3TAMB

Crystal structure of hiv-1 reverse transcriptase (k103n mutant) in complex with inhibitor m06
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
424
structure length
403
Chain Sequence
b'IETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase/ribonuclease H
publication title Design and synthesis of pyridone inhibitors of non-nucleoside reverse transcriptase.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Transferase/transferase inhibitor
total genus 106
structure length 403
sequence length 424
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2011-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3tamB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3tamB03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3tamB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3tamB04
3DYAA 3HVTB 4XPEA 3SFGA 3HVTA 5I3UB 2XGQA 3CJ4A 5L1KA 4K4ZA 4WZQA 5F8MA 5I3UA 1HNIB 2BRLA 5DGBA 3NKYA 3QGGA 1HNIA 3NBPB 4YR0A 5KFBA 3NBPA 3ISNC 3DDKA 4MKAA 5KFIA 2XCAA 4RNFA 1HARA 3G6VA 2E9TA 1EETB 2R8HA 1EETA 4K4YA 2JEGA 4QW8A 5KFSA 1LWEB 5DQHA 5DGAA 3OL8A 4NLWA 4KBIA 3PW7A 1JX4A 2WOMB 3KK1B 4J9OA 2WOMA 3KK1A 3LP2B 3I5AA 3LP2A 5J2QB 4ID5B 4EYHB 4KSEB 4ID5A 5J2QA 4ECQA 2FVCA 5KFUA 4WZMA 4MK7A 3BJYA 5KFVA 3DRRB 5L9XA 5HP1B 3DRRA 5CYMB 2W9CB 5HP1A 5CYMA 2W9CA 2ASJA 3E51A 3RBDA 1T94A 3OLAA 3M8QB 1S9GA 3M8QA 3PJWA 4OL8A 4FS1A 4KHRA 4JV0A 3KMQA 2RKIB 2UVWA 3QLHB 5KFYA 2RKIA 5FDLB 3KLFB 3QLHA 2CKWA 4ZPCA 4ED6A 3KLFA 5FDLA 4TY8B 4PUOB 3D5MA 3T5HA 4TY8A 5KFEA 4PUOA 2FJWA 4O3SA 5J2NB 5J2NA 3T5KA 2UUTA 2FVRA 2W8KA 1C1BB 2ASLA 3V4IA 3BSCA 1C1BA 4IQXA 3CWJA 4YQWA 2IJFA 4RNNA 1N6QA 4O3NA 1JLCB 3IGNA 3H4DA 1JLCA 4F4ZA 2WCXA 3NGDA 3OHBA 1N4LA 1RT4B 1JLFB 3EZUA 2J6TA 1JLFA 1SUQB 1SUQA 1C0UB 3PW5A 2XCPA 5EDWA 4H4MB 1C0UA 4PWDB 3GIJA 4H4MA 4PWDA 4J9NA 3NMAA 2I5JB 4IDKB 3T1AA 3TVKA 5KFDA 2I5JA 4IDKA 4K4TA 2JLEA 5KFHA 1JIHA 4FBUA 3IN5A 2OPQA 3OL9A 4RUCA 2ASDA 3MF5A 3DOLB 2B43A 4IH7A 3DOLA 3TAMB 3SI8A 4G1QB 3IG1B 3FQLA 5F8HA 3IG1A 3HKWA 2FVSA 3KHRA 1LW0B 1LW0A 1T05B 5KT6A 3FFIB 1T05A 3JSMB 2IMWP 3FFIA 5KFXA 3JSMA 5DG9A 1IKXB 4RNHA 1UWBB 4O44B 1IKXA 1DTTB 4Y3CA 1UWBA 4O44A 2AGQA 4IKAA 1DTTA 1MU2B 3V6HA 3PW2A 2DPIA 1MU2A 4MIBA 1JLEB 5KFCA 2BANB 3DMJB 2JC0A 4IOBA 3G6XA 2BANA 3DMJA 1RYSA 3LP0B 2ATLA 4TQRA 3LP0A 2IA6A 5F8IA 4IH5A 3M8PB 1NNDA 4YP3A 1JLBB 4Y2AA 4ED0A 3M8PA 5KFNA 4WYWA 1JLBA 3OLBA 3GV5B 3T5JA 3M9MB 4GC6A 1LWCB 1VRTB 1LWCA 5KFOA 1N56A 2UVVA 1VRTA 3RB0A 3PW0A 4O4GB 3C6UB 4ZVHA 5L1IA 4O4GA 4NLPA 2GC8A 1HQEB 3C6UA 3CJ0A 4NLSA 3KLGB 4ZP9A 1S9FA 1HQEA 3FDSA 3I0SB 3KLGA 5KG4A 2R8JA 3I0SA 3MEEB 5KG3A 3MR2A 3I5CA 5J2PB 3MEEA 5KFPA 4ECZA 2QV6A 5J2PA 4NLOA 1IKVB 2OH2A 4K4UA 1N48A 1IKVA 1Z4UA 4WXOA 2HMIB 1S0OA 2HMIA 1U09A 1KHWA 4H4OB 4YR3A 4ECUA 2R8IA 2DPJA 4KHMA 2IAJB 4H4OA 3BSOA 2IAJA 4J9SA 3E01B 5KG7A 1TL1B 3E01A 3PZPA 1TL1A 4F4WA 1FK9B 1KHVA 2YNIB 5DLGA 2R2TA 1FK9A 5KT7A 2YNIA 4Q45A 2ILYA 4QWCA 4NLUA 4U7CA 5C25B 4DL7A 4Y2CA 5C25A 4RW7B 2ZD1B 4O3RA 4RW8B 4RW7A 5CYQB 2UUWA 2ZD1A 4RW8A 1QE1B 5CYQA 3Q8PB 4IG3B 5F9NA 4IG3A 4K4SA 4Q0BB 4ZVFA 3V81B 2F8EX 3GYNA 4Q0BA 3NAHA 1LWEA 1ZETA 3V81A 1S6PB 2C2EA 1QUVA 1S6PA 4ECSA 5J2MB 2OPRB 4J9LA 5J2MA 2OPRA 3GIKA 3KHHA 3LALA 1XR6A 3BR9A 2IM3A 2RDJA 5T14A 1WNEA 1LW2B 3H5SA 4NLGA 3BQ1A 1LW2A 1YVFA 1S1WB 3CDUA 3D28A 2W9AA 3V6JA 2AX0A 1S1WA 1RTDB 1RA6A 1RTJB 2WRMA 3EPIA 4FBTA 1RTDA 1RTJA 3V6KA 4LQ9A 2IM0A 4EO6A 3Q8SB 3KLVA 3MEDB 3QYYA 5L1LA 3MEDA 2AGPA 1ZTWA 2BRKA 4F4YA 2BQRA 4RU9A 1S9EB 5HROB 1S1TB 4TYBA 3N6LA 1S9EA 5HROA 1S1TA 1S4FA 5C5JA 4WFZA 4PQUB 4J9KA 3CO9A 4PQUA 1SH0A 4EBEA 4RW4B 2FLLA 4RNMA 5C24B 1QAJA 4RW4A 4WXWA 1S6QB 5C24A 1S6QA 2AWZA 3NL0A 2CJQA 3NAIA 2B5JB 1S10A 4I2PB 2QE5A 2B5JA 1T03B 3EPGA 4I2PA 3UPFA 5JUMA 1T03A 3JYTB 3RB4A 4NLVA 2IBKA 4RW9B 3JYTA 3FQKA 4NLTA 4RW9A 4F50A 1T3NA 5KFWA 1RT4A 1RA7A 3ICLA 4WYLA 5DLFA 4O3OA 4JV2A 4NZ0A 3DI6B 2W7PA 2C2DA 3DI6A 3KLIB 5D3GB 4IFYB 4TXSA 2HNDB 4Q8FA 3KLIA 3LAMA 5D3GA 4IFYA 3N6NA 2HNDA 1C2PA 4ECRA 4DL5A 3KJVB 3CDWA 5EWFA 2V4RA 3KJVA 3FRZA 4Q43A 1S97A 4R8UB 4R8UA 1EP4B 4ECTA 1EP4A 3KK2B 2W7OA 2B6AB 3KK2A 4K4XA 2B6AA 4HKQA 3DLEB 4JV1A 4ECVA 1S1UB 4KAIA 3BGRB 5KG5A 3DLEA 1K1QA 3PW4A 1S1UA 4EO8A 3BGRA 3IS9B 3TAMA 5F8LA 3PR4A 4G1QA 1GX5A 3IS9A 4MK9A 2FLPA 1VRUB 4LSNB 3BQ2A 5EUHA 1VRUA 4LSNA 4J9MA 4IRKA 5EWGA 1RT2B 3H5YA 1RT2A 3H98A 2R2RA 5HLFB 4ZVEA 4RUAA 4X2BA 4KE5A 5HLFA 3H59A 5KT2A 4ECXA 4G3IA 3BQ0A 2GIRA 3PJXA 5KFQA 4EEYA 1JLAB 3H4BA 1JLAA 2BE2B 5HBMB 1JLEA 2BE2A 2J6UA 5HBMA 1XR5A 5F8GA 4RZRA 1JKHB 1D1UA 4RNOA 1JKHA 3GIMA 3RBEA 3LP1B 1D0EA 2VA2A 3I0RB 3LP1A 1LWFB 4M94A 4URSA 3SFUA 5DG8A 3I0RA 3VQSA 1LWFA 2R2UA 2R2SA 4O3PA 1RT5B 4R0EA 3PVXA 3QIDA 1RT5A 5EWEA 4KV8B 4NRTA 5L1JA 2R8KA 4KV8A 3CIZA 4NLRA 3KNAA 4TQSA 4I2QB 3KHLA 4I2QA 3QIPB 1TP7A 3QIPA 2JEJA 5F9LA 3OHAA 1DLOB 2D41A 4QWEA 2UVRA 1DLOA 1MMLA 1DTQB 4J9QA 2AX1A 1DTQA 2XWYA 4ZVGA 5DG7A 2HWHA 4YR2A 1RAJA 3QZ7A 4EBCA 1C0TB 3CJ5A 1C0TA 3DLGB 4MIAA 3GIIA 4XO0A 3DLGA 4ED1A 4MH8A 5KG2A 4O4RA 4MFBB 4QW9A 3RB3A 1SH3A 1JLQB 4MFBA 5C42B 2D3ZA 3CJ2A 2IJNA 3KOAA 1JLQA 5C42A 5I42B 2HAIA 1RT6B 1HPZB 3G6YA 5I42A 3GILA 1RT6A 1HPZA 4DL6A 2BQ3A 2C2RA 1SH2A 3QGIA 4ZP8A 3HVAA 4ECYA 1J5OB 1TKTB 4TLRA 2E9RX 1J5OA 4IRCA 1QE1A 4NLXA 1TKTA 3OL7A 4FS2A 4IG0B 1FKOB 3KLHB 4IG0A 3T19A 1FKOA 3I5BA 3KLHA 5KFJA 3GQCA 4ZP6A 2E9ZA 4I7FB 2HNYB 4IH6A 3IGVA 4HYKA 3V6DB 4I7FA 2HNYA 2WK4A 3ITHB 3V6DA 2V0NA 4J9RA 3ITHA 1BQMB 1HYSB 4B3OB 1HYSA 1BQMA 1RT1B 4KFBB 4B3OA 2AU0A 5JXSA 3RAXA 4KFBA 1RT1A 3DLKB 3G86A 5KG0A 3H40A 3DLKA 3DRPB 3PHEA 4IFVB 3DRPA 3H2LA 2OPSB 4IFVA 5KFMA 1TKXB 2OPSA 3KHGA 4URQU 1TKXA 4ED2A 4Q8EA 3ISND 5KFZA 1KLMB 3BSNA 4ED8A 1HMVB 1KLMA 1HMVA 2ILZA 3OSNA 1RT3B 3DOKB 4NYZA 5KG6A 2YKNB 3M9NB 1RT3A 3DOKA 4ICLB 5K14B 2YKNA 4WFYA 3Q8QB 1RTIB 4ICLA 5K14A 4XPCA 2JC1A 2O5DA 1RTIA 3MR6A 1S48A 2WONB 3IRXB 2RF2B 2WONA 4URGA 1XR7A 3IRXA 2RF2A 4ZP7A 4Y34A 4DG1B 4ZPAA 1TKZB 4DG1A 1TKZA 2VG7B 4J9PA 2VG7A 5KG1A 5KFFA 1N5YB 1REVB 1S1XB 3MTKA 1N5YA 4RW6B 1REVA 1S1XA 1S9GB 1RDRA 3MR5A 4RW6A 5J1EB 1TV6B 3QO9B 3CDEA 4MKBA 5J1EA 1TV6A 3QO9A 2I1RA 2IC3B 5DQGA 2IC3A 2V9WA 4ED3A 5KFTA 4YMEA 2EC0A 4TN2A 4DL2A 1TQLA 2FVPA 4KB7A 2GIQA 1R0AB 2IM1A 4ZPBA 2XC9A 2FJVA 3M9OB 1R0AA 1NHVA 5DQIA 4QPXA 4ED7A 2YNGB 2VA3A 5F8JA 3V4IB 2YNGA 4WE1B 1S49A 4TYAA 4DL3A 4WE1A 3UR0A 1N6QB 1OS5A 2ZE2B 2W9BB 3RAQA 2FLNA 1SV5B 2ZE2A 2W9BA 2WB4A 2BR0A 1QAIA 1SV5A 4EBDA 3T5LA 2D7SA 3QGHA 1IKWB 1IKWA 3UQSA 4DEZA 2JEIA 1RTHB 1HQUB 4ECWA 3OSPA 1RTHA 1TVRB 1HQUA 4IR9A 5KFKA 2AQ4A 1I6JA 5KFRA 1TVRA 2VG6B 3BSAA 4EYIB 2VG6A 4WFXA 5KT3A 1JXLA 2FJXA 3UDLA 5KFAA 4NLDA 3KLEB 1RT7B 2XI3A 4JUZA 1IM4A 3MFIA 2C28A 3KLEA 1RT7A 3KMSA 2C22A 2OPQB 4KKOB 1S0MA 4TY9A 4KKOA 4MK8A 3QZ8A 2WTFA 4ZHRB 3KK3B 1W25A 3BREA 4ZHRA 4IRDA 3KK3A 2ALZA 4K4WA 5KT4A 4O3QA 4QWAA 2V4QA 3TQ1A 3MECB 2AGOA 2BQUA 3LAKA 3MECA 3MEGB 2HWIA 3CVKA 3HVWA 1BQNB 4DL4A 4NLQA 3MEGA 3DRSB 1BQNA 2VG5B 3GV7B 3GV8B 5F8NA 3DRSA 5KFGA 2VG5A 3RB6A 1C1CB 4F4XA 3MR3A 1NHUA 1C1CA 4H54A 4R5PB 4R5PA 1K1SA 2XGPA 2UVUA 2YKMB 2YNFB 1GX6A 4LQ3A 1ZTTA 2YKMA 2YNFA 1TL3B 4NLYA 2W8LA 4K4VA 2R8GA 1TL3A 2WHOA 4GC7A 3MFHA 2HNZB 4NCGB 2HNZA 4NCGA 3HHKA 3DM2B 4ZPDA 4QWBA 3Q8RB 3DM2A 2IM2A 4Q44A 2FVQA 5KFLA 2J6SA 2YNHB 2ZKUA 2YNHA 4ZMMA 2OPPB 1S0NA 1FKPB 5KT5A 1RYRA 1HNVB 2OPPA 2D3UA 2RDIA 1FKPA 2JEFA 1HNVA 3LANA 1S1VB 2XI2A 3CJ3A 1S1VA 4QWDA 1CSJA 4NRUA 3C6TB 4M95A 1IKYB 1JLGB 3N6MA 3PR5B 3C6TA 1IKYA 1JLGA 4K50A 3H5UA 3H5XA 4KO0B 4IR1A 4LSLB 4U6PA 3FSIA 3OL6A 4KO0A 4LSLA 3DYAB
chains in the Genus database with same CATH superfamily
4DR2F 1U1PA 1HNIA 2KT3A 4RNFA 1SKWA 4Q7AA 2R7UA 1DZ5A 2QLFB 1U47A 1SQGA 2YQ3A 2W24A 4WZMA 1GTHA 2PGCA 3B54A 4PEOA 2MGZB 2XMTA 5BXIA 3UN2A 1OPIA 3PRBA 5FDLA 2HHWA 4U8VA 4QYZK 4HVZA 2F4VF 3O8WA 3IP0A 2BW2A 2F65A 5BYSA 3DXBA 3HP6A 3TYTA 1B0PA 3IR6B 3NMAA 3OTCA 4ZVPB 5KFDA 1RWUA 3ZC4A 3NY0A 2Q6CA 2ASDA 3M30A 2AYMA 2D3OR 2RVJA 3TVZA 1XWLA 1X60A 2XY6A 2DNMA 3ENAA 1JXEA 5AE1A 3CCZA 3M8PA 2HHPA 2H1YA 3C14A 1VRTA 2KHDA 3G9CA 2BQUA 3GYXB 3I0SB 2VOOA 4NYOA 3I5CA 1ZAXA 4I67A 2HMIB 2DPJA 4J9SA 4DCJB 3PZPA 4F4WA 4B3TJ 1M5OC 2YNIA 3UVJA 4KQZA 2AKWB 4JI7F 2J9CA 2GIFA 2PC6A 4Q2MA 3M2VA 2CPIA 4IG3B 2JNJA 4K4SA 1UW9A 4ECSA 4K0KF 2IM3A 1R0CB 4HL9A 3BN4A 1RTDB 1MN7A 3JSBA 3N5FA 1F2GA 2PMHA 5L1LA 4MTPA 2BRKA 1UJ6A 1UZDA 1WF0A 3ZO7A 1HWLA 5C24A 1S6QA 4JP8A 2VJUA 3NAIA 2B5JA 5G4DA 1SJFA 4QU6A 1H73A 1VQ9S 1ZAVA 2UXBJ 1YJ9S 1EKSA 4ZJQA 1SPBP 5D3GB 3LAMA 1UZHA 2E1AA 1WWHA 2ERRA 2ZITA 3G2XA 2VQFF 1BGXT 1IBLF 2KRRA 4OYWA 4KR0B 3IS9B 1S57A 4J9MA 3D6HB 2OKQA 3VVTA 2EFGA 2MZQA 3SEOA 2V2QA 3US5A 2RH3A 5K20B 2C3YA 4ZLJA 3TI0A 1SC1B 2ADCA 3X1LB 4XO0A 1JLQB 1X8DA 5I42B 3OVBA 1RT6B 3JTOA 2BQ3A 2JLGA 1U1NA 1TZ0A 4IH6A 5K8PA 3V6DA 4LF7J 1Q7YT 4DCOB 4DQIA 2RILA 2R7QA 2BX6A 1GMUA 2YKNB 1RT3A 2JC1A 1Q5VA 2EG1A 3ZNUA 1YSJA 5AXLA 4XIUA 1FRLA 4ZVRB 1V5VA 1FD2A 2JH3A 3M05A 2Y0SD 5DDQC 2BE7D 3QO9B 3CDEA 3T9ZA 4NA1A 2LECA 1KN6A 2IM1A 1R0AA 4LFAF 1HHSA 2YNGA 4I0WA 2KVIA 4UW2A 5IC6B 3FBBA 3CCUS 2W9BB 4YN3B 3M32A 3V4MA 2ZBCA 4ECWA 4JI5F 1Q0NA 1K9MT 3BSAA 4V19J 2FJXA 2C28A 2CADA 2F3JA 1IM4A 2FJEB 2C22A 3T1YF 3PX4A 1IQTA 1U25A 5KT4A 1U1OA 4WFBQ 7AT1B 1VC5A 7FDRA 3MFHA 4FP9A 5FD1A 4FVMA 5AJ3J 1FKPB 3NNHA 2JEFA 5M2RA 1S6OA 4JB8B 1R8HA 3BGUA 1JLGB 3PYFA 1ZPVA 4U6PA 3PO4A 4X66F 3I82A 1CS4B 4X4VA 3ONQA 4YR0A 4OI0A 4XTTA 3EX7B 1Z2LA 2J7KA 1H2VZ 3LOUA 2E9TA 2KTQA 5LXYA 2QL9B 4G1IA 2Q79A 2AYEA 4DS4A 3NS6A 1OY6A 3DRRA 3N9UC 4K0KJ 3ZZTA 4HHUA 3RBDA 2EBGA 3G6ES 3OLAA 4PPDA 5E3CA 4OJ1A 3MAQA 4G65A 3HULA 1RHUB 2FVRA 5H9EK 4DR4F 4FNIA 2XNRA 3OHBA 2J6TA 3GJQB 5LL6d 4PYDA 1KSPA 2E5IA 2K3IA 3R97A 4F25A 1HD0A 2QTWA 4JV5J 2BOAA 1SJ1A 3W2WA 4L75A 1UWBB 4O44B 1ICEB 4OX7A 4IKAA 4X62F 3DMJB 4UZBA 5D0RA 2CPEA 1RYSA 4MYTA 1HWJA 4DR5F 1JLBB 3DNCA 1NBEB 1NJZA 4EMDA 3PW0A 5A0YB 4EGLA 5CXTA 4LRCA 2VHGA 2J8AA 2RUGA 2PDAA 1UEKA 3SDEA 4C6AA 4Z2XA 4YDDB 4WXOA 2E5GA 1MG7A 3H2VE 5CAAA 3E01B 2VQEJ 2E1RA 1TL1A 1H98A 3M2RA 1VGYA 1N5SA 2EEYA 2ZHBA 3R5GA 1UVMA 2CDRB 2C2MB 2G0IA 4KH0B 4CLPA 3K7RA 5J2MB 2JOQA 3N28A 1OWXA 4J9UE 3DDIA 2OD6A 1SXLA 1CBKA 4DJBA 5E2QA 1HI1A 4RW4B 3BYRA 5I3QA 1SJ4P 2MKJA 4CLZA 1UPMB 3E2EA 2Y1JA 4CT9A 4DUZJ 2RQ4A 3WIUA 4LF9F 3BGLA 4TLQA 4Q8FA 3NL0A 2DNKA 4DL5A 2GMHA 1RBAA 3P3DA 2QJ3A 4HTJA 2PN6A 3SSRA 4ECVA 1S1UB 5D4PA 4DFPA 5EWGA 2AJFE 2HFOA 1FO1A 4QIGA 5KT2A 1B99A 2HZAA 2GIRA 1TELA 2Y8WA 1JLAA 2J6UA 3VGUA 2RQKA 1FESA 4CDIA 4P52A 3LP1A 4DV0F 1UA0A 3T1YJ 3QIDA 5EWEA 4LVOP 4QIEA 3HHNB 2IA0A 3G96A 2UVRA 1DQ8A 1X0FA 2VFSA 5LSOA 4OZ5A 3QGPA 3K5PA 3ZNJ1 2ZUGA 3V2UC 5IFMA 3NGKA 2B4VA 1UVIA 3GILA 2SXLA 4QCLA 4Y00A 2AJ1A 3AA8A 1VQSA 3DHWC 1FKOA 2UU9J 5KFJA 1N32J 1FTCA 2VD3A 2LQ5A 5HVGA 3OVSA 2M88A 4B3OA 3RAXA 4I68A 4NPOA 2E29A 3DLKA 4ZIWA 1IWAA 2VH7A 2HS0A 3TANA 1DY3A 1HMVA 2LYVA 2CJKA 3ENQA 3LH2S 5K14A 3MMAB 5LMUJ 1IM6A 1P9QC 2NQPA 1T9WA 2ALYB 2LXIA 2ADBA 1REVB 1S1XB 2I1RA 1HBNB 5E5NA 3X3UA 5D4OA 1F1BB 4NZ6A 1V5IB 2RAQA 3CJ8A 5A76A 2DVIA 4ILMA 4DR4J 2HBQB 3K5MA 1KVIA 4KT0C 1U1LA 3OFGA 1PG5B 2Y9HA 3BBFA 1H72C 3KK3B 1W25A 4ZHRA 3PACA 3TQ1A 2AGOA 2N3LA 2HWIA 4FPIA 4NLQA 4IO9Q 2AEJA 1DURA 5A8KA 4C8ZA 1K1SA 1LWXA 1DJ0A 4E2FB 1U24A 2OD4A 1X4DA 2E44A 3EWGA 4HT7A 2VKZG 5THWA 4X62J 1TK0A 1RYRA 4DR5J 1QDUB 4PXBA 1TFYA 1S1VA 3C6TB 2KU7A 4DX5A 1F6TA 1NSAA 5HJXA 2KRBA 4KBIA 2DRDA 2L9NA 1LFWA 4GVBA 1HNIB 3VAJA 3QGGA 3OVAA 1LXNA 3EGZA 4OFZA 3NBPA 1T3OA 5CYJA 3ISNC 4UY85 2PEBA 1KOHA 4E8UA 2HVEA 1FDDA 3K2YA 3MM6A 1F5CA 1VBKA 3QT7A 2A18A 1YX2A 3O44A 4HH1A 2FVCA 1PILA 3I6PA 4DV7F 5ETOA 1VQNS 2HK3A 3ZZRA 4F3MA 3HMJG 1HNWF 1S9GA 4KHRA 2V8PA 4C48A 3K89A 3TUIC 3VV2B 2PI4A 2RKIA 5FDLB 3J81j 1O8BA 3N79A 1G7CB 2P9CA 3LA0A 1MROA 5BYQA 4F2SA 4OYMA 5A8RB 4LIWA 5GADI 1C1BA 5KAKA 5A2QU 4F4ZA 3K58A 3DGPA 1JLFA 2Z2YB 4NASA 4ZVUB 1FVSA 4NA2A 3HT3A 1GAOA 4WBFA 1SQEA 3D2WA 4FKYA 4LF9J 2XHCA 3OPKA 3M30B 3EUNA 3DU6A 2MZRA 2R3VA 3ET6A 3H7HB 2DKOB 5IOLA 5CD4A 5E0OA 2RRAA 3AD7C 3EZ5A 3R8YA 4MIBA 3GFHA 3F0NA 3GCXP 3M8PB 3OLBA 3C14B 5F0WA 1VRTB 1LWCA 5KFOA 2UVVA 3BBCA 3FEXB 4USMA 3FCWA 2KI2A 2V8DA 3M4XA 2GW8A 2QFJA 5ETNA 4F8RA 2XZWA 2FGCA 1KC8T 1RWWB 3HJVA 2IAJA 2HFNA 2YNIB 1FK9A 3UVJB 5CA5A 2J0SD 2FTRA 3M2VB 4M5MA 3TA1A 3FBFA 4JI2F 4QU7A 4OYXA 4RBVA 2HBYB 4L74A 2BKPA 3LALA 2QLWA 1F5AA 5DDOC 1Y5LB 3Q8UA 2C3MA 1RA6A 1RTJA 3ILJA 3V6KA 3QYYA 1U7LA 2ZJPQ 1OY9A 1S4FA 4J9KA 1NK8A 2FLLA 4RNMA 5C24B 1DBDA 2CQ2A 2NYIA 1S6QB 3NLCA 2MMYA 2B5JB 2QC3A 1T03A 3KTQA 4NLTA 2PFFB 2CRLA 2W7PA 4TXSA 3R1HA 5H9EJ 2KFZA 1PAEX 1N0UA 3HFKA 1UKUA 5EHHA 1WOSA 5CH7B 2D9OA 3H5YA 1R6VA 2V50A 3M6UA 1SL0A 2V2KA 1NJWA 2HGLA 3L9ZA 1TP7A 1PJ6A 4JBCA 3QFHA 1SL2A 3T1HF 1EX8A 4ZKAA 4LF8J 4ETXA 3CJ5A 4J37A 3MAAA 2W2PP 2CPHA 3IA0A 2G9OA 3I4HX 4NA3A 4DR7J 3CJ2A 2WVCA 4ZDNA 2H5JB 1SH2A 1VQOS 1J5OA 3OL7A 4FS2A 4PWUA 2O1PA 3I5BA 1ZH5A 2HQDA 1DAXA 4C98A 2GQ2A 2V4JA 3V6DB 1NZAA 2HNYA 5HMYA 1HNZF 2YPYA 1NCLA 3PHEA 2H51B 3MCNA 3QQCD 4YDXA 5KFMA 5CD4H 2GJIA 1TKXA 1UVNA 3ZTQA 5CCLA 2ZDOA 4NE9C 2AEMA 4A8MP 1M1KT 1RT3B 1CJKA 1U0SA 2BKOA 3MR6A 8AT1B 3R2DJ 2JWNA 4PG7A 3MHYA 1N5YA 1VQKS 4DV7J 1Q79A 3WIVA 2B9YA 4M5LA 2IC3A 3CT9A 3MUVP 4ZK7M 4QR2A 3G71S 1HNWJ 1R0AB 4DN0A 2YNGB 3PYDA 2WBRA 3RAQA 1O51A 1SV5A 3D1QA 3M32B 1AROP 1N8RT 3QGHA 3KG0A 3CB4A 1IKWA 2RT3A 4N41A 5CZVA 2XMKA 2HRUA 3A12A 1Y11A 4DS5A 4OX6A 4K5RA 2XSFA 3DRSA 1NHUA 2V69A 4B9SA 3UFCX 3QJPA 5IV4A 2EKYA 5BJRA 1TU0B 2XLJA 1N36F 4M5KA 2J6SA 4LUBA 1VQ4S 2XG8A 3LANA 4B9MA 4DSLA 3BZQA 4PRFA 4OJ3A 2D9PA 4K50A 1KS2A 2HKEA 3OL6A 4ALZA 3NKYA 3IAM9 4F36A 2V67A 4NLWA 3VGVA 2F8HA 2MSSA 1CEZA 2IRXA 4MK7A 1V6HA 3B4DA 3DRRB 2W9CA 1HW8A 4A8SA 1JK9B 3PJWA 2HQGA 3DRYA 1LOUA 2UVWA 5KFYA 1BD6A 2RB7A 3JSRA 4AQYJ 3SXLA 3BSCA 4L3NA 4N76A 3CWJA 2V34A 2Z2MA 1ZBTA 3EZUA 4WP9A 3WZ0A 2XCPA 1Y4ZB 4OHZA 3UDEA 2UP1A 4YY3J 4OJHA 1JIHA 1NB2A 2QN6B 1XNQF 3MF5A 1NHKL 5B0BA 2LEBA 3FNNA 3U27A 3W2WB 4DQRA 2DTJA 5E3RA 3ZFVA 2BANA 4DWIA 3RB0A 2KXHA 1APSA 4J5OA 2QEXS 1S9FA 1M5PC 3BDEA 3NG8A 3GJRB 3SDEB 1D9FA 1KQFB 2MY8A 4P72A 5E3AA 1YI2S 1B7FA 1UMJA 2PI5A 1TL1B 3M2RB 2BJDA 2R2TA 1UFKA 5T7LA 3ZTOA 4HACA 2ZNYA 3M2UA 1LWEA 4DL0C 3HX9A 2W25A 2X51A 1WNEA 1V3SA 1FRKA 2CJXB 2YKPA 1WG4A 1RAFB 1HNZJ 1ZTWA 4FF2A 3ENWA 5C5JA 2DR7A 4B9NA 2QYCA 3MPVA 2CJQA 2KKHA 2ZJQQ 1YBAA 4PYAA 2BV3A 2CQGA 4DF4A 1WF2A 4GRSA 3DI6A 2RD5C 2F9JA 4UTGA 3KLIA 1DRZA 2HNDA 4BC7A 1P1LA 1Q78A 1ZZNA 3KK2A 2DGUA 2W2MP 1S7HA 4DV6F 3TAMA 1PAUB 2YXLA 3QAUA 1HFEL 5ETSA 5LSRA 2ZH3A 2VDIA 4G3IA 2RMLA 1JLAB 2FQQB 1D1UA 3FEZA 3LP1B 1L3KA 5LJ3Y 5F3TA 2QMUB 4UUWA 5L1JA 4FYDA 4DPWA 2ZH7A 1YGYA 3AXKA 4AL5A 4QWEA 1DTQA 3TW0A 4LRFA 4LF4F 3QZ7A 2QYGA 4JI1J 3R5CA 2MXYA 3GSDA 1KWMA 4USIA 2PSZA 2CZ4A 1TKDA 2HBRB 1N0VC 2C2RA 4DUYF 4YB1P 3P5TL 1FKOB 3T19A 5DDPC 2BJ1A 2XLKA 4FZVA 4B3OB 1RT1A 3DLKB 4WIQA 4UUXA 1HMVB 4ZLLA 5K14B 4MKYA 1X5TA 3GR0A 1YJRA 2RF2A 1Q4RA 2Y1LB 3K8WA 1BQXA 5KFFA 2ASYA 3J7YU 2F9DA 1RDRA 4OI1A 4B9UA 4RW6A 4ED3A 4B9VA 4RKUC 4WKYA 2XC9A 4C4WA 2CWKA 2RRBA 1QUPA 2DHSA 3NGRA 3ZZ0A 1TMMA 2OTLS 1M5SA 2JEIA 2N4CA 2QRRA 2BZ2A 4PXEA 2KFYA 5KFAA 4CM0A 2HIQA 4NLDA 3DCAA 1RLDA 1HHQA 3KLEA 2PIIA 4KKOA 4ZHRB 2FZCB 1S79A 1WDTA 4L72B 3SYZA 3GPAA 3VWSA 4OJGA 4MIWA 5ETLA 4DR3F 5A8KB 3MR3A 2R42A 3HSZA 2K7KA 4NLYA 3W9IA 2HNZA 4MYUA 3CCSS 3DM2A 4OQJA 5E33A 4Q44A 2FVQA 1BC6A 3TJAA 4ZMMA 1G3OA 2D3UA 3UW1A 1RWPB 2FD2A 4HI1A 1S1VB 2LCWA 2DYAA 4KTQA 5AXMA 1NM2A 5A2QY 4UQTA 4GVBB 2RRNA 3PEJA 5F8MA 4GO5X 2CQIA 2BRLA 3NBPB 3VCDA 3DDKA 4Q2LA 5KFIA 1X4GA 3MM6B 5DQHA 4ID8A 5ITHA 3CCVS 2VDHA 2BW7A 3QMQA 4DQQA 1D9DA 3W60A 3RGIA 2BJ3A 3IWXA 1FDBA 1JQGA 2NXJA 1GXLA 3QT5A 2AYBA 2WSFC 1XQIA 2ATCB 2HGNA 4NEYA 2RKIB 3MWBA 3UNYA 1XMBA 2FPHX 4TY8A 1MROB 2J0XA 3LTOA 3EGVA 1C1BB 2HLUA 1U2CA 2IJFA 3MM5A 4NWBA 1N6QA 4A8YA 1YJNS 3H4DA 3DGPB 1JLFB 2ABYA 1W26A 3ZXWA 1X5OA 1SUQA 1U49A 3W9JA 3TQEA 5EDWA 3BBBA 1M5VC 3IO1A 4J9NA 2RSQA 1XMQF 4PKDB 2J7WA 2CNKB 3BM7A 4NL5A 3ET6B 2KYZA 3CD5A 4R25A 4G1QB 2A6MA 2LXUA 2OHDA 1LW0A 4USHA 1T05A 3NS5A 3FFIA 2AJ0A 4J9VA 1YG0A 4DV6J 1DTTA 1R7IA 3FBCA 3KDNA 5A6PA 3M9MB 1GXTA 1WDDA 1LWCB 1NAQA 3THTA 3DRXA 3C6UA 1HI8A 5HMXA 2EFQA 3PRVA 4LFBF 1VHIA 1IKVA 1NKBA 4C3KA 3L7UA 2CG4A 1SCJB 2IAJB 1N33F 1NK0A 1FK9B 1KHVA 3QJLA 4FXWA 4LF4J 1REGX 2HAFA 2NPIA 5GMKa 4F2RA 4CI0B 5CCMA 4LF2A 4ZVFA 5CABA 1Q8IA 3D4JA 2VICA 1UW4A 1JWWA 5L9NA 2EWHA 2VPXB 1YVFA 3OTOF 1ACMB 1RTJB 3EPIA 3CDAA 3ILOA 2HLTA 5HMWA 2B51A 3CO9A 2E7XA 2XY7A 3O3LA 3I31A 2KXFA 4KIAA 5DO2A 1KONA 1T03B 2RHSB 4DSEA 2E1PA 2QIFA 3ICLA 1NSKL 4O3OA 5LSLA 1Y10A 5IS2A 5BR8F 1U1RA 1H0HB 2V4RA 3HCXA 4AXJA 1YJTA 3THPA 2BM1A 3AD9C 3PW4A 2BUNA 4LSZB 5C2GA 1SL1A 1F3FA 2VZ9A 3R3TA 2HIYA 1MNEA 3ILIA 1HBOA 4DQSA 3Q89A 1X4CA 4LF5F 1B70B 1DQ9A 1VISA 5L39A 3KHLA 2HHVA 3W5YA 1H38A 3EXCX 3HFVA 2AJ4A 4ZVGA 4DR3J 2A2CA 3MAAB 4DX8H 1VBYA 1EIYB 3DLGA 1R27B 4EZ9A 3UE2A 5KG2A 4O4RA 2FC8A 1Q1KA 1AW0A 1J5OB 1L3UA 2IIHA 4V1Ak 1FFWB 3HSGA 5I4MA 4F0MA 2V4JB 3TJ8A 2HNYB 1FXRA 3LF0A 4DMZA 1BQMA 1KBRA 1J27A 2POKA 1TKXB 4ZIVA 3AB2B 3Q86A 3BSNA 4P75A 1T7PA 1CJKB 2BE9B 1G4CA 3W8PA 2DNPA 2KHCA 4N56A 4DV4F 4JOUA 4DG1A 3ADAC 3MMJA 3RBXA 4CLTA 3P96A 1N5YB 1FFGB 3MR7A 2MZSA 4RWWA 4C9DA 5J1EA 2IC3B 3R5BA 4ATNA 4I6WA 3D1OA 4DL2A 4JI4F 2GIQA 3FMWA 4QPXA 2EVZA 1NB7A 2N4DA 3N5BA 2MB0B 1SV5B 1QAIA 2MZTA 2GHPA 3TUPA 1IKWB 5IT0A 3SV3A 4QPTA 3RBZA 3UDLA 1P9YA 2HHTA 2HBZB 3NRBA 2ZNZA 2OPQB 1PJ5A 2XMUA 2DR5A 3MI7X 2DIUA 1XMQJ 3P45B 3EICA 4DCPB 4M5GA 1YRUA 3DRSB 1BQNA 2NSBA 4NCBA 4R5PA 2XHWA 3FCVA 4NCGA 3HHKA 1TUGB 4F0HA 5LXRA 4QYRA 2ZBIA 4D3GA 3ELHA 4O23A 2A1BA 3ISZA 1HNVA 3CJ3A 1X9WA 1ZZFA 4LFCF 2EC2A 4LFBJ 2LLZA 3HVTA 5L1KA 4K4ZA 2HGMA 4P9SA 1V9OA 1FHTA 4MKAA 1R8CA 3CCQS 2QA2A 1PC5A 1VS3A 4MKVA 5DGAA 1ZA1B 3R7NB 2VC0A 3K8VA 2PE8A 5KFVA 2W9CB 5HP1A 5CYMA 3WC0A 4MJKA 3W1YC 3EGWB 4OL8A 1UCNA 3ENVA 1OQ6A 2Z8QA 4ZPCA 1RHKB 5D77A 3D5MA 3T5KA 4PQAA 1X4FA 1Q81T 4ETZA 3LO3A 1NU4A 1C0UA 2CFXA 4AL7A 2U2FA 1U45A 1QSYA 4FBUA 4WFNQ 5BR8J 3W61A 2IVMA 2VKRA 1P27B 3JB9k 1IKXA 2DPIA 2LU1A 4A8OA 2BANB 5AXKA 5KFNA 2GAHC 1Y0HA 4E98A 4C0BA 3P5BP 1SJRA 2OI2A 3UN5A 3EM1A 3CW2C 4GKJJ 2KL8A 4JI8F 4BS2A 3SCIE 1VQLS 3H8YA 2DR9A 4YUDA 1VQ7S 3ZTPA 5T7LB 3PJ9A 4RW8A 5CYQA 4HACB 3M2UB 5F9NA 1N54B 2N7YA 1Q82T 4J9LA 1UETA 2YX7A 2OPRA 4YHHJ 2VB6A 1GEHA 2XEXA 1YJWS 2DO4A 1T9XA 3RW6A 2YQ0A 2UUAF 1UJ5A 2XS2A 1H7XA 1S1TA 4EBEA 5HVHA 3JTNA 4NX9A 2AWZA 2CPDA 3LW5C 3UPFA 4OX9F 4DV4J 2L9DA 2IBKA 1T3NA 3GE9A 2Z30B 2PMZD 3DI6B 3KLIB 2WAQD 2HNDB 1N5QA 3VTIA 1CQNA 3KJVA 1NLKL 1N34F 4JI4J 3KK2B 2EG2A 3FVYA 5ETQA 2OLWA 4CCHA 4RUAA 3H59A 2HQ3A 4WP3A 1HL6A 2I2YA 1YITS 4OI2A 3GIMA 4JI6J 4C8YA 1WF1A 3BGOP 4M94A 1HW9A 3FJ2A 1LWFA 4R0EA 4NRTA 1HA1A 2ZH4A 3KNAA 4CH7A 4WP8A 2A6OA 2IYIA 1DLOA 1DTQB 1YQHA 3TEGA 2GVZB 4PAAA 3ZTRA 3A4TA 4ZS6A 4QW9A 5ETTA 1FWKA 1NKEA 4H4KC 5IXUA 2HVIA 1SKSA 2HFVA 2A10A 3KLHA 1HBMA 4ZJLA 2QLBB 4CTAA 3VALA 3VAHA 2DHGA 4LFCJ 1RT1B 3PM9A 1ROFA 2AEFA 1GMWA 3QT6A 2VPWB 2G1HA 3JSYA 2OPSA 2HK2A 5KFZA 2KVQE 1JJ2R 4NYZA 3I55S 2R9LA 2RF2B 1XR7A 2HVDA 2BYCA 2HS4A 4ZPAA 3OXFA 3C2PA 1TAUA 1NDKA 2VG7A 4RW6B 3PDNA 2CVIA 3IBCB 2UXCF 4YMEA 1FE0A 3M9OB 2ZFHA 4A8FA 2AIRB 2X1GA 4B3SF 3CCTA 4C11A 1ZYQA 4KRWA 1Y5IB 1Y3JA 4FYYB 4DOZA 2CQ3A 3UQSA 1IR0A 4HHHA 1IBMJ 2FJBB 5KFKA 1ZM2A 4JUZA 3KLEB 3MFIA 1RT7A 4KKOB 2MQPA 3QZ8A 2WTFA 4DSJA 2YKQA 3V5RA 3VAIA 1VRQC 1FJGF 1ZPWX 5D4NA 5FJ4A 1HQ2A 3LAKA 1WORA 2VBYA 3CD0A 3LGHA 4ZJOA 3WHIA 1C1CA 3VGSA 2XGPA 1FXLA 2HEKA 2YKMA 1I1GA 1CC7A 2HNZB 3DDNA 3DM2B 4N77A 3BO3A 3QSYB 5KFLA 3TWZA 1G6BA 2RQCA 2PA3A 2I0XA 1RAOA 1RKIA 4F7VA 5I3UA 1FFSB 2XY5A 1CJUA 4JI8J 4UOGA 1HR0F 2HHHF 3LP2A 3CGIA 2B0GA 1D3WA 3OV7A 4USJC 4DPOA 3FCHA 3MPWA 2ASJA 2J9DE 3CPWR 3M8QA 1NK9A 4OZJA 4TY8B 3PTWA 1WOOA 2VL1A 3MM5B 5LT5A 3QJJA 4RU2A 1RT4B 1SUQB 4F02A 4LR7A 3GIJA 4KGXB 4IDKA 1XNRF 1J2VA 3THVA 3IR5B 2B43A 3DOLA 3WX4A 1LW0B 1T05B 3FFIB 5KFXA 1WD6A 1DTTB 2O01C 1OSDA 2MY7A 3P8BB 2B8QA 3LP0A 2IA6A 1F9HA 2FJDB 4ELTA 4QZVB 1VJWA 4GC6A 1N56A 3C6UB 3KLGA 2G2ZA 3LWMA 4NLOA 1IKVB 4B3TF 2Z4PA 4X4PA 2QSFA 4H4OA 3L95X 3J7ZT 5HATA 2V8GA 3NGTA 2YWWA 2YY3A 3QSIA 4WFAQ 5GAEU 4LRBA 3PX6A 4JI3F 1HWIA 2R7SA 2ZH8A 2YWGA 3GIKA 3KHHA 4DSIA 4P2XA 2QA4G 4NMLA 3K5OA 3D28A 4DFJA 3FK4A 5K5MA 1X5PA 3M6WA 4AUKA 2F8MA 3MAHA 3MEDA 4KHPJ 2I9SA 4OYAA 3KFWX 3OR2A 1CJVA 3TNVA 1UFWA 4A47A 2ZH9A 2DNOA 2H5EA 2IDEA 1S10A 3R6GB 1SBRA 3CSKA 3EMTA 4EZ6A 5GAHU 3K0JA 4WYLA 4FF1A 4JV2A 4NZ0A 1F60B 3BDPA 2J76E 1UVJA 4CO3A 4HDHA 1NH7A 4QBUA 4CH0S 4KAIA 2V2VA 1MLAA 4B3SJ 2DNGA 3BQ2A 2JVOA 4LSNA 1W7WA 1KKHA 4ECXA 2HZCA 3AFGA 1PYOB 1HBOB 5HBMA 2HS3A 2XZTB 1U1QA 1JXVA 3BV8A 3WBZA 3NGSA 2OEMA 1DFDA 4M5JA 4OLPA 2AHOB 5DJBA 1FRIA 1JMTA 2J0QD 3OHAA 2D41A 3IBWA 4BDPA 2HHUA 2OFGX 4UZCA 3DLGB 4MIAA 4X84A 3CD7A 2D3O1 1T95A 2I38A 5IQQA 5A8WA 1ZM9A 3NEKA 3HO1A 2NSCA 1K47A 2N3OA 2R7TA 1IXKA 1BXNA 4CNZA 1VQ5S 3MDFA 4A48A 1PIEA 1S59A 1UTAA 1K0TA 3ITHA 1BQMB 2BJ7A 2FJAB 1OJ4A 3BKUA 1FTRA 4AD6A 2ZH6A 5H9FK 3U1NA 3KHGA 1RWVB 5HN0A 4ED8A 4DUTA 3W2VA 3M9NB 5KG6A 1HR0J 2O5DA 3ZZZA 3H90A 4DG1B 1HNXJ 2HHHJ 5D15A 5K9FA 5LM7E 2QA1A 5J1EB 4ILRA 3DKDA 4KB7A 4X64J 4DR6J 4MT1A 4CH1A 3IWLA 3V4IB 2BR0A 2WB4A 4CNYA 2ZZTA 1FWPA 5AXNA 5KFRA 5LOQA 2VG6A 3BEGB 4NZ7A 3CMAS 1HI0P 2E7VA 2C3OA 1S0MA 3RZAA 3IBFB 1AZSA 4CLFA 4NXNF 1XNRJ 4OX8A 3CJRA 3RG6A 1BQNB 2ZDPA 4F4KA 2L48A 3QWUA 3RB6A 4R5PB 3OTEA 3MGJA 5AJ3F 4NCGB 2RS8A 1FDAA 3CCWA 3JQKA 1OPZA 2LP4A 1HNVB 2OPPA 3SMZA 5K8NA 1N5TA 2QMWA 4M95A 4R0JA 1NSQA 1TL5A 2QFIA 3C16A 3MM7A 1YWXA 3HVTB 2MQLA 4USWA 4C8LA 5FLXU 1UVKA 4DBQA 1YZ6A 2MDAA 3OL8A 1LEOA 4USKA 3I5AA 4JI3J 3C8YA 2VBXA 5HP1B 5CYMB 3E51A 4A8QA 1KFSA 4FS1A 2I8EA 4ZVQB 2NUUG 1FEEA 5ETRA 3QLHA 2GQQA 4W90B 5KFEA 2UUTA 1NMEB 2IYGA 4OHVA 3BO4A 2W8KA 2R7OA 2DCUB 3HF5A 4IOCQ 4LVNP 3W62A 2EFOA 4CYUA 1JLCA 3AB4B 4CO2A 2EFNA 3HPOA 3PEHA 4F0KA 2DB1A 1GTEA 1C0UB 1WC6A 2C3PA 4JV5F 1UP1A 3KJNB 2I5JA 2V5HG 2OAUA 2AMCB 2W2QP 1LFPA 2KB2A 5F8HA 3L3CA 2FVSA 2BJEA 4KPYA 2Q43A 1IKXB 1QVFR 4TU9A 1IQZA 1FNXH 2JC0A 1RHQB 4TQRA 1R43A 3EGNA 1B0TA 5ETMA 2ZHAA 3GONA 3GJSB 3HSDA 2MLZA 3TZYA 2DGQA 4A8WA 2HZVA 3NWRA 2YX1A 2A3JA 1KQKA 3Q22A 4ECZA 2CQ1A 5E41A 5J2PA 2VQEF 1Z4UA 4CLLA 2JJ4D 2ZOFA 1U09A 1VYAA 5KG7A 4L76A 2DITA 3MD3A 4Q45A 1C4CA 5IT4A 2M70A 4RW8B 5CYQB 1YRXA 3OXGA 2W4DA 3R5JB 1FX4A 2G1DA 1ZETA 1BMQB 1HD1A 1S6PA 3CE8A 2OPRB 2COLA 5CQGA 5T14A 3UD4P 2C3UA 4IYQA 4FBTA 4LQ9A 2XLIA 3Q8SB 2M0GB 2KG0A 3R9LA 2XMAA 4EFAC 1WKKA 4F4YA 3OJUA 3H42A 2AZ3A 1S1TB 2DH9A 3K5LA 1CVJA 1QM9A 5EN1A 4DUZF 5GMDA 5JJBA 5JUMA 1S4EA 1FXDA 4ECRA 4ILLA 3KJVB 2E7WA 1S97A 2J9DA 3HDSA 3WC2A 1K1QA 3BGRA 2YX4A 2CNNB 3N0VA 2G13A 4IRKA 2BJ9A 4QIFA 2CZVC 3CCJS 4X2BA 4EU0A 1NUEA 3PJXA 1JKHA 2VA2A 1LWFB 3AOBA 3HHDA 4O3PA 1RT5A 3CIZA 2F4FA 4NXNJ 1UL3A 5F9LA 1DLOB 1QJHA 2NREA 2BABA 2M8DB 1C0TA 3VZHA 2OUGA 3QWPA 3HVRA 2UU9F 1GNKA 1N32F 2B9WA 3QGIA 4ZP8A 1TUVA 2KFNA 1TKTA 3KLHB 3LPEA 1HBMB 4ZP6A 2E9ZA 4CTAB 2PT0A 4I7FA 3SSSA 1WKLA 3W66A 3GFZA 3B4MA 4OYIA 2OPSB 1JJCB 4LIRA 5LMUF 3PIPQ 3MEKA 4WU3A 3OSNA 3QRPA 2GHWA 2M8HA 2CQDA 1S48A 1GQEA 4ZP7A 1SQFA 1R89A 3BB5A 4Y34A 4B3RF 2EK6A 3VAFA 2VG7B 4ZVSB 4XK8C 3MR5A 4DSFA 3NCQA 4ZPBA 3OXLA 1NHVA 4LBPA 4ED7A 1KTVA 2MQOA 3QNWB 3HD1A 1Y3KA 2OGUA 4C11B 2BOPA 5E3QA 1TAQA 4YEAA 1TVRA 4EYIB 5JVGQ 4ER8A 1RT7B 2KDOA 3JXOA 4WK3A 1VIXA 1DHMA 1R8PA 1RTZA 4USUA 3D67A 3MZIA 3CVKA 4FNHA 5B0EA 1C1CB 4DR1J 2UVUA 2YKMB 2XQCA 4K4VA 3HD2A 1WTBA 1RWXB 4GC7A 1RKJA 2VONA 2IM2A 1IVZA 4CLSA 3HZGA 4I56A 5KT5A 2HHQA 3AQOA 2HFSA 4ZCIA 2DH8A 4NRUA 4CZCA 1IKYA 4GO7X 1NO8A 5B0FA 2NLWA 4XPEA 5I3UB 1DARA 5I3PA 2D74B 5DGBA 4RR5A 2QX0A 1CJUB 1WKJA 3IM8A 3NP5A 1EETA 1ZA2B 2M7SA 5D0GA 3MPYA 2DCLA 3PW7A 4HHJA 2WOMA 3LP2B 2HWTA 4PABA 4ID5A 2MKHA 5GAGU 2EBEA 1Q8KA 3M8QB 2WW4A 3SIPB 1M1HA 3KLFA 5LMNF 2RU3A 1LXJA 2ROGA 1M5HA 4U96A 4IQXA 3MOJB 4RNNA 4CRJA 1C4AA 3VZIA 4U67Q 1Y7PA 2GHVC 2CQHA 3R27A 3BPDA 3KUGA 2OIHA 4QYZJ 3ULHA 2W2OP 4IDKB 2WW8A 2XMWA 2JLEA 3MD1A 3DLJA 4RUCA 1SI9A 3DOLB 3Q24A 2PA8D 3OFEA 1S6UA 3IG1A 2AJQA 1WUUA 3HXMA 3P4UB 1TTHB 4ES1A 2VBZA 4Z37A 3AAWB 3GJTB 1JLEB 4UF4A 3LP0B 2M2BA 3BN7A 4Y2AA 3RRGA 3IFEA 1SIZA 1VIOA 1X4EA 4BLGA 2JLFA 1CULA 4NLSA 3KLGB 2UZAA 2R8JA 1JNZB 4CO0A 2QV6A 3S8SA 4ELVA 1R6YA 1X4BA 1JB0C 1KHWA 4H4OB 1SKUB 1L5UA 4XAKA 2CA9A 4DX7A 2KZMA 1QE1B 2ZC3A 2MQMA 1YBUA 1QUVA 4WJBA 3BR9A 3RR8A 3CUNA 2AX0A 2P9EA 3KKFA 3MEDB 3A8KA 1KP6A 2EFVA 3VHQA 4RU9A 5FIIA 2WB1D 3A3NB 3TX8A 1U8SA 3OR2B 2HRYA 4PQUA 2LDIA 5HSPA 1B0VA 2D1CA 4B3RJ 4F50A 3M6VA 4RUHA 3LPYA 4IFYA 1RBOB 3CDWA 4KGKA 3GU0A 3AHPA 2AYGA 2RJZA 3C46A 1WSVA 3U7JA 4LSNB 3TVYA 4IQMA 3L09A 1SC3B 4S0MA 5HBMB 2K2PA 1AXQA 2CUYA 2YBVA 2CQPA 1O0PA 3SSQA 2R7WA 3E8OA 3VAKA 1I3OB 5DG8A 3SFUA 2MYFA 2R2UA 3PVXA 2CJ9A 2LXFA 4KV8A 1RXOB 2LQ8A 4LF8F 3LQVA 2Y0BB 4DR7F 1HWUA 1RK8A 2M3DA 3BR8A 4RL1A 3G8QA 4CT8A 4ED1A 3PCOB 3QAEA 3RB3A 5A8WB 3H2UB 2DXFA 2NR0A 5C42A 4UOCA 4OI4A 2MJNA 2CPZA 4K5SA 1WG5A 1CLFA 3TZZA 2FIUA 4EWTA 4NXMF 3ITHB 4J9RA 1BUXA 1WACA 2DRBA 1HYSA 1EAYC 3H40A 1FDNA 1U6FA 1MN9A 3H2LA 3A8EA 2K1RA 2FYXA 2KH9A 3W2VB 3B8HA 3D54A 3QT8A 3IRXA 4AXIA 4FXVA 4J9PA 3MTKA 2QL7B 3UNGC 1TV6A 1SC6A 5HANA 2RE1A 3IM9A 1M1GA 5LMNJ 2VFRA 4V19X 6AT1B 1UA1A 1FJ7A 4FF4A 1W2BR 2VG6B 1LQ9A 4LT6A 5FLXY 1WC0A 2XS5A 4JI0F 5F0UA 1XN9A 1AZSB 4LRAA 5IM0A 2GVDA 2ALZA 4CO1A 4I69A 1SJ3P 2RU9A 3MECA 3Q83A 3MEGA 1NJIT 4F4XA 3NS7B 5DDRC 2ZBQA 1XERA 3P49B 2LFVA 4CWBA 4LQ3A 3TOQA 4ZPDA 2GJ2A 5B7WA 1F9FA 1R31A 3M8SA 2OPPB 3ZZUA 3J7YI 1HKAA 2FLOA 3T6JA 1S76D 2MQ8A 3KG4A 3C16B 3TEHB 4KO0A 4ELUA 3MM7B 1Q53A 3G8SA 4PG8A 1TFWA 1NH8A 4GKKF 2Q66A 5ETKA 1HARA 2IRUA 2L3MA 2BEFA 2JEGA 3MURP 3JAMY 3TO8A 3VVUA 3DU5A 4ECQA 2AJ2A 3F41A 3R6LB 2F40A 3CXCR 3OT9A 1FRMA 4DXLA 2DJWA 4Y2KA 2FDNA 1EQ0A 2OP5A 4JV0A 3QLHB 4AQYF 2CKWA 2HVHA 2WSCC 1EB0A 1SKRA 2IHR1 1KRPA 4CYUB 3VR1A 1JLCB 1Q95G 4YY3F 4LREA 4H4MA 4PWDA 3SQOP 2I5JB 3T1AA 4K4TA 3PV8A 4ZCKA 4X65J 2XO6A 3OL9A 1YBTA 2OEJA 4JYAJ 1F0XA 1FJEB 5JMNA 1T9YA 2WVEA 2RNEA 4L3KA 3JSMA 2XYGB 4KGZB 1EKRA 1OQ3A 1ITPA 2B7BB 3CC2S 2FHOB 4IOBA 1AUSL 3O5TB 2V9KA 3D6TB 4DHVA 2H5IB 3FSYA 3FDSA 3G82A 5KG3A 5J2PB 4DQPA 2OH2A 1UEUA 4K4UA 2QG9B 2DGXA 4HR2A 3IR7B 4KY3A 2MQQA 1AUDA 3I96A 1VDHA 3G87A 1KOOA 5K8MA 2VPZB 3PXGa 3Q0AA 1OYEA 2VFTA 2VJVA 4U7UD 3Q8PB 2YWKA 2F8EX 1IBKF 3NAHA 3V81A 1S6PB 2GS8A 1KD1T 1VMBA 1R8BA 2CG8A 1Q8BA 4NXMJ 2PO4A 4KGVB 1B7YB 1NZ8A 2AGPA 3VGTA 2BQRA 2KYXA 4YB6A 5A8RA 3KUHA 4ZPTR 2KXNB 3RB4A 1E6VA 3QBCA 1VOMA 3UCGA 4LBIA 1RSCA 4P7VA 3N6NA 3QRRA 1C2PA 5EWFA 2DRAA 1CC8A 1IR2A 1U02A 2W7OA 1BE4A 4JV1A 5KG5A 3BGRB 3DLEA 4QOTA 2VFVA 4M8LA 1FKAF 2XM3A 3PX0A 4ZVEA 2DHAA 3MCOA 1E6YA 3UD5A 2W1BA 1IR1A 2BE2A 1XR5A 2AT1B 1VCTA 1JKHB 2ZZNA 3PKMA 3OQ2A 4URSA 4CQ1A 3OFHA 1RT5B 4JI0J 2M5YA 4QR1A 3W5XA 2V68A 4JI1F 2CJYB 4WTOB 2JEJA 1WOPA 1KQSR 4U9RA 1QY7A 4BWJA 3AT1B 5B0CA 1C0TB 2B4OA 3GIIA 4MH8A 4OZ2A 1L3SA 1T9VA 4MFBA 1CQMA 2D3ZA 2HAIA 2RDDA 4ECYA 3HVAA 1TKTB 2QMXA 2X3DA 2EW9A 2H65B 2VF3A 3DGVA 2M9KA 4I7FB 2WK4A 3G86A 1WHXA 4WIIA 4GKKJ 5KOWA 2V8HA 2ACMA 4KGMA 3DLBA 3PRDA 1VBZA 5MAOA 2PD1A 5JVHQ 3SBMA 4USVA 8ATCB 4D3HA 2XNQA 5DQGA 3AA9A 1X4HA 1YKWA 1R3NA 4LR9A 2VA3A 1S49A 1FF2A 3UR0A 2VU5A 2ZE2A 2G2OA 4CLUA 2R4FA 1RU1A 3O1LA 5D6GA 3R5DA 4EUVA 2CJBA 2GO9A 2IFXA 1TVRB 3GR1A 1U6ZA 1I6JA 2H48B 1RABB 4F3OA 1AFJA 2E5LJ 3POTA 2IJRA 4UT4A 2X1BA 2VODA 1PBAA 2HSEB 3W8GA 2FLNA 3GV7B 2J8SA 2HHSA 2QLJB 3RW7A 2AD9A 1ZTTA 2R8GA 2WHOA 3Q8RB 3DOMA 1H2TZ 3DXSX 2UUCF 5HVFA 1IKYB 1OYDA 3N6MA 5B08A 4DV3J 2H54B 4UY8T 2P6SA 4LSLA 2XYPB 1RACB 4WZQA 1MW7A 5HL7Q 5KFBA 2QSWA 3UWTA 3G6VA 2DO0A 2DGOA 4OYBA 2ZH2A 1EETB 3HZEA 4DR2J 2KT5A 2B7CB 1CG2A 1JX4A 1KDNA 1U4BA 2WOMB 4ID5B 4KSEB 5J2QA 4X4QA 5KFUA 1TUWA 3C19A 1IBKJ 2EI5A 4Y0FA 5IWAF 3S6EA 3M8WA 1Q16B 1NSPA 2QLXA 3KLFB 2PMWA 3T5HA 4P73A 2HFZA 4NCAA 2XSJA 2DNYA 2P8IA 2Z56B 3S01A 4ENOA 2ASLA 2MQNA 2ZBPA 4BCAA 2F4VJ 1N88A 5GMEA 2FY8A 2HURA 1YRTA 3OUYA 4F04B 3SI8A 3IG1B 3M1VA 2KG1A 4ZA1A 1WG1A 3MPUB 4Y3CA 3U1MA 3J81U 3G6XA 3ZTSA 1UFLA 3ILLA 3LUYA 5B09A 3I32A 1CULB 1YK9A 2NCKL 1HQEA 1PYTA 3T41A 1SJQA 2VPYB 2DD8S 3OTDA 4YR3A 1QVGR 1VQMS 3NMRA 5SZTA 4YFUA 3GZ7A 4DL7A 5C25A 2C42A 1SB6A 3R2CJ 1V3ZA 4RBUA 4JI7J 2E5JA 1P6TA 1H2UX 1PGZA 2EKNA 3R7BB 4WF9Q 2CQ4A 3C15A 2R7RA 3V6JA 2JHEA 3ZZYA 3VAMA 1S99A 1PYSB 4EO6A 4OZ3A 2YTCA 3CJSA 4PQUB 2DNQA 3GIRA 4ZITA 4M5IA 4WXWA 3B78A 4C2MA 3MMCA 2V2ZA 2QE5A 1QTNB 1NJYA 3PKYA 2KZZA 1YJ7A 1TK5A 3Q8VA 1VR6A 2DK2A 5B0DA 4IFYB 2QL5B 2UV8G 3D0GE 3M8RA 1Q86T 4R8UA 3D0HE 2K8GA 2DBBA 4HKQA 1PJ7A 1FD8A 1H74A 2VQFJ 1VRUA 1IBLJ 4OI3A 5ETPA 1RCOB 4EEYA 1OSCA 5F8GA 4B17A 3BKFA 1X9SA 3TA0A 1HLWA 4TKTA 3VQSA 3RR7A 2G0CA 3C66A 4M5DA 1PSDA 4C8NA 5L46A 3PYGA 1M0SA 4KV8B 1RQ0A 1R0BG 2H4WB 4LJMA 5G0RA 4I2QA 1MMLA 1RHRB 2AX1A 2FB0A 1NDLA 2LMIA 2HWHA 1GMWD 4ANEA 3PG9A 4ZCMA 3KOAA 5C42B 1WC1A 3KXDA 5IT9Y 2YH1A 1NK4A 4ZN3A 3CC4S 2E9RX 2NXCA 4C8OA 4IRCA 4DLEA 2YPZA 2DNRA 1MWZA 2UUCJ 3IGVA 1HWKA 1IJFB 3UR3C 4A4JA 1HYSB 4LMZA 2AU0A 5JXSA 2IDLA 2K1RB 4DV5F 1FA0A 3CCRS 4J91A 3DOKA 2KO1A 2HW3A 5HQ8A 1RTIA 3IRXB 3TAQA 4Y6IA 2HFUA 4QIVA 1EJ7L 3SCJE 2CDQA 1S9GB 3AJDA 4MKBA 1TV6B 1A0OB 3L4BC 3Q8YA 1RADB 3HI9A 1U48A 5IWAJ 2V9WA 3D3BJ 2YWHA 4HI2A 4K7QA 1FWLA 2NPFA 2DGWA 3HJFA 4GVLA 1SVDA 1LNQA 5HK4A 2X3GA 1U26A 2MEWA 4LFAJ 2B9XA 2DGVA 1HQUA 2AQ4A 2D69A 2XMVA 4OZLA 5MLCV 3RYLA 2IPOB 1K0VA 4L6V3 1YJVA 3WDOA 2Y8YA 4JI5J 5IM0B 2GVDB 4RX6A 3MECB 4AT1B 3MEGB 2MKCA 2R7VA 1M5KC 5F41A 3MTJA 1GX6A 1RU2A 1TL3A 3SCKE 3CCES 1PO6A 4A8XA 5LJ5Y 1U1MA 2CIMA 1KFDA 2XI2A 1X7VA 4TNOA 3H5XA 4KO0B 1QSLA 4A8KA 1P8GA 4XDDA 3DYAA 2ZBRA 3GP9A 3CEDA 2A0FB 1V3RA 3CJ4A 3TZXA 3DLLQ 2XCAA 3W65A 4X66J 1BWVA 2R8HA 5L8RC 1SIWB 3KUEA 4K4YA 1KNZA 4HT5A 3F44A 2L08A 3WQPA 3FRYA 4M5HA 1FRJA 3GLJA 1QAXA 2P6TA 1FCAA 1MMNA 3UDCA 4CIOA 2MLYA 3S1TA 4DFMA 3R1LA 5D8HB 1MWQA 4OIXA 3AQPA 4YQWA 3A1YG 3GFYA 3EXYA 2DNNA 4ES3A 1A7GE 4PCQA 2CNLB 4H4MB 4PWDB 1RI7A 1VC6A 2V8VA 2CNOB 1RWKB 4P71A 3HKWA 3JSMB 2ACYA 1RBLA 4ZVTB 2ZUAA 3M8ZA 2AGQA 3V6HA 4K8RA 2LVWA 4KYZA 3K57A 5F8IA 2H9ZA 2Z0GA 5EX3A 2CAJA 3FSXA 1WEXA 2CVEA 5L1IA 4CP5A 3CJ0A 4ZP9A 3TUJC 5M2UA 4GKJF 3G82B 3MR2A 2GJFA 2AV5A 3MMBA 3IMQJ 1H6KX 2GMJA 2MJUA 4OYOA 1WC4A 1S0OA 4ECUA 3RU0A 5AT1B 1XMOF 1S5ZA 1WEYA 2FHJD 5DLGA 1T9UA 1WI6A 3J7AN 4RW7A 2ZD1A 4YHHF 3W63A 3MPDA 1W2IA 1NKCA 3OR1A 3AJ1A 1NDPA 2GAGC 3V81B 2VOPA 2ZZMA 3GCWP 3KWMA 2JFKA 2DISA 4RUBA 5C2CA 2B9EA 7FD1A 1XEZA 2HVZA 1GK8A 4AL6A 1F3VA 3D7SB 1S9EA 5J1PA 2OTJS 4DV5J 3PNIA 4I2PA 1E6VB 4NLVA 3BO2A 5DLFA 2C2DA 4YB7A 2H3EB 3NOGA 1EP4A 3BPSP 2B6AA 2EK1A 3DLEB 2E1CA 4EO8A 1QLNA 2FLPA 2GZOA 4OZNA 4G1QA 2YKAA 3NCRA 2G4BA 1JNRB 1WHYA 5HLFA 4ZLPA 1T0TV 5GAEI 2YH0A 4JI6F 1E6YB 2BE2B 4X4TA 5HI7A 3IRWP 2MTLA 2MSTA 4NLRA 2JRSA 1NPPA 3I9ZA 4DV0J 2LA6A 5DG7A 3MM9A 1N5VA 3AODA 4MFBB 4FYVB 2O67A 3K59A 8RUCA 1AA1B 5GAHI 3UN3A 1RE1B 3EJMA 2HG4A 2MZJA 1VLYA 2L41A 4DF8A 2KJWA 2XMJA 1S12A 2IVFB 3TA2A 2NS1B 5KG0A 2XBPA 3DRPA 2DT9A 3RRKA 4IFVA 1KLMA 2YKOA 1H7WA 1T8EA 5CZXA 4WFYA 4ICLA 4FYXB 2F7VA 2LEAA 3EDRB 2RIJA 1G1XA 2CWXA 5HMZA 2P5VA 3NCPA 5D0HA 2FJVA 4BHQA 5F8JA 2FC9A 4TYAA 4DL3A 3J80U 4WE1A 1IBMF 2ZE2B 4EBDA 3LGNA 2Q3PA 2FHMA 2YVSA 2FZGB 1RTHA 2CQBA 5DM6Q 2DGSA 4WFXA 1XBWA 4WPAA 4L73A 3POTB 3O6QA 4KJIA 2LKZA 4TU7A 3BREA 4ED5A 4O3QA 4QWAA 4WCEQ 1NPRA 4USTA 4KC5A 2VC1A 2EFPA 2YNFA 2W8LA 1UJ4A 3CIMA 1BLUA 4QWBA 4UOHA 3CCMS 3DOMB 4O0NA 1RUSA 3M7VA 1Z1ZA 2OO4A 4ES2A 2ZH5A 3GFXA 4LSLB 2HHXA 2QT7A 3EZOA 2BVZA 1XMOJ 4YB5A 1T9TA 2LA4A 2OEKA 1RHJB 1LWEB 3WX8A 2RUSA 3ETOA 5J2QB 4U7UK 4RWXA 2GX8A 2DXDA 2HPUA 3J81Y 2Q6BA 1VC0A 3TARA 3IXQA 3W64A 1T94A 1RAEB 1RZMA 1RWNB 4ERDA 4PUOA 2XSJB 3T9NA 5J2NA 2MPUA 3NXZA 1ZM3A 4ED4A 1QAYA 3IGNA 1LKZA 3CCLS 5DRKA 3MM8A 1S0VA 1FNMA 3RTVA 3EVOA 2P9GA 2AW0A 3HHLD 1BHNA 3TVKA 4YS2A 3OUYB 2OPQA 1RP5A 3FGVA 3TAMB 3M1VB 4P10A 1VQ6S 4I64A 3AXMA 4EI2A 3DN9A 1MU2A 2ATLA 3LWLA 3HM9A 3R5AA 4HLBA 4WYWA 1R8AA 2B3TB 4LRDA 4ZVHA 4O4GA 4NLPA 1HQEB 3D1HA 2W4PA 2ZEJA 5KG4A 3CMES 3M6XA 2C2OB 1IUJA 2NXEA 1Y5NB 3BSOA 3EVMA 5KT7A 1HBUA 4NLUA 5C25B 4Y2CA 2PEHA 4EK2A 1AT1B 2ZKTA 3GYNA 2CQCA 2DIVA 4JI2J 3C15B 4KHPF 2HQIA 3CJTA 2WRMA 4ZCLA 3BGFA 2IM0A 4B02A 3KLVA 2X1FA 3W5ZA 4BC9A 2XS7A 4TYBA 5HROA 1A9NB 1SH0A 1QAJA 4OV6A 3L7OA 3MMCB 2BMBA 2R7XA 3NNCA 2B8PA 4OZ0A 4RW9A 4OI6A 1KR4A 2GNKA 1XIQA 3JTPA 4R8UB 5F3ZA 2K06A 2ZHOA 3B82A 3MUTP 4I4BA 1GX5A 1RCXB 1VRUB 1G2EA 1X4AA 2JVRA 3H98A 1LK7A 1ZOTA 4PG6A 3G8TA 4RNOA 3N01A 1D0EA 3I0RA 4M5DB 4U95A 3MXHP 3O2IA 1LV5A 3IAS9 5G0RB 1YLXA 4TQSA 4I2QB 1ZS6A 4MAKA 1XTZA 1TMJA 2DY1A 4DN9A 1K44A 3T1HJ 5HQMA 3CNQP 1GMVA 4N5SA 1HPZA 1WSRA 4NLXA 4IG0A 2X7IA 4DI6A 3P6YC 3GQCA 1VI7A 4NI2A 2V0NA 4KFBA 3GSIA 3U02A 1FVQA 3D9BA 2YWEA 4URQU 2GO8A 1HNXF 3DOKB 2GCFA 1S77D 3A3OB 3CD6S 1RTIB 2OELA 3HFZB 4FVCA 4AYBD 3I9V9 1TL7A 4RBTA 4X64F 4DR6F 4I6YA 5T41A 4C97A 1N6QB 3BH6B 3KNGA 2P2CB 4N8OA 1VBXA 4DFKA 4N8NA 1XC9A 4B9LA 2HYIB 1HQUB 3OSPA 4PG5A 5HJYA 1JXLA 3RRHA 3H25A 1NEEA 3CJKA 1B3TA 1VLOA 1F2HA 4DU8A 2WZ1A 5B0GA 4DL4A 2BKNA 3GV8B 5KFGA 2VG5A 1NDCA 2OJ3A 1OY8A 2DEJA 1TL3B 2GA7A 5HAOA 1EQMA 5GADU 2CJAA 2GVZA 3SQGA 4ANCA 1VQPS 5D0EA 1N36J 1CSJA 3PR5B 3F73A 2CPYA 1URRA 3FSIA 3DYAB 2F5GA 4J7CA 3OTBA 2GV1A 2GFFA 2H4YB 2M4MA 3AOCA 4FDFA 2V6AA 3M8YA 1NXIA 2HRTA 2BBEA 1U0HA 2IMOA 3PIOQ 4DV2F 2MKYA 3KK1A 4IUFA 2WSEC 1KTQA 3BJYA 3AD8C 4WK1A 2FHJA 1Q5YA 1JJ4A 3D3CJ 3D68A 2NXNA 4ED6A 1VJQA 5K8OA 3VF0B 3GG0A 2MKSA 2FJWA 4ZVOB 3N4WA 2ZJRQ 4WTYA 3B6BA 3I4PA 4O3NA 2WCXA 3NGDA 4A46A 4QIWD 1WJ9A 3NWGA 1FJCA 2BACA 1M90T 2Y1RI 2K7JA 3W9HA 1ZM4A 3D6MB 5DG9A 3PHTA 1XNQJ 2EPIA 1TR0A 4P2MA 3PW2A 4PXCA 1RAIB 2L9WA 2Y1IA 4PZVA 2JZ5A 4ED0A 5GAGI 4G1PA 3EYZA 1FEHA 6FD1A 5DZ7A 1RAHB 2XTJP 2XMMA 3MMBB 3MEEA 2APOA 4NOHA 2I6WA 1N48A 4IOAQ 4QQBA 1VHFA 1X5SA 2R8IA 2W01A 1VK8A 4ZN1A 1KEKA 1D09B 1XK8A 4AE5A 3FMBA 4OHWA 4RW7B 2ZD1B 4M1KA 2UUWA 1WEZA 3KJFB 3DHXA 2F1FA 2LQBA 3OR1B 2GGPA 4Q0BA 2IY5B 3HLUA 4FPRA 2BA9A 2ZM6F 3K5NA 1MWYA 2DR6A 3MCMA 1PBUA 3BQ1A 1LW2A 2W9AA 1S1WA 2IRYA 4RPFA 1CJTA 2Z2LA 2DHXA 2JL9A 4P7TA 9RUBA 3VAGA 2CPJA 1S9EB 3N6LA 4H4KA 2ZC4A 2DNZA 3DC2A 2RHQB 3PO5A 4I2PB 3EPGA 3JYTA 2RQMA 1RT4A 3U1LA 2VFUA 4BWMA 4C3LA 4DPUA 2MKKA 2ZOGA 3FEYB 1EP4B 2N82B 2B6AB 4K4XA 3S7RA 3SV4A 1RT2A 5HLFB 1D9AA 4NEZA 3ZZPA 3H4BA 4I6AA 4G6VB 4HTIA 4F4AA 4RZRA 2Z58B 4C8KA 1GXUA 4NMXA 3HSJA 5IZHA 3TUZC 4U8YA 2CQ0A 3QIPA 2ZWPA 4X4NA 4F26A 4X4UA 2OMOA 4J9QA 3TP2A 4OLOA 1WELA 2XWYA 3MM9B 1RAJA 4DZ6A 3LGMA 1SH3A 2IJNA 1YIJS 2B4UA 3J80Y 2X1AA 2DXEA 4TLRA 1URNA 4DPXA 2XWXA 4DUYJ 4RO0A 2GQCA 3UCUP 3J7A1 4DPYA 3DRPB 4TU8A 4IFVB 1EZZB 4CM2A 1KLMB 4QJVA 4DSKA 1YDLA 4ICLB 1F5BA 4DV1F 1I94F 3E3XA 3GWCA 2WONA 4URGA 2JX2A 4DV2J 1TKZA 3GMGA 3L7PA 2C2NA 2AF6A 2JSXA 4FF3A 4FYWB 1J5EF 4QR0A 3F56A 3GTYX 3JS9A 3A8JA 5KFTA 1N52B 4TN2A 1TQLA 1VQ8S 1RLCL 1Q8LA 2DH7A 1UPPA 4WE1B 2MZ1A 2G0JA 3UO0A 2Q1LA 4LBHA 5BYRA 1RTHB 3KDOA 4IR9A 1RB0A 5ETVA 6FDRA 4WKRA 4TY9A 2Y3YA 3C3LA 5ADZA 4IRDA 1T02A 2DY9A 4DR1F 2V4QA 2U1AA 4LR8A 3IC1A 1KVJA 2C2ZB 3JAMU 1NK5A 1UEVA 4LF1A 3RAMA 2J9EA 2YNFB 2J7UA 3TAPA 3FZ2A 5A6WA 3HHLA 2LEPA 2ROEA 2YNHA 1JJHA 3I56S 2RDIA 4QWDA 4HH0A 4Q5VA 3H5UA 1GT8A 1ZAWA 4DZDA 3CDBA 5E3PA 3BYPA 1Q7LB 4C3MA 3NOCA 4K2XA 4QW8A 5KFSA 4X4OA 1T11A 4EYHB 1K73T 3BS9A 2QO3A 5HO4A 2MGZA 2LDYA 2ZM6J 5IV3A 1FT8A 1DQAA 3KMQA 1I51B 1TK8A 4PUOB 5J2NB 3AH6A 2W7AA 3KG1A 3D66A 3V4IA 1BWEA 1FE4A 2Z57B 2DR8A 3CJQA 3MM8B 3FC9A 3PW5A 4KH1B 5KFHA 1YZ7A 3IN5A 1WC3A 4IH7A 2IBOA 1FNOA 2G2YA 3FQLA 2BJ8A 1X31C 1YJUA 2IMWP 1MU2B 1UVLA 5KFCA 1AFIA 2ZOMA 2FZKB 2NXUA 1WHWA 4WWSA 2UXDF 2KT2A 4O4GB 2J5AA 1YTYA 2GC8A 3I0SA 2DNHA 3UI3A 5KFPA 3MUMP 2BXJA 3TZWA 4CLYA 2HMIA 3Q23A 4KHMA 2XZDB 3CTRA 1HBUB 4QWCA 4N7TA 3OBIA 4C8MA 1N33J 1XJWB 4O3RA 3J7Z5 2B4PA 2DHHA 4IG3A 4UOFA 4E0DA 2FY1A 2C2EA 4LF6F 1MSWD 3G4SS 1XR6A 3RJMB 1UWAA 4M5NA 1GH8A 3H5SA 4NLGA 1A6LA 1FRHA 1OMSA 1RTDA 5HQLA 3T3FA 3GYGA 3NNAA 3OTOJ 5HROB 5L38A 4WFZA 1U2RA 3MOZA 4RJVA 2W2NP 2OFHX 1GFWB 4DV1J 1I94J 3D0IE 1I5OB 4RW9B 2GMLA 4C7QA 2VASA 2E66A 1RA7A 4P2FA 2MHEA 1PCAA 2E5HA 5D3GA 4K2JA 1J5EJ 4ECTA 3JQMA 3QFWA 2XO7A 4B3MF 4KPCA 4UQGA 1CPZA 3IS9A 4PWWA 5EUHA 4YOEA 1LK5A 2R2RA 3UD3P 1FERA 5KFQA 1FI4A 5D4LA 2YQ1A 2VIHA 2WBMA 3RBEA 3I0RB 1WTFA 1HIYA 2R2SA 2NZCA 2R8KA 4OMFG 5KOXA 1WHVA 3TR5A 4BBYA 2ROPA 4LF5J 2MLXA 3FZBA 1PC4A 5SUHA 4HEA9 3SZ2A 4ZLNA 4YR2A 2KM8C 2C2KB 1JLQA 4TVAB 3G6YA 1HPZB 5I42A 1RT6A 4Z7CA 3OJSA 2Z2ZA 4DDFA 3AY0A 4OHXA 4IG0B 2J0WA 4FN5A 1PKUA 1D8ZA 3MCSA 3AOAA 4HYKA 4NI2B 2V94A 1Y00A 4KFBB 3A8IA 2XB2D 3ISND 5U47A 3GB0A 2ILZA 3A3PB 1B64A 2YKNA 3NGUA 2ZH1A 2QZ8A 1TL7B 5EX0A 5H9FJ 3DLHA 3OW2R 5KG1A 2CPFA 1NK7A 2OSRA 3HK2A 3Q2SC 2QA4S 3EE3A 3QO9A 4P6QA 2M52A 3HHEA 5DS7A 2FVPA 4DX6A 5DQIA 1IWGA 2FHKA 3KJQB 1OS5A 4DLGA 3HKZD 2W9BA 4PPZA 2D7SA 1EHWA 2QGFB 4DEZA 4NYPA 5EGYA 1U1KA 5KT3A 2ZVSA 2XI3A 3KMSA 3QPIA 3CJKB 3CULA 4Z7YA 4XDCA 1BY9A 4F3QA 2VG5B 2ZWOA 2VUGA 1K8AT 2UUBF 1AB8A 3SQGB 2CZ9A 3BH7B 2ZKUA 2PFDA 1RAAB 1S0NA 1NK6A 1FKPA 2KJVA 2UXDJ 3FBEA 2LQ9A 1JLGA 2XYHB 5IQ6A 2AP6A 4IR1A 3SFGA 2XGQA 1CS4A 4CO4A 4C0OC 1VFJA 1Y9OA 1X9MA 3VQTA 1U2FA 3TJ9A 2ZVIA 3AJ2A 1U0HB 1RGVA 2LQJA 4OYPA 3CF5Q 3KK1B 4OHYA 2FUG9 4J9OA 4W4MA 1SC4B 5L9XA 4LF6J 2JDJA 4OV1A 1FX2A 3IWNC 2KM8B 3PFEA 4ZOSA 1CJVB 4W92B 5AE2A 4Y65A 4O3SA 4PXDA 3EVWA 4X4SA 1UAWA 2E1MC 4GMKA 1KQGB 3CO0P 2NZ4A 1N4LA 5D78A 4B08A 9ATCB 3FKBA 1MMDA 1O6XA 4X65F 4JYAF 3H20A 1ULRA 1QD1A 1RISA 3TX0A 3KHRA 4P74A 2VBWA 1WC5A 5AE3A 5KT6A 4RNHA 4B3MJ 1UWBA 4O44A 1EARA 3DMJA 1IBCB 3PFOA 3DFEA 4IH5A 1NNDA 3RUBL 4YP3A 3GV5B 1JLBA 3T5JA 4C0HA 5IC4B 4M63A 2HQFA 5A0YA 4WU2A 4FXDA 5RUBA 1IN0A 3H0PA 3PYEA 3MEEB 4CO5A 4ITSA 1WI8A 3PY8A 4OYZA 3E01A 1B4SA 1YHQS 2ILYA 4U7CA 1D8YA 1VQYA 3UCZP 1H3DA 2GGPB 1ELOA 4Q0BB 3QATA 3SCLE 2KN4A 1QTMA 3UDVA 4Y2IA 3OFFA 5J2MA 2IVYA 2RDJA 1F9EB 4DPTA 5GVQA 2OMLA 1LW2B 1OO0B 4N47A 2K3KA 1S1WB 3CDUA 4B9TA 1CJTB 2B56A 2DGTA 1Z2ZA 4Y28C 2XULA 1RHMB 4RW4A 3ZZOA 2YWFA 2UUAJ 3W3SA 5CHCB 4OZ1A 4K59A 2O3DA 3JYTB 3Q2TC 3FQKA 3GG1A 5KFWA 3HHLC 5H1SV 4IO1A 4OX9J 2C1EB 1S7IA 4HDGA 3FRZA 1O5JA 2WVBA 4Q43A 3HT0A 5IT9U 4PR6A 3A13A 1S1UA 5F8LA 3PR4A 4MK9A 4Y2MA 3R7SB 3EDQB 4ANDA 1N34J 1RT2B 2A2DA 4FKXA 4RLEA 4KE5A 5J1NA 5M2PA 2FGOA 2BDPA 3BQ0A 4ZPVR 2V63A 5B0AA 1JLEA 4AFFA 1RAGB 4F67A 3FUYA 3TRGA 3QIPB 1VK3A 4EBCA 3KYLA 1NJXA 2UUBJ 5DETA 5C7PA 4DL6A 3K17A 1S72S 2UV8A 3CC7S 1QE1A 1P1TA 3ETMA 1TL4A 2OSQA 5KTQA 2NUHA 4ED2A 1OIAA 4Q8EA 2O66A 3T6BA 1X0PA 4J90A 2BM0A 2HQCA 2WVDA 3Q8QB 3D6FB 4DU7A 4XPCA 2MKIA 2WONB 3MMAA 1TKZB 2UXBF 4I1TA 3QRQA 2VV5A 4CLWA 1REVA 1S1XA 3BKTA 1QSSA 1AYEA 1RJJA 3JQJA 1HBNA 2EC0A 1HHTP 2N7CA 2CPXA 3OD2A 1FRXA 1IJEB 1L3TA 2UXCJ 2MHNA 3T5LA 1KLNA 2E5LF 4ZPWR 2NYHA 3W7BA 5E7OB 2EXUA 5DZ6A 4O0IA 1RWOB 4P2SA 4MK8A 4PG4A 3KK3A 3I87A 4W98A 2F63A 4K4WA 5DM7Q 3HVWA 5F8NA 1FJGJ 3CMQA 4H54A 2RS2A 4CLKA 2CYYA 4MMOA 1U6BA 3HHLB 2CXEA 2YNHB 2AZ1A 1NPKA 4X4RA 4DV3F 2DEIA 2LU2A 2W4CA 2JFDA 2WVFA 3C6TA 3BF4A 1L3VA 1U8WA 2DNLA 1KVKA 4LF7F 1NRKA 1RWMB
chains in the Genus database with same CATH topology
2QT7A 2RRNA 5B0FA 2NLWA 3PEJA 4XPEA 5I3UB 1DARA 5I3PA 5F8MA 4GO5X 2D74B 2CQIA 2BRLA 4DR2F 5DGBA 1U1PA 1HNIA 3NBPB 2KT3A 3VCDA 3DDKA 3NP5A 4Q2LA 5KFIA 4RNFA 1SKWA 1X4GA 2BVZA 4YB5A 4Q7AA 1EETA 2R7UA 2LA4A 2M7SA 3MM6B 1DZ5A 3MPYA 2DCLA 1LWEB 5DQHA 3PW7A 4ID8A 4HHJA 1U47A 2WOMA 3LP2B 2HWTA 3ETOA 5ITHA 5J2QB 3CCVS 4U7UK 4ID5A 2MKHA 4RWXA 3QMQA 2YQ3A 5GAGU 2GX8A 2W24A 4WZMA 4DQQA 1GTHA 2PGCA 2HPUA 1D9DA 2EBEA 2MGZB 3IWXA 2Q6BA 1FDBA 3J81Y 1VC0A 3TARA 1GXLA 2XMTA 2AYBA 2WSFC 3IXQA 1T94A 3M8QB 1OPIA 3PRBA 2HGNA 2RKIB 3MWBA 3KLFA 5FDLA 1XMBA 2FPHX 5LMNF 4ERDA 2HHWA 4TY8A 4PUOA 2XSJB 2RU3A 1LXJA 1MROB 3T9NA 5J2NA 2ROGA 4HVZA 2F4VF 2MPUA 2J0XA 3O8WA 1M5HA 1C1BB 1ZM3A 2HLUA 4IQXA 2IJFA 3MM5A 4NWBA 4RNNA 1N6QA 1QAYA 3MOJB 3IGNA 4A8YA 1YJNS 1C4AA 3H4DA 1LKZA 3VZIA 4U67Q 1JLFB 2BW2A 1Y7PA 2GHVC 3CCLS 2CQHA 2ABYA 3DXBA 5DRKA 5BYSA 3R27A 3HP6A 3MM8A 1X5OA 1SUQA 1U49A 1S0VA 1FNMA 2OIHA 5EDWA 4QYZJ 3RTVA 3ULHA 2P9GA 3TYTA 1M5VC 1B0PA 3IO1A 4J9NA 2AW0A 2RSQA 3HHLD 3IR6B 3NMAA 4IDKB 2WW8A 2XMWA 3OTCA 3TVKA 5KFDA 1XMQF 1RWUA 2JLEA 3ZC4A 4PKDB 3MD1A 3OUYB 2J7WA 3DLJA 2OPQA 1RP5A 2Q6CA 3BM7A 4RUCA 1SI9A 2ASDA 3M30A 2AYMA 3DOLB 3FGVA 4NL5A 2D3OR 3Q24A 2RVJA 3TAMB 2KYZA 2PA8D 3CD5A 3M1VB 4G1QB 3OFEA 4R25A 3TVZA 1XWLA 1S6UA 3IG1A 2LXUA 1LW0A 2AJQA 3HXMA 1VQ6S 4USHA 1T05A 3NS5A 2XY6A 3FFIA 4I64A 4ES1A 2VBZA 4Z37A 2AJ0A 3DN9A 1YG0A 3AAWB 1DTTA 1R7IA 1MU2A 1JLEB 2DNMA 3LP0B 2ATLA 3LWLA 3HM9A 2M2BA 1JXEA 3BN7A 5AE1A 3R5AA 4HLBA 4Y2AA 3CCZA 3M8PA 5A6PA 4WYWA 3RRGA 3IFEA 1SIZA 1VIOA 1X4EA 1R8AA 1GXTA 2HHPA 3M9MB 1LWCB 1NAQA 2B3TB 2JLFA 1VRTA 2KHDA 3THTA 3G9CA 3DRXA 4ZVHA 2BQUA 4O4GA 4NLPA 3GYXB 1HQEB 3C6UA 1HI8A 3D1HA 3KLGB 2UZAA 2W4PA 4NLSA 5HMXA 3I0SB 5KG4A 3CMES 2EFQA 1JNZB 2R8JA 2VOOA 4NYOA 4CO0A 3I5CA 4LFBF 2QV6A 3S8SA 3M6XA 1ZAXA 1IKVA 4I67A 1NKBA 1R6YA 1X4BA 4ELVA 2HMIB