3TAMB

Crystal structure of hiv-1 reverse transcriptase (k103n mutant) in complex with inhibitor m06
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
424
structure length
403
Chain Sequence
IETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase/ribonuclease H
publication title Design and synthesis of pyridone inhibitors of non-nucleoside reverse transcriptase.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Transferase/transferase inhibitor
total genus 106
structure length 403
sequence length 424
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2011-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3tamB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3tamB03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3tamB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3tamB04
5DGBA 4IR9A 4J9MA 1S48A 5C5JA 5DLGA 4G1QB 1IKXB 2HNYA 5KFUA 2XGPA 2C22A 3NL0A 4ED8A 4YR2A 2YNHB 4WXOA 4QWBA 5KFCA 4KHMA 3M8PB 1GX5A 3DRSB 4FBTA 4RNNA 2V4QA 3GV8B 3TAMA 1HYSB 2W9BA 3V6HA 1S49A 3PW4A 2OPQB 4ECQA 3GIIA 4GC7A 3T5JA 3LAKA 4ZHRA 3NMAA 4KB7A 3BQ2A 4KBIA 4QW9A 4K4TA 4DL7A 3PR5B 4M94A 5KFBA 5JXSA 1MU2B 1S1UA 2BQUA 4Q45A 4LQ3A 3MR5A 4H4OB 1JIHA 5KT4A 2W9CB 2RF2A 3T19A 5J2PA 1JLFB 4J9QA 2YKNB 1XR6A 2ZD1A 2HMIA 2R8JA 2HNDA 5KT5A 2WHOA 4Q8FA 4MKAA 2IAJA 3VQSA 3FFIA 3DI6A 1C1CA 3I0SA 1SH2A 3DOKB 1N56A 3RAQA 3KLIA 3QZ7A 3IS9A 2FLNA 5HLFB 1QAIA 5KT6A 2ILYA 5I3UA 3V6KA 3QO9B 1C0UA 4NLOA 1YVFA 3KNAA 4TQRA 5KFYA 5KFJA 4O3SA 1RT7B 4KV8A 4PUOB 2AX1A 4K4ZA 2V0NA 2BQ3A 2EC0A 5J2QA 2BANA 2RF2B 5J2PB 2I1RA 4EBEA 3TVKA 1S1XB 5DG9A 4WFYA 3Q8RB 4RNHA 1JLEA 3UPFA 3H5YA 1S9EA 2CKWA 4EYIB 3CVKA 3ISND 3BQ1A 2HMIB 1N6QA 1RAJA 1JLBA 1TQLA 1RDRA 3PW0A 4MFBB 4IH6A 1RTJB 1TKZB 2OPSA 3BGRB 5KFRA 5KFSA 1K1QA 2XCAA 4Q8EA 2R2TA 4O3PA 2BR0A 2BE2A 3DI6B 1C1CB 4URQU 4JV0A 4F4XA 1SV5A 3I0SB 1D0EA 5CYMB 4Y3CA 3RBEA 3DLEB 1REVA 1TKXA 3BSOA 5KFIA 3OL9A 4IKAA 5I3UB 4Q43A 1FK9A 1HNVA 3N6LA 4ICLB 2RKIA 3DM2A 3KK2B 3Q8PB 3V4IA 3KK1B 5KFHA 4KHRA 2BANB 4Y34A 3JSMA 4DL3A 2IC3A 1JLEB 1TL1A 4IFVB 1S6PA 5KT7A 3T5KA 2DPJA 4GC6A 2RDJA 1JLBB 2GIQA 4RZRA 3GV7B 2FLPA 5HP1B 4NLUA 2YNFB 1KHVA 3MECA 3BSCA 3JYTA 3C6TA 3BQ0A 3KJVA 3C6UA 3G6XA 1TL3A 3QLHA 4NLPA 2ASLA 1C2PA 4O44A 2VG7A 3GIKA 4ECXA 3D5MA 3MEEB 2I5JA 3EZUA 1TKTA 3G6YA 4KE5A 1FK9B 1HNVB 4DG1A 3ITHA 1KLMB 1JLCA 1TVRA 2OPPA 3UQSA 4O3RA 1FKPA 2ZE2A 2RKIB 4NLVA 1EP4A 5KFZA 1R0AB 4LSNA 2W7OA 1HQEB 5FDLA 3LALA 1TV6A 2R2SA 3CJ4A 4O4GA 1S6QA 2D7SA 1RYRA 1HPZA 4YP3A 3H2LA 4EBDA 1N48A 1I6JA 3OHAA 4RW7A 4IFYA 2IM1A 2IM2A 4ZP7A 4K4SA 2IC3B 4ED1A 1S1TB 3KOAA 4TY8B 5KG4A 1N5YB 2XWYA 3FDSA 5KFPA 4PQUB 1KHWA 4YR3A 3CO9A 2FVRA 4JUZA 1EETA 3E01B 2BRLA 1LWEB 3Q8SB 1C1BA 3NBPA 3JYTB 3QGGA 3KJVB 3C6UB 1IKVB 3QLHB 1RT5A 4O44B 2E9ZA 4JV1A 5KFXA 2I5JB 3KHRA 1TKTB 3IRXB 1GX6A 4DL2A 5DG8A 4DG1B 3KLGB 1JLCB 3ITHB 5KG6A 3OLBA 1JLQA 3M9MB 3OSPA 3Q8QB 1S1VB 3DLGB 2VG6B 4RW4A 4LSNB 3KHHA 3GYNA 1VRUA 1TV6B 3MR3A 4ECRA 4O4GB 1S6QB 3DRRB 3V6JA 1HPZB 1IKWA 5KT2A 2WOMA 4FS2A 1BQNB 3DRPB 3E51A 2W7PA 4IRDA 3CJ5A 4YR0A 3DYAA 1SH3A 3PJXA 4DEZA 4KFBB 5HBMA 2HWHA 4F4ZA 3LP2B 3OL8A 3I5BA 1NHUA 2W8KA 4PWDA 2W8LA 1SUQB 5C25B 1S97A 3SI8A 4ED6A 2FJVA 1LWCB 1T03A 4YMEA 5F8GA 3IGNA 1EETB 1HQUA 1S0MA 1W25A 2R2UA 3SFGA 2R8KA 2F8EX 1DTQB 4ZPAA 4O3QA 3NBPB 3T1AA 4ED7A 2XCPA 1ZTWA 1LW0A 3KK3A 3UR0A 3MEDB 2XGQA 3DMJA 1RA6A 5F8IA 4ED0A 1S9FA 1D1UA 4RW8A 3NGDA 4XPEA 4J9PA 1SH0A 1S1WB 3RAXA 4NLXA 5KG7A 3RB3A 4O3NA 1JLQB 2HNYB 1JLAA 5KFNA 5F8NA 2ASDA 4RW4B 4KKOA 2FLLA 3H4DA 2AQ4A 2YNIA 4RW6A 2J6TA 2UVUA 5KFTA 4RNOA 3TAMB 1QE1A 4RW9A 5EDWA 2W9BB 4X2BA 2WCXA 5HBMB 2AWZA 4FBUA 2C2EA 5F9LA 5KFAA 4ZHRB 4TY9A 3MFIA 3D28A 4QWEA 1T03B 2JC0A 2BQRA 1NHVA 2O5DA 1HNIA 3CDWA 5KG1A 4Q44A 4H4MA 2FJWA 4EYHB 2D3UA 4NLGA 1S1UB 3IGVA 3CDEA 5I42A 3M9OB 4NLRA 3CIZA 2AX0A 4NLTA 3HVAA 1WNEA 1LWFA 3RBDA 2YKMA 2R8HA 2AGQA 3I5AA 2ZD1B 3LP1A 1JLAB 2HNDB 1J5OA 4ED3A 5F8MA 4NCGA 2J6UA 3BREA 4I2PA 3EPIA 1ZETA 2IAJB 2YNIB 4RW6B 3FFIB 4K4XA 1QE1B 3OLAA 1XR5A 1JXLA 4M95A 3H40A 4NRTA 4NLWA 3KLIB 1VRTA 3IS9B 4I2QA 1HMVA 1RT6A 4TXSA 2IBKA 2R8GA 1C0UB 4IRKA 2WRMA 3KLVA 3I0RA 4KV8B 4H4MB 1XR7A 4MH8A 1RTHA 3DLKA 3BJYA 1S4FA 3GQCA 4ECYA 5I42B 5DG7A 5J2QB 1T05A 4IH5A 2YKMB 1S9EB 5K14A 5KFOA 2XI3A 3LP1B 1RT3A 1N6QB 1K1SA 3M9NB 3T5LA 2JEIA 4QPXA 4NCGB 4R0EA 2OPSB 4EO8A 5L1KA 3QIDA 3UDLA 4O3OA 3OL6A 2BE2B 4WZQA 2JEJA 1SV5B 2C2DA 2WONA 4XPCA 1DTTA 4MIAA 4TLRA 1VRTB 1REVB 1TKXB 1RT2A 1T94A 4IDKA 4I2QB 5KFDA 2VA2A 2HWIA 3MF5A 4K50A 2JEFA 3KLHA 2QV6A 2QE5A 2WB4A 2IMWP 3MR6A 1BQMA 4RNFA 3DM2B 2XC9A 3DLKB 4KSEB 4KO0A 3V4IB 5D3GA 1OS5A 5C24A 4R8UA 3GIJA 3M8QA 1JKHA 2B6AA 4K4VA 4NLQA 4I7FA 3JSMB 2B5JA 1T05B 4ZVHA 3KLEA 1TL1B 5KFKA 1S6PB 4B3OA 3IG1A 1RT3B 4URSA 3V81A 2OPRA 3KLFA 1RTDA 5J2MA 4ZP8A 1JLGA 3LP0A 3QIPA 5KFFA 4EEYA 3HKWA 3RB6A 3MECB 4IG3A 2UUTA 3FRZA 1CSJA 3C6TB 5DQIA 5DQHA 4G1QA 1IKXA 1TL3B 2GC8A 2WONB 5KFQA 2VG7B 1U09A 1DTTB 4QW8A 4DL4A 5HROA 2B43A 3M8PA 4ZVFA 2ATLA 4ECUA 1RT1A 3SFUA 1TVRB 2OPPB 4HKQA 4ZPBA 1FKPB 2ZE2B 2WTFA 5L1LA 1BQMB 3PJWA 1EP4B 1DLOA 2OPQA 3H5XA 3CJ2A 4LSLA 5FDLB 4FS1A 4ZPDA 2B6AB 4QWDA 4RW7B 4IFYB 2E9RX 3KLEB 2BRKA 3BSAA 1FKOA 2UVWA 4EO6A 1MU2A 2FJXA 4TYBA 3GIMA 1HARA 3V81B 2V9WA 1RTDB 5KG3A 5J2MB 5F8HA 2W9CA 3H98A 3H4BA 2R8IA 2J6SA 1NNDA 4IG3B 1JLFA 1C1BB 2YKNA 3FQLA 5CYQA 1RT5B 4ECZA 4WFZA 5HROB 5JUMA 1RT1B 3ISNC 1Z4UA 1TP7A 4ZMMA 1QAJA 4F4WA 3RB4A 1DLOB 3DOKA 3PW2A 4TYAA 4J9LA 1VRUB 4LSLB 5HLFA 4RNMA 5L1JA 4WE1A 3PW5A 2IJFA 3QO9A 1IKWB 2WK4A 2WOMB 4H54A 4IH7A 5F8LA 4J9OA 3DYAB 4NLYA 4DL6A 1FKOB 1RT7A 4LQ9A 4G3IA 4PUOA 4PWDB 3DOLA 4IRCA 4DL5A 3MR2A 1HQUB 1S0NA 3LANA 1QUVA 2JEGA 1S1XA 3PR4A 5KFWA 3PVXA 2IA6A 3QGIA 4ID5A 4J9RA 5CYQB 2FVCA 1LW0B 3KK3B 5T14A 3DMJB 3LAMA 3OHBA 3KHGA 3PW7A 4RW8B 2ALZA 4MFBA 2JC1A 1RTJA 1TKZA 3BGRA 4Y2AA 3PHEA 5KG0A 2W9AA 3T5HA 3RB0A 3CJ0A 3H5UA 1RTIA 3NAIA 2AGPA 2E9TA 5CYMA 1S0OA 3DLEA 4KKOB 3CWJA 4WE1B 4IG0A 3OL7A 4K4WA 4ICLA 4RW9B 3GILA 2CJQA 2UVRA 3FQKA 1JX4A 4J9NA 1S10A 1T3NA 3KK2A 4ED2A 3KK1A 3DOLB 3MTKA 5J1EA 5DQGA 4MIBA 4OL8A 2V4RA 3IN5A 2UVVA 1HNIB 1RT4A 3N6NA 5KFEA 4IFVA 4ID5B 4MK9A 2ZKUA 1ZTTA 4Q0BA 3NKYA 4ZP6A 4Y2CA 5HP1A 2YNFA 1C0TA 1LWFB 2XI2A 4XO0A 5KFMA 2ILZA 3CJ3A 1RTIB 4IOBA 3HVTA 3G6VA 3OSNA 5EWFA 3PZPA 4IQXA 5C42A 2FVQA 1J5OB 2IM0A 4I2PB 1UWBA 4URGA 3MEEA 2YNGA 4MK8A 5KFGA 4IG0B 4EBCA 3I5CA 4NZ0A 5L9XA 1IKYA 1N4LA 1KLMA 4ZVGA 5KT3A 4QWCA 3QGHA 4J9KA 4WXWA 3BR9A 2ASJA 4MK7A 1R0AA 1S9GA 1HMVB 1HQEA 2D3ZA 2UUWA 3N6MA 1RT6B 4WYWA 1LW2A 5J1EB 5KFVA 4QWAA 4NRUA 5J2NA 1MMLA 5EWGA 4NLSA 3QZ8A 4ZP9A 4J9SA 3H59A 1RT4B 3I0RB 4O4RA 3GV5B 4U6PA 4R5PA 2IJNA 4ZVEA 1RTHB 2R2RA 1S1TA 2VG5A 3DDKA 3G86A 3H5SA 4YQWA 5DGAA 2FVPA 4Q0BB 4TY8A 1N5YA 1RYSA 2C2RA 4WZMA 4PQUA 3HVWA 4NYZA 3E01A 4JV2A 1C0TB 2IM3A 1LWEA 3V6DA 3ICLA 5K14B 4RUAA 3KMQA 2HNZA 3HVTB 5EUHA 5DLFA 2OH2A 2AGOA 5C42B 1IKVA 1RA7A 2RDIA 4ECTA 3MEGA 4F50A 3EPGA 1UWBB 2YNGB 5KG5A 3IRXA 4HYKA 5L1IA 4F4YA 1IKYB 3KLGA 2D41A 2JLEA 4MKBA 3KMSA 2DPIA 1S1VA 2YNHA 3MFHA 3DLGA 1RT2B 2VG6A 4IDKB 1S9GB 4RU9A 3DRSA 1LW2B 3BSNA 2VA3A 3DRRA 5J2NB 3KLHB 4TQSA 1HYSA 1BQNA 3DRPA 4ECWA 4IR1A 4RUCA 4R5PB 4WYLA 4KFBA 3QYYA 5EWEA 4ECSA 2VG5B 3LP2A 4KO0B 5D3GB 2GIRA 3CDUA 1SUQA 5C24B 5C25A 4KAIA 4R8UB 5KG2A 3M8QB 1JKHB 4U7CA 3TQ1A 1LWCA 4I7FB 3HHKA 4ZPCA 2B5JB 2C28A 2AU0A 1IM4A 2HAIA 4NLDA 4K4YA 3V6DB 4ECVA 1DTQA 4B3OB 3IG1B 3KHLA 2HNZB 5F8JA 3FSIA 4WFXA 2OPRB 3KLFB 3MEGB 3MEDA 5F9NA 4H4OA 3NAHA 1JLGB 3LP0B 3QIPB 4K4UA 5KFLA 1S1WA 4TN2A 2FVSA
chains in the Genus database with same CATH superfamily
3D3CJ 5KFUA 2CDQA 2MZTA 2ACYA 2YKOA 4FNIA 2LA6A 1VLYA 2N3LA 5AXLA 2VKRA 3NMAA 3IXQA 4JI4F 5HQMA 5D4PA 1VQNS 2JLFA 2LQ8A 5HATA 4OYBA 4EMDA 3A4TA 2W9CB 4H4OB 3MMAA 5C7PA 2GQ2A 1KRPA 3TVYA 1R8AA 3I9V9 4W92B 2Z2ZA 1NDPA 3L7OA 2XLJA 3DI6A 4CO0A 4JI3F 1FDDA 1XBWA 1IR2A 1S76D 5AE2A 3FC9A 4PYDA 1UAWA 2GGPB 2VFTA 2V9WA 2E1MC 5DG9A 3UPFA 3OXGA 3M6UA 3BQ1A 2HVIA 2O3DA 2R7UA 3HZGA 4DSFA 4IH6A 3EGZA 1TKZB 4DV5J 4JV0A 4F4XA 1XMOJ 2R7VA 1NPPA 5IOLA 1L3UA 3ENVA 3JQMA 1NEEA 4AL7A 2JFKA 2GMHA 3NOCA 2ZH4A 3OV7A 3BSCA 1QJHA 2U2FA 2ZUAA 2ASLA 2VG7A 5L38A 3ITHA 3IFEA 1Y7PA 3UQSA 3CC2S 4NZ6A 3M8RA 1VQ5S 4O4GA 3H2LA 4E98A 4RW7A 3KOAA 3CO9A 3Q8SB 2JVOA 4JV5J 3ENAA 1WKKA 3PRVA 3IRXB 5KG6A 4OHXA 3UD3P 1S6QB 4OI4A 4B3SF 5JJBA 3OL8A 1R8CA 4ED6A 2MQLA 2G0JA 5IS2A 4ED7A 4RUBA 1HD1A 3NGDA 2CNOB 4LFCJ 2DY1A 4H4KA 1J5EJ 1VQYA 2HGLA 3NGRA 2K1RA 4GO7X 1H2UX 2P9GA 2W1BA 1YDLA 2QL9B 2VJUA 1Y10A 3CDWA 4NLRA 4I1TA 2V34A 2DGSA 3SCLE 1SC4B 2ZD1B 5A8KB 1VQPS 4Y2MA 4B9MA 4DV3J 2HZVA 2FHKA 1U24A 4WPAA 3ZTRA 2BACA 1AB8A 4PQAA 2LEBA 1HWLA 3TEHB 1R43A 1S9EB 5K14A 3LP1B 2RD5C 4NMLA 5AE1A 2WZ1A 1G6BA 1PJ7A 2J8SA 1FRJA 1RT2A 2VA2A 3UW1A 5T7LA 5BYRA 3DM2B 3R7SB 1MWQA 5D3GA 5DZ7A 4PEOA 1X4EA 3KG4A 2KXHA 3PX6A 4RWWA 2BZ2A 5E2QA 3V81A 3ADAC 2M9KA 2VICA 3TA0A 4J9UE 2OHDA 1XNRF 3H2VE 3ULHA 1OMSA 4ZPBA 1QVFR 4IFYB 4L73A 2UVWA 3GIMA 2N4CA 2MY8A 1JJ4A 3EDRB 2YKNA 3RG6A 3JQJA 1IBMJ 1HIYA 2WVEA 1X5PA 4LSLB 2UUBF 1Q86T 4CLPA 3HHEA 4KGZB 1U1RA 1FJ7A 4WP9A 2FZGB 2V8VA 3PW7A 2JC1A 5KG0A 1Z2LA 5D77A 2JZ5A 4IG0A 3AHPA 1UVMA 1CPZA 1U02A 2NS1B 3I4PA 3KK1A 4OL8A 2FC9A 2UVVA 3N6NA 1RT4A 2HHXA 5D0GA 3W66A 2ZKUA 2RVJA 4Q0BA 5GVQA 2LQJA 2MLXA 3OPKA 3MEEA 2GS8A 5KFGA 1WG4A 4D3GA 3QGHA 4J9KA 1APSA 2X3DA 3VAGA 1RT6B 4DU8A 4NRUA 3UI3A 3TWZA 4QBUA 2B56A 4YQWA 1K44A 1XMQJ 1MROB 3OR1A 1RA7A 3IBFB 5KG5A 1IBLF 1YWXA 2XLKA 1S9GB 4P71A 3O3LA 2D9PA 2UV8G 4NASA 1HLWA 4NE9C 1Q5YA 2LXUA 3KHLA 2HNZB 4WFXA 3FCVA 5F41A 4K4UA 3Q86A 1S48A 4YR2A 3PX4A 1Y5IB 2CRLA 2H4YB 3CC4S 1HYSB 2KN4A 2F4VF 4OZ0A 5ETOA 4ZHRA 3BQ2A 1AFJA 2KDOA 4L74A 3TZZA 1S1UA 2FZCB 3IC1A 5HJYA 4MKAA 1DQ8A 4P2SA 4DR3F 1DURA 3V6KA 2QRRA 3A13A 1YVFA 5KFJA 1AXQA 2YX7A 4JI4J 4TVAB 1QUPA 1XC9A 1RLCL 3JXOA 5KFRA 3K57A 2G1DA 2BMBA 2ZKTA 2YPYA 2P5VA 1JLEB 1HNWF 4EK2A 2DO0A 4C8YA 1KHVA 1RHMB 3JYTA 3M4XA 2GJIA 2MZJA 3D5MA 2I5JA 1TKTA 2HQDA 3JQKA 3MOZA 1RYRA 4CLUA 2L9NA 2E66A 1HI1A 4JI8J 3GCWP 4DHVA 2BRLA 2V94A 2C2NA 2CZ4A 1XTZA 3FJ2A 3FNNA 4X4NA 3VAHA 1S1VB 1S5ZA 2DKOB 4FPIA 2HG4A 4ES2A 3MCOA 2D69A 4DPTA 4JI0F 2R2UA 3SFGA 4ZPAA 3IM9A 1R0CB 1RAIB 1RA6A 4FYYB 4NLXA 2HNYB 3ZZOA 3P96A 1H3DA 1EJ7L 2DR5A 2HHHF 3G2XA 3AODA 1RWOB 3CDEA 4OJHA 5LMUF 3W3SA 2AX0A 1DQAA 3WQPA 5F3TA 2YKPA 2O1PA 2W2NP 2B7BB 2AKWB 5LL6d 4ED3A 2VFVA 2IAJB 4QYZJ 2FQQB 1VRTA 3IS9B 4I2QA 2WRMA 4HHJA 3CXCR 1RTHA 4HDGA 5DG7A 2DJWA 3L7PA 1LK7A 4K5RA 4IH5A 5KFOA 2NLWA 2OPSB 4KT0C 3UDLA 3QT5A 4TLRA 1Z2ZA 2JEFA 5ADZA 1HWUA 2DNOA 3IG1A 1X9SA 1FDNA 3KXDA 3W2VA 2AYBA 3HKWA 4IG3A 3NGTA 1IKXA 1DTTB 4OHVA 1U2FA 4X65J 2C2ZB 2ZH3A 1Q16B 1T02A 1EP4B 5J1NA 3Q0AA 1AFIA 4EO6A 5K20B 4OYWA 2OI2A 2Z56B 3P6YC 3UDCA 2V5HG 1BMQB 2ATCB 4DUZJ 2V8GA 2XULA 4RNMA 2PC6A 2WOMB 3D66A 4IH7A 4LQ9A 4I64A 3VZIA 2BOAA 4C3MA 2Q1LA 5ETNA 1GAOA 2GHPA 1FKAF 3QWUA 1RBAA 1VGYA 3AQPA 3PNIA 3PHEA 1V3ZA 5U47A 1B0VA 3DLEA 2CQPA 3GILA 2UV8A 4OI2A 3GSIA 4ED2A 1OQ3A 3OJSA 4OI3A 1RWWB 2YX1A 3O44A 3ETMA 1NSAA 2FVQA 3CCQS 3DLJA 3OUYB 2ALYB 5L9XA 1B0TA 3PX0A 1QM9A 3DDKA 1UL3A 3G86A 1A6LA 1ZM2A 2KTQA 3I55S 2CPFA 5C42B 1IKVA 4I6WA 3EXCX 2YNGB 4RUHA 2JLEA 3AY0A 4X62F 3TUPA 2YQ0A 3RYLA 2RQKA 2VA3A 3DRPA 4F3OA 4U96A 2M52A 2VG5B 4KO0B 2C28A 1LWCA 1UEUA 3BKTA 1H74A 4F3QA 5F8JA 1XERA 4CWBA 5DLGA 3NL0A 4KJIA 1RSCA 1ICEB 1U1LA 3S01A 1J2VA 3M6XA 3R1HA 4USWA 3GJRB 1JIHA 1S0VA 1CJVB 2HNDA 2V8DA 4NX9A 3I0SA 1N5VA 3GFHA 3KLIA 2NXCA 5HVFA 3D1OA 2LEPA 2DRAA 2CPZA 2J76E 3F41A 2X1FA 2V0NA 1ROFA 4ECXA 2MKIA 4EYIB 2HS0A 5DDQC 1NO8A 3PW0A 4A8FA 3X1LB 1RISA 3DI6B 2F8MA 1SV5A 1RJJA 2BX6A 2RUSA 4ICLB 1WORA 2DR6A 3NNAA 1JB0C 4KHRA 1S6PA 1Q95G 2YNFB 1KDNA 3OR2A 4AL6A 4OZ3A 4W4MA 3G6YA 3HI9A 3AOBA 3MR7A 2XEXA 3PV8A 3PJ9A 3OVAA 3KDNA 1B64A 4OI6A 4CYUB 3BPSP 4RO0A 4FYDA 2IRUA 4C8NA 3QJJA 2XM3A 1CULB 2PEHA 3W9IA 1TUGB 2O66A 4JV1A 2XYPB 1JNZB 2HQ3A 4GO5X 3ITHB 4ZN3A 3CD5A 2G2OA 2ZH6A 4P52A 4O4GB 1FDBA 5KT2A 1IKWA 4YR0A 1NMEB 4OHWA 1B7FA 3KFWX 3SI8A 1NB7A 4OZ1A 2CWXA 1ZTWA 2VKZG 4EGLA 2RS2A 2ZH1A 1RBLA 1ZBTA 3OXFA 2VBYA 3O6QA 2QN6B 2UVUA 2NPIA 2ZZNA 5F9LA 2KJVA 2EVZA 1X8DA 1VK8A 3A12A 3FBCA 4EZ6A 2IVYA 2CJAA 2EG1A 2YKAA 7FD1A 4NCGA 2K1RB 8RUCA 4TXSA 3DN9A 3SSQA 3KLVA 3NP5A 4KV8B 2JJ4D 1SJ1A 2VDIA 2QA2A 3VV2B 4EO8A 4WZQA 5DDRC 2BW2A 4K50A 2HBYB 2AJFE 4ZA1A 4B3RJ 4UUXA 3QJLA 4DV2F 4JI2J 3GMGA 4B3OA 2DXEA 4MKVA 3OTBA 1ZYQA 1RTDA 5J2MA 4EFAC 4EEYA 2A10A 2B4OA 1Q1KA 3JS9A 4DL4A 5HROA 1XEZA 4ECUA 1RT1A 1SC1B 3OFFA 3L09A 3HD1A 4NWBA 4QWDA 2LXFA 4CLTA 1IWAA 3QT6A 4OHZA 3V81B 4AXIA 5F8HA 5CA5A 2ZDOA 3UNYA 2ZUGA 3HO1A 2QLXA 3GG0A 2VPYB 4WP8A 5K8OA 1VRUB 4CO4A 1EKRA 3IMQJ 2JSXA 4IRCA 2EK6A 3ZTPA 3HFKA 2NXNA 4KRWA 4J9RA 1F1BB 2FTRA 1RTJA 4DS5A 3TA1A 2RRNA 3HFVA 2ZBIA 4OIXA 4DR2J 2GVDA 1JX4A 2YVSA 2P6SA 4U7UK 3SBMA 1UP1A 3M2UA 5B0AA 2YWGA 1NK8A 3G6ES 2OKQA 5KFMA 3CJ3A 3DDIA 1RBOB 1DHMA 1RABB 4FNHA 4EBCA 3W2WB 4IG0B 4NZ0A 2W2QP 4DFPA 2DXFA 3QBCA 1RT4B 2A2DA 3AOCA 3Q24A 3TI0A 4Q0BB 2C2RA 1D9AA 4I6AA 4QIWD 3GIRA 4BWMA 2AGOA 3ET6B 3EPGA 1GMVA 1P1TA 2XSJA 4WU3A 4ERDA 3TZWA 4HYKA 3DDNA 1U1PA 4WK1A 2VG6A 3DRSA 2JWNA 2LU1A 1PYSB 4RUCA 1OJ4A 2UXDJ 5SUHA 4K4YA 5HQLA 2KZZA 3OR1B 4AQYJ 1KVIA 3NAHA 4CT8A 3M8PB 1WUUA 4L72B 4UOFA 4X64J 4KB7A 4PXEA 5DRKA 1W7WA 2KM8C 4ZVTB 3MPDA 2K8GA 5A8RB 1HBNB 5LMNJ 4J9QA 1XR6A 1V3SA 3VWSA 2V2VA 1L3KA 1NDLA 3J7A1 3PYFA 2ZC3A 5GAEU 4PXBA 4NXNJ 4OYZA 1KQGB 2PO4A 3M8ZA 2GMLA 4O3SA 3NCPA 1F60B 2BE9B 2HAFA 4K0KF 3W5YA 1RDRA 2HBZB 4PPZA 1WTBA 3AXMA 1NSKL 4LSZB 2QC3A 4V1Ak 3KK2B 3JSMA 3ELHA 2I6WA 2VJVA 4LRFA 1NK7A 2GIQA 3ZZRA 2EFVA 3TUIC 1R6YA 1T9VA 4DV7F 2ZVSA 1CQNA 2VONA 4LF4F 4A8YA 1FKPA 2RS8A 1KKHA 4L76A 4JI1J 4LSNA 3CJ4A 3BDEA 2MQ8A 3OD2A 5D6GA 4Q5VA 4YR3A 2OSQA 3JYTB 1BWVA 5HJXA 1N32J 2I5JB 3MM7A 1TKTB 1L3TA 3KLGB 3OSPA 5FLXU 1S7IA 4RW4A 3V6JA 3M8YA 3ISZA 3JTNA 3UN3A 4ZJOA 3TX8A 5CQGA 4PWDA 3MCNA 1VQSA 3FZBA 2C3OA 1W25A 4AE5A 4X4QA 2M8DB 2J7UA 3T1AA 3KK3A 1IUJA 4OJ3A 4RW8A 4RBVA 4LRAA 2XZWA 5H1SV 1U26A 3SCIE 1UCNA 2ZEJA 5IM0A 3TEGA 2WCXA 2XBPA 4OJGA 1Q7YT 2AJ2A 2EFPA 1TFYA 1YG0A 3M9OB 3FSXA 3I4HX 4X66F 4NLTA 2XNRA 4KYZA 1UPPA 1X9WA 2J6UA 1NBEB 1U0HB 4DSEA 2N82B 3KNGA 3THVA 3OLAA 4NLWA 1T8EA 2ZH5A 4DR6J 2DGOA 3FRYA 5DM7Q 2RQ4A 3AH6A 2DGQA 1SXLA 4UOGA 3HZEA 4EUVA 2K7KA 2XI3A 1N6QB 2GQCA 3C66A 1MN9A 2V67A 1TUWA 1VRTB 3H25A 1TKXB 4I2QB 1O5JA 3VALA 2DGVA 4A8MP 3D6MB 2B6AA 4CNYA 4IYQA 2L9DA 5KFKA 3TUJC 2E5GA 2HQCA 2J9DA 3MECB 2F40A 1IQZA 3R6LB 1JMTA 4Z37A 4FXWA 2AEMA 3DLHA 5FDLB 2UXBF 4KH1B 1VQ9S 2BRKA 4B02A 2FJXA 1HARA 4DV2J 3H98A 3H4BA 1CQMA 4IG3B 3WZ0A 4F4KA 1FNMA 4YHHF 3RB4A 1VBZA 2HFZA 4J37A 4IQMA 4DS4A 5A8WB 5H9FJ 1TL5A 2A18A 3J81j 3IP0A 2ZNYA 1X4BA 1GNKA 1HNZJ 2E1RA 5IXUA 2KI2A 5KFWA 4HVZA 4ID5A 2AYEA 2M8HA 1RTIA 1EX8A 4N56A 1OY8A 1K0VA 4B3MF 2V4JA 2MYFA 3CJRA 2E9TA 2FJDB 2B3TB 3N5BA 4CLFA 2CQGA 2MQOA 3J80Y 2MKCA 3NKYA 2FIUA 1I3OB 2ZBRA 4MK8A 2L9WA 1RAAB 5KT3A 2GCFA 4DR5F 1RCOB 1HQEA 4NLSA 1U6FA 2IJNA 1S1TA 2FZKB 2JHEA 4PQUA 3DC2A 1Y4ZB 1YJ9S 1P27B 1RWXB 3AOAA 3J81U 1NSPA 3CB4A 3RW6A 2DISA 1SKWA 4QU6A 5KTQA 3KLHB 2FYXA 1FWLA 4TQSA 2NZ4A 1WHWA 5EWEA 4DX5A 4R8UB 3M8QB 3LQVA 4LF2A 1YQHA 3VAIA 1VBKA 3J81Y 3ILOA 2CVIA 3DRYA 1P9YA 1GX5A 4RNNA 1ZAWA 3TAMA 4OJ1A 2FJBB 3UCZP 1RHQB 3NLCA 2BQUA 1VDHA 1DRZA 3W65A 3BZQA 2HLTA 1JLFB 1JJCB 1U8SA 3MUVP 1V6HA 2IFXA 3TOQA 2CADA 1IBCB 3DGVA 4HHHA 2J7KA 1RTZA 3OJUA 2H5JB 4UTGA 2Z8QA 4PUOB 3T3FA 1QDUB 2EC0A 3TUZC 3HULA 2YQ3A 1SL2A 4WFYA 4RNHA 2IDLA 2XY6A 2OFHX 3ENQA 3BGRB 2VPZB 4UZCA 3EVWA 3I0SB 3RRKA 5CYMB 4Y3CA 4NYPA 2WB1D 5J1PA 3M30A 2GO8A 1SCJB 4FKYA 1FVQA 1QSLA 3JSBA 1I94F 3G8TA 4GC6A 3GV7B 3OTOF 4LRBA 4P75A 1HR0F 2K2PA 2AYGA 2AF6A 5MLCV 2XZTB 2OPPA 3BN7A 2R2SA 4R25A 2VBWA 4YP3A 4K4SA 1FX2A 4ELVA 1LFWA 1OPZA 5KFPA 2ZH2A 2B8QA 3CPWR 5E0OA 4DLEA 1YJUA 2BUNA 5DG8A 3DLGB 3A3PB 2KXFA 3DYAA 4DEZA 3D9BA 3K5LA 1SUQB 1QTMA 4F2SA 4YUDA 2R8KA 2ACMA 3R9LA 3DMJA 4G1PA 2M0GB 5CAAA 4J9PA 1SH0A 1S1WB 1ZPVA 3RAXA 5HN0A 4H4KC 2XMAA 3HF5A 2J6TA 2VFUA 1SQFA 2QMUB 1Y0HA 4TY9A 2A1BA 3CO0P 2JC0A 3MAHA 4YB1P 1UZDA 2PI5A 3HD2A 1UVKA 1ZM3A 2YKMA 2KHDA 3BREA 1KVKA 2W4CA 1LXJA 4P74A 1JXLA 3A8KA 4DX6A 2HHQA 5THWA 1ZAVA 5JVHQ 3CJ8A 2DHSA 2NZCA 4DZDA 2VC0A 1WDDA 4LBHA 4NCGB 2DO4A 1RE1B 2QTWA 4PAAA 2J9DE 4KPCA 3DOMA 5E3CA 1BE4A 3E3XA 2C2KB 2BJ8A 2IMWP 1D8ZA 2C3UA 4RNFA 1N33J 4FZVA 2QLBB 3P4UB 1H7WA 2E5LF 1OS5A 1JKHA 2PA3A 4K4VA 1Y9OA 4OLPA 3W8PA 2W2MP 3VR1A 5KFFA 2UUTA 1FHTA 4LIRA 3H90A 2ZE2B 5HMWA 1SJFA 3R5JB 1KQKA 3V2UC 3GJQB 4USVA 4ATNA 1EARA 4TYBA 1RAHB 1RTDB 5KG3A 5J2MB 2W9CA 2JLGA 2Q66A 5IQQA 4ITSA 5HROB 1M5OC 2FY1A 1RT1B 1WC5A 1XNQJ 5L1JA 5HL7Q 3KJQB 2GHWA 1ULRA 5E41A 5IV3A 1KSPA 3CCJS 2UXBJ 2RDDA 4NI2B 3CDAA 3WC0A 2DH7A 4K7QA 2E7WA 4PG8A 3RB0A 1TKZA 1VBXA 4DR7F 4O0NA 3NNHA 1EHWA 3TW0A 2JH3A 2V9KA 4RWXA 3K17A 5L46A 4A8QA 2KVIA 2RU9A 2F5GA 1YLXA 5A2QY 5CD4H 2V4RA 4N41A 2QLJB 3DRXA 3F73A 2BXJA 4RPFA 2WSFC 1VR6A 4XK8C 1ITPA 4Z7CA 3K89A 4ZVGA 2GVDB 2MJNA 3VF0B 2XY5A 4KH0B 4R5PA 2F63A 3OW2R 1UVLA 3M2UB 3V6DA 3IRXA 1BHNA 1SJRA 2Z57B 1EZZB 3OTEA 4ZCLA 3GONA 5ETSA 1OYEA 3HJVA 4X4TA 2AU0A 4BBYA 4BC9A 3N01A 3RBXA 4ZIVA 5BJRA 2K3IA 3DRSB 5RUBA 1IN0A 1FWPA 4KBIA 3ZXWA 3KJFB 2HVEA 2YX4A 5KFBA 1MU2B 1S6OA 2BOPA 3EGWB 2ZD1A 5A8KA 2GW8A 2QA4G 2IDEA 1WHXA 1UPMB 3QZ7A 2ILYA 4DUYJ 5K9FA 5GAGI 4ENOA 1ELOA 1WSVA 1HA1A 3PG9A 1S1XB 3RUBL 1QLNA 4ZVRB 1S9EA 4CTAA 1RB0A 3UD4P 4MFBB 3LA0A 1KFSA 4DQPA 1Q7LB 3NGUA 3GSDA 3PYDA 3VCDA 4YEAA 5EX0A 1K0TA 3DM2A 1TTHB 2J0XA 1ZH5A 5IWAF 4AUKA 5HP1B 1N36J 4ALZA 4QCLA 4QIEA 3U1LA 4CLWA 3BH7B 1X0FA 2UUCF 1V5IB 1R0AB 4NCAA 5M2RA 1T95A 4I4BA 1HPZA 5DZ6A 2RNEA 1YSJA 4ZP7A 4IFYA 3TJAA 1UWAA 4K2XA 3FDSA 1KHWA 2CPJA 5GMEA 3MXHP 1I94J 2ZC4A 3LPYA 2COLA 2C42A 3OTOJ 2LDYA 1ZA2B 4USUA 3BM7A 4LSNB 3DGPB 2CDRB 3DRRB 1BQNB 3E51A 1NK6A 1HW8A 1YJWS 3PJXA 5E3RA 4HT7A 1FDAA 4NMXA 1Q8LA 2XGQA 3MEDB 1I51B 2XNQA 1S9FA 4WKRA 1WOPA 2AYMA 2ASDA 1X4CA 4RW4B 3LW5C 2AQ4A 3R7NB 2VQEF 4PRFA 1S12A 1XWLA 1F9EB 1MLAA 3DFEA 3ZTSA 3BEGB 4DQQA 1VQOS 1U7LA 4NLGA 3VAMA 3J7Z5 3IGVA 4FN5A 3O8WA 1HL6A 4IOAQ 1PAUB 3D1HA 3SXLA 5F8MA 5EN1A 3FFIB 5IM0B 4NRTA 4DBQA 1RT6A 1YJRA 3DLKA 4O23A 3MCSA 5J2QB 1CLFA 1NJWA 4PZVA 4R0EA 3OVSA 4B9VA 2KFNA 1FFGB 1VC6A 3H8YA 2QLFB 4ZLJA 4KSEB 2E5IA 2X1AA 3P3DA 3PKMA 3OQ2A 1TFWA 3D6FB 1HBOA 4CIOA 2XS5A 4ZVUB 1NDKA 4FDFA 6AT1B 1PG5B 2ATLA 3GWCA 2OD6A 2XZDB 3CSKA 2FB0A 4DV4F 3C46A 1X4HA 2B6AB 2N3OA 3CCVS 2QEXS 1OSDA 1UVNA 1IR1A 1WEYA 2MSTA 3O1LA 4ZIWA 1JK9B 4ANCA 1HHTP 4RBTA 3LGMA 2X1BA 1F3FA 4DV6J 4ZJQA 2WK4A 2CVEA 3BF4A 3T6BA 4BCAA 4FYWB 2RAQA 3DOLA 2DHXA 1QD1A 3ETOA 2JEGA 3PVXA 2IA6A 1WG5A 1IVZA 3D6TB 1RU1A 5F0UA 2XS7A 1YRXA 1R7IA 4F4AA 5JMNA 4KKOB 4F02A 4HDHA 2P9CA 1ZA1B 3TARA 2VZ9A 1Q79A 2RQMA 4A8SA 2HS3A 4ID5B 4WKYA 4S0MA 1ZTTA 5I3QA 1RTIB 2ZM6J 3HVTA 6FDRA 2V4JB 4DF8A 4PPDA 2AJ0A 1NLKL 1UEKA 4WXWA 2NXUA 1Q4RA 3D4JA 2OMOA 3C16B 5FJ4A 3QZ8A 2MGZB 4MKYA 3GV5B 2Z2MA 1BGXT 3ZZ0A 3TZYA 3GYGA 4K2JA 5BR8F 3HVWA 2IM3A 1BWEA 5H9EK 2AV5A 5EUHA 2OH2A 1DZ5A 3D3BJ 1S1VA 1I5OB 4JI5F 1VJQA 3IAM9 4N8NA 3IM8A 4CDIA 4ZPCA 3CCLS 4KGXB 1HKAA 1U48A 2Y1LB 4G1QB 2HNYA 4WK3A 4NXMF 2ZFHA 1MN7A 2CPEA 3GIIA 4GKJF 4QW9A 3KUGA 1GTEA 3JTPA 4DL7A 2ROGA 1C4CA 4LF7F 2HQIA 4PXDA 1NK4A 1LNQA 3W61A 2AEFA 5LXYA 4DR1F 2DCUB 2IAJA 2X7IA 3POTB 3IS9A 2RH3A 1IJEB 4TKTA 4DQIA 3CMQA 2HW3A 2W2PP 4JYAF 2I1RA 3TVKA 1IBKF 1U2CA 3AD8C 3P45B 2J0SD 5FIIA 1CG2A 4FF1A 1UJ4A 2OPSA 2R2TA 3MM5A 2BR0A 2BJ1A 1NJZA 1LQ9A 4CH0S 2MZ1A 3SSSA 4CNZA 2BA9A 2DNKA 2RKIA 2VDHA 1KQFB 1DJ0A 4Y34A 2IA0A 5GAHI 1FRLA 2DPJA 1HWJA 3TAPA 1TUVA 4DFJA 4F67A 1EQMA 3GB0A 1VJWA 5LSOA 1FJEB 3ZTOA 1GTHA 3M30B 4DG1A 1EP4A 3MMCB 3BBFA 1TV6A 2RRAA 3MM6B 1R6VA 1GT8A 2F9DA 4ED1A 1DFDA 2VQFJ 5G4DA 3SV4A 2XHWA 4PR6A 5HMXA 2B4UA 3M9MB 2Y8YA 4LRDA 3KHHA 2OIHA 2WOMA 3S1TA 4I56A 2HWHA 1HQ2A 1TL7B 2G4BA 1U45A 2UU9J 2ASYA 4GMKA 1P8GA 2LQ9A 2G2ZA 3MI7X 4C48A 1WDTA 1N34F 4LBPA 2WW8A 2F9JA 1SB6A 1U47A 3CD0A 4DR4F 2HWTA 3CIZA 2LFVA 4TU8A 3CC7S 2AGQA 4GVBA 1KR4A 3MPYA 4KTQA 2XQCA 3OUYA 2QT7A 1RZMA 3PDNA 2B0GA 4DLGA 3GFZA 2MHEA 3B82A 2PA8D 1ACMB 1O8BA 1S4FA 4DV1F 3NS7B 2CJYB 2JFDA 3LUYA 2YKMB 1VISA 3J7AN 2JRSA 1Y5LB 2UXCF 3M9NB 3N0VA 4CRJA 2JEIA 2H65B 4YDXA 2QSFA 4MYUA 3QIDA 1TMMA 2BE2B 2WONA 3DCAA 3BGUA 2OEJA 2GAHC 2V8PA 4UUWA 2QV6A 4WFNQ 2WB4A 4DCPB 2FDNA 4KO0A 2KG0A 3QATA 1RWMB 1FD2A 3BGOP 3OT9A 2LXIA 4OX9F 2UUAF 4YOEA 3PO5A 1NPKA 2D3O1 3BPDA 3BGFA 3DOMB 3KG1A 4ZVFA 1KQSR 2WTFA 2CJKA 1VQKS 2F8HA 3BV8A 1SJ3P 3D1QA 4GVLA 2U1AA 2CPYA 5A0YB 2VBXA 1WEZA 2HFVA 3FQLA 4LF6F 4B3TJ 1KBRA 5JUMA 5IT9Y 1TP7A 3BYRA 4F4WA 4U7UD 3PW2A 2YWKA 5F8LA 4LF5F 5DETA 4DL6A 2MQNA 2ZOMA 3H0PA 2ADCA 1K73T 1SKUB 3UN5A 1Y3KA 5F0WA 1N5QA 1TMJA 3K5PA 3EUNA 3QGIA 2DBBA 5E3PA 1V3RA 3M2RA 4JI6J 4P9SA 1OO0B 1KOHA 5DDPC 4ICLA 4RW9B 3T1YF 1WG1A 2KH9A 3CJSA 5J1EA 1HNIB 3GG1A 1WC1A 4MK9A 4HI1A 2HQGA 4NPOA 2YNFA 1NSQA 1LWFB 2XI2A 3DKDA 1HNXF 1FEEA 1ZPWX 1RAEB 2LU2A 2CAJA 1AROP 3NWRA 3M32B 1IKYA 1PCAA 5HVGA 4ER8A 5LJ3Y 1M1HA 3DHWC 4QWAA 5J2NA 3UCUP 1RLDA 4CYUA 3PYGA 5L8RC 3DXSX 2YH1A 4PG5A 1WC0A 2B8PA 4NOHA 3RBZA 1CULA 2ZJRQ 1YBUA 5AJ3J 2YNHA 3VVTA 4DF4A 4Z2XA 4IDKB 4HACA 2GQQA 4GKKF 3BSNA 3HM9A 2CFXA 4R5PB 3SCJE 4I7FB 4D3HA 3V6DB 3FSIA 5AXNA 4A47A 2ZNZA 3HSGA 4ELTA 2ZZTA 1NH8A 4BDPA 4FBTA 1S49A 2OPQB 2P8IA 1X5TA 1PIEA 4LIWA 3HHLB 4UOHA 4ID8A 2ZHAA 2BJ9A 4M5DB 4QOTA 2H4WB 4XIUA 3PFEA 3VQSA 2E1PA 1OSCA 2BABA 1UEVA 2PEBA 4QJVA 5I3UA 1X60A 5IT0A 3SV3A 3R97A 4XAKA 4USHA 4KV8A 2AX1A 2KHCA 2FHOB 4N5SA 2E5HA 2HBRB 3OVBA 2I9SA 3Q8RB 3ISND 1RAJA 2X51A 4ZPTR 2XCAA 1K1QA 3LO3A 4O3PA 3CT9A 2AD9A 5B0FA 4LR9A 4LMZA 5KFIA 4IKAA 2APOA 3N6LA 3HSJA 2YWFA 3IBCB 4F25A 5B0BA 1SKRA 4ZPWR 3CJKA 1U6ZA 4CTAB 2QFJA 4C97A 4RZRA 4UF4A 4LFAJ 2CQ4A 3EM1A 1TELA 3EZUA 2JNJA 3IA0A 1DBDA 2Z0GA 1I6JA 3OHAA 4ZVPB 1G3OA 4QR1A 3QWPA 3BO2A 3E01B 1E6YB 1FJGF 1IWGA 3MDFA 4MAKA 4YY3J 4ILRA 4DV0F 3WDOA 3BDPA 1JLQA 2VODA 3K5NA 1AZSB 4ZCIA 4RU2A 1VRUA 1HPZB 2E44A 5ETKA 3NNCA 5A76A 3CJ5A 1SH3A 5C25B 2F65A 1T03A 3IGNA 4B9SA 1S0MA 1RP5A 4ZPVR 1DTQB 4B9NA 2HURA 3LGHA 4ZVSB 3H4DA 4X2BA 2XG8A 3THTA 3JSRA 3PACA 2VOPA 3C19A 4FBUA 1UW4A 1RADB 3D28A 4QWEA 2VHGA 3VQTA 5ITHA 2KJWA 1X9MA 1NZ8A 1U1OA 2C2MB 4HLBA 4DI6A 3MOJB 1T9WA 4HI2A 2MQPA 1BD6A 4QZVB 4PCQA 1MSWD 2IJRA 3W2WA 4UQGA 3H40A 4JI7F 1PO6A 3N79A 3B78A 1WHVA 3LTOA 4IRKA 1HBUA 4HTJA 4R0JA 4OI1A 1FXLA 1IM6A 2Q79A 3T5LA 4QPXA 3ET6A 2LQBA 1CS4A 3RTVA 3NEKA 4MIAA 3FBBA 5D78A 3DLKB 3GPAA 2Y9HA 4WU2A 3DNCA 2HIQA 4YS2A 4URSA 3G8SA 5LOQA 4DV1J 1CSJA 2CNKB 1U09A 2UXCJ 4WIQA 5ETQA 3M8PA 4ANEA 1J27A 1TVRB 1PAEX 4PG6A 1DLOA 3O2IA 5LT5A 2DRBA 4B08A 4LF9J 3L9ZA 3I87A 1SJQA 5ETTA 1KVJA 2AW0A 1HBOB 2NQPA 5A8RA 1HBNA 4QIGA 1N88A 3K8WA 1NPRA 5KOWA 1KFDA 4WFZA 3R5AA 5CH7B 4LF8F 2CPDA 2HSEB 4M5HA 3PW5A 3T1HJ 3KYLA 5DO2A 2Q3PA 1R0BG 4J9OA 1JXEA 4FYVB 3D6HB 1NAQA 4QIFA 2GHVC 4HEA9 1B7YB 3CJ0A 3H5UA 2OFGX 2KYXA 3CWJA 4ZDNA 1XMBA 1HWIA 3KG0A 3FQKA 2DEIA 3KK2A 3TR5A 5AT1B 3DOLB 4C2MA 3F56A 1FXDA 1Y00A 3BGLA 2AIRB 1FESA 4WBFA 3HSDA 4LFBF 5DM6Q 1J5OB 3P5BP 1U25A 4I2PB 1UWBA 4OX8A 4LRCA 4JI3J 1JQGA 1HMVB 2JX2A 4B17A 3I0RB 2J7WA 4ZVEA 2HEKA 3FBEA 2BKNA 2DNQA 2MHNA 2VB6A 3HVTB 3C2PA 2DRDA 3D0HE 4OYPA 4Q2MA 4F50A 3KLGA 2D41A 1PGZA 3CCSS 2AEJA 5HI7A 3VHQA 3G8QA 3W62A 5EHHA 5C24B 1UVJA 2B5JB 1R8HA 2MSSA 3QIPB 2FVSA 3MTJA 5GAGU 2C22A 2XGPA 3BO4A 1UETA 1F5AA 2HHPA 5G0RA 2H3EB 2GVZB 4J5OA 4LQ3A 3VGUA 5D4NA 3PO4A 4NCBA 8AT1B 2H1YA 2WHOA 4Q8FA 1U0HA 5D15A 1SIZA 5B0EA 1C1CA 1SH2A 1SC6A 4G65A 5HLFB 1RT7B 4B3SJ 4KHPF 1URNA 1RAFB 5D0RA 2ZH7A 1SIWB 1N6QA 2HHSA 1WELA 5E3AA 1TKXA 2ZWOA 5K8NA 2CXEA 4Y0FA 1R8PA 2HKEA 3IR7B 3TP2A 3R5CA 2W01A 1UJ5A 3ILLA 1RUSA 1T9UA 3MECA 3MM5B 3G6XA 4HR2A 3GCXP 1FO1A 3LH2S 2RIJA 2RKIB 5AXMA 1PKUA 1F5BA 5FDLA 1T9TA 4F36A 4NEZA 5B09A 1WF1A 2Q43A 1R8BA 1JXVA 1N5YB 2HHTA 4JUZA 3TO8A 2OGUA 2QLWA 3HHDA 3U7JA 1YGYA 2OSRA 4MMOA 4DG1B 3GTYX 2HK2A 1TV6B 4ECRA 5A8WA 5CCMA 1H73A 2W8LA 1NU4A 4YMEA 2F4FA 3PEJA 1TK0A 1Q82T 3BO3A 2DNLA 4DV5F 3MAQA 2MKSA 1XMOF 4O3NA 2CJ9A 1JLAA 1XNRJ 4DQRA 4RW6A 1UFLA 4M5NA 3MUMP 3K5OA 4DSKA 2KL8A 4J91A 4K8RA 1VCTA 4NA3A 2OTLS 1D09B 1Q8BA 2XMUA 3RBDA 3H2UB 4P2XA 1LXNA 2DR8A 4CO1A 2G13A 1XR5A 3NGKA 1R27B 1EAYC 2UUBJ 3SQOP 1PSDA 5E5NA 2FJEB 2IYGA 2G0CA 2XMKA 1VI7A 4JV5F 4GVBB 3CJTA 1K1SA 3THPA 4TU7A 4NEYA 4PXCA 1YITS 1ZOTA 3I6PA 4OI0A 1T0TV 3MF5A 3M1VB 3W5XA 3KLHA 4WFBQ 1U6BA 2PMWA 2CQIA 3V4IB 4R8UA 3M8QA 1AA1B 3T41A 3Q2TC 3R2DJ 3AB2B 1SQGA 4LFCF 3AB4B 1TL3B 1J5EF 2WONB 3MMJA 1YJ7A 2Z4PA 2LKZA 4M5MA 3H5XA 3EZ5A 1NK0A 3JB9k 3NMRA 1FKOA 4UZBA 1UFWA 1JLFA 1C1BB 1RT5B 3AJ1A 1R3NA 2FJAB 4DV3F 3N5FA 1QAJA 3IO1A 1IBLJ 4YB5A 4QU7A 2KU7A 4PUOA 2FC8A 2CNLB 2HVHA 1U8WA 1UA1A 3GZ7A 1VLOA 2GV1A 1TAUA 4CZCA 2W9AA 3BGRA 1YKWA 1CVJA 3QJPA 1T3OA 2BM0A 5CYMA 3QRPA 3QSYB 2WBMA 3UNGC 3OL7A 2ZWPA 2F4VJ 1B99A 3R8YA 2LP4A 4DX7A 4LT6A 4ZP6A 3M2RB 4OV1A 3MPWA 1AT1B 2EI5A 2QYGA 1OPIA 3EJMA 4J90A 2ASJA 3N6MA 5A6PA 2UUWA 4DR3J 1LW2A 5J1EB 1MMLA 3CCRS 2BJ3A 4L75A 1BUXA 3F44A 3H5SA 4WIIA 1NKEA 1EIYB 1S6UA 2FHJD 2MQQA 2L3MA 1IBMF 3ZTQA 3SYZA 4XDCA 4EWTA 1U1NA 1NUEA 1IKYB 2ZHOA 2DPIA 3MFHA 3DLGA 3QRRA 1K9MT 5J2NB 4C0BA 2D9OA 2CQ1A 3RU0A 3LF0A 1NKCA 2GIRA 1SUQA 3K58A 1NB2A 3BS9A 4WFAQ 1HNWJ 1FX4A 1B3TA 1JLGB 1CJTA 5KFLA 1RCXB 1S1WA 2HHUA 4PKDB 4J9MA 2R7QA 2YNHB 4WXOA 2FY8A 4HACB 3FEZA 4DJBA 3GV8B 4DSIA 2HVDA 4L3NA 4U9RA 3C8YA 1Q53A 2CG8A 2MPUA 4CM0A 4I68A 3OBIA 2EXUA 3M8SA 2GMJA 1IJFB 2MKKA 2KRBA 1IXKA 5IV4A 1F2GA 4HL9A 5GAHU 3DOKB 5EGYA 1QAIA 1FRIA 4RL1A 5LSRA 1F3VA 4AD6A 1XMQF 3GFXA 4A8XA 1GMWD 1RU2A 3ENWA 3C3LA 4DL0C 4JI0J 1QTNB 2WW4A 3D2WA 4URQU 1M1KT 4AXJA 4E0DA 3RBEA 2MQMA 2BVZA 5I3UB 3CF5Q 2VIHA 2KB2A 1FE0A 2E1AA 1WJ9A 3W7BA 1W2IA 1JJ2R 2HHHJ 5KT7A 3RR7A 3M8WA 5LMUJ 2YWWA 3BQ0A 2BV3A 1C2PA 4O44A 2IVFB 1KLMB 3GYXB 2ZE2A 2FHMA 2W4PA 1U0SA 2OLWA 1IQTA 3J7YI 2D7SA 5ETRA 4WTOB 3CJKB 2KZMA 1SPBP 3HT3A 1LKZA 1LWEB 3L95X 5KOXA 4BHQA 1N5SA 3NBPA 2Y1RI 5KFXA 2EBGA 3ILIA 3Q23A 1H2VZ 4KR0B 3RZAA 2XMMA 3R7BB 1H6KX 5HBMA 4NI2A 4O3QA 3QQCD 4ZITA 2QL5B 1T7PA 4WP3A 2MMYA 2PDAA 3WBZA 1VS3A 5KG7A 4F2RA 1JLQB 2FUG9 5KFNA 3FVYA 2YNIA 5KFTA 1QE1A 1R89A 1N0VC 4QR2A 1T03B 1QVGR 3ZZYA 4P2FA 4H4MA 4EYHB 2D3UA 5I42A 4RX6A 3I5AA 1ZM4A 1MG7A 2FHJA 3DU5A 4N7TA 1WOSA 1C0UB 4JI8F 4F0MA 1XR7A 4TLQA 3ONQA 1PYTA 2YTCA 5GAEI 3GJTB 3G82B 2ROEA 3HDSA 4PG7A 4DSJA 2VASA 2QZ8A 1REVB 1LK5A 3MUTP 1SL1A 2RU3A 2QE5A 3MR6A 1BQMA 2QO3A 3UD5A 1KOOA 4I69A 2G9OA 1HBUB 4OLOA 3OXLA 2CYYA 3N28A 3W9HA 2M4MA 3W60A 1CS4B 4X4RA 5CD4A 4ILLA 4QW8A 1TR0A 1MW7A 1S7HA 3MPVA 3SFUA 2VL1A 1Q8IA 4ZPDA 4M1KA 2NYIA 1LWXA 4PYAA 1MU2A 2AT1B 5CYQA 3AQOA 1GMWA 2DIUA 1DLOB 5HVHA 4X62J 4L3KA 5LM7E 2DGWA 4WE1A 2CQCA 2JVRA 4C0HA 2CNNB 1HQUB 2H5EA 2M2BA 1S1XA 2LLZA 2XYHB 4NYOA 5K5MA 3HLUA 4MFBA 1PYOB 1N8RT 3G4SS 2NXJA 1S0OA 4ELUA 3GU0A 3A3NB 2C1EB 3KKFA 1H0HB 1E6VB 3V4MA 3MTKA 3EGVA 3D54A 2PI4A 3EX7B 3X3UA 3UDEA 2XO6A 5HP1A 5D0HA 4X65F 3I5CA 2RJZA 1N4LA 2GX8A 2MXYA 1R0AA 3R2CJ 1CC8A 5KFVA 4CLKA 3EYZA 3UCGA 4WZMA 4NYZA 3ICLA 2V2QA 3AA8A 1EB0A 2DNZA 1UWBB 2XMTA 4DUZF 4F4YA 1UA0A 3D68A 4MKBA 3DGPA 1SI9A 3DRRA 1BQNA 4ECWA 3Q8VA 4LR8A 3CDUA 3TQ1A 1X4DA 2BDPA 3DLBA 4C8ZA 2HK3A 2DK2A 4ECVA 2A3JA 4C8OA 3Q2SC 3KLFB 3MEDA 2H9ZA 3LP0B 3DU6A 3DXBA 2QL7B 4QWBA 1PBAA 3NWGA 3PW4A 2KFYA 1M5VC 2UP1A 4OYMA 2QA1A 4Y2IA 2DEJA 3MR5A 5I3PA 2LMIA 2DR9A 2HMIA 5KT5A 3FFIA 5G0RB 3UFCX 1MWZA 2R3VA 2C2OB 5J2QA 2F1FA 1H98A 3CVKA 1UVIA 2MEWA 1JLBA 2J9CA 3CTRA 4N8OA 5KFSA 2OJ3A 1C1CB 1RWPB 5DDOC 1D0EA 3BSOA 3CMAS 1HNVA 2ZJPQ 4PG4A 1BC6A 2X3GA 1VQMS 4C0OC 5D4OA 4N76A 4C11B 4C8KA 2XHCA 4W98A 4NLUA 1OQ6A 3C6UA 3I56S 3ZZZA 1G2EA 1HWKA 2CA9A 2CPIA 1FXRA 4EBDA 2IM2A 2WAQD 2XWYA 1RQ0A 4Y28C 5D0EA 4DFMA 3BBBA 2R7WA 2KYZA 3FGVA 3RW7A 2W2OP 2B9XA 1VRQC 2H51B 4KFBB 3LP2B 2DNRA 1DQ9A 3Q89A 5F8GA 1XQIA 2DGXA 2F8EX 4DMZA 2JL9A 1M0SA 1WC3A 4OYIA 5FD1A 5K8PA 2F3JA 4F3MA 4KPYA 3RB3A 4OX6A 3MGJA 3WX8A 3PEHA 3FK4A 4KKOA 5GMKa 3CULA 4USKA 4JB8B 4CO5A 2W9BB 1DAXA 3MPUB 3EDQB 4DPXA 1TKDA 3QRQA 2BQRA 4Q44A 3J80U 3FMBA 4C3LA 3MM9B 2KM8B 1RAOA 1YZ6A 2DNGA 3FBFA 1M5KC 5AE3A 4CT9A 2DNHA 5K8MA 2PE8A 1WNEA 2CQHA 2Y0BB 1JLAB 2HRYA 1CC7A 4RW6B 3SMZA 3MURP 3C16A 2MGZA 2EFOA 3K8VA 2EPIA 2NXEA 1T05A 1SQEA 2BYCA 3LOUA 1AUDA 5L1KA 4IUFA 2KRRA 4XPCA 2FGOA 2CZVC 1QY7A 1WKJA 5KFDA 2CQ3A 3JAMU 4MIWA 1CJKA 4GRSA 3M2VA 2QX0A 4NLQA 3IWNC 4FP9A 1TL1B 2XMVA 3RB6A 3PKYA 3C6TB 5DQIA 1CEZA 5DQHA 4G1QA 3MCMA 4AL5A 2MLYA 2B43A 3G87A 4OZJA 3JAMY 2ADBA 3FZ2A 1VC5A 3CJ2A 2P9EA 3PRBA 4WTYA 3TAQA 1RGVA 2R8IA 2J6SA 2RHSB 2CUYA 2IPOB 3UE2A 5ETVA 1UMJA 3POTA 2A2CA 1KN6A 3GLJA 3VTIA 4FXDA 1FKOB 5M2UA 1AUSL 1NXIA 2H54B 4X4UA 3NG8A 3QGPA 3LANA 4P6QA 1LW0B 5L9NA 1BY9A 3LAMA 1RHUB 2W24A 3WIUA 2XWXA 1WI8A 3RAMA 1RXOB 2CIMA 4UY8T 3OFGA 2UVRA 3MAAB 4B3RF 4JI2F 3TYTA 2CJBA 2P2CB 5KFEA 1N5TA 4LJMA 1L3SA 2WSCC 7AT1B 4Y2CA 2DCLA 2HGNA 3Q83A 3CE8A 2HVZA 2IM0A 2DH8A 4A8WA 1NJIT 2Y3YA 4QWCA 3AJDA 3BR9A 4C8LA 3MMCA 1KC8T 3MR2A 3MM6A 4A8OA 4ZKAA 1FA0A 2XMJA 4CLLA 3FKBA 1KLNA 1MWYA 1N54B 3LPEA 5DGAA 2R4FA 4K0KJ 2CWKA 5H9FK 3KMQA 5HANA 3I82A 3RR8A 1FWKA 3TANA 3R5DA 3MEGA 4FVMA 2FPHX 1LW2B 2VPXB 4IR1A 1Q0NA 4WYLA 4DN0A 4P2MA 1KNZA 1HW9A 1KTVA 2R7SA 1TL7A 1NCLA 4U67Q 2CPHA 2OPRB 3NS5A 4TN2A 1FERA 5C5JA 1HI0P 2IRYA 5KFCA 3SDEB 2BKPA 4DR2F 4CM2A 4DV7J 1YJTA 2VF3A 3VAKA 3CGIA 2Z2LA 4ECQA 4LF4J 1NKBA 4UY85 1XIQA 4K4TA 1N52B 1X5OA 3C15B 4Q45A 1UFKA 1CJTB 2XB2D 1VQ8S 3NGSA 2DXDA 2IMOA 4I67A 3HHLD 1FEHA 1UJ6A 2FLNA 4USJC 3QO9B 2M70A 4C3KA 3B4MA 4NL5A 4DN9A 1QSYA 4L6V3 1TQLA 1QAYA 4Q8EA 2BE2A 1U1QA 1SBRA 2ZBCA 2A6OA 2JDJA 2UXDF 2V2KA 3Q8PB 3CUNA 1CJUB 2ZH8A 2PN6A 3KUHA 3CCWA 1S99A 3TNVA 1S4EA 4IFVB 4AQYF 3T5KA 2RDJA 4G6VB 2FLPA 4X66J 2YY3A 5T41A 4OX7A 2NCKL 4Q7AA 1JLCA 4NLVA 4X64F 2Z58B 2VU5A 3HPOA 3HXMA 5A0YA 4TY8B 5LMNF 3I32A 2FVRA 1EETA 1K8AT 1VC0A 2R7OA 1W26A 3QAEA 4O44B 3KHRA 1GX6A 3ZZPA 3LWLA 4NXNF 3I31A 1NH7A 2VUGA 1HI8A 3DLLQ 3K2YA 4IRDA 2W7PA 2XYGB 3P8BB 1PJ6A 3I5BA 4YDDB 4YB6A 4P10A 3PXGa 3FEXB 3DHXA 1FF2A 1KWMA 2GZOA 3NBPB 2D74B 3A8EA 3AD9C 1YX2A 3UR0A 1D1UA 4Q2LA 2KVQE 2XS2A 4RW9A 4JP8A 4KGMA 5HBMB 2RQCA 3B6BA 5A2QU 1FNXH 1HNIA 1X4AA 3FCWA 3MMAB 3QNWB 2LA4A 1LWFA 2BKOA 4X4SA 3EPIA 3M32A 2YNIB 1AYEA 2HFSA 4K4XA 1QE1B 4JI1F 4YHHJ 1FVSA 1NRKA 4P73A 4OYXA 2LEAA 4H4MB 4A46A 2B4VA 5I42B 1RHRB 1FFSB 2IHR1 2KT5A 1N32F 3GJSB 4B3MJ 1T94A 4IDKA 4OV6A 2Y1JA 3L4BC 3M6WA 5DJBA 1PILA 4I7FA 2VH7A 2YH0A 4ZP8A 3K5MA 1LEOA 2L08A 1FTCA 2FGCA 2LCWA 2VG7B 2DT9A 2R7XA 1BQMB 2OPQA 1RWUA 4DR5J 3HHLA 4RW7B 4HT5A 3CD7A 1GXTA 2VD3A 3QFHA 4M5DA 2GA7A 3BBCA 3TQEA 1YK9A 3AJ2A 3CCMS 4P7VA 3ISNC 3H7HB 3B54A 4DR6F 3K59A 3WHIA 4CO2A 1RKIA 2QMWA 1FE4A 2IBOA 3PRDA 2PMHA 1TK8A 5CYQB 4Y2AA 3W8GA 4WJBA 3NAIA 3R27A 2M7SA 2RHQB 4WE1B 4K4WA 1OWXA 3QFWA 4C6AA 2MLZA 3IWLA 1A9NB 2DR7A 1O0PA 1G7CB 1M90T 5B7WA 4OFZA 1C0TA 3G6VA 3OSNA 4C98A 2LECA 5IFMA 3J7ZT 2N7CA 5LJ5Y 1RACB 4J9SA 1KP6A 5EWGA 1NHKL 2R2RA 5GADI 1I1GA 2FVPA 4O0IA 3E01A 1E6YA 5K14B 4USTA 5DLFA 4DFKA 2NYHA 3UO0A 1YRUA 2LDIA 4DWIA 1AZSA 3EVMA 1RT2B 5IT4A 2YQ1A 3FUYA 1U4BA 5T7LB 1HNZF 5D3GB 2PFFB 5C25A 3HHKA 1DTQA 1XK8A 3EZOA 3HK2A 1B4SA 5DGBA 4IR9A 2OEKA 4ED8A 1HR0J 1X4GA 2WVFA 2V4QA 3V6HA 1FD8A 2HS4A 4GC7A 2GNKA 4DQSA 2ZVIA 4M94A 5JXSA 2IY5B 2C3YA 1FTRA 4ZVQB 3D0IE 5KT4A 2RF2A 2OO4A 2YKNB 3SIPB 1OIAA 3MM8A 1O51A 3WC2A 2RUGA 3ZNUA 2ERRA 1F0XA 2UZAA 2DNYA 3PM9A 3KUEA 4NLOA 2J9EA 3SQGA 2EWHA 1RAGB 4G1IA 1IR0A 4E8UA 2BANA 2B9EA 2XLIA 2JEJA 2IIHA 3H5YA 2CKWA 2ROPA 2HMIB 1SVDA 3N9UC 3NS6A 3J7YU 4M5IA 4WF9Q 4DPYA 1KD1T 3P5TL 3TA2A 1GMUA 4I0WA 4LVNP 3KK1B 2MB0B 3TVZA 1Y11A 3MD1A 1JLBB 3GP9A 2EFGA 2BJ7A 1S72S 2PSZA 3BN4A 1PBUA 3MEEB 1YIJS 4IO1A 1RKJA 1HNVB 1TVRA 1JWWA 2FD2A 3NCQA 1M1GA 3NOGA 4UOCA 3SZ2A 2GJ2A 1U49A 2G1HA 2YXLA 3VAJA 9RUBA 4OHYA 1W2BR 3C6UB 2M5YA 2DGUA 3S6EA 2HFUA 5KAKA 3OLBA 2C3MA 2HLUA 4X4VA 4FS2A 1UTAA 2EBEA 1NJYA 2JOQA 2OAUA 1S97A 4Y65A 1WHYA 4I6YA 2FJVA 2PD1A 2E5LJ 3ZO7A 2HHVA 2XCPA 4ED0A 2AJQA 4XPEA 3D0GE 3B8HA 3RRGA 1NM2A 1RWVB 2Z2YB 4V19J 2YBVA 5EDWA 2GO9A 4BC7A 5KFAA 4ZHRB 2EFNA 4ANDA 5KG1A 2FJWA 3TJ8A 1S1UB 1WF0A 3VVUA 3HVAA 1J5OA 4ZK7M 1GEHA 4I2PA 3CW2C 4M95A 3Q22A 1HMVA 3I0RA 1H7XA 2DHGA 1VIOA 1SJ4P 3CEDA 4ECYA 4EU0A 3O5TB 3QAUA 4KY3A 4ETZA 2PMZD 4O3OA 2DNNA 4DR7J 2X1GA 4RLEA 2C2DA 2HBQB 1ZS6A 2H5IB 4ES1A 4Z7YA 2XC9A 2HFOA 2B51A 2DGTA 2RRBA 5C24A 3GIJA 5BYQA 1FRHA 2B5JA 1T05B 3PIOQ 2BJDA 2ZJQQ 3QIPA 3HX9A 2POKA 4CH7A 4B9UA 1PJ5A 4HKQA 2J8AA 3BYPA 1CJKB 3M2VB 2GVZA 2IRXA 3HVRA 3AT1B 3QT7A 3BSAA 4N77A 1B0PA 4DZ6A 3TJ9A 1N0UA 1OYDA 3G96A 1Z4UA 4ZMMA 2K06A 3UR3C 5FLXY 5HLFA 4FVCA 3L7UA 1RT7A 5GMDA 2VC1A 3SCKE 1QUVA 2AHOB 1L3VA 2FVCA 1VBYA 2ALZA 1ZAXA 4Y6IA 5SZTA 3PFOA 2LQ5A 2AGPA 4DPWA 5HO4A 2DD8S 5JVGQ 1N33F 4J9NA 2KKHA 4F26A 5IC4B 2HQFA 1PC4A 3IN5A 3MMBA 5HSPA 4RBUA 3CIMA 1HD0A 4QPTA 5CZVA 4DUTA 4XO0A 4IOBA 3RGIA 1Q8KA 4UQTA 4YB7A 4ED5A 2CQ0A 3FMWA 2D3ZA 2LYVA 4O4RA 5F3ZA 1RTHB 2MZSA 2NUHA 2MKYA 1N5YA 2P6TA 4FKXA 1MMDA 1GFWB 2RDIA 4ECTA 2QSWA 2RB7A 2K7JA 1XNQF 4M5GA 2EFQA 1WSRA 1VQ6S 5KG2A 4O3RA 2DNMA 1IM4A 2HAIA 4NLDA 3IG1B 4M5KA 3MEGB 2OTJS 2K3KA 3W2VB 5IWAJ 1VHIA 3HP6A 3G9CA 1IKXB 4DPOA 1FFWB 2GJFA 4DX8H 2UUCJ 2HHWA 1BXNA 2QGFB 4OQJA 4HTIA 5J2PA 2VBZA 2BJEA 5B0CA 3H20A 2HZCA 2R7RA 5I4MA 5ETMA 3VGSA 1WACA 1N56A 4ETXA 3RRHA 2ZDPA 4ZOSA 2QYCA 3R3TA 2E7XA 3KNAA 2H48B 4TQRA 2O01C 3W63A 2BQ3A 4C8MA 2V8HA 5D8HB 1KTQA 4IO9Q 1YZ7A 2BM1A 2CG4A 5BXIA 2DY9A 3DLEB 2ZBQA 1FK9A 3M1VA 4PWWA 4CLYA 2VQEJ 1FCAA 3V4IA 1HHQA 2RMLA 5KFHA 3MWBA 4DL3A 2IC3A 5HMYA 2PGCA 3KJVA 1TL3A 3QLHA 3GIKA 3CCUS 4KE5A 5KFZA 3UDVA 4FYXB 3LALA 2DHHA 1N48A 5IC6B 2XY7A 1S77D 1H72C 2M88A 1C1BA 3QGGA 1IKVB 1RT5A 2G2YA 3AFGA 1NZAA 5IT9U 1JLCB 3CJQA 1SC3B 4CH1A 4DUYF 1F6TA 3DRPB 5IZHA 3GE9A 2W8KA 1LWCB 1EETB 5HMZA 3ZZTA 1Q81T 1WKLA 2G0IA 4RNOA 3R1LA 1F2HA 3UVJA 2MZQA 3BKUA 1GH8A 2AWZA 4ZLNA 4DV4J 5CHCB 4MJKA 2NR0A 4C9DA 1N36F 4F0HA 1KS2A 3NXZA 2R8HA 1HHSA 2HNDB 2AP6A 2WBRA 4PWUA 5AXKA 3KLIB 3IRWP 1F9HA 5L39A 1GQEA 2IBKA 2Y8WA 2QJ3A 1YHQS 5M2PA 3BJYA 1A0OB 2KXNB 3GFYA 2ZOGA 2R42A 3SEOA 6FD1A 1RT3A 2NPFA 2DVIA 3HHNB 2ABYA 4Y00A 1SV5B 3ZFVA 2HWIA 1F5CA 1A7GE 2M3DA 1B70B 3UN2A 3C14A 4ZVHA 4U8YA 3M05A 3KLEA 1S6PB 1HBMA 4QR0A 1JLGA 4CLSA 1WC6A 1UZHA 3FRZA 2MKJA 3OR2B 5ETLA 5KFQA 3CNQP 3PJWA 4EZ9A 4M63A 2DH9A 2DTJA 5MAOA 2CQ2A 1YJNS 2N4DA 5BR8J 2HPUA 4ILMA 2EKYA 3Q8UA 2L41A 2MTLA 4FPRA 2AMCB 3DOKA 2IJFA 1IKWB 3BR8A 4H54A 2HYIB 4JI5J 4NLYA 2EG2A 1BLUA 4KIAA 3ILJA 3OHBA 1R31A 1UKUA 4HHUA 2OD4A 2V68A 4NXMJ 4MTPA 1T3NA 1GXUA 5DQGA 4MIBA 1L5UA 4GKJJ 4F7VA 2NSCA 2RSQA 4LF7J 2MDAA 5EWFA 4KGKA 4IQXA 2IYIA 4URGA 4DR1J 3NY0A 1KLMA 2MZRA 4MK7A 4XTTA 5B0GA 3WIVA 1QSSA 3H59A 4WCEQ 3RJMB 3B4DA 2A0FB 3W1YC 2ZITA 2ZHBA 4FF2A 4F04B 1C0TB 1LWEA 4RUAA 4DDFA 4JYAJ 1IBKJ 2V50A 5L1IA 2DHAA 4DV6F 3BB5A 1WI6A 2WVDA 1FJCA 1HFEL 2CQBA 1U1KA 1JJHA 4KAIA 1TU0B 2SXLA 1S59A 4B3OB 3EMTA 3IBWA 3MD3A 1RHJB 2F7VA 4H4OA 5F9NA 4M8LA 2NSBA 4ZS6A 2DNPA 1YJVA 4KHMA 3M7VA 2YWEA 1TL4A 3IWXA 3T5JA 3LAKA 2XMWA 1U2RA 4M5LA 5HK4A 2GGPA 2GAGC 1H38A 4Y2KA 1X0PA 3VAFA 2WVCA 4NA2A 2ZM6F 1P9QC 4ES3A 3FCHA 2LVWA 4P7TA 3NCRA 2MJUA 4ZCMA 2HFNA 3SSRA 4OZ2A 1C0UA 3VZHA 1M5HA 4CLZA 4CI0B 2RF2B 4EBEA 3G82A 1S57A 2W25A 2AJ1A 1RI7A 3MM8B 2D3OR 1RTJB 2PIIA 4FXVA 4LREA 1P6TA 4U8VA 1REVA 3PCOB 4OYOA 1URRA 3SQGB 5D4LA 1OY6A 2DYAA 1N34J 2BANB 2NUUG 3R6GB 2FLOA 3HT0A 4JOUA 3R5GA 8ATCB 4DR4J 1LV5A 5LSLA 4A48A 4B9TA 1FRXA 1RHKB 4RJVA 1FRKA 1RWKB 2W7OA 2QA4S 4ZLLA 4CO3A 1S6QA 2W4DA 2VFSA 1Y3JA 2IM1A 4ZJLA 3JTOA 5LXRA 4OZ5A 2OEMA 2GFFA 2KG1A 1RK8A 2I38A 4QQBA 3K7RA 3CCES 2E9ZA 4HH0A 2XSJB 1K47A 3Q8YA 4DL2A 2R7TA 3QSIA 2EC2A 4AT1B 3Q8QB 2B9YA 2VG6B 1VFJA 4ZCKA 1EQ0A 3GYNA 1T11A 3MR3A 4MT1A 2DIVA 4F4ZA 1D3WA 1NHUA 2AJ4A 3WX4A 1M5SA 3US5A 1HQUA 5ETPA 2E29A 3KDOA 5F8IA 4OX9J 2UUAJ 2E7VA 2HZAA 3CCZA 3PY8A 2PFDA 2RILA 1DY3A 3QMQA 1DARA 1S79A 1E6VA 3MFIA 3ZC4A 4RKUC 2O5DA 5E3QA 2RE1A 3LP1A 4LF6J 1VHFA 4DXLA 2B7CB 3MHYA 3IAS9 4RR5A 3OTDA 3OTCA 2XO7A 4LF5J 1UW9A 3EVOA 1KEKA 3GQCA 2I2YA 3CMES 2VQFF 2BW7A 3CD6S 2QIFA 3QPIA 2V2ZA 3A3OB 4MYTA 4OZLA 5B08A 3IR5B 1PC5A 3OL6A 5CABA 4KQZA 3KWMA 4C7QA 2BBEA 3D67A 4EI2A 4X84A 3T1YJ 2OMLA 1D9FA 4OMFG 5CYJA 3JSMB 2D1CA 3AXKA 3NRBA 4DPUA 1REGX 3E8OA 3KLFA 3A8JA 3TX0A 3LP0A 5CCLA 1ZZFA 2UU9F 2GC8A 3LGNA 1HNXJ 3HMJG 1NJXA 5L1LA 1FKPB 3IR6B 5HAOA 4DU7A 4LSLA 2E9RX 2J5AA 7FDRA 2GIFA 1V5VA 4DSLA 3AD7C 1VIXA 4UW2A 2VPWB 1NNDA 2KT3A 4QYRA 4LVOP 2AZ1A 3EGNA 3MM7B 4BLGA 3HKZD 3K0JA 2B9WA 2EKNA 4J7CA 5CZXA 4GKKJ 5H9EJ 1P1LA 4G3IA 3HCXA 4PWDB 4DL5A 1S0NA 1VQLS 3UWTA 5T14A 3KK3B 3KHGA 4RW8B 4B9LA 1Z1ZA 3CDBA 3T5HA 2WVBA 1VOMA 2R9LA 1X31C 2CPXA 1MMNA 4C4WA 3GR1A 5GADU 1MNEA 3U1MA 2BEFA 3HJFA 1WF2A 2CJQA 1NK5A 4DCOB 5A6WA 2EK1A 3LWMA 2A6MA 1YTYA 3OFHA 2O67A 3U1NA 4C11A 1Q78A 3VGTA 1MROA 1X7VA 3EWGA 1G1XA 1H2TZ 1FRMA 2N7YA 2KT2A 4DOZA 1S9GA 5HQ8A 4ZP9A 1WWHA 2L48A 3MMBB 4CP5A 1FI4A 2YPZA 4B3TF 2HNZA 2J0WA 2MY7A 4YN3B 3EE3A 2VFRA 1SL0A 3I9ZA 4XDDA 1LFPA 4RU9A 4X4PA 1HYSA 3A1YG 3MEKA 4KFBA 3LP2A 3T9ZA 4U7CA 2E1CA 4P72A 4QIVA 1FNOA 3FSYA 4JI6F 4V19X 1WC4A 2W9BA 4UT4A 3PR5B 3BH6B 3MM9A 3OFEA 4NA1A 5C2CA 3T19A 2ZZMA 3I96A 4ZN1A 1YRTA 2R8JA 1FJGJ 1WD6A 4HH1A 3PYEA 1XJWB 3CCTA 4DV0J 3RAQA 5KT6A 5KFYA 4K4ZA 1KONA 5J2PB 2KO1A 1JLEA 2VOOA 4A4JA 5AJ3F 3PHTA 5E7OB 2OELA 2DB1A 2Y0SD 4ZLPA 4NZ7A 3OL9A 4Q43A 2C3PA 2Q6BA 2V63A 3T9NA 1ZM9A 2QFIA 4USMA 3VGVA 1NK9A 1TL1A 2KFZA 5B0DA 4YFUA 2ZOFA 2QG9B 1FT8A 2CJXB 3C6TA 4NLPA 1JNRB 3KJNB 1ZZNA 2YKQA 1FK9B 1Q5VA 1D8YA 4U95A 5C2GA 4JI7J 1HQEB 5IQ6A 3W5ZA 3ZZUA 2IC3B 1S1TB 2ZBPA 2W7AA 5KG4A 4PQUB 1VMBA 3EXYA 2IVMA 3G71S 3E2EA 2EEYA 3KJVB 2I0XA 3QLHB 5DS7A 2AZ3A 3M6VA 9ATCB 4ZVOB 2VV5A 3HSZA 1C4AA 4QYZK 4AFFA 4X4OA 4BS2A 2XSFA 4CCHA 1LW0A 3MZIA 2PT0A 1G4CA 2XTJP 1V9OA 3S8SA 3HFZB 2FLLA 3TAMB 4LUBA 3MAAA 4CQ1A 5E33A 2C2EA 4OZNA 1NHVA 3TRGA 3PIPQ 2Y1IA 4TNOA 3W64A 4LFAF 2V6AA 1X5SA 1VQ4S 4W90B 4IOCQ 1RWNB 5EX3A 1TZ0A 1ZETA 3JSYA 4PABA 3UVJB 1T9YA 4LF8J 1F9FA 1VK3A 2R8GA 3EICA 2HGMA 4TU9A 4MH8A 2BE7D 3V5RA 1O6XA 4YY3F 1VYAA 1WOOA 1DTTA 1TAQA 4ED4A 3KTQA 1VQ7S 4K5SA 1SKSA 3F0NA 3TZXA 2HIYA 2CQDA 1RT3B 2DITA 2OPRA 1WEXA 1YBTA 1XN9A 3PTWA 2NREA 4LFBJ 3W9JA 2HRUA 3SDEA 2OPPB 3N4WA 5BYSA 3HHLC 4USIA 4FS1A 1GK8A 2Q6CA 3C14B 4OYAA 4KGVB 3KLEB 1HBMB 3C15A 4LBIA 3T6JA 2E5JA 3P49B 4ECZA 3U27A 4TYAA 2QMXA 4J9LA 2EW9A 2J0QD 3R5BA 3QO9A 4F8RA 3DYAB 4FF4A 3GR0A 1X4FA 1D9DA 2CZ9A 4LR7A 4LF1A 4DCJB 3PR4A 1YI2S 3DMJB 4N47A 4AYBD 1EKSA 3H42A 1GXLA 1S10A 3AAWB 1QAXA 1YBAA 4E2FB 1CJUA 2OP5A 3QT8A 4JBCA 4IFVA 1AW0A 2MKHA 1WTFA 2ILZA 2OUGA 2HRTA 1Y5NB 3PZPA 5C42A 2WSEC 2YNGA 2B4PA 3ZNJ1 1M5PC 2Z30B 1NDCA 1T9XA 4LF9F 4FF3A 4WYWA 5F8NA 2ZH9A 3FEYB 4M5JA 4U6PA 3L3CA 4K59A 2VG5A 3D7SB 4TY8A 1RYSA 4KHPJ 2YWHA 4JV2A 1U1MA 3AA9A 2RT3A 4A8KA 3KMSA 1TK5A 3T1HF 1LOUA 1BQXA 2I8EA 4BWJA 4ECSA 3QYYA 1JKHB 3U02A 2V69A 1CBKA 3S7RA 4F0KA 4WWSA 4J9VA 4KC5A 5CXTA 1OY9A 3A8IA 3BKFA 1CJVA
chains in the Genus database with same CATH topology
3J81Y 5DGBA 3MTJA 4IR9A 2CVIA 5GAGU 2C22A 5KFUA 2XGPA 3BO4A 3DRYA 1UETA 4ED8A 2CDQA 2MZTA 1GX5A 1X4GA 2ACYA 2YKOA 4FNIA 4RNNA 2V4QA 1F5AA 1ZAWA 3TAMA 2HHPA 5G0RA 1FD8A 3V6HA 2HS4A 4OJ1A 2FJBB 2LA6A 4GC7A 1VLYA 2GNKA 2N3LA 5AXLA 2VKRA 3NMAA 3IXQA 4J5OA 3UCZP 4JI4F 5D4PA 4DQSA 1VQNS 3NLCA 2JLFA 4M94A 5JXSA 2C3YA 1FTRA 2BQUA 1DRZA 4LQ3A 5D4NA 3PO4A 3D0IE 4H4OB 3BZQA 5KT4A 2W9CB 3MMAA 4NCBA 2RF2A 2OO4A 2GQ2A 1KRPA 3TVYA 2HLTA 1JLFB 1R8AA 2YKNB 1OIAA 3I9V9 4W92B 1U8SA 3MUVP 1V6HA 2WHOA 2IFXA 4Q8FA 3MM8A 3TOQA 1O51A 3L7OA 3WC2A 2RUGA 1SIZA 5B0EA 2XLJA 3DI6A 1C1CA 4CO0A 4JI3F 1FDDA 1XBWA 2ERRA 1SH2A 1SC6A 1S76D 2J7KA 1F0XA 5HLFB 5AE2A 2UZAA 2DNYA 3OJUA 3PM9A 4NLOA 1RT7B 2J9EA 2Z8QA 3SQGA 4PUOB 2EWHA 1UAWA 3T3FA 4KHPF 1URNA 2GGPB 4G1IA 1IR0A 2EC0A 4E8UA 2VFTA 2BANA 3TUZC 2XLIA 2E1MC 2JEJA 2V9WA 2YQ3A 5DG9A 4WFYA 3H5YA 4RNHA 3UPFA 1SL2A 2CKWA 3OXGA 2ZH7A 2XY6A 3M6UA 2ROPA 3BQ1A 2HMIB 1N6QA 1SIWB 2O3DA 3N9UC 3NS6A 2HVIA 2R7UA 3HZGA 2HHSA 2OFHX 3ENQA 1WELA 3BGRB 1TKZB 4IH6A 3J7YU 4DSFA 2VPZB 3EGZA 4JV0A 5E3AA 4F4XA 3I0SB 3RRKA 4WF9Q 1KD1T 5CYMB 4Y3CA 3P5TL 4NYPA 2R7VA 2WB1D 1TKXA 5J1PA 3TA2A 5K8NA 3M30A 4I0WA 4Y0FA 1R8PA 2GO8A 1FVQA 4LVNP 3IR7B 3TP2A 1L3UA 3KK1B 1QSLA 3ENVA 3R5CA 3JSBA 2MB0B 1I94F 3TVZA 3G8TA 1NEEA 1UJ5A 3MD1A 4GC6A 4AL7A 1JLBB 2JFKA 3OTOF 3GV7B 2GMHA 2ZH4A 3OV7A 3MECA 3MM5B 2EFGA 3BSCA 1HR0F 1QJHA 2U2FA 3G6XA 1S72S 2ASLA 2VG7A 2K2PA 2PSZA 2AYGA 3BN4A 2AF6A 5L38A 5MLCV 3MEEB 1YIJS 4IO1A 1FO1A 1RKJA 1HNVB 3LH2S 3ITHA 2RIJA 1TVRA 2OPPA 1Y7PA 3IFEA 2FD2A 3NCQA 3UQSA 2RKIB 1JWWA 3CC2S 5AXMA 3BN7A 4NZ6A 1F5BA 3M8RA 1VQ5S 5FDLA 2R2SA 4O4GA 4R25A 2VBWA 4YP3A 3H2LA 4E98A 4RW7A 5B09A 1WF1A 2Q43A 4UOCA 2GJ2A 3SZ2A 4K4SA 1R8BA 1U49A 4ELVA 3KOAA 1LFWA 3VAJA 1OPZA 1N5YB 5KFPA 2ZH2A 2HHTA 3CPWR 3CO9A 4JUZA 3TO8A 4OHYA 5E0OA 3Q8SB 4DLEA 2JVOA 1W2BR 3C6UB