3KJVB

Hiv-1 reverse transcriptase in complex with dna
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
428
structure length
400
Chain Sequence
PIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase p66 subunit
publication title Visualizing the molecular interactions of a nucleotide analog, GS-9148, with HIV-1 reverse transcriptase-DNA complex.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase/dna
total genus 98
structure length 400
sequence length 428
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3kjvB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3kjvB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3kjvB03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3kjvB04
1SUQB 4OL8A 1WNEA 5KFOA 5CYQA 1GX6A 3T5JA 1RT5A 3KK3A 2UUWA 4RW7B 2IAJB 1S9FA 4WFXA 3RB4A 1KLMA 5KG7A 1TKXA 5FDLA 3M9NB 2IM2A 2FVRA 3KK1B 2R8JA 1VRUB 4XPEA 3HKWA 1N56A 3CDWA 4NRTA 1HMVA 4ZPDA 4R8UA 4O44A 3DM2A 3KMSA 1RYRA 1KHVA 4R0EA 2HNDA 3SFGA 1U09A 1S0NA 4ZP6A 1IKVB 2J6TA 2C2RA 3PR5B 3KLHA 4ZP8A 3OSPA 1S1WB 4ECZA 4RNOA 3V4IB 5EWGA 4Y34A 3KLGA 3PJXA 2YNHA 4YR0A 3V6DB 4ZHRB 5HP1A 4J9MA 2IA6A 1N5YA 1S1XA 3DLEB 1QAJA 1TV6B 4RW6A 4DG1B 3KK1A 3H5SA 3M9OB 1VRUA 5K14A 2XGQA 3PW4A 4MKBA 1BQMB 2IM0A 5KFLA 3IN5A 5J2MB 2QV6A 2V9WA 3DLGA 2DPIA 3M8PB 3EPIA 2FJVA 4ID5B 3RB0A 5CYMA 1TQLA 4URGA 4QW9A 1IKVA 4TY8B 3DLKA 3OSNA 2R8HA 3T5LA 3DRSA 1SH2A 2OPQA 5L9XA 3BQ2A 3GV8B 3T5KA 4WE1B 4EEYA 4DG1A 2D3UA 3BSOA 2XI2A 4J9LA 5KFYA 4IG0B 4O4RA 2W9CA 5J2MA 4H4MB 3LAKA 5EWFA 3JYTA 5KFNA 3NGDA 1RT2B 3IS9B 4EO8A 4MK9A 4K4VA 4RW9A 5F8HA 4ID5A 2I1RA 5T14A 1JLGB 4URSA 2BR0A 1HNIB 1JLCB 4O4GB 2ZD1A 4FBUA 3BR9A 3KK2B 2JEFA 3NL0A 5KFTA 4ECYA 3PVXA 3NAHA 3KNAA 5KFUA 4WE1A 2HMIA 3KLVA 2R8GA 4KV8B 1S1TA 2GIRA 5J1EA 3BJYA 3EZUA 4ZPBA 3OLAA 4ED1A 1SV5B 4H4MA 4RUAA 2R8KA 2JEIA 4NLDA 1RT2A 5KFQA 3IS9A 4K4UA 1JLEB 1JLQB 1FKPB 1REVB 2JLEA 1JLGA 4FBTA 4J9QA 4TQSA 3DOLB 4MIBA 1S0OA 4YMEA 3DRPA 1HNIA 2E9ZA 4O4GA 3CDUA 3LP0B 3CJ3A 1BQNB 3MR5A 5HROB 3CIZA 5KFJA 2WCXA 3TVKA 3NAIA 3H4BA 2W9BB 3H5UA 4LSLB 3HVWA 1KHWA 3I0RA 3SI8A 5KFSA 2UVUA 1RT7B 1S97A 2FJXA 3DYAB 2YKMA 3MTKA 1JLEA 2XI3A 5KG3A 1TKZB 4NZ0A 1HPZA 3DOLA 2RDJA 5F8GA 3GQCA 4X2BA 1S1UB 4QPXA 3FQLA 1RT1A 4ED0A 3ITHB 3BSCA 5J2QB 2FLLA 1IKWB 2W9BA 1IKXA 4LSLA 3BQ0A 1RT3A 5JUMA 3KLIA 1N6QB 3C6UA 1IKYA 1C0TB 1S4FA 2HWIA 1JXLA 3OHAA 1FK9B 1RYSA 1TKZA 3MFHA 2AQ4A 3ISND 2J6SA 2HNYA 4ED2A 3OL7A 5L1JA 1RA7A 3GIMA 1S1UA 1J5OB 2FJWA 3N6LA 2DPJA 1LWCA 4R5PB 3JSMB 3ITHA 4ICLB 5J2QA 1TKTA 2JEGA 5CYQB 4URQU 2XCPA 3KK3B 4NLTA 4YQWA 1C1BA 5KFIA 3MR2A 3V81B 4RU9A 4K4SA 4QWBA 2YKNA 1FK9A 3KJVB 4NLYA 4XPCA 2R2TA 4ECXA 3RAQA 4QWEA 1S9GA 2JC1A 2IM3A 4J9KA 1RT4A 1MMLA 4QWAA 4R5PA 2FVCA 3PW7A 4ICLA 3RB6A 2HNDB 2OPSA 1S49A 2AGOA 4IFYA 3Q8QB 3MECA 2W9AA 3QIDA 4TY9A 5EDWA 4FS2A 3PW2A 2IC3B 4WYWA 3KLHB 3V81A 3KHGA 4K4XA 4O3RA 1NHUA 4I2PB 3KLGB 2YNHB 2HAIA 2ILZA 4NLSA 4IH6A 3V6JA 5HP1B 3KJVA 4TQRA 5I3UB 1S1XB 1N5YB 3H5YA 4RW6B 2FVPA 3GYNA 1HARA 5KFRA 5KG6A 3KHRA 5K14B 4NYZA 3HVAA 4IRDA 3DLGB 3NBPB 5F8JA 4EO6A 1C2PA 2WHOA 4IR9A 4LSNA 3MEDA 5CYMB 5F8NA 3UDLA 5DG9A 1SH0A 3DLKB 2IC3A 2I5JB 5KFXA 3DRSB 3QGHA 4JV0A 3H40A 4I2PA 2OPQB 4TYAA 3RB3A 1EP4A 3PW0A 5I3UA 4IQXA 3KOAA 3FQKA 1LW2B 1TL3A 2WONA 2W9CB 1RT6B 2D3ZA 3IRXB 2GIQA 3OHBA 3LAMA 3NBPA 3JYTB 4LQ9A 1TVRB 4PWDB 5F8IA 4RW9B 4WFYA 2I5JA 2HNZA 2B6AB 2YNFB 2ZD1B 3I5CA 5JXSA 4ED8A 3TAMB 4NLXA 4YP3A 2HMIB 2IJFA 2IJNA 1S1TB 1SH3A 5J1EB 3ICLA 2VG7A 4RNFA 1W25A 1LW2A 3KHHA 2W8LA 1RT6A 3MEGA 3IRXA 1QAIA 4NLOA 3QGGA 4Y2CA 3RBEA 3MEEA 1TVRA 4PWDA 4ECRA 3G6XA 2AGQA 1ZTWA 4O3NA 5L1KA 3Q8SB 3H5XA 3PHEA 1JKHA 4DL6A 3DRPB 5KFEA 1DTQA 2B6AA 2YNFA 4IDKB 3OL9A 3LALA 3TAMA 2YNGA 1DTTB 4PQUB 2VG6A 5KFZA 4K4ZA 2B5JA 3I0RB 4KE5A 4H4OA 5D3GA 4NCGA 2BQ3A 5DGAA 3DRRB 2YKMB 1K1QA 1OS5A 1HPZB 4IH7A 4GC7A 2C28A 5DLGA 2YNIB 3OLBA 4QWDA 4F4ZA 3FFIA 3G6VA 1T3NA 4JV1A 1R0AA 2VA2A 3EPGA 2WK4A 4IDKA 5KG0A 1RT1B 3OL8A 2V4QA 4GC6A 4O3SA 4KHMA 1DTTA 1LW0A 4PQUA 5KFBA 5KT4A 1ZETA 1IKXB 4WXOA 4MH8A 4TN2A 4ZP9A 2J6UA 1RT3B 5F8LA 3KLIB 3QO9B 2AX1A 2AGPA 4F4YA 3DRRA 3C6UB 1IKYB 2FVSA 1HNVA 2ALZA 5DGBA 3V6HA 1JX4A 2O5DA 3UPFA 1I6JA 3QZ7A 2YNIA 2HNYB 3CJ5A 3LP1A 2E9RX 5KFCA 4DL7A 5F8MA 2BQRA 1T05B 1LWCB 3IG1A 5HBMB 1JLBA 4XO0A 1TKTB 2OPRB 4FS1A 1RTJB 1EETA 1UWBA 4WYLA 5KFPA 4ECVA 1HQUB 3OL6A 2BANB 4KKOB 4EBEA 1RAJA 1C1BB 2RKIB 4O3OA 4DL5A 4M95A 4RUCA 5L1IA 3QO9A 4NLPA 3GILA 2YKNB 4NLGA 3BGRB 4TLRA 4ECTA 5J2NA 1JLFA 4O3PA 1S9GB 2R2SA 4I2QB 4IG3B 4ECUA 4I7FA 1ZTTA 4KO0B 1GX5A 3C6TA 1RT4B 1T05A 3BREA 5HBMA 1LWEA 5C25A 1T94A 5C42B 4QW8A 2OPSB 2OPRA 4RNNA 1RTJA 2XCAA 1HQUA 4IFYB 3HVTB 3MECB 4WXWA 3DOKB 1RTIB 2BANA 4KKOA 4J9OA 2RKIA 2FLNA 3H59A 2JC0A 5EUHA 2UVRA 1S48A 1RTDB 1XR6A 5KT7A 5KT2A 3BGRA 1FKOA 1S9EB 2RF2B 1K1SA 4RNHA 3QZ8A 3E01A 3FRZA 4Q8EA 4I2QA 4IG3A 4KB7A 4QWCA 3N6MA 4Q45A 4KO0A 4ED6A 5C24A 3MR3A 2ASJA 3I0SA 5C42A 2OH2A 2ATLA 5F9LA 4LSNB 3MEDB 3RBDA 3HVTA 4ED7A 4MFBB 3DOKA 1RTIA 1XR7A 3CJ0A 4TXSA 3GV5B 3QYYA 3PZPA 3DMJB 3JSMA 5DQIA 1RA6A 4J9NA 5I42A 1RTDA 1EP4B 1S9EA 1NNDA 4MK7A 2RF2A 3MFIA 3M8QA 4EBDA 2FVQA 4ZP7A 3QLHA 4RW4A 1TL3B 1XR5A 2WONB 5KFWA 4KAIA 2R2RA 4O3QA 4ZMMA 2XWYA 2D7SA 4Q44A 4MFBA 2W8KA 2OPPA 2R2UA 4K4YA 2HNZB 3DMJA 4WFZA 4RZRA 5KT5A 2UVVA 3LP2B 5KFMA 1CSJA 1VRTB 5KG2A 2VG7B 2ASDA 5DG7A 3DI6B 4NLQA 3MEGB 2AX0A 2ILYA 4J9SA 2BQUA 4ZPAA 2WOMA 3KLEA 3MEEB 4MKAA 4EYHB 4HYKA 5KG4A 1QE1A 3BQ1A 1SUQA 4ZVFA 3BSNA 4F4WA 4WZQA 1JKHB 2ZE2B 4B3OB 3D5MA 3CJ4A 1DTQB 4RW7A 2IAJA 3QIPB 2YNGB 3D28A 4J9PA 3LP2A 4ZVGA 2VG6B 4M94A 3H2LA 3UQSA 1S6PB 4PUOB 4K50A 1VRTA 4K4TA 2B5JB 4KBIA 5C5JA 5DG8A 3DI6A 1RTHB 4H4OB 4RW8B 4JUZA 3RAXA 5D3GB 2C2EA 4NCGB 4TYBA 3I5AA 2BE2B 5KT3A 4IH5A 4IFVB 3ISNC 2ZKUA 3NKYA 2F8EX 2C22A 4KSEB 2IMWP 4KFBB 2WRMA 4G1QB 3FFIB 3FDSA 2ZE2A 1R0AB 4B3OA 2EC0A 3GV7B 3E51A 3QIPA 2HWHA 3CO9A 1LW0B 1S1WA 3V4IA 1S6PA 2JEJA 4PUOA 3V6DA 4ZHRA 4RW8A 1RTHA 3DLEA 4IKAA 1TV6A 3H98A 4DL4A 2GC8A 2ASLA 3G86A 1LWFB 2C2DA 4Q8FA 2BE2A 1HNVB 5KFKA 1BQMA 3NMAA 4IFVA 2IBKA 3N6NA 4IR1A 3GIKA 3I5BA 1JLAB 3M8PA 4KFBA 5KFVA 4G1QA 3TQ1A 3T19A 5KG1A 3LP1B 1N48A 4ZVEA 1DLOB 1Z4UA 3IG1B 3KLFB 1YVFA 4TY8A 1JLBB 4MK8A 1RDRA 2V0NA 3T5HA 1EETB 1MU2B 1S6QB 1UWBB 4EBCA 4KHRA 3H4DA 4F4XA 4MIAA 2AU0A 1T03B 5KFDA 1QUVA 4RNMA 1LWFA 2XGPA 5DLFA 4IG0A 2CJQA 2RDIA 4Q0BB 5J2NB 3CDEA 3DDKA 1JLFB 1D1UA 4Y3CA 5KG5A 1JLAA 4IOBA 3Q8PB 2AWZA 4I7FB 2WTFA 3C6TB 2BRLA 1DLOA 2W7PA 3KLFA 5KT6A 4U6PA 3G6YA 1LWEB 2D41A 5C25B 4DEZA 4EYIB 3PR4A 3KMQA 1JLCA 1MU2A 1S6QA 1TL1B 4IRKA 3GIIA 3KK2A 3M9MB 4LQ3A 3Q8RB 4DL3A 5J2PB 5KFHA 4JV2A 1T03A 2UVWA 1N4LA 4KV8A 3FSIA 4U7CA 2R8IA 4NRUA 3V6KA 1HYSB 4Q0BA 1FKOB 1HQEB 1SV5A 3MF5A 4Y2AA 5F9NA 5EWEA 1S10A 1S1VB 3T1AA 3E01B 4IRCA 5HLFB 1FKPA 1JLQA 1REVA 4NLUA 2B43A 5C24B 3I0SB 4H54A 2UUTA 3IGVA 4Q43A 2V4RA 1TL1A 4NLRA 3LP0A 4WZMA 1BQNA 1C0UB 5HROA 5J2PA 2E9TA 1C1CB 4DL2A 3HHKA 1JIHA 2FLPA 5I42B 2VA3A 1D0EA 1HYSA 3GIJA 1HQEA 1RT7A 2W7OA 4F50A 1S1VA 2QE5A 3DYAA 3M8QB 5HLFA 3QLHB 4RW4B 3IGNA 4ED3A 2VG5B 5KFGA 5DQHA 4ZPCA 3MR6A 3LANA 3UR0A 1TP7A 4ECQA 1C0UA 1S0MA 1NHVA 1IKWA 2OPPB 5L1LA 4J9RA 2IM1A 1C1CA 1RT5B 4ECSA 4G3IA 4K4WA 4HKQA 3CVKA 4ECWA 1KLMB 5DQGA 1N6QA 2BRKA 3SFUA 3CJ2A 3CWJA 3PW5A 1C0TA 1TKXB 5FDLB 3KHLA 4ZVHA 3VQSA 3QGIA 2CKWA 2VG5A 5KFAA 1IM4A 4NLVA 2WOMB 3KLEB 4NLWA 2XC9A 4YR3A 4YR2A 1HMVB 2WB4A 1J5OA 3PJWA 4R8UB 1QE1B 4O44B 3DM2B 5KFFA 3BSAA
chains in the Genus database with same CATH superfamily
2G0IA 4RW7B 1KLMA 1TKXA 2IM2A 3I4PA 4YFUA 1ZA2B 1AW0A 4TU8A 2VJUA 5FLXU 1Q8KA 1BQMB 4DX6A 1FEHA 1IBCB 2FQQB 2DNRA 5KFYA 2HBRB 4O4RA 1FRMA 4ID5A 3DFEA 3M2VA 4URSA 1FXDA 4O4GB 1S77D 3JXOA 1CJUB 3JB9k 2W7AA 2KJWA 4F3QA 2VICA 4TQSA 4B9LA 4G65A 2DO4A 2MQ8A 3NAIA 3H4BA 4LRCA 1YJWS 3OT9A 2Q43A 5KFSA 2QTWA 3GMGA 4HI1A 1ZA1B 4NZ0A 5A6WA 3FQLA 4L6V3 3UN2A 3FBEA 3THVA 4YS2A 1SJRA 1CBKA 3W60A 2FJEB 2WBMA 4DBQA 3ISND 4BBYA 4ED2A 2OSQA 5CYQB 2U2FA 3MR2A 3O6QA 1LXNA 1SQGA 4ZK7M 3DLHA 1OQ3A 5CCLA 3OUYB 3QSIA 3G4SS 4OYMA 3MUTP 1NLKL 3JSYA 2PDAA 3GYNA 1YJUA 5CZXA 3DLGB 2NR0A 3CCTA 2WHOA 1PYTA 2HQCA 5CYMB 1V6HA 2WAQD 4WU3A 1EHWA 4LREA 2IVFB 5E2QA 3QRQA 4WFYA 2ZD1B 2HMIB 1SH3A 2VG7A 3M32A 4KPYA 2PEHA 1X4GA 4MKYA 3BO2A 4DFJA 1Q4RA 1EKRA 5GAGI 3OL9A 3G8TA 4PQUB 2CZ4A 2LXFA 3VAIA 1CULB 2RU3A 5D4LA 4B3MF 4PYAA 2QLBB 3CCZA 3OLBA 3SSSA 4LFAF 2ZEJA 5HI7A 3P8BB 1NSKL 4ZCMA 1DQAA 1TL7B 4F4YA 3DRRA 2OEJA 5IQ6A 3PRVA 1JLBA 1RTJB 2L9WA 4WYLA 2BANB 1C1BB 2RKIB 4MMOA 2KM8B 4M95A 2R2SA 3K8VA 4I2QB 3UW1A 3C6TA 1X4AA 2VPXB 2OPRA 3HVTB 1CG2A 4KKOA 3TJ8A 2J7KA 4CNZA 4HTIA 4YB6A 1FD8A 4KYZA 1VQSA 2QRRA 5E3QA 1ZBTA 1L5UA 1RJJA 3GV5B 2P6SA 1RCXB 5DM7Q 4RW4A 2WONB 3R1HA 2K7JA 2BOAA 4X65F 3MPUB 2CPIA 4JI8F 2B9WA 3PCOB 3IMQJ 3M8WA 4NLQA 1QSYA 3OD2A 3KLEA 4X66F 2ERRA 3QJPA 2DXEA 5D78A 3D28A 4J9PA 4LF4F 4C48A 2B5JB 4QR0A 3UDVA 5B0BA 4YHHF 3OW2R 4B3OA 1RWPB 2Z2LA 2HAFA 2K3KA 4DJBA 4DV2F 4FXWA 3K8WA 3N6NA 4G1QA 3UN3A 4DI6A 1EETB 1S6QB 2R7OA 4AL5A 4OZJA 4CLLA 4IOBA 2W7PA 2D41A 4K0KF 3PR4A 4USTA 2HHHJ 3ILLA 3AFGA 1VLYA 4NCAA 1SV5A 2ACYA 1A9NB 3M6UA 1N0UA 1X9WA 2QMXA 1VJQA 4NYOA 2AJ0A 4FYWB 4WZMA 1ZAWA 1C0UB 3OTOJ 4F50A 1U4BA 1S1VA 4QR2A 5KFGA 3I87A 2I0XA 2HFUA 4NA3A 5L46A 4USUA 4WK1A 1OIAA 4X4PA 1HMVB 2DXFA 2F8MA 2GGPB 3US5A 5IC6B 2HW3A 2KXNB 3IAS9 4NRTA 2DGXA 4K59A 3TA0A 1R8AA 4X4UA 4A8SA 5DRKA 1BLUA 4CM0A 1EZZB 4U7UD 1S1XA 2LU2A 5DDPC 2ZDPA 2R8HA 4LF8F 3R6LB 2M3DA 3CCMS 2OPQA 2YQ1A 1X4DA 4DUZJ 3GV8B 5H9EJ 4WE1B 5A8WB 3N28A 1FI4A 1IUJA 1KONA 5T14A 4A47A 4FKYA 3RJMB 5CZVA 3BR9A 1BXNA 1S1TA 2KXHA 4RUAA 3GCXP 1KFSA 2C2MB 4DL0C 1VIXA 3P49B 2BW2A 2RS2A 3MR5A 1GXUA 4KR0B 2WCXA 4U67Q 3UD3P 1FVSA 4RL1A 4NXMF 2FJXA 1Y00A 5I3PA 2D1CA 3BO4A 2Y8WA 2B4VA 4J9UE 3THTA 1RT3A 3M2RB 2Q3PA 1C0TB 1EQ0A 3M1VA 2KB2A 5ETRA 4ZCKA 2XLJA 4WFAQ 1TKTA 4RWWA 3GJSB 3CTRA 4UT4A 1SL2A 5A8RB 4BLGA 2IM3A 4CYUB 2MHEA 2ZH3A 1Y5LB 3RB6A 3GZ7A 3CDAA 3HF5A 3CMAS 4YY3J 3V81A 4I67A 3KG4A 3UCZP 3SCJE 2KFNA 1QUPA 5JVGQ 1RAAB 4M5MA 4EO6A 1CC8A 1SJFA 4BC7A 1QJHA 4JI3J 1MSWD 1U24A 3ET6B 5BYRA 2E66A 4USWA 5GAEI 4M5DA 5F8IA 1KVJA 3ZFVA 3BS9A 5A8KB 4K2XA 1EB0A 4DR4F 3SDEB 4GKKF 1RADB 4PWDA 4J5OA 3HHNB 1YG0A 3W9JA 3JAMY 4EZ6A 2CJAA 2MKCA 2XS5A 2NS1B 5D3GA 3M05A 3NXZA 1MMNA 2OHDA 1XNQF 1H98A 2VA2A 4OX9J 7FD1A 3W62A 1IKYB 1FWPA 3V6HA 1JX4A 3PTWA 2ZHAA 1UWBA 3TW0A 4EBEA 4WBFA 3A8JA 4NLPA 4HDHA 2GO8A 4TLRA 4DPOA 3KDNA 4O3PA 3HFKA 3MMCA 1D09B 4KO0B 1RT4B 3H20A 1LWEA 4LR8A 4AFFA 4J9OA 1XR6A 3ULHA 4C11B 3B78A 2E1CA 3ETOA 2BKPA 3A1YG 1ZM3A 2QO3A 4JI4J 2B3TB 4OZNA 3S7RA 2B4OA 4PZVA 1YRTA 1U1RA 1ZH5A 2QC3A 1D8YA 3P96A 4Q44A 1WOOA 1HNZF 2IY5B 2XYHB 2PD1A 3MMBA 4UF4A 2ASDA 2ILYA 2YY3A 3CGIA 1HHQA 4ZVFA 4QIEA 4FYXB 4XDCA 2F8HA 1S6PB 4KBIA 2DRDA 1DY3A 2LLZA 3HPOA 2C22A 4KSEB 1VRQC 1K47A 1VQNS 1X7VA 3MHYA 3T6JA 2DT9A 4TY8A 2MHNA 3L9ZA 5B7WA 3BN4A 1PGZA 1LWFA 3NCPA 2FHMA 1RHJB 3K58A 2XMTA 3G6YA 3MM8B 1VCTA 2XHCA 2EFQA 5CH7B 4DFMA 5D4OA 1WG4A 4J7CA 4JI5J 2CA9A 2VIHA 2K1RB 3IGVA 1TELA 2BX6A 4JV5J 4DL2A 4BDPA 2IYGA 1DJ0A 1XWLA 3ZTRA 3LANA 2QL5B 5LMNF 2GVZA 3VGVA 3U27A 2BV3A 3TYTA 1Q78A 1B70B 3DM2B 2FHOB 2NPIA 3T5JA 1DURA 2QA2A 2YPZA 4JI1F 2E7XA 2CNKB 1HKAA 2DO0A 2XNQA 2H54B 3QRPA 2L08A 2Z58B 3FVYA 4L72B 3CJKA 4O44A 3KMSA 2KM8C 1YSJA 3KXDA 4RJVA 4OX7A 2QL9B 3IN5A 5D0GA 4LIRA 2QMWA 3UE2A 2G0CA 2UV8G 4L75A 4PG7A 4K5RA 4QBUA 2VV5A 2YKAA 1RISA 1RT2B 4F25A 2DHXA 4JOUA 1NK6A 4K4SA 4FBUA 4ECYA 2V2VA 1WSVA 4YN3B 1RCOB 2ZWOA 4ED1A 4H4MA 4P7TA 4K4UA 3IFEA 3M2UB 1JLGA 3LPYA 2F4VF 3N4WA 3LP0B 3TX8A 1WF0A 3M6XA 4W90B 3I0RA 3LGMA 2UVUA 1IR2A 3W2WB 4DV6F 4WFNQ 2KZMA 1U0HB 3BSCA 1WF2A 5GADU 1UA0A 1N6QB 2MQLA 2XY5A 1JXLA 2HNYA 3OL7A 1FFWB 3ITHA 4AT1B 2VBZA 4ZPWR 1O51A 3D3BJ 4LT6A 2E5IA 4RU9A 2XB2D 1FK9A 1FE4A 1IR1A 1SQEA 3MUVP 4R5PA 3L4BC 2AGOA 2M4MA 3PW2A 4FF3A 3A8KA 1ROFA 2HAIA 2DR8A 1VOMA 5HP1B 2DNNA 4TQRA 2W25A 3HXMA 4RR5A 2KYXA 5IS2A 4FDFA 4G6VB 4F0HA 1ELOA 4IR9A 2XMKA 1SH0A 2V8GA 4JV0A 4I2PA 4TYAA 4NXNF 2JL9A 2U1AA 5IWAF 2FZGB 3I5CA 3GFXA 1ZAXA 1RAOA 3FGVA 3TAMB 4PCQA 4PXEA 4A8XA 2VH7A 2DHAA 3HD1A 3SSQA 2XTJP 2HGLA 2F9JA 5KFZA 5CHCB 4B3SJ 4DPYA 2G2OA 1K1QA 4FXDA 1QD1A 2GFFA 4UQTA 3G6VA 3PYGA 4YB7A 4IDKA 4HHJA 1Q16B 1LK5A 1Q5VA 1U8WA 3TVYA 4C9DA 4ITSA 4F0KA 4FN5A 3MAQA 3CB4A 1SL1A 2GJFA 4ZKAA 2MMYA 4A8YA 2MQQA 1FWLA 1YX2A 4NLGA 2ZH8A 3WX8A 4I7FA 2RILA 1IBMJ 1OQ6A 1RHKB 1Q82T 4NX9A 1WTBA 4DV5J 1PIEA 4DUYF 3CJ0A 2M5YA 4C8OA 1FDBA 1YI2S 1XR5A 1WEYA 3FMBA 5AE1A 4ES2A 4DR2F 1N5QA 5EGYA 1M5PC 2HVIA 4DCPB 3LP2B 2YTCA 1BC6A 2YQ3A 2AX0A 3MEEB 1S4EA 2AEFA 1NEEA 3LWLA 1SUQA 2V63A 1VJWA 1HBMB 2YNGB 3E3XA 4K50A 2RUSA 4QYZJ 2YVSA 4RW8B 2YX4A 4PQAA 3A8EA 1U6BA 3C16A 3IBFB 3N79A 5LJ3Y 4PWWA 2ZE2A 1VI7A 2NXJA 4Z2XA 3CO9A 1NK4A 5ETPA 4LF7J 2OKQA 4HH1A 3V6DA 2FIUA 2DRAA 3H98A 2XULA 2C2DA 1HNVB 4ILRA 5KFKA 2IBKA 2O1PA 4V19J 4WCEQ 4IR1A 3GIKA 1JLAB 2B7BB 2CPJA 3DDNA 3LW5C 4B3TF 3ZZUA 3C14A 3T5HA 4OZ3A 4LF9J 4HEA9 1HWJA 1E6VA 3JTNA 2ROGA 3K59A 3CCRS 5GMDA 3CSKA 2BBEA 2LQ9A 2NYIA 4LQ3A 3KTQA 5J2PB 4Q0BA 4I6WA 1FKOB 1GK8A 3GPAA 2H48B 2B43A 3F44A 4I6YA 4Q43A 3D6TB 4C8NA 3TEHB 4OHWA 2VQFF 1HQEA 1N32F 2LECA 2PSZA 2PIIA 4JBCA 3W8PA 2I38A 3NNHA 2F9DA 1UEKA 3UR0A 4PEOA 3BKFA 1JXEA 1TP7A 4ECQA 5L1LA 2OPPB 4J9RA 2ZJRQ 2J0SD 3FZ2A 4NL5A 3BYPA 4NE9C 4NLVA 2ZDOA 2UUBJ 4DQRA 3ILJA 4X64J 2VL1A 3KUHA 2ZNYA 2IAJB 3LGNA 5D4NA 1GEHA 2ZC4A 3EDRB 3U02A 2HNDA 3HZEA 2EPIA 1B7FA 3W8GA 2CQDA 5E3PA 5EWGA 2DISA 4TU9A 1XNRJ 4UUXA 3CIMA 1HI0P 5KOXA 2F65A 1IKVA 3OFHA 2DGTA 4GKJF 3HHLD 3IP0A 1X4CA 1I5OB 5F0WA 5HJXA 2Q66A 5LJ5Y 3W61A 2DNLA 3T1YJ 2XZTB 4ZPBA 2R8KA 4NPOA 1CJKB 2HYIB 4I1TA 2HHTA 3FK4A 1E6YB 1J5EF 3CE8A 4F04B 1KHWA 1RT7B 1PJ7A 1JLEA 3HULA 4DLGA 1NKCA 1HNWF 4OV1A 1CS4B 2MQMA 2VPWB 5J2QB 2AT1B 4LSLA 1JB0C 3C6UA 3D1OA 1UZHA 1TKZA 2J6SA 1FO1A 5IM0B 1Q86T 4ZVRB 1Y7PA 3FRYA 1R89A 3MD1A 2CWXA 4QQBA 4ENOA 3OR1B 2R2TA 1MLAA 4O23A 1URNA 2CQ4A 1XMOJ 4CLKA 2EFGA 2ZBQA 2IC3B 4DQQA 2E7WA 1YQHA 4NLSA 3V6JA 3A13A 3W7BA 3SV4A 3AHPA 2GS8A 5A6PA 2E1MC 2QYCA 3UDLA 3QGHA 3OXLA 4YB1P 1UEUA 1URRA 3SMZA 4ZDNA 1B4SA 2D3ZA 3NBPA 4LQ9A 2KZZA 4AXJA 2I5JA 4CNYA 2IJFA 3CJ8A 1W25A 2W8LA 1SC6A 2R7SA 2AGQA 1Q8LA 5L1KA 3Q8SB 3H8YA 3F41A 1DTQA 3MM6A 2NXNA 5M2RA 4IO9Q 3IXQA 2NYHA 4JP8A 1YDLA 2HHSA 4QWDA 1FESA 3OL8A 1T9XA 3UPFA 1T05B 4LF6J 2EFNA 4OJGA 1BE4A 2BA9A 5AE3A 4OYOA 1T94A 3BGLA 3DOKB 1R7IA 5EN1A 3FCVA 1CEZA 4FYVB 3TNVA 2XY7A 4LSNB 1IVZA 2JRSA 3DMJB 3PZPA 2XHWA 3WC2A 1XERA 1NDPA 4MK7A 4OHVA 1U45A 3KJFB 1TL3B 1T3OA 3WIUA 2DRBA 4OZ5A 2C2NA 1Q8IA 4WFZA 4RZRA 1DQ8A 1RQ0A 4F7VA 2OFHX 3MEGB 2WOMA 2GHVC 1GMWA 2MYFA 5IQQA 4OYIA 2RMLA 3IR5B 4ZVGA 2VG6B 4CT8A 2HWTA 2ZH1A 4IH5A 3ISNC 4G1PA 1SJ1A 1WOPA 1R0AB 2W24A 3QIPA 1AYEA 2HBQB 1PJ6A 2EG1A 2GCFA 4DV7F 4FKXA 2BE2A 3I5BA 5IT9U 4KFBA 4NZ6A 3DHWC 3OVBA 3KLFB 3TJAA 2A3JA 4UY85 4UY8T 3OPKA 2CJQA 1VQPS 2C1EB 5E3RA 2AEMA 5C25B 3R7SB 3GIIA 3KK2A 3M9MB 3IBCB 4M5GA 3HDSA 2HPUA 4OX9F 1T02A 2RU9A 5HLFB 5IT4A 4O0IA 4H54A 2EKYA 1OPIA 2QFIA 5HROA 3K5OA 1XN9A 3GWCA 2W7OA 1UCNA 3QLHB 5CCMA 4OJ1A 1KRPA 1R27B 1PKUA 1NHVA 1YBAA 1C1CA 1FRHA 2HHWA 2YWFA 2ZOFA 1WHYA 2EFOA 2VG5A 1KOOA 5A0YA 4KQZA 2Y8YA 2NLWA 2UUWA 3CC7S 5KAKA 1LV5A 4QIVA 1N56A 1BUXA 4OMFG 3IO1A 3DOMB 2IA6A 1N5YA 4WJBA 4RW6A 3H5SA 1N36F 1P6TA 2QZ8A 3SYZA 2V9WA 3F0NA 2ZH6A 2KO1A 2ZH5A 4URGA 4ZJQA 3EZ5A 3T5LA 3PO4A 1FVQA 4GVBB 4ZJOA 2D3UA 1KNZA 4YDDB 2LCWA 1WG5A 1RAIB 2CQIA 1FRLA 2V69A 2HS4A 3H42A 2M88A 5T41A 1U1KA 3FEYB 2Y3YA 5J1EA 1X4EA 3AY0A 4D3HA 1UAWA 1REVB 2A6MA 4ZCIA 3D0HE 4J9QA 1YJ9S 3DOLB 2BKNA 2KN4A 3DRPA 4O4GA 2G13A 4LRBA 3CIZA 4ZVUB 1CJUA 3I31A 2MZTA 2PEBA 2G4BA 4ED0A 1IWGA 2FLLA 2NPFA 3QMQA 2VDIA 1RA7A 2ZVSA 2G2ZA 3D9BA 1ZPWX 3W1YC 1HFEL 5IT0A 3KK3B 4PG5A 4NLTA 2LEPA 4YQWA 2XMAA 4I69A 3HP6A 2HIYA 3ENQA 4QWEA 1S9GA 2VPZB 2XO6A 1MMLA 2JZ5A 5IOLA 2WSCC 4IFYA 4FS2A 1PSDA 4WYWA 3KLHB 1Q0NA 3Q2SC 2ILZA 1HBOB 2BW7A 2CJYB 1HHSA 3N5BA 2XQCA 3DRSB 2DGOA 3JTOA 3EDQB 4IQXA 3FQKA 5GADI 1S57A 4J90A 2H4YB 2MTLA 4UQGA 1ZM2A 2XSFA 3Q8YA 3ICLA 4K2JA 3PV8A 2JVRA 2CQ3A 4ZN1A 2C3PA 4U8YA 1VGYA 1JKHA 3FC9A 4NMLA 4USIA 4H4OA 1RGVA 3U1LA 1TAUA 4NCGA 1NDLA 3S01A 1NKBA 3VVUA 1TZ0A 3FFIA 1U2FA 4PQUA 1IKXB 3QQCD 1UVLA 1CULA 2ZWPA 2MZ1A 2HZCA 2CXEA 3RZAA 1T9WA 3QJJA 3LP1A 2E9RX 4AD6A 1WC6A 1JQGA 3GJTB 1AZSB 4F67A 4DV3F 2HS3A 2ZFHA 1AT1B 3R1LA 4PG4A 1RTJA 2BANA 5T7LB 3I55S 2K3IA 2RKIA 1S48A 1CJTA 3TR5A 1UJ4A 3T6BA 4I2QA 3N6MA 3I0SA 2DR5A 3HVTA 2MEWA 2GQ2A 2J8AA 3O1LA 2IFXA 3QRRA 1F60B 3HT0A 2AP6A 4WK3A 1X5SA 3FZBA 2HNZB 5D0EA 3ZZPA 4FZVA 1LOUA 2ZJQQ 1CSJA 3LH2S 4J9SA 2VQEF 4MKAA 3OQ2A 4EYHB 3CCSS 3HX9A 5KG4A 4PPDA 2Y0SD 4WZQA 2BOPA 1U26A 4DSFA 4PUOB 4EMDA 1SJ3P 2YKOA 3I4HX 2OTLS 3MCNA 4MIWA 4Y28C 3X1LB 4B3MJ 1VMBA 2ZOGA 5B09A 3BKTA 3N01A 1OJ4A 3KYLA 1M5OC 4UOHA 1WKKA 1YVFA 3WQPA 3B4MA 1S6OA 1QUVA 3SV3A 1JLFB 3HFVA 2WTFA 2QFJA 2ADCA 3ZXWA 3OFGA 3NEKA 1S6QA 1GTHA 1Y3KA 2E5GA 1NMEB 1RWWB 2V94A 2R8IA 4LBIA 3E01B 1T9UA 2D9PA 1VK3A 1OPZA 1R6YA 4NLRA 2BJ7A 2FLPA 3LO3A 2UP1A 3SQGB 2GW8A 2R7UA 1U2RA 2Y9HA 1V5VA 2H51B 1OYEA 4DF8A 1C0UA 1S0MA 2QGFB 3BR8A 3EMTA 5IZHA 4ECSA 1FJEB 3W63A 3M8SA 1MNEA 3LUYA 3ISZA 4X65J 3JSMA 1TFWA 4JI8J 2B4PA 1GX6A 2F40A 2VASA 2BJ8A 3PY8A 1K0VA 1UETA 3UCGA 2KKHA 4HR2A 4X66J 1UW9A 1HMVA 2XYGB 2G2YA 2NREA 4CP5A 1U09A 2GGPA 4USKA 1Q7YT 4LF4J 4NI2A 1WEZA 5AXMA 3FBFA 4YR0A 4P2FA 4P2XA 5K14A 2YKQA 4YHHJ 1Z2ZA 4MKBA 5KFLA 5J2MB 3CCES 3D6FB 4QW9A 1GMUA 4HTJA 3DLKA 4DV2J 1OSDA 5L9XA 3AD8C 3DLJA 3HHLB 1VBKA 3A4TA 4F2RA 2W9CA 3VCDA 3IS9B 3P4UB 4DWIA 1HNIB 3NL0A 4WE1A 2R8GA 4KV8B 2H1YA 3OLAA 3MD3A 1F0XA 4K0KJ 3BGOP 3CDUA 3G9CA 2IRXA 4PRFA 2HQDA 3TVKA 2PO4A 1CJVB 1UFWA 4ES3A 4HT7A 4JI6F 2GMLA 1RT1A 1VC6A 5G0RB 4HI2A 1IKWB 2BJEA 2KT5A 1I51B 4KIAA 3BQ0A 5C2CA 5ETLA 3KG0A 4DPTA 3OHAA 3MFHA 2VFVA 1JMTA 2ZH7A 1T11A 2EI5A 4CO5A 2DPJA 1LWCA 4ICLB 2POKA 3EZOA 4CH1A 2XM3A 3JS9A 1FFGB 4HT5A 3RTVA 3KJVB 1NJYA 2MKJA 4M63A 2OPSA 2IHR1 4CLFA 5A8RA 2QLJB 5FIIA 4CYUA 4N8NA 1Q81T 3Q89A 6FD1A 2MQPA 2WVCA 4Q7AA 1S7IA 3IRXB 3ZZZA 3SEOA 2RRAA 4LF8J 2ZM6F 4NCBA 2E44A 1WC4A 3OFFA 1W2BR 5K8MA 4FF2A 1R8BA 1DTTB 2CPHA 3SDEA 3DXSX 4B02A 1FXLA 3PIPQ 2DR7A 2FD2A 4LSZB 2XSJA 3NWRA 4UOCA 2DY1A 2Q79A 3PYEA 2IVMA 1YKWA 4NXMJ 3K5MA 2EBEA 3MAAA 4B3RF 2M70A 3QATA 4ANDA 1MROA 2CJKA 3GYXB 3Q83A 3VGUA 4FS1A 3OL6A 3WDOA 2CDQA 4RUCA 1GQEA 1IR0A 3HI9A 2GIFA 2VF3A 2XCAA 4C98A 3VZHA 1HWIA 4C0OC 3AJDA 3H59A 2OJ3A 2CQPA 3IM9A 1RTDB 2NZ4A 4KO0A 5C24A 3MR3A 2LKZA 1SKWA 2OH2A 3HHEA 4Z7CA 2JOQA 2ZKTA 4OI3A 3T9NA 2GJ2A 1B0TA 2HHXA 1U1OA 2RVJA 3P5TL 4KGMA 4KAIA 3Q8VA 2R2RA 2XWYA 4C4WA 2HZAA 2FJBB 4DV4F 1NDKA 5KFMA 3D1HA 2VG7B 2J76E 2BQUA 4AL7A 3D6MB 4RX6A 4OLPA 2ACMA 4CTAB 5A2QY 2BUNA 3CJ4A 4QIWD 4IOCQ 4DR4J 4P2SA 4DLEA 4GKKJ 2EFVA 3NS5A 5AJ3F 4JB8B 4IFVB 2DNKA 2AJ1A 2DD8S 3O3LA 1YJVA 1FRJA 1SL0A 8ATCB 4Y6IA 1YK9A 1S6PA 2AZ3A 3DXBA 1P8GA 4X4OA 3PNIA 3T19A 5KG1A 4WWSA 1DLOB 2CJ9A 1JLBB 1N34F 3DLBA 2YX1A 4P9SA 4I64A 3KNGA 4W98A 3DU5A 3M8ZA 2A6OA 3HVRA 1YZ6A 3C6TB 3MCSA 4ZPVR 1RP5A 3W5XA 3OVSA 4WP9A 2N3LA 2I6WA 2W4PA 2KFZA 3TAPA 1BQNA 2RHSB 3BYRA 1D0EA 4RW4B 3IGNA 2K1RA 3MR6A 2FJDB 2FHKA 4DQSA 1B7YB 4CIOA 3CVKA 4ECWA 3PW5A 2CPXA 3KLEB 3B6BA 1PAUB 1HNZJ 5KFFA 5J1PA 1F1BB 2HK3A 3RB4A 1JNZB 3OJUA 2FVRA 3HKWA 5HK4A 4ZPDA 3DM2A 1S0NA 2M52A 3D3CJ 4C0HA 3D67A 4DN9A 1YIJS 1QAJA 4DG1B 3MM9A 1FF2A 3SIPB 2HQGA 3OXFA 2DPIA 3EPIA 1H2UX 3OSNA 1MW7A 1Y9OA 2RJZA 3BQ2A 3T5KA 3PX6A 5EHHA 4DV1F 3NGDA 5RUBA 2V68A 2BEFA 4KGZB 5KFTA 3PVXA 2AIRB 1S99A 1SV5B 1RT2A 2JLEA 4LFBF 5B0CA 4KHPF 1N5SA 3G87A 2W9BB 3SI8A 3GFHA 1VYAA 1ZZNA 3M2UA 2UV8A 1KD1T 1S1UB 2MJUA 1RLCL 2DKOB 2NCKL 3KLIA 1BHNA 1KC8T 1YZ7A 3B82A 2JLFA 2QG9B 3M7VA 2FJWA 1KVKA 5K20B 2FZCB 2X1AA 5LMNJ 1OSCA 2FTRA 2YKNA 3TX0A 1LQ9A 4KH0B 3SZ2A 4JI1J 1OY8A 4QPTA 2DBBA 1HD0A 3BBBA 2RE1A 2VC0A 1S1XB 4GVLA 2FVPA 2DH9A 2DNHA 4RWXA 4CH7A 3ONQA 1Q79A 2OD4A 2VFRA 2MZJA 3GG0A 2B51A 1RWOB 4XK8C 2OPQB 5LMUF 2LA6A 1VR6A 3IR7B 3LAMA 1XMBA 3WX4A 3JAMU 6AT1B 1R6VA 2B6AB 2MGZA 4AXIA 2ROEA 2F63A 1S1TB 4CO2A 4RNFA 4FF4A 3I9V9 4RKUC 1QAIA 4QOTA 5CQGA 1YGYA 3TAMA 5SUHA 4K8RA 1RHMB 3QBCA 4QR1A 2C2KB 4BHQA 1EARA 1WELA 5DGAA 3G82A 2F4VJ 1CVJA 2WZ1A 4JV1A 2V4QA 1VQKS 3DU6A 1RT3B 4ZLLA 4DV6J 3M1VB 2AYMA 1RUSA 2N3OA 3IRWP 4J37A 1TKTB 5HMYA 2DCLA 3VHQA 4Y2KA 1S5ZA 4GO5X 5DETA 1HLWA 2PFFB 1R43A 2CQBA 2CQ2A 3Q0AA 2CUYA 2PA8D 4FPIA 2MKHA 3HHLC 5EUHA 1YHQS 2EKNA 3LF0A 4KB7A 2XWXA 1H74A 1YWXA 4OI6A 3IWLA 3W9HA 4MFBB 4USMA 5DQIA 1RA6A 1HW9A 4EBDA 3JQKA 1GNKA 4M5DB 5E3AA 1HQ2A 4CT9A 2LMIA 4NXNJ 1NDCA 5K8NA 2PE8A 2HZVA 5IWAJ 1WDTA 7AT1B 2AKWB 3LP2A 1NJXA 2WW4A 4YB5A 4K4TA 5DG8A 1RTHB 2I9SA 5D3GB 2R4FA 3NG8A 2F8EX 2VFTA 3AA8A 3GV7B 2CQHA 3C15B 4RW8A 1G4CA 1TV6A 2ASLA 2GC8A 2HVDA 1MWZA 3G86A 1T9TA 3MR7A 3M8PA 4DSJA 1UTAA 3TO8A 2CQCA 2V0NA 1UWBB 2A2DA 2ZBIA 5I3QA 4IG0A 2BDPA 1JLAA 2KJVA 3RYLA 1LWEB 1VQYA 5CD4H 2QLWA 3H7HB 1FTCA 3DRYA 2FYXA 2UUTA 3KJNB 2PI4A 5J2PA 2GJIA 4UOFA 4Y2IA 4F0MA 1S12A 4DUYJ 1JJCB 2UZAA 1DBDA 1UZDA 3UO0A 4G3IA 2YBVA 3QGIA 4ETXA 4DX8H 2XC9A 4YR3A 4DR2J 5EX0A 5KFOA 1S9FA 3ZTOA 3V4MA 4WFXA 2CZVC 2HBZB 1LNQA 3CCWA 3KK1B 4XPEA 2KU7A 1RKIA 2MLYA 4BCAA 1KHVA 2YNHA 1PCAA 4U95A 2EWHA 2J7UA 2W4DA 4TY8B 1RWNB 3V5RA 1T9YA 3FSXA 3LGHA 2AYGA 2Z2ZA 4J9LA 4P71A 4W92B 4OYWA 5EWFA 3JYTA 4DPXA 4K4VA 4B3TJ 4HVZA 3BN7A 1REGX 1WC1A 2B9YA 1YBTA 3MAHA 4KY3A 3EZUA 4X4QA 5K9FA 2XBPA 4NLDA 4LJMA 1V9OA 1HD1A 2AD9A 3BGFA 2E9ZA 1SB6A 2DR9A 1R0BG 1Z2LA 4USVA 3J81j 5CABA 2HFZA 2Y0BB 3WHIA 2R9LA 3RBZA 2BXJA 5F8GA 2VQFJ 2GVZB 1ULRA 1N32J 4JYAF 2P6TA 1HI8A 2HLTA 1RU1A 3QT6A 5J2QA 5LXYA 4KGVB 3W2VA 1RE1B 4ECXA 2JC1A 1KN6A 1ZZFA 2JSXA 1G1XA 5D6GA 2OSRA 1YBUA 3MECA 1KFDA 3J7YU 3POTA 2RAQA 1V3SA 4IH6A 4PABA 5I3UB 4PG6A 4X62F 1BWEA 4DR7F 1SIZA 4JI7F 3HVAA 3PRDA 2WSFC 4C6AA 3W9IA 3MURP 2Z8QA 5F8NA 2HSEB 2IC3A 1EP4A 3EICA 1O6XA 2IYIA 4GKJJ 3MCOA 4ZN3A 2UXCF 1QTMA 3HCXA 4FXVA 4NLXA 2YPYA 3MM7A 4CO4A 4W4MA 3TOQA 3QGGA 4I56A 4ECRA 1NB7A 1YJNS 3LALA 1QLNA 3I0RB 4P74A 4ZOSA 2W1BA 4Z37A 1OS5A 4DR5F 3ZNJ1 4EZ9A 3EGNA 3EPGA 1J5EJ 4L76A 1APSA 1LW0A 2Q6BA 2V2QA 4WXOA 3ENVA 4OLOA 1SPBP 1RB0A 4ILLA 2J9DE 1UVNA 2HNYB 1HNWJ 1EJ7L 3CJ5A 2UUCF 3AB2B 3ILIA 4XO0A 2VDHA 1TTHB 1HQUB 2ZBPA 4CCHA 1VQLS 4O3OA 4EI2A 3BGRB 1X4HA 4KJIA 1T05A 1VBYA 1Q1KA 3FSYA 2N7YA 2UVRA 5KT7A 3M8YA 3MWBA 1FERA 1XJWB 3JQJA 5F9LA 3PEHA 3DOKA 1PC5A 3ZTQA 1WDDA 2Z4PA 2QN6B 3J7ZT 1KQFB 4OIXA 2HFOA 3HLUA 3DMJA 4X84A 5HVGA 2UVVA 1UL3A 1RACB 2ALYB 1NKEA 5KG2A 2B4UA 1C4AA 4HYKA 2VD3A 2KTQA 3EWGA 4QU7A 1N33F 2G1DA 2IJRA 2FDNA 2C42A 2MZRA 4LIWA 1CQMA 2C2EA 4CLSA 1LFPA 2ZKUA 1NU4A 2N4DA 1SCJB 2WRMA 4C7QA 4QJVA 1D9AA 3VAGA 2ASYA 4ZHRA 3DLEA 3D66A 4UOGA 5KFVA 2VOOA 2AYEA 1I94F 4EBCA 1HHTP 1UVMA 4MIAA 1T03B 3UWTA 4CO3A 3CF5Q 3SSRA 3DDKA 1FNMA 4DV0F 2AWZA 2F3JA 4I7FB 2MY8A 3KLFA 5KT6A 2QA4S 4DEZA 1VISA 2R7QA 4EYIB 2DNQA 5HANA 1GH8A 1UJ6A 3TEGA 2VONA 4DL3A 4Y0FA 4JV2A 4GO7X 2CYYA 2J7WA 3K2YA 4IRCA 4ZIWA 2P9CA 2XMVA 3ELHA 3D6HB 3OTDA 4N8OA 2VA3A 4DSKA 3DYAA 5HLFA 3H90A 3RR8A 1TUWA 4OFZA 2JHEA 3WC0A 1XMQF 1FHTA 1K9MT 5H9FK 3L7OA 1NXIA 2P8IA 2EVZA 3H2VE 2V8DA 1J5OA 2LDIA 3VAJA 2B56A 1SUQB 3CPWR 4GRSA 4YOEA 3W5YA 2KG1A 4NA2A 1RZMA 2HQIA 2M8DB 4WIIA 4MJKA 1M5SA 2LVWA 4JI0F 3C8YA 4Y65A 3M6WA 1IBLF 3RBXA 4DFPA 4I0WA 3KLGA 3V6DB 3NNCA 3PW4A 2J0WA 3S1TA 2X1BA 4AQYF 4YEAA 4C8YA 1O8BA 1NM2A 3DOMA 4B9VA 4DV7J 1E6VB 2XI2A 3DLLQ 4RW9A 1X4BA 4DR6F 2JEFA 3NAHA 3U1MA 4DHVA 2V5HG 1N8RT 3PX0A 3N5FA 1RK8A 4EU0A 4LF1A 3JQMA 5HATA 3RUBL 3GG1A 3KUEA 1ICEB 2QLFB 5ETVA 2W2OP 3MTKA 2XI3A 2DGVA 3DOLA 5F3ZA 4YUDA 2QYGA 4KTQA 5CAAA 2HWIA 3L7PA 2EC2A 3N6LA 2VJVA 5DM6Q 1A6LA 3U7JA 4ZVPB 5GAHU 3FNNA 4M5KA 2Z56B 2HNDB 1S49A 2D3OR 3FBCA 3H5YA 5KFRA 1WORA 2EG2A 4NYZA 8AT1B 2VBWA 2HFVA 2H3EB 4A8WA 5LSLA 1UEVA 2L9NA 5KFXA 3M4XA 2V2KA 3NS6A 2DNMA 2P9GA 5AXKA 1N36J 1HBOA 2GAGC 3KFWX 1B99A 1FJGF 2Q6CA 2YWHA 1LW2B 1NSQA 1CPZA 3CD6S 4BC9A 3EVMA 2F7VA 1FNXH 4M1KA 2RHQB 3Q23A 4BWJA 4YP3A 2JFKA 2V4JA 4CLWA 1WI6A 3MOZA 1Y11A 4O3NA 1F5BA 5HL7Q 4C97A 2MDAA 4J91A 3OBIA 3FMWA 4F02A 3J7AN 4TN2A 2IDEA 1SXLA 4CLZA 3C6UB 3I9ZA 3NLCA 3RAMA 1UP1A 4DL7A 2AMCB 2V50A 1VQ5S 3HT3A 2XMMA 3D4JA 2APOA 3GILA 4ECTA 2JJ4D 5J2NA 3LA0A 1NH8A 1NO8A 2EEYA 3CC2S 4P6QA 2DK2A 1M1GA 3MM5A 1RTIB 4HACA 1AZSA 2P2CB 1S9EB 2NZCA 3UVJA 4QWCA 2HHVA 2QLXA 1YRXA 2IRUA 4ED7A 3CO0P 5ITHA 4MTPA 2GVDB 2WB1D 3KKFA 2LQ8A 2HVHA 2UUAJ 1JNRB 2FVQA 4ZP7A 1BQXA 3QT8A 2WVBA 2GAHC 1G2EA 2YWWA 3E2EA 3DI6B 2QIFA 1W2IA 4F4WA 4DPWA 4OZ0A 1DTQB 3MM6B 5LOQA 2XMUA 4OYPA 1RABB 2V8HA 3DGPA 2VKRA 3EGZA 3TUZC 5DO2A 4TYBA 2AJ2A 3CULA 2YWGA 5JJBA 2RQKA 3PXGa 3CUNA 1S1WA 3BBFA 3W3SA 2A10A 4PUOA 3NCRA 2EFPA 4OX8A 4Q8FA 3QNWB 4ZVEA 1DRZA 2E7VA 5A76A 2RD5C 1MU2B 3K5LA 4FVMA 5DLFA 3MTJA 1N5TA 4P10A 2OFGX 3QGPA 3BDEA 4TLQA 3VF0B 1U7LA 2B9XA 3KMQA 5D0HA 2KXFA 4DV3J 1H7XA 3PIOQ 3GJQB 1FKPA 1JLQA 4I6AA 3OVAA 1QSLA 4P73A 1AXQA 3J81U 1FJCA 2VUGA 1RTZA 2GNKA 2PMZD 3CCVS 2OO4A 4NEYA 4LRAA 2C3MA 1RT5B 3VGSA 5U47A 3D0GE 2BRKA 1GMVA 3G96A 2BE9B 1NSPA 2WOMB 2FB0A 1VC5A 1P9QC 3EYZA 1WNEA 1FNOA 3QAUA 3N0VA 4ZPTR 2VQEJ 2M0GB 2IMOA 2LP4A 2J0XA 2Z2YB 2CG4A 4ZP6A 2MKYA 3BGUA 3QFWA 4Q5VA 1IBKF 4ECZA 2EK6A 1R31A 2FY8A 1AA1B 3FCWA 1OMSA 2HHPA 3MPDA 3CD5A 2IM0A 7FDRA 1BGXT 2WVFA 2MXYA 2FJVA 3FBBA 4UUWA 4LBPA 1AB8A 2RQMA 4L3KA 1SC3B 2K8GA 1EX8A 1WHXA 2HQ3A 2AW0A 5J2MA 3LAKA 4K5SA 4IO1A 4ANEA 4F26A 1MG7A 2BR0A 3KK2B 3IS9A 4CM2A 1RHRB 4YMEA 4G1IA 1HNIA 5HAOA 3KG1A 5HROB 5ETOA 4HLBA 4C8MA 2YKMA 4S0MA 5HSPA 2RDJA 4X2BA 3PM9A 2CPFA 3EVOA 4ER8A 2EBGA 1HBUB 2DTJA 2VFSA 1FRIA 1RYSA 3T1HF 1TUVA 5A0YB 5G0RA 1M5HA 4M5HA 4URQU 5IV3A 2V2ZA 1DARA 2P9EA 4UZCA 3QT7A 1NJZA 2MY7A 1WHVA 4TKTA 4ICLA 3P45B 3Q8QB 4RUBA 4K4XA 1RXOB 5D4PA 3H25A 3KJVA 4UTGA 1N5YB 4RW6B 2N7CA 4RBVA 2MSTA 4KGXB 3V2UC 2IIHA 2BABA 3FUYA 4DZDA 4USHA 2DR6A 2L48A 3KOAA 1BWVA 1F2GA 1RKJA 2DH7A 4OYAA 1P27B 4ED8A 1A0OB 1W7WA 5J1EB 4MT1A 1SKSA 3IRXA 3RBEA 2JH3A 1ITPA 2XLIA 1AFIA 3DRPB 1Z1ZA 3ENAA 5C7PA 3NGKA 3J7YI 4ETZA 1SC1B 3HHDA 4RBTA 2C28A 2KL8A 2AJ4A 2RH3A 1IWAA 5AXNA 1DTTA 5KT4A 4NMXA 5AT1B 4CO0A 3EUNA 4JI6J 2M9KA 5CYJA 1VIOA 3IG1A 5HBMB 4DPUA 4V19X 3MPYA 1P9YA 1S9GB 1ZTTA 3EGWB 4B9SA 2B8PA 2F4FA 4RNNA 3J7A1 1VLOA 4IFYB 1RI7A 2OGUA 2PA3A 2FLNA 4QU6A 1OY9A 1FDDA 5ETNA 4A8KA 2M2BA 4Q8EA 4Q45A 2BM0A 1XR7A 4J9NA 1RTDA 3R2DJ 2W2PP 3ZTPA 3M8QA 3Q24A 5B0GA 3J80Y 3ZZ0A 2R2UA 1D8ZA 2KVIA 1DZ5A 5KT5A 2OLWA 5DG7A 3MI7X 3TP2A 2IVYA 4DS5A 4AUKA 2ZM6J 3BQ1A 2MJNA 1JKHB 1YJTA 4OYBA 3H2LA 8RUCA 5C5JA 4JUZA 4H4OB 4NCGB 3AOBA 3CCLS 4B9UA 3UDEA 4CH0S 3CCJS 3E8OA 4CTAA 3FFIB 3V4IA 2FHJD 2QA4G 2CVIA 4ED5A 4IFVA 3TJ9A 4QCLA 3LP1B 5E41A 3OR2A 4B3RJ 2ROPA 3UFCX 1H73A 5E33A 1DLOA 2X1FA 1JLCA 1TL1B 2X7IA 3EM1A 1CJTB 5F9NA 3PHTA 3I0SB 2GA7A 4FYDA 4OV6A 4LRDA 4WKYA 1TKDA 2LYVA 1JIHA 5LL6d 3MMAA 4TU7A 3CMES 3TVZA 2SXLA 3PYFA 1UVIA 1VC0A 3VR1A 3HK2A 1NH7A 3C46A 4DF4A 3CJRA 1MWQA 4YR2A 4ILMA 5D77A 4DV4J 2HK2A 4PWUA 4AE5A 1X60A 1HW8A 4R0EA 4FF1A 4FNIA 2J6TA 4X4VA 1MN9A 2RDDA 5AJ3J 4J9MA 1HR0F 4J9VA 3M9OB 1X0PA 3Q2TC 1WTFA 3UR3C 1TQLA 4DG1A 1FA0A 2JLGA 5JMNA 1F9EB 5ETQA 1N34J 1FX2A 3KNAA 1B0VA 1TK0A 3NNAA 4LVNP 1RHUB 4CLTA 2JEIA 1HBNA 1UFLA 5DJBA 2J9EA 2E5LF 4MKVA 4OQJA 3CT9A 2OEKA 2LFVA 3H5UA 2Z57B 3HVWA 1NJWA 1QVFR 2VFUA 1L3UA 2H5JB 3Q8UA 1HPZA 3RW7A 3GQCA 4OZ1A 2NXUA 5HO4A 1U02A 2DEJA 3D2WA 2W9BA 1RWXB 5DDRC 1L3TA 1U2CA 3ZO7A 5EX3A 3TZWA 1S1UA 1Y10A 3JSMB 5GMEA 2XCPA 4FPRA 4LF2A 1FCAA 1TK5A 1H3DA 2CPDA 1XK8A 1JXVA 1YRUA 3U1NA 4LFCF 4CLPA 2W9AA 4NI2B 4IUFA 3BB5A 3KHRA 5K14B 3FJ2A 5BR8F 2C3OA 2AYBA 3MEDA 1JK9B 2PFDA 3DLKB 3DC2A 1M5VC 2EK1A 2GQQA 2YH1A 2EXUA 1S76D 2BJ1A 2FUG9 1Q8BA 4WTOB 5CA5A 1RT6B 2W9CB 5E0OA 2C2OB 1TVRB 4RU2A 1H2TZ 4DV1J 9RUBA 1PBUA 5GAHI 3G6XA 1ZTWA 2XLKA 1QVGR 3P6YC 1EKSA 3TZZA 1U6FA 3PHEA 4DL6A 2B6AA 1Q5YA 4DX5A 1LK7A 2OI2A 2H9ZA 2HIQA 2XMWA 4LFBJ 3C2PA 1WHWA 5DLGA 2YNIB 1NJIT 1RT1B 4KHPJ 5LT5A 1OO0B 4MH8A 3BKUA 4ZP9A 3QO9B 3KUGA 2HFSA 2ALZA 4LF5F 3QZ7A 2ZBRA 3KJQB 1LWCB 1H2VZ 4NZ7A 2CAJA 3RG6A 5D8HB 9ATCB 3EXYA 3I96A 1WC5A 3N9UC 2V9KA 2OPSB 2MLZA 1RWVB 1T9VA 2ZUAA 4OI1A 3M30B 2PGCA 2Z2MA 1K1SA 1XC9A 4WKRA 4D3GA 5DZ6A 3RBDA 2QT7A 2CFXA 5I42A 3T3FA 4H4KC 3QWPA 3C19A 2Y1RI 3R5JB 5A2QU 4MFBA 2OMOA 2RUGA 1GAOA 5LMUJ 1X31C 1Y0HA 3D68A 1VRTB 2GZOA 3OJSA 2AF6A 4ZPAA 3R27A 3LTOA 3B54A 1ZM4A 1QE1A 5SZTA 3R5DA 4HH0A 4OI2A 1N88A 4RW7A 1GFWB 4KT0C 4M94A 3RR7A 1F9HA 2BZ2A 1KEKA 4R25A 2XSJB 1FRKA 4C3LA 1RSCA 2CNLB 2HWHA 2YX7A 3O8WA 5HMXA 2Z0GA 5D15A 1MWYA 1RTHA 2XO7A 3MAAB 1KP6A 3UCUP 1BQMA 3GP9A 1MROB 1N48A 1Z4UA 3QT5A 1KLNA 4WFBQ 1U1NA 3C15A 2GX8A 1FDAA 2KVQE 2RDIA 1F5CA 2GV1A 1KSPA 2IRYA 5IXUA 4U6PA 1FRXA 4IRKA 1A7GE 5KFHA 3PG9A 3H0PA 4NRUA 1HYSB 3KWMA 5C24B 3EXCX 5H9FJ 1O5JA 3I6PA 1AUSL 5F3TA 1WC3A 1PJ5A 3MGJA 2QE5A 4A8OA 4LMZA 2RRBA 4A46A 5FDLB 3AD7C 4LUBA 3AH6A 1X5PA 4R8UB 5CYQA 2QX0A 1UJ5A 2B9EA 1WUUA 3UD5A 2V8VA 1VRUB 3CDWA 1NAQA 2UUAF 2CPYA 2BM1A 3C66A 3ILOA 3GYGA 4LRFA 3OUYA 2C2RA 2RQCA 2ADBA 5GVQA 4QZVB 2FLOA 1VBXA 3KK1A 4OJ3A 3DLGA 3SQOP 1IXKA 3CEDA 5CYMA 4M5IA 3AT1B 2FJAB 5FLXY 2CIMA 4L3NA 3S6EA 2ZD1A 4XIUA 3HKZD 1NK0A 1B3TA 2HMIA 2KHDA 4CZCA 2GMJA 1VQ8S 3EJMA 2HFNA 3GE9A 1FXRA 1BQNB 1WG1A 2CJXB 4XDDA 2XNRA 2V34A 1YITS 1KTQA 4TVAB 3IBWA 1U6ZA 1TL7A 3PACA 2KRRA 1K8AT 2AQ4A 1H6KX 1NK5A 3T9ZA 3CW2C 3R2CJ 5GMKa 4LR9A 1C1BA 1XEZA 4NLYA 1UWAA 1R3NA 3DRXA 2FVCA 1F3VA 4X4NA 2RT3A 4U9RA 3MOJB 4P2MA 3MCMA 1EIYB 2DNOA 1NHUA 3UI3A 1FTRA 3WZ0A 1J27A 1RBAA 1HARA 3MM9B 5F8JA 1WI8A 1X5OA 2LEBA 1KKHA 4DU8A 5I3UA 1Y5IB 2WONA 2GIQA 1U47A 3PO5A 2ZH2A 2YNFB 3KHHA 1GTEA 2KYZA 1Y4ZB 2M7SA 2K2PA 2OMLA 5K5MA 2K7KA 2CRLA 2G1HA 3FKBA 3PX4A 2B5JA 1NB2A 3FEXB 4ED4A 4CLUA 4IH7A 2HGNA 3PYDA 1ZYQA 1U0SA 2L3MA 3AQPA 4B9TA 1Y3JA 5KFBA 1U8SA 3TARA 1HNXF 3KLIB 3IWXA 1I6JA 4ZLNA 1NK9A 4X4RA 2YH0A 2RS8A 2HLUA 3ETMA 1EETA 4JYAJ 1FEEA 3GR0A 2DXDA 1UFKA 3SBMA 2YKNB 4MAKA 1G6BA 3AB4B 3MZIA 1VFJA 4IG3B 4C3MA 4QW8A 2NXCA 5C42B 4WTYA 1HQUA 3RU0A 2VC1A 4JI2F 1UPPA 5KT2A 4DR3F 3GFYA 3BGRA 5CD4A 2RF2B 3FRZA 2UU9F 2ZH4A 4DOZA 5B0DA 1BMQB 3MXHP 2ATLA 3CC4S 2DNZA 1TR0A 2UXBF 3NY0A 3HJVA 4OYZA 2CDRB 3LQVA 1HL6A 4USJC 4DSEA 4X62J 2BKOA 4DR7J 4AYBD 1JWWA 1TU0B 2C2ZB 4JI7J 5B0AA 4O3QA 2D7SA 1ZOTA 4M5NA 1R8PA 2MGZB 3A3NB 5ETTA 3BPSP 4RUHA 3TI0A 3W65A 2UXCJ 4DN0A 3K0JA 4ZA1A 1XTZA 3RAXA 3Q86A 1HWKA 3MPVA 3G82B 1GT8A 3FDSA 5ETSA 5AXLA 1TMMA 3E51A 1BY9A 1NCLA 3CXCR 1X8DA 2A2CA 1IQTA 1PO6A 3BV8A 4DR5J 1BD6A 1KDNA 1OWXA 3GONA 2OELA 5A8WA 2WBRA 2RB7A 4DU7A 2UUCJ 4NWBA 5ADZA 4DR1J 2BRLA 1H72C 5HQ8A 2ZHBA 1H0HB 4F3MA 5H1SV 1SC4B 1T03A 3VGTA 1N4LA 4U7CA 2CNOB 4OHZA 5IFMA 2DNGA 1Y5NB 1F2HA 1FFSB 1DAXA 5ETKA 2XY6A 3QJLA 1M1HA 2D69A 4ZCLA 3GIJA 4ERDA 4DCJB 3PFEA 4QYRA 2RRNA 3M2RA 1KLMB 2I2YA 3CWJA 1C0TA 1TKXB 2DEIA 1PYOB 2DGUA 3WBZA 1JJ4A 1IM4A 1XIQA 4DS4A 5LSRA 3Q8PB 4Y00A 3D0IE 3AXMA 3M9NB 4NASA 3VTIA 1M1KT 1RYRA 3SFGA 1N33J 5THWA 4PYDA 1LKZA 4ZP8A 2VODA 3PJXA 2ZJPQ 4A48A 1TV6B 1AROP 3ZZYA 1EQMA 2BJ3A 3M8PB 1HI1A 3ZTSA 1PAEX 4ID5B 3M2VB 2Y1IA 4F8RA 3MMJA 3TUPA 4EEYA 1PC4A 3ET6A 4IG0B 5CXTA 4CDIA 4EO8A 3NCQA 5MLCV 2VB6A 2XG8A 1I94J 5A8KA 2ZVIA 3ZC4A 3OTBA 5KFUA 2GIRA 2R7RA 4DV0J 2LXUA 2JNJA 1S0OA 1U48A 1FKAF 1S97A 1V5IB 4ZVOB 1PYSB 2OP5A 3MEKA 2I8EA 1FT8A 1VHFA 1SKRA 1IKYA 1S4FA 2LQJA 1VK8A 1KR4A 2NSCA 2QEXS 1XMQJ 2RSQA 4F4AA 4DSLA 2HBYB 1IJEB 4QWBA 3NWGA 4RBUA 4C8LA 4DCOB 1D9FA 1WKLA 1RT4A 4QWAA 2ZH9A 3QIDA 6FDRA 3OTEA 2HVZA 2YNHB 2JVOA 4JI0J 4C11A 4CQ1A 2HEKA 1IBLJ 2PI5A 2RIJA 4IRDA 2B0GA 3NOGA 4U96A 1VBZA 4N7TA 2E29A 3TZYA 2HKEA 3H40A 5LM7E 1GXLA 3M32B 4AQYJ 1S6UA 2DY9A 1UMJA 3JYTB 2X1GA 4ID8A 3IAM9 2O67A 3AAWB 2IJNA 1LW2A 3K7RA 1D9DA 3R5GA 4NLOA 3PFOA 4DR6J 3H5XA 1EAYC 3GLJA 2D3O1 2LEAA 4BWMA 3TAQA 1WEXA 4WP3A 4KE5A 1RAGB 2BQ3A 3DRRB 3CJQA 4F4ZA 4L74A 1LWXA 4HL9A 4O3SA 1ZETA 3K5NA 1NK7A 3X3UA 2N82B 4IYQA 2DGSA 2F5GA 2BQRA 2J9CA 2OPRB 2HRTA 4ZIVA 2HHHF 4KKOB 2ZZMA 2GHWA 2ATCB 3W2VB 2AZ1A 2BJ9A 2MSSA 1UA1A 2R3VA 4CI0B 3VQTA 3MM8A 3MECB 4E0DA 3L3CA 2JC0A 3PDNA 3POTB 4PR6A 3OTOF 3QZ8A 2CZ9A 3HMJG 2ZHOA 4ED6A 1WSRA 1M0SA 3BH6B 4N5SA 3IR6B 4TXSA 1RTIA 1UPMB 5HQLA 2HS0A 1AUDA 1EP4B 1S9EA 3MFIA 1WD6A 2VOPA 5KFWA 3THPA 1IN0A 4OJHA 4OYXA 4K4YA 2GVDA 3NS7B 3P3DA 5F41A 3ZNUA 1FJGJ 2DH8A 3MM7B 5KTQA 1VQMS 1PBAA 1TK8A 4L73A 4HHHA 4B3OB 2MQOA 1TL5A 3UQSA 3AODA 3DI6A 1OYDA 1RWKB 3K89A 3H2UB 2IMWP 4G1QB 5I4MA 2EC0A 3UDCA 5BJRA 4FYYB 1LW0B 2GMHA 5LXRA 3BM7A 4KPCA 4DUZF 5BYSA 4DL4A 1SQFA 3GB0A 3NMAA 1TFYA 3L95X 4ES1A 5DS7A 4A8MP 3TQ1A 2UXDJ 2FGCA 4MK8A 3HSDA 4KHRA 3H4DA 2AU0A 3LPEA 4RNMA 3EE3A 4OX6A 4DDFA 2NQPA 3TUJC 3HSGA 1VQ7S 2KH9A 4ZVSB 3SCKE 5HMWA 1MU2A 4RO0A 2W2MP 2CQ0A 2UVWA 2R7VA 2CPEA 3VV2B 1S10A 1S1VB 3T1AA 5G4DA 2V4RA 3HSZA 3LP0A 3I56S 1Q53A 5LSOA 3R5BA 3W2WA 1NSAA 2CJBA 3W66A 3TZXA 5DQHA 2MKKA 4KGKA 1U0HA 1S72S 2DIUA 4O0NA 4DSIA 1UVJA 1N6QA 3KHLA 4WU2A 1T95A 1H38A 3A12A 2C3YA 1NZ8A 1RT5A 4EGLA 4YY3F 1F6TA 2R8JA 4XTTA 1KTVA 1R0CB 2W01A 2HGMA 2IBOA 4PXDA 3HM9A 3PR5B 4GMKA 3OSPA 2E5HA 3TUIC 3GSDA 4ZHRB 5HP1A 1U1PA 3DLEB 2IDLA 4JI3F 1VQ9S 2X3DA 2QV6A 3NOCA 3D1QA 3RB0A 1U25A 2R42A 3TA1A 1KQKA 2XEXA 4I68A 1O0PA 2NXEA 3CDBA 2W4CA 2I1RA 3SCIE 3GR1A 1MMDA 2PMHA 1RBLA 2VKZG 1NPKA 2O01C 3K5PA 4MIBA 4R0JA 2CG8A 4C3KA 2CNNB 1WWHA 1SJQA 4NA1A 1AFJA 5L9NA 4H4KA 2E1RA 5HQMA 3DYAB 3NRBA 2DHHA 4N56A 4DUTA 3M6VA 1KQSR 4PAAA 1WJ9A 3CNQP 2DB1A 3GIMA 1J5OB 2JEGA 4P75A 1HBUA 5KFIA 3V81B 3J81Y 2AJQA 4XPCA 3RAQA 4DQPA 1R8HA 2G9OA 4MYTA 5HN0A 5EDWA 3D54A 1T8EA 4JI4F 3KLGB 2ABYA 2LQ5A 3NMRA 3DNCA 1IBKJ 2B7CB 3VWSA 4FNHA 1NZAA 4PWDB 5DDOC 4RW9B 3UNYA 3R8YA 2RQ4A 1F3FA 4X4SA 2C3UA 1YLXA 4FVCA 2HHQA 2WSEC 4M5LA 3PKMA 3MEEA 2LXIA 2V6AA 4F3OA 5KFEA 3HJFA 1IM6A 4AL6A 1HBMA 2YNGA 2NUHA 3IA0A 2PT0A 1ZPVA 4ALZA 5E7OB 1N0VC 1RWMB 1T3NA 4U8VA 1RU2A 2WK4A 3JSBA 4ELVA 3IC1A 4N47A 1L3KA 4C8KA 4A8FA 5F8LA 2AX1A 1U1QA 1WKJA 3AXKA 2FVSA 1HNVA 3ENWA 5DGBA 1V3RA 3MMCB 3QPIA 4NOHA 1W26A 1P1TA 2YQ0A 5KFPA 4WP8A 4DL5A 5L1IA 1U49A 2QSWA 3T1HJ 2ZZTA 2DHSA 1VQ6S 4JI5F 3AD9C 1GX5A 1WF1A 3BREA 5HBMA 5J1NA 4JV5F 2XYPB 3AOAA 4KC5A 1FKOA 2MB0B 3IM8A 2ZBCA 2KRBA 3FCHA 5M2PA 1QAXA 1QSSA 2MQNA 4E8UA 3AA9A 3MMBB 3R97A 3TRGA 2CQGA 4QIFA 1GMWD 2DNPA 3TQEA 1M5KC 4EUVA 1KS2A 1WACA 2OIHA 2QJ3A 4N76A 2OPPA 4PXBA 2OEMA 2V4JB 2KG0A 4A8QA 2HRYA 1KQGB 2JFDA 3BO3A 4XAKA 2XMJA 4M5JA 4ZLPA 4I4BA 3GU0A 2IAJA 2QSFA 5B0FA 4WPAA 3QAEA 2D9OA 4EWTA 1QY7A 1SJ4P 4RLEA 4ZVTB 3EGVA 4DXLA 4V1Ak 1NRKA 2MZSA 2CADA 2E1PA 4IKAA 4PPZA 1LWFB 3HZGA 1LXJA 2KHCA 5E3CA 1N5VA 3B8HA 1DFDA 4F4XA 5J2NB 3CDEA 1KWMA 4RPFA 4Y3CA 4NYPA 1RBOB 3HFZB 3MM5B 3Q8RB 5E5NA 4A4JA 4HACB 4OI4A 3FSIA 3ZZOA 5EWEA 1S59A 4NLUA 3UVJB 3GIRA 2J9DA 2YWKA 1CJKA 3SCLE 1TL1A 1E6YA 4PG8A 3TWZA 1RT7A 2DYAA 1CS4A 2IA0A 3TA2A 4HKQA 3RW6A 5DQGA 3CMQA 2P5VA 4NLWA 5IM0A 3CJKB 2E9TA 4O44B 3DGVA 5HVFA 2BJDA 3VAMA 2OTJS 2DHGA 3OR1A 5KG7A 3DGPB 4N77A 2FY1A 1SKUB 1L3VA 2COLA 1SIWB 2D74B 1GXTA 2DIVA 4B9MA 1S1WB 2OD6A 4B17A 2KT2A 2Y1LB 2XGQA 1VQ4S 2V67A 3M8RA 2AJFE 1KOHA 5BYQA 3NP5A 1DQ9A 1SBRA 3R6GB 1S79A 4LFAJ 4H4MB 5HMZA 1TL4A 4MK9A 3QSYB 1JLGB 2OUGA 4DFKA 3NGTA 3F73A 2KI2A 2L41A 3OTCA 3KLVA 4X4TA 3BJYA 3ADAC 4B3SF 3PEJA 1DHMA 2BVZA 1JLQB 1FKPB 4ZVQB 5MAOA 3CJTA 5H9EK 1RAEB 4FBTA 1HIYA 3RRHA 1KBRA 3EVWA 4OI0A 5KFJA 1VHIA 1NK8A 5KG3A 1HWLA 4ZLJA 3HD2A 3ITHB 4DR1F 3GTYX 4TNOA 2Q1LA 2JWNA 5JUMA 4HHUA 1FK9B 4ELUA 4LVOP 4R5PB 3UD4P 1TMJA 2IPOB 1IBMF 2HVEA 4P72A 1Q7LB 3VVTA 3I32A 4DV5F 4DQIA 2K06A 3PW7A 5GAGU 3SXLA 4O3RA 4I2PB 3J7Z5 3DHXA 2VBXA 5KG6A 3MUMP 1C2PA 4LSNA 3K17A 2EW9A 2A1BA 2L9DA 1HR0J 1TL3A 1D3WA 4Q2MA 3F56A 3OHBA 2QMUB 3G8QA 1NBEB 2HG4A 2ZUGA 4B9NA 1RT6A 3MEGA 4Y2CA 3OV7A 1TVRA 3BZQA 2CQ1A 2ZITA 3GJRB 2XZDB 4IDKB 2VG6A 4LF7F 2YKMB 2E5LJ 4GC7A 1XBWA 3FEZA 1R0AA 5KG0A 3VZIA 1PG5B 1YJRA 1RWUA 1RAFB 4LF9F 2AGPA 2YXLA 3DDIA 3R7BB 3AOCA 2O5DA 3OXGA 2DVIA 4OHXA 2YNIA 4K7QA 2HHUA 2XS2A 5F8MA 1FJ7A 1RAJA 4ELTA 2PMWA 3QO9A 2B8QA 3BBCA 4M8LA 3NGUA 1B0PA 4ECUA 3A8IA 3BEGB 3CD0A 1VDHA 5C25A 3R7NB 2BYCA 4WXWA 2CPZA 1M90T 4ZJLA 5DZ7A 1ZM9A 1X4FA 2YWEA 4LFCJ 3J80U 3MPWA 5C2GA 1SI9A 3KDOA 3EX7B 3QYYA 3MDFA 5BXIA 3M30A 1NNDA 4ANCA 2KDOA 5BR8J 3QLHA 2QL7B 3NGRA 1S7HA 4ZMMA 4KH1B 2UUBF 2MPUA 2E5JA 2W8KA 1YTYA 4X64F 2Y1JA 3GSIA 3R3TA 3AJ2A 1N54B 3NGSA 4HDGA 3C16B 2MZQA 5ETMA 2ZE2B 3D5MA 2J5AA 3JSRA 3L7UA 1JJHA 1VRTA 5FD1A 1L3SA 1X0FA 3O5TB 5KT3A 1JJ2R 1XNRF 3NKYA 4F2SA 2HRUA 1QM9A 3GFZA 3LWMA 2DITA 2WW8A 3C14B 2NUUG 4F36A 2JEJA 2RNEA 2WVDA 3IG1B 1RDRA 2PC6A 2CVEA 4GVBA 4PXCA 5AE2A 5KFDA 3T1YF 2XGPA 2M8HA 4Q0BB 1VS3A 4Q2LA 2J0QD 4LF5J 3QFHA 1D1UA 1CC7A 5IT9Y 2H65B 2ZC3A 3R5CA 4ATNA 4LR7A 3V6KA 5HJYA 1HQEB 4Y2AA 1REVA 3VAFA 1P1LA 3O44A 3BDPA 4CRJA 3CJSA 2VPYB 4CO1A 4B08A 2DGWA 3HHKA 3HSJA 2JDJA 1HYSA 2VU5A 4CWBA 4ZITA 3M8QB 2AEJA 4ED3A 1SVDA 2MKSA 2NSBA 1K44A 3WIVA 1QTNB 2IM1A 1ZAVA 4K4WA 2G0JA 3DKDA 3SFUA 3CJ2A 4ZVHA 3VQSA 5KFAA 5K8OA 3W5ZA 2WB4A 1QDUB 3PJWA 3PRBA 2X51A 4OL8A 1XMOF 3KK3A 2BMBA 3RGIA 5FDLA 2J8SA 3VAKA 3G71S 1NHKL 4R8UA 2LA4A 3RRKA 1H7WA 1IKVB 2O3DA 3KLHA 4RNOA 3V4IB 2VBYA 4Y34A 3HO1A 2DJWA 2AV5A 1VRUA 1VQOS 2HQFA 3G2XA 3DRSA 1SH2A 3OR2B 3BSOA 1WOSA 1XNQJ 3ZZRA 5KFNA 5HVHA 2E1AA 2N4CA 5F8HA 1UW4A 4EFAC 3CCUS 1JLCB 1XQIA 2DGQA 5FJ4A 3G8SA 3B4DA 2FZKB 5KFQA 4KRWA 1JLEB 1K0TA 2XS7A 5B0EA 1G7CB 5L39A 3CJ3A 4N41A 2UXDF 4CLYA 1I1GA 4LSLB 3VALA 3MMAB 3CD7A 1N52B 3A3OB 1TKZB 1RLDA 3A3PB 4QPXA 1F5AA 1CLFA 3CCQS 4LF6F 1IKXA 2W2NP 1G3OA 2GQCA 1Q95G 5GAEU 1S0VA 5L1JA 4LBHA 2DCUB 3K57A 1KVIA 3UNGC 4DZ6A 2KT3A 1T0TV 1X9SA 1LEOA 2F1FA 2R7TA 4J9KA 5D0RA 2QA1A 1U1MA 5M2UA 4TY9A 5T7LA 3KHGA 2W2QP 3BF4A 1NPPA 3GCWP 2R7WA 3NBPB 4NEZA 3PKYA 1J2VA 5DG9A 2GO9A 5DDQC 2I5JB 1UVKA 2ZZNA 3RB3A 3PW0A 4C0BA 1NPRA 3AJ1A 2FGOA 2OAUA 1MN7A 3IWNC 4DMZA 4PKDB 1IQZA 1FD2A 3JTPA 2HNZA 5JXSA 4FP9A 3S8SA 2KFYA 2MLXA 4QIGA 1HBNB 5B08A 2A0FB 3C3LA 2YNFA 2VZ9A 4U7UK 2R7XA 2LU1A 4BS2A 1HPZB 4OZLA 1TUGB 1FDNA 4GC6A 3DN9A 4KHMA 1R8CA 1V3ZA 3BPDA 5JVHQ 2J6UA 3BH7B 1C4CA 1OY6A 3QWUA 1ZS6A 1K73T 1RHQB 4UW2A 5KFCA 4E2FB 2XZWA 4EK2A 4ECVA 1FX4A 1B64A 4IQMA 2H5IB 2LQBA 5K8PA 4OHYA 3RRGA 1JLFA 1HWUA 2DNYA 4K4ZA 2BE7D 2H4WB 1LFWA 5IV4A 1FWKA 2AHOB 4P52A 5L38A 5KOWA 4UZBA 1IJFB 2PN6A 4RNHA 3E01A 4IG3A 2ASJA 5L8RC 2WVEA 5C42A 4F4KA 3MEDB 2ZOMA 3I82A 2JX2A 2LDYA 3SQGA 2RF2A 2CWKA 1X5TA 4DX7A 3ZZTA 3G6ES 5IC4B 2ZNZA 2HURA 1WC0A 4C2MA 3BSNA 2FC8A 3QIPB 2FC9A 1PILA 2MKIA 3I5AA 2BE2B 1FE0A 3R9LA 1CQNA 2YKPA 4KFBB 2Z30B 3LOUA 2O66A 2VHGA 3TANA 1TAQA 4IOAQ 1U1LA 3O2IA 4Z7YA 1X9MA 4QYZK 4Y2MA 1I3OB 1HNXJ 3HHLA 3W64A 3P5BP 2FHJA 3UN5A 3VAHA 3PJ9A 5KG5A 1QAYA 4P7VA 4MYUA 2FPHX 5F0UA 4KV8A 4WF9Q 3MF5A 3AQOA 1T7PA 4ZS6A 3T41A 1RAHB 4JI2J 3DCAA 4YDXA 2X3GA 1C1CB 4DR3J 5I42B 1CJVA 2UU9J 3D7SB 3L09A 1ACMB 2VG5B 3R5AA 4ZPCA 3OFEA 2A18A 4WIQA 2UXBJ 1F9FA 1IKWA 2V8PA 1HA1A 3Q22A 2H5EA 1NUEA 1UKUA 4OZ2A 4C8ZA 2GHPA 2CKWA 4E98A 1YJ7A 1QE1B 2BACA 3BSAA
chains in the Genus database with same CATH topology
1SUQB 3CPWR 4YOEA 4Y00A 3D0IE 2KG1A 2NLWA 2UUWA 4RW7B 4NA2A 3CC7S 2HQIA 2M8DB 4WIIA 1KLMA 4MJKA 1TKXA 5KAKA 3M9NB 2IM2A 1M5SA 2LVWA 3I4PA 4JI0F 3VTIA 1LV5A 4QIVA 4YFUA 3C8YA 1N56A 4Y65A 1M1KT 3M6WA 1IBLF 1RYRA 3SFGA 4DFPA 5THWA 1LKZA 1AW0A 4OMFG 3IO1A 4TU8A 4ZP8A 4I0WA 3KLGA 3PJXA 2VODA 3V6DB 2IA6A 3NNCA 1N5YA 4WJBA 4A48A 2ZJPQ 1TV6B 4RW6A 1AROP 3H5SA 1N36F 1P6TA 2QZ8A 3PW4A 2J0WA 1BQMB 3S1TA 2X1BA 3SYZA 4AQYF 4YEAA 2V9WA 3ZZYA 3M8PB 1HI1A 1FEHA 2ZH6A 2KO1A 4C8YA 4ID5B 3M2VB 1O8BA 4URGA 2ZH5A 2Y1IA 3EZ5A 3T5LA 4F8RA 3PO4A 3DOMA 3MMJA 1FVQA 4B9VA 4EEYA 1E6VB 2D3UA 2DNRA 2XI2A 1KNZA 4YDDB 1PC4A 5KFYA 4IG0B 4O4RA 3DLLQ 2LCWA 1WG5A 1FRMA 5CXTA 4EO8A 3NCQA 4RW9A 4ID5A 3DFEA 3M2VA 2VB6A 2XG8A 5MLCV 4URSA 1FXDA 2CQIA 1FRLA 5A8KA 2HS4A 3ZC4A 1X4BA 4DR6F 4O4GB 1S77D 2JEFA 3OTBA 2M88A 3NAHA 3U1MA 4DHVA 2V5HG 5KFUA 5T41A 1U1KA 3FEYB 1N8RT 2GIRA 5J1EA 3PX0A 1X4EA 3AY0A 2R7RA 3JB9k 3N5FA 4D3HA 1UAWA 1RK8A 2LXUA 2W7AA 1REVB 2KJWA 4F3QA 4EU0A 4ZCIA 3D0HE 4J9QA 4TQSA 3DOLB 1YJ9S 1S0OA 4B9LA 2KN4A 3DRPA 1U48A 4O4GA 1FKAF 2G13A 3CIZA 3GG1A 2DO4A 3NAIA 3H4BA 1YJWS 2Q43A 5KFSA 3I31A 1S97A 2MZTA 3GMGA 3MTKA 4HI1A 2XI3A 4NZ0A 5A6WA 2DGVA 3DOLA 5F3ZA 2G4BA 2OP5A 4YUDA 3FQLA 3MEKA 4ED0A 4L6V3 3THVA 2FLLA 2I8EA 4KTQA 1FT8A 1SJRA 1VHFA 1SKRA 1IKYA 1S4FA 2FJEB 2HWIA 2NPFA 2WBMA 4DBQA 2LQJA 1VK8A 3ISND 3QMQA 1KR4A 4BBYA 2NSCA 4ED2A 1RA7A 2ZVSA 3L7PA 2OSQA 2QEXS 3N6LA 1ZPWX 5CYQB 2U2FA 5DM6Q 1HFEL 1A6LA 3KK3B 5IT0A 2RSQA 4PG5A 4NLTA 2LEPA 4YQWA 4DSLA 3MR2A 1IJEB 3O6QA 4I69A 1LXNA 3HP6A 4QWBA 3U7JA 3NWGA 4RBUA 3ENQA 5GAHU 4ZK7M 4QWEA 1S9GA 2VPZB 3DLHA 1OQ3A 4C8LA 1D9FA 3FNNA 1RT4A 1MMLA 4QWAA 2ZH9A 2HNDB 2JZ5A 1S49A 5CCLA 2WSCC 4IFYA 2D3OR 3OUYB 3QIDA 4FS2A 6FDRA 1PSDA 4WYWA 3KLHB 3OTEA 2HVZA 3G4SS 3Q2SC 2YNHB 2ILZA 2JVOA 3MUTP 4C11A 3H5YA 4CQ1A 1HBOB 3JSYA 2PDAA 3GYNA 5KFRA