3KJVB

Hiv-1 reverse transcriptase in complex with dna
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
428
structure length
400
Chain Sequence
PIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Visualizing the molecular interactions of a nucleotide analog, GS-9148, with HIV-1 reverse transcriptase-DNA complex.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase/dna
molecule keywords Reverse transcriptase p66 subunit
total genus 98
structure length 400
sequence length 428
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3kjvB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3kjvB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3kjvB03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3kjvB04
5KFNA 4ECSA 3QIPA 2HWHA 3M9NB 3CDWA 4M95A 4IG3A 5D3GA 1TQLA 3BSNA 4J9LA 5DLGA 2CJQA 3QGHA 4LSNB 4NLWA 2BE2B 1LW2A 3PHEA 1FKPB 1S6QA 4DG1B 2B43A 4FS1A 1XR6A 1N5YB 4GC7A 4TYAA 3MECB 1BQMA 3Q8PB 4ZVHA 1HQEB 1BQNA 2HNZB 4ID5A 4NCGB 3DMJB 1RT4B 1OS5A 3CO9A 4NRTA 4URQU 4QWBA 4MFBB 3OL8A 4EEYA 2R8GA 1N6QA 4RW7A 3NAHA 4F4YA 4J9KA 3BQ2A 4ED1A 2YNGB 3PW7A 4IG0A 3PW4A 5HBMA 1S1UB 3TAMB 2IM1A 4ED0A 2UUWA 2UVWA 2YNHA 1REVB 3KK1B 2WB4A 4WFZA 2OH2A 3PW5A 5KFTA 4TLRA 4KKOB 2OPRB 3Q8QB 3GYNA 5F9LA 4U6PA 3GV5B 5FDLA 2I5JB 3KLFA 3KK3A 3H5XA 5F8IA 4MKAA 3QO9B 3HVTA 1JKHB 4KFBB 4PUOB 5JXSA 2FVPA 2ZE2A 5KFUA 4RUCA 2RDJA 4MKBA 4LQ3A 3T1AA 5KFRA 4RW6B 3KLHA 3SFGA 1QE1B 2FJVA 1T94A 4URSA 2XCAA 4NLSA 3DOKA 5KFVA 1RT1A 5KFOA 1C0UA 3PJWA 5KFIA 1GX6A 4RUAA 1EETB 3RBDA 2B6AB 3BSOA 5EWEA 2J6TA 4H4MB 1KLMA 4K50A 5DGAA 4IRCA 1RTJA 5KFCA 2VA3A 4YR3A 1C1BB 2W9AA 5F8GA 2V4QA 4IFVB 1T05B 2V9WA 5I3UA 4PQUB 4HYKA 1S1WA 4J9PA 4FBUA 4K4TA 1TL1A 1QUVA 1QAJA 2GC8A 1BQMB 1SH0A 4FS2A 2HNDB 2BR0A 3IS9B 3I5CA 2E9RX 1SV5A 4MFBA 4O3QA 3E51A 3FQKA 3RB0A 4KV8A 4DL5A 3KMQA 4TXSA 3CIZA 4WZMA 2HAIA 5J2PA 3KLGB 4IG3B 5D3GB 4O4RA 3OLAA 2JEFA 4EO8A 4WXWA 1VRTB 1HPZB 1HMVB 4ZHRA 1IKXB 4J9NA 4ECWA 4K4SA 1DLOA 3MFIA 3DYAA 1T3NA 5KFFA 5JUMA 3M8QA 5CYQA 4Y2AA 5KFDA 5J1EA 1SH2A 4MK9A 1SUQA 5HLFB 3CJ0A 3IG1A 3M8PB 2D3ZA 3KNAA 2B6AA 4PWDA 1S4FA 3M9OB 4LSLA 2WHOA 2ASLA 3JSMA 3DOLA 3DRRB 3H5YA 4U7CA 1C1BA 4LSNA 3ITHB 2IJNA 1EP4B 4Q44A 3RB3A 1RYSA 2FVSA 4DL7A 3KLFB 3RAQA 3QIPB 4EBCA 2YKMB 1ZTWA 5F8MA 2VG7B 3V4IA 2BANA 2IAJB 3BR9A 4RU9A 2DPIA 4RW6A 5L1JA 2E9ZA 4M94A 1JLBB 3KMSA 5J2MB 1N48A 2VG6A 2FLNA 2OPQA 3QO9A 4F4ZA 2XGQA 3MR6A 3GQCA 5KFLA 3SFUA 1U09A 4EYHB 4K4ZA 3V81B 4QWCA 1HQEA 2HNZA 5KFSA 5EWGA 1C1CB 4WFXA 1RT4A 3RBEA 1RT7A 4ED7A 1VRTA 1LWCB 3CDUA 3DLGA 1S0OA 4IFVA 1T05A 3G6YA 1S1UA 4FBTA 4H4OA 1RA7A 1FK9A 2YNIB 2XI3A 3H98A 4NLXA 3UR0A 5I42B 1TL3A 4Y34A 5KFQA 4DL3A 1LW0B 4G3IA 1FKOB 2R8KA 5C42A 2W9BB 2XCPA 2R8HA 1TKZA 2VG5A 1IM4A 4IKAA 4MK7A 3FDSA 3GIIA 4O3RA 4XPCA 1TL1B 3LP0A 4X2BA 5KG7A 2IM3A 1S1VA 2ZE2B 2UVRA 1HNVA 1S9FA 5DQGA 1IKVB 2JEIA 1SV5B 1N56A 4K4VA 3HVWA 2W7OA 1IKXA 2ALZA 1KLMB 2IM2A 5C5JA 1S1XA 4DL2A 3I5BA 3BJYA 1IKWB 3LP1B 4G1QA 5KG4A 1TKZB 3DM2A 1MMLA 1RT6A 3OL6A 1HNIA 5HP1B 4Q45A 2J6SA 4KV8B 1TKTB 1DLOB 4QW9A 1RDRA 4IH5A 3BQ1A 3MECA 5KFPA 3RAXA 1TP7A 4EBEA 4J9SA 4H54A 4QWEA 3DOKB 3BQ0A 3DRSB 5KFAA 4ECXA 2HMIB 1LWCA 1JLCA 3KHHA 3EPIA 4EBDA 1ZETA 4LQ9A 2YNGA 4RZRA 2D7SA 4KBIA 3N6LA 1S6PB 4K4XA 1JLQA 4ZMMA 3T5HA 2FLLA 5CYMA 1LWEB 2OPRA 3BGRB 1KHVA 1VRUB 2WRMA 5L1KA 3MEDB 1LWFA 2YNHB 5L9XA 3LANA 4ZPAA 3C6UA 4QW8A 1K1QA 5KT3A 3E01A 3FQLA 1LW2B 1N4LA 3DI6A 1XR5A 1YVFA 3DRSA 3MEGA 3HHKA 4RNOA 3IN5A 2HWIA 3H4BA 1JKHA 1S9EA 4O44A 2XGPA 3DOLB 3DRRA 3CJ2A 4H4OB 3DLEB 3V6HA 2W8LA 4JV2A 1DTTA 1RT5A 2YKNB 4KKOA 1RT1B 5K14A 4WE1A 4MK8A 4YQWA 2RKIB 1TKXA 3GIKA 5KT7A 4IRKA 2BQRA 3GV7B 1I6JA 2RF2B 3QZ7A 3H5UA 3OL7A 2OPQB 1TL3B 3CWJA 4NLOA 5F8NA 3E01B 4KAIA 5FDLB 3DDKA 3ICLA 4ECZA 5HLFA 1IKVA 3C6TB 3DLKB 1N5YA 1R0AA 4EO6A 4RW4B 3GV8B 1HQUA 4NRUA 4MIBA 5KFMA 5EWFA 1S10A 2JC0A 5J2NA 3DLEA 2IMWP 3KOAA 4ICLA 3KLIB 1JLGB 3MEEA 3ITHA 4RW7B 4MH8A 5C42B 4RW9A 5DQHA 2GIRA 5I42A 4RNMA 2ZD1A 4I2PA 5F9NA 3V4IB 1HARA 1RTHB 2C28A 2YNFA 3OHBA 4F50A 2YKMA 3QIDA 1UWBB 4NLVA 2EC0A 2VG5B 1SH3A 4PQUA 5F8HA 2GIQA 3I0SA 3HKWA 2ASDA 4NYZA 3KJVA 2BRKA 2W9CA 5J2NB 5EDWA 5KT2A 2WOMB 4HKQA 3TVKA 3IG1B 4KSEB 1C0UB 2J6UA 2HMIA 1T03A 3EPGA 1RT3A 2W7PA 5L1LA 3I5AA 1JLFB 4Q0BB 2I1RA 2AGPA 2ZD1B 4I2PB 4KB7A 4O3PA 4QPXA 3DYAB 3KHRA 1JLAB 1TKTA 1S6PA 4B3OA 1TV6B 1EP4A 4IH7A 3DRPA 5KFXA 4J9MA 4ECUA 4ZPCA 3MEGB 3OL9A 1RTDB 2IJFA 2QE5A 3D28A 2DPJA 1MU2B 1GX5A 3M9MB 3C6UB 3KHGA 4Y2CA 2JEGA 1J5OB 3NKYA 4R5PA 5J2QA 4KHMA 4YR0A 5KG0A 4DEZA 1RT3B 4IQXA 1ZTTA 5T14A 4ZPDA 4IDKB 1JLEB 1TVRB 1C1CA 3T19A 2BQUA 2WTFA 1S1XB 2UVUA 2OPPB 1RT2B 3QLHA 4ZHRB 2R8IA 3NMAA 1LWEA 4J9RA 4R8UB 3I0SB 5KFHA 2HNYA 4O3OA 3NBPA 3V6DA 3LALA 2BANB 2WONB 4I7FA 5HROB 4RW8A 4ZPBA 3DI6B 3MF5A 2OPSA 3DLGB 3PJXA 2IA6A 3DLKA 1T03B 3EZUA 1HYSB 5HBMB 3V81A 3IRXB 2C22A 3QYYA 1JLEA 1TVRA 3KLIA 3FFIB 1JLAA 3UDLA 5CYMB 4NLDA 4F4WA 1JLQB 1RT6B 3N6MA 2I5JA 4NLUA 3C6TA 1S1TA 4Q43A 1S1VB 4ECTA 4ED2A 4IR1A 5HROA 1RTIB 1J5OA 4KO0A 1S97A 3PR5B 1S9GB 2C2DA 2ILZA 3T5KA 5DGBA 3Q8RB 1IKYB 4J9OA 4RNFA 4DL4A 4ECQA 4LSLB 2YKNA 4ICLB 4WE1B 1C2PA 4ED3A 2YNFB 5KT5A 3OSNA 2B5JB 3MTKA 2JC1A 3Q8SB 4NZ0A 2AGOA 3MEDA 2BE2A 4IH6A 4ZVFA 1RYRA 3BGRA 3PW2A 3I0RA 3LP2A 3HVTB 1S49A 1IKWA 3LP1A 4G1QB 3OLBA 4ED6A 5KFBA 2C2EA 1R0AB 4I2QA 5KG3A 3LP0B 4ZP7A 1C0TB 4IG0B 4TY8A 2W9CB 4EYIB 1DTQA 1DTTB 1RT5B 1RTJB 3NGDA 3V6JA 4O4GB 5C25B 3KK2B 1S9EB 4O44B 3G6XA 1TKXB 3RB4A 1RTHA 4R8UA 3PR4A 5KT6A 2IC3A 3JYTB 5DLFA 4RNNA 3H59A 4JUZA 3BSAA 5DG8A 2W9BA 2R2RA 1FKPA 1S6QB 4DG1A 3N6NA 5KFYA 3PZPA 2FLPA 2XC9A 1LWFB 4KO0B 5KG5A 3OSPA 4K4WA 3TQ1A 3KJVB 1RAJA 2HNYB 3RB6A 2QV6A 4IR9A 4TYBA 3OHAA 3CDEA 3NAIA 5KFWA 5L1IA 3QGGA 2RKIA 3SI8A 1RA6A 3CJ4A 5I3UB 4KHRA 3I0RB 3LP2B 3ISND 4B3OB 1D0EA 3T5JA 4KFBA 4PUOA 4WFYA 3DRPB 2ASJA 3MR3A 3UQSA 2IAJA 4WXOA 1RTIA 5KFZA 4QWAA 4WYLA 4I2QB 1S1TB 2WONA 3LAKA 4NLRA 1IKYA 5DG7A 2WOMA 5J2PB 1D1UA 3MEEB 5KFGA 1XR7A 2WK4A 3CJ5A 5KT4A 1S0MA 3GIMA 4JV1A 3PW0A 1N6QB 1NHUA 5KFEA 3MR2A 4ECRA 1HQUB 1JXLA 4Q0BA 2R2TA 2AU0A 2IBKA 4IFYB 4NLYA 4O3SA 4NLPA 5DG9A 4TQSA 1QAIA 4IDKA 1CSJA 4ECVA 3V6KA 2VG7A 5K14B 3KK1A 2ZKUA 2IM0A 1HMVA 1S1WB 3G6VA 4RW9B 2BQ3A 1RTDA 2FJWA 3KLEA 4F4XA 2ATLA 4IRDA 2RF2A 2FVQA 2XI2A 2VG6B 3PVXA 1JX4A 4ZP9A 1TV6A 4YR2A 1S48A 3DMJA 1MU2A 3H5SA 1HNVB 3GILA 4J9QA 2AGQA 4Y3CA 4ZVEA 4Q8EA 2OPSB 2FVCA 4YMEA 4K4UA 3MFHA 3H4DA 4ED8A 4RW4A 3QGIA 4NLGA 4OL8A 4IFYA 5C24B 1REVA 2AX0A 5KG2A 4O3NA 3TAMA 1LW0A 2R2SA 3FFIA 4IOBA 1W25A 4WYWA 2JLEA 1RT2A 3KK3B 5DQIA 2BRLA 3MR5A 1JIHA 2ILYA 4RNHA 3VQSA 3H40A 2IC3B 3JYTA 1UWBA 2C2RA 3M8QB 5CYQB 4I7FB 1S0NA 1QE1A 3G86A 3NBPB 3FSIA 3BSCA 3CJ3A 4H4MA 5KFJA 3GIJA 3CVKA 2VA2A 3IRXA 1EETA 1BQNB 4NCGA 4Q8FA 2F8EX 1C0TA 4TY8B 1JLGA 3JSMB 1HPZA 1NNDA 3QLHB 2OPPA 1KHWA 3QZ8A 4DL6A 3LAMA 2RDIA 4ZVGA 2W8KA 2UVVA 5C25A 4TY9A 1VRUA 3D5MA 4R0EA 5KFKA 1HNIB 5HP1A 4XO0A 3V6DB 2YNIA 2CKWA 2JEJA 2E9TA 2HNDA 4KE5A 4TN2A 5KG1A 1JLBA 3NL0A 3KHLA 3M8PA 2R2UA 1K1SA 1JLCB 3T5LA 1HYSA 2R8JA 4WZQA 4GC6A 2FJXA 2UUTA 3KLHB 2WCXA 4MIAA 3FRZA 4K4YA 4RW8B 1NHVA 2V4RA 3KLGA 2V0NA 4O4GA 3KK2A 4R5PB 1FKOA 1S9GA 5J2QB 2D3UA 4TQRA 4URGA 2B5JA 1FK9B 3DM2B 1JLFA 2O5DA 4ZP6A 3BREA 3IGNA 3UPFA 4XPEA 5F8LA 3HVAA 2FVRA 1Z4UA 2AWZA 4ZP8A 2AQ4A 2AX1A 4NLQA 5F8JA 4NLTA 1WNEA 5EUHA 1SUQB 3IGVA 5J1EB 3KLEB 4QWDA 3H2LA 5J2MA 4PWDB 5KG6A 1DTQB 4YP3A 2XWYA 4JV0A 3IS9A 5C24A 4ID5B 1RT7B 3KLVA 3ISNC 2D41A 4ECYA
chains in the Genus database with same CATH superfamily
3P45B 3BBCA 1MN9A 4ECSA 2HWHA 3BGUA 4DUYJ 1NKEA 2YQ0A 2FTRA 4IG3A 1IR1A 1TQLA 3BSNA 4J9LA 2YTCA 3CPWR 1UVIA 2HHUA 2H9ZA 1O5JA 4ILLA 1EAYC 2QN6B 4DG1B 2VB6A 2B43A 4DCOB 4QOTA 1BY9A 1GT8A 3FC9A 1XR6A 5E0OA 1N5YB 1NZ8A 1X5OA 4M5HA 5DDOC 1BQMA 1R8HA 5L39A 2GA7A 3DMJB 4NRTA 2QFIA 1U1LA 1GMWD 3OW2R 4RW7A 1RAEB 1EIYB 2FYXA 1RABB 1VYAA 4F4YA 4FXWA 3M2UA 1U0HB 4GVLA 3LWLA 2DEIA 4IG0A 1NHKL 5IQQA 4ZLJA 4ED1A 1NDLA 2OKQA 2UUWA 4J7CA 3PW4A 2D1CA 4WFZA 1KOOA 2KB2A 5IQ6A 1I94J 4LR9A 5F9LA 2HW3A 3QBCA 5FDLA 2IDEA 1GNKA 2PT0A 5F8IA 4AL7A 3KDNA 3OV7A 4CLZA 2E7WA 1Y4ZB 1PG5B 3RYLA 2JL9A 4ES3A 2XY7A 2AYEA 4X4VA 2JNJA 2J9DA 3A3PB 4USUA 3MPUB 1YJWS 2KFYA 4ZJLA 4AD6A 4ZLPA 4NLSA 5KFVA 4C2MA 5HQLA 4RUAA 1C0UA 2XCAA 1KWMA 3BYPA 2IA6A 3RBDA 2G9OA 3PEHA 3W1YC 2MQQA 2MXYA 3G4SS 3FKBA 1H38A 5D0RA 4LUBA 5DGAA 4IRCA 1FWKA 1RTJA 2VA3A 1RWPB 3FUYA 1RHJB 5DS7A 2V9KA 1R31A 3UDEA 2V4QA 2W9AA 2HGMA 2V9WA 3OT9A 5LJ3Y 4J9PA 3MHYA 1HBNA 1SJRA 2DYAA 2QMUB 3LUYA 4J37A 4WU2A 4NXNF 2HZCA 1NCLA 1QAJA 2GC8A 1SH0A 1VBKA 2VV5A 4KY3A 2HNDB 2BVZA 5B7WA 5HSPA 3PRVA 1IR0A 1FO1A 1SV5A 2Q3PA 4OX9J 2I8EA 4O3QA 5B0CA 3PW7A 5HMXA 3RB0A 3BKFA 4JI0J 1RU2A 2CZ9A 4L72B 5M2RA 4KGXB 1Y5NB 1VQSA 2HAIA 2UXDF 2F9JA 3IP0A 2JLGA 1AA1B 5IFMA 3MUTP 1F1BB 2DY9A 3FEZA 1HPZB 2NSCA 4DR4J 3Q2TC 4ZHRA 4ZCLA 1QM9A 3BO2A 2QLWA 2A6OA 1NK4A 3D6FB 4ECWA 4GVBA 1YKWA 3BF4A 3KYLA 3Q23A 3PX4A 1SPBP 2HVZA 2RRNA 5ETNA 3ULHA 2PC6A 4Y2AA 5KFFA 3J80U 3EGZA 1SH2A 2RHSB 5CXTA 3K58A 2MQNA 4MK9A 2GZOA 2E66A 4C8OA 2B6AA 1I3OB 4JI5F 2VF3A 4PWDA 1S4FA 2X1BA 1HD1A 4LSLA 2B56A 4G1PA 2MKIA 3DRRB 2F8MA 3PIOQ 2E5LJ 1RWXB 4U7CA 3Q83A 2V69A 4LSNA 4NMXA 2PE8A 3HPOA 2IJNA 5H9FJ 5D8HB 2FVSA 3WHIA 5CA5A 3QIPB 1A6LA 1Q16B 1RJJA 2RUSA 2HGLA 2WSEC 2YKMB 3ZZPA 4DV6F 4EBCA 3D54A 2VG7B 3V4IA 3NNHA 4JI2F 1IQTA 2ACMA 4FBTA 1T9TA 2ERRA 1F2GA 2GS8A 4P73A 4DR1F 1V3SA 1BD6A 5J2MB 1N48A 2VFRA 1X31C 4EK2A 3MR6A 1U8SA 5ETMA 3SFUA 4J9UE 2CNOB 4EYHB 2ZUAA 2CPJA 1HQEA 4QBUA 2VU5A 2LLZA 3FCVA 3NLCA 4W4MA 1VRTA 1LWCB 3PYGA 2GVDB 4NXMJ 2ZKTA 3J7YU 2B4UA 3G6YA 2KDOA 2GMJA 3D66A 2MHEA 3NL0A 4OHWA 3O2IA 3G82A 3UFCX 3OTEA 1LW0B 5KFQA 1U1QA 1AW0A 1RCXB 1ZM3A 1R8AA 2GIFA 2VFSA 2W9BB 1TUVA 3TVZA 3QSYB 2PFFB 1V6HA 1X5PA 2RAQA 2Y0SD 5HANA 3QAEA 1VQLS 3W61A 2QEXS 4DV5F 1Q78A 4X64J 1S99A 2HFSA 1N5SA 3CW2C 2B9XA 3FDSA 2Y8YA 1RWOB 2LXIA 3AD9C 3QT7A 1F3FA 1UCNA 2DHXA 1S9FA 1NPKA 1IBKF 4IO1A 2HZVA 4DQSA 3M2UB 1U6BA 4M8LA 3HI9A 2W7OA 4V19X 4G1IA 2IM2A 3S8SA 5C5JA 2EFNA 1NSPA 1OY6A 2EFVA 4F36A 1VS3A 2J0WA 2QMWA 3SXLA 4CT8A 2MQPA 4G1QA 2QA4S 3H2UB 4DL2A 2FIUA 2DNYA 3W62A 3DM2A 1MMLA 1RT6A 3OL6A 4NA3A 2LECA 4KV8B 2ZWPA 3AXMA 3D9BA 1RDRA 1S7HA 1TZ0A 2MB0B 4JI4F 3HK2A 3MECA 3WC0A 3RAXA 2HFZA 4ECXA 4J9SA 3P6YC 4LF7F 3OVAA 3CMAS 2OSRA 3AJ2A 3BB5A 3KHHA 3NP5A 1UA0A 5E3CA 4UTGA 1OQ6A 5L9NA 1U24A 1XN9A 2NLWA 2YNGA 5L8RC 2FZCB 2D7SA 3POTB 4KGMA 1S6PB 3CCSS 3QPIA 3IXQA 3KWMA 3C14A 3AA8A 4L3KA 1UVLA 2FLLA 1UFKA 2DGUA 5CYMA 1LWEB 2OPRA 1KHVA 1UVNA 3MEDB 5HAOA 1B0VA 3EDQB 5AJ3J 2YNHB 3LANA 4ZPAA 2NR0A 1YRUA 1KQKA 3C6UA 5KT3A 1WI6A 2W4PA 5FLXU 3E01A 1FKAF 1LW2B 2YKQA 3LGNA 3CEDA 4RNOA 3R5CA 4CO4A 1VK3A 3IFEA 5HVHA 3GJSB 2HWIA 4I69A 1R6VA 1YHQS 4WF9Q 4NE9C 2HK3A 2KHDA 3V6HA 4H4OB 2LCWA 1AROP 1T9XA 2ADBA 1DTTA 3PRBA 2YKNB 4KKOA 4QIFA 1RT1B 4PYDA 4UUXA 3S7RA 1U6FA 2R7WA 1U1KA 4QR1A 2W2NP 4JV5F 1TKXA 3GIKA 5KT7A 3Q8VA 3QSIA 4Z2XA 4DPXA 2EFGA 1I6JA 3MMAA 3F56A 2LVWA 4ETXA 4LF9F 1HWKA 2KVQE 1TL3B 4DR3J 2DNZA 1PIEA 1JQGA 5F8NA 3E01B 4DR5J 4YDXA 4C3MA 2KYZA 4DUZF 2YX1A 2VBZA 1TAQA 3PG9A 4MMOA 2NREA 4FPRA 1R0AA 3CJKA 5E3AA 2ASYA 3GV8B 1WC3A 4LBIA 3KOAA 5GVQA 2EC2A 1PKUA 2HWTA 3GPAA 2K06A 2IVFB 3KLIB 1JLGB 4HLBA 2M4MA 3MEEA 3RR7A 2GO8A 2OIHA 2HQDA 4W98A 1ZH5A 3CCRS 2VONA 5I42A 4DX8H 1NO8A 2ZD1A 5G4DA 2MZRA 4BCAA 3V4IB 2MEWA 3E3XA 3L7PA 4NZ6A 1IBCB 3G87A 2XNRA 2DB1A 3QIDA 2EC0A 1RISA 1L3UA 3QT6A 2OHDA 4ZVRB 2CJ9A 1VC6A 3I0SA 2V5HG 4NYZA 1QSSA 1DHMA 2BRKA 5EX3A 2W9CA 3J7A1 2EKNA 1XNQF 2HHHF 5EDWA 5KT2A 3R2CJ 2DVIA 1TFWA 1SKUB 4HKQA 1G4CA 1TR0A 2HQ3A 3TVKA 4C3LA 2FB0A 4X65J 2B9YA 4ID8A 5T7LA 3W5YA 2X1FA 3IWNC 3D67A 6FDRA 4DV2J 3I5AA 1JLFB 3DU5A 4PRFA 2AGPA 4RWXA 2ZD1B 1N0VC 3EXYA 4KB7A 4O3PA 1SJ1A 4DZDA 4EZ6A 3F0NA 1APSA 1WF0A 1FRXA 2O01C 4B3OA 1GEHA 3M30A 1EP4A 3OTDA 2OI2A 3BGLA 4IH7A 4P2MA 3DLLQ 4NXNJ 1R0BG 4ECUA 2MYFA 3MEGB 2DITA 4CNYA 3D28A 3OR1B 1D9DA 3EGNA 1Z2LA 5E33A 4NEZA 1RBAA 1WF2A 1BHNA 3KKFA 4AXIA 4GKJJ 1UEUA 5KAKA 4CTAA 3AD7C 1QSYA 4YR0A 1MMNA 1Y5LB 2GVZB 5KG0A 2ZJRQ 4ILMA 1ZTTA 2WBRA 3R97A 3SV3A 2VD3A 3GTYX 1FDBA 1C1CA 4I67A 2CWKA 3TARA 2BQUA 3MM8A 1F9FA 1BWEA 2C2NA 1S4EA 1HBUB 2R8IA 4DS4A 5B0DA 2XTJP 3ONQA 3NMAA 1XK8A 2D74B 2DNQA 2CFXA 3F44A 4XK8C 3RBXA 2HFUA 4DV1F 2DH7A 2CAJA 2EVZA 3NY0A 2HZAA 3UN2A 4MIWA 2XS2A 1UZHA 3MM7B 1IXKA 1GTHA 3NCPA 1JB0C 4ZPBA 3DI6B 2WSCC 5CYJA 1X0PA 4OV6A 1ZM2A 3CD7A 3DLKA 1IN0A 4KPCA 1YBTA 3EZUA 4YB6A 3UD5A 4C98A 3CCES 2DR8A 5HBMB 3V81A 2UUCJ 2C22A 4USMA 5BXIA 3FJ2A 3L7OA 3UDLA 3FFIB 2CVEA 2P6TA 5CYMB 2HHWA 5H9FK 1HBUA 1RT6B 3DDIA 3N5BA 2I5JA 2L9DA 4NLUA 4UOHA 1L5UA 1CPZA 1PO6A 2ZOMA 4OX9F 1S1TA 3PCOB 3BDEA 4Q43A 1S1VB 3TEGA 2J7UA 2G1DA 5J1PA 1WWHA 2UXCF 1ZZFA 2WAQD 3GJQB 4DQPA 1S6OA 1SIZA 1YRTA 2PEHA 2FD2A 3BGFA 5MAOA 2HIYA 2R7XA 2QIFA 3PR5B 5DGBA 1IKYB 3J7AN 2XO6A 2YKNA 1EJ7L 3ZTSA 2ZH5A 1VGYA 4WJBA 5E5NA 5KT5A 1SB6A 5IWAF 1X4FA 3SV4A 4WP8A 5AJ3F 3OTOF 2KT5A 3MEDA 4ZVFA 2M2BA 4OX7A 3PW2A 4DPOA 3I0RA 2DGOA 5RUBA 3MTJA 2FJAB 1SC6A 4DFJA 3G96A 4NZ7A 4LF7J 1IKWA 3NS7B 4NYOA 3ZXWA 4DF4A 4LREA 2AJQA 3QNWB 4BC7A 1R0AB 3P49B 4ZKAA 2G0JA 4DS5A 3KXDA 3VZHA 3OJSA 3KJFB 2BE7D 2MPUA 1C0TB 4IG0B 4TY8A 4ZP7A 5GADI 1OQ3A 1DTTB 3VAHA 2DHAA 5BYRA 4V1Ak 4GKKF 4O4GB 3R1HA 1YJTA 2V2VA 5GMDA 2M8HA 1FT8A 3NGSA 4XDDA 4Y00A 1VMBA 2IC3A 3JYTB 1OYDA 3KFWX 1VQ4S 3WZ0A 1KBRA 2RRBA 1U1RA 2FLPA 2W4DA 3A1YG 2ZBPA 3B78A 3M6XA 5KFYA 3H42A 2HLTA 2YWHA 4ZLLA 2KJVA 4KO0B 2VZ9A 2CA9A 4NPOA 1P1TA 1XBWA 4M5KA 1NU4A 1NDKA 1S5ZA 3BS9A 3VGVA 3ZTQA 2CIMA 1BC6A 4FVCA 4TYBA 1Y7PA 3IBWA 3OHAA 3R27A 5L1IA 1SKRA 3CC2S 2EI5A 3O6QA 1UEKA 3D2WA 4Z37A 4A48A 2COLA 4E8UA 4A46A 1PAUB 1KR4A 4B3OB 3JS9A 1TMJA 3OFEA 4ZA1A 4WFYA 3W9IA 4Q8EA 2P9EA 3ILJA 2IAJA 1R89A 3KJQB 2ZJPQ 2MZJA 5KFZA 1VQ7S 3TX0A 4QWAA 1Q4RA 3NOGA 4LF5J 4DL0C 3F41A 4C8MA 3M2RA 1IBKJ 4LIRA 2WONA 4NLRA 5D6GA 1GXLA 2XMMA 2VDHA 2YH1A 2HVEA 4ZITA 1SIWB 4CLPA 1XR7A 3CJ5A 4U8YA 5KT4A 4TU9A 3BH7B 1N6QB 1JXLA 5KFEA 3DGPA 3MR2A 1HQUB 2UUAF 2IBKA 2BYCA 4OJHA 4EWTA 2W2OP 4NLPA 3VVTA 2MJUA 4ZVUB 1MNEA 1SVDA 4DN0A 4IDKA 4FYVB 4RBUA 4ZCMA 4TQSA 2XHWA 1FX2A 3V6KA 3I56S 3FK4A 3Q24A 1S1WB 5E41A 5IT9U 1WKJA 1LEOA 2FJWA 5L46A 2ATLA 1KFSA 2E5JA 2RF2A 1UW4A 2LFVA 3FZ2A 1OYEA 4P74A 1JX4A 1YITS 3VCDA 4ANEA 2OO4A 1OY8A 1BLUA 1HWLA 1TV6A 3M4XA 5D0EA 1S48A 4ZP9A 1HW8A 4CO3A 4C0BA 4C0OC 4RPFA 2W7AA 2VBYA 2ZBCA 3AQOA 3CCWA 2LP4A 3QFHA 1SQFA 2POKA 4EUVA 2ZH8A 5JVHQ 1K0VA 3O8WA 4CNZA 1XQIA 1UJ5A 4OL8A 3LQVA 5THWA 2KT3A 4DXLA 2J0SD 2HPUA 5GAGI 1R8CA 2ZNZA 3OTCA 2OTLS 4IOBA 1S76D 3A8KA 3W2VB 1HA1A 2QO3A 2ILYA 2RSQA 3CJQA 3MD1A 1U26A 4Y6IA 4YB5A 1PBUA 2V4JA 2WB1D 2MZTA 3T1YF 4FF4A 1U8WA 5I3PA 3B4DA 4I7FB 4HH1A 4C8NA 3PX0A 5D77A 1UPMB 3NBPB 1YIJS 4H4MA 4GMKA 3HHLC 3GIJA 2GJIA 2F65A 2CJYB 4OLOA 2CPFA 1NH8A 3NCRA 4DX7A 2V50A 3THVA 3GU0A 2A10A 4Q8FA 4MT1A 3JSMB 1F5BA 2VPZB 3QZ8A 4DL6A 1XC9A 2BJ3A 1DFDA 2M88A 2OGUA 3RTVA 2GVDA 1H2TZ 5C25A 3TW0A 4L75A 5HP1A 3T6BA 3DU6A 2JEJA 5K9FA 3T1HJ 1HR0J 1XJWB 2IJRA 3MUVP 1HNXF 4CH1A 4TN2A 2GMLA 1VQ8S 1VISA 1VHFA 1UETA 4LJMA 2GMHA 1RQ0A 1WSVA 5GAHU 1M0SA 3T5LA 2Y1LB 2DNPA 1YRXA 3SCIE 3VAIA 4DZ6A 3QAUA 3HZGA 2XLKA 4YHHF 3ZZUA 4ZPTR 4RW8B 1NHVA 2P6SA 3QRPA 4O4GA 2ZDOA 4RJVA 3EICA 1SL1A 2VL1A 3ZTPA 2MZQA 3HSDA 4URGA 2B5JA 1FK9B 3DM2B 3ZTOA 3UPFA 4F3QA 1M5OC 1VJWA 2FVRA 1Z4UA 2B7CB 2UXBJ 3PFEA 4EFAC 1YQHA 5LL6d 2AX1A 4D3GA 4J90A 1FE0A 4NLTA 1S0VA 1WNEA 1SUQB 3IGVA 4I6WA 1HBNB 3B54A 2MSTA 1J27A 3KLEB 1MROA 1U49A 4QWDA 2A0FB 3DRXA 2FHJA 2YPZA 4YP3A 2HFOA 2HFVA 2BABA 4Q5VA 1RT7B 2BJ9A 5H1SV 3OTOJ 3ISNC 3IM8A 1WTBA 2D41A 5BR8F 5K8PA 5KFNA 3TAPA 3P5TL 5B09A 2XLIA 2HHTA 4I0WA 1KVJA 3CCLS 1D9FA 2UUBJ 1I94F 4RLEA 2KH9A 3K5PA 5DM7Q 3K0JA 2VFUA 1NMEB 2A18A 3AA9A 3AXKA 2XYPB 3MAHA 1LW2A 4M5GA 1S6QA 1RADB 2B9EA 4U95A 3HSZA 3G6ES 4FS1A 4N41A 2ZUGA 4FNIA 1RP5A 2F9DA 4ZVHA 4ZIVA 4NI2B 4YMEA 1BQNA 3RW7A 1H7WA 2W2PP 3BKTA 1RT4B 4URQU 4QWBA 5KFOA 1RBOB 2B51A 2YPYA 5ETPA 4AQYJ 1N6QA 3C14B 3NAHA 3FEXB 3QGPA 2D3OR 1KNZA 1W26A 2E29A 4P7VA 3CDBA 3CIMA 3BQ2A 2AD9A 1S1UB 4ED0A 3GCXP 2UVWA 2AYMA 2YNHA 5B0FA 2GQ2A 3FBBA 3OUYA 1AXQA 1DARA 2DHHA 3U7JA 3PW5A 2OH2A 1YDLA 4KKOB 3MCOA 4TLRA 3UD4P 1W2BR 4BWJA 3L4BC 4OHVA 5HATA 5A8WA 3KK3A 2GJFA 3D1OA 5DDQC 3SMZA 4EGLA 4A8SA 4UZBA 2CQGA 3HVTA 4RUCA 2R3VA 3MM5B 4UF4A 3IO1A 4CO0A 2DGVA 1HNWJ 5ETSA 4F02A 5KFRA 1V3ZA 4NOHA 4LIWA 1Q81T 4LFBF 1QE1B 3IR7B 4DR5F 3DOKA 1RT1A 2BUNA 4E98A 2K3KA 3PJWA 3HMJG 4AFFA 2B6AB 3BSOA 4DX6A 1NB2A 2JH3A 4QCLA 1QUPA 5KFCA 2KL8A 1RXOB 2MMYA 3HSJA 4Y28C 5F8GA 1WD6A 1WEZA 2XQCA 2ZDPA 2DXFA 1Y3JA 3DN9A 1QJHA 1VIOA 4OYBA 1VLYA 4K4TA 1TL1A 1QAYA 1YSJA 3CT9A 1X8DA 2V8HA 4RWWA 5K5MA 4FS2A 4X4OA 3EXCX 3I5CA 4ZVSB 3SSQA 1EZZB 1N52B 4MFBA 2VODA 1EQ0A 1X4HA 2F3JA 5LMUF 4C7QA 1M5SA 4DL5A 5ETVA 3CIZA 5JMNA 1YBUA 1YTYA 4B3TJ 1NM2A 3KLGB 2HVIA 3DDNA 4O4RA 3OLAA 2JEFA 2F4FA 4A8YA 1CJKA 3NRBA 5IC6B 4LF1A 1VRTB 4X4UA 2MGZA 1ZAWA 3FNNA 3O5TB 4ER8A 4N76A 5ETQA 2W2MP 4K4SA 1DLOA 1VDHA 1UZDA 4L73A 1LNQA 3TUIC 4RUHA 2CJAA 1G7CB 2XHCA 1T3NA 1ZA1B 4ZS6A 4F2SA 4DR1J 1YJ7A 5J1EA 4Y2MA 2G2OA 3CJ0A 2K2PA 2YKAA 3WX4A 4X84A 3M9OB 1R8PA 2DGWA 2WHOA 3JSMA 3H5YA 2ASLA 5D4NA 1C1BA 3CD6S 4ATNA 3ITHB 4Q44A 1EP4B 1VQPS 2PEBA 3RB3A 2H3EB 3WDOA 3MM9B 4DU8A 4DL7A 1FJGF 3KLFB 2N3LA 3RAQA 1FFGB 2SXLA 4AE5A 2FJEB 1QSLA 2QFJA 1ZTWA 2CJXB 2L9WA 4JI6F 1X9MA 2DPIA 2XZTB 4RW6A 5L1JA 3TO8A 4M94A 1E6VA 1JLBB 4CLTA 3CC7S 1B4SA 2GV1A 2VG6A 2FLNA 4DR4F 3QO9A 4F4ZA 3GQCA 1ICEB 1OSCA 2PMWA 3V81B 4JI0F 2XMJA 4QWCA 2HNZA 1J2VA 2MHNA 4OX6A 1C1CB 3RBEA 2CQDA 1WJ9A 2DH9A 2PI5A 3CDUA 2DRAA 5DQHA 1S0OA 1T05A 2QMXA 2G1HA 1S79A 4X4NA 2CZ4A 4H4OA 4ZVPB 1RA7A 3MMCA 3H98A 2Y1IA 1TFYA 3POTA 4G3IA 2HBZB 1B70B 2R7VA 1KLNA 1B64A 4ELVA 3MWBA 4CO1A 2R8HA 1TKZA 4JV5J 2ZH9A 2CQIA 1IM4A 3IAS9 2NYIA 4MK7A 1SQGA 3UNYA 3GIIA 2G2ZA 4KJIA 3LP0A 4DV1J 1S1VA 2ADCA 2ZE2B 3MOJB 4HACA 1NK9A 5LSLA 2UU9F 1RHRB 4F0KA 3TYTA 1RI7A 5GMEA 5A2QY 4K0KJ 1EX8A 3TANA 1QAXA 3HVWA 2UUBF 3I4PA 4UUWA 1KLMB 4C11A 1LXJA 2MKYA 1S1XA 2AMCB 1VBYA 1F5AA 1HBOA 1UP1A 4CWBA 5A8RB 1FI4A 1IKWB 1MWZA 1SQEA 2ZOGA 3ZZRA 2MQOA 3BJYA 1XMQF 1TKZB 1YWXA 1UA1A 3LWMA 2VKZG 3EZOA 4NI2A 1RBLA 2KN4A 2PGCA 5KFPA 4EBEA 2Y8WA 1JJ4A 3DOKB 1CLFA 1RHQB 1XEZA 1HWUA 2HMIB 1JLCA 3S1TA 5ETTA 3HFVA 5IS2A 2ZH2A 1RLDA 5CCLA 4DR6J 1XERA 3R3TA 2QL9B 4LQ9A 1FDNA 4FN5A 4K4XA 3N6LA 4NCBA 3NGRA 2YH0A 1P27B 1NLKL 1JLQA 1SI9A 2F7VA 3A3NB 3D1QA 1GXTA 5A8WB 5HVGA 3D4JA 2R7RA 2AJ0A 3T1YJ 3IM9A 2WRMA 4R0JA 5L1KA 1X0FA 3HD1A 3ELHA 1RAFB 5L9XA 3VAFA 4OMFG 3ZZYA 2PI4A 4PZVA 2IDLA 2UV8A 2BXJA 3FQLA 3MEGA 2XY6A 1FEHA 2ALYB 1KD1T 1IJEB 1N5VA 2YWEA 4EI2A 2HQFA 2J9CA 3EDRB 2HK2A 2LXFA 4Y2KA 2XGPA 3EVWA 3DRRA 1NKCA 3Q8YA 4AL6A 3DLEB 2L3MA 2W8LA 3D6TB 1LV5A 4JB8B 4YDDB 3J81U 4ERDA 3OXLA 4MK8A 4F25A 4N8NA 5T7LB 3H20A 2J8AA 2JZ5A 4DV3F 4IRKA 3CTRA 3GV7B 4ES2A 1NJYA 2KT2A 3H5UA 4E0DA 3OL7A 5HK4A 1RHKB 4DBQA 2OPQB 1TAUA 3CWJA 4NLOA 3ZC4A 2AJ1A 2ZM6F 3FGVA 2CQ3A 1FXRA 2QTWA 4DWIA 1KN6A 2HHPA 5AXNA 1IUJA 3R9LA 3R1LA 3NXZA 2KU7A 3QT8A 4RW4B 1TL7A 1HQUA 4RX6A 5EWFA 1U25A 2JC0A 3DLEA 3Q86A 4KH1B 4ICLA 1WC6A 3PJ9A 3W8PA 4J91A 5GAGU 1FJEB 3VGSA 3ITHA 4OIXA 3MMBB 5IV4A 3R7SB 2A6MA 3AOBA 4MH8A 5C42B 3SBMA 2RRAA 1NPRA 1DAXA 1PYOB 4OYXA 2L08A 5GAHI 2GHVC 4RNMA 1VRQC 3SIPB 5AXKA 3SQGA 3M32B 3WIVA 3ADAC 1CS4A 3JB9k 2YKMA 2C28A 1UWBB 1Y9OA 1ZAXA 1F9HA 3KUHA 5DDPC 2HAFA 4K5SA 4B3TF 1P8GA 4HTJA 1GMUA 2P5VA 3DGPB 4LF5F 2CPZA 5F0WA 2GNKA 3M8ZA 1T8EA 1A9NB 1YGYA 1KQSR 3GFYA 3GG0A 4WU3A 1FESA 1UMJA 1AUSL 1LQ9A 3GJRB 1RT3A 3Q2SC 2W7PA 3FSYA 1TUGB 3G2XA 4Q0BB 1KVKA 1WC4A 3DYAB 5U47A 2E1MC 1TKTA 2A2DA 1TV6B 1LK7A 5CAAA 2LQ8A 2OFHX 1Q8LA 1KVIA 4J9MA 4DSJA 4X66J 4JYAF 1VLOA 5IM0A 1Q86T 4LMZA 1WF1A 1RTDB 2QE5A 4JBCA 2KJWA 4DUYF 1ZPWX 4OZ1A 1X7VA 1GX5A 4Y0FA 4YY3F 3KHGA 2MQ8A 2H54B 2XYHB 2Q1LA 2EPIA 1FVQA 2RILA 2G2YA 2JEGA 3NKYA 4R5PA 5J2QA 3OFFA 2R7UA 2M70A 4HEA9 1U4BA 1RT3B 5H9EK 2BEFA 5T14A 4ZPDA 1HD0A 3D68A 3Q0AA 3T19A 4DSKA 1HBOB 1RB0A 1U7LA 3LGHA 1SC1B 2UVUA 1RT2B 2APOA 1F60B 1U0SA 2FLOA 1SBRA 3UI3A 3OBIA 2Z56B 1WOSA 4O3OA 4JYAJ 3NBPA 1RWNB 1VQMS 2CWXA 2DNRA 5D4LA 5ITHA 5HJXA 1QDUB 1V5IB 2D69A 2YKPA 3CE8A 3C8YA 3EVMA 3HD2A 4RW8A 1WHYA 3AB2B 4FKYA 1HQ2A 3MF5A 3O3LA 4ZOSA 2KRRA 1RHUB 2QYGA 3A12A 3GG1A 1T03B 4L3NA 3MAAB 3TA0A 3TUJC 1U47A 2CJKA 2I2YA 3K7RA 3UWTA 3L3CA 1U1NA 3PYEA 2F40A 4H4KA 5B0GA 3PYDA 3MMAB 1FDDA 2UZAA 3N6MA 4M5LA 5J1NA 3W7BA 2UU9J 3C6TA 4O23A 3I9ZA 4CLKA 4KIAA 4LFAJ 2C3YA 4LVOP 3SYZA 2DD8S 3GE9A 3JXOA 2D9PA 1SKSA 1J5OA 4KO0A 1WG1A 2AJ4A 2JFKA 3AQPA 3LTOA 3S01A 3VAMA 4P6QA 2C2DA 3B8HA 1S97A 4J9OA 1JJ2R 1FTRA 2QRRA 2A1BA 2GHPA 4ECQA 4P9SA 2WZ1A 3EGVA 1C2PA 2C3UA 5KOWA 4ED3A 2YNFB 1NAQA 2HVHA 2E5GA 3V4MA 2JC1A 1S12A 2C2ZB 2ZOFA 2DXDA 3HHLD 3L09A 4M1KA 4HL9A 3JTOA 4NZ0A 3TQEA 4FYWB 1Q0NA 1U6ZA 5C7PA 1N88A 1TK5A 3RZAA 1BQXA 1FF2A 1BUXA 2NXUA 3NS6A 1TU0B 1S49A 2YBVA 4A8OA 2RJZA 1X4GA 3IR5B 1O51A 4ED6A 1IBLF 5KFBA 1Q8BA 4CO2A 2DO4A 3PKYA 1P9YA 1HKAA 2MKCA 2XULA 5HN0A 3GIRA 1SL0A 3T6JA 3H7HB 1DTQA 3ILOA 2MSSA 3PY8A 4Q7AA 2IVMA 1RTJB 1K0TA 2PIIA 1KDNA 1Q95G 2KI2A 2WVBA 5GADU 2AIRB 2EXUA 2WVEA 1WI8A 1HI8A 1NJWA 1N33F 3JQKA 1LK5A 4FYXB 4QYRA 2OLWA 1TKXB 1IBMJ 2CDRB 3ETOA 1M1HA 3SQGB 3PR4A 4C48A 3OXFA 1M1KT 5KOXA 3DLBA 3MDFA 2VQFF 3LGMA 4JUZA 2ZZMA 1FD8A 3TR5A 3QJPA 1RE1B 1FKPA 2LXUA 5A2QU 2H5IB 2MKHA 3ZZOA 2BW7A 4AUKA 2HRYA 2XC9A 4ES1A 1LWFB 4F2RA 2VPWB 5HI7A 2EBGA 1RAJA 2HNYB 1E6YB 2AHOB 2XZWA 2E44A 3MR7A 2QV6A 4Z7CA 5IT4A 1P9QC 1RZMA 5GAEI 3P4UB 4CTAB 3OUYB 1L3SA 1WOPA 2ZH4A 4M63A 2V67A 1RA6A 2AEFA 4LT6A 2HG4A 1T3OA 2VHGA 1WUUA 2DIVA 4KHRA 3LP2B 1WELA 4WBFA 2OFGX 3ISND 3UVJA 1D0EA 3EUNA 2OD6A 3P5BP 4DF8A 2IHR1 1YBAA 2HS4A 3UQSA 2ASJA 1X9WA 1RWKB 4WXOA 3RJMB 1DRZA 4NASA 1RTIA 2FY8A 2FZGB 1D09B 4HR2A 5E3QA 3ZZZA 4A8QA 3B6BA 2JVRA 3T1HF 1HR0F 1D1UA 1TL4A 5KFGA 3A8JA 4QQBA 1B7YB 2NYHA 1VK8A 3GFXA 4JV1A 5D4OA 4LF8J 5B0EA 3M1VA 2RB7A 4Q0BA 1WC5A 3RAMA 4KTQA 2HEKA 4NLYA 4C8ZA 4O3SA 1RK8A 1A7GE 2GX8A 4ECVA 1QAIA 1CSJA 1T0TV 2IFXA 4Y65A 2VG7A 5K14B 4DPYA 2ZH6A 3PV8A 1PGZA 4USKA 4UOGA 4BHQA 1FXLA 3G6VA 4KHPJ 1RTDA 1YJNS 4IRDA 3I87A 4X65F 2XI2A 1QVFR 2G4BA 3PVXA 3EYZA 5EGYA 1X4DA 3HCXA 4YR2A 3DMJA 2B8QA 3H5SA 2H48B 3BKUA 3LPYA 5GMKa 4Y3CA 3RUBL 3GILA 1T7PA 4B9VA 2FVCA 4K4UA 3MFHA 1CULA 5IOLA 2HFNA 2BJEA 4JI8J 2AF6A 1YI2S 4DR7F 1R7IA 2QG9B 1H3DA 2AX0A 5KG2A 4O3NA 2UP1A 3TAMA 3QRRA 1LW0A 1F6TA 5B0BA 1KTQA 3FFIA 1XTZA 4FVMA 4WP9A 1OSDA 4B9UA 3MR5A 5DQIA 2HQGA 2U2FA 4PEOA 3K8VA 3L9ZA 4PYAA 1JIHA 4YY3J 1V9OA 2CPYA 1VQ6S 4OHYA 2QJ3A 2AYGA 3MM6B 1G3OA 3V5RA 3ENWA 4OYMA 3M8QB 3MPYA 3HDSA 3CCVS 1MSWD 1HBMA 3BSCA 3FSIA 3PHTA 4N8OA 3W66A 3W9HA 5KFJA 1HI0P 1RWWB 2VA2A 1EETA 1BQNB 1NUEA 3CCUS 2F8EX 1WHVA 1PJ6A 3VR1A 1GXUA 1CJUA 4OI3A 2A2CA 2OPPA 1KHWA 4ZDNA 3VGUA 1FNXH 4LFCF 2IY5B 2AV5A 2DNNA 2RDIA 1EARA 4MAKA 3HFKA 3R5GA 4M5DA 3D5MA 5KFKA 3K5NA 5HMZA 2F5GA 2HS0A 4OZ0A 4QIVA 2XMVA 2HNDA 2GQQA 2ZNYA 5IC4B 4F8RA 1CBKA 1FD2A 2V94A 3AODA 4DLEA 1C4CA 1UVKA 4OYZA 3KHLA 2PA3A 3M8PA 2R2UA 3BEGB 1HYSA 1WDDA 4DHVA 3V2UC 4GC6A 2FJXA 1XMOJ 4MIAA 3LPEA 4LFBJ 2V4RA 2HGNA 4LF6J 1AYEA 3I4HX 1TTHB 3FMBA 2PDAA 4KYZA 2AJ2A 2O5DA 4X4SA 1K9MT 1IVZA 2MDAA 5F8LA 1N0UA 1YG0A 3CCMS 3AFGA 1X9SA 2AWZA 2MTLA 4YFUA 3M05A 4GRSA 5KTQA 4NLQA 3M2VA 1EKRA 2R42A 2L41A 3K8WA 3T3FA 5F8JA 1FRKA 1VOMA 2BJ8A 4DV7F 3C66A 1PYSB 3R5JB 4MJKA 3GZ7A 3JAMU 5D0GA 4JI3F 4PG6A 4XAKA 2RT3A 4QR0A 4PWDB 2H5EA 1DURA 1YJVA 1DTQB 2XSFA 3EWGA 3VF0B 3KLVA 3FBEA 3W65A 4CI0B 2F4VJ 4ECYA 1ZAVA 4CYUA 1F5CA 1TUWA 3TZWA 4QYZK 3QIPA 1KP6A 4USHA 5CD4A 3CB4A 2C2KB 1NJXA 3SCJE 5DLGA 3QGHA 4LSNB 4A8XA 4IO9Q 5DZ6A 3QJJA 4NLWA 3M2VB 5CCMA 3G8QA 2BW2A 7AT1B 3PHEA 1I51B 3GCWP 3CJKB 4TYAA 2ZC3A 4DQQA 1HQEB 4NCGB 1H6KX 1OS5A 2P9CA 2J8SA 4KT0C 4NL5A 2DO0A 4Z7YA 4MFBB 2MQMA 3OL8A 3HVRA 1LXNA 3US5A 5LXRA 4OYWA 4BWMA 2NPFA 4P7TA 3PM9A 4IYQA 4FXDA 2VDIA 1AFJA 4NMLA 1REVB 2E5LF 3A4TA 4ANDA 1SJ3P 3Q8QB 3ET6B 1B0TA 3GYNA 2AZ1A 2X3GA 5F3TA 4U6PA 3NS5A 3GV5B 2BM0A 2R7TA 3KLFA 4ELTA 1IM6A 2R9LA 4DPTA 4MKAA 4DV6J 5KFUA 4KFBB 4PUOB 5BJRA 2FVPA 4KPYA 1GK8A 3SZ2A 4LQ3A 4MKBA 5IV3A 3CDAA 3U1NA 4RW6B 3SFGA 3M8WA 3HJVA 4F3MA 7FDRA 4AT1B 1VIXA 1ROFA 1YZ6A 2DY1A 4DL3A 3OVBA 2JWNA 2OMLA 5KFIA 3M8RA 2KXHA 4PR6A 5EWEA 4B9TA 4QIWD 5BR8J 4K50A 4K0KF 2VICA 2GQCA 3G82B 4RUBA 2JOQA 5HQ8A 2UXCJ 4YR3A 1C1BB 4DCJB 5HJYA 3P8BB 4WFAQ 3FEYB 1VJQA 1G2EA 1T05B 2VOPA 3CSKA 2W4CA 3IA0A 1S1WA 1HWIA 5A6PA 4HYKA 1SKWA 1NZAA 5A8KB 3R2DJ 2K3IA 2LA4A 3AB4B 3M32A 3OTBA 1S6UA 2HBRB 4TLQA 3VHQA 2YVSA 2NZ4A 4FDFA 4DQIA 2KO1A 1VQ5S 4OI6A 3FQKA 2HQIA 4HTIA 4KV8A 1GMWA 1WKLA 2P2CB 2ZBQA 3DHXA 2LDYA 2ZWOA 5MLCV 3KMQA 5D78A 4B9MA 3ZZ0A 2Y1RI 3GP9A 5D3GB 1PC4A 4FYYB 2EG2A 1QVGR 5CQGA 4CCHA 4DDFA 4EO8A 4WXWA 5LSOA 4KR0B 1HMVB 3C2PA 5DO2A 1N32F 2K8GA 1FNMA 3RGIA 3R5BA 1IQZA 3T9ZA 3MFIA 4K5RA 2C3MA 3DYAA 5CH7B 2LMIA 2V63A 3M8QA 2DGSA 4LR8A 5JUMA 3EVOA 2Q66A 2C2MB 2VFVA 2PSZA 2VJVA 1LKZA 4P52A 3JQJA 4OI2A 1BE4A 5A76A 4YS2A 3TUZC 2CUYA 3HXMA 3BYRA 2DRBA 1CJUB 3DOLA 2WW4A 1RHMB 3I82A 5HQMA 4I68A 1FJCA 3FVYA 3TZXA 3LF0A 2QLXA 3HLUA 2CQ1A 2FUG9 2RMLA 4FP9A 4DV0F 1NJZA 1ZZNA 1LFPA 4HI1A 3OXGA 3IC1A 2Z0GA 3DCAA 3SDEB 2VPXB 5LOQA 4RU9A 4JOUA 4DFMA 4A8FA 2E9ZA 4W92B 3GONA 4JI4J 3FCWA 3GR1A 2CNLB 4USVA 3N0VA 2OD4A 2YX4A 2XGQA 5KFLA 1O8BA 5LMNF 2OSQA 3AOAA 2NUHA 1WC1A 5CHCB 3AOCA 3DKDA 3ZNJ1 2X1AA 2ZC4A 1RT7A 2HHQA 2F8HA 2Q43A 4IFVA 2CNKB 3QT5A 1S1UA 4DR2J 2E1PA 3T41A 2G0IA 2X7IA 1U0HA 4CH7A 1FK9A 2YNIB 1KS2A 5ETLA 3RU0A 4X4QA 1TL3A 1VC5A 4DV7J 2DEJA 1T9WA 3CCQS 3CD5A 3BM7A 3GJTB 2M0GB 3BGOP 8ATCB 2XCPA 3D0HE 2RS8A 2VG5A 4C6AA 3C15B 1URNA 3JSRA 1RWUA 4IKAA 4O3RA 2IYGA 1ZPVA 4XPCA 5IXUA 2IM3A 4DJBA 4DR3F 4B17A 1HNVA 2Y1JA 2UVRA 4GKJF 4YN3B 5DQGA 2DKOB 1R27B 4FNHA 1SV5B 3RRGA 1PC5A 2DNHA 4L74A 4K4VA 1FEEA 2LQ9A 2DCUB 1IKXA 2VPYB 4S0MA 5D4PA 4ZN1A 4X62F 2ALZA 4B9NA 1NKBA 1FJGJ 3HHLB 1VI7A 3CUNA 3ISZA 3UDVA 1RAHB 2YX7A 3I5BA 3VGTA 4LF9J 1M90T 2KFNA 3N28A 4DCPB 3DHWC 1HNIA 1VQYA 3CF5Q 2LU2A 3TEHB 4E2FB 3AD8C 4GVBB 2FHKA 3HHEA 4OYAA 4QW9A 4D3HA 3BQ1A 4PPZA 3HHNB 1TP7A 3AT1B 4H54A 2W25A 4QWEA 3DRSB 2OEKA 2CQHA 2CQ2A 2EK6A 3OR1A 4DFKA 3EPIA 1ZM9A 4C8YA 1FWPA 4DR7J 1GTEA 4K7QA 4MTPA 1N34J 3VQTA 2GAHC 3RR8A 4KBIA 1WDTA 1FJ7A 1Y11A 1N5QA 2QSFA 1V3RA 3BGRB 1WOOA 1VRUB 2AW0A 1EKSA 1LWFA 1CQMA 2CPIA 3K5MA 2NPIA 1CS4B 2JX2A 3UO0A 3CJSA 3W2WB 3HHKA 3DI6A 2DHGA 3DRSA 4CLSA 5IM0B 3MURP 2N4DA 4FYDA 5C2GA 5IT9Y 1JKHA 1S77D 2E5HA 4U7UD 5D0HA 4LRFA 3W63A 2HSEB 4JI7J 4P10A 3EGWB 1RT5A 5EX0A 2OUGA 2HKEA 3MM9A 4YQWA 1W7WA 2I38A 5G0RB 1RLCL 1WG4A 1RAAB 4F04B 1CJVA 2WVCA 2RF2B 1IR2A 1FRJA 2RQ4A 2Y3YA 2XB2D 3NMRA 4UOFA 2XMUA 2M5YA 2XY5A 4KAIA 3ICLA 1ZS6A 2VQEF 1IKVA 2QX0A 3I32A 3DLKB 1N5YA 4HH0A 4UT4A 4EO6A 4CM0A 1HW9A 4EU0A 4NRUA 4C9DA 4ANCA 1FFSB 1S10A 2B4PA 5J2NA 1YX2A 3FBCA 2DGXA 2XMWA 4RW7B 2G0CA 4PXCA 3NGUA 2DR7A 2FHMA 1NJIT 3H2VE 3MAAA 4M5NA 2MGZB 1YLXA 1WORA 1CJTB 1D3WA 2V2KA 1I5OB 3CJ8A 4I2PA 2PMHA 4TKTA 4RBTA 4OHXA 1HARA 1RTHB 5AT1B 3AHPA 3DC2A 5F9NA 2RQCA 4NLVA 4CRJA 2CPDA 5AE1A 1SH3A 1H0HB 4PQUA 2JFDA 2Q6CA 4CLFA 1RU1A 3HKWA 2VC1A 2ASDA 4RL1A 3KJVA 3M1VB 5F41A 5F3ZA 5J2NB 4A8KA 2EK1A 2V6AA 1VQ9S 1Q7YT 3IG1B 4B02A 1C0UB 2J6UA 3QRQA 1RAOA 1T03A 3IWLA 3NWRA 4BS2A 4BBYA 2VASA 5L1LA 4WKYA 3Q89A 6AT1B 4QU6A 3MUMP 2RD5C 4I2PB 4LBHA 2DGTA 1Q5YA 3UN5A 4QPXA 1RAGB 3BPSP 3HM9A 3HJFA 4CDIA 3Q8UA 1S6PA 5EN1A 3DRPA 1HNZJ 1RWVB 4F67A 2GW8A 3F73A 2MKSA 1ITPA 1M5HA 2LQJA 5LMNJ 3VAGA 3HT3A 2ZM6J 1NK6A 2DPJA 2E7VA 4RO0A 1MU2B 5A0YB 1PJ5A 3BR8A 4CM2A 3C6UB 1RUSA 2DNGA 4N7TA 4U7UK 4WCEQ 5DJBA 1KRPA 1J5OB 2FHJD 2XMKA 4DEZA 4IQXA 2DJWA 1U2CA 1NK8A 2GO9A 1HWJA 5LT5A 5LSRA 1JLEB 5B08A 1PYTA 4WKRA 1XNRF 8AT1B 2KG0A 1S1XB 1Q53A 2OPPB 5HL7Q 4ZHRB 1Q8KA 3GMGA 4WTYA 4B3SJ 3C15A 4WIIA 1LWEA 2E1CA 2U1AA 4J9RA 3PO5A 1RAIB 5KFHA 2CPEA 2FDNA 2PO4A 2XG8A 3MCMA 3MD3A 2HRUA 1U02A 2QA2A 3A8IA 4B3RJ 3LALA 1SCJB 2BANB 2C1EB 1Q7LB 1U45A 4PG8A 2J5AA 2BKOA 2Z58B 1B0PA 3PJXA 3W8GA 3DLGB 2AP6A 3AY0A 2R7QA 2HHHJ 3BDPA 3HFZB 2QA1A 3DLJA 1HYSB 4I6AA 3HHLA 1K47A 3ILLA 1JLEA 3MI7X 3EMTA 1JJHA 3KLIA 1WACA 1JLAA 2GGPB 2QLFB 4NLDA 3E2EA 5CABA 1JLQB 3C16A 3D6HB 2EEYA 3BPDA 1R8BA 1Q8IA 3HP6A 2AKWB 2Z2MA 4ECTA 4EZ9A 1AT1B 4DUTA 3CMES 4N56A 4IR1A 4UY8T 2LEPA 2VFTA 1RTIB 1QD1A 2FC8A 1ZBTA 1XMQJ 3T5KA 3Q8RB 1QTMA 2V8PA 1CVJA 4PCQA 4LSLB 3BO3A 4JI3J 3D3CJ 4KGZB 1YK9A 1XMOF 3UE2A 3TZZA 3D0IE 1RYRA 1IJFB 4IH6A 3X3UA 1Y0HA 2AGOA 4ED5A 1HHTP 4CQ1A 2FY1A 3LP2A 2K7KA 3UVJB 4DX5A 3PKMA 3HVTB 4ZJQA 4K8RA 4CLUA 2ZJQQ 3LP1A 1N34F 2Y0BB 4W90B 1UPPA 3MCSA 1J5EF 2RQMA 2PFDA 2DNKA 4HHJA 2FJBB 3GWCA 5KG3A 3CCZA 1HFEL 1MW7A 2WVDA 2H65B 4CO5A 1DQ8A 3MPVA 2W9CB 2L9NA 4EYIB 1NB7A 4PXEA 1RT5B 5M2PA 4DV0J 3G9CA 1PSDA 3N9UC 1U2RA 5C25B 4RBVA 1S9EB 4O44B 2ZITA 3G6XA 4B9SA 3PIPQ 2IRXA 2V68A 1RTHA 4R8UA 2XEXA 5I3QA 1S59A 5KT6A 3R6GB 3RB4A 5DLFA 3IBCB 2Y9HA 4CLWA 4RNNA 3EJMA 4N5SA 4C97A 4GO5X 2R2RA 4DG1A 3M30B 4HT7A 1UFWA 2W9BA 2G13A 9RUBA 2RU9A 3ETMA 5KG5A 3OSPA 3TQ1A 1VQNS 3KJVB 2XBPA 2GVZA 1NXIA 3AJDA 3FZBA 3R5DA 3RB6A 3HO1A 2C42A 4I6YA 4XTTA 2KFZA 3WBZA 4HDHA 1KQGB 3CDEA 3NAIA 5KFWA 2CJBA 2WVFA 2KG1A 3MM8B 3QGGA 2RKIA 2MQLA 3SI8A 2NXJA 2NQPA 1N36F 1EQMA 1H74A 3SQOP 3VAKA 1B7FA 1Q79A 1VQKS 4OQJA 2BKPA 2IA0A 4JV2A 3HKZD 3T5JA 4KFBA 4PUOA 2CQCA 3DRPB 2KRBA 3MR3A 4ZCKA 1NDCA 3G8TA 1PBAA 2J7KA 4U8VA 4N77A 4OZ5A 2DHSA 4P2XA 3AJ1A 4WYLA 4I2QB 1S1TB 3LAKA 3A8EA 1SJ4P 3I6PA 1NK7A 2BMBA 5DG7A 2XZDB 1CG2A 2XSJA 4QIGA 3HZEA 4X62J 2M9KA 3GIMA 4DV5J 5K20B 3IBFB 2AU0A 3M8YA 2WSFC 2MLZA 3P96A 4WPAA 3VVUA 3J7ZT 2J76E 2HIQA 4F0HA 3KK1A 1VQOS 2ZKUA 3H0PA 2BDPA 1HMVA 4RR5A 4RW9B 4DSIA 2VUGA 3KLEA 1PILA 5FD1A 1E6VB 4UY85 2NSBA 4NCAA 3QJLA 1R3NA 2VG6B 1CEZA 2V8DA 4L76A 4ED4A 5E3PA 3I55S 4F4AA 4ZVEA 4AL5A 1KTVA 3EE3A 3R8YA 2ZBRA 1FWLA 2V2QA 2J7WA 2B7BB 2QZ8A 3FBFA 4YHHJ 4F7VA 1FE4A 4HDGA 4QPTA 5HVFA 3QGIA 4ED8A 1FRMA 3VWSA 4YUDA 1AZSB 1VR6A 4ZIWA 3PX6A 1JWWA 2R2SA 4OHZA 3CULA 2AEJA 1Y00A 2OJ3A 1W25A 4WYWA 2JLEA 1RT2A 3KK3B 1H98A 1HHQA 2AJFE 2BRLA 2B3TB 2EG1A 2DR6A 1OY9A 2RDDA 3GSDA 2E5IA 3JSYA 4RNHA 5E7OB 3H40A 3HX9A 2IC3B 3JYTA 3D3BJ 1G1XA 4KGVB 3SDEA 3WQPA 2C2RA 2BBEA 1X4CA 2OAUA 5CYQB 2MY8A 3G86A 1VBZA 4DV3J 5JVGQ 3O44A 1F2HA 2V8GA 3NG8A 4ZVTB 3OFGA 5IZHA 1N5TA 4NCGA 3NWGA 1OO0B 1WC0A 1C0TA 4MKVA 4TY8B 1JLGA 2PMZD 2I6WA 3TRGA 1HPZA 1WEXA 3QLHB 4B3RF 3LAMA 4CT9A 3M6UA 2UVVA 2X3DA 4TY9A 3SEOA 4C4WA 3LOUA 1GAOA 2QYCA 2DBBA 3KDOA 1WG5A 2CZVC 4XO0A 3V6DB 2YNIA 1MWYA 2CKWA 3QQCD 4OJ1A 3J81Y 4KHPF 2D9OA 3TAQA 2P8IA 4MYUA 2BZ2A 1DZ5A 1LFWA 2CYYA 1I1GA 1JLCB 2C3OA 3DRYA 3L7UA 3SSRA 4WZQA 1UKUA 2Z30B 2F1FA 5FIIA 4K2JA 3FRZA 1VCTA 4N47A 3TWZA 3UD3P 3C19A 2V0NA 3N5FA 3ENVA 4WK3A 1S9GA 4DUZJ 4X64F 4OYOA 1M5VC 1N54B 2NXCA 4HT5A 1JLFA 5HO4A 2VJUA 4AYBD 2RU3A 1GQEA 3HVAA 4KH0B 1SJQA 3A13A 4C3KA 2PA8D 3H8YA 3LW5C 2OP5A 5EUHA 1ULRA 2ZH3A 4DLGA 5IT0A 1TL5A 2H4WB 3IRWP 4DMZA 4CH0S 4C8LA 2MLXA 2KKHA 1E6YA 5KG6A 2XWYA 1SC4B 4JV0A 5C24A 4ID5B 3PEJA 3TI0A 1VC0A 4HVZA 1NRKA 1QY7A 2M52A 2LKZA 1TELA 2A3JA 3W9JA 3UW1A 1K44A 2ACYA 2IBOA 1WKKA 1XNQJ 2IRUA 2OTJS 3M9NB 2HLUA 1CQNA 2BOAA 3CDWA 4JP8A 4M95A 5D3GA 2ZHOA 2CJQA 5GAEU 4OZ3A 1KEKA 3U1MA 4QYZJ 3M6WA 4ZLNA 2BE2B 3HF5A 3M6VA 1FKPB 3W2WA 2RH3A 2KZMA 2NXNA 1D8ZA 1HLWA 3HHDA 4ETZA 4WFNQ 4GC7A 3MECB 3Q8PB 4A4JA 2V4JB 2HNZB 2K1RA 4ID5A 3MMJA 2CPHA 2CG8A 3CO9A 4EEYA 1TK0A 3MPWA 4P2SA 3UCZP 3MMBA 2R8GA 4FXVA 4OYIA 3R7BB 3J7YI 4J9KA 2CNNB 2YNGB 3JTPA 2DK2A 2ZH7A 5HBMA 2IM1A 3TAMB 4PWUA 3RBZA 2BKNA 4RU2A 4LF4J 3KK1B 3MXHP 2WB4A 5KFTA 4IOAQ 2OPRB 2IVYA 5K8NA 2RQKA 1A0OB 2QL7B 4ZVOB 2I5JB 3ENAA 2BJ7A 3H5XA 2Q6BA 1AFIA 3K2YA 4LBPA 3JTNA 1REGX 3QO9B 3THPA 4OI4A 2RDJA 1JKHB 5JXSA 2XYGB 3PFOA 2ZE2A 2XSJB 4JI6J 3T1AA 2K1RB 3GFZA 3KLHA 3GR0A 1K8AT 1DBDA 2FJVA 1HBMB 1T94A 2CVIA 2CADA 3CNQP 3D1HA 4LSZB 4URSA 2GCFA 4OZNA 1CULB 1GX6A 1EETB 2J6TA 4H4MB 1KLMA 4C11B 1L3VA 1UVMA 1FX4A 2KZZA 3VV2B 4LFAF 5CD4H 4OYPA 2WBMA 3UDCA 1UJ4A 4YOEA 4IFVB 4PG4A 4IUFA 5I3UA 4PQUB 2J9EA 4F26A 2EFOA 4ZJOA 3I9V9 4FBUA 1QUVA 1DY3A 1TMMA 1BQMB 3WIUA 4PPDA 4LR7A 5ETOA 3IS9B 3OR2B 4Q2LA 2XMAA 2BR0A 1HL6A 8RUCA 5L38A 2E9RX 3BZQA 3E51A 3VZIA 1MROB 1Q5VA 3BO4A 4DV4F 1Y5IB 4TXSA 4WZMA 3MAQA 5J2PA 2FGOA 3PTWA 5ADZA 2KM8C 4IG3B 4IQMA 2IPOB 2C3PA 5A8RA 1RWMB 1WEYA 3UNGC 1IKXB 3R7NB 4K59A 4J9NA 2HHSA 5IWAJ 2MY7A 4QJVA 1R6YA 5CYQA 3BV8A 3KUGA 3MM6A 5ETKA 1JXVA 2ROPA 2QSWA 4XDCA 5KFDA 3ENQA 1SUQA 1HNWF 5HLFB 4ILRA 3IG1A 1KFDA 2I0XA 2HRTA 3M8PB 2D3ZA 2NUUG 4R25A 3TA1A 3KNAA 4QU7A 2FPHX 3MZIA 1MMDA 5BYQA 2JRSA 2YKOA 4BDPA 3GLJA 5M2UA 1PAEX 1Q1KA 1S57A 2LYVA 3DXBA 1X4AA 5DDRC 2B9WA 3NEKA 4ZCIA 3CCJS 1U1MA 3QMQA 1RYSA 2DNMA 1T95A 2RS2A 1BGXT 4BC9A 5F0UA 3IAM9 1FNOA 1CC8A 2K7JA 1JXEA 5LXYA 5F8MA 2FC9A 4UZCA 3OFHA 1M5PC 2BANA 2IAJB 3BR9A 1UTAA 3CJTA 4TNOA 3ZNUA 4NEYA 4USJC 4CLYA 4QZVB 2W24A 3DXSX 3PACA 1SXLA 3E8OA 3KMSA 3VAJA 4I4BA 3H90A 2OPQA 1IBLJ 1M5KC 3DOMB 1KC8T 4B3MF 3EM1A 1KOHA 4F3OA 1U09A 2EFQA 1KONA 1H2VZ 1NDPA 4PG7A 2HYIB 5EWGA 5KFSA 2ZHAA 4WFXA 1RT4A 4ED7A 4P71A 3OJUA 3DLGA 2GAGC 5FLXY 2J9DE 3C16B 1LWXA 3UR0A 5EHHA 2GFFA 2XI3A 4NLXA 3W5XA 5I42B 4DSEA 3GFHA 2ZFHA 4Y34A 1OJ4A 3W3SA 1FKOB 1K73T 2BACA 2Z2ZA 5C42A 4DPUA 5H9EJ 1U1OA 2R8KA 4PAAA 4JI2J 4JI1F 1G6BA 4USTA 5G0RA 2DTJA 4KC5A 2Z2LA 3P3DA 2W01A 2P9GA 3OD2A 4KQZA 4LF6F 2E7XA 1UEVA 3B4MA 1TL1B 5LM7E 2LQBA 1X5TA 5KG7A 4X2BA 3MM5A 2CPXA 1OPZA 2CQ4A 2YQ1A 3K5LA 4LF8F 1IKVB 3U02A 4A47A 2JEIA 1L3TA 2LU1A 1GH8A 1N56A 1UJ6A 1TKDA 2ROEA 1GFWB 2Z2YB 4WWSA 2CQBA 1VFJA 2VC0A 5C2CA 2DXEA 4DI6A 5ETRA 1MG7A 4USWA 1F0XA 1CJKB 3TJAA 4Q2MA 3JQMA 3LP1B 2DR5A 5KG4A 3N79A 5I4MA 3NNAA 4DQRA 3CXCR 5HP1B 2YQ3A 4Q45A 1T02A 2KVIA 1TKTB 1DLOB 2O66A 1F9EB 3MM7A 4IH5A 4NWBA 2J6SA 2EW9A 3TNVA 2IMOA 3HT0A 3BQ0A 2PN6A 5KFAA 3OVSA 1Q82T 1LWCA 1FRIA 4USIA 3KUEA 3O1LA 2BJDA 2XMTA 4EBDA 2DGQA 4FF3A 2GJ2A 3M7VA 1ZETA 2CQPA 4RZRA 4U67Q 4ZPVR 4CP5A 2VBWA 2ZBIA 4ZMMA 2PD1A 3T5HA 1UAWA 4KGKA 3ET6A 3CC4S 3GYXB 3BH6B 4PXBA 3PDNA 5A8KA 4MYTA 4QW8A 1K1QA 5SUHA 5AE2A 4CIOA 2VQEJ 1SJFA 3TOQA 1N4LA 1MLAA 1YVFA 1XR5A 3IN5A 1IBMF 3H4BA 2X1GA 1H7XA 1S9EA 4O44A 2NCKL 4PQAA 3DOLB 3CJ2A 2QLJB 2QGFB 2JJ4D 3FCHA 4I64A 1ELOA 1HNXJ 2LEAA 1R43A 5K14A 2JHEA 4WE1A 1F3VA 2R7SA 4ENOA 2RKIB 2YWGA 2BQRA 3QZ7A 3CJRA 2XNQA 4X4PA 4YEAA 2CG4A 1NSAA 5D15A 4BLGA 2JVOA 5FDLB 3DDKA 4FZVA 3TJ8A 4ECZA 1Z2ZA 5HLFA 2OEMA 1H72C 3T9NA 3C6TB 2IIHA 4FPIA 4C0HA 3TZYA 3N01A 2M7SA 1T11A 2C2OB 1HIYA 3IWXA 3GYGA 3KG0A 4MIBA 5KFMA 1UW9A 2DNLA 2IMWP 4I1TA 4LF2A 2H5JB 5CZXA 3ZTRA 3UCGA 3ILIA 4G6VB 1HHSA 1BWVA 1B3TA 1WSRA 2KXFA 4RW9A 3MCNA 2GIRA 2BJ1A 3X1LB 1KQFB 2XLJA 1RSCA 2DT9A 4DV4J 2YNFA 3OHBA 4F50A 1D9AA 4OZ2A 1HNZF 3DGVA 2VG5B 2RNEA 4OZJA 4Y2IA 4ZN3A 2AT1B 4DOZA 5F8HA 1VHIA 4B08A 1NH7A 2GIQA 1U2FA 3IR6B 5E3RA 4WFBQ 1AB8A 2VIHA 3EZ5A 1FCAA 3NOCA 3BBFA 4OI0A 1H73A 3D0GE 2UXBF 1M1GA 2WOMB 2NXEA 2R7OA 3IMQJ 1UVJA 2V34A 2KXNB 3JSBA 4KSEB 3UR3C 4OJ3A 2HMIA 2MZ1A 3EPGA 2GHWA 2I1RA 1R0CB 2E1AA 3KHRA 1RCOB 1NSKL 1AZSA 1ZM4A 1JLAB 1X4EA 1T9VA 1JNZB 5JJBA 3R6LB 3MPDA 3THTA 2KM8B 3QFWA 4F4KA 2DNOA 2O3DA 4M5JA 2RUGA 3OPKA 4ZPCA 5KFXA 3M8SA 2M8DB 2ROGA 4PWWA 1CC7A 2IJFA 3M2RB 3OL9A 3W64A 3J80Y 2M3DA 1OWXA 5DETA 3M9MB 4UQTA 4U96A 2Z4PA 3SSSA 3UN3A 2DIUA 4Y2CA 2JLFA 2ZEJA 4A8WA 2J0QD 4KHMA 4DSFA 2AYBA 4JI5J 1NBEB 2BV3A 2VOOA 5AXLA 2AEMA 1NSQA 4IDKB 2FZKB 1TVRB 1WTFA 4P72A 3C3LA 4HHUA 1YJUA 2Z8QA 2WTFA 1D8YA 3QLHA 4RKUC 2RVJA 3W2VA 2W2QP 4AXJA 2B4OA 3TP2A 5DM6Q 4OI1A 1ZYQA 2Q79A 1O6XA 1HI1A 2D3O1 7FD1A 1C4AA 4R8UB 3I0SB 4DFPA 1VBXA 2HNYA 3KTQA 1B99A 3LO3A 4C8KA 3V6DA 2H51B 2MJNA 2XO7A 4MKYA 3RRHA 2HS3A 2N82B 4L6V3 2WONB 4I7FA 4NXMF 5HROB 2RIJA 4NA1A 2O1PA 2OELA 2OPSA 1NK0A 3HSGA 2KYXA 3WX8A 2KHCA 9ATCB 1FFWB 2BE9B 4OZLA 3IRXB 2BX6A 3QYYA 3I96A 1TVRA 2KTQA 2WW8A 4B9LA 4F4WA 2R4FA 4A8MP 1CJVB 1RGVA 1XIQA 2QT7A 3RG6A 2XM3A 2VQFJ 5LMUJ 2HURA 2O67A 4PABA 4ZK7M 2LA6A 3GB0A 4OJGA 1MWQA 3PO4A 2XWXA 4ED2A 1J5EJ 5HROA 1GMVA 3LA0A 2BOPA 5HMYA 2ABYA 4FF2A 1S9GB 1YJRA 2ILZA 4GO7X 1RACB 4QIEA 3J7Z5 4ZPWR 3B82A 1N32J 4RNFA 1AUDA 2EWHA 4DL4A 1U1PA 1XNRJ 3I31A 2HBYB 2NZCA 3QWUA 1EB0A 4NX9A 3JAMY 4ICLB 4WE1B 1P1LA 2UUCF 2HHXA 3OSNA 2N7YA 2B5JB 3MTKA 4X66F 1CJTA 3LH2S 3QWPA 2BE2A 3RW6A 2HVDA 3BGRA 3D7SB 2DR9A 1KKHA 1TK8A 4LRDA 4TVAB 4ZVQB 4G1QB 3OLBA 2CDQA 2QLBB 1OMSA 2BM1A 3L95X 3KG4A 3MGJA 4OFZA 3SCKE 3DLHA 2C2EA 6FD1A 2B0GA 1PJ7A 1FHTA 1DJ0A 4I2QA 1L3KA 3ZO7A 3HULA 3SCLE 3LP0B 2CRLA 2HBQB 2W1BA 4XIUA 5HMWA 2H1YA 3KNGA 2DISA 2E1RA 2YXLA 5AXMA 3KK2B 4M5DB 3NGDA 1Z1ZA 3V6JA 4LRCA 1N36J 2BA9A 2EKYA 2EFPA 3CGIA 3GSIA 3FMWA 2LEBA 3NNCA 3H59A 1T9UA 3BSAA 5DG8A 4AQYF 4LF4F 1S6QB 1X60A 2OMOA 3N6NA 3CD0A 3PZPA 1NK5A 3FRYA 1N8RT 1MN7A 2JDJA 4WK1A 4DR2F 2XS7A 4K4WA 4UQGA 4G65A 2MKJA 5CZVA 1JMTA 3K5OA 4ELUA 3CO0P 3CMQA 2N7CA 4IR9A 4NYPA 4HACB 3TJ9A 1BMQB 1FA0A 3NGKA 4V19J 3OQ2A 1WHWA 1FXDA 4GKKJ 3CJ4A 5I3UB 2ZVIA 1URRA 2ATCB 3KJNB 3Q22A 2XS5A 3I0RB 1FRLA 4IOCQ 3DNCA 2VKRA 1Y10A 2JSXA 5E2QA 1YJ9S 4O0NA 2CXEA 1X4BA 1XWLA 4PXDA 2HQCA 3ZFVA 5DRKA 3TVYA 2MKKA 1IKYA 2FQQB 3BN7A 2RE1A 2WOMA 5J2PB 1OIAA 5B0AA 5A6WA 4OLPA 4PKDB 5AE3A 3MEEB 4I56A 4O0IA 1SL2A 2WK4A 2YY3A 4LVNP 1S0MA 4DV2F 3PW0A 1NHUA 1NPPA 2B4VA 4ECRA 1S72S 4FF1A 2YWKA 2R2TA 4DSLA 2ZZNA 3EX7B 4IFYB 2H4YB 2YWWA 3K59A 1FERA 5DG9A 2UXDJ 1FRHA 2DCLA 1FDAA 4X4TA 4WP3A 4YB1P 4OX8A 2IM0A 2OEJA 4P2FA 4J9VA 4QR2A 4P75A 3S6EA 3W60A 4F4XA 2BQ3A 5LJ5Y 1JJCB 3C46A 2FVQA 3K17A 5BYSA 1MU2A 5A0YA 1HNVB 4J9QA 2AGQA 2MLYA 4NA2A 2OPSB 3DFEA 1KSPA 1RTZA 1XMBA 3G71S 2UV8G 4CYUB 3VALA 2QL5B 3Q8SB 1N33J 3H4DA 4RW4A 1TL7B 4CZCA 4OV1A 4NLGA 1JK9B 4IFYA 5C24B 4CLLA 1REVA 3TX8A 4FKXA 4M5IA 3PXGa 1S7IA 1ZOTA 2YWFA 5DZ7A 1QTNB 4M5MA 3U1LA 2ZHBA 4DR6F 1NEEA 2GGPA 2F4VF 2AZ3A 1P6TA 4UOCA 3BN4A 3TUPA 1UFLA 3MEKA 1PCAA 3AH6A 5SZTA 1FVSA 3VQSA 4LFCJ 1JNRB 2IYIA 4PG5A 3RRKA 1UWBA 4F0MA 1O0PA 1RKIA 4YB7A 1RKJA 1QLNA 4TU7A 1S0NA 2QC3A 1QE1A 1EHWA 3J81j 4JI7F 2N3OA 1W2IA 3CJ3A 3CCTA 3FSXA 2FGCA 4B3SF 3K89A 3CVKA 4HI2A 4LRAA 3IRXA 2V2ZA 2CQ0A 2F63A 3D6MB 5T41A 4UW2A 4DPWA 2IRYA 1NNDA 1WHXA 2I9SA 5K8MA 1ZA2B 2RHQB 4ZVGA 2W8KA 3TA2A 4WTOB 1VRUA 3W5ZA 3QATA 4R0EA 4EMDA 1IWAA 1HNIB 3A3OB 1H2UX 2LDIA 4HHHA 3H25A 2E9TA 3BBBA 3DOMA 4KE5A 2B8PA 2FJDB 1IWGA 2DRDA 3N4WA 1JLBA 5KG1A 4H4KC 1DQAA 2Z57B 3PYFA 1K1SA 2N4CA 1Y3KA 2X51A 2VH7A 4JI1J 1X5SA 2R8JA 3NCQA 2FHOB 2ZZTA 1DQ9A 3MOZA 1U48A 1UWAA 3KG1A 3U27A 2UUTA 3KLHB 2WCXA 4JI8F 4K4YA 4J5OA 2ZH1A 1OPIA 2EBEA 3KLGA 4B3MJ 3K57A 3KK2A 4K2XA 4R5PB 1FKOA 5J2QB 1FTCA 1SC3B 1YZ7A 2D3UA 4DU7A 4TQRA 2J0XA 3PRDA 4TU8A 3UCUP 3MMCB 4ZP6A 4ITSA 3BREA 3IGNA 4WIQA 2QA4G 4XPEA 3ZZTA 3R5AA 1BXNA 1LOUA 2DH8A 1T9YA 3PNIA 4KRWA 4ALZA 2MZSA 4ZP8A 3G8SA 4DN9A 2AQ4A 4U9RA 3AAWB 4X4RA 3VTIA 5K8OA 3WC2A 1V5VA 5J1EB 2V8VA 3H2LA 5J2MA 2LQ5A 2ZVSA 2L48A 2NS1B 4K4ZA 3IS9A 1UL3A 3OR2A 4LRBA 2UUAJ 2HHVA 3NGTA 5FJ4A 2VBXA 1ACMB
chains in the Genus database with same CATH topology
4ECSA 2HWHA 3BGUA 1NKEA 2FTRA 4IG3A 1TQLA 3BSNA 4J9LA 1UVIA 2YTCA 3CPWR 2HHUA 2H9ZA 1O5JA 4ILLA 2VB6A 4DG1B 2B43A 4QOTA 1BY9A 1GT8A 1XR6A 1N5YB 1X5OA 5DDOC 1BQMA 1R8HA 5L39A 2GA7A 3DMJB 4NRTA 1U1LA 3OW2R 4RW7A 4F4YA 4FXWA 3M2UA 4ED1A 3LWLA 5IQQA 4IG0A 3PW4A 3PW7A 2OKQA 2UUWA 2D1CA 4WFZA 1KOOA 2KB2A 5IQ6A 5F9LA 2HW3A 5FDLA 1GNKA 2PT0A 5F8IA 4AL7A 3OV7A 2E7WA 1Y4ZB 3RYLA 4ES3A 2JL9A 2XY7A 4X4VA 2AYEA 2J9DA 1YJWS 2KFYA 4ZLPA 4NLSA 5KFVA 4C2MA 2XCAA 4RUAA 1C0UA 2IA6A 3RBDA 2G9OA 3PEHA 2MQQA 2MXYA 3G4SS 1H38A 4LUBA 5DGAA 4IRCA 1RTJA 2VA3A 5DS7A 2W9AA 2V9KA 1R31A 2V4QA 2HGMA 2V9WA 5LJ3Y 4J9PA 3MHYA 1HBNA 1SJRA 3LUYA 4J37A 4WU2A 4NXNF 2HZCA 1QAJA 2GC8A 1SH0A 2VV5A 2HNDB 2BVZA 5B7WA 1IR0A 1FO1A 1SV5A 2Q3PA 2I8EA 4O3QA 5B0CA 3RB0A 5HMXA 4L72B 5M2RA 1Y5NB 1VQSA 2HAIA 2UXDF 2F9JA 2JLGA 5IFMA 3MUTP 3FEZA 1HPZB 2NSCA 3Q2TC 4ZHRA 4ZCLA 1QM9A 3BO2A 2QLWA 1NK4A 4ECWA 3Q23A 3BF4A 3KYLA 3PX4A 2HVZA 2RRNA 3ULHA 5KFFA 2PC6A 4Y2AA 3EGZA 1SH2A 5CXTA 3K58A 2MQNA 4MK9A 2E66A 4C8OA 2B6AA 4PWDA 1S4FA 2X1BA 1HD1A 4LSLA 2B56A 4G1PA 2MKIA 3DRRB 2F8MA 3PIOQ 4U7CA 3HPOA 4LSNA 2PE8A 2IJNA 5H9FJ 5D8HB 2FVSA 5CA5A 3QIPB 1A6LA 1Q16B 1RJJA 3ZZPA 2HGLA 2WSEC 2YKMB 4DV6F 3D54A 2VG7B 3V4IA 3NNHA 4JI2F 1IQTA 2ERRA 1F2GA 4DR1F 1V3SA 1BD6A 5J2MB 1N48A 2VFRA 3MR6A 1U8SA 3SFUA 4EYHB 2CPJA 1HQEA 4QBUA 2LLZA 3NLCA 1VRTA 1LWCB 2ZKTA 3J7YU 2B4UA 3G6YA 2KDOA 2GMJA 2MHEA 3NL0A 4OHWA 3O2IA 3UFCX 5KFQA 3OTEA 1LW0B 1U1QA 1AW0A 1ZM3A 2VFSA 1R8AA 2PFFB 2W9BB 1TUVA 3TVZA 1V6HA 1X5PA 2Y0SD 2QEXS 3QAEA 1VQLS 4DV5F 1Q78A 1S99A 1N5SA 3FDSA 2B9XA 2LXIA 2DHXA 1S9FA 1IBKF 4IO1A 4DQSA 3M2UB 1U6BA 4M8LA 3HI9A 2W7OA 4V19X 4G1IA 2IM2A 3S8SA 5C5JA 2EFNA 2EFVA 2QA4S 1VS3A 2J0WA 2QMWA 3SXLA 4CT8A 2MQPA 4G1QA 4DL2A 3H2UB 2FIUA 2DNYA 3DM2A 1MMLA 1RT6A 3OL6A 4NA3A 2LECA 4KV8B 1RDRA 1S7HA 1TZ0A 2MB0B 4JI4F 3HK2A 3MECA