOA 1RT6B 5L39A 4CLUA 3M32A 3PG9A 5C42B 1T05A 4NZ7A 1V3SA 1JMTA 4BWJA 2FVSA 4USIA 4PG5A 1R6YA 3VVUA 3LANA 3HM9A 5IZHA 3QT7A 3D7SB 4ZLPA 4CLKA 1SL0A 5AXKA 3NMRA 2ATLA 5FIIA 4F4YA 3OSNA 3PIOQ 3T5JA 1IVZA 1EIYB 2VPYB 4ELTA 2D9PA 2C3OA 1N33F 2AKWB 1G6BA 5DDPC 2MZ1A 1HNZF 4ID5A 2I5JB 1WDTA 3MM9B 3IBFB 4WFAQ 2WBMA 4TY8A 1FXDA 3IP0A 4DZ6A 3I55S 4K4SA 4YR0A 1M5VC 2R7XA 2ZDPA 4XAKA 3SQGB 1C0UA 2BANB 1OWXA 2ASJA 1VJWA 1S49A 4RKUC 2BKNA 5J1NA 1O5JA 2IJNA 4CT8A 1KLNA 5KOWA 1W2IA 1A0OB 4OX8A 3FCVA 1RHQB 1F0XA 5JUMA 2BJ7A 1DTQB 2RB7A 2VQEJ 3CJ0A 4OZLA 1HNWJ 2DH9A 1HW8A 2OSRA 2KT3A 2A2DA 2C1EB 1VQ7S 2VODA 3ISNC 3CJTA 3X3UA 3DYAA 1IM4A 3MMBB 3TZXA 2ZJQQ 2C2NA 4WFZA 2IJFA 4IFVA 3MM5B 3FQLA 3OFEA 4HVZA 4WYLA 2HQDA 3R3TA 1N0UA 5LSOA 5F3TA 1NZ8A 4KV8A 1L3KA 1NK7A 3NS6A 4FYXB 4DL5A 2YH1A 1NB2A 4Y00A 3DMJA 2AZ3A 3CCLS 4M5GA 2R2RA 1F9EB 4DU8A 1N5TA 2JC1A 3V6DA 2W7PA 1RYSA 4USMA 2ADCA 3KLGA 3Q22A 4C6AA 3TP2A 3TJ9A 3OHBA 2JEFA 2XO6A 2KI2A 3F41A 4DUYJ 3PX4A 3EUNA 1M5SA 4USTA 4DMZA 3GR1A 4NEYA 1GX5A 1YJWS 2GVZA 2VONA 3W65A 2MZQA 3D9BA 4EO8A 3G6VA 1P6TA 4H4KA 2KO1A 2VBYA 3KUEA 2YWHA 1UJ5A 2Q66A 3IWLA 5CABA 3PW0A 1JKHA 2OHDA 2YKQA 3H2UB 3RZAA 4Y0FA 4TYAA 3DRRB 3TA1A 1KOHA 1CJKA 1S4FA 3UR3C 3I0RA 3FNNA 2AJ1A 2DRAA 3R5JB 4XTTA 4MT1A 1JJHA 5I4MA 4QYRA 1G7CB 4TU8A 2LECA 3HD2A 2MGZA 2G1HA 5AT1B 1I5OB 3R7BB 1D1UA 4B3TJ 5KFXA 5AJ3J 1VBZA 2EXUA 3TANA 2ASDA 3FBEA 2XB2D 2D69A 2MPUA 3K2YA 2DHAA 3ZFVA 4G3IA 4I6WA 1XWLA 3DXSX 4CTAB 3KLHB 3B8HA 2YKOA 1N5YB 2OH2A 2KKHA 4DQQA 4NA2A 1V6HA 4M5JA 2D3OR 1RAGB 4P2XA 3EX7B 3BPSP 5HATA 2JLEA 3N6MA 3CIMA 1I3OB 3RBDA 1Y11A 1LW2A 1DQ8A 2QZ8A 2EKNA 2VOOA 4OZ3A 1IBMJ 1UFWA 3UN5A 3GCWP 1S0OA 2W4PA 2Y8WA 2NZCA 1AA1B 2ZH3A 4A8SA 1KN6A 1S1TB 4XO0A 2N3LA 5C5JA 4DSLA 3T1HF 4NLVA 3HSZA 2CZVC 4U96A 3HZEA 4B08A 4AL5A 2MY7A 2D3UA 1U1LA 4Z2XA 5AXLA 3FC9A 1QUVA 4K0KF 1REVB 4YN3B 2EW9A 3OUYB 1HA1A 2J9EA 1KHVA 4DQSA 4PQUA 5HMWA 4ER8A 4F8RA 3HD1A 4B9MA 2WHOA 1BLUA 4OLPA 4PUOB 1U1QA 2OMLA 2UUBJ 4TU7A 1V3ZA 2ZDOA 1VISA 3UNYA 2CPHA 2KT5A 1SH2A 1EHWA 4C4WA 2YXLA 5BJRA 4C97A 2HHPA 2VQFF 1TUWA 1SJQA 1U26A 3OT9A 2FVQA 3QAUA 4R0JA 3W62A 3GIRA 3KMSA 4NXNJ 2N82B 3QLHA 4DPTA 4NXMF 3BPDA 3TAPA 2ZZMA 3UNGC 1GEHA 3AA9A 1OY9A 4OI1A 3RTVA 3VV2B 2Q3PA 1TVRA 2MEWA 1TK5A 1VIXA 2UVVA 1XNQF 4QBUA 2IVMA 1J5OB 1BQXA 1VMBA 4WPAA 4PXBA 5D8HB 3UWTA 3CMAS 4QCLA 2FZGB 1U2FA 3WC2A 1UVMA 1X4BA 1GTEA 5HQMA 4G1IA 2HGLA 3J80U 3POTB 2ASLA 3VTIA 4KGZB 2MQOA 1KD1T 1SC3B 4NLOA 3TW0A 5K20B 3D54A 1DTTA 2KZMA 1BWVA 1WI8A 4DFJA 3G8QA 1NK6A 1NU4A 3A8KA 3MFHA 5IXUA 1CULA 3E51A 3DDNA 4NLSA 2JZ5A 4ETXA 1PKUA 5A6PA 5E3RA 3PRBA 4I4BA 3DRPA 1RT5B 5ETQA 4AD6A 4EU0A 2CIMA 2RJZA 2H65B 4FVCA 1SJ3P 1U0HB 5AXMA 1I6JA 1T11A 2W24A 4KB7A 1IWAA 2OPSB 3D3BJ 4HEA9 5D4LA 3BV8A 4B9SA 1SIWB 1U2CA 1RKJA 3KDOA 2D74B 2RE1A 4LUBA 2MHEA 2CQCA 2W2NP 4DBQA 4WXWA 4QW8A 5F8NA 1SVDA 1I94J 3NCPA 2HAFA 2RHSB 4WYWA 2LDIA 2FZKB 4I6YA 2FJDB 2X1GA 2DNOA 4EBEA 3KUHA 1APSA 1BQMB 3AFGA 3R5GA 1CJTB 3KHGA 2WSEC 2WVBA 2RKIA 5T14A 2RQCA 1VQYA 3H0PA 2H4WB 4RUCA 4OZ2A 4FXWA 3HVTB 2BDPA 3M8YA 2CZ9A 4O0NA 4M5KA 4CLTA 2IC3A 4FYDA 4LSNA 2GMHA 3HKZD 5B08A 2HFNA 2M5YA 3OR1B 4JI4F 4IUFA 3LWMA 3BDPA 4O44A 2L9DA 2QL5B 4FNHA 2UP1A 3I0SA 3SIPB 1VQSA 3MAHA 5MLCV 2WOMA 4ECWA 2G1DA 2P9CA 2OO4A 2LQ9A 3G6XA 3BREA 3I5BA 5CYQA 3LP2B 1X7VA 4P7VA 3EJMA 4GMKA 3GJSB 3GILA 2ZJRQ 1UJ4A 2VBWA 5KFMA 2BV3A 2I0XA 2UVWA 2KU7A 3NOCA 3PHEA 1N48A 4MMOA 2ZH8A 1BWEA 1RWPB 1RAFB 3D1QA 3H5UA 1QD1A 3IRXB 3GTYX 4YS2A 3DGVA 3KHHA 3VAMA 4ATNA 2GQ2A 2OEMA 2YX7A 3UD3P 1HYSB 4UQTA 4MKVA 3M8QA 4CO3A 5F3ZA 4ZJOA 2CA9A 3WHIA 2MKIA 4J9LA 2FZCB 1NSQA 2BEFA 3KLEA 4DDFA 5GMEA 1UEVA 2WW8A 3I9ZA 5A8WB 1N33J 1KLMA 1HNZJ 5E2QA 4EZ6A 4MH8A 2P9GA 2AF6A 5DM7Q 3CDAA 1F9FA 4G1QB 5HANA 1ZETA 1EZZB 4TKTA 4DV1F 2ACMA 2GAGC 3OFGA 1OY6A 1Q81T 4TVAB 4NZ0A 2P8IA 4Y2CA 1RAHB 3W8PA 1K47A 4MTPA 3CVKA 2B9YA 5ETTA 3MM7B 1UP1A 3K89A 1R43A 1NJIT 3AB4B 1VBYA 4KHRA 4ZVSB 1UWBB 2A1BA 3W2VA 4JI2F 1CEZA 1RHJB 1U1MA 4DR3F 2QA4G 5LL6d 3VQTA 1CQNA 4CIOA 4HT7A 1I51B 2XGPA 4K59A 2DGVA 3DM2A 2CQ3A 3WIVA 1VQ9S 1KQFB 2JL9A 3GB0A 1JLFB 3HO1A 2VG6B 4W92B 1Q95G 3FBBA 1LW0A 1U1PA 2EG2A 2YNGB 4K8RA 1HL6A 1T02A 3QATA 5DDRC 5L1KA 4FBUA 1C1CB 1PG5B 4DSEA 3KK1B 4RU2A 1YJNS 1DBDA 4E98A 5DQHA 4B9LA 3TEHB 4KT0C 2DBBA 2E5JA 3QT8A 4J9QA 1SCJB 1U8SA 2ZZNA 4ZVUB 4I7FA 5T7LB 3ONQA 1U02A 2E9TA 2XCPA 2CPZA 1S1VB 1S6PA 3H2VE 2DHGA 2DH7A 5D15A 3D0HE 3OL6A 2BQRA 3I87A 4I64A 2MMYA 1QTMA 3I5CA 5B0GA 1BC6A 2R42A 5B0EA 3AT1B 1TAQA 3AD9C 4QWEA 1E6YB 2W1BA 4Q2LA 4GKJF 2Z0GA 1GMUA 1OMSA 4WZMA 2JNJA 3MTKA 5D0EA 2W9AA 4HDHA 1JLGB 4TXSA 2CQDA 3EVOA 4Q0BA 4D3HA 5DG9A 2ATCB 2IBKA 5ADZA 4OJ1A 1KQGB 2G9OA 2OFGX 4O4GB 2GO8A 2KYXA 4UQGA 3SYZA 3PR4A 1GAOA 3C16B 5J2MA 3A1YG 4RW4A 4YQWA 5ETMA 2E66A 3ZNUA 2FC8A 4YB6A 4OMFG 1MN9A 3I96A 5E33A 2BJEA 4YDDB 3T1HJ 5HVHA 5DGAA 3PRDA 5D4NA 2PN6A 2Z2YB 4OI4A 2K1RB 4K0KJ 3QWUA 4KY3A 1C0TA 3OR2B 1KOOA 2CWKA 2DNQA 2L3MA 1URRA 3BSNA 2HS4A 2FC9A 2FGOA 5JJBA 4P6QA 3UO0A 3MTJA 2AZ1A 1EP4B 3UD4P 2CJBA 3T9NA 2HEKA 5GAEU 1HNXF 5HP1A 5LMUF 2VDIA 1TR0A 3VGTA 3BGOP 5F8JA 2YKNB 1SQGA 3KK2A 1LWEB 2OIHA 1RWOB 1HNVA 1TELA 5LM7E 4IDKB 1RT7B 2VQFJ 2V8GA 4OYPA 1S9EB 1FNOA 3LP0A 1NHKL 4NXMJ 4Z37A 2DITA 2JOQA 3MF5A 3UDLA 5HBMB 4X66F 2FHJD 3BKUA 2FPHX 1TP7A 3IBCB 1F5CA 2PMHA 2FTRA 3CCQS 1XNQJ 3JYTA 4CO2A 3NNCA 5IT9U 3TYTA 4PKDB 2DNLA 2DGQA 1HMVA 3QJJA 3I6PA 4PPDA 4FF4A 4RBTA 3ZTSA 3C3LA 4PG7A 2KJWA 2OD4A 4ED8A 1RDRA 1YRTA 4QWBA 3QSYB 4DSFA 2PE8A 1NPKA 3KDNA 2FVCA 4A47A 4YOEA 2RHQB 5SZTA 2MQLA 3OHAA 4QOTA 3BS9A 1WUUA 2VG5B 1GMVA 4C98A 5EWFA 4F7VA 4FNIA 4OI3A 1XR5A 1ROFA 5J1PA 4KC5A 3DHWC 1VGYA 3DLJA 1FKPA 4P73A 2LXIA 3RBXA 2V9KA 5KFOA 4ILMA 1X4HA 5KFZA 5DDOC 4ZVRB 4BS2A 3UN3A 2B4UA 3M2UA 2VG7A 1ZAVA 1RWVB 2OPQB 2ZVIA 3PACA 2IM1A 2GS8A 1Q86T 2ZBRA 2ZBQA 1NSPA 4ZIVA 4LF4F 2ZD1B 3AXMA 2WONB 2HKEA 1YX2A 1VRQC 3EZOA 3MPUB 3PFEA 1QSSA 3HVAA 3NKYA 9RUBA 3M2VB 2HSEB 1ZPVA 5CYJA 1RT2B 3UD5A 5KFLA 1IBLF 1TV6B 3CNQP 1SL1A 3TVKA 1S6QB 1RAOA 4W4MA 1SKUB 4GO7X 4N5SA 1U47A 2VJUA 3MPDA 3THTA 2F40A 2V0NA 3T41A 5JMNA 2RRBA 4NCBA 4OJGA 2ILYA 2D9OA 2VD3A 1VQMS 5E3PA 4LIRA 3R2DJ 2XSJB 2X1FA 2DR5A 2KM8B 1S97A 4J9PA 3QRQA 1SPBP 2NYHA 2V94A 3PKMA 2HW3A 2J7KA 4MYUA 1RTJA 2E29A 4JI4J 5I3QA 5CYMA 3VQSA 1K1QA 4DR7F 1MNEA 3N79A 1PILA 5B7WA 3VAHA 3MGJA 2LXUA 2KVQE 3NL0A 3UI3A 2VFUA 4PWDB 1HQUA 3RJMB 4YEAA 3ETOA 1G1XA 5ETVA 1HBOA 3CJ4A 3MUMP 1LFPA 2M9KA 2HMIB 2XQCA 3GYXB 2DNYA 2XBPA 2QTWA 1YJ9S 1YHQS 3D1OA 4ZN3A 1WC1A 3I56S 4CI0B 1O6XA 4CLZA 5ETSA 4M5LA 3CJKB 3QT5A 5HJXA 2R8HA 4HHJA 1QUPA 2UXBF 3HFKA 5A0YA 2XS7A 2YKPA 5H9EK 4ZJLA 1R8AA 1XK8A 2Y0SD 4IOAQ 2EBGA 3BEGB 3BZQA 1HQEB 4I0WA 1Q82T 4FKXA 3PYFA 2R7WA 5KG4A 2FJBB 4HACA 2AV5A 3RB4A 2GHWA 3J7Z5 4DL6A 2ZH2A 3NEKA 2QSWA 2ZOGA 2J8AA 5J2QB 2VOPA 2HLTA 4OIXA 2CYYA 3SCIE 2W9CB 2LEBA 4M5DB 1ZM9A 2CPXA 4O4RA 2FVRA 2NPFA 3LAKA 3D3CJ 4RNMA 1DJ0A 2R2SA 3GR0A 1R7IA 4JI2J 3SBMA 2J9DA 3F56A 4DR3J 2DNGA 2UUCJ 1VRTB 3IWXA 2QL9B 2UV8G 3RBZA 1F3VA 4A4JA 3G87A 1S72S 1S1UB 3MHYA 1HWIA 5B0DA 3OVAA 2ZZTA 2OPPA 1VIOA 1IKXB 2DNHA 3TX0A 1NPRA 1VS3A 1SKRA 2YKAA 2B5JB 2EG1A 1F2HA 4HR2A 1F9HA 3AOBA 3H2LA 4DL2A 2H4YB 2HHTA 2LFVA 2MZJA 5C25B 2NPIA 3DOMB 3M6WA 1R0BG 1D09B 4CYUA 1T03A 1UZDA 1Q8LA 1AB8A 3PIPQ 1GH8A 5CZXA 1KEKA 4AL6A 1N54B 1BUXA 1U4BA 1MWZA 2CVEA 1R8BA 5KFWA 4C8KA 3KLIB 5HMYA 3R8YA 3S7RA 5THWA 2FLPA 2QE5A 1JX4A 4USWA 2H54B 2Z58B 2VPZB 4R8UA 2DGUA 4ECRA 2FQQB 5DM6Q 1OYDA 2E5LF 1RT6A 3HVRA 5KFBA 4P9SA 3TQ1A 5C42A 3B78A 3CUNA 2MQPA 1QAJA 3DRSB 1T8EA 2ZE2B 3LF0A 3H5SA 2AYEA 2AEMA 1KFDA 4M5NA 1YQHA 1NK9A 1MU2B 2Z8QA 1B4SA 4B3RF 1RT4B 3RR7A 4NLWA 4AQYF 4X4NA 5D3GB 4GKJJ 3SDEB 3BGFA 4TLRA 1V9OA 4CLPA 3OFFA 2QFIA 3DOKB 1VQPS 4M1KA 3PDNA 2I5JA 4TU9A 2GC8A 1FJCA 3MM9A 4DPYA 4Q5VA 3EMTA 2HHVA 3IGVA 1VC0A 1NSAA 2HRUA 2W7AA 1Y3JA 5CAAA 1XMQF 4JYAF 5HJYA 4J90A 4C9DA 1TK8A 3B4DA 3SQGA 1DQAA 2BANA 3B6BA 3F73A 4MKAA 5L38A 4GC6A 1IR1A 3LP1B 2AD9A 3C15B 3JAMY 5F9NA 4C8NA 3BYPA 2R9LA 4Y2IA 2H5IB 4L75A 5KFAA 1DTQA 1B70B 1M1KT 1H38A 1EAYC 1ACMB 3TARA 2XLKA 1FO1A 2JEIA 4DG1B 4WP9A 3R6LB 4V19X 2Q1LA 2VA3A 1H0HB 3ZZ0A 4NX9A 2MZTA 3WIUA 3MMBA 5E3QA 2PA8D 1SIZA 3R6GB 3IM9A 3JQJA 1LWCB 3MM5A 4LRDA 1F5AA 4QWAA 4HH0A 2Y0BB 4K4YA 2OGUA 5HROB 4QU7A 4CNYA 1S48A 2OAUA 2HVHA 1TFWA 4LFBF 4ZDNA 4WTYA 3AA8A 3U02A 1PJ7A 1HNXJ 4DPOA 5LMUJ 2UXDF 4OV6A 2C22A 2K7JA 2MQMA 2MXYA 4L72B 5BR8F 4QJVA 2KM8C 4I2QB 2J6UA 2ZHAA 4DV3F 1N52B 3ICLA 2DXDA 1T9YA 1PYSB 3CC2S 1TQLA 2WK4A 1X4DA 3OTOF 5KFSA 1ZOTA 2I6WA 2IM0A 1HBUB 4ZJQA 3UDEA 1S57A 2HVEA 2V4JB 3PHTA 3ENWA 2IDLA 1AT1B 1PGZA 3FVYA 2FHOB 1UPMB 4GO5X 3CC7S 4UZBA 4X4OA 4X66J 1YG0A 2DGOA 4M95A 3G82B 3RW6A 1NRKA 1FHTA 2CQ1A 4QWCA 1N5VA 2F5GA 3DRRA 3M8RA 2FLOA 5LXRA 1FRIA 2MQ8A 1LV5A
chains in the Genus database with same CATH topology
1AXQA 1P6TA 4H4KA 1Z1ZA 3KLGB 2VBYA 5EX0A 4Y6IA 2YWHA 4I2PA 1UJ5A 4A8QA 2N7YA 3CDUA 3M6UA 2EPIA 2Q66A 1LKZA 2KHDA 1FRXA 3IWLA 3TRGA 4Q44A 4X65F 3PW0A 1H2VZ 1JKHA 2XULA 3M6XA 1JWWA 2YKQA 3H2UB 4C11A 3B82A 1ZM4A 2DT9A 3RZAA 2HLUA 4O3PA 4Y0FA 3CCTA 1H98A 5A8KB 1T7PA 3JTNA 4TYAA 2HG4A 2IM3A 2ZVSA 4YR2A 3DRRB 3QYYA 3OL7A 2QMWA 3NLCA 5IM0B 4R0EA 3TA1A 1KOHA 4WJBA 1S4FA 3UR3C 3I0RA 1RP5A 2E7WA 2FD2A 3FNNA 3J7YU 5L9XA 2AJ1A 1K73T 2DRAA 4I2PB 4USJC 3HHDA 2W25A 4ZCMA 2E9RX 1JJHA 1B0TA 2LMIA 2KXFA 4C8LA 2UXCF 2PGCA 1PC5A 5I4MA 4QYRA 3IBWA 1G7CB 4FXVA 1JKHB 4TU8A 2LECA 3TO8A 3THVA 5IQ6A 2YNIA 4C11B 2MGZA 3RB3A 3DU6A 2HHXA 1D1UA 4J9NA 1OQ6A 4CTAA 3KLHA 3CIZA 4PCQA 5KFXA 4AYBD 4CH1A 2YNHA 1N5YA 4EYHB 3OPKA 2IRUA 1RTIA 2YNFA 1VBZA 3I0RB 2HZCA 3TANA 2ASDA 2C2EA 2ZH9A 2F9JA 2X51A 2XB2D 1UVKA 1KNZA 4C8MA 1CQMA 1FA0A 3U1NA 4K5RA 3MEEA 2J0XA 4W90B 2RMLA 1N34F 2MPUA 3K2YA 2DHAA 2FLNA 2HQ3A 3ZFVA 4G3IA 3CD7A 4I6WA 1XWLA 2UUCF 2XC9A 4R5PA 2VC1A 3DXSX 3M4XA 2YNIB 2MGZB 2P5VA 3HVWA 1L3VA 2NZ4A 4KHPF 2ABYA 2KFYA 4CTAB 2M7SA 3KLHB 2ZHOA 2B9XA 3HMJG 2YNHB 2J7UA 3B8HA 2YKOA 1N5YB 3BSCA 3FSXA 5JVHQ 1FEEA 2OH2A 2KKHA 3CEDA 4URGA 2YNFB 2GHPA 2Z2LA 3G8SA 4DQQA 4ED2A 4NA2A 4GKKF 3LOUA 1GT8A 3O44A 4PRFA 2HGMA 2ZKUA 1V6HA 3U7JA 3NGDA 4DR2F 2D3OR 1O0PA 4BCAA 2ZH4A 3MEEB 2OSQA 3EX7B 1W25A 4Q8EA 4RW6A 1WTBA 2DGSA 3LW5C 3QGHA 3JB9k 2JLEA 1QY7A 2NQPA 1H2UX 3N6MA 4RLEA 4DFPA 3CIMA 4R5PB 2UVUA 3MPVA 3OXLA 2CJQA 3VR1A 3BR9A 3RBDA 4IR9A 3GIJA 2JFKA 4FVMA 3O1LA 2QV6A 1UA0A 3OXFA 1D8ZA 1LW2A 1SI9A 4CH7A 1K0VA 1DQ8A 2QRRA 2QZ8A 1M5KC 1U1KA 1YVFA 2M2BA 2VOOA 4NYZA 1ZM3A 1VFJA 1UFWA 4A46A 1VQLS 1FJ7A 5IS2A 4A8YA 1X9WA 1E6VA 4MFBA 1S0OA 1DRZA 1XMBA 4ZHRA 2W4PA 1PC4A 2HPUA 1KRPA 4RW6B 1SUQA 1HR0F 1UVLA 1REVA 4OHXA 2ZH3A 5GAGI 4A8SA 5DG8A 3OUYA 3US5A 4QYZJ 3D1HA 3EXCX 1KN6A 4BWMA 3OVSA 1S1TB 4XO0A