3TAMB

Crystal structure of hiv-1 reverse transcriptase (k103n mutant) in complex with inhibitor m06
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
424
structure length
403
Chain Sequence
IETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Design and synthesis of pyridone inhibitors of non-nucleoside reverse transcriptase.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Transferase/transferase inhibitor
molecule keywords Reverse transcriptase/ribonuclease H
total genus 106
structure length 403
sequence length 424
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2011-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3tamB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3tamB03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3tamB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3tamB04
1T05A 2BQRA 5CYQA 1T05B 3MFIA 1HQEB 3MF5A 2WOMB 1TQLA 3PJWA 3Q8PB 2RF2B 5DG8A 1C1BA 3FQKA 2AX1A 2ASDA 2BE2A 1KLMA 4M95A 4MK7A 1LWCA 3KK3A 2D7SA 4F50A 3KLEA 4O4RA 5L9XA 3TAMA 3H4DA 4MFBB 4H4MB 5EWEA 4MIBA 4QWCA 2W9BB 3RB4A 3KMQA 5L1IA 1RT2B 3M8QA 4Q0BA 5J1EA 1MU2B 1BQNB 1K1QA 1S1TB 4ICLA 4O4GA 5J2NB 4KAIA 2W9AA 1RYSA 1QE1A 3QYYA 4KB7A 4ID5B 2IBKA 1RT1B 4ECSA 4J9PA 1TL3B 4IDKA 3M9NB 3LANA 5DGAA 1BQMB 5HBMB 1N5YA 4O3RA 4DL6A 5KFOA 1RT5A 1NHUA 4H4OA 2RKIB 2OPSB 2RKIA 2JEJA 4Q45A 3DOLB 2ASLA 3PW2A 2RDIA 3DLKA 1S49A 4F4ZA 3LP0A 2FVCA 4LQ3A 1RDRA 5C25A 5KFVA 1R0AA 4ZPBA 3IRXA 1S0NA 2FLPA 4WYLA 3V81A 4NYZA 3MR6A 2IM2A 1DTQA 5KT7A 4ECWA 2HWHA 4IG0B 1TKTA 4Y34A 4RNFA 5KT2A 2B43A 2WB4A 4DL4A 3KK3B 2QV6A 1LWCB 3M8PB 4WXOA 4J9QA 3JYTB 2YNFA 3PHEA 2JC0A 4DL7A 4RW4A 2UUWA 2C2EA 2XC9A 1S4FA 1C2PA 4JUZA 5D3GB 4NLRA 4WFYA 4GC6A 4TN2A 4FBUA 4IKAA 2WCXA 5K14B 3PW0A 4DL2A 3CJ3A 4NLWA 3CWJA 1TVRB 2WOMA 1NHVA 1SV5B 1FKPB 1SV5A 4KSEB 2R2TA 1RTDA 2YKMA 3HVTB 4WYWA 4ED1A 3QIPA 1S6PB 3I0SB 2HMIB 1EETB 3KOAA 4K4UA 3GILA 4X2BA 3KLFA 1SH0A 1HNVA 3DM2A 2R2UA 4KHMA 5KFDA 2AGPA 3BSAA 4LSNB 5HP1B 3M8PA 4IG3B 2E9TA 3DOKA 1JLGB 5KG2A 4RW4B 4TQSA 4NLSA 4RW6A 1JLBB 4J9OA 1JLBA 2B6AA 2WONB 1DTTA 1SH3A 3V81B 2IMWP 4EYHB 3IRXB 3E01B 4PWDB 4IG0A 1XR6A 3MEEA 4JV1A 2YKNA 5KG7A 2E9ZA 1S48A 3Q8RB 1KHVA 3KK2B 1HNIB 3BGRB 2XGPA 4F4WA 4TYAA 4ECVA 1TVRA 1FK9B 4MK8A 4DG1A 3D28A 3HVTA 3CO9A 3CJ0A 1ZTWA 4KV8A 2I5JA 4MKAA 1IKXB 5HROB 4H4OB 4NCGA 5K14A 4MIAA 2IM0A 3KLVA 4IFVA 1JLEA 3LP1B 3MTKA 1TL1A 5KFXA 4WE1B 4NLDA 5KFQA 3I0RA 2BANB 1IKVA 4RW9B 1JIHA 3H98A 4ICLB 4O4GB 4R0EA 3LP2A 3GV8B 3H5XA 3SI8A 1TL3A 5DLFA 2XI3A 3NKYA 2C2RA 4TYBA 1DTQB 3GQCA 4G3IA 3MR5A 3T5KA 1MU2A 3V6KA 3FSIA 5J2QA 4ECRA 1RYRA 2UUTA 5J2PB 1TKTB 3PW4A 2UVVA 1GX6A 4U6PA 5J2PA 5DLGA 3FFIB 3DRSA 4NLYA 4QWBA 3G6YA 3MEGB 3TAMB 4NLTA 1S97A 3OHBA 2B5JA 1IKYA 1C0UA 2IC3B 1T94A 3T1AA 1S9EB 4LSLA 4QW8A 4NCGB 4F4XA 1LWFB 3LP1A 5DQGA 4DL5A 3PW5A 4KHRA 1VRUB 2QE5A 3QGHA 2XCAA 3CJ2A 4RU9A 2YNIA 4J9RA 4YR3A 3UQSA 2R8IA 2VG6A 4I7FA 1TKZA 3D5MA 3MR2A 3QGGA 4IDKB 3PVXA 3VQSA 3PR5B 5F8GA 4QWDA 3KHGA 5KFPA 4EO6A 3G6VA 1KHWA 2XWYA 4ECZA 2W9BA 1S1WA 4R5PB 2V4QA 3KLGA 1HARA 3FFIA 4RNOA 3T5HA 1LW2B 1T3NA 2R8GA 5F8HA 3BSNA 4IH5A 3MECA 2WTFA 2W8LA 2C22A 2DPIA 5F8NA 2AWZA 4H4MA 4MFBA 2HNZA 2B6AB 2IJNA 3IG1A 2XGQA 3HKWA 3KLFB 3DLGA 5C5JA 1KLMB 4NLOA 2DPJA 3QZ8A 1S9GA 4R8UB 1FKPA 1RTDB 1TKZB 3H5SA 5I42B 2VG6B 3ICLA 4H54A 4ZMMA 5KFNA 3QIPB 2VG5A 3HVWA 1IKXA 5HROA 1WNEA 3RBEA 4ZHRA 1JKHB 5JXSA 4FBTA 1N6QB 4NRTA 5J2MA 1ZETA 5JUMA 2JEGA 4K4YA 3EZUA 1VRTA 5KFRA 3OSNA 3MR3A 1S6QB 1TV6A 2WK4A 4RNHA 2BRLA 4K50A 3V4IB 5DG9A 1DTTB 1RT3B 5KFZA 5EWFA 5DG7A 3C6TB 5T14A 3KNAA 4OL8A 4B3OA 4IH6A 2ILZA 2YNHB 5J2QB 4DEZA 4ECYA 2JEIA 5EUHA 3MFHA 4FS2A 1JLAB 5HP1A 3I5CA 1C1CA 3RBDA 3NL0A 3LALA 3BQ0A 1LW2A 1CSJA 3G6XA 4F4YA 4ED2A 3N6NA 1TKXB 3LAMA 3HHKA 3LP2B 3KLIA 1RA6A 5DQIA 1DLOB 1HMVA 1T03A 4I2PB 1IKWA 1LWEA 1RTIB 3C6UA 3KLHA 2W9CA 4Q8EA 3BR9A 1LWFA 1K1SA 4IFYB 5KFGA 4TQRA 2YNIB 4WFXA 2ALZA 5KFYA 3NBPA 2F8EX 3NGDA 1W25A 3G86A 1RT1A 4NZ0A 4Q44A 4DG1B 2V9WA 1QAJA 2FJXA 5HBMA 1D0EA 5L1JA 4IQXA 3QO9B 3DYAA 2J6TA 5KFTA 4EBEA 2CKWA 5F8MA 1C1CB 1JLAA 2R8HA 3PZPA 3TQ1A 3I5AA 5KFAA 5J1EB 3SFUA 5CYMB 3V6HA 3RAQA 3IS9B 3QGIA 4RW6B 3BSCA 2C28A 2OPRB 4ZPAA 3PW7A 5C25B 3H2LA 1I6JA 4RZRA 3M9OB 1RT3A 3ISNC 1UWBA 1HNVB 3DM2B 3NBPB 1YVFA 2J6UA 2AGOA 2W7PA 5KT3A 4WZMA 2J6SA 1JLCA 4XPCA 4RNNA 5KFLA 3JSMA 3QZ7A 3BQ2A 4KV8B 4O3SA 1S1XA 3M9MB 4ECQA 1N6QA 4IH7A 4ZVGA 2W9CB 3MEDB 1LWEB 3KLHB 1T03B 2ZKUA 2BQUA 5CYQB 1OS5A 3N6LA 3IN5A 3GV5B 3UPFA 3RB6A 3KK2A 2AU0A 2IAJA 1S9GB 4M94A 4R8UA 1LW0A 3QLHA 3V6DA 1QUVA 3IGVA 3JYTA 4Y3CA 4EBDA 2ZE2A 5F9NA 4KE5A 3RB0A 2ZE2B 2VA3A 3C6TA 3OL7A 4RUCA 4ED6A 4PUOB 2GIQA 3V6JA 4PUOA 5C24B 5KG0A 4NRUA 4IG3A 3HVAA 3MECB 3UR0A 1RT7A 3PR4A 2V0NA 1FKOB 2HNYB 4NLQA 2FVQA 3SFGA 2D3UA 4KFBA 3LP0B 3OL8A 1SUQB 1JKHA 4RW8A 4YQWA 1C1BB 4I7FB 2FVPA 5I3UB 5KFBA 4O44A 2FJVA 1EP4A 3GIJA 1SH2A 2C2DA 1VRUA 2OPSA 4KO0A 4NLXA 1JXLA 1RTHA 5C42B 4O3QA 1IM4A 3KHLA 4J9KA 2VG7A 4ZPDA 2IJFA 1BQMA 1GX5A 4JV2A 1S0OA 1XR7A 1RTJB 2FLLA 3OL6A 4TY8B 4O3PA 3T5LA 4URSA 2BRKA 2HNZB 4LSLB 1JLFA 5KG3A 4YMEA 4EBCA 2IC3A 4QW9A 3CDEA 3Q8QB 4RW7B 3H40A 1RT2A 3DMJB 2JEFA 1HPZA 5CYMA 5L1KA 3BSOA 4K4WA 5KT5A 4MK9A 2R2RA 2XCPA 3ISND 3RB3A 1RAJA 3IGNA 2OPQB 3DI6A 4KBIA 4MKBA 5KFEA 4EEYA 4JV0A 3OHAA 5KFKA 3H5YA 1RT6B 1S10A 4KKOA 3CJ5A 1JLEB 4IFVB 2GC8A 4NLPA 4ED0A 2VG7B 4ZP9A 3I0RB 4WE1A 5KG5A 1RTJA 3QIDA 3KHHA 3LAKA 1IKYB 1IKWB 1C0UB 2B5JB 3C6UB 4I2PA 4G1QA 2D41A 3H5UA 1DLOA 1HMVB 3RAXA 2BQ3A 1BQNA 1EP4B 1HNIA 2ASJA 5KFIA 1S1UB 1J5OA 5KT6A 5DGBA 4K4VA 2YKNB 5J2NA 1FK9A 4TY9A 1S1TA 3I5BA 3GIIA 4ECXA 2UVUA 1Z4UA 3DI6B 4R5PA 2OPQA 3CVKA 3DRRB 2GIRA 4EO8A 2V4RA 2OPPB 3KJVA 3NAHA 2E9RX 4XO0A 2YNHA 4B3OB 1JLFB 5C24A 5F9LA 1RT4A 4RW7A 4K4SA 4ZVEA 2HWIA 4YP3A 1TL1B 3KLEB 4ZVHA 4QWAA 1TV6B 1JLGA 3UDLA 3KMSA 3E51A 4DL3A 2BANA 4IRKA 2RF2A 3V6DB 1MMLA 1QAIA 2IM3A 4ED3A 2YKMB 3BREA 2W7OA 2UVWA 4URGA 4O44B 5I3UA 5L1LA 2HMIA 4I2QB 5HLFA 4I2QA 2YNGB 1RTHB 3ITHB 5C42A 4KO0B 5HLFB 4HKQA 4YR2A 3T5JA 2OH2A 2FVRA 3BGRA 1S0MA 4U7CA 1JLCB 5KFWA 2AGQA 5I42A 1S1XB 4EYIB 4RUAA 4WZQA 1N4LA 3DLEB 3CIZA 4FS1A 2EC0A 3E01A 3DDKA 4ECTA 4YR0A 5KFCA 2ZD1A 5F8IA 1N56A 1NNDA 4ZPCA 3FRZA 3IS9A 1LW0B 2R8JA 3BJYA 2IAJB 2OPRA 4O3NA 4J9MA 1R0AB 3TVKA 5EWGA 1EETA 4NLUA 5F8LA 1S6PA 3I0SA 3CJ4A 4NLGA 3N6MA 4URQU 4ECUA 2O5DA 2R8KA 2FVSA 3QO9A 4IRCA 4PQUB 1HQUB 4J9LA 5F8JA 5DQHA 3DRPB 3KK1A 4IOBA 4J9NA 3DOLA 4Y2CA 3DLKB 3JSMB 2ILYA 1U09A 4ED7A 1REVB 1S1VB 4TLRA 3EPGA 1REVA 1S1VA 2XI2A 5D3GA 4QWEA 2FLNA 1S9EA 4K4ZA 3H4BA 5KG6A 1RTIA 4ZVFA 2W8KA 1RT5B 4WXWA 3NMAA 1ZTTA 2HNDA 4IR9A 1HQUA 3H59A 3T19A 3OLAA 1UWBB 4KKOB 5KG1A 1JLQA 1RT6A 4K4XA 3DRSB 4ID5A 4WFZA 2BR0A 1QE1B 2YNFB 5KFUA 3CDUA 5KFJA 3MEGA 4ZP6A 1HYSA 1HYSB 3KJVB 3OSPA 4RNMA 2OPPA 4Q8FA 4O3OA 3DYAB 3Q8SB 3EPIA 2VA2A 4HYKA 1HPZB 2IM1A 2RDJA 3DMJA 3FDSA 2HNDB 4LQ9A 4TXSA 1IKVB 4RW9A 1RA7A 1S1UA 1J5OB 3PJXA 1XR5A 1JLQB 1S6QA 3V4IA 5KFHA 5KFSA 5KFFA 1TP7A 4G1QB 2JLEA 2BE2B 1N5YB 3OLBA 2JC1A 4ZP8A 2I5JB 4MH8A 4NLVA 4ZHRB 5FDLA 2IA6A 2CJQA 4IFYA 4QPXA 2YNGA 3DRPA 3ITHA 3KK1B 5KFMA 1C0TB 5FDLB 4PQUA 4Q43A 2WHOA 1TKXA 1HQEA 3GIMA 4ED8A 1FKOA 2HNYA 2VG5B 2FJWA 2HAIA 1RT7B 4GC7A 3KLIB 2AX0A 4RW8B 1SUQA 4KFBB 2WRMA 4J9SA 3OL9A 3KHRA 2R2SA 3M8QB 2WONA 3IG1B 4Q0BB 3MEEB 4ZP7A 5KG4A 2D3ZA 1RT4B 4Y2AA 4PWDA 3DLGB 1JX4A 4IRDA 3CDWA 2ZD1B 3NAIA 4XPEA 3GYNA 1D1UA 2UVRA 4LSNA 4K4TA 3GIKA 3QLHB 3DRRA 3GV7B 2AQ4A 1S9FA 3DOKB 1N48A 2ATLA 4IR1A 3BQ1A 3FQLA 4TY8A 5EDWA 3DLEA 5J2MB 2I1RA 5KT4A 3KLGB 3MEDA 1S1WB 1VRTB 1C0TA
chains in the Genus database with same CATH superfamily
4FF3A 1T05A 2Y1RI 3UN2A 2EPIA 3MF5A 4MKYA 3NGUA 5CZXA 2P6SA 4N8NA 3ZTPA 2CG4A 3BYRA 1NM2A 4HHUA 1E6YA 4USVA 2RF2B 2IFXA 2YY3A 3OBIA 4BS2A 1C1BA 3FQKA 3WHIA 3GFZA 3Q2SC 1P9QC 3T6BA 2BE2A 4CLZA 5C2GA 4DR2J 5DDRC 1KLMA 5JMNA 1RAFB 3HT0A 2MQNA 1VS3A 3ENQA 6FD1A 3KK3A 4KGMA 2KM8C 3SSQA 4F50A 3TQEA 2DNQA 1FTRA 4M5DA 1IBLJ 3U1MA 3BGLA 1GAOA 1VJWA 1WOOA 3M7VA 4F2RA 1M5PC 1FD2A 1OIAA 4F67A 2ACYA 3VWSA 4WIQA 4QBUA 4Q0BA 4KYZA 3TR5A 5J1EA 2GJ2A 3THTA 5CCLA 1K1QA 5H1SV 3PKYA 2UP1A 4O4GA 2KZZA 5J2NB 1IBMF 2IBKA 1F9HA 3PFEA 2IYIA 1ZS6A 4KB7A 4F02A 1RT1B 2C3OA 3M9NB 4IDKA 2QRRA 3LANA 4J9PA 2K3IA 4K2XA 2P2CB 2DIUA 4O3RA 4A8WA 3UNGC 1RT5A 4HACB 2RUGA 2RKIB 3M4XA 1I94J 5HATA 3N9UC 2J0WA 3DOLB 3NRBA 1KD1T 2K2PA 3IBCB 4ZN3A 3PW2A 2RDIA 4DQSA 3S1TA 2DR6A 4YB1P 1F60B 1ACMB 2M7SA 3D68A 1F5AA 4MYTA 1KQKA 4F3QA 2JNJA 4ZPBA 5KFVA 3IRXA 4WYLA 4DN0A 4PAAA 1B7YB 2G1HA 2IM2A 3MR6A 2LQBA 3RRKA 3QT6A 4DDFA 5KT2A 1RADB 2B43A 4I64A 2WB4A 3GU0A 3PW5A 1Y0HA 3KK3B 1U24A 1WD6A 3PHEA 4ZLLA 2JC0A 1JXEA 1YZ7A 3TP2A 1K0VA 4WFYA 3CB4A 4TN2A 2GMJA 3L95X 3HCXA 3MPDA 1BHNA 3EVOA 1RTZA 1U1QA 1S99A 1BQXA 3GJRB 4KH0B 1CQMA 1WTFA 2FZKB 2G0IA 1L3SA 3DN9A 3PYGA 4HTJA 2HBZB 3CWJA 5IZHA 1UVJA 4KSEB 2VUGA 4FN5A 3FZ2A 4P72A 2DO0A 2DY9A 3QIPA 2N3OA 1EJ7L 2HMIB 1EETB 3R5CA 2XS7A 4DUZJ 4K4UA 2DXFA 4E98A 3THVA 4B08A 1HNVA 3HT3A 1VDHA 3BSAA 1FXLA 5HP1B 4OJ3A 1RE1B 4IG3B 3DOKA 2AW0A 1NDKA 3PACA 2IDLA 3QWPA 1HBNB 4I0WA 2WB1D 1KONA 1JLBB 4J9OA 2DRDA 2B6AA 4CLYA 4USHA 2WONB 1KP6A 2V94A 4LF1A 2IMWP 1SH3A 3V81B 4YDDB 4OX9J 3IRXB 3E01B 4PWDB 5J1NA 1X8DA 1IQZA 3P45B 3OT9A 4JV1A 4QR0A 3Q8RB 1AUDA 3KK2B 1HNIB 4PG8A 3VAKA 4F4WA 1ICEB 1S76D 1TVRA 2K7KA 1L5UA 1H2UX 2RD5C 1H72C 1IBMJ 3CJ0A 1CULB 4M5JA 4M5MA 5HQ8A 2FHJD 1L3KA 1JK9B 2VASA 1LOUA 2BDPA 4JI5J 2EWHA 2N3LA 2GIFA 5E5NA 3MM5B 3W1YC 4U67Q 2E5LF 2HHHF 5K14A 4MIAA 5E7OB 5G0RB 1RWKB 4DQRA 1OO0B 6AT1B 5GADI 3MURP 3MTKA 4ZCMA 1HI8A 4WE1B 5KFQA 4ZCIA 3K17A 4DV7F 1IKVA 3H5XA 3BBFA 3OVSA 3GV8B 1PAEX 4QZVB 2G4BA 3ET6A 1XK8A 3RZAA 2KKHA 1F0XA 8RUCA 5HJYA 3J7YI 2R7UA 4L75A 1VQ4S 4E2FB 4J90A 2FTRA 2EFGA 1MU2A 3V6KA 1RYRA 3R5DA 4ECRA 1TKTB 1Y10A 3KG0A 3FFIB 4NLYA 3T3FA 3W2WB 4QWBA 1IWGA 3MEGB 3G6YA 2HQFA 4OLOA 3OHBA 1U48A 2KDOA 2V8DA 3OTEA 2O67A 2U1AA 2XULA 2XZWA 5ITHA 2NS1B 4QW8A 4PXEA 3CCQS 4NCGB 3CEDA 2KTQA 1Q5YA 2HBYB 3GB0A 2IRYA 2UUCJ 2L48A 2LU2A 1OY9A 3G8TA 2CJ9A 2GQQA 4P71A 2XCAA 4KGZB 2NXNA 2XYPB 4C4WA 2B4OA 2PIIA 3I82A 3UQSA 3QRQA 2O3DA 2GO9A 3D5MA 1FWKA 2C2MB 2CPXA 3QGGA 1CULA 1KSPA 3VQSA 1D8ZA 4UQTA 1H73A 4EO6A 2XSJB 4ECZA 2ZH9A 2W9BA 3R1HA 4FYYB 1TFWA 3ZZYA 1FF2A 3K8WA 1MSWD 3VAGA 4OI3A 2C2OB 3IO1A 4RNOA 1KFSA 4R25A 2BJDA 2B4VA 3LPEA 1XBWA 5F8HA 4P7VA 2RIJA 3MECA 4IH5A 4USJC 1PYTA 2HK3A 5GAEI 3EYZA 4A8YA 4ELUA 5F8NA 4MFBA 2FDNA 1YJRA 4QIFA 3G71S 1JNZB 1NU4A 1JB0C 1UEVA 3M8ZA 3OXGA 3IG1A 3KDOA 1BMQB 2XGQA 3HKWA 3PYFA 1B0TA 2V69A 2WVCA 3D3BJ 1KLMB 3K58A 1HNXF 3N0VA 1FDNA 2J5AA 1QDUB 2XY5A 4QQBA 3PXGa 1ZOTA 1QVGR 3P6YC 3AT1B 3MCSA 1ZA1B 3L7OA 4H54A 3D67A 4ZMMA 4X64F 2MXYA 3QIPB 2VG5A 1VC0A 2HVEA 5HROA 5K5MA 1YI2S 3ULHA 2HQDA 1HHSA 2RAQA 3PKMA 2CQ2A 4EGLA 1ZETA 1S7IA 3OV7A 5EX0A 2MKHA 3AAWB 3EZUA 1FX4A 5LT5A 5CQGA 5GMEA 1O51A 4ANEA 4LF6J 2HHHJ 1S6QB 2H5IB 1TV6A 4Q2LA 2D9OA 2M52A 2VFTA 2WK4A 3IBWA 1SC6A 2PFDA 4YN3B 1XNRJ 3SV4A 1XN9A 5DG9A 3VAHA 5A8RA 4ZPVR 3HO1A 1RT3B 2EVZA 2JLGA 3C6TB 1UL3A 4OL8A 4PR6A 4YY3J 2JEIA 2YNHB 2DR9A 2CPDA 4I1TA 5EUHA 1KWMA 3MM6A 1PYOB 2AEJA 2BEFA 4XTTA 1DBDA 2HRUA 2MYFA 3U27A 3LALA 4CH1A 1LW2A 3NL0A 3LUYA 4P10A 3EDRB 2ZJPQ 3CF5Q 3RBXA 2DNZA 3HHKA 3LP2B 3PRVA 5DQIA 2HWTA 2L9DA 1XNQF 2CZ4A 2KH9A 2A6OA 2W9CA 3SSRA 4Q8EA 4ZCKA 1WF1A 2HAFA 5IT9Y 3BR9A 4P52A 1LWFA 4HLBA 2OSQA 2XBPA 4USWA 2FY8A 4N77A 3IR6B 1VQOS 4CZCA 2ALZA 3W8GA 4JI3F 3NBPA 3C14A 5ETSA 3NGDA 2F4VF 2EFOA 3CJ8A 2C1EB 3A3PB 1UEUA 2HGLA 5DJBA 1QAJA 3DU5A 2I9SA 1D0EA 4KIAA 1KKHA 2H5JB 2HFUA 5B09A 3QO9B 4DS5A 1U25A 1YRXA 1NDLA 3DYAA 1V5IB 1FI4A 3ZFVA 4EBEA 4MAKA 1OPZA 3OUYB 2R7XA 4PABA 3MM6B 1GTEA 3TQ1A 3I5AA 3SFUA 5J1EB 3VAMA 2UU9F 1BXNA 3N4WA 3QRPA 2PI4A 3G8SA 2XSFA 3MCMA 4UW2A 3ZXWA 2KM8B 4AE5A 3ZNJ1 1D8YA 3OD2A 2DR8A 4HR2A 2HIQA 2LFVA 3THPA 7FD1A 3G96A 2XO6A 3PY8A 2WSFC 2CPFA 2DGOA 4OYAA 1DZ5A 3DM2B 2RT3A 4EUVA 3CCMS 1NKBA 2MQOA 1QSYA 2E5LJ 3MZIA 2K1RB 5KT3A 1KLNA 4WZMA 1U1PA 1JLCA 4XPCA 3RR7A 3JSMA 2RHQB 3GFXA 4LF8F 3RJMB 3AFGA 3AJ2A 4U7UK 3ENAA 3WC0A 1N6QA 3EICA 3MGJA 2RRBA 1MLAA 1NDPA 1P9YA 4USUA 1KDNA 3R7SB 5B7WA 2XQCA 3IN5A 2ZHAA 3MAAB 2ASYA 4UOCA 5LSRA 3KJFB 1UFLA 4R8UA 1IBKF 1WEXA 5HANA 3V6DA 1N33F 4JP8A 2M0GB 3JYTA 4Y3CA 2ZH1A 4EBDA 3BKUA 2NZ4A 4U7UD 3K5OA 2FJEB 4KE5A 3JAMU 2R42A 5GVQA 3TARA 4RUCA 4A8QA 2ZJQQ 4ANDA 3V6JA 1H74A 1RHMB 4PWWA 2OEKA 4ZLJA 3O5TB 3O8WA 4WKRA 3DRYA 1I51B 2V8VA 3HVAA 1GMVA 3UR0A 4A8OA 3PR4A 2R7VA 1PKUA 3E2EA 4K4WA 2FVQA 1SUQB 1HBMA 3FRYA 4I7FB 2FVPA 3CCES 3RRHA 2V4JB 2Q1LA 4CO3A 2RU3A 4E0DA 2Z57B 4QIWD 5I3UB 2DISA 4DFJA 2CZVC 2FJVA 1ZAVA 1SH2A 1X5PA 3HHLB 3W5ZA 4ENOA 4P75A 5C42B 4O3QA 2EKNA 1NZAA 3HHEA 2OLWA 2VG7A 4HT5A 4X64J 1YITS 2AEMA 3JQMA 2YX4A 4DR1F 4NXNJ 5EN1A 1RTJB 2FLLA 5GAGU 2ZBCA 2B4UA 2HQGA 4CTAA 1JLFA 3ILJA 3CCLS 3A13A 2BOPA 4QW9A 3Q8QB 3MM7B 4C8KA 2B8QA 1APSA 4RW7B 5EHHA 5D8HB 2DTJA 2NUUG 2H51B 3EX7B 2YWEA 1ZM4A 4JBCA 1A6LA 1RCOB 4FS2A 2OEMA 2KI2A 1UVKA 4ZDNA 2JL9A 4YOEA 2OPQB 2BJ9A 5CH7B 4ZVOB 5HMYA 3OJSA 4CCHA 2DGUA 2JJ4D 2B9EA 3A3NB 3RG6A 2X7IA 5E41A 1IVZA 2CPZA 3H5YA 1RT6B 4KKOA 2BJ7A 1RUSA 2IVMA 3ZNUA 3MM9A 5G0RA 1VBXA 2E1PA 4NLPA 3GIRA 1H3DA 7AT1B 5A8KB 1N52B 2I2YA 1RTJA 1NK0A 5D6GA 4J7CA 4OHVA 3H0PA 3H2UB 3M6VA 1I94F 1F2HA 3AOAA 2B5JB 2MY7A 2XLJA 2MPUA 3H5UA 2KG0A 3CD6S 4NZ6A 1KBRA 4NEZA 1AA1B 1S1UB 4LRAA 1WWHA 1NJWA 2BVZA 4TY9A 4ZVPB 4ZITA 5IQQA 2GGPA 1T11A 3KNAA 3IWLA 2UVUA 3DI6B 2DVIA 3F0NA 3FNNA 1T9UA 4DUZF 1VC6A 2OPPB 3GG1A 4K8RA 3FCHA 4A48A 3OVBA 2YNHA 4Q7AA 2CJBA 2NXJA 1JLFB 2IPOB 2CRLA 2HWIA 3EVMA 3GQCA 3KLEB 1JJHA 2AYBA 3UDLA 3ILIA 5D4LA 1M1KT 4FXVA 4B9UA 2QLBB 1VOMA 2RF2A 1ZZFA 3V6DB 1MMLA 2EBEA 4OI0A 2ZVSA 2YKMB 1IXKA 3BREA 5D78A 2A18A 1J2VA 1SJFA 2FY1A 2J76E 4A8FA 1Y7PA 1WUUA 3W64A 4I2QA 2YNGB 1RTHB 5HLFB 1KC8T 1SL2A 3TUIC 3T1YF 2YQ0A 3CDAA 3MD3A 3RAMA 2MQ8A 3TVZA 1NZ8A 1S7HA 4J37A 1QAXA 3EGZA 4DV7J 4FXDA 4WZQA 4FKYA 5HMWA 1FRHA 4OI4A 4Z7YA 1GMWD 3VCDA 5IXUA 3E01A 4MT1A 1ROFA 2GS8A 2RB7A 4C7QA 2ZD1A 1YTYA 2UXBJ 2RMLA 3FCVA 1NNDA 1CG2A 2HBQB 2JSXA 2HRTA 3IS9A 3BJYA 2VQFJ 4QU7A 3HSJA 9RUBA 2YH1A 4O3NA 3WQPA 2F9DA 1R0AB 3TVKA 3PX0A 4TNOA 5F0WA 5F8LA 2OTJS 3I0SA 5G4DA 2Q43A 2LEPA 4URQU 4UOHA 2GW8A 3R7NB 2R8KA 1CJVA 4LF8J 1WDDA 1HQUB 1B7FA 3WX4A 4I67A 4K5RA 3OUYA 1WDTA 3DRPB 3KK1A 4PG7A 4M8LA 2QMWA 3DOLA 3R9LA 3NNAA 2XM3A 2DRAA 3JSMB 3NOCA 3IM9A 5L9NA 4ED7A 1REVB 1FD8A 1VI7A 2CAJA 3HD1A 1PILA 1REVA 1CJKB 2FHOB 4X84A 1R6YA 2EFPA 1S9EA 2FLNA 4B3RJ 1IN0A 1RTIA 3NG8A 4U8VA 3FEZA 1RWNB 4LFAF 3T19A 3OLAA 4DV2J 2YWFA 4K4XA 1JLQA 2ASDA 3CTRA 3A4TA 1ZPWX 2J6UA 5KFUA 1ZBTA 3CDUA 3MEGA 4B3MJ 3L7PA 3HKZD 4DPUA 3BDPA 2KXHA 3OSPA 4RNMA 2VKZG 4Q8FA 4ZS6A 2FC9A 1H98A 4JI6F 3DYAB 3EPIA 2VA2A 4HYKA 3DNCA 3DMJA 1IUJA 2HNDB 2BZ2A 2GVDB 4IQMA 1RA7A 4TXSA 5L39A 4DF8A 3K57A 1UAWA 1N5VA 3G8QA 1LV5A 3CDBA 3V4IA 1QSSA 1LXJA 2Z4PA 2E44A 3DCAA 4KT0C 4Q2MA 1TP7A 2ZEJA 1DURA 3MMBB 5KFFA 1FJEB 1QM9A 1P6TA 2FLOA 1T02A 2I5JB 2RHSB 4NLVA 4ZP8A 2MKKA 2UXDF 1CPZA 1WC6A 2CJQA 4QYZJ 4IFYA 4NXMJ 3ITHA 3IC1A 3W2VA 2HVZA 4X4VA 2V8HA 2VICA 2AJ0A 2GAGC 3QATA 3HFZB 2WHOA 1LFPA 2WVFA 4ID8A 2FJWA 1OPIA 2D74B 4GC7A 3KLIB 3VV2B 5KOXA 1VMBA 2WRMA 1MN7A 3OL9A 1H7XA 2RQMA 4Q0BB 2VPXB 2ZKTA 3C8YA 3TA0A 2D3ZA 2NPFA 3UFCX 2M88A 3ZZZA 3Q0AA 1NK8A 4IRDA 2MB0B 1HWIA 3PEHA 4C97A 2QC3A 3ZZPA 4B3MF 2MZTA 2FJBB 3I31A 2UXCF 1EARA 4LSNA 2KG1A 4K4TA 1R8PA 4M5DB 2Y0BB 3DRRA 4DR4F 1HQ2A 4NYOA 1N48A 4RL1A 2Z2MA 1G4CA 5E2QA 1BWVA 4P2MA 5EDWA 1RB0A 1DJ0A 3TAPA 2DNKA 2I1RA 1MROA 3M30A 1VISA 2FYXA 3AJDA 1I3OB 1VRTB 4RUBA 3R8YA 4NZ7A 4CNZA 2BQRA 2CQDA 3HK2A 2HVIA 2K8GA 2CPEA 3GPAA 3CC7S 3A8KA 3GP9A 2LMIA 3SSSA 1PIEA 1U0HA 2BABA 3R6LB 4CH0S 1TQLA 3Q8PB 1HBMB 2EI5A 2ACMA 1QJHA 2V2KA 1B4SA 1X4CA 5A2QY 4Z7CA 2VFVA 1HNZJ 3F56A 1EAYC 4JV5J 4WP9A 2HW3A 3W9JA 3NY0A 2ZM6F 3R5BA 3PNIA 4Y28C 2QMXA 2VD3A 3H4DA 3G6ES 3BR8A 2NXUA 4ZK7M 2HQIA 1T3OA 2LXIA 3HSDA 3TJAA 1RT2B 1VBKA 2B9WA 2R7RA 2MQLA 4L73A 4PRFA 2GMHA 1BQNB 5C7PA 1VJQA 1NHKL 4ICLA 1XMQJ 5A6PA 3U02A 2DYAA 2ZWOA 3ET6B 4NI2B 4JI2J 3WBZA 3JXOA 3PFOA 3PX4A 1FFGB 3K89A 1FJGJ 4YHHF 4H4OA 5L46A 1VQLS 2RKIA 4XDDA 4KHPF 4LF4J 2FJDB 2A6MA 2GVDA 1R31A 4YS2A 3VGSA 1S49A 2CYYA 3MR7A 4F4ZA 5IT9U 2FVCA 1R3NA 3GMGA 4I68A 1DARA 4P74A 2CQPA 2VQFF 4ZVUB 4X62F 1TK8A 1WOSA 1WJ9A 4NYZA 1RBLA 2H48B 4OI2A 4PEOA 2HWHA 4NCBA 1NSKL 1GH8A 3D7SB 4USKA 1XC9A 1U7LA 1D9AA 3F41A 3H2VE 5EX3A 4CLWA 4DL4A 2QV6A 3M8PB 3C46A 1SQEA 2LP4A 4J9QA 2DHHA 2YNFA 4DCOB 1HBNA 4RW4A 2UUWA 5GAGI 2FD2A 1S4FA 1U8WA 3D1HA 4JUZA 5D3GB 1RZMA 1JJ4A 2EFNA 4BHQA 3QQCD 4IKAA 3JB9k 2AKWB 2RILA 5IM0B 2KO1A 4CO4A 3Q89A 3PW0A 1VQYA 2L9NA 4DV0J 3CSKA 4OZLA 4AFFA 4KH1B 4KC5A 2UV8A 2XLIA 1TVRB 2WOMA 1NHVA 1SV5B 2CPIA 1FKPB 3HZEA 3LGNA 4P2SA 5HMZA 4B3SJ 5LXYA 1X5TA 3HVTB 1NAQA 2QO3A 3C66A 3I0SB 2V4JA 5LL6d 1FVQA 4UT4A 4LFCF 1LNQA 3J7AN 5HL7Q 1UW4A 4X2BA 1K47A 1SH0A 3DM2A 1I1GA 2R2UA 1S57A 1VIXA 2HFOA 3BKFA 3W63A 2ZH6A 2AGPA 4LSNB 1V9OA 2CJYB 4WBFA 3M8PA 2HQCA 1HA1A 5D77A 1W2IA 3CJKA 3R2DJ 1XQIA 2DB1A 4NLSA 4OZ0A 1BWEA 3QRRA 3G4SS 3I9ZA 3B4DA 3PTWA 5DDOC 1DTTA 2DY1A 2DNHA 1SC3B 4EYHB 2V9KA 1N5SA 3GYXB 1NPRA 3FBBA 4MTPA 5CABA 2V8GA 4ES2A 5F3ZA 1YBTA 1YWXA 3IAM9 1B0PA 5HO4A 2BXJA 3CCUS 4ECVA 3UD4P 4TYAA 1VBYA 2GGPB 2APOA 2AZ1A 1RAOA 3M2UA 4JI5F 2AP6A 3D28A 4OYXA 3HVTA 4LBIA 4B9LA 1KS2A 4FNIA 2QA2A 3N79A 2I5JA 5ETVA 5HROB 2BA9A 2HHVA 4F0KA 4ZVQB 1SJ3P 2BKOA 4IOCQ 1X5SA 2MTLA 3PRDA 4FDFA 5IM0A 4IFVA 2WVEA 4DR5F 3LP1B 4DQIA 4DQPA 5KFXA 4NLDA 3ELHA 1JIHA 4PYDA 2QA4S 3GZ7A 2JVRA 3H98A 4OHXA 1SJRA 3LP2A 3NNCA 5F0UA 3NNHA 2HHSA 1TL3A 5A8WB 1S5ZA 1XEZA 3B78A 2XI3A 4LFCJ 4DU7A 3UN3A 1WG1A 1WSRA 1N54B 1DTQB 2MKCA 4LRDA 2GJIA 3MR5A 4XAKA 2C2RA 3MOJB 2DNLA 3P49B 5J2QA 4DCJB 1ELOA 2BKPA 2VDHA 3CUNA 2YBVA 3HSZA 1OYDA 2Y1IA 1GX6A 1S77D 1UFWA 2HFZA 4U6PA 1T8EA 2BV3A 2MQMA 4DR3J 2PFFB 3I55S 1RU1A 2ZWPA 5ETTA 2X3DA 2HKEA 2W4PA 1Y3JA 2B5JA 3MM8B 5ETLA 2IC3B 3T1AA 1S9EB 2XYGB 4BBYA 3TI0A 2CQBA 1NK9A 1UEKA 3LP1A 4YB5A 2ZH2A 4TU7A 2Q3PA 1VRUB 1V3RA 4KHRA 4DV5F 4P9SA 2QGFB 3SMZA 2HIYA 1RQ0A 2J8AA 4ED0A 1NO8A 2ATCB 1MG7A 2OKQA 3PR5B 4MKVA 3CW2C 4QWDA 4JYAF 2HGMA 2EFVA 4N8OA 1Q86T 4R5PB 1BE4A 3KLGA 1WC3A 2Z2YB 2P6TA 1NEEA 4ZVTB 3FFIA 2E7VA 3T5HA 1LW2B 4M1KA 5JVHQ 4ATNA 2DITA 3BSNA 2C22A 5LMNJ 1B3TA 3TW0A 3IRWP 4DFKA 1OYEA 1R8BA 1UVLA 2HNZA 1MW7A 3J80U 2DT9A 3MAHA 1M90T 1ZM9A 4H4KC 4QOTA 2MHEA 4AQYJ 2OUGA 3FEYB 2ADBA 1NPKA 3DLGA 1RHKB 2ZHOA 4KY3A 2J0QD 2DPJA 1GK8A 3T1HF 3QZ8A 4GKKF 3D1OA 4R8UB 2CQHA 1HHQA 3WZ0A 4X4OA 5KFNA 5I42B 5B0AA 3QSYB 2WBMA 3HVWA 1IKXA 2Y1JA 1DY3A 1FWPA 1X7VA 5E0OA 1UA0A 4C8OA 1S6UA 4FBTA 2VBYA 4CM2A 3HJFA 1N6QB 2QLXA 4GO5X 2JEGA 3KG4A 2VJUA 3JTNA 1VRTA 2OD6A 3BH7B 3QWUA 1VCTA 4BLGA 2DXDA 2G0CA 3DC2A 2DO4A 3RGIA 3D66A 2BRLA 3TRGA 1N0UA 4AL7A 4PG6A 3M2VA 3LOUA 2LEBA 1B99A 4YY3F 1TZ0A 1IJFB 1NJZA 2CNKB 5KFZA 5DG7A 1OSDA 3Q24A 5BYRA 4WP3A 1HD1A 3KNGA 4IH6A 2X51A 5E3CA 3TO8A 1WI8A 4PQAA 4Q5VA 2JOQA 3MFHA 3S7RA 3UD3P 5HP1A 3I5CA 4WJBA 2H9ZA 2G2OA 1HW8A 3G6XA 2XY6A 3D0GE 1YIJS 4DV6J 2P5VA 2F7VA 1TKXB 2J9EA 3N6NA 4DZDA 2CIMA 2R7OA 3LAMA 1DFDA 3AB2B 1RA6A 4B17A 3I96A 2PI5A 2BOAA 3ADAC 3IR5B 3HDSA 2V8PA 1NSPA 1LWEA 2LQ8A 1Q79A 4JI0F 3PO4A 4QYZK 3RRGA 1Q78A 1RWUA 1CC8A 2QZ8A 2JVOA 4JI7J 4V19J 3G82B 4IFYB 4TQRA 2YNIB 4WFXA 4NXMF 5KFYA 1HWLA 1PJ6A 4ETZA 2KN4A 2V2VA 1QY7A 3DHXA 3FK4A 2IVYA 3G86A 4CNYA 1EX8A 2XMUA 4DG1B 3W66A 2V9WA 4K2JA 4LMZA 1CS4B 4OJHA 3M8WA 4RJVA 2NCKL 2O66A 5AXMA 5BXIA 4NWBA 1QVFR 1IBLF 3IXQA 4CO2A 5B0CA 1WTBA 2CPJA 3RAQA 3NS7B 3IS9B 2MZJA 4QIEA 1FESA 3CPWR 1ZM3A 1VBZA 2C2ZB 3OXLA 4RW6B 4USMA 1TMMA 1SC4B 5A8WA 4B3TJ 1NJYA 4DUTA 3PW7A 1WF2A 4RZRA 2VOPA 1CJUB 1RT3A 3ISNC 3MUTP 3VAJA 3TNVA 3H8YA 4USIA 3NBPB 1YVFA 5A6WA 4I4BA 2IVFB 2W7PA 1YJ7A 2OIHA 2AEFA 2YX7A 2J6SA 3QZ7A 1U2RA 3IWNC 1G7CB 2MZ1A 1F3VA 2FJAB 1S1XA 1W26A 3M9MB 1VK8A 2V2ZA 1RJJA 3GONA 2ZBIA 1OMSA 3D9BA 4IH7A 4ZVGA 5IOLA 4ECQA 2QEXS 4KPYA 2CPHA 1LWEB 3KJNB 3HFKA 2ZKUA 1K0TA 5CYQB 1OS5A 3GV5B 3UPFA 1CEZA 4V19X 5HVFA 2RH3A 3KK2A 3LA0A 1R8CA 1LW0A 4OYZA 4XDCA 1QUVA 3CJQA 4X4PA 3MTJA 2ZE2A 4NA3A 4L76A 1EB0A 2MKSA 1FE0A 5M2RA 5A8RB 5F9NA 3HXMA 3HVRA 2XS5A 4PUOA 5C24B 4DQQA 2IRXA 4CLPA 2XMKA 4GKJF 4NRUA 3DGPA 2SXLA 1SL1A 3MECB 4FVMA 3UCZP 4KQZA 4I56A 1UPMB 1FKOB 2HNYB 2QIFA 2QLFB 4NLQA 2D3UA 2DGVA 1RI7A 5JJBA 2AU0A 3DLHA 3CJSA 1F3FA 1RAHB 2H1YA 3B6BA 3MCOA 4U96A 4ES3A 2QT7A 1FE4A 2VH7A 2M3DA 2DNOA 2W4CA 4O44A 4A8MP 2C2DA 1JMTA 3QAUA 3SCIE 1FNMA 1VRUA 2MQQA 1JXLA 4LF5J 1RTHA 3IA0A 3C2PA 4I6WA 2IJFA 5LM7E 4CYUB 1BQMA 2JFDA 3W9IA 1TUGB 1S0OA 4JV2A 3MM8A 5LMNF 3CC4S 1J5EF 3T5LA 2CFXA 1NSQA 3ILOA 3M32B 2DEJA 4YFUA 4LF4F 2HVHA 3D6FB 4EMDA 3H40A 4LSZB 1Q0NA 4DFPA 1UMJA 4CT8A 1NBEB 5CYMA 2DH9A 5L1KA 4WWSA 3UCGA 5KT5A 2R2RA 4C98A 3KTQA 3PDNA 3RB3A 1RAJA 3KFWX 2JDJA 1WOPA 1RWVB 3R5AA 4M5HA 1K73T 3DFEA 4LF7F 1SPBP 4MKBA 5K8NA 4EEYA 2BYCA 4OLPA 2VQEF 4DX5A 4X65J 2CQ1A 1S10A 3UD5A 2A0FB 1WI6A 1JLEB 1M5KC 1G3OA 1ZYQA 1RSCA 2PO4A 4ZP9A 3I0RB 5ETPA 4WE1A 3AODA 5KG5A 3QIDA 3W60A 3ZZ0A 2YPYA 1IM6A 4DV0F 4B3SF 2BJ3A 3ZC4A 2R4FA 4K5SA 2MZSA 1CJKA 2ZVIA 1IKWB 3C6UB 2GX8A 2JLFA 2OP5A 3H42A 1X4EA 3AD9C 5B0GA 1DLOA 3BN7A 3AOCA 4Z37A 1L3UA 3ENVA 2XB2D 4DOZA 1SVDA 2FUG9 2ZOGA 1FDAA 5KFIA 5KT6A 2MGZA 3P96A 2YKNB 2KVIA 1KVKA 2PEHA 4F25A 3I5BA 2IMOA 2BBEA 4ED4A 1YZ6A 4C48A 2DR7A 1Z4UA 3F73A 3S01A 3M2RB 2QL5B 2KT5A 1HI1A 3CVKA 1WEYA 4EO8A 4DSLA 1JWWA 4DF4A 5LXRA 2E9RX 1Q82T 1U1OA 2FGCA 5CXTA 4B3OB 1JJCB 1GMUA 1RT4A 4RW7A 2MJNA 4ETXA 4K4SA 1S6OA 2N4CA 1TV6B 1JLGA 2ADCA 2RU9A 3E51A 3VVUA 1S12A 5DM6Q 3Q22A 1O0PA 1JXVA 2BANA 2P9EA 4IRKA 1RLCL 2QL9B 2VONA 3NMRA 2IM3A 4ED3A 1U0HB 2UVWA 4LUBA 5K8OA 4DMZA 4O44B 1HWJA 3EXYA 4DV3J 2HMIA 1T95A 3UVJB 4HKQA 2F4FA 2ZUAA 3HHLA 2FVRA 3H25A 1X0PA 4U7CA 1R43A 5KFWA 3QJLA 1PBAA 5MLCV 3SYZA 4XIUA 3HI9A 2OGUA 4NMLA 2EC2A 2XYHB 4OHWA 2JX2A 4FS1A 2Q6CA 4DPYA 1Z1ZA 2B4PA 2AYEA 2AJQA 3MMJA 3P4UB 2MHNA 2Q79A 3CCWA 1RHJB 3QSIA 5F8IA 1FRIA 5I3QA 2HHXA 2RJZA 4ZPCA 2G1DA 3WC2A 2NZCA 1TK5A 2R8JA 1KQGB 2ZUGA 3FBEA 3WDOA 5GAHI 5IT4A 5EWGA 1EETA 4ZPWR 4NLGA 1S6PA 3MDFA 1R8HA 1EIYB 3G2XA 3N6MA 4FVCA 5ETRA 4ECUA 2DNGA 4F4KA 4KHPJ 2FVSA 3QO9A 1X4FA 3TAQA 4QYRA 3SQGA 3OFGA 4N41A 4YUDA 1NCLA 1ZH5A 2YWHA 2W4DA 3DLKB 3X3UA 1U09A 4Y2IA 1S1VB 1YQHA 1Y9OA 1S1VA 3EPGA 4BC9A 2Y8YA 4DHVA 1NB2A 2RNEA 3H4BA 3N01A 2ROGA 4DS4A 5A0YA 3TZWA 1H6KX 2HEKA 1N36J 3FBCA 4Y6IA 5H9FK 2HNDA 2D3OR 1BD6A 3G87A 3DRSB 4DL5A 4WFZA 2R3VA 5HVHA 2YNFB 2BR0A 4TU9A 3MPYA 2VFUA 1HYSA 4OYOA 3ZZRA 2CNNB 2OD4A 1ZM2A 1H0HB 4WK1A 2Z2ZA 4WIIA 1UKUA 2Y1LB 3LGHA 1HIYA 2IM1A 3PYEA 5LJ3Y 1IKVB 2J9CA 3CGIA 1J5OB 2E1RA 2MEWA 4M5KA 1UVIA 2WSEC 3CMES 1S6QA 2DHGA 2IYGA 1BLUA 2GVZB 2J7UA 3M2VB 1WKJA 1VQ5S 2Y8WA 2HHWA 3N28A 2QFJA 1N5YB 1OY8A 4MH8A 4DX7A 4ZHRB 3K5LA 1ZZNA 2M8DB 3DRPA 3KK1B 1ULRA 1TUWA 1TFYA 2PGCA 4LFAJ 2EXUA 1HQEA 2DNYA 3GIMA 1OQ3A 1FKOA 2HNYA 3OFHA 2ZH3A 2PDAA 1RT7B 2ZH7A 1RAEB 2AHOB 2E7WA 4RW8B 3VGUA 4M5GA 3L7UA 2R2SA 5BR8J 2WONA 3IG1B 4ZP7A 1FNXH 4B9NA 1JX4A 1RT4B 2RQ4A 4MJKA 3DLGB 4DXLA 2UXCJ 3I6PA 2ZD1B 2VZ9A 2E1MC 3GYNA 3NAIA 4F8RA 3KKFA 2KXNB 4X4UA 4OQJA 1H38A 3HF5A 3QLHB 2AQ4A 2MY8A 1S9FA 1FJCA 2HHPA 2LCWA 2AJ2A 4DV6F 3H7HB 1NK6A 2E66A 1Z2LA 1VLYA 2XSJA 3FZBA 3DLEA 1EZZB 2F40A 3NWRA 4LRCA 4ELVA 2CADA 2V6AA 3KLGB 1S1WB 2GO8A 6FDRA 5FDLA 1GXUA 1T05B 1HQEB 2P9GA 3LH2S 3LTOA 5T7LA 3SCKE 8ATCB 2WOMB 2LECA 2V34A 4YHHJ 5DG8A 4OV6A 5H9EK 3US5A 2DNPA 1GEHA 1LFWA 3DRXA 3J7Z5 3BB5A 4UUWA 4FP9A 2AV5A 3EGWB 2POKA 2ZM6J 5IS2A 3QAEA 4A8KA 2J9DE 2NXEA 4QCLA 1LWCA 1N33J 3FJ2A 2D7SA 3W2WA 4GMKA 2PE8A 3MPWA 3NS6A 4BCAA 4C9DA 2DGWA 2FZCB 3TAMA 3SCJE 4HI2A 1RU2A 4MFBB 3HFVA 3TUJC 5EWEA 2DKOB 5E3AA 1YRUA 4PYAA 3UN5A 3CCRS 2IJRA 2XNQA 4MIBA 1XMOJ 4B3TF 3KMQA 3L09A 3R3TA 5L1IA 3M8QA 2L41A 5LSLA 1R7IA 3I56S 3OXFA 2HZAA 3FEXB 4OI1A 1RYSA 2W9AA 3K5PA 4C3KA 4ID5B 1NH8A 2E1AA 4DV1F 4ECSA 1TL3B 5AE1A 5DGAA 3OTCA 1BQMB 5HBMB 1N5YA 1Y5NB 1YJVA 4JI7F 1NHUA 4RUHA 1K44A 2JEJA 1Y5LB 2Q6BA 2MKIA 2ASLA 1Q81T 2DR5A 2DCLA 3HLUA 4DN9A 4DR1J 1P8GA 4NXNF 3DLKA 4I6AA 1U6BA 3LP0A 2C3YA 4LQ3A 2HZCA 2HBRB 1N5TA 3B82A 4USTA 1R0AA 1XTZA 1S0NA 3OR1B 3Q86A 3GSIA 5E3RA 3V81A 5FLXU 1EKRA 3MAQA 5K8MA 2FLPA 4LF6F 1DTQA 2MJUA 3CC2S 4IG0B 1TKTA 1UZHA 4Y34A 4YB6A 4C2MA 2NQPA 2I8EA 2VPWB 2ROPA 3DLLQ 2OEJA 3HX9A 3JAMY 1LWCB 1CQNA 4HH0A 4WXOA 3RUBL 1KNZA 3I9V9 4S0MA 4DL7A 2C2EA 3I4PA 2XC9A 2B56A 4TKTA 1KVIA 3QPIA 4NLRA 4IUFA 4OFZA 4Y00A 2VFSA 2WCXA 4C0HA 1PJ5A 2KJVA 4DR6F 1FJGF 5K14B 2IHR1 1OY6A 5LMUF 4DL2A 5H9EJ 2ZZNA 2BJ1A 2IY5B 3OR2B 3G82A 2R7TA 2OI2A 2F1FA 2DNNA 2ROEA 3CCZA 4NLWA 2YKOA 3CJTA 3OR2A 3UDEA 4CLKA 2MZQA 4EFAC 2ZH4A 1RTDA 1SV5A 1WF0A 2R2TA 1BGXT 3FBFA 2YKMA 4LIWA 2YWGA 4UZCA 4WYWA 1S6PB 1U6FA 2Z2LA 3D54A 2HHUA 3LF0A 3U1NA 4DR5J 1Y3KA 2H5EA 4X62J 3TUPA 1HBOB 5KFDA 4QR2A 3NLCA 4PXBA 3C16B 2ZNYA 4PG5A 1FVSA 1SIZA 1SIWB 4AXJA 2XO7A 1TMJA 1PGZA 1JLGB 4ES1A 3KJQB 4RW4B 4C3LA 2E9TA 2VV5A 4W90B 4OJGA 4RW6A 4RKUC 1JLBA 2LQ9A 3MHYA 3EUNA 4G65A 1YK9A 3HP6A 1D9DA 4F36A 2BE7D 1N32J 3GWCA 1FCAA 3BGUA 1S48A 2XGPA 1KHVA 2RSQA 4ZOSA 3BGRB 4X65F 1V5VA 2X1GA 1U45A 2HHTA 1T9VA 1FK9B 2QMUB 4DG1A 4NMXA 4P73A 1ZTWA 3CCVS 5L8RC 1P27B 3DXBA 1YSJA 5CD4H 1IKXB 2V50A 3T6JA 1REGX 4Y2MA 1VLOA 3K2YA 3MWBA 3MCNA 3DGVA 5U47A 1GT8A 1CJTA 3KLVA 1QD1A 3EVWA 4DV5J 4EK2A 1TL1A 3GFHA 3PX6A 3O2IA 2UXBF 3I0RA 1EQMA 4RW9B 4R0EA 2LLZA 4O4GB 2ZITA 5M2PA 2WVBA 1JQGA 3SI8A 2YTCA 2Z58B 4I69A 4FYVB 4LF9J 3J81Y 2X3GA 3NKYA 4RBUA 3UR3C 4DSJA 4NEYA 2JH3A 4HHHA 4TYBA 1Q1KA 4G3IA 4RPFA 3T5KA 2EBGA 2VIHA 3JSBA 2R7WA 2EK6A 2FC8A 3CJRA 4DR3F 4CRJA 1SJ4P 1HR0J 2UVVA 1U8SA 1MMDA 2YXLA 2DHXA 1KQSR 3DRSA 1WC1A 2H54B 1NLKL 4CT9A 3D4JA 4GVBA 4NLTA 4LF7J 1TELA 5B0FA 2KFZA 3CD5A 3NOGA 3Q83A 1VHIA 1IKYA 1C0UA 1T94A 2DGSA 2CDQA 3FC9A 3M32A 4LR7A 4LSLA 3UWTA 1G2EA 4N76A 4F4XA 2VC1A 2XNRA 1LWFB 1FXRA 2M5YA 2KL8A 2OHDA 5DQGA 3TVYA 4OYBA 2QE5A 3CE8A 3QGHA 5T7LB 1PC4A 2FZGB 1B70B 2YNIA 3DU6A 2E29A 2LYVA 3CJ2A 4NI2A 3IR7B 4JI2F 4RU9A 4CLLA 1URNA 4W98A 2R8IA 4I7FA 1TKZA 2AMCB 2CQIA 3MR2A 4IDKB 3PVXA 1VQPS 4UY85 5F8GA 3G6VA 4G1IA 1KHWA 1H2TZ 4DV2F 2C3PA 2DHAA 2HLTA 2V4QA 1MROB 1QAYA 3ZTRA 2G9OA 1N8RT 4DUYJ 2QYGA 1GFWB 1XWLA 3DKDA 4JYAJ 2QJ3A 2W8LA 2DPIA 1E6VB 1UJ4A 2AWZA 3CJKB 4J91A 3TX0A 2YPZA 3VR1A 1HR0F 2ZDPA 4FYDA 1O6XA 2B6AB 2CA9A 2LEAA 2VBZA 2IJNA 1UPPA 3R97A 3UDVA 5J1PA 2K7JA 3CD7A 3Q2TC 3T1HJ 3GCXP 3U1LA 5FIIA 4H4KA 3KLFB 5C5JA 1QTMA 4DLEA 1FJ7A 4OYPA 2XMAA 2KB2A 3NCQA 4UOGA 4W92B 1V3SA 1FO1A 1M1HA 2ZOMA 1FKPA 4O23A 3H5SA 3GIJA 3AXKA 2VG6B 3BKTA 4X66J 2A3JA 2UV8G 4C3MA 3OJUA 3BPSP 3UCUP 3RW6A 2GCFA 4CLTA 4ZHRA 1JKHB 3NCPA 4NX9A 1KQFB 4C8NA 5JXSA 3M30B 4NRTA 5CAAA 5J2MA 3T9NA 5JUMA 2GNKA 2HFVA 1Q7LB 1F9FA 5F3TA 3OSNA 4KGVB 5KFRA 3PHTA 3DGPB 3QT7A 4DWIA 2KFNA 2EEYA 3SZ2A 3NXZA 3MMAA 1S0VA 4DV4J 9ATCB 3V4IB 1HWUA 3NCRA 1DTTB 4GO7X 4OIXA 1F2GA 2ZOFA 3E3XA 3SDEA 5B08A 4OZ1A 4CP5A 1HL6A 3D6HB 4OX7A 3OTDA 2I6WA 5T14A 4DUYF 4ECYA 5J2QB 2QSFA 1BC6A 3ISZA 2RDDA 1C1CA 2P8IA 2VBWA 3EZ5A 5HQMA 4F4YA 4QR1A 1CSJA 3AQOA 3M6WA 1K8AT 4KJIA 1LK5A 3U7JA 3CNQP 2DH8A 4HL9A 5DETA 1S79A 3MUVP 1DLOB 3DOMA 2ZH5A 4CI0B 1PG5B 1WELA 5A0YB 1IKWA 3C6UA 3KLHA 1KR4A 4G1PA 4JI4F 1VQNS 3G9CA 1FWLA 3FMWA 5E33A 2CZ9A 4PZVA 5KFGA 3BH6B 3BZQA 3TUZC 1RHQB 2KYXA 1YJ9S 2IBOA 2DK2A 2NYIA 2NPIA 5GAEU 1W25A 4ZIWA 2W01A 3IBFB 4NZ0A 1PBUA 5AE3A 1CJUA 1NK7A 5HBMA 4JI4J 1Q53A 3OTBA 2U2FA 5L1JA 3QGPA 1DQAA 3SXLA 5IC4B 2J6TA 2GJFA 5KFTA 3ONQA 2CQGA 2LDYA 4PWUA 1WHVA 1C1CB 2BMBA 3NGRA 2YX1A 4OZNA 4PCQA 3OPKA 3NS5A 4RR5A 3JTPA 4U95A 3N5FA 2R8HA 3PZPA 5CYMB 5DRKA 3M8RA 3MEKA 1YHQS 3S8SA 3ZZUA 1AYEA 1TL4A 2D69A 3ENWA 5EGYA 2C28A 1T0TV 2OPRB 3AXMA 3FKBA 4CLSA 5LSOA 3KUEA 5C25B 1LWXA 2YQ1A 3M9OB 4J9SA 4F3OA 3OVAA 4WTYA 1NK5A 1UWBA 3AH6A 2QN6B 1TAQA 1BUXA 2LXUA 2HHQA 1U0SA 3IWXA 3MI7X 2HS4A 2KYZA 3EJMA 2ZZMA 4O3SA 4K59A 1X31C 1RWMB 4DX8H 3QT5A 4V1Ak 2WBRA 1XMBA 4KPCA 3ZZOA 2W9CB 3KLHB 2ZDOA 3FSXA 2BQUA 3O3LA 1EHWA 1UETA 1HFEL 2W1BA 3N6LA 2WW8A 4C6AA 3W7BA 3AY0A 2IAJA 2PT0A 1S9GB 1TL5A 4LT6A 5A2QU 3LO3A 3IGVA 1HBUB 2FHKA 3A8JA 5BJRA 1PJ7A 3RB0A 2VA3A 2ZE2B 2HSEB 3C6TA 5CCMA 1WHYA 3LW5C 4PKDB 2HK2A 1OSCA 4M5LA 5KG0A 2VOOA 1HBOA 3NGKA 2BUNA 3CIMA 3FMBA 4CM0A 5BYSA 2MKYA 1UP1A 2OMOA 3MMAB 4C0BA 4DFMA 3V4MA 3TA1A 2OFGX 4KFBA 2NREA 4RW8A 4YQWA 1U1RA 1CLFA 2AT1B 2M70A 2OFHX 3O1LA 2J0SD 1YDLA 2DNRA 5JVGQ 4J9VA 5KFBA 1EP4A 1WORA 3K8VA 1CVJA 4NLXA 2OPSA 1M5HA 3J7ZT 3KHLA 1NJIT 3WX8A 3DDIA 3H20A 2HS3A 4J9KA 2E5IA 2H4YB 1L3VA 4JI3J 2AF6A 3VHQA 5L38A 3GLJA 5GMKa 4FNHA 4DCPB 1XR7A 2NLWA 3OL6A 4TY8B 4F0HA 1NJXA 1XNQJ 2HNZB 4QIVA 4YMEA 4EBCA 2IC3A 1XIQA 3CDEA 3NWGA 2O1PA 1RT2A 1X4GA 1TU0B 3LWLA 3DLBA 1VRQC 5D15A 2CNLB 4DL0C 2ZC4A 2RE1A 2F9JA 1Q8BA 1Y4ZB 4OYIA 4ZJQA 2V5HG 2XCPA 2V67A 1XMOF 3EZOA 2Q66A 2DH7A 4LBHA 3W5XA 1FEEA 2CJAA 3C15B 2YWWA 4DPOA 2C42A 2YKQA 5KFEA 3KG1A 3R5GA 5RUBA 4JV0A 2KXFA 4OX8A 5KFKA 2RQKA 3SIPB 3OHAA 4TLQA 1YX2A 3CJ5A 3T41A 4K7QA 2GC8A 4CIOA 2Z8QA 4NE9C 4CO0A 5A8KA 5AJ3F 3LAKA 3S6EA 3B54A 2VBXA 1R0BG 3C19A 4I2PA 2Y0SD 3T9ZA 4G1QA 1AFIA 1HMVB 5ETNA 3UI3A 4BDPA 3RAXA 1J5EJ 3IAS9 1N5QA 2BQ3A 1FKAF 1EP4B 1FFSB 1HNIA 1O8BA 4UF4A 1H2VZ 2YWKA 5DGBA 1SKSA 4K4VA 2ZH8A 1YLXA 2HFSA 4RWXA 1S1TA 2F8MA 3M2UB 4HVZA 5IWAJ 1FRXA 2LVWA 3D0HE 4ECXA 3KUHA 5HVGA 3FCWA 1NRKA 3DRRB 1RK8A 1F5BA 2V4RA 2QSWA 2DGXA 4P2FA 3CCSS 4XO0A 1R89A 3HJVA 2QLJB 1X9SA 1T9TA 5F9LA 2R8GA 5DO2A 4LR9A 2IRUA 4ZVHA 3V5RA 3KMSA 3HM9A 1BY9A 3O6QA 3A1YG 2VQEJ 4ILLA 1N32F 3SCLE 5FLXY 2A2CA 2VPYB 1MWZA 2ZBPA 1QAIA 5ETQA 3HMJG 1NK4A 5HI7A 2W7OA 1X0FA 2AYGA 4UUXA 4URGA 4EZ9A 3MOZA 5I3UA 1UW9A 5L1LA 5LMUJ 4I2QB 5HLFA 1M5VC 2RRNA 3ITHB 2OH2A 1R27B 4KO0B 1FX2A 2PMZD 4HT7A 4DSIA 3TANA 1N88A 4RWWA 1S0MA 4ZLNA 3CULA 1RABB 1LKZA 2VL1A 2AGQA 2P9CA 3BM7A 3GCWP 3VQTA 5CYJA 3MUMP 4RUAA 2GZOA 3F44A 3CCTA 1IBCB 3GYGA 2OSRA 2VFRA 5FJ4A 4L3NA 3DDKA 1HWKA 1Q5VA 2KRRA 5K8PA 3NGTA 4J9UE 2EKYA 1MMNA 4P6QA 2XZDB 5D0EA 2ZFHA 4X4SA 4Y2KA 2AJFE 2MLYA 2IAJB 2OPRA 4KGXB 4J9MA 4NLUA 4ERDA 3I32A 2O5DA 2XG8A 4DX6A 1CS4A 2B7BB 2X1FA 3GJSB 5DQHA 2OJ3A 1UJ6A 1YKWA 3JQKA 4J9NA 2ERRA 4ANCA 4K0KJ 4IO9Q 1AFJA 8AT1B 2FQQB 1T7PA 4FZVA 3SBMA 5LJ5Y 4TLRA 2J0XA 2DCUB 2XI2A 5D3GA 2JWNA 2QTWA 4C8LA 3CO0P 4WU3A 3TJ8A 3K5NA 1M5SA 1FTCA 5D4PA 4DR7J 4WXWA 5IC6B 1HQUA 1OJ4A 3H59A 4CO5A 2IDEA 1RBOB 2YQ3A 5KG1A 3B8HA 1QE1B 4PXDA 2EFQA 1GXTA 1CC7A 4M5NA 1SC1B 2ZC3A 1UWAA 4GVBB 4RLEA 4ZP6A 4R0JA 4WFBQ 2VU5A 1HYSB 2OPPA 4ZCLA 1ZPVA 4N7TA 4HI1A 2L08A 3JQJA 3MM7A 1QSLA 1JNRB 3Q8SB 5GADU 1MWYA 2VDIA 1HPZB 2RDJA 2GHPA 3J81U 3J80Y 1S1UA 3PJXA 1JLQB 1IR1A 1TR0A 5KFHA 3PV8A 1RLDA 5DZ6A 5KFSA 3RTVA 5HAOA 4X4NA 1FEHA 4G1QB 4C8ZA 1E6YB 2ZHBA 3K0JA 2JLEA 3JSRA 3KDNA 4X66F 4ZJOA 4AUKA 3BO2A 3A3OB 1T9XA 2YNGA 2F5GA 5KFMA 3SQGB 1X4DA 4UZBA 5FDLB 2AJ1A 2M9KA 2G2YA 2VG5B 1VQKS 2GHVC 2AX0A 2MMYA 2CJKA 4LREA 2CQCA 2DNMA 2LQ5A 3QBCA 3M8QB 4NASA 2HVDA 3NEKA 4PWDA 1Q8KA 4X4RA 4B9SA 2KRBA 4FXWA 3CD0A 5DDPC 2D3O1 5K9FA 1U1KA 5IV3A 2UUBJ 1D1UA 2C2NA 1F5CA 2UVRA 4OI6A 5C2CA 4BWMA 1WKLA 1HLWA 3GIKA 1IWAA 1QUPA 2V63A 3DOKB 4LF2A 1YJNS 4JI8F 4IR1A 2E5HA 1Q95G 1NH7A 1R6VA 3KXDA 4TY8A 2GQCA 4LR8A 5J2MB 5DM7Q 3FGVA 1X9MA 1RAGB 1XJWB 1RACB 4PQUB 1C0TA 3DHWC 3IMQJ 2K3KA 5CYQA 3EGNA 3MFIA 1VQ7S 3LGMA 2CQ4A 3M6UA 3UW1A 3MPVA 2KFYA 1FRLA 3ZTQA 1Q16B 2DXEA 3PJWA 5CHCB 3SQOP 1TAUA 3HHLC 2AX1A 1RAAB 2LQJA 2CWKA 4MYUA 1YBAA 5BR8F 3Q8UA 1VQSA 4M95A 3D3CJ 1RBAA 4MK7A 3TEGA 2QG9B 1F6TA 5B0DA 3BO3A 1VC5A 1FRKA 2Z30B 3TEHB 3KLEA 4W4MA 5IV4A 4GKJJ 2MZRA 3FSYA 3KYLA 3AD8C 4GVLA 4O4RA 1LEOA 4JOUA 5AT1B 5L9XA 3AA8A 4H4MB 1KOHA 4QWCA 4ZLPA 2W9BB 3RB4A 3L4BC 2W7AA 3QNWB 4F26A 4C0OC 1FXDA 4HEA9 2DHSA 4IOAQ 1MU2B 3AB4B 3D6MB 3MAAA 1VGYA 3TWZA 4LFBF 3I4HX 3EXCX 4LF5F 1S1TB 4KAIA 3W3SA 4CLFA 1JJ2R 1QE1A 2WVDA 3QYYA 3A8EA 3JTOA 4DSFA 3ZTOA 1SKUB 1U2FA 3AHPA 4LBPA 1UJ5A 4AYBD 4DL6A 5KFOA 3BPDA 2A1BA 3ILLA 4GKKJ 1GQEA 2OPSB 3PG9A 4B9TA 3C3LA 1RHUB 2VODA 2UZAA 4Q45A 2J8SA 2K1RA 3B4MA 1RGVA 1FFWB 2KZMA 3AJ1A 1AROP 5AXLA 1X60A 3VZHA 1EQ0A 2B9XA 2RQCA 1AXQA 1RDRA 1RWOB 5ETKA 2QL7B 5HQLA 1WHXA 1IBKJ 5C25A 1U6ZA 1KN6A 4FYWB 5DS7A 2RUSA 2W2QP 4QWAA 1NUEA 5KT7A 4ECWA 1N34F 4RNFA 2K06A 3WIUA 4NL5A 4RU2A 2MQPA 2CVIA 4HTIA 5CA5A 3JYTB 1MWQA 2OO4A 3HPOA 3H90A 2N7CA 4EWTA 3P5TL 4K0KF 3LQVA 1C2PA 4E8UA 4JI8J 2CXEA 3R27A 2JZ5A 3MM5A 4GC6A 1T9WA 4JI1J 4FBUA 2QLWA 4ZJLA 1D09B 2MLZA 5THWA 7FDRA 4C8MA 1FRJA 1Z2ZA 4LRBA 3J81j 4DV3F 3CJ3A 3BGFA 1IQTA 1NKEA 4DR6J 4OZJA 4J5OA 2BX6A 4B9MA 3RW7A 3SEOA 2AD9A 1YJUA 4G6VB 3ETOA 1C4AA 4JI0J 1RKJA 4WFAQ 4FF2A 3PEJA 4ED1A 2VHGA 3KOAA 3BDEA 3GILA 3R2CJ 3KLFA 2B3TB 2LDIA 5CZVA 4KHMA 2PA3A 2VC0A 4EI2A 4Z2XA 3MD1A 2F63A 2YKPA 4ZN1A 1HNZF 3NP5A 4TU8A 1TUVA 2H3EB 4Y65A 4ALZA 4LRFA 5KG2A 5D4OA 4TQSA 5IFMA 2R9LA 4OX9F 3QFHA 5D0RA 2ZBQA 4OJ1A 3OW2R 4IG0A 1XR6A 3MEEA 1R0CB 3IFEA 2YKNA 1U2CA 4KRWA 5KG7A 2E9ZA 2XEXA 1CBKA 4KGKA 1U1LA 2E7XA 1C4CA 2HURA 4MK8A 3CO9A 2CPYA 2XWXA 5BYQA 3W8PA 4KV8A 1UCNA 1WC5A 2LXFA 1FERA 1F9EB 2RS8A 4MKAA 4H4OB 2RS2A 1AB8A 1YJWS 1VQ8S 2NYHA 4AT1B 1PYSB 2OELA 4NCGA 2DGQA 2IM0A 4OX6A 1JLEA 3BYPA 4ILRA 4I6YA 2BANB 1HNWJ 4ICLB 2GVZA 2BW7A 4LJMA 4D3HA 4X4TA 1SBRA 5T41A 5DLFA 1TTHB 3BF4A 1OWXA 4OYMA 5IQ6A 4LIRA 3FSIA 3TX8A 4BC7A 2UUTA 5J2PB 3OFFA 3PM9A 3PW4A 3HULA 1IR2A 1HHTP 2W25A 5J2PA 4F3MA 4ZKAA 5DLGA 2R7QA 1W2BR 1N34J 4HDGA 1GXLA 2CUYA 5B0EA 2FHMA 4N5SA 3TAMB 3UO0A 3J7YU 1S97A 2COLA 2NSCA 1ITPA 3DDNA 2XZTB 3UNYA 4CTAB 5DDQC 4IYQA 2AYMA 1TK0A 2IA0A 1N36F 4P7TA 1HI0P 1NB7A 2DIVA 3C14B 1N0VC 4DLGA 4UY8T 2MKJA 3UDCA 3K5MA 4YR3A 3BS9A 4J9RA 3SV3A 1X4AA 1HKAA 4JV5F 2LA4A 2VG6A 4NA1A 5A76A 1U1NA 2XS2A 4FPRA 3C15A 2KHCA 2CQ0A 2M4MA 5ETOA 3KHGA 4QJVA 5KFPA 2HZVA 2XWYA 3OFEA 3BO4A 3TZYA 4LF9F 2RVJA 1S1WA 2QA1A 4DU8A 5LOQA 1HARA 5IWAF 3R7BB 4OHYA 1T3NA 2WTFA 1V3ZA 5KTQA 3K59A 1K9MT 4CDIA 4H4MA 4O0NA 1E6VA 2H65B 2BM0A 2ZZTA 5F41A 3CMQA 2HGNA 4WU2A 1XMQF 2I38A 3VZIA 4D3GA 2VJVA 2L9WA 4A46A 3AA9A 2B51A 2LU1A 1I5OB 1V6HA 1VQ6S 3POTA 4NLOA 2UUCF 1S9GA 1SI9A 3GTYX 2WAQD 1RTDB 1J27A 1VHFA 1TKZB 3ICLA 1WNEA 1PCAA 3A12A 3RBEA 1SCJB 2IIHA 2PC6A 5D4NA 1RWXB 3BBCA 4DSEA 5K20B 4ZPTR 3VALA 4K4YA 4BWJA 3P5BP 1RP5A 2FB0A 4CQ1A 3MR3A 2HG4A 3CCJS 4RNHA 2EK1A 2NXCA 4F2SA 4K50A 4N56A 2WZ1A 1HW9A 1R8AA 2W2OP 1RKIA 4Q44A 1TKDA 4A47A 1FRMA 5EWFA 2FGOA 3L9ZA 5HK4A 1GNKA 2HRYA 4FF1A 4B3OA 1HD0A 2ILZA 4OZ5A 4DEZA 1U47A 2UU9J 2PEBA 4DPTA 3IM8A 1RISA 1JLAB 3P3DA 3PYDA 5DZ7A 3C16A 3PIPQ 3OTOF 1UTAA 1VYAA 3RBDA 3BQ0A 2M8HA 4ED2A 3RYLA 3M2RA 4U9RA 1HNXJ 2UUAJ 1ZAWA 1RXOB 1NKCA 1Q8IA 1AT1B 1Y00A 3KLIA 2VF3A 4PXCA 4CWBA 4AL6A 4YB7A 1HMVA 4X4QA 1T03A 4I2PB 1RTIB 3FUYA 4OZ2A 1UVMA 4PPZA 3MPUB 1KFDA 3PJ9A 2Z56B 2F4VJ 1K1SA 2KJWA 2PMHA 1X9WA 1EKSA 3CT9A 2JFKA 2F8EX 3MM9B 1D3WA 1X5OA 3IP0A 1P1TA 2GA7A 5HSPA 1RT1A 3MMBA 1AZSB 4NA2A 2HS0A 4RX6A 1KOOA 3CXCR 1L3TA 2FJXA 1IJEB 4DR7F 4IQXA 2HLUA 2B0GA 1CJVB 3KUGA 3EE3A 1ZAXA 3AQPA 2MSSA 5D0HA 4A4JA 4M63A 2CKWA 1B64A 5F8MA 2VPZB 1KRPA 1Y5IB 1JLAA 2EG2A 5KFAA 2OAUA 1LK7A 3UE2A 3P8BB 3V6HA 4WKYA 2AJ4A 3QGIA 1B0VA 1X4BA 3BSCA 4JI6J 2NR0A 3MXHP 4OV1A 4ZPAA 5KAKA 3H2LA 1I6JA 1FA0A 1G6BA 2ZBRA 3SDEB 1YRTA 4N47A 2N7YA 3OTOJ 4YEAA 5HN0A 2QX0A 1P1LA 1HNVB 2A10A 2CWXA 2MSTA 3GJQB 2AGOA 1U49A 2RRAA 1LXNA 4RNNA 1U02A 1VFJA 2KU7A 5KFLA 4KV8B 2QFIA 3OQ2A 1WEZA 4CYUA 3BQ2A 1QLNA 2C2KB 2YH0A 4HACA 4L72B 3DOMB 4ZVRB 2BM1A 3Q23A 2EW9A 1WC4A 3ZZTA 3MEDB 2XY7A 1T03B 1UFKA 1S59A 1TL7A 4NCAA 2W24A 1PSDA 2NSBA 1FNOA 2HYIB 3POTB 2J9DA 3RB6A 4OYWA 5I4MA 1SXLA 5SUHA 3M8SA 4M94A 3M1VA 3QT8A 2XMTA 3QLHA 2CJXB 2QYCA 2XTJP 2FPHX 3I87A 2XHCA 4OHZA 1KTVA 3LWMA 1WG4A 5MAOA 3BV8A 1Q7YT 2HPUA 3W61A 3OL7A 4ED6A 4PUOB 2GIQA 1AW0A 1DAXA 2XMJA 5AE2A 3GSDA 3GG0A 2BJ8A 3GFYA 4B9VA 3VAIA 4IG3A 4KTQA 4L74A 2W2PP 2N4DA 1RT7A 4XK8C 3QFWA 2V0NA 4F0MA 3X1LB 3SFGA 3EWGA 3QJJA 2JRSA 3LP0B 2Y3YA 3OL8A 1JKHA 1D9FA 1C1BB 1KTQA 1PAUB 4RBVA 1KEKA 2MDAA 2KHDA 1TL7B 2EG1A 2PA8D 3JSYA 4ED5A 2JHEA 2KT2A 2F65A 5E3QA 3R1LA 4QU6A 2H4WB 4KO0A 4WFNQ 1IM4A 1GTHA 4NPOA 1LQ9A 4ZPDA 1U1MA 1U4BA 1GX5A 2BJEA 2CNOB 4C11A 3GR0A 1Y11A 2AIRB 4O3PA 1NPPA 3D6TB 2BRKA 2W2MP 1X4HA 4LSLB 4URSA 5KG3A 4WP8A 2ZJRQ 2DGTA 2G0JA 1GMWA 2PMWA 1SKRA 1W7WA 3BGOP 4AD6A 4HHJA 4WF9Q 1DHMA 3DMJB 4L6V3 4AQYF 1HPZA 2JEFA 3BSOA 4MK9A 3FVYA 5I3PA 3ISND 2J7KA 3ZTSA 1VK3A 3IGNA 3DI6A 1U26A 3EGVA 3OR1A 4KBIA 1SL0A 4LFBJ 4ITSA 3W9HA 4DJBA 1WACA 3HZGA 5IT0A 1A0OB 4IFVB 1SB6A 3RU0A 3HD2A 2VG7B 3VAFA 2C3MA 2O01C 4ZA1A 1AZSA 2GAHC 4DPXA 3Q8YA 4C11B 4WTOB 1NMEB 3KHHA 3W65A 2LKZA 4JB8B 2C3UA 4M5IA 4ZVSB 1IKYB 1C0UB 2D41A 4F4AA 4JI1F 5AJ3J 1RHRB 2MLXA 3T1YJ 2D1CA 2W2NP 3AOBA 4Y0FA 2WSCC 1BQNA 1WC0A 1RCXB 3GR1A 2ASJA 3PRBA 2BE9B 1J5OA 3R5JB 4HH1A 2XHWA 3VVTA 4A8XA 1VQ9S 5J2NA 1FK9A 3HHLD 3GIIA 2KT3A 1WHWA 5M2UA 2OTLS 1Q8LA 1FT8A 2LA6A 3HHDA 1WSVA 3AD7C 4GRSA 2OPQA 1DQ8A 2DJWA 1MN9A 2GIRA 4OMFG 1SJ1A 2GMLA 5AXKA 3PO5A 3EDQB 3M8YA 3KJVA 3NAHA 3TYTA 5D0GA 2XMVA 1OQ6A 1SQGA 4L3KA 3RBZA 3QJPA 2CQ3A 5C24A 2B9YA 4QPTA 2BKNA 4ZVEA 4F7VA 1TL1B 2V68A 1YBUA 3GJTB 3TZXA 4YP3A 1CJTB 4PG4A 2XMMA 4DL3A 1DQ9A 3BBBA 1T9YA 2G13A 4KR0B 4ELTA 2YKAA 2J7WA 3PCOB 4EU0A 3UVJA 4ER8A 4A8SA 1UZDA 5C42A 1MNEA 3T5JA 2R7SA 1RWPB 2Z0GA 4YDXA 3VF0B 4YR2A 3RR8A 4DV1J 3BGRA 4DPWA 2DRBA 1JLCB 3GE9A 4ILMA 4ZIVA 1AUSL 1M1GA 5I42A 1S1XB 2GQ2A 1NXIA 3D1QA 1VR6A 4AXIA 2GHWA 4EYIB 2XLKA 1N4LA 3LPYA 5H9FJ 4UOFA 3DLEB 2M2BA 1QTNB 3CIZA 4HDHA 5E3PA 3TOQA 2EC0A 2DBBA 2WW4A 5B0BA 4ECTA 4NOHA 1O5JA 1M5OC 4YR0A 1FDDA 5KFCA 1NSAA 4NYPA 1N56A 3JS9A 1RAIB 3TA2A 1VQMS 3FRZA 1FHTA 1LW0B 1H7WA 4QIGA 1A7GE 1SQFA 2CVEA 1NDCA 2E5JA 4UQGA 4AL5A 1HBUA 1URRA 2AZ3A 3TJ9A 5ADZA 4WCEQ 3CJ4A 1WG5A 3BN4A 2VB6A 2F3JA 4RBTA 4P2XA 4PPDA 4CLUA 4IRCA 3Q8VA 3QMQA 3TZZA 4C8YA 4J9LA 4LVNP 2E5GA 5F8JA 1Q4RA 1SJQA 2FIUA 2PSZA 3K7RA 4TVAB 4IOBA 3W2VB 3MMCA 4Y2CA 3W62A 4B02A 5SZTA 2XMWA 1VIOA 2ILYA 2B7CB 4OZ3A 4DZ6A 1ZA2B 3J7A1 1S4EA 4MMOA 2GV1A 2I0XA 4QWEA 4DV4F 4WPAA 4K4ZA 3D0IE 3L3CA 2UXDJ 5KG6A 4ZVFA 2CG8A 3EM1A 3O44A 1M0SA 3WIVA 1RT5B 3V2UC 2W8KA 1ZTTA 1PO6A 2FHJA 3VGTA 3NMAA 1HNWF 4IR9A 1UWBB 4KKOB 1RT6A 1XNRF 2E1CA 4ID5A 2ALYB 2HQ3A 1S72S 5KFJA 2BW2A 3M05A 1UA1A 3NGSA 3KJVB 1WKKA 2DEIA 2HFNA 4DBQA 2L3MA 2F8HA 4FYXB 4O3OA 1DRZA 4CH7A 4FF4A 3CMAS 3A8IA 2ZNZA 3FDSA 4LQ9A 4RW9A 2OMLA 3VTIA 2MGZB 3N5BA 1XR5A 2D9PA 5HMXA 3HHNB 3M6XA 1XERA 4U8YA 3E8OA 2BE2B 2KVQE 2N82B 2JC1A 2A2DA 2GFFA 3W5YA 3OLBA 4EZ6A 1G1XA 4B3RF 2IA6A 5HJXA 5CD4A 1RWWB 4QPXA 2PD1A 4CO1A 1PC5A 2QA4G 1C0TB 4PQUA 2Y9HA 3R6GB 3ZO7A 4Q43A 1KVJA 2V2QA 3DLJA 4DR2F 1TKXA 3MMCB 2BACA 4ED8A 4O0IA 2G2ZA 1YGYA 2HAIA 1F1BB 3VGVA 4UTGA 1SUQA 5GAHU 4KFBB 1YJTA 2PN6A 3EMTA 3ETMA 5GMDA 4F04B 4MIWA 3KHRA 2X1BA 5KG4A 3MEEB 2X1AA 1YG0A 4Y2AA 2UUBF 5ETMA 4DI6A 4WK3A 3CDWA 4FPIA 4XPEA 3DXSX 3HSGA 4FKXA 3BEGB 2NUHA 2DD8S 3KWMA 5FD1A 1UVNA 3GV7B 3M1VB 4LVOP 5KOWA 2ATLA 2CDRB 2UUAF 4DSKA 1A9NB 4RO0A 3BQ1A 3FQLA 2ABYA 1FDBA 3D2WA 1SKWA 4DR4J 3PIOQ 2VKRA 1IR0A 5KT4A 3MEDA 4R5PA 4IO1A 2YVSA 2B8PA 5AXNA
chains in the Genus database with same CATH topology
4FF3A 1T05A 2Y1RI 2EPIA 3MF5A 4MKYA 5CZXA 2P6SA 4N8NA 2CG4A 1E6YA 2RF2B 2IFXA 2YY3A 3OBIA 4BS2A 1C1BA 3FQKA 3GFZA 3Q2SC 1P9QC 3T6BA 2BE2A 5DDRC 1KLMA 2MQNA 1VS3A 3ENQA 6FD1A 3KK3A 4KGMA 2KM8C 3SSQA 4F50A 2DNQA 1FTRA 4M5DA 3U1MA 3BGLA 1GAOA 1VJWA 4F2RA 1M5PC 1FD2A 1OIAA 4F67A 2ACYA 3VWSA 4QBUA 4Q0BA 5J1EA 2GJ2A 3THTA 5CCLA 1K1QA 5H1SV 3PKYA 2UP1A 4O4GA 2KZZA 5J2NB 1IBMF 2IBKA 3PFEA 2IYIA 4KB7A 4F02A 1RT1B 2C3OA 3M9NB 4IDKA 2QRRA 3LANA 4J9PA 2K3IA 4K2XA 2DIUA 4O3RA 4A8WA 3UNGC 1RT5A 2RUGA 2RKIB 3M4XA 3N9UC 2J0WA 3DOLB 3NRBA 1KD1T 2K2PA 3PW2A 2RDIA 4DQSA 3S1TA 4YB1P 1F60B 4MYTA 2M7SA 1KQKA 1F5AA 4F3QA 5KFVA 4ZPBA 3IRXA 4WYLA 4DN0A 3MR6A 2IM2A 2LQBA 3RRKA 4DDFA 5KT2A 4I64A 2B43A 2WB4A 1Y0HA 3KK3B 1U24A 1WD6A 3PHEA 2JC0A 1JXEA 3TP2A 4WFYA 3CB4A 4TN2A 2GMJA 3L95X 1U1QA 1S99A 1BQXA 1CQMA 1WTFA 1L3SA 3DN9A 4HTJA 3CWJA 5IZHA 1UVJA 4KSEB 2VUGA 4FN5A 3FZ2A 2DO0A 3QIPA 2N3OA 2XS7A 2HMIB 1EETB 3R5CA 4K4UA 4E98A 3THVA 4B08A 1HNVA 3HT3A 3BSAA 1FXLA 5HP1B 4OJ3A 4IG3B 3DOKA 2AW0A 3PACA 3QWPA 1HBNB 4I0WA 2WB1D 1KONA 1JLBB 4J9OA 2B6AA 4USHA 2WONB 2V94A 2IMWP 1SH3A 3V81B 4YDDB 3IRXB 3E01B 4PWDB 5J1NA 1X8DA 1IQZA 4JV1A 4QR0A 3Q8RB 1AUDA 3KK2B 1HNIB 4PG8A 3VAKA 4F4WA 1S76D 1TVRA 2K7KA 1L5UA 1H2UX 2RD5C 3CJ0A 5HQ8A 2FHJD 1L3KA 1JK9B 2VASA 1LOUA 2BDPA 2EWHA 2N3LA 5E5NA 2E5LF 3MM5B 4U67Q 2HHHF 5K14A 4MIAA 5E7OB 5G0RB 4DQRA 1PO6A 1OO0B 3MURP 5GADI 3MTKA 4ZCMA 1HI8A 4WE1B 5KFQA 4ZCIA 4DV7F 1IKVA 3H5XA 3OVSA 3GV8B 4QZVB 2G4BA 1XK8A 3RZAA 2KKHA 1F0XA 3J7YI 2R7UA 1VQ4S 2FTRA 2EFGA 1MU2A 3V6KA 1RYRA 3R5DA 4ECRA 1TKTB 3KG0A 3FFIB 4NLYA 3T3FA 3W2WB 4QWBA 3G6YA 3MEGB 4OLOA 3OHBA 1U48A 2KDOA 2V8DA 3OTEA 2O67A 2U1AA 2XULA 2XZWA 5ITHA 2NS1B 4QW8A 4PXEA 3CCQS 4NCGB 3CEDA 2KTQA 3GB0A 2IRYA 2L48A 2LU2A 3G8TA 2CJ9A 2GQQA 2XCAA 4C4WA 2B4OA 2PIIA 3I82A 3UQSA 2O3DA 2GO9A 3D5MA 2CPXA 3QGGA