2OFGX

Solution structure of the n-terminal domain of the zinc(ii) atpase ziaa in its apo form
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
106
structure length
106
Chain Sequence
b'PLKTQQMQVGGMDCTSCKLKIEGSLERLKGVAEASVTVATGRLTVTYDPKQVSEITIQERIAALGYTLAEPKSSVTLNGHKHPHSHREEGHSHSHGAGEFNLKQEL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zinc-transporting ATPase
publication title NMR structural analysis of the soluble domain of ZiaA-ATPase and the basis of selective interactions with copper metallochaperone Atx1.
pubmed doi rcsb
source organism Synechocystis sp.
molecule tags Hydrolase, membrane protein
total genus 23
structure length 106
sequence length 106
ec nomenclature ec 7.2.2.12: P-type Zn(2+) transporter.
pdb deposition date 2007-01-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ofgX01
2BUNA 3F44A 4A47A 2K7KA 2QIFA 2ASYA 1OQ6A 1FD8A 1GXTA 2KT2A 4Q2MA 1S6UA 1JWWA 5B0CA 4OIXA 5B0DA 4DPOA 1TUVA 3BGUA 1XBWA 1AFIA 1N5QA 4OJ3A 3BN7A 2FTRA 4A46A 2HFOA 1Y3JA 1OSDA 4ZOSA 3HDSA 4Y2MA 1Q8BA 1N5VA 1YJTA 3QGPA 4U9RA 4OJGA 4DN9A 2Q3PA 5T7LB 3TNVA 2N4DA 5F0UA 2PGCA 3MZIA 1K0VA 1WD6A 1QUPA 2RU9A 2XMMA 2ZDPA 3WDOA 3BM7A 4HH0A 4OJHA 3KG1A 2RSQA 3KNGA 1U7LA 2AJ0A 1Y0HA 1FESA 3DCAA 2CRLA 3E8OA 2HLUA 2K1RA 1P8GA 2FIUA 1FE0A 1X7VA 2KT3A 4FNIA 5B0FA 4Y2IA 1URRA 2IFXA 2HFNA 2GCFA 2RILA 2K1RB 3KKFA 1VQSA 1OQ3A 2ACYA 2ROEA 2XMJA 1P6TA 2ROPA 1TR0A 2K7JA 1YJRA 3BF4A 5A6PA 5B0BA 2AP6A 5KAKA 2OFHX 2FHMA 1JK9B 4FNHA 2QYCA 3HF5A 3VTIA 2GA7A 4ZA1A 2VV5A 2W4DA 2XMVA 4DL0C 1CC8A 1KVJA 2LXFA 2VH7A 1CPZA 2HLTA 2GFFA 2QLXA 3IWLA 2N7YA 1SB6A 1RJJA 2AJ1A 2OD6A 2ZDOA 3BDEA 2W4CA 3LGNA 3FGVA 1VQYA 2IYGA 2KKHA 2IYIA 2EW9A 2OKQA 2QLWA 3K7RA 5A6WA 4EFAC 3DXSX 4QOTA 2RMLA 4A4JA 4F67A 1AFJA 3GZ7A 5B0EA 2AW0A 1FVQA 1V3ZA 1SQEA 5B09A 1MWYA 2XMUA 1N5SA 3MCSA 1IUJA 1Y9OA 3HHLD 2OP5A 4HI2A 2G9OA 2HIQA 3FMBA 4OJ1A 1APSA 1CC7A 1LQ9A 2OFGX 3T9NA 1YG0A 2BJEA 1KVIA 2L3MA 2OMOA 3FRYA 1S6OA 3HHLA 2GO8A 2BBEA 1OPZA 3UDCA 2LQBA 2GGPA 4Y2KA 5B0AA 1R6YA 4HI1A 1N5TA 5B0GA 2GV1A 2W4PA 1Q4RA 2GGPB 1X8DA 1W2IA 2XMKA 3BB5A 1X0PA 2LDIA 3LGMA 4HL9A 4NL5A 5F0WA 1GXUA 1FE4A 2BJDA 2JDJA 3TRGA 2PD1A 1FEEA 3CJKA 1AW0A 4Q2LA 1YJUA 3HX9A 3HFKA 5B08A 4YEAA 3CJKB 3HHLC 1YJVA 3I9ZA 1SI9A 3QMQA 5K9FA 3TOQA 3KG0A 2FB0A 3LO3A 1FVSA 1Q8LA 1MWZA 2N4CA 2ROGA 4YDXA 1TZ0A 2OAUA 1KQKA 1TL4A 2OD4A 5T7LA 1TL5A 2XMWA 2XMTA 2KYZA 5IXUA 2HQIA 4HH1A 1Y3KA 2K2PA 1YRXA 1ULRA 3BR8A 4A48A 3IWXA 3HHLB 2BYCA 4NPOA 2LQ9A 1Q53A
chains in the Genus database with same CATH superfamily
2J9CA 2QIFA 2R8KA 1QSSA 4ES1A 4AQYF 3T5JA 1RCXB 3T1YJ 2IDEA 3CEDA 3ZC4A 3HFVA 3LP1B 3RBEA 2M8HA 1QUPA 2UUAJ 1E6VB 3OR1B 3SEOA 2DNKA 4IH6A 1HBMA 3AOAA 1CJKA 5D4LA 4WFZA 1S7HA 4PYAA 3CCJS 2FJBB 1JLBB 1X4DA 3CDWA 1VLOA 2D1CA 3HHNB 2XI3A 4O44B 4NWBA 4DR6F 2D69A 2C3PA 3QSYB 4I56A 3OHAA 1H6KX 4DL6A 4ITSA 5B0AA 2DNPA 4DPYA 2WOMB 2AJQA 3E01A 1S4EA 1FHTA 3L9ZA 2EPIA 2OTJS 3HHLB 3DM2B 1F9EB 4FPIA 2W2QP 4OZ2A 3QT5A 2JFDA 2BW2A 1UCNA 1S49A 3SYZA 1JWWA 3N01A 1LFPA 2EKYA 2AJFE 5FJ4A 2LMIA 4NI2B 4WXOA 1VC0A 3NGRA 4LRBA 2XMMA 1KWMA 1RT2B 3IR5B 2DJWA 3GB0A 3BBCA 4HHJA 3NL0A 1REVA 3D28A 4X4NA 3HSGA 4KO0B 1SB6A 2WW4A 1Q7LB 1TQLA 3M2RA 4EU0A 4RNNA 3N28A 1ACMB 4CYUB 4LBIA 2X51A 3UR3C 2J6SA 5EX0A 1FKAF 4OZ1A 4C0HA 2AMCB 1FEHA 1EARA 5A8WB 3KK2B 3W65A 3VZIA 1GMVA 5SZTA 2DRDA 2MYFA 3B82A 5C2CA 4LFAJ 3J81U 5L39A 3UQSA 3TZXA 2LA6A 1PG5B 3PIPQ 5K14B 5HI7A 4KGXB 1IJFB 4NLWA 1REGX 1IQTA 4OV1A 4LVNP 2WB4A 1PYSB 3IMQJ 2GMHA 5KFEA 1OY9A 1S6QA 2K8GA 1RTZA 2DO0A 1S1WA 5C25A 3MOJB 2B9YA 2CNLB 3PW5A 4JI5F 1F9HA 1RJJA 2J5AA 4K0KJ 4NLUA 1FWPA 1S6PA 2V34A 4F67A 1VQ6S 4WK1A 4U95A 3G6XA 3PYDA 5KFGA 4OYAA 4X4RA 3ZZYA 4GO5X 3IM8A 3L3CA 2UVVA 2NS1B 1IKYA 1KEKA 3ETOA 1O51A 4Q2LA 4DV2F 4UF4A 4YEAA 4DS5A 4A8SA 3H4BA 2V4QA 3M2UA 1Q95G 1IKWA 1HBUB 2GJFA 3NOCA 4ZPWR 4G3IA 2MKHA 3A13A 2MKIA 2IVMA 2D3UA 4OIXA 5T41A 2W8KA 1XMQF 2Z8QA 1N5YB 1C0TA 1S76D 2VONA 5LMNF 2O1PA 1Q79A 2DNRA 1UFLA 4DR3J 2LKZA 3KNGA 1RBLA 1X7VA 4KR0B 2RHQB 3VAMA 4JV5J 3KKFA 5DDRC 5KT3A 2OFHX 2DIUA 3QWUA 2GVDA 1M90T 5FD1A 4KB7A 4LQ9A 5HMZA 4K4WA 2R4FA 4F2RA 5KOXA 4UOGA 3T5HA 4P52A 2J6TA 2YNIB 4EO8A 3F56A 1S6OA 1P27B 4ERDA 5HROA 3TUZC 3TO8A 1QDUB 4WYWA 4AT1B 2V63A 2VASA 2BABA 2V8DA 2WW8A 5K8PA 2D41A 3AJ2A 3AAWB 3N6MA 2ZBPA 1HARA 1TL1B 3F0NA 1I51B 2E1PA 5CYQB 1U47A 3R3TA 1IBKJ 1YVFA 5I3UB 4B3RJ 1R3NA 5GMEA 3JAMU 2NREA 2P6SA 2UUBJ 3IBWA 3BKUA 5L38A 2F4FA 2R8IA 2SXLA 5HQ8A 4LFBJ 2M52A 3N0VA 3PFOA 1P1TA 1S72S 1KLMB 1WWHA 4PZVA 5IC6B 4WP8A 4ZP6A 1T9TA 3ZTPA 1R0AB 2BE2A 4GKKF 3O2IA 4DQSA 2AGOA 1WKKA 4BLGA 3BDPA 3NLCA 2FGOA 3ZTQA 1VQ5S 4IFVA 1HD0A 1KP6A 1RAJA 5CABA 2JJ4D 2CDQA 5B08A 4DL3A 2KU7A 3M8YA 1Q8LA 1KD1T 4WYLA 4OI2A 1T95A 4WTYA 1WOSA 3FBFA 4NPOA 3NCQA 3K5PA 5CHCB 3H59A 4W98A 2AKWB 5BXIA 4OHXA 3QJLA 2DRAA 5GADU 2HEKA 4HACB 2CQHA 2FZGB 3BN7A 1R8HA 2CPXA 1RHMB 4IG0B 2A0FB 3HHDA 1K0VA 1HFEL 3I0RA 2AYBA 3M6VA 1TL7A 4RX6A 4LR8A 2PEBA 1ZS6A 1TUGB 3T5KA 1G2EA 4DQPA 3KNAA 3B4MA 3DYAB 5THWA 2GIFA 2ZZTA 3ZZOA 1HPZA 3PTWA 3SDEA 1I94J 3KJVA 3EGWB 4KGKA 3PV8A 3EM1A 1UEVA 5CYMA 1UJ6A 2ASJA 2QA2A 2HMIA 3MMAB 3X3UA 4W4MA 1VQ7S 3L7UA 1S9GB 1T02A 4J9NA 4ECYA 2DR6A 2FB0A 3LO3A 4YDXA 3WIVA 4RW6A 2QJ3A 1WHYA 3UCGA 1B3TA 2FQQB 4K4ZA 1FD8A 1U48A 4Q2MA 2NCKL 3AY0A 3SCIE 1HNZJ 1WI6A 1G4CA 3P4UB 3LP1A 1Q8BA 2C2DA 5EGYA 4DR1J 2POKA 5GADI 1RHUB 4ZIWA 1E6VA 4AUKA 3OR1A 4LF9F 4F4XA 1UW4A 1A9NB 3SSSA 3U02A 2NUUG 3QYYA 4F0MA 1JLBA 5CA5A 1TK5A 2XZWA 2YNFB 1RT6A 4QPXA 4KAIA 1U1NA 4TLRA 2M7SA 3ETMA 4IRKA 4I2PB 4CP5A 1WSVA 4M63A 3PW7A 2EFQA 5ETLA 2GV1A 5DG9A 4LF4J 1CVJA 1NJIT 4KBIA 2WOMA 2BMBA 3HXMA 3K59A 2E9RX 4HVZA 3OTCA 4QR2A 4IG3B 1TL4A 3AD8C 1F9FA 3M1VB 4OZ3A 3DM2A 2DR9A 4QPTA 4A8KA 2I2YA 3L7PA 2W8LA 2Y1IA 4C8KA 2GO9A 3NGSA 4PWDB 2RS2A 4DX6A 5IT9U 2DISA 1TFWA 2VU5A 2EVZA 1WHWA 1LV5A 4OX8A 2XYHB 1GEHA 1KOHA 1MLAA 4N5SA 2R7QA 3H2UB 3OTDA 3KWMA 3CCTA 1OYDA 2GZOA 1HQUA 2FPHX 4ZVRB 1S0VA 2IM3A 3VTIA 2FY1A 2BA9A 3MMBB 3IGVA 4E8UA 1JMTA 3QT8A 1VQYA 4CYUA 1RLCL 3EGNA 2AW0A 3MEEB 5KFCA 2YKOA 2C2ZB 1R27B 3FSXA 2XO7A 2KT5A 5A8WA 1JIHA 1GTHA 1WDTA 2BOPA 1X4FA 3ZTOA 3LH2S 1T0TV 3QRPA 3DGPB 2Y1JA 3CJKB 5JVHQ 1F5BA 1GQEA 4LJMA 2UXCF 3RAXA 2ZH4A 5AXMA 2JNJA 4DR5F 3OSPA 2H3EB 4CCHA 2ZKUA 2KFNA 4ECSA 2C3YA 2K7KA 5K14A 3KLIA 4N76A 3GE9A 3TX8A 1HNWJ 2EK6A 2XG8A 3RBZA 1WEZA 4OZJA 3VZHA 2Q3PA 1D3WA 3CC2S 4ELVA 1N52B 2HHVA 2DK2A 4LF8J 2AWZA 4ED7A 3FUYA 2YNHB 1KQFB 1BE4A 3AJ1A 1CEZA 1VS3A 2RDDA 4QJVA 4DL0C 1Y5NB 3TA1A 4DCJB 2ZWOA 2CQ4A 2VDIA 3FGVA 1X4EA 2HBYB 3CNQP 2PE8A 5L1JA 2B8QA 5D0HA 2MY8A 3W8GA 2DNLA 2XZDB 3OFHA 3BH6B 4RW8B 1RI7A 4Y2KA 1FNXH 3GJQB 2Y3YA 1CBKA 1RB0A 3KLEB 4O3QA 5AE1A 4M95A 4MK7A 2AHOB 1T11A 3KMSA 4H4MB 5D0GA 1LW0B 1SJFA 4Q43A 2J0WA 2MLXA 2ZNYA 3ADAC 2YWHA 3CD6S 4KC5A 4D3HA 1K44A 3WC0A 1S6UA 2CPYA 4ETZA 2I5JB 2UZAA 2XGPA 3LGHA 3NOGA 3PG9A 1U6BA 2HHWA 4G1PA 2A2CA 4UUXA 4ANCA 1RZMA 1N5VA 1JLEB 2EK1A 2GAHC 1CULA 2L41A 1M5KC 2QA4S 2H54B 3PEJA 4I4BA 2KT3A 3EVWA 3RU0A 5I42B 4M5NA 2FY8A 3IAS9 3ZZZA 1ZPVA 3JYTB 2C22A 3K58A 4RO0A 2BQUA 3DRRA 4RUHA 4DQQA 3TQ1A 3W60A 1RHJB 2ZC3A 3M30B 4X65J 2R2SA 2LLZA 3UD3P 3T9NA 3RB4A 4X64F 2ZNZA 2MQMA 4DS4A 2E66A 2E5HA 4JP8A 1FRJA 4WU2A 3SFGA 2V6AA 4B3TJ 4WPAA 2Z58B 3CMAS 2V8PA 3GMGA 1R6VA 5C5JA 2QEXS 4FYXB 2ADBA 5KFSA 3CUNA 5CYQA 1RT5B 4GVBA 3UD5A 3QZ7A 3DRSB 3NAIA 1B70B 1DRZA 2R8GA 3HCXA 2W7AA 4CH1A 2ALZA 2YPYA 1MN9A 1NSAA 3TUJC 1IKXB 5J2PB 1N0VC 1J5OB 1IN0A 4PUOB 5F3ZA 4RW7B 1KLMA 4B3SJ 3BV8A 1SC1B 4LRAA 1R0AA 2XULA 1SVDA 1U49A 1VCTA 1PBAA 1YRUA 2NQPA 4RKUC 1ZAXA 1U1PA 2JVOA 2YWEA 1D9DA 1OS5A 2MHNA 3FQLA 1RA6A 1YG0A 2PT0A 4DZ6A 3QO9A 4HI1A 4A8XA 3CIZA 5HN0A 2VC0A 1JXEA 2IC3A 4DV0J 2PD1A 3IS9B 4B9VA 2RQKA 3G9CA 4OZNA 2BQRA 3R5JB 5KFKA 2QT7A 4YB1P 3G6VA 5DG8A 4L74A 5C2GA 2LQ9A 5E2QA 2WHOA 3OXGA 4NLOA 1NBEB 5GAHU 1RISA 4HACA 2OELA 1WORA 3DHWC 1R7IA 3PDNA 2HQFA 4DI6A 4F3OA 1F5AA 4U9RA 1C0UA 4C9DA 1SKUB 2RU9A 2KRBA 3GG0A 3KG4A 3KG1A 5AE3A 3TW0A 4RW4B 1W2BR 4C7QA 3DYAA 1KTQA 4DUZJ 2E44A 3IWLA 2N7YA 1AYEA 4IO1A 3CO9A 4BC9A 4PEOA 1T9UA 2IM0A 1SV5A 3FEYB 2GVZB 5MLCV 4DL7A 3C6TB 4GVLA 4NXNJ 3DNCA 2E5LJ 3NS6A 3MMAA 2L3MA 1U8WA 4UW2A 1MMNA 1S9GA 3H42A 2XMKA 1NNDA 2MHEA 3CF5Q 4DN0A 1VQOS 3BGRB 4P6QA 1WELA 2MQPA 3OTEA 1YJNS 2E1AA 3RYLA 2BVZA 2HQIA 4I0WA 1Y11A 1S10A 1TMMA 1W26A 4LF6F 1VI7A 2IVFB 4Y28C 1QJHA 3BGFA 3Q8PB 5GAHI 4JI7F 4URQU 5DDOC 2GIRA 4ECWA 1FKPB 4TNOA 1Z1ZA 3EDQB 4DR4J 4DFKA 2U1AA 4CT8A 5M2PA 5KT4A 3CDBA 2BW7A 2BANB 3G96A 2YNFA 3L4BC 2GFFA 1JQGA 1WKJA 2OPQB 2YX7A 3P6YC 4MTPA 3BQ2A 1NAQA 2BM0A 4O0IA 1FF2A 3BO3A 2Z56B 1FNOA 4J9VA 2CQ3A 2VFRA 2Z0GA 4L3KA 4QU7A 2Z2YB 4IG3A 1YJVA 2Z2ZA 3NNHA 1HI1A 3M1VA 2KZMA 5IZHA 2P5VA 2XMTA 5KG3A 1NJYA 1HWKA 4B9LA 3GYXB 3TJAA 4C0OC 3SV4A 2JEIA 2V8GA 2XEXA 1FDAA 3O8WA 3CSKA 1R31A 2LQ5A 4B08A 1VQNS 3VGTA 1FD2A 3VAIA 4JI1J 1QAIA 1CJVB 4ZP8A 2JHEA 2AJ0A 3NEKA 1HNIB 5EDWA 1L3VA 4EZ6A 3KJNB 2IIHA 1S12A 3MMBA 3SQGA 4YR0A 4WBFA 2LP4A 4CH0S 3ILJA 1NKEA 3T1HJ 3M4XA 1D9AA 4ZITA 4JI4F 1Y10A 1VJQA 1WF2A 3H2LA 3ISNC 1FRHA 1T9VA 2HWHA 4FXDA 4OX6A 1JJHA 4DV5J 2XSFA 1EX8A 4DV7J 3DGPA 3HP6A 1FE4A 3CJKA 2AYEA 1C2PA 2AZ1A 1HR0F 5C42B 2OD4A 1NK5A 1VOMA 5BR8F 4IRDA 3PO4A 3MGJA 4AFFA 3P5BP 4DV6F 2CQ2A 4L3NA 5J2QA 4ZVTB 4K7QA 1IWGA 4NOHA 4TQSA 3M8SA 1FERA 4DV4J 4HEA9 1LK5A 1DTQB 2YWKA 4DL2A 3CVKA 1DJ0A 4TVAB 2ZEJA 1TL3A 3J7A1 1IBMF 1UMJA 3PJ9A 1X4HA 1WD6A 4JI8J 2B7BB 4QW9A 2YNHA 1UEUA 3TVKA 4DQRA 5GMDA 1WC4A 1AROP 1C4AA 4F8RA 2WB1D 1KS2A 5HJXA 4J9LA 1HYSB 1WJ9A 4IO9Q 4CLZA 1RWUA 2VUGA 2QMXA 5B09A 1GX6A 1N5SA 4RW8A 4KTQA 3KK3B 1RWKB 4I2QA 1VHIA 4IDKA 5IFMA 3KLEA 3GFXA 3R5GA 3B8HA 5DG7A 2P8IA 2WSCC 4H4MA 1LW0A 4IQMA 4F36A 4RUAA 5T7LA 1J5EF 5KFMA 1ULRA 5C7PA 2ZM6J 2LCWA 1HBNB 3CDEA 2VG7B 4OX9F 3Q83A 3R5DA 4OZ0A 4CLYA 2JRSA 1D0EA 3ZNJ1 3BKTA 5A8KB 3NNCA 2U2FA 2ZH2A 2K3KA 5F0UA 1JB0C 3MZIA 1SCJB 3W66A 4Q8EA 3HFZB 1SL2A 4DFPA 4F4KA 3HT3A 4IOCQ 3DHXA 2OPRB 4UOHA 4YFUA 1GK8A 2ZHOA 1UA1A 1LWEA 2C2RA 5KFBA 2R7SA 4PXBA 4WF9Q 3M30A 2MJUA 4JV0A 2Z57B 2V94A 2HRTA 4RNHA 1H7XA 2BE9B 4ILLA 2P9EA 3RBDA 5FLXU 1P9QC 1AZSA 5K20B 4ALZA 2MQLA 1FT8A 1VIOA 4DOZA 1FJGJ 3DRSA 2UUAF 3HJFA 2BQ3A 1NCLA 4KKOB 2LYVA 3I0SB 5K8OA 4ID8A 4OYIA 3W9IA 2HBQB 1J5OA 4PUOA 2CPZA 4DV3F 5KFPA 1SC4B 2AEJA 4OHZA 3MD1A 2PMHA 2XBPA 8RUCA 4P75A 5ETTA 1VQKS 2VBWA 4CO2A 2HQDA 3WBZA 1TAUA 4ZN3A 1XK8A 3B6BA 4OYWA 5DZ6A 5LSOA 3GONA 3S7RA 4OYPA 1VR6A 2QX0A 1RDRA 4UOFA 3GV5B 3UN5A 2ZOFA 1UWBB 2GAGC 4P2SA 4ZCMA 1FJ7A 2B4OA 2GX8A 2CPEA 3BBFA 2BJ7A 1B64A 1UKUA 3ZXWA 4Y6IA 4Y00A 4LF2A 2CPJA 1H2VZ 2C2KB 1VIXA 4FF2A 1TUWA 4RWXA 1KQSR 5IOLA 2E29A 2W25A 2VIHA 4A8MP 4DSEA 4RWWA 2VBZA 3QGGA 2BE7D 3GQCA 2FC9A 4WE1B 3IWNC 5LJ3Y 4NLXA 3MXHP 2F9JA 2RSQA 4RW4A 3CCVS 3GSDA 5CYJA 1JK9B 1RT4B 3QATA 4DSJA 1R8CA 2YKPA 1NM2A 1N33J 1NDPA 3C6TA 1EETB 2KM8C 1RCOB 2PFDA 2OH2A 5L9NA 5F9LA 1HMVB 4RBUA 5D0RA 5A0YA 1FXLA 4U96A 2W4PA 2XB2D 2LA4A 2VZ9A 5DRKA 5F8HA 1PILA 3BGRA 5BYSA 4P72A 3BH7B 3NWGA 4J37A 4J9SA 3CJ0A 4X62J 5CZXA 1D09B 3KXDA 3Q2TC 5ETQA 3P49B 1Q0NA 3N5BA 3SXLA 5H9FJ 4PPDA 2CWXA 1F2HA 3UWTA 4V19X 3OBIA 2MLZA 2YY3A 2YNGB 4TY9A 2OIHA 1PCAA 3KUGA 2DXFA 2E1RA 1U6FA 2C2MB 1AA1B 1FKPA 4B02A 1ZM3A 3NRBA 2ZZNA 4P2MA 1HHSA 1RYSA 5CCMA 1SUQA 1U09A 5KFXA 1T9WA 1VC6A 3VAFA 3DKDA 2IM1A 2M70A 4KIAA 4K2XA 1VJWA 2BANA 4GC6A 3UNGC 3Q8YA 3C14B 1TKXA 4X4PA 4FF1A 2JLFA 2DKOB 3CPWR 2RH3A 1M1HA 1T3NA 2OKQA 2XY7A 4A4JA 3S01A 3TARA 4GC7A 3V6JA 3KLVA 3OR2B 2OPPA 2GJ2A 3PZPA 3K0JA 4NLVA 1NO8A 1RT7B 4H54A 4IH7A 4DBQA 3Q8SB 4EBCA 1W2IA 2B8PA 1GXUA 2UUCJ 1GAOA 2DXDA 3CGIA 3TANA 3BPSP 4PCQA 3LAKA 1HQEA 4ILMA 2HQ3A 3Q22A 1SJ3P 1EZZB 3LP2B 1OQ6A 2XTJP 3TA0A 5E33A 3EPIA 2VQEF 2UV8A 2C3UA 4GKJF 4LVOP 3OL8A 1OSDA 3LALA 3GR1A 3M05A 3MFHA 2JEFA 4ZJOA 3PYEA 4JI2F 4ZCIA 2B56A 1N6QB 3ITHB 1URRA 2ACYA 4XTTA 4QR0A 3CD5A 3QBCA 4J9PA 4RLEA 3DMJB 2NSCA 1FFSB 3C6UA 2QLXA 5AJ3F 3J80Y 3E51A 2XYGB 3GJSB 1LNQA 1RUSA 5D0EA 3ONQA 4ATNA 2DY9A 4DU8A 1SKSA 4LMZA 3K5NA 1BY9A 2M5YA 3U1LA 1YRTA 4DPTA 2RS8A 1U0HB 2DNHA 2FHKA 2V2ZA 4FKXA 3UDLA 5C42A 3GJRB 3DOMB 5DETA 3V4IB 2JC1A 4LFBF 3QGHA 4DX5A 4BCAA 2ACMA 1YBUA 5F9NA 3U7JA 3MPWA 2B4PA 2K06A 1XBWA 2F63A 2R7RA 3CWJA 1HHQA 5F8IA 2DHXA 5KG7A 4TU8A 5EWFA 4EUVA 3W63A 2RILA 1S57A 4USUA 2K7JA 3JSRA 2AGQA 1YJ9S 4BDPA 1TAQA 4JV2A 1JX4A 3AOCA 3VF0B 1ITPA 2L9NA 2CNOB 3TUPA 1N4LA 2VFVA 1MWYA 2ZHBA 2VG5B 3KK3A 4RU2A 1GH8A 5K5MA 5IT4A 1LWFB 2W9BB 3W2WB 2DXEA 1K47A 2V69A 3ENVA 1P9YA 1PAUB 2PSZA 2D7SA 1BQMA 2G0IA 4UUWA 1HHTP 2V0NA 7FD1A 2F8MA 3T5LA 3CCZA 2GHPA 3RG6A 4N47A 2QFJA 1HBNA 2VG7A 4ED8A 3MI7X 4LR9A 2WBMA 2YQ0A 5A8KA 3WQPA 5HMWA 3VR1A 4X84A 1RWVB 1X0FA 1I94F 3AXKA 3W2VA 4HYKA 3K8VA 4NLTA 2J8SA 3PYGA 3P5TL 2NZ4A 2DNQA 5A6PA 4DCPB 1HL6A 4CNZA 3EGZA 2B5JA 2QYCA 2W4DA 1NKCA 2FUG9 1RHRB 2E7WA 2QMWA 2W4CA 2BOAA 1DHMA 4ZVGA 5CH7B 5DO2A 4OZ5A 2BDPA 3MCOA 1U2FA 2IJFA 3V6DB 2GO8A 2BBEA 1ZAWA 4A8OA 4AQYJ 1Q4RA 2R7XA 4F7VA 4TXSA 3TWZA 3OHBA 2ZUAA 2FZCB 2XY5A 5DGAA 3W3SA 1HBOB 3TA2A 1WOPA 1R89A 3ILOA 3IFEA 2B9WA 1YRXA 4DLEA 2ZBIA 3NG8A 2B7CB 3GPAA 1NJWA 1N56A 4KKOA 2E1MC 5JXSA 1LXJA 3I0SA 2UU9F 2MB0B 4HT7A 3OT9A 4OX7A 2DTJA 2PN6A 3B54A 2OPSA 3H25A 4EI2A 1Q16B 2AZ3A 4Z7YA 2XI2A 3NCRA 2CZ4A 4HHUA 5HVHA 2JWNA 4DSFA 5IQQA 5KG0A 4DPUA 2HFNA 3QJPA 3W9JA 3DOKA 4ED5A 3MCNA 1BUXA 3M8WA 1RWNB 1UVMA 2R7TA 1BQNB 2CNNB 2DGQA 3PX4A 3GP9A 3FDSA 3M6UA 4Z37A 1DQ9A 4CZCA 2VKZG 1UWBA 1H98A 2HHUA 1JLQA 4BBYA 1IR1A 4F0HA 2FGCA 4DU7A 2X3DA 1FEEA 2F8EX 4NMLA 4QIWD 2KN4A 3HHLC 4V1Ak 4LIWA 5M2RA 4CO5A 4WKYA 1SJ4P 1FCAA 3L7OA 3UVJA 1ZETA 2ZE2B 3CIMA 4M1KA 5KFFA 1VHFA 3T1AA 3HZEA 1T9XA 1UPMB 4TU7A 1NXIA 5KFZA 4F50A 1TVRB 1S4FA 4IQXA 3GU0A 1X5SA 2HNYA 3AXMA 5KOWA 4LSNB 1RT4A 2DCLA 2CZVC 5E3CA 5J1PA 3WC2A 4BWMA 4KGZB 1HMVA 4FP9A 3FVYA 3WIUA 2HK2A 2AD9A 3K89A 3NCPA 5HQLA 4PWUA 1VFJA 4FKYA 3BYPA 3MMCB 2KFZA 3GIRA 2I1RA 4JI5J 2YNGA 2H48B 3HJVA 2ZD1B 4JI0F 4EK2A 4CLPA 3KOAA 1MSWD 4PWWA 5KFUA 3FKBA 2MEWA 4TU9A 2XQCA 1HQ2A 1OJ4A 1ZYQA 4LUBA 3JSYA 1YZ6A 3IG1B 3HVAA 5D3GB 2DGWA 4M8LA 4DV2J 3J81j 4ELUA 2OI2A 1AT1B 2WVCA 1U4BA 3LPEA 2BV3A 2FHJD 2FZKB 1IBLF 2DEJA 1MMDA 3I6PA 4F4AA 3D2WA 4TY8B 5DQHA 2YX4A 3OR2A 3UPFA 1TMJA 4S0MA 1RT7A 4EWTA 1XMQJ 1RWXB 2MTLA 5L8RC 2RD5C 1OPZA 1QAXA 4PG4A 3VAJA 4XAKA 1NHKL 4JI6F 4R8UA 4X4OA 3KLGB 2W1BA 1S1XB 5MAOA 2ILZA 2Y0SD 2YBVA 3M9OB 1TZ0A 4QIEA 1AUDA 2YH0A 3MAQA 3FC9A 3D67A 3MM8B 1XWLA 1C1BB 2UVWA 2HFZA 2HRYA 3TAMA 2EBGA 1Q8KA 1VQLS 4ANDA 1PYOB 4FXWA 3IXQA 3DN9A 6AT1B 2HIYA 4QR1A 1B4SA 4RW9B 4A8QA 4XDCA 2VL1A 4LF7F 4J90A 1FK9A 5E0OA 1RYRA 4ZLLA 4CO4A 1JLCB 2FJAB 3ZNUA 3UN2A 3PEHA 3NWRA 3PJWA 3MAAA 2J0XA 2A3JA 2W7OA 1XMBA 5ADZA 1EQ0A 1WUUA 4YS2A 3FRYA 2CKWA 2G0CA 3OLAA 1O8BA 1U0HA 3MEGB 3OLBA 3ILLA 1QM9A 4DPWA 1X9MA 2DGVA 3AQOA 1IWAA 4NRTA 2QTWA 3GIIA 3P45B 3R27A 3V4IA 4PPZA 2XMWA 3I55S 1SJ1A 2RHSB 4IRCA 2ZITA 3IO1A 2IRUA 2XCAA 2O5DA 1L3UA 2M88A 2LECA 5IWAJ 2XLIA 3KFWX 4MK9A 1S1VB 3QIPB 1N36F 4WFAQ 1RADB 2HW3A 3I9V9 2Y8WA 2WRMA 2MZQA 3M7VA 2JH3A 5KG1A 3MCMA 4ELTA 4Q0BA 3MFIA 2H1YA 3PR5B 1KHVA 1YKWA 3ISND 4RBTA 3HVTA 3E2EA 4I68A 3PIOQ 4DV0F 2OD6A 4X4VA 1V5IB 1LOUA 2B0GA 5DM7Q 1L3SA 4QOTA 1RT1B 4DL4A 4FS1A 4FZVA 3AA9A 2RDJA 3ILIA 2RDIA 2VG5A 2L9DA 3CJQA 4NLQA 2OP5A 4HI2A 2VFSA 2HWIA 1LWFA 2ZUGA 1G1XA 2EG2A 2W9BA 3K8WA 1N5TA 1UVKA 5KG4A 3A8EA 5K8MA 2BJDA 2FJDB 3D54A 5IM0B 1ZTWA 1K73T 4F25A 1I1GA 5HP1B 3KMQA 1RACB 2XYPB 1RABB 3M6XA 1FVSA 4DFJA 3SZ2A 3MM7B 2ZKTA 2CQDA 1NJXA 2V4RA 1U1MA 2W9AA 3BR8A 3IWXA 3IRXA 3GWCA 2J76E 4FF4A 3CULA 3CJ3A 3CJRA 1NDLA 1KNZA 1KTVA 3AD7C 4HR2A 4IFYA 4DUZF 3UO0A 2ERRA 2MJNA 3MTKA 4RUCA 4EBDA 5EWGA 3FEZA 4PQUB 1UJ4A 1U1KA 3RBXA 5B0BA 1H38A 3OVAA 3I5BA 1M5HA 1X4GA 2LQ8A 2XMVA 1FXDA 4LF5F 3G87A 2AJ1A 3DLJA 1PGZA 2OMLA 1F3VA 1FDDA 4NA2A 3H5XA 3V6DA 1RWWB 2VJUA 4CDIA 1GMWA 2BKNA 1PAEX 1QE1B 2DNGA 2RIJA 5FDLA 4OI6A 3EE3A 5HMYA 2LQJA 2G0JA 2BEFA 2Q79A 2NYIA 1S77D 2XHWA 1HBOA 1B0TA 3ENWA 5EHHA 4M5DA 1KQKA 4I67A 2EFOA 4DR4F 2HHSA 5I4MA 3R7NB 4MFBA 4E0DA 1HWLA 3PKMA 5D4PA 3I5CA 5HQMA 2EFPA 2V9WA 1HI8A 4MT1A 2MQOA 2HBZB 1XR5A 1NH8A 4USTA 3RRGA 3QGPA 2N4DA 3GCXP 3JB9k 2HAIA 6FD1A 3LWLA 1DLOB 4NA1A 3KHGA 2BKOA 4ZVOB 4CLKA 3C16B 5KT7A 1UAWA 3OV7A 5L46A 2NR0A 5RUBA 1B0PA 5BYQA 2KH9A 4YUDA 2O3DA 4JI3F 2ADCA 1WEYA 2AIRB 1NMEB 2KHCA 1T05A 2DEIA 1VRQC 3KK1B 5CCLA 4M5IA 4JB8B 5B0EA 3RGIA 1FRXA 1CQMA 2LU1A 5E3RA 2JOQA 2YKQA 2AJ4A 4X66F 1YIJS 4KV8B 5D78A 5JVGQ 5IV4A 4ZK7M 4KT0C 5HMXA 1EQMA 1ZA1B 4CRJA 2W24A 3L09A 2JEGA 2HNZA 4I1TA 1NU4A 3SQOP 1QTNB 1YHQS 5E3PA 3V81B 1DQ8A 2RJZA 4ED4A 1MN7A 2ZE2A 2HYIB 1Q53A 2ABYA 1LWXA 2X3GA 1G6BA 2DGOA 1FFGB 4QZVB 2VFTA 1RTHB 2AYGA 1VRTB 1TVRA 3C2PA 4UY8T 4WFNQ 1NHVA 3UD4P 3FCHA 3W64A 4L72B 1LXNA 4LSLB 4O23A 1BC6A 5HAOA 4LSNA 4ZLJA 3BF4A 3EVOA 3Q8UA 3Q24A 3MEDB 2JFKA 3A3PB 4TQRA 2UXCJ 3BSCA 4DR5J 4JOUA 3RTVA 1HI0P 3IP0A 3KUHA 3ZZ0A 1RTDB 3A4TA 1FDNA 1BD6A 2CZ9A 1H3DA 5C24B 2HK3A 1BXNA 1APSA 4CTAB 3GCWP 2LQBA 3RAQA 4DV4F 4ED3A 4OI3A 5CXTA 3BB5A 3OVBA 1X5PA 1PSDA 3GR0A 2EFNA 2DO4A 3DI6B 1S1TA 2FVSA 1XNRF 4OYMA 4HDGA 1B99A 2HKEA 2EKNA 3MMCA 5J1EB 1JJ2R 4YB5A 3MAHA 5DJBA 4WK3A 3NMRA 1TELA 2EWHA 1R0BG 3H5UA 1PYTA 3S6EA 3MM5B 4FYDA 5HL7Q 1TV6B 3R6LB 5D15A 2B3TB 2VICA 2H4YB 3E3XA 4ID5B 1Q5YA 1YI2S 2CQ0A 5D3GA 1BWEA 2FIUA 3DDIA 2K1RB 2XMJA 1AB8A 5LMUJ 3AD9C 3JSMB 3C15B 4F4WA 2XSJB 1CG2A 1HWJA 3D1OA 5F8LA 3OTOF 3OTBA 2PA8D 2ZOGA 2ZJRQ 2CA9A 4HT5A 4K4TA 2VBYA 1GTEA 1DTTB 3PCOB 2CUYA 4ZP7A 4ETXA 1JLAB 4KFBA 1CC7A 4CLUA 1RWMB 2VFUA 1PC5A 1LW2B 3MUMP 3R7SB 2CQCA 1DBDA 3Q86A 4U8VA 3NP5A 3KLGA 4ZN1A 1S1XA 1JNRB 3SIPB 2MQQA 4ZMMA 3BBBA 3JTPA 4GO7X 4LSZB 3T6JA 3NBPB 2CQGA 1RBOB 4YR2A 1QAYA 5KFIA 2CVIA 4DV1F 2XWXA 4WZQA 5H1SV 2YKNB 2BJ8A 3I96A 2CJYB 2DCUB 3GFZA 4HDHA 5IT0A 3D0HE 3LWMA 3MM9B 1J2VA 4UTGA 3JTNA 4J5OA 3MPUB 4NE9C 2MKSA 3A3OB 2HHHF 3CCES 1XR7A 3CD7A 1YJRA 1S1UA 3B4DA 2FVPA 1T7PA 1JLCA 1H0HB 4ZA1A 2VV5A 2X1GA 4O0NA 3H5YA 3HHKA 3MEKA 3NKYA 3C46A 1MMLA 2MMYA 3VV2B 4ZPCA 4AD6A 4YY3F 3OFEA 3LANA 1CJKB 3MEGA 4ER8A 1YGYA 4WJBA 3CJTA 4PG8A 3F73A 4YHHF 3UW1A 4P73A 2QA4G 2WZ1A 2V5HG 2ASYA 3TEHB 2OEJA 2VG6B 1Q8IA 3IBFB 1OIAA 1YWXA 1R8AA 1VBXA 1N88A 5B0DA 1S1VA 2HFOA 2CQ1A 2J7WA 3QQCD 2VB6A 3D3CJ 3SCLE 5E41A 1LK7A 2UVRA 1NK6A 2N3OA 3NMAA 2E5GA 1VQSA 2RQCA 2LXUA 3MPYA 1DARA 4DUYF 3K17A 3FFIA 1RT1A 1QVFR 2IMOA 4MKVA 4TN2A 4B3MF 5HATA 1URNA 3UDVA 4F4ZA 5LT5A 2GQCA 5AE2A 2J9DA 4OQJA 5IM0A 1ZBTA 1NK8A 5DQIA 1NPPA 1RKJA 1N32F 2LDYA 2V8HA 3M2RB 3AB2B 2DYAA 2KZZA 1NB2A 2ROGA 4C98A 4O4GB 3EMTA 1DFDA 2MZTA 3DDNA 4JV1A 2W2NP 2QV6A 2R7VA 1H2TZ 3ET6B 3R7BB 3VAKA 4CQ1A 2D3ZA 2PMWA 3NAHA 1S9FA 2H65B 1GFWB 3M32B 2C2EA 1XJWB 2DVIA 3H98A 2XHCA 1Q81T 1FO1A 2OO4A 4LF1A 4O44A 3BO2A 5KFNA 2M4MA 1UA0A 3D4JA 2I9SA 1NRKA 5DDPC 1V3RA 4QYZJ 4I6YA 4AL7A 2LXFA 3QPIA 3BDEA 5H9EK 1HWIA 1PO6A 1S97A 1O0PA 2ZH9A 3H90A 3PACA 2VBXA 4MK8A 3R2DJ 1S6QB 1QE1A 4LF6J 1SIWB 3QAEA 1PKUA 1S1WB 3HHLA 3FNNA 1VGYA 2WVDA 4JI7J 1R43A 2UXDF 2HSEB 3AA8A 2R8HA 4W90B 3VVUA 4QWEA 4NLRA 2NPFA 4DCOB 4RNFA 1QLNA 3NNAA 4DHVA 4NI2A 1RT2A 4U7UK 2UXBF 3IGNA 4CLSA 2C3MA 4R0JA 2J7KA 2C28A 1CJTB 3HT0A 1RWPB 2RVJA 3LA0A 2RQMA 3SCKE 2NXNA 4KO0A 3WZ0A 1IKWB 2PO4A 1W25A 3A8JA 4HLBA 4OI4A 1DLOA 3BM7A 5KG2A 2KRRA 2FVRA 3DCAA 1YTYA 3J7AN 4ENOA 2AEMA 2R3VA 1VLYA 3I82A 4PR6A 3P96A 3A8KA 1U25A 4WKRA 1SKWA 4U67Q 1RTIB 1LFWA 4CLWA 2VC1A 5HSPA 2UUCF 3KK2A 3KK1A 3TVYA 4F04B 1EKSA 2QA1A 4MIWA 2DGUA 2CXEA 3SBMA 2EI5A 4KV8A 2FJEB 1SQFA 2GVDB 4DL5A 2E1CA 5EUHA 3DLKB 1IKVB 3N6LA 5K9FA 3V81A 2AJ2A 1RAHB 3EZOA 3QJJA 2HPUA 5HROB 1RE1B 3R5CA 1YSJA 2I0XA 4DWIA 1RTHA 3EVMA 3M9MB 2DNZA 4PQAA 4ZPVR 4U8YA 3CC4S 4JI4J 3HO1A 1SXLA 3X1LB 1QSLA 1XMOF 4WXWA 4LSLA 1U6ZA 1RTJB 1UP1A 2BZ2A 3E8OA 1NSKL 2C1EB 3C8YA 3MEDA 4X4TA 1YJWS 3D6FB 1HR0J 1NZ8A 3CW2C 3FJ2A 5BR8J 2NUHA 3G6YA 1RTDA 4RL1A 4C0BA 3TAPA 3M9NB 3HHLD 4CTAA 1HBUA 3PFEA 2HHTA 2F3JA 2HHQA 3NY0A 3ZTRA 3TX0A 2A6MA 1IBMJ 2KL8A 1WEXA 3NXZA 1R8PA 3DI6A 4Q7AA 1N5YA 4C11B 1H2UX 4X4QA 4USIA 5J1EA 3VCDA 4DX7A 2CQBA 4FS2A 1TTHB 4IFVB 4J91A 4F2SA 3MM5A 3CCQS 3H8YA 3JQJA 4DPOA 4TKTA 5DZ7A 1XEZA 2XS5A 2J9EA 4EYIB 3LQVA 3MMJA 3EXCX 3QNWB 4ID5A 1WTFA 1WHXA 2HFSA 3DGVA 2K1RA 1RQ0A 1KR4A 2YNIA 3JSMA 2ROEA 3C15A 2XSJA 2ZVSA 5BYRA 3S8SA 3QT6A 4UOCA 2MZJA 1EAYC 4C8MA 4G1QB 2FD2A 3GIMA 3G8TA 2DD8S 4EFAC 2CQIA 2RT3A 3CCSS 2RMLA 4D3GA 1DAXA 2I6WA 2DHSA 1TL1A 1JLAA 3K5LA 4OX9J 2JZ5A 2F65A 1GT8A 3G86A 5I3UA 3QIDA 2QRRA 2E7VA 4NXMF 2NXUA 4MIAA 1YJUA 3I56S 3TAQA 1NK4A 3KUEA 2JLGA 3NBPA 2C2OB 1P1LA 5D8HB 1M5SA 2K2PA 2HMIB 3UNYA 4PXEA 5E3QA 2YKNA 1E6YB 2HG4A 2FLOA 3D6MB 3MM9A 1BQXA 5F8NA 1RHKB 1DURA 2XGQA 1WC3A 3OUYB 4EBEA 2NLWA 1SC6A 1U02A 2KG0A 1M1KT 2OSQA 3S1TA 4OL8A 2IFXA 4P7VA 2N3LA 2HRUA 1SH3A 2F4VF 3LGNA 2MDAA 4DX8H 4O3RA 4R0EA 2XMUA 1X5TA 2HS4A 2PI4A 3TUIC 2YWWA 2PDAA 2AX1A 1JLFB 3H4DA 2DH9A 5G4DA 3IR7B 2HQGA 3Q0AA 1X8DA 2QN6B 5DDQC 4ZVFA 1RT6B 1VQ9S 1TFYA 4DV3J 1WC0A 4IG0A 3G4SS 2YPZA 4WP9A 3DLBA 2DB1A 2VG6A 3KTQA 1TKTB 5CD4A 2M8DB 1NUEA 2V2VA 3POTB 3ISZA 2KJWA 2K3IA 1N5QA 2CJBA 4WZMA 3PW2A 4WFBQ 2IPOB 4HTIA 1NSQA 3T41A 5EN1A 3SSRA 1T9YA 2FLPA 1MG7A 4CO1A 4QYRA 1JLGB 1RA7A 1S59A 3GV7B 4K5RA 2LEPA 1WI8A 3GIJA 4HHHA 4OV6A 2KKHA 1NJZA 2VOOA 1JXVA 1WOOA 2ZH5A 5A8RB 3TJ9A 4P2FA 3WX4A 2F7VA 1Y00A 1D9FA 1HQUB 3IBCB 4G1IA 4C4WA 5L1IA 3G8SA 1NEEA 3IA0A 4AL5A 2H9ZA 2LDIA 2ASDA 4MJKA 4IKAA 3BKFA 1IR0A 3D1HA 4DJBA 2AU0A 4O4GA 3BN4A 2DRBA 2ZFHA 5A2QY 3A1YG 4DR7F 2V68A 5KFLA 4BS2A 1XNQF 3ET6A 3TR5A 2KI2A 3G71S 2B4VA 1WACA 4M5LA 2V9KA 4DFMA 1UWAA 5E3AA 3M32A 1K8AT 2BJ9A 1KRPA 2ZBQA 3J80U 2FJWA 1MU2B 3CJ8A 2YH1A 2ZH7A 3H7HB 5B0FA 4KPCA 4I2PA 3KLIB 1VQ4S 1RLDA 1Q86T 4FNHA 1FNMA 2PC6A 3SI8A 4NYPA 2XLJA 2F9DA 4BHQA 5I3QA 1Q1KA 2NXEA 4WIIA 3PX6A 4ZCLA 3N6NA 4USMA 3W5YA 1YK9A 2PA3A 3QFHA 4ECTA 3BR9A 2MSTA 4E2FB 1G7CB 3OXLA 4TYBA 1ZZNA 1U8SA 2BX6A 2WSEC 2VQFF 1WC6A 1HW9A 2LU2A 1OMSA 1Z2LA 1B7YB 4PWDA 3D6TB 3BS9A 3TOQA 2V8VA 1TL5A 3BQ1A 2MGZB 2V4JB 2XMAA 2MY7A 1N34F 4C3LA 2P9GA 2CJQA 1CJTA 2IVYA 3K5MA 1OYEA 4QWDA 5LOQA 3O6QA 1PIEA 4C8YA 3RUBL 2DNNA 2KVIA 2QG9B 1HNXF 2G4BA 2ZDPA 3MEEA 3VALA 3LP0B 1P8GA 4JYAF 5ETOA 4QQBA 2R2TA 4KSEB 1PJ6A 4OHWA 5HLFB 1SJQA 4M5KA 1RTIA 5HANA 4DF8A 4MIBA 3FQKA 1X4CA 3G82B 5KFVA 3MDFA 1CULB 3UDEA 1YX2A 4MMOA 3H5SA 4F0KA 5F41A 3ZZPA 1ICEB 2KDOA 1Y9OA 5HBMB 3I31A 2Q1LA 1NDCA 3L95X 1KKHA 2VQEJ 3PNIA 4GKJJ 3TQEA 1IM4A 5J1NA 5HO4A 2FJXA 3DRRB 3DLKA 1GNKA 2G13A 1IKVA 2R2RA 1KOOA 2YX1A 3J7YU 4JI2J 4CH7A 3QGIA 5KT2A 3TI0A 1MNEA 4KHPF 2A6OA 4Y34A 4ZKAA 4MH8A 3CT9A 5AJ3J 2E9TA 1NH7A 2WVFA 3PYFA 3N79A 1RKIA 1OWXA 1M5PC 1L3KA 1RTJA 1XN9A 4IYQA 4MKYA 2Q43A 1KSPA 4LT6A 1BHNA 3DOLB 4GVBB 1U7LA 3N4WA 3AHPA 3RW7A 3ZZUA 5IC4B 4X4UA 2O67A 2G2OA 1Z2ZA 2E5JA 4W92B 3C66A 1ZTTA 4H4OB 1QD1A 2FC8A 4PG5A 2VDHA 1V9OA 1RAGB 1Y7PA 3MD3A 4QCLA 1X9SA 1GMUA 2MQ8A 4ZVPB 2MZ1A 3MUVP 4ZVSB 2ZHAA 1VBYA 3VWSA 4LIRA 5LJ5Y 1SKRA 2I5JA 5IWAF 3W61A 3GTYX 2XY6A 1X60A 2UUTA 4C11A 3DLLQ 2MKKA 4C2MA 2CNKB 2L9WA 5KG5A 1JLEA 3H0PA 3CCUS 3MPDA 2Y9HA 3J7YI 4FBTA 1HWUA 3QO9B 9ATCB 5I42A 4F3MA 4DR2F 1UVIA 2IC3B 3W8PA 4ZVEA 4LFCF 4AXJA 3R6GB 5D4NA 3JYTA 2HVZA 4ZOSA 3TNVA 4A8WA 2BRLA 2H5JB 4NEZA 5CZVA 1NLKL 4Y2IA 3OSNA 1B7FA 4J9KA 4YMEA 4G1QA 4PXCA 3C3LA 2VPXB 4KGVB 3SFUA 3QT7A 1SPBP 4O4RA 2ZH6A 3LPYA 1C0UB 5L9XA 4NCGB 3T1YF 4X2BA 1C1CB 1U26A 2QC3A 1RT5A 1M0SA 1UFKA 4DDFA 1WG1A 2QZ8A 2Y1RI 4MYUA 2RRAA 2D3OR 1SV5B 4L76A 2MLYA 2CG8A 4NLPA 1IKXA 1YBTA 4NRUA 3AODA 4ED0A 5J2PA 3P3DA 2IA6A 1WTBA 4N8OA 1E6YA 3F44A 2ZZMA 5IV3A 1RSCA 2UV8G 4O3PA 4RW7A 1RBAA 2Z30B 3T19A 4WWSA 1TUVA 4QIVA 3PY8A 2ZJQQ 3OUYA 2O66A 4KH1B 2IBOA 2CG4A 1F6TA 2NZCA 2EFGA 2XZTB 4H4KA 4OJHA 2FJVA 4CM2A 2XCPA 3BEGB 4M5MA 4OYOA 1FKOB 2KO1A 3CJSA 3O44A 3CXCR 1DQAA 2MKCA 4MYTA 3OL6A 3W5XA 2OSRA 4BWJA 3IS9A 1QY7A 5A6WA 4RZRA 3I32A 3MECB 2FVCA 3TEGA 4EEYA 1H7WA 2UU9J 3HKWA 1JLFA 4CLTA 4I6AA 1KVIA 4KJIA 5BJRA 3JXOA 5B0GA 2P9CA 4YB6A 3HSJA 5ETKA 5LSLA 2BJ1A 4USWA 4XIUA 2H5EA 2RNEA 4AXIA 2IHR1 3GYNA 1TKTA 1G3OA 1RU2A 2CPIA 3POTA 4ZPAA 5F8JA 2IY5B 1FTRA 4ZCKA 1WNEA 1HNVB 2UUWA 1NPKA 1U1LA 2GVZA 4M5JA 2VF3A 4WCEQ 4WTOB 2ZWPA 2CRLA 1JLGA 3TYTA 4RJVA 5U47A 4LFAF 2BJ3A 2PEHA 4TYAA 2ASLA 2Q6CA 3TZZA 1JNZB 4LR7A 3UCUP 2J0QD 3LW5C 5A8RA 2CAJA 3LTOA 3R5AA 1ZH5A 3MCSA 2EC2A 4KRWA 4DG1B 3SQGB 1S99A 2DGSA 4NMXA 1ROFA 4J9UE 4R25A 2EC0A 2DPJA 4NYOA 2VPWB 3PVXA 3KHHA 4K0KF 1WF1A 2CPHA 1UZDA 2WSFC 3MR3A 4LRCA 1KFDA 1XERA 1WSRA 1MU2A 2YWFA 2OPQA 4PAAA 2QO3A 2LEBA 5J2QB 4Y2AA 2ZH1A 3GYGA 1UVNA 1FJEB 3SV3A 4PG6A 1RAAB 2JL9A 2RKIB 1TL3B 1KVKA 1RHQB 3R97A 2HNDB 2XM3A 3DRXA 4L75A 4X4SA 2HIQA 3AH6A 1Q7YT 4DR3F 3SMZA 4JI0J 3DLEB 2EBEA 3VAHA 4Y2CA 4JV5F 3DU5A 4ICLB 1JKHB 1NHUA 4ECXA 5KFRA 4KQZA 2RUGA 2V50A 2MGZA 2YKAA 2V4JA 3OQ2A 1U1RA 1PC4A 1CJVA 3MR7A 1NPRA 1VK8A 5CD4H 2BM1A 3RB3A 1CQNA 4A47A 1HNIA 4I2QB 4EGLA 4IDKB 3Q8QB 1SL0A 5LMUF 2KYXA 3HKZD 1IBLJ 4RR5A 5JMNA 1D1UA 3CC7S 3PXGa 1UTAA 2IJNA 2ZH3A 2E9ZA 1YJTA 3DLGB 4LBPA 2V67A 1F1BB 5T7LB 1LEOA 2QLJB 1Q78A 1EHWA 1K1QA 2HGMA 3LP0A 1VQPS 4KY3A 3J81Y 4ZLPA 2LFVA 5HLFA 2VKRA 4RUBA 4JI6J 4ILRA 2W2MP 4ZS6A 4QIFA 2FHMA 5JJBA 1IBKF 4B3RF 3G82A 3G8QA 1JJCB 3K2YA 4PG7A 4Y3CA 2J7UA 5KFYA 5F8MA 2HGLA 1QAJA 3HHEA 2UUBF 1SH0A 1KHWA 5HBMA 4Z7CA 2BJEA 2R42A 2XLKA 2VODA 3RRHA 2HS3A 4FBUA 1DTQA 1RK8A 1LWEB 4OYZA 5DS7A 5AXNA 4DUTA 3IN5A 1IQZA 4UQGA 4WFXA 3PW0A 2B9XA 2GNKA 1HKAA 2R9LA 4LF7J 2KYZA 2P6TA 4ZP9A 4PXDA 3D0GE 8AT1B 5EX3A 1AZSB 5LXRA 2IM2A 3HSZA 2OHDA 4ECQA 1HYSA 3BZQA 4B9MA 2J9DE 3DOLA 3Q2SC 4DSIA 4NCBA 1ZOTA 3OPKA 3K57A 2QL9B 3W9HA 2CFXA 3WDOA 2J8AA 4K2JA 2PI5A 1FRKA 4J9OA 4H4OA 1B0VA 2PMZD 2QL5B 4OHVA 2GHWA 3DXSX 1Q82T 2ILYA 8ATCB 1U2RA 1RAFB 4NEYA 3GFHA 1NK9A 2GGPB 3NGTA 2YWGA 1QVGR 4DSLA 1N36J 3ZTSA 4F02A 3FBBA 2CQPA 3GIKA 4YQWA 3HX9A 3HFKA 5LSRA 3D5MA 2JLEA 3UN3A 1SI9A 3ICLA 5AT1B 1O5JA 1WF0A 4OI0A 1S48A 1WG4A 3H40A 2D9PA 1FXRA 4IOBA 4I6WA 2DITA 3DRPB 4QYZK 1F5CA 3FCVA 2OPRA 3BSNA 3V6HA 4OJ3A 2JC0A 3MURP 2AT1B 3M8ZA 2G1HA 2E7XA 4PABA 5ETNA 3W1YC 3VGVA 1S9EB 4XPEA 1HLWA 4ECUA 3HPOA 1YLXA 1NDKA 3Q8RB 3JAMY 4I69A 4BC7A 4AYBD 3DC2A 1HD1A 3D6HB 4NCGA 1HNZF 3AOBA 2DGTA 1C1CA 1F60B 2C2NA 2MKJA 2QE5A 5M2UA 2YQ1A 4DR1F 4U7UD 1PJ7A 2OMOA 5F3TA 2BACA 5KFDA 2D3O1 4XO0A 1X0PA 4UZBA 1VK3A 2B6AB 2W9CB 4UZCA 4NASA 2XNQA 4O3NA 1S0MA 2XO6A 3D9BA 3QSIA 3OL9A 1UETA 1EJ7L 1HIYA 4DR6J 5A0YB 2BUNA 2N7CA 4QBUA 4C8LA 4IR9A 4LF5J 4WFYA 3EZ5A 4J7CA 2YVSA 4A46A 2KTQA 3PR4A 4LF4F 3Q89A 1PJ5A 2J0SD 1FESA 2HHXA 1FKOA 2H4WB 2GCFA 3UE2A 3VQSA 5J2MB 5KAKA 3JQKA 4C3KA 1ZA2B 3FK4A 2HVEA 1OPIA 1D8YA 5GAEU 2QLWA 4XK8C 1SUQB 3A8IA 3MECA 2GS8A 2MQNA 1V3ZA 3CJ4A 2H5IB 1NB7A 1EB0A 5G0RB 2KJVA 1CSJA 3PRDA 1LQ9A 3A3NB 1GX5A 2Y8YA 1I6JA 1V3SA 1TKXB 4C3MA 4NZ7A 4ZPDA 4J9RA 2NPIA 4B9SA 3F41A 4N77A 3EGVA 2VJVA 2C3OA 4ES3A 4WE1A 2L08A 2OPPB 2Z2LA 1LWCB 2HZVA 2QSFA 1HA1A 2KB2A 3PHEA 2MXYA 4JI3J 2QL7B 5B0CA 2D74B 1HNVA 4B9NA 1UPPA 3OJUA 4GMKA 1Y3JA 3VAGA 2XS7A 1HQEB 4OJGA 3LF0A 3RJMB 2M9KA 4X66J 1EETA 3CJ5A 2R7OA 1T8EA 3O1LA 7AT1B 4YP3A 4K4XA 3ZZTA 2X1FA 3BJYA 2NXJA 1KVJA 2DHAA 4USJC 3W7BA 3M8QB 2CADA 1HNWF 4QW8A 1NK7A 2DIVA 3BGLA 2R7WA 3IC1A 3CJ2A 1W7WA 5GAEI 2WVEA 1BGXT 4DG1A 2G9OA 5J2NB 4DPXA 4U6PA 3OFGA 2RU3A 3H20A 2CDRB 1DZ5A 2CYYA 1L3TA 2HZCA 4LF8F 3C6UB 5F0WA 3D3BJ 3EX7B 4NX9A 1VRUB 4E98A 4OYXA 4FXVA 4Q5VA 3CCMS 4FYVB 2CPFA 4XPCA 2AF6A 1WG5A 3NGKA 1AXQA 2I8EA 3W5ZA 1FWKA 2KT2A 2DR8A 4RU9A 4ED6A 3DDKA 5ETRA 4A8FA 5GMKa 3C14A 3R1HA 3OL7A 2R7UA 2G2ZA 4M5GA 4KGMA 4DN9A 2OGUA 3CMQA 1V5VA 2F5GA 1Q5VA 2GIQA 3R1LA 3AT1B 3IRWP 2HS0A 1T94A 3EZUA 2RQ4A 2GMLA 2RKIA 3BPDA 3BREA 2WONB 1CPZA 3KHLA 4Q45A 1XNRJ 2IDLA 2RAQA 5LMNJ 2APOA 5IT9Y 2HNDA 4C6AA 1FVQA 2RRBA 4CIOA 1RWOB 3VGUA 2FYXA 2WVBA 2R8JA 5GVQA 5HVGA 3UI3A 3DLEA 3LP2A 1CS4B 5D77A 1OY8A 4ICLA 1JKHA 2AQ4A 4QWCA 5EWEA 1FRIA 3I87A 1UVLA 2HGNA 4FPRA 3HD1A 5KFTA 2PIIA 4YR3A 1FWLA 2NYHA 2X7IA 2WK4A 5IXUA 2HVHA 2AEFA 1UZHA 4CT9A 4KPYA 4OLOA 1N6QA 3ITHA 4X65F 3FSYA 4Y65A 3OTOJ 5HK4A 1VQ8S 2XS2A 3N5FA 1SJRA 2GJIA 3FCWA 2VOPA 1XC9A 3U27A 2F40A 3DMJA 1S79A 3DLGA 4B3TF 3AB4B 3TZWA 3KLHB 1BQMB 1HW8A 1FI4A 4QWBA 5L1KA 1WDDA 2YKMB 3GG1A 4CLFA 1KN6A 3C19A 1KC8T 4MKBA 2OUGA 1M1GA 1N8RT 4IR1A 1FFWB 2ZJPQ 3TZYA 5IS2A 5E7OB 4K4UA 2DR7A 4DSKA 5KFWA 2HWTA 2H51B 1EKRA 2ZH8A 5A76A 4DMZA 1SBRA 3HZGA 2IYGA 2Q66A 3W2VB 4DV1J 1FDBA 1FX2A 1UFWA 3JS9A 2PFFB 4FN5A 3DOMA 3BSOA 4F26A 2B5JB 3NGDA 1NZAA 2DPIA 4P74A 2IAJB 3DRYA 2YTCA 3I5AA 1R0CB 4AL6A 4YN3B 1K0TA 3MR6A 3MOZA 4GKKJ 2HHHJ 4B3SF 3QZ8A 4LREA 2EXUA 2DNYA 3EUNA 2IA0A 1U45A 4N56A 2IMWP 2VPYB 2BRKA 2ATLA 1FRMA 3QLHB 4WU3A 2FTRA 6FDRA 4YY3J 2DHGA 1D8ZA 1BMQB 3MWBA 5DQGA 1RT3B 2CIMA 2RF2B 3PJXA 2HBRB 3MPVA 3HLUA 2WTFA 3W2WA 2OPSB 1X4AA 4YHHJ 1BWVA 1OO0B 4QWAA 1SH2A 3OW2R 3CCLS 1ELOA 3QFWA 4ES2A 2MSSA 3MR2A 3GLJA 3JQMA 3LOUA 4V19J 3DOKB 3U1MA 1O6XA 2GGPA 4EO6A 3FZBA 1OSCA 1CJUB 3LGMA 4B9TA 1CLFA 1JJ4A 2HURA 2G2YA 2B4UA 1N0UA 2DNOA 3BGOP 1VYAA 2M0GB 4USVA 2IJRA 1XIQA 1JLQB 2CWKA 4DUYJ 3DRPA 4NXNF 2HFVA 4DXLA 1UEKA 2E5LF 3M2VB 2HVDA 2OJ3A 1AFIA 4B3MJ 3NGUA 4EYHB 1U1OA 2OLWA 1Y5LB 4L6V3 5L1LA 4CM0A 4XDDA 3UVJB 1I3OB 1S9EA 3W62A 1FX4A 2MZRA 2N82B 1N32J 2LVWA 1TKDA 2ZBCA 4FDFA 5F8GA 2HLTA 4KHMA 1ZM4A 4UT4A 2YQ3A 2HHPA 4NLSA 1XQIA 4LF9J 3G6ES 2HNYB 2Y0BB 3DFEA 2B6AA 2W9CA 2FHOB 4ECZA 3R9LA 4F4YA 3I9ZA 5KFAA 4O3SA 3BO4A 2AV5A 3AFGA 2HAFA 4P10A 5CQGA 3MTJA 2XWYA 1T03B 2QYGA 1UVJA 2BXJA 2A10A 2Q6BA 5SUHA 4N41A 4K4YA 1YITS 3CDAA 4Y2MA 1BQNA 1UJ5A 5ITHA 2A18A 1S0OA 1RAIB 2NXCA 3ELHA 4K4SA 4RBVA 1Y0HA 2W2PP 3CDUA 5ETMA 5AXLA 2UXDJ 5J2MA 2AGPA 2JVRA 1A0OB 4B17A 3CB4A 1X5OA 2DHHA 2AP6A 2GQQA 3CCRS 4LQ3A 1V6HA 4JBCA 2KVQE 4PKDB 2VH7A 1X9WA 4N8NA 2R2UA 3KDOA 3VGSA 2EW9A 4EZ9A 5KFQA 4P9SA 3I4PA 3FMWA 2UXBJ 2GHVC 5G0RA 5B7WA 4K59A 4JI1F 3N9UC 3V4MA 4LRDA 1IXKA 5T14A 1J27A 4P71A 1SIZA 2KXHA 3DXBA 2VA3A 3QMQA 3SCJE 4QU6A 3ZFVA 3FBCA 2N4CA 4YB7A 2OAUA 3RR7A 2YXLA 1Y3KA 1UW9A 3T1HF 1LWCA 3CCWA 1M5VC 2BYCA 4OI1A 1F3FA 3RR8A 2WBRA 2LEAA 3ZZRA 2LXIA 2W7PA 4R8UB 2DT9A 5H9EJ 3BGUA 4DV5F 4USKA 4UY85 4DV7F 1ZAVA 4B3OB 3M8PB 2RB7A 4N7TA 2RE1A 2OTLS 2C42A 3HI9A 1TKZB 4URGA 1GMWD 1ZM2A 3TAMB 2DH8A 4ZHRB 3R2CJ 1FRLA 3HSDA 5JUMA 4L73A 2KXFA 3MHYA 1XTZA 3M8QA 4G6VB 4KE5A 3PX0A 3HD2A 3GJTB 4ZVUB 5KT5A 5J2NA 4DEZA 4RNOA 4ZIVA 3DU6A 1FK9B 3MM6B 5D4OA 4JI8F 2KFYA 4I7FB 3TP2A 1F2GA 1VRUA 3TRGA 1XMOJ 2CJKA 2ZC4A 4FVMA 4NYZA 2ZD1A 4PYDA 4WP3A 5ETSA 1VQMS 2GW8A 3MAAB 4F3QA 4HKQA 1LKZA 3AJDA 1KFSA 3O5TB 4FYWB 4YDDB 3AQPA 4R5PB 4K5SA 3IG1A 1ZZFA 5DLGA 4FVCA 3DLHA 3K5OA 4GRSA 2DGXA 3RB0A 3IM9A 2AYMA 3EWGA 2X1AA 3EICA 1N48A 3KHRA 1RGVA 3QWPA 2RUSA 4TY8A 4U7CA 3HMJG 3IAM9 3UCZP 1NK0A 5KT6A 4NA3A 5LL6d 2ROPA 2FVQA 2E5IA 3LAMA 2ZM6F 2WONA 3JSBA 1Y4ZB 3R5BA 3G2XA 1YDLA 1YJ7A 2G1DA 2QSWA 2P2CB 4C8OA 1FJCA 1AFJA 1U2CA 3GZ7A 1KBRA 1A7GE 1X31C 2O01C 4AE5A 5HVFA 2B51A 2ZOMA 2HFUA 1EP4B 3HVWA 4Q0BB 2OFGX 1A6LA 1CS4A 3MM8A 3PW4A 3HVTB 1C1BA 2BKPA 5LXYA 3ENQA 1VBKA 1TP7A 3R8YA 3ZO7A 3RW6A 1RAOA 1IR2A 4EMDA 1NKBA 4X64J 3FBEA 1MROB 4RW9A 1IJEB 2QMUB 3KLFB 1GXTA 2FDNA 2CVEA 1WC1A 3HK2A 5D6GA 2XC9A 4CO3A 4ZLNA 3KLHA 4KHRA 3D66A 2MPUA 2YKMA 4J9QA 2DY1A 3HDSA 2IBKA 3OD2A 2OEMA 3HM9A 1T3OA 3TJ8A 4KH0B 2A1BA 3IRXB 3VQTA 2KHDA 4C48A 4ZVQB 1FJGF 1JXLA 4NXMJ 1YZ7A 5DGBA 3J7ZT 3UFCX 1HBMB 2CJXB 5LM7E 4IFYB 1H72C 5ETPA 1KQGB 4M5HA 5A2QU 2B9EA 2JX2A 3QRQA 9RUBA 3J7Z5 5GAGU 4NZ0A 2IAJA 1U1QA 4FYYB 4CLLA 4P7TA 4NLYA 3NS5A 4IUFA 3KJQB 4CNYA 1RU1A 4LBHA 1L5UA 2IRXA 4MKAA 3E01B 3QIPA 4P2XA 4A48A 4NCAA 5DLFA 3KJFB 2W2OP 5FDLB 4UQTA 2F4VJ 1SQGA 3QLHA 4TLQA 4K50A 4H4KC 1C4CA 5KFJA 4M5DB 4K4VA 1RT3A 5HJYA 2D9OA 3A12A 4DLGA 2HLUA 2RF2A 1FE0A 4YOEA 4MFBB 1BLUA 2HQCA 1XR6A 4C8ZA 5H9FK 1REVB 2GC8A 3KDNA 3HF5A 2JSXA 2GA7A 1U0SA 3ENAA 3V6KA 3QAUA 3ULHA 2ZDOA 5KFHA 3TVZA 4ECRA 5HP1A 2HVIA 2QLBB 4ZVHA 3HVRA 2DR5A 3CMES 3MM7A 1M5OC 1K9MT 1CJUA 2KM8B 1VMBA 2RRNA 2GQ2A 2HZAA 2MKYA 3HULA 5GAGI 4KYZA 2FHJA 1T05B 3GV8B 1RAEB 3D1QA 3KG0A 4WIQA 4URSA 3RRKA 1N33F 3PKYA 2OEKA 2KXNB 4CWBA 3GFYA 3PM9A 3LUYA 4PQUA 3D7SB 2VD3A 3M2VA 1AUSL 2VA2A 3T3FA 3EPGA 2HNZB 2Z4PA 3THTA 2QGFB 1RXOB 5IQ6A 5FLXY 3UR0A 2ZBRA 4Z2XA 2EFVA 5I3PA 4NLGA 3VHQA 4FNIA 2UP1A 4X62F 1P6TA 4IOAQ 1FTCA 2L48A 5C25B 3EXYA 4OMFG 2BR0A 3RB6A 4DR7J 4DQIA 1Y5IB 4ED1A 3SSQA 1XNQJ 1S6PB 2X1BA 4OJ1A 3D0IE 1MWQA 3RAMA 1IKYB 1ZPWX 1QUVA 2FLNA 3THVA 4OYBA 3FZ2A 2UVUA 4OLPA 1EIYB 5DM6Q 3V2UC 3CD0A 3M2UB 2VHGA 2Y1LB 3PRVA 3EDRB 3FRZA 1T03A 1UL3A 2M3DA 3US5A 1KLNA 1FA0A 1VISA 2W01A 4Q44A 3C16A 4OFZA 3MR5A 1S1TB 4J9MA 1C0TB 4RNMA 2CJAA 2F8HA 1Z4UA 2DNMA 3PHTA 3U1NA 3JTOA 1X4BA 3T6BA 2ATCB 3UDCA 2VQFJ 2ALYB 1TK8A 4HTJA 1K1SA 1RP5A 4FF3A 3CTRA 4NZ6A 4G65A 2IYIA 1IBCB 3OJSA 4USHA 2GMJA 4ECVA 1N34J 3CE8A 2EG1A 4Q8FA 2DH7A 3CO0P 3B78A 1F0XA 3EJMA 3OFFA 4DF4A 2VPZB 5ETVA 1NSPA 4HL9A 4MAKA 4ED2A 1HNXJ 1AW0A 2JDJA 4ZPTR 3PRBA 3NS7B 3V5RA 1VRTA 4ANEA 2B43A 4ZJQA 3MF5A 4RPFA 2Z2MA 4Y0FA 4JYAJ 2XNRA 5AXKA 2QLFB 1KONA 4KFBB 1TK0A 1QTMA 1SC3B 4OZLA 1VBZA 1GXLA 4C8NA 4QIGA 5K8NA 3IR6B 1N54B 3Q23A 1QSYA 3VVTA 1ZM9A 4B3OA 1U24A 3M8PA 3EYZA 2CJ9A 3BQ0A 3Q8VA 2DBBA 2AX0A 2PGCA 5E5NA 4DV6J 1TKZA 1IVZA 4O3OA 4C97A 3I4HX 3M6WA 3MUTP 1VDHA 4ZHRA 5C24A 1TR0A 2JEJA 5KFOA 4JUZA 1MW7A 1WHVA 2V2KA 1CC8A 2COLA 1R8BA 3K7RA 4B9UA 2BE2B 1VC5A 4KHPJ 2QFIA 1SQEA 1YBAA 1IUJA 4LRFA 3PO5A 3MM6A 1S1UB 1WKLA 4I7FA 4OHYA 2A2DA 1R6YA 2M2BA 2WCXA 1SL1A 4NL5A 4PRFA 3WX8A 3T9ZA 1S5ZA 1TV6A 2ZVIA 1PBUA 4A8YA 2WAQD 3THPA 3D68A 3FEXB 4HH1A 4R5PA 1IM6A 1OY6A 4CO0A 3OXFA 4IH5A 2F1FA 1H73A 5CAAA 2NSBA 2J6UA 5FIIA 1J5EJ 1YQHA 4HH0A 2KG1A 3I0RB 4ZDNA 3BYRA 1DTTA 1TL7B 5KTQA 1H74A 1OQ3A 1LW2A 2EEYA 4NLDA 3BSAA 3QRRA 1S7IA 3KYLA 4ZJLA 1DY3A 4CI0B 1HPZB 3P8BB 2CPDA 2IRYA 3SDEB 3WHIA 3KJVB 3GILA 1EP4A 3H2VE 3FMBA 4DR2J 5CYMB 2I38A 4K8RA 3OVSA 4LFCJ 1I5OB 4ZPBA 1WC5A 1TU0B 3M8RA 4DZDA 7FDRA 3FFIB 1S0NA 2FLLA 3O3LA 4M94A 2V2QA 4I64A 1MWZA 5KG6A 3GSIA 3FSIA 1KDNA 1MROA 4RW6B 3KLFA 3RZAA 2MZSA
chains in the Genus database with same CATH topology
2J9CA 2QIFA 2BQ3A 2R8KA 2ASYA 3H40A 2D9PA 2VG6B 1FXRA 1Q8IA 4IOBA 1OIAA 4I6WA 2DITA 3DRPB 1F5CA 1YWXA 1R8AA 4KKOB 1QSSA 4ES1A 1VBXA 2LYVA 2OPRA 3I0SB 1N88A 5B0DA 3BSNA 3V6HA 5K8OA 4ID8A 4AQYF 4OJ3A 3T5JA 2JC0A 1S1VA 2HFOA 2CQ1A 2J7WA 3MURP 3CEDA 4LF5F 2VB6A 3SCLE 3ZC4A 5E41A 3LP1B 3RBEA 2M8HA 1QUPA 1J5OA 1LK7A 2E7XA 2UVRA 4PUOA 2CPZA 1NK6A 4DV3F 2N3OA 5KFPA 3NMAA 1E6VB 1S9EB 2E5GA 3OR1B 4OHZA 2DNKA 3SEOA 3MD1A 4IH6A 1VQSA 2PMHA 2RQCA 4XPEA 2XBPA 2LXUA 3MPYA 4ECUA 3HPOA 1HBMA 5D4LA 1DARA 2VBWA 4WFZA 1S7HA 3CCJS 4CO2A 4DUYF 3Q8RB 1VQKS 3JAMY 4I69A 3WBZA 4BC7A 1TAUA 1XK8A 4AYBD 2FJBB 3FFIA 1JLBB 1RT1A 1QVFR 3DC2A 2IMOA 1X4DA 3CDWA 1HD1A 1HNZF 4NCGA 5LSOA 2D1CA 4TN2A 4B3MF 2DGTA 3S7RA 3HHNB 2XI3A 4O44B 4NWBA 1C1CA 4DR6F 1F60B 1RDRA 2C3PA 2MKJA 4I56A 2QE5A 3GV5B 5M2UA 1URNA 4DR1F 4F4ZA 3OHAA 1H6KX 5LT5A 2OMOA 2GQCA 2ZOFA 4DL6A 5AE2A 1UWBB 2J9DA 4ITSA 5F3TA 2DNPA 5B0AA 4P2SA 4OQJA 2BACA 5KFDA 4ZCMA 1FJ7A 4XO0A 1X0PA 5IM0A 1VK3A 1ZBTA 2B4OA 2B6AB 2W9CB 1NK8A 5DQIA 1RKJA 2GX8A 1N32F 2LDYA 2WOMB 2V8HA 2XNQA 3M2RB 4O3NA 1S0MA 2CPEA 3AB2B 2AJQA 1B64A 3E01A 1UKUA 1AW0A 2KZZA 3OL9A 1UETA 2ROGA 4C98A 4O4GB 1FHTA 4Y6IA 2EPIA 2OTJS 5A0YB 2MZTA 4Y00A 3DDNA 1DFDA 3HHLB 4JV1A 3DM2B 2QV6A 2BUNA 2N7CA 4QBUA 2R7VA 1H2TZ 2CPJA 2JFDA 1H2VZ 4C8LA 4IR9A 2BW2A 1VIXA 1S49A 3SYZA 4FF2A 1JWWA 4WFYA 4RWXA 1KQSR 3EZ5A 3VAKA 3N01A 2E29A 4CQ1A 2D3ZA 1LFPA 2W25A 3NAHA 4A8MP 1S9FA 2YVSA 2EKYA 4RWWA 4A46A 4DSEA 2AJFE 3M32B 2VBZA 3QGGA 2C2EA 5FJ4A 2KTQA 3PR4A 4LF4F 3GQCA 2FC9A 2DVIA 2LMIA 4WE1B 3IWNC 4WXOA 5LJ3Y 1VC0A 3H98A 4NLXA 3MXHP 2XMMA 2J0SD 1Q81T 1FO1A 1RT2B 2DJWA 2F9JA 2RSQA 3GB0A 2OO4A 3IR5B 4RW4A 4O44A 1FESA 2HHXA 3CCVS 4HHJA 1FKOA 3BO2A 2GCFA 5KFNA 3NL0A 3UE2A 2M4MA 3VQSA 5J2MB 1REVA 3GSDA 1UA0A 5KAKA 2I9SA 1NRKA 5CYJA 1JK9B 5DDPC 4C3KA 1V3RA 4QYZJ 1RT4B 1OPIA 3D28A 4I6YA 4X4NA 4AL7A 2LXFA 4DSJA 1D8YA 4KO0B 3QPIA 1R8CA 1SB6A 3BDEA 1Q7LB 1TQLA 5GAEU 1HWIA 2YKPA 1PO6A 2QLWA 3M2RA 4EU0A 4XK8C 1S97A 4RNNA 3C6TA 3N28A 1SUQB 1EETB 1O0PA 2ZH9A 3MECA 2KM8C 2MQNA 3PACA 2VBXA 2X51A 4MK8A 1V3ZA 2OH2A 3UR3C 3CJ4A 1S6QB 1QE1A 5EX0A 5L9NA 5F9LA 1FKAF 2J6SA 1HMVB 1NB7A 4RBUA 1SIWB 5G0RB 2KJVA 1CSJA 3PRDA 3QAEA 1S1WB 1LQ9A 5A0YA 1FXLA 3HHLA 3FNNA 1GX5A 1VGYA 4OZ1A 1I6JA 2W4PA 4C0HA 1R43A 1TKXB 1V3SA 4C3MA 1FEHA 5A8WB 4NZ7A 2LA4A 4ZPDA 2UXDF 2XB2D 2VZ9A 3KK2B 5DRKA 4J9RA 2NPIA 5F8HA 1PILA 3AA8A 2R8HA 4W90B 4B9SA 3F41A 3VZIA 4N77A 3BGRA 5BYSA 2C3OA 5SZTA 4QWEA 4NLRA 3NWGA 4J37A 2MYFA 4J9SA 2NPFA 3CJ0A 4RNFA 1QLNA 4ES3A 5CZXA 3B82A 3NNAA 4WE1A 2L08A 4DHVA 2OPPB 3Q2TC 3P49B 2Z2LA 1RT2A 4U7UK 5L39A 2UXBF 3UQSA 3N5BA 2LA6A 3IGNA 1LWCB 3SXLA 2QSFA 1HA1A 5H9FJ 2KB2A 4PPDA 3PIPQ 3PHEA 2MXYA 3UWTA 4V19X 3OBIA 2YY3A 2C3MA 2YNGB 2J7KA 4R0JA 5HI7A 5K14B 5B0CA 2C28A 4TY9A 2OIHA 1IJFB 2D74B 1HNVA 2RVJA 4NLWA 4B9NA 2RQMA 3SCKE 2E1RA 1IQTA 3OJUA 1U6FA 4GMKA 4OV1A 1Y3JA 4KO0A 4LVNP 3VAGA 1FKPA 3WZ0A 1IKWB 4B02A 2XS7A 2PO4A 1W25A 1HQEB 1ZM3A 2WB4A 3NRBA 3LF0A 4OJGA 2M9KA 2ZZNA 1HHSA 4HLBA 1RYSA 4OI4A 5CCMA 1SUQA 1EETA 1U09A 1DLOA 2GMHA 3BM7A 5KFXA 5KG2A 2KRRA 1VC6A 2FVRA 3CJ5A 5KFEA 3VAFA 3DCAA 1YTYA 1S6QA 2IM1A 2K8GA 2M70A 2R7OA 4KIAA 1VLYA 2DO0A 4K2XA 1T8EA 3O1LA 1S1WA 1VJWA 3I82A 4PR6A 2BANA 5C25A 3P96A 4YP3A 4GC6A 4K4XA 3ZZTA 3MOJB 2X1FA 4WKRA 1U25A 3UNGC 1SKWA 2B9YA 4U67Q 3BJYA 1TKXA 1RTIB 4X4PA 3PW5A 4JI5F 4FF1A 1KVJA 2JLFA 1LFWA 2DHAA 4USJC 3W7BA 2VC1A 3CPWR 1RJJA 3M8QB 3KK2A 2UUCF 2RH3A 1T3NA 3KK1A 2J5AA 2OKQA 2XY7A 1HNWF 4NLUA 4A4JA 3TVYA 1S6PA 4F67A 1VQ6S 4WK1A 4QW8A 3G6XA 1NK7A 2DIVA 3S01A 3BGLA 2QA1A 4MIWA 5KFGA 2DGUA 2R7WA 4GC7A 3V6JA 3TARA 4X4RA 3IC1A 4GO5X 3ZZYA 3CJ2A 3KLVA 5GAEI 3OR2B 2EI5A 2OPPA 1BGXT 4DG1A 2G9OA 4KV8A 5J2NB 4U6PA 3L3CA 2GJ2A 3PZPA 3K0JA 2UVVA 4NLVA 3OFGA 2RU3A 1NO8A 1RT7B 2FJEB 2NS1B 4H54A 4IH7A 1IKYA 3H20A 4DBQA 1DZ5A 2CYYA 1L3TA 3Q8SB 2HZCA 4EBCA 1W2IA 4LF8F 3C6UB 5F0WA 1KEKA 4DL5A 1GXUA 3ETOA 1O51A 4Q2LA 3EX7B 4NX9A 1VRUB 4E98A 4DV2F 4YEAA 4DS5A 2E1CA 5EUHA 4FXVA 1GAOA 3CGIA 3DLKB 4Q5VA 1IKVB 3N6LA 3H4BA 5K9FA 2V4QA 3CCMS 4A8SA 3TANA 3M2UA 4PCQA 1IKWA 3V81A 3LAKA 1HQEA 4ILMA 2CPFA 1HBUB 4XPCA 2HQ3A 2AF6A 3Q22A 3QJJA 1WG5A 2HPUA 4ZPWR 3NGKA 5HROB 1AXQA 3R5CA 2I8EA 4G3IA 1SJ3P 1YSJA 2I0XA 3LP2B 1OQ6A 4DWIA 2MKHA 1RTHA 3TA0A 2KT2A 5E33A 2MKIA 3EPIA 2DR8A 4RU9A 4ED6A 2IVMA 2D3UA 4OIXA 5T41A 3M9MB 3DDKA 2VQEF 2DNZA 2UV8A 4PQAA 2W8KA 4ZPVR 1XMQF 2Z8QA 4A8FA 2C3UA 5GMKa 4LVOP 3CC4S 4GKJF 3OL8A 3R1HA 1C0TA 1N5YB 3J7Z5 3OL7A 1OSDA 2R7UA 3LALA 3HO1A 3GR1A 1S76D 2VONA 1SXLA 4KGMA 4DN9A 3X1LB 3M05A 3MFHA 5LMNF 1XMOF 2O1PA 1Q79A 1QSLA 2DNRA 2JEFA 1UFLA 4WXWA 4LSLA 1U6ZA 1RTJB 1UP1A 2LKZA 2BZ2A 3KNGA 4JI2F 3E8OA 4ZCIA 2GIQA 1X7VA 2B56A 3R1LA 1N6QB 4KR0B 3VAMA 3ITHB 1URRA 3KKFA 2ACYA 5DDRC 3IRWP 2HS0A 3C8YA 3MEDA 1T94A 5KT3A 3EZUA 2OFHX 4X4TA 1YJWS 2RQ4A 4QR0A 2GMLA 3CD5A 4J9PA 2DIUA 3QWUA 2RKIA 4RLEA 3DMJB 3BREA 2WONB 2NSCA 1CPZA 3KHLA 3C6UA 2QLXA 4Q45A 3FJ2A 1M90T 5FD1A 4KB7A 5AJ3F 2NUHA 4LQ9A 3G6YA 5HMZA 1RTDA 4K4WA 2R4FA 3J80Y 2APOA 3E51A 4C0BA 5KOXA 4F2RA 3TAPA 5IT9Y 2HNDA 3M9NB 3T5HA 1FVQA 2RRBA 3ONQA 4CIOA 4ATNA 2J6TA 3HHLD 4CTAA 1HBUA 3PFEA 1SKSA 2R8JA 4LMZA 5GVQA 2YNIB 4EO8A 3K5NA 3F56A 1S6OA 1P27B 3UI3A 4ERDA 3DLEA 5HROA 2F3JA 2HHTA 3TUZC 1BY9A 2HHQA 3LP2A 2M5YA 3TO8A 5D77A 4ICLA 1YRTA 4WYWA 3U1LA 1JKHA 2AQ4A 2VASA 2RS8A 1WEXA 4QWCA 2DNHA 2BABA 2FHKA 2V8DA 2WW8A 5K8PA 1R8PA 3DI6A 5EWEA 1FRIA 4Q7AA 3I87A 1UVLA 1N5YA 2D41A 2HGNA 3AJ2A 4FPRA 3UDLA 4C11B 5C42A 3AAWB 1H2UX 2PIIA 3N6MA 5KFTA 4X4QA 4YR3A 4USIA 1HARA 1TL1B 5J1EA 3VCDA 3RZAA 5DETA 2CQBA 2WK4A 5IXUA 3V4IB 2JC1A 2HVHA 5CYQB 4LFBF 4FS2A 3QGHA 1U47A 3R3TA 4IFVB 4CT9A 4BCAA 4KPYA 4OLOA 4F2SA 3MM5A 3CCQS 1N6QA 1YVFA 3ITHA 5F9NA 3U7JA 3FSYA 4Y65A 5I3UB 3H8YA 4X65F 1VQ8S 2XS2A 1R3NA 3N5FA 1SJRA 2GJIA 4DPOA 4TKTA 2VOPA 1XC9A 2NREA 3MPWA 2B4PA 1XBWA 2P6SA 1XEZA 3U27A 2XS5A 2F40A 2J9EA 3DMJA 2R7RA 1S79A 3IBWA 3DLGA 4EYIB 3CWJA 4B3TF 3LQVA 3AB4B 3KLHB 3MMJA 1BQMB 5F8IA 1HW8A 3EXCX 4QWBA 5L38A 4ID5A 2DHXA 5L1KA 2YKMB 1WTFA 3GG1A 1WHXA 1KN6A 2R8IA 4MKBA 5KG7A 1KC8T 2SXLA 5HQ8A 2M52A 3N0VA 1N8RT 3PFOA 4IR1A 4TU8A 5EWFA 4EUVA 2K1RA 1RQ0A 1KR4A 1P1TA 1S72S 2RILA 2YNIA 3JSMA 2ROEA 2ZJPQ 2K7JA 2XSJA 2ZVSA 5BYRA 3S8SA 4UOCA 5IS2A 5E7OB 2MZJA 2DR7A 4K4UA 1KLMB 3JSRA 1WWHA 4DSKA 5KFWA 2AGQA 2HWTA 4C8MA 4G1QB 1YJ9S 4BDPA 2FD2A 3GIMA 1TAQA 3G8TA 2DD8S 2ZH8A 4ZP6A 4JV2A 4DMZA 1SBRA 1JX4A 3HZGA 1R0AB 3VF0B 2BE2A 2IYGA 3O2IA 2Q66A 3W2VB 4DQSA 1FDBA 4EFAC 2CQIA 2AGOA 1UFWA 2RT3A 3CCSS 2L9NA 2RMLA 4D3GA 2PFFB 4FN5A 3DOMA 1DAXA 2DHSA 1N4LA 1TL1A 3BSOA 2VFVA 1MWYA 1JLAA 3K5LA 2ZHBA 3BDPA 2VG5B 3KK3A 4RU2A 4F26A 3NLCA 1GH8A 2JZ5A 2FGOA 5K5MA 5IT4A 1VQ5S 4IFVA 1GT8A 1HD0A 1LWFB 2B5JB 3NGDA 1NZAA 3G86A 2DPIA 2IAJB 3DRYA 2YTCA 1RAJA 2W9BB 3W2WB 2JJ4D 5I3UA 3I5AA 3QIDA 4AL6A 2QRRA 1K0TA 3MR6A 4NXMF 2CDQA 3MOZA 2NXUA 3ENVA 4MIAA 1YJUA 4B3SF 5B08A 3I56S 4DL3A 2KU7A 3TAQA 3QZ8A 1NK4A 2JLGA 2PSZA 2DNYA 2D7SA 3NBPA 1P1LA 1Q8LA 1KD1T 1BQMA 4WYLA 4OI2A 1T95A