2L3MA

Solution structure of the putative copper-ion-binding protein from bacillus anthracis str. ames
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
71
structure length
71
Chain Sequence
SNAMEQLTLQVEGMSCGHCVNAIESSVKELNGVEQVKVQLAEGTVEVTIDSSVVTLKDIVAVIEDQGYDVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title To be published
rcsb
source organism Bacillus anthracis
molecule tags Metal binding protein
molecule keywords Copper-ion-binding protein
total genus 18
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 2010-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2l3mA00
2L3MA 2IYIA 2ROEA 2XMTA 2AJ0A 4OJHA 1FE0A 2QLWA 2W4PA 2VV5A 1VQSA 1VQYA 1CC8A 1OSDA 3HDSA 4HH0A 1GXUA 1KVJA 5F0WA 2K1RB 1MWZA 2XMUA 4A48A 4A47A 2OFHX 3MCSA 3DCAA 1SQEA 1XBWA 2ASYA 3K7RA 5B0CA 1Y3JA 5B0GA 1IUJA 2OP5A 2VH7A 1P6TA 1S6OA 5B0FA 1TL4A 3QGPA 1YRXA 1FEEA 1OQ6A 1Y0HA 2K7KA 1CPZA 3HHLB 1OPZA 2HFOA 2XMVA 1Q53A 3BDEA 3HHLC 4HI2A 2GA7A 2KKHA 1AFJA 1N5QA 2OMOA 2K1RA 3F44A 1OQ3A 1GXTA 1TUVA 2AW0A 3FMBA 4HH1A 2G9OA 2LQ9A 4Q2MA 3KKFA 2BYCA 1KQKA 4FNIA 2QIFA 4EFAC 1APSA 1YJTA 1TZ0A 1YJRA 3GZ7A 4HL9A 3LGNA 4Q2LA 3CJKA 1AFIA 1TR0A 2JDJA 1URRA 1V3ZA 4OJ1A 2XMJA 4A46A 5B0BA 4QOTA 2KYZA 4YDXA 3MZIA 1FVSA 3UDCA 1SB6A 4OJ3A 2K2PA 1ULRA 2W4DA 2GGPA 2OD6A 4HI1A 1FESA 1SI9A 2RMLA 5A6PA 2XMKA 1X0PA 2CRLA 2BBEA 2N4DA 1AW0A 3HF5A 1Y3KA 3KNGA 2ROGA 2ROPA 3BF4A 3I9ZA 2W4CA 1X8DA 4FNHA 1FE4A 2XMMA 4Y2IA 1TL5A 1Y9OA 1YJVA 5KAKA 3HHLA 1YG0A 2LQBA 4NL5A 4OJGA 4A4JA 5B08A 2QYCA 2OD4A 2FTRA 2BUNA 1CC7A 3BM7A 2AP6A 2N4CA 4F67A 1U7LA 1R6YA 3DXSX 1S6UA 2PGCA 3LO3A 4ZOSA 1YJUA 2ACYA 3TOQA 4DPOA 4NPOA 5F0UA 1N5VA 2GO8A 5T7LB 3LGMA 2K7JA 4DN9A 3CJKB 2PD1A 1X7VA 2IYGA 2BJDA 3BGUA 3HHLD 2ZDOA 2QLXA 2IFXA 2RILA 1N5SA 3T9NA 3HFKA 2LXFA 1LQ9A 1RJJA 1FD8A 2GGPB 4OIXA 1WD6A 2KT3A 2AJ1A 5T7LA 2FHMA 3QMQA 1KVIA 2OKQA 2N7YA 2HIQA 3BB5A 3IWLA 4Y2MA 1N5TA 3WDOA 5A6WA 2LDIA 3FGVA 1MWYA 2RU9A 3BR8A 1JWWA 2ZDPA 4ZA1A 2KT2A 1Q4RA 2XMWA 3E8OA 3VTIA 4DL0C 3TRGA 5K9FA 3IWXA 1P8GA 1QUPA 1W2IA 2RSQA 1Q8LA 2GFFA 2GV1A 2OFGX 4Y2KA 1JK9B 2HQIA 2HFNA 2Q3PA 4U9RA 2FIUA 2BJEA 2HLTA 5B0DA 5IXUA 1Q8BA 2EW9A 2OAUA 5B0AA 1K0VA 1FVQA 2GCFA 3HX9A 3BN7A 5B0EA 3KG1A 4YEAA 2FB0A 3FRYA 3KG0A 3TNVA 2HLUA 5B09A
chains in the Genus database with same CATH superfamily
3PX6A 1JKHA 1UPMB 1X31C 1WKJA 2FJAB 3GYXB 4WK3A 1S0MA 4NI2B 1DTQB 1T9XA 2B4PA 3GYGA 1UVNA 1JXLA 3CCWA 2WW4A 2K1RB 3Q8YA 2O5DA 2OFHX 4QCLA 4EK2A 4R8UA 3MUMP 3PO5A 4JI5F 3Q2TC 4ED0A 3RW6A 4Y0FA 1S59A 2CQIA 2JWNA 3ET6B 4UZBA 1ZETA 1U45A 4CCHA 1LWCA 3NL0A 3W2WB 5CD4H 1X9MA 2CQ1A 4R0JA 4CLFA 5K20B 2DYAA 5DG7A 1RYSA 4DQPA 3OVBA 2KXNB 1QUVA 1LXNA 3R8YA 3BDEA 4CLWA 3O5TB 4I6AA 1DZ5A 2F7VA 4UW2A 1EP4A 4F26A 1JLFA 2GMJA 2BRKA 2ZC4A 3PIPQ 2HHXA 5D15A 2E7XA 3HVTA 1EETB 3MEGA 8AT1B 1OQ3A 3DHXA 2GNKA 2L48A 2HVDA 2L9DA 2GQQA 2LQ9A 3FMBA 1FWPA 4QYRA 4WP9A 5G4DA 4DLEA 1T11A 3THVA 4F2RA 2E9TA 3QO9A 3CCMS 2HWHA 3EE3A 3G87A 3SZ2A 3U27A 3M8QB 5KFCA 4WU2A 2JDJA 3WQPA 3H42A 3RB6A 5GMKa 2YKPA 4DSLA 3WC0A 3MZIA 1NK9A 3M8YA 1I51B 2QMXA 1EQMA 1IBLJ 4RPFA 1DTQA 4O3RA 3VAMA 2RJZA 2QA2A 3NOGA 1N33F 3ZZTA 2VBXA 4QYZK 3HD2A 2RE1A 4R8UB 3W60A 2ZVIA 5D0HA 5JVGQ 5CH7B 4MYTA 3PW7A 4C98A 1HBUA 1VQOS 2RF2B 3DLKA 2GW8A 1HI8A 1X8DA 1NPKA 2WW8A 2ZBCA 1BMQB 3DOMB 4J7CA 4V1Ak 1FJEB 1M5VC 1RAFB 2QG9B 3M2RA 4RJVA 3VALA 1J5OB 1CJVB 2MEWA 3AOCA 4JI3F 2M4MA 3HHEA 1YKWA 4WPAA 4ZHRB 5CAAA 3GQCA 1BUXA 2AYEA 5DQHA 3V6HA 1TK0A 1QTMA 1FKPB 5F0UA 1WI6A 1B7FA 1WHYA 2ABYA 3LP0B 2AKWB 4DN9A 3QZ8A 4IO9Q 1ZA2B 5KT5A 2C42A 1YHQS 4FBTA 4C4WA 4IOAQ 2KDOA 4AXIA 3LQVA 1RKIA 4ID5A 4YN3B 3H5UA 4PG5A 3QBCA 4K5SA 4OI0A 3G96A 3FVYA 4KH0B 1WC4A 4DCPB 3HFKA 1KP6A 2B3TB 1RTHB 2B9XA 2X1BA 4DF8A 3P45B 1MU2A 3PZPA 2H48B 4TU8A 1O6XA 4C9DA 2HRYA 4RWXA 1S97A 5IWAJ 2LDIA 1PKUA 1MWYA 1NDCA 3DLJA 4DR1F 1WG1A 3H98A 2FHOB 2XI3A 4MKBA 4ED6A 2IVFB 2BACA 4HEA9 4USIA 4F4YA 3PJXA 3J7ZT 1CJUA 1HNZF 1EQ0A 2Q3PA 3MM8B 4UZCA 1SV5B 4G1IA 3W65A 2MZJA 4OMFG 1X9SA 2HFSA 2KHDA 1S79A 1NZAA 3D1QA 4P75A 3ZZOA 4LSNA 3A3OB 2Z58B 2VBZA 2YNHB 2DD8S 3PACA 2UXCF 1M5SA 2HLUA 1B4SA 3QJLA 3MM9B 2GVZA 4H4OA 4HT5A 4OHZA 3GV5B 2HSEB 3I32A 3EGZA 2ASLA 1ITPA 3PEHA 4KGZB 2WRMA 3AB2B 3HDSA 1UWAA 3OBIA 2DR8A 3B8HA 2CDRB 4FVCA 3I5CA 2XSJB 3FDSA 4LF6J 4DV6F 5ETMA 1G2EA 1M5KC 4KGMA 1XIQA 3OTDA 2ILYA 4ZITA 2F40A 3UVJB 1RTHA 2ZOFA 4IH7A 1HIYA 5CD4A 5B0GA 4QWEA 2VBWA 5G0RA 1BQNA 4TQRA 4O44B 3UO0A 4EI2A 3OFHA 2VA2A 2V2ZA 2B0GA 3KK1B 3CMAS 4YB5A 2IMWP 4LF4F 2XYGB 3DGPB 3C15B 3PRVA 2K7KA 2VQEF 3OW2R 3NNCA 4Y6IA 2RQCA 3THPA 1MMNA 4XPCA 2MHEA 2RRNA 1E6YB 1SKRA 3G2XA 1RI7A 1AFJA 3DLBA 4G1PA 2HWTA 1B99A 3D0HE 2UP1A 4TY9A 4WJBA 2XNQA 4JP8A 5IWAF 2AW0A 3G6XA 4EBCA 3D68A 3NMAA 3OXLA 4CLYA 2IY5B 4FNIA 1QSYA 1IBMJ 2WONA 1NJIT 2A18A 5CZVA 1APSA 1IM6A 2BANA 1WTBA 3LGNA 1VGYA 2BR0A 2QLBB 2NQPA 1DARA 2GX8A 2Y0SD 3D28A 4WZMA 5ETQA 3FEZA 2MXYA 2G0IA 1TKTA 3SQOP 4YUDA 4RWWA 1FVSA 3SCIE 2GVZB 4H4OB 4RR5A 5BR8J 5J2PA 3MR3A 1EJ7L 1WEZA 1BLUA 3M30A 2UUBJ 3P3DA 1WDTA 4C97A 4LRBA 5U47A 2O66A 2DNZA 1VJQA 1K1QA 4XDCA 3QIPA 1FRLA 3HF5A 2FJEB 1Q8KA 3GB0A 3MM7A 4ZCLA 4M8LA 4O44A 4DMZA 5LM7E 1Q5YA 3C46A 1RT5A 1UZDA 2XMMA 3DGPA 4IFYB 3H5SA 2CPFA 1WACA 4A8XA 4CTAB 1KOHA 8ATCB 1VIOA 2JRSA 2OPQA 3NS5A 4DSKA 5LMNF 2FQQB 4ILMA 1TTHB 4PG8A 2XS2A 4JI4J 2KZMA 2R7OA 1FEHA 3GYNA 4C11A 2U2FA 1RAEB 2X1GA 2ZBRA 1U1QA 5A76A 1LOUA 1Z2ZA 4DV1J 2M7SA 2A10A 1NHUA 5E41A 3V6DB 1XMOJ 1G4CA 3GMGA 3QFWA 2IM1A 3C6TA 5LL6d 2ZH3A 4LUBA 5J2MA 4NYOA 1GAOA 1X4BA 2EFGA 2QRRA 3QSIA 4OX7A 1D1UA 3DKDA 4QWDA 1ZZFA 3QJJA 2NYIA 2WBRA 1JLGA 2Z2ZA 4PCQA 4DX7A 1A0OB 1WD6A 1Q95G 3G86A 2AJ1A 3IBWA 1SL0A 3UNGC 1PC5A 2E5GA 1FA0A 3NCRA 2DGVA 3WC2A 4RBUA 4DL4A 4A8WA 1ZM3A 1RU2A 4DR4J 2UU9J 2DO0A 2C3UA 2WAQD 1H72C 2UV8G 3ZFVA 4F4AA 3QGGA 1IBKJ 1FWKA 2YNIB 2HRTA 4IFYA 1JKHB 1UMJA 1WJ9A 3FCVA 4LRDA 1JJ2R 4NI2A 4CTAA 3NMRA 1MWQA 2QJ3A 3AD9C 3EGNA 1WF0A 4FPRA 3SFGA 2WCXA 4ZCMA 4X62F 2MKIA 5A0YA 3UCUP 1Y5LB 2PA3A 3RR8A 2RVJA 3FBBA 4W4MA 5ETPA 3OL9A 4K4YA 2BJEA 1O8BA 5MAOA 2V4JB 3EDQB 4FDFA 4LF1A 4DV4F 2D69A 2NYHA 1RDRA 1HYSB 2DXEA 3ISZA 4CWBA 2AX0A 3PEJA 3W2WA 4TQSA 4DSFA 3BN7A 1NK0A 3KTQA 3CTRA 1UA1A 2KFYA 7FDRA 4WK1A 2LA4A 4ED7A 4OZ0A 2HGMA 1FKOA 1KQGB 3MFIA 2W4PA 2XC9A 4CRJA 4LBHA 5DJBA 3TQ1A 2DVIA 1D0EA 2JEFA 1Q8IA 2VG7B 1RWPB 3MMAB 1FO1A 5I3PA 2C2KB 1WELA 2EFQA 1SQEA 1VHFA 3I5AA 4FF4A 2LLZA 1Y3JA 3FZBA 3GIIA 3NXZA 3C3LA 2IRYA 4WKRA 5AXNA 2XZTB 1WTFA 5B0FA 1WNEA 1AZSB 2KH9A 4B3TF 3R5JB 1CPZA 3PDNA 4ECTA 4DFPA 3AA9A 3C66A 3RB0A 3KUHA 2J9DE 5J2NB 2GA7A 3CCZA 3PKMA 1N5QA 2BKNA 4FPIA 1UJ5A 4J9VA 4X62J 2B51A 1HR0F 4DSIA 2HS0A 1TUVA 5LXRA 1RWVB 3VF0B 4HVZA 1VJWA 1QM9A 3R7BB 3LPEA 4PXCA 4ZPAA 4TKTA 1UJ6A 1YJRA 4FXWA 1KOOA 1RTJA 2NPFA 1HBUB 1NMEB 5HVHA 2CVEA 2IVYA 3M8WA 2CJ9A 3LP2A 5F8LA 5KFNA 4ECVA 2MQ8A 3ILOA 3Q8SB 2FZCB 2DNYA 3LP1B 1RP5A 2K2PA 1ULRA 2V8GA 4UF4A 5HANA 4ANDA 4EBDA 4ED1A 4ZS6A 4WFBQ 2G1DA 3UI3A 4MTPA 4NLWA 2BJ7A 2AYGA 2B9YA 2KJVA 4OV1A 2P5VA 1JLQA 3ELHA 4GC7A 4ECQA 1WC6A 2ROPA 1WF1A 1JNZB 1S7HA 2IC3B 1TK8A 4C8YA 4KFBB 3SXLA 3MURP 4V19X 1TL3B 2DRDA 3VGVA 4DFMA 3KMQA 1YJVA 2WVBA 1VQ4S 1S5ZA 2BW7A 3QT8A 3JSMB 4A4JA 4TU7A 2H51B 2GMLA 2HHPA 2QYCA 4ZDNA 4YS2A 3VAGA 1JX4A 3LALA 3ZZRA 2X51A 3CD0A 1CBKA 2XO6A 4ECSA 2DHXA 3LO3A 4IFVB 3TOQA 1M1KT 2JJ4D 1NJXA 3BKTA 4O3PA 4KAIA 3A8KA 3MGJA 3EZ5A 2HG4A 1VQPS 3K8VA 3MMJA 2X1FA 3DRYA 3GFXA 1Y5IB 2MLZA 2VU5A 1OYEA 4J37A 2B4OA 2JHEA 2Z2YB 2ZBQA 5EWEA 3AOAA 4DDFA 2B8PA 2RILA 1Z1ZA 4DG1A 2W2MP 4LF2A 4QW8A 4JI2F 3M9MB 1CSJA 2LXFA 2OPRB 3Q8PB 2VC0A 2G13A 2ZEJA 5HJXA 2FVQA 3BO3A 2MQPA 3OTBA 1KSPA 2NUHA 2OKQA 2N7YA 1PAUB 3Q2SC 2IDLA 4X64J 3NGKA 3ONQA 5DM7Q 3MR2A 5EN1A 2ZH1A 3FUYA 3QYYA 1SH3A 2FLOA 2IC3A 4R0EA 4ED3A 1BHNA 3N0VA 3R5BA 1KFSA 2VODA 3J7A1 3VAJA 2GIFA 4O4GA 4DX5A 3CCSS 1DY3A 1OY6A 4DV2F 3TZXA 2RSQA 4KQZA 1YDLA 3PFEA 2MJNA 4DS4A 2JEGA 2OPPB 1X4AA 2LXUA 2YPYA 2PMWA 3TUIC 1PGZA 1UCNA 4U9RA 2XSJA 3P5TL 4YHHJ 4ZP7A 4M5MA 4F4WA 3RBDA 3QFHA 4QYZJ 1R43A 4CNYA 2HHTA 1K0VA 1S9EB 1RWWB 5AXKA 3LUYA 1X4CA 4OYPA 5I3QA 2H5EA 1MROA 3CC7S 4I1TA 1NH8A 3TX0A 2UU9F 5F8JA 3B6BA 1BQMB 1JJCB 2Z2LA 1S48A 4TYBA 3OQ2A 2KT5A 3KDOA 4IG0B 5KG5A 2AEMA 3TI0A 3GR1A 2MTLA 1X5SA 2W9CB 4JI0J 2ZZNA 1TVRA 4K2JA 4X4SA 3SSRA 3CMQA 5KG6A 4JV2A 5IV4A 3R6GB 3KLFA 4JI7F 2GZOA 3EVMA 1FD2A 1K9MT 1TV6B 1ZPVA 3FEXB 1IQZA 1NPPA 2EI5A 3N9UC 4QR0A 3HT3A 1WOOA 3CDUA 5D3GB 2E1AA 1FI4A 2YNHA 3OTEA 3QNWB 4HACA 1D9FA 1YRXA 1XNQF 1P27B 1K8AT 4JI2J 1XR7A 2XMVA 1CULA 1PYSB 2ZHOA 3DRXA 3QATA 4X4TA 4KHPF 3BQ1A 3EICA 1X5OA 1LWEA 3BDPA 4FKXA 2DGTA 1ZPWX 2J76E 2QMUB 5SZTA 2O67A 4LFAF 2IRXA 5CCMA 4FN5A 1J5EF 2RHSB 2VQFJ 3KKFA 2HNYB 2XI2A 3NWGA 4ETXA 1RAOA 2CNLB 3DXBA 2GIQA 2V8HA 2SXLA 5GMDA 4RO0A 5BXIA 3KMSA 1TR0A 2DITA 1DURA 4X4PA 4ZVPB 3CVKA 2CJKA 1K44A 4LR8A 4WCEQ 3TO8A 1C1BB 3JSYA 1REVB 2V6AA 2RUGA 1MMLA 1VQ9S 4AT1B 1CS4A 2V9KA 2MPUA 1DQ9A 4OLPA 1RISA 3A12A 4MIAA 4USKA 3SCKE 4ZMMA 1RYRA 1S0NA 2XNRA 3TUPA 3CULA 4KC5A 2OHDA 5A6PA 1R0AB 4J9KA 3RBEA 2IHR1 4I4BA 3T5LA 2N4DA 3DFEA 4OX9J 2PIIA 4EUVA 2W2QP 3O2IA 4ZCIA 1N8RT 4NMLA 1RAJA 4TLQA 3SFUA 4WTOB 3NS6A 1HQUA 3I9ZA 3O44A 1FNXH 1FE4A 1KNZA 4Y2IA 4OYMA 2LQBA 3FKBA 2R2RA 5J1NA 5J2MB 3DOLA 3Q23A 3BQ2A 1NDKA 1Q86T 2R7VA 4HDHA 4FF1A 3NRBA 4RUCA 5K14B 1S0OA 5F3TA 5F9LA 4MFBA 5A2QY 4CH1A 2VZ9A 4CLPA 1IKYA 1TQLA 2ZHBA 1YJUA 2K8GA 4U7UK 3QAUA 2DCUB 3QGHA 3CC2S 5KFDA 2XS5A 3CJ8A 3AJ2A 3TA1A 2ZWPA 3GIKA 5A8RA 3SQGA 1N56A 1RWUA 5LJ5Y 2M3DA 4TYAA 4B9MA 2DHHA 1FXDA 1KWMA 1FDAA 4XAKA 4ZP9A 4J9OA 3WIVA 2VKZG 2ZDOA 4LMZA 3I0SB 1T05B 1ZM9A 1QE1A 2BEFA 2YKMB 1HHTP 3MEDA 2G2ZA 3H2LA 3IXQA 5L46A 2RIJA 3RW7A 1UAWA 2AZ1A 4ECXA 1R7IA 4ZPCA 2HBYB 3KJVB 2XBPA 2HWIA 3MM6B 5T7LA 4C11B 1OJ4A 3QMQA 5D77A 3BKFA 3DLLQ 2W1BA 3HULA 2JX2A 1SUQA 2W25A 4IRDA 3HJFA 2RU9A 3ZTRA 1HQUB 3GCXP 4WE1B 3ZZYA 5CYJA 1S7IA 2WB1D 3UR0A 3W63A 1R8HA 4MIBA 3CT9A 3DYAA 3N01A 2BQUA 2GFFA 3CDWA 3ISNC 3DOKB 4OX9F 3PXGa 2XS7A 1I1GA 4Z7CA 1GTEA 3M1VA 3D4JA 5K14A 5KFPA 1SJQA 3H2VE 1FWLA 1U09A 4B02A 1SVDA 3DM2A 3IGVA 1HNWJ 2EW9A 3T1YJ 1RLCL 2VL1A 1FRMA 4NYPA 1EX8A 1HFEL 2MB0B 3OHAA 3L9ZA 2C2DA 4PUOB 4NMXA 5B0EA 5IV3A 5AXLA 3BZQA 2ZE2B 3L7UA 4OFZA 5JXSA 3CDAA 3KLIB 3RRKA 3W64A 3KK2A 2YNIA 3CW2C 4WIIA 5LJ3Y 2PO4A 3B4MA 3FRZA 4KYZA 1NSAA 5HBMB 1FE0A 2HQ3A 3AB4B 2KI2A 2MKKA 5J2NA 5DRKA 2RB7A 1QE1B 1X4GA 2YKMA 1RZMA 1ZM4A 3S01A 3D6MB 3LW5C 3M8RA 1VQMS 2UUBF 1H2VZ 3K2YA 3M6XA 7FD1A 3VAFA 2M8DB 4B3TJ 4DWIA 1XBWA 1LW0B 3PYGA 2BOAA 3TVZA 2CUYA 4Q45A 2I38A 1LWXA 2BW2A 3DU6A 2D1CA 2AIRB 4NEZA 5JJBA 2P6SA 3I55S 3KHHA 3HXMA 3QGPA 1HQEB 1PCAA 1IKVA 1BXNA 3NGSA 1Y11A 1RGVA 3CDEA 5GAHI 2OEJA 2M9KA 1MG7A 3HHLC 1AXQA 2G1HA 1LFPA 4WE1A 5GADU 3PX0A 2KKHA 3NKYA 2BRLA 5IC4B 4C8MA 2IM0A 5IFMA 4FBUA 3TQEA 3JSRA 4ID8A 1YK9A 2VG7A 3LAMA 2KRBA 4PQAA 3N79A 1GXTA 2VQEJ 4YDDB 1N5YB 1T9YA 5C5JA 2CKWA 3CJRA 1RWKB 4IKAA 4Q2MA 4IDKA 5GAGU 4PQUB 3JAMY 2E66A 5DGAA 2RHQB 1PJ5A 2G0CA 4U8YA 4Q2LA 3KYLA 1AFIA 2LU1A 3I96A 1S72S 5C2GA 5BYSA 2BE2A 4PXEA 5C24B 4RW6A 2CAJA 4ID5B 2LVWA 4RLEA 3SYZA 2QA1A 4QIWD 1U1PA 3MECA 5HBMA 1X5PA 2W4DA 3BSOA 2GJFA 4FKYA 1UTAA 1HNIB 4N56A 1U49A 2YH1A 2MMYA 5DDQC 2HHVA 5IZHA 1S1VA 4FF2A 2EKNA 4F4KA 1K73T 1NRKA 1NXIA 3FC9A 2QL7B 4H4MB 2MYFA 3TJ8A 4PAAA 2MZSA 3QGIA 5HMYA 3Q22A 2KXHA 4Q8FA 1Y4ZB 4YB6A 4LREA 4USVA 2N3LA 3R5GA 5GAEU 3RYLA 3CD5A 1HWKA 1TL5A 4X4RA 2AYMA 1WEXA 3HHLA 1IBKF 4NL5A 4MT1A 1D9AA 2I1RA 1YITS 4DR5J 1I94F 5GAHU 2WSEC 5KFFA 2N4CA 4ANCA 4X66F 1U7LA 2V9WA 3N28A 3EZOA 4ZOSA 3ZXWA 1GMWD 3DDIA 2R3VA 2DIVA 3SBMA 3C8YA 5HMXA 1E6VB 3MD3A 4CIOA 1LKZA 4QU7A 2POKA 2DGUA 1EKRA 1ZTTA 2Y3YA 3HHKA 3MM9A 1JMTA 4N41A 1VIXA 3K58A 2Y8YA 2AV5A 5E7OB 2B8QA 4WBFA 2IFXA 4DQSA 3UW1A 5DLGA 3IR5B 5T41A 1LEOA 4X64F 3G8TA 4ERDA 2ILZA 3VWSA 3MTKA 4NLRA 1IJEB 2GS8A 2KO1A 3CJ5A 2KT3A 2CYYA 1F5AA 4RW4B 3MAQA 1I6JA 2HMIA 2DISA 4CNZA 1QAXA 5DG8A 1F5BA 3R5CA 4TLRA 2OJ3A 3WDOA 1XMBA 2XZWA 1UFLA 2HFZA 3D0GE 3SEOA 2KM8B 4K4XA 1KQSR 1JWWA 4P2FA 2PT0A 3CJTA 1UVKA 2WOMA 2X1AA 3W5YA 3CMES 1SJRA 2JH3A 2YTCA 3IWXA 1YWXA 2EEYA 1NSPA 4GO7X 5KFXA 4WFNQ 3D54A 1O0PA 2DH7A 2GV1A 4NLTA 4HLBA 4DR6F 2HZCA 4OZ5A 2FIUA 4ECZA 2MKJA 3GFHA 2J7WA 1VRTA 1JIHA 1TV6A 4H4KC 5B0DA 4FYYB 1JLAB 1FVQA 2DH9A 3NBPA 3QLHB 4HHUA 4ZPVR 1S99A 1T03A 3LP0A 4KPYA 1VHIA 4N8NA 4DR5F 1RT7A 4U6PA 3IR7B 4ZCKA 2C3OA 3FQKA 3SIPB 1YZ6A 3KLGB 2CWKA 1VBYA 2IYIA 1RUSA 4O4GB 3MM5B 2AJ0A 4OJHA 4P72A 3TWZA 3VZIA 3R2CJ 2FZGB 3CO9A 5KFVA 1GK8A 3OJSA 1OSDA 3MEEB 4RBTA 2ZBIA 3MF5A 4UQTA 3ETOA 4USTA 5A8WB 5L39A 2V0NA 3H7HB 5AE3A 4E8UA 3S7RA 3ILIA 3MCSA 1SKSA 1XNQJ 2LEPA 5M2RA 4M5IA 3NGUA 4DL6A 4ZVOB 2WVFA 2OP5A 2IA0A 3L4BC 4YY3F 5I3UA 1TL4A 1T9TA 1HW9A 2F1FA 4O3NA 2RUSA 2VASA 4X65J 1OQ6A 1S1UB 3A8EA 2IVMA 1J27A 2QGFB 4GVLA 1EB0A 2W2NP 3N5BA 3UD5A 4ZPDA 4EYIB 4LQ3A 3O8WA 1VLYA 4F8RA 3BBCA 1VQ6S 5LMUJ 2YBVA 3F44A 4WFXA 3PRBA 3AAWB 4F0KA 3OR2A 1ZAWA 2C2MB 2QFIA 1MN9A 3A3PB 1AUSL 3H4BA 4HTJA 1OY9A 2B5JA 3D6HB 4DUTA 4P7TA 3ICLA 2AHOB 4HACB 5FLXY 1URRA 1S6PB 4LSNB 2ZWOA 2V94A 2FDNA 4BC9A 4A8MP 1N32J 3I4PA 1KBRA 4HYKA 1U4BA 3DN9A 2XG8A 4ZVEA 4A8FA 4IQXA 2EFNA 3K5NA 2GGPA 5JVHQ 2BKOA 3NAIA 3SSQA 2ADBA 1U1NA 4FZVA 4EZ9A 3D3CJ 4DUZJ 2XGPA 2K3IA 2GQCA 4QIFA 2BBEA 1OS5A 2I0XA 2LCWA 3EUNA 4CH0S 2XMAA 3QPIA 4M5DB 5KFWA 5HL7Q 1H74A 3NGTA 2GJ2A 4KR0B 3OTOF 3IS9B 2F63A 2QTWA 1C0UA 3MAAA 5KG0A 4B17A 1HKAA 3PR5B 4ICLA 1FK9A 3I0SA 5KFZA 1T05A 1E6YA 4ZJLA 3BR9A 1AUDA 1RBLA 3BM7A 4NE9C 5ETRA 2XQCA 1WORA 1RXOB 5E3PA 5I42A 3N6MA 1NB2A 2JFDA 2W9AA 1S6UA 1H6KX 4NYZA 4L6V3 2H5JB 2CQGA 1Q7LB 3J7AN 4KGVB 4RW7B 5T7LB 4YFUA 2CJBA 1WI8A 5C42A 5KFRA 3TP2A 4U7CA 2VIHA 1U1KA 2RAQA 4QWBA 4DUYF 3UPFA 4JI1J 1H0HB 3NLCA 4OHWA 2HVIA 3NCPA 2CQCA 2IBOA 1UFWA 5H1SV 2V50A 3IAM9 1H2TZ 2QLXA 4LBPA 2E5LF 3BS9A 5RUBA 4DR3F 1VC6A 4XPEA 1M5PC 4BWMA 2J9CA 3CJSA 1TELA 2D3OR 2AGQA 3TARA 4NXNJ 1NK7A 3M30B 4WIQA 3O1LA 4QZVB 2XZDB 3Q83A 4DR1J 3H5XA 4RUBA 2CJAA 3HT0A 3BGOP 3NOCA 2XLKA 3TZYA 1BY9A 4C8KA 1NEEA 2W01A 3VAIA 3EWGA 3OTCA 2R7XA 2JNJA 3W8GA 1N34J 4PUOA 3K5OA 4PXBA 8RUCA 2DXDA 3IM8A 4ZLLA 3K89A 4R5PB 5DDPC 1QVFR 1NUEA 4YR0A 1TL7B 4FVMA 1HNWF 1NDLA 1QUPA 1W2IA 4L72B 1RHKB 1Q8LA 1FERA 3OXGA 2E9RX 4F02A 4JV5J 2C2ZB 3QRRA 1VBZA 3VGTA 4DI6A 5I42B 1UEUA 3LWLA 3JTOA 3A4TA 1VBXA 3HK2A 4DSEA 1M5HA 3S6EA 2F65A 2R2TA 1TL1B 4TU9A 4AUKA 2GCFA 4L3KA 3RUBL 5IQ6A 1YI2S 1CVJA 3SCJE 4KBIA 5D0RA 5C7PA 1GFWB 1IBCB 3KG1A 3RU0A 2FB0A 3KG0A 1HQEA 5L9NA 2YKOA 4LF6F 4JUZA 5LSRA 4KGKA 2C2EA 2PEBA 2HHQA 1QTNB 4O3OA 4O3SA 4I2QB 1EP4B 4IQMA 4KB7A 3LPYA 1NK6A 4R25A 1I5OB 4NZ6A 5F0WA 4AL5A 5KG4A 1MWZA 2A0FB 2BE7D 4J9UE 1VQKS 4ZK7M 1B64A 4ZLPA 3J80U 3DM2B 4U95A 4PQUA 2RH3A 4LSLB 1W7WA 1F9FA 2W7AA 1WOPA 2L9NA 3IG1B 4DR3J 2ZH7A 4Y2CA 1X4EA 5KFLA 2UXDF 1T0TV 3HD1A 5ITHA 4JI5J 2YPZA 4KKOA 1NO8A 2G2OA 1CJTA 2MKYA 4ZKAA 1RAHB 4LF8F 4ANEA 3DRPA 9RUBA 3PX4A 3AHPA 1NHKL 1HNIA 3K59A 2ZITA 3HHNB 2G9OA 1RT6A 2W7OA 1U0SA 2GHPA 4ECUA 1LW0A 2E5IA 4OX6A 3MPYA 1KKHA 2QIFA 3RTVA 1SKWA 2I2YA 1CJKA 3KLEB 3BGLA 1M0SA 2C28A 3P6YC 3C14A 3DC2A 3U7JA 3HFZB 4CM2A 3WHIA 3UDCA 4L75A 1FFSB 3L09A 3LA0A 1N5YA 3M8PB 2RQ4A 3PNIA 2QEXS 2LDYA 4LR9A 2OPRA 1CJVA 3KLHA 2DRAA 4NLDA 2PC6A 2E5JA 5KG7A 3MAHA 3F73A 7AT1B 3CGIA 1K47A 1DLOA 1OYDA 1IWAA 5M2UA 4LJMA 4IO1A 4P74A 3CCQS 2QX0A 1VCTA 3K8WA 1PBAA 5HAOA 4ECRA 2P6TA 1HW8A 1YG0A 4ATNA 2VFRA 4MKAA 2KG0A 2XY5A 2KL8A 4JI4F 3MFHA 2BUNA 2HYIB 3ZZ0A 1CC7A 3DRPB 4F04B 2D9PA 4Y28C 2MZQA 3DXSX 2BJ8A 4C6AA 3G8SA 4NPOA 4H4MA 1MU2B 3DDKA 1KQFB 4WFZA 2PE8A 2CPEA 4CO4A 2UVUA 4P73A 1A6LA 1WHVA 1VBKA 5DG9A 3V4MA 2KXFA 3JTPA 3K57A 3OTOJ 3Q0AA 1YLXA 2WVEA 3VAKA 3DRSA 2MGZB 3V4IB 3BPSP 2APOA 5BJRA 1K1SA 2HBZB 3M6VA 5E3QA 5DGBA 1ELOA 5FLXU 3KLFB 1FRKA 2CVIA 2FJXA 2R7TA 1M90T 4DV3J 4LF9J 4ELUA 1IR0A 4LFBF 1S6QA 2KG1A 4KH1B 2OH2A 2JVRA 4DJBA 4NXMJ 4DF4A 2FHMA 2W8KA 4ECYA 2IAJB 2ZH6A 1VQ8S 2DO4A 3BB5A 1HBNA 1RAGB 2HIQA 5IQQA 2HQFA 4DN0A 2DGQA 1QJHA 1HR0J 2Q79A 2JZ5A 2V2KA 1Q0NA 3RGIA 2V2VA 1ZZNA 3FSYA 2MLXA 2VB6A 3GWCA 3T3FA 2XMWA 3E8OA 5L38A 1Q16B 2BM0A 3RAQA 1Q81T 4C8LA 5K9FA 5KT3A 1IM4A 3RJMB 1FTRA 4DV4J 2XHCA 4OI6A 3GFYA 1P9YA 2GJIA 2QLJB 1VMBA 2N7CA 1C4CA 2XCPA 3OV7A 3MOZA 3X3UA 1UL3A 2NZCA 3W62A 5EWGA 3ITHB 3GIJA 2XWYA 3MWBA 2IA6A 4ZPTR 3M8SA 2DIUA 2J5AA 1NJZA 1TAUA 4WXOA 1BD6A 5HQ8A 2N82B 1BQNB 3B4DA 1V3SA 4F50A 4DFJA 2CG4A 2F3JA 2FVCA 3MI7X 2DKOB 3H59A 2HGNA 1L3TA 2HZAA 4OI4A 2CIMA 1XQIA 2XMTA 4HR2A 3I0RB 4TN2A 2QLWA 2QV6A 1DJ0A 1NB7A 5KTQA 2OMLA 3THTA 4J9SA 2EKYA 2YNFA 2DEJA 1Q1KA 1RHQB 3WX8A 2QA4S 1TK5A 3KFWX 1WKKA 3K7RA 2JOQA 4UT4A 3MXHP 1B0PA 2EFVA 2Q66A 2UXBF 3CJ0A 3K17A 1HNXJ 4DR4F 4WTYA 2JLGA 2DPJA 2Z2MA 2IDEA 5LMUF 1XC9A 2ZKTA 4DZ6A 3PRDA 1ZH5A 1EKSA 1OPZA 3KLVA 1Q53A 1PG5B 4YR3A 4FS1A 4W92B 3NEKA 2XLJA 3R6LB 1WHWA 1HNXF 2V8PA 4ZPWR 2J8AA 1HI1A 2KB2A 4HH1A 4Y3CA 5HATA 3PIOQ 4JI7J 4CLUA 1UWBB 2GMHA 4QW9A 4M95A 2M52A 3D0IE 1ZS6A 5GVQA 3SQGB 1C2PA 1YJTA 4HL9A 3QAEA 5CYMB 3KK1A 4NA1A 1VRUB 5EUHA 2R8JA 4A46A 3O6QA 4QOTA 2ADCA 2H65B 3GTYX 2HNZA 1BQMA 1GNKA 2NPIA 4WYLA 2DNQA 2Z8QA 4ZIWA 4B3SF 2DY9A 2IM2A 2Z0GA 3I5BA 2NSCA 2A1BA 2O1PA 4KHMA 4QIVA 4PKDB 2CNNB 3OR2B 4ZVGA 3GJSB 3U1NA 3IRWP 3UD4P 3ETMA 3W5XA 3H25A 4RL1A 2DGXA 4DV2J 3OXFA 4YB7A 2BZ2A 3GG0A 3GJTB 5IOLA 1XNRF 3PVXA 3NWRA 5JMNA 3R9LA 1VS3A 3KHLA 2B43A 3EPIA 4DOZA 1C0TB 1UVIA 2OIHA 3WIUA 1Y9OA 2KU7A 1YRUA 1SJ1A 4GC6A 5J2PB 3CPWR 2UUWA 2HVZA 3JAMU 2BOPA 2DRBA 1U02A 2HFVA 2LQJA 4DEZA 2AJ4A 2ZM6F 1U1RA 4ES3A 4QU6A 1MMDA 2IIHA 3G6VA 2XLIA 2KN4A 3IWNC 3I87A 1GMUA 4OI1A 2DK2A 1N5VA 2CA9A 4RX6A 5L9XA 1DAXA 4E98A 1I94J 2VJUA 2C1EB 4GKJJ 1V5IB 1KLMA 2HKEA 3CJKB 3UN5A 2VPYB 5DZ6A 1R8PA 4LFCJ 1W25A 5ETOA 2ZH4A 1X7VA 1LK7A 2VA3A 2YX1A 1NPRA 3BGUA 2UV8A 3K5MA 2YX4A 5D4LA 2AEFA 1REVA 1WKLA 5D0GA 1HLWA 2XO7A 3X1LB 1CS4B 2ALYB 1TU0B 4OHVA 4A8OA 4XTTA 4OZ2A 2RKIB 3BH7B 5HI7A 4J9NA 4DL7A 3LANA 4NLVA 5D4NA 2IBKA 1B3TA 4XO0A 2JLFA 1T9UA 2O01C 4YY3J 5D4PA 4MYUA 2VQFF 1VQ5S 4IRKA 2ZDPA 1VOMA 3B82A 2CJYB 3TRGA 1KDNA 1RWMB 2EPIA 1B0VA 4Y2AA 4PG4A 5KG2A 5KFHA 4NCGA 3CE8A 3OLBA 1JK9B 3E2EA 1T9VA 2PFDA 1SQGA 1S1WB 1NM2A 3N6LA 4J9QA 4ER8A 3LAKA 5E0OA 4P6QA 2XM3A 3EGWB 1ZOTA 2EVZA 2QSWA 3GV7B 3CIMA 2KVIA 5B0AA 5DO2A 4JV1A 2QLFB 3BGFA 5HK4A 3T9ZA 3UDLA 5CABA 1F2GA 4DQRA 4K50A 2BE2B 5C24A 3CCES 1RSCA 2C2OB 4DPXA 4GO5X 5EX3A 3AD7C 4X66J 1UP1A 2R7WA 3MECB 3HO1A 4WF9Q 1VR6A 3OL7A 2F9DA 2FZKB 2VV5A 3UD3P 4M5LA 4C0HA 1Q82T 1IJFB 2J0WA 4OX8A 2AT1B 3G9CA 5KT7A 3ZC4A 3W61A 4A48A 1I3OB 2MZTA 1KN6A 2MQOA 1N6QA 4IUFA 3R7SB 2V4JA 4ITSA 3JB9k 1S0VA 1HARA 2RKIA 2VONA 4FXVA 3FMWA 2HNDB 4G65A 5KG3A 5KFSA 4GVBB 2QSFA 5IC6B 3QQCD 2R7UA 2RF2A 3DLKB 5CCLA 1SC1B 2R42A 1SUQB 2BJ9A 2VG5B 4J91A 5T14A 5CYQA 4B3MJ 3BPDA 2V2QA 3JQJA 4U67Q 2FGCA 4LRCA 1R89A 2D7SA 4IG3A 5F8HA 5K8MA 3D2WA 1Q79A 4ED8A 3R27A 4I6WA 2AGPA 4N5SA 2K3KA 3MHYA 4YQWA 3M1VB 3ISND 4P2SA 2Y1IA 1KQKA 2F8MA 1SIWB 1VLOA 3TANA 1XR6A 4LSLA 1WHXA 2DR7A 1NKBA 1FX4A 1HQ2A 2OSQA 2G4BA 5HROA 4X4QA 1JLQB 1FNMA 2LEAA 4RBVA 3RRHA 3HI9A 4OJ1A 2YX7A 1ROFA 3HSJA 3TAMA 4KFBA 5B0BA 4UOCA 2CFXA 4Q44A 3QT5A 1EIYB 5HVFA 4K7QA 1H38A 5DQIA 5E3AA 3DLGB 1UKUA 4OZJA 4KT0C 4OQJA 3W5ZA 2HURA 2EC0A 2FD2A 1KTQA 5KFGA 3H90A 1NAQA 2ZJPQ 4BWJA 2NREA 1BWEA 4DBQA 2W2PP 1AROP 2ZJRQ 4DS5A 1FDDA 2VKRA 3U1MA 4FYXB 1SL1A 3CDBA 1D8YA 4HTIA 2F8EX 5KFEA 3H4DA 1S77D 3Q8QB 1XMOF 4OL8A 1F5CA 1N34F 4ZN3A 4TNOA 4NZ7A 4EEYA 2YWEA 1U1MA 2HHHJ 1XN9A 1NBEB 2VFTA 1RAAB 1RQ0A 1V3RA 2MSSA 3LOUA 2FTRA 2D74B 4GMKA 1L3KA 1CJUB 1VYAA 2ZD1B 4Y00A 4LIRA 2V67A 4E0DA 1WF2A 3MCOA 2E29A 3TA0A 3NNHA 2CQHA 2VUGA 1VRTB 4CDIA 2WVDA 3T1HF 4DPOA 3NGDA 3D3BJ 5D4OA 2RQKA 3MPWA 2FY8A 1XMQF 1KFDA 3LGMA 4NLOA 3RAMA 2MHNA 3BN4A 1RE1B 2JSXA 5E3CA 3IBFB 4O4RA 3POTA 4AE5A 3R1HA 4RW6B 1HA1A 2YH0A 5LSOA 4MKYA 4UUXA 3US5A 1HBMA 3CNQP 4JI6F 2YKQA 5I4MA 3SV3A 1U1OA 1NKCA 2LQ8A 3DLGA 3MCMA 3EMTA 5HMWA 3OVAA 1PAEX 4DL2A 3D67A 2VFUA 3MTJA 1U26A 2JEIA 3ITHA 2D3ZA 1LW2A 3NY0A 4KHRA 1RTDA 2ZH5A 3UWTA 4DV7J 2LA6A 3K0JA 1C1CA 5A6WA 1MN7A 3CCVS 3VCDA 2ACMA 2I9SA 2KT2A 1JLCB 3RG6A 3M2VB 4DL0C 1DRZA 1IBMF 4GKKJ 2DNOA 4USMA 3H0PA 1FFGB 2E1CA 3KOAA 3P8BB 2C22A 2IRUA 1RCOB 1TVRB 2LFVA 3AH6A 3M2RB 5SUHA 5H9FJ 3WX4A 3T1AA 1FDNA 3L7PA 5DDOC 1IR1A 4K0KJ 1MSWD 4P52A 5BR8F 4M5NA 2ZUGA 4WFYA 2HQCA 3G71S 2A6OA 4B3OA 3CCRS 4HHHA 1F3FA 1L3UA 4I68A 3ENQA 2DGSA 3EYZA 5HQMA 3P49B 3MOJB 1DQAA 5ETLA 2QE5A 2IPOB 4LR7A 2FVRA 5HP1B 5LXYA 2G2YA 4PWWA 2UUCF 1R31A 1L3VA 4D3GA 1T3NA 2J9EA 3EM1A 1LW2B 1U6ZA 2CZ9A 3LGHA 4KGXB 4U96A 5K8OA 4RU9A 3H40A 1F6TA 4M5DA 4JOUA 1FRIA 3KUGA 4U7UD 1PIEA 3T5JA 3FJ2A 3GIMA 2HHUA 2QO3A 3FBCA 2HFOA 4G1QA 3ZTPA 5HSPA 3T41A 2R7QA 2HNZB 2W9CA 2Y1RI 2OPQB 1UVLA 2ZBPA 2OMOA 3SDEA 1HNZJ 1HPZA 3JYTA 3VAHA 4IRCA 1S1TA 3UCGA 4Z7YA 4OZ1A 4B3RJ 2E9ZA 5LMNJ 3PO4A 4C0OC 1EZZB 2BYCA 5F8GA 3OR1B 3QRPA 5C42B 1S49A 1ZBTA 5KFIA 1YX2A 1RK8A 4CT9A 1J5EJ 1Z4UA 3IO1A 1U24A 2ZFHA 1HWLA 2KYZA 3CCUS 3HZGA 3A1YG 5J1EB 5F9NA 3VQSA 3EZUA 1GXLA 1FFWB 2VDIA 1YQHA 3DOLB 4FYWB 5ETNA 4DCJB 1X4DA 3HZEA 4EO6A 3MUTP 4K4WA 5A8WA 2OPSB 1KVKA 3ZZZA 1SI9A 1AB8A 2IM3A 3E01B 4KV8A 4OYBA 1WEYA 5KFYA 1UVMA 2DGWA 1AYEA 1IXKA 3A8JA 3P4UB 3GCWP 4Z37A 2WZ1A 2DR5A 3RAXA 5CYMA 2CPJA 2Z57B 4PYAA 3IMQJ 9ATCB 4USWA 4CO1A 3BGRA 4EYHB 3CJQA 5J2QA 1URNA 5KT2A 2CADA 3K5PA 2Y9HA 3OFGA 4PG7A 3OHBA 4DSJA 2V8DA 3FK4A 1R8BA 3HCXA 4PYDA 3Q89A 2F9JA 2MDAA 2UZAA 3DMJB 3OPKA 3GSDA 1WSVA 2OELA 1R6YA 4ILRA 3Q24A 1CLFA 3W1YC 5MLCV 2XY6A 2AU0A 4ZVRB 3V81A 3BKUA 2MY8A 3MM6A 3PR4A 1NK5A 2DNLA 3QZ7A 1O51A 3B54A 2CNOB 2DR6A 4K4ZA 2PD1A 1Q5VA 2R8HA 4HHJA 4RNFA 5AE2A 5AJ3F 3OD2A 5KG1A 3HSDA 3VR1A 4ZVQB 1TKTB 1Q78A 3HHLD 2Y8WA 2R4FA 2XULA 1LFWA 2W7PA 1YRTA 3G6ES 2YWGA 3KDNA 1OWXA 4NCGB 3DOKA 1FD8A 3EX7B 5D0EA 1DFDA 4QR2A 3J7Z5 1NZ8A 3T1HJ 1U1LA 4M5HA 2WSFC 5A8RB 4DZDA 2ERRA 1RT3A 1JXVA 5IT0A 3DLHA 5KFAA 3VGSA 1FDBA 1TFYA 2AGOA 3BGRB 5J2QB 2VJVA 4L73A 3A13A 1DQ8A 2VPWB 4KKOB 1VRQC 3BBFA 3GP9A 3R7NB 5A8KA 1IWGA 1GX5A 2OTLS 1X4FA 1C0UB 3MAAB 2DNPA 4YMEA 4X4VA 3IM9A 1IQTA 5B7WA 4NLSA 2YKNB 3UQSA 5C25A 3KUEA 2ASJA 2W9BB 5IS2A 2B4VA 1UZHA 4DCOB 4I7FB 1N6QB 3W9HA 2OAUA 4ETZA 1G3OA 4DV1F 1CJKB 1FF2A 3KLEA 1Q7YT 4GVBA 1S9GA 2XYPB 4DV7F 4WWSA 1U6BA 2VDHA 5DZ7A 2CPIA 5IT9U 3PM9A 3V6DA 4NA3A 1QVGR 1JLBA 4NX9A 3FBEA 3HP6A 2MKHA 3UDEA 4WP3A 1P1TA 4IG3B 2C3PA 2PEHA 5CQGA 1MLAA 2B7BB 2RDDA 4Q0BA 4I0WA 2HQGA 2VFVA 4WP8A 4B3MF 2V34A 2FHJD 3CJ3A 5EX0A 5DLFA 5DDRC 4Q8EA 4LF7F 2BXJA 2QL9B 4CYUB 2G0JA 1XNRJ 1GT8A 4DR7J 4YR2A 3BO2A 4LSZB 4P2XA 4QPXA 3L7OA 1HBOB 2IJFA 5KFKA 1REGX 4RNMA 2NZ4A 3EGVA 3NNAA 2KZZA 2RQMA 3DU5A 3L3CA 1UA0A 1SPBP 1ICEB 4PRFA 1L3SA 3IRXB 2K1RA 1AA1B 3AXMA 4ENOA 4X4NA 3G82B 2NUUG 1NNDA 1R3NA 1RTIB 3U02A 1RAIB 2H9ZA 5CA5A 5C25B 2WTFA 2UUAF 2UUCJ 2HNDA 5DETA 3M7VA 4S0MA 4C3LA 2RU3A 1HYSA 3GZ7A 4P2MA 2PA8D 4BC7A 1HWIA 1IKVB 4DR2F 1DTTB 5FDLB 2UXDJ 3DRSB 1JLBB 1JLFB 3GPAA 1M5OC 1FKOB 5IM0A 3OSNA 1SB6A 3EJMA 5F41A 3N4WA 4I2QA 1OY8A 4NLPA 2DB1A 4OZNA 3MEGB 4ZIVA 1GMVA 2E5HA 1G6BA 4NLXA 1FJ7A 3QWUA 3MMAA 1X60A 1FESA 1OMSA 1TUWA 1VK8A 1WC3A 1SC6A 3D66A 1PJ7A 1RHUB 2WVCA 2VG6A 3D1OA 3HKZD 4X84A 4Z2XA 2LXIA 1CQNA 4RW8A 1FKPA 4NWBA 4A8SA 2RS2A 3CUNA 1Y3KA 3GONA 2RT3A 5IT4A 1XK8A 3GG1A 3IG1A 1RADB 2GHVC 1NJWA 1WDDA 2HAIA 4OYXA 3DHWC 2HS4A 4OV6A 3TAQA 1UEVA 5AE1A 4CLSA 1HD1A 2UXBJ 2V4RA 3QT7A 1RCXB 3IRXA 5GADI 4NXMF 2PGCA 3TUJC 3W9IA 1RTIA 3R2DJ 1RT6B 3G6YA 1S9EA 4ZVHA 2DEIA 2ZJQQ 4RW4A 1RTDB 2E5LJ 1U2FA 1FJGJ 5HVGA 3VHQA 2H54B 4IOCQ 1MROB 1ZM2A 5GAGI 3ILLA 2EXUA 1CG2A 3EPGA 2DNKA 1DTTA 5FDLA 2BVZA 3C14B 4A8YA 2GIRA 1JLCA 3VZHA 2M70A 2VBYA 2WOMB 3BQ0A 4DPTA 2V8VA 3VVUA 2ZD1A 1RBAA 3LP1A 3PYDA 4DX6A 2BDPA 2DBBA 3R5AA 1S4FA 3BV8A 1M1HA 1WC0A 3SI8A 1SC4B 3T1YF 3CSKA 2ZUAA 3JS9A 4MK9A 4ZP8A 3ZTQA 3KXDA 2HK2A 4Y2MA 1W2BR 1BC6A 4O23A 1IVZA 4KE5A 4B3SJ 4LFAJ 4JV5F 2PMHA 1T03B 2QC3A 4B3OB 3C2PA 2C2NA 2MY7A 1WG4A 2X3DA 4ZVSB 5AJ3J 4MMOA 3KK3B 2D9OA 4B9UA 3HJVA 1HBMB 4DU8A 1NU4A 1LWEB 4KHPJ 3C6UA 2QA4G 2JC0A 1R8AA 4ED2A 3UN3A 1R0BG 5K5MA 2Z4PA 4JBCA 1G7CB 5A2QU 1NDPA 3IP0A 4NZ0A 2QFJA 3R5DA 4IFVA 2HPUA 4DV3F 4LF9F 4NCAA 2HK3A 3J80Y 4RKUC 2NR0A 2Q6BA 2J0SD 3DI6A 2OGUA 1C1CB 1PJ6A 2BA9A 3GILA 3KHRA 2F8HA 1EHWA 4I69A 3GSIA 3FRYA 3PW5A 4BCAA 1Y10A 3T19A 3TEHB 2C3YA 4DPUA 1G1XA 3LWMA 3M9OB 1VQYA 1CC8A 3FCWA 2QYGA 3FEYB 5GMEA 1T7PA 3VV2B 4DG1B 1FJGF 2XMUA 2LKZA 1S10A 1SV5A 2FPHX 4LF4J 1Y00A 3RRGA 3I82A 2FY1A 2A6MA 1J2VA 2V68A 3NBPB 5L1IA 3OR1A 2IAJA 1N36F 2CQBA 2B4UA 3W2VB 4F4ZA 2QN6B 1V5VA 3KLGA 1FEEA 4PR6A 1RWOB 3KK3A 1RHRB 4Q7AA 4A8QA 3RB4A 4LVNP 4RW9B 1QSLA 2A2CA 5J1EA 4Q43A 4EZ6A 2R9LA 3OSPA 1SJFA 2GVDB 4OYAA 4DQQA 5CXTA 5FD1A 5HP1A 5JUMA 3CJ2A 1F0XA 2XY7A 2WHOA 2W24A 2MKCA 1N48A 4KV8B 3W3SA 3CWJA 3CC4S 4ZVFA 3IR6B 3IGNA 2A2DA 3MM7B 1TUGB 4N77A 2J6SA 1LXJA 1F60B 2E44A 4TVAB 3UCZP 2B6AA 3I0RA 4IG0A 1SJ3P 4MK8A 3TZWA 1FK9B 4JI8J 5KFBA 1OSCA 1PILA 3J81Y 1FX2A 2OLWA 2YQ0A 2XYHB 3MPDA 4KY3A 1D09B 3KJVA 1NCLA 5KFQA 4USJC 3C16A 4CLZA 5EGYA 2WONB 3KJFB 2EBEA 2XTJP 4YB1P 1N36J 2BANB 2CRLA 4RW7A 3I9V9 1VC0A 3Q8UA 1MNEA 1TKZB 4QIGA 3M32B 3W7BA 3BF4A 4CI0B 2W4CA 4DR2J 3H5YA 2VF3A 1KC8T 1SC3B 2E7WA 2V69A 4Y34A 3AXKA 5D78A 4LVOP 4AD6A 2OUGA 4AYBD 3GU0A 3QIDA 1N0VC 5EHHA 2D3UA 4UOFA 3HVWA 3ZZUA 1U25A 2AD9A 2OPSA 1H73A 2LMIA 3BYPA 1PO6A 5L1KA 1IKWA 5DM6Q 4IR1A 2HNYA 4UY8T 2GO8A 2QT7A 3HSZA 3QIPB 5HLFB 2FLLA 2K7JA 5EDWA 4CT8A 1JQGA 2YWFA 2ZE2A 3KK2B 2XCAA 3JXOA 5HQLA 5ETTA 2KFNA 2KFZA 3H2UB 4XIUA 2UXCJ 1FJCA 1XMQJ 3OT9A 1KONA 1SH0A 4FP9A 2HVHA 2FC9A 4JI8F 4EWTA 1GH8A 1HMVA 4DV0F 1N52B 3QJPA 2XEXA 4KO0A 5LOQA 4IR9A 1KHVA 2CDQA 2MQNA 1MW7A 4O0NA 1H2UX 3MPUB 2MSTA 4OIXA 3EVWA 4LT6A 4ED5A 2EK6A 3HHDA 4C3KA 1RWXB 2YWKA 4I7FA 2KTQA 3FBFA 3IWLA 2UUTA 2H3EB 1FCAA 1IBLF 2U1AA 1GMWA 2R2UA 3FGVA 3KWMA 2RRAA 4ZA1A 1UFKA 5LT5A 1YTYA 1JXEA 4J90A 1H3DA 1RWNB 2M0GB 1XJWB 1P8GA 3HVTB 4K4VA 3ZZPA 1K0TA 2DPIA 3PV8A 1SH2A 3V2UC 2DJWA 4DX8H 4BS2A 3SSSA 1KS2A 1OO0B 1YJNS 2ASDA 2UVWA 2HHSA 4DHVA 1T8EA 3M8QA 2VD3A 3CIZA 1RT3B 3M4XA 4RNOA 2DT9A 2CXEA 3BH6B 4ZPBA 2B56A 2DY1A 2LEBA 3TVYA 1KLNA 4OI3A 3TAMB 3NS7B 3ULHA 5B09A 1GX6A 1F9EB 1WSRA 4QPTA 4UOHA 3CXCR 3OFEA 4Y65A 3I56S 3CCJS 1HMVB 4J9LA 4LF7J 3BSCA 3MEDB 4LF5F 1SIZA 4ZP6A 3QSYB 3R1LA 6FDRA 2I6WA 2KM8C 1QAIA 1S1VB 4IYQA 1DBDA 3CO0P 2ASYA 5B0CA 4YHHF 2R8GA 2J9DA 4UY85 4NEYA 2VH7A 4NASA 1S6OA 2YNGA 2AJ2A 4DV0J 1RT2B 2DTJA 1RTJB 2XWXA 2QL5B 3DDNA 2FGOA 2LQ5A 2RDIA 2YQ3A 2HBRB 3HHLB 3S1TA 1YBUA 1RLDA 3BEGB 4RZRA 5H9EK 3PY8A 4C0BA 2CG8A 5KT4A 2ZH8A 2ZOMA 3OL6A 2VOOA 3WZ0A 2X3GA 2FJWA 5F3ZA 2XHWA 2KVQE 1F9HA 3TYTA 3RR7A 1VISA 4B08A 1YJ7A 3D6FB 4URSA 5DS7A 3ZTSA 4C48A 4DV5F 2CPZA 5IT9Y 1E6VA 3GJQB 1VK3A 3GE9A 3MD1A 4RW8B 3OVSA 5H9EJ 1T9WA 4TY8A 1AZSA 1DLOB 1VQ7S 1NSKL 4MJKA 1D8ZA 3V5RA 3PTWA 1UW4A 4QBUA 4K2XA 4YDXA 1PYTA 4OZ3A 2DGOA 5CZXA 2D41A 3PFOA 3PW4A 1HHSA 2ZC3A 4F3OA 1F3VA 2P2CB 4LF5J 1RACB 2I5JA 2Q6CA 2ZOGA 3F41A 2KJWA 3G82A 3IAS9 1Z2LA 1TP7A 2OD6A 4HI1A 2NLWA 1RHMB 3M9NB 2X7IA 3DRRA 2CQPA 4KIAA 3UR3C 4B9NA 1HNVA 2HHWA 4J9MA 4ALZA 1AW0A 2NXNA 2P9CA 4QWCA 3PKYA 2GO9A 4PEOA 3HVAA 2M88A 4MK7A 2HAFA 2VG5A 4QQBA 4C2MA 2FHJA 2MQMA 2ZM6J 1FRJA 3ENWA 3VVTA 5ETVA 3O3LA 2XGQA 2D3O1 4JI6J 1WOSA 3KG4A 2HS3A 2ZHAA 3PW0A 2LU2A 3J81j 4BHQA 2YY3A 2PI5A 1T3OA 3MM8A 2ATLA 2PFFB 4MIWA 5AXMA 3RB3A 3KLHB 2KRRA 1RT1B 5AT1B 2VG6B 4H4KA 3JSBA 1JJHA 3R3TA 5E2QA 3BREA 4D3HA 4EMDA 5KFMA 1EAYC 2CQ2A 1QSSA 1JNRB 3M8ZA 4RUHA 4RNHA 1LK5A 5THWA 3SV4A 4ZLNA 4K4UA 4GKKF 4DFKA 4O0IA 4ECWA 1TL3A 1HI0P 1OPIA 4B3RF 3PYFA 1C4AA 2OO4A 1JJ4A 3OJUA 2HEKA 2P8IA 3JQMA 3M6WA 3TA2A 1RKJA 2GQ2A 3I4HX 3ZTOA 2MKSA 4K0KF 3MMCA 4U8VA 2ZKUA 4N8OA 2K06A 2CJQA 4P7VA 4QJVA 1S57A 4OYWA 1X9WA 2ATCB 3PJ9A 3W9JA 1HNVB 4M5JA 4WU3A 1X0FA 1KVIA 2RRBA 1D9DA 4ZJOA 1CQMA 3AQOA 3C15A 3U1LA 4AL7A 2L9WA 1TFWA 4ELVA 4HDGA 4K8RA 4CO3A 2MGZA 2CQ4A 2ZNYA 4A8KA 3V4IA 1VQLS 1QAJA 4NRUA 2BABA 3GR0A 2FYXA 4G3IA 1UVJA 3DNCA 2OFGX 1ZAXA 2CPYA 4N47A 1N88A 2YNFB 4G6VB 2VHGA 2HRUA 4ZHRA 3CB4A 2HLTA 4B9SA 5KFOA 1Q8BA 5FJ4A 2ZH2A 2B5JB 1RB0A 2FUG9 3B78A 1DHMA 3BO4A 2XB2D 4LFCF 4JI1F 3FNNA 4C8NA 1LNQA 2V4QA 4J9PA 4AQYJ 3TR5A 2WBMA 1UEKA 2L3MA 3POTB 1WWHA 1XR5A 3ZNJ1 1N4LA 2FLPA 2FJDB 1H98A 1ZAVA 3HVRA 4CQ1A 2EK1A 2M8HA 2PI4A 1XERA 1YSJA 2WB4A 1KVJA 3ZNUA 3AT1B 1BQXA 3TAPA 1PYOB 2EC2A 2VC1A 1UWBA 3DCAA 3KJQB 4NLQA 4URGA 2HMIB 4PWUA 1NK8A 5DQGA 2HVEA 1PBUA 4PG6A 4C3MA 4AL6A 2AMCB 4CP5A 4JI3J 2DNMA 3MR6A 3T6JA 2R7SA 2FJVA 1H7WA 4ILLA 1Y0HA 1WG5A 4N7TA 4HT7A 4AFFA 2EG2A 1C1BA 2M5YA 4DR7F 3D1HA 2YVSA 3FFIB 3CEDA 1FTCA 2Z30B 3CCLS 2F5GA 4K4SA 2JVOA 4QWAA 3HLUA 4X4UA 2OEKA 3V81B 2OSRA 2YQ1A 4JYAJ 2DHSA 1OIAA 2JC1A 3S8SA 1R6VA 3ADAC 5FIIA 1YGYA 2E1MC 2VPXB 4FYVB 4ED4A 3QT6A 3MEKA 4ES2A 2RDJA 3QWPA 4NXNF 4K4TA 3ZO7A 4NOHA 4WYWA 1V3ZA 1RT7B 1PSDA 5LSLA 3K5LA 2AQ4A 3D9BA 3NG8A 1NHVA 2H5IB 3MM5A 5KFTA 3UNYA 4CO0A 3AD8C 4ZLJA 4BDPA 1U2RA 2HBQB 3PHEA 1LWFA 1RU1A 2BV3A 3MPVA 1JLGB 2XSFA 1HWJA 4AXJA 2B9WA 4MFBB 4NLUA 2UVVA 3R97A 3Q86A 3CJ4A 2UVRA 1FRXA 1WC5A 3AJ1A 2M2BA 1S12A 2MJUA 5HLFA 2E1PA 5I3UB 4F3MA 4LQ9A 2YKAA 1XTZA 5A8KB 4FNHA 2E7VA 4CZCA 1S1UA 1TL7A 2NXEA 3GFZA 2AWZA 1U8WA 4G1QB 2F4FA 4K59A 4OJGA 2E1RA 4OYZA 3VGUA 5B08A 2F4VJ 2OD4A 3CD6S 3TUZC 3FFIA 3N6NA 3SDEB 4LFBJ 2W9BA 4KO0B 2DNNA 3EDRB 3FQLA 1KEKA 3C16B 4RUAA 1S76D 2A3JA 1EARA 2AX1A 4X65F 4DQIA 3AY0A 1TL1A 2I8EA 2CZVC 2PDAA 3T5HA 3PJWA 3BSNA 1QY7A 1O5JA 4OYIA 2IYGA 3UDVA 1VC5A 4PWDA 4FF3A 1WC1A 4JI0F 1H7XA 3TJ9A 5M2PA 2LP4A 1N33J 4GRSA 3LH2S 5L8RC 1IKYB 1FXRA 1LQ9A 1RJJA 2GGPB 2Z56B 3PHTA 4M63A 2Y1JA 2FLNA 3KNAA 3AOBA 2DHGA 3M05A 1U0HB 4TXSA 4CYUA 4ZVTB 4UQGA 2Q1LA 1IKXA 1IR2A 1NH7A 3RBZA 3H20A 3MMBA 1HBOA 1U2CA 2NSBA 2BMBA 3BR8A 2IMOA 3PG9A 4KTQA 1B7YB 3KLIA 3VTIA 1CJTB 2HHHF 2Y0BB 3E3XA 3J81U 4B9TA 3AJDA 1NSQA 2FC8A 4ICLB 1SJ4P 4DPYA 5BYRA 2HFNA 1VQNS 2DH8A 3DMJA 1SL2A 2EFOA 1R27B 4F4XA 3MDFA 4NLGA 1QAYA 5F8MA 4P71A 3PYEA 5E33A 3MUVP 3TEGA 1RBOB 1U6FA 2F4VF 3HX9A 3OL8A 5BYQA 4FS2A 1BE4A 1HWUA 1KTVA 1JB0C 1XEZA 3M6UA 4K5RA 4YEAA 1RT2A 3FCHA 4WFAQ 5CYQB 2YXLA 3TNVA 1UETA 2B7CB 3GJRB 5IM0B 4O3QA 3C6TB 3DYAB 4BLGA 1TKDA 1RT4B 1VQSA 3PCOB 4CLLA 2NS1B 1GXUA 1T95A 2YWHA 5EWFA 4PZVA 1HD0A 1SCJB 2HIYA 1GTHA 2RS8A 2CPHA 2EFPA 2H4WB 4NCBA 1QDUB 2DCLA 2HZVA 1UW9A 2O3DA 3QO9B 4L76A 4OYOA 5GAEI 3NCQA 2DHAA 1RA6A 1SXLA 4DPWA 1IKXB 2MZRA 3UE2A 4CO5A 5HROB 2BQRA 2PSZA 3I6PA 2HW3A 1CEZA 2H1YA 4I56A 2BJ3A 4HI2A 2NXUA 5HO4A 1FHTA 3OFFA 2PN6A 4OHYA 2V63A 3JQKA 3P5BP 3AQPA 2I5JB 4JV0A 5J1PA 3FZ2A 4M94A 4F36A 2AEJA 5A0YB 1B70B 3GLJA 4MKVA 1LWCB 1VI7A 4BBYA 4YP3A 3IN5A 3HKWA 4QIEA 3KHGA 4J5OA 2R7RA 4ELTA 3V6KA 2NXJA 2XMJA 1KHWA 3VQTA 4M5GA 2BM1A 5F8IA 3E51A 4WZQA 1PC4A 3TX8A 3RZAA 4OJ3A 3DOMA 4F0HA 1EETA 4JB8B 3TVKA 4ZVUB 3AODA 4PPZA 4DV6J 4V19J 2MZ1A 1A9NB 1S6QB 2GHWA 2ZVSA 4IDKB 1UJ4A 2C2RA 1J5OA 3PW2A 2ZZMA 1RT1A 2VPZB 5C2CA 1HBNB 1KRPA 2UUAJ 1HL6A 3OUYA 1B0TA 4TY8B 3N5FA 2ROGA 1AT1B 3DLEB 3JTNA 4OZLA 2CPXA 3Q8VA 3TJAA 2H4YB 4ES1A 1NJYA 1D3WA 1YVFA 5KAKA 4LF8J 5KOXA 2J6TA 4EBEA 3SMZA 3AFGA 3F0NA 1N32F 4LIWA 3W8PA 2FJBB 3NP5A 4F67A 1TMJA 3DRRB 4F2SA 3AA8A 1N54B 2FVPA 2EWHA 2CQ3A 2JFKA 3I31A 4DUZF 1FKAF 1SQFA 2HQDA 3DGVA 5D8HB 3LF0A 1U47A 6FD1A 2P9EA 4KRWA 2CQ0A 1L5UA 2EBGA 2QZ8A 1ZA1B 3LP2B 4LBIA 2L08A 2BJ1A 2GAGC 2VOPA 5F8NA 4CM0A 2B9EA 3GIRA 3BYRA 3M8PA 4M5KA 4OI2A 2Q43A 1ZTWA 4FXDA 4UOGA 4XDDA 3UFCX 5K8NA 1YJ9S 1FNOA 1N0UA 2BQ3A 4I2PB 4I67A 1S9FA 3OUYB 1P1LA 1QD1A 1GEHA 2GAHC 4X2BA 2CPDA 3DLEA 2ZZTA 4OLOA 4QR1A 3M2UA 6AT1B 4DR6J 1S4EA 4DUYJ 4RW9A 4PXDA 3MR5A 3IC1A 2BKPA 4URQU 3JSMA 2J0XA 1HHQA 1BWVA 1WUUA 2FHKA 2R8IA 2AZ3A 2CZ4A 2CNKB 4MAKA 2ALZA 3MMCB 2CWXA 2WSCC 3ENVA 4DL3A 4IH6A 4UTGA 1P9QC 2HFUA 5IXUA 2J7UA 1VDHA 3BBBA 3CCTA 4I64A 3D5MA 4EO8A 4Q5VA 1VRUA 2MQLA 4CO2A 4RNNA 3HM9A 3WBZA 1U8SA 4Y2KA 1NKEA 3M2VA 3ENAA 2J6UA 1IN0A 2ROEA 3NGRA 3F56A 4WKYA 5K8PA 4CH7A 4DL5A 1YIJS 3A8IA 4HH0A 1SKUB 4DLGA 1TAQA 1F1BB 1SBRA 2DR9A 1GQEA 2KYXA 3FSIA 2LECA 1S1TB 4A47A 3HPOA 2MLYA 2JEJA 2Y1LB 3SCLE 1R0AA 1JLEA 2R8KA 3CF5Q 4NLYA 3J7YI 4P9SA 1JLAA 3QLHA 2VFSA 1IUJA 3D7SB 5KOWA 1FXLA 4I2PA 2R2SA 1P6TA 1RABB 1TKZA 4ZN1A 3V6JA 1C0TA 4KSEB 1F2HA 3LTOA 1S6PA 1XWLA 2DNHA 4F7VA 3M2UB 2V5HG 4JYAF 2MQQA 2FVSA 3MEEA 3W66A 1R0CB 5D6GA 3C6UB 2COLA 1Y5NB 5KFJA 5H9FK 1W26A 4IOBA 2NCKL 1LWFB 2OPPA 4B9LA 2L41A 1M1GA 4X4OA 3HMJG 3UVJA 3C19A 3IA0A 1VFJA 5G0RB 4EFAC 2OTJS 4F3QA 1TZ0A 3CJKA 4NRTA 3DI6B 4XK8C 3MR7A 1YBTA 4GKJF 5ADZA 4W90B 2DXFA 4RU2A 4F25A 4KJIA 2CJXB 1T94A 2YWWA 1NK4A 2J0QD 1S1XA 1NLKL 4C7QA 5HJYA 1HPZB 3UN2A 3JYTB 1KD1T 4J9RA 2IJNA 1A7GE 4WXWA 4USHA 5E5NA 2EG1A 4UUWA 2RMLA 4YOEA 4H54A 5D3GA 2AF6A 1JLEB 1TMMA 4LRAA 2XMKA 1X0PA 1YZ7A 4MH8A 4OHXA 2DNGA 1QLNA 3KNGA 4L74A 3W2VA 3J7YU 4W98A 3HSGA 3ILJA 2JLEA 2QMWA 4DXLA 4LRFA 4I6YA 1R8CA 4IH5A 1CULB 4KPCA 2N3OA 3T5KA 5L1LA 4P10A 2ZH9A 5KFUA 1YBAA 2DNRA 2GVDA 2IJRA 3P96A 3IBCB 1S1WA 2AP6A 3H8YA 3A3NB 4L3NA 4F0MA 1T02A 2OEMA 3E01A 1TKXB 2ACYA 5L1JA 5KT6A 4USUA 5E3RA 5ETSA 3NAHA 3CD7A 1FRHA 1U0HA 2C3MA 3IFEA 4PABA 1RT5B 2GC8A 2PMZD 2VICA 4FYDA 2OI2A 2J7KA 3IS9A 2LYVA 3MMBB 3QRQA 2BJDA 2KHCA 2WK4A 2BE9B 4R5PA 2AJFE 4AQYF 2P9GA 3D6TB 4ZJQA 2B6AB 2RNEA 2CQDA 4DV5J 1N5SA 1S1XB 3T6BA 3T9NA 3FSXA 2YKNA 3KJNB 3EXCX 3MCNA 5HMZA 4EU0A 1YJWS 2RD5C 3ET6A 3BSAA 4NA2A 5HN0A 3EXYA 3G4SS 2AJQA 1RA7A 1X5TA 1N5TA 1Y7PA 2YNGB 1X4HA 3HFVA 1RHJB 1S9GB 3L95X 4CLTA 3GV8B 1LV5A 2JL9A 3M32A 1Q4RA 3TW0A 4C8OA 2W8LA 4PWDB 2HGLA 1BGXT 1RT4A 4E2FB 1V6HA 4EGLA 2HQIA 1V9OA 4C8ZA 3EVOA 5ETKA 4CLKA 2AYBA 3Q8RB 1ZYQA 4Q0BB 1ACMB 1U48A 1TKXA 2NXCA 2W2OP 1IKWB 2BX6A 2J8SA 4PPDA 5CHCB 1FT8A 3BJYA 1RTZA 3TZZA 1UPPA 4M1KA 4HKQA 4B9VA 1KLMB 3G8QA 4DU7A 3OLAA 2ZNZA 4N76A 1KR4A 3RBXA
chains in the Genus database with same CATH topology
1JKHA 1S0MA 3GYXB 2FJAB 4WK3A 1DTQB 2B4PA 1UVNA 1JXLA 3CCWA 2K1RB 2O5DA 2OFHX 4QCLA 4R8UA 3MUMP 3PO5A 4JI5F 3Q2TC 4ED0A 3RW6A 4Y0FA 2CQIA 2JWNA 4CCHA 3NL0A 1ZETA 1U45A 1LWCA 3W2WB 5CD4H 1X9MA 2CQ1A 4R0JA 5DG7A 1RYSA 4DQPA 3OVBA 2KXNB 1QUVA 1LXNA 3BDEA 1DZ5A 3O5TB 4I6AA 2F7VA 4UW2A 1EP4A 4F26A 1JLFA 2GMJA 2BRKA 2ZC4A 3PIPQ 2HHXA 2E7XA 3HVTA 1EETB 3MEGA 1OQ3A 3DHXA 2GNKA 2L48A 3FMBA 2L9DA 2GQQA 2LQ9A 5G4DA 4DLEA 4QYRA 4F2RA 2E9TA 3THVA 3QO9A 3CCMS 2HWHA 3SZ2A 3U27A 3M8QB 5KFCA 4WU2A 2JDJA 3RB6A 5GMKa 2YKPA 4DSLA 3WC0A 3MZIA 1NK9A 2QMXA 4O3RA 1DTQA 3VAMA 2RJZA 2QA2A 1N33F 3ZZTA 2VBXA 2RE1A 4R8UB 5JVGQ 5CH7B 4MYTA 3PW7A 4C98A 1HBUA 1VQOS 2RF2B 3DLKA 2GW8A 1HI8A 1X8DA 2WW8A 2ZBCA 1FJEB 1M5VC 3M2RA 3VALA 1J5OB 4JI3F 2M4MA 3HHEA 4ZHRB 4YOEA 3GQCA 2AYEA 5DQHA 3V6HA 1TK0A 1QTMA 1FKPB 5F0UA 1WI6A 1B7FA 1WHYA 2ABYA 3LP0B 4DN9A 3QZ8A 4IO9Q 4C4WA 1YHQS 5KT5A 2C42A 4FBTA 4IOAQ 2KDOA 4AXIA 3LQVA 1RKIA 4ID5A 3H5UA 4PG5A 4K5SA 4OI0A 3G96A 3FVYA 3HFKA 2B3TB 1RTHB 2B9XA 2X1BA 4DF8A 3PZPA 1MU2A 4TU8A 4C9DA 2HRYA 4RWXA 1S97A 2LDIA 1MWYA 4DR1F 3DLJA 1WG1A 3H98A 2FHOB 2XI3A 4MKBA 4ED6A 2IVFB 2BACA 4HEA9 4USIA 4F4YA 3PJXA 3J7ZT 1HNZF 2Q3PA 3MM8B 1SV5B 4G1IA 2MZJA 4OMFG 1X9SA 2KHDA 1S79A 1NZAA 3D1QA 3ZZOA 4LSNA 2VBZA 2YNHB 2DD8S 3PACA 2UXCF 1M5SA 2HLUA 3QJLA 3MM9B 3EGZA 4H4OA 4HT5A 4OHZA 3GV5B 3I32A 2ASLA 3PEHA 2WRMA 3AB2B 3HDSA 3OBIA 2DR8A 3B8HA 4FVCA 3I5CA 2XSJB 3FDSA 1G2EA 4DV6F 1M5KC 4KGMA 3OTDA 4JI1F 2ILYA 2F40A 4QWEA 1RTHA 2ZOFA 4IH7A 5B0GA 2VBWA 5G0RA 1BQNA 4TQRA 4O44B 3OFHA 2VA2A 2B0GA 3KK1B 3CMAS 4YB5A 2IMWP 4LF4F 3NNCA 2VQEF 3OW2R 2K7KA 4Y6IA 2RQCA 3THPA 1MMNA 4XPCA 2MHEA 2RRNA 1E6YB 1SKRA 1RI7A 1AFJA 3DLBA 4G1PA 2HWTA 2UP1A 3D0HE 4TY9A 4WJBA 2XNQA 5IWAF 4EBCA 2AW0A 3G6XA 3NMAA 3OXLA 4FNIA 1QSYA 2WONA 1NJIT 2A18A 5CZVA 1APSA 2BANA 1WTBA 3LGNA 1VGYA 2BR0A 2NQPA 1DARA 2GX8A 2Y0SD 3D28A 4WZMA 3FEZA 2MXYA 1TKTA 4YUDA 4RWWA 1FVSA 3SCIE 4H4OB 5J2PA 3MR3A 1WEZA 1BLUA 3M30A 3P3DA 4C97A 5U47A 2O66A 2DNZA 1K1QA 4XDCA 3QIPA 1FRLA 3HF5A 2FJEB 3GB0A 3MM7A 4ZCLA 4DMZA 4M8LA 4O44A 3C46A 1RT5A 2XMMA 3DGPA 4IFYB 3H5SA 2CPFA 1WACA 4A8XA 4CTAB 1KOHA 1VIOA 2JRSA 2OPQA 3NS5A 4DSKA 5LMNF 4ILMA 4PG8A 2XS2A 2KZMA 2R7OA 1FEHA 3GYNA 4C11A 2U2FA 2X1GA 1U1QA 1LOUA 1Z2ZA 2M7SA 2A10A 1NHUA 5E41A 3V6DB 3GMGA 2IM1A 3C6TA 5LL6d 2ZH3A 4LUBA 5J2MA 4NYOA 1GAOA 1X4BA 2EFGA 2QRRA 4OX7A 1D1UA 4QWDA 1ZZFA 3QJJA 2NYIA 2WBRA 1JLGA 4PCQA 1WD6A 3G86A 3IBWA 1SL0A 2AJ1A 3UNGC 1PC5A 2E5GA 1FA0A 3NCRA 2DGVA 3WC2A 4RBUA 4DL4A 4A8WA 1ZM3A 2DO0A 2C3UA 2WAQD 2UV8G 3ZFVA 3QGGA 2YNIB 4IFYA 1JKHB 1UMJA 1JJ2R 4CTAA 3NMRA 4ZCMA 3EGNA 1WF0A 4FPRA 3SFGA 2WCXA 2MKIA 4X62F 3UCUP 5A0YA 1Y5LB 2PA3A 3RR8A 2RVJA 3OL9A 4K4YA 2BJEA 1O8BA 5MAOA 2V4JB 4DV4F 1HYSB 1RDRA 3ISZA 4TQSA 2AX0A 3PEJA 3W2WA 4DSFA 1NK0A 3BN7A 3KTQA 3CTRA 1UA1A 2KFYA 4WK1A 2LA4A 4ED7A 4OZ0A 2HGMA 1FKOA 1KQGB 3MFIA 2W4PA 2XC9A 5DJBA 3TQ1A 2DVIA 1D0EA 2JEFA 1Q8IA 2VG7B 3MMAB 1FO1A 5I3PA 1WELA 2EFQA 1SQEA 1VHFA 3I5AA 4FF4A 2LLZA 1Y3JA 3FZBA 3GIIA 3C3LA 4WKRA 2IRYA 5AXNA 1WTFA 5B0FA 1WNEA 2KH9A 4B3TF 3PDNA 4ECTA 4DFPA 3AA9A 3C66A 3RB0A 2J9DE 5J2NB 2GA7A 3CCZA 3PKMA 1N5QA 1UJ5A 1HR0F 2B51A 4DSIA 1TUVA 2HS0A 5LXRA 3VF0B 4HVZA 1VJWA 1QM9A 4PXCA 4ZPAA 4TKTA 1UJ6A 1YJRA 4FXWA 1KOOA 1RTJA 2NPFA 1HBUB 5F8LA 2CVEA 2IVYA 5KFNA 2CJ9A 3LP2A 4ECVA 3Q8SB 2DNYA 3LP1B 1RP5A 2K2PA 1ULRA 2V8GA 4EBDA 4ED1A 4ZS6A 4WFBQ 2G1DA 3UI3A 4MTPA 4NLWA 2AYGA 2B9YA 2KJVA 4OV1A 2P5VA 1JLQA 4GC7A 4ECQA 2ROPA 1WF1A 1JNZB 1S7HA 2IC3B 1TK8A 4C8YA 4KFBB 3SXLA 3MURP 4V19X 1TL3B 4DFMA 3KMQA 1YJVA 1VQ4S 3JSMB 1JJ4A 4A4JA 4TU7A 3VAGA 2GMLA 2HHPA 2QYCA 4ZDNA 1JX4A 3LALA 3ZZRA 2X51A 3CD0A 4ECSA 2DHXA 3LO3A 4IFVB 3TOQA 1M1KT 2JJ4D 1NJXA 4O3PA 4KAIA 3MGJA 3EZ5A 1VQPS 2HG4A 3K8VA 3MMJA 2X1FA 3DRYA 3GFXA 1Y5IB 4J37A 2B4OA 2JHEA 5EWEA 4DDFA 2RILA 1Z1ZA 4DG1A 4QW8A 4JI2F 3M9MB 1CSJA 2LXFA 2OPRB 3Q8PB 2VC0A 2G13A 2FVQA 3BO3A 2MQPA 3OTBA 1KSPA 2NUHA 2OKQA 2N7YA 3Q2SC 5DM7Q 3NGKA 3ONQA 5EN1A 3MR2A 2ZH1A 3QYYA 1SH3A 2FLOA 2IC3A 4R0EA 4ED3A 3N0VA 1KFSA 3R5BA 2VODA 3J7A1 3VAJA 4O4GA 3CCSS 4DV2F 4DS4A 2RSQA 4KQZA 3PFEA 2JEGA 2MJNA 2OPPB 1X4AA 2LXUA 3TUIC 1PGZA 4U9RA 2XSJA 3P5TL 4F4WA 4ZP7A 3RBDA 4QYZJ 1R43A 4CNYA 2HHTA 1K0VA 1S9EB 5AXKA 3LUYA 1X4CA 5I3QA 2H5EA 1MROA 3CC7S 4I1TA 1NH8A 2UU9F 5F8JA 1BQMB 1U47A 2Z2LA 1S48A 4TYBA 3OQ2A 2KT5A 4IG0B 3TI0A 2NZ4A 3GR1A 2ZZNA 1X5SA 2W9CB 1TVRA 4X4SA 3SSRA 4JV2A 5KG6A 3KLFA 4JI7F 1FD2A 1K9MT 1TV6B 1ZPVA 3FEXB 1IQZA 2EI5A 3N9UC 4QR0A 3HT3A 5D3GB 3CDUA 2E1AA 2YNHA 3OTEA 1D9FA 1YRXA 1XNQF 1P27B 1K8AT 1XR7A 2XMVA 2ZHOA 3DRXA 4X4TA 4KHPF 3BQ1A 1X5OA 1LWEA 3BDPA 2DGTA 1ZPWX 2J76E 5SZTA 2O67A 4LFAF 2IRXA 5CCMA 4FN5A 1J5EF 3KKFA 2HNYB 2XI2A 3NWGA 4ETXA 3DXBA 2GIQA 2V8HA 2SXLA 3KMSA 1TR0A 2DITA 1DURA 4X4PA 3CVKA 2CJKA 4WCEQ 3TO8A 1C1BB 3JSYA 1REVB 2RUGA 1MMLA 1VQ9S 2V9KA 2MPUA 1DQ9A 4OLPA 1RISA 3SCKE 4MIAA 4ZMMA 1RYRA 1S0NA 2XNRA 3CULA 4KC5A 5A6PA 1R0AB 4J9KA 3RBEA 2IHR1 4I4BA 3T5LA 2N4DA 3DFEA 2PIIA 4EUVA 3O2IA 4ZCIA 4F3OA 1N8RT 4NMLA 1RAJA 4TLQA 3SFUA 3NS6A 1HQUA 3I9ZA 3O44A 1FNXH 1FE4A 1KNZA 4Y2IA 2LQBA 2R2RA 5J1NA 5J2MB 3DOLA 3Q23A 3BQ2A 1Q86T 2R7VA 4HDHA 4FF1A 3NRBA 4RUCA 5K14B 1S0OA 5F3TA 5F9LA 4MFBA 5A2QY 4CH1A 2VZ9A 2ZHBA 1IKYA 1TQLA 4KPYA 1YJUA 2K8GA 4U7UK 3QAUA 2DCUB 3QGHA 3CC2S 5KFDA 2XS5A 3AJ2A 3TA1A 3GIKA 5A8RA 3SQGA 1N56A 1RWUA 5LJ5Y 2M3DA 4TYAA 4B9MA 1FXDA 1FDAA 4XAKA 4ZP9A 4J9OA 2VKZG 2ZDOA 4LMZA 3I0SB 1T05B 1ZM9A 1QE1A 2YKMB 1HHTP 3MEDA 3H2LA 3IXQA 2RIJA 3RW7A 1UAWA 4ECXA 1R7IA 4ZPCA 3KJVB 2XBPA 2HWIA 3MM6B 5T7LA 4C11B 3QMQA 5D77A 3DLLQ 1SUQA 2JX2A 2W25A 4IRDA 3HJFA 2RU9A 1HQUB 3ZZYA 4WE1B 5CYJA 2WB1D 3UR0A 1R8HA 4MIBA 3CT9A 3DYAA 3N01A 2BQUA 2GFFA 3CDWA 3ISNC 3DOKB 4OX9F 3PXGa 2XS7A 1I1GA 1GTEA 3M1VA 5K14A 5KFPA 1SJQA 3H2VE 1U09A 4B02A 3DM2A 3IGVA 2EW9A 2MB0B 2VL1A 1FRMA 4NYPA 1HFEL 3OHAA 4PUOB 2C2DA 5B0EA 5AXLA 3BZQA 2ZE2B 4OFZA 3RRKA 5JXSA 3CDAA 3KLIB 3KK2A 2YNIA 4WIIA 5LJ3Y 2PO4A 3B4MA 3FRZA 5HBMB 2MKKA 1FE0A 2HQ3A 3AB4B 2KI2A 5J2NA 5DRKA 2RB7A 1QE1B 1X4GA 2YKMA 3S01A 1ZM4A 3LW5C 3M8RA 1VQMS 2UUBF 1H2VZ 3K2YA 3M6XA 7FD1A 3VAFA 2M8DB 4DWIA 1XBWA 1LW0B 3TVZA 4Q45A 2I38A 2BW2A 3DU6A 2D1CA 5JJBA 2P6SA 3I55S 3KHHA 3HXMA 3QGPA 1HQEB 1IKVA 1RGVA 3CDEA 5GAHI 2M9KA 3HHLC 4WE1A 1AXQA 3PX0A 1LFPA 5GADU 1L3TA 4O3SA 2KKHA 3NKYA 2BRLA 4C8MA 2IM0A 5IFMA 4FBUA 3JSRA 4ID8A 2VG7A 3LAMA 2KRBA 4PQAA 3N79A 1GXTA 1N5YB 4YDDB 5C5JA 2CKWA 4IKAA 5GAGU 4Q2MA 4IDKA 4PQUB 3JAMY 2E66A 5DGAA 2G0CA 3KYLA 4Q2LA 1AFIA 2LU1A 3I96A 1S72S 5BYSA 2BE2A 4PXEA 5C24B 4RW6A 4ID5B 2LVWA 4RLEA 3SYZA 2QA1A 4QIWD 1U1PA 3MECA 5HBMA 1X5PA 2W4DA 3BSOA 1HNIB 4N56A 2YH1A 2MMYA 5DDQC 2HHVA 5IZHA 1S1VA 4FF2A 4F4KA 1K73T 1NRKA 4H4MB 2MYFA 2MZSA 3QGIA 5HMYA 4Q8FA 2KXHA 1Y4ZB 4YB6A 2N3LA 5GAEU 3RYLA 3CD5A 1HWKA 1TL5A 4X4RA 2AYMA 1WEXA 3HHLA 1IBKF 4NL5A 1D9AA 2I1RA 1YITS 1I94F 5GAHU 2WSEC 5KFFA 2N4CA 4X66F 1U7LA 2V9WA 3N28A 4ZOSA 2DIVA 3C8YA 5HMXA 1E6VB 3MD3A 4CIOA 1LKZA 4QU7A 2POKA 2DGUA 1ZTTA 3MM9A 3HHKA 1JMTA 4N41A 1VIXA 3K58A 2AV5A 5E7OB 2IFXA 4DQSA