1DZ5A

The nmr structure of the 38kda u1a protein-pie rna complex reveals the basis of cooperativity in regulation of polyadenylation by human u1a protein
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
101
structure length
101
Chain Sequence
AVPETRPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKMKGTFV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U1 SMALL NUCLEAR RIBONUCLEOPROTEIN A
publication title The NMR Structure of the 38kDa U1A Protein-Pie RNA Complex Reveals the Basis of Cooperativity in Regulation of Polyadenylation by Human U1A Protein
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ribonucleoprotein/rna
total genus 13
structure length 101
sequence length 101
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1dz5A00
3G71S 3DXBA 1F9FA 2FC9A 2CQGA 2MKIA 2RRBA 2CQ1A 1X4HA 2M52A 4QPTA 3FEXB 3CCES 5JVHQ 1JJ2R 1R8PA 1OPIA 2AD9A 1WTBA 1Q7YT 2DH9A 2KFYA 1OIAA 1X0FA 2M88A 5HO4A 2LXUA 4TLQA 2G4BA 2BZ2A 3J7ZT 3CCSS 2FY1A 3EX7B 1O0PA 2DGVA 2KVIA 2HGMA 2DGWA 2MGZB 5D77A 3MUMP 2YH1A 2GO9A 2MHNA 2HGLA 4IO9Q 3G9CA 2X1BA 3Q2TC 1U1MA 2RT3A 3CCJS 3TP2A 2YTCA 2MGZA 5GAHU 2CQCA 2QA4S 4OZ1A 3IRWP 3CF5Q 3J7YU 2LCWA 2RU3A 4WFAQ 2X1GA 2NLWA 4UY8T 1H2VZ 5DETA 5CA5A 5IM0B 1VQ8S 2KHCA 2MQLA 2RUGA 3G96A 2DNPA 5LXYA 1KQSR 2QEXS 5GAGU 1M1KT 4CIOA 1DRZA 3MOJB 2MZRA 5D78A 1NJIT 4F02A 2JVRA 5IM0A 3UD4P 1HL6A 5IFMA 2YWKA 3NS5A 1D9AA 3VAJA 5CXTA 1FJ7A 1Q86T 3I56S 2CPIA 2DHXA 1WHWA 3UD3P 3ULHA 2LECA 3CUNA 2D3OR 5HL7Q 2ADBA 1WHXA 3I55S 1ZZNA 1WEXA 2MMYA 4P6QA 4PKDB 1M5VC 2K8GA 2LKZA 4M5DB 1VQ4S 1A7GE 3H2UB 3UE2A 2MSSA 3VAGA 3MXHP 1KOHA 4Y0FA 2OTLS 2DNMA 1CVJA 1QVFR 3DLLQ 4QU7A 2DNHA 4C0OC 2ZJPQ 1R8HA 1SJQA 1UAWA 5GVQA 4TU8A 3PIOQ 2MPUA 2YKAA 3SDEB 3ZZYA 3VAFA 3BO3A 2BOPA 1X4BA 4CH0S 1U6FA 1VC0A 1XN9A 2F9DA 1YJWS 1Q82T 5DDPC 5DM7Q 3THPA 3IWNC 3SDEA 5MLCV 3NNHA 1K73T 1FT8A 4IOAQ 2SXLA 3G4SS 1HA1A 4W92B 5GAEU 1U1QA 4V19X 1SJRA 2M0GB 2E5HA 2XB2D 2CQ0A 2MKSA 2I2YA 2DO0A 3VALA 2MQOA 4W90B 1P27B 3K0JA 3CCVS 3RW6A 1WWHA 1OO0B 1X4EA 2M8HA 2MZJA 3LQVA 2MQQA 5LJ5Y 1L3KA 2DNZA 3OW2R 1VBYA 2DGSA 2MQMA 1N54B 3JB9k 1JJ4A 1VBXA 4OZ0A 3VAKA 3B4DA 2RQ4A 1G2EA 1SJFA 2M8DB 4LMZA 5LSOA 3V4MA 2LEBA 3LPYA 4Y00A 3UCUP 2AYEA 2F9JA 3P5TL 1YJ9S 1SJ3P 2CQ4A 3CULA 4YOEA 2MQNA 5DDQC 1K8AT 2HVZA 3BO4A 4A8XA 2L08A 2MKCA 2JWNA 2KI2A 1M5KC 2XS2A 2J0SD 5LXRA 2CPXA 3S01A 2RQCA 2N3OA 3R1LA 3CD6S 2O3DA 2DB1A 1YIJS 2OSRA 2OJ3A 2M7SA 1U1LA 1VQOS 4TU9A 2XS7A 2EK6A 2RVJA 4C7QA 1X4GA 4ED5A 1VC5A 3VAIA 2AYMA 2CPDA 4WKRA 3EGNA 1JMTA 2MY8A 3CCUS 2E5JA 3UCZP 1X5SA 2MZTA 1UFWA 2DITA 2DGOA 3NNAA 1N52B 2DHGA 1BY9A 1U1NA 1U1PA 1H2TZ 1UP1A 2VOPA 2QFJA 1WHVA 2MYFA 1YTYA 3NMRA 2KRRA 1M90T 4F26A 1K9MT 3PIPQ 1N8RT 2OSQA 2L41A 2A3JA 2KU7A 2N7CA 3UWTA 3CTRA 1VQ6S 1PO6A 1WF0A 1NU4A 4WFBQ 3BEGB 3SXLA 2KYXA 2DNRA 2LXIA 1U1RA 3HHNB 4TU7A 2B0GA 2LEAA 2U1AA 2AYBA 1W2BR 3CCLS 2VOOA 2DIVA 2L9WA 5BJRA 3BS9A 3MURP 1FJEB 2MZQA 5DDRC 1FJCA 2DNKA 1SJ4P 2E44A 5FJ4A 1M5PC 2M4MA 5GMKa 3P3DA 4QQBA 2MQPA 3ZZZA 1X5TA 1S72S 1M5OC 2MKHA 1VQKS 1X4CA 2ZJRQ 4EGLA 1YITS 2I38A 3CC2S 2U2FA 2RRAA 2XNQA 2JX2A 2G0CA 2J8AA 1U2FA 1VQLS 3G6ES 1HD0A 1SXLA 3MD3A 2DGTA 2CQPA 4CQ1A 3EGZA 1RKJA 2NZ4A 1X4AA 1QM9A 5DM6Q 2ZJQQ 1AUDA 1X5PA 3S8SA 3MI7X 2PEHA 4LJMA 2EVZA 4IUFA 4F25A 2F3JA 4LIRA 3NS6A 2VODA 1RK8A 3CCQS 1WI8A 3HI9A 2CPYA 5IQQA 3TYTA 2PE8A 5CYJA 1WG4A 1S79A 2MZSA 3H2VE 3G8TA 1YJNS 3CXCR 1H6KX 2AYGA 1Q81T 2KT5A 2RS8A 3B4MA 1VQ7S 2M70A 2JRSA 2LMIA 2HGNA 3G8SA 2DH7A 2LA6A 4UQTA 2KH9A 2DHSA 3NNCA 2CPEA 3CMES 1WG1A 4QU6A 1N88A 1VQPS 1B7FA 3CC7S 2FHOB 2M9KA 1URNA 2XSFA 2J76E 1KOOA 3S7RA 2DK2A 4RU2A 2X1AA 1WEZA 2G1DA 2ADCA 4J5OA 1IQTA 2OIHA 1NO8A 1WF1A 3R1HA 1VQMS 2RS2A 4WIIA 1JJHA 2FPHX 5LJ3Y 1X4DA 3RW7A 2Q79A 1ZZFA 3CPWR 2DHAA 1DHMA 2DH8A 2LA4A 2KG1A 2CJKA 2VONA 4C4WA 1X4FA 3Q2SC 2LYVA 1P1TA 5LSLA 3TO8A 3VAMA 3MD1A 3CCRS 2GHPA 1DZ5A 3L3CA 1YI2S 3VF0B 4FXVA 2MY7A 2K3KA 3R27A 2DNLA 2DNNA 3CCMS 2E5IA 2RNEA 2DO4A 2V94A 1VQ9S 3U1MA 1FNXH 1ZH5A 2CQ3A 3N9UC 2CQ2A 2N82B 5ITHA 5GADU 2MJUA 3THTA 2KG0A 3CMAS 4WFNQ 3MUVP 2MKKA 1VQ5S 2MSTA 2DNQA 2YH0A 2DGXA 3MDFA 2MKJA 5JVGQ 1KC8T 4YB1P 3UCGA 3P6YC 1QVGR 2HYIB 2D9OA 2KXHA 2KM8C 1VC6A 2KXNB 2CQBA 5H1SV 2CQHA 3SMZA 2KM8B 2CQDA 1FXLA 2EK1A 2OTJS 1VQNS 3D2WA 1WF2A 1YWXA 4ERDA 1U1KA 1WG5A 3CC4S 2M2BA 2N3LA 4ZKAA 2DISA 2DGUA 4PRFA 2X1FA 1WI6A 2UP1A 1X5OA 1U6BA 2MB0B 2DNYA 2CPJA 2J0QD 1YHQS 1DBDA 4FXWA 2DNOA 3S6EA 2E5GA 1H2UX 4CH1A 1U1OA 3BO2A 2JVOA 1FO1A 1WEYA 2HZCA 2CQIA 1UW4A 2CPHA 2CPZA 3FEYB 1WELA 2LQ5A 1HD1A 2KXFA 1VBZA 3MUTP 3P49B 2MZ1A 2DNGA 1FHTA 4Z2XA 2CPFA 5EN1A 1OWXA 4U67Q 1D8ZA 2FC8A 2WBRA 2XS5A 3U1LA 1A9NB 2ERRA 3VAHA 2D9PA 4WCEQ 2DIUA 5DDOC 2MXYA 3US5A 2DGQA 4PR6A 4IOCQ 1PGZA 4YUDA 4BS2A 4WF9Q 1KD1T 2XNRA 1WHYA 2MJNA 2KRBA 2KN4A
chains in the Genus database with same CATH superfamily
1OYDA 3G71S 4DSKA 3TW0A 3CCES 2D1CA 2F65A 3MWBA 2VQFJ 1TV6A 2DTJA 2KDOA 3ZO7A 4DSJA 2HK3A 4V1Ak 1H7WA 1HQEB 2B4PA 3QGPA 1NUEA 2X1BA 1AFJA 4ZIWA 2EG2A 4DV5J 4L3NA 1RKIA 3L7UA 4WBFA 2P9GA 3SBMA 3AJDA 5DETA 5HQLA 3N6LA 4KPCA 3OHAA 5JMNA 2ZH7A 4I69A 1ZAWA 1T9TA 3CJKB 4ZVUB 3M8ZA 1S6UA 1KLMA 4PPZA 2GGPB 1D9AA 3VAJA 3OBIA 2I5JA 2VJUA 5JXSA 3T19A 1EARA 3MTJA 2V4QA 1H98A 1MN7A 4PG7A 1NZAA 3T1HF 3VAGA 4DR3J 2ZZNA 4JYAJ 2C42A 3W8PA 5KG2A 2DNHA 5KFHA 4DR6J 4NLDA 4B3RJ 4LSNA 2LU2A 3KYLA 3GJTB 5THWA 3Q86A 4JI7J 2VFTA 3KJVB 1KFSA 4ZVFA 1R0AB 3KK1A 3ZZUA 4ECSA 3DOLB 2CNKB 3AA8A 2RH3A 3K8WA 1ZA1B 2A6OA 4NRTA 1ZAXA 2Y9HA 3TEHB 1FXDA 4C8LA 5D0EA 3MR5A 3ILJA 4ZLPA 3LPYA 2IA6A 3IRXA 2KZMA 3RR8A 2Z2YB 1CJUB 1NPRA 1F5BA 1WDDA 1WC5A 2B3TB 2O3DA 2DB1A 1FEEA 2YWGA 4Q8FA 3NBPA 2HRYA 1Y11A 1GMVA 5C42A 3M2VB 1TAUA 3CCUS 2F4VJ 3QRQA 3MAAA 2DITA 1BE4A 5E3CA 4F67A 4RKUC 1S10A 4F4ZA 4KHPJ 1JXVA 3PX0A 4DR2F 3R5DA 4DV6J 1H0HB 3DRXA 2DEJA 1B99A 2IRYA 1XEZA 1ZS6A 1PYSB 1S4EA 3R2CJ 2V2ZA 3N0VA 5KFIA 2VOOA 5K20B 5KFEA 3MURP 4ED1A 5HMYA 3KLEA 1VS3A 1QAYA 3NAIA 1K44A 4NLPA 2DEIA 2ZFHA 2VBXA 4U9RA 4MYTA 4YB5A 1RT4A 5M2PA 2NREA 1VQLS 1SXLA 3D5MA 4KAIA 4KV8A 5B0EA 2FHKA 4IUFA 2C2NA 2YNFB 2VG6B 1KWMA 3D1OA 1VHFA 5BYQA 2G1HA 2BRLA 4ICLA 3M32B 5F8GA 2LMIA 2IDEA 1LWCB 2NZCA 1IBKF 3SSSA 5HI7A 1HW8A 3M8WA 3TVYA 3JSBA 2BOAA 1S76D 4JI4F 1OMSA 1IQTA 4KBIA 4XAKA 4PABA 2M5YA 3TR5A 2VQEJ 4O3NA 4A4JA 4TVAB 3CPWR 2Z2MA 5KFMA 3C6UB 4HHJA 1NK6A 4L75A 1C1BA 5GAEI 2K06A 1RTIB 3GV7B 1EIYB 3DGPA 1WC1A 3HHLD 2E5IA 4QYZJ 3N4WA 3U1MA 2HVDA 3MECA 4QWAA 3Q8VA 3W5YA 4LFBF 2QIFA 4L76A 4OJGA 3RRGA 2DR9A 3P6YC 4K4ZA 5J1NA 3K59A 2IM1A 4O4GB 2CQDA 4F4WA 1RT2A 2V68A 4FF3A 1NKCA 3ZC4A 2UVWA 1FRHA 2DISA 4C3MA 2F63A 2AIRB 3PO5A 3FFIA 3IR6B 1S57A 3IC1A 2OAUA 1Q8KA 2FVRA 2W7OA 2LFVA 1K0VA 1C0TA 2X3DA 4DR4F 3HVWA 2NQPA 1RTHB 3U1LA 1SQEA 2APOA 3VAHA 4WCEQ 3VTIA 3MMJA 4KB7A 1EB0A 2KRBA 2AV5A 2VD3A 2RRBA 2CJAA 2GIRA 4I2PB 2NXUA 3BM7A 2J9EA 2DCLA 1WTBA 4HHUA 4G1PA 2YKNA 1Y4ZB 4HDHA 4W4MA 2XZWA 9RUBA 1S6QB 2GO9A 3DRRB 4ZOSA 3QSYB 1HQUA 2M3DA 2GHWA 3G87A 4WXOA 2D3UA 3CCJS 5KFYA 4FNHA 3TP2A 2MGZA 3N79A 5GMEA 4HKQA 4WTYA 4CT8A 1U09A 1M0SA 2B9YA 4R8UA 1CQMA 3MMCB 4ILLA 3BH6B 1ULRA 3JAMY 3MPYA 5AXNA 5L38A 1OYEA 4X64F 1QE1A 4QIEA 4ZJLA 4KY3A 1WEXA 4J9PA 2W7AA 1RCXB 4OJHA 3I32A 1B0TA 3L4BC 4RW9B 4JI5J 3JTNA 2OTLS 4IH5A 2ZJPQ 1VRQC 1R8HA 1SJQA 2CWKA 2R7SA 2HPUA 3LGHA 1D8YA 4IG3B 3SCJE 1LWEA 1VOMA 5DM7Q 1DURA 3QIPA 3HX9A 2C3MA 4LF4J 1B70B 3H98A 2DR6A 4OIXA 3KLGA 4NYPA 4ZVHA 1RT3A 2DO0A 5HROA 2M8HA 3QT7A 4K8RA 4X4VA 3JYTB 2ZH3A 1WKLA 4E0DA 4L73A 1RBAA 3MMAB 1HBNB 3RBEA 2YWHA 1D9FA 2XS2A 4QOTA 1FJGF 1U0HB 4DLGA 1T03A 1SV5A 1PJ7A 4FS1A 3T1YF 2RVJA 5LMUF 3K8VA 1BWEA 4IFYB 1EP4A 1X7VA 3EGNA 4LQ9A 4EO6A 1KVIA 4G65A 4K2JA 2XY6A 4HACA 3ELHA 2BKPA 5ETPA 4PUOA 2DHGA 1XNRF 3OVSA 3LP0A 1WHVA 4ZPCA 1KVJA 1YTYA 4CRJA 3EM1A 1N34F 3GFZA 1RAAB 1RB0A 2WBMA 2C2ZB 1QDUB 4YFUA 3IG1A 3OR2A 1H7XA 1NH7A 2CAJA 1M5OC 2MKHA 2YWFA 4LF8J 1FKAF 4KGXB 1PIEA 2IIHA 2J8AA 2DY1A 2DGTA 3AQOA 4RU9A 1YJVA 4M63A 2R7XA 3MI7X 3NGTA 2PN6A 1MMLA 2A2DA 3CJ5A 4LR9A 4YS2A 4DV0J 3DLBA 2FGCA 3TYTA 3NWGA 5CYJA 3LAMA 1DQ9A 1UVKA 2RS8A 1TVRB 2D74B 2NCKL 4IG0B 3Q23A 1MWQA 4WU2A 4KGMA 2VF3A 2H4YB 4DUZF 2VFUA 1TKXA 3TWZA 1WC3A 1SUQB 2EWHA 2R2TA 2VHGA 4DR5J 3CNQP 4LREA 3E01B 1R0BG 1DZ5A 1YI2S 5D4NA 1RWNB 4DPTA 1PYOB 2B5JA 1WC6A 1D0EA 3CCMS 2DJWA 4TYBA 5J1EA 2N82B 4ZHRA 3UN5A 3C46A 2EFPA 1LEOA 3RGIA 2MKKA 2EFQA 1RLCL 1WTFA 2FZKB 3SZ2A 1VDHA 2YBVA 4B9SA 3PX4A 4DL4A 3VR1A 5CD4A 2D9OA 2KXHA 2CQHA 4HEA9 5FIIA 1REVB 1U1KA 4URSA 4NLVA 5J2QA 3HHEA 2IA0A 4CYUA 1HNZJ 3ZNJ1 2FY8A 5KFZA 2VDHA 2OPQB 4O3SA 2JVOA 3NXZA 1CS4A 2HQCA 2ILYA 2OPSA 3H4BA 4DR7J 4U96A 2GW8A 2ZOFA 3R6LB 4UOFA 2UXBJ 5B7WA 2FC8A 2ERRA 5J2NA 4QR0A 5IT9U 4B3SF 3KXDA 2ZOMA 2LU1A 1K1SA 4J9VA 1HKAA 1MLAA 2GX8A 2WCXA 3A3OB 3QGHA 3TI0A 5JVHQ 1J5EJ 1R8PA 5F9NA 4EYIB 2ROGA 1IQZA 3PHEA 5HO4A 1I51B 4R5PA 4RW8A 5A8WB 4ANEA 5ETNA 4LF2A 4WU3A 4QWDA 1OS5A 3BSAA 4O0IA 4NOHA 1RWUA 4J37A 4PWDA 3M8QA 2UUBF 4DUYJ 1RAEB 4RW6B 3CDUA 2QLXA 2NLWA 3IP0A 1T9VA 1P9YA 3K5MA 1UKUA 1UETA 1VQ8S 2HNDA 1AXQA 2BMBA 4X4OA 1VRUA 3PVXA 4ANDA 2ZE2B 1SH0A 4OI6A 1PBUA 3DRSA 1YJ7A 4ECTA 3I56S 1YLXA 2I9SA 3HP6A 4KGVB 3OVBA 2Q3PA 1T9UA 2EKNA 1VLYA 2J0WA 3Q22A 3H5UA 3UE2A 1L5UA 2JEFA 2LQ9A 5L39A 4DV3F 1HBUA 2XMUA 3M9NB 3D1HA 3PIOQ 1Q0NA 2YKAA 5IT0A 2BKOA 2V50A 4QR2A 1U6FA 2OELA 1VC0A 4NI2A 4DFKA 2AKWB 4ED7A 1CLFA 2HZAA 3BKTA 1SL1A 1U1QA 4JUZA 3SFGA 2FLNA 2HQDA 3UNYA 2MQOA 3MPVA 3EZUA 3KK3B 5I3PA 1OO0B 3KLFB 3JB9k 1N54B 4BWMA 2EFVA 4XK8C 1SJFA 3QMQA 1ZM2A 4C48A 3UCUP 5H9FK 4IO1A 1S9EB 2ROEA 3CDAA 4OLOA 3M2RA 2IMOA 5C7PA 2RILA 3ZTSA 3R1LA 2R7QA 1BMQB 2AEJA 1YVFA 2RKIB 4NLTA 1FKPA 1RHMB 2O5DA 2MY8A 4TQSA 3OL9A 4URGA 4OQJA 2HQFA 4DX8H 4HR2A 2R7VA 2IC3A 4YQWA 1U1NA 3LF0A 1S1VB 4ED6A 2MYFA 1T94A 2UU9J 1TQLA 3L7OA 2RD5C 1HI1A 3W60A 3VHQA 4C8KA 1K9MT 1EKSA 1RAFB 5IT9Y 2N7CA 3T5JA 2W4DA 4ILRA 1B3TA 1HHQA 4ED0A 5AE2A 1V6HA 2VKRA 1VK3A 1FJCA 3MM5B 1G6BA 1PCAA 5KFXA 2H9ZA 2WW4A 5FJ4A 4LSZB 2KYZA 3CCTA 2MQPA 4QWCA 3J7YI 4CO2A 4UZBA 1NKEA 7FDRA 4TY8B 2XTJP 2XZTB 2PO4A 4P7VA 5IS2A 1X4AA 5LT5A 4JI3F 1AUDA 1X5PA 3S8SA 2HNZB 1X0PA 3W9JA 1NPKA 4KKOA 1FDDA 2VB6A 5ETTA 1RK8A 3QJPA 2VL1A 2WZ1A 4KYZA 3H2VE 3OHBA 1RTJA 3PHTA 1BQNA 2UXCJ 4LR8A 4FDFA 4USTA 4C8YA 1PAUB 5J1PA 3LUYA 1RWVB 1VCTA 4M1KA 2MLYA 3ZTOA 2ZM6J 3ETOA 2Q79A 4A46A 1RT5A 2J0XA 2GQQA 2HS0A 2NYIA 1GAOA 1VQ9S 3V6KA 2IBKA 1GTEA 3I0RB 2MQ8A 1HBMA 2ZHAA 4WFNQ 3K58A 4ED8A 4E98A 4WE1B 1VQ5S 5DQHA 5JVGQ 3PY8A 4B3TF 5KTQA 2WOMA 4F50A 3BPSP 2ZZTA 2KXNB 5H1SV 3DI6A 1S6OA 4NLOA 3MFHA 2BANA 2L9DA 1L3UA 1TFWA 4PRFA 3BKUA 3PW2A 3MMBA 1KSPA 2RF2B 3PJWA 2V2KA 1LQ9A 1FO1A 1FNMA 2A18A 2ZH4A 2CQIA 2JFDA 3T1HJ 1TU0B 2KXFA 4N7TA 4TQRA 4EBDA 2XGPA 5EHHA 2W8KA 3GJRB 1A9NB 3SSRA 1TKZB 1HPZB 4MKYA 1PGZA 4ECXA 3PNIA 2AT1B 2AP6A 1EETA 3DDKA 1IR1A 1WJ9A 5DZ7A 3TX8A 1H73A 1WDTA 4F0HA 1LWFB 5CYMB 5C25A 2VIHA 1R6VA 2M88A 2BZ2A 3EVOA 2XMJA 4HI1A 3NCQA 3IS9A 2MHNA 3D68A 1KBRA 3UDVA 4JV5F 4A8QA 4CH7A 1Q79A 3AH6A 3TEGA 4MFBB 4ZPVR 3T5LA 1D1UA 2AGOA 3RYLA 3I82A 5CA5A 1J2VA 1KQGB 2XSJB 2W9BA 3MOJB 1N56A 4ZN1A 3SFUA 3NS5A 2D41A 2QLWA 3WIVA 2Q6CA 5KT5A 1GXTA 4YDXA 3SIPB 2QA2A 3GCWP 2I6WA 1WHXA 2E1RA 2GCFA 1BQMA 4CNYA 2MMYA 5ETRA 4NZ0A 1HNXF 2CYYA 4UUWA 4OJ3A 5CYQA 4HH1A 3HZGA 1KOHA 4RNOA 4DR2J 4F3OA 1UA1A 3TUJC 3FDSA 1WACA 5E3PA 2FLLA 4FYDA 5KFDA 2GAHC 3IWNC 4CTAA 1NK8A 4KR0B 3OLBA 4C0HA 1SC4B 1R31A 1VGYA 3FKBA 3FGVA 3GJQB 4B9VA 1P27B 2VFVA 2EBGA 5CH7B 5E2QA 2BVZA 1Y3KA 2MQMA 3KTQA 4Q0BA 1GMWA 4WFXA 2W25A 2QL7B 2AGPA 1WUUA 2QLBB 2CPXA 2BQUA 4KO0A 3DKDA 2CADA 2UUWA 3MPWA 3J81j 2J7KA 1KVKA 4OLPA 2IM0A 1JLAB 1QSYA 2KL8A 3OR1B 1JJCB 1IBKJ 2UV8A 1JNZB 5J2MA 1NPPA 5HMWA 4HL9A 5K9FA 4JI4J 1KTVA 4NL5A 3FBEA 5C24B 4CLWA 3IMQJ 1RHUB 5DG9A 2PFDA 3IXQA 3QZ7A 1B4SA 2XZDB 1JLQB 1GNKA 2G0IA 1SC6A 3R5BA 2E7VA 1RU2A 1FJEB 3MEDA 1FRJA 4DL6A 1Q8IA 3DLKB 1FK9B 1NAQA 4LFBJ 2NR0A 1XMOF 1S5ZA 4J7CA 1G4CA 3TVZA 3C8YA 4OV1A 5KT4A 2Q43A 2XNQA 2H4WB 2FZCB 1R43A 2RUSA 2H1YA 3UQSA 3H0PA 2CJQA 3IWXA 4ZLNA 2PEHA 4DG1A 3CJRA 4DL2A 3T9NA 4F25A 5B0DA 1FDAA 2H3EB 2CIMA 3QT6A 2CPYA 2PE8A 4RO0A 1S1WA 5DG8A 3SI8A 2IMWP 1FRLA 4DFJA 1HFEL 2ZHOA 4DR4J 2WVEA 3BGUA 2GFFA 4EK2A 3HKZD 1N88A 2NS1B 4I64A 1NLKL 3W9IA 3NCPA 5L1IA 2OIHA 2IRXA 3MM7A 1JJHA 3AOCA 4F3MA 1DHMA 2X7IA 3M30A 4H4OA 5A8RA 2W4CA 3M2UB 3KFWX 3NEKA 2XI3A 1V3RA 2KHDA 3D4JA 1KNZA 4WYLA 4ZPWR 4NCGA 4GVLA 1L3SA 4BCAA 2BE9B 3IA0A 2YWWA 3IBFB 5EGYA 2ZH5A 3QLHA 5IWAF 5DG7A 4ERDA 2G2ZA 3FC9A 2PEBA 1V9OA 4QIWD 1VK8A 5KFBA 2VBYA 1ZM4A 4X4NA 4FXWA 4X64J 1H2UX 2BUNA 1TKTB 3HD1A 3PW5A 1VQSA 4EFAC 2CPHA 1RAGB 3RBDA 4KE5A 1RUSA 1RACB 4O3QA 4LRBA 1RT6B 3NKYA 4NLSA 3KK2A 3HCXA 3US5A 2R2UA 2IPOB 2MEWA 1IJFB 5L1KA 2XNRA 3OXLA 3C15B 2LDIA 2JLFA 1X8DA 1JJ2R 4C97A 5KFUA 4GKKF 5EWGA 2CZ9A 4YMEA 3J7A1 4USIA 1HMVB 2UUTA 1K0TA 3CJSA 3JTPA 3V5RA 1BWVA 4J9NA 4LF9F 3NGRA 3SQOP 1HQEA 3QO9B 1NJYA 2LCWA 4DHVA 2CRLA 4CO1A 4X4SA 3CEDA 3JS9A 1FJGJ 2QEXS 1DRZA 3C3LA 5BYRA 2VPZB 2B9XA 2GJ2A 1RWWB 3T1YJ 2YWKA 2EG1A 4WP8A 5LMUJ 2RIJA 2QYCA 5JUMA 3FUYA 2HZVA 2Y1IA 3DOKB 2OHDA 2GGPA 2E7XA 1ZBTA 2QE5A 3HHLC 1ZZNA 4F0MA 2K8GA 1TL5A 2OEJA 4M5LA 1XNRJ 1U6ZA 2HHSA 4Y0FA 2DNMA 3KKFA 2HLUA 2PDAA 5L9NA 1GMWD 1YBUA 2W2MP 3ENAA 1N34J 3NGUA 2W2PP 3DRPB 2I8EA 1JLBB 2GIFA 4K4WA 2V8PA 1NHVA 1R0AA 2R7RA 2OPRB 2JH3A 2QJ3A 1XBWA 2MQQA 3DOLA 4LR7A 1LW0B 1DLOB 3RBXA 3CJ4A 4PWWA 2BJDA 2GJFA 3D0GE 2ZH8A 5D3GB 5HJYA 1N36F 2KI2A 2J0SD 3CO9A 2RQCA 5K8OA 2BA9A 4NE9C 2XS7A 4DU8A 1D3WA 2B4OA 3GFXA 4C9DA 2BABA 2YQ3A 1W26A 3R7SB 4KIAA 4YY3F 1T95A 4FKYA 3GSIA 2BQ3A 4C8MA 3M2VA 3POTB 1U1PA 4ITSA 4JI6F 4DUZJ 2AZ1A 5HSPA 3HDSA 4WIQA 1TL3B 3IGNA 3KLHB 3FRZA 1GXLA 1D09B 1RHJB 1IBMF 4H4KA 7AT1B 2XHWA 3EVWA 1MMNA 1P9QC 2DNKA 2UUCF 5GMKa 4DV7F 1IR0A 3VGUA 4QQBA 4FN5A 3EZ5A 2XMAA 4DI6A 2V4JB 1VQKS 1N32F 4O23A 2I38A 2FB0A 2U2FA 2H65B 5KFPA 3PKYA 3UVJB 4LF7F 4D3GA 1AROP 2XMTA 4USMA 4P9SA 4I2QA 4NMLA 2L3MA 2VODA 4OHVA 2KVQE 5M2RA 3H20A 4DXLA 1WG4A 1S79A 3OL7A 2AYGA 1Q81T 2MHEA 2YNFA 4NA3A 2VG6A 8ATCB 4MK8A 1E6VA 2PMHA 1UZDA 3TAQA 3DYAB 5DS7A 3M32A 2PA3A 1LWCA 2ABYA 2V6AA 4N8NA 2QFIA 4B3SJ 2ADCA 3NG8A 1NO8A 1WF1A 3DHXA 4K7QA 2JJ4D 1H38A 4BC7A 1OPZA 3UR0A 3CT9A 3EYZA 2DHAA 2CJKA 1FRIA 2AJ4A 3C6UA 4P2MA 3RG6A 1M5SA 1RTIA 4CWBA 3KDOA 5EWEA 2CQ2A 1KR4A 2KG0A 3UFCX 3OTOF 3NGSA 2UUBJ 3EXCX 1KLNA 1KC8T 1I3OB 4ELVA 4L6V3 2ZWPA 3BBCA 5KT2A 5B08A 1DJ0A 2AMCB 4CLFA 3MEKA 1OJ4A 2KKHA 4O4GA 2ASJA 2KO1A 4ILMA 2MB0B 2ZH9A 2WVBA 2J7UA 2CKWA 3K7RA 1HWKA 3MM8A 4X84A 3UPFA 3HFKA 2HFOA 1FD2A 3J81U 5KFOA 2MZ1A 4DV3J 3AHPA 3G6YA 3TJ8A 1GMUA 3N5FA 3MEGB 4IOCQ 4Y2KA 4EWTA 4QPTA 3ILIA 3LO3A 1TL1B 1DTQA 2XHCA 2YNHB 1Q7YT 4M5MA 4I2PA 3G86A 1YZ6A 4FPIA 3KNAA 3CD5A 4URQU 4DX5A 3G9CA 5IC4B 3BH7B 1Q8LA 4DUTA 1W2IA 2QA4S 1S6QA 4DWIA 4G6VB 3DRRA 2C28A 1YRXA 4DBQA 5HN0A 3TAPA 2LP4A 1U24A 3CCWA 2D3O1 4USUA 3VVTA 3U7JA 2QG9B 2C2RA 5D78A 2YNIB 2VPXB 3CJ2A 3MMCA 3D1QA 4CLTA 4QWEA 4DL5A 1DARA 3G6VA 4IKAA 5HL7Q 3NCRA 1Q5VA 1MN9A 3HHLB 2R9LA 4ZCKA 4J9KA 3GCXP 4MIAA 1U47A 4C3LA 2FJWA 2ZBPA 4ECRA 5GVQA 1YSJA 3HJVA 4RW9A 5IQ6A 3FEZA 2E5LF 3BZQA 4PXCA 4X2BA 2F9DA 1IN0A 1NM2A 4Z7YA 4IG3A 3W63A 1RADB 1CPZA 4ED4A 1ITPA 1I5OB 3B8HA 3FRYA 2HWIA 4J9OA 2Z8QA 1X4EA 3PKMA 4RW7B 3B4DA 2LQBA 3GYGA 2FIUA 5AE1A 1SL0A 1NSPA 3JYTA 5KT6A 2XG8A 3NGDA 4OI0A 4JI3J 2MKCA 2JWNA 1HBNA 1EHWA 4ZVSB 1YIJS 4GMKA 4ENOA 4TU9A 1VLOA 1ZM9A 2YPZA 1TFYA 4ED5A 1VC5A 1U0HA 2CUYA 4MKAA 1JMTA 1UFWA 1HW9A 4IFYA 4X66F 2HRUA 1N52B 2R8GA 3ONQA 4WPAA 2IBOA 4U6PA 4QR1A 1N0UA 2OP5A 3WX4A 1UEKA 2EFOA 2W2OP 4G1IA 4A8YA 5DJBA 1Q4RA 1Z2ZA 3JXOA 5F41A 3R8YA 1H74A 3K5PA 2IVYA 3GFHA 2M4MA 5HJXA 3I0SA 3RAMA 2Q6BA 4PG6A 4B3TJ 1YITS 3MGJA 2BJ3A 4CM2A 4KHRA 3D0HE 2WB1D 4G1QB 1RTDB 4NLQA 3EGZA 1QM9A 5KFGA 2JDJA 2RE1A 2B43A 2V2VA 3AT1B 2B51A 3BJYA 3AOAA 1Z1ZA 1Y7PA 4TNOA 4CT9A 4ECYA 3B4MA 2ZC3A 2LA6A 4YR2A 1FVSA 1TVRA 1B0PA 4IG0A 3PRVA 3UD5A 3HK2A 1WEZA 1Y10A 2HMIB 1RYRA 1BXNA 2OGUA 3QQCD 3GP9A 1IWGA 2H48B 3Q2SC 1FFGB 1P1TA 2JEJA 3VAMA 1SUQA 1JLCB 2JC0A 2Y8YA 3VF0B 2FDNA 4A8MP 4FVCA 1S4FA 3E01A 2V94A 4OI1A 2BX6A 1E6YB 3HKWA 5FLXU 4NLUA 2V2QA 3W5XA 1YX2A 4C98A 3TARA 4JV5J 2HS4A 4DX6A 4MH8A 3MAQA 3FCVA 3BYPA 3HXMA 1JX4A 1YBAA 4NLXA 3AD7C 4Q43A 2R8KA 2DRBA 4N47A 2N3LA 5EUHA 2FVQA 2DGUA 1REVA 3PCOB 1C0UB 3QJLA 4KV8B 4I6WA 2ZBIA 1GEHA 2DNOA 4CH1A 1U1OA 5KFQA 3RBZA 1HNXJ 3Q8PB 1AYEA 1PC5A 5B0FA 1R8AA 2OPQA 2IJFA 2QLJB 1D8ZA 3SV4A 2UZAA 4E2FB 4N76A 4OHZA 5DDOC 3LP2B 1VMBA 4BS2A 1SI9A 3N28A 2PT0A 1W7WA 2GIQA 3FEXB 1S1XB 3AY0A 1UTAA 5BR8F 5CQGA 1OIAA 2LXUA 4CLSA 1T05B 3AJ2A 1QJHA 4WXWA 3W9HA 2DR7A 3DGPB 4P75A 3V6DB 3BN7A 4NLRA 5A8WA 1XR6A 1UWBB 4OZ1A 2RU3A 2X1GA 4HLBA 3D54A 4UY8T 3BR9A 3R5GA 3R9LA 4B9TA 1JLFB 4RW6A 4OYAA 4Q2MA 2E1MC 1S12A 3OL8A 2Y8WA 2ZE2A 2LECA 3CUNA 1F6TA 3V4IB 3DCAA 1B0VA 2NPFA 1ZA2B 4UQGA 3R3TA 2AHOB 1VQ4S 4EMDA 3C19A 3ZFVA 3TZYA 1RE1B 1V5VA 4JBCA 1HBOB 3DLGB 4DJBA 1N6QB 1RSCA 3SDEB 3TUPA 1C4AA 3IFEA 3TA2A 1YJWS 5AXLA 4DSEA 5K8PA 2E5HA 1RWKB 3C66A 2GHVC 2W9CB 3RW6A 2ZVSA 1TL4A 1VBYA 2WSFC 1XMOJ 4XDCA 4OZ0A 3KLIB 4UTGA 3KK3A 2C3OA 4FVMA 4RUBA 3KLFA 1YJ9S 3LANA 2KT2A 1QD1A 4NLWA 3TZXA 3ENVA 1QY7A 1BUXA 2IAJB 4NLGA 1Q78A 1S9EA 1WC0A 3ETMA 4CLKA 3VAIA 4ZJOA 1VQYA 3I9ZA 4HT7A 1MMDA 1WKKA 3C14B 3W65A 3X3UA 3DOMB 1SKRA 4U7CA 4CO4A 4C2MA 3A8EA 4ECUA 1A6LA 2BE2B 5I4MA 1QSSA 4HT5A 3BGOP 1BQXA 3QWUA 2QT7A 4ZPBA 3DLEB 1TR0A 2A1BA 3FMWA 5LMNF 2L48A 2ZBQA 4MKBA 1K1QA 2BM0A 3UN2A 1JLGB 4CDIA 1YBTA 2GNKA 3UO0A 3M9OB 2YVSA 1YZ7A 2YX7A 1FI4A 1YKWA 4KGZB 2VBZA 3MM5A 1X5TA 4F8RA 4TYAA 2OO4A 3FVYA 2CVEA 4DQPA 1NHUA 2CZVC 3EZOA 2V8VA 5A8KB 4A8KA 4ZVRB 5IWAJ 1RWXB 4MIWA 5KFAA 2GMJA 2EEYA 3M8PB 1FE4A 4LIRA 3CE8A 3PM9A 2HNZA 3CJ0A 1IKVB 4AE5A 3A12A 2MZSA 3G8TA 3E3XA 3IO1A 2DH7A 1IKXB 1R3NA 3GJSB 4LT6A 3EDRB 1N0VC 4QU6A 1EP4B 4M5GA 2ACMA 5KFJA 1URNA 3EJMA 2DK2A 4HACB 4UOCA 3G8QA 5B0GA 4DOZA 2E7WA 2EBEA 2VONA 4QBUA 1UJ4A 2QC3A 3CO0P 1RAIB 4GKKJ 2OEKA 3BN4A 1M5HA 3GQCA 1XWLA 1NBEB 4NZ6A 5KFVA 4HTIA 2HQ3A 4O3OA 4PYAA 4OYZA 3W62A 5GADU 1TL7B 2XWXA 3MUVP 4JI2F 4LF9J 3Q8UA 3I0RA 2LLZA 4ANCA 2Y3YA 2CQBA 1R8CA 1VQNS 3NWRA 3F41A 1RP5A 1FWLA 2YKPA 4RBVA 4EZ6A 2MDAA 4XTTA 1X5OA 2C2OB 2J0QD 3EVMA 3ZXWA 3G82A 4C8OA 4GKJF 3QWPA 2HHUA 3HVTB 1SIWB 3WZ0A 2OEMA 4IQMA 4F2RA 3IAM9 2RF2A 1HIYA 1MW7A 4WFZA 5CABA 2RHSB 2FGOA 1LV5A 2A0FB 2HNYB 3ENWA 2QZ8A 3ITHB 4ZPDA 2DIUA 3SV3A 5I3QA 5ETKA 3IBWA 2CA9A 3H2LA 3W5ZA 1TKZA 5H9EK 1F9FA 1HPZA 2M52A 3G6XA 5F8NA 3QNWB 4MMOA 1KHWA 4J9SA 1LWFA 1FVQA 1GFWB 2NXNA 1RJJA 3J80Y 5MAOA 2B8QA 3CB4A 2YH1A 4ZITA 3KUHA 1OY6A 4LRAA 4Q2LA 3I31A 3D6MB 2JL9A 1MROB 4NXMF 3SCLE 3OD2A 3CF5Q 1FWKA 4EEYA 2EFGA 3JSRA 4Q44A 3LPEA 3EGVA 3VGTA 1N36J 1OY9A 3Q83A 1NSAA 4EBCA 4MFBA 3EDQB 2VUGA 4ZLLA 4WZMA 4F02A 1Q53A 2HFVA 2BQRA 1ACMB 1HL6A 2XSJA 3GIIA 5KOXA 5F8IA 1QUVA 3GR0A 3HF5A 1SVDA 3T5HA 4YY3J 2ZKUA 1G3OA 2GO8A 5K8MA 1IVZA 2HHWA 4UUXA 1F3FA 1HHTP 3WC0A 1UZHA 4JI6J 3GMGA 3DLLQ 2ZD1B 1WOSA 4TU8A 1JK9B 4ZA1A 1NH8A 3ZZYA 3JQJA 1QTMA 1B64A 4ZVTB 4NRUA 3CSKA 3PG9A 5KG7A 1IBMJ 5J2NB 1U49A 4X4PA 3KHHA 3Q0AA 2CDRB 2R4FA 4KJIA 1HR0F 2M0GB 3DMJB 3EICA 3HJFA 2UUCJ 3OFFA 2MZJA 4DV7J 2K7JA 2DNZA 4B9LA 1T8EA 3JTOA 3HT0A 1N32J 2RQ4A 3QPIA 5HAOA 4LF7J 1NMEB 3DU6A 2WW8A 2VG7B 1A0OB 3BR8A 4ZLJA 4Q5VA 2H54B 2RU9A 2WRMA 4WZQA 2GC8A 2HRTA 4K4TA 2PC6A 4C7QA 2AYMA 4ZVEA 3MR6A 4U8YA 1VRUB 4HHHA 3EPGA 4EUVA 2WB4A 1F2GA 1JLAA 1PKUA 3OR1A 3K17A 3B6BA 2KFZA 3MTKA 1LFWA 1BY9A 3MPDA 4IQXA 2AEFA 4B3MF 1IM6A 2AJFE 1S49A 3NGKA 2W7PA 1RBLA 2UUAF 4Y2AA 2IJRA 2BM1A 2OD4A 4WP3A 3KHGA 5HMXA 3Q89A 4ETXA 2B6AB 2ZH2A 5C24A 2DNRA 4TU7A 4WJBA 4UOHA 1T9WA 1RHKB 2LEAA 2XGQA 2ALZA 4CM0A 3I87A 1JLQA 1X31C 4NI2B 4G3IA 3RU0A 5F8MA 3OTOJ 4QZVB 5T41A 5HVGA 5D4PA 6AT1B 1M5PC 1IJEB 4JV1A 1Y3JA 3ZZZA 3CIMA 1S72S 2WVDA 1W25A 3DLKA 1FK9A 4EGLA 4C8ZA 1HWJA 2YX1A 4IDKB 1YJTA 4CLLA 3TVKA 1YDLA 1HYSB 4CQ1A 4KT0C 1UVNA 4PXDA 1VRTA 3ET6B 4KFBB 2J8SA 3HMJG 2LQ8A 4B08A 2V63A 3CW2C 1M1GA 3IR5B 4NPOA 3JSMB 2EW9A 1UL3A 1H6KX 4UQTA 1JB0C 3W64A 2JLEA 5J2PB 4JV0A 1EZZB 3CC7S 5IV3A 4ZS6A 3FSXA 4PEOA 4CI0B 4DCPB 3CIZA 3LGMA 4AFFA 3E2EA 4Y28C 4LBHA 5LJ3Y 2CXEA 2KG1A 1RXOB 5IC6B 2JFKA 2QA1A 4ZDNA 1G1XA 2FJVA 5I42B 3R27A 3QATA 3N9UC 3M2UA 2O1PA 4DCOB 5A0YB 2V9KA 1LW2B 2JZ5A 2HHXA 2DRAA 3VCDA 3LGNA 3GIKA 5G0RB 2KZZA 2EK1A 3BGFA 1R27B 4NLYA 4ED2A 5DGBA 4ZKAA 1G7CB 1PBAA 1MNEA 1RWPB 4PG4A 4ECWA 3PEJA 4ZVQB 2OFHX 3LP1B 3U02A 2C22A 2F5GA 1TELA 2E66A 2QMUB 2CFXA 1WELA 5HQMA 1TKTA 1U2RA 2KB2A 3BBBA 2WBRA 3RAQA 4ZVOB 1S1UB 4LBIA 2E5LJ 1RTJB 3QYYA 2DGQA 5E33A 4B02A 2VH7A 1SPBP 2H5EA 1KD1T 3L9ZA 2MJNA 1F9EB 3UW1A 2YKOA 2E9RX 1BD6A 3CVKA 4EBEA 4MYUA 3VWSA 3D0IE 3QIDA 4J9LA 3J7ZT 3QZ8A 1O0PA 1TTHB 1KFDA 1AT1B 4CO5A 5D77A 3Q2TC 4OFZA 4UZCA 3D67A 1HMVA 3M6WA 5E7OB 2IYIA 2CWXA 4NMXA 4NZ7A 5CZXA 1F0XA 2QTWA 1NSKL 1XMBA 4Y6IA 2V34A 3QO9A 3OJSA 3M8SA 3TNVA 2DNPA 1Y5IB 3W2WB 3J7AN 1NSQA 2WOMB 4I6YA 4KHMA 2PI5A 1Q86T 5KAKA 2XYGB 3ZZ0A 5B0CA 2VC1A 1U02A 4NEZA 4X66J 4ES2A 3DOKA 3MXHP 5H9FJ 1F5AA 5BYSA 1QVFR 4DPYA 3SYZA 1UVMA 3BO3A 5F8JA 1ZETA 5L9XA 5D6GA 2QSFA 2ROPA 3N01A 2D7SA 2V0NA 5F3TA 3AFGA 1HA1A 5GAEU 1BC6A 4ELUA 1Q16B 3DRPA 3DDNA 3VALA 3V2UC 1JLBA 1FNOA 2BJEA 1L3KA 2DGSA 1JJ4A 3MM9B 2OPRA 4OYPA 3VAKA 4AXJA 1U2CA 1CULB 4TLRA 3KJFB 3DFEA 2F9JA 4ZP8A 2CQ4A 3IS9B 1LW0A 1DLOA 4I7FA 3BO4A 4R0JA 4OZJA 3FZ2A 4K0KF 4DZDA 3DGVA 3S01A 1Q5YA 5D3GA 1T3NA 2OJ3A 3EXYA 4F4KA 1R8BA 2C2KB 4X65F 3UR3C 1UW9A 3QGIA 3Q24A 2NSCA 3GG1A 2VU5A 3NY0A 3POTA 3O1LA 2KRRA 2OSQA 2HVIA 2DPJA 2ZDOA 2AJ2A 2BEFA 2W9AA 1ZTWA 3BEGB 2KYXA 1TL3A 1S9GB 1CJVA 2UXBF 3KLHA 4ZMMA 2RRNA 3E51A 2E1CA 1MU2B 2E44A 1UFLA 3HSZA 1S0OA 4O0NA 1SQGA 2ZJRQ 4M5KA 4RZRA 4QIFA 4A48A 3DXSX 2Z4PA 2V4JA 3G6ES 4FYWB 2Y1RI 4DZ6A 4Q0BB 4O44B 1RKJA 4RWWA 2NZ4A 1IKWA 1XERA 1XNQF 3UVJA 3QFHA 3D9BA 4NWBA 1NDPA 4LJMA 4WP9A 3RR7A 3LW5C 3CDWA 4LF5F 5IZHA 3KNGA 4QW8A 4RW4B 2IFXA 1L3TA 2XLJA 3H42A 2QO3A 1OQ3A 4U7UK 1AB8A 2JRSA 3IWLA 5KFRA 3T41A 3A8IA 3CMES 4K4VA 4AUKA 2EC0A 4XPCA 2Y1JA 4CO3A 5I3UB 3OSPA 1UFKA 1FKOB 5IV4A 4IRKA 3DYAA 1NCLA 3FBCA 2W2NP 3K89A 3TZZA 4F04B 4XIUA 4J5OA 1Y0HA 2E1PA 1VQMS 4DN0A 3R7NB 2F40A 3RW7A 1Y00A 2LA4A 1WORA 5KFLA 1ZTTA 2DY9A 2XMKA 4ZP7A 3MEEB 4KH1B 2IY5B 5BR8J 4K4UA 3NOGA 4FXVA 2MY7A 3I6PA 1IUJA 2X3GA 1TZ0A 3A13A 4U7UD 3W7BA 4N77A 1EX8A 4H4KC 3MF5A 3M6XA 4QW9A 5T14A 2PMWA 3MDFA 3MEDB 4YB1P 2O01C 3HLUA 3FJ2A 1QSLA 3NLCA 3SMZA 2E9TA 3CC4S 2M2BA 2AX0A 4JI0F 1FA0A 1U6BA 4WYWA 2AWZA 3GLJA 3TRGA 5KG5A 2HZCA 2NXCA 2W1BA 3PW7A 1UEUA 2MLXA 4PG8A 1FHTA 2LVWA 5KG0A 1RU1A 4KQZA 1F1BB 3UDLA 1UVLA 3A8KA 2UXDF 4YUDA 2V9WA 1S0NA 3MEGA 5HLFB 2A2CA 2H5IB 2CJXB 3HHDA 4PXEA 1NJXA 1N33F 1RT1B 1H3DA 1VHIA 4TLQA 3RB0A 1U8SA 2ZUAA 4PQUB 1TL1A 2HBRB 2YNHA 2KVIA 2WK4A 2WSCC 1RTZA 3KMQA 5HMZA 2YTCA 2PMZD 1R0CB 4P52A 2BKNA 3K5OA 2N4CA 4YP3A 2K7KA 2E1AA 8AT1B 1KQSR 5F9LA 4CIOA 2OPPB 3MPUB 2DXDA 1YJUA 5EX0A 1FRKA 3OV7A 1XIQA 4EI2A 3AJ1A 1CSJA 2BW2A 4OYOA 1ZYQA 2COLA 2FVSA 3HSDA 3W2VB 3L7PA 2P2CB 1SH2A 2B9WA 1TK5A 5A2QU 2FJEB 2V5HG 4AL5A 4USKA 3H40A 1P1LA 3GIMA 2FHMA 1Q82T 4PAAA 5LMNJ 4ECQA 4NCAA 1WD6A 3C16B 2B56A 4I4BA 4YB7A 1KHVA 1SJRA 3FQKA 4W90B 4AT1B 4NA2A 3AAWB 1RAJA 1J5OB 3OQ2A 4IH6A 1S77D 3KG1A 4AQYF 1G2EA 3GWCA 1T02A 5HVFA 1GXUA 4RW7A 5D0GA 3ZTPA 5AJ3F 1NHKL 4X4QA 1XQIA 2H51B 2MLZA 1P8GA 2OSRA 3HULA 4USWA 4TXSA 2VJVA 1X4GA 3DNCA 3BYRA 3R7BB 1FERA 5KFSA 2C3UA 2R2SA 1NNDA 4QPXA 2VKZG 4C8NA 1VJWA 1FF2A 2MTLA 2GS8A 3OL6A 1PAEX 2ZZMA 3NMRA 4DL3A 1M90T 1P6TA 1RAHB 2A3JA 4A8SA 3SQGB 3HVRA 2X51A 4HI2A 1LKZA 3V6JA 2B0GA 4OI2A 3CCLS 2EPIA 4IRDA 4HTJA 1RT7B 3P96A 3DM2A 4JI2J 3C2PA 3BSNA 4DQQA 2CJ9A 5KFCA 4OZLA 4PQAA 1NEEA 2P6TA 4F3QA 2BJ9A 3DLHA 3M4XA 1HD0A 3MD3A 1HARA 3OXFA 2PIIA 3ISND 4LVNP 5C5JA 4K4YA 2BW7A 3DN9A 4G1QA 1RTDA 3OT9A 3QBCA 1S9FA 4WTOB 5K5MA 4GKJJ 2FQQB 1SL2A 1RWOB 2MKYA 2WHOA 1REGX 1ICEB 3VQSA 2GJIA 4LQ3A 2DHSA 3NNCA 2QMWA 5A2QY 2DCUB 2ZHBA 2EXUA 4Q8EA 2DPIA 1HNVB 4OYMA 4DF4A 4RU2A 2X1AA 2CZ4A 3R1HA 2QV6A 2HHHF 3AQPA 4ECZA 4FBUA 3CDBA 2HMIA 4PPDA 2QL9B 2R8HA 2DNNA 3GU0A 3GTYX 3F44A 1JLCA 1N5QA 2CQ3A 4RNNA 4CLYA 2PD1A 2DR5A 2MJUA 1E6YA 5K14B 4BHQA 5HQ8A 2MSTA 2Z0GA 4NXMJ 3PXGa 4X62F 1HQ2A 3IR7B 3RRKA 2GQ2A 2RJZA 1K47A 2P5VA 2Z57B 1WG5A 1UJ6A 2RDIA 4OX9F 2X1FA 2RMLA 3WBZA 4ZIVA 3I5AA 4BLGA 1ZAVA 3UNGC 5T7LA 2GVZB 4I2QB 1C0UA 1UW4A 3KG0A 3MHYA 1O51A 2LQ5A 4P71A 3JAMU 4U67Q 3JQMA 2HQGA 3Q8RB 1CJKB 3LA0A 1C1CA 4JI8F 2MXYA 3T9ZA 1E6VB 4ID5B 4PR6A 1AFIA 5HP1B 2HAIA 2Q66A 3RAXA 4OYBA 1RBOB 4FNIA 3DLJA 3LP2A 4HDGA 2CQGA 4B9MA 2CQ1A 3GV8B 1N5YB 3PACA 1OPIA 2AD9A 1HR0J 2NPIA 1S1XA 4DF8A 1FE0A 4Q7AA 2HGMA 2G13A 1JKHB 2XLIA 2XI2A 1U4BA 3H8YA 3L95X 1T05A 2RT3A 3J7YU 3V6DA 4OX8A 3OFGA 4Q45A 3MR7A 3EGWB 4K59A 5IM0B 1T3OA 1UWBA 3G96A 3RZAA 3AD9C 1VI7A 3ADAC 3VGVA 2JVRA 1C4CA 1JLFA 3KLVA 5CD4H 1RHRB 4KGKA 4LFCF 1T9XA 3H5YA 3ZTQA 2B4UA 2QA4G 2JSXA 4M5DB 3V4IA 4M95A 1TUGB 1WSVA 3TQEA 4B3MJ 3GFYA 4QU7A 3PR5B 3MM8B 1UAWA 4J9RA 3Q8SB 4ZK7M 2UUAJ 3KUGA 3VAFA 4WK1A 3P4UB 4QCLA 2WVCA 5ETLA 1HBOA 3DLGA 4OHWA 1N6QA 3SDEA 3NNHA 1Q7LB 4WFYA 2SXLA 1HWLA 5LM7E 3G4SS 4W92B 1N5SA 3X1LB 3GSDA 2XB2D 2CQ0A 2YNGB 2W4PA 2P6SA 3PRDA 1FWPA 1DTQB 1XTZA 3FSIA 4QIGA 2W9CA 4LMZA 1NK7A 4Y00A 4USJC 2AQ4A 3KLIA 5KOWA 3CULA 1Y5LB 4A8XA 1URRA 2CNNB 5KFFA 4FXDA 1S0VA 1JLEB 1RA6A 1VQOS 2EKYA 2NSBA 2EK6A 2IAJA 4J9MA 4NA1A 4K4XA 2CPDA 3MFIA 3RB3A 1XK8A 1O8BA 3FQLA 4RNMA 3UCZP 2Q1LA 3OSNA 4CLZA 2DGOA 3NNAA 2HHPA 1VIOA 2HAFA 1DTTB 4EO8A 2YKMB 3C14A 4L74A 3HFZB 3DOMA 3LOUA 1N8RT 2KU7A 3NMAA 1PO6A 4MKVA 3OUYB 4FYYB 1S48A 3E8OA 3G2XA 2BE2A 3UDEA 3HHNB 4DDFA 1XC9A 1SC1B 3DLEA 3HPOA 2HHVA 2U1AA 2DIVA 4CCHA 2R42A 2WONB 1IKYB 2RDJA 3L09A 2VG5B 4O4RA 1JLGA 5E3AA 2DD8S 2Y0BB 4DV2F 4JV2A 1HLWA 4FYXB 3RTVA 1RA7A 2ATLA 2G0CA 2AJ1A 1U2FA 1KP6A 3QT8A 1JXEA 5A8KA 3GR1A 3NS6A 2XCAA 3M8PA 5IQQA 1FTCA 1CJTB 4DV4F 1AZSB 3AXMA 4OMFG 3CXCR 1S59A 4YN3B 4AL6A 3H59A 1IKVA 4TY9A 4DL7A 1V5IB 2BJ8A 3ZZRA 1T9YA 2RSQA 2OKQA 1IKXA 3D6FB 3RB4A 2ZDPA 2XSFA 1UEVA 1KOOA 2XYHB 2J9DE 1DAXA 2HHQA 1NKBA 4U95A 1XJWB 5HBMB 2VDIA 2RS2A 3RB6A 3WIUA 2FPHX 2DH8A 4Z37A 4OV6A 2HQIA 3TUIC 4FF2A 2BRKA 1T11A 3R6GB 2C3PA 4GVBB 4N8OA 3D6TB 4OZ2A 4B9NA 1EAYC 3ZTRA 5ITHA 5KT3A 4ED3A 2AZ3A 2DNQA 3BQ2A 1GX6A 2MKJA 1TL7A 3RRHA 4A8OA 2Y1LB 2RQKA 3CJKA 1S6PB 3ZZPA 2HYIB 2KM8C 4JI1F 4OZ5A 1WOOA 1UA0A 3I0SB 2OTJS 1WF2A 5SZTA 3PW0A 4D3HA 1BHNA 2J5AA 2V8HA 5D4LA 4H4MB 4LF6F 2HKEA 2GQCA 1MWYA 3AA9A 4JOUA 3GZ7A 3IBCB 4QYZK 3HVTA 5ADZA 2DNGA 3GILA 2R8IA 4CO0A 3KJVA 5F8HA 2D9PA 2ZITA 4WF9Q 3FNNA 1U25A 2HNYA 3RUBL 3ITHA 5KFNA 3OVAA 2FC9A 2JNJA 4B9UA 1SJ1A 2N4DA 2HG4A 3A3PB 2R3VA 1X0FA 3H7HB 2ZH1A 3O8WA 2G4BA 4C11B 1U8WA 3OXGA 3IM8A 5C2GA 3IGVA 3KJNB 1S1TB 3LH2S 3MM6B 4PCQA 1KKHA 1CJUA 3UDCA 2IDLA 2IYGA 5L1LA 1MROA 2KHCA 4K0KJ 2MQLA 2RUGA 4P2XA 3O6QA 1LNQA 1NDKA 3DRYA 1QUPA 1I94F 2LQJA 5LL6d 1NJIT 3ICLA 4R0EA 5CXTA 2HEKA 1QAIA 4X65J 2XY7A 1ELOA 1GK8A 1N5VA 4NXNF 4P6QA 1M5VC 2B4VA 4IOBA 4P2SA 1M1HA 4UY85 2XO6A 2BJ7A 2ZD1A 3MR2A 3HFVA 5D8HB 1KEKA 2DR8A 3TAMB 4ES3A 2DKOB 1T0TV 3DDIA 4IFVB 3FK4A 5EWFA 1BLUA 4L72B 3ZZTA 3BSOA 3OTCA 1NJZA 1L3VA 1WWHA 4KSEB 3DMJA 4I1TA 4LSLB 3KDNA 1X9SA 1APSA 1PYTA 1HNWF 2BXJA 2UVVA 4I0WA 3P5TL 5U47A 3I4PA 3I5BA 1K8AT 2HVZA 2AF6A 2NUUG 4Y2CA 2L08A 1XNQJ 5CAAA 4Y2MA 5FD1A 4LF5J 3PEHA 2VG7A 3FCWA 2XLKA 4C3KA 1SKSA 1HNIB 4YHHF 1RQ0A 1UWAA 2DYAA 4C0BA 2VFSA 4NYOA 3HO1A 5LOQA 3HT3A 3KWMA 1H2TZ 3K2YA 5A76A 2K3IA 4F26A 1PSDA 2OLWA 4H54A 4RNHA 2L41A 5IT4A 2ZVIA 3UWTA 3CTRA 2IM2A 1DQ8A 3LWMA 2G2OA 1HWIA 2J6SA 2ZEJA 3FBFA 2PSZA 2VC0A 2B6AA 3TANA 5B09A 2MZQA 4QYRA 3WDOA 4F4XA 2LDYA 4CZCA 3KHRA 1KQFB 2CJYB 1HI8A 3N6MA 3D3CJ 2ZKTA 2ZBRA 2FJAB 2J9CA 1YG0A 2CNLB 4GC6A 3UN3A 1TUVA 4Y65A 2GMHA 3OTBA 3AB2B 2CQPA 4RUCA 2E9ZA 5DM6Q 2HFUA 4IDKA 2ALYB 4JI0J 1DQAA 4F4YA 1HYSA 4ZJQA 2WAQD 3P8BB 3HI9A 3V81B 2F8EX 1SH3A 2FVCA 5FDLB 3ET6A 3N6NA 4KFBA 2FLOA 4FPRA 1F5CA 1RTHA 1YJNS 2HBQB 8RUCA 2KJWA 2OFGX 2G2YA 5D0HA 2GVDB 4LRFA 3BGRB 3JSMA 1HWUA 1FFSB 3O44A 3T1AA 3GE9A 2K1RB 4OX7A 3BQ0A 2UXDJ 5J2PA 3S7RA 2PI4A 1RWMB 4JB8B 1IXKA 4UOGA 4ZVPB 4RUAA 2PA8D 1N33J 1PC4A 3KOAA 2CDQA 2K3KA 4GC7A 4LIWA 3K5LA 3F56A 3TQ1A 2J6UA 4KRWA 2ZNZA 5I42A 2IVFB 1Z2LA 3AOBA 3C6TB 1SBRA 5A0YA 1VBKA 1LW2A 2XEXA 2KM8B 2OUGA 3KMSA 1Q95G 4J91A 5G0RA 4FF1A 1U7LA 2UP1A 1CC8A 1SKWA 2DNYA 2W2QP 1DBDA 2HSEB 4ETZA 3TJAA 3S6EA 2C1EB 3RJMB 1U0SA 3M1VB 4DFPA 5SUHA 1XR7A 1CG2A 4I68A 3GYNA 4E8UA 2FHJA 2RB7A 2C2EA 1ZM3A 1NRKA 4DU7A 3LP1A 2UVRA 4B3OB 4AD6A 3BV8A 4M5HA 2DXEA 1S1UA 4QJVA 1C2PA 1NJWA 1TV6B 3T5KA 1UVIA 2YKQA 3CJQA 2GMLA 1S7HA 5DRKA 3CCSS 2FY1A 1FX2A 3KG4A 1KONA 3MMAA 1QAJA 2OMLA 4AQYJ 2D3ZA 2EI5A 1S99A 4IYQA 4WFAQ 4UF4A 3W8GA 5AJ3J 1H2VZ 5A6PA 1VISA 2RHQB 1HHSA 1KLMB 2LXFA 2KT3A 5IOLA 2VBWA 2HW3A 4FKXA 4BBYA 3PRBA 3H90A 2CJBA 3NRBA 2I5JB 3J81Y 3QRRA 2Z2ZA 2RAQA 5IFMA 2HIYA 2KJVA 3W2WA 2CPIA 3MCSA 2BBEA 1Q1KA 4YR3A 4LVOP 3GB0A 3I55S 4X4UA 1CEZA 4M5JA 5A6WA 4LSNB 5C2CA 3G82B 5KG4A 1CVJA 4K5RA 2ZWOA 5E0OA 1DFDA 5DLGA 1SC3B 2A6MA 4CH0S 4MAKA 3TA0A 6FDRA 4DR1F 2QSWA 3KK1B 5F3ZA 4LF1A 2YQ1A 2K2PA 1FT8A 3FMBA 4U8VA 1UPPA 4P72A 4V19X 3K5NA 1U45A 3PZPA 3K0JA 2VV5A 3CCVS 2B7CB 4DV1F 1U48A 2Y0SD 4LRCA 1NZ8A 4KPYA 4RX6A 3IRXB 4A8FA 4DPUA 2LEBA 3MM9A 4DPWA 1SJ3P 2MQNA 1CULA 3U1NA 2I0XA 1FRXA 1YQHA 4ZCLA 4RLEA 3NBPB 2M7SA 1D9DA 5C42B 3FBBA 1SIZA 3A3NB 3MAAB 5CHCB 2UV8G 2FJBB 1X5SA 5ETMA 3WHIA 3H25A 3HD2A 2EC2A 1WC4A 1EJ7L 3M05A 4CNZA 1YRTA 3H5XA 2HHHJ 2XY5A 1OSCA 1Z4UA 2YQ0A 2FJXA 5E3RA 4ID8A 3SXLA 1U1RA 2F8HA 2VICA 4IR1A 3VVUA 2I1RA 1R89A 3MR3A 4ER8A 1TUWA 3KLEB 5ETQA 5BJRA 5DDRC 3TX0A 1S9GA 2P9CA 1U26A 1RISA 4N5SA 2XWYA 1CQNA 2XMVA 1RT4B 3SSQA 3P5BP 4X62J 1MU2A 1RABB 1R6YA 1PJ5A 3M7VA 1NB7A 1PILA 1S0MA 2JX2A 2YX4A 3HSJA 1RAOA 4J9QA 2AU0A 4DN9A 4OX9J 5RUBA 1Q8BA 1XR5A 3R97A 4O44A 4I56A 4ICLB 1DY3A 5BXIA 1S7IA 3VGSA 3W3SA 1N48A 4AXIA 4WKYA 2BACA 1FX4A 4RW4A 4O3RA 4ZP9A 4NYZA 2R7UA 1RCOB 1VQPS 2M9KA 4JI8J 1LFPA 3VZIA 5I3UA 1C1BB 3BF4A 1FKOA 3D7SB 5M2UA 4LFAF 1X4DA 4M5IA 4AL7A 2LYVA 4N41A 3TO8A 4K50A 1JXLA 1F3VA 2QYGA 3MECB 1XMQF 3O3LA 3CCZA 3MEEA 3SEOA 2HURA 3THTA 5E3QA 4KH0B 1NK4A 2FHJD 4IR9A 3HHKA 2DGXA 3LTOA 5G4DA 4NX9A 1RT2B 1QVGR 3BGLA 5DZ6A 5H9EJ 2D69A 3M8RA 2NXJA 5D0RA 1JIHA 5AXMA 4DS4A 3W1YC 3FFIB 2LEPA 4LFCJ 1YGYA 2CPJA 2Z56B 4L3KA 1VRTB 1C0TB 4MK9A 2CPZA 3D3BJ 3P49B 4OZNA 5AT1B 3LAKA 2A10A 1LWXA 3DHWC 4DX7A 4ZN3A 2XO7A 1RI7A 2BJ1A 1WKJA 2F4FA 5FLXY 4J90A 2V69A 2W24A 2V4RA 3DXBA 4RNFA 1S97A 2HBZB 2YKNB 1RHQB 3ISNC 2AEMA 3PR4A 3HZEA 1I1GA 5HLFA 1EQMA 2KFYA 4FBTA 5ETVA 2ASDA 3V6HA 1HQUB 2JEGA 2DGVA 1UJ5A 2MGZB 3MOZA 1RT1A 1VIXA 4DPXA 1J27A 1IBLF 3NL0A 4PQUA 4R8UB 4TKTA 2CQCA 3BSCA 5IXUA 2B7BB 2HWTA 1CC7A 2RKIA 3HVAA 2Z30B 2HWHA 1V3ZA 2OI2A 1M1KT 2MZRA 2DVIA 1QE1B 3A1YG 3CJTA 2OPPA 3J7Z5 2ADBA 2QGFB 3B78A 1S1VA 4K4SA 3CDEA 1LXJA 1FRMA 2GV1A 2MSSA 1ZPWX 3W2VA 1TAQA 5D4OA 2VA3A 3O5TB 4CLUA 1N4LA 3AD8C 1LWEB 2R7OA 1RDRA 3F0NA 2B9EA 3QIPB 3D28A 1X4BA 4V19J 4KTQA 5DDPC 3FSYA 3BPDA 3KLGB 2QN6B 1RT3B 4QWBA 2HLTA 5HROB 2VQFF 2OMOA 2MKSA 5E41A 3C16A 4GRSA 2XCPA 1NK0A 3BQ1A 4DV2J 3OW2R 4TY8A 1VBXA 3OTEA 1UCNA 3SCKE 1BGXT 1VJQA 1J5OA 1TK8A 2B8PA 3D66A 2AYEA 4DV5F 3GIRA 1T03B 3MAHA 2YPYA 5EX3A 1SV5B 2FVPA 1X9MA 1KN6A 1M5KC 5LXRA 3PYDA 1LXNA 3PYFA 3A4TA 4DV4J 1TKDA 4DSIA 2ATCB 2E5JA 4PUOB 1GQEA 4DQSA 3PW4A 3LP0B 4RL1A 4FZVA 3B82A 2JHEA 4DR3F 2VOPA 4JYAF 4CP5A 2KFNA 2F7VA 4DR6F 3WC2A 4B3RF 2JEIA 3M6UA 1YRUA 2FYXA 2HVHA 1EKRA 1WF0A 1NU4A 4JI7F 3IG1B 3OR2B 4J9UE 4DS5A 3SQGA 4PXBA 3M6VA 1X9WA 4WE1A 1W2BR 2L9WA 2HVEA 1QLNA 2J9DA 2F8MA 5EDWA 1B7YB 4LBPA 2NYHA 4MIBA 4O3PA 3SCIE 1RT7A 3OPKA 3THVA 5DGAA 1TMMA 2VZ9A 3CWJA 4JI1J 1GT8A 2IHR1 3UI3A 4ZCMA 2R8JA 5DLFA 2ZJQQ 3OFHA 3PJ9A 3EMTA 2F3JA 4LF6J 1VR6A 3AB4B 3R5CA 4I7FB 1WNEA 1TP7A 3VZHA 4DFMA 3Q8YA 3ISZA 4YEAA 2F4VF 2F1FA 3PJXA 4X4TA 1TKXB 2AJ0A 4MTPA 4Y34A 4ZVGA 2FHOB 1O6XA 4UT4A 2ZUGA 4HVZA 1JQGA 4OX6A 2J76E 4KHPF 4I6AA 5CYMA 4RJVA 2HK2A 3IAS9 5ETSA 4DQIA 4DV6F 2VA2A 3KHLA 1HNVA 2ASYA 2QRRA 1ZZFA 2P9EA 1I6JA 4R25A 4C4WA 2B5JB 1X4FA 3MD1A 3CCRS 2GHPA 5J1EB 4ZHRB 3T6BA 5GMDA 4EZ9A 2DNLA 4DL0C 1ZH5A 2XMWA 1CJVB 1SB6A 3AODA 3OFEA 3R5AA 3M8YA 3UCGA 4FP9A 5K14A 2P8IA 1FESA 5J2QB 4P2FA 4YR0A 1I94J 3D2WA 4CYUB 1H72C 1CS4B 1QTNB 2OPSB 2AW0A 2ZOGA 3FZBA 2E5GA 1IKWB 4NXNJ 2QLFB 1MWZA 1MSWD 4P74A 1O5JA 5L1JA 2GVZA 4ZCIA 2JLGA 2RDDA 4AYBD 4FYVB 1CJKA 1WHYA 2BE7D 3BB5A 2XC9A 1JNRB 2VQEF 4XDDA 4ID5A 1FXRA 5HP1A 4R5PB 4RW8B 4PWUA 1N5YA 4PWDB 3JQKA 3EX7B 4B17A 3M8QB 2DGWA 2Z58B 4F7VA 5KG3A 4IO9Q 2G9OA 2N7YA 1HNWJ 1JKHA 3R2DJ 2HNDB 2DRDA 4WK3A 3DRSB 5LXYA 5IM0A 1HI0P 4ES1A 4YHHJ 1WHWA 2D3OR 4GO5X 4XO0A 2FTRA 4N56A 1YK9A 1GX5A 1RGVA 1HBUB 3P45B 3PYGA 3H2UB 3MZIA 3DC2A 2ZC4A 2IJNA 3NOCA 4C6AA 4MT1A 4M5DA 4NCBA 4DPOA 4FF4A 2BOPA 5DQGA 1FDNA 1XN9A 5B0AA 3THPA 5GAHI 3PTWA 3ENQA 5MLCV 3S1TA 3EWGA 3ILLA 3VV2B 2I2YA 5GAGI 2FD2A 3CD7A 3LQVA 5LJ5Y 2NUHA 2YNGA 1RYSA 4HYKA 2PFFB 5JJBA 2M8DB 5LSOA 4IH7A 3MCNA 4IRCA 5HVHA 3M2RB 2W8LA 3CJ3A 4PG5A 1TMJA 1GH8A 4DSFA 2XM3A 2BV3A 5K8NA 2AGQA 4GO7X 2OD6A 1FKPB 1U1LA 5HATA 1KQKA 5KT7A 2WTFA 1JLEA 2HS3A 4FS2A 4WKRA 2QMXA 5F0WA 2HFNA 2BR0A 4DSLA 5LSRA 2ACYA 4BC9A 2R2RA 2IC3B 2MZTA 2CG4A 3BDPA 2C2DA 3HM9A 4OYIA 2O66A 3OJUA 4JI5F 3IN5A 1KS2A 1DTTA 2YKMA 2IM3A 3PIPQ 4BDPA 3HSGA 4PZVA 1IR2A 5HK4A 3WQPA 1VQ6S 3K57A 1CBKA 1NDCA 4DQRA 4WFBQ 3PYEA 1VFJA 2LXIA 3TJ9A 3OTDA 4LF4F 4CLPA 3Q8QB 3ILOA 3OUYA 2AYBA 3T3FA 2HBYB 4OZ3A 4KC5A 4P7TA 3P3DA 2WONA 1IKYA 4NASA 2W01A 1AUSL 2VG5A 2C2MB 4M94A 3GG0A 1X4CA 3CC2S 2Z2LA 1IM4A 5E5NA 6FD1A 4QIVA 3O2IA 4MK7A 4KKOB 5F0UA 3MCOA 1NK9A 3H5SA 1QAXA 4ECVA 1F60B 3EE3A 3BKFA 4RUHA 2VFRA 1F2HA 1BQNB 4BWJA 1RT6A 2DBBA 4A8WA 1SCJB 2HGNA 3G8SA 1JWWA 1CJTA 2J6TA 2QL5B 1AZSA 3T6JA 2XQCA 5KFKA 4TN2A 2FZGB 3C15A 3NP5A 2ZBCA 5AE3A 2L9NA 1RT5B 5L46A 2G1DA 3VQTA 3ZNUA 3FCHA 3GIJA 4WIIA 1LOUA 1NK5A 4JP8A 5HBMA 1IBCB 1FD8A 1HBMB 1KTQA 2XYPB 1FNXH 4YDDB 4OYWA 2QX0A 4LUBA 3PDNA 4GVBA 3GPAA 2UVUA 3CMAS 1IWAA 2WVFA 3AXKA 3GONA 5KG1A 3IM9A 1NDLA 3DI6B 1GTHA 3N5BA 4LF8F 3DM2B 2BANB 2C3YA 1WSRA 1FXLA 2HFZA 1S6PA 4UW2A 3MMBB 3M9MB 1WI6A 1R7IA 4DCJB 3PFOA 1YHQS 3CGIA 4DV0F 4ZP6A 3W66A 3BO2A 5DQIA 2R7TA 4H4MA 4OJ1A 2ILZA 4OL8A 3BBFA 4P10A 3TZWA 5EN1A 1OWXA 1FTRA 4OHYA 2XULA 9ATCB 1EETB 1SQFA 3PO4A 4Y3CA 1EQ0A 3OLAA 2HFSA 4RR5A 4DR1J 5C25B 2KN4A 4F0KA 2BDPA 2E29A 2MKIA 4DR5F 1X4HA 2DH9A 1FCAA 2JOQA 4DLEA 1SKUB 2CVIA 1F9HA 2AX1A 4DV1J 4YB6A 5CZVA 2GZOA 3MUMP 2JC1A 2HGLA 4C11A 1U1MA 3QRPA 4EU0A 3QAUA 4M8LA 5GAHU 1UPMB 3IRWP 1S1TA 2IVMA 1PJ6A 2W9BB 3GYXB 3MM6A 4W98A 2VPWB 2FLPA 5GAGU 3QGGA 2H5JB 5F8LA 3UD4P 1BQMB 1FJ7A 2DHXA 3UD3P 3ULHA 1HNZF 1AW0A 5CYQB 3QFWA 4I67A 4PKDB 2IRUA 2LKZA 4DR7F 1A7GE 3QAEA 3DU5A 3I9V9 4P73A 2PGCA 4C0OC 5T7LB 3BREA 3QSIA 3TOQA 2MPUA 3D6HB 2ASLA 4CTAB 3I4HX 1V3SA 1T7PA 5B0BA 3LWLA 1MG7A 4A47A 1C1CB 1K73T 4IOAQ 1J5EF 4RBUA 2HIQA 1FEHA 3TAMA 5GADI 4DMZA 2DT9A 4USHA 4IFVA 2YY3A 4OI4A 1PG5B 3A8JA 4OI3A 3V4MA 2GA7A 4LSLA 4DUYF 4YOEA 5DDQC 4KO0B 1Y9OA 3CJ8A 2V8GA 2OH2A 4OYXA 4EYHB 2N3OA 3CD6S 3R5JB 3ZZOA 3W61A 2G0JA 1RZMA 2WSEC 4WWSA 5J2MB 1NB2A 4HH0A 2ZH6A 2VPYB 2RQMA 1HNIA 1FDBA 2AJQA 3F73A 5DO2A 1UP1A 2QFJA 2FJDB 1UVJA 1WOPA 3CMQA 4LFAJ 2J7WA 3CD0A 5D15A 4NEYA 4XPEA 2VASA 5KFTA 1XMQJ 4Z7CA 4RBTA 4ZPTR 3BS9A 1ROFA 2O67A 1SJ4P 4K2XA 3I5CA 2HHTA 3BDEA 4RPFA 2EFNA 2RRAA 3PV8A 1Y5NB 1X60A 2V67A 4DG1B 4ATNA 2ZNYA 4M5NA 4K5SA 1YJRA 4F36A 2EVZA 4F2SA 5L8RC 1S1WB 3CCQS 1WI8A 5ETOA 3TUZC 1KRPA 1ZPVA 2KT5A 1VQ7S 2M70A 3GV5B 3V81A 2CNOB 5FDLA 2KH9A 3I96A 2CPEA 4ALZA 1WG1A 1N5TA 1B7FA 3NS7B 5KFWA 1KDNA 3MM7B 4RWXA 2GVDA 3BGRA 1AA1B 3PX6A 4OHXA 2UU9F 4MJKA 3M30B 4H4OB 5A8RB 2K1RA 1NXIA 3PFEA 4USVA 1LK7A 3QJJA 5LSLA 5HANA 2YWEA 3L3CA 4LRDA 3H4DA 3TA1A 2RNEA 2DO4A 3LALA 4Y2IA 1OSDA 3JSYA 4ELTA 4NCGB 1VYAA 2XBPA 1IBLJ 4X4RA 4DEZA 2YH0A 3EUNA 2R7WA 3QLHB 2DXFA 2YNIA 3NAHA 1VC6A 3C6TA 2YXLA 3KJQB 3J80U 4S0MA 1YWXA 2BYCA 2CG8A 2FUG9 3HHLA 5KG6A 7FD1A 5AXKA 2NXEA 3MCMA 1WEYA 2V8DA 4PYDA 3WX8A 3KUEA 1UMJA 3U27A 3FEYB 3KK2B 3QT5A 1HD1A 1OQ6A 1VBZA 3MUTP 1TK0A 3M1VA 2UXCF 1LK5A 4Z2XA 1RLDA 5CCLA 2CPFA 3B54A 2XMMA 2XS5A 2GAGC 4F4AA 2DHHA 1FFWB 4ZPAA 3EPIA 4B3OA 1OY8A 1ZOTA 2KTQA 5CCMA 2ZM6F 2POKA
chains in the Genus database with same CATH topology
1NJWA 2LDIA 3G71S 3CVKA 4DSKA 1TV6B 3T5KA 3TW0A 4EBEA 1UVIA 2JLFA 2YKQA 1X8DA 4MYUA 3VWSA 3CCES 2D1CA 3D0IE 1JJ2R 4C97A 3MWBA 2GMLA 5KFUA 1S7HA 4GKKF 3QIDA 1TV6A 5EWGA 5DRKA 2DTJA 4YMEA 2KDOA 3J7A1 4USIA 4J9LA 3J7ZT 3CCSS 3QZ8A 2FY1A 1O0PA 3KG4A 1KFDA 1HMVB 1KONA 4DSJA 2UUTA 1K0TA 3MMAA 4CO5A 1H7WA 1HQEB 2B4PA 3QGPA 5D77A 1QAJA 3JTPA 2OMLA 3V5RA 2D3ZA 2EI5A 2X1BA 1S99A 3Q2TC 4OFZA 4J9NA 1AFJA 1HMVA 3M6WA 5E7OB 2IYIA 4LF9F 1HQEA 4IYQA 2EG2A 4NZ7A 3QO9B 4L3NA 1NJYA 2LCWA 5CZXA 1RKIA 1F0XA 4WFAQ 4DHVA 2P9GA 2CRLA 1H2VZ 5DETA 3N6LA 1XMBA 4Y6IA 4CO1A 5A6PA 4X4SA 3QO9A 3OJSA 1HHSA 3OHAA 3M8SA 3CEDA 3TNVA 1KLMB 2LXFA 2DNPA 2ZH7A 2KT3A 1Y5IB 2VBWA 2QEXS 2HW3A 1DRZA 4I69A 3C3LA 1ZAWA 4BBYA 3PRBA 3W2WB 5BYRA 2CJBA 2VPZB 3NRBA 2B9XA 2I5JB 3CJKB 2GJ2A 2WOMB 3J81Y 1S6UA 4I6YA 4KHMA 1KLMA 2YWKA 2GGPB 2KJVA 1D9AA 2EG1A 4PPZA 5IFMA 3VAJA 2PI5A 3OBIA 1Q86T 3W2WA 2RIJA 2QYCA 5JUMA 2CPIA 3MCSA 5KAKA 2BBEA 1Q1KA 2I5JA 5JXSA 4YR3A 4LVOP 3ZZ0A 2Y1IA 3DOKB 5B0CA 2VC1A 3T19A 2GGPA 3GB0A 2E7XA 3I55S 1ZBTA 2QE5A 3HHLC 1ZZNA 1CEZA 4X4UA 3MTJA 2V4QA 1H98A 4ES2A 5A6WA 4PG7A 2K8GA 1NZAA 1TL5A 3DOKA 4LSNB 3T1HF 3VAGA 3MXHP 1U6ZA 2ZZNA 2HHSA 5H9FJ 4Y0FA 2DNMA 2C42A 3KKFA 5KG4A 1F5AA 5BYSA 2HLUA 5KG2A 2PDAA 1CVJA 2DNHA 5KFHA 1QVFR 5L9NA 4K5RA 4NLDA 5E0OA 4LSNA 1DFDA 2LU2A 5DLGA 3KYLA 3SYZA 1UVMA 5THWA 3BO3A 4CH0S 1RTDB 5F8JA 1ZETA 4MAKA 5L9XA 3TA0A 6FDRA 4DR1F 2VFTA 2QSWA 3KJVB 3KK1B 5F3ZA 5D6GA 1KFSA 2QSFA 2ROPA 3DRPB 3N01A 2D7SA 4ZVFA 2K2PA 1FT8A 2I8EA 3FMBA 2V0NA 5F3TA 1R0AB 1JLBB 1HA1A 3KK1A 3ZZUA 5GAEU 4K4WA 4ECSA 4V19X 1BC6A 4ELUA 1Q16B 3DRPA 3DOLB 3DDNA 1NHVA 3VALA 3AA8A 3K5NA 1U45A 3PZPA 1R0AA 3K0JA 2RH3A 2VV5A 3V2UC 2OPRB 1JLBA 1FNOA 2B7CB 3K8WA 2R7RA 3CCVS 2JH3A 4DV1F 1XBWA 2BJEA 2MQQA 1U48A 2Y0SD 1L3KA 4NRTA 3DOLA 1ZAXA 2DGSA 1JJ4A 4KPYA 3MM9B 2OPRA 3VAKA 4RX6A 4AXJA 1LW0B 1DLOB 1FXDA 4C8LA 3CJ4A 3IRXB 3MR5A 4A8FA 4ZLPA 2BJDA 2LEBA 4TLRA 3LPYA 3MM9A 3DFEA 2F9JA 1SJ3P 4ZP8A 2CQ4A 3IS9B 1LW0A 2MQNA 1DLOA 2IA6A 3D0GE 3IRXA 4I7FA 2ZH8A 3BO4A 5D3GB 4R0JA 2KZMA 4OZJA 1N36F 2KI2A 3FZ2A 3U1NA 3RR8A 4K0KF 2J0SD 1F5BA 3CO9A 3S01A 2RQCA 2B3TB 2I0XA 1FRXA 1YQHA 2O3DA 4ZCLA 2DB1A 4RLEA 5D3GA 3NBPB 1T3NA 5K8OA 1FEEA 2M7SA 2OJ3A 1D9DA 3EXYA 2BA9A 2YWGA 5C42B 2XS7A 1SIZA 4F4KA 1D3WA 2B4OA 3GFXA 4Q8FA 1R8BA 4C9DA 2BABA 3NBPA 2YQ3A 2HRYA 5CHCB 4X65F 2UV8G 5C42A 3M2VB 2FJBB 1TAUA 3CCUS 4KIAA 1X5SA 4YY3F 3UR3C 1T95A 3H25A 2DITA 3QGIA 3Q24A 2NSCA 2BQ3A 4C8MA 5E3CA 4F67A 3M2VA 4RKUC 3POTB 3GG1A 1S10A 3M05A 4CNZA 4ITSA 1U1PA 4JI6F 4F4ZA 1YRTA 3H5XA 3PX0A 4DR2F 3R5DA 3POTA 3O1LA 2KRRA 3HDSA 2XY5A 2OSQA 2HVIA 1H0HB 2DPJA 2ZDOA 3DRXA 1TL3B 3IGNA 1OSCA 1Z4UA 2W9AA 2FJXA 3KLHB 1ZTWA 3FRZA 1GXLA 5E3RA 2IRYA 1XEZA 3BEGB 4ID8A 3SXLA 2KYXA 1U1RA 2F8HA 4IR1A 1TL3A 1S9GB 2I1RA 1R89A 1IBMF 3MR3A 2UXBF 3N0VA 5KFIA 4H4KA 3KLHA 4ZMMA 3KLEB 2VOOA 2RRNA 5BJRA 5KFEA 3MURP 4ED1A 2XHWA 3E51A 5HMYA 5DDRC 2E1CA 1MMNA 1S9GA 2P9CA 1P9QC 2DNKA 1U26A 1MU2B 2E44A 1RISA 3KLEA 1VS3A 4N5SA 2UUCF 1QAYA 5GMKa 2XWYA 1CQNA 4DV7F 1IR0A 2XMVA 1RT4B 4QQBA 3NAIA 3SSQA 4FN5A 3EZ5A 1UFLA 4NLPA 1MU2A 1S0OA 2V4JB 2ZFHA 1VQKS 2VBXA 4U9RA 4MYTA 2ZJRQ 1N32F 1R6YA 4O23A 4YB5A 2I38A 1RT4A 1PILA 2FB0A 2U2FA 4RZRA 1S0MA 1NB7A 5KFPA 5M2PA 4QIFA 4A48A 3DXSX 2JX2A 2YX4A 3PKYA 2NREA 2Z4PA 4LF7F 4D3GA 2V4JA 2XMTA 1AROP 3G6ES 1SXLA 4J9QA 1VQLS 3D5MA 2Y1RI 4KAIA 4KV8A 4Q0BB 4O44B 2AU0A 1RKJA 4RWWA 2NZ4A 4DN9A 1IKWA 1XERA 5B0EA 1XNQF 2FHKA 4NWBA 1Q8BA 4LJMA 3RR7A 4IUFA 3LW5C 1XR5A 3CDWA 4I2QA 4NMLA 4O44A 2L3MA 4I56A 4LF5F 2VODA 4ICLB 4OHVA 5IZHA 3KNGA 2YNFB 2VG6B 4QW8A 5M2RA 4RW4B 2IFXA 1L3TA 3W3SA 3D1OA 1VHFA 1N48A 3H20A 3OL7A 1WG4A 1S79A 5BYQA 4AXIA 4WKYA 2XLJA 2QO3A 1OQ3A 2BRLA 4ICLA 3M32B 4U7UK 2AYGA 1Q81T 2BACA 2YNFA 2MHEA 4NA3A 5F8GA 2VG6A 2JRSA 2LMIA 3IWLA 5KFRA 1LWCB 4RW4A 4MK8A 1E6VA 3SSSA 1IBKF 5HI7A 2PMHA 4O3RA 1HW8A 3TAQA 3DYAB 4ZP9A 3CMES 5DS7A 4K4VA 3M32A 4AUKA 2EC0A 2PA3A 4XPCA 4NYZA 2Y1JA 2R7UA 4CO3A 1LWCA 2ABYA 5I3UB 3OSPA 1VQPS 3TVYA 2M9KA 3JSBA 4N8NA 1FKOB 4IRKA 1S76D 3DYAA 4JI4F 4XIUA 1LFPA 1IQTA 4KBIA 4J5OA 2ADCA 3NG8A 4XAKA 3VZIA 1NO8A 1C1BB 1WF1A 1Y0HA 3BF4A 2M5YA 3DHXA 5I3UA 1VQMS 2JJ4D 3TR5A 1H38A 1FKOA 4O3NA 4DN0A 4BC7A 4A4JA 1OPZA 5M2UA 2F40A 3UR0A 4LFAF 1X4DA 3RW7A 3CT9A 1Y00A 2Z2MA 2DHAA 5KFMA 2LA4A 3C6UB 1FRIA 4HHJA 3EYZA 1NK6A 2CJKA 4AL7A 2AJ4A 2LYVA 5KFLA 1C1BA 4N41A 3TO8A 5GAEI 1ZTTA 4K50A 1JXLA 2XMKA 1RTIB 4ZP7A 3MEEB 3GV7B 3DGPA 3MECB 3HHLD 4K4UA 4FXVA 3C6UA 2MY7A 1XMQF 3O3LA 3I6PA 1IUJA 2E5IA 4QYZJ 3N4WA 3U1MA 3CCZA 2X3GA 1M5SA 1RTIA 3MEEA 1TZ0A 3SEOA 3MECA 5EWEA 2CQ2A 1KR4A 3THTA 3W7BA 2KG0A 4N77A 5E3QA 3UFCX 3OTOF