3KJVB

Hiv-1 reverse transcriptase in complex with dna
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
428
structure length
400
Chain Sequence
b'PIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase p66 subunit
publication title Visualizing the molecular interactions of a nucleotide analog, GS-9148, with HIV-1 reverse transcriptase-DNA complex.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase/dna
total genus 98
structure length 400
sequence length 428
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3kjvB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3kjvB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3kjvB03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3kjvB04
4RNHA 3OHAA 4KV8A 3NL0A 2RKIA 4ECWA 4LSLB 3CO9A 2QV6A 4ED6A 3PW2A 2UVRA 4KKOA 3DRRA 1TL1B 2AQ4A 2C2RA 3GIKA 2FJVA 3KHRA 3SI8A 3DRSB 3KHLA 1KHWA 2WK4A 4TXSA 1S9GB 3MEGB 4MH8A 4JV2A 2AGOA 2E9TA 3LP2A 2I5JB 2VA2A 2BRKA 1S97A 2GIRA 5EWFA 4FS2A 3OL8A 4O4GA 1RYSA 3NBPA 4RUAA 4G1QB 1DLOB 3DLEA 3FSIA 2R8KA 4Q8FA 4JV1A 4KE5A 3V6KA 5L9XA 4H4OA 5HROA 4R8UB 3M9MB 4J9OA 3OL9A 3RB6A 1EP4B 4H54A 4F4YA 1HYSB 1LWCA 1S9EA 1R0AB 2BE2B 3LAMA 4I2PB 4O3SA 1KLMA 1TP7A 3QIPB 1TL3A 1RT5A 5FDLB 1RT6B 3V81A 5DLFA 1UWBB 4DEZA 5KFDA 2EC0A 3HVWA 4JUZA 4NZ0A 3PZPA 4RW9A 3CJ2A 4HKQA 4NLUA 2OPQA 3KLFA 2HMIA 2B5JA 4IRKA 2HWIA 3KLEB 2W8KA 1RDRA 1HNIB 3MEDA 3JSMA 2OH2A 1SUQB 3KK1B 4URSA 2OPPB 1C0TB 2WB4A 3IG1B 3KOAA 4WZQA 2W9CB 3T1AA 1TKTB 1RT7B 4RW7B 2IM0A 5KFMA 2OPSB 3M8QA 4NLYA 3GV8B 1JKHA 1C1BB 3LALA 5K14B 4KAIA 3T5HA 3V6DA 3EZUA 4YQWA 4MK9A 4J9SA 2HNYB 2W7OA 3DOKB 2R2TA 2UVWA 2RF2B 3DLKA 5HP1A 1JLQB 4ID5A 2IM1A 1C1CA 4MK8A 4QWEA 3CJ3A 3I0RB 4FS1A 2J6TA 3N6LA 4B3OA 3MEEB 1JLEA 4MIBA 2D41A 4ZP7A 4IDKB 4DL5A 2WONB 1MU2A 4KO0A 2FJWA 3H2LA 3BREA 5F8HA 3RBEA 3HHKA 1TQLA 4NCGB 1TV6B 4IH6A 1IKVB 4H4MA 5HLFA 3SFGA 3C6TA 5C5JA 3RB0A 2YNGA 1BQNB 4IRCA 4QWBA 3JYTA 3DRPB 3IGVA 1K1QA 5I42B 4M94A 5J2QA 3FFIA 1ZTTA 3UPFA 2V4RA 2V0NA 3BR9A 2IM3A 4RUCA 3V6HA 1HPZA 1RT1B 4RW6B 1XR5A 4NLWA 1J5OB 4Y2AA 2ASLA 3T19A 2F8EX 4TQSA 1DTQB 3LP0A 1IM4A 1RT3B 4O3QA 1QE1B 1QAJA 3QIDA 4YP3A 1ZTWA 4KB7A 4IRDA 3CJ0A 1FKOA 2XC9A 5L1LA 4RU9A 4IG3A 1JLGA 3BSCA 5KG5A 1C2PA 4IFYA 3KMQA 2CKWA 1OS5A 5KFFA 3MTKA 1S1XA 2WOMA 3QLHB 4O3RA 4I2QA 3TAMA 1S6PA 1JIHA 4MKBA 5KT7A 2YNHB 5C24B 4ZPBA 3DYAB 5C25B 1IKWA 3DI6B 1T05B 2BANB 4K4SA 3KK2A 2IC3A 2FLNA 1RTDB 2FJXA 4PQUB 1W25A 4NLDA 3T5JA 4G3IA 2XCPA 2YNIA 3MR3A 3PW5A 3Q8QB 2BR0A 2OPRB 1VRUA 3MECB 5J2NA 4K4XA 2VG5B 2ZE2A 4DL3A 1TKXA 5KFPA 3ISNC 1LW0B 1S48A 3MFHA 3H5UA 3NMAA 4ECZA 2R2UA 2YKNA 4K4UA 3QO9A 3GQCA 1WNEA 4URQU 1DTTA 2XCAA 4KV8B 4J9QA 2RKIB 1N6QA 4ZPDA 5KFEA 3GYNA 3PR4A 4NLRA 4J9RA 2JEGA 4KKOB 4GC6A 3H98A 3DRRB 1S1VA 2VG7A 3HVTA 2IAJA 4ZVHA 2W9BA 2BQ3A 3V4IA 5C42A 5F9LA 5KT6A 1JLFA 1S49A 3LP2B 2RDIA 4PWDA 2DPIA 4ED3A 1EETA 2GC8A 1D1UA 4O4GB 4MK7A 4JV0A 3NBPB 4EYIB 2IBKA 3DLEB 1FKPA 4TYAA 4F4WA 4Y2CA 2UUWA 3VQSA 5HBMA 4QWCA 2YNFA 4H4OB 5HROB 4NYZA 2FLLA 4DG1A 5EWGA 4WFZA 1LWCB 1S9EB 3OL6A 1KLMB 1TL3B 1RT5B 2C22A 1GX6A 3V81B 2IM2A 5KG7A 1D0EA 5F8IA 4RW9B 2OPQB 3KLFB 2HMIB 3UQSA 4ZPCA 2B5JB 3KLHA 2GIQA 4NRUA 4WE1A 3MEDB 3JSMB 1RT4A 3I5CA 5EWEA 5J2MA 1SH2A 5KFYA 3PW4A 3C6UA 3RAXA 2IMWP 2XGQA 4RW8A 2J6UA 1JLAA 3H5SA 1RTJA 2FVQA 1KHVA 2D7SA 3M8QB 4R5PA 4FBUA 3N6MA 1JKHB 3DDKA 3QGGA 4IKAA 4MKAA 4ECYA 3M8PA 3KMSA 3V6DB 3MR5A 4Y34A 3KHGA 5KFIA 1IKYA 1JLCA 2R8GA 4IR1A 2XGPA 4DL7A 3M9NB 1LW2A 2R2RA 3G86A 3GV5B 3DLKB 5HP1B 3IS9A 4ID5B 3MFIA 4IOBA 1C1CB 3DLGA 2XI2A 3H5XA 5KFJA 4B3OB 5F9NA 2YKMA 5F8GA 1GX5A 3KLGA 1JLEB 3KK3A 2DPJA 4YR3A 1MU2B 1N48A 4KO0B 2J6SA 1NHUA 4IR9A 3NAHA 1Z4UA 4RNMA 5KG6A 3UR0A 2D3ZA 2JEFA 4WFYA 4WXWA 4Q45A 1RA7A 4H4MB 2ZD1A 5HLFB 2VG6A 3C6TB 1JX4A 1C0UA 4NLXA 2YNGB 3BJYA 4IG0A 3PVXA 4K4TA 2UVUA 3JYTB 1JLBA 1TVRA 5J2QB 3FFIB 1N5YA 5JXSA 3GV7B 3G6XA 3BQ0A 2R8HA 1HPZB 4IQXA 5J1EA 2JC0A 5DQGA 3OLAA 3LP0B 2FVRA 3UDLA 3NAIA 3GILA 3I5BA 4WFXA 4NLVA 1FKOB 5I3UA 2HWHA 4ZHRA 4IG3B 1JLGB 5D3GA 4ZVGA 4IFYB 4IFVA 4EEYA 4ZVFA 3D28A 4MIAA 4O3NA 3OL7A 1LWFA 4EO6A 2R8IA 4ECTA 1S1XB 4NLTA 1HMVA 2WOMB 4O3PA 1T3NA 2FVSA 4I2QB 3TAMB 1S6PB 3KLIA 3BSAA 3QGIA 3T5LA 1S1WA 1N4LA 1S1TA 2XWYA 4YMEA 1XR7A 4QWAA 1IKWB 4DL4A 4EO8A 3G6YA 2C2DA 1VRTA 5DQHA 2ATLA 3KJVA 3KK2B 4K4WA 2IC3B 3GIMA 4IH7A 3I5AA 2WTFA 2YNIB 3M9OB 5F8JA 4KBIA 1N56A 2HNZA 4O44A 4ICLA 5KFBA 5J2PA 1VRUB 2R8JA 5J2NB 2ZE2B 3FQLA 5KFRA 4MFBA 1TKXB 4WYWA 5CYMA 4WXOA 2IJNA 2YKNB 1S6QA 1T03A 3QO9B 4I7FA 4ECSA 3PJWA 4LQ3A 4X2BA 1DTTB 1LWEA 1SH0A 4F4ZA 4RZRA 1N6QB 3E51A 2HNDA 3Q8SB 2ASJA 5JUMA 4RW4A 4KSEB 2AGPA 1S1VB 3GIJA 2VG7B 4IH5A 4GC7A 3HVTB 2IJFA 1RTIA 2IAJB 2W9BB 4EBCA 3E01A 2B6AA 1HQEA 5C42B 3V4IB 3FRZA 4TN2A 5F8LA 1JLFB 5KT5A 4K4VA 2FVPA 3H4BA 1RYRA 4PWDB 1EETB 3IRXA 5KT4A 5DGBA 1HQUA 4QPXA 4KFBA 1SV5A 4ED0A 2ZKUA 1FKPB 5KG4A 4KHMA 3I0SA 4PUOA 3BSOA 3PW7A 3RB4A 3LAKA 5HBMB 1T94A 2YNFB 1S1UA 2ILYA 3EPIA 3EPGA 4DG1B 3BGRA 3H40A 1CSJA 3RAQA 4Q0BA 4O3OA 3BQ2A 3DM2A 4LQ9A 5KFXA 1IKXA 1TKZA 3CDWA 4R0EA 3OSNA 5CYQA 4EYHB 4ECUA 4EBDA 3BSNA 5KT3A 3MR2A 4K4YA 1RT2A 3T5KA 2JEJA 5DLGA 3KLHB 4K50A 3LP1A 4WE1B 4M95A 4ECQA 1RT4B 4QW8A 3DOLA 5J2MB 3C6UB 2VA3A 2JEIA 1BQMA 4RW8B 1S9FA 1JLAB 4LSNA 5KG0A 1RTJB 3H59A 5EDWA 4O4RA 4R5PB 2XI3A 3HKWA 1HNVA 3PJXA 2FLPA 2E9ZA 3M8PB 1REVA 3ITHA 1IKYB 1JLCB 2V9WA 1FK9A 5L1JA 3CIZA 1LW2B 5F8NA 2BQUA 4U7CA 5F8MA 1ZETA 3IS9B 1RTHA 2AWZA 3IN5A 3DLGB 3MR6A 2YKMB 5DG7A 3DMJA 3KLGB 3KK3B 4ECVA 1K1SA 4Q8EA 2W7PA 5KFKA 4DL6A 2UVVA 5T14A 4LSLA 4TYBA 3PW0A 4J9LA 3ISND 2W8LA 5L1IA 2ZD1B 1SH3A 2VG6B 1C0UB 1TL1A 4IG0B 4ECXA 3DRSA 1S9GA 1JLBB 3MEGA 4NLQA 1TVRB 4ECRA 3RBDA 2I5JA 1N5YB 5DQIA 3KNAA 3D5MA 1JXLA 4G1QA 3CDUA 1DLOA 1XR6A 1RA6A 5J1EB 4NLPA 2JLEA 5KFCA 1MMLA 3NGDA 4ED8A 4R8UA 4FBTA 2I1RA 4ZP6A 2E9RX 1EP4A 1HARA 1HYSA 2R2SA 2ILZA 1R0AA 2BE2A 5I3UB 4I2PA 4QWDA 4U6PA 4YR0A 4ZHRB 5D3GB 5DGAA 3QIPA 4IFVB 4ZMMA 5FDLA 4NLSA 4ED7A 1RT6A 4RNNA 1LWFB 1YVFA 2AGQA 1UWBA 5KFNA 1S0OA 1HMVB 2AX1A 2CJQA 4Q43A 4NLOA 4YR2A 4TY8B 3KLIB 3H5YA 1S1WB 4OL8A 1S1TB 1U09A 4XO0A 4EBEA 1VRTB 3KLEA 1S4FA 4RNOA 1HNIA 3KJVB 2WRMA 1SUQA 3KK1A 3KLVA 2OPPA 3GIIA 2AX0A 2AU0A 1C0TA 4F50A 2HNZB 4O44B 3IG1A 3Q8RB 5KFOA 4ICLB 2W9CA 5J2PB 1TKTA 3V6JA 1RT7A 4RW7A 1QAIA 4ZP9A 4TY8A 2OPSA 3OLBA 4MFBB 3CDEA 5CYMB 1C1BA 4DL2A 5KFLA 5K14A 1I6JA 4J9NA 2ASDA 1T03B 1S6QB 2BQRA 2WHOA 3CWJA 1QUVA 4F4XA 4I7FB 2HNYA 3ICLA 3DOKA 1LWEB 2RF2A 2V4QA 1JLQA 5KFGA 1S0NA 4RNFA 2HNDB 4TQRA 3I0RA 2WCXA 3H4DA 3RB3A 2UUTA 4WZMA 3MEEA 4RW4B 3G6VA 3LANA 3N6NA 4HYKA 4IDKA 5KFSA 2WONA 2BRLA 3QGHA 3BQ1A 1RTIB 5KG3A 3QYYA 3E01B 2B6AB 1HQEB 4ZVEA 5KG1A 4NCGA 1TV6A 1IKVA 3IRXB 4URGA 1HQUB 4KFBB 1SV5B 1BQNA 2JC1A 3I0SB 4PUOB 3CJ4A 1NHVA 3FDSA 3FQKA 5KFVA 3DRPA 2O5DA 5KFQA 1S1UB 5I42A 2ALZA 2C2EA 3BGRB 5EUHA 4K4ZA 3PR5B 4KHRA 1S0MA 3HVAA 4XPCA 4RW6A 1RT1A 4Q0BB 3CJ5A 4TY9A 3TQ1A 1J5OA 2HAIA 3DM2B 3CVKA 1DTQA 1RT3A 1IKXB 1QE1A 1TKZB 5KFAA 1S10A 5CYQB 5KT2A 4WYLA 1NNDA 2RDJA 4ZPAA 1RT2B 4J9MA 4ED1A 2C28A 3LP1B 3IGNA 3TVKA 5KFWA 3DOLB 2B43A 4NRTA 3QLHA 3OHBA 5KFTA 2QE5A 5KFHA 4Q44A 2YNHA 1BQMB 5C24A 3DYAA 5C25A 3NKYA 3DI6A 4XPEA 2D3UA 4LSNB 3QZ8A 4NLGA 1T05A 3MF5A 2BANA 4ZP8A 4Y3CA 3OSPA 1RTDA 1HNVB 4PQUA 5DG9A 4J9PA 1REVB 2IA6A 5KFZA 5DG8A 4TLRA 3ITHB 4ED2A 3QZ7A 1FK9B 4J9KA 2OPRA 3Q8PB 3MECA 3SFUA 2VG5A 1RTHB 5L1KA 4QW9A 1LW0A 2FVCA 3KHHA 2W9AA 3DMJB 1RAJA 3PHEA 5KG2A 5KFUA
chains in the Genus database with same CATH superfamily
1CS4B 4LF7J 1ACMB 2BJ9A 3I55S 2FJVA 1CJUB 3KHLA 4ZVRB 2ZFHA 4JB8B 2I5JB 2BRKA 2BM0A 3OFEA 3S7RA 4FKYA 3OL8A 3NBPA 2IRUA 2HBQB 2CG8A 5ETRA 4JI8F 3RB6A 2DIVA 4F4YA 1FE0A 3T41A 2R7WA 1YJVA 3MTJA 4ILLA 3HVWA 3WC2A 3CCWA 2C2NA 2HHUA 5LSLA 2OH2A 1RBOB 3MAHA 4CDIA 3JTPA 3NOCA 4J9SA 1FKAF 3I0RB 3N6LA 1U49A 1NPKA 2ZEJA 3K5MA 4TU9A 1VQPS 3L9ZA 3UNYA 5C5JA 2ROGA 2YNGA 3KWMA 2N7YA 2O1PA 1RGVA 1OYDA 1H2VZ 5HMWA 4J9VA 3BR8A 4DV2J 2J9EA 4J37A 4LBPA 4PQUB 4A8SA 5ETTA 2W1BA 2LLZA 2DNZA 1PYOB 4V19J 3GONA 3BDEA 4DQQA 3DU6A 1DTTA 3PR4A 3LGMA 3Q23A 4E8UA 4OV1A 1WTFA 1NXIA 1TMMA 2DPIA 1FD8A 2BM1A 3DLEB 2DR7A 3ZNJ1 2QMXA 1RABB 1NPPA 3ZZOA 3M30A 4OIXA 1GX6A 3UR3C 5E33A 4RW9B 2HMIB 3PYEA 3KXDA 4CNZA 2DCLA 2Y9HA 1BWVA 1Q53A 2FVQA 1GXUA 2P6SA 5B09A 3N6MA 3DDKA 1ZZNA 4A8KA 2CPDA 2DK2A 1HWIA 2R2RA 4MYUA 3JXOA 3ISZA 1D9AA 2YKMA 2GVDB 2J6SA 1IJEB 1VBXA 1OYEA 1B3TA 1YJNS 3TA2A 2M3DA 4KH1B 5BR8F 4Q7AA 3QPIA 3E8OA 3BQ0A 3BGLA 1HPZB 3IO1A 2FVRA 4C11A 4WKRA 2ZOGA 5IWAF 3C14B 3BN7A 1JLGB 4WF9Q 2B4VA 3R6GB 3K5NA 1S1XB 3EXCX 1WC5A 4M5HA 3AOAA 1G6BA 5DQHA 3KK2B 4C0HA 4CLTA 3PRVA 3M9OB 3R2CJ 2OTJS 5LJ5Y 5J2PA 5GMDA 4OZJA 1S6QA 2HQ3A 3OR1B 3N4WA 4DPOA 3PJWA 1FHTA 3CULA 4USIA 3Q8VA 2PMHA 1A6LA 3GIJA 5C42B 4OYPA 1IR0A 2FVPA 2ZH9A 3LAKA 3TOQA 3T9ZA 1WSVA 2UZAA 2B8PA 3PIOQ 1VK8A 4OYIA 2E5LF 1FJ7A 2ZBPA 3CDWA 1IBKJ 3HHLC 1S0VA 4K4YA 3M2UB 4OYBA 4OYMA 2E44A 2KL8A 1TUGB 1HNVA 1REVA 1IUJA 1IKYB 3S6EA 1WI6A 1LW2B 5GAGI 4HHHA 3DLGB 2KZZA 2HGLA 2XULA 3PW0A 1FDAA 3AA8A 2WBMA 3B78A 1RAAB 5CQGA 5HL7Q 4NLPA 2JHEA 1T7PA 2H4YB 2A10A 2CQPA 5IV4A 3EVOA 4IFVB 3AHPA 5FDLA 4RNNA 3D6HB 2HS4A 4YR2A 1XQIA 3KG1A 1T9XA 2VFTA 3LWMA 5MAOA 3GIIA 2A6OA 2W9CA 1C1BA 2ZC3A 3RR7A 1N33J 4B3RJ 3LO3A 1H73A 2UUCJ 3V5RA 2HNDB 4RW4B 3LGHA 4IDKA 2BRLA 2XG8A 2K7JA 3BKUA 1UCNA 3D0IE 3CJ4A 3FQKA 1Q0NA 3RJMB 1UP1A 1S7HA 3THPA 4AL5A 2ZHOA 4KHRA 2HAIA 2UUAJ 2VPYB 4X4NA 3ZZRA 3UI3A 1NNDA 2B9WA 3UCUP 3LP1B 1RWOB 3NY0A 3DOMA 5KFTA 4I6WA 4CCHA 4XPEA 3QZ8A 1KC8T 1GXLA 4B3TJ 3Q0AA 1HBMB 2PFFB 4J9KA 5SZTA 4ZCIA 2F8MA 5JVGQ 1RTHB 5L1KA 2NPFA 2KHDA 2DNQA 2W9AA 3IWLA 3LH2S 4GMKA 2EPIA 4C8YA 1NCLA 4F3OA 2QV6A 5E3CA 5HMXA 3A3OB 4F0KA 1TL1B 2C2RA 4NCAA 1S9GB 2KT2A 2RQKA 4O4GA 2XEXA 4RX6A 1D8ZA 4H4OA 4HDHA 2ADCA 5RUBA 1AW0A 3LAMA 3EJMA 2HHWA 1UWBB 4NLUA 1U0SA 4CWBA 3MPWA 5IQ6A 2XMUA 2HVDA 1SUQB 4WZQA 1SCJB 1RT7B 3M32A 3DNCA 3EUNA 3R2DJ 5K14B 2X51A 3O5TB 3DHXA 4I56A 2HBRB 1FI4A 1RWMB 4F2SA 2XS2A 2WVCA 3ELHA 2MKJA 3CCZA 2HSEB 3QT7A 2FJDB 1NAQA 3UCZP 2Z56B 1DTQB 5A8KA 4KB7A 1VQSA 2DR6A 3BSCA 2CKWA 3MOJB 3L95X 4I2QA 5D77A 1UVJA 1I94F 4H4KC 1YZ6A 3MDFA 1UPMB 4DL3A 1A0OB 4QJVA 3JSBA 1X5TA 1PGZA 3Q8UA 1S1VA 2VPXB 2G0JA 3MOZA 1U24A 5KOXA 1EKSA 2GC8A 3BYPA 2K06A 1APSA 1R0CB 1XWLA 4KPCA 2PT0A 3UDEA 4AXIA 4NYZA 2BKNA 4P7VA 3RTVA 3SV4A 1LWCB 1EQ0A 1ZZFA 2PI4A 2ZH7A 4PG7A 4NRUA 3GCWP 1PILA 4A4JA 2IA0A 5HJYA 2Q1LA 2IMWP 4RW8A 4QR0A 1RTJA 1NO8A 2NUUG 1V3SA 2F9JA 3RU0A 2DRAA 1GX5A 3KLGA 4MJKA 1JLEB 4PXCA 1RBLA 3F0NA 1Z4UA 4WXWA 1UJ4A 1K44A 3HJFA 1JWWA 3CJSA 3QMQA 1XK8A 3MURP 1PYTA 2JVRA 2GQ2A 4NI2A 4AYBD 2DR5A 4F04B 2ZH6A 1IKWB 2IC3B 2M7SA 3GIMA 5F8JA 1VIOA 3EX7B 5EN1A 2CFXA 5CXTA 1TKXB 1MG7A 2M5YA 1RWWB 2YKNB 3VAKA 1UEVA 4ECSA 2HHHF 4LQ3A 4X2BA 3RUBL 1TUVA 3FMBA 3E51A 2PI5A 2ASYA 1RTIA 4DS5A 3W64A 3I4PA 5FLXY 1OSDA 3J7YI 2DITA 3J7A1 4KHMA 3IAM9 3RB4A 4WU2A 2GMJA 3TUPA 4UY8T 1VOMA 3TJAA 5DDRC 5A76A 5EGYA 4Y0FA 2JEJA 3KKFA 1RT4B 3AXMA 8RUCA 1S9FA 1R8PA 1JLAB 3P5BP 3ILIA 1IBMJ 5F8NA 2AWZA 4ZLNA 2H54B 1KFSA 4XDCA 4PPZA 4Y28C 2XQCA 4DL6A 4DUZF 2RMLA 4RU2A 1A7GE 2D1CA 4NLQA 4C8ZA 1E6YA 3CDUA 3FBBA 1V5IB 4TKTA 2DRDA 4K5RA 4F0HA 3MAQA 2CIMA 4LMZA 4BWMA 1NEEA 4C8OA 4NLSA 5GAGU 5DJBA 3GFZA 4FF1A 3ZZYA 1FF2A 2ATCB 3D6FB 2JH3A 2ZZTA 1U1KA 1PC4A 2HK2A 2NZCA 4DQRA 1I6JA 4UOGA 1F3VA 4J9NA 2YWHA 4TQRA 4LRDA 1V3ZA 3LF0A 3PTWA 3BQ1A 2JFKA 4ZPVR 3KFWX 1WF1A 1SKWA 3GFYA 3FDSA 2O5DA 4X4PA 2CQ3A 2EK6A 1RT1A 2ZOFA 2DGQA 3MM7B 3VCDA 2COLA 1AZSA 3R7NB 3U1NA 4X66F 3IGNA 2RU9A 2BANA 2BW7A 2QA1A 3AQOA 4BS2A 2W7AA 3A13A 1NPRA 2FVCA 2CJAA 3G2XA 4KKOA 3GJQB 5IT4A 3K8WA 4DV3F 2LEPA 4K5SA 1L3KA 3KUEA 2HPUA 3OTBA 4YN3B 2JFDA 1EP4B 3BPDA 2VQFJ 2V8GA 2YQ1A 4HKQA 2OPQA 1TR0A 2Y1LB 4A8QA 4L3NA 4LRBA 3KOAA 4B17A 3M8QA 2BE9B 3T5HA 2GAHC 3HD1A 2QTWA 1HI1A 2W2QP 4LRAA 1JLQB 3CIMA 3VZIA 1NU4A 1NJWA 2VL1A 3FK4A 4DL5A 2XBPA 2CQCA 2APOA 1NJZA 4X64F 1DQ9A 2V94A 4Y00A 3SFGA 2E5HA 1W7WA 1BQNB 1NK0A 4M94A 2P5VA 4A8MP 4BCAA 2V4RA 1O51A 3MAAA 1X60A 3S01A 3G82A 1YI2S 2ADBA 1EAYC 3RGIA 4KGXB 5K9FA 1G2EA 3DYAB 2QJ3A 2RSQA 1RAFB 2F5GA 1ZM4A 2HQIA 4KTQA 4G3IA 5DM6Q 3MR3A 4TNOA 1MMNA 3OUYA 3ILOA 2RE1A 1S48A 4XAKA 2NXNA 2XYHB 4J9QA 1N6QA 4FNHA 3HCXA 3FMWA 4B9LA 2DNRA 2A18A 4ED5A 2F4FA 2W4PA 4PWDA 1Q8LA 3MPYA 1B99A 2LVWA 4JV0A 1PBUA 3C16B 1SJ3P 3OVBA 4DPUA 5A8RA 1REGX 4OYXA 1O6XA 4K59A 1JNRB 2VBXA 5KG7A 5F8IA 4UOHA 3UQSA 5EWEA 2KI2A 4LVOP 1K0TA 3TP2A 3ZTOA 1U4BA 5ETKA 4GKJJ 3QGGA 3HDSA 3QFWA 5HK4A 3B6BA 3CW2C 2LU1A 2XGPA 1NJYA 3DLKB 3H5XA 4IOBA 5FLXU 5B0FA 1Y4ZB 1Q5YA 2UXDJ 4WKYA 4DV6F 3FZ2A 2H5IB 3DN9A 3UD5A 5H9FK 4K4TA 2HQDA 1HNWJ 3TI0A 1RUSA 2EFQA 4USKA 3CXCR 3OLAA 3GYGA 2HWHA 2WVDA 2QMWA 1B7FA 4RPFA 3OL7A 4O3PA 4NLTA 1Y3KA 3MMCA 1S1TA 4YMEA 4QWAA 3TUJC 2ZM6F 3HMJG 2V67A 2DNLA 1XBWA 3W8PA 2Z8QA 4CLKA 4OI0A 5BYQA 3Q8SB 4GC7A 1HQEA 4ITSA 1WC4A 5DGBA 1FKPB 2HIQA 2A6MA 1MROB 4XIUA 1PKUA 2HGMA 1RHMB 4LF7F 4LFCF 3FSYA 2MTLA 1Q82T 5ETMA 3MPVA 5E3PA 2CXEA 4CLLA 4YS2A 4PYDA 3ITHA 3CEDA 3J7YU 5GAEI 4U7CA 1U26A 4DXLA 1GH8A 2B9YA 2UXCF 4HT7A 3R3TA 1SPBP 5D0EA 4IG0B 3DRSA 5B0EA 3MEGA 1N5YB 3PX0A 3FKBA 1EKRA 1DLOA 3PXGa 1VQ6S 1M1HA 4ED8A 2MSTA 1R0AA 2BE2A 4I2PA 4U7UD 5D3GB 3QIPA 2WVBA 4NLOA 3KLIB 4LF4J 1N5SA 2RHQB 4G65A 1FT8A 3ZTQA 1VK3A 2AX0A 1TKTA 2AZ1A 1H74A 5B0DA 5CYMB 4DV4J 2KXNB 1QUVA 2HGNA 4DV2F 2R9LA 2DIUA 3A8JA 4WZMA 1YJRA 3HSDA 3JSYA 1L3TA 2PEHA 4KT0C 5IQQA 5KFVA 3LA0A 3UD4P 4DCJB 4JI6J 3CJ5A 4Q0BB 5A0YA 2IMOA 1IN0A 1J5OA 4FF4A 1FESA 2LA6A 1WEXA 2AD9A 5DS7A 5DETA 2C28A 1DRZA 1UTAA 2VONA 1FVSA 3D3CJ 2ALYB 2GAGC 4Q44A 2DNNA 2HLTA 2VU5A 4ED2A 1FK9B 4LVNP 4ED4A 2WB1D 2D74B 3DMJB 5M2RA 1NH7A 4KV8A 2DH9A 3CO9A 2XY7A 2AQ4A 3SI8A 3SCIE 5IM0B 1OY8A 5B0AA 2X1FA 4R8UB 4MYTA 4HI1A 4LR8A 1YRUA 4RUHA 2DR8A 4Q5VA 3PX6A 2BX6A 1N36J 4URSA 4I6YA 1C0TB 2RUSA 2OPSB 4MK9A 2OLWA 1T9VA 4DBQA 4QWEA 3HZGA 3BYRA 3OD2A 4X4RA 1Y00A 3W7BA 2FJWA 3DRPB 3IGVA 5I42B 5B7WA 3UPFA 3W61A 3DLHA 3W3SA 2IM3A 2YWFA 1TTHB 4QYRA 2N3LA 1AROP 1U6BA 4FN5A 1VBZA 1WC0A 4RWXA 2WAQD 5F3TA 1FXLA 2PGCA 3W5YA 4P2XA 1UJ6A 5D8HB 5H9EK 1IBKF 4JOUA 1WHWA 2UXBJ 4G1PA 2OELA 2FGOA 4X4OA 1WG4A 3HVTA 1FFSB 4ZVHA 1IBLF 1WTBA 3ZZZA 3G8TA 1TFWA 3CJQA 2QX0A 4RUBA 1RT5B 2IM2A 3GSIA 2Y3YA 3KLHA 2GIQA 4GKKJ 4OX7A 2O66A 3MM6B 2HURA 1BUXA 2JSXA 4IKAA 4MKAA 2MJNA 3M8PA 3RRHA 1P8GA 2GGPB 3MR5A 1RCXB 1VMBA 1JLCA 4C2MA 4K8RA 3QNWB 5LSRA 4PG4A 4IR9A 1ZA1B 3TZXA 4QIEA 2V63A 2IVMA 4FP9A 4PPDA 1KONA 4NLXA 1N33F 1RB0A 4B3RF 3HHEA 2R7XA 2YKPA 3IWNC 4FKXA 5JXSA 1ZM2A 4L3KA 2UUCF 5JMNA 2N82B 4F36A 4ERDA 4BDPA 2HFNA 3D6TB 4N8OA 1VHFA 3X3UA 4B9TA 4OJ3A 2FVSA 3TAMB 1N4LA 1XR7A 4FXVA 2FZKB 2ATLA 1N5TA 2BJ7A 2YNIB 2MZ1A 2RS2A 2GVZA 2JDJA 3FEYB 2ACMA 1LWEA 4OZ5A 3ETMA 4OZLA 3ETOA 2VFUA 3QRPA 2IAJB 4QQBA 2KXFA 4ZIWA 3CD5A 2F1FA 4WFBQ 4KFBA 3GZ7A 3BGRA 3QJLA 5IT0A 5CA5A 3IR7B 1T0TV 3GE9A 3NCPA 4RBTA 2CPJA 2J7UA 1DQ8A 4ECQA 4DR6F 2H9ZA 2QA2A 3BBCA 1TUWA 1BLUA 4G1IA 4FZVA 3GP9A 1ZETA 5CYJA 4LT6A 1U6ZA 2J8AA 3A3NB 1K1SA 2JZ5A 2RDDA 5T14A 4TYBA 1RSCA 2FY8A 2VG6B 2ZBIA 1VFJA 2QZ8A 1TVRB 5HATA 5D78A 3D1QA 1DAXA 3MMBB 5KFCA 4C98A 2DGXA 3T6JA 2M4MA 4FXWA 5I3UB 3VVTA 4U6PA 5GAEU 4OZ1A 1FJCA 9ATCB 4J9UE 2HVEA 1N32F 3A4TA 3CDBA 3KJVB 2KRRA 3D4JA 3KLVA 4O44B 4UT4A 1U47A 4ZVPB 2I6WA 4B08A 4QYZK 3AJ1A 1NM2A 5CABA 2DNKA 3QYYA 3R5AA 3HM9A 4PEOA 3UCGA 2C2EA 2J0WA 2IPOB 4CLSA 2QT7A 3TJ9A 1QE1A 1H98A 4U8YA 1YBTA 1U02A 3FSXA 4LSNB 1ZAVA 2AEMA 4QIWD 1HBUB 2CPEA 2G13A 3SFUA 2ZHBA 2F7VA 4KR0B 3SDEB 5KFUA 2DNMA 3ADAC 3EXYA 4GVBB 2RRAA 1N54B 2HQCA 1X4CA 3GIKA 1JNZB 1PYSB 1B4SA 3DGPA 3CPWR 1CVJA 2NXEA 1RWNB 1KFDA 4N41A 1TL7B 3M9MB 2M9KA 1S9EA 4ETZA 3CJ2A 1YWXA 2VIHA 4NZ7A 4LF8J 2QFIA 1WDTA 3UVJB 1SL1A 3L3CA 4V1Ak 3MHYA 3LALA 2IVYA 1CJTA 2E7WA 4QR1A 2QGFB 1C1CA 1MSWD 3OW2R 3MEEB 3OXLA 2EXUA 1AXQA 1U0HA 4U9RA 2AKWB 1B0TA 3QAUA 1FTRA 4ES2A 3T19A 3MR2A 4IO1A 4YP3A 1EB0A 4ES3A 5ADZA 5L1LA 4IG3A 3TZYA 2WOMA 4DX7A 1W25A 2Y1IA 1FRJA 1Y5LB 3SCKE 3MECB 3PEHA 1F5CA 1UFWA 1C4CA 3ISNC 3Q22A 4WP9A 1K47A 3AOCA 5M2UA 3H98A 2W9BA 1KQSR 5F9LA 1M5VC 3NP5A 3VQTA 4UUXA 2H5EA 2FGCA 3KYLA 2HFUA 4XTTA 3TEGA 5HBMA 3CC7S 2YX4A 4ZVOB 2RU3A 1U6FA 3WHIA 1S5ZA 1G3OA 3Q24A 2FJAB 3C6UA 1YRTA 2MB0B 4DSIA 2V8DA 4AXJA 2QYGA 2IHR1 2MDAA 3DC2A 3DKDA 4ID5B 1R89A 3W5ZA 4B3OB 3KK3A 4YR3A 3D6MB 4RNMA 5E3QA 3GB0A 2D3ZA 1NDLA 1Y7PA 3NGSA 2DJWA 3JYTB 2AIRB 4C3LA 5AT1B 4B9NA 3QT5A 3W2WB 3VAJA 3EE3A 3NRBA 2HK3A 1PCAA 2VQEF 1LEOA 1XMQJ 4ZHRA 4CH1A 2VF3A 2KG1A 4MIAA 4ECTA 3QSIA 1N0UA 1HMVA 3BSAA 5CZVA 1HBOB 3CT9A 1R43A 3G6YA 2HFSA 4K4WA 2AEFA 1H7WA 5A6PA 3U1MA 2ZJPQ 4N76A 4MFBA 4WYWA 5MLCV 3RBXA 3IMQJ 2I0XA 3ENAA 2CJYB 1R8HA 1VQ8S 2R4FA 1FRMA 2MQPA 3VZHA 4L76A 3FJ2A 1SV5A 1X9SA 4PUOA 3BKFA 3P3DA 2L08A 1S1UA 4DS4A 1I3OB 1AA1B 3ZZPA 2K7KA 2V4JA 5CYQA 2FZGB 1S7IA 1FXDA 3PYGA 2ABYA 1S99A 2BBEA 4P73A 4Y2IA 3M2VB 4P72A 1DFDA 4UW2A 4JI1F 1GAOA 3RBDA 1HI0P 2AJ4A 4P71A 1VYAA 5J1EB 5D6GA 4ZA1A 1HYSA 3Q2TC 2LXUA 4QWDA 1CULB 4C97A 2XMMA 3AY0A 2EFGA 3KK1A 2AU0A 2HNZB 3IG1A 1K0VA 2ZZNA 4KHPJ 2ZH4A 4JI7J 2UU9J 2ASDA 3DDNA 1CJVA 2RF2A 1S0NA 1N88A 3EM1A 1R8CA 2XS7A 1NB2A 1SL0A 4ZPTR 1Y3JA 4K0KJ 3E01B 2QO3A 4NMXA 1TV6A 5DDOC 1C4AA 4XDDA 3TQ1A 3CF5Q 4C8NA 4E98A 1TKZB 4DX6A 2EG1A 2HRYA 3CE8A 5IFMA 2D3UA 1AFIA 1JXEA 3Q8PB 3DDIA 3TZZA 2X1AA 3K2YA 1U1OA 3OSNA 3DGVA 4UOFA 1G4CA 3CCLS 2QYCA 3EVWA 1RHUB 2B7BB 4GKJF 4M5NA 2DHXA 1SJ1A 4MH8A 2E9TA 5HMZA 1NUEA 4B3MJ 2ZBCA 3FSIA 1SIZA 3C46A 1HHSA 1WOOA 2NXJA 4OHZA 2UXDF 1IR1A 2KM8C 1KLMA 4JP8A 4NZ0A 3P4UB 1P1LA 4DR1F 2DBBA 3AFGA 1Q95G 1AB8A 1RHKB 1NBEB 4Q2MA 3MMAA 4MIBA 2D41A 4ZP7A 3A8IA 1IKVB 5HLFA 3CJRA 3TARA 5T41A 3UFCX 5J2QA 3KG4A 1Q79A 2FIUA 3QIDA 1TELA 2MKSA 4HACA 3CJ0A 1FKOA 2V34A 1U2RA 5KT7A 1JJHA 1WWHA 4N56A 4K4SA 4UTGA 5LL6d 1RHRB 1VRUA 2LECA 2R7RA 1TK0A 1DURA 1SQFA 1YX2A 3PFEA 2K1RA 4NLRA 4WCEQ 3EGNA 3DRRB 2NPIA 1XIQA 1AUSL 1EETA 1FJGJ 4MK7A 1BQXA 4DG1A 4DJBA 1LV5A 4E2FB 2G2ZA 2F4VJ 4OHXA 2XSJA 1TL3B 3W2VB 2E5JA 2NXUA 4CP5A 4LRCA 3KLFB 3EMTA 3TR5A 4AQYJ 2B5JB 4WE1A 3JSMB 5C2CA 1T02A 1VC0A 2ZNYA 3UWTA 3K58A 3R5BA 4UOCA 2LMIA 3UDVA 1X5SA 3M9NB 3GV5B 2Z57B 4V19X 5GAHI 3SYZA 3KJQB 1EJ7L 3CGIA 2FC9A 1C0UA 2OP5A 4OX9F 1UVIA 4B3SJ 4DV4F 4NA1A 3GV7B 1GTEA 5ETQA 4IQXA 3UW1A 1KBRA 3HPOA 3QRRA 4DMZA 1X9MA 4OMFG 4EEYA 1HLWA 4LFBJ 3H7HB 2GCFA 1KEKA 4TLQA 3I56S 3R8YA 3ZZTA 3HX9A 1RXOB 3M2RA 2B0GA 2YBVA 3R7BB 3UN2A 4HT5A 1ZM9A 5BYRA 3AH6A 2ASJA 3FBEA 4F2RA 1AUDA 3V4IB 4DV5F 1X0FA 3H4BA 1HQUA 4QPXA 2J76E 1UFKA 3BSOA 3I0SA 5SUHA 3I96A 2V6AA 2IDLA 2YX7A 2FZCB 1LXJA 4O3OA 3VWSA 2HVIA 3RAMA 4LQ9A 1JK9B 5KT3A 1RT2A 3PO4A 5DLGA 3J7ZT 5B0BA 3T1HJ 1DZ5A 3QATA 4KH0B 4O4RA 4KJIA 1VQ9S 1Q8IA 2WBRA 2DGUA 3CD7A 1N36F 1WF2A 3T9NA 2X1BA 1CJKA 4B9UA 3R9LA 2XY6A 1YHQS 1S59A 3IAS9 5G0RA 4EUVA 4ZP6A 1NK4A 1EZZB 2XS5A 1RT6A 2UV8A 1YVFA 1MMDA 1F0XA 1YJTA 2E7VA 3WX8A 1F9FA 2XTJP 3ZXWA 5ITHA 5GMKa 2HZAA 3Q8YA 1SKSA 1NLKL 3CDEA 2HLUA 1T03B 2H4WB 4I7FB 3DOKA 1TFYA 2KKHA 4P74A 2EC2A 4LR7A 4DCOB 3IXQA 4URGA 4LRFA 3EDQB 2UXBF 3MCOA 4XPCA 2ZH8A 4RW6A 2W2PP 4TY9A 4DQSA 1RT3A 4FVMA 3PM9A 2DKOB 4ZJLA 1U1PA 2B43A 4PXDA 1BQMB 2RVJA 2CWXA 1RTDA 4X84A 1F5AA 2VICA 3SEOA 4CLWA 1SC1B 4GKKF 3N0VA 2DYAA 1EIYB 4LSLB 2YVSA 4NPOA 2UVRA 4PG6A 2J9DE 5AXLA 3KHRA 3J81j 1KHWA 4CLFA 3OBIA 2PEBA 5H9FJ 1KVKA 3POTB 2MZQA 5DO2A 1GTHA 1P1TA 5HROA 3OL9A 1SJRA 1RAHB 1XNQJ 2C2MB 1U2CA 4ER8A 4OI6A 4W92B 1UVLA 3PZPA 3OV7A 2HKEA 2MQQA 4QR2A 4ZVTB 4LF1A 2WB4A 1QSSA 4RW7B 5KFMA 4KY3A 3GV8B 4IUFA 2OMLA 2UVWA 2CPHA 1MU2A 4KO0A 4A48A 4F26A 1LFWA 4QWBA 2FB0A 4DSEA 2ZJRQ 1IM6A 4M5IA 2OTLS 3E3XA 4DFJA 2EFNA 5CZXA 4ENOA 5C24B 2CQ2A 2GQQA 2YKQA 2ZDOA 3FUYA 4ANCA 4FNIA 2ZE2A 5DM7Q 1SXLA 1WNEA 3HK2A 5I3QA 2Z30B 3IR6B 4MAKA 4ZPWR 2RKIB 5FJ4A 2XZDB 4FDFA 3Q86A 5HMYA 1Z2LA 3LP2B 3TX0A 4USMA 3W60A 3NCQA 2VKRA 3SXLA 1I5OB 3C15B 4DR3F 3JQJA 1IXKA 3KUHA 5D0HA 2BJ3A 4ZPCA 5HVFA 3ZC4A 4PG8A 3BO3A 3MM9B 3AAWB 3H5SA 1HA1A 4R5PA 1JKHB 3IBCB 3M1VA 3KHGA 3MM5A 5K5MA 4DL7A 5HP1B 1VQYA 3E2EA 2CADA 3HF5A 3IA0A 4FXDA 2PDAA 4PYAA 2IIHA 4A8FA 3K17A 1RA7A 4JBCA 3C6TB 1RP5A 3PYFA 1SQEA 1JLBA 4Z7YA 3U7JA 2JC0A 3BN4A 3I32A 4NLVA 4IFYB 4O3NA 1JQGA 5GAHU 3CUNA 2DEJA 3QGIA 4DLGA 2BV3A 2ERRA 3MCNA 4CT8A 1E6VA 2WTFA 2GHWA 3AODA 5D4NA 3RW7A 4ZITA 4ICLA 3W9HA 2E7XA 3GSDA 4CNYA 1B0VA 3VTIA 2B51A 1HWLA 2LFVA 2EBEA 4AT1B 2IJFA 3M4XA 5AE3A 2B6AA 4BBYA 3A8KA 1T94A 2YNFB 2HYIB 4Y65A 1LKZA 1JJ2R 5G4DA 2DHSA 2SXLA 3H25A 1IKXA 3TUZC 2PC6A 2A0FB 4K50A 2QL7B 3ILJA 5B0GA 2VA3A 2G0CA 3HHLB 4NL5A 1UWAA 2MQLA 3FCWA 1WSRA 1FFWB 3MR6A 1BGXT 5L39A 1T8EA 2KYXA 4DV7J 3VF0B 1CS4A 1HNZJ 5LM7E 3VHQA 4Y2KA 3VAIA 2ZD1B 1CJUA 2AYBA 2HFOA 2I5JA 3D5MA 4PAAA 2PA3A 4M5KA 4FBTA 3NNHA 4N47A 4AL6A 1P27B 5L46A 1X9WA 4FYVB 3PFOA 1VRTB 4DR7J 3Q8RB 1VQ7S 1PO6A 2YH1A 4QCLA 4ZP9A 1HBNB 2HHTA 2BQRA 5H9EJ 3TZWA 3MPUB 3I0RA 2AW0A 4HYKA 1FNOA 2L41A 3IRXB 3QT8A 1UA1A 1Q8KA 1L3SA 4UQTA 3MR7A 2KH9A 1TK5A 1FWLA 4J9MA 4B9SA 4MIWA 1YIJS 4ED1A 4NRTA 3K5OA 5KFHA 1KNZA 4P9SA 2VDHA 4PQUA 3PACA 4CTAB 5CD4A 1BD6A 4CLUA 2B4UA 5FIIA 1RCOB 1ZM3A 2RQ4A 3CCJS 2ZH1A 4PXEA 1NSKL 3TO8A 1SI9A 5F3ZA 4OI4A 5A8WB 2QG9B 4UUWA 2BMBA 2GIRA 4FS2A 3DLEA 2R8KA 4YFUA 4OJHA 4JI2J 2VBYA 2GW8A 2XMKA 2PN6A 1FX4A 3MUVP 1F5BA 3NOGA 3AD7C 3SQGB 4RW9A 2HMIA 3KLEB 3RG6A 2OPPB 1RWUA 4OZNA 2VOPA 4DHVA 3TWZA 1XMQF 4ES1A 2R3VA 5IC4B 2XLKA 4MK8A 1FRHA 3BM7A 3JS9A 2DXEA 2GVDA 2HZCA 3RRKA 4X4QA 4DQPA 3KUGA 1S79A 4NCGB 3CMES 4CM2A 4DSLA 4DR4J 1K1QA 2VPWB 2DXFA 5IWAJ 2XO6A 4LF6J 1HPZA 3RZAA 4Y2AA 2HG4A 4O3QA 1ICEB 3W1YC 3C14A 1JLGA 1S1XA 4O3RA 2YNHB 2EG2A 4CM0A 4KGKA 3KK2A 1ZH5A 3MCSA 2BR0A 2XMWA 2VV5A 3D68A 3CJKB 1S12A 5F0UA 1SBRA 4Z37A 3OR1A 3TA1A 2OEJA 4LF2A 1M5OC 2JEGA 3V4MA 5C42A 4ED3A 2RAQA 1RJJA 2IBKA 2E5LJ 3OR2B 4F4WA 2DGVA 4K2XA 3AJDA 2V9KA 3VAGA 3A3PB 1S6OA 2V2KA 2MGZB 4DV0F 5AE1A 4Z2XA 3M2UA 3GG0A 1TL5A 1NRKA 4NCBA 4A46A 2D7SA 2MHEA 1KSPA 4QPTA 1IKYA 3PNIA 1P9QC 4MKVA 3Q2SC 1LW2A 3D7SB 2JL9A 3DLGA 5F8GA 4QYZJ 2V50A 4FYDA 3NAHA 2MEWA 1SJ4P 2CQ1A 2GS8A 1VC5A 2EFVA 4KHPF 4H4MB 4JI7F 1MN9A 4DZDA 3PX4A 2YPZA 1IWAA 2OEKA 3LP0B 4ALZA 5C2GA 3GILA 4K0KF 1ULRA 4IFVA 1GK8A 3IFEA 1PIEA 2KRBA 2J0XA 1X4BA 2QLJB 1GNKA 2C1EB 3EVMA 3MUMP 1N56A 5J2NB 4F4KA 3QO9B 1SH0A 4F4ZA 5LMUF 2ZWPA 2HNDA 2X3GA 1YG0A 5JUMA 4RW4A 4KSEB 2AGPA 2G4BA 1JLFB 1RYRA 4XK8C 3FC9A 3PY8A 3KDNA 2ZOMA 2MQ8A 5KAKA 1HQ2A 4G6VB 2Y1RI 3BQ2A 2R7QA 4HDGA 2E29A 4ECUA 3BZQA 2CZ9A 1I1GA 1M5SA 3LP1A 4FYYB 4B3MF 2OO4A 1PBAA 1QLNA 2E5GA 2Y8YA 4B9MA 2DHHA 2Z2LA 3ENQA 1HBMA 5ETLA 1RTHA 3IN5A 3R6LB 4BWJA 1W2IA 1UVNA 2B7CB 3UN5A 4J9LA 3ISND 3RW6A 5L1IA 4NX9A 4DL0C 1TL1A 1U1LA 1VQOS 3BBBA 1HR0J 1S9GA 1X5OA 3M7VA 4ECRA 2PMWA 2G2OA 2DR9A 3MI7X 4EFAC 1HARA 1QM9A 2ILZA 4YR0A 5HO4A 1LWFB 1UWBA 4TY8B 5IV3A 2IJRA 8ATCB 4PCQA 1U09A 4XO0A 4PQAA 4EBEA 4LFAF 1SUQA 2DNOA 2ZC4A 3EWGA 3W62A 4CO0A 1N0VC 2OIHA 1RT7A 3FCVA 4TY8A 4DL2A 5K14A 2WHOA 4A47A 1R8BA 2WCXA 2KN4A 3IM9A 3N6NA 2HHQA 4ZVEA 3EGZA 4F67A 4L6V3 4MT1A 1L5UA 4K4ZA 4CYUB 1VBYA 1QDUB 3DM2B 2IYIA 1DTQA 2BW2A 4NASA 4I4BA 3PDNA 3HHNB 1ZPWX 3AOBA 1FJGF 1ELOA 3CC2S 1FRKA 5DZ6A 2BZ2A 4Y3CA 1F60B 3SV3A 2F4VF 2FHKA 2RILA 4AQYF 2ZNZA 1IBCB 1F2HA 4ECWA 1RHJB 2VFSA 1KRPA 1JXVA 3DLJA 4YOEA 3TX8A 2VBZA 4O23A 3WDOA 2VA2A 2LDIA 4G1QB 3BEGB 4Q8FA 2E1MC 2J0SD 1LWCA 1VQNS 4YUDA 1G1XA 3M6WA 5DLFA 4DEZA 5KFDA 2KJVA 3M05A 4B3SF 2BDPA 1WKJA 1RDRA 1HNIB 2UUBJ 1TZ0A 2G1DA 4R25A 5CD4H 2HWTA 4ELUA 3P96A 3JB9k 2AEJA 1MNEA 2RNEA 2R2TA 4LFBF 2IM1A 2G9OA 4FS1A 3I9V9 2P8IA 3MXHP 1B70B 1JLEA 2WONB 5K8NA 5T7LB 1N8RT 1LXNA 2AYEA 4NA3A 2H5JB 2GJ2A 4USWA 1ZTTA 3BR9A 4RUCA 1XJWB 2ASLA 4C7QA 1WEYA 4IRDA 4C8MA 3BB5A 1KVIA 1YDLA 3QLHB 5C25B 1IKWA 3DI6B 2ZZMA 5LMNJ 2IC3A 2OPRB 1VGYA 3K89A 1Q81T 1TKXA 3F41A 2PO4A 4ECZA 2YKNA 1H72C 3MM8B 3T1HF 5LXYA 1FEEA 2PIIA 3G6ES 3SSSA 2GHVC 2RJZA 2ZDPA 1DARA 3G87A 5BXIA 5E5NA 2BQ3A 1S49A 2RQMA 2CVIA 1X4GA 4DFPA 4DX8H 1UFLA 2V69A 3GU0A 2XM3A 4L72B 3V81B 3MEDB 1RT4A 3PW4A 3CJ8A 3BKTA 3RAXA 1JLAA 3G4SS 3PRDA 1KHVA 5HAOA 4FPIA 4FBUA 4DI6A 3KMSA 3V6DB 4ZKAA 4DUZJ 2XI2A 4NEYA 1N48A 4OZ0A 3M8RA 3NNAA 3HSGA 2UP1A 1HD1A 2BUNA 1ROFA 2RS8A 2XWXA 4A8WA 1X4AA 2W2OP 1MWZA 3FFIB 4CLPA 3R7SB 2DNGA 2Q79A 1XC9A 1RWKB 4X65J 2I8EA 3UDLA 3NAIA 2YQ3A 3I5BA 3N5FA 3H90A 3M8YA 4WP3A 1FE4A 2EKYA 4EO6A 1RWXB 1S6PB 4JI5J 2C2DA 4RL1A 3O6QA 5CAAA 2FC8A 4WXOA 1T9WA 3AT1B 4P2MA 3QJJA 3PV8A 5BYSA 5B0CA 2HS0A 2VG7B 2CJBA 3TNVA 2I2YA 1RAIB 4DF4A 1W2BR 2AP6A 2MPUA 1WORA 3OFGA 2DCUB 3ET6B 3ZNUA 2ILYA 3EPIA 3HP6A 1XN9A 1CLFA 5KFXA 3MM7A 3I6PA 4DLEA 2V68A 4M95A 1R6YA 5J2MB 2MLXA 3NS5A 4TU7A 3O2IA 1BWEA 1XNQF 3IS9B 2R7SA 4WIIA 4Q8EA 3HSZA 4DV3J 1IJFB 2UVVA 4OV6A 1CC7A 2KT5A 3DXBA 2HHPA 6FD1A 1XERA 3O44A 4DSJA 1HNXF 3QQCD 1FERA 1RHQB 2B9EA 1PAUB 4N8NA 2E9RX 1EP4A 2FJEB 2R2SA 4WPAA 4BLGA 1QSYA 1S1WB 1GMUA 1HWJA 5LJ3Y 2PSZA 5E41A 2N7CA 3PCOB 2JWNA 1WC1A 3J7AN 4LBHA 3HVRA 1JLQA 2UUTA 2CPIA 5ETSA 2IY5B 5AXNA 3QGHA 1R0BG 4WFAQ 4ZS6A 2CNLB 3MPDA 1BQNA 2QIFA 3M8ZA 1CC8A 5L9NA 5KT2A 3BH6B 1FDBA 2DTJA 5HVHA 4RWWA 2XB2D 2HHXA 2QLBB 4DFMA 3DOLB 2NSCA 2BOAA 3DYAA 3JTNA 3R5CA 4P2SA 1B0PA 1YSJA 5CCMA 2EFOA 4RNHA 1WHVA 3I82A 2QL5B 3C16A 4WFNQ 2XMTA 5L9XA 3MCMA 2CYYA 3OTDA 2EEYA 1OY6A 3K7RA 3MZIA 5K20B 2KT3A 3PIPQ 1XMOJ 2W2MP 1NK5A 1FO1A 5HANA 2DY9A 2HNYB 1FRLA 1L3UA 3DLKA 4LSZB 3MUTP 3MEKA 3D3BJ 4ZN1A 2ACYA 4DQIA 2BVZA 4M5JA 1JMTA 3H2UB 3FBFA 3NG8A 1Q78A 4M1KA 5D4LA 1RISA 4HH0A 2PFDA 3CCQS 3SCJE 1VDHA 1R6VA 3H2VE 5LSOA 5KG5A 2ZM6J 3KMQA 2EKNA 2BKOA 1RU1A 1BE4A 3L7PA 3B54A 1WG5A 2HVHA 5ETPA 1T05B 3W63A 4M5DB 2D3O1 3W8GA 3ZO7A 2J0QD 2DISA 2VG5B 3LPYA 5KFPA 1LW0B 4KRWA 4FF3A 1Q4RA 4JYAJ 4Z7CA 1N5QA 1CQNA 3K57A 2I9SA 3T1YJ 1D1UA 4OYOA 3NBPB 4U96A 1FKPA 4QWCA 1MROA 4LFCJ 4DV7F 2P9CA 4WFZA 1HNZF 2GJIA 2Y0BB 3BO2A 1V5VA 2AMCB 3G8QA 2JJ4D 2O3DA 3IRWP 1KR4A 1WOPA 1KDNA 3OVAA 1N5VA 5KFYA 1UW9A 2OI2A 4RBVA 3PKYA 2UXCJ 4A8YA 1KWMA 3TAQA 2MXYA 3ONQA 3MFIA 4N5SA 3I87A 2E1PA 1URRA 3BBFA 2XO7A 4DR7F 4OLPA 2Y1JA 2RIJA 1WD6A 4Q45A 2JRSA 2YNGB 4IG0A 4EU0A 2V8VA 1N5YA 2W2NP 3FVYA 3MD1A 1HI8A 1SC4B 3CD6S 5B08A 1U1MA 1IR2A 1M5KC 4ZVGA 5D3GA 3I9ZA 2MLZA 2AHOB 3KLIA 4ETXA 4IH7A 3I5AA 2RD5C 3TA0A 4CO2A 1X8DA 2KVQE 1YJWS 2R8JA 1S4EA 2IYGA 5CYMA 2QN6B 3QAEA 3D67A 1DQAA 1MW7A 1DTTB 4RZRA 1LFPA 2PE8A 4PKDB 3VVUA 4TU8A 2V2VA 4LREA 4UY85 5F8LA 3OXGA 1UEKA 2JVOA 3LPEA 1Q5VA 1CSJA 4Q0BA 3BDPA 3M30B 1WUUA 2KFZA 2K2PA 1D8YA 1FRIA 3BSNA 4HVZA 3GMGA 3N28A 1B64A 3F44A 4HEA9 5KG0A 4JI2F 3PJXA 1FK9A 5L1JA 2BQUA 2FTRA 3R1LA 2YKMB 3DMJA 1S6UA 1IWGA 1PJ7A 3DU5A 1CEZA 1S76D 5HJXA 4F8RA 4JI0J 2R42A 5IM0A 5DDQC 2EW9A 1U1NA 1JXLA 1MMLA 4R8UA 4C11B 2FJBB 2EWHA 1SQGA 1LK5A 1RAEB 4DSFA 2GIFA 3TQEA 5KFNA 3GR1A 3H5YA 3EYZA 4DR4F 1NDPA 4LF6F 1S57A 3M6VA 1C0TA 4F50A 4UQGA 5E3RA 5J2PB 1URNA 3NGKA 1Q16B 2OPSA 3ENVA 3M8WA 5KFLA 1S6QB 3N5BA 3T6BA 4P10A 2CQIA 4NYPA 1HD0A 4LIWA 1NZAA 1U2FA 1M1KT 3IP0A 1VJWA 1ZBTA 3DRPA 1VISA 5I42A 4DZ6A 2AYGA 1T3OA 1S0MA 2MY8A 2HEKA 1LNQA 1UMJA 2WZ1A 2LXIA 3ZTRA 2X7IA 1Y0HA 2QE5A 2NLWA 2VBWA 3SSQA 5A2QU 2QFJA 2MY7A 4CO1A 1FDNA 1HNVB 1D3WA 1REVB 2A1BA 2JLFA 1QAXA 1NMEB 1SJFA 2X3DA 2M2BA 3O1LA 3AQPA 1DJ0A 1F3FA 4J7CA 1IBLJ 4X4TA 4DF8A 4O0NA 4DU7A 2VFRA 3HULA 4IYQA 4NA2A 5EWFA 3NMRA 3EZOA 4RUAA 2VFVA 4W4MA 3D1HA 4J9OA 2VODA 2C2KB 4UZCA 5IT9Y 1TP7A 4JV5J 5FDLB 1RT5A 2L3MA 4LJMA 2GO9A 3C66A 1YLXA 2U1AA 1M90T 3CO0P 2YXLA 3C8YA 2W9CB 3MM6A 2C3YA 2KDOA 1C1BB 2GGPA 4PR6A 2M52A 4OJGA 4OYZA 4DN0A 3UD3P 4IDKB 1UPPA 3HXMA 1FTCA 4F4AA 4U95A 4F25A 1GMVA 2M8HA 3CCES 1QUPA 1RE1B 2V0NA 1XR5A 3JQKA 2OKQA 2K8GA 3TW0A 3BO4A 3MTKA 2UUAF 2LQ8A 3DOMB 1JIHA 3TAMA 3DHWC 3HI9A 2OFGX 2CQHA 2RUGA 1FD2A 2FLOA 2YNIA 3AB4B 2C2ZB 3OFHA 3VGUA 1L3VA 4K4XA 3B4DA 1BXNA 4B3TF 4EZ6A 1UJ5A 4K2JA 1LOUA 3J81Y 2FDNA 1S77D 2IAJA 2ZVSA 5KT6A 4JI4J 1OO0B 3GYXB 2B9XA 4O4GB 4RJVA 1R7IA 1GXTA 2JOQA 1KP6A 4H4OB 5EWGA 9RUBA 3OL6A 2YQ0A 5EX3A 1KD1T 1RWPB 1UZHA 4DR6J 1GEHA 1HR0F 3HKZD 1SH2A 1NB7A 4M63A 1H0HB 1BHNA 3OVSA 2A2CA 4QU7A 3HFVA 2ZITA 3M32B 3Q89A 3WBZA 4Y34A 2RQCA 3QWPA 3G86A 3P45B 3OT9A 2DRBA 1ZA2B 1NHUA 2YWWA 3FCHA 5E2QA 4WK1A 2VG6A 3BV8A 4U8VA 1N34J 3CCSS 1TVRA 4I68A 2D3OR 2MJUA 2R8HA 5AJ3J 5H1SV 5DQGA 3MMBA 3W9IA 2OD4A 5A8KB 1N32J 2LQ9A 5I3UA 2XHWA 1WEZA 2HRUA 4I2QB 2L9DA 5D4OA 2CQGA 2KYZA 3KJVA 4QIGA 4O44A 4J5OA 3TAPA 2FQQB 4DWIA 2CQDA 2H65B 2HHSA 2WW4A 4QOTA 1WHYA 1CBKA 2DEIA 4GRSA 1S1VB 1RKIA 3KJNB 3ENWA 2QA4S 1UAWA 3L7UA 3EZ5A 2Q6BA 4CT9A 3Q83A 1AFJA 3IBFB 4Y6IA 5K8PA 1F1BB 4WK3A 2DT9A 1J5EJ 4EYHB 5E7OB 1IQTA 4EBDA 4X62J 1F9EB 2CJ9A 3FGVA 3L4BC 1HW8A 4RW8B 4LSNA 1RTJB 3K8VA 1HBUA 2BJ1A 3DLLQ 3G96A 4NYOA 4ZVSB 2VD3A 2PMZD 1M5PC 2F65A 3SDEA 3KLGB 1U7LA 2UUBF 4GVBA 1VRQC 4M5LA 3OTCA 4ID8A 3KTQA 4R0JA 2NZ4A 4DX5A 1VLOA 2DNYA 1TL7A 2DXDA 2I1RA 4AUKA 2KB2A 1X0PA 4NI2B 2CJQA 4OL8A 1K9MT 2MYFA 2I38A 2XNRA 2BKPA 3UVJA 1FDDA 3OLBA 2GJFA 1CPZA 1T9TA 4I6AA 3ICLA 4KIAA 3H4DA 4ZCLA 3MEEA 3LANA 1F6TA 5LMNF 1FCAA 1RTIB 2CRLA 5IT9U 2WW8A 2WSFC 4NXMJ 1NHKL 2ROEA 1Q7YT 2XSFA 4WIQA 2IRYA 3FEXB 1B7YB 1OPZA 4ZPAA 2MSSA 5KFWA 1Y10A 1QAYA 3NKYA 4NLGA 5U47A 3HO1A 1RQ0A 2JNJA 4TVAB 4I64A 4J9PA 1KQGB 4OJ1A 3VGTA 2YWEA 3MECA 4B9VA 4DFKA 3M6UA 4J90A 1IBMF 3OHAA 1OSCA 2KO1A 4ED6A 2BJDA 2M0GB 1X4HA 2WK4A 4IQMA 4TXSA 1UEUA 1GT8A 2QRRA 2ZH5A 1E6YB 2QMUB 4JV1A 3O8WA 1FJEB 4KQZA 2EC0A 5E3AA 2KM8B 3G8SA 1GMWA 8AT1B 1N52B 3GTYX 4X65F 2NXCA 3T1AA 5D0GA 4NLYA 3J81U 4DR5J 4W90B 4QIVA 1GMWD 4YQWA 2DGTA 4DUYJ 2R7TA 2P9GA 2CJXB 1UETA 4ID5A 3VALA 4JI5F 4B3OA 3W65A 2CAJA 1GFWB 1WDDA 5FD1A 1Y9OA 4YY3J 2VB6A 2VC1A 3H8YA 3RB0A 2B4OA 3JYTA 1WELA 4OYWA 2VQEJ 3W2WA 1RT1B 4TQSA 1UL3A 3K5LA 2AZ3A 1AZSB 3OQ2A 4QZVB 3D0HE 1C2PA 4WWSA 5KFFA 5L38A 4MKBA 1HBOA 2BANB 2FLNA 2XLJA 3GCXP 2DVIA 2CQ4A 1JB0C 2R2UA 2D9PA 5KFEA 1P6TA 4F02A 3S8SA 4KKOB 2EI5A 1DBDA 4LBIA 3JAMY 1H3DA 4ELVA 4TYAA 4NEZA 2Q43A 2W01A 1S72S 3AB2B 4DPTA 4PWWA 2OPQB 2VQFF 2MZSA 5IC6B 1YRXA 4M8LA 2J6UA 2OUGA 3M8QB 4L74A 3CDAA 4F3MA 1O8BA 4JI1J 5F9NA 2LXFA 4BC9A 3M2VA 3UR0A 7AT1B 4CI0B 3HSJA 4HH1A 3M6XA 3IR5B 4OZ2A 5L8RC 2P9EA 1LK7A 1QJHA 4ZOSA 3MAAB 3B82A 3IM8A 5J1EA 2YWKA 3ZZUA 3D54A 2F3JA 2Z58B 3G82B 2ZBRA 1CULA 1T3NA 2POKA 4EO8A 3QJPA 4S0MA 2MKIA 2XMAA 1V6HA 4USUA 1HHQA 2CPXA 2HNZA 2ZH3A 3OUYB 1KTQA 1HWUA 2LP4A 5J1PA 3TJ8A 4EI2A 1N6QB 5F0WA 3AJ2A 1QVGR 2E1CA 4IH5A 3E01A 2IDEA 4TN2A 4PWDB 4YB7A 2RB7A 4DCPB 4HTJA 2VUGA 2P2CB 5A8RB 4DR2J 4ZDNA 1TKZA 2GQCA 4CIOA 1OY9A 3BGFA 1Q8BA 4QW8A 3A12A 1Q86T 3NGTA 5EDWA 1QTMA 3TEHB 4I0WA 3NCRA 3HKWA 4RKUC 2CVEA 5F8MA 2F63A 2HAFA 5ETVA 1WACA 3CTRA 4LF5J 2ZUAA 3ZTSA 2VC0A 1XMOF 4ECXA 3TVZA 4LUBA 1KQFB 4ZCKA 2NQPA 5DQIA 3WIUA 3CCMS 3NGDA 1HIYA 2VKZG 2GFFA 4YHHJ 1HNWF 1M1GA 4DR1J 2CZVC 1U48A 1S0OA 3UE2A 4N7TA 4GO7X 3MMCB 1S1TB 1R3NA 1PJ6A 1QAIA 1CQMA 1Y11A 1Q1KA 3TANA 3F56A 2V4QA 4NWBA 2WVFA 2C3OA 3G6VA 2RRNA 3GWCA 1FFGB 4CH0S 1HQEB 2BJEA 3GLJA 4FYXB 2NUHA 1IKVA 1KQKA 3T3FA 3P6YC 1VCTA 3SIPB 1MN7A 3ZTPA 2CPZA 2CQ0A 4JYAF 2C3UA 1JJ4A 2LQ5A 3H0PA 5D0RA 2DY1A 3TVKA 3T1YF 1DY3A 3K59A 3FEZA 3AXKA 2QSFA 5KFZA 4TLRA 3ITHB 2LYVA 3QZ7A 3PHTA 1WC6A 2C22A 4RO0A 3H42A 5KG2A 3HT3A 1KOHA 1D09B 4KPYA 1R8AA 4EWTA 3ZFVA 1U8SA 2XZTB 5KOWA 1RZMA 3DRRA 3DRSB 3MEGB 1NZ8A 3FZBA 2LCWA 3PKMA 1DLOB 1D9DA 3CCVS 2KXHA 2OSQA 1R0AB 2BE2B 4I2PB 3QIPB 1TL3A 2AJ2A 3W2VA 2DH7A 1TU0B 3KLFA 2B5JA 4WP8A 3JSMA 1YJ7A 1WKKA 4LF4F 1TKTB 2IM0A 3F73A 2N4CA 4F0MA 3EZUA 2E1RA 3EGVA 2J6TA 1LQ9A 3JAMU 1VBKA 4OX9J 2C3MA 3BREA 2O67A 4NOHA 1ZAXA 1NSAA 4A8XA 1EHWA 2DNPA 4A8OA 2J7KA 2NYIA 1NSPA 3V6HA 3VV2B 5A0YB 3U1LA 1J5OB 3U27A 3C2PA 2XC9A 4JI6F 5EX0A 4ZLPA 4ZCMA 4GO5X 2YTCA 3DXSX 4QIFA 4ZPBA 4RR5A 1YKWA 4U7UK 4HL9A 5THWA 3TUIC 2FJXA 2QLFB 2KU7A 3P5TL 1V9OA 3W66A 1HWKA 4DUTA 3SQOP 2LU2A 1EQMA 1OMSA 1VHIA 2HZVA 2XCAA 4KV8B 4EZ9A 3GYNA 4DV5J 1XNRJ 1IQZA 2YKAA 2HFVA 3V4IA 4U67Q 2RDIA 2V2ZA 4EYIB 1V3RA 2UUWA 1HFEL 2FY1A 4N77A 2D69A 3QWUA 3HLUA 2HBZB 5IZHA 2BEFA 2OFHX 4JI0F 1T11A 2XZWA 1VIXA 2MMYA 4OQJA 4ZLJA 4ECYA 2R7UA 5KFIA 2HVZA 3D9BA 5K8MA 3FBCA 5IXUA 2RHSB 2X1GA 2JLGA 1KTVA 4OI1A 3CCUS 2F9DA 2Q3PA 3R27A 4FF2A 4IOAQ 2BOPA 2YKOA 3US5A 4MMOA 2WSEC 2MLYA 2C2OB 1NKEA 3MD3A 2QEXS 1FRXA 3BGUA 1FA0A 1WKLA 1MWYA 4C48A 5KFBA 3LQVA 1Z1ZA 1T03A 4DV1J 4I7FA 2A3JA 3C3LA 4DOZA 3G71S 3HVTB 2DHAA 5KT5A 1U1RA 4C3KA 2J5AA 2ZKUA 4CLZA 4LF9J 4IO9Q 1SC6A 2B56A 5D15A 3NEKA 4HLBA 4JI3J 2AJQA 1NDKA 2E66A 1F2GA 3KLHB 2XY5A 4CLYA 3CCTA 2DD8S 1BQMA 4P7TA 5JJBA 3EDRB 2XI3A 4UZBA 3M8PB 4JV5F 1JLCB 2E5IA 3GJTB 3R5JB 2MZTA 3NWRA 1ZAWA 5DG7A 3R5GA 4ECVA 2W7PA 1M5HA 5KFKA 4W98A 4LSLA 1VQ5S 3NGRA 2W8LA 1U1QA 2MQOA 3RRGA 3POTA 1XR6A 2GMLA 4NXNJ 2J8SA 3CSKA 4ED7A 2A2DA 2FPHX 2WRMA 4WTYA 4WU3A 4RW7A 1RAOA 2GVZB 5AXKA 2F8HA 3CWJA 1LWEB 5KFGA 5KFSA 4YB6A 3BH7B 1ZYQA 4KFBB 4C8LA 1RADB 3BGRB 3LWLA 3N9UC 4WYLA 4FPRA 4HR2A 4JI4F 3NXZA 5C24A 4X4UA 2N4DA 3ZZ0A 1BC6A 3OSPA 1EARA 4DSKA 3OJUA 3NLCA 2AT1B 2GMHA 4ZJOA 2RRBA 2KFNA 5AE2A 4LR9A 2RKIA 2CDQA 1Y5NB 3HHDA 2CUYA 2DGOA 3LW5C 4JV2A 4AE5A 2AGOA 3LP2A 2CNOB 2YY3A 3HJVA 4OLOA 2ZKTA 4DR3J 4KE5A 4QBUA 2BABA 1FXRA 3DLBA 4YDXA 1VJQA 3C15A 4JUZA 2BXJA 1N34F 4IRKA 1X4DA 4WJBA 3VAMA 2HRTA 3CMAS 3BPSP 3TYTA 5AJ3F 2OAUA 3MM9A 3P8BB 2AYMA 2BACA 3ULHA 1JKHA 4KAIA 5D4PA 1RKJA 5HP1A 3CJ3A 4M5MA 4YB5A 1T95A 3VR1A 4UF4A 2LQJA 3H2LA 3WC0A 2MKKA 3RBEA 1TQLA 4IH6A 3VGVA 3I4HX 3C6TA 4DU8A 2QC3A 3EGWB 4IRCA 2W4CA 4L75A 2CPFA 2WVEA 3RBZA 2U2FA 2N3OA 2RT3A 1IVZA 2DPJA 1QE1B 1QAJA 2LDYA 4ELTA 1KN6A 4PRFA 1NSQA 4IFYA 1OS5A 3UNGC 1HHTP 1W26A 3OTOJ 1VQMS 2R7VA 4C3MA 1AT1B 1Y5IB 1MLAA 4FVCA 2HIYA 3T5JA 3PW5A 2G2YA 1J5EF 1OPIA 3H5UA 4X62F 1J2VA 3GFHA 2IFXA 1O0PA 1TL4A 3DGPB 5HQ8A 1YZ7A 1UA0A 2BE7D 2HHVA 3WX4A 3IBWA 2LQBA 2YNFA 2VASA 1S9EB 3D1OA 2WSCC 5GMEA 2P6TA 4HI2A 2CA9A 2QLWA 1YGYA 1NK9A 3R97A 2PA8D 1BY9A 3HHLA 4OHVA 3A8EA 1PSDA 4LF8F 1CJTB 1NH8A 4WBFA 1C1CB 3HHLD 7FD1A 1M0SA 4JI8J 1K73T 2EFPA 2CNKB 3W5XA 3QSYB 1U0HB 2OMOA 3AD9C 2ZD1A 3G6XA 2CPYA 4B02A 4ZVQB 3I31A 4KGMA 4IG3B 4DPXA 3CB4A 2WOMB 3NS7B 4NXMF 4ILRA 2XMJA 1S97A 4IOCQ 1VRTA 4KBIA 3BS9A 5KFRA 2YX1A 3KDOA 1HBNA 3VAFA 4ANDA 3HT0A 2IJNA 1UZDA 2ZUGA 3QFHA 1RI7A 4CO5A 2HQFA 2KTQA 1D9FA 2Z2YB 3SZ2A 4EBCA 2K3KA 2W9BB 4RBUA 4ANEA 3IRXA 1HW9A 1QY7A 5KG4A 3PW7A 5HBMB 3J7Z5 3H40A 3RAQA 4OI2A 1BMQB 4R0EA 4BC7A 3K0JA 4Q2LA 4CZCA 3T5KA 1OWXA 4ZK7M 1KKHA 5LXRA 3C6UB 1LWXA 2H1YA 5GVQA 1SB6A 1VR6A 1P9YA 4CTAA 2Q66A 4DDFA 3THVA 3KK3B 2AJFE 4C0OC 3PEJA 2FHJA 1H2TZ 1SH3A 2BJ8A 5A8WA 4DR5F 4ZLLA 4DUYF 1Z2ZA 1XMBA 1CG2A 2FHJD 3LOUA 3U02A 2JLEA 2Z2MA 3CNQP 4KC5A 2Z0GA 2NSBA 5LOQA 1NK6A 4ZHRB 2H48B 4YY3F 4KGZB 2G0IA 1HMVB 3SQGA 4ZVUB 1Q7LB 3KLEA 4RNOA 2GZOA 1VQKS 4ZJQA 7FDRA 1WJ9A 2OPPA 1ZS6A 5KFOA 2XYGB 3CJTA 4MFBB 2LEBA 1UW4A 5BR8J 3GJSB 4NMLA 4USJC 5DDPC 4QU6A 2XNQA 2AF6A 2CQBA 2XYPB 5KG1A 4NCGA 2L48A 3BF4A 5F41A 1SV5B 5I3PA 1OIAA 3MWBA 2JC1A 4PUOB 4CO4A 1S1UB 2ALZA 3SMZA 5EUHA 4EMDA 3HVAA 2FHOB 1FWKA 3SSRA 2V4JB 5KFAA 5CYQB 1ITPA 2ZH2A 2L9NA 4PZVA 1WF0A 1WG1A 2YNHA 3DRXA 2NCKL 3MF5A 4ZP8A 2EVZA 2EK1A 5LT5A 5DG8A 3CJKA 4USVA 4MTPA 4H4KA 1NKCA 2OSRA 3CVKA 3PHEA 1NDCA 2HQGA 2B8QA 2KG0A 4DPWA 1O5JA 4HHJA 1NK8A 1SVDA 4EK2A 1VLYA 3EICA 3AA9A 1OQ3A 2HW3A 1RBAA 1EX8A 1RYSA 3V2UC 3OR2A 3V6KA 3UN3A 4DV0J 1XEZA 4H54A 1HYSB 4O3SA 2QL9B 3N79A 4P52A 1T9YA 2MGZA 4PABA 3B4MA 2VHGA 3X1LB 1VC6A 2AV5A 1WHXA 3TVYA 3KK1B 5DRKA 2YPYA 4ATNA 4OZ3A 2UV8G 1TAUA 3IG1B 2XMVA 2OEMA 3D66A 1CJVB 2KJWA 2RF2B 2UU9F 1MWQA 4OHYA 3HHKA 4I69A 1TV6B 3KG0A 4H4MA 4MKYA 3G9CA 4OHWA 2J9CA 3GR0A 3R5DA 3VAHA 1WC3A 1X5PA 3LP0A 1FNMA 2LEAA 1ZTWA 3GIRA 1TK8A 3W9JA 4DR2F 4I1TA 4NLDA 3Q8QB 1NKBA 3QRQA 5LMUJ 5J2NA 1JJCB 1OJ4A 3QT6A 4K4UA 1YTYA 3QO9A 3GQCA 1VS3A 5M2PA 3LTOA 4J9RA 4AD6A 2LA4A 1JLFA 1RACB 1J27A 1KVJA 4Y2CA 5K8OA 3B8HA 2XLIA 4LF5F 1KLMB 1KOOA 4FYWB 3TRGA 2VJUA 2ROPA 3I5CA 4OX6A 2DO0A 2C3PA 3OFFA 2MKCA 2DNHA 1OQ6A 1TMJA 3J80Y 4YHHF 2H3EB 3MMJA 1VQ4S 2KZMA 3MMAB 2V5HG 5BJRA 2GX8A 3L7OA 4GVLA 2JEFA 1A9NB 5HLFB 2V2QA 3PVXA 1JX4A 3BJYA 3QGPA 5J2QB 3KJFB 4F3QA 3BGOP 3WIVA 2LKZA 4HACB 1FKOB 4LFAJ 2YWGA 2R8IA 1LWFA 1YJ9S 3T5LA 2XWYA 4YEAA 3D0GE 1T9UA 4ILMA 2DGSA 2HS3A 1VRUB 2VOOA 2K1RB 5CHCB 1NJIT 6AT1B 4DPYA 3OPKA 1EETB 3PO5A 2D9OA 1FX2A 1VQLS 2BA9A 1I94J 3EPGA 4DG1B 2MQNA 2FD2A 1G7CB 2Q6CA 3UO0A 4CYUA 1X4EA 2XSJB 3M8SA 3DM2A 3WZ0A 2ZWOA 4X4VA 2FHMA 4WE1B 1SL2A 3H59A 2GNKA 2FLPA 2E9ZA 2V9WA 3RYLA 3CIZA 3HFKA 2CG4A 2GO8A 2VDIA 4E0DA 1C0UB 3JSRA 1GQEA 4J91A 2XHCA 2FYXA 1X4FA 1RU2A 4G1QA 1RA6A 4M5GA 2J9DA 2F40A 2IRXA 5DGAA 2BYCA 1H2UX 2AGQA 4Q43A 4X4SA 5C7PA 1QD1A 2V8HA 4C4WA 1S4FA 1UKUA 2DH8A 1HNIA 4KGVB 4USTA 3M2RB 4P6QA 5HN0A 3WQPA 1FWPA 2AJ1A 2JX2A 5GADI 4KYZA 2DB1A 3ILLA 1YBAA 1KLNA 4RNFA 3OTEA 1DHMA 2WONA 3GJRB 3VGSA 3THTA 1YBUA 5KG3A 2KVIA 5J1NA 5T7LA 2CZ4A 1HQUB 2O01C 3I0SB 5KFQA 1XNRF 5CCLA 3OXFA 4USHA 5ETOA 3MGJA 2RDJA 3PG9A 1RT2B 4L73A 1FNXH 1SJQA 2HHHJ 3QLHA 3OHBA 2W24A 5C25A 3DI6A 4NZ6A 2NR0A 2IA6A 2IVFB 1H6KX 2OPRA 4QW9A 3KHHA 1RAJA 4C9DA 2VZ9A 1X31C 1PC5A 3MM8A 3NL0A 2QLXA 2PD1A 1WOSA 3PW2A 3HFZB 1CJKB 5CH7B 1YITS 5I4MA 5G0RB 5IOLA 1RT6B 3V81A 5AXMA 2KFYA 2HWIA 2W8KA 3MEDA 2NREA 3IC1A 3GG1A 4AL7A 3GPAA 3RR8A 3V6DA 2W7OA 3DOKB 1PG5B 4OI3A 1XTZA 1KS2A 2H51B 2EBGA 5F8HA 4OYAA 4P75A 2ZVIA 2ZHAA 1PAEX 1R31A 1SC3B 4DV1F 3FFIA 3PJ9A 2CJKA 2W4DA 4RW6B 4NLWA 2F8EX 1IM4A 1RT3B 4EGLA 1UVKA 4RU9A 3R1HA 3J80U 1NJXA 1S6PA 4LF9F 4K7QA 4O0IA 1ZOTA 1RTDB 1FVQA 2XCPA 4JI3F 3DCAA 2MKHA 2GHPA 3NMAA 3MFHA 2VJVA 3KNGA 2NS1B 4URQU 3IWXA 1SKRA 2MHNA 4ZPDA 2DGWA 3DFEA 1H38A 4GC6A 1RLDA 5HI7A 2VG7A 2VH7A 4X66J 5IS2A 2MZJA 4AFFA 3ET6A 1YQHA 3VQSA 5HROB 1AYEA 2FLLA 2Y0SD 1D0EA 5DZ7A 3CC4S 1K8AT 2QA4G 4Y2MA 4CQ1A 4HHUA 5EHHA 2AJ0A 5J2MA 2NYHA 2ZBQA 1YJUA 4PWUA 2XGQA 4NXNF 4IR1A 2OJ3A 2R8GA 1ZPVA 4CH7A 3IS9A 5KFJA 4RLEA 1MU2B 4KO0B 1X7VA 3UDCA 5KG6A 1HNXJ 4WFYA 2MQMA 2ZJQQ 3QBCA 2UVUA 2Z4PA 3DRYA 3AD8C 2KHCA 2CDRB 2IBOA 3P49B 4WFXA 4WTOB 2Y8WA 3FRYA 3NWGA 4ZVFA 3D28A 1RAGB 1S1WA 4DL4A 2Z2ZA 5JVHQ 1U45A 4F7VA 4C8KA 2FUG9 4X64J 2ZE2B 3FQLA 1SKUB 1PJ5A 4D3HA 4ZIVA 3HZEA 4C6AA 1FEHA 3CCRS 2HFZA 5A6WA 5HQLA 4K4VA 3FRZA 3O3LA 1TKDA 1QTNB 5KT4A 4ED0A 2YH0A 2CNNB 2B4PA 3NGUA 1H7XA 2K3IA 3K5PA 5HVGA 3C19A 3DOLA 1RTZA 1VI7A 2JEIA 4OFZA 4R5PB 3M1VB 2W25A 4LIRA 6FDRA 1HL6A 3MM5B 1F9HA 1QSLA 5HQMA 2RH3A 2M8DB 3CD0A 2G1HA 4YDDB 3HD2A 2MZRA 2DO4A 3FNNA 4ZN3A 3OJSA 3L09A 1JLBB 2M70A 3NNCA 3KNAA 3JQMA 1RLCL 2C42A 2M88A 1U25A 3CMQA 5ETNA 4D3GA 1U8WA 2GV1A 4ZMMA 4CRJA 2AX1A 2OD6A 2GA7A 5E0OA 3H20A 1NK7A 1I51B 1QVFR 5A2QY 4CO3A 3PRBA 1E6VB 3NS6A 3SCLE 4DV6J 3A1YG 3JTOA 4ICLB 3V6JA 2B3TB 3SBMA 5HSPA 4F4XA 1SIWB 2HNYA 2CWKA 4HTIA 3OTOF 3LUYA 3RB3A 1RWVB 2HBYB 3S1TA 4NE9C 2OGUA 1YK9A 5KTQA 3D2WA 2VPZB 2B6AB 4I67A 3N01A 4PXBA 4YB1P 1NHVA 2OHDA 4PG5A 3PR5B 4DN9A 2E1AA 1IKXB 3GFXA 5GADU 1WI8A 1UVMA 1S10A 2QSWA 3LGNA 1HKAA 4P2FA 4BHQA 2L9WA 1T05A 4C0BA 1TAQA 1R27B 2J7WA 2MKYA 4OX8A 4M5DA 5DG9A 1RK8A 2DHGA 2V8PA 2VG5A 3PYDA 1LW0A 2R7OA
chains in the Genus database with same CATH topology
2ZNZA 3HT3A 1KOHA 2DNMA 3EXYA 4ECWA 2VFSA 4KPYA 2RRAA 1KRPA 1R8AA 4EWTA 1N54B 3ZFVA 3DLJA 1U8SA 5KOWA 4YOEA 1X4CA 3DRRA 3I55S 3TX8A 2VBZA 3GIKA 2FJVA 1JNZB 3DRSB 3DGPA 4O23A 3WDOA 3KHLA 3MEGB 2ZFHA 3CPWR 2I5JB 2VA2A 2BRKA 1CVJA 2BM0A 3FZBA 3OFEA 3S7RA 3OL8A 2LDIA 3NBPA 2IRUA 4G1QB 2LCWA 1DLOB 3BEGB 3PKMA 1KFDA 4N41A 4Q8FA 2E1MC 1D9DA 4JI8F 3M9MB 2M9KA 3RB6A 3CCVS 2KXHA 2DIVA 2J0SD 4F4YA 1FE0A 1LWCA 1S9EA 1R0AB 2OSQA 2BE2B 4I2PB 1VQNS 2R7WA 4YUDA 3QIPB 1G1XA 1TL3A 3M6WA 3W2VA 5DLFA 1YJVA 2DH7A 3MTJA 4DEZA 2KJVA 3M05A 5KFDA 3HVWA 4ILLA 3WC2A 4B3SF 4ETZA 3CJ2A 2BDPA 1YWXA 3KLFA 3CCWA 2B5JA 2HHUA 5LSLA 1RDRA 1HNIB 3JSMA 2OH2A 4NZ7A 1TZ0A 3SV3A 2G1DA 4R25A 3MAHA 5CD4H 3JTPA 2HWTA 1SL1A 4LF4F 3L3CA 4ELUA 1TKTB 2IM0A 3TVZA 3F73A 3MHYA 3P96A 3JB9k 3LALA 2IVYA 2N4CA 2E7WA 3EZUA 1MNEA 4J9SA 2E1RA 2RNEA 4QR1A 1FKAF 2R2TA 4LFBF 2IM1A 2J6TA 2G9OA 1C1CA 4FS1A 1MSWD 1LQ9A 3I0RB 3OW2R 3I9V9 3N6LA 3MXHP 3MEEB 1JLEA 1U49A 3OXLA 2WONB 5K8NA 2C3MA 3K5MA 1AXQA 4TU9A 3BREA 2O67A 1VQPS 4NOHA 5T7LB 1N8RT 1ZAXA 1LXNA 4A8XA 5C5JA 2ROGA 2AYEA 2YNGA 4U9RA 4NA3A 2DNPA 4A8OA 3KWMA 2N7YA 2O1PA 2GJ2A 2J7KA 2NYIA 1ZTTA 1B0TA 3QAUA 3BR9A 3V6HA 4RUCA 1FTRA 3U1LA 4ES2A 5A0YB 1J5OB 1RGVA 3T19A 3U27A 3MR2A 4IO1A 2ASLA 4C7QA 4YP3A 3C2PA 4ES3A 1WEYA 4IRDA 5ADZA 2XC9A 1H2VZ 4JI6F 5EX0A 4C8MA 3BB5A 4ZLPA 5HMWA 5L1LA 4IG3A 1KVIA 4ZCMA 4GO5X 2YTCA 3DXSX 3BR8A 2WOMA 3QLHB 4QIFA 2J9EA 4J37A 4ZPBA 5C25B 1IKWA 3DI6B 4U7UK 2ZZMA 4HL9A 5THWA 3TUIC 2IC3A 2FJXA 4PQUB 1W25A 4A8SA 2Y1IA 1FRJA 2KU7A 2LLZA 2DNZA 2OPRB 3P5TL 1VGYA 1Y5LB 4V19J 1V9OA 3MECB 1HWKA 1F5CA 3PEHA 2LU2A 3SCKE 1UFWA 1Q81T 1C4CA 1TKXA 3ISNC 3F41A 2PO4A 3BDEA 4DQQA 3DU6A 4ECZA 3Q22A 2YKNA 3MM8B 3T1HF 1DTTA 2XCAA 4KV8B 4EZ9A 5LXYA 3PR4A 3GYNA 3LGMA 3Q23A 4E8UA 1FEEA 2PIIA 5M2UA 3G6ES 3SSSA 1IQZA 2GHVC 2RJZA 3H98A 4OV1A 2ZDPA 2YKAA