2OFGX

Solution structure of the n-terminal domain of the zinc(ii) atpase ziaa in its apo form
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
106
structure length
106
Chain Sequence
PLKTQQMQVGGMDCTSCKLKIEGSLERLKGVAEASVTVATGRLTVTYDPKQVSEITIQERIAALGYTLAEPKSSVTLNGHKHPHSHREEGHSHSHGAGEFNLKQEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase, membrane protein
molecule keywords Zinc-transporting ATPase
publication title NMR structural analysis of the soluble domain of ZiaA-ATPase and the basis of selective interactions with copper metallochaperone Atx1.
pubmed doi rcsb
source organism Synechocystis sp.
total genus 23
structure length 106
sequence length 106
ec nomenclature ec 7.2.2.12: P-type Zn(2+) transporter.
pdb deposition date 2007-01-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ofgX01
1YG0A 2K7KA 3HHLA 4HI2A 1S6OA 1TR0A 2FIUA 2OFHX 1QUPA 1FEEA 1KVIA 4Q2LA 4A4JA 2KYZA 4NPOA 3HX9A 1N5SA 1JK9B 1N5TA 2AJ1A 2RU9A 3I9ZA 2HFNA 1CC8A 5F0WA 1GXTA 4OJGA 1LQ9A 1KVJA 3FRYA 2AP6A 2HQIA 4A47A 1FD8A 1Y0HA 1URRA 4OJ3A 2IYIA 2XMWA 3TOQA 2RILA 2CRLA 2XMKA 2RSQA 5B0EA 1FE4A 2OAUA 2VH7A 1Q4RA 5K9FA 3F44A 2ZDOA 2W4DA 3BGUA 5B0FA 3BB5A 5A6PA 5KAKA 1CPZA 2N4DA 2QLXA 2XMMA 3IWLA 3KG1A 4HH1A 1K0VA 2BYCA 4EFAC 2OKQA 1Y9OA 5B0DA 3WDOA 1AFIA 1XBWA 2OD4A 1Q8LA 1V3ZA 3UDCA 2GGPA 1ULRA 3KG0A 1W2IA 1YJVA 1RJJA 2XMJA 4Q2MA 3HHLD 2QLWA 3LO3A 5F0UA 2GV1A 2OMOA 5T7LA 4HI1A 2ACYA 2KT2A 3VTIA 2XMVA 2GA7A 1OQ6A 3IWXA 3CJKB 2RMLA 2PD1A 4OJ1A 2JDJA 2BJDA 2G9OA 2FB0A 1AW0A 2W4CA 2L3MA 1Q53A 3BM7A 5B0BA 1TUVA 3HFKA 3KKFA 4FNHA 1YRXA 2OFGX 4Y2IA 2XMTA 2KKHA 4FNIA 2HFOA 2W4PA 3QMQA 2HIQA 1SB6A 1FE0A 3K7RA 2FHMA 2LDIA 3HDSA 4ZA1A 2LXFA 2GO8A 2QIFA 2K1RA 2QYCA 3FMBA 1FESA 5T7LB 2N7YA 1KQKA 1S6UA 1TZ0A 1TL5A 5B08A 1X7VA 1CC7A 1SI9A 3LGNA 1AFJA 1APSA 3T9NA 4ZOSA 4HL9A 5B0CA 3HF5A 1FVQA 3HHLC 5A6WA 2KT3A 3MCSA 3DCAA 2FTRA 2AJ0A 4OJHA 2OP5A 5IXUA 3TNVA 1X8DA 3MZIA 1YJTA 1YJRA 4OIXA 3HHLB 2BUNA 3TRGA 3BN7A 1IUJA 3BDEA 1MWZA 1GXUA 2BJEA 1WD6A 2PGCA 4NL5A 5B0AA 2GFFA 2OD6A 2Q3PA 2XMUA 2N4CA 3GZ7A 3CJKA 1N5VA 4U9RA 1YJUA 1U7LA 2ASYA 1OSDA 5B0GA 2VV5A 3E8OA 2LQ9A 1TL4A 1VQSA 4F67A 3BR8A 5B09A 2ROGA 1N5QA 1Y3JA 2ROPA 4QOTA 4A46A 4DPOA 1FVSA 1OQ3A 1P8GA 1R6YA 3FGVA 1P6TA 3DXSX 1OPZA 2ROEA 1X0PA 2GCFA 4YDXA 4YEAA 4DN9A 2IYGA 2K1RB 1SQEA 3KNGA 4A48A 2ZDPA 2LQBA 3QGPA 1JWWA 2IFXA 2AW0A 2K7JA 4Y2KA 4Y2MA 2HLUA 2GGPB 1MWYA 1Q8BA 3BF4A 4HH0A 2BBEA 2EW9A 2K2PA 2HLTA 3LGMA 4DL0C 1VQYA 1Y3KA
chains in the Genus database with same CATH superfamily
4D3GA 3N6NA 4LREA 1J5EF 2FY8A 2PIIA 3CCJS 4F25A 2DIUA 2PDAA 4O44B 3H98A 3M8QA 4OYAA 1FTCA 1W26A 2FLLA 2EC0A 2V2VA 2ATLA 3E01B 5DLFA 4CLZA 1K0VA 1D8ZA 3K17A 3NGDA 1LK5A 3A8KA 2VFSA 2L41A 5DZ6A 3ZFVA 3DLLQ 2WSEC 4LF2A 2B9EA 1QE1A 5T14A 1FFSB 1NJZA 3HFKA 4KRWA 3WHIA 2L9NA 4IRCA 5MLCV 2J7KA 3R3TA 2HQGA 2GJ2A 4DOZA 2HWIA 1QSLA 1YRTA 4PXCA 2DHGA 3AJ1A 4A8MP 4WK1A 3ZNUA 2HRUA 3OJSA 5D4LA 2OELA 2ZKTA 3MHYA 4B3RJ 5HQLA 2Y1IA 1VIXA 3Q83A 3B6BA 3W1YC 3GR1A 5L1LA 1WOOA 3MR6A 3AD9C 1L3TA 4OZNA 1ZYQA 3CCLS 3A3NB 4AD6A 2BJ7A 4RU9A 5A0YA 2ZNYA 5B0DA 5KG7A 1JLQA 4YP3A 4NA1A 3JAMY 1YJVA 2NYIA 3P96A 2XMVA 3QLHB 5C25B 2YQ0A 3VZIA 4QW9A 4LQ9A 3KWMA 2DH8A 4HL9A 3ISND 2IM3A 2E5IA 2DNGA 5D4PA 1RYRA 1SKWA 1HNVB 2CNKB 4QIWD 4ED1A 4ZS6A 3ZZ0A 4X4PA 1JLFA 4I2PA 3OR2A 1IVZA 3OR1B 3NRBA 3AQOA 4M5JA 2EFNA 3TUJC 3LP2B 1SL1A 3TJAA 4PG5A 2KJVA 3FBCA 2BBEA 3W8GA 2R4FA 3QZ8A 1WACA 1RHUB 2V2ZA 4A4JA 2XTJP 3UNGC 5D3GB 2D3UA 2HAIA 3US5A 3BDPA 1S1XA 1JJHA 4EO8A 2ZH1A 3MMAB 1Y10A 4DQRA 2KG0A 3JYTB 4LF9F 3M8PB 2OPPA 3I0RB 4ID8A 3J81Y 1FRLA 4EYHB 4IG3B 5GAEI 2PD1A 3KKFA 1PJ7A 3T5HA 3Q23A 4OHYA 5DS7A 4G65A 4FXDA 3RRGA 2VJUA 3QRPA 5CAAA 4HEA9 2Y0SD 1IN0A 5C42B 3BH6B 1NO8A 1MN9A 2FVRA 3TW0A 3SDEB 4WZMA 4CDIA 3CJKA 1EARA 4KH1B 2ZM6F 2V8PA 1SXLA 1R8CA 3KLVA 2HNDB 3NLCA 2V68A 2L9WA 4LR8A 5EWFA 1X9SA 2B51A 1V3SA 1NKEA 4DWIA 1QSSA 4E98A 3MR5A 3D3CJ 4DL2A 3IM9A 4AXJA 5IC4B 3EVWA 4NEZA 3PW0A 2YPZA 5F0UA 2RDDA 5KFGA 3TA1A 3E51A 5GMEA 3GILA 3DI6B 2JLEA 2B0GA 4KPYA 1HI1A 5KFBA 4JI6J 1SIZA 1TAQA 4CH0S 4OLOA 1GNKA 4XO0A 1S0OA 4CH7A 5KOXA 3AOBA 1PAUB 4QR2A 4I4BA 1PYTA 2QMXA 2CJQA 1K1SA 2YNHB 3IG1A 5IOLA 4B3MJ 1OO0B 2IRUA 2GMLA 4L74A 3UW1A 1S1VB 2A2DA 5C24A 3VHQA 3M2UB 3F41A 1IKWB 3B54A 1JJ4A 2HHUA 3CO0P 2VIHA 5D78A 1JKHB 3RZAA 3EYZA 2B43A 1RU1A 3OTDA 3F73A 4DV2J 3DKDA 3FDSA 2V6AA 2PEBA 3TEGA 3J81U 3JQKA 2P9CA 3RGIA 2RT3A 5K8MA 4EFAC 4X4QA 1F9EB 3EJMA 2IPOB 1UPPA 2XMJA 3HXMA 4FN5A 1YHQS 3WC0A 1FK9B 5BYQA 4RW8B 2CQGA 1F2HA 5ADZA 4PG6A 2H3EB 2DNRA 3OD2A 3DRYA 4KKOA 1WNEA 1RTJA 3FBBA 5A6WA 4QIGA 1YJWS 2BJ1A 3GLJA 1OS5A 1FRMA 2BANB 3GFZA 1X60A 4TU8A 4K4VA 4YFUA 1U1LA 3IBFB 3THPA 3HVTA 3LF0A 2OHDA 4CLKA 3UNYA 3M6WA 2AWZA 4MYUA 1NM2A 4WIQA 1XNQJ 1UVJA 2GZOA 2MKYA 2J0QD 2KVIA 1VBZA 1XERA 4M1KA 1JLEA 2GW8A 4RKUC 2YXLA 2DNQA 3C46A 1YQHA 2FIUA 5E3QA 1BXNA 3MCOA 3S1TA 4FBUA 2RS2A 2V0NA 3G71S 4PYDA 3FRZA 3TR5A 3MUVP 3DRSA 2K3IA 4G1IA 3TQ1A 3SMZA 2XI3A 3GTYX 1Y9OA 2CIMA 4ZVPB 3RBDA 2FJEB 2D3OR 1HPZA 3KG0A 3VWSA 1FJGJ 5HN0A 3JSBA 4NRUA 2AU0A 4DSIA 1S10A 4JI8J 4WXOA 2O66A 3IA0A 1GAOA 2NXUA 5C2GA 2XY7A 2HZAA 2Z57B 2XB2D 3PIOQ 1FWPA 4R0EA 4RZRA 1BGXT 3OJUA 5U47A 2DISA 1EAYC 1K0TA 1ZAVA 3FMWA 5JVHQ 1U1OA 4Y6IA 4FXWA 2W01A 2BW7A 3U1MA 5KFDA 4B3OB 2BW2A 1RWWB 4G1QA 4NPOA 2GQ2A 1FCAA 5EX0A 2E1AA 4WKYA 3MECA 2F4FA 4CTAA 2RQMA 4Q8EA 5KG5A 3T5JA 2MQLA 5KFIA 3I6PA 4HACA 4JV1A 2FY1A 2MLXA 3DLEB 3VALA 1BD6A 4WFNQ 1FX2A 4ZLJA 1MU2A 2QV6A 2MQPA 1S0VA 4OZLA 1PKUA 2OLWA 2QZ8A 3V4MA 1JB0C 3CJSA 4A8WA 4EZ9A 2LA4A 4H4OB 5I3QA 4J9UE 4I67A 2WBMA 3V81A 1Q7YT 3I5BA 4DG1B 1RHRB 3DHWC 4NLOA 2CQ3A 4F3MA 7AT1B 1JXEA 3PX4A 1TKXB 5ETPA 2VU5A 2ZH7A 2DGQA 1M5SA 3UCZP 1WC3A 5ETKA 1U1PA 2UUBF 4FYXB 1RBAA 4B3MF 1CJTB 4YB6A 1NHUA 1X5PA 3QATA 4M5IA 1XMQJ 4XIUA 2PE8A 3NS6A 1S79A 2VG5B 3DM2B 1DURA 5B0FA 4DV2F 4R25A 3H90A 1VYAA 2ZKUA 3DU5A 3FVYA 3IS9B 5L1KA 1I51B 2NLWA 1WTFA 4DFMA 1UA0A 5LSOA 1VJQA 1C0TB 1PJ5A 4LSLA 4WFXA 4TQSA 2CDQA 3BPSP 3G6ES 2R9LA 3MOZA 1CVJA 4B9SA 2CDRB 3T9NA 4ED6A 1ZM3A 2FHOB 1RUSA 2HBZB 3EXCX 4N56A 2VF3A 1WWHA 4ANDA 2XHWA 2BX6A 5A76A 2IM0A 1T9UA 3L09A 2DXEA 2RQKA 3CPWR 2EXUA 2DGSA 2NZCA 3UI3A 1FRJA 2J9EA 2EKYA 2K2PA 1P1TA 2AYEA 4NASA 4BWMA 3PV8A 4PPZA 3ZZRA 1XNQF 2JJ4D 5H9EJ 3R5AA 2C3PA 4PXDA 4NLVA 2QC3A 3CXCR 2B56A 2XM3A 3DGPA 3AA9A 4JUZA 2ZZTA 4ZP6A 3MUTP 1VLOA 1MN7A 2QL9B 1HD0A 2LDYA 1Q95G 4UQTA 1LWEA 3CJRA 2XEXA 3VV2B 2XULA 4MK9A 2UUCJ 3BGLA 4LFBF 2W7OA 3O6QA 2Z2ZA 3QJLA 1B64A 2RJZA 3GSIA 1GMVA 1FJGF 3FMBA 3NAIA 3N6MA 2XWYA 3I55S 3G6VA 4ICLB 4JI8F 2ZJPQ 5IXUA 3TP2A 4AUKA 3PJXA 1GTHA 4KO0A 5B0AA 4ED7A 2N82B 2WTFA 2LQ9A 4AXIA 2MKKA 1JLBB 2PFDA 3MEGA 3PO4A 3RW6A 4AE5A 4O3QA 4GVBB 3BR9A 4AL7A 1RHQB 1M0SA 3B4DA 3LWMA 3MAQA 1NHVA 2RDJA 1TMJA 3T6JA 4N41A 2MZRA 4P52A 2UVUA 2IA0A 2XYGB 3QO9A 3OL7A 1HI0P 1KVJA 4A47A 3O2IA 2OTJS 3RUBL 3ET6A 5JVGQ 3DOKB 4ZCLA 4MMOA 5E3PA 2I2YA 3C66A 1T9XA 1X4GA 4OZ0A 4USIA 3GIKA 2VG7A 3POTB 4RNFA 4ECUA 3V5RA 3PW2A 3SYZA 2X3DA 2CZ4A 2DGTA 2KM8B 3ENVA 4WFYA 3M9MB 2Z58B 4TY9A 4ED2A 4OYXA 2HURA 3HULA 3PXGa 1IR2A 2J9CA 3W62A 2CPIA 2HS0A 4ES3A 5KG4A 3N0VA 3OVAA 3MD3A 1X0PA 4M95A 2XBPA 2VA3A 3ZNJ1 4RUAA 2BQ3A 4K8RA 4TU9A 1H74A 1VMBA 4O0IA 4WK3A 1Y4ZB 1F9HA 3ICLA 3NXZA 3T1AA 5ITHA 2ALZA 3PYFA 5IWAF 2AT1B 3IBWA 2CFXA 4I68A 4OX9J 2NPIA 5HK4A 2HFUA 3M8WA 4I6YA 3IWLA 1XMQF 4F4KA 2ZEJA 1S9FA 1WHVA 2YNGB 3W63A 2ATCB 3H4DA 2Q6CA 4TXSA 4OX8A 4PWUA 4JV0A 1S9EB 2Z8QA 4NE9C 4GO5X 2IVMA 3MM5B 1RABB 1WHXA 5KG0A 2CPXA 1KD1T 5IFMA 3QFHA 2R3VA 3PG9A 5ETOA 3ZTOA 2BJ9A 2E1RA 3HFZB 3GV8B 2B6AB 4MKVA 3NGTA 4X4RA 4ATNA 4ZPDA 4EMDA 3D9BA 4QCLA 1YJUA 2DEIA 4C48A 2C1EB 5B09A 3OUYB 2M3DA 3BGRA 4Y34A 5BXIA 3H20A 4DN9A 2HWTA 2C3YA 2OI2A 4TY8B 3R5GA 2EFPA 3G2XA 1RWNB 1NK6A 1TMMA 4WTYA 3C15B 3HHNB 1RHKB 2DGOA 1G6BA 3SCIE 3PR4A 3CCVS 1LFPA 4I64A 1B7FA 1Y0HA 1C1CB 3FCWA 3W2VA 1HQEA 1VRQC 2O01C 5A8RA 2B4OA 5K14B 2HQ3A 4IRKA 4QIFA 3VAKA 2EKNA 8RUCA 2BABA 1P1LA 1S76D 2Z0GA 3KLHB 2VFRA 2RMLA 2QA2A 1Q82T 4C7QA 5B0BA 5HMZA 4FPRA 3GIRA 1QLNA 2DR5A 5GAEU 3CJQA 1R0AB 1N5YB 5C5JA 4BBYA 2ZBRA 3M8RA 1JLGB 4XDCA 4IKAA 1RT2A 3AOCA 4O44A 2OH2A 4B9NA 2V34A 1KEKA 2EWHA 1FVSA 3I5CA 1NDKA 3R2CJ 3ILLA 4URSA 2PSZA 2ZWPA 1TK5A 1HA1A 1Q8BA 5A8KB 1HQUB 4KGZB 4JI5J 2C3UA 1S0NA 3U1NA 3H8YA 4C0HA 2X1AA 4ECXA 3NWRA 2BV3A 3TJ8A 2OEJA 3KK3A 1HWLA 5KG2A 4ZN3A 1FWLA 5KT3A 1D3WA 3K5NA 5F8LA 3T5KA 4H54A 2EBGA 4J9VA 5CH7B 2GVZB 1YBUA 3DRXA 3C6UB 4DPXA 2D9PA 4CLFA 1TFYA 1RT3B 3CCSS 1S1UB 3KUHA 1N6QB 5K8OA 1RLCL 3CD5A 3TNVA 3KLEB 3GIMA 2O67A 3L7OA 4R5PB 1NXIA 4CP5A 2MZSA 2LEAA 4QWBA 3Q2SC 2O1PA 1FKAF 1JLCA 1YGYA 3N9UC 2VASA 5HVGA 4X65J 2LVWA 4YHHJ 1EB0A 2X1BA 3QBCA 3NP5A 4ES2A 2LQ5A 3TAMB 2A6OA 4CT8A 1RTIB 2FJBB 2OSRA 1LW2A 3QLHA 5C25A 1KFSA 2FDNA 4RNOA 4RWWA 2CPFA 2KRRA 4DV0J 1D9FA 5B0EA 3N01A 5KAKA 2KL8A 2WAQD 1QAXA 3R7NB 1WELA 5KG6A 5SUHA 1Q0NA 3AH6A 3TUIC 4PAAA 1X5TA 2V50A 4OX9F 2GV1A 3Q8QB 2GO9A 1LWFB 3W2WA 1P9QC 3OR1A 4GMKA 1S6QA 1TUVA 2BQUA 2ZH6A 4CNYA 3TA0A 4KIAA 5IV3A 3TUPA 3HJVA 2R8KA 4RBUA 1VJWA 4HHJA 2QG9B 5D3GA 3KG4A 3HHDA 2DPJA 1AXQA 3MMAA 3FBEA 4RW4A 2B9XA 4J37A 2NXEA 4CWBA 1FRIA 3PFOA 3JYTA 1R43A 1S9GB 1VRUB 2RIJA 3G86A 1VRTB 3CIMA 3I0RA 4QZVB 4A48A 2HWHA 2Q43A 2LQBA 2H9ZA 3CJTA 4IG3A 1VQ9S 3KDNA 4YY3J 2AEMA 2HS4A 1WF2A 2XLIA 1PBAA 5KT5A 1U8WA 5LXYA 5C42A 2FC8A 3KG1A 1NSKL 3G8SA 2HGNA 1SPBP 3GG0A 3CD0A 3EUNA 1N36J 5DDOC 3MPUB 3FNNA 1F5AA 2IA6A 4TVAB 2DPIA 2CPHA 1RLDA 1TZ0A 4YR3A 3OL9A 1FKPA 1WC6A 4UTGA 5CCMA 4IH5A 2OTLS 3S01A 1WC4A 4RW7A 3EX7B 2PI4A 2FD2A 2KDOA 1DQ8A 3VVTA 2H54B 1U47A 2VONA 1O8BA 2K06A 1LK7A 3RB3A 5E3AA 2C2DA 2J0WA 4NI2A 4CO2A 1YDLA 3GJQB 2CUYA 4RW9B 2BJ3A 3ZZZA 5DG7A 3NMRA 3KJNB 1MMNA 2H5IB 3LQVA 1H2TZ 1QD1A 1IM4A 2HRTA 2F8MA 3PNIA 3DI6A 4LF8J 1FD8A 1P27B 3DYAA 4CLSA 4TQRA 4JI5F 4F4WA 4X62J 2OKQA 2YX1A 4PWWA 2KTQA 2XI2A 2M88A 1VC6A 4FS1A 2ZD1A 3TZXA 3M2UA 2A0FB 1NJIT 1YRXA 4CT9A 2UP1A 3FUYA 5CYMB 1JKHA 2QT7A 1RHJB 4KE5A 4O0NA 3ILIA 3NS5A 2B7CB 3W66A 4DUZF 3D7SB 1EETA 2FJAB 2BUNA 3AOAA 3LTOA 2EG1A 3M2RB 3GV5B 1KLMB 4QBUA 5K8PA 4J9PA 4RLEA 2ZZMA 1RISA 1N0UA 3N5BA 2GCFA 2HHSA 2AX0A 1RXOB 1M1KT 1TL7A 4KPCA 4DQPA 3VVUA 2MZTA 3HMJG 3V6DB 4LRAA 2ADCA 4EU0A 2BZ2A 1FK9A 4X65F 5T7LB 3ETMA 3BEGB 1AYEA 4YHHF 3J7A1 3UQSA 1RT6A 2J0XA 2CQ4A 4DCPB 3Q2TC 3MTJA 2GHPA 1MROA 1DTTB 1XC9A 2KG1A 1CQNA 1TELA 4ZHRA 3MMCB 4DLGA 1FJCA 2ZH9A 4ZN1A 4DV0F 1B70B 2WVFA 3DOLB 3VTIA 2W2NP 4TLQA 1IR1A 3H2VE 3TVYA 2YVSA 3AT1B 2W2PP 4ZDNA 4LFCJ 4MFBA 4NMLA 4NCBA 2OEMA 2LDIA 3M8ZA 1SBRA 2R7RA 2OPRB 1GMUA 1FDNA 2PO4A 5F8HA 1Y5NB 3HJFA 3KHHA 2XZTB 1F0XA 3B82A 4M5HA 2QYGA 1AB8A 1F3VA 2ZE2B 1HR0J 1KFDA 1ZTTA 1Q81T 2W7AA 3R2DJ 4IO1A 3CC7S 4DSEA 3P8BB 5L8RC 2ZWOA 1C1BB 2AYGA 1LWCB 3BV8A 2C42A 1HBOA 3LPEA 4USVA 4K5SA 1TKZA 4I2QB 4DL0C 4YQWA 1XK8A 4LBHA 2MMYA 4JI1J 5HQ8A 2YWKA 1CJUA 2QX0A 2BR0A 1MNEA 3OTBA 1QDUB 3Q8VA 5IQ6A 4ZVTB 1LEOA 2E1PA 1TL1B 4C8YA 4YY3F 1TP7A 4NLYA 4U95A 4IDKB 4TU7A 3ZXWA 1VIOA 3G6YA 4OYMA 1QSYA 1FI4A 4UZCA 1YZ7A 1VOMA 4ZPAA 2DEJA 3MURP 1WTBA 4P2XA 2XO6A 2KVQE 2M7SA 8ATCB 1XTZA 4DF8A 1V5IB 1EHWA 4DV5J 3GR0A 2FZCB 4P72A 5F9LA 1FKOA 2HMIB 2BEFA 2MTLA 1QY7A 1N36F 1IKYA 5DDRC 2LP4A 3BS9A 1M5KC 1RWPB 3QNWB 1WOSA 4XPCA 2GFFA 4CI0B 3KK2B 4FKXA 4OLPA 3AXKA 1FJ7A 4W98A 1HNIB 2RAQA 3NNAA 3KK1B 1UETA 3FGVA 3DLEA 2AHOB 2WOMB 2BM1A 6AT1B 5KFFA 4U6PA 2K7JA 3M2VA 4PWDB 5JXSA 4HDGA 1T3NA 4P2MA 1U4BA 4JV5J 3SCLE 3ZZUA 5LL6d 1U1QA 3UVJB 2HVDA 2VC0A 4KV8B 1B0PA 3D6HB 2XMKA 3P3DA 1N32F 3Q8SB 2KZZA 4H4KC 4QYZK 4NLRA 4LF8F 2LECA 2JWNA 3QGHA 3M1VA 4OZ5A 3DC2A 1IJFB 4DQSA 4F4YA 3A3PB 5CYQA 1RAIB 2XZDB 4NEYA 1U2FA 4X62F 1RTDB 3P6YC 4P71A 2LU1A 2ZBQA 1H38A 1FFWB 2V8VA 1SV5B 2KB2A 3NMAA 2OPSA 3HO1A 1X5OA 3L7UA 4FZVA 4ETZA 1EP4A 2MKJA 4F26A 3M30B 4RNNA 3DM2A 4ECZA 5I42B 4NCGB 1R3NA 2DJWA 1DARA 3OL8A 1G2EA 1VBKA 4EK2A 1N5QA 3D28A 3IS9A 3EGZA 2ZDPA 1OMSA 5HLFB 1HHSA 4PXEA 4HTJA 1C0TA 4Q2LA 4NYZA 1NH8A 1E6YA 5L1IA 1C2PA 1D8YA 2HK2A 2PA3A 2CRLA 1QM9A 1S5ZA 1WKLA 4E2FB 2QFJA 2QLXA 3CW2C 2J6UA 1REVB 4MT1A 1MW7A 5E33A 4LVOP 1CS4A 3C16B 5KFQA 1R6VA 4K2JA 3PCOB 2ACYA 3J7YI 3J7ZT 1FHTA 4I69A 1S1TA 3C2PA 2MKIA 1H72C 4ID5B 4ZK7M 4PR6A 3L7PA 2JZ5A 4C0OC 4UQGA 1M1GA 2ERRA 4M5GA 1JNRB 4LFCF 2DO0A 3MM6B 3QFWA 2HFVA 3I82A 4DSFA 2DNNA 2OD6A 2N4CA 2VBZA 1PC4A 4EBCA 4DU7A 2AGPA 4ZLNA 1NB2A 2BXJA 2R7QA 1L3UA 4IH7A 3ZZTA 2ZUAA 1I6JA 3NGUA 1Q78A 3S7RA 3NWGA 5AT1B 1HR0F 4C11B 1RE1B 3W9HA 1KQFB 3ETOA 2RHSB 1T3OA 3CCRS 5J2MB 2DVIA 3OHAA 4NLSA 4DR2F 1YSJA 4JI1F 4R8UB 4M5DA 4QR1A 3JS9A 3KLFB 4FXVA 1N8RT 1KHWA 1I1GA 5K20B 4Y2CA 4UOFA 2WONB 2B5JB 3OFFA 2YKAA 1G3OA 2C2NA 4AQYF 4FF2A 3J7Z5 1ZTWA 2B9YA 3VGUA 2DRBA 4GVBA 3NCPA 2V69A 4A8XA 1PO6A 4OYPA 1NK0A 1RU2A 4DV5F 1UWAA 2YY3A 4XDDA 1LWXA 3KHLA 5RUBA 2H5JB 2XGPA 1QVFR 1R6YA 2IIHA 4J9QA 4LQ3A 1FWKA 2JEJA 3BPDA 2FJXA 2MPUA 3POTA 3IBCB 1TV6A 1IBMJ 3CJ4A 5H9EK 3I4HX 3QRQA 1U6BA 3BREA 2BM0A 3NOGA 4CO5A 2V4JB 2SXLA 1DQ9A 4JV5F 2W9CB 3DGVA 1ROFA 2FHKA 1XBWA 3B8HA 3GPAA 2LEPA 2JLGA 2R8IA 4YB7A 3QMQA 2DH7A 4CLTA 2F8EX 3MR2A 1WEYA 5KG3A 2JEFA 4DL6A 1X7VA 3C3LA 1L3KA 4C98A 4CM0A 4DZ6A 3K59A 4IFVB 2DR6A 3LP0B 3WX8A 1OY6A 4C8MA 4UT4A 2NZ4A 5F8IA 4XAKA 4QYRA 2YQ1A 3FFIA 5H9FK 1SH2A 3RAQA 4WJBA 2FZGB 3BO3A 3QGPA 2B4UA 3PW7A 3ILOA 4HI2A 1RWKB 4O4RA 2I9SA 1N5SA 1IKVA 3ZZOA 2JVOA 2OEKA 3J81j 3K5MA 1HYSB 5FIIA 4O3RA 3J7AN 3FEYB 1XEZA 1Q79A 3BSNA 1WI8A 2AMCB 3D6FB 4NZ6A 4ECYA 2VBWA 2AGQA 4Q2MA 4WE1B 2JL9A 1XR7A 4ECRA 3LW5C 2JDJA 1KOHA 4J9KA 1N33J 4ED8A 3MR3A 1U02A 1U8SA 4TY8A 4LRFA 1T05A 2CQ2A 5IM0B 1RYSA 2E5GA 1RTHA 2ZJQQ 2Y0BB 3HHLB 2Q6BA 1FA0A 1IUJA 1IBLJ 1VQ8S 4IFYA 4OYWA 1OYEA 2BOAA 1KP6A 3RBXA 1UZHA 5D4NA 2HQCA 3MM7B 1YK9A 1FJEB 3CVKA 4NLGA 4JI0J 1EIYB 2XY5A 2LYVA 4NWBA 3P5TL 2VG6B 4OI0A 4ECQA 3G6XA 3GCXP 3LH2S 5CZXA 2ASLA 1LKZA 4DU8A 1C0UB 3BBBA 3W9IA 1I94J 1FERA 2GJIA 5BR8J 1NK4A 3TQEA 1NSPA 1JLGA 3T1HJ 1R31A 5FDLB 1F60B 4OI4A 2XYPB 3FKBA 3V2UC 3LP1B 5G4DA 1LW0B 3JTPA 1N56A 3DLKB 5J1EA 4J7CA 3Q8YA 4W90B 3PX0A 2EBEA 3O44A 2LXFA 1A9NB 1RAFB 1S4FA 3T19A 4DR5J 3W65A 3ITHB 5A8KA 1FVQA 4USJC 4KR0B 3VAMA 3MMJA 3KJFB 4Q45A 1RT7A 2J5AA 4YMEA 3FQLA 4IG0A 5BYRA 2XLKA 4E0DA 4RW6B 1T9YA 1CLFA 5KFHA 4OQJA 3UDVA 5KT2A 1GEHA 1N88A 1MWYA 2JOQA 3SQGB 2ASJA 3TANA 3QAUA 4MH8A 3LAKA 3C6UA 2R42A 4G6VB 3IRWP 3GU0A 2VICA 1MG7A 4ZPCA 3TOQA 1VBXA 3UN2A 3D5MA 3FCVA 4LIWA 3DU6A 1N6QA 1IBMF 2QJ3A 1T9TA 1M5OC 2RQ4A 1HBUB 3G82A 1ZOTA 4CZCA 2AQ4A 2OUGA 4ZVRB 3M6UA 2AX1A 3EZOA 1JLAB 1S6PB 2JNJA 1R0BG 3DLBA 4NLDA 4IOAQ 1BC6A 3IR5B 1GFWB 5LSLA 4ANCA 4X66J 4IR1A 1YBAA 3VGVA 4LF6J 2PGCA 5D0RA 4B9MA 4LR9A 1U7LA 2VD3A 1HARA 3TX0A 3BR8A 3I0SA 2XSFA 2D1CA 2RH3A 4AFFA 2F40A 4I0WA 4JB8B 4NYPA 1UW9A 2HLUA 2KI2A 2GGPB 5HJXA 3G87A 2MQOA 1Y3KA 5AXNA 4CRJA 3K5PA 2XNRA 1QUPA 2FPHX 1FDBA 2IAJA 2GQCA 3N6LA 5HMWA 1QVGR 3HVRA 3QSYB 1NHKL 2F3JA 4ED3A 1WG1A 2W8LA 4U8VA 2P9GA 1RT5A 2IBOA 1BQMA 3K8WA 1S1WB 5J2QB 2ZH5A 2VDHA 2LLZA 3HVWA 4B3TJ 2HYIB 3X3UA 2HHTA 3Q8PB 1VRTA 2G0IA 4L3NA 3PHEA 3A8EA 1XMBA 1OWXA 3OVBA 1S6UA 3H0PA 4KGXB 2UUWA 1N33F 1UFLA 3EGNA 4EO6A 2ZH3A 2CJ9A 3ENQA 3BQ0A 2DXDA 5ETTA 2J8SA 4J90A 2PI5A 1T03A 3TZWA 1IBKJ 1TL4A 1UVNA 3DN9A 3M8QB 4C97A 1L5UA 2XSJB 3CO9A 2J6SA 4K4UA 1VI7A 2W2OP 3NCQA 3Q86A 2DB1A 1ELOA 4HH0A 4DX8H 3MEDA 1TUWA 3MEKA 2H4YB 4DUYJ 1G4CA 3NY0A 2WB4A 2DNHA 1BUXA 5AXKA 4ERDA 2OMLA 2VFVA 4JI0F 4DL7A 2ZOMA 1A7GE 2GAGC 5HATA 1BQNA 2QL5B 4JI4J 2BYCA 3O3LA 5ETMA 5DQIA 4F4XA 2O3DA 2F4VJ 5DG9A 2BE2B 4ZVEA 3HT3A 4LVNP 1ZM4A 5BR8F 2X3GA 3RRHA 3T1HF 3SEOA 3UDEA 2AJ2A 2WZ1A 4CO3A 5KFRA 2CVEA 5DQGA 1LV5A 1WSRA 2HK3A 2P6SA 4DV6J 3HSZA 2KZMA 1X0FA 4ITSA 2RU3A 4CNZA 3BKTA 2AF6A 2AJ0A 4KHRA 4C8KA 2AD9A 1EKRA 3DFEA 2MB0B 2WVDA 4DR5F 2BJ8A 2VV5A 4DHVA 3R7SB 2D69A 3SQOP 3EPGA 5A0YB 3C6TB 2L48A 2OJ3A 3PDNA 5JMNA 3HSDA 2R7TA 1MMDA 2VKRA 2W9AA 4RBVA 2GNKA 3LGMA 4O23A 2APOA 1NDPA 2HW3A 2YKMA 2XMWA 2VH7A 2ZDOA 3R27A 3IR7B 2NPFA 3HVAA 3FQKA 4V19J 2FVPA 1KTQA 5E41A 3M2RA 1VCTA 1E6VB 3EZ5A 1JLFB 4I2PB 3OR2B 4URQU 4ELUA 1PYOB 1VQ4S 4DUTA 2XLJA 3HPOA 2XS5A 3JSMA 1LXNA 3KXDA 1IKXA 3H42A 4KQZA 4F7VA 1TVRA 5KFPA 2LXUA 3MAAA 3GJSB 4RUCA 2HSEB 3A8JA 2EVZA 2HEKA 3KLIA 1S1XB 5E7OB 3CCMS 4ELVA 2B8QA 4X66F 5LOQA 3GYXB 1NKCA 1OPZA 4EYIB 2V9KA 4LF6F 4ILMA 2NXNA 5KFXA 1SQEA 2A3JA 5F3ZA 2OPPB 4M8LA 5HBMA 2XHCA 2DY1A 3QIPB 3D2WA 1PIEA 2JEGA 3TAPA 4UF4A 3FZBA 2DNZA 1Z1ZA 4Q0BB 2EK6A 1GK8A 1NAQA 4NYOA 2V9WA 4YB1P 2HG4A 1O51A 5H1SV 1TU0B 4RUHA 2CNLB 3CCES 4PUOA 3BQ2A 4PG7A 1M1HA 2ZE2A 3MM8B 4B9UA 2ZOGA 3CJKB 1UKUA 3HFVA 5HVHA 2NUHA 1SL0A 1LWCA 5CA5A 3UN3A 2GO8A 2Y8WA 3J7YU 2ZHOA 3R97A 1D9DA 3FSYA 1JMTA 3OT9A 5G0RB 4FS2A 3L3CA 3PY8A 5B7WA 4B3TF 4QQBA 5DQHA 1KSPA 3CCTA 4FF4A 3W5ZA 2J8AA 4J9SA 4C8ZA 2DRDA 4F0KA 3MF5A 4ZJQA 4WFBQ 2ZZNA 3RB0A 3UD3P 1TL1A 3K58A 1B99A 1NCLA 2QMWA 4X4NA 5E3CA 2GQQA 1IBKF 4B9LA 3GFXA 1N48A 3SCKE 3ZTSA 2W9BB 2KYZA 1DY3A 3BYRA 1WKKA 2AP6A 5CXTA 1FXRA 1VDHA 1UWBA 3AQPA 2FJDB 1NEEA 2W4DA 4C8NA 4DPWA 4DI6A 4BS2A 1YX2A 4S0MA 3DRRA 5I3UA 3HI9A 4DUYF 1S77D 2CYYA 3LO3A 3GFYA 3KK2A 2Z2LA 4HT5A 1NK8A 5IV4A 1U0SA 1HNIA 2E9ZA 4JI4F 2YX4A 1MMLA 3M9OB 5C24B 2W4PA 2F4VF 2WOMA 4HVZA 4J9NA 3I87A 2FVCA 2YWWA 4PWDA 3IRXA 1PG5B 2E7XA 4PZVA 4ECTA 3UE2A 3TRGA 4NL5A 2M52A 1HHQA 3TEHB 4USWA 2RDIA 2YNIA 2IC3B 2E9TA 2I1RA 2CKWA 5J2NA 2CZ9A 1URNA 1CULB 2MQNA 3A1YG 1JXLA 1NH7A 1RTDA 3D4JA 4ZCMA 2R2RA 4HLBA 3Q8UA 3CDBA 3RYLA 5ETNA 2RVJA 3G8QA 3CNQP 1HLWA 2MGZB 1U48A 1XN9A 1RTJB 1V3ZA 1IJEB 1N4LA 2VOOA 2BE7D 1HNWJ 4WYWA 3HVTB 2L3MA 4WWSA 2VQEJ 4C0BA 2G13A 3ZO7A 3SXLA 2NYHA 3MFIA 5E2QA 3R1LA 3MCMA 3Q8RB 2LCWA 4W4MA 4DX7A 3CC4S 5HLFA 5AE2A 1R89A 4ANEA 2F9JA 2PT0A 1GXUA 1WEZA 4C2MA 3A3OB 1N54B 3CIZA 4PQUA 2AEFA 1TAUA 2IJRA 2J0SD 3DLGB 4CO4A 4B3RF 3DRSB 3PYEA 3DMJA 5GMDA 3MI7X 2F8HA 4NXNJ 5KT4A 3BGFA 4YDXA 1TKDA 4LRCA 2K1RB 4MAKA 3TZZA 3W64A 1HPZB 1S97A 5KFVA 2ASDA 2K7KA 4HYKA 4C8OA 3S6EA 2R2SA 3CTRA 7FDRA 1X9WA 3I9ZA 2X1GA 2DR7A 1LQ9A 4FBTA 3OHBA 1VK3A 1R8AA 1HWUA 3FSIA 4WBFA 1MWQA 2M9KA 2FLNA 1RJJA 4JYAJ 5KFCA 1OQ6A 2JVRA 5HP1A 2DRAA 1RADB 4C11A 4Y0FA 1O6XA 4N77A 2ACMA 2JLFA 4USKA 4DLEA 4P2FA 2YH1A 4G1QB 4TNOA 2RKIB 3HHEA 4FDFA 4YB5A 1UCNA 3GP9A 2Q3PA 1J27A 2X1FA 3MECB 2DO4A 2I5JA 3HD2A 3KLFA 4F2SA 4HACB 5IT0A 3P45B 1CSJA 2WONA 3RB4A 5EWEA 2G2ZA 1WC5A 4DZDA 4FF1A 3LOUA 1FXLA 2YKOA 3SCJE 3PIPQ 1CJKA 2MZJA 3WX4A 1CJVB 1RBOB 2YKNB 4URGA 2DXFA 1QUVA 3K5OA 1U6FA 2OD4A 1Q8LA 4HT7A 4UOCA 3VAIA 3C14B 3CDAA 1HWIA 3D6MB 5HROB 4WKRA 1NDCA 1RA6A 4IQXA 4Y2IA 2M4MA 1SKUB 3SFGA 2CJBA 4LR7A 4DJBA 4OV1A 1Y11A 1HBMA 5KFAA 2P6TA 4IO9Q 4UY8T 4LSNA 4DL3A 4NOHA 3RG6A 1K8AT 1CG2A 3CWJA 2MXYA 2W9CA 1YRUA 4Y00A 2ROEA 1T95A 2UXBJ 4KFBA 1AT1B 5LM7E 3DLJA 2QLJB 1SC3B 5D8HB 2G0CA 1B0VA 3IN5A 5FLXY 3OLBA 4BLGA 2RQCA 2JSXA 2V63A 4LT6A 4WPAA 4KHPJ 1RAEB 4CLUA 2N4DA 4IR9A 3LUYA 3QJJA 3LP0A 5HL7Q 1ITPA 2F65A 1Q5YA 1UVMA 4M5KA 3IGVA 4HTIA 2WB1D 4K7QA 3CMAS 3Q24A 2GMJA 4PYAA 4JI6F 1AW0A 2RF2A 3EGWB 2DNOA 4KH0B 4QU6A 4M5MA 4LIRA 3MCNA 4RU2A 1O0PA 1SI9A 1HNWF 4OZ2A 3HHLC 1RT4A 3FJ2A 3TVZA 2VQEF 4JI3J 2AZ3A 4WF9Q 2KT5A 2G2OA 2ZBIA 4X4SA 2DD8S 4UY85 1HYSA 4XK8C 3DGPB 2WW8A 4P6QA 4K50A 1Q7LB 2FGCA 9ATCB 2HGLA 1NZ8A 2XGQA 1QJHA 3NL0A 2LEBA 2CWXA 4NXNF 4CH1A 1SJ3P 5DRKA 3T1YJ 2RS8A 2X51A 2QLBB 3A13A 1VS3A 1CPZA 4MK8A 3H5SA 3H7HB 1T94A 2C3MA 3D68A 1C4CA 1WDTA 1ULRA 2ZUGA 3NKYA 4WZQA 1R0CB 3IM8A 4KO0B 3PYGA 2W2QP 3TX8A 3FCHA 4AYBD 2OFGX 3MM7A 1WKJA 2HFOA 1YWXA 4KB7A 2D7SA 3MEGB 2DNPA 2N7YA 4HHHA 2ZHAA 4JYAF 5HMYA 1EKSA 4YDDB 4L75A 1ICEB 5KFKA 2OP5A 4OIXA 4OV6A 2QE5A 1SJ4P 4OZ3A 3QO9B 3MMBA 3WBZA 1TL3B 1FF2A 3ET6B 3QWPA 2R8HA 3A4TA 2GS8A 5FLXU 4K4TA 2RRBA 4JV2A 2MQMA 2AKWB 3LP1A 3BF4A 1LW0A 3QGGA 3NS7B 2VG7B 3DLKA 1U49A 1HBNB 3D67A 4B3SJ 1U0HA 1PJ6A 1XR6A 5KT6A 1ZAXA 2MZ1A 4KC5A 4TYBA 1X4DA 3ITHA 2BDPA 4NRTA 3BYPA 1G7CB 4DV7J 5IT9Y 4QWCA 3IAS9 3LWLA 5D4OA 1N0VC 3HP6A 3KHGA 4LRBA 2KYXA 3KJVA 3DRPA 2YH0A 1A6LA 2NXCA 4WP9A 1ZPVA 4OFZA 3Q0AA 1AZSA 1FE0A 2FHMA 2B4VA 4E8UA 1I3OB 3LGNA 3SQGA 2KFYA 3GMGA 3MEEA 3CT9A 2FTRA 3OL6A 4DCOB 3LGHA 1X8DA 3IP0A 1EZZB 2ILYA 3FK4A 3KUGA 3KLGB 3BSOA 2DITA 4IH6A 2HRYA 4QOTA 5A8WB 1P8GA 4YUDA 2E44A 4LF4J 1RWUA 3GJTB 4H4MB 3W61A 3EVMA 2HLTA 2NR0A 4O4GA 1TR0A 5L38A 4ETXA 1GH8A 5GMKa 1RHMB 1DTQA 3JXOA 2UXBF 2LA6A 1UFKA 3KJQB 4KGMA 2UUTA 2QA1A 1K9MT 3EXYA 3AFGA 3OVSA 4KBIA 1Y5LB 1ZH5A 4KHPF 4FVCA 2RRNA 1BE4A 4DR3J 2C22A 3BM7A 2FC9A 4IOCQ 3CCQS 3BGRB 2QYCA 3CUNA 1TFWA 3D66A 2UVRA 2Y9HA 2WSCC 3BKFA 2CPZA 3VR1A 1KLNA 3CDEA 5F3TA 2DBBA 3CULA 3PFEA 2WVBA 1ZM2A 3W2VB 5D6GA 1HQEB 3PO5A 1OQ3A 5A8RB 1P6TA 4PPDA 2LKZA 4HDHA 5EUHA 2EFGA 2B4PA 8AT1B 3BQ1A 2VA2A 1DLOA 2FUG9 3QT7A 5IT9U 1BWVA 1VQPS 2W2MP 2FJWA 4BHQA 4ZVUB 2DYAA 5E5NA 4FP9A 1Y00A 1Q5VA 2MDAA 4OHZA 1VQKS 1OYDA 2H51B 2CJYB 3PM9A 1BY9A 3T1YF 2HHWA 3OLAA 2G2YA 1RT2B 3HCXA 1NZAA 3UCUP 4OMFG 2BJDA 2XSJA 3IXQA 2Y1RI 5DZ7A 5KTQA 1HFEL 2QGFB 2V8DA 2V67A 1S7IA 2DIVA 2YX7A 1M5VC 1VQ7S 2KU7A 3HD1A 2LQ8A 3RBZA 3QIDA 2F63A 4MIWA 3EGVA 2VQFJ 2W8KA 3MM9A 3I56S 5IS2A 1N5VA 2L9DA 3NBPA 2WRMA 5F9NA 4RPFA 2H4WB 2J7UA 4ZVOB 2OIHA 4I56A 2E5HA 3K89A 2HKEA 2WW4A 3SBMA 3KK3B 3BN4A 2BE2A 2CA9A 3CD6S 4OI3A 3MXHP 2BVZA 2PMZD 3THTA 3L95X 3IO1A 3SI8A 4WCEQ 3OSPA 4U67Q 2HBRB 2YWFA 2OFHX 4RR5A 4I7FA 2EG2A 1Z2ZA 2AYBA 2IVFB 1N5TA 2GVDA 4K4YA 1ACMB 4B9VA 3CGIA 2PFFB 1TK0A 1KTVA 1WSVA 1IBCB 2IM1A 1U1MA 4EEYA 3GE9A 4B3SF 4NLWA 4ECWA 4X4OA 2UUCF 2J76E 2NXJA 2QSWA 2PMHA 2QLWA 4ZKAA 2AV5A 4C3MA 1UJ4A 5LJ3Y 1RWXB 4DV7F 1JLCB 3C6TA 3HDSA 3R5JB 1FTRA 3E01A 1K1QA 4NA3A 3VQTA 1YZ6A 4X4TA 4RX6A 4B9TA 2R7UA 1LW2B 3MZIA 1PGZA 4F04B 2LFVA 3N28A 2XMAA 2FYXA 1OSDA 1S7HA 1L3VA 4WXWA 3UDLA 1NU4A 2KFNA 1Y3JA 3D1HA 1X4HA 3RR7A 4K4XA 4V19X 3M32B 4TYAA 4F3OA 4BWJA 2MHEA 3WIVA 1QAJA 1RP5A 2ADBA 3BKUA 1E6VA 3RRKA 2BACA 1X9MA 3W2WB 4LMZA 2AGOA 2GIFA 3R7BB 4LF4F 1S6QB 2EFOA 4WU2A 3N79A 4IOBA 2NQPA 2IYIA 3I4PA 2JFKA 3BH7B 2ZOFA 2R7XA 3IR6B 1DQAA 1FXDA 1YIJS 2GA7A 1WF0A 2MYFA 4USTA 3M9NB 1LFWA 2IDEA 4RW4B 4ECVA 3KDOA 5C7PA 4CLLA 4O3PA 5DG8A 3EICA 1TKTB 3AA8A 1KS2A 1UAWA 2ILZA 2QRRA 4DR3F 3O5TB 4Q7AA 3QIPA 3NGRA 5HO4A 3R6LB 4Q0BA 3HZEA 4LJMA 2V2KA 3MAHA 2D3ZA 2M8DB 3K57A 3UWTA 3PZPA 4DSJA 2DNLA 3MM8A 2QO3A 5KG1A 2XCAA 4J5OA 2DNMA 3TARA 3M05A 1KNZA 2PMWA 1HNVA 1F1BB 1A0OB 1O5JA 3W3SA 3AJDA 2HHQA 3QT8A 2HQIA 4X84A 1JXVA 4MK7A 3PKYA 2AEJA 3OQ2A 4Y3CA 3OFEA 1T9WA 3NOCA 5G0RA 2MHNA 3LP2A 1WI6A 2CPYA 1FKPB 3DOMB 4FPIA 4F8RA 1FRKA 5HMXA 4QWEA 5D15A 4RW7B 1KRPA 4KJIA 4EGLA 1VC0A 2FQQB 3H59A 3OW2R 3C19A 3QT5A 3JAMU 2ZNZA 1RQ0A 4UOHA 3OFGA 5BJRA 2YWGA 4DFJA 4ZITA 2R7VA 4NI2B 4AT1B 3G9CA 1RKIA 1TL5A 2NSBA 2U2FA 3M8PA 5GADI 5T41A 4ZLPA 5F8GA 2W9BA 2VKZG 4NZ0A 2ZVSA 3E8OA 3DYAB 4DV1J 4KTQA 5BYSA 3H2UB 1REGX 1PILA 5F8JA 2VQFF 3A12A 5AE1A 1F5CA 2UUBJ 3TJ9A 1KVKA 2ZVIA 3JSYA 5THWA 3I31A 5L9XA 1LXJA 3SDEA 2ZD1B 2MQQA 2C2ZB 2E1MC 5CYJA 3LPYA 3CD7A 2CWKA 3L9ZA 3CJ8A 5KFZA 4OZJA 1HNZJ 1S4EA 4ECSA 2MZQA 3TUZC 2HNDA 2E9RX 3ZC4A 1AFIA 1ZPWX 1EETB 1RWOB 1F3FA 2XQCA 2CQIA 1VFJA 1CBKA 3VAHA 2F1FA 2IC3A 1FT8A 5AXLA 2D74B 2BKNA 3VZHA 1CULA 2IHR1 1OIAA 4ELTA 4ZOSA 1TL7B 3CCZA 4FYYB 4RUBA 2XCPA 4NCAA 1KBRA 3BO4A 3GB0A 4V1Ak 1RT6B 2RUSA 2MGZA 5EWGA 3V6KA 4DV4J 2ZBCA 4A46A 3M6XA 1MROB 3RAXA 2DCLA 4P73A 2D41A 5HANA 1N34J 2XYHB 3Q22A 4L72B 3OFHA 4ZHRB 2BOPA 2VBYA 4YN3B 1Y5IB 5FD1A 5CD4H 1SQFA 2YNHA 3TA2A 1S1VA 1WG5A 1YKWA 3K8VA 4MFBB 5KOWA 2RNEA 2RSQA 1Q4RA 2YNFB 3BB5A 4G3IA 1IKWA 3AJ2A 3WQPA 1S48A 3JB9k 1SL2A 4M5LA 3QGIA 1XQIA 4QJVA 2HS3A 1T02A 3CEDA 4OYZA 3DLGA 5J1NA 2NS1B 2HPUA 3AXMA 4IRDA 4LFBJ 2K1RA 1FESA 4QYZJ 1U2RA 1HBOB 3LA0A 3CC2S 4Z7YA 1RT1B 1DZ5A 2DR8A 2G4BA 1RI7A 3MCSA 3LAMA 1TKZB 2OPQB 5GAHI 2IMOA 2DHSA 3F56A 1CJUB 3RTVA 3JQMA 5KT7A 2CQDA 4LSZB 2H48B 4U9RA 3QT6A 4RW8A 1VQ6S 1KQGB 2FHJA 4HHUA 1FO1A 1RAHB 4BC7A 2GIQA 4DR1J 3E2EA 1X4BA 3ISZA 3QWUA 4FYWB 2BANA 2DHAA 3UDCA 4ZVGA 2ZC3A 1YJNS 3EWGA 3ADAC 2AJ1A 4DEZA 2DR9A 1WC0A 1FKOB 1WUUA 2DNKA 4L73A 2N7CA 1IKYB 4P9SA 2RKIA 3KUEA 1KONA 4ZCIA 2C2OB 2DH9A 2U1AA 4CYUB 4DR7J 2KT2A 2G1HA 3T9ZA 4OHWA 3U1LA 4ALZA 2WK4A 2YKQA 1LOUA 1SJ1A 3JSRA 4EBDA 1OY9A 3HKWA 4RNMA 3UR3C 2AJ4A 2NSCA 3M2VB 4ZVQB 2BKPA 4DDFA 3I9V9 2A1BA 3AAWB 2HVEA 1CJVA 2LQJA 2YKNA 4FVMA 1U1KA 2ROPA 4DS4A 3DXSX 1U45A 5KFOA 4N5SA 2V8GA 2QA4S 1SQGA 2Q79A 3M1VB 1RACB 2HFSA 3BBFA 3C14A 1H3DA 4DV1F 5HROA 4OX6A 2CAJA 5ETRA 5CYQB 1F6TA 5GAGI 2WVCA 1RAOA 2FGOA 1VGYA 4OJ3A 4ED5A 4A8YA 1U25A 2OGUA 5IWAJ 4NMXA 2L08A 2OPSB 4B3OA 5L46A 2HHXA 5DLGA 1HNZF 1EP4B 1YJ9S 3VAFA 2G9OA 1NBEB 4J9LA 2YPYA 3ENAA 3BZQA 3MFHA 3UCGA 3HHKA 1AFJA 2W1BA 3PHTA 2V4RA 1H0HB 2JX2A 1QAIA 3OBIA 2C3OA 2DHHA 2VODA 2AYMA 2R2TA 4J9OA 2HIYA 2MLYA 3NGKA 5EX3A 1E6YB 2ASYA 5CABA 1FX4A 2W7PA 3QQCD 1VQMS 3AHPA 2HBYB 2ROGA 2HQDA 1WHYA 4H4OA 1BHNA 3RJMB 2M8HA 1CS4B 2CZVC 4DG1A 2EW9A 4DV4F 2E5LJ 1VQLS 1KC8T 2DGVA 1YITS 2B7BB 5KFLA 1N34F 1B4SA 1QAYA 3B78A 1S1TB 1TKXA 3TO8A 1D9AA 4TKTA 3TWZA 1F9FA 1UP1A 1HNXJ 1CJTA 2CADA 1AA1B 1VBYA 1XJWB 5J2PB 1HKAA 2HHHJ 2G1DA 4U7UK 1ZZFA 4FNHA 2VG5A 4PG8A 4CCHA 4MIBA 1PYSB 2BA9A 3P49B 5KFYA 1KQKA 1K44A 1UA1A 2WCXA 5K5MA 3D0HE 2HNZB 4H4KA 1YJRA 4NZ7A 4ENOA 2F9DA 4X4VA 2DGWA 2MSTA 2HNYB 3V4IB 4NXMJ 4ES1A 1RKJA 4WIIA 1NK7A 4K4WA 1UPMB 3GWCA 2B9WA 2JC1A 4M5DB 5LXRA 3D1QA 4LBPA 1VQ5S 5DGBA 5K8NA 4QR0A 2QL7B 2I0XA 4DR1F 3VGSA 2HVHA 1UJ5A 2QMUB 3VAJA 5H9FJ 1DRZA 4N47A 2JEIA 1WC1A 1GQEA 1NSAA 4CLWA 2Z30B 3MWBA 2HBQB 2X7IA 3K2YA 1S0MA 5KFSA 3ZZYA 1TL3A 2W25A 3IWXA 2V2QA 4DR4J 3DXBA 1PAEX 4B17A 1WJ9A 5KFJA 3SSQA 4N7TA 1H2VZ 4DR7F 2KXFA 2C2RA 1VHFA 1R8PA 1HBNA 4D3HA 2VUGA 1TV6B 3R5DA 3BDEA 4OI6A 4CM2A 1H73A 5CCLA 1NB7A 3NEKA 5KFTA 2POKA 3FEXB 1AUDA 1KHVA 1HI8A 2CJAA 1BWEA 1IR0A 4NX9A 2E66A 4ICLA 2VHGA 1G1XA 3QPIA 3PW4A 3EDRB 2J9DA 1NUEA 1ZZNA 1VC5A 4P75A 3RAMA 3OTCA 2UVVA 3PR5B 3KOAA 1JLBA 2RE1A 2G0JA 4HH1A 2CPEA 4ILRA 4LF1A 3HK2A 1SH3A 2DTJA 4LFAJ 6FD1A 4ZP9A 2QSFA 2GAHC 5F8NA 4HI1A 3QSIA 3KLGA 3G96A 2IJNA 4YOEA 1T0TV 2DGXA 5A8WA 3SIPB 4G1PA 3BSAA 4MKAA 4BC9A 3FFIB 4H4MA 3DOKA 1FRXA 4K0KJ 1B3TA 3MD1A 3OXFA 4PXBA 1UJ6A 3M8YA 5ETQA 2IMWP 2DY9A 4DL4A 3D6TB 1IKVB 2H1YA 2ZBPA 4F3QA 2UU9J 1Z2LA 2WHOA 3ISNC 4NLPA 4YEAA 1ZETA 4KSEB 4EBEA 4PKDB 1Y7PA 3VF0B 3W9JA 3ELHA 3HX9A 4CLYA 2KN4A 5F0WA 3O1LA 3PEHA 2IY5B 4WYLA 4P7TA 1R7IA 3RB6A 2EPIA 2E5LF 3S8SA 3NAHA 4DMZA 5ETLA 1T05B 4U96A 3HLUA 2AZ1A 4EWTA 3R9LA 5KFEA 2PA8D 1RTHB 1DHMA 3OPKA 1NRKA 4GKKJ 2WBRA 4W92B 2MLZA 4IFYB 2UXCJ 1HNXF 3ZTRA 1HIYA 2XMTA 5LT5A 4DQQA 3CDWA 4LF7J 1SB6A 5M2UA 1BMQB 3AODA 1PSDA 2HHHF 4DBQA 3TI0A 4WU3A 3HF5A 1UEVA 2YNGA 4CQ1A 1FDAA 3D0GE 1FDDA 1S9EA 4DCJB 4UUXA 1WD6A 4PABA 5D0HA 1NJYA 1U26A 4K59A 1RDRA 1NPPA 1IM6A 3MM5A 4PG4A 3R5BA 3SZ2A 1WOPA 4X2BA 3AD7C 2M5YA 4OYOA 1S72S 1F5BA 4NLXA 4J9MA 4ZVFA 4NXMF 1NPRA 3HKZD 5EN1A 5D0EA 2B6AA 5M2PA 4UZBA 2VPWB 3DDIA 5J1EB 1YBTA 1B0TA 3OUYA 4K4SA 5K9FA 1GT8A 4RWXA 2ZJRQ 4YS2A 3SSRA 1OPIA 1RT7B 5IC6B 3THVA 2J7WA 3C15A 1JX4A 2CPDA 4IG0B 3H5XA 3IWNC 2Z56B 2XWXA 1C1CA 2FVQA 3CJ2A 4IYQA 1CC7A 5K14A 4WTOB 1APSA 2V94A 4DR4F 1QTMA 4F36A 2HAFA 1Q86T 3TYTA 1J5OB 2IM2A 4I1TA 3BN7A 3KLHA 4DUZJ 1U6ZA 5GADU 1UVIA 4XTTA 1FRHA 1Z4UA 2VPZB 3NCRA 5LSRA 2J9DE 1I5OB 1R0AA 1SJFA 1X4FA 2CPJA 1N5YA 1KOOA 3G82B 1UZDA 3AB2B 2XZWA 1C4AA 4C4WA 1N52B 3PACA 3VCDA 4DFPA 4QWAA 2ZH2A 3D54A 4U7UD 5I4MA 1U2CA 1SUQB 3EM1A 2QFIA 4Q43A 1BLUA 2KO1A 1NJWA 4OJGA 1UFWA 3AY0A 1URRA 1KR4A 3CJ5A 4JI7J 5A6PA 4QU7A 2C28A 4WP8A 3WIUA 3MPWA 2A6MA 2LU2A 1V3RA 2P2CB 2R7SA 2BE9B 3LALA 1HQUA 4UUWA 3PTWA 4X64J 1VK8A 2CQ1A 1HMVB 3B4MA 2QEXS 4LFAF 4QIVA 3M32A 3KMQA 2I38A 3I0SB 4KHMA 4ZJOA 4OI2A 5B08A 1W25A 1RCOB 2VFTA 4DL5A 1Q16B 3RR8A 2VC1A 3CMQA 2EFQA 4FYVB 1GX5A 4ZLLA 4K0KF 1VLYA 2IAJB 3CSKA 2GVZA 5IQQA 3T6BA 4GO7X 1RT3A 1S1UA 4B08A 1RT5B 1RTZA 1BQMB 5J1PA 1YJ7A 2YTCA 3KLEA 2C2MB 2R7WA 3CCUS 2UU9F 1RWVB 2P8IA 4R5PA 2VOPA 4HKQA 2HHVA 3FRYA 1EJ7L 4M94A 1TKTA 4EI2A 3I32A 1S57A 2N3OA 2EFVA 1IXKA 1EX8A 4DPTA 3R5CA 3TAMA 1RTIA 2ZFHA 1T7PA 3PRVA 3HHLD 5SZTA 5M2RA 4PRFA 3MGJA 4DSKA 1T03B 2CG8A 2FB0A 1IWGA 2VPYB 2ZC4A 2HIQA 5AE3A 1WORA 4GKKF 2DCUB 2MY8A 3CMES 2UXCF 4RO0A 2CQBA 3DCAA 1NJXA 3R1HA 4LF7F 3MEDB 2ZH4A 4UW2A 3TZYA 1LWFA 2K8GA 3CF5Q 1NKBA 1XWLA 3QZ7A 2DGUA 1BQXA 3W5YA 5GAHU 3DOMA 1X4CA 3PJWA 1HWJA 2AJFE 3PRBA 1BQNB 2IYGA 3MDFA 3G4SS 1D09B 4OZ1A 1D0EA 3GQCA 3BSCA 5AJ3J 1FEHA 3ZZPA 2EI5A 3MR7A 3R8YA 3MTKA 1S9GA 1VRUA 3EMTA 2XS2A 1FNMA 1N32J 3JTOA 2NREA 4RNHA 4RBTA 1W2IA 4OL8A 2K3KA 2HZCA 4JI2J 2A10A 3X1LB 1KN6A 4P2SA 4Q5VA 3NNCA 4K2XA 6FDRA 3GONA 1TQLA 3N4WA 1IBLF 2Y1JA 4AL5A 2ALYB 3PEJA 2V5HG 2CJKA 4F50A 2BJEA 1NDLA 1WHWA 3FSXA 1VHIA 1QE1B 2ABYA 4IQMA 2YKMB 3ZTPA 1PC5A 1EQMA 2NCKL 3CJ0A 4Y28C 1JWWA 3H5YA 1ZS6A 3RBEA 4CO0A 1GMWD 5CQGA 4ZP7A 4C6AA 4C9DA 2MQ8A 1I94F 5L9NA 2CNOB 2COLA 4DSLA 5DDPC 3IC1A 3JSMB 2HHPA 3HM9A 1IKXB 5GAGU 4RW9A 1TVRB 4J91A 4PCQA 5MAOA 3MAAB 3JTNA 4Q8FA 4F02A 4JI7F 1Q53A 3KLIB 4DXLA 1T8EA 3V6HA 3W7BA 5B0CA 4X64F 1NPKA 4ZPTR 2KRBA 1SKRA 5HBMB 1XR5A 3HZGA 2BRLA 1JQGA 2CXEA 1JLQB 3GZ7A 2JC0A 3DLHA 2UUAJ 5B0GA 2MJNA 2YNFA 3H40A 3PYDA 5CYMA 2Y3YA 4ZMMA 1HD1A 2RHQB 1CEZA 4ZVHA 4Y2MA 4PUOB 5DM6Q 3IFEA 4Y65A 3GG1A 1OY8A 3V6JA 1YG0A 2FVSA 2IRXA 4LRDA 3A8IA 5LMNJ 3H5UA 1KLMA 5I3PA 3PJ9A 2OAUA 2HQFA 1V9OA 1RT1A 3QRRA 4DR2J 2OPQA 1F2GA 2CVIA 3P4UB 1CQMA 3V6DA 3J80Y 4MIAA 5T7LA 3KTQA 4ZCKA 3W60A 3K7RA 4AQYJ 3I96A 4UOGA 4TN2A 1DTTA 2V4QA 2VZ9A 2PC6A 4QIEA 3MMCA 1RGVA 4A8SA 4I6AA 3DOLA 4ZP8A 4Q44A 1PCAA 3GV7B 2HFZA 3HSJA 2CNNB 1UWBB 4DPOA 2YWHA 3E3XA 2OPRA 3ONQA 3DRRB 2FLOA 5I3UB 4WFAQ 4NLQA 4CYUA 2AW0A 1HQ2A 3T41A 1SVDA 1VQYA 2UV8A 4DV3J 3SV4A 4KY3A 2E29A 4RL1A 1TUGB 2QLFB 1OJ4A 5KFWA 3CDUA 1C1BA 3ZTQA 3Q89A 5CD4A 3U27A 3IRXB 3ULHA 3IAM9 1UMJA 2B3TB 5AJ3F 5F8MA 4I2QA 1L3SA 4CIOA 1JJ2R 2OMOA 1H2UX 2DKOB 2FLPA 4DR6J 2W4CA 2YNIB 1MSWD 3DDNA 3OV7A 4XPEA 4R0JA 1IWAA 4FKYA 5J2NB 5EDWA 4JI2F 3UFCX 2JHEA 4IDKA 4WP3A 1S59A 3R6GB 2C2KB 4Z2XA 2XG8A 5JUMA 1SIWB 1MWZA 2R8JA 4QPTA 1RAGB 2DT9A 3D3BJ 2QA4G 4OI1A 3MPYA 2XO7A 1NK9A 4LF5J 1WF1A 1RWMB 2HMIA 1YTYA 2CQHA 3C8YA 1SCJB 4USUA 1HWKA 4A8FA 2CJXB 4ZIVA 4USMA 2P9EA 2GX8A 5DDQC 3IG1B 3J80U 3JQJA 3KK1A 1FE4A 5ETVA 5DETA 1T9VA 3CJ3A 2XMMA 3DNCA 2H5EA 4JBCA 1WG4A 1M5HA 1FD2A 1W7WA 2AIRB 3VQSA 2FJVA 4KGVB 4PQUB 4YR0A 3UVJA 2DNYA 3QJPA 4KV8A 4DV6F 3DMJB 4OYIA 4N8NA 1NSQA 1SC4B 4DQIA 2IRYA 3MOJB 1MLAA 4LUBA 4USHA 3ENWA 1JJCB 3N5FA 4PQAA 1SH0A 5L39A 2VDIA 1VQSA 2MJUA 1HW8A 4GC6A 3GIJA 4Z37A 5J2PA 4KKOB 2UUAF 1SV5A 4A8KA 2UVWA 1X31C 1LNQA 1KVIA 4KAIA 2Z4PA 1VQOS 2JFDA 3M30A 5I42A 4NCGA 1ZAWA 1UEUA 5HP1B 1UVLA 2ZH8A 3K5LA 1XNRJ 4DS5A 3PX6A 1SKSA 2HNZA 2CG4A 2BQRA 1IQZA 5LMNF 4Y2AA 2C2EA 2FZKB 3M6VA 1JLEB 4OHVA 2HNYA 3V4IA 2CQCA 1AUSL 1R8HA 2M0GB 4FNIA 4ZJLA 2I5JB 4ZA1A 1DAXA 4A8QA 1REVA 2D3O1 3EDQB 2A18A 3O8WA 3C16A 2D9OA 1M5PC 4DF4A 1RZMA 5L1JA 2KM8C 3BBCA 1KQSR 3PRDA 1CJKB 4ID5A 3U02A 5IZHA 2KXNB 1W2BR 4MKBA 2BMBA 4HR2A 4QPXA 2KFZA 1X5SA 5HVFA 5CZVA 4CLPA 1KDNA 3MM6A 2WVEA 1FEEA 3AB4B 3KNAA 4M5NA 2YKPA 3W5XA 2RB7A 2RILA 3OTEA 3GCWP 2A2CA 4C8LA 2OO4A 4DV3F 4B02A 1VQNS 2Y1LB 2V8HA 3L4BC 4F4AA 1HBMB 1K73T 4LSNB 4ER8A 3FBFA 2RUGA 2QTWA 5J2MA 3CB4A 1ZM9A 3IMQJ 3BJYA 3ILJA 2E1CA 2Y8YA 2YBVA 4AL6A 4R8UA 2YWEA 5DGAA 4CTAB 4KFBB 2KT3A 4DR6F 3HSGA 5GVQA 1FNXH 1UEKA 4MKYA 3T3FA 5JJBA 2B5JA 1MU2B 2XMUA 3KYLA 4L76A 2BRKA 3GJRB 2KH9A 1PBUA 2UXDJ 1X4EA 2IFXA 3UD4P 3M7VA 2CQ0A 2MY7A 3V81B 4FF3A 1S6OA 4KGKA 3TAQA 4LF5F 3FEZA 2RF2B 3W8PA 2KHCA 4ZPVR 4C3KA 1RB0A 1OSCA 4U7CA 5KFUA 5FJ4A 3MPDA 3OTOJ 4GKJJ 4BCAA 3GIIA 3UD5A 2VFUA 2IVYA 1YLXA 1V6HA 1RT4B 1QTNB 3D1OA 4EUVA 1U1RA 3OSNA 3UPFA 4NLTA 1XMOJ 4P74A 1YVFA 1KKHA 5HI7A 3M8SA 1RAAB 2GHWA 4N76A 5IT4A 4DN0A 2V4JA 5LMUJ 5A2QY 1GTEA 3BGOP 1WDDA 4M63A 3H2LA 4DFKA 3EZUA 1D1UA 1H98A 4O3SA 2VJVA 2MKSA 2R2UA 1WEXA 5LJ5Y 4LSLB 2FHJD 3CE8A 4I6WA 3UR0A 1P9YA 5ETSA 4IFVA 2CQPA 4J9RA 1YI2S 3MUMP 2EK1A 1DFDA 3OXLA 1U09A 1JK9B 2VBXA 3NNHA 2O5DA 5D0GA 3KHRA 4FYDA 2HVIA 5AXMA 2F5GA 1DJ0A 1RK8A 1Q8KA 2JRSA 5KFNA 3VGTA 1ZA1B 4NA2A 2UV8G 3WC2A 2GHVC 1HW9A 4OX7A 4ZVSB 4OYBA 4Z7CA 4GRSA 5DJBA 1XNRF 3MPVA 3MMBB 1K47A 1FFGB 3M4XA 1U1NA 2MEWA 2W24A 1SJRA 1TK8A 4CO1A 2HVZA 5HAOA 4P10A 2EC2A 1RA7A 5E0OA 2MSSA 1YJTA 1UTAA 1ZA2B 3BO2A 4WE1A 1LWEB 4F0HA 4F2RA 3EVOA 4NLUA 5HSPA 3QAEA 2IJFA 1U0HB 3IGNA 1RAJA 5DM7Q 4QW8A 4QWDA 4OHXA 1S12A 2OSQA 1H7XA 1TTHB 1DBDA 1J5EJ 2J6TA 3PW5A 4DX5A 1NK5A 2ZHBA 4U8YA 5IM0A 1GX6A 3GYNA 4Y2KA 2R7OA 3HHLA 4KYZA 3KJVB 2XNQA 3DRPB 2XY6A 3FC9A 2E7VA 4ED0A 1AZSB 1UL3A 2P5VA 2LMIA 2VL1A 1J5OA 2LXIA 3MEEB 3WDOA 2H65B 2PN6A 4O3NA 4X4UA 2I8EA 1R27B 2RRAA 1SC1B 3HT0A 2VG6A 1VISA 3GFHA 1NMEB 2XS7A 2VPXB 5A2QU 3KMSA 1GXLA 1C0UA 1T11A 4A8OA 1Q8IA 2RD5C 2QIFA 1XIQA 2E5JA 3H25A 4WFZA 5HQMA 4DX6A 1UW4A 5FDLA 1HL6A 3FZ2A 4F4ZA 1SUQA 4MJKA 5KFMA 4K5RA 4O4GB 4O3OA 1V5VA 1RBLA 1IQTA 2HZVA 5CHCB 1SC6A 1DTQB 4MYTA 4EZ6A 4GVLA 4ED4A 1M90T 5DO2A 4BDPA 2M70A 1EQ0A 4TLRA 3DDKA 2XC9A 3T5LA 1Q1KA 1NLKL 1S99A 2HGMA 4GC7A 3EE3A 3VAGA 1HMVA 1KWMA 2UXDF 2HFNA 1CC8A 2WSFC 1AROP 1FNOA 2MKCA 3F44A 3BGUA 1R8BA 2KHDA 4RW6A 2EEYA 4L6V3 2QN6B 5C2CA 1J2VA 3SSSA 3PKMA 3CCWA 3G8TA 2YQ3A 2DHXA 3OTOF 4L3KA 4GKJF 4OJ1A 2I6WA 3D0IE 2KKHA 4ZPBA 2ZITA 5HJYA 3GSDA 3GYGA 5E3RA 5EHHA 1XMOF 2Q1LA 4K4ZA 1HBUA 3K0JA 4PEOA 5F41A 4OJHA 2F7VA 2VB6A 1DLOB 2GMHA 1GMWA 1RCXB 2MKHA 1VR6A 5LMUF 3NG8A 4JOUA 4MTPA 7FD1A 2GC8A 1B7YB 2BKOA 1JLAA 1X4AA 1S6PA 4N8OA 3AD8C 1NNDA 3KFWX 3KNGA 2NUUG 4KT0C 4F0MA 1UVKA 2PEHA 4ZPWR 4LBIA 3H4BA 2DK2A 3RW7A 2GIRA 4LF9J 1H6KX 2RU9A 1GXTA 2JH3A 2Z2MA 1SJQA 9RUBA 4JP8A 3DHXA 3UO0A 3SV3A 2GGPA 4IUFA 2Z2YB 1JNZB 3MM9B 3I5AA 3NBPB 5D77A 2B8PA 2IDLA 2M2BA 3LANA 3P5BP 5EGYA 4P7VA 2IBKA 2N3LA 1RSCA 4RJVA 4JI3F 3TVKA 2KJWA 1ZBTA 2KXHA 3NGSA 3U7JA 2ZM6J 4YR2A 3EPIA 3UN5A 1HHTP 1JIHA 1S1WA 4I7FB 2UZAA 3PVXA 4ZIWA 1U24A 5J2QA 2GVDB 2GJFA 3OXGA 4C3LA 3F0NA 2Q66A 4DPUA 3SFUA 3RU0A 4DPYA 4F67A 2E7WA 2R8GA 1H7WA 1S49A 3WZ0A 2AJQA 3QYYA 4ILLA
chains in the Genus database with same CATH topology
4X65F 5T7LB 4D3GA 3VF0B 3BEGB 3N6NA 4YHHF 4FF1A 3LOUA 1FXLA 3HX9A 1J5EF 2YKOA 3SCJE 3J7A1 2KN4A 2PIIA 5F0WA 3CCJS 3UQSA 3PIPQ 1RT6A 3O1LA 3PEHA 4F25A 2DIUA 4WYLA 2J0XA 2CQ4A 4P7TA 2PDAA 4O44B 2MZJA 3WX4A 3H98A 3M8QA 3Q2TC 1R7IA 1FTCA 3MTJA 2EPIA 3RB6A 2E5LF 2FLLA 2GHPA 1MROA 3S8SA 2EC0A 2YKNB 3NAHA 4URGA 2ATLA 3E01B 5DLFA 4DMZA 1DTTB 1T05B 1XC9A 1K0VA 2KG1A 1CQNA 1D8ZA 1QUVA 3HLUA 3NGDA 1LK5A 4EWTA 4ZHRA 3MMCB 3K5OA 4DLGA 1FJCA 1U6FA 2ZH9A 2OD4A 4DV0F 5KFEA 2PA8D 1Q8LA 1RTHB 2VFSA 2L41A 1DHMA 3OPKA 4HT7A 3ZFVA 4UOCA 3DLLQ 2WSEC 3VAIA 1NRKA 1QE1A 2WBRA 4W92B 3DOLB 3VTIA 3CDAA 4IFYB 4TLQA 1HWIA 5HROB 5T14A 4WKRA 3H2VE 3TVYA 1NJZA 2YVSA 1RA6A 1HNXF 4IQXA 3HFKA 4KRWA 4ZDNA 4Y2IA 2XMTA 4MFBA 5LT5A 4DQQA 3CDWA 2L9NA 4NMLA 1SB6A 4IRCA 4NCBA 2LDIA 5MLCV 5M2UA 2J7KA 1SBRA 2M4MA 2R7RA 3R3TA 2OPRB 3SFGA 1PSDA 2GJ2A 2HHHF 4DBQA 2CJBA 3TI0A 4WU3A 4DJBA 1FDNA 4DOZA 3HF5A 2PO4A 1UEVA 5F8HA 1Y5NB 2YNGA 4OV1A 2HWIA 1QSLA 3HJFA 1HBMA 5KFAA 3KHHA 2P6TA 4CQ1A 1FDAA 4IO9Q 3D0GE 1YRTA 1FDDA 4PXCA 4UY8T 1F0XA 2DHGA 3AJ1A 4LSNA 4DL3A 3B82A 1S9EA 4NOHA 4UUXA 1WD6A 1K8AT 2ZE2B 1CG2A 1KFDA 1ZTTA 1Q81T 3CWJA 4A8MP 2W7AA 4WK1A 2MXYA 1NJYA 1U26A 4IO1A 4K59A 1RDRA 3CC7S 2HRUA 3OJSA 4DSEA 5D4LA 3MM5A 4PG4A 5L8RC 2ZKTA 2W9CA 1C1BB 2AYGA 3R5BA 1LWCB 3SZ2A 3MHYA 4X2BA 1YRUA 4Y00A 2M5YA 2ROEA 1S72S 1F5BA 2C42A 1HBOA 4NLXA 4J9MA 1T95A 4ZVFA 4NXMF 4KFBA 4K5SA 2Y1IA 1TKZA 1VIXA 4I2QB 3HKZD 4DL0C 3DLJA 3GR1A 4YQWA 2B6AA 5L1LA 1XK8A 5EN1A 2MMYA 5HQ8A 3MR6A 5D8HB 2YWKA 5M2PA 2G0CA 2VPWB 1L3TA 1B0VA 3IN5A 2BR0A 4OZNA 5J1EB 5FLXY 1ZYQA 3OLBA 1MNEA 2RQCA 3CCLS 3OTBA 1B0TA 3OUYA 2JSXA 5IQ6A 4K4SA 4LT6A 4RU9A 5K9FA 1GT8A 4RWXA 5A0YA 2ZNYA 1TL1B 2N4DA 2ZJRQ 4IR9A 3LUYA 4C8YA 4YY3F 1TP7A 3QJJA 5B0DA 4NLYA 3LP0A 5KG7A 5HL7Q 4IDKB 4TU7A 3SSRA 1JLQA 4YP3A 1VIOA 1OPIA 3G6YA 4NA1A 1QSYA 3JAMY 1YJVA 1RT7B 1UVMA 2NYIA 3THVA 2J7WA 3P96A 1JX4A 2XMVA 2CPDA 4IG0B 3MURP 1VOMA 3IGVA 4HTIA 2WB1D 3QLHB 4ZPAA 3CMAS 3Q24A 1WTBA 5C25B 2GMJA 3H5XA 3IWNC 3VZIA 2M7SA 2XWXA 4JI6F 1AW0A 2RF2A 3EGWB 2DNOA 4QW9A 1XTZA 4DF8A 4QU6A 1C1CA 2FVQA 3GR0A 4LQ9A 3CJ2A 4LIRA 5F9LA 3KWMA 1FKOA 2HMIB 4RU2A 1QY7A 1O0PA 1CC7A 1SI9A 2DH8A 4IYQA 5K14A 1N36F 1HNWF 1APSA 1IKYA 4HL9A 5DDRC 2V94A 4DR4F 1QTMA 3HHLC 3ISND 1RT4A 3BS9A 2IM3A 2E5IA 1Q86T 3FJ2A 2DNGA 3TVZA 3TYTA 2VQEF 5D4PA 1M5KC 1J5OB 4WF9Q 1RYRA 2IM2A 4I1TA 1SKWA 2KT5A 1HNVB 3BN7A 4QIWD 2ZBIA 4X4SA 3KLHA 2DD8S 4ED1A 4ZS6A 3ZZ0A 4XPCA 2GFFA 4X4PA 4UY85 1JLFA 1HYSA 4I2PA 3OR2A 1U6ZA 4XK8C 4CI0B 5GADU 3KK2B 4OLPA 3OR1B 1UVIA 3NRBA 2WW8A 3AQOA 1FJ7A 4P6QA 1HNIB 2EFNA 1FRHA 1Z4UA 3NNAA 4K50A 3KK1B 1Q7LB 1UETA 2VPZB 3TUJC 3FGVA 2FGCA 3NCRA 3LP2B 3DLEA 5LSRA 2J9DE 1SL1A 2WOMB 1R0AA 1SJFA 1X4FA 2HGLA 2CPJA 1N5YA 1KOOA 2XGQA 4PG5A 2BM1A 2KJVA 3AB2B 2XZWA 5KFFA 4U6PA 1C4AA 2K7JA 4C4WA 3M2VA 4PWDB 1N52B 1QJHA 5JXSA 2BBEA 4HDGA 1T3NA 3PACA 3VCDA 4DFPA 1U4BA 4QWAA 3NL0A 2LEBA 2R4FA 2ZH2A 3D54A 3QZ8A 1WACA 3SCLE 5I4MA 3ZZUA 1SUQB 4A4JA 3UNGC 4Q43A 5D3GB 1BLUA 2KO1A 5LL6d 1NJWA 4NXNF 2D3UA 1U1QA 2HAIA 3US5A 4CH1A 1SJ3P 4OJGA 2VC0A 4KV8B 1B0PA 1UFWA 3AY0A 3BDPA 5DRKA 1URRA 1S1XA 1KR4A 2RS8A 1JJHA 2XMKA 4EO8A 2ZH1A 2X51A 3CJ5A 3MMAB 3P3DA 1N32F 4DQRA 1VS3A 5A6PA 2KG0A 4QU7A 1CPZA 4MK8A 2C28A 3Q8SB 3JYTB 3M8PB 4LF9F 3H5SA 2KZZA 4H4KC 3MPWA 1T94A 4NLRA 2LU2A 4LF8F 2LECA 2C3MA 2JWNA 3QGHA 1C4CA 1V3RA 2OPPA 3M1VA 3I0RB 4OZ5A 2R7SA 4ID8A 3DC2A 1ULRA 1IJFB 3J81Y 2ZUGA 3NKYA 1FRLA 1HQUA 3LALA 4DQSA 4WZQA 4F4YA 4EYHB 4KO0B 4IG3B 4UUWA 5CYQA 5GAEI 1VK8A 2PD1A 3TX8A 1U2FA 4X62F 1RTDB 2CQ1A 1HMVB 3B4MA 3FCHA 2QEXS 3P6YC 4AYBD 3KKFA 3T5HA 2OFGX 3MM7A 4LFAF 2LU1A 2HFOA 4QIVA 3Q23A 4OHYA 1YWXA 3M32A 3KMQA 1H38A 4KB7A 5DS7A 2D7SA 4FXDA 2I38A 3RRGA 3I0SB 3MEGB 2DNPA 2N7YA 4KHMA 4OI2A 2V8VA 5B08A 2ZHAA 4JYAF 5HMYA 1W25A 4YDDB 4HEA9 1SV5B 2Y0SD 1IN0A 5C42B 2VFTA 1NO8A 4DL5A 5KFKA 2KB2A 3NMAA 2OP5A 2OPSA 1Q16B 4OIXA 3RR8A 3HO1A 1X5OA 2FVRA 2VC1A 2QE5A 1SJ4P 4FZVA 3TW0A 2EFQA 3SDEB 4WZMA 4ETZA 1GX5A 1EP4A 2MKJA 3CJKA 4F26A 3M30B 4RNNA 3DM2A 3QO9B 4ECZA 3MMBA 5I42B 4NCGB 4K0KF 1VLYA 3WBZA 2IAJB 1R3NA 1TL3B 2DJWA 3CSKA 1DARA 2ZM6F 5IQQA 3OL8A 1G2EA 1FF2A 1N5QA 3QWPA 2R8HA 1SXLA 3T6BA 3D28A 1R8CA 4GO7X 3IS9A 4K4TA 1RT3A 3KLVA 1S1UA 4B08A 2RRBA 2ZDPA 2HNDB 4JV2A 3EGZA 1RT5B 3NLCA 2MQMA 1BQMB 3LP1A 3BF4A 1LW0A 5J1PA 5HLFB 1HHSA 2L9WA 4PXEA 3QGGA 2YTCA 4HTJA 3KLEA 5EWFA 2VG7B 3DLKA 1C0TA 4Q2LA 2R7WA 1U49A 3CCUS 4NYZA 4R5PA 1X9SA 2UU9F 1NH8A 2B51A 2VOPA 4HKQA 1HBNB 1E6YA 1V3SA 5L1IA 1C2PA 1NKEA 4DWIA 2HHVA 1XR6A 3FRYA 4M94A 1TKTA 5KT6A 1QSSA 1ZAXA 2MZ1A 1D8YA 3I32A 2PA3A 4KC5A 2CRLA 1QM9A 4TYBA 2N3OA 1X4DA 3ITHA 2QFJA 2BDPA 4NRTA 2EFVA 2QLXA 4E98A 1G7CB 3MR5A 1IXKA 2J6UA 1REVB 5IT9Y 4DL2A 4AXJA 1MW7A 4QWCA 5E33A 4LVOP 3R5CA 3TAMA 1RTIA 3IAS9 2ZFHA 1T7PA 5KFQA 3PW0A 3HHLD 3LWLA 5F0UA 5D4OA 5SZTA 5M2RA 2ACYA 4PRFA 1N0VC 3J7YI 3HP6A 3MGJA 3KHGA 3J7ZT 2KYXA 3KJVA 3DRPA 1FHTA 5KFGA 4DSKA 1T03B 2YH0A 3TA1A 4I69A 1A6LA 3E51A 2FB0A 1S1TA 3C2PA 1ZPVA 2MKIA 3GILA 3DI6B 2JLEA 4OFZA 2B0GA 2VPYB 2ZC4A 4ID5B 2HIQA 3Q0AA 4KPYA 1HI1A 5AE3A 1FE0A 2FHMA 2B4VA 5KFBA 4ZK7M 1SIZA 1TAQA 4PR6A 4CH0S 4OLOA 4E8UA 3L7PA 2JZ5A 1GNKA 4GKKF 2DCUB 3LGNA 4C0OC 2MY8A 4UQGA 3CMES 3SQGA 2UXCF 2KFYA 4XO0A 1S0OA 4CH7A 3GMGA 2CQBA 3MEEA 2ERRA 3DCAA 5KOXA 1JNRB 3CT9A 2FTRA 4LFCF 3OL6A 2DO0A 1NJXA 1X8DA 3R1HA 3MM6B 4QR2A 2ILYA 4LF7F 4I4BA 3MEDB 2ZH4A 4UW2A 2QMXA 2CJQA 3I82A 4DSFA 1K1SA 2DNNA 2YNHB 1LWFA 3IG1A 2OD6A 1OO0B 2N4CA 2VBZA 2K8GA 2IRUA 3CF5Q 1PC4A 4EBCA 1NKBA 2GMLA 1XWLA 3UW1A 1S1VB 3KLGB 3BSOA 2A2DA 2AGPA 3QZ7A 2BXJA 2DITA 2R7QA 1L3UA 2DGUA 5C24A 1BQXA 4IH6A 2HRYA 3M2UB 4IH7A 3ZZTA 3F41A 1I6JA 5GAHU 4QOTA 3DOMA 1X4CA 3PJWA 5A8WB 1P8GA 4YUDA 2E44A 1IKWB 1HWJA 2AJFE 1Q78A 3PRBA 1JJ4A 2HHUA 3S7RA 1BQNB 3NWGA 1RWUA 5D78A 1HR0F 2IYGA 1JKHB 4H4MB 4C11B 3MDFA 3RZAA 3EYZA 3G4SS 2B43A 1KQFB 3ETOA 2HLTA 3OTDA 3F73A 2NR0A 4O4GA 1TR0A 1T3OA 5L38A 3FDSA 4OZ1A 4ETXA 1D0EA 3CCRS 5J2MB 2DVIA 3OHAA 3GQCA 1GH8A 4NLSA 5GMKa 3BSCA 1DTQA 1FEHA 2UXBF 3ZZPA 2EI5A 2LA6A 4DR2F 3MTKA 1S9GA 1VRUA 2XS2A 1YSJA 2P9CA 4JI1F 4R8UB 2RT3A 4M5DA 5K8MA 1FNMA 4QR1A 4EFAC 4X4QA 3KLFB 4FXVA 4KGMA 2UUTA 3JTOA 1N8RT 2NREA 2QA1A 1K9MT 3EXYA 1I1GA 1KHWA 4RNHA 4RBTA 4Y2CA 1W2IA 3OVSA 2WONB 2XMJA 3HXMA 4KBIA 4OL8A 2K3KA 1Y5LB 2HZCA 1ZH5A 2B5JB 3OFFA 4KHPF 2YKAA 4FN5A 1YHQS 3WC0A 1G3OA 1FK9B 2A10A 4FVCA 2RRNA 5BYQA 4AQYF 4RW8B 3X1LB 4FF2A 1KN6A 2C22A 3BM7A 3J7Z5 2CQGA 4P2SA 4Q5VA 1ZTWA 2B9YA 2FC9A 5ADZA 4IOCQ 3NNCA 4K2XA 4PG6A 2DRBA 3CCQS 2DNRA 3BGRB 2QYCA 6FDRA 3CUNA 1TFWA 3DRYA 4KKOA 1WNEA 3NCPA 1RTJA 1TQLA 4A8XA 2UVRA 3N4WA 5A6WA 4QIGA 1PO6A 1YJWS 2WSCC 1OS5A 1IBLF 2Y1JA 1FRMA 2BANB 2CPZA 1NK0A 3GFZA 3VR1A 4AL5A 4TU8A 4K4VA 1KLNA 3PEJA 2V5HG 4DV5F 2CJKA 3CDEA 4F50A 4YFUA 1U1LA 2BJEA 2YY3A 4XDDA 5F3TA 1WHWA 3FSXA 3KHLA 2DBBA 3THPA 1QE1B 3CULA 3PFEA 3HVTA 3LF0A 1ZM2A 2ABYA 4IQMA 2YKMB 3W2VB 3M6WA 5D6GA 2XGPA 1HQEB 1PC5A 2AWZA 4MYUA 3PO5A 1QVFR 1OQ3A 1R6YA 5A8RB 1P6TA 4PPDA 2LKZA 3CJ0A 4HDHA