3TAMB

Crystal structure of hiv-1 reverse transcriptase (k103n mutant) in complex with inhibitor m06
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
424
structure length
403
Chain Sequence
IETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Reverse transcriptase/ribonuclease H
publication title Design and synthesis of pyridone inhibitors of non-nucleoside reverse transcriptase.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
total genus 106
structure length 403
sequence length 424
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2011-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3tamB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3tamB03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3tamB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3tamB04
4Q45A 5DLGA 3BQ0A 2C2EA 4GC6A 4FBTA 3JSMA 3H4BA 4RW9A 2OPQA 4ECXA 4IH7A 2YKMA 4O4GB 2GIRA 3QGIA 1S1XA 2JC1A 4K4ZA 2W9CA 1RYSA 5KFCA 1S49A 4OL8A 1IKVA 4I2PB 5J1EA 3I5BA 4WZMA 2IC3B 1TP7A 3PW7A 1KLMA 4TQSA 4IDKA 3KLGA 1C1CB 2ASJA 3HVTA 4WXWA 1JLFB 3SFUA 2C22A 1ZTTA 3RBEA 5KFTA 5I42A 3DOKA 4MKBA 3CJ4A 1HYSA 4ZP6A 3LAKA 3MEEA 2D41A 2FVPA 5K14B 2FVRA 3N6NA 1LWEA 3C6UB 3BR9A 4R0EA 4RNNA 2BQRA 1TVRB 3MEDB 2ZD1B 3DM2B 4I2QA 5C25A 2WHOA 2VA2A 2YNIB 3QIDA 3M9MB 2VG7A 3UQSA 3TAMB 4ZMMA 5DQHA 3RAQA 5JUMA 4G3IA 4M94A 2RDIA 5C5JA 1S9GA 5F8IA 1IM4A 1LWFB 4EBDA 3RAXA 4JV0A 5CYQB 1BQNA 1JLEB 1S1WA 2AWZA 4KB7A 3GV5B 5C24B 5F9NA 1EETA 4HYKA 4K4VA 4WFZA 1N6QB 5L1JA 2IM1A 3IGVA 1JLGB 5CYMA 3KHRA 4MIBA 4MKAA 4GC7A 4NLVA 1T03A 5KT4A 2AQ4A 5T14A 2QV6A 4IRCA 2FJVA 4Y2CA 4K4SA 1JKHB 3GILA 5KFAA 2D3UA 3KLFB 3GV7B 2CJQA 4URQU 3I5CA 4O3NA 4ECTA 1KHWA 3D28A 5KFUA 5FDLB 5C42A 5F8HA 2VA3A 4IKAA 3OLBA 2J6SA 4I7FA 4KFBB 1J5OB 4JV1A 4NCGA 2HWIA 3CWJA 3RB0A 3DLKB 4H4MA 1NNDA 4RW6B 1I6JA 3IRXB 5KFFA 1HNIB 4MK8A 2HNYA 5I3UB 4RNFA 4MFBA 4IG3B 4B3OB 1XR7A 1JLCB 1W25A 1JX4A 1HQEB 4WFYA 5F8LA 4O4GA 1S6PB 4YR0A 4WZQA 3DOLB 2UVVA 1JLAB 4IH5A 4MH8A 1HNVB 4I2PA 1EP4B 4TY8B 2IC3A 3Q8RB 4NLOA 1N56A 2RDJA 5KFDA 5KFKA 1C1CA 4ID5B 1S6QB 5KFZA 3N6LA 1JLFA 3M8QA 2HWHA 4J9MA 3IS9B 3LP1B 4U6PA 2W8LA 1SV5B 2R2UA 4O44B 3KK2A 3V4IB 1OS5A 3NAHA 1XR5A 4EBCA 2ILYA 1XR6A 3C6UA 3MEDA 2ZD1A 1YVFA 4DEZA 4F4ZA 2YNIA 1D0EA 4O3RA 4ZP9A 2WRMA 5HP1B 3KHLA 4ECWA 4R8UB 5L1LA 1N48A 1S1VB 2VG5B 4Y34A 1RTIB 1HPZB 1LWFA 1FK9A 4RW8B 3I0RA 2RF2B 1TL3B 4XPCA 3QGGA 4TY9A 3OL7A 3LAMA 4URGA 2IA6A 3KLEB 1JLEA 3DLEB 4NLTA 1N4LA 5EWFA 3PW2A 5C24A 2IBKA 3V6KA 2UVUA 3OL9A 4ICLA 3MECB 1TKZB 2BE2B 4IG0B 2HAIA 2XCAA 5DLFA 1JIHA 1VRTB 2BQUA 2JEJA 1C2PA 4Q44A 3HHKA 4IR9A 2IM3A 3BGRA 4RU9A 3DRPA 4KO0B 1HQUB 1BQMB 3HVWA 4O3OA 3QLHB 2WONB 3M9OB 3KLFA 4NLXA 3BSAA 2HNZB 5DG8A 2V4RA 2UVWA 5KFLA 2J6TA 2ZE2B 3H59A 3H2LA 3G86A 3BJYA 2J6UA 5FDLA 1RTJB 1S48A 4EEYA 3KNAA 4O4RA 1J5OA 4RW7B 4TXSA 3Q8QB 5KG0A 4QWAA 1FKOA 5KFQA 2C2RA 2W9AA 1HARA 3IRXA 1LW0B 1HNIA 5KT5A 1S1UB 3LALA 5I3UA 2YNGB 4WFXA 3E51A 4B3OA 4PWDB 1JLCA 4ED0A 1HQEA 4MK9A 4K4XA 1S6PA 3QGHA 3DOLA 3SI8A 4XO0A 1HNVA 4Y3CA 1FKPB 4ZPCA 5KG6A 5KT3A 1EP4A 3KLHB 2I1RA 5DG9A 4LSLA 1SH2A 4F4WA 5EWGA 1S6QA 3V81A 5D3GA 3PJXA 2W7OA 2R8JA 1WNEA 3T19A 3IS9A 3MEGA 5J2PA 4EO8A 1SV5A 2YKNB 4IFVB 3FFIA 4O44A 3V4IA 4Q0BB 2D3ZA 2JEFA 2HMIB 2F8EX 1RTHA 4FS1A 4DL2A 1DLOB 1DTTA 1LWCB 4ECYA 4ZP8A 3LANA 4J9SA 3E01B 5J2QB 4RZRA 1RT3B 1S9EA 4ED1A 2AGOA 5JXSA 4YR2A 3MR6A 3OSNA 5HP1A 4F50A 5KFOA 3DRSA 4R8UA 4K4YA 1S97A 2IAJB 3TQ1A 1S1VA 2IJNA 1N5YB 5KFBA 1RTIA 1TKXA 4NLSA 3H4DA 4J9LA 4RW8A 1TL3A 2RF2A 3MFHA 1R0AA 3KLEA 1VRUB 3DLEA 1JXLA 2WTFA 2OPPB 3ITHA 2XGPA 3DRRB 3MECA 2R8KA 2BE2A 4ZP7A 3IGNA 5F8MA 1TKTA 3GQCA 3I0SB 1JLQB 1DTQA 4R5PB 4KO0A 4ZVHA 1BQMA 3DMJB 2IJFA 3QLHA 2WONA 2R8GA 1TV6B 3KK3A 2B43A 3FQKA 3CIZA 4QWBA 1QE1B 3PR5B 3GIKA 3H40A 2HNZA 1LW2B 5DQGA 2B6AB 3T5KA 4DG1B 4LQ9A 4RNOA 1IKWB 2RKIB 2OPRB 1MU2B 2HNDA 3PJWA 1S1TB 5L1IA 4FS2A 4ECVA 5J2NB 2WOMB 1IKXB 5L9XA 3GIIA 3C6TB 4RW7A 4MIAA 2JEIA 1RT4B 3HVAA 2XCPA 1QUVA 5KT7A 1S0OA 3PW4A 2YNGA 1RT5B 4PQUB 5KFGA 4IOBA 3LP0B 4NLDA 4YR3A 4EYIB 3CDWA 4RUAA 4O3QA 3OHBA 4LSNB 4X2BA 3M8PB 4K4WA 3KMQA 3UPFA 1UWBB 5KT6A 2XI3A 4ZVEA 3KLHA 5KFEA 4NLYA 2UUTA 1RT6B 4DL6A 3V6JA 4KAIA 4K4UA 4QW9A 3ISNC 4KHMA 4Q8EA 3H5UA 4F4YA 4QWEA 5F8JA 1QAIA 2YKNA 4IFVA 3JSMB 3DLGB 2OPQB 5K14A 3KOAA 1LWCA 1TVRA 4JV2A 3DM2A 4ZHRB 3GYNA 1RT1B 5KFSA 2W9BB 4IQXA 1RT3A 1C0TB 3IN5A 2IMWP 1IKVB 3TAMA 4NYZA 5J1EB 5HROB 3KK1B 3MFIA 1RTDB 3T5LA 3RB4A 1C0UB 4IRKA 3T5JA 3NBPB 5KG2A 4K50A 2IAJA 4J9RA 3CJ3A 3HVTB 1ZTWA 5CYQA 4TLRA 2DPJA 4RNHA 4LQ3A 1JLBB 1NHVA 5I42B 4KHRA 4ZPBA 5DGBA 1K1QA 1N6QA 2OPPA 4ED3A 4ED7A 1JLGA 3DRRA 3FQLA 3TVKA 4Q8FA 2YNFB 1NHUA 3PVXA 3I0SA 1JLQA 2JC0A 5KG1A 2GC8A 5KT2A 4R5PA 2R8IA 4FBUA 2YNHB 3H98A 4NZ0A 4Q43A 1SH0A 1JKHA 3KMSA 1S10A 3QZ8A 1RYRA 1TV6A 5KG5A 2C2DA 1QE1A 4TYAA 1LW2A 2AGQA 5KG3A 3KLIB 3NKYA 4ZVGA 4DG1A 4RW4B 5HBMB 1IKWA 2OPRA 1MU2A 3DYAB 5KFMA 1S1TA 3FSIA 2GIQA 5J2NA 4KFBA 4WE1B 1IKXA 5F8GA 4IFYB 4NRTA 3DLKA 4RW6A 4Y2AA 5EWEA 1REVB 4TN2A 5KG4A 3Q8PB 2W8KA 3M9NB 4IG3A 2AX0A 2I5JB 4YMEA 5KFPA 1RT5A 3KLVA 4RUCA 4KBIA 3PR4A 3OL6A 4ECSA 1JLAA 4LSNA 3M8PA 1T3NA 3JYTB 4TY8A 1UWBA 5EUHA 4XPEA 2AX1A 5KG7A 4F4XA 2ILZA 4I7FB 3Q8SB 3V6DB 4ED6A 4ID5A 1RT2B 2IM2A 4H4MB 1S0NA 1HMVB 5J2MB 3LP1A 4DL3A 2HNYB 3BSOA 4MFBB 4H4OB 1RA6A 2BQ3A 1SH3A 3LP2B 3CDUA 3DLGA 2V0NA 5L1KA 4ZHRA 3KHHA 1RT1A 4KKOB 2W9BA 3GV8B 4IR1A 4IH6A 3EPIA 3QO9B 1C0TA 5DG7A 3H5XA 5HROA 3KK1A 1RTDA 3G6XA 3CDEA 1C0UA 3NBPA 2VG5A 1KHVA 2XI2A 3DI6B 1HPZA 3DDKA 3I5AA 3RBDA 2ASLA 3UDLA 4IRDA 2AU0A 4QPXA 3M8QB 3MR2A 3KJVB 2V4QA 2ALZA 4TYBA 1JLBA 3IG1B 3KK2B 4PUOB 4NRUA 1SUQB 1RA7A 2OPSB 3GIJA 4K4TA 1TKZA 4ECZA 4IG0A 3D5MA 2BR0A 4WXOA 1VRTA 1RAJA 4DL4A 4U7CA 5F8NA 2FJWA 2YNFA 4ZVFA 3BQ2A 2WK4A 1HQUA 4NLPA 2BRLA 2UUWA 1IKYB 2YNHA 2O5DA 1TQLA 3RB6A 3G6VA 2C28A 3MR5A 3PHEA 4J9KA 3EPGA 1FK9B 2FLNA 3I0RB 5KFJA 2FJXA 3N6MA 2BRKA 4KV8B 1RT7B 2ZE2A 1ZETA 3KLIA 2VG6B 3PZPA 4RW4A 5HBMA 4MK7A 1RTJA 3DYAA 4ED8A 4ICLB 3MR3A 4WE1A 3CJ0A 3RB3A 4O3PA 3BSNA 1TL1B 1C1BB 2BANB 4IFYA 4HKQA 2WB4A 1T05B 4RNMA 3OHAA 4URSA 3BGRB 1LW0A 1REVA 1S1UA 3DRPB 4EO6A 4QWCA 2E9RX 5DQIA 4PWDA 2I5JA 3QIPB 4DL7A 2D7SA 4G1QB 3FDSA 4ZPDA 2JEGA 3NMAA 3H5YA 1GX5A 3GIMA 1FKPA 1RDRA 3JYTA 4EYHB 2FLLA 3OL8A 3BREA 3T5HA 2EC0A 3V6HA 5HLFB 2V9WA 4J9OA 3V6DA 5KFRA 2B5JB 1FKOB 1RT2A 2R2TA 2AGPA 3CJ5A 1HMVA 5J2MA 4M95A 2XC9A 2XWYA 5KFWA 4Q0BA 4H4OA 4RW9B 2HMIA 3PW0A 2UVRA 3LP2A 1DLOA 2YKMB 5KFIA 4KE5A 1S1XB 2ATLA 2OH2A 2W9CB 3NGDA 3E01A 5J2QA 4KKOA 3T1AA 3NL0A 3UR0A 3QO9A 4O3SA 2IM0A 1K1SA 4J9NA 2R2RA 1KLMB 1U09A 5KFHA 2XGQA 3G6YA 4J9QA 4EBEA 4IDKB 4LSLB 3KLGB 2R2SA 1N5YA 4YQWA 2FLPA 3DI6A 4WYWA 4YP3A 1CSJA 2FVCA 3QZ7A 3V81B 3CO9A 5D3GB 2FVQA 1T94A 4QW8A 2W7PA 3CVKA 4DL5A 1VRUA 3DOKB 3KJVA 3MEGB 5J2PB 2FVSA 1HYSB 5EDWA 4ECQA 3FFIB 3IG1A 3MEEB 4PUOA 3ICLA 2R8HA 3OSPA 1SUQA 1LWEB 1RTHB 2OPSA 1DTTB 4I2QB 5C25B 1S0MA 2ZKUA 4J9PA 1S9EB 3QYYA 2VG7B 3DMJA 4JUZA 1S9FA 1IKYA 1S9GB 3DRSB 4ECRA 3MF5A 1Z4UA 4ECUA 1D1UA 1TKXB 2JLEA 3VQSA 1BQNB 1S1WB 2B6AA 2WCXA 3H5SA 4NLUA 3EZUA 4KV8A 1RT7A 1R0AB 4ZPAA 5KFNA 1EETB 2RKIA 4ED2A 2ASDA 3BQ1A 2VG6A 1GX6A 2WOMA 2QE5A 4NLWA 4NLRA 3ITHB 5KFXA 4H54A 4NLQA 5CYMB 3SFGA 3C6TA 1T03B 1TKTB 1QAJA 3ISND 1TL1A 1C1BA 1RT4A 2BANA 3MTKA 4QWDA 1T05A 1DTQB 4WYLA 3PW5A 1MMLA 3FRZA 5KFYA 2DPIA 4PQUA 5F9LA 5DGAA 4KSEB 3LP0A 3QIPA 3BSCA 4TQRA 3KK3B 4G1QA 2CKWA 1S4FA 3OLAA 4NLGA 5C42B 3NAIA 2HNDB 2E9ZA 3KHGA 5KFVA 1RT6A 2E9TA 4NCGB 5HLFA 3HKWA 3CJ2A 2B5JA
chains in the Genus database with same CATH superfamily
3CCQS 4OZNA 4USTA 5ETMA 1WC4A 4OX8A 1CLFA 2C22A 1Q16B 2GHWA 1UVJA 2ZD1B 3AD8C 3GR0A 2AEJA 3TP2A 3EYZA 3PYEA 5DQHA 5A8WB 1GNKA 2AWZA 3GV5B 5C24B 4CT8A 1FVSA 1NSPA 3MM7A 5IZHA 4NMXA 1SIZA 1TAQA 2RHQB 3HSJA 5K20B 4F0MA 4LIWA 5FDLB 1XN9A 2VA3A 3OLBA 4V19X 3DLKB 3TJAA 2N7YA 5AJ3F 1SC6A 1YLXA 4DFMA 3IR5B 1FRLA 4X4PA 2ATCB 3UDCA 2LEPA 3J81j 2ROPA 4WTYA 2VUGA 2O66A 1MNEA 4NLOA 3MD1A 1IWGA 3FRYA 1S6QB 1LFPA 4J9MA 2XB2D 1PSDA 3UCUP 4DV4J 2DNKA 1SV5B 1S5ZA 1FJGJ 3NAHA 4F3QA 1CJKB 1REGX 2XMJA 1BLUA 1TK5A 1N48A 4Y34A 1B4SA 4C8KA 3W65A 2OHDA 3PW2A 4Q44A 3CMAS 2UUCJ 3M6WA 2QN6B 1SKSA 2DK2A 2XS7A 2RS8A 2P5VA 1UPPA 5ETTA 3HHLB 4EEYA 3UW1A 1NPRA 2G0IA 2LQJA 1UVMA 5LJ5Y 3LALA 2XMUA 2DIVA 3SDEB 3F0NA 2CYYA 1RAFB 2CPHA 2F9DA 1L3KA 4XO0A 4RPFA 5EGYA 5KG6A 2LFVA 1WKKA 1RWUA 2RUGA 4U7UD 4AQYF 4OZLA 1UFKA 5EX0A 2ZUAA 1FF2A 1GXLA 4PZVA 1N36F 4X4QA 3NGUA 3MECA 1FFSB 3I0SB 1WKLA 1BQMA 2B8PA 1P6TA 3NS7B 2B6AB 3H2VE 3IBCB 4FS2A 2CZVC 5J2NB 2ZDOA 3W9HA 2XYGB 4H4KA 4NLDA 1UWAA 4K4WA 2HLTA 2P8IA 4K4UA 3CSKA 4U8YA 4KQZA 2ZHAA 2Y1LB 1CJUA 1YBTA 3PFOA 1C0TB 3KK1B 3NBPB 2I6WA 4W90B 1AA1B 3DRXA 2XO6A 5D0EA 3ET6A 1MG7A 2KXFA 3WC0A 4CNZA 1NAQA 2YXLA 1R8AA 1RISA 4B3SF 2GC8A 4R5PA 4FBUA 2BMBA 3R5AA 4X66J 1LW2A 4FYVB 2DT9A 2OELA 1K44A 4X62J 1GMUA 4IG3A 2UUBJ 2XO7A 2KYXA 1E6YA 2M8HA 4LREA 1T95A 2DO0A 2D69A 4CLPA 2GVDB 1NRKA 1XTZA 1L3TA 2BQ3A 2Q3PA 3I9ZA 3KXDA 2QLJB 2M3DA 4IH6A 5K5MA 2HHPA 2CDRB 1H73A 2VV5A 2VG5A 1KHVA 2FJEB 3BBBA 2ASLA 1MWQA 3D1HA 2AU0A 1YZ6A 2YY3A 3A12A 1DRZA 2OPSB 3GB0A 1VRTA 3NOCA 4L72B 4ZVFA 2WK4A 3R6GB 2K7KA 1XMBA 1HBUB 2YX4A 2NZCA 3N6MA 4B3TF 2B9EA 3O2IA 3NNAA 1IVZA 4HKQA 3BH6B 4ZCLA 2W2OP 1PGZA 3EUNA 2BVZA 4UTGA 2IVFB 2I5JA 4QYZJ 2QFJA 2UUAJ 1BWEA 2EC0A 1IBMJ 4LFAF 1HWKA 2XSJA 4M95A 2DYAA 4DV7J 3LP2A 5KFIA 1JXEA 3W1YC 2QMXA 2RT3A 2IM0A 1K1SA 1BC6A 4QOTA 2KU7A 3CVKA 1FWLA 2NXUA 2G9OA 3I31A 4LJMA 1GTEA 3OSPA 3LPYA 1OMSA 2F9JA 2HFVA 2ZKUA 4C6AA 2RD5C 2V34A 2FY8A 3KWMA 1FFGB 1GX6A 2HK3A 1HI8A 1TL1A 1B7FA 2ZH9A 5DGAA 1X0PA 3N4WA 1YJWS 3EVWA 5ETVA 2HFZA 4OHZA 2H4YB 2KL8A 5CD4H 4FBTA 3CJRA 2OPQA 1C4CA 3ZTOA 2OEKA 3AXKA 1B99A 1HW9A 4IDKA 3D66A 3CJ8A 3WX8A 4OFZA 4F7VA 2DR7A 4UOGA 3BKFA 2BM0A 4WFZA 5HAOA 3TR5A 4XDCA 5KT4A 3LWMA 5A8KB 4IRCA 2ACYA 2FJVA 3ZZUA 1DZ5A 2DXFA 2Z56B 5B0EA 4O3NA 3AOCA 4KFBB 3IMQJ 3FKBA 3A3OB 2UXDJ 4WFYA 1FA0A 2HHWA 2IC3A 1GXTA 3K5MA 3GSIA 2F7VA 1TU0B 3QSYB 1P27B 3D1OA 3RW6A 1KRPA 1UP1A 4BBYA 1S7IA 1T11A 3GTYX 1WHVA 3KUEA 1G3OA 2W4PA 2HW3A 4ERDA 3I0RA 1QLNA 1HBOA 4NLTA 4GKKJ 1XWLA 2BE2B 3GFYA 3K5PA 1B7YB 3NWRA 2CVEA 4GO5X 2VC1A 2XULA 5E5NA 2CJXB 4NI2A 2W9AA 3NNHA 1GMVA 2JX2A 6FD1A 3PHTA 3PJ9A 3L7UA 2UXBF 4OZ0A 4CI0B 5EWGA 3WIVA 3F56A 3R5GA 1YJNS 1WKJA 5E7OB 3EICA 3JAMY 1AUSL 1FE4A 2H48B 5HP1A 2FLOA 1VRUB 3MM9A 2R3VA 1CVJA 3SZ2A 1R3NA 3HHLD 2O01C 1WOOA 3T5KA 4DV0F 4ECVA 2Y1JA 2HG4A 1IKXB 5CXTA 3HFKA 4X4OA 2DRDA 4DS5A 3LP0B 2VPWB 3A3NB 3KMQA 2AW0A 3V6JA 3HHNB 2KFNA 4QW9A 4YY3F 3M8SA 1VJQA 4CLKA 1QAIA 3PEJA 2AYMA 5D4PA 4JV2A 4RUHA 1RT1B 1VQKS 2L08A 2IHR1 2D3OR 3T5JA 5KG2A 4B3RJ 2MQPA 2ZJPQ 1K1QA 3I96A 5LSOA 2DH8A 3TVKA 2DITA 2YQ0A 1K0TA 4RW4B 1Q8IA 3FSIA 1U1LA 2KVIA 3M05A 1SKRA 1XMOF 4KBIA 3FMBA 2LXUA 2IBOA 1T9WA 4XPEA 3HX9A 1FDNA 2FUG9 1S0NA 2DNYA 2XMKA 2DHGA 2GO8A 2DGVA 2RS2A 2MLXA 3D6MB 2PE8A 1LQ9A 2LMIA 3I5AA 4EMDA 4LRBA 4PUOB 4BHQA 1TKZA 4B3SJ 1OWXA 4C48A 1TQLA 1N0VC 2C28A 1XJWB 2CPDA 5GAGI 3P45B 4KV8B 4A8FA 4ZVSB 5GADU 2E5IA 4NXNF 3QIPB 1E6VB 4LF5J 2CNLB 1V6HA 1FKPA 6AT1B 2NSBA 3CJ5A 2PIIA 2CPZA 5KFWA 2HMIA 3OTEA 4UQTA 3E01A 5J2QA 4KGXB 1QSLA 1J5EF 1RAGB 2R2RA 3VWSA 4YQWA 4I67A 2C1EB 2DR9A 5BYSA 1RTZA 4CO0A 4DPOA 2KB2A 3T41A 2HBRB 4B3TJ 4EBCA 2VG6A 1L3UA 3PNIA 4DR5F 4M5HA 5KFYA 5F9LA 2UXCJ 1S4FA 2G1DA 2D3O1 3CIMA 2XMMA 1HNWJ 1VQYA 2ZOMA 3CMQA 2J8AA 2BABA 4UQGA 4IH7A 4O4GB 2E1PA 3QGIA 1U6BA 5E3PA 4JI4J 1Y11A 2J7KA 1RCOB 1XNRJ 1JLFB 3EE3A 3TJ8A 4JI0F 2MEWA 3LAKA 1M0SA 3W5XA 2FVPA 3BR9A 4USHA 3M9MB 3K0JA 3M6XA 4L76A 4X4SA 3D67A 4G3IA 2RDIA 4K0KF 4EBDA 2V68A 2NYHA 3FSXA 3IGVA 2NQPA 6FDRA 3A1YG 1KFSA 3KLFB 1S77D 4OZ2A 1NBEB 3I5CA 4F04B 2JVOA 2J6SA 4DFJA 3GYGA 2HWIA 2R7QA 3ZNUA 2A6MA 2LVWA 2WW8A 1LXJA 4IG3B 4P10A 2M2BA 4UZBA 3PM9A 4FPRA 1HNVB 4I2PA 2PO4A 5C7PA 2DNHA 3DRYA 1XR5A 2R9LA 1XR6A 4OI6A 4N76A 2NPIA 4O3RA 1K73T 3HLUA 1PO6A 4ECWA 2FY1A 5B7WA 2VG5B 3VZHA 4V19J 2UVUA 5BYRA 4B9MA 3J7A1 1JMTA 2Z2LA 7FDRA 5DLFA 4O0IA 1IBCB 2JEJA 1VRTB 3PXGa 4LF6F 1WHYA 3IO1A 4QR0A 2Y8WA 3BSAA 2XNRA 2KT5A 1BHNA 1KQKA 3G86A 2J6UA 3K5NA 3ZC4A 1PIEA 2AJ1A 3RRKA 5MAOA 2UV8A 1S79A 2E5LF 2VPYB 3CJSA 2AYEA 1R8HA 1NO8A 3PJXA 2V8DA 4Q5VA 3THPA 4TVAB 3V4IA 2GMHA 3W7BA 4ECYA 2NXNA 1RT3B 4FYDA 4I6WA 1MROA 1TKXA 3CPWR 5DDQC 1OYDA 2ZNZA 3C16A 3VAJA 4FKYA 1NK5A 1TL7A 1FE0A 1NSAA 1CQMA 4LF9J 3GQCA 2FDNA 3EGVA 1JB0C 4WJBA 2MQNA 3HHEA 1W2BR 2E5HA 2B0GA 2C3OA 1U1RA 4RW7A 2LA6A 3PW4A 2HVZA 2A2DA 1T9XA 3HCXA 2I0XA 1H38A 2FPHX 3CDWA 3OD2A 3M8PB 3IP0A 4M5DB 3D4JA 2UXBJ 4OYBA 1ZPVA 4IFVA 2OPQB 1TVRA 4IQXA 2W9BB 2IMWP 3R9LA 4W92B 1U6FA 3CCWA 4RNHA 4PQAA 2ERRA 1D9AA 2RHSB 3FQLA 3EXCX 4KR0B 3EZOA 2EBEA 1SL0A 2XHWA 2D9OA 2NR0A 4Y2AA 3QJLA 5BR8F 4OMFG 5IWAF 4RUCA 2MSSA 3X1LB 2FC9A 1N8RT 4YY3J 3V6DB 4ZITA 4NYOA 3WBZA 2KH9A 2DCUB 2DNGA 3CCRS 4DUZF 4DZ6A 4YDXA 1RAJA 1KEKA 1AZSA 1D3WA 4JI5F 3I0RB 5GMKa 2KZZA 3KLIA 3DYAA 1JNZB 3OHAA 4IFYA 5U47A 1S1UA 4QWCA 1QUPA 2AIRB 4NEZA 3VQTA 4ZVQB 3JYTA 1X0FA 3C3LA 1RKJA 1RT2A 1HMVA 1TFWA 3DLHA 2PA3A 2ATLA 3NGSA 2W9CB 1U49A 1WWHA 1YJRA 4PPZA 1KOHA 2M7SA 1HI0P 1NLKL 2XGQA 1ZZFA 3KLGB 5D4OA 2OLWA 3VR1A 4I4BA 4RUBA 4ECQA 3IG1A 1SUQA 3UCZP 1IUJA 4LFCJ 1VFJA 3LUYA 1IQTA 2V5HG 3W5YA 3GCXP 5L46A 2JFDA 1M1GA 4JUZA 1IKYA 5IXUA 1KVJA 5KAKA 1RBOB 4OHWA 3H5SA 1RAHB 3PRVA 2DXEA 3MM9B 4H54A 3SFGA 4DPWA 1TL4A 1QAJA 2BANA 3KG0A 3AY0A 2GV1A 5HQLA 1YRXA 3QJJA 1EQ0A 2VC0A 3OTOF 5KFVA 3TQEA 2E9TA 1M5SA 3CJ2A 4GC6A 3D68A 1HR0F 2N3OA 4PWWA 1P9YA 4UOFA 3I5BA 2V94A 4Q2MA 3HZGA 1A9NB 3T1HF 2EFGA 4MMOA 4S0MA 3Q23A 2MXYA 3UQSA 1LK7A 4ZMMA 3A8EA 4ZLJA 3H42A 1LWFB 3M8YA 5IT4A 4KB7A 4FDFA 4DV2F 1YITS 1M5VC 4NOHA 3MAQA 3G6ES 1RWMB 2QA4G 1F3VA 4DR5J 3M7VA 1KR4A 1JJ2R 3HKZD 1WTBA 2QV6A 2CNOB 3I4HX 4NZ6A 2UV8G 3ZNJ1 4F3MA 1ZAXA 4OYPA 3T1YJ 3TA1A 4ZLLA 4NCGA 3B4MA 1NNDA 1SKWA 2QGFB 1XR7A 2R7OA 2W4CA 3DOLB 5A2QU 3U7JA 4MH8A 1KN6A 5CYJA 2ADCA 3I56S 2H5IB 4JI0J 1GH8A 2AJFE 3UNGC 3S8SA 1NH7A 1T8EA 3C6UA 3PKYA 1ITPA 1R7IA 4K0KJ 4R8UB 2X3DA 5F0WA 1RTIB 4RJVA 4L3KA 4WP3A 4X65J 4CO3A 1S72S 1N4LA 4CP5A 3GCWP 1TKZB 2YTCA 4DR6F 2BW7A 1WHXA 2HNZB 2CQ1A 2BW2A 2BV3A 4O4RA 4RO0A 5KG0A 3VGVA 4QWAA 4EUVA 1ZAWA 3IRXA 1HNIA 5I3UA 3DGPB 1RWWB 3VVTA 1YZ7A 4UUWA 5E3AA 4Y3CA 1JWWA 1FKPB 4LSLA 2L41A 1NK4A 2VPXB 4ZCMA 2R8JA 1CULA 2YKNB 4OJHA 4I6AA 2HMIB 1NDLA 2EXUA 2PEBA 1DTTA 3E01B 5J2QB 2AGOA 2XYPB 4F67A 1XMQF 2I8EA 3H4DA 1WC1A 1FX4A 1PJ7A 1N33F 3JTPA 2CPFA 2Q43A 2GAHC 1U7LA 3TZXA 3VV2B 1RAEB 3RZAA 3GIKA 2N3LA 3JQMA 2KTQA 1CQNA 3Q86A 5G4DA 1U25A 4MIAA 3HVAA 4QR2A 4XIUA 3W2WB 4AE5A 3HXMA 3AAWB 1UAWA 3CE8A 4YHHF 4LSNB 3KG1A 3KLHA 3R27A 4FF2A 2MHEA 4GKJJ 4DX6A 2PFFB 1NK9A 3PV8A 2M8DB 3L09A 3CD6S 2NXJA 5HO4A 2KHDA 4F36A 2N4CA 1KLNA 2AEMA 1QTNB 3UFCX 1DJ0A 2MGZB 4ED7A 1FXDA 4IO9Q 4Y28C 4Q8FA 1F5BA 2QG9B 1TV6A 4ALZA 5IM0B 1R0CB 1OSCA 4RWWA 5HBMB 2K1RB 2XQCA 4UY85 4CZCA 1DY3A 5F41A 1FRKA 2W8KA 2KT3A 3D0GE 1VDHA 2Y3YA 1T3NA 2OSQA 1Q82T 3L4BC 3ZZZA 2AX1A 1UL3A 3VAIA 3QT5A 1NU4A 2ZH7A 2BOPA 5AE3A 5A0YA 1TMMA 3ILJA 1AFJA 2EFVA 3OVSA 4ETXA 4OYOA 3WDOA 4JI8F 4LVOP 5L9NA 2F63A 4DR7J 1Q8BA 4NRUA 2AJ0A 2PMHA 3GIJA 2V2ZA 3AODA 4IG0A 4L75A 5HANA 9ATCB 5IQQA 1U1MA 2A6OA 3OFHA 1WI6A 3C14B 5CHCB 5BYQA 4ZCKA 3MMBA 2GVZB 3BGOP 1RTJA 4YB5A 5JJBA 2XNQA 2QO3A 5CZVA 3OXGA 4EO6A 2PT0A 2JL9A 3G82A 1Z2ZA 1HW8A 3OR1B 3V6HA 1CS4A 2LQ9A 3PW0A 1X9SA 4LFBF 3UWTA 2G13A 2X1FA 4CLTA 1ZZNA 3R1LA 3QZ7A 2FVCA 3CO9A 4N5SA 5LMNF 1AUDA 2E5JA 3MTJA 3KJFB 4I2QB 3J80Y 1VC5A 1XERA 4MKYA 4ECUA 1SB6A 3RR8A 1TKXB 5CA5A 3MPYA 2RU9A 1URRA 2NXEA 3ISZA 1Y7PA 1EX8A 2DCLA 1WF0A 2MMYA 2DY1A 1VRQC 1P9QC 3HKWA 5HVHA 3KNGA 4RW9A 2YKMA 4USMA 4LF1A 2VKRA 1W2IA 4WZMA 2H51B 3ONQA 1VBXA 3PCOB 4Y6IA 2HS4A 2J7UA 2Q79A 1B64A 3BZQA 2FHJD 1TVRB 2BKPA 1RBLA 3I9V9 2POKA 5IQ6A 2OI2A 1B70B 5JUMA 3M2VA 1SIWB 2DISA 5I4MA 1JLEB 4LVNP 1S6UA 3KFWX 4MIBA 4RX6A 5KTQA 4ZDNA 4LBPA 3IA0A 3GILA 1K47A 4YB1P 3OTOJ 4N47A 4WU2A 5C42A 4DCOB 3SYZA 4WCEQ 1WEZA 4H4MA 2LYVA 1HR0J 5HI7A 5B0FA 2GJ2A 4MK8A 2N82B 3EGZA 4J37A 2Y0BB 1R31A 4AL5A 5K8NA 2MYFA 2CUYA 3KK2A 3OBIA 2CADA 5H9FK 3TI0A 4DEZA 4G65A 4USWA 2ZWOA 5EX3A 1KQGB 3GG1A 2NREA 1I94F 1RWNB 3OT9A 4N41A 3EGWB 3FEXB 3H2LA 2G2ZA 3KNAA 5DJBA 2AEFA 1S1UB 1BWVA 5KT5A 2YNGB 4B3OA 2CDQA 4ED0A 4DHVA 4YUDA 2AYGA 4QIEA 3L7OA 5B08A 3FEYB 5D3GA 3PDNA 3TVYA 4I69A 3NCRA 3UN2A 4P74A 1Q79A 4ZP8A 2LA4A 2X1BA 3CJQA 5KFOA 5HMYA 2IAJB 2ZUGA 2RF2A 2BXJA 2AHOB 4DQQA 3EX7B 1DTQA 4CO2A 2P2CB 1P1TA 2B43A 3PR5B 4F2RA 1I51B 1S1TB 2H1YA 1QUVA 1S0OA 5JMNA 4GVBB 2VONA 2ZH1A 4F8RA 1UWBB 4DL6A 3AH6A 2GAGC 3C8YA 1YJ9S 4QWEA 4DPUA 4BLGA 3R5CA 1XMQJ 2M5YA 1N33J 3MI7X 3QWPA 3CO0P 4EZ9A 1H2UX 2E7VA 1RAOA 4ED3A 2RDDA 4DX7A 4DL0C 3UN3A 4NZ0A 3M8RA 2FYXA 3SMZA 3LH2S 4UUXA 1IKWA 2OPRA 1MU2A 3BH7B 3OQ2A 2MZTA 2J0QD 4NX9A 1N34J 1PG5B 2FGCA 3KUGA 2AJQA 1JQGA 3N5FA 4TY8A 5EUHA 5KG7A 4ILLA 3Q8SB 4ZIVA 5D15A 4DV5F 2CZ9A 3BN7A 4B3MF 4OX6A 5D0GA 5L1KA 4MIWA 2IA0A 5HROA 3X3UA 5HN0A 3SSSA 3UDLA 2B51A 3MR2A 2B9WA 3QRPA 3M2UA 4Y0FA 2JDJA 1FXRA 5DZ7A 2VODA 2YWGA 3Q8VA 1WC3A 3D7SB 2BRKA 1UEKA 4DI6A 2HURA 4ED8A 4MTPA 3BSNA 1KVIA 4DUYF 1REVA 1NKBA 5A76A 1KWMA 4G1QB 3EWGA 3OUYA 1UEVA 1WDDA 1TAUA 5LT5A 5J2MA 1L3SA 1EZZB 4HI2A 2UVRA 3QMQA 7AT1B 1S1XB 3NL0A 3ZZOA 4DSEA 4LSLB 1HFEL 2B7CB 2VH7A 3KJVA 1HYSB 1U0HA 1RWVB 1DTTB 1U1OA 2BBEA 3QYYA 2MTLA 5GAEI 2XLKA 2EFPA 4ECRA 1D9DA 1PBAA 3MZIA 2JLEA 1S1WB 1RSCA 3AOAA 5C2CA 4NLRA 3MAHA 4DDFA 4E2FB 3C6TA 1P8GA 1G4CA 5DO2A 1T05A 3QPIA 5LL6d 1EHWA 1FD8A 5B0DA 4KSEB 4TQRA 3OLAA 4QIGA 5ADZA 3CULA 2J0SD 3KHGA 2KI2A 3BQ0A 3JQKA 1UZDA 5J1EA 3W62A 4DS4A 4JOUA 4M5KA 4PAAA 4DR4F 2D41A 4TLQA 1OPZA 3W2VB 2QL7B 4R0EA 5C2GA 3MEDB 3TJ9A 2EBGA 3IXQA 2QMUB 1VBZA 4X4VA 3KJQB 2HZAA 3SCIE 3TRGA 2HGNA 3OTCA 2MJUA 2B7BB 2B56A 1X4HA 1AW0A 4JI2F 3T6JA 4FNHA 1VIOA 5F8HA 4JV1A 4ZJQA 3CWJA 1KSPA 1JLCB 1YKWA 2VB6A 1S6PB 4YR0A 4WZQA 1GXUA 3WC2A 2QSFA 2EW9A 1MMDA 3LOUA 2RB7A 5K8OA 1UA1A 1OS5A 2VQEF 1YVFA 2ZD1A 2C2ZB 1MN9A 1WORA 4OZJA 1ROFA 3QFWA 3OXFA 5C24A 3CUNA 1B0VA 4ZA1A 4IG0B 3V4MA 4IR9A 2BJ7A 3LWLA 3CDBA 5FJ4A 5HK4A 3MMBB 1GFWB 4HDGA 5FDLA 1RTJB 2EFQA 3CJKB 3Q8QB 4ANEA 3DXBA 3POTB 1HHTP 3VGTA 3G82B 5ETLA 2HZVA 2I1RA 1CS4B 1S6QA 4G1PA 1SV5A 1IBLF 1SXLA 1CPZA 1LWCB 2CJYB 4R25A 4K5RA 3DRSA 2JSXA 4A46A 4DCJB 5IT9U 8ATCB 2MB0B 1VK3A 2LEAA 5F8MA 1RKIA 3W9JA 2WAQD 1SJRA 1VLOA 2CQPA 1VQPS 3HHLA 3MCSA 5H9FJ 5KFGA 4IOBA 3VZIA 2DR5A 4KRWA 2QL5B 2K7JA 4NLYA 1PILA 2AV5A 1F0XA 3O5TB 4K8RA 5LM7E 2G2YA 1N0UA 2LXIA 2HFNA 4ZIWA 3TAQA 3U1NA 2A3JA 2QYCA 1PC4A 4FF1A 3T3FA 1UFLA 3I0SA 3PVXA 1IQZA 5J2NA 4DBQA 1MWYA 2F4VF 4PG4A 3P3DA 1NJZA 1R8CA 1RAAB 1I3OB 3Q8PB 2D1CA 2AX0A 2V6AA 2KN4A 3BYRA 3B82A 4WPAA 5ETQA 2Z2ZA 4Q2LA 4H4MB 3NGKA 2V0NA 3E2EA 2CG8A 5DETA 4KY3A 1C0TA 1H6KX 3KK1A 1RLCL 3NBPA 4IRDA 3MAAB 3RBDA 3M8ZA 2ALZA 2F40A 3KK2B 4DV4F 2YWHA 2XMAA 3LF0A 4WXOA 2IRXA 1FJGF 3GZ7A 5F8NA 1SJ3P 4NLPA 3RB6A 3AJDA 4P75A 3KTQA 3LGHA 2FLNA 3UI3A 2X51A 1BMQB 4OHYA 4J9UE 3CJ0A 4MT1A 3VAHA 4ZS6A 4BWJA 2HRTA 5DQIA 1APSA 5FIIA 2J8SA 2UUCF 4JI7J 5E2QA 1Q95G 2EG1A 3C19A 3C66A 4WKYA 3J7ZT 2GVDA 3MUVP 3NGTA 4ER8A 1EIYB 1DLOA 2RMLA 4V1Ak 4OLOA 2R2SA 2R42A 3PYDA 5E0OA 1CSJA 7FD1A 5D3GB 3G2XA 3ICLA 4CM0A 2OPSA 4DQSA 5C25B 2OMOA 1S9GB 5D77A 2LDIA 1HBUA 3R7SB 3VQSA 3CC4S 4ED2A 4ED5A 2MJNA 5CYMB 1D8YA 4DUYJ 1RT4A 2ZH4A 1DTQB 4Y2KA 1IR2A 3OJUA 3PKMA 5J1NA 2BJ3A 2CQBA 1RABB 3THVA 1UVKA 4DSLA 1VIXA 5KFCA 2VBZA 5EN1A 4XTTA 4WXWA 4LT6A 1HA1A 3CJ4A 3RU0A 2MQ8A 1SC1B 3R7BB 5C5JA 2WSFC 1RQ0A 1FVQA 4JV0A 4ANCA 1OY9A 3W64A 4HYKA 1SQEA 4JV5F 1F9FA 1NUEA 3G9CA 1UFWA 3ILLA 2HLUA 2HVHA 4X66F 2B4OA 1FT8A 4NA2A 5T7LB 4X62F 4BCAA 1M1HA 2ZNYA 2KJVA 2OD4A 3DN9A 2UUBF 3BO3A 2HS3A 3DU5A 1TKDA 4TY8B 3GWCA 3N01A 2V2QA 1RWPB 4JI1J 2FJAB 4CLFA 3QRRA 4QYZK 1S1VB 3CCVS 3TUPA 4RW8B 5THWA 2CPXA 3M2UB 2XCAA 1NDKA 1NK7A 4FYXB 5A8KA 2HBQB 3MDFA 4LRAA 2UVWA 2WSEC 2M52A 3GMGA 3O44A 1YJTA 3SQGA 3AD9C 5T41A 1SCJB 1IM6A 5ETSA 4KGVB 4ZPCA 5DG9A 2UUAF 5A6PA 2OMLA 1IBMF 5IOLA 4FXVA 2VD3A 4K2XA 2VQEJ 2HHUA 2Z8QA 4YR2A 5GAHU 3OSNA 1OJ4A 2V8PA 1YJVA 3IR6B 3MFHA 1QY7A 1IR1A 1JXVA 2EK6A 2BE2A 4ZP7A 1J27A 4DQPA 2W24A 3BGUA 4HR2A 4RBVA 3M30B 4DG1B 5LOQA 2XS5A 1R6YA 3C6TB 3ETOA 2IY5B 2XZDB 1RT5B 3DU6A 4PG6A 2B4PA 2UUTA 5M2UA 4C8YA 4CIOA 4KHMA 3MMJA 3NXZA 3DXSX 3HFVA 2KRBA 2F1FA 4DN9A 3LGNA 2MDAA 2ZZNA 4NYZA 5J1EB 2Z2MA 4QZVB 3US5A 5J1PA 3VAMA 5DGBA 3FCWA 5DM6Q 2HHHJ 2PDAA 5K8MA 1CC7A 5KG1A 2C2KB 2YNHB 1NSQA 1FJ7A 4NE9C 4PABA 2CQDA 2EEYA 1IKXA 5F8GA 3GG0A 2VIHA 4HHUA 4DMZA 2MKCA 2YKQA 2LU1A 4R0JA 3J7YU 1SC3B 3CDUA 4FXDA 4ZVRB 1RT1A 4KKOB 2UXDF 2L9NA 2EKNA 3G6XA 2XI2A 1MLAA 4NYPA 2RNEA 4PRFA 3W3SA 2ZOFA 4GMKA 1UA0A 5B0AA 4X64J 4CLYA 3A13A 3FBCA 5HQ8A 3KDOA 2F65A 4RW4A 3HDSA 2F4VJ 4GKKF 4OLPA 1C1BB 3LA0A 4G6VB 3IBWA 2FC8A 4DV6J 4ZPDA 1M1KT 2DRAA 1F5AA 1FESA 3G71S 1F9EB 4HH1A 3UD3P 3ZZPA 2EWHA 3SSRA 3N5BA 1VOMA 2XLJA 4F0HA 5KOWA 3TUZC 1N5YA 5AXMA 3PYGA 2B9XA 2VFVA 5EDWA 3MEEB 3T9NA 5IFMA 4PUOA 1SQGA 3K2YA 1AT1B 2YWEA 2HQGA 4C3MA 4Z37A 3DRSB 5D4NA 4C8ZA 1BE4A 1BQNB 4KV8A 3RGIA 3LPEA 3I6PA 3ISND 2XZWA 4LF8J 2PMZD 3FRZA 2DPIA 3QIPA 1E6VA 1X4DA 4NLGA 1FNMA 2DNPA 1VYAA 2WVDA 4MYTA 1U1NA 5DLGA 3TZWA 2JC1A 3ILIA 8AT1B 1R43A 3N79A 3UNYA 3Q89A 2FVRA 4RNNA 2BQRA 2KHCA 1NKCA 2B3TB 1WF2A 5AT1B 3RAQA 4TNOA 4K4VA 4B3RF 3M4XA 1KONA 1VQ8S 2DNQA 3C46A 4N8NA 4NLVA 4E0DA 1KS2A 3CDAA 4CWBA 1DQAA 1R8BA 4URQU 3LQVA 2RVJA 1NK6A 3D28A 1HLWA 4I1TA 1I6JA 3KG4A 5KFFA 2C3PA 3ZXWA 4OHXA 1R0BG 2VZ9A 1X5TA 4O4GA 1EP4B 3RTVA 5KFZA 4O0NA 1JLFA 2XY6A 2VOPA 5GMEA 2ILYA 2B4VA 4ZP9A 4CH0S 1T9YA 3BF4A 2E29A 2J9DE 1Q8KA 3PG9A 3GU0A 5EWFA 2DY9A 4A8WA 1NXIA 4JV5J 2EVZA 1X5PA 4TU9A 2HQDA 2YKPA 3K7RA 4U67Q 3HVWA 1Q78A 3HSZA 1Y5LB 3KLFA 4NLXA 4C8NA 2IMOA 2J6TA 3TVZA 4CLLA 3ENVA 2ZBPA 4HEA9 1R27B 3S7RA 5IT9Y 3CD0A 1QAXA 3QT8A 4B9LA 4HH0A 4LF5F 4RLEA 1HNVA 3MURP 5ETPA 1FEHA 4CYUB 4I56A 1IJEB 3K59A 3ADAC 5J2PA 3HPOA 4JB8B 4DL2A 1DLOB 3LANA 4WIIA 5E3QA 4DR1J 4NA3A 2RJZA 4WIQA 4OZ1A 1TFYA 2GMLA 5KFBA 2EKYA 3KUHA 2RIJA 2WTFA 4CDIA 1JLQB 4HACA 1X4AA 4D3HA 1QE1B 2RRAA 2XMTA 3PJWA 4HI1A 1X7VA 3GIIA 1RT4B 4FPIA 3OFGA 2DNZA 4Q7AA 1UTAA 1U0SA 3EGNA 2UXCF 3UPFA 1WOPA 1OIAA 3TWZA 1HNWF 2MKJA 3ISNC 1FI4A 3H5UA 5F8JA 1AB8A 4U96A 5KOXA 3RYLA 3DLGB 3R2CJ 3GYNA 1RT3A 3IN5A 5G0RB 4JI4F 3CCJS 2OAUA 4LQ3A 1XNRF 1HNZJ 4C8OA 4LR8A 2PMWA 5KT2A 4Q43A 3ELHA 1CJTB 1R6VA 3C2PA 1M5KC 3EMTA 3N9UC 5KFMA 1RWXB 4WE1B 1XC9A 4QU6A 2NS1B 2XY7A 3MCOA 2MKHA 1LWXA 1PYTA 2OEJA 1S12A 3M8PA 2ZH8A 4M5DA 3D3BJ 4ED6A 3JTOA 4PWUA 1SJ1A 2W9BA 3QO9B 3CDEA 3DI6B 2DTJA 5GVQA 2WBMA 4ECZA 4F3OA 3M6UA 1VQ5S 1EB0A 4DQRA 2UUWA 3R1HA 2JLGA 1XBWA 2Y9HA 3OW2R 4YB6A 2UU9J 3A8JA 4A4JA 1R8PA 3AB2B 4RNMA 3UCGA 1F2HA 2BUNA 3F44A 2GA7A 1RDRA 4YFUA 5HLFB 4OV1A 3V6DA 2R2TA 1NHKL 2Y0SD 3DC2A 3SQGB 1L5UA 2ZOGA 2OH2A 5L38A 5KFHA 3IAM9 4EBEA 3DOKB 1LWEB 2CG4A 3NCQA 2VG7B 2DHXA 1V3ZA 1PYOB 2WCXA 1Q8LA 1EETB 2IIHA 1RK8A 1T03B 1N5QA 3IM8A 3HT0A 4ZKAA 4LF9F 3R3TA 3EJMA 2Q6BA 1X4CA 2V8GA 2FGOA 2MSTA 2VICA 1V5IB 2C2EA 3B78A 4P2MA 5GMDA 2AT1B 1WOSA 4K4ZA 4CNYA 2M70A 2W9CA 1BY9A 3CCUS 4TQSA 1WI8A 1FTCA 3KLGA 4CH7A 2W01A 3RG6A 3MPVA 2VA2A 3SBMA 3B8HA 2D74B 5F8IA 3BKUA 2FHJA 4RBUA 2Q6CA 4O23A 3RRGA 4P9SA 5AXLA 1N32J 4P7TA 2IDEA 4AXIA 1NKEA 2CA9A 3S01A 3H25A 2IYIA 4X4UA 5CH7B 2F8MA 2MLZA 3LGMA 3MEKA 2QL9B 2P6TA 3EDQB 4FVMA 3G96A 3IRWP 4KPYA 2XG8A 2ZH2A 3MPUB 5DZ6A 4WK3A 4NPOA 3CCMS 2BJ9A 2VJUA 3MMCB 1FNOA 2HGMA 2QFIA 1UPMB 1DARA 3EZ5A 3I87A 1LWFA 3A4TA 1FK9A 1TL3B 4TY9A 2Z4PA 4KGMA 1FDBA 1JIHA 2CVIA 2DGXA 5SUHA 2BOAA 3TAPA 5D6GA 5DG8A 4DR3J 5CABA 2MKYA 4TXSA 2HEKA 2OP5A 2VFRA 3K8VA 5HQMA 2XM3A 3IC1A 2LQ5A 2M9KA 3DOLA 4HHHA 1NMEB 2M4MA 2MKSA 1NJIT 2JEFA 1PYSB 4J9SA 1QM9A 4R8UA 1N5YB 3UDVA 4F4AA 3ETMA 1RTIA 1F60B 3BDPA 2WBRA 3DRRB 3IGNA 1TKTA 4LFCF 1FEEA 1RHQB 4OYZA 2R8GA 1WHWA 4OI2A 3SIPB 2M0GB 4QWBA 2HNZA 1FHTA 3BGFA 3N28A 4HTIA 4C3KA 4CLSA 2R7XA 3WQPA 1V3SA 4C11B 4RBTA 3DGPA 1GT8A 4EYIB 1U1QA 2PEHA 2DNMA 2YQ1A 1CJVB 1KQSR 1AXQA 4A8SA 4RU2A 1UVNA 3BO4A 2YKNA 1Y3JA 2P9EA 5K14A 2E44A 1URNA 5KFSA 1T9UA 1YBUA 4EZ6A 1C0UB 2XHCA 3DLBA 4OV6A 2VFUA 1ZTWA 2G2OA 4KIAA 2DPJA 4JBCA 4ZPTR 1X4GA 4C8MA 3FVYA 3B54A 1NHUA 4P2FA 3FJ2A 3TX0A 1YTYA 5HATA 2GS8A 2V9KA 2GIQA 3UO0A 4U95A 1GAOA 3VALA 3W2WA 4LBHA 3M9NB 3I32A 4LSNA 2MZSA 4OYAA 4X4RA 3J80U 3T1YF 2YBVA 4NASA 2P9GA 1HD1A 3KHHA 2WW4A 5DM7Q 2HVDA 2DHHA 1CC8A 1A6LA 2MGZA 2A18A 2BJ8A 5LJ3Y 4U7CA 1HQUA 1WACA 1T9VA 2O5DA 3MR5A 2FJXA 3NG8A 5IM0A 1RT7B 5HBMA 3PX4A 2MKKA 4X65F 2K1RA 5LXYA 1Q5YA 1FRMA 3RB3A 3TO8A 3CEDA 1CBKA 1LW0A 3NGRA 2E9RX 3FEZA 4A8KA 2QA4S 1QDUB 3GIMA 4EYHB 3GR1A 3OL8A 5E3CA 4J9OA 2V67A 3J7Z5 4KHPF 2OKQA 2VL1A 1IN0A 4DV1J 4AUKA 3EM1A 4EU0A 4J9QA 2HRUA 3CCES 1S76D 5B0BA 3JS9A 4QW8A 1FRHA 1T94A 2W7PA 5J2PB 2DH9A 2DHAA 3OTDA 1F6TA 3O6QA 1QD1A 1S0MA 5BJRA 1X5SA 3BYPA 1Z4UA 3CD5A 3C14A 2CIMA 1VBKA 4ZJLA 2GVZA 3BQ1A 3U1LA 2QE5A 4OZ3A 2K8GA 3JB9k 2NXCA 3MM6B 4HACB 3CW2C 4WF9Q 1X60A 3Q8UA 4F25A 3K8WA 3OR1A 3R6LB 3BM7A 4PYDA 4P6QA 4QIFA 2PGCA 4FN5A 3TOQA 3TANA 3AJ2A 1S49A 1ZH5A 4I0WA 2KVQE 4GKJF 3FZBA 2ZBRA 1LOUA 1SJQA 4I2QA 3QIDA 4KGZB 3BBFA 4M94A 4JI6J 2V2VA 1LFWA 3ENAA 2FHMA 1RP5A 2WVEA 4DV3J 2EC2A 2R7UA 4DF8A 5D78A 2APOA 2UZAA 2FQQB 5KFUA 3PIOQ 3P5BP 2ZFHA 2E1MC 2VBXA 2RQCA 2RDJA 5KFDA 3N6LA 1UZHA 4U6PA 2W8LA 2R2UA 4USUA 1MMNA 2HS0A 3H20A 2MZ1A 2QA1A 1OQ3A 3KLEB 3HM9A 1JLEA 3U1MA 4DR7F 3E3XA 2WSCC 1DURA 2GFFA 2QJ3A 2ZM6J 5LXRA 3E8OA 5HVGA 4O3OA 2WONB 1EARA 3EVOA 2DR8A 2QC3A 4K7QA 3NS5A 3BJYA 4M5MA 2YQ3A 4ZJOA 2FIUA 3MD3A 1HARA 8RUCA 1UCNA 4U9RA 2UP1A 1RWOB 3PTWA 4FP9A 1D8ZA 3EVMA 4CCHA 2XMVA 3FFIA 2CQ3A 4EK2A 1XIQA 5ETRA 1TR0A 2DGUA 2BM1A 2ZDPA 1X8DA 4NLSA 4NEYA 4WTOB 2OPPB 2XGPA 4EWTA 4LBIA 4U8VA 2ZHBA 4ZVHA 4HT7A 3G8TA 4F0KA 4ZPVR 3CD7A 2F4FA 4X4TA 2CJAA 2CQ0A 2JEIA 1ULRA 4DFPA 2YNGA 4JI3J 3P49B 1ZS6A 1RZMA 2ZVSA 4DJBA 1VJWA 4X2BA 5KT6A 2K3IA 1H7WA 2XI3A 4LRDA 4B9NA 2HAFA 4Q8EA 2ABYA 1SJ4P 1MSWD 3MM5B 3BPSP 1PBUA 4ZHRB 4A8QA 2Y1RI 2ZH6A 2IAJA 1GTHA 3BEGB 5CYQA 2C3MA 1FCAA 4ZPBA 4Y2MA 4P72A 1WG1A 3H0PA 2YNFB 2HHTA 1Q4RA 1VQOS 2XWXA 1YJUA 5GADI 1G1XA 4AL6A 4C8LA 4FZVA 2J7WA 3NKYA 3NMRA 1S1TA 4RW6A 4J90A 2B4UA 4GVBA 2RH3A 1BD6A 3OL6A 5HVFA 3QT6A 1U24A 2KFYA 1F2GA 1UWBA 1SL1A 2CQ2A 2IM2A 2XBPA 3LP1A 2WVFA 2YWKA 1QTMA 5JVGQ 4H4OB 1RA6A 3EDRB 5HMWA 4GO7X 3OVBA 3AA8A 1DAXA 5DG7A 4WP8A 3OVAA 2MQMA 1KP6A 2V4QA 2FJWA 2LXFA 4DR2J 3ZTRA 1FK9B 2GO9A 5MLCV 2OTLS 2NSCA 1ZA2B 2MY8A 4QPTA 1WSRA 1NZAA 1WELA 3PIPQ 3NMAA 4RKUC 2QLFB 4ZVOB 3BREA 4OJ1A 2KXHA 3GJRB 5DDPC 2B5JB 2CQHA 2CZ4A 1DQ8A 4Q0BA 4AT1B 2X3GA 3GSDA 4HT5A 4C98A 1KLMB 1TMJA 2OSRA 4DL5A 2P9CA 1H2TZ 2V69A 5I3QA 1MW7A 1JJCB 2C42A 4NWBA 2JWNA 1TELA 3DMJA 2GZOA 2VOOA 1G6BA 1PKUA 2RKIA 3SCJE 4GRSA 4WFAQ 1ZOTA 2CWKA 4UY8T 5GAGU 1TKTB 4USIA 2DRBA 4OX9J 4LF2A 2HYIB 3K5OA 1HIYA 3VAFA 4G1QA 2YPYA 1KOOA 5LSLA 2VFTA 5DDRC 2E9ZA 4UOHA 4KHPJ 3I82A 4YB7A 4DN0A 2GIFA 3GIRA 1S1XA 3UVJA 5HL7Q 4LF4J 2OUGA 4C3LA 4FF4A 2PC6A 1C1CB 2ASJA 1NJWA 2HIYA 1HYSA 5K14B 5DRKA 2WHOA 2YNIB 2SXLA 1IM4A 3BKTA 2Z0GA 2RQKA 4ETZA 4ZN3A 4B17A 3RAXA 5IS2A 1S1WA 1W26A 1C4AA 4DPTA 3M8WA 5L1JA 3ZTQA 4GC7A 4TU7A 1A0OB 2D3UA 2CPYA 2EFOA 5L39A 2PA8D 1RAIB 2I38A 1J5OB 2DJWA 3ZZTA 3RAMA 3TYTA 1H72C 3NY0A 2JOQA 2HHVA 1N34F 1HQEB 1ACMB 1N5VA 3FSYA 2GMJA 4QIWD 3Q8RB 2BKNA 2CJ9A 4F26A 2HWHA 3IS9B 3ZZYA 4O44B 2DNRA 4ZLNA 3W2VA 1RE1B 3CMES 3MEDA 3CB4A 3MM8A 5L1LA 3D6FB 1O5JA 3QGGA 4XPCA 3LAMA 3MGJA 3DLEB 3V6KA 3FUYA 3BGLA 4K59A 4ICLA 2HAIA 5LSRA 4M1KA 2MQLA 1H2VZ 4RU9A 3D2WA 4KO0B 1HQUB 3JTNA 3QLHB 1ZA1B 3DOMB 2VKZG 2C2OB 2DGQA 1ZBTA 1G2EA 3H59A 1S48A 2K06A 4UF4A 3B4DA 2OFHX 2C2RA 1LW0B 4WFXA 1JLCA 4K4XA 1S6PA 3SSQA 3OFEA 3RBXA 3V81A 4ZVTB 3R5BA 2VQFF 1PJ6A 2K2PA 1Y9OA 2CQIA 2DO4A 4RZRA 4ED1A 1NB2A 2L9DA 1VQ7S 3QGPA 3TQ1A 1IWAA 4DSIA 2N7CA 4XAKA 1JXLA 2QEXS 2QLXA 9RUBA 3JSBA 2XLIA 2GX8A 5K8PA 5EHHA 1SVDA 1X5OA 5E41A 3TW0A 3CJKA 4I64A 2R7WA 1BQXA 2F3JA 3POTA 3JSYA 2DD8S 4KGKA 4KAIA 1U2FA 1WUUA 3MOJB 2FHKA 2RU3A 4PR6A 1LWCA 1NEEA 1BXNA 4M5LA 1U4BA 3T5LA 3MFIA 1RTDB 5HMXA 2QLBB 3Q83A 1JLBB 3ENWA 3GLJA 2KKHA 2V8HA 4F4KA 2WZ1A 2HFUA 3H98A 3DLJA 2EK1A 2L3MA 1HL6A 1RYRA 5KG5A 2C2DA 2QTWA 3J81U 4YOEA 5AJ3J 4DUTA 4USVA 2XTJP 5KFPA 2FD2A 3R8YA 3MR7A 4C97A 3DDNA 4DXLA 2R7TA 4KYZA 4ID5A 3Q8YA 2MY7A 1T9TA 1S7HA 4XK8C 3HO1A 4HDHA 3FC9A 3OXLA 4DWIA 4CT9A 1TL5A 4AD6A 1QVGR 1RA7A 4ID8A 4UOCA 1IR0A 2HFSA 4CRJA 3BQ2A 1FXLA 3LTOA 2VF3A 1VQ9S 1ZETA 2H54B 3PZPA 4MK7A 2C2NA 4PXBA 4F02A 2WB4A 2RQ4A 2KDOA 4LRFA 2D7SA 2V8VA 2JEGA 2RRNA 2EFNA 1KQFB 2FLLA 1RACB 3PO4A 4KJIA 2AGPA 3QJPA 2W7AA 2XWYA 4AQYJ 4KE5A 3BO2A 3NGDA 3PY8A 4W4MA 1N36J 3CNQP 2FLPA 3MAAA 1JNRB 1VQ4S 2L9WA 2PI4A 3FFIB 1EAYC 2E66A 2K3KA 2H4WB 3AQPA 1D1UA 4YS2A 3BPDA 3GYXB 2YWWA 3MCNA 3MM7B 2ZZTA 4G1IA 2J9EA 1RI7A 4RWXA 4PQUA 5A8RA 3W9IA 3F41A 1RT6A 4ES3A 3GJQB 4ITSA 3NLCA 3PEHA 2GIRA 1RYSA 1BGXT 4P2XA 1TP7A 3BS9A 5C25A 1Y0HA 1WC5A 1EJ7L 1S9GA 2I2YA 2X1GA 2LKZA 5CYQB 3PYFA 2IM1A 3KHRA 5CYMA 1T0TV 3ZZRA 1QSSA 2J76E 5KFAA 5I3PA 5CD4A 1ELOA 3GV7B 2CJQA 2GCFA 1KHWA 4ANDA 1GMWA 1NJYA 1S0VA 4IKAA 4RW6B 2HNYA 1W25A 3GP9A 2HQFA 2QLWA 1HWLA 2UVVA 3LW5C 3P6YC 4A8OA 2HK2A 2GQQA 1Q7YT 2BZ2A 5HJXA 3LP1B 1VQ6S 1RJJA 3FBBA 4UW2A 1UJ6A 3UN5A 1AROP 1G7CB 3W61A 2D9PA 3MOZA 3OL7A 2YX7A 3MECB 1QVFR 2YH1A 2H5JB 3DRPA 1RHKB 2ZHOA 1BQMB 3M9OB 3U27A 1XEZA 3OFFA 2H65B 3AD7C 4LFAJ 1BUXA 1X31C 3HHLC 3GJSB 5T7LA 5KFQA 2G4BA 4HTJA 1FWKA 2ZH3A 4MK9A 3EXYA 4JI7F 1YJ7A 4L73A 1H7XA 1V9OA 3DGVA 4Y00A 4OHVA 3M1VA 2LQ8A 3MEGA 2N4DA 4DSFA 4EO8A 4Q0BB 1WC6A 1U26A 2CJBA 3L9ZA 5IT0A 2ASYA 1CJUB 2A0FB 1ZM4A 2HRYA 5ETOA 3MPWA 1S1VA 2IJNA 3B6BA 4RW8A 3ET6B 2O3DA 4PG7A 5AE1A 4JYAF 1SJFA 3IWLA 4R5PB 4MAKA 3DMJB 2IJFA 4DPYA 4FVCA 1LW2B 2RKIB 2HNDA 1U8SA 5IC6B 1F3FA 2J9DA 3F73A 4YR3A 1E6YB 4O3QA 4PXEA 1B0TA 1J2VA 4E98A 5KFEA 1T7PA 4I6YA 3QRQA 2DGWA 3HJVA 1FJEB 2VQFJ 4DLEA 3PFEA 3UVJB 4DCPB 4N8OA 3TAMA 4IRKA 1YRTA 2AZ1A 2KG1A 2BACA 2F8HA 3P8BB 4ES2A 2W2MP 3AXMA 2QYGA 3H7HB 2BEFA 1XK8A 2R8IA 1TUVA 1Y4ZB 3S1TA 1OY8A 3CCSS 3N0VA 3M30A 2U1AA 1WG5A 4DG1A 4KTQA 5HMZA 2OFGX 3SV3A 1KDNA 2GJIA 1EQMA 2I5JB 5K9FA 1RT5A 2HQCA 2IJRA 3HF5A 1JLAA 1X9MA 3W66A 3QAUA 5E3RA 1TUGB 2H5EA 2XSJB 4EGLA 2VHGA 3BSOA 2BKOA 5AE2A 3LP2B 1RXOB 1VHFA 1YI2S 4ELVA 4IR1A 2CNNB 1RHJB 2PSZA 1Q7LB 4DL4A 4JI1F 2HZCA 3MM8B 3A8IA 2HVIA 2BRLA 4BDPA 2YNHA 3G6VA 3Q22A 3EPGA 5KFJA 2FTRA 1F9HA 1Z1ZA 4ICLB 4O3PA 1TL1B 4URSA 5FLXU 3TZYA 3UR3C 2Y1IA 3FCHA 2AF6A 3IM9A 3W63A 2AKWB 2XC9A 3BV8A 2XS2A 2VFSA 4I68A 4ZK7M 4KKOA 2DGTA 4IDKB 3VHQA 4YP3A 3D6HB 3V81B 3QWUA 3T6BA 4IUFA 3Q2TC 2RSQA 2DR6A 4C9DA 2OEMA 1I1GA 2AZ3A 4DSKA 4DV0J 1EKRA 2VBWA 3TNVA 3PX0A 3EZUA 5KFNA 3K57A 2ASDA 2CNKB 1UMJA 2KFZA 4NLQA 2E7XA 2LDYA 3QNWB 1C1BA 1H0HB 3PW5A 3BSCA 3R5DA 3NAIA 4E8UA 3I55S 1NDCA 3DNCA 1IKVA 2IC3B 1YQHA 1O8BA 3HVTA 3SFUA 5I42A 3KJNB 3MEEA 1JK9B 1FRXA 1JJHA 2LEBA 4LIRA 1WDTA 4B9UA 2NUHA 1Q86T 4OZ5A 1HBOB 1BQNA 3NS6A 4P52A 1TTHB 3D54A 1HNXF 4ZCIA 1FNXH 1UETA 1YG0A 2AQ4A 5T14A 1TZ0A 2DNNA 2HHHF 3W8GA 1XMOJ 4EI2A 2W1BA 3IBFB 3QSIA 5IV4A 2CQ4A 2MLYA 4NI2B 3RB0A 3TARA 3D0HE 2GJFA 1VQSA 2HIQA 3MCMA 4ELUA 4BC9A 1O51A 4X84A 1X4BA 5B0GA 4L3NA 3RUBL 2V2KA 4ID5B 3Q2SC 5B0CA 1NB7A 4WWSA 4PXDA 1Y00A 1OY6A 3CF5Q 1M5PC 4F2SA 4W98A 3NOGA 1LV5A 2WRMA 5HP1B 3HJFA 1XQIA 3RW7A 3OL9A 2CFXA 1HQ2A 1C2PA 3HHKA 4X64F 3BGRA 4NXNJ 1SPBP 2OIHA 2H3EB 2QRRA 2V4RA 4NXMF 3OJSA 2ZKTA 3W5ZA 1DFDA 1VMBA 1LK5A 2IRYA 2ZBCA 2CPIA 4MJKA 2DHSA 2GGPA 2WB1D 1T02A 1UKUA 3QGHA 4DV6F 1J5EJ 1EP4A 2Y8YA 3UD4P 3CTRA 3H8YA 1WNEA 2AJ2A 2EG2A 1S97A 4PKDB 2R8KA 4QU7A 4ATNA 3IFEA 3JQJA 4MKVA 2DXDA 3H40A 3CIZA 1Q5VA 5DQGA 2CWXA 1ZAVA 4LSZB 1AYEA 4ENOA 2YKOA 1X4EA 2XCPA 5CCMA 4ES1A 4LF8F 4PQUB 5A8RB 2FZCB 1RT6B 2QX0A 3MHYA 4CYUA 2J0XA 2Z58B 3V2UC 1UVIA 3H90A 5IV3A 1VK8A 2G0JA 3J81Y 3VF0B 2E1RA 1X9WA 3R97A 4J9RA 4OIXA 4JYAJ 3DDIA 4KH1B 2AP6A 1RUSA 1JLQA 4PG5A 2DGSA 3KMSA 2PN6A 1QE1A 1PJ5A 1U45A 3AA9A 1V3RA 1ZPWX 3BBCA 5EWEA 3SCLE 3HP6A 3PR4A 4YN3B 2HQ3A 5RUBA 2DGOA 2JJ4D 1HI1A 3D6TB 2HNYB 1M5OC 2U2FA 3DLGA 3S6EA 2ZITA 1SKUB 3P96A 4FXWA 1K8AT 4ED4A 5G0RA 1M5HA 1HPZA 1QSYA 1X4FA 4CQ1A 4ZVPB 4LF6J 3HI9A 4J7CA 2GHVC 1FJCA 1LNQA 2AMCB 1CJTA 1U1PA 1ZM2A 4J9KA 3ULHA 2ZE2A 3QQCD 2VG6B 2ZZMA 4PPDA 4WE1A 1T3OA 2JVRA 3OTBA 3DRPB 4CLUA 3SV4A 4PWDA 3C15A 4DL7A 2E5LJ 2J5AA 3OV7A 3TA0A 1PC5A 1NK8A 4K5SA 3RJMB 1RGVA 2ZC4A 3T1AA 4M5JA 3QO9A 1VC6A 4OI3A 4FF3A 3DI6A 3M1VB 3MEGB 2FVSA 1WD6A 1RHUB 4DX5A 2HQIA 3D0IE 2AJ4A 2QT7A 4DR1F 3Q24A 1AFIA 3PX6A 3HSGA 5D4LA 4ZPAA 4C0HA 4NLWA 4DLGA 1FWPA 1XNQF 3FNNA 4OQJA 2HNDB 2DEIA 1N52B 2H9ZA 5HLFA 1UEUA 1VC0A 3AJ1A 4AL7A 4FYWB 3JSMA 3H4BA 5IC4B 1YWXA 3CJTA 4H4KC 4DZDA 4OL8A 2ACMA 3H2UB 3SXLA 4I2PB 3DFEA 1RBAA 4M8LA 3PW7A 1JJ4A 4X4NA 1VLYA 1ZTTA 4BWMA 2LU2A 5KFTA 3DOKA 3CCLS 4ZP6A 3M32A 1LWEA 2BE9B 3QBCA 2VG7A 3TAMB 1LEOA 1U6ZA 2RILA 3TX8A 3ZFVA 5GAEU 1EETA 2OO4A 3K89A 1HNZF 3VVUA 1VBYA 1T03A 2YH0A 5BR8J 5IWAJ 1A7GE 1SQFA 1I5OB 3SEOA 3KKFA 1FX2A 4TKTA 3W8PA 2KO1A 1HWJA 4IYQA 3DCAA 3TA2A 5AXKA 2BX6A 4RNFA 1WSVA 4WU3A 3ENQA 1NPPA 1KVKA 3VAKA 3BB5A 1JLAB 4IH5A 2C3UA 1UW4A 2BJDA 4DUZJ 1F5CA 3V4IB 2ZJQQ 1HHQA 4JI5J 1NDPA 2LECA 2ROGA 4U7UK 1MROB 2QZ8A 2A1BA 3CC2S 1NK0A 3GFZA 4URGA 3J7AN 3C16B 1HNXJ 1VGYA 2XSFA 1TL7B 2BQUA 2IM3A 3WX4A 4CLWA 4WFNQ 5KFLA 2R7RA 2ZC3A 2UU9F 4RW7B 1U1KA 3ILOA 1FKOA 2JLFA 3FCVA 1HWIA 3ZTSA 4MYUA 2QA2A 2ZH5A 4KPCA 3HZEA 3R7NB 2J9CA 4DU7A 4PYAA 1SH2A 2NPFA 2W7OA 4J9VA 4IFVB 5M2RA 1RTHA 3MMCA 1NH8A 4CLZA 1S9EA 3HSDA 3MR6A 3IR7B 1TUWA 2A2CA 2ADBA 2Z2YB 1TL3A 1Q53A 3ITHA 1KKHA 4HL9A 3G4SS 3UD5A 3NCPA 4NXMJ 3MXHP 4B9TA 1LXNA 4B9SA 5D8HB 1Q0NA 3GONA 2MQQA 1IBKF 3NRBA 5E33A 3DLLQ 2IFXA 2RRBA 1RHRB 2G1HA 3T1HJ 2CJKA 3CC7S 1FDAA 3IAS9 3UDEA 4N56A 2NZ4A 4KC5A 4IQMA 1SI9A 2GW8A 3CXCR 3K58A 3DM2A 4Z2XA 1IKVB 3GE9A 4IOAQ 4J91A 4DV2J 3HVTB 3MMAA 5FD1A 2XMWA 5I42B 2DBBA 2W4DA 1N6QA 1JLGA 3DRRA 3RRHA 3VCDA 2JC0A 2IPOB 2F5GA 1AZSB 1JKHA 4DX8H 1S59A 1U8WA 3KLIB 1VHIA 3DYAB 1K0VA 2ALYB 1ICEB 1YGYA 4IFYB 1YSJA 1H3DA 4C11A 2HBZB 3TUIC 3QT7A 1OPIA 2BE7D 1N32F 4HLBA 2MZJA 2YWFA 3JYTB 2QSWA 4DQIA 2ILZA 1CJVA 1RT2B 1HMVB 4AYBD 4CO4A 2YX1A 3EPIA 1C0UA 5FLXY 3WZ0A 3M2RA 3BN4A 4TYBA 4Z7CA 3IG1B 1SUQB 4LF7F 4DR6J 3AOBA 2MQOA 1HBMA 3JXOA 2HHXA 1IKYB 4C4WA 3PHEA 3UE2A 3SCKE 2DKOB 2DVIA 2DNLA 2FB0A 4D3GA 3MR3A 1GMWD 2BANB 4ILMA 3BGRB 1PAEX 2NUUG 5B09A 1TK8A 2DB1A 3HK2A 3H5YA 1GX5A 4QCLA 4DR3F 3MUTP 4OYIA 2C3YA 2GGPB 1U02A 3G6YA 1U09A 1ZM3A 1VQMS 1HBNA 1VQNS 2R8HA 3PACA 2MZQA 1UW9A 1S9FA 2XEXA 3RR7A 4N77A 1RT7A 4K2JA 2WOMA 4BS2A 4DFKA 2VDHA 4OI0A 1FFWB 1YHQS 3KYLA 1S57A 4YHHJ 2PI5A 3HFZB 2CRLA 3GJTB 4PCQA 4QJVA 2ZBIA 4NCGB 4ELTA 2CQCA 4Q45A 1NPKA 2E1AA 2E7WA 2R7SA 4WP9A 4ECXA 3MPDA 4NCAA 4YEAA 2V4JA 3WIUA 4QQBA 2WVBA 3RBEA 4MKBA 1V5VA 3C6UB 2Z57B 1EKSA 1VCTA 2W2PP 4JP8A 3PRBA 3FK4A 4XDDA 2KYZA 1F1BB 1FRJA 5L8RC 3BR8A 4MKAA 3A3PB 1XNQJ 3MM6A 4OJGA 5H9EK 4Y2CA 4M63A 4ZN1A 1FTRA 1W7WA 4OI1A 2DNOA 1KBRA 3THTA 3NP5A 4I7FA 1O0PA 2JZ5A 2AD9A 3IRXB 1HNIB 1OSDA 5I3UB 4MFBA 5D0HA 1JX4A 1H98A 4RR5A 3HT3A 2ZWPA 4JI8J 3DHXA 1N56A 5KFKA 2V63A 1CULB 3M8QA 5GAHI 1RLDA 1YBAA 1FERA 3DHWC 5BXIA 1OYEA 2CPEA 1D0EA 3KHLA 2RE1A 1HPZB 3WHIA 2KM8B 4L74A 2BYCA 4A8MP 1Z2LA 2QMWA 2IBKA 2KXNB 1KTQA 1HD0A 1P1LA 4DF4A 2FJDB 2MHNA 5F0UA 4USKA 2ZE2B 2Q1LA 1ZM9A 4A8YA 3OR2A 2QIFA 3AQOA 2O67A 4LFBJ 3E51A 4PWDB 3QAEA 3C15B 4NA1A 1VS3A 3HULA 2OJ3A 3SI8A 2W25A 2FZGB 3QFHA 5KT3A 3L7PA 4C7QA 4NMLA 3KLHB 4F4WA 5LMNJ 3GPAA 5F3TA 3FGVA 2D3ZA 2F8EX 1L3VA 3MWBA 5DDOC 2XZTB 4DV1F 1RB0A 5JXSA 4ILRA 4AXJA 1R0AA 3KLEA 2OD6A 3D9BA 5A2QY 4N7TA 4YDDB 3NEKA 2WONA 2XYHB 1TV6B 1N5TA 4CTAA 3KK3A 4USJC 3FQKA 2HSEB 4NCBA 4LQ9A 4RNOA 4DPXA 2Z30B 4NL5A 2EPIA 4OYMA 4OJ3A 5KT7A 3ZTPA 3J7YI 2DH7A 2G0CA 2MPUA 1GQEA 2C2MB 4RUAA 3OHBA 1S6OA 4HHJA 1OO0B 4WK1A 1FKAF 4F4YA 3JSMB 5A0YB 3KOAA 4M5NA 4P2SA 3NWGA 3HVRA 5A8WA 4K50A 1KTVA 2XY5A 5M2PA 2I9SA 4QIVA 3AFGA 2EI5A 1NHVA 3GFHA 2OPPA 1GK8A 3M32B 2J0WA 5H1SV 2W2NP 5A6WA 3D1QA 1S10A 5CQGA 3QZ8A 4JI6F 4TYAA 4LRCA 1CG2A 2AGQA 4ZVGA 3O1LA 2M88A 1UVLA 2MZRA 3DLKA 1WG4A 1IBKJ 2JFKA 4TN2A 5KG4A 4DV3F 4YMEA 2LQBA 4ECSA 2HWTA 1IJFB 1U2CA 5CZXA 1N88A 2VBYA 4M5GA 5LMUF 5JVHQ 4DL3A 2FJBB 3MM5A 4HVZA 4CO1A 1CJKA 4ZHRA 3AHPA 2IRUA 3H5XA 1HHSA 1Y3KA 2HHQA 3CGIA 4AFFA 2KG0A 4LR7A 2ZJRQ 2WVCA 1MWZA 1I94J 4A8XA 2YNFA 2IYGA 3I4PA 3NNCA 1FO1A 4FYYB 4EFAC 2ZVIA 2HVEA 1R89A 2LP4A 2A10A 2JH3A 4ZPWR 2ZM6F 3SDEA 3PO5A 1WEYA 3FDSA 4NZ7A 2FZKB 5HSPA 5KFRA 1FKOB 1SL2A 3VGSA 4H4OA 4RW9B 1IXKA 2HHSA 2YKMB 2KZMA 3ZO7A 1DQ9A 3UR0A 4O3SA 1WF1A 4J9NA 4UZCA 3VGUA 4P73A 1Q1KA 2ZEJA 4WYWA 4RL1A 1NZ8A 2GQCA 4LF7J 1D9FA 2DIUA 1RTHB 2NLWA 3IWXA 2HBYB 1S9EB 2X1AA 3K5LA 2BDPA 2YPZA 1DHMA 3MF5A 3M2VB 1U2RA 2B6AA 4OX7A 4F4XA 3ITHB 4QYRA 3MTKA 2Q66A 4WYLA 3T9ZA 2BA9A 1WC0A 1HKAA 2CKWA 1OQ6A 4DSJA 4OYWA 5C42B 3CCZA 3ZZ0A 2B5JA 2L48A 1SBRA 2VU5A 4JI3F 3M6VA 4WFBQ 1KLMA 4UT4A 1UJ4A 3DKDA 2B8QA 1Y5IB 2P6SA 3N6NA 1NCLA 3DM2B 3D3CJ 2JHEA 3MMAB 2HPUA 2NYIA 3CCTA 5F9NA 1N6QB 4DOZA 1JLGB 2O1PA 3VAGA 1Y10A 2PFDA 4QR1A 4K4SA 1JKHB 4QBUA 3G8QA 4ECTA 1RU1A 4DV5J 3TZZA 5F3ZA 1VI7A 1YRUA 2OGUA 4B3MJ 2CPJA 3VTIA 4B3OB 4CH1A 2HGLA 3O3LA 3BDEA 5F8LA 1K9MT 4L6V3 3QATA 5SZTA 1C1CA 1FD2A 3Q0AA 3OPKA 4CM2A 4F4ZA 2YNIA 4BC7A 2FHOB 5HJYA 2RF2B 1YIJS 4CO5A 1S4EA 3M2RB 2IA6A 4P71A 5ETKA 2RQMA 4LR9A 3P5TL 1HBMB 3SQOP 3U02A 2VDIA 2YVSA 2GNKA 4OI4A 3PRDA 2KT2A 4DR2F 4LUBA 3FMWA 4A48A 1N54B 1S99A 1J5OA 2AYBA 2GHPA 5ITHA 2V50A 3CT9A 3R5JB 1VR6A 4Y65A 1HQEA 2B9YA 1U48A 1HWUA 3FZ2A 2COLA 1RHMB 4ZOSA 2YKAA 4C0BA 3JSRA 2IDLA 2NCKL 1CEZA 3T19A 3IS9A 4O44A 2OTJS 1RU2A 4FS1A 1NSKL 1UJ5A 2E5GA 5H9EJ 1KFDA 4B9VA 4F50A 4K4YA 4J9LA 1HBNB 3DLEA 3AB4B 4B08A 3HMJG 4WKRA 4KO0A 4ZVUB 4A47A 2BJ1A 3QLHA 1FDDA 2R7VA 3DOMA 1IKWB 5L1IA 2OPRB 1MU2B 1PAUB 2BJEA 1WJ9A 5ETNA 2WOMB 3JAMU 3HD1A 5L9XA 1SC4B 2HKEA 3V5RA 4OX9F 2JRSA 4ZVEA 5D0RA 4DR4J 3TUJC 4B02A 4WBFA 1MN7A 3IWNC 2LLZA 3RB4A 5HROB 4LF4F 4FNIA 2V4JB 3KDNA 1RWKB 2CAJA 3CJ3A 4TLRA 4KHRA 3MUMP 4J5OA 5DS7A 4OYXA 2LCWA 1WTFA 1H74A 1SH0A 4JI2J 3GFXA 1O6XA 2E1CA 1Q81T 5CAAA 3L95X 5KG3A 1LKZA 3RBZA 2ZBQA 4KFBA 4NRTA 2CXEA 1Y5NB 4GVLA 1WEXA 1REVB 3R2DJ 3KLVA 2VJVA 2GQ2A 3OUYB 1DBDA 4I7FB 1N5SA 3FBEA 5J2MB 2RUSA 4MFBB 1SH3A 4DV7F 2RAQA 1YX2A 3GV8B 1RTDA 4Z7YA 2IVYA 4IOCQ 3DDKA 3AT1B 4QPXA 3M8QB 3KJVB 3A8KA 3P4UB 1JLBA 1U0HB 1GEHA 4M5IA 4K4TA 2BR0A 3D5MA 3O8WA 4FKXA 1QJHA 3K17A 1QAYA 4KT0C 1U47A 4KH0B 1T05B 2ROEA 1YK9A 1PCAA 1FRIA 1VQLS 2DEJA 1YDLA 4C2MA 1KD1T 2VPZB 4IO1A 3TEHB 3T5HA 1M90T 5LMUJ 2V9WA 3OR2B 1IBLJ 2JNJA 4PEOA 1B3TA 3FBFA 2IVMA 2VASA 2KJWA 4LMZA 5AXNA 3LO3A 2FVQA 1RCXB 1VRUA 2W2QP 1KNZA 4Y2IA 4TU8A 4J9PA 2CQGA 2MKIA 3L3CA 2HFOA 4ZLPA 4PG8A 1NM2A 1B0PA 2R4FA 3HHDA 4NLUA 1R0AB 4PXCA 3TEGA 2KM8C 2X7IA 5KFXA 4DU8A 3HD2A 2KRRA 3W60A 1VISA 4QWDA 1TK0A 1D09B 3G8SA 1MMLA 4P7VA 1RADB 4C0OC 3LP0A 4CTAB 3KK3B 1NJXA 3G87A 5CCLA 1KC8T 2PD1A 1ZYQA
chains in the Genus database with same CATH topology
2C2EA 3B78A 4E8UA 4RW9A 2YKMA 3CCQS 3I55S 4K4ZA 4CNYA 2M70A 2W9CA 4OZNA 1BY9A 2VKRA 1W2IA 3DNCA 1IKVA 4WZMA 2IC3B 3CCUS 3ONQA 1VBXA 4TQSA 1WI8A 1FTCA 1YQHA 1O8BA 3KLGA 4CH7A 4Y6IA 3HVTA 4OX8A 3SFUA 1CLFA 2HS4A 2C22A 5I42A 2J7UA 3MPVA 2Q79A 3MEEA 1JK9B 1Q16B 1FRXA 2GHWA 3BZQA 1B64A 1JJHA 1UVJA 2FHJD 1TVRB 2ZD1B 2LEBA 2VA2A 3I9V9 4LIRA 2POKA 5IQ6A 3GR0A 3TP2A 3EYZA 5DQHA 4B9UA 3B8HA 5A8WB 1GNKA 3ZZTA 5JUMA 2D74B 5F8IA 2NUHA 1Q86T 3M2VA 1SIWB 2DISA 4OZ5A 5I4MA 1HBOB 1BQNA 1JLEB 2AWZA 3NS6A 4LVNP 3GV5B 5C24B 3D54A 4CT8A 2FHJA 1S6UA 4RBUA 2Q6CA 4O23A 1HNXF 1FVSA 4ZCIA 3KFWX 4MIBA 4RX6A 3MM7A 1UETA 5KTQA 4ZDNA 5IZHA 1YG0A 2AQ4A 1FNXH 5T14A 1TZ0A 2DNNA 2HHHF 5AXLA 3IA0A 1SIZA 3GILA 4P7TA 4AXIA 1NKEA 1TAQA 4YB1P 4N47A 4LIWA 4WU2A 2CQ4A 5FDLB 5C42A 1XN9A 3SYZA 3S01A 2VA3A 3OLBA 4WCEQ 3H25A 1WEZA 4V19X 2IYIA 4X4UA 5CH7B 2F8MA 3RB0A 3LGMA 3DLKB 4H4MA 2LYVA 3MEKA 5HI7A 2N7YA 5B0FA 2GJ2A 4MK8A 3TARA 3D0HE 2N82B 5AJ3F 1SC6A 4J37A 2P6TA 3EGZA 4DFMA 3IR5B 1FRLA 1VQSA 4X4PA 2HIQA 4FVMA 3G96A 3UDCA 2LEPA 4BC9A 3IRWP 4ELUA 1R31A 4KPYA 1O51A 2XG8A 2ROPA 4WTYA 1X4BA 2VUGA 4X84A 5B0GA 2ZH2A 2O66A 1MNEA 4NLOA 3MD1A 4L3NA 4AL5A 2V2KA 3FRYA 4WK3A 4ID5B 1S6QB 3Q2SC 1LFPA 4NPOA 5B0CA 5K8NA 1PSDA 3CCMS 4PXDA 2DNKA 4J9MA 3UCUP 1NB7A 1SV5B 1Y00A 2MYFA 3KK2A 3OBIA 3NAHA 3MMCB 4F3QA 3CF5Q 1M5PC 4F2SA 3TI0A 1FNOA 4DEZA 2HGMA 2XMJA 1BLUA 1TK5A 2WRMA 1LV5A 5HP1B 1N48A 1DARA 4Y34A 3EZ5A 3I87A 1LWFA 4C8KA 1FK9A 1TL3B 4TY9A 3HJFA 3RW7A 5EX3A 2Z4PA 1KQGB 3PW2A 3OL9A 4KGMA 1FDBA 1JIHA 2CFXA 2CVIA 1C2PA 4Q44A 2DGXA 3GG1A 3HHKA 2NREA 3CMAS 4X64F 3BGRA 1I94F 2OIHA 3M6WA 1SKSA 5SUHA 2DK2A 4N41A 3TAPA 2QRRA 5D6GA 2V4RA 5DG8A 2XS7A 2RS8A 2P5VA 3EGWB 4NXMF 3FEXB 3OJSA 3H2LA 2ZKTA 3HHLB 4EEYA 3KNAA 1DFDA 3UW1A 4TXSA 1VMBA 1LK5A 2IRYA 2LQJA 1UVMA 5LJ5Y 2OP5A 2ZBCA 2CPIA 2VFRA 5DJBA 5KT5A 1S1UB