1DZ5A

The nmr structure of the 38kda u1a protein-pie rna complex reveals the basis of cooperativity in regulation of polyadenylation by human u1a protein
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
101
structure length
101
Chain Sequence
AVPETRPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKMKGTFV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribonucleoprotein/rna
molecule keywords U1 SMALL NUCLEAR RIBONUCLEOPROTEIN A
publication title The NMR Structure of the 38kDa U1A Protein-Pie RNA Complex Reveals the Basis of Cooperativity in Regulation of Polyadenylation by Human U1A Protein
pubmed doi rcsb
source organism Homo sapiens
total genus 13
structure length 101
sequence length 101
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1dz5A00
2D3OR 1IQTA 2MKSA 4OZ0A 1S72S 3PIOQ 2MZTA 2MB0B 2RT3A 2FC9A 4WIIA 1U1RA 3VAHA 1WHWA 2LMIA 1WG5A 3P5TL 1OWXA 2KVIA 3ZZZA 1WWHA 1X5SA 3VAJA 4ED5A 1PGZA 5GAHU 2KN4A 2FHOB 1Q7YT 3TP2A 4LMZA 1WHVA 2YTCA 1U1QA 2MZJA 2DGSA 2PEHA 2MZ1A 2XSFA 2HGMA 2LEAA 3S8SA 2EVZA 1YIJS 2KM8B 2N3LA 1YTYA 4M5DB 2DB1A 4YB1P 3CULA 3S01A 3LPYA 1X4DA 2AYGA 1WF1A 2MQOA 2MZRA 5CYJA 3CD6S 2L9WA 3I55S 2DO4A 2HGNA 1Q82T 3CC4S 1U2FA 1U1MA 1VQKS 2CQGA 3PIPQ 1H2VZ 2CQHA 4LJMA 4OZ1A 1SJ3P 1N54B 3G6ES 3CCUS 2LQ5A 1M5PC 5DDOC 2MKKA 1UW4A 1VQLS 2MZQA 1SJRA 1HA1A 2BZ2A 2DNRA 5IFMA 4IUFA 1JJ2R 2MGZB 1DBDA 3RW6A 2XB2D 2MZSA 3VF0B 3EX7B 2RU3A 2RS8A 3EGZA 2DGUA 2LXUA 1SJQA 3THTA 2DNMA 4UY8T 2KXFA 3HI9A 2X1AA 4QPTA 4UQTA 1M5OC 3SDEB 1B7FA 5GAEU 4CQ1A 2QA4S 3BO4A 1UFWA 4ZKAA 1FXLA 1X4CA 3U1LA 3H2UB 1VQNS 2DNQA 1JMTA 1O0PA 4Z2XA 1X4BA 2DHXA 3J7YU 2DNKA 2N7CA 1X5TA 4IOAQ 4A8XA 3UCUP 1W2BR 1FJCA 2DK2A 3S7RA 1FNXH 2MXYA 2KYXA 3UCZP 2ZJPQ 1NU4A 3MXHP 3G8SA 3UE2A 2HYIB 5LSLA 2F9DA 2KXHA 3OW2R 2LEBA 3D2WA 1M5KC 1A7GE 1YI2S 2E5HA 3BO3A 1VQ7S 2DNNA 1WELA 1X0FA 4BS2A 4PKDB 2HZCA 1FHTA 2CQ4A 1U6BA 4CH0S 3NS5A 2CPIA 5FJ4A 2MY7A 3G96A 1N52B 3CCES 1R8PA 1X4HA 4LIRA 2N3OA 3CPWR 2MQLA 1Q81T 5DM7Q 2RRAA 1VQ6S 1VC0A 3NS6A 2DIUA 2EK1A 1WHYA 4YOEA 2F9JA 3UCGA 3IRWP 1DRZA 2M2BA 5GMKa 2OTLS 2DH8A 1A9NB 5LXYA 3VAGA 3SXLA 3FEYB 2WBRA 3ULHA 3IWNC 3MOJB 1NJIT 4QU6A 2GHPA 3JB9k 3CCLS 2HVZA 3HHNB 3MURP 4WFAQ 2KFYA 1HD1A 2M7SA 1ZH5A 4WKRA 4WF9Q 3G8TA 2F3JA 2MQQA 2DGXA 3N9UC 1YJ9S 2DH7A 5DM6Q 2L08A 2LA6A 2FY1A 1ZZFA 1FJEB 3UD3P 2M4MA 2OSRA 3DXBA 4U67Q 5IM0A 1K9MT 4IO9Q 3TO8A 2KG0A 1WTBA 2PE8A 1RK8A 1U1LA 2KH9A 2SXLA 1QVGR 2FPHX 2DNPA 3CXCR 2FC8A 1X4AA 4CH1A 5CA5A 2OJ3A 3U1MA 1KQSR 2U1AA 5DETA 2CQDA 1U1OA 2CPFA 2J76E 1FJ7A 3CCMS 3S6EA 4P6QA 1M90T 1WEXA 2MQNA 3CCRS 1YHQS 1WF0A 1SJ4P 3UD4P 1SJFA 3CF5Q 4PRFA 3MUTP 1U1PA 2MKCA 2O3DA 4FXVA 3CC2S 2MSSA 2OTJS 3B4DA 1VQOS 2YH0A 3G4SS 3V4MA 3P3DA 3G71S 1H2UX 3DLLQ 2HGLA 2QFJA 3MD3A 2G0CA 1CVJA 1UAWA 4PR6A 5LJ3Y 2MJNA 2Q79A 5ITHA 2XNRA 2XS2A 2D9PA 1VC6A 2DNHA 5IQQA 2MKIA 1N8RT 2XS5A 2MHNA 1RKJA 2DGQA 3K0JA 3P49B 1QVFR 2CJKA 1VQ9S 4TU8A 1VBYA 2MKHA 2M88A 1YITS 2DNGA 2M52A 2M8HA 1YWXA 4YUDA 2X1BA 1QM9A 5GAGU 3H2VE 2DNYA 5LXRA 2J8AA 1YJWS 2RRBA 2LXIA 5LSOA 4FXWA 1H2TZ 3NNCA 3I56S 4IOCQ 2MYFA 5MLCV 3G9CA 1JJHA 5DDPC 4C4WA 2MY8A 4W92B 2CPEA 1XN9A 2CQ2A 3RW7A 1VQPS 3NMRA 5IM0B 1VQ4S 3MUMP 1H6KX 2DITA 2AYBA 5BJRA 2CQ1A 2JRSA 4C0OC 5CXTA 2DO0A 1VQ5S 3TYTA 2BOPA 5LJ5Y 3FEXB 1WI6A 2YWKA 3R27A 3CCVS 1OO0B 2OIHA 5DDRC 2JX2A 5GVQA 2LA4A 2LKZA 3CCJS 1P1TA 5D77A 1D8ZA 2QEXS 2DISA 2AYEA 4QU7A 1K73T 1KC8T 2CPXA 3P6YC 2I38A 2K8GA 1WG1A 2N82B 4RU2A 1F9FA 2YH1A 3Q2SC 5HO4A 2AYMA 2LYVA 2RS2A 2JVOA 1YJNS 2DNOA 3J7ZT 2GO9A 2CQBA 2KI2A 2CQPA 4TU7A 1DHMA 2VONA 1FO1A 2E5IA 2VODA 1X4FA 1X4GA 1WEYA 2DGOA 4Y00A 2K3KA 1M1KT 2J0SD 2CPJA 1KOHA 2JVRA 2DGTA 2CPHA 2OSQA 1PO6A 1VQMS 1X4EA 3LQVA 2UP1A 5HL7Q 3VALA 2DIVA 4TLQA 1FT8A 3L3CA 3CMAS 2RNEA 5DDQC 4WFNQ 2RUGA 2ZJQQ 3CC7S 3VAMA 1NO8A 2M9KA 2G4BA 4CIOA 2KXNB 2RVJA 1R8HA 4ERDA 2CQIA 1U6FA 2MQPA 1N88A 1KD1T 1VQ8S 2KHCA 2I2YA 3BO2A 2B0GA 1WEZA 2G1DA 1HD0A 2YKAA 2L41A 1HL6A 2MMYA 2CQ3A 1VBZA 2DGWA 2JWNA 1SXLA 2MKJA 2J0QD 2ZJRQ 2DH9A 2MJUA 5H1SV 1WF2A 4WCEQ 5D78A 2X1GA 3R1LA 1JJ4A 2KG1A 2CPDA 2E5GA 2LCWA 4F26A 2KRRA 4V19X 1WG4A 1L3KA 1Q86T 4W90B 3EGNA 2D9OA 2U2FA 1VC5A 3NNAA 1WHXA 2CQ0A 3CCSS 3B4MA 2CQCA 2M0GB 2MPUA 1AUDA 1KOOA 2XNQA 2KM8C 2VOPA 1P27B 2X1FA 3Q2TC 2DNZA 2DHAA 2E44A 2KT5A 4Y0FA 1K8AT 2KRBA 4F25A 3SMZA 2V94A 3BS9A 2RQ4A 4EGLA 3CUNA 4QQBA 2A3JA 1WI8A 3CMES 5GADU 2VOOA 3US5A 2ADCA 3MI7X 2KU7A 3MUVP 3R1HA 3UWTA 4TU9A 1X5OA 2CPYA 4C7QA 2MGZA 2NZ4A 5JVHQ 2DHSA 3VAIA 3CTRA 1U1KA 1X5PA 2AD9A 1U1NA 2E5JA 5EN1A 3VAFA 4J5OA 3BEGB 2DGVA 3MD1A 2RQCA 2MSTA 3CCQS 1UP1A 2NLWA 3VAKA 2DNLA 1VBXA 3ZZYA 2M70A 2MQMA 3SDEA 2M8DB 1OIAA 4F02A 3NNHA 2ERRA 3MDFA 1S79A 1M5VC 2DHGA 2EK6A 1BY9A 2XS7A 1D9AA 1ZZNA 2CPZA 3THPA 2ADBA 4WFBQ 2LECA 1OPIA 5JVGQ 1G2EA 1URNA 1DZ5A
chains in the Genus database with same CATH superfamily
3JSMB 3DOLA 3E3XA 4FS1A 1KTQA 1TZ0A 2WBMA 1IN0A 4RWWA 1JLFB 1DY3A 2WONB 1CC7A 2MQ8A 4DV2J 4RNHA 4NRUA 2VICA 5K9FA 3MAAB 3L7UA 1WF1A 5LMUJ 1UVIA 2E7VA 1BGXT 4S0MA 4URGA 5E41A 1SKRA 2PA3A 2F8MA 2R7OA 4OZ1A 5J1PA 4PCQA 1MN7A 2UU9F 4LFBF 2GVDB 2X3GA 4I7FB 1RT5B 4IOBA 3QRQA 4Y65A 4WBFA 5HSPA 2BANB 3PYDA 1FERA 2RU3A 2KZZA 2UUAF 3D4JA 4UY8T 4ZJLA 4OZ2A 2OI2A 4PPDA 1B7FA 4K2JA 4FPRA 1UFWA 4ZKAA 1S0NA 3KKFA 2Y1JA 2C3MA 2CVIA 2GVZA 3H5SA 2WAQD 3M2UA 1APSA 2DEJA 2KJVA 3FBBA 3W8PA 3WX4A 3NOCA 1BD6A 2B9EA 1CS4A 2LVWA 3EZOA 4X4RA 5KFEA 3MPWA 1OJ4A 1FHTA 3NS5A 5FJ4A 4O4GB 2OO4A 3BB5A 3R5AA 2HVDA 4DPWA 2XSJA 4DPTA 3PY8A 2OTLS 5CD4H 5J2NB 1HR0J 5AE2A 5EWEA 1N6QB 3WIVA 3UD5A 1T3NA 2M7SA 4B9NA 4KFBB 5I3PA 3FVYA 2XY6A 1RACB 1S9FA 3NAIA 1KLMA 4ED8A 2HFNA 4LRAA 3GONA 1RK8A 2DVIA 4P2XA 1QVGR 2XMVA 5D4NA 2NYHA 4IO1A 2RRNA 4OI0A 3DU6A 4NCAA 1M0SA 3A3NB 2V63A 3PKYA 1PILA 1C0UB 1C1BB 2CPFA 4DR3F 1TR0A 2Z4PA 3EM1A 3KMQA 2LDIA 3QFHA 3DLEA 3JTPA 4UOHA 4CLKA 1SJFA 2GNKA 5SUHA 2HURA 4KGMA 2IVFB 2GQCA 2XCAA 2VBYA 3VGSA 2ZFHA 3MGJA 5I42B 1VQOS 3MR7A 5KFIA 4NASA 2Y8WA 5J2QA 3EZUA 4KO0B 1F5BA 3M8SA 1ZOTA 2QFJA 3PW7A 2Q79A 3ICLA 4DN0A 5IQQA 2XS5A 4AL5A 1S1XB 4ZJOA 1UVNA 3IM9A 5GAGU 1AB8A 5LSOA 3I9V9 1HNIB 2HQDA 4PXCA 4H54A 2FJBB 3WC0A 1ZM4A 4KGXB 3UN3A 1TP7A 2JRSA 1OSCA 2WVCA 3HSJA 3SSQA 1REVA 2QMWA 2LKZA 1HBMB 3CCJS 4GO7X 5D4OA 5K8NA 4B08A 3A8IA 2K8GA 1WG1A 2G0JA 4RU2A 3H59A 4ECXA 2FJVA 4CNYA 2ZBPA 2DNOA 3J7ZT 3J80Y 5CZVA 2ZKUA 2OEMA 1T8EA 2R2TA 4ZVEA 3W9IA 2K3KA 1KOHA 3N01A 4J37A 1B0VA 4BC9A 3ISNC 4EYHB 2HBQB 3KK2B 4MYTA 1HI1A 3G86A 4E8UA 3KG4A 3VAMA 3OXLA 1KD1T 4LF7F 1UVMA 4L74A 3TA1A 1YG0A 1RT6A 2R9LA 1ZM3A 3NBPB 3PRBA 1QDUB 1IM6A 1TU0B 2DH9A 2V50A 1RLDA 3GJSB 4WZMA 2E5LJ 3MMAB 3I0SB 1NAQA 4DR5F 4F25A 4LT6A 4PPZA 3CUNA 3M32A 3FMWA 1DJ0A 2BKNA 4NEZA 5EN1A 4WTYA 2NCKL 2ZNZA 3KDNA 3J81Y 3IFEA 5ETLA 4USVA 3UDEA 2B3TB 2YWEA 3UPFA 2CPZA 4PYDA 2BYCA 1QE1B 2HNZA 3ENVA 4JUZA 4U7UK 1TELA 1F9EB 2FJDB 4P7TA 3SBMA 7FD1A 1PYSB 2RT3A 5M2UA 4PXDA 2OKQA 3C6UB 1H38A 3W2VB 3RU0A 4YR3A 1TMMA 3G82B 4JYAJ 1SUQA 4C8OA 2W4CA 4ED0A 1X4DA 5DQHA 2V34A 4ENOA 3CC4S 3I55S 2IHR1 4TNOA 1S59A 3RB4A 4LJMA 3U1NA 1LWFA 1M5PC 1S7HA 1S76D 1SJRA 2BZ2A 4AQYF 4ZPAA 1FRHA 4JI5J 1RQ0A 4NXMJ 4CO1A 2LXUA 3Q8YA 1CJVA 5HI7A 2AIRB 1XMQF 2AEMA 4OX7A 4HHUA 2RDJA 4LR9A 3PRVA 1Y5IB 2OD6A 2ATLA 4RW9A 5IOLA 4JI2F 2GJIA 2UXDF 4X66F 2QL5B 3OTOF 4V19J 3B82A 2PN6A 3ZFVA 4WYWA 1R6VA 2ZJPQ 4M1KA 1RSCA 1GTEA 3GIIA 4XK8C 2YNHA 4JI0F 1Q8KA 2PO4A 3OR1B 2F4FA 1X0FA 5IC6B 1G7CB 4OX8A 3NWRA 3L4BC 3CCES 3MCSA 2XI2A 2IM1A 3CDWA 2DIUA 2IDEA 1HW9A 3D6HB 3D9BA 3A8EA 3LP2B 4NLDA 3CCLS 4WFAQ 4MKYA 1HYSA 4RJVA 1B7YB 3M8QA 2H9ZA 2XQCA 1DURA 2LA6A 2F7VA 4WXWA 2ACYA 4F3MA 3P96A 3ZZPA 4F4WA 2XEXA 3HJVA 1RAAB 3P8BB 1RI7A 1FDNA 1HNZF 1GX5A 4I2PA 2SXLA 1W7WA 1N0UA 4USWA 3J7AN 1AROP 1X9SA 4N5SA 3U1MA 2XYHB 2VASA 3MMCB 3H20A 1SJ4P 3TANA 4F4ZA 1G3OA 2B7BB 3GR1A 1LEOA 3GV5B 2BE9B 4LF1A 2BM1A 5K8MA 3M8ZA 2HBYB 3GMGA 4CLPA 2QV6A 3MM5A 2W7PA 3G71S 3CB4A 3KJVA 1KQKA 3OT9A 4PR6A 1N33F 1U8WA 3MM9B 3I32A 2QSFA 4NA2A 3BM7A 3OL7A 3T1YF 1N8RT 4QIGA 3BPDA 2V2ZA 2EC0A 2J9EA 1S77D 4MT1A 1L3TA 2QTWA 4P7VA 3D3BJ 2AT1B 2R8KA 2BJ3A 1N5VA 4P72A 2DO0A 5C2CA 2EWHA 2XI3A 1XNQJ 1IR2A 4NLSA 2HHQA 3QGHA 2OPRA 3W2WB 4USHA 3K17A 1Y9OA 3KUGA 1WKLA 4GC7A 1C0TB 2YH1A 3A4TA 2HMIB 5KFJA 4HLBA 1UEUA 4FYWB 2GO9A 1T95A 4Q43A 2OGUA 3QJJA 3GG1A 3W60A 1X7VA 3R2DJ 4KGVB 2UU9J 5HQMA 2V4JB 2HBZB 4NCGA 1XNRJ 2B7CB 4ZVTB 1S1TA 1N88A 3C16A 3A8KA 2EFQA 1Q78A 2V6AA 2BW2A 4ES1A 1Z4UA 3GCWP 2G1DA 2VDIA 2ASDA 4D3HA 4ETXA 1MU2B 1TKDA 4PZVA 4Y3CA 4DEZA 3EGVA 1HWIA 3ISND 3RTVA 3IG1B 7AT1B 3C46A 4ZA1A 1Q8LA 2B6AA 1YGYA 2BBEA 2OAUA 3WC2A 2BOAA 3TEHB 3PXGa 3DRPA 1Q5VA 2M0GB 2E7WA 3BPSP 1S9EB 3ZZUA 3N6LA 2FGOA 1MWQA 5J2MA 4EGLA 2XLKA 1FKOA 1FXRA 3UWTA 1X5OA 2DHSA 1JLCB 4J5OA 5H9EK 3PDNA 1BE4A 4OYAA 2DGVA 2VHGA 1JQGA 1KRPA 2GFFA 3HK2A 1YX2A 1S79A 5J2PA 2D3UA 1VOMA 2MLZA 3T19A 4H4KA 3B54A 3ET6B 3HT3A 1WG5A 3EPIA 1UWBA 4PAAA 1F2GA 4LRDA 2UUBF 2VPXB 2V4QA 1AUSL 3DMJA 2H5EA 4AT1B 4DR3J 5CYQB 2VU5A 2HVHA 2UVWA 3MM7B 4M5JA 1N54B 4C8YA 2XGPA 2OEKA 1HFEL 2LQ5A 2UVVA 3MAHA 1T02A 4A46A 4OJ1A 3LO3A 3JSBA 5IQ6A 2DEIA 4FXDA 2X1AA 1NK0A 4I6YA 1KFDA 2GAHC 3CJKB 3HHKA 4LFCJ 2EEYA 5E2QA 5HATA 1RCXB 3T5HA 1JMTA 2QLFB 2BM0A 4EZ6A 1RWNB 3W65A 1NPKA 5SZTA 4K4YA 2JDJA 1X9MA 1WOPA 1UEKA 3HHLC 2HYIB 4ED7A 2VFRA 2LEBA 4JI7J 1YI2S 3D1HA 1IKXB 5KT7A 1CJKB 4LF5F 3EVMA 1WORA 3ADAC 4X4VA 3DLJA 4R5PB 1DRZA 4PG8A 1N0VC 2C2NA 2YNFB 2YKNB 3MCOA 3DYAA 3FCWA 1XMOF 1FD8A 1IKXA 3G8TA 2MQQA 4QWCA 2DGXA 2RF2B 4WZQA 1SKUB 3K57A 5KT3A 2V2KA 4ELUA 1TV6A 3OLAA 2AJ1A 3AD7C 4K4ZA 1S6PA 1VGYA 3CCMS 3BQ1A 4P6QA 1M90T 4I4BA 4Q8FA 1U0HB 2R3VA 1YHQS 4NPOA 4ILRA 2BXJA 2ASLA 4OJHA 3OLBA 2QL7B 2V4RA 2VQEF 3B4DA 3DN9A 3BN4A 3VWSA 3AY0A 2G0CA 4P75A 2XLIA 1PBAA 4EI2A 2MHNA 2HNDB 3MM8B 4FZVA 2YWFA 9ATCB 4TU8A 4M5KA 4WU2A 3TAMB 2X1BA 1D09B 4LSLA 1HARA 2LXIA 3GPAA 3PCOB 1F1BB 1CJUB 3WX8A 3HVWA 4OMFG 1NH7A 2AMCB 5DS7A 2IM0A 2BE2B 1IJFB 5BJRA 2POKA 3SQGA 5HN0A 2BOPA 4WPAA 2HNDA 3R27A 3KK3B 4WFXA 2IM2A 2LA4A 4RWXA 3KLGB 4B9MA 2V2QA 3PHTA 2ZWPA 1KC8T 4ANEA 3D6FB 1S97A 4LR7A 1FFSB 3ENWA 4TKTA 1K47A 3M4XA 1K1SA 5E3RA 4P52A 4U9RA 4Y00A 2DGOA 3FBCA 2JVRA 1YZ6A 2VFUA 3TARA 4H4OA 2FLOA 3CD5A 2QMXA 1KLNA 1CJTB 1U8SA 1T94A 1SL2A 1JLGB 3SI8A 1NB2A 2QT7A 5DRKA 1N5YA 3V5RA 3G6YA 3RG6A 3FZBA 3R3TA 4RNMA 1N34J 4PXBA 2CQIA 2HLUA 3HSGA 2E66A 1XMQJ 4ZHRB 3Q22A 2C3UA 4I67A 2MKJA 2X51A 2GA7A 4WCEQ 3PV8A 3IBCB 3C14B 3M2RB 3GWCA 4OYIA 4F26A 2G1HA 5F9NA 1WG4A 3D0GE 4KV8B 5IV3A 3QWPA 2RAQA 1CBKA 3MPUB 4ID5A 3HVRA 3DXSX 4ZPVR 3QGPA 3DRXA 4J7CA 4JI0J 4OZ5A 2UUCJ 2PEBA 4M5IA 2KT5A 4AL7A 3MEEA 2CNNB 1GTHA 4DN9A 2A3JA 1RT3A 2C42A 5B08A 3FFIB 1SB6A 3DHXA 4MKBA 3BDPA 4Q2MA 4OLOA 4B3SF 2NLWA 1GFWB 4F02A 5EX0A 3MDFA 3AB2B 3ZTOA 3KLFA 1MG7A 1RT7B 1IBCB 4ZVUB 2GCFA 4TN2A 3DDIA 1VYAA 2QRRA 3GIRA 2NSBA 4DR4F 1FEEA 1OQ6A 2NYIA 3SCIE 1PG5B 4XO0A 1HNZJ 4X64F 1Y4ZB 1RTHB 2DXEA 1YIJS 4F4KA 4XAKA 4DPYA 1H73A 3K5LA 2VKZG 1W25A 2MZRA 2R8JA 4F7VA 2R8GA 4IDKA 1PCAA 1EB0A 4C11A 2CQGA 2V69A 1FWKA 1NK7A 5K8OA 3UDCA 1VQLS 4H4MA 1T9VA 3VR1A 4CYUB 3AD8C 1RT1A 1IQZA 3EYZA 1Y00A 2JHEA 4NLPA 1CLFA 4KT0C 3THTA 2VQFF 1BQMA 3M8PA 2JC1A 4QPTA 1JLBA 4RW8A 4UOCA 2AJ4A 3TUZC 2E7XA 3SDEB 5GAEU 4ZLNA 4K4SA 2AP6A 1RWOB 3QAEA 3H2UB 3NGKA 2DHXA 3DI6A 4RR5A 1JLQB 3M8RA 3CJ0A 4JI8F 2J8SA 3QLHB 4ZLPA 3AA9A 4O44A 5DG8A 1UCNA 1WELA 3GIJA 3BGUA 3TAPA 1A6LA 2B9YA 3LGHA 1N52B 2IVYA 2AJ0A 1Q1KA 2Z8QA 5A8WA 1WC6A 1WKJA 1WHYA 3F0NA 3VAGA 3JB9k 3AOBA 2IIHA 2QLBB 4AD6A 2FIUA 3I4HX 1J5EJ 2VUGA 5JJBA 3EICA 4ZCIA 2ZOMA 4ZN3A 4DUYF 2KYZA 1MMDA 3TO8A 1UA1A 1U1LA 3KLIA 2GQ2A 4DR1F 4TY8B 1SV5A 1PYOB 2BJ8A 3MR2A 1VJWA 5KFHA 1HMVA 2ZDPA 1P9QC 4EK2A 3M8WA 1WEXA 3HVAA 4N8OA 4B02A 3KYLA 4QIFA 3OFHA 4K4VA 4OHVA 3MUTP 4ALZA 2MEWA 4OYBA 2WK4A 3ILJA 2VPZB 4NXNF 3TJ9A 1NHUA 4NLYA 2CADA 2FD2A 1NK5A 3GLJA 2D69A 1NDKA 3MD3A 4LF9F 2QGFB 2G0IA 1NRKA 5HAOA 4DUTA 3W5YA 1VQ9S 2R2SA 5KFRA 2XMMA 1NSPA 1E6YB 3D7SB 1LW2A 2VG6A 1SC1B 1IWAA 4EU0A 4L73A 3RW7A 3N5FA 4OYWA 3ZZOA 2PI5A 5DG9A 3M9NB 2PSZA 1FI4A 4AXIA 1FWPA 2W9BA 1HBUB 2X7IA 4EZ9A 1NSAA 4K8RA 2ZH7A 2UUBJ 1HQUB 3CJ2A 4X65F 4NLVA 4ZPCA 1RWUA 4KHRA 3QJPA 2W7OA 4OHWA 3VGUA 1BQXA 1X4EA 3JTNA 3PRDA 5DJBA 5MAOA 2DY9A 1HQEA 2KVQE 4ED1A 1T11A 2BRLA 5HJXA 4WKYA 2VG5B 4F8RA 4K4XA 3N79A 4FNIA 2OPPB 2G2YA 5C7PA 3IWLA 1U6FA 3AJ2A 3HCXA 3H5YA 2FJEB 3BO2A 1CULB 4DX7A 2I6WA 4L3NA 1J5OB 4ZPTR 3VZHA 2YNIB 5KFXA 3TZWA 1E6VA 3CWJA 3QMQA 2HWIA 3R1LA 2ZC4A 2E5GA 2VL1A 4V19X 3I96A 2DYAA 3NNAA 4CLTA 1WHXA 3CCSS 2G2OA 4RX6A 2BKPA 4YB6A 4HACB 1P9YA 2BJ1A 1UW9A 2ZD1A 2IJFA 1UA0A 4LF5J 4CCHA 1DTTA 2K7KA 3NEKA 1RTJB 2VV5A 1D8YA 3VAIA 3E8OA 1HNWF 3ILIA 4FF1A 2MSTA 4KHPF 1S48A 1UP1A 4L75A 4PWDA 1OIAA 2XYPB 2DHGA 1D9AA 1IKWA 1TQLA 1XMOJ 4U8VA 2DRBA 5CD4A 3HVTA 5ETRA 3KHLA 4EEYA 2MKSA 4OZ0A 2GIRA 1JLEB 1NXIA 2ALZA 1RTJA 2HLTA 3MCMA 3P5TL 1OWXA 4DV3F 1VRQC 5CCMA 1EQMA 4NZ6A 3TP2A 4YHHF 2PEHA 1RDRA 5C24A 1TL3B 2XSFA 1ZM2A 3S01A 1YKWA 2B5JA 3TUPA 2YKMA 2LEPA 1RBOB 2XLJA 2F8HA 4X4NA 1VQKS 1WD6A 3GFXA 3JTOA 3FEZA 4DLGA 3G6ES 3I9ZA 4CT9A 2BJEA 5L39A 1JJ2R 2VA3A 5M2PA 4G65A 3UI3A 4ZVHA 4FYDA 1LWEA 2I5JB 2IA6A 3SFUA 4IKAA 3QO9A 2F8EX 2OEJA 2JOQA 4JI1F 1X4BA 4LF8J 2DNKA 2ILZA 4UUWA 1JXLA 1MMNA 1PIEA 1F3VA 2IRUA 2YQ3A 1FCAA 1S4EA 3M6XA 1NPRA 3AQOA 1RYRA 4DG1B 4EFAC 4M95A 3DGVA 1JKHB 2HZCA 2P5VA 3GU0A 4CH0S 4CLFA 2EKNA 4C9DA 5E3QA 4FNHA 1VC0A 1KS2A 1Y11A 5KFVA 4RBTA 3N4WA 3KK1A 2W24A 4A8OA 1I94F 3HXMA 4OJ3A 3O2IA 2AEJA 2VPYB 2QC3A 2UXBJ 1PC5A 4KC5A 4EWTA 1R0AB 3GZ7A 2QA4G 5DG7A 1KQGB 5CHCB 1WTBA 4U7UD 4IR1A 4E98A 1PBUA 2DNPA 2IDLA 1BQNB 3E01A 5FDLA 5CA5A 4JOUA 4PEOA 2IMOA 5A76A 3QSYB 3HFZB 3OBIA 1T3OA 3FQLA 4Y34A 3S6EA 3CDUA 1S1VB 2HNYA 3CCRS 3KDOA 4TYBA 2BQRA 1BHNA 4DLEA 5KG4A 2XHCA 3CF5Q 4KKOB 1I5OB 1YJ7A 4RUAA 1EP4B 4LRCA 1B0TA 3OR2A 4Q0BA 3V2UC 2FLPA 1WSVA 5I3UB 2WTFA 2XC9A 5F8LA 2W8LA 3L95X 1VC6A 3J81j 1FTRA 1VCTA 3AAWB 4LSNA 4OI3A 3NLCA 3AD9C 5HVGA 4LVOP 4C98A 3QPIA 1S1WA 2M88A 3SV4A 1TVRA 1YWXA 3EDRB 2J8AA 2HFOA 2QLJB 1Q5YA 4FXWA 5KG1A 3MAQA 1NB7A 4RBVA 2MYFA 5MLCV 1H98A 3DLKB 1GK8A 2Q6CA 2IC3A 4M5LA 4UZBA 4C0OC 1KDNA 2D1CA 5LJ5Y 2YWKA 3DRRA 3HKWA 3P5BP 2HW3A 2GMLA 4URQU 4DPUA 3H4BA 4OI4A 1TL1B 4ETZA 1RA6A 2NPIA 3OJUA 2LQ9A 4PYAA 4QIEA 1L3UA 1TAUA 4KE5A 5BR8F 3OL9A 3EGWB 2DCLA 7FDRA 1SC6A 1Y5LB 3POTB 1AFIA 4J9LA 3FNNA 2VQFJ 5KFCA 1TKXA 4KGZB 1ZAXA 4N76A 3J7A1 4CLSA 2KB2A 2ZJRQ 1KHVA 2CFXA 2MJUA 5E7OB 5LSRA 1JJ4A 2HSEB 4B3RF 5KFMA 3OTDA 3CDEA 3UVJB 1T0TV 1TUWA 3O5TB 3V81A 4M63A 4JBCA 5AE1A 2VOOA 1AYEA 1K0VA 4C8NA 3U02A 2AD9A 1RJJA 3BZQA 2LQJA 1V3SA 3EDQB 3R6GB 2DNLA 5HVHA 2R7TA 2ILYA 1G1XA 3PW0A 1YRXA 5L1IA 1RTDB 4ECZA 4QZVB 1J2VA 4BCAA 3GB0A 4ZP6A 3GSIA 5FLXU 3VAHA 4DV4F 1W2IA 4A48A 4ZLLA 3R7NB 1RWXB 5LOQA 5GAHU 4NI2B 5HMXA 2EPIA 1ZTWA 2HFSA 2B43A 2DGSA 2VIHA 2FLLA 4F4AA 1YBTA 2DB1A 1HI0P 1EKRA 3LPYA 3EXYA 1GAOA 3LALA 4IRKA 4O3RA 1KFSA 4DV2F 2PGCA 3PACA 5JUMA 3U27A 5IS2A 3LP0B 5C42B 5LMUF 4GMKA 3V4IB 3JS9A 2KDOA 4LQ3A 4PG4A 4AL6A 1M5SA 3C6TA 1TKTB 4YY3J 3HI9A 1DAXA 2JZ5A 2OPQA 2E9ZA 4WE1A 2AJQA 3HX9A 4C8LA 3ZTPA 4PQUB 1Q53A 4NE9C 3BDEA 4Z2XA 5F0WA 4IG0B 1X5TA 4GKJJ 3QIDA 1IVZA 2ZE2B 4CTAB 5ETOA 3IGVA 3AOAA 3X1LB 3UE2A 2Y1LB 4UTGA 2E1RA 3L7PA 2VBWA 5D6GA 2NQPA 3MTKA 2N3OA 2AV5A 5KOXA 4CRJA 3HPOA 1JWWA 4X65J 1RU2A 2WOMB 3SXLA 2WBRA 2Y3YA 3GJQB 3MOJB 3SCLE 2PFDA 2Z2YB 1WC1A 3SSSA 5G4DA 1ZH5A 3JXOA 5AXMA 1IXKA 1UL3A 3DGPA 3RR7A 1KR4A 2PD1A 3O3LA 3DM2B 1QTMA 2KZMA 2CKWA 2XTJP 5DGBA 4CH1A 3IR7B 1O51A 4ICLB 1C1CB 2AEFA 4PQAA 1HBOB 1SL1A 4RW6B 2HHSA 1LFPA 5KFUA 3AT1B 2AZ3A 2YH0A 3IM8A 3DLLQ 1VBKA 4DUZJ 1EKSA 4IFVB 3ZZRA 2W9CA 3F73A 2FHKA 5LMNF 3T9ZA 3CD7A 1U45A 1HNWJ 1YITS 2LQ8A 5GADI 3R9LA 4OX9J 3I4PA 1NHVA 2N4CA 3R6LB 3CD0A 1U0SA 4A8MP 3BGRB 2DITA 1BLUA 5L46A 3TYTA 2VC1A 4DV3J 2GZOA 4DSKA 2JX2A 1NDLA 5G0RB 3Q8QB 2AKWB 2OLWA 4USUA 5HP1A 4YR2A 1RHKB 5HO4A 3BN7A 2K1RB 3R5GA 1YJNS 3H40A 4YMEA 4EYIB 2J5AA 2QG9B 4YR0A 3D0IE 1RAOA 3I0RA 5ETMA 2WCXA 5KFSA 1FNMA 1VQMS 2W1BA 4B3OA 4DI6A 4WP3A 1JLAB 2K3IA 3PX4A 4CP5A 4BLGA 3CC7S 2FVQA 2ZZNA 3ENQA 3IR6B 1LWCB 4Q45A 2I2YA 5J1NA 4JV2A 1WEZA 3M30B 1EX8A 3MEGA 2OP5A 2QO3A 2JEIA 1U47A 4DU8A 2J0QD 2Y0BB 3MWBA 5IT9Y 1U2RA 2R8HA 1ZA1B 2VG7A 2EKYA 1Q86T 4RUBA 1VC5A 2FJWA 2A0FB 1RAFB 2WB4A 1IUJA 3TVZA 4J90A 1P27B 1DQAA 2DXFA 4EO8A 2E5LF 1WI8A 4ZVGA 3US5A 3JQKA 1Z1ZA 4DL5A 2MGZA 1YJTA 3CTRA 2RUSA 4IQMA 4OHYA 4DL6A 2YNGB 3BEGB 2J0WA 2BQ3A 1VBXA 3BYRA 3ZZYA 1VFJA 3NCQA 3J80U 1XBWA 1KTVA 2C2EA 1F5AA 1OPIA 5ETTA 2BV3A 4Y6IA 2D3OR 3W7BA 3PIOQ 5THWA 2W01A 1T05B 5HROB 2KVIA 1S1UA 5K14A 3ISZA 1WHVA 3GSDA 1KEKA 5F3ZA 1VK8A 1PJ6A 2N3LA 1U6ZA 4M5DB 5FD1A 1EETA 3CGIA 2AGQA 2CQHA 1T03A 3C15A 1SJ3P 2EFOA 4JYAF 3BR8A 2GS8A 3FZ2A 2IAJA 1UW4A 4P2SA 3D6TB 4U7CA 4IUFA 5KFGA 3L7OA 1RAJA 4MFBA 1RAGB 2W25A 3M6UA 4N8NA 4C0HA 3BH6B 2Y1RI 4K7QA 2IVMA 2IA0A 1SVDA 3Q86A 4I69A 2ZH4A 3HHLA 4LUBA 3SCJE 4NXMF 2KO1A 3BR9A 3J81U 1ZM9A 3ITHA 1X8DA 3S7RA 1TFYA 2I8EA 2PIIA 4O3SA 4HDGA 3LGNA 3MXHP 1P6TA 3P4UB 3K5MA 2GO8A 3NMAA 3D54A 2OELA 5LSLA 2DR9A 4X62J 2BW7A 1VRUB 4I2QA 3IO1A 4O3PA 4PUOB 3HD2A 4KH1B 3G96A 1VS3A 3MCNA 1R8PA 1IBKJ 3AA8A 4ECYA 1OMSA 1SCJB 3NS6A 1IKYB 2UXCJ 1NJIT 3KHGA 3F41A 3DFEA 1WC0A 4WKRA 4DSIA 1IKVB 3T5LA 1Y0HA 2JL9A 2ROEA 4G1QA 2OUGA 3DXBA 1K9MT 2XCPA 2O66A 3NKYA 4NYOA 5JMNA 3CIMA 3PJ9A 2LFVA 4FYYB 3M2VB 1KQSR 1GMVA 5D3GA 3KLHA 5HK4A 5KOWA 1RT2A 3DOMB 4HKQA 1NUEA 3DCAA 3GV8B 2QYGA 3UD4P 2HKEA 3W66A 4DHVA 2QL9B 1UETA 3CC2S 5CABA 3D67A 1VRTB 2P2CB 3X3UA 1NLKL 4F2RA 2MJNA 3M6WA 1ZPWX 3VQSA 1S6QB 2DNHA 3DOMA 3ZZTA 1RT4A 1SKSA 1YLXA 1RKJA 3P49B 1VBYA 3EWGA 4XIUA 2M52A 1B3TA 4YUDA 3KUEA 1O6XA 5B0CA 3Q0AA 2NR0A 1F0XA 2PDAA 3TQ1A 2J7UA 5F8IA 2VJVA 2MY8A 4C48A 4QWDA 5C25B 2KHDA 1N5QA 2R7UA 3MUMP 1OYEA 5CXTA 4JI4F 4DV4J 2XM3A 3OUYB 2RQMA 2CJAA 4P2MA 4N41A 4OX6A 1Q8BA 2I38A 4J91A 1F9FA 2CJQA 4QYRA 5ETSA 4RNFA 4YFUA 2ZNYA 2RS2A 2JVOA 1XNQF 4L3KA 1FFGB 4DV6J 3M6VA 2VONA 2GGPA 2C2RA 2OHDA 4MH8A 4FN5A 4ZP9A 2J0SD 1M1KT 3G87A 1PO6A 3OTCA 3L3CA 4XPEA 3V6KA 3QZ7A 4ZIVA 3BYPA 4JP8A 2CA9A 2VFSA 3HHDA 3JSMA 5HQ8A 4CIOA 1U09A 3PYEA 4N77A 1R8BA 3HF5A 3HZEA 4KIAA 2RDIA 3MPDA 2FGCA 3PX0A 3SCKE 1JLFA 4DPOA 2WONA 1AZSB 1XNRF 2EFVA 1HL6A 2CQ3A 4J9OA 4WFYA 4YQWA 4C2MA 3D68A 4PWUA 1WF2A 3CJSA 2AX1A 3MAAA 2CPDA 4DR7J 5AXKA 1L3KA 2C2OB 1GQEA 3LGMA 2CVEA 3PKMA 1MWYA 4B9VA 4K5RA 1NCLA 5F9LA 2GVDA 2GIQA 4I7FA 1RT5A 4N56A 2ADCA 2BANA 5A0YB 3TA2A 4C7QA 4U96A 1N48A 1U1KA 2R2RA 3VAFA 4DQSA 3QBCA 3MD1A 2ZM6J 2M70A 3Q8RB 2BUNA 4YP3A 3VZIA 4QW8A 2E9RX 1WOSA 5B0FA 4RUCA 2EK6A 5KT5A 1NK8A 1URNA 1OY6A 2YWGA 6FD1A 3A12A 5LM7E 1S72S 2N4DA 4TXSA 4YDDB 1WHWA 3PHEA 2XMAA 1YBUA 4QR1A 5CH7B 4HYKA 3OJSA 1FKAF 2XMUA 2MZ1A 1X9WA 4PG6A 4F04B 3OSPA 3IMQJ 4LQ9A 3CDAA 3Q89A 3IP0A 4O4GA 2MQOA 5D0HA 3D1QA 3MPYA 1RABB 2IRXA 3RZAA 1S9GB 5J2NA 1HBNB 2Q1LA 3MR5A 1D9DA 3GQCA 1N6QA 1BWEA 2DNRA 3KG1A 3T41A 2HRTA 3M8YA 3QSIA 4KFBA 4DQIA 2YXLA 3G6XA 8ATCB 2XB2D 4DL0C 2DGUA 2BEFA 1CQMA 1LXNA 1NJYA 4AFFA 1M5OC 2Y9HA 5DZ7A 5H9FK 5LMNJ 1MROB 2HQFA 3WBZA 2ALYB 3DOKB 3J7YU 2XWXA 3HULA 4IOAQ 2A18A 1W2BR 1FJCA 1C0UA 1C1BA 2ZVSA 3K7RA 3RRHA 2PC6A 4LFCF 4JV5F 2AGPA 5A8KB 5K8PA 3JQJA 5CZXA 3QZ8A 1A7GE 3AFGA 1NK9A 5I42A 2GV1A 4KO0A 3W9JA 2B8PA 4JI3F 4JI7F 2F9JA 2M2BA 1PSDA 2B9WA 1CSJA 2FVSA 4QU6A 1S1XA 1NJZA 4WK1A 3FSIA 4FF3A 1YJ9S 1EHWA 4H4KC 4TQSA 2L08A 1HNIA 4DFKA 2OSRA 1D9FA 3FC9A 3AXKA 3UR0A 3I87A 2PE8A 4I0WA 5HLFB 4OL8A 2FPHX 4FDFA 1HBMA 5KT4A 4F0MA 1QAXA 3N6NA 3TX8A 2HHHJ 1WF0A 5A6PA 4XTTA 1R3NA 4A8FA 4C3LA 2VZ9A 5HVFA 2FZGB 2MKCA 4HI1A 1L3VA 1HHSA 2MSSA 1ZS6A 3D3CJ 4HL9A 2GMHA 3RYLA 3MR6A 4B3MJ 2HWHA 3KK2A 3G8QA 2NXCA 2CJKA 3QJLA 4A8WA 4FS2A 4TLRA 1QM9A 5H9EJ 4IFYB 3EPGA 2RKIB 1H2TZ 4F3QA 1HPZB 5D15A 1KVJA 1JJHA 4RW4B 3NBPA 3H5XA 2CQ2A 1VQPS 5IM0B 3NGUA 1VQ4S 1BC6A 4Q7AA 1NH8A 4F50A 3MMAA 2QN6B 4F2SA 3I0SA 3GV7B 3PX6A 5IWAJ 3TVKA 1OO0B 3QIPB 4Q8EA 2AYEA 3DRSB 2WHOA 4ZLJA 5A8RB 2AGOA 4MKAA 1Y7PA 1FVQA 4O3QA 5F0UA 1FF2A 2V8VA 1FO1A 4C3KA 1BXNA 5D0GA 1WEYA 2CPHA 3CMAS 1GXTA 1QE1A 2BABA 4GVBB 2GHVC 2RHSB 4CI0B 4BHQA 4ERDA 2EBGA 4P9SA 1V3RA 2EFPA 4ZK7M 5B0DA 3T3FA 3C6UA 3W2VA 3KLEB 5HBMB 2V8HA 1IM4A 4CZCA 1H7XA 1VBZA 3PYFA 3RJMB 3G82A 1N34F 5EX3A 2OPSB 1T7PA 4IYQA 4DSFA 2X1GA 4X4OA 1RTIB 1S0OA 1FNOA 3KWMA 2E1PA 3IS9B 3CO0P 1FD2A 2AX0A 5T7LB 4RLEA 2O5DA 2HWTA 4DDFA 2XYGB 5B0EA 4KJIA 5D4PA 5GMEA 3W64A 2E44A 4OIXA 3QGGA 1IR0A 5EWFA 2HS0A 2Z56B 3CMES 2RILA 3MUVP 2J7KA 4ED2A 4DCJB 1CEZA 5AT1B 2UUCF 2GC8A 2RQCA 3QWUA 3H5UA 3W3SA 2MQMA 2ERRA 1FVSA 1BY9A 5B09A 4Y2MA 4FPIA 4B9SA 1Q7LB 1U1RA 1TTHB 4WWSA 4M94A 1UZDA 3CCZA 1SH3A 1UVKA 5ETKA 4LMZA 3H98A 2ZHAA 3OR1A 2KFZA 5GMDA 3HDSA 2LEAA 3HT0A 4JB8B 2I1RA 1TL7B 2KTQA 5F8JA 1SQEA 3CULA 3RBXA 3OFFA 3OD2A 3CD6S 1JK9B 3ZO7A 1RZMA 4HHHA 2ZZTA 3MPVA 3RBEA 3LP2A 3OPKA 2MZQA 1KSPA 1F2HA 2ROPA 1FE0A 5I3QA 5A6WA 4OYOA 3VCDA 2AW0A 3HFVA 4HVZA 5CYMB 4WXOA 4UQGA 3PTWA 3PR4A 4QJVA 4NLGA 3UO0A 3MEDB 3MM6B 3U1LA 3R5DA 3D5MA 4D3GA 3LP1B 2NUUG 2CJBA 3UCUP 2FUG9 1NKCA 1UZHA 2QA1A 5E33A 4NLTA 2MLYA 3ZTRA 3MMCA 1QSSA 1B64A 5B0AA 4KQZA 3RB6A 2YX7A 3D2WA 4OYPA 4JI4J 1F5CA 3NGDA 1GNKA 1TKZB 1FKPB 2ACMA 4QR0A 2JFDA 4K50A 1VQ6S 3MM9A 4KTQA 2E29A 4ECWA 4J9QA 5LXYA 3S1TA 4OV1A 4MAKA 4JI6F 1OQ3A 1SH0A 1HNVB 3MR3A 2F3JA 2R4FA 2HIQA 1DFDA 3B6BA 4USTA 2M4MA 3UD3P 1ZETA 1N5TA 1JX4A 2JLEA 3SSRA 4LBPA 3DLBA 2KH9A 1J5EF 3CXCR 2J6TA 3O1LA 2CDRB 4G3IA 2BA9A 3W2WA 1RBAA 1U1OA 3KMSA 2J76E 1FJ7A 2VH7A 1C0TA 1FDBA 4B3TJ 2HMIA 3H7HB 5D0RA 2YKOA 3IR5B 1AXQA 4FXVA 5KT2A 1RAEB 1WDDA 1UVJA 2JC0A 1P8GA 2DXDA 4I56A 1QUPA 5ITHA 2V4JA 2HFZA 2F65A 4LF6J 3Q8PB 3J7YI 2OFHX 3RAXA 3GFYA 2DNGA 2RB7A 1LKZA 1DARA 5KG3A 1M1GA 2E1AA 3MMBB 3AHPA 3EZ5A 1B70B 5A2QY 2K2PA 2RRBA 3G9CA 1FK9B 3LWMA 1MU2A 3NMRA 2OMLA 5L1LA 4QOTA 1LW0B 1AT1B 1DLOB 3IG1A 1VQ5S 4ED6A 3FEXB 3CCVS 3UDLA 5GVQA 1P1TA 1HIYA 1VIXA 3BKFA 4DR2F 1S9EA 2FHMA 4IG3B 3QT8A 1FK9A 2J9DE 5AXLA 1JLCA 1TAQA 3KG0A 4R8UB 2RJZA 4TY9A 2Q6BA 3ENAA 1YJVA 3BSCA 4DV5F 1WOOA 2GJFA 1N4LA 1S0MA 3F56A 1S7IA 5K5MA 1HHTP 2H51B 2JFKA 1SJ1A 1NMEB 1A0OB 5KTQA 2MTLA 2G4BA 2QZ8A 5F8HA 4X4UA 3NS7B 3UNYA 5U47A 3ET6A 5J1EB 2K06A 2HVIA 4DV7F 4ZPBA 2B0GA 4R8UA 3EE3A 4NLOA 1DTQB 3RAQA 1HNXJ 2JWNA 4DFMA 4QWAA 5D78A 2Z58B 2ASJA 3L09A 2DD8S 2OD4A 3LH2S 3IRXB 2LCWA 2XY5A 2BMBA 4W90B 1YJRA 4L6V3 4KRWA 4FYXB 4NMXA 5CYQA 4JV5J 2F63A 4UOFA 3UW1A 1H3DA 4ANCA 2CQCA 3MM7A 2W2PP 3Q2TC 4Y0FA 2KRBA 3MECB 2RD5C 1NZ8A 1NNDA 1VDHA 2HAIA 1WC5A 4KSEB 1X5PA 4RW7B 4B17A 1YVFA 4JI3J 1SQGA 2WVBA 1SC4B 2OH2A 4NZ7A 2ZH9A 4C8ZA 2JH3A 3CJKA 1NDCA 1FRIA 2R7QA 1M5VC 4NLUA 1UFLA 2XS7A 4C8MA 3AH6A 5IT0A 1WNEA 2ZHOA 2VF3A 4Z37A 5KFOA 2C2ZB 2YVSA 1HLWA 4IRDA 4EBDA 3NCPA 3VAJA 1Q0NA 1RBLA 4EUVA 2EI5A 2MZJA 4K0KJ 2RH3A 1CJKA 1FFWB 1KVKA 2FJAB 3A8JA 2AYGA 1F60B 3QNWB 3T1HF 2YPZA 3GJRB 1Q82T 4XDCA 3NGTA 4R5PA 3PIPQ 2EG2A 1UFKA 2YNFA 2J9DA 2YKNA 2C28A 1ITPA 5EGYA 3UNGC 1L5UA 2RF2A 5D0EA 3OQ2A 4OLPA 2DPJA 3V6DB 2RS8A 4WU3A 2ZC3A 3JYTB 3IGNA 2QA4S 4DV0J 3H0PA 1NSKL 1OY9A 1S0VA 2R7SA 5IV4A 3NGRA 2RHQB 4K2XA 3MF5A 2DK2A 4C97A 2QJ3A 1XEZA 1AA1B 3DOLB 1U0HA 3PEHA 4EBCA 4KPYA 2KXHA 1QUVA 3OW2R 4LF8F 5KT6A 2I0XA 1VQ7S 2JSXA 2VA2A 2EG1A 4OYXA 2GHWA 1RLCL 2QMUB 1IBLJ 4M5MA 4IH6A 3BGOP 4QPXA 1KP6A 4F4XA 5GMKa 2DH8A 2A10A 4DZDA 3MM8A 3ULHA 1R43A 3A3OB 2HFVA 2HVZA 3TAMA 3JAMY 3NY0A 5KFBA 1CPZA 1UJ5A 5AE3A 3ILOA 2VKRA 1CJUA 4C0BA 4WIQA 3FSYA 1FWLA 2BE2A 2UXBF 4WP8A 1TL4A 3FK4A 3HO1A 4NYZA 2GVZB 4DCOB 4OFZA 3KK3A 1MW7A 4DFPA 3M2UB 3TQEA 4LRBA 2U1AA 3KLGA 2HRUA 2CQDA 2AJ2A 4P2FA 4P71A 3FBFA 1RYSA 5KFPA 3CJ3A 1CS4B 3HM9A 1ICEB 3DLGB 1QJHA 4CLZA 1F6TA 5AJ3J 4K4TA 2P9EA 1HWJA 1CJTA 1JLGA 4O3NA 2XSJB 2CAJA 1MNEA 2ZDOA 4O3OA 2V9KA 1FRJA 3CO9A 4ZHRA 3DLGA 5HMYA 3VTIA 1FRKA 1KLMB 4C4WA 5BXIA 4ATNA 3C14A 1QSYA 3M2RA 4OZLA 2YY3A 4KV8A 3SQOP 1WI6A 3T1AA 2RDDA 3CDBA 4QU7A 1K73T 1BWVA 1EARA 1R0BG 5DQIA 1VQYA 5LT5A 1S49A 3PO4A 3DLEB 3CW2C 3FFIA 4UW2A 3HSDA 1YQHA 5IT4A 3IC1A 4TU7A 2VODA 2KT2A 4ZVSB 2CPJA 5J2QB 1QAJA 3OFGA 4C3MA 2XMKA 1FT8A 1SBRA 5DDQC 1RT7A 2IPOB 3W5XA 1HW8A 1FDAA 1VMBA 1LQ9A 1VQ8S 2YWWA 2KHCA 2F40A 2VFTA 4DBQA 2M3DA 4OI1A 3LWLA 4A47A 2YKAA 2L41A 1RTHA 2KFNA 1TL5A 2HAFA 2J6UA 5H1SV 1LNQA 1HI8A 4GC6A 3NRBA 2UVUA 2H5IB 1REVB 4W4MA 3QAUA 1T9UA 1JXEA 1KBRA 3ZZ0A 3TW0A 4HT5A 1PC4A 4CYUA 3MI7X 1JB0C 2FHJD 1I3OB 2KT3A 2D41A 2B4OA 4K5SA 3SDEA 5E0OA 9RUBA 2J7WA 3K89A 4JI6J 1W26A 3LW5C 4CO4A 1HHQA 1FA0A 3VGTA 2DR7A 2CJ9A 4J9VA 2HFUA 1JLQA 2GW8A 1PKUA 3HHLD 1PGZA 2FJXA 4QWBA 2E9TA 4DF4A 2Y1IA 2CYYA 2H54B 3QLHA 1RT6B 1RUSA 1ULRA 2B56A 2BR0A 3S8SA 2CDQA 2VFVA 2J9CA 1H2VZ 4HH1A 4QYZK 1VK3A 4Y2KA 3HLUA 4RPFA 2V0NA 3LPEA 4Z7CA 2P9CA 1WUUA 1O5JA 2ABYA 1B4SA 1TK5A 3M32B 4AUKA 3EGZA 1R89A 3O6QA 3ELHA 3HFKA 3IBWA 4ECQA 4CWBA 3UN2A 2XMJA 4WYLA 4BBYA 4YY3F 5HMZA 4TY8A 5HQLA 2HNZB 2XGQA 1FTCA 1BUXA 4NRTA 4V1Ak 1X31C 3K5OA 2J0XA 3R5CA 5KFFA 3PFEA 2QYCA 3TZXA 3QYYA 4DXLA 4GKJF 3N0VA 1RAIB 4Y28C 2NREA 4KR0B 1SUQB 1QTNB 5RUBA 4DR2J 2MQLA 2ZWOA 3O44A 3OVSA 2V2VA 4YOEA 3IRWP 3ZNUA 3WZ0A 3CJ8A 2VBXA 3FEYB 1LWFB 1Q4RA 4ZCLA 5AXNA 3VHQA 3HHNB 2HEKA 2DKOB 1E6YA 1HD1A 4DV5J 3BBBA 4DSJA 3N9UC 4F3OA 1ZZFA 1CJVB 1YRTA 1Y3JA 3RB3A 2KG0A 1H7WA 2V8DA 4RW9B 1UPPA 2QLWA 4DV7J 1ACMB 3NAHA 1HBUA 2GJ2A 2EFNA 2WVEA 1SPBP 3RRGA 3M05A 4ILLA 1HQUA 4X4TA 1U48A 3HP6A 4G1PA 3SZ2A 4DQPA 2YNHB 4LIWA 3IA0A 3IN5A 3LTOA 4YEAA 2ATCB 3V4MA 1ZAVA 2HGLA 5F8MA 1UAWA 2O01C 2PI4A 2LU1A 2BJ9A 2D9PA 2VG5A 4DJBA 2OPPA 3FDSA 4DUZF 2QX0A 3H2VE 1CULA 1HYSB 3NNCA 3M8QB 4NOHA 1Y3KA 1J5OA 1TK8A 4O23A 2YNIA 2CPEA 3TRGA 5KG2A 3ILLA 4YN3B 5ADZA 2O67A 2B8QA 4I2PB 1SL0A 1R27B 4OX9F 3BGFA 4HH0A 4W98A 5D77A 3SV3A 2JEFA 4URSA 1H74A 4HACA 2CPXA 3D28A 3HSZA 1UKUA 5KFNA 3TI0A 2LYVA 2RSQA 2KI2A 1S99A 2V5HG 3T1HJ 1U4BA 1X4FA 1X4GA 5T14A 2BVZA 3MM5B 2DGTA 2OSQA 3KJVB 2ZUAA 2Q3PA 3GIMA 2XZDB 1EIYB 1FJGF 3DHWC 5HL7Q 2N7YA 1RHUB 2DIVA 2RNEA 2DR5A 2XY7A 3MFIA 3G2XA 3QRPA 1LOUA 4U8YA 2UVRA 3OVAA 1JLEA 2OMOA 1R8HA 2DTJA 2GAGC 3ZC4A 4DX6A 4RBUA 4DOZA 3E51A 4PG5A 4RNNA 3FMBA 2B4VA 4USIA 1TL3A 4A8SA 4ZDNA 3EMTA 1YRUA 4J9MA 4NYPA 2HBRB 2C3PA 5KFAA 5KFDA 3MEKA 6AT1B 5M2RA 2MHEA 3B4MA 2OPRB 4ECRA 1XQIA 2XNQA 5KFWA 4FBUA 3NP5A 1FE4A 4LF4J 3MHYA 1FX2A 2BQUA 4WTOB 2MLXA 1NBEB 4QQBA 1T9WA 5GADU 1PJ7A 3DU5A 4K59A 4ZN1A 4RUHA 1RWVB 2Z0GA 2I5JA 5KG7A 3CCQS 5C5JA 3IAS9 1KHWA 2M8DB 4Y2IA 3NNHA 3VQTA 1TK0A 4NWBA 4MMOA 4MK7A 4NCGB 1UEVA 1M5HA 4HI2A 1S1TB 1ELOA 1TUVA 3PJWA 3C16B 1WWHA 1UVLA 2CZ9A 2FHOB 1U2CA 5BYSA 4FBTA 4X2BA 1S4FA 3R7BB 2VB6A 3PVXA 1H0HB 1U1QA 2L9DA 1PJ5A 4DG1A 3A1YG 1JKHA 3UQSA 1YTYA 1FRXA 4LFBJ 4YB1P 4DL4A 4DCPB 2PT0A 2B6AB 3GIKA 2L9NA 3DC2A 3DRPB 1GMWD 5IT9U 4Y2AA 2D7SA 3DRYA 5EWGA 2FZCB 3H25A 2UUAJ 3H42A 5DDOC 5J2MB 3AB4B 1IJEB 1FKOB 2ZH6A 3WQPA 2FTRA 2XG8A 4FKXA 1CQNA 3KJFB 4UT4A 1R0AA 3AODA 3SFGA 1KN6A 4L72B 3BF4A 1S6UA 2QLXA 1FXLA 1X4CA 1VQNS 4UUXA 5KFTA 5J2PB 1BQNA 3QATA 2C3YA 4ILMA 1S1VA 5GAGI 2Z30B 4A4JA 1FDDA 1NJXA 3PEJA 1UWBB 4KKOA 1AFJA 2E1MC 2C2MB 1EP4A 4NMLA 4BS2A 1L3SA 3DMJB 2DPIA 3CSKA 4LF2A 2CQ4A 3W61A 5I3UA 1U6BA 2MY7A 1Z2ZA 2CG4A 5KFYA 2NPFA 4LIRA 2PMHA 4X62F 1UWAA 3RGIA 3ZXWA 4CLLA 2RU9A 1K44A 3UCGA 5DLFA 3ETMA 1A9NB 3RRKA 4C8KA 4X4SA 4WJBA 3BBCA 1CC8A 1IBKF 2XMTA 2XHWA 1SQFA 3R2CJ 5D4LA 3DLKA 3HZGA 4YB5A 4Q2LA 4YB7A 3M9MB 2JNJA 2UXCF 1FRMA 4FVCA 4DS5A 1RWKB 4ZP8A 4DQQA 3M9OB 4RO0A 3BJYA 1XR6A 2HHVA 1ZYQA 4LBIA 2F4VF 1LK5A 8AT1B 1RE1B 5HMWA 2CG8A 2PMZD 3U7JA 2A2DA 4HTIA 2NXJA 5IXUA 2HRYA 4CO3A 4FF2A 1TFWA 5KFLA 5EHHA 5L8RC 2J6SA 1U1PA 1TL1A 4OV6A 1AW0A 1RWPB 3G6VA 2PMWA 5KG6A 3QGIA 1XERA 1HKAA 4OYMA 4WFZA 4B9LA 3QFWA 2XWYA 4RNOA 3PW5A 2DGQA 3POTA 4ECSA 3DYAB 3OL6A 2ZH8A 2ZH1A 5B0GA 2DNYA 5LXRA 4UOGA 4YS2A 5L1JA 4NX9A 2ROGA 1XJWB 3CJTA 3AJDA 4USMA 2AYBA 3TVYA 3UVJA 1U7LA 1TV6B 3W62A 2G9OA 4M5NA 5K20B 1LFWA 2CZVC 4ZVRB 5DDRC 1D8ZA 2DISA 1S6PB 2KKHA 2F1FA 2IJRA 2BKOA 3P6YC 1WJ9A 1ZPVA 2GQQA 4LR8A 3Q2SC 1SIWB 4MK8A 3KFWX 5HJYA 1DHMA 4ER8A 3K2YA 2E5IA 4U6PA 2D74B 1QAYA 4LF7J 2P6SA 3VALA 2HHWA 4TLQA 4DSLA 1RTDA 4WFNQ 4DV6F 1R7IA 1EJ7L 5F3TA 3T9NA 1K0TA 2KXNB 2RVJA 5ETVA 4CT8A 1SC3B 5E3PA 4LSLB 4NI2A 1KQFB 2C22A 4F4YA 4DL7A 2NZCA 4I64A 4DS4A 4DR5J 2HQGA 2HZAA 3SQGB 3I5BA 1WC3A 4BDPA 3QQCD 3KHHA 1X60A 3PNIA 1IBMF 2MPUA 1AUDA 2WB1D 2DHAA 2B9XA 1HWKA 2KL8A 3SMZA 3LP0A 5C42A 4DR7F 5EDWA 1PAEX 3V4IA 4DL3A 4L76A 2KU7A 4LREA 1RISA 2CPYA 1TKTA 4A8YA 1D1UA 4J9PA 1S12A 4H4OB 1D0EA 2FDNA 4PQUA 4OHXA 3RB0A 4CO0A 1I51B 3DNCA 1N5YB 4IG0A 3W8GA 3H4DA 1LK7A 1DZ5A 3IXQA 3Q83A 4DZ6A 2ZM6F 1TUGB 4ZVFA 2FC9A 2ZE2A 3KTQA 3UR3C 4GKKF 4CTAA 2ZOFA 3UDVA 1SI9A 4CO5A 1NSQA 3QT7A 3GE9A 4DX5A 1Q16B 2YTCA 1OY8A 4LRFA 3BBFA 2HGMA 4DR6F 2AF6A 4LBHA 5CAAA 1VQSA 4ITSA 3TZYA 1VLYA 4AQYJ 2DO4A 4ID5B 1U2FA 3PO5A 2WOMA 4RU9A 4OZNA 2CZ4A 2R7VA 3MEEB 2HG4A 2FVRA 3FCVA 1BMQB 1EQ0A 1RT3B 5IFMA 3RR8A 3RW6A 2MZSA 4PXEA 4JI2J 1SIZA 3EX7B 2UXDJ 4X66J 1XK8A 1MSWD 3OTOJ 5KG5A 1T9XA 3DM2A 1MN9A 1VISA 4CQ1A 4ES3A 2QSWA 2VDHA 3KLFB 1NKEA 3MTJA 4UF4A 1R6YA 1M1HA 1FNXH 1HQ2A 1XIQA 1SH2A 4KYZA 4ICLA 4HR2A 1C1CA 4XDDA 4I6AA 4CH7A 4DWIA 3CJ4A 1HBOA 4RW6A 3DDNA 3BSAA 2F9DA 2FZKB 4HHJA 2HHPA 2E5HA 3GYNA 3F44A 2JLGA 3AQPA 3C8YA 2DR8A 2Q43A 2RIJA 4O0NA 2B4PA 3TJ8A 4NLQA 4IDKB 4IFVA 4C11B 2EK1A 3K8VA 4BC7A 2EBEA 1P1LA 4ZJQA 2W8KA 4H4MB 3MURP 1RT1B 1WDTA 1OSDA 3MFHA 4A8QA 1FJGJ 5E3AA 1BQMB 3M8PB 4ECTA 3BGRA 3GTYX 1B99A 1JLBB 4RW8B 4J9NA 1WC4A 3Q8SB 4ZMMA 2JEGA 3LAKA 3ZTSA 3Q8UA 4KAIA 4IH5A 3PYGA 3KLVA 3DI6B 2OJ3A 5KFZA 2IBKA 5DETA 5G0RA 3PZPA 1ZTTA 3TR5A 2ZH5A 3C19A 2MQNA 2QE5A 1FEHA 4IR9A 2K1RA 1N33J 5JXSA 4O44B 3GG0A 3T1YJ 3TA0A 2OTJS 4X4QA 5KAKA 2WW8A 2HHHF 2B4UA 5A8WB 1JLAA 2XNRA 3T5KA 3K5NA 2H65B 1F3FA 4CLYA 1V5IB 1LWCA 3OHAA 4B3MF 3N28A 2H5JB 3M30A 5D8HB 5DDPC 2NXNA 4W92B 1FESA 3TWZA 1QAIA 3JSYA 2Q66A 2HK2A 3KJQB 2YX4A 2UV8A 2HS3A 5BYQA 3KLIB 4LFAF 3KXDA 1SV5B 3TEGA 4DSEA 1RHJB 1HMVB 2C1EB 2XO7A 3O8WA 4ED4A 3WHIA 5IWAF 2QA2A 2IM3A 2ZBCA 2YNGA 4FVMA 3BGLA 3LF0A 4ZVOB 2HS4A 2LP4A 5DQGA 2DRDA 4Q5VA 3LQVA 3RBDA 1N56A 2RUGA 4O0IA 1GX6A 3HKZD 5I4MA 1G6BA 5E3CA 1NO8A 1T05A 5HROA 2FHJA 2I9SA 3P45B 4HEA9 1LW2B 4OJGA 2K7JA 2VG6B 2Z2ZA 5H9FJ 3OTEA 2MMYA 2YX1A 4DV1F 1VHIA 5EUHA 4M5DA 1XWLA 5IZHA 3CMQA 2DT9A 2VD3A 2CWKA 3EGNA 2LLZA 2IBOA 2W9BB 2C2DA 1ROFA 3EJMA 2DNZA 3PG9A 1GH8A 4NLWA 3B8HA 4TVAB 1HWUA 1RB0A 2A6OA 5B0BA 3C2PA 4J9UE 2C2KB 3OXGA 2L3MA 1RP5A 4AYBD 4I6WA 1HQEB 4EBEA 4OZ3A 1X0PA 3NL0A 3EUNA 2V9WA 2MZTA 2FY8A 2ZITA 4WIIA 2XZTB 1PYTA 3NG8A 1VI7A 4J9SA 1Q7YT 2BACA 2YKPA 1VRUA 2CNOB 2NXUA 4CLUA 3NWGA 4PUOA 2KM8B 1E6VB 3IWXA 3BKTA 2F4VJ 4NCBA 4CO2A 5CYJA 2L9WA 2R8IA 4YDXA 1U1MA 2V8PA 1IKYA 4JV1A 2P6TA 2ZD1B 1V5VA 1R31A 1DTTB 5F8NA 1IKVA 3KNAA 1WTFA 4TQRA 1S6OA 1DQ8A 3D1OA 2IY5B 2GIFA 3W9HA 1QSLA 4PWDB 3ETOA 3OFEA 2W9AA 1IKWB 5E5NA 1RWWB 3M2VA 4KY3A 2WW4A 3HVTB 2MXYA 1NHKL 2KYXA 1FXDA 2M5YA 1JNZB 4NA3A 1GT8A 1YZ7A 5C24B 2DY1A 4F36A 4PKDB 1QY7A 4IQXA 4MYUA 1VRTA 2CPIA 1IR1A 2B5JB 3WIUA 2YKMB 3DLHA 3CPWR 1NDPA 5DM7Q 1S6QA 2IJNA 3PFOA 4PWWA 1Q8IA 3IWNC 2QIFA 4U95A 2CJYB 2APOA 4IRCA 2NUHA 2DH7A 2R42A 1RWMB 5DM6Q 2F5GA 1B0PA 4I1TA 1LWEB 4X84A 5C25A 3W63A 4IO9Q 1RHQB 4FP9A 3QO9B 2R2UA 2VC0A 2ZEJA 5ETQA 2FC8A 2H48B 2JEJA 3OUYA 1RCOB 1XR5A 2ZOGA 2VQEJ 4MIWA 4G6VB 1RHRB 2L48A 2CUYA 2DR6A 4PRFA 2O3DA 1U49A 4DX8H 3NGSA 2DRAA 4B9UA 2HQ3A 3P3DA 1IBMJ 2JLFA 2MKYA 4B3TF 1CVJA 3EVOA 5LJ3Y 3OV7A 3QT6A 3KK1B 2YKQA 1QVFR 4TYAA 4QWEA 2PFFB 3TJAA 4ZS6A 2HHTA 3FJ2A 2UZAA 1ZBTA 1AZSA 3I56S 2D3O1 4LF6F 1R8CA 4DL2A 1RADB 2Z2MA 1XC9A 1H6KX 1WACA 3W5ZA 4GKKJ 3E01B 5FDLB 5F41A 3CJ5A 2D3ZA 2CWXA 2N82B 2HNYB 2AQ4A 4DR6J 2ZHBA 2IFXA 3ZNJ1 5A0YA 4ED3A 1UPMB 5KG0A 5L38A 3FSXA 2BJ7A 3OR2B 4Q0BB 1VHFA 1JXVA 2HIYA 1KVIA 2DBBA 3KOAA 2QFIA 4HT7A 3I31A 1J27A 2UP1A 3BKUA 1T9TA 2ZBQA 1K1QA 4LVNP 1DQ9A 4LSNB 3CT9A 1S1WB 3AJ1A 1TVRB 3QRRA 1NZAA 4DU7A 2W4DA 4NZ0A 2LQBA 2W2QP 4N47A 2IYGA 3T6JA 2XMWA 2HVEA 3CCTA 1FRLA 2DGWA 2H4YB 2IC3B 3K8WA 5A2QU 4ELVA 5GAEI 3IBFB 3V6HA 3DRRB 2U2FA 2E1CA 2WVDA 2CQ0A 3C66A 1HNXF 1KOOA 2BX6A 2FYXA 1S9GA 2VOPA 2X1FA 1HBNA 1MLAA 4B3SJ 3N5BA 2HQCA 4NLXA 1ZA2B 2YBVA 3I82A 4E2FB 1GMUA 5JVHQ 4G1IA 3CVKA 3KJNB 2E5JA 1RAHB 3VAKA 3Q23A 4HDHA 1GMWA 4DR4J 1UMJA 1UTAA 4PG7A 1MROA 1NPPA 3GFHA 1ZZNA 3THPA 4AE5A 2BDPA 3DOKA 3LOUA 4X64J 5JVGQ 5CQGA 1NM2A 1IQTA 1LV5A 1NJWA 5T41A 3ZZZA 4C6AA 4BWJA 1X5SA 5A8KA 2AU0A 3N6MA 3LA0A 1XMBA 1TKXB 2CNKB 1U26A 3MMJA 4FF4A 2JJ4D 1N36F 3M1VB 3BQ0A 1RA7A 4K0KF 3V81B 3RBZA 1I1GA 4EO6A 2YQ0A 3NCRA 2H1YA 1OS5A 2XO6A 3D0HE 5DLGA 3QT5A 3THVA 1DBDA 1UJ6A 4LSZB 3GYGA 1MWZA 2V68A 3M1VA 1EAYC 3OSNA 3FGVA 5HLFA 2UUTA 3A3PB 4P74A 1N32F 3KNGA 1VR6A 2DNQA 4JI8J 2EC2A 4MTPA 1NEEA 1PAUB 3H8YA 4MIBA 3UCZP 1NU4A 4DV0F 2ZZMA 6FDRA 2MDAA 3JQMA 1VIOA 2LDYA 1EZZB 2DNNA 4ZP7A 4LFAJ 3AXMA 4R0EA 4ZVPB 1S10A 1U02A 1X4HA 3Q8VA 2CJXB 4RL1A 1KWMA 1SKWA 4DUYJ 1S5ZA 2ZH3A 4IH7A 2W7AA 1IBLF 3LUYA 4UZCA 4IFYA 2RKIA 3GJTB 3C6TB 4E0DA 4DR1J 3JSRA 1HPZA 3HMJG 2FY1A 4RW4A 1FJEB 4CM2A 2OPQB 5IM0A 4WE1B 4UY85 2YPYA 1RTZA 4OI2A 4OQJA 3QIPA 4FYVB 3NXZA 1GEHA 3DRSA 4CM0A 3CEDA 2WZ1A 3TOQA 3TAQA 4NXNJ 5A8RA 2GX8A 1H72C 4QCLA 4J9KA 4DV1J 1OPZA 2VPWB 2UV8G 4LF9J 3FKBA 2XBPA 3ZTQA 3BSNA 4ZPWR 2A2CA 3PM9A 3B78A 2W2MP 2NXEA 4Z7YA 1YJUA 3G4SS 1H2UX 1XR7A 4B9TA 4ZCMA 2Z2LA 4GVBA 4QR2A 5AJ3F 2H4WB 2MKHA 3SIPB 3MZIA 2X3DA 1KNZA 2LXFA 1YJWS 1G4CA 3KLEA 3HJFA 5HBMA 5BYRA 3T5JA 3SEOA 4ECVA 3DGPB 4NA1A 1I6JA 2OPSA 1Y5NB 2XULA 4BWMA 3JAMU 4RZRA 3UN5A 1RTIA 2CQ1A 5HANA 4MK9A 2V67A 2CXEA 3IS9A 4WP9A 5T7LA 2OIHA 3KHRA 3NOGA 2Z57B 2AHOB 3TNVA 1IWGA 5IC4B 3R97A 3I5CA 4ES2A 1HR0F 2CQBA 4QIVA 2UUWA 2P9GA 4JV0A 2BJDA 2HZVA 2IYIA 2H3EB 3VGVA 3UFCX 4GRSA 2W9CB 3GP9A 3TZZA 1YK9A 2COLA 1OYDA 4ELTA 2MQPA 3BH7B 4GO5X 3TUIC 3T6BA 2NSCA 4CNZA 1SXLA 1V6HA 1D3WA 5DO2A 4A8KA 1TL7A 1C2PA 4USJC 2GMJA 2KRRA 3HHEA 1CG2A 3KUHA 4ZITA 3D66A 1C4AA 1O8BA 2W2NP 2YWHA 4KPCA 5CCLA 4I68A 3TUJC 3LAMA 4OI6A 4KHPJ 2Y8YA 5B7WA 5HP1B 2CRLA 3BS9A 2RQ4A 2G13A 3R8YA 3CIZA 1RHMB 3FUYA 4WK3A 4P73A 4MIAA 4DF8A 3I0RB 3J7Z5 5CYMA 1S57A 2RMLA 3ONQA 2P8IA 5L9NA 1RU1A 2AJFE 5FIIA 5L1KA 3MEDA 3MM6A 3WDOA 4B3OB 3RAMA 3H90A 4N7TA 2ADBA 4YHHJ 3LP1A 4KH0B 2LECA 1KKHA 2AZ1A 3PW4A 2MB0B 2LMIA 4PABA 4ED5A 1YSJA 2KN4A 2G2ZA 3MEGB 1NK6A 2RE1A 2EVZA 1Q95G 2OFGX 1TKZA 3R5JB 1F9HA 1FKPA 2VG7B 1U24A 3OTBA 3H2LA 3RUBL 2HGNA 1TMJA 4ZVQB 3CCUS 5ETPA 2MKKA 3L9ZA 4X4PA 3GILA 1HA1A 8RUCA 1HNVA 2MGZB 3VF0B 4JI1J 1SJQA 2R7RA 2DNMA 2KXFA 4ECUA 4UQTA 1RXOB 1REGX 2HQIA 3BO4A 5L9XA 1O0PA 1Z2LA 5DZ6A 2N7CA 5LL6d 3OXFA 4A8XA 4NEYA 1VJQA 2AWZA 3K5PA 4DPXA 4M5GA 3I5AA 2LU2A 3IAM9 1KONA 2ZBRA 3R5BA 4ID8A 2FQQB 2EFGA 2HHXA 3G8SA 1R8AA 1S1UB 1XTZA 3DDKA 5K14B 1LWXA 2BE7D 3FRYA 1M5KC 3BO3A 3PW2A 4QIWD 3GYXB 3K59A 1GXLA 4KGKA 1I94J 2V8GA 4J9RA 1EETB 1YBAA 3I6PA 3BV8A 1Q81T 1R0CB 2RRAA 2HHUA 2ZKTA 1WKKA 1FX4A 1T03B 3C15B 1RKIA 3GCXP 2W4PA 2IAJB 2GHPA 4ANDA 3GFZA 2ASYA 3V6JA 2ZBIA 4Y2CA 2KFYA 3MMBA 1URRA 2RQKA 2CNLB 4WF9Q 5ETNA 3Q24A 1V9OA 5F8GA 4MFBB 2DHHA 5KFQA 3OVBA 4F0HA 4U67Q 4KHMA 4ZCKA 1LW0A 1DLOA 4M8LA 4KB7A 4AXJA 3HHLB 3FCHA 2VJUA 1X4AA 2CIMA 1V3ZA 2ZH2A 4KBIA 3LANA 3ITHB 4CLWA 3BQ2A 4OZJA 4F67A 4OHZA 2VBZA 2HK3A 5DGAA 3C3LA 2EW9A 1RGVA 3FQKA 4IG3A 2HPUA 3E2EA 1C4CA 3FBEA 1JJCB 4DQRA 4I2QB 4DMZA 2ZUGA 1JNRB 2FVCA 4RKUC 3FRZA 4HTJA 2FB0A 4DFJA 3A13A 2R7XA 3VV2B 4JI5F 2WSEC 2WVFA 1LXJA 1N5SA 2W2OP 4CDIA 2XS2A 1JIHA 3CJRA 2MKIA 1YDLA 1GXUA 3K0JA 3OHBA 3M7VA 3DKDA 5J1EA 2O1PA 3VVUA 2M8HA 3CJQA 3GR0A 1HWLA 4ZOSA 1DTQA 4IOCQ 2XZWA 4USKA 1XN9A 4G1QB 2Y0SD 4QW9A 2IRYA 3IRXA 3PR5B 5KFKA 4NL5A 2QEXS 1QD1A 5D3GB 3KLHB 3VVTA 1RT2B 4FKYA 4MJKA 4K4UA 3MECA 1NKBA 2C3OA 1UJ4A 2BRKA 5GAHI 4ZPDA 2AYMA 4P10A 2A1BA 5BR8J 4ZIWA 1N36J 4RW7A 2CQPA 3PJXA 3D6MB 2A6MA 3CCWA 2DCUB 3OL8A 3MOZA 4QYZJ 5FLXY 3W1YC 3HD1A 3SYZA 4EMDA 2ZJQQ 1RT4B 4F0KA 3EXCX 2M9KA 2YQ1A 3CNQP 5C2GA 1T9YA 4MKVA 3AOCA 4B3RJ 3TX0A 3R7SB 4QBUA 4K4WA 2NS1B 4XPCA 1N32J 1HD0A 3K58A 2FVPA 4R0JA 2KG1A 2WSFC 3BREA 1QLNA 2FLNA 1VLOA 2D9OA 1WSRA 2DJWA 2KM8C 2WSCC 1MMLA 4OYZA 2WRMA 1K8AT 2V94A 4M5HA 1NK4A 2PA8D 1U25A 3BSOA 4O4RA 1Y10A 3EVWA 3R1HA 4TU9A 2NZ4A 3V6DA 1U1NA 2EXUA 4GVLA 4LF4F 2GGPB 4R25A 4Q44A 2R7WA 3JYTA 2IMWP 3CE8A 1Q79A 2ZVIA 4WFBQ 2B51A 1ZAWA 4NLRA 1G2EA 2KJWA
chains in the Genus database with same CATH topology
3IXQA 3HVTA 4Y2MA 3KHLA 4EEYA 2MKSA 4OZ0A 4ZVFA 2GIRA 3JSMB 2ZM6F 4B9SA 1JLEB 2FC9A 2ZE2A 2ALZA 3KTQA 1Q7LB 3UR3C 1RTJA 4CTAA 1U1RA 2HLTA 3DOLA 3E3XA 4GKKF 2ZOFA 1OWXA 3P5TL 4DV3F 4FS1A 1KTQA 1TZ0A 2WBMA 1IN0A 1SI9A 5CCMA 4M94A 4CO5A 3CCZA 3GE9A 4RWWA 1SH3A 1UVKA 4NZ6A 1JLFB 3TP2A 1Q16B 4LMZA 2WONB 2YTCA 3H98A 4YHHF 2PEHA 2ZHAA 3OR1A 1RDRA 2KFZA 5C24A 1TL3B 3HDSA 2XSFA 1CC7A 2HGMA 2LEAA 4DR6F 2I1RA 2AF6A 4RNHA 2KTQA 4NRUA 5K9FA 5F8JA 1SQEA 1ZM2A 1VQSA 4ITSA 3CULA 3S01A 3OFFA 2B5JA 1WF1A 1UVIA 2YKMA 2LEPA 1BGXT 1VLYA 2XLJA 3CD6S 4URGA 1JK9B 2F8HA 2DO4A 4ID5B 5E41A 1U2FA 4X4NA 1VQKS 1WD6A 2PA3A 1SKRA 3GFXA 2F8MA 3JTOA 3FEZA 3PO5A 2R7OA 4OZ1A 5J1PA 2WOMA 4DLGA 4PCQA 3G6ES 3I9ZA 3MPVA 4RU9A 4OZNA 2CZ4A 2UU9F 2R7VA 3RBEA 4CT9A 2BJEA 3LP2A 3MEEB 3OPKA 2X3GA 4LFBF 4I7FB 1RT5B 2HG4A 4IOBA 2FVRA 4Y65A 2MZQA 1KSPA 2ROPA 5L39A 1RT3B 2BANB 5IFMA 1FE0A 5I3QA 1JJ2R 5A6WA 3RR8A 3VCDA 2AW0A 2VA3A 3RW6A 5M2PA 1FERA 2MZSA 4PXEA 1SIZA 3UI3A 2RU3A 3EX7B 4ZVHA 4FYDA 2KZZA 2UUAF 4UY8T 1LWEA 1XK8A 4HVZA 5CYMB 2I5JB 4WXOA 2IA6A 1MSWD 4UQGA 5KG5A 3SFUA 3PR4A 4QJVA 4NLGA 4PPDA 3DM2A 4IKAA 1B7FA 3QO9A 3MEDB 3MM6B 4CQ1A 4FPRA 2F8EX 4ES3A 1UFWA 4ZKAA 1S0NA 3KKFA 3U1LA 2QSWA 2Y1JA 2C3MA 2CVIA 3KLFB 2JOQA 3R5DA 3H5SA 2WAQD 3D5MA 1X4BA 4D3GA 3LP1B 1NKEA 3M2UA 2DNKA 2NUUG 3MTJA 1R6YA 2CJBA 2ILZA 4UUWA 3UCUP 1APSA 1JXLA 1FNXH 1MMNA 1SH2A 2FUG9 4ICLA 1NKCA 2KJVA 1C1CA 4XDDA 2QA1A 4I6AA 5E33A 4NLTA 2IRUA 3WX4A 4CH7A 4DWIA 3MMCA 2YQ3A 3CJ4A 1FCAA 1QSSA 1B64A 1HBOA 4RW6A 3DDNA 1BD6A 3BSAA 5B0AA 4KQZA 2F9DA 3RB6A 3M6XA 4HHJA 2YX7A 2HHPA 3D2WA 2LVWA 3AQOA 1RYRA 2E5HA 4DG1B 4X4RA 3GYNA 3F44A 4EFAC 2JLGA 4M95A 1F5CA 3AQPA 1JKHB 2HZCA 3MPWA 5KFEA 3C8YA 3NGDA 1FHTA 2DR8A 2P5VA 2Q43A 1GNKA 2RIJA 3NS5A 4CH0S 5FJ4A 1TKZB 4O4GB 2OO4A 2B4PA 3BB5A 1FKPB 4QR0A 4NLQA 3R5AA 4C9DA 2JFDA 4IDKB 4IFVA 2XSJA 5E3QA 4K50A 4FNHA 4C11B 1VQ6S 3MM9A 1VC0A 3PY8A 4KTQA 2E29A 2EK1A 1KS2A 5KFVA 3K8VA 4J9QA 4RBTA 4ECWA 2OTLS 4BC7A 5CD4H 2EBEA 3N4WA 3KK1A 1P1LA 5LXYA 2W24A 4A8OA 2W8KA 1I94F 3S1TA 5J2NB 3HXMA 4OJ3A 3O2IA 5AE2A 4OV1A 5EWEA 4MAKA 2VPYB 4JI6F 4H4MB 1N6QB 1OQ3A 3MURP 1RT1B 1T3NA 1PC5A 1OSDA 2M7SA 1SH0A 4B9NA 3MFHA 1HNVB 4KC5A 4KFBB 3MR3A 2F3JA 4A8QA 5I3PA 4EWTA 3FVYA 2XY6A 2R4FA 1S9FA 3NAIA 2HIQA 1KLMA 1DFDA 1R0AB 3UD3P 2M4MA 1ZETA 3GZ7A 4ED8A 2QA4G 1N5TA 1BQMB 2HFNA 3M8PB 5E3AA 1JX4A 4ECTA 3BGRA 5DG7A 1KQGB 5CHCB 1JLBB 2JLEA 4RW8B 3SSRA 1WTBA 1RK8A 2DVIA 5D8HB 3DLBA 4J9NA 4IR1A 3Q8SB 2KH9A 2XMVA 1QVGR 1J5EF 4ZMMA 4E98A 5D4NA 2DNPA 4IO1A 3CXCR 2JEGA 2J6TA 3LAKA 3O1LA 2RRNA 4OI0A 4G3IA 3DU6A 1BQNB 4KAIA 1M0SA 3E01A 5FDLA 5CA5A 4NCAA 4JOUA 2BA9A 4IH5A 3KLVA 2OJ3A 3DI6B 2IMOA 5KFZA 3W2WA 2IBKA 5DETA 1PILA 5G0RA 3PKYA 1C0UB 3KMSA 1C1BB 2CPFA 2J76E 3OBIA 1T3OA 3FQLA 4Y34A 4DR3F 3PZPA 3S6EA 1FJ7A 1ZTTA 1TR0A 2VH7A 3TR5A 3CDUA 2ZH5A 1S1VB 2Z4PA 2HNYA 3KMQA 1C0TA 2MQNA 3CCRS 1FDBA 2LDIA 2HMIA 4TYBA 2QE5A 2BQRA 3DLEA 3JTPA 1FEHA 4DLEA 5KG4A 4IR9A 2K1RA 5JXSA 1SJFA 4O44B 2GNKA 4KKOB 3CF5Q 2YKOA 5SUHA 4KGMA 3GG0A 2IVFB 4RUAA 1EP4B 3IR5B 1AXQA 2GQCA 4FXVA 5KT2A 2XCAA 1B0TA 2VBYA 3TA0A 3OR2A 1UVJA 4Q0BA 2OTJS 3V2UC 2JC0A 2FLPA 2ZFHA 3MGJA 5I42B 4X4QA 1P8GA 1VQOS 5KFIA 5KAKA 5I3UB 5J2QA 2WW8A 3EZUA 4I56A 1QUPA 2HHHF 4KO0B 1F5BA 3M8SA 1ZOTA 2QFJA 3PW7A 2B4UA 5A8WB 1JLAA 2Q79A 5ITHA 2WTFA 2XC9A 3ICLA 2XNRA 3T5KA 2V4JA 2HFZA 5F8LA 2W8LA 3L95X 5IQQA 4DN0A 1VC6A 2XS5A 1FTRA 3AAWB 4LSNA 4OI3A 3K5NA 3NLCA 4LVOP 3J7YI 4C98A 3Q8PB 3QPIA 1S1WA 2OFHX 3RAXA 4AL5A 2M88A 3GFYA 1S1XB 3SV4A 1TVRA 1UVNA 1LWCA 2DNGA 1LKZA 2RB7A 1DARA 5KG3A 1YWXA 2E1AA 3MMBB 5GAGU 3AHPA 2J8AA 3EZ5A 3OHAA 4B3MF 5A2QY 2K2PA 3N28A 2HFOA 2RRBA 5LSOA 4FXWA 3M30A 5KG1A 3MAQA 1NB7A 3I9V9 4RBVA 2MYFA 1HNIB 1H98A 1FK9B 3DLKB 5MLCV 5DDPC 4PXCA 4H54A 3G9CA 3LWMA 2Q6CA 1MU2A 2FJBB 4W92B 1FESA 3WC0A 2IC3A 1ZM4A 1QAIA 3NMRA 2OMLA 3JSYA 5L1LA 2Q66A 4QOTA 1LW0B 1TP7A 1DLOB 3IG1A 2JRSA 2YX4A 1OSCA 4C0OC 1VQ5S 2UV8A 2D1CA 2HS3A 5BYQA 3KLIB 4ED6A 3SSQA 5LJ5Y 1REVA 4LFAF 3FEXB 2YWKA 1SV5B 3DRRA 3HKWA 3CCVS 3UDLA 5GVQA 2QMWA 2LKZA 1HBMB 3CCJS 1P1TA 4GO7X 5D4OA 5K8NA 4DSEA 1VIXA 4DR2F 1S9EA 4B08A 1HMVB 2K8GA 1WG1A 2HW3A 4RU2A 2FHMA 3H59A 4ECXA 2GMLA 4URQU 4IG3B 2XO7A 2FJVA 1FK9A 3H4BA 3O8WA 4CNYA 2J9DE 5IWAF 4OI4A 5AXLA 2QA2A 2DNOA 1TL1B 3J7ZT 4ETZA 3J80Y 1JLCA 5CZVA 1RA6A 2IM3A 1TAQA 2ZBCA 2ZKUA 3KG0A 4R8UB 2RJZA 2YNGA 4FVMA 2R2TA 4TY9A 3BGLA 2Q6BA 4ZVEA 1T8EA 3LF0A 1YJVA 2K3KA 2HS4A 3BSCA 2NPIA 4DV5F 1KOHA 5DQGA 3OJUA 2LQ9A 4Q5VA 3N01A 4J37A 3LQVA 1B0VA 1N4LA 4QIEA 1S0MA 3F56A 4BC9A 1L3UA 1TAUA 4KE5A 5BR8F 3ISNC 3OL9A 3EGWB 2DCLA 5K5MA 4EYHB 1HHTP 3KK2B 4MYTA 2JFKA 7FDRA 1