3TAMB

Crystal structure of hiv-1 reverse transcriptase (k103n mutant) in complex with inhibitor m06
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
424
structure length
403
Chain Sequence
IETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Design and synthesis of pyridone inhibitors of non-nucleoside reverse transcriptase.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Transferase/transferase inhibitor
molecule keywords Reverse transcriptase/ribonuclease H
total genus 106
structure length 403
sequence length 424
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2011-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3tamB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3tamB03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3tamB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3tamB04
3RB4A 4LQ9A 3I0SB 4QWDA 4WFZA 3CJ0A 5J2MB 4O3RA 1T05A 2UUTA 5KFJA 3PJWA 1RT1B 1RTIB 2YNHA 5J2QA 3FQKA 2OPRB 5KFMA 5KG6A 1JLCB 5KFDA 5JXSA 3DOLB 3UR0A 4J9NA 3PW2A 1OS5A 2YNGA 1RT3A 2GC8A 2E9RX 1MMLA 2HWHA 4OL8A 2ASDA 4URSA 3LAMA 4QWAA 3HVTB 4U7CA 4YQWA 2UVRA 2B5JB 1EETA 3LP0B 2B6AB 5DGAA 3HHKA 1RT5A 1CSJA 3I0SA 2IJFA 3LALA 3OSNA 4KKOB 4WFXA 1HQEB 3DRSB 4ECQA 1NNDA 3OLBA 2IM1A 5KG2A 4Y2CA 1S9GA 3N6MA 4O4GB 5C24A 4G1QA 5KT4A 4IG3A 2JC0A 2EC0A 1JLAA 3V6DB 2VG7B 4J9QA 3FFIB 3KLGA 3IRXA 4URQU 4O3SA 3NAIA 3UPFA 3SFGA 2BQUA 4I2QA 1HPZA 3MECA 4IG0B 3MR6A 3UDLA 1DTTB 4LQ3A 3FDSA 4WE1B 4MK8A 3E01B 3IG1A 5HBMA 2W9BB 1IKVA 3MEDA 4LSLB 4NLVA 1RAJA 1S9GB 4F50A 4NRTA 4MK7A 4TQSA 1TKXB 2XC9A 1JLGA 4XPCA 1S9EA 4IFVB 1TL3B 3ITHA 4ZP9A 2ZD1A 4NZ0A 3IRXB 3HVWA 2JLEA 4IH6A 4GC7A 2ILYA 1RT1A 4J9SA 3DM2B 2OPSA 1HQUA 2HNYB 1TKZB 1JLQB 3PR5B 3G86A 1HNIB 5F8LA 4WE1A 4Q43A 4ECUA 4ED2A 3N6NA 2OPQB 2AQ4A 2R2RA 4DL7A 2BE2A 5K14B 1VRUB 3KK3A 3BJYA 4ECTA 2I5JA 3KK2B 1N5YB 1JLEA 3M9OB 2IA6A 4TY8B 3KLVA 1S1XB 1BQMA 3V4IB 3KLFA 1RTDA 3H4BA 3KLIB 3BSNA 4YR0A 4DL4A 1HMVB 2IC3A 4I7FB 2OPSB 3DLEB 5KT7A 5KT3A 5F8JA 5HP1A 2YNIA 2WHOA 3ICLA 1XR6A 1IKXA 4DL6A 3KLGB 2D7SA 1NHVA 5F8IA 3DRPA 4KV8B 1S1UA 1IKWB 2J6TA 1FKPB 4GC6A 5FDLA 5HROA 2JEJA 4K4SA 1EP4A 3C6TA 5C5JA 3EPGA 3PZPA 2QE5A 4I7FA 3OHAA 4EBEA 2VG6B 2OPRA 3QO9B 3GV8B 2BANA 1TKXA 1J5OA 3EPIA 1TV6A 2WRMA 4QWCA 1S1TB 3BQ0A 1ZETA 5C25A 1N6QA 1HNVB 2CKWA 3DDKA 3OHBA 2B5JA 3RBEA 4H4MB 1SV5A 4G3IA 5DG8A 3DRPB 4KV8A 2WCXA 4IH5A 5KG1A 5KT6A 3H4DA 2B43A 1GX5A 5KG7A 5KFCA 4Q0BB 3FRZA 2V4RA 1S48A 2BRLA 4TN2A 3OL6A 5EWFA 2WONB 2VG5A 3KJVB 4NLOA 5C24B 1S6QB 2FVSA 2FJWA 1TL1A 2FVQA 1GX6A 2OPPA 3BSAA 2R2SA 2R8KA 3V6HA 3QGGA 1REVB 5KFFA 3BSCA 1TQLA 3H2LA 5KFWA 4DG1A 4EO6A 4EYHB 3NBPA 5EWEA 4NCGB 1TKTB 4H4OB 1RTJB 4KAIA 1JLFA 3E01A 3IG1B 2QV6A 4O3OA 4ZVGA 5KFIA 4LSLA 4ZP6A 4J9MA 2AU0A 5HBMB 2WONA 4NLDA 3M8PA 5EDWA 3MF5A 4I2PA 5CYMA 2XWYA 1S6PA 3DMJB 3QGIA 1S9FA 2AGQA 1S9EB 2DPJA 4WZQA 3CJ5A 5HROB 4RNMA 3KLEB 1FK9B 4F4XA 2JEIA 5DQGA 1EP4B 3JYTB 4F4YA 4KE5A 3DLKA 3TAMB 5KFHA 4ED3A 1HQUB 4R8UA 3RAXA 3KOAA 4PQUB 4ZVHA 1JLQA 2XCAA 4KHMA 2R2TA 4RNHA 2VG6A 4IR1A 1JKHA 1R0AA 5EWGA 4ZP7A 4K4TA 1LWFB 2WB4A 1YVFA 4RNOA 1LW2A 1N5YA 3V6KA 2BE2B 5KFOA 1C0TB 3Q8QB 3NGDA 4KFBB 4MH8A 5I42A 1BQMB 4ED0A 1LW0B 2ZE2B 4K50A 1S1XA 3KLFB 2RDIA 1FK9A 5KT5A 2E9ZA 2J6UA 3DLGA 1SH0A 5L1LA 4ZPAA 4RW9A 4RZRA 1DTQA 4ECVA 4TYAA 3RB6A 2IM3A 3ISNC 3QLHB 2YNHB 4PUOB 3H59A 4YP3A 3PW5A 2OH2A 1JLCA 1LWEA 1TL1B 1SUQA 5F8MA 3BQ2A 1MU2B 4IRKA 2AGPA 5L9XA 2YKMB 2C2RA 2B6AA 5CYQA 1KHVA 3NL0A 3DM2A 1FKOA 5KFLA 4DG1B 2AX0A 4K4UA 3DOKB 1SH2A 4K4ZA 2F8EX 5F9NA 4MIBA 3OL7A 5DG7A 2HNZA 3DLGB 3C6TB 4WYLA 5KG4A 4K4WA 2OPQA 3NKYA 4ZPCA 3M8QA 1RA7A 3IS9A 4ZVEA 3H5YA 5C42A 4ECWA 4NLTA 2ILZA 2R8IA 2GIQA 4RW7B 1UWBB 3I5CA 4ED1A 3V6JA 3VQSA 2W7PA 3D28A 4QW8A 1K1QA 2IC3B 1HPZB 3KNAA 3DYAA 5J1EA 3DOKA 5HP1B 1S49A 2FJVA 1JKHB 3I0RB 1R0AB 4PWDA 5L1JA 5KG3A 1TP7A 4O3PA 1LWCB 3Q8RB 2AGOA 1SH3A 1RT2A 4ECXA 3DI6A 1T94A 1WNEA 5KFAA 3T19A 1TVRA 2BQ3A 1REVA 4JV1A 1UWBA 2W9AA 2W9CB 3MEGB 4U6PA 5F8NA 5KFPA 3BGRA 3QIPA 3CJ3A 4Y34A 5KG0A 1RT4A 1TKTA 4H4OA 3T1AA 4RW4A 4Q8FA 4FBUA 4MFBB 5J1EB 3QO9A 2HNYA 1HARA 1LWEB 3E51A 5KFBA 4ECSA 4PWDB 4DL5A 2HWIA 3NMAA 2RF2A 4RUAA 1VRUA 1S0OA 1IKYB 3OL9A 5T14A 1S6PB 3DMJA 3IN5A 1K1SA 4TY9A 4F4ZA 3BQ1A 4I2PB 1D0EA 3QYYA 2ATLA 5KFSA 1W25A 3TAMA 3GV5B 5J2MA 3GYNA 3SI8A 3RB3A 3MEGA 3BREA 3QIDA 4URGA 3MR5A 4TYBA 5KFKA 1Z4UA 4QW9A 3PW7A 2R8JA 3LP1B 1LW2B 1XR7A 3H5SA 2OPPB 1IM4A 4LSNA 4RW7A 5KFGA 4O44B 5D3GB 4ECYA 5J2NB 4YR3A 1T03B 4O3NA 3Q8SB 4Q8EA 4ED6A 3LAKA 1C0TA 2ZE2A 5KFVA 3KHHA 4EYIB 3TQ1A 3NBPB 3CJ2A 5HLFA 2XGQA 4IQXA 5F9LA 1S1VB 3T5HA 1S0NA 4TXSA 1HQEA 4QWEA 2IAJB 4MK9A 5KFXA 3M8PB 5KT2A 4ED7A 4IG3B 3I5BA 3GIIA 4IFYA 4O4GA 1J5OB 1SUQB 4NLRA 3KLEA 1S1TA 3KHGA 2IM2A 1RTHA 4RNNA 1XR5A 1DTTA 3OLAA 1FKOB 4ZVFA 3MECB 4IG0A 3I5AA 3BR9A 3T5JA 3RAQA 1C1CB 2FLPA 1JIHA 4EO8A 3ISND 4XO0A 3G6YA 1HYSA 1ZTWA 1S97A 3PW4A 3MEDB 1N56A 2C2EA 4ID5B 3T5KA 4KFBA 4NLYA 1RT7B 3MEEB 5F8GA 4JV2A 1JXLA 2XI3A 2C22A 3IGVA 1JLGB 4NYZA 3QZ7A 3JSMB 4TQRA 4EBCA 2UUWA 5JUMA 2HNDA 3H98A 4RW9B 4KHRA 4IRDA 5KFUA 5KFZA 5DLFA 1HNIA 5DG9A 3G6VA 4EBDA 2JC1A 3UQSA 1JLFB 4IOBA 4LSNB 3MR3A 1MU2A 3CDUA 2YKNA 4M95A 4IDKB 2AWZA 2D3UA 1KLMA 4RW6B 1RT2B 5KFNA 2E9TA 2R8GA 1LWCA 4MIAA 2I5JB 3KK2A 3KMQA 3C6UB 3D5MA 4MKBA 4IKAA 3M9NB 3FQLA 2WTFA 4EEYA 1S10A 3QIPB 3KLIA 4NLXA 3JYTA 4PQUA 1QAJA 3SFUA 4RW4B 3V4IA 2HNDB 1RA6A 4FBTA 2IAJA 4XPEA 3KK1A 3M8QB 2V0NA 1RDRA 2J6SA 2YNFA 4R5PA 4RU9A 1LWFA 3LANA 1RT3B 1KHWA 2YNIB 5DGBA 3DOLA 4R0EA 3M9MB 3GIKA 2V4QA 3KLHB 1EETB 4RW8B 2IJNA 4KO0A 3OL8A 4WXWA 3HVTA 1RT5B 3GV7B 4WZMA 3LP0A 2D41A 4F4WA 3DYAB 5I42B 4FS2A 1RT6A 5L1KA 1C1CA 3Q8PB 4NLPA 1U09A 3IGNA 2DPIA 2I1RA 4K4XA 3DRSA 4KSEB 4FS1A 3KK1B 1T3NA 4ID5A 2V9WA 3HVAA 1RT7A 1JLAB 3MEEA 3V6DA 1JLBA 4G1QB 3FFIA 1TV6B 4J9KA 5CYQB 5J2NA 5C25B 1N6QB 2W9CA 4IH7A 4RW8A 3BGRB 3CDWA 5KFRA 3LP2B 1QE1A 4KBIA 4I2QB 1S0MA 2FVPA 2FVRA 3RB0A 1S1VA 1T05B 2RF2B 1C0UB 2WK4A 2HAIA 5C42B 3MTKA 2W9BA 4IR9A 2VG5B 1S6QA 3KJVA 1D1UA 4YMEA 5F8HA 3C6UA 2YNGB 4IFVA 4ZMMA 1JX4A 3H5XA 1DLOB 2GIRA 1TL3A 3ITHB 2AX1A 4HYKA 4QPXA 4NLUA 2R2UA 2IMWP 4ZPBA 1BQNA 2HMIA 2W8KA 4J9OA 4NCGA 3H5UA 3I0RA 1QAIA 1HYSB 4O44A 5D3GA 1VRTA 3EZUA 4J9LA 3CVKA 2VA2A 1T03A 3N6LA 2FVCA 3T5LA 5CYMB 4YR2A 3DI6B 5K14A 3KK3B 2FJXA 4ZPDA 1TVRB 1JLEB 5KFYA 2FLLA 4HKQA 4J9PA 1C1BB 4MKAA 1N48A 3PR4A 5HLFB 1ZTTA 3MFIA 2XI2A 2BRKA 3DLKB 2ALZA 3BSOA 4O3QA 4ECRA 4R8UB 3PW0A 1RT4B 3CDEA 1QUVA 3CWJA 4O4RA 3RBDA 2XGPA 4NLWA 3NAHA 4IDKA 3KMSA 3MR2A 5KG5A 4RUCA 4K4YA 5EUHA 3PVXA 1RTHB 1IKYA 5KFEA 1S1WB 2ZKUA 2WOMA 1IKWA 4IRCA 3V81A 4ZP8A 1S1UB 5FDLB 3GIJA 1LW0A 3G6XA 5J2PA 5I3UA 3CIZA 2JEGA 4KKOA 1DTQB 3LP1A 4X2BA 3QLHA 4PUOA 2UVUA 2VG7A 4ZHRA 4Y2AA 1HNVA 4B3OB 2YKMA 3KHLA 2ASLA 2FLNA 2IBKA 1SV5B 4KO0B 3KLHA 4Q44A 4NLQA 1S1WA 4DL3A 2C28A 2UVWA 5DLGA 3PJXA 3DRRB 3V81B 4TY8A 2RDJA 1N4LA 3MFHA 4JUZA 4Q0BA 4DEZA 2HNZB 2UVVA 3HKWA 5L1IA 2W8LA 4TLRA 1VRTB 2XCPA 3H40A 1RTIA 5J2QB 3DLEA 4Q45A 1IKVB 4IFYB 4ECZA 3IS9B 5DQIA 4QWBA 2IM0A 2CJQA 1C1BA 1JLBB 4B3OA 5DQHA 4M94A 2RKIB 4ICLB 4WFYA 4WXOA 2ASJA 3LP2A 3GQCA 4ED8A 2ZD1B 2BR0A 3DRRA 3CJ4A 4H54A 5KFQA 1QE1B 1C2PA 3TVKA 2YNFB 4R5PB 4WYWA 1TKZA 3OSPA 1RTJA 1I6JA 4JV0A 4NLSA 3GIMA 1RYSA 1C0UA 4NRUA 2VA3A 4NLGA 2R8HA 4Y3CA 4K4VA 2WOMB 4J9RA 2BANB 2O5DA 4DL2A 2D3ZA 3PHEA 2W7OA 3JSMA 5KFTA 4RNFA 1DLOA 1RT6B 5J2PB 5I3UB 4H4MA 3QZ8A 4ICLA 2RKIA 1RTDB 2BQRA 1RYRA 1HMVA 3CO9A 1BQNB 2HMIB 4MFBA 3QGHA 3KHRA 1NHUA 4KB7A 4ZHRB 2C2DA 1KLMB 4RW6A 1IKXB 2YKNB 3FSIA 1S4FA 3GILA 2JEFA 1FKPA
chains in the Genus database with same CATH superfamily
2QLBB 1ZOTA 1X4FA 3A8IA 2DGTA 2F4VJ 2WSCC 2V6AA 4FF4A 4X4UA 1T05A 2VBXA 1HI0P 2DD8S 5KFJA 2ZEJA 2BM0A 4YB6A 1YJTA 2OPRB 2GVZB 4PKDB 1YJRA 2OI2A 5D0HA 3UD4P 1VQ6S 1S72S 2Q3PA 2YNGA 1WF0A 4AQYJ 4ZPTR 4A46A 4DPTA 4OL8A 1VBYA 3LAMA 2R42A 4CLUA 1LK5A 4JI7F 1U8SA 4WP3A 5L8RC 1PYTA 4HTIA 5DGAA 4OI3A 3I0SA 1GAOA 1Z2LA 1XN9A 2J9DE 3HDSA 4CLSA 1NDKA 3UCGA 5B0BA 3LALA 4B3SJ 2MMYA 5B0FA 2IM1A 4Y2CA 4C11B 3I87A 2LLZA 2R7QA 1YZ7A 2JDJA 3BR8A 4F7VA 4JI1F 4NPOA 2AYMA 2CJBA 3NWRA 3AT1B 4ZLPA 2VQEJ 3FFIB 2YX4A 1IBCB 3C16B 4BDPA 3IRXA 1XNRF 2RDDA 4NE9C 2OFGX 4WCEQ 1CC7A 2XNQA 4IG0B 2AT1B 2HFNA 1DTTB 3POTA 4YUDA 2IY5B 3DKDA 2J76E 2QSFA 1VYAA 2MXYA 1DARA 4DV7F 3E01B 3FZ2A 4LSLB 2W7AA 1O8BA 2HZVA 5I3PA 1EKRA 4BC7A 2QLXA 3BO2A 4NRTA 4CYUB 2ZZTA 2QZ8A 4MK7A 3J7ZT 2XULA 1JLGA 2JOQA 4LFCF 2A6OA 2JHEA 3BGUA 4IFVB 2QRRA 3JQKA 4ZP9A 1WTFA 5GMDA 4LF6J 2E44A 4GC7A 4MMOA 4CLYA 2OPSA 1QLNA 1HQUA 2AV5A 1X31C 2ZDOA 1QM9A 1RLDA 4W90B 1HNWJ 2NSCA 4ECUA 4FF1A 3N6NA 2OPQB 1B64A 2BE2A 4YB5A 4ECTA 2IBOA 3GE9A 1NEEA 1OPIA 3M9OB 3DLJA 4TY8B 8ATCB 2G9OA 3HSGA 3MUTP 5SZTA 5JVGQ 3THVA 3DRYA 3ONQA 2FIUA 3VCDA 3K58A 2ZUGA 3P96A 3H20A 4FVMA 4V1Ak 3HMJG 3FEXB 2J9CA 5HVFA 3G71S 1HMVB 2UXDF 2IA0A 5D78A 1B3TA 3RR8A 1RHUB 4F36A 2WHOA 1R8HA 2I8EA 1GK8A 1WI8A 2H4WB 4F3OA 3IWNC 3K17A 4RJVA 1NHVA 3BBCA 4DN0A 3DGVA 3UDCA 2YWEA 4UOHA 2G2OA 2V69A 2V2QA 4CH0S 1UPPA 2V8VA 1IKWB 3NP5A 1ZM4A 2BJ8A 1NK8A 1QD1A 1YSJA 1UVJA 2JEJA 1JWWA 4NXNJ 2BACA 4YEAA 3DLHA 5C5JA 1VHIA 3H2VE 3EPGA 2DNKA 2V5HG 1UKUA 4Y2IA 2AEFA 3FNNA 2MB0B 1Y5IB 2DISA 4DQIA 4USJC 3PTWA 2R7XA 2O3DA 1J5OA 2W1BA 3HFKA 1R6YA 1WF1A 4QWCA 1W2BR 1S1TB 1Q95G 2XMTA 4RLEA 3GG1A 3GYXB 2JEFA 3A8JA 1Z1ZA 2G13A 4M8LA 1L3KA 4IH5A 4A8OA 3ET6B 2B4PA 2J9DA 5ITHA 3H4DA 4MT1A 1NDLA 2N82B 4F3MA 1QY7A 3BEGB 2XO6A 1SJFA 5DDQC 2HFZA 1S48A 2XSJB 4DXLA 4EU0A 5EWFA 1RBLA 1LKZA 5ETKA 1H0HB 1HHSA 4OYBA 4AUKA 2FVQA 1E6YA 1IM6A 2Q66A 1MROA 1YJ7A 2R2SA 2GNKA 4DX7A 2AJ1A 5JVHQ 3V6HA 4FPIA 2R8KA 1N52B 3MM9A 4OYPA 3CDAA 4ETXA 4DL0C 4K5RA 5A0YB 1QTMA 2M8DB 3FBCA 3OVAA 3HHLB 2CJAA 3FSYA 4M5NA 2C2ZB 4DG1A 5B09A 4EYHB 3NBPA 3T3FA 3F0NA 3VAHA 5LMUF 3VV2B 1UTAA 3DGPB 5KFIA 4DV5F 3TARA 1RTZA 2AU0A 1WC3A 2WONA 3NRBA 1OQ6A 4BWJA 1FRJA 3MF5A 3UDVA 2D9OA 2DPJA 1U2RA 4L3NA 1GMUA 2HQFA 4N47A 3DU6A 2U1AA 2Y0BB 4PEOA 2FYXA 3KLEB 4F4XA 5CH7B 1VIXA 3GMGA 5DQGA 4BWMA 1PBUA 2YKOA 2AMCB 3TAMB 3BKTA 4F4AA 1MWZA 3EX7B 4CH1A 4LF9J 1U48A 2E29A 1TUGB 1JLQA 2OSRA 2EFVA 2DIUA 3UW1A 3QFWA 3L09A 4RNHA 4M5GA 3B4MA 5D4PA 1SC3B 4ZP7A 4JYAF 1WHVA 5A8WA 1UZDA 1LWFB 4ZCIA 1YVFA 4LFCJ 4XTTA 3DNCA 3Q89A 4DLGA 1N5YA 1ZA2B 4A8MP 2KG0A 2L9WA 5KFOA 1C0TB 4KFBB 3HD1A 2WVCA 3N01A 3NMRA 4Y00A 1YJNS 2B8PA 2MZQA 4TKTA 4ED0A 3W60A 2B9YA 3W65A 1OIAA 3VALA 3DLBA 2MZTA 3OFFA 1TELA 2Y1LB 5L1LA 2AJQA 1KOHA 5E3QA 3M6UA 2IM3A 3WX4A 1X9SA 3NGTA 4YP3A 2RQKA 4UY85 1TFYA 5CHCB 2UUCJ 2AD9A 1LXJA 4M5JA 4IRKA 3K5OA 3HKZD 1KNZA 5L9XA 2VIHA 4WK1A 3VAFA 3RBXA 2EFNA 3A1YG 3NGUA 3HHLA 3C8YA 3O3LA 1FKOA 5KFLA 4DG1B 1Q8IA 3BBBA 3DOKB 3KFWX 4C4WA 2KDOA 4MJKA 3W62A 4Z7CA 4UT4A 3CCSS 4FP9A 5H9EJ 1I5OB 4OYMA 4LF4J 4WYLA 1NSQA 5B0CA 5K8NA 1WSRA 3NKYA 2G1HA 4MAKA 2B9WA 2CJKA 2DHGA 5C42A 1U6FA 4NLTA 4DUYJ 2ILZA 3CGIA 2R8IA 2PSZA 5I4MA 3GR1A 1NZAA 5BYSA 2HGLA 3ELHA 4GO7X 1SI9A 1Q1KA 3I5CA 3R8YA 3V6JA 1Y4ZB 1RWKB 3ILLA 1AA1B 5D0EA 3SCJE 1SKRA 4DWIA 3KNAA 4DR4J 5GADI 4XAKA 3R1HA 3RUBL 3DYAA 4ILMA 2BOPA 1TL7A 3M30A 1Q16B 1J2VA 3I0RB 2GO9A 2XYHB 2F4VF 3MAAB 3MUMP 1RWVB 1BY9A 2DH7A 4LR9A 2HHSA 2DR7A 2R7TA 2R7WA 3W5XA 1FF2A 3Q8UA 1LWCB 1NAQA 2FGCA 4NMLA 3Q8RB 2CJ9A 3MPWA 4QR2A 4ECXA 3EGZA 3DI6A 3FEZA 1O5JA 1T94A 1W7WA 4DR4F 2BQ3A 1REVA 1UWBA 2MLYA 4DV5J 1WD6A 2EBEA 2IRUA 4DR5F 3CCES 2MLXA 3GLJA 5KFPA 2RHSB 2CYYA 2LEBA 1TKTA 4QYZJ 1Y11A 1V5IB 4OZ0A 2B7CB 1BLUA 4DN9A 4FBUA 1B7FA 2HNYA 1HARA 2LKZA 5KOXA 4ECSA 2PC6A 2Z4PA 3ENWA 4LT6A 2XQCA 2RF2A 1TUVA 4RUAA 4OV1A 1NHKL 1IKYB 3ISZA 4E98A 3OL9A 3W9IA 4LFBJ 5T14A 2MKIA 1CG2A 1FKAF 2ZH9A 1D0EA 2PN6A 4WFNQ 2ATLA 5KFSA 4X4QA 3MDFA 2GHVC 3SYZA 2F63A 2RUSA 3GV5B 2BKOA 1Q53A 3RB3A 1WDTA 4X62J 1U1RA 3FRYA 2VQEF 4P75A 3DRXA 1YK9A 1X9WA 4LSZB 2A10A 1C4CA 1PKUA 1RUSA 1FJ7A 1UVLA 3QFHA 3H5SA 1EB0A 5ETOA 4P2XA 2KL8A 3K8WA 1OQ3A 3Q24A 5J2NB 1VJQA 1U24A 1UZHA 1T03B 4YR3A 2VDIA 4UW2A 5A2QU 2KXFA 1VC6A 3CE8A 5T41A 3ZZRA 5J1PA 1VJWA 1FERA 4EYIB 4HACA 5D77A 3M8SA 2FB0A 3HFVA 3AB4B 2GZOA 2K1RA 3ILIA 4IQXA 1OY6A 2VBYA 1BE4A 2WW4A 1IR2A 5F9LA 5ETPA 2LXIA 2IAJB 1HBOB 5KT2A 1UJ6A 1HHQA 2W2QP 1CJKB 3PRBA 3GIIA 3AXMA 4IFYA 2ROGA 2LQ5A 1EKSA 3W61A 4NLRA 3SV3A 3KHGA 2HHVA 2HGMA 3N28A 2MYFA 4ES3A 4PXBA 2GW8A 1FVQA 3H90A 4DR1J 1ULRA 4FPRA 4K2JA 1D8YA 4PG6A 4IG0A 3I5AA 3BR9A 4LUBA 4CTAB 3T5JA 3GU0A 3D4JA 5E3AA 2HHHF 3CIMA 2IRXA 4EO8A 1OO0B 2JVOA 3G6YA 2DTJA 1LQ9A 4ELVA 3KDNA 2OFHX 5AXNA 1L3TA 5HO4A 2C2EA 3T5KA 3N5FA 5IQQA 2YXLA 2I2YA 1NUEA 1LFWA 4I4BA 3F73A 3LOUA 2XI3A 2N3OA 1JJ2R 1JLGB 3QZ7A 5B7WA 1E6VA 1TZ0A 1YJ9S 1ZM9A 3ILJA 4TQRA 4EBCA 3R6LB 1T9VA 3H98A 4KGKA 4RW9B 3OR2B 5LSOA 1S6UA 2A2DA 5KFZA 1P9QC 4C0OC 1HWUA 2C2OB 5AE3A 4OZLA 2M52A 3EZ5A 2JC1A 3UQSA 4EBDA 1NJXA 3MR3A 1MU2A 3CDUA 3VGSA 1HWIA 1FE4A 2CUYA 3VGVA 4RU2A 4IDKB 2GMJA 4RW6B 2VFTA 1RT2B 3QPIA 1FRKA 3A8KA 3QQCD 4CNZA 4UQGA 1MN9A 2R8GA 2E9TA 3KMQA 3QJLA 3C6UB 4MKBA 4IKAA 3HZEA 4J9VA 3M9NB 3L7PA 2V94A 1S10A 4HI1A 4EEYA 1B70B 3QIPB 3KLIA 4NLXA 4PQUA 3CC2S 1RA6A 3GJTB 2MQLA 1EAYC 2IAJA 4K2XA 3M8QB 5THWA 3WZ0A 3CCTA 4R5PA 2G1DA 3VZIA 1QAXA 1KQGB 4WWSA 3ZZ0A 3D67A 3DOLA 1HQ2A 1U0SA 2AZ3A 3VVUA 4ED5A 2PFDA 3AB2B 3M9MB 1K9MT 1V3ZA 2VFUA 1EX8A 2J7UA 4NXNF 2IJNA 3OL8A 2B51A 2FPHX 2C3MA 2IIHA 5HI7A 2ASDA 1WI6A 4PAAA 1KQSR 2D41A 1NK5A 2F8MA 4ES2A 4P52A 1WWHA 3MD1A 1KEKA 5L1KA 3UNGC 3MM7A 4PG4A 3GFZA 4CLLA 1GTEA 2DGVA 2APOA 2O66A 1NU4A 2I1RA 4UZBA 4C8ZA 2MKCA 5D4LA 3LW5C 4I56A 4EK2A 1T3NA 4CLKA 4LFAJ 3OXGA 2RRAA 1FO1A 4OLPA 5C2CA 2OO4A 3X3UA 4LR8A 2XM3A 3FFIA 3C16A 2LECA 1AUDA 3C46A 5CYQB 2VFRA 2XZTB 4IH7A 1H72C 4NEYA 2YH1A 3LP2B 2YWGA 3GJQB 1SIZA 1T9YA 3QMQA 2C3YA 4KBIA 4EFAC 2KTQA 1WOSA 2FVRA 1FWKA 3RB0A 1UEUA 3O2IA 3BPDA 2WK4A 1C0UB 2YY3A 3MTKA 2W9BA 1BHNA 2GJFA 2V8HA 3NOGA 2FHOB 2JL9A 3C6UA 5CYJA 1RWNB 3J7AN 4IFVA 4QBUA 2W25A 5AE2A 4ELUA 2NXNA 2GIRA 1R0BG 1N5QA 2F9DA 3D54A 2XMMA 5H9FK 4AFFA 5E3PA 2HMIA 4OIXA 3VAGA 2W8KA 4J9OA 5HVHA 3CB4A 3HP6A 4OZ3A 1RBAA 1VRTA 2VA2A 2ROEA 3TEHB 5CABA 3T5LA 5HL7Q 4RX6A 2QA4G 1GEHA 5K14A 5LJ5Y 1KOOA 4KQZA 5KFYA 4Q7AA 2H65B 2FLLA 5IT9Y 3EJMA 2L9DA 5E41A 3PR4A 2J0QD 1MW7A 2V8PA 3BSOA 1WEYA 3KUGA 1F9EB 4B9MA 3A12A 3OQ2A 2GO8A 1VQ5S 3Q86A 1N34J 2ZDPA 4I6AA 3KMSA 2KXNB 4K4YA 3OD2A 1SKWA 3PVXA 1RTHB 2FZKB 3HHLD 3MPDA 1S1WB 5G0RA 3HJVA 2PI4A 1IKWA 4JBCA 3HLUA 4W4MA 4AD6A 4GVBB 4F25A 1S1UB 2RMLA 2WVDA 1UEKA 1VQKS 1MMDA 1WHYA 4MKVA 1J5EF 3M2VB 2ZJQQ 1M5SA 1R8CA 1KBRA 2UU9J 5B08A 2GJIA 2YPYA 1ZA1B 2P9GA 3BPSP 1CLFA 2DNYA 2NYHA 1VS3A 5M2RA 4FXWA 1WACA 1Y5LB 3D9BA 3NCRA 4OJ3A 1FCAA 2BJ9A 3OPKA 4ZHRA 1IQZA 4E2FB 4ZPVR 1CJVA 1YGYA 4ZVOB 1WC0A 3HK2A 1X4GA 5BJRA 4WF9Q 5GMKa 2C28A 2IFXA 1XWLA 2QA2A 4DL3A 1SJ4P 3DRRB 3PHTA 4ZLNA 1UA0A 1RAAB 2ZBPA 3AQPA 2OAUA 1NLKL 4C0HA 2HNZB 4NZ7A 3BDPA 2GQQA 1VRTB 2XCPA 2W01A 4NWBA 3DLEA 2GFFA 4OJHA 3NY0A 1E6YB 3CW2C 4X65F 3SV4A 2QYGA 3O5TB 5DQIA 2KHCA 2CJQA 3D6FB 1JLBB 4B3OA 2K3KA 2WVBA 5DDOC 3M8ZA 2N4CA 2ASJA 4QIEA 1KONA 1SPBP 4HVZA 4P7VA 2IJRA 1C2PA 4LREA 3IBWA 4WYWA 1B4SA 3DGPA 3PEJA 1FXRA 2H48B 2NZCA 3DHXA 1RTJA 2MY8A 4Y65A 1N33F 2Q79A 4NLSA 4N77A 1RYSA 2KYXA 3TVZA 3QRRA 2R8HA 1B0VA 3TJAA 1M1GA 3EVMA 4CH7A 3ENAA 2K8GA 5IV3A 2CNOB 3PRDA 1S4EA 5DDPC 1XMQF 3OTDA 4DFJA 3HF5A 3W7BA 3JSMA 1ZM3A 2JLFA 3TJ8A 1Q5VA 3QZ8A 4CNYA 2RKIA 2VV5A 1RTDB 4YDXA 3TVYA 3ZXWA 3K0JA 3PCOB 5B0EA 3A3OB 1RYRA 2VDHA 5C7PA 4R0JA 2VU5A 2FD2A 3VTIA 5A6PA 2CVEA 2EFQA 2ZBIA 1PCAA 4DSJA 3AD7C 5E0OA 4ZHRB 3M2RA 2VKRA 1KLMB 2XMUA 4AL5A 5IQ6A 4DMZA 3PYFA 2HS4A 1G4CA 2E1CA 3EM1A 4A4JA 4HH0A 1GH8A 4K0KJ 2DKOB 2HGNA 1NPRA 3P3DA 5GAGU 3RB4A 3M8WA 4QWDA 1N34F 1HBNA 1XERA 2AW0A 5IC4B 3CJKA 3K5PA 2DH9A 3VHQA 1D09B 2UUTA 3EZOA 1RP5A 1ZYQA 3QRQA 2QLFB 2FZGB 4HH1A 1NK7A 1FHTA 1RCXB 3NXZA 4NL5A 5LSLA 1XMOJ 2VD3A 5KFDA 4JI0J 1CULB 1BXNA 1OS5A 3GFXA 4FYDA 2RSQA 2GJ2A 2HWHA 3D6TB 3TNVA 3I9V9 3UO0A 4HHJA 4URSA 3A3PB 1X4AA 1OY8A 3PNIA 3HVTB 4LRCA 4QWAA 2B5JB 3NS7B 3LP0B 4HTJA 3M7VA 5ETQA 3HHKA 1RT5A 2W2PP 4KJIA 1WEZA 2DHSA 2H51B 2CNLB 2MEWA 2J7KA 1YX2A 3CF5Q 4KPYA 4KKOB 1HQEB 3W2VA 1D9DA 3DRSB 2BVZA 1WOPA 5KG2A 1S9GA 3RYLA 1WELA 4CQ1A 3I4PA 3PV8A 1NK0A 3KUEA 5C24A 4CP5A 4G1QA 5M2UA 2X3GA 1HNXJ 1JLAA 3GWCA 4FYVB 2VG7B 1RWWB 4ZCKA 2BJDA 4KYZA 4S0MA 3FBBA 4BHQA 1IWGA 3M32B 3NAIA 4J37A 4EZ6A 4L74A 2H5JB 4I2QA 1H73A 2DNZA 2KI2A 5K8OA 3MECA 2ZUAA 4ES1A 3MR6A 3CD5A 1U1MA 3W63A 4LQ3A 1XTZA 3B6BA 1M90T 4OX9J 4ZVPB 4JI4J 3BN7A 3W3SA 4WE1B 2U2FA 3IG1A 5HBMA 4ZPWR 2HSEB 5F3TA 4Y0FA 2PEBA 2LDIA 3W64A 2NPIA 1DY3A 4C11A 4LVNP 3NWGA 4E8UA 3SEOA 4MKYA 2EKNA 2W4CA 4RR5A 3THTA 1WKJA 2YKAA 3EDQB 4XPCA 2CQHA 2V2ZA 3H25A 1TL3B 1EHWA 3DOMA 3EVWA 1M0SA 3IRXB 3HVWA 3I9ZA 4IH6A 1FTCA 1WUUA 5KAKA 5CD4H 2OLWA 1XMOF 1Z2ZA 4QPTA 4LIRA 3PKYA 3DM2B 5D8HB 3B54A 2HNYB 1TKZB 1U6BA 2PE8A 3PR5B 1VK8A 3G86A 2VBWA 4KR0B 2DR9A 4JI1J 2NUHA 4WU3A 4QU6A 1F3FA 1PBAA 4YB1P 2P6TA 4ED2A 2R2RA 1U1LA 3KK2B 2QL5B 2CPXA 1JLEA 1UP1A 2VB6A 2X1GA 3D0GE 4CT9A 3MUVP 2V9KA 2HAFA 3SSSA 3PO4A 4UY8T 2OEKA 1S1XB 1F9FA 3I56S 3E8OA 4OMFG 2HEKA 3M05A 3KLFA 2I38A 3L4BC 4WFAQ 3H4BA 3KLIB 2EFGA 4YR0A 2EPIA 1KKHA 2IC3A 5F8JA 2OPSB 1RSCA 3D1QA 5HK4A 2E1MC 1PC4A 2EFPA 2ZKTA 4RL1A 2DHHA 3OV7A 4IUFA 1XR6A 4M5DB 1MG7A 1IKXA 2CXEA 2DB1A 4OYZA 4DL6A 3AAWB 4LF5F 2NQPA 3M32A 3N9UC 4KV8B 1RCOB 1NSAA 4Z37A 1HWJA 3GYGA 2DEIA 2Y3YA 4Q5VA 5FDLA 4ZJQA 3RRGA 3FMBA 2VOPA 2DNLA 2M7SA 3R5BA 1EIYB 2X3DA 3C6TA 2QYCA 2VBZA 1VBXA 2HHPA 3HHLC 3MM7B 1HBUA 4I68A 3PZPA 2QE5A 4EWTA 4X4OA 2UP1A 1HLWA 1RABB 3GV8B 3QO9B 2OP5A 2BANA 1QAYA 5L39A 1RWPB 1RI7A 2F40A 5C25A 1N6QA 1HNVB 3DDKA 4Z2XA 3RBEA 1YJWS 3P6YC 4H4MB 2G2YA 2VUGA 3MPUB 5DG8A 2XHCA 3OVSA 4B3RJ 4WKRA 3KYLA 4MYTA 4OHWA 5KT6A 3C3LA 4CTAA 1U6ZA 2W2OP 2DNOA 4DJBA 2B43A 4XDCA 1GMWA 2ZITA 3T1HJ 2ZM6J 2RS8A 1KC8T 3OL6A 2L41A 2A1BA 4NLOA 1FEEA 2CPDA 2KB2A 4XDDA 6AT1B 2ZZNA 3RW6A 2FVSA 5EX0A 2FY8A 2CFXA 1OSDA 5D15A 2KXHA 3BSAA 2HFUA 1E6VB 3PDNA 1IQTA 2XLKA 2ZH1A 2ZWPA 1ZAXA 4DU8A 4GKJF 4C8KA 1ZZFA 1RB0A 2WW8A 4I67A 5KFWA 3H2LA 4ZIVA 2HHXA 1T02A 3TUPA 3MMBA 4H4OB 4KAIA 3E01A 2QV6A 4O3OA 1U1PA 5BR8F 4FF2A 4LSLA 2VOOA 4DR7F 1VQSA 4X66J 3J7YU 4J9MA 3KJFB 1SL2A 3VVTA 4I2PA 4A48A 4QU7A 4U67Q 1MROB 3CJ5A 3MI7X 3FJ2A 1ROFA 1H7WA 1HW9A 4L75A 3DLKA 1TAUA 1HQUB 3PIPQ 2LQ9A 3AA8A 4ZVHA 1Y00A 1GFWB 4ZCMA 2NXJA 3NEKA 5HMWA 2F8HA 1JKHA 1R0AA 1YBUA 4OX6A 4UOFA 5D4OA 4K4TA 2AYBA 4YB7A 2WB4A 1LW2A 2XYPB 2QG9B 2O1PA 4OYOA 1I3OB 2DY1A 3GPAA 4RWXA 1NZ8A 1UJ5A 3V6KA 4DFMA 1NB2A 4TVAB 2DR8A 1SKSA 4B3RF 2V68A 2RDIA 1U1QA 2W2MP 2NSBA 2E9ZA 3UR3C 1XMBA 5HMXA 5DDRC 1SH0A 3JAMU 4X4PA 3MM8A 2PI5A 2C3OA 4RZRA 3LWMA 1VQ9S 2ZOFA 4ECVA 1W2IA 5F0WA 4RWWA 2YNHB 1WC5A 5U47A 1O51A 1Q8KA 5GMEA 2M3DA 4CYUA 1L3SA 2RHQB 3L7UA 5F8MA 3G96A 3BQ2A 3SQOP 3NGRA 2HFOA 2B6AA 1KHVA 3NL0A 1RKIA 1U25A 2MDAA 3D68A 1N54B 1QSLA 2SXLA 1SH2A 2F8EX 3VGTA 3H42A 5F9NA 3OL7A 1LNQA 1K73T 2HNZA 4UOGA 1SC4B 5KG4A 4DBQA 2F9JA 2OPQA 4K4WA 4IOCQ 2H3EB 2C3UA 3EICA 5DJBA 3IS9A 1OJ4A 5HQ8A 3H5YA 4ECWA 3MCSA 3C19A 4F0MA 2AEJA 1Q8LA 4RW7B 3VWSA 1F3VA 3C2PA 5M2PA 4USIA 1HW8A 3B82A 3ETMA 3SSQA 2XYGB 2HQGA 1K1QA 4NA1A 1HPZB 2MPUA 5GADU 5J1EA 3DOKA 1R3NA 1RAFB 2FJVA 1JKHB 1R0AB 4CLZA 4RBTA 3B8HA 1LOUA 1YBTA 5KG3A 4ED4A 2EI5A 4YFUA 2CZVC 3GFYA 3F44A 4B3SF 3EGWB 2XLIA 3MCOA 1NJZA 1WNEA 3PACA 3T19A 2GGPB 1CQNA 4I6WA 4P2MA 5BR8J 2FDNA 3AJDA 4LBHA 3F41A 7AT1B 3RBZA 3MM8B 4U6PA 4Y34A 4X64J 1YRXA 5KG0A 1KVJA 2DNNA 4RW4A 1EARA 4BCAA 4AQYF 3WIUA 5KFBA 1C4AA 3QWUA 2WSEC 2EWHA 2M70A 1KR4A 2DNHA 4IO9Q 1VRUA 4AL7A 2WSFC 4HI2A 4OX9F 1S9FA 2CQ0A 2BEFA 3P5TL 3G4SS 3PRVA 4TY9A 1ELOA 2EC2A 4ID8A 4CO5A 2UUAF 1H74A 3CUNA 1W25A 5HVGA 3TAMA 4RUBA 5J2MA 1RE1B 1VFJA 3BGFA 3TA2A 2KT3A 2P9EA 3M1VA 4DS4A 1NCLA 2XEXA 3OJSA 4FXVA 1U2FA 4DR3J 2RE1A 1AYEA 1P27B 3GJSB 1R8BA 3LP1B 1CS4A 2HBZB 4JI6F 5L38A 1I1GA 5GAHU 4LSNA 4RW7A 1IBKJ 2AJ4A 1FFWB 1AW0A 8AT1B 3EWGA 2MHNA 1ZAWA 5LMNJ 3LAKA 2JZ5A 3WIVA 4A8XA 5IWAF 3NBPB 3K57A 5LM7E 3HFZB 4DPXA 2XGQA 2BX6A 4M63A 4FYXB 1S1VB 4J9UE 4TXSA 1HQEA 4QWEA 3W9JA 1XJWB 4I69A 1GT8A 1FTRA 2HS0A 2V67A 3LA0A 4PZVA 3TWZA 5H9EK 2XY5A 3I5BA 3MOZA 2KYZA 4ZK7M 1YDLA 2JVRA 1LXNA 1SUQB 1K47A 3KLEA 2CJXB 1XNQJ 2IM2A 1FX2A 4MIWA 2KZZA 3W5YA 2CNKB 4CI0B 2ADCA 2M2BA 2HRTA 2VL1A 2EKYA 3HULA 3D2WA 1U0HB 3OLAA 2H1YA 4WBFA 3MECB 4ZVFA 4X4RA 3T6BA 3HVRA 2FLPA 1C1CB 3D1HA 3ISND 2ZNYA 2VJUA 3LPEA 1ZTWA 3PYDA 1KD1T 5A6WA 4KFBA 1IUJA 1RWMB 4NLYA 4FN5A 2JX2A 3NCQA 5K9FA 5F8GA 2KJVA 2C22A 3IGVA 1UMJA 2F65A 4O0NA 4NYZA 3SCLE 3UN3A 4V19J 4GKJJ 4ZVUB 1HNZJ 3CJ8A 2ZH2A 1FVSA 3IM8A 4KHRA 4DV2J 4IRDA 1RADB 5HJYA 3MAAA 5DLFA 1HNIA 3KWMA 1Y9OA 4LSNB 4P74A 3CC7S 3NNCA 2ZC3A 4J91A 4RBUA 4M95A 4OX7A 3T1HF 5LOQA 1A6LA 4OJGA 3KK2A 5LL6d 3D5MA 2D3OR 2KJWA 1HR0F 1IBLJ 1FI4A 3MZIA 5T7LB 2WTFA 1VQ7S 4JI2J 3TANA 2ZHAA 4ZOSA 1PO6A 4X4VA 3ZTOA 3CPWR 3U02A 4FBTA 1HHTP 2WVFA 1RHKB 3ENQA 3KK1A 3CCRS 1IBKF 4X65J 1RDRA 4JI6J 4L76A 2CADA 4RU9A 1HR0J 2ROPA 2X1BA 2XMJA 5DGBA 2CPEA 4C8MA 1KN6A 1KSPA 3CD0A 4NASA 5IS2A 4RW8B 2C42A 1FDDA 1RT5B 4B9LA 4D3HA 4NEZA 3UD3P 4F4WA 3DYAB 2UUAJ 2ZBCA 1F6TA 1RT6A 3S6EA 2QX0A 3OXLA 1C1CA 2NCKL 4NLPA 4DSIA 2FTRA 1V6HA 3LGNA 2X7IA 3V2UC 4K4XA 2UV8A 2MTLA 1KLNA 3QGPA 4LF7J 1CJTA 2DRDA 3HVAA 4DV4F 1IBMJ 1QSYA 1JLAB 2BA9A 1URNA 2GHPA 2YWWA 3EDRB 3QT8A 4ZVTB 1KQKA 2E1RA 4JI8J 1X0FA 5C25B 1N6QB 3J81U 3BH7B 3EGVA 2C3PA 3BH6B 3CDWA 2VPXB 3H8YA 3GG0A 3UI3A 1QE1A 1N88A 4N76A 1OWXA 1PYOB 1NH8A 4DV7J 2DCUB 4QR0A 4LF4F 3QJJA 3FCHA 3IFEA 1RAOA 2YQ1A 1P8GA 3MM6B 3MMCB 2RF2B 3C14A 4LJMA 2BUNA 3HPOA 1D1UA 2Q6CA 3FKBA 4YMEA 4F04B 2BE7D 1O0PA 3CJQA 3SQGB 2XMAA 1Q81T 2MSTA 1HWLA 1VMBA 2MZSA 3CCMS 4NXMF 3H0PA 3H5XA 1DLOB 2M8HA 3RG6A 2AX1A 4C0BA 3BM7A 1LFPA 4HYKA 4F02A 4DSLA 3EMTA 3MCMA 3ZTQA 4N5SA 4C9DA 1D9AA 4HEA9 4KH0B 1V3RA 2RB7A 4RO0A 1BQNA 5D4NA 4OI4A 1T95A 3NCPA 3NGSA 3JS9A 4ELTA 3D6MB 4USMA 3CVKA 1T03A 3N6LA 4PABA 4YR2A 1F5BA 3R27A 3D7SB 1Q5YA 1CC8A 2B3TB 3I6PA 1TVRB 1NPPA 3MPYA 4ZPDA 2X1AA 4HKQA 4HACB 1C1BB 5SUHA 1N48A 3MFIA 2XI2A 4ALZA 2BRKA 4OQJA 3DLKB 3WHIA 4EUVA 2L48A 3DN9A 4O3QA 4ECRA 3PW0A 1PILA 2N7CA 1RT4B 1CQMA 1RU2A 2BW7A 4W98A 4U7UD 1CJKA 1N0VC 2XGPA 2RQMA 4IDKA 2EK1A 5DETA 3MR2A 2GCFA 2MQNA 5EUHA 4OV6A 1FX4A 4HLBA 1B0PA 1WORA 1SJ3P 2ZKUA 1F1BB 2WOMA 2LXUA 2POKA 3BGOP 3I31A 2ALYB 4ZKAA 3CULA 1FJGF 5FDLB 3WDOA 3PYEA 3GIJA 3CCWA 3GSDA 3IAM9 2HG4A 1U7LA 3BYRA 4F8RA 5J2PA 5I3UA 3MM6A 4I0WA 5D0GA 1CEZA 2CZ9A 1SVDA 1ZS6A 2GVDB 2NXCA 5A8RA 2KM8B 3CMAS 1TKDA 3DLLQ 2OD6A 4KHPJ 1XMQJ 2PGCA 3BGLA 4K7QA 1MLAA 1ZPWX 5L46A 2UVUA 3TRGA 5K8MA 1UVKA 3O8WA 1KTVA 1HNVA 4Y2AA 3O1LA 2ASLA 3TA0A 5A2QY 1ITPA 2EG2A 3KLHA 1HBMB 1S7IA 1S1WA 2KKHA 1TR0A 1FDNA 2MHEA 3G87A 4P71A 5G0RB 1KQFB 3UFCX 4EGLA 4ERDA 1N4LA 1YLXA 4JUZA 1SKUB 1DQ9A 3R5CA 3ET6A 4DEZA 2BXJA 1UETA 2R3VA 2Z0GA 3GIRA 4TLRA 4F0HA 2W8LA 2ADBA 2ACYA 1M5PC 1OPZA 3H40A 4X66F 1REGX 1RTIA 2MKHA 4OHXA 4Q45A 4DQQA 1IKVB 2J5AA 2R7OA 4USTA 4DU7A 2KVIA 3IS9B 2LCWA 5G4DA 4B08A 4ECZA 4C8YA 2IM0A 2CZ4A 5K5MA 1C1BA 2B4UA 2NR0A 2HFVA 1CJVB 2CA9A 2QMUB 3LP2A 2ATCB 2AHOB 2ZD1B 5MLCV 3J80Y 4ED8A 3DRRA 5H9FJ 2F4FA 2FC9A 4R5PB 1XEZA 4WFBQ 3TX0A 2YKPA 1FNXH 1RAHB 3OSPA 2MQOA 3GIMA 2VA3A 4NRUA 4I6YA 1QTNB 3OFEA 2LP4A 1IR1A 2AJFE 2BW2A 2WOMB 3D3BJ 5E33A 4Y6IA 2LU2A 5ETVA 2L08A 3PHEA 2ZHBA 4HDHA 4EI2A 1X9MA 4Y28C 3ILOA 5KFTA 5HN0A 2COLA 2DRBA 1OYEA 1FRMA 1N5TA 4AXIA 5J2PB 5I3UB 4ZVRB 2I9SA 5K20B 5LXRA 1UPMB 1HMVA 4OI6A 2HMIB 4MFBA 5FLXY 2B4OA 3LGMA 2BV3A 1NHUA 3IA0A 2IHR1 4OHVA 3C15A 2C2DA 2DT9A 2YKNB 1S4FA 1SQFA 2QT7A 1Y7PA 2Y1RI 2FJEB 2PA3A 1JQGA 4HT5A 1U1OA 4B9UA 3W66A 2LQ8A 1J27A 3ZZZA 2N4DA 4WFZA 2BYCA 4CLPA 4ZCLA 3CJ0A 5J2MB 2FQQB 2HBYB 2LVWA 4HHUA 3JAMY 5GAEU 2FJBB 2DJWA 4USVA 4DUYF 1RTIB 2YNHA 2E5JA 1YRTA 4N56A 3OTCA 2Z2YB 3IP0A 4AE5A 4J9NA 4DQRA 3PW2A 1SQEA 1L3VA 1RT3A 2GC8A 2MKYA 3WQPA 1KS2A 1FD2A 2IRYA 1MNEA 2QJ3A 4YQWA 1RHJB 2UVRA 2HPUA 1HL6A 5FIIA 4YHHF 2V8GA 1AFIA 2RU3A 1MWQA 1K0TA 4JI5F 3OSNA 4ECQA 1I94J 1NNDA 3OLBA 1A9NB 3MGJA 1RHQB 1X5SA 2GMLA 4NXMJ 1Y3JA 1ZAVA 3PY8A 5KT4A 2FJDB 2JC0A 2CQ3A 4LF2A 3CXCR 1NKCA 3VGUA 4J9QA 3QAUA 3OBIA 4URQU 3UPFA 2DXDA 1UW4A 4PG7A 3HM9A 2GHWA 1HPZA 2DYAA 4TLQA 4U8YA 1U0HA 5DZ6A 4ENOA 3OVBA 3OR1A 1X5TA 2R7UA 1Q4RA 2ZWOA 1OSCA 2NUUG 1UAWA 2CQIA 2UZAA 3AFGA 4MK8A 3E2EA 1TUWA 4NLVA 4OZ5A 1RAJA 3N0VA 1S9GB 4QJVA 3R5JB 2DGUA 1TTHB 4OLOA 4F50A 4TU9A 4JV5F 2XC9A 4WIIA 3G82A 2DGOA 3JQJA 2KU7A 3WX8A 1S9EA 1B99A 3ITHA 3EXYA 2WZ1A 2KT2A 5BYRA 3T1YF 3M2VA 2J7WA 4B3TJ 5CZXA 4ETZA 2RD5C 3BB5A 3TOQA 4K5SA 2QGFB 4F67A 1YG0A 2DCLA 3TZYA 2JJ4D 3PO5A 1HNIB 2IMOA 3MTJA 4WE1A 1TL4A 2XWXA 2YWHA 4CM0A 2AQ4A 4DL7A 4C48A 3KK3A 2MJUA 3BJYA 2IA6A 3CO0P 2ABYA 4QYZK 2JH3A 3D0IE 2D9PA 4UUWA 4CIOA 4C8NA 3T6JA 1UCNA 5F41A 4CO1A 1QVFR 4FXDA 5IFMA 1BQMA 2EEYA 3V4IB 4HT7A 3TX8A 2GMHA 3WC2A 3BSNA 5EN1A 1V9OA 4I7FB 2D74B 3DLEB 2PT0A 3QATA 4FKYA 2XG8A 5HP1A 4M5IA 2YNIA 3N79A 3ZO7A 4YY3F 1FFGB 2D7SA 2QLJB 1P1TA 3DRPA 2EG1A 2VPYB 1FT8A 1AB8A 2HYIB 2DNRA 5CAAA 2MKSA 2Q1LA 2XMVA 5CZVA 1FKPB 2L9NA 5ADZA 2J6TA 4GC6A 4A8FA 1JNRB 4K4SA 1MSWD 1H98A 3D6HB 4ZN1A 3KUHA 2CPJA 3GCXP 4BBYA 3OHAA 4EBEA 4F0KA 2OPRA 3KJNB 4A47A 1NBEB 3AD8C 2MZ1A 4LRAA 4X4SA 1TV6A 1ZH5A 2WRMA 2DIVA 2Y1JA 4ZVSB 3A13A 1ZETA 1L3UA 1DBDA 2HVZA 2CKWA 2AF6A 2PMHA 2B5JA 2YBVA 3I32A 3OHBA 1N8RT 4E0DA 4G3IA 4KV8A 3GP9A 2Z57B 3OTOF 2BMBA 4GO5X 5KG1A 2JWNA 2OMOA 1GX5A 3W2VB 3OT9A 1NSPA 4KIAA 8RUCA 3BDEA 1WTBA 3M2RB 2BRLA 4ANEA 2MQQA 3LWLA 2VG5A 3KJVB 4HHHA 5AT1B 1R6VA 3R6GB 5C24B 4DV1J 3M6VA 3U1LA 2DRAA 1XNQF 3BN4A 4CDIA 1DQ8A 1HFEL 2OPPA 1AZSB 1M5OC 2HVIA 3HHDA 3J80U 5KFFA 3IBFB 1TQLA 3TAQA 2NXUA 3R7NB 4OFZA 4DFPA 3I82A 4GMKA 1X8DA 4HL9A 4EO6A 5A8KB 5EWEA 2VICA 1ZZNA 3K2YA 4X2BA 3IG1B 1X7VA 1JXVA 2HLTA 3CNQP 3MHYA 4UZCA 1RKJA 1FJGJ 4NLDA 5E3CA 3MXHP 3M8PA 3FBFA 5LMUJ 3FUYA 3M2UB 5D0RA 1CVJA 3ZTSA 1S6PA 3DMJB 3JTNA 3QGIA 5AXLA 4WZQA 1UFLA 2C1EB 1PAEX 2RS2A 1FK9B 2JEIA 1EQ0A 1U26A 4DR3F 3FK4A 4LF1A 3W5ZA 5KFHA 1NK6A 2MZRA 1WHXA 2C2KB 2MJNA 3B78A 4R8UA 3KOAA 4PQUB 4FF3A 4KHMA 2R2TA 1W26A 1WHWA 2B8QA 1KVKA 2JFDA 3MMBB 4ATNA 2VJVA 3NNAA 4OYXA 5EWGA 1PJ7A 2OTLS 2Q6BA 1H3DA 1GMVA 2FHJD 1CJUB 2XZWA 4NA3A 4ZA1A 3BKUA 4FNHA 4USKA 7FDRA 2BE2B 3HI9A 5IXUA 1X4DA 3W8PA 4ZN3A 4WTOB 5FJ4A 3AQOA 2P2CB 4K50A 2ZE2B 3ZZTA 1MMNA 1NM2A 3KLFB 1YJUA 2AJ0A 5KT5A 2J6UA 2W24A 4IOAQ 3DLGA 4ZPAA 1HI1A 3SCIE 2V4JA 1HBOA 2GVZA 2WBRA 4TYAA 4WTYA 2GVDA 3QLHB 4PUOB 3AY0A 4O23A 4M5DA 4DHVA 1JLCA 1LWEA 1KFDA 3W9HA 4OYIA 1XNRJ 1ZBTA 3UN2A 4B9SA 2UUCF 2F3JA 2JLGA 5CYQA 1WG5A 4OHYA 5CQGA 3MAQA 5E3RA 1VQ4S 3SXLA 1HD1A 3DM2A 1T9TA 4K4UA 5DM7Q 2C2MB 3MMAB 4K4ZA 2QMWA 3MMCA 2AJ2A 4MIBA 4QIGA 3TQEA 1HBUB 4LF8F 1RAGB 1YTYA 3QWPA 3M6WA 4U9RA 3NGKA 5L9NA 1G2EA 4ZPCA 2D69A 1RA7A 4ZVEA 4JI7J 3SQGA 4YY3J 2W4PA 2GIQA 3V5RA 1EZZB 2CQ2A 2DXFA 2E5IA 5HANA 5EGYA 5LSRA 1FRXA 2PA8D 2DGXA 3VQSA 3PJ9A 4YDDB 2W7PA 3D28A 1VLYA 3ZC4A 4LMZA 2IC3B 2UV8G 3UCZP 1S49A 2PMZD 4PWDA 1JNZB 2HIYA 2HHUA 3AHPA 3HJFA 3NG8A 4O3PA 4F4KA 2GS8A 2B56A 3N4WA 1SH3A 5IM0B 2DHAA 2P5VA 5KFAA 4M5MA 1RAIB 3G6ES 3T1YJ 2FHMA 4B3TF 2W9CB 3MEGB 2QA1A 1VOMA 2CNNB 4G1PA 3BGRA 1BUXA 1BMQB 4DCJB 3FC9A 1RT4A 4H4OA 3KKFA 1H38A 1NH7A 2CQDA 2JSXA 4MFBB 5J1EB 3QO9A 2E5GA 1LWEB 4DL5A 2ZZMA 4V19X 3NMAA 2NXEA 4C3KA 3ETOA 2Z56B 1F2GA 2G0JA 1DURA 2PEHA 3EE3A 3E3XA 5DO2A 2HQ3A 3KNGA 4WP9A 2BBEA 1R8PA 1K1SA 1WSVA 2EBGA 3IN5A 3BQ1A 2D1CA 4F4ZA 2BZ2A 1NJIT 3QYYA 4FYYB 4DV1F 1K8AT 1JB0C 3GYNA 2HQIA 3CT9A 3M6XA 2YTCA 3BREA 3IR6B 4DV2F 1DAXA 4TYBA 5KFKA 2KFYA 1RQ0A 5HMYA 3DDNA 3G8SA 3PW7A 1G7CB 2HK3A 1KTQA 1LW2B 1XR7A 2RILA 5GAHI 4A8QA 5KFGA 2A2CA 4O44B 5D3GB 5A8WB 4ECYA 1L5UA 5ETRA 2HW3A 1YJVA 2B4VA 2DNMA 1JK9B 1S7HA 4Q8EA 4ED6A 1C0TA 3KHHA 4FNIA 2DH8A 2Z58B 2BJ7A 4PYDA 3TQ1A 3OFGA 4BLGA 1YIJS 2NREA 2PIIA 3R7SB 3CJ2A 3IRWP 3I55S 5HLFA 1VISA 3TEGA 2VQFF 2R9LA 4O0IA 1N36F 1QSSA 3DFEA 4KY3A 3T5HA 1S0NA 3KG1A 4ILLA 2XB2D 4WPAA 2BOAA 1NB7A 5KFXA 2NZ4A 1GXLA 4F2RA 2UXBJ 1Q79A 2V50A 4IG3B 4Z7YA 4L73A 4X4TA 2J8SA 1UFKA 4LF9F 2OHDA 2IVMA 1PSDA 2RQ4A 4RNNA 4X4NA 2QO3A 3VF0B 1YQHA 4DF4A 1OY9A 1FKOB 1T9WA 1D8ZA 5F0UA 2CG8A 1S0VA 3RAQA 2M4MA 2IVFB 4UTGA 1JIHA 3TA1A 3OFHA 3QT6A 4AXJA 3WBZA 5B0GA 4OHZA 5CD4A 1GXUA 5IT0A 1HYSA 2XMKA 3JQMA 3PKMA 3PW4A 1GMWD 3CCZA 4AT1B 2GV1A 1RT7B 1NXIA 4PWWA 1SIWB 1SQGA 3R5DA 4N7TA 1JXLA 3MM9B 2N3LA 3JSMB 4XIUA 2RJZA 5JUMA 4LFAF 4CCHA 1TK8A 2HNDA 4DOZA 3OW2R 1JJHA 1M1HA 2CPFA 3LPYA 1YKWA 3AJ2A 4NMXA 5IOLA 3M30B 4DPUA 2UXBF 2IDLA 1JLFB 3Q83A 3PFEA 4GKKF 5AXMA 4B9TA 1M5KC 3LO3A 4LIWA 2YKNA 3OUYB 2E7WA 2W4DA 1KLMA 2HVEA 2LQJA 2NPFA 1NRKA 4OI0A 1LWCA 2Z2MA 4MIAA 2OTJS 1PYSB 4PYAA 1YITS 1WJ9A 4KH1B 3U7JA 3FQLA 4A8YA 3BKFA 2ZJPQ 1R27B 3KG0A 1R0CB 2F5GA 3JYTA 1RWXB 4RW4B 3V4IA 1BWVA 4B17A 1UVMA 2HHWA 2MZJA 4XPEA 1A0OB 2K7JA 3K8VA 3TYTA 4AL6A 2YNFA 3R97A 1RJJA 3M8RA 2YKQA 1LWFA 4TU7A 1RT3B 1T11A 2YNIB 4LR7A 5KOWA 4A8SA 5EX3A 4R0EA 3IWXA 2V4QA 1WG4A 3K59A 4CZCA 4KO0A 4DDFA 4WXWA 3HVTA 1B0TA 3QSYB 4WZMA 4UOCA 3LP0A 2PMWA 4DX6A 4ILRA 5I42B 1SXLA 5I3QA 5EHHA 2R4FA 2QSWA 4KRWA 3SIPB 2DR6A 2M9KA 1AT1B 1GQEA 3H2UB 4EMDA 2DPIA 1A7GE 3DRSA 5HQLA 1T0TV 4FS1A 3KK1B 2J0WA 1LEOA 1WC4A 1RT7A 3GCWP 3BZQA 1P9YA 1JLBA 2M5YA 4G1QB 2MLZA 4XK8C 1TV6B 1QVGR 1VGYA 2AZ1A 2RH3A 5J2NA 3W1YC 1DQAA 1FXDA 4DUTA 5IZHA 4P10A 4RW8A 2EW9A 3L95X 3OXFA 5KFRA 4I2QB 1FRLA 1FXLA 4C98A 1S1VA 3CEDA 3R5GA 2K1RB 1T05B 2CPHA 3QT5A 3ZNJ1 1PG5B 3OUYA 1Y0HA 1KWMA 3GJRB 5C42B 3R3TA 2HIQA 2VG5B 1S6QA 3KJVA 4PG5A 4Y2KA 1VQLS 3Q2TC 1CJTB 1AFJA 2YNGB 1U2CA 3US5A 4JB8B 5IT9U 1HNXF 4ZMMA 4CM2A 2V8DA 4L72B 1JX4A 3TZXA 1VBZA 4DCPB 1TL3A 2CRLA 3EXCX 3G8TA 3D0HE 1FESA 3RU0A 4NLUA 2R2UA 4QPXA 3BO4A 2IVYA 3DDIA 1TAQA 1S5ZA 2OSQA 3QBCA 1RBOB 1T9UA 4L3KA 1YZ6A 4NI2A 4ZPBA 5HATA 4CWBA 2FHJA 4JI2F 3H5UA 4ZIWA 1WKKA 2J0XA 2IYGA 3IR7B 2R7RA 5E5NA 4JP8A 4DQPA 4P2FA 1RAEB 2Z8QA 1Q7YT 4CRJA 4Q2LA 5CYMB 3DI6B 2LEPA 3GTYX 1JLEB 4QR1A 1SL1A 1SJRA 4MKAA 2EFOA 4NYPA 4JI0F 2RU9A 2AKWB 5A76A 3OR2A 2VZ9A 4R8UB 3CDEA 4I1TA 3T9NA 2QFIA 4AYBD 4C3MA 2LXFA 3A8EA 3NAHA 1DZ5A 5AE1A 1I94F 4QCLA 5RUBA 1TK0A 4PPDA 2ZBRA 3HSDA 3V81A 2MKJA 3EUNA 3ZNUA 2HRYA 1FJEB 3MWBA 3G6XA 1BQXA 3CIZA 1M5VC 3TW0A 4H4KC 2CJYB 3D1OA 2CPIA 3RRHA 2DNQA 3QLHA 4PUOA 5DZ7A 3M8YA 1IJEB 2VG7A 2YKMA 4QQBA 1Q8BA 3KHLA 2FLNA 2Y8WA 6FD1A 2MQPA 3PM9A 5CXTA 4EZ9A 1S77D 2MQMA 3AJ1A 4NLQA 3WC0A 5DLGA 1ACMB 1AROP 3PJXA 4TY8A 4PXEA 4NI2B 2HS3A 4U7UK 1F2HA 2GQ2A 4CLTA 3J7A1 3X1LB 1PC5A 2UVVA 3HKWA 5L1IA 2CQ1A 2DY9A 2OD4A 4WIQA 1TL5A 2H9ZA 3R7BB 4U8VA 1HKAA 2YQ3A 5J2QB 3A4TA 1QJHA 4CLWA 4IFYB 2HHHJ 1F5AA 1FA0A 2O01C 4DCOB 1VQPS 3HO1A 3HCXA 3R2CJ 5T7LA 3DOMB 5DQHA 4M94A 4DR1F 4ICLB 1B7YB 4WFYA 2X1FA 4OZ2A 1N32J 3GQCA 5HMZA 2XLJA 3TI0A 3CCJS 3JTPA 4ZDNA 5LXYA 4H54A 3PYGA 2B9XA 4PPZA 3HT3A 2J0SD 4C6AA 1I6JA 2R7SA 4UF4A 1C0UA 4NLGA 3LF0A 3MOJB 3AOAA 3DXBA 1S6OA 1XBWA 2E7VA 4DV0J 2XTJP 4J9RA 2M0GB 2KFNA 3CTRA 3R9LA 1DJ0A 4DFKA 1N33J 1XQIA 2JRSA 4KGMA 4KC5A 4U95A 3J7Z5 2ZH8A 4DR7J 1DLOA 2FGOA 4JOUA 1RT6B 1K44A 1NO8A 2FJAB 2BQRA 1YWXA 4I64A 5DRKA 3UVJB 2KZMA 1BQNB 3LQVA 1U45A 4OZNA 3QGHA 1XIQA 2LQBA 3FBEA 1NJWA 1CJUA 2XSJA 1Q82T 3L9ZA 4RW6A 1RU1A 2HHTA 4FVCA 3GILA 2XS7A 2DNGA 3Q2SC 2BJ3A 5B0AA 3QRPA 2CG4A 4LQ9A 3I0SB 3IBCB 2MQ8A 2XZDB 1SJ1A 2WAQD 4M5HA 1F0XA 4QZVB 4O3RA 2G0CA 3PJWA 3C14B 4OZ1A 1RT1B 5J2QA 3FQKA 3LH2S 4DUZJ 3PX0A 4ANCA 5KFMA 1Q78A 1JLCB 2E1PA 1IN0A 5KG6A 2ZH5A 5JXSA 3DOLB 3S8SA 1HA1A 4K8RA 3U1MA 3HHEA 4JI8F 3UR0A 2K2PA 2P9CA 2ZH6A 2E9RX 1MMLA 2UXDJ 4DI6A 1RWOB 5HQMA 4U7CA 2UUBF 1EETA 2B6AB 3P4UB 1P1LA 1CSJA 1GXTA 4GVBA 3POTB 1D3WA 2IJFA 3UWTA 3W2WB 4USUA 2QC3A 4WFXA 3G8QA 4B02A 2F1FA 4USHA 1F5CA 2KHDA 2LMIA 3TUJC 1HNWF 1VK3A 3N6MA 2A3JA 3NS5A 4O4GB 1PJ6A 2KN4A 4IG3A 2QL9B 2EC0A 3V6DB 3JXOA 2XMWA 3KLGA 1AUSL 4TU8A 3QJPA 1TMJA 4O3SA 4C7QA 2RVJA 4LF6F 3SFGA 2BQUA 1CBKA 3AH6A 3UN5A 4CLFA 3TUZC 3SMZA 5A0YA 4N8NA 1X4CA 2AIRB 3UDLA 5CA5A 3UDEA 3ZZPA 3ZZYA 3BO3A 3FDSA 4JV5J 1URRA 1R7IA 1FRIA 3OTBA 2W9BB 2RNEA 1IKVA 4ANDA 3MEDA 3DC2A 3MM5A 4PR6A 3CCQS 2XO7A 2E5LJ 1UVNA 1S76D 4LF8J 2VODA 1FJCA 2A0FB 3MURP 2AP6A 4QYRA 4ZJOA 2H4YB 1TKXB 2CVIA 2VKZG 4TQSA 1KVIA 4F2SA 4J90A 3F56A 3RAMA 1WKLA 3FEYB 2ZD1A 4NZ0A 1VI7A 3IMQJ 2JLEA 2HVDA 2NYIA 5A8RB 2ILYA 1RT1A 2KG1A 4J9SA 4DUZF 2DXEA 1T7PA 4KGVB 1JLQB 2F7VA 4MTPA 2KH9A 2ASYA 5HAOA 1RISA 1VC5A 3K89A 1FDAA 3MCNA 2HWTA 3GZ7A 5F8LA 2HBQB 3LTOA 4P72A 4Q43A 1NK9A 1DFDA 5K14B 1VRUB 2ZFHA 2I5JA 1N5YB 1UA1A 1NKBA 2JNJA 3KLVA 1FWLA 4UUXA 3KTQA 4DPOA 3G2XA 3M4XA 4YHHJ 1S99A 4DSKA 3U1NA 2N7YA 1PGZA 1RTDA 4DL4A 5GAEI 4C8LA 5KT3A 4PXCA 1SCJB 1TL7B 2OGUA 1WF2A 2QIFA 3ICLA 4NX9A 4USWA 1VC0A 3TP2A 1BC6A 1NDCA 1GTHA 3KLGB 1X4HA 4UQTA 3RW7A 4WJBA 2WVEA 4KPCA 5F8IA 2K3IA 4OI2A 3LUYA 1JMTA 5AJ3J 1S1UA 3FGVA 1JXEA 3HHNB 2OEMA 5IV4A 3PFOA 5ETTA 4A8KA 2BE9B 4GKKJ 1FRHA 5HROA 2AYEA 2CDQA 3CJSA 3NOCA 5FD1A 3L7OA 1EP4A 4NCBA 1UL3A 2ZNZA 1RLCL 4B9NA 3P49B 1IXKA 4DPYA 2XY6A 1VCTA 4LVOP 4I7FA 1SL0A 2VG6B 2QL7B 3PXGa 2OIHA 2AEMA 1CPZA 1TKXA 3HSJA 1LWXA 3UNYA 3EPIA 3IXQA 1R89A 3BQ0A 3P8BB 3RJMB 2CQBA 2QFJA 1KRPA 1FFSB 4C97A 3FCVA 1SV5A 2DK2A 2ZH3A 4DSEA 3DRPB 4CO4A 1U1NA 2WCXA 4IQMA 2XBPA 2E1AA 5CCLA 3MAHA 4FDFA 4QIVA 5KTQA 5KG7A 5KFCA 4Q0BB 2HURA 1EJ7L 3FRZA 2Z30B 3C15B 3FSXA 4TN2A 2V4RA 3S01A 2WONB 4B3MJ 2CPYA 2HBRB 2FC8A 1VRQC 1RHRB 1S6QB 2D3O1 2FJWA 1TL1A 1GX6A 1Y3KA 2DBBA 2BKPA 3ZFVA 2GGPA 2MKKA 1HNZF 5MAOA 3OTOJ 3RZAA 1AXQA 2QEXS 3ADAC 2QMXA 3QGGA 1REVB 3QSIA 2ZH4A 2Y8YA 1BGXT 2PD1A 3BSCA 4QIFA 4OYWA 4M5LA 4NCAA 1U4BA 4F3QA 1U1KA 4NCGB 1TKTB 2ZVIA 1RTJB 2UU9F 1JLFA 1WDDA 1N36J 4ZVGA 4WU2A 3CCVS 4RKUC 1YBAA 4KT0C 4ZP6A 3ZZOA 3CD6S 5HBMB 3TJ9A 1APSA 2J9EA 4C3LA 4J7CA 2YWFA 5EDWA 2HLUA 3PIOQ 2CQ4A 5CYMA 1H2VZ 1FD8A 1SC1B 2LYVA 2XWYA 3CD7A 1S9EB 5H1SV 4DV3F 2AGQA 1S57A 4MYUA 5HROB 3BBFA 4RNMA 1AZSA 3TO8A 1SC6A 1EP4B 3JYTB 4F4YA 4KE5A 3M1VB 4ED3A 2DGQA 2RT3A 1LK7A 3Q0AA 3RAXA 2XCAA 9RUBA 2VONA 2VG6A 1UFWA 2LDYA 4IR1A 2KFZA 3SZ2A 1CS4B 4P6QA 4NZ6A 4KHPF 2IYIA 4U96A 2Y9HA 4RNOA 2VF3A 2NLWA 3C66A 3VAKA 3ULHA 2KO1A 3Q8QB 4YN3B 1U02A 3NGDA 1S79A 4QOTA 4ZJLA 4MH8A 5I42A 1BQMB 2P6SA 1LW0B 3CMQA 1X60A 5ETMA 3CJKB 1S1XA 1MN7A 5DS7A 1FK9A 3OR1B 3S1TA 1UWAA 5C2GA 2BABA 3LGHA 1VQOS 4JI4F 2MGZB 4RW9A 1PJ5A 1DTQA 3EVOA 3SSRA 2YH0A 3K5MA 5JJBA 3RB6A 3PW5A 3ISNC 1NPKA 1CULA 3H59A 5IC6B 2OH2A 4YS2A 1RHMB 3GONA 1TL1B 3G82B 1SUQA 3MR7A 1MU2B 2CQPA 2DR5A 2AGPA 4GRSA 2YKMB 2C2RA 1VHFA 2XHWA 3I96A 3J81Y 1T3OA 3JSYA 2NS1B 1P6TA 2AX0A 2RRBA 3EYZA 3BS9A 5DG7A 3R1LA 2B7BB 2HQDA 3DLGB 4RBVA 4DV6F 3C6TB 3V4MA 4D3GA 2Y1IA 4JI3F 3CSKA 3JSRA 3M8QA 3BF4A 3O44A 4IO1A 3MMJA 3T41A 2V2KA 1UWBB 1HWKA 3O6QA 5AXKA 4A8WA 4ED1A 2GX8A 1IR0A 1VBKA 1X5OA 2YQ0A 4DSFA 4DS5A 4QW8A 1YHQS 1R8AA 1F9HA 2A18A 2JFKA 5HP1B 3MMAA 2CWKA 2YPZA 4Y2MA 5L1JA 1X5PA 1X4EA 5GVQA 1VIOA 3QNWB 5ETSA 4DV3J 1TP7A 4DR6F 3FVYA 2ZC4A 4OZJA 1RT2A 3TUIC 2AGOA 1TMMA 1G3OA 2VC0A 3PX6A 1TVRA 3IAS9 4JV1A 2HFSA 2W9AA 5F8NA 2MGZA 3QIPA 3CJ3A 3IC1A 2DVIA 4Q8FA 2ZOGA 3T1AA 2VC1A 3GB0A 5ETLA 3UVJA 2DGWA 9ATCB 2QA4S 2B0GA 2LA4A 3E51A 3VAJA 3UCUP 4LF7F 4PWDB 2HWIA 2QLWA 5F3ZA 4JI3J 4DPWA 1RGVA 4P73A 3HT0A 1WOOA 1R43A 3W8GA 3NLCA 4ZLJA 1S0OA 1S6PB 3DMJA 1Q7LB 3ZZUA 4ZLLA 4I2PB 4FZVA 4DR2J 1UW9A 2ZVSA 4LBIA 4JYAJ 2W2NP 3SI8A 2ZM6F 4OYAA 4C2MA 3MEGA 5K8PA 3QIDA 4URGA 3MR5A 1X4BA 4OI1A 4K59A 1QDUB 1Z4UA 5DM6Q 4QW9A 1U8WA 5GAGI 3J7YI 2R8JA 1F60B 6FDRA 2OPPB 1IM4A 4PWUA 1HI8A 4DX5A 3Q22A 3IO1A 1D9FA 3NS6A 4O3NA 3Q8SB 5E2QA 3IR5B 2DO0A 1WC1A 2E7XA 1LV5A 1QUPA 2VHGA 2ZE2A 2EXUA 1V5VA 2VASA 4M5KA 2XSFA 5KFVA 3TZZA 1IBLF 3CCLS 5A8KA 1N0UA 3NNHA 4RPFA 2DEJA 4DZ6A 2WB1D 2HK2A 1Y10A 1DHMA 2V4JB 3KJQB 3W2WA 3CMES 1VQ8S 3K5LA 3UD5A 2E66A 4MK9A 3M8PB 2L3MA 4ED7A 2EK6A 2QTWA 3SBMA 2XS2A 4KTQA 4LRFA 4O4GA 3CDBA 1J5OB 3GR0A 4Q2MA 3GSIA 2OKQA 3HD2A 1S1TA 4FYWB 2HHQA 1RTHA 2RIJA 1SJQA 1XR5A 4NOHA 2GAHC 1RXOB 3ENVA 5J1NA 4N41A 1HD0A 2Z2LA 1DTTA 3AODA 2KM8C 2YX1A 1JJ4A 3N5BA 3TR5A 2BJEA 2FUG9 3RTVA 4XO0A 2RAQA 2IDEA 1S97A 3MEDB 3MM5B 1N56A 4ID5B 4CO3A 4ER8A 3MEEB 2MSSA 4JV2A 5HJXA 1FEHA 1OMSA 1NK4A 1BD6A 1O6XA 1VQNS 2BJ1A 2OMLA 1KP6A 2CDRB 2UUWA 2X51A 2YVSA 2YWKA 5HSPA 2DHXA 2CQGA 5KFUA 4X62F 5LJ3Y 5DG9A 3G6VA 2CPZA 3TAPA 2CAJA 1Q0NA 2VFSA 1H2TZ 2G0IA 3K7RA 3P5BP 3Q8VA 4IOBA 3CC4S 4B3MF 2D3UA 2AWZA 2H54B 1FNMA 3VR1A 5IM0A 2CIMA 5CCMA 5KFNA 2EVZA 4L6V3 2I5JB 3RGIA 4LFBF 5IWAJ 3SDEB 3DU5A 2KRBA 3B4DA 1NDPA 4P7TA 3L3CA 3RRKA 2HQCA 3CCUS 1N32F 1K0VA 1NSKL 4NYOA 3SFUA 4PRFA 1QAJA 1IWAA 5JMNA 2HNDB 2DITA 1MWYA 2O67A 1VR6A 4DF8A 2DO4A 2V0NA 4PG8A 2DGSA 5KT7A 4P2SA 4DR5J 2J6SA 3LANA 1KHWA 3D3CJ 3Q8YA 1XK8A 1XC9A 3OJUA 2FHKA 3HZGA 5B0DA 3GIKA 3OTEA 3KLHB 1HBMA 3FZBA 1EETB 4CT8A 5ETNA 2R7VA 3GV7B 2CQCA 3AOCA 3HSZA 1RWUA 1WEXA 4DR2F 2FZCB 4FS2A 2LFVA 5AJ3F 2OUGA 3Q8PB 1U09A 2V2VA 3IGNA 2KRRA 4DZDA 1NKEA 1X0PA 4YOEA 2G2ZA 4KSEB 1S59A 3R2DJ 4ID5A 2V9WA 1TU0B 3MEEA 3V6DA 5E7OB 1JJCB 2Z2ZA 4X64F 4J9KA 4W92B 1J5EJ 3VAIA 2RRNA 4H4KA 2W9CA 1FE0A 3KDOA 3BGRB 3THPA 2V34A 1KFSA 3CJRA 1S0MA 4LBPA 3AA9A 2LA6A 2FVPA 1NMEB 1RZMA 2QN6B 2IPOB 4LRDA 1TK5A 4DR6J 3CJTA 2H5IB 1U47A 2HAIA 1Y5NB 4IR9A 1HIYA 5F8HA 1VQMS 2ZHOA 1WG1A 3SDEA 2G4BA 3U27A 4ITSA 1T9XA 2P8IA 3AXKA 1M5HA 3PX4A 3VQTA 3ITHB 2XS5A 2YX7A 3PG9A 2IMWP 3AD9C 1IJFB 5LT5A 4JI5J 1ZPVA 1ICEB 4DV4J 4J5OA 4PQAA 4NCGA 1IBMF 2E5LF 3I0RA 2PDAA 4QIWD 1QAIA 1HYSB 3I4HX 2I6WA 4O44A 5D3GA 3EZUA 3TZWA 4J9LA 3VZHA 4DV6J 2LEAA 2FVCA 3BYPA 2WBMA 1VQYA 1PIEA 3KK3B 2FJXA 1SBRA 4HR2A 7FD1A 2J8AA 3QAEA 4J9PA 3PEHA 2ZOMA 3AOBA 4IYQA 5BYQA 3HXMA 5HLFB 1ZTTA 1BWEA 3K5NA 2XY7A 3IWLA 1HBNB 4R25A 3BV8A 4RUHA 1TFWA 2ALZA 2I0XA 3GFHA 2VPWB 4DLEA 4HDGA 1QUVA 3CWJA 1SB6A 3MPVA 4O4RA 3RBDA 1S12A 3IM9A 4OJ1A 1RK8A 4NLWA 3EGNA 3A3NB 2AYGA 1IVZA 5KG5A 4RUCA 4G6VB 2GIFA 2A6MA 2VFVA 1IKYA 1G6BA 5KFEA 3SCKE 2ZBQA 3DHWC 1FDBA 2E5HA 2OEJA 4PXDA 4ZP8A 4IRCA 1G1XA 2BDPA 1PAUB 4BS2A 3G9CA 2UUBJ 1EQMA 1LW0A 3MEKA 3UE2A 1H7XA 4ZVQB 2JEGA 4KGZB 4G1IA 4KKOA 3HX9A 2OJ3A 3H7HB 1DTQB 1WC6A 4ZITA 3LP1A 3MD3A 4DQSA 3RR7A 2FLOA 1T8EA 4BC9A 2VH7A 1YRUA 4GVLA 4B3OB 2C2NA 2XNRA 4WP8A 2IBKA 1SV5B 4KO0B 2RUGA 4Q44A 1I51B 2PO4A 2UVWA 4ZS6A 4B9VA 4C8OA 3V81B 2RDJA 3DXSX 3MFHA 2GA7A 4FKXA 4K0KF 3T9ZA 3R5AA 3FMWA 4Q0BA 4G65A 2H5EA 1YI2S 2OELA 3JTOA 1VDHA 4PCQA 2RQCA 2VQFJ 3S7RA 4LF5J 4LRBA 2ACMA 2Y0SD 4WKYA 2LU1A 4M1KA 2M88A 4N8OA 3Q23A 1R31A 1Q86T 1U49A 4QWBA 2FY1A 1VLOA 4DX8H 1V3SA 1H2UX 1ZM2A 1UEVA 3D66A 5BXIA 2HZCA 3KXDA 2RKIB 4WXOA 2BM1A 2V63A 2DNPA 3P45B 4WK3A 2GQCA 2BR0A 2ERRA 2HKEA 3CJ4A 5KFQA 4P9SA 1QE1B 3TVKA 4CO0A 3J81j 2YNFB 5FLXU 4DV0F 2KVQE 1TKZA 2CWXA 3DCAA 3JB9k 4JV0A 2GAGC 1N5SA 2UXCF 2MY7A 1DRZA 5D6GA 2BKNA 4NA2A 4Y3CA 4K4VA 1OYDA 2BANB 2O5DA 1GNKA 4DL2A 1KDNA 1RACB 2D3ZA 3M2UA 1FWPA 4F26A 2B9EA 2W7OA 4RNFA 2K7KA 2Q43A 2HRUA 5LMNF 4H4MA 4ICLA 1H6KX 4KGXB 1M1KT 3ZTPA 3JSBA 2KT5A 3CO9A 3QT7A 1NJYA 4CO2A 2VPZB 2PFFB 1UVIA 3FCWA 3ZTRA 3KHRA 4KB7A 1FNOA 3VAMA 4TNOA 2HZAA 1UJ4A 4OX8A 1N5VA 2ZJRQ 1IKXB 3FSIA 2ZH7A 2UXCJ 2HVHA 3KG4A 4X84A 5IT4A 2K06A 1FKPA
chains in the Genus database with same CATH topology
1ZOTA 1X4FA 2DGTA 2WSCC 4FF4A 4X4UA 1T05A 2VBXA 1HI0P 2DD8S 5KFJA 2BM0A 4YB6A 1YJTA 2OPRB 4PKDB 1YJRA 3UD4P 1VQ6S 1S72S 2Q3PA 2YNGA 1WF0A 4ZPTR 4A46A 4OL8A 1VBYA 3LAMA 1LK5A 4JI7F 1U8SA 5L8RC 5DGAA 4HTIA 4OI3A 3I0SA 1GAOA 1Z2LA 1XN9A 2J9DE 3HDSA 3UCGA 5B0BA 3LALA 2MMYA 5B0FA 2IM1A 4Y2CA 4C11B 3I87A 2LLZA 2R7QA 3BR8A 2JDJA 4JI1F 4NPOA 2AYMA 2CJBA 4ZLPA 3FFIB 2YX4A 1XNRF 4BDPA 3IRXA 2OFGX 4WCEQ 1CC7A 2XNQA 4IG0B 2HFNA 1DTTB 3POTA 4YUDA 2J76E 2QSFA 4DV7F 2MXYA 1DARA 3E01B 3FZ2A 4LSLB 2W7AA 1O8BA 5I3PA 3BO2A 4BC7A 2QLXA 4NRTA 3J7ZT 2QZ8A 4MK7A 2XULA 1JLGA 2JOQA 4LFCF 2JHEA 3BGUA 4IFVB 2QRRA 4ZP9A 1WTFA 2E44A 4GC7A 4MMOA 1QLNA 2OPSA 1HQUA 2AV5A 2ZDOA 1QM9A 4W90B 2NSCA 4ECUA 4FF1A 3N6NA 2OPQB 1B64A 2BE2A 4YB5A 4ECTA 2IBOA 3GE9A 1NEEA 1OPIA 3M9OB 3DLJA 4TY8B 2G9OA 3MUTP 5SZTA 5JVGQ 3THVA 3DRYA 3ONQA 2FIUA 3VCDA 3K58A 2ZUGA 3P96A 3H20A 4FVMA 3HMJG 3FEXB 2J9CA 2UXDF 3G71S 1HMVB 2IA0A 5D78A 3RR8A 2WHOA 1R8HA 2I8EA 1WI8A 4F3OA 3IWNC 4DN0A 1NHVA 3UDCA 2YWEA 4CH0S 2V8VA 3NP5A 1IKWB 1ZM4A 1NK8A 1YSJA 1UVJA 2JEJA 1JWWA 2BACA 4YEAA 3DLHA 5C5JA 3H2VE 3EPGA 2DNKA 2V5HG 1UKUA 4Y2IA 3FNNA 2MB0B 1Y5IB 2DISA 4DQIA 4USJC 2R7XA 2O3DA 1J5OA 3HFKA 1R6YA 1WF1A 4QWCA 1W2BR 1S1TB 2XMTA 4RLEA 3GG1A 3GYXB 2JEFA 1Z1ZA 2G13A 4M8LA 1L3KA 4IH5A 4A8OA 2B4PA 2J9DA 5ITHA 3H4DA 2N82B 4F3MA 1QY7A 3BEGB 1SJFA 5DDQC 2HFZA 1S48A 2XSJB 4EU0A 5EWFA 1LKZA 1H0HB 1HHSA 4AUKA 2FVQA 1E6YA 2Q66A 1MROA 2R2SA 2GNKA 5JVHQ 2AJ1A 3V6HA 2R8KA 1N52B 3MM9A 4ETXA 3CDAA 4DL0C 4K5RA 5A0YB 1QTMA 2M8DB 3OVAA 3HHLB 2CJAA 3FSYA 3T3FA 4C9DA 4DG1A 5B09A 4EYHB 3NBPA 3VAHA 5LMUF 3TARA 5KFIA 4DV5F 2AU0A 2WONA 3NRBA 1OQ6A 4BWJA 1FRJA 3MF5A 2D9OA 2DPJA 1U2RA 4L3NA 4N47A 3DU6A 2U1AA 4F4XA 3KLEB 5CH7B 1VIXA 3GMGA 5DQGA 4BWMA 2YKOA 3TAMB 1MWZA 3EX7B 4CH1A 1U48A 2E29A 2EFVA 1JLQA 2OSRA 3UW1A 2DIUA 1VQNS 4RNHA 3L09A 3B4MA