2ROGA

Solution structure of thermus thermophilus hb8 ttha1718 protein in living e. coli cells
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
66
structure length
66
Chain Sequence
MLKLKVEGMTCNHCVMAVTKALKKVPGVEKVEVSLEKGEALVEGTADPKALVQAVEEEGYKAEVLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Heavy metal binding protein
publication title Protein structure determination in living cells by in-cell NMR spectroscopy
pubmed doi rcsb
source organism Thermus thermophilus
total genus 11
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2008-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2rogA00
1YJTA 2AW0A 1K0VA 1MWZA 1ULRA 1FD8A 3FMBA 2K1RA 3HHLB 3KKFA 1TUVA 1FESA 2GV1A 2RILA 2LXFA 4HH1A 1Q4RA 1X8DA 2XMMA 2HIQA 2OMOA 5B0FA 2N7YA 4DN9A 2N4DA 2PD1A 5A6PA 4ZA1A 3BGUA 1KVJA 2QYCA 1VQYA 4Y2MA 2RSQA 1YRXA 2W4DA 3T9NA 3BN7A 2ASYA 3VTIA 4A46A 2ZDOA 1CC7A 2OAUA 2VV5A 3MZIA 3IWLA 2Q3PA 2XMJA 3HF5A 5B0CA 1OQ3A 1AFJA 1TZ0A 4ZOSA 3QGPA 5B0EA 3HX9A 1W2IA 1TL5A 1JK9B 2CRLA 5B0DA 1URRA 1QUPA 4DPOA 4HL9A 2GA7A 1S6UA 2EW9A 2K1RB 3HHLD 2KT3A 1OPZA 1U7LA 4YDXA 5IXUA 2RMLA 3E8OA 4Q2LA 3CJKA 1X0PA 4OJHA 2BJDA 1SI9A 4NL5A 4YEAA 3TRGA 2KT2A 3BM7A 3QMQA 5B0BA 1CPZA 2ACYA 4U9RA 3HDSA 3IWXA 1SQEA 2LQ9A 2BYCA 1FVQA 3KG0A 3DXSX 1N5TA 2QLXA 2W4PA 1FVSA 2GGPB 5B08A 1Y9OA 1APSA 1RJJA 3FGVA 2FB0A 2GGPA 1Y3JA 2AJ1A 2OP5A 4HH0A 1Q8BA 4A48A 2OKQA 4Y2IA 2G9OA 2RU9A 1N5QA 4HI2A 3KNGA 1TL4A 1R6YA 2XMWA 2HLUA 2IYGA 2OFGX 5T7LA 2K7KA 3CJKB 4Y2KA 2GO8A 4DL0C 2OD6A 2W4CA 2ZDPA 1AW0A 1OQ6A 4A4JA 1P6TA 3BDEA 2QIFA 1KQKA 1IUJA 3LO3A 4Q2MA 1S6OA 1YJUA 1MWYA 3BB5A 1KVIA 4EFAC 3WDOA 2HLTA 1YJRA 4OJGA 1Q53A 2BBEA 1X7VA 2FHMA 2LQBA 2IFXA 3DCAA 2ROPA 4OJ3A 1V3ZA 4HI1A 5A6WA 4F67A 5KAKA 2HQIA 1AFIA 2XMTA 2XMKA 3HHLC 2KKHA 2ROEA 3KG1A 3GZ7A 2K7JA 2N4CA 5B09A 5K9FA 1FEEA 3FRYA 1FE0A 3I9ZA 4A47A 5F0UA 2HFNA 4FNIA 3HHLA 1YJVA 2ROGA 4NPOA 2K2PA 2QLWA 3TNVA 3MCSA 2GFFA 5T7LB 1CC8A 1GXUA 3F44A 1P8GA 3LGMA 2PGCA 1Q8LA 3UDCA 2XMUA 2IYIA 3HFKA 1Y0HA 2FTRA 1FE4A 4OIXA 4FNHA 1YG0A 2AJ0A 5B0GA 2XMVA 2LDIA 2FIUA 1LQ9A 1TR0A 2JDJA 2OFHX 2VH7A 2KYZA 3K7RA 2L3MA 1XBWA 3LGNA 3BF4A 2BJEA 5B0AA 3BR8A 4OJ1A 2BUNA 5F0WA 1VQSA 1N5VA 1N5SA 2OD4A 2AP6A 4QOTA 1GXTA 1WD6A 1SB6A 3TOQA 1JWWA 2GCFA 1OSDA 2HFOA 1Y3KA
chains in the Genus database with same CATH superfamily
1N54B 4OI1A 1FRJA 2KZMA 1JQGA 1XERA 3FDSA 1M5HA 1VK3A 3NCRA 4FYXB 1N36J 2IRYA 3RJMB 2M7SA 4ZP6A 2FHJD 3IGVA 2Y0SD 5KG3A 5KT6A 2HWTA 2EBGA 2W9BA 4USKA 1FK9A 1CJTB 1T95A 4QIGA 4RNNA 5KG2A 4ZIVA 2VFUA 1VBZA 4ZVPB 4LRCA 1TL7A 1JLCA 4G1IA 1RTZA 3HKZD 3CCRS 1IBCB 4KE5A 3C6UA 2ZH3A 3GTYX 5BXIA 2HQFA 1I5OB 3KK2B 2GMHA 3M2RA 2DNLA 1RT4B 3N6LA 3FCWA 3MFIA 1R8HA 1T8EA 1M5SA 4NLVA 4DV2F 3JSRA 1D3WA 1X31C 3LGNA 1MN9A 4PKDB 1YTYA 2KXFA 3PVXA 4NMLA 1VQSA 2ZJRQ 1S9FA 1JWWA 3N4WA 4OZ5A 4XPEA 4X62F 3GIJA 3GJTB 1X8DA 1L3UA 2ZJQQ 4JI5F 3MM7A 4LF7J 4YDDB 3MZIA 2PN6A 3QT5A 4FN5A 2CPIA 3PYDA 4WF9Q 1VIOA 3CVKA 3D3BJ 3GSDA 2VIHA 4OI4A 4NL5A 3TRGA 1BQXA 3DYAA 1VQ4S 2BDPA 2DH9A 1Q95G 2GIFA 4K0KF 3AFGA 4DCJB 4QR0A 2R9LA 4N76A 1WI6A 4NASA 4Z7YA 1DURA 3T5JA 3S6EA 3PRBA 4ZCMA 1U09A 5K5MA 5L38A 4K4ZA 3QAEA 4WE1B 4HEA9 5ETVA 4HACB 1LFWA 1PIEA 4RLEA 2UUCJ 3DKDA 2MKYA 1TUWA 1IM6A 3OL8A 3G6YA 3M30B 3THTA 4KH0B 2HPUA 1S49A 2MTLA 3RB4A 2DRDA 2YWFA 2XI3A 3NGRA 1MW7A 2Q3PA 4Z37A 2G1HA 2QO3A 5FD1A 3ISNC 5E3AA 4TU8A 2EEYA 2Y0BB 2MKHA 2CPEA 1SC6A 4OZ2A 2J8AA 5I3PA 2HQDA 2DD8S 1IR2A 1FFGB 2RU9A 2CWXA 2J9EA 3DI6A 2FVCA 3BQ0A 2R8JA 4DL0C 1U1MA 3DU6A 1MWYA 2GAHC 4KQZA 3TWZA 3MEGB 3SZ2A 2KJWA 4CLWA 1WHVA 3CC7S 2BE9B 3DGVA 1XNRF 1IWGA 3ZNJ1 3G6XA 2MHEA 3R6LB 1H2UX 1ELOA 2JLFA 2IRXA 3BS9A 3V6KA 4EO6A 2VQEF 1DJ0A 1IJEB 4DDFA 5IOLA 4MKYA 3TOQA 3QIDA 3FSYA 3H40A 1Q4RA 1NCLA 1JB0C 3ZZTA 3CPWR 3OW2R 1S7HA 5J1PA 2FPHX 1RQ0A 4DR7F 3LTOA 4WFNQ 2I6WA 2P5VA 2Y3YA 2AD9A 4IFVB 2RHSB 2X7IA 1M0SA 3V5RA 2BJ1A 3EGVA 5DDRC 2B9WA 3VAIA 1QVFR 1D0EA 1S4FA 4HACA 3DLBA 1X4AA 4CI0B 4ZP9A 4DU7A 3HT0A 5AXMA 4OJ3A 5LMNJ 4NLDA 2QA4G 1CJKB 3TZXA 4DXLA 4FF4A 1RHMB 1O5JA 4QJVA 5CD4A 3OBIA 3M30A 4PAAA 2QLBB 2C2DA 2YX1A 2YKNB 2RNEA 4WXWA 1OY9A 1S12A 1XBWA 3RB0A 3QO9B 2NXCA 2CQ1A 3VZIA 1RCOB 4IFYA 2UUWA 1BE4A 1WEZA 1Y10A 1S97A 1WKKA 1FXLA 1PJ5A 4QR1A 1TL3B 1QAYA 3OFFA 5GAGI 2GC8A 1U45A 5F8MA 4ED1A 4KO0A 5IXUA 1TFYA 1I1GA 3IN5A 3D1OA 4B9VA 4PXDA 4MMOA 2DNKA 1KQSR 2W4PA 4K4UA 1QSSA 1BLUA 4J9QA 2XY6A 3HHDA 1OSCA 3CJQA 4X4RA 1NK7A 3OR1A 4NOHA 1HMVB 3HCXA 1JXVA 3MPWA 4RJVA 2QGFB 3OL9A 1S1VB 1UEKA 1W7WA 3IBWA 1HLWA 4K4YA 3ELHA 3PX0A 2AJFE 4TVAB 4NLTA 4LBHA 4DSJA 4YB1P 4FXWA 4FNHA 2W2MP 2E9RX 3CCQS 2HVDA 2YVSA 1QVGR 5I42B 3IM9A 5M2UA 2YKOA 3DRSA 5GAEU 1FRIA 2E1AA 3Q8SB 1TUVA 4UOFA 2C3OA 2I8EA 1U0SA 4OYPA 1NK4A 3KLFB 4O3RA 3I9V9 1WG4A 1AFJA 2Y1IA 4LSZB 4TYBA 3EGNA 1X0PA 2BQRA 4NCBA 3WIUA 4OI3A 2JX2A 2OMLA 1XTZA 3QRRA 1CJKA 2B51A 4LF1A 3DDIA 4G1PA 3FCHA 4P74A 2HRTA 1SQFA 1AROP 1S1XB 2W9CB 3C6TA 4DR1F 2WHOA 4NLOA 1D8YA 2ZM6J 2V94A 2YKNA 5GAHI 2M4MA 2QC3A 2R7SA 1QLNA 3N6NA 2XMTA 3QO9A 4L75A 4ZVOB 2FJDB 1RHRB 1UZDA 5DLFA 4LFAF 1P1LA 2WOMB 3KNAA 2HHPA 4URGA 5THWA 1ZAXA 3P6YC 1UVNA 4OIXA 1XJWB 4C0OC 1A0OB 2ZFHA 5L46A 1TL3A 3DOMB 2OEMA 2OPRB 1O8BA 4ZHRA 2GJ2A 2ZZMA 1VJQA 4FBTA 1VQ8S 3JAMU 3P49B 2CZ9A 3G6ES 2HHXA 1JMTA 2RSQA 3HPOA 4B3SJ 1IXKA 2BE2B 4LREA 1W2IA 1S1UB 1X4EA 3R5BA 3QSYB 1SH0A 4ZVSB 1S1VA 5HN0A 2V50A 2DHXA 3K59A 4LIWA 4JI6J 2M52A 4CYUA 2YWEA 2AWZA 2FVSA 1Q82T 1IUJA 3VF0B 4ED4A 4R0EA 2KG1A 3WDOA 3T6JA 1S1TA 4DQIA 2FJEB 4TY8B 1UW9A 5I42A 4IH6A 3M6VA 3C19A 4GVLA 4Q0BA 1S77D 1WOOA 1NDKA 4PYAA 1A6LA 1NSKL 5KFZA 4DV6F 1K9MT 1LKZA 5CD4H 1RHJB 3R2CJ 5F8JA 3H7HB 1WD6A 4DQPA 3J7YI 4D3HA 1AT1B 5B0FA 3PKMA 2CPYA 2IM1A 4I7FB 2BM1A 2A10A 1NH8A 3PW2A 2HRYA 3HX9A 5D78A 3IM8A 1FNXH 2IA6A 4DZDA 3HLUA 3CO9A 4JI2J 2FZCB 2CJKA 4QBUA 5ETMA 3LP2A 4C3MA 4X65J 2KB2A 3DLKA 2NPIA 3MPUB 3N9UC 4FPRA 1T03B 3IS9B 1EETA 3NG8A 1S7IA 3KUHA 2I38A 2FLLA 1SKSA 3DOMA 3WC2A 4L6V3 1WF2A 2OPRA 3P5BP 2JVRA 2V4JB 2GMJA 3HM9A 4KGXB 4DF8A 4ICLB 2QFIA 4IR9A 2VJUA 1HWUA 1AUDA 2LECA 4ECVA 4HR2A 4K8RA 4TU9A 1NPRA 2YNIB 2BE2A 4C7QA 4BDPA 4B02A 1S1UA 2RE1A 5A76A 5FLXU 4DX7A 3MD3A 2IMWP 4C3KA 3EVMA 1ZM3A 1NH7A 3VAHA 4FKYA 2J9DA 2OI2A 4P72A 4OLOA 1M1HA 3JXOA 3CDWA 1HNWJ 1QUPA 2GA7A 1S6UA 3WIVA 3W5XA 2Z2ZA 3VGVA 1JLFB 3QQCD 3EDQB 1HQEB 1Y00A 2KFNA 4TY8A 3FGVA 1RACB 2ZUGA 2MKIA 4NXMF 4U67Q 3OT9A 5LOQA 1N5QA 2HAIA 1FWLA 2VB6A 4OYWA 2FHOB 2FJXA 2UVWA 1KVIA 3EDRB 1FA0A 4DPWA 2W24A 2AJ2A 5K14B 5A6WA 4J9OA 4O3QA 1SH3A 1A9NB 1FE0A 5L39A 3K5PA 2BR0A 1LNQA 4GRSA 1MU2A 1EB0A 5I3UB 2UXBF 2XS5A 2BX6A 4LSNA 2WBMA 4I7FA 1WC0A 3OJUA 2RIJA 2JL9A 1YJTA 4ECYA 4HTIA 2V8PA 5D0HA 4NLPA 3C14A 2M8HA 5KFCA 4ES1A 2MZSA 2LKZA 1KR4A 2VFVA 4FVCA 2KXNB 4E98A 3PZPA 3BGUA 4NYPA 2YH1A 2HHHJ 3PHEA 3TUPA 4YMEA 1T9XA 2KFZA 4O3PA 3TJ8A 3L95X 5D3GB 4LRBA 3ILIA 5K8MA 2QEXS 4AXIA 1T03A 1X5TA 3BBCA 3D67A 3DXSX 4U7UK 4BCAA 3Q8VA 3W8PA 1HI0P 2GGPB 3D4JA 2W7OA 5D4NA 1R6YA 1IBMJ 1U26A 1PGZA 3GE9A 2MSSA 1D9FA 4QW9A 4WZMA 4B3MF 3MGJA 1FF2A 3PDNA 2YNIA 4KPYA 3OFGA 2XZWA 1BUXA 1GT8A 4KV8A 3LUYA 3B4DA 2AT1B 2QV6A 1MN7A 5KFMA 1SXLA 2V2ZA 5B0AA 4C2MA 2BUNA 2UUAJ 3HXMA 4DR4F 4ED3A 1HQUB 1Y3KA 1FD8A 1B0VA 3AY0A 4WKRA 4DX8H 2L41A 1JLFA 4K7QA 1QAJA 4QU7A 5J1NA 4IKAA 2FGCA 3MTJA 3MFHA 1IKVB 4KHPF 1TV6A 2Z2MA 4OX9J 2HZAA 5C5JA 5K14A 3JB9k 1BWEA 4JI0J 4FF3A 3AXMA 2B5JA 2CQ3A 4U8YA 3Q83A 5C25B 3KJQB 1RWOB 5DRKA 2I5JB 1BGXT 2XCPA 2DHAA 1LWCA 4ZCKA 3US5A 2C2RA 4OL8A 3BGOP 3WBZA 5KOXA 3CJ5A 3R6GB 3VQSA 1IQTA 4RW4A 3KLGB 1CBKA 1T0TV 4J9MA 3W5ZA 3I55S 3M8YA 2DXEA 2CA9A 3FC9A 2ZBRA 4U8VA 5D3GA 4ERDA 1IKXA 2NYHA 3MR5A 2R8GA 3MCNA 2QA2A 5CXTA 5HVFA 4KPCA 1YRXA 1N6QA 2QYGA 4W4MA 4DJBA 3MMCB 4H4KA 4QPXA 1X9WA 2MDAA 4NCAA 1R3NA 3CF5Q 3QJPA 2ZH1A 2C22A 5SZTA 4WTYA 4KAIA 2F40A 4KGMA 2RF2A 4DUTA 3IAS9 4FVMA 4WP8A 4DPXA 5KFRA 4JI4J 2FJAB 3VALA 1NAQA 1MMNA 1SC4B 5HL7Q 1FTCA 4LBPA 4HTJA 1NM2A 2ZBCA 3OL7A 4YB6A 2CQ2A 1UPMB 4OYMA 3TX8A 1M90T 4NLGA 3DRRB 1FRHA 7FD1A 3IBFB 4WJBA 5IWAF 2V4QA 3HULA 2CJYB 3PJ9A 2E7WA 2RQMA 1IKVA 4MIWA 1U8SA 1SKWA 4NEZA 4DV5F 4FS2A 4M5NA 3T9NA 4GKKF 4B9SA 3IMQJ 2YPZA 5C25A 4Q2LA 4L74A 1N32J 1NK8A 1FD2A 3EVOA 2XHCA 3PR5B 1WC6A 4HI2A 4CRJA 4ECSA 3OVBA 1SJFA 3CJKB 1P6TA 1PJ6A 1YJUA 2Z58B 2W7AA 3P3DA 1UVIA 1PC5A 1AB8A 2HVHA 1XR6A 4C48A 3JYTB 3O2IA 1RAEB 4F25A 4IDKB 4EWTA 4DR2F 2XMUA 5EWEA 2OPPA 2JWNA 1ACMB 1T9WA 1FWKA 4AQYJ 5CZXA 4WTOB 2FVRA 2XI2A 3MMCA 2F4VF 3S7RA 4PR6A 4JV5J 2UXCJ 2R7XA 4KFBB 2CZVC 2XMMA 4B9LA 5A6PA 3QZ8A 3VTIA 2CWKA 2JFDA 5HLFB 2FQQB 2ZHOA 5AE1A 4B3OA 2CQGA 2MY8A 2KO1A 4OZNA 1SI9A 4CO3A 5L9NA 4K4WA 2ACMA 2E5LF 2PMHA 4JI1F 1FDNA 1RZMA 3ET6B 4IUFA 2HQ3A 4NXNJ 5D0EA 3ZO7A 4TNOA 3VZHA 2QLJB 3OSNA 4QIEA 2VQFF 1HI1A 1F1BB 1KOHA 1FKOA 1RHQB 1XNQF 1NO8A 4A47A 1NK0A 2BXJA 4DV3F 3GMGA 1EKRA 4NI2B 4OHWA 3HSZA 3ISND 3M9MB 3GYXB 1ZH5A 1B0PA 3UPFA 3D6TB 3EVWA 1S6QB 4NA1A 4PQUB 4O0NA 2A0FB 1NB2A 5F0WA 2D1CA 1KBRA 2XGPA 1SUQB 3UN3A 1T11A 5HK4A 2E66A 3JTPA 2V9KA 4ZPAA 5GMEA 4B9MA 3IP0A 5D4LA 2YWGA 3QT6A 4PEOA 2BM0A 3B82A 4B9UA 2MQQA 3IWLA 1U1PA 2AHOB 3MEKA 1KEKA 3CJKA 2DXFA 3CO0P 2VL1A 2CQPA 2WVCA 3ZTSA 2DGVA 2G2ZA 3F73A 4DS5A 2HK3A 2XQCA 2VBWA 3JYTA 2OEKA 4USHA 1FJEB 3MWBA 5J2PA 4X4NA 2ZEJA 2GO8A 4LRDA 4IDKA 4A8FA 4PXBA 2YNGB 3SI8A 2CQDA 2BOPA 1VS3A 3GQCA 3CJ3A 4ZP8A 3E01B 2HFNA 2AV5A 2F4FA 4C8YA 4DR6F 2J6SA 2E29A 3QLHB 4MKBA 4F8RA 2HYIB 4KFBA 2IM3A 1HNIB 2ZC4A 3LWLA 4YS2A 3K7RA 1N36F 2D9OA 4ILLA 2HSEB 3ZTQA 1S6PB 3DDKA 4FBUA 4ECXA 3HI9A 2ZE2B 5F8IA 1YLXA 3PG9A 4FYVB 3VWSA 3NGDA 4PXCA 2BEFA 1TKTB 5ETPA 3PEHA 1Y4ZB 1S0OA 4U95A 3LW5C 4N77A 2P2CB 3KHLA 4KJIA 3KWMA 4HL9A 1VJWA 2J0QD 3QIPB 4UY8T 2C3MA 2E5IA 2Q79A 3UQSA 2OTJS 1RWXB 2VG6B 2C3YA 2VBXA 1L5UA 4ZVFA 2DK2A 4IR1A 1OQ6A 1UKUA 2BANA 4CLSA 1WTFA 4WFZA 4OJGA 4N7TA 4DV7J 2G1DA 1S6QA 4PQUA 1HARA 2CVEA 5GAEI 3KLHA 3R7SB 2VF3A 4PZVA 1WJ9A 4Q45A 3I87A 5KT4A 4LF7F 1UVKA 1IBKJ 4C9DA 3NXZA 3T3FA 2V67A 2XMVA 5KFQA 4LSLB 3FFIB 4RPFA 1QAXA 2VDIA 1OWXA 1I6JA 4BBYA 3HD2A 2C2OB 4WFYA 3D1QA 2H3EB 4DN9A 2GVDB 2XMJA 5JJBA 5EDWA 2VDHA 3PTWA 4EI2A 3NBPB 2YNGA 1PCAA 5KFJA 1FX2A 2D74B 4Q7AA 4DPYA 2GIQA 5KFOA 4DL3A 2OSQA 4A8WA 2UUCF 2K8GA 3OXFA 2LU1A 2MEWA 5AXNA 2WTFA 1M1GA 4DMZA 4PPZA 3KUEA 2HLTA 2V34A 1L3SA 1LW0B 3KG1A 5DO2A 5K8NA 3RBDA 1S6PA 3DRXA 2ROGA 5KG4A 1AUSL 3W2WB 3CCSS 3G87A 5B0GA 1PYTA 3WQPA 4Y34A 2J9DE 2BJEA 4IYQA 2RKIB 1ZM9A 1VISA 4USWA 2PMZD 4I69A 5H9EK 3J80U 1YBTA 1K44A 3FEZA 2XYHB 4CO0A 3R5GA 1V3SA 2OIHA 1TL5A 2DEJA 5E5NA 5DG9A 2CDQA 2BA9A 3DHXA 1F3FA 3B78A 3VCDA 1URNA 1N5TA 4NMXA 3TVKA 2CJAA 4Y2IA 3I96A 3HP6A 3K2YA 2AU0A 1Q86T 2L08A 1X9MA 2UUBJ 2ALYB 3N79A 2XY5A 1F5BA 1XR7A 3L3CA 5L9XA 4LSLA 5DG8A 2MGZB 4ELTA 2IY5B 1L3VA 1RADB 4PWWA 3G8QA 3H2UB 3M6UA 2DISA 1R0AA 4XIUA 1YHQS 2DR9A 3T5HA 4QZVB 5F3ZA 2K3KA 3CD5A 4KRWA 2RS8A 3O3LA 3B8HA 3NS5A 4ID5B 5KFHA 2XG8A 2XO7A 1S4EA 2WSFC 3MCMA 1UWBB 1RWUA 3JTNA 3NS7B 4C8LA 4MKVA 4TQRA 3NBPA 3L4BC 2MQOA 2BVZA 2UVVA 2OAUA 4UY85 1WHWA 5DZ6A 1RT5B 2HVIA 3SFUA 2P8IA 2YH0A 3QWPA 2Z30B 4NLUA 4GO7X 1PO6A 5LMNF 2FVPA 3T1YJ 2GQ2A 3EZUA 3N28A 4C8MA 2WW4A 2E7XA 1RJJA 1TKXB 1LW0A 2YKAA 2QT7A 2X1GA 3J81U 3T5LA 3W2WA 2NXUA 1BY9A 3MMJA 1QM9A 4CTAB 3W63A 4F67A 4KBIA 2JC0A 2R2SA 5FDLB 1I51B 3Q22A 3J7A1 3R97A 3FRYA 5E33A 3SCIE 4Q43A 1B4SA 5LT5A 1ZTTA 1RTHA 1Y0HA 2ZVSA 1NKCA 4WYWA 4NYOA 1XN9A 4ZKAA 1TR0A 3N5BA 1HI8A 2IC3B 4LT6A 2GVZB 1QTNB 4FYWB 1WDDA 1XK8A 1S9EA 2BACA 4L3KA 2AYEA 4FDFA 4DR3J 1AZSB 4HHJA 4OX6A 4BC7A 2HRUA 4RNHA 1CULB 2HNZA 4R25A 4X4PA 2POKA 3UD3P 2ATCB 2B4OA 2OH2A 1B64A 6AT1B 3O1LA 1Q8KA 4DPOA 3UDEA 2VBYA 3DGPB 1CVJA 1PBUA 2H65B 2HNYB 5RUBA 3V4IA 3BV8A 2E1RA 5B7WA 4M5KA 4TQSA 1R7IA 5T14A 4QWCA 1DLOB 2AJ1A 3KDOA 3G6VA 2DO4A 2V9WA 1NHUA 1JLEA 1TU0B 4ZN1A 4LFBJ 3CCZA 3R8YA 2DNOA 2EFNA 4ID5A 2NREA 2FC9A 3MURP 4DV0F 1TFWA 4Y6IA 1U1QA 5EUHA 4NRTA 1FRKA 3IA0A 2J0XA 5A8KB 3EGWB 2EKNA 3ADAC 3H4DA 3UCUP 1NK6A 2KL8A 1X5SA 2LEAA 3RRGA 1RT5A 4RWWA 3T5KA 4U7UD 2LXIA 2YNHB 1XMOJ 4NWBA 3EXYA 2J9CA 2D69A 4MIAA 3U1LA 2HAFA 1UVJA 3KJVB 2AYMA 4H4KC 1HD0A 2D7SA 2ZM6F 3GLJA 2V68A 3GU0A 1RI7A 3D6HB 5AJ3J 4YEAA 4CTAA 3G82A 4C6AA 2J0WA 4PRFA 1LWFB 4OYAA 3F0NA 5FDLA 1S0VA 5KFIA 3DDNA 5AE2A 3GB0A 4X4UA 3KLEB 1H7WA 4RL1A 2ZH8A 1HBOB 4YR0A 3OTEA 2PEHA 1TUGB 8AT1B 1WTBA 4AT1B 1R6VA 4ZVQB 2IC3A 3DC2A 3HZEA 2W7PA 3RRKA 3GV7B 2EFOA 4DSEA 3UW1A 4DV1J 2ZJPQ 1O0PA 2CKWA 3LP1B 1KQGB 1L3KA 2YY3A 1UA0A 3V2UC 3MR6A 3LH2S 1RISA 2ZOGA 3PIOQ 1RTIA 3DRPB 3R7NB 3DGPA 1F5AA 2APOA 4ZCLA 3QPIA 4PWDB 4DOZA 3I5BA 2QFJA 2HIQA 4CNYA 4IOBA 1NSPA 3I5CA 3BR9A 4OI6A 3PY8A 4CO1A 2VASA 1FWPA 1T9YA 3CEDA 1B70B 2ZVIA 3TA1A 1GMWA 4IQMA 2RRAA 4B3RJ 5AXKA 2JHEA 4FF2A 3WX4A 2QLXA 2D3UA 1UVMA 2HHSA 4USIA 3I82A 1KONA 3IGNA 2DB1A 3TAMA 2V8VA 4NLYA 4ZPVR 1H38A 4I64A 4HYKA 1EQMA 2AEJA 2NQPA 1S76D 3ZZOA 2X3GA 3SMZA 2AMCB 3HT3A 2V8GA 5SUHA 3UD4P 4TN2A 4W98A 9RUBA 2Q1LA 2K2PA 4QWDA 1WACA 3MR3A 2YNHA 1NJYA 5HP1B 2QA1A 1LXNA 2Y8YA 4DN0A 1LFPA 2BV3A 4F2SA 5ETKA 1EIYB 1UAWA 3VAKA 2EVZA 4OZ1A 4USMA 3RBEA 1ULRA 4JI2F 2WONB 1OJ4A 3IR5B 2FLOA 4DPTA 1FJCA 3M8QA 5IQQA 3EXCX 1MNEA 2RB7A 4CH1A 3KDNA 1G4CA 5K8PA 2XB2D 4CO5A 3ZXWA 5B0EA 1OY6A 1URRA 3WZ0A 3LP0B 3MM6A 2VPZB 2CNNB 3GIMA 1RGVA 3KLEA 3I4HX 3K8WA 4U9RA 1DQ8A 2YWHA 1WG1A 2X51A 5E3PA 1FVSA 3Q24A 3VQTA 2H5JB 3AT1B 2F1FA 4KSEB 3U02A 3U7JA 1RTDB 2K7KA 4JI3J 5IT9U 4BC9A 4ID8A 2DGOA 3VVTA 3EM1A 4NZ0A 4ZITA 3A12A 3D0GE 1ZYQA 1JLBB 3KHRA 2Y1RI 4WYLA 1FX4A 4RW6B 3OSPA 3S1TA 3BO3A 2WVDA 3DHWC 1ZS6A 1OO0B 1NBEB 1WDTA 3ENAA 2FIUA 3MDFA 3W9JA 3IAM9 4DFKA 1HNWF 1WELA 3CB4A 5JXSA 1MMDA 1TK0A 1IN0A 4J9SA 1T9VA 2F9JA 1ZZNA 1JKHA 1IKWB 1S48A 1HA1A 3OR2B 4RKUC 1X0FA 4FPIA 2NCKL 1LXJA 3PJXA 1TK5A 1HBMB 3NS6A 3CGIA 4USUA 4YFUA 2QJ3A 1T3OA 1NU4A 2VA3A 4JUZA 3MAHA 3JAMY 3CNQP 5E41A 1PILA 3FQKA 3HSJA 5J2NB 5ETNA 3HD1A 1EAYC 4NA2A 3TANA 3QMQA 1B7YB 3ZTOA 3CD0A 3FRZA 1IR1A 3RZAA 3GJSB 2FZGB 4OZ3A 2WW8A 4CWBA 4LRAA 3RB3A 4ZS6A 4KGKA 3DLGB 1YJRA 3H5SA 4X62J 2ZHBA 4RW7B 4ANEA 1N0VC 2XMKA 3AJ2A 2JEFA 2VFSA 2CJ9A 1K73T 1I3OB 3TW0A 2Z2LA 2WONA 3UCZP 3PACA 3BSCA 3H8YA 2DHSA 3OPKA 2R7RA 1RKJA 1N4LA 2CAJA 3TZZA 4GKJJ 2RAQA 2MZTA 4P2SA 1WKLA 3LP0A 1U47A 2C3PA 4K0KJ 1QSLA 4LR7A 2MKKA 5BYQA 2LYVA 1VHIA 2F8HA 1UEVA 3BYRA 3ENVA 1IBMF 2GJIA 2VV5A 2W2NP 3WHIA 1OQ3A 3L09A 1S9GA 1U24A 2DITA 3PYEA 3O44A 4M5JA 4YDXA 4F4YA 5F8NA 3OXGA 2KVQE 5A0YA 3QGHA 3C46A 4ZVHA 3NL0A 1U1NA 1JLGB 2E44A 4CLZA 1RB0A 3CDUA 3H20A 4WP3A 5C42B 4LUBA 1Q16B 3TZWA 2UUAF 2ZD1B 3LPYA 4ES2A 4DQRA 4XO0A 1IR0A 5JMNA 5K9FA 4A8MP 2W25A 4TLRA 1IKWA 3G9CA 3OR2A 4DV4J 3F41A 5D8HB 4BHQA 1KD1T 3GIIA 2RQCA 3QT8A 2KM8B 3FZBA 3RBZA 1HR0J 4P73A 4P7VA 1NJXA 3KK3B 3JS9A 3QGIA 1F3VA 4DUYJ 2Q43A 3FSXA 3AOAA 4LF9J 4JI0F 4WWSA 5HQ8A 3N01A 3H25A 4ALZA 4M5IA 1DBDA 4DUZF 1NK5A 1QE1B 2R2RA 4QIFA 5FLXY 3UR0A 1BD6A 2XBPA 2HHTA 3MUVP 3E8OA 4I67A 4OJHA 2KT2A 2W9BB 2BKPA 3NWRA 3TR5A 4CNZA 4JV2A 4JP8A 1FK9B 2WSEC 1TMMA 2BOAA 3G8SA 1FFSB 1TL7B 1U1LA 1JLAB 5KT2A 2HHWA 1HBUB 2OFGX 2OJ3A 4Y2KA 4CO4A 2VHGA 3C6UB 1VRUB 1W2BR 1NJZA 5E7OB 2NYIA 1KC8T 1VR6A 3AODA 2CUYA 2HWIA 2RU3A 2AJ0A 4EK2A 4O0IA 4OMFG 1SL0A 2V2VA 3BDPA 4X64J 2YWWA 3QRQA 2KHDA 3L7PA 3W62A 1H6KX 5IM0A 3MEEA 2NSBA 3Q2TC 5KG1A 4QIVA 3KJNB 4ILMA 1CJUB 3KHGA 3JSMB 4JI4F 1W26A 1JLGA 4P2FA 1NUEA 1KFDA 3FZ2A 2KT3A 2B9YA 4RZRA 3MI7X 1MMLA 2EFVA 3MD1A 4X4TA 3DYAB 1RHUB 2ACYA 4WU3A 4G3IA 1R43A 1CJVA 3GP9A 1T94A 3M8SA 3CCWA 3GPAA 2QL7B 2XZTB 1P27B 4WZQA 3T1HJ 2ASJA 4UTGA 4WU2A 1RKIA 1H3DA 5F41A 2QL9B 2F5GA 4DL7A 1JJCB 1YZ6A 3CC4S 5DDQC 4YB7A 2IRUA 3VVUA 3KK3A 1T9UA 4F02A 4EU0A 3HFKA 2FVQA 3MOJB 2WSCC 5HJXA 1RT3A 2MKJA 1ZETA 3PIPQ 3AA9A 2CNKB 1QE1A 1B3TA 1N32F 3GR0A 5A8RB 5KFWA 3QT7A 2J6TA 2FLNA 3N0VA 2JZ5A 4B3TJ 1WOSA 1RTJB 3CCES 1U1OA 2HS3A 4PG4A 3T9ZA 3AOCA 3EPGA 4DI6A 3NAIA 1TZ0A 1PAUB 1JLAA 2NSCA 4YR3A 1HBUA 2R7VA 1BHNA 2AF6A 4OYXA 1JLQB 4KKOA 1RBOB 3BSOA 1VRUA 4LVOP 2IVMA 2MQPA 4DLEA 3W7BA 2V0NA 1UJ5A 3DI6B 2UVUA 2FGOA 1NHKL 4IOCQ 1ZTWA 4AQYF 4LMZA 4OHYA 1D09B 3SYZA 3CUNA 3G2XA 4YHHJ 5KFBA 1N8RT 3PW0A 2FLPA 4EZ6A 3FEYB 2M9KA 4I6WA 2QA4S 3CJ2A 2PE8A 2DNYA 3T41A 1CJUA 3AOBA 3FKBA 3JSMA 2O01C 3PRDA 5HANA 4OZ0A 1RU1A 4K5RA 1NSQA 4FXDA 3TUIC 1LW2A 2PD1A 4CLKA 5DGAA 3ILOA 4NXNF 2DGXA 2ZOMA 2U1AA 3BN7A 2MB0B 4WIIA 2HBRB 2IVYA 2CFXA 4DBQA 2CADA 3MMBB 3DLEA 4AL6A 4ILRA 5EWGA 4F4AA 1U48A 4TXSA 4LFAJ 5A8WB 1BQMA 1ZPVA 4LF4J 2LQ5A 1APSA 5DQHA 4QWAA 2KHCA 2AQ4A 3NP5A 1FI4A 3SXLA 2Q66A 1XR5A 3ETMA 1GX5A 2LA4A 1D9AA 3PYFA 5IV4A 3KK1B 1U0HA 4NLXA 4KT0C 5CYMA 4ETXA 4A8YA 2ROEA 3BH7B 2K7JA 1RT6B 2KN4A 4ZVGA 3KOAA 4CP5A 5A8RA 6FDRA 1UTAA 1RTJA 3AB2B 4ZMMA 4IG0B 2JFKA 2UZAA 1OYEA 4IFYB 3RTVA 1WSRA 1FFWB 2B6AB 2MZJA 5KT3A 1JLQA 2R4FA 3D9BA 4GVBB 4EBEA 3P8BB 2W4DA 5IT0A 4OYBA 2DIUA 2A6MA 3NGSA 1U2RA 2B3TB 4KO0B 1U1KA 1U8WA 4IRKA 2NR0A 2BE7D 2PIIA 1IQZA 3BN4A 1VBXA 3G8TA 3S8SA 1PBAA 1U02A 1SIWB 1RLDA 4DV6J 2QSWA 3OR1B 4F4KA 2ATLA 1YDLA 3BB5A 4ENOA 1RA7A 1WHYA 2HBYB 2JLGA 1KLMB 3NRBA 5I3QA 4A8SA 3NNCA 2N4CA 1M5VC 3H5XA 3MM8A 2LDYA 2DY9A 2G2OA 1T3NA 2DGUA 1Q0NA 1GTHA 4FZVA 2XEXA 2LDIA 2OSRA 1AA1B 1TQLA 2HWHA 3DRSB 2E5JA 4M1KA 4ZIWA 1QY7A 2ZWOA 2QRRA 1ZA1B 4KH1B 2QMWA 4OV6A 3MMBA 2G0CA 5CA5A 2OGUA 5A8WA 1ZAWA 4MKAA 5KFAA 2UXDJ 4Y2MA 3KYLA 2PDAA 2X1BA 3PX6A 2C42A 1RHKB 3VHQA 4FP9A 1TMJA 1FNOA 2AGOA 1R0BG 2PFDA 3KK1A 4ZDNA 3RBXA 4MIBA 2KZZA 4IRDA 5HQMA 1RT6A 1IBKF 3C6TB 2XMWA 3DXBA 4L76A 1AW0A 1IKYB 1YZ7A 2AEMA 4IG0A 1SIZA 4YOEA 9ATCB 3M8PA 2GX8A 4F4WA 1WOPA 2B6AA 2PMWA 2YX7A 2RD5C 4GVBA 5DDOC 4OJ1A 4DS4A 4MH8A 3V81A 1WKJA 2EC2A 3PCOB 4ZHRB 5GMDA 2R8HA 2ZBPA 1JJ4A 1YGYA 4NXMJ 3KKFA 2RUGA 2DIVA 4MK9A 3W2VB 3ULHA 4M5HA 1E6VB 1FEHA 3W66A 4Y3CA 3BGRA 5H9FK 2QSFA 4BLGA 1KOOA 4GC7A 4NYZA 3W3SA 3MM5B 3FQLA 3NOGA 4KR0B 2DHHA 1KLMA 1S99A 4CYUB 4NZ7A 4MAKA 7AT1B 1UFLA 2HW3A 4ZN3A 3PJWA 6FD1A 4J9KA 2C3UA 3GG0A 3HSDA 1S1TB 4LQ3A 4HKQA 3HVWA 4UOCA 2N7CA 3NMRA 2UU9J 5C7PA 2DPIA 4Q0BB 1G2EA 1U6ZA 2OTLS 2MQLA 2PEBA 2I2YA 3CJ0A 4ZJOA 1CQNA 3QGGA 2AKWB 4QYZJ 2CYYA 4HLBA 3R5DA 4C0BA 3SEOA 4ZA1A 2OELA 4O23A 2XMAA 2CPDA 2I9SA 1UFWA 2PA8D 2RQKA 3RU0A 1NZAA 2R7QA 4P10A 4DFPA 1N33J 1IKYA 2YTCA 4X66J 3AJDA 4F0HA 4JI8J 1LV5A 8RUCA 2RRBA 2WBRA 4G6VB 1DRZA 3LP2B 4N41A 3DLKB 4OX7A 1FXDA 2P9GA 3MR2A 2AGQA 1ROFA 2NXEA 3TUJC 1KQKA 2HK2A 1EETB 1VRTB 5J2MA 5KFKA 2LMIA 4A8KA 3AAWB 4H4MA 2IVFB 1ZAVA 2M88A 1YIJS 1U25A 5L1JA 1VCTA 3LAMA 2FTRA 1Q78A 4M5LA 5F9LA 4KHPJ 3W2VA 4G1QB 1UZHA 1UMJA 1HNZJ 1VQPS 1E6VA 4F0MA 2HKEA 1X4BA 1GTEA 2G0IA 2OD4A 5KFXA 2DY1A 3NWGA 1SB6A 3CCLS 2ALZA 3MECB 3T1YF 4DX5A 3FBEA 1JXEA 2YKPA 3MM5A 1HFEL 4MK7A 1Y7PA 3SCKE 1C4CA 4RBVA 1F0XA 3U27A 4PUOB 1KS2A 1HWIA 5HJYA 2O67A 2AX1A 3OVAA 3Q8QB 4IO9Q 5KFTA 1V3RA 1DFDA 5F3TA 2PI5A 3MAQA 1N48A 1F2HA 2OD6A 3J7YU 1M5OC 3W64A 2EG1A 4I6AA 2GIRA 3CDBA 4C0HA 5BR8J 1RT1B 4MYUA 1HKAA 3A13A 1SKRA 2GNKA 2IDEA 4FNIA 1KRPA 1MU2B 5HAOA 3ILLA 3TA0A 1GAOA 5M2PA 3IR7B 4KGVB 3FBFA 2JDJA 4LSNB 2KYZA 2YPYA 2MSTA 1U2CA 5KT5A 2GAGC 4GC6A 2ZUAA 2HGMA 2B9XA 3W5YA 1FJGJ 3HHLB 3K5OA 2D3ZA 1KTQA 1XC9A 3OTOJ 3LALA 1WG5A 3C14B 4ZPWR 3U1MA 1REVA 2R42A 1VQYA 1SC1B 3P4UB 3PO4A 5MAOA 5L1KA 3A3OB 5LJ3Y 4N56A 2H1YA 1IM4A 1V5VA 2DBBA 4O44A 5ETRA 1SPBP 1VRTA 4EYHB 3LAKA 3Q8PB 2C2MB 3UD5A 5CCLA 1RBLA 2VPWB 1U6FA 3L7UA 2LU2A 3OLAA 3TEGA 2ZDPA 3M2VA 4LR8A 1OPIA 1WC5A 1N52B 4O3SA 1FKAF 1HHQA 4DPUA 1C2PA 4G1QA 1RCXB 1RLCL 1FEEA 4KB7A 1HHTP 5E0OA 3MECA 3CCVS 2EPIA 3UCGA 2MJNA 1VDHA 4KTQA 4I2PA 3U1NA 4NEYA 4KV8B 3CIMA 1YBAA 5JUMA 1RE1B 5FIIA 2C2NA 4K4TA 4IH5A 2W8KA 3MUTP 3D6FB 4DL2A 4QWEA 3W8GA 3OLBA 3CTRA 1JJHA 5AJ3F 2GCFA 4UZBA 1WC1A 7FDRA 4PUOA 4UF4A 3I0RB 4CLLA 1GXLA 1R8BA 4ZK7M 1RT7B 2DNGA 3AH6A 1SJ4P 2KG0A 1UVLA 1X5OA 1TV6B 1HD1A 1Z2LA 3BEGB 3D2WA 4EGLA 2BJDA 1NDCA 1C1BB 5KG0A 5DG7A 1UJ6A 1EHWA 4XDDA 3MOZA 2ZZNA 2IJRA 4FS1A 4DR2J 1T7PA 1RT1A 1Y9OA 2O5DA 2B5JB 1VQ7S 2IBKA 1HW8A 4J9PA 2AYBA 3B54A 3GSIA 1N0UA 3V6JA 4PCQA 4N5SA 4PQAA 1T05B 3RW6A 3AA8A 4QYRA 3K17A 1LWCB 2KM8C 3G96A 3J81Y 3ISZA 1AXQA 1SJ3P 4WIQA 4ZPCA 4LR9A 3IO1A 3MPDA 3T19A 4RW4B 3HHLA 2HZCA 5HVHA 1P8GA 1PYOB 3MEDA 1S79A 3O8WA 4ETZA 2JVOA 2DEIA 2GHVC 4NLQA 4B9NA 3UDVA 3HJVA 4X4VA 5I4MA 4B3RF 4OV1A 3QWUA 3K5NA 3ZZYA 1IKXB 1RU2A 3H2VE 2KVIA 2EFPA 1Q1KA 1N6QB 1DY3A 4ECWA 4MJKA 4AL5A 1K1SA 2B7BB 2CPZA 3M6XA 3CC2S 4RNMA 4NX9A 2RS2A 4MYTA 3PW7A 3NCPA 2RF2B 1UP1A 4RBUA 3S01A 2WB1D 4OYOA 4Z2XA 2AJ4A 4CLYA 4CZCA 1TTHB 3C66A 4N8OA 2HG4A 3C3LA 3UN5A 2IFXA 2J8SA 3H0PA 3KLIA 1B99A 3QJJA 4TKTA 2PI4A 1KWMA 1HWJA 1HL6A 4R8UB 4OYIA 4LF5J 2WVFA 2E9TA 4JI7J 4Y28C 3I0RA 1YRUA 3ZTRA 2YQ0A 3VGTA 2BW7A 4LF6J 2FY1A 3OFEA 3PM9A 4Q5VA 1RT7A 1DARA 4CLFA 2AW0A 2ZBIA 3KFWX 1VBKA 2GV1A 1P9QC 4DL4A 1C1BA 3DOLB 3ZTPA 2R7TA 2E1MC 2VKZG 2VC0A 2CQCA 4F26A 3NGKA 1Y11A 4JI3F 1JK9B 3AD9C 4TLQA 5DQGA 3CSKA 4OZLA 1V9OA 3NGUA 2HGNA 1BQNA 1T05A 1OY8A 1NMEB 2A6OA 4P7TA 4DR6J 2MZRA 1GX6A 4DG1B 1H72C 3GIKA 3THPA 3RG6A 2FB0A 3TA2A 2DGQA 4WFAQ 5GADU 2ZWPA 2N82B 4NZ6A 2XULA 5HBMB 3LOUA 2MHNA 2XTJP 1RWPB 3BPDA 4X4QA 1HW9A 3ILJA 1HNVA 3PRVA 5F8HA 3IC1A 2PC6A 4GO5X 5HSPA 3OVSA 4ED2A 5F0UA 4NLRA 2XLIA 3BGFA 3OUYA 1AYEA 2OPPB 1X9SA 2W8LA 3PR4A 2MKSA 3TX0A 1RAGB 2KDOA 2SXLA 1VFJA 4I1TA 2L9NA 4O4GB 5J2QB 2Y8WA 3DLJA 3M1VA 4KY3A 4UQGA 4IG3A 4XDCA 3DLHA 1A7GE 3MXHP 4R5PB 5LSRA 2ERRA 2R3VA 2CJXB 1XEZA 2V6AA 4ZOSA 4B3OB 1WI8A 4FYYB 3I0SA 1HPZA 1EP4A 4YR2A 4RUBA 1YQHA 3TUZC 5KFLA 5A2QY 1SJRA 1VLOA 1CQMA 3FEXB 1T02A 2DR7A 4R8UA 4F4XA 2IJNA 4YY3F 3AQPA 1XMQJ 1PAEX 4NRUA 4GKJF 2QTWA 2MQNA 1NJIT 1FDBA 1FKOB 2DRAA 2XC9A 4Y00A 3I9ZA 1J5OA 4CO2A 2LEBA 1NZ8A 5L1LA 4M94A 4EBDA 2E1CA 3BSAA 3AXKA 3MHYA 3DOLA 2BW2A 4ZLLA 3K0JA 4ZJLA 1NXIA 2MQ8A 1J27A 3GFYA 2BKNA 1S0MA 1LK7A 1OSDA 4OX8A 4G65A 2DNNA 1WC3A 2CPFA 3AD8C 1X4FA 2FDNA 4ZVTB 3H59A 2HNDB 3HFZB 4PG8A 4S0MA 4DG1A 1RXOB 5H9FJ 3BBBA 2GW8A 4DCPB 3VAGA 5DM6Q 4QQBA 3SQOP 5HBMA 1CEZA 4DL6A 3BM7A 3HFVA 4Q44A 3UO0A 2LCWA 3CD6S 4N47A 2DPJA 3FVYA 1DTQB 1FRLA 1CJTA 2MY7A 3R7BB 5EWFA 4DV4F 5J2PB 4PG7A 1F9EB 3TVYA 1B0TA 1X4HA 4CLTA 5LMUF 2MMYA 3DCAA 1S57A 4DCOB 4HI1A 3D54A 3P45B 1HR0F 3RUBL 4DUYF 3O5TB 3ICLA 4O4GA 5IT9Y 3KK2A 5J2QA 2BKOA 4LF9F 4MTPA 4F0KA 1RT4A 2PGCA 1M1KT 1BC6A 3BSNA 4Y2AA 3GWCA 3PX4A 4R5PA 2HHUA 3NNAA 4WCEQ 4DFMA 2EWHA 2X3DA 3RGIA 3L7OA 1RK8A 3EJMA 2M3DA 5HVGA 4RO0A 2XGQA 3OTCA 2XO6A 4CM0A 1VQ9S 2H9ZA 3BO4A 4OYZA 3DNCA 1RA6A 3M32B 4P2XA 2BYCA 1RYSA 3OQ2A 2ZC3A 5KG6A 5LXYA 5ETLA 1VMBA 4JYAF 4ZPBA 3GV8B 2OO4A 4P2MA 4I56A 1HNXJ 3QBCA 2QL5B 4WK3A 3EZ5A 4ZVUB 2BANB 3AB4B 4X64F 1SKUB 3BDEA 4EFAC 1WUUA 3KLHB 4WE1A 1RWMB 4NPOA 2VONA 3UR3C 4EEYA 2W2QP 3KJFB 4P9SA 2HNDA 3Q0AA 5IZHA 1JIHA 2OEJA 3IR6B 3BR8A 2RVJA 3UVJB 2EI5A 1F2GA 3CCMS 2FJVA 5JVHQ 4J90A 3BJYA 1LK5A 1J5EF 1WORA 4HH1A 1RYRA 3KHHA 5CYJA 4F36A 3MPVA 2N3OA 3H42A 3KTQA 5H1SV 2CG4A 2VZ9A 1DTQA 5KFNA 4DSKA 2V5HG 1VQKS 3T1HF 4AUKA 1OPZA 4DR5J 2RJZA 1Y5LB 4RBTA 3HDSA 2NXNA 2KU7A 5B08A 2DGSA 3VAMA 2AJQA 4ELVA 2HURA 1S1WB 2EK1A 4NE9C 5HROB 4RUHA 5FJ4A 4LFCJ 2HQIA 4N8NA 3MEGA 3SDEB 5T41A 4B3TF 2PFFB 2CQBA 3G4SS 1CC8A 3R3TA 3VV2B 1IBLJ 3W1YC 1GMWD 2QMUB 5EGYA 4F50A 2VICA 1VQLS 2G2YA 3BPSP 2HGLA 2RQ4A 2HS4A 4CCHA 3UWTA 4YP3A 1GH8A 1EKSA 2ZNZA 4RW9B 2RILA 2LXFA 3JQJA 4PWUA 3M32A 1IVZA 2C1EB 1NPKA 2BQ3A 2V8DA 3VAFA 1N34J 1VQ5S 4EBCA 4DV0J 5BYRA 3SBMA 3G86A 4YHHF 2R7UA 4IFVA 2J0SD 1FVQA 3K89A 5IT4A 2HVZA 4UW2A 4LRFA 1RDRA 2JOQA 4ECZA 1OYDA 3SSRA 2BABA 3FBCA 1NEEA 3CDAA 1SL2A 1T9TA 2V2KA 3EWGA 1C0TB 2FUG9 3J81j 4C8NA 2LXUA 3ZZ0A 3GJQB 3R5CA 2Q6CA 3UVJA 2FZKB 4P71A 5KFEA 1R0AB 1MSWD 4TYAA 2QLWA 8ATCB 2GFFA 3R1HA 2YX4A 3M8WA 1FJ7A 1FNMA 4W90B 4ECRA 2L3MA 3TAPA 2YQ1A 3A8JA 2C28A 2L48A 1VI7A 1Y5IB 4I6YA 1F5CA 3NNHA 2EXUA 2DXDA 4LF4F 4WK1A 2QZ8A 3EGZA 3CJ4A 3ZNUA 3AD7C 1PC4A 3F56A 3P5TL 3MPYA 5HO4A 1ZOTA 2W01A 4X4SA 3RAXA 1Y5NB 4U96A 1G1XA 2JEGA 1S1WA 4LBIA 2XYGB 1SQEA 5HROA 3TAQA 1CSJA 1YJ7A 2F8EX 2O3DA 2PA3A 3GJRB 3SDEA 3D66A 3HO1A 1TP7A 1EZZB 2PO4A 1HMVA 1SJQA 2ZH5A 3O6QA 3R5AA 2IMOA 4P6QA 4CH0S 3D1HA 3UE2A 3PO5A 4P75A 3UFCX 2JC1A 1FKPB 2AYGA 2FHJA 4UUWA 4RUAA 1KDNA 4ED7A 4R0JA 1RTHB 4RW9A 1HYSB 2VODA 2M70A 2CQ4A 4CDIA 5C2GA 1S9EB 3AHPA 5E3CA 3M7VA 2R8KA 2CNLB 3PHTA 1S72S 2WZ1A 4ATNA 3SSQA 3OTDA 3ZZRA 1Q5YA 1VC6A 3KLFA 2HNZB 3VR1A 2W1BA 5IS2A 3LGHA 2L9WA 4RR5A 5KFYA 5D0GA 4ES3A 5BJRA 4L72B 1JX4A 3V4IB 3JSBA 3CCTA 3GCXP 3NLCA 2RH3A 1C0TA 3KG0A 4OQJA 1F9FA 3CCJS 1JLEB 3BKFA 5KT7A 3OTBA 1S1XA 2W9CA 4RUCA 1PYSB 5D4OA 2MYFA 3TARA 3M05A 3A8EA 2GJFA 3RR8A 3HHLC 2KKHA 2KTQA 5CHCB 4C3LA 1R8CA 1J2VA 2N3LA 2WOMA 5T7LB 3LWMA 3C15B 2BZ2A 2UXDF 2HHQA 1EX8A 4C97A 1XIQA 2VG5B 2BJ7A 3Q8UA 2E5HA 2DTJA 1TELA 4DLGA 3TJ9A 4P52A 1D8ZA 4C8OA 2JJ4D 1W25A 3R1LA 4RX6A 3FNNA 4C8ZA 3M4XA 3TJAA 2DNPA 4LF8J 1VHFA 1QJHA 1L3TA 4LVNP 3ENQA 4KHRA 4D3GA 2BJ8A 4JOUA 2IM2A 3FMWA 3G82B 3IWNC 4Y65A 4URQU 1FDAA 3TI0A 2W2PP 2QX0A 1FKPA 3R2DJ 2QLFB 2EBEA 2HBQB 1HYSA 2EKYA 4RU2A 4K4XA 1Q53A 1FDDA 1JJ2R 5KFDA 1K0TA 4B17A 2NZCA 3CJSA 5LM7E 2M8DB 1ZM2A 2V63A 2ABYA 1YG0A 1DAXA 3NEKA 2OHDA 4CLUA 1SBRA 1RTIB 2QG9B 1K0VA 5IV3A 1KTVA 4H4OB 4PXEA 4YQWA 2MLXA 2R2TA 2GS8A 4OHZA 4ZVRB 1RAFB 4I2QB 4QWBA 1EARA 4ED0A 5KTQA 4I0WA 1UCNA 3D3CJ 1ZZFA 2AIRB 3KLVA 3OHAA 2VBZA 2KJVA 2UU9F 3HJFA 4YN3B 4A48A 1HBNB 3TAMB 2OKQA 3M2UB 2DR8A 2IYGA 5T7LA 3C15A 2JEIA 4C4WA 5L1IA 4A4JA 1S6OA 1G7CB 2J7UA 3IS9A 3Q2SC 1MLAA 2VG5A 3MCOA 2YXLA 4GMKA 1VC0A 2WAQD 1MROB 3I32A 3NAHA 3IBCB 1SH2A 2IA0A 4WBFA 2WK4A 2V4JA 2WVBA 2X1AA 1Q8LA 2ZNYA 3CDEA 4ICLA 3UN2A 5EX0A 1FRXA 1ICEB 2OPQB 3W9IA 2K3IA 1N33F 1H73A 2E7VA 1YVFA 4JI8F 4X66F 4L3NA 2HVEA 2A1BA 4AE5A 3M8QB 1GFWB 2CQHA 2DKOB 3HK2A 3Q86A 3NY0A 3A1YG 2VPXB 4ECUA 3JQMA 1QDUB 3MM6B 1K8AT 2HFZA 4E0DA 3K8VA 2NPFA 5ETTA 2J7WA 1DZ5A 2CVIA 4KYZA 4ED6A 1ITPA 1H7XA 1HQEA 2IAJB 4NLSA 1UW4A 3DLLQ 1Y3JA 1PJ7A 4K4SA 2P9EA 3SV4A 2IIHA 4B3SF 1RWVB 1HNZF 4C11B 3BO2A 2QE5A 1KN6A 4O4RA 3CD7A 1WC4A 2BRKA 3RAQA 1FTRA 2VFRA 1QAIA 1YJVA 4J9NA 4DUZJ 3F44A 3VAJA 1YJWS 1MWQA 1X4GA 3W61A 4H4OA 3FBBA 4UUXA 3M8RA 5I3UA 4JI6F 5AE3A 4KC5A 2BJ9A 2E9ZA 1D1UA 5F8GA 2G0JA 3CMAS 2F8MA 4I2QA 1GMVA 4WP9A 4X2BA 1JKHB 4ZPTR 4KGZB 3DMJB 1RUSA 3KXDA 2NZ4A 3HVTB 4OI0A 2CDRB 4CM2A 2B0GA 1GK8A 5F9NA 2R8IA 3D7SB 2DR6A 5B0CA 1HBNA 3M2UA 5GADI 1KQFB 1C1CB 3DFEA 4I4BA 5BR8F 3NGTA 2ZH9A 2CQIA 3A4TA 2LA6A 1LEOA 1VYAA 5GMKa 2OLWA 2Z56B 4A8XA 1DQAA 2GGPA 2A3JA 1MROA 2EK6A 3RW7A 4ZP7A 1PG5B 3GR1A 3TVZA 4F4ZA 3C8YA 2IBOA 2HHVA 2LQBA 1FJGF 1BXNA 3PFEA 3OTOF 3PNIA 2OPQA 4AD6A 1I94J 1QUVA 4HDHA 1XMBA 3OXLA 2PSZA 3TQ1A 1JXLA 5LXRA 3ZZZA 4X65F 5GVQA 4B08A 4X84A 1UA1A 3GONA 4QOTA 1YJNS 2B8QA 1HQUA 3EZOA 5G4DA 2JEJA 2BQUA 2Y9HA 2AEFA 4PG5A 2N4DA 3LA0A 2MJUA 2GHWA 2ZKUA 2IAJA 3RAMA 1S9GB 4XTTA 2KYXA 2OPSB 4ZJQA 1YWXA 5A0YB 1IWAA 3KMQA 1U49A 5KG5A 3PV8A 4C11A 2CG8A 2XWXA 3E2EA 5CZVA 3GCWP 1RAOA 4J9RA 2X1FA 3H4BA 1RWKB 3QYYA 3QNWB 2HLUA 3SQGB 4PPDA 2WRMA 2ASLA 3JTOA 2I5JA 2FHKA 1VQOS 4UT4A 2DHGA 3W60A 2HZVA 5DZ7A 1TKDA 1UETA 1PSDA 3GIRA 3KLGA 2DJWA 5LL6d 5CH7B 2DNQA 5KFGA 3DMJA 3L9ZA 1Q8IA 3ZC4A 3HVTA 4ZLPA 4K50A 4WFBQ 4XAKA 2FJWA 2VD3A 5ADZA 1WF0A 2XM3A 3BREA 2FYXA 2VKRA 2XY7A 5LSLA 1C1CA 4WPAA 3EMTA 3LF0A 2YNFB 1SV5B 4JB8B 4M5GA 4DL5A 3HVRA 1B7FA 1NDPA 5G0RB 3BZQA 4DV2J 4C8KA 4UZCA 4M63A 3FK4A 1R27B 3BKTA 3QGPA 4ECTA 1KP6A 2K06A 3UI3A 2RMLA 4HVZA 3ENWA 3IFEA 3BGLA 2P9CA 4JI5J 1QTMA 1RT2B 1V5IB 1C4AA 2UUTA 3SCLE 4BWMA 2QN6B 3CT9A 2HHHF 3EPIA 2DH8A 2Q6BA 5KAKA 3MR7A 2ASDA 2MKCA 5B09A 3D6MB 1CG2A 2HQCA 3ITHB 3VGUA 1N5YB 2RDDA 1FE4A 2HEKA 1LQ9A 3DRRA 2IJFA 4HHHA 4W92B 2AP6A 3K5MA 2ZH7A 3QZ7A 5D6GA 1ZPWX 5KFFA 5IM0B 3MEEB 2OPSA 5C2CA 4UOGA 4WKYA 1G3OA 4Z7CA 3HVAA 2AGPA 3QFHA 1H98A 4O3OA 1NKEA 3HHNB 1KVKA 1CC7A 3SIPB 4EZ9A 2JSXA 2NUUG 4BWJA 1SVDA 3SQGA 4ITSA 2LVWA 1WWHA 1NHVA 2MZ1A 5B0BA 1YBUA 2VJVA 2RUSA 5LSOA 1CJVB 2C2EA 4LF5F 3DU5A 3TQEA 4UQTA 4JI7F 1NDLA 2J6UA 2VU5A 2G9OA 3WX8A 4IQXA 2J7KA 3T6BA 4M5MA 2B4UA 4LF6F 1GQEA 2E1PA 1RAAB 2FHMA 3EUNA 2ROPA 4K2XA 2D41A 5CQGA 4RU9A 2DH7A 1KHVA 1P9YA 1RAJA 1QD1A 5H9EJ 4OX9F 1OMSA 3EE3A 2DNZA 2H51B 2YNFA 1SV5A 1RT3B 2KH9A 4DSIA 3HSGA 2A18A 5G0RA 3X1LB 3IRXB 3MM9B 2HFUA 3PXGa 4J7CA 3GV5B 4MT1A 2DNHA 4M5DB 3EX7B 4QPTA 1FESA 4USJC 3CMES 1UWAA 3M6WA 1XWLA 2DGWA 1XNRJ 1U1RA 2KT5A 4RWXA 5D4PA 2ASYA 1TVRB 3HF5A 2Z4PA 2F63A 3CULA 5K20B 5HLFA 1RT2A 2K1RB 2VQEJ 2ZH6A 2RHQB 4KKOB 4EUVA 4ANCA 3ET6A 3GILA 1FRMA 1TL4A 3ZZPA 3ITHA 4DR7J 3PYGA 1N5YA 2V69A 3H2LA 1M5KC 5DGBA 2GQQA 3TZYA 4M8LA 3C16B 3NOCA 3BYPA 1YRTA 3M8ZA 2IHR1 3IRWP 1Q7LB 4NI2A 3MAAB 3Q8YA 2HFVA 4JV0A 1Z2ZA 3HHEA 3CWJA 4I68A 4RNOA 3V6HA 3OFHA 3V4MA 2VUGA 3A8IA 2HFOA 1SUQA 4TU7A 2C2KB 3THVA 3IG1B 1LW2B 4EO8A 4DEZA 4ANDA 1FCAA 5JVGQ 3FJ2A 2KFYA 3Q23A 3CJRA 4URSA 1XMQF 2VPYB 3DLEB 3PKYA 2EW9A 3SCJE 2HQGA 2GZOA 1NRKA 1X5PA 1BQMB 3Q8RB 2M5YA 4MK8A 3GFXA 3QFWA 1M5PC 4IRCA 4AL7A 3KG4A 4F3QA 4J9LA 1VGYA 2HBZB 4Q2MA 4F04B 2GO9A 2DNRA 1U0HB 5CYMB 3FUYA 2RT3A 3IXQA 2L9DA 4F7VA 3IRXA 3MM9A 2CNOB 2U2FA 2WCXA 3E01A 4M5DA 1VC5A 5LJ5Y 3QLHA 4A8QA 1TAUA 2IYIA 2DCLA 5F8LA 2DT9A 4EYIB 1HNIA 2VH7A 1NNDA 2ZH2A 2WB4A 1TVRA 2ADCA 1N5VA 1RWWB 5L8RC 3LPEA 3OD2A 2H4WB 5KFPA 5IC4B 2K1RA 2GHPA 2ZE2A 5J1EB 2H54B 5C24B 4BS2A 2QYCA 2EFGA 1TKTA 4WXOA 2EFQA 1KHWA 1SL1A 2LQ8A 3DN9A 3QIPA 1CS4B 1VQNS 2ILYA 4DSFA 3C16A 4JV5F 2UXCF 2VG6A 2G4BA 5K8OA 3ZFVA 4V19J 3BQ2A 3K5LA 3MAAA 2BBEA 1V3ZA 2JRSA 1VLYA 4Y0FA 3MM8B 3I6PA 2F65A 3TNVA 3D0HE 2JLEA 1EQ0A 2A2DA 5AXLA 4OZJA 2VG7B 3IG1A 4DR1J 3D68A 3FFIA 2V4RA 3TYTA 5D15A 5KFVA 2I1RA 3GFZA 3QJLA 1HNXF 5CYQB 2GVDA 2ADBA 2ZDOA 1S0NA 2ZHAA 3HMJG 1NSAA 1VOMA 1RP5A 3OJSA 5CAAA 1TAQA 1Q5VA 3BBFA 3R5JB 2B56A 3D28A 4O3NA 2D3OR 4OHXA 2XWYA 5HMWA 5HATA 2B4VA 1NJWA 4OHVA 1TK8A 3SFGA 2YKMB 3M9OB 4USTA 1NLKL 4CIOA 4KHMA 2YKQA 3D0IE 4IH7A 4OI2A 4HHUA 1AFIA 1S10A 1KSPA 4V1Ak 4J9UE 1Z1ZA 3GZ7A 3M8PB 1KKHA 2Z0GA 4AXJA 1U2FA 3G71S 5J1EA 5C24A 1E6YB 2G13A 4RW8B 4ED5A 2DGTA 3V81B 4DR5F 1DQ9A 5HMZA 2RKIA 1R8AA 3CIZA 3MMAB 4FXVA 2MQMA 4K2JA 1MWZA 3CJ8A 3C2PA 2UVRA 1EJ7L 4Q8FA 1CS4A 1UJ4A 5IFMA 2N7YA 4A46A 3BGRB 2MXYA 5MLCV 2XYPB 4QU6A 2CZ4A 1C0UB 2HS0A 3SSSA 3HHLD 1V6HA 3R9LA 4LFCF 4ER8A 2ZOFA 4DZ6A 1JNRB 4CH7A 4X4OA 2M2BA 2HMIB 1IBLF 3OL6A 2P6TA 2R2UA 2MLYA 2GQCA 1LWXA 3ONQA 2VG7A 2XLKA 1VRQC 2YBVA 3CMQA 2CJQA 5KFSA 1FT8A 3W9HA 2MGZA 2H4YB 2D9PA 1YX2A 1RSCA 1RABB 3TO8A 4FF1A 4LF2A 5ETQA 4F3OA 1PKUA 4F3MA 5CYQA 1N34F 2FD2A 3N5FA 3BKUA 5EX3A 2HFSA 1UWBA 4DV7F 2EG2A 2DR5A 4EMDA 2RRNA 1RAHB 3DM2B 1KVJA 4MFBB 4F2RA 5D0RA 2YKMA 5DETA 4WFXA 1YK9A 2M0GB 1YITS 2XLJA 2KI2A 5DS7A 4C98A 1IJFB 2DRBA 2OP5A 5ITHA 2ZH4A 1TKXA 2IDLA 5GAGU 1BMQB 3ETOA 1R89A 3TP2A 2F7VA 3FCVA 5E3RA 5EHHA 2W4CA 1YSJA 2QIFA 4RNFA 2R7OA 4YB5A 5J2MB 3QRPA 3DOKB 2IM0A 4H4MB 3W65A 1E6YA 4RW8A 2IPOB 1ZA2B 2FY8A 2CPXA 3MMAA 1VQ6S 2ZITA 1XQIA 2F3JA 3MCSA 5DM7Q 3UDCA 2WVEA 1O6XA 2ZBQA 3PFOA 3V6DB 3PEJA 1LWEB 4OFZA 2RDJA 1WEXA 2GVZA 3GYNA 3RR7A 3H90A 2MLZA 1C0UA 3FMBA 3EICA 4J91A 1GNKA 4AFFA 3QAUA 1P1TA 5EN1A 3MTKA 2ZKTA 2UXBJ 1AZSA 3T1AA 1CULA 2HMIA 4LJMA 5HI7A 3J7ZT 4ED8A 2H5IB 1K1QA 3LQVA 2HNYA 3VGSA 2LQ9A 3Q89A 1WF1A 1YI2S 3HHKA 2CJBA 1DLOA 5A2QU 2R7WA 5DJBA 4JV1A 1NKBA 4U6PA 5IQ6A 1S5ZA 5U47A 2AZ1A 2NLWA 1TL1B 2AX0A 3TEHB 1VBYA 5HQLA 3WC0A 2PT0A 5A8KA 4CQ1A 1H0HB 4USVA 3NCQA 1OIAA 3KMSA 5GAHU 4DHVA 3DM2A 2BMBA 2UP1A 1SC3B 2XCAA 5DQIA 4FKXA 3HZGA 3OHBA 1UEUA 4MFBA 2UUBF 1X4DA 4B3MJ 1VK8A 2XSJB 4KIAA 5KFUA 2LEPA 1KNZA 1K47A 1U4BA 2RDIA 1REVB 4NA3A 4TY9A 4XK8C 3KJVA 2VC1A 4PYDA 4A8OA 2Z57B 3CXCR 2JNJA 2COLA 2VOOA 1F9HA 4O44B 1UPPA 2XS7A 4DR4J 1RBAA 1Q81T 3POTB 4M95A 3DOKA 2XZDB 5D77A 1LWFA 4CT8A 2FJBB 2Y1JA 3M2VB 3M9NB 3FSIA 2B4PA 3CCUS 1HBOA 4DU8A 1X7VA 3V6DA 2AZ3A 3X3UA 1LWEA 3HKWA 4ZVEA 2C2ZB 3JQKA 1FXRA 5KOWA 1N88A 1Z4UA 4E8UA 2J76E 4I2PB 4U7CA 4LF8F 1N56A 1X60A 4NCGB 2NS1B 3LP1A 2XNRA 1G6BA 1ZBTA 1REGX 3A3PB 4ZCIA 3B4MA 1QSYA 1N5SA 1FERA 5ETSA 1DTTB 2OUGA 1CLFA 3DRPA 3JSYA 3CE8A 1O51A 4PWDA 1TKZB 1D9DA 1WSVA 2DCUB 3MUMP 4ECQA 3I31A 2H48B 2P6SA 1ZM4A 3SV3A 2B43A 2CRLA 1U7LA 4DFJA 3GFHA 2F9DA 3H98A 4HDGA 4DSLA 5E3QA 4DQQA 3K58A 1TL1A 2CXEA 3QATA 2V8HA 1R8PA 1WHXA 2UV8A 4DR3F 5HMYA 2DYAA 4LIRA 2KRBA 3LO3A 3H5YA 1Q79A 3H5UA 4FYDA 1KFSA 2NUHA 4E2FB 2XSJA 4XPCA 3MEDB 4B9TA 2KXHA 2O1PA 5HP1A 4LFBF 3E51A 3P96A 4K4VA 3RB6A 1JNZB 4DQSA 4LQ9A 3CJTA 3J80Y 3NKYA 4H54A 4Q8EA 4DF4A 2OMOA 2CPHA 4QCLA 3POTA 1GEHA 4JBCA 2BJ3A 2Y1LB 4YY3J 3J7Z5 1F60B 2H5EA 3J7AN 1YJ9S 5B0DA 5IWAJ 2B8PA 2FC8A 5CABA 4QYZK 1NPPA 2VA2A 3PW4A 2UV8G 5KG7A 2GMLA 3A8KA 4DV5J 4ZLNA 4HH0A 1XMOF 5E2QA 1Q8BA 3RRHA 1RWNB 2J5AA 3EYZA 2V2QA 2DNMA 3BH6B 3D5MA 5ETOA 3UNGC 4J9VA 4GKKJ 2YQ3A 1WNEA 1RTDA 2O66A 1GMUA 3GG1A 4NCGA 5CCMA 3KLIB 1HHSA 2ZZTA 1SJ1A 4QW8A 1JLBA 3AJ1A 3E3XA 3DRYA 2JH3A 4RW6A 1DTTA 3RYLA 1GXUA 3LGMA 4PABA 4J5OA 1TKZA 2OFHX 3OV7A 1F6TA 1X4CA 1OS5A 2DVIA 1HIYA 2LFVA 3K57A 1GXTA 3I56S 5IC6B 4NLWA 4Y2CA 4CT9A 4QIWD 1R31A 2NXJA 2Z8QA 1HBMA 1WEYA 3A3NB 4DV1F 4DWIA 5LMUJ 1H2VZ 1BQNB 2E5GA 3GYGA 2CIMA 3KUGA 2W9AA 5J2NA 2F4VJ 3MF5A 1CPZA 3PW5A 2QMXA 4IO1A 1R0CB 1H2TZ 4QR2A 1LOUA 3UNYA 3AQOA 2B7CB 1NK9A 3UDLA 1VQMS 1HWKA 3KNGA 4ELUA 4K5SA 4AYBD 2LLZA 3I4PA 1SCJB 4V19X 3DLGA 2MZQA 2EC0A 4YUDA 1HNVB 2I0XA 5AT1B 4HT5A 4RW7A 1Q7YT 1NB7A 3OUYB 2A2CA 1SQGA 2E5LJ 1HWLA 4JI1J 1JLCB 1YKWA 2YWKA 1DHMA 2BRLA 4ZPDA 4J37A 2LP4A 4OLPA 3BQ1A 2VQFJ 1BWVA 2ILZA 3M2RB 4IOAQ 3M1VB 1FO1A 1XNQJ 1MG7A 4JYAJ 4IG3B 4K59A 1KLNA 3LANA 4DV3J 3CW2C 4DX6A 2XSFA 2B9EA 4L73A 3QSIA 1H74A 1U6BA 3I0SB 1UL3A 2XS2A 1HPZB 2Z2YB 1EP4B 3IWXA 1S59A 3MM7B 2VOPA 3I5AA 1I94F 3NMAA 5BYSA 3ZZUA 3R27A 5DLGA 2KRRA 5DDPC 5C42A 2HIYA 2XNQA 2DO0A 2ZD1A 5M2RA 1J5EJ 4ZLJA 1J5OB 4UOHA 2VFTA 2XHWA 2D3O1 5HMXA 1VIXA 2CPJA 3N6MA 4HT7A 4CLPA 2MPUA 1UFKA 1FHTA 4PG6A 3BF4A 1RAIB 2LQJA 3B6BA 2CQ0A 2W2OP 1HQ2A
chains in the Genus database with same CATH topology
4X2BA 1JKHB 1N54B 4OI1A 1FRJA 4ZPTR 3R5DA 2KZMA 3DMJB 4BBYA 4C0BA 1XERA 1I6JA 2NZ4A 3FDSA 3HVTB 4OI0A 1M5HA 4WFYA 3D1QA 1VK3A 4DN9A 3SEOA 4ZA1A 2B0GA 5F9NA 2R8IA 3NCRA 4O23A 2CPDA 2I9SA 1UFWA 2PA8D 2XMJA 5B0CA 1HBNA 5JJBA 2RQKA 2IRYA 3M2UA 2M7SA 5GADI 5EDWA 4ZP6A 2FHJD 1C1CB 1KQFB 3IGVA 3DFEA 4I4BA 2Y0SD 3RU0A 1NZAA 2R7QA 5KG3A 5BR8F 4DFPA 2ZH9A 1IKYA 5KT6A 2CQIA 3NBPB 2YTCA 2LA6A 2HWTA 2YNGA 1LV5A 2EBGA 5KFJA 2W9BA 2RRBA 2WBRA 5GMKa 2D74B 4G6VB 2OLWA 4A8XA 4Q7AA 1DRZA 1FK9A 3LP2B 4N41A 4QIGA 1DQAA 1T95A 2GIQA 5KFOA 4RNNA 5KG2A 2GGPA 3DLKB 4DL3A 2A3JA 2VFUA 1VBZA 2OSQA 1MROA 4A8WA 4OX7A 2EK6A 2UUCF 2K8GA 3OXFA 1FXDA 2P9GA 2LU1A 3RW7A 1JLCA 3MR2A 4G1IA 4ZP7A 2AGQA 1ROFA 3TUJC 5AXNA 2WTFA 1KQKA 3HKZD 1EETB 1VRTB 3GR1A 3TVZA 3CCRS 4DMZA 4PPZA 4F4ZA 5J2MA 3C8YA 2IBOA 2HLTA 5KFKA 2HHVA 2LMIA 4KE5A 3C6UA 2LQBA 1FJGF 4A8KA 3AAWB 3PFEA 4H4MA 2ZH3A 3OTOF 1L3SA 2IVFB 3CC4S 3PNIA 1LW0B 2OPQA 3KG1A 5DO2A 5K8NA 1ZAVA 3RBDA 3KK2B 2GMHA 2M88A 1QUVA 1S6PA 3DRXA 3M2RA 4HDHA 1YIJS 1XMBA 2DNLA 2ROGA 3OXLA 1U25A 2PSZA 3TQ1A 5KG4A 1RT4B 1JXLA 5L1JA 3N6LA 3W2WB 5LXRA 3CCSS 3LAMA 3ZZZA 3MFIA 1R8HA 2FTRA 1T8EA 1M5SA 4NLVA 1Q78A 4X65F 5B0GA 4DV2F 5GVQA 5F9LA 4B08A 3JSRA 1D3WA 4Y34A 3LGNA 4PKDB 3W2VA 4G1QB 2J9DE 2BJEA 4IYQA 1UMJA 2KXFA 4X84A 1E6VA 1YTYA 2RKIB 3PVXA 1VQPS 1UA1A 1X4BA 1GTEA 1ZM9A 4NMLA 1VQSA 2ZJRQ 4QOTA 2OD4A 5KFXA 1S9FA 3NWGA 1SB6A 1YJNS 1JWWA 3CCLS 2ALZA 1HQUA 3MECB 3N4WA 3T1YF 4OZ5A 4XPEA 4X62F 5G4DA 4I69A 2PMZD 3GIJA 2JEJA 1JXEA 1X8DA 2BQUA 2YKPA 1L3UA 2ZJQQ 4JI5F 3FEZA 3MM5A 3MM7A 4PG5A 1HFEL 2N4DA 2MJUA 4CO0A 4YDDB 4MK7A 1V3SA 2GHWA 2OIHA 2ZKUA 2IAJA 3RAMA 1Y7PA 3MZIA 1S9GB 2PN6A 3SCKE 2KYXA 1C4CA 4RBVA 4FN5A 1F0XA 1TL5A 5E5NA 2CPIA 3U27A 4WF9Q 2OPSB 5DG9A 1VIOA 2CDQA 3CVKA 4PUOB 3GSDA 1KS2A 1YWXA 4OI4A 1HWIA 5A0YB 2BA9A 4NL5A 3TRGA 3DHXA 2O67A 3KMQA 1BQXA 5KG5A 1U49A 2AX1A 3OVAA 3PV8A 3DYAA 3B78A 4C11A 3Q8QB 1VQ4S 2XWXA 2BDPA 4IO9Q 2DH9A 3E2EA 3VCDA 1URNA 5CZVA 5KFTA 1N5TA 1V3RA 1DFDA 4J9RA 5F3TA 2PI5A 2X1FA 4K0KF 3MAQA 3TVKA 3H4BA 2CJAA 1N48A 3QYYA 4Y2IA 3I96A 4QR0A 3HP6A 2R9LA 4N76A 1WI6A 2HLUA 3K2YA 1DURA 3SQGB 2AU0A 1Q86T 2L08A 4PPDA 3T5JA 2OD6A 1X9MA 3N79A 2WRMA 3J7YU 2XY5A 1M5OC 3S6EA 2ASLA 1F5BA 1XR7A 3L3CA 3JTOA 2I5JA 3PRBA 2EG1A 2FHKA 5L9XA 4ZCMA 1U09A 4I6AA 2GIRA 3CDBA 4LSLA 5K5MA 4C0HA 5L38A 5DG8A 2MGZB 1L3VA 4ELTA 1VQOS 1RT1B 4MYUA 4K4ZA 2DHGA 3QAEA 3G8QA 4WE1B 3H2UB 1TKDA 3M6UA 2DISA 1UETA 1SKRA 2GNKA 4HEA9 1PSDA 1R0AA 4FNIA 4XIUA 1YHQS 2DR9A 1KRPA 3T5HA 4QZVB 5F3ZA 2K3KA 2DJWA 1MU2B 3CD5A 5LL6d 5CH7B 1LFWA 3KLGA 2DNQA 5KFGA 4RLEA 3DMJA 4KRWA 1Q8IA 3ZC4A 2RS8A 3HVTA 3TA0A 4ZLPA 1GAOA 5M2PA 3IR7B 3O3LA 4WFBQ 4K50A 3B8HA 3NS5A 4LSNB 2JDJA 4ID5B 4XAKA 2FJWA 2KYZA 2VD3A 5ADZA 2MSTA 1WF0A 5KT5A 4GC6A 5KFHA 2XG8A 2HGMA 2B9XA 2XO7A 2WSFC 3BREA 3OL8A 3HHLB 3K5OA 2D3ZA 1KTQA 3G6YA 1XC9A 2VKRA 1UWBB 3LALA 2XY7A 3M30B 1RWUA 1C1CA 5LSLA 1WG5A 3JTNA 3THTA 4C8LA 3LF0A 2YNFB 4ZPWR 1SV5B 4TQRA 3NBPA 2HPUA 4DL5A 1S49A 3HVRA 3RB4A 3U1MA 2MQOA 1B7FA 2BVZA 1REVA 2YWFA 5G0RB 1VQYA 2XI3A 2UVVA 2OAUA 3BZQA 3PO4A 4C8KA 1MW7A 2Q3PA 1WHWA 4M63A 5MAOA 5L1KA 4UY85 1R27B 4Z37A 3QGPA 4ECTA 1RT5B 2QO3A 5LJ3Y 4N56A 3SFUA 2HVIA 1IM4A 5FD1A 3ISNC 2YH0A 2DBBA 3QWPA 5E3AA 3UI3A 4NLUA 2RMLA 4O44A 4TU8A 4GO7X 4HVZA 1PO6A 5LMNF 2FVPA 2MKHA 1VRTA 4EYHB 2CPEA 3ENWA 2GQ2A 3EZUA 1SC6A 3LAKA 3Q8PB 3IFEA 3N28A 4C8MA 3BGLA 5CCLA 2E7XA 2J8AA 2P9CA 2VPWB 1RJJA 1TKXB 5I3PA 1U6FA 1LW0A 2DD8S 2YKAA 1QTMA 2QT7A 2X1GA 2RU9A 1RT2B 2LU2A 3OLAA 2J9EA 3DI6A 2FVCA 3BQ0A 2R8JA 3T5LA 3W2WA 2NXUA 1C4AA 2UUTA 4DL0C 3SCLE 4BWMA 2ZDPA 1U1MA 3CT9A 3DU6A 3M2VA 2HHHF 3EPIA 2DH8A 1OPIA 1MWYA 1BY9A 1N52B 3MMJA 4O3SA 1FKAF 1QM9A 4CTAB 4KQZA 2Q6BA 4F67A 5KAKA 4KBIA 2JC0A 1C2PA 4G1QA 2R2SA 3MEGB 5FDLB 3SZ2A 3Q22A 2ASDA 2MKCA 5B09A 3J7A1 2KJWA 1FEEA 3FRYA 4KB7A 1CG2A 1WHVA 5E33A 3SCIE 1HHTP 3CC7S 4Q43A 5E0OA 3MECA 3CCVS 1XNRF 2EPIA 3UCGA 3ITHB 5LT5A 3G6XA 2MHEA 2MJNA 1H2UX 1N5YB 4KTQA 1ZTTA 1ELOA 4I2PA 2JLFA 3U1NA 1RTHA 1Y0HA 2ZVSA 4KV8B 1FE4A 3CIMA 1NKCA 1YBAA 2IRXA 3BS9A 4NYOA 1XN9A 4WYWA 5JUMA 4LF5F 5FIIA 4ZKAA 1LQ9A 1TR0A 3DRRA 4EO6A 3V6KA 2IJFA 3N5BA 4K4TA 4IH5A 1HI8A 2IC3B 4LT6A 3MUTP 2W8KA 2VQEF 4W92B 4DL2A 4QWEA 1DJ0A 1IJEB 2AP6A 4DDFA 3K5MA 1XK8A 1S9EA 3CTRA 3TOQA 1JJHA 5AJ3F 3QZ7A 2GCFA 5D6GA 3OLBA 2BACA 1ZPWX 7FDRA 5KFFA 3QIDA 5IM0B 3MEEB 2OPSA 3FSYA 3H40A 4PUOA 3I0RB 4WKYA 1Q4RA 1G3OA 2AYEA 1JB0C 3ZZTA 3HVAA 3CPWR 2AGPA 3OW2R 1GXLA 1H98A 1R8BA 1S7HA 4O3OA 4ZK7M 4HHJA 4OX6A 4BC7A 2HRUA 1NKEA 3HHNB 1RT7B 2DNGA 4RNHA 2HNZA 3AH6A 1CC7A 1SJ4P 4R25A 5J1PA 2FPHX 1RQ0A 4X4PA 4DR7F 2POKA 2KG0A 4WFNQ 3UD3P 4EZ9A 1UVLA 2B4OA 2OH2A 1B64A 2JSXA 3O1LA 1X5OA 1TV6B 4DPOA 2NUUG 4BWJA 1HD1A 2P5VA 1Z2LA 2VBYA 3SQGA 3BEGB 4ITSA 2LVWA 1CVJA 1WWHA 1NHVA 2AD9A 3D2WA 4IFVB 4EGLA 2BJDA 2HNYB 2MZ1A 5B0BA 1C1BB 3V4IA 5KG0A 2E1RA 5DG7A 1UJ6A 4XDDA 3MOZA 2ZZNA 5B7WA 5LSOA 4FS1A 4TQSA 1T7PA 1R7IA 5T14A 1RT1A 1M0SA 1Y9OA 2O5DA 2B5JB 3V5RA 1DLOB 4QWCA 1VQ7S 2C2EA 2IBKA 2AJ1A 1HW8A 3G6VA 3DU5A 2DO4A 4J9PA 2AYBA 2V9WA 4UQTA 5DDRC 4JI7F 2B9WA 2J6UA 1NHUA 3VAIA 1JLEA 2G9OA 1QVFR 3CCZA 1N0UA 3V6JA 4IQXA 2J7KA 4PCQA 1D0EA 4N5SA 4PQAA 1S4FA 1T05B 3RW6A 3DLBA 3T6BA 2B4UA 4LF6F 1GQEA 3AA8A 4QYRA 1X4AA 4CI0B 4ZP9A 2DNOA 5AXMA 2FHMA 1LWCB 3EUNA 2EFNA 2ROPA 4ID5A 4OJ3A 4K2XA 2D41A 5CQGA 2KM8C 4NLDA 3G96A 2QA4G 2NREA 2FC9A 3J81Y 4RU9A 3MURP 4DV0F 2DH7A 1TFWA 4NXNF 3ISZA 1AXQA 4Y6IA 1U1QA 5EUHA 1KHVA 1RAJA 1SJ3P 4NRTA 4ZPCA 1FRKA 3IA0A 4FF4A 3IO1A 1O5JA 2J0XA 4QJVA 3T19A 4RW4B 3OBIA 4OX9F 5H9EJ 3HHLA 5A8KB 2HZCA 3EGWB 3M30A 1P8GA 3H4DA 3UCUP 2C2DA 2DNZA 2YX1A 3MEDA 2YNFA 2YKNB 1S79A 1SV5A 2RNEA 1RT3B 3O8WA 4WXWA 4ETZA 2KH9A 4DSIA 2JVOA 2A18A 2GHVC 4NLQA 1XBWA 5G0RA 3RB0A 3X1LB 3QO9B 4B9NA 3IRXB 3MM9B 2CQ1A 3PXGa 3GV5B 1NK6A 2DNHA 3VZIA 4M5DB 3EX7B 2LEAA 1X5SA 4IFYA 3RRGA 1RT5A 4X4VA 5I4MA 4B3RF 4RWWA 2UUWA 3T5KA 4OV1A 2LXIA 3QWUA 3K5NA 1WEZA 4QPTA 2YNHB 3ZZYA 1FESA 4USJC 1IKXB 3CMES 4NWBA 3EXYA 2J9CA 3M6WA 1XWLA 2DGWA 1S97A 3H2VE 1U1RA 4MIAA 1FXLA 3U1LA 2KT5A 2KVIA 2EFPA 1Q1KA 4QR1A 1TL3B 1N6QB 4RWXA 5D4PA 1UVJA 3KJVB 2ASYA 4ECWA 4MJKA 1QAYA 1TVRB 4AL5A 2AYMA 3HF5A 1K1SA 3OFFA 2B7BB 4H4KC 2CPZA 3M6XA 1HD0A 2Z4PA 2D7SA 2GC8A 5GAGI 2ZM6F 3CULA 5HLFA 1U45A 1RT2A 3CC2S 2K1RB 5F8MA 4ED1A 4RNMA 2ZH6A 4KO0A 5IXUA 4NX9A 1RI7A 4KKOB 4MYTA 2RS2A 4YEAA 1TFYA 1I1GA 3IN5A 3PW7A 3NCPA 3D1OA 4B9VA 4PXDA 4CTAA 4MMOA 4EUVA 2J0WA 4PRFA 1LWFB 2DNKA 1KQSR 2W4PA 2RF2B 1UP1A 4K4UA 5FDLA 1S0VA 4RBUA 5KFIA 3GILA 1QSSA 1BLUA 3S01A 3DDNA 4J9QA 1FRMA 2WB1D 3HHDA 1OSCA 2AJ4A 1TL4A 4Z2XA 5AE2A 2XY6A 3GB0A 4CZCA 4X4RA 1NK7A 4X4UA 3ZZPA 3OR1A 3ITHA 4NOHA 1HMVB 3KLEB 1H7WA 3C66A 3MPWA 4N8OA 1N5YA 2ZH8A 1HBOB 2HG4A 4YR0A 3H2LA 3OL9A 1S1VB 3C3LA 3OTEA 2PEHA 1M5KC 2IFXA 5DGBA 1WTBA 2GQQA 3KLIA 3IBWA 2IC3A 4M8LA 4K4YA 3QJJA 3DC2A 4TKTA 2PI4A 3HZEA 1YRTA 2W7PA 3PX0A 1HWJA 2AJFE 3RRKA 1HL6A 3GV7B 2EFOA 4NLTA 4R8UB 4DSEA 2IHR1 2E9TA 3UW1A 3IRWP 1Q7LB 4DSJA 4Y28C 4YB1P 2ZJPQ 3I0RA 1YRUA 1O0PA 4FXWA