2ROGA

Solution structure of thermus thermophilus hb8 ttha1718 protein in living e. coli cells
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
66
structure length
66
Chain Sequence
MLKLKVEGMTCNHCVMAVTKALKKVPGVEKVEVSLEKGEALVEGTADPKALVQAVEEEGYKAEVLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Heavy metal binding protein
publication title Protein structure determination in living cells by in-cell NMR spectroscopy
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Metal binding protein
total genus 11
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2008-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2rogA00
2BJEA 3QGPA 4A47A 2XMVA 3T9NA 2HLTA 1OQ3A 3CJKA 1R6YA 3BF4A 1TR0A 2EW9A 1MWYA 1FE4A 2IYGA 3BGUA 3HF5A 4HI2A 5KAKA 4EFAC 5B0EA 3BR8A 1AW0A 2ASYA 2FTRA 4A48A 1S6UA 2L3MA 1SI9A 5B0AA 1GXTA 2W4DA 4NPOA 1AFIA 1OPZA 2KYZA 2RMLA 1OSDA 2HIQA 2K2PA 4OJ3A 1U7LA 2IYIA 3KG0A 2LQBA 2VH7A 1YG0A 2OKQA 2OP5A 1X8DA 1CPZA 2GA7A 3KNGA 1LQ9A 1Y3KA 2ZDOA 2IFXA 2XMUA 2BBEA 1Y3JA 3HHLB 5B0BA 3DCAA 1CC7A 3LO3A 2OAUA 2GFFA 4A46A 2ACYA 3WDOA 2HQIA 1CC8A 3BDEA 3BN7A 1N5VA 3HDSA 3HHLC 4Q2MA 2GCFA 2AJ1A 2ROPA 2BUNA 5A6WA 5B0CA 3DXSX 3KKFA 1YJVA 3MZIA 2AJ0A 3CJKB 2W4CA 1JWWA 1N5SA 4HH0A 2K7JA 2FIUA 1VQYA 2ROGA 5IXUA 2HLUA 3E8OA 2K1RA 2HFNA 3LGNA 1FESA 1WD6A 2N7YA 3F44A 2XMMA 4OJ1A 4YEAA 3KG1A 2PD1A 1Q4RA 1TL4A 3QMQA 5T7LA 2QLWA 2RSQA 2ROEA 2JDJA 3HHLD 1SQEA 5B0FA 2GGPA 1YJRA 1SB6A 4ZA1A 4OJGA 3UDCA 2AW0A 2K7KA 2VV5A 4HH1A 4HL9A 2OFGX 1KVIA 1IUJA 1V3ZA 3TNVA 2CRLA 4A4JA 1AFJA 4QOTA 2KKHA 5F0UA 1TZ0A 2BJDA 3GZ7A 1OQ6A 2AP6A 1Q8BA 2W4PA 4Y2IA 3TOQA 1FE0A 1FVSA 3VTIA 5K9FA 1X0PA 2LQ9A 3FRYA 2KT2A 5B09A 3IWXA 2K1RB 1JK9B 2Q3PA 4Q2LA 4YDXA 1APSA 3MCSA 2GO8A 1YRXA 2QLXA 5T7LB 1RJJA 1X7VA 2G9OA 4OJHA 2QIFA 1S6OA 1YJTA 1MWZA 4FNHA 4Y2MA 4ZOSA 3BB5A 1ULRA 1KVJA 2XMTA 2GGPB 5F0WA 1TUVA 1FEEA 2QYCA 3FGVA 3HFKA 3LGMA 1P6TA 4NL5A 4DL0C 1P8GA 4F67A 1N5TA 2ZDPA 2XMKA 1URRA 5B0DA 4OIXA 3IWLA 1KQKA 5B08A 1QUPA 5B0GA 2GV1A 1VQSA 2FB0A 1W2IA 2N4DA 2RILA 1N5QA 2XMWA 4Y2KA 2LDIA 2OD6A 1XBWA 1Y0HA 3HX9A 2OD4A 1Q53A 2FHMA 2KT3A 1Y9OA 2XMJA 2N4CA 3BM7A 4FNIA 4DPOA 3K7RA 4HI1A 2LXFA 2RU9A 3HHLA 1YJUA 1FVQA 2OMOA 1GXUA 4U9RA 1TL5A 3TRGA 3I9ZA 5A6PA 2PGCA 4DN9A 2OFHX 2HFOA 1Q8LA 1FD8A 1K0VA 3FMBA 2BYCA
chains in the Genus database with same CATH superfamily
3SFUA 1RTDA 2X1BA 2FY8A 2PT0A 5AE2A 1F9HA 1RDRA 1NDLA 2C3MA 2NXUA 2OSQA 4E2FB 3KHHA 1M5OC 3H8YA 2EFOA 1RBAA 3MPWA 2YQ3A 4DG1B 1ITPA 1ICEB 4PXBA 3DLEB 4NLUA 4F3OA 1ROFA 3M2UB 3A8EA 4OJGA 1IM6A 1S1UA 2AEFA 1C4AA 4DQQA 2AGQA 4M5LA 2AZ3A 1NK9A 5F41A 4KHPJ 4B3MJ 4O44A 4HHUA 4B9VA 4QR2A 4FKYA 1BMQB 4M5GA 1ZA1B 3PYGA 3W9JA 4EWTA 4OYOA 4FZVA 1YJTA 1PKUA 1Y10A 1UMJA 2XMKA 1IWAA 1UTAA 3SV3A 1VQLS 1C0TB 2B8PA 2VL1A 2LLZA 2HS0A 1IQZA 1T94A 3OLAA 4DV2J 3QYYA 3HF5A 2Z4PA 2ASYA 3M1VB 3G8TA 3B54A 3VCDA 3QNWB 3DYAB 3KMSA 4NZ7A 2GAGC 5GAEU 2NR0A 1EKRA 4OYIA 4U67Q 2V9KA 2KM8B 1OSCA 2O66A 3ELHA 4IFVA 1QAIA 3EWGA 2HS3A 4BHQA 4FDFA 2RS8A 4F25A 2YNIA 3L4BC 5HQLA 2KKHA 3MMBB 5GAEI 5HQ8A 3LF0A 1VQPS 2LA6A 2BOAA 4H4MA 3AJDA 5ETPA 1FK9A 3D6FB 3T1YF 1LNQA 3DXBA 2BDPA 3G82A 2ZH1A 4DQRA 2XSJA 2RHSB 1JJCB 2CA9A 4DL7A 2E5GA 2DHSA 3JSMA 1NUEA 2DH8A 4W4MA 3HULA 4FPRA 5EX3A 1O0PA 4CLKA 3HJVA 2B6AB 1NHKL 1P27B 1PAUB 2H4YB 2NXEA 4USVA 2R42A 3PCOB 4ELTA 1CPZA 2CPJA 2XZDB 3DCAA 1VI7A 3RBZA 1GX5A 2AYEA 3TAMB 2MLXA 3TVYA 3J80Y 2F4VF 1LFPA 2E1PA 4I69A 5C2CA 2K06A 8ATCB 3K2YA 1NEEA 3MR7A 1MU2B 3B82A 2M8HA 2GMHA 2DPJA 4ED8A 4J9NA 1YWXA 2MQOA 2G2YA 1B0PA 3PEJA 3J81j 4Y2IA 4WCEQ 4X62J 2DK2A 1U1NA 5I3UB 4E98A 1I51B 4KQZA 3K5MA 1WF1A 1RT3A 5AJ3J 4K4ZA 5U47A 2MQPA 1ZAXA 5E3RA 5IWAJ 4ED2A 1RWKB 4DR1F 2YH0A 3CCVS 4LSZB 2ALZA 1LWXA 2VONA 4F3QA 4B9TA 2A6MA 2YNGB 3MAAB 2XY5A 2YXLA 4FYWB 4RNMA 3UDLA 2F1FA 4PQUA 1MROA 3C14B 4DCOB 4WTYA 5CYMA 2WONA 5E3CA 1RXOB 1N52B 1GH8A 2OPQA 3C19A 4EBEA 5J2QA 1UWBB 4YHHJ 3MFHA 2AJ1A 5A6WA 3RBXA 2CPDA 3A3OB 1KQSR 3SIPB 2IVMA 3I0SB 1X31C 4JI3F 1IBCB 1RT5B 1UA0A 4NA3A 2UVUA 3G2XA 4N8NA 3DRSB 4G3IA 1OQ6A 3ZXWA 4YQWA 5B09A 5IC6B 2GAHC 2MKCA 1F60B 3QT8A 3US5A 1QM9A 2YKNA 2DRAA 2D74B 2BKNA 1RCXB 4ZLPA 4B3RJ 3CJSA 3GFZA 1VQSA 3IA0A 4DUZJ 1YZ6A 1RGVA 1U0HA 3RGIA 2LECA 2GS8A 3RUBL 1JLAB 3CCSS 1S10A 2W4DA 1Y5IB 4CT8A 2FZKB 2ZUGA 4LF8J 4FF3A 5EWFA 2R7RA 1NZAA 1GT8A 2E1MC 2ZE2B 2EFPA 2BQUA 3OL6A 3BN7A 1KRPA 2YPYA 3K5LA 4ELUA 2R2UA 4DU7A 2DTJA 3N6LA 5D4PA 1S7IA 4TN2A 4PYDA 3M2RB 4U8VA 4CWBA 4U7UD 3KYLA 1T05A 2HNZB 3U7JA 3B8HA 3O1LA 3ZTRA 1C0UA 5HBMA 5F9LA 1AROP 4WP9A 2BRKA 1BQMB 4UUWA 4DLEA 2DH9A 1R27B 1T9TA 4IR9A 4GKJJ 3NL0A 1ZZFA 5HROA 3SQGB 4CRJA 4N7TA 3ITHA 1N5QA 2V34A 2YPZA 1TFYA 1NBEB 2V4JB 2H3EB 3TJAA 5KFVA 5FD1A 2EEYA 1HNWF 4TQRA 3ILIA 1RB0A 3EYZA 3TJ8A 1XMQJ 4ZPVR 3IWNC 3W64A 3MCOA 3Q89A 4C2MA 3EE3A 4QWAA 3CCQS 4Q43A 2B7CB 1CJVA 4A8XA 2F63A 2R8JA 4LRCA 3CJKB 2FY1A 3Q83A 5A8RA 3W66A 2YWWA 4A8WA 3A3PB 2L9WA 1RQ0A 2AW0A 1TVRA 3QGHA 3M30A 2DJWA 3MAHA 3HKZD 3PRVA 3T5KA 2R7OA 2YY3A 4L75A 2CZ9A 1IBKF 4NLRA 4RZRA 2UU9J 3S7RA 3U27A 2Y9HA 1X5OA 4DXLA 4DL0C 5GADU 1NO8A 3RRKA 5KT7A 4LMZA 2QYGA 3D28A 5KFFA 2M0GB 1N0UA 1XQIA 2COLA 3QT7A 3I5BA 3FSXA 3Q8VA 3WQPA 4O4GB 4CLWA 1F5AA 4ED0A 2XLIA 4F2RA 5D0EA 5GADI 3BO2A 2GFFA 4CLTA 1S6PB 3CCZA 2VG7B 1UAWA 4PQAA 2C2KB 5AXLA 4P52A 1EQMA 1FX4A 3FKBA 3IP0A 1VYAA 2OTJS 4QYZJ 1CG2A 5AE3A 5CZXA 1PBUA 1TELA 2P9CA 1WC3A 3VQSA 2RHQB 4ECQA 1DTTA 1GNKA 1BE4A 4RNHA 5EWEA 3BO4A 4D3HA 1F5BA 5EN1A 4WXOA 5KFEA 1N5TA 3KK1A 5CABA 1CEZA 2UVRA 3AA8A 1SKWA 2HYIB 2HNDA 1HKAA 3ISZA 1U1RA 5FDLB 2RNEA 2NYIA 4M5NA 1LXJA 1DARA 1LW0A 2OFHX 1OPIA 5KFQA 1R6YA 2H9ZA 2E5LF 1UPMB 4Q44A 3P5TL 1KSPA 1P1LA 3NBPB 1U6FA 2E5HA 1X60A 1SKSA 4UT4A 4KY3A 1WOPA 1WORA 4C8LA 3M7VA 4FN5A 2OPRB 2KI2A 3JB9k 4YB7A 3KLFB 2K3IA 1FT8A 2HMIB 1NLKL 2FGOA 4IRCA 4UOHA 1N8RT 1MN9A 3LANA 3SCKE 4F0KA 5DLFA 4Q45A 3SDEA 1VQNS 2YNFA 5J2NB 4ZP7A 5H9EK 5KFOA 5F8LA 1VOMA 4MFBB 2KO1A 2Z58B 2ADCA 2HFUA 3TZYA 2GMLA 4ECZA 1GEHA 3QATA 2DBBA 3N6MA 2M3DA 2NXJA 3SCIE 1QD1A 2QA4G 2Q3PA 4DBQA 1BWEA 3CC7S 2ZNZA 1FEEA 3MM8A 4R8UB 3MD3A 5B0GA 2HGNA 7FD1A 4MMOA 3U1LA 3VALA 2D3OR 2HAFA 2AX0A 3R3TA 2G2ZA 2YH1A 1K73T 1H7XA 3GIRA 3H25A 1U4BA 4DL6A 2M52A 1X9WA 2BE7D 2MZTA 3OTBA 1NKBA 4KT0C 3SI8A 2QA4S 2V67A 2EXUA 3CCMS 4ILLA 1N4LA 4CCHA 4OYAA 3KNGA 1MMDA 3W2VA 1IJFB 1IVZA 3HZEA 5DJBA 2KVQE 1VQ8S 3RRGA 1J27A 3FDSA 2XEXA 3CCTA 4HDGA 4X65F 1SCJB 2MJUA 4CLZA 4C8ZA 3BKFA 3WZ0A 4G1PA 4K4YA 3J80U 4DV3J 4QPXA 5CZVA 1JJHA 2IRYA 2R8KA 4YP3A 3EGVA 4PWWA 2RAQA 4YFUA 1MG7A 2UXCJ 2KYXA 3PO4A 2A10A 1YQHA 4OYWA 2AYMA 3C15B 3KLEA 2IAJA 2RT3A 4Z2XA 5K8OA 4HYKA 1FI4A 4TXSA 2UXBF 3C6TA 5K20B 1N5YB 3OXLA 4ZPTR 2VFRA 2IC3A 4LF7J 4QZVB 1FWKA 4OI2A 5J2PB 4NLDA 1KLMA 1GXUA 1RLDA 2GA7A 2DNOA 1V5VA 2RF2A 3C16A 3TEGA 1WSRA 2FHJD 5IQ6A 3FFIA 1S1TA 5ITHA 4OI6A 2F7VA 4U7UK 1I5OB 1CJUA 3M05A 2MTLA 3MM6A 3BGRA 2OP5A 2W8KA 2BEFA 1ZM9A 2EFNA 2LFVA 3DRPB 4NLWA 3M32B 4L73A 4OX9F 5KFBA 3KNAA 4DHVA 2N3LA 4O0NA 1TV6B 2MLYA 3E8OA 1NJWA 4I7FB 1VC5A 3VZHA 2XCAA 1CSJA 1KKHA 1IBLJ 3A3NB 4IO1A 2YWGA 3QSIA 1DURA 3GZ7A 3CMES 2IA0A 2ZD1B 1C1CB 3M2VA 3P8BB 3UN3A 1RT7B 3CE8A 1HWJA 3EZUA 4USUA 4RNNA 4NLYA 5A8KB 1RAIB 1UZDA 3CTRA 1N33J 3BBFA 1HQEB 5DO2A 3U1MA 1JLFB 2LXFA 3I56S 1KBRA 2GHPA 3Q2TC 3QGIA 2VUGA 4J9VA 2ASLA 1LFWA 4WXWA 1DQ8A 4C0HA 5GAHU 2EI5A 3HVTB 4KFBB 2F65A 4LSLB 5A8WB 1T7PA 1XN9A 3R6GB 3W5YA 3VR1A 2K1RA 1L3TA 4P6QA 1SKUB 4C4WA 2N82B 1ZM4A 3CCJS 3A8JA 4H4KA 4F02A 4IG0B 5KFPA 5I42A 2E5JA 5IT4A 5GAHI 1FA0A 4OZNA 4U8YA 3M8PB 3SYZA 4HACA 1WELA 3IBFB 2DD8S 4C98A 4EGLA 3R9LA 1HBNA 2XI3A 3ZTSA 4Y3CA 1M5SA 2QLFB 2GHWA 1UCNA 4TY8B 2BOPA 9RUBA 2LA4A 5HN0A 4IG3B 2WRMA 1FEHA 1IN0A 2X7IA 3UVJA 2DNRA 2U2FA 4MKAA 3HSJA 4OZ0A 4O3OA 2XSFA 4HDHA 1OYEA 1U1QA 3IAM9 4QWDA 1LQ9A 2XMUA 2FGCA 3PV8A 4JUZA 1BC6A 4Y00A 5KG3A 1TAQA 3FSYA 4CO2A 1QE1A 3GIIA 2DY9A 4LSNA 5KG5A 3UNYA 1JLBB 3QMQA 2X3GA 1HBUB 3A1YG 1U6BA 2LCWA 1FNOA 1LWCA 4CO1A 3KFWX 2YWHA 2HFSA 5E5NA 2F4VJ 2JFKA 3M6VA 5D0GA 2WVDA 5GAGU 1REVB 3OXGA 1KD1T 1TK5A 3QIPA 1WJ9A 3KK3A 3MEKA 4F50A 3OV7A 1HA1A 2HGMA 4X4PA 2QO3A 2KHCA 3J7ZT 7AT1B 1XJWB 3D54A 2N4CA 3C8YA 4JI8F 1RTHB 1S4EA 4O3QA 1FE4A 4YR3A 1DTQB 5KFXA 4WFBQ 3MM7A 3RJMB 2V8HA 1TKTA 2W1BA 5E0OA 1GMVA 4MH8A 4UZCA 3JYTA 3O6QA 5GAGI 3K5OA 2UUTA 3W2WA 3EZ5A 1IR0A 2AIRB 1RWMB 3OSPA 1RTDB 2DISA 2KB2A 4U7CA 2H48B 2CQ3A 3KHGA 1JLGA 3CIZA 2F5GA 4ZKAA 4OHVA 2LKZA 4WTOB 3K0JA 1AFJA 3V81A 2HRTA 1IBMJ 3UO0A 3GR0A 2DGQA 1Q8BA 1RLCL 3TYTA 2LQ9A 3NRBA 1VQ7S 3H20A 3TWZA 2P8IA 1IKYA 3FC9A 3ZZYA 3OFHA 1G4CA 4PG5A 3CIMA 1S1UB 4IH5A 5ETTA 3LQVA 4O44B 2VOOA 5L1JA 5HLFA 2FHMA 2PI4A 1NB7A 4WJBA 4ZVTB 1XMOF 4ANCA 1F2GA 2UUCF 3T9NA 5CD4A 1X9SA 1FJGJ 1R8AA 1SI9A 5L38A 2I5JA 4ES2A 4FS2A 3OXFA 1WTBA 5KFDA 5KG0A 2OAUA 2V6AA 2F3JA 1WG4A 3UCZP 3O3LA 2HLUA 5E3AA 3F44A 2WW8A 3HHLD 5B0FA 2P9GA 2VV5A 2AMCB 4K8RA 4XO0A 3N28A 2KFZA 3IM9A 2AJ2A 5KFIA 3UN5A 4X4SA 1FXRA 1R8CA 4WU2A 5HANA 8RUCA 4NYPA 4M63A 3D6TB 4J9OA 3Q22A 1SIWB 4IFVB 5H9FJ 2DCLA 4OI0A 5ETRA 4A8SA 4DV4F 2YNIB 3QRPA 4OL8A 1CBKA 5J1EA 2N4DA 4Y2KA 1LWEA 4C3MA 1Q8KA 2FZGB 2J0WA 4QU7A 4H4MB 2B5JA 4FBTA 2DR8A 1FK9B 3DLGA 4OFZA 1RK8A 2L9DA 3G82B 2DR6A 4YB1P 4EZ9A 1HW8A 4JOUA 1S49A 1HI8A 2DPIA 1X4BA 2XSJB 2QL7B 2I1RA 5LOQA 3JSMB 2XHWA 3KJVA 1BD6A 3LP2A 5LXRA 1SXLA 2W7AA 3CC2S 1F6TA 2ATCB 2NS1B 5RUBA 3ENAA 2Y1IA 3ISND 2ZVIA 2XQCA 2XYGB 2OLWA 3FCVA 2LQ5A 3KG4A 3CC4S 4HTIA 2K7KA 4TU9A 3PEHA 1WC6A 3Q8SB 2UUBF 5M2RA 3GV5B 5CAAA 2CRLA 2RQCA 2B4VA 3BGLA 4KSEB 2IM2A 1DZ5A 1JXVA 3KOAA 1JK9B 4CQ1A 2YX1A 4CZCA 3WIVA 4TYBA 3MR6A 2UUWA 2VBYA 4UW2A 1FDNA 3DN9A 1QSYA 4OX6A 1S0NA 3FCHA 4IRKA 3HHKA 4NOHA 5CYQA 4F2SA 3LOUA 1FFWB 2ATLA 3OTEA 1EARA 1Q95G 4FYVB 1RT3B 1RHKB 2HVIA 3G8QA 2EK6A 3CWJA 4LFAF 3CMQA 3UR3C 5C25B 1WI8A 4B9LA 3BPDA 5KFHA 4ED1A 4ILMA 1NH7A 3GYXB 2F40A 2HNYB 3HHLC 5B0CA 2JSXA 1CS4A 4KGXB 4PQUB 1MROB 1HIYA 1NCLA 2PFDA 5CYMB 2WONB 2DIUA 2MQMA 2OPQB 5J2QB 2P6TA 1YHQS 3CNQP 2AX1A 3DDNA 2IM1A 3GLJA 2ZM6J 1TKXA 4ID5A 4WPAA 2HRYA 1YJ9S 4LRAA 3U02A 1NPRA 4NLQA 4ZJQA 2QYCA 2HHUA 1SQFA 4JP8A 4KPCA 2C2OB 1YRTA 1YIJS 2MDAA 1LWFA 2CIMA 1X4EA 1XBWA 3BM7A 2W9AA 2VPWB 4W92B 3L09A 3PKYA 2YWFA 3HHEA 2YKNB 3PJXA 2IYGA 5KFNA 3D5MA 1YZ7A 1G7CB 4AL5A 5BJRA 2CWXA 2ZJPQ 1U0HB 3VAKA 3VQTA 2QT7A 3J7Z5 4CNYA 3ULHA 1WSVA 2LXIA 1CULA 1HR0J 3MHYA 2POKA 2VG5A 4LQ3A 4B9NA 4DJBA 2E5IA 1M90T 3ENQA 4EYIB 5FIIA 3QO9B 2HZAA 3FK4A 5IFMA 3AAWB 2LEPA 3IWXA 1HWUA 2GJFA 1HBMA 2CVIA 5LMUF 1TL1A 1T05B 3RZAA 2PSZA 4KO0A 2WAQD 4ES3A 3PR4A 1C0UB 1BY9A 1EIYB 1GTEA 2CNOB 1F3FA 4MKBA 1U1LA 3GJTB 1Q8LA 4YR0A 2BABA 6FD1A 5KFAA 4IFYA 1SC6A 2FPHX 2XG8A 4USTA 5B0AA 5HROB 3ITHB 1DLOA 3R5DA 5B0BA 1XR6A 4KC5A 3M4XA 1WUUA 1LK7A 4P9SA 2QN6B 4CLYA 4KYZA 3GP9A 1O6XA 2MKIA 4XPEA 1GFWB 1SBRA 3EVOA 3PNIA 3V4IA 2FLOA 3MEEA 3IN5A 2F8HA 1CJVB 4R25A 4DSKA 4F4ZA 3T6JA 4P7VA 2V8DA 5AXNA 3CT9A 2FJEB 1X4GA 2ZZNA 5A8RB 2A2DA 3G9CA 5CA5A 4DV1F 3MCSA 2KG1A 4ZOSA 6AT1B 3CCLS 1TKZA 1TVRB 4KBIA 3L7UA 4DPTA 3BBCA 2EKYA 1HI1A 3TP2A 1NSQA 4EO8A 1TFWA 4B3MF 4KHPF 2RU9A 4DPWA 4MK8A 1BWVA 3H2LA 3QGPA 1LV5A 2C2RA 2G4BA 1ZAWA 1HWKA 3ZZOA 1IKXA 1Y5LB 2UVWA 4N8OA 2BJ8A 2BV3A 3CSKA 2OSRA 4RL1A 3OVBA 4CO3A 3PY8A 2XLJA 2OKQA 1R0AA 2IM3A 3D3BJ 5CD4H 2HK3A 4UTGA 2A2CA 3V6HA 3A4TA 3PYEA 5KG1A 2R7XA 3C6UA 4I4BA 3UD3P 1R89A 1YDLA 4C8NA 3R7SB 2H51B 3CDUA 2HZCA 4DV2F 5KOWA 3FEYB 3IR6B 5BYRA 4LF9F 3T19A 3PW0A 2CQCA 1FXLA 4WZQA 3AD8C 3HK2A 2DIVA 1RUSA 4U6PA 1PO6A 1VRUA 4I6WA 4Q7AA 2CQDA 2E9RX 3TR5A 2VD3A 1REGX 1FNMA 4PEOA 1PC4A 1UZHA 2M5YA 2VFSA 4H54A 1ZETA 4AL7A 1DTTB 3GU0A 3OTOJ 4NCGA 3CCRS 1HYSA 2XMJA 4IKAA 4JI5J 2J6SA 1QSLA 4BC9A 4P2SA 2HVZA 3GR1A 1Y00A 3T6BA 4NEYA 3KK1B 4ZP9A 2JL9A 4DX6A 2F9DA 2HNDB 1WHYA 5KT3A 1OJ4A 4WP8A 4IRDA 1WACA 2IY5B 2R7UA 1LW0B 3V4MA 1OYDA 2BUNA 2CVEA 1FXDA 3DRRA 4OZ2A 1HHTP 3BGOP 3N9UC 2R4FA 1K1SA 3RTVA 4YEAA 1WEYA 3MCNA 3K8VA 3PXGa 5GMDA 4X4TA 2J9CA 5BR8J 5IT0A 2CQIA 1JLEA 3CJ8A 1IKVA 4DR7J 1X0PA 2ZH9A 2YNFB 4DSLA 2ZZMA 2EFQA 2DEIA 3UD5A 3MCMA 4DPXA 2VDHA 3GFYA 5CXTA 2O1PA 1RISA 3DLKB 2PMHA 3FBEA 3EDQB 2XI2A 5DM7Q 1SV5B 2XO6A 3ADAC 3OR2A 2HHWA 5EGYA 1VS3A 2QMXA 3MM8B 3QFHA 2JFDA 5AJ3F 4OZ3A 4NLSA 3UD4P 3JAMY 3KLVA 5IWAF 3RW7A 4CLUA 4UY8T 4IUFA 1IXKA 2PC6A 1C2PA 1RHQB 3AD7C 3BPSP 1AA1B 1HD1A 1HMVA 2AJ0A 2FJAB 5LSLA 3JTNA 3AQPA 1CJTA 3NGRA 4Z7YA 3IFEA 4EBDA 4XDCA 2NZ4A 3IM8A 3HSZA 1DAXA 5LXYA 3W2VB 3SXLA 3RBDA 2MKSA 2ERRA 4O4RA 2X3DA 4IOCQ 2CJQA 2V2ZA 3KDNA 3A8KA 2DRBA 4NA2A 2BQ3A 3UI3A 4DQIA 1RTIA 1Y5NB 3B4MA 4DV0F 4UUXA 2WK4A 1X5TA 1X4DA 5D3GA 1S6QA 1Q53A 2HVEA 1TL7A 3KLEB 1G2EA 4RW4A 2IAJB 3VAHA 6FDRA 1L3UA 3GSIA 4ZP8A 1MWYA 1WF0A 2CXEA 5B0EA 3AOBA 5AT1B 2D3ZA 1UW9A 1H7WA 1OY8A 2IC3B 2KJVA 4J37A 4NPOA 4URGA 2P5VA 1B0VA 4B3RF 4TQSA 2G0JA 1KLMB 4CNZA 4DUZF 4OX8A 2LEAA 4ZITA 1Q1KA 3M8YA 5I3QA 3M9MB 3HHDA 2D1CA 1SIZA 4JI2J 3M8RA 3NKYA 2RF2B 3C16B 3FFIB 1S1TB 3PM9A 5JMNA 4Q8FA 2M8DB 1CJUB 3UFCX 3MM6B 2GGPA 3BGRB 1B0TA 1MN7A 4CO0A 4ED6A 1KVIA 4ICLA 1HHSA 3MMCA 4LJMA 3CJ4A 4LFBF 1VBXA 3WHIA 4I6AA 3K5NA 4LFCF 1CLFA 2B8QA 1NAQA 4OYMA 2HK2A 4ATNA 2FYXA 1VFJA 3GIJA 3CJ2A 2XWYA 3O5TB 4DL4A 1WHVA 4IH7A 3M2VB 3RW6A 2W8LA 2BM0A 2HURA 4JI4J 4FBUA 1QAXA 3UQSA 4ZP6A 1SH0A 1HFEL 3V6DA 4PABA 1NZ8A 1TUGB 2PIIA 4GKJF 4C0BA 3ZZPA 3OVSA 4RUCA 5LMNF 2CNLB 3EVMA 1BUXA 1FERA 1MMLA 5KG7A 1FJEB 4HT7A 1KQGB 2A0FB 1NDPA 5A0YA 2NPFA 2AJ4A 1XMOJ 3N5FA 2UUCJ 5F8GA 3OT9A 3NGKA 3E01A 3VZIA 1XMQF 3NS6A 4QIVA 3BQ0A 4ZVFA 4UOFA 2Z57B 5C24A 4NI2A 4U96A 2KXNB 5LJ5Y 2MYFA 4DEZA 2K1RB 4I6YA 3GE9A 1R31A 3N6NA 3AT1B 3H42A 5J1NA 2AF6A 3BB5A 2LYVA 5J2MA 3HSDA 4KR0B 5I42B 3DI6A 1WHXA 3GWCA 3NP5A 4K4TA 5B08A 3CO0P 3E2EA 4OV1A 4ZVUB 5GMEA 1Y0HA 4HACB 2DITA 5A6PA 3I5AA 1U8WA 4K7QA 5LT5A 3R7NB 2R7QA 1Y11A 3PW4A 1HBNB 2UU9F 5KTQA 3QIDA 3I32A 1WI6A 1YBUA 3AY0A 2KH9A 3KMQA 2DVIA 1XK8A 2BQRA 4KE5A 2YBVA 2RKIA 2E66A 5IM0B 2XS5A 3H5XA 3DGVA 2ZHAA 3DMJA 3NAHA 2VPYB 4F0HA 3UVJB 2FIUA 1YJWS 5ETKA 2EG2A 3KLGA 1GX6A 3R5AA 4YB6A 1V3SA 1N56A 3MEGA 2XM3A 4FYXB 2O3DA 2IMOA 5D77A 2CPIA 2B56A 2MZ1A 1PILA 3HJFA 1QE1B 2C3YA 4LSNB 1FCAA 4RNOA 4QR1A 3E51A 3POTA 3L7PA 5IV4A 2AV5A 2GVZA 4QR0A 3AODA 4MKYA 1LWCB 2KZMA 1VHFA 3C3LA 2UUBJ 3KUHA 4C0OC 3FRZA 4M5KA 4IOAQ 2B43A 3BH7B 2J76E 5ETLA 3VGTA 2HW3A 3LAMA 3ZC4A 3QIPB 3KK3B 1U2FA 1YJNS 4OJ3A 4RW9A 1TL3A 2BJ3A 1LW2A 2Y3YA 2XY7A 1T9XA 2DHHA 3NNCA 3JQKA 3CO9A 1NSKL 1U02A 1Z2LA 2W7OA 3ETOA 4N5SA 4NYOA 3JQMA 1T9VA 1N88A 3MM7B 1TKTB 1RAJA 3B6BA 4J9PA 2JDJA 3JYTB 1VC6A 3LP1A 4OLOA 4LFAJ 3W2WB 2OFGX 2PO4A 1IUJA 1FWLA 3DOMA 2JOQA 4QIWD 4EI2A 1JLGB 4RU2A 1SC1B 4DV6J 3GYNA 3IC1A 2V2KA 4Y2MA 4K0KF 2ZBCA 2MKHA 1UVJA 1RA7A 2QMWA 4CDIA 5KFJA 3V81B 3W3SA 2IIHA 1UJ6A 5C7PA 2HEKA 2KT3A 3P3DA 4K59A 1RU1A 3IS9A 1WOSA 3HZGA 2DXFA 1IKYB 2W7PA 2WHOA 2QX0A 3J7AN 1T02A 4OX7A 4DR4F 5DQIA 3I5CA 4I2PB 4PG7A 4ECWA 5HLFB 3OFFA 2BZ2A 1WF2A 1Y3KA 3SZ2A 1T9WA 5LM7E 1U49A 3CULA 5DLGA 5K14A 2MSSA 2KTQA 5F8IA 3PFEA 3CJTA 1NU4A 3KXDA 2MKKA 3BN4A 2I5JB 2QLWA 5E41A 4LR8A 3HO1A 4URSA 2CPXA 2MGZA 4P74A 3MPUB 3WIUA 4J9SA 4DQSA 2CWKA 2B4UA 5L1KA 1VJQA 3MAQA 2KG0A 4O3SA 1GQEA 2ASJA 3IWLA 4LBHA 3THPA 2UXCF 4ZIVA 2XMAA 2J6TA 4MKVA 4QIFA 1EETA 2PGCA 1RBOB 1WDTA 1JXLA 3RAQA 2MY7A 1D9FA 2OIHA 2OEJA 2FQQB 3CJ0A 1VQKS 5J1EB 2KYZA 4L72B 1LWEB 4LF7F 1Y7PA 4JI6F 5HMZA 2WCXA 4FKXA 3IAS9 1JLQA 1Q7YT 2JRSA 3JAMU 2B5JB 1N36J 2F8MA 3O8WA 4KPYA 3DLGB 3HVWA 4IR1A 2IDEA 4WZMA 2OPSA 2RSQA 3MOZA 4A8YA 4N76A 2OGUA 2W01A 4Q5VA 3LP2B 2C2MB 2VKZG 2NXNA 2B3TB 4TNOA 4F7VA 4K2JA 2YQ0A 4ZHRA 3KJNB 2GO8A 1X7VA 1WNEA 2F9JA 3H2VE 3Q2SC 1RKJA 1IBLF 3SSSA 2MQ8A 5EUHA 1B70B 4KGVB 2OD4A 4JI0J 2R2RA 1RTJA 4BLGA 1JNZB 1W2BR 4DOZA 4OYPA 2IA6A 4YOEA 3HHNB 4UOGA 3BR8A 4DV1J 2CQGA 1Q0NA 1N54B 4B9MA 2G1HA 2MB0B 4BWJA 3F0NA 3NOGA 2IYIA 5CYQB 2LQBA 2E7WA 1N33F 2OEMA 3PR5B 1UETA 2XC9A 1ZPVA 2ZZTA 1F2HA 2H5JB 4YY3F 4C8YA 4ID8A 1RBLA 2HBZB 4ED3A 4CH0S 4X4UA 1QTMA 2N7YA 2W9BA 1W7WA 2G1DA 2ROEA 2JEFA 3TA0A 3UDCA 1WEZA 3CMAS 1O5JA 2FJDB 5DDRC 2V94A 1U1MA 2R7VA 3AJ2A 2B4OA 2JEJA 2P9EA 1SJQA 1EKSA 3ZZRA 1CS4B 4I2QA 1RHUB 4DR6F 4K5RA 1V9OA 2XZWA 4DFPA 4QQBA 4LF9J 3SSQA 4P71A 4DCPB 4DSIA 4MK7A 2XBPA 2VQEF 4HTJA 4AL6A 1TKXB 4ID5B 1RT4A 4NZ6A 4A8KA 1R8PA 2AWZA 1YK9A 2Z2MA 2GQ2A 4A48A 3PRBA 4NCBA 1U0SA 1LWFB 3MEDA 1YX2A 2ZH3A 3KJFB 1FRIA 2M2BA 5HMYA 3GONA 3KKFA 3IMQJ 5A2QY 4OI4A 2VBZA 2W25A 3MMAA 3LWMA 2ILYA 3T41A 4ENOA 4KGKA 1TK8A 1V5IB 1CULB 2CPYA 3FRYA 1L5UA 2H1YA 3MTJA 1UVKA 1ZM2A 3IR5B 2JX2A 3CJ5A 3HD1A 2VG5B 2VODA 1VIOA 4C9DA 1VRTA 2XYPB 4OHXA 2XMWA 1PGZA 4RWWA 1S79A 3R5BA 4PXCA 1R0BG 4L74A 1AXQA 3C66A 1YVFA 4AYBD 1HBMB 3S8SA 3VGSA 1JLAA 2BYCA 4A47A 3W63A 4GKKF 2CQHA 2IPOB 4KO0B 3MR3A 3BSOA 4C8KA 3HVAA 1UEUA 4GVLA 1FDBA 3H90A 3LO3A 3MWBA 1U47A 3UCUP 3QAUA 3HDSA 3M8QA 4OZJA 5ETVA 3GPAA 1JWWA 2XB2D 5GMKa 3GJQB 4IFYB 3PO5A 1SL1A 4IDKA 3M2RA 1RT6B 4USWA 1WD6A 2ZHOA 2KM8C 1DLOB 3NGUA 2BR0A 4FYYB 1QSSA 4WK1A 1WHWA 1XNRJ 2P2CB 4LT6A 1NSAA 3D68A 4OMFG 3A8IA 4A8MP 3V4IB 1KHWA 3MEEB 1SC3B 2NCKL 1ULRA 5IT9Y 3H40A 3QGGA 3FGVA 4L6V3 3FBBA 4PAAA 2GV1A 1IBMF 1FF2A 4OV6A 2C3UA 1H6KX 2CZ4A 3TO8A 2HFOA 4G6VB 3ET6B 4JI1J 2DR7A 4OZ1A 1BQNA 2HBQB 1TKZB 4EFAC 2KU7A 2CDQA 2R3VA 4QPTA 2R8GA 4MK9A 2V4RA 4DV0J 3CDEA 3F41A 4LBIA 2BE2A 2GMJA 2HBRB 3MPDA 3KTQA 1PYSB 3B78A 5L9NA 2D41A 2DY1A 5JXSA 3OBIA 1IKXB 1S0VA 1VLYA 1FJGF 4DF8A 3PIOQ 1R0AB 1FRJA 1TK0A 3GCXP 2F4FA 2PEBA 1N34J 3CPWR 4IYQA 3C6UB 2DNMA 5K9FA 2FJVA 1SH2A 4PWUA 2RB7A 4ZVGA 2I2YA 2D3UA 1HI0P 2HVDA 1RT1A 1QLNA 3OW2R 4I0WA 3KLHA 2K8GA 3DHXA 3HT3A 4PWDA 3SMZA 4LR7A 4WE1A 3NXZA 1EQ0A 1HWLA 1PJ7A 4EYHB 4LFBJ 1RADB 5DQHA 5HSPA 2FZCB 1CQNA 4F26A 4M95A 1FKPB 4LFCJ 4NCGB 1HYSB 2QRRA 3MECA 5L1LA 3W7BA 2BBEA 1SUQA 2ACYA 3DLJA 1VQ4S 2XZTB 2B0GA 5KT2A 4EEYA 1QTNB 1JKHA 1KFDA 1XNQJ 3VHQA 3KHLA 1O8BA 3V5RA 2W2PP 5ETSA 5LMNJ 4OYZA 3DRRB 4DX5A 1N48A 1TU0B 3CDBA 1HD0A 2L41A 1VQ9S 4J9UE 1SKRA 4XDDA 1OIAA 4FNHA 2XY6A 3PX0A 3K5PA 1P8GA 3LP0A 2V8PA 2RQ4A 1JLEB 1IKVB 1LOUA 3GFHA 4ECXA 4MIWA 4K50A 4IH6A 1NJXA 3LALA 3KLIA 4EO6A 2Z0GA 1RAEB 4M5HA 3AD9C 3BKTA 2R7SA 1FRMA 2NZCA 2QTWA 4DSJA 3CD5A 4DX7A 1N6QA 2ASDA 3KLFA 4RR5A 3K57A 1KOOA 3OR2B 3I55S 2AT1B 2C3PA 2IHR1 4XPCA 2VOPA 4B9UA 5J2NA 2E1AA 2RRAA 2BKPA 1U26A 4OHWA 1MMNA 3NCQA 3UE2A 2P6SA 3DDKA 3OLBA 2VJUA 3BDPA 2HQGA 4WK3A 4ED5A 4OHYA 1HMVB 4M5JA 2PMZD 2Q1LA 4J9RA 3GSDA 3CUNA 3MUMP 1CJTB 2FVRA 2G9OA 3MM9B 2H65B 4YN3B 1Q82T 4CT9A 3NCRA 4WFZA 1UP1A 4I1TA 3OFGA 2VC1A 1RYRA 5HP1B 4DV7J 2M4MA 3D0HE 1S1WA 1RTIB 2ZM6F 3IO1A 3W9HA 2J7KA 4YS2A 3BSAA 3DLLQ 2QL5B 3Q8QB 2HIQA 1S6QB 1TUWA 1DQAA 1FDAA 5KT4A 1TL7B 3OL7A 4FXVA 3H5SA 2AGOA 3NNAA 3UR0A 1FD2A 4YMEA 3CEDA 3X3UA 2BXJA 5DDPC 3R1LA 4QOTA 3MMJA 4RLEA 4DUYJ 2W4PA 3ZZ0A 4KRWA 2JNJA 1OY6A 1HR0F 1QJHA 5KOXA 2GGPB 5MLCV 3IBWA 3ZFVA 5ETMA 1RWOB 5ETNA 2BVZA 4A8OA 3MMCB 1W2IA 4KIAA 1FKOA 3D0IE 4X4NA 4DN9A 2MZRA 5DETA 2B9WA 1FTCA 4IQMA 2EWHA 4QWEA 1WG1A 3SCJE 4M1KA 4KHRA 4K0KJ 2WSCC 4Z37A 3N79A 4QJVA 1EJ7L 2QFJA 2DNQA 3HLUA 2ABYA 3PJ9A 4PXDA 3EXCX 3D9BA 2PE8A 2Z30B 2MQLA 2VA2A 1TV6A 3DXSX 1YRUA 5B7WA 2K7JA 1RYSA 2ROGA 5K5MA 3V6DB 1HNVA 4P2FA 5A2QU 2FHOB 4YR2A 2XS2A 4FF4A 4KGMA 5CCLA 4DR4J 4RKUC 2HAIA 3ZTOA 3QT6A 1YGYA 4LIWA 2O67A 1S0OA 5F0UA 5HI7A 5A0YB 1O51A 2JH3A 1H98A 2XS7A 2OHDA 2WB4A 3E01B 4JYAF 1EAYC 2DGSA 1X4FA 2N3OA 1PJ6A 3MPVA 2ZDPA 1URRA 3R27A 4OIXA 5C24B 4NI2B 2J9DA 4N47A 1HQEA 4DL2A 4S0MA 1SH3A 2KRBA 1S1VA 2HFZA 3NWRA 1RU2A 3CD0A 3TQEA 2OMOA 2KXHA 5DGBA 3MDFA 2XWXA 3H2UB 3P6YC 2KN4A 5J2MB 1KWMA 3DI6B 2V68A 1OPZA 1R6VA 2YQ1A 3NCPA 4ECVA 2CJBA 1WKJA 5JVHQ 3OHAA 4LSLA 1XERA 1S99A 1CC8A 2FVCA 4KHMA 9ATCB 1YJVA 2ZH7A 2CZVC 3BYPA 3T3FA 3CJRA 4JV1A 4B9SA 2ZOGA 4UQTA 1F9EB 1D8YA 2RKIB 3LAKA 4HL9A 2BANA 3PJWA 2MSTA 3MUVP 2JC0A 3DMJB 1S9GA 3ILLA 4JI6J 3TUJC 2CPFA 1OO0B 2FVPA 3OFEA 1HARA 2VJVA 2Z2LA 2YKQA 3OUYB 3S1TA 4ZVPB 3KLGB 2Q43A 3OTCA 2DT9A 3MEGB 1NJZA 2CUYA 2MHNA 4LF4F 1UFLA 1X9MA 5G4DA 4CO5A 5IT9U 2DXEA 2FC9A 2CQ2A 1Q86T 2BACA 2AEJA 3HT0A 3OL9A 2GNKA 2ZWPA 3VWSA 4F4YA 4NX9A 4Q8EA 4QYZK 3POTB 2DR9A 3I6PA 4RBTA 1VLOA 3TVZA 4OYXA 4PG4A 1ZS6A 3TX8A 3NMAA 4BDPA 2LXUA 3O2IA 4ILRA 4USMA 2EC2A 3OTOF 4M5DA 1UFKA 4B3OA 1Q8IA 4JI5F 1H3DA 2GO9A 2ZBRA 1RWUA 3BZQA 2JEIA 1H73A 4GMKA 4OJ1A 2HWTA 4RW9B 3P96A 1TL3B 1LW2B 5HVFA 4ZDNA 4C7QA 4A4JA 4CLLA 2ZITA 3FBFA 4W90B 3I87A 3SCLE 5I3PA 5DM6Q 4IO9Q 4DR3J 3RB4A 3NNHA 4YY3J 2J5AA 3WC2A 3SBMA 4O0IA 4N41A 5E3QA 3LP1B 1ZA2B 4ZCLA 2IJNA 5IC4B 5T41A 4B3TJ 3DOMB 4ZVSB 4WIIA 4J9LA 2R7TA 2J9DE 2YVSA 5BR8F 4OZLA 1ZOTA 1J2VA 3Q8YA 5K8NA 1HNZJ 4DR7F 2QEXS 3GV7B 4NLOA 1RTHA 1FD8A 1UPPA 4C8OA 3OTDA 4DR6J 1AW0A 3G6YA 2CJXB 1S4FA 3SFGA 2C42A 2I38A 5C2GA 2ZBQA 3R1HA 1D8ZA 4EU0A 5E33A 3TZWA 3IS9B 3G8SA 1T8EA 4ANEA 3BJYA 2VQEJ 2IBOA 1AB8A 1VJWA 2SXLA 1R8HA 3LGNA 4J9KA 4AXIA 3Q8RB 1WDDA 2M9KA 3IR7B 2JJ4D 4LUBA 3W9IA 3MM5A 1VQOS 4ECRA 4FF1A 1URNA 3DOLA 5K14B 3ENWA 4P75A 5CYJA 1JLCA 3DGPA 2UZAA 2GJIA 2DO4A 1N32J 3WX4A 1WWHA 2DNYA 3HVRA 5D6GA 2GW8A 2DNNA 1M5VC 4PG8A 1P6TA 4F67A 4IQXA 3PACA 1F5CA 4RX6A 4NCAA 2MGZB 3FUYA 4C48A 1A6LA 1QVGR 2D7SA 3TQ1A 3VV2B 1NRKA 2HQCA 3GG1A 3OVAA 4DZ6A 2YWEA 2AYBA 2QA1A 4F4WA 1HPZA 3EGZA 4NZ0A 1U09A 2OELA 1G1XA 4F8RA 3HI9A 1I3OB 4JV2A 1U25A 1R3NA 1SJFA 4LIRA 4BC7A 3BEGB 1CC7A 1RAFB 1EETB 1UA1A 2ROPA 2DB1A 1JIHA 4A8QA 1YTYA 1NDKA 1R7IA 1WC1A 4Y28C 4Z7CA 5T7LA 4JV5F 4GKKJ 4CP5A 1FRLA 1JLQB 2JLEA 3M8WA 1RAGB 2UUAF 1T95A 1R43A 3BYRA 2ZOMA 3JSYA 4DSEA 1MWQA 4C11A 1E6YB 5C5JA 4RW6A 1RI7A 4JI2F 1B64A 2M7SA 2OPSB 3ZTQA 4KJIA 2AHOB 4Q0BA 5KT5A 5D15A 3QAEA 4RBVA 4DLGA 4TYAA 3GG0A 3C46A 5LSRA 2VHGA 5C42A 4HEA9 3HHLA 4ZHRB 3HM9A 1W25A 3NGDA 3BF4A 5BYSA 5KAKA 5CCMA 2MEWA 1KLNA 2R2SA 2C1EB 4MIBA 4PZVA 2ZJQQ 4R5PA 2DHGA 3QFWA 3TUIC 4EBCA 2HHHJ 2RUSA 2Q66A 1UEKA 1F1BB 1RTJB 2MQQA 5D78A 3EXYA 4HH0A 1Q79A 4CLFA 4JI4F 2Z2ZA 1XIQA 5LSOA 4Y65A 2Y1LB 1T3OA 2EK1A 1FKAF 4DCJB 1T3NA 3EDRB 2BA9A 1UVLA 2CADA 1R8BA 1QAJA 5HJXA 2J8AA 4B3SF 2KT2A 3PDNA 1RWWB 3ILJA 4RW7A 2W9BB 1HW9A 1YRXA 4NXMF 1U1OA 4DS4A 2ACMA 3BBBA 1QAYA 2E44A 1H2TZ 1J5OA 2RU3A 3CCUS 3GFXA 1FFSB 3I96A 2C22A 4I2QB 1U48A 5DS7A 3FEZA 4ZCIA 4L3NA 1Q16B 4J90A 1F9FA 3UCGA 3RBEA 4CYUA 3CCWA 5C25A 4DR2F 2XULA 4ZK7M 1P9QC 2XYHB 1NJIT 1SL2A 1TP7A 1DY3A 2VH7A 3MXHP 3TJ9A 1D3WA 4AT1B 3TI0A 3NMRA 4ZS6A 2HNYA 1RT4B 1TMMA 2MPUA 3MD1A 3RR8A 2ZC4A 3L3CA 2NSBA 2NSCA 1RAOA 4OI3A 3T5JA 3DOKA 3NS5A 2IRXA 3H4BA 1Q4RA 2FLLA 2DNKA 3MEDB 4BBYA 4QCLA 2GJ2A 1SPBP 1VC0A 2QSFA 2DGWA 4DPYA 3ZNJ1 1NH8A 3M8ZA 1VRQC 2O5DA 4MAKA 1YLXA 3MMAB 1B7YB 2VF3A 1S6OA 2XTJP 2IJFA 4K4SA 5G0RA 1VIXA 1KQKA 3DKDA 4RWXA 1S7HA 3CDWA 1LKZA 2OD6A 2QLJB 1ZAVA 2XNQA 2GIRA 3OJSA 1E6VA 4MT1A 1PC5A 4LBPA 2QA2A 4LRDA 2XHCA 4ZVEA 3FMBA 3M9OB 3AB4B 1BQXA 3LW5C 4ES1A 3BGFA 1NXIA 3AOAA 1VRTB 3K17A 3DFEA 4I67A 4E0DA 2OPPA 4YB5A 3WDOA 2YKMA 3G86A 4FVCA 1ZH5A 3VAFA 1JJ2R 3CXCR 1HQ2A 4QW9A 2PI5A 1NM2A 2NQPA 2DGXA 3WX8A 3D6MB 2C2DA 2EBEA 1JMTA 2MKYA 1NPPA 4G1QA 4RUBA 1SB6A 3QJJA 5KFWA 1G6BA 1UW4A 4CLPA 3TUPA 2CFXA 3QO9A 3M8QB 3WBZA 1Q81T 2LEBA 1B4SA 3TOQA 5DZ6A 4AXJA 4IDKB 4B02A 5KFKA 2LQ8A 1T03A 5HMWA 4ECUA 4FYDA 5H9EJ 3THVA 3MTKA 1M1GA 3PHEA 2J7UA 3JS9A 1NK0A 1Y9OA 4X64F 2JEGA 3SEOA 2HHXA 3UDVA 4DV6F 3AJ1A 3QLHA 4DDFA 2HLTA 5DG9A 4HI2A 1RP5A 4C97A 4M5MA 3M6WA 2ZWOA 3W8PA 3HP6A 5FJ4A 2G0CA 3BKUA 2Y8WA 4C6AA 4X2BA 2WOMA 3DRXA 1D0EA 3PTWA 3MR5A 1TMJA 1BQNB 4NRUA 2HIYA 4EZ6A 3Q24A 1RKIA 1J5EJ 4M94A 4DI6A 1S1XA 3AFGA 3G6VA 3FJ2A 3LA0A 2BE2B 1C1BA 1WC5A 1X4HA 1T11A 3FVYA 3LWLA 4NLGA 1U24A 3W1YC 3R6LB 2Z8QA 2ZHBA 1KFSA 1SVDA 4LF6J 1EZZB 4R0EA 2FVSA 2NUUG 2JC1A 4ELVA 4ZIWA 1HQUA 2L9NA 2VFTA 3R5CA 4HI1A 3WC0A 1LK5A 1H72C 4KH1B 4DFMA 2Q6CA 5KFSA 1DHMA 2QMUB 1S76D 3ISNC 4CTAA 3SQOP 3NLCA 5GVQA 4JI7F 3J7A1 1RT1B 2CG4A 4ECTA 1IJEB 1U2RA 1H2UX 3KLHB 4DFJA 1GXTA 4J5OA 3PG9A 1UEVA 4PWDB 3AB2B 1OMSA 2KT5A 4WE1B 3JXOA 3EM1A 5F8MA 3LH2S 4Y6IA 1D1UA 4R0JA 2ZH5A 5H9FK 4NYZA 4J9MA 2I0XA 1TAUA 5BXIA 3VGVA 4ECSA 5I4MA 4X66F 2BMBA 3MECB 2QZ8A 1SUQB 1HL6A 3CB4A 4X4VA 4RNFA 2DNHA 1FE0A 4L3KA 2JWNA 5HBMB 1N36F 4LF5J 5KFZA 3NOCA 4C3LA 1RABB 3QZ7A 1JKHB 3ZZTA 4RBUA 1ZBTA 1CJKA 3A13A 1I6JA 3EZOA 5EDWA 2DNGA 2HKEA 5SUHA 3HCXA 3UW1A 1KOHA 5FLXY 3MGJA 5KT6A 4EUVA 2B51A 1AT1B 2KFYA 1VQMS 4DX8H 4KV8A 4AE5A 1OQ3A 1FX2A 3LPEA 2VIHA 3LP0B 1ZM3A 4JYAJ 4HHHA 4KH0B 4USJC 1OS5A 2K2PA 3HXMA 3KLIB 3QQCD 2IFXA 4P72A 4H4OA 2OJ3A 4A46A 1KC8T 3ETMA 1HBOA 4JI0F 2RQMA 1RTZA 5H1SV 3QRRA 2AJFE 3BSCA 1MLAA 1N6QB 4TU8A 4GRSA 1VR6A 1SJ4P 2CNNB 2QC3A 1KHVA 2QSWA 3M30B 3OJUA 3RU0A 1H74A 1FNXH 1ZTTA 3BH6B 4RW8A 2Z56B 1JB0C 3D6HB 3P45B 2PFFB 3VGUA 3O44A 3EMTA 3DLKA 3W5ZA 1NSPA 1SV5A 3HMJG 2Y1JA 3ONQA 3TRGA 4GVBA 1UVNA 3H5UA 2CJKA 2DXDA 2RE1A 4W98A 4LF4J 4NWBA 4DV5J 2VFVA 3MUTP 3NGSA 2QGFB 4WFYA 4HVZA 2HWHA 1S1WB 3CDAA 1AZSA 5ADZA 2VZ9A 3KK2A 4IOBA 2J0QD 1P9YA 2A1BA 3PX6A 1S57A 3K8WA 4NXNF 2UP1A 3H98A 1L3VA 2BJDA 2ZH8A 3QJPA 4N56A 2WSFC 2ZBIA 3Q8PB 3DU6A 4ZPCA 2M70A 3EICA 2ZKUA 3BR9A 4PXEA 1YKWA 2BJ1A 3UDEA 1PCAA 2CJ9A 2VQFF 5KFLA 5HJYA 2DGVA 2PA3A 4GO5X 2CQ0A 1FWPA 3T1HJ 4M8LA 2V9WA 4U9RA 1IM4A 3BQ1A 5D4NA 3I0RA 2V8GA 2XMVA 3I31A 2H5IB 2EFGA 3N01A 1ZTWA 2DR5A 2CQ4A 1FKOB 3KG0A 2EKNA 1X8DA 4DMZA 3FMWA 5IQQA 1RWVB 3CW2C 1HNXJ 3VF0B 2KXFA 4Q2MA 5ETOA 1GTHA 2CG8A 2GIQA 4K4WA 1VBKA 4LF1A 3SDEB 4ZJLA 4TLQA 1RA6A 2WB1D 2Y0SD 5KFRA 4URQU 4ZLJA 3GTYX 2VICA 5EWGA 1P1TA 3CVKA 3FZ2A 3JTOA 2J9EA 1XEZA 1XMBA 2HGLA 3NEKA 5E2QA 2DNZA 1JJ4A 1HNVB 1GMWA 1MWZA 3GJRB 5K8MA 3EGWB 4USKA 4NL5A 4ZJOA 2RDIA 3R2DJ 2YKOA 1KS2A 4RUHA 1BGXT 2FC8A 2R7WA 1XNRF 5SZTA 3FNNA 2FJWA 1KTQA 1FVQA 1IWGA 3OQ2A 5HMXA 1Z1ZA 4ZPDA 1RZMA 3UNGC 1MNEA 4AFFA 2MJNA 1Q78A 1TR0A 4LF2A 3BS9A 2A6OA 5KG2A 3AA9A 4F4AA 4KKOA 1NKCA 2AD9A 1S1VB 2HQ3A 3RB3A 2VDIA 2CKWA 3MF5A 1RT2A 2RDJA 3N4WA 5DDQC 1T9UA 4JI1F 1PSDA 3TA1A 1VCTA 1A0OB 4WFAQ 4P2XA 2KVIA 2MQNA 5IV3A 1Z2ZA 3PRDA 3TAPA 2M88A 3GIKA 2I6WA 3G6ES 2J7WA 1FJCA 2AEMA 3W62A 2WVFA 2NLWA 3AXKA 3FEXB 3C6TB 1NNDA 3HFKA 2BANB 3K89A 4JV5J 2GVDA 1S9GB 3JSBA 4F0MA 2WBMA 1N34F 2UUAJ 2UXDF 3K7RA 5D0RA 1NK6A 7FDRA 2J0SD 4RU9A 4ZN3A 3R97A 1IR2A 1WKKA 2Q79A 5IM0A 3CF5Q 3BSNA 2NPIA 4N77A 2V4QA 1XTZA 1Y3JA 4MJKA 2XLKA 4DN0A 4WP3A 5DG8A 3NGTA 2VBWA 3GYGA 3MZIA 2W4CA 2C2EA 1WG5A 3T1YJ 2R2TA 2JVRA 4ZPBA 1NHUA 2EVZA 3N5BA 3GCWP 1RAAB 4I56A 4M5DB 2DGUA 4B3OB 1EX8A 1TZ0A 1HNIA 1S97A 2HHVA 3D1HA 4UQGA 2X51A 3VTIA 1RACB 3F73A 5HO4A 2CQPA 1EP4A 2HPUA 4NLVA 3J7YU 1JQGA 1RCOB 4BCAA 4K4VA 2ZOFA 3LGMA 4PRFA 1RHMB 3ILOA 4ERDA 1XNQF 2CYYA 3TUZC 2LU2A 1RE1B 4O3NA 3LPYA 3DC2A 1KVKA 1S9EA 2BM1A 5L9XA 3EPIA 3IG1A 2E7XA 1TQLA 4KGZB 4O23A 1ELOA 4B3SJ 1KNZA 3J7YI 5KG4A 3HPOA 2X1GA 4PUOA 4NXMJ 2ILZA 2YKPA 3GJSB 4HR2A 1FDDA 3OL8A 2MZSA 2ZUAA 4OYBA 2KJWA 5D4OA 1WC4A 4ER8A 2PN6A 3QT5A 1QDUB 2W9CA 1H0HB 4DR2J 2LMIA 3DM2A 4HHJA 2WSEC 1IQTA 1RWXB 1K0TA 4DZDA 4DR1J 3Q0AA 2V2QA 2FVQA 3FCWA 4G65A 2LP4A 1X5SA 3VAGA 1VK8A 3SV4A 4CH7A 1ZPWX 3I4PA 3R5GA 1Z4UA 3THTA 3IRXA 1M5PC 4WFNQ 1F3VA 2GQQA 2C2NA 3KWMA 3L7OA 3MM5B 4NLXA 2B9YA 3DOLB 4PR6A 2H54B 2NREA 3QPIA 4DFKA 1JLCB 3DGPB 4HT5A 1A9NB 3AQOA 3PX4A 3CGIA 4JI3J 1FO1A 3EX7B 5FLXU 2FTRA 3CJQA 4WBFA 3J81Y 4I2PA 3D67A 1X0FA 1K44A 3KUGA 4FXWA 2E7VA 2XNRA 2K3KA 2CPEA 1UL3A 4DV7F 1HPZB 4J91A 4QW8A 3L95X 3G96A 2BJ9A 4MIAA 1OY9A 4RPFA 3I82A 3OR1A 2XMMA 2FD2A 3W60A 4USHA 3I4HX 1IKWA 2W2QP 1Y4ZB 3ZZZA 3TX0A 4Y0FA 1IR1A 2W24A 4NMLA 2V2VA 3T5HA 4C3KA 2C3OA 5JVGQ 5T7LB 3MOJB 2GZOA 5JJBA 2G2OA 2BW7A 1KR4A 4AD6A 2DKOB 1H2VZ 4H4KC 4DR5F 2B4PA 1VMBA 2DEJA 3V2UC 4C11B 4FVMA 4EK2A 4RW6B 4DUYF 2HHQA 4K5SA 5M2PA 4Q0BB 3PW2A 2L3MA 1KTVA 2BW2A 4F3MA 2RJZA 1KQFB 4QIEA 3Q8UA 2HVHA 5C42B 3HHLB 5BYQA 2I9SA 1VDHA 3BDEA 3GV8B 5F8NA 4WWSA 2H5EA 4X64J 2MMYA 3G6XA 3DLHA 1Q5YA 3GIMA 4UY85 4R5PB 1FESA 4NRTA 3PIPQ 4AQYF 2ZEJA 3IGVA 5L8RC 4FF2A 2AGPA 3HSGA 2YNHA 2HRUA 3G4SS 1B99A 1HNWJ 2VG6A 2QLXA 3PW5A 1NKEA 3UPFA 2QL9B 1DJ0A 2BRLA 4NA1A 3KJQB 2JLFA 3GB0A 1DQ9A 3VAMA 4NLTA 4RJVA 3K59A 1UJ4A 4V19X 4RW7B 1N0VC 1PG5B 2OO4A 3DDIA 3D66A 3IBCB 5CH7B 4CO4A 4DG1A 3PVXA 2EW9A 3DLEA 4XK8C 1S77D 1J5OB 4ZLNA 3M2UA 2X1FA 2RMLA 1U6ZA 2VPZB 1YG0A 3K58A 1GK8A 2DYAA 1KN6A 5JUMA 2APOA 4QYRA 2RRBA 4CLSA 1IBKJ 1M5KC 3H4DA 3FBCA 4ZPAA 2DH7A 4CYUB 4CI0B 3HFVA 3LGHA 1CQMA 4DSFA 4JI7J 4RUAA 3TZZA 4ZVRB 2V5HG 2DNLA 3TNVA 5D4LA 3VAIA 1C0TA 3W61A 3DOKB 2WVCA 3LTOA 2E29A 3Q86A 3NY0A 4ZCMA 2RQKA 2ZH2A 1V6HA 3M1VA 3DYAA 4KB7A 2HSEB 4X66J 2L08A 3R5JB 1RHRB 4X4OA 1EB0A 4LREA 2AKWB 2BX6A 2EG1A 4PG6A 2HQFA 3SSRA 3P5BP 1SJ1A 1K0VA 5G0RB 1K9MT 3H59A 1YITS 3QZ8A 2ZH6A 3BQ2A 2BJ7A 1YSJA 3GQCA 2ZFHA 1E6VB 3KJVB 3R8YA 1N5VA 5AE1A 3MMBA 5DG7A 3NS7B 8AT1B 3I9V9 4WYWA 4DL5A 2KL8A 1GMUA 4I68A 2AZ1A 5EHHA 2NYHA 4XTTA 1JNRB 3D3CJ 2OPPB 1M0SA 4X84A 3NAIA 2WVBA 2JVOA 1I94F 1VQ5S 2YKMB 1S72S 4ZMMA 1RWPB 4K2XA 1WC0A 3DRYA 2R9LA 2E5LJ 1UFWA 3G71S 4OJHA 2LQJA 2GC8A 4G1QB 2VASA 3M6UA 2B6AA 2DO0A 4ETZA 2HWIA 4KAIA 2ZH4A 3Q23A 3IXQA 1OWXA 3HX9A 3FQLA 2EPIA 1F0XA 2RDDA 4WFXA 1FRKA 1DRZA 1PYOB 1T03B 4DR3F 2L48A 2QFIA 2J8SA 3TAMA 2BJEA 3GILA 5DDOC 2HZVA 4E8UA 1MU2A 1X5PA 2W2OP 5KFMA 4B3TF 1TKDA 5F3TA 3C2PA 3H7HB 4F04B 4P73A 2RRNA 1HNZF 3QLHB 2UV8A 4J7CA 3TAQA 5DRKA 1RT6A 3DU5A 5L46A 4LVNP 3UWTA 3MFIA 5I3UA 2A18A 2VPXB 2LU1A 2AQ4A 4Y2AA 1XWLA 2J0XA 3V6JA 1YBTA 3R7BB 2WOMB 2AP6A 2U1AA 2V69A 4FXDA 5HQMA 2H4WB 4QBUA 5IS2A 1PAEX 2VBXA 4Q2LA 2YNGA 3MAAA 1S1XB 1FFGB 4JBCA 1C1BB 5MAOA 3NWGA 4NASA 2BE9B 3C14A 4ZCKA 2RILA 4NXNJ 2LDIA 1MSWD 2V50A 4LVOP 4X4QA 1UWBA 4WU3A 1FRHA 3D1QA 4X65J 3AOCA 3ET6A 1N32F 2QLBB 2FDNA 3CCES 3I0SA 4OI1A 2DGOA 3MURP 4G1IA 5L39A 1S48A 1BLUA 1HQUB 4ECYA 1RT5A 2EC0A 2ZDOA 1W26A 3T5LA 2FLPA 3D0GE 2VQFJ 4P2MA 4PYAA 2IJRA 3RYLA 3FZBA 3DRSA 4CTAB 4EMDA 4TY9A 3RR7A 1JXEA 3MI7X 2LVWA 3W5XA 2UXBJ 4C8MA 4ED4A 4K4UA 1UVIA 2ADBA 1PYTA 4WIQA 4AUKA 1HLWA 4O3RA 1VK3A 4LRFA 4ZLLA 5M2UA 1ZYQA 1G3OA 1KONA 1SC4B 2VB6A 3TARA 4L76A 4DU8A 2MLZA 1YJ7A 4Y2CA 2D9PA 2IRUA 1KVJA 4RO0A 1SJ3P 1TUVA 2XGQA 1TL1B 3ZNUA 4WF9Q 4V1Ak 4B17A 1PBAA 3PFOA 1FTRA 3RAMA 5THWA 4OX9J 3ZO7A 3ZZUA 2PMWA 3B4DA 2ZE2A 2VA3A 1YI2S 3HKWA 3PZPA 1CJKB 4X4RA 1PJ5A 4B08A 1FKPA 3IRWP 1SL0A 2FLNA 1VBZA 1NMEB 4GO7X 3J81U 2FHKA 5IZHA 2HNZA 3VAJA 1PIEA 1FRXA 2E1CA 4KV8B 1R0CB 2CAJA 1BQMA 3V6KA 1B3TA 2YKAA 2QJ3A 2AYGA 4UOCA 2HHHF 4H4OB 1M1KT 1V3ZA 1V3RA 1HBOB 3SQGA 3DHWC 1T9YA 3AHPA 2V4JA 2ZJRQ 1KEKA 5F9NA 4CH1A 2HS4A 3EVWA 4DPUA 5KFUA 4FNIA 2R8IA 1QY7A 3RAXA 3EUNA 4MTPA 2KFNA 2J6UA 4RW8B 1K47A 2PDAA 3N0VA 1U1KA 3CJKA 2YX7A 2YX4A 1NK5A 2RS2A 2UVVA 1NB2A 1OSDA 3QBCA 4JV0A 2HHSA 2MXYA 3P49B 3RRHA 4WKRA 4X62F 2XO7A 3DNCA 3EGNA 4GVBB 3G87A 2UXDJ 1B7FA 2I8EA 2GQCA 3RB0A 3W65A 2CQBA 3OHBA 5KG6A 4I64A 1H38A 4QIGA 2CJYB 1VHIA 1ZZNA 2DRDA 3M9NB 1KDNA 2C2ZB 1RWNB 1JX4A 1WTFA 2IMWP 1AZSB 5LJ3Y 3KHRA 3EJMA 4TKTA 1VQ6S 1VRUB 3KK2B 1APSA 3MM9A 4QWCA 1UJ5A 4NLPA 4KTQA 4O4GA 1HHQA 5EX0A 3FSIA 3ICLA 3BREA 2IVFB 1QUPA 1VBYA 1NPKA 4YHHF 1MW7A 5HP1A 2OTLS 3IGNA 2B9EA 2HG4A 1YJUA 3CJ3A 1S6PA 4OLPA 2VG7A 2HQDA 1ACMB 4ED7A 4ZVQB 3JSRA 4F4XA 4HKQA 2B9XA 2ZBPA 4QU6A 3KUEA 3I0RB 1S12A 2PEHA 1N5SA 2Y1RI 3OSNA 2UV8G 1QUVA 3KG1A 2PD1A 1EHWA 1TL4A 2PA8D 2MZQA 1GMWD 4NE9C 4CIOA 3OPKA 2Y8YA 3TA2A 1WOOA 3PYDA 5FDLA 4JI8J 4ZVOB 4NMXA 2AU0A 1TTHB 2OUGA 3EPGA 3E3XA 2CJAA 4NEZA 1CVJA 4DS5A 4ETXA 3VVTA 4OHZA 3NBPA 2D3O1 4LF8F 1K1QA 2DNPA 2OPRA 3QWUA 3UN2A 1GXLA 5E7OB 1GAOA 3D7SB 2HMIA 1BHNA 1RSCA 2FJXA 5KFCA 2FUG9 1S5ZA 1BXNA 4MFBA 2Y0BB 3RB6A 3W8GA 1U8SA 4A8FA 3T9ZA 3BV8A 2VC0A 4LQ9A 3PKMA 1AUSL 2KDOA 2QV6A 5T14A 3A12A 4OZ5A 1M1HA 1I1GA 4KKOB 2G13A 2XCPA 5CQGA 4R8UA 2ZKTA 2NUHA 4J9QA 1RT2B 4F36A 2XGPA 1M5HA 1LEOA 1NJYA 1RJJA 1D9DA 1J5EF 1L3KA 4DWIA 2YWKA 2F8EX 1S0MA 2KZZA 5AXMA 3AH6A 2W2MP 2G0IA 4CM0A 2VKRA 5D3GB 1U2CA 4ZPWR 2KHDA 3PYFA 5HVHA 4RW4B 2V0NA 3KDOA 2WTFA 2Z2YB 2EFVA 2BKOA 2IDLA 4LF6F 2MKJA 2GVDB 3GMGA 1NK7A 1RHJB 2NXCA 2D9OA 2YTCA 1WEXA 2JZ5A 4ANDA 4DR5J 2E9ZA 2VU5A 5K8PA 4YUDA 2OH2A 1AUDA 2GCFA 2DHAA 3TZXA 2RUGA 2EBGA 5AXKA 1T0TV 3C15A 2JLGA 3QWPA 1UWAA 4PPZA 3VVUA 1Q5VA 3S6EA 2ZNYA 4USIA 2HHTA 1XC9A 2R8HA 1Q7LB 2RVJA 4DV4J 1N5YA 4ZA1A 2IM0A 2E1RA 3PW7A 4ICLB 2DGTA 2QE5A 1AYEA 3MPYA 4WYLA 2GX8A 5J2PA 3OUYA 3ZTPA 5E3PA 1UKUA 2GIFA 5F0WA 1C4CA 2KRRA 1FJ7A 3CD7A 2AJQA 3T1AA 4AQYJ 1HNIB 4YDDB 1EP4B 1TL5A 3I9ZA 5HAOA 4LF5F 3DRPA 4FP9A 3M32A 4DPOA 4DQPA 2MZJA 3R2CJ 2CQ1A 2JHEA 5HL7Q 5DZ7A 1K8AT 4I7FA 1VISA 3HFZB 4PCQA 3RG6A 1U7LA 2MY8A 3L9ZA 4F4KA 2HBYB 4CM2A 2A3JA 1S9EB 3QSYB 3LUYA 1KP6A 3IG1B 1NDCA 2RD5C 3F56A 2CNKB 2HQIA 3PHTA 2RIJA 2FHJA 4GC7A 3M8SA 3JTPA 4OQJA 2HFNA 2ZD1A 4PUOB 5DQGA 1C1CA 5KFTA 2HHPA 3TEHB 3U1NA 1RT7A 1SQEA 5A8KA 2LDYA 2C28A 4U95A 2QG9B 1QVFR 1RAHB 1XR5A 4QWBA 4FPIA 2IBKA 1JLFA 4UZBA 1L3SA 3D1OA 5DGAA 3JQJA 4P10A 4XIUA 2W9CB 1FHTA 4BWMA 3DM2B 4PPDA 4M5IA 4ZN1A 1VGYA 3D4JA 3HVTA 4ITSA 4WKYA 1S59A 2CPZA 4KFBA 4LR9A 3IRXB 2CPHA 5A8WA 4XAKA 4TU7A 5ETQA 3P4UB 4LRBA 3BGUA 3OD2A 2ZVSA 1S6UA 3QJLA 1AFIA 1DBDA 3H0PA 5KFGA 4IG0A 1XR7A 5LL6d 1U1PA 3NG8A 5A76A 5F8HA 5HATA 4MYTA 3M8PA 2DHXA 2OEKA 4DF4A 1VQYA 3S01A 3M6XA 2GHVC 3HD2A 4JB8B 3H5YA 2WW4A 1SJRA 1YJRA 4HH1A 3D2WA 2E9TA 4DV5F 3DLBA 3TW0A 2ZC3A 4K4XA 2B7BB 4TY8A 4ZVHA 4IG3A 3OR1B 2V8VA 3TVKA 4DL3A 2QIFA 2D69A 2XMTA 1IKWB 1UVMA 2GVZB 3MR2A 1X4AA 2IVYA 4TLRA 4V19J 5F3ZA 4O3PA 3AXMA 1LXNA 1I94J 4D3GA 4ALZA 1HWIA 1YBAA 3ENVA 3CD6S 2VFUA 1U45A 4DV3F 1D9AA 2WZ1A 2V63A 4FS1A 4HLBA 2DCUB 1JLBA 2OI2A 1HBUA 1A7GE 4Y34A 4GC6A 5HVGA 5L1IA 2OMLA 3T1HF 1DFDA 3QRQA 2CDRB 4P7TA 5IXUA 2Q6BA 1NK4A 2MHEA 5LMUJ 4DUTA 5F8JA 1WKLA 2ALYB 2N7CA 3BO3A 1REVA 5HK4A 1NHVA 3X1LB 5J1PA 1HNXF 1FVSA 1D09B 1E6YA 1S9FA 5D8HB 2WBRA 4YDXA 5D0HA 1X4CA 4MYUA 5IOLA 1DTQA 3TANA 4TVAB 2X1AA 5KFYA 5B0DA 5CHCB 2HFVA 2FB0A 4BS2A 2W2NP 2O01C 4PKDB 1NK8A 3FQKA 2FJBB 4UF4A 2YNHB 2WVEA 2RH3A 1SQGA 2VG6B
chains in the Genus database with same CATH topology
3SFUA 2YKNB 2R7SA 1RTDA 2X1BA 3PJXA 1FRMA 2PT0A 2IYGA 1NK6A 7FDRA 2J0SD 5KFNA 5AE2A 4RU9A 3D5MA 1RDRA 2C3MA 2OSQA 2NXUA 4DSJA 2Q79A 3CD5A 3KHHA 1G7CB 1N6QA 5IM0A 2ASDA 1M5OC 3CF5Q 3KLFA 3H8YA 3BSNA 4AL5A 5BJRA 2ZJPQ 2NPIA 4N77A 2V4QA 1XTZA 1Y3JA 4MJKA 2EFOA 2XLKA 4DN0A 3VAKA 3K57A 3MPWA 5DG8A 2VBWA 1KOOA 3OR2B 3VQTA 3I55S 2QT7A 2YQ3A 4DG1B 3MZIA 4CNYA 3J7Z5 2W4CA 3ULHA 2C3PA 2IHR1 2LXIA 4PXBA 3DLEB 4XPCA 2C2EA 4NLUA 4F3OA 2VOPA 4B9UA 1WG5A 5J2NA 1ROFA 2E1AA 2R2TA 3M2UB 2JVRA 3A8EA 4ZPBA 2RRAA 1NHUA 2EVZA 3MHYA 3N5BA 1U26A 4OJGA 4OHWA 2POKA 1MMNA 4I56A 2VG5A 3NCQA 4M5DB 3UE2A 4LQ3A 2P6SA 3DDKA 2DGUA 3OLBA 4DJBA 3BDPA 4B9NA 1S1UA 2E5IA 4B3OB 1C4AA 4DQQA 2AGQA 1M90T 3ENQA 1TZ0A 1HNIA 5FIIA 3QO9B 5F41A 4EYIB 1S97A 1NK9A 2HHVA 3D1HA 4O44A 4UQGA 4WK3A 4ED5A 4OHYA 1HMVB 2X51A 3VTIA 2PMZD 3F73A 5IFMA 3AAWB 2LEPA 5HO4A 4B9VA 4QR2A 2CQPA 2Q1LA 1EP4A 2HPUA 3IWXA 1HWUA 4NLVA 1HBMA 3J7YU 4J9RA 3GSDA 3CUNA 3MUMP 4EWTA 4FZVA 2FVRA 2G9OA 3MM9B 4BCAA 1YJTA 4K4VA 2CVIA 5LMUF 2ZOFA 1TL1A 1T05B 3LGMA 1UMJA 4PRFA 3RZAA 2XMKA 2PSZA 1Q82T 4KO0A 4CT9A 4ERDA 2WAQD 3SV3A 1XNQF 3NCRA 4WFZA 4ES3A 1UP1A 2CYYA 1C0UB 3TUZC 3PR4A 1BY9A 4I1TA 2LU2A 1VQLS 3OFGA 2VC1A 1GTEA 1C0TB 4O3NA 1RYRA 5HP1B 2VL1A 2LLZA 3LPYA 3DC2A 4MKBA 1S9EA 2BM1A 5L9XA 1U1LA 3EPIA 3IG1A 2E7XA 1TQLA 2HS0A 2M4MA 1IQZA 1T94A 1Q8LA 4YR0A 2BABA 3D0HE 1S1WA 1RTIB 4O23A 2ZM6F 3OLAA 1ELOA 6FD1A 3QYYA 1KNZA 3IO1A 3HF5A 5KFAA 2J7KA 4IFYA 1SC6A 2Z4PA 3BSAA 3DLLQ 2ASYA 2FPHX 3M1VB 3G8TA 3J7YI 5KG4A 3VCDA 2XG8A 3HPOA 2X1GA 4PUOA 3DYAB 5B0AA 3Q8QB 5HROB 3KMSA 4NZ7A 3ITHB 2HIQA 1DLOA 1S6QB 5GAEU 2NR0A 2ILZA 2YKPA 1DQAA 1FDAA 3R5DA 5KT4A 5B0BA 3OL7A 1XR6A 4FXVA 1FDDA 3OL8A 2MZSA 4KC5A 3M4XA 3H5SA 1LK7A 2AGOA 4U67Q 2V9KA 3NNAA 2KJWA 2KM8B 3UR0A 1OSCA 2O66A 1FD2A 5D4OA 2MKIA 4XPEA 4YMEA 1SBRA 2PN6A 3PNIA 3V4IA 2FLOA 3MEEA 4IFVA 3IN5A 2W9CA 1QAIA 3CEDA 1H0HB 2HS3A 2LMIA 3DM2A 3X3UA 2BXJA 2F8HA 4BHQA 4R25A 4DSKA 4HHJA 5DDPC 2WSEC 1IQTA 4F4ZA 2RS8A 3R1LA 1K0TA 3T6JA 4F25A 2YNIA 3Q0AA 4QOTA 4P7VA 2KKHA 3MMJA 2FVQA 4RLEA 3MMBB 2V8DA 2W4PA 5GAEI 5HQ8A 3LF0A 3CT9A 2FJEB 5AXNA 3ZZ0A 1VQPS 1X4GA 1X5SA 4KRWA 3VAGA 1VK8A 3SV4A 2ZZNA 2LA6A 5A8RB 2A2DA 4CH7A 3G9CA 1ZPWX 3I4PA 5CA5A 1Z4UA 3THTA 3IRXA 4H4MA 1M5PC 4WFNQ 4DV1F 2GQQA 3MCSA 1HR0F 2KG1A 1FK9A 4ZOSA 3T1YF 1QJHA 5KOXA 3DXBA 3KWMA 2GGPB 3L7OA 2BDPA 5MLCV 3IBWA 3MM5B 3ZFVA 3CCLS 1TKZA 1TVRB 4KBIA 4NLXA 2ZH1A 2B9YA 3DOLB 4PR6A 4DQRA 2BVZA 2XSJA 4A8OA 2NREA 3MMCB 2EKYA 1HI1A 1W2IA 4KIAA 3QPIA 4DFKA 1FKOA 1JLCB 3TP2A 3D0IE 4DL7A 2E5GA 4X4NA 2DHSA 4EO8A 4HT5A 4B3MF 1TFWA 2RU9A 3JSMA 4KHPF 1A9NB 3AQOA 2DH8A 4DN9A 4FPRA 2MZRA 1O0PA 3CGIA 3H2LA 4MK8A 5EX3A 3PX4A 3QGPA 5DETA 1LV5A 2C2RA 1FO1A 3EX7B 2G4BA 2B9WA 1ZAWA 1FTCA 2B6AB 1HWKA 4IQMA 3ZZOA 1IKXA 2EWHA 1Y5LB 4QWEA 1P27B 2FTRA 4N8OA 1WG1A 3SCJE 2UVWA 4M1KA 2BV3A 4KHRA 3CSKA 3J81Y 2OSRA 4I2PA 3OVBA 4CO3A 1X0FA 2XLJA 3PY8A 2WSCC 2OKQA 3N79A 4Z37A 4QJVA 1R0AA 2IM3A 2CPJA 4ELTA 5CD4H 2QFJA 1CPZA 2DNQA 4FXWA 3HLUA 2ABYA 2A2CA 3DCAA 1VI7A 3V6HA 2XNRA 1GX5A 4PXDA 3EXCX 2AYEA 2K3KA 5KG1A 2R7XA 2CPEA 2PE8A 3TAMB 2MQLA 3TVYA 3J80Y 3C6UA 2VA2A 1LFPA 1TV6A 1UL3A 3DXSX 4I69A 1HPZB 4I4BA 4DV7F 1YRUA 5B7WA 3K2YA 1NEEA 1R89A 3UD3P 2K7JA 4C8NA 4QW8A 1RYSA 2ROGA 5K5MA 3L95X 3G96A 3CDUA 1MU2B 2HZCA 4MIAA 4DV2F 1HNVA 5KOWA 3V6DB 3B82A 2M8HA 3FEYB 3I82A 3OR1A 2XMMA 3IR6B 2FHOB 5BYRA 2FD2A 4LF9F 4YR2A 2XS2A 3T19A 4FF4A 2GMHA 3PW0A 4KGMA 2CQCA 5CCLA 2DPJA 4RKUC 4USHA 1FXLA 2HAIA 3I4HX 4WZQA 1IKWA 4ED8A 4LIWA 1YGYA 4J9NA 2O67A 1YWXA 3HK2A 2DIVA 1Y4ZB 3ZZZA 2MQOA 1S0OA 5F0UA 1B0PA 3PEJA 4Y0FA 5HI7A 5A0YB 1O51A 2W24A 4U6PA 4Y2IA 2JH3A 1PO6A 4NMLA 1VRUA 4WCEQ 4I6WA 4Q7AA 3T5HA 2CQDA 1H98A 2XS7A 2E9RX 4C3KA 2DK2A 2C3OA 2VD3A 3TR5A 2WB4A 3E01B 1U1NA 5I3UB 4E98A 5JVGQ 4KQZA 5T7LB 3MOJB 4JYAF 2DGSA 3K5MA 5JJBA 1WF1A 1KR4A 1FNMA 1RT3A 1PC4A 4K4ZA 5U47A 1X4FA 2M5YA 2VFSA 2N3OA 2MQPA 1ZAXA 5E3RA 3MPVA 1H2VZ 4H4KC 2ZDPA 4H54A 1URRA 1ZETA 4DR5F 3R27A 4OIXA 4AL7A 1DTTB 2B4PA 5C24B 2J9DA 4N47A 1HQEA 4DL2A 1VMBA 4ED2A 4NCGA 3CCRS 4DR1F 1SH3A 2KRBA 3V2UC 2YH0A 1S1VA 2XMJA 4C11B 4IKAA 1HYSA 2HFZA 4FVMA 2J6SA 3CCVS 3CD0A 4RW6B 2ALZA 4DUYF 1QSLA 2OMOA 2VONA 2KXHA 4F3QA 2HHQA 5DGBA 4B9TA 2YNGB 2XY5A 4BC9A 4P2SA 3MDFA 2XWXA 4K5SA 2HVZA 3GR1A 3H2UB 3P6YC 2KN4A 5M2PA 4Q0BB 5J2MB 1Y00A 4RNMA 3T6BA 3UDLA 3DI6B 2F1FA 3KK1B 4PQUA 1MROA 4ZP9A 3PW2A 2JL9A 2F9DA 2L3MA 2HNDB 1WHYA 5KT3A 1KTVA 1OPZA 4WTYA 2BW2A 4F3MA 5CYMA 2WONA 2RJZA 1KQFB 3NCPA 5E3CA 4QIEA 4ECVA 2CJBA 1N52B 2HVHA 5C42B 4IRDA 1GH8A 2OPQA 1WACA 3HHLB 5JVHQ 5BYQA 4EBEA 3OHAA 5J2QA 2I9SA 4LSLA 1UWBB 2R7UA 1LW0B 1S99A 1CC8A 1XERA 2FVCA 3BDEA 4KHMA 3MFHA 3GV8B 5F8NA 3V4MA 2AJ1A 2BUNA 2H5EA 2CVEA 5A6WA 2CPDA 1FXDA 1YJVA 3DRRA 2CZVC 2ZH7A 1KQSR 1HHTP 3T3FA 2IVMA 2MMYA 3I0SB 3G6XA 3DLHA 3N9UC 4JI3F 3GIMA 4UY85 4R5PB 1FESA 2R4FA 1K1SA 4JV1A 4B9SA 2ZOGA 4UQTA 3RTVA 4NRTA 4YEAA 1WEYA 1D8YA 3K8VA 2RKIB 3PIPQ 3PXGa 4AQYF 1RT5B 1UA0A 3LAKA 4NA3A 3IGVA 4X4TA 2J9CA 2UVUA 4HL9A 2BANA 3PJWA 2MSTA 3MUVP 2JC0A 4N8NA 5L8RC 3DMJB 5IT0A 1S9GA 3DRSB 4FF2A 2CQIA 4G3IA 1OQ6A 3TUJC 1JLEA 1IKVA 2CPFA 1OO0B 2FVPA 3OFEA 1HARA 2AGPA 1X0PA 4YQWA 2ZH9A 5B09A 2YNHA 2Z2LA 2HRUA 2YKQA 3OUYB 3S1TA 3G4SS 3KLGB 2Q43A 2YNFB 3OTCA 2MKCA 2VG6A 1F60B 3US5A 4DSLA 2QLXA 1QM9A 3PW5A 1NKEA 2DT9A 3MEGB 2YKNA 2DRAA 1NJZA 2ZZMA 2MHNA 2EFQA 3UPFA 4LF4F 2D74B 1UFLA 1X9MA 1DJ0A 5G4DA 4ZLPA 3GFYA 5CXTA 2O1PA 1RISA 3GFZA 2BRLA 3DLKB 4NA1A 4CO5A 1VQSA 2PMHA 2JLFA 3GB0A 3IA0A 2FC9A 1DQ9A 2CQ2A 1Q86T 2BACA 1RGVA 3VAMA 2XI2A 4NLTA 3K59A 5DM7Q 3OL9A 1UJ4A 2GNKA 4V19X 3VWSA 1SV5B 2LECA 4RW7B 1N0VC 2OO4A 4F4YA 3OR2A 4NX9A 4Q8EA 2HHWA 5CH7B 1JLAB 3POTB 4CO4A 4DG1A 3PVXA 2DR9A 3I6PA 5EGYA 1VS3A 4RBTA 3TVZA 2EW9A 4PG4A 3DLEA 4XK8C 1S77D 2QMXA 3MM8B 1J5OB 3CCSS 3TX8A 3NMAA 4BDPA 2JFDA 1S10A 2LXUA 5AJ3F 3M2UA 2W4DA 4NLSA 3UD4P 2X1FA 3O2IA 2RMLA 3JAMY 3KLVA 1U6ZA 1Y5IB 4ILRA 3RW7A 5IWAF 2VPZB 4CT8A 1YG0A 3OTOF 2ZUGA 4FF3A 4UY8T 4IUFA 5EWFA 3K58A 2R7RA 1NZAA 1GT8A 4M5DA 1IXKA 2PC6A 1C2PA 1KN6A 2E1MC 2ZE2B 2EFPA 2BQUA 4B3OA 5JUMA 3OL6A 1Q8IA 4JI5F 3BN7A 1H3DA 2APOA 2GO9A 2RRBA 4QYRA 1KRPA 1RWUA 1HD1A 1HMVA 1M5KC 2AJ0A 3K5LA 2FJAB 4ELUA 3H4DA 4ZPAA 2DH7A 3BZQA 5LSLA 2JEIA 2R2UA 2DTJA 3N6LA 5D4PA 3JTNA 4TN2A 4CI0B 3AQPA 3M2RB 4GMKA 1CQMA 4OJ1A 4DSFA 4RUAA 2HWTA 3IFEA 4EBDA 4RW9B 4XDCA 3P96A 1TL3B 3KYLA 2NZ4A 1LW2B 1T05A 1DAXA 2V5HG 5LXYA 3W2VB 2DNLA 4ZDNA 3TNVA 4C7QA 2HNZB 3U7JA 3SXLA 4A4JA 3RBDA 2ZITA 4W90B 2MKSA 3I87A 3B8HA 3SCLE 2ERRA 3O1LA 4O4RA 1C0UA 5HBMA 5F9LA 1AROP 4IOCQ 5I3PA 2CJQA 5D4LA 5DM6Q 3VAIA 1C0TA 4IO9Q 3RB4A 2BRKA 1BQMB 3NNHA 4UUWA 2DRBA 4NA2A 4DLEA 2J5AA 3WC2A 3DOKB 2DH9A 2BQ3A 3UI3A 4O0IA 4DQIA 1RTIA 1R27B 1Y5NB 2E29A 4N41A 5E3QA 3B4MA 3LP1B 4DV0F 4ZCLA 2IJNA 4UUXA 4ZCMA 4IR9A 2RQKA 2ZH2A 1V6HA 5T41A 3NL0A 3M1VA 2WK4A 1X5TA 1ZZFA 3DYAA 1X4DA 4WIIA 4KB7A 4J9LA 5HROA 3SQGB 5D3GA 2J9DE 2R7TA 2YVSA 3ITHA 5BR8F 1N5QA 1S6QA 2L08A 1Q53A 4X4OA 4OZLA 1ZOTA 1J2VA 1TFYA 4PG6A 2EG1A 3KLEB 5K8NA 3SSRA