3KJVB

Hiv-1 reverse transcriptase in complex with dna
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
428
structure length
400
Chain Sequence
PIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna
molecule keywords Reverse transcriptase p66 subunit
publication title Visualizing the molecular interactions of a nucleotide analog, GS-9148, with HIV-1 reverse transcriptase-DNA complex.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
total genus 98
structure length 400
sequence length 428
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3kjvB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3kjvB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3kjvB03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3kjvB04
2FJWA 2AGOA 3G86A 2BQRA 3CJ3A 5L1LA 4RNOA 4J9SA 2EC0A 1MU2B 1RT5B 1FKPB 4NCGA 3QYYA 2IC3B 5K14B 2ZKUA 1FK9A 2UVVA 4MKAA 2IAJA 3EZUA 4IG0B 3H2LA 3H98A 2W9CB 3E01A 5DG9A 4NLTA 1NHUA 1LWEB 5HLFB 4K4SA 4I7FA 4OL8A 3PW0A 3KLFA 5KFDA 4F50A 2WK4A 4G1QA 3M8QA 2AWZA 5KFWA 1JLGA 2UUTA 1IKXB 3NKYA 5DLGA 5C25A 3ICLA 5C42A 3QLHA 5DQHA 3CVKA 4U7CA 3GYNA 1NNDA 1S1XB 2UVUA 1HYSB 1RT3B 3JSMB 1HYSA 4ZVFA 4IH6A 5KFIA 3UR0A 3OL6A 3TQ1A 5KT7A 3RB0A 3KJVB 3C6TA 4K4TA 3HKWA 4TXSA 2B5JA 1FKOB 5CYQA 2HNDA 1XR7A 5KFFA 2IJNA 4ED0A 1LWCB 4H4MA 4RW7B 4ZPDA 4DEZA 2RDJA 4MIBA 2YKMA 4RW6B 5KFOA 2B43A 4Q0BA 4WE1A 2XWYA 3QGIA 1QE1B 4ECZA 4Y2CA 1D1UA 2W7OA 3RAXA 1S6PA 2ZD1B 1K1SA 3RB4A 4WZQA 4WFYA 3LP0A 3MEGA 4Y34A 4YMEA 1LW2B 1C2PA 3PR5B 3NBPA 5F9LA 1CSJA 3BSAA 2DPJA 3DRSA 1TP7A 5CYMA 4MFBA 4ED6A 4RNNA 2HMIA 1C1BB 5D3GA 4TLRA 1RT6A 2HNZA 3FQLA 4IFVA 2ILZA 3M8PB 1OS5A 4WXOA 2YNHA 3BR9A 4ZP7A 4ECUA 2IM3A 1S9EA 4WXWA 4HKQA 4RNHA 5KFNA 2VG6A 5EWFA 3PJWA 3C6UB 2GC8A 3M9NB 2ZE2A 3QO9A 3FDSA 3MECA 4URSA 1JLFB 3Q8QB 1JLCB 3FFIB 2F8EX 3N6LA 4KHMA 4F4ZA 2BE2B 3KLEA 4ECRA 5KT6A 3LP1B 4ID5B 5C5JA 3IRXB 3BSCA 2YNIB 1HQEB 1C0TA 3VQSA 3GIJA 4EEYA 1DTQB 1KLMA 4KKOA 3KK2A 4Q44A 1TL1B 5KFSA 1EP4B 3MR2A 4NLGA 2XGQA 3LP2B 1RT4A 1S48A 3H5SA 4MKBA 3UPFA 2J6SA 3KLHB 4I2PA 1RT2B 4JV1A 1TL3B 2OPRB 4TY9A 3DOKA 3KK3B 4ED1A 3D28A 4ZPBA 5DLFA 4RNMA 2J6UA 3Q8PB 2FVPA 5KG4A 4PUOB 4PUOA 4URGA 1RTHB 1RTHA 5F8HA 4XO0A 3N6NA 1RAJA 4WYLA 1HNIB 3LAKA 2FLLA 4Q45A 4JUZA 4F4WA 4RW8B 3DLKB 4IFYB 2R8KA 1LWFB 3GIIA 4R8UA 4NLSA 1S9FA 2XGPA 4F4YA 3DLGB 1UWBA 5FDLA 3V6HA 5KFCA 3Q8RB 3DM2A 3JYTB 3LALA 3PW5A 3QIPB 5KT3A 2FLNA 1IKVB 5KG1A 4J9LA 2W9BA 3Q8SB 4KFBA 5L1KA 4DL5A 3UQSA 4TY8B 1VRTA 2AGPA 2IM0A 3DRPB 1S1VA 2ILYA 3QZ8A 2R8JA 1S10A 3KHGA 4ED8A 3E51A 1RYRA 3H5YA 4KV8B 1TVRB 4KV8A 3KK1B 4RNFA 3SFUA 1RTDB 1C0UB 1ZTWA 2WOMB 5KFJA 5F8LA 4QWDA 4EBEA 2HWIA 5I3UA 5KFGA 5KFQA 2RF2B 1S1WA 1S4FA 3H4BA 1EETA 2VG7B 3V4IB 4FS2A 3RAQA 1SH3A 3SFGA 3MR6A 4KO0A 5KT5A 1IKWA 3V6DB 1XR6A 4HYKA 1FKPA 1RTJA 2QE5A 3CIZA 4J9OA 4PQUB 4LSLB 2JEIA 5J2PB 5KG7A 3MR3A 4F4XA 1K1QA 2XCPA 1MU2A 1RT5A 3UDLA 4J9PA 4DL4A 2VA3A 4NLOA 4IRDA 5KFMA 5J2NB 1RT7B 2IC3A 5K14A 2BRKA 3PR4A 4JV2A 4YR3A 1TKTB 4IG0A 4YQWA 2W9CA 1RDRA 4NLRA 3HVAA 4I2QB 1LWEA 5HLFA 1C1CB 1KHWA 5KG0A 1T3NA 2BQUA 5KG3A 1TQLA 2D3ZA 3IGVA 3PHEA 2IBKA 4ZHRB 3OSPA 1IKXA 5KT2A 2E9ZA 4FS1A 4ECYA 4EO8A 4GC6A 4IQXA 3MEEB 2FVQA 3H59A 1S1XA 3LAMA 1RT3A 3JSMA 4QWCA 2WTFA 3T5HA 3HVWA 1J5OB 1R0AB 3KJVA 3I5BA 4TQRA 1S0NA 5C24B 2R8IA 3V6JA 2HAIA 1FKOA 5EDWA 4O4GB 4O4GA 4JV0A 4QPXA 2BRLA 2XI3A 1LWCA 4RW7A 4TYAA 1S1TB 1REVB 2WHOA 4NLQA 4TN2A 2FLPA 4RW6A 2C22A 4Q8FA 2YKNB 1KHVA 3D5MA 3T19A 1QE1A 4QWBA 2CKWA 1DLOB 3HVTB 2ZD1A 4ZP8A 4QWEA 2CJQA 5J1EB 2V0NA 5HROB 2FVRA 1SH0A 3N6MA 1LW2A 4O44B 4O44A 3OLBA 4DL2A 4B3OB 3OSNA 4DL7A 4K4ZA 3OHAA 1T94A 4KHRA 2OPSB 2OPPB 1TKXB 2D41A 4EO6A 5KG5A 4J9KA 4FBTA 2V9WA 4K4UA 3KLIB 1S0OA 1JLQB 3TAMB 4ZPAA 5KFUA 1C1BA 4DL3A 3BJYA 1RA7A 3BGRB 2AU0A 5F8MA 1JKHB 4IH7A 3DRRB 3M8PA 3KHHA 3OL8A 3ISNC 3CDEA 3RB3A 4ZMMA 2JEJA 3H5XA 3KHLA 3G6YA 4ZP9A 5KG6A 5KFTA 1HPZB 4ICLB 1HQUB 1HQUA 3C6UA 3IG1B 2XC9A 2ASDA 1S6QB 1JLFA 2XI2A 1JLCA 3FFIA 1HARA 1RT1B 1SV5B 2BE2A 4IH5A 3LP1A 4ID5A 3IRXA 1S9GB 2O5DA 1W25A 1QAIA 3DLEB 2YNIA 1HQEA 4EBDA 3KNAA 4Y3CA 2C2DA 4IDKB 3NGDA 3MF5A 3KLVA 3I0SB 2ASJA 1DTQA 5HBMB 1S1UB 2VG5B 4RW4B 3QGHA 4IG3B 1TL1A 4KE5A 4WFXA 1N56A 1EP4A 4PWDB 2FJVA 4R0EA 3DOLB 3LP2A 1Z4UA 4LSNB 2I1RA 1JLEB 4K4XA 1JLEA 4YP3A 4EYIB 5I42B 4NLWA 3GILA 3KLHA 4EBCA 1RT2A 3KMQA 1TL3A 2OPRA 2D3UA 1IKYB 3KK3A 2BR0A 5KFEA 3H4DA 3RBEA 1RTIB 1N5YB 4O3NA 2D7SA 1LW0B 2B6AB 4J9NA 1NHVA 2WONB 2WCXA 5F8IA 1HNIA 4R5PB 1D0EA 4RW8A 3DLKA 4IFYA 1JLAB 5F8GA 4H54A 1LWFA 4NZ0A 1TKZB 3FRZA 5J2MB 3DLGA 3PW4A 1SUQB 3G6XA 4ECQA 1VRUB 3JYTA 2JEFA 3T5JA 5DQGA 3QIPA 2ALZA 5HP1B 1IKVA 4ECVA 2GIRA 5KT4A 2RKIB 4KAIA 2IM1A 2AQ4A 3KHRA 4TY8A 2J6TA 3DRPA 4IOBA 3DI6B 4MK8A 4H4OB 1N6QB 1S0MA 3MFIA 2HNYB 1TVRA 3PW2A 4NLDA 1TV6B 3ITHB 1TV6A 3MEDB 3GV8B 2OPQB 4KSEB 3KK1A 3CJ0A 1RTDA 1C0UA 5KFKA 3DMJB 2WOMA 2R2RA 3GV7B 4U6PA 5DG7A 5F9NA 3RB6A 2RF2A 4TYBA 4ZVGA 2VG7A 3V4IA 4TQSA 1WNEA 3I0RB 1N4LA 3EPIA 4G3IA 3FSIA 3V6DA 3BQ2A 3NL0A 1T05B 3H40A 4PQUA 4LSLA 5J2PA 3KLGB 5F8NA 5JXSA 3MTKA 3BSOA 1DTTB 4NLPA 2YNFB 2I5JB 2IM2A 4MK7A 3KMSA 2C28A 5J2NA 1RT7A 1YVFA 2OH2A 3CWJA 3HHKA 5J2QB 1TKTA 3DYAB 4O3SA 3QZ7A 3OL9A 3NAIA 4RU9A 3RBDA 2YNGB 2V4QA 4I2QA 5KG2A 1C1CA 3GV5B 1HNVB 2JC1A 4WYWA 1T03B 2V4RA 1RYSA 2IA6A 2UVWA 4FBUA 4K50A 4QW8A 4QWAA 4ZHRA 4MIAA 4O3PA 1BQMB 3IS9B 4NRTA 4LQ9A 2R8HA 3SI8A 4IRKA 3MEEA 4K4WA 3T5LA 4NCGB 4NLVA 3CJ5A 3OHBA 1J5OA 1R0AA 5DGBA 4MK9A 3NMAA 2AX1A 5C24A 1FK9B 2E9RX 2IAJB 2JEGA 3E01B 4XPEA 3CJ4A 2VA2A 2R2SA 1S1TA 1REVA 4I7FB 1N48A 2YKNA 3KLFB 4NLUA 4G1QB 3M8QB 5DQIA 1JLGB 5KFHA 4YR2A 4ED3A 1DLOA 3HVTA 4KB7A 5KFXA 5C25B 5J1EA 4Q43A 5C42B 2BANB 2BANA 4J9QA 3QLHB 5HROA 1SH2A 2WB4A 3MFHA 5KFBA 4B3OA 2OPSA 3T1AA 2OPPA 1TKXA 4ECXA 3M9OB 4RW9B 3C6TB 4RW9A 3KLIA 2B5JB 5CYQB 1JLQA 2HNDB 3TAMA 4M94A 1IM4A 3PVXA 2UVRA 1JX4A 3BGRA 2WRMA 4H4MB 3GQCA 1JKHA 3GIMA 2RDIA 3DRRA 2YKMB 3OLAA 4Q0BB 4WE1B 4RZRA 4QW9A 3CDUA 2BQ3A 1S6PB 4NLYA 4YR0A 4MH8A 1JXLA 2R2UA 3LP0B 3MEGB 2W9AA 4DG1B 1JIHA 4DG1A 3FQKA 2HWHA 3CJ2A 3PJXA 1HPZA 4ICLA 3IG1A 4ZP6A 3NBPB 1QUVA 4O3RA 1S6QA 4M95A 1JLBB 1JLBA 3DRSB 4J9RA 5CYMB 4K4VA 2C2EA 1RT1A 1SV5A 3DDKA 4MFBB 1GX6A 3QGGA 2HMIB 2W7PA 1MMLA 3V6KA 4IR9A 2JC0A 4ECTA 5D3GB 1S9GA 2AGQA 1RT6B 2HNZB 5KFLA 4IFVB 4Q8EA 4ZPCA 3DLEA 1S97A 2YNHB 4IDKA 2GIQA 3I5CA 3LANA 3I0SA 1RA6A 4RUCA 5EUHA 1S9EB 5L1JA 5HBMA 5KFRA 1S1UA 2VG5A 4RW4A 3ISND 4IG3A 1I6JA 3BQ0A 2VG6B 3CDWA 4PWDA 3IN5A 2FJXA 5EWGA 3GIKA 2C2RA 2IMWP 1S49A 2ZE2B 3DOLA 3QO9B 3BREA 2XCAA 3MECB 4URQU 4LSNA 4X2BA 3G6VA 5I42A 3KLEB 1ZETA 5KFYA 1IKYA 4RUAA 2ASLA 3MR5A 4ED2A 1RTIA 5KFZA 1C0TB 1N5YA 1LW0A 2B6AA 2WONA 2AX0A 4XPCA 3PZPA 4R5PA 2QV6A 5DG8A 5L1IA 3CO9A 2IJFA 3PW7A 1BQNB 1JLAA 1BQNA 2UUWA 1KLMB 4KKOB 4NLXA 4DL6A 3KK2B 1TKZA 2DPIA 5J2MA 3H5UA 1QAJA 1SUQA 2R2TA 1VRUA 5KFAA 4EYHB 4WZMA 4GC7A 5HP1A 5EWEA 3M9MB 1RT4B 2RKIA 4I2PB 2R8GA 3T5KA 3DOKB 4NYZA 3DI6A 5T14A 4LQ3A 4H4OA 1N6QA 3IGNA 2HNYA 4ZVHA 2FVCA 3ITHA 3MEDA 4O3QA 2OPQA 3OL7A 4IKAA 3V81B 3V81A 3DMJA 4ECWA 4R8UB 4J9MA 1UWBB 5FDLB 1GX5A 4O4RA 3I0RA 3DM2B 5KFVA 2ATLA 5JUMA 4IR1A 5DGAA 2E9TA 1T05A 2W9BB 5F8JA 4KFBB 1VRTB 3KOAA 3KLGA 1S1VB 1DTTA 2YNFA 5KFPA 2I5JA 4KBIA 2W8KA 2W8LA 3BQ1A 4K4YA 4ECSA 5J2QA 3EPGA 3DYAA 1U09A 3I5AA 5I3UB 1HMVB 4IRCA 1HMVA 1S1WB 2JLEA 2YNGA 1EETB 1ZTTA 4Y2AA 5L9XA 3TVKA 3BSNA 1HNVA 4ZVEA 1T03A 2FVSA 4WFZA 4O3OA 4KO0B 3NAHA 4ED7A 1IKWB 4NRUA 1BQMA 1RTJB 3IS9A 1XR5A 3QIDA
chains in the Genus database with same CATH superfamily
2IDLA 2DISA 2MKKA 4X66J 2GHVC 2AIRB 3HJVA 3I96A 1M90T 1U1LA 4DR3F 2P5VA 4ZLNA 5KFDA 3ZZ0A 2CQGA 3QLHA 2BDPA 4CO0A 3DN9A 3KUEA 4CYUA 4WFBQ 1R8BA 3D67A 3F73A 5KFFA 1B7FA 5E5NA 3EYZA 5DO2A 2DNRA 4C11B 4WIQA 2XWYA 3D6MB 4F3MA 4ECZA 2B3TB 1K1SA 3GZ7A 2LXIA 3G8SA 1WC0A 2YWWA 2XQCA 2FGCA 1BD6A 7FDRA 2FDNA 3GR0A 3C15B 3AODA 4FVMA 1TR0A 2OKQA 1DQ9A 3MECA 4ID5B 2UXDJ 3GIJA 2XMTA 2MZQA 4FF1A 4BC9A 4CTAB 2RILA 1WF2A 1X4CA 3RZAA 3DGPB 2KFYA 4DR6J 4PWWA 3U1NA 3DLGB 3Q8RB 2DCUB 1CJTB 5ETQA 3IBCB 3ZZTA 2CAJA 3UQSA 4TY8B 4KV8B 3N4WA 5KFJA 2EK6A 5KFQA 2GS8A 1M1HA 1TKDA 3MR6A 5GMKa 4A8KA 4DV2J 3H7HB 3D1OA 1MU2A 2X7IA 2HVZA 2WW8A 3CDBA 2YBVA 3DDNA 2W9CA 5HLFA 4F2RA 3BN7A 3MM9A 3VVTA 4DQRA 4ZVOB 3HULA 1HNXF 1S1XA 3JSMA 1NK0A 4C8LA 1VFJA 4O4GA 2J9DE 3OUYA 2HRUA 3D1HA 1LWCA 4NLQA 1ZS6A 4HLBA 4X4OA 1R27B 3OLBA 4B3OB 2OPPB 2D41A 4EO6A 1KFDA 1WC4A 4KGZB 2ZHBA 1KTVA 1UEVA 5LJ3Y 3ZNUA 5GAGU 4E0DA 3ZTRA 4ICLB 2P9EA 4G6VB 2WBRA 4I1TA 2OAUA 5C2GA 1HARA 1NB7A 3NP5A 2OEKA 4OX6A 2ZH5A 4M1KA 5ITHA 4LF6F 1K47A 4LF1A 2CNKB 3H8YA 1XBWA 1NXIA 2I1RA 5I42B 1TL3A 3HSJA 1IKYB 3KK3A 2HS0A 3SV4A 2WCXA 1RAFB 4UT4A 4G1PA 2N3LA 3ILJA 2HHQA 2XLIA 5I3QA 1FNOA 2KJVA 4D3GA 2HVDA 2V5HG 4MK8A 3C8YA 4H4OB 1TVRA 4NLDA 4RLEA 1TV6A 3DOMB 3DMJB 1EQMA 3CCVS 4G3IA 2PI5A 2Y8WA 1IBKJ 1QLNA 5U47A 2CPDA 3M30A 1SJFA 4DN0A 2ASYA 1TKTA 3ET6B 2V4RA 4P7TA 3VZIA 2LU1A 3UD5A 4JB8B 1NK5A 4ALZA 3AB2B 2VICA 4Y2MA 4XPEA 4ENOA 4NI2B 2KZMA 2WSEC 3AFGA 4YR2A 3ZZRA 3T1YJ 2WB4A 1YJ9S 3T1AA 4LF4F 1AYEA 3VAJA 3F44A 2UVRA 2WRMA 2ZVIA 1HI8A 2RDIA 2YKMB 4B9NA 1FJGJ 1V6HA 3CUNA 2HWHA 4IO1A 2MLYA 2QG9B 2C2EA 3FVYA 3OVSA 1RT6B 3CO0P 4ZPCA 1UVNA 2D69A 4UW2A 3LH2S 2QA4G 3VAKA 1Q1KA 2C2RA 2W2PP 4Z37A 1QSLA 3CMAS 5KFYA 2CVEA 2J0WA 2FB0A 1NDPA 1N32J 3U27A 4NLXA 4ER8A 3KK2B 3CJ8A 2DPIA 2OFGX 3A12A 1JNZB 2UV8A 4GC7A 2V2ZA 1QTNB 3J7ZT 4CLWA 1ZBTA 1RACB 1HW9A 4F04B 1ZPVA 4U96A 3TRGA 2DR7A 3HD2A 1UTAA 3KLGA 2HIYA 4LBIA 2PE8A 1GMWD 5JMNA 2ZKTA 4QR0A 2F4VJ 4ZVEA 2ZEJA 4WFZA 5B0DA 3H25A 4ED7A 2KHCA 1FKPB 4PXBA 4OZ2A 2LQ5A 2PC6A 3E01A 5DG9A 1H98A 1NH7A 1UW4A 2DBBA 2ALYB 1HYSB 5K8PA 3KJVB 5DRKA 3MURP 4HH0A 3GU0A 2HNDA 1XR7A 2EBEA 1Y5NB 2IJNA 1TFYA 4RJVA 1Q16B 2W7OA 1WSVA 2IJRA 2M8HA 5IWAJ 3NBPA 1XWLA 3CCWA 2CJ9A 3B78A 2PEBA 3N01A 2Y1IA 2HNZA 1DURA 4QYZJ 3KJFB 2C2OB 5B7WA 1RHMB 2B56A 4IO9Q 2GC8A 1JLFB 1UETA 2BKOA 3MM7B 4OI2A 2QMWA 1GXUA 5DM6Q 4B17A 3IWXA 2LQBA 3LTOA 3PDNA 1UA1A 2J9EA 4ZDNA 3OFHA 4PG8A 2HLTA 4AQYJ 3HSDA 3PTWA 3NS7B 4PUOB 5LM7E 3B4DA 3HHDA 4RBTA 3B4MA 3MPUB 4C0OC 5FDLA 3R2CJ 4C0HA 5CH7B 2AGPA 3TA0A 4ZVSB 4ED4A 3QJJA 3JSRA 3H4BA 4YHHJ 4ZCLA 1SH3A 4KO0A 4ZLPA 2N4DA 1WC1A 4RO0A 4J9OA 4KPYA 3OTCA 4CZCA 4Z2XA 2P2CB 3N0VA 4YQWA 1VLYA 2CG8A 2DO4A 2RRNA 2E9ZA 2Z57B 2H4WB 3VR1A 4I4BA 1YBAA 2G0IA 4C11A 2UUCF 1MROB 4P6QA 1X4GA 2CKWA 5HROB 1QAXA 4QIWD 4RUHA 4CLSA 3TP2A 3CCRS 3RRKA 1NSKL 2JLGA 3OL8A 1EKRA 3RB3A 3KHLA 3C15A 3K2YA 1WG1A 1SV5B 3UN5A 4ID5A 5D0HA 5GVQA 2AJ0A 3IR7B 2C2DA 4CDIA 2ASJA 4ZCKA 4CTAA 3DOLB 3E3XA 4AL5A 3CT9A 1UL3A 5IM0B 4ELTA 3DLGA 2ALZA 1CJTA 3SQGB 2GIRA 4TY8A 4J91A 2DNYA 3TAQA 5F0WA 5KFKA 1VQNS 3RB6A 1XNQF 1S0VA 2VPXB 3U7JA 2AJ4A 5JXSA 4MK7A 5BR8F 3KMSA 1YVFA 1A9NB 4GO7X 4IOAQ 1RAOA 1T03B 3OBIA 2FHOB 3HD1A 4W98A 3SI8A 1IR0A 3EGNA 4ELUA 1MG7A 3HT0A 3RU0A 3FJ2A 1HQ2A 2QX0A 4Q2MA 4B3OA 4HDHA 3W60A 2AP6A 2OPPA 1KLNA 2HHHF 1JJ4A 1Q8BA 2C3OA 4CI0B 3E2EA 4WE1B 2HW3A 1FRIA 3CDUA 1XNRF 2J76E 4DG1B 2ZZMA 2EFOA 2MGZB 4ICLA 3CMES 4O3RA 4Y65A 5HSPA 4IR9A 2XZDB 3CCSS 2KXNB 1V3RA 2IMWP 1VGYA 2RAQA 3QO9B 3RUBL 3WBZA 2KT5A 5I42A 2VBXA 4NE9C 1IKYA 2AV5A 1X5SA 2E5HA 5DG8A 3PW7A 1SQFA 4QR2A 1H2TZ 4JI2J 4H4OA 2X3DA 3DOMA 3BGFA 1TK5A 3DMJA 3X1LB 4KH1B 4BC7A 5D4OA 3A3NB 2ZH2A 1D9AA 3D3BJ 2L9WA 2HHVA 3EPGA 1K0TA 3VALA 3ET6A 2IMOA 1XTZA 4EFAC 3U1MA 1L3UA 1ACMB 4U8YA 4RR5A 5CA5A 5FD1A 2HIQA 5KFWA 2H5JB 1C4AA 4UQGA 4DR4J 2EKYA 4AL7A 1PBAA 2ZH3A 1FKOB 2NUHA 4DUYF 1H6KX 2YKMA 3UCZP 2QSWA 2DGWA 4USVA 2CQ3A 2PEHA 2QA4S 3R1HA 3BKFA 4LFCJ 5F9LA 4GKKJ 4EMDA 3Q8YA 4GKJF 2DIUA 2KFNA 1RT6A 3HXMA 1FNXH 4ECUA 2BM1A 3AJDA 3GJQB 2V2VA 3V2UC 2ZJQQ 1YJTA 2IA0A 3ZO7A 4URSA 4E2FB 2W24A 3CC7S 2WVCA 2MY8A 2DR9A 4B3TF 5SUHA 3KK2A 4Q44A 1U49A 1KKHA 4M5HA 3H5SA 1RK8A 2F9JA 2C3PA 2AJFE 3A13A 3SCJE 1GH8A 1SL2A 4IFYB 4LVNP 4OHXA 4EZ6A 3W2VB 3UDVA 1KDNA 4FPRA 4I69A 2ILYA 1S10A 4F02A 1K8AT 2VFTA 2F63A 1AROP 2XYGB 5F8LA 2Y0SD 1S4FA 2XS2A 4TLQA 2JX2A 2DO0A 3IBWA 3CJSA 1FKPA 4AXJA 4KH0B 2VPWB 2C42A 2XCPA 4IRDA 4OZ0A 3PR4A 3CC2S 3N79A 3HHEA 4LJMA 5KG3A 4LF7F 2IBKA 1U1QA 2AHOB 4P10A 1R0AB 3KJVA 4UUWA 5HL7Q 5EDWA 1PCAA 1SJQA 3D5MA 3PYFA 1PSDA 2KJWA 1UJ4A 2CQBA 4O44A 4DL2A 2OPSB 5DDRC 3KLIB 2DNNA 4ZVQB 2R7SA 2WBMA 1HI0P 3KTQA 4DR7J 4HL9A 5G4DA 4CWBA 1DFDA 4P2SA 1JLFA 3OFGA 3MM7A 1R0CB 1GEHA 3FBFA 5HANA 1U2CA 3LGMA 4V1Ak 5HBMB 1WD6A 3J7AN 2FJVA 1Z4UA 3GILA 4B9LA 1LV5A 1R3NA 4W92B 2D9OA 4KTQA 2D7SA 3BBFA 2AZ1A 3KG0A 4ECQA 5I3PA 2AKWB 2D1CA 1HNWJ 1FX2A 2M9KA 4IOBA 2RUGA 3NEKA 1WEXA 2HHTA 1S99A 2OTLS 1H2UX 4QIGA 2KZZA 2HFUA 5DJBA 2DTJA 1YLXA 3I4HX 1W26A 3WIUA 4P74A 4JP8A 4A8MP 2GVDB 2KXHA 4O0IA 4FBUA 4O3PA 1LK7A 2EC2A 2R8HA 4IRKA 3EMTA 2G13A 4B9SA 2DNZA 1U6ZA 4L72B 2IAJB 1KONA 2QA2A 1G7CB 1MROA 1U45A 2JJ4D 5KFXA 4W90B 2J0SD 5HROA 3DLLQ 1OJ4A 4DXLA 1L3TA 2HKEA 4DV7J 3UWTA 1T95A 3CE8A 3EGVA 3OLAA 1JXLA 2RMLA 1KFSA 2E7VA 3PJXA 3T1HJ 4FDFA 4DV6F 1OYDA 5CYMB 2DNKA 1SV5A 3NOCA 1I3OB 2JC0A 2PFDA 2DCLA 5IQ6A 1WHXA 1VBKA 2K1RB 4HR2A 2GIQA 4L75A 3PXGa 5EUHA 3NS5A 2WSFC 1S79A 4FXVA 4YB5A 3GIKA 2V6AA 3DOLA 4CO3A 2VBWA 1U6BA 2PMZD 3EZ5A 2L9NA 2AX0A 5IM0A 1KVIA 4KPCA 2CDQA 3SQGA 4NEYA 4NOHA 5F3ZA 3ENAA 4LFAJ 3DOKB 2A6MA 1IBMJ 3R8YA 3EX7B 3N5BA 2B8PA 2OUGA 1GX5A 2AD9A 5D4LA 5KFVA 4M5KA 4DUTA 3RRGA 1VRTB 2DGOA 4AE5A 3J7A1 2YX1A 4ZOSA 5KFPA 1F2HA 3W63A 2Q66A 1S76D 3SSQA 1T03A 2IYIA 2KTQA 2EPIA 2YKQA 2AGOA 2YKPA 3BGUA 3CJ3A 1NPKA 5K14B 2UXBJ 3M4XA 1IWGA 3T3FA 2NS1B 2ROGA 3TZXA 3MPVA 4NWBA 3CVKA 2XO6A 1RT3B 4IH6A 2MY7A 3R7BB 1E6VB 4DEZA 2B43A 4WE1A 3FK4A 2G9OA 4PXEA 4B3RJ 2MGZA 1X4FA 2JFDA 1JXVA 2ZZTA 2CXEA 1KQSR 6AT1B 5LMNF 2HQCA 2DGXA 3QWUA 3HM9A 4AYBD 4PYDA 4RNHA 3GCXP 3CIMA 1RWUA 3QO9A 4ECRA 3IRXB 2ZITA 2RIJA 3GYXB 4DSIA 2MMYA 1DTQB 5KFSA 4I68A 2A10A 3W3SA 3PNIA 4FYXB 3W8GA 1GMWA 2HZAA 4HT7A 5E3RA 4A48A 2PN6A 2FVPA 4JI3J 4URGA 3QNWB 2FLLA 4Q45A 3DLKB 2C2KB 5KFCA 3PACA 1NSAA 5KG1A 4FNHA 4OV1A 1WC5A 5LSLA 2IRXA 4ED8A 4N5SA 1C0UB 1FDDA 3K59A 3GMGA 8AT1B 1Y9OA 5KT5A 4Y00A 4PQUB 2QLWA 3D9BA 4OLPA 3I87A 3M05A 2KXFA 2MPUA 2YQ0A 3FGVA 4FKYA 5CXTA 4FS1A 4CQ1A 1FDNA 4GC6A 4X64J 2HYIB 3D4JA 2FVQA 2MQQA 5L9NA 4JI7J 4LMZA 1Q78A 1FKOA 4JI8J 2BXJA 3AOAA 5M2RA 4DUZJ 3HJFA 1W2BR 4ZP8A 4DI6A 5D8HB 1TKXB 4OHYA 4J9KA 2KHDA 2VDHA 4TU7A 3BJYA 2MSTA 2VC1A 1FFGB 3DRRB 2AF6A 1V3ZA 1UJ6A 2F9DA 3A8EA 2K7JA 4JYAF 2IBOA 3FCHA 3NWGA 1SJ3P 4IDKB 1YJUA 1EX8A 2VG5B 3QGHA 2JL9A 4PWDB 2HHSA 1ROFA 3MR7A 1YZ7A 4O3NA 4IFYA 1JLAB 3G71S 2ZNYA 3W2VA 1HHQA 3VAGA 2OP5A 2G2YA 2PO4A 3VGSA 2Y1LB 5C7PA 5HMYA 1VBYA 2AJ1A 5LOQA 1RCXB 4ANCA 3EWGA 1MLAA 4FVCA 3CWJA 5J2QB 3NAIA 2J7WA 2PFFB 3R3TA 2JC1A 2MKSA 4CNZA 2UVWA 2Y9HA 3MAHA 3T5LA 3AB4B 4HI1A 4LBPA 1R0AA 4ZPTR 3KNGA 5FLXY 2VFRA 4J90A 3MMBB 3S7RA 1YRTA 3TOQA 4G1QB 4B9MA 3DC2A 1SH2A 1C4CA 2XS7A 3GCWP 1FJCA 2OPSA 5DETA 3C6TB 3PFEA 3KLIA 2P8IA 3PVXA 2FJBB 2E5GA 2GNKA 3VCDA 1S6PB 4YR0A 1AFJA 3MEGB 4DR1J 2W2QP 3CJ2A 1QUVA 3NCQA 1PO6A 3SMZA 4DQPA 3G4SS 1CBKA 5CQGA 1GXTA 1KC8T 3CW2C 5HBMA 2XSFA 4WP9A 4OI1A 4EI2A 1X5OA 1S49A 4USJC 3NWRA 3KLEB 2LP4A 2ASLA 4TU8A 2HHXA 4J5OA 5IT9Y 2MDAA 2V8VA 4CH0S 1MN9A 1BQXA 3U02A 1U48A 3POTB 2LDYA 2E66A 1TL7B 5B0AA 2GHPA 5G0RB 3EM1A 3SCKE 2RQ4A 1SC3B 3FUYA 2BOAA 3DCAA 1FJGF 1KBRA 1T9YA 4OZ1A 1URNA 4L3KA 1ZOTA 2VQEJ 2HPUA 2GVDA 2YY3A 2VQFF 4YB1P 4UOCA 1S6OA 2HQDA 2BQRA 4F0KA 4NZ6A 4IUFA 2IAJA 1MMNA 2ZUGA 2AWZA 3JAMY 5AXNA 1I1GA 1NNDA 2H5IB 4ZVFA 4N8NA 3ZTPA 4D3HA 1SKWA 5HATA 4FXDA 3AH6A 3KDNA 2VJVA 2CVIA 1LK5A 2G0CA 4EK2A 4KGXB 1RHKB 1LW2B 3DLBA 3BKTA 1U1PA 1N52B 1PAEX 5CYMA 4C8KA 5T7LB 3QAEA 2VODA 3HO1A 3BB5A 1N34F 2ILZA 4ZPVR 3LOUA 3R7NB 1R8HA 3Q2TC 4PWUA 2H3EB 2QTWA 4NASA 1GMUA 1RZMA 2QLFB 2Y8YA 4ZCIA 2PGCA 4B02A 1OPZA 5DLFA 2OPRB 3DOKA 1X4AA 2RHSB 5KG4A 3KUHA 3BYPA 4JUZA 4RW8B 2IVFB 4JI1J 2CJAA 4DQIA 3V6HA 2ZJPQ 2RRAA 1Z2ZA 1V3SA 2B4PA 1VRTA 2ZH4A 2Q43A 1U0SA 5IWAF 4USHA 3UN2A 3SFUA 2JLFA 2JWNA 4EBEA 4J9VA 4FS2A 4KYZA 3SFGA 2UUAJ 4DPXA 2R7OA 3CIZA 3MR3A 1K1QA 1F5BA 4J9PA 3VAIA 3R5GA 2DITA 5K14A 3KJQB 3OQ2A 4CLZA 4LF8F 1PBUA 3UNYA 6FDRA 4ED5A 1YX2A 3IGVA 1WTFA 2RD5C 4ECYA 4X4QA 4Q7AA 1KTQA 1UVKA 1RT3A 1Q5VA 1S0NA 5C24B 4E8UA 2CZVC 4QPXA 4LRBA 1E6VA 1REVB 1RHUB 3AD8C 1HD0A 2JHEA 1GFWB 2ADBA 1SH0A 5AE2A 1O8BA 3OSNA 5HI7A 1NK7A 1MNEA 4FBTA 1U2RA 2LCWA 3BGRB 1Q5YA 4ZS6A 4DPUA 2OJ3A 2PT0A 2MKCA 3RG6A 2XI2A 2HEKA 1RT1B 2JZ5A 2UV8G 3IRXA 1PG5B 1S9GB 2IYGA 2DRDA 2P6SA 5FLXU 3C16B 1DTQA 3J80U 2V2KA 4OI0A 2FHJD 4K4XA 4CLLA 4DU8A 3TW0A 3OXFA 4B9VA 2WONB 1IJFB 1D0EA 3DLKA 2ROPA 2ZBQA 1VQMS 1H73A 4DS4A 5HP1B 4USMA 4QR1A 2FIUA 3IM8A 1FJEB 3MEDB 5H9FJ 3Q23A 1C0UA 1OPIA 1G6BA 5GAHI 4F2SA 1X31C 4NCAA 2XMJA 3NL0A 2KO1A 4PQUA 5F8NA 2QL7B 1MWYA 1N8RT 1HA1A 3N28A 1VQOS 1RGVA 3GV5B 4WK3A 5BJRA 4QWAA 2BUNA 5DGBA 2F1FA 2MJNA 4RBVA 1FRLA 3CJ4A 3PRDA 3CD6S 1JLGB 1AT1B 4JV5F 3JB9k 2BANA 4PG5A 3SSSA 4LIRA 3DXBA 4LT6A 1HD1A 1TKXA 2VV5A 1YJWS 5GADI 3MOZA 3DRRA 2ZBIA 4ILRA 3JTOA 5GADU 1RLDA 1AUDA 3JXOA 3T9ZA 1VQSA 4RWXA 3VHQA 4IFVB 4XDDA 4C9DA 4IDKA 3ZTSA 2VG5A 4PWDA 3OR2B 3MCNA 1WDTA 2XTJP 2BMBA 5GAEI 1BQNB 1JLAA 4DL6A 4X65F 1K44A 1A6LA 3IMQJ 2XO7A 2FVCA 2HBRB 2RHQB 3TYTA 3V81B 4ECWA 1N33F 4YOEA 2ZH8A 1UWBB 1N36J 2W9BB 3CGIA 1NJYA 3MMCB 1RWXB 5CD4H 3BQ1A 5J2QA 4DX5A 1F5CA 3A8KA 1HMVB 2ADCA 2XULA 2OD4A 5DDOC 4NLPA 3UNGC 1BHNA 5LMUF 2I0XA 3OJSA 2EC0A 1RT5B 3QYYA 2IC3B 1IJEB 4DWIA 3MMBA 2M7SA 4NLTA 5LJ5Y 3KG1A 4F50A 4G1QA 3BF4A 2YWKA 2UUTA 9RUBA 3FC9A 1HNZJ 1NZAA 3I31A 3M8ZA 2CQ4A 3C6TA 4ZPDA 3EDQB 2I6WA 4NXNJ 4WZQA 1S6PA 3J7Z5 3MEGA 1R43A 4IOCQ 1HBUB 1E6YB 1I94F 2L08A 4RNNA 4DBQA 3H90A 3NLCA 1HWJA 3M1VB 4WXWA 2BKNA 3T41A 1FJ7A 1B99A 3M9NB 1RADB 2E1AA 3KLEA 3SEOA 1QD1A 2LEAA 4F0MA 1FD8A 4KC5A 3RYLA 2BJDA 2DGQA 1N0VC 4GVBB 1X0PA 3C66A 3POTA 2QYGA 1TL7A 4DPYA 3TWZA 5G0RA 1RAJA 2HK2A 1HNIB 3LAKA 3PRVA 4WYLA 2Z0GA 4RX6A 3UDCA 3JYTB 2MTLA 2Q6BA 2ZOGA 2J8AA 3IAS9 5AXKA 2ZWPA 3BO2A 1YJRA 2HBQB 4MIWA 1WTBA 2FZCB 2V67A 4HYKA 1YJ7A 5GMEA 2QE5A 2C2NA 1R31A 2XMAA 2DGVA 1RDRA 3BGOP 3QT5A 1TQLA 2ZOMA 3SIPB 3QRRA 4LUBA 1Q7YT 1VQ6S 1U24A 3L09A 2EFNA 2RVJA 1U6FA 1X5TA 3HHLB 1ZYQA 1A7GE 2MQOA 2M2BA 4TN2A 4QWEA 1OY8A 4FF4A 2V0NA 2NSBA 1LW2A 2AYEA 3THVA 3GLJA 5T7LA 4USTA 2XM3A 5F8MA 1X4EA 3KHHA 3Q24A 2LFVA 1WHYA 2A18A 1OSDA 5LSRA 5HO4A 4C97A 3CB4A 5B08A 4OYAA 3MF5A 2KDOA 5IC6B 1YBTA 2Z2LA 3HMJG 2OIHA 1WC6A 4QIEA 1ZAXA 1R6VA 2BJ1A 2V8DA 4DV3F 1TMMA 2OPRA 1GTHA 2GX8A 3PHTA 2B6AB 5D0EA 5THWA 4RW8A 2CDRB 1NKCA 1UMJA 1WWHA 1TKZB 3G6XA 1YG0A 2UUBF 4LFBJ 4FF3A 1DQAA 2F7VA 2ZBCA 5CAAA 1T9XA 5F0UA 2HNYB 1HI1A 3MGJA 4U6PA 1WNEA 4CLUA 3PKMA 4QYZK 1VK3A 1L3KA 2EEYA 2CQDA 2OH2A 2PI4A 5ETNA 4WFNQ 1TL5A 1F1BB 3QZ7A 1T02A 1MN7A 3N9UC 5ADZA 3IS9B 4B3MF 1KQGB 1NDLA 2XS5A 5C24A 2BE9B 2L9DA 3DNCA 1REVA 1N48A 3PRBA 1HBOB 3OR1B 2DIVA 2MLXA 3JTNA 2DGSA 2NQPA 3N5FA 3BGRA 3L4BC 4OYPA 4QW9A 2CG4A 2YVSA 4P7VA 4OJ3A 3DRSB 4J9RA 1RT1A 3GP9A 1GX6A 3QGGA 1S9GA 3C16A 1S97A 1D09B 2HVEA 1R8AA 2HGMA 1HR0J 4OIXA 4CT9A 1YGYA 4WU3A 4URQU 4X2BA 2HFOA 2JFKA 4RUAA 1NK4A 4ED2A 1XMQF 2IIHA 2WONA 3PV8A 3PO5A 1RABB 2DHHA 4WK1A 1VBXA 5IS2A 1RHQB 4FPIA 4DV5J 2BW7A 5HP1A 1FTRA 5E3QA 3M9MB 5E7OB 2BYCA 4AT1B 3TARA 3MEDA 1MWQA 1UZHA 4OZNA 1WI6A 4R8UB 2O3DA 4ZITA 2YQ3A 4DR2J 4ETXA 4O4RA 2ATLA 4KGMA 3KOAA 3JQJA 2XY7A 2XMKA 2A6OA 3RBZA 3F41A 4DV4J 4ECSA 2ZUAA 1X60A 3IR6B 3SCIE 4C8OA 5KOWA 3Q8VA 4I0WA 2IA6A 4OX9J 4RNOA 5D0GA 4UUXA 2IHR1 4NYOA 2I2YA 2RQMA 2J9DA 1UFWA 3IA0A 4GMKA 3LA0A 3Q2SC 3D66A 1JLGA 1R0BG 4DR5F 2H4YB 3TQ1A 4WTYA 1EB0A 2MSSA 3WZ0A 3O3LA 4ANEA 4OFZA 1F6TA 2FHMA 4X4SA 4CO4A 2QZ8A 5CHCB 4JI4F 1RWKB 4ED6A 4TLRA 4LR8A 4IFVA 2HAFA 3QT8A 2LEBA 4C3KA 4M5LA 3FNNA 4NZ7A 2ZWOA 4J7CA 3C14B 2FC8A 3OR2A 3TX0A 3FFIB 3N6LA 4DR3J 5JVHQ 2BE2B 4MJKA 2CRLA 2V50A 1CC7A 3IWNC 2B4UA 1RUSA 4ZN3A 3TZZA 2NPIA 2DVIA 1O0PA 4AFFA 4B9UA 1RTHB 2R8KA 1U26A 1PYTA 2D3O1 4NLSA 4F4YA 1UWBA 2B9EA 3HX9A 2D74B 1FE0A 2GHWA 2DRAA 2MZJA 2W9BA 3MMCA 1FO1A 4CLKA 2NXEA 3W64A 2MXYA 1Q86T 1X9WA 3BEGB 4Y0FA 3T6BA 3TUZC 3AD7C 1RT5A 4K7QA 2M70A 2CQCA 3JSBA 5KFMA 2IC3A 4C7QA 2BZ2A 3QFHA 1PYSB 2V4JA 1J2VA 2NXNA 2D3ZA 3PX6A 1RAEB 1PJ6A 3SZ2A 3H59A 2WTFA 3I6PA 2HAIA 4QIVA 5BYRA 2XI3A 2DXFA 4DZ6A 3J7YI 3HZGA 1KS2A 3MPDA 5IV3A 1Q8KA 2DKOB 4NEZA 3CCMS 2FVRA 1HBUA 1E6YA 1BXNA 4KGKA 1FKAF 2SXLA 2HHWA 3Q22A 1A0OB 3OXLA 4WP8A 3WC2A 3M1VA 2EG2A 3NS6A 1CULB 3MMAB 5KG6A 5KFTA 4NYPA 1S6QB 4JI5F 1PJ7A 1HNXJ 4RW4B 1U1NA 2NUUG 5HJXA 2DNGA 4KE5A 4RPFA 3A3PB 4GVBA 5FIIA 1P27B 2CQ1A 4C6AA 3DGVA 1RTIB 4A4JA 1HNIA 5K8NA 3PW4A 3RR7A 2FPHX 1SUQB 4MYTA 2KL8A 3JYTA 4PKDB 4KAIA 1D9DA 2HQIA 2CA9A 1WJ9A 1Y5LB 1N4LA 1JXEA 1QTMA 1JWWA 4AD6A 2RH3A 6FD1A 3OXGA 1T05B 3RAMA 1X4BA 1HWKA 4OI3A 5HAOA 1CLFA 2DHSA 1VQYA 3FBCA 4LF6J 2V63A 4RU9A 2YNGB 4QW8A 2AT1B 2HLUA 3GG1A 3BR8A 4TNOA 5DS7A 1NDCA 2FQQB 1R8CA 3OW2R 4AXIA 1FK9B 3HHLA 5IC4B 2WVBA 5EHHA 2R2SA 4I7FB 4B9TA 4Q43A 2CZ9A 4ZLLA 3MFHA 1GMVA 4RW9A 5CYQB 3FRYA 3E8OA 1JQGA 1WEZA 1NMEB 2BQ3A 3LP0B 2FHJA 2OI2A 1WOSA 3D0GE 3KXDA 2HHUA 1JLBA 3HI9A 3D6FB 1WKJA 4OYWA 3LANA 4DQQA 3M6WA 2OEMA 3CD5A 3K0JA 3MOJB 1XEZA 1ICEB 4AL6A 5AJ3F 2UP1A 2B6AA 2IJFA 3TZWA 4PR6A 1TKZA 2ZH7A 4LREA 4LF4J 2R2TA 3D6TB 4DQSA 4NYZA 4C3MA 3I9ZA 1RJJA 2HNYA 2LECA 3NGUA 1RAGB 2WVFA 2CWXA 1VRQC 5DGAA 3S01A 2ZHAA 1I51B 4CLTA 1FWPA 5HQLA 4ZVUB 2GW8A 3JSYA 3BN4A 1WF0A 1ZZNA 3CTRA 1G1XA 1FFWB 3IS9A 4BWMA 3AA9A 2GFFA 5L1LA 3DHXA 2UXCF 1WEYA 3EZUA 1HBOA 3OR1A 1VQLS 5DLGA 2LXFA 5KFIA 1IBLF 4DMZA 4RW7B 2XZTB 3S1TA 4RUBA 2RDJA 2DEIA 2EVZA 1EKSA 2GMLA 4ES1A 5B09A 4Y34A 3PR5B 3Q86A 4WWSA 3DRSA 1C1BB 4HHJA 4DPWA 5GAGI 3T6JA 1XC9A 1FFSB 1RAIB 3KWMA 2KVIA 4CLFA 5IQQA 4MTPA 1HL6A 3C6UB 4B3SF 4PRFA 2R7RA 2GQQA 1XERA 3Q83A 4UZCA 5EX0A 4DOZA 2CJBA 3UVJA 2LLZA 3L3CA 2VKRA 4YY3F 5L38A 1G3OA 3VTIA 3OTOF 4BHQA 1SC6A 3D28A 4DSJA 1YZ6A 4RNMA 2E1RA 3NMRA 4HACB 4OHZA 1K73T 1UEUA 3THTA 2FY8A 1S9FA 4R8UA 3PW5A 4P52A 2MQ8A 3EUNA 3V4MA 3Q8SB 2A3JA 3TANA 4Y28C 3I32A 2MQLA 1J27A 2RJZA 2PD1A 2RF2B 4X4RA 4UY85 1JB0C 2X1AA 3KDOA 4OYOA 2JRSA 1BWVA 1UA0A 3P6YC 2OELA 1WOPA 5J2NB 1GTEA 3VQTA 3AQOA 4I2QB 1KHWA 1C1CB 2CQ0A 4ID8A 2XSJB 3OSPA 3ILOA 3O44A 1Z2LA 3I5BA 3GTYX 1NKEA 3T19A 4HEA9 1AXQA 2CADA 5EN1A 3EXCX 3N6MA 4M5NA 2RT3A 1SJRA 4K4UA 3ZZUA 1S0OA 4ZPAA 4ZPWR 3NXZA 1SVDA 2CWKA 1HIYA 2J7UA 1FX4A 3DFEA 1RQ0A 1XIQA 3W9IA 3G6YA 3C14A 1HQUB 2P9CA 3FFIA 2BE2A 4NMLA 2EI5A 2FC9A 2GAHC 2O5DA 3BO4A 3NNHA 2V94A 1TZ0A 1B0TA 1F5AA 2Q1LA 2GIFA 4LSNB 2ABYA 1JLEA 1YRUA 2D3UA 2ZH1A 2R7TA 5KFEA 2UUCJ 3RJMB 5ETKA 3FRZA 1FXLA 4CO5A 4N56A 4U8VA 4QYRA 4ECVA 2HFSA 5KT4A 1S0MA 1RSCA 5L39A 1LWXA 3OPKA 3PIPQ 1IWAA 3LWLA 2XNRA 3W5XA 3HF5A 2IM2A 1EJ7L 2QIFA 2MHNA 2QC3A 4H4KA 4OYMA 5A6PA 1T11A 3CJ5A 2DXEA 3SBMA 3MM5A 2FZKB 3KLFB 3EZOA 2DR5A 2F4FA 2LMIA 3VF0B 4J9QA 3TA1A 5JJBA 3MM8B 3M9OB 2NPFA 1XNQJ 3F56A 1QM9A 4RZRA 3MAAB 1CULA 2R2UA 2W9AA 3MMAA 5BR8J 4DX7A 1S6QA 4M95A 4K4VA 5E3PA 2B9WA 5HVHA 4KY3A 5B0GA 2YNHB 4RW4A 4BS2A 1OY9A 2LA6A 3U1LA 1H7WA 2OMOA 4Y6IA 3G6VA 1ZETA 4X4TA 1NLKL 1CS4B 1RTIA 5IZHA 1C0TB 3W8PA 2HG4A 5L1IA 1SUQA 2HHHJ 3PX4A 2KM8C 2R8GA 5HMZA 2RU9A 1XNRJ 3MI7X 4NA1A 4J9MA 1M5OC 1VISA 4PYAA 3DM2B 4JI0F 1T05A 3LWMA 1HBNB 4M5MA 1PYOB 1Y3JA 1OSCA 5I3UB 2HRTA 2YNGA 5L9XA 1EETB 5A0YB 3FCWA 4O3OA 1WDDA 3M2RB 2ACMA 3R6LB 2NR0A 1U1RA 4CLPA 1FK9A 4KIAA 4I7FA 1FRJA 5LL6d 3PW0A 2QJ3A 4N7TA 4NMXA 5KT7A 3FMWA 5CYQA 1T9WA 1UFLA 3CD0A 1CEZA 3RB4A 4WFYA 3LP0A 4YMEA 4N8OA 1VIOA 1C2PA 1H7XA 3RTVA 2BW2A 1CSJA 4CM2A 4WKRA 2V34A 1SIZA 2CFXA 2C2MB 4CM0A 4LF9F 3AD9C 1CPZA 2MB0B 1U1KA 3BV8A 1N5QA 2XGQA 4PEOA 4DUYJ 2W4CA 4YB7A 4A8OA 3M6VA 4ED1A 4WPAA 3QSIA 1GT8A 4XO0A 2QO3A 3DGPA 3SQOP 4LF2A 2G2ZA 1BLUA 3LALA 2V8GA 5HVFA 4GKJJ 2KKHA 5L1KA 4DL5A 1IVZA 2JH3A 2L41A 3FBEA 3AJ2A 2HHPA 4UOGA 4KV8A 1KVKA 1RTDB 2OHDA 4QQBA 2Y1JA 3FCVA 4ATNA 1VI7A 1OQ3A 3UCUP 4B3TJ 2VUGA 2YWFA 3HVAA 5KG0A 4DX8H 1U1OA 2CJXB 3DRXA 3MEEB 3LAMA 5FJ4A 2G0JA 2EXUA 4E98A 1SB6A 1SJ1A 1L5UA 4O4GB 1VQ8S 4RW7A 2YTCA 5J1NA 3HFZB 2ZNZA 2A0FB 3AOCA 2YKOA 3MZIA 5A76A 1NU4A 4MMOA 2HVHA 4PABA 5KG5A 1YJNS 1C1BA 2M5YA 3LQVA 3LUYA 4YUDA 2E1PA 4ZMMA 3H5XA 1X9MA 3C6UA 4PG6A 2ASDA 1I5OB 4J37A 1QAIA 4LF7J 2J0QD 3GFZA 4JOUA 1F3VA 2UU9J 4M63A 4IG3B 1S4EA 4OJGA 4R0EA 3QJPA 1PC5A 4DN9A 4HACA 4F4AA 2CPFA 3MPWA 4H54A 3RBXA 1T9VA 1YSJA 2RKIB 3NRBA 1TV6B 4DPTA 4FN5A 5KTQA 4KSEB 1DHMA 4C2MA 4MYUA 3GYGA 2RF2A 4QJVA 4WKYA 4I56A 4ZVGA 2C2ZB 3WX4A 1DRZA 1LNQA 3I0RB 3BZQA 5ETPA 1ZH5A 5J2NA 1VS3A 1T7PA 4I2QA 1C1CA 1HNVB 1RYSA 4TKTA 2ZDPA 4A8WA 2XSJA 2ZDOA 4NCGB 3NMAA 4OYZA 3TO8A 2JEGA 4DX6A 2BKPA 1FA0A 4NI2A 4JI6F 4OJ1A 3EDRB 2K2PA 2C3MA 3GSDA 2M0GB 3HSGA 2E44A 2IDEA 1NJXA 4PZVA 4H4MB 3GIMA 4DCJB 1SBRA 3FQKA 4ZP6A 3EVOA 2DYAA 5D3GB 2DY1A 1CQNA 1FE4A 3TUJC 5L1JA 2DD8S 2DH7A 3AXMA 4I6YA 1U02A 4QOTA 4LSNA 4RWWA 5D6GA 3EVMA 2VHGA 4ZJLA 4OZ5A 3KUGA 5DZ7A 5L8RC 3VGTA 3NNCA 4J9UE 4F26A 2ZC4A 1JNRB 4ZVHA 5HK4A 2GO8A 3IO1A 2N7CA 3C46A 4RBUA 2VFVA 2LYVA 4DV6J 5JUMA 1FHTA 3WDOA 2E5LF 2H48B 4A8FA 2W8LA 1VQKS 5E3CA 3PEJA 3FEYB 2DNOA 3L7PA 3TVKA 5A8WB 2D3OR 2DGUA 5AE1A 3OVAA 3ILIA 4GO5X 1S7IA 4OHWA 3G86A 1P6TA 4F67A 1W2IA 5LSOA 3TJ9A 2OTJS 4IG0B 4ZA1A 1RISA 3DXSX 2RQCA 4KHPF 2J5AA 3DU6A 3KLFA 1VQ7S 4DV0F 3NKYA 1H2VZ 3K58A 3A8JA 1HYSA 2VOPA 3AY0A 4NXMF 4K4TA 2M52A 1Q0NA 1UAWA 3MAAA 2ZD1B 2NXUA 4UQTA 2IRYA 4OHVA 3DU5A 2VB6A 2NYHA 1TP7A 1VMBA 2QLJB 4I67A 1NJZA 4FP9A 5ETMA 1Q81T 1M5VC 1WOOA 1UKUA 2YNHA 3ZTOA 2MKJA 4HTJA 3FDSA 5IT0A 1AZSB 1C0TA 2JVOA 1RU2A 1SKRA 1TL1B 1NK9A 2Z2MA 4HT5A 3BBBA 3KLHB 2BJ9A 4OZJA 2I9SA 4PUOA 1O6XA 3PO4A 4BBYA 5K8OA 4UF4A 3O8WA 3DM2A 2QN6B 5A8KB 1HBNA 5LMNJ 3OTBA 3KHGA 3E51A 2RE1A 2WOMB 5I3UA 2MZTA 1RWOB 1EETA 5A0YA 3L7OA 2RUSA 1FVQA 1BMQB 1UWAA 3M2RA 1KEKA 2MKYA 2HS3A 1KRPA 2JEIA 2GV1A 4NLOA 3AAWB 5GMDA 1AFIA 1FXRA 4FZVA 5H1SV 2JOQA 2CJKA 2RQKA 4TVAB 4YDXA 3H42A 3T5HA 3NCRA 1S1TB 2WHOA 1U8SA 4K0KF 1VQ4S 1NB2A 2BOPA 1FWLA 1VC5A 3HVTB 1GAOA 4P75A 3UW1A 4DL7A 2VBYA 2H5EA 3Q0AA 4HI2A 4ITSA 5AT1B 1R89A 1BE4A 3TUPA 4YN3B 1JJ2R 4WTOB 1XMOJ 3CF5Q 2DHAA 2ZM6F 1KP6A 1PILA 1S59A 2KRBA 1ZAWA 1ITPA 3DLEB 1NJIT 1S1UB 1OY6A 4CT8A 3D7SB 5CZVA 2RB7A 3GFYA 4PG7A 4EYIB 5K9FA 3TR5A 2W1BA 1LW0B 2B4OA 3QATA 4NZ0A 4X62F 1WF1A 2PDAA 3AJ1A 5IV4A 1D8ZA 5MLCV 1RTDA 2R2RA 4OLOA 4CH1A 3K7RA 4TYBA 2VFSA 1FRMA 4TQSA 4F3OA 4UTGA 3GE9A 1U7LA 3H40A 4JYAJ 1DTTB 1FDAA 2EFVA 2M4MA 2CPHA 3GJTB 2RU3A 2V4QA 4PPDA 3D0IE 1YK9A 4NRTA 2E5JA 4F3QA 3MEEA 1SJ4P 2BJ3A 1N54B 2ZH9A 4QBUA 4A47A 3L7UA 2E9RX 3IWLA 2DNMA 5DQIA 3BH7B 1Y3KA 3LPYA 3P5BP 2J7KA 4CH7A 1OYEA 3W65A 2P9GA 2KYZA 4DG1A 3FZBA 2W7PA 4DV1F 1SPBP 2FJDB 3ZC4A 1RA6A 2QT7A 3J81j 1GNKA 4IG3A 5EWGA 3CJTA 2KYXA 4DU7A 4CO1A 1PGZA 1HHSA 4X66F 1Y0HA 2G4BA 2UUWA 2RKIA 2K06A 1UPPA 2R9LA 4LQ3A 4ZIVA 3BDPA 1MW7A 5LT5A 3I0RA 2EFPA 4IR1A 4Z7CA 2ATCB 2BBEA 5ETRA 3QPIA 4IRCA 1S1WB 1ZTTA 4Y2AA 1HNVA 3K8WA 1RTJB 4NCGA 1TAQA 3CCLS 1APSA 2CUYA 3TEHB 4A8YA 2HVIA 3EGWB 4OL8A 3R5JB 2UXDF 1K9MT 2PMWA 4YB6A 3B54A 2LQ8A 3K5NA 4K2JA 3C3LA 1UW9A 2YH1A 4IYQA 3TQEA 2G1HA 4WJBA 2RSQA 1RWMB 4O0NA 4H4MA 1RAHB 3MTJA 4DR6F 1Y00A 1EHWA 2XMMA 4I6AA 3NG8A 5D3GA 1SI9A 2VQFJ 3M8PB 2BABA 2AZ3A 3MCOA 5A6WA 2DH8A 3GR1A 1UEKA 4KHMA 3LP1B 3M8YA 3IR5B 1QVGR 3GJRB 4DV2F 1JMTA 2XNQA 2Q79A 3GFHA 2NLWA 2KI2A 3UE2A 2RS2A 4F36A 1S48A 3EICA 1M5SA 3BO3A 4ZPBA 4DJBA 3Q8PB 3KJNB 4WIIA 1NH8A 2XEXA 5F8HA 3N6NA 2GQCA 2V2QA 2FLNA 3VVUA 5M2UA 2IM0A 1N34J 2VZ9A 4OJHA 4NL5A 1QUPA 2HWIA 5A8WA 1CC8A 5HMXA 4DPOA 3MAQA 3V6DB 2MEWA 2FJEB 1LQ9A 2MZSA 5AE3A 3MMJA 3UDLA 3O1LA 2BRKA 4JV2A 1WHWA 3TVYA 4YR3A 3K5MA 4IG0A 4I6WA 1KQKA 1S7HA 2CQ2A 3DLJA 2XY5A 3SCLE 4LVOP 1VDHA 3NCPA 1JJCB 2MLZA 1XK8A 4EZ9A 3HHLC 4R25A 3J80Y 3RR8A 3JS9A 4QZVB 3SDEB 2ZD1A 2J8SA 1FEHA 2CJQA 4U7UK 5BYQA 2EW9A 2K8GA 4O44B 4O23A 2GVZB 1T94A 2FTRA 4JBCA 2V9WA 3LW5C 3TAMB 4L6V3 1Q7LB 2AU0A 2GCFA 3H0PA 3PY8A 2GO9A 1WG5A 3CDEA 2VF3A 3UD3P 3IAM9 1HPZB 2XC9A 4LF8J 2CNLB 2FUG9 1AZSA 2AYMA 1IBKF 3I0SB 1GQEA 2CIMA 5LXRA 4I64A 1TL1A 3DHWC 4HVZA 3MUMP 4KJIA 3KLHA 3KMQA 4C98A 3ETOA 5DDPC 4ZJQA 1Y4ZB 2VDIA 3ZZPA 2A1BA 5DQGA 2C3YA 2HZVA 5A8KA 1LXNA 3VAHA 3DI6B 3T1YF 4LIWA 3DDIA 2WOMA 3R97A 2ACYA 2YWGA 1NRKA 4PQAA 1X8DA 2ERRA 3CCTA 2HK3A 3RW7A 1FXDA 4CP5A 2XLKA 3P49B 2YNFB 3HSZA 2I5JB 1FF2A 1XJWB 2P6TA 1P1LA 3O5TB 3FBBA 2CZ4A 5HN0A 2CYYA 2VONA 3KKFA 3R9LA 1RWNB 4WCEQ 3SYZA 2FY1A 4G65A 3PEHA 3X3UA 5ETTA 4LQ9A 1WKLA 1F9EB 4YDDB 1Q79A 1YQHA 4MK9A 1YBUA 1S1TA 4NLUA 1N32F 3HVTA 4KB7A 2E7WA 5C25B 3AT1B 2Q6CA 2YWEA 3GB0A 3CCQS 5ETSA 4CNYA 2PA8D 3D68A 1DBDA 2AJ2A 2ROEA 5K8MA 4F0HA 3GQCA 4OQJA 1JIHA 2F40A 1QSYA 1X7VA 3DDKA 3A4TA 1KSPA 1T9UA 4Q8EA 3DLEA 2K1RA 4L74A 1XN9A 1S1UA 1RHJB 1B70B 3CDWA 1X4HA 1U0HB 3IN5A 2FJXA 2F4VF 3QBCA 2BEFA 1QSSA 2OSQA 1FT8A 5KFZA 3HDSA 1S72S 1LW0A 1IXKA 2HBYB 4JV5J 1NUEA 1H38A 4NPOA 1ZPWX 2BX6A 1PAUB 4LRDA 4N76A 4DSEA 2FZGB 2POKA 3IM9A 2MKHA 3MCMA 2F65A 1TUWA 1DZ5A 1S1VB 1DTTA 2W8KA 4FYVB 4C8NA 3FSYA 3PJ9A 2O1PA 2YKAA 1ULRA 1VLOA 1RXOB 1N5TA 5HQMA 2XHWA 4J9SA 2YWHA 2OSRA 2UVVA 2HGNA 2NREA 4X65J 1UCNA 1NHUA 1LWEB 4K4SA 4PG4A 2JDJA 3I82A 2EG1A 3WX8A 3M2UB 1ZM4A 4U7CA 5DQHA 3G8QA 1D3WA 3OL6A 2APOA 2GAGC 1N33J 4TXSA 3OVBA 5B0CA 5LXYA 4AQYF 4LF5J 3IRWP 3QT7A 5KFOA 1U47A 4HHHA 1D1UA 2B7CB 4K8RA 3GSIA 4U7UD 4QCLA 1Y11A 3FQLA 1OS5A 3BR9A 5DZ6A 5LMUJ 4HKQA 3BS9A 1MWZA 5K5MA 2VKZG 2VL1A 4YHHF 3SV3A 3Q8QB 1JLCB 1RWPB 3SSRA 5C5JA 1KOHA 4A8SA 3TX8A 3P8BB 3VQSA 4EEYA 2YXLA 8RUCA 2V8HA 5B0BA 4OZLA 1QJHA 2Q3PA 5CYJA 4TY9A 5H9EJ 2GZOA 1IR2A 4F4WA 3NOGA 1I94J 1X9SA 1IKVB 1SQEA 2WVEA 2CPJA 3QAUA 2R8JA 3QRQA 1P1TA 4RNFA 4QWDA 1TAUA 1S1WA 3V4IB 1XR6A 2K3IA 1RTJA 2GMHA 4DFMA 5J2PB 5KG7A 4QU6A 1OO0B 4HH1A 5T41A 5IXUA 3FZ2A 2BACA 2QL9B 1Q53A 3JQMA 1DAXA 1TK0A 4H4KC 2KB2A 1NZ8A 2LDIA 3CJRA 3QJLA 3V6JA 3ONQA 2CPEA 4TYAA 2EBGA 2C22A 5IT4A 2LA4A 1DLOB 3OHAA 3L95X 2ZBPA 3M8PA 1PKUA 4LR7A 4ZP9A 1DARA 1J5EJ 2HSEB 3LP1A 2V9KA 1M5KC 4EBDA 2CPYA 3KLVA 2KG0A 3W9JA 4WFXA 1VHFA 4EUVA 2G2OA 4CCHA 2DR6A 4P71A 1FWKA 4C0BA 3SXLA 1N5YB 3MPYA 4ZK7M 2XG8A 3IFEA 2EFQA 4A46A 1DQ8A 5J2MB 2DH9A 1VRUB 4EU0A 2H9ZA 2JSXA 3HFVA 3CNQP 3KHRA 1FDBA 3H2UB 4OZ3A 2QMXA 3PW2A 1RKJA 2X1BA 1WC3A 1V9OA 2QL5B 1CVJA 2GJ2A 4ES2A 2QYCA 3V6DA 7AT1B 4F7VA 2QGFB 2DR8A 2DNLA 4ZN1A 5L46A 3HHKA 4DF4A 3W62A 4CLYA 1HWUA 3UFCX 3HLUA 2W7AA 4R0JA 5F3TA 4DV3J 1BQMB 2DHXA 2UU9F 1YKWA 2HURA 1TTHB 3K17A 2K7KA 2R4FA 2MKIA 2UUBJ 5B0EA 1LEOA 3SDEA 3M8QB 5KFHA 3KYLA 2DXDA 2CPIA 5C42B 2YPZA 2GVZA 3BPDA 4UZBA 1KQFB 4C4WA 2LEPA 1RI7A 2B5JB 3TAMA 1KNZA 3ULHA 4JI2F 3P3DA 3AXKA 2PSZA 5RUBA 1M0SA 3R5CA 1FEEA 3W5ZA 1LXJA 2BJ7A 3HKZD 1HPZA 2ZH6A 5D15A 1AW0A 2F5GA 5KAKA 2HMIB 3HPOA 4DLGA 2AGQA 3F0NA 3HFKA 3KG4A 4RUCA 4B3MJ 3I0SA 3M8WA 3AOBA 1S9EB 2W2MP 1EZZB 4YFUA 3BREA 5EX3A 1CG2A 3I4PA 1HHTP 2HS4A 4PPZA 1Q8LA 3D2WA 2QV6A 4XAKA 3THPA 1KLMB 1Q4RA 3K5PA 3QWPA 4BDPA 1UVMA 2Z4PA 1D8YA 1FVSA 1X5PA 4XK8C 1UFKA 2NZ4A 4DR4F 3DI6A 3C19A 1M5PC 2YPYA 3MUVP 2MYFA 3OJUA 3O6QA 1VR6A 3NGRA 2YNFA 2I5JA 4KBIA 2XLJA 5DM7Q 3R5DA 4LFCF 3I5AA 4GKKF 2JLEA 1F3FA 3FSXA 5E3AA 2FVSA 3TUIC 1SL0A 2WAQD 4NLGA 2FJWA 2MJUA 1XMQJ 1QY7A 3US5A 5I4MA 4MKAA 3H98A 3H2LA 2XZWA 5C25A 2H65B 2A2CA 3UR0A 2N82B 1YHQS 4X4PA 1L3VA 4EGLA 3P45B 4MIBA 4RW6B 3EJMA 5BXIA 2RRBA 2HQ3A 3RAXA 2R7VA 1T0TV 2I38A 4HHUA 3ZNJ1 2DPJA 2DEJA 5D0RA 2KVQE 3R1LA 4USUA 3G82B 2PIIA 1TFWA 1U0HA 5EWFA 2HZCA 4DSKA 2YH0A 2KU7A 1DY3A 1NEEA 1HQEB 2VH7A 1LKZA 3M2VB 4DR5J 1UZDA 1YITS 1HWIA 2N4CA 1FNMA 2DNQA 3LP2B 4UOHA 2KM8B 4XIUA 1R8PA 4Y2KA 1BY9A 3QFWA 4ANDA 3OTEA 4USIA 1Z1ZA 4JI4J 5DDQC 4G1IA 3QIPB 2Z56B 2QEXS 1NCLA 2NZCA 4BWJA 3W1YC 3DRPB 1S1VA 3QZ8A 2HQGA 2OD6A 2WVDA 2XYHB 1UVIA 1RKIA 2VG7B 1AUSL 3RAQA 2AJQA 4DFPA 5E41A 3ZZZA 2XYPB 4DR7F 4F4XA 9ATCB 4DL4A 4LRCA 1RB0A 2VOOA 2HFVA 3P5TL 1LWEA 2BQUA 4ZHRB 1FTCA 5KT2A 1F60B 3M2UA 1NSPA 4LBHA 5SZTA 3PYEA 1OWXA 2R8IA 4DCOB 2M88A 4JV0A 3WHIA 1NBEB 4Q8FA 4QWBA 2MQMA 2QSFA 2OGUA 4UY8T 4KHRA 3I55S 2CQPA 1JLQB 1HNWF 2C3UA 3NGKA 4KT0C 3ISNC 2JEJA 2OFHX 3O2IA 1SKUB 3UDEA 2N7YA 2QA1A 1JLCA 3CJKB 1W25A 2VPZB 1Y7PA 3KNAA 4RKUC 1XMBA 5E0OA 4EBCA 4CRJA 3VGUA 1WKKA 1FRXA 1MMDA 3JQKA 1IKVA 4FXWA 3A8IA 4CIOA 1SQGA 1N6QB 3FMBA 4V19J 2WW4A 3ITHB 2X51A 2W2OP 3CJ0A 3TEGA 5K20B 3S8SA 4DV7F 3V4IA 1VBZA 4JI5J 3JTPA 1K0VA 5J2PA 1XMOF 3MTKA 1TELA 1KVJA 4DF8A 3T1HF 3DYAB 4A8XA 1GXLA 5KG2A 4WYWA 3PM9A 2V68A 4MIAA 1RCOB 4RU2A 2BE7D 1B3TA 3D3CJ 4NLVA 8ATCB 3OHBA 2GJFA 3BYRA 1N0UA 2DNPA 1VHIA 2IVMA 4ED3A 1H72C 1DLOA 3BGLA 2BANB 5KFBA 4ECXA 2HGLA 1IM4A 1QDUB 3PFOA 3PG9A 3HVRA 4LFAF 1CJVB 4Q0BB 1IBMF 2OMLA 1VK8A 4LRAA 4OYIA 3TA2A 4XTTA 1FI4A 2HBZB 1ZZFA 1UP1A 4MFBB 1URRA 2W01A 1MMLA 3W2WB 5KFLA 4GRSA 3ZZOA 3CMQA 1H3DA 1RHRB 5B0FA 3UI3A 2VG6B 3V5RA 3HCXA 2ZE2B 2X3GA 2VU5A 3B6BA 2LXUA 3W66A 4B08A 4OV6A 1ZA2B 3IBFB 1N5YA 1S77D 1BQNA 2UXBF 4KKOB 2GMJA 2ZOFA 5J2MA 4WBFA 3IP0A 1VRUA 2EWHA 4WZMA 1VQ9S 5EWEA 1RT4B 3P4UB 3R5BA 3G9CA 4TU9A 3OL7A 3V81A 3CEDA 3BBCA 1LFPA 1YIJS 1F0XA 2F3JA 5F41A 3FKBA 4KFBB 2B51A 4FYYB 3HZEA 4B3RF 4YEAA 4V19X 1U09A 4YS2A 1HMVA 2BM0A 3QQCD 1WG4A 1IKWB 3CCJS 1BQMA 1V5IB 5AJ3J 2AYGA 4L73A 1TL4A 2ZKUA 2FGOA 3ENQA 3ENVA 3QMQA 4OX7A 2AYBA 2CPXA 3M8QA 4FKXA 1SCJB 2DT9A 1IKXB 3L9ZA 3ICLA 5C42A 3NGTA 3ZTQA 3OD2A 3M7VA 2HFNA 1U25A 3HKWA 1NK8A 2B5JA 2L3MA 3MEKA 1SXLA 1CJKB 3R27A 4PCQA 2RNEA 5ETLA 4Y2CA 2XMVA 3TAPA 4JI3F 3DKDA 2VFUA 2C1EB 2HMIA 3A3OB 2NSCA 1B0VA 2O66A 2FHKA 1VJQA 1NHKL 4KQZA 1Y5IB 1S9EA 2PA3A 2U2FA 2COLA 3DLHA 3CXCR 4OI4A 3CCZA 4ZVRB 2UXCJ 3GPAA 2G1DA 3P96A 3RGIA 5KT6A 3W7BA 5CCLA 2YNIB 2EK1A 1KLMA 4S0MA 3VZHA 3MR2A 1IBLJ 2NXJA 3C2PA 2J6SA 3UPFA 1RT2B 3MCSA 5D78A 3ISZA 2J6UA 4X64F 3OT9A 4PXDA 3K89A 3TVZA 1LWFB 4JI7F 1H0HB 4JI8F 4P9SA 4DUZF 2EKNA 2CQIA 4P73A 1RYRA 3H5YA 3KK1B 1ZTWA 1HBMB 1LFWA 4B3SJ 2FD2A 3Q8UA 3W5YA 3K8VA 3G2XA 3CPWR 4OX8A 1T9TA 2VA3A 4YY3J 4WP3A 2QFIA 1N5VA 4NX9A 3OTOJ 3PHEA 2N3OA 3ZXWA 1CJUB 4EO8A 2R7QA 4Q2LA 4IQXA 1J5OB 2BA9A 4TQRA 4K5RA 5ETOA 2BRLA 4RW6A 2YKNB 4FF2A 4ZKAA 3HK2A 2KH9A 1Q95G 3BPSP 4DL3A 1RA7A 2X1GA 3PCOB 3ZFVA 2GGPB 2IVYA 3G82A 1G4CA 1TK8A 3IG1B 3VGVA 1RLCL 4FNIA 2MQPA 1HQEA 3M32B 3M2VA 4IQMA 4LSZB 2HRYA 4ZCMA 3LP2A 5HQ8A 4NLWA 2BR0A 2CJYB 3H4DA 3RBEA 3G6ES 2LQ9A 5F8IA 5A2QY 3ETMA 2AEJA 3ZZYA 3QIPA 2AEFA 4OMFG 3DRPA 5KOXA 3R5AA 1VC6A 1VC0A 4X4UA 3TZYA 3GV8B 2OPQB 3UD4P 2KG1A 2VG7A 1FD2A 4WFAQ 3FEXB 3BQ2A 3K57A 2XMWA 2ZVSA 3ENWA 2NCKL 4DR1F 4LRFA 2KN4A 2Y0BB 2W2NP 4M5JA 1RU1A 2Y1RI 2ZHOA 4ZHRA 1NM2A 4K4WA 3I9V9 1ZM3A 1FERA 3VV2B 2ZJRQ 2Z2ZA 3H20A 3B8HA 5D4NA 4N77A 4QIFA 1RP5A 1S57A 1OMSA 1JLQA 1JX4A 2IFXA 3I56S 3HHLD 1FESA 1TUVA 4M5IA 1NKBA 4DLEA 4PAAA 2MZRA 2PMHA 1HW8A 3GIRA 3CJKA 3V6KA 4M5DB 3T9NA 3CDAA 5E2QA 2VBZA 4F25A 1U2FA 2VQEF 1I6JA 1IUJA 4C8YA 1HKAA 2O67A 3MR5A 2J0XA 4XPCA 4QU7A 3ADAC 4EYHB 1BC6A 4N47A 3PX0A 2UZAA 4I2PB 3T5KA 5HVGA 1N6QA 3ITHA 1U4BA 4U95A 4ZIWA 4ZJOA 4ERDA 2R42A 4BCAA 3LO3A 5GAHU 2E9TA 1KN6A 2DY9A 2B0GA 1NK6A 1RE1B 1O5JA 4QPTA 1R6YA 2KT3A 4K4YA 3A1YG 3DYAA 2LVWA 2LQJA 4K59A 5IT9U 3G96A 1FRKA 1ELOA 1CQMA 1UVJA 3QIDA 4RL1A 2EFGA 4DZDA 1WUUA 3QRPA 1OIAA 4U67Q 4USWA 1KR4A 1PIEA 3G8TA 1OQ6A 4KR0B 2QLXA 3M8SA 2YX4A 4P2FA 3AQPA 2UVUA 3EXYA 4Y2IA 4ZVPB 1Q82T 2Z8QA 4JI0J 1CJVA 3IC1A 3AHPA 4Q0BA 1QE1B 1KD1T 2CNNB 3CC4S 4JI1F 1UJ5A 4C48A 3BSAA 2E29A 2KRRA 2LU2A 4MFBA 1VJWA 3W2WA 1S5ZA 4C8MA 1WACA 4WXOA 3KFWX 4ZP7A 2BJ8A 2D9PA 2IM3A 2E5IA 5KFNA 2VG6A 4MKYA 2M3DA 2ZE2A 3JAMU 2UUAF 2RS8A 2ZC3A 2MZ1A 3BSCA 1REGX 3UO0A 2B4VA 4KKOA 5GAEU 1EP4B 1ZAVA 1EIYB 2ZZNA 1RT4A 1QVFR 4JV1A 1KOOA 2FYXA 1SC1B 4DHVA 1F9FA 1RTHA 3DRYA 1PJ5A 2IPOB 2XGPA 4LF5F 1B7YB 4KFBA 3MD3A 1U8WA 3RRHA 2Z30B 1M1KT 1B64A 4LF9J 2MQNA 1IKWA 1TUGB 3BH6B 4DL0C 4LSLB 4DFKA 1RT7B 2X1FA 3EVWA 2V4JB 2DGTA 5A2QU 2I8EA 2J9CA 1IKXA 3MM6B 5CZXA 3K5OA 2AW0A 4MAKA 1GK8A 1CJKA 2Z58B 2FLOA 5J1EB 3BDEA 3OFEA 2W25A 1X0FA 1QAYA 1IQZA 1WSRA 4KGVB 1FRHA 5J1PA 3LPEA 1JKHB 4DFJA 1WHVA 1X4DA 5A8RB 1YWXA 2Y3YA 5IOLA 1U1MA 2DHGA 4C3LA 2XHCA 4NA2A 4ZVTB 2YNIA 4Y3CA 3QT6A 1WORA 2JVRA 1ZA1B 4FYWB 4YP3A 1RT2A 3TNVA 1Q8IA 1FCAA 1O51A 1NHVA 4R5PB 1LWFA 1VIXA 3T5JA 2E1CA 2U1AA 5CABA 3TJ8A 2IM1A 4NCBA 1HFEL 2J6TA 5D4PA 3MFIA 3WC0A 3KK1A 4X4VA 1L3SA 1HBMA 5DG7A 3D54A 4DSLA 2V69A 3EPIA 4L76A 3MDFA 3BSOA 3CSKA 1J5EF 4O3SA 5BYSA 5CCMA 3OL9A 1BWEA 4K50A 3CCUS 2IY5B 2CNOB 1CJUA 4AUKA 4OYBA 2VPYB 1G2EA 5M2PA 1J5OA 2AX1A 2WB1D 4L3NA 2VA2A 2MHEA 3GJSB 2YKNA 4LR9A 4A8QA 1IQTA 1N88A 1N5SA 3QLHB 4MT1A 2B7BB 4CYUB 4RW9B 2E1MC 3MWBA 3K5LA 3MD1A 4M94A 3IXQA 1IBCB 2XY6A 2GGPA 3MHYA 4MH8A 1D9FA 5E33A 2RDDA 3IG1A 1VOMA 2YX7A 1JLBB 2H51B 1N36F 2M8DB 3D1QA 5EGYA 3M32A 4ZLJA 1VYAA 3WIVA 3BQ0A 3ILLA 2XCAA 3MECB 4P2XA 4KRWA 4ES3A 2E7XA 1BGXT 3VAFA 4JI6J 4NA3A 3D6HB 4DSFA 3LF0A 2AEMA 4WF9Q 3H5UA 5KFAA 1EARA 1SL1A 1RAAB 1XQIA 4Z7YA 5JVGQ 3UCGA 4ETZA 3IGNA 3OFFA 4CO2A 1HNZF 1JK9B 4O3QA 2OPQA 4IKAA 3S6EA 2WSCC 3UR3C 2HFZA 4N41A 2B9XA 4HDGA 1RBOB 4NXNF 1VQ5S 2DNHA 4FYDA 2DJWA 2L48A 1HWLA 2XB2D 4GVLA 1XR5A 3PYGA 4NRUA 2ZBRA 1UVLA 4ILMA 1MU2B 2W9CB 1P9QC 5HLFB 1YI2S 1S12A 3EGZA 2WK4A 3MM9B 3GYNA 1S1XB 3JSMB 3RB0A 2VD3A 3OUYB 4ED0A 5HJYA 1LWCB 4U9RA 3OV7A 4MKVA 1NDKA 2E5LJ 3QGIA 3GFXA 2B8QA 2OEJA 2AMCB 2DK2A 4M5DA 1M1GA 1EQ0A 1SIWB 3VWSA 4BLGA 1B4SA 3PJWA 5IFMA 2F8EX 1NJWA 4F4ZA 3J81Y 4KHPJ 2R7WA 3M6UA 3CULA 3W61A 1B0PA 3NGSA 3UVJB 4DV0J 3LGHA 5AXMA 1RTZA 4NXMJ 2KFZA 3OTDA 2R3VA 4MKBA 4I2PA 1UPMB 1TL3B 3KK3B 1F9HA 3NY0A 5MAOA 2CPZA 1SKSA 1EAYC 3GIIA 5KT3A 2VC0A 2DB1A 4J9LA 2K3KA 1NO8A 1YRXA 1TVRB 2NYIA 5AXLA 5KFGA 1TU0B 2HQFA 3M6XA 3MUTP 2O01C 1VQPS 3M30B 1W7WA 3WQPA 1YTYA 1TKTB 3PYDA 1MSWD 2JNJA 4NLRA 4F8RA 1T3NA 4XDCA 1YDLA 3Q89A 2DRBA 2H1YA 2GJIA 3EE3A 1DJ0A 4QWCA 3HVWA 4X4NA 2FLPA 2WZ1A 1KHVA 3TI0A 1QE1A 2BV3A 4PXCA 4M8LA 4K4ZA 5HMWA 1NPRA 4LFBF 4OI6A 3W9HA 3CCES 1WELA 5KFUA 3PIOQ 3NNAA 3QSYB 1VCTA 4IH7A 2XWXA 2BVZA 2XBPA 3QGPA 4HTIA 1HQUA 2A2DA 3B82A 4IH5A 3H2VE 4X84A 2NXCA 4EWTA 5C2CA 3NGDA 2W4DA 3PKYA 1N56A 1EP4A 3VAMA 1NSQA 2YQ1A 1JLEB 4P2MA 4WU2A 2VJUA 4DDFA 2F8MA 4K0KJ 2FJAB 1PC4A 3CD7A 4J9NA 3R6GB 2Z2YB 1AA1B 5F8GA 3HP6A 1YJVA 3R7SB 4C8ZA 2JEFA 2ZFHA 2QMUB 2W4PA 2AQ4A 4DCPB 1RBLA 1IR1A 1RWVB 3GV7B 5F9NA 1ZM2A 1M5HA 2ZM6J 1WI8A 3FSIA 5ETVA 1H74A 4LSLA 3KLGB 2C28A 2QRRA 1RT7A 1ZM9A 5CD4A 4P72A 3M8RA 4OYXA 4USKA 3RBDA 2R7XA 4W4MA 2H54B 3CJQA 4F4KA 3MM6A 3G87A 1HR0F 3TJAA 3D0HE 3MM5B 5H9EK 4X62J 3E01B 4UOFA 3R2DJ 1V5VA 1Y10A 2CQHA 4K5SA 2IRUA 5J1EA 1T8EA 1P8GA 5D77A 1SC4B 3J7YU 1BUXA 3MM8A 4DV5F 4Q5VA 2HNDB 1JKHA 3MXHP 2LKZA 5H9FK 5A8RA 1RWWB 4NLYA 3GONA 1LOUA 3BKUA 1NAQA 3NBPB 4DR2F 2QFJA 1NPPA 3HT3A 3GG0A 4K2XA 4ECTA 2OO4A 2HNZB 1T3OA 3I5CA 2OLWA 7FD1A 1F2GA 5KFRA 1KWMA 4DV4F 3ISND 4M5GA 2V8PA 3ELHA 2F8HA 3UN3A 1S6UA 2BJEA 2HWTA 1CS4A 4OX9F 4ELVA 2KT2A 3PZPA 4R5PA 3HHNB 3CO9A 1P9YA 1QAJA 2VASA 2B9YA 1RBAA 1IN0A 1IM6A 5T14A 2R7UA 3BM7A 3AA8A 1TMJA 3FEZA 5FDLB 1AB8A 1R7IA 1HLWA 1JJHA 4DV1J 5F8JA 2XMUA 3LGNA 3J81U 3GWCA 2GA7A 2GQ2A 3RW6A 2QLBB 4DS5A 3BSNA 4ILLA 2VIHA 4KO0B 3NAHA
chains in the Genus database with same CATH topology
4UOCA 1S6OA 2DISA 2MKKA 2FJWA 2MJUA 2BQRA 2NR0A 2GHVC 1QY7A 4NZ6A 1U1RA 3US5A 3I96A 4IUFA 5I4MA 1FK9A 1M90T 4MKAA 4KIAA 2IAJA 3H98A 1U1LA 3H2LA 4DR3F 2XZWA 2P5VA 1MMNA 4I7FA 1FRJA 5LL6d 3PW0A 2ZUGA 5KFDA 3ZZ0A 2AWZA 5C25A 3JAMY 5AXNA 2CQGA 3QLHA 1I1GA 1NNDA 2A2CA 2BDPA 4ZVFA 3UR0A 2N82B 4N8NA 4D3HA 4CO0A 1SKWA 3DN9A 5KT7A 4WFBQ 1YHQS 4X4PA 1R8BA 1L3VA 3FMWA 5CYQA 4FXDA 3F73A 3AH6A 5KFFA 4EGLA 1UFLA 5E5NA 1B7FA 3EYZA 5DO2A 2DNRA 2CVIA 4MIBA 4C11B 4RW6B 1LK5A 3CD0A 2XWYA 2RRBA 2G0CA 2HQ3A 1CEZA 4F3MA 4ECZA 3RAXA 2R7VA 2B3TB 1K1SA 3RB4A 3GZ7A 4WFYA 3LP0A 4YMEA 2LXIA 2I38A 1VIOA 4N8OA 1LW2B 1C2PA 3DLBA 1H7XA 3RTVA 3G8SA 1U1PA 2BW2A 1CSJA 2DPJA 1N52B 4C8KA 5CYMA 5T7LB 3QAEA 2VODA 3HO1A 3BB5A 3R1LA 4WKRA 1N34F 2FGCA 2ILZA 1BD6A 1SIZA 4ZPVR 7FDRA 2CFXA 2PIIA 3LOUA 2FDNA 3GR0A 4FVMA 1TFWA 5EWFA 2HZCA 1R8HA 1TR0A 2OKQA 1DQ9A 4DSKA 3MECA 3Q2TC 2YH0A 4LF9F 2KU7A 4PWUA 4ID5B 1CPZA 1NEEA 1HQEB 3GIJA 2MB0B 2XMTA 1U1KA 2VH7A 1LKZA 3M2VB 2MZQA 4ZCIA 4FF1A 4BC9A 4CTAB 2RILA 2PGCA 1YITS 1HWIA 2N4CA 1FNMA 1N5QA 2DNQA 4B02A 1WF2A 1X4CA 2XGQA 3LP2B 2KM8B 4XIUA 1R8PA 1OPZA 4Y2KA 3RZAA 2W4CA 4YB7A 4A8OA 2OPRB 5DLFA 3DOKA 3M6VA 4ED1A 1X4AA 1BY9A 1GT8A 5KG4A 4XO0A 2QO3A 3DGPA 3OTEA 4USIA 4JUZA 4RW8B 1Z1ZA 2KFYA 2IVFB 3U1NA 3DLGB 2CJAA 4DQIA 3V6HA 2ZJPQ 1BLUA 3Q8RB 5DDQC 4G1IA 2RRAA 1Z2ZA 3LALA 2DCUB 3QIPB 2V8GA 1V3SA 2KKHA 2B4PA 2QEXS 3ZZTA 5L1KA 4DL5A 3UQSA 4TY8B 1VRTA 2JH3A 4BWJA 2L41A 3DRPB 1S1VA 3QZ8A 3AJ2A 2ZH4A 2Q43A 2HHPA 4KV8B 4KV8A 5IWAF 4USHA 2OD6A 3SFUA 1RTDB 2JLFA 3N4WA 5KFJA 2JWNA 2EK6A 4EBEA 5KFQA 1UVIA 1RKIA 2VG7B 4FS2A 3RAQA 4QQBA 3SFGA 1TKDA 2AJQA 3MR6A 2Y1JA 4DFPA 5E41A 5GMKa 3ZZZA 2R7OA 4A8KA 3CIZA 4DR7F 3MR3A 4F4XA 3UCUP 4ATNA 1K1QA 1OQ3A 1VI7A 1F5BA 3D1OA 1MU2A 4J9PA 3VAIA 4DL4A 2HVZA 2DITA 2VOOA 5K14A 2WW8A 2VUGA 3CDBA 3OQ2A 3DDNA 2YWFA 4LF8F 2W9CA