1DZ5A

The nmr structure of the 38kda u1a protein-pie rna complex reveals the basis of cooperativity in regulation of polyadenylation by human u1a protein
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
101
structure length
101
Chain Sequence
b'AVPETRPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKMKGTFV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U1 SMALL NUCLEAR RIBONUCLEOPROTEIN A
publication title The NMR Structure of the 38kDa U1A Protein-Pie RNA Complex Reveals the Basis of Cooperativity in Regulation of Polyadenylation by Human U1A Protein
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ribonucleoprotein/rna
total genus 13
structure length 101
sequence length 101
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1dz5A00
2FPHX 1VBZA 2JRSA 3CC7S 1AUDA 1FT8A 4V19X 1VQNS 3TP2A 1VQMS 4CH1A 4LJMA 1OO0B 4IUFA 3HHNB 2CQ4A 2NLWA 2HGMA 3FEYB 2PEHA 3H2UB 3TO8A 1WG1A 3UCUP 1SJ3P 2HGLA 5CXTA 2MGZB 3UD4P 4C7QA 3MOJB 2DIUA 3CCVS 3RW6A 2RVJA 4QU6A 2E5IA 2OIHA 4WCEQ 1KC8T 2MPUA 1R8PA 1M5OC 1SJRA 1U1LA 3SDEA 2KG1A 4IOCQ 2HGNA 1X4GA 2DH7A 4C0OC 5JVGQ 2HVZA 2ADBA 1JMTA 1FNXH 2CPJA 2M9KA 2ZJPQ 1VQLS 3MD3A 1DHMA 1H2UX 2MQPA 1VC6A 2LMIA 3VAIA 2DGUA 2L9WA 1WEYA 3HI9A 3FEXB 5IM0B 1JJHA 2DNGA 3J7ZT 2MSTA 1N54B 2PE8A 3VAFA 4WIIA 2RQ4A 2DISA 2NZ4A 1X5TA 3PIOQ 3I56S 2X1AA 4P6QA 3LQVA 1YIJS 2E5JA 1L3KA 3SDEB 1QM9A 1CVJA 1HL6A 1H2TZ 2F9JA 2QFJA 1RKJA 1NU4A 1VQ6S 2G4BA 2KFYA 4YOEA 1IQTA 2CPZA 2LEAA 2FY1A 4TU9A 2AYBA 3CULA 2DNKA 2DGWA 1YJ9S 2VOOA 4C4WA 4F02A 3H2VE 3R27A 3V4MA 1X4CA 2MYFA 2CQDA 2X1FA 2U2FA 2CPFA 4F26A 2I2YA 3S6EA 2F3JA 2AYEA 3MURP 3U1MA 3P49B 2YH0A 2LA4A 3P5TL 5DETA 2O3DA 1RK8A 1WG4A 1HD0A 2DNQA 2YWKA 2HYIB 3D2WA 2XS7A 2FC8A 2MQQA 1A9NB 2DHSA 5GAEU 4CQ1A 4Y0FA 3G4SS 4Y00A 3NNHA 1B7FA 1W2BR 2CQPA 2FC9A 3S7RA 2KRBA 2M88A 2AYMA 2E5HA 3UD3P 2CQ2A 2RUGA 1FXLA 4RU2A 2M0GB 1WHYA 2DH9A 4WFAQ 1FJCA 5DM7Q 2CQ1A 4PR6A 1ZZFA 2DGVA 1M90T 1YJNS 1U6FA 1D9AA 4J5OA 1U2FA 1NJIT 1SXLA 2KI2A 2OTLS 4W90B 2D9PA 3SMZA 4PRFA 2X1BA 1WG5A 2LYVA 2CQ3A 3CCLS 3MD1A 2DGXA 1U1RA 2JVRA 3NS5A 2DNPA 1S79A 1WEXA 2UP1A 5IM0A 3I55S 1DBDA 3MUMP 2DNYA 2AD9A 1VC5A 2LA6A 1NO8A 2DNRA 5DDRC 3CCJS 1YTYA 1VBYA 4OZ1A 2MZQA 1K9MT 2DHXA 4A8XA 2QA4S 2M52A 1VC0A 2JWNA 2XSFA 2DGTA 1ZH5A 3U1LA 1U1OA 3P3DA 5DDOC 3VF0B 5GVQA 1X4DA 1A7GE 1WI6A 1X5OA 2M8HA 1WF0A 1X0FA 2DGQA 1WHVA 2CPIA 2YTCA 2DO0A 4CIOA 3CUNA 3IWNC 1KOHA 3G71S 1Q86T 2RRAA 2OSQA 1YI2S 3VAMA 2DITA 2U1AA 2DNOA 1Q7YT 2F9DA 2MSSA 1VQ4S 1FJ7A 3VAKA 2KRRA 1X5PA 3G6ES 2DNNA 5ITHA 5DDQC 3BO4A 2KHCA 1VQ7S 5GAGU 1FJEB 1U6BA 2DHAA 2GHPA 5EN1A 4QU7A 2KVIA 3G8TA 5LJ5Y 3UE2A 3MDFA 3S01A 3CCES 5H1SV 1XN9A 2CQGA 3ULHA 4Z2XA 1WI8A 5D77A 2LXUA 3Q2TC 1X4AA 4YB1P 1KD1T 1X4EA 2VODA 3PIPQ 3G96A 5DM6Q 1QVGR 3VALA 3J7YU 3NS6A 2DHGA 3CCQS 5HO4A 1O0PA 2CJKA 4ED5A 1M5VC 4QQBA 2M8DB 1U1MA 5IQQA 1VQ9S 3CCRS 1X4BA 2ADCA 3US5A 1OIAA 3CMES 4W92B 1URNA 1WELA 3BEGB 5GAHU 4QPTA 4EGLA 1WF2A 1WF1A 1UW4A 3R1HA 2J0SD 2YH1A 2LCWA 3VAHA 2KM8B 2MY7A 2XB2D 4TU8A 2MXYA 1U1NA 4WFBQ 2ZJRQ 1U1KA 2M4MA 5GADU 5CYJA 5GMKa 3RW7A 2G0CA 3EX7B 1X5SA 4FXVA 1U1QA 2DGOA 2DK2A 1P1TA 2MHNA 3LPYA 2J0QD 1DZ5A 2CQIA 2OTJS 5LJ3Y 2MZRA 1YWXA 2RS8A 3VAJA 1PGZA 2VONA 2D3OR 2XS2A 4U67Q 2K3KA 2N3LA 4YUDA 1OPIA 3CC4S 4UQTA 1SJFA 2A3JA 2MJUA 2DB1A 1X4FA 1OWXA 2D9OA 2JX2A 3DXBA 2MB0B 2OJ3A 2LQ5A 2WBRA 3IRWP 2RRBA 5LSOA 3OW2R 3G9CA 4CH0S 2MZ1A 1M5PC 1UFWA 2DO4A 2CPEA 2SXLA 1Q82T 1FO1A 1VQPS 2MJNA 2K8GA 2KXNB 1S72S 2DNLA 2KM8C 1D8ZA 3UWTA 1WHWA 2KT5A 3CC2S 2KXHA 3CD6S 3R1LA 2KG0A 2EK6A 2XS5A 3CCUS 4BS2A 2BZ2A 2KN4A 2GO9A 1F9FA 3MI7X 1N52B 2MQMA 1M5KC 1JJ2R 2MY8A 1G2EA 2MZJA 4F25A 2RNEA 2MMYA 2MKJA 5LXRA 3CCMS 3BO2A 1HA1A 5BJRA 2CPHA 3SXLA 1SJ4P 4UY8T 3B4DA 5DDPC 4IOAQ 2HZCA 4M5DB 4WF9Q 3CTRA 2B0GA 1VQ5S 2BOPA 2KU7A 5HL7Q 2MZSA 2KXFA 2X1GA 2MZTA 1N8RT 2XNRA 3MXHP 2E44A 3DLLQ 5LSLA 2JVOA 3THTA 3S8SA 2MKSA 1QVFR 4LMZA 5FJ4A 1VQOS 3BS9A 1KQSR 2DIVA 2RQCA 1HD1A 5D78A 3THPA 2MQOA 2YKAA 3MUTP 2KYXA 3CXCR 2RS2A 3BO3A 3G8SA 2CPXA 2QEXS 1KOOA 3NMRA 3CPWR 2ZJQQ 2KH9A 5JVHQ 5LXYA 2DNZA 1FHTA 3N9UC 2J76E 2AYGA 2MKHA 2N3OA 2E5GA 3UCZP 1K73T 2LXIA 3CMAS 1H6KX 4OZ0A 1DRZA 2MKKA 4WKRA 2RT3A 3VAGA 1YJWS 3UCGA 1R8HA 2CPYA 2RU3A 1U1PA 2VOPA 2DH8A 2DGSA 2MQLA 2MKIA 4IO9Q 2CQCA 4TU7A 3TYTA 1VQKS 1H2VZ 3JB9k 3MUVP 1PO6A 1M1KT 1UP1A 4WFNQ 2EK1A 2EVZA 4LIRA 3CCSS 1K8AT 1VBXA 2LEBA 1YHQS 2CQ0A 1VQ8S 3P6YC 3EGZA 2XNQA 2OSRA 4ZKAA 2LECA 1BY9A 2M2BA 1SJQA 3EGNA 2ERRA 1N88A 1P27B 3ZZZA 2I38A 1WEZA 1X4HA 2MKCA 2CQBA 2J8AA 2L41A 3NNAA 5MLCV 3K0JA 2L08A 3B4MA 4PKDB 3CF5Q 2CQHA 2MGZA 5IFMA 2DNHA 4FXWA 1UAWA 2DNMA 2N7CA 4ERDA 1Q81T 3NNCA 1ZZNA 2LKZA 2Q79A 2FHOB 1YITS 2N82B 2M70A 2MQNA 3Q2SC 2CPDA 1WTBA 4TLQA 2G1DA 1WWHA 2V94A 1WHXA 2M7SA 5CA5A 1JJ4A 3ZZYA 3L3CA
chains in the Genus database with same CATH superfamily
4PXDA 4U7CA 2PA8D 2F4VF 2Y1LB 1SBRA 3W8GA 4KR0B 2IIHA 3O8WA 3A8EA 3GR1A 2LQBA 2HGLA 3FJ2A 4DLGA 5KG6A 3K89A 3TWZA 2DHHA 3MEDA 3CCVS 1UJ6A 4OMFG 4WCEQ 3GFHA 2ZUAA 4IOCQ 5CYQB 2ZH2A 4DBQA 2LMIA 3RR8A 5AXNA 5A0YB 5J1EA 4PG8A 2VD3A 4KT0C 4Q0BA 4DL5A 4DV4F 3W3SA 3VAFA 2RMLA 3MEEA 1L3KA 2BJ9A 4LFCF 4HHJA 1JKHA 1NJYA 4JI3F 4ANDA 2BA9A 1S57A 2CQDA 4MT1A 1NZAA 2OPRA 2AYEA 2VASA 4WXOA 3P5TL 4DPWA 4B3TF 4B9VA 3PR4A 3CIZA 5GAEU 3BKTA 3G4SS 3KTQA 1Z2LA 1W7WA 1S1WA 1B7YB 3UD3P 2XG8A 3G6VA 4CO0A 4IDKB 2W2OP 1M90T 3KNAA 2JC0A 3ICLA 2JLEA 4HTIA 4DJBA 1C4AA 2NSCA 1SB6A 2DGXA 4X2BA 4F0MA 3F56A 3NCRA 4ZPTR 3MCMA 1QD1A 4K5RA 5KFAA 2Z57B 2WVDA 3RYLA 2VUGA 3I5BA 2VPWB 2VB6A 5L9XA 3HVRA 1HNIB 4OJHA 2V0NA 3CB4A 4D3GA 1RTJA 1ZPVA 1X60A 3SBMA 4JI8F 1X4DA 2R8KA 3IRXA 1B3TA 3R97A 4YMEA 1QTNB 3J7Z5 2DGQA 1NB7A 3JSMB 4OJGA 4MFBA 2AEMA 5J2PB 4X66F 1NBEB 1T9TA 2BM1A 2HNYA 3V4IA 4EU0A 1VRTB 4DQIA 3C14B 4ICLB 2C2NA 3E2EA 2E66A 4M5NA 5CQGA 4DV7J 1KEKA 1U8SA 1WI8A 3SI8A 2QMXA 4C8ZA 2QLFB 3VR1A 5J2NA 4P71A 5KFRA 5KFZA 4IDKA 3G82B 4JI5J 3D67A 1D09B 4PXEA 1CC7A 3UPFA 1TUGB 4ZN1A 4RNFA 4C3MA 3CCRS 4LF9J 1F5AA 5A8RB 4OX6A 1WF1A 2GFFA 2V8VA 4LQ3A 3I82A 1WC6A 1D1UA 1S4EA 1NMEB 3PO4A 4ECYA 2W4DA 4ZPCA 2ZBPA 3ISND 4RBUA 4DUYJ 1RT3A 4RNHA 2Q6CA 4LBHA 4RR5A 1UA1A 3R5BA 1H7XA 3KLFA 2V67A 3IM8A 3FSYA 4U67Q 3DLEB 1AW0A 3VGVA 5J2PA 4HVZA 2VBZA 2MB0B 2WBRA 4MYTA 2CNKB 4USUA 3C14A 5EDWA 2A1BA 1V3ZA 4LR7A 4NYPA 1SQGA 5B0DA 1PJ6A 2KG0A 4OYIA 3J7YI 4G1PA 4MIBA 3R7BB 1SIZA 3HK2A 4TY8B 4LIWA 3W62A 1JJ2R 3IG1B 5CZXA 1SJ4P 2D7SA 4TXSA 5A8RA 2YWWA 2B8QA 2KXFA 2W9CB 4ZVGA 4CLYA 4OJ3A 3AH6A 3BS9A 3IWLA 2GHVC 1KQSR 4F0KA 2RQCA 1S9FA 1SH3A 4RU9A 3R7SB 3MUTP 2RD5C 2EG1A 3NMRA 2PDAA 2CJYB 2D1CA 4CTAB 2HKEA 3MR6A 1R8BA 4J9PA 4ECWA 3DLEA 3VAGA 1S1XA 4NPOA 3N28A 4TU7A 5H9EK 3TYTA 3FKBA 1TP7A 2BJ3A 1VBXA 5D0GA 1DTQB 2LECA 1FKPB 4XPCA 2XGPA 3W60A 2F4FA 1NK0A 3TOQA 1WDDA 5M2PA 3Q0AA 3H42A 3MF5A 2EEYA 4DV7F 2ZZNA 2JEGA 4V1Ak 2Q79A 4QYZK 2M70A 2VC0A 4JI5F 2OKQA 1RTIA 4OHZA 1NK5A 4DCPB 1GH8A 4FYDA 3D1OA 4IUFA 1Q53A 5HVGA 1S97A 3H2UB 1NSKL 1WG1A 3LP1A 2ROGA 2WK4A 4I6YA 1GTHA 4K5SA 4YB6A 4DUYF 2YKQA 1EETB 3WZ0A 4F36A 2BEFA 2DVIA 3E3XA 2NUUG 2C1EB 2IPOB 4DX6A 4O3PA 2DISA 2B9YA 3NGRA 3PIOQ 1DTQA 2X1AA 2QYCA 3LQVA 1CVJA 3QT7A 1RKJA 3M7VA 4LF6J 4HKQA 2JDJA 3DRRB 3N6NA 2MYFA 2BXJA 2L48A 1IJEB 4ELVA 2K7JA 3GONA 3D54A 4RW4B 4YS2A 4Y0FA 3ZFVA 4KAIA 3VTIA 3L09A 1VK8A 2EBGA 1B7FA 2QLWA 5J2MA 2GIFA 2OD4A 1S9EA 2M0GB 4IH7A 3PW0A 1YSJA 3NOCA 1X9SA 2DR5A 1FKOA 5E2QA 1NJIT 2KL8A 3TUZC 5D8HB 1VHIA 2FJXA 1CPZA 4XDCA 2KZMA 1UA0A 1IUJA 5HSPA 2Z4PA 3DCAA 1HFEL 1JLAB 5HANA 2KYZA 4KFBA 3GV7B 2YKNA 3AODA 1VC5A 4NX9A 2V8GA 4P2XA 4A8XA 2W9BA 5B09A 4CM2A 3FUYA 4I2QA 1RCXB 4DUTA 2XY7A 4LBIA 5CCMA 3DRRA 3CUNA 1R0CB 4ZLPA 1RA7A 3MMBA 5L9NA 4ZJOA 3FMWA 2IA6A 1SL0A 2DNOA 4O3SA 4RUAA 3NS7B 3BV8A 4AFFA 4RJVA 5B08A 1TK0A 2JH3A 3H59A 4RW4A 4RNNA 4NASA 5SUHA 4HHHA 4IFVB 4A47A 3RUBL 2HMIA 3PRVA 3CCQS 5DGBA 2LDYA 4QYZJ 1S49A 3US5A 2FLPA 1EP4A 1LXJA 2QC3A 2W7AA 4EBDA 2RILA 4C8NA 1J27A 2JC1A 1DURA 4JOUA 3HVTA 2YBVA 4NXMF 2CQIA 4G6VB 1YBAA 2VA2A 1YJRA 3VAJA 2VPXB 1UVKA 2RUSA 3IS9A 1SQFA 1LOUA 4LF6F 4FNHA 4OYZA 2C3UA 2OJ3A 3MR2A 1Y5LB 3CJQA 3CDAA 1AZSA 2WSCC 1YBTA 2DY1A 1BWVA 4ED2A 2ZNZA 1VQPS 1CG2A 2ZH1A 2KM8C 3I5AA 2V4RA 5AXMA 2CJ9A 2G0JA 1R6YA 2KTQA 2D3O1 2UU9F 3PJ9A 4IFVA 4A8KA 2QO3A 1RT6B 5DLGA 4J9VA 3Q8YA 2QG9B 3ZC4A 4Q45A 5CYMB 3W1YC 2H51B 3CJ2A 4WF9Q 1OSDA 3CDBA 4KGZB 3QRRA 3ENVA 5HL7Q 2WSFC 3D6TB 3GG0A 1TKTB 3LGMA 1RHUB 4P2FA 1U7LA 3BZQA 3WX4A 4EZ9A 2MTLA 5KFHA 4M94A 3R5CA 3G8SA 4WP8A 1FEEA 4FBUA 5JVHQ 1WC1A 1VHFA 2MKHA 4IRDA 3UCZP 3VHQA 2ZM6F 2DEJA 1EB0A 2BVZA 4IO9Q 2V2QA 3KK1A 1S6QB 4MMOA 4B9MA 1VRUA 1S0OA 3DLGB 3A8KA 1FERA 3OXGA 1RLCL 4DZDA 5KTQA 3O2IA 1X4HA 3K5NA 1VS3A 4PYAA 2J6SA 2ZNYA 2DNMA 2H48B 4N56A 4QIVA 3NNCA 1R31A 5KG0A 2E7XA 2PEBA 2GMLA 2G1DA 4YR0A 4C8KA 4Y3CA 1N34J 2JRSA 3HKZD 1TFYA 4LJMA 1OO0B 3CJKA 2QL5B 3ONQA 3TO8A 5DZ7A 2HRTA 2H54B 1Q1KA 1R27B 3M30B 1HWJA 4DG1B 1SKWA 1F3VA 3A1YG 2HQDA 3N0VA 5KT7A 1T8EA 1FJGF 2JLFA 1GAOA 2DXDA 4MYUA 1FNXH 1Q7LB 2WOMA 1VC6A 1DFDA 3CJ8A 4Y2IA 1RTZA 2OFGX 1YG0A 2PE8A 2Y3YA 5CH7B 2DCLA 2RE1A 3HHDA 2R7RA 5IS2A 3BGOP 4RW6B 4WTYA 3MAAA 4AXIA 3EDQB 3HXMA 4B3RF 2I6WA 2CJQA 2Q3PA 5KG1A 5ETMA 6FDRA 5EX3A 1OMSA 2OMOA 3DYAB 1YGYA 1RK8A 1RU1A 4NYOA 4OHYA 3V81A 2MQQA 3OXLA 1WSVA 4M5GA 2GHWA 4P73A 4IH5A 2NUHA 4MJKA 3K5PA 3M30A 4ILRA 4ECTA 5KAKA 2JOQA 3OD2A 4ELTA 1HMVB 5C25A 5HMWA 1N33F 3KLGA 4J5OA 4F4AA 1CQMA 2XZWA 5L1JA 1GXUA 3BKUA 1YJVA 2DRAA 3KG0A 5LM7E 4LF4J 3UR3C 2VG6B 1T9UA 1U1RA 3TZYA 1WEXA 2BQRA 3WX8A 2IJNA 3DC2A 3TANA 1M5SA 4CLSA 2HVDA 4ZP7A 3WC2A 1RAHB 1TV6B 4IQMA 4C11B 3CJ0A 3PW7A 1S1UB 5DZ6A 2IFXA 3TAPA 5GVQA 1AUSL 3DGVA 3M6UA 4KRWA 2QE5A 2FGCA 1WF0A 2CPIA 1H98A 4TNOA 3P96A 3V5RA 5CD4A 2OO4A 1XR5A 4DFMA 2OSQA 1WC5A 1VQ4S 3W9JA 1X5PA 3Q22A 2DNNA 4HL9A 4R8UA 2F5GA 2ZZTA 3ZTRA 5KOWA 5ETLA 5LJ5Y 2AF6A 3ULHA 5KT4A 3HFVA 5DRKA 4U8VA 4ED8A 1X4EA 2HBQB 1URRA 4OI6A 1VQ9S 2ADCA 2HNZA 3GIKA 2VG6A 2AJ4A 4URGA 4QPTA 4WTOB 2P5VA 1NAQA 3W7BA 4KPYA 2XQCA 4GMKA 3GJSB 4DR4J 1RHMB 2M4MA 3PNIA 4X4RA 4FS2A 4ILLA 3RBDA 3M9NB 1P1TA 4C11A 2XMMA 5F8LA 2MZRA 1QLNA 2NQPA 4NXNJ 4DPUA 1IKWA 4TQSA 2XS2A 1FF2A 4IR1A 2IAJA 3C15B 2DPIA 3HCXA 3OFGA 3OV7A 4P10A 4ECZA 2O67A 1S1TB 5KFPA 3NAHA 5C24B 1LEOA 1N5YA 2DNLA 2HQ3A 2OEJA 3PYDA 4PQUA 4DX7A 3BGRA 3H5SA 4A8FA 2AJ0A 5IV4A 4NEYA 3IAM9 2P6SA 4DLEA 2FDNA 2MMYA 2MKJA 8AT1B 4UQGA 3Q8SB 2N4DA 1MG7A 1ZAXA 3B4DA 4IOAQ 1X9WA 4K4UA 3MMAA 3VVTA 4RW8B 4WJBA 3THTA 1VOMA 3MEGA 3N5BA 3R5AA 1HD1A 1QSSA 1BHNA 1FFSB 2FZCB 2FHMA 1SC1B 3BQ2A 2XYGB 4NLYA 2ZUGA 2R7XA 3RAMA 2R7WA 2JL9A 3KG1A 2XI2A 4OZ0A 1N32J 2RT3A 4LSNA 4A8SA 1NPKA 4RKUC 2ZWPA 4PQAA 4C2MA 3PEJA 1U45A 3OFHA 4WK1A 3TVKA 1FDBA 4PG5A 4C3LA 4LSZB 3I9ZA 4O44B 4U8YA 2PFDA 4ED1A 1QE1A 3ZZZA 4URQU 3BPSP 4K4SA 2J6TA 1HWKA 3C6TA 4J91A 2XY5A 1N56A 2OEKA 4OV1A 4WFZA 4NL5A 1FTRA 1SV5B 2CPDA 2VKRA 3GPAA 2YX4A 2CG4A 1TZ0A 1B0TA 5ETVA 4OX9F 5CA5A 1PAUB 1VBZA 2GJ2A 3CC7S 3TP2A 3QIPA 3OTCA 5K5MA 4CH1A 1VBKA 1PYOB 4M95A 1NJZA 2HGMA 1YK9A 3UCUP 1FK9A 5DG7A 4BDPA 4ILMA 3MOJB 3QMQA 1NDPA 1R89A 9ATCB 5CABA 2D74B 3QO9A 1VFJA 4NXNF 3S1TA 4TYAA 4ZVRB 1N54B 4PWDB 5J2QA 3KG4A 5F8NA 1UPPA 2XO6A 3O6QA 3SZ2A 1D0EA 3ENWA 2VFRA 3L7PA 1T02A 1M1GA 2ZITA 1NU4A 4P2MA 2LEAA 1YJ9S 2XLJA 1X4CA 3NGTA 2VBXA 1SV5A 1U8WA 7FDRA 3BQ0A 1R3NA 3P49B 5KT2A 1LWCB 1BQXA 2IRXA 1U25A 2LEPA 5A8KB 4OHVA 4JV5J 4UT4A 3PM9A 4ZPVR 1FJCA 2CQ1A 3GU0A 4PR6A 5JUMA 1AXQA 1D9AA 1OYEA 2HWTA 2O5DA 2LYVA 3IO1A 2IA0A 5U47A 3K5OA 5HLFA 1P9YA 1N32F 4CRJA 3TEGA 1CJVA 2HURA 3BR9A 5T14A 4KHRA 2XBPA 4PWDA 5ETTA 4J9MA 4O4GA 1LW2B 1XQIA 3D6FB 3QZ8A 2M52A 2JWNA 2UUCF 2HHQA 4W4MA 4C8MA 4DFJA 4WPAA 5DDOC 5L1KA 3NGDA 2BJEA 3J81U 1KQFB 1MN7A 3JQKA 1KLMB 2RRAA 4UF4A 5GAHI 3OTOJ 5AJ3J 3VAKA 1UWBA 3BGLA 4A8MP 3I6PA 4FKXA 1Y3JA 5EN1A 2RU9A 2P9CA 1LWEA 1X4AA 4H4OB 3AD9C 3DRPB 4DN0A 4C48A 2HHVA 1UETA 1QVGR 2DHGA 3AJ1A 4KB7A 5F8IA 2KHDA 2ZBIA 3FK4A 2VU5A 2C3YA 3O1LA 1A0OB 4FPIA 3ZTOA 1Q5YA 3SCJE 4FF4A 3MZIA 2Z2MA 3MPYA 3M6VA 4IH6A 1Q0NA 5I3PA 1X5SA 3N79A 2DGOA 2MHNA 4C8LA 4USKA 2J0QD 1MU2B 1U49A 2YNFB 2N3LA 2BYCA 3LF0A 4EYHB 1L3VA 2R7TA 3BJYA 2Y0BB 3OW2R 2MZ1A 2DO4A 2XHCA 2SXLA 1JQGA 1OY9A 4P72A 1F0XA 1WHWA 3DGPB 2EFQA 5ETOA 2AGPA 5HMXA 3KMSA 2V4JB 3PW2A 2M3DA 5L8RC 4JV5F 2VPYB 5C2CA 5K14A 1BQNB 3TJAA 1IBCB 2OPQA 3ITHB 1LWXA 3D66A 1NSAA 3DLLQ 4LMZA 5GADI 1RABB 1T9YA 3RRKA 4ZN3A 3DRYA 1NKBA 1LW0B 3KJVA 1ZTWA 1LKZA 2KH9A 3HHKA 2AYGA 4LF8J 1UTAA 1JLQA 1M0SA 1P8GA 2YNFA 3CMAS 5DGAA 2BJ1A 4RW9B 5CCLA 3OR1A 2H5JB 3UCGA 2RU3A 2WW4A 3F44A 3KLHB 4NA1A 2D3UA 4AXJA 4B17A 4WFNQ 2E7VA 2CQ0A 2LU2A 4EZ6A 4W98A 4U7UD 1IBLJ 3WC0A 1U0HB 4RUCA 3OTOF 5AJ3F 4NA3A 3KK3A 3FGVA 3DGPA 2GJIA 4J9NA 2C3MA 2MGZA 3SSSA 5L1IA 5T7LB 1KS2A 3DKDA 3BN7A 1Q8KA 3Q2SC 2WVBA 1JLEB 3WDOA 2X3GA 1ZTTA 2V94A 3E01B 3GFXA 4USIA 2E9ZA 1SC6A 2V6AA 3ITHA 2YNIB 1JJ4A 3HO1A 1YQHA 3R3TA 2G2OA 4JUZA 2BE2A 2JSXA 2HG4A 3MPVA 2QV6A 2B3TB 2NYHA 2CXEA 2YY3A 3EYZA 4JV1A 1KDNA 1I3OB 3GJTB 4NCGA 3PRDA 3QRPA 4FF1A 2B6AB 3PDNA 2DH7A 5BYRA 3SSQA 3KJNB 4WK3A 1O8BA 2M9KA 2XSJA 4PG4A 3HFZB 4RW9A 1F2GA 1BUXA 2DGUA 1FD2A 3KLHA 3RBZA 1JB0C 1BLUA 1VQSA 4OIXA 3OJSA 4K50A 4J9SA 1Q16B 4QIFA 2RQ4A 1Q95G 1REGX 3IBWA 1U0HA 3H25A 1YIJS 2CJXB 2VQFJ 1C1BB 4NZ0A 3R2CJ 1RWXB 3GTYX 1IQTA 4HTJA 4WU2A 3VQTA 3MPUB 3R27A 3L4BC 1S7HA 4ZLNA 2W7PA 4KQZA 2X1FA 2CZ4A 4PXCA 5F0WA 3X1LB 5B0GA 2LA4A 1QAXA 4LF2A 3HLUA 1RAAB 4C0BA 1R8CA 4ECQA 3OVAA 1VISA 1JJCB 1S7IA 3ADAC 2XCAA 1HYSA 1PJ5A 4CP5A 2OTLS 2RRNA 3THVA 4LF8F 1T03A 2FJEB 2K1RA 1HKAA 2DNPA 1C4CA 1T11A 5JJBA 4DHVA 4K59A 1FCAA 2AD9A 2YWGA 4IYQA 1XIQA 4F3MA 4GVBB 1BXNA 1WI6A 4KHMA 1X5OA 1B0VA 6AT1B 3UVJA 3MEKA 3PKYA 1TVRB 5H9FJ 2CVIA 3TUIC 1FRMA 1YVFA 1F5CA 1QJHA 1PIEA 4XDDA 3EZ5A 1KVKA 5D3GB 2O66A 2YKMA 2W01A 3H5XA 1UPMB 2DHAA 5HN0A 3DHWC 2VDHA 1FRKA 3U27A 1RAEB 5HP1B 4WP9A 2AW0A 1NPRA 1IR1A 5LMUF 2VODA 5DM6Q 1UL3A 3NS6A 2EI5A 1RYSA 1O0PA 1XTZA 4ED5A 1GMWA 2BJDA 4OLOA 1RACB 1NNDA 2P9EA 1HQUA 2CIMA 2BKOA 3FDSA 2WHOA 2VPZB 3MWBA 4CI0B 5DS7A 1IJFB 2B4OA 1K1SA 3LPYA 2EKNA 5HMYA 1S5ZA 5LJ3Y 1UWAA 1WNEA 4LRBA 5D0HA 1N5VA 1TVRA 3A13A 1S0VA 5F8HA 4YUDA 2Z30B 3ET6B 2GQCA 2P2CB 2EWHA 3DLKA 3HSZA 5E3AA 2HFVA 4OZJA 2VG5A 1CQNA 2IC3B 3C8YA 5KFFA 3DMJA 2DT9A 1JLFA 1NDCA 2GVZA 3OVSA 2ZH3A 2XYPB 4AD6A 1IM6A 4DPOA 4R5PB 5B0CA 1KQGB 2HHUA 3CMQA 2H4WB 4K2JA 4ZJQA 2HK2A 1HW9A 2OHDA 2MLXA 3D3BJ 5DDPC 3VCDA 4A8WA 2VG7A 4QW9A 4S0MA 2OH2A 5E3CA 3FFIB 3OLBA 5KG7A 4WYWA 1TQLA 3J7AN 2YKAA 3FZBA 3Q8PB 4ZPWR 4Q8EA 2DTJA 1LWFB 4OYXA 2E5GA 1H6KX 1XR7A 2KT3A 3NMAA 1H72C 3UFCX 1V3SA 2DH8A 3T19A 1MSWD 1VQKS 4C3KA 4DEZA 2EK1A 1NJXA 3R5JB 3KLEA 3EMTA 2IC3A 3C16B 5ETRA 3TJ8A 1N88A 3POTB 1SPBP 2QFIA 2CQBA 4MKVA 1RWVB 2CQHA 4FNIA 3W2VB 1PBAA 1TL1A 3IFEA 1KWMA 2OELA 2N82B 3BSAA 4CO1A 2BANA 4O4RA 1WHXA 3CCWA 2VFVA 3BDEA 2KFZA 3FFIA 2WONA 1HQEA 1FRJA 1SJ3P 2IDEA 3AOBA 2IBKA 4LVNP 3BSNA 2R8JA 4DV5F 3I0RB 4ECVA 5HATA 5F9NA 1S4FA 1DY3A 3DDKA 2V2VA 5KFJA 2HNDA 1G1XA 2MQPA 5DG9A 1ZOTA 5IT4A 3NBPB 3A3NB 3QGGA 3B8HA 3P8BB 1L5UA 4F3OA 4PABA 4MIAA 2WCXA 3IAS9 4URSA 2NZ4A 4ZVQB 3DOKA 2ZFHA 1VMBA 2J9DE 2ZDOA 4H4KC 1HL6A 2RF2A 1VK3A 4GRSA 2QFJA 2EFGA 2HFOA 3EICA 2KFYA 2RKIB 4YOEA 2FY8A 1X9MA 4C97A 3OSNA 4DU8A 3JSYA 4KGXB 1S77D 2CPFA 4A8QA 1FE0A 2YKOA 3I32A 3HVAA 1HD0A 3QFHA 4Q2MA 3D2WA 2XS7A 2ZH4A 1D3WA 2W24A 1Y3KA 5IWAJ 1FDDA 2PO4A 3PJWA 3UD5A 1PCAA 3CCZA 2G13A 3UNYA 1CJKB 3I9V9 4QBUA 4XPEA 4DV6J 2C42A 3Q86A 1HIYA 5IT9U 3TAMB 4B3OB 1KSPA 1YLXA 1C0UB 1YKWA 3RRHA 3LP0A 1BE4A 3SMZA 4ZHRA 1VR6A 4DL3A 2HBZB 5LOQA 3NLCA 3TZXA 3OUYA 1RTDB 1ZBTA 2L9DA 2JEIA 2QX0A 5LL6d 2DNYA 3L9ZA 3IP0A 1YTYA 2W25A 1OYDA 2J8SA 1S9GA 2BDPA 3TR5A 2VDIA 2EBEA 4ZPDA 2RKIA 4DR2J 4QR2A 2PD1A 3D0IE 4OLPA 4MKAA 3G71S 3ISZA 5HQLA 4RLEA 1S1VA 3OTBA 1FJ7A 1RWUA 1RAFB 2KRRA 3FC9A 5DDQC 4NCBA 2Y8YA 3MECA 4F67A 3MDFA 1CJKA 3TAMA 4K7QA 4OYWA 3FVYA 2ZHBA 4DXLA 2CJKA 3L7OA 3AQOA 1U1MA 5KFUA 2B7BB 1VRQC 1N36J 1D9FA 3MM9B 2MDAA 2I8EA 5ADZA 4ELUA 2W7OA 3DOLB 2MXYA 2NREA 2CAJA 3O5TB 2CNOB 2HWIA 1P6TA 1NPPA 4XAKA 1RZMA 1TKXA 3RB0A 4EYIB 1IR0A 4ES3A 4HDGA 2OLWA 3AB2B 4RNOA 1AYEA 3PO5A 2CRLA 1KN6A 4IKAA 1Y11A 2YNGB 3EXYA 3MCOA 5F3TA 3SFUA 1XMOF 4ECRA 5M2RA 1Q82T 3MMCB 4YHHJ 4FKYA 4ZP8A 4HHUA 3CD6S 4WWSA 3T1YF 4NRUA 1TL5A 3M05A 2DBBA 2KN4A 3PZPA 1F9FA 3GFYA 2MQMA 3W2WA 4DV6F 3V6KA 1NLKL 4DR1F 4OFZA 5BJRA 4OZ5A 1MROB 5KFXA 3T5LA 3DLBA 1UJ5A 2XNRA 3QSIA 4DR6J 1RJJA 2FJBB 3DOLA 4EEYA 4RL1A 4CYUA 1ZA2B 4G1QB 2MQOA 2XMUA 1J5OB 2GAHC 4F4XA 4BWJA 2R2SA 3NG8A 3K2YA 3E8OA 2R8HA 2V5HG 3CJ5A 4AT1B 4RUBA 3UO0A 1NSPA 4FPRA 1CULA 1U1PA 2CNLB 4DR2F 2R7OA 3M1VA 3M2RB 4Z7CA 2Z58B 2IVMA 4KO0A 4A8OA 1FA0A 3OVBA 1PKUA 3OTEA 2WW8A 4U96A 1ZM2A 5DQHA 1IM4A 4IOBA 3D9BA 3KHHA 2RDJA 4PKDB 3G86A 3H2LA 4LRAA 3CJSA 3IWXA 2FVQA 2MQNA 3UI3A 4YEAA 2WVFA 3IBCB 3PTWA 4TU9A 2XEXA 4UTGA 4V19X 3ZZOA 2FYXA 4USMA 1N36F 1KRPA 3N6LA 3KLIA 1BQMB 2HW3A 1IKVA 2FJWA 3IMQJ 3D0HE 4M5IA 2B7CB 4OYMA 2LLZA 3QZ7A 3DDIA 3CJRA 1RWMB 4JI7F 3D6MB 4PWWA 1GEHA 4NCAA 3W5YA 2PA3A 3D5MA 3K57A 3KXDA 3NGUA 1KKHA 4DZ6A 1LFWA 1B64A 2E5LF 4EUVA 4R0EA 1QUPA 2XYHB 1H2TZ 3I4PA 4YHHF 1VQ6S 3M2UA 1TKZA 1M5HA 5M2UA 2F40A 4X4QA 1HI0P 1F60B 2VC1A 1S76D 2VFTA 3HD1A 1REVB 2Z0GA 3GJQB 4K4WA 2IRUA 3T3FA 1VI7A 2GVDA 1BQMA 1XC9A 4TQRA 1JIHA 2M88A 2ZOFA 5HK4A 5A8WA 4WE1A 4HLBA 4WXWA 3RU0A 3J80Y 1FX2A 5DM7Q 5EWFA 3H0PA 1SUQA 4H54A 1N48A 1U2FA 2F63A 4W90B 2D9PA 4H4MA 5E0OA 4TLRA 4DV4J 1P9QC 2V9KA 1RBLA 4NRTA 1EARA 4F4KA 5GAGI 1Q4RA 1TMMA 3CCJS 2C2ZB 1EQMA 1JNZB 2JHEA 4ZDNA 5KFKA 1SJ1A 4DR7F 2QJ3A 4JI3J 2FIUA 4ZMMA 1X0FA 5LSRA 2YQ0A 5EGYA 3DM2A 2N4CA 4L75A 4K2XA 2PIIA 2E1RA 5KT6A 4DU7A 2F9DA 3BH7B 4I7FB 5KFSA 2PMHA 1KFSA 2X51A 4KSEB 3CCES 2R7VA 2GGPB 2CQGA 3W65A 1KP6A 3D3CJ 4Z2XA 5D77A 5A76A 3Q2TC 4HACA 3I31A 3VALA 3PW5A 2ZD1B 2XMKA 3M4XA 1HWLA 1R0AA 5KFGA 2AGOA 1RT2B 4N8NA 3EGVA 1B99A 2GZOA 1QAJA 4JBCA 1T05B 3BB5A 3KHRA 1T95A 5KFOA 3KHLA 1IR2A 3RW7A 3DN9A 4HDHA 4FXVA 2B43A 4JI8J 4EWTA 3UDVA 4KV8B 4NLVA 4OZ3A 1XJWB 2DY9A 2RS8A 1ELOA 4U6PA 4X66J 1WD6A 2W2QP 2A3JA 2J5AA 5L46A 4DV1J 3UN3A 3DI6A 4M5DA 2HRYA 1HPZA 1UVJA 2ASDA 1H0HB 1S72S 4N76A 1D8ZA 4LF1A 3KK2A 1CEZA 1HNVA 3BYPA 3KLVA 3MM6A 3R1LA 5I42B 4IQXA 4PCQA 2BZ2A 2I9SA 2GO9A 1MLAA 1VLYA 2AZ3A 4LT6A 3ETOA 3N6MA 4CT8A 4L72B 1SH2A 1NEEA 1HWUA 2I0XA 1EHWA 3NAIA 2UUAJ 1HA1A 4Y65A 1RTHA 2HZCA 3MPDA 2IM3A 3LWMA 1VQOS 1HBNA 2DR8A 4P74A 5EWEA 1XNQJ 1HW8A 1OS5A 4J9QA 2QEXS 1V6HA 3D6HB 4KKOA 3WIVA 3DNCA 1HWIA 3I0SA 3CDUA 2CPYA 4CNYA 2EVZA 2V63A 4F50A 4ECXA 3EGZA 1SKUB 3HDSA 1BWEA 4ZCKA 3AB4B 3R5GA 5FLXU 4QWCA 4B08A 3EWGA 1RT5B 4M5KA 5ETSA 5I42A 4OI0A 1IQZA 4C98A 3HF5A 5CYQA 3CJ4A 4TLQA 2GC8A 2EFOA 4HEA9 1FWKA 4RBTA 3SCKE 2XHWA 5A0YA 1U48A 1WKLA 3T41A 3PFEA 4F4ZA 4I1TA 4NI2B 3FEYB 4ECSA 3IXQA 4C7QA 2V34A 2MPUA 4LRDA 3H20A 4ZP6A 5EHHA 1C2PA 1X4GA 4HH1A 4C0OC 2ZE2B 2E1PA 1H2UX 3F73A 3BSOA 1WEYA 4D3HA 5KFYA 1KLNA 1OPZA 1VYAA 4LF7F 3FEXB 5HI7A 3QGPA 3M32B 2ZHAA 2NCKL 4CO2A 2A10A 2R7SA 4DV1F 4WIIA 2RH3A 1W25A 3RBXA 2QL9B 4X65J 2AT1B 1IN0A 2ROPA 4UZCA 3I4HX 1QUVA 2CNNB 2VJVA 4RO0A 4FDFA 2YKPA 2QIFA 4OYBA 2UUAF 2H4YB 2QGFB 4AL6A 2NZCA 5GMDA 3NGSA 1N5SA 4BC9A 2KRBA 1HQ2A 2R2TA 4JI1J 2FJAB 3DOMB 4ZVFA 1HNIA 1F5BA 1XNQF 2DR9A 2ZE2A 3HZGA 4PRFA 5L39A 2DJWA 3VGUA 3JSMA 4KC5A 3M32A 1GQEA 2AJ1A 4M1KA 2XMJA 2B4UA 4X84A 2XI3A 1JK9B 1VRTA 1B70B 3A8IA 4ICLA 2CADA 3FZ2A 4WU3A 3MM8B 3TRGA 2R7UA 1ZM9A 1PBUA 2YTCA 1Q5VA 3G82A 3W61A 4YDXA 4JI0J 4KE5A 3PYGA 2VQEJ 2U1AA 3M9OB 4IRKA 2LU1A 1KHVA 4E2FB 1I51B 1VQ7S 1HNWJ 4E98A 3T5HA 1T94A 2A6MA 2NXCA 3G8TA 5IOLA 1XN9A 1OJ4A 2ZDPA 4ES1A 1SCJB 4P2SA 1SIWB 1EIYB 3EZUA 3PIPQ 5HO4A 3NY0A 5F0UA 1URNA 4USTA 5GAHU 5IC4B 4EGLA 4WFYA 2YH1A 2LCWA 4DSFA 4M8LA 2J7UA 3PX0A 2EC2A 2ZVSA 1WUUA 3MM5B 2ZH8A 1DQAA 2OTJS 3H7HB 3W64A 1WOOA 3SV4A 4DQSA 4X65F 2HS3A 1G4CA 1SJFA 4F4WA 4TY8A 3IG1A 4YY3J 2H1YA 3IC1A 5HAOA 1C0TB 2VKZG 1FDNA 1WC0A 2W9CA 3CSKA 3UWTA 4RW7B 4IRCA 4PXBA 4JYAJ 2ASJA 2GX8A 2XS5A 2B9EA 3FCWA 5K8MA 1J2VA 3MHYA 4CTAA 2ALZA 3P45B 4ETXA 2OEMA 4F25A 4JI1F 3DLHA 3J80U 1AFJA 4KHPF 3V6DB 3OL6A 4OZLA 5K8OA 1N8RT 2JVOA 2IBOA 4IO1A 1F2HA 3FNNA 3PX6A 2QLBB 2CG8A 2Y1RI 4NXMJ 4FP9A 2CPXA 4NLRA 1FKPA 4X4NA 2B9WA 3DLJA 3N9UC 4OHWA 5J1PA 2VOPA 4GO7X 2CQCA 3E51A 3GQCA 1N6QB 3GE9A 2BQ3A 1UP1A 1K8AT 4JI0F 1NK4A 1FRXA 2VQEF 4MKYA 2OPPB 4YDDB 2W8LA 2E1MC 1VIOA 3SV3A 2UU9J 3GIMA 4BCAA 1HNWF 1SH0A 2GQ2A 3CF5Q 5IFMA 3L7UA 3FBBA 4DS5A 5DQIA 2BJ7A 5KFQA 4NYZA 3K17A 3PVXA 4PUOB 3P4UB 2BE9B 5BXIA 2ACYA 1EETA 1S48A 1JXVA 1T3NA 3HJFA 2HLTA 3JYTB 4ECUA 2QSFA 1I1GA 1RWOB 4FN5A 4WIQA 4F3QA 4DSJA 1CJUB 4FYVB 4DL2A 3GV8B 5G0RB 2RVJA 5E41A 5BR8J 2QMWA 1QSLA 3OR2B 5HBMB 4FVCA 1U1LA 4O3QA 2ZM6J 3JAMU 3AT1B 2FJDB 2J0XA 2ZJPQ 1MNEA 3CD7A 3JQJA 3HVWA 2L9WA 1HLWA 2OFHX 2E29A 4KGVB 5H9EJ 4DV2J 1KTQA 2MSTA 3OBIA 3LA0A 3FCVA 4JI6J 4YY3F 1RT7B 1FX4A 4Q43A 2QT7A 3SDEB 1FVSA 3PYEA 1U24A 4QR0A 2W8KA 3VVUA 1Y5IB 4OI4A 4C4WA 5ETKA 4JYAF 1FE4A 3AJDA 4A48A 3EZOA 2KJVA 2GIQA 3AQPA 3JTOA 1HI8A 4ITSA 5FIIA 2ZEJA 3PR5B 3DHXA 3H5YA 1JLAA 4MK7A 3RGIA 4ED0A 2R3VA 5LT5A 5F8MA 1ZYQA 4QCLA 4KIAA 2E5HA 1FJGJ 1VCTA 4DR5J 4FYYB 3UDEA 1ZZFA 3G6XA 1HNXF 3JXOA 3LO3A 1SXLA 3RRGA 2FLLA 2HS0A 4J90A 2JVRA 1H3DA 2HHPA 5MAOA 2NS1B 2WSEC 3FSXA 1FDAA 1D8YA 3W5XA 4KH1B 3MM7B 4I4BA 2KVQE 4AL5A 5DDRC 4ZLLA 1RHJB 2E1AA 3WIUA 2QA4S 3OL8A 1ZH5A 4B3RJ 1U1OA 2BABA 4ZOSA 1Q78A 2FTRA 1U2CA 3Q8VA 5K9FA 2HFNA 2PMZD 4MKBA 2ATCB 1PJ7A 4YB7A 1S6PB 4DPXA 3UN2A 4LSLB 2YNHB 1NK9A 3ZZTA 2K06A 2C3PA 4NMXA 2VICA 4QR1A 4G1IA 2BW7A 4X64F 4QWEA 1MMNA 3M6XA 4EBEA 1SKSA 4YB1P 1N33J 4OQJA 4MIWA 5IXUA 1JLGB 3G96A 4PAAA 1FXDA 3HHLC 5BR8F 5K20B 1FFWB 3CD5A 2M8DB 3GR0A 2FZKB 3BEGB 2LQJA 4OJ1A 3FEZA 4QJVA 2KM8B 2MY7A 3CO0P 1JLCB 3NCQA 2P6TA 3M2VB 2Z2YB 3CW2C 3C46A 4LQ9A 4N5SA 4DV2F 5GMKa 3EX7B 4JI6F 2N7YA 4HI1A 2KB2A 3J81Y 2EW9A 1PGZA 1TL7B 3V6HA 2K3KA 3PV8A 2CA9A 2ALYB 2NXJA 2YX1A 3IGVA 4GC6A 4KJIA 4X62J 1RT6A 2QSWA 4RX6A 3TQEA 3EM1A 4LSLA 4IFYB 5LSOA 5CYMA 2CPEA 2BUNA 2YX7A 2VFSA 4L73A 3MFHA 1TKTA 2KXHA 3UN5A 3LTOA 3PCOB 2AHOB 2YWFA 1ZS6A 3MI7X 1JLGA 2HQCA 4DOZA 2MY8A 5HROB 4DR5F 1K0TA 1C1CB 4LF5F 5B0BA 2YXLA 4P52A 4UY8T 2RDIA 4NOHA 5RUBA 1PYSB 1DLOB 5D15A 1VQ5S 2KU7A 3HSGA 1S6QA 1V5IB 2HBYB 3EE3A 3DLGA 5D78A 2O1PA 4J37A 3LP2B 4AE5A 3M8PB 3QJJA 2ZJQQ 2BRKA 3TJ9A 2J76E 4I0WA 1W26A 1K73T 2R8GA 1DRZA 5A6PA 2JFDA 1KVIA 4ZCIA 2QL7B 4UUWA 3AD7C 3JB9k 4FF2A 4Y2KA 2XWXA 3OQ2A 1RYRA 5BYQA 1SJQA 4GKJJ 3AD8C 3CGIA 4CLFA 4OI1A 4DG1A 1Q8IA 2AKWB 3QAUA 5F41A 5HROA 1T3OA 2CZ9A 3GP9A 3M8WA 1DLOA 1FT8A 1RT1B 2XLKA 1VQMS 2CZVC 3R9LA 1OY8A 2GW8A 5D6GA 3PYFA 1WORA 3ENAA 1WOSA 3MMJA 3SYZA 4V19J 3M8PA 3H40A 4X4VA 1JLBB 1IKYB 4RW6A 5JVGQ 3MD3A 4DWIA 4ED7A 4USWA 1WDTA 4UUXA 4O3NA 2ACMA 3MFIA 1V3RA 3D28A 3N01A 1TTHB 1G6BA 5KFMA 2JZ5A 1EZZB 3K5MA 4X62F 3CCTA 2AGQA 3DYAA 1X5TA 3MEDB 2HZAA 1XK8A 1ITPA 1RCOB 2FHJA 2IM1A 4CWBA 3SQOP 3PW4A 5IT0A 5J1EB 2VOOA 4F02A 2IY5B 2IHR1 1RWNB 1HMVA 4Q0BB 2XMWA 4OX9J 5KG5A 2DKOB 2I2YA 3FQLA 3GSDA 3MEEB 5F3ZA 1S0MA 1OSCA 4USVA 1EQ0A 2YWKA 2FC8A 4DSEA 4Y00A 5KOXA 2VBWA 2NPFA 1JKHB 2QTWA 2CQ2A 2RUGA 1J5EF 1JNRB 1TV6A 1S1UA 2OPRB 1EJ7L 4OV6A 1RHQB 4DFKA 3BSCA 2WZ1A 1WJ9A 2EKYA 3UQSA 2IVFB 4CO3A 3QGIA 2IVYA 2HEKA 3UDLA 1ZM4A 2UV8G 1S1WB 4XTTA 3U1NA 1NJWA 4Y6IA 2F8EX 1K9MT 4OZ1A 2JEFA 2G1HA 1UW9A 3U1LA 3DXSX 3MCSA 4GKJF 1H73A 4FXDA 5I3QA 2M8HA 1UVMA 3BYRA 4YN3B 2DO0A 3IA0A 3BN4A 4MK9A 2HRUA 3NOGA 3TX8A 1MMDA 1KOHA 4I64A 1RSCA 2KHCA 3TVZA 3B82A 2BJ8A 2GHPA 1U6BA 2XCPA 3OPKA 4U7UK 4RUHA 1T9WA 1RTJB 1L3TA 1FRHA 3IRXB 5SZTA 3GIIA 1K47A 1NK7A 2YWHA 4DF8A 1KD1T 4MFBB 3LUYA 4BWMA 3V4IB 2HNYB 1UVNA 2IM2A 1CSJA 3A3OB 1FESA 4PEOA 3V6JA 1RISA 1RQ0A 3BBBA 3C15A 3T6JA 2K7KA 4RNMA 2FZGB 1TR0A 3VAHA 2J7WA 2GO8A 4P7TA 3HD2A 1U1NA 2UUCJ 1S1TA 5J2NB 1GK8A 5CYJA 5GMEA 1YRUA 5C24A 3GG1A 1YWXA 3QJLA 3A3PB 1RLDA 3GYNA 5L38A 1KONA 2DB1A 1OWXA 4B9LA 5L1LA 3K7RA 1WACA 1RT3B 4E8UA 1X0PA 2AJFE 4NZ7A 4RW8A 3PKMA 3CJTA 4J9RA 3QWPA 1XBWA 3KLFB 3M8QB 2AWZA 3AXMA 4CT9A 4GVLA 1GXTA 1N52B 1NUEA 1G2EA 2MZJA 1IBMF 1RKIA 1L3UA 1UEUA 3BO2A 3GWCA 2Q1LA 2MZTA 1X31C 5AXKA 5FJ4A 4F4YA 1JXLA 1ICEB 1RHRB 2AJ2A 3CO9A 4FF3A 4O44A 1UZDA 3RAXA 5LXYA 3I87A 4L76A 2LXIA 3I96A 1VQYA 1X7VA 2RHQB 2DGSA 2XMAA 3H90A 5DG8A 1H2VZ 3PHEA 2AX0A 2J9CA 3FMBA 4N41A 2IJFA 2E9TA 2O01C 1GMWD 2CWKA 1APSA 2ERRA 1P27B 1LQ9A 4DL0C 2D41A 2EXUA 3M8QA 1DQ8A 4J9LA 1EX8A 1RB0A 4HR2A 1SVDA 1S1XB 1U09A 4B02A 1RAIB 2GNKA 1RT4B 1E6YB 1P1LA 1I5OB 1VLOA 4CNZA 1WWHA 2IRYA 1R6VA 3KUEA 4PWUA 3BKFA 3MGJA 1OQ3A 2CQ4A 2PEHA 2HAIA 4JB8B 1UKUA 3UD4P 4UW2A 1S12A 2OP5A 1WTFA 4QWDA 1R8PA 3W9HA 2KG1A 1LFPA 4K4TA 5CHCB 2HVZA 1EKSA 2ZBRA 5KFTA 2OD6A 1RTIB 1TAQA 1MW7A 5KFIA 2RQKA 1WKJA 3G8QA 2FJVA 4B9TA 3IR6B 3M6WA 1Z1ZA 5KFLA 4I56A 3LP1B 2HVHA 3VZHA 1LWCA 1WC3A 2ZWOA 1GMVA 5C2GA 2FLOA 1PAEX 3Q83A 2IM0A 5DO2A 2F9JA 1GXLA 5A8KA 2CPZA 1IVZA 1RT4A 1E6YA 2XO7A 2AEJA 2H5IB 1TL3B 3S6EA 4ZVPB 3BBCA 2J6UA 1LNQA 1WG4A 4OL8A 5AE2A 1PSDA 2E1CA 1A9NB 4CQ1A 3TA0A 3RB4A 3NNHA 3QATA 3S7RA 1FXRA 2ZOGA 3VQSA 1LW2A 1UFKA 3QLHB 4DDFA 4DFPA 3NKYA 1UEVA 1H38A 2X1BA 3ILLA 4ZCMA 2CQ3A 3SCIE 3CCLS 3MD1A 4TKTA 4LF9F 2V4QA 1KLMA 1TK8A 4YQWA 2HLUA 5J2MB 2LA6A 3KJQB 1W2IA 1S9EB 3GB0A 2W2PP 2XSFA 1FKOB 1QAYA 3IR7B 4WKYA 1BC6A 2AJQA 2ZC3A 1WSRA 4NLUA 4ZPBA 3AOCA 2AEFA 4H4OA 4NLGA 3DRPA 2J0WA 2ZOMA 1VGYA 4CIOA 3LH2S 1TL3A 4KFBB 1V9OA 2DITA 3ZO7A 1Q7YT 2HQIA 2MSSA 2YKNB 3KFWX 2DR7A 4RWXA 5FDLB 5GAGU 2W9BB 3AOAA 5IT9Y 5D0RA 4KTQA 5I3UB 4I2QB 4A4JA 3QLHA 2R2UA 3IBFB 3MMBB 3BREA 1MU2A 1OIAA 1WELA 5G4DA 2J9EA 4EI2A 1QY7A 1UW4A 2J0SD 4Z37A 2CYYA 4ZP9A 4WFBQ 1PC5A 3ZZUA 4Y34A 2HMIB 3G87A 2QMUB 3TX0A 1UCNA 2DK2A 1RUSA 5FD1A 4B3SJ 3HMJG 2V4JA 4UOCA 1NHVA 1EP4B 4DPYA 3CC4S 4UQTA 3OL7A 2JJ4D 3PX4A 2W2MP 2JX2A 2W9AA 1BQNA 2XWYA 1RWPB 3G9CA 4LVOP 4NLTA 1S10A 2NYIA 1BMQB 5FDLA 1EAYC 2F1FA 1SI9A 3HVTB 5I3UA 1RXOB 2PSZA 1ZPWX 2HHXA 5LMUJ 2EK6A 3RB6A 1LW0A 1XERA 3IS9B 4WZMA 3QRQA 4NEZA 3BBFA 4BBYA 1U6ZA 4AYBD 1AZSB 3SXLA 4X4OA 4ZS6A 1NHUA 4DV3J 2MZSA 5LSLA 2W4PA 3PXGa 4YR3A 2X3DA 1AROP 3DDNA 3THPA 3HP6A 3BGFA 5E33A 3GYXB 4O0NA 5D4OA 2DNZA 3O44A 2B56A 2ZH9A 4CLPA 1T0TV 2N3OA 1YBUA 1NDLA 4WKRA 5T7LA 1YJWS 1FVQA 1R8HA 4LR8A 3OHBA 2UXBJ 1N0UA 4OYPA 5HVHA 2V9WA 2HFSA 3MUVP 1SL2A 1JLEA 4ZA1A 3E01A 3HT0A 3Q8QB 2LEBA 1YHQS 2XNQA 2YNIA 4DS4A 1U0SA 4ZKAA 3T5JA 4DL4A 4ZK7M 4K4YA 3GILA 3IM9A 2BR0A 1WEZA 2MKCA 3NGKA 2ZKUA 2FVCA 4F04B 1NHKL 3QAEA 2GMHA 2R42A 2B6AA 2GV1A 2FHOB 3KK1B 2F8HA 1VRUB 1K1QA 4QW8A 1YZ6A 2M7SA 3C6UB 1FFGB 4ZJLA 1ACMB 4QPXA 2R9LA 2HZVA 2C2MB 4GC7A 2C2EA 2DIUA 4LFAJ 3K59A 4QU6A 2E5IA 2OIHA 2IDLA 5E7OB 4AUKA 1KR4A 3OTDA 5D4PA 2HGNA 2GJFA 1C1BA 1JMTA 5KFWA 1LK7A 4B3SF 1ROFA 4C9DA 3GJRB 3CJKB 3J7ZT 1FNOA 1R43A 4ATNA 1SC4B 2B4PA 4C8OA 3VWSA 5KFCA 3NXZA 3JTPA 5IQ6A 1AT1B 3BQ1A 2AP6A 2WOMB 3C66A 2QRRA 2J7KA 4CLTA 2FD2A 4F26A 2MEWA 3U1MA 2DXFA 3FCHA 3C6UA 2AMCB 4Z7YA 1JX4A 2OAUA 5DJBA 5C42B 3MAAB 4DV5J 2DPJA 4DV3F 4KY3A 2CQPA 2LP4A 2JNJA 3NCPA 5KFBA 5C5JA 3VV2B 4P75A 1TUWA 5HJYA 2KI2A 4GVBA 2KZZA 3WHIA 2UVRA 1YRXA 3WQPA 4ANEA 3NWGA 2C22A 3LOUA 3KWMA 3MAQA 3V81B 2XMVA 2UP1A 3KJFB 2V8PA 2FQQB 2UXBF 5C7PA 2LQ9A 3GV5B 1NO8A 2AX1A 5D3GA 3PEHA 2HWHA 1VBYA 3C2PA 5C25B 3LAMA 3KLGB 4YB5A 2NXUA 3LGNA 4Y2AA 5AE1A 4L3NA 5HP1A 3OLAA 4LUBA 3WBZA 4EO6A 3IWNC 3GSIA 1NK6A 4P9SA 5ITHA 2XULA 1S59A 3UR0A 5C42A 2KVIA 3P5BP 4DR3J 4TYBA 1U2RA 4WBFA 3KDNA 1HBOB 1E6VB 3B54A 2R4FA 2XZDB 3J7YU 4P7VA 4LFAF 3T5KA 4QQBA 5IQQA 2HIYA 5EWGA 3CMES 2LXFA 3F41A 4R8UB 2PMWA 5T41A 4TY9A 1GMUA 4I67A 3ET6A 4R0JA 1KNZA 1IWAA 3AY0A 3Q8RB 3HKWA 2G0CA 3OT9A 1Y10A 4NWBA 3ZNUA 2C28A 4CLUA 1H74A 3QNWB 3QT5A 2HNZB 5E3PA 2B9XA 3Q8UA 4M63A 1FI4A 4CLWA 4R5PA 3RB3A 4DF4A 2DD8S 2MJUA 3ETMA 2NR0A 1B4SA 4F8RA 2VL1A 4OX7A 3HHLD 2HQGA 2KXNB 2KT5A 1QAIA 1IKWB 1HBOA 3RTVA 1E6VA 2BX6A 4N8OA 2IAJB 2HSEB 4F2SA 3F0NA 3KNGA 1TKDA 1LWFA 1M5KC 5DLFA 4TVAB 2RNEA 3LGHA 3QT8A 2H65B 3OHAA 4KGMA 2B0GA 2BOPA 3QWUA 1N5YB 2YQ1A 3S8SA 2MKSA 1N34F 3IGNA 4OHXA 4PQUB 2UVVA 2B5JB 3H8YA 3BGRB 4MK8A 3C16A 5KFEA 3POTA 3W8PA 3J81j 1MMLA 1YDLA 2ZVIA 3W63A 4B9SA 4K0KJ 3KHGA 3JS9A 3MMAB 3W2VA 3SQGB 2GS8A 4FVMA 3CVKA 3DU6A 2DXEA 3MEGB 4CZCA 1XMOJ 4I6WA 3OL9A 2BKPA 2OPSB 2QN6B 4L6V3 5K8PA 4KBIA 4HI2A 3T1YJ 3D0GE 2C3OA 2HHSA 2L41A 5MLCV 2L08A 4FXWA 4DR3F 4LSNB 1T9XA 3I0RA 2GMJA 1SC3B 4DR1J 3M8SA 3EXCX 2ZH6A 2HAFA 3X3UA 4O3OA 4OYAA 3NBPA 4X4SA 1QE1B 1U4BA 1OY6A 3QIDA 3GLJA 3KDOA 2ASLA 3RAQA 4DQQA 3C6TB 2B5JA 8ATCB 4Q44A 1KC8T 1NK8A 4EMDA 5KFNA 2W1BA 3K8VA 1DHMA 5KG3A 3VAIA 2COLA 1HBUB 4LF4F 3SQGA 3QIPB 3BPDA 4YR2A 2POKA 3ILJA 3TI0A 1FK9B 3CIMA 5FLXY 1CLFA 2OPSA 2WB4A 1N5QA 2Y0SD 5GAEI 5EUHA 1D9DA 1BD6A 3H98A 1RAJA 3FBFA 1T9VA 3KOAA 3QO9B 4GO5X 5F9LA 4B3OA 3D68A 3V4MA 3TVYA 2GA7A 2JFKA 1C0UA 3U02A 5J2QB 4X4TA 5DETA 4LRCA 2O3DA 5KFDA 4Q7AA 4HT5A 3M8ZA 3H5UA 1RTDA 2CWXA 4H4KA 1W2BR 2FC9A 2BRLA 3MTKA 2HVEA 3PACA 1GFWB 2VIHA 1WHYA 4M5HA 3LANA 3BF4A 4JI7J 1U47A 1NKCA 3LPEA 1UVIA 1WG5A 5THWA 2GIRA 1HBUA 1RHKB 4K0KF 4ENOA 4PG6A 4OYOA 2E5LJ 2Z56B 4DI6A 3W9IA 4DR4F 2Y9HA 4MH8A 2ROEA 3P3DA 2RAQA 2BQUA 2F8MA 3K58A 3VF0B 1F9EB 1A7GE 3ILOA 2FB0A 1KVJA 5LMNJ 5HLFB 4F7VA 1WHVA 4CDIA 1GX6A 1CJVB 3ZXWA 3N5FA 1YI2S 3CNQP 3QFWA 2BBEA 4O4GB 3MM9A 3FQKA 1AFIA 4QU7A 2MKYA 2LQ8A 3B78A 2VA3A 1NCLA 2KO1A 3T9ZA 1KBRA 4J7CA 4Q5VA 1Z2ZA 4EBCA 3TZZA 2VH7A 4CO4A 1ZM3A 4QWAA 3FRZA 1UWBB 2HFZA 4DPTA 4K4XA 4O0IA 2VV5A 3ZZRA 1DQ9A 4B3MJ 2VJUA 1ZETA 2DR6A 2F65A 1RGVA 1XNRJ 1FD8A 4JV0A 1LWEB 2YNGA 4M5MA 2FUG9 2VFUA 4FYXB 2LDIA 2HS4A 4R25A 1RP5A 4DR7J 3MMCA 4YP3A 3NWRA 1HHQA 2XZTB 4CLZA 1HNZJ 1GT8A 2A6OA 4YFUA 1OPIA 4OX8A 2CDQA 1X4FA 2LQ5A 1NZ8A 2KDOA 3HM9A 3IRWP 1M5PC 1ZAWA 1RU2A 1I6JA 2GQQA 3JSRA 1MROA 3UW1A 2FVPA 2MJNA 2R8IA 4OI2A 2DCUB 3CC2S 4G1QA 4ALZA 1J5OA 4DX5A 3SCLE 2NSBA 2HHHJ 4PPDA 4WZQA 4JI4J 3HSJA 2BMBA 5D4NA 3NP5A 2C2OB 5D4LA 3PY8A 1QTMA 2KFNA 4G65A 2HFUA 4U9RA 3M2RA 4FS1A 1DAXA 2F7VA 5ETPA 1Q8LA 1F6TA 2YPZA 2UZAA 1KOOA 1UVLA 3QT6A 5K14B 1WKKA 2OPQB 2PC6A 3PG9A 3OXFA 4LRFA 3CJ3A 1UMJA 5LMNF 4FZVA 2XM3A 1M1KT 4HYKA 3CCSS 1KHWA 3P6YC 1VQ8S 3KJVB 2QA4G 1BY9A 2UUTA 2P9GA 1NB2A 2Q6BA 3QQCD 1LXNA 2J8AA 3HFKA 2WTFA 1JLQB 4KYZA 2BACA 3B4MA 3BM7A 1CC8A 3OR1B 1QDUB 1SL1A 2APOA 2G9OA 3L3CA 2FGOA 3KUHA 3KK3B 2V50A 4CCHA 3HHNB 2XY6A 2QZ8A 4B3MF 2MGZB 4Y28C 1V5VA 1XNRF 1M5OC 2MLYA 4RBVA 3HJVA 1G7CB 4NLQA 4A8YA 3ZTPA 2NXEA 4EK2A 3FSIA 2ADBA 2IJRA 2CPJA 2UXDJ 1HNZF 2H3EB 4ZVOB 4DUZJ 3HI9A 2BE2B 2Y8WA 5B7WA 2MQ8A 3RZAA 4I2PB 1JJHA 2NXNA 2V68A 1UZHA 3HULA 2AU0A 1N0VC 2CFXA 4DN9A 1REVA 4NCGB 3D1QA 2WRMA 1NH7A 1QM9A 3CT9A 2PT0A 3SSRA 3V2UC 2HBRB 2G4BA 2A0FB 2XSJB 4OZ2A 3CULA 2DNKA 1CS4B 5H9FK 3HZEA 3R6GB 4J9KA 4X4PA 2G2YA 4ZIWA 3H4BA 2JEJA 2HHHF 1N4LA 1Y9OA 2F3JA 1XR6A 5E5NA 4JI4F 3AAWB 1TFWA 2E9RX 2EPIA 4ES2A 4XO0A 4CM0A 2JLGA 2DHSA 1Q8BA 4ZVSB 3GMGA 1XMBA 2FHKA 3JAMY 2ABYA 2OUGA 3RBEA 2OGUA 2Q43A 1WC4A 4HH0A 3H4DA 3FBCA 3T1HJ 2HPUA 3AJ2A 4LF7J 2ZHOA 3PRBA 4A46A 3TA1A 2I5JB 5JMNA 5IC6B 2MHEA 4I2PA 1DBDA 1VJWA 4LFBJ 5KT5A 4I7FA 2MZQA 2DHXA 1VC0A 1HYSB 1UEKA 3G6YA 2GGPA 2D69A 1UJ4A 3TEHB 1CS4A 1IXKA 3NRBA 1Y5NB 2ZC4A 1T03B 2K1RB 3RJMB 2V2KA 1LK5A 2ZH5A 2ZD1A 1Q86T 3ISNC 1HHSA 4TN2A 4ZCLA 1RT2A 1HI1A 3JQMA 3K5LA 4X4UA 1FJEB 5ETNA 4JI2J 1FRLA 4WP3A 2VZ9A 3R5DA 5H1SV 8RUCA 1T05A 2LXUA 1Q79A 3UVJB 2RHSB 1HHTP 4OI3A 3OFEA 2K3IA 4PZVA 4FYWB 2IMWP 4KV8A 2ILYA 1M5VC 2EC0A 4ZLJA 4W92B 4USJC 1YX2A 4JV2A 4RZRA 2YKMB 3GCXP 3EPGA 2WVEA 1RDRA 2UXDF 2I5JA 3LW5C 3OSPA 3CEDA 2XB2D 1S0NA 4DUZF 4DMZA 4G3IA 3QYYA 4ID5B 4IG0B 1U1QA 3OJUA 1DZ5A 3J7A1 2KKHA 4DL6A 3BH6B 3QJPA 4QWBA 4ED3A 1AA1B 3DRSB 1YJ7A 2BW2A 4DCOB 3OFFA 2XGQA 3GYGA 1HQUB 1Y4ZB 3ILIA 5F8GA 3T9NA 3MTJA 3C3LA 2RRBA 1TMJA 5J1NA 4CH0S 4QYRA 3Q24A 1RADB 2Y1IA 3B6BA 1F9HA 1UFLA 1IBLF 1RAGB 3T6BA 3AHPA 3UDCA 3D7SB 1HARA 4BS2A 2WVCA 1S6UA 4DCJB 5LXRA 5B0AA 3DLKB 4AQYJ 1AB8A 5E3RA 1F1BB 2VG5B 4CH7A 3DMJB 3MOZA 3T1HF 4CO5A 3MXHP 2C2KB 1JLFB 2GVZB 2DIVA 3AXKA 2RB7A 4LFBF 3QSYB 3MCNA 4ID5A 3QPIA 4IG0A 3VGTA 1KFDA 3GZ7A 1FRIA 1RT5A 1WOPA 4N77A 1HR0J 2QA1A 2R7QA 3M8YA 1NRKA 4MTPA 3DRSA 5B0EA 4O3RA 3LALA 2VG7B 4UOHA 1PO6A 2QYGA 3VGSA 9RUBA 3TAQA 2OSRA 3CE8A 4QZVB 2UUBJ 3EGNA 4GKKJ 2QA2A 1B0PA 2XC9A 4NI2A 2L3MA 2V69A 3NNAA 3K0JA 2CJBA 5K8NA 4JI2F 3TNVA 1RWWB 2VQFF 4ERDA 1BGXT 2W4CA 1EKRA 4L3KA 4KHPJ 1WTBA 2W2NP 1CBKA 1RE1B 3EVOA 2ASYA 5I4MA 1MN9A 2D3ZA 3KLEB 2OMLA 1DARA 2Z8QA 1VQNS 2WAQD 2BM0A 4MAKA 2NLWA 2KT2A 2AZ1A 3HHEA 1PILA 1SKRA 1TUVA 1DTTB 3EVWA 5IV3A 3MPWA 1TL1B 1CJTB 2DRBA 4UY85 1G3OA 2BANB 4NLPA 1VQLS 3CD0A 4BHQA 2E7WA 4QIWD 3TARA 5JXSA 1F3FA 2QLJB 4PG7A 2WONB 1HQEB 2DNGA 4F2RA 3I56S 4Q8FA 4UOGA 2A2CA 1H7WA 3M9MB 2E5JA 3IR5B 2HNDB 2FY1A 4K4VA 2DGWA 3H2VE 3DOMA 3BR8A 2U2FA 2IMOA 2CJAA 3EGWB 2EFNA 2AV5A 4AQYF 3DOKB 2HYIB 5KFVA 2ZKTA 2RF2B 3DRXA 5A2QY 3NL0A 1GNKA 2AYMA 3A8JA 1DTTA 4I6AA 4RU2A 1CJTA 2DH9A 4CLLA 3BGUA 2BOAA 1MWZA 2IYIA 5IZHA 3MM8A 4DV0J 2H9ZA 1FTCA 3D1HA 1U02A 2RIJA 3W5ZA 1RI7A 4NLXA 5CD4H 1HR0F 1S79A 2CKWA 5HVFA 1T7PA 3UNGC 2B8PA 1ZAVA 4ED6A 5AT1B 3MUMP 4B9NA 2BE7D 2UV8A 1PC4A 3TZWA 3ELHA 5KG2A 2DGTA 1A6LA 1HBMB 3LP0B 2R2RA 2UUBF 4GKKF 4ZHRB 2J9DA 1U26A 3IN5A 3JSBA 2PI4A 2ATLA 4DQRA 1QSYA 2C2RA 1XMQJ 4EFAC 3EVMA 4JP8A 3OUYB 2FVSA 4QIGA 4NE9C 3EUNA 3GIJA 3VAMA 3R7NB 2Z2ZA 4I68A 3KMQA 3TUPA 1MWQA 3GCWP 1S9GB 1N5TA 1Z4UA 1RAOA 2FLNA 3UE2A 1FNMA 1TAUA 2UVUA 1HNXJ 4ED4A 4OZNA 3LWLA 4I69A 4FBTA 4USHA 3MM5A 3N4WA 1RWKB 4M5LA 2FHJD 1S1VB 2XMTA 3KYLA 1JWWA 3MECB 4DL7A 4TU8A 4N47A 1O6XA 7AT1B 1TELA 1YRTA 1XWLA 1C0TA 1YJUA 4ID8A 2ZJRQ 1U1KA 5GADU 3SFGA 6FD1A 4C6AA 1K0VA 1HBMA 4C8YA 4IG3B 4RW7A 4HT7A 4Y2CA 4ANCA 2D3OR 2DRDA 5F8JA 1FWLA 2UXCJ 2GAGC 3BDPA 5D0EA 2B51A 2FVRA 3DXBA 3ENQA 1Y00A 3HPOA 2H5EA 3V6DA 1FO1A 1JXEA 3GIRA 2HHTA 4X64J 2K8GA 1LV5A 1TKXB 5A6WA 4KPCA 3VZIA 2YQ3A 1YZ7A 4ZVUB 5ETQA 4B9UA 4DSLA 3CCMS 3MR5A 3T1AA 5BYSA 2CPHA 4XK8C 3AA9A 4DV0F 2X1GA 1RBAA 2E44A 1N6QA 1QVFR 4E0DA 5AE3A 1FWPA 2KYXA 3TUJC 3CXCR 2RS2A 2OPPA 2PI5A 3W2WB 2VF3A 2DYAA 4IG3A 1FHTA 2HVIA 4K8RA 2EFVA 3QBCA 2L9NA 4L74A 1MWYA 2MKKA 3AA8A 1TU0B 1FKAF 2LVWA 2MQLA 3HT3A 2MKIA 5EX0A 3SIPB 4ER8A 4PUOA 1XMQF 2RSQA 4LIRA 2GCFA 2CVEA 4CYUB 4AL7A 1DJ0A 1L3SA 4ZVHA 3R2DJ 3JYTA 3MR3A 3LAKA 3W66A 2C2DA 5AXLA 2QLXA 3TW0A 4DQPA 1CJUA 4LR9A 1UAWA 2LFVA 5G0RA 1Q81T 1CULB 5HMZA 1ZZNA 2Z2LA 3OR2A 2LKZA 5HBMA 4LF5J 3A4TA 1KQKA 3M1VB 2BKNA 4RWWA 4KO0B 5CZVA 3ZZYA 2XLIA 2FPHX 1AUDA 3R6LB 3Q89A 5HQ8A 2V2ZA 4WYLA 4N7TA 4U95A 5CXTA 2YVSA 3K8WA 5IWAF 3JTNA 1X8DA 3RW6A 3CDWA 1RT7A 1GTEA 2MLZA 1SJRA 1M1HA 3SDEA 4IR9A 1Y7PA 3ZZ0A 4QOTA 2M5YA 2EG2A 2AIRB 3KLIB 2UXCF 2V8DA 5IM0B 4NLDA 2I1RA 4ZVTB 1VDHA 4ZITA 1IKVB 4Y2MA 4UZBA 3DFEA 1ZA1B 2UVWA 4P6QA 3EDRB 3R8YA 1NKEA 3D4JA 1Y0HA 2G2ZA 3HX9A 4PPZA 4DSIA 4CLKA 4NMLA 2AYBA 3PJXA 5HQMA 2V8HA 2A18A 4UOFA 3ZZPA 1TK5A 1OQ6A 3MURP 2YH0A 3HSDA 2Q66A 3M8RA 1SQEA 2DNQA 2IYGA 3PFOA 2HK3A 4ETZA 3O3LA 1I94J 3M2UB 1TKZB 3MM7A 1KTVA 3CWJA 2ILZA 4BC7A 2HQFA 1FXLA 1FEHA 2YPYA 4WFAQ 3RG6A 3ZTSA 2DGVA 1YJNS 1U6FA 2RJZA 4KH0B 2ZH7A 1R8AA 2CUYA 1IBKJ 1K44A 4XIUA 1NDKA 4M5JA 3NS5A 1RA6A 2GVDB 2HHWA 4F0HA 5IM0A 1S6PA 1R7IA 2ZBQA 3I55S 2OI2A 2VHGA 2YNHA 5B0FA 2DNRA 5A8WB 4WE1B 3CDEA 3TA2A 1PG5B 1S99A 2ZBCA 1SUQB 3HHLB 2VBYA 5HJXA 2YWEA 4H4MB 1VJQA 2HIQA 3TQ1A 4NLSA 1NM2A 1NH8A 1NSQA 3EPIA 3MAHA 3SEOA 3G6ES 1RBOB 3BO4A 4LBPA 2ZZMA 2XTJP 5CAAA 2KJWA 3S01A 1JLCA 2Y1JA 3M2VA 1J5EJ 1XEZA 3AFGA 3FRYA 3DM2B 2CDRB 3G2XA 1R0BG 2F4VJ 1X4BA 1TL7A 1WF2A 4QIEA 3R1HA 7FD1A 1O5JA 4WFXA 4BLGA 4C0HA 1IKXB 4IFYA 3NEKA 5DQGA 4DR6F 2B4VA 4HACB 3Q23A 1IWGA 4RPFA 3PHTA 2BV3A 3HHLA 1S6OA 4ZIVA 1R0AB 2UUWA 2VONA 4Q2LA 3I5CA 3L95X 4NA2A 4K4ZA 3ZTQA 2D9OA 1O51A 1C1CA 4PYDA 1UFWA 3RR7A 2RDDA 1PYTA 4KGKA 2X7IA 4LFCJ 4DSKA 2RQMA 4J9UE 4J9OA 2K2PA 2WBMA 1TL4A 4NZ6A 3CCUS 4LREA 2DEIA 3LP2A 1I94F 4ZPAA 2PFFB 3ZNJ1 5A2QU 4B3TJ 1YJTA 1GX5A 3EJMA 3DI6B 3FBEA 4M5DB 1HPZB 3CTRA 3C19A 3U7JA 3KK2B 1IBKF 1IKXA 1HNVB 3KKFA 3MM6B 5KG4A 1VIXA 3KUGA 3BO3A 4ZVEA 3CPWR 3GFZA 4DX8H 2P8IA 4EO8A 1RTHB 3DU5A 4O23A 3A12A 5KT3A 2PN6A 4NLOA 1HBNB 5E3QA 2EFPA 2AQ4A 1NXIA 2M2BA 2G0IA 4NLWA 1RT1A 2I38A 4KKOB 3QGHA 3I0SB 2DNHA 2WB1D 2N7CA 1IBMJ 2PGCA 1JLBA 1IKYA 2A2DA 2NPIA 1YITS 1ULRA 3MR7A
chains in the Genus database with same CATH topology
1YQHA 1T3NA 3HJFA 3NBPA 4PXDA 4U7CA 2HLTA 3R3TA 3JYTB 4X4SA 2PA8D 2F4VF 1SBRA 4ECUA 1QE1B 4KR0B 1U4BA 4JUZA 2BE2A 2JSXA 2HG4A 2QSFA 3QIDA 3O8WA 3MPVA 1I1GA 2QV6A 3A8EA 3GR1A 2LQBA 3RAQA 2HGLA 2ASLA 2B3TB 4DQQA 4FN5A 3FJ2A 4F3QA 4DLGA 4DSJA 5KG6A 4DL2A 3C6TB 2B5JA 2YY3A 4Q44A 3GV8B 3MEDA 5G0RB 3EYZA 2RVJA 5E41A 3CCVS 4JV1A 1UJ6A 4NCGA 4OMFG 3PRDA 4WCEQ 1KC8T 2QMWA 3GFHA 1QSLA 3OR2B 4FF1A 5HBMB 2B6AB 4FVCA 3PDNA 1U1LA 4O3QA 1NK8A 4IOCQ 5CYQB 5KFNA 2DH7A 2ZH2A 5BYRA 3SSQA 4WK3A 3K8VA 2FJDB 1O8BA 4DBQA 2J0XA 2M9KA 2ZJPQ 2XSJA 4PG4A 1DHMA 1MNEA 3CD7A 5KG3A 4RW9A 1F2GA 3HVWA 2LMIA 3VAIA 2DGUA 2L9WA 2COLA 3RR8A 5AXNA 5A0YB 1HBUB 5J1EA 4LF4F 3SQGA 3QIPB 1FD2A 2OFHX 4PG8A 4YR2A 2VD3A 3KLHA 4KT0C 2E29A 4Q0BA 1JB0C 1BLUA 4DL5A 1VQSA 2POKA 4OIXA 5H9EJ 3OJSA 1KTQA 4DV4F 4K50A 2MSTA 3OBIA 4J9SA 3W3SA 3TI0A 1Q16B 1FK9B 4QIFA 3VAFA 3CIMA 5FLXY 2RQ4A 1CLFA 2OPSA 2WB4A 2RMLA 3MEEA 1N5QA 4YY3F 2Y0SD 3IBWA 1RT7B 5GAEI 3H25A 5EUHA 4Q43A 2QT7A 1YIJS 1D9DA 1BD6A 1L3KA 3SDEB 1FVSA 3H98A 1U24A 4QR0A 1C1BB 4NZ0A 4LFCF 1RAJA 2W8KA 4HHJA 1IQTA 1Y5IB 1JKHA 1NJYA 4HTJA 4WU2A 4JI3F 3QO9B 4GO5X 4OI4A 5F9LA 3KOAA 4B3OA 4C4WA 3VQTA 4JYAF 3R27A 1FE4A 2BA9A 3V4MA 3TVYA 4A48A 1S7HA 2W7PA 2GA7A 4KQZA 2KJVA 2JFKA 1C0UA 2CQDA 2X1FA 2GIQA 3U02A 2CZ4A 4PXCA 5F0WA 3X1LB 1NZAA 3AQPA 2OPRA 2AYEA 2VASA 5B0GA 5J2QB 4X4TA 3JTOA 2LA4A 1HI8A 3P5TL 1QAXA 4ITSA 4WXOA 5DETA 4B3TF 5FIIA 2O3DA 5KFDA 4B9VA 4Q7AA 3PR4A 3PR5B 3DHXA 4HT5A 3H5YA 3CIZA 3HLUA 4C0BA 3H5UA 1R8CA 1RTDA 1JLAA 4MK7A 5GAEU 4ECQA 4ED0A 4H4KA 3G4SS 3KTQA 5LT5A 1Z2LA 3OVAA 5F8MA 1W2BR 2FC9A 2BRLA 1ZYQA 1S1WA 3MTKA 4QCLA 3PACA 4KIAA 2E5HA 3UD3P 2XG8A 3G6VA 1WHYA 2XCAA 4CO0A 3LANA 4IDKB 1HYSA 1ZZFA 3G6XA 1M90T 1HNXF 3KNAA 2JC0A 3ICLA 3LO3A 2JLEA 1SXLA 3BF4A 2OTLS 4HTIA 1U47A 4DJBA 1NKCA 1C4AA 2RRNA 2NSCA 3THVA 3RRGA 1UVIA 1WG5A 1SB6A 2FLLA 2DGXA 5THWA 2HS0A 4X2BA 4LF8F 2GIRA 1HBUA 2JVRA 3F56A 3NCRA 1H3DA 1T03A 4ZPTR 2FJEB 2K1RA 2HHPA 2DNPA 5MAOA 2NS1B 4K0KF 4K5RA 2WSEC 5KFAA 4PG6A 3FSXA 1C4CA 3RYLA 1FDAA 2VUGA 1D8YA 3I5BA 5JJBA 2VPWB 2VB6A 4DHVA 3MM7B 1FCAA 4I4BA 4K59A 2AD9A 5L9XA 4AL5A 5DDRC 3HVRA 2YWGA 2E1AA 2QA4S 1HNIB 4OJHA 2V0NA 4DR4F 3OL8A 1ZH5A 4MH8A 2ROEA 4IYQA 1U1OA 2BABA 3P3DA 4ZOSA 3CB4A 4D3GA 1Q78A 2FTRA 2BQUA 1RTJA 4F3MA 1ZPVA 2F8MA 3K58A 3VF0B 4JI8F 5K9FA 1X4DA 1A7GE 2HFNA 1WI6A 2FB0A 1KVJA 4KHMA 1X5OA 2R8KA 3IRXA 1B0VA 3MEKA 4YMEA 3PKYA 3J7Z5 1TVRB 5HLFB 2DGQA 1WHVA 1NB7A 5H9FJ 2PMZD 2CVIA 4MKBA 3JSMB 3TUIC 4OJGA 4MFBA 1GX6A 1FRMA 1YVFA 5J2PB 4X66F 1F5CA 4YB7A 1QJHA 1S6PB 3N5FA 2BM1A 2HNYA 3V4IA 1YI2S 4LSLB 4XDDA 2YNHB 3EZ5A 1NK9A 3ZZTA 2BBEA 4O4GB 2C3PA 5D3GB 4EU0A 2O66A 2YKMA 1VRTB 2AGQA 4DQIA 3MM9A 3H5XA 2DHAA 3FQKA 4ICLB 5HN0A 1AFIA 3E2EA 4QU7A 3B78A 4QR1A 2E66A 3DHWC 2VA3A 4G1IA 4X64F 4QWEA 5CQGA 1FRKA 1MMNA 1KEKA 1U8SA 3M6XA 4EBEA 1WI8A 3U27A 3SI8A 2QMXA 5HP1B 2KO1A 1SKSA 2AW0A 4C8ZA 3T9ZA 3VR1A 4YB1P 5J2NA 4OQJA 4MIWA 5KFRA 5KFZA 5LMUF 5IXUA 1JLGB 2VODA 3G96A 4IDKA 5DM6Q 1UL3A 4Q5VA 3NS6A 1Z2ZA 1FXDA 4PXEA 2EI5A 3HHLC 1CC7A 1O0PA 1XTZA 3UPFA 1RYSA 4EBCA 5BR8F 4ED5A 2VH7A 3CD5A 2M8DB 4RNFA 4C3MA 2BJDA 4CO4A 1ZM3A 3CCRS 3GR0A 4OLOA 4QWAA 3FRZA 3BEGB 1UWBB 2LQJA 1NNDA 2HFZA 4OJ1A 1F5AA 5A8RB 4K4XA 4OX6A 4O0IA 1WF1A 2VV5A 3ZZRA 1DQ9A 2P9EA 2GFFA 1HQUA 2V8VA 3FEZA 2CIMA 4QJVA 4LQ3A 2KM8B 2MY7A 1ZETA 3I82A 3FDSA 1RGVA 2VPZB 2WHOA 3MWBA 1JLCB 3NCQA 2P6TA 1D1UA 1FD8A 3M2VB 4CI0B 4JV0A 5DS7A 1LWEB 2YNGA 2W4DA 4ECYA 3PO4A 3C46A 4LQ9A 2FUG9 4ZPCA 2VFUA 4N5SA 4DV2F 2LDIA 2HS4A 4R25A 1RP5A 5GMKa 3MMCA 3ISND 4RBUA 4YP3A 1IJFB 3EX7B 1RT3A 4RNHA 2B4OA 2Q6CA 1K1SA 3LPYA 4JI6F 2N7YA 1UA1A 4HI1A 2KB2A 3R5BA 3J81Y 1H7XA 5HMYA 1GT8A 5LJ3Y 2EW9A 3KLFA 1WNEA 1PGZA 3V6HA 3FSYA 4U67Q 1N5VA 2K3KA 3PV8A 3DLEB 1TVRA 4YFUA 1S0VA 5F8HA 4YUDA 1OPIA 4OX8A 2CDQA 2YX1A 3IGVA 4GC6A 4KJIA 1RT6A 2QSWA 4RX6A 2GQCA 1X4FA 1AW0A 5J2PA 4HVZA 2VBZA 2MB0B 2LQ5A 2WBRA 2KDOA 4MYTA 3HM9A 4LSLA 3IRWP 2EWHA 3DLKA 4IFYB 5LSOA 5E3AA 1M5PC 5CYMA 1ZAWA 1I6JA 2CPEA 2GQQA 3JSRA 4OZJA 1MROA 2VG5A 3UW1A 1CQNA 2IC3B 3C8YA 5KFFA 2BUNA 3DMJA 2FVPA 2MJNA 2YX7A 2R8IA 2VFSA 4OI2A 5EDWA 2A1BA 2DCUB 2DT9A 3CC2S 1JLFA 3MFHA 1TKTA 2KXHA 1V3ZA 4NYPA 5B0DA 2KG0A 3OVSA 2ZH3A 4G1QA 4ALZA 2YWFA 3J7YI 1J5OA 4G1PA 4MIBA 3SCLE 4DPOA 5B0CA 4R5PB 2NSBA 3MI7X 1JLGA 1KQGB 1SIZA 2HHUA 3HK2A 4TY8B 4LIWA 4PPDA 4DOZA 4WZQA 1JJ2R 3IG1B 2MY8A 5CZXA 5D4NA 3NP5A 5HROB 4DR5F 1HW9A 1K0TA 1C1CB 4LF5F 5D4LA 5B0BA 3PY8A 1SJ4P 4UY8T 2RDIA 4NOHA 5DDPC 3VCDA 2D7SA 1QTMA 1DLOB 4TXSA 5A8RA 2KFNA 4A8WA 1VQ5S 2VG7A 4QW9A 2KU7A 2KXFA 2W9CB 2OH2A 4ZVGA 5E3CA 4OJ3A 4U9RA 1S6QA 3AH6A 3FFIB 3M2RA 4FS1A 1DAXA 3BS9A 3IWL